6FD1A

7-fe ferredoxin from azotobacter vinelandii low temperature, 1.35 a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7-FE FERREDOXIN I (FD1)
publication title Structure of Azotobacter vinelandii 7Fe ferredoxin at 1.35 A resolution and determination of the [Fe-S] bonds with 0.01 A accuracy.
pubmed doi rcsb
molecule tags Electron transport
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1997-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 6fd1A00
3IR7B 4XK8C 2VPWB 5CH7B 1B0TA 1BQXA 1D3WA 1HFEL 2C3UA 1IQZA 2WB1D 1GTHA 2C3YA 1FXDA 2GMHA 1A6LA 2ZVSA 4OMFG 2PDAA 1KQFB 1FEHA 3MM5B 1CLFA 3MMCA 1BC6A 2FJDB 1JNRB 3MM8A 4KT0C 2UZAA 3PNIA 2C3PA 1FDDA 2WSEC 1H98A 1F5CA 1GTEA 2Z8QA 3OR2A 3MMAA 2O01C 4XDDA 5L8RC 2C42A 1FRIA 1FD2A 2C3MA 1PC4A 1FRKA 5BYRA 2WSCC 1DFDA 2VKRA 7FD1A 1Q16B 1RGVA 4XDCA 1FERA 1FF2A 1FRJA 3MMBA 1GT8A 2XSJB 1SJ1A 3MM9B 1BWEA 1XERA 5FD1A 2V4JB 1R27B 2VPYB 1JB0C 4DHVA 1DAXA 2Y0SD 1AXQA 2PA8D 1FTCA 3MM7A 1FRXA 1GAOA 3EGWB 3LW5C 2FGOA 3OR1A 1KEKA 2FDNA 2VPZB 2PMZD 1G3OA 1H0HB 2VPXB 1JNZB 3MMCB 1FDBA 1PC5A 3EUNA 3MM8B 4ID8A 2C3OA 1F5BA 1Y5NB 3C8YA 1DURA 3OR2B 2V2KA 2FJAB 2V4JA 3MMAB 3MM5A 3MM6B 1C4CA 5CHCB 1SIWB 2GMJA 1FRHA 1BLUA 1VJWA 6FD1A 1KQGB 1G6BA 1SIZA 4YDDB 2IVFB 3GYXB 1H7WA 1K0TA 1Y5IB 1WTFA 6FDRA 3MMBB 2FJEB 4AYBD 1IR0A 3IR6B 4CI0B 5BYSA 1ROFA 2WSFC 1B0PA 1FRLA 1Y5LB 1C4AA 2XSJA 1B0VA 3IR5B 3MM9A 1F2GA 1FXRA 1Y4ZB 4OV1A 3MM7B 1BD6A 1FRMA 1H7XA 1FCAA 4RKUC 2FJBB 1FDAA 3MM6A 7FDRA 2WAQD 5BYQA 4L6V3 1FDNA 3HKZD 3OR1B 3EXYA 4Y28C 2FD2A 5E7OB
chains in the Genus database with same CATH superfamily
4F8RA 2M9KA 4CLLA 2X3DA 3OTEA 3N6NA 4IFYB 3DI6B 2XNRA 2HNZB 2YX7A 3DKDA 3N6LA 4JP8A 2YQ1A 4UF4A 1OPIA 2BE2A 3E3XA 2Q79A 4OYOA 1WEXA 4M95A 4C11A 3SV3A 5J2MB 1ICEB 4FYWB 1QM9A 4P71A 1RWVB 2AIRB 5M2RA 2BJ8A 4K4VA 3W64A 4QU7A 3TO8A 3IWNC 3OR1A 2FZKB 4USWA 5K9FA 4WYWA 3R2DJ 3KLEB 5KFQA 3VVTA 2ROGA 4N56A 2MZRA 2VUGA 2CQIA 4KHMA 1NJXA 3GMGA 2XM3A 4C4WA 4KH0B 4RBUA 2HMIB 1ZPWX 2OEJA 4NMXA 1IR2A 4N5SA 4K4ZA 3AA9A 3W2WA 3D6MB 2RQKA 4RW7A 1CPZA 3MR2A 1Q95G 1V6HA 4DL6A 4DX8H 3QATA 5IOLA 2W9CA 2UVWA 3CC4S 4DV3F 4J7CA 2MGZB 4H4MA 2Y1JA 2EFVA 1U0SA 3DXBA 1XNQJ 2FC8A 3EZ5A 5CYMA 3R5DA 1DQ8A 5KFOA 2KHCA 3V81A 5CAAA 2HRTA 3HM9A 2CG8A 4JI0J 2ADBA 2AZ3A 1TV6A 2ACYA 5IC6B 2C3PA 2MQPA 3OR2A 1U2CA 2EXUA 1TK5A 3R7NB 1HNZJ 4U8VA 5H9EJ 3NWGA 4ES2A 2WBRA 1VLOA 2ILYA 1F9EB 2R7WA 3U27A 3MEEA 1HW9A 1E6VA 3MFHA 4K0KJ 4AL6A 2CA9A 3Q8QB 3T1YJ 3H4DA 3K0JA 4LR9A 4NZ7A 5DDQC 4IRDA 1QSSA 2BANA 1PC5A 2CQ0A 1Y5NB 3C8YA 2IDLA 2E7WA 1LNQA 3CJRA 1FRHA 3I32A 3TZZA 1M1KT 4PKDB 1WF1A 5DO2A 5L1JA 3D6TB 4P7VA 4UUWA 1UPPA 2CJ9A 1X4AA 1ZOTA 1DBDA 4UOHA 1LWCA 2IAJA 1RABB 4WK1A 5HROB 4EWTA 2LEAA 3H5SA 2K8GA 2J7KA 3C2PA 1NH7A 2ZZMA 3POTB 1PYSB 3K5NA 1DTTA 2BBEA 3OL9A 3ZXWA 2KZMA 3LA0A 4B08A 3D6FB 1P9YA 1KP6A 2WW8A 4L72B 3C6UA 5C24A 5J2NB 2RT3A 1CG2A 4F04B 4LF5F 3PM9A 2VFVA 4O4GB 1LW0A 3BQ1A 3JSRA 2W7AA 5F8JA 1HD1A 2BACA 4LFBJ 2OSQA 4FYDA 4PXBA 1F6TA 2AGPA 2YNFA 2IRYA 1DZ5A 2UP1A 4OHVA 2DCUB 2CQGA 1RHRB 4RBTA 2WVFA 3X3UA 2H51B 1PILA 3LP0B 2MQLA 1HNXF 3AAWB 1KD1T 4DR7J 2YWWA 4LBPA 1CJVA 1FWPA 1S5ZA 2QIFA 4UW2A 5D3GA 3KJVA 2FYXA 3W5YA 4M5DA 2XMAA 3H2LA 3BGOP 1MROA 2U2FA 2MLZA 1L3KA 2AEMA 2Q6CA 4NLWA 2ROEA 4EO8A 1QVFR 3H0PA 1RWUA 2CJYB 2B4PA 4NWBA 5J2PA 4EMDA 1TK8A 4DPUA 3KK2B 2V9KA 1QAXA 4M5JA 1S6PA 1N88A 2YQ3A 3HULA 4ED2A 3AT1B 3TAPA 5F8LA 3EICA 5IC4B 1X4BA 2RMLA 1FF2A 2CQ1A 3CD5A 1Q86T 3MR3A 3H7HB 3DDNA 4N47A 3FMBA 3NGRA 3Q89A 1R8HA 1SL2A 4CO4A 3TQ1A 2HW3A 5GADU 1YJVA 4DFPA 1S1WA 2XYGB 4ALZA 2EFQA 2DNQA 2FTRA 1AZSB 4NCBA 2D3UA 3GQCA 3OLAA 1SKRA 3BV8A 1BUXA 2DO0A 4HDGA 3GR0A 4K8RA 4ID5A 4JI5F 2OP5A 5AE1A 3M6WA 4R8UB 1FNOA 3IR5B 4C0HA 4X65J 1BQNA 2ZZNA 3VZHA 1H7XA 4ZPVR 1IWGA 2IA6A 4CO5A 2N4DA 4PWWA 2ROPA 4O23A 2YNHA 1IKWB 3M2RB 4YOEA 4QWEA 2F63A 2OPPB 1F1BB 1T03B 1S0NA 4J9KA 1F5CA 3DLGB 3V4IB 2DGQA 3CW2C 4ZIVA 3KJNB 3E8OA 1N5QA 1HHTP 3DGVA 3KUEA 1FRJA 5ETRA 2H54B 2DNLA 3M8PA 4RPFA 4JV5J 2D9OA 1XBWA 4IG3B 2JEGA 2HNYA 3Q83A 1U1PA 4CLWA 4QU6A 4QJVA 2FLLA 2HYIB 1X0FA 3BEGB 1CJUB 2M8DB 1A7GE 4DSJA 5KFUA 2GQ2A 3TP2A 3MMBB 3OFEA 1NBEB 2DIUA 3BREA 5H1SV 2FQQB 1NK0A 2WOMB 1PSDA 3KOAA 1HQUA 4EBDA 3G2XA 3KLVA 5LMUJ 4Q2MA 2UUAJ 3ISNC 3OTBA 5IXUA 4CT9A 1ULRA 3MM5B 5K14A 2BM0A 1SJ3P 5DETA 1U1MA 2A6OA 2R2TA 4DFKA 3ZNJ1 3IAS9 1TVRB 2GVZA 1LWEA 4DR3J 2L9WA 3ZZYA 4X62F 4JV2A 3DM2B 1FI4A 3FC9A 1CJKA 2QA1A 2QLWA 3Q86A 2XZTB 3CDBA 4LVOP 1S9FA 2GQQA 5DZ7A 2B5JB 4FXWA 3GIRA 1I5OB 2P9CA 4FF4A 4NLQA 2VZ9A 4X4TA 3OVBA 2GHVC 1T11A 3MR6A 2NLWA 1RYRA 1X60A 4CLZA 3CUNA 2MTLA 3HZEA 2F7VA 1DARA 2YTCA 4W4MA 4AL5A 4LSNB 3RBXA 4XPEA 3OQ2A 4P2MA 3WX4A 2RU3A 3RRKA 4DX6A 2YH0A 1NM2A 2XLJA 3DLHA 1KHVA 3RU0A 1WWHA 5KFAA 3JAMU 2DHGA 2LA6A 2E1RA 5GMEA 2HAIA 1VC5A 4NLRA 2UUCJ 3KK3B 2HGNA 2PIIA 2P2CB 3PDNA 3EGVA 3QO9B 5KFBA 4YHHJ 1LWFA 4JI7J 2PEHA 2LQBA 3VQSA 1BC6A 3PX4A 3QWPA 3LAMA 2DT9A 4URQU 3HLUA 1M5KC 1L3TA 2AV5A 8ATCB 3CEDA 6AT1B 4BBYA 3MM9B 1BQMA 2MZQA 4DCPB 1JLCA 1R27B 3T1HF 3HX9A 2WZ1A 3D0GE 4X4RA 2FGOA 2DXFA 3G82B 5EDWA 1LOUA 1Y9OA 4FNHA 1U1QA 3HFVA 2ZH9A 1IQTA 3T19A 1WG1A 3D7SB 4YR3A 3GYXB 3MD3A 4NXMF 1REVA 2J9DE 2HHHF 2HBRB 5A76A 4B3TJ 2ZM6F 5KFWA 2DGOA 3JSMA 4FKYA 2F40A 3BKFA 3MPUB 2FUG9 4CDIA 3VR1A 3IR7B 3ENAA 1K47A 3LP1B 5B0BA 2MXYA 2EBEA 1AFIA 4CLKA 4ATNA 1SH2A 1VBZA 4OYMA 1NHKL 3LALA 1EQ0A 5HP1B 5D15A 5GVQA 1S6OA 3OSNA 1AT1B 4ELUA 3IM8A 3TVYA 1YJ9S 4GVLA 2XMVA 1X4EA 2GGPA 1AUDA 3KK1A 2W7OA 2EFPA 3W2VB 4YEAA 2IIHA 2DISA 1U25A 5EHHA 4DR5F 3DLBA 4K5SA 4LF2A 2QEXS 1HNVB 1GEHA 1PJ6A 3VHQA 3CCRS 1KSPA 2XSJA 1N54B 5DG9A 4IR1A 2FJBB 1GXUA 4OX7A 4USMA 3PFEA 1KR4A 1KS2A 3A1YG 5IFMA 4C3LA 2ZH1A 2QL5B 2MKSA 2MQMA 2ZBIA 1HI0P 2VG7A 3PEJA 4RL1A 3J81j 1FE0A 2LECA 2RQ4A 1FJ7A 1UVLA 3PYFA 1FJGJ 1UFWA 2FJDB 4LF7F 2BJ9A 4RLEA 3SSRA 1VOMA 4B02A 5HJXA 4YQWA 1HHQA 1RT7A 3PJXA 1VRTB 4Y34A 2KU7A 4Y2MA 3RR8A 3MCNA 3JB9k 2MHNA 2QZ8A 2DR7A 4CO1A 3MEDB 4BHQA 2C2MB 2R8HA 2KHDA 3NOCA 2FHMA 1SC3B 2OTLS 1VK3A 1GK8A 4UOCA 2AHOB 2J76E 2MHEA 3WC0A 5CD4H 1IN0A 4Y3CA 2BYCA 3Q0AA 1RTJA 4NXNF 2NQPA 3DRXA 5ETLA 5HN0A 4AD6A 3PJ9A 4CM0A 3D28A 2VF3A 5M2PA 5D77A 2YKOA 3BBCA 2N82B 1KLMA 4V19J 3QGGA 4XK8C 5ETOA 2Y8WA 3QSIA 3Q8YA 3E01B 2M4MA 4ELVA 3J7Z5 3EDQB 5IWAJ 3V5RA 1R31A 1TKXA 2YKNA 1XTZA 4A48A 3NLCA 2XHCA 1HW8A 4PEOA 1WOSA 5E3CA 4Q8EA 3SQOP 3U02A 1WC0A 3A3NB 3EGNA 3QJLA 3PEHA 3FCWA 4OQJA 1J27A 4DSFA 5KTQA 3LPYA 1Q7YT 1SIZA 3NS5A 4CLSA 2HHXA 3ZZUA 2FB0A 3GJQB 1FXRA 1BD6A 3IMQJ 1FDAA 5CXTA 2PSZA 3SQGB 3FBCA 1Q8LA 4QOTA 1U4BA 4F3QA 4PPZA 1XK8A 2J6SA 2O66A 2NPFA 3DRYA 2CRLA 1X8DA 4WCEQ 4RUAA 2DNPA 1D1UA 4F50A 4B9NA 1AUSL 1KRPA 1J5EF 1G2EA 1I94J 3QAEA 1QAJA 3UPFA 3IBFB 3CCMS 2AEJA 1S99A 1SJ1A 4EGLA 1VYAA 1QE1A 4OZNA 1U1LA 2GW8A 2XZWA 4CLFA 2FLNA 1TL4A 1CC8A 1N56A 3MEGA 4WP8A 1WHXA 2HS0A 1Q53A 3ILIA 2VQFF 3Q23A 2VONA 1U1RA 3CE8A 4CTAB 2Q6BA 4XTTA 2XI2A 1S9GA 2VOOA 1M0SA 2OD6A 2PO4A 1R0BG 3J80Y 2LQ8A 4NE9C 3E51A 5HJYA 3CB4A 2B7CB 1CJTB 4MT1A 3L3CA 1JLAB 2K7KA 4UZCA 1B0TA 5E5NA 3PIOQ 4HACA 1U6BA 4Q8FA 3IXQA 5B0FA 3P8BB 1KQFB 2ZH7A 2DPIA 4PUOB 4DX7A 2RVJA 4M5HA 4ZS6A 1Y3KA 4TY9A 4LF8J 1VBYA 1T9WA 2HGLA 1S1XB 4RJVA 1S10A 3R5JB 2ZE2B 4QIEA 3FFIA 2AQ4A 2YWEA 1VHFA 2Z2MA 1K0VA 3EGWB 2CJBA 2D1CA 3TEGA 4JI6F 1T7PA 3V6HA 2Z0GA 1K73T 4B17A 4IYQA 4USJC 4DV1J 4PYAA 4CO0A 1F5BA 1EZZB 1DURA 4ZN3A 2XGQA 2A18A 5M2UA 1XNRF 4DCJB 4ECXA 4C2MA 2CZ4A 2HVIA 1CULA 1RWNB 1TL7A 3NAHA 3KLIB 4CP5A 4OZ2A 2XHWA 2FHJA 2KH9A 1BE4A 2N3LA 2XY6A 4ANCA 1NSQA 2JEJA 2C2OB 4RR5A 5D6GA 3GV7B 3ETOA 1F9HA 3LGMA 1HBNA 1S1UA 3PO4A 1RKIA 4MK7A 2J7WA 3US5A 4I7FA 2LMIA 1CVJA 4LMZA 1VLYA 1Y3JA 5KT5A 3MTJA 3GONA 3MUMP 2RDIA 4TLQA 1FJEB 3TZXA 3WHIA 1MMDA 2HQ3A 4N77A 1H0HB 4LSZB 5F9NA 1FNXH 5DLGA 2VL1A 2JSXA 2F9JA 2F8MA 4Y2AA 2HG4A 1QLNA 3QZ8A 3UFCX 1OSCA 3C16B 4USVA 4LRAA 3HO1A 1Y4ZB 1WG4A 2APOA 2XSFA 4DV0F 4AFFA 4C8ZA 3I4PA 3PTWA 3BH7B 2GMHA 3OTDA 2H5JB 1SL1A 3RB3A 3L7PA 2V8GA 2C1EB 2XGPA 3IFEA 3N5FA 3UN3A 3P3DA 3I5BA 4IG0B 2C2RA 3CIZA 2R7SA 2R7VA 1WC1A 2DKOB 1RTZA 3J7YI 1UVJA 5FIIA 1RWWB 1S0OA 1HWJA 4DUTA 1D9FA 1RACB 2DGSA 8AT1B 3IG1B 3LGNA 1MN7A 5EX3A 4ZVPB 3TAMA 3UR0A 5KG6A 3UI3A 2IVMA 3QT8A 1Z2LA 4HVZA 3AQPA 2D3O1 1FRLA 3ITHB 1U2RA 2YX1A 1HNIB 3MM7B 2KVIA 1IUJA 3CSKA 4DL4A 3LP2A 1N34J 3AOCA 4B9TA 5BXIA 4LIWA 5CH7B 4Y65A 2I6WA 3B82A 2WSEC 4LF1A 1N5VA 3M6VA 4CZCA 1RHUB 1YDLA 3D0IE 3B4DA 3P96A 3VAFA 2BJEA 3M2VB 4J9PA 2DNMA 2DBBA 3KLFB 4M5MA 4HHHA 4L3KA 4HT5A 1VIOA 1NNDA 1TL5A 2VPXB 4YUDA 5KFVA 2KT3A 3J81U 4FNIA 3ET6A 2DRAA 3KNGA 2MKCA 4Q2LA 3Q22A 3RRGA 3D0HE 1LK7A 5B7WA 1WDTA 2NS1B 2XWYA 1UMJA 2GJIA 4C3MA 1S4FA 5CCMA 5E33A 4JI8J 1ZETA 3UDLA 1UPMB 3DOMA 2Y1IA 5HVHA 2RH3A 2POKA 1R8CA 2E1PA 5LSOA 3O6QA 1Q82T 4DV2F 4ECRA 1AW0A 1CBKA 2KG0A 2OMOA 2RF2A 2IFXA 4S0MA 2OMLA 4CH7A 5E2QA 1D9DA 1JKHB 3KLGB 5F8IA 1RTDA 4C8YA 1S6QB 4OI2A 3MCMA 2JC0A 1S57A 4FS1A 4ECQA 2CVEA 4ZN1A 1XMOF 1RJJA 2VQEJ 3T1AA 2YWKA 1UVNA 2FJAB 2DITA 2MLXA 1C4CA 2C2DA 2AW0A 4ZPCA 2E5GA 4DV6J 3CCZA 5JMNA 3MCSA 4F4KA 1RBOB 1Y5LB 3R7BB 1YTYA 4WTYA 3QLHB 3QBCA 2GQCA 2L08A 4USUA 2JEIA 4ED8A 1VBKA 2UVVA 3O1LA 5ETQA 4ZPTR 1OQ6A 2QX0A 3NBPA 2DNKA 4IH5A 2UXDF 5FJ4A 2MDAA 3I0RA 2UV8A 3SIPB 2MKIA 2CQ3A 1FRKA 2G1HA 2AX0A 3S1TA 3DMJB 3DGPA 4TLRA 3I0SA 4YB6A 4F0HA 4CO3A 1C1CB 3NL0A 1PYTA 5KT2A 3LANA 2WBMA 1M5PC 4X66J 3QRRA 4X4NA 4LF6J 2VFUA 3G6XA 3CO0P 1MU2B 3ULHA 2C3OA 5KFCA 3OJSA 2VHGA 1OO0B 5KFHA 3G4SS 3E2EA 2IY5B 5CHCB 5L1KA 1NK7A 1W26A 2N4CA 2H48B 4JI2F 2FJEB 3LGHA 3KDNA 5A6WA 3IGVA 4RW6B 1S76D 2D7SA 3I5AA 4ECVA 1B3TA 4YB5A 1HMVB 3PO5A 4A8MP 1YHQS 4GVBA 2VPWB 1VC6A 1SKSA 1UETA 3M1VB 1APSA 3OBIA 3TRGA 3NKYA 1XC9A 3HHLB 1RWOB 2AJ4A 4RBVA 1IVZA 2V6AA 3ZTQA 3I5CA 1FFGB 5J2QA 2VKRA 1FO1A 3PR5B 1VRUB 1KHWA 3TR5A 2AF6A 3SFGA 1X5OA 2NYIA 3FCVA 4FKXA 4I1TA 1NB2A 2NXUA 1XMQJ 1FTCA 2NREA 2A0FB 2AKWB 4TQSA 3BGRB 4IDKA 4RU2A 2VG5A 1IJEB 5KFYA 3F73A 2DNYA 5D4LA 3GPAA 4FYXB 1RWMB 4ZA1A 4K4UA 3EUNA 1B70B 3IRWP 2YKMA 5A2QY 3FUYA 1QUVA 3R2CJ 1KOOA 2DRDA 3HVRA 2KKHA 3R97A 1MWZA 2GNKA 1YZ7A 3BGLA 3HVAA 1TKZB 5D0EA 3TVZA 5KT3A 2EVZA 2GIQA 2W4DA 4MIWA 2J0QD 1FD8A 2V8PA 4B9UA 3O3LA 3GR1A 3VV2B 2BXJA 4CH0S 3H40A 3NS6A 4I2QB 3VQTA 2I2YA 3RB4A 3T5HA 4I6YA 2B7BB 1TMJA 5KG3A 1KQKA 1Q8BA 2WONA 1Y0HA 5E3AA 4GKKF 2ZNZA 5B0GA 4H4OB 1NK6A 2JHEA 2E7VA 3R6GB 1W25A 1GMWA 3AJDA 3K5PA 3A12A 2ABYA 5HVFA 2UUBF 3GJSB 2HHUA 4K2XA 2DIVA 3MMCB 4J9RA 3HHLD 2V2KA 2V8HA 1KQGB 1GX5A 3CD0A 3AJ2A 3GCXP 3B54A 1T9UA 5DG7A 3JQJA 4TYAA 1TTHB 3PXGa 4F26A 1KTQA 1RU1A 3AB4B 2XS7A 3RG6A 7AT1B 3BSOA 4A8YA 3GSIA 2K06A 9ATCB 3HJFA 3EXYA 2HWHA 1CS4A 1IBLF 2E1MC 4RW4B 3HSZA 2XLKA 3UCUP 2OO4A 4URGA 1LK5A 2J0SD 3AJ1A 1RSCA 3S01A 4KT0C 2BKNA 4FPIA 4EO6A 1FDDA 4I2PB 4K2JA 2BMBA 1R8PA 1JLQA 2QL7B 3ISZA 4ETZA 2UXCF 5ITHA 2UVUA 1WSRA 3QNWB 4Y2IA 1XERA 1H2TZ 4FYVB 2ZDOA 4ITSA 2CNOB 1NJIT 2HNDB 3CO9A 2DNRA 1ITPA 5I42A 3HHNB 3QAUA 2MSSA 3DRRB 3CCTA 2H65B 1E6YB 1H3DA 4FBTA 3M2VA 4ZHRA 4BC9A 3PY8A 4DZDA 3Q8RB 3G6YA 1NJZA 3T6BA 1R6YA 3GTYX 3ETMA 3DLLQ 5HMXA 4P2FA 2RJZA 1UEVA 2FJXA 4BCAA 2P5VA 4B3OA 2JDJA 5J1EA 2HIYA 3JSYA 4OX6A 3ZZZA 4ZP9A 2ZH2A 4YDXA 1N0UA 1D09B 2M2BA 1WACA 2KXFA 4PQUA 2GCFA 5A8RA 1HQEA 3BR8A 4YR2A 2HLTA 2VJVA 3GFYA 4ZLJA 5AJ3F 3D3CJ 4DL3A 1FT8A 3NNAA 3PKMA 3MR7A 1C0TB 1YJUA 1N36F 5IM0B 5L39A 3M2UB 8RUCA 4ZJLA 2CJXB 3EZOA 4OX8A 2G2OA 2M8HA 1TUGB 4GO7X 3W1YC 2DNNA 4LIRA 2OJ3A 1HARA 2W4PA 4P75A 3UNYA 4O44B 4LF4F 3J7YU 4OI1A 3WZ0A 4CWBA 1S6QA 1WOOA 3OL7A 4L76A 1RBAA 2O67A 2F65A 3OW2R 2OSRA 3PW4A 5DDPC 5JJBA 3GB0A 4YB7A 3ZZ0A 4M5IA 1MNEA 4F02A 4WJBA 1P9QC 5BYQA 3OVAA 1UJ6A 2QYCA 5B0CA 4QQBA 2V8DA 1F3VA 1BY9A 2F4VJ 1WHWA 4JI3F 1QVGR 2OPQA 3M05A 2G1DA 4R0EA 1RT4A 4J5OA 3MAAB 4NMLA 2CUYA 4NA1A 5GMKa 1SVDA 3CPWR 2FLPA 4ED1A 3G6VA 4IFVB 1RE1B 2XMKA 1BHNA 2C2EA 3W60A 1DY3A 4JOUA 4LSLA 3O5TB 2GVDA 2HS4A 2X7IA 5GAEU 3T6JA 2GO8A 3VAKA 3MGJA 2DHSA 4PCQA 1RISA 1ZA1B 2CQHA 2QMUB 3N6MA 3PJWA 2KM8C 3TEHB 1URNA 1UZHA 4W92B 1KWMA 2BE2B 4X64J 5AXNA 4CO2A 4IO9Q 1WTFA 2X1BA 4C11B 3ILLA 3EJMA 5IT0A 1JLGA 4FXDA 1VI7A 3MAHA 4IOCQ 3MZIA 4Y00A 5GAGI 4DF4A 5DQHA 2HVEA 4L74A 3WIVA 3OR1B 5IV4A 2ERRA 4DPWA 5LJ5Y 3IWLA 1S6UA 1HR0F 2IM3A 3OVSA 1U6FA 1Z4UA 1IXKA 2IMOA 2AYEA 4MKBA 2FPHX 3IS9A 2YPZA 1KBRA 4DEZA 2ZH8A 4QWDA 1U02A 3W2WB 2VODA 4DX5A 2WSCC 2ZWPA 4RW7B 3DLKA 3W5XA 1KDNA 1FERA 4ZPDA 4C48A 3HXMA 2V67A 2W9CB 2J5AA 2XMJA 2MJUA 1XN9A 4H4MB 3MECA 2QFJA 3A4TA 1N32J 3PCOB 3KWMA 3QJPA 4P2SA 5CYMB 4R0JA 4OYAA 1GFWB 3V81B 1SH0A 3D4JA 1TV6B 4Q45A 5E3PA 3OR2B 4AXJA 4TNOA 2WK4A 3AOBA 1HKAA 2YNIA 3I96A 4ED5A 1IWAA 1RHJB 6FDRA 2F3JA 1ROFA 3BQ0A 1EJ7L 3M8QA 3BBFA 3MEEB 1E6VB 3ZC4A 3C46A 2HRYA 3H59A 2G2YA 1HWLA 2HQFA 2RRBA 2Z4PA 4F4YA 4LFCF 1S4EA 2LKZA 2KZZA 3CDEA 4EEYA 3UCGA 1H98A 1YJNS 1B99A 1RTHB 5KOXA 2DHAA 1DQ9A 5LJ3Y 1X9MA 2HZVA 1KNZA 1LWCB 2IAJB 1UKUA 3K59A 4DFJA 1UVIA 2QT7A 1QAIA 1MW7A 3BGUA 4M63A 4F3OA 1LKZA 1ZPVA 4EZ6A 4PXEA 1DTTB 3RB0A 1U2FA 3N5BA 4NI2A 4MFBA 3FEXB 4AUKA 2RKIB 2DYAA 4C7QA 3C6UB 3NS7B 2P6TA 3TUPA 5C24B 3CTRA 3H98A 2ASJA 3FK4A 1YZ6A 2HWTA 4CT8A 2ZHAA 4MJKA 1LW0B 2H4WB 2FHKA 5DZ6A 3VVUA 4CI0B 5IQQA 1VQLS 1GXLA 1VQPS 1N5YA 4OL8A 2YNFB 2QL9B 1FCAA 3H5YA 5DG8A 3UQSA 3BKUA 4ED0A 1D3WA 1KOHA 3HHEA 1GTHA 3TA1A 3TA0A 1W2BR 1U8SA 4B3RF 4NCGA 4C8NA 1RHKB 3BDPA 1CJVB 3JYTA 2ZVIA 4MKAA 3PYEA 1UW9A 4OJ1A 5D3GB 2FZGB 3L7OA 3KJVB 2CPXA 4M5DB 2ZD1A 4A8WA 5A8KA 1MROB 5EN1A 3WC2A 4RUCA 4FP9A 2RQCA 4DR2F 3W9JA 2CYYA 5LMNJ 4O0NA 5J2PB 2MKKA 1NO8A 3BYPA 1F0XA 2GIFA 4DR6J 3AXMA 1Q79A 2KL8A 4CQ1A 1S6PB 4B3MJ 3AB2B 5HMZA 1N8RT 4F0MA 1IM6A 1IKYA 4P10A 3JTNA 3KDOA 5HBMB 1A9NB 3T9NA 4MMOA 3MWBA 5EUHA 3IBWA 4RNHA 1IBMJ 2Z30B 5KFKA 1ZTWA 3HKZD 3LO3A 3M8ZA 4NYZA 3AA8A 1P8GA 4QPXA 1S1WB 2XMMA 1UZDA 4F7VA 1NK4A 4GKJF 1O51A 4PABA 1RCXB 5DRKA 2H5EA 1PO6A 1ZBTA 4Q5VA 5DDRC 4ID5B 3NG8A 1SUQA 1DRZA 3OXFA 2XG8A 2WVCA 4UOFA 1PAEX 4PR6A 4G1QA 2W24A 5D4PA 1BQNB 3HVWA 4NLGA 1P27B 4DV4F 5FLXY 2HVDA 5BR8J 2XMTA 1T94A 2YNHB 2DO4A 3H20A 1U49A 1YBUA 2A3JA 1V9OA 1CC7A 3HHKA 3KHLA 1YX2A 2V2VA 2M70A 5IT4A 4EYHB 3M8PB 4UTGA 1S0MA 3DU5A 4OV1A 3ENQA 3GIIA 2RHSB 5DM7Q 3JTPA 4DR1F 1FKAF 4WZQA 4PXDA 5ADZA 1QDUB 2HNYB 4IOAQ 4NLOA 3UWTA 4NA3A 2AJQA 3CJKA 1VISA 3DRSA 1JNRB 4FVCA 2P6SA 4LRFA 1H72C 1R6VA 2B56A 1KLNA 1KVKA 3A3PB 1Q16B 2BE9B 2E1AA 1Q0NA 2YBVA 3JQKA 1C0UA 4OHYA 3NMRA 3KJFB 1U09A 3FCHA 2C22A 1HQUB 1LW2A 4F2SA 4IRKA 3H90A 2G4BA 1ZS6A 2R7RA 2YWFA 3C15A 2BJ3A 5K14B 5F3TA 2EG2A 4FXVA 3VWSA 3RBDA 4I6AA 2ZBCA 2HSEB 2GVZB 1LWEB 1Q5YA 1HBOA 1KC8T 5HQLA 1CJKB 1EP4A 2DRBA 1NDPA 1SJFA 3THVA 2CPJA 3CJ0A 1NK8A 3IN5A 4YR0A 1X9SA 1GNKA 3W8PA 4P52A 5AXKA 1RT1A 1S72S 4XPCA 2WB1D 5K8NA 3SBMA 4ZCKA 5HAOA 1FKPA 3M6UA 4WP9A 4B3SJ 3I31A 1R8BA 3EWGA 1VQ7S 4DDFA 1XNQF 1C1BA 4KHPJ 5ETTA 1RUSA 5JVHQ 1RTIA 1M5OC 4JI0F 3BJYA 4KIAA 2JEFA 2J6TA 1SC6A 3H5XA 3BGFA 3CJQA 2QO3A 1HNZF 2BE7D 2W8LA 1LWFB 3CCJS 2E5IA 1F5AA 3CWJA 4ES3A 3R27A 2DXDA 6FD1A 4DZ6A 1F2HA 4OX9J 4LFAJ 3LOUA 1YJTA 4OZ3A 4K0KF 2L9NA 2YQ0A 1BQMB 3T1YF 5AXMA 2JL9A 1HNWJ 1JLCB 1HA1A 4QIGA 3DLEA 3NY0A 4OYPA 1URRA 5DJBA 1HWIA 4Q44A 1UA0A 4LQ9A 2XEXA 2IYGA 4PG5A 3M6XA 1SJRA 3NCQA 4OYXA 3ADAC 3SDEA 3OJUA 1NZAA 2A1BA 1UTAA 2X51A 3W5ZA 1HLWA 3GG0A 2RILA 2YKQA 5CZVA 2XB2D 4RNMA 3MMAA 4DPTA 2UV8G 2DNGA 1G4CA 3SSSA 4DF8A 1REVB 2XO6A 4WU3A 2H5IB 2Q66A 3TOQA 4D3GA 3IGNA 2WW4A 2KFYA 3JSMB 1NSAA 3V6DA 4AXIA 2NXNA 2R8KA 1HBUA 1RTHA 4KKOB 3QGIA 2LYVA 3L9ZA 1HWUA 3TJAA 3UDVA 2HLUA 1YK9A 3H5UA 4LFBF 4F36A 1UL3A 3BZQA 1PBUA 1JXVA 2W9BA 2HRUA 4KGMA 2RKIA 2AJFE 3MI7X 3UO0A 2ZJRQ 1UJ5A 2GGPB 3RB6A 3Q8PB 3IC1A 4C6AA 2ATCB 3KK1B 3BSNA 2E66A 3P45B 4ED4A 5EWGA 4DR7F 2MSTA 1KKHA 3J7ZT 1VQMS 4CH1A 2MQ8A 2DGVA 3WIUA 2NZCA 2M52A 4H54A 2PMHA 2JLEA 3HFKA 1RHMB 4DV7J 4Q0BA 1T05A 3MPWA 2IC3A 3DU6A 5GAGU 2BRKA 2O01C 5C42A 1ZYQA 3H2UB 3OTOJ 1JLFA 2BKPA 3JTOA 4G6VB 2XSJB 4MTPA 4JYAJ 5KG7A 2OPSA 2FY1A 5HQ8A 4K4WA 2XO7A 2XYHB 2GV1A 2VG7B 2OELA 4MYUA 2UUBJ 2NPIA 4ZVGA 1MMNA 2BOAA 3WQPA 2DEJA 1RT5A 3OTCA 4LR8A 4KBIA 3G96A 3HKWA 1ZTTA 5KG5A 4ED3A 1RT7B 2QLBB 2DK2A 4WE1A 4DQSA 2CJAA 1PCAA 3OPKA 1S9EA 2DGXA 2QV6A 2CNNB 5EWEA 3N4WA 2Y1RI 5JUMA 2XS2A 3BDEA 2P9GA 3KHRA 4QWAA 3GFHA 4G65A 1OY8A 4DOZA 2HHQA 1T0TV 1EARA 3EVOA 2PFFB 1GH8A 5JVGQ 1TMMA 5DM6Q 2C2NA 3G8QA 2E9RX 3ILOA 5HBMA 5IQ6A 1RTJB 4X65F 1H74A 2N3OA 1RAOA 4N76A 2G9OA 2QC3A 3N28A 2JWNA 3J7AN 3AD8C 4ZOSA 1BGXT 1X5SA 1EKRA 2HFVA 2VFTA 5HLFA 1VQ5S 3CDAA 2GJ2A 3TX0A 1KLMB 1IKXA 1JXEA 2UXBJ 4V19X 2EK1A 2AYBA 2XMWA 2OEKA 1ZM3A 5E41A 2EFOA 2WVDA 2FC9A 2HZCA 3CD6S 3M9NB 4Z2XA 1XR7A 1FKOA 2XBPA 4K4YA 2BRLA 4KQZA 2HHPA 4AQYF 4JV5F 2HFUA 1XWLA 1NHUA 1FTRA 1DTQA 1TKXB 2YKNB 2K3KA 5L9XA 3BO3A 4QYRA 2CWKA 3AFGA 1G1XA 3NGSA 3HD1A 1C2PA 2QMXA 2IVYA 2CXEA 4V1Ak 1J5OA 4WFXA 2C42A 3T41A 3ZZRA 5LMUF 2F8EX 1QUPA 2UUAF 1N5SA 4OZJA 3R7SB 2UU9J 5CYQA 3DRPA 2Q1LA 3UDCA 4HHJA 5MAOA 4TY8A 3VGVA 5HQMA 2CZ9A 1WC6A 4UY85 2CG4A 4M5GA 1S0VA 1SQGA 4DR3F 3ZTOA 3GWCA 4TQRA 1RAAB 4W98A 4ANEA 1PKUA 2I9SA 5KG0A 3HCXA 3M8SA 4D3HA 3KLHA 4CNZA 2Z57B 2IVFB 4ZP7A 1Y7PA 2MB0B 4LBIA 2MQQA 3PG9A 4A4JA 1QE1B 4WXWA 2ALZA 1FEEA 4KFBA 2JVOA 2PGCA 4L6V3 3MEGB 3GE9A 3LF0A 5AE2A 2C2KB 5B09A 2C3YA 3KUGA 3DOLA 4ECZA 4U67Q 3JS9A 1EIYB 1YLXA 5J1PA 4ZVFA 2I5JA 2A2DA 1EX8A 1S9GB 2UUCF 2V69A 1MWYA 2RRAA 5IZHA 4JI1J 4C98A 4YHHF 2ZNYA 1DLOA 1T02A 4JI7F 1U45A 3AHPA 1HD0A 2LDIA 2PA8D 2QLJB 1V3SA 3OD2A 4C3KA 3LW5C 1K44A 2CQDA 4HACB 3RTVA 1GMVA 5C2CA 1JIHA 3MR5A 1JLEA 1NPKA 3KHHA 1D0EA 3UR3C 2HQDA 3PKYA 2HK3A 1VHIA 2L48A 2DNOA 1RT6A 1K0TA 4ZMMA 1JJHA 1PG5B 1JJ4A 2RD5C 2IMWP 2B4OA 3FFIB 2WSFC 3KG0A 4F3MA 1B0VA 4DSIA 4P6QA 4FS2A 3R1HA 2BDPA 2VV5A 4NEZA 1WHVA 7FDRA 1ACMB 1N33J 3FJ2A 1K9MT 2HHVA 2E44A 5ETMA 1OMSA 1REGX 2CPZA 4DS5A 2ZVSA 3AOAA 4B3TF 3K89A 5B0AA 5THWA 4O3PA 2KYXA 1L3VA 1UFKA 3QQCD 1CULB 1TL7B 4KH1B 4P2XA 2KXHA 4DUYJ 4DLEA 2FVSA 2J9CA 4DPYA 3W65A 1VRQC 2EFGA 3W62A 2I1RA 2ZH3A 3RW6A 2U1AA 3O8WA 1HL6A 4TU9A 3T5JA 4KTQA 1HBNB 4ICLA 1S1UB 2DVIA 4X2BA 3IM9A 3NP5A 2KTQA 4I7FB 2YNGB 2GMJA 2E1CA 1NPPA 4U96A 5KFIA 3IA0A 3KKFA 3DCAA 1BMQB 2W2NP 4KKOA 2GAHC 3H42A 5KT4A 2B9WA 2XCAA 1CSJA 2Y3YA 3K2YA 3AD7C 3W63A 5KFJA 2EC2A 2E9TA 3VGTA 4LRBA 4FN5A 3FMWA 2PT0A 4WF9Q 2MZTA 1EAYC 2JH3A 2FIUA 4DQRA 3S7RA 1N4LA 1RYSA 3R9LA 1WF0A 3DOKA 4DPOA 3C6TA 1RAIB 2F1FA 1X4FA 2Z2ZA 3TUJC 1U1OA 4WK3A 4GO5X 4QWCA 3C3LA 4U8YA 4YP3A 4NL5A 1FJGF 2C28A 4OJGA 2VBYA 3LWMA 3HSDA 2LU1A 1VCTA 4TXSA 4DQIA 3J80U 1W7WA 4DUZJ 5C25A 1NHVA 2HBZB 2FVQA 1EQMA 1TZ0A 1L5UA 1UWBA 3JXOA 1IBCB 4PAAA 1RA6A 4DR4J 3IBCB 3V2UC 3S6EA 4DI6A 4KGKA 2FHJD 5K8PA 3HSGA 1WJ9A 3ENVA 1RXOB 2R2SA 1T8EA 1RBLA 3KG4A 3K7RA 1NLKL 4F2RA 3K58A 2E5LJ 2BR0A 1XIQA 4OYIA 1VQKS 3TAMB 1HPZA 1WD6A 5D4NA 3ZZOA 1TFWA 1TL1A 4QYZK 3KFWX 1FNMA 3ZO7A 2GHWA 4KPYA 1R7IA 2AT1B 2MY7A 3Q24A 2DR6A 3HVTA 2ZZTA 2KI2A 5EGYA 3LP2B 1IKVA 2ASYA 3SEOA 4B9LA 3KUHA 2R2RA 1X4GA 4JB8B 2YXLA 5IWAF 3TANA 2HVZA 3KMQA 3B78A 2AYGA 1DHMA 1JJCB 1T3NA 3PR4A 2FGCA 1SIWB 4G1IA 2OKQA 3F0NA 4NASA 3BO4A 2YVSA 3TARA 2HWIA 3LH2S 3Q8SB 2QRRA 3IRXA 4YY3J 4O4RA 2RE1A 3GG1A 4USHA 1VK8A 2OHDA 1FDNA 4LF9F 5KT6A 3AQOA 3BM7A 2JNJA 4L75A 3OFHA 3FBBA 4WKRA 1T9VA 1JXLA 1JQGA 3ZTSA 5KG1A 3OXGA 2PI5A 1SI9A 1DJ0A 1NJYA 4RWXA 3ET6B 3FKBA 5L8RC 3DC2A 2XCPA 1PC4A 1P6TA 2RRNA 3HFZB 2DGTA 3OUYA 2V34A 1UA1A 3RAMA 4DV4J 1S49A 2DGUA 3DOMB 3M8RA 5A8WA 1FWLA 2CVIA 4P9SA 2RU9A 1PGZA 2QG9B 5RUBA 2CWXA 2RF2B 2DNZA 4X4SA 1NH8A 5G0RA 3QIPA 2F8HA 1IR0A 4K7QA 1RT3A 2WVEA 2YWHA 1S1VA 1WC3A 2HQIA 4QIFA 3UVJA 1RTDB 4WBFA 2ZITA 3G8TA 1FK9A 1X5PA 3SCLE 1RAEB 3GJTB 2IBOA 5C7PA 5I3UA 1NDCA 4K50A 3NMAA 1T9TA 1WI8A 4C8KA 5KFRA 1R8AA 4NEYA 5KFFA 3K57A 4Z7CA 4CYUA 3LTOA 2JFDA 1YBTA 3GIKA 2V63A 2W2QP 2VPYB 3GV5B 2AP6A 2CQPA 4KJIA 1IBKJ 4LF8F 1UFLA 1RWKB 2DH7A 2VG6A 1WTBA 5L46A 3PRDA 4TVAB 3P6YC 3NBPB 2FY8A 4ID8A 2B51A 3I0RB 5F9LA 1A0OB 3HHLC 4OFZA 3J7A1 3FRZA 4NLPA 1RT2A 4I64A 3TJ8A 5F8HA 2ZJQQ 4HH0A 2PA3A 3S8SA 3D6HB 1ZZFA 3DGPB 3I0SB 1YJ7A 4Z7YA 4AYBD 1PYOB 5BYSA 1M1GA 3TW0A 2RQMA 3BSCA 3CF5Q 3K5OA 3TNVA 5LL6d 1S79A 4DV1F 2OFHX 4PZVA 1QSLA 1YSJA 2XYPB 3V4MA 3GV8B 3QJJA 4DG1A 4F0KA 1HYSA 3EVMA 5FDLA 4WWSA 2B6AB 1A6LA 1AB8A 5F8GA 4DU8A 3MM8A 1AFJA 1GTEA 4C9DA 1X7VA 2AEFA 4N8OA 1TL3B 1U47A 5IT9Y 2WRMA 3ONQA 2KM8B 2WB4A 5ETPA 1VC0A 2GA7A 3BN7A 4OHWA 2R8IA 1GAOA 2XC9A 3PX0A 1DQAA 4GVBB 5F8MA 4K5RA 2RDJA 4DV3J 4EUVA 2VBZA 3EM1A 3TZWA 1G6BA 5J2QB 4WFBQ 2JJ4D 2RIJA 4CRJA 4OI0A 2OPRA 3GYGA 2LA4A 4QR1A 1KTVA 2VFSA 2Q43A 1WNEA 1I51B 2YNGA 5F8NA 1JLBA 2Z56B 3C14A 4IDKB 3A8EA 2F4FA 2VG5B 3M32A 2VASA 3HT0A 2NR0A 1YBAA 4OMFG 1SV5A 2ZJPQ 3PACA 4JUZA 1CLFA 2CAJA 2YKMB 4O3QA 4KSEB 1U0HA 4PWDA 3PV8A 1UCNA 5T7LA 3DYAA 2DXEA 3MEKA 2BW2A 1VMBA 2MY8A 1KONA 2W1BA 4RW8A 2RSQA 4P72A 4O0IA 2R9LA 4O3SA 2X3GA 2B9XA 1LQ9A 3VTIA 2HURA 4NYOA 1L3SA 4X4PA 2MEWA 2HHTA 2DGWA 1RI7A 3X1LB 1B7FA 2VKZG 2J6UA 5LM7E 3RGIA 2ZUGA 4RW9B 1OQ3A 3D66A 1R0AA 2ZOFA 2FVCA 1I3OB 5MLCV 4ZCLA 1Z1ZA 2WONB 2AWZA 3UE2A 2HHSA 2CZVC 2MZ1A 2CNLB 3H8YA 1FWKA 2DY1A 3GIJA 2IJRA 4ZCMA 4RKUC 4LF5J 2WAQD 4PG7A 2RB7A 1N6QA 3TA2A 4NLSA 3OL8A 1YITS 2CPEA 1SJQA 4KGZB 2XY5A 4ZVHA 1FEHA 2W2OP 2Y0BB 3EPGA 2UZAA 1J2VA 2W4CA 1FJCA 2VC0A 4ED7A 1OSDA 4XDDA 2JX2A 1N34F 4U7UK 1HNXJ 1WORA 1TU0B 1EB0A 1LXNA 4ZVOB 3VAHA 3NOGA 1YJRA 1RQ0A 2MZJA 1SPBP 4HTIA 4NLXA 2AJ2A 3K17A 2R4FA 2ZUAA 1CS4B 2RS8A 2PI4A 3HF5A 1JNZB 1SB6A 2X1GA 4RUBA 4I4BA 1M5SA 4HR2A 4DV5F 3H2VE 4LBHA 3EYZA 1JLQB 3HI9A 2IBKA 1K1SA 4OI6A 1BXNA 2DD8S 3QMQA 4WZMA 2A2CA 3PHTA 4F4AA 1C4AA 3KMSA 3R8YA 3MD1A 2RUSA 3CCSS 1RAJA 3CGIA 1T95A 4JV0A 3FRYA 1NKEA 3W66A 2R42A 5I42B 2HFZA 4JI4F 3R5BA 2XWXA 1S1TA 2IM1A 4BC7A 4EU0A 4HL9A 5T14A 2GJFA 4OZ0A 2OIHA 2QSWA 4JI8F 4G1PA 4ZHRB 4ECYA 3VAJA 4O3RA 1JK9B 2LEPA 5HK4A 3GLJA 4ZCIA 4R5PA 1O8BA 5ETNA 3BR9A 2HBYB 2L9DA 4AL7A 3Q8VA 5A2QU 2MQNA 1XJWB 4B3OB 4CIOA 1MLAA 3DLJA 4N41A 2J0WA 5J1EB 4JI5J 5KG4A 1GMWD 3GP9A 3DHWC 3PRBA 1U48A 1RKJA 4KV8A 1V5VA 3T3FA 1S7IA 1Q5VA 2AYMA 4KO0A 4PQUB 4AQYJ 5A8RB 1MWQA 1HQEB 5L1LA 4RX6A 4U6PA 3NGKA 4DQQA 1WDDA 2V5HG 2QLFB 5D4OA 4L73A 3D1QA 2VQEF 3RR7A 4TN2A 4ER8A 1B7YB 4DV6F 2ZOMA 2NUHA 1HBMA 5C2GA 4J90A 3RRHA 2AJ0A 5D0GA 2K1RA 2MYFA 4NLVA 4OZ5A 1NKCA 4ZJOA 4YMEA 3NGTA 2HKEA 1WEYA 1EETA 4WFZA 1JX4A 4XIUA 2W25A 1M90T 4OJ3A 2KN4A 3MAQA 2W9AA 4EI2A 3N0VA 4IFYA 2OPQB 3DI6A 4YB1P 2HNZA 2OTJS 2BOPA 3PIPQ 2G0CA 1RT4B 2V50A 4X66F 3ZFVA 3CXCR 3HP6A 4LF6F 2ZBPA 2WTFA 3QRQA 1AYEA 1JMTA 2HBQB 1ZM4A 4LSLB 2GVDB 1NZ8A 4DWIA 2KFZA 5J2MA 2JLFA 4WFYA 3MCOA 4PG6A 4X62J 2FZCB 3GCWP 4OHZA 4Y2CA 1KVIA 1UAWA 3CC7S 3QFHA 1KQSR 2VDIA 1OY9A 3KNAA 1Q78A 2L41A 3KLEA 4ZVEA 4HH1A 2R7OA 2XQCA 3BYRA 2MKYA 2CIMA 2IRUA 4F4WA 5BYRA 2HMIA 1JLGB 1XQIA 2EG1A 2B6AA 4DXLA 4EK2A 1JB0C 3BO2A 4ZPWR 3SMZA 4J9MA 5E3QA 3PYGA 2MGZA 5HL7Q 2ADCA 1RHQB 2PE8A 5CZXA 1WHYA 1TL3A 4X84A 1RWPB 2CNKB 2G13A 2N7YA 1G3OA 5KFZA 3PW7A 1HWKA 2OLWA 3IS9B 1LEOA 2D41A 1XMQF 3TZYA 3DLKB 1UW4A 1F3FA 2SXLA 4NRTA 5LT5A 2V68A 3MECB 1G7CB 3HDSA 4Q7AA 4ECTA 2VB6A 1YIJS 4Y28C 3QGHA 1M5HA 2D74B 2GMLA 3EXCX 2X1FA 2KT2A 3T1HJ 2ASDA 4DPXA 2R2UA 1IJFB 2VICA 2YNIB 4KY3A 4LQ3A 2AU0A 1T9XA 2W01A 1VGYA 1X0PA 1ZA2B 1S12A 3EE3A 2M7SA 3M8QB 4E98A 4Y0FA 5HROA 3BB5A 3M30B 4KHRA 1KN6A 3VCDA 2G2ZA 2LEBA 3ZZPA 2ZH6A 4NXMJ 4DN0A 2H4YB 2XTJP 5T41A 3POTA 3VF0B 2HHHJ 3FBFA 2ZM6J 3DHXA 2EW9A 4NLTA 4NRUA 3I56S 2D3ZA 3VAMA 2IPOB 5E3RA 1BWVA 4ZJQA 4TU7A 2EFNA 3I9V9 3NWRA 4ILLA 5J2NA 1YJWS 1NJWA 2MMYA 3CCWA 1NEEA 3CD7A 3W7BA 2CJQA 5DLFA 2HFSA 1NSPA 4BWJA 4O4GA 3IAM9 4OYZA 2CADA 4P73A 4RW9A 2OUGA 3MFIA 1Q7LB 1V3ZA 2ZDPA 4KRWA 4NI2B 4MFBB 3UCZP 3NEKA 4KAIA 4F67A 5SZTA 1RP5A 1RCOB 1VR6A 2E5JA 3LP0A 1F9FA 2M88A 2QFIA 1B4SA 2MKHA 1TAUA 4QZVB 1ZH5A 2CJKA 4ZLLA 1TAQA 4E2FB 4DR5J 4ZVSB 4EBEA 1N5YB 3BBBA 5IS2A 1S48A 2AGQA 4Y2KA 4RNFA 4NLDA 4ELTA 2Z2LA 3QYYA 3GZ7A 1R89A 3G87A 2QSFA 2XS5A 4XO0A 1AROP 4NCGB 2VOPA 4OJHA 1YVFA 4BLGA 3JYTB 1Y10A 3CCLS 3HK2A 2B4UA 3KK2A 4M5NA 1HHSA 2NXJA 2FVPA 1YKWA 1WELA 2ZD1B 5A8KB 4LVNP 3WBZA 4I6WA 4LF7J 1GQEA 3THPA 3EGZA 3NRBA 1FRMA 4HI2A 2AGOA 3TAQA 1OWXA 3CCVS 2KXNB 3TX8A 2Y0SD 3G86A 3SXLA 1MN9A 2P9EA 3OHBA 1FX2A 3MPYA 3M9MB 2AD9A 4WXOA 2LQJA 3UD3P 2R8JA 4DL5A 1AZSA 1FFWB 3JAMY 3QPIA 4MKYA 4HHUA 3RBEA 1IKYB 4WP3A 5A6PA 2CQCA 2HGMA 4J9SA 2ALYB 2LU2A 4DJBA 3D67A 4R8UA 2V4JB 4IH7A 5HMWA 3CJ8A 4NXNJ 5H9FJ 3QT5A 2QJ3A 1N52B 4RZRA 2XI3A 3VAGA 1IKWA 3M2RA 1T3OA 2YWGA 4LR7A 2P8IA 2BQRA 2OPPA 1NB7A 3GIMA 2Y1LB 1IR1A 1T03A 1SUQB 3DLGA 4UZBA 3V4IA 4DSLA 3BH6B 1RB0A 5D0RA 3DDKA 3D1HA 1L3UA 4G1QB 1GX6A 1HI1A 5HO4A 1FFSB 2QLXA 5F0WA 1Q8IA 1TUWA 2NCKL 3T5LA 3I9ZA 3NAIA 4IG3A 4LF9J 3A8IA 4JBCA 4KYZA 1T9YA 4C97A 5KFSA 2EWHA 2EC0A 3MHYA 3ENWA 4U9RA 2W7PA 2DJWA 4DS4A 1CJUA 3U1NA 4ZPAA 3EVWA 2CFXA 5KFMA 4U95A 1OYDA 3MMBA 3ZNUA 2Z58B 2F4VF 3B6BA 4EBCA 4DHVA 1SQEA 1AXQA 3K8WA 3NCPA 5HMYA 1HQ2A 1FRXA 2WOMA 3DDIA 1RAFB 3CJ5A 3M4XA 4OZ1A 5KFGA 4OLOA 4PG8A 2KT5A 3FQLA 3CJKB 3DRSB 1FESA 3CVKA 3MM5A 2FHOB 2AMCB 4DL0C 1TVRA 2QYGA 2QA4G 4DFMA 1C0UB 3DM2A 2V4QA 3L7UA 1LW2B 2GZOA 1VQ8S 2B5JA 1J5EJ 1VQ6S 2BJDA 5E0OA 1KFSA 2RUGA 4KB7A 2HFNA 4X64F 2JC1A 3I6PA 5L38A 2J7UA 1Y00A 3C15B 3B4MA 4ED6A 2UVRA 3A13A 2EPIA 4DL7A 5DGBA 4CCHA 2Q3PA 1Q1KA 4LSNA 4P74A 1HBOB 1H6KX 4DBQA 1EP4B 1NAQA 3PYDA 2V9WA 3JSBA 2BJ7A 2OFGX 1BWEA 4HDHA 3C66A 2VQFJ 4FF2A 1SJ4P 1VIXA 5LXRA 1K8AT 1TP7A 2G0IA 5U47A 4C0BA 4NZ6A 4JV1A 2GAGC 4RO0A 1RT1B 3KK3A 4QIVA 5K8MA 1YI2S 1YWXA 3VZIA 3HMJG 5I4MA 3QO9A 3PW2A 4QYZJ 4MIAA 2NZ4A 2KVQE 1FKPB 3SCKE 3TUIC 2H1YA 4YDDB 3L4BC 2NXEA 4M5LA 4X4OA 4OZLA 1UVKA 1N32F 3H25A 1CEZA 1C1BB 1W2IA 1ZAWA 2M3DA 3UW1A 2ASLA 1PAUB 3TYTA 3MM9A 2EKYA 1RTIB 2KO1A 3VGUA 3R5CA 4PG4A 4BS2A 4G3IA 4A8OA 3CCES 2V8VA 3G82A 1P1LA 2KJWA 2J9EA 4LREA 5FLXU 3PNIA 4KE5A 2BV3A 3F41A 4K4XA 2VBWA 1U1NA 3MUTP 4ZLPA 4JI6J 5JXSA 4M94A 2LCWA 3QRPA 3QT6A 1NDKA 3FSXA 2X1AA 3MURP 4IQMA 4ENOA 3DLEB 3IP0A 1VQNS 2BUNA 1XNRJ 1UEUA 4WFAQ 4DSEA 3O44A 1VFJA 2IJFA 3SDEB 5F0UA 3K5MA 3LP1A 4IKAA 1TKDA 4M8LA 3MMAB 3V6JA 4DQPA 3M30A 1YRXA 3LUYA 5HP1A 4KC5A 3KXDA 1ZAVA 1UEKA 3W61A 5KOWA 2DR9A 2WVBA 4TU8A 4EZ9A 5KT7A 3V6DB 2IHR1 1FVSA 1HBUB 1X9WA 2R7TA 3ISND 1RWXB 3W2VA 1VQOS 4RUHA 4KPCA 1HFEL 1RLDA 4ES1A 4BWMA 3KG1A 3I55S 4FDFA 3HT3A 3GJRB 3HHDA 3T5KA 4WPAA 4MIBA 2W9BB 1HNVA 2R3VA 3R5GA 2W2PP 2V94A 4EFAC 3BF4A 1DAXA 1D8YA 2JZ5A 1CQNA 2E5HA 1RK8A 5DDOC 4CLTA 2VPZB 2BEFA 1SKUB 4Q0BB 1T05B 4X4VA 4U7UD 4USKA 4I67A 3HJVA 2HK2A 3UDEA 2IC3B 5D78A 3M8YA 5KFNA 3RW7A 4DV0J 4H4KA 3A8KA 5C42B 3M9OB 3ILJA 1JLFB 2KFNA 2IJNA 1Y5IB 2B43A 3SI8A 1X4CA 4XAKA 5LMNF 2OPSB 4M1KA 1VRTA 2BX6A 2BW7A 4LRCA 1F2GA 3MOZA 2D9PA 4ZK7M 4AT1B 4DR6F 4ILMA 3TWZA 2YPYA 3MEDA 4B3MF 4ECWA 1MG7A 4UQGA 2ATLA 3ICLA 3LAKA 4J9LA 1SQFA 2PFDA 3U1LA 5AE3A 1RT5B 2HQCA 2L3MA 3R3TA 3H4BA 4ZITA 1IBMF 2F5GA 1FD2A 2CDQA 4WE1B 5EWFA 1D9AA 1XEZA 1QSYA 4UY8T 5KFPA 1S9EB 2B9YA 4DN9A 1WKKA 4Z37A 1F60B 2V4RA 2ZHOA 4ZDNA 3MF5A 5GAEI 3D68A 1NU4A 4A46A 2YH1A 1VDHA 1KEKA 3VALA 3QSYB 5ETVA 5KFDA 5BJRA 1FDBA 3BKTA 3E01A 2V4JA 4C0OC 4DV5J 1WC4A 3CMES 2B9EA 1JJ2R 5BR8F 3FSYA 5CQGA 5HLFB 3BPDA 3SZ2A 3BPSP 4PXCA 3RJMB 2QA4S 1KVJA 2GFFA 1IKXB 5EX0A 3T9ZA 4M5KA 3EMTA 5H9EK 3QIDA 4JI4J 5L9NA 4HTJA 1FKOB 1QD1A 1EHWA 2JRSA 2LP4A 2PC6A 1SCJB 1XR5A 1HIYA 1Q8KA 4OLPA 3NGUA 3KHGA 3EX7B 3MTKA 1WOPA 1XMBA 1DTQB 5LSLA 2FLOA 2GIRA 1ZM2A 2EK6A 2YY3A 3MXHP 2VIHA 2J8AA 1S77D 4GMKA 1TUVA 3ELHA 2ZH4A 3SQGA 3G71S 2YKPA 2NYHA 4QR0A 1TELA 3ZTPA 1Z2ZA 2VU5A 1J5OB 3MOJB 3UN5A 2DEIA 2D3OR 3I4HX 3GFZA 2A6MA 4P7TA 3HD2A 5CYQB 5D0HA 3DRPB 5KFLA 2DNHA 1NXIA 4HT7A 4QWBA 4TY8B 4DU7A 1RAGB 4DV2J 2NUUG 5B0DA 4O3NA 3UN2A 4ERDA 2XY7A 5L1IA 4HYKA 3FBEA 2C3UA 1IQZA 2ZBRA 1RZMA 1FHTA 2PDAA 5I3QA 3CJ2A 2MQOA 3OLBA 3KLHB 3L95X 4HLBA 2QE5A 2W8KA 2GS8A 4CTAA 1DFDA 1XMOJ 5LOQA 5ETKA 4K4SA 1UWAA 4KFBB 4C8MA 2IM2A 4CM2A 4B3SF 1TK0A 3GYNA 2CQBA 1ZM9A 1CJTA 3CJ4A 1S7HA 5KFEA 2ZKUA 1JLAA 3D5MA 3DOLB 4GRSA 2LQ9A 1PBAA 2CQ4A 4KHPF 4ZVRB 4O3OA 4PUOA 2I5JB 3HPOA 4B9SA 1BLUA 1U26A 2R7XA 1S1XA 3UD4P 3PX6A 1DLOB 2LDYA 2Z2YB 2ZE2A 2PEBA 4OI4A 1P1TA 2UXDJ 2KB2A 4J9UE 1VBXA 1UJ4A 4E0DA 4WKYA 4K4TA 2JLGA 4ETXA 4UQTA 2ZC3A 2CPIA 5I3PA 4OX9F 4LFAF 2HAFA 4CLPA 3P49B 1BQXA 2J9DA 4QW8A 1JLEB 4PYDA 1HNWF 4J37A 1RA7A 1RT6B 1FRIA 2KRRA 2HPUA 2HQGA 3CCQS 2DH8A 3FEZA 2ZEJA 1R3NA 4J91A 3KLIA 1K1QA 2B8PA 3NGDA 2O5DA 2NSCA 5KFTA 4JI2J 2MJNA 3OL6A 4J9OA 3KTQA 4ZVUB 3HZGA 1CQMA 3OHAA 2K3IA 3A3OB 5GMDA 3BQ2A 5AXLA 5DQIA 2BZ2A 1N48A 2DHXA 1H73A 3RAXA 2R7UA 2B0GA 3WDOA 4ZKAA 3M8WA 5K20B 3MPVA 3J81Y 5A0YB 4ICLB 4OHXA 3R6LB 4GC6A 1QJHA 2DHHA 1V5IB 3FZ2A 3CDUA 2O3DA 3FEYB 4DLGA 3QT7A 3W9HA 1NK9A 4WYLA 2NSBA 4ZIWA 4QPTA 3CMAS 2I0XA 2VFRA 3C16A 1TKTB 4DV7F 1PIEA 1GXTA 3TQEA 4HKQA 4IRCA 4H4KC 1SKWA 3OTOF 4LUBA 2EEYA 4U7CA 5GAHI 4QBUA 3PW0A 1SXLA 4JYAF 3RZAA 4F25A 3DOKB 4FZVA 3MM6B 2GHPA 3C6TB 4ZVQB 5K5MA 1H7WA 2DB1A 3DN9A 3IR6B 4IG0A 5KAKA 1YRTA 1PJ7A 1N0VC 3JQMA 2GO9A 3QZ7A 1N5TA 2BKOA 4A8QA 3O2IA 3BN4A 4I0WA 5CYJA 2E9ZA 1WG5A 5LSRA 2QMWA 4GKKJ 5C25B 2YKAA 3IG1A 2VC1A 1FXDA 4DL2A 1VJQA 4ZP6A 2CPDA 5CABA 4NA2A 1UWBB 5B08A 7FD1A 4MYTA 1U6ZA 3R5AA 3P4UB 1FVQA 2QGFB 2OAUA 4USTA 2DTJA 2M0GB 3ITHA 2K2PA 4ECSA 2DH9A 2OGUA 1HNIA 3MM7A 2LVWA 3AD9C 1YRUA 4TKTA 3CJSA 4WIIA 2CPFA 1HPZB 5HSPA 3FDSA 1U8WA 2UXBF 2MPUA 1WUUA 1TL1B 1ELOA 1IBLJ 1OY6A 4HI1A 5AT1B 1MMLA 3GILA 3HVTB 3OFGA 1YQHA 3OV7A 1TFYA 1I6JA 1MSWD 1IKVB 3TUZC 4ZLNA 2OD4A 3KLFA 4CLYA 2GX8A 1R43A 1NUEA 2FD2A 3D2WA 5E7OB 2UXCJ 1VS3A 3U7JA 3LQVA 3KYLA 4ECUA 4W90B 2KJVA 2V2QA 2AJ1A 3TJ9A 2JVRA 2BJ1A 3V6KA 2RHQB 3EDRB 2KDOA 3IRXB 3DFEA 1Q81T 1LV5A 2ZKTA 2C2ZB 1I1GA 3IO1A 1SL0A 4RNNA 4NX9A 4Y6IA 2IYIA 2XLIA 2KYZA 4WFNQ 1V3RA 2ZFHA 2MKJA 1O5JA 2QN6B 2Y9HA 3CIMA 2PMZD 3G6ES 3MMJA 3MPDA 3CC2S 1O0PA 3A8JA 2XNQA 1U24A 2UU9F 2ZBQA 3D9BA 9RUBA 4QR2A 3BS9A 2XMUA 3R1LA 4MK9A 3CMQA 4I68A 2COLA 3G8SA 3OUYB 2OH2A 4FVMA 4IOBA 2HIQA 1SC4B 2ZWOA 4PQAA 2AZ1A 1JKHA 2VH7A 1GMUA 1OJ4A 3KLGA 4A8FA 4OV6A 5A8WB 1TR0A 1X4HA 5AJ3J 1OS5A 1OYEA 4NOHA 1N36J 3N9UC 3EZUA 2CPHA 2CPYA 5G0RB 4N8NA 3QIPB 2DR8A 4NZ0A 3FZBA 4IH6A 1NSKL 1RT3B 1RDRA 1S1VB 3UVJB 2DR5A 3N01A 2G0JA 1WSVA 4LF4J 1FXLA 3P5BP 3RBZA 1FK9B 3OXLA 4DCOB 3QLHA 4PPDA 2FDNA 5I3UB 4IO1A 4DSKA 3D54A 4JI1F 1WEZA 1IM4A 2QA2A 1EKSA 3QGPA 3I82A 2V2ZA 5D8HB 2DCLA 2R7QA 3GU0A 2GC8A 2EBGA 3CNQP 2I38A 3SCIE 5HANA 4CYUB 4KGXB 1AA1B 2PD1A 3DMJA 2RDDA 2ZC4A 4JI3J 2UUTA 1C1CA 1S59A 3PVXA 2V0NA 3CDWA 2ZH5A 5G4DA 5DGAA 4LRDA 1X5TA 1NMEB 2VG6B 4I69A 2HS3A 4ZPBA 3SYZA 2HVHA 3VAIA 2OEMA 1MU2A 3EPIA 1RT2B 1U7LA 2DPJA 1NKBA 4J9VA 1N33F 1VQ4S 5ETSA 4YS2A 1RGVA 5DS7A 2HZAA 4KR0B 3NNHA 1HI8A 1FX4A 2HFOA 2K7JA 4F4ZA 3LWLA 1YGYA 4RW6A 1OPZA 4DG1B 3PZPA 1HYSB 2RAQA 4QCLA 1SH3A 1HMVA 5FDLB 3TVKA 4ILRA 4DUYF 1VQSA 4RWWA 1VQYA 4IUFA 2CQ2A 3M1VA 3MM8B 2VA3A 3HHLA 3F44A 4FF3A 3CJ3A 4QW9A 4OIXA 3FNNA 1X4DA 2JFKA 3OFFA 4NLYA 5B0EA 1HR0J 3HSJA 2EI5A 1YG0A 4URSA 4DMZA 1VRUA 4ZP8A 4FBUA 4USIA 5H9FK 2LXUA 2DY9A 5DQGA 2ACMA 1D8ZA 2IDEA 4OYBA 5IV3A 2IA0A 2E29A 1WC5A 3BGRA 1RLCL 4B9VA 4LT6A 4B9MA 3IWXA 3CCUS 2WCXA 2HHWA 2BA9A 3FVYA 1RU2A 2ILZA 4NLUA 5HVGA 2OPRB 5J1NA 2FJWA 3PFOA 5A0YA 3LPEA 2KG1A 5GADI 2BANB 2UUWA 3BSAA 3THTA 4TYBA 3ZTRA 1QTMA 5FD1A 1UP1A 1JLBB 3DXSX 3C14B 3K8VA 1TKZA 4FF1A 4HEA9 2LXIA 2J8SA 3M32B 1RAHB 1QAYA 2H9ZA 1WF2A 2O1PA 4LJMA 2PMWA 2B4VA 2BM1A 1SV5B 2VA2A 2IRXA 2VD3A 4A8XA 1TKTA 3VGSA 1U0HB 4PWDB 1XR6A 5T7LB 3DYAB 1WI6A 4I2QA 4LFCJ 3KJQB 4RW8B 1VQ9S 1NK5A 2N7CA 2MLYA 1SBRA 4UOGA 3MUVP 4RU9A 2M5YA 4DUZF 1QTNB 4H4OA 2Y8YA 3MM6A 5CD4A 2ZHBA 3D1OA 3Q8UA 2EKNA 3FSIA 1NPRA 1NCLA 2VBXA 4DR4F 4WTOB 1R0AB 3MMCA 3B8HA 3W8GA 2LXFA 4ZVTB 2C3MA 5CCLA 2WHOA 5K8OA 1O6XA 3Q2SC 1NRKA 2F9DA 1X31C 1H2UX 1GT8A 4MAKA 2IM0A 2E5LF 3QWUA 4C8OA 4EYIB 4I56A 1M5VC 1N6QB 1FE4A 1B64A 3SCJE 3NCRA 3DNCA 2W2MP 3CT9A 3K5LA 1H2VZ 3UD5A 4RW4A 5C5JA 4MH8A 2R8GA 4GC7A 3F56A 2VDHA 2KRBA 1S97A 4I2PA 4A8SA 3SFUA 1B0PA 4B3RJ 3CJTA 1ZZNA 3AH6A 2LLZA 4Q43A 4J9NA 4PWUA 5IT9U 4X4QA 3TI0A 3FGVA 2HNDA 1QY7A 3QFWA 4OI3A 5KG2A 3DRRA 4X4UA 2BVZA 4YY3F 1E6YA 4DR2J 2PN6A 1WKJA 4WU2A 3RYLA 4UT4A 4R25A 4AE5A 4XDCA 4C8LA 3GSDA 1H38A 1M1HA 1PJ5A 2JOQA 3M7VA 2HEKA 2XULA 3UNGC 3L09A 3NXZA 4J9QA 2CDRB 3AODA 1UVMA 4BDPA 1S1TB 3PRVA 1LWXA 5HI7A 2E7XA 1NDLA 3W3SA 2VJUA 3SV4A 5KFXA 4YFUA 3PHEA 2XZDB 3WX8A 1LFPA 3CULA 2MZSA 4R5PB 1FA0A 4GKJJ 2OI2A 5GAHU 4NYPA 2ZOGA 3FQKA 1Q4RA 2BABA 1C0TA 5IM0A 1TQLA 2B3TB 2RNEA 3P5TL 3M2UA 1U1KA 2FJVA 1LFWA 1Y11A 2FVRA 1LXJA 4UUXA 4KV8B 5F3ZA 4KO0B 4L3NA 4QIWD 4YN3B 2Z8QA 2H3EB 1ZAXA 4IQXA 3C19A 4O44A 4A8KA 2BQUA 1I94F 4MKVA 5SUHA 4CLUA 3RAQA 2A10A 4RNOA 3W9IA 4OYWA 2J0XA 3U1MA 3SSQA 5HATA 2LQ5A 3GFXA 4NCAA 2RS2A 3PW5A 1KFDA 4IR9A 2D69A 4WIQA 3N79A 4FPRA 2NXCA 2AX1A 1HBMB 5F41A 5LXYA 3ZZTA 3AY0A 1SC1B 4NPOA 3OT9A 4E8UA 5CA5A 3OSPA 1RADB 1OIAA 3G9CA 1R0CB 2LFVA 2B8QA 2YX4A 2K1RB 4K59A 2CKWA 4DR1J 3NNCA 4PRFA 4KGVB 4N7TA 1VJWA 1WKLA 2I8EA 3AXKA 4FYYB 4MK8A 1IBKF 3MAAA 1EETB 4A47A 3Q2TC 3MDFA 3I87A 2QTWA 4IFVA 2BQ3A 4F4XA 3RUBL 4CNYA 3D3BJ 4ANDA 1JWWA
chains in the Genus database with same CATH topology
4F8RA 2M9KA 3I6PA 5L38A 2JEIA 4ED8A 2J7UA 1Y00A 2UVVA 3B4MA 3O1LA 4ED6A 2UVRA 2EPIA 4DL7A 5B09A 4ZPTR 1OQ6A 3OTEA 2C3YA 3N6NA 4IFYB 5DGBA 3DI6B 3DOLA 2XNRA 2HNZB 4ECZA 3NBPA 2DNKA 4IH5A 4U67Q 4CCHA 2YX7A 5J1PA 2Q3PA 3N6LA 2UXDF 5FJ4A 2MDAA 3I0RA 4ZVFA 2UV8A 1Q1KA 2I5JA 2MKIA 1OPIA 4LSNA 2A2DA 1HBOB 1S9GB 2UUCF 1H6KX 4DBQA 2BE2A 3E3XA 2CQ3A 1MWYA 1FRKA 2Q79A 2RRAA 1EP4B 1NAQA 2AX0A 3S1TA 5IZHA 3DMJB 2V9WA 1WEXA 3DGPA 3JSBA 4TLRA 3I0SA 4YB6A 4C98A 4M95A 4YHHF 2ZNYA 4CO3A 1C1CB 1DLOA 2OFGX 3NL0A 1BWEA 1T02A 4HDHA 4C11A 3C66A 5KT2A 3SV3A 3LANA 1U45A 5J2MB 4JI7F 4FF2A 1QM9A 1SJ4P 2WBMA 3AHPA 1VIXA 5LXRA 1HD0A 2LDIA 1TP7A 2PA8D 1K8AT 1M5PC 5M2RA 5U47A 4K4VA 1V3SA 4C0BA 4NZ6A 4C3KA 4JV1A 4QU7A 3LW5C 3TO8A 4X4NA 1RT1B 3IWNC 3KK3A 4QIVA 5K8MA 3OR1A 1YI2S 1YWXA 2CQDA 3VZIA 3HMJG 3RTVA 5I4MA 2VFUA 5K9FA 4WYWA 3G6XA 3QO9A 3PW2A 4QYZJ 1JIHA 1MU2B 3KLEB 5KFQA 4MIAA 2ROGA 2NZ4A 3ULHA 4N56A 3MR5A 2MZRA 1JLEA 2C3OA 3KHHA 1D0EA 1FKPB 3UR3C 5KFCA 2VUGA 3PKYA 3OJSA 1OO0B 3SCKE 3TUIC 5KFHA 2CQIA 4KHMA 5CHCB 3G4SS 5L1KA 1NK7A 2L48A 1NJXA 2DNOA 3GMGA 4C4WA 4YDDB 4RBUA 2N4CA 4X4OA 4OZLA 2HMIB 1ZPWX 1RT6A 1UVKA 1K0TA 1N32F 4N5SA 4ZMMA 4K4ZA 3H25A 1JJHA 3AA9A 4JI2F 1JJ4A 3W2WA 2RD5C 1C1BB 1CEZA 2IMWP 2FJEB 1W2IA 2RQKA 1ZAWA 4RW7A 1CPZA 2B4OA 3FFIB 2WSFC 2M3DA 3KG0A 3MR2A 5A6WA 3UW1A 2ASLA 4F3MA 1V6HA 1B0VA 3IGVA 3TYTA 3MM9A 4DSIA 2EKYA 1RTIB 4P6QA 4DX8H 4FS2A 2W9CA 4DL6A 3R1HA 2BDPA 2VV5A 2UVWA 2KO1A 4RW6B 3CC4S 1S76D 4DV3F 2D7SA 1WHVA 2MGZB 3I5AA 7FDRA 4ECVA 3R5CA 4H4MA 2Y1JA 3FJ2A 4YB5A 2EFVA 1HMVB 3PO5A 4A8MP 1K9MT 3DXBA 4PG4A 2HHVA 1YHQS 2FC8A 4BS2A 4G3IA 2E44A 2VPWB 4A8OA 3EZ5A 3CCES 1VC6A 5CYMA 2V8VA 1UETA 1SKSA 1P1LA 1DQ8A 3R5DA 5KFOA 2CPZA 3M1VB 4DS5A 2KJWA 2KHCA 1APSA 3V81A 3OBIA 3TRGA 2J9EA 3NKYA 2ZVSA 1XC9A 3HHLB 3HM9A 4B3TF 5B0AA 2ADBA 5THWA 4O3PA 2KYXA 1TV6A 3PNIA 1L3VA 2ACYA 2AJ4A 2C3PA 4KE5A 4RBVA 2MQPA 3OR2A 2BV3A 3F41A 3I5CA 4K4XA 2VBWA 1U1NA 3MUTP 1TK5A 4ZLPA 5JXSA 4M94A 2LCWA 5J2QA 5H9EJ 2VKRA 1FO1A 3PR5B 3FSXA 3NWGA 2X1AA 3MURP 2KXHA 4ES2A 2WBRA 1VRUB 1KHWA 3TR5A 4IQMA 4DLEA 2ILYA 2FVSA 3DLEB 2AF6A 3SFGA 1X5OA 1VQNS 2NYIA 2J9CA 2BUNA 2R7WA 4I1TA 1UEUA 2NXUA 1FTCA 3U27A 2NREA 2EFGA 3MEEA 1HW9A 1E6VA 2I1RA 3MFHA 4WFAQ 4TQSA 2ZH3A 4DSEA 3RW6A 3BGRB 2U1AA 3O44A 4AL6A 3O8WA 4IDKA 1VFJA 3Q8QB 2IJFA 1HL6A 4TU9A 3T5JA 4RU2A 3H4DA 4KTQA 3SDEB 2VG5A 1IJEB 5KFYA 3F73A 2DNYA 1HBNB 5D4LA 5F0UA 4ICLA 1S1UB 3K0JA 4NZ7A 3K5MA 5DDQC 4IRDA 3LP1A 1QSSA 4IKAA 2BANA 4ZA1A 1TKDA 2DVIA 4K4UA 1PC5A 3EUNA 4X2BA 2CQ0A 3NP5A 2KTQA 4I7FB 1Y5NB 3C8YA 4M8LA 2YNGB 3MMAB 3IRWP 2E7WA 3V6JA 4DQPA 3M30A 2GMJA 1YRXA 2YKMA 3LUYA 1FRHA 3I32A 2E1CA 5KFIA 3IA0A 3KKFA 1M1KT 3DCAA 4PKDB 5A2QY 1WF1A 5DO2A 5L1JA 5HP1A 1QUVA 4KKOA 1KOOA 4KC5A 5KT4A 3HVRA 4P7VA 2KKHA 4UUWA 2B9WA 2XCAA 2CJ9A 1X4AA 1CSJA 1MWZA 1ZAVA 2GNKA 1ZOTA 1DBDA 1LWCA 2IAJA 5KOWA 3K2YA 4WK1A 2DR9A 5HROB 4EWTA 4TU8A 5KFJA 3BGLA 3HVAA 1TKZB 2LEAA 5KT7A 3H5SA 3TVZA 2IHR1 5KT3A 3V6DB 4EZ9A 2E9TA 2EVZA 2GIQA 1FVSA 2K8GA 2J7KA 1HBUB 3C2PA 1X9WA 2W4DA 1NH7A 2ZZMA 4MIWA 2R7TA 3POTB 4FN5A 3K5NA 2J0QD 1FD8A 3ISND 1DTTA 3W2VA 1VQOS 4B9UA 4RUHA 3O3LA 2BBEA 3OL9A 2KZMA 1HFEL 3FMWA 2PT0A 4WF9Q 2MZTA 4B08A 4ES1A 4BWMA 3GR1A 3KG1A 3I55S 2JH3A 2FIUA 2WW8A 4DQRA 2BXJA 4L72B 3C6UA 3HT3A 3S7RA 1N4LA 4CH0S 5C24A 1RYSA 3H40A 5J2NB 1WF0A 3HHDA 3DOKA 2RT3A 3NS6A 1CG2A 4I2QB 4DPOA 3T5KA 3C6TA 3VQTA 3PM9A 3RB4A 2I2YA 4LF5F 3T5HA 4I6YA 2VFVA 2B7BB 4MIBA 2W9BB 1HNVA 5KG3A 2F1FA 1X4FA 1KQKA 4O4GB 1LW0A 1Q8BA 2WONA 1Y0HA 5E3AA 3TUJC 1U1OA 2ZNZA 4GKKF 5B0GA 3BQ1A 3JSRA 2W7AA 4WK3A 2V94A 4GO5X 4EFAC 4QWCA 2BACA 5F8JA 3C3LA 1HD1A 4YP3A 4H4OB 2OSQA 4FYDA 4PXBA 4NL5A 3BF4A 1DAXA 2AGPA 1FJGF 2YNFA 2C28A 2IRYA 1D8YA 4OJGA 1NK6A 1DZ5A 2UP1A 2VBYA 3LWMA 2JZ5A 2JHEA 4OHVA 2DCUB 1CQNA 2E5HA 1W25A 2LU1A 1RK8A 2CQGA 5DDOC 4RBTA 4TXSA 3K5PA 4DQIA 2VPZB 3X3UA 2ABYA 1PILA 2UUBF 3LP0B 4Q0BB 1T05B 2MQLA 5C25A 4I67A 4K2XA 2DIVA 3MMCB 4J9RA 2HHUA 1HNXF 4X4VA 1NHVA 2IC3B 3AAWB 5D78A 3HHLD 2V2KA 2FVQA 2V8HA 5KFNA 3RW7A 1KD1T 1TZ0A 4H4KA 5C42B 1KQGB 3M9OB 1L5UA 1JLFB 2KFNA 1GX5A 2IJNA 1Y5IB 3CD0A 2B43A 3SI8A 1UWBA 3AJ2A 2QIFA 4UW2A 1X4CA 5D3GA 4XAKA 5LMNF 5DG7A 2OPSB 4M1KA 1RA6A 4TYAA 1VRTA 3V2UC 3KJVA 3S6EA 3PXGa 4M5DA 4F26A 1KTQA 4KGKA 3AB4B 2FHJD 3H2LA 1F2GA 3MOZA 5K8PA 1MROA 2D9PA 2U2FA 2XS7A 4ZK7M 4DR6F 4ILMA 1L3KA 3BSOA 3ENVA 2Q6CA 4A8YA 4NLWA 3MEDA 3HJFA 2R2SA 2ROEA 3EXYA 4B3MF 4ECWA 4EO8A 1QVFR 1T8EA 1RWUA 2HWHA 3KG4A 3K7RA 1IBLF 4F2RA 4UQGA 2E1MC 3K58A 4RW4B 2ATLA 2BR0A 3ICLA 2B4PA 3LAKA 4J9LA 4NWBA 5J2PA 2XLKA 3U1LA 3UCUP 2OO4A 4URGA 5AE3A 1LK5A 1RT5B 2J0SD 1TK8A 3AJ1A 1VQKS 2L3MA 3S01A 3TAMB 4KT0C 1HPZA 3R3TA 3KK2B 2V9KA 4EO6A 3H4BA 1WD6A 1FDDA 4I2PB 1IBMF 5D4NA 3ZZOA 1QAXA 1TFWA 1FD2A 2CDQA 4WE1B 1S6PA 5EWFA 1N88A 1TL1A 1D9AA 1XEZA 2YQ3A 1QSYA 3KFWX 1R8PA 4UY8T 4ED2A 1FNMA 2GHWA 1JLQA 5F8LA 3TAPA 4KPYA 1R7IA 3ISZA 1X4BA 4ETZA 2MY7A 5ITHA 2UVUA 2RMLA 2UXCF 5KFPA 1S9EB 2B9YA 1FF2A 2CQ1A 3CD5A 3Q24A 1Q86T 4DN9A 3HVTA 4Y2IA 4Z37A 1F60B 2KI2A 3MR3A 2V4RA 3DDNA 1XERA 1H2TZ 2ZHOA 5EGYA 2ZDOA 4N47A 3FMBA 4ITSA 3LP2B 4ZDNA 1IKVA 2ASYA 3MF5A 5GAEI 1NJIT 3SEOA 1NU4A 4A46A 2R2RA 4B9LA 2YH1A 1R8HA 1SL2A 1X4GA 2HNDB 3CO9A 4CO4A 3TQ1A 2HW3A 1KEKA 2DNRA 5I42A 3HHNB 3VALA 3QAUA 2MSSA 5GADU 3DRRB 1YJVA 5KFDA 4DFPA 3CCTA 1S1WA 5BJRA 4ALZA 5IWAF 3TANA 1E6YB 2DNQA 2EFQA 1FDBA 1H3DA 2HVZA 3B78A 3KMQA 4FBTA 2FTRA 3M2VA 3E01A 4NCBA 2AYGA 1DHMA 2D3UA 2V4JA 1T3NA 3PR4A 4C0OC 2FGCA 1SIWB 4G1IA 3GQCA 3OLAA 1SKRA 2OKQA 3CMES 2DO0A 4HDGA 3GR0A 1JJ2R 5BR8F 4ID5A 4JI5F 3FSYA 3BO4A 2YVSA 2OP5A 5CQGA 3TARA 5AE1A 2HWIA 4ZHRA 4BC9A 3LH2S 3M6WA 3Q8SB 5HLFB 3PY8A 3Q8RB 3G6YA 1NJZA 3T6BA 1R6YA 2QRRA 3IRXA 4R8UB 3SZ2A 4PXCA 4O4RA 2RE1A 5HMXA 1FNOA 3IR5B 2QA4S 3DLLQ 1KVJA 2GFFA 1IKXB 2RJZA 1UEVA 4C0HA 3GG1A 5EX0A 4USHA 3T9ZA 2FJXA 1BQNA 4BCAA 1VK8A 3VZHA 2ZZNA 1H7XA 3QIDA 4ZPVR 2P5VA 2IA6A 1FDNA 4CO5A 4B3OA 2N4DA 2JDJA 5J1EA 5L9NA 4LF9F 2ROPA 4O23A 5KT6A 3JSYA 1FKOB 2YNHA 1IKWB 3AQOA 3M2RB 4HTJA 3BM7A 2JRSA 4OX6A 3ZZZA 2PC6A 3OFHA 4YOEA 4QWEA 4ZP9A 2ZH2A 4YDXA 2OPPB 4WKRA 1XR5A 1JXLA 1N0UA 2M2BA 1WACA 5KG1A 1T03B 3OXGA 2PI5A 1SI9A 1S0NA 2KXFA 4J9KA 4PQUA 1F5CA 2GCFA 1DJ0A 5A8RA 3DLGB 3V4IB 4OLPA 1NJYA 4RWXA 5L8RC 1HQEA 2DGQA 3KHGA 3DC2A 3EX7B 2XCPA 1PC4A 3BR8A 3MTKA 4YR2A 1P6TA 3E8OA 2RRNA 2HLTA 2DGTA 1XMBA 3GFYA 1DTQB 1N5QA 1HHTP 5AJ3F 3OUYA 1FRJA 5LSLA 2DNLA 3M8PA 4DL3A 1UA1A 2FLOA 1FT8A 2GIRA 1ZM2A 3RAMA 2EK6A 2YY3A 3NNAA 3MXHP 3PKMA 1C0TB 1YJUA 1N36F 5IM0B 2D9OA 1XBWA 1S49A 2J8AA 2DGUA 5L39A 4IG3B 4GMKA 1S77D 2JEGA 1TUVA 3M2UB 3M8RA 5A8WA 2ZH4A 2HNYA 3SQGA 2CVIA 4OX8A 1U1PA 2M8HA 4QU6A 3G71S 4QJVA 2YKPA 4QR0A 2RU9A 1Z2ZA 4GO7X 1PGZA 2DNNA 4LIRA 1J5OB 2FLLA 1HARA 2OJ3A 3MOJB 2HYIB 2W4PA 1X0FA 3BEGB 2M8DB 4O44B 4LF4F 1A7GE 4OI1A 3WZ0A 3J7YU 2RF2B 2D3OR 4DSJA 2DNZA 4X4SA 1NH8A 5KFUA 1S6QA 3OL7A 3I4HX 5G0RA 3GFZA 2O67A 3QIPA 2GQ2A 3TP2A 3MMBB 3OFEA 2F8HA 1IR0A 4P7TA 2DIUA 3OW2R 5CYQB 3DRPB 5KFLA 2DNHA 2OSRA 3PW4A 4HT7A 5DDPC 5JJBA 4QWBA 3BREA 5H1SV 3GB0A 4TY8B 4YB7A 1NK0A 3ZZ0A 1RT3A 2YWHA 1S1VA 2HQIA 1PSDA 1MNEA 2WOMB 4QIFA 4F02A 4WJBA 1RTDB 3KOAA 2NUUG 1P9QC 5BYQA 1HQUA 5B0DA 2ZITA 3OVAA 4O3NA 3G8TA 1FK9A 1UJ6A 4EBDA 3KLVA 4ERDA 1X5PA 2QYCA 4Q2MA 2XY7A 3SCLE 5B0CA 4QQBA 3ISNC 2V8DA 5L1IA 1BY9A 4HYKA 2C3UA 3OTBA 1IQZA 5IXUA 4CT9A 2IBOA 1ULRA 1FHTA 5I3UA 2PDAA 4K50A 1WHWA 3NMAA 3MM5B 5I3QA 4JI3F 5K14A 3CJ2A 1WI8A 2BM0A 4C8KA 1QVGR 5KFRA 1R8AA 2OPQA 2MQOA 1SJ3P 3M05A 5DETA 3OLBA 3KLHB 1U1MA 2G1DA 3L95X 2R2TA 4DFKA 4R0EA 5KFFA 3IAS9 4HLBA 2QE5A 1TVRB 2W8KA 4CTAA