6FD1A

7-fe ferredoxin from azotobacter vinelandii low temperature, 1.35 a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords 7-FE FERREDOXIN I (FD1)
publication title Structure of Azotobacter vinelandii 7Fe ferredoxin at 1.35 A resolution and determination of the [Fe-S] bonds with 0.01 A accuracy.
pubmed doi rcsb
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1997-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 6fd1A00
1WTFA 1FCAA 1H98A 3C8YA 2WSEC 2PA8D 1G6BA 1FD2A 1H7WA 7FD1A 3EXYA 2ZVSA 1JB0C 2GMJA 1FXRA 2IVFB 4AYBD 4OMFG 2Y0SD 3MM9A 2FD2A 3MMBA 1GT8A 1FXDA 2WSCC 4RKUC 1F2GA 2VKRA 2WSFC 3GYXB 6FD1A 3HKZD 2C3OA 1DAXA 3MMAA 5BYQA 1BC6A 1F5BA 1FDAA 2VPWB 5CHCB 1JNRB 1DURA 1PC4A 3MMAB 2XSJA 2C3UA 5BYRA 3OR2A 2C3MA 1CLFA 1B0VA 1A6LA 1R27B 1HFEL 1K0TA 1D3WA 2FJDB 3OR2B 2VPYB 2FDNA 4DHVA 1B0PA 1F5CA 2FGOA 2VPXB 4CI0B 1SIWB 2PMZD 1FRXA 2FJBB 2V2KA 3MM5A 2FJEB 1BQXA 3IR5B 1BLUA 1RGVA 4Y28C 1Y5LB 4KT0C 1ROFA 5L8RC 3MM5B 2FJAB 1FRHA 1C4AA 3MM9B 3MMBB 1IQZA 1G3OA 1Y5IB 3MM6A 5FD1A 2C42A 1IR0A 3OR1A 2PDAA 3EGWB 1KQFB 1FRKA 3MM6B 1FTCA 2UZAA 2XSJB 4XDDA 1FRJA 3IR7B 4XK8C 1GTEA 1FDBA 1FRMA 2O01C 2V4JA 1H0HB 1FDNA 1Q16B 1JNZB 4YDDB 2V4JB 7FDRA 1XERA 2VPZB 1SIZA 3PNIA 4OV1A 3LW5C 1FEHA 1SJ1A 1B0TA 3MMCA 1GAOA 4ID8A 4XDCA 2WB1D 1BD6A 1FDDA 3MM8A 1GTHA 3IR6B 3MM7A 3MMCB 1KEKA 1FF2A 2C3YA 3MM8B 1VJWA 1Y4ZB 3MM7B 3OR1B 5CH7B 6FDRA 1C4CA 2C3PA 1FERA 1KQGB 2WAQD 1Y5NB 2Z8QA 3EUNA 5E7OB 1PC5A 1AXQA 1FRIA 4L6V3 2GMHA 1DFDA 1FRLA 1BWEA 1H7XA 5BYSA
chains in the Genus database with same CATH superfamily
1WTFA 3LF0A 2QZ8A 2E1CA 5THWA 1R8AA 4ILLA 5IV3A 5LXYA 4LREA 3KDNA 3MUMP 1U4BA 2ZD1A 4U9RA 4NLXA 1JLEA 5HMWA 2G0JA 1NK4A 2UUBF 3W9JA 4DPXA 4KHPJ 1K44A 3HVWA 1S6PA 4Y2AA 1X5PA 4ED1A 2DNZA 1WUUA 2R3VA 4Z2XA 1WKLA 4RBVA 2DHHA 3FEZA 1Z4UA 1F6TA 2ZBIA 3MM6A 3PIPQ 3PYDA 3J81j 1F5AA 1FRKA 1YDLA 3BGLA 3JB9k 5I3UA 1JLAA 5DRKA 1YBUA 1UA0A 3TP2A 2EWHA 2XHCA 5ETLA 3MTKA 3QIDA 4W92B 3CJQA 2MQNA 1PJ7A 1X9SA 1LK5A 5IOLA 3TEHB 4QPXA 4BDPA 1TVRA 1VBXA 2B51A 3MR7A 3MTJA 3TAPA 4CLWA 2RKIB 2GHPA 1ULRA 1SL0A 4I56A 3MPDA 3EZOA 2PO4A 2NXEA 4O44B 2Q6BA 1OWXA 2OH2A 2FVSA 2O66A 4GRSA 4OX8A 1CG2A 1AZSA 4ZVTB 2MMYA 2P9CA 4NLDA 3PX4A 2ZUGA 4NXNF 2FY8A 1T95A 5K20B 5K8MA 1X4HA 3FZ2A 2P6TA 3PEJA 5J1EB 4R8UA 3JAMU 3R5AA 4DL4A 2FZCB 1Q7LB 1RAJA 2EBEA 2DB1A 1QDUB 2ROPA 3EDQB 4BWJA 3ZZPA 4MFBB 1QTNB 3CNQP 3EPIA 3SEOA 1G4CA 2UUAF 1S77D 3N6NA 5AE2A 4DU7A 2HVDA 2IHR1 1U6BA 4BCAA 1I5OB 5LJ5Y 5KFAA 3RBXA 3W9IA 4EK2A 2CJYB 4U8VA 4P74A 1FEHA 1KFSA 1RU2A 2OKQA 2MZ1A 2ILZA 3CJ2A 3A8KA 1B7FA 3FCHA 3SXLA 4R25A 1QVFR 5D4OA 1HBMA 3OFEA 2C2MB 1NJIT 3WIUA 4LSNB 2OI2A 4K50A 1R8CA 4X4RA 2AJ1A 4X84A 4PWUA 2V8DA 1AW0A 1HPZA 4TQSA 4OJ3A 2EPIA 5J2PA 3ENQA 1NJZA 3QZ7A 3KNGA 5M2UA 1PO6A 2XM3A 3LA0A 2V8HA 3VGUA 4B02A 2WRMA 3MWBA 1OQ6A 5AJ3F 3H5UA 4K4VA 2V9WA 2M52A 1Q1KA 1QJHA 1TUVA 2QFIA 2MKSA 3CCRS 2J7WA 3HFZB 4HKQA 1XQIA 4KH0B 3I96A 2YKPA 1V9OA 1K1QA 5ETTA 2KXFA 4A4JA 2PMHA 2DISA 1VS3A 1Z2ZA 2YPZA 1M90T 3J7A1 2CZ9A 2RVJA 2NZCA 4DUYF 2BJEA 3FSYA 2VG7B 1NH7A 2ASLA 1A7GE 1TQLA 1N34F 4FKYA 3IC1A 1RADB 2YQ3A 3PHTA 2PA3A 3CJ8A 1UEKA 1YZ7A 3BQ0A 3GCWP 2OJ3A 4NL5A 5B0CA 1K8AT 3HHDA 3KNAA 2Y3YA 3R5GA 1N0UA 4K4UA 4GC6A 1DAXA 1EIYB 2HAFA 3J7ZT 2F1FA 2QG9B 2DYAA 5KT2A 4DV5J 2VICA 3OL8A 2M4MA 3I6PA 3CDUA 1P8GA 1C4AA 4F7VA 2XY5A 2H4WB 4Q0BA 2V4QA 4DU8A 2RKIA 1HNXJ 1R89A 1XEZA 3LP2B 4K4ZA 4O44A 4LFAF 2F8MA 1T94A 2VF3A 1T9YA 4ES2A 1F9FA 1G7CB 1JLQB 2IFXA 5A2QY 4N77A 2YNGB 3F73A 1HNIB 3J81U 2ZZTA 2MQLA 1S6UA 4NZ7A 4J9UE 3VCDA 2WW8A 4OHVA 4I6YA 2R8KA 5K8NA 1UZHA 5DO2A 4EUVA 2A10A 2VH7A 4J9QA 2VHGA 3N0VA 1TK8A 1I94J 1NLKL 2YX4A 2W7PA 4ZJQA 3CULA 4KE5A 1HWJA 2FGOA 2KO1A 4PKDB 1RXOB 3PX6A 2FJEB 3IBCB 1REGX 3DHXA 4BC9A 5KT3A 2KM8C 3KXDA 2XMKA 3R1HA 4P7VA 3KG4A 4KJIA 1LW2B 1KQFB 2C2NA 2LA6A 2HMIA 2R7XA 4OI4A 4LSNA 3VF0B 7FDRA 2LEBA 2AIRB 4DCJB 3GIIA 2CNKB 2XBPA 4X65J 4ZP7A 5D0HA 1RBOB 3AJ1A 2A2CA 2B8QA 2KVQE 2VBXA 4KIAA 2ZEJA 5E3AA 4G1PA 2AKWB 3QWPA 4GVLA 1HQUB 4C48A 3M8ZA 1RTDB 3BN4A 3W7BA 1Q8IA 3T1AA 3G6YA 2BJ7A 1KKHA 1TL3B 3B54A 3JSRA 1HW8A 4IYQA 4RX6A 4NI2B 2X1BA 4BBYA 3PJ9A 2GZOA 1O6XA 4O3OA 5LJ3Y 5IV4A 1KP6A 1ZZFA 2HPUA 1ZZNA 4DPTA 2HS3A 1UFKA 3HZEA 5HBMB 1N5TA 2X1GA 1DQ9A 2NUUG 2UV8A 1UWBB 3CCLS 4OJHA 3DHWC 1CQNA 2HNZB 3SQGB 2CQ4A 1F60B 1SI9A 3J7AN 4NLOA 1RTZA 2GQCA 1RT6A 2YTCA 3H59A 2K2PA 3SV3A 2A2DA 1RT2B 4H4MB 4DX7A 4JI1J 3D4JA 1VIOA 2CQPA 2ZBCA 2J6UA 1QAJA 4F0MA 1C1CA 1F3FA 3QWUA 1FRIA 3NRBA 3PDNA 4DR7J 4R0EA 1UL3A 1HI1A 1IKVA 2BM0A 3EWGA 3D6TB 4TNOA 2UXBJ 3LPEA 1G6BA 3TVZA 4LT6A 2ZH3A 2ROEA 4AYBD 3HP6A 4U8YA 2KG1A 4OL8A 4L76A 3LP1B 2X1AA 1HR0F 3DOMB 2LLZA 5DLGA 1JJCB 5IZHA 5GMDA 4F4XA 5KG1A 2HLTA 2HK2A 3LP2A 4WXWA 4ATNA 1RBAA 4JV5J 1HWLA 1KTQA 1TL4A 5KFVA 1SXLA 3GSIA 1YSJA 2B5JA 5AE3A 4GO5X 1RLCL 4KY3A 1JLQA 2KKHA 4RLEA 4K0KF 3SCKE 4DBQA 2MQOA 2YNGA 3H25A 3CJKB 4KGXB 1HNIA 1NK9A 5EDWA 4HTJA 1KLMB 3U1NA 3GV5B 2V6AA 2YX7A 3OQ2A 3Q8RB 3AXMA 1YBAA 4LF8F 4LR8A 4LBIA 2J9EA 2WK4A 3UDVA 2XMAA 4ZHRB 5B7WA 2BJ3A 2B0GA 2ZM6F 1WD6A 3PV8A 4IUFA 2Z0GA 1SC6A 4RW7B 3JS9A 3EICA 5KFDA 1UTAA 3MD1A 4CI0B 4I68A 4WIQA 2DITA 4DV3J 4WE1B 2MKYA 2PSZA 1TV6B 3M8YA 2YWEA 4ECSA 2WW4A 2VU5A 2UZAA 1HQUA 1XJWB 1DJ0A 1L5UA 2MYFA 1DARA 1CJTB 4PAAA 4URQU 4RNHA 4ID8A 2W2NP 4IOBA 3IR6B 1TL3A 1X4CA 2E1MC 3CJ0A 4QBUA 1LWEB 3H7HB 3HHNB 2GVDB 1Q7YT 4NI2A 3R8YA 1C1BB 2P8IA 4U7CA 2EC0A 2YWHA 2WBRA 2KJWA 1A9NB 4LSLA 3BBBA 4DX8H 1U49A 1IJFB 5HBMA 3IM9A 1FFSB 2QMWA 4HTIA 2QA1A 2VKRA 2GJIA 2I1RA 1O51A 4F4ZA 2HWIA 5DGAA 1UWBA 3UDCA 2HNZA 2IRXA 2W1BA 4B3TF 3SQGA 4EBEA 4LQ9A 4LF6J 3QO9B 2I0XA 4KH1B 1PAEX 4DSEA 3R6GB 2RMLA 2CWKA 4ZPTR 1RT2A 4H4MA 4Z7CA 2OEMA 3FMBA 1SKSA 3OXLA 2JEJA 2RQ4A 1PBAA 2DGQA 3MCOA 4CNYA 2VBZA 4HLBA 3BH6B 2IDLA 2PIIA 3K5NA 2LMIA 1BXNA 3C16A 3MM8A 3AB4B 4B3OB 2MLYA 3DLEB 1S12A 3W65A 4AL6A 3MEEA 3ETOA 1Y4ZB 3DOMA 4C3MA 2XMMA 3K2YA 2Z4PA 3AOAA 1UPMB 1GXUA 3FUYA 3PCOB 2Z2ZA 3S7RA 4QR1A 3V81B 4K5SA 4DV7J 3GJSB 4LR9A 3PZPA 1AFIA 2VQFF 4OYXA 4IRCA 1WDDA 2KRRA 4RR5A 3SCJE 4KV8B 1VISA 1YRXA 4NLGA 1VBYA 3FBCA 4DV2J 3BR9A 4RW4B 2XULA 1PYSB 3CJKA 3I56S 4WP9A 3DN9A 1B70B 3QT7A 2MHNA 4DSLA 1XNRF 3V5RA 3MM9B 4C8NA 3DU5A 1FT8A 3KWMA 3TUIC 3CO0P 3FFIB 2C42A 3G71S 4H4KA 4TU8A 1FRJA 3FSIA 4IKAA 1FVQA 3M2UB 1MN9A 4WXOA 4KKOB 3OD2A 3TX8A 1K47A 4J7CA 2LQBA 2QL5B 3EPGA 4ZHRA 2V2VA 1ZPWX 1IJEB 2B4UA 2CNOB 3DM2B 2R8IA 8RUCA 3MR5A 1TZ0A 3HJFA 1VC0A 5GMEA 1RWXB 3TRGA 4C0OC 2RDJA 2OIHA 5K8PA 1VI7A 4RW7A 4ZPBA 3CF5Q 3TJ9A 2Z30B 1D9AA 5BYSA 2WTFA 3PM9A 1REVB 2FB0A 4J91A 4NLPA 4QR2A 2MEWA 2NLWA 3ADAC 2LDYA 3P5TL 1DTTB 4ED6A 4B3MJ 1F3VA 2XC9A 3O5TB 1MNEA 3I9ZA 2PMZD 1N33J 4QQBA 2KXHA 1HNWF 5GAEI 2ZH8A 1GEHA 4EI2A 1LWEA 3KUHA 3KMQA 5L1IA 4A8KA 1C0TB 2GVDA 1HIYA 3DDKA 1EHWA 1C1BA 2VODA 3BGUA 2XMWA 1U1LA 3DYAB 4OIXA 5CYQB 4ZOSA 1S1UB 5C25B 2ACMA 1NB7A 3WC2A 1JWWA 4CQ1A 4ZVSB 2NXUA 1N32F 5A8WB 1VHIA 2UVUA 4ERDA 4B3RJ 1MMDA 1W2BR 3CJSA 4ED7A 1FCAA 2BR0A 3QO9A 3H90A 2XYPB 4C7QA 2OEJA 3EJMA 3T41A 3DMJB 1VIXA 2GMJA 3NG8A 1U2CA 4JYAF 3D3CJ 1WDTA 3M1VB 4TQRA 2LQ9A 3Q8PB 2HGLA 3D5MA 2Q6CA 1XNQF 2F8HA 2HFNA 2FDNA 1KBRA 1FRXA 2QV6A 1R43A 1U2FA 3HT0A 3ZNUA 1ROFA 2GX8A 1VGYA 3DLEA 4B3OA 5CCLA 2E1PA 2XLIA 1TL1B 1EKRA 1HHQA 1NDPA 4C8OA 4NE9C 1TFYA 1Y7PA 2BE9B 3DLBA 1WJ9A 3OTOF 4OI1A 4J9RA 3VQSA 1RWKB 4E2FB 3MM7A 3UNYA 1U1KA 4DZDA 2I38A 4Y2IA 3KMSA 4PZVA 3H2LA 2X1FA 3OSPA 4CDIA 4WFYA 5M2PA 4XPEA 2K1RA 2YY3A 2OPRB 2GGPB 1R0AB 5HMYA 2LQ5A 3DOKB 3KK1B 4OJGA 1H98A 4RW4A 2H3EB 1RHUB 1RHJB 4KBIA 1U1QA 4PQUB 2NPIA 2VZ9A 2IRYA 2DH8A 3M9NB 3FK4A 3MM9A 3MR2A 5HQMA 3FFIA 3PG9A 3I4HX 4JI4F 2NYHA 3ZTRA 2XHWA 2JX2A 4I2PB 3C3LA 2J8SA 1BGXT 3M2UA 2R42A 3JAMY 2GA7A 4KKOA 4DHVA 2UUBJ 1YJTA 5D3GB 3UW1A 3JQJA 3KLFB 2HFZA 5B0BA 2KT2A 4DMZA 4ECRA 1C2PA 4CO1A 3DM2A 3G87A 1SL2A 4HDGA 5KFYA 2O67A 2V4JA 2CJAA 2XB2D 4ZVOB 2MKKA 1U8SA 5DGBA 2VPZB 3FQLA 4OLOA 2Y9HA 1SJ1A 1GX6A 3OTCA 2L9WA 1UJ6A 1DTTA 3HMJG 2UXCJ 2VQEF 1KN6A 2HNDA 2DEJA 3UVJA 2QL7B 4NYOA 2Y8WA 2HS0A 5KFLA 2V0NA 1VQ4S 5JVGQ 5DG9A 1U09A 3MFIA 2AGOA 2GFFA 3TVKA 3SI8A 4QIVA 4GKJJ 4IR1A 3NGTA 4NLUA 2D3O1 3NOCA 1C0TA 3DXSX 1KLNA 4YMEA 2B3TB 2VONA 3UCGA 4PWDB 3R3TA 4YB1P 5KFFA 3DYAA 3V6HA 2IVYA 4WU3A 5CYQA 4M5KA 4FNHA 1S1UA 1N48A 2VG6B 2JZ5A 3RAXA 5KFIA 1X8DA 2AP6A 4M5DB 3EGVA 4XTTA 4F3OA 1YZ6A 2HHWA 2WONB 2RAQA 5A8WA 3Q89A 4K4TA 1CC8A 1R8PA 1FD8A 2YWWA 4IH7A 1VBKA 2GNKA 4OYBA 1DZ5A 4M5GA 1FDDA 3M1VA 1S7IA 2ERRA 2XWYA 2IY5B 5GAHU 1U0SA 3VGTA 5LSOA 4UQTA 4U95A 3BPDA 2H5JB 2RRNA 4IH5A 3SDEB 2E7XA 4M5NA 2AU0A 1HNVB 4TY8B 1WKJA 5HMXA 2HFVA 2XG8A 4HI2A 4YEAA 1X31C 5DG7A 1EARA 3W1YC 1TL1A 4JI0J 1LFWA 3FMWA 5CA5A 2VFSA 4TN2A 2JFDA 1NSPA 4ZPVR 2QN6B 1BQNB 1N5YA 2V2ZA 3R6LB 2Q1LA 4X4UA 4J90A 2N4DA 4FF3A 3GR0A 2XS5A 3WDOA 1T3NA 4DR3F 1XMQJ 4EU0A 2AEFA 5T41A 2VA3A 2OPRA 2V5HG 3MAAB 4KC5A 1R0AA 4PXCA 3DOKA 3UN2A 3KK1A 3BREA 5CXTA 2MTLA 1XN9A 1OY9A 3NCQA 1N56A 4C0BA 3Q8UA 1JXVA 4ZVUB 3W9HA 1M5PC 4I2PA 4QOTA 3EE3A 3CD6S 5KFEA 1DFDA 3B8HA 4GO7X 4WYLA 5IQQA 1RWUA 5D3GA 3J81Y 1NDCA 1PSDA 3QGPA 3KLFA 4UQGA 2MDAA 5GAGI 3Q2SC 5FJ4A 3NS6A 4E98A 1QY7A 3MOJB 1RK8A 5LSRA 3KLVA 5KG6A 1S5ZA 1B0VA 4UUXA 2CQHA 2DTJA 3N5BA 2HIQA 4F4YA 4C8ZA 3SFUA 4DF4A 3BKFA 1RT3B 3U1LA 2OHDA 2DNPA 3NS7B 2HBZB 3IWNC 3MPVA 4HHUA 1ICEB 3GSDA 2H48B 2OUGA 4DX5A 3M8SA 2G4BA 3CCUS 3K17A 4I1TA 3H4BA 4MKAA 5KG7A 5ETMA 4DSJA 2ZZMA 3G4SS 1YX2A 1ZAVA 1KNZA 2LXFA 1HWKA 1FE0A 2V4RA 1JKHB 2MZJA 2KXNB 3D66A 2V8VA 2BE2A 4PWDA 2G1HA 2F4VF 7FD1A 3T6JA 2VG6A 3Q22A 4NWBA 5A8KA 4OX9J 1Q8BA 4M5DA 1QE1B 4ZLNA 3MZIA 3TOQA 1X9WA 4JV2A 1B7YB 2WONA 3CGIA 1PGZA 3OR2A 4DS4A 1GQEA 2RQMA 4G1QB 2GHVC 1F5CA 1SIWB 3RG6A 4ZCKA 1UWAA 4D3GA 3A13A 2HLUA 1JLGA 3WX8A 5FD1A 4ANDA 3C6UB 4X4SA 2XI3A 3DRSB 1K73T 4LSZB 3V6DB 2QTWA 5EN1A 1Y3KA 1X4GA 4OFZA 4B9UA 2CG8A 2AW0A 3SDEA 8AT1B 3PNIA 4CLTA 2CQ1A 1WOSA 3CCZA 4DL2A 5CQGA 2XGPA 3DRPB 4NLRA 2PMWA 1IM4A 2DNRA 1UEVA 4G65A 4AD6A 3PJWA 2PA8D 2NCKL 1BQNA 2DY9A 2V9KA 2BZ2A 4UOHA 1NHVA 3MAAA 2UP1A 2FHMA 2AJ0A 3CSKA 4LF5F 3K58A 3VAHA 1RTIB 2K7KA 1WWHA 2RILA 1UAWA 3QJPA 5F8LA 1MMLA 3M6UA 2E5JA 1HBNB 1SB6A 4CIOA 1FTCA 3HM9A 3KJQB 4CZCA 4F4AA 3GYGA 4UTGA 3VAFA 1SC1B 1WG5A 2JEIA 3SIPB 5I4MA 3G8QA 1I3OB 4EWTA 2DXDA 2V67A 1ZPVA 3N5FA 3ZZRA 3WIVA 1S9EA 4UT4A 4AT1B 4MK7A 2ZOGA 2BMBA 4YB7A 1WEXA 3CW2C 2MLXA 3TQ1A 1VQOS 4LBPA 3TAQA 2NREA 1LEOA 1RT3A 1RT4B 4OYZA 2WSCC 4LUBA 1JX4A 4KFBB 1VMBA 3T5KA 4KGKA 2OELA 1D3WA 1YTYA 4RW6B 1OQ3A 1EB0A 5E3PA 1IKWB 1SVDA 5C42B 1WKKA 2AYEA 1WC6A 2GVZB 4ZA1A 4V19J 3D54A 3M8QB 4RUHA 1IKYB 1JKHA 2K7JA 2D3OR 3FSXA 1HQEB 4K59A 3TI0A 4IG0B 2FHKA 4FKXA 2WB1D 4DEZA 3UR3C 1ZH5A 5KT7A 1F1BB 1JXEA 3BS9A 5HATA 2I5JA 1QE1A 4YY3F 3D0IE 2HQ3A 2YKMB 3ICLA 1FKOB 4Y6IA 1J5EJ 2BEFA 1ZYQA 3DOLB 4G1QA 4DZ6A 3FRZA 3QYYA 5IT9U 2PC6A 3FBEA 2B9EA 3B4MA 3G82A 3K7RA 3R7BB 1VYAA 2ZM6J 1FJEB 2UU9J 3DC2A 1S99A 3C6UA 3DRSA 3HZGA 5KAKA 3OVBA 1FWPA 1FJGF 3DU6A 2DNNA 3SBMA 2CQIA 5KFUA 3VAMA 3OXGA 4Y28C 5L1JA 4OZJA 1PKUA 2XQCA 3G2XA 4ECTA 1NKEA 5A8RB 3T1HJ 4JI5F 2KHDA 1KVKA 1NUEA 3K8VA 4ZJLA 1ZS6A 3THVA 3NGUA 4OQJA 3K5OA 4ZPWR 2PEBA 4A8OA 1IN0A 1VC5A 4WZMA 1XC9A 1MN7A 2EW9A 1FERA 1LWCA 3EUNA 4ZLLA 2OSRA 3CIZA 3FRYA 3D3BJ 2HVZA 5D0RA 4CM0A 2GO8A 3ULHA 2IIHA 4USIA 4YHHF 1H7WA 4DV1J 3CJRA 2PFDA 4LRDA 1NK5A 1NH8A 4ZPDA 1IBMF 2LDIA 6FD1A 9RUBA 1X4EA 2LYVA 2MY7A 4PRFA 5HO4A 5KFPA 1UCNA 2E7VA 5F0WA 4C8MA 4QWCA 2W4CA 3DLKB 5LL6d 4B3TJ 4ZCLA 2V2KA 3L7OA 4R5PA 1P1TA 3PR4A 2RT3A 5L39A 3W5ZA 4B9SA 2BYCA 1ZM4A 4PXDA 3GP9A 1O0PA 4ANEA 2ZUAA 3L7UA 1S0VA 3BZQA 2CDRB 3MPYA 3KJNB 2C2KB 3LGNA 5KOXA 4B9VA 1Q8LA 2C2OB 2B4OA 3MMCA 1RJJA 2BBEA 3IAM9 5I42B 3IMQJ 1RT4A 4IQMA 4C11B 3N79A 1KQSR 4X4OA 2DNKA 4DR6F 3NOGA 4MK8A 1RB0A 1YHQS 3MGJA 2A18A 1XK8A 4OLPA 1KHWA 1IKWA 1N36F 1UJ5A 3VQTA 4FF2A 5DQIA 5C42A 2R7SA 4FS2A 2J0WA 4IO9Q 3AD8C 2FVPA 4QIEA 3M8QA 1IKYA 1WF2A 2VFTA 3VR1A 2VPXB 2LU1A 4F2SA 2FTRA 4NCGB 2RSQA 5H9EK 1M5KC 2WOMB 4N41A 2H65B 4F50A 3H5XA 4ZVEA 4H54A 4IOCQ 3AJDA 1VRTB 1XNRJ 1YVFA 3P5BP 2EVZA 1NPPA 2YKMA 3EVOA 1FKOA 4X4NA 1I1GA 2UUCF 3TARA 1Q5YA 3DOLA 1KONA 1BWVA 4DPWA 5EX3A 3CE8A 3HSDA 2A3JA 4KO0B 5HROB 3TZWA 2K3IA 2B9XA 2H9ZA 3JSMB 4IRKA 4O4GB 2BW7A 3BO4A 1XIQA 2XZTB 2NSCA 2OSQA 1DTQA 1N8RT 3E01B 4WTOB 8ATCB 2VUGA 5A8RA 4L75A 4DR2F 2B43A 3Q8VA 2JFKA 2K8GA 1P1LA 4NZ0A 2W9CB 1U7LA 5HQLA 5K9FA 2FHJA 3FQKA 4RPFA 4USHA 3TVYA 4M1KA 3GTYX 2ADBA 2ZOMA 4B9MA 2ALYB 4IG3A 5EX0A 4CTAA 1CJUB 3MM5B 2B56A 3UNGC 3RBEA 2ROGA 5C5JA 3ZTQA 4CO5A 1HNWJ 1RACB 5D8HB 1FKAF 2LP4A 3JTPA 2EFQA 3OFGA 3EGZA 1FDBA 3WC0A 1PJ6A 4DR1J 2YVSA 4NMXA 1HI8A 1B3TA 3ET6B 2VG5B 2DGVA 3I4PA 3M8WA 3NLCA 1FESA 4ZVHA 1PYOB 3BKUA 3EVMA 2MB0B 1NB2A 3WZ0A 4DL0C 2RQCA 2M0GB 1N32J 5K14B 3IWXA 4UF4A 3E51A 1HBUB 1WC5A 1FD2A 2IJRA 1DLOB 3ITHA 1VDHA 4C8KA 2JEGA 2G1DA 2EFNA 3AY0A 2J8AA 2OD6A 4DR4J 2HIYA 2JH3A 3MMAA 4RU2A 3X1LB 1S4FA 3QGGA 2DCLA 2FY1A 2HHHJ 1CLFA 1U1OA 1V3RA 3D0GE 3L95X 1RWMB 1XR5A 2Z2LA 4CYUB 2OAUA 1RWVB 1RTHA 2ABYA 3QFWA 1D1UA 1H74A 2EI5A 4OZ5A 4ZK7M 3NNCA 4IOAQ 3DRRA 5I42A 2ZBPA 1R31A 3DCAA 4C11A 3U27A 3FDSA 2BUNA 4WBFA 2HVIA 2D41A 5GADU 1SH0A 3LH2S 4E0DA 2DGWA 1FKPA 3HK2A 3I82A 1RHMB 2DR7A 2HG4A 3GCXP 5F0UA 3W66A 1OO0B 3POTA 3H5SA 2OO4A 3PY8A 2MGZB 3PYEA 1RAFB 2Y1RI 2KT3A 5IXUA 5IM0B 3H98A 3FEYB 4NYPA 5HJYA 4TYAA 4KAIA 3CCES 2F7VA 3ILIA 3OBIA 3T1YF 3TW0A 2VC1A 4C3LA 2WOMA 3KLIB 4L3NA 3PIOQ 3AOBA 3W8GA 2YNIB 1VRTA 1F5BA 4ZVQB 2HGNA 1KDNA 2F9JA 4X4TA 2C3MA 3W61A 4N7TA 2LU2A 1RUSA 1S6PB 3QLHA 5KG2A 2B4PA 4KO0A 5HROA 2XEXA 2AYMA 1IQZA 1JXLA 4X4VA 3JSMA 2RH3A 2KZMA 3ENAA 4QWEA 3MM6B 1HYSB 4O4GA 3HVTB 4XK8C 2QLFB 5F3TA 4FBTA 4Q8EA 2MZQA 3G9CA 1M1GA 4C6AA 5I3UB 4QYZJ 4GVBB 3Q8YA 3TZZA 1VC6A 1SH2A 2OTLS 2RB7A 4O23A 3ZO7A 2R8HA 3S1TA 1TVRB 3BDEA 2DIUA 2BM1A 3QRRA 1NKBA 2BRKA 1Q8KA 1V5VA 4J9PA 2ZNZA 5IWAJ 4YR0A 1IBLF 3BGRB 4HI1A 3AHPA 1RAEB 1U2RA 3ILLA 4LF7J 3F44A 3RU0A 5DS7A 1BC6A 1QUPA 1FWKA 2FZGB 3BR8A 2QIFA 3GFHA 1RP5A 2M3DA 3J7YU 4B9LA 2Y1JA 4FYDA 3H4DA 1YRTA 1CJVA 1LW0A 2WHOA 4KHPF 3AFGA 2VG5A 2F63A 2AEJA 3O8WA 3MCMA 2HHVA 4JI8F 3BO2A 4OI6A 2E7WA 4GMKA 3UQSA 4OZ2A 2O5DA 4JBCA 1TKTA 3CJ3A 4ECWA 1VQSA 1RWWB 4O0NA 3R2CJ 1HBUA 5EUHA 1RT5A 2GJ2A 4DUZJ 3W5XA 1GFWB 4RBTA 1C4CA 3MPUB 1WORA 1JLFB 3M8PB 1HBMB 4WFNQ 1QAXA 4CYUA 5F3ZA 2JLEA 1YKWA 3BQ2A 1WEZA 2YXLA 3LP0B 5J2PB 4ED0A 3ZXWA 4NA2A 4NLTA 3TO8A 4YP3A 1H72C 5AXMA 4P2FA 4NLSA 2XO7A 3PTWA 4CLYA 4CM2A 1BMQB 1BQXA 3IR5B 2DR9A 2MGZA 1RT1B 4NLVA 3J7YI 1JIHA 3H40A 1TKDA 3ISNC 3BSCA 1PG5B 3A8IA 3UD4P 3PRVA 1HD0A 4XIUA 2W9BA 1WNEA 1UVNA 1JMTA 2B7CB 3IO1A 2HQIA 4ZN3A 3AA9A 1T7PA 2QE5A 5F8GA 4RNFA 3KLIA 2RHSB 4PYDA 3RYLA 1X9MA 1T05A 3BDPA 2R2UA 2AGQA 2HNYB 2YNIA 2DNGA 1TR0A 3T19A 2OMOA 5E7OB 3NGKA 3NGSA 1KHVA 2CYYA 3T5HA 2HKEA 3EXCX 3CCQS 2ATLA 3EXYA 2R4FA 3RBZA 3CCWA 4YN3B 2VC0A 2E1RA 2SXLA 5GMKa 2DGUA 2VJVA 3ZZZA 3DFEA 2KT5A 2CQBA 1HYSA 3HVTA 2C3UA 3EX7B 3IGNA 2W01A 3MCNA 4X64J 3UPFA 1VQPS 4GVBA 1SJQA 1U1MA 1NK6A 2EG1A 2UVRA 3QATA 4N5SA 3B6BA 3SMZA 4Q0BB 3M9MB 4X62J 3OL9A 4F04B 4OHZA 1OJ4A 4AXJA 4J9NA 2BJDA 5ITHA 4DG1A 3BGRA 4FYYB 4PWWA 3DLGA 4F3MA 1HL6A 3D7SB 4CP5A 1ACMB 2H51B 2UXDJ 2XMTA 3VAJA 5RUBA 3N6MA 4P10A 2W2MP 1L3TA 3EDRB 1VCTA 3K57A 1VQLS 4QIWD 3G86A 5MLCV 3NWRA 2F4VJ 2DR6A 3Q8QB 3ZZOA 5DDOC 2FJXA 3A12A 1SKUB 1SC3B 2R7UA 1R8BA 4RJVA 4F4KA 4ELVA 4URSA 1KTVA 3I0RB 1ZTWA 3RW6A 3E2EA 3OJUA 3GV7B 4K4XA 2EK1A 5DDRC 4NCAA 2YKAA 4PYAA 1GMWD 5U47A 2Q3PA 3M4XA 4QCLA 5A76A 5KFBA 1S6QA 2DH7A 2N4CA 3PHEA 4DV5F 4WF9Q 1JLFA 4FN5A 1WTBA 3LOUA 3M8PA 3PACA 2HMIB 2O3DA 1Q82T 4YDDB 3DLHA 3HKWA 5E2QA 3BM7A 3PW2A 3NBPA 4J9VA 1FFWB 2IAJB 4DX6A 3LP0A 1WELA 2QA4G 4P2XA 3H8YA 1I6JA 3I9V9 2VBWA 3R9LA 3K5LA 1RHQB 1YIJS 2XCPA 3FVYA 1WOOA 4F26A 4IDKB 2WSEC 4F2RA 3FKBA 4WFBQ 1UVMA 1S1WA 3LTOA 4DLEA 1RT1A 2DHSA 4CH1A 1N5SA 3KHRA 1QUVA 3ZFVA 4PQAA 1W2IA 4DV6J 2APOA 4USWA 1I94F 2B7BB 1L3UA 2HNYA 4QU6A 4A8MP 5KFWA 3JYTB 2KJVA 4ZN1A 1LNQA 1SIZA 5KFQA 1JK9B 1RT6B 3SFGA 3CMES 2ASJA 2FVQA 5JJBA 4HT7A 4WKRA 3VAIA 3VHQA 4X65F 1C1CB 1N54B 2YH1A 5LMNF 1PCAA 5HJXA 1EJ7L 1IKVB 4MIWA 1Y11A 4L72B 2W2QP 5IT9Y 4QYRA 2R2SA 2AGPA 4A8QA 3AH6A 2F4FA 1SH3A 2OFHX 3QT8A 4P72A 3KG1A 2OPSB 3R5DA 2VV5A 4EZ9A 3PO4A 4DV0F 1PC4A 5ETOA 3RB6A 1M5VC 3RAMA 2DHAA 1EP4A 4Z7YA 4LF4J 2E9TA 1RGVA 2KFYA 1K9MT 2E1AA 3Q0AA 5J2QB 2LQ8A 2RD5C 1UVJA 2JHEA 1JLBA 2KVIA 3PW4A 3PW7A 1U25A 1KD1T 4ID5B 2B5JB 4XO0A 1TKXB 4FYWB 1D9FA 1WC0A 3S8SA 3P4UB 4Q43A 4YDXA 4Y00A 4RBUA 2V2QA 5KFNA 4DLGA 4O3NA 2BOAA 2L9DA 5KT6A 1VQ5S 1KWMA 5DDQC 2E29A 5E0OA 2CVEA 2IYIA 3SSRA 4EYIB 5IFMA 1VQKS 3I0RA 3EMTA 2NXJA 5J2MB 3V4IA 1X4BA 4LF9J 2R2RA 5ETQA 3QT6A 1FXRA 1RA7A 2R2TA 5IC6B 4DR7F 5B08A 4NLYA 2HYIB 1FA0A 3FBFA 2JVRA 3D6FB 3EZUA 1VK3A 3CT9A 3W2VB 1IBKF 2G13A 4MIAA 4DPUA 4QZVB 2XI2A 2MY8A 2VBYA 5KFJA 3T9NA 4NMLA 4ANCA 4CO2A 4IRDA 2HQGA 2Y1LB 1NK8A 1K0VA 2IAJA 5KG5A 2QL9B 5F8JA 1FX4A 4UOFA 3SYZA 3NXZA 3TJ8A 1AB8A 3UCZP 4NXMF 4J9SA 2VFVA 4IDKA 1XERA 3VZIA 3Q24A 2CVIA 4OHWA 1T8EA 3MCSA 1RAOA 2DIVA 3QJLA 2C2RA 1Q79A 3MHYA 4USKA 2XYHB 1U24A 3G6VA 3O1LA 3QPIA 4B3SF 4DPYA 3CCTA 1NO8A 3OLBA 4LSLB 1VRQC 1YWXA 2RS2A 4M5HA 4YHHJ 4L73A 3ZTOA 2ASDA 3ILJA 3HHKA 1SCJB 5HI7A 4Q2MA 2KFZA 3AODA 3GZ7A 3RTVA 3LO3A 3HFKA 4DR5J 3JYTA 1B0PA 5T7LB 2ZITA 2J76E 4KHMA 3UI3A 2XLKA 2CJQA 1KRPA 1NJWA 3P3DA 1N0VC 1T0TV 4DQSA 3OL7A 4JI2J 4OX6A 4RUAA 4DV3F 2C2DA 1U1NA 1MWQA 1DHMA 4G6VB 5C24A 7AT1B 2BKPA 2CZ4A 2YBVA 1X4DA 3OTDA 2G9OA 2FPHX 1E6YB 2RQKA 3T9ZA 3C16B 3VZHA 3MM8B 2ZH9A 2OPSA 4UUWA 2W24A 3MEEB 5IC4B 3FEXB 3MD3A 4IR9A 2H1YA 2CJBA 1WC1A 2XSFA 5F8MA 1CULB 4DR6J 1VLYA 2MKHA 1MROA 1X5OA 3TAMB 2D3ZA 2ZWPA 3Q8SB 5EHHA 4LFCJ 5J2QA 4HH1A 4ICLA 4ITSA 2PI4A 1FXDA 2VJUA 3BJYA 1YJWS 3HKZD 5IT4A 1KQKA 2BJ9A 4ID5A 1WF1A 1K0TA 1TKXA 1OYDA 3KJVA 2D69A 1Q81T 2ZZNA 1G1XA 1VJQA 4CT8A 2I8EA 4LF6F 2JWNA 4U67Q 3W2WA 3LAMA 2IYGA 5DDPC 4DQQA 2UUCJ 3A4TA 5J2MA 2IA0A 2H5EA 1HMVA 1GTHA 1S97A 3G96A 1FF2A 2XMJA 3KK3A 3GMGA 3GJTB 1FE4A 3W2VA 1N4LA 4YOEA 1PJ5A 2AEMA 1N6QA 5E33A 3D1QA 2KL8A 4JI6J 3NCPA 2HZVA 3OTEA 3V2UC 1VBZA 5KG3A 3FNNA 3MEGB 5CHCB 3EYZA 2QMXA 1FWLA 4DV7F 2WVCA 4DR2J 5LT5A 2CNLB 2MXYA 3THPA 2HBQB 3I0SB 3QIPB 3ZNJ1 5LMUJ 1BLUA 3NL0A 3PR5B 1LWFB 3ZZ0A 4DDFA 2X7IA 3IG1B 5HL7Q 1SL1A 4DV2F 2ZHBA 3PEHA 1R7IA 4XDDA 2HFSA 5KFXA 2CIMA 1XMOJ 3A3OB 3L09A 4JI3F 2OFGX 2QSWA 3GJQB 5D0EA 3CDBA 3ENVA 5K5MA 2RU9A 1CVJA 4I6AA 5H1SV 1OMSA 1U26A 1D9DA 1Q5VA 2NR0A 2DNQA 4A8XA 4OI0A 4XPCA 4N8OA 3OL6A 3PYFA 2ZE2B 4Y65A 4CCHA 4HH0A 5T7LA 4URGA 2IC3B 4F8RA 2ZBQA 5AXLA 3FCWA 3WX4A 2MQPA 5AXKA 5KG4A 3TQEA 3QNWB 2ILYA 4DS5A 3Q23A 2GAGC 3Q86A 3D67A 1JJ2R 5L1KA 2GHWA 3RRKA 1E6YA 4B3MF 4LF2A 5A0YB 4USJC 3CD7A 1DQ8A 2DGTA 5EWGA 3KJFB 2CFXA 3HI9A 4PG7A 1CULA 4J5OA 3TAMA 3GG0A 4Q7AA 2JNJA 2KB2A 4RNNA 4OYMA 4I67A 1PYTA 3MM7B 4ZDNA 3ZTPA 4QIGA 4CLZA 3SV4A 2K1RB 2XLJA 1YG0A 2VDIA 3C8YA 3AOCA 3LUYA 4P2SA 4QW8A 4A8YA 1HA1A 2AX0A 2XO6A 3T1YJ 3GWCA 1IQTA 2J6SA 4EO8A 2XTJP 1DQAA 1VQ7S 2ZH7A 5KTQA 5HVGA 2R8JA 2B6AB 2E5HA 5BR8J 5SUHA 2BDPA 2OPPB 3N6LA 4LIRA 2FZKB 2FC8A 2MKIA 4ZCIA 3W5YA 2BV3A 3TJAA 1KS2A 4BHQA 4P75A 2DNHA 2V63A 4EGLA 2RJZA 2OLWA 4I4BA 3A3PB 1CEZA 3A8JA 4OHXA 1M5SA 2MKCA 2OD4A 4RW9B 1RQ0A 1RBLA 1W7WA 3AB2B 3PO5A 1TUGB 2V4JB 2N3OA 3N4WA 2NYIA 4DI6A 2LCWA 2GMLA 2ZDOA 1E6VB 3MEGA 1GXLA 3KLGB 1Q78A 1Y5NB 1VR6A 3CCMS 1UVKA 3H2UB 4AQYJ 4NRUA 2HNDB 4LVOP 5HN0A 3UVJB 3I0SA 3QIPA 4ED8A 4UY85 2DJWA 5HSPA 4NEZA 1LWFA 4BC7A 5HAOA 1IR1A 3IG1A 1X60A 5B0GA 3GB0A 1UETA 1WC3A 4ILRA 1AA1B 4WIIA 3L9ZA 1FFGB 5B09A 3WBZA 3IAS9 1GK8A 4MT1A 3G8TA 2KTQA 3H42A 1XBWA 4FVMA 4KT0C 2EFVA 2C2EA 4HVZA 2MQQA 4JI7F 2AF6A 1F9EB 4FF1A 3S01A 2EFOA 3HHLA 2XS7A 4JI8J 2W4PA 2CAJA 3K5PA 1YJ9S 1T03B 4F0KA 2KYZA 2ZE2A 2J7KA 1ZM3A 1JNZB 2IC3A 4N56A 2QA2A 2KHCA 4ECQA 1SQEA 2V8PA 1UVIA 3BEGB 2HWTA 1S9GB 4XAKA 3KLEB 2BOPA 5LSLA 2JEFA 4LJMA 4PXEA 1PBUA 1VQ9S 2BACA 4RZRA 4MYUA 3IA0A 1QAYA 2GV1A 1Q4RA 4QW9A 3GG1A 2DEIA 3BSOA 3ONQA 2DD8S 3RR7A 1U6ZA 2UXCF 3GIRA 5A0YA 1GT8A 4R0JA 2V50A 1T9VA 2VPWB 1RTJB 3W62A 4OV6A 5HVHA 1NM2A 1WSRA 1WOPA 4GKJF 4BWMA 3PW5A 2DNOA 1S1VB 3N01A 1N5YB 4I64A 2IMOA 1FRHA 4ZJOA 2GC8A 2RIJA 2HVHA 1QLNA 1YJUA 3AD9C 2G2YA 3I32A 1BUXA 5IQ6A 1QD1A 4TYBA 4KYZA 3GIKA 4WFAQ 1XWLA 5L38A 1RU1A 2MKJA 1VJWA 2YX1A 2B6AA 2Z8QA 1MMNA 2OPPA 2CPYA 5LOQA 2HEKA 1F2HA 3PFOA 2M8DB 2WB4A 4QWBA 1VOMA 5B0DA 5LXRA 3GJRB 1RE1B 2ATCB 5EWEA 3QGIA 2FLNA 2HVEA 4RW9A 4YUDA 3P96A 4LRFA 4DJBA 3CUNA 2YWFA 4JI0F 3MUVP 4NYZA 2ZH5A 3QRPA 5AXNA 3IFEA 4DOZA 1Y5IB 3HHLD 2CWXA 2VOPA 1E6VA 3UFCX 1WSVA 3KLGA 2CQCA 3D1HA 3NKYA 2CNNB 4ECYA 3CD5A 1Q16B 2HSEB 2I6WA 3KOAA 1XMQF 3KHHA 2BE7D 2RE1A 3C19A 2LXIA 1U1RA 1Q95G 2DNYA 3MAHA 3MMJA 3J80Y 2F3JA 3NNAA 1KOOA 4OZ3A 3H5YA 1Q53A 1R0CB 5KFGA 4NXNJ 1QAIA 4DWIA 1YITS 4X66F 2JSXA 3BBFA 3SCLE 2BE2B 3KDOA 3HD1A 1NHUA 2RDIA 2ZFHA 4RKUC 2XNRA 3O2IA 4WFXA 3S6EA 5A8KB 2DO4A 2RUSA 2DT9A 4RNOA 2RDDA 3N9UC 3QT5A 4DV4F 3OR2B 1T03A 4C8LA 2NQPA 4WU2A 2UUAJ 4MAKA 2YQ0A 2A6OA 1T02A 2BJ1A 3C15B 2YNHB 1LKZA 3HPOA 1YRUA 1JLGB 1S9GA 4I0WA 3KLEA 3PKYA 1AFJA 3W63A 1T9TA 2ZH2A 5KFSA 2X3DA 3PW0A 1DBDA 1WHXA 2J9DA 4TY9A 2QRRA 5JUMA 2JOQA 3O6QA 3T6BA 5C2GA 2BVZA 3IRWP 1SJRA 1W25A 2U1AA 2LQJA 3BYPA 4Q8FA 1S49A 1RTJA 1YI2S 1ZOTA 4KTQA 2GW8A 1QSSA 4RWWA 2CPHA 2B8PA 2GAHC 5D15A 1S1VA 3QZ8A 3QRQA 1FNOA 4DFPA 1L3SA 2Y0SD 3KFWX 1NPKA 4NX9A 5AJ3J 1TMJA 4CRJA 4OZNA 4LFBF 5J1EA 3M2RB 3PRBA 1GH8A 1S72S 2W25A 4AFFA 1D8ZA 2FQQB 4OX9F 3A1YG 3SQOP 1MW7A 3KG0A 1URRA 3I31A 3JXOA 4MFBA 3MMBB 1YJVA 2DVIA 1DRZA 4B9NA 4DSKA 2IJNA 4DUYJ 4PG5A 1WI6A 1X5SA 4CWBA 3TYTA 1OIAA 4DSIA 4MKVA 4USUA 1HBOB 1N34J 2CADA 4ETZA 4U7UK 4MIBA 2AYBA 1M1HA 2L48A 1H3DA 3RAQA 1S7HA 1KEKA 2YKOA 5GAHI 2WVFA 1NSQA 1S9EB 2MZRA 1APSA 4Q45A 4L6V3 2PGCA 3MAQA 3NEKA 2CPJA 1T3OA 5DZ6A 5LMNJ 4DL3A 2K06A 2IM1A 2ZH1A 1FXLA 2L3MA 2CPIA 2N7YA 5BXIA 2MPUA 2C1EB 2QJ3A 2ZJRQ 3A8EA 2W4DA 1M5OC 4DV0J 9ATCB 3C66A 4I69A 3M30B 3M6XA 2M8HA 1I51B 3MEDB 2EXUA 2BRLA 1P6TA 4K2XA 4X4QA 4LFAJ 2Z58B 3TUZC 4ELTA 2MJNA 4OZ0A 4CO4A 1V5IB 5SZTA 3OVAA 1NCLA 3OW2R 2QYGA 5E3RA 4K2JA 1CPZA 4PPDA 4ZCMA 4WYWA 4LR7A 4FYXB 2WCXA 2JVOA 1HHTP 1MLAA 1IKXB 1ZA2B 1RABB 1TL7B 2BKNA 2VG7A 2QA4S 4ZVRB 3P45B 2MLZA 2DPIA 1RHRB 3SSQA 2I5JB 4TLQA 4UZBA 4L3KA 3BYRA 2ZJPQ 3AQPA 1VK8A 4ES1A 2CRLA 3CMAS 3DRXA 2UUWA 4K4YA 4U6PA 1BY9A 3GIMA 2FLPA 4B08A 2OPQB 1F2GA 2P6SA 3C15A 2YNHA 2PEHA 2C3OA 2BX6A 3G82B 2CPDA 2ZC3A 3BSAA 3DXBA 3CDEA 4OZ1A 2HK3A 1VHFA 2CUYA 3B82A 2W7AA 1WEYA 3F41A 1IBKJ 4HR2A 1RSCA 2GIFA 3DGVA 3I87A 5CYMB 2CPXA 4HYKA 5KOWA 4WK3A 5L8RC 3L3CA 2Z2YB 1V3SA 4CNZA 1RWPB 1FJCA 2E5LF 1RZMA 1WACA 5L9NA 5M2RA 2VIHA 2FLLA 4WWSA 5CD4A 4NXMJ 1YLXA 4UOGA 4ZS6A 3I5AA 4DL5A 2V34A 4J9KA 2DHXA 4QJVA 1AUSL 1MG7A 2KFNA 4P2MA 4PXBA 2MSSA 2H5IB 4WCEQ 2AJFE 3QFHA 3M2RA 3NAIA 2AD9A 1NK0A 2A0FB 1A0OB 1LWCB 1FHTA 4F25A 4DQPA 1U6FA 2QYCA 4B3SJ 2AWZA 2M70A 4NZ6A 1J5EF 4DN9A 2DRDA 3MMBA 4C0HA 2VB6A 3C14B 3KUGA 3NAHA 1GNKA 2DO0A 2VKZG 2M7SA 2XZWA 3BGOP 4CLUA 1EQ0A 2WVDA 1L3KA 4CLSA 2AX1A 2UU9F 3RGIA 2BANB 4UOCA 1KR4A 1HBOA 2KYXA 1UA1A 3GE9A 3OT9A 4FXWA 4R5PB 4PABA 2F9DA 2HHSA 1LW2A 2VFRA 3HF5A 3VV2B 3R5BA 2HZAA 1N5QA 3BF4A 1J5OB 1OPIA 5DM6Q 2IMWP 4AUKA 1WHVA 2CJXB 3GFZA 3ISND 2KI2A 3T1HF 2KM8B 3TA0A 2ZNYA 3R5CA 2HRYA 3ZTSA 3K89A 1X0FA 3MMCB 1QSYA 4IQXA 2DNLA 3MF5A 1TAUA 2CPEA 2DRAA 1KQGB 4NOHA 3P49B 3FC9A 3B4DA 5ETNA 4WPAA 1RTDA 1HR0J 4JP8A 4M63A 1P9QC 3FBBA 3OTBA 4PG6A 3AA8A 3M30A 2HHUA 3MEDA 3ZC4A 4HHHA 2KDOA 3TUJC 5KFCA 2FD2A 1Y00A 3T5LA 2POKA 4ZPAA 4DV1F 2NUHA 3TWZA 4LIWA 3JTNA 2COLA 2Z56B 2RRAA 2AZ3A 3GPAA 1YJRA 3GR1A 2BA9A 3IM8A 1XMBA 4K0KJ 2FJAB 3X3UA 4ES3A 3HFVA 1IKXA 3R27A 2Y1IA 1TL7A 5C7PA 2AHOB 1MWYA 4QWAA 1AT1B 2FLOA 3AT1B 3GYNA 3WQPA 4I7FB 2RS8A 4YR2A 1CBKA 4DF8A 4LF8J 2Y8YA 5FDLB 2D9OA 2OPQA 2FJWA 1VRUB 4ENOA 1N5VA 2MSTA 3E8OA 5CAAA 2OMLA 5F9NA 5CYMA 1WF0A 1ZBTA 3LP1A 1DTQB 1UW9A 1SQFA 2AZ1A 2OEKA 2F65A 4ZIVA 1R3NA 3E3XA 2X3GA 4YB6A 2ZHOA 3LGHA 3UCUP 3D1OA 4LF1A 4WJBA 4GC7A 1OPZA 4PG8A 3MR6A 2ZDPA 1IXKA 5CZVA 3QMQA 1S0OA 3UDLA 1UP1A 4LRBA 4ZITA 3OUYB 5KFZA 4IG3B 4A8SA 1NDKA 1G3OA 4CTAB 4TLRA 2BQ3A 4A47A 2HRUA 5GAEU 4M5MA 2DR5A 3IR7B 5FLXU 1UJ4A 1GTEA 4EEYA 3CO9A 3GLJA 3HXMA 2RF2B 4WFZA 1VQMS 3I55S 4JI3J 5DM7Q 1FO1A 1KLMA 1FTRA 2W8LA 3HD2A 3W60A 1GAOA 2B9YA 3CC2S 2HQFA 3BB5A 2X51A 4LRAA 2C3YA 4ZKAA 2KU7A 3C14A 5F8HA 1BQMB 4RL1A 2I2YA 1R0BG 4W90B 4O3QA 4HT5A 4ALZA 2G0CA 4UZCA 5F8IA 3UR0A 1WG4A 1UVLA 3OPKA 2QLXA 1HARA 2BANA 3NNHA 3C6TB 5E41A 2AJQA 3ZZUA 3ITHB 2R7TA 4O3SA 1Y0HA 5BYQA 3MEKA 1QSLA 1RKIA 3UD3P 3MMAB 1J5OA 3MECB 3J7Z5 1H73A 2V8GA 1X5TA 3RJMB 3NY0A 1MWZA 3NCRA 5B0FA 1SV5B 1T11A 4WE1A 4WTYA 1TV6A 1RTHB 3AQOA 2VA2A 1CSJA 4N47A 3DRRB 3UDEA 3QSIA 3M7VA 1OY8A 1RT7B 4G3IA 2IM2A 1FRMA 1H0HB 1FDNA 1D8YA 1S6OA 1FKPB 1CJTA 3JQKA 1Z1ZA 4EFAC 1RCOB 4ZP9A 3POTB 2FHOB 4X4PA 4JUZA 3RBDA 3IRXB 5KFMA 4DR1F 2GQQA 2PN6A 5CH7B 3NMRA 3RUBL 1ZA1B 3M6VA 2C3PA 1RAIB 3Q2TC 4A48A 3TANA 4DXLA 4CLLA 5HP1B 2VQFJ 4RUCA 2QGFB 2V69A 3IS9B 5ETKA 2DGSA 3HHLC 4KGMA 4Y34A 4JV0A 4OMFG 4Y2MA 1U8WA 3M32B 2IPOB 3GYXB 4DQRA 2YKNB 1RKJA 1FVSA 2CQ2A 3MR3A 1WG1A 1RYSA 1DURA 2HAIA 4NA1A 1L3VA 1BHNA 4P73A 4PUOB 2C28A 3F56A 1RI7A 4DR4F 1D0EA 2GO9A 3QLHB 3P6YC 4I7FA 4KR0B 5HANA 2VL1A 2HHXA 2HHHF 5FDLA 4I6WA 2FJVA 2ZKUA 3OVSA 3VVUA 2HURA 1VRUA 4QIFA 2M9KA 2FVRA 4ELUA 4Y0FA 4N76A 1PILA 3GFYA 2G2ZA 1B0TA 1RAGB 4CT9A 2DRBA 1N52B 3DLLQ 3RR8A 5HLFB 5I3PA 2YKQA 1M1KT 1NU4A 1LXNA 3CMQA 4TVAB 1X4FA 3FGVA 2CDQA 1F0XA 3V81A 4K8RA 2N3LA 3NWGA 1SJFA 4P71A 3DKDA 4QWDA 3OUYA 4M5IA 2DR8A 5EWFA 4ZLJA 4NRTA 4OYWA 5DG8A 5H9FK 4ZIWA 2E5IA 1HNZF 4KV8A 4GKKF 1SJ3P 3HULA 5MAOA 1NSKL 2DHGA 3RRHA 2FJDB 2RF2A 3CXCR 3CD0A 3HHEA 1WI8A 5JVHQ 2HFOA 4V1Ak 5CZXA 4TXSA 5KFOA 2EKNA 1CJVB 4C9DA 1LW0B 2NPFA 1NPRA 1BQMA 3G6XA 4JI7J 2HHPA 4Y2CA 4M5JA 5H9EJ 1NEEA 1OSDA 2M2BA 1TKTB 4OI3A 1HWIA 2XNQA 2L9NA 3PX0A 4FVCA 3C6TA 1NSAA 3HSGA 1RT5B 2QSFA 1NJYA 1FJ7A 3THTA 2QFJA 4FPRA 3PJXA 1NNDA 2H54B 1W26A 1OS5A 2HW3A 3T3FA 4JYAJ 3MECA 1JQGA 5CABA 1REVA 4NASA 3HT3A 1SV5A 3U02A 1RA6A 2E66A 3CDAA 3ISZA 2JLGA 1XNQJ 1YK9A 5B0AA 2GQ2A 3BSNA 2J5AA 1NXIA 5IWAF 1P9YA 4NCBA 3OJSA 1RT7A 3BBCA 1R27B 1NBEB 4KQZA 4LMZA 4K4SA 2CZVC 4LF7F 2IBOA 3QGHA 1S79A 4MJKA 2QO3A 1D09B 3CCSS 4P6QA 4RUBA 3IRXA 3OTOJ 4ER8A 1OYEA 1RLDA 5D0GA 4DFJA 4AL5A 5HP1A 3QQCD 3R97A 3KYLA 1NZAA 2K3KA 3RB3A 2W9BB 4F02A 5H9FJ 1ZM2A 5C25A 1T9XA 3OXFA 2AQ4A 3EGNA 1T9UA 3IS9A 3RB4A 4MKBA 2RUGA 2ZH4A 5A6PA 3M32A 2YKNA 1T05B 1JJHA 1XTZA 2ZWOA 4J9LA 4DUZF 1U02A 1FRLA 3HDSA 4PUOA 4ZLPA 4JI4J 4DL6A 3HVRA 2XMVA 4EMDA 3D0HE 3DMJA 3HCXA 1S57A 5ETPA 2A1BA 4ECZA 3CJTA 2LFVA 3AD7C 5CYJA 2DXFA 3A3NB 1KVIA 3QBCA 1B64A 1GMVA 3D68A 1TTHB 5GAGU 3M8RA 2QLWA 4CO3A 2ZKTA 4K7QA 4USVA 2VPYB 1V6HA 3OFHA 2L41A 4FXDA 3N28A 1VQ8S 1LQ9A 4IFVB 3BPSP 5GADI 3VVTA 1PIEA 2GCFA 1SBRA 4O4RA 5HLFA 3KUEA 5J1PA 2H4YB 4OYOA 2QLBB 2WZ1A 1TAQA 1QTMA 1U1PA 5IT0A 2VQEJ 3GIJA 3BN7A 2VFUA 1NDLA 3UE2A 1YBTA 1RDRA 2M5YA 4DG1B 1X7VA 3DLGB 2HQDA 2GGPA 4ZPCA 4C97A 5DLFA 3D6HB 1TKZB 4B17A 3VTIA 1V3ZA 4CO0A 1CQMA 1VQNS 3TA2A 3HSZA 4PQUA 5JXSA 3LALA 4KHRA 2XS2A 3CIMA 4N8NA 4X66J 2BKOA 4TU9A 3TA1A 3GONA 1HWUA 2LEAA 4EO6A 2DBBA 1FDAA 2E9ZA 3CC7S 3BV8A 5KFTA 2CJKA 2J9CA 1S1TB 3MFHA 4DV4J 4BS2A 4FDFA 2R7QA 1B4SA 5ETSA 3B78A 1B99A 2F8EX 2JC1A 4X64F 2PDAA 1HLWA 1UFWA 4MKYA 1S6QB 4TU7A 5D77A 2HHQA 4OI2A 1IWAA 2LVWA 3HX9A 4IH6A 3DNCA 1Y9OA 3GFXA 4Q44A 4F4WA 5DQGA 4U7UD 1ZAWA 1EZZB 4G1IA 4X62F 4DL7A 2ZH6A 3NBPB 1EKSA 1O5JA 2JRSA 1GX5A 2UVWA 3T5JA 2BQRA 4YQWA 3R2DJ 4C4WA 2D74B 1TK5A 3ELHA 3H20A 1RAHB 4C3KA 1BWEA 4TKTA 1BE4A 3RW7A 2VDHA 2ZVSA 2UXDF 5J2NB 1S1WB 2DKOB 2Z57B 3DI6B 2EC2A 3PYGA 4OYPA 4MK9A 3KHGA 1GMWA 2I9SA 2P5VA 4K4WA 4LFBJ 1Z2LA 3U7JA 1HQ2A 4DR3J 1X4AA 1Y5LB 1RISA 4OZLA 5L46A 4RO0A 3US5A 2AYGA 4NLQA 2IDEA 2EEYA 4J37A 2GIQA 1EETB 2JJ4D 1HHSA 4OV1A 3IBFB 3V6JA 1SUQB 4RW8B 2Y0BB 3CPWR 3WHIA 3NMAA 3DGPB 3R7SB 3OR1B 5ADZA 3K5MA 2UV8G 3PFEA 3LQVA 1AXQA 4O0IA 2J6TA 2EK6A 3OV7A 1HNVA 4TY8A 1TK0A 3IN5A 2R7OA 4MTPA 4FXVA 4IFVA 2DGXA 2R7WA 2J0QD 2DK2A 3KK2B 2ACYA 2IVFB 4USMA 5J1NA 1HKAA 4ZP8A 3TEGA 2HWHA 4IO1A 4DFKA 2MJUA 2VD3A 2R9LA 5F9LA 2ALZA 1HD1A 5F8NA 1UKUA 4Y3CA 3EZ5A 3H0PA 1EP4B 1WHYA 1TU0B 3TR5A 5HK4A 3JTOA 5AT1B 2IVMA 3HSJA 3C46A 3NGRA 4B9TA 2N7CA 3R1LA 1JLBB 2L08A 3BKTA 4DCOB 1TKZA 4PR6A 4DV6F 3CC4S 2EFGA 3PRDA 2OGUA 1NJXA 4BLGA 4EYHB 5DETA 3R7NB 5I3QA 1EAYC 2EKYA 3PKMA 4LBHA 1IM6A 4O3PA 4KPCA 2HBYB 1S9FA 5E3QA 4USTA 4ETXA 3K59A 1TFWA 2KN4A 4X2BA 3IWLA 2CA9A 4Q5VA 1O8BA 3TNVA 1JJ4A 2CPZA 1S1TA 2CKWA 1TELA 1LFPA 1JB0C 4OHYA 1AUDA 3V4IB 1GMUA 4CLPA 3QAEA 2WSFC 1FX2A 3ILOA 3W8PA 3KTQA 1UW4A 4ED5A 4E8UA 3M6WA 4AE5A 3RB0A 1LWXA 2RU3A 2DXEA 4ED3A 4OYAA 1FI4A 2HS4A 2MQMA 2XYGB 4EZ6A 4MH8A 4FYVB 4M5LA 2YNFB 1Y10A 1CJKB 2BXJA 1LV5A 3GILA 2IM0A 1UPPA 1GXTA 3V6KA 1AYEA 1YJ7A 3NGDA 1HNXF 3J80U 1SJ4P 1U47A 4LF4F 1WC4A 2E5LJ 2B4VA 2O01C 4L74A 5HQ8A 1H2UX 2ZBRA 3K8WA 3I5BA 4D3HA 1YQHA 4MMOA 3HO1A 1TUWA 4ECXA 2HGMA 5J2NA 1R6VA 1G2EA 3DI6A 2DPJA 4FZVA 1TL5A 2ASYA 1SC4B 2O1PA 2MZSA 3O3LA 5L1LA 1H7XA 5GVQA 3UO0A 2QX0A 4LF5J 4F0HA 2UUTA 1CC7A 2QEXS 4EBCA 4LF9F 2WVEA 5AE1A 2A6MA 1A6LA 1M5HA 4WZQA 4FS1A 1EETA 3QJJA 2EBGA 2LECA 1PAUB 1SUQA 2JLFA 4RW8A 3LGMA 4JB8B 1VQYA 3DGPA 4HACB 2C2ZB 3V6DA 3OR1A 3LAKA 2D7SA 4C8YA 2XGQA 1KFDA 3HVAA 2XSJB 5JMNA 1U48A 1U0HB 4QR0A 2HZCA 1LXJA 3ENWA 4P52A 4HHJA 5C24B 3KK2A 3IGVA 2Q66A 4KGVB 2VOOA 2FUG9 3BGFA 3DRPA 1J2VA 4U96A 4KPYA 2R7RA 4CH7A 2QT7A 2ZOFA 5A2QU 2G0IA 1PC5A 4H4OB 3CWJA 2J0XA 3JQMA 2LEPA 3VALA 4QU7A 1SKWA 2OP5A 4RNMA 1MSWD 2F5GA 2IRUA 4UY8T 5HVFA 1RWNB 1MROB 4A8WA 2P9EA 2BQUA 4P9SA 5G4DA 4ICLB 2D9PA 1DY3A 1TP7A 2Z2MA 4WP8A 5E5NA 3VWSA 1RTIA 5D4PA 2KRBA 4IFYB 3LWMA 1IWGA 2XCAA 2AJ2A 3H2VE 4H4KC 1EQMA 1QM9A 3KJVB 3VAGA 2Q43A 4DR5F 2BABA 2KZZA 1HBNA 2YWKA 3O44A 2OTJS 1TMMA 4OX7A 1NAQA 2E9RX 2N82B 3CJ4A 3CJ5A 1SKRA 5FLXY 3AAWB 2HQCA 3W2WB 3AJ2A 1UMJA 4YY3J 3OHAA 1KVJA 4JI1F 4NPOA 4JI2F 1RWOB 4DQIA 3JSBA 2NZ4A 1HMVB 4KRWA 6FDRA 1VLOA 3KK3B 2MQ8A 2UXBF 1ITPA 3KLHB 3LPYA 3MPWA 1IVZA 5K8OA 3IP0A 1N6QB 5ETRA 2YNFA 2NSBA 3JSYA 3VGVA 1ZAXA 1CJKA 2U2FA 1FJGJ 4I2QB 3W64A 4KFBA 2GIRA 3CEDA 4ZVFA 1JLCB 3DRYA 4PPZA 4RW6A 1RHKB 4JV5F 1HFEL 1M0SA 1P27B 4LFCF 5KFHA 4C98A 4JI5J 4AXIA 1QVGR 2D1CA 3SZ2A 3K0JA 4WK1A 4DCPB 4QPTA 4YS2A 3RRGA 5KG0A 3L7PA 3UD5A 1HW9A 3DDIA 2GVZA 2FGCA 2D3UA 4WP3A 1R8HA 2BJ8A 1S0MA 2BW2A 2QC3A 5B0EA 1HQEA 2UVVA 4IG0A 3D6MB 3IBWA 5KT5A 1MU2B 3LW5C 3LANA 2NXNA 4F3QA 4J9MA 3MURP 2CJ9A 5DZ7A 1FNMA 3TUPA 3BQ1A 5D6GA 5KT4A 2GS8A 1H2VZ 1U45A 4LQ3A 3KHLA 1FNXH 2V68A 2JC0A 1IBMJ 2CXEA 3G8SA 1YJNS 2PT0A 2HRTA 1CS4B 2AJ4A 4M95A 2FC9A 2XZDB 3MI7X 5KFKA 2ZJQQ 3KKFA 1ELOA 3M2VB 3GU0A 4CLFA 3OSNA 4F67A 4JV1A 3MXHP 4HACA 4ILMA 1S0NA 2EFPA 1JNRB 4JI6F 2GJFA 1UFLA 2XSJA 1FK9B 1R6YA 1FEEA 1S1XB 1U0HA 3NP5A 4ZP6A 2DH9A 3OFFA 2LXUA 1VQ6S 4EBDA 4KB7A 3TZYA 5LMUF 1ZETA 2J9DE 4Z37A 4H4OA 3DLJA 1UZDA 2QLJB 3AXKA 4JOUA 2ADCA 2JL9A 1BD6A 1XMOF 3SCIE 4ED2A 3P8BB 3CVKA 4PCQA 5ETVA 1N36J 4RU9A 4IFYA 4FNIA 1XR7A 2XY6A 1NHKL 2R8GA 5T14A 2QMUB 4DPOA 2P2CB 2C22A 2HHTA 1LK7A 3CTRA 3V4MA 5G0RB 1S4EA 4NLWA 1F9HA 4M94A 4HEA9 1S59A 4J9OA 4W4MA 3OLAA 1S10A 5EGYA 3G6ES 3CB4A 2Q79A 3I5CA 1RAAB 1ZTTA 3DLKA 3TZXA 3MUTP 2XWXA 1NRKA 3OHBA 3HJVA 3SSSA 2W2PP 5LM7E 4QYZK 1IR0A 3RZAA 3EGWB 3M05A 4NA3A 2VASA 4FPIA 3PXGa 2PI5A 5E3CA 2DCUB 4WKYA 2XY7A 3KLHA 5D78A 3BO3A 2W8KA 4CLKA 2EG2A 4ZMMA 4XDCA 4YR3A 4FP9A 3FZBA 4M8LA 2RNEA 5L9XA 4I2QA 2CG4A 3U1MA 4O3RA 1SQGA 2RHQB 1SPBP 2WAQD 1LOUA 1JLCA 3GV8B 4ZVPB 4PEOA 1OSCA 1KSPA 2GMHA 2AMCB 2MZTA 4AL7A 4UW2A 2M88A 5A6WA 2WBMA 4NEYA 5D4LA 2IBKA 3CDWA 5IS2A 2MHEA 2R7VA 3NS5A 4S0MA 2FVCA 5BYRA 1C0UB 1Q86T 2IJFA 1HNZJ 4GKKJ 4NCGA 2W9AA 4DFMA 2DY1A 2CQGA 2FJBB 1MU2A 5BR8F 3W3SA 2FHJD 3D9BA 3BH7B 4CH0S 3FJ2A 2ZD1B 2NXCA 2DGOA 5F41A 1JLEB 5KFRA 1Y3JA 3HHLB 2RRBA 1CS4A 1N88A 2B9WA 2ZHAA 4ECVA 4ZVGA 3M2VA 2E5GA 1H2TZ 4DN0A 4FF4A 3M9OB 2ZVIA 1IR2A 5DJBA 1NK7A 2PE8A 1FK9A 3F0NA 1IBCB 2YQ1A 2V94A 1RYRA 1JLAB 1S1XA 2W7OA 4DUTA 3E01A 5FIIA 3D2WA 1X0PA 3UN5A 2LKZA 1H6KX 4HDHA 3MDFA 5DQHA 2FIUA 4MYTA 4AQYF 2W9CA 2DNMA 3CCJS 3ETMA 4K5RA 2IA6A 4LVNP 1N33F 2P9GA 3CCVS 2F40A 1CJUA 2WVBA 5CCMA 3VAKA 3MM5A 1WHWA 1AZSB 2CPFA 4DSFA 2HFUA 3EVWA 4W98A 3UWTA 2E44A 3D28A 2G2OA 1VFJA 2AV5A 2CQ0A 4R8UB 3UN3A 1XR6A 2J7UA 2YH0A 1URNA 1S48A 3VGSA 2LA4A 3ET6A 4F36A 2XMUA 1RCXB 4OYIA 4P7TA 6AT1B 5G0RA 2CQ3A 3LWLA 1T9WA 4B3RF 4RWXA 5CD4H 1OY6A 3R5JB 5C2CA 5K14A 2ZC4A 1EX8A 4YFUA 4V19X 3GQCA 4ED4A 3Q83A 1DLOA 4A8FA 2J0SD 4YB5A 4HL9A 3TX0A 1UEUA 5BJRA 3ZZYA 3EM1A 1IUJA 3QSYB 4Y2KA 1NKCA 4C2MA 2JDJA 1K1SA 2HBRB 3IXQA 4OJ1A 4Q2LA 3L4BC 3HLUA 2KH9A 1HPZB 1NZ8A 3PVXA 2CQDA 4PG4A 2NS1B 2AT1B 1KC8T 1NMEB 2PD1A 3MOZA 1H38A 3DDNA 4A46A 3FCVA 4ECUA 4FBUA 1ZM9A 5D4NA 4KSEB 2YPYA 3ZZTA 1J27A 2KG0A 5IM0A 1YGYA 1Q0NA 2YWGA 3QAUA 4LRCA 1AROP 1S76D 5HMZA 1IBLJ 4KGZB 1HI0P 2IM3A 1C0UA 3C2PA 2FYXA 2W2OP 1KOHA 2PFFB
chains in the Genus database with same CATH topology
1WTFA 2BE2A 4PWDA 3LF0A 2F4VF 3IS9B 2QZ8A 7FD1A 3OLBA 2DGSA 3T6JA 2E1CA 3HHLC 5THWA 4LSLB 4KGMA 4Y34A 2VG6A 4JV0A 4OMFG 1YWXA 2RS2A 1R8AA 4Y2MA 3Q22A 4ILLA 5LXYA 2ASDA 4NWBA 3HHKA 5A8KA 1Q8BA 3M32B 3MUMP 3GYXB 4DQRA 2YKNB 4Q2MA 4M5DA 5HI7A 1RKJA 1QE1B 1U4BA 1FVSA 2KFZA 3GZ7A 3MZIA 3TOQA 2ZD1A 4U9RA 3RTVA 1X9WA 2CQ2A 3LO3A 3MR3A 1WG1A 4JV2A 1RYSA 1DURA 4NLXA 1JLEA 2WONA 2HAIA 4NA1A 3CGIA 3HFKA 3OR2A 5HMWA 4DS4A 1NK4A 1PGZA 1L3VA 2UUBF 3HVWA 1S6PA 3JYTA 1GQEA 2RQMA 4G1QB 4Y2AA 4PUOB 1X5PA 2GHVC 2C28A 3F56A 1RI7A 1B0PA 1F5CA 4DR4F 5T7LB 2ZITA 2J76E 1D0EA 1SIWB 4KHMA 4ED1A 2DNZA 3UI3A 4ZCKA 2GO9A 3QLHB 4Z2XA 4I7FA 4KR0B 3P6YC 2XLKA 2VL1A 4D3GA 4RBVA 2CJQA 3FEZA 2HHXA 2HHHF 1KRPA 2HLUA 1NJWA 3P3DA 1JLGA 1Z4UA 5FDLA 1N0VC 4I6WA 2FJVA 2ZBIA 3MM6A 5FD1A 3PIPQ 2ZKUA 3C6UB 3OVSA 4DQSA 4X4SA 3OL7A 2XI3A 1F5AA 3DRSB 1FRKA 1K73T 1VRUA 4QIFA 3V6DB 4OX6A 3BGLA 4RUAA 4DV3F 2C2DA 3JB9k 5EN1A 1Y3KA 1U1NA 1X4GA 2M9KA 4OFZA 4B9UA 5I3UA 1JLAA 5DRKA 1DHMA 4G6VB 5C24A 2FVRA 4ELUA 4Y0FA 1UA0A 4N76A 3TP2A 2AW0A 2CZ4A 1PILA 3SDEA 2EWHA 3PNIA 3GFYA 2CQ1A 1X4DA 3OTDA 2G9OA 1B0TA 3CCZA 2FPHX 1E6YB 2RQKA 3MTKA 4CT9A 4DL2A 3QIDA 3T9ZA 4W92B 2MQNA 3VZHA 3MM8B 1LK5A 1X9SA 2DRBA 1N52B 3DLLQ 2ZH9A 4QPXA 5CQGA 3RR8A 4BDPA 1TVRA 2XGPA 5HLFB 1VBXA 2B51A 2OPSA 4UUWA 5I3PA 2YKQA 2W24A 3MEEB 3FEXB 3MD3A 3MTJA 3DRPB 1NU4A 4NLRA 1LXNA 3TAPA 1M1KT 4IR9A 2RKIB 2GHPA 1ULRA 1SL0A 1X4FA 3FGVA 2CDQA 2CJBA 4I56A 1F0XA 3V81A 1IM4A 2XSFA 2N3LA 5F8MA 2DNRA 3NWGA 2PO4A 4O44B 1UEVA 2Q6BA 1SJFA 1VLYA 2MKHA 1OWXA 1MROA 3PJWA 1X5OA 2PA8D 2OH2A 1BQNA 4QWDA 2FVSA 3OUYA 3TAMB 2D3ZA 2O66A 2V9KA 3Q8SB 4OX8A 1CG2A 5EHHA 2DR8A 2MMYA 2P9CA 4NLDA 5J2QA 4HH1A 4ICLA 2BZ2A 5EWFA 4ITSA 2PI4A 1FXDA 3PX4A 4NRTA 3BJYA 2ZUGA 3HKZD 5DG8A 1YJWS 4NXNF 1T95A 2E5IA 5K8MA 1X4HA 1NHVA 5IT4A 1HNZF 4KV8A 1KQKA 3FZ2A 4GKKF 2P6TA 3PEJA 4ID5A 1SJ3P 5J1EB 2UP1A 4R8UA 1WF1A 5MAOA 1K0TA 2FHMA 2AJ0A 2DHGA 3RRHA 2FJDB 1TKXA 3CSKA 4LF5F 3K58A 2RF2A 3R5AA 3VAHA 4DL4A 1RTIB 3CXCR 1Q7LB 2K7KA 3KJVA 1RAJA 2EBEA 3CD0A 1WWHA 2DB1A 1UAWA 2RILA 3HHEA 1WI8A 3QJPA 5F8LA 5JVHQ 1MMLA 2HFOA 3M6UA 1Q81T 5CZXA 2ZZNA 4TXSA 5KFOA 2ROPA 4BWJA 3ZZPA 1G1XA 4C9DA 1LW0B 2NPFA 4CT8A 4MFBB 2I8EA 4LF6F 2E5JA 1HBNB 2JWNA 1BQMA 1SB6A 4CIOA 3G6XA 3SEOA 4U67Q 3EPIA 3W2WA 2UUAF 3LAMA 1FTCA 1S77D 3N6NA 5AE2A 3HM9A 4CZCA 2HHPA 2IYGA 4Y2CA 2IHR1 1U6BA 4BCAA 5H9EJ 1NEEA 3VAFA 5DDPC 5LJ5Y 5KFAA 1OSDA 1WG5A 2M2BA 4DQQA 2JEIA 1TKTB 4OI3A 5I4MA 1HWIA 5J2MA 2XNQA 2L9NA 1FEHA 3G8QA 2IA0A 2OKQA 2MZ1A 3PX0A 1KFSA 2H5EA 4FVCA 2ILZA 3CJ2A 3C6TA 4EWTA 1ZPVA 1HMVA 1B7FA 3N5FA 3FCHA 1GTHA 1RT5B 3ZZRA 3G96A 3SXLA 1S97A 2QSFA 1S9EA 1FF2A 1NJYA 3THTA 1FJ7A 4R25A 2XMJA 3KK3A 1QVFR 3GMGA 2QFJA 5D4OA 4FPRA 3PJXA 4MK7A 1HBMA 1NNDA 2ZOGA 3OFEA 1OS5A 2HW3A 1FE4A 1NJIT 3T3FA 4YB7A 1WEXA 3W2VA 1N4LA 3MECA 3TQ1A 4YOEA 1VQOS 1REVA 1N6QA 3HT3A 4LSNB 4K50A 1R8CA 5E33A 4X4RA 2AJ1A 4X84A 4PWUA 3D1QA 3TAQA 2V8DA 1SV5A 1AW0A 2NREA 3U02A 1HPZA 1RA6A 4OJ3A 2EPIA 4TQSA 2E66A 3NCPA 5J2PA 3CDAA 3ENQA 3OTEA 1NJZA 3ISZA 3QZ7A 3V2UC 2JLGA 1RT3A 1RT4B 3KNGA 5M2UA 1VBZA 5B0AA 2WSCC 5KG3A 1PO6A 2GQ2A 3BSNA 3FNNA 2J5AA 4LUBA 3MEGB 2V8HA 5IWAF 1JX4A 4KFBB 1VMBA 4B02A 5CHCB 3EYZA 2QMXA 3T5KA 4DV7F 4NCBA 2WRMA 4KGKA 3OJSA 1RT7A 3MWBA 5LT5A 1OQ6A 1R27B 4KQZA 4LMZA 1D3WA 4K4SA 1YTYA 4RW6B 5AJ3F 2MXYA 1OQ3A 3THPA 3I0SB 2CZVC 3QIPB 4LF7F 3H5UA 4K4VA 2V9WA 2IBOA 3QGHA 2M52A 1Q1KA 1QJHA 1BLUA 1IKWB 1S79A 5E3PA 3NL0A 3PR5B 1LWFB 1TUVA 4MJKA 2QO3A 3ZZ0A 4DDFA 2MKSA 3CCRS 3CCSS 4P6QA 3IG1B 5C42B 2J7WA 5HL7Q 1SL1A 4HKQA 3IRXA 4DV2F 2ZHBA 3I96A 2AYEA 2YKPA 3PEHA 1R7IA 1V9OA 4DFJA 1K1QA 4ZA1A 4XDDA 4V19J 3D54A 5KFXA 2CIMA 2KXFA 4AL5A 5HP1A 3L09A 3M8QB 4JI3F 2OFGX 4RUHA 1IKYB 3KYLA 1JKHA 2QSWA 1NZAA 2K3KA 2K7JA 2D3OR 4A4JA 3RB3A 2PMHA 3FSXA 2W9BB 4F02A 2DISA 3CDBA 3ENVA 5H9FJ 1ZM2A 5K5MA 5C25A 1HQEB 2RU9A 3OXFA 1VS3A 4K59A 2AQ4A 3EGNA 3TI0A 3MOJB 4IG0B 1Z2ZA 1CVJA 3IS9A 4I6AA 1M90T 2FHKA 3RB4A 3J7A1 2WB1D 5H1SV 4MKBA 2RVJA 2RUGA 4DEZA 2ZH4A 1U26A 3UR3C 4DUYF 1D9DA 5A6PA 1ZH5A 5KT7A 3M32A 1JXEA 2NR0A 2DNQA 3BS9A 2BJEA 2YKNA 2I5JA 1QE1A 3FSYA 4YY3F 1JJHA 2VG7B 1NH7A 3D0IE 2ASLA 2HQ3A 1T05B 2YKMB 1A7GE 1TQLA 1N34F 3ICLA 1XTZA 3IC1A 4A8XA 4OI0A 1FKOB 4Y6IA 2YQ3A 1ZYQA 4J9LA 2PA3A 3DOLB 4N8OA 4XPCA 3OL6A 1FRLA 4DUZF 2ZE2B 3HDSA 4G1QA 4PUOA 4ZLPA 4Y65A 4CCHA 4DL6A 3HVRA 2XMVA 3D0HE 3DMJA 4HH0A 3FRZA 3QYYA 5T7LA 3BQ0A 4URGA 2OJ3A 4NL5A 2PC6A 5B0CA 2A1BA 2IC3B 1K8AT 4ECZA 3HHDA 4F8RA 3B4MA 5AXLA 3K7RA 3WX4A 5CYJA 5AXKA 2MQPA 3KNAA 1N0UA 1FJEB 4K4UA 1KVIA 5KG4A 3DC2A 4GC6A 1B64A 1DAXA 1S99A 3C6UA 3J7ZT 2ILYA 3DRSA 4DS5A 3HZGA 2F1FA 5GAGU 3M8RA 3Q23A 5KAKA 2QLWA 3OVBA 4JV5F 4CO3A 2ZKTA 1FJGF 3DU6A 2DNNA 2VPYB 2CQIA 1V6HA 3OFHA 5KFUA 2L41A 4FXDA 5KT2A 3N28A 3VAMA 1VQ8S 1JJ2R 3OL8A 1LQ9A 3OXGA 2GHWA 4IFVB 5L1KA 4Y28C 2M4MA 5L1JA 3I6PA 1E6YA 3CDUA 4OZJA 3RRKA 4B3MF 1P8GA 1C4AA 5A0YB 5GADI 4USJC 4ECTA 2XY5A 3CD7A 1NKEA 5A8RB 2GCFA 4JI5F 1SBRA 1DQ8A 4Q0BA 2KHDA 4O4RA 2V4QA 5HLFA 2DGTA 3K8VA 5J1PA 2RKIA 3THVA 1R89A 5EWGA 1XEZA 2CFXA 1TAQA 1QTMA 3LP2B 3HI9A 4PG7A 1U1PA 4K4ZA 4OQJA 3K5OA 4O44A 5IT0A 4ZPWR 4LFAF 4A8OA 2F8MA 1T94A 4J5OA 3GIJA 3BN7A 2VFUA 3TAMA 3GG0A 1IN0A 3UE2A 1VC5A 4Q7AA 1RDRA 4WZMA 2M5YA 4DG1B 2KB2A 1XC9A 4RNNA 1X7VA 4I67A 3DLGB 4ES2A 3MM7B 4ZDNA 2EW9A 1F9FA 2GGPA 4ZPCA 1FERA 1G7CB 4C97A 1LWCA 1JLQB 4QIGA 2IFXA 5DLFA 3EUNA 1TKZB 5A2QY 3SV4A 2K1RB 2OSRA 3CIZA 4B17A 3FRYA 2HVZA 1V3ZA 3VTIA 4CO0A 1CQMA 4N77A 2XLJA 1VQNS 2YNGB 2GO8A 3TA2A 3ULHA 1YG0A 1HNIB 3F73A 4PQUA 5JXSA 3C8YA 3LALA 3LUYA 4USIA 4YHHF 4P2SA 4KHRA 1H7WA 4QW8A 4A8YA 1HA1A 2AX0A 2MQLA 2XS2A 1S6UA 4NZ7A 3GWCA 3CIMA 1IQTA 4N8NA 1NK5A 3VCDA 2J6SA 1NH8A 4EO8A 4TU9A 3TA1A 2WW8A 4OHVA 4ZPDA 1IBMF 1HWUA 2LEAA 4I6YA 2R8KA 1DQAA 4EO6A 2DBBA 1VQ7S 5K8NA 2LDIA 2ZH7A 6FD1A 5KTQA 1X4EA 5DO2A 2R8JA 2B6AB 4EUVA 2A10A 1FDAA 2E9ZA 2VH7A 4J9QA 2E5HA 2LYVA 5SUHA 2MY7A 2BDPA 3CC7S 4PRFA 3N0VA 5HO4A 5KFPA 2OPPB 1TK8A 3N6LA 4LIRA 5F0WA 4C8MA 4QWCA 2YX4A 2W7PA 3CULA 5KFTA 2CJKA 2W4CA 2FC8A 1HWJA 4KE5A 2MKIA 2J9CA 3DLKB 2FGOA 2KO1A 4PKDB 5LL6d 4ZCLA 1S1TB 4ZCIA 3MFHA 2BV3A 2V2KA 3L7OA 3PX6A 2FJEB 4R5PA 1P1TA 1KS2A 3PR4A 3DHXA 4BS2A 4BHQA 2RT3A 2R7QA 4BC9A 5KT3A 5L39A 2KM8C 4B9SA 2BYCA 3B78A 1ZM4A 2XMKA 4PXDA 2DNHA 3R1HA 2F8EX 4EGLA 4P7VA 2RJZA 3KG4A 2OLWA 4KJIA 4I4BA 1CEZA 2JC1A 4X64F 1LW2B 1O0PA 2PDAA 1S0VA 3BZQA 1KQFB 3MPYA 1UFWA 2LA6A 2HMIA 4MKYA 1S6QB 4TU7A 4OHXA 5D77A 1M5SA 2MKCA 2OD4A 4RW9B 1RQ0A 2R7XA 3LGNA 2HHQA 3AB2B 5KOXA 4OI2A 3PO5A 4OI4A 4B9VA 2LVWA 3HX9A 1Q8LA 4LSNA 4IH6A 3DNCA 2V4JB 1Y9OA 3VF0B 7FDRA 2N3OA 2LEBA 3GFXA 4Q44A 3GIIA 3N4WA 4F4WA 2B4OA 2NYIA 5DQGA 3MMCA 2XBPA 1RJJA 2LCWA 1ZAWA 2BBEA 3IAM9 4ZP7A 5I42B 2GMLA 4G1IA 4X62F 1RT4A 4IQMA 4C11B 4DL7A 3N79A 2ZH6A 3AJ1A 2A2CA 3NBPB 1KQSR 2ZDOA 1O5JA 1E6VB 1GX5A 2JRSA 2UVWA 4X4OA 3MEGA 2VBXA 4KIAA 4YQWA 3T5JA 2BQRA 2D74B 4C4WA 5E3AA 2DNKA 4G1PA 1GXLA 3KLGB 1Q78A 1TK5A 1Y5NB 4DR6F 3QWPA 3H20A 1HQUB 3CCMS 4C3KA 1UVKA 3H2UB 4NRUA 1BWEA 4MK8A 2HNDB 4TKTA 4LVOP 5HN0A 1YHQS 3RW7A 3I0SA 1RTDB 3QIPA 3BN4A 3MGJA 3W7BA 1Q8IA 2A18A 1XK8A 4ED8A 4UY85 4OLPA 2DJWA 1KHWA 3T1AA 3G6YA 2ZVSA 2UXDF 1IKWA 1N36F 1UJ5A 1LWFA 1TL3B 3JSRA 4BC7A 5J2NB 1S1WB 3VQTA 4FF2A 3DI6B 3IG1A 1HW8A 5DQIA 5C42A 4IYQA 5B0GA 2R7SA 4FS2A 4RX6A 3GB0A 1UETA 2X1BA 4ILRA 4MK9A 2J0WA 4BBYA 3KHGA 2I9SA 4WIIA 4IO9Q 4O3OA 2P5VA 4K4WA 2FVPA 4QIEA 5B09A 3M8QA 3WBZA 5LJ3Y 3IAS9 3G8TA 1Z2LA 1ZZFA 1IKYA 1WF2A 3U7JA 2HPUA 2VFTA 1X4AA 3VR1A 2KTQA 2VPXB 2LU1A 1XBWA 4FVMA 4F2SA 1ZZNA 2FTRA 1Y5LB 4NCGB 2HS3A 2RSQA 3HZEA 4KT0C 5HBMB 1M5K