1S12A

Crystal structure of tm1457
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
MIKVTVTNSFFEVTGHAPDKTLCASVSLLTQHVANFLKAEKKAKIKKESGYLKVKFEELENCEVKVLAAMVRSLKELEQKFPSQIRVEVIDNGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein TM1457
publication title Crystal structure of TM1457 from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 30
structure length 94
sequence length 94
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04327 Peptidase_Prp Cysteine protease Prp
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1490 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Cysteine protease Prp 1s12A00
4PEOA 2IDLA 2G0JA 1S12A 2G0IA
chains in the Genus database with same CATH superfamily
3EGWB 4NOHA 4PG6A 1RADB 5HBMA 4O0IA 4DSIA 2YNFA 1S1XB 1ZM9A 3AQOA 5IT9U 1XERA 2ACMA 2CQCA 2CQDA 3MOZA 5F8JA 2J9EA 4HT7A 3LGHA 3FFIA 4DI6A 4O3OA 3X3UA 1R43A 4B9LA 3KLHA 2MJNA 3D54A 5B0EA 3TA1A 2F4VJ 1Q7YT 2MQ8A 2ZZMA 1VIXA 1RYSA 1RWMB 3H8YA 4HL9A 5DS7A 5HJXA 4CLSA 3RTVA 3ILLA 4X65J 3CJ4A 1URRA 4Y65A 1ZZFA 2C2DA 4CIOA 2YVSA 4F4WA 5LXYA 3DDIA 3RB0A 1BMQB 3JSMA 2Y1LB 5HAOA 4K50A 1ZZNA 3SCJE 3BQ2A 2OPSA 2FLNA 2QLWA 4CTAB 4ID8A 3C66A 2JEFA 2KKHA 3T1AA 3HZGA 3VTIA 4ZVFA 1ZETA 4RR5A 1HARA 1HD1A 2DR8A 1RT3B 2IFXA 4DCOB 4F67A 3QSIA 3R6LB 5C24B 2HFZA 4NXNJ 3GYNA 4EWTA 1VQPS 4B9TA 3KMSA 5E3PA 3AJ1A 1YGYA 4KYZA 4UZCA 1UW4A 1TK5A 4DCJB 3HP6A 2RHSB 5IFMA 2C1EB 4I64A 1HPZA 1X9MA 5HVFA 4K7QA 3IA0A 3P8BB 1FD8A 2D3ZA 2R8KA 3BREA 2CKWA 3OTOJ 4CLFA 2DNHA 2QRRA 3L7UA 3HX9A 3MOJB 3GCWP 3ONQA 4K4YA 2NZCA 3FSYA 3Q22A 3EVMA 4X4PA 3C6UB 2XGQA 2F8HA 3MUMP 3WIVA 2NUUG 2FJAB 5DZ6A 1APSA 1UETA 2VFSA 1LV5A 3L7PA 4J37A 1A9NB 4DX5A 4JYAJ 1ZBTA 2E7WA 2YX7A 3H7HB 1PYTA 2ZKTA 2QSFA 4MT1A 2W9BB 2CDQA 3GWCA 3LOUA 3SCIE 4OI4A 5E7OB 1SQEA 4LRAA 1AZSA 5KFJA 1N33J 4TN2A 4J5OA 2CQ0A 4ZIVA 3CCJS 1REVA 5D3GB 2ASLA 3OTBA 1QLNA 1K1QA 3UFCX 1EHWA 3P3DA 3MWBA 3CCVS 4RW4A 2XMMA 2AX1A 2W9AA 1FDAA 1FEHA 3D5MA 3C14B 4L72B 2BE2A 1KTQA 5AXLA 1XNQJ 3ISND 1DBDA 3I0SA 4WYLA 1RHUB 1JWWA 3QT6A 1NK0A 1U1KA 1RSCA 1MROA 3DYAA 5B0DA 2H51B 2POKA 1TUWA 2KM8C 1U45A 1DJ0A 2D3O1 1SKSA 2XQCA 4QBUA 4NLWA 2DGXA 3ENQA 1S57A 4K8RA 2FVCA 3DDKA 2IJNA 3BR8A 2IY5B 3QMQA 2RNEA 5LMUJ 2CPZA 1AZSB 1MMLA 1IKWB 2XMVA 2CPDA 2XYGB 1FXDA 1Q53A 1N0VC 4ZPDA 1T3OA 3D6HB 1RAIB 1GMWD 4TLRA 1T05B 1RBLA 1FX4A 2ZC4A 5IV4A 1VRTB 4O3NA 4OV6A 1VQMS 4N7TA 4OYOA 2E9TA 1OJ4A 3RR8A 5BJRA 2QLBB 2W1BA 2FJDB 2JX2A 2XMWA 2BANB 2YKQA 3KWMA 3OFFA 3W62A 3H25A 1JXVA 3SBMA 5E3RA 3DYAB 3J7A1 3GG0A 3LP2A 2RB7A 4NCAA 4BS2A 1U09A 2KH9A 4M8LA 3T1YF 2FVPA 2ZHAA 4UUWA 5GVQA 2O1PA 3FQKA 2JRSA 3AY0A 2LDIA 2H4YB 4NLRA 4PYAA 3DRRB 4OZJA 3VAHA 4C9DA 2QLFB 4PXBA 1RTDB 3I5BA 1S1TB 2BZ2A 4M5JA 4HT5A 3QGHA 3TQ1A 2EWHA 5ETOA 3EGVA 5ETNA 1VQ9S 3TVKA 4KY3A 3ITHB 3PHEA 1DURA 4Y2MA 1RT6A 1VBKA 3LP2B 2EFVA 2EFNA 2FTRA 1L5UA 3U1LA 4DR4F 1FERA 1DTTB 5A8WB 3MEDB 2VODA 1HNVB 2R7TA 3NG8A 1LK5A 3J7AN 3K5NA 2UUWA 5C5JA 1R8HA 3EDRB 4KHPF 2AJQA 1H7XA 2VQFJ 3KG4A 2HHPA 2C2KB 3ZZUA 2XTJP 2NUHA 3DHXA 1KONA 2HHSA 2EBGA 1U1OA 2XC9A 4ZP6A 3M8WA 1TL5A 3H40A 3M6UA 2YQ1A 4J9UE 3Q8UA 5BR8F 2APOA 2W25A 2AJ2A 1RTZA 4RLEA 3QRPA 4OYWA 3CJ8A 4M5KA 1VLYA 1RWVB 2MQQA 4R0EA 4G6VB 4KGKA 2DISA 2QL5B 3V6DB 3CJ3A 3CMES 4Q45A 3DOKB 3CF5Q 2Y1IA 4B17A 4DJBA 2MQPA 1GMVA 3BGRB 4NLXA 1T0TV 4FF1A 5EWGA 4J9PA 5DM6Q 3ISNC 4QIFA 3G82B 1IWAA 1MLAA 2RVJA 4LF9F 2F4VF 5GMDA 3MM6A 1F0XA 3OVBA 3QYYA 4FDFA 2CZVC 4OLPA 1YSJA 2PN6A 4X65F 4EI2A 2M52A 1UKUA 1AFIA 3DLLQ 2WZ1A 4X4UA 5D6GA 1RISA 4FP9A 4URGA 1SXLA 2J0SD 3CDBA 3W60A 1HYSB 5AXKA 3K8VA 1KHVA 1KVJA 4IKAA 2CG8A 5HQ8A 4CQ1A 3PW5A 3NY0A 3H0PA 2Z56B 4ZN3A 2UUTA 4RUBA 1RWNB 2WW4A 4OJ3A 4J9RA 2VBXA 2Y1RI 4K4SA 3OHBA 3GJTB 4NXNF 5L39A 4WBFA 3PR4A 2BV3A 4D3GA 5A8KA 2QX0A 3FSIA 4ZP7A 5E3QA 1O8BA 2YX4A 3OSPA 2XB2D 2NPIA 5GAHI 4Y2IA 1CJVB 3N6LA 1JXEA 3KLFB 1X7VA 4XAKA 1TKZA 3QWPA 1LOUA 1KBRA 3QAEA 1X9SA 1Z2ZA 4FXDA 1SIWB 3R7NB 4AL5A 1NMEB 1S1VA 3OTOF 2YPYA 4USTA 1QAYA 4RNMA 2HVZA 3TI0A 1X4HA 5DQIA 2HFNA 4I6YA 3MR2A 4YFUA 4GKJJ 5DG7A 3MEEB 2Z0GA 2OFGX 3BKFA 1RT5A 4DN0A 4LFAJ 2GS8A 4PQUB 5JXSA 3MR6A 1VQYA 1XEZA 2VBWA 3LGMA 4JYAF 3THVA 1DY3A 1FJ7A 2E66A 2MQNA 4DFJA 2XWXA 3D2WA 2HVDA 2MTLA 1N33F 3NGSA 4DF8A 3TAPA 2B9EA 3GE9A 1R0AA 4ZVQB 3RUBL 1R6YA 5KFPA 2VFRA 3JQJA 3TUIC 4F2SA 2OKQA 1XNQF 2CAJA 4MYUA 3AAWB 2MHNA 1LWFA 2IJRA 3CJQA 4U9RA 1U4BA 4GVBB 1AXQA 4X66J 2XNRA 1XMQJ 2VFTA 3TYTA 4LF4F 4YHHJ 2KDOA 4Y2AA 1M5OC 3ETOA 1UVLA 1JLGA 2EG1A 1BWVA 5LMUF 4TU9A 3Q8SB 4C0OC 4TY9A 4QYZK 3B6BA 2KTQA 4HTJA 1UFLA 3Q2SC 1VMBA 2V8PA 3HKZD 2EBEA 3W7BA 1RHJB 3OXLA 4KFBB 4X64J 2MKJA 3PO4A 5ETKA 1B3TA 2CNKB 5LJ5Y 3UN3A 3TP2A 4DV7J 3RU0A 1FESA 4OYBA 1NEEA 2VPZB 5H9FJ 2LYVA 3V81B 4K0KJ 3Q24A 1QDUB 3ZTQA 1KQSR 1O5JA 3PG9A 2LFVA 4Q2MA 2EXUA 4ZPAA 1YJ9S 1D8YA 2B4VA 4N41A 1RTHA 4A8YA 2DH9A 2C3MA 1HKAA 2P6SA 4LIRA 1VJQA 2XNQA 4FZVA 1BQXA 2MJUA 4MH8A 2HW3A 1SVDA 2YWHA 1KQFB 3H5YA 1NJWA 2CXEA 5B0CA 2N4CA 2KN4A 2HQIA 2A10A 4YQWA 3BH6B 3H2VE 3R7SB 4UOHA 4WKYA 4UTGA 3ZZRA 4PG8A 3PFEA 1M90T 4I6AA 5IM0A 4DF4A 2FZGB 4OHWA 2ZH5A 3J81j 2EFGA 3SCLE 2GJ2A 2CQ1A 4QWEA 1WEYA 4LFCJ 1V5IB 4DR7J 5DDQC 3M6VA 3FUYA 1SV5B 3TAMB 5GAEI 2G1DA 3CCLS 2OTJS 2DHXA 1L3VA 2HVHA 2DGQA 3LP0B 1WG1A 1NH7A 1SH2A 2JLEA 3CCES 2ZUGA 1HIYA 3V6JA 2GGPB 2V4JA 3UWTA 3QLHB 1ZYQA 2C2RA 3MAAA 1FEEA 5F8HA 2XS7A 4YB5A 1ZS6A 3H5SA 5A8RA 3BSOA 2ZE2B 1MW7A 5DM7Q 1SL1A 1QE1A 1VDHA 1S49A 3EZOA 1XBWA 4E2FB 2BXJA 4J7CA 3HD1A 1HBMB 1E6YB 3OL6A 5K20B 1FFGB 5KAKA 1Z1ZA 2CPHA 2LKZA 1FDBA 2AP6A 3O3LA 3W61A 5D4NA 1RAOA 2GVZA 1DLOA 1D9AA 2RT3A 4ICLA 3ILOA 1FDDA 3BO4A 2JOQA 3MM5B 4JI2F 2GIFA 1Q8KA 4YB1P 5F8LA 2QA1A 1FI4A 5F8MA 5GAHU 4IG3A 5A8RB 1VQ8S 2XGPA 1F9FA 3M2VA 3T5HA 4OMFG 4B3SJ 1MWYA 2ZJQQ 3I6PA 1CVJA 3Q2TC 2MGZB 1B0PA 3PRBA 1L3SA 1JKHA 4IFVA 4I2PA 3KHGA 2HHQA 3E01B 1RUSA 5BYQA 1NK9A 1NHKL 4K4WA 4ZVTB 4JUZA 1YI2S 2R2RA 1RHMB 4R25A 1NU4A 1VQLS 4CH0S 5J2PB 1TMMA 3K89A 3R9LA 2Y9HA 4GKJF 1W2BR 3CMQA 4AQYF 4J9MA 2QC3A 1S97A 4Y34A 2AYEA 4LFAF 4DZ6A 2P9EA 4DS5A 1MMDA 3CDEA 4YY3F 4RW7A 1RAFB 2MKKA 4J9VA 4IFVB 5H9EJ 3FMWA 2L9NA 4OV1A 5KFQA 5EDWA 5CXTA 2DR7A 1VI7A 2O3DA 3MMCB 4PRFA 1GX5A 5EWEA 2M4MA 4ELUA 4C8LA 2L48A 1HMVA 2ASYA 1X4GA 3DHWC 4X62J 1ZAXA 3EICA 4DFKA 4QCLA 3T9ZA 4X66F 2MKCA 4C2MA 1XMQF 3A8EA 2VOPA 4YHHF 4C0BA 2RKIA 2B4OA 2L41A 2BJ1A 2GVDA 3NNCA 2W2OP 1ACMB 5DGAA 4C11B 3KOAA 2LA4A 5B0AA 4DV4J 1UTAA 3HPOA 1NDKA 1IQTA 3CIZA 3T5JA 4OHZA 1HNWJ 1N5VA 2X3GA 4X64F 2BBEA 2EC0A 3DLEA 3EXCX 4NLSA 4Q2LA 4TU8A 2RF2A 2MB0B 4DV7F 1S6PB 2X1BA 2ZBPA 3FSXA 4I69A 4ECXA 1KLMB 3PFOA 4H54A 2BABA 3FMBA 2WTFA 4NCGA 4CO0A 4IUFA 1BXNA 1YKWA 2GVDB 3QRQA 2WRMA 8AT1B 1UL3A 3HF5A 3SQGA 5C25B 2G0CA 4CLTA 2BX6A 1U1LA 3MECA 5E3CA 1HR0J 3B54A 2HQFA 2FLLA 3M1VA 3DOLA 2BVZA 4WP9A 4O3QA 1IBKJ 2B6AB 1YJRA 5J1NA 1H98A 3CDUA 1WDDA 4LQ9A 2HMIB 1S79A 1C0UB 2H4WB 1K47A 2M9KA 5SUHA 1BQNA 3GFXA 1D1UA 4Q7AA 3CDWA 3MF5A 4O3RA 1UEUA 4P2SA 1NCLA 3CB4A 2E5IA 1UVJA 4ZVSB 2LXIA 1RBOB 3PY8A 2DNMA 1HNXJ 4KTQA 4AE5A 4FS2A 4TQRA 3R2CJ 1SQGA 1ZAWA 4DQIA 1EETB 2VD3A 2GHWA 3QZ7A 2I0XA 1FWLA 4ITSA 1YBTA 2DRBA 2V69A 1X5SA 1FJEB 2VG7B 3MMJA 4KKOA 5GAEU 4MTPA 1YBUA 3PNIA 4NLGA 2KHCA 2E1MC 5FLXY 5AE1A 2W7AA 4DG1B 2JVRA 1FWPA 4DR7F 1EP4A 2NYIA 2DNNA 3P45B 3W63A 2YKOA 4RWXA 3W2WA 1KHWA 1RKIA 2ADBA 2Z2ZA 3W2VA 1OO0B 1SC1B 1CEZA 5D4OA 2CJ9A 3UR0A 2XMTA 1GXTA 1RU2A 1RT1A 4PYDA 2Z2MA 1SJQA 2CPFA 2C2MB 1IKXA 1LW2B 1N6QA 1U2CA 4GVLA 3MZIA 3CEDA 2R9LA 2M8HA 3DMJB 2DCUB 1IXKA 1V3SA 2R2SA 1WD6A 2JVOA 2R7UA 4FYDA 4IH6A 2G2YA 3PIPQ 1MN9A 4PR6A 4DHVA 4B9MA 3MXHP 3NXZA 5L1LA 1O0PA 3DRSB 3JQKA 3QFHA 3S1TA 4H4KA 4JI7J 4WWSA 2W8KA 3LPYA 2R3VA 3QFWA 4OI0A 1UWBB 2HAIA 3F73A 4FXWA 3CSKA 4UUXA 4FYVB 4UZBA 2YWWA 1RCXB 2KYXA 3ZXWA 1FX2A 3FEXB 1U47A 3VAFA 4ZLLA 2AWZA 1K9MT 4ELTA 2MSSA 2VC0A 1U2FA 3BKTA 3WX8A 3TVZA 1VRQC 3MAQA 1G4CA 1YZ6A 3LW5C 4B3SF 2V2ZA 3CC4S 2RAQA 4OI6A 3MMAB 2YKPA 4WIQA 2GQCA 4OLOA 3M8SA 2VL1A 4DU7A 4LF8F 2J8SA 2A3JA 3TRGA 4NLYA 3MR3A 2MEWA 5HMWA 1PC4A 1TL3A 1MG7A 3TJ9A 3O44A 4HKQA 1U02A 3TW0A 4LR9A 1RHKB 4CLUA 1F2HA 1U0HA 2QV6A 4H4MA 3ET6B 2EKNA 4O44A 7AT1B 1E6VB 3UN5A 4ZA1A 3N6NA 4WK1A 4RBVA 4R5PB 1U1MA 3I82A 3THPA 2F4FA 3K17A 3HSZA 4C7QA 2W2QP 3KK2B 2CJQA 1I3OB 1FTCA 1LFWA 3SDEB 2XSJB 1RP5A 4EMDA 1XWLA 4B3TJ 3IR7B 3TAQA 3OJSA 4PZVA 4M1KA 5IXUA 5J2QA 3FJ2A 2DJWA 3WBZA 3AODA 2VA3A 5HK4A 3QJPA 4TYAA 1QAIA 3C46A 3BBFA 1WELA 4CLLA 2M8DB 1IKYA 4H4MB 3GG1A 4MK7A 4X62F 4X4OA 4UQTA 4ZMMA 3CC2S 3DN9A 1FRMA 3CULA 2AEFA 3HFZB 4ID5A 2X3DA 5KG3A 2N3LA 1OY8A 1NH8A 1FKOA 1XC9A 5J2QB 1QJHA 4PWDB 2BW2A 1S6OA 1RACB 4DV4F 2DCLA 4MYTA 1W25A 4K4TA 3LAKA 2ZWOA 2HHWA 4ZN1A 5KFZA 1S4FA 2C2NA 1HNWF 1NSPA 4H4OA 1H7WA 2FVSA 3BN4A 5EUHA 1RTIA 1KEKA 4DSFA 1UFWA 2ROGA 2VFVA 3LALA 2LP4A 3EX7B 1RI7A 4WFZA 4HDGA 3SYZA 1VLOA 1XTZA 3HSJA 1X31C 3HLUA 1MSWD 4IRDA 3W64A 2Y3YA 1HR0F 3SV3A 5FD1A 3QJJA 2W4CA 2IJFA 2NQPA 4YR0A 2E7VA 4CO5A 4J9QA 1QD1A 1IBKF 1J5OA 1TELA 2AMCB 4KO0B 4ZHRA 3TX0A 8RUCA 1H0HB 4UT4A 1ZA1B 4WU3A 3R1HA 1AROP 3W65A 1QSSA 1S6QA 1U48A 4RWWA 3B82A 3VHQA 3DOMB 4DU8A 4PXDA 3BGUA 3GIKA 4WZQA 4HTIA 2VJVA 2HNDA 1XR6A 4FN5A 1ZTWA 2M5YA 1RABB 2DNQA 1HNXF 1SC6A 4ED1A 2XHCA 2XCPA 1PBUA 4OHXA 1H2VZ 3CIMA 2WVBA 2GHPA 1TL1A 2C3OA 2U2FA 4QR1A 2VF3A 4TY8B 1AA1B 3NCQA 3M2UA 1MWQA 2UVRA 4DUZJ 2LEAA 4ZIWA 4WJBA 1S6UA 2CWXA 1KVIA 5KFIA 1FDNA 4EU0A 1CJTB 5KFGA 2VUGA 1DAXA 4W92B 3OL7A 2G4BA 2QA4G 2XO7A 3AT1B 3OR1B 2H5JB 1W2IA 2MLXA 2HNDB 4OI2A 2VZ9A 5KFKA 3K8WA 2YH1A 2BQ3A 4V19X 4DLEA 3KJQB 2E1PA 2R4FA 3GV8B 2NS1B 3BQ0A 4NLTA 2Y8YA 3A13A 1JLCA 2J7KA 3FEYB 2R8GA 3V4IB 2B4PA 1HQUA 2IVFB 2UU9J 1GT8A 3BKUA 4M5DA 2O67A 4KV8B 5A76A 3LANA 2BRLA 3P49B 2H3EB 3G86A 3Q83A 4P7VA 4ETZA 4DX7A 2AJFE 4ECUA 2O66A 3C6TB 2OPQA 5FLXU 1S10A 3BYRA 3ZC4A 3KLIB 4DV0J 4ES3A 5D4LA 3QATA 3ZTSA 4JI7F 1N32F 2ZH9A 2VG5B 4H4KC 1FFSB 4NEZA 4QW8A 3HVAA 8ATCB 4CWBA 5KFXA 1S9FA 3VAIA 3FC9A 1RA6A 4CYUB 4IH5A 2ZUAA 4ERDA 4CLZA 5CHCB 1PKUA 2CQ4A 1V9OA 4CI0B 5I3PA 1SL0A 2BKPA 1EKRA 2YY3A 4OIXA 2G2ZA 3G4SS 4RNNA 2HGNA 2JH3A 3CJKB 1M0SA 3OR2A 1S0OA 1C0TA 1BUXA 4OYAA 2NSCA 3LA0A 2IM1A 2HHHJ 1HBOA 2DO0A 1TTHB 3OVAA 1S1WA 2QLXA 1F2GA 4XDCA 1M5KC 4DQSA 4CNYA 1HWKA 1ICEB 1WG5A 2X1FA 5LOQA 2B8QA 5KG6A 5HQLA 3ILJA 1PBAA 1SJRA 2CPEA 4LSNB 4DFPA 2XMJA 3S01A 2RRAA 3VF0B 2ZVSA 3PEHA 2ZDOA 1R27B 5K8NA 4USWA 4RW6A 3RBZA 2LQ9A 1JXLA 1P9YA 4K5SA 2P6TA 4F4ZA 1CBKA 1WC0A 3OR2B 5F41A 1AYEA 3M8PB 3UDEA 3K7RA 3PW4A 3GR0A 3DLGB 3MM8A 2NLWA 2GZOA 2E1AA 1PIEA 2LU2A 2R8JA 3OFGA 4MMOA 1K0TA 4PXEA 3VGTA 2ZVIA 3LP1A 1UAWA 3PDNA 3ICLA 4LRFA 4QIEA 4IG0B 3EYZA 2QA4S 3M05A 3N5FA 3TZYA 1KR4A 5D4PA 1S1UB 3IGNA 2CQHA 1G1XA 4TQSA 2HZVA 4RW6B 3CXCR 1TFYA 3OL8A 4IO1A 1Q81T 3ENWA 1EB0A 2J9DA 4AL6A 2YNIA 1PJ6A 1SUQA 2DR6A 3ZZTA 2WOMB 5J1EB 2ATCB 2M0GB 4X4QA 2KT2A 5E33A 5CABA 3LTOA 1RHRB 3KJVA 2QEXS 2HIYA 2XS2A 5ETSA 1JNZB 2Q79A 3RAQA 5CH7B 2WSFC 4J9NA 3EVOA 2W24A 3JYTA 1U25A 3PVXA 1M5PC 5HLFA 2VB6A 1WEZA 2RQMA 2Z57B 3CO0P 5D15A 1HNZJ 5DO2A 4C8KA 1R8AA 1VRUB 2WONA 3CCWA 4YP3A 2CYYA 3DRYA 3HO1A 1UEVA 2YNIB 2DH7A 3MM7A 2KJWA 1OPIA 1R89A 1CLFA 5LSLA 2DHGA 2CJXB 3KJVB 1JLFB 2KXNB 1KFDA 1PJ5A 4JBCA 4FYYB 2DH8A 1GXUA 3Q8YA 4CZCA 1NAQA 1NSKL 1DTQA 3PYFA 3G6ES 5ETRA 1LK7A 5IQ6A 4DR6J 4RBUA 2RRNA 2K2PA 2N7CA 4IO9Q 2HRUA 4CM2A 1KN6A 1GMUA 5J2MA 2GJIA 5A2QY 3FCHA 3ZZ0A 3BQ1A 2XY7A 4OX9J 1YZ7A 1UPMB 1SBRA 2MHEA 3BDPA 1GXLA 5DDOC 1JJCB 5D0RA 4QWBA 4Q0BB 2BM1A 3KFWX 1TAQA 2XZTB 3MD1A 3PW7A 3NGDA 5LM7E 2ALYB 5K8PA 4IRKA 4HR2A 1RT7B 4DUZF 4USVA 4ECYA 1TMJA 2MZRA 4Q5VA 4FF4A 4ECTA 1DQ9A 1HBNA 3AQPA 1UVIA 2FY8A 2DPIA 1Y7PA 2DY1A 1PSDA 3DXBA 3F56A 2NREA 4I2QA 4DV3J 4A48A 5M2RA 4UQGA 3TEHB 2OPPA 2ZJPQ 2OJ3A 4J9OA 2V94A 4O4RA 4DPYA 2MKIA 2MXYA 3IAM9 4DLGA 3SV4A 1LKZA 3LUYA 4ATNA 1HBUA 4WP3A 2YWKA 3AD8C 3O8WA 2UU9F 3G96A 2HNYA 4PUOA 3F44A 1H73A 4X4TA 3QQCD 2AEJA 4A8XA 1NK6A 1GAOA 2XCAA 2VIHA 4M5IA 3U1MA 1MNEA 4BC9A 4USMA 2B4UA 4PG7A 2GNKA 3HJFA 1T9XA 2E5HA 4DV0F 3MMBA 2VG6B 4N76A 2UZAA 4R8UB 2R7XA 1QSYA 1GH8A 1MWZA 2RHQB 1DZ5A 4NCBA 4KBIA 2JLGA 4ILRA 2ZH1A 1ZM4A 1NKEA 4XTTA 3OTDA 5F8IA 3DI6A 3MEGB 2HNYB 2CVEA 2D69A 3G2XA 3KUHA 4ZLJA 2CJYB 4AL7A 3SEOA 4I7FB 3FRZA 5A0YB 3NNHA 3MUVP 4ZP9A 2WBMA 5DJBA 3R5DA 1J27A 2HHHF 4DPWA 1Q5YA 3R5BA 1HI8A 3GU0A 3C15B 1JLAA 3SZ2A 3CCTA 4A46A 2BMBA 4JI4J 1B7YB 2MYFA 3BYPA 5LJ3Y 2OIHA 4MK9A 4NA1A 5KFEA 1LWXA 3ZTRA 2NZ4A 3ENVA 2UXDJ 2B5JB 1GTHA 1RB0A 4KC5A 4F2RA 1U26A 3QJLA 5CD4H 2M7SA 1HNIB 2FQQB 4L6V3 2QO3A 1LWCA 1TVRB 1IKVB 4NI2B 3CCRS 2YQ3A 4ECRA 5T41A 4CO3A 4FF3A 1RAAB 2IPOB 4C3MA 4F4AA 4Y0FA 1N48A 3VQTA 2IMOA 2FJEB 2FLOA 4BLGA 1M1KT 4A8FA 2IM2A 1RCOB 2CPXA 4Q44A 1Q86T 1U24A 1ZOTA 1XK8A 4LSLA 3H98A 1NZ8A 3ILIA 1OPZA 3EJMA 4FPRA 3UD4P 1S9EB 4ZJOA 1RDRA 1K44A 5EGYA 1RT2B 4ED8A 4DL5A 2ACYA 3H42A 1T03B 3ENAA 2A1BA 1TUGB 2BEFA 1NB7A 4RUCA 1YJ7A 5ETPA 1ZH5A 3CD6S 3AJ2A 3I87A 3B78A 2ZM6J 2VHGA 3GIIA 4ED6A 2X51A 2E5JA 4CRJA 2RRBA 1FKAF 4IOCQ 2BJ3A 1HQEB 1EIYB 5L1JA 2CJBA 5C42B 2HNZB 4DV1J 1F6TA 1XJWB 1Y0HA 1WHVA 1HNZF 3DLKB 4LREA 4F0MA 2MZTA 1WHXA 2G9OA 4CO2A 3A3NB 1HHSA 1WTBA 2EC2A 4KB7A 2HS4A 4G1IA 2Y0BB 4WFAQ 4XK8C 2A2DA 2Q3PA 3JTPA 1MMNA 3SFGA 3FBBA 1FKPB 3BH7B 2JFKA 2V4RA 2XLKA 4DR6F 2WHOA 2CVIA 2I2YA 1NO8A 2MY8A 4KH1B 3KHHA 4RPFA 3UDLA 4ED2A 4C8OA 2LXUA 2KYZA 2FHKA 4P2MA 2VONA 1WHWA 1RYRA 3FCVA 4OX9F 2UXCJ 1NM2A 2IDEA 3UPFA 2K1RB 1YBAA 4MIBA 3RBEA 4I67A 2BJ7A 5B08A 2WVDA 3BPSP 4QOTA 3PYEA 3CE8A 2HEKA 4MKYA 4EGLA 3JS9A 2V6AA 4L74A 2AGOA 2V9KA 3TX8A 1S7IA 2YWEA 4EUVA 2OHDA 4M63A 3J7Z5 2FVQA 1RU1A 3T1YJ 5A2QU 3I0RB 1DFDA 1UJ5A 1C1CA 4B02A 3PX0A 5E3AA 2AZ1A 3GSDA 4XO0A 1C4CA 4DV3F 5KT5A 2J7WA 2BE7D 4CLKA 3POTA 4F0HA 3P5TL 1ZA2B 1VK3A 1WG4A 5KG7A 4XDDA 4OYMA 1UVMA 4YUDA 2I8EA 4QIVA 4KGMA 4Q8EA 3BDEA 2J6SA 2CQ2A 1NK4A 3PXGa 5I3UA 4QR2A 2ZD1A 2PFDA 4L73A 3U1NA 4HHUA 4FBTA 2J9DE 2XY6A 4LQ3A 3CVKA 2FDNA 2Q43A 2VFUA 1QAXA 2V50A 4I1TA 3K58A 3C2PA 3IM8A 3VCDA 2QSWA 1X0PA 4L76A 1SJ4P 4RW8A 2K7JA 4B9NA 3QWUA 1HHQA 1HQ2A 1F5AA 1IUJA 3AD9C 1FNXH 2W2PP 3NBPA 4WE1B 1LNQA 4U96A 5HQMA 5LT5A 3DFEA 2KHDA 4F7VA 2VPYB 4JV5J 4WKRA 4N47A 1RLCL 2R7OA 1U49A 3NS7B 4DR5J 4HACB 1EZZB 2HWHA 2XHWA 4CLPA 3C19A 3D7SB 1BE4A 1LXJA 3ETMA 3FVYA 2F9JA 2R7VA 3W5YA 4IH7A 4PXCA 2CA9A 4ECVA 4K5RA 1QVGR 3J7YI 3NWRA 2F63A 1S59A 5HANA 2ZWPA 3BR9A 3GLJA 3VGVA 1VQ6S 3HM9A 1H72C 3EPGA 3HHEA 3NAIA 4U67Q 3G8SA 2J6UA 4LF9J 3DDNA 4RO0A 4JI4F 1S99A 1VBYA 4NRUA 4W90B 4A8QA 1F3FA 4QR0A 2UXDF 3GFYA 2IM3A 2ZOGA 1RAHB 2MZQA 1P1LA 4BC7A 1U1PA 3CMAS 1FXLA 5HBMB 2YNFB 5L46A 5KFLA 1FF2A 1U6FA 2BJDA 2ZBRA 1Q8BA 4JI1J 4ZLPA 5GADI 3W1YC 2Z4PA 3FFIB 3NAHA 4AD6A 3D6FB 3K5OA 3PJXA 1I51B 3M6WA 1YVFA 4UW2A 3KLHB 5KFYA 4DQRA 1CULA 5KFNA 2YKNA 2HFUA 3AD7C 2AGQA 1FO1A 1I5OB 3FDSA 2K7KA 3D4JA 3Q23A 2YNHA 1TL7A 2C28A 4PWUA 2V8VA 4ZVHA 2N7YA 3JSMB 1A0OB 4RX6A 3R97A 2R7SA 2OPSB 2PEBA 2EEYA 4KAIA 1UA1A 2MKYA 4RU2A 4W98A 1CULB 2XYHB 3K5PA 2RH3A 3H20A 4YB6A 2JZ5A 1GQEA 2ZM6F 4OJHA 2EK1A 1IR0A 2ZDPA 4LBPA 1B0TA 4DV1F 1WORA 3M9NB 3Q89A 1VQ5S 2H54B 2L3MA 3BEGB 2KXFA 1HPZB 2UVUA 4USUA 1EX8A 1C1BA 1K8AT 1U6ZA 2C3UA 4ETXA 1NSQA 4QWCA 3V5RA 3KXDA 4OX8A 1S0MA 4E0DA 5KG0A 3NLCA 3OFHA 4NYPA 2VOOA 4G1QA 4LF4J 1RZMA 1HI1A 3Q8VA 2CUYA 3HVWA 1K73T 2YNGA 3HSDA 3R5CA 3WX4A 3OLBA 1X4AA 3K59A 3UDVA 3T3FA 3DLHA 2UXCF 1TP7A 1REVB 3D1OA 5DDRC 2V5HG 3TARA 2R8HA 1LWEA 4B9VA 5L9NA 3HDSA 2AT1B 2BUNA 4RW4B 1VHFA 1AUSL 1WI8A 2YKMA 3CJ2A 2Q6CA 3GQCA 2BE2B 1G3OA 4ILMA 3I0SB 3S7RA 4ED7A 3RG6A 4CCHA 4OI3A 1L3TA 1MROB 3PJWA 3IP0A 3HKWA 2WVFA 4USJC 2WAQD 3LPEA 1HL6A 3DM2A 1Q82T 3I4PA 1UJ6A 3KLVA 4DPXA 2VU5A 4V1Ak 5IV3A 3OTEA 2UXBJ 3R5AA 2YX1A 3ZZZA 1W26A 4A8OA 4YMEA 1X8DA 1SJ3P 3EXYA 1TQLA 3QRRA 2FB0A 3O1LA 3DRPA 2RQ4A 3NGKA 1VIOA 2MZJA 1VYAA 1JLEA 3D0IE 2VC1A 3PEJA 4RUAA 1MU2A 1LW0A 3W5ZA 4UOGA 3T41A 3KJFB 3HMJG 3MAHA 1RT4A 2NXCA 4ELVA 3OUYA 2JC0A 3T1HJ 2HZAA 3ULHA 2UUAJ 2XBPA 1UZHA 2FZKB 3LWLA 2V68A 7FDRA 1CJKA 1AUDA 1NJXA 2FJVA 2Q1LA 2DGOA 3PX6A 2ADCA 3AXKA 2MZSA 3IM9A 2V67A 4OZ1A 4X4NA 4P2FA 1TKXA 1VC0A 1N34F 1CQNA 1NK7A 3O2IA 2RQKA 3RB3A 3OFEA 2OGUA 1YITS 4BWMA 3D6TB 1WF0A 1VQKS 1RT4B 2YKAA 3OUYB 1ZTTA 3WHIA 1B7FA 1RBAA 2QTWA 2OO4A 3BGLA 4OQJA 2HBYB 4HHHA 4JV5F 9ATCB 2HRTA 2XMAA 5LMNJ 4DR5F 1RT6B 1YDLA 3GIMA 4I4BA 2RU3A 1RQ0A 1UMJA 4DX8H 5ETTA 3KG0A 4ZVGA 2VASA 3J7YU 1FE4A 2LDYA 2DNZA 1KTVA 3VZHA 5KFHA 2J6TA 2IDLA 1VQ7S 2NR0A 4DFMA 2DGVA 1VQ4S 3N01A 2DRAA 2DNRA 2KXHA 2I9SA 4N5SA 4Z7CA 3DNCA 1Y00A 4TVAB 5KT4A 3CWJA 5J2NA 2P5VA 2QL9B 2LQ8A 3U02A 2HHVA 1X5TA 3T6BA 4CM0A 2VA2A 2QZ8A 4NXMJ 3JQMA 3HVTA 2CJKA 1N5QA 4KR0B 5GADU 3E3XA 1BHNA 3GYXB 4CH1A 1N36J 2HK2A 2KG1A 3IBWA 4JI6J 1RWUA 4HI1A 2FZCB 2VQEJ 4JI1F 2DPJA 3BBCA 4ANEA 2XLIA 2ATLA 3HHNB 2GA7A 4DSJA 2P8IA 4PG4A 3W3SA 1P27B 2UV8G 4Y3CA 3BN7A 1WF1A 1BQMA 4JI2J 1CS4A 4GRSA 1VK8A 3MM6B 1YJUA 1S5ZA 3T19A 2H65B 4LF7J 4DL3A 4DN9A 4RW9A 2IBKA 1TV6A 5BYSA 4AFFA 1N0UA 2ZEJA 5KT2A 1OYDA 2EFPA 3QZ8A 3HHKA 3HVTB 1CG2A 2FUG9 3P4UB 3IWXA 1R0CB 1QSLA 5EX0A 4K4VA 2OP5A 1ZM3A 2AIRB 3CCQS 2ZH2A 2OMOA 2UUBJ 2GJFA 5IT9Y 4HLBA 4QIGA 1VR6A 3B4MA 3S6EA 1B0VA 3FZ2A 4ANCA 5B0FA 1FD2A 1XQIA 1JLQA 5K9FA 1KNZA 1S0NA 4AQYJ 2B9XA 1S9GA 3FRYA 5A8KB 3MGJA 1FRLA 4K4XA 1SB6A 4MK8A 3C16A 1JJ2R 3BV8A 4JI5J 3HHLA 1F9HA 2QFIA 4YY3J 1ZM2A 1TKZB 4DCPB 4JI0J 3CO9A 2DHSA 1S1VB 2DNOA 4HVZA 3TJ8A 2Z2YB 2A0FB 2PT0A 1JLBA 3I4HX 4EO6A 5KFSA 4N8NA 2KFNA 4LVOP 2RUSA 2JDJA 2EPIA 1RWPB 1UZDA 4DUYJ 1RT5B 5ETQA 1S9GB 1EJ7L 3IC1A 3D1HA 4KPCA 2H5IB 3X1LB 3SSSA 1UVKA 4C98A 3RB6A 3OBIA 1XNRJ 2W9CA 2I1RA 2HKEA 3IXQA 2E1CA 1R0AB 1WOPA 2G1HA 2HBZB 4DR1F 3OXFA 1O51A 3MR7A 3M32A 3QT8A 4F3MA 4BHQA 1JLBB 5EWFA 3PX4A 5KT7A 2M3DA 3TZWA 1MN7A 1FVSA 2ZH8A 4C8ZA 5HP1A 3GCXP 4V19J 3EZ5A 2AF6A 3KHRA 4ZCKA 1LWFB 4KH0B 1R6VA 4FPIA 3RBXA 2JLFA 4QPTA 2UXBF 3R3TA 1TFWA 1JLGB 2C42A 2HK3A 3HSGA 2BM0A 4LF1A 3I5AA 1XMBA 3PR5B 3UCZP 5HATA 5H9FK 3TNVA 1G2EA 4IFYA 5EN1A 5IWAJ 3AJDA 2ERRA 1T9YA 1YWXA 3NP5A 3T1HF 5KFDA 1S48A 3QIPA 1RA7A 2FYXA 2FVRA 2UUAF 4AUKA 4OYXA 4NL5A 1TK8A 4B9SA 1JQGA 2DVIA 5E0OA 3J7ZT 2FJXA 1IBMJ 2J8AA 2CZ9A 4DX6A 3M6XA 5HO4A 3ELHA 4Y28C 4J9SA 4CO1A 2IMWP 1RTHB 2HHUA 2DTJA 2WB4A 1X4FA 4WFBQ 1FT8A 1PILA 4OX6A 2M2BA 4IFYB 3IG1A 1Z4UA 4IDKA 3HHLD 1N5SA 1JJHA 1FWKA 4KGVB 3ZO7A 4RZRA 1QTMA 3H59A 4DQQA 1KSPA 3G6YA 3IS9A 3G6XA 1EAYC 4F4XA 2ZFHA 3DLBA 1WWHA 3GPAA 1Y4ZB 4DZDA 3PO5A 4CO4A 2EFQA 4P7TA 1L3KA 5LMNF 1NUEA 4ED5A 1SC3B 1RTJA 4ZCLA 2PO4A 2CQ3A 3G6VA 5T7LA 2AJ1A 3PKMA 3RRGA 2RIJA 1SKUB 1TL4A 2PMHA 5IM0B 1YX2A 1F1BB 1FCAA 1KP6A 5HN0A 2Z58B 2XULA 4NYZA 2DXFA 2ZBCA 2DNGA 3OTCA 2CFXA 2XS5A 1QTNB 2GW8A 2H5EA 3CC7S 4C4WA 2VJUA 2ZNYA 4CLWA 2KRRA 2Z8QA 4NXMF 5CYJA 1GFWB 3HZEA 3OT9A 3V2UC 1FNMA 1JIHA 4OX7A 5CYQA 2HYIB 1N36F 4YN3B 4IOAQ 4ECWA 2WW8A 3A3OB 4JI6F 3K5LA 1NPKA 2VQEF 1DARA 4ED0A 2LEBA 3MPUB 2V4JB 2NPFA 4LF6J 3N9UC 4EBDA 2E5LJ 3MAAB 2N82B 1RKJA 3A8JA 4LF2A 4LF7F 1T9UA 1IQZA 4FYXB 1GX6A 2RS2A 1QE1B 1SC4B 2MLYA 2E9RX 4IOBA 4LF8J 4QU6A 3OQ2A 1S1XA 4KGXB 2N3OA 3EE3A 2UUBF 1HWIA 1WOSA 2GVZB 2IYGA 1DLOB 2HVIA 5CA5A 4ICLB 4DEZA 1SJ1A 1Q0NA 4CP5A 6FD1A 3T9NA 2ROPA 2B56A 4A4JA 4IG3B 4U7CA 3M2VB 1EKSA 5F0WA 2MZ1A 3D3BJ 2R7QA 2DGTA 5G4DA 2DEIA 1D9FA 2WVCA 5L1KA 3VAJA 4JI5F 1X5PA 4EYHB 3TZZA 1SH3A 3OW2R 2D9OA 3TJAA 4BCAA 4JI0F 4PQAA 5I4MA 3HHLC 1JKHB 5HSPA 4DV2J 4PPDA 1NDPA 4I2PB 3LGNA 2AYBA 3EM1A 1U6BA 5GMEA 2DNLA 4GO5X 2GFFA 4CTAA 5MAOA 3DU6A 1UVNA 3UE2A 2DHAA 4DL7A 3K5MA 1YTYA 2U1AA 5H9EK 3QGPA 2F8EX 1RT3A 2YWFA 3MFHA 2IVMA 4GC7A 2AJ0A 4DUYF 3R6GB 2VDHA 5C24A 3TUZC 2CPIA 3D9BA 1YJWS 3HT0A 1X5OA 4ER8A 2N4DA 2W01A 3I9ZA 4ZPVR 3L3CA 3G87A 5H1SV 2IM0A 4NLVA 4RW7B 1XNRF 1GMWA 1FRHA 2HZCA 2M70A 2D9PA 3MCSA 1T9TA 5A6WA 1KRPA 4QJVA 2AW0A 1HMVB 1B70B 2OLWA 2DIUA 3BM7A 1BC6A 4P9SA 2WB1D 3TANA 5KFUA 2DR5A 3QIDA 4B9UA 3JB9k 9RUBA 3WIUA 3C6UA 1Q16B 2RKIB 3K2YA 3KNAA 3NNAA 3LO3A 1A7GE 2H48B 1NHVA 3ZNUA 2W7OA 1DQAA 4MAKA 4JV1A 4ES2A 3TOQA 1UP1A 2W9BA 1FJGJ 2E29A 3I56S 1UW9A 5IC4B 1WC3A 2GCFA 2EK6A 4HDHA 4Q8FA 2AKWB 5D3GA 1OSDA 2ILZA 4DL2A 4JI3J 5IWAF 2HQ3A 1NPPA 4ZK7M 5K8OA 2HFSA 3THTA 3DLEB 5FJ4A 5HL7Q 2RF2B 3W66A 3C14A 2GX8A 2JEIA 2UVVA 4YS2A 1F60B 4LR7A 4NCGB 3I96A 1IBMF 3FZBA 1KLNA 3SQGB 4WYWA 2V9WA 2CQIA 3MECB 2I6WA 2DGUA 2F3JA 3M1VB 3DOLB 1WOOA 3M8RA 3EUNA 2MLZA 1IKWA 1XMOJ 5ETVA 2KJVA 4W4MA 1HHTP 4FVMA 3L7OA 2BJ9A 2ZC3A 1T05A 1VRTA 1M5VC 3AXMA 1BQNB 2F7VA 3R5GA 1PCAA 3EMTA 5CD4A 5GAGI 3U7JA 2W2MP 4ZITA 2HURA 3N28A 4DS4A 2BANA 2ZOMA 2LU1A 2EG2A 2G0JA 2O5DA 1QY7A 2BE9B 2MQLA 2XO6A 3VVUA 2GQ2A 2FHOB 3N6MA 2UVWA 2MMYA 3LF0A 3DRRA 2LQ5A 3EWGA 3IGVA 3MPYA 1RTDA 4TKTA 3AB4B 4KKOB 1S1TA 4M94A 4O3SA 3KTQA 3GV7B 1EP4B 5EHHA 3W2WB 5D8HB 4QU7A 1JX4A 4G65A 3ITHA 3W2VB 4ZPWR 2XMKA 1N32J 1M5SA 2OEKA 3TZXA 2F65A 5E5NA 1RT1B 2BJ8A 3NCPA 1DTTA 5A8WA 3MEDA 1IKXB 1YJNS 2H9ZA 2VICA 1HNVA 1N6QB 1YRXA 3VAGA 2HWTA 2KB2A 1K1SA 3BPDA 4LMZA 2HHXA 5AE3A 3FCWA 2KZMA 1VBXA 1FK9A 4EK2A 3CNQP 2D1CA 2V8HA 4LF6F 2XYPB 5AJ3J 2NYHA 2E5LF 1XIQA 2CQGA 1UCNA 1TR0A 3H5XA 1VQOS 1Y11A 3OXGA 3L09A 1X4CA 3D6MB 4AXJA 3OD2A 2GO9A 2HLUA 3UD3P 4ZVRB 3BZQA 3HCXA 4YEAA 1GTEA 2EI5A 2B3TB 1NBEB 4K2JA 1S72S 3V6DA 2XI2A 3DOKA 2CADA 5DDPC 3BGRA 2NCKL 1FK9B 3D68A 1QM9A 2KO1A 3G82A 1YIJS 1FRXA 4NPOA 4N8OA 2F8MA 4FVCA 3L95X 4C3LA 4NLDA 2A6MA 3KK1A 3KMQA 3K57A 5M2PA 2B7BB 1SI9A 4EZ9A 2YBVA 3CUNA 1FFWB 3NRBA 1YLXA 3M7VA 4PAAA 3UD5A 4DV2F 4LFBJ 1NNDA 1TL3B 3NGTA 2COLA 4DR3J 1FHTA 4UOFA 5RUBA 5KT3A 1K0VA 1HYSA 3PZPA 4DOZA 2HG4A 2QMWA 4C6AA 1U0HB 1R31A 2VPXB 1I94J 1SQFA 4O44B 3CW2C 3MPDA 2B9WA 1VBZA 2R2TA 2FJWA 5I42A 3KK1B 4ED4A 4B3MJ 3QSYB 1T3NA 2XMUA 2ASJA 4LIWA 1G6BA 4WFXA 2XG8A 4FKXA 5A6PA 1UA0A 3CCSS 4PG5A 1H2TZ 1CJVA 4EBCA 3KLFA 2OD4A 1IR2A 2RE1A 4DPUA 3KYLA 2HGMA 5F8NA 2W4DA 1IKYB 1IM6A 3PHTA 4QZVB 3O5TB 1WJ9A 4WFYA 1B99A 3GSIA 1NJYA 3CD7A 5I42B 2WSEC 3MEEA 1WKKA 4ID5B 1PG5B 4F4KA 1KQGB 1UFKA 4ZDNA 1FKOB 5IOLA 4PQUA 2ZH7A 2HWIA 3GYGA 1T11A 4O3PA 5D0HA 3O6QA 3JSYA 2QG9B 1FJGF 5AXMA 4DMZA 2KZZA 5T14A 1SL2A 2ASDA 1YJTA 2CNOB 1H38A 1U1NA 4ZCMA 2NXJA 4DUTA 4JI3F 4OHYA 4WU2A 2V34A 2RILA 4K4UA 4H4OB 2RMLA 1FNOA 2FGOA 1RTIB 1S77D 4FS1A 1I6JA 3F0NA 1FJCA 2K06A 1PAUB 4QW9A 4GVBA 2HFVA 2QJ3A 3OVSA 3M8YA 4KHMA 3HJVA 2PSZA 1RHQB 2HPUA 4I56A 3JAMY 3KDNA 4K2XA 4OJGA 1TZ0A 4LBIA 3VGSA 5BYRA 4ECSA 5DG9A 1ULRA 4L3NA 3A1YG 1J5OB 1XMOF 1WHYA 4ZHRB 3G8TA 5GAGU 3QO9A 1R8CA 2MKSA 4HEA9 4DXLA 1S6QB 1V5VA 1R3NA 2V2VA 4KFBA 1VOMA 4URSA 4OZ3A 4RJVA 4AYBD 6AT1B 4QYZJ 4USHA 2C22A 4ZJQA 2JJ4D 1T8EA 3V81A 1JMTA 2HLTA 3VGUA 4YDDB 5DG8A 1S12A 1TL1B 3H2LA 3PRDA 1IJFB 5KG4A 1C4AA 1EQMA 2J0XA 3M2UB 5F3ZA 1IBLJ 4Q43A 4KJIA 2PIIA 3ZZOA 2GMJA 2R8IA 3KUGA 3IO1A 3QO9B 3NS5A 3OJUA 2AZ3A 2X1GA 2V2QA 1VQSA 2RDDA 3M4XA 4WTOB 3RAMA 3DGVA 2QLJB 5IT0A 2EFOA 2RU9A 4JP8A 2FC9A 4DR2J 3W5XA 2V4QA 4OZ0A 4G1PA 3MDFA 5DGBA 3HFKA 2K3KA 2ABYA 2JNJA 3GIJA 1VGYA 4ILLA 4KT0C 1DQ8A 4ALZA 2J0QD 4Z37A 1JLCB 4ECQA 2GIRA 1HQUB 3VAMA 4LRBA 3CJTA 4M5DB 1SKRA 4WZMA 1J2VA 1RAJA 5AJ3F 3SSRA 2OPQB 2YXLA 3A3PB 4KSEB 3VR1A 2XI3A 2OTLS 2W4PA 1TAUA 4F25A 3OL9A 5L8RC 1KOOA 1SV5A 3TAMA 4XIUA 5F0UA 2V8GA 5AXNA 2RDJA 4Y2KA 1RWKB 1NZAA 1XN9A 1M1GA 3LP0A 1U1QA 5B09A 4URQU 2B43A 4P10A 1SCJB 2V8DA 3T5LA 2BKOA 2AYGA 1VJWA 2VQFF 3OPKA 2BJEA 3EDQB 1Y5IB 2GIQA 2GMHA 3CPWR 2JC1A 3SXLA 4RKUC 2GGPA 1N56A 3QLHA 2D41A 2KVIA 4ZVUB 5D0GA 4WFNQ 1C0TB 1N8RT 1AW0A 2ZE2A 3A8IA 1HBOB 3BSCA 5KFRA 1HW8A 1X60A 2NXUA 1S1WB 1CSJA 5F3TA 4LBHA 3NWGA 4NRTA 3ADAC 2DHHA 1HBMA 2FLPA 1E6YA 3BS9A 4LFBF 3ISZA 4LJMA 1OWXA 5IT4A 4DR3F 2K3IA 3N0VA 1Q5VA 1X4DA 1I94F 3IWLA 2IC3A 4B3RJ 3MM5A 5HMXA 4OHVA 3EGNA 4C8NA 3E8OA 2AU0A 4B3MF 3AOBA 1Y5LB 2E9ZA 1KQKA 3PYGA 3BBBA 2D3OR 1R7IA 4ZPCA 3MM8B 2KG0A 3CTRA 4FXVA 5U47A 3I55S 2HGLA 4U8YA 3LP1B 4MKAA 2MGZA 3PIOQ 5F8GA 5F9NA 1QAJA 2GAHC 2DRDA 4B08A 5KG1A 3UDCA 3E01A 5D0EA 2SXLA 2PA8D 3UNGC 4LR8A 1N5YA 2AV5A 5LL6d 3NOGA 1QUPA 2V2KA 3IRXA 4NMXA 2DGWA 2IC3B 1VC5A 1WNEA 2JHEA 5J2PA 4FNIA 4HI2A 2RD5C 3BB5A 1SUQB 3VALA 5JVHQ 3JSRA 1UPPA 5DRKA 4YR3A 2B7CB 3VZIA 4DV5J 2OUGA 3AH6A 1IWGA 3W9IA 1DHMA 4ZJLA 3MPWA 4NYOA 3A8KA 3QGIA 2WSCC 3JYTB 1N5YB 1PC5A 1NJIT 5HLFB 2MY7A 3MMCA 3IRXB 3CGIA 4AT1B 1H74A 5CQGA 4MIAA 2WONB 4WCEQ 4ZVPB 3RRKA 1SKWA 3MM7B 2QMUB 3GV5B 2AQ4A 2J76E 3WQPA 5C2CA 2KT5A 2DYAA 3MD3A 1U2RA 5K8MA 1NLKL 2KRBA 3I31A 1OIAA 4C11A 1DTQB 3P96A 3R5JB 2HIQA 2DO4A 5C2GA 4DBQA 1FXRA 4UY85 4OJ1A 5J2MB 1NDLA 2BQRA 4IR1A 5HMZA 4C0HA 5E2QA 3NEKA 4QYRA 3R27A 1RXOB 1WKLA 2IBOA 1S6PA 2HS3A 3NGRA 1WI6A 4OYPA 4DL4A 5KFCA 2EW9A 1KLMA 2IHR1 4I0WA 1FVQA 1KOHA 4CT9A 3JAMU 1U8WA 3RB4A 3RW6A 2F1FA 4ES1A 3Q8PB 2VDIA 5C25A 4D3HA 3FBFA 3NGUA 4QQBA 1IBLF 2Y0SD 4PEOA 2QL7B 4NE9C 3FBEA 3DRXA 4A47A 1LXNA 2B6AA 2FD2A 3OV7A 1N5TA 3KG1A 1HBNB 3N79A 2DXEA 4NX9A 6FDRA 3R8YA 2HMIA 3VWSA 1C0UA 2C2OB 2JWNA 2P2CB 1WUUA 3GJRB 4DR2F 4I2QB 4CH7A 4QPXA 3RAXA 2AJ4A 4NLPA 2LECA 2ZHBA 1WDTA 2BA9A 2OPPB 1VQNS 2OI2A 4NA2A 4F3QA 2P9CA 4K0KF 3DXSX 1RLDA 1PAEX 1HBUB 2GO8A 3LAMA 1EETA 3QT7A 4NLUA 2EKYA 3R1LA 4PUOB 4S0MA 4YB7A 2HQDA 4ZS6A 3IN5A 4IR9A 2QMXA 2V0NA 2VG7A 2CJAA 2BKNA 3T6JA 4RNHA 4BDPA 2ILYA 4OZNA 3LWMA 4LVNP 4NMLA 4DG1A 4NASA 3MMBB 4XPCA 5CAAA 2QIFA 2A18A 4P2XA 2DT9A 2XEXA 2BDPA 5IS2A 1NSAA 3BF4A 5ETLA 3W9HA 3QPIA 4ZPBA 5KFVA 3RJMB 2C3YA 2CQPA 4MIWA 3SIPB 3MI7X 2HBQB 1N88A 1LW2A 3NMAA 3DI6B 4Y6IA 1FE0A 2J5AA 1OS5A 2HSEB 1D3WA 1V3RA 3DMJA 1P9QC 1Q78A 1QUVA 2GV1A 2NXNA 3MCOA 4M5LA 1H6KX 2HRYA 3J80Y 4GO7X 1SJFA 4LFCF 4QIWD 1SH0A 1TU0B 3D1QA 3W8PA 4ZKAA 4EYIB 4KE5A 3DRSA 4HH1A 1CJUA 2KL8A 4PKDB 2VKRA 1JLAB 1VFJA 3BSNA 1UWBA 5KG2A 1UJ4A 4TU7A 3MCMA 1U1RA 3I5CA 1Q95G 2VV5A 2C2EA 2FC8A 2B8PA 5HROA 7FD1A 4Y00A 1LWCB 1H2UX 3K0JA 4B3RF 3VQSA 2AD9A 5JMNA 4IRCA 3J81Y 4DWIA 4BBYA 2LVWA 3RR7A 1AT1B 2CPJA 3RRHA 1YRTA 3GMGA 1Q7LB 1J5EJ 2E1RA 1CJUB 1KC8T 4M5MA 2F9DA 3HT3A 2AHOB 3MMAA 5KOWA 4G3IA 4X2BA 3BGOP 4KPYA 3AOCA 1P1TA 4LSLB 4U8VA 1YJVA 5HVGA 3AOAA 4LRDA 4NZ7A 4CDIA 2MSTA 2YTCA 2HFOA 2DNKA 4KRWA 3RW7A 5HROB 5J1PA 1BD6A 1T02A 4KIAA 3OHAA 3PKYA 3ET6A 1E6VA 2ZNZA 5IZHA 4R5PA 2PI4A 3BJYA 3CJ0A 1NB2A 1S76D 2OSQA 5MLCV 3TO8A 1FTRA 3DU5A 3I9V9 3KK2A 2M88A 2XSFA 4EZ6A 3SDEA 2XSJA 2OELA 2VKZG 4ZP8A 4DSLA 4ZCIA 4DV5F 1KVKA 2JSXA 4FYWB 2IVYA 4DSKA 1N4LA 4ZLNA 4YDXA 3C3LA 1P6TA 3GILA 3PTWA 5I3QA 3GJQB 1R8BA 2DGSA 2C2ZB 3KLGA 2HBRB 2V63A 4USIA 1QVFR 3B4DA 3HI9A 2LXFA 2KU7A 2W2NP 1WC1A 2OH2A 2KFZA 3D3CJ 3FK4A 3PJ9A 2PC6A 2I5JA 1PYSB 3L4BC 2QA2A 2PI5A 4I6WA 3MPVA 4PWDA 2Z2LA 2X7IA 4DQPA 5HJYA 1JK9B 3BO3A 3F41A 1X4EA 1V6HA 2IA6A 3IAS9 1NKBA 4OZ2A 1KDNA 3Q0AA 3B8HA 4MKBA 3P5BP 3SCKE 3KLGB 4DPOA 2XZWA 1X4BA 4J9KA 5DQHA 5LXRA 1RWXB 3IMQJ 3GONA 4IYQA 3I32A 1F9EB 2I5JB 2KT3A 4PPZA 5DZ7A 2AGPA 3GFHA 2EVZA 3ZZYA 5KFOA 2PEHA 3NMRA 3FKBA 3EZUA 4JOUA 5IC6B 3TWZA 5KFWA 5E41A 3H4BA 3MM9A 3G9CA 4KO0A 1RJJA 2XY5A 1URNA 2MQMA 1Z2LA 3GTYX 1BGXT 1C1CB 3PYDA 4F3OA 3UQSA 2LMIA 2GMLA 1N34J 3DOMA 4DV6J 3HD2A 5SZTA 3POTB 3GB0A 2FHJA 3MUTP 3PW2A 2VPWB 2OSRA 4O0NA 4J91A 3KDOA 4DL0C 2FGCA 5G0RA 1M5HA 1FRIA 2DY9A 3IBCB 4OZLA 5I3UB 1S0VA 1R0BG 2GAGC 4TY8A 2ZD1B 4P6QA 1NKCA 2BW7A 2VBYA 1YQHA 2L9WA 3MM9B 1P8GA 1T7PA 2X1AA 1T9VA 5ITHA 4WTYA 4J90A 4F50A 1WSRA 3MR5A 1CJTA 1D9DA 1RE1B 2BOPA 3IR5B 1Q79A 3CCMS 4RW8B 1ROFA 2ZH6A 1OY6A 3OR1A 3US5A 4UF4A 3UO0A 3CJSA 1YK9A 5EX3A 3PW0A 4L3KA 3Q86A 3NBPB 3Q8RB 5B0BA 5C7PA 2DNYA 2IIHA 4M5GA 5G0RB 3GP9A 4NEYA 2G0IA 4U7UD 4EBEA 4FNHA 3V4IA 4JI8J 5KFAA 3ZTOA 1ZPVA 4DL6A 1RK8A 5KT6A 1NHUA 4KV8A 5JUMA 4F0KA 2KFYA 1VISA 3C6TA 1HFEL 5JJBA 1IN0A 5D77A 2IAJA 3KLIA 3GR1A 2W7PA 3SQOP 2ZZTA 5KFBA 1RAEB 4ZVOB 2XWYA 4OI1A 4JV2A 2VG5A 1OSCA 4NLQA 2DNPA 3H2UB 1WTFA 2UV8A 3DKDA 4B3OA 4LUBA 2W8LA 2ZKUA 2PE8A 2QFJA 4OZ5A 1Y3JA 3D0HE 4CYUA 1WEXA 2GQQA 3BO2A 2BQUA 1L3UA 1YHQS 5L38A 4O4GA 3J80U 2IAJB 2R2UA 3TUPA 2ZZNA 2R7RA 4TLQA 3CJKA 1J5EF 1OY9A 1ZPWX 3S8SA 4F26A 1TKTA 5KTQA 4RNFA 2D7SA 2PMZD 2YKNB 4A8SA 2OMLA 2KI2A 4LRCA 3D66A 4FF2A 5FIIA 4B3OB 2DITA 2FHJD 3ZTPA 5GMKa 1HA1A 4IQXA 1LEOA 3AHPA 1LQ9A 1REGX 2VH7A 3QBCA 1UEKA 2YNHB 1TL7B 3TR5A 2BRKA 3FGVA 4M5NA 4P71A 5THWA 2RDIA 2RUGA 4GC6A 2PDAA 3A12A 4LSNA 4O4GB 3J81U 1X0FA 4A8KA 1PO6A 2L08A 3GIRA 2LEPA 3HVRA 4EFAC 4WF9Q 5F9LA 5DLGA 1TKTB 3R7BB 3M8PA 4CNZA 3PV8A 5AT1B 3DLGA 3TA2A 5KFMA 1KKHA 4MKVA 1GNKA 3NOCA 4IG0A 1XR5A 3M2RA 4GKKJ 2A6OA 2ZH4A 4C97A 5BXIA 2Q6BA 5B7WA 1S1UA 5K14A 4DDFA 4UOCA 4X4VA 3HULA 2DD8S 2HQCA 2Z30B 1C1BB 4DR1J 4HYKA 1OYEA 2CRLA 2WOMA 3EVWA 1Y3KA 2YH0A 5J1EA 5LSOA 5D78A 5CCLA 4B3TF 4P74A 1N54B 5CCMA 1HI0P 1DRZA 2MQOA 2MPUA 2JEJA 3NL0A 4M95A 4NZ6A 2HS0A 3E2EA 3ZFVA 4G1QB 1CC7A 2YNGB 3M2RB 2UUCJ 3LH2S 4I68A 4RU9A 5K14B 5JVGQ 1GK8A 1IJEB 2PA3A 2ZBQA 1VRUA 2E7XA 1LWEB 1TUVA 3EPIA 2O01C 4F8RA 2KVQE 1WSVA 2YKMB 1IBCB 3Q8QB 1HWJA 3BSAA 2ZJRQ 1ZAVA 3HK2A 3M8QA 1IVZA 1JLFA 2DR9A 1U0SA 3DM2B 5KOXA 1PGZA 1F5BA 2CWKA 1EARA 2ZITA 4OFZA 3RYLA 1NPRA 4NLOA 4E98A 4P52A 3TA0A 4UY8T 2J0WA 2IRUA 1T95A 3KJNB 2F40A 1HLWA 3ZNJ1 4QWDA 4DV6F 3DRPB 1JLEB 2ZHOA 3DLJA 1MU2B 4Q0BA 1LW0B 3NS6A 1Q1KA 2DK2A 5LSRA 1NXIA 3M8QB 2QYCA 1FA0A 3CDAA 1Q8IA 1CJKB 3AFGA 1RT7A 2IRYA 3H4DA 3SI8A 2HAFA 1H3DA 2CIMA 4E8UA 1Y9OA 4XPEA 1TKXB 5DLFA 3CD0A 3UR3C 4A8MP 5L9XA 1OQ6A 2PFFB 3PCOB 2L9DA 3U27A 4LF5J 1B4SA 3RBDA 1D8ZA 2LQBA 2BOAA 4TNOA 2QGFB 2YPZA 2CNLB 4WK3A 4P75A 4MFBA 3QGGA 2P9GA 2JFDA 1OQ3A 4JI8F 3V6HA 2OFHX 2LLZA 2LCWA 3KHLA 1HD0A 3GJSB 1RAGB 4OYIA 4ENOA 4NA3A 1BWEA 1JB0C 1AB8A 1YRUA 4WIIA 4Y2CA 4KHRA 2E44A 4TXSA 1IR1A 3PACA 5CYMA 2J9CA 4Z2XA 1M1HA 1HW9A 4DPTA 3IFEA 2MDAA 2VG6A 4WXOA 4R8UA 4R0JA 5J2NB 3G8QA 3JTNA 3IWNC 4EEYA 3E51A 4MFBB 2OD6A 3UW1A 1SPBP 5DETA 3UVJA 3HXMA 1BY9A 4MJKA 3MEGA 2OAUA 1ELOA 4BWJA 1BLUA 4I7FA 1C2PA 1NRKA 1WC4A 2B9YA 2YWGA 5A0YA 4ED3A 4PCQA 3VAKA 2ZH3A 3D28A 2MKHA 1N52B 3OSNA 5CYMB 1G7CB 2YQ0A 2I38A 2QT7A 2XZDB 1BQMB 1W7WA 1CS4B 2E5GA 4Z7YA 1HWUA 3BGFA 5AE2A 3C15A 3JXOA 2CNNB 3IR6B 3V4MA 4KQZA 4RW9B 3UVJB 1TV6B 1RWOB 1F5CA 3P6YC 3T5KA 2AEMA 3TEGA 3MURP 2B5JA 4ZOSA 3EGZA 2LA6A 1PYOB 2VBZA 2HVEA 3SSQA 1CPZA 1CC8A 2HQGA 3G71S 4J9LA 1HNIA 2BR0A 1UWAA 4DSEA 3H90A 1TVRA 1KS2A 1IKVA 4NI2A 1TKDA 3A4TA 1PJ7A 1ITPA 4M5HA 3HFVA 3DCAA 2UP1A 3MEKA 2G2OA 4X4SA 1WC6A 3D67A 1JLQB 3UN2A 1A6LA 4U95A 4LT6A 3FNNA 1B64A 1R8PA 5M2UA 2B51A 3C16B 3ZZPA 4GKKF 4CT8A 4LSZB 1S9EA 3HHLB 1WACA 3PRVA 1GEHA 4K4ZA 3KKFA 3UCGA 1RT2A 1RWWB 2HHTA 1T03A 3QT5A 4RL1A 5ETMA 4A8WA 2D3UA 4RBTA 2IA0A 3KNGA 5K5MA 1Y5NB 2OEJA 3FEZA 5KG5A 4F02A 2CZ4A 2CQBA 3OLAA 2RQCA 3KLEA 4C3KA 1XR7A 2JL9A 2PD1A 3CJ5A 1U7LA 4OYZA 1TK0A 4NZ0A 2UUCF 3CCUS 1HQEA 3V6KA 3MCNA 2A2CA 1S4EA 4RUHA 1WC5A 5C42A 2HNZA 2BACA 4IQMA 2WVEA 2FJBB 1HWLA 4O23A 2W9CB 2CDRB 3DLKA 4JB8B 4JV0A 1VC6A 3M9OB 2DIVA 2QE5A 4FBUA 2FPHX 3M32B 4WXWA 2XM3A 1KD1T 1NK5A 1KFSA 1WF2A 3W8GA 1F3VA 5DQGA 1NK8A 4X4RA 2C3PA 4ZVEA 5HP1B 2JEGA 3DGPA 4KGZB 4RNOA 3KLEB 1VHIA 3H5UA 4OL8A 1FKPA 2LQJA 2QN6B 1VS3A 1Q4RA 2RJZA 2GHVC 4AXIA 2R7WA 4K59A 1CQMA 1KWMA 3AA8A 3MTKA 1JNRB 3IRWP 3RGIA 2CPYA 5KFFA 3JSBA 1WKJA 3WZ0A 5KFTA 5FDLA 2K1RA 5HI7A 1LFPA 1U8SA 2AX0A 2AYMA 2RS8A 1O6XA 2RSQA 3SMZA 3QIPB 2G13A 5HMYA 3DGPB 3GFZA 3N5BA 2PMWA 4YOEA 1NDCA 3M30A 3MHYA 3M9MB 3UNYA 3KK3A 2IYIA 2ZOFA 3QNWB 4YR2A 4EO8A 1Y10A 3I0RA 2R42A 1V3ZA 5ADZA 3M8ZA 4C8YA 5CZXA 3CCZA 4PABA 3AA9A 2OPRA 3SFUA 3IG1B 2DEJA 4LF5F 4IDKB 5FDLB 3C8YA 3L9ZA 2DKOB 2WCXA 4QWAA 4WPAA 2OEMA 1D09B 3JTOA 3IS9B 3PM9A 3MFIA 2Y8WA 2NXEA 4ANDA 2BYCA 2D74B 3TVYA 2DBBA 3DC2A 3WC0A 4PWWA 3FBCA 2FY1A 1RTJB 2KM8B 3M30B 1FRJA 3UCUP 3CT9A 4F4YA 5L1IA 3KK3B 2DB1A 4X84A 4C8MA 4ZPTR 3CD5A 3TUJC 5T7LB 1NJZA 5IQQA 3VVTA 3CJRA 1SIZA 1EQ0A 2OPRB 5B0GA 2IRXA 2Y1JA 3NCRA 3QAUA 2ALZA 4N56A 2XLJA 4N77A 1AFJA 1T9WA 3MTJA 5CZVA 4P73A 4WE1A 2J7UA 2FIUA 2ZBIA 3AB2B 3TQEA 4U7UK 3WDOA 4C48A 4NWBA 1D0EA 4HACA 4TYBA 3R2DJ 3UI3A 5CYQB 2K8GA 2PGCA 1Q8LA 3NKYA 4DR4J 4L75A 4ECZA 4FKYA 1T94A 1YG0A 4P72A 1S7HA 3D0GE 4GMKA 3FQLA 3HHDA 3KUEA 5HVHA 3LQVA 2GC8A 2B0GA 4WP8A 4KHPJ 4HHJA 4F36A 1VCTA 2WK4A 4HH0A 2CG4A 3N4WA 2QYGA 4U6PA 4USKA 3IBFB 1X9WA 2WBRA 1RGVA 2Q66A 2ROEA 4F04B 2NSBA 3GZ7A 4CLYA 5BR8J 1I1GA 3W9JA 1OMSA 1FRKA 1IM4A 3VV2B 2F5GA 2FHMA 3RZAA 2DXDA 1JJ4A 2H1YA 3WC2A
chains in the Genus database with same CATH topology
4PEOA 2IDLA 2G0JA 1S12A 2G0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PEO A;  2IDL A;  2G0J A;  1S12 A;  2G0I A; 
#chains in the Genus database with same CATH topology
 3EGW B;  4NOH A;  4PG6 A;  1RAD B;  5HBM A;  4O0I A;  4DSI A;  2YNF A;  1S1X B;  1ZM9 A;  3AQO A;  5IT9 U;  1XER A;  2ACM A;  2CQC A;  2CQD A;  3MOZ A;  5F8J A;  2J9E A;  4HT7 A;  3LGH A;  3FFI A;  4DI6 A;  4O3O A;  3X3U A;  1R43 A;  4B9L A;  3KLH A;  2MJN A;  3D54 A;  5B0E A;  3TA1 A;  2F4V J;  1Q7Y T;  2MQ8 A;  2ZZM A;  1VIX A;  1RYS A;  1RWM B;  3H8Y A;  4HL9 A;  5DS7 A;  5HJX A;  4CLS A;  3RTV A;  3ILL A;  4X65 J;  3CJ4 A;  1URR A;  4Y65 A;  1ZZF A;  2C2D A;  4CIO A;  2YVS A;  4F4W A;  5LXY A;  3DDI A;  3RB0 A;  1BMQ B;  3JSM A;  2Y1L B;  5HAO A;  4K50 A;  1ZZN A;  3SCJ E;  3BQ2 A;  2OPS A;  2FLN A;  2QLW A;  4CTA B;  4ID8 A;  3C66 A;  2JEF A;  2KKH A;  3T1A A;  3HZG A;  3VTI A;  4ZVF A;  1ZET A;  4RR5 A;  1HAR A;  1HD1 A;  2DR8 A;  1RT3 B;  2IFX A;  4DCO B;  4F67 A;  3QSI A;  3R6L B;  5C24 B;  2HFZ A;  4NXN J;  3GYN A;  4EWT A;  1VQP S;  4B9T A;  3KMS A;  5E3P A;  3AJ1 A;  1YGY A;  4KYZ A;  4UZC A;  1UW4 A;  1TK5 A;  4DCJ B;  3HP6 A;  2RHS B;  5IFM A;  2C1E B;  4I64 A;  1HPZ A;  1X9M A;  5HVF A;  4K7Q A;  3IA0 A;  3P8B B;  1FD8 A;  2D3Z A;  2R8K A;  3BRE A;  2CKW A;  3OTO J;  4CLF A;  2DNH A;  2QRR A;  3L7U A;  3HX9 A;  3MOJ B;  3GCW P;  3ONQ A;  4K4Y A;  2NZC A;  3FSY A;  3Q22 A;  3EVM A;  4X4P A;  3C6U B;  2XGQ A;  2F8H A;  3MUM P;  3WIV A;  2NUU G;  2FJA B;  5DZ6 A;  1APS A;  1UET A;  2VFS A;  1LV5 A;  3L7P A;  4J37 A;  1A9N B;  4DX5 A;  4JYA J;  1ZBT A;  2E7W A;  2YX7 A;  3H7H B;  1PYT A;  2ZKT A;  2QSF A;  4MT1 A;  2W9B B;  2CDQ A;  3GWC A;  3LOU A;  3SCI E;  4OI4 A;  5E7O B;  1SQE A;  4LRA A;  1AZS A;  5KFJ A;  1N33 J;  4TN2 A;  4J5O A;  2CQ0 A;  4ZIV A;  3CCJ S;  1REV A;  5D3G B;  2ASL A;  3OTB A;  1QLN A;  1K1Q A;  3UFC X;  1EHW A;  3P3D A;  3MWB A;  3CCV S;  4RW4 A;  2XMM A;  2AX1 A;  2W9A A;  1FDA A;  1FEH A;  3D5M A;  3C14 B;  4L72 B;  2BE2 A;  1KTQ A;  5AXL A;  1XNQ J;  3ISN D;  1DBD A;  3I0S A;  4WYL A;  1RHU B;  1JWW A;  3QT6 A;  1NK0 A;  1U1K A;  1RSC A;  1MRO A;  3DYA A;  5B0D A;  2H51 B;  2POK A;  1TUW A;  2KM8 C;  1U45 A;  1DJ0 A;  2D3O 1;  1SKS A;  2XQC A;  4QBU A;  4NLW A;  2DGX A;  3ENQ A;  1S57 A;  4K8R A;  2FVC A;  3DDK A;  2IJN A;  3BR8 A;  2IY5 B;  3QMQ A;  2RNE A;  5LMU J;  2CPZ A;  1AZS B;  1MML A;  1IKW B;  2XMV A;  2CPD A;  2XYG B;  1FXD A;  1Q53 A;  1N0V C;  4ZPD A;  1T3O A;  3D6H B;  1RAI B;  1GMW D;  4TLR A;  1T05 B;  1RBL A;  1FX4 A;  2ZC4 A;  5IV4 A;  1VRT B;  4O3N A;  4OV6 A;  1VQM S;  4N7T A;  4OYO A;  2E9T A;  1OJ4 A;  3RR8 A;  5BJR A;  2QLB B;  2W1B A;  2FJD B;  2JX2 A;  2XMW A;  2BAN B;  2YKQ A;  3KWM A;  3OFF A;  3W62 A;  3H25 A;  1JXV A;  3SBM A;  5E3R A;  3DYA B;  3J7A 1;  3GG0 A;  3LP2 A;  2RB7 A;  4NCA A;  4BS2 A;  1U09 A;  2KH9 A;  4M8L A;  3T1Y F;  2FVP A;  2ZHA A;  4UUW A;  5GVQ A;  2O1P A;  3FQK A;  2JRS A;  3AY0 A;  2LDI A;  2H4Y B;  4NLR A;  4PYA A;  3DRR B;  4OZJ A;  3VAH A;  4C9D A;  2QLF B;  4PXB A;  1RTD B;  3I5B A;  1S1T B;  2BZ2 A;  4M5J A;  4HT5 A;  3QGH A;  3TQ1 A;  2EWH A;  5ETO A;  3EGV A;  5ETN A;  1VQ9 S;  3TVK A;  4KY3 A;  3ITH B;  3PHE A;  1DUR A;  4Y2M A;  1RT6 A;  1VBK A;  3LP2 B;  2EFV A;  2EFN A;  2FTR A;  1L5U A;  3U1L A;  4DR4 F;  1FER A;  1DTT B;  5A8W B;  3MED B;  2VOD A;  1HNV B;  2R7T A;  3NG8 A;  1LK5 A;  3J7A N;  3K5N A;  2UUW A;  5C5J A;  1R8H A;  3EDR B;  4KHP F;  2AJQ A;  1H7X A;  2VQF J;  3KG4 A;  2HHP A;  2C2K B;  3ZZU A;  2XTJ P;  2NUH A;  3DHX A;  1KON A;  2HHS A;  2EBG A;  1U1O A;  2XC9 A;  4ZP6 A;  3M8W A;  1TL5 A;  3H40 A;  3M6U A;  2YQ1 A;  4J9U E;  3Q8U A;  5BR8 F;  2APO A;  2W25 A;  2AJ2 A;  1RTZ A;  4RLE A;  3QRP A;  4OYW A;  3CJ8 A;  4M5K A;  1VLY A;  1RWV B;  2MQQ A;  4R0E A;  4G6V B;  4KGK A;  2DIS A;  2QL5 B;  3V6D B;  3CJ3 A;  3CME S;  4Q45 A;  3DOK B;  3CF5 Q;  2Y1I A;  4B17 A;  4DJB A;  2MQP A;  1GMV A;  3BGR B;  4NLX A;  1T0T V;  4FF1 A;  5EWG A;  4J9P A;  5DM6 Q;  3ISN C;  4QIF A;  3G82 B;  1IWA A;  1MLA A;  2RVJ A;  4LF9 F;  2F4V F;  5GMD A;  3MM6 A;  1F0X A;  3OVB A;  3QYY A;  4FDF A;  2CZV C;  4OLP A;  1YSJ A;  2PN6 A;  4X65 F;  4EI2 A;  2M52 A;  1UKU A;  1AFI A;  3DLL Q;  2WZ1 A;  4X4U A;  5D6G A;  1RIS A;  4FP9 A;  4URG A;  1SXL A;  2J0S D;  3CDB A;  3W60 A;  1HYS B;  5AXK A;  3K8V A;  1KHV A;  1KVJ A;  4IKA A;  2CG8 A;  5HQ8 A;  4CQ1 A;  3PW5 A;  3NY0 A;  3H0P A;  2Z56 B;  4ZN3 A;  2UUT A;  4RUB A;  1RWN B;  2WW4 A;  4OJ3 A;  4J9R A;  2VBX A;  2Y1R I;  4K4S A;  3OHB A;  3GJT B;  4NXN F;  5L39 A;  4WBF A;  3PR4 A;  2BV3 A;  4D3G A;  5A8K A;  2QX0 A;  3FSI A;  4ZP7 A;  5E3Q A;  1O8B A;  2YX4 A;  3OSP A;  2XB2 D;  2NPI A;  5GAH I;  4Y2I A;  1CJV B;  3N6L A;  1JXE A;  3KLF B;  1X7V A;  4XAK A;  1TKZ A;  3QWP A;  1LOU A;  1KBR A;  3QAE A;  1X9S A;  1Z2Z A;  4FXD A;  1SIW B;  3R7N B;  4AL5 A;  1NME B;  1S1V A;  3OTO F;  2YPY A;  4UST A;  1QAY A;  4RNM A;  2HVZ A;  3TI0 A;  1X4H A;  5DQI A;  2HFN A;  4I6Y A;  3MR2 A;  4YFU A;  4GKJ J;  5DG7 A;  3MEE B;  2Z0G A;  2OFG X;  3BKF A;  1RT5 A;  4DN0 A;  4LFA J;  2GS8 A;  4PQU B;  5JXS A;  3MR6 A;  1VQY A;  1XEZ A;  2VBW A;  3LGM A;  4JYA F;  3THV A;  1DY3 A;  1FJ7 A;  2E66 A;  2MQN A;  4DFJ A;  2XWX A;  3D2W A;  2HVD A;  2MTL A;  1N33 F;  3NGS A;  4DF8 A;  3TAP A;  2B9E A;  3GE9 A;  1R0A A;  4ZVQ B;  3RUB L;  1R6Y A;  5KFP A;  2VFR A;  3JQJ A;  3TUI C;  4F2S A;  2OKQ A;  1XNQ F;  2CAJ A;  4MYU A;  3AAW B;  2MHN A;  1LWF A;  2IJR A;  3CJQ A;  4U9R A;  1U4B A;  4GVB B;  1AXQ A;  4X66 J;  2XNR A;  1XMQ J;  2VFT A;  3TYT A;  4LF4 F;  4YHH J;  2KDO A;  4Y2A A;  1M5O C;  3ETO A;  1UVL A;  1JLG A;  2EG1 A;  1BWV A;  5LMU F;  4TU9 A;  3Q8S B;  4C0O C;  4TY9 A;  4QYZ K;  3B6B A;  2KTQ A;  4HTJ A;  1UFL A;  3Q2S C;  1VMB A;  2V8P A;  3HKZ D;  2EBE A;  3W7B A;  1RHJ B;  3OXL A;  4KFB B;  4X64 J;  2MKJ A;  3PO4 A;  5ETK A;  1B3T A;  2CNK B;  5LJ5 Y;  3UN3 A;  3TP2 A;  4DV7 J;  3RU0 A;  1FES A;  4OYB A;  1NEE A;  2VPZ B;  5H9F J;  2LYV A;  3V81 B;  4K0K J;  3Q24 A;  1QDU B;  3ZTQ A;  1KQS R;  1O5J A;  3PG9 A;  2LFV A;  4Q2M A;  2EXU A;  4ZPA A;  1YJ9 S;  1D8Y A;  2B4V A;  4N41 A;  1RTH A;  4A8Y A;  2DH9 A;  2C3M A;  1HKA A;  2P6S A;  4LIR A;  1VJQ A;  2XNQ A;  4FZV A;  1BQX A;  2MJU A;  4MH8 A;  2HW3 A;  1SVD A;  2YWH A;  1KQF B;  3H5Y A;  1NJW A;  2CXE A;  5B0C A;  2N4C A;  2KN4 A;  2HQI A;  2A10 A;  4YQW A;  3BH6 B;  3H2V E;  3R7S B;  4UOH A;  4WKY A;  4UTG A;  3ZZR A;  4PG8 A;  3PFE A;  1M90 T;  4I6A A;  5IM0 A;  4DF4 A;  2FZG B;  4OHW A;  2ZH5 A;  3J81 j;  2EFG A;  3SCL E;  2GJ2 A;  2CQ1 A;  4QWE A;  1WEY A;  4LFC J;  1V5I B;  4DR7 J;  5DDQ C;  3M6V A;  3FUY A;  1SV5 B;  3TAM B;  5GAE I;  2G1D A;  3CCL S;  2OTJ S;  2DHX A;  1L3V A;  2HVH A;  2DGQ A;  3LP0 B;  1WG1 A;  1NH7 A;  1SH2 A;  2JLE A;  3CCE S;  2ZUG A;  1HIY A;  3V6J A;  2GGP B;  2V4J A;  3UWT A;  3QLH B;  1ZYQ A;  2C2R A;  3MAA A;  1FEE A;  5F8H A;  2XS7 A;  4YB5 A;  1ZS6 A;  3H5S A;  5A8R A;  3BSO A;  2ZE2 B;  1MW7 A;  5DM7 Q;  1SL1 A;  1QE1 A;  1VDH A;  1S49 A;  3EZO A;  1XBW A;  4E2F B;  2BXJ A;  4J7C A;  3HD1 A;  1HBM B;  1E6Y B;  3OL6 A;  5K20 B;  1FFG B;  5KAK A;  1Z1Z A;  2CPH A;  2LKZ A;  1FDB A;  2AP6 A;  3O3L A;  3W61 A;  5D4N A;  1RAO A;  2GVZ A;  1DLO A;  1D9A A;  2RT3 A;  4ICL A;  3ILO A;  1FDD A;  3BO4 A;  2JOQ A;  3MM5 B;  4JI2 F;  2GIF A;  1Q8K A;  4YB1 P;  5F8L A;  2QA1 A;  1FI4 A;  5F8M A;  5GAH U;  4IG3 A;  5A8R B;  1VQ8 S;  2XGP A;  1F9F A;  3M2V A;  3T5H A;  4OMF G;  4B3S J;  1MWY A;  2ZJQ Q;  3I6P A;  1CVJ A;  3Q2T C;  2MGZ B;  1B0P A;  3PRB A;  1L3S A;  1JKH A;  4IFV A;  4I2P A;  3KHG A;  2HHQ A;  3E01 B;  1RUS A;  5BYQ A;  1NK9 A;  1NHK L;  4K4W A;  4ZVT B;  4JUZ A;  1YI2 S;  2R2R A;  1RHM B;  4R25 A;  1NU4 A;  1VQL S;  4CH0 S;  5J2P B;  1TMM A;  3K89 A;  3R9L A;  2Y9H A;  4GKJ F;  1W2B R;  3CMQ A;  4AQY F;  4J9M A;  2QC3 A;  1S97 A;  4Y34 A;  2AYE A;  4LFA F;  4DZ6 A;  2P9E A;  4DS5 A;  1MMD A;  3CDE A;  4YY3 F;  4RW7 A;  1RAF B;  2MKK A;  4J9V A;  4IFV B;  5H9E J;  3FMW A;  2L9N A;  4OV1 A;  5KFQ A;  5EDW A;  5CXT A;  2DR7 A;  1VI7 A;  2O3D A;  3MMC B;  4PRF A;  1GX5 A;  5EWE A;  2M4M A;  4ELU A;  4C8L A;  2L48 A;  1HMV A;  2ASY A;  1X4G A;  3DHW C;  4X62 J;  1ZAX A;  3EIC A;  4DFK A;  4QCL A;  3T9Z A;  4X66 F;  2MKC A;  4C2M A;  1XMQ F;  3A8E A;  2VOP A;  4YHH F;  4C0B A;  2RKI A;  2B4O A;  2L41 A;  2BJ1 A;  2GVD A;  3NNC A;  2W2O P;  1ACM B;  5DGA A;  4C11 B;  3KOA A;  2LA4 A;  5B0A A;  4DV4 J;  1UTA A;  3HPO A;  1NDK A;  1IQT A;  3CIZ A;  3T5J A;  4OHZ A;  1HNW J;  1N5V A;  2X3G A;  4X64 F;  2BBE A;  2EC0 A;  3DLE A;  3EXC X;  4NLS A;  4Q2L A;  4TU8 A;  2RF2 A;  2MB0 B;  4DV7 F;  1S6P B;  2X1B A;  2ZBP A;  3FSX A;  4I69 A;  4ECX A;  1KLM B;  3PFO A;  4H54 A;  2BAB A;  3FMB A;  2WTF A;  4NCG A;  4CO0 A;  4IUF A;  1BXN A;  1YKW A;  2GVD B;  3QRQ A;  2WRM A;  8AT1 B;  1UL3 A;  3HF5 A;  3SQG A;  5C25 B;  2G0C A;  4CLT A;  2BX6 A;  1U1L A;  3MEC A;  5E3C A;  1HR0 J;  3B54 A;  2HQF A;  2FLL A;  3M1V A;  3DOL A;  2BVZ A;  4WP9 A;  4O3Q A;  1IBK J;  2B6A B;  1YJR A;  5J1N A;  1H98 A;  3CDU A;  1WDD A;  4LQ9 A;  2HMI B;  1S79 A;  1C0U B;  2H4W B;  1K47 A;  2M9K A;  5SUH A;  1BQN A;  3GFX A;  1D1U A;  4Q7A A;  3CDW A;  3MF5 A;  4O3R A;  1UEU A;  4P2S A;  1NCL A;  3CB4 A;  2E5I A;  1UVJ A;  4ZVS B;  2LXI A;  1RBO B;  3PY8 A;  2DNM A;  1HNX J;  4KTQ A;  4AE5 A;  4FS2 A;  4TQR A;  3R2C J;  1SQG A;  1ZAW A;  4DQI A;  1EET B;  2VD3 A;  2GHW A;  3QZ7 A;  2I0X A;  1FWL A;  4ITS A;  1YBT A;  2DRB A;  2V69 A;  1X5S A;  1FJE B;  2VG7 B;  3MMJ A;  4KKO A;  5GAE U;  4MTP A;  1YBU A;  3PNI A;  4NLG A;  2KHC A;  2E1M C;  5FLX Y;  5AE1 A;  2W7A A;  4DG1 B;  2JVR A;  1FWP A;  4DR7 F;  1EP4 A;  2NYI A;  2DNN A;  3P45 B;  3W63 A;  2YKO A;  4RWX A;  3W2W A;  1KHW A;  1RKI A;  2ADB A;  2Z2Z A;  3W2V A;  1OO0 B;  1SC1 B;  1CEZ A;  5D4O A;  2CJ9 A;  3UR0 A;  2XMT A;  1GXT A;  1RU2 A;  1RT1 A;  4PYD A;  2Z2M A;  1SJQ A;  2CPF A;  2C2M B;  1IKX A;  1LW2 B;  1N6Q A;  1U2C A;  4GVL A;  3MZI A;  3CED A;  2R9L A;  2M8H A;  3DMJ B;  2DCU B;  1IXK A;  1V3S A;  2R2S A;  1WD6 A;  2JVO A;  2R7U A;  4FYD A;  4IH6 A;  2G2Y A;  3PIP Q;  1MN9 A;  4PR6 A;  4DHV A;  4B9M A;  3MXH P;  3NXZ A;  5L1L A;  1O0P A;  3DRS B;  3JQK A;  3QFH A;  3S1T A;  4H4K A;  4JI7 J;  4WWS A;  2W8K A;  3LPY A;  2R3V A;  3QFW A;  4OI0 A;  1UWB B;  2HAI A;  3F73 A;  4FXW A;  3CSK A;  4UUX A;  4FYV B;  4UZB A;  2YWW A;  1RCX B;  2KYX A;  3ZXW A;  1FX2 A;  3FEX B;  1U47 A;  3VAF A;  4ZLL A;  2AWZ A;  1K9M T;  4ELT A;  2MSS A;  2VC0 A;  1U2F A;  3BKT A;  3WX8 A;  3TVZ A;  1VRQ C;  3MAQ A;  1G4C A;  1YZ6 A;  3LW5 C;  4B3S F;  2V2Z A;  3CC4 S;  2RAQ A;  4OI6 A;  3MMA B;  2YKP A;  4WIQ A;  2GQC A;  4OLO A;  3M8S A;  2VL1 A;  4DU7 A;  4LF8 F;  2J8S A;  2A3J A;  3TRG A;  4NLY A;  3MR3 A;  2MEW A;  5HMW A;  1PC4 A;  1TL3 A;  1MG7 A;  3TJ9 A;  3O44 A;  4HKQ A;  1U02 A;  3TW0 A;  4LR9 A;  1RHK B;  4CLU A;  1F2H A;  1U0H A;  2QV6 A;  4H4M A;  3ET6 B;  2EKN A;  4O44 A;  7AT1 B;  1E6V B;  3UN5 A;  4ZA1 A;  3N6N A;  4WK1 A;  4RBV A;  4R5P B;  1U1M A;  3I82 A;  3THP A;  2F4F A;  3K17 A;  3HSZ A;  4C7Q A;  2W2Q P;  3KK2 B;  2CJQ A;  1I3O B;  1FTC A;  1LFW A;  3SDE B;  2XSJ B;  1RP5 A;  4EMD A;  1XWL A;  4B3T J;  3IR7 B;  3TAQ A;  3OJS A;  4PZV A;  4M1K A;  5IXU A;  5J2Q A;  3FJ2 A;  2DJW A;  3WBZ A;  3AOD A;  2VA3 A;  5HK4 A;  3QJP A;  4TYA A;  1QAI A;  3C46 A;  3BBF A;  1WEL A;  4CLL A;  2M8D B;  1IKY A;  4H4M B;  3GG1 A;  4MK7 A;  4X62 F;  4X4O A;  4UQT A;  4ZMM A;  3CC2 S;  3DN9 A;  1FRM A;  3CUL A;  2AEF A;  3HFZ B;  4ID5 A;  2X3D A;  5KG3 A;  2N3L A;  1OY8 A;  1NH8 A;  1FKO A;  1XC9 A;  5J2Q B;  1QJH A;  4PWD B;  2BW2 A;  1S6O A;  1RAC B;  4DV4 F;  2DCL A;  4MYT A;  1W25 A;  4K4T A;  3LAK A;  2ZWO A;  2HHW A;  4ZN1 A;  5KFZ A;  1S4F A;  2C2N A;  1HNW F;  1NSP A;  4H4O A;  1H7W A;  2FVS A;  3BN4 A;  5EUH A;  1RTI A;  1KEK A;  4DSF A;  1UFW A;  2ROG A;  2VFV A;  3LAL A;  2LP4 A;  3EX7 B;  1RI7 A;  4WFZ A;  4HDG A;  3SYZ A;  1VLO A;  1XTZ A;  3HSJ A;  1X31 C;  3HLU A;  1MSW D;  4IRD A;  3W64 A;  2Y3Y A;  1HR0 F;  3SV3 A;  5FD1 A;  3QJJ A;  2W4C A;  2IJF A;  2NQP A;  4YR0 A;  2E7V A;  4CO5 A;  4J9Q A;  1QD1 A;  1IBK F;  1J5O A;  1TEL A;  2AMC B;  4KO0 B;  4ZHR A;  3TX0 A;  8RUC A;  1H0H B;  4UT4 A;  1ZA1 B;  4WU3 A;  3R1H A;  1ARO P;  3W65 A;  1QSS A;  1S6Q A;  1U48 A;  4RWW A;  3B82 A;  3VHQ A;  3DOM B;  4DU8 A;  4PXD A;  3BGU A;  3GIK A;  4WZQ A;  4HTI A;  2VJV A;  2HND A;  1XR6 A;  4FN5 A;  1ZTW A;  2M5Y A;  1RAB B;  2DNQ A;  1HNX F;  1SC6 A;  4ED1 A;  2XHC A;  2XCP A;  1PBU A;  4OHX A;  1H2V Z;  3CIM A;  2WVB A;  2GHP A;  1TL1 A;  2C3O A;  2U2F A;  4QR1 A;  2VF3 A;  4TY8 B;  1AA1 B;  3NCQ A;  3M2U A;  1MWQ A;  2UVR A;  4DUZ J;  2LEA A;  4ZIW A;  4WJB A;  1S6U A;  2CWX A;  1KVI A;  5KFI A;  1FDN A;  4EU0 A;  1CJT B;  5KFG A;  2VUG A;  1DAX A;  4W92 B;  3OL7 A;  2G4B A;  2QA4 G;  2XO7 A;  3AT1 B;  3OR1 B;  2H5J B;  1W2I A;  2MLX A;  2HND B;  4OI2 A;  2VZ9 A;  5KFK A;  3K8W A;  2YH1 A;  2BQ3 A;  4V19 X;  4DLE A;  3KJQ B;  2E1P A;  2R4F A;  3GV8 B;  2NS1 B;  3BQ0 A;  4NLT A;  2Y8Y A;  3A13 A;  1JLC A;  2J7K A;  3FEY B;  2R8G A;  3V4I B;  2B4P A;  1HQU A;  2IVF B;  2UU9 J;  1GT8 A;  3BKU A;  4M5D A;  2O67 A;  4KV8 B;  5A76 A;  3LAN A;  2BRL A;  3P49 B;  2H3E B;  3G86 A;  3Q83 A;  4P7V A;  4ETZ A;  4DX7 A;  2AJF E;  4ECU A;  2O66 A;  3C6T B;  2OPQ A;  5FLX U;  1S10 A;  3BYR A;  3ZC4 A;  3KLI B;  4DV0 J;  4ES3 A;  5D4L A;  3QAT A;  3ZTS A;  4JI7 F;  1N32 F;  2ZH9 A;  2VG5 B;  4H4K C;  1FFS B;  4NEZ A;  4QW8 A;  3HVA A;  8ATC B;  4CWB A;  5KFX A;  1S9F A;  3VAI A;  3FC9 A;  1RA6 A;  4CYU B;  4IH5 A;  2ZUA A;  4ERD A;  4CLZ A;  5CHC B;  1PKU A;  2CQ4 A;  1V9O A;  4CI0 B;  5I3P A;  1SL0 A;  2BKP A;  1EKR A;  2YY3 A;  4OIX A;  2G2Z A;  3G4S S;  4RNN A;  2HGN A;  2JH3 A;  3CJK B;  1M0S A;  3OR2 A;  1S0O A;  1C0T A;  1BUX A;  4OYA A;  2NSC A;  3LA0 A;  2IM1 A;  2HHH J;  1HBO A;  2DO0 A;  1TTH B;  3OVA A;  1S1W A;  2QLX A;  1F2G A;  4XDC A;  1M5K C;  4DQS A;  4CNY A;  1HWK A;  1ICE B;  1WG5 A;  2X1F A;  5LOQ A;  2B8Q A;  5KG6 A;  5HQL A;  3ILJ A;  1PBA A;  1SJR A;  2CPE A;  4LSN B;  4DFP A;  2XMJ A;  3S01 A;  2RRA A;  3VF0 B;  2ZVS A;  3PEH A;  2ZDO A;  1R27 B;  5K8N A;  4USW A;  4RW6 A;  3RBZ A;  2LQ9 A;  1JXL A;  1P9Y A;  4K5S A;  2P6T A;  4F4Z A;  1CBK A;  1WC0 A;  3OR2 B;  5F41 A;  1AYE A;  3M8P B;  3UDE A;  3K7R A;  3PW4 A;  3GR0 A;  3DLG B;  3MM8 A;  2NLW A;  2GZO A;  2E1A A;  1PIE A;  2LU2 A;  2R8J A;  3OFG A;  4MMO A;  1K0T A;  4PXE A;  3VGT A;  2ZVI A;  3LP1 A;  1UAW A;  3PDN A;  3ICL A;  4LRF A;  4QIE A;  4IG0 B;  3EYZ A;  2QA4 S;  3M05 A;  3N5F A;  3TZY A;  1KR4 A;  5D4P A;  1S1U B;  3IGN A;  2CQH A;  1G1X A;  4TQS A;  2HZV A;  4RW6 B;  3CXC R;  1TFY A;  3OL8 A;  4IO1 A;  1Q81 T;  3ENW A;  1EB0 A;  2J9D A;  4AL6 A;  2YNI A;  1PJ6 A;  1SUQ A;  2DR6 A;  3ZZT A;  2WOM B;  5J1E B;  2ATC B;  2M0G B;  4X4Q A;  2KT2 A;  5E33 A;  5CAB A;  3LTO A;  1RHR B;  3KJV A;  2QEX S;  2HIY A;  2XS2 A;  5ETS A;  1JNZ B;  2Q79 A;  3RAQ A;  5CH7 B;  2WSF C;  4J9N A;  3EVO A;  2W24 A;  3JYT A;  1U25 A;  3PVX A;  1M5P C;  5HLF A;  2VB6 A;  1WEZ A;  2RQM A;  2Z57 B;  3CO0 P;  5D15 A;  1HNZ J;  5DO2 A;  4C8K A;  1R8A A;  1VRU B;  2WON A;  3CCW A;  4YP3 A;  2CYY A;  3DRY A;  3HO1 A;  1UEV A;  2YNI B;  2DH7 A;  3MM7 A;  2KJW A;  1OPI A;  1R89 A;  1CLF A;  5LSL A;  2DHG A;  2CJX B;  3KJV B;  1JLF B;  2KXN B;  1KFD A;  1PJ5 A;  4JBC A;  4FYY B;  2DH8 A;  1GXU A;  3Q8Y A;  4CZC A;  1NAQ A;  1NSK L;  1DTQ A;  3PYF A;  3G6E S;  5ETR A;  1LK7 A;  5IQ6 A;  4DR6 J;  4RBU A;  2RRN A;  2K2P A;  2N7C A;  4IO9 Q;  2HRU A;  4CM2 A;  1KN6 A;  1GMU A;  5J2M A;  2GJI A;  5A2Q Y;  3FCH A;  3ZZ0 A;  3BQ1 A;  2XY7 A;  4OX9 J;  1YZ7 A;  1UPM B;  1SBR A;  2MHE A;  3BDP A;  1GXL A;  5DDO C;  1JJC B;  5D0R A;  4QWB A;  4Q0B B;  2BM1 A;  3KFW X;  1TAQ A;  2XZT B;  3MD1 A;  3PW7 A;  3NGD A;  5LM7 E;  2ALY B;  5K8P A;  4IRK A;  4HR2 A;  1RT7 B;  4DUZ F;  4USV A;  4ECY A;  1TMJ A;  2MZR A;  4Q5V A;  4FF4 A;  4ECT A;  1DQ9 A;  1HBN A;  3AQP A;  1UVI A;  2FY8 A;  2DPI A;  1Y7P A;  2DY1 A;  1PSD A;  3DXB A;  3F56 A;  2NRE A;  4I2Q A;  4DV3 J;  4A48 A;  5M2R A;  4UQG A;  3TEH B;  2OPP A;  2ZJP Q;  2OJ3 A;  4J9O A;  2V94 A;  4O4R A;  4DPY A;  2MKI A;  2MXY A;  3IAM 9;  4DLG A;  3SV4 A;  1LKZ A;  3LUY A;  4ATN A;  1HBU A;  4WP3 A;  2YWK A;  3AD8 C;  3O8W A;  2UU9 F;  3G96 A;  2HNY A;  4PUO A;  3F44 A;  1H73 A;  4X4T A;  3QQC D;  2AEJ A;  4A8X A;  1NK6 A;  1GAO A;  2XCA A;  2VIH A;  4M5I A;  3U1M A;  1MNE A;  4BC9 A;  4USM A;  2B4U A;  4PG7 A;  2GNK A;  3HJF A;  1T9X A;  2E5H A;  4DV0 F;  3MMB A;  2VG6 B;  4N76 A;  2UZA A;  4R8U B;  2R7X A;  1QSY A;  1GH8 A;  1MWZ A;  2RHQ B;  1DZ5 A;  4NCB A;  4KBI A;  2JLG A;  4ILR A;  2ZH1 A;  1ZM4 A;  1NKE A;  4XTT A;  3OTD A;  5F8I A;  3DI6 A;  3MEG B;  2HNY B;  2CVE A;  2D69 A;  3G2X A;  3KUH A;  4ZLJ A;  2CJY B;  4AL7 A;  3SEO A;  4I7F B;  3FRZ A;  5A0Y B;  3NNH A;  3MUV P;  4ZP9 A;  2WBM A;  5DJB A;  3R5D A;  1J27 A;  2HHH F;  4DPW A;  1Q5Y A;  3R5B A;  1HI8 A;  3GU0 A;  3C15 B;  1JLA A;  3SZ2 A;  3CCT A;  4A46 A;  2BMB A;  4JI4 J;  1B7Y B;  2MYF A;  3BYP A;  5LJ3 Y;  2OIH A;  4MK9 A;  4NA1 A;  5KFE A;  1LWX A;  3ZTR A;  2NZ4 A;  3ENV A;  2UXD J;  2B5J B;  1GTH A;  1RB0 A;  4KC5 A;  4F2R A;  1U26 A;  3QJL A;  5CD4 H;  2M7S A;  1HNI B;  2FQQ B;  4L6V 3;  2QO3 A;  1LWC A;  1TVR B;  1IKV B;  4NI2 B;  3CCR S;  2YQ3 A;  4ECR A;  5T41 A;  4CO3 A;  4FF3 A;  1RAA B;  2IPO B;  4C3M A;  4F4A A;  4Y0F A;  1N48 A;  3VQT A;  2IMO A;  2FJE B;  2FLO A;  4BLG A;  1M1K T;  4A8F A;  2IM2 A;  1RCO B;  2CPX A;  4Q44 A;  1Q86 T;  1U24 A;  1ZOT A;  1XK8 A;  4LSL A;  3H98 A;  1NZ8 A;  3ILI A;  1OPZ A;  3EJM A;  4FPR A;  3UD4 P;  1S9E B;  4ZJO A;  1RDR A;  1K44 A;  5EGY A;  1RT2 B;  4ED8 A;  4DL5 A;  2ACY A;  3H42 A;  1T03 B;  3ENA A;  2A1B A;  1TUG B;  2BEF A;  1NB7 A;  4RUC A;  1YJ7 A;  5ETP A;  1ZH5 A;  3CD6 S;  3AJ2 A;  3I87 A;  3B78 A;  2ZM6 J;  2VHG A;  3GII A;  4ED6 A;  2X51 A;  2E5J A;  4CRJ A;  2RRB A;  1FKA F;  4IOC Q;  2BJ3 A;  1HQE B;  1EIY B;  5L1J A;  2CJB A;  5C42 B;  2HNZ B;  4DV1 J;  1F6T A;  1XJW B;  1Y0H A;  1WHV A;  1HNZ F;  3DLK B;  4LRE A;  4F0M A;  2MZT A;  1WHX A;  2G9O A;  4CO2 A;  3A3N B;  1HHS A;  1WTB A;  2EC2 A;  4KB7 A;  2HS4 A;  4G1I A;  2Y0B B;  4WFA Q;  4XK8 C;  2A2D A;  2Q3P A;  3JTP A;  1MMN A;  3SFG A;  3FBB A;  1FKP B;  3BH7 B;  2JFK A;  2V4R A;  2XLK A;  4DR6 F;  2WHO A;  2CVI A;  2I2Y A;  1NO8 A;  2MY8 A;  4KH1 B;  3KHH A;  4RPF A;  3UDL A;  4ED2 A;  4C8O A;  2LXU A;  2KYZ A;  2FHK A;  4P2M A;  2VON A;  1WHW A;  1RYR A;  3FCV A;  4OX9 F;  2UXC J;  1NM2 A;  2IDE A;  3UPF A;  2K1R B;  1YBA A;  4MIB A;  3RBE A;  4I67 A;  2BJ7 A;  5B08 A;  2WVD A;  3BPS P;  4QOT A;  3PYE A;  3CE8 A;  2HEK A;  4MKY A;  4EGL A;  3JS9 A;  2V6A A;  4L74 A;  2AGO A;  2V9K A;  3TX8 A;  1S7I A;  2YWE A;  4EUV A;  2OHD A;  4M63 A;  3J7Z 5;  2FVQ A;  1RU1 A;  3T1Y J;  5A2Q U;  3I0R B;  1DFD A;  1UJ5 A;  1C1C A;  4B02 A;  3PX0 A;  5E3A A;  2AZ1 A;  3GSD A;  4XO0 A;  1C4C A;  4DV3 F;  5KT5 A;  2J7W A;  2BE7 D;  4CLK A;  3POT A;  4F0H A;  3P5T L;  1ZA2 B;  1VK3 A;  1WG4 A;  5KG7 A;  4XDD A;  4OYM A;  1UVM A;  4YUD A;  2I8E A;  4QIV A;  4KGM A;  4Q8E A;  3BDE A;  2J6S A;  2CQ2 A;  1NK4 A;  3PXG a;  5I3U A;  4QR2 A;  2ZD1 A;  2PFD A;  4L73 A;  3U1N A;  4HHU A;  4FBT A;  2J9D E;  2XY6 A;  4LQ3 A;  3CVK A;  2FDN A;  2Q43 A;  2VFU A;  1QAX A;  2V50 A;  4I1T A;  3K58 A;  3C2P A;  3IM8 A;  3VCD A;  2QSW A;  1X0P A;  4L76 A;  1SJ4 P;  4RW8 A;  2K7J A;  4B9N A;  3QWU A;  1HHQ A;  1HQ2 A;  1F5A A;  1IUJ A;  3AD9 C;  1FNX H;  2W2P P;  3NBP A;  4WE1 B;  1LNQ A;  4U96 A;  5HQM A;  5LT5 A;  3DFE A;  2KHD A;  4F7V A;  2VPY B;  4JV5 J;  4WKR A;  4N47 A;  1RLC L;  2R7O A;  1U49 A;  3NS7 B;  4DR5 J;  4HAC B;  1EZZ B;  2HWH A;  2XHW A;  4CLP A;  3C19 A;  3D7S B;  1BE4 A;  1LXJ A;  3ETM A;  3FVY A;  2F9J A;  2R7V A;  3W5Y A;  4IH7 A;  4PXC A;  2CA9 A;  4ECV A;  4K5R A;  1QVG R;  3J7Y I;  3NWR A;  2F63 A;  1S59 A;  5HAN A;  2ZWP A;  3BR9 A;  3GLJ A;  3VGV A;  1VQ6 S;  3HM9 A;  1H72 C;  3EPG A;  3HHE A;  3NAI A;  4U67 Q;  3G8S A;  2J6U A;  4LF9 J;  3DDN A;  4RO0 A;  4JI4 F;  1S99 A;  1VBY A;  4NRU A;  4W90 B;  4A8Q A;  1F3F A;  4QR0 A;  2UXD F;  3GFY A;  2IM3 A;  2ZOG A;  1RAH B;  2MZQ A;  1P1L A;  4BC7 A;  1U1P A;  3CMA S;  1FXL A;  5HBM B;  2YNF B;  5L46 A;  5KFL A;  1FF2 A;  1U6F A;  2BJD A;  2ZBR A;  1Q8B A;  4JI1 J;  4ZLP A;  5GAD I;  3W1Y C;  2Z4P A;  3FFI B;  3NAH A;  4AD6 A;  3D6F B;  3K5O A;  3PJX A;  1I51 B;  3M6W A;  1YVF A;  4UW2 A;  3KLH B;  5KFY A;  4DQR A;  1CUL A;  5KFN A;  2YKN A;  2HFU A;  3AD7 C;  2AGQ A;  1FO1 A;  1I5O B;  3FDS A;  2K7K A;  3D4J A;  3Q23 A;  2YNH A;  1TL7 A;  2C28 A;  4PWU A;  2V8V A;  4ZVH A;  2N7Y A;  3JSM B;  1A0O B;  4RX6 A;  3R97 A;  2R7S A;  2OPS B;  2PEB A;  2EEY A;  4KAI A;  1UA1 A;  2MKY A;  4RU2 A;  4W98 A;  1CUL B;  2XYH B;  3K5P A;  2RH3 A;  3H20 A;  4YB6 A;  2JZ5 A;  1GQE A;  2ZM6 F;  4OJH A;  2EK1 A;  1IR0 A;  2ZDP A;  4LBP A;  1B0T A;  4DV1 F;  1WOR A;  3M9N B;  3Q89 A;  1VQ5 S;  2H54 B;  2L3M A;  3BEG B;  2KXF A;  1HPZ B;  2UVU A;  4USU A;  1EX8 A;  1C1B A;  1K8A T;  1U6Z A;  2C3U A;  4ETX A;  1NSQ A;  4QWC A;  3V5R A;  3KXD A;  4OX8 A;  1S0M A;  4E0D A;  5KG0 A;  3NLC A;  3OFH A;  4NYP A;  2VOO A;  4G1Q A;  4LF4 J;  1RZM A;  1HI1 A;  3Q8V A;  2CUY A;  3HVW A;  1K73 T;  2YNG A;  3HSD A;  3R5C A;  3WX4 A;  3OLB A;  1X4A A;  3K59 A;  3UDV A;  3T3F A;  3DLH A;  2UXC F;  1TP7 A;  1REV B;  3D1O A;  5DDR C;  2V5H G;  3TAR A;  2R8H A;  1LWE A;  4B9V A;  5L9N A;  3HDS A;  2AT1 B;  2BUN A;  4RW4 B;  1VHF A;  1AUS L;  1WI8 A;  2YKM A;  3CJ2 A;  2Q6C A;  3GQC A;  2BE2 B;  1G3O A;  4ILM A;  3I0S B;  3S7R A;  4ED7 A;  3RG6 A;  4CCH A;  4OI3 A;  1L3T A;  1MRO B;  3PJW A;  3IP0 A;  3HKW A;  2WVF A;  4USJ C;  2WAQ D;  3LPE A;  1HL6 A;  3DM2 A;  1Q82 T;  3I4P A;  1UJ6 A;  3KLV A;  4DPX A;  2VU5 A;  4V1A k;  5IV3 A;  3OTE A;  2UXB J;  3R5A A;  2YX1 A;  3ZZZ A;  1W26 A;  4A8O A;  4YME A;  1X8D A;  1SJ3 P;  3EXY A;  1TQL A;  3QRR A;  2FB0 A;  3O1L A;  3DRP A;  2RQ4 A;  3NGK A;  1VIO A;  2MZJ A;  1VYA A;  1JLE A;  3D0I E;  2VC1 A;  3PEJ A;  4RUA A;  1MU2 A;  1LW0 A;  3W5Z A;  4UOG A;  3T41 A;  3KJF B;  3HMJ G;  3MAH A;  1RT4 A;  2NXC A;  4ELV A;  3OUY A;  2JC0 A;  3T1H J;  2HZA A;  3ULH A;  2UUA J;  2XBP A;  1UZH A;  2FZK B;  3LWL A;  2V68 A;  7FDR A;  1CJK A;  1AUD A;  1NJX A;  2FJV A;  2Q1L A;  2DGO A;  3PX6 A;  2ADC A;  3AXK A;  2MZS A;  3IM9 A;  2V67 A;  4OZ1 A;  4X4N A;  4P2F A;  1TKX A;  1VC0 A;  1N34 F;  1CQN A;  1NK7 A;  3O2I A;  2RQK A;  3RB3 A;  3OFE A;  2OGU A;  1YIT S;  4BWM A;  3D6T B;  1WF0 A;  1VQK S;  1RT4 B;  2YKA A;  3OUY B;  1ZTT A;  3WHI A;  1B7F A;  1RBA A;  2QTW A;  2OO4 A;  3BGL A;  4OQJ A;  2HBY B;  4HHH A;  4JV5 F;  9ATC B;  2HRT A;  2XMA A;  5LMN J;  4DR5 F;  1RT6 B;  1YDL A;  3GIM A;  4I4B A;  2RU3 A;  1RQ0 A;  1UMJ A;  4DX8 H;  5ETT A;  3KG0 A;  4ZVG A;  2VAS A;  3J7Y U;  1FE4 A;  2LDY A;  2DNZ A;  1KTV A;  3VZH A;  5KFH A;  2J6T A;  2IDL A;  1VQ7 S;  2NR0 A;  4DFM A;  2DGV A;  1VQ4 S;  3N01 A;  2DRA A;  2DNR A;  2KXH A;  2I9S A;  4N5S A;  4Z7C A;  3DNC A;  1Y00 A;  4TVA B;  5KT4 A;  3CWJ A;  5J2N A;  2P5V A;  2QL9 B;  2LQ8 A;  3U02 A;  2HHV A;  1X5T A;  3T6B A;  4CM0 A;  2VA2 A;  2QZ8 A;  4NXM J;  3JQM A;  3HVT A;  2CJK A;  1N5Q A;  4KR0 B;  5GAD U;  3E3X A;  1BHN A;  3GYX B;  4CH1 A;  1N36 J;  2HK2 A;  2KG1 A;  3IBW A;  4JI6 J;  1RWU A;  4HI1 A;  2FZC B;  2VQE J;  4JI1 F;  2DPJ A;  3BBC A;  4ANE A;  2XLI A;  2ATL A;  3HHN B;  2GA7 A;  4DSJ A;  2P8I A;  4PG4 A;  3W3S A;  1P27 B;  2UV8 G;  4Y3C A;  3BN7 A;  1WF1 A;  1BQM A;  4JI2 J;  1CS4 A;  4GRS A;  1VK8 A;  3MM6 B;  1YJU A;  1S5Z A;  3T19 A;  2H65 B;  4LF7 J;  4DL3 A;  4DN9 A;  4RW9 A;  2IBK A;  1TV6 A;  5BYS A;  4AFF A;  1N0U A;  2ZEJ A;  5KT2 A;  1OYD A;  2EFP A;  3QZ8 A;  3HHK A;  3HVT B;  1CG2 A;  2FUG 9;  3P4U B;  3IWX A;  1R0C B;  1QSL A;  5EX0 A;  4K4V A;  2OP5 A;  1ZM3 A;  2AIR B;  3CCQ S;  2ZH2 A;  2OMO A;  2UUB J;  2GJF A;  5IT9 Y;  4HLB A;  4QIG A;  1VR6 A;  3B4M A;  3S6E A;  1B0V A;  3FZ2 A;  4ANC A;  5B0F A;  1FD2 A;  1XQI A;  1JLQ A;  5K9F A;  1KNZ A;  1S0N A;  4AQY J;  2B9X A;  1S9G A;  3FRY A;  5A8K B;  3MGJ A;  1FRL A;  4K4X A;  1SB6 A;  4MK8 A;  3C16 A;  1JJ2 R;  3BV8 A;  4JI5 J;  3HHL A;  1F9H A;  2QFI A;  4YY3 J;  1ZM2 A;  1TKZ B;  4DCP B;  4JI0 J;  3CO9 A;  2DHS A;  1S1V B;  2DNO A;  4HVZ A;  3TJ8 A;  2Z2Y B;  2A0F B;  2PT0 A;  1JLB A;  3I4H X;  4EO6 A;  5KFS A;  4N8N A;  2KFN A;  4LVO P;  2RUS A;  2JDJ A;  2EPI A;  1RWP B;  1UZD A;  4DUY J;  1RT5 B;  5ETQ A;  1S9G B;  1EJ7 L;  3IC1 A;  3D1H A;  4KPC A;  2H5I B;  3X1L B;  3SSS A;  1UVK A;  4C98 A;  3RB6 A;  3OBI A;  1XNR J;  2W9C A;  2I1R A;  2HKE A;  3IXQ A;  2E1C A;  1R0A B;  1WOP A;  2G1H A;  2HBZ B;  4DR1 F;  3OXF A;  1O51 A;  3MR7 A;  3M32 A;  3QT8 A;  4F3M A;  4BHQ A;  1JLB B;  5EWF A;  3PX4 A;  5KT7 A;  2M3D A;  3TZW A;  1MN7 A;  1FVS A;  2ZH8 A;  4C8Z A;  5HP1 A;  3GCX P;  4V19 J;  3EZ5 A;  2AF6 A;  3KHR A;  4ZCK A;  1LWF B;  4KH0 B;  1R6V A;  4FPI A;  3RBX A;  2JLF A;  4QPT A;  2UXB F;  3R3T A;  1TFW A;  1JLG B;  2C42 A;  2HK3 A;  3HSG A;  2BM0 A;  4LF1 A;  3I5A A;  1XMB A;  3PR5 B;  3UCZ P;  5HAT A;  5H9F K;  3TNV A;  1G2E A;  4IFY A;  5EN1 A;  5IWA J;  3AJD A;  2ERR A;  1T9Y A;  1YWX A;  3NP5 A;  3T1H F;  5KFD A;  1S48 A;  3QIP A;  1RA7 A;  2FYX A;  2FVR A;  2UUA F;  4AUK A;  4OYX A;  4NL5 A;  1TK8 A;  4B9S A;  1JQG A;  2DVI A;  5E0O A;  3J7Z T;  2FJX A;  1IBM J;  2J8A A;  2CZ9 A;  4DX6 A;  3M6X A;  5HO4 A;  3ELH A;  4Y28 C;  4J9S A;  4CO1 A;  2IMW P;  1RTH B;  2HHU A;  2DTJ A;  2WB4 A;  1X4F A;  4WFB Q;  1FT8 A;  1PIL A;  4OX6 A;  2M2B A;  4IFY B;  3IG1 A;  1Z4U A;  4IDK A;  3HHL D;  1N5S A;  1JJH A;  1FWK A;  4KGV B;  3ZO7 A;  4RZR A;  1QTM A;  3H59 A;  4DQQ A;  1KSP A;  3G6Y A;  3IS9 A;  3G6X A;  1EAY C;  4F4X A;  2ZFH A;  3DLB A;  1WWH A;  3GPA A;  1Y4Z B;  4DZD A;  3PO5 A;  4CO4 A;  2EFQ A;  4P7T A;  1L3K A;  5LMN F;  1NUE A;  4ED5 A;  1SC3 B;  1RTJ A;  4ZCL A;  2PO4 A;  2CQ3 A;  3G6V A;  5T7L A;  2AJ1 A;  3PKM A;  3RRG A;  2RIJ A;  1SKU B;  1TL4 A;  2PMH A;  5IM0 B;  1YX2 A;  1F1B B;  1FCA A;  1KP6 A;  5HN0 A;  2Z58 B;  2XUL A;  4NYZ A;  2DXF A;  2ZBC A;  2DNG A;  3OTC A;  2CFX A;  2XS5 A;  1QTN B;  2GW8 A;  2H5E A;  3CC7 S;  4C4W A;  2VJU A;  2ZNY A;  4CLW A;  2KRR A;  2Z8Q A;  4NXM F;  5CYJ A;  1GFW B;  3HZE A;  3OT9 A;  3V2U C;  1FNM A;  1JIH A;  4OX7 A;  5CYQ A;  2HYI B;  1N36 F;  4YN3 B;  4IOA Q;  4ECW A;  2WW8 A;  3A3O B;  4JI6 F;  3K5L A;  1NPK A;  2VQE F;  1DAR A;  4ED0 A;  2LEB A;  3MPU B;  2V4J B;  2NPF A;  4LF6 J;  3N9U C;  4EBD A;  2E5L J;  3MAA B;  2N82 B;  1RKJ A;  3A8J A;  4LF2 A;  4LF7 F;  1T9U A;  1IQZ A;  4FYX B;  1GX6 A;  2RS2 A;  1QE1 B;  1SC4 B;  2MLY A;  2E9R X;  4IOB A;  4LF8 J;  4QU6 A;  3OQ2 A;  1S1X A;  4KGX B;  2N3O A;  3EE3 A;  2UUB F;  1HWI A;  1WOS A;  2GVZ B;  2IYG A;  1DLO B;  2HVI A;  5CA5 A;  4ICL B;  4DEZ A;  1SJ1 A;  1Q0N A;  4CP5 A;  6FD1 A;  3T9N A;  2ROP A;  2B56 A;  4A4J A;  4IG3 B;  4U7C A;  3M2V B;  1EKS A;  5F0W A;  2MZ1 A;  3D3B J;  2R7Q A;  2DGT A;  5G4D A;  2DEI A;  1D9F A;  2WVC A;  5L1K A;  3VAJ A;  4JI5 F;  1X5P A;  4EYH B;  3TZZ A;  1SH3 A;  3OW2 R;  2D9O A;  3TJA A;  4BCA A;  4JI0 F;  4PQA A;  5I4M A;  3HHL C;  1JKH B;  5HSP A;  4DV2 J;  4PPD A;  1NDP A;  4I2P B;  3LGN A;  2AYB A;  3EM1 A;  1U6B A;  5GME A;  2DNL A;  4GO5 X;  2GFF A;  4CTA A;  5MAO A;  3DU6 A;  1UVN A;  3UE2 A;  2DHA A;  4DL7 A;  3K5M A;  1YTY A;  2U1A A;  5H9E K;  3QGP A;  2F8E X;  1RT3 A;  2YWF A;  3MFH A;  2IVM A;  4GC7 A;  2AJ0 A;  4DUY F;  3R6G B;  2VDH A;  5C24 A;  3TUZ C;  2CPI A;  3D9B A;  1YJW S;  3HT0 A;  1X5O A;  4ER8 A;  2N4D A;  2W01 A;  3I9Z A;  4ZPV R;  3L3C A;  3G87 A;  5H1S V;  2IM0 A;  4NLV A;  4RW7 B;  1XNR F;  1GMW A;  1FRH A;  2HZC A;  2M70 A;  2D9P A;  3MCS A;  1T9T A;  5A6W A;  1KRP A;  4QJV A;  2AW0 A;  1HMV B;  1B70 B;  2OLW A;  2DIU A;  3BM7 A;  1BC6 A;  4P9S A;  2WB1 D;  3TAN A;  5KFU A;  2DR5 A;  3QID A;  4B9U A;  3JB9 k;  9RUB A;  3WIU A;  3C6U A;  1Q16 B;  2RKI B;  3K2Y A;  3KNA A;  3NNA A;  3LO3 A;  1A7G E;  2H48 B;  1NHV A;  3ZNU A;  2W7O A;  1DQA A;  4MAK A;  4JV1 A;  4ES2 A;  3TOQ A;  1UP1 A;  2W9B A;  1FJG J;  2E29 A;  3I56 S;  1UW9 A;  5IC4 B;  1WC3 A;  2GCF A;  2EK6 A;  4HDH A;  4Q8F A;  2AKW B;  5D3G A;  1OSD A;  2ILZ A;  4DL2 A;  4JI3 J;  5IWA F;  2HQ3 A;  1NPP A;  4ZK7 M;  5K8O A;  2HFS A;  3THT A;  3DLE B;  5FJ4 A;  5HL7 Q;  2RF2 B;  3W66 A;  3C14 A;  2GX8 A;  2JEI A;  2UVV A;  4YS2 A;  1F60 B;  4LR7 A;  4NCG B;  3I96 A;  1IBM F;  3FZB A;  1KLN A;  3SQG B;  4WYW A;  2V9W A;  2CQI A;  3MEC B;  2I6W A;  2DGU A;  2F3J A;  3M1V B;  3DOL B;  1WOO A;  3M8R A;  3EUN A;  2MLZ A;  1IKW A;  1XMO J;  5ETV A;  2KJV A;  4W4M A;  1HHT P;  4FVM A;  3L7O A;  2BJ9 A;  2ZC3 A;  1T05 A;  1VRT A;  1M5V C;  3AXM A;  1BQN B;  2F7V A;  3R5G A;  1PCA A;  3EMT A;  5CD4 A;  5GAG I;  3U7J A;  2W2M P;  4ZIT A;  2HUR A;  3N28 A;  4DS4 A;  2BAN A;  2ZOM A;  2LU1 A;  2EG2 A;  2G0J A;  2O5D A;  1QY7 A;  2BE9 B;  2MQL A;  2XO6 A;  3VVU A;  2GQ2 A;  2FHO B;  3N6M A;  2UVW A;  2MMY A;  3LF0 A;  3DRR A;  2LQ5 A;  3EWG A;  3IGV A;  3MPY A;  1RTD A;  4TKT A;  3AB4 B;  4KKO B;  1S1T A;  4M94 A;  4O3S A;  3KTQ A;  3GV7 B;  1EP4 B;  5EHH A;  3W2W B;  5D8H B;  4QU7 A;  1JX4 A;  4G65 A;  3ITH A;  3W2V B;  4ZPW R;  2XMK A;  1N32 J;  1M5S A;  2OEK A;  3TZX A;  2F65 A;  5E5N A;  1RT1 B;  2BJ8 A;  3NCP A;  1DTT A;  5A8W A;  3MED A;  1IKX B;  1YJN S;  2H9Z A;  2VIC A;  1HNV A;  1N6Q B;  1YRX A;  3VAG A;  2HWT A;  2KB2 A;  1K1S A;  3BPD A;  4LMZ A;  2HHX A;  5AE3 A;  3FCW A;  2KZM A;  1VBX A;  1FK9 A;  4EK2 A;  3CNQ P;  2D1C A;  2V8H A;  4LF6 F;  2XYP B;  5AJ3 J;  2NYH A;  2E5L F;  1XIQ A;  2CQG A;  1UCN A;  1TR0 A;  3H5X A;  1VQO S;  1Y11 A;  3OXG A;  3L09 A;  1X4C A;  3D6M B;  4AXJ A;  3OD2 A;  2GO9 A;  2HLU A;  3UD3 P;  4ZVR B;  3BZQ A;  3HCX A;  4YEA A;  1GTE A;  2EI5 A;  2B3T B;  1NBE B;  4K2J A;  1S72 S;  3V6D A;  2XI2 A;  3DOK A;  2CAD A;  5DDP C;  3BGR A;  2NCK L;  1FK9 B;  3D68 A;  1QM9 A;  2KO1 A;  3G82 A;  1YIJ S;  1FRX A;  4NPO A;  4N8O A;  2F8M A;  4FVC A;  3L95 X;  4C3L A;  4NLD A;  2A6M A;  3KK1 A;  3KMQ A;  3K57 A;  5M2P A;  2B7B B;  1SI9 A;  4EZ9 A;  2YBV A;  3CUN A;  1FFW B;  3NRB A;  1YLX A;  3M7V A;  4PAA A;  3UD5 A;  4DV2 F;  4LFB J;  1NND A;  1TL3 B;  3NGT A;  2COL A;  4DR3 J;  1FHT A;  4UOF A;  5RUB A;  5KT3 A;  1K0V A;  1HYS A;  3PZP A;  4DOZ A;  2HG4 A;  2QMW A;  4C6A A;  1U0H B;  1R31 A;  2VPX B;  1I94 J;  1SQF A;  4O44 B;  3CW2 C;  3MPD A;  2B9W A;  1VBZ A;  2R2T A;  2FJW A;  5I42 A;  3KK1 B;  4ED4 A;  4B3M J;  3QSY B;  1T3N A;  2XMU A;  2ASJ A;  4LIW A;  1G6B A;  4WFX A;  2XG8 A;  4FKX A;  5A6P A;  1UA0 A;  3CCS S;  4PG5 A;  1H2T Z;  1CJV A;  4EBC A;  3KLF A;  2OD4 A;  1IR2 A;  2RE1 A;  4DPU A;  3KYL A;  2HGM A;  5F8N A;  2W4D A;  1IKY B;  1IM6 A;  3PHT A;  4QZV B;  3O5T B;  1WJ9 A;  4WFY A;  1B99 A;  3GSI A;  1NJY A;  3CD7 A;  5I42 B;  2WSE C;  3MEE A;  1WKK A;  4ID5 B;  1PG5 B;  4F4K A;  1KQG B;  1UFK A;  4ZDN A;  1FKO B;  5IOL A;  4PQU A;  2ZH7 A;  2HWI A;  3GYG A;  1T11 A;  4O3P A;  5D0H A;  3O6Q A;  3JSY A;  2QG9 B;  1FJG F;  5AXM A;  4DMZ A;  2KZZ A;  5T14 A;  1SL2 A;  2ASD A;  1YJT A;  2CNO B;  1H38 A;  1U1N A;  4ZCM A;  2NXJ A;  4DUT A;  4JI3 F;  4OHY A;  4WU2 A;  2V34 A;  2RIL A;  4K4U A;  4H4O B;  2RML A;  1FNO A;  2FGO A;  1RTI B;  1S77 D;  4FS1 A;  1I6J A;  3F0N A;  1FJC A;  2K06 A;  1PAU B;  4QW9 A;  4GVB A;  2HFV A;  2QJ3 A;  3OVS A;  3M8Y A;  4KHM A;  3HJV A;  2PSZ A;  1RHQ B;  2HPU A;  4I56 A;  3JAM Y;  3KDN A;  4K2X A;  4OJG A;  1TZ0 A;  4LBI A;  3VGS A;  5BYR A;  4ECS A;  5DG9 A;  1ULR A;  4L3N A;  3A1Y G;  1J5O B;  1XMO F;  1WHY A;  4ZHR B;  3G8T A;  5GAG U;  3QO9 A;  1R8C A;  2MKS A;  4HEA 9;  4DXL A;  1S6Q B;  1V5V A;  1R3N A;  2V2V A;  4KFB A;  1VOM A;  4URS A;  4OZ3 A;  4RJV A;  4AYB D;  6AT1 B;  4QYZ J;  4USH A;  2C22 A;  4ZJQ A;  2JJ4 D;  1T8E A;  3V81 A;  1JMT A;  2HLT A;  3VGU A;  4YDD B;  5DG8 A;  1S12 A;  1TL1 B;  3H2L A;  3PRD A;  1IJF B;  5KG4 A;  1C4A A;  1EQM A;  2J0X A;  3M2U B;  5F3Z A;  1IBL J;  4Q43 A;  4KJI A;  2PII A;  3ZZO A;  2GMJ A;  2R8I A;  3KUG A;  3IO1 A;  3QO9 B;  3NS5 A;  3OJU A;  2AZ3 A;  2X1G A;  2V2Q A;  1VQS A;  2RDD A;  3M4X A;  4WTO B;  3RAM A;  3DGV A;  2QLJ B;  5IT0 A;  2EFO A;  2RU9 A;  4JP8 A;  2FC9 A;  4DR2 J;  3W5X A;  2V4Q A;  4OZ0 A;  4G1P A;  3MDF A;  5DGB A;  3HFK A;  2K3K A;  2ABY A;  2JNJ A;  3GIJ A;  1VGY A;  4ILL A;  4KT0 C;  1DQ8 A;  4ALZ A;  2J0Q D;  4Z37 A;  1JLC B;  4ECQ A;  2GIR A;  1HQU B;  3VAM A;  4LRB A;  3CJT A;  4M5D B;  1SKR A;  4WZM A;  1J2V A;  1RAJ A;  5AJ3 F;  3SSR A;  2OPQ B;  2YXL A;  3A3P B;  4KSE B;  3VR1 A;  2XI3 A;  2OTL S;  2W4P A;  1TAU A;  4F25 A;  3OL9 A;  5L8R C;  1KOO A;  1SV5 A;  3TAM A;  4XIU A;  5F0U A;  2V8G A;  5AXN A;  2RDJ A;  4Y2K A;  1RWK B;  1NZA A;  1XN9 A;  1M1G A;  3LP0 A;  1U1Q A;  5B09 A;  4URQ U;  2B43 A;  4P10 A;  1SCJ B;  2V8D A;  3T5L A;  2BKO A;  2AYG A;  1VJW A;  2VQF F;  3OPK A;  2BJE A;  3EDQ B;  1Y5I B;  2GIQ A;  2GMH A;  3CPW R;  2JC1 A;  3SXL A;  4RKU C;  2GGP A;  1N56 A;  3QLH A;  2D41 A;  2KVI A;  4ZVU B;  5D0G A;  4WFN Q;  1C0T B;  1N8R T;  1AW0 A;  2ZE2 A;  3A8I A;  1HBO B;  3BSC A;  5KFR A;  1HW8 A;  1X60 A;  2NXU A;  1S1W B;  1CSJ A;  5F3T A;  4LBH A;  3NWG A;  4NRT A;  3ADA C;  2DHH A;  1HBM A;  2FLP A;  1E6Y A;  3BS9 A;  4LFB F;  3ISZ A;  4LJM A;  1OWX A;  5IT4 A;  4DR3 F;  2K3I A;  3N0V A;  1Q5V A;  1X4D A;  1I94 F;  3IWL A;  2IC3 A;  4B3R J;  3MM5 A;  5HMX A;  4OHV A;  3EGN A;  4C8N A;  3E8O A;  2AU0 A;  4B3M F;  3AOB A;  1Y5L B;  2E9Z A;  1KQK A;  3PYG A;  3BBB A;  2D3O R;  1R7I A;  4ZPC A;  3MM8 B;  2KG0 A;  3CTR A;  4FXV A;  5U47 A;  3I55 S;  2HGL A;  4U8Y A;  3LP1 B;  4MKA A;  2MGZ A;  3PIO Q;  5F8G A;  5F9N A;  1QAJ A;  2GAH C;  2DRD A;  4B08 A;  5KG1 A;  3UDC A;  3E01 A;  5D0E A;  2SXL A;  2PA8 D;  3UNG C;  4LR8 A;  1N5Y A;  2AV5 A;  5LL6 d;  3NOG A;  1QUP A;  2V2K A;  3IRX A;  4NMX A;  2DGW A;  2IC3 B;  1VC5 A;  1WNE A;  2JHE A;  5J2P A;  4FNI A;  4HI2 A;  2RD5 C;  3BB5 A;  1SUQ B;  3VAL A;  5JVH Q;  3JSR A;  1UPP A;  5DRK A;  4YR3 A;  2B7C B;  3VZI A;  4DV5 J;  2OUG A;  3AH6 A;  1IWG A;  3W9I A;  1DHM A;  4ZJL A;  3MPW A;  4NYO A;  3A8K A;  3QGI A;  2WSC C;  3JYT B;  1N5Y B;  1PC5 A;  1NJI T;  5HLF B;  2MY7 A;  3MMC A;  3IRX B;  3CGI A;  4AT1 B;  1H74 A;  5CQG A;  4MIA A;  2WON B;  4WCE Q;  4ZVP B;  3RRK A;  1SKW A;  3MM7 B;  2QMU B;  3GV5 B;  2AQ4 A;  2J76 E;  3WQP A;  5C2C A;  2KT5 A;  2DYA A;  3MD3 A;  1U2R A;  5K8M A;  1NLK L;  2KRB A;  3I31 A;  1OIA A;  4C11 A;  1DTQ B;  3P96 A;  3R5J B;  2HIQ A;  2DO4 A;  5C2G A;  4DBQ A;  1FXR A;  4UY8 5;  4OJ1 A;  5J2M B;  1NDL A;  2BQR A;  4IR1 A;  5HMZ A;  4C0H A;  5E2Q A;  3NEK A;  4QYR A;  3R27 A;  1RXO B;  1WKL A;  2IBO A;  1S6P A;  2HS3 A;  3NGR A;  1WI6 A;  4OYP A;  4DL4 A;  5KFC A;  2EW9 A;  1KLM A;  2IHR 1;  4I0W A;  1FVQ A;  1KOH A;  4CT9 A;  3JAM U;  1U8W A;  3RB4 A;  3RW6 A;  2F1F A;  4ES1 A;  3Q8P B;  2VDI A;  5C25 A;  4D3H A;  3FBF A;  3NGU A;  4QQB A;  1IBL F;  2Y0S D;  4PEO A;  2QL7 B;  4NE9 C;  3FBE A;  3DRX A;  4A47 A;  1LXN A;  2B6A A;  2FD2 A;  3OV7 A;  1N5T A;  3KG1 A;  1HBN B;  3N79 A;  2DXE A;  4NX9 A;  6FDR A;  3R8Y A;  2HMI A;  3VWS A;  1C0U A;  2C2O B;  2JWN A;  2P2C B;  1WUU A;  3GJR B;  4DR2 F;  4I2Q B;  4CH7 A;  4QPX A;  3RAX A;  2AJ4 A;  4NLP A;  2LEC A;  2ZHB A;  1WDT A;  2BA9 A;  2OPP B;  1VQN S;  2OI2 A;  4NA2 A;  4F3Q A;  2P9C A;  4K0K F;  3DXS X;  1RLD A;  1PAE X;  1HBU B;  2GO8 A;  3LAM A;  1EET A;  3QT7 A;  4NLU A;  2EKY A;  3R1L A;  4PUO B;  4S0M A;  4YB7 A;  2HQD A;  4ZS6 A;  3IN5 A;  4IR9 A;  2QMX A;  2V0N A;  2VG7 A;  2CJA A;  2BKN A;  3T6J A;  4RNH A;  4BDP A;  2ILY A;  4OZN A;  3LWM A;  4LVN P;  4NML A;  4DG1 A;  4NAS A;  3MMB B;  4XPC A;  5CAA A;  2QIF A;  2A18 A;  4P2X A;  2DT9 A;  2XEX A;  2BDP A;  5IS2 A;  1NSA A;  3BF4 A;  5ETL A;  3W9H A;  3QPI A;  4ZPB A;  5KFV A;  3RJM B;  2C3Y A;  2CQP A;  4MIW A;  3SIP B;  3MI7 X;  2HBQ B;  1N88 A;  1LW2 A;  3NMA A;  3DI6 B;  4Y6I A;  1FE0 A;  2J5A A;  1OS5 A;  2HSE B;  1D3W A;  1V3R A;  3DMJ A;  1P9Q C;  1Q78 A;  1QUV A;  2GV1 A;  2NXN A;  3MCO A;  4M5L A;  1H6K X;  2HRY A;  3J80 Y;  4GO7 X;  1SJF A;  4LFC F;  4QIW D;  1SH0 A;  1TU0 B;  3D1Q A;  3W8P A;  4ZKA A;  4EYI B;  4KE5 A;  3DRS A;  4HH1 A;  1CJU A;  2KL8 A;  4PKD B;  2VKR A;  1JLA B;  1VFJ A;  3BSN A;  1UWB A;  5KG2 A;  1UJ4 A;  4TU7 A;  3MCM A;  1U1R A;  3I5C A;  1Q95 G;  2VV5 A;  2C2E A;  2FC8 A;  2B8P A;  5HRO A;  7FD1 A;  4Y00 A;  1LWC B;  1H2U X;  3K0J A;  4B3R F;  3VQS A;  2AD9 A;  5JMN A;  4IRC A;  3J81 Y;  4DWI A;  4BBY A;  2LVW A;  3RR7 A;  1AT1 B;  2CPJ A;  3RRH A;  1YRT A;  3GMG A;  1Q7L B;  1J5E J;  2E1R A;  1CJU B;  1KC8 T;  4M5M A;  2F9D A;  3HT3 A;  2AHO B;  3MMA A;  5KOW A;  4G3I A;  4X2B A;  3BGO P;  4KPY A;  3AOC A;  1P1T A;  4LSL B;  4U8V A;  1YJV A;  5HVG A;  3AOA A;  4LRD A;  4NZ7 A;  4CDI A;  2MST A;  2YTC A;  2HFO A;  2DNK A;  4KRW A;  3RW7 A;  5HRO B;  5J1P A;  1BD6 A;  1T02 A;  4KIA A;  3OHA A;  3PKY A;  3ET6 A;  1E6V A;  2ZNZ A;  5IZH A;  4R5P A;  2PI4 A;  3BJY A;  3CJ0 A;  1NB2 A;  1S76 D;  2OSQ A;  5MLC V;  3TO8 A;  1FTR A;  3DU5 A;  3I9V 9;  3KK2 A;  2M88 A;  2XSF A;  4EZ6 A;  3SDE A;  2XSJ A;  2OEL A;  2VKZ G;  4ZP8 A;  4DSL A;  4ZCI A;  4DV5 F;  1KVK A;  2JSX A;  4FYW B;  2IVY A;  4DSK A;  1N4L A;  4ZLN A;  4YDX A;  3C3L A;  1P6T A;  3GIL A;  3PTW A;  5I3Q A;  3GJQ B;  1R8B A;  2DGS A;  2C2Z B;  3KLG A;  2HBR B;  2V63 A;  4USI A;  1QVF R;  3B4D A;  3HI9 A;  2LXF A;  2KU7 A;  2W2N P;  1WC1 A;  2OH2 A;  2KFZ A;  3D3C J;  3FK4 A;  3PJ9 A;  2PC6 A;  2I5J A;  1PYS B;  3L4B C;  2QA2 A;  2PI5 A;  4I6W A;  3MPV A;  4PWD A;  2Z2L A;  2X7I A;  4DQP A;  5HJY A;  1JK9 B;  3BO3 A;  3F41 A;  1X4E A;  1V6H A;  2IA6 A;  3IAS 9;  1NKB A;  4OZ2 A;  1KDN A;  3Q0A A;  3B8H A;  4MKB A;  3P5B P;  3SCK E;  3KLG B;  4DPO A;  2XZW A;  1X4B A;  4J9K A;  5DQH A;  5LXR A;  1RWX B;  3IMQ J;  3GON A;  4IYQ A;  3I32 A;  1F9E B;  2I5J B;  2KT3 A;  4PPZ A;  5DZ7 A;  2AGP A;  3GFH A;  2EVZ A;  3ZZY A;  5KFO A;  2PEH A;  3NMR A;  3FKB A;  3EZU A;  4JOU A;  5IC6 B;  3TWZ A;  5KFW A;  5E41 A;  3H4B A;  3MM9 A;  3G9C A;  4KO0 A;  1RJJ A;  2XY5 A;  1URN A;  2MQM A;  1Z2L A;  3GTY X;  1BGX T;  1C1C B;  3PYD A;  4F3O A;  3UQS A;  2LMI A;  2GML A;  1N34 J;  3DOM A;  4DV6 J;  3HD2 A;  5SZT A;  3POT B;  3GB0 A;  2FHJ A;  3MUT P;  3PW2 A;  2VPW B;  2OSR A;  4O0N A;  4J91 A;  3KDO A;  4DL0 C;  2FGC A;  5G0R A;  1M5H A;  1FRI A;  2DY9 A;  3IBC B;  4OZL A;  5I3U B;  1S0V A;  1R0B G;  2GAG C;  4TY8 A;  2ZD1 B;  4P6Q A;  1NKC A;  2BW7 A;  2VBY A;  1YQH A;  2L9W A;  3MM9 B;  1P8G A;  1T7P A;  2X1A A;  1T9V A;  5ITH A;  4WTY A;  4J90 A;  4F50 A;  1WSR A;  3MR5 A;  1CJT A;  1D9D A;  1RE1 B;  2BOP A;  3IR5 B;  1Q79 A;  3CCM S;  4RW8 B;  1ROF A;  2ZH6 A;  1OY6 A;  3OR1 A;  3US5 A;  4UF4 A;  3UO0 A;  3CJS A;  1YK9 A;  5EX3 A;  3PW0 A;  4L3K A;  3Q86 A;  3NBP B;  3Q8R B;  5B0B A;  5C7P A;  2DNY A;  2IIH A;  4M5G A;  5G0R B;  3GP9 A;  4NEY A;  2G0I A;  4U7U D;  4EBE A;  4FNH A;  3V4I A;  4JI8 J;  5KFA A;  3ZTO A;  1ZPV A;  4DL6 A;  1RK8 A;  5KT6 A;  1NHU A;  4KV8 A;  5JUM A;  4F0K A;  2KFY A;  1VIS A;  3C6T A;  1HFE L;  5JJB A;  1IN0 A;  5D77 A;  2IAJ A;  3KLI A;  3GR1 A;  2W7P A;  3SQO P;  2ZZT A;  5KFB A;  1RAE B;  4ZVO B;  2XWY A;  4OI1 A;  4JV2 A;  2VG5 A;  1OSC A;  4NLQ A;  2DNP A;  3H2U B;  1WTF A;  2UV8 A;  3DKD A;  4B3O A;  4LUB A;  2W8L A;  2ZKU A;  2PE8 A;  2QFJ A;  4OZ5 A;  1Y3J A;  3D0H E;  4CYU A;  1WEX A;  2GQQ A;  3BO2 A;  2BQU A;  1L3U A;  1YHQ S;  5L38 A;  4O4G A;  3J80 U;  2IAJ B;  2R2U A;  3TUP A;  2ZZN A;  2R7R A;  4TLQ A;  3CJK A;  1J5E F;  1OY9 A;  1ZPW X;  3S8S A;  4F26 A;  1TKT A;  5KTQ A;  4RNF A;  2D7S A;  2PMZ D;  2YKN B;  4A8S A;  2OML A;  2KI2 A;  4LRC A;  3D66 A;  4FF2 A;  5FII A;  4B3O B;  2DIT A;  2FHJ D;  3ZTP A;  5GMK a;  1HA1 A;  4IQX A;  1LEO A;  3AHP A;  1LQ9 A;  1REG X;  2VH7 A;  3QBC A;  1UEK A;  2YNH B;  1TL7 B;  3TR5 A;  2BRK A;  3FGV A;  4M5N A;  4P71 A;  5THW A;  2RDI A;  2RUG A;  4GC6 A;  2PDA A;  3A12 A;  4LSN A;  4O4G B;  3J81 U;  1X0F A;  4A8K A;  1PO6 A;  2L08 A;  3GIR A;  2LEP A;  3HVR A;  4EFA C;  4WF9 Q;  5F9L A;  5DLG A;  1TKT B;  3R7B B;  3M8P A;  4CNZ A;  3PV8 A;  5AT1 B;  3DLG A;  3TA2 A;  5KFM A;  1KKH A;  4MKV A;  1GNK A;  3NOC A;  4IG0 A;  1XR5 A;  3M2R A;  4GKK J;  2A6O A;  2ZH4 A;  4C97 A;  5BXI A;  2Q6B A;  5B7W A;  1S1U A;  5K14 A;  4DDF A;  4UOC A;  4X4V A;  3HUL A;  2DD8 S;  2HQC A;  2Z30 B;  1C1B B;  4DR1 J;  4HYK A;  1OYE A;  2CRL A;  2WOM A;  3EVW A;  1Y3K A;  2YH0 A;  5J1E A;  5LSO A;  5D78 A;  5CCL A;  4B3T F;  4P74 A;  1N54 B;  5CCM A;  1HI0 P;  1DRZ A;  2MQO A;  2MPU A;  2JEJ A;  3NL0 A;  4M95 A;  4NZ6 A;  2HS0 A;  3E2E A;  3ZFV A;  4G1Q B;  1CC7 A;  2YNG B;  3M2R B;  2UUC J;  3LH2 S;  4I68 A;  4RU9 A;  5K14 B;  5JVG Q;  1GK8 A;  1IJE B;  2PA3 A;  2ZBQ A;  1VRU A;  2E7X A;  1LWE B;  1TUV A;  3EPI A;  2O01 C;  4F8R A;  2KVQ E;  1WSV A;  2YKM B;  1IBC B;  3Q8Q B;  1HWJ A;  3BSA A;  2ZJR Q;  1ZAV A;  3HK2 A;  3M8Q A;  1IVZ A;  1JLF A;  2DR9 A;  1U0S A;  3DM2 B;  5KOX A;  1PGZ A;  1F5B A;  2CWK A;  1EAR A;  2ZIT A;  4OFZ A;  3RYL A;  1NPR A;  4NLO A;  4E98 A;  4P52 A;  3TA0 A;  4UY8 T;  2J0W A;  2IRU A;  1T95 A;  3KJN B;  2F40 A;  1HLW A;  3ZNJ 1;  4QWD A;  4DV6 F;  3DRP B;  1JLE B;  2ZHO A;  3DLJ A;  1MU2 B;  4Q0B A;  1LW0 B;  3NS6 A;  1Q1K A;  2DK2 A;  5LSR A;  1NXI A;  3M8Q B;  2QYC A;  1FA0 A;  3CDA A;  1Q8I A;  1CJK B;  3AFG A;  1RT7 A;  2IRY A;  3H4D A;  3SI8 A;  2HAF A;  1H3D A;  2CIM A;  4E8U A;  1Y9O A;  4XPE A;  1TKX B;  5DLF A;  3CD0 A;  3UR3 C;  4A8M P;  5L9X A;  1OQ6 A;  2PFF B;  3PCO B;  2L9D A;  3U27 A;  4LF5 J;  1B4S A;  3RBD A;  1D8Z A;  2LQB A;  2BOA A;  4TNO A;  2QGF B;  2YPZ A;  2CNL B;  4WK3 A;  4P75 A;  4MFB A;  3QGG A;  2P9G A;  2JFD A;  1OQ3 A;  4JI8 F;  3V6H A;  2OFH X;  2LLZ A;  2LCW A;  3KHL A;  1HD0 A;  3GJS B;  1RAG B;  4OYI A;  4ENO A;  4NA3 A;  1BWE A;  1JB0 C;  1AB8 A;  1YRU A;  4WII A;  4Y2C A;  4KHR A;  2E44 A;  4TXS A;  1IR1 A;  3PAC A;  5CYM A;  2J9C A;  4Z2X A;  1M1H A;  1HW9 A;  4DPT A;  3IFE A;  2MDA A;  2VG6 A;  4WXO A;  4R8U A;  4R0J A;  5J2N B;  3G8Q A;  3JTN A;  3IWN C;  4EEY A;  3E51 A;  4MFB B;  2OD6 A;  3UW1 A;  1SPB P;  5DET A;  3UVJ A;  3HXM A;  1BY9 A;  4MJK A;  3MEG A;  2OAU A;  1ELO A;  4BWJ A;  1BLU A;  4I7F A;  1C2P A;  1NRK A;  1WC4 A;  2B9Y A;  2YWG A;  5A0Y A;  4ED3 A;  4PCQ A;  3VAK A;  2ZH3 A;  3D28 A;  2MKH A;  1N52 B;  3OSN A;  5CYM B;  1G7C B;  2YQ0 A;  2I38 A;  2QT7 A;  2XZD B;  1BQM B;  1W7W A;  1CS4 B;  2E5G A;  4Z7Y A;  1HWU A;  3BGF A;  5AE2 A;  3C15 A;  3JXO A;  2CNN B;  3IR6 B;  3V4M A;  4KQZ A;  4RW9 B;  3UVJ B;  1TV6 B;  1RWO B;  1F5C A;  3P6Y C;  3T5K A;  2AEM A;  3TEG A;  3MUR P;  2B5J A;  4ZOS A;  3EGZ A;  2LA6 A;  1PYO B;  2VBZ A;  2HVE A;  3SSQ A;  1CPZ A;  1CC8 A;  2HQG A;  3G71 S;  4J9L A;  1HNI A;  2BR0 A;  1UWA A;  4DSE A;  3H90 A;  1TVR A;  1KS2 A;  1IKV A;  4NI2 A;  1TKD A;  3A4T A;  1PJ7 A;  1ITP A;  4M5H A;  3HFV A;  3DCA A;  2UP1 A;  3MEK A;  2G2O A;  4X4S A;  1WC6 A;  3D67 A;  1JLQ B;  3UN2 A;  1A6L A;  4U95 A;  4LT6 A;  3FNN A;  1B64 A;  1R8P A;  5M2U A;  2B51 A;  3C16 B;  3ZZP A;  4GKK F;  4CT8 A;  4LSZ B;  1S9E A;  3HHL B;  1WAC A;  3PRV A;  1GEH A;  4K4Z A;  3KKF A;  3UCG A;  1RT2 A;  1RWW B;  2HHT A;  1T03 A;  3QT5 A;  4RL1 A;  5ETM A;  4A8W A;  2D3U A;  4RBT A;  2IA0 A;  3KNG A;  5K5M A;  1Y5N B;  2OEJ A;  3FEZ A;  5KG5 A;  4F02 A;  2CZ4 A;  2CQB A;  3OLA A;  2RQC A;  3KLE A;  4C3K A;  1XR7 A;  2JL9 A;  2PD1 A;  3CJ5 A;  1U7L A;  4OYZ A;  1TK0 A;  4NZ0 A;  2UUC F;  3CCU S;  1HQE A;  3V6K A;  3MCN A;  2A2C A;  1S4E A;  4RUH A;  1WC5 A;  5C42 A;  2HNZ A;  2BAC A;  4IQM A;  2WVE A;  2FJB B;  1HWL A;  4O23 A;  2W9C B;  2CDR B;  3DLK A;  4JB8 B;  4JV0 A;  1VC6 A;  3M9O B;  2DIV A;  2QE5 A;  4FBU A;  2FPH X;  3M32 B;  4WXW A;  2XM3 A;  1KD1 T;  1NK5 A;  1KFS A;  1WF2 A;  3W8G A;  1F3V A;  5DQG A;  1NK8 A;  4X4R A;  2C3P A;  4ZVE A;  5HP1 B;  2JEG A;  3DGP A;  4KGZ B;  4RNO A;  3KLE B;  1VHI A;  3H5U A;  4OL8 A;  1FKP A;  2LQJ A;  2QN6 B;  1VS3 A;  1Q4R A;  2RJZ A;  2GHV C;  4AXI A;  2R7W A;  4K59 A;  1CQM A;  1KWM A;  3AA8 A;  3MTK A;  1JNR B;  3IRW P;  3RGI A;  2CPY A;  5KFF A;  3JSB A;  1WKJ A;  3WZ0 A;  5KFT A;  5FDL A;  2K1R A;  5HI7 A;  1LFP A;  1U8S A;  2AX0 A;  2AYM A;  2RS8 A;  1O6X A;  2RSQ A;  3SMZ A;  3QIP B;  2G13 A;  5HMY A;  3DGP B;  3GFZ A;  3N5B A;  2PMW A;  4YOE A;  1NDC A;  3M30 A;  3MHY A;  3M9M B;  3UNY A;  3KK3 A;  2IYI A;  2ZOF A;  3QNW B;  4YR2 A;  4EO8 A;  1Y10 A;  3I0R A;  2R42 A;  1V3Z A;  5ADZ A;  3M8Z A;  4C8Y A;  5CZX A;  3CCZ A;  4PAB A;  3AA9 A;  2OPR A;  3SFU A;  3IG1 B;  2DEJ A;  4LF5 F;  4IDK B;  5FDL B;  3C8Y A;  3L9Z A;  2DKO B;  2WCX A;  4QWA A;  4WPA A;  2OEM A;  1D09 B;  3JTO A;  3IS9 B;  3PM9 A;  3MFI A;  2Y8W A;  2NXE A;  4AND A;  2BYC A;  2D74 B;  3TVY A;  2DBB A;  3DC2 A;  3WC0 A;  4PWW A;  3FBC A;  2FY1 A;  1RTJ B;  2KM8 B;  3M30 B;  1FRJ A;  3UCU P;  3CT9 A;  4F4Y A;  5L1I A;  3KK3 B;  2DB1 A;  4X84 A;  4C8M A;  4ZPT R;  3CD5 A;  3TUJ C;  5T7L B;  1NJZ A;  5IQQ A;  3VVT A;  3CJR A;  1SIZ A;  1EQ0 A;  2OPR B;  5B0G A;  2IRX A;  2Y1J A;  3NCR A;  3QAU A;  2ALZ A;  4N56 A;  2XLJ A;  4N77 A;  1AFJ A;  1T9W A;  3MTJ A;  5CZV A;  4P73 A;  4WE1 A;  2J7U A;  2FIU A;  2ZBI A;  3AB2 B;  3TQE A;  4U7U K;  3WDO A;  4C48 A;  4NWB A;  1D0E A;  4HAC A;  4TYB A;  3R2D J;  3UI3 A;  5CYQ B;  2K8G A;  2PGC A;  1Q8L A;  3NKY A;  4DR4 J;  4L75 A;  4ECZ A;  4FKY A;  1T94 A;  1YG0 A;  4P72 A;  1S7H A;  3D0G E;  4GMK A;  3FQL A;  3HHD A;  3KUE A;  5HVH A;  3LQV A;  2GC8 A;  2B0G A;  4WP8 A;  4KHP J;  4HHJ A;  4F36 A;  1VCT A;  2WK4 A;  4HH0 A;  2CG4 A;  3N4W A;  2QYG A;  4U6P A;  4USK A;  3IBF B;  1X9W A;  2WBR A;  1RGV A;  2Q66 A;  2ROE A;  4F04 B;  2NSB A;  3GZ7 A;  4CLY A;  5BR8 J;  1I1G A;  3W9J A;  1OMS A;  1FRK A;  1IM4 A;  3VV2 B;  2F5G A;  2FHM A;  3RZA A;  2DXD A;  1JJ4 A;  2H1Y A;  3WC2 A; 
#chains in the Genus database with same CATH homology
 4PEO A;  2IDL A;  2G0J A;  1S12 A;  2G0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...