6FD1A

7-fe ferredoxin from azotobacter vinelandii low temperature, 1.35 a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
b'AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7-FE FERREDOXIN I (FD1)
publication title Structure of Azotobacter vinelandii 7Fe ferredoxin at 1.35 A resolution and determination of the [Fe-S] bonds with 0.01 A accuracy.
pubmed doi rcsb
molecule tags Electron transport
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1997-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 6fd1A00
1Y4ZB 1C4CA 3OR1A 3MM6B 1IR0A 1Y5IB 3OR1B 1F5CA 7FD1A 2VPXB 2C3OA 3HKZD 2VPYB 4CI0B 1BWEA 3MM5A 2C3UA 2WAQD 1FRJA 3IR7B 3EGWB 2GMJA 3MM6A 3MM5B 1H0HB 1RGVA 1FRLA 3MM9A 3EXYA 3OR2A 5BYSA 1BC6A 1B0PA 3MM8A 3MM9B 3OR2B 4KT0C 3MMAA 1GTHA 1Y5NB 1K0TA 3MM8B 3IR5B 2IVFB 3MMAB 1FF2A 1BD6A 1JNRB 2C3PA 2WSCC 1FXRA 1Q16B 4DHVA 1G6BA 1HFEL 1FRHA 1DAXA 2FJDB 3MM7A 4XK8C 2FD2A 5E7OB 1GTEA 3MM7B 1GAOA 1Y5LB 1SJ1A 3C8YA 1AXQA 2FGOA 5FD1A 1ROFA 1FTCA 1FEHA 1PC5A 2C42A 1FXDA 4L6V3 4ID8A 2WB1D 4RKUC 2WSFC 2FJBB 4OV1A 3PNIA 3MMCA 1WTFA 2V2KA 1F5BA 2PA8D 3MMCB 5CH7B 4OMFG 2VPZB 2XSJB 2VPWB 5CHCB 2C3YA 1C4AA 4XDCA 4XDDA 1D3WA 1KQGB 1BQXA 5BYRA 1FCAA 2PMZD 1FERA 2PDAA 4YDDB 1FRXA 5BYQA 7FDRA 1FRIA 2C3MA 2FDNA 2VKRA 3MMBA 1H7WA 2V4JA 6FD1A 1CLFA 1PC4A 3LW5C 1JB0C 1B0TA 3MMBB 2V4JB 1A6LA 4Y28C 2WSEC 1FDAA 1SIWB 1B0VA 1H98A 2XSJA 6FDRA 1GT8A 1FRKA 1F2GA 1R27B 1FDNA 3EUNA 3IR6B 1VJWA 5L8RC 1G3OA 1IQZA 2ZVSA 1KEKA 1FRMA 1SIZA 1H7XA 1XERA 2FJAB 2GMHA 2UZAA 2Y0SD 1KQFB 1DURA 3GYXB 2FJEB 2Z8QA 1BLUA 2O01C 1DFDA 1JNZB 1FD2A 1FDBA 4AYBD 1FDDA
chains in the Genus database with same CATH superfamily
1AUSL 2HQIA 2DNZA 1U24A 1CJUB 1IXKA 3TO8A 2F3JA 4A46A 5KFJA 2MJNA 1ITPA 3BEGB 4MAKA 2JEJA 3W5ZA 3CJQA 4JI8F 1IWAA 1B0PA 5JMNA 5EX3A 2R42A 1IM6A 3MR6A 3CB4A 4IO1A 2Y9HA 4LRAA 3GFYA 2MB0B 2B4UA 5K5MA 1U2CA 1GXLA 1RLDA 2XM3A 1U7LA 4KTQA 2DGTA 2HNYB 4ID8A 4F7VA 2YKNB 3P96A 5M2UA 1Q81T 2V69A 3TVKA 1YJ9S 2V50A 4F4XA 3SBMA 3J80U 2R7WA 2OD4A 3MMCB 4ZVOB 1NPPA 1AFIA 1U1OA 3GCWP 2P2CB 2B7BB 1FJCA 3GWCA 3LP0A 1G2EA 4USMA 5BYQA 1MSWD 4B9NA 2HVIA 2DGOA 3TAPA 3BSAA 1XJWB 4TN2A 4JI6F 2ASLA 2W8LA 2YTCA 2MXYA 2YWEA 1XERA 4TLRA 1WWHA 2I9SA 4CZCA 1TV6B 4FYYB 3LALA 2HAFA 4FDFA 2VFVA 4CTAA 4FYVB 5J2QA 3E8OA 1ZAXA 2YX4A 2W4CA 5CYQB 4M5LA 1U6BA 2BKOA 5IWAF 4ZVGA 3QBCA 1S57A 4PQAA 4USVA 2WB4A 1S1VA 3J81Y 3KHRA 3VZIA 1X4BA 4G1QB 4DV0J 2Q66A 3WC2A 3O6QA 4Y3CA 2UUAF 2XB2D 3PEHA 3VGUA 4P2FA 4TXSA 2QEXS 3H5SA 3GQCA 2KM8B 1IKYB 4EMDA 4BC9A 2E1AA 4CYUB 2N7CA 4QWCA 2E9RX 4QR1A 3AQOA 4XIUA 1VQYA 2K06A 2M70A 3PEJA 1P9QC 1RUSA 3EZ5A 1DZ5A 2U1AA 2RQCA 1RT2B 2X1GA 1IBKJ 2YQ3A 3OJSA 4I2PA 1VR6A 3CCVS 4TU7A 1NPRA 2B56A 2GO9A 1HW8A 4KT0C 1H2TZ 1FFGB 3C46A 5IT4A 5AXMA 4ZPTR 3DMJB 5HMXA 2F63A 3GJTB 2C42A 2FYXA 3FCVA 2VZ9A 1DJ0A 3MTKA 1S9EA 3QMQA 3R7NB 3MAHA 1CC8A 1NZ8A 3GV7B 4DF4A 5IC6B 2CUYA 2D74B 5RUBA 1FX2A 1E6VA 3BJYA 2KVIA 2QE5A 3PW0A 4RO0A 1CBKA 2FY1A 4JV1A 1OY8A 1FK9B 1ZPWX 1S1UA 4ZJOA 1GNKA 1GH8A 3MCNA 1RYSA 4X4OA 2QRRA 3D6FB 2E5GA 1WEZA 4WYWA 1M0SA 3Q8YA 2FGCA 1FJ7A 3OTOF 2POKA 1RA7A 4FZVA 1IKWB 4NASA 1HWLA 4MIAA 3TARA 4FXDA 4KPCA 4Q8EA 4GC6A 5J2MB 3LA0A 3F56A 4FPIA 4JV5J 5HLFA 1VQ5S 3QLHB 4LR7A 5DM6Q 4K2JA 1RACB 1YKWA 2B3TB 2K1RB 3QIPB 2V67A 1YIJS 5EDWA 4JB8B 4YP3A 4ZCLA 4MK9A 1FVSA 4NLGA 3GV5B 1AB8A 2OEKA 5KT6A 4N76A 1TL7B 4OFZA 2HSEB 3MR5A 3VHQA 1LWEB 1S7HA 4WFYA 4AXIA 2DY1A 1R8AA 3KLGA 1RT1B 3FK4A 4J9UE 4JI2J 3T1HJ 5HBMA 4A8KA 2CJBA 1MU2B 2DNLA 3DLHA 3ISND 4DSJA 2XMAA 4QW9A 4F2RA 3OXFA 2G0IA 3UI3A 1RDRA 2FLLA 3KLFA 1NZAA 3B4MA 2C2ZB 4K8RA 1RP5A 1YWXA 3GR1A 5CZXA 1D9AA 4LF2A 5HMZA 1NKCA 1RAFB 4DSFA 1BQNB 1N5TA 5K14B 1YZ6A 1PJ6A 3KFWX 4USIA 5B0GA 5CABA 1HD1A 3K57A 3SQGA 2BE2B 2J76E 3CDWA 2MKJA 2DH7A 2HFOA 4F0KA 4YB6A 4NA1A 1C4AA 3EJMA 3T41A 2RDIA 2OPSA 2MZSA 3CDBA 5KFAA 3J80Y 2BOPA 5A76A 3FJ2A 3NCRA 2QIFA 1F60B 4OYMA 2RJZA 3M1VB 3LO3A 4LBHA 3EM1A 3M8ZA 3G4SS 2DIUA 2M9KA 2HFNA 3HPOA 1JLQA 2KH9A 2NXNA 3KK3A 3HO1A 4FS2A 2HHTA 5LJ5Y 1C4CA 3NKYA 1UEUA 4RBUA 2WVBA 2E1MC 1UVNA 1H0HB 4ZVPB 4ZVSB 1CPZA 2CPJA 5LXYA 1PSDA 1DHMA 1FF2A 2FIUA 1MLAA 1LV5A 1JK9B 1RQ0A 4B9MA 2QA4G 4DR3J 3CE8A 2CNNB 3KMQA 2GC8A 2I38A 3A3NB 1NRKA 5D0HA 1LWFA 1N34F 2W9BA 2EXUA 3PIPQ 2W2OP 2YNIB 4XDCA 2X3DA 1FCAA 1TUVA 2E7VA 2BANA 4DSKA 3DRRA 2CNOB 2VHGA 1X9SA 2NYIA 3TAMB 1RXOB 1D8ZA 4YY3F 1H98A 3ENVA 4EZ9A 4JI7F 4YN3B 5DS7A 3UD4P 1ZTWA 3P5TL 2O01C 1S9FA 3SIPB 2DR7A 1RT5A 4NCGB 4U6PA 1PYSB 4ICLA 3D67A 4QR2A 3CEDA 1LW2B 1H2VZ 1TELA 2WTFA 3V4IB 2MHEA 3MAAA 5KFWA 1HNXF 3HJFA 2PIIA 1EAYC 1X4CA 2PI4A 4ES1A 3UR3C 2ZM6J 2W9CA 4QW8A 3DOLA 4DV1F 5HJYA 2LDYA 2MJUA 5KFTA 3TJAA 1K9MT 3KJVA 1F2HA 4PPZA 2B9YA 2QTWA 1VC5A 5MLCV 3S1TA 4O4GB 3KHHA 2AT1B 4DR6F 2Z2MA 4L72B 3MI7X 2FVPA 2F8HA 3DCAA 2DEJA 3AJ1A 3N6NA 4WK1A 3M6WA 4OJGA 3DI6B 4HYKA 2F40A 5D4OA 1G3OA 4M63A 1MWYA 3PKMA 4X66F 4JV2A 3MM6A 3I0RB 3D9BA 4LQ9A 2BJ8A 4J90A 2OELA 4HACB 1VK3A 5KT7A 2BACA 2KVQE 1HI8A 4K4SA 1OQ6A 3RYLA 5LM7E 4LRCA 3BH6B 4NLRA 2YWWA 3D66A 4ANEA 1YTYA 2ZZNA 3CD7A 2BABA 4B9VA 5KFDA 3DOMB 3MPVA 5J1NA 2FVSA 3MECB 4RUHA 3D3CJ 3F41A 4YQWA 1RHJB 3HX9A 1TVRA 5J2PA 4L73A 3VQSA 4CLZA 3MUTP 2DO0A 1TL1A 2YKMB 5BYRA 1TL4A 3HT3A 3ZZ0A 3CCSS 4K4WA 2CQGA 1ZH5A 3NGRA 4QOTA 4OYZA 3K5LA 4I6AA 2GCFA 4QIFA 3HHLB 4CM0A 3DHXA 1HBNA 2L9NA 1WHXA 2C1EB 2F4VJ 5DG8A 3FNNA 1VCTA 3NGUA 5BXIA 3E01A 1NJYA 3HHEA 3RGIA 2RU9A 2HBRB 5JVGQ 1U8SA 3FBEA 1GFWB 1S76D 4QU7A 2MZTA 1N8RT 4IFYB 2L9DA 4QYRA 5HLFB 2CQ0A 2CDRB 2RB7A 4ZVUB 4OYXA 2CPEA 2YNFB 3SXLA 2XLIA 4B02A 1PBAA 2M7SA 3DRPA 2IBOA 3HHKA 3IG1B 2CPZA 2HS0A 1XMOJ 1U1NA 2DGUA 5LOQA 2E7XA 2Y8YA 1A0OB 2ACYA 4KGZB 1HHTP 3BGUA 2WB1D 5DLFA 3KYLA 4IOAQ 3GE9A 4YUDA 2AD9A 4KGVB 3DLGB 3BQ0A 2HGLA 1XNQF 3G86A 1W26A 2GAHC 3SMZA 4P73A 5IZHA 4UTGA 3MURP 4IOCQ 1X0PA 4DDFA 3G9CA 4KYZA 2JJ4D 2I8EA 3WZ0A 5KG7A 1WHWA 4UUXA 4DV0F 1U45A 3UCUP 4NYZA 4Q8FA 4WCEQ 2AV5A 2KL8A 3POTB 3KLFB 3I6PA 4TY8B 1RT6B 3MPDA 4ZPDA 1S59A 4ID5B 3JQKA 2K2PA 2NPIA 1VQNS 1IR0A 2HNZB 2KRRA 5HVGA 2WAQD 3V4MA 2HHWA 4M5IA 2XQCA 3GG1A 3PHTA 5K9FA 5KFIA 2QFIA 3HP6A 2UUCF 2HRYA 1YITS 2EFOA 4L76A 1BUXA 2YNGB 3BR8A 1IBKF 1MNEA 4MKAA 1R8PA 2RVJA 2FLNA 3RJMB 3FEXB 2DR8A 4PUOA 3D6MB 1S9GB 3R2DJ 3RR7A 2XMUA 3QAUA 2HFSA 2CVIA 3IM8A 1TU0B 1OYDA 5KG1A 2CRLA 2PSZA 1T05A 2AJ1A 2Y1LB 1L3UA 1R8BA 3AQPA 2GIQA 4LF9F 3I5CA 2YKPA 2R9LA 1R8CA 1U2RA 3V6DB 1E6YB 2AJ4A 1KOHA 4JI5J 2ZOMA 4YOEA 3HD2A 3CULA 3C6TB 1QVGR 4QIVA 4IKAA 1SUQA 5HROA 4OX7A 3NCPA 3KG4A 5D3GA 2ZHBA 4DX6A 3MEDA 4JBCA 3N28A 4WXWA 3ILOA 1HQUB 2QA2A 3K59A 4LSLA 3KMSA 1U02A 4DX7A 2V4RA 2ZFHA 2ZJPQ 2V6AA 2Y1JA 2V8HA 4DBQA 2AJ2A 1U1MA 5A0YB 2DH8A 3K5OA 4Y2MA 4OV6A 2AIRB 2ZITA 1HYSA 2MQQA 2HRTA 1U6FA 3T3FA 1FKOB 3JB9k 2HIYA 2ZC3A 3KDNA 1NJIT 1DY3A 3S8SA 3DGVA 1REGX 1RTDB 4JV5F 3I4HX 3KG1A 4I6YA 4LVNP 2JLGA 4JP8A 3D1OA 4IO9Q 5HAOA 4YMEA 5DDPC 4KV8B 4C0BA 3CMAS 3TVZA 3JXOA 1SV5B 3PFEA 3CCJS 4N41A 3VZHA 4MTPA 2ALYB 4ES2A 2RDJA 1P8GA 4AFFA 5DGAA 3BR9A 1LFWA 3MAAB 4AYBD 3OR1A 4ECUA 1PAEX 3NLCA 1VBKA 3IBCB 5K20B 4LRDA 4JI2F 1RHKB 4OHWA 3T1HF 2AEMA 1KONA 2E9TA 4IDKA 4CQ1A 1V9OA 2RQMA 1PILA 4K59A 4HKQA 4I1TA 1SKRA 4Y00A 3OSNA 2DNHA 3R1HA 1UMJA 4WE1A 2M8DB 2XHWA 4OJHA 1XNRF 2CJAA 1V3SA 1Q7LB 4WU3A 4ATNA 5AE1A 2AEFA 3FEZA 2L9WA 1JB0C 3BGLA 4F4WA 1OS5A 3GSDA 4DL5A 2OSQA 1F2GA 2B9WA 1XEZA 2CPDA 2ASYA 3PYDA 5LMNF 2WW8A 4KIAA 2IM0A 3ITHA 1JXVA 2NQPA 5B7WA 3I9ZA 2QA1A 5GAGU 2VOPA 3BPSP 3IFEA 2H65B 3C16B 3JQMA 3M7VA 1RJJA 1VRUA 3LUYA 3BDPA 2YH1A 1JLCA 5CYMA 1U25A 1LQ9A 2R4FA 1EP4B 2YPZA 1U1RA 3G82A 4AUKA 1AXQA 4J9LA 2ZD1B 3GB0A 3DRXA 5EX0A 1T9TA 4QQBA 4DV6J 2B6AB 1Q5VA 3R5GA 5H9EJ 1KWMA 1HNVB 2XS2A 1HWKA 1UA0A 1TKZB 5CH7B 3CPWR 1WG5A 2HHUA 2LEBA 3OTDA 1SVDA 3W2VA 1NM2A 4DR3F 4I67A 2DXDA 2I6WA 1SJ4P 3MMBB 3BM7A 3F0NA 3TA2A 5AT1B 4ZS6A 5GAGI 3LGNA 1K8AT 1UL3A 3UVJA 4IG3A 4B3MJ 4OZ3A 2PFFB 5L1KA 1UVKA 1P27B 1RT7A 2VDHA 1NK4A 1WC6A 2MY7A 3VWSA 2J6SA 3FGVA 2GMJA 1J5OA 2RHQB 4JI3J 4TLQA 4DFJA 3JSMA 3R3TA 2AJQA 3SSSA 2UV8A 3CJ5A 4P2XA 1BE4A 1HA1A 5C7PA 5B0DA 1I6JA 1KLMA 3VAMA 2J0QD 2BKNA 4A8MP 3KJNB 4GO7X 2ABYA 2P9GA 2KJVA 3IO1A 3R9LA 2IRUA 3MEKA 3GR0A 3VTIA 4P52A 2JLEA 5EN1A 2BMBA 3PYFA 1LW0A 4KH1B 4NLQA 2KU7A 3R7SB 5D8HB 4LSZB 2WSEC 5J2NA 4J9MA 4ZVEA 2UXDJ 4ZP7A 4DV4J 4DUYJ 2WONB 2RHSB 2HAIA 4I2QB 2D1CA 3L9ZA 5GMEA 1UPMB 4JV0A 4ECXA 3EXCX 1ZOTA 1TFYA 2HHQA 1I51B 3L95X 1S79A 4KO0A 4DUZJ 1JKHB 1FRLA 2B5JA 4UOGA 2EFGA 5D4NA 1FESA 2RRNA 1U48A 1YRXA 3MEGA 4MFBB 1R3NA 4NXMJ 2DNQA 2JX2A 3EDRB 2KG0A 3EE3A 3LF0A 1R0AB 5M2PA 3D0IE 1RA6A 3CJKB 1H72C 2GNKA 2AZ1A 2NS1B 1N88A 4MT1A 3HSJA 3CJTA 2D7SA 2R2SA 2YNHA 2XMJA 4PWDA 2RKIB 1RSCA 3N0VA 2BRLA 1PO6A 2E5LJ 5FIIA 1Q8LA 4ZOSA 1VJWA 3W9HA 3OPKA 1GMUA 2BQ3A 3MFIA 3M8PB 1KS2A 3W5XA 2NSBA 1BLUA 4C4WA 2MY8A 3PJWA 4C97A 4C8ZA 2HWTA 3DDIA 4UF4A 2XLJA 3D0HE 3OXGA 3MUVP 5CD4A 2EI5A 3HKZD 3PRVA 2HZAA 1CSJA 3QGPA 2LU2A 2F4VF 1KQKA 2VA3A 4WFXA 3MPUB 1X4AA 1Y5NB 1FHTA 3NY0A 3V81B 2FC9A 1VRTB 3S7RA 2MLYA 4O23A 5A8WB 2AEJA 3JYTB 1JLFA 4OL8A 1P1TA 3ZTSA 1FEEA 4U96A 3P6YC 2MGZB 4RBTA 4Y0FA 1BMQB 1U8WA 4B3SJ 4NRUA 3NMAA 1F5BA 2WBRA 2LVWA 1KC8T 1QUVA 4OMFG 2GGPB 2J0SD 2EG2A 3FBCA 2I0XA 3UCGA 2DR6A 1XMOF 4FKYA 3HM9A 1OMSA 4R0JA 4CO3A 4BC7A 4C98A 2CQIA 4F04B 4E0DA 1YQHA 2DGXA 4LFBF 3UFCX 2DHXA 1FDNA 1U0SA 1HPZA 3PG9A 1HWUA 1W25A 3PX4A 2Y0SD 1D9DA 4ED6A 2QLFB 2DPIA 3L4BC 2K7KA 2BJ7A 3QT7A 1ELOA 3ILJA 2R8GA 4B3OB 1WHYA 5A2QU 3HVTB 4M5KA 1WACA 5A8KB 1YX2A 1N6QB 3W65A 3DLJA 4X4QA 1X5TA 1NJXA 2DRBA 1S6UA 2MYFA 1SH2A 4OZ2A 2ZH2A 3U27A 4EK2A 1T3OA 2R8HA 5IM0A 5DDQC 2XZDB 2HS3A 3NWGA 1UWAA 1RWNB 2DNKA 3PV8A 3UNGC 1NSKL 2BOAA 1C1CA 2DTJA 3OL6A 3RUBL 2RQKA 2RE1A 1WC0A 2BZ2A 4OJ1A 2OPPA 3K89A 3CCLS 4AQYF 1LXJA 1U1LA 2JLFA 3D2WA 2EG1A 1JLEA 3W2WA 1N33J 5THWA 1RAGB 1OWXA 2RS2A 4FF2A 2P9EA 1FRIA 2HZCA 4O44B 5IC4B 5ETKA 1RT4B 3SSQA 1S1TA 2BXJA 2FVCA 1HBMB 1R27B 2E7WA 1VYAA 1RWUA 3EGVA 2DXFA 3DRSB 4CT9A 5DETA 2A6MA 1JLGA 3Q0AA 1RADB 3PO4A 1QTNB 2W4PA 5D4PA 1FNOA 2HFZA 3HF5A 1DTQB 3CJ0A 3BGFA 4HLBA 1WC3A 2DRAA 4ZDNA 1H2UX 1R0BG 5L9XA 3KJFB 3C15A 3ETOA 2WOMA 2OFHX 2MDAA 5LL6d 2VQFJ 1WI6A 4GO5X 4C11A 2VC1A 4I0WA 5AXKA 2W2MP 4H54A 5KFRA 4ZJQA 2RF2A 2KZZA 1WTFA 2B7CB 3FCWA 1RAIB 2Q1LA 3D6TB 1UFLA 4MMOA 2GVZA 2O1PA 3R27A 1WC1A 2HVDA 4MKYA 3GSIA 3TUIC 2MQPA 4OYWA 3T5LA 1GQEA 4ECWA 3OVAA 2VBWA 2CJYB 4J9SA 1J5OB 3EVMA 3GIKA 2F7VA 3I0SA 1REVB 2J8SA 4ER8A 1LEOA 1S1WA 3NBPA 3H2LA 3HFVA 1BWEA 3MPYA 1ACMB 1XR7A 3HD1A 1S7IA 5KFEA 3D3BJ 3MR3A 2PC6A 3HSGA 4C8YA 3VR1A 3P8BB 4DL7A 2C3PA 4M5HA 4KFBB 4YR3A 1XWLA 3T5KA 3HHDA 4C3LA 2FGOA 3M05A 1S4EA 1VQ8S 4RJVA 2ROEA 2CPFA 4R5PA 3UO0A 5LJ3Y 3N6LA 1YJUA 4YB7A 1OY9A 1HBOB 1FE4A 3Q8UA 1UEKA 1WOSA 1PJ5A 2JVRA 2ZJQQ 3CCWA 1KD1T 1HWJA 4Y28C 2OJ3A 2BKPA 5F8NA 4AL5A 3QRQA 4DV5J 1RWOB 2CQDA 1NMEB 1YBUA 4FYDA 3CMQA 5KFFA 4F2SA 5HQMA 3DM2B 4ECSA 2XY5A 3C3LA 3W64A 1NSAA 1NUEA 2MMYA 2ZHAA 3M2VB 1DARA 4F3MA 2VPYB 3H2UB 4DQIA 4I4BA 1YZ7A 3M6XA 2BEFA 2WHOA 2ZNYA 4TY9A 4URSA 1SQEA 4IFVA 1CS4A 5DO2A 2NXEA 3KOAA 4LF5J 4B9LA 3SDEB 2HHSA 1Q82T 5I3PA 5C24B 1Y5LB 3C8YA 3TAQA 3FSXA 3QWUA 5B0EA 3FBFA 1O0PA 2VL1A 3CF5Q 1LKZA 3MHYA 2PA8D 2PT0A 3KLIB 4PQUB 2AJ0A 2OFGX 4UOHA 2QSWA 4OX9J 3VV2B 3A4TA 3AH6A 3CJRA 5G4DA 3D4JA 4RBVA 4DV6F 3Q24A 2KT5A 1HMVA 3AD8C 2A2DA 3J7AN 3R6LB 1H7XA 5SUHA 2CQ1A 3EMTA 2X3GA 1YJNS 2QA4S 1U1KA 4N7TA 1Z2ZA 1F5CA 7FD1A 1CVJA 3G96A 2VFUA 5A2QY 4X64J 5HQLA 3OR2A 4A4JA 3I4PA 4B3MF 3RAXA 3DLEA 4GVBB 1TAQA 2W24A 5B08A 2OI2A 5FDLB 1EETB 1S12A 4OZLA 1M5OC 4AT1B 2ZWOA 3TRGA 3IXQA 3KG0A 3QATA 4X62J 4NLTA 1S48A 3QGIA 3GMGA 4G65A 2DNPA 2FJBB 3LWMA 4J91A 1WDTA 1S0VA 5G0RA 2XULA 2Q43A 3AXKA 4OYPA 2IDEA 3TP2A 2VBZA 3ENQA 4IG0B 1HPZB 2G2ZA 1FE0A 4N56A 1JXLA 3ZZPA 1YJVA 1VHIA 4RW8A 3NNAA 4ECRA 4NZ0A 3TYTA 2XEXA 1WOPA 1J27A 2LXFA 2QLXA 1VS3A 3GYGA 2G4BA 1Z2LA 3PCOB 5JJBA 4A8YA 4DI6A 2BW7A 4PRFA 5IM0B 2G2OA 1NJZA 1N0UA 1HNIA 2Z0GA 4G1PA 4NLXA 2X1AA 3NWRA 3GILA 1WSVA 2LLZA 3QRPA 5K8NA 1UCNA 1QTMA 5ETNA 1GXTA 2PFDA 4OI3A 2UXDF 3TQEA 3MM9A 4PWWA 4DV4F 3OFFA 4ZN1A 1RT3B 2PD1A 1UW4A 1VQ9S 2H4YB 3M30B 5KFLA 4TU8A 3J7A1 2CFXA 3T6JA 3AODA 1N5YA 5T7LA 1QAJA 1SJ3P 3BF4A 3GV8B 1IVZA 2RSQA 4B08A 2WBMA 3AOBA 4NE9C 2GHPA 2Z58B 5LT5A 4NXMF 4DX8H 2EFNA 3PRDA 5AE2A 2B8QA 2LECA 2ZE2B 2Y0BB 3O5TB 2KFNA 2PN6A 2XO6A 4GKJJ 1TR0A 4WPAA 3RB4A 2FJEB 4OLPA 4PWUA 3OUYB 1FD2A 2ZZMA 1CJUA 1YRTA 1NB2A 1RZMA 3GU0A 3THVA 4JI0J 2LQBA 4L3NA 1NDPA 1UA1A 1UVLA 3W61A 4YR2A 2Y8WA 2E5LF 1RGVA 3R97A 3L7OA 5H9EK 2BW2A 2YWHA 4EBDA 2RQ4A 3UNYA 3MFHA 1UTAA 4ZLJA 2ZH6A 1X7VA 2OPRB 3H8YA 4OZJA 1NJWA 2HNYA 2JC0A 2YKNA 4ERDA 2Y1RI 3PW4A 4DPTA 3EZUA 4LR9A 4OX6A 2EVZA 2HK2A 3ADAC 4I6WA 3MMCA 3TJ9A 1KHVA 4U8YA 3AA8A 2N3LA 4ECTA 2FZCB 3BREA 3CVKA 3VAGA 1UEVA 3PY8A 1XBWA 2E5JA 1S6PB 5AXNA 3HDSA 3UCZP 2DT9A 1WF0A 1NKBA 4LIRA 4WP9A 1C1BA 5F9LA 4X4UA 2D69A 2WZ1A 2UXCJ 1TV6A 3FFIB 1GMWA 5KT3A 3M8YA 2MKHA 1Q53A 4NX9A 2VPXB 5L39A 5KG4A 2J8AA 3PW2A 3LOUA 4JYAJ 4J9QA 4ZVQB 5CYQA 2A2CA 1FWLA 3R7BB 2OMOA 3MMJA 2BJDA 1WEXA 4U9RA 1YGYA 2VD3A 4P75A 4C8LA 4K0KJ 1KNZA 3QZ7A 4EYHB 3OFHA 1LK7A 3HHNB 4G1QA 4RU2A 4PG5A 3I87A 2KDOA 3VAHA 3N6MA 8ATCB 4CIOA 1NK7A 4V1Ak 4DV3J 3K5NA 4FYXB 4WP8A 3ZZYA 3EPGA 4Q0BB 4DR4J 4MIBA 3H0PA 1IKYA 4C3MA 4WIQA 4F3OA 2MPUA 3CSKA 3KK1B 4HT7A 2HGMA 2MLXA 2AGPA 4CYUA 4J9VA 4ELUA 1N33F 4D3GA 4CT8A 2G1HA 1R8HA 2A0FB 4DL2A 1T0TV 4WKRA 3C14B 1JQGA 1RT2A 3AD9C 2R2UA 1B3TA 2HFUA 4UOFA 2ATCB 1S1XB 3Q89A 2IM2A 2MSSA 2VQEJ 2KM8C 4DV2F 4ZLPA 2AQ4A 2Q6CA 2E1PA 1NAQA 1RWVB 3W9JA 3WX4A 2HQGA 4S0MA 4EU0A 2KTQA 5DZ6A 2AU0A 2MKYA 1UAWA 4YR0A 4PG8A 3DMJA 5KG5A 2B43A 2CJXB 4WFBQ 2DGWA 4Y2CA 2OTJS 1CQMA 1UWBB 4DFMA 2CZ4A 3C6UB 1GX6A 1C0UB 3IGVA 4RW9B 1RTIB 1WKJA 4PAAA 3DYAA 4YHHJ 2VQFF 2AYGA 2IM1A 4K4ZA 2OD6A 3N9UC 1BHNA 1FK9A 3HZEA 2RS8A 3QPIA 1XIQA 1B7YB 1KSPA 1LWCB 3BKUA 3F44A 3UN5A 2BUNA 3V5RA 2R8IA 5GAHU 2VOOA 4U7CA 1FDBA 1Q1KA 3NGSA 4PR6A 3Q83A 1PYTA 3G6YA 4UOCA 5HVFA 2HLUA 4KR0B 4HTJA 2GO8A 2XMKA 2KZMA 1IKWA 4PXBA 2ILZA 4LF4J 2XCPA 4W98A 2ROGA 1WJ9A 3QT5A 5J2MA 3K5MA 1QE1B 3GPAA 2J7WA 2DCUB 4P9SA 3QT8A 3QLHA 5C2GA 2DR9A 3OD2A 3TEHB 1TKXB 3P5BP 2K1RA 3QIPA 4QIWD 2V2QA 1U1PA 4M5NA 4QJVA 5HANA 3LAMA 2E66A 2ZH7A 1HNXJ 3MEEB 1URNA 1TL7A 5IS2A 3W62A 3GFXA 3BS9A 1LWEA 1IWGA 1U1QA 1TK0A 1RT1A 2WCXA 3OFEA 5GAHI 4DV1J 2W9AA 3W1YC 3M4XA 2MKSA 3PO5A 3H59A 1SKSA 1MU2A 1VK8A 4DR5F 2JC1A 4RNOA 2IBKA 4FVMA 2QN6B 3DGPB 1F1BB 4CDIA 2RH3A 2IDLA 4GKKJ 1S97A 4DV5F 3PKYA 2A6OA 3UWTA 3MM5B 4RPFA 4ZVTB 5A6PA 1BQNA 1KVKA 1QJHA 5K14A 3LGMA 1JLBB 3U1MA 3ZZZA 4OHYA 4HTIA 4QR0A 4IUFA 4EO6A 2NLWA 3H25A 2BE2A 1JWWA 5DDRC 1Y11A 1GAOA 1U49A 2FJXA 3EPIA 2KB2A 3LAKA 4L6V3 2VB6A 4H4MB 1SC3B 1P9YA 4DPXA 4XTTA 2QMUB 4AD6A 4M5DB 2R7VA 5ETPA 3HFZB 3FQKA 4LF5F 3KUHA 3AJ2A 4K7QA 2YVSA 4CLUA 4Q2MA 3CCUS 3M1VA 1PCAA 4USHA 4NCAA 1B0VA 2XSJA 3O3LA 3IR6B 4F50A 4N8OA 2ZUAA 3ZTRA 3CW2C 1IJFB 2HQCA 2WVDA 2HHHJ 4OX9F 4YEAA 2RNEA 4RX6A 3SI8A 4ZKAA 3SV3A 4L74A 4NMLA 1HNZJ 3VAKA 5KFVA 2Z2ZA 3VAJA 4LSNB 3RRKA 3BGOP 4MH8A 2L48A 2WRMA 3EZOA 1RHRB 1H74A 3MMAB 5ITHA 2D3UA 1HL6A 2COLA 4K4XA 3OJUA 2H3EB 2UUWA 4BCAA 3DLKB 3VCDA 5F3ZA 4X64F 4RL1A 1N32J 2YNIA 2LQ5A 2N3OA 2PEBA 3QT6A 1N5QA 1C1BB 1ZM4A 4DQRA 4LT6A 2X1FA 2B0GA 3NG8A 4TNOA 2H1YA 5E2QA 3OTCA 2MKIA 4X62F 3TAMA 3CIZA 2GW8A 4KB7A 4OI2A 2J7UA 2M52A 1WHVA 3M2RB 2P8IA 4U95A 5T41A 4NZ6A 5J1EB 3KK2B 2CG4A 4FBTA 2IJRA 4NCGA 5KG0A 1XNQJ 3JTNA 3ZZRA 2UVRA 3GCXP 1S6QB 1JJ2R 1LW2A 3V4IA 1PYOB 3QGHA 1X5PA 1RWPB 2ADBA 1RWKB 2I5JB 3MM8B 4IQMA 3B8HA 3T6BA 3CCMS 3NOGA 1G1XA 2J0XA 4DMZA 3BGRA 2V4QA 4FF4A 2QX0A 3KJQB 2QL7B 3ISZA 4X2BA 2IC3B 2XY6A 3VF0B 1YHQS 3SZ2A 1IN0A 5I42B 1RK8A 1HQEB 1VIXA 1SB6A 2BE7D 4OHVA 1RHQB 3L09A 4O4GA 1WKKA 2DVIA 4Y2KA 2AKWB 1ZZNA 2UUCJ 1PC4A 3TANA 4W4MA 4MJKA 3DI6A 2EKNA 4B9TA 1TP7A 4RW4B 1JLAB 2VICA 1PGZA 5CQGA 3I0RA 2XMWA 4J9NA 3PJXA 5KFCA 4HACA 4QU6A 4EO8A 4E98A 1FFSB 2CPXA 2M3DA 3Q8RB 4GKJF 3UDEA 3VVUA 2IAJB 3ULHA 1Q86T 4LF9J 3US5A 3DOMA 3M32B 1PG5B 2G2YA 3DYAB 4JI0F 1XQIA 3ZXWA 1IR2A 2E44A 3MECA 2JEIA 3J7YU 4DS4A 2ZH5A 1WSRA 3DRYA 4EZ6A 4RKUC 4DR2J 1SC6A 2YKMA 1VOMA 3CCTA 5HK4A 2YQ0A 2DGVA 1UJ5A 4FNHA 4QCLA 2UU9F 5I3UB 5AE3A 4AL6A 2V4JB 3HHLA 2EFPA 1SIZA 1NK0A 1TKDA 5F8HA 2ZBCA 1YJRA 2V8VA 4QBUA 4IFYA 2JFDA 2XTJP 3ETMA 1VGYA 2D9OA 2YNFA 4PXCA 3HHLC 2R7SA 4CO5A 4YFUA 2HMIB 1BC6A 3HJVA 1FO1A 4Z7CA 3LP2B 1I3OB 2UXCF 3J7YI 3IG1A 5DJBA 2YXLA 1YRUA 2AGOA 1L3KA 2NZCA 2VG7B 1OO0B 2LCWA 3KUGA 4DPWA 1RAAB 2YBVA 3IS9A 4JYAF 3MZIA 3RW6A 3FZBA 3DLGA 3A3PB 5K8PA 3OLBA 2CIMA 2R7TA 2HVEA 1RE1B 5A8RB 4TKTA 4K0KF 4EI2A 2VU5A 2FLOA 2XMVA 2OIHA 2ZKUA 6FDRA 3POTA 4MKBA 4TY8A 1RT6A 1IJEB 4DV3F 1DRZA 4ID5A 5C5JA 4HL9A 1XNRJ 4UUWA 4DR4F 2DBBA 3SV4A 2HNZA 3M2UB 1M5KC 2I2YA 3FEYB 1N0VC 4OI4A 2JNJA 4ZPVR 1OQ3A 2QFJA 4H4KC 3D28A 2UUBJ 2X51A 3C66A 2CQPA 2YNGA 3SCJE 1FRHA 5LMNJ 1X4FA 2GJFA 2OLWA 3H7HB 2CAJA 3NAIA 2D41A 2VQEF 3OL7A 1FI4A 4DLEA 2QLWA 3HCXA 1S9GA 3NRBA 2J9CA 5B0BA 2CPIA 5IT0A 3ZTPA 3KLHB 2XSJB 4ZCMA 2OEMA 1YVFA 4A8XA 1AA1B 3RBZA 3H4DA 1NLKL 1OPZA 4LBIA 3M6UA 3PR5B 2FHJA 2BVZA 3VQTA 3WQPA 4P2MA 1IR1A 3V6DA 2DB1A 3UN2A 1E6YA 2KT3A 1Q8IA 3T5JA 2GMHA 2J6UA 2G13A 3TZZA 4YHHF 5F0UA 5MAOA 5EUHA 1QUPA 2OPQB 2A3JA 3C6TA 4KE5A 1FDDA 1IBLJ 1N5SA 2XLKA 2B9EA 2J0WA 1EIYB 3THTA 1HQUA 3MXHP 2C3UA 3FVYA 3QJLA 4RUBA 1X5SA 1TKTB 2Y1IA 1WF2A 2JHEA 2UV8G 3I5BA 1T3NA 1BD6A 1U0HB 1Q8BA 2XYGB 5A0YA 4DLGA 3OHAA 5L38A 4KY3A 2VONA 3W66A 3NL0A 5GADU 4ITSA 4DN9A 2CQ3A 1FKOA 1T95A 4OX8A 4ED8A 3OSPA 4LF4F 2KRBA 1N52B 2CJQA 1NHVA 1WC4A 4LFCJ 2NXJA 1F3VA 1RTDA 2V9WA 3W8PA 1L3SA 1KVJA 1RTZA 1KTVA 1SJFA 1H7WA 3LW5C 4KV8A 3QO9B 1EHWA 1SV5A 4OZ1A 3IAM9 2B4VA 3EUNA 4RW7B 5KFBA 2ZVSA 2UZAA 3FCHA 2DKOB 1Y4ZB 1J5EJ 2HWHA 3PFOA 4K50A 2NUHA 4DL6A 2RUGA 1X4GA 3OBIA 3BGRB 2GHWA 3AA9A 3CJ2A 3PXGa 4USWA 1LOUA 3TR5A 5ETVA 3ET6A 2O5DA 3GZ7A 3BN7A 2YKAA 4WXOA 4Q5VA 3TUZC 2CYYA 3H40A 4GKKF 1SL2A 4BWMA 2VJVA 5IT9U 3RRGA 4ELVA 4GMKA 4M5MA 3EDQB 1ZA1B 6FD1A 4ECQA 1H38A 2FHMA 1O8BA 4RW6B 3FUYA 5IOLA 3IRXA 5DM7Q 1RTHB 4ELTA 3DN9A 4F4ZA 3TVYA 1X9WA 2XS5A 4E2FB 3P4UB 5D0EA 3TNVA 3NNCA 2VC0A 2DGSA 1UP1A 3C16A 3OLAA 4DQSA 1KFDA 4CNZA 1N54B 4ILMA 3EGWB 3UW1A 3K0JA 4LRBA 2HHHF 3IA0A 4NLYA 2FHOB 1PKUA 1EP4A 2DY9A 2XBPA 4DQPA 3BH7B 4XK8C 2ZD1A 1LXNA 2RAQA 5KFOA 2CZVC 2B6AA 3UD3P 4C9DA 1W2BR 4ZLLA 1HNZF 3ILLA 1HNVA 3Q22A 3ZTQA 5H1SV 1TKZA 1T02A 2LYVA 3RRHA 2AYBA 2AYMA 1FXLA 4ECZA 1C0TB 2ZEJA 4DR1J 4IRDA 2HNDB 4KHPJ 4K5RA 1SBRA 3MMBA 3DLLQ 4ZHRB 2BYCA 1MMLA 2HQ3A 4F26A 3ENAA 2Q79A 5L9NA 4HEA9 3DLBA 1N32F 2A1BA 2YKOA 1DURA 5ETRA 4DL4A 4RU9A 3N01A 4F02A 1ZAWA 2V0NA 3N79A 2DNOA 4ED3A 3DFEA 2XYHB 1FD8A 4WTYA 1NO8A 2DGQA 2L08A 4LFBJ 3IS9B 2DXEA 4LIWA 1S0OA 1GXUA 2IIHA 3DHWC 1I94J 4EEYA 3GIJA 3ZNJ1 2HLTA 2EFQA 5FD1A 1PC5A 4Y34A 2IFXA 3M8WA 2PGCA 1JJ4A 1D0EA 4CCHA 2HGNA 1BQXA 3KDOA 2XHCA 1XMBA 3G6VA 4IRKA 2GIFA 3NCQA 1NK5A 4NLVA 1SQGA 2AF6A 2V2VA 4DPUA 3BV8A 2ZH4A 2R3VA 4ZITA 4KRWA 1QAIA 1T7PA 5BR8J 4AQYJ 1WELA 5CZVA 2WONA 4CRJA 1X8DA 4DUTA 3V6JA 4I2QA 2DPJA 1TFWA 1HI1A 2HBYB 3A8IA 1WUUA 2HQDA 1YBAA 2MLZA 1CC7A 3T9NA 2XGQA 6AT1B 4M5JA 1SQFA 1TL3B 1JKHA 3HSDA 5KG2A 1NDKA 3A8EA 4MFBA 2H54B 2V68A 1UVIA 4Y2IA 1SH0A 5AXLA 1CJKB 5D0RA 1R0AA 4M8LA 3P45B 1WOOA 3AHPA 1YI2S 3CJKA 4URGA 3M9MB 3TEGA 3MUMP 4PABA 1WG1A 2N7YA 3RZAA 4RLEA 1S6OA 4O3SA 4KGMA 3CWJA 2VPZB 2CJKA 1DLOB 4NLSA 4LF6J 4ZPBA 2RKIA 2C3MA 2P6TA 1S99A 5D0GA 1MN9A 3VGVA 1HQ2A 3I96A 4DF8A 1CEZA 2H48B 1GT8A 4DR2F 2AMCB 1HHQA 1FKPB 5L8RC 3M8PA 4FP9A 3FC9A 2IPOB 2IYGA 2ZVIA 2E5HA 3BZQA 1Q78A 3IR7B 2M4MA 1U2FA 1CJVB 2KYXA 2R8JA 2V2ZA 4DWIA 2W7PA 4KKOB 2YWKA 2VFRA 4WU2A 1HNWJ 4ZP8A 2HZVA 3IRWP 3GP9A 2DCLA 3K58A 2JH3A 1TMMA 1EQ0A 4A8SA 3V81A 1VRTA 2EWHA 2IVFB 2G0CA 1GK8A 2WSCC 5KFKA 4ZN3A 5A8WA 5DG7A 1RAHB 1HBUA 1HFEL 3JYTA 4QPXA 5DQHA 3JTOA 2CA9A 5HJXA 2JFKA 2ZBIA 4BHQA 2MGZA 2ROPA 1BGXT 1JIHA 1YK9A 3T1YJ 3E51A 2O67A 2C2EA 1RAJA 2GGPA 2DITA 2HBQB 2HYIB 4DG1B 4F4KA 3LTOA 2BA9A 3ICLA 3OHBA 5F3TA 4NZ7A 5KFNA 2E1CA 2F8MA 2VKRA 5J1PA 5IT9Y 1XR5A 3CDAA 4J9KA 2H5JB 1T03B 3K7RA 1SC4B 4WFZA 3OW2R 1O51A 4C6AA 1YG0A 4NOHA 1WKLA 2SXLA 2RIJA 1M5VC 2X7IA 4B3OA 2FUG9 3ET6B 3HVTA 4NLOA 5A8KA 2W4DA 1DTTB 4L3KA 3R5JB 1N6QA 2L3MA 1APSA 3RAMA 2OO4A 2ERRA 3RTVA 2GIRA 2J7KA 2W2PP 1RTJB 1VQ6S 4QYZJ 1UPPA 3EXYA 2ASJA 2MKCA 2JEGA 2ZH8A 5C42B 1T9YA 2Z56B 1FXRA 1Q16B 3BQ2A 4CO0A 2CADA 4URQU 1KDNA 3MM7B 4KGKA 1B7FA 3A8KA 4P6QA 2UXBJ 1G7CB 5HP1B 3JS9A 5LSRA 2XSFA 4LJMA 2KYZA 3IRXB 4TYBA 4G3IA 2UUBF 2VJUA 4YDDB 2FDNA 4O44A 2VODA 3U1NA 4R8UB 1RT4A 5F8IA 4ZVRB 3IP0A 2GJIA 1RKJA 1HBMA 3AOAA 5E3AA 3DRSA 5IV4A 3B6BA 4I7FB 1AFJA 4FYWB 1B70B 1HKAA 2Z8QA 3R1LA 2GQ2A 4X4VA 2I1RA 1DTQA 4Q45A 1IKXB 1OJ4A 2QLBB 3MCMA 2YH0A 3IWXA 2PI5A 3LH2S 4H4OB 3PYGA 1T9VA 2KT2A 1R6YA 5KG3A 2VDIA 2BRKA 1Y9OA 3U02A 1IBLF 3QNWB 2F9JA 3N5FA 1AW0A 1VQKS 1SJRA 3AOCA 4XPEA 4F0HA 1MN7A 1IBCB 4NI2B 1TUWA 2GVDB 1VC6A 1RBAA 5KFGA 3I9V9 4JI1F 2CQCA 1SL1A 1KQGB 4V19J 4IOBA 3TJ8A 5E33A 4PXEA 3D7SB 2DNRA 4ZPWR 3MR7A 3IWNC 3OL9A 2ZJRQ 4Q44A 1DQAA 4LFCF 1JXEA 4F25A 3SEOA 2FC8A 1CJTB 1REVA 2FPHX 4I69A 3IM9A 2WVCA 4DPOA 3DXSX 4UY8T 1WEYA 2HWIA 1AYEA 2LEPA 2ZWPA 2AJFE 1NSQA 2X1BA 3PIOQ 1HD0A 5B0AA 3SCIE 4X4TA 3CT9A 4A48A 4ZIWA 3GONA 3PDNA 4KFBA 1J5EF 3B54A 3GJSB 4DSEA 3DOKB 2CQHA 4HHJA 1ROFA 3GG0A 2EBEA 2PE8A 1AZSB 1LFPA 1Q8KA 1GMWD 4PXDA 4OZNA 2OAUA 2JOQA 2Z2YB 2C3YA 1XR6A 1XMQJ 1HBOA 4GC7A 2PDAA 3SSRA 4C8MA 3BO2A 1R6VA 4U7UK 4LRFA 3CJSA 2ZH3A 1IKVB 1T9WA 3EX7B 2GAGC 1YDLA 4OJ3A 3W63A 1NH7A 3DM2A 2GHVC 3RB0A 2VG6B 4FN5A 3CIMA 4CM2A 4O0NA 3J7ZT 2LU1A 5IXUA 5CCMA 3OFGA 1S10A 4Q2LA 3PR4A 2QT7A 3M2VA 4C0HA 5KFSA 5GMDA 1VBYA 5HO4A 2H51B 1NEEA 2XNRA 5HMYA 4ZJLA 1DQ8A 4CWBA 4OHXA 2HHVA 3NP5A 3CD5A 2KO1A 4ZA1A 2EFVA 4B3RJ 3SDEA 3KHGA 3OVSA 5E5NA 5C24A 1FTRA 1N5VA 5C25B 2W8KA 5AJ3J 3IN5A 3KNAA 4ED2A 1V5IB 3D1QA 1K47A 3Q8PB 3LP1B 1Y0HA 4TQRA 3KLIA 4PQUA 2M2BA 2BJ9A 1F6TA 2PMZD 2KXNB 1MROB 2PO4A 1HI0P 1FRXA 3JAMU 5KFYA 1L5UA 2GMLA 1CULB 3W9IA 1SIWB 2IMWP 2JVOA 5D15A 2EBGA 8RUCA 3VAFA 2ZKTA 4G1IA 1KOOA 1YSJA 5DDOC 2QO3A 1BQMB 4B17A 4HDGA 4DR1F 4KHPF 3IR5B 1M5PC 1K44A 1BXNA 4LF7F 5HQ8A 4U7UD 3R8YA 1HBUB 3LGHA 3PW7A 2YX1A 4A8QA 2XMTA 2FTRA 1TQLA 4GVBA 4CLWA 2BBEA 2V9KA 1TAUA 5FDLA 1EETA 3ZNUA 2NYHA 1O6XA 3A12A 5JXSA 3BB5A 1V3ZA 2WSFC 4NXNJ 1U09A 3CCES 1IQTA 3H20A 2CG8A 3UDLA 3T19A 3BBBA 4DZ6A 4WF9Q 3OTEA 2ZH1A 4IG0A 1I94F 3U1LA 2XMMA 1FERA 3LP0B 4I68A 2ATLA 1VQ7S 4HHUA 3N5BA 1B0TA 1X9MA 4K4VA 2BM0A 2P6SA 3NNHA 2OSRA 2MQLA 2P9CA 4RWWA 1ZM3A 3V6HA 2XYPB 3HVWA 2VH7A 3VGSA 2HG4A 1P1LA 2IY5B 1SKUB 3TQ1A 2BR0A 2MSTA 1I1GA 4UQGA 4CTAB 4CLKA 1WD6A 4TYAA 5J2QB 5EHHA 5BR8F 1PIEA 3MGJA 1EQMA 1RT3A 3M30A 2A10A 4Y2AA 3KLVA 4QPTA 2AX1A 3HFKA 4DSIA 4ED1A 4YB1P 4FNIA 5E7OB 2RT3A 2ACMA 1S1VB 2ZBRA 1FTCA 3NS5A 1N36J 1KN6A 3E3XA 3D5MA 4B3TJ 4ZP9A 1T9XA 5HI7A 2W2QP 4LVOP 1QD1A 1FT8A 2IA0A 4DV2J 1RU1A 2ALZA 1MWQA 4IYQA 4J9PA 2JL9A 3IMQJ 3F73A 2CPYA 4N8NA 4WBFA 4PG7A 1UVMA 2ZE2A 5LMUJ 2QLJB 4HDHA 1Y3JA 4BBYA 1VC0A 2VG5A 5I3QA 3H5YA 1RHMB 4LF6F 3OUYA 2GQCA 1NK9A 3MD1A 2RU3A 2HHPA 1F9FA 4J5OA 3OV7A 4BWJA 2KN4A 2HIQA 2JZ5A 2C3OA 2K3IA 4K5SA 5B0CA 2NXCA 4QZVB 1HR0J 1QSYA 1GEHA 3GYNA 1L3VA 4O3PA 1MWZA 4CH1A 4I2PB 2XC9A 1RU2A 4CLYA 4F67A 4ZCKA 2C2DA 1WNEA 2OPRA 2YPYA 3THPA 2XG8A 2Z30B 1G6BA 2J5AA 4NLUA 1GTEA 4CO4A 4UQTA 5F41A 1FJGJ 4ED4A 1HNWF 2VASA 4ALZA 2IRYA 1WG4A 2MKKA 4KH0B 2RRBA 1S9EB 1AUDA 2QMWA 2YQ1A 1KQSR 3BN4A 4UZBA 1YLXA 2D3ZA 5K8OA 2ZH9A 4RWXA 3C2PA 2P5VA 1E6VB 1S6PA 2W1BA 3NMRA 4OI0A 1WORA 1CLFA 2OH2A 3RU0A 3OL8A 1ZETA 2C2NA 2B4OA 4DN0A 3T1YF 1S1UB 1IM4A 3R2CJ 1KQFB 5H9FJ 1N48A 3FFIA 2Z4PA 4ZK7M 1BY9A 1SKWA 1EX8A 2DNNA 2DD8S 3EVWA 1NDCA 3G87A 3V2UC 2XY7A 5KT5A 3QSIA 2XWYA 1O5JA 3G8QA 2DIVA 4DR5J 3Q8QB 1S5ZA 3AAWB 1RHUB 2FJWA 1U26A 4BLGA 1RCOB 4NYPA 4UZCA 1RI7A 2DISA 2APOA 3PTWA 1PAUB 1S0NA 2ZHOA 4O4RA 2C22A 3FSYA 4Q0BA 9ATCB 4FXVA 4Q7AA 3TX0A 4OI1A 9RUBA 5ETOA 4TVAB 2UXBF 3KK1A 1HARA 3O44A 5HATA 1FA0A 1Y3KA 2V34A 2ZDPA 3R6GB 2IJFA 3KLGB 3JAMY 4A47A 1KFSA 3BO4A 4ETXA 2FJAB 2XZWA 4OQJA 3WX8A 3C14A 4ANCA 1D09B 3HLUA 5HBMB 3UE2A 3RR8A 2ZNZA 1S1XA 1VMBA 2FVRA 5EWGA 3T5HA 3T1AA 3CCZA 2NXUA 2A18A 1VBXA 1Y7PA 3P3DA 2LDIA 4DCPB 5LXRA 3OQ2A 3R5AA 3S01A 3SFGA 2M0GB 1SC1B 4CLFA 2EPIA 4HT5A 3OT9A 2BV3A 2HBZB 1WC5A 4X4RA 1UWBA 2XGPA 3SQGB 2ZUGA 2K3KA 5KTQA 3EGZA 3C6UA 2R2TA 1C0UA 4RW9A 4CNYA 1RTIA 3V6KA 2ZDOA 1R89A 3OXLA 4Q43A 3PZPA 4F4AA 3IAS9 3PX6A 5ETSA 4ANDA 3WDOA 2OPSB 3ILIA 3TUJC 4PCQA 4G6VB 2O66A 4MKVA 4Z7YA 2R2RA 5KFZA 2RD5C 1LWCA 3QAEA 3R5CA 2E9ZA 1JLQB 3GJRB 1ZS6A 4M1KA 2J9DE 1K1SA 2H4WB 2OMLA 4FBUA 5KFMA 3KK3B 4M5GA 2J9DA 2OHDA 4DU8A 2JRSA 1FWKA 4BDPA 3QSYB 1VHFA 2CJ9A 4ZPAA 4WJBA 1AT1B 2LEAA 1FJEB 3HT0A 2R7QA 2EC0A 2NPFA 3GIRA 3IC1A 1QE1A 4K4YA 2M5YA 5HMWA 5FJ4A 4P7TA 4MK8A 4RZRA 3CUNA 2ZZTA 2V5HG 3HHLD 3DXBA 2DHSA 2QC3A 2CPHA 5D77A 1TKXA 3QRRA 5CCLA 1VQPS 2PMHA 3QQCD 4EUVA 1X4EA 3PVXA 3AB2B 3CJ3A 1H73A 2Q6BA 5HN0A 2BJ1A 2H5IB 1LWFB 4RNFA 2IVYA 2R8KA 2W9BB 4JI4J 3UDCA 3MEEA 2BJ3A 1JMTA 5KFUA 1M1HA 4C0OC 1R7IA 2HKEA 3TX8A 3TZWA 2GV1A 1CG2A 2BANB 4DFPA 2ADCA 1ZM2A 3DRRB 4USTA 1NNDA 2CZ9A 2EK1A 4QYZK 5B09A 1XMQF 1P6TA 1OIAA 4Y6IA 3DGPA 1RT5B 3OTBA 1NHKL 4ICLB 2IMOA 3MM5A 2CWKA 2DNMA 1GX5A 3PACA 4OYOA 3H4BA 4ZVHA 2HS4A 3S6EA 2IA6A 3FSIA 3L7PA 4C7QA 4DJBA 1JLBA 1AROP 5T14A 1NB7A 2L41A 2IVMA 4TQSA 2W9CB 3H90A 4KHMA 4QWBA 2KFYA 3QWPA 3DOLB 4RNNA 1SPBP 4C8NA 3C19A 4H4MA 3PNIA 4V19X 3BPDA 4M5DA 2VUGA 1XN9A 1J2VA 3KJVB 4B3RF 5IV3A 4XDDA 2VG5B 3NGTA 1UZHA 2FLPA 4P7VA 1RWXB 5D6GA 4OZ0A 2H5EA 2FY8A 5AJ3F 4ZCIA 1FNMA 4WK3A 3D1HA 1RBOB 4N77A 1W7WA 3B82A 1ZYQA 4B9UA 4USUA 2WVEA 3TI0A 5DGBA 2NR0A 1NKEA 1QVFR 3X3UA 2DHAA 4IR1A 4DR7J 1EZZB 1ZTTA 5KT2A 2FVQA 1EJ7L 4P72A 3MM6B 4PKDB 1OSDA 2C28A 3ZC4A 1FRJA 4LSNA 2AHOB 2UU9J 2OP5A 2F8EX 3W3SA 3CGIA 5HL7Q 5GMKa 2H9ZA 3QGGA 3MMAA 2LQ9A 1NXIA 5U47A 3UN3A 4QWEA 3PW5A 4Z2XA 2FHJD 3DLKA 3JTPA 1X5OA 4ECYA 3DU6A 2RMLA 5M2RA 2VFSA 3MCSA 1R43A 1D8YA 4N5SA 1VQ4S 1TVRB 3O1LA 5J2PB 2ILYA 1TL1B 1XK8A 3RG6A 3D54A 3QFHA 1T11A 3M9OB 2VV5A 3QYYA 4K4TA 5KFPA 1EKRA 4ES3A 1HLWA 2Q3PA 3M2RA 1LK5A 3ZZOA 4LQ3A 1MMNA 5HSPA 4NXNF 1NH8A 3JSRA 2XI2A 2LMIA 4NRTA 2CXEA 5J1EA 1HBNB 3KK2A 3E01B 3A1YG 2VF3A 4CO1A 4KAIA 1JNZB 4Y65A 3GLJA 1S6QA 1UETA 2UVUA 2F5GA 3KXDA 2AW0A 3R5BA 2FQQB 4ED0A 2ZBQA 3HI9A 2I5JA 3MM8A 4WKYA 5EGYA 1VLOA 3CC7S 3R5DA 2E1RA 3DRPB 2FD2A 2VIHA 4DCJB 2IC3A 2NUUG 2M88A 1WI8A 4O3NA 4FF3A 5I42A 4GRSA 1HQEA 5JVHQ 3MR2A 3RBDA 2KXHA 4F36A 4FS1A 1CQNA 4ETZA 2WK4A 2MZRA 3ZZUA 3AD7C 3WIVA 3I32A 4X4SA 4A8FA 3GJQB 3QFWA 1Z4UA 2K7JA 3MOJB 4J37A 2ASDA 3HVRA 4X84A 1N36F 3CCQS 3ISNC 1YJ7A 1UW9A 4RW4A 1JLAA 5EWFA 4B3TF 3E2EA 3H2VE 4NMXA 2ZM6F 1Q0NA 2GJ2A 3SQOP 2Z57B 3K5PA 2KHDA 5K8MA 1WF1A 3O2IA 5KAKA 2J9EA 5LMUF 1ZZFA 1M1KT 2IAJA 4UT4A 4XPCA 3BSOA 5IQQA 3H5XA 5F0WA 4LF8J 3X1LB 3ZTOA 3JSBA 2Z2LA 3W5YA 2W25A 3M32A 1JX4A 1KBRA 5E3PA 3EICA 3BKTA 2ZC4A 2MQNA 3MD3A 1ULRA 1HR0F 3AY0A 4K4UA 1KLNA 4PUOB 1UVJA 3PX0A 2KG1A 2BDPA 8AT1B 1ZM9A 3TW0A 2MQ8A 1T05B 2QGFB 5I3UA 2V4JA 1FJGF 1S4FA 1ZA2B 2XO7A 3QJJA 1TK5A 2CDQA 2MTLA 4OLOA 1G4CA 2IM3A 1Q4RA 4LREA 3I55S 3LWLA 5D78A 4LF1A 3BBFA 3AT1B 2GFFA 2HRUA 1SUQB 5HROB 4RR5A 5D3GB 2B8PA 2HMIA 3LP2A 3MEDB 4X4NA 3DNCA 3RBEA 4FPRA 1GTHA 2VBYA 2LA6A 3HK2A 4LSLB 2VG7A 4ZMMA 1D1UA 4QWDA 2C2OB 2AWZA 3GFZA 3Q8SB 1Q95G 5ETTA 1HYSB 1X0FA 1Y10A 2LKZA 2DJWA 3Q2TC 3BKFA 2ZOFA 1UJ6A 4JOUA 1T8EA 4X4PA 4QIGA 3B4DA 5A8RA 5LSLA 4WIIA 2OTLS 4NL5A 4XO0A 2VFTA 2DHGA 3ZZTA 4ZLNA 2MHNA 4I64A 3UDVA 2GX8A 2MEWA 1EB0A 2JWNA 2AX0A 1QAYA 3NXZA 2VA2A 4EGLA 5F8MA 3Q2SC 3M2UA 2R7UA 3L3CA 2XZTB 3OR1B 5ETLA 4P2SA 4AL7A 4PG4A 2F9DA 5KOXA 2U2FA 1VQSA 2IJNA 2JSXA 5E3RA 2LFVA 3K8WA 4IDKB 1VQOS 4HH1A 2ZOGA 4USKA 2W01A 2KKHA 4ZIVA 3DDNA 3Q86A 2DR5A 1FEHA 3IBFB 3H42A 1X31C 3G8SA 4C2MA 4WE1B 3KLHA 5IFMA 1XC9A 2EK6A 1URRA 2QL5B 3CD0A 5L1IA 4HI1A 4ECVA 3TZXA 4KBIA 1UKUA 3NGDA 2RILA 2KJWA 3KKFA 3HVAA 3G71S 3BSNA 2WVFA 1OYEA 2C2RA 3CJ4A 5BJRA 2OPQA 3TOQA 2E5IA 1F5AA 1T94A 1A7GE 1KHWA 3AXMA 4IH5A 3ITHB 3MF5A 3CDEA 4E8UA 3H98A 4LFAJ 4D3HA 2B4PA 4USJC 3MDFA 1TKTA 1VRUB 2N4DA 2QSFA 1VDHA 1U0HA 2AGQA 1JLCB 5CYMB 4IQXA 4PG6A 4Z37A 4CP5A 2E29A 1Q79A 2R7RA 2RUSA 2W7AA 1YJWS 3IBWA 4MYUA 1SJ1A 2IYIA 3G82B 4DXLA 4DSLA 4C8KA 4JI5F 2FB0A 3T9ZA 3U7JA 1H6KX 2C2KB 4OZ5A 3KLEA 2JEFA 2K8GA 5H9FK 4WZQA 1D9FA 4LR8A 2IRXA 3W2VB 3BQ1A 1V6HA 3M8QA 4PZVA 3JQJA 1VI7A 3QO9A 4MIWA 1IUJA 2GQQA 1FRKA 4RW7A 1MMDA 3G8TA 3KUEA 4OIXA 1IQZA 4JI4F 5JUMA 5B0FA 3GYXB 2YY3A 4DV7J 4CLPA 3UVJB 4IG3B 1HIYA 5F8JA 4ILRA 4YDXA 4O3RA 1U6ZA 4FVCA 2B9XA 1RT7B 4W90B 3AJDA 1H3DA 4YS2A 2G1DA 3FMWA 4P10A 1N56A 3UR0A 1OPIA 3GIMA 1OSCA 2JDJA 3M9NB 1YBTA 4AE5A 2MQOA 1IBMJ 3JSMB 1ZPVA 1EARA 2RRAA 1SXLA 2HPUA 2V94A 1RYRA 2KI2A 4ILLA 2V8DA 3BO3A 2D3OR 4OV1A 3LANA 1KLMB 2B51A 4NYOA 5GAEU 1NK8A 3FQLA 5FLXU 4DZDA 3AB4B 3LQVA 3UQSA 2YX7A 3W8GA 1LW0B 4RW6A 2YKQA 4IH6A 1YJTA 4O3OA 2QYCA 3PM9A 1Z1ZA 3A8JA 1HW9A 1RTHA 5J2NB 2CQ2A 4M95A 1DFDA 3N4WA 1NDLA 3M6VA 5KFQA 3KTQA 3CC4S 3M8RA 2UVVA 2BQRA 2LQJA 2HHXA 2KXFA 3DU5A 4X65J 3KNGA 4OHZA 5DQIA 5GVQA 5KFXA 5DQGA 4KO0B 2Y3YA 4DR7F 1SI9A 3VGTA 2B5JB 4R0EA 1NBEB 1C2PA 1NHUA 1VBZA 4EFAC 1S0MA 3MEGB 2QYGA 3WBZA 2G0JA 3HSZA 2D3O1 3TA0A 2GA7A 2CNLB 3Q23A 4NLPA 3K2YA 2VKZG 5GAEI 4P71A 2MZQA 1SH3A 2W2NP 1KKHA 1RISA 3FBBA 1TK8A 2XS7A 2LP4A 1C0TA 1MW7A 3SCLE 3BYRA 2HNDA 5L46A 4DX5A 2YNHB 2EEYA 4MK7A 4PWDB 4ZHRA 2QL9B 4FF1A 1QSSA 4BS2A 1VFJA 3RW7A 4WYLA 2QZ8A 1X4HA 4JI8J 4PYAA 2LQ8A 1KEKA 2QMXA 4DCOB 2OKQA 3ELHA 3I82A 2EC2A 4DOZA 3RBXA 4B9SA 4ENOA 4J9RA 4I56A 4C48A 4N47A 4F0MA 2CQBA 3ONQA 1QSLA 4PPDA 4UY85 2CVEA 4CI0B 4RNHA 1UFKA 3EWGA 3EVOA 4CLTA 1DQ9A 2BX6A 3BYPA 3PRBA 1S49A 3TZYA 1EKSA 2IHR1 3UD5A 4DPYA 3QZ8A 4R25A 2HK3A 3MOZA 2NZ4A 3SFUA 2VBXA 1JLFB 1GMVA 3SYZA 3NS7B 3D6HB 4K2XA 4C3KA 4JI6J 3EGNA 5C2CA 4OYIA 1DBDA 2QV6A 5KOWA 3D68A 1N4LA 3FRYA 3PJ9A 3CTRA 4OYAA 4H4KA 2NREA 4J7CA 1X60A 3TWZA 2HFVA 1ZBTA 3W60A 4JI3F 2AZ3A 1FFWB 3AFGA 2DHHA 4O3QA 1PJ7A 5IWAJ 3LPEA 1I5OB 5ADZA 4J9OA 1SL0A 1HHSA 4LMZA 1VQMS 4RNMA 1KVIA 5DRKA 3J7Z5 5CA5A 1TL3A 2D9PA 5E0OA 3KWMA 1B99A 4EBEA 4KPYA 4DQQA 1UJ4A 3BSCA 1K0TA 2GZOA 2UUAJ 3W7BA 1CJKA 4L75A 4MYTA 1Y00A 2LXIA 2HQFA 3FRZA 1C1CB 1RB0A 1T9UA 1RWMB 1K0VA 5ETQA 5KG6A 2GS8A 4KC5A 2OPPB 1TZ0A 1NSPA 1U4BA 4DUYF 1F9HA 4LF8F 3RB6A 2V2KA 4U8VA 5E41A 1DLOA 2BM1A 1JLEB 3W2WB 3UPFA 4YB5A 1TTHB 3A3OB 2BQUA 1S72S 1SJQA 4DUZF 2ZBPA 1F0XA 1Q5YA 4ED5A 1FKPA 1S1TB 4HI2A 4IH7A 1NPKA 1JJHA 1TMJA 1RKIA 1CJVA 5E3QA 1JLGB 4CH7A 4JI1J 3HULA 1LWXA 3VALA 4TU9A 4KKOA 1K1QA 2V8GA 1QLNA 4HHHA 5F8GA 5BYSA 2MZ1A 1K73T 2UUTA 3FZ2A 4WFAQ 1KR4A 3C15B 2WOMB 3GTYX 3CNQP 3KLEB 3M8SA 2J6TA 5DG9A 3J81j 2OGUA 3I5AA 3DC2A 1VLYA 4LUBA 3WIUA 4C11B 2DH9A 4PYDA 1V5VA 1JJCB 4EYIB 1M90T 2R7OA 3M8QB 4JUZA 2RF2B 4OI6A 4DS5A 4DG1A 2QG9B 3QIDA 5CHCB 4KQZA 4CLLA 2GVZB 3OVBA 3D0GE 1ICEB 4KHRA 1M1GA 4O0IA 4IR9A 4DL0C 3H5UA 3OTOJ 2AYEA 2DO4A 1T03A 2KFZA 1UZDA 5FLXY 5HVHA 3FKBA 3CD6S 2XI3A 2BE9B 4F3QA 5I4MA 3K17A 3I56S 2UVWA 5IQ6A 2HVHA 2UP1A 4WP3A 2NSCA 5DLGA 3HXMA 3HKWA 1DTTA 5GADI 2HURA 4P74A 3CJ8A 1F9EB 4FXWA 3I0SB 4IRCA 2FHKA 4B3SF 4A8OA 3BBCA 5CAAA 3NAHA 2EW9A 1S1WB 1X4DA 3NBPB 1RTJA 1FX4A 4ZPCA 1QAXA 5C42A 1RAEB 2PEHA 4NLWA 4DHVA 5F9NA 3I31A 3MM7A 5ETMA 2OUGA 3CC2S 2NCKL 4KSEB 3KHLA 2R7XA 5HP1A 3MCOA 1SCJB 4R5PB 2V63A 1M5SA 2XCAA 3GFHA 3DKDA 1LNQA 1ZAVA 4R8UA 2F4FA 5A6WA 2PMWA 3FDSA 4HVZA 4PEOA 5CXTA 3B78A 4F4YA 3CO0P 4NA2A 1FVQA 2PA3A 4I7FA 4DFKA 2C2MB 2FJVA 4NLDA 3NEKA 1RAOA 1KRPA 3G6ES 4DL3A 5E3CA 1IKXA 1R0CB 4WZMA 1FKAF 1XTZA 2CKWA 4HH0A 1RBLA 5F8LA 1RLCL 3ZO7A 3IWLA 3TA1A 4H4OA 2HEKA 5KFHA 4WWSA 1VRQC 1OY6A 3P49B 2LA4A 2KHCA 3J81U 4QIEA 3FMBA 1MG7A 3RAQA 3NGKA 1CS4B 4IFVB 2FJDB 1HWIA 4FKXA 3EYZA 3TUPA 4LFAF 2CNKB 1M5HA 4RUCA 3CDUA 3QJPA 1V3RA 4NI2A 4LF7J 1BWVA 4ZP6A 2GVDA 1R31A 5KT4A 5L1JA 3IGNA 3LPYA 4LBPA 3VAIA 2VPWB 5CYJA 1D3WA 1UFWA 2HVZA 4CH0S 1WDDA 1F3FA 1B4SA 2BJEA 2V8PA 3MTJA 3MWBA 2DEIA 2OEJA 1VISA 1NU4A 5CD4H 1HMVB 4NWBA 1VJQA 4U67Q 1CJTA 1W2IA 2AP6A 3A13A 3WC0A 1FWPA 4AXJA 5SZTA 3WHIA 2YWFA 3G6XA 3Q8VA 4DEZA 4NCBA 2DRDA 4OYBA 4UW2A 3OR2B 1N34J 4A8WA 1PBUA 4DV7F 2DYAA 3DLEB 4C8OA 4NPOA 4RUAA 2XNQA 3DOKA 1KP6A 2WW4A 1TUGB 2CWXA 4M94A 2FZKB 1RCXB 4KJIA 3PYEA 3JSYA 1RABB 5D4LA 1VQLS 2DNYA 1QDUB 1FXDA 1B64A 1AZSA 1NCLA 4YY3J 3K8VA 4JI7J 4NEYA 5G0RB 1IBMF 3ZFVA 1U47A 2XWXA 2MZJA 3CO9A 4W92B 7FDRA 1IKVA 4DU7A 2O3DA 3NS6A 1S77D 4WTOB 2N4CA 1A6LA 2FZGB 4RW8B 1FDAA 4WFNQ 5DZ7A 1RWWB 3G2XA 1NK6A 1L3TA 5LSOA 2VG6A 4CLSA 4EWTA 3O8WA 1HNIB 1Y5IB 1QM9A 3BDEA 2F1FA 2DNGA 3RB3A 3MM9B 1FNXH 4NA3A 3L7UA 2DK2A 3HMJG 5EWEA 2EKYA 3CXCR 1JNRB 2CQ4A 3HZGA 4CO2A 1DAXA 5C25A 4DR6J 2F65A 3DDKA 1N5YB 2W7OA 5T7LB 1VIOA 3LP1A 4X65F 3PHEA 5L1LA 1WTBA 2HW3A 3CCRS 2M8HA 4EBCA 4F8RA 2LXUA 1Q7YT 2QJ3A 3VVTA 4X66J 4HR2A 1MROA 2MQMA 1A9NB 3SCKE 2G9OA 4NEZA 7AT1B 4QWAA 4ZVFA 1QY7A 1CULA 1TL5A 3GIIA 3CMES 2N82B 2RDDA 3MAQA 1BQMA 1FRMA 4XAKA 4KGXB 3MPWA 4GVLA 3NOCA 1KTQA 4ED7A 2YWGA 3ENWA
chains in the Genus database with same CATH topology
2HQIA 3DGPA 3HVTB 2DNZA 1N5SA 1U24A 1WACA 1RT5B 5A8KB 1IXKA 3OTBA 2XLKA 3TO8A 1N6QB 2F3JA 3DLJA 4A46A 1X5TA 2J0WA 5KFJA 1S6UA 4ICLB 4X4QA 2IMOA 2MYFA 1NJXA 1SH2A 3THTA 1HQUA 2MJNA 3MM5A 2ZH2A 3BEGB 3U27A 3MXHP 2DNMA 2C3UA 1GX5A 3PACA 4MAKA 3FVYA 2JEJA 3H4BA 4ZVHA 1T3OA 2R8HA 2HS4A 3S6EA 5DDQC 5IM0A 2IA6A 3QJLA 2HS3A 4JI8F 3NWGA 3FSIA 1B0PA 1X5SA 3L7PA 2DNKA 4C7QA 4DJBA 1JLBA 1TKTB 2Y1IA 1WF2A 5EX3A 3PV8A 3UNGC 2JHEA 3MR6A 1AROP 3CB4A 2UV8G 4IO1A 5T14A 1C1CA 2DTJA 3I5BA 3GFYA 3OL6A 1BD6A 2B4UA 1T3NA 2MB0B 5K5MA 1Q8BA 1NB7A 5A0YA 1GXLA 2RQKA 2L41A 4DLGA 3OHAA 2IVMA 2RE1A 4TQSA 2W9CB 5L38A 2BZ2A 1U7LA 4KHMA 4OJ1A 4QWBA 2KFYA 3QWPA 3DOLB 4RNNA 4KTQA 2VONA 2OPPA 4C8NA 2DGTA 3CCLS 4AQYF 2HNYB 1LXJA 4H4MA 1U1LA 3NL0A 5GADU 4ID8A 2JLFA 4ITSA 2YKNB 4DN9A 3P96A 5M2UA 1Q81T 2CQ3A 3TVKA 1YJ9S 3PNIA 3D2WA 1FKOA 1T95A 4OX8A 4F4XA 4ED8A 3OSPA 2EG1A 4LF4F 4V19X 2KRBA 1N52B 4M5DA 2R7WA 2OD4A 2VUGA 2CJQA 1JLEA 1NHVA 1XN9A 1J2VA 3MMCB 3W2WA 3KJVB 1AFIA 5THWA 1U1OA 1OWXA 2B7BB 3GWCA 1RTDA 4B3RF 1FJCA 2RS2A 4XDDA 2V9WA 2VG5B 3LP0A 2FLPA 1G2EA 4P7VA 4FF2A 1L3SA 5D6GA 1KVJA 2P9EA 5BYQA 4OZ0A 1FRIA 2H5EA 1KTVA 1SJFA 4B9NA 1MSWD 2HVIA 1H7WA 2DGOA 5AJ3F 4ZCIA 3LW5C 3TAPA 2HZCA 4O44B 1FNMA 4KV8A 4WK3A 3BSAA 3D1HA 4N77A 4TN2A 3B82A 1RT4B 4JI6F 1ZYQA 2ASLA 3SSQA 3QO9B 1S1TA 2BXJA 2FVCA 4B9UA 1SV5A 4OZ1A 3TI0A 3IAM9 1HBMB 2B4VA 1R27B 2E7WA 3EUNA 5DGBA 2W8LA 1NKEA 1RWUA 1QVFR 2NR0A 2YTCA 2MXYA 3X3UA 4RW7B 2DHAA 4IR1A 5KFBA 2ZVSA 3DRSB 2YWEA 4CT9A 1XERA 2UZAA 3FCHA 4TLRA 5DETA 1ZTTA 1JLGA 4KE5A 5KT2A 1WWHA 2I9SA 4CZCA 3Q0AA 1TV6B 2FVQA 3PO4A 1Y4ZB 2W4PA 3LALA 3MM6B 5D4PA 4PKDB 1OSDA 2HWHA 1FNOA 2HFZA 3HF5A 1DTQB 2VFVA 3CJ0A 3PFOA 3BGFA 2NUHA 4CTAA 2RUGA 4DL6A 4K50A 1X4GA 4HLBA 5J2QA 2C28A 3OBIA 3E8OA 3BGRB 3ZC4A 2GHWA 3AA9A 2DRAA 1ZAXA 1FRJA 2YX4A 3CJ2A 4LSNA 3PXGa 2OP5A 2W4CA 1LOUA 2F8EX 4ZDNA 3TR5A 3W3SA 3CGIA 1H2UX 5CYQB 5HL7Q 1U6BA 5L9XA 5GMKa 2H9ZA 3ETOA 5IWAF 3QGGA 2O5DA 3MMAA 4ZVGA 2WOMA 3GZ7A 3BN7A 2LQ9A 5U47A 2OFHX 2MDAA 2YKAA 4QWEA 5LL6d 3PW5A 4PQAA 4Z2XA 2FHJD 3DLKA 4WXOA 3JTPA 2WB4A 1WI6A 4Q5VA 4GO5X 1S1VA 3TUZC 4C11A 3J81Y 3KHRA 1X5OA 4ECYA 3DU6A 2RMLA 5M2RA 2VFSA 3VZIA 1X4BA 2CYYA 2VC1A 4I0WA 5AXKA 3H40A 4GKKF 3MCSA 4G1QB 1SL2A 1R43A 4H54A 5KFRA 1D8YA 2Q66A 2RF2A 3WC2A 2KZZA 1WTFA 4BWMA 3O6QA 4Y3CA 4N5SA 2B7CB 2UUAF 2XB2D 3PEHA 1VQ4S 2Q1LA 1UFLA 3RRGA 4MMOA 2O1PA 1TVRB 3O1LA 5J2PB 2ILYA 3R27A 4ELVA 1TL1B 1XK8A 3D54A 4GMKA 4TXSA 3M9OB 2QEXS 3H5SA 6FD1A 2VV5A 3QYYA 3GQCA 4K4TA 4ECQA 4MKYA 1H38A 5KFPA 2FHMA 4ES3A 2Q3PA 2KM8B 1O8BA 1IKYB 4RW6B 3M2RA 3TUIC 1LK5A 3ZZOA 2MQPA 4LQ3A 1MMNA 3IRXA 4BC9A 1NH8A 4NXNF 3JSRA 2XI2A 2LMIA 5DM7Q 3T5LA 1RTHB 1GQEA 2E1AA 4NRTA 5J1EA 4ECWA 1HBNB 2N7CA 3KK2A 4ELTA 3OVAA 4QWCA 3DN9A 2E9RX 4QR1A 4F4ZA 2VBWA 3TVYA 3AQOA 3E01B 4XIUA 4J9SA 3A1YG 1J5OB 1VQYA 1X9WA 2XS5A 2M70A 3GIKA 2F7VA 4CO1A 4KAIA 1JNZB 4Y65A 3PEJA 3TNVA 1P9QC 3I0SA 1REVB 3EZ5A 1DZ5A 2U1AA 2RQCA 1RT2B 1S6QA 3NNCA 1UETA 2X1GA 2VC0A 2DGSA 1UP1A 2UVUA 3NBPA 1S1WA 3OLAA 2AW0A 2YQ3A 3OJSA 3H2LA 4DQSA 1BWEA 1KFDA 3MPYA 3R5BA 4I2PA 1N54B 4CNZA 4ILMA 3EGWB 4ED0A 3CCVS 3UW1A 3HI9A 2I5JA 3MM8A 1XR7A 2B56A 4TU7A 3K0JA 4WKYA 5EGYA 2GO9A 1HW8A 4KT0C 5KFEA 3MR3A 2PC6A 3CC7S 1H2TZ 3R5DA 2E1RA 4C8YA 3VR1A 2HHHF 3IA0A 4NLYA 4DL7A 2FHOB 2C3PA 3C46A 3DRPB 1EP4A 2XBPA 4KFBB 4YR3A 4DQPA 1XWLA 5IT4A 4XK8C 5AXMA 2FD2A 3HHDA 4C3LA 3T5KA 4ZPTR 2ZD1A 2IC3A 2NUUG 3DMJB 1LXNA 5HMXA 2FGOA 2C42A 5KFOA 2CZVC 2M88A 1WI8A 2B6AA 4O3NA 4FF3A 3UD3P 2R8GA 4C9DA 1W2BR 1HNZF 2VZ9A 3M05A 5I42A 1HQEA 5JVHQ 1DJ0A 1HNVA 1S9EA 3MTKA 3MR2A 2KXHA 3Q22A 3RBDA 1VQ8S 5H1SV 4FS1A 1CQNA 3QMQA 1TKZA 2ROEA 2CPFA 4R5PA 3MAHA 5LJ3Y 4ETZA 1CC8A 1T02A 2LYVA 2WK4A 2MZRA 3N6LA 3ZZUA 3RRHA 2AYBA 2AYMA 1FXLA 3GV7B 4ECZA 4DF4A 3I32A 1YJUA 2D74B 4YB7A 1C0TB 4X4SA 4A8FA 1E6VA 1HBOB 4IRDA 2HNDB 1FE4A 4K5RA 1Z4UA 2K7JA 1SBRA 2JVRA 3BJYA 4J37A 3MOJB 2ASDA 2KVIA 2ZJQQ 2QE5A 3MMBA 3CCWA 3PW0A 1KD1T 4ZHRB 2FY1A 2BYCA 3DLLQ 1MMLA 3HVRA 1HWJA 4X84A 4Y28C 2HQ3A 4JV1A 1N36F 2OJ3A 1FK9B 4F26A 2Q79A 3CCQS 4AL5A 5F8NA 1ZPWX 1S1UA 3ISNC 5L9NA 4RW4A 1JLAA 5EWFA 4HEA9 4B3TF 3E2EA 3DLBA 3H2VE 1GNKA 1GH8A 1N32F 2CQDA 4FYDA 5KFFA 2A1BA 2YKOA 2ZM6F 4F2SA 2GJ2A 1RYSA 1DURA 3DM2B 4ECSA 2XY5A 4DL4A 4X4OA 4RU9A 3C3LA 3N01A 4F02A 2QRRA 3K5PA 1ZAWA 2E5GA 2KHDA 1WEZA 2V0NA 5K8MA 1WF1A 3O2IA 4WYWA 5KAKA 1M0SA 3N79A 2DNOA 2J9EA 2MMYA 2FGCA 1FJ7A 3OTOF 4ED3A 2ZHAA 5LMUF 2POKA 3DFEA 3M2VB 1ZZFA 1DARA 4F3MA 1M1KT 1RA7A 2VPYB 3H2UB 4DQIA 1FD8A 4I4BA 2IAJA 4WTYA 4FZVA 1NO8A 3M6XA 2DGQA 4XPCA 3BSOA 5IQQA 2WHOA 3H5XA 2L08A 1IKWB 5F0WA 2ZNYA 4TY9A 1HWLA 3IS9B 4MIAA 3TARA 3X1LB 3JSBA 4URSA 4FXDA 1SQEA 2Z2LA 4LIWA 2W25A 1S0OA 4Q8EA 3M32A 1GXUA 4GC6A 5J2MB 4IFVA 3DHWC 5DO2A 1JX4A 3F56A 3KOAA 4B9LA 4EEYA 3GIJA 3SDEB 5E3PA 2HHSA 2HLTA 5HLFA 1Q82T 5I3PA 1VQ5S 2EFQA 2ZC4A 5C24B 3QLHB 1Y5LB 2MQNA 3C8YA 3MD3A 5FD1A 1ULRA 5DM6Q 1PC5A 3AY0A 1HR0F 4Y34A 4K4UA 3TAQA 3FSXA 2IFXA 3QWUA 2B3TB 5B0EA 2K1RB 3QIPB 1O0PA 2VL1A 1KLNA 2PGCA 4PUOB 3CF5Q 1LKZA 3PX0A 1YIJS 1JJ4A 1UVJA 3MHYA 1D0EA 2KG1A 2PA8D 5EDWA 4YP3A 4CCHA 2PT0A 4ZCLA 4MK9A 2HGNA 3KLIB 2BDPA 4PQUB 2AJ0A 2OFGX 1FVSA 4NLGA 1ZM9A 1BQXA 2QSWA 3GV5B 1XMBA 3G6VA 3TW0A 5KT6A 4N76A 4IRKA 3AH6A 4OFZA 1T05B 3MR5A 3NCQA 1NK5A 5I3UA 4NLVA 5G4DA 2V4JA 2AF6A 1LWEB 1S7HA 4WFYA 1FJGF 4AXIA 1S4FA 2ZH4A 1R8AA 3KLGA 4KRWA 1RT1B 2XO7A 1QAIA 1T7PA 4RBVA 4DV6F 3Q24A 2KT5A 3QJJA 1HMVA 1TK5A 2CDQA 4OLOA 2A2DA 2IM3A 1Q4RA 1WELA 1H7XA 5CZVA 2WONA 3I55S 3LWLA 5D78A 1X8DA 5HBMA 5SUHA 2CQ1A 2GFFA 4I2QA 2CJBA 4A8KA 3V6JA 2DPJA 1HI1A 1TFWA 1MU2B 2X3GA 2DNLA 3DLHA 3ISND 1YJNS 4DSJA 2HRUA 4QW9A 1YBAA 2QA4S 1U1KA 4F2RA 1CC7A 3OXFA 3T9NA 2XGQA 1Z2ZA 1F5CA 7FD1A 1CVJA 1SUQB 3UI3A 5HROB 3G96A 1RDRA 5D3GB 2FLLA 2VFUA 1TL3B 1JKHA 3KLFA 1NZAA 5A2QY 3B4MA 2HMIA 5KG2A 3LP2A 1RP5A 3MEDB 3OR2A 4X4NA 1YWXA 3DNCA 4A4JA 3GR1A 3A8EA 3I4PA 5CZXA 4MFBA 1D9AA 5HMZA 3RBEA 4FPRA 1GTHA 1NKCA 3RAXA 2VBYA 2LA6A 3DLEA 4DSFA 4B3MF 1UVIA 4Y2IA 3HK2A 1BQNB 4LSLB 1TAQA 1SH0A 5AXLA 2W24A 1N5TA 5K14B 2VG7A 4ZMMA 5B08A 1R0AA 1D1UA 5FDLB 4QWDA 4M8LA 1EETB 3KFWX 2AWZA 4OZLA 1M5OC 4USIA 3GFZA 3Q8SB 3TRGA 5B0GA 3IXQA 1HD1A 3K57A 3AHPA 3SQGA 3KG0A 1YI2S 4NLTA 2BE2B 3CJKA 4URGA 1S48A 3QGIA 3M9MB 1HYSB 2J76E 3GMGA 4B3OB 3MUMP 1X0FA 1WG1A 2DNPA 2FJBB 3LWMA 2LKZA 2DJWA 2N7YA 3CDWA 3Q2TC 2MKJA 1S0VA 3RZAA 4RLEA 2ZOFA 5G0RA 1UJ6A 2DH7A 1S6OA 2XULA 4O3SA 2Q43A 4JOUA 1T8EA 2HFOA 4KGMA 3CWJA 2VPZB 4YB6A 2CJKA 4NA1A 3TP2A 4X4PA 1C4AA 1DLOB 4NLSA 4ZPBA 4QIGA 2VBZA 3ENQA 4IG0B 2RDIA 2OPSA 1HPZB 3B4DA 5A8RA 5LSLA 2RKIA 2MZSA 3CDBA 4WIIA 5KFAA 3J80Y 1FE0A 4N56A 1JXLA 2BOPA 4NL5A 3FJ2A 2C3MA 3NCRA 2OTLS 2QIFA 4XO0A 3ZZPA 1YJVA 1S99A 2P6TA 2VFTA 1F60B 4RW8A 3NNAA 4ECRA 4NZ0A 3TYTA 2DHGA 3ZZTA 2XEXA 2RJZA 3I96A 4DF8A 1CEZA 3M1VB 3LO3A 2MHNA 4I64A 1GT8A 4DR2F 2GX8A 3G4SS 2DIUA 2LXFA 2M9KA 2HFNA 3HPOA 1JLQA 1VS3A 2QLXA 2JWNA 2AX0A 1FKPB 5L8RC 3M8PA 4FP9A 2G4BA 1QAYA 1Z2LA 5JJBA 4A8YA 2IYGA 2VA2A 2KH9A 4PRFA 2E5HA 4EGLA 5IM0B 3KK3A 5F8MA 1NJZA 3HO1A 4FS2A 3BZQA 1N0UA 1Q78A 3IR7B 2M4MA 2HHTA 1HNIA 1U2FA 2Z0GA 3Q2SC 3M2UA 2KYXA 5LJ5Y 1C4CA 4G1PA 3NKYA 4NLXA 3L3CA 2X1AA 2R7UA 2R8JA 1UEUA 3OR1B 4DWIA 3GILA 2W7PA 4RBUA 2LLZA 2E1MC 4KKOB 2YWKA 5K8NA 2VFRA 4P2SA 1QTMA 4WU2A 1GXTA 4AL7A 4PG4A 2F9DA 1UVNA 1H0HB 4OI3A 4ZP8A 2UXDF 3MM9A 3IRWP 5KOXA 2U2FA 2DCLA 3K58A 1VQSA 4DV4F 2JH3A 3OFFA 1RT3B 1CPZA 2PD1A 2IJNA 2JSXA 4A8SA 5E3RA 3V81A 1VRTA 1UW4A 2CPJA 2EWHA 3M30B 5LXYA 2IVFB 2G0CA 5KFLA 4TU8A 1PSDA 1VQ9S 3J7A1 1DHMA 1FF2A 2CFXA 3K8WA 4IDKB 3T6JA 1VQOS 4HH1A 2ZOGA 2WSCC 2FIUA