6FD1A

7-fe ferredoxin from azotobacter vinelandii low temperature, 1.35 a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Azotobacter vinelandii 7Fe ferredoxin at 1.35 A resolution and determination of the [Fe-S] bonds with 0.01 A accuracy.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords 7-FE FERREDOXIN I (FD1)
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1997-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 6fd1A00
3HKZD 2C3PA 1FCAA 1JB0C 3MMCA 2PA8D 2V4JB 1BLUA 1FRHA 1B0TA 1Q16B 4L6V3 3MM5A 1CLFA 1F5CA 5L8RC 1Y4ZB 2XSJB 1WTFA 5BYSA 1FRXA 1FD2A 2WSEC 1FXDA 1G3OA 2V4JA 1KQFB 1H98A 1SIWB 3OR2B 1B0VA 1H7XA 2WB1D 4OMFG 2Z8QA 5BYQA 3IR5B 1F5BA 3MMBB 1FTCA 2GMJA 1FF2A 3EGWB 1C4CA 3MM7B 2IVFB 3GYXB 4OV1A 2VPWB 1R27B 2VPYB 3MM5B 2FJDB 4KT0C 2VKRA 2O01C 2FJAB 1DURA 5FD1A 2FGOA 5CHCB 1FERA 1FRMA 2FJBB 2FD2A 2C3UA 6FD1A 1FRIA 3MM9A 2PDAA 2XSJA 1FDAA 3OR1B 2V2KA 1IQZA 1FDNA 2ZVSA 1Y5LB 1F2GA 3IR6B 1KEKA 1PC4A 1HFEL 1SJ1A 1FDBA 3C8YA 7FDRA 1JNRB 1AXQA 2C3YA 1PC5A 1BWEA 1GT8A 2FJEB 1H0HB 1BQXA 1KQGB 3EXYA 1JNZB 2C42A 2VPZB 1G6BA 1BD6A 1DAXA 4DHVA 1B0PA 3OR2A 1FEHA 1GAOA 3MM8B 6FDRA 4YDDB 2Y0SD 1BC6A 2C3OA 1ROFA 3LW5C 1IR0A 1FRKA 1DFDA 2FDNA 5CH7B 1FDDA 2GMHA 1GTHA 1Y5NB 4RKUC 4AYBD 3PNIA 1C4AA 1FRJA 1GTEA 4XK8C 2WSCC 1FRLA 1RGVA 7FD1A 3MMAB 1A6LA 3MM9B 5E7OB 1K0TA 3OR1A 2UZAA 3MM7A 3IR7B 1SIZA 3MMCB 1XERA 1VJWA 2VPXB 3EUNA 1Y5IB 4XDCA 1D3WA 2PMZD 3MMAA 4XDDA 4Y28C 1FXRA 2WSFC 3MM6B 5BYRA 3MM6A 2C3MA 4CI0B 3MMBA 2WAQD 3MM8A 4ID8A 1H7WA
chains in the Genus database with same CATH superfamily
1Y9OA 3KJFB 4YEAA 2VBZA 1EQMA 3FCHA 1PAUB 4QJVA 3CCUS 3K5OA 3DRPB 3BH6B 4ECUA 5CYMA 1N36J 2FPHX 5LM7E 3MEEB 4WU2A 4CH7A 3P5BP 1F9HA 3CJ3A 3JSMA 1F5CA 3PFEA 2FJXA 4I2QA 5BR8F 1OIAA 1UWAA 3TAMA 2GVZA 1NSAA 3FRZA 3IGNA 3M9NB 1WOPA 1VC6A 1Q7YT 3T9NA 3J7YU 4FBUA 1OQ6A 1VGYA 3BSCA 3QGGA 4E98A 2AF6A 3GFXA 3TWZA 2DPIA 1NHVA 4DQPA 2I38A 2WBMA 4U8VA 1D8YA 3GIRA 4FDFA 1KOHA 1PJ5A 2CJBA 2NCKL 4USWA 1CC8A 5CYQA 4C0BA 3ULHA 2EKNA 4HDHA 3K57A 5C2GA 2DTJA 4M5LA 2IC3A 3OUYA 1U1OA 4I7FB 1U6BA 3IWNC 3P3DA 1WF2A 3U7JA 1LK5A 3BGFA 2G2OA 2GHWA 3E01B 2YKPA 4ITSA 3R7NB 2FHJA 4CNYA 1S1WB 4GC7A 2XMMA 1SQFA 1TTHB 5FIIA 1S76D 1CEZA 2F8MA 3MM7B 1XMBA 3G6ES 3A3NB 2BJ7A 1YBUA 1UVJA 1OPIA 1XBWA 1APSA 1S1TA 1LWCA 2KKHA 1YZ6A 4NXMJ 3M30A 5MLCV 4R5PB 5HP1B 3LWMA 4I2PB 4PG7A 4Q43A 2HHWA 1U0SA 1TL7A 1LXNA 2L9WA 1Q0NA 3DGPB 5CHCB 1U24A 1VYAA 1V3RA 3ENQA 3D1HA 3R8YA 3W7BA 1TMMA 5KG5A 2FJVA 3GYGA 3IO1A 4FPRA 5DRKA 1P27B 1FDAA 2J5AA 4H4KC 4DV5J 4KRWA 2HHSA 1GH8A 1FJ7A 1V3SA 1UKUA 4DS5A 4CO2A 5H1SV 1I94F 3MEKA 4X4TA 4A46A 4O44B 4M5HA 3TR5A 3BSNA 3NG8A 1ZPVA 3M6UA 2W8LA 4LR8A 4DUZJ 1VQ7S 1NK5A 3J7AN 3M8SA 2YPYA 3D4JA 4ZCKA 3GR0A 4WP8A 1RT6B 2QFJA 1YI2S 1KQGB 2DNMA 3M2RB 5HQLA 1OSCA 2XGPA 2AJFE 1IM4A 4CH1A 2DR7A 2QG9B 3G71S 4PUOB 4U95A 2FTRA 4ATNA 1B0PA 1ZM4A 5E3RA 3MM8B 2AZ1A 3E2EA 2BJ9A 1S6QA 1T05A 4JI1F 3W2WB 2J9EA 4RPFA 3JAMY 4N76A 2P9GA 3OLAA 2YNFA 1N32F 2CQ2A 3QWUA 3H25A 4OI2A 5GAEU 2G9OA 2AGQA 1Q86T 2HFZA 3WZ0A 2MZJA 4RKUC 3WX4A 4WIIA 1NO8A 1EP4B 4A8MP 5RUBA 2W9AA 2VJUA 2DGUA 2G1HA 3M8RA 2E7VA 4A8YA 4O3SA 2Z56B 2LQJA 2Z2LA 2E9RX 2CJ9A 1WF1A 2YNHA 5C25B 2R2SA 2XS2A 1GXUA 1S9EA 2RQ4A 4M5DB 5D3GB 4NLRA 1MROA 4ZS6A 4X4QA 3GTYX 4O0IA 1RTJB 3CEDA 4OLPA 1KQKA 5IT9U 3BR8A 1HR0J 2VG6B 4B3MF 2XO6A 3ELHA 3ZZOA 2G2ZA 2JHEA 1GK8A 2XI3A 4RBUA 2VPXB 2Q6BA 2YWKA 3UD5A 3AD7C 2R7TA 4UY8T 1VC5A 4UQGA 1PKUA 2XMUA 4NZ7A 1OYEA 3GJQB 4EO8A 1F5AA 4EEYA 2BOPA 4LF7J 1JQGA 1UZDA 3FZ2A 5ETRA 5JXSA 3HDSA 3CWJA 3N5FA 3Q0AA 5LMNJ 4E0DA 2UUWA 3RBZA 4G1IA 1FK9A 1WEXA 2WOMA 4KH1B 2FJWA 2JEGA 2HGMA 5LL6d 2HVEA 4FP9A 5KFZA 4WFYA 2V9KA 3EGVA 3IAM9 2D9OA 1BY9A 2GO8A 2SXLA 4LF9F 3CUNA 4Q2MA 4DN9A 1D9AA 5M2UA 5AJ3J 2H51B 1KONA 1VDHA 2NXJA 2YX1A 3A4TA 1QTNB 3IM8A 5CCMA 5HO4A 4NLQA 2KT3A 1VQPS 2E7WA 2EG1A 2C1EB 2OTJS 1S1UA 1CULB 3ZO7A 4MH8A 1RA7A 1HA1A 1T11A 4F50A 4K5RA 4DSLA 2OD4A 1R8BA 4KV8B 1MNEA 2A6OA 5GAEI 4O3PA 3DYAB 2FY8A 1PIEA 1S6PB 1RHUB 2FIUA 2KU7A 2XSJB 4M63A 2DNYA 2HK3A 2RQMA 3AY0A 4P7VA 2D69A 4D3GA 5ETMA 4IQXA 2ROEA 4DWIA 1N56A 4CLWA 2R7UA 7AT1B 2BJ8A 3DOKB 3M4XA 4NCAA 1RT4A 4RW6A 2X1AA 4Q8FA 4USMA 3MMBB 1IBLJ 1N5YB 5B0GA 2C2MB 3GFZA 1YQHA 2LECA 2IMOA 1C4CA 2RRNA 4CNZA 3AAWB 4DFJA 2RDDA 3AJ2A 3ZZYA 4DF8A 4DMZA 1HNWJ 1FJCA 1DTQB 2D74B 3IC1A 3QAEA 2X51A 2V8HA 4H4MB 2MZQA 5B09A 2ZJRQ 3N5BA 1R0AA 3Q2TC 1YRTA 3BSOA 3F41A 5A6PA 4ZCLA 1IJFB 2FGOA 3L09A 3UDVA 4KBIA 3I5AA 2E29A 1G2EA 4DV0J 4K0KJ 3OR1B 5DS7A 1TKZB 4GVLA 4NPOA 2HRTA 4Q5VA 3IN5A 2JOQA 1FJEB 5EGYA 4DV6J 1NJXA 3AB2B 3N4WA 3PIPQ 4E8UA 4KPYA 2QLXA 2AHOB 4MYUA 3I55S 2OJ3A 4UQTA 4DV1F 2XMWA 3MCNA 4OX6A 1KLMA 3W8PA 1P1LA 4DEZA 2M52A 2ZEJA 5CAAA 2BE2A 1TKTB 2X1BA 4HACA 5CCLA 1N48A 2HGNA 3NKYA 1GQEA 2F63A 4YOEA 1FK9B 2WOMB 2CQCA 4ANEA 3TARA 4KR0B 4IOCQ 1RLDA 5K8MA 4X4NA 1S1UB 4X2BA 4JUZA 5J2NB 1WC5A 2R42A 4RX6A 4RU9A 2HHTA 2BACA 4LVNP 4J37A 1VFJA 3ZNJ1 3ILLA 3C66A 4MK7A 3R6LB 4DR3J 5B0CA 4RW4B 4I69A 2KHDA 3LGHA 2RMLA 3NBPA 3PFOA 2HWHA 1RAIB 1RT1B 1HLWA 2GIFA 2QO3A 4U7UK 1TV6B 5IT9Y 3FBBA 1HHTP 4JYAF 2IDEA 1Z2LA 3H98A 4YP3A 3OVSA 1AZSB 2FHKA 2BM1A 3LGNA 1IKXA 1CC7A 2OTLS 1GNKA 3NRBA 1SC4B 4DJBA 1VQOS 3MUVP 2JJ4D 3HHLD 4YB7A 5HQ8A 5EX3A 4HT5A 1S12A 3VAFA 4YHHJ 3M2RA 3CD7A 3TQ1A 1DZ5A 4CTAB 2XBPA 1HBOB 2QE5A 3PW2A 2EFGA 4NEZA 3WQPA 1W2IA 1NJYA 1HW8A 1S6OA 5D4NA 2FYXA 2AT1B 3BO4A 1X5OA 1WEZA 2GNKA 3VF0B 1KOOA 2AD9A 1X60A 2P6TA 2MKIA 2N4DA 3KK2A 2DR6A 3FCWA 3I56S 4DQQA 2IPOB 2YNIB 3Q23A 3HZEA 2EBGA 3G8QA 3MEDB 3RW6A 3MM8A 2J0QD 1VQYA 4BHQA 1KVIA 3V6JA 5HLFB 2IFXA 5DG9A 3D2WA 4R25A 4CH0S 4FBTA 4F36A 4X62J 4ECXA 2CPIA 1NMEB 3QGIA 1VQNS 4WXWA 4FKXA 4ZP6A 4L6V3 4I67A 3SSRA 3U1LA 5MAOA 2C28A 1L3SA 3I87A 2IAJB 1XR5A 1XNRF 1TL1A 1X4EA 1AFJA 2Z2YB 1BHNA 1KVJA 4ED1A 1YLXA 4X65F 1MU2A 4EU0A 1WTFA 3NCPA 1VIOA 2NPFA 1FXDA 2PMWA 3KK1B 4R0EA 2BQ3A 4Y6IA 3G86A 4ECSA 2WZ1A 5KFEA 1MLAA 3FFIB 1SIWB 2YWHA 3NCRA 1Y10A 2WVDA 3TEGA 1NU4A 2LXUA 4X62F 1U1NA 4B9SA 1PAEX 4F8RA 4OL8A 1FKAF 2DHHA 2DGXA 3GZ7A 4C0OC 2DHGA 2OPRB 3CMES 2HBZB 1UWBB 3CDEA 3SEOA 4N8NA 4RNOA 3FDSA 2I6WA 4DPTA 5KFOA 2IJRA 4G1QB 1FKOB 2B43A 1UVMA 3KLEB 1S1XA 2HSEB 4ECZA 3JSBA 1VK3A 1RT3A 1PG5B 2HGLA 5I3QA 1T9WA 1XQIA 1YG0A 4OX7A 4WIQA 4C3LA 1HYSA 2VKRA 3BYPA 4ZPAA 3H20A 3KK3B 3QZ8A 1ZETA 2BW2A 5FD1A 5D8HB 4C98A 1SV5A 4KGZB 2LCWA 4ZVRB 4WTOB 4DL5A 2FJBB 1YJWS 2C3UA 1O51A 3MUMP 4DL3A 1VLYA 1JJHA 3ILOA 1ZZNA 1N33F 1F3VA 3DRXA 2FC9A 2Y1RI 2HMIA 1XR7A 5DZ6A 5BXIA 5HROB 5IM0A 3C3LA 2HRUA 2B5JA 4ZJOA 5KFUA 2HLUA 4IH6A 3CTRA 3QMQA 4HHUA 2BQRA 5LMUJ 4F3OA 2F7VA 3UDEA 1QY7A 4ES2A 5A8KA 2YNGA 4B3RJ 2DNOA 2GVDA 3HHLA 3NGSA 2FJEB 3GYNA 2BEFA 3LALA 4M5NA 4FNIA 4PAAA 4QWAA 2C2EA 3PO5A 4DR3F 3QPIA 5F0WA 3DMJB 3TZWA 2NUUG 2VB6A 2DEJA 4RW7A 2C42A 5HJXA 2F8EX 2DH7A 3SI8A 4K4YA 1EKSA 1TR0A 4L3KA 5CYJA 1WI6A 3T1YJ 3J80U 3GV7B 2EXUA 4NMLA 2BKNA 1IUJA 2FDNA 1HNWF 4JB8B 3GWCA 1Y3JA 4ANCA 4NLSA 4Z2XA 2H5JB 4MKAA 3NS5A 3SMZA 3AA9A 2ZOGA 3PRBA 4I7FA 4JV5J 1KLMB 3ET6A 3GCWP 4DV7J 2QTWA 1PILA 4C8KA 3DC2A 4MIBA 5F3TA 2CA9A 3N6MA 2BR0A 3M9MB 1U45A 5HK4A 3OHAA 4P2XA 5KFRA 2IA6A 5GMKa 1RAFB 1S7IA 4QR0A 3OR1A 1QD1A 2GFFA 2XYPB 3I6PA 2ZM6J 3KTQA 4TNOA 3VAJA 3V2UC 1XC9A 4PG8A 2B9YA 2QMUB 1T9YA 4WXOA 2CNLB 3R9LA 2VASA 3W5XA 3MMCB 2UUAF 3FEZA 2KTQA 2QA4S 3OFEA 4DV4J 3V81A 1ZTWA 1WHYA 1CS4B 2QLBB 2XWXA 3MMAA 3K2YA 4F2RA 3BQ0A 2CPJA 4X64J 3MMBA 4QR2A 1FI4A 2HNZB 2CNOB 1RDRA 2FZKB 2CQPA 3CGIA 2V4RA 2FVSA 1HBMA 2OHDA 1QAJA 2OPPA 3MDFA 3DRRB 3PIOQ 5KFGA 4ZVOB 1AROP 3BGRA 3K5PA 2HPUA 2XMKA 2VDHA 3DYAA 5ITHA 4B9UA 3T41A 5KFXA 1VISA 4IH7A 2GQQA 4QYZJ 3M8YA 1N34J 3KHHA 4P2SA 4G65A 3A12A 2B8PA 2CVIA 4BC9A 2E5IA 3GG0A 2PIIA 2HFVA 3A8KA 4WKYA 4P73A 4PWDB 3PX4A 3PX6A 4HI2A 2R7RA 5KOXA 1CQNA 1T95A 2W4CA 5I42B 4FF2A 4P75A 3H42A 2AV5A 2XMAA 3NAHA 2OSRA 1CVJA 2B4OA 3QIDA 3EPIA 3D28A 4UZCA 2W2QP 4KQZA 4O4RA 4TY8B 1HARA 3UDCA 4U67Q 4J9LA 2GJIA 1SJ4P 2CJKA 4OI6A 1W25A 2V4QA 2VIHA 3MFHA 3AJDA 4ZVEA 4CDIA 4OV1A 4X65J 1HBUA 3UWTA 1R8CA 1S0MA 1YJRA 5HANA 3BN4A 5C42B 2HVIA 3CVKA 3LH2S 1HHQA 3DI6A 1FERA 4MK9A 2OMLA 2PC6A 4KHMA 3TJAA 4MKYA 3CCJS 1FRIA 2B51A 3DM2B 4NYZA 2Q43A 3RJMB 4RNFA 1UVIA 4MK8A 1URNA 2IHR1 2LP4A 4OHYA 4LF9J 1NH8A 5L1KA 4XTTA 1Y5LB 4DV2J 3FBFA 3EWGA 3IR6B 1U2CA 2K7JA 2R3VA 2R7QA 5CABA 2DB1A 3C8YA 2ALZA 1S1VB 3ISND 3FEYB 4JI2J 2VU5A 3IRXB 2C3YA 1S9FA 1UA0A 1ACMB 5C2CA 5LSLA 4BLGA 1EHWA 4F4WA 1MU2B 3K8WA 2W1BA 4QIWD 4DPWA 1JMTA 2RUGA 1BUXA 5EUHA 3S6EA 4LSLA 1FKPB 1FD8A 2CQ1A 2DKOB 4OHWA 4C11A 2W7OA 2RQKA 4UOFA 4K4XA 2ZH6A 3CNQP 2GA7A 1FWKA 2MXYA 1X0FA 1YX2A 2KFZA 3KG1A 4NI2A 5HBMA 1R6VA 3GE9A 5B0EA 2CNKB 1T8EA 1LK7A 1JLCB 1PJ7A 2O3DA 4PG4A 2ACYA 3T1HF 4O3RA 2BKPA 3C6UB 2CZ4A 5EDWA 5EN1A 3PW0A 2V2QA 3MAQA 3BQ2A 4CLUA 2AJ0A 4MFBA 2G0CA 3CDAA 5D4OA 1TELA 5HL7Q 1N88A 2A1BA 2KO1A 4B02A 3FBCA 3UDLA 1XMQJ 2EC0A 1KTQA 2ALYB 2WSCC 3KJVB 1RTHB 4XIUA 7FD1A 3KWMA 4I6YA 4PPDA 1R89A 1DTQA 1PGZA 3WC2A 2GGPA 4I1TA 1FNMA 3CJ8A 2YKMB 1Q82T 1HMVB 2Q66A 3WDOA 1F60B 2CPEA 3SIPB 4TKTA 4OJ3A 4K4SA 2D1CA 2N7YA 4JI0F 5T7LB 3D1OA 1SVDA 1SIZA 2F5GA 1JJ2R 1M1HA 3UW1A 2KZMA 2IMWP 5IWAJ 1HKAA 1NSQA 3BGLA 3DXSX 3I0RA 2D7SA 1O8BA 2DYAA 5ETNA 5A8KB 2GHPA 2CZVC 1JLGA 2J8SA 2W4PA 4N5SA 1NBEB 1IBKF 4NXMF 1HBNB 3V6KA 3QNWB 1Y11A 1QJHA 5KG4A 2BDPA 1FXRA 1NPKA 1AT1B 2NYHA 3ENWA 4IOBA 3WX8A 3IXQA 4CI0B 3MZIA 4PEOA 1VHIA 2K8GA 4MKVA 1H7WA 4PG5A 1J5EF 4YY3F 2C3PA 4JI8F 3B8HA 4PYDA 4QW8A 3QIPB 1KSPA 1UAWA 3HFKA 4K0KF 3SDEA 1RYRA 1UW4A 2AP6A 5C24A 1MMNA 5KTQA 4UY85 3GG1A 5T41A 1M1GA 4AT1B 4B9TA 4NYOA 4R5PA 3CMAS 5J2QA 3ISZA 6AT1B 4KKOB 1RKJA 1UVKA 3QT7A 2NQPA 1KNZA 3W2VB 1HHSA 4IFYB 3RBEA 3TA1A 3W9JA 1IBCB 2J7WA 5GADU 3IS9A 4K7QA 3LO3A 1ZAVA 5E2QA 1Y3KA 3IP0A 4EK2A 2FQQB 2WSEC 5D0RA 1A9NB 4TXSA 1Z4UA 5CYMB 1AA1B 4IKAA 5HVGA 3C19A 2GQ2A 1B0VA 2V8DA 5D4PA 1S0OA 2DNGA 2BXJA 4Z7CA 5LJ3Y 2KYZA 4F04B 2OO4A 2YNFB 2XEXA 3CPWR 4AQYJ 4HHHA 4J9VA 3EGWB 4CYUA 3DRPA 4HTJA 1OYDA 3H40A 2NR0A 2B4UA 3UN3A 1UETA 1WJ9A 1IJEB 3W5YA 1U8SA 3FSIA 3MM5B 4ZVGA 2YKMA 3CD5A 2OPQA 1WKLA 1S79A 4KGXB 2VQFJ 1N5YA 3OBIA 1NJWA 3AQOA 4X64F 1I3OB 1L5UA 4QBUA 3OTBA 3VGSA 5AXLA 3ZTQA 2KHCA 4GKKF 3IG1B 2ASDA 4UW2A 1JKHB 5HN0A 4ELTA 3EPGA 1IQZA 2PE8A 1FDNA 3VAIA 1XJWB 4RUBA 2UUAJ 3OPKA 4JV2A 5ETVA 4ZCIA 2PA3A 3HX9A 1UW9A 3N6LA 5GMDA 4DDFA 3WIVA 2IRUA 5J1EB 1J5OA 4LT6A 1PC5A 3HFVA 1CQMA 3DGPA 1GT8A 2F4VJ 1NK9A 4LBIA 3FBEA 1NZ8A 1YWXA 3FMBA 4LFAF 2I0XA 2NSBA 1U48A 5DZ7A 3KG4A 3M30B 1VRUA 1FNOA 2D3UA 1GAOA 3S7RA 1GEHA 3M9OB 2BJ3A 2GC8A 2DGWA 4AL7A 3VV2B 4YB6A 2ZDPA 1MN9A 4M5GA 3SFGA 2MGZB 5H9FJ 5KFQA 4JV5F 4FYVB 3AXMA 4TLQA 5KG6A 2C2NA 4J90A 5AT1B 5G0RB 1GTHA 1U0HA 3X3UA 2N3OA 1HNZF 2E44A 1SL2A 1YBTA 4A8KA 2IRYA 3CJQA 2BVZA 4ZHRA 4DUYJ 5ADZA 1LXJA 4I2PA 1GTEA 4LRBA 4NA2A 1HIYA 3FZBA 4C8NA 3NS6A 3LPEA 1Z2ZA 2XB2D 2CZ9A 1DQ9A 3IS9B 4ANDA 4ECTA 1A6LA 3THPA 2UXBJ 1HQEA 4RL1A 2N82B 2CQDA 2YKNB 2HS0A 4C7QA 4PQUB 2M9KA 5J2QB 1U1KA 2OFGX 3UNGC 4DV7F 1KLNA 3AJ1A 1RSCA 5U47A 5B0AA 1H6KX 1JWWA 4DXLA 5A0YB 3QJPA 1F0XA 2M2BA 3DFEA 1YTYA 1EQ0A 1KTVA 4ZVQB 2AGOA 3BDEA 3V6HA 3QJJA 2QGFB 1GMWA 3EZOA 3TVYA 2V8PA 1LWEB 3TZYA 3EMTA 1IKWA 2XHWA 3MEEA 4P71A 3DLKA 2VG5A 3CF5Q 1YJ9S 2KRBA 3R5CA 1T03B 3A13A 3NGDA 3BGUA 1YRXA 2R7VA 4ZCMA 1WHVA 5AE3A 3D7SB 3I5BA 3M8QB 3OT9A 3BGOP 4NWBA 2V50A 3OL8A 2PA8D 4LF8F 2B4VA 5KG3A 3BN7A 1J2VA 3L7OA 3OD2A 4O4GA 2YTCA 2CG8A 1C0TB 3EGZA 4OYMA 1SH3A 1F6TA 1RT5B 2ZBRA 1LEOA 2AMCB 1VQ9S 1UCNA 3IBCB 4CO3A 3JSYA 3KLFA 3TEHB 2FB0A 5KFFA 4B08A 1VLOA 5KT3A 4RNNA 1HNXF 4ECWA 3BV8A 2PSZA 3RRGA 3TNVA 5KT5A 2IRXA 2JFKA 3H59A 1LOUA 1FRXA 2CPXA 2YPZA 4F2SA 2DJWA 2NSCA 2PEBA 3JYTB 3H90A 2CPHA 1V3ZA 4RUHA 2ABYA 5FLXY 3G8TA 4YB5A 2RQCA 2A2CA 2V8VA 1VBYA 3IRXA 1MMDA 2B4PA 1NHKL 2BRLA 3GU0A 4B9LA 3DHXA 2AJ1A 3HVAA 2HVZA 2I5JB 1MWQA 3M2VA 2HFOA 1I94J 4DR7J 2A10A 1U4BA 3C15A 1QDUB 3ICLA 4YR3A 2G2YA 4DR2F 2FVRA 4JI3J 1H2UX 2A3JA 3NGTA 2KRRA 4KH0B 4KT0C 2R2TA 2MKSA 2RT3A 3QT6A 4FN5A 5HP1A 2DRAA 2W2PP 4O0NA 3P6YC 4JI8J 3HLUA 4WYLA 2DITA 3TQEA 5F8JA 4QW9A 3LP1B 1FRMA 1VQ4S 1SKRA 4DV2F 4PR6A 3L3CA 3I31A 1IKXB 4UTGA 2I8EA 3VZIA 5EWEA 1M5SA 4W4MA 1S6PA 2RDIA 1X4DA 2XSJA 1N36F 3RB6A 1HQEB 4ZP9A 3D0GE 4KY3A 2VC1A 3FSXA 3R6GB 5CZVA 4BDPA 2IY5B 1D09B 1TKXB 3DOMB 2RD5C 1RT1A 4YUDA 4NLVA 1SXLA 2L08A 5L46A 3MPYA 1CULA 1LFWA 2ZUGA 4ZPWR 5IWAF 4JI4J 2GAGC 3Q24A 2MKJA 4Y2AA 1WI8A 1DLOA 4F25A 5E41A 1IXKA 5ETLA 1BWEA 2ATCB 1W7WA 3C14A 4TYBA 4EFAC 3W3SA 3LOUA 2DBBA 1RWWB 3JTOA 5K20B 3KLGB 4K4TA 2ZJPQ 3HO1A 2DIUA 3M7VA 2WCXA 4LRFA 2AKWB 1DAXA 3PRDA 4P2MA 4OJHA 4DS4A 2MZTA 4DV4F 1SBRA 1QE1B 4I2QB 4QYRA 1G7CB 4C8YA 3NAIA 3OTDA 1SUQA 4Q0BB 1GMWD 1EETB 3ZZRA 4I68A 4ZLLA 2RS2A 2FY1A 3RAXA 2VKZG 1VR6A 2POKA 2RVJA 4RWWA 2BE7D 2GMHA 3H5YA 1L3UA 2H5IB 2DGQA 2HQCA 1RWMB 3H7HB 1HNVA 1UFLA 1N34F 1R0AB 3AXKA 4XK8C 5KT4A 3O44A 2HVDA 4A47A 1IN0A 2WVBA 2V69A 1GMVA 3BEGB 3BKUA 3SCKE 1OPZA 4F0MA 2HNYA 1RAEB 2Z57B 4DPUA 2LXFA 1S9EB 1U25A 1VRQC 5J1EA 2MGZA 3I0RB 4JBCA 4DR1J 4IH5A 3QLHB 1K0TA 4X4UA 5DDQC 5EWFA 4ED8A 4CZCA 1LV5A 1QAYA 1IR2A 2O67A 4LFBF 2EK1A 2ZDOA 2Z2MA 2VQEF 2CXEA 2IM3A 3R7SB 5HJYA 2ZE2B 4CLFA 1RU1A 1FJGF 3ZZZA 2OD6A 4Q2LA 3EUNA 4C8LA 1GMUA 1T94A 4X66J 3FNNA 4B9NA 4HH1A 1RQ0A 4QYZK 3MWBA 3NMRA 3GR1A 3CCVS 1S9GA 2Z2ZA 5K14A 1JJ4A 5ETKA 4RLEA 2VONA 2GZOA 4EUVA 4DR5J 2WAQD 2HHPA 4ID8A 4ICLB 4K2XA 3W64A 5A8WA 3MAHA 1DQ8A 1T03A 2FLLA 3NNCA 3PCOB 3LUYA 4LF6F 4F26A 2KJWA 2KZZA 1BLUA 2B56A 2JZ5A 2QMXA 1TZ0A 2V67A 3IBFB 4GVBB 2LMIA 4LF7F 4DFMA 2IJFA 2VF3A 1FJGJ 1NPRA 3CB4A 5F3ZA 1X9SA 2Q3PA 1DJ0A 1X4GA 5KFSA 3CD0A 5DQIA 3IAS9 2MY8A 3LF0A 2W9BA 3I9ZA 4MKBA 1NKCA 1B3TA 2UU9J 1IKWB 3KMQA 2CPDA 4ZP8A 1WG4A 4NL5A 5KFKA 3PVXA 2GX8A 3L7PA 2OPSB 3LP0A 4EBCA 3C14B 5LT5A 3EICA 2ZJQQ 1M5OC 4LFCJ 2RSQA 1Q4RA 3GP9A 2ZNZA 5J1PA 3KK2B 1FE0A 3BQ1A 4I56A 2XMJA 1KQFB 1FVSA 5E3QA 3CJTA 2ZH2A 2M5YA 2XZTB 2HHHJ 3GSDA 3MAAB 2B3TB 2GMJA 2DR5A 5IM0B 3KG0A 2MQQA 4WJBA 1VRUB 3K17A 4DBQA 3U02A 4TY9A 4J9QA 1M1KT 2W2NP 4P2FA 1S72S 2ACMA 4YR0A 2FJAB 3CDUA 4ZP7A 3JSMB 3RB3A 1FE4A 4F4KA 3R2DJ 1E6VA 3NOGA 4LSNA 4RZRA 2LXIA 2MJNA 1HBNA 4IO1A 4X84A 2C22A 4LFAJ 4P9SA 3ZFVA 1IR1A 2LYVA 3MM9A 3QT5A 1RXOB 3KMSA 4OZ5A 2V2KA 2RS8A 4PXEA 5M2RA 5A2QY 3A8IA 4ETXA 2R2UA 3BS9A 1WOSA 4EZ9A 2VOPA 2O5DA 2EI5A 3UNYA 1P9QC 4IO9Q 1F1BB 1F2GA 1SI9A 3HT0A 1PC4A 3FQKA 1HFEL 1FVQA 4ZOSA 5L1JA 2PEHA 3D6HB 1Q5VA 1VOMA 1N4LA 3PZPA 1XWLA 3AH6A 4JV1A 2WONB 3IGVA 1AXQA 2HQFA 3FCVA 3HSZA 4USJC 4LRDA 2KH9A 2MSSA 1S48A 2J9DA 3BBFA 3KK1A 4RBTA 2VICA 4G3IA 2XULA 3U27A 4LIRA 3EYZA 4ZVHA 3LGMA 1D9FA 1KFSA 2DRDA 2E1CA 4LF5F 4V19X 1B4SA 2WRMA 1H74A 3DU6A 4OJ1A 3LW5C 3NGKA 2B9WA 1Y0HA 3JTNA 1Q8BA 5CH7B 4ZVFA 2NXUA 2H4WB 2OPPB 3GMGA 1JIHA 1HBMB 1TUGB 1ZZFA 2ZBQA 4L72B 2Y1JA 3PYFA 3W66A 4DR1F 3OTOJ 3RBDA 4PQAA 2DHXA 1C0UB 3TUJC 4O3NA 4QIFA 4ED6A 1RHKB 2DT9A 2XZWA 3KLIA 3NNAA 3ENVA 4LQ3A 4C8ZA 1SQGA 3C6UA 2Z30B 4O4GB 4USIA 3MMAB 5KT7A 3UPFA 1R0BG 1QE1A 2QZ8A 5GVQA 1JLQA 2YKAA 4KO0B 4R8UB 3K0JA 4O3OA 2IJNA 1Q79A 2NPIA 5DG8A 5E3PA 4WK1A 1KHWA 4NA1A 4OZNA 3IR7B 3PR4A 3HFZB 4OV6A 5HATA 1LWEA 4J9RA 2B9EA 2XY7A 1WKJA 5JMNA 4NZ6A 3NEKA 4DLGA 4C8OA 2IDLA 2NZCA 2HIQA 4JOUA 2C2RA 5GAHI 3C2PA 3DMJA 5KFVA 2HNYB 3MM6B 4F67A 2ZFHA 2GAHC 2H48B 1U1MA 1TFYA 2DEIA 2V68A 4Y2IA 3RB0A 5AXNA 2U1AA 1BMQB 2YVSA 3AD8C 4RWXA 4ED2A 1RT7A 4FKYA 1KWMA 2VD3A 4DFPA 2KDOA 2XNQA 1B7YB 1WOOA 3K5LA 1X5SA 4WCEQ 1NCLA 2BJ1A 4F4AA 4FVMA 1QSSA 3PYEA 2N7CA 1RWKB 5L8RC 4HVZA 2Q1LA 2PN6A 3M32B 4H4KA 1RADB 2B6AA 1UJ6A 3UFCX 4CLLA 2JLGA 3AT1B 2HIYA 1UP1A 2D9PA 4LQ9A 1ZA1B 8RUCA 3BH7B 3JQMA 3BSAA 4J7CA 5CQGA 3AOCA 4K4VA 3CCRS 4ELVA 2D3O1 2QL7B 1UA1A 1RHQB 4UF4A 1V9OA 2RU9A 2H1YA 3M05A 3KLEA 2UXCF 1N32J 4NYPA 2WBRA 4OMFG 4FYWB 4ZDNA 3W1YC 3ZZUA 2XCPA 5ETSA 2HNZA 4NRTA 5BR8J 3V6DA 2DVIA 4QWDA 4NI2B 5HBMB 3KK3A 1XNRJ 3OL6A 4OYIA 5IV4A 2BX6A 2YKOA 1R27B 2GCFA 2JSXA 1JLQB 3L7UA 3J7A1 3CCLS 1OS5A 1PBUA 4YDXA 3D66A 1VJQA 3T5LA 2L9DA 3QT8A 1I5OB 4ZVTB 3VGTA 4PPZA 1WNEA 4DX8H 4KE5A 2G0IA 2FVQA 2PFFB 5KFBA 4DQIA 2XO7A 1YITS 4C11B 5GAHU 2FVCA 3DLKB 1RWOB 4CRJA 3I0SB 3GJRB 3SZ2A 3V5RA 4LF8J 2JVOA 1WEYA 4QIGA 3IWXA 4B3SF 1R43A 2RAQA 1Q7LB 2AEMA 5LOQA 4X4RA 1S99A 3CJRA 2DHAA 2D3ZA 3U1MA 4AE5A 2HHQA 1A0OB 1KR4A 2HWIA 2WVEA 2BZ2A 5L1IA 2B8QA 5IZHA 4LMZA 2HQGA 2ZBPA 4Q0BA 3BREA 2FHJD 3GFYA 1HBUB 2ILYA 1G6BA 2LQ9A 1BD6A 2VPZB 5D77A 2BJDA 5GAGI 3DHWC 2IM0A 4ZPCA 1BC6A 1GX6A 1ROFA 1RWVB 2OFHX 2M88A 3HVTB 4X4OA 4GMKA 4RNMA 1SH0A 1TL3B 1N0VC 3KXDA 4FNHA 4IQMA 4RR5A 3TA0A 1XNQJ 1DFDA 2CNNB 3N79A 2HQDA 2AWZA 5JUMA 1KDNA 1Y5NB 4C8MA 4PZVA 3EVWA 3EVMA 1TL4A 4USVA 3ITHA 3OFFA 4KKOA 3UR3C 1VQMS 5LSOA 1TKDA 1M5KC 2BRKA 2OEKA 2UV8G 2W8KA 3IWLA 1K1SA 3HVWA 4LSNB 2CJXB 1X8DA 4UOGA 4YB1P 2ZWOA 2XLJA 4ZIWA 1N6QB 1S4EA 3SBMA 5DQHA 2QMWA 3R7BB 3KLVA 2DGTA 4K5SA 4FS2A 4HHJA 4MIAA 5DJBA 3T5KA 2R9LA 4YFUA 1FKOA 3TX8A 1SJRA 4X66F 1B64A 1D0EA 2UUCF 2VOOA 4B3OB 3NY0A 1IKVB 3DRSA 1R0CB 3GIJA 3HSDA 1RAJA 3MPUB 3QGPA 4S0MA 3US5A 2ZKTA 3TANA 3EVOA 3VAGA 4PQUA 1TVRA 1WELA 5F0UA 3VR1A 2W9CA 5J2PB 1YKWA 3VAMA 1KN6A 1VQLS 4RU2A 2ZBCA 2AYBA 3OHBA 1VQ8S 1HNIB 2QL9B 4DL2A 4ALZA 1S6QB 2CJQA 1T05B 2HHVA 3C46A 3BYRA 2QN6B 2OH2A 3LA0A 2K7KA 4EGLA 2V34A 4KC5A 2AZ3A 1FX4A 3H5XA 4DX6A 4JI6J 2HRYA 2LVWA 1IBKJ 3VHQA 5FDLA 1RWUA 2J0XA 2ZWPA 3NL0A 5LJ5Y 1Q81T 2HKEA 3I0SA 3MM5A 2V2ZA 1ZOTA 2V6AA 3UR0A 1NJZA 4C3MA 2CQHA 2O66A 3Q2SC 5IT4A 4QPTA 2QLFB 4Y2MA 3DLJA 4G6VB 3QWPA 2KT2A 3PY8A 2MEWA 4K4ZA 5I3UB 3KLHB 2YNHB 2NXEA 3H2UB 5C25A 4C97A 1NK8A 5HMWA 1TAUA 4A8XA 2MQOA 1GXTA 1JXEA 2BBEA 2DNRA 2L3MA 2LKZA 4CLYA 4WZMA 1R8AA 1WTBA 1RHRB 1OY9A 1PCAA 1Q1KA 2K3IA 2BV3A 4DCPB 2ZH8A 5IC4B 5DLFA 1W2BR 1NNDA 3UN5A 4B3MJ 1RK8A 4K2JA 2RDJA 4N56A 4JI1J 4AL5A 3C16A 2AYGA 3MPWA 3W63A 2HNDB 3IR5B 5K9FA 3O8WA 2KG1A 3I96A 1EIYB 1GX5A 1X5PA 3W2VA 4QR1A 3CCMS 3FMWA 3PX0A 3RU0A 1SJ3P 3PTWA 8ATCB 3HD2A 4DR6F 4BC7A 3GV8B 4OHXA 4QCLA 2JFDA 1VQ6S 5IQ6A 2J0WA 4OYBA 2UXCJ 1S0VA 4AXIA 5HAOA 2I1RA 1N5VA 1N5SA 2GS8A 2VV5A 4ED4A 3QIPA 4ES3A 5KG2A 4DFKA 1ZYQA 1S77D 4J9PA 3UCGA 3RB4A 5L39A 2P2CB 4M5JA 1C2PA 2RJZA 3PR5B 4DZ6A 2P5VA 4RBVA 1SC3B 3G2XA 2F9DA 3HHDA 3W61A 2MB0B 4JI2F 2MQMA 5HSPA 3QRPA 3O3LA 4ES1A 2JL9A 3NGRA 3T6JA 2E5HA 5IT0A 3G8SA 5J2PA 4ED5A 1FDBA 4CLTA 4PG6A 2EFQA 5CA5A 1NSKL 7FDRA 1OY8A 1U0HB 2MZSA 4YMEA 4RW9B 2QA4G 4J9OA 1K47A 2B5JB 3BPDA 5B0DA 2NS1B 5KFJA 3M8WA 4X4VA 1S1XB 3QRQA 3X1LB 1FEHA 1I6JA 4ID5A 2XGQA 2LQBA 4DUTA 2C3OA 3TAQA 1R31A 2XZDB 4R0JA 5GMEA 1IR0A 1FRKA 4DX5A 1I51B 2R8HA 4M95A 2RHSB 2UVVA 2CQIA 3LWLA 3PKMA 3AODA 2E1PA 1NB7A 2I9SA 3EDQB 2QRRA 2HBQB 2D3OR 1JLBB 2EVZA 3ETOA 2QA2A 3Q22A 4KO0A 4U6PA 3ZTOA 3CCWA 1YJ7A 3HI9A 1NSPA 1VMBA 4CLPA 5BJRA 5DM7Q 1RHMB 5DDOC 1JLAA 3JQJA 3LAMA 3VWSA 1B99A 4ILMA 1FFGB 3HVTA 4WTYA 1GFWB 2GHVC 3HSJA 1RTJA 5ETQA 3PG9A 1XTZA 5DQGA 1IVZA 1JLGB 3JXOA 4I6WA 3T1HJ 2M0GB 2XTJP 4U9RA 4JI6F 1N5QA 3T9ZA 2J6TA 1RKIA 1SB6A 1JXLA 2ATLA 5I3UA 2MLYA 4NLTA 4Q7AA 3D9BA 3JB9k 2QSWA 2C2KB 1Y5IB 3SQGA 1X31C 5KG0A 1V5IB 5F8GA 2V94A 2FZGB 1CJVA 1D3WA 2YQ1A 4H4OB 5A2QU 3JYTA 2X1FA 3NOCA 2BA9A 3KFWX 3VGVA 2EBEA 3B78A 5L9NA 2V9WA 3HK2A 5DDPC 3M8ZA 3FQLA 4F0HA 1RWPB 3FRYA 2F3JA 2UUCJ 3RR8A 3ZTSA 3DN9A 3EGNA 2MTLA 2YQ3A 5IXUA 5DGAA 2CFXA 4URSA 3SCLE 2DNKA 5KFNA 3PW5A 2RIJA 3FEXB 4TU8A 4M1KA 4AUKA 3K59A 4TQSA 3DLGB 1WHWA 4Y34A 4IDKA 1U49A 2J6SA 4OYZA 1QSYA 5HMYA 2OUGA 1RT6A 2AW0A 2VG7A 4KGKA 3RGIA 3DCAA 4DI6A 2RU3A 1REGX 1IKYB 1HD0A 5E5NA 3M2UA 3ONQA 5KFDA 1ELOA 3GIKA 2VFUA 1BGXT 4NOHA 4TU7A 5F8NA 1LWXA 2UXDF 3V4MA 2KL8A 1KHVA 2DXFA 3EE3A 4WFNQ 4MJKA 3CCQS 2AIRB 1S0NA 2OEMA 2H54B 5D78A 3R3TA 4YQWA 2HS3A 4ZVSB 2UXBF 2BANA 1NPPA 4P52A 4F3MA 3TW0A 1H98A 3HT3A 3QYYA 4ZN1A 1IQTA 4LJMA 4CTAA 1H7XA 4WFBQ 2HYIB 1AZSA 2Z8QA 4KTQA 1HNIA 2QL5B 2IBOA 3L4BC 2Z58B 1HL6A 1SUQB 4WPAA 3T5HA 2HMIB 4J5OA 4RW9A 1EETA 2GW8A 3B54A 1N54B 3P5TL 1P8GA 2MZ1A 2XLIA 2MDAA 1TK0A 3UO0A 4OI0A 3RW7A 3HMJG 2VPYB 1N5TA 1Q53A 4DPXA 4M5DA 4EO6A 2AJ2A 2IYGA 3DLEB 3SQOP 3TJ9A 1T9UA 2HBYB 2DNNA 1REVA 4CQ1A 5LXYA 3J80Y 1OO0B 3DOLA 4LR7A 4W98A 2BMBA 2HAFA 1DBDA 2QIFA 1W26A 4OHZA 2ASYA 4GRSA 2E1AA 3BO3A 2DNLA 4CT8A 2W7PA 3W9HA 2Y1LB 3D67A 1SJ1A 3MD3A 3MPVA 3HXMA 3VALA 5CYQB 3CIZA 3D0HE 2YKQA 4A8QA 5EHHA 4DL7A 3QO9B 5AXMA 3KYLA 3QSYB 2J9CA 5F41A 2IM1A 3J7Z5 2Q79A 2XQCA 2R8GA 2QLWA 1KS2A 2JVRA 3T1AA 4BWMA 1FEEA 1CPZA 5D4LA 1JNZB 2HFNA 1WHXA 1CBKA 1HWLA 4OI3A 3D3BJ 2E5JA 3MCSA 4GKKJ 2HHXA 2UUBF 4DHVA 4DR5F 1RBLA 2OSQA 3TJ8A 4IUFA 2H65B 4PYAA 4ED3A 4FXDA 3HCXA 1EZZB 1CJTA 2I5JA 1S49A 2ZZTA 3R5DA 4WFXA 3M2VB 2HBRB 4C2MA 4OYWA 2B7BB 4W92B 2ZH7A 1ZAWA 4HH0A 4IG0B 1WC4A 2QYCA 2M8DB 4GKJJ 3PNIA 2DNQA 2CDRB 3TOQA 2JNJA 3CSKA 5A8RA 5K5MA 3HM9A 1ZA2B 3HZGA 2FLOA 3RAQA 2L48A 2ZC3A 2YBVA 3CXCR 1U8WA 2OGUA 5FDLB 4K4WA 2DPJA 2X3DA 2K1RB 1B70B 1R6YA 2QC3A 4I0WA 1LW0B 4ZPDA 1T7PA 3R5JB 2RB7A 1JJCB 4RW7B 4B9MA 1EX8A 4LF6J 3HPOA 1M0SA 3RYLA 3M6XA 1KD1T 1ZM9A 1NLKL 3E3XA 3J7ZT 1JLFB 2YNGB 3KDNA 2MSTA 4EBEA 3G87A 4KB7A 2XG8A 2Z4PA 3MTKA 4HTIA 2KN4A 3OXLA 2PMZD 4DQSA 5EWGA 4F3QA 3E01A 3LQVA 3PYGA 4XO0A 1SJQA 3GQCA 1N0UA 5C5JA 4DSKA 2EG2A 2VBXA 4OZ1A 4TN2A 1Q8LA 2DHSA 1NKEA 1FRHA 4OQJA 1HI8A 1HQUB 4ZPBA 4IFVA 5I4MA 5IS2A 3EJMA 5B0FA 2QEXS 3QJLA 1N33J 3IBWA 4OZLA 4DL6A 5KFIA 4TYAA 1HNVB 2DXEA 1MROB 1U1LA 2AYMA 1RE1B 3GFHA 4UOHA 2H5EA 2VC0A 4OZ3A 2EFVA 4P7TA 3BR9A 1SKWA 4DCJB 1HI0P 2EW9A 4HL9A 3P49B 3DRYA 2VG6A 1C1BA 1VRTA 2WK4A 3BM7A 1C1BB 1VRTB 2A18A 3OXGA 3K58A 4ER8A 2FZCB 5D0HA 1O6XA 3D5MA 5BYSA 1VBZA 1I1GA 4C6AA 3HSGA 3GIMA 3OR2B 1U26A 3PDNA 2HWTA 1M5PC 4ZLNA 4DV3F 4IYQA 3TI0A 2XY6A 4L73A 1G1XA 4K8RA 2BW7A 1KRPA 1CS4A 2QLJB 1AFIA 3P45B 1YSJA 3JTPA 3OJUA 2CJAA 4G1QA 1PYOB 1YK9A 5E3CA 1U1RA 3MCMA 4ZLPA 4ID5B 3SYZA 2WVFA 3Q89A 3PO4A 2R4FA 3B6BA 1K73T 5HI7A 3IMQJ 3G6VA 4BCAA 4LRCA 2GIRA 4CLSA 1CSJA 1WKKA 3OFHA 5IQQA 1O5JA 5DG7A 2RILA 1WACA 4MFBB 2BABA 2Y1IA 2KFYA 4DSEA 1LW0A 3OVAA 2ZVSA 4AFFA 2JH3A 1MN7A 3GONA 3UD4P 3TUZC 1HWKA 2CADA 4G1PA 5B08A 1T9TA 3BZQA 1M90T 4WU3A 1OQ3A 2RH3A 5KFMA 2PI4A 5F8IA 2W24A 2K1RA 4ERDA 1E6VB 4Q8EA 1MMLA 2RE1A 3F56A 4QZVB 3UE2A 3G4SS 2BJEA 1RISA 1YJUA 4HKQA 3QFWA 4DPOA 2M4MA 2VDIA 3W9IA 2Y8WA 1FXLA 3KJQB 4X4SA 1ZBTA 2JX2A 2M8HA 4XPEA 3J7YI 3VAHA 1MSWD 3MURP 1TUWA 3MEDA 2HHHF 1CJUA 1RT5A 3OXFA 3M6VA 4C3KA 2HQIA 4D3HA 4DG1B 1M5VC 1B7FA 2IAJA 1NDPA 3MAAA 4J9KA 1FWPA 3G9CA 4WYWA 4M5KA 3LANA 4BWJA 3N6NA 2AJQA 1VBKA 3OUYB 1OY6A 2MKYA 1IBLF 3PHEA 4NLDA 3Q8PB 5GAGU 3K5NA 3TZZA 3G82A 2MHEA 3ZTRA 1FRJA 1RA6A 1S1WA 2VL1A 5F9NA 1H38A 3QRRA 4NZ0A 3DOLB 2FHMA 5L9XA 4GKJF 2EK6A 2NUHA 1IWAA 2ZBIA 2F8HA 3P96A 3Q8UA 2CWKA 3DKDA 3MM9B 3T3FA 1CJTB 2DCUB 2ZITA 1BXNA 1R8PA 2G0JA 3D6MB 3I82A 4XAKA 3OLBA 2ZH1A 4OFZA 2DK2A 2UV8A 4RNHA 3TX0A 1PJ6A 1RWXB 1RI7A 1TL7B 4KAIA 2OAUA 3ZNUA 4F7VA 4MT1A 1D8ZA 1VCTA 2VODA 1K44A 1YVFA 3SDEB 2EFNA 1HYSB 1UFKA 2DY1A 5C24B 1TUVA 1VJWA 2IVYA 5F8LA 4NLOA 4IG3A 3G6YA 4IG3B 1U02A 3S01A 2ZH3A 2CQ4A 4P10A 2KXNB 3LP1A 2MPUA 1E6YA 5HVFA 3CJKB 3OFGA 3VCDA 5J2NA 4DV1J 3JS9A 3MECB 1NK7A 2VBYA 2WW8A 3O6QA 2X3GA 2UU9F 5BYRA 3PRVA 1URRA 3QQCD 2C3MA 2ZNYA 1VBXA 4KHPJ 3P8BB 1RABB 2KYXA 3I4PA 4YS2A 3HKZD 4LREA 4DR4F 4LFBJ 1EJ7L 4ICLA 3NBPB 1WUUA 3RAMA 5A8WB 5CZXA 2CJYB 1SKUB 1RB0A 2Y3YA 5JVHQ 2F1FA 3R97A 4DV0F 4ECQA 1B0TA 2FUG9 3MR2A 1FNXH 3QGHA 4OX8A 3CD6S 2R8IA 5KFYA 4DF4A 2HG4A 3KLIB 3SSSA 4DZDA 5KFWA 3MFIA 2HEKA 2DH8A 3BPSP 2BANB 1KVKA 3PEHA 1S57A 3Q86A 1MWYA 2GGPB 1X4HA 3OTEA 4PWDA 4QU6A 3KHLA 5L1LA 2ZM6F 2OPQB 1FD2A 3GJTB 5CXTA 3PXGa 2OIHA 2V4JA 2GMLA 1ZPWX 3OL9A 2OP5A 1PYSB 4LF2A 4URQU 4Z37A 2VQEJ 2ZHAA 2DNHA 1WG5A 3RUBL 3CC4S 3TVZA 2HNDA 5B7WA 2OEJA 1JKHA 3H8YA 4C48A 4QU7A 1TL3A 4UUXA 2H9ZA 2X1GA 1WSVA 3M8QA 5LMNF 3DU5A 1C1CA 1S1TB 2ZD1A 5CD4A 4AQYF 3EM1A 2UXDJ 1RBAA 2NYIA 1BQNB 4I64A 4B9VA 2ZKUA 2M3DA 3O2IA 1CJKB 4J91A 2A0FB 2KVQE 4HI1A 4L3NA 2PFDA 4MMOA 3I9V9 3OSNA 2C2ZB 1CJVB 1XMOJ 1X9MA 4C9DA 2FD2A 3CT9A 3KHRA 6FD1A 2GO9A 3LTOA 3S1TA 2KG0A 3F44A 4DU8A 3MOZA 5HMZA 1DARA 5KG7A 2QV6A 4QOTA 4NLPA 4RO0A 1R8HA 3N28A 4UUWA 3H4BA 2LEBA 2J0SD 1E6YB 3H0PA 3M32A 5F9LA 4OZ0A 4CM0A 3P4UB 4RW8B 4JI5J 1BE4A 1HPZB 1JXVA 2VQFF 2CVEA 2JC0A 2LQ8A 3GCXP 2XS5A 3HF5A 2ZUAA 3NWRA 4N7TA 3SSQA 1BQXA 4LBPA 1TKXA 3DOMA 4N77A 2GQCA 4FS1A 4U7UD 1PSDA 5ETPA 2H3EB 3OR2A 6FDRA 2ZOFA 4YDDB 1RCOB 2FC8A 2UUTA 2AGPA 5D0GA 1RAOA 1SKSA 2MKHA 5IC6B 1NUEA 1VS3A 3L9ZA 1L3VA 4FF4A 2GJFA 2IBKA 3CJSA 3TUPA 3BJYA 4ZPTR 1EP4A 3G6XA 1C0UA 1TL5A 1UJ4A 1C4AA 2QFIA 2VFRA 4OJGA 4E2FB 1HNXJ 1T3NA 3TAMB 2G4BA 1UPMB 1UEUA 4BBYA 3SCJE 1XEZA 2AX0A 2CRLA 2QYGA 3RG6A 4F4YA 4LF5J 1RTHA 4WBFA 1RGVA 1HQUA 4WWSA 4ENOA 4URGA 1UMJA 2N4CA 3DLHA 1CJUB 1T3OA 3C6TA 3POTB 1H2VZ 3SCIE 2IM2A 4DV5F 1F2HA 4PWUA 1YHQS 2VBWA 3KUGA 4O23A 4P74A 3HHLC 1U47A 5F8HA 2E1RA 4LF4J 2JRSA 4ZPVR 1TFWA 2WHOA 4LIWA 1BQNA 3M6WA 4YY3J 3N0VA 3C16B 1DTTA 2FGCA 4FPIA 4QWBA 4XPCA 1J5OB 3RR7A 4EZ6A 3BB5A 5AXKA 1RTIB 1HWUA 1XIQA 3TYTA 3H5UA 2CKWA 2XMTA 4Y28C 2KJVA 5DO2A 1YBAA 3MM6A 4F4ZA 4ED7A 1LWFB 3HP6A 2I2YA 1K8AT 1WF0A 2RKIA 3SQGB 3GSIA 4NCGA 1WC6A 1ZAXA 4RUAA 3ET6B 1TL1B 3MMCA 4LF4F 2IVMA 1FX2A 3IFEA 4IDKB 4NE9C 2RF2B 3OJSA 4KYZA 3SXLA 1M5HA 4Y0FA 4OI4A 2X7IA 2YKNA 2NXNA 2BM0A 4NXNF 1Y00A 4N8OA 4QIEA 3VZHA 3HD1A 2XMVA 3UVJA 4IFYA 4ZVPB 2DNPA 4LSLB 3QZ7A 3DI6B 5J2MA 3BDPA 3JSRA 3OW2R 4JI7J 1SQEA 2B9XA 3ZTPA 2KM8C 2EEYA 5FLXU 3TAPA 1K0VA 5KFLA 4IRCA 3MGJA 4ZHRB 2LA4A 5A6WA 1N52B 2QSFA 4CO0A 2F9JA 5GADI 1KC8T 3TVKA 2A6MA 2LDYA 3OQ2A 4J9NA 2CWXA 2AEFA 1DQAA 3GIIA 2VG5B 2WB1D 3W5ZA 3IA0A 3F0NA 5BYQA 4B3OA 2BKOA 3V6DB 2O1PA 1FTCA 3KOAA 5K8NA 3MCOA 3RBXA 1QVFR 3OL7A 2J7UA 3ILIA 4F0KA 4WP3A 2L41A 5KFCA 4PRFA 2NLWA 2OMOA 3MPDA 3NGUA 1U1QA 1JLBA 1NEEA 1WG1A 3IM9A 3MD1A 3C6TB 3H2VE 3NS7B 3QFHA 5AE1A 2VJVA 4GVBA 1REVB 1UL3A 3G96A 1LQ9A 1VQKS 3TUIC 2V63A 4DUYF 3QATA 4A8OA 5K8OA 1TK5A 4KHPF 1HD1A 5DETA 5SZTA 4B3TF 4JP8A 1YJNS 3Q8VA 2W01A 3L95X 4ZIVA 5AJ3F 5DM6Q 4CT9A 2PDAA 1S7HA 5D0EA 3AHPA 4TY8A 2XHCA 4IR9A 2R7WA 2G1DA 2C2OB 4PXCA 2XYGB 3CMQA 4Z7YA 1DHMA 4EYHB 3SV3A 3OSPA 2JEFA 1UZHA 4DSIA 1EARA 4M5IA 4K4UA 1QAIA 3I4HX 1JNRB 1UPPA 2JC1A 3LP2A 4MYTA 3NWGA 4HR2A 1KKHA 3M8PB 3MEGA 5J2MB 2DCLA 4L76A 1H0HB 3D0IE 3CCES 2AYEA 2PI5A 3A1YG 1TKTA 3EXYA 3FKBA 3HULA 2CQGA 2H4YB 2QT7A 1QUPA 3FC9A 4X4PA 1RAAB 3DLBA 9ATCB 4H54A 3EZUA 2LU2A 4NLYA 2YH1A 2ZHOA 2Q6CA 4RUCA 1LWFA 1XK8A 2CG4A 2W2OP 5B0BA 3J81U 4J9SA 3V81B 3PKYA 2VA2A 1HQ2A 3MOJB 1TAQA 1Q5YA 1X5TA 3NXZA 2ASLA 3DLGA 1FDDA 4YN3B 3S8SA 2ZZNA 5HMXA 2ZH9A 2ZOMA 2ERRA 3W62A 3R1LA 3AB4B 2J76E 4WFZA 4WZQA 4J9UE 5A8RB 4JI7F 3GV5B 1EKRA 1S4FA 5M2PA 1NHUA 3FJ2A 1OMSA 2ILZA 4OIXA 1LW2B 3PYDA 2E1MC 4DX7A 5L38A 1S6UA 3DRRA 4QWCA 3KUEA 4H4OA 2ZH5A 2OPSA 1VK8A 3LP0B 4U96A 3W8GA 3CO0P 5K14B 4LFCF 5E7OB 3RZAA 2HAIA 1XNQF 4LR9A 2APOA 2JLFA 4M94A 3CDBA 1P9YA 1TU0B 1U09A 1YJVA 3VQSA 3D6TB 2E9TA 3B82A 1R7IA 4L74A 3BO2A 5ETTA 4WE1A 4DOZA 4N41A 4JI4F 4RW6B 2HZCA 4FF3A 4UT4A 1U1PA 2R8JA 1X7VA 2HQ3A 2V8GA 2E5LF 5IOLA 4CYUB 2CDQA 4QIVA 1FO1A 2XI2A 3PJXA 1HWJA 3MMJA 2RUSA 2YNIA 1K1QA 4NCBA 2DY9A 2WSFC 3D54A 3M1VA 2HVHA 4B17A 1NAQA 4HEA9 1PYTA 2ADBA 1S97A 2XWYA 2MQNA 3A8JA 3KKFA 4OYXA 3EZ5A 4B3TJ 1FHTA 1VC0A 4ECRA 4KPCA 4USKA 3KLGA 8AT1B 4PABA 1JLAB 2XSFA 2JWNA 2AU0A 1DTTB 4HT7A 1PO6A 3CCZA 2P8IA 4Y65A 2C2DA 3DOKA 3O5TB 5DGBA 1SPBP 3DLEA 2XY5A 1HMVA 1K9MT 2LLZA 2A2DA 2NXCA 1NDKA 5I42A 4GC6A 3KHGA 2DO4A 2PMHA 4IFVB 1XMQF 1U2FA 1Y4ZB 1AUSL 3ZXWA 3JQKA 3M8PA 3MEGB 3SFUA 2W4DA 2XNRA 1HI1A 3QBCA 1NB2A 3MTJA 1G3OA 3B4MA 4LF1A 4PKDB 1RTDB 4DQRA 2BUNA 1HPZA 1MWZA 3FUYA 1U6FA 5T7LA 4YR2A 4JI0J 1LKZA 2KVIA 4F02A 3R2CJ 1EAYC 1H73A 1TQLA 4CCHA 1ZS6A 2RRBA 3CW2C 1YIJS 3CULA 2Y9HA 3FFIA 3A3PB 1KQSR 4KGVB 3R5BA 1NK6A 2JLEA 4IG0A 2CQBA 4HACB 2E5GA 2XYHB 5KAKA 1T9VA 4B3RF 2VFSA 1DURA 5LMUF 1J5EJ 1D9DA 1RZMA 1V6HA 2PGCA 1WD6A 3UVJB 3F73A 2W25A 1OSDA 1S1VA 5KT6A 9RUBA 5IV3A 4RW8A 1SH2A 2KI2A 4QPXA 3V4IA 4MTPA 5KFHA 1ZTTA 2DD8S 5F8MA 2KM8B 2JEIA 1KEKA 3M2UB 1IKYA 2MKCA 3R1HA 4W90B 3EXCX 1QVGR 5FJ4A 1FKPA 3NMAA 3RRKA 2XCAA 1X4BA 2LDIA 4R8UA 3CJ4A 4ZK7M 1RHJB 1QSLA 2J6UA 4ECVA 4DSFA 1T9XA 4ELUA 5LSRA 4KFBB 1RLCL 4V19J 4OHVA 4JI5F 2MQPA 4CO5A 3HVRA 4H4MA 4C0HA 1BQMA 3UN2A 1XN9A 4V1Ak 3K89A 2Y0SD 2RRAA 1RWNB 5HLFA 3W2WA 2ROPA 1KFDA 4DN0A 3UCUP 3CO9A 2NREA 3PHTA 1WWHA 4K59A 4OZ2A 2VH7A 4EI2A 2W7AA 1PBAA 4DR2J 4AL6A 3PM9A 3KLHA 2QA1A 2RHQB 1YZ7A 3QO9A 1NK4A 4DR6J 4K50A 4AYBD 3DNCA 5LXRA 2YY3A 1T02A 2DXDA 1U7LA 2IYIA 1NDCA 3POTA 3CJ0A 1SL0A 3OVBA 1UEVA 4NLWA 2DH9A 3ZC4A 1P1TA 2HW3A 4ETZA 2JEJA 4AD6A 1VQSA 4ZMMA 3J81j 1X4CA 5EX0A 1WC3A 5JJBA 1ZH5A 3R27A 3DXBA 4DPYA 4M5MA 3ITHB 3LP2B 2UVRA 4ZITA 1RBOB 2L9NA 2ASJA 4USTA 2UP1A 5H9FK 5C42A 3MM7A 3NNHA 3MHYA 2R7OA 4CLZA 5KT2A 4DV6F 4FXVA 2E7XA 2KXFA 4USHA 5ETOA 5HVHA 3MR3A 1UFWA 2GIQA 4OI1A 4IR1A 2CPZA 2WW4A 4NLXA 4Y00A 5CD4H 1YRUA 2MY7A 3D1QA 3ENAA 1DY3A 2R8KA 1ICEB 2DISA 2BE2B 2LQ5A 2YH0A 2QX0A 3J81Y 4CIOA 1X0PA 2P9CA 4NMXA 4CWBA 2FLNA 1NDLA 1QUVA 1XMOF 5E33A 2ZZMA 2BYCA 1Q8KA 2RNEA 2VG7B 2EC2A 1FCAA 3KDOA 4ZKAA 3AOBA 1GXLA 1ZM2A 3CJ2A 4CP5A 4WE1B 5H9EK 2HHUA 1EB0A 3E51A 1WC1A 3DGVA 5T14A 1N6QA 5G0RA 3D3CJ 3ADAC 2E5LJ 1CLFA 2GV1A 5AE2A 3A3OB 2MYFA 3DDIA 1IBMF 3U1NA 2HFUA 2HZVA 4LUBA 1G4CA 2DIVA 5G4DA 2CPYA 2J9DE 4EBDA 3NCQA 2YWWA 3H5SA 4CM2A 3UD3P 4KJIA 1F9EB 4CO1A 4LVOP 2LEPA 4DSJA 2FHOB 2YWGA 3EDRB 2AQ4A 4A8FA 1NK0A 3D6FB 4ILRA 2E66A 3QAUA 3AA8A 4Y3CA 2R7XA 2NZ4A 2HLTA 1BQMB 1VQ5S 3D68A 1JLFA 3BKTA 2PT0A 1N8RT 4FF1A 1S5ZA 2XLKA 1H72C 2CYYA 3OV7A 4NRUA 4PCQA 1FF2A 3KUHA 4WFAQ 3Q8SB 4B3SJ 4PXDA 3RTVA 4NXNJ 3K8VA 4DL0C 1P6TA 2IVFB 2ZD1B 2EKYA 2V5HG 1SC6A 1ULRA 1R3NA 1SCJB 2KT5A 3CE8A 3IG1A 1CG2A 4NA3A 5KOWA 3QSIA 4ED0A 5JVGQ 4IRKA 2VFTA 2EWHA 1CJKA 2O01C 3OTCA 2BQUA 2J8AA 1RU2A 1WDDA 2GVDB 3HHLB 1TP7A 4CO4A 2YWFA 4NLUA 1C1CB 1JK9B 3FSYA 1S10A 2B7CB 3DM2A 3E8OA 4GO7X 4ZJQA 3Q8RB 2MZRA 5IFMA 2U2FA 4MIWA 4J9MA 2R7SA 4OX9J 2ROGA 4IRDA 1C0TA 1HWIA 2XC9A 5C7PA 3MUTP 3CCSS 4LRAA 2VA3A 4NASA 2DGOA 2Z0GA 4KGMA 1J27A 1S9GB 5J1NA 1RT7B 3T1YF 3R5GA 3R5AA 3T19A 2WONA 3MF5A 3N01A 4M8LA 3TA2A 4ZLJA 2VZ9A 3DDKA 1FTRA 4USUA 5KFTA 1RT2B 5E3AA 2KB2A 2BE9B 2VFVA 2F40A 2WTFA 1UTAA 1KBRA 1HW9A 4WF9Q 4A8SA 4LSZB 1RT3B 2B6AB 2J7KA 3AQPA 3CC2S 3WHIA 1L3TA 2HK2A 5SUHA 3HKWA 3PV8A 1RTDA 1LWCB 4A4JA 2DGVA 4TQRA 2YX4A 5DLGA 1UWBA 1SV5B 3AD9C 2OPRA 1RCXB 3KNGA 5A76A 2CUYA 3Q8YA 1TV6A 4TU9A 1JX4A 4DR7F 3M1VB 5KG1A 1RYSA 4GO5X 4KV8A 2OI2A 1BWVA 3CCTA 5E0OA 1RUSA 4OZJA 3HHEA 3VVUA 2ZHBA 3BBBA 4RW4A 2DRBA 3PEJA 3GILA 1Q95G 2CQ0A 3LAKA 4PXBA 1YDLA 2P6SA 4KSEB 2MLZA 3VTIA 4MAKA 1AB8A 4UOCA 3TO8A 3THTA 2K2PA 2MQ8A 3H4DA 2LU1A 1DLOB 3IRWP 2GVZB 1WSRA 3W65A 4ZJLA 2IIHA 2BOAA 2UZAA 2MMYA 3HHKA 5D15A 3VGUA 3BKFA 3ZZTA 1JLEA 1QAXA 4KFBA 4Q45A 3KJVA 4DV3J 2V0NA 5H9EJ 2UVUA 1Z1ZA 4UZBA 1TK8A 3I5CA 2KFNA 1XERA 1YGYA 2W2MP 3HJFA 1UJ5A 4ZVUB 3G82B 1D1UA 4XDCA 2E9ZA 1XR6A 2EPIA 3PJWA 4I6AA 3T5JA 4O3QA 3NP5A 3TP2A 4XDDA 4FYYB 2YQ0A 4JV0A 4Y2CA 1SJFA 3TZXA 2HFSA 1TKZA 2N3LA 2GJ2A 2HURA 1H2TZ 1RTIA 1TMJA 2PO4A 3ISNC 4DG1A 2F65A 2EFOA 3C15B 3ETMA 3MR5A 1LNQA 3KLFB 4EYIB 1HR0F 1JB0C 2V4JB 2RF2A 4PWWA 2ZE2A 1FT8A 1YJTA 1VI7A 1Q16B 3H2LA 3MXHP 3OTOF 2M70A 2CIMA 2B0GA 2QJ3A 2CPFA 3VQTA 1KP6A 1FESA 1MG7A 4FZVA 2COLA 4JYAJ 2HS4A 3AFGA 4LBHA 3DLLQ 1FFWB 4NEYA 1IKVA 3DRSB 3FGVA 5I3PA 1AUDA 4OYPA 3WIUA 3V4IB 4JI3F 4C4WA 4NX9A 2UVWA 4EMDA 3SV4A 1TVRB 2W9CB 4ECYA 2M7SA 3DDNA 4WP9A 3CJKA 2VUGA 3Q83A 3QLHA 3RRHA 3HJVA 2D41A 2WVCA 1IBMJ 3FVYA 3T6BA 3BF4A 4QWEA 5K8PA 3CIMA 1RJJA 1L3KA 4WK3A 4OYAA 4YHHF 3PJ9A 4FYDA 2AEJA 1F9FA 1F5BA 2PD1A 3A8EA 1HNZJ 1JLCA 2OELA 1NM2A 2OLWA 3I32A 4P6QA 1NJIT 4BS2A 2XS7A 3ZZ0A 1RP5A 1NRKA 2AX1A 4KHRA 3CC7S 4DCOB 3GYXB 4ZA1A 1A7GE 2VPWB 4EWTA 3WBZA 1WORA 3BGRB 2FJDB 4AXJA 3B4DA 5DDRC 2XM3A 1QLNA 1NH7A 5A0YA 4RJVA 3GJSB 4DR4J 3K5MA 5HROA 1ITPA 2FVPA 4DUZF 3GPAA 4CLKA 3THVA 4WKRA 1WDTA 4L75A 3O1LA 4TVAB 4HLBA 2W9BB 4HYKA 1QTMA 4IOAQ 5HQMA 2F4VF 1FWLA 1Q78A 2K06A 1H3DA 3UI3A 1UVLA 1F3FA 2YWEA 1Q8IA 3EX7B 1V5VA 1JLEB 4I4BA 4TLRA 1U6ZA 3LPYA 3VAKA 4FVCA 2DR9A 1ZM3A 2DR8A 3K7RA 5THWA 3PW7A 3MR6A 4Q44A 1MW7A 2WB4A 4F4XA 1UVNA 2G13A 4OX9F 3PACA 1Y7PA 2LA6A 5KFAA 3AOAA 1AYEA 1IM6A 4DL4A 2P9EA 2YXLA 2MLXA 1RAGB 4OLOA 2IC3B 4QQBA 3N9UC 2CQ3A 1NKBA 2YX7A 1VIXA 2AJ4A 1X4AA 4HDGA 1X9WA 4DU7A 4P72A 1AW0A 4NCGB 5D3GA 1SC1B 2LEAA 2HZAA 2ZH4A 2MHNA 3PW4A 2CAJA 2K3KA 4U8YA 1QM9A 3W60A 3VVTA 5D6GA 1S59A 2IA0A 3CDWA 3BBCA 1FFSB 1O0PA 2R2RA 2DNZA 1RT2A 1X4FA 4A8WA 2ZVIA 2KXHA 1NXIA 1T0TV 2ADCA 2F4FA 2Y8YA 4Y2KA 4OYOA 4ZN3A 3GB0A 1SL1A 1FRLA 4N47A 2EFPA 2LFVA 2DGSA 3ZZPA 4ILLA 1DRZA 2UUBJ 2FLPA 1NZAA 1U2RA 1WC0A 2V2VA 2VHGA 3MI7X 1LFPA 2DO0A 1OJ4A 2RKIB 5KFPA 3MR7A 1LW2A 3ILJA 4KIAA 4O44A 2ZC4A 2JDJA 4NLGA 4PUOA 1RACB 2MKKA 1VHFA 1OWXA 2MJUA 2OKQA 3FK4A 2Y0BB 1RTZA 1RAHB 3NLCA 3UCZP 2MQLA 3Q8QB 3KJNB 4A48A 3WC0A 1UEKA 1HBOA 3UQSA 1FA0A 1RT4B 3GLJA 3MECA 4U7CA 3JAMU 4FXWA 3KNAA 1IWGA 4DLEA 3TRGA 3CJ5A 3HHNB 4FYXB
chains in the Genus database with same CATH topology
1Y9OA 4YEAA 2VBZA 3FCHA 4QJVA 3CCUS 3K5OA 3DRPB 4ECUA 5CYMA 2FPHX 4CH7A 3MEEB 4WU2A 3CJ3A 3JSMA 1F5CA 3PFEA 2FJXA 4I2QA 5BR8F 1OIAA 3TAMA 3M9NB 3IGNA 1VC6A 3FRZA 1Q7YT 4FBUA 3T9NA 3J7YU 1OQ6A 1VGYA 3BSCA 3QGGA 4E98A 2AF6A 3GFXA 2DPIA 1NHVA 4DQPA 2I38A 2WBMA 1D8YA 1KOHA 2CJBA 1CC8A 5CYQA 4C0BA 3ULHA 4HDHA 3K57A 2DTJA 3OUYA 2IC3A 1U1OA 4I7FB 1U6BA 3IWNC 3P3DA 1WF2A 3U7JA 1LK5A 3BGFA 2GHWA 3E01B 2YKPA 4ITSA 4CNYA 2FHJA 4GC7A 1S1WB 3TQ1A 2XMMA 5FIIA 1S76D 2KFNA 1CEZA 2F8MA 3MM7B 1XMBA 3G6ES 1UVJA 1APSA 1OPIA 1XBWA 1S1TA 1LWCA 2KKHA 3M30A 5MLCV 4R5PB 5HP1B 3LWMA 4I2PB 4PG7A 4Q43A 2HHWA 2L9WA 1LXNA 1IBMF 3W7BA 5CHCB 4EZ9A 1U24A 3ENQA 1V3RA 3D1HA 2FJVA 5KG5A 3IO1A 4FPRA 5DRKA 1P27B 1FDAA 2J5AA 4H4KC 2HHSA 4KRWA 1GH8A 1FJ7A 1V3SA 1UKUA 4DS5A 4CO2A 5H1SV 1I94F 3MEKA 4X4TA 4A46A 4O44B 3BSNA 3TR5A 3NG8A 1ZPVA 3M6UA 2W8LA 1VQ7S 1NK5A 3M8SA 4ZCKA 3GR0A 1YI2S 1RT6B 2QFJA 1KQGB 2DNMA 3M2RB 1OSCA 2XGPA 2AJFE 1IM4A 4CH1A 2DR7A 3G71S 4PUOB 2FTRA 4ATNA 1B0PA 1ZM4A 5E3RA 3MM8B 3E2EA 1S6QA 1T05A 4JI1F 3W2WB 2J9EA 3JAMY 4N76A 2P9GA 3OLAA 2YNFA 1N32F 2CQ2A 3QWUA 3H25A 4OI2A 5GAEU 2G9OA 1Q86T 2HFZA 3WZ0A 2MZJA 4RKUC 3WX4A 4WIIA 1NO8A 1EP4B 4A8MP 2W9AA 2DGUA 3M8RA 4A8YA 4O3SA 2LQJA 2Z2LA 2E9RX 2CJ9A 1WF1A 2YNHA 5C25B 2R2SA 2XS2A 1GXUA 1S9EA 2RQ4A 4M5DB 5D3GB 4NLRA 1MROA 4ZS6A 4X4QA 4O0IA 1RTJB 3CEDA 4OLPA 1KQKA 3BR8A 2VG6B 4B3MF 3ZZOA 2JHEA 2XI3A 4RBUA 2VPXB 2Q6BA 2YWKA 2R7TA 4UY8T 1VC5A 4UQGA 2XMUA 4NZ7A 4EO8A 4EEYA 1F5AA 2BOPA 3FZ2A 3Q0AA 5JXSA 3HDSA 3CWJA 3N5FA 4E0DA 2UUWA 4G1IA 1FK9A 1WEXA 2WOMA 2JEGA 2HGMA 5LL6d 4FP9A 5KFZA 4WFYA 2V9KA 3IAM9 4LF9F 2D9OA 1BY9A 2GO8A 2SXLA 3CUNA 4Q2MA 4DN9A 1D9AA 5M2UA 1KONA 2YX1A 5CCMA 5HO4A 4NLQA 2KT3A 1VQPS 2E7WA 2EG1A 2OTJS 1S1UA 4MH8A 1RA7A 1HA1A 4F50A 4DSLA 4K5RA 2OD4A 1R8BA 4KV8B 1MNEA 5GAEI 4O3PA 3DYAB 1S6PB 2XSJB 2FIUA 2KU7A 4M63A 2DNYA 2RQMA 3AY0A 4D3GA 4P7VA 4IQXA 2ROEA 4DWIA 1N56A 2R7UA 3M4XA 3DOKB 4NCAA 1RT4A 4RW6A 2X1AA 4Q8FA 3MMBB 1N5YB 5B0GA 3GFZA 1YQHA 2LECA 2IMOA 1C4CA 2RRNA 4CNZA 3AAWB 4DFJA 3AJ2A 3ZZYA 4DF8A 4DMZA 1FJCA 1DTQB 2D74B 3IC1A 3QAEA 2X51A 2V8HA 4H4MB 2MZQA 5B09A 2ZJRQ 3N5BA 1R0AA 3Q2TC 1YRTA 3BSOA 3F41A 5A6PA 4ZCLA 1IJFB 2FGOA 3L09A 4KBIA 3I5AA 2E29A 1G2EA 3OR1B 5DS7A 1TKZB 4NPOA 4Q5VA 3IN5A 2JOQA 1FJEB 5EGYA 1NJXA 3AB2B 3N4WA 3PIPQ 4E8UA 4KPYA 2QLXA 4MYUA 2OJ3A 3I55S 4UQTA 4DV1F 2XMWA 4OX6A 1KLMA 1P1LA 4DEZA 2M52A 2BE2A 1TKTB 2X1BA 5CCLA 1N48A 2HGNA 3NKYA 1GQEA 4YOEA 1FK9B 2WOMB 2CQCA 3TARA 4KR0B 4IOCQ 5K8MA 4X4NA 1S1UB 4X2BA 4JUZA 5J2NB 4RX6A 4RU9A 2HHTA 2BACA 4LVNP 4J37A 1VFJA 3C66A 4MK7A 5B0CA 4RW4B 4I69A 2KHDA 2RMLA 3NBPA 3PFOA 1RT1B 2HWHA 5IT9Y 2QO3A 4U7UK 1TV6B 1HHTP 4JYAF 3H98A 1Z2LA 3OVSA 4YP3A 2FHKA 2BM1A 3LGNA 1IKXA 1CC7A 2OTLS 1GNKA 3NRBA 4DJBA 1VQOS 3MUVP 2JJ4D 3HHLD 4YB7A 5HQ8A 5EX3A 4HT5A 3VAFA 3M2RA 3CD7A 1DZ5A 4CTAB 2XBPA 1HBOB 2QE5A 3PW2A 2EFGA 1NJYA 1W2IA 1HW8A 1S6OA 5D4NA 3BO4A 1X5OA 1WEZA 2GNKA 3VF0B 1KOOA 2AD9A 2MKIA 2P6TA 3KK2A 2N4DA 3I56S 4DQQA 2YNIB 3Q23A 3HZEA 2EBGA 3G8QA 3MEDB 3RW6A 3MM8A 2J0QD 1VQYA 4BHQA 1KVIA 3V6JA 5HLFB 2IFXA 5DG9A 3D2WA 4R25A 4CH0S 4FBTA 4ECXA 2CPIA 3QGIA 1VQNS 4WXWA 4ZP6A 4L6V3 4I67A 3SSRA 3U1LA 5MAOA 2C28A 1L3SA 3I87A 2IAJB 1XR5A 1XNRF 1TL1A 1X4EA 1AFJA 1KVJA 4ED1A 4X65F 1MU2A 4EU0A 1WTFA 3NCPA 1VIOA 2NPFA 1FXDA 3KK1B 4R0EA 2BQ3A 4Y6IA 3G86A 4ECSA 5KFEA 3FFIB 1SIWB 2YWHA 3NCRA 4X62F 1U1NA 4B9SA 1NU4A 2LXUA 4OL8A 4F8RA 1FKAF 3GZ7A 2DGXA 4C0OC 2DHGA 2OPRB 3CMES 1UWBB 3CDEA 3SEOA 4N8NA 4RNOA 3FDSA 5KFOA 4G1QB 1FKOB 2B43A 1UVMA 3KLEB 1S1XA 4ECZA 3JSBA 1VK3A 1RT3A 2HGLA 5I3QA 4OX7A 1YG0A 4C3LA 1HYSA 2VKRA 4ZPAA 3H20A 3KK3B 3QZ8A 1ZETA 2BW2A 5FD1A 5D8HB 4C98A 1SV5A 4DL5A 2LCWA 2FJBB 1YJWS 2C3UA 1O51A 3MUMP 4DL3A 1VLYA 1JJHA 1ZZNA 1N33F 3DRXA 2FC9A 2Y1RI 2HMIA 1XR7A 5HROB 5IM0A 3C3LA 2HRUA 2B5JA 5KFUA 2HLUA 4IH6A 3CTRA 3QMQA 2BQRA 4F3OA 2F7VA 4ES2A 1QY7A 5A8KA 2YNGA 2DNOA 3HHLA 2FJEB 3GYNA 3LALA 4FNIA 4QWAA 2C2EA 3PO5A 4DR3F 3QPIA 5F0WA 3DMJB 2NUUG 2VB6A 4RW7A 2C42A 2F8EX 2DH7A 3SI8A 4K4YA 1TR0A 5CYJA 1WI6A 3GV7B 4NMLA 1IUJA 2FDNA 1HNWF 3GWCA 1Y3JA 4NLSA 4Z2XA 4MKAA 3NS5A 3SMZA 3AA9A 2ZOGA 3PRBA 4I7FA 1KLMB 1PILA 4C8KA 3DC2A 4MIBA 5F3TA 2BR0A 3N6MA 1U45A 3M9MB 3OHAA 5KFRA 2IA6A 5GMKa 4QR0A 3OR1A 3I6PA 2GFFA 3KTQA 4TNOA 3VAJA 3V2UC 1XC9A 4PG8A 2B9YA 4WXOA 2VASA 3MMCB 2UUAF 3FEZA 2KTQA 2QA4S 3OFEA 3V81A 1ZTWA 1WHYA 2XWXA 3MMAA 3K2YA 4F2RA 3BQ0A 2CPJA 3MMBA 4QR2A 2HNZB 1RDRA 2CQPA 3CGIA 2V4RA 2FVSA 1HBMA 1QAJA 2OPPA 3MDFA 3DRRB 3PIOQ 5KFGA 1AROP 3BGRA 3K5PA 2HPUA 2XMKA 3DYAA 5ITHA 4B9UA 5KFXA 4IH7A 2GQQA 4QYZJ 3KHHA 4P2SA 2CVIA 4BC9A 2E5IA 3GG0A 2PIIA 4WKYA 4PWDB 3PX4A 3PX6A 4HI2A 2R7RA 5KOXA 1CQNA 1T95A 2W4CA 5I42B 4FF2A 2AV5A 3NAHA 2OSRA 1CVJA 2B4OA 3QIDA 3EPIA 3D28A 4KQZA 4O4RA 4TY8B 1HARA 3UDCA 4U67Q 4J9LA 2GJIA 1SJ4P 2CJKA 4OI6A 1W25A 2V4QA 3MFHA 4ZVEA 4OV1A 1HBUA 3UWTA 1R8CA 1S0MA 1YJRA 3BN4A 5C42B 2HVIA 3CVKA 3LH2S 4MKYA 3DI6A 1FERA 4MK9A 2OMLA 2PC6A 4KHMA 3CCJS 1FRIA 2B51A 3DM2B 4NYZA 2Q43A 4RNFA 1UVIA 4MK8A 1URNA 2IHR1 4OHYA 1NH8A 5L1KA 1Y5LB 3IR6B 2K7JA 2R7QA 2ALZA 2DB1A 3C8YA 1S1VB 3ISND 3FEYB 3IRXB 1S9FA 2C3YA 1UA0A 5LSLA 4F4WA 1MU2B 3K8WA 4QIWD 1JMTA 2RUGA 5EUHA 3S6EA 4LSLA 1FKPB 1FD8A 2CQ1A 4OHWA 4C11A 2W7OA 2RQKA 4K4XA 2ZH6A 2GA7A 2MXYA 1X0FA 2KFZA 3KG1A 5HBMA 3GE9A 1T8EA 5B0EA 1LK7A 1JLCB 2O3DA 4PG4A 3T1HF 2ACYA 4O3RA 3C6UB 2CZ4A 5EDWA 5EN1A 3PW0A 3MAQA 3BQ2A 2AJ0A 4MFBA 2G0CA 3CDAA 5D4OA 5HL7Q 1N88A 2A1BA 2KO1A 4B02A 3UDLA 2EC0A 1KTQA 2WSCC 3KJVB 1RTHB 4XIUA 7FD1A 3KWMA 4I6YA 4PPDA 1R89A 1DTQA 1PGZA 3WC2A 2GGPA 4I1TA 1FNMA 2YKMB 1Q82T 1HMVB 2Q66A 3WDOA 1F60B 2CPEA 4TKTA 4OJ3A 4K4SA 2D1CA 2N7YA 4JI0F 5T7LB 3D1OA 1SIZA 2KZMA 1JJ2R 3UW1A 2IMWP 5A8KB 3BGLA 3DXSX 3I0RA 2D7SA 1O8BA 5J2MA 3PVXA 2CZVC 2GHPA 1JLGA 2W4PA 4N5SA 1IBKF 4NXMF 1HBNB 3V6KA 1QJHA 5KG4A 2BDPA 1FXRA 3ENWA 4IOBA 4CI0B 3IXQA 3MZIA 2K8GA 1H7WA 4PG5A 1J5EF 4YY3F 2C3PA 4JI8F 3B8HA 1KSPA 4QW8A 3QIPB 1UAWA 3HFKA 4K0KF 3SDEA 1RYRA 1UW4A 2AP6A 5C24A 1MMNA 5KTQA 4UY85 3GG1A 5T41A 4B9TA 4NYOA 4R5PA 3CMAS 5J2QA 3ISZA 1RKJA 4KKOB 1UVKA 2NQPA 1KNZA 3W2VB 1HHSA 4IFYB 3RBEA 3TA1A 2J7WA 5GADU 3IS9A 3LO3A 1ZAVA 5E2QA 1Y3KA 2WSEC 1A9NB 4TXSA 1Z4UA 5CYMB 4IKAA 2GQ2A 1B0VA 2V8DA 5D4PA 1S0OA 2DNGA 2BXJA 5LJ3Y 2KYZA 2OO4A 2YNFB 2XEXA 3CPWR 3EGWB 3DRPA 4HTJA 3H40A 2NR0A 2B4UA 1UETA 1IJEB 1U8SA 3FSIA 3MM5B 4ZVGA 2YKMA 3CD5A 2OPQA 1S79A 1N5YA 3OBIA 1NJWA 3AQOA 4X64F 1L5UA 4QBUA 3OTBA 5AXLA 2KHCA 4GKKF 3IG1B 2ASDA 4UW2A 1JKHB 5HN0A 4ELTA 3EPGA 1IQZA 2PE8A 1FDNA 3VAIA 3OPKA 4JV2A 4ZCIA 2PA3A 3HX9A 3N6LA 4DDFA 2IRUA 5J1EB 1J5OA 4LT6A 1PC5A 1CQMA 3DGPA 1GT8A 1NK9A 4LFAF 1YWXA 3FMBA 2I0XA 2NSBA 1U48A 3KG4A 3M30B 1VRUA 1FNOA 2D3UA 1GAOA 3S7RA 3M9OB 4AL7A 2IBKA 2GC8A 2DGWA 1TAUA 4YB6A 2ZDPA 3SFGA 2MGZB 5H9FJ 5KFQA 4JV5F 4TLQA 5KG6A 5G0RB 1GTHA 3X3UA 2N3OA 1HNZF 2E44A 1SL2A 4A8KA 2IRYA 2BVZA 4ZHRA 5ADZA 1LXJA 4I2PA 1GTEA 4NA2A 3FZBA 4C8NA 3NS6A 2XB2D 1Z2ZA 1DQ9A 3IS9B 4ECTA 1A6LA 3THPA 1HQEA 2N82B 2CQDA 2YKNB 2HS0A 4C7QA 4PQUB 2M9KA 5J2QB 1U1KA 2OFGX 3UNGC 4DV7F 1KLNA 3AJ1A 5U47A 5B0AA 1H6KX 1JWWA 5A0YB 3QJPA 1F0XA 2M2BA 3DFEA 1YTYA 1KTVA 2AGOA 3BDEA 3V6HA 3QJJA 3TVYA 1LWEB 1IKWA 2XHWA 3MEEA 3CF5Q 3DLKA 2VG5A 1YJ9S 1T03B 2KRBA 3R5CA 3NGDA 3BGUA 1YRXA 2R7VA 4ZCMA 1WHVA 5AE3A 3I5BA 3M8QB 4NWBA 3OL8A 4LF8F 2PA8D 2B4VA 5KG3A 3BN7A 1J2VA 3L7OA 4O4GA 2YTCA 1C0TB 3EGZA 1SH3A 1RT5B 1VQ9S 3KLFA 4CO3A 3JSYA 5KFFA 2FB0A 4B08A 5KT3A 1HNXF 4RNNA 3RRGA 4ECWA 2PSZA 3TNVA 5KT5A 2IRXA 2JFKA 3H59A 1LOUA 1FRXA 2CPXA 4F2SA 2DJWA 2NSCA 3JYTB 2CPHA 1V3ZA 4RUHA 2ABYA 5FLXY 3G8TA 4YB5A 2RQCA