1S12A

Crystal structure of tm1457
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
MIKVTVTNSFFEVTGHAPDKTLCASVSLLTQHVANFLKAEKKAKIKKESGYLKVKFEELENCEVKVLAAMVRSLKELEQKFPSQIRVEVIDNGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein TM1457
publication title Crystal structure of TM1457 from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 30
structure length 94
sequence length 94
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04327 Peptidase_Prp Cysteine protease Prp
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1490 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Cysteine protease Prp 1s12A00
2IDLA 1S12A 2G0JA 4PEOA 2G0IA
chains in the Genus database with same CATH superfamily
1S99A 3MM5B 1RT3B 1UFKA 1BXNA 5LMNF 5F8GA 4F04B 2BM1A 2YWWA 2VD3A 4JB8B 3MM8B 5HVFA 2R7RA 3DLHA 1LWEB 1T11A 5IT9Y 3HZEA 2MJNA 2VZ9A 2UUWA 3DM2A 1ZH5A 3B78A 3NG8A 2RAQA 1JLQA 3ZFVA 5E2QA 5D6GA 4YR2A 1ZZNA 3FRYA 2QFJA 1YJTA 2AJ2A 2D3ZA 3M6VA 3OPKA 4IFYB 4KV8B 3P6YC 2FJBB 4PYDA 5JUMA 4DUZF 1GX6A 1VC5A 4OZNA 4DPTA 3N6MA 2DCLA 2HMIB 5KFOA 3VAKA 4DV5F 4NWBA 1S0VA 3H4BA 3P5BP 5C7PA 5AXMA 3OLAA 2V2ZA 3AH6A 5KFRA 1RBLA 3R5JB 4P9SA 3F44A 2B7BB 1HA1A 4QJVA 5A2QU 3M9MB 1T0TV 4RJVA 3V81A 3KLGA 1R8AA 3C6UB 4KQZA 2AZ3A 2DRAA 5KFMA 1VBYA 2FVPA 1VLYA 1AUDA 1WDTA 1S6QB 2CFXA 3J7ZT 2PN6A 3PEHA 3EGWB 3I0RA 1SC4B 2UXBJ 2EK1A 2DNHA 4CH7A 1LOUA 4DWIA 3DGVA 2WHOA 3K57A 3HD1A 2OJ3A 3T5JA 5HMZA 4KAIA 5D8HB 4F7VA 5BR8J 3ULHA 2DH7A 1X4GA 2H5IB 5ITHA 2OMLA 1UWBA 3N0VA 2AEFA 1FNXH 3DGPB 3M8ZA 1R31A 2JLGA 2FY1A 3TEGA 2UUTA 2CIMA 3FQLA 1RA6A 3L09A 2E66A 3AD7C 1FRIA 4RLEA 2LP4A 5SUHA 2CJQA 5IT0A 3UCUP 5LMNJ 3Q8UA 1U2FA 3PRVA 4I68A 1TK8A 5K8PA 4F3QA 4MT1A 3GWCA 4QBUA 1JLFA 2ZH1A 3F56A 1TV6A 4NLYA 4ZVOB 4CLSA 2XB2D 5D4NA 3GSDA 3TQEA 1QY7A 4XK8C 3CGIA 3U1NA 4CT8A 3M2UB 2HHPA 4ZVQB 1UVIA 4F4WA 1XK8A 4CTAB 4DR5F 1R43A 3DLKB 3GIRA 5F9NA 4ELUA 3KDNA 4Q2LA 4DUZJ 4DV5J 2HBYB 4R8UB 1KN6A 4F0MA 4RW9A 3FZ2A 1NSQA 4MIBA 1DHMA 4DPUA 1I1GA 2MLZA 3F73A 2DCUB 3IS9A 1TU0B 3TVZA 1FK9A 2DY1A 2OTLS 5HMYA 1TP7A 5B0FA 5D0HA 2DR7A 1NK7A 1NDLA 2GHPA 2NLWA 2RDIA 1HD1A 5AXKA 3KOAA 4R5PA 4J9PA 4DR7F 4DR6F 3MR7A 2JEIA 3MMAB 3Q8RB 3SSRA 3RW7A 2M9KA 1WC0A 5I42B 4CLFA 2C3OA 1T3OA 4I7FB 2BE2B 4C8NA 5A76A 1BMQB 1S1TA 3SXLA 1NK5A 2WB1D 1APSA 1K0VA 1RTJA 1R0CB 1N5TA 1NJYA 4AXIA 2DNLA 2NR0A 4LFAF 1ACMB 1RWMB 2A10A 2ATCB 4DL2A 2YPZA 2QE5A 4WFZA 1OY9A 4Y6IA 2PC6A 2XWXA 1UPPA 1T9YA 4OI4A 4LR7A 2CVIA 4NEYA 4GVLA 4Q43A 1H72C 4E8UA 1VQ7S 2YNHB 4PWWA 3E51A 1WWHA 1RT1A 5D3GA 1RE1B 2G2YA 2J9EA 4OJ1A 1DTQA 1GMWA 1JMTA 2MZQA 2DHAA 5KFWA 1YJVA 4N76A 1XEZA 1Q7YT 1KOOA 2AYEA 1Q95G 3Q2TC 4IRKA 3GR0A 4DZDA 5I3UB 2AYGA 4DR5J 4L76A 4IFVB 4A8WA 5ETNA 2MZ1A 1S1UB 3W63A 4RL1A 1HBNA 3TW0A 4J91A 3QZ7A 3V6DB 2CQDA 2WOMB 3CCMS 3T41A 2CZ9A 1XMQF 3GG0A 1DQ9A 2HNYB 2CNNB 2HVHA 3ICLA 5HLFB 3AD8C 2M8HA 3KUHA 1C1BA 3S7RA 4N56A 2VKRA 3OVAA 3V4IA 1PYTA 4ID8A 3FQKA 2MLXA 1SJFA 2QYGA 3DI6B 3GFZA 3KHLA 2DRDA 4J9RA 3C15B 3NRBA 5DS7A 2HFOA 1U1NA 5FD1A 1LWCB 1NRKA 2Z57B 4DR7J 5E3QA 1OPIA 2GAHC 1S5ZA 3C19A 2X1FA 3GTYX 4OHZA 5DQHA 4DR1F 3R7NB 4FVCA 3IC1A 1KTQA 3THPA 4UT4A 3MI7X 4MKAA 1XIQA 3R5BA 2XO6A 4TQRA 4RU2A 2ZH7A 1EX8A 2H4WB 2EFOA 3UD4P 5A2QY 3GJSB 3R5GA 2X1GA 2HQFA 4ECTA 3MZIA 4YB6A 4LFAJ 4H4OB 3TX0A 2ILZA 2VFSA 1S10A 2COLA 4ZVTB 3K8VA 1LQ9A 1ICEB 2CPFA 3CE8A 3FK4A 3QNWB 1JLGA 5LSLA 1RKIA 2CQ2A 3JTOA 1TFWA 2AP6A 5LMUF 1IKXA 1U1LA 1Z2ZA 3NEKA 4HDGA 4PKDB 4BHQA 3CCRS 3MPVA 2A6OA 1HR0F 5DZ7A 1G1XA 2IMOA 1HWIA 4QWEA 1CS4B 3G8TA 3LQVA 1IUJA 4ED4A 4JV5F 2FB0A 2IVYA 1NPPA 4CNYA 1TKTB 3OR1B 4A8MP 4RW7B 4K59A 4ECVA 1S7IA 4KKOA 4F02A 4QWCA 2JWNA 1XMQJ 1PILA 2OO4A 1RYSA 4OV6A 1FRJA 3MF5A 1Q5VA 1IM4A 1F0XA 4JI4F 2E5GA 1ZM2A 3DC2A 3NCQA 1UA0A 3BV8A 1W26A 3AJ2A 3J7AN 1KQFB 3PFEA 2KT5A 2RIJA 5F8IA 3CMAS 2C22A 2ZC4A 2DIUA 3QT6A 5J2MB 4USJC 3LW5C 3A1YG 1LWEA 5E5NA 3HP6A 2K1RB 4YEAA 3SBMA 5HI7A 3BH6B 3DLEB 2J0SD 4ZA1A 1F60B 4PG6A 5IV3A 4OYWA 1SUQB 3G8QA 2OTJS 3AXKA 4PABA 5DJBA 4JI8F 2FJDB 2XGPA 4U8YA 4YOEA 4ECZA 4DR1J 1FXDA 3BH7B 3PEJA 3SIPB 4TY8A 4B3SF 4LRDA 3V6KA 4IFYA 1JNZB 1TAUA 4KV8A 5DQGA 3ENAA 3AJ1A 3CB4A 3CW2C 5C24B 5HMWA 3ZZ0A 1AZSA 1S4EA 2RB7A 3ITHB 3AXMA 4PCQA 3TUPA 4ZMMA 4DFJA 3ENVA 4ETXA 2DNNA 1YK9A 2O5DA 3I5BA 2IFXA 1FWKA 4BWMA 1Q1KA 1HW9A 1GT8A 4Z37A 3DN9A 3V5RA 1Q7LB 2WVBA 1HWJA 2JH3A 4DQIA 1V9OA 2C3PA 5LMUJ 1DTTA 4HTIA 1H7XA 2RILA 2VC0A 2RHSB 4LIWA 4RNHA 1U6BA 1KS2A 1M1GA 2B9WA 5GAEI 3SYZA 3CCTA 1S6QA 1HR0J 2DHHA 3BDEA 2LU1A 3CCVS 1IBKF 4ANDA 2Q66A 1LWFB 2GFFA 1YJ9S 4EI2A 1FKPB 2IAJA 5LSRA 3CJ4A 4JV5J 4PEOA 1RT6A 2OHDA 4C8MA 3UD3P 1KP6A 2EK6A 3ZTOA 2ILYA 1BY9A 2YTCA 5KG3A 1H2VZ 2RVJA 5E3AA 3RU0A 2XI3A 4X4VA 2E29A 5HJYA 2HWTA 3MCOA 1WNEA 2Z58B 4C48A 3DGPA 3GFYA 2IJRA 5AE1A 3MEDB 1WUUA 3S6EA 3TZXA 6FDRA 3O8WA 4JI4J 3HVTB 4EBDA 4RR5A 3OBIA 4NZ7A 4X4RA 3H20A 3I87A 3ISND 2ZJPQ 1UFLA 1M5KC 4L74A 3IXQA 3MR6A 4LF8F 4DV2F 1YBTA 2CADA 3Q22A 3ILJA 1MU2A 1DQAA 3FUYA 4U67Q 3CO0P 1NJZA 2CPDA 5EHHA 2HNDB 4OI0A 3X1LB 4JI8J 3D67A 5ETTA 2FHJA 1T03A 1O8BA 5DGBA 1R0AB 3QIDA 3M2UA 2MZSA 3MEEB 4I2QA 2RRBA 2ZH2A 1SH2A 4B3SJ 1B70B 1FFSB 1S12A 4CTAA 4IYQA 3MGJA 3NAIA 2JFDA 2ZE2A 1NB2A 3JS9A 1Q16B 1X5PA 2HFVA 3CXCR 2HHQA 1H2TZ 5DQIA 3G96A 4HH0A 4R8UA 1N5SA 4PWUA 4CLLA 2C2ZB 2FVQA 1RBOB 2XLIA 3W3SA 1TVRB 6FD1A 3UR3C 1Y5NB 2ZKUA 4DF8A 4J9VA 3PG9A 4FNHA 1H7WA 3G8SA 2ZDPA 1ZTTA 4B9VA 5KG0A 1D09B 3B4DA 4O4GB 2HAIA 1MG7A 1IBKJ 1AXQA 2Z2LA 5CH7B 3D28A 1ZPWX 3AODA 3AFGA 4NA3A 3EPIA 5KFLA 3MMAA 2HVIA 2L48A 4NLOA 4QU7A 4N47A 4V19J 1RQ0A 3OXLA 2D1CA 2F9DA 5I42A 1RI7A 3GJQB 4I7FA 3L9ZA 2BE2A 2YY3A 4BDPA 3L7OA 3MMJA 4AFFA 1QUVA 2W8KA 1M0SA 1MW7A 1NM2A 5DDQC 3MCMA 4FNIA 2ZWOA 1HI1A 1I3OB 2W25A 4YB1P 2DGSA 4LF1A 1FE4A 1Z2LA 3SV4A 2H3EB 2V67A 3KNAA 3P96A 3FFIB 4DCJB 2DNKA 2O01C 3A8EA 1IR1A 4CLYA 4LF8J 1HKAA 4DFMA 4MYUA 2CQGA 4DV2J 3CMQA 5CHCB 4AD6A 4C11A 4MIAA 5LXYA 4M5KA 1CJTB 5D4OA 1NHVA 4OMFG 4RX6A 2J9DA 4A4JA 1GTHA 4I56A 4OX6A 3GR1A 2XGQA 1HHSA 3VAHA 3MAAB 3HFZB 5I3UA 3DNCA 3L95X 1OO0B 3KHGA 2H4YB 2G13A 4IFVA 1D9DA 4PG8A 1U45A 4O0IA 3PJXA 4NLGA 1S1UA 3D1HA 2EG2A 4TU7A 1DURA 4I67A 1UETA 4USUA 5F8LA 5K8MA 3E8OA 4DV1F 3CEDA 1X8DA 3V6DA 2WOMA 1B0PA 4KE5A 1Y7PA 2CPYA 4I6AA 1FDAA 1K1QA 2HNYA 4EYHB 5HLFA 2E5HA 4ZPWR 1QJHA 3MM6A 2F8HA 4CRJA 3KWMA 1P6TA 3HKZD 4EBCA 2CPZA 2F8EX 2YKMB 1RP5A 4LRCA 1S6OA 2YNFB 3LP2B 1RTHB 3PW4A 2PA3A 4UQGA 4RUCA 3DOMB 1HQEB 1LWCA 3G6ES 3QPIA 3RB4A 1MLAA 2RKIB 5DLFA 4RUHA 1RT5B 4OI3A 2M5YA 1UVNA 2IM0A 3DRYA 1PIEA 2LMIA 3K89A 3QWPA 4A8KA 4FS1A 1JXEA 3AHPA 1SJ3P 1S1WB 3CJSA 1N0VC 1RWNB 1IN0A 2BJ1A 2ZC3A 3DLGB 4WIQA 4LT6A 4TQSA 3OL9A 3HHLD 3BS9A 4USIA 2Q3PA 1XBWA 3W2WB 1FCAA 3BGOP 4H4OA 4O3SA 4C6AA 4CZCA 2LQ5A 2OFGX 5H9FK 4IH6A 5K20B 3NS5A 3JTNA 2N7YA 1NK0A 4ZLLA 3NMRA 3OFEA 4QWBA 3JYTB 3TUJC 1RHMB 1TAQA 4A47A 4DX5A 2M88A 4Y2MA 2AIRB 2HURA 4KRWA 1HNWF 1H73A 5HP1B 4PQUB 4HVZA 1CQMA 2MKIA 1MMDA 3DLJA 3PW5A 1B0VA 4M5GA 2JZ5A 5EX0A 2F1FA 1FDNA 3BN7A 2DGOA 1RAEB 2AJ0A 3NP5A 4ECQA 1BD6A 3A12A 4RW7A 3J7YI 5GAGI 4DV1J 4DBQA 1E6VB 2EPIA 1T05B 4NA1A 2MKKA 5LOQA 2NXEA 2GIRA 4ZK7M 3A8KA 3HFKA 4OZ2A 3V2UC 3FCWA 3K58A 2XYHB 1KSPA 2MSSA 4O3QA 2DHXA 4ERDA 3MTKA 1VR6A 3KJFB 3CO9A 4HT7A 4WYWA 2BW7A 2O66A 2V2VA 2V8PA 5J2MA 4P52A 5ETOA 2L9NA 2K1RA 3GONA 3DLEA 4JI7F 3H40A 4UTGA 4C2MA 4WXWA 1RSCA 1HNVB 2MZTA 1QVGR 5DO2A 2LVWA 2QEXS 4IDKB 1NPKA 4K8RA 2FJXA 3AA9A 5GMEA 1JLEB 2J0WA 3QRPA 3K5OA 1KQKA 1SCJB 4WE1A 1VQLS 4YUDA 3PJWA 4M94A 3R7BB 3IR7B 3CUNA 5EDWA 1RTZA 2Q6BA 1BWEA 2OPSA 3ITHA 2A6MA 1S57A 2EFQA 2ZOGA 2BDPA 2Z56B 4JI3F 4LF2A 2KJWA 3M8PB 1WTFA 4C97A 2Q6CA 3O3LA 1NSKL 2OPRB 2V4JB 3M6WA 4OZ1A 4K7QA 3BBBA 3POTB 4CLKA 2KZMA 2ZWPA 1X4HA 2RF2B 1JLAB 4CO1A 3BKTA 2G0CA 1HNWJ 1RWXB 1HBOB 3K17A 4EK2A 1ZOTA 3MDFA 1TMJA 3NGDA 3DRRB 3W5YA 1UJ5A 2IYIA 2RH3A 2EKNA 1LWFA 2G9OA 4PXEA 1QDUB 2W4CA 1NDKA 1FKPA 2WCXA 2DR9A 2U1AA 4H4KA 1CC7A 5AT1B 2ZH9A 2GA7A 3GYGA 1RWUA 3TUZC 3TA0A 2ZVIA 4NLDA 1Y9OA 1EHWA 1XNQF 2HQ3A 2C42A 3MEDA 2CNLB 2RT3A 1IWGA 2EBEA 3M9OB 3HVTA 3OUYB 1FX2A 5RUBA 2FLPA 1VISA 2R7VA 2IJFA 1UJ4A 2RHQB 3NMAA 4DMZA 3R6GB 2APOA 5F3ZA 3BYRA 2E9ZA 4A46A 3OL8A 4YP3A 1RHQB 1N54B 2KHDA 2EVZA 4MKVA 1IBMF 3I82A 3TNVA 3KLEA 3IGNA 2OIHA 1X5OA 1GX5A 4DXLA 3B82A 2AD9A 1N32F 4JI7J 3SCIE 3O2IA 4ZCLA 1GXLA 4AL6A 3GSIA 1FRHA 3W5ZA 3QGHA 4UY8T 1L3TA 3QT5A 3RBXA 3EVWA 2UV8G 3OVSA 4FBUA 3MEEA 2AWZA 1WF2A 3D2WA 4URSA 1MWZA 5LT5A 4KBIA 3C6TB 3PKMA 4ANCA 1CULB 2DO0A 3HMJG 2BANB 1YJRA 1Q5YA 4J9NA 4OYBA 4U7CA 3NCPA 2Q79A 4GRSA 1OSCA 4Q8EA 2BRKA 3MUMP 2VU5A 2OAUA 4JI3J 4ES3A 1DARA 4KGVB 2MGZA 3LWLA 2LDIA 1CEZA 1VFJA 4QW8A 3PHTA 1FO1A 4X4OA 2ZH8A 4YFUA 2FJEB 4HR2A 1R8CA 4WYLA 2DR6A 4TN2A 3NXZA 5F8HA 3IR5B 1S0OA 2ZVSA 3Q23A 2AJQA 2G2ZA 2ZUGA 1UW4A 3N6NA 1I94F 1RK8A 4O4GA 3MR5A 1O0PA 2W8LA 2XMTA 3H5XA 1U1PA 4P71A 1PC5A 4DCPB 2IA6A 4KGXB 4CO3A 2XCAA 2HZAA 1WI8A 4XPEA 3FNNA 3LPEA 1RT4B 2RMLA 2HBRB 2MEWA 5J1EB 4C8OA 1FFWB 1XNQJ 3M8QB 1WC5A 4ENOA 3C8YA 4TLQA 2HWIA 3EXCX 4ECYA 2MKHA 2ZEJA 1NK9A 2ASYA 2DJWA 2ASDA 3VAJA 2QFIA 4CNZA 3B4MA 2KB2A 3GJRB 2AQ4A 5IM0A 2XULA 2BYCA 3H2LA 3FFIA 3GIJA 1NJWA 1JQGA 4DS5A 1IBMJ 3GZ7A 3EJMA 1ELOA 3FCVA 5K8OA 4G65A 2CZVC 1N32J 2JC0A 3R5AA 3KG1A 5KFSA 1NZ8A 4KC5A 5GAHU 4K5SA 5MLCV 3JQKA 4YR3A 1HHQA 1Y11A 2Y9HA 4UOHA 2EFGA 4ZPCA 3EE3A 2OD6A 1WG4A 3MAAA 3MUVP 3QWUA 4ZS6A 2AF6A 4FXWA 1S79A 3DDIA 1O51A 5HVHA 1SJQA 4TKTA 1F2HA 4DV6F 1UVKA 3TZWA 2UUCF 4OZ5A 3RZAA 5ETMA 2BZ2A 1X0PA 2VPZB 5D78A 5KT7A 2ATLA 1J5EF 1C0TA 3EDQB 3QRRA 3HX9A 2PE8A 2PEHA 1SQFA 1UTAA 1IJEB 1U1MA 4Y2AA 2BR0A 5C2GA 4ED1A 5IQQA 1BWVA 5CQGA 2CZ4A 2ZZMA 4HH1A 2W2PP 5J2PA 4P73A 4PUOB 1JX4A 1DZ5A 2YX1A 4X2BA 1YDLA 3CCES 1TMMA 4B9TA 1I6JA 4DPXA 4TXSA 3MFHA 1I94J 4U9RA 2YKMA 3I5AA 4CO2A 2YNFA 2ACMA 3LP2A 2B4OA 2QZ8A 3K2YA 2W2NP 3DOMA 4Z2XA 1WEZA 4WK1A 2RKIA 1RT5A 4NEZA 3Q83A 1U1QA 3MR2A 3CD7A 4FYXB 1X4DA 2MB0B 3S01A 3LPYA 5KFBA 1S1WA 1BLUA 3O5TB 4L3NA 4QPXA 5L39A 3JAMU 1PC4A 4USHA 3PM9A 3G82B 2RSQA 3P5TL 1R6VA 1QAYA 4U95A 3PIPQ 5ETPA 1WTBA 2ZUAA 2FUG9 3W2WA 3DLBA 4FS2A 1FERA 4WP9A 1YRTA 2RQ4A 3TAQA 1S72S 4LRFA 2VKZG 3EX7B 3DOKB 3D6TB 5DDPC 2FVSA 3OW2R 2QT7A 1VIOA 2XMKA 3NBPB 1N56A 3MHYA 2PEBA 3FEZA 2DGXA 2VB6A 2Z0GA 2GVZB 4DSKA 3CCJS 3TR5A 4KR0B 1SV5B 3EUNA 3CJRA 3KK1A 5H9FJ 4A8SA 3CD5A 4F67A 1VQ4S 3IA0A 2FLNA 3FEYB 1RACB 1RWKB 1OY6A 2WSCC 4DS4A 2A1BA 2DNRA 5CA5A 3VAGA 3RJMB 1FFGB 4IQXA 1YTYA 9ATCB 2YWHA 3R6LB 2KVQE 4EZ9A 3BQ2A 1VBKA 1FKOB 3BSOA 4DV6J 2KTQA 2UUCJ 1BGXT 3ETOA 1B7FA 1T05A 2VFVA 3M1VB 1J5EJ 5CYQB 3K59A 2MY7A 5KG2A 4RUBA 2Y1RI 3ENWA 3E2EA 1AFIA 4KT0C 1DJ0A 4RPFA 2OI2A 1U8SA 4OZJA 4OZLA 5EWFA 4L75A 4DZ6A 2DNPA 4V19X 2ERRA 1UW9A 4OYAA 8AT1B 1GMUA 2RDJA 3SV3A 4ZN1A 4DSLA 5DRKA 1W2BR 2UP1A 2HFZA 1FKAF 2DNOA 3UD5A 1IJFB 1N8RT 1V6HA 2D74B 1U8WA 1MROB 3VVUA 1HNVA 2I1RA 2Y1IA 2C2RA 2E1AA 4IDKA 4B3OB 2VBYA 4ZPBA 2IC3B 3CCSS 5L9XA 3BM7A 1XQIA 4JI6F 1JLEA 2AX0A 1N33F 1N6QB 3I4HX 4MH8A 3OR2B 4JI5F 2WW8A 1TKXB 2NSCA 3IR6B 1TK0A 3QT8A 2CPIA 2U2FA 4B3RF 3CNQP 2W9AA 1C4CA 1VJWA 1D9AA 2YWKA 1MMNA 2RE1A 2KM8B 1NCLA 3M8PA 1VRTA 1AB8A 2OPRA 4TLRA 2AYBA 2HQCA 4DV3F 4ZVFA 1G2EA 2KFNA 3POTA 4ITSA 2IBOA 2IM1A 3HSDA 3VTIA 1LK7A 4LR9A 5A8RB 3SDEB 5K5MA 3HK2A 4JUZA 3KXDA 1KRPA 1WORA 1HBOA 4ZJOA 5CCMA 1RHKB 2V0NA 2ZBRA 3D1QA 1JJ4A 3DRRA 5B08A 5KG1A 2HKEA 4BS2A 5E33A 1S0NA 4ED5A 2AW0A 3ZZZA 1U0HB 4OX7A 1YSJA 4KHRA 3K5NA 4GMKA 1YJ7A 1FWLA 2OEKA 1HWLA 5MAOA 2R2RA 3D3CJ 4ILMA 4UF4A 2C2NA 2DNZA 4EMDA 2FGCA 5T41A 1F6TA 3FSIA 5THWA 4C8KA 4EGLA 3OUYA 1IBLF 3MOZA 3VAMA 1W7WA 5KG4A 2VG6A 2YKPA 2YNIB 2W7AA 2W1BA 4L72B 1R8BA 1LNQA 4ZITA 4F3MA 3ISZA 2XEXA 3UVJA 2W9CA 2BABA 2Z4PA 2EFNA 1UPMB 8RUCA 4WFBQ 3ET6B 1WI6A 1EB0A 4LSNB 4J9QA 3M8YA 1JIHA 2ZH4A 2CJ9A 4ID5B 4JV1A 1Q8LA 2B9YA 2V2QA 2V6AA 5DZ6A 3TJ8A 1XTZA 5A8KB 3ZC4A 2NS1B 3U02A 3MOJB 4JI6J 1S76D 1N33J 4NRTA 2H9ZA 1PBUA 3M9NB 2WW4A 4LBPA 1Y3KA 4JI5J 3C6TA 5HVGA 1NUEA 1X60A 4I4BA 4PG4A 5L1IA 2RQKA 1X9MA 4LQ9A 5F41A 2BANA 2GCFA 3ILOA 2YQ0A 4C0OC 2BMBA 3DOLA 3OD2A 4B3RJ 2R8HA 4TU8A 3H5YA 5J1NA 4NCGB 1NMEB 4DV3J 4PWDB 3HZGA 4ZP6A 4FYWB 4W90B 4Y2IA 2H65B 1KDNA 3OTCA 2VODA 3W2VB 4OX8A 2LYVA 4FPIA 3IMQJ 2XHCA 2F7VA 3MD3A 3OVBA 4O0NA 2LCWA 3LGNA 3N5FA 3Q2SC 1E6YB 4R0EA 2BJ9A 4FF1A 1HQUB 3HHDA 5I3PA 4BCAA 3ZTSA 3IBWA 1YRUA 2YXLA 3U27A 1Y5LB 3BDPA 3LOUA 4Y00A 2R7SA 1G3OA 3B8HA 4ZP8A 1VQ5S 1ZYQA 2G1DA 1NKEA 1BQMB 5IS2A 3R5CA 3JAMY 3UDLA 1RB0A 1R0BG 4QR0A 4WBFA 3I9ZA 2QSFA 2PT0A 5L1KA 4CDIA 2J5AA 4MK7A 1YZ7A 3CTRA 4Q0BB 1DLOB 4QIFA 4PYAA 1N34F 3MMCB 2MSTA 5KFZA 2ZITA 5L1JA 1NSPA 4FZVA 2UVUA 2QLJB 1SKRA 3Q8SB 1RT7B 3DFEA 1SIZA 2R7XA 3I56S 1IBLJ 2YWFA 1DBDA 5L1LA 4XAKA 2BBEA 1JLCA 4RW6B 1R8PA 4DL0C 4A48A 1ZAWA 2Z2ZA 3WQPA 1VS3A 1RTIA 4JP8A 4UY85 3DXBA 2HHHF 3KLIB 2L3MA 2FZCB 4DU7A 4OHXA 2VPXB 1OSDA 4AUKA 3QYYA 3TO8A 3JQMA 3R8YA 1C1CA 4UZCA 5DG8A 5AJ3F 4RZRA 3NLCA 3LGMA 1HPZB 3ILIA 1FEHA 4DN9A 1R3NA 2QGFB 3BR8A 1ITPA 2YWEA 3BO4A 1MWYA 4ETZA 3FSXA 2BJ3A 1U7LA 1RADB 1BHNA 4J9KA 1S7HA 2H48B 2R7TA 3BGRB 2VQFF 1XWLA 3G6YA 2BW2A 3JSRA 1UWAA 1N5YB 1S6PB 3C16A 3M30B 1NKBA 3DHWC 2R7UA 4UZBA 4HLBA 1T9UA 1TUGB 3FBFA 2DEIA 4PPZA 3GFHA 1LFPA 2IPOB 5IT4A 4NLUA 1FXRA 1PKUA 2XHWA 2J8AA 3IAM9 2B4PA 1HW8A 2J7UA 5KT2A 4CCHA 3QT7A 2Y3YA 4NRUA 4PPDA 3RTVA 2MDAA 3JSYA 3RW6A 1WEYA 5A8WA 3CIMA 2KT2A 2EFVA 3D0IE 1U1OA 5FLXY 2DTJA 3A8JA 3NY0A 1U48A 3H25A 2VQEF 4UOGA 4EU0A 1RWPB 1IKVA 1RU2A 4Y65A 1LFWA 1AUSL 1Q78A 3LAKA 3AY0A 3W60A 4H4MB 1N34J 3SFUA 1VQNS 4XDDA 4AYBD 3PYEA 1OQ3A 1EZZB 1CC8A 3CC7S 3TQ1A 2LEAA 3ZNUA 4GO7X 3K7RA 1MSWD 4X62F 2HBZB 1X31C 1YJWS 2CQ3A 4C4WA 5KFDA 4ZLPA 5HSPA 2PDAA 5J2NA 3MAHA 3TX8A 1G6BA 1NJXA 2DH8A 3R2CJ 3DOKA 1KQGB 3ZZOA 3UN3A 5DDOC 3K0JA 2QC3A 2VONA 2HHHJ 3G86A 2BOPA 1K47A 4Y28C 4F4YA 1S59A 4ICLB 3OLBA 5EN1A 5IOLA 2K3KA 3NBPA 3RG6A 2HGLA 4YS2A 3CJ0A 3CMES 2MQLA 4ECXA 2GVZA 3M2RB 3MPWA 4M5MA 3R3TA 1GK8A 5AJ3J 1SV5A 3QGIA 5C42B 1S1XB 1HBMB 3FZBA 3LP1A 1K1SA 4K0KF 2RJZA 2G0JA 2HS3A 4MJKA 4YDXA 2GJFA 5AE3A 2FHOB 1IR2A 3PR4A 4PG5A 5K14B 2AU0A 1IQZA 2VQFJ 2AKWB 2HWHA 1FKOA 2D9OA 2ACYA 4LF9F 3KK3B 2DT9A 4C8YA 2YQ1A 4LJMA 2JJ4D 2X3GA 3MFIA 3M1VA 1UAWA 2ROPA 2M2BA 2KU7A 2BXJA 2FD2A 2DNYA 4X64F 2R7WA 2PD1A 5ETLA 5DG9A 3TEHB 2IRYA 5I3QA 1KKHA 1HD0A 2W9BB 4U7UK 4C3MA 1RZMA 2HEKA 1Q82T 2R8KA 4PXBA 2E1PA 1UZHA 1X4BA 2VQEJ 5LM7E 5KFPA 1WHVA 4ZP7A 2YBVA 2HGMA 5J2QB 5BYRA 3BGUA 3US5A 2D3O1 4B3OA 3VHQA 2K8GA 4X84A 2E7VA 3SCLE 4CT9A 2IC3A 3HSZA 3KLFB 4B3MF 5FJ4A 2X3DA 1N6QA 4MK9A 3OR2A 2MQQA 1NH7A 5EWEA 3N01A 3HXMA 2V50A 4ZPAA 4DV4F 3NL0A 4X62J 3ETMA 1ZM9A 4H54A 2IDEA 2VOPA 4USTA 4FXVA 4OX9F 3E01B 4P6QA 2W24A 1RT2A 1WG5A 2KXHA 4MFBB 2VOOA 4DX7A 3UDVA 1X9SA 4G1PA 5F8MA 4IG0B 4ZVPB 3OTOF 3GV5B 2C3MA 4RO0A 3HD2A 3SDEA 2B8PA 3TP2A 2AT1B 2ZOMA 1Q53A 1NEEA 4H4KC 2W4PA 2O67A 3A3OB 3TUIC 4K0KJ 1L3SA 1U0HA 1Y0HA 1GNKA 2R3VA 1YKWA 4ER8A 1VDHA 1WC3A 3IG1B 4AT1B 3D5MA 5KFYA 1V5VA 3PW2A 1REVA 2QLFB 4F50A 1GTEA 3CVKA 4LF9J 2G0IA 3MPDA 5KTQA 3U1LA 4X66F 3VGSA 4LFCF 3NAHA 5CABA 2XO7A 2WONB 1LV5A 1N36F 2CJAA 1KVJA 1KOHA 4X64J 4X65F 5IQ6A 3DRSB 4B9NA 5H9EK 3QLHA 1ULRA 2BJ8A 1N88A 3IN5A 2YNIA 1S97A 4N8OA 2IIHA 2YX4A 4ED7A 2GAGC 2GX8A 3ZZYA 2AGPA 1S0MA 3NS6A 4CH0S 2RRNA 1BQNB 1GXUA 1FRXA 2YKQA 3D1OA 3ET6A 1RAFB 4LSNA 5D77A 2LFVA 2VIHA 2VDHA 3DDNA 4DLEA 2XSJB 1TL5A 1EETB 3A3PB 1F3FA 4ZCKA 3AOCA 3J81Y 1M5HA 2C1EB 5A8KA 2XZWA 3BREA 4B3MJ 3KUGA 4R0JA 3UR0A 3PYGA 1RWVB 1RUSA 2BACA 2IRXA 3MECA 2C3YA 3TRGA 1R27B 4W92B 2KO1A 2FDNA 4DV4J 2EBGA 2KG0A 2BV3A 5IZHA 3H8YA 3CT9A 4O4RA 3KK2A 2KRBA 2ABYA 4NCGA 3TJ9A 2N82B 5C5JA 4OX9J 4WKYA 4KGZB 2QJ3A 2B43A 4PWDA 3W2VA 2ZJQQ 1T95A 4WK3A 2GC8A 4I2PB 3OTOJ 3T9NA 4F4ZA 4HKQA 1ZM3A 1VK3A 1VCTA 3PO5A 2RNEA 4Q8FA 1JKHB 1JLQB 2ROGA 2XS5A 1P8GA 5BJRA 4E0DA 3CDBA 2QLWA 5IC4B 2XLJA 1BQMA 4MIWA 1WKKA 2V8VA 4J37A 2N3LA 4J9MA 5DDRC 1KLNA 2RQCA 4HYKA 2EC2A 2B6AA 4S0MA 1RU1A 3G4SS 4P72A 2F4VF 3GV7B 2GNKA 4Q0BA 1DLOA 3MM7B 1UEUA 2GMJA 3MMCA 4ZLNA 1CG2A 4X66J 1TFYA 2FJAB 4RW8B 4JYAF 1B4SA 4LFCJ 3ELHA 1N48A 1N36J 3LGHA 1MN7A 4FYDA 2F40A 4X65J 1RT7A 3HT3A 3G87A 4F0HA 3NWRA 3SSQA 4JI0F 3NGRA 3QFHA 4RW6A 3ZZUA 1F3VA 4FXDA 3VAFA 2JC1A 5K9FA 4TU9A 2CPHA 4K4SA 2AMCB 3KLIA 4NCAA 4G1QB 3R1LA 3MAQA 2JEGA 4YHHF 4FF3A 1IXKA 7AT1B 2AV5A 4DR2F 2MLYA 4LR8A 1HPZA 3WDOA 2VDIA 3BBCA 3N4WA 3WHIA 3THVA 2A0FB 1NHUA 4HT5A 3EM1A 1TKZB 3VCDA 4KYZA 2X1BA 3BGRA 4D3GA 1EARA 1RHRB 1PAEX 1S6PA 3M30A 2N7CA 3MWBA 1IM6A 4CQ1A 4O3PA 4NX9A 5CD4H 4F2SA 5KFKA 4TYAA 2MHNA 1IKYA 4OFZA 4FYVB 5IFMA 4XIUA 4CO0A 3D54A 4K4WA 4TY9A 2P6TA 3GV8B 4ZVEA 1H38A 1JLFB 2HHSA 3DCAA 1CPZA 3QAUA 5KFFA 1NK8A 2FVCA 2PFDA 1KLMA 1SXLA 1S48A 3GCWP 1D1UA 5IT9U 1JXVA 1REGX 3SCJE 1WKJA 3V6JA 2XTJP 3OFGA 2CJYB 2F4VJ 3R5DA 2CQCA 1HFEL 4M5HA 3BO3A 3IWNC 4H4MA 4NASA 3UWTA 4DPYA 1BC6A 5BYQA 3RGIA 4HHUA 4RWWA 4JYAJ 2WSFC 3VV2B 1KNZA 4OV1A 4ED8A 3TYTA 2VUGA 2QO3A 1PJ5A 3IS9B 4WTYA 4JI0J 3DMJA 4QIGA 1HMVB 2AGOA 5L9NA 2XQCA 1FJGF 1SI9A 2V5HG 1SVDA 4NE9C 3PIOQ 4DQQA 2YVSA 1LW0B 1B0TA 5GMKa 3QQCD 3CF5Q 2DB1A 2ZOFA 4YHHJ 4YY3F 4MAKA 2JNJA 3M2RA 2VG5B 3MM5A 3GIMA 1WHYA 1RT3A 4R5PB 3W7BA 3CIZA 1CQNA 4F36A 2NCKL 4DR2J 5A6PA 5LJ5Y 3W8PA 5C42A 3MM8A 1S1XA 3BKFA 2AJ4A 2Y8WA 5KAKA 1HBMA 4M5NA 2B4VA 4M1KA 4J9LA 2BEFA 4B9MA 2HIQA 3M8RA 4IRCA 1S1TB 2OPQB 4HHJA 4KIAA 5JVHQ 1TELA 1OJ4A 5K14A 3UI3A 4ED3A 2R2SA 1G7CB 2LKZA 2W2QP 2BM0A 3TWZA 1WC1A 5H1SV 5KFHA 2V63A 2CJXB 3EGNA 2XS7A 5EX3A 4M5LA 2HMIA 3EWGA 4AL5A 2BKPA 1VGYA 2WB4A 4K4TA 4B17A 3L4BC 4OJHA 2W9BA 3HHLB 5E3CA 2JVRA 4KH0B 4LSLB 4EO6A 4Y0FA 3IM8A 1F2GA 2ZD1B 4DL7A 4QCLA 4I69A 3C6UA 3H59A 4NMLA 1VQMS 4K4XA 1WKLA 4NLWA 1BUXA 4I64A 4IG3B 2HNZB 2DGQA 5J2QA 1OIAA 4ES2A 1IR0A 5AE2A 1ZETA 2AZ1A 2J76E 3SMZA 3BQ0A 4QOTA 3RUBL 4OJ3A 3KLFA 3GPAA 4ZIWA 3ZXWA 4N5SA 5L8RC 1K73T 4FKYA 1F9HA 2YKNB 3HJFA 3PHEA 2WAQD 4M5JA 3JTPA 3UDCA 1U4BA 4NLVA 1ZTWA 2CQ1A 4I0WA 5GMDA 1RCOB 1WG1A 4PG7A 2EW9A 5CYMB 2MHEA 4LF6F 1LXNA 2QN6B 3PX0A 1FJGJ 4ZJQA 2QTWA 3E01A 4OL8A 4WZMA 3V4IB 4LQ3A 1D0EA 5KT6A 4UUXA 4DL5A 5T14A 4QYRA 3AOAA 2MYFA 1FESA 1TUWA 4DDFA 3K5PA 4IG0A 3CWJA 2JL9A 3F41A 4YY3J 2NPFA 2VL1A 1NZAA 4CM2A 1FVQA 2EC0A 4MMOA 2VBXA 3HCXA 4AQYF 2CWXA 1UKUA 1WC6A 2ZBIA 4LSZB 2RUGA 1QSLA 3UE2A 3D7SB 4GVBB 5KT5A 1WEXA 2KI2A 1X0FA 2FZGB 2R2UA 5F8JA 3R1HA 2WVEA 1S6UA 4Q2MA 2GMLA 4O23A 2V69A 3ZTRA 4FF4A 2XI2A 3MURP 3BB5A 2WONA 2CQ4A 2WTFA 3H5SA 3DLKA 2DNQA 1YLXA 2BJDA 5C25B 1X9WA 2C2DA 3DRSA 1K8AT 2YKAA 1PAUB 1GMVA 2WK4A 2DXFA 4FYYB 1NDPA 2VFRA 1L5UA 3IWLA 3W9HA 2K3IA 2DK2A 3P3DA 2N4DA 4B9SA 3E3XA 1TZ0A 3VGVA 1S9FA 1YRXA 2P8IA 1IWAA 1Q81T 3IRWP 3VR1A 4GO5X 2M70A 3A8IA 2XSJA 1EETA 3HVRA 3HKWA 5H9EJ 3TA1A 2FY8A 3AD9C 5B7WA 2GQQA 1Q86T 1SJ1A 3HJVA 3PY8A 3UNGC 3D3BJ 1WD6A 4WP8A 2QL7B 3KLHB 2VHGA 2LLZA 1PYOB 2PIIA 1Q8IA 4TNOA 1WOOA 2P9GA 4IOBA 3RB3A 3NWGA 3A4TA 1VBXA 2CAJA 1YITS 3MXHP 4FN5A 2BKOA 4LF6J 4IQMA 1A0OB 4E98A 2LXIA 1TUVA 3EVMA 4WWSA 8ATCB 1S4FA 1SB6A 5GAHI 4BBYA 2IVFB 2K7KA 5T7LB 4IR9A 1CLFA 3LF0A 1OY8A 1OYEA 2C2OB 4F4XA 1P27B 4QWAA 3LA0A 2PSZA 4I2PA 1Y10A 1JK9B 2J6UA 4CWBA 2EXUA 2BRLA 3S8SA 1O6XA 4ALZA 4M5DB 2KDOA 5KFJA 3JXOA 2RU3A 1JKHA 4AQYJ 2HYIB 2YNHA 3V4MA 3OSPA 4D3HA 2R8GA 1VC0A 4EZ6A 4MYTA 2W2MP 3CC4S 2MZJA 1AW0A 3NOGA 3QZ8A 4TY8B 5DM7Q 4PQAA 4OI2A 2XNQA 3VF0B 3ZTPA 2QLXA 3BQ1A 5F0UA 3WC2A 4Z7CA 2NYHA 5HMXA 4PXDA 2HLTA 3MM7A 2HK2A 1FXLA 1AZSB 4P2FA 2CYYA 4RW8A 4KTQA 1P1LA 4OJGA 4ED2A 1Q0NA 2F4FA 5JXSA 4UQTA 3UO0A 2MQOA 1A6LA 3IFEA 3LO3A 3LUYA 3PW0A 1TL7B 1KC8T 2MQPA 3NGUA 3QJLA 2M52A 3CCZA 3IBCB 2F63A 1DTTB 4Y34A 3NGTA 5GADU 4YB5A 2V9WA 2HFNA 4BLGA 3T6JA 2V9KA 2PI5A 2ASLA 3MR3A 2BQRA 2CVEA 4ATNA 4G1QA 3QGGA 2PGCA 2QLBB 1SL2A 4LFBF 1EKSA 1VRQC 2AEMA 3CPWR 2YPYA 2IAJB 3DI6A 1U6FA 1RT6B 2CNOB 4K2XA 4K4YA 3C15A 3RR8A 4OIXA 4PAAA 2E5IA 5CAAA 1TKZA 3RRKA 3TAPA 2DKOB 3NNAA 4JBCA 3HO1A 3QSIA 4OLOA 3PVXA 4ZPTR 4WZQA 2V4RA 1WC4A 2BKNA 2CUYA 3Q8YA 2YH0A 2V8GA 2NZ4A 3KMSA 1VQ8S 4KY3A 3JB9k 5LJ3Y 2FHKA 1GMWD 4DQPA 2O1PA 2WBRA 1PJ7A 2HHUA 2QA1A 4ILLA 4F0KA 5HQ8A 1MU2B 2FJVA 2PFFB 4O3RA 3RB0A 2KFYA 3KUEA 3GILA 4RBUA 1SQEA 2MQ8A 2ROEA 3PXGa 4FKXA 1SJ4P 2XWYA 2XC9A 3CCUS 2DY9A 1T03B 4O3NA 4I2QB 2JSXA 2C2MB 1K44A 4JOUA 1WHXA 2RRAA 2J7WA 1MWQA 3HHKA 2ZE2B 3IRXB 1D3WA 5HANA 1Y4ZB 1CS4A 4LREA 1NH8A 4RWXA 5ETQA 1FRKA 3B6BA 2KH9A 3H42A 2QIFA 3KG0A 4HACB 4ECRA 1TKTA 2Z30B 5DM6Q 3OR1A 2QA2A 1HMVA 2EWHA 3I0SB 1N5VA 2HS0A 2HBQB 2KFZA 1Q8BA 2J9DE 3H98A 4USWA 3A13A 3T19A 1KBRA 1RDRA 3GP9A 2CJKA 4IH5A 2FGOA 1AROP 1CJKB 1LW0A 1Q8KA 3QIPB 1UVLA 4E2FB 1NU4A 5FIIA 4K2JA 2VG5A 4LFBJ 1SC6A 3FMBA 3P49B 3HLUA 3OSNA 2R7OA 4NI2B 2GGPB 3LTOA 1UEKA 1VLOA 3QBCA 4IRDA 2LDYA 2UU9F 3RBZA 3KJVB 2VJVA 1KR4A 2CQPA 1WSVA 1DAXA 2IM3A 4ZN3A 3RRGA 4JI1F 2JEFA 4AXJA 3QATA 1QAXA 3AQPA 1SUQA 2Y1JA 2OPQA 3VAIA 1HWUA 5KG6A 4R25A 3HI9A 3BSAA 1U09A 2NYIA 4DL3A 2CPEA 4XPCA 3AB4B 3HSGA 4ILRA 3KTQA 5KFEA 1SKUB 3NKYA 5GVQA 1B99A 1D8YA 2A2DA 4J90A 3H2UB 3LWMA 2KKHA 3MTJA 4CO4A 2QMUB 4EFAC 5C24A 2LEBA 5KFUA 3KHHA 3RAMA 2CWKA 2XYPB 3VGTA 4C11B 1FTRA 2KVIA 2GV1A 3HHLA 1P1TA 4LSLA 1NO8A 3THTA 1SIWB 1Q4RA 3DRPB 3DLLQ 2BUNA 2ZD1A 1U1KA 4LF7F 2WVFA 3KMQA 4J9UE 3SSSA 4UW2A 1VHFA 1YGYA 3PRBA 2ZFHA 1KHVA 1V3SA 2HHWA 2B9EA 3R9LA 1RLDA 4IG3A 1CJVB 2HNZA 2VPWB 3H2VE 1J2VA 2IJNA 1HNIB 1T8EA 1SC1B 4A8XA 3HSJA 1U49A 4YDDB 6AT1B 2CPJA 2YKNA 4U7UD 2KYZA 2NPIA 1KEKA 2KM8C 2R9LA 5AXLA 3T1YF 1VRUB 1OYDA 3QFWA 4NYZA 4ZCIA 5CYMA 4NOHA 4USKA 2DO4A 1GXTA 2D7SA 3MM6B 4WCEQ 2HG4A 1NJIT 1QAJA 4C8ZA 3D6FB 3VQSA 1EQ0A 3GMGA 3K5MA 2F5GA 2XCPA 3N28A 4EWTA 2HK3A 3C14B 5KT3A 3CCQS 2H5EA 3TA2A 4K4ZA 1EP4B 1RAAB 4DR6J 1OWXA 1WDDA 1T7PA 2VBWA 2UU9J 5DGAA 1R6YA 2LQBA 1U1RA 4JI1J 2GMHA 1YVFA 1LWXA 1L3UA 2DHGA 4CLWA 4GVBA 2HNDA 2FVRA 2UUBF 1C2PA 3TJAA 1DRZA 1RGVA 4C7QA 2L41A 3A3NB 3CJ8A 2ZHAA 1R0AA 3BF4A 3BKUA 3Q8QB 1T94A 4B9UA 1LK5A 1CJUB 4DF4A 2I9SA 4DPWA 5EUHA 2I0XA 2ZHOA 3DYAB 5C25A 5CZVA 5E41A 1J27A 4NYOA 1U47A 2HZVA 1W2IA 1NHKL 2JOQA 4ZVGA 1H3DA 2EG1A 4DSJA 1ZPVA 2XMVA 2FTRA 4ZVRB 2VA2A 1PO6A 1TVRA 1PJ6A 4LF7J 4IO9Q 2Z2MA 1V5IB 4DL6A 1K9MT 1FJ7A 2WVCA 4F8RA 2CJBA 3GQCA 2DGUA 3FGVA 4F4KA 2KG1A 4RW4B 3I55S 3D0HE 2AX1A 4ZDNA 2XMJA 3I4PA 3MCSA 5HAOA 4J9OA 3MCNA 3KLHA 1KVIA 3M2VB 2OPPB 2W01A 3T1YJ 3U7JA 4KHMA 4N77A 3TVKA 5G0RB 2KT3A 4DCOB 4RNMA 3LALA 2A2CA 2L08A 2B5JB 2R7QA 3W5XA 4DSFA 2OKQA 2W4DA 5T7LA 2XM3A 1LW2B 1RAGB 3D0GE 5CCLA 5KFVA 2FHJD 1F1BB 3AT1B 4F4AA 3RBEA 4DV7F 4OYXA 3PO4A 2DXDA 4M5DA 4LF4F 4CP5A 2R42A 4Q44A 2DBBA 4ANEA 1XERA 4OI6A 2D3OR 3GIKA 2BJEA 3UPFA 3GU0A 1YQHA 2E7XA 1Y5IB 1CJTA 1TK5A 3G2XA 4Y3CA 1RWWB 1PG5B 2IDLA 4WE1B 2N4CA 2UUBJ 2G2OA 4I6WA 4EYIB 1KD1T 3GLJA 1TKDA 3W61A 2F8MA 2OPSB 2NREA 4RU9A 4OHWA 1MMLA 5E7OB 4WFAQ 2FC9A 5HATA 2DR8A 4IH7A 2XSFA 4UUWA 4NLTA 2VV5A 5KFIA 2I5JB 2FHMA 1JLBB 1URRA 1TL7A 2J6SA 2FZKB 2XMWA 3RAQA 3NGSA 3NS7B 2HPUA 2KHCA 4KH1B 2ADBA 3QJJA 3QO9B 2UVVA 2PO4A 5BYSA 3MUTP 4ED0A 4MTPA 4OI1A 4Y2CA 4BC9A 2CA9A 3SQGB 2VASA 3GYNA 5A0YB 1CVJA 1ZS6A 4QQBA 1YG0A 5D0RA 2K2PA 4KPCA 1XJWB 1UMJA 3AA8A 4OYZA 2E1MC 3N6LA 1EKRA 3OJSA 3QRQA 4NCBA 4WU2A 2GIFA 2J7KA 2BJ7A 4KO0B 3W65A 5JVGQ 2OH2A 2I2YA 4A8FA 1RTHA 3FBBA 4QIWD 1HQEA 4UOFA 4KFBB 4QYZK 2LQ9A 2DEJA 1NDCA 4NMXA 2EFPA 3NGKA 3BGLA 4QIEA 4OHYA 2VG7B 4CH1A 1QSSA 3DLGA 4DU8A 3CCLS 1S49A 3PYDA 4ZHRB 4HHHA 4NLRA 3Q8VA 2AEJA 4Q5VA 3OXFA 4LUBA 3KLEB 3T5LA 2Y8YA 2FJWA 4DV7J 2G1HA 4FBTA 1AFJA 4LF4J 3EYZA 3JYTA 1M1HA 3AQOA 1U2RA 1SPBP 1XR7A 4IO1A 1NBEB 2E1CA 4WJBA 5FDLB 3SCKE 2J9CA 4XTTA 3CDEA 1FTCA 3F0NA 5EWGA 4NXMF 2HFSA 5HP1A 4PQUA 3IRXA 2OMOA 1EJ7L 2DGTA 1Y00A 1SL1A 4WP3A 4X4PA 4KHPF 1WSRA 1HBUB 3L7UA 4HACA 2ZJRQ 4EO8A 1T3NA 1VYAA 4Q7AA 3D6HB 2MGZB 2HSEB 3JSBA 2NXUA 4OQJA 5DETA 3AB2B 3O1LA 1M5PC 2GHWA 1KVKA 3PZPA 4IUFA 2QMWA 3I0SA 4CLUA 3J7Z5 4O3OA 1SH3A 1VIXA 1E6VA 3UQSA 3ZZRA 2MKJA 3M6XA 3Q0AA 4HI1A 1JXLA 1MNEA 4KPYA 1NLKL 4WFYA 1CJKA 3RYLA 1CSJA 4BC7A 3QIPA 2GVDB 2EI5A 2E7WA 1VOMA 2H51B 5BXIA 5HK4A 3TAMB 1U0SA 1SH0A 2ZZNA 4NI2A 3OT9A 4P10A 2GGPA 1KTVA 2RU9A 1KHWA 4CI0B 3KJVA 5B0AA 2MTLA 3QAEA 2E1RA 4JI2F 4ZKAA 1QM9A 5ETVA 2MKCA 4K4VA 1I51B 4DOZA 3DHXA 3ZO7A 1HI0P 2P9CA 2FYXA 4DLGA 2XBPA 2OUGA 1NK4A 1GFWB 2M4MA 2VBZA 2HFUA 1IQTA 3NNHA 5IM0B 1X4CA 4K5RA 1HIYA 3FSYA 2J0XA 1J5OB 4CIOA 3IBFB 4NLSA 3CJ5A 2N3OA 1T02A 1RHUB 1DY3A 1EQMA 3W64A 2B7CB 5HO4A 1U24A 1TR0A 2QSWA 2V4JA 3DRPA 4C3LA 2ZDOA 2V2KA 2RF2A 5KG5A 2XZTB 1HL6A 2NXNA 1JLAA 3S1TA 2AGQA 2YH1A 2OELA 3P4UB 1RAIB 1CJVA 3PNIA 1M5SA 4NXMJ 1FRLA 2J8SA 2ZM6F 5K8NA 2FIUA 5KOWA 4DX6A 3NCRA 4DJBA 5HL7Q 3OFFA 4M95A 1HNIA 2E9RX 4P2SA 3CDAA 1HYSB 1V3ZA 2LXUA 2HRUA 1T9VA 1HHTP 4KHPJ 4U8VA 3I32A 3EMTA 2CDRB 2IMWP 4JV2A 1O5JA 1M90T 2JFKA 1C0TB 5M2PA 1VRUA 4X4QA 4DQSA 3PRDA 3V6HA 3KJQB 3FBCA 3BBFA 2HS4A 2MJUA 2VH7A 1BE4A 3TZYA 1C4AA 3DDKA 1RYRA 1S9GB 5J2PB 1X4AA 3HVWA 1UA1A 4BWJA 3OHAA 4U6PA 4B3TF 1RLCL 2XY5A 4C98A 5JMNA 3C14A 2F65A 4QIVA 5ADZA 3CD6S 1L3VA 1H2UX 3T1AA 1JJ2R 4NYPA 2HHVA 2CQIA 1EP4A 1QSYA 2ZH5A 3FC9A 3T6BA 3IP0A 2VF3A 2DGWA 3OQ2A 2JHEA 5F9LA 4JI2J 7FD1A 4YR0A 5B09A 1U02A 1OS5A 4ZPVR 4DSEA 1VBZA 3J81j 4W4MA 3L7PA 1WJ9A 5JJBA 1IBCB 1S9EB 4KSEB 1QD1A 1VQSA 5HBMB 2R2TA 4LVNP 3K8WA 3UCZP 2MQNA 1XMOF 1VQYA 3ZZPA 1CJUA 2XY7A 3DRXA 5D15A 4RBTA 5HROB 1YHQS 4FF2A 3DXSX 1N5QA 1C0UB 1RISA 1YJUA 3DYAA 1RCXB 1CULA 1Q79A 2VFUA 3M8WA 2C2EA 2OEJA 2BX6A 1QE1B 5IWAF 2QMXA 4HEA9 3R97A 1VK8A 2HAFA 3M32B 2HQIA 1NB7A 2PMHA 3KK1B 1SC3B 2JLFA 1JNRB 4ZVHA 3L3CA 3EGZA 1SJRA 1Y3JA 2DPJA 5KFXA 2GQCA 3ILLA 4NA2A 4QR1A 2BQ3A 1LKZA 3PV8A 2QA4G 3G6VA 2ZM6J 5E0OA 1FHTA 4RW4A 3FCHA 1RTDB 2GIQA 1RAHB 1R7IA 2B0GA 5F3TA 4YN3B 4G3IA 2IHR1 3PR5B 2X7IA 4P7VA 4DFKA 4MKYA 3M2VA 2OPPA 3R7SB 2FQQB 4PZVA 1RT4A 3QGPA 2POKA 1MN9A 3OHBA 4DN0A 5G0RA 5J1EA 1YIJS 4U96A 2ZHBA 3D6MB 3M8QA 5KFCA 3PX4A 2B5JA 4ZVUB 4LBHA 4A8OA 4G1IA 2W7OA 2HVDA 4N41A 4B3TJ 2Q43A 5M2RA 2QL9B 1LW2A 2LU2A 5IXUA 1G4CA 2CG4A 2V68A 2XLKA 5HQMA 1N0UA 2IBKA 3ISNC 2ZH6A 1QVFR 2R4FA 1OMSA 3DU5A 2CRLA 3ONQA 3HULA 2D69A 3PTWA 2V8HA 1NPRA 3U1MA 4DR3F 3WX4A 1U26A 2LQJA 1FRMA 2E44A 3EPGA 2DITA 4HDHA 2UXDF 1FEEA 1SKWA 1FI4A 1SBRA 3VZIA 4OYMA 1YI2S 2NXCA 3IM9A 5D4PA 5M2UA 3FVYA 4DUYF 2HHXA 1XMOJ 4USMA 3PDNA 2HVEA 3BJYA 2E5JA 2RS8A 4JV0A 1XR5A 3OFHA 1UEVA 1KFSA 2WVDA 2L9WA 2I5JA 3UNYA 1JLBA 1VRTB 2DRBA 2IY5B 1VJQA 1H98A 4LRAA 5KFNA 4AL7A 2UV8A 2ZNZA 4XDCA 5IWAJ 4CYUB 3QO9A 3QJPA 1ZZFA 3GJTB 4FVMA 1YBAA 2ZZTA 1IVZA 3SQGA 3I5CA 3WX8A 2VICA 1A7GE 5AXNA 4F2RA 2F3JA 3IO1A 4ECWA 5A0YA 4QU6A 4L6V3 2V34A 3CCWA 3AAWB 1FX4A 5D0GA 3CSKA 4PUOA 2ZBPA 4WKRA 3FBEA 1OPZA 3DKDA 3UDEA 3Q24A 4NXNF 1Z4UA 1VHIA 2UVRA 4KO0A 2I6WA 3SZ2A 3ZZTA 2GO8A 1EIYB 4UOCA 4KFBA 1AT1B 4F3OA 4DG1B 1EAYC 1URNA 3KHRA 3HFVA 2CG8A 5GAEU 3J80U 1RBAA 2PI4A 2VG7A 1SKSA 3Q89A 2MKSA 4M8LA 2DPIA 5KG7A 4ZJLA 1RXOB 1NKCA 3G82A 4WXOA 2GZOA 2UUAF 3OTBA 1RWOB 2VG6B 5CXTA 5G4DA 4ZHRA 2XMMA 4K4UA 2FLOA 4ZIVA 3IGVA 3X3UA 4QYZJ 1S1VB 1TL1B 4URQU 3MEGB 2W9CB 3UVJB 3PFOA 1NSAA 5I4MA 3W62A 2SXLA 2HIYA 2EKYA 4L3KA 5DG7A 2HLUA 2Y1LB 3RR7A 2KZZA 1B64A 2M7SA 2GO9A 1WOPA 4WF9Q 3MMBB 1RA7A 4DR3J 1YZ6A 4ZPDA 3HHNB 4IR1A 4DL4A 3KDOA 2D3UA 1UJ6A 3FDSA 2KXFA 2HRYA 4PR6A 4PRFA 3W9JA 5FDLA 3H0PA 3VVTA 2UXDJ 3BSCA 2WRMA 2XYGB 1FE0A 4KGMA 1IKWB 1UL3A 1FT8A 3MD1A 4DUTA 1L3KA 1R89A 4DUYJ 3C46A 3UN5A 3W8GA 2V4QA 4P2MA 2G4BA 3DOLB 3M8SA 1FNOA 1HBUA 1F5AA 4YB7A 1TQLA 3CJQA 3I9V9 3HVAA 1FDDA 1HQ2A 2VFTA 4TYBA 4HL9A 1RJJA 2BQUA 4OYPA 5CYQA 3DU6A 1ZBTA 4C3KA 2C28A 3GG1A 3CJKB 3CC2S 4GKKF 5E3RA 2GVDA 1FWPA 2QL5B 3QSYB 4F26A 3G6XA 3EXYA 3H4DA 3TAMA 2HZCA 1D9FA 1UP1A 4MK8A 4NXNJ 3RRHA 5B0DA 4ELVA 3IWXA 2DVIA 2R8IA 2EEYA 1X5TA 3VQTA 5IV4A 2IM2A 4P74A 1MROA 4CLTA 2UVWA 3LANA 1RAJA 2UXCF 4N8NA 4LIRA 2DGVA 4LF5F 4OZ0A 3ADAC 4V1Ak 1PGZA 3EICA 2IRUA 2JVOA 1UFWA 4NLQA 3HDSA 3CD0A 4MKBA 3VGUA 2DYAA 2YNGB 2UUAJ 1JLCB 2MMYA 5U47A 2OGUA 2ALYB 1TKXA 5CZXA 1J5OA 3WC0A 5ETRA 3HHLC 1RTIB 2UZAA 2BE7D 2P6SA 5KFAA 4ES1A 3ZNJ1 4YMEA 1T9XA 4P7TA 3EZUA 5E3PA 1VQKS 2B3TB 3KG4A 1C1CB 3CDWA 4X4UA 4ZLJA 1R8HA 2BA9A 4PXCA 2WBMA 4DSIA 1HNXF 1TL4A 3MEKA 5HJXA 3MPYA 3D68A 5A8RA 2M8DB 1RAOA 3OXGA 3HHEA 1WACA 2K7JA 3JSMB 4CM0A 4QPTA 2XZDB 3SEOA 2HHTA 9RUBA 2HQGA 1P9YA 2OEMA 2CQ0A 3MPUB 2QX0A 4DFPA 4W98A 1YX2A 1HYSA 1SL0A 2RQMA 5KOXA 4EBEA 3C16B 3RAXA 3GE9A 3CULA 3PKYA 5ETSA 2J6TA 2WSEC 3H5UA 1CBKA 1U6ZA 2E9TA 4RKUC 4DHVA 2CXEA 1DFDA 1FD8A 2LA4A 4DR4F 2IVMA 4ECUA 4WU3A 1S9GA 3SI8A 4X4NA 1JJCB 5A8WB 2YKOA 2ZBCA 3PYFA 3LAMA 4GKKJ 3TZZA 4C9DA 4IOAQ 4WTOB 2VPYB 3R27A 4ZP9A 1WF1A 2CQHA 2BOAA 2KJVA 4ELTA 3W1YC 3P45B 3LP0B 1IKVB 1QLNA 1ZA2B 1KONA 2LQ8A 4LVOP 2H54B 1TL3B 3GIIA 2LA6A 2C2KB 1FJEB 2XNRA 4OYOA 4OYIA 4DPOA 2BE9B 1UCNA 1FA0A 4EEYA 1RKJA 4ID5A 1S77D 4LBIA 2K06A 4XO0A 1KQSR 2XS2A 2UXCJ 3M4XA 3O44A 3UFCX 1K0TA 2JDJA 4DX8H 1S9EA 2O3DA 4LF5J 5EGYA 1F5BA 5HBMA 4WIIA 3MM9B 3C2PA 5B0BA 2HQDA 3N9UC 5HROA 5LL6d 3WZ0A 5SZTA 2JRSA 5J2NB 4FPRA 3WIUA 1C0UA 4O44B 5KT4A 4Z7YA 2PA8D 4Q45A 1FD2A 1M5OC 1QE1A 1XNRF 5J1PA 3BZQA 2RS2A 2ZBQA 2P2CB 3G71S 3C3LA 4WFNQ 3M32A 1GQEA 4M63A 3UCGA 1X4EA 2CKWA 1JB0C 5B0CA 1FJCA 4KGKA 4M5IA 2P5VA 1HNXJ 2QV6A 3LP1B 1E6YA 1HQUA 3DM2B 2J0QD 1TTHB 1ZAVA 2HGNA 5F0WA 2DNMA 3Q8PB 2PMWA 4WFXA 3J80Y 2B51A 1RTDA 3T9ZA 4ZOSA 2OFHX 4NL5A 3N5BA 4CLZA 4OHVA 4J9SA 3TANA 3HPOA 2B4UA 2WZ1A 2DXEA 2GS8A 4RUAA 5GADI 1N52B 3M05A 2OP5A 1UVMA 4J7CA 3OV7A 3BO2A 4DR4J 2YX7A 3EZ5A 3NOCA 7FDRA 2KYXA 4FDFA 4DV0F 5L46A 1GH8A 1VQPS 2E5LF 3ZTQA 3V81B 3J7YU 2JLEA 1YWXA 4GC7A 3KLGB 5GAGU 1GEHA 4RNFA 3VALA 3LH2S 2R8JA 1M1KT 4A8QA 2V8DA 1NAQA 2CQBA 2ASJA 1YBUA 2GJ2A 4OZ3A 3FMWA 1FDBA 5FLXU 3D4JA 4OLPA 1JWWA 2OSQA 2ZKTA 3CJ3A 3I0RB 4GKJF 2AJFE 1WOSA 2I38A 4RNNA 2D9PA 3EGVA 2H5JB 1F9FA 4URGA 1T9TA 4C0HA 2HVZA 4K50A 2FPHX 4CO5A 2I8EA 1KFDA 2YWGA 1UWBB 2NXJA 3KYLA 4AE5A 1ROFA 2CPXA 2F9JA 1H6KX 2M3DA 2LXFA 3WBZA 3PW7A 4C0BA 1NXIA 1T9WA 3TVYA 4Y2KA 3PACA 5D4LA 1RT2B 2W7PA 5IC6B 3OTDA 1XNRJ 4CYUA 4L73A 1N5YA 4C8LA 2A18A 1DQ8A 5B0EA 1FVSA 3OTEA 5DLGA 4ZCMA 2MXYA 1P9QC 1XN9A 4WPAA 5LSOA 4EUVA 2LEPA 2AJ1A 4QWDA 4G6VB 1UZDA 4I1TA 1VQ9S 5L38A 2GJIA 4NPOA 3TOQA 1TV6B 2QRRA 4B9LA 2ZH3A 3W66A 1D8ZA 2KXNB 2DR5A 1REVB 1U25A 1X5SA 1N4LA 3KJNB 3WIVA 4DG1A 3PCOB 1WF0A 1H74A 2MY8A 4ED6A 1QUPA 4RNOA 1B7YB 1QAIA 2JX2A 2XG8A 3B54A 3BPDA 3QLHB 1PBAA 2GQ2A 2HRTA 3T3FA 2KRRA 5F8NA 1RABB 4RW9B 4DV0J 3P8BB 4I6YA 2Z2YB 5KFGA 2X1AA 1S1VA 1TL1A 4USVA 3RB6A 2E5LJ 2XMAA 3MEGA 3FJ2A 2DIVA 1FK9B 1H0HB 2CNKB 2GHVC 2JEJA 3AJDA 3UN2A 1XC9A 5HQLA 3GCXP 3MMBA 4ICLA 3NNCA 2A3JA 2C3UA 1XR6A 4TVAB 3OJUA 3KNGA 1HNZF 1M5VC 2IA0A 4GKJJ 2KL8A 2P9EA 1UVJA 2QYCA 5C2CA 2PMZD 1GAOA 1IKWA 3MECB 1YJNS 1OQ6A 2XY6A 2W2OP 2NSBA 3QMQA 3FRZA 3HF5A 1LXJA 3KKFA 1NNDA 2D41A 1X7VA 4HTJA 1KWMA 1PYSB 3I6PA 5KFTA 3BYPA 3VWSA 3G9CA 2X51A 1HARA 3KK2B 3KFWX 2B9XA 4P2XA 3BR9A 3O6QA 1PSDA 4KJIA 1PCAA 1RTJB 4KB7A 1X4FA 2ADCA 3HT0A 1B3TA 3KK3A 1ZM4A 2AYMA 3CJTA 2Y0BB 3T1HF 3R2DJ 2ZNYA 3EVOA 3J7A1 4F25A 3OL7A 1W25A 3CJKA 1FNMA 2RUSA 4B02A 1RT1B 5D3GB 2MKYA 1DTQB 1AYEA 2NQPA 3GYXB 4B08A 4ZVSB 2FLLA 1F5CA 2B6AB 3I31A 4X4SA 5KFQA 4QR2A 3EZOA 3H7HB 2VJUA 3SFGA 2HW3A 2OD4A 4DI6A 3PX6A 2KN4A 2Q1LA 3PJ9A 4YQWA 2ALZA 1HBNB 1U2CA 3VZHA 3TARA 5CD4A 2NUHA 4LRBA 1HWKA 2V94A 2YNGA 1F9EB 1SQGA 3D9BA 4IOCQ 3W9IA 3RBDA 2VA3A 3H90A 2DH9A 2QA4S 2L9DA 2VC1A 2DHSA 1C1BB 1VQ6S 4RBVA 3TI0A 1AA1B 2DISA 3BN4A 4MFBA 1WELA 4A8YA 2DD8S 3CDUA 3GB0A 2OLWA 3I96A 2NUUG 1HI8A 2LECA 2Z8QA 3KLVA 1HNZJ 4FP9A 2RD5C 3JSMA 3J81U 3C66A 3FKBA 1VC6A 3ENQA 1Z1ZA 2FC8A 1HLWA 1ZA1B 3JQJA 4DEZA 4NZ6A 2XMUA 3FEXB 1LEOA 1VQOS 1JJHA 3BGFA 2NZCA 4QZVB 5LXRA 3IG1A 2MZRA 2M0GB 1QTMA 1ZAXA 1RHJB 2QG9B 1IKYB 1VI7A 3T1HJ 3SQOP 5CYJA 3BPSP 2RDDA 2MPUA 3Q86A 4X4TA 4GC6A 3CJ2A 3IAS9 3BEGB 1A9NB 1KLMB 1JLGB 5HN0A 3K5LA 2Y0SD 5A6WA 2H1YA 3LP0A 1FF2A 1IKXB 3UW1A 4ECSA 2B56A 3HM9A 3T5HA 1NK6A 1BQNA 4NZ0A 1TL3A 5ETKA 4CLPA 3T5KA 1WHWA 2GW8A 2AHOB 1BQXA 4N7TA 5B0GA 3GFXA 2CDQA 2UXBF 2DNGA 3M6UA 2YQ3A 4DQRA 1XMBA 4LMZA 5BR8F 5D0EA 1I5OB 2B8QA 3MM9A 1QTNB 4HI2A 3DMJB 2IYGA 4KKOB 3OL6A 3BSNA 3AOBA 4IKAA 2BVZA 3D66A 4O44A 2MQMA 3M7VA 2OSRA 1V3RA 4QW9A 1VMBA 4J5OA 4NLXA 3EDRB 3N79A 4P75A 4NLPA
chains in the Genus database with same CATH topology
2IDLA 1S12A 2G0JA 4PEOA 2G0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IDL A;  1S12 A;  2G0J A;  4PEO A;  2G0I A; 
#chains in the Genus database with same CATH topology
 1S99 A;  3MM5 B;  1RT3 B;  1UFK A;  1BXN A;  5LMN F;  5F8G A;  4F04 B;  2BM1 A;  2YWW A;  2VD3 A;  4JB8 B;  3MM8 B;  5HVF A;  2R7R A;  3DLH A;  1LWE B;  1T11 A;  5IT9 Y;  3HZE A;  2MJN A;  2VZ9 A;  2UUW A;  3DM2 A;  1ZH5 A;  3B78 A;  3NG8 A;  2RAQ A;  1JLQ A;  3ZFV A;  5E2Q A;  5D6G A;  4YR2 A;  1ZZN A;  3FRY A;  2QFJ A;  1YJT A;  2AJ2 A;  2D3Z A;  3M6V A;  3OPK A;  4IFY B;  4KV8 B;  3P6Y C;  2FJB B;  4PYD A;  5JUM A;  4DUZ F;  1GX6 A;  1VC5 A;  4OZN A;  4DPT A;  3N6M A;  2DCL A;  2HMI B;  5KFO A;  3VAK A;  4DV5 F;  4NWB A;  1S0V A;  3H4B A;  3P5B P;  5C7P A;  5AXM A;  3OLA A;  2V2Z A;  3AH6 A;  5KFR A;  1RBL A;  3R5J B;  4P9S A;  3F44 A;  2B7B B;  1HA1 A;  4QJV A;  5A2Q U;  3M9M B;  1T0T V;  4RJV A;  3V81 A;  3KLG A;  1R8A A;  3C6U B;  4KQZ A;  2AZ3 A;  2DRA A;  5KFM A;  1VBY A;  2FVP A;  1VLY A;  1AUD A;  1WDT A;  1S6Q B;  2CFX A;  3J7Z T;  2PN6 A;  3PEH A;  3EGW B;  3I0R A;  1SC4 B;  2UXB J;  2EK1 A;  2DNH A;  4CH7 A;  1LOU A;  4DWI A;  3DGV A;  2WHO A;  3K57 A;  3HD1 A;  2OJ3 A;  3T5J A;  5HMZ A;  4KAI A;  5D8H B;  4F7V A;  5BR8 J;  3ULH A;  2DH7 A;  1X4G A;  2H5I B;  5ITH A;  2OML A;  1UWB A;  3N0V A;  2AEF A;  1FNX H;  3DGP B;  3M8Z A;  1R31 A;  2JLG A;  2FY1 A;  3TEG A;  2UUT A;  2CIM A;  3FQL A;  1RA6 A;  3L09 A;  2E66 A;  3AD7 C;  1FRI A;  4RLE A;  2LP4 A;  5SUH A;  2CJQ A;  5IT0 A;  3UCU P;  5LMN J;  3Q8U A;  1U2F A;  3PRV A;  4I68 A;  1TK8 A;  5K8P A;  4F3Q A;  4MT1 A;  3GWC A;  4QBU A;  1JLF A;  2ZH1 A;  3F56 A;  1TV6 A;  4NLY A;  4ZVO B;  4CLS A;  2XB2 D;  5D4N A;  3GSD A;  3TQE A;  1QY7 A;  4XK8 C;  3CGI A;  3U1N A;  4CT8 A;  3M2U B;  2HHP A;  4ZVQ B;  1UVI A;  4F4W A;  1XK8 A;  4CTA B;  4DR5 F;  1R43 A;  3DLK B;  3GIR A;  5F9N A;  4ELU A;  3KDN A;  4Q2L A;  4DUZ J;  4DV5 J;  2HBY B;  4R8U B;  1KN6 A;  4F0M A;  4RW9 A;  3FZ2 A;  1NSQ A;  4MIB A;  1DHM A;  4DPU A;  1I1G A;  2MLZ A;  3F73 A;  2DCU B;  3IS9 A;  1TU0 B;  3TVZ A;  1FK9 A;  2DY1 A;  2OTL S;  5HMY A;  1TP7 A;  5B0F A;  5D0H A;  2DR7 A;  1NK7 A;  1NDL A;  2GHP A;  2NLW A;  2RDI A;  1HD1 A;  5AXK A;  3KOA A;  4R5P A;  4J9P A;  4DR7 F;  4DR6 F;  3MR7 A;  2JEI A;  3MMA B;  3Q8R B;  3SSR A;  3RW7 A;  2M9K A;  1WC0 A;  5I42 B;  4CLF A;  2C3O A;  1T3O A;  4I7F B;  2BE2 B;  4C8N A;  5A76 A;  1BMQ B;  1S1T A;  3SXL A;  1NK5 A;  2WB1 D;  1APS A;  1K0V A;  1RTJ A;  1R0C B;  1N5T A;  1NJY A;  4AXI A;  2DNL A;  2NR0 A;  4LFA F;  1ACM B;  1RWM B;  2A10 A;  2ATC B;  4DL2 A;  2YPZ A;  2QE5 A;  4WFZ A;  1OY9 A;  4Y6I A;  2PC6 A;  2XWX A;  1UPP A;  1T9Y A;  4OI4 A;  4LR7 A;  2CVI A;  4NEY A;  4GVL A;  4Q43 A;  1H72 C;  4E8U A;  1VQ7 S;  2YNH B;  4PWW A;  3E51 A;  1WWH A;  1RT1 A;  5D3G A;  1RE1 B;  2G2Y A;  2J9E A;  4OJ1 A;  1DTQ A;  1GMW A;  1JMT A;  2MZQ A;  2DHA A;  5KFW A;  1YJV A;  4N76 A;  1XEZ A;  1Q7Y T;  1KOO A;  2AYE A;  1Q95 G;  3Q2T C;  4IRK A;  3GR0 A;  4DZD A;  5I3U B;  2AYG A;  4DR5 J;  4L76 A;  4IFV B;  4A8W A;  5ETN A;  2MZ1 A;  1S1U B;  3W63 A;  4RL1 A;  1HBN A;  3TW0 A;  4J91 A;  3QZ7 A;  3V6D B;  2CQD A;  2WOM B;  3CCM S;  3T41 A;  2CZ9 A;  1XMQ F;  3GG0 A;  1DQ9 A;  2HNY B;  2CNN B;  2HVH A;  3ICL A;  5HLF B;  3AD8 C;  2M8H A;  3KUH A;  1C1B A;  3S7R A;  4N56 A;  2VKR A;  3OVA A;  3V4I A;  1PYT A;  4ID8 A;  3FQK A;  2MLX A;  1SJF A;  2QYG A;  3DI6 B;  3GFZ A;  3KHL A;  2DRD A;  4J9R A;  3C15 B;  3NRB A;  5DS7 A;  2HFO A;  1U1N A;  5FD1 A;  1LWC B;  1NRK A;  2Z57 B;  4DR7 J;  5E3Q A;  1OPI A;  2GAH C;  1S5Z A;  3C19 A;  2X1F A;  3GTY X;  4OHZ A;  5DQH A;  4DR1 F;  3R7N B;  4FVC A;  3IC1 A;  1KTQ A;  3THP A;  4UT4 A;  3MI7 X;  4MKA A;  1XIQ A;  3R5B A;  2XO6 A;  4TQR A;  4RU2 A;  2ZH7 A;  1EX8 A;  2H4W B;  2EFO A;  3UD4 P;  5A2Q Y;  3GJS B;  3R5G A;  2X1G A;  2HQF A;  4ECT A;  3MZI A;  4YB6 A;  4LFA J;  4H4O B;  3TX0 A;  2ILZ A;  2VFS A;  1S10 A;  2COL A;  4ZVT B;  3K8V A;  1LQ9 A;  1ICE B;  2CPF A;  3CE8 A;  3FK4 A;  3QNW B;  1JLG A;  5LSL A;  1RKI A;  2CQ2 A;  3JTO A;  1TFW A;  2AP6 A;  5LMU F;  1IKX A;  1U1L A;  1Z2Z A;  3NEK A;  4HDG A;  4PKD B;  4BHQ A;  3CCR S;  3MPV A;  2A6O A;  1HR0 F;  5DZ7 A;  1G1X A;  2IMO A;  1HWI A;  4QWE A;  1CS4 B;  3G8T A;  3LQV A;  1IUJ A;  4ED4 A;  4JV5 F;  2FB0 A;  2IVY A;  1NPP A;  4CNY A;  1TKT B;  3OR1 B;  4A8M P;  4RW7 B;  4K59 A;  4ECV A;  1S7I A;  4KKO A;  4F02 A;  4QWC A;  2JWN A;  1XMQ J;  1PIL A;  2OO4 A;  1RYS A;  4OV6 A;  1FRJ A;  3MF5 A;  1Q5V A;  1IM4 A;  1F0X A;  4JI4 F;  2E5G A;  1ZM2 A;  3DC2 A;  3NCQ A;  1UA0 A;  3BV8 A;  1W26 A;  3AJ2 A;  3J7A N;  1KQF B;  3PFE A;  2KT5 A;  2RIJ A;  5F8I A;  3CMA S;  2C22 A;  2ZC4 A;  2DIU A;  3QT6 A;  5J2M B;  4USJ C;  3LW5 C;  3A1Y G;  1LWE A;  5E5N A;  3HP6 A;  2K1R B;  4YEA A;  3SBM A;  5HI7 A;  3BH6 B;  3DLE B;  2J0S D;  4ZA1 A;  1F60 B;  4PG6 A;  5IV3 A;  4OYW A;  1SUQ B;  3G8Q A;  2OTJ S;  3AXK A;  4PAB A;  5DJB A;  4JI8 F;  2FJD B;  2XGP A;  4U8Y A;  4YOE A;  4ECZ A;  4DR1 J;  1FXD A;  3BH7 B;  3PEJ A;  3SIP B;  4TY8 A;  4B3S F;  4LRD A;  3V6K A;  4IFY A;  1JNZ B;  1TAU A;  4KV8 A;  5DQG A;  3ENA A;  3AJ1 A;  3CB4 A;  3CW2 C;  5C24 B;  5HMW A;  3ZZ0 A;  1AZS A;  1S4E A;  2RB7 A;  3ITH B;  3AXM A;  4PCQ A;  3TUP A;  4ZMM A;  4DFJ A;  3ENV A;  4ETX A;  2DNN A;  1YK9 A;  2O5D A;  3I5B A;  2IFX A;  1FWK A;  4BWM A;  1Q1K A;  1HW9 A;  1GT8 A;  4Z37 A;  3DN9 A;  3V5R A;  1Q7L B;  2WVB A;  1HWJ A;  2JH3 A;  4DQI A;  1V9O A;  2C3P A;  5LMU J;  1DTT A;  4HTI A;  1H7X A;  2RIL A;  2VC0 A;  2RHS B;  4LIW A;  4RNH A;  1U6B A;  1KS2 A;  1M1G A;  2B9W A;  5GAE I;  3SYZ A;  3CCT A;  1S6Q A;  1HR0 J;  2DHH A;  3BDE A;  2LU1 A;  3CCV S;  1IBK F;  4AND A;  2Q66 A;  1LWF B;  2GFF A;  1YJ9 S;  4EI2 A;  1FKP B;  2IAJ A;  5LSR A;  3CJ4 A;  4JV5 J;  4PEO A;  1RT6 A;  2OHD A;  4C8M A;  3UD3 P;  1KP6 A;  2EK6 A;  3ZTO A;  2ILY A;  1BY9 A;  2YTC A;  5KG3 A;  1H2V Z;  2RVJ A;  5E3A A;  3RU0 A;  2XI3 A;  4X4V A;  2E29 A;  5HJY A;  2HWT A;  3MCO A;  1WNE A;  2Z58 B;  4C48 A;  3DGP A;  3GFY A;  2IJR A;  5AE1 A;  3MED B;  1WUU A;  3S6E A;  3TZX A;  6FDR A;  3O8W A;  4JI4 J;  3HVT B;  4EBD A;  4RR5 A;  3OBI A;  4NZ7 A;  4X4R A;  3H20 A;  3I87 A;  3ISN D;  2ZJP Q;  1UFL A;  1M5K C;  4L74 A;  3IXQ A;  3MR6 A;  4LF8 F;  4DV2 F;  1YBT A;  2CAD A;  3Q22 A;  3ILJ A;  1MU2 A;  1DQA A;  3FUY A;  4U67 Q;  3CO0 P;  1NJZ A;  2CPD A;  5EHH A;  2HND B;  4OI0 A;  3X1L B;  4JI8 J;  3D67 A;  5ETT A;  2FHJ A;  1T03 A;  1O8B A;  5DGB A;  1R0A B;  3QID A;  3M2U A;  2MZS A;  3MEE B;  4I2Q A;  2RRB A;  2ZH2 A;  1SH2 A;  4B3S J;  1B70 B;  1FFS B;  1S12 A;  4CTA A;  4IYQ A;  3MGJ A;  3NAI A;  2JFD A;  2ZE2 A;  1NB2 A;  3JS9 A;  1Q16 B;  1X5P A;  2HFV A;  3CXC R;  2HHQ A;  1H2T Z;  5DQI A;  3G96 A;  4HH0 A;  4R8U A;  1N5S A;  4PWU A;  4CLL A;  2C2Z B;  2FVQ A;  1RBO B;  2XLI A;  3W3S A;  1TVR B;  6FD1 A;  3UR3 C;  1Y5N B;  2ZKU A;  4DF8 A;  4J9V A;  3PG9 A;  4FNH A;  1H7W A;  3G8S A;  2ZDP A;  1ZTT A;  4B9V A;  5KG0 A;  1D09 B;  3B4D A;  4O4G B;  2HAI A;  1MG7 A;  1IBK J;  1AXQ A;  2Z2L A;  5CH7 B;  3D28 A;  1ZPW X;  3AOD A;  3AFG A;  4NA3 A;  3EPI A;  5KFL A;  3MMA A;  2HVI A;  2L48 A;  4NLO A;  4QU7 A;  4N47 A;  4V19 J;  1RQ0 A;  3OXL A;  2D1C A;  2F9D A;  5I42 A;  1RI7 A;  3GJQ B;  4I7F A;  3L9Z A;  2BE2 A;  2YY3 A;  4BDP A;  3L7O A;  3MMJ A;  4AFF A;  1QUV A;  2W8K A;  1M0S A;  1MW7 A;  1NM2 A;  5DDQ C;  3MCM A;  4FNI A;  2ZWO A;  1HI1 A;  1I3O B;  2W25 A;  4YB1 P;  2DGS A;  4LF1 A;  1FE4 A;  1Z2L A;  3SV4 A;  2H3E B;  2V67 A;  3KNA A;  3P96 A;  3FFI B;  4DCJ B;  2DNK A;  2O01 C;  3A8E A;  1IR1 A;  4CLY A;  4LF8 J;  1HKA A;  4DFM A;  4MYU A;  2CQG A;  4DV2 J;  3CMQ A;  5CHC B;  4AD6 A;  4C11 A;  4MIA A;  5LXY A;  4M5K A;  1CJT B;  5D4O A;  1NHV A;  4OMF G;  4RX6 A;  2J9D A;  4A4J A;  1GTH A;  4I56 A;  4OX6 A;  3GR1 A;  2XGQ A;  1HHS A;  3VAH A;  3MAA B;  3HFZ B;  5I3U A;  3DNC A;  3L95 X;  1OO0 B;  3KHG A;  2H4Y B;  2G13 A;  4IFV A;  1D9D A;  4PG8 A;  1U45 A;  4O0I A;  3PJX A;  4NLG A;  1S1U A;  3D1H A;  2EG2 A;  4TU7 A;  1DUR A;  4I67 A;  1UET A;  4USU A;  5F8L A;  5K8M A;  3E8O A;  4DV1 F;  3CED A;  1X8D A;  3V6D A;  2WOM A;  1B0P A;  4KE5 A;  1Y7P A;  2CPY A;  4I6A A;  1FDA A;  1K1Q A;  2HNY A;  4EYH B;  5HLF A;  2E5H A;  4ZPW R;  1QJH A;  3MM6 A;  2F8H A;  4CRJ A;  3KWM A;  1P6T A;  3HKZ D;  4EBC A;  2CPZ A;  2F8E X;  2YKM B;  1RP5 A;  4LRC A;  1S6O A;  2YNF B;  3LP2 B;  1RTH B;  3PW4 A;  2PA3 A;  4UQG A;  4RUC A;  3DOM B;  1HQE B;  1LWC A;  3G6E S;  3QPI A;  3RB4 A;  1MLA A;  2RKI B;  5DLF A;  4RUH A;  1RT5 B;  4OI3 A;  2M5Y A;  1UVN A;  2IM0 A;  3DRY A;  1PIE A;  2LMI A;  3K89 A;  3QWP A;  4A8K A;  4FS1 A;  1JXE A;  3AHP A;  1SJ3 P;  1S1W B;  3CJS A;  1N0V C;  1RWN B;  1IN0 A;  2BJ1 A;  2ZC3 A;  3DLG B;  4WIQ A;  4LT6 A;  4TQS A;  3OL9 A;  3HHL D;  3BS9 A;  4USI A;  2Q3P A;  1XBW A;  3W2W B;  1FCA A;  3BGO P;  4H4O A;  4O3S A;  4C6A A;  4CZC A;  2LQ5 A;  2OFG X;  5H9F K;  4IH6 A;  5K20 B;  3NS5 A;  3JTN A;  2N7Y A;  1NK0 A;  4ZLL A;  3NMR A;  3OFE A;  4QWB A;  3JYT B;  3TUJ C;  1RHM B;  1TAQ A;  4A47 A;  4DX5 A;  2M88 A;  4Y2M A;  2AIR B;  2HUR A;  4KRW A;  1HNW F;  1H73 A;  5HP1 B;  4PQU B;  4HVZ A;  1CQM A;  2MKI A;  1MMD A;  3DLJ A;  3PW5 A;  1B0V A;  4M5G A;  2JZ5 A;  5EX0 A;  2F1F A;  1FDN A;  3BN7 A;  2DGO A;  1RAE B;  2AJ0 A;  3NP5 A;  4ECQ A;  1BD6 A;  3A12 A;  4RW7 A;  3J7Y I;  5GAG I;  4DV1 J;  4DBQ A;  1E6V B;  2EPI A;  1T05 B;  4NA1 A;  2MKK A;  5LOQ A;  2NXE A;  2GIR A;  4ZK7 M;  3A8K A;  3HFK A;  4OZ2 A;  3V2U C;  3FCW A;  3K58 A;  2XYH B;  1KSP A;  2MSS A;  4O3Q A;  2DHX A;  4ERD A;  3MTK A;  1VR6 A;  3KJF B;  3CO9 A;  4HT7 A;  4WYW A;  2BW7 A;  2O66 A;  2V2V A;  2V8P A;  5J2M A;  4P52 A;  5ETO A;  2L9N A;  2K1R A;  3GON A;  3DLE A;  4JI7 F;  3H40 A;  4UTG A;  4C2M A;  4WXW A;  1RSC A;  1HNV B;  2MZT A;  1QVG R;  5DO2 A;  2LVW A;  2QEX S;  4IDK B;  1NPK A;  4K8R A;  2FJX A;  3AA9 A;  5GME A;  1JLE B;  2J0W A;  3QRP A;  3K5O A;  1KQK A;  1SCJ B;  4WE1 A;  1VQL S;  4YUD A;  3PJW A;  4M94 A;  3R7B B;  3IR7 B;  3CUN A;  5EDW A;  1RTZ A;  2Q6B A;  1BWE A;  2OPS A;  3ITH A;  2A6M A;  1S57 A;  2EFQ A;  2ZOG A;  2BDP A;  2Z56 B;  4JI3 F;  4LF2 A;  2KJW A;  3M8P B;  1WTF A;  4C97 A;  2Q6C A;  3O3L A;  1NSK L;  2OPR B;  2V4J B;  3M6W A;  4OZ1 A;  4K7Q A;  3BBB A;  3POT B;  4CLK A;  2KZM A;  2ZWP A;  1X4H A;  2RF2 B;  1JLA B;  4CO1 A;  3BKT A;  2G0C A;  1HNW J;  1RWX B;  1HBO B;  3K17 A;  4EK2 A;  1ZOT A;  3MDF A;  1TMJ A;  3NGD A;  3DRR B;  3W5Y A;  1UJ5 A;  2IYI A;  2RH3 A;  2EKN A;  1LWF A;  2G9O A;  4PXE A;  1QDU B;  2W4C A;  1NDK A;  1FKP A;  2WCX A;  2DR9 A;  2U1A A;  4H4K A;  1CC7 A;  5AT1 B;  2ZH9 A;  2GA7 A;  3GYG A;  1RWU A;  3TUZ C;  3TA0 A;  2ZVI A;  4NLD A;  1Y9O A;  1EHW A;  1XNQ F;  2HQ3 A;  2C42 A;  3MED A;  2CNL B;  2RT3 A;  1IWG A;  2EBE A;  3M9O B;  3HVT A;  3OUY B;  1FX2 A;  5RUB A;  2FLP A;  1VIS A;  2R7V A;  2IJF A;  1UJ4 A;  2RHQ B;  3NMA A;  4DMZ A;  3R6G B;  2APO A;  5F3Z A;  3BYR A;  2E9Z A;  4A46 A;  3OL8 A;  4YP3 A;  1RHQ B;  1N54 B;  2KHD A;  2EVZ A;  4MKV A;  1IBM F;  3I82 A;  3TNV A;  3KLE A;  3IGN A;  2OIH A;  1X5O A;  1GX5 A;  4DXL A;  3B82 A;  2AD9 A;  1N32 F;  4JI7 J;  3SCI E;  3O2I A;  4ZCL A;  1GXL A;  4AL6 A;  3GSI A;  1FRH A;  3W5Z A;  3QGH A;  4UY8 T;  1L3T A;  3QT5 A;  3RBX A;  3EVW A;  2UV8 G;  3OVS A;  4FBU A;  3MEE A;  2AWZ A;  1WF2 A;  3D2W A;  4URS A;  1MWZ A;  5LT5 A;  4KBI A;  3C6T B;  3PKM A;  4ANC A;  1CUL B;  2DO0 A;  3HMJ G;  2BAN B;  1YJR A;  1Q5Y A;  4J9N A;  4OYB A;  4U7C A;  3NCP A;  2Q79 A;  4GRS A;  1OSC A;  4Q8E A;  2BRK A;  3MUM P;  2VU5 A;  2OAU A;  4JI3 J;  4ES3 A;  1DAR A;  4KGV B;  2MGZ A;  3LWL A;  2LDI A;  1CEZ A;  1VFJ A;  4QW8 A;  3PHT A;  1FO1 A;  4X4O A;  2ZH8 A;  4YFU A;  2FJE B;  4HR2 A;  1R8C A;  4WYL A;  2DR6 A;  4TN2 A;  3NXZ A;  5F8H A;  3IR5 B;  1S0O A;  2ZVS A;  3Q23 A;  2AJQ A;  2G2Z A;  2ZUG A;  1UW4 A;  3N6N A;  1I94 F;  1RK8 A;  4O4G A;  3MR5 A;  1O0P A;  2W8L A;  2XMT A;  3H5X A;  1U1P A;  4P71 A;  1PC5 A;  4DCP B;  2IA6 A;  4KGX B;  4CO3 A;  2XCA A;  2HZA A;  1WI8 A;  4XPE A;  3FNN A;  3LPE A;  1RT4 B;  2RML A;  2HBR B;  2MEW A;  5J1E B;  4C8O A;  1FFW B;  1XNQ J;  3M8Q B;  1WC5 A;  4ENO A;  3C8Y A;  4TLQ A;  2HWI A;  3EXC X;  4ECY A;  2MKH A;  2ZEJ A;  1NK9 A;  2ASY A;  2DJW A;  2ASD A;  3VAJ A;  2QFI A;  4CNZ A;  3B4M A;  2KB2 A;  3GJR B;  2AQ4 A;  5IM0 A;  2XUL A;  2BYC A;  3H2L A;  3FFI A;  3GIJ A;  1NJW A;  1JQG A;  4DS5 A;  1IBM J;  3GZ7 A;  3EJM A;  1ELO A;  3FCV A;  5K8O A;  4G65 A;  2CZV C;  1N32 J;  2JC0 A;  3R5A A;  3KG1 A;  5KFS A;  1NZ8 A;  4KC5 A;  5GAH U;  4K5S A;  5MLC V;  3JQK A;  4YR3 A;  1HHQ A;  1Y11 A;  2Y9H A;  4UOH A;  2EFG A;  4ZPC A;  3EE3 A;  2OD6 A;  1WG4 A;  3MAA A;  3MUV P;  3QWU A;  4ZS6 A;  2AF6 A;  4FXW A;  1S79 A;  3DDI A;  1O51 A;  5HVH A;  1SJQ A;  4TKT A;  1F2H A;  4DV6 F;  1UVK A;  3TZW A;  2UUC F;  4OZ5 A;  3RZA A;  5ETM A;  2BZ2 A;  1X0P A;  2VPZ B;  5D78 A;  5KT7 A;  2ATL A;  1J5E F;  1C0T A;  3EDQ B;  3QRR A;  3HX9 A;  2PE8 A;  2PEH A;  1SQF A;  1UTA A;  1IJE B;  1U1M A;  4Y2A A;  2BR0 A;  5C2G A;  4ED1 A;  5IQQ A;  1BWV A;  5CQG A;  2CZ4 A;  2ZZM A;  4HH1 A;  2W2P P;  5J2P A;  4P73 A;  4PUO B;  1JX4 A;  1DZ5 A;  2YX1 A;  4X2B A;  1YDL A;  3CCE S;  1TMM A;  4B9T A;  1I6J A;  4DPX A;  4TXS A;  3MFH A;  1I94 J;  4U9R A;  2YKM A;  3I5A A;  4CO2 A;  2YNF A;  2ACM A;  3LP2 A;  2B4O A;  2QZ8 A;  3K2Y A;  2W2N P;  3DOM A;  4Z2X A;  1WEZ A;  4WK1 A;  2RKI A;  1RT5 A;  4NEZ A;  3Q83 A;  1U1Q A;  3MR2 A;  3CD7 A;  4FYX B;  1X4D A;  2MB0 B;  3S01 A;  3LPY A;  5KFB A;  1S1W A;  1BLU A;  3O5T B;  4L3N A;  4QPX A;  5L39 A;  3JAM U;  1PC4 A;  4USH A;  3PM9 A;  3G82 B;  2RSQ A;  3P5T L;  1R6V A;  1QAY A;  4U95 A;  3PIP Q;  5ETP A;  1WTB A;  2ZUA A;  2FUG 9;  3W2W A;  3DLB A;  4FS2 A;  1FER A;  4WP9 A;  1YRT A;  2RQ4 A;  3TAQ A;  1S72 S;  4LRF A;  2VKZ G;  3EX7 B;  3DOK B;  3D6T B;  5DDP C;  2FVS A;  3OW2 R;  2QT7 A;  1VIO A;  2XMK A;  3NBP B;  1N56 A;  3MHY A;  2PEB A;  3FEZ A;  2DGX A;  2VB6 A;  2Z0G A;  2GVZ B;  4DSK A;  3CCJ S;  3TR5 A;  4KR0 B;  1SV5 B;  3EUN A;  3CJR A;  3KK1 A;  5H9F J;  4A8S A;  3CD5 A;  4F67 A;  1VQ4 S;  3IA0 A;  2FLN A;  3FEY B;  1RAC B;  1RWK B;  1OY6 A;  2WSC C;  4DS4 A;  2A1B A;  2DNR A;  5CA5 A;  3VAG A;  3RJM B;  1FFG B;  4IQX A;  1YTY A;  9ATC B;  2YWH A;  3R6L B;  2KVQ E;  4EZ9 A;  3BQ2 A;  1VBK A;  1FKO B;  3BSO A;  4DV6 J;  2KTQ A;  2UUC J;  1BGX T;  3ETO A;  1B7F A;  1T05 A;  2VFV A;  3M1V B;  1J5E J;  5CYQ B;  3K59 A;  2MY7 A;  5KG2 A;  4RUB A;  2Y1R I;  3ENW A;  3E2E A;  1AFI A;  4KT0 C;  1DJ0 A;  4RPF A;  2OI2 A;  1U8S A;  4OZJ A;  4OZL A;  5EWF A;  4L75 A;  4DZ6 A;  2DNP A;  4V19 X;  2ERR A;  1UW9 A;  4OYA A;  8AT1 B;  1GMU A;  2RDJ A;  3SV3 A;  4ZN1 A;  4DSL A;  5DRK A;  1W2B R;  2UP1 A;  2HFZ A;  1FKA F;  2DNO A;  3UD5 A;  1IJF B;  1N8R T;  1V6H A;  2D74 B;  1U8W A;  1MRO B;  3VVU A;  1HNV A;  2I1R A;  2Y1I A;  2C2R A;  2E1A A;  4IDK A;  4B3O B;  2VBY A;  4ZPB A;  2IC3 B;  3CCS S;  5L9X A;  3BM7 A;  1XQI A;  4JI6 F;  1JLE A;  2AX0 A;  1N33 F;  1N6Q B;  3I4H X;  4MH8 A;  3OR2 B;  4JI5 F;  2WW8 A;  1TKX B;  2NSC A;  3IR6 B;  1TK0 A;  3QT8 A;  2CPI A;  2U2F A;  4B3R F;  3CNQ P;  2W9A A;  1C4C A;  1VJW A;  1D9A A;  2YWK A;  1MMN A;  2RE1 A;  2KM8 B;  1NCL A;  3M8P A;  1VRT A;  1AB8 A;  2OPR A;  4TLR A;  2AYB A;  2HQC A;  4DV3 F;  4ZVF A;  1G2E A;  2KFN A;  3POT A;  4ITS A;  2IBO A;  2IM1 A;  3HSD A;  3VTI A;  1LK7 A;  4LR9 A;  5A8R B;  3SDE B;  5K5M A;  3HK2 A;  4JUZ A;  3KXD A;  1KRP A;  1WOR A;  1HBO A;  4ZJO A;  5CCM A;  1RHK B;  2V0N A;  2ZBR A;  3D1Q A;  1JJ4 A;  3DRR A;  5B08 A;  5KG1 A;  2HKE A;  4BS2 A;  5E33 A;  1S0N A;  4ED5 A;  2AW0 A;  3ZZZ A;  1U0H B;  4OX7 A;  1YSJ A;  4KHR A;  3K5N A;  4GMK A;  1YJ7 A;  1FWL A;  2OEK A;  1HWL A;  5MAO A;  2R2R A;  3D3C J;  4ILM A;  4UF4 A;  2C2N A;  2DNZ A;  4EMD A;  2FGC A;  5T41 A;  1F6T A;  3FSI A;  5THW A;  4C8K A;  4EGL A;  3OUY A;  1IBL F;  3MOZ A;  3VAM A;  1W7W A;  5KG4 A;  2VG6 A;  2YKP A;  2YNI B;  2W7A A;  2W1B A;  4L72 B;  1R8B A;  1LNQ A;  4ZIT A;  4F3M A;  3ISZ A;  2XEX A;  3UVJ A;  2W9C A;  2BAB A;  2Z4P A;  2EFN A;  1UPM B;  8RUC A;  4WFB Q;  3ET6 B;  1WI6 A;  1EB0 A;  4LSN B;  4J9Q A;  3M8Y A;  1JIH A;  2ZH4 A;  2CJ9 A;  4ID5 B;  4JV1 A;  1Q8L A;  2B9Y A;  2V2Q A;  2V6A A;  5DZ6 A;  3TJ8 A;  1XTZ A;  5A8K B;  3ZC4 A;  2NS1 B;  3U02 A;  3MOJ B;  4JI6 J;  1S76 D;  1N33 J;  4NRT A;  2H9Z A;  1PBU A;  3M9N B;  2WW4 A;  4LBP A;  1Y3K A;  4JI5 J;  3C6T A;  5HVG A;  1NUE A;  1X60 A;  4I4B A;  4PG4 A;  5L1I A;  2RQK A;  1X9M A;  4LQ9 A;  5F41 A;  2BAN A;  2GCF A;  3ILO A;  2YQ0 A;  4C0O C;  2BMB A;  3DOL A;  3OD2 A;  4B3R J;  2R8H A;  4TU8 A;  3H5Y A;  5J1N A;  4NCG B;  1NME B;  4DV3 J;  4PWD B;  3HZG A;  4ZP6 A;  4FYW B;  4W90 B;  4Y2I A;  2H65 B;  1KDN A;  3OTC A;  2VOD A;  3W2V B;  4OX8 A;  2LYV A;  4FPI A;  3IMQ J;  2XHC A;  2F7V A;  3MD3 A;  3OVB A;  4O0N A;  2LCW A;  3LGN A;  3N5F A;  3Q2S C;  1E6Y B;  4R0E A;  2BJ9 A;  4FF1 A;  1HQU B;  3HHD A;  5I3P A;  4BCA A;  3ZTS A;  3IBW A;  1YRU A;  2YXL A;  3U27 A;  1Y5L B;  3BDP A;  3LOU A;  4Y00 A;  2R7S A;  1G3O A;  3B8H A;  4ZP8 A;  1VQ5 S;  1ZYQ A;  2G1D A;  1NKE A;  1BQM B;  5IS2 A;  3R5C A;  3JAM Y;  3UDL A;  1RB0 A;  1R0B G;  4QR0 A;  4WBF A;  3I9Z A;  2QSF A;  2PT0 A;  5L1K A;  4CDI A;  2J5A A;  4MK7 A;  1YZ7 A;  3CTR A;  4Q0B B;  1DLO B;  4QIF A;  4PYA A;  1N34 F;  3MMC B;  2MST A;  5KFZ A;  2ZIT A;  5L1J A;  1NSP A;  4FZV A;  2UVU A;  2QLJ B;  1SKR A;  3Q8S B;  1RT7 B;  3DFE A;  1SIZ A;  2R7X A;  3I56 S;  1IBL J;  2YWF A;  1DBD A;  5L1L A;  4XAK A;  2BBE A;  1JLC A;  4RW6 B;  1R8P A;  4DL0 C;  4A48 A;  1ZAW A;  2Z2Z A;  3WQP A;  1VS3 A;  1RTI A;  4JP8 A;  4UY8 5;  3DXB A;  2HHH F;  3KLI B;  2L3M A;  2FZC B;  4DU7 A;  4OHX A;  2VPX B;  1OSD A;  4AUK A;  3QYY A;  3TO8 A;  3JQM A;  3R8Y A;  1C1C A;  4UZC A;  5DG8 A;  5AJ3 F;  4RZR A;  3NLC A;  3LGM A;  1HPZ B;  3ILI A;  1FEH A;  4DN9 A;  1R3N A;  2QGF B;  3BR8 A;  1ITP A;  2YWE A;  3BO4 A;  1MWY A;  4ETZ A;  3FSX A;  2BJ3 A;  1U7L A;  1RAD B;  1BHN A;  4J9K A;  1S7H A;  2H48 B;  2R7T A;  3BGR B;  2VQF F;  1XWL A;  3G6Y A;  2BW2 A;  3JSR A;  1UWA A;  1N5Y B;  1S6P B;  3C16 A;  3M30 B;  1NKB A;  3DHW C;  2R7U A;  4UZB A;  4HLB A;  1T9U A;  1TUG B;  3FBF A;  2DEI A;  4PPZ A;  3GFH A;  1LFP A;  2IPO B;  5IT4 A;  4NLU A;  1FXR A;  1PKU A;  2XHW A;  2J8A A;  3IAM 9;  2B4P A;  1HW8 A;  2J7U A;  5KT2 A;  4CCH A;  3QT7 A;  2Y3Y A;  4NRU A;  4PPD A;  3RTV A;  2MDA A;  3JSY A;  3RW6 A;  1WEY A;  5A8W A;  3CIM A;  2KT2 A;  2EFV A;  3D0I E;  1U1O A;  5FLX Y;  2DTJ A;  3A8J A;  3NY0 A;  1U48 A;  3H25 A;  2VQE F;  4UOG A;  4EU0 A;  1RWP B;  1IKV A;  1RU2 A;  4Y65 A;  1LFW A;  1AUS L;  1Q78 A;  3LAK A;  3AY0 A;  3W60 A;  4H4M B;  1N34 J;  3SFU A;  1VQN S;  4XDD A;  4AYB D;  3PYE A;  1OQ3 A;  1EZZ B;  1CC8 A;  3CC7 S;  3TQ1 A;  2LEA A;  3ZNU A;  4GO7 X;  3K7R A;  1MSW D;  4X62 F;  2HBZ B;  1X31 C;  1YJW S;  2CQ3 A;  4C4W A;  5KFD A;  4ZLP A;  5HSP A;  2PDA A;  5J2N A;  3MAH A;  3TX8 A;  1G6B A;  1NJX A;  2DH8 A;  3R2C J;  3DOK A;  1KQG B;  3ZZO A;  3UN3 A;  5DDO C;  3K0J A;  2QC3 A;  2VON A;  2HHH J;  3G86 A;  2BOP A;  1K47 A;  4Y28 C;  4F4Y A;  1S59 A;  4ICL B;  3OLB A;  5EN1 A;  5IOL A;  2K3K A;  3NBP A;  3RG6 A;  2HGL A;  4YS2 A;  3CJ0 A;  3CME S;  2MQL A;  4ECX A;  2GVZ A;  3M2R B;  3MPW A;  4M5M A;  3R3T A;  1GK8 A;  5AJ3 J;  1SV5 A;  3QGI A;  5C42 B;  1S1X B;  1HBM B;  3FZB A;  3LP1 A;  1K1S A;  4K0K F;  2RJZ A;  2G0J A;  2HS3 A;  4MJK A;  4YDX A;  2GJF A;  5AE3 A;  2FHO B;  1IR2 A;  3PR4 A;  4PG5 A;  5K14 B;  2AU0 A;  1IQZ A;  2VQF J;  2AKW B;  2HWH A;  1FKO A;  2D9O A;  2ACY A;  4LF9 F;  3KK3 B;  2DT9 A;  4C8Y A;  2YQ1 A;  4LJM A;  2JJ4 D;  2X3G A;  3MFI A;  3M1V A;  1UAW A;  2ROP A;  2M2B A;  2KU7 A;  2BXJ A;  2FD2 A;  2DNY A;  4X64 F;  2R7W A;  2PD1 A;  5ETL A;  5DG9 A;  3TEH B;  2IRY A;  5I3Q A;  1KKH A;  1HD0 A;  2W9B B;  4U7U K;  4C3M A;  1RZM A;  2HEK A;  1Q82 T;  2R8K A;  4PXB A;  2E1P A;  1UZH A;  1X4B A;  2VQE J;  5LM7 E;  5KFP A;  1WHV A;  4ZP7 A;  2YBV A;  2HGM A;  5J2Q B;  5BYR A;  3BGU A;  3US5 A;  2D3O 1;  4B3O A;  3VHQ A;  2K8G A;  4X84 A;  2E7V A;  3SCL E;  4CT9 A;  2IC3 A;  3HSZ A;  3KLF B;  4B3M F;  5FJ4 A;  2X3D A;  1N6Q A;  4MK9 A;  3OR2 A;  2MQQ A;  1NH7 A;  5EWE A;  3N01 A;  3HXM A;  2V50 A;  4ZPA A;  4DV4 F;  3NL0 A;  4X62 J;  3ETM A;  1ZM9 A;  4H54 A;  2IDE A;  2VOP A;  4UST A;  4FXV A;  4OX9 F;  3E01 B;  4P6Q A;  2W24 A;  1RT2 A;  1WG5 A;  2KXH A;  4MFB B;  2VOO A;  4DX7 A;  3UDV A;  1X9S A;  4G1P A;  5F8M A;  4IG0 B;  4ZVP B;  3OTO F;  3GV5 B;  2C3M A;  4RO0 A;  3HD2 A;  3SDE A;  2B8P A;  3TP2 A;  2AT1 B;  2ZOM A;  1Q53 A;  1NEE A;  4H4K C;  2W4P A;  2O67 A;  3A3O B;  3TUI C;  4K0K J;  1L3S A;  1U0H A;  1Y0H A;  1GNK A;  2R3V A;  1YKW A;  4ER8 A;  1VDH A;  1WC3 A;  3IG1 B;  4AT1 B;  3D5M A;  5KFY A;  1V5V A;  3PW2 A;  1REV A;  2QLF B;  4F50 A;  1GTE A;  3CVK A;  4LF9 J;  2G0I A;  3MPD A;  5KTQ A;  3U1L A;  4X66 F;  3VGS A;  4LFC F;  3NAH A;  5CAB A;  2XO7 A;  2WON B;  1LV5 A;  1N36 F;  2CJA A;  1KVJ A;  1KOH A;  4X64 J;  4X65 F;  5IQ6 A;  3DRS B;  4B9N A;  5H9E K;  3QLH A;  1ULR A;  2BJ8 A;  1N88 A;  3IN5 A;  2YNI A;  1S97 A;  4N8O A;  2IIH A;  2YX4 A;  4ED7 A;  2GAG C;  2GX8 A;  3ZZY A;  2AGP A;  1S0M A;  3NS6 A;  4CH0 S;  2RRN A;  1BQN B;  1GXU A;  1FRX A;  2YKQ A;  3D1O A;  3ET6 A;  1RAF B;  4LSN A;  5D77 A;  2LFV A;  2VIH A;  2VDH A;  3DDN A;  4DLE A;  2XSJ B;  1TL5 A;  1EET B;  3A3P B;  1F3F A;  4ZCK A;  3AOC A;  3J81 Y;  1M5H A;  2C1E B;  5A8K A;  2XZW A;  3BRE A;  4B3M J;  3KUG A;  4R0J A;  3UR0 A;  3PYG A;  1RWV B;  1RUS A;  2BAC A;  2IRX A;  3MEC A;  2C3Y A;  3TRG A;  1R27 B;  4W92 B;  2KO1 A;  2FDN A;  4DV4 J;  2EBG A;  2KG0 A;  2BV3 A;  5IZH A;  3H8Y A;  3CT9 A;  4O4R A;  3KK2 A;  2KRB A;  2ABY A;  4NCG A;  3TJ9 A;  2N82 B;  5C5J A;  4OX9 J;  4WKY A;  4KGZ B;  2QJ3 A;  2B43 A;  4PWD A;  3W2V A;  2ZJQ Q;  1T95 A;  4WK3 A;  2GC8 A;  4I2P B;  3OTO J;  3T9N A;  4F4Z A;  4HKQ A;  1ZM3 A;  1VK3 A;  1VCT A;  3PO5 A;  2RNE A;  4Q8F A;  1JKH B;  1JLQ B;  2ROG A;  2XS5 A;  1P8G A;  5BJR A;  4E0D A;  3CDB A;  2QLW A;  5IC4 B;  2XLJ A;  1BQM A;  4MIW A;  1WKK A;  2V8V A;  4J37 A;  2N3L A;  4J9M A;  5DDR C;  1KLN A;  2RQC A;  4HYK A;  2EC2 A;  2B6A A;  4S0M A;  1RU1 A;  3G4S S;  4P72 A;  2F4V F;  3GV7 B;  2GNK A;  4Q0B A;  1DLO A;  3MM7 B;  1UEU A;  2GMJ A;  3MMC A;  4ZLN A;  1CG2 A;  4X66 J;  1TFY A;  2FJA B;  4RW8 B;  4JYA F;  1B4S A;  4LFC J;  3ELH A;  1N48 A;  1N36 J;  3LGH A;  1MN7 A;  4FYD A;  2F40 A;  4X65 J;  1RT7 A;  3HT3 A;  3G87 A;  4F0H A;  3NWR A;  3SSQ A;  4JI0 F;  3NGR A;  3QFH A;  4RW6 A;  3ZZU A;  1F3V A;  4FXD A;  3VAF A;  2JC1 A;  5K9F A;  4TU9 A;  2CPH A;  4K4S A;  2AMC B;  3KLI A;  4NCA A;  4G1Q B;  3R1L A;  3MAQ A;  2JEG A;  4YHH F;  4FF3 A;  1IXK A;  7AT1 B;  2AV5 A;  4DR2 F;  2MLY A;  4LR8 A;  1HPZ A;  3WDO A;  2VDI A;  3BBC A;  3N4W A;  3WHI A;  3THV A;  2A0F B;  1NHU A;  4HT5 A;  3EM1 A;  1TKZ B;  3VCD A;  4KYZ A;  2X1B A;  3BGR A;  4D3G A;  1EAR A;  1RHR B;  1PAE X;  1S6P A;  3M30 A;  2N7C A;  3MWB A;  1IM6 A;  4CQ1 A;  4O3P A;  4NX9 A;  5CD4 H;  4F2S A;  5KFK A;  4TYA A;  2MHN A;  1IKY A;  4OFZ A;  4FYV B;  5IFM A;  4XIU A;  4CO0 A;  3D54 A;  4K4W A;  4TY9 A;  2P6T A;  3GV8 B;  4ZVE A;  1H38 A;  1JLF B;  2HHS A;  3DCA A;  1CPZ A;  3QAU A;  5KFF A;  1NK8 A;  2FVC A;  2PFD A;  1KLM A;  1SXL A;  1S48 A;  3GCW P;  1D1U A;  5IT9 U;  1JXV A;  1REG X;  3SCJ E;  1WKJ A;  3V6J A;  2XTJ P;  3OFG A;  2CJY B;  2F4V J;  3R5D A;  2CQC A;  1HFE L;  4M5H A;  3BO3 A;  3IWN C;  4H4M A;  4NAS A;  3UWT A;  4DPY A;  1BC6 A;  5BYQ A;  3RGI A;  4HHU A;  4RWW A;  4JYA J;  2WSF C;  3VV2 B;  1KNZ A;  4OV1 A;  4ED8 A;  3TYT A;  2VUG A;  2QO3 A;  1PJ5 A;  3IS9 B;  4WTY A;  4JI0 J;  3DMJ A;  4QIG A;  1HMV B;  2AGO A;  5L9N A;  2XQC A;  1FJG F;  1SI9 A;  2V5H G;  1SVD A;  4NE9 C;  3PIO Q;  4DQQ A;  2YVS A;  1LW0 B;  1B0T A;  5GMK a;  3QQC D;  3CF5 Q;  2DB1 A;  2ZOF A;  4YHH J;  4YY3 F;  4MAK A;  2JNJ A;  3M2R A;  2VG5 B;  3MM5 A;  3GIM A;  1WHY A;  1RT3 A;  4R5P B;  3W7B A;  3CIZ A;  1CQN A;  4F36 A;  2NCK L;  4DR2 J;  5A6P A;  5LJ5 Y;  3W8P A;  5C42 A;  3MM8 A;  1S1X A;  3BKF A;  2AJ4 A;  2Y8W A;  5KAK A;  1HBM A;  4M5N A;  2B4V A;  4M1K A;  4J9L A;  2BEF A;  4B9M A;  2HIQ A;  3M8R A;  4IRC A;  1S1T B;  2OPQ B;  4HHJ A;  4KIA A;  5JVH Q;  1TEL A;  1OJ4 A;  5K14 A;  3UI3 A;  4ED3 A;  2R2S A;  1G7C B;  2LKZ A;  2W2Q P;  2BM0 A;  3TWZ A;  1WC1 A;  5H1S V;  5KFH A;  2V63 A;  2CJX B;  3EGN A;  2XS7 A;  5EX3 A;  4M5L A;  2HMI A;  3EWG A;  4AL5 A;  2BKP A;  1VGY A;  2WB4 A;  4K4T A;  4B17 A;  3L4B C;  4OJH A;  2W9B A;  3HHL B;  5E3C A;  2JVR A;  4KH0 B;  4LSL B;  4EO6 A;  4Y0F A;  3IM8 A;  1F2G A;  2ZD1 B;  4DL7 A;  4QCL A;  4I69 A;  3C6U A;  3H59 A;  4NML A;  1VQM S;  4K4X A;  1WKL A;  4NLW A;  1BUX A;  4I64 A;  4IG3 B;  2HNZ B;  2DGQ A;  5J2Q A;  1OIA A;  4ES2 A;  1IR0 A;  5AE2 A;  1ZET A;  2AZ1 A;  2J76 E;  3SMZ A;  3BQ0 A;  4QOT A;  3RUB L;  4OJ3 A;  3KLF A;  3GPA A;  4ZIW A;  3ZXW A;  4N5S A;  5L8R C;  1K73 T;  4FKY A;  1F9H A;  2YKN B;  3HJF A;  3PHE A;  2WAQ D;  4M5J A;  3JTP A;  3UDC A;  1U4B A;  4NLV A;  1ZTW A;  2CQ1 A;  4I0W A;  5GMD A;  1RCO B;  1WG1 A;  4PG7 A;  2EW9 A;  5CYM B;  2MHE A;  4LF6 F;  1LXN A;  2QN6 B;  3PX0 A;  1FJG J;  4ZJQ A;  2QTW A;  3E01 A;  4OL8 A;  4WZM A;  3V4I B;  4LQ3 A;  1D0E A;  5KT6 A;  4UUX A;  4DL5 A;  5T14 A;  4QYR A;  3AOA A;  2MYF A;  1FES A;  1TUW A;  4DDF A;  3K5P A;  4IG0 A;  3CWJ A;  2JL9 A;  3F41 A;  4YY3 J;  2NPF A;  2VL1 A;  1NZA A;  4CM2 A;  1FVQ A;  2EC0 A;  4MMO A;  2VBX A;  3HCX A;  4AQY F;  2CWX A;  1UKU A;  1WC6 A;  2ZBI A;  4LSZ B;  2RUG A;  1QSL A;  3UE2 A;  3D7S B;  4GVB B;  5KT5 A;  1WEX A;  2KI2 A;  1X0F A;  2FZG B;  2R2U A;  5F8J A;  3R1H A;  2WVE A;  1S6U A;  4Q2M A;  2GML A;  4O23 A;  2V69 A;  3ZTR A;  4FF4 A;  2XI2 A;  3MUR P;  3BB5 A;  2WON A;  2CQ4 A;  2WTF A;  3H5S A;  3DLK A;  2DNQ A;  1YLX A;  2BJD A;  5C25 B;  1X9W A;  2C2D A;  3DRS A;  1K8A T;  2YKA A;  1PAU B;  1GMV A;  2WK4 A;  2DXF A;  4FYY B;  1NDP A;  2VFR A;  1L5U A;  3IWL A;  3W9H A;  2K3I A;  2DK2 A;  3P3D A;  2N4D A;  4B9S A;  3E3X A;  1TZ0 A;  3VGV A;  1S9F A;  1YRX A;  2P8I A;  1IWA A;  1Q81 T;  3IRW P;  3VR1 A;  4GO5 X;  2M70 A;  3A8I A;  2XSJ A;  1EET A;  3HVR A;  3HKW A;  5H9E J;  3TA1 A;  2FY8 A;  3AD9 C;  5B7W A;  2GQQ A;  1Q86 T;  1SJ1 A;  3HJV A;  3PY8 A;  3UNG C;  3D3B J;  1WD6 A;  4WP8 A;  2QL7 B;  3KLH B;  2VHG A;  2LLZ A;  1PYO B;  2PII A;  1Q8I A;  4TNO A;  1WOO A;  2P9G A;  4IOB A;  3RB3 A;  3NWG A;  3A4T A;  1VBX A;  2CAJ A;  1YIT S;  3MXH P;  4FN5 A;  2BKO A;  4LF6 J;  4IQM A;  1A0O B;  4E98 A;  2LXI A;  1TUV A;  3EVM A;  4WWS A;  8ATC B;  1S4F A;  1SB6 A;  5GAH I;  4BBY A;  2IVF B;  2K7K A;  5T7L B;  4IR9 A;  1CLF A;  3LF0 A;  1OY8 A;  1OYE A;  2C2O B;  4F4X A;  1P27 B;  4QWA A;  3LA0 A;  2PSZ A;  4I2P A;  1Y10 A;  1JK9 B;  2J6U A;  4CWB A;  2EXU A;  2BRL A;  3S8S A;  1O6X A;  4ALZ A;  4M5D B;  2KDO A;  5KFJ A;  3JXO A;  2RU3 A;  1JKH A;  4AQY J;  2HYI B;  2YNH A;  3V4M A;  3OSP A;  4D3H A;  2R8G A;  1VC0 A;  4EZ6 A;  4MYT A;  2W2M P;  3CC4 S;  2MZJ A;  1AW0 A;  3NOG A;  3QZ8 A;  4TY8 B;  5DM7 Q;  4PQA A;  4OI2 A;  2XNQ A;  3VF0 B;  3ZTP A;  2QLX A;  3BQ1 A;  5F0U A;  3WC2 A;  4Z7C A;  2NYH A;  5HMX A;  4PXD A;  2HLT A;  3MM7 A;  2HK2 A;  1FXL A;  1AZS B;  4P2F A;  2CYY A;  4RW8 A;  4KTQ A;  1P1L A;  4OJG A;  4ED2 A;  1Q0N A;  2F4F A;  5JXS A;  4UQT A;  3UO0 A;  2MQO A;  1A6L A;  3IFE A;  3LO3 A;  3LUY A;  3PW0 A;  1TL7 B;  1KC8 T;  2MQP A;  3NGU A;  3QJL A;  2M52 A;  3CCZ A;  3IBC B;  2F63 A;  1DTT B;  4Y34 A;  3NGT A;  5GAD U;  4YB5 A;  2V9W A;  2HFN A;  4BLG A;  3T6J A;  2V9K A;  2PI5 A;  2ASL A;  3MR3 A;  2BQR A;  2CVE A;  4ATN A;  4G1Q A;  3QGG A;  2PGC A;  2QLB B;  1SL2 A;  4LFB F;  1EKS A;  1VRQ C;  2AEM A;  3CPW R;  2YPY A;  2IAJ B;  3DI6 A;  1U6F A;  1RT6 B;  2CNO B;  4K2X A;  4K4Y A;  3C15 A;  3RR8 A;  4OIX A;  4PAA A;  2E5I A;  5CAA A;  1TKZ A;  3RRK A;  3TAP A;  2DKO B;  3NNA A;  4JBC A;  3HO1 A;  3QSI A;  4OLO A;  3PVX A;  4ZPT R;  4WZQ A;  2V4R A;  1WC4 A;  2BKN A;  2CUY A;  3Q8Y A;  2YH0 A;  2V8G A;  2NZ4 A;  3KMS A;  1VQ8 S;  4KY3 A;  3JB9 k;  5LJ3 Y;  2FHK A;  1GMW D;  4DQP A;  2O1P A;  2WBR A;  1PJ7 A;  2HHU A;  2QA1 A;  4ILL A;  4F0K A;  5HQ8 A;  1MU2 B;  2FJV A;  2PFF B;  4O3R A;  3RB0 A;  2KFY A;  3KUE A;  3GIL A;  4RBU A;  1SQE A;  2MQ8 A;  2ROE A;  3PXG a;  4FKX A;  1SJ4 P;  2XWY A;  2XC9 A;  3CCU S;  2DY9 A;  1T03 B;  4O3N A;  4I2Q B;  2JSX A;  2C2M B;  1K44 A;  4JOU A;  1WHX A;  2RRA A;  2J7W A;  1MWQ A;  3HHK A;  2ZE2 B;  3IRX B;  1D3W A;  5HAN A;  1Y4Z B;  1CS4 A;  4LRE A;  1NH8 A;  4RWX A;  5ETQ A;  1FRK A;  3B6B A;  2KH9 A;  3H42 A;  2QIF A;  3KG0 A;  4HAC B;  4ECR A;  1TKT A;  2Z30 B;  5DM6 Q;  3OR1 A;  2QA2 A;  1HMV A;  2EWH A;  3I0S B;  1N5V A;  2HS0 A;  2HBQ B;  2KFZ A;  1Q8B A;  2J9D E;  3H98 A;  4USW A;  3A13 A;  3T19 A;  1KBR A;  1RDR A;  3GP9 A;  2CJK A;  4IH5 A;  2FGO A;  1ARO P;  1CJK B;  1LW0 A;  1Q8K A;  3QIP B;  1UVL A;  4E2F B;  1NU4 A;  5FII A;  4K2J A;  2VG5 A;  4LFB J;  1SC6 A;  3FMB A;  3P49 B;  3HLU A;  3OSN A;  2R7O A;  4NI2 B;  2GGP B;  3LTO A;  1UEK A;  1VLO A;  3QBC A;  4IRD A;  2LDY A;  2UU9 F;  3RBZ A;  3KJV B;  2VJV A;  1KR4 A;  2CQP A;  1WSV A;  1DAX A;  2IM3 A;  4ZN3 A;  3RRG A;  4JI1 F;  2JEF A;  4AXJ A;  3QAT A;  1QAX A;  3AQP A;  1SUQ A;  2Y1J A;  2OPQ A;  3VAI A;  1HWU A;  5KG6 A;  4R25 A;  3HI9 A;  3BSA A;  1U09 A;  2NYI A;  4DL3 A;  2CPE A;  4XPC A;  3AB4 B;  3HSG A;  4ILR A;  3KTQ A;  5KFE A;  1SKU B;  3NKY A;  5GVQ A;  1B99 A;  1D8Y A;  2A2D A;  4J90 A;  3H2U B;  3LWM A;  2KKH A;  3MTJ A;  4CO4 A;  2QMU B;  4EFA C;  5C24 A;  2LEB A;  5KFU A;  3KHH A;  3RAM A;  2CWK A;  2XYP B;  3VGT A;  4C11 B;  1FTR A;  2KVI A;  2GV1 A;  3HHL A;  1P1T A;  4LSL A;  1NO8 A;  3THT A;  1SIW B;  1Q4R A;  3DRP B;  3DLL Q;  2BUN A;  2ZD1 A;  1U1K A;  4LF7 F;  2WVF A;  3KMQ A;  4J9U E;  3SSS A;  4UW2 A;  1VHF A;  1YGY A;  3PRB A;  2ZFH A;  1KHV A;  1V3S A;  2HHW A;  2B9E A;  3R9L A;  1RLD A;  4IG3 A;  1CJV B;  2HNZ A;  2VPW B;  3H2V E;  1J2V A;  2IJN A;  1HNI B;  1T8E A;  1SC1 B;  4A8X A;  3HSJ A;  1U49 A;  4YDD B;  6AT1 B;  2CPJ A;  2YKN A;  4U7U D;  2KYZ A;  2NPI A;  1KEK A;  2KM8 C;  2R9L A;  5AXL A;  3T1Y F;  1VRU B;  1OYD A;  3QFW A;  4NYZ A;  4ZCI A;  5CYM A;  4NOH A;  4USK A;  2DO4 A;  1GXT A;  2D7S A;  3MM6 B;  4WCE Q;  2HG4 A;  1NJI T;  1QAJ A;  4C8Z A;  3D6F B;  3VQS A;  1EQ0 A;  3GMG A;  3K5M A;  2F5G A;  2XCP A;  3N28 A;  4EWT A;  2HK3 A;  3C14 B;  5KT3 A;  3CCQ S;  2H5E A;  3TA2 A;  4K4Z A;  1EP4 B;  1RAA B;  4DR6 J;  1OWX A;  1WDD A;  1T7P A;  2VBW A;  2UU9 J;  5DGA A;  1R6Y A;  2LQB A;  1U1R A;  4JI1 J;  2GMH A;  1YVF A;  1LWX A;  1L3U A;  2DHG A;  4CLW A;  4GVB A;  2HND A;  2FVR A;  2UUB F;  1C2P A;  3TJA A;  1DRZ A;  1RGV A;  4C7Q A;  2L41 A;  3A3N B;  3CJ8 A;  2ZHA A;  1R0A A;  3BF4 A;  3BKU A;  3Q8Q B;  1T94 A;  4B9U A;  1LK5 A;  1CJU B;  4DF4 A;  2I9S A;  4DPW A;  5EUH A;  2I0X A;  2ZHO A;  3DYA B;  5C25 A;  5CZV A;  5E41 A;  1J27 A;  4NYO A;  1U47 A;  2HZV A;  1W2I A;  1NHK L;  2JOQ A;  4ZVG A;  1H3D A;  2EG1 A;  4DSJ A;  1ZPV A;  2XMV A;  2FTR A;  4ZVR B;  2VA2 A;  1PO6 A;  1TVR A;  1PJ6 A;  4LF7 J;  4IO9 Q;  2Z2M A;  1V5I B;  4DL6 A;  1K9M T;  1FJ7 A;  2WVC A;  4F8R A;  2CJB A;  3GQC A;  2DGU A;  3FGV A;  4F4K A;  2KG1 A;  4RW4 B;  3I55 S;  3D0H E;  2AX1 A;  4ZDN A;  2XMJ A;  3I4P A;  3MCS A;  5HAO A;  4J9O A;  3MCN A;  3KLH A;  1KVI A;  3M2V B;  2OPP B;  2W01 A;  3T1Y J;  3U7J A;  4KHM A;  4N77 A;  3TVK A;  5G0R B;  2KT3 A;  4DCO B;  4RNM A;  3LAL A;  2A2C A;  2L08 A;  2B5J B;  2R7Q A;  3W5X A;  4DSF A;  2OKQ A;  2W4D A;  5T7L A;  2XM3 A;  1LW2 B;  1RAG B;  3D0G E;  5CCL A;  5KFV A;  2FHJ D;  1F1B B;  3AT1 B;  4F4A A;  3RBE A;  4DV7 F;  4OYX A;  3PO4 A;  2DXD A;  4M5D A;  4LF4 F;  4CP5 A;  2R42 A;  4Q44 A;  2DBB A;  4ANE A;  1XER A;  4OI6 A;  2D3O R;  3GIK A;  2BJE A;  3UPF A;  3GU0 A;  1YQH A;  2E7X A;  1Y5I B;  1CJT A;  1TK5 A;  3G2X A;  4Y3C A;  1RWW B;  1PG5 B;  2IDL A;  4WE1 B;  2N4C A;  2UUB J;  2G2O A;  4I6W A;  4EYI B;  1KD1 T;  3GLJ A;  1TKD A;  3W61 A;  2F8M A;  2OPS B;  2NRE A;  4RU9 A;  4OHW A;  1MML A;  5E7O B;  4WFA Q;  2FC9 A;  5HAT A;  2DR8 A;  4IH7 A;  2XSF A;  4UUW A;  4NLT A;  2VV5 A;  5KFI A;  2I5J B;  2FHM A;  1JLB B;  1URR A;  1TL7 A;  2J6S A;  2FZK B;  2XMW A;  3RAQ A;  3NGS A;  3NS7 B;  2HPU A;  2KHC A;  4KH1 B;  2ADB A;  3QJJ A;  3QO9 B;  2UVV A;  2PO4 A;  5BYS A;  3MUT P;  4ED0 A;  4MTP A;  4OI1 A;  4Y2C A;  4BC9 A;  2CA9 A;  3SQG B;  2VAS A;  3GYN A;  5A0Y B;  1CVJ A;  1ZS6 A;  4QQB A;  1YG0 A;  5D0R A;  2K2P A;  4KPC A;  1XJW B;  1UMJ A;  3AA8 A;  4OYZ A;  2E1M C;  3N6L A;  1EKR A;  3OJS A;  3QRQ A;  4NCB A;  4WU2 A;  2GIF A;  2J7K A;  2BJ7 A;  4KO0 B;  3W65 A;  5JVG Q;  2OH2 A;  2I2Y A;  4A8F A;  1RTH A;  3FBB A;  4QIW D;  1HQE A;  4UOF A;  4KFB B;  4QYZ K;  2LQ9 A;  2DEJ A;  1NDC A;  4NMX A;  2EFP A;  3NGK A;  3BGL A;  4QIE A;  4OHY A;  2VG7 B;  4CH1 A;  1QSS A;  3DLG A;  4DU8 A;  3CCL S;  1S49 A;  3PYD A;  4ZHR B;  4HHH A;  4NLR A;  3Q8V A;  2AEJ A;  4Q5V A;  3OXF A;  4LUB A;  3KLE B;  3T5L A;  2Y8Y A;  2FJW A;  4DV7 J;  2G1H A;  4FBT A;  1AFJ A;  4LF4 J;  3EYZ A;  3JYT A;  1M1H A;  3AQO A;  1U2R A;  1SPB P;  1XR7 A;  4IO1 A;  1NBE B;  2E1C A;  4WJB A;  5FDL B;  3SCK E;  2J9C A;  4XTT A;  3CDE A;  1FTC A;  3F0N A;  5EWG A;  4NXM F;  2HFS A;  5HP1 A;  4PQU A;  3IRX A;  2OMO A;  1EJ7 L;  2DGT A;  1Y00 A;  1SL1 A;  4WP3 A;  4X4P A;  4KHP F;  1WSR A;  1HBU B;  3L7U A;  4HAC A;  2ZJR Q;  4EO8 A;  1T3N A;  1VYA A;  4Q7A A;  3D6H B;  2MGZ B;  2HSE B;  3JSB A;  2NXU A;  4OQJ A;  5DET A;  3AB2 B;  3O1L A;  1M5P C;  2GHW A;  1KVK A;  3PZP A;  4IUF A;  2QMW A;  3I0S A;  4CLU A;  3J7Z 5;  4O3O A;  1SH3 A;  1VIX A;  1E6V A;  3UQS A;  3ZZR A;  2MKJ A;  3M6X A;  3Q0A A;  4HI1 A;  1JXL A;  1MNE A;  4KPY A;  1NLK L;  4WFY A;  1CJK A;  3RYL A;  1CSJ A;  4BC7 A;  3QIP A;  2GVD B;  2EI5 A;  2E7W A;  1VOM A;  2H51 B;  5BXI A;  5HK4 A;  3TAM B;  1U0S A;  1SH0 A;  2ZZN A;  4NI2 A;  3OT9 A;  4P10 A;  2GGP A;  1KTV A;  2RU9 A;  1KHW A;  4CI0 B;  3KJV A;  5B0A A;  2MTL A;  3QAE A;  2E1R A;  4JI2 F;  4ZKA A;  1QM9 A;  5ETV A;  2MKC A;  4K4V A;  1I51 B;  4DOZ A;  3DHX A;  3ZO7 A;  1HI0 P;  2P9C A;  2FYX A;  4DLG A;  2XBP A;  2OUG A;  1NK4 A;  1GFW B;  2M4M A;  2VBZ A;  2HFU A;  1IQT A;  3NNH A;  5IM0 B;  1X4C A;  4K5R A;  1HIY A;  3FSY A;  2J0X A;  1J5O B;  4CIO A;  3IBF B;  4NLS A;  3CJ5 A;  2N3O A;  1T02 A;  1RHU B;  1DY3 A;  1EQM A;  3W64 A;  2B7C B;  5HO4 A;  1U24 A;  1TR0 A;  2QSW A;  2V4J A;  3DRP A;  4C3L A;  2ZDO A;  2V2K A;  2RF2 A;  5KG5 A;  2XZT B;  1HL6 A;  2NXN A;  1JLA A;  3S1T A;  2AGQ A;  2YH1 A;  2OEL A;  3P4U B;  1RAI B;  1CJV A;  3PNI A;  1M5S A;  4NXM J;  1FRL A;  2J8S A;  2ZM6 F;  5K8N A;  2FIU A;  5KOW A;  4DX6 A;  3NCR A;  4DJB A;  5HL7 Q;  3OFF A;  4M95 A;  1HNI A;  2E9R X;  4P2S A;  3CDA A;  1HYS B;  1V3Z A;  2LXU A;  2HRU A;  1T9V A;  1HHT P;  4KHP J;  4U8V A;  3I32 A;  3EMT A;  2CDR B;  2IMW P;  4JV2 A;  1O5J A;  1M90 T;  2JFK A;  1C0T B;  5M2P A;  1VRU A;  4X4Q A;  4DQS A;  3PRD A;  3V6H A;  3KJQ B;  3FBC A;  3BBF A;  2HS4 A;  2MJU A;  2VH7 A;  1BE4 A;  3TZY A;  1C4A A;  3DDK A;  1RYR A;  1S9G B;  5J2P B;  1X4A A;  3HVW A;  1UA1 A;  4BWJ A;  3OHA A;  4U6P A;  4B3T F;  1RLC L;  2XY5 A;  4C98 A;  5JMN A;  3C14 A;  2F65 A;  4QIV A;  5ADZ A;  3CD6 S;  1L3V A;  1H2U X;  3T1A A;  1JJ2 R;  4NYP A;  2HHV A;  2CQI A;  1EP4 A;  1QSY A;  2ZH5 A;  3FC9 A;  3T6B A;  3IP0 A;  2VF3 A;  2DGW A;  3OQ2 A;  2JHE A;  5F9L A;  4JI2 J;  7FD1 A;  4YR0 A;  5B09 A;  1U02 A;  1OS5 A;  4ZPV R;  4DSE A;  1VBZ A;  3J81 j;  4W4M A;  3L7P A;  1WJ9 A;  5JJB A;  1IBC B;  1S9E B;  4KSE B;  1QD1 A;  1VQS A;  5HBM B;  2R2T A;  4LVN P;  3K8W A;  3UCZ P;  2MQN A;  1XMO F;  1VQY A;  3ZZP A;  1CJU A;  2XY7 A;  3DRX A;  5D15 A;  4RBT A;  5HRO B;  1YHQ S;  4FF2 A;  3DXS X;  1N5Q A;  1C0U B;  1RIS A;  1YJU A;  3DYA A;  1RCX B;  1CUL A;  1Q79 A;  2VFU A;  3M8W A;  2C2E A;  2OEJ A;  2BX6 A;  1QE1 B;  5IWA F;  2QMX A;  4HEA 9;  3R97 A;  1VK8 A;  2HAF A;  3M32 B;  2HQI A;  1NB7 A;  2PMH A;  3KK1 B;  1SC3 B;  2JLF A;  1JNR B;  4ZVH A;  3L3C A;  3EGZ A;  1SJR A;  1Y3J A;  2DPJ A;  5KFX A;  2GQC A;  3ILL A;  4NA2 A;  4QR1 A;  2BQ3 A;  1LKZ A;  3PV8 A;  2QA4 G;  3G6V A;  2ZM6 J;  5E0O A;  1FHT A;  4RW4 A;  3FCH A;  1RTD B;  2GIQ A;  1RAH B;  1R7I A;  2B0G A;  5F3T A;  4YN3 B;  4G3I A;  2IHR 1;  3PR5 B;  2X7I A;  4P7V A;  4DFK A;  4MKY A;  3M2V A;  2OPP A;  3R7S B;  2FQQ B;  4PZV A;  1RT4 A;  3QGP A;  2POK A;  1MN9 A;  3OHB A;  4DN0 A;  5G0R A;  5J1E A;  1YIJ S;  4U96 A;  2ZHB A;  3D6M B;  3M8Q A;  5KFC A;  3PX4 A;  2B5J A;  4ZVU B;  4LBH A;  4A8O A;  4G1I A;  2W7O A;  2HVD A;  4N41 A;  4B3T J;  2Q43 A;  5M2R A;  2QL9 B;  1LW2 A;  2LU2 A;  5IXU A;  1G4C A;  2CG4 A;  2V68 A;  2XLK A;  5HQM A;  1N0U A;  2IBK A;  3ISN C;  2ZH6 A;  1QVF R;  2R4F A;  1OMS A;  3DU5 A;  2CRL A;  3ONQ A;  3HUL A;  2D69 A;  3PTW A;  2V8H A;  1NPR A;  3U1M A;  4DR3 F;  3WX4 A;  1U26 A;  2LQJ A;  1FRM A;  2E44 A;  3EPG A;  2DIT A;  4HDH A;  2UXD F;  1FEE A;  1SKW A;  1FI4 A;  1SBR A;  3VZI A;  4OYM A;  1YI2 S;  2NXC A;  3IM9 A;  5D4P A;  5M2U A;  3FVY A;  4DUY F;  2HHX A;  1XMO J;  4USM A;  3PDN A;  2HVE A;  3BJY A;  2E5J A;  2RS8 A;  4JV0 A;  1XR5 A;  3OFH A;  1UEV A;  1KFS A;  2WVD A;  2L9W A;  2I5J A;  3UNY A;  1JLB A;  1VRT B;  2DRB A;  2IY5 B;  1VJQ A;  1H98 A;  4LRA A;  5KFN A;  4AL7 A;  2UV8 A;  2ZNZ A;  4XDC A;  5IWA J;  4CYU B;  3QO9 A;  3QJP A;  1ZZF A;  3GJT B;  4FVM A;  1YBA A;  2ZZT A;  1IVZ A;  3SQG A;  3I5C A;  3WX8 A;  2VIC A;  1A7G E;  5AXN A;  4F2R A;  2F3J A;  3IO1 A;  4ECW A;  5A0Y A;  4QU6 A;  4L6V 3;  2V34 A;  3CCW A;  3AAW B;  1FX4 A;  5D0G A;  3CSK A;  4PUO A;  2ZBP A;  4WKR A;  3FBE A;  1OPZ A;  3DKD A;  3UDE A;  3Q24 A;  4NXN F;  1Z4U A;  1VHI A;  2UVR A;  4KO0 A;  2I6W A;  3SZ2 A;  3ZZT A;  2GO8 A;  1EIY B;  4UOC A;  4KFB A;  1AT1 B;  4F3O A;  4DG1 B;  1EAY C;  1URN A;  3KHR A;  3HFV A;  2CG8 A;  5GAE U;  3J80 U;  1RBA A;  2PI4 A;  2VG7 A;  1SKS A;  3Q89 A;  2MKS A;  4M8L A;  2DPI A;  5KG7 A;  4ZJL A;  1RXO B;  1NKC A;  3G82 A;  4WXO A;  2GZO A;  2UUA F;  3OTB A;  1RWO B;  2VG6 B;  5CXT A;  5G4D A;  4ZHR A;  2XMM A;  4K4U A;  2FLO A;  4ZIV A;  3IGV A;  3X3U A;  4QYZ J;  1S1V B;  1TL1 B;  4URQ U;  3MEG B;  2W9C B;  3UVJ B;  3PFO A;  1NSA A;  5I4M A;  3W62 A;  2SXL A;  2HIY A;  2EKY A;  4L3K A;  5DG7 A;  2HLU A;  2Y1L B;  3RR7 A;  2KZZ A;  1B64 A;  2M7S A;  2GO9 A;  1WOP A;  4WF9 Q;  3MMB B;  1RA7 A;  4DR3 J;  1YZ6 A;  4ZPD A;  3HHN B;  4IR1 A;  4DL4 A;  3KDO A;  2D3U A;  1UJ6 A;  3FDS A;  2KXF A;  2HRY A;  4PR6 A;  4PRF A;  3W9J A;  5FDL A;  3H0P A;  3VVT A;  2UXD J;  3BSC A;  2WRM A;  2XYG B;  1FE0 A;  4KGM A;  1IKW B;  1UL3 A;  1FT8 A;  3MD1 A;  4DUT A;  1L3K A;  1R89 A;  4DUY J;  3C46 A;  3UN5 A;  3W8G A;  2V4Q A;  4P2M A;  2G4B A;  3DOL B;  3M8S A;  1FNO A;  1HBU A;  1F5A A;  4YB7 A;  1TQL A;  3CJQ A;  3I9V 9;  3HVA A;  1FDD A;  1HQ2 A;  2VFT A;  4TYB A;  4HL9 A;  1RJJ A;  2BQU A;  4OYP A;  5CYQ A;  3DU6 A;  1ZBT A;  4C3K A;  2C28 A;  3GG1 A;  3CJK B;  3CC2 S;  4GKK F;  5E3R A;  2GVD A;  1FWP A;  2QL5 B;  3QSY B;  4F26 A;  3G6X A;  3EXY A;  3H4D A;  3TAM A;  2HZC A;  1D9F A;  1UP1 A;  4MK8 A;  4NXN J;  3RRH A;  5B0D A;  4ELV A;  3IWX A;  2DVI A;  2R8I A;  2EEY A;  1X5T A;  3VQT A;  5IV4 A;  2IM2 A;  4P74 A;  1MRO A;  4CLT A;  2UVW A;  3LAN A;  1RAJ A;  2UXC F;  4N8N A;  4LIR A;  2DGV A;  4LF5 F;  4OZ0 A;  3ADA C;  4V1A k;  1PGZ A;  3EIC A;  2IRU A;  2JVO A;  1UFW A;  4NLQ A;  3HDS A;  3CD0 A;  4MKB A;  3VGU A;  2DYA A;  2YNG B;  2UUA J;  1JLC B;  2MMY A;  5U47 A;  2OGU A;  2ALY B;  1TKX A;  5CZX A;  1J5O A;  3WC0 A;  5ETR A;  3HHL C;  1RTI B;  2UZA A;  2BE7 D;  2P6S A;  5KFA A;  4ES1 A;  3ZNJ 1;  4YME A;  1T9X A;  4P7T A;  3EZU A;  5E3P A;  1VQK S;  2B3T B;  3KG4 A;  1C1C B;  3CDW A;  4X4U A;  4ZLJ A;  1R8H A;  2BA9 A;  4PXC A;  2WBM A;  4DSI A;  1HNX F;  1TL4 A;  3MEK A;  5HJX A;  3MPY A;  3D68 A;  5A8R A;  2M8D B;  1RAO A;  3OXG A;  3HHE A;  1WAC A;  2K7J A;  3JSM B;  4CM0 A;  4QPT A;  2XZD B;  3SEO A;  2HHT A;  9RUB A;  2HQG A;  1P9Y A;  2OEM A;  2CQ0 A;  3MPU B;  2QX0 A;  4DFP A;  4W98 A;  1YX2 A;  1HYS A;  1SL0 A;  2RQM A;  5KOX A;  4EBE A;  3C16 B;  3RAX A;  3GE9 A;  3CUL A;  3PKY A;  5ETS A;  2J6T A;  2WSE C;  3H5U A;  1CBK A;  1U6Z A;  2E9T A;  4RKU C;  4DHV A;  2CXE A;  1DFD A;  1FD8 A;  2LA4 A;  4DR4 F;  2IVM A;  4ECU A;  4WU3 A;  1S9G A;  3SI8 A;  4X4N A;  1JJC B;  5A8W B;  2YKO A;  2ZBC A;  3PYF A;  3LAM A;  4GKK J;  3TZZ A;  4C9D A;  4IOA Q;  4WTO B;  2VPY B;  3R27 A;  4ZP9 A;  1WF1 A;  2CQH A;  2BOA A;  2KJV A;  4ELT A;  3W1Y C;  3P45 B;  3LP0 B;  1IKV B;  1QLN A;  1ZA2 B;  1KON A;  2LQ8 A;  4LVO P;  2H54 B;  1TL3 B;  3GII A;  2LA6 A;  2C2K B;  1FJE B;  2XNR A;  4OYO A;  4OYI A;  4DPO A;  2BE9 B;  1UCN A;  1FA0 A;  4EEY A;  1RKJ A;  4ID5 A;  1S77 D;  4LBI A;  2K06 A;  4XO0 A;  1KQS R;  2XS2 A;  2UXC J;  3M4X A;  3O44 A;  3UFC X;  1K0T A;  2JDJ A;  4DX8 H;  1S9E A;  2O3D A;  4LF5 J;  5EGY A;  1F5B A;  5HBM A;  4WII A;  3MM9 B;  3C2P A;  5B0B A;  2HQD A;  3N9U C;  5HRO A;  5LL6 d;  3WZ0 A;  5SZT A;  2JRS A;  5J2N B;  4FPR A;  3WIU A;  1C0U A;  4O44 B;  5KT4 A;  4Z7Y A;  2PA8 D;  4Q45 A;  1FD2 A;  1M5O C;  1QE1 A;  1XNR F;  5J1P A;  3BZQ A;  2RS2 A;  2ZBQ A;  2P2C B;  3G71 S;  3C3L A;  4WFN Q;  3M32 A;  1GQE A;  4M63 A;  3UCG A;  1X4E A;  2CKW A;  1JB0 C;  5B0C A;  1FJC A;  4KGK A;  4M5I A;  2P5V A;  1HNX J;  2QV6 A;  3LP1 B;  1E6Y A;  1HQU A;  3DM2 B;  2J0Q D;  1TTH B;  1ZAV A;  2HGN A;  5F0W A;  2DNM A;  3Q8P B;  2PMW A;  4WFX A;  3J80 Y;  2B51 A;  1RTD A;  3T9Z A;  4ZOS A;  2OFH X;  4NL5 A;  3N5B A;  4CLZ A;  4OHV A;  4J9S A;  3TAN A;  3HPO A;  2B4U A;  2WZ1 A;  2DXE A;  2GS8 A;  4RUA A;  5GAD I;  1N52 B;  3M05 A;  2OP5 A;  1UVM A;  4J7C A;  3OV7 A;  3BO2 A;  4DR4 J;  2YX7 A;  3EZ5 A;  3NOC A;  7FDR A;  2KYX A;  4FDF A;  4DV0 F;  5L46 A;  1GH8 A;  1VQP S;  2E5L F;  3ZTQ A;  3V81 B;  3J7Y U;  2JLE A;  1YWX A;  4GC7 A;  3KLG B;  5GAG U;  1GEH A;  4RNF A;  3VAL A;  3LH2 S;  2R8J A;  1M1K T;  4A8Q A;  2V8D A;  1NAQ A;  2CQB A;  2ASJ A;  1YBU A;  2GJ2 A;  4OZ3 A;  3FMW A;  1FDB A;  5FLX U;  3D4J A;  4OLP A;  1JWW A;  2OSQ A;  2ZKT A;  3CJ3 A;  3I0R B;  4GKJ F;  2AJF E;  1WOS A;  2I38 A;  4RNN A;  2D9P A;  3EGV A;  2H5J B;  1F9F A;  4URG A;  1T9T A;  4C0H A;  2HVZ A;  4K50 A;  2FPH X;  4CO5 A;  2I8E A;  1KFD A;  2YWG A;  1UWB B;  2NXJ A;  3KYL A;  4AE5 A;  1ROF A;  2CPX A;  2F9J A;  1H6K X;  2M3D A;  2LXF A;  3WBZ A;  3PW7 A;  4C0B A;  1NXI A;  1T9W A;  3TVY A;  4Y2K A;  3PAC A;  5D4L A;  1RT2 B;  2W7P A;  5IC6 B;  3OTD A;  1XNR J;  4CYU A;  4L73 A;  1N5Y A;  4C8L A;  2A18 A;  1DQ8 A;  5B0E A;  1FVS A;  3OTE A;  5DLG A;  4ZCM A;  2MXY A;  1P9Q C;  1XN9 A;  4WPA A;  5LSO A;  4EUV A;  2LEP A;  2AJ1 A;  4QWD A;  4G6V B;  1UZD A;  4I1T A;  1VQ9 S;  5L38 A;  2GJI A;  4NPO A;  3TOQ A;  1TV6 B;  2QRR A;  4B9L A;  2ZH3 A;  3W66 A;  1D8Z A;  2KXN B;  2DR5 A;  1REV B;  1U25 A;  1X5S A;  1N4L A;  3KJN B;  3WIV A;  4DG1 A;  3PCO B;  1WF0 A;  1H74 A;  2MY8 A;  4ED6 A;  1QUP A;  4RNO A;  1B7Y B;  1QAI A;  2JX2 A;  2XG8 A;  3B54 A;  3BPD A;  3QLH B;  1PBA A;  2GQ2 A;  2HRT A;  3T3F A;  2KRR A;  5F8N A;  1RAB B;  4RW9 B;  4DV0 J;  3P8B B;  4I6Y A;  2Z2Y B;  5KFG A;  2X1A A;  1S1V A;  1TL1 A;  4USV A;  3RB6 A;  2E5L J;  2XMA A;  3MEG A;  3FJ2 A;  2DIV A;  1FK9 B;  1H0H B;  2CNK B;  2GHV C;  2JEJ A;  3AJD A;  3UN2 A;  1XC9 A;  5HQL A;  3GCX P;  3MMB A;  4ICL A;  3NNC A;  2A3J A;  2C3U A;  1XR6 A;  4TVA B;  3OJU A;  3KNG A;  1HNZ F;  1M5V C;  2IA0 A;  4GKJ J;  2KL8 A;  2P9E A;  1UVJ A;  2QYC A;  5C2C A;  2PMZ D;  1GAO A;  1IKW A;  3MEC B;  1YJN S;  1OQ6 A;  2XY6 A;  2W2O P;  2NSB A;  3QMQ A;  3FRZ A;  3HF5 A;  1LXJ A;  3KKF A;  1NND A;  2D41 A;  1X7V A;  4HTJ A;  1KWM A;  1PYS B;  3I6P A;  5KFT A;  3BYP A;  3VWS A;  3G9C A;  2X51 A;  1HAR A;  3KK2 B;  3KFW X;  2B9X A;  4P2X A;  3BR9 A;  3O6Q A;  1PSD A;  4KJI A;  1PCA A;  1RTJ B;  4KB7 A;  1X4F A;  2ADC A;  3HT0 A;  1B3T A;  3KK3 A;  1ZM4 A;  2AYM A;  3CJT A;  2Y0B B;  3T1H F;  3R2D J;  2ZNY A;  3EVO A;  3J7A 1;  4F25 A;  3OL7 A;  1W25 A;  3CJK A;  1FNM A;  2RUS A;  4B02 A;  1RT1 B;  5D3G B;  2MKY A;  1DTQ B;  1AYE A;  2NQP A;  3GYX B;  4B08 A;  4ZVS B;  2FLL A;  1F5C A;  2B6A B;  3I31 A;  4X4S A;  5KFQ A;  4QR2 A;  3EZO A;  3H7H B;  2VJU A;  3SFG A;  2HW3 A;  2OD4 A;  4DI6 A;  3PX6 A;  2KN4 A;  2Q1L A;  3PJ9 A;  4YQW A;  2ALZ A;  1HBN B;  1U2C A;  3VZH A;  3TAR A;  5CD4 A;  2NUH A;  4LRB A;  1HWK A;  2V94 A;  2YNG A;  1F9E B;  1SQG A;  3D9B A;  4IOC Q;  3W9I A;  3RBD A;  2VA3 A;  3H90 A;  2DH9 A;  2QA4 S;  2L9D A;  2VC1 A;  2DHS A;  1C1B B;  1VQ6 S;  4RBV A;  3TI0 A;  1AA1 B;  2DIS A;  3BN4 A;  4MFB A;  1WEL A;  4A8Y A;  2DD8 S;  3CDU A;  3GB0 A;  2OLW A;  3I96 A;  2NUU G;  1HI8 A;  2LEC A;  2Z8Q A;  3KLV A;  1HNZ J;  4FP9 A;  2RD5 C;  3JSM A;  3J81 U;  3C66 A;  3FKB A;  1VC6 A;  3ENQ A;  1Z1Z A;  2FC8 A;  1HLW A;  1ZA1 B;  3JQJ A;  4DEZ A;  4NZ6 A;  2XMU A;  3FEX B;  1LEO A;  1VQO S;  1JJH A;  3BGF A;  2NZC A;  4QZV B;  5LXR A;  3IG1 A;  2MZR A;  2M0G B;  1QTM A;  1ZAX A;  1RHJ B;  2QG9 B;  1IKY B;  1VI7 A;  3T1H J;  3SQO P;  5CYJ A;  3BPS P;  2RDD A;  2MPU A;  3Q86 A;  4X4T A;  4GC6 A;  3CJ2 A;  3IAS 9;  3BEG B;  1A9N B;  1KLM B;  1JLG B;  5HN0 A;  3K5L A;  2Y0S D;  5A6W A;  2H1Y A;  3LP0 A;  1FF2 A;  1IKX B;  3UW1 A;  4ECS A;  2B56 A;  3HM9 A;  3T5H A;  1NK6 A;  1BQN A;  4NZ0 A;  1TL3 A;  5ETK A;  4CLP A;  3T5K A;  1WHW A;  2GW8 A;  2AHO B;  1BQX A;  4N7T A;  5B0G A;  3GFX A;  2CDQ A;  2UXB F;  2DNG A;  3M6U A;  2YQ3 A;  4DQR A;  1XMB A;  4LMZ A;  5BR8 F;  5D0E A;  1I5O B;  2B8Q A;  3MM9 A;  1QTN B;  4HI2 A;  3DMJ B;  2IYG A;  4KKO B;  3OL6 A;  3BSN A;  3AOB A;  4IKA A;  2BVZ A;  3D66 A;  4O44 A;  2MQM A;  3M7V A;  2OSR A;  1V3R A;  4QW9 A;  1VMB A;  4J5O A;  4NLX A;  3EDR B;  3N79 A;  4P75 A;  4NLP A; 
#chains in the Genus database with same CATH homology
 2IDL A;  1S12 A;  2G0J A;  4PEO A;  2G0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...