6FD1A

7-fe ferredoxin from azotobacter vinelandii low temperature, 1.35 a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7-FE FERREDOXIN I (FD1)
publication title Structure of Azotobacter vinelandii 7Fe ferredoxin at 1.35 A resolution and determination of the [Fe-S] bonds with 0.01 A accuracy.
pubmed doi rcsb
molecule tags Electron transport
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1997-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 6fd1A00
1Y4ZB 4YDDB 1PC5A 2VPXB 5BYQA 1JB0C 1A6LA 4KT0C 1RGVA 4OV1A 3EGWB 4RKUC 3MM7A 2ZVSA 1IR0A 5FD1A 5BYRA 4XDDA 2GMHA 1FXDA 5E7OB 1F5BA 3OR1B 1FRHA 3MMAA 3MM8A 1KQFB 2FDNA 1FCAA 3PNIA 1XERA 2C3MA 1B0VA 1FRXA 3MM6A 2C3UA 2WSCC 1FD2A 1Q16B 3EUNA 2Y0SD 2PA8D 1Y5LB 2VKRA 1DURA 1C4CA 4L6V3 2FJAB 2UZAA 3HKZD 1B0TA 3OR2A 1CLFA 2PDAA 2WAQD 1FRIA 1F2GA 2V4JB 1SIWB 1WTFA 3IR6B 1FF2A 1GAOA 1GT8A 5CHCB 1SIZA 2C3OA 1FRJA 2C3PA 1G6BA 1FXRA 4Y28C 3MM9B 2WSEC 2XSJB 3MM5B 1HFEL 1K0TA 2VPZB 1PC4A 2WB1D 2FGOA 3OR1A 1VJWA 3MMBB 4XDCA 6FDRA 1H98A 1IQZA 1D3WA 1Y5IB 1R27B 3MMCB 1FRLA 5L8RC 1BLUA 1DAXA 1BC6A 6FD1A 2WSFC 2C42A 4CI0B 5CH7B 2O01C 5BYSA 3C8YA 2FJDB 1FTCA 1SJ1A 1B0PA 4DHVA 2Z8QA 3MM7B 3EXYA 2IVFB 3IR7B 1BD6A 1GTHA 1Y5NB 1H7WA 2FJEB 4AYBD 1ROFA 1FERA 1G3OA 2V4JA 1BQXA 3MMAB 1JNZB 3MM8B 1KQGB 1AXQA 2VPYB 2PMZD 4XK8C 1FDAA 1C4AA 3MM6B 4OMFG 2VPWB 2FJBB 3MM9A 3LW5C 2XSJA 3MM5A 1FEHA 4ID8A 1FRMA 1H7XA 2FD2A 1FDBA 1FRKA 7FDRA 3MMBA 1KEKA 3GYXB 2GMJA 1BWEA 3OR2B 1DFDA 2C3YA 1JNRB 3IR5B 3MMCA 1GTEA 1FDNA 1F5CA 1H0HB 2V2KA 7FD1A 1FDDA
chains in the Genus database with same CATH superfamily
2RRBA 1B70B 1XWLA 4MIAA 2B7CB 1YTYA 1TK0A 2KM8B 2DK2A 3EXCX 4PWWA 5AXNA 3R5BA 2NLWA 2XY7A 1TZ0A 3NNHA 2N4CA 3HDSA 2VFUA 3SBMA 3FK4A 4ZDNA 2XHCA 2Q43A 2J5AA 1UWBB 4LSNB 3AJ2A 2Z2MA 1EP4A 3I31A 1LKZA 1RQ0A 3OJUA 2OPSB 4OHWA 1CSJA 2AGQA 3P4UB 2XWYA 4TY8A 2KH9A 1FX4A 2BDPA 3NS6A 3W3SA 2KT3A 2F4FA 1S79A 3ADAC 4PWDB 3M9NB 4OX7A 4DR4J 4Q0BA 3CD6S 2XZWA 1NPRA 4LBIA 1HBOA 1CJVA 2UV8G 1YJRA 3RW7A 6AT1B 4Q2MA 4ATNA 4Z37A 2N3LA 2NZCA 4DPOA 4A4JA 1O51A 3CEDA 1HPZB 1NDPA 3DGPB 1T95A 1TV6A 4OV1A 4P7VA 4OZ2A 3R9LA 1QAYA 2DNNA 1Q8LA 2LQ9A 4RUAA 2UP1A 4ECQA 3DLBA 3MZIA 5CABA 2DR8A 4O3QA 1VBXA 5IV4A 3OTCA 3WX8A 4LSLB 2NSCA 2RS2A 3QGPA 2W24A 5KFFA 3MHYA 4IRDA 1R0BG 3CJ3A 3UR3C 1DY3A 1S6PB 3T5KA 4LUBA 5F3TA 4O0IA 2AMCB 2V34A 1JJCB 2PMHA 1VQ6S 5FDLA 2XM3A 3VWSA 3J7A1 3CW2C 1CVJA 1LXJA 3GJRB 4DPYA 1U1QA 1H7WA 2HQDA 3MUTP 4DUZJ 2W8KA 4KFBA 3HHDA 1R8PA 1HQEA 1S1XB 4IG3A 3C6UB 3R97A 1R0AB 1YRTA 1U1MA 3KUEA 2C2DA 2J9CA 3U1NA 4CLYA 5HROB 2EVZA 4C8NA 2OTJS 2LQ5A 4FYDA 3QZ8A 2MKJA 1RGVA 2V8VA 3CDBA 5IXUA 4A8XA 2DR7A 5D4NA 3OR1B 4C8YA 3RAQA 1UVLA 3GWCA 4NRUA 2E5LF 2WSCC 2EK6A 3RW6A 4J9NA 3IXQA 2F9JA 4FKYA 1SL0A 3ZTSA 4RWWA 3BDPA 4B9MA 5L1IA 1NB2A 5E41A 1FESA 2IIHA 2RILA 3D6FB 3PRBA 1KSPA 1Y9OA 1MWYA 1IKVB 1ZAWA 3U1LA 2ZH1A 2VASA 3MR2A 3TW0A 1L3UA 5IQ6A 3AAWB 1HNVA 1RT3B 1RT7B 4DWIA 3CCVS 3LW5C 1N8RT 1UFWA 4QQBA 2M70A 5KFVA 2OPQA 4HHHA 2RMLA 2EKYA 4O3SA 4P6QA 4FVMA 1RLDA 4HKQA 1M1HA 4XPEA 2HHSA 3KJNB 3W2VA 1U8SA 4JI7F 1NXIA 2ZNYA 4CTAB 2HIYA 1VQKS 2WOMA 4X4TA 2J7UA 4DN0A 4DX6A 1YLXA 4PXBA 1M5OC 3QGGA 3O3LA 2CWKA 3B4DA 2MZRA 4O3PA 2WSFC 1TUGB 2XG8A 5KT7A 3TP2A 3MCMA 4DLEA 1P1LA 4P2MA 3KLHA 4B3OA 5L1JA 1N56A 3R5DA 2YWKA 4X64F 4NCAA 2CZVC 3C19A 2LMIA 3MTKA 4HH0A 4NZ7A 3QJJA 1HHSA 3FBEA 2VG7A 4JI4F 2A10A 3NS5A 1FE0A 1RWKB 2QLBB 1ELOA 4F26A 1JMTA 2H5IB 1UETA 4RW8B 2K3IA 2HRYA 5DM6Q 4X4PA 3VAGA 2IVYA 5J2NB 2VDIA 2C3MA 1NDCA 2F40A 5KFMA 3PRDA 1JJHA 5D4LA 2I2YA 5HI7A 2OELA 4F4WA 5HJXA 2FJAB 2PDAA 3DRXA 1AA1B 1Q5VA 2HS0A 1S48A 5F8JA 1UZHA 1DTQB 2FY1A 2NQPA 3UQSA 4EO8A 1AB8A 1N5VA 1HD0A 4ECXA 4ZP7A 3F41A 3DDNA 4YB1P 4D3HA 5FLXY 3OL8A 3OHAA 3EZ5A 2DGTA 4PXDA 1RAOA 3MCNA 4DV6F 4ECYA 2OO4A 2CQ1A 2JX2A 1K73T 2X1AA 2PMZD 2BJ7A 1JXVA 2PEBA 3TZZA 2WZ1A 2VPWB 2FJBB 2UUBJ 3BPDA 1GMWD 2DCUB 5HL7Q 1RE1B 1FKOA 5A76A 1HI8A 1KQKA 4ZOSA 4WK3A 2X1FA 5DZ7A 3TAMA 3G2XA 4MK9A 2QE5A 3D68A 4XIUA 3EYZA 1RCOB 3LH2S 3GYGA 2FDNA 2FTRA 1LV5A 5HQ8A 1QY7A 4PG7A 1RT5B 4NCGB 2UU9J 2IDEA 1T3OA 2DR5A 1IM6A 4TU9A 4ED1A 3K59A 3CCSS 1NNDA 4OI0A 4N8OA 3PJ9A 1CG2A 1CULA 3ZZOA 4O3OA 3GE9A 4USJC 1A0OB 4ZLPA 3PW7A 4CO0A 3NOGA 2CJAA 3VQTA 1X9WA 1RAGB 5DJBA 1FERA 4DUZF 1CQMA 2IBOA 2H5EA 3W9HA 5G4DA 3L7UA 3GIMA 1MMDA 2ALYB 1BWEA 4KR0B 4L3NA 3KLVA 2F9DA 2B9YA 3NWGA 3DRRA 3LQVA 3G86A 2EXUA 1ZM3A 5B0EA 3UDCA 3M8QA 2CJQA 3CD0A 3PM9A 4OZ1A 1TFWA 3GQCA 1FD8A 1PO6A 3THPA 1RTDB 1VQOS 5J1NA 4U7UD 2H51B 2PA8D 5D0RA 4MFBA 2MKIA 1REGX 4NLUA 3Q8UA 1WTFA 1VK3A 4Z7YA 2QN6B 4PPDA 3OFEA 3DM2B 4LRCA 3F73A 5B0GA 5F8LA 1VJWA 4BS2A 4G1QA 4TVAB 1TKTA 1E6YA 3SDEA 4H4KA 4QWDA 2RB7A 1RI7A 4QWAA 3A8KA 2VBWA 3J7ZT 1XMOF 3QQCD 4CDIA 5CYQB 2H54B 2PT0A 4KHPJ 4O44A 2CNKB 1LWCA 1S1TB 4AL7A 1D8YA 2YBVA 1M5PC 3MM8B 2L48A 2M88A 5DQHA 4W4MA 3OLBA 5GAGU 1KVKA 2NXCA 4NI2B 3AA9A 4NLGA 1UKUA 3QO9B 2Y8WA 5E3AA 3K5LA 1FXLA 2QLWA 3T5HA 4OYOA 4I2QA 1UMJA 3J80Y 3AODA 3MAAA 2JFKA 8ATCB 2LDIA 1VMBA 2EK1A 3P5TL 3OFFA 5KFUA 5DDRC 2VG6B 3ET6B 4HHUA 3HF5A 4ELTA 1QVFR 3GJTB 4ED2A 1PSDA 2YKAA 4FXWA 2BKPA 3G82B 4CLUA 2MHNA 4H4MB 1BUXA 3Q89A 3QT7A 3RU0A 4LR7A 3NNCA 2FVCA 1CJKA 4HTIA 2E29A 4HI1A 4TXSA 2CKWA 5A8WB 1FKOB 2E1AA 3SSSA 3IBFB 3CPWR 2IFXA 2D3UA 3BR9A 1OQ3A 1MMNA 2GCFA 1RAAB 1JLQA 3N01A 3NBPA 2OHDA 3SXLA 1S99A 2NXEA 2BEFA 3OTOJ 3PNIA 1XR7A 1FWPA 4FZVA 4I67A 1YRUA 3PHTA 4BLGA 2IJFA 1NK9A 5GAGI 3RG6A 3A13A 5DQGA 1R8BA 2LDYA 4RO0A 2M8DB 3UWTA 1B0VA 1HWLA 3UD5A 1QSYA 3KLFB 2AJQA 2VICA 1B0TA 2FHKA 4NLXA 1TL1A 2V4JB 3P8BB 3QT5A 4IOCQ 4DXLA 2W9BB 2ROEA 1UEKA 2R4FA 2W2NP 2ZVIA 1T05B 4ZPVR 2EC0A 2Z56B 4X65J 2HK3A 3KNAA 4IRCA 5GAHI 4MH8A 4QW8A 3GG0A 4KPCA 5DDQC 2R9LA 1MN9A 4B9SA 3BB5A 3OBIA 4KKOB 4K50A 4CNZA 2CZ4A 5RUBA 3PX4A 4LFCJ 4NLDA 4A8WA 2QRRA 1WDDA 2VPXB 4J37A 3GSDA 1YJ9S 4KRWA 4PG5A 4USTA 2HQGA 1X4FA 4J9RA 3GIJA 1T94A 2UXCF 1KOOA 4LQ3A 1WDTA 4DUYF 3MEGB 4F7VA 2O1PA 3DGVA 1GH8A 4JI1F 2RHQB 2Z58B 3RB0A 2GJFA 2KG1A 1U1RA 1OY9A 4DV5F 2GGPA 1WOSA 2ZH9A 1BY9A 3SCIE 3H59A 3KK1A 2LEPA 2JWNA 3SQGA 3D2WA 4C7QA 2ZHOA 6FD1A 3S7RA 3T41A 2DPJA 3H2VE 3N6MA 1AZSA 3T1YJ 4LF9J 4ANCA 4OI1A 3NGTA 4GKJJ 4UY85 3I0SB 2W4CA 1LW2A 2KFZA 2DXEA 2V50A 1QAJA 1U6BA 1RA7A 1SH2A 4WIIA 4X2BA 5T14A 1M90T 2E5IA 4DPTA 2HS4A 4DN9A 5B7WA 2IMWP 1RJJA 1RP5A 7AT1B 5B08A 4LRFA 3SMZA 2V68A 5H9FJ 1XR5A 1QSLA 2HFNA 2W7AA 1F60B 2R3VA 1FXDA 2EG2A 3HHLC 1JLEA 1U0HB 2O67A 3DLEA 4CH1A 1VHFA 3P96A 2DPIA 3EUNA 4A8KA 5HMYA 1MROA 1UA1A 1RBAA 1SUQA 3TR5A 1C0TB 4JI0F 2IHR1 1ZM2A 3VGVA 4TYBA 2DGWA 2BA9A 4RBUA 5G0RB 1OO0B 1A9NB 2UUWA 6FDRA 4C48A 1RHKB 1WOPA 3N6LA 1SI9A 5JXSA 3CJ5A 3QMQA 3CMAS 4YUDA 2OEMA 2WONB 1N0VC 2OKQA 4R0EA 4KHPF 1PIEA 2AEMA 1HNIB 5BR8F 3OFGA 4ED6A 3MMAB 1X9MA 3D0GE 1AXQA 4IH6A 2QEXS 2HZCA 3P5BP 3LALA 3D3CJ 4RNHA 3JSMA 1WEYA 2IRXA 4F4AA 2CQBA 1IVZA 1VDHA 5E0OA 3D0HE 4DQSA 4DFJA 1R8AA 4KE5A 2FLLA 4BCAA 1DQ9A 1PYOB 5I3QA 1JXEA 1S9FA 2FGCA 2UUAJ 1T9WA 1WG5A 3IM9A 4MYTA 1GXTA 5AXLA 4DV0J 4KO0B 5CZVA 2VQFJ 4ECUA 3G6ES 4Q45A 4WWSA 4YOEA 2G0JA 2HVIA 4LIRA 2Z30B 3MEDA 3DKDA 4L74A 2MQ8A 1S9EA 2XMWA 2AV5A 4ECTA 3A8EA 4CI0B 4URSA 1ZZFA 3M2VB 4ZP8A 1FFGB 3Q8QB 1BD6A 4UZBA 4CIOA 1RTIA 4OYPA 4MIBA 1NDLA 5CXTA 3GFYA 2W4DA 1MWQA 4WU2A 3RYLA 2HNZA 1G2EA 5LOQA 2HAIA 3AOBA 3HZGA 3K7RA 3UD3P 3K8VA 4F4XA 1HNWF 4JI5F 4QIFA 3VVUA 1Y0HA 3HHLD 1YGYA 2UVVA 3O8WA 3M30A 4ETXA 1S1VB 5ETSA 5F8HA 1KTQA 1U2FA 3KG1A 1HWUA 1REVA 4DLGA 3K89A 1RTJB 1GK8A 2ZE2B 1TQLA 3E3XA 5KFIA 2MQNA 2B9XA 3BM7A 2LU2A 2Q3PA 1S10A 2CPJA 3FSIA 3W63A 2YNHB 2C42A 2JFDA 2W25A 3POTA 3BSAA 1SC6A 1U25A 4DX8H 1SQEA 1SV5B 1JKHA 1QE1A 2VF3A 1FWKA 2DNGA 2XTJP 2ZM6F 1Q81T 8AT1B 4QPXA 4MJKA 3FCWA 1VLOA 1AUDA 4F02A 1ULRA 1U47A 4EYHB 3KHGA 3PFOA 2ZH6A 1HNZJ 1N36J 3GIIA 1D1UA 3NAIA 1FDDA 1ZS6A 3AHPA 3M2RB 1SQFA 4NMLA 1JLCA 4HYKA 4ELVA 4OZLA 1CC8A 3LP1A 4OHZA 4UTGA 4ZA1A 3R6LB 1FO1A 4U67Q 4ZHRA 4NASA 2ASLA 3L3CA 4ICLA 4U8YA 2K8GA 2C3PA 5DS7A 1T03B 2DGXA 2QV6A 1FJGF 5KFDA 3CO9A 3QRPA 2EKNA 3DDKA 4MKAA 4QWCA 1KFSA 3R27A 1APSA 4EYIB 3MM7B 3T19A 4LF9F 4JV5J 2BRLA 4RZRA 1N34J 4PQUB 2F8MA 5ETOA 1HW8A 4IDKA 4WE1A 2FLNA 2XO6A 3EPGA 4J9VA 2V8DA 4DBQA 1NJZA 3VALA 5I3UB 2VJUA 1S9GA 2N82B 3KUHA 3D66A 4ZCIA 2F8HA 2OPPB 1W2BR 3CIMA 4OIXA 1RAEB 2ZJQQ 4P2XA 3CD5A 4ED4A 3DNCA 3FQKA 4LFAJ 2XMAA 1TVRB 3I55S 2PI5A 1NM2A 1H2UX 1Q5YA 2V9KA 1WF2A 3DOMB 4W92B 1ZETA 1XEZA 4AQYJ 4YFUA 3LP0A 4PG8A 1F2GA 5I42B 2ZDPA 2BV3A 4IO1A 3E8OA 3QIPB 1EB0A 2WBMA 2E5HA 1EQMA 2L08A 4QBUA 1RT1A 1M5SA 2MPUA 3CCTA 2AJ2A 1NK4A 5J1PA 1F3FA 2RDJA 3B54A 1ZM9A 4PXCA 3LOUA 2DGOA 5A2QU 1H72C 4OYAA 2CQ0A 3QLHA 5HQLA 2HQCA 3EPIA 1JNRB 1TKZA 3KFWX 1YWXA 1XQIA 1X9SA 3AOAA 4XDDA 5LM7E 3BKUA 1V5IB 4RBVA 2C28A 1OIAA 3BGRA 4P9SA 2NYIA 3FUYA 3ENWA 2C2RA 3JQMA 2LVWA 1D8ZA 4IG0A 5LJ3Y 5IOLA 3IMQJ 4DV0F 4XTTA 2ZFHA 4U9RA 1R43A 2ACYA 2I6WA 3G6YA 2NYHA 1SQGA 4ZIVA 3LWMA 2RJZA 1SJFA 2M7SA 1UA0A 4NLVA 1NB7A 3FCVA 1R27B 5CCLA 2YKMB 2M52A 2OAUA 2KM8C 4RW7A 3QFWA 1WTBA 3R7BB 4R5PB 1C1BB 4C8ZA 2QYCA 3PHEA 3BBCA 3MM9A 4NXMJ 3TUIC 1VQNS 2EEYA 4DR7J 4RU9A 4OI3A 3OR2B 5D0GA 2XC9A 4ENOA 1D09B 3VTIA 1NUEA 4C3KA 1FA0A 4EGLA 4DI6A 4RUCA 4DSEA 3OT9A 3M7VA 2OI2A 3EDRB 2WVBA 1FJ7A 3FZBA 4MK8A 2LCWA 3MPVA 3X1LB 4OI4A 4LFBJ 3AQPA 1H38A 3HO1A 3UDLA 1FRXA 1Y3KA 2BE7D 3K5NA 3BYPA 5C25B 5IM0A 1KRPA 2BUNA 4OHYA 5CHCB 1KKHA 1N6QA 2DNPA 4E0DA 2K06A 5KFOA 3IGNA 4EI2A 3AD7C 4I2PB 4GVBA 4P73A 2MQQA 5M2UA 1S6OA 2CXEA 2QG9B 4PUOA 3J81Y 2HGNA 2EBGA 4EBEA 1WC4A 5ADZA 2F4VF 2RH3A 3KJQB 1HD1A 4RNMA 1ZTTA 4QZVB 4C11B 1HMVB 1T8EA 1S1WA 5AE1A 4JI2J 1JLGB 4TKTA 1I5OB 3MURP 4YR0A 1FEEA 3MMCA 3PW5A 4RU2A 3FKBA 3PKMA 2PSZA 2PE8A 3MPWA 5KAKA 4DQPA 4DSFA 3LGMA 3DHXA 1KTVA 1QJHA 4WXOA 5DGAA 1ZTWA 4X4RA 5HK4A 1EARA 1DLOA 2W2OP 3AXMA 4K5RA 2A6OA 5K14A 4IOAQ 3BSOA 2D9PA 3HVAA 2V4RA 4TQRA 3VGSA 1WD6A 2M9KA 3SI8A 1HBMA 4K4TA 4P72A 1F9HA 1P1TA 1LW0A 4UQTA 2GMLA 4ZCMA 4G1PA 5THWA 2DYAA 4LJMA 2VJVA 1EETA 3HVTA 3O44A 2EI5A 2FQQB 4RJVA 2CADA 3T1AA 5IT9U 3IS9A 1U02A 3ISNC 3DRPA 1VQPS 3ENQA 4DQQA 4U7UK 1DZ5A 5F8GA 1N34F 1V3RA 3H42A 4WKRA 3OL6A 4DUTA 1C4AA 2MXYA 3H20A 4EZ9A 3VAMA 1U2CA 3DHWC 2MQMA 3W5YA 4DV4J 1VJQA 3CTRA 2HFZA 2V2KA 2GVDA 2AP6A 3GONA 3RR7A 3G87A 3V6DA 2RT3A 1IKWA 3CMQA 2AX0A 4HT5A 4YR3A 5C7PA 2VODA 1RTHA 3ZZUA 2BABA 4OYIA 3HCXA 2BBEA 5F8MA 2G1DA 2CA9A 2E5JA 4AQYF 1GMUA 1KONA 4OZNA 3MWBA 4UUWA 1GAOA 5KFTA 4DQRA 4BWMA 1EIYB 2CPXA 1N5YB 3OXFA 1YZ7A 4HACA 1P8GA 4P52A 2R7OA 4YHHJ 3OUYA 2E1RA 3H2LA 4A8YA 3O1LA 3QRRA 3EVWA 4CLSA 2Y0BB 5KFYA 4M5IA 3D67A 1B3TA 4F8RA 4Q8FA 5ETPA 1KOHA 2IVMA 4ILLA 4C0OC 2DHSA 4DFMA 3S1TA 1TKXB 3VCDA 4XPCA 3AQOA 3H5YA 1J27A 4YY3F 2BW7A 2DHXA 1BQNB 1S6QA 1FKPB 4I6AA 1D9FA 4QWBA 4F36A 2M4MA 4KGMA 4U6PA 4J5OA 2GZOA 4LF6J 1HR0J 3H5XA 2B51A 3M6UA 4KSEB 2ZJPQ 1IBMJ 2R2RA 1U24A 3C6TA 4I69A 3CB4A 2RUGA 2KB2A 1UEVA 3V6KA 5I4MA 4B3RF 3AB2B 4GVBB 2XMVA 3K5OA 1EQ0A 3W2WB 3BEGB 4JI3J 3AD9C 2E9TA 4HEA9 4QWEA 3G9CA 1SJ3P 4K0KF 2X51A 4NZ0A 4LREA 4GKKJ 4Y2MA 1YRXA 5KOWA 5B0CA 1VGYA 2VHGA 3CJ8A 1G3OA 2GHPA 3GIKA 3PDNA 3ISND 4F2RA 1NJWA 5D78A 1QLNA 2DB1A 1GMVA 2YWGA 3MM5A 2VB6A 2AJ4A 5DG8A 3GFXA 4DR7F 3DOKA 4HHJA 3EX7B 1JLAA 1PC5A 4NRTA 3R3TA 2GQ2A 1XJWB 3NLCA 2GMHA 2H3EB 3CVKA 3W5ZA 1NK8A 2LQ8A 5HATA 1RACB 1OSCA 1F2HA 2W2PP 4DFPA 2RQMA 1XERA 1H6KX 1K1QA 5HQMA 2DNHA 2FZKB 3CC4S 1J5EJ 3R1HA 2CQGA 1DJ0A 4MKVA 4KGVB 3PO4A 2C1EB 2ZH2A 4OHVA 2R2TA 2BKNA 1YK9A 4ZN1A 3FRYA 1WF0A 2NXUA 5T7LA 4WBFA 2HAFA 1RHJB 1RHRB 2JLEA 2UUCJ 4C0HA 1DTTB 4A8SA 3CMES 3D7SB 4ED3A 4ZPBA 5A0YA 1RKIA 1Q4RA 1VK8A 4OZJA 4DL2A 4J91A 3PYEA 4JI2F 2BRKA 4IFYB 3ENAA 2BANB 3CJKB 4DR3F 2YNFB 2XYPB 3TNVA 1IKWB 5D3GB 1TL7A 4M5DB 1J5OA 1HW9A 4ERDA 3MFIA 1WHWA 2ZH3A 5KFRA 5EGYA 3K2YA 2V67A 4AD6A 3QATA 3CJQA 4OI2A 3W7BA 1HNXF 3KJVA 2VQEJ 1Y11A 4Y2KA 1X4DA 4GO7X 2AWZA 3R1LA 1S7HA 1CJTB 2VD3A 3HHLB 5KFWA 3NGKA 3QAEA 1GXUA 3MAQA 4DSIA 2ATCB 2ASJA 5HVFA 5GMDA 1MNEA 5F41A 5KFCA 3BYRA 3HLUA 1X4GA 4LF7J 3MOJB 1Y5IB 2I9SA 1Z1ZA 4MIWA 1JIHA 1RUSA 4OYZA 4DPWA 2O01C 3CCWA 4PXEA 1GMWA 2E9RX 1JJ4A 3OL7A 2DEJA 1RT6B 2ZD1A 1CS4B 3IAM9 1WC0A 5IC6B 3L9ZA 2DISA 3W61A 1WHXA 5KFXA 3S6EA 5D8HB 4L73A 2N7YA 2WVFA 2KI2A 3M32A 1V6HA 4QIVA 2QGFB 4X4VA 3BGUA 1UVIA 2XGQA 4PYDA 2C22A 4IQXA 1X31C 3ZO7A 5LMUF 3KLEA 4Q2LA 3IC1A 4WYWA 4YB7A 3KKFA 2D69A 4LF5F 5CYMB 4RNOA 2KHDA 1MU2B 4CO1A 1S0VA 4Y2CA 4YHHF 3EVMA 3H7HB 1L5UA 3V5RA 1DAXA 1UJ4A 5ETVA 3KK2A 3UNGC 3W60A 4NXNJ 2A1BA 3V4IA 3EXYA 4UOHA 2L9NA 2Z2LA 2V9WA 4DV3J 2BJDA 2EWHA 4ECZA 4NLRA 5DG9A 2GQCA 2B8PA 2MGZB 1UZDA 7FD1A 1LNQA 2LA4A 1XNRF 2OIHA 5HSPA 3TEGA 1NPKA 1UVMA 1HI1A 4O4GB 2CRLA 5AJ3F 4LF6F 1HR0F 3DLJA 1VLYA 2B4PA 1Q16B 1X4BA 1DQAA 2HPUA 3DMJB 1S0MA 1E6VB 2VG5B 3I5CA 5HAOA 1HBNA 4FVCA 4DCPB 5LJ5Y 1RT2A 4H4OB 1RU2A 1OY6A 1MMLA 2O5DA 1F6TA 4ZK7M 1K0VA 1BLUA 3J7AN 4DR6F 3OQ2A 5D15A 1YJTA 3Q8PB 4FYXB 3OFHA 1MSWD 3DLHA 1PCAA 3PX6A 3R5JB 2AEFA 3MEEA 2DXFA 1UEUA 3IG1A 3Q2SC 4ITSA 3FSYA 1IBLJ 1U1OA 2R8HA 5DG7A 3DLGB 3KK3B 4FS1A 5IWAJ 2P8IA 2CWXA 3Q8SB 3G8QA 1S7IA 3MR5A 1T9TA 2DGSA 1S12A 1W25A 4A8MP 3VHQA 4DR1J 5KFKA 3O2IA 2VZ9A 1EZZB 2HHHJ 5J2MA 1OY8A 2XS5A 4LF8F 2RF2A 3FBCA 3A8IA 4M8LA 3NRBA 3CDUA 1J5EF 5E5NA 2POKA 2V2VA 3EZUA 2H5JB 1T9VA 3A8JA 1RHQB 1FF2A 1HQUA 2VFSA 4ZVTB 1S1UB 4C8KA 4KY3A 2I0XA 4DV1J 1XN9A 5LMNJ 3PYGA 2E7VA 5C24A 1NSAA 2FY8A 4U8VA 3NGSA 3LP2B 1NAQA 4X66J 2AZ1A 2P9EA 1Q53A 3KLGB 1M5HA 5H9EK 3WC2A 5K8NA 2W9AA 4ZMMA 1ZH5A 4ES2A 1NRKA 1KQGB 2HK2A 5ITHA 2DO0A 2XYHB 1LWEB 2DRAA 1U7LA 2MLXA 4RNFA 3AD8C 5FLXU 3MMBA 2J0WA 3R8YA 4H4KC 4IFVB 3TX0A 4NLWA 1S5ZA 4QU6A 3GB0A 3BJYA 3A12A 2KXHA 4RNNA 1UVKA 2ZC3A 2AEJA 3TQEA 2VQEF 2CG4A 1ACMB 5DLFA 4A8OA 1IR2A 2G2OA 3IRXA 2B5JA 3MD3A 1SJRA 2UXDF 2JVRA 1UP1A 1K0TA 2RNEA 4BC9A 3OVBA 4UOFA 3N5BA 2N7CA 2HHQA 3FDSA 3EDQB 3CXCR 1Q82T 4M5LA 4JV2A 1P27B 1PJ6A 4AYBD 1V3ZA 3DI6B 4OX9F 2CZ9A 2JEGA 3UVJA 3FGVA 3KMQA 1S0OA 4IH5A 3I4PA 2BYCA 2AYGA 2LEBA 4P10A 3C14A 1XK8A 4C8LA 4FPIA 4CT9A 1JLFA 4OX6A 4MK7A 2D3OR 2MQOA 4Y6IA 3MI7X 5L38A 2CQ2A 3HFZB 5C5JA 2OSRA 1IN0A 2DHHA 3PW4A 4ID5A 3OJSA 2GC8A 3M8YA 2DIVA 4E8UA 1FK9B 1F9FA 3IA0A 3CJTA 4EU0A 4Y65A 3TUZC 2HMIB 2OP5A 2YKNA 2OFHX 5A8KA 5F9NA 1MG7A 3J7Z5 3BF4A 2DR9A 4NXNF 1SJ1A 3SEOA 4B9TA 5KFSA 2QLXA 2RE1A 2HHUA 2PD1A 4I4BA 1TL3A 3CCRS 4AXJA 2IC3A 1RA6A 4DV3F 3CC7S 4Y34A 3WIUA 2SXLA 4OL8A 3M2UA 2J0QD 3D6HB 2OEJA 2NXNA 4KV8A 4R25A 1YBAA 5C42A 3Q2TC 4C3MA 5DDOC 1KR4A 1XR6A 3IN5A 2IAJB 2EPIA 1UPPA 3H8YA 3U1MA 5B09A 2CJKA 3AFGA 3LO3A 2KN4A 3KLIB 5KTQA 4DJBA 4DV7J 3MM6A 2ZBCA 1WF1A 2X3GA 1HQUB 1CPZA 2RU9A 3N5FA 3N6NA 2BJ1A 3MUVP 4I7FB 3B6BA 1YX2A 1L3TA 4PRFA 1SXLA 4N41A 3D6TB 1SIZA 4DV2J 1GXLA 2DNOA 1LWFA 4NLSA 2DHAA 3J80U 5CCMA 4ZVQB 1VYAA 3EMTA 1RT4B 3CO0P 3JYTA 2QIFA 2AJ0A 2HWIA 2QO3A 3IFEA 1TAUA 1TP7A 1SJ4P 4NEYA 4BHQA 4DL5A 4FF2A 4I56A 4CM2A 2CVEA 1Y7PA 1Z4UA 1WUUA 1FDBA 3RTVA 3THVA 4QU7A 3MCSA 5IWAF 2ZH7A 1DFDA 3DOLA 1TMMA 2HGMA 3E2EA 2M0GB 4OJGA 5HVHA 2CNOB 4DSLA 1XMBA 3TOQA 4DR1F 5E7OB 3SSRA 1HBUB 1IKYA 1HWKA 3HD1A 2HHHF 5D0EA 2RDIA 4X62F 5K5MA 3TZYA 3ZTOA 3PIOQ 1RWWB 1RDRA 1IWAA 1X8DA 4A47A 1NJXA 5FIIA 1MLAA 1CJUA 1P6TA 1VQSA 1CLFA 2AYMA 1HYSB 2B6AA 4FXDA 4P75A 4R8UA 2V8HA 1AROP 1RAFB 4OZ3A 3KMSA 4DV1F 2ZJRQ 5LMNF 4XDCA 1S77D 1BQMA 2M3DA 4Q8EA 3QFHA 2RVJA 4JYAF 1XBWA 1RTZA 4X66F 1WI6A 1UPMB 1GTHA 2MY8A 4CYUA 2PFFB 2HG4A 1IBCB 4QIWD 3KOAA 1RADB 1VBZA 2ZDOA 4RW6B 4QJVA 4M5MA 3DXSX 2VOOA 3I82A 4GVLA 2HFOA 2JEIA 3PYDA 2C2NA 4I64A 4TQSA 3PRVA 3FMBA 2MDAA 3Q83A 5KFNA 4B9NA 2HNDB 2ZUAA 2YNIB 4DFKA 2VFRA 3C15B 2QFJA 2YNGA 3I32A 3TJ8A 4IR1A 3UDEA 2GJIA 4O3NA 1AFIA 1TUVA 3DFEA 3DRSB 2FYXA 4QW9A 2DKOB 4I0WA 1RISA 2OSQA 3KHLA 5A8RB 1NKBA 2CQDA 1VRTA 2GIRA 3DLKA 5F9LA 4JB8B 4ZVFA 2WSEC 5HBMB 1AFJA 3F44A 4AUKA 4WPAA 4WK1A 1B99A 3JB9k 1PYSB 1TK8A 1Q7LB 2R7RA 3EM1A 4J9SA 4ZCKA 3UCUP 3RZAA 2CJ9A 3US5A 1WORA 3MEKA 5KFAA 4D3GA 3B8HA 2PN6A 4RW9A 9ATCB 2QTWA 3S01A 5HLFA 4XK8C 4X4SA 3TYTA 3N4WA 3KJFB 1T0TV 4ID8A 2LEAA 3R7NB 2QLJB 3GP9A 2E1PA 2YKPA 1HQ2A 2GO9A 3VVTA 1EP4B 1KC8T 2IRYA 1I94J 4I6WA 4WF9Q 3RBXA 5J2PA 2KL8A 3G6VA 4TY8B 3PEHA 1KLMA 1T9UA 1Y3JA 2MJUA 5KFLA 4B9LA 4WFNQ 5HMWA 4ECSA 4DL6A 1HA1A 2YY3A 3BH6B 2CJBA 2JHEA 3IP0A 3BQ1A 4YB6A 2Q79A 3U02A 4Q0BB 1X4AA 3ITHA 3WHIA 4BC7A 5FJ4A 1HBOB 2DRBA 1CJVB 4DR2F 1CBKA 4B3MJ 1AT1B 3K17A 2MKCA 2DGUA 3NP5A 3V81A 3ZZ0A 1GX6A 3OL9A 3IWLA 3HSZA 5IFMA 1XMQF 2QJ3A 2JDJA 5KG7A 2FHJA 1TV6B 3I0RA 1R3NA 3HM9A 1FNOA 4JV1A 2FHMA 5JVGQ 1FDAA 4C2MA 1U6ZA 1U1KA 4OI6A 3KDNA 3HI9A 4RW4A 2XBPA 4ALZA 3RBDA 4N76A 2X7IA 1VISA 4C3LA 5HANA 2HNYA 4ZVGA 4ILRA 4DG1A 2D3O1 5FDLB 1CJUB 2VONA 1FHTA 1C0UA 5J2QA 3MOZA 3M05A 3UE2A 1F5AA 4LRBA 2LXUA 5C2GA 3TANA 1FVQA 1U1NA 4NLQA 1QAXA 2UZAA 2ZH8A 4USUA 5DM7Q 4PKDB 4FF3A 3BGFA 5CQGA 4KFBB 2L3MA 3KTQA 3PY8A 2FVSA 1FNMA 2LXFA 1FWLA 2BX6A 2QMXA 4NCBA 1HQEB 3GU0A 3PYFA 4DR4F 4IG3B 2OH2A 1HFEL 2CPEA 1Q95G 1P9YA 3OHBA 5LSLA 3MECA 2P6SA 4QIGA 4URGA 4NYOA 5K20B 4JI6J 4AT1B 2N4DA 4X4NA 1ZA1B 2R8JA 3SV4A 1JK9B 3GYXB 1HHTP 3LA0A 4NPOA 4C98A 3MGJA 2XI3A 1X4HA 3C3LA 2A2DA 1R31A 4IRKA 1OWXA 2FLOA 3DYAA 3FEYB 1VC6A 5J1EA 3A3NB 3RGIA 1WC6A 1OPIA 2JL9A 4CLFA 1OPZA 4WFAQ 2LLZA 1Y5LB 1OSDA 4U96A 1DURA 2CQ3A 3IBWA 4ZVOB 2BKOA 3KYLA 3NOCA 2CJYB 2YPYA 3E01A 1RSCA 5HP1A 1WC1A 2B9WA 1HNVB 3HFVA 2C3OA 3FVYA 1K8AT 2XO7A 1VRQC 3PO5A 3CGIA 1TTHB 1H98A 2VA2A 2FJVA 4P74A 3BKFA 2OPQB 4DMZA 2LQBA 1DBDA 2JRSA 1BWVA 4B3TJ 1LWXA 4ZP6A 2MY7A 4AE5A 3OTDA 4WZQA 2F5GA 2MLZA 5GADU 3LANA 3QJLA 1QM9A 3TVYA 1X60A 3BN7A 3W2VB 5HN0A 2GHVC 2ZZNA 3A4TA 4UZCA 4TY9A 2XSJA 4F4KA 1TELA 2BE2A 2BM0A 2HHPA 1UL3A 2BQ3A 2WOMB 3A3PB 5F8NA 1XNQJ 5EWGA 4ZPDA 1EJ7L 3K8WA 1RAIB 3RRHA 1WI8A 2I5JA 4CM0A 2G0IA 4JUZA 1JLBA 5T41A 3KLHB 4B3OB 1X5TA 3PFEA 2HZVA 2WK4A 1UAWA 3D28A 3CCMS 4KB7A 3W8PA 3RRGA 2BZ2A 1WNEA 5AE3A 2KVIA 3BH7B 1FT8A 4F2SA 2BE9B 1Q78A 1S0NA 2VG7B 2XY5A 4PWUA 2OLWA 4KGZB 2YX7A 4P2SA 2FVQA 3LUYA 5LSOA 2R7TA 4M95A 1X0FA 1ZBTA 5KT5A 4OYMA 2KVQE 2RKIA 4ZKAA 4ZVHA 2IYGA 4OMFG 2GVZA 5GADI 1FX2A 4QYZK 2D3ZA 5ETNA 5DZ6A 2W8LA 1FNXH 3H40A 1X5PA 3K5MA 1WSVA 5BYRA 2QLFB 4TLQA 3HHKA 2NS1B 3PV8A 2P9GA 3GIRA 2ILZA 2DCLA 4P7TA 3N28A 1PKUA 3CUNA 1Q8KA 4ZJLA 2OPRA 3M1VA 2KYXA 1UVJA 4R0JA 1QUPA 1IJEB 3AJ1A 2HFVA 2MLYA 3NAHA 1PJ7A 4QR2A 2YKOA 3GV5B 2OFGX 1BC6A 4HL9A 2ZZMA 1UWAA 1WKJA 4KIAA 1UWBA 4LSNA 3TAMB 2XCAA 1S72S 1VI7A 4LF2A 3BDEA 2OPSA 3LAKA 3CJRA 2J76E 2MZJA 2KFYA 4ES3A 3G4SS 2J0SD 2F8EX 4K4YA 1GX5A 4JP8A 4B02A 1T9YA 2JLFA 1R6YA 2HQ3A 5IQQA 1FDNA 5GMKa 2D7SA 2YX4A 2G1HA 4LQ9A 1CULB 4PPZA 1X4EA 4PWDA 3Q24A 5IT4A 3I96A 3CSKA 3W5XA 1NK6A 4ZLJA 4E98A 1KQFB 5EX0A 2XEXA 4OHXA 5HP1B 2WRMA 4PYAA 3HKZD 4USIA 1HPZA 1QUVA 3PR5B 2WVDA 2CQIA 4DR5J 2IM3A 5B0AA 3DGPA 5H1SV 2IY5B 2JZ5A 3ETMA 1IBKJ 4B3SJ 4Y3CA 4CWBA 4USWA 5L9XA 4LRAA 4RX6A 3TEHB 2U2FA 3PVXA 2UUBF 3DRRB 4LSLA 1G4CA 2WVCA 3D54A 3N0VA 4WFZA 3M8QB 2MQPA 3HT3A 2G0CA 2FC8A 5IZHA 2DVIA 1S6PA 2KYZA 3R5CA 2DBBA 3MPYA 4F0HA 4J9PA 2HBQB 4ZN3A 2ZEJA 2MQLA 4DOZA 1SH0A 4MFBB 1NLKL 2ATLA 5A6PA 2B8QA 2AJ1A 3GCWP 2UUTA 3EJMA 1H0HB 1P9QC 2UU9F 3G8TA 5M2PA 3HPOA 4MKYA 4L76A 5GAEU 3MCOA 1Q7YT 2UV8A 4J9OA 1UFKA 2HWTA 1FRHA 2WBRA 2Y3YA 2ZOMA 4G1QB 4L75A 1TKTB 1UW4A 3BO3A 1E6YB 3SDEB 4BWJA 3C6UA 1R0AA 5K9FA 4IO9Q 5HROA 4O44B 4ZJOA 1UW9A 1LWCB 2MSSA 3ZTRA 1UTAA 1WACA 1YDLA 2Z2YB 4JI7J 3OR1A 5F0UA 4FNIA 3ILIA 3H4BA 2YQ1A 2HHXA 1VRUA 2EFVA 1IWGA 4GC7A 2FJDB 4Q44A 3KHRA 1N33J 5D6GA 4ZLLA 2HVHA 2R8GA 2QFIA 3ZFVA 1HKAA 1HL6A 4I2QB 3I9V9 3CCJS 4HH1A 3M4XA 2LFVA 3MAAB 3E51A 3J81U 1HI0P 4DL3A 5DO2A 2C2MB 3DXBA 1IKVA 3AXKA 3BR8A 4JV0A 1K47A 4O4RA 1VC0A 2HHWA 4UUXA 3GFZA 3K5PA 1SB6A 4UOCA 2BXJA 5AE2A 1NJIT 4CH0S 4JI4J 5GAEI 3R5AA 1RT7A 1WC5A 4M63A 2C3UA 2HFSA 3HVWA 4W98A 2ROGA 5KFPA 3AJDA 3O5TB 2V69A 4ZPAA 4O0NA 2PFDA 2XMMA 4QYRA 3MR6A 4KH1B 4MKBA 3UD4P 1CJKB 5E3PA 4M5KA 2RU3A 2NPFA 1XIQA 3ULHA 3QGIA 3QBCA 1I3OB 3HSDA 2AYEA 1RZMA 2DR6A 1BXNA 1JLQB 1HWJA 3NBPB 2HVZA 5MAOA 4Q5VA 4DZ6A 2XNQA 2J0XA 4AXIA 4CTAA 5L1KA 3TJAA 1N32J 1BMQB 3BN4A 5LXYA 3H98A 4YQWA 3VV2B 3EGZA 4C6AA 4F67A 3R2CJ 4YS2A 3M8RA 2WCXA 3ZZYA 1WELA 3TWZA 1TU0B 2GO8A 2J9DA 1TL1B 1GTEA 4EO6A 1UFLA 4DV6J 4PZVA 3VAFA 2ADCA 2CVIA 4H54A 4RKUC 4KTQA 5F0WA 2VIHA 1G1XA 4IH7A 3FZ2A 5KFZA 1PBUA 1HLWA 1FD2A 4NA2A 4ZVSB 2IMOA 4IQMA 2R7SA 2HGLA 5EWFA 2J8SA 4RW8A 1H74A 3M9MB 1ITPA 4DCOB 3LWLA 3NKYA 3ZZPA 4MTPA 5LL6d 4AFFA 5DQIA 5J2NA 1KVIA 1JWWA 1YSJA 2F1FA 1RAJA 2I1RA 2DNMA 1FTRA 4AL6A 1VBYA 2IVFB 3OTOF 3SFUA 2DJWA 2FUG9 1EHWA 5HO4A 1DTQA 4MMOA 1R89A 5KFQA 2HFUA 3GILA 4PAAA 2MEWA 4K5SA 3M8PA 1F3VA 2ASYA 2VKZG 1CC7A 4AL5A 3EGNA 2GGPB 2E7WA 2ZVSA 3G8SA 4ZIWA 2XS7A 4NYZA 2ZNZA 2ERRA 3KK1B 2P5VA 1AYEA 2VUGA 2Q6BA 5ETMA 1YJNS 1ICEB 3SQGB 2OUGA 3OW2R 3MR7A 4KGXB 5BXIA 5LSRA 1T3NA 3GLJA 1AZSB 2E1CA 1KVJA 3GR1A 4DR5F 3HT0A 4X65F 1LW2B 3ETOA 1DHMA 3C2PA 1IBKF 4B3SF 1C1CA 1VRUB 2EFOA 2XULA 3HULA 5L8RC 2LECA 3GCXP 5GVQA 1RT5A 4NCGA 2E44A 2DNRA 1GFWB 4LFCF 1BQXA 1JLEB 2DRDA 3DLEB 1VQ7S 3Q8VA 1FRMA 2WB4A 2EFQA 4ECVA 1MROB 2GMJA 2MB0B 1SUQB 1XMOJ 3KG0A 1YJVA 1JB0C 2VH7A 1Y00A 3G71S 2DO4A 2PEHA 5ETQA 2QMUB 3T9ZA 2VBYA 1VQ8S 1FCAA 4IUFA 3JTPA 3FEXB 2ZHAA 2DT9A 1I1GA 1N54B 2M8HA 5I3PA 3MMJA 2VDHA 2X1BA 4F0KA 3Q8RB 4C4WA 4CLZA 3LPYA 2APOA 3MTJA 2B56A 3T1YF 3T6JA 1FRJA 1L3SA 1G6BA 4GKJF 3JSMB 3UW1A 4WU3A 1S76D 2XLJA 4N77A 4UF4A 3QYYA 3OD2A 1RTDA 3W62A 4ED5A 2V0NA 3JAMY 2C2KB 4W90B 1RWVB 1YG0A 3VZHA 3ILOA 1N33F 2JH3A 4OQJA 2V2ZA 2U1AA 3DN9A 2MYFA 3DM2A 1IKXA 1H7XA 1X7VA 1PYTA 2MKYA 2R7VA 2IBKA 3GTYX 2D1CA 1H3DA 1M1KT 2RD5C 3MEDB 5CYQA 3LPEA 2EC2A 3VF0B 3IWNC 1S1TA 1S9EB 5JJBA 1AUSL 2ZBQA 2MSTA 3MM8A 4NEZA 3RBZA 5CD4A 2E7XA 3MD1A 4B17A 1U8WA 1KFDA 2MJNA 3BSNA 4YR2A 2HRTA 1U09A 5ETKA 1SBRA 2W2MP 4NI2A 1RTIB 3P49B 2QL7B 3JSBA 2FJXA 1GT8A 3QO9A 4L3KA 3TVKA 5B0DA 4M1KA 3WQPA 1FXRA 3UR0A 5GMEA 4K8RA 1NO8A 3TX8A 2HNZB 1VFJA 3BO2A 5BYSA 2ZKTA 1N32F 3FQLA 2H9ZA 3LF0A 1JNZB 4LVNP 2GQQA 2MZSA 3M8PB 2VG6A 3BZQA 3M30B 3ET6A 5KG2A 4TU7A 3T6BA 1SPBP 2FC9A 1OMSA 3Q8YA 1B4SA 2KZMA 2HVDA 1KEKA 1ZZNA 1I51B 2C3YA 2UUAF 2CPYA 2IPOB 2V5HG 3QGHA 3RB4A 3G82A 1REVB 2CUYA 3ZXWA 4H4MA 2DHGA 2QMWA 2VQFF 1IR0A 4ZVPB 3D9BA 3LGHA 1HWIA 1FKAF 3LGNA 5A8WA 4J9KA 3W8GA 2YTCA 5K8OA 3POTB 1SC1B 2UVRA 4MYUA 2H4YB 1S6UA 1C1CB 4K4ZA 1JKHB 1QE1B 2UXCJ 4DUYJ 1RXOB 4LBPA 2WB1D 3L7PA 4K4XA 2NXJA 2R2UA 4JI1J 4MT1A 2G2YA 4OLPA 3EE3A 1KLNA 1IM4A 3KLFA 3K57A 2VV5A 3I5AA 4DV5J 4J9UE 4V1Ak 1QSSA 2V4JA 3QT6A 1JLCB 4F04B 2LYVA 3GFHA 2Y1JA 2E5GA 1NHVA 2VBZA 2Z0GA 2ZWPA 3LP1B 5DGBA 2W9BA 3NMAA 1IQTA 3K0JA 4ZHRB 3VAIA 3DRYA 4LMZA 1T05A 4ICLB 4DL7A 2HWHA 4DCJB 1NSQA 2CIMA 4GO5X 2RQCA 3MR3A 3PTWA 4PG4A 3UPFA 1KD1T 2OMLA 4KKOA 5E33A 2WAQD 2RQKA 4NOHA 3Q23A 2M2BA 4IOBA 5D77A 2R2SA 3EICA 4YDXA 3IM8A 1TL4A 5D4OA 4RWXA 4IDKB 1VS3A 3QPIA 4WE1B 3BBFA 5KT3A 4EWTA 4F50A 2MHEA 2ZZTA 4FN5A 2J6TA 1S9GB 1BGXT 3MEGA 4JI0J 2KG0A 1YVFA 1TL5A 2AYBA 2HYIB 1HNZF 3HSJA 2CQ4A 1N36F 1R6VA 1IKXB 3DC2A 1Q79A 5DLGA 4S0MA 3DDIA 5EUHA 4WIQA 3D6MB 1KBRA 4QR1A 3LP0B 4KHRA 5BR8J 3KHHA 4Q43A 1VCTA 2HW3A 4DU7A 4DU8A 2DNZA 1RYSA 3P45B 4DF8A 2XLKA 3SV3A 3I0SA 4LBHA 4WFXA 3MUMP 4EFAC 3RBEA 1RT1B 4DF4A 4OYWA 1WHYA 2CNNB 2O66A 3C46A 4CLLA 1LOUA 3AA8A 3NL0A 1VBKA 3U7JA 1SKWA 2CAJA 4U7CA 4G3IA 2G13A 1WG1A 2FHOB 4RPFA 4JV5F 3TO8A 1DQ8A 2AZ3A 3QLHB 4F0MA 2VPZB 3IRWP 2ZWOA 4YB5A 1U0HA 2DGQA 3W9IA 2UXBJ 4UQGA 2MKSA 2VC0A 1SKSA 2CJXB 1RCXB 1TKZB 2DNKA 4UT4A 1KWMA 2AKWB 2XSFA 2BMBA 2XS2A 1C0TA 1T7PA 1TUWA 3VGTA 3BGRB 2K1RA 3OSPA 5KG6A 1BHNA 3TA0A 5G0RA 2R7QA 1PILA 4JI8J 4IG0B 5GAHU 4LFAF 1V3SA 1YIJS 1UJ6A 2GS8A 3TVZA 2BQRA 3NCPA 2XMTA 4YDDB 4GMKA 2WONA 2LXIA 1X4CA 4ZCLA 1HNIA 3MMAA 4IYQA 2FPHX 4CP5A 4ZITA 2XHWA 4RW7B 2HRUA 3UN2A 4FYWB 2X1GA 5KFGA 1YQHA 4EZ6A 1HNWJ 3A3OB 5HVGA 4PR6A 2KZZA 1NKEA 4JI5J 4OX8A 1CEZA 4FF1A 2L9WA 3MM9B 2WW8A 3CCQS 1S59A 4YN3B 4O23A 3OV7A 1FRLA 3ZZZA 4FBUA 1L3KA 1W7WA 4PQAA 3NGUA 3U27A 2OMOA 2E1MC 4G6VB 4OZ0A 4KO0A 4J7CA 1NK5A 3IWXA 1N5SA 3IAS9 4LR9A 5KG5A 2XYGB 2QA1A 4V19J 1TFYA 1KP6A 2V63A 3IGVA 5IM0B 3M2VA 4URQU 5BYQA 1U0SA 4LSZB 1N6QB 2ZM6J 4ZPCA 4QPTA 3GPAA 2J7KA 3PIPQ 2ZUGA 1YJWS 1VQ5S 3JQJA 5IC4B 1KDNA 4PUOB 1JQGA 3HXMA 4TU8A 5H9FK 4WTYA 5SUHA 4Q7AA 1PGZA 3ZNJ1 2AIRB 1RU1A 3R6GB 2HIQA 1S1WB 1IXKA 1UCNA 3TARA 2QSWA 1U45A 1U26A 4NYPA 4RUHA 2A6MA 3MMCB 4BBYA 2YWFA 3ZNUA 4NXMF 4HI2A 4UW2A 1S1VA 1Y5NB 2YWWA 3HD2A 2BR0A 1K9MT 3SZ2A 3NWRA 3SQOP 3DCAA 2Z2ZA 1FJGJ 1RTJA 1DLOB 1JJ2R 2CDQA 2ZE2A 4F3OA 2F63A 5K14B 4LR8A 3M6VA 4LFBF 3BSCA 3NG8A 4ETZA 3L4BC 3L95X 2YNHA 4O3RA 1HBMB 4F4ZA 2A3JA 1LW0B 4BDPA 2UVUA 1TKDA 3NNAA 2WHOA 1RAHB 4I6YA 4X84A 2K7KA 1SV5A 5D0HA 3FCHA 1EETB 3HVTB 4TYAA 3D1OA 4OLOA 2HBZB 2GNKA 4A46A 3L7OA 3IS9B 2YQ3A 3DRPB 3MDFA 3RUBL 4CLPA 3EGVA 5DDPC 2QA4S 2NUUG 3BPSP 3JS9A 4E2FB 4F4YA 3GV7B 3M2RA 2AD9A 2XNRA 1QTMA 4DZDA 1Q8BA 1A7GE 2XI2A 2PMWA 2BW2A 5CZXA 4KH0B 2GVDB 2RUSA 1NBEB 3I9ZA 2HEKA 3C8YA 2K1RB 3NY0A 3V6DB 2Z8QA 1WJ9A 1RHMB 1LK5A 2KTQA 2ASDA 4PCQA 2YWHA 3HP6A 1RTHB 3GJSB 2KDOA 1T03A 1ZAVA 2XWXA 4P71A 3NEKA 3JSRA 2B7BB 2Q6CA 2CQCA 4K4WA 5K8MA 4K4SA 3FEZA 1F5CA 4RR5A 1SKRA 2AGPA 2AT1B 1Y4ZB 3T1HJ 5EX3A 4CO2A 3MM7A 2VC1A 4HACB 4WP8A 2PA3A 4FXVA 2XQCA 4KPYA 4PQUA 1HHQA 3OUYB 3RRKA 2QA4G 4I68A 1W2IA 3OVAA 5KFHA 4K7QA 3CDAA 2H4WB 5I3UA 3LAMA 4CZCA 4NLTA 4WJBA 2V2QA 2OPPA 1H2VZ 4NX9A 4WP3A 4ANEA 3CJSA 3CJ4A 3R5GA 2N3OA 2UXBF 1TVRA 1S6QB 2JSXA 2HURA 2R8IA 2ZBPA 3DOMA 4P2FA 3PJXA 4DV4F 1RLCL 1KHWA 3CD7A 3IR7B 2F65A 1WOOA 5I42A 2R42A 1N52B 4C8MA 3TUPA 3VR1A 1NJYA 3W64A 1YBTA 3CCZA 1RBLA 1FEHA 3QIPA 4JI8F 4ZP9A 3IBCB 3C6TB 4CO4A 4TN2A 3THTA 3I5BA 5AT1B 1OYDA 1M5VC 2QC3A 4C9DA 3GG1A 5FD1A 4ELUA 4ES1A 1DARA 1V9OA 2B4UA 3TAPA 2XB2D 4FPRA 4ZPWR 1SVDA 5KOXA 4ED7A 3CC2S 3BGLA 3V6HA 3UFCX 1FE4A 4B9UA 3MM5B 2BJEA 2AQ4A 3HHEA 5E3RA 2OD4A 3DOKB 1U2RA 3EVOA 3FNNA 3VGUA 1JLAB 2CDRB 5KFJA 3ICLA 4WFBQ 2VA3A 3QWUA 3GR0A 1SKUB 2IYIA 3RB3A 1GNKA 3OTBA 3QZ7A 2WVEA 2I38A 2F4VJ 3P3DA 2AGOA 2YKMA 3AY0A 3A1YG 1IBMF 3QJPA 3ILJA 2MZ1A 1IJFB 2NCKL 4KT0C 4R5PA 1C1BA 2MZTA 4DSJA 4ZPTR 4OZ5A 2RSQA 2B4OA 5T7LB 2ZOGA 2KKHA 1O6XA 1TK5A 2COLA 1OS5A 4JI3F 4YMEA 1IR1A 3CWJA 2IA6A 2LP4A 5A0YB 4LF1A 3OR2A 3C16A 1NZ8A 3V2UC 2B3TB 3H2UB 3GYNA 3ZTQA 4CLTA 4DS4A 4KQZA 4GKKF 1X5SA 3ELHA 1UJ5A 3SYZA 1NH8A 4NL5A 2KXNB 1FI4A 2FGOA 2DNQA 4FKXA 2IA0A 3MPUB 1G7CB 4QCLA 1TL7B 4CLKA 4FNHA 4EEYA 3QNWB 1J5OB 2P9CA 1B0PA 3T9NA 4CO3A 5C25A 3FJ2A 4ZVUB 2VPYB 3KJVB 4J9MA 2F7VA 4NE9C 2OEKA 5KG3A 1LFWA 1NMEB 4I2PA 1HARA 4YP3A 1NDKA 2GHWA 5EWEA 1MW7A 1L3VA 3TZWA 2RS8A 9RUBA 1A6LA 3I56S 1EX8A 2XMJA 2FHJD 3QAUA 4QIEA 1SCJB 5D4PA 4C11A 1HMVA 1LK7A 2DGVA 1JLGA 4USKA 8RUCA 2Y0SD 3B78A 4M5JA 1KN6A 2UUCF 5E3QA 4LRDA 1AW0A 1FRIA 2ZD1B 2CPHA 3PKYA 3R2DJ 4WTOB 2CFXA 3CT9A 3PCOB 2BJ3A 3BO4A 3NMRA 2LKZA 3GMGA 3M32B 1NK7A 4ECRA 1F1BB 2FJEB 2BJ8A 4KBIA 1N5TA 1J2VA 3L09A 3HJVA 2DNYA 3TZXA 3BV8A 3D1HA 3CCLS 2J8AA 3KLEB 1FRKA 7FDRA 2ZC4A 1YKWA 2HZAA 2W2QP 4HT7A 4M5GA 4USMA 3ZZRA 1U1LA 3KG4A 3T1HF 3C66A 3K58A 2KO1A 2DY1A 2K2PA 2YXLA 1NEEA 2BQUA 4NA3A 3EWGA 2GX8A 2LU1A 3ZC4A 3NCQA 4YY3J 4QR0A 3OXLA 3ENVA 2KFNA 2MMYA 1HIYA 3FBFA 1YJ7A 2FJWA 2J7WA 4LF7F 3KK2B 2HQFA 3D3BJ 3V4IB 4DX5A 3UN3A 3F0NA 3D5MA 1RWMB 4OJ3A 2RRAA 4MAKA 2KHCA 3M9OB 5H9EJ 2WW4A 2GA7A 1CQNA 1VQ9S 2IDLA 4B3RJ 1FTCA 3NGRA 5EN1A 1ZYQA 5CAAA 2P2CB 1RBOB 5C2CA 4K0KJ 1N5YA 1VQYA 5U47A 2FD2A 3PW2A 4X4QA 1HBNB 1Q0NA 2DNLA 3CCUS 1Q8IA 1RT2B 2W1BA 3BKTA 1N48A 3EGWB 2W7PA 1PAEX 5HJYA 1Y10A 4I1TA 4FYVB 3IO1A 1FFWB 2JVOA 3MPDA 4HLBA 1FFSB 1TKXA 3C16B 2FIUA 4DL4A 3FC9A 2JEJA 3DU6A 1BQNA 3MEEB 5DETA 1FKPA 3JTNA 3IG1B 2DH9A 4DQIA 4RBTA 5ETRA 3PR4A 3FMWA 4USVA 4C97A 4C8OA 2ILYA 5KT6A 1NSPA 2Y1IA 3AOCA 3OPKA 2R7XA 4KJIA 1WEZA 2A18A 2K7JA 2KT5A 2G4BA 2Q66A 4M94A 3CF5Q 3ISZA 5J2MB 3ZZTA 3M6XA 4UY8T 5JMNA 1NSKL 3VQSA 2RF2B 3W2WA 4CT8A 3BGOP 5KFEA 2P6TA 4JOUA 1T02A 3OLAA 2KJVA 4HTJA 2ZOFA 1S57A 2X3DA 1O0PA 3W9JA 1NCLA 2NPIA 1WC3A 4OV6A 5EHHA 3M8ZA 2QYGA 3OXGA 1NHKL 1S4EA 2CYYA 5C24B 2NZ4A 3QSIA 3FSXA 4DR3J 1B64A 3CDWA 3VAKA 1RWPB 3PACA 1RWUA 1VQLS 1V5VA 2DIUA 2BOAA 4L6V3 2DEIA 2WTFA 2VU5A 4PEOA 3DLLQ 2NR0A 4J90A 1SIWB 2DD8S 5LXRA 1HNXJ 4WFYA 1WEXA 2FVRA 3KXDA 2W4PA 3W65A 1QAIA 3MMBB 1EKSA 3EZOA 1IBLF 2AU0A 2DXDA 5CA5A 2QL9B 5M2RA 2GIQA 2ZBRA 2IJNA 3MF5A 3R7SB 1R8HA 1NK0A 1H73A 1SL1A 3HKWA 3TI0A 2G9OA 3ZTPA 5L1LA 4QOTA 3H90A 1WSRA 2G2ZA 2HHVA 4J9LA 3PW0A 1B7FA 4N5SA 2XLIA 4EBDA 2MKKA 3IRXB 1DTTA 2B5JB 1PBAA 4FYYB 3OVSA 4F3QA 1Q1KA 2DY9A 2BJ9A 1OYEA 1O5JA 3HHNB 4Z7CA 3UO0A 3KUGA 2F3JA 2QT7A 1QTNB 4IFYA 4Z2XA 2BANA 3CJKA 4HVZA 1F0XA 2CPZA 2YNFA 2BVZA 4ER8A 5D3GA 1C2PA 3I87A 4M5DA 3UVJB 4ZS6A 4Y2AA 1YZ6A 3M6WA 3RAMA 2W9CA 4DS5A 4EBCA 5LMUJ 1IQZA 3C14B 1U1PA 1JLFB 3J81j 1SC3B 2OJ3A 4CRJA 3KNGA 3PEJA 4LF5J 1U48A 1CJTA 4CH7A 3HHLA 4ANDA 3RR8A 3B4MA 2AW0A 2FVPA 4ID5B 3UCZP 1QVGR 2J9DE 1SL2A 1ZM4A 3H5UA 5KT2A 3HZEA 3B82A 3CDEA 1KNZA 2EFNA 2ZKUA 4EK2A 3T3FA 3P6YC 3UDVA 5EDWA 3FRZA 2D41A 3BQ2A 3WBZA 3VZIA 3J7YU 5JUMA 4IR9A 3CJ2A 2YKNB 1K1SA 3M8SA 1RT6A 2YH0A 5A8KB 4X4UA 5K8PA 2FB0A 2KRBA 1CS4A 1VQMS 3PJWA 3V6JA 3N9UC 1PJ5A 2CPDA 3NGDA 4DX7A 1XNRJ 4WP9A 2GAGC 1N4LA 1TL3B 2IC3B 2OD6A 2RHSB 1NH7A 5AJ3J 2Y1RI 2KJWA 4OYBA 3TA1A 2A2CA 4LVOP 4NLPA 2C2OB 3KWMA 3M8WA 5IS2A 4ED0A 2B43A 1D0EA 3M2UB 2IM1A 3UN5A 2V4QA 5SZTA 1S49A 4KV8B 1PG5B 2J6SA 4DHVA 3SCKE 1YI2S 5C42B 3UNYA 2R7WA 4Y0FA 1W26A 2L41A 5CYMA 3MM6B 3TRGA 1MU2A 2J9EA 4DR6J 2Y1LB 3V4MA 1NPPA 4OJ1A 2PI4A 3G96A 4N56A 5E3CA 4K2XA 3MFHA 5HMZA 2BACA 4Y2IA 2KT2A 4NZ6A 1RB0A 4UOGA 1F5BA 1LWFB 5HMXA 2BM1A 3T5LA 3JSYA 4FDFA 3CNQP 3J7YI 2ADBA 3JYTB 4CNYA 4KGKA 4M5NA 1D9DA 2MGZA 5KT4A 1Z2ZA 1RHUB 1Z2LA 1TAQA 3HJFA 2XZDB 4LF8J 3FFIA 2E9ZA 2XCPA 3HFKA 2IRUA 4O4GA 3DOLB 2Z4PA 2HLUA 1LEOA 2K3KA 5CD4H 1ZPWX 4KAIA 1EAYC 3PZPA 2V94A 5A6WA 5ETLA 3DMJA 2GFFA 2ACMA 1E6VA 1ZOTA 2VG5A 1RWNB 2PIIA 3Q22A 4GRSA 1IKYB 3JTOA 1FJCA 4H4OA 1SJQA 2AHOB 3BBBA 3KDOA 4G65A 2FLPA 4DV7F 3TA2A 3WX4A 3HX9A 2VFVA 4RL1A 2JJ4D 2ZH5A 2VFTA 2B6AB 4FS2A 4Y00A 3PG9A 3WDOA 1FVSA 2OTLS 3S8SA 4R8UB 2QL5B 2RAQA 2DH8A 2V6AA 1VC5A 2JOQA 4DV2F 1YHQS 1BQMB 3SCLE 2GJ2A 2HHTA 2PO4A 3DU5A 3CJ0A 1N88A 3QIDA 2R8KA 3DLGA 3KK3A 4K4VA 1M0SA 3D0IE 3HMJG 3IR6B 4CYUB 2W9CB 3CULA 4KYZA 4ECWA 5A2QY 2CQPA 3VAHA 3QSYB 1X5OA 2IJRA 4NMXA 1WKKA 1B7YB 1N0UA 2ZITA 2MKHA 3AH6A 1IUJA 2C2EA 1JXLA 2JEFA 2RDDA 2UXDJ 4LF4J 4B9VA 2Z57B 4M5HA 1U49A 4KC5A 2EFPA 2VOPA 1S1UA 1YBUA 2YNGB 5BJRA 1MWZA 2HQIA 2ZBIA 3GV8B 2ZH4A 4WKYA 4X4OA 1NKCA 2H65B 2DTJA 5KG0A 3PXGa 3TQ1A 1VOMA 2H1YA 4WCEQ 4LIWA 3LP2A 2HS3A 1VRTB 4OX9J 3DLKB 4OJHA 1ZA2B 2AJFE 3KLGA 1RWOB 2E66A 4ZVEA 4YEAA 1R7IA 3PX0A 1LWEA 4ZLNA 5L46A 2GV1A 4U95A 2QA2A 4K4UA 2ROPA 4NLOA 3RB6A 4RW9B 4IFVA 1R8CA 4CLWA 4OYXA 5HLFB 2I8EA 1KQSR 1PC4A 2FZCB 3SSQA 1OQ6A 1T11A 1VIOA 1YITS 2PC6A 5CH7B 5J2PB 3SIPB 3AT1B 3MAHA 2RRNA 4JBCA 2ALZA 3CIZA 1WWHA 1UVNA 1KLMB 2AF6A 4ZVRB 5CYJA 5IV3A 2R7UA 3QWPA 3W66A 4WZMA 4B08A 2FZGB 3NS7B 3IR5B 3O6QA 5KG4A 3ITHB 4EUVA 5IT0A 2VL1A 2PGCA 4USHA 1X0PA 1KHVA 2XMKA 4HR2A 3UI3A 3V81B 4K59A 2D74B 3DI6A 2BOPA 4WXWA 1EKRA 4FBTA 1XC9A 2UVWA 4N47A 3NCRA 2L9DA 2JC0A 3I0RB 2GW8A 3I6PA 1I6JA 2GAHC 4K2JA 3HSGA 3FFIB 4TNOA 5F8IA 2HKEA 2NREA 2YH1A 2CQHA 4A48A 2J6UA 2W7OA 3X3UA 3CCES 1GQEA 4CO5A 2YVSA 4ILMA 2EFGA 2RIJA 1D3WA 3SCJE 1LQ9A 1LXNA 4RW4B 1LFPA 1ZPVA 1GEHA 3N79A 1SC4B 1PAUB 4RLEA 2HNYB 1FK9A 4XAKA 1I94F 2RQ4A 4DG1B 4EMDA 1F9EB 4OFZA 2EW9A 4FP9A 1ZAXA 1C0UB 2QSFA 5J2QB 2LQJA 2HMIA 1RYRA 2V8PA 1VQ4S 2HSEB 5B0FA 2MZQA 2DH7A 1H2TZ 2Y9HA 3TJ9A 3W1YC 2B0GA 3JAMU 2NUHA 1WKLA 3BREA 4IKAA 3BS9A 1T9XA 3JQKA 3UCGA 2V8GA 4B3MF 1QD1A 1FJEB 3MECB 3H5SA 1VR6A 4F25A 2CNLB 5LT5A 2VKRA 5KFBA 3WC0A 1N5QA 4A8FA 4CQ1A 1TMJA 5ETTA 4LT6A 5IT9Y 4NA1A 2XMUA 3TAQA 1WG4A 3HVRA 4L72B 4X62J 2KRRA 4Y28C 3D4JA 2CPIA 3GSIA 1URRA 3AB4B 4DSKA 2C2ZB 2IAJA 1S97A 2H48B 3KLIA 1VHIA 1NHUA 2JNJA 4QYZJ 5L9NA 2YX1A 3DYAB 2HVEA 4NWBA 3G6XA 5J1EB 3WIVA 4I7FA 3RAXA 2XY6A 3QT8A 2EG1A 1RABB 3NXZA 3VAJA 2VBXA 2Q1LA 4FF4A 3H0PA 4XO0A 2O3DA 1BE4A 1SH3A 4HDGA 5JVHQ 2LA6A 4JYAJ 2XGPA 5E2QA 1NZAA 4J9QA 4DDFA 1U4BA 3T5JA 3E01B 1KS2A 1RT4A 3I4HX 5L39A 4KHMA 1M1GA 1URNA 3GJQB 3OSNA 5AXMA 2YPZA 2E5LJ 5F3ZA 2XZTB 3H25A 1RWXB 3Q86A 3ONQA 3JXOA 4CCHA 4F3MA 1C4CA 3CE8A 2IM0A 1S4FA 4C0BA 1QDUB 2JC1A 4PG6A 2MTLA 2YKQA 4A8QA 2ABYA 2XSJB 2BE2B 1HBUA 4DPXA 4JI6F 3Q0AA 2CPFA 1VIXA 3OTEA 5DRKA 2CG8A 4PABA 3WZ0A 3ILLA 1TR0A 2IM2A 1R0CB 3H4DA 2OGUA 4LF4F 4DPUA 1ROFA 3SFGA 5B0BA 4V19X 2I5JB 4WYLA 2KXFA 1HYSA 3TUJC 1JLBB 2HBYB 3HK2A 2GIFA 2NSBA 2KU7A 5AXKA 2YQ0A 1S1XA 4G1IA 4RUBA 2ZHBA 2AX1A 1MN7A 3BQ0A 4N8NA 1XTZA 3MXHP 1M5KC 2B9EA 2B4VA 4N7TA 3GZ7A 3RJMB 1O8BA 2JLGA 4RW6A 2EBEA 4GC6A 2RKIB 2A0FB 5MLCV 4ED8A 3QRQA 4B3TF 1WHVA 1DRZA 3LTOA 3FBBA 1Q86T 1RKJA 2GVZB 1U6FA 4DL0C 2HNDA 1K44A 2YNIA 2QX0A 3C15A 2D9OA 4TLRA 2W01A 4DEZA 4ZJQA 2DITA 3F56A 4DR2J 2QZ8A 3DRSA 1XNQF 4NLYA 4X64J 1OJ4A 3D1QA 1YJUA 5A8RA 1JX4A 1XMQJ 2HBRB 5KG1A 2YWEA 2HLTA 4HDHA 5HBMA 1D9AA 1RK8A 2M5YA 1NU4A 2OPRB 2Y8YA 3M1VB 1RT3A
chains in the Genus database with same CATH topology
4EGLA 2XI3A 1SKRA 2AGPA 1X4HA 2RRBA 1Y4ZB 3C3LA 2A2DA 1R31A 5EX3A 4IRKA 1OWXA 2FLOA 3DYAA 1XWLA 4MIAA 3FEYB 4RUCA 1VC6A 4DSEA 4CO2A 3MM7A 2B7CB 2VC1A 5J1EA 1YTYA 1TK0A 2PA3A 4FXVA 2KM8B 2DK2A 3EXCX 5AXNA 3R5BA 2NLWA 1FJ7A 1OPIA 3FZBA 2XY7A 4MK8A 2LCWA 1TZ0A 3MPVA 4KPYA 4PQUA 2JL9A 3OUYB 3RRKA 4OI4A 3X1LB 1OPZA 2N4CA 2QA4G 3NNHA 3HDSA 3AQPA 1H38A 2VFUA 4WFAQ 4I68A 3UDLA 3HO1A 1FRXA 1W2IA 1Y3KA 4ZDNA 2Q43A 2J5AA 2LLZA 3OVAA 1UWBB 1Y5LB 4LSNB 1OSDA 1DURA 2CQ3A 3K5NA 5KFHA 3IBWA 3CDAA 3AJ2A 2Z2MA 1EP4A 5C25B 5I3UA 3I31A 3LAMA 1LKZA 3KYLA 1RQ0A 4CZCA 3OJUA 3E01A 5IM0A 1KRPA 2OPSB 4NLTA 4OHWA 2BUNA 5HP1A 4WJBA 1CSJA 2B9WA 4OHYA 2OPPA 5CHCB 1HNVB 2C3OA 1H2VZ 3FVYA 1K8AT 2XO7A 1N6QA 4NX9A 2DNPA 4E0DA 3PO5A 2AGQA 5KFOA 3IGNA 3CJ4A 2XWYA 4TY8A 2KH9A 2BDPA 3CGIA 4I2PB 3NS6A 3W3SA 2N3OA 1H98A 2KT3A 2MQQA 5M2UA 2VA2A 1TVRA 2UXBF 1S6QB 1S79A 1S6OA 2JSXA 2FJVA 2R8IA 2OPQB 4DMZA 4PUOA 2LQBA 3J81Y 1DBDA 2JRSA 2HGNA 2EBGA 3DOMA 3PJXA 4EBEA 4ZP6A 5ADZA 2F4VF 2MY7A 4DV4F 2RH3A 1KHWA 4PWDB 3CD7A 3IR7B 4AE5A 3OTDA 3M9NB 1HD1A 4RNMA 4OX7A 4WZQA 4Q0BA 1ZTTA 5GADU 3LANA 3QJLA 4QZVB 3CD6S 4C11B 1HMVB 1T8EA 5I42A 2XZWA 1QM9A 1S1WA 3TVYA 3BN7A 1N52B 4C8MA 3W2VB 1HBOA 2UV8G 5HN0A 1YJRA 3VR1A 1NJYA 2GHVC 5AE1A 2ZZNA 3RW7A 1JLGB 3CCZA 4Q2MA 4TY9A 4ATNA 4Z37A 2XSJA 1FEHA 3QIPA 4JI8F 2N3LA 4ZP9A 4F4KA 4TKTA 2BE2A 3C6TB 4CO4A 4TN2A 2BM0A 4DPOA 3MURP 2HHPA 1O51A 3I5BA 3THTA 1UL3A 4A4JA 2BQ3A 2WOMB 3CEDA 5F8NA 4YR0A 1FEEA 1HPZB 3MMCA 3PW5A 4RU2A 5EWGA 3PKMA 4ZPDA 2PSZA 1M5VC 1T95A 2PE8A 1TV6A 3MPWA 4OV1A 5KAKA 4P7VA 4C9DA 3K8WA 3GG1A 5FD1A 3RRHA 4DQPA 4DSFA 1QAYA 1WI8A 2DNNA 3DHXA 3LGMA 4ES1A 4ELUA 1Q8LA 1KTVA 1QJHA 2LQ9A 4WXOA 4RUAA 2UP1A 1DARA 2I5JA 4ECQA 1V9OA 2B4UA 5DGAA 3TAPA 1ZTWA 3DLBA 3MZIA 4X4RA 4JUZA 2DR8A 1DLOA 4O3QA 1JLBA 1VBXA 4K5RA 5T41A 3OTCA 4LSLB 5K14A 2XB2D 4IOAQ 3BSOA 3KLHB 2NSCA 4FPRA 2RS2A 4B3OB 3QGPA 1X5TA 3PFEA 2D9PA 2W24A 3HVAA 2V4RA 2WK4A 4TQRA 5KFFA 1UAWA 3D28A 4ZPWR 3CCMS 1WD6A 3MHYA 2M9KA 4KB7A 4IRDA 5KOXA 3RRGA 4ED7A 2BZ2A 1WNEA 3CJ3A 5AE3A 3SI8A 3UR3C 1HBMA 3CC2S 2KVIA 3BGLA 1S6PB 4K4TA 1P1TA 3V6HA 1LW0A 4UQTA 3UFCX 2GMLA 4ZCMA 1FT8A 3T5KA 1FE4A 4B9UA 4LUBA 5F3TA 3MM5B 4F2SA 4O0IA 4G1PA 2BJEA 2AQ4A 5THWA 1Q78A 3HHEA 5E3RA 2OD4A 2VG7B 4LJMA 2XY5A 4PWUA 3DOKB 1S0NA 2OLWA 1EETA 2PMHA 1VQ6S 5FDLA 1U2RA 3HVTA 2YX7A 2EI5A 3O44A 3VWSA 3FNNA 4P2SA 3J7A1 2FVQA 3LUYA 1CVJA 5LSOA 3T1AA 1JLAB 1LXJA 2R7TA 3IS9A 4M95A 5KFJA 1U1QA 3ICLA 1X0FA 1ZBTA 5KT5A 3ISNC 2RKIA 3DRPA 1H7WA 1VQPS 3ENQA 4DQQA 4WFBQ 4U7UK 3MUTP 1DZ5A 5F8GA 2W8KA 4KFBA 1N34F 4ZKAA 2VA3A 1V3RA 3HHDA 4ZVHA 2IYGA 1R8PA 3QWUA 4WKRA 3OL6A 3GR0A 1C4AA 2MXYA 1HQEA 1S1XB 4OMFG 2IYIA 5GADI 4IG3A 3RB3A 3C6UB 2D3ZA 1R0AB 1GNKA 1YRTA 3H20A 3OTBA 1U1MA 3QZ7A 4EZ9A 3VAMA 2C2DA 2J9CA 3DHWC 2I38A 3U1NA 2MQMA 5HROB 2EVZA 4C8NA 3P3DA 2W8LA 2AGOA 3CTRA 2OTJS 2LQ5A 2YKMA 3AY0A 4FYDA 2HFZA 2V2KA 3A1YG 1IBMF 3QJPA 1FNXH 2AP6A 2MZ1A 3H40A 1IJFB 1X5PA 3QZ8A 3K5MA 2MKJA 1RGVA 4KT0C 3RR7A 4R5PA 2V8VA 3V6DA 3CDBA 1C1BA 2MZTA 2RT3A 5BYRA 4DSJA 5IXUA 4TLQA 3HHKA 4ZPTR 4OZ5A 4A8XA 1IKWA 2DR7A 5D4NA 3OR1B 4C8YA 2RSQA 2NS1B 3RAQA 2AX0A 2B4OA 4HT5A 5T7LB 3PV8A 1UVLA 2P9GA 2ZOGA 2KKHA 1TK5A 4YR3A 3GWCA 2ILZA 4NRUA 2DCLA 4P7TA 2COLA 3N28A 2VODA 1RTHA 2E5LF 3CUNA 1OS5A 3ZZUA 2WSCC 2BABA 4JI3F 4YMEA 2BBEA 3CWJA 5F8MA 2G1DA 2EK6A 2IA6A 2E5JA 4J9NA 3RW6A 3IXQA 5A0YB 2OPRA 2F9JA 3M1VA 4AQYF 2KYXA 3OR2A 1KONA 1SL0A 3V2UC 1UVJA 4R0JA 4OZNA 4RWWA 3MWBA 2B3TB 3H2UB 1GAOA 3GYNA 4UUWA 5KFTA 4DS4A 4KQZA 3BDPA 4GKKF 4DQRA 1QUPA 4BWMA 1IJEB 3AJ1A 2CPXA 1X5SA 1N5YB 4B9MA 1UJ5A 3OXFA 3SYZA 1NH8A 4NL5A 5E41A 2KXNB 1FESA 5L1IA 1P8GA 3NAHA 2FGOA 2RILA 3PRBA 2DNQA 2R7OA 4QR2A 1KSPA 2YKOA 2IA0A 3OUYA 2E1RA 3GV5B 2OFGX 3H2LA 1G7CB 4A8YA 1BC6A 3O1LA 4HL9A 2ZZMA 4KIAA 1Y9OA 4QCLA 1MWYA 1IKVB 1ZAWA 3U1LA 4FNHA 4EEYA 1UWBA 1J5OB 2P9CA 5KFYA 2ZH1A 2VASA 4LSNA 1B0PA 3TAMB 3T9NA 2XCAA 3MR2A 3TW0A 1L3UA 4CO3A 1S72S 5C25A 5IQ6A 3AAWB 4F8RA 1VI7A 3FJ2A 4Q8FA 3BDEA 1KOHA 2IVMA 2OPSA 3LAKA 4ILLA 2VPYB 3KJVB 4C0OC 2DHSA 4J9MA 3S1TA 4DFMA 1HNVA 1RT3B 1RT7B 2F7VA 1TKXB 2MZJA 2J76E 3VCDA 4XPCA 2KFYA 3AQOA 4DWIA 3CCVS 3LW5C 3H5YA 1N8RT 5KG3A 1LFWA 4ES3A 3G4SS 2J0SD 2F8EX 4K4YA 4YY3F 4FBTA 1UFWA 4I2PA 1GX5A 1HARA 2DHXA 4YP3A 2GHWA 4B02A 2JLFA 1BQNB 1R6YA 1S6QA 2HQ3A 1MW7A 1FDNA 5IQQA 4QQBA 2M70A 5GMKa 5EWEA 1L3VA 5KFVA 1FKPB 2OPQA 2D7SA 2RS8A 2YX4A 2RMLA 4I6AA 4LQ9A 1A6LA 1D9FA 4PPZA 2EKYA 4QWBA 4O3SA 4P6QA 4FVMA 1X4EA 3I56S 4PWDA 3Q24A 2XMJA 5IT4A 4HKQA 2FHJD 3QAUA 2M4MA 4KGMA 3I96A 3CSKA 4QIEA 4U6PA 5D4PA 4C11A 1HMVA 1NK6A 4XPEA 2HHSA 4E98A 4J5OA 1KQFB 3W2VA 1U8SA 1LK7A 2DGVA 5EX0A 3H5XA 2B51A 1JLGA 2XEXA 3M6UA 4JI7F 4OHXA 4KSEB 2ZJPQ 2ZNYA 2Y0SD 2R2RA 1U24A 3B78A 3C6TA 4CTAB 4I69A 3CB4A 5HP1B 2WRMA 2RUGA 1KN6A 2UUCF 3HKZD 2KB2A 5E3QA 1VQKS 2WOMA 4X4TA 1AW0A 1FRIA 2J7UA 4DN0A 4USIA 1HPZA 1QUVA 3PR5B 1UEVA 2CQIA 3V6KA 2IM3A 5B0AA 4PXBA 5I4MA 4B3RF 2ZD1B 2CPHA 3DGPA 5H1SV 3AB2B 1M5OC 2JZ5A 2XMVA 3PKYA 3K5OA 3QGGA 4Y3CA 3W2WB 3BEGB 2CFXA 3CT9A 2E9TA 5L9XA 3O3LA 4HEA9 4RX6A 4QWEA 2U2FA 3G9CA 1SJ3P 4K0KF 3B4DA 3PVXA 3BO4A 2MZRA 2UUBF 4O3PA 2WSFC 2XG8A 3DRRB 3NMRA 2LKZA 5KT7A 3GMGA 3TP2A 3M32B 1NK7A 4LSLA 4DLEA 1P1LA 2X51A 4NZ0A 3KLHA 4Y2MA 1YRXA 5KOWA 5B0CA 5L1JA 4ECRA 3D54A 3N0VA 3R5DA 1VGYA 2YWKA 4WFZA 1N56A 3M8QB 2MQPA 2FJEB 4X64F 4KBIA 4NCAA 1G3OA 2GHPA 1N5TA 1J2VA 3GIKA 2CZVC 3HT3A 3PDNA 3L09A 3ISND 2G0CA 2FC8A 5IZHA 4F2RA 2DVIA 2LMIA 1S6PA 3MTKA 2DNYA 4HH0A 5D78A 1NJWA 3D1HA 1QLNA 4NZ7A 2DB1A 2KYZA 3R5CA 3CCLS 2J8AA 3QJJA 2YWGA 2DBBA 3MPYA 4J9PA 3MM5A 2VB6A 2AJ4A 5DG8A 2MQLA 4DOZA 3KLEB 1SH0A 4MFBB 1HHSA 1FRKA 2ATLA 3GFXA 7FDRA 2VG7A 4DR7F 5A6PA 4JI4F 3DOKA 2ZC4A 2A10A 2AJ1A 4HHJA 3NS5A 2UUTA 4HT7A 1FE0A 1H0HB 3ZZRA 3EX7B 1P9QC 1U1LA 2UU9F 1ELOA 1JLAA 3G8TA 3KG4A 3T1HF 1PC5A 4NRTA 4F26A 3C66A 3R3TA 3K58A 1JMTA 1UETA 2KO1A 2GQ2A 4RW8B 2K3IA 2HRYA 2K2PA 5M2PA 3HPOA 4MKYA 3NLCA 5DM6Q 5GAEU 1NEEA 2BQUA 4X4PA 2GMHA 3CVKA 4NA3A 3VAGA 2UV8A 1Q7YT 4J9OA 2HWTA 1NK8A 1FRHA 2GX8A 2WBRA 2LU1A 3ZC4A 1OSCA 2IVYA 3NCQA 2ZOMA 4G1QB 4QR0A 3OXLA 5J2NB 2RQMA 3ENVA 1XERA 2C3MA 1H6KX 2MMYA 4DFPA 1K1QA 1TKTB 2F40A 2KFNA 1UW4A 5KFMA 1E6YB 3SDEB 3BO3A 4BWJA 2DNHA 2FJWA 2J7WA 3C6UA 4LF7F 3PRDA 1R0AA 1JJHA 5D4LA 3KK2B 3CC4S 2I2YA 5HI7A 5K9FA 4IO9Q 4F4WA 3V4IB 3R1HA 2FJAB 2CQGA 5HROA 2PDAA 1DJ0A 3DRXA 4O44B 3D5MA 1LWCB 2MSSA 2HS0A 1S48A 4OJ3A 2RRAA 5F8JA 3PO4A 1WACA 1DTQB 2FY1A 2ZH2A 4OHVA 2NQPA 3UQSA 2R2TA 4MAKA 2KHCA 3FRYA 4EO8A 3M9OB 1N5VA 1HD0A 4ECXA 3OR1A 5H9EJ 5F0UA 1WF0A 4FNIA 2NXUA 5T7LA 4ZP7A 3H4BA 2JLEA 4C0HA 3F41A 1DTTB 2GA7A 3DDNA 1CQNA 4YB1P 2HHXA 4D3HA 1VQ9S 4A8SA 5FLXY 1VRUA 2EFVA 3CMES 3OL8A 4GC7A 3OHAA 2FJDB 3EZ5A 1FTCA 4ZPBA 4ED3A 2DGTA 4PXDA 5A0YA 4Q44A 5EN1A 3KHRA 1ZYQA 1RKIA 5D6GA 1Q4RA 4DV6F 4ECYA 2OO4A 2HVHA 1VK8A 2CQ1A 2JX2A 4OZJA 4DL2A 2R8GA 1K73T 2X1AA 3ZFVA 1HL6A 2PMZD 4I2QB 4JI2F 3I9V9 3CCJS 1N5YA 2BRKA 4HH1A 1VQYA 2VPWB 3M4XA 2FJBB 5U47A 4IFYB 2DCUB 5HL7Q 2BANB 3CJKB 2FD2A 4DR3F 1FKOA 3PW2A 3E51A 4X4QA 1HBNB 1HI0P 1HI8A 1KQKA 2YNFB 4ZOSA 4DL3A 2DNLA 5DO2A 3TNVA 1IKWB 3CCUS 3DXBA 1Q8IA 1IKVA 1RT2B 4WK3A 5D3GB 4M5DB 3BR8A 1J5OA 1HW9A 2X1FA 4ERDA 1N48A 4JV0A 3MFIA 3EGWB 4O4RA 3TAMA 1WHWA 1VC0A 2HHWA 4UUXA 2W7PA 5KFRA 2ZH3A 3GFZA 5EGYA 3K2YA 3K5PA 4MK9A 4I1TA 2QE5A 1SB6A 4OI2A 4UOCA 4XIUA 2BXJA 5AE2A 3EYZA 3W7BA 1NJIT 3IO1A 3LH2S 1HNXF 2JVOA 2FDNA 4HLBA 4CH0S 3KJVA 5GAEI 3R5AA 1RT7A 2FTRA 1LV5A 1TKXA 4M63A 5HQ8A 2FIUA 1QY7A 4DL4A 2C3UA 4PG7A 1RT5B 3HVWA 4NCGB 2ROGA 5KFPA 2JEJA 1T3OA 3DU6A 1X4DA 4GO7X 2AWZA 4Y2KA 2DR5A 3O5TB