1S12A

Crystal structure of tm1457
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
b'MIKVTVTNSFFEVTGHAPDKTLCASVSLLTQHVANFLKAEKKAKIKKESGYLKVKFEELENCEVKVLAAMVRSLKELEQKFPSQIRVEVIDNGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein TM1457
publication title Crystal structure of TM1457 from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 30
structure length 94
sequence length 94
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04327 Peptidase_Prp Cysteine protease Prp
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1490 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Cysteine protease Prp 1s12A00
2G0IA 2G0JA 4PEOA 2IDLA 1S12A
chains in the Genus database with same CATH superfamily
2XLKA 3MTKA 4E0DA 2CVEA 3DOKA 2E9ZA 3HKWA 2WRMA 1Q8KA 4UUWA 2MZJA 4B3MF 5GMKa 4UW2A 1WC5A 4DV3F 2VODA 1HNVA 1S12A 3V6DA 4XO0A 5CD4H 1TKTB 4I6AA 2L9WA 1C0TA 1AZSA 3IN5A 5FDLA 2FC8A 3Q22A 2A1BA 5JMNA 3G6YA 4FS1A 2HIQA 2HVZA 3MURP 3VZHA 1VQ8S 5A76A 1EHWA 5K8OA 2VKZG 2OLWA 5J2QA 1DJ0A 4UQTA 1KD1T 2CWKA 1T02A 4TLQA 4LSLA 4QW9A 3DOMB 3KNGA 3KK2A 1VLOA 1RTZA 3NNHA 3QRPA 2WK4A 1F9HA 2XEXA 2HNYA 1R7IA 3TUJC 2RRAA 4HH0A 4LRBA 3U1NA 2B9EA 3DLJA 3PO4A 2PFFB 3M30B 2DNLA 3M2UB 4EO6A 2D9PA 4DF8A 4GC6A 4DZDA 4USWA 2APOA 2Q66A 3DLGB 1SXLA 3A8EA 2UXBJ 2BUNA 2G13A 4FZVA 3KJVA 1VC5A 4KJIA 2I6WA 4PAAA 3FVYA 3AJ1A 3MMJA 4CO2A 3DLEB 5HVGA 2YH0A 4B3OB 4O23A 3KLVA 2IM1A 2MHEA 2M8HA 2JC0A 1RACB 3MMBB 2CZVC 3HHEA 3RR8A 1TAUA 1M1KT 2XS7A 3MPVA 4F0HA 4RBUA 2UVRA 4OI1A 1T94A 3CJSA 4IFYA 2QYGA 4JI0F 3QJLA 1Q79A 4K5SA 4ZVEA 1IWAA 5C2CA 2D3O1 2RD5C 1GX6A 1RT1B 1DTQA 4X4OA 2HS3A 4CCHA 3GB0A 1KRPA 1S48A 2KYZA 1SUQA 5M2UA 2GCFA 3HCXA 3GV7B 4S0MA 4NLGA 1SH2A 4M5KA 2RHSB 1OJ4A 1NK4A 2E1PA 4OI4A 2XWYA 2DNRA 3UE2A 3J80U 1HQ2A 3QRQA 2XMKA 3CIMA 4KR0B 1WNEA 5BYSA 1E6VA 3C66A 2GHWA 1H2TZ 1G6BA 1KLMA 1QE1A 1FDNA 4JYAF 3HO1A 1EX8A 1PCAA 3OTDA 3GG0A 3L7UA 3V4MA 4HDGA 4LFBF 1J5EF 1U0HB 5AXLA 3D5MA 1J2VA 3T1HF 3QWUA 4FBTA 2NXEA 4RNHA 1RAJA 2EK1A 3THTA 2VG5A 2QL9B 2KU7A 3M8SA 2KJVA 1T9WA 5KG3A 2VKRA 4LF1A 2X3DA 2Z2ZA 4OYXA 5EGYA 3HXMA 1X5PA 2C3YA 4PG5A 1UA0A 1LKZA 3U02A 3ZC4A 3MM8B 4QR2A 1P27B 1IKVB 2HZVA 4X84A 3J7ZT 4WFXA 2VFSA 4HKQA 2JNJA 3QT6A 1NK0A 1V5IB 3D9BA 1HA1A 4AL7A 4K7QA 3ZZOA 4DUTA 3RB0A 2DGXA 1HIYA 1PJ6A 3CDWA 2QT7A 1TK0A 1T03A 4DV4F 2PC6A 2ASJA 4M94A 1CJKB 4H4MA 4LQ3A 1OYDA 4B9NA 2HHTA 4IG0A 2EKYA 4C8OA 5SUHA 1FEHA 4R0EA 1OYEA 5D3GA 5CQGA 2RU9A 1IBKJ 4JI8J 2EG1A 1UPPA 4PABA 1L3TA 2DY9A 4LF7F 1WELA 1NKEA 2M4MA 1UP1A 2GZOA 5CD4A 2JDJA 1ZETA 4F4KA 2CADA 3QO9B 2DRBA 2BABA 2PEHA 2HBRB 3IBFB 2K1RB 4C7QA 2B7CB 1OQ3A 2E7XA 2Y9HA 3VGTA 3PACA 3QWPA 5KFGA 2GS8A 2MPUA 2ATLA 4LFAF 4Z7YA 2BOPA 1XIQA 3IG1B 4K4XA 3BYRA 3NGRA 1T9YA 1WWHA 1S6PA 1FFWB 1KP6A 4AFFA 3J7A1 2MQLA 2ZKUA 2NQPA 2DKOB 3FEXB 3M1VA 1WACA 3KHRA 3MM9B 5J2PA 3UD3P 4DSFA 2E7WA 4WPAA 4B9VA 4URGA 3OUYA 2R8HA 3NKYA 3TJ9A 2XY5A 4BS2A 1VMBA 1X4EA 2J0QD 3PM9A 3DM2B 1T11A 2OUGA 1HNXF 1VQ4S 2WB1D 5GVQA 1CC7A 1HMVB 4LF6F 1U02A 1SC6A 1A7GE 1DLOB 1VQ5S 3FFIA 2VBXA 2ZH4A 2L41A 3ETOA 3N01A 4EZ9A 5DZ7A 3EGNA 3UDCA 2XYPB 2OPPB 4Y2KA 3JSBA 2DR7A 1ACMB 2HHUA 1FRJA 4P2FA 4CYUB 4ATNA 1NK5A 3BKUA 3NGSA 3OL6A 5KFYA 1L3UA 3VAFA 4QOTA 2V2VA 2AEMA 1VBYA 4ZPWR 1HKAA 3I5BA 2C42A 3RB3A 3TP2A 3CO9A 3TRGA 2E1MC 1RT6A 3JB9k 1KR4A 3CJ3A 1VQLS 1RTDA 1S1UB 2E29A 1RTJB 4WZQA 1DAXA 2JX2A 4YOEA 3NMAA 3OPKA 1JLQA 2GQQA 4P73A 3H5XA 4WKYA 1JLAA 4H4KA 1H0HB 2COLA 2MY7A 5E7OB 1I94J 4EUVA 3NOCA 1XEZA 3LP1A 4CO3A 4DR4F 1FRMA 2XZTB 2VBZA 4I56A 3QFWA 1VK8A 3KLHA 1UTAA 2JWNA 3L7PA 2JJ4D 4OHWA 1XNQJ 1EKRA 3GJQB 3G71S 3LWMA 3IO1A 4LF2A 1DQAA 1EETA 2ZBPA 5DM7Q 4RLEA 3TARA 1JLGA 5C24B 3PCOB 1XQIA 1FXLA 2LECA 1N34J 3SFGA 2KB2A 1U0SA 4NCGB 1U45A 3CULA 3HVAA 4DWIA 2CNOB 2M70A 2B6AB 1UEKA 1RLCL 3W5XA 3MMAB 4XDDA 4ZIWA 4KTQA 4FVMA 2R7XA 1CQNA 3BJYA 3IXQA 1GMWD 5KFVA 1QLNA 3OFEA 3W66A 4YB1P 3JYTA 1C4AA 4DV5F 4EZ6A 5HMYA 3MEDB 4FYXB 1Y11A 4KQZA 4JI5J 3MHYA 3FSXA 4LJMA 2UV8G 1FKPA 4MK8A 2HHVA 3OL9A 2IRYA 3MR6A 3NBPB 4RX6A 1PILA 3I0RB 3O3LA 2HMIB 1NDCA 4OJ1A 1IKYB 4EEYA 1IBMJ 2QA4G 4USUA 1S9EA 3H90A 5MLCV 1ZH5A 1CJVB 5KG4A 1QM9A 3WIUA 1T9TA 3WHIA 2BM1A 5C25A 4Y6IA 3PHTA 1N5SA 4Z37A 1KQKA 3PJWA 1Y7PA 4GVLA 2MZQA 2UV8A 2ZBIA 3PRDA 1KFSA 2BDPA 3HMJG 1NJZA 1AROP 1EP4B 1JLEA 2XMTA 2GVZB 1AB8A 4F4YA 2C3PA 3N5FA 5D0RA 1C1CB 3MM6B 3BBFA 4YY3J 1C1BB 2UUWA 1LWEA 1WKJA 2BBEA 4C11A 1B4SA 2CJ9A 2V2ZA 3R7BB 1NPPA 3BO4A 1GTHA 3A8KA 4L3KA 1WF1A 2BE7D 2IA6A 1OQ6A 4K4WA 3CD7A 3I0SB 4IRDA 2ZHAA 4ZPDA 3W2VB 2VQFF 1KS2A 4O4GA 4D3GA 3UD5A 2V8VA 2PD1A 1VRTA 2VQEJ 1PAUB 2DR8A 2QE5A 2PT0A 4MH8A 5KFCA 2JFDA 2UXCF 1BUXA 1S9GB 3KG0A 5GADU 3AXKA 4PCQA 2QLFB 2VHGA 1G4CA 5CAAA 3DLBA 3H20A 4U7CA 3MR2A 5KTQA 1K47A 4RW7A 3UR3C 3R8YA 1JMTA 5C7PA 2EC2A 1JLFB 4YMEA 5HVFA 2F65A 3BQ2A 4CT9A 1NK8A 3MM7A 1C0UA 4PWUA 1DTTA 2VBWA 2HS4A 3OXGA 4B9LA 4L3NA 4RR5A 1SL2A 1QUPA 2ZM6J 1S76D 1FESA 1VRUB 4KKOB 2QGFB 2AYGA 1FA0A 4DS4A 3QBCA 1VJQA 3PFOA 1TMJA 1RAEB 1K1SA 4USIA 3RB4A 4MYUA 5HMWA 1GNKA 3HF5A 4B3MJ 2MKIA 4E98A 3DMJA 3G82B 3MCNA 1BLUA 1WORA 2KT3A 3AODA 1RK8A 2J6UA 1IJEB 2XNRA 1NPKA 1ZM3A 2RJZA 3DOLA 5EX3A 1CSJA 1CJUB 3A8JA 1Y3JA 4DSEA 1RDRA 4ECVA 2FY1A 1JNRB 2LQJA 3O6QA 2HK3A 2DY1A 2V2QA 1JB0C 2M5YA 1TELA 2CZ4A 5KFFA 1ELOA 4J9MA 3AXMA 3CC4S 1WOSA 4YDXA 3ZTOA 3V81A 4R5PB 2R7RA 2OPRA 2XSFA 1BGXT 4MIBA 1F0XA 3KK1B 5HBMB 2KHDA 3HLUA 2LA4A 2DHSA 4I64A 2DYAA 1ZBTA 4RZRA 1J5OB 2ZEJA 5D78A 3RRKA 4FXDA 3C6TA 3W63A 4DPWA 2DR9A 5I3QA 3S8SA 3UN3A 3CJ2A 3CJQA 2W9BB 1GMWA 5J2NB 1IWGA 4LFCJ 2AV5A 2YNFB 5LSRA 3BH6B 4U96A 5AXKA 3I56S 4JI0J 2QA1A 3LPEA 2Y1JA 4A8KA 3RYLA 1RTHB 3LGNA 2RRNA 5KT4A 3M2VA 1BXNA 4MFBA 4RUHA 4M95A 4NI2A 1NPRA 4ECUA 1EZZB 2CQGA 2LQ5A 3MEGB 2BE2B 3A1YG 3ZNJ1 1FVQA 2NSBA 3M9NB 1QSSA 3DI6A 4OMFG 1HNZF 4UTGA 4C8LA 3EWGA 4RW6A 5F9NA 2ATCB 3L09A 4LF9J 2V63A 2VFUA 2UUTA 2FVCA 4NOHA 2P6TA 3GWCA 2MTLA 1N32F 3RAMA 1WJ9A 2JC1A 1QVGR 4JI7F 4YUDA 5L1LA 4X4TA 5E0OA 4LFBJ 1J5EJ 1G3OA 4URQU 3VQTA 4RWXA 3RBDA 3D1QA 3OR1A 3PR5B 3T1HJ 1WI8A 1BY9A 3S01A 2RKIA 1VQ7S 1ZPWX 3ENQA 3IMQJ 2YWGA 2QFIA 3H2LA 4ED0A 1VOMA 2Y0BB 1FERA 3LAMA 2FLNA 4LIRA 2C28A 2RILA 2DHHA 4ETZA 2W9CA 4K5RA 2M3DA 5B0GA 3AQPA 2WHOA 2A2CA 4KFBB 1Y5NB 1FWPA 5EUHA 1S5ZA 2FLPA 4BWJA 1G7CB 2GJ2A 5EX0A 4IH5A 5ETKA 1OS5A 1N5TA 2ZC3A 1HW9A 2JEIA 4ZIVA 3EX7B 2HLUA 2OTJS 4FYYB 2LXFA 2ROGA 4OX6A 2ZHBA 2FHKA 1SQFA 3EVOA 2QLBB 3NGUA 1Q16B 3CCJS 3R3TA 1GX5A 3B6BA 1RBAA 2W4CA 4MTPA 5KAKA 3R1HA 4FKXA 1Q7YT 1RWNB 3HDSA 4ZN3A 4ECSA 3KLEB 2VA2A 4OI0A 3DRPB 2AU0A 3OFGA 1HI0P 5IZHA 1TV6B 2N4CA 1IQTA 2E5LJ 2XQCA 1IR2A 2CNNB 2ZHOA 1CULA 3MXHP 4RKUC 5EWEA 3MAAB 1X5OA 4UF4A 1T05A 2KG0A 3K59A 3KKFA 5KT2A 5I3UB 3AOCA 1FK9A 3HKZD 3H5YA 5HMXA 2UUAF 3JTNA 4DFMA 1CC8A 1SL0A 2X1BA 4FNIA 4QR1A 1YWXA 4QIGA 1HWUA 3NP5A 3DGPB 2XSJA 4JI4F 3BPSP 3OHAA 4C3KA 3VAHA 4LFAJ 1SVDA 4FPIA 3PX4A 2WCXA 2X7IA 2BR0A 4M5JA 3EVMA 5AXNA 2E9RX 4I6YA 1YBAA 3LQVA 2AZ3A 3PW2A 2GX8A 5KT5A 2GW8A 3GJRB 3PRVA 4RJVA 5T7LB 1M5OC 2WVDA 3MZIA 1BC6A 1NM2A 5J2QB 1TKXA 3PX6A 1HNXJ 3FSYA 3TUPA 1U49A 4LSLB 4LF6J 5E2QA 3P4UB 2XI2A 4ED5A 3EPGA 3ZZTA 2VBYA 2MKHA 3C3LA 3B78A 4HHUA 3C16A 2YNIA 1ZOTA 1H98A 1FDBA 2I5JA 4DCOB 1EKSA 3TI0A 2AGQA 4OI3A 4DQSA 1IKWA 1F6TA 2DJWA 1HQEB 3RRGA 1NZAA 2CAJA 3B8HA 2BJ1A 3PIPQ 5DG7A 5K14B 3IA0A 3QIDA 4Y2MA 4ZN1A 2FHMA 5KFIA 3WX8A 2ZE2B 4M5MA 2XO6A 4G1QB 4U7UK 5CH7B 3PW0A 2FZCB 4HT5A 4PWWA 2I38A 2F4FA 3DCAA 5AJ3F 4ANEA 5LMNF 3QGIA 1N88A 1SQEA 4NXNF 2CQIA 4JB8B 3O8WA 1HHSA 3OTOF 3CF5Q 2CG8A 4A48A 1S4FA 1NLKL 3KK3A 2MDAA 4DU8A 4DR4J 2KI2A 3N6NA 1UEVA 5F3ZA 3J81j 1UAWA 5BR8F 3LGMA 4Y2IA 1S1TA 4C6AA 4QJVA 2HNZA 1N6QB 3HHLD 1UETA 3PNIA 1QVFR 1S49A 3FUYA 1SUQB 2DD8S 4HHHA 4ICLB 1XNRF 1NEEA 1REGX 4NZ7A 2QTWA 3C15B 3JQJA 4KGXB 1FWKA 1NAQA 4MMOA 2LEPA 1G1XA 3BN4A 2NXUA 2HIYA 4FVCA 5DS7A 9RUBA 2KG1A 3EDQB 4I6WA 5JVHQ 3QRRA 2UU9J 2F40A 2ZH6A 1KLMB 5DLFA 1VS3A 1AYEA 5CZXA 1KC8T 3TAPA 1VC0A 4C48A 2R7SA 4O3OA 5KT7A 2CIMA 2KHCA 1XTZA 5B0FA 3UCGA 4WF9Q 1F9FA 3BSOA 2OMOA 4USMA 4UZCA 4NLXA 2GAGC 1U6FA 4LF5F 2NUUG 3SSRA 4OX7A 4N5SA 1IKXB 1S59A 1L3SA 1QDUB 2ASDA 2NR0A 4ES1A 3M6XA 1ZS6A 2H54B 3WQPA 3E8OA 4G3IA 1VHFA 1FRHA 1K0VA 2QFJA 2G4BA 2OD6A 3NMRA 1ZPVA 1RCXB 1HWIA 4Q43A 1HFEL 3GJSB 4F67A 4Y0FA 2ZC4A 3MMCA 3E01B 2B7BB 2CJKA 3RTVA 3T5JA 5DG8A 3POTB 2HBZB 1XMBA 2AJ4A 2FY8A 1RWPB 2Z2YB 5LJ5Y 4P10A 3TW0A 5ETSA 5G4DA 4L76A 4LVNP 3VALA 5IM0A 4J9UE 1GT8A 1FD8A 1UVJA 1CG2A 2BZ2A 3D6HB 5F8HA 4FPRA 2ABYA 2HPUA 2VQFJ 3MECB 2ADBA 5I42A 4OJGA 1RA7A 2BEFA 3ZZYA 1MW7A 1M90T 4EBEA 5DZ6A 4DS5A 3QYYA 3HSZA 2PE8A 4XPCA 1U1KA 1LWCA 1WEZA 2DH7A 3W1YC 3UVJB 2M9KA 3T5KA 2BOAA 2K06A 2CPDA 4AE5A 2FDNA 2FZKB 2XHWA 4QZVB 3ICLA 3TNVA 5GADI 2LDIA 2ASYA 2FGCA 4TQRA 4PG6A 1VIXA 3KG4A 4M5DB 4ZVQB 1YJVA 4ZP9A 1LV5A 3MM5B 1WC3A 2HLTA 2FD2A 2V4JB 4J7CA 2GVDB 4ES3A 5IXUA 3AOAA 1S7IA 1F3FA 3N28A 3I5CA 1YRTA 1RHJB 4BHQA 5L8RC 5FLXY 1FTCA 2NZCA 2HVHA 1ITPA 1SC4B 4MYTA 3DYAA 1GTEA 5ETLA 3BYPA 3OUYB 2MLZA 2IJNA 4I7FB 1F2HA 4HI2A 5K8MA 3KUGA 3SBMA 5F8NA 4LSNA 4QWBA 2OIHA 1YI2S 2KZMA 2RS2A 2QL5B 3FFIB 1F1BB 2XWXA 1TKZA 2QC3A 4TY8A 2MEWA 3BGLA 2QLXA 3G8TA 2DB1A 3UW1A 1RWVB 3LF0A 3V4IB 3Q8SB 5IQ6A 3NLCA 3DDIA 4NLOA 4N47A 3CCMS 2X1FA 1HBMA 1BQMA 4OIXA 3TAMB 2DO0A 3EJMA 4MKVA 2M2BA 1S1XA 4I2PB 1FNOA 1ZAXA 2RS8A 1GFWB 5ADZA 3NAIA 4NMLA 1AT1B 4TNOA 1P1TA 3CJKA 4KH0B 1N5YA 2QA2A 3LP0A 2Y1IA 1ZAVA 2OPQA 4BCAA 4CLWA 4YB5A 4DUYF 1H74A 5KFRA 4DPYA 3G8SA 3TVKA 1F5BA 2ZWOA 3HD1A 2LA6A 2P9GA 1R0AA 4WU3A 2FC9A 1TUVA 3TJ8A 4QWAA 1RAFB 4PG7A 3ITHB 5J2MA 4H54A 3PXGa 3IRWP 3UDLA 3MD3A 4OX9F 3V6KA 2MZTA 2HVIA 4USHA 2N3OA 3KDOA 3VAMA 2PIIA 3ISND 5KG0A 4L6V3 2D3UA 1HNZJ 1UFKA 2CJQA 2YWEA 3DLKB 1NK6A 4DV2F 1ZTTA 2LXUA 5A8KB 2N4DA 4LT6A 5FD1A 4DUZF 5LL6d 4CLSA 3PW5A 3BQ0A 4ECXA 4OZLA 4ED1A 5EN1A 5U47A 1XN9A 2KM8C 3LPYA 5LJ3Y 3OL8A 2B5JA 2RAQA 4LQ9A 3C6UA 1HD1A 2KL8A 3HHLB 1T7PA 3GYXB 8ATCB 4NLPA 4HACA 5LXYA 2E5GA 2H9ZA 2IVFB 1AFIA 4ED4A 4IOBA 2XCPA 2E5HA 1KFDA 1U47A 2B4UA 2YKNA 1SCJB 2GIQA 2IAJA 3M8RA 4F36A 2HHXA 4OV1A 4GVBB 3I31A 1MROB 2UXBF 3CVKA 3R6LB 3VHQA 2NUHA 4ELTA 3PR4A 3M8PA 1REVA 4C11B 4LBPA 2PMZD 2MQMA 5E33A 3MPYA 2KTQA 5C42A 1SJQA 1OPIA 1NSAA 1Q0NA 1DFDA 1WHWA 4QPXA 4F3OA 4FF3A 4OJHA 4C0HA 3OVBA 2YX1A 1N48A 3CCZA 5KFTA 2H1YA 4DHVA 4A8YA 1BQNB 1B7YB 3D3BJ 4UOFA 1RYSA 3HFKA 2OSRA 4TVAB 5GMEA 5DDPC 1X4GA 5HMZA 1FKOB 4G1PA 2F4VJ 4P7VA 4O3QA 4A8WA 4C4WA 1VJWA 1YVFA 3TA2A 5E3RA 2R8KA 2MMYA 4IDKB 1RUSA 1APSA 4JI4J 3T3FA 4RU2A 1HW8A 3A3PB 3D6FB 4ZVUB 3T41A 3M8YA 3MEEA 4PZVA 2XG8A 2JLEA 1K0TA 4F4WA 2NYHA 1HI1A 2MQOA 4JOUA 4G6VB 1KTVA 2DH9A 5CYJA 1JJHA 1VQNS 3NXZA 2AF6A 3PY8A 2DT9A 4LRFA 3CUNA 4DL3A 1SJRA 4DL6A 3K57A 3LGHA 4O44B 1SL1A 1UZHA 2HNDA 1KVJA 3FMBA 4ANCA 3MDFA 1DARA 5HROA 2VG7A 2BMBA 4C0BA 2J7KA 5ETRA 2MB0B 4OZ5A 2IC3A 2HFSA 3SDEB 2LU2A 3FGVA 1KQSR 2PMWA 1H7WA 4OYPA 1U1MA 5GAHI 2E5IA 3IWXA 5J1EB 2ZNZA 3GU0A 3V81B 5AE2A 2ZOMA 2C22A 2R7VA 2HQDA 1D9FA 2ZZMA 4QYZK 1RT5B 5AE3A 2R8GA 2F8MA 1JLCB 1WC0A 2CRLA 4DV7F 2LU1A 2UZAA 3LANA 3H59A 3PRBA 1V6HA 4Y2AA 3M32A 2BQ3A 5DJBA 2LEAA 1U1LA 3KUHA 1HNIB 4GKKF 1SC3B 5AJ3J 2KFZA 3ZZUA 2F8EX 3SQGB 1T0TV 5LMNJ 3JAMY 1VC6A 5ETVA 4NXNJ 5HQLA 5KFNA 4HVZA 2H5IB 3OTOJ 1VBKA 4JV0A 4JI8F 4MIWA 4RUCA 1JK9B 3N9UC 5DO2A 1WD6A 1R8HA 4C9DA 4U67Q 4OX8A 1LOUA 3FRYA 2OTLS 2IIHA 1GXLA 4KRWA 4O0NA 1YZ7A 2KXFA 2G1DA 1RISA 5BR8J 1HWKA 2BA9A 4TN2A 5T14A 1RWOB 2W4PA 2XGPA 1VQPS 3QT7A 1H2UX 3DXSX 3TQ1A 4F26A 2KFNA 2YNHA 4RBTA 4N8OA 4USTA 2VFRA 4PKDB 4EU0A 3AHPA 2A2DA 2GHVC 1MN9A 1U48A 1I6JA 4FF2A 4P7TA 1RU2A 4V1Ak 3QMQA 3UI3A 5D4NA 4HR2A 4P2MA 5A6WA 1NUEA 1U6BA 4Y28C 3RB6A 3PO5A 5AT1B 4I69A 2V8DA 1X31C 2VD3A 3IR7B 1LK7A 4GKJF 3WC2A 4QBUA 1FX4A 2MJUA 3IBWA 1IM6A 3J7AN 2EBEA 4PR6A 5L1KA 3A13A 1RWMB 1U2CA 4LF5J 7FDRA 2RU3A 4ZJLA 1R6YA 3NOGA 2EPIA 1UA1A 1E6YA 3PVXA 2H65B 2C3OA 1LNQA 2AT1B 2G9OA 4RW4A 1PC4A 2Z2MA 2PMHA 1YGYA 2ZOGA 3NCPA 5KFWA 4YQWA 1P8GA 2V8PA 3FBCA 2NXJA 4QWDA 1Y3KA 1TL3B 4IRCA 1CJTA 3IS9A 1XMOF 2OEJA 4IOCQ 4V19J 4TQSA 3BQ1A 2ACYA 5F3TA 1UJ4A 4J9PA 4KY3A 1X4HA 3TVZA 3PKMA 1AA1B 3K2YA 3JSMB 1ZZFA 3W65A 4ER8A 2QJ3A 3C19A 5HQMA 2HFNA 2HHPA 2KKHA 4NZ6A 4EMDA 3KTQA 1WHVA 5C2GA 3IP0A 2RMLA 3Q23A 3HSDA 4IO9Q 1S10A 1RT7A 3ILOA 3DRRA 3N6LA 3QFHA 2EBGA 3EZOA 2L48A 3TA0A 2IMOA 1EARA 1IXKA 2DXEA 3CNQP 2GGPB 3I32A 2XTJP 1VQOS 1VQ6S 3BS9A 3SXLA 1QAJA 5KG7A 4PPZA 2XLIA 4ZP7A 2WONB 4K4VA 3X3UA 3PYDA 1YX2A 2IJRA 3W9IA 1NKBA 4F3QA 4DR2F 2AD9A 1DRZA 3W61A 4RNFA 4USKA 1HBOB 2AW0A 2OEMA 4M5LA 4ZDNA 4DR7J 2BW2A 3R27A 3IRXB 2AHOB 5FIIA 2LYVA 3DC2A 3K5LA 5LMUF 5E3CA 2DGUA 3MOJB 2RQCA 4ZVPB 1SV5B 4JI5F 5A8RB 1H3DA 4RNMA 2ZH5A 1NKCA 3SV4A 3HX9A 2PA8D 1Z4UA 3PEHA 1KTQA 3SSSA 3K5PA 5LOQA 1N56A 3KHLA 3QNWB 3W9JA 2HWHA 2GO9A 2E66A 2YQ3A 2FHJD 2J5AA 2A10A 4RU9A 3RZAA 2P9EA 2MKJA 4XK8C 4TLRA 3FDSA 2EK6A 3SCLE 5KFJA 4HTIA 1VQ9S 4LF8F 3DOMA 2J9DA 3BM7A 1F2GA 3LWLA 1X7VA 2LDYA 2WOMB 4YY3F 3MI7X 2RQMA 2VFVA 5LT5A 3N6MA 3ZTPA 2ZDPA 3I4PA 4UT4A 4NXMJ 2IYGA 1HPZB 1B0PA 5EDWA 3M30A 1H38A 3M2UA 3J81Y 2RB7A 4OYWA 1NH7A 5DGAA 2LP4A 1AFJA 2QSFA 3PG9A 2I8EA 3KNAA 3DLGA 4IQXA 1AUSL 4G65A 2AEFA 3CW2C 4OQJA 1UVIA 2KFYA 3NWRA 5HN0A 2W01A 1LW0B 4J9NA 5D0HA 3DLEA 2I0XA 5A0YB 4N7TA 4LF4F 4Q5VA 2MXYA 4NRUA 2MKYA 1RT4B 1WI6A 2VZ9A 4C8MA 3M2RB 2FVPA 3LALA 4JI6F 2UVUA 1MU2B 3IBCB 3QZ7A 4KH1B 4W92B 1PJ5A 2M7SA 3F0NA 1S1WB 5CHCB 4KPYA 3FZBA 4FP9A 3ULHA 1RT1A 3QSIA 2YKMB 3HP6A 4F0MA 2XGQA 1RCOB 3LW5C 4DN9A 2IBKA 1MN7A 3FSIA 3KDNA 4ZJOA 3T1YF 4HDHA 1NJXA 3BKTA 2PI5A 1HBUB 1V9OA 4DV2J 4K4ZA 4OLOA 2NCKL 4WFYA 4DUZJ 2GMJA 4UUXA 1EAYC 1WUUA 3RG6A 4CLLA 2DISA 1NSKL 3D3CJ 1OSDA 3ZZPA 1SJFA 4U8YA 1YG0A 1NK9A 4DQIA 1B64A 3B54A 1U0HA 3D67A 1U26A 1UKUA 3FQKA 1WG4A 5A8WB 2MQ8A 2ZNYA 4NRTA 4DQQA 3D1OA 3CCUS 5IV4A 3CCTA 1SJ4P 3V2UC 1TL7B 3ILJA 3MPWA 1S6OA 4DV0J 4EI2A 2HHQA 4XAKA 2QZ8A 4K8RA 4X62F 4EK2A 4OYZA 4B9UA 1CVJA 4K0KF 1H7XA 2OI2A 2MKSA 3MAHA 4J9VA 3MM8A 3F56A 1KOHA 1IKVA 4B08A 2ZZNA 4FYWB 1S1VB 3LP2B 3S7RA 4C2MA 5FJ4A 2RQKA 2ZH8A 1SH0A 4LMZA 1W26A 3MOZA 2Z57B 2FJXA 2PSZA 1YDLA 3CMQA 4LFCF 2UP1A 4KO0B 4OZ3A 5B0EA 4PUOB 3CDAA 2EKNA 4PXDA 1S79A 3VZIA 2VASA 2FQQB 1CJKA 1OMSA 2HRUA 2B8PA 3AJ2A 4DFJA 4DV1F 1P9QC 2PFDA 2QMXA 3NS5A 1DQ9A 4Z7CA 2O01C 2R7OA 3T1AA 3M9MB 2FHJA 1O0PA 3RW7A 2W2PP 1VBZA 2AJFE 2R4FA 3KXDA 1O51A 5F8GA 2R7TA 2J7WA 3OL7A 3HHDA 3QO9A 3K58A 2W1BA 4LF9F 2K1RA 2QA4S 2OP5A 2G0IA 2DNMA 2VF3A 1AW0A 4CLZA 5KFBA 4ID5B 3BBBA 3VR1A 1HYSB 2O1PA 4JV2A 5K8PA 4EGLA 2HHHF 1WF0A 4IFVB 3K7RA 3R5GA 3QQCD 1X4DA 5B0CA 4B9SA 1KBRA 4YEAA 1DURA 3GPAA 1QY7A 3IG1A 1D0EA 2HYIB 5E41A 1IR1A 1XERA 1KQFB 2R42A 3BSCA 2WSCC 3JTPA 2VONA 4NA2A 2DH8A 2XNQA 3CDEA 3BGRB 2JEGA 1R89A 1RWWB 3BEGB 1N5QA 4PQUB 2FYXA 2GFFA 2V4QA 3OTCA 2ROPA 3A3OB 4WE1B 3ILLA 2OMLA 4F4ZA 2ZJPQ 4O3RA 1VIOA 3ET6B 3DM2A 4PXBA 2AKWB 4LBHA 1UWBB 2DRAA 5IT9Y 3H0PA 1JXVA 4ZP6A 2CQ4A 1LXNA 1HMVA 4FXVA 1DLOA 3R5CA 1BQMB 3MPDA 2DO4A 2WVBA 5DQIA 3WX4A 4F04B 3NAHA 2XS5A 1GXUA 4NCBA 2OPPA 4M5NA 3GP9A 4CYUA 1S97A 3OTBA 1SPBP 3MFHA 1W25A 1URNA 4DV7J 5I4MA 2D1CA 3KLIB 4B9MA 2JLGA 4CNYA 1RT2B 1X4FA 2HHWA 1PG5B 4R8UB 4GKKJ 4P72A 1S1UA 2CKWA 2JZ5A 3K0JA 4X4RA 2XYHB 1RTJA 5ETTA 3NCQA 2EXUA 2E5LF 3ZZRA 2ZKTA 2V6AA 1N0UA 2N7CA 3G6VA 3VAIA 2RF2B 1LK5A 3HULA 2ZD1B 3CC7S 1PGZA 3NS6A 3IFEA 1A6LA 2G2ZA 4IG3B 4ED8A 4ALZA 1FJGF 1HWLA 4ZKAA 2C2ZB 2ZVIA 3QSYB 3C14B 2HK2A 1DHMA 4YDDB 3Q8RB 3HSJA 2CQ1A 2V2KA 1QAIA 1PYOB 3ZZZA 4AT1B 2QSWA 4ZHRB 2ALYB 2FJDB 3QIPB 5HP1B 5F8LA 1S72S 3M8QB 4URSA 4OZNA 3CCQS 4ZVGA 2R7UA 5C24A 4LRCA 3QZ8A 2N3LA 3W5ZA 3P8BB 3NRBA 3G4SS 2BQRA 4NCGA 4TU8A 4RNNA 2B6AA 2YX4A 2JFKA 2YQ0A 3TJAA 4FDFA 4O3PA 4HH1A 3MMAA 4GKJJ 1URRA 1WSRA 1SQGA 1HHTP 3RBZA 3R5AA 4ETXA 1MMDA 4UOCA 3OHBA 1RHMB 3OBIA 3CDBA 1FFGB 3MEDA 3AFGA 2E1CA 2ZFHA 3AD9C 5H9FJ 3UWTA 1WC4A 3QGHA 3NBPA 1PYTA 3I0RA 3TZXA 3QPIA 2GIRA 2G2YA 4FYDA 3U27A 2Q6BA 2HMIA 1WTFA 1IKYA 2UUCF 1V3SA 2DXFA 4Q0BB 2HBQB 4ED3A 4LR7A 5E3PA 2DR6A 2AGOA 3QGGA 4LIWA 3TO8A 1CJVA 3HHLC 2FZGB 1IBCB 4J9LA 3I9V9 2CPHA 3OD2A 2W7AA 4CIOA 1XMOJ 2KJWA 2HQIA 1KHWA 3MUVP 1EP4A 2GVZA 3GE9A 2H5EA 2GJIA 3IWNC 2GQCA 5IOLA 1C1CA 3U7JA 3MM6A 1C1BA 2CQHA 2YX7A 1X9WA 1HBNB 4NLTA 1D9AA 3OR2B 1D09B 2C2RA 3ZNUA 4U8VA 1NO8A 2ZDOA 2W4DA 4J9OA 1U6ZA 3I0SA 2HQGA 3W2VA 4QYZJ 2DNPA 1Q81T 2GC8A 4NLRA 4LRDA 4A8SA 3PYFA 4CH0S 4X66F 4Q8EA 1KVKA 2VDIA 2EC0A 4ZA1A 3SEOA 3BN7A 2X3GA 3D4JA 4O0IA 4DFPA 2QN6B 5T41A 1UFLA 1FE4A 3ENVA 2C3MA 4TKTA 4CLTA 4W90B 2BVZA 3W2WB 1NZ8A 2OKQA 4F4AA 4DR2J 2ZWPA 1M5PC 4RW8B 1JLFA 3V6HA 2LXIA 2CNLB 2L08A 2OELA 1B70B 1U2RA 2UU9F 3M6WA 1WDTA 3CCLS 1UW9A 5HJYA 4KPCA 4CRJA 1JKHB 1Y10A 5LMUJ 1VRUA 4KKOA 1J27A 3OJUA 4KB7A 1IR0A 2OEKA 2DNNA 3D6MB 3UDEA 5DDRC 5CA5A 2XI3A 5GAEI 3P5TL 3U1LA 5IT0A 3T5HA 1U25A 4PWDB 3G82A 3M9OB 5LM7E 4ZCKA 2FHOB 5HROB 4U7UD 1RAGB 4CO1A 4DQPA 1X4BA 4X4PA 4FKYA 2CPEA 5BXIA 1CJUA 2B9XA 1VQMS 1S6QB 4CNZA 2IYIA 2ZJRQ 2P5VA 2PEBA 3D2WA 3MCOA 3SYZA 4ZPVR 3QLHB 1SB6A 3W5YA 4LF8J 4E8UA 1SIWB 4DEZA 3NEKA 4YS2A 3MWBA 4H4OB 4Z2XA 3RJMB 3D68A 2VIHA 2J0XA 4YB7A 1FRLA 1X9SA 4IH7A 2IRXA 2GA7A 4R5PA 2WSEC 2G1HA 3R5DA 2V5HG 2VDHA 1ZM9A 1FD2A 3KK1A 2MSSA 5HBMA 3CB4A 4JV1A 1S0OA 2J9CA 3GV8B 2IHR1 2EFOA 1PKUA 1TUGB 2AWZA 4ECTA 1J5OA 4F0KA 2W7PA 2L9DA 1BWVA 3FCVA 1QUVA 4KV8B 3KHHA 1JLBB 1K9MT 1Q5YA 1JJ2R 2VH7A 3L95X 4LF4J 1A9NB 5M2PA 2H5JB 2C2MB 1Z1ZA 2J9EA 4DCPB 4O3SA 2D41A 2F7VA 1LWFB 1U1OA 1ZAWA 4I0WA 4TU7A 4PRFA 1R31A 4ZCIA 2W9BA 5J2NA 2B3TB 5A2QY 4RW9B 2HFUA 4LUBA 3SV3A 2YNFA 4OJ3A 4JI6J 1R3NA 3TYTA 1HR0J 4ILRA 1HI8A 1T95A 5KOWA 1RTHA 3LUYA 5IS2A 1TR0A 2OPSB 4ILMA 5HANA 2HAIA 2U2FA 1EIYB 3OXLA 2J6SA 2KVIA 3UPFA 3O44A 2H3EB 3G6XA 2YNGB 2DPJA 2HGMA 4F4XA 3T1YJ 3MEGA 3QGPA 2BE2A 2W2MP 4ECQA 3C46A 4PPDA 1XMQF 3D54A 5KFDA 2OSQA 3ILIA 4KHPJ 3PHEA 2OJ3A 3EUNA 3E3XA 4N76A 3BREA 2YH1A 1IBLF 2O3DA 4WKRA 5H9EK 4WP3A 2DGSA 4DG1B 5HK4A 4KGMA 1X5TA 1YBTA 2AYEA 2WW8A 3O5TB 4I2QB 1H6KX 4ZLNA 4QPTA 4Y2CA 4X64J 2HGLA 1FEEA 1NB2A 3I55S 2BYCA 4CH7A 2NZ4A 1P1LA 3KLFB 3PV8A 1T8EA 2D3OR 3UO0A 3VTIA 3OFHA 4KFBA 5KFZA 2CQPA 1ZA2B 4X62J 2WVFA 4EBDA 1VFJA 2ASLA 3OW2R 1OSCA 1HD0A 1IQZA 3GIMA 4K0KJ 1FJEB 4IR9A 2FUG9 2P9CA 5G0RA 4KT0C 4DV6F 2O67A 2ZBCA 2F63A 2PDAA 2JLFA 1PSDA 4UY8T 2CPYA 3ISNC 2W9AA 4F50A 4OYMA 3CCVS 1RTIB 4CT8A 2DXDA 2NLWA 4J9QA 5D0EA 3DKDA 1RU1A 2CFXA 3FBFA 4CLUA 4HHJA 1RT3B 2W2QP 5IWAF 2DGTA 1TVRB 1VQSA 3KLEA 1X0FA 3BKFA 2AJQA 3DRPA 4WFBQ 3EICA 1TV6A 2V34A 2W8KA 3VQSA 4DV1J 4DSKA 4RBVA 3OFFA 5DM6Q 3WDOA 4F2SA 2KXNB 5HSPA 5F41A 1FJCA 2XZWA 3I5AA 5ITHA 3THPA 3MAAA 2QIFA 4NLQA 2VPZB 5DETA 5I3UA 2CQ2A 2ADCA 1RHUB 5F8MA 2MQNA 3SSQA 1B0VA 3UCUP 1RBLA 5CYQB 1UZDA 1WDDA 2CQ0A 3RAQA 5IQQA 3J80Y 2NXCA 4TYAA 3DGPA 3BH7B 2KRRA 2EFGA 1O8BA 2HHHJ 1UMJA 3P49B 1SBRA 4K4SA 1B3TA 1GQEA 3UFCX 1XR7A 2VG6A 4BC7A 1SIZA 5JXSA 2MGZB 3J7YI 3R1LA 3AY0A 1W2IA 4ZJQA 2V50A 5T7LA 5HQ8A 4CTAB 3TZYA 1NU4A 2IFXA 4DN0A 4I1TA 1I5OB 3RU0A 4KGVB 3K5MA 2NS1B 5CYMB 1IUJA 2YKOA 4F02A 1BWEA 4BWMA 4CDIA 6AT1B 1XK8A 3TVYA 1JJCB 2DCUB 1N4LA 3KLGB 4HL9A 2A18A 2K2PA 2O5DA 5HO4A 4EFAC 1S9FA 3VWSA 1Q86T 2E5JA 3PFEA 5CXTA 3Q8UA 1TL1B 3O1LA 3CE8A 1JQGA 2W25A 3IR6B 3CXCR 2WAQD 4WFZA 2BKPA 4HI1A 2J76E 5E3AA 5D6GA 2ZH2A 1HQEA 3QATA 4C8YA 4FBUA 4IR1A 2HHSA 2KT5A 2POKA 5K14A 3PJ9A 5D4LA 2OD4A 2ZE2A 4G1QA 1S0NA 4KC5A 3GLJA 5B7WA 3OLBA 4PG8A 2NPFA 4N77A 2I9SA 3L7OA 2VJUA 1L3VA 5K20B 4DX5A 3Q89A 4WYLA 2BANA 1HQUB 3RGIA 1RXOB 3EM1A 1F3VA 3GCWP 3K89A 4Q2LA 2P8IA 4ERDA 1FNMA 3FBBA 5DDOC 2FB0A 1RZMA 2F4VF 4QU6A 4JP8A 5F8IA 4CZCA 3MF5A 1HL6A 3AT1B 1FJGJ 4CLPA 2KRBA 2VPWB 5D0GA 3R6GB 2BXJA 1N6QA 1RBOB 2XCAA 5KFUA 4NE9C 3DOKB 3I6PA 3ONQA 1N36F 4ICLA 2HKEA 1QSYA 4PXEA 2WSFC 3DHWC 3M4XA 3C15A 3G8QA 4DJBA 2VL1A 1FE0A 1HNVB 3V6DB 1HARA 2R2TA 5KFAA 5LSOA 3GIKA 1C0TB 1AZSB 2FLLA 5FDLB 5L1JA 1X0PA 2VV5A 4NLVA 5EHHA 1X5SA 3OTEA 2PN6A 2MZSA 3HT3A 2AZ1A 4ITSA 1RGVA 2RE1A 3MAQA 4YP3A 4KGZB 3VVTA 5GAHU 2YKQA 3DXBA 4EWTA 4ZPBA 1NB7A 3CD6S 1U8WA 2EG2A 2LCWA 3UQSA 3KK2B 4WBFA 4CO0A 3EPIA 1S6UA 2B0GA 1NH8A 4A4JA 3KMQA 4HEA9 4FN5A 1Q1KA 4AL6A 2HNYB 1ZZNA 2LEBA 1EB0A 3AA8A 3VAJA 3GR0A 1R8BA 3KJFB 3QAUA 4ZCLA 5HLFA 2DIUA 1IKXA 1Y5LB 1JIHA 2UUCJ 1U2FA 1OY8A 4ZP8A 2GMLA 2W2NP 4QU7A 4N41A 2MHNA 2BACA 2H51B 3KJVB 1N52B 2XB2D 4CQ1A 1YJ7A 3L4BC 2C2NA 2BJ7A 4QWCA 3SCJE 2R2RA 3KJNB 3EGVA 3E01A 2QMUB 1PAEX 4EBCA 3A4TA 2Y8WA 3HFVA 3POTA 3NGKA 4OHZA 3K5NA 4W4MA 2Y8YA 4K50A 3GTYX 4GRSA 4IFYB 1QD1A 3B4DA 1YZ6A 3EXYA 4ANDA 1JXEA 3R2DJ 3EDRB 4ZVRB 2IRUA 1U7LA 4MKAA 3FBEA 3TX0A 2EW9A 1XR5A 3MECA 4C8NA 1DTQB 1TQLA 1K1QA 3UN5A 3SFUA 1N33J 3CJTA 3I4HX 4X66J 1Q78A 1M1GA 4X2BA 1MNEA 3H4BA 2B9YA 5F0WA 1MMLA 2CJBA 2J7UA 2G0JA 2HBYB 1DBDA 5F8JA 1KLNA 5KG2A 1RADB 3MTJA 3UVJA 4NASA 4NLSA 3N0VA 4A47A 3OT9A 1GAOA 3DNCA 4PEOA 2GAHC 3A3NB 3PDNA 2QG9B 4AL5A 1E6VB 4WTYA 4OI2A 3NNAA 1QE1B 4M5DA 3PYGA 1GK8A 1YLXA 1CLFA 3MM5A 1YJUA 2V4JA 1GEHA 1ROFA 2GVDA 5F0UA 3DRYA 2G2OA 2RH3A 4Q45A 2VG5B 3BV8A 2IBOA 1VCTA 2B56A 4X4QA 2Q3PA 4YFUA 4I7FA 4P74A 3T6BA 1BHNA 4L73A 5L46A 1ULRA 3PX0A 1RAIB 4OZ1A 4Y3CA 2R7QA 1KQGB 3OSNA 2BE9B 3H25A 4DU7A 2YBVA 3V6JA 1LFWA 4B17A 2HFOA 4IRKA 1HWJA 2R8JA 5EWGA 5HATA 4KHMA 3V4IA 1R6VA 5DLGA 2Z2LA 2BRLA 4X4NA 2B43A 1QAXA 2ZOFA 4YR3A 3AAWB 4NX9A 3HT0A 2XMVA 2V68A 5J1NA 2JL9A 3T19A 1FHTA 2RDIA 1TK8A 3TAMA 3AB4B 4U9RA 3K8WA 4M5GA 3OVSA 3VGSA 1P6TA 3T9NA 4Y00A 1T03B 4I2PA 2D69A 2X51A 4ED7A 3AQOA 4YHHJ 4F8RA 4H4MB 3NCRA 3FQLA 4IG0B 3CGIA 1FNXH 1NJYA 2VC1A 2LQBA 1NK7A 2OGUA 5D3GB 1R8AA 3I87A 2YWKA 1K8AT 2UXDF 4K4TA 2E9TA 1JX4A 6FDRA 1S57A 4U95A 3HK2A 1EJ7L 1NCLA 1LXJA 3DU6A 4NYPA 4MAKA 1UJ6A 2ALZA 4XDCA 2LQ8A 5ETNA 4OHXA 4WIIA 4RWWA 1K44A 2MZRA 1Z2LA 3G2XA 3ZO7A 3NL0A 4L74A 1Q95G 2XC9A 3NG8A 4U6PA 2ZITA 2MY8A 4DR7F 3KG1A 2FLOA 3ITHA 2M0GB 2M52A 4YN3B 1EQMA 1S6PB 2IDEA 4ZVFA 2BW7A 3BGUA 5K5MA 4A46A 1SI9A 4WYWA 4IUFA 4NL5A 1Q53A 2E1AA 2HSEB 4V19X 3GYGA 3M1VB 3VF0B 1TFWA 3A12A 4USJC 5IC6B 5J2PB 1RWKB 4AYBD 4DR3F 2DPIA 4JV5F 1T9XA 4DPXA 1QSLA 4DXLA 3EMTA 1XMQJ 4Q8FA 2ZZTA 2KM8B 3ELHA 3MR5A 3DLKA 4CH1A 4RNOA 2DNKA 2QL7B 3T9ZA 1MSWD 3IM9A 5A8KA 2VOPA 2RUSA 1CPZA 1WG1A 2BJ9A 3KHGA 1IBLJ 3AB2B 7FD1A 4OFZA 2V0NA 4P6QA 4K4YA 4B3RJ 3DRXA 3Q0AA 3BF4A 2FIUA 3IR5B 2DBBA 3QT8A 4R25A 3R7NB 1PIEA 4CO4A 2Q1LA 2IM3A 5F9LA 2EI5A 3DRSA 2E7VA 3FNNA 3HHLA 4ZS6A 1RT6B 2FJEB 3GILA 4NXMF 2V4RA 4O3NA 2YQ1A 1RTDB 1RQ0A 4JUZA 4ECRA 3G96A 1N8RT 2JRSA 1I51B 3HVTA 4HTJA 1X8DA 2A0FB 1UVNA 3OSPA 2NPIA 4GVBA 1JLQB 1MROA 2O66A 1FXDA 1YIJS 4QWEA 4DV6J 2CUYA 1JLAB 1TL5A 2WVEA 4OHYA 1PJ7A 2XHCA 2U1AA 3LP1B 2HAFA 4X4UA 4X65F 2VFTA 5L9XA 2DNOA 3KLHB 3M6UA 3CSKA 4NA1A 4XPEA 3PW4A 1NHKL 1EQ0A 4TU9A 3D0IE 4J9SA 1Q82T 3HHNB 5D77A 1FI4A 5IWAJ 1BMQB 3C8YA 1EETB 2DGQA 3AJDA 1JLGB 4WWSA 3I82A 5KG5A 4UY85 2FVRA 3ENAA 2V9KA 3CC2S 2DHAA 2RUGA 4K59A 1VRQC 1BQNA 4I67A 4P9SA 4J9KA 2B4VA 2VPXB 1WOOA 3KFWX 4PG4A 2CJXB 1FKOA 2HS0A 4WFNQ 5J1PA 2M88A 3JYTB 4IDKA 3CJ8A 1O5JA 2CA9A 3NGTA 4ELUA 3DLLQ 5GAGU 1CS4A 3GFHA 3X1LB 4P71A 1FTRA 1FKPB 5FLXU 3DN9A 3P45B 4E2FB 2ZUAA 4DV3J 1M1HA 3ZXWA 2ZH1A 3KUEA 4BBYA 1KOOA 2F8HA 1S9EB 2FTRA 3SI8A 4QIWD 3LTOA 4R0JA 4JBCA 3VAGA 1V3RA 5C25B 1WHXA 4O44A 2K7KA 1PBUA 5CZVA 3NGDA 3VGVA 3TX8A 2V69A 4J5OA 4DV0F 5M2RA 1R8CA 1JLEB 2RSQA 1FT8A 1KVIA 3SDEA 1OPZA 4GO7X 5E3QA 4B3SF 1H2VZ 1LWEB 3JSRA 3M7VA 1UFWA 3I9ZA 3ADAC 5H9EJ 2CJAA 2JEJA 2R9LA 3CJ4A 5J1EA 2F9JA 4QQBA 3G87A 1MLAA 5KFLA 1NSPA 4GO5X 7AT1B 3D6TB 1RT5A 4O4GB 2VPYB 4ZCMA 1JLCA 1Q4RA 4DOZA 2GMHA 4ELVA 1CEZA 3BPDA 1VRTB 3LA0A 4ES2A 2PO4A 5EWFA 2V8HA 3M8WA 2XY6A 1JJ4A 3BZQA 1D9DA 1TL4A 1HNIA 2XMWA 3HVRA 4L72B 9ATCB 3T6JA 2Z4PA 1TAQA 3LH2S 3SQGA 2UUBF 3LO3A 1MWZA 4RW7B 4CLYA 3PZPA 3HJVA 2XULA 1WKLA 4FNHA 2V67A 2EFVA 3MM7B 2RIJA 1C0UB 1DTTB 2RRBA 2FJVA 4IOAQ 5DQHA 2VB6A 3H42A 4QIVA 2JEFA 2XS2A 2VA3A 2MKCA 1FRXA 2I2YA 2I1RA 2OO4A 2CWXA 4L75A 2MZ1A 2MYFA 2OAUA 1KHVA 4HLBA 1KWMA 4MJKA 5HL7Q 2C2DA 3CWJA 1N36J 3UDVA 5H9FK 2EVZA 4M5IA 1SJ1A 3JXOA 2JVRA 5DG9A 3DMJB 2UVVA 2CJYB 4DX8H 1RE1B 4XTTA 2CPFA 3GONA 1UVMA 3DOLB 2ACMA 1WEXA 2BKOA 1LW2A 4ZITA 4P2SA 4RPFA 2R8IA 4DR6F 2J0WA 1R0BG 4WP9A 1Y4ZB 1D1UA 4JYAJ 2E44A 3SMZA 1Q8IA 4ZVHA 2K7JA 3Q8YA 2RDJA 5DQGA 5KFEA 2BM0A 3W7BA 2Z56B 1VR6A 3W3SA 4AUKA 4KHRA 2HQ3A 2XO7A 5B0BA 4DPOA 4DR1F 2OH2A 3BSNA 4F3MA 2OPRB 3MD1A 1RB0A 3IC1A 4AXIA 3N4WA 3DHXA 2IY5B 4ZOSA 3G86A 3TEGA 4MKYA 3G6ES 4PYDA 1WHYA 5KFSA 2B4PA 4LR8A 1NBEB 2DGOA 4OYBA 5G0RB 1TL3A 1U1NA 4DPUA 4Q44A 3C6TB 2D74B 3JQKA 4UQGA 3PKYA 1RJJA 1H73A 2IDLA 2YTCA 2QLJB 2B4OA 3H7HB 2OHDA 4ZVOB 5LSLA 1X9MA 3BGOP 3D1HA 3GIIA 3WC0A 2HFVA 2V8GA 2MQPA 3JSMA 3TA1A 4AQYF 1F5AA 4ZVSB 3CT9A 4DCJB 1NJIT 3R7SB 2V9WA 2CG4A 5KFKA 3CEDA 4DV4J 3GSDA 1YJTA 1Q7LB 5KFHA 2Q43A 1UCNA 3GR1A 3GQCA 1YJNS 1S7HA 2HZCA 3M2VB 1ICEB 1U1QA 1YRUA 4MFBB 3J7Z5 4RL1A 4O4RA 4NI2B 3H40A 4LF7J 2GGPA 1S0VA 4KGKA 1FFSB 1OY6A 3EE3A 2J8AA 4AD6A 3DI6B 4NLWA 2MLXA 5CCLA 1I1GA 5C5JA 5D8HB 2WONA 2XBPA 1XC9A 4DLEA 4RW6B 4OL8A 1YSJA 1ZA1B 1HBOA 2AGPA 5A6PA 4ZPTR 2ZVSA 3W64A 3IRXA 1VLYA 3NWGA 2VG6B 2CQCA 1MG7A 3OR1B 4WFAQ 1C4CA 3VGUA 2QYCA 1KEKA 4NWBA 2RKIB 5AXMA 3OV7A 1VK3A 3H2UB 1SV5A 4WXWA 3FEYB 2XYGB 5A8RA 2J6TA 2CPZA 1WTBA 3DGVA 2W9CB 1RLDA 2HZAA 2CXEA 1N0VC 2CYYA 1SJ3P 2BX6A 2AX1A 4CLFA 1FWLA 4EYHB 3M05A 4YR2A 1FO1A 3D0HE 3M8ZA 1MWQA 3ZFVA 2AJ1A 4IKAA 2XMJA 4GC7A 1M5HA 3UNYA 3HPOA 2VICA 5IT4A 5DRKA 3MCSA 4C3LA 1FXRA 5CCMA 1IN0A 2HEKA 3GFZA 1UJ5A 4ZK7M 4ID8A 2L3MA 1KN6A 1YBUA 2GO8A 3TUIC 5HJXA 3CD0A 3GFXA 1L5UA 1RHRB 3W8PA 2WOMA 2RNEA 2ZH3A 2YWWA 2IMWP 3LAKA 1F5CA 1HPZA 3OQ2A 2XM3A 1NHVA 4CWBA 3SZ2A 3CMAS 1D8YA 2H48B 1VQKS 2BANB 3JAMU 1RP5A 4XIUA 1VYAA 5JVGQ 5ETPA 4AXJA 2SXLA 1CULB 2EFPA 4J37A 3TZZA 2UXDJ 3HHKA 3NNCA 4C8ZA 2ZH9A 1T05B 1TTHB 4A8OA 4MKBA 2YWHA 2QRRA 5KOXA 4F2RA 3BO2A 1LW0A 1FK9B 5A0YA 3FEZA 5GMDA 4DF4A 3D66A 4ECYA 1F9EB 2GV1A 2WB4A 4F25A 2VUGA 5B09A 2GQ2A 2XSJB 1RT4A 2C2KB 3M2RA 1KONA 4C8KA 1B0TA 1MU2A 3F41A 1S1WA 5GAEU 2KXHA 2GNKA 4OZJA 4DL7A 4QCLA 4OZ2A 2CDQA 4K2JA 4TXSA 3ZTRA 3GZ7A 1L3KA 3MUTP 1B7FA 2YKMA 2W7OA 2KVQE 2KH9A 1NMEB 4YR0A 4DR3J 3HI9A 3M6VA 4JV5J 1NNDA 3TR5A 2QEXS 4ZVTB 2HFZA 2F1FA 2NYIA 1TKXB 2GJFA 4FYVB 1HBUA 1TKTA 2X1GA 1SKSA 1QTMA 1PBAA 3Q8VA 3DDKA 1WOPA 4DV5J 2CQDA 2J0SD 3GJTB 2JVOA 1JXLA 3P3DA 3UCZP 3EZ5A 4M5HA 1RHQB 1BE4A 3T5LA 3C16B 3GFYA 1NRKA 2YNIB 1GMVA 2CPXA 4IQMA 2ZH7A 5D4PA 2I5JB 5HLFB 2ZBRA 1IKWB 3HZEA 2DEIA 3B4MA 3BSAA 1VI7A 5JJBA 5A8WA 4ZLJA 3L3CA 3KYLA 1TMMA 3H2VE 3IGVA 3BO3A 2BKNA 1TL7A 1HNWF 1FKAF 1GMUA 2P2CB 4UOGA 2QX0A 3IM8A 3QAEA 4ED6A 5RUBA 1WG5A 1SC1B 3K17A 3CIZA 1M5SA 1OY9A 4D3HA 2DNZA 3KK3B 2LVWA 2C2OB 3G9CA 4X65J 2FJBB 4ZPCA 3O2IA 5KFXA 5B08A 3FCHA 4DSLA 1ZM4A 2WZ1A 4B3TF 3GIRA 4B3OA 4HT7A 4C0OC 4NYZA 1W2BR 1S1VA 1RA6A 3LP2A 2HVEA 1H72C 1S1TB 3OXFA 2HNZB 4ED2A 3E2EA 3MMBA 2XZDB 8AT1B 3CJ5A 1G2EA 2EWHA 4KO0A 4PUOA 1WC1A 1BQXA 2DCLA 1U4BA 2UXCJ 2B51A 1HR0F 1JNZB 3RW6A 2FPHX 4FXWA 1Y5IB 1X4AA 1HLWA 2NXNA 3CJ0A 2F3JA 4Y65A 4LRAA 3ISZA 4KAIA 3A8IA 2AJ2A 4JI3F 2G0CA 4NA3A 1ZYQA 2KZZA 1LEOA 1RAAB 2B9WA 1RAHB 3CCWA 2HRTA 2YWFA 4DSIA 2C2EA 4KHPF 1RABB 1Q5VA 4OHVA 1S77D 1SKUB 4A8QA 2E1RA 4JI2F 2DR5A 3QT5A 5K9FA 2IVMA 4LSZB 1RKJA 4ID5A 3HFZB 1Y00A 2HG4A 1HYSA 3Q8QB 1Y0HA 4IFVA 4OV6A 1DQ8A 2RVJA 3P6YC 1S99A 1OWXA 1YQHA 3TEHB 5KFMA 5GAGI 2DK2A 4I4BA 5BJRA 4WXOA 2ROEA 5H1SV 3F73A 4OYIA 3BGRA 4CM0A 4RUAA 4X64F 1AUDA 3JQMA 3UNGC 4PQUA 2Z0GA 4JI1F 4HYKA 2W24A 3MPUB 4DL0C 4DR5F 1VDHA 4WE1A 1WKKA 1XWLA 3ET6A 2LFVA 2MJNA 2Z58B 3GV5B 3MMCB 1UWBA 2M8DB 2R3VA 2P6SA 4IH6A 1S4EA 4B3SJ 5D4OA 2K3IA 3H98A 2K8GA 4QYRA 1QAYA 2YKPA 3C2PA 1M0SA 2YPZA 5IM0B 1FVSA 2AP6A 3CCRS 2D7SA 2IPOB 3UN2A 2DEJA 4NZ0A 2JSXA 3J81U 4WK3A 5I42B 4DL2A 3OLAA 4LREA 2Y0SD 3KLIA 1LWXA 1NXIA 2BJ8A 4J9RA 2XMUA 3HZGA 4CLKA 3V5RA 1TFYA 2QV6A 1U8SA 1DZ5A 2AQ4A 1FF2A 1RT2A 2FVQA 1S0MA 4F7VA 4R8UA 4WJBA 1LWCB 5KT3A 4J91A 2UVWA 2UUBJ 4MK7A 2KT2A 4K2XA 4PYAA 1RKIA 2A6MA 5K8NA 2RF2A 4MIAA 3JTOA 3KWMA 2CZ9A 2ZD1A 4DL5A 2W2OP 3CTRA 2GIFA 5KFPA 4IG3A 1U09A 4QIEA 2XMAA 3C14A 3MEKA 2N7YA 1NSQA 2VOOA 2AIRB 3J7YU 2R2UA 4ZHRA 3QIPA 5HP1A 3DYAB 3M8QA 3QJJA 4NLDA 2DHXA 4N8NA 4CI0B 1D3WA 2DVIA 4LSNB 5BYQA 1N32J 3MM9A 4J90A 4DR6J 1HHQA 2Q6CA 1F60B 3HM9A 3AD8C 3Q83A 1TKZB 4JI7J 4TY8B 6FD1A 1Q8BA 4NYOA 3MFIA 2N82B 4N56A 3CDUA 1GXTA 4A8FA 3K5OA 4EO8A 1SH3A 2DNQA 4OLPA 4BLGA 3K8VA 2K3KA 5L38A 1HBMB 1RI7A 1R8PA 3DRSB 3DDNA 1P9YA 4DR1J 2ILYA 5L39A 3ENWA 1S1XB 2J8SA 4MK9A 4WIQA 3D0GE 1YITS 1U1PA 1QJHA 3PTWA 1YRXA 2CPIA 2PA3A 1TK5A 3N5BA 3HVTB 3AA9A 3CJRA 4Q0BA 2X1AA 4B9TA 2HQFA 2PI4A 3JS9A 1FCAA 3CJKB 1FRKA 1M5KC 1M5VC 1N5YB 2KYXA 4NCAA 3TWZA 3AH6A 3LP0B 1Z2ZA 3HD2A 3ZZ0A 2OPQB 2IM0A 2HWIA 1KSPA 1RAOA 5HI7A 3SIPB 3IGNA 1UWAA 5CABA 3QJPA 1YTYA 1RWUA 1R43A 2HGNA 5JUMA 4AQYJ 3D28A 4QW8A 3R5JB 4H4KC 4Q2MA 3IAM9 5HAOA 1R0AB 1NDKA 2C3UA 5KG6A 1HBNA 3EZUA 2FJAB 4WTOB 3OR2A 2HVDA 1VISA 3E51A 2DNHA 5J2MB 2VJVA 2C1EB 4QR0A 2KN4A 5I3PA 1NDLA 4PXCA 3MUMP 5AE1A 4G1IA 2ERRA 5L1IA 3THVA 3CPWR 4X4SA 4USVA 1R0CB 2GHPA 2WBMA 4OYOA 1B99A 2LLZA 3TAQA 2UUAJ 4ECWA 3VAKA 3SCIE 1KNZA 3W2WA 5KG1A 1LFPA 4RW8A 4NLUA 2YY3A 1CS4B 4OYAA 2FGOA 2DITA 4EYIB 2H4WB 1VGYA 4DZ6A 2AX0A 1JKHA 4FF1A 1LQ9A 2B5JB 1PO6A 4CP5A 3C6UB 2F9DA 1T9VA 1YJRA 4I68A 4QIFA 2A3JA 3RRHA 3DFEA 4A8MP 2R7WA 3GIJA 3FKBA 3KMSA 4HACB 3GYNA 4PWDA 2WVCA 4P2XA 4UZBA 4CM2A 2YKNB 4ZLLA 2IAJB 5IT9U 3F44A 3RBEA 1YK9A 3AOBA 3TUZC 2HURA 1FDDA 3W8GA 1I3OB 1FDAA 2RT3A 2IA0A 2D9OA 5KT6A 3M8PB 1REVB 1S6QA 4Y34A 3S1TA 1T3NA 3UR0A 2R2SA 1TZ0A 1OIAA 1T9UA 5C42B 5KFQA 1V3ZA 1UEUA 3EXCX 1MMNA 3QLHA 3Q2SC 3P5BP 5ETMA 4ZPAA 4B02A 1BD6A 1U1RA 3BDPA 4IYQA 4W98A 3ZTQA 1U24A 4UOHA 3AD7C 3H4DA 4H4OA 1FX2A 5E5NA 2CPJA 4ENOA 1AXQA 3H5UA 2FJWA 3HSGA 1KKHA 2QO3A 1SKRA 5KFOA 4KIAA 3NS7B 3U1MA 4P75A 2LQ9A 3W9HA 3R2CJ 2AYMA 3DLHA 3PEJA 1C2PA 1N33F 2Z8QA 1IBKF 4TYBA 4X4VA 3HVWA 4BC9A 1D8ZA 1RYRA 2OFHX 1SKWA 4KV8A 1JLBA 4C98A 2CNKB 2DNYA 1CQMA 2PGCA 3CMES 1S9GA 4ILLA 2XLJA 5MAOA 4BDPA 2QLWA 1LWFA 3WIVA 4NEZA 5ETQA 5DDQC 4DX6A 4RW9A 1YHQS 3MEEB 1VQYA 2IVYA 1XNRJ 2DRDA 3ZTSA 1UVKA 2YPYA 2LMIA 2WW4A 1RWXB 4DL4A 2OPSA 5ETOA 2EFQA 4LBIA 4FF4A 2BRKA 2VU5A 1OO0B 4C3MA 1YJWS 1LW2B 4M1KA 2VC0A 2YNGA 1NHUA 1W7WA 3FC9A 2HWTA 1O6XA 3MGJA 2HNDB 4NPOA 3PIOQ 3IWLA 2VG7B 3LOUA 3TOQA 1UPMB 1V5VA 2IC3B 1VBXA 1KDNA 4DI6A 3FRZA 2ZJQQ 2IM2A 3L9ZA 3S6EA 3RAXA 3R97A 3CCES 4DG1A 2Y1RI 2IJFA 3PYEA 4DLGA 4I2QA 3GSIA 2CVIA 3P96A 4M63A 2CQ3A 3R5BA 4WU2A 2DTJA 3B82A 4DSJA 4KE5A 2RDDA 3Q8PB 3TZWA 3Q24A 4NMXA 3FCWA 1NDPA 1RSCA 3M32B 3N79A 1HNWJ 3KLFA 3OVAA 1NJWA 3H5SA 4YHHF 5BYRA 4PQAA 2WBRA 3KOAA 5IFMA 2NSCA 3NY0A 3WBZA 4KSEB 2DIVA 4YB6A 2JOQA 2WTFA 1JWWA 2B8QA 1PC5A 2ZBQA 3PJXA 2QMWA 4DDFA 3SQOP 5IC4B 2HQCA 3FMWA 1TKDA 5SZTA 4KYZA 2MLYA 2ILZA 1I94F 4B3TJ 2FVSA 4KBIA 3PW7A 4C97A 1MWYA 3DU5A 3BR9A 3BGFA 1RTIA 3ETMA 4DQRA 3SCKE 3CCSS 2CQBA 1XNQF 4M8LA 2YNHB 1RT3A 1XJWB 1TVRA 4TY9A 5HVHA 1PYSB 1UL3A 3EVWA 3WZ0A 4ECZA 5LXRA 4WCEQ 3CO0P 1R27B 1N34F 3TQEA 1UW4A 2BJEA 2KDOA 1WF2A 2JHEA 2HRYA 4JI3J 1CBKA 2EEYA 2ZUGA 1T3OA 3TANA 2DHGA 4Q7AA 1YJ9S 3BB5A 3RUBL 2DNGA 3IAS9 8RUCA 4ZMMA 3MR3A 2L9NA 4MT1A 1X60A 3VCDA 2Y1LB 1YKWA 3D7SB 2A6OA 4DFKA 3FK4A 2KO1A 5CYQA 4JI2J 1TU0B 3GG1A 4OZ0A 2DGVA 2BJ3A 3MR7A 1XBWA 1TUWA 2AMCB 4B3RF 2EFNA 3OJSA 2LKZA 4DBQA 3EYZA 1E6YB 3JSYA 4LVOP 3W60A 2W8LA 1VHIA 1QTNB 4RW4B 4DMZA 1X4CA 3EGZA 2MGZA 1IJFB 4DX7A 1IBMF 3RR7A 4P52A 3FZ2A 4LR9A 4JI1J 3H8YA 4CTAA 2HW3A 3Q2TC 4DR5J 3KJQB 1CJTB 4WZMA 3MCMA 3IS9B 2DGWA 5THWA 5CYMA 4DPTA 1K73T 2XMMA 1FRIA 1ZTWA 2YXLA 1Y9OA 3BR8A 3KLGA 2MQQA 1ZM2A 2RQ4A 2RHQB 4CO5A 1TL1A 4OI6A 5L9NA 3W62A 2NREA 2D3ZA 2Z30B 1DY3A 1FJ7A 3Q86A 3BDEA 1RT7B 2J9DE 1UVLA 1WSVA 3DRRB 2XY7A 3US5A 1RHKB 5B0AA 4WK1A 3BBCA 2OFGX 2BV3A 2AJ0A 1Q8LA 2Y3YA 2V94A 4WP8A 1XR6A 2VQEF 1IM4A 2YVSA 4A8XA 2H4YB 5B0DA 4ZLPA 5IV3A 3RBXA 2F5GA 3CD5A 2YKAA 4DUYJ 1GH8A 1HQUA 4RUBA 2BQUA 2AYBA 3VVUA 4NEYA 3VV2B 2JH3A 3I96A 5A2QU 3UD4P 1N5VA 2AEJA 3GCXP 4GMKA 3HJFA 2Q79A 4NLYA 2ZM6F 2MKKA 1N54B 3GMGA 2MSTA 4IO1A 1WEYA 5DGBA 3FJ2A 3R9LA 3EGWB 2CDRB 1IVZA 1A0OB 4K4UA 1WC6A 4OX9J 4RO0A 1TP7A 5D15A 4FS2A 2BJDA
chains in the Genus database with same CATH topology
2G0IA 2G0JA 4PEOA 2IDLA 1S12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G0I A;  2G0J A;  4PEO A;  2IDL A;  1S12 A; 
#chains in the Genus database with same CATH topology
 2XLK A;  3MTK A;  4E0D A;  2CVE A;  3DOK A;  2E9Z A;  3HKW A;  2WRM A;  1Q8K A;  4UUW A;  2MZJ A;  4B3M F;  5GMK a;  4UW2 A;  1WC5 A;  4DV3 F;  2VOD A;  1HNV A;  1S12 A;  3V6D A;  4XO0 A;  5CD4 H;  1TKT B;  4I6A A;  2L9W A;  1C0T A;  1AZS A;  3IN5 A;  5FDL A;  2FC8 A;  3Q22 A;  2A1B A;  5JMN A;  3G6Y A;  4FS1 A;  2HIQ A;  2HVZ A;  3MUR P;  3VZH A;  1VQ8 S;  5A76 A;  1EHW A;  5K8O A;  2VKZ G;  2OLW A;  5J2Q A;  1DJ0 A;  4UQT A;  1KD1 T;  2CWK A;  1T02 A;  4TLQ A;  4LSL A;  4QW9 A;  3DOM B;  3KNG A;  3KK2 A;  1VLO A;  1RTZ A;  3NNH A;  3QRP A;  2WK4 A;  1F9H A;  2XEX A;  2HNY A;  1R7I A;  3TUJ C;  2RRA A;  4HH0 A;  4LRB A;  3U1N A;  2B9E A;  3DLJ A;  3PO4 A;  2PFF B;  3M30 B;  2DNL A;  3M2U B;  4EO6 A;  2D9P A;  4DF8 A;  4GC6 A;  4DZD A;  4USW A;  2APO A;  2Q66 A;  3DLG B;  1SXL A;  3A8E A;  2UXB J;  2BUN A;  2G13 A;  4FZV A;  3KJV A;  1VC5 A;  4KJI A;  2I6W A;  4PAA A;  3FVY A;  3AJ1 A;  3MMJ A;  4CO2 A;  3DLE B;  5HVG A;  2YH0 A;  4B3O B;  4O23 A;  3KLV A;  2IM1 A;  2MHE A;  2M8H A;  2JC0 A;  1RAC B;  3MMB B;  2CZV C;  3HHE A;  3RR8 A;  1TAU A;  1M1K T;  2XS7 A;  3MPV A;  4F0H A;  4RBU A;  2UVR A;  4OI1 A;  1T94 A;  3CJS A;  4IFY A;  2QYG A;  4JI0 F;  3QJL A;  1Q79 A;  4K5S A;  4ZVE A;  1IWA A;  5C2C A;  2D3O 1;  2RD5 C;  1GX6 A;  1RT1 B;  1DTQ A;  4X4O A;  2HS3 A;  4CCH A;  3GB0 A;  1KRP A;  1S48 A;  2KYZ A;  1SUQ A;  5M2U A;  2GCF A;  3HCX A;  3GV7 B;  4S0M A;  4NLG A;  1SH2 A;  4M5K A;  2RHS B;  1OJ4 A;  1NK4 A;  2E1P A;  4OI4 A;  2XWY A;  2DNR A;  3UE2 A;  3J80 U;  1HQ2 A;  3QRQ A;  2XMK A;  3CIM A;  4KR0 B;  1WNE A;  5BYS A;  1E6V A;  3C66 A;  2GHW A;  1H2T Z;  1G6B A;  1KLM A;  1QE1 A;  1FDN A;  4JYA F;  3HO1 A;  1EX8 A;  1PCA A;  3OTD A;  3GG0 A;  3L7U A;  3V4M A;  4HDG A;  4LFB F;  1J5E F;  1U0H B;  5AXL A;  3D5M A;  1J2V A;  3T1H F;  3QWU A;  4FBT A;  2NXE A;  4RNH A;  1RAJ A;  2EK1 A;  3THT A;  2VG5 A;  2QL9 B;  2KU7 A;  3M8S A;  2KJV A;  1T9W A;  5KG3 A;  2VKR A;  4LF1 A;  2X3D A;  2Z2Z A;  4OYX A;  5EGY A;  3HXM A;  1X5P A;  2C3Y A;  4PG5 A;  1UA0 A;  1LKZ A;  3U02 A;  3ZC4 A;  3MM8 B;  4QR2 A;  1P27 B;  1IKV B;  2HZV A;  4X84 A;  3J7Z T;  4WFX A;  2VFS A;  4HKQ A;  2JNJ A;  3QT6 A;  1NK0 A;  1V5I B;  3D9B A;  1HA1 A;  4AL7 A;  4K7Q A;  3ZZO A;  4DUT A;  3RB0 A;  2DGX A;  1HIY A;  1PJ6 A;  3CDW A;  2QT7 A;  1TK0 A;  1T03 A;  4DV4 F;  2PC6 A;  2ASJ A;  4M94 A;  1CJK B;  4H4M A;  4LQ3 A;  1OYD A;  4B9N A;  2HHT A;  4IG0 A;  2EKY A;  4C8O A;  5SUH A;  1FEH A;  4R0E A;  1OYE A;  5D3G A;  5CQG A;  2RU9 A;  1IBK J;  4JI8 J;  2EG1 A;  1UPP A;  4PAB A;  1L3T A;  2DY9 A;  4LF7 F;  1WEL A;  1NKE A;  2M4M A;  1UP1 A;  2GZO A;  5CD4 A;  2JDJ A;  1ZET A;  4F4K A;  2CAD A;  3QO9 B;  2DRB A;  2BAB A;  2PEH A;  2HBR B;  3IBF B;  2K1R B;  4C7Q A;  2B7C B;  1OQ3 A;  2E7X A;  2Y9H A;  3VGT A;  3PAC A;  3QWP A;  5KFG A;  2GS8 A;  2MPU A;  2ATL A;  4LFA F;  4Z7Y A;  2BOP A;  1XIQ A;  3IG1 B;  4K4X A;  3BYR A;  3NGR A;  1T9Y A;  1WWH A;  1S6P A;  1FFW B;  1KP6 A;  4AFF A;  3J7A 1;  2MQL A;  2ZKU A;  2NQP A;  2DKO B;  3FEX B;  3M1V A;  1WAC A;  3KHR A;  3MM9 B;  5J2P A;  3UD3 P;  4DSF A;  2E7W A;  4WPA A;  4B9V A;  4URG A;  3OUY A;  2R8H A;  3NKY A;  3TJ9 A;  2XY5 A;  4BS2 A;  1VMB A;  1X4E A;  2J0Q D;  3PM9 A;  3DM2 B;  1T11 A;  2OUG A;  1HNX F;  1VQ4 S;  2WB1 D;  5GVQ A;  1CC7 A;  1HMV B;  4LF6 F;  1U02 A;  1SC6 A;  1A7G E;  1DLO B;  1VQ5 S;  3FFI A;  2VBX A;  2ZH4 A;  2L41 A;  3ETO A;  3N01 A;  4EZ9 A;  5DZ7 A;  3EGN A;  3UDC A;  2XYP B;  2OPP B;  4Y2K A;  3JSB A;  2DR7 A;  1ACM B;  2HHU A;  1FRJ A;  4P2F A;  4CYU B;  4ATN A;  1NK5 A;  3BKU A;  3NGS A;  3OL6 A;  5KFY A;  1L3U A;  3VAF A;  4QOT A;  2V2V A;  2AEM A;  1VBY A;  4ZPW R;  1HKA A;  3I5B A;  2C42 A;  3RB3 A;  3TP2 A;  3CO9 A;  3TRG A;  2E1M C;  1RT6 A;  3JB9 k;  1KR4 A;  3CJ3 A;  1VQL S;  1RTD A;  1S1U B;  2E29 A;  1RTJ B;  4WZQ A;  1DAX A;  2JX2 A;  4YOE A;  3NMA A;  3OPK A;  1JLQ A;  2GQQ A;  4P73 A;  3H5X A;  4WKY A;  1JLA A;  4H4K A;  1H0H B;  2COL A;  2MY7 A;  5E7O B;  1I94 J;  4EUV A;  3NOC A;  1XEZ A;  3LP1 A;  4CO3 A;  4DR4 F;  1FRM A;  2XZT B;  2VBZ A;  4I56 A;  3QFW A;  1VK8 A;  3KLH A;  1UTA A;  2JWN A;  3L7P A;  2JJ4 D;  4OHW A;  1XNQ J;  1EKR A;  3GJQ B;  3G71 S;  3LWM A;  3IO1 A;  4LF2 A;  1DQA A;  1EET A;  2ZBP A;  5DM7 Q;  4RLE A;  3TAR A;  1JLG A;  5C24 B;  3PCO B;  1XQI A;  1FXL A;  2LEC A;  1N34 J;  3SFG A;  2KB2 A;  1U0S A;  4NCG B;  1U45 A;  3CUL A;  3HVA A;  4DWI A;  2CNO B;  2M70 A;  2B6A B;  1UEK A;  1RLC L;  3W5X A;  3MMA B;  4XDD A;  4ZIW A;  4KTQ A;  4FVM A;  2R7X A;  1CQN A;  3BJY A;  3IXQ A;  1GMW D;  5KFV A;  1QLN A;  3OFE A;  3W66 A;  4YB1 P;  3JYT A;  1C4A A;  4DV5 F;  4EZ6 A;  5HMY A;  3MED B;  4FYX B;  1Y11 A;  4KQZ A;  4JI5 J;  3MHY A;  3FSX A;  4LJM A;  2UV8 G;  1FKP A;  4MK8 A;  2HHV A;  3OL9 A;  2IRY A;  3MR6 A;  3NBP B;  4RX6 A;  1PIL A;  3I0R B;  3O3L A;  2HMI B;  1NDC A;  4OJ1 A;  1IKY B;  4EEY A;  1IBM J;  2QA4 G;  4USU A;  1S9E A;  3H90 A;  5MLC V;  1ZH5 A;  1CJV B;  5KG4 A;  1QM9 A;  3WIU A;  1T9T A;  3WHI A;  2BM1 A;  5C25 A;  4Y6I A;  3PHT A;  1N5S A;  4Z37 A;  1KQK A;  3PJW A;  1Y7P A;  4GVL A;  2MZQ A;  2UV8 A;  2ZBI A;  3PRD A;  1KFS A;  2BDP A;  3HMJ G;  1NJZ A;  1ARO P;  1EP4 B;  1JLE A;  2XMT A;  2GVZ B;  1AB8 A;  4F4Y A;  2C3P A;  3N5F A;  5D0R A;  1C1C B;  3MM6 B;  3BBF A;  4YY3 J;  1C1B B;  2UUW A;  1LWE A;  1WKJ A;  2BBE A;  4C11 A;  1B4S A;  2CJ9 A;  2V2Z A;  3R7B B;  1NPP A;  3BO4 A;  1GTH A;  3A8K A;  4L3K A;  1WF1 A;  2BE7 D;  2IA6 A;  1OQ6 A;  4K4W A;  3CD7 A;  3I0S B;  4IRD A;  2ZHA A;  4ZPD A;  3W2V B;  2VQF F;  1KS2 A;  4O4G A;  4D3G A;  3UD5 A;  2V8V A;  2PD1 A;  1VRT A;  2VQE J;  1PAU B;  2DR8 A;  2QE5 A;  2PT0 A;  4MH8 A;  5KFC A;  2JFD A;  2UXC F;  1BUX A;  1S9G B;  3KG0 A;  5GAD U;  3AXK A;  4PCQ A;  2QLF B;  2VHG A;  1G4C A;  5CAA A;  3DLB A;  3H20 A;  4U7C A;  3MR2 A;  5KTQ A;  1K47 A;  4RW7 A;  3UR3 C;  3R8Y A;  1JMT A;  5C7P A;  2EC2 A;  1JLF B;  4YME A;  5HVF A;  2F65 A;  3BQ2 A;  4CT9 A;  1NK8 A;  3MM7 A;  1C0U A;  4PWU A;  1DTT A;  2VBW A;  2HS4 A;  3OXG A;  4B9L A;  4L3N A;  4RR5 A;  1SL2 A;  1QUP A;  2ZM6 J;  1S76 D;  1FES A;  1VRU B;  4KKO B;  2QGF B;  2AYG A;  1FA0 A;  4DS4 A;  3QBC A;  1VJQ A;  3PFO A;  1TMJ A;  1RAE B;  1K1S A;  4USI A;  3RB4 A;  4MYU A;  5HMW A;  1GNK A;  3HF5 A;  4B3M J;  2MKI A;  4E98 A;  3DMJ A;  3G82 B;  3MCN A;  1BLU A;  1WOR A;  2KT3 A;  3AOD A;  1RK8 A;  2J6U A;  1IJE B;  2XNR A;  1NPK A;  1ZM3 A;  2RJZ A;  3DOL A;  5EX3 A;  1CSJ A;  1CJU B;  3A8J A;  1Y3J A;  4DSE A;  1RDR A;  4ECV A;  2FY1 A;  1JNR B;  2LQJ A;  3O6Q A;  2HK3 A;  2DY1 A;  2V2Q A;  1JB0 C;  2M5Y A;  1TEL A;  2CZ4 A;  5KFF A;  1ELO A;  4J9M A;  3AXM A;  3CC4 S;  1WOS A;  4YDX A;  3ZTO A;  3V81 A;  4R5P B;  2R7R A;  2OPR A;  2XSF A;  1BGX T;  4MIB A;  1F0X A;  3KK1 B;  5HBM B;  2KHD A;  3HLU A;  2LA4 A;  2DHS A;  4I64 A;  2DYA A;  1ZBT A;  4RZR A;  1J5O B;  2ZEJ A;  5D78 A;  3RRK A;  4FXD A;  3C6T A;  3W63 A;  4DPW A;  2DR9 A;  5I3Q A;  3S8S A;  3UN3 A;  3CJ2 A;  3CJQ A;  2W9B B;  1GMW A;  5J2N B;  1IWG A;  4LFC J;  2AV5 A;  2YNF B;  5LSR A;  3BH6 B;  4U96 A;  5AXK A;  3I56 S;  4JI0 J;  2QA1 A;  3LPE A;  2Y1J A;  4A8K A;  3RYL A;  1RTH B;  3LGN A;  2RRN A;  5KT4 A;  3M2V A;  1BXN A;  4MFB A;  4RUH A;  4M95 A;  4NI2 A;  1NPR A;  4ECU A;  1EZZ B;  2CQG A;  2LQ5 A;  3MEG B;  2BE2 B;  3A1Y G;  3ZNJ 1;  1FVQ A;  2NSB A;  3M9N B;  1QSS A;  3DI6 A;  4OMF G;  1HNZ F;  4UTG A;  4C8L A;  3EWG A;  4RW6 A;  5F9N A;  2ATC B;  3L09 A;  4LF9 J;  2V63 A;  2VFU A;  2UUT A;  2FVC A;  4NOH A;  2P6T A;  3GWC A;  2MTL A;  1N32 F;  3RAM A;  1WJ9 A;  2JC1 A;  1QVG R;  4JI7 F;  4YUD A;  5L1L A;  4X4T A;  5E0O A;  4LFB J;  1J5E J;  1G3O A;  4URQ U;  3VQT A;  4RWX A;  3RBD A;  3D1Q A;  3OR1 A;  3PR5 B;  3T1H J;  1WI8 A;  1BY9 A;  3S01 A;  2RKI A;  1VQ7 S;  1ZPW X;  3ENQ A;  3IMQ J;  2YWG A;  2QFI A;  3H2L A;  4ED0 A;  1VOM A;  2Y0B B;  1FER A;  3LAM A;  2FLN A;  4LIR A;  2C28 A;  2RIL A;  2DHH A;  4ETZ A;  2W9C A;  4K5R A;  2M3D A;  5B0G A;  3AQP A;  2WHO A;  2A2C A;  4KFB B;  1Y5N B;  1FWP A;  5EUH A;  1S5Z A;  2FLP A;  4BWJ A;  1G7C B;  2GJ2 A;  5EX0 A;  4IH5 A;  5ETK A;  1OS5 A;  1N5T A;  2ZC3 A;  1HW9 A;  2JEI A;  4ZIV A;  3EX7 B;  2HLU A;  2OTJ S;  4FYY B;  2LXF A;  2ROG A;  4OX6 A;  2ZHB A;  2FHK A;  1SQF A;  3EVO A;  2QLB B;  3NGU A;  1Q16 B;  3CCJ S;  3R3T A;  1GX5 A;  3B6B A;  1RBA A;  2W4C A;  4MTP A;  5KAK A;  3R1H A;  4FKX A;  1Q7Y T;  1RWN B;  3HDS A;  4ZN3 A;  4ECS A;  3KLE B;  2VA2 A;  4OI0 A;  3DRP B;  2AU0 A;  3OFG A;  1HI0 P;  5IZH A;  1TV6 B;  2N4C A;  1IQT A;  2E5L J;  2XQC A;  1IR2 A;  2CNN B;  2ZHO A;  1CUL A;  3MXH P;  4RKU C;  5EWE A;  3MAA B;  1X5O A;  4UF4 A;  1T05 A;  2KG0 A;  3K59 A;  3KKF A;  5KT2 A;  5I3U B;  3AOC A;  1FK9 A;  3HKZ D;  3H5Y A;  5HMX A;  2UUA F;  3JTN A;  4DFM A;  1CC8 A;  1SL0 A;  2X1B A;  4FNI A;  4QR1 A;  1YWX A;  4QIG A;  1HWU A;  3NP5 A;  3DGP B;  2XSJ A;  4JI4 F;  3BPS P;  3OHA A;  4C3K A;  3VAH A;  4LFA J;  1SVD A;  4FPI A;  3PX4 A;  2WCX A;  2X7I A;  2BR0 A;  4M5J A;  3EVM A;  5AXN A;  2E9R X;  4I6Y A;  1YBA A;  3LQV A;  2AZ3 A;  3PW2 A;  2GX8 A;  5KT5 A;  2GW8 A;  3GJR B;  3PRV A;  4RJV A;  5T7L B;  1M5O C;  2WVD A;  3MZI A;  1BC6 A;  1NM2 A;  5J2Q B;  1TKX A;  3PX6 A;  1HNX J;  3FSY A;  3TUP A;  1U49 A;  4LSL B;  4LF6 J;  5E2Q A;  3P4U B;  2XI2 A;  4ED5 A;  3EPG A;  3ZZT A;  2VBY A;  2MKH A;  3C3L A;  3B78 A;  4HHU A;  3C16 A;  2YNI A;  1ZOT A;  1H98 A;  1FDB A;  2I5J A;  4DCO B;  1EKS A;  3TI0 A;  2AGQ A;  4OI3 A;  4DQS A;  1IKW A;  1F6T A;  2DJW A;  1HQE B;  3RRG A;  1NZA A;  2CAJ A;  3B8H A;  2BJ1 A;  3PIP Q;  5DG7 A;  5K14 B;  3IA0 A;  3QID A;  4Y2M A;  4ZN1 A;  2FHM A;  5KFI A;  3WX8 A;  2ZE2 B;  4M5M A;  2XO6 A;  4G1Q B;  4U7U K;  5CH7 B;  3PW0 A;  2FZC B;  4HT5 A;  4PWW A;  2I38 A;  2F4F A;  3DCA A;  5AJ3 F;  4ANE A;  5LMN F;  3QGI A;  1N88 A;  1SQE A;  4NXN F;  2CQI A;  4JB8 B;  3O8W A;  1HHS A;  3OTO F;  3CF5 Q;  2CG8 A;  4A48 A;  1S4F A;  1NLK L;  3KK3 A;  2MDA A;  4DU8 A;  4DR4 J;  2KI2 A;  3N6N A;  1UEV A;  5F3Z A;  3J81 j;  1UAW A;  5BR8 F;  3LGM A;  4Y2I A;  1S1T A;  4C6A A;  4QJV A;  2HNZ A;  1N6Q B;  3HHL D;  1UET A;  3PNI A;  1QVF R;  1S49 A;  3FUY A;  1SUQ B;  2DD8 S;  4HHH A;  4ICL B;  1XNR F;  1NEE A;  1REG X;  4NZ7 A;  2QTW A;  3C15 B;  3JQJ A;  4KGX B;  1FWK A;  1NAQ A;  4MMO A;  2LEP A;  1G1X A;  3BN4 A;  2NXU A;  2HIY A;  4FVC A;  5DS7 A;  9RUB A;  2KG1 A;  3EDQ B;  4I6W A;  5JVH Q;  3QRR A;  2UU9 J;  2F40 A;  2ZH6 A;  1KLM B;  5DLF A;  1VS3 A;  1AYE A;  5CZX A;  1KC8 T;  3TAP A;  1VC0 A;  4C48 A;  2R7S A;  4O3O A;  5KT7 A;  2CIM A;  2KHC A;  1XTZ A;  5B0F A;  3UCG A;  4WF9 Q;  1F9F A;  3BSO A;  2OMO A;  4USM A;  4UZC A;  4NLX A;  2GAG C;  1U6F A;  4LF5 F;  2NUU G;  3SSR A;  4OX7 A;  4N5S A;  1IKX B;  1S59 A;  1L3S A;  1QDU B;  2ASD A;  2NR0 A;  4ES1 A;  3M6X A;  1ZS6 A;  2H54 B;  3WQP A;  3E8O A;  4G3I A;  1VHF A;  1FRH A;  1K0V A;  2QFJ A;  2G4B A;  2OD6 A;  3NMR A;  1ZPV A;  1RCX B;  1HWI A;  4Q43 A;  1HFE L;  3GJS B;  4F67 A;  4Y0F A;  2ZC4 A;  3MMC A;  3E01 B;  2B7B B;  2CJK A;  3RTV A;  3T5J A;  5DG8 A;  3POT B;  2HBZ B;  1XMB A;  2AJ4 A;  2FY8 A;  1RWP B;  2Z2Y B;  5LJ5 Y;  4P10 A;  3TW0 A;  5ETS A;  5G4D A;  4L76 A;  4LVN P;  3VAL A;  5IM0 A;  4J9U E;  1GT8 A;  1FD8 A;  1UVJ A;  1CG2 A;  2BZ2 A;  3D6H B;  5F8H A;  4FPR A;  2ABY A;  2HPU A;  2VQF J;  3MEC B;  2ADB A;  5I42 A;  4OJG A;  1RA7 A;  2BEF A;  3ZZY A;  1MW7 A;  1M90 T;  4EBE A;  5DZ6 A;  4DS5 A;  3QYY A;  3HSZ A;  2PE8 A;  4XPC A;  1U1K A;  1LWC A;  1WEZ A;  2DH7 A;  3W1Y C;  3UVJ B;  2M9K A;  3T5K A;  2BOA A;  2K06 A;  2CPD A;  4AE5 A;  2FDN A;  2FZK B;  2XHW A;  4QZV B;  3ICL A;  3TNV A;  5GAD I;  2LDI A;  2ASY A;  2FGC A;  4TQR A;  4PG6 A;  1VIX A;  3KG4 A;  4M5D B;  4ZVQ B;  1YJV A;  4ZP9 A;  1LV5 A;  3MM5 B;  1WC3 A;  2HLT A;  2FD2 A;  2V4J B;  4J7C A;  2GVD B;  4ES3 A;  5IXU A;  3AOA A;  1S7I A;  1F3F A;  3N28 A;  3I5C A;  1YRT A;  1RHJ B;  4BHQ A;  5L8R C;  5FLX Y;  1FTC A;  2NZC A;  2HVH A;  1ITP A;  1SC4 B;  4MYT A;  3DYA A;  1GTE A;  5ETL A;  3BYP A;  3OUY B;  2MLZ A;  2IJN A;  4I7F B;  1F2H A;  4HI2 A;  5K8M A;  3KUG A;  3SBM A;  5F8N A;  4LSN A;  4QWB A;  2OIH A;  1YI2 S;  2KZM A;  2RS2 A;  2QL5 B;  3FFI B;  1F1B B;  2XWX A;  1TKZ A;  2QC3 A;  4TY8 A;  2MEW A;  3BGL A;  2QLX A;  3G8T A;  2DB1 A;  3UW1 A;  1RWV B;  3LF0 A;  3V4I B;  3Q8S B;  5IQ6 A;  3NLC A;  3DDI A;  4NLO A;  4N47 A;  3CCM S;  2X1F A;  1HBM A;  1BQM A;  4OIX A;  3TAM B;  2DO0 A;  3EJM A;  4MKV A;  2M2B A;  1S1X A;  4I2P B;  1FNO A;  1ZAX A;  2RS8 A;  1GFW B;  5ADZ A;  3NAI A;  4NML A;  1AT1 B;  4TNO A;  1P1T A;  3CJK A;  4KH0 B;  1N5Y A;  2QA2 A;  3LP0 A;  2Y1I A;  1ZAV A;  2OPQ A;  4BCA A;  4CLW A;  4YB5 A;  4DUY F;  1H74 A;  5KFR A;  4DPY A;  3G8S A;  3TVK A;  1F5B A;  2ZWO A;  3HD1 A;  2LA6 A;  2P9G A;  1R0A A;  4WU3 A;  2FC9 A;  1TUV A;  3TJ8 A;  4QWA A;  1RAF B;  4PG7 A;  3ITH B;  5J2M A;  4H54 A;  3PXG a;  3IRW P;  3UDL A;  3MD3 A;  4OX9 F;  3V6K A;  2MZT A;  2HVI A;  4USH A;  2N3O A;  3KDO A;  3VAM A;  2PII A;  3ISN D;  5KG0 A;  4L6V 3;  2D3U A;  1HNZ J;  1UFK A;  2CJQ A;  2YWE A;  3DLK B;  1NK6 A;  4DV2 F;  1ZTT A;  2LXU A;  5A8K B;  2N4D A;  4LT6 A;  5FD1 A;  4DUZ F;  5LL6 d;  4CLS A;  3PW5 A;  3BQ0 A;  4ECX A;  4OZL A;  4ED1 A;  5EN1 A;  5U47 A;  1XN9 A;  2KM8 C;  3LPY A;  5LJ3 Y;  3OL8 A;  2B5J A;  2RAQ A;  4LQ9 A;  3C6U A;  1HD1 A;  2KL8 A;  3HHL B;  1T7P A;  3GYX B;  8ATC B;  4NLP A;  4HAC A;  5LXY A;  2E5G A;  2H9Z A;  2IVF B;  1AFI A;  4ED4 A;  4IOB A;  2XCP A;  2E5H A;  1KFD A;  1U47 A;  2B4U A;  2YKN A;  1SCJ B;  2GIQ A;  2IAJ A;  3M8R A;  4F36 A;  2HHX A;  4OV1 A;  4GVB B;  3I31 A;  1MRO B;  2UXB F;  3CVK A;  3R6L B;  3VHQ A;  2NUH A;  4ELT A;  3PR4 A;  3M8P A;  1REV A;  4C11 B;  4LBP A;  2PMZ D;  2MQM A;  5E33 A;  3MPY A;  2KTQ A;  5C42 A;  1SJQ A;  1OPI A;  1NSA A;  1Q0N A;  1DFD A;  1WHW A;  4QPX A;  4F3O A;  4FF3 A;  4OJH A;  4C0H A;  3OVB A;  2YX1 A;  1N48 A;  3CCZ A;  5KFT A;  2H1Y A;  4DHV A;  4A8Y A;  1BQN B;  1B7Y B;  3D3B J;  4UOF A;  1RYS A;  3HFK A;  2OSR A;  4TVA B;  5GME A;  5DDP C;  1X4G A;  5HMZ A;  1FKO B;  4G1P A;  2F4V J;  4P7V A;  4O3Q A;  4A8W A;  4C4W A;  1VJW A;  1YVF A;  3TA2 A;  5E3R A;  2R8K A;  2MMY A;  4IDK B;  1RUS A;  1APS A;  4JI4 J;  3T3F A;  4RU2 A;  1HW8 A;  3A3P B;  3D6F B;  4ZVU B;  3T41 A;  3M8Y A;  3MEE A;  4PZV A;  2XG8 A;  2JLE A;  1K0T A;  4F4W A;  2NYH A;  1HI1 A;  2MQO A;  4JOU A;  4G6V B;  1KTV A;  2DH9 A;  5CYJ A;  1JJH A;  1VQN S;  3NXZ A;  2AF6 A;  3PY8 A;  2DT9 A;  4LRF A;  3CUN A;  4DL3 A;  1SJR A;  4DL6 A;  3K57 A;  3LGH A;  4O44 B;  1SL1 A;  1UZH A;  2HND A;  1KVJ A;  3FMB A;  4ANC A;  3MDF A;  1DAR A;  5HRO A;  2VG7 A;  2BMB A;  4C0B A;  2J7K A;  5ETR A;  2MB0 B;  4OZ5 A;  2IC3 A;  2HFS A;  3SDE B;  2LU2 A;  3FGV A;  1KQS R;  2PMW A;  1H7W A;  4OYP A;  1U1M A;  5GAH I;  2E5I A;  3IWX A;  5J1E B;  2ZNZ A;  3GU0 A;  3V81 B;  5AE2 A;  2ZOM A;  2C22 A;  2R7V A;  2HQD A;  1D9F A;  2ZZM A;  4QYZ K;  1RT5 B;  5AE3 A;  2R8G A;  2F8M A;  1JLC B;  1WC0 A;  2CRL A;  4DV7 F;  2LU1 A;  2UZA A;  3LAN A;  3H59 A;  3PRB A;  1V6H A;  4Y2A A;  3M32 A;  2BQ3 A;  5DJB A;  2LEA A;  1U1L A;  3KUH A;  1HNI B;  4GKK F;  1SC3 B;  5AJ3 J;  2KFZ A;  3ZZU A;  2F8E X;  3SQG B;  1T0T V;  5LMN J;  3JAM Y;  1VC6 A;  5ETV A;  4NXN J;  5HQL A;  5KFN A;  4HVZ A;  2H5I B;  3OTO J;  1VBK A;  4JV0 A;  4JI8 F;  4MIW A;  4RUC A;  1JK9 B;  3N9U C;  5DO2 A;  1WD6 A;  1R8H A;  4C9D A;  4U67 Q;  4OX8 A;  1LOU A;  3FRY A;  2OTL S;  2IIH A;  1GXL A;  4KRW A;  4O0N A;  1YZ7 A;  2KXF A;  2G1D A;  1RIS A;  5BR8 J;  1HWK A;  2BA9 A;  4TN2 A;  5T14 A;  1RWO B;  2W4P A;  2XGP A;  1VQP S;  3QT7 A;  1H2U X;  3DXS X;  3TQ1 A;  4F26 A;  2KFN A;  2YNH A;  4RBT A;  4N8O A;  4UST A;  2VFR A;  4PKD B;  4EU0 A;  3AHP A;  2A2D A;  2GHV C;  1MN9 A;  1U48 A;  1I6J A;  4FF2 A;  4P7T A;  1RU2 A;  4V1A k;  3QMQ A;  3UI3 A;  5D4N A;  4HR2 A;  4P2M A;  5A6W A;  1NUE A;  1U6B A;  4Y28 C;  3RB6 A;  3PO5 A;  5AT1 B;  4I69 A;  2V8D A;  1X31 C;  2VD3 A;  3IR7 B;  1LK7 A;  4GKJ F;  3WC2 A;  4QBU A;  1FX4 A;  2MJU A;  3IBW A;  1IM6 A;  3J7A N;  2EBE A;  4PR6 A;  5L1K A;  3A13 A;  1RWM B;  1U2C A;  4LF5 J;  7FDR A;  2RU3 A;  4ZJL A;  1R6Y A;  3NOG A;  2EPI A;  1UA1 A;  1E6Y A;  3PVX A;  2H65 B;  2C3O A;  1LNQ A;  2AT1 B;  2G9O A;  4RW4 A;  1PC4 A;  2Z2M A;  2PMH A;  1YGY A;  2ZOG A;  3NCP A;  5KFW A;  4YQW A;  1P8G A;  2V8P A;  3FBC A;  2NXJ A;  4QWD A;  1Y3K A;  1TL3 B;  4IRC A;  1CJT A;  3IS9 A;  1XMO F;  2OEJ A;  4IOC Q;  4V19 J;  4TQS A;  3BQ1 A;  2ACY A;  5F3T A;  1UJ4 A;  4J9P A;  4KY3 A;  1X4H A;  3TVZ A;  3PKM A;  1AA1 B;  3K2Y A;  3JSM B;  1ZZF A;  3W65 A;  4ER8 A;  2QJ3 A;  3C19 A;  5HQM A;  2HFN A;  2HHP A;  2KKH A;  4NZ6 A;  4EMD A;  3KTQ A;  1WHV A;  5C2G A;  3IP0 A;  2RML A;  3Q23 A;  3HSD A;  4IO9 Q;  1S10 A;  1RT7 A;  3ILO A;  3DRR A;  3N6L A;  3QFH A;  2EBG A;  3EZO A;  2L48 A;  3TA0 A;  2IMO A;  1EAR A;  1IXK A;  2DXE A;  3CNQ P;  2GGP B;  3I32 A;  2XTJ P;  1VQO S;  1VQ6 S;  3BS9 A;  3SXL A;  1QAJ A;  5KG7 A;  4PPZ A;  2XLI A;  4ZP7 A;  2WON B;  4K4V A;  3X3U A;  3PYD A;  1YX2 A;  2IJR A;  3W9I A;  1NKB A;  4F3Q A;  4DR2 F;  2AD9 A;  1DRZ A;  3W61 A;  4RNF A;  4USK A;  1HBO B;  2AW0 A;  2OEM A;  4M5L A;  4ZDN A;  4DR7 J;  2BW2 A;  3R27 A;  3IRX B;  2AHO B;  5FII A;  2LYV A;  3DC2 A;  3K5L A;  5LMU F;  5E3C A;  2DGU A;  3MOJ B;  2RQC A;  4ZVP B;  1SV5 B;  4JI5 F;  5A8R B;  1H3D A;  4RNM A;  2ZH5 A;  1NKC A;  3SV4 A;  3HX9 A;  2PA8 D;  1Z4U A;  3PEH A;  1KTQ A;  3SSS A;  3K5P A;  5LOQ A;  1N56 A;  3KHL A;  3QNW B;  3W9J A;  2HWH A;  2GO9 A;  2E66 A;  2YQ3 A;  2FHJ D;  2J5A A;  2A10 A;  4RU9 A;  3RZA A;  2P9E A;  2MKJ A;  4XK8 C;  4TLR A;  3FDS A;  2EK6 A;  3SCL E;  5KFJ A;  4HTI A;  1VQ9 S;  4LF8 F;  3DOM A;  2J9D A;  3BM7 A;  1F2G A;  3LWL A;  1X7V A;  2LDY A;  2WOM B;  4YY3 F;  3MI7 X;  2RQM A;  2VFV A;  5LT5 A;  3N6M A;  3ZTP A;  2ZDP A;  3I4P A;  4UT4 A;  4NXM J;  2IYG A;  1HPZ B;  1B0P A;  5EDW A;  3M30 A;  1H38 A;  3M2U A;  3J81 Y;  2RB7 A;  4OYW A;  1NH7 A;  5DGA A;  2LP4 A;  1AFJ A;  2QSF A;  3PG9 A;  2I8E A;  3KNA A;  3DLG A;  4IQX A;  1AUS L;  4G65 A;  2AEF A;  3CW2 C;  4OQJ A;  1UVI A;  2KFY A;  3NWR A;  5HN0 A;  2W01 A;  1LW0 B;  4J9N A;  5D0H A;  3DLE A;  2I0X A;  5A0Y B;  4N7T A;  4LF4 F;  4Q5V A;  2MXY A;  4NRU A;  2MKY A;  1RT4 B;  1WI6 A;  2VZ9 A;  4C8M A;  3M2R B;  2FVP A;  3LAL A;  4JI6 F;  2UVU A;  1MU2 B;  3IBC B;  3QZ7 A;  4KH1 B;  4W92 B;  1PJ5 A;  2M7S A;  3F0N A;  1S1W B;  5CHC B;  4KPY A;  3FZB A;  4FP9 A;  3ULH A;  1RT1 A;  3QSI A;  2YKM B;  3HP6 A;  4F0M A;  2XGQ A;  1RCO B;  3LW5 C;  4DN9 A;  2IBK A;  1MN7 A;  3FSI A;  3KDN A;  4ZJO A;  3T1Y F;  4HDH A;  1NJX A;  3BKT A;  2PI5 A;  1HBU B;  1V9O A;  4DV2 J;  4K4Z A;  4OLO A;  2NCK L;  4WFY A;  4DUZ J;  2GMJ A;  4UUX A;  1EAY C;  1WUU A;  3RG6 A;  4CLL A;  2DIS A;  1NSK L;  3D3C J;  1OSD A;  3ZZP A;  1SJF A;  4U8Y A;  1YG0 A;  1NK9 A;  4DQI A;  1B64 A;  3B54 A;  1U0H A;  3D67 A;  1U26 A;  1UKU A;  3FQK A;  1WG4 A;  5A8W B;  2MQ8 A;  2ZNY A;  4NRT A;  4DQQ A;  3D1O A;  3CCU S;  5IV4 A;  3CCT A;  1SJ4 P;  3V2U C;  1TL7 B;  3ILJ A;  3MPW A;  1S6O A;  4DV0 J;  4EI2 A;  2HHQ A;  4XAK A;  2QZ8 A;  4K8R A;  4X62 F;  4EK2 A;  4OYZ A;  4B9U A;  1CVJ A;  4K0K F;  1H7X A;  2OI2 A;  2MKS A;  3MAH A;  4J9V A;  3MM8 A;  3F56 A;  1KOH A;  1IKV A;  4B08 A;  2ZZN A;  4FYW B;  1S1V B;  3LP2 B;  3S7R A;  4C2M A;  5FJ4 A;  2RQK A;  2ZH8 A;  1SH0 A;  4LMZ A;  1W26 A;  3MOZ A;  2Z57 B;  2FJX A;  2PSZ A;  1YDL A;  3CMQ A;  4LFC F;  2UP1 A;  4KO0 B;  4OZ3 A;  5B0E A;  4PUO B;  3CDA A;  2EKN A;  4PXD A;  1S79 A;  3VZI A;  2VAS A;  2FQQ B;  1CJK A;  1OMS A;  2HRU A;  2B8P A;  3AJ2 A;  4DFJ A;  4DV1 F;  1P9Q C;  2PFD A;  2QMX A;  3NS5 A;  1DQ9 A;  4Z7C A;  2O01 C;  2R7O A;  3T1A A;  3M9M B;  2FHJ A;  1O0P A;  3RW7 A;  2W2P P;  1VBZ A;  2AJF E;  2R4F A;  3KXD A;  1O51 A;  5F8G A;  2R7T A;  2J7W A;  3OL7 A;  3HHD A;  3QO9 A;  3K58 A;  2W1B A;  4LF9 F;  2K1R A;  2QA4 S;  2OP5 A;  2G0I A;  2DNM A;  2VF3 A;  1AW0 A;  4CLZ A;  5KFB A;  4ID5 B;  3BBB A;  3VR1 A;  1HYS B;  2O1P A;  4JV2 A;  5K8P A;  4EGL A;  2HHH F;  1WF0 A;  4IFV B;  3K7R A;  3R5G A;  3QQC D;  1X4D A;  5B0C A;  4B9S A;  1KBR A;  4YEA A;  1DUR A;  3GPA A;  1QY7 A;  3IG1 A;  1D0E A;  2HYI B;  5E41 A;  1IR1 A;  1XER A;  1KQF B;  2R42 A;  3BSC A;  2WSC C;  3JTP A;  2VON A;  4NA2 A;  2DH8 A;  2XNQ A;  3CDE A;  3BGR B;  2JEG A;  1R89 A;  1RWW B;  3BEG B;  1N5Q A;  4PQU B;  2FYX A;  2GFF A;  2V4Q A;  3OTC A;  2ROP A;  3A3O B;  4WE1 B;  3ILL A;  2OML A;  4F4Z A;  2ZJP Q;  4O3R A;  1VIO A;  3ET6 B;  3DM2 A;  4PXB A;  2AKW B;  4LBH A;  1UWB B;  2DRA A;  5IT9 Y;  3H0P A;  1JXV A;  4ZP6 A;  2CQ4 A;  1LXN A;  1HMV A;  4FXV A;  1DLO A;  3R5C A;  1BQM B;  3MPD A;  2DO4 A;  2WVB A;  5DQI A;  3WX4 A;  4F04 B;  3NAH A;  2XS5 A;  1GXU A;  4NCB A;  2OPP A;  4M5N A;  3GP9 A;  4CYU A;  1S97 A;  3OTB A;  1SPB P;  3MFH A;  1W25 A;  1URN A;  4DV7 J;  5I4M A;  2D1C A;  3KLI B;  4B9M A;  2JLG A;  4CNY A;  1RT2 B;  1X4F A;  2HHW A;  1PG5 B;  4R8U B;  4GKK J;  4P72 A;  1S1U A;  2CKW A;  2JZ5 A;  3K0J A;  4X4R A;  2XYH B;  1RTJ A;  5ETT A;  3NCQ A;  2EXU A;  2E5L F;  3ZZR A;  2ZKT A;  2V6A A;  1N0U A;  2N7C A;  3G6V A;  3VAI A;  2RF2 B;  1LK5 A;  3HUL A;  2ZD1 B;  3CC7 S;  1PGZ A;  3NS6 A;  3IFE A;  1A6L A;  2G2Z A;  4IG3 B;  4ED8 A;  4ALZ A;  1FJG F;  1HWL A;  4ZKA A;  2C2Z B;  2ZVI A;  3QSY B;  3C14 B;  2HK2 A;  1DHM A;  4YDD B;  3Q8R B;  3HSJ A;  2CQ1 A;  2V2K A;  1QAI A;  1PYO B;  3ZZZ A;  4AT1 B;  2QSW A;  4ZHR B;  2ALY B;  2FJD B;  3QIP B;  5HP1 B;  5F8L A;  1S72 S;  3M8Q B;  4URS A;  4OZN A;  3CCQ S;  4ZVG A;  2R7U A;  5C24 A;  4LRC A;  3QZ8 A;  2N3L A;  3W5Z A;  3P8B B;  3NRB A;  3G4S S;  2BQR A;  4NCG A;  4TU8 A;  4RNN A;  2B6A A;  2YX4 A;  2JFK A;  2YQ0 A;  3TJA A;  4FDF A;  4O3P A;  4HH1 A;  3MMA A;  4GKJ J;  1URR A;  1WSR A;  1SQG A;  1HHT P;  3RBZ A;  3R5A A;  4ETX A;  1MMD A;  4UOC A;  3OHB A;  1RHM B;  3OBI A;  3CDB A;  1FFG B;  3MED A;  3AFG A;  2E1C A;  2ZFH A;  3AD9 C;  5H9F J;  3UWT A;  1WC4 A;  3QGH A;  3NBP A;  1PYT A;  3I0R A;  3TZX A;  3QPI A;  2GIR A;  2G2Y A;  4FYD A;  3U27 A;  2Q6B A;  2HMI A;  1WTF A;  1IKY A;  2UUC F;  1V3S A;  2DXF A;  4Q0B B;  2HBQ B;  4ED3 A;  4LR7 A;  5E3P A;  2DR6 A;  2AGO A;  3QGG A;  4LIW A;  3TO8 A;  1CJV A;  3HHL C;  2FZG B;  1IBC B;  4J9L A;  3I9V 9;  2CPH A;  3OD2 A;  2W7A A;  4CIO A;  1XMO J;  2KJW A;  2HQI A;  1KHW A;  3MUV P;  1EP4 A;  2GVZ A;  3GE9 A;  2H5E A;  2GJI A;  3IWN C;  2GQC A;  5IOL A;  1C1C A;  3U7J A;  3MM6 A;  1C1B A;  2CQH A;  2YX7 A;  1X9W A;  1HBN B;  4NLT A;  1D9A A;  3OR2 B;  1D09 B;  2C2R A;  3ZNU A;  4U8V A;  1NO8 A;  2ZDO A;  2W4D A;  4J9O A;  1U6Z A;  3I0S A;  2HQG A;  3W2V A;  4QYZ J;  2DNP A;  1Q81 T;  2GC8 A;  4NLR A;  4LRD A;  4A8S A;  3PYF A;  4CH0 S;  4X66 F;  4Q8E A;  1KVK A;  2VDI A;  2EC0 A;  4ZA1 A;  3SEO A;  3BN7 A;  2X3G A;  3D4J A;  4O0I A;  4DFP A;  2QN6 B;  5T41 A;  1UFL A;  1FE4 A;  3ENV A;  2C3M A;  4TKT A;  4CLT A;  4W90 B;  2BVZ A;  3W2W B;  1NZ8 A;  2OKQ A;  4F4A A;  4DR2 J;  2ZWP A;  1M5P C;  4RW8 B;  1JLF A;  3V6H A;  2LXI A;  2CNL B;  2L08 A;  2OEL A;  1B70 B;  1U2R A;  2UU9 F;  3M6W A;  1WDT A;  3CCL S;  1UW9 A;  5HJY A;  4KPC A;  4CRJ A;  1JKH B;  1Y10 A;  5LMU J;  1VRU A;  4KKO A;  1J27 A;  3OJU A;  4KB7 A;  1IR0 A;  2OEK A;  2DNN A;  3D6M B;  3UDE A;  5DDR C;  5CA5 A;  2XI3 A;  5GAE I;  3P5T L;  3U1L A;  5IT0 A;  3T5H A;  1U25 A;  4PWD B;  3G82 A;  3M9O B;  5LM7 E;  4ZCK A;  2FHO B;  5HRO B;  4U7U D;  1RAG B;  4CO1 A;  4DQP A;  1X4B A;  4X4P A;  4FKY A;  2CPE A;  5BXI A;  1CJU A;  2B9X A;  1VQM S;  1S6Q B;  4CNZ A;  2IYI A;  2ZJR Q;  2P5V A;  2PEB A;  3D2W A;  3MCO A;  3SYZ A;  4ZPV R;  3QLH B;  1SB6 A;  3W5Y A;  4LF8 J;  4E8U A;  1SIW B;  4DEZ A;  3NEK A;  4YS2 A;  3MWB A;  4H4O B;  4Z2X A;  3RJM B;  3D68 A;  2VIH A;  2J0X A;  4YB7 A;  1FRL A;  1X9S A;  4IH7 A;  2IRX A;  2GA7 A;  4R5P A;  2WSE C;  2G1H A;  3R5D A;  2V5H G;  2VDH A;  1ZM9 A;  1FD2 A;  3KK1 A;  2MSS A;  5HBM A;  3CB4 A;  4JV1 A;  1S0O A;  2J9C A;  3GV8 B;  2IHR 1;  2EFO A;  1PKU A;  1TUG B;  2AWZ A;  4ECT A;  1J5O A;  4F0K A;  2W7P A;  2L9D A;  1BWV A;  3FCV A;  1QUV A;  4KV8 B;  3KHH A;  1JLB B;  1K9M T;  1Q5Y A;  1JJ2 R;  2VH7 A;  3L95 X;  4LF4 J;  1A9N B;  5M2P A;  2H5J B;  2C2M B;  1Z1Z A;  2J9E A;  4DCP B;  4O3S A;  2D41 A;  2F7V A;  1LWF B;  1U1O A;  1ZAW A;  4I0W A;  4TU7 A;  4PRF A;  1R31 A;  4ZCI A;  2W9B A;  5J2N A;  2B3T B;  5A2Q Y;  4RW9 B;  2HFU A;  4LUB A;  3SV3 A;  2YNF A;  4OJ3 A;  4JI6 J;  1R3N A;  3TYT A;  1HR0 J;  4ILR A;  1HI8 A;  1T95 A;  5KOW A;  1RTH A;  3LUY A;  5IS2 A;  1TR0 A;  2OPS B;  4ILM A;  5HAN A;  2HAI A;  2U2F A;  1EIY B;  3OXL A;  2J6S A;  2KVI A;  3UPF A;  3O44 A;  2H3E B;  3G6X A;  2YNG B;  2DPJ A;  2HGM A;  4F4X A;  3T1Y J;  3MEG A;  3QGP A;  2BE2 A;  2W2M P;  4ECQ A;  3C46 A;  4PPD A;  1XMQ F;  3D54 A;  5KFD A;  2OSQ A;  3ILI A;  4KHP J;  3PHE A;  2OJ3 A;  3EUN A;  3E3X A;  4N76 A;  3BRE A;  2YH1 A;  1IBL F;  2O3D A;  4WKR A;  5H9E K;  4WP3 A;  2DGS A;  4DG1 B;  5HK4 A;  4KGM A;  1X5T A;  1YBT A;  2AYE A;  2WW8 A;  3O5T B;  4I2Q B;  1H6K X;  4ZLN A;  4QPT A;  4Y2C A;  4X64 J;  2HGL A;  1FEE A;  1NB2 A;  3I55 S;  2BYC A;  4CH7 A;  2NZ4 A;  1P1L A;  3KLF B;  3PV8 A;  1T8E A;  2D3O R;  3UO0 A;  3VTI A;  3OFH A;  4KFB A;  5KFZ A;  2CQP A;  1ZA2 B;  4X62 J;  2WVF A;  4EBD A;  1VFJ A;  2ASL A;  3OW2 R;  1OSC A;  1HD0 A;  1IQZ A;  3GIM A;  4K0K J;  1FJE B;  4IR9 A;  2FUG 9;  2P9C A;  5G0R A;  4KT0 C;  4DV6 F;  2O67 A;  2ZBC A;  2F63 A;  2PDA A;  2JLF A;  1PSD A;  4UY8 T;  2CPY A;  3ISN C;  2W9A A;  4F50 A;  4OYM A;  3CCV S;  1RTI B;  4CT8 A;  2DXD A;  2NLW A;  4J9Q A;  5D0E A;  3DKD A;  1RU1 A;  2CFX A;  3FBF A;  4CLU A;  4HHJ A;  1RT3 B;  2W2Q P;  5IWA F;  2DGT A;  1TVR B;  1VQS A;  3KLE A;  1X0F A;  3BKF A;  2AJQ A;  3DRP A;  4WFB Q;  3EIC A;  1TV6 A;  2V34 A;  2W8K A;  3VQS A;  4DV1 J;  4DSK A;  4RBV A;  3OFF A;  5DM6 Q;  3WDO A;  4F2S A;  2KXN B;  5HSP A;  5F41 A;  1FJC A;  2XZW A;  3I5A A;  5ITH A;  3THP A;  3MAA A;  2QIF A;  4NLQ A;  2VPZ B;  5DET A;  5I3U A;  2CQ2 A;  2ADC A;  1RHU B;  5F8M A;  2MQN A;  3SSQ A;  1B0V A;  3UCU P;  1RBL A;  5CYQ B;  1UZD A;  1WDD A;  2CQ0 A;  3RAQ A;  5IQQ A;  3J80 Y;  2NXC A;  4TYA A;  3DGP A;  3BH7 B;  2KRR A;  2EFG A;  1O8B A;  2HHH J;  1UMJ A;  3P49 B;  1SBR A;  4K4S A;  1B3T A;  1GQE A;  3UFC X;  1XR7 A;  2VG6 A;  4BC7 A;  1SIZ A;  5JXS A;  2MGZ B;  3J7Y I;  3R1L A;  3AY0 A;  1W2I A;  4ZJQ A;  2V50 A;  5T7L A;  5HQ8 A;  4CTA B;  3TZY A;  1NU4 A;  2IFX A;  4DN0 A;  4I1T A;  1I5O B;  3RU0 A;  4KGV B;  3K5M A;  2NS1 B;  5CYM B;  1IUJ A;  2YKO A;  4F02 A;  1BWE A;  4BWM A;  4CDI A;  6AT1 B;  1XK8 A;  3TVY A;  1JJC B;  2DCU B;  1N4L A;  3KLG B;  4HL9 A;  2A18 A;  2K2P A;  2O5D A;  5HO4 A;  4EFA C;  1S9F A;  3VWS A;  1Q86 T;  2E5J A;  3PFE A;  5CXT A;  3Q8U A;  1TL1 B;  3O1L A;  3CE8 A;  1JQG A;  2W25 A;  3IR6 B;  3CXC R;  2WAQ D;  4WFZ A;  2BKP A;  4HI1 A;  2J76 E;  5E3A A;  5D6G A;  2ZH2 A;  1HQE A;  3QAT A;  4C8Y A;  4FBU A;  4IR1 A;  2HHS A;  2KT5 A;  2POK A;  5K14 A;  3PJ9 A;  5D4L A;  2OD4 A;  2ZE2 A;  4G1Q A;  1S0N A;  4KC5 A;  3GLJ A;  5B7W A;  3OLB A;  4PG8 A;  2NPF A;  4N77 A;  2I9S A;  3L7O A;  2VJU A;  1L3V A;  5K20 B;  4DX5 A;  3Q89 A;  4WYL A;  2BAN A;  1HQU B;  3RGI A;  1RXO B;  3EM1 A;  1F3V A;  3GCW P;  3K89 A;  4Q2L A;  2P8I A;  4ERD A;  1FNM A;  3FBB A;  5DDO C;  2FB0 A;  1RZM A;  2F4V F;  4QU6 A;  4JP8 A;  5F8I A;  4CZC A;  3MF5 A;  1HL6 A;  3AT1 B;  1FJG J;  4CLP A;  2KRB A;  2VPW B;  5D0G A;  3R6G B;  2BXJ A;  1N6Q A;  1RBO B;  2XCA A;  5KFU A;  4NE9 C;  3DOK B;  3I6P A;  3ONQ A;  1N36 F;  4ICL A;  2HKE A;  1QSY A;  4PXE A;  2WSF C;  3DHW C;  3M4X A;  3C15 A;  3G8Q A;  4DJB A;  2VL1 A;  1FE0 A;  1HNV B;  3V6D B;  1HAR A;  2R2T A;  5KFA A;  5LSO A;  3GIK A;  1C0T B;  1AZS B;  2FLL A;  5FDL B;  5L1J A;  1X0P A;  2VV5 A;  4NLV A;  5EHH A;  1X5S A;  3OTE A;  2PN6 A;  2MZS A;  3HT3 A;  2AZ1 A;  4ITS A;  1RGV A;  2RE1 A;  3MAQ A;  4YP3 A;  4KGZ B;  3VVT A;  5GAH U;  2YKQ A;  3DXB A;  4EWT A;  4ZPB A;  1NB7 A;  3CD6 S;  1U8W A;  2EG2 A;  2LCW A;  3UQS A;  3KK2 B;  4WBF A;  4CO0 A;  3EPI A;  1S6U A;  2B0G A;  1NH8 A;  4A4J A;  3KMQ A;  4HEA 9;  4FN5 A;  1Q1K A;  4AL6 A;  2HNY B;  1ZZN A;  2LEB A;  1EB0 A;  3AA8 A;  3VAJ A;  3GR0 A;  1R8B A;  3KJF B;  3QAU A;  4ZCL A;  5HLF A;  2DIU A;  1IKX A;  1Y5L B;  1JIH A;  2UUC J;  1U2F A;  1OY8 A;  4ZP8 A;  2GML A;  2W2N P;  4QU7 A;  4N41 A;  2MHN A;  2BAC A;  2H51 B;  3KJV B;  1N52 B;  2XB2 D;  4CQ1 A;  1YJ7 A;  3L4B C;  2C2N A;  2BJ7 A;  4QWC A;  3SCJ E;  2R2R A;  3KJN B;  3EGV A;  3E01 A;  2QMU B;  1PAE X;  4EBC A;  3A4T A;  2Y8W A;  3HFV A;  3POT A;  3NGK A;  4OHZ A;  3K5N A;  4W4M A;  2Y8Y A;  4K50 A;  3GTY X;  4GRS A;  4IFY B;  1QD1 A;  3B4D A;  1YZ6 A;  3EXY A;  4AND A;  1JXE A;  3R2D J;  3EDR B;  4ZVR B;  2IRU A;  1U7L A;  4MKA A;  3FBE A;  3TX0 A;  2EW9 A;  1XR5 A;  3MEC A;  4C8N A;  1DTQ B;  1TQL A;  1K1Q A;  3UN5 A;  3SFU A;  1N33 J;  3CJT A;  3I4H X;  4X66 J;  1Q78 A;  1M1G A;  4X2B A;  1MNE A;  3H4B A;  2B9Y A;  5F0W A;  1MML A;  2CJB A;  2J7U A;  2G0J A;  2HBY B;  1DBD A;  5F8J A;  1KLN A;  5KG2 A;  1RAD B;  3MTJ A;  3UVJ A;  4NAS A;  4NLS A;  3N0V A;  4A47 A;  3OT9 A;  1GAO A;  3DNC A;  4PEO A;  2GAH C;  3A3N B;  3PDN A;  2QG9 B;  4AL5 A;  1E6V B;  4WTY A;  4OI2 A;  3NNA A;  1QE1 B;  4M5D A;  3PYG A;  1GK8 A;  1YLX A;  1CLF A;  3MM5 A;  1YJU A;  2V4J A;  1GEH A;  1ROF A;  2GVD A;  5F0U A;  3DRY A;  2G2O A;  2RH3 A;  4Q45 A;  2VG5 B;  3BV8 A;  2IBO A;  1VCT A;  2B56 A;  4X4Q A;  2Q3P A;  4YFU A;  4I7F A;  4P74 A;  3T6B A;  1BHN A;  4L73 A;  5L46 A;  1ULR A;  3PX0 A;  1RAI B;  4OZ1 A;  4Y3C A;  2R7Q A;  1KQG B;  3OSN A;  2BE9 B;  3H25 A;  4DU7 A;  2YBV A;  3V6J A;  1LFW A;  4B17 A;  2HFO A;  4IRK A;  1HWJ A;  2R8J A;  5EWG A;  5HAT A;  4KHM A;  3V4I A;  1R6V A;  5DLG A;  2Z2L A;  2BRL A;  4X4N A;  2B43 A;  1QAX A;  2ZOF A;  4YR3 A;  3AAW B;  4NX9 A;  3HT0 A;  2XMV A;  2V68 A;  5J1N A;  2JL9 A;  3T19 A;  1FHT A;  2RDI A;  1TK8 A;  3TAM A;  3AB4 B;  4U9R A;  3K8W A;  4M5G A;  3OVS A;  3VGS A;  1P6T A;  3T9N A;  4Y00 A;  1T03 B;  4I2P A;  2D69 A;  2X51 A;  4ED7 A;  3AQO A;  4YHH J;  4F8R A;  4H4M B;  3NCR A;  3FQL A;  4IG0 B;  3CGI A;  1FNX H;  1NJY A;  2VC1 A;  2LQB A;  1NK7 A;  2OGU A;  5D3G B;  1R8A A;  3I87 A;  2YWK A;  1K8A T;  2UXD F;  4K4T A;  2E9T A;  1JX4 A;  6FDR A;  1S57 A;  4U95 A;  3HK2 A;  1EJ7 L;  1NCL A;  1LXJ A;  3DU6 A;  4NYP A;  4MAK A;  1UJ6 A;  2ALZ A;  4XDC A;  2LQ8 A;  5ETN A;  4OHX A;  4WII A;  4RWW A;  1K44 A;  2MZR A;  1Z2L A;  3G2X A;  3ZO7 A;  3NL0 A;  4L74 A;  1Q95 G;  2XC9 A;  3NG8 A;  4U6P A;  2ZIT A;  2MY8 A;  4DR7 F;  3KG1 A;  2FLO A;  3ITH A;  2M0G B;  2M52 A;  4YN3 B;  1EQM A;  1S6P B;  2IDE A;  4ZVF A;  2BW7 A;  3BGU A;  5K5M A;  4A46 A;  1SI9 A;  4WYW A;  4IUF A;  4NL5 A;  1Q53 A;  2E1A A;  2HSE B;  4V19 X;  3GYG A;  3M1V B;  3VF0 B;  1TFW A;  3A12 A;  4USJ C;  5IC6 B;  5J2P B;  1RWK B;  4AYB D;  4DR3 F;  2DPI A;  4JV5 F;  1T9X A;  4DPX A;  1QSL A;  4DXL A;  3EMT A;  1XMQ J;  4Q8F A;  2ZZT A;  2KM8 B;  3ELH A;  3MR5 A;  3DLK A;  4CH1 A;  4RNO A;  2DNK A;  2QL7 B;  3T9Z A;  1MSW D;  3IM9 A;  5A8K A;  2VOP A;  2RUS A;  1CPZ A;  1WG1 A;  2BJ9 A;  3KHG A;  1IBL J;  3AB2 B;  7FD1 A;  4OFZ A;  2V0N A;  4P6Q A;  4K4Y A;  4B3R J;  3DRX A;  3Q0A A;  3BF4 A;  2FIU A;  3IR5 B;  2DBB A;  3QT8 A;  4R25 A;  3R7N B;  1PIE A;  4CO4 A;  2Q1L A;  2IM3 A;  5F9L A;  2EI5 A;  3DRS A;  2E7V A;  3FNN A;  3HHL A;  4ZS6 A;  1RT6 B;  2FJE B;  3GIL A;  4NXM F;  2V4R A;  4O3N A;  2YQ1 A;  1RTD B;  1RQ0 A;  4JUZ A;  4ECR A;  3G96 A;  1N8R T;  2JRS A;  1I51 B;  3HVT A;  4HTJ A;  1X8D A;  2A0F B;  1UVN A;  3OSP A;  2NPI A;  4GVB A;  1JLQ B;  1MRO A;  2O66 A;  1FXD A;  1YIJ S;  4QWE A;  4DV6 J;  2CUY A;  1JLA B;  1TL5 A;  2WVE A;  4OHY A;  1PJ7 A;  2XHC A;  2U1A A;  3LP1 B;  2HAF A;  4X4U A;  4X65 F;  2VFT A;  5L9X A;  2DNO A;  3KLH B;  3M6U A;  3CSK A;  4NA1 A;  4XPE A;  3PW4 A;  1NHK L;  1EQ0 A;  4TU9 A;  3D0I E;  4J9S A;  1Q82 T;  3HHN B;  5D77 A;  1FI4 A;  5IWA J;  1BMQ B;  3C8Y A;  1EET B;  2DGQ A;  3AJD A;  1JLG B;  4WWS A;  3I82 A;  5KG5 A;  4UY8 5;  2FVR A;  3ENA A;  2V9K A;  3CC2 S;  2DHA A;  2RUG A;  4K59 A;  1VRQ C;  1BQN A;  4I67 A;  4P9S A;  4J9K A;  2B4V A;  2VPX B;  1WOO A;  3KFW X;  4PG4 A;  2CJX B;  1FKO A;  2HS0 A;  4WFN Q;  5J1P A;  2M88 A;  3JYT B;  4IDK A;  3CJ8 A;  1O5J A;  2CA9 A;  3NGT A;  4ELU A;  3DLL Q;  5GAG U;  1CS4 A;  3GFH A;  3X1L B;  4P71 A;  1FTR A;  1FKP B;  5FLX U;  3DN9 A;  3P45 B;  4E2F B;  2ZUA A;  4DV3 J;  1M1H A;  3ZXW A;  2ZH1 A;  3KUE A;  4BBY A;  1KOO A;  2F8H A;  1S9E B;  2FTR A;  3SI8 A;  4QIW D;  3LTO A;  4R0J A;  4JBC A;  3VAG A;  1V3R A;  5C25 B;  1WHX A;  4O44 A;  2K7K A;  1PBU A;  5CZV A;  3NGD A;  3VGV A;  3TX8 A;  2V69 A;  4J5O A;  4DV0 F;  5M2R A;  1R8C A;  1JLE B;  2RSQ A;  1FT8 A;  1KVI A;  3SDE A;  1OPZ A;  4GO7 X;  5E3Q A;  4B3S F;  1H2V Z;  1LWE B;  3JSR A;  3M7V A;  1UFW A;  3I9Z A;  3ADA C;  5H9E J;  2CJA A;  2JEJ A;  2R9L A;  3CJ4 A;  5J1E A;  2F9J A;  4QQB A;  3G87 A;  1MLA A;  5KFL A;  1NSP A;  4GO5 X;  7AT1 B;  3D6T B;  1RT5 A;  4O4G B;  2VPY B;  4ZCM A;  1JLC A;  1Q4R A;  4DOZ A;  2GMH A;  4ELV A;  1CEZ A;  3BPD A;  1VRT B;  3LA0 A;  4ES2 A;  2PO4 A;  5EWF A;  2V8H A;  3M8W A;  2XY6 A;  1JJ4 A;  3BZQ A;  1D9D A;  1TL4 A;  1HNI A;  2XMW A;  3HVR A;  4L72 B;  9ATC B;  3T6J A;  2Z4P A;  1TAQ A;  3LH2 S;  3SQG A;  2UUB F;  3LO3 A;  1MWZ A;  4RW7 B;  4CLY A;  3PZP A;  3HJV A;  2XUL A;  1WKL A;  4FNH A;  2V67 A;  2EFV A;  3MM7 B;  2RIJ A;  1C0U B;  1DTT B;  2RRB A;  2FJV A;  4IOA Q;  5DQH A;  2VB6 A;  3H42 A;  4QIV A;  2JEF A;  2XS2 A;  2VA3 A;  2MKC A;  1FRX A;  2I2Y A;  2I1R A;  2OO4 A;  2CWX A;  4L75 A;  2MZ1 A;  2MYF A;  2OAU A;  1KHV A;  4HLB A;  1KWM A;  4MJK A;  5HL7 Q;  2C2D A;  3CWJ A;  1N36 J;  3UDV A;  5H9F K;  2EVZ A;  4M5I A;  1SJ1 A;  3JXO A;  2JVR A;  5DG9 A;  3DMJ B;  2UVV A;  2CJY B;  4DX8 H;  1RE1 B;  4XTT A;  2CPF A;  3GON A;  1UVM A;  3DOL B;  2ACM A;  1WEX A;  2BKO A;  1LW2 A;  4ZIT A;  4P2S A;  4RPF A;  2R8I A;  4DR6 F;  2J0W A;  1R0B G;  4WP9 A;  1Y4Z B;  1D1U A;  4JYA J;  2E44 A;  3SMZ A;  1Q8I A;  4ZVH A;  2K7J A;  3Q8Y A;  2RDJ A;  5DQG A;  5KFE A;  2BM0 A;  3W7B A;  2Z56 B;  1VR6 A;  3W3S A;  4AUK A;  4KHR A;  2HQ3 A;  2XO7 A;  5B0B A;  4DPO A;  4DR1 F;  2OH2 A;  3BSN A;  4F3M A;  2OPR B;  3MD1 A;  1RB0 A;  3IC1 A;  4AXI A;  3N4W A;  3DHX A;  2IY5 B;  4ZOS A;  3G86 A;  3TEG A;  4MKY A;  3G6E S;  4PYD A;  1WHY A;  5KFS A;  2B4P A;  4LR8 A;  1NBE B;  2DGO A;  4OYB A;  5G0R B;  1TL3 A;  1U1N A;  4DPU A;  4Q44 A;  3C6T B;  2D74 B;  3JQK A;  4UQG A;  3PKY A;  1RJJ A;  1H73 A;  2IDL A;  2YTC A;  2QLJ B;  2B4O A;  3H7H B;  2OHD A;  4ZVO B;  5LSL A;  1X9M A;  3BGO P;  3D1H A;  3GII A;  3WC0 A;  2HFV A;  2V8G A;  2MQP A;  3JSM A;  3TA1 A;  4AQY F;  1F5A A;  4ZVS B;  3CT9 A;  4DCJ B;  1NJI T;  3R7S B;  2V9W A;  2CG4 A;  5KFK A;  3CED A;  4DV4 J;  3GSD A;  1YJT A;  1Q7L B;  5KFH A;  2Q43 A;  1UCN A;  3GR1 A;  3GQC A;  1YJN S;  1S7H A;  2HZC A;  3M2V B;  1ICE B;  1U1Q A;  1YRU A;  4MFB B;  3J7Z 5;  4RL1 A;  4O4R A;  4NI2 B;  3H40 A;  4LF7 J;  2GGP A;  1S0V A;  4KGK A;  1FFS B;  1OY6 A;  3EE3 A;  2J8A A;  4AD6 A;  3DI6 B;  4NLW A;  2MLX A;  5CCL A;  1I1G A;  5C5J A;  5D8H B;  2WON A;  2XBP A;  1XC9 A;  4DLE A;  4RW6 B;  4OL8 A;  1YSJ A;  1ZA1 B;  1HBO A;  2AGP A;  5A6P A;  4ZPT R;  2ZVS A;  3W64 A;  3IRX A;  1VLY A;  3NWG A;  2VG6 B;  2CQC A;  1MG7 A;  3OR1 B;  4WFA Q;  1C4C A;  3VGU A;  2QYC A;  1KEK A;  4NWB A;  2RKI B;  5AXM A;  3OV7 A;  1VK3 A;  3H2U B;  1SV5 A;  4WXW A;  3FEY B;  2XYG B;  5A8R A;  2J6T A;  2CPZ A;  1WTB A;  3DGV A;  2W9C B;  1RLD A;  2HZA A;  2CXE A;  1N0V C;  2CYY A;  1SJ3 P;  2BX6 A;  2AX1 A;  4CLF A;  1FWL A;  4EYH B;  3M05 A;  4YR2 A;  1FO1 A;  3D0H E;  3M8Z A;  1MWQ A;  3ZFV A;  2AJ1 A;  4IKA A;  2XMJ A;  4GC7 A;  1M5H A;  3UNY A;  3HPO A;  2VIC A;  5IT4 A;  5DRK A;  3MCS A;  4C3L A;  1FXR A;  5CCM A;  1IN0 A;  2HEK A;  3GFZ A;  1UJ5 A;  4ZK7 M;  4ID8 A;  2L3M A;  1KN6 A;  1YBU A;  2GO8 A;  3TUI C;  5HJX A;  3CD0 A;  3GFX A;  1L5U A;  1RHR B;  3W8P A;  2WOM A;  2RNE A;  2ZH3 A;  2YWW A;  2IMW P;  3LAK A;  1F5C A;  1HPZ A;  3OQ2 A;  2XM3 A;  1NHV A;  4CWB A;  3SZ2 A;  3CMA S;  1D8Y A;  2H48 B;  1VQK S;  2BAN B;  3JAM U;  1RP5 A;  4XIU A;  1VYA A;  5JVG Q;  5ETP A;  4AXJ A;  2SXL A;  1CUL B;  2EFP A;  4J37 A;  3TZZ A;  2UXD J;  3HHK A;  3NNC A;  4C8Z A;  2ZH9 A;  1T05 B;  1TTH B;  4A8O A;  4MKB A;  2YWH A;  2QRR A;  5KOX A;  4F2R A;  3BO2 A;  1LW0 A;  1FK9 B;  5A0Y A;  3FEZ A;  5GMD A;  4DF4 A;  3D66 A;  4ECY A;  1F9E B;  2GV1 A;  2WB4 A;  4F25 A;  2VUG A;  5B09 A;  2GQ2 A;  2XSJ B;  1RT4 A;  2C2K B;  3M2R A;  1KON A;  4C8K A;  1B0T A;  1MU2 A;  3F41 A;  1S1W A;  5GAE U;  2KXH A;  2GNK A;  4OZJ A;  4DL7 A;  4QCL A;  4OZ2 A;  2CDQ A;  4K2J A;  4TXS A;  3ZTR A;  3GZ7 A;  1L3K A;  3MUT P;  1B7F A;  2YKM A;  2W7O A;  2KVQ E;  2KH9 A;  1NME B;  4YR0 A;  4DR3 J;  3HI9 A;  3M6V A;  4JV5 J;  1NND A;  3TR5 A;  2QEX S;  4ZVT B;  2HFZ A;  2F1F A;  2NYI A;  1TKX B;  2GJF A;  4FYV B;  1HBU A;  1TKT A;  2X1G A;  1SKS A;  1QTM A;  1PBA A;  3Q8V A;  3DDK A;  1WOP A;  4DV5 J;  2CQD A;  2J0S D;  3GJT B;  2JVO A;  1JXL A;  3P3D A;  3UCZ P;  3EZ5 A;  4M5H A;  1RHQ B;  1BE4 A;  3T5L A;  3C16 B;  3GFY A;  1NRK A;  2YNI B;  1GMV A;  2CPX A;  4IQM A;  2ZH7 A;  5D4P A;  2I5J B;  5HLF B;  2ZBR A;  1IKW B;  3HZE A;  2DEI A;  3B4M A;  3BSA A;  1VI7 A;  5JJB A;  5A8W A;  4ZLJ A;  3L3C A;  3KYL A;  1TMM A;  3H2V E;  3IGV A;  3BO3 A;  2BKN A;  1TL7 A;  1HNW F;  1FKA F;  1GMU A;  2P2C B;  4UOG A;  2QX0 A;  3IM8 A;  3QAE A;  4ED6 A;  5RUB A;  1WG5 A;  1SC1 B;  3K17 A;  3CIZ A;  1M5S A;  1OY9 A;  4D3H A;  2DNZ A;  3KK3 B;  2LVW A;  2C2O B;  3G9C A;  4X65 J;  2FJB B;  4ZPC A;  3O2I A;  5KFX A;  5B08 A;  3FCH A;  4DSL A;  1ZM4 A;  2WZ1 A;  4B3T F;  3GIR A;  4B3O A;  4HT7 A;  4C0O C;  4NYZ A;  1W2B R;  1S1V A;  1RA6 A;  3LP2 A;  2HVE A;  1H72 C;  1S1T B;  3OXF A;  2HNZ B;  4ED2 A;  3E2E A;  3MMB A;  2XZD B;  8AT1 B;  3CJ5 A;  1G2E A;  2EWH A;  4KO0 A;  4PUO A;  1WC1 A;  1BQX A;  2DCL A;  1U4B A;  2UXC J;  2B51 A;  1HR0 F;  1JNZ B;  3RW6 A;  2FPH X;  4FXW A;  1Y5I B;  1X4A A;  1HLW A;  2NXN A;  3CJ0 A;  2F3J A;  4Y65 A;  4LRA A;  3ISZ A;  4KAI A;  3A8I A;  2AJ2 A;  4JI3 F;  2G0C A;  4NA3 A;  1ZYQ A;  2KZZ A;  1LEO A;  1RAA B;  2B9W A;  1RAH B;  3CCW A;  2HRT A;  2YWF A;  4DSI A;  2C2E A;  4KHP F;  1RAB B;  1Q5V A;  4OHV A;  1S77 D;  1SKU B;  4A8Q A;  2E1R A;  4JI2 F;  2DR5 A;  3QT5 A;  5K9F A;  2IVM A;  4LSZ B;  1RKJ A;  4ID5 A;  3HFZ B;  1Y00 A;  2HG4 A;  1HYS A;  3Q8Q B;  1Y0H A;  4IFV A;  4OV6 A;  1DQ8 A;  2RVJ A;  3P6Y C;  1S99 A;  1OWX A;  1YQH A;  3TEH B;  5KFM A;  5GAG I;  2DK2 A;  4I4B A;  5BJR A;  4WXO A;  2ROE A;  5H1S V;  3F73 A;  4OYI A;  3BGR A;  4CM0 A;  4RUA A;  4X64 F;  1AUD A;  3JQM A;  3UNG C;  4PQU A;  2Z0G A;  4JI1 F;  4HYK A;  2W24 A;  3MPU B;  4DL0 C;  4DR5 F;  1VDH A;  4WE1 A;  1WKK A;  1XWL A;  3ET6 A;  2LFV A;  2MJN A;  2Z58 B;  3GV5 B;  3MMC B;  1UWB A;  2M8D B;  2R3V A;  2P6S A;  4IH6 A;  1S4E A;  4B3S J;  5D4O A;  2K3I A;  3H98 A;  2K8G A;  4QYR A;  1QAY A;  2YKP A;  3C2P A;  1M0S A;  2YPZ A;  5IM0 B;  1FVS A;  2AP6 A;  3CCR S;  2D7S A;  2IPO B;  3UN2 A;  2DEJ A;  4NZ0 A;  2JSX A;  3J81 U;  4WK3 A;  5I42 B;  4DL2 A;  3OLA A;  4LRE A;  2Y0S D;  3KLI A;  1LWX A;  1NXI A;  2BJ8 A;  4J9R A;  2XMU A;  3HZG A;  4CLK A;  3V5R A;  1TFY A;  2QV6 A;  1U8S A;  1DZ5 A;  2AQ4 A;  1FF2 A;  1RT2 A;  2FVQ A;  1S0M A;  4F7V A;  4R8U A;  4WJB A;  1LWC B;  5KT3 A;  4J91 A;  2UVW A;  2UUB J;  4MK7 A;  2KT2 A;  4K2X A;  4PYA A;  1RKI A;  2A6M A;  5K8N A;  2RF2 A;  4MIA A;  3JTO A;  3KWM A;  2CZ9 A;  2ZD1 A;  4DL5 A;  2W2O P;  3CTR A;  2GIF A;  5KFP A;  4IG3 A;  1U09 A;  4QIE A;  2XMA A;  3C14 A;  3MEK A;  2N7Y A;  1NSQ A;  2VOO A;  2AIR B;  3J7Y U;  2R2U A;  4ZHR A;  3QIP A;  5HP1 A;  3DYA B;  3M8Q A;  3QJJ A;  4NLD A;  2DHX A;  4N8N A;  4CI0 B;  1D3W A;  2DVI A;  4LSN B;  5BYQ A;  1N32 J;  3MM9 A;  4J90 A;  4DR6 J;  1HHQ A;  2Q6C A;  1F60 B;  3HM9 A;  3AD8 C;  3Q83 A;  1TKZ B;  4JI7 J;  4TY8 B;  6FD1 A;  1Q8B A;  4NYO A;  3MFI A;  2N82 B;  4N56 A;  3CDU A;  1GXT A;  4A8F A;  3K5O A;  4EO8 A;  1SH3 A;  2DNQ A;  4OLP A;  4BLG A;  3K8V A;  2K3K A;  5L38 A;  1HBM B;  1RI7 A;  1R8P A;  3DRS B;  3DDN A;  1P9Y A;  4DR1 J;  2ILY A;  5L39 A;  3ENW A;  1S1X B;  2J8S A;  4MK9 A;  4WIQ A;  3D0G E;  1YIT S;  1U1P A;  1QJH A;  3PTW A;  1YRX A;  2CPI A;  2PA3 A;  1TK5 A;  3N5B A;  3HVT B;  3AA9 A;  3CJR A;  4Q0B A;  2X1A A;  4B9T A;  2HQF A;  2PI4 A;  3JS9 A;  1FCA A;  3CJK B;  1FRK A;  1M5K C;  1M5V C;  1N5Y B;  2KYX A;  4NCA A;  3TWZ A;  3AH6 A;  3LP0 B;  1Z2Z A;  3HD2 A;  3ZZ0 A;  2OPQ B;  2IM0 A;  2HWI A;  1KSP A;  1RAO A;  5HI7 A;  3SIP B;  3IGN A;  1UWA A;  5CAB A;  3QJP A;  1YTY A;  1RWU A;  1R43 A;  2HGN A;  5JUM A;  4AQY J;  3D28 A;  4QW8 A;  3R5J B;  4H4K C;  4Q2M A;  3IAM 9;  5HAO A;  1R0A B;  1NDK A;  2C3U A;  5KG6 A;  1HBN A;  3EZU A;  2FJA B;  4WTO B;  3OR2 A;  2HVD A;  1VIS A;  3E51 A;  2DNH A;  5J2M B;  2VJV A;  2C1E B;  4QR0 A;  2KN4 A;  5I3P A;  1NDL A;  4PXC A;  3MUM P;  5AE1 A;  4G1I A;  2ERR A;  5L1I A;  3THV A;  3CPW R;  4X4S A;  4USV A;  1R0C B;  2GHP A;  2WBM A;  4OYO A;  1B99 A;  2LLZ A;  3TAQ A;  2UUA J;  4ECW A;  3VAK A;  3SCI E;  1KNZ A;  3W2W A;  5KG1 A;  1LFP A;  4RW8 A;  4NLU A;  2YY3 A;  1CS4 B;  4OYA A;  2FGO A;  2DIT A;  4EYI B;  2H4W B;  1VGY A;  4DZ6 A;  2AX0 A;  1JKH A;  4FF1 A;  1LQ9 A;  2B5J B;  1PO6 A;  4CP5 A;  3C6U B;  2F9D A;  1T9V A;  1YJR A;  4I68 A;  4QIF A;  2A3J A;  3RRH A;  3DFE A;  4A8M P;  2R7W A;  3GIJ A;  3FKB A;  3KMS A;  4HAC B;  3GYN A;  4PWD A;  2WVC A;  4P2X A;  4UZB A;  4CM2 A;  2YKN B;  4ZLL A;  2IAJ B;  5IT9 U;  3F44 A;  3RBE A;  1YK9 A;  3AOB A;  3TUZ C;  2HUR A;  1FDD A;  3W8G A;  1I3O B;  1FDA A;  2RT3 A;  2IA0 A;  2D9O A;  5KT6 A;  3M8P B;  1REV B;  1S6Q A;  4Y34 A;  3S1T A;  1T3N A;  3UR0 A;  2R2S A;  1TZ0 A;  1OIA A;  1T9U A;  5C42 B;  5KFQ A;  1V3Z A;  1UEU A;  3EXC X;  1MMN A;  3QLH A;  3Q2S C;  3P5B P;  5ETM A;  4ZPA A;  4B02 A;  1BD6 A;  1U1R A;  3BDP A;  4IYQ A;  4W98 A;  3ZTQ A;  1U24 A;  4UOH A;  3AD7 C;  3H4D A;  4H4O A;  1FX2 A;  5E5N A;  2CPJ A;  4ENO A;  1AXQ A;  3H5U A;  2FJW A;  3HSG A;  1KKH A;  2QO3 A;  1SKR A;  5KFO A;  4KIA A;  3NS7 B;  3U1M A;  4P75 A;  2LQ9 A;  3W9H A;  3R2C J;  2AYM A;  3DLH A;  3PEJ A;  1C2P A;  1N33 F;  2Z8Q A;  1IBK F;  4TYB A;  4X4V A;  3HVW A;  4BC9 A;  1D8Z A;  1RYR A;  2OFH X;  1SKW A;  4KV8 A;  1JLB A;  4C98 A;  2CNK B;  2DNY A;  1CQM A;  2PGC A;  3CME S;  1S9G A;  4ILL A;  2XLJ A;  5MAO A;  4BDP A;  2QLW A;  1LWF A;  3WIV A;  4NEZ A;  5ETQ A;  5DDQ C;  4DX6 A;  4RW9 A;  1YHQ S;  3MEE B;  1VQY A;  2IVY A;  1XNR J;  2DRD A;  3ZTS A;  1UVK A;  2YPY A;  2LMI A;  2WW4 A;  1RWX B;  4DL4 A;  2OPS A;  5ETO A;  2EFQ A;  4LBI A;  4FF4 A;  2BRK A;  2VU5 A;  1OO0 B;  4C3M A;  1YJW S;  1LW2 B;  4M1K A;  2VC0 A;  2YNG A;  1NHU A;  1W7W A;  3FC9 A;  2HWT A;  1O6X A;  3MGJ A;  2HND B;  4NPO A;  3PIO Q;  3IWL A;  2VG7 B;  3LOU A;  3TOQ A;  1UPM B;  1V5V A;  2IC3 B;  1VBX A;  1KDN A;  4DI6 A;  3FRZ A;  2ZJQ Q;  2IM2 A;  3L9Z A;  3S6E A;  3RAX A;  3R97 A;  3CCE S;  4DG1 A;  2Y1R I;  2IJF A;  3PYE A;  4DLG A;  4I2Q A;  3GSI A;  2CVI A;  3P96 A;  4M63 A;  2CQ3 A;  3R5B A;  4WU2 A;  2DTJ A;  3B82 A;  4DSJ A;  4KE5 A;  2RDD A;  3Q8P B;  3TZW A;  3Q24 A;  4NMX A;  3FCW A;  1NDP A;  1RSC A;  3M32 B;  3N79 A;  1HNW J;  3KLF A;  3OVA A;  1NJW A;  3H5S A;  4YHH F;  5BYR A;  4PQA A;  2WBR A;  3KOA A;  5IFM A;  2NSC A;  3NY0 A;  3WBZ A;  4KSE B;  2DIV A;  4YB6 A;  2JOQ A;  2WTF A;  1JWW A;  2B8Q A;  1PC5 A;  2ZBQ A;  3PJX A;  2QMW A;  4DDF A;  3SQO P;  5IC4 B;  2HQC A;  3FMW A;  1TKD A;  5SZT A;  4KYZ A;  2MLY A;  2ILZ A;  1I94 F;  4B3T J;  2FVS A;  4KBI A;  3PW7 A;  4C97 A;  1MWY A;  3DU5 A;  3BR9 A;  3BGF A;  1RTI A;  3ETM A;  4DQR A;  3SCK E;  3CCS S;  2CQB A;  1XNQ F;  4M8L A;  2YNH B;  1RT3 A;  1XJW B;  1TVR A;  4TY9 A;  5HVH A;  1PYS B;  1UL3 A;  3EVW A;  3WZ0 A;  4ECZ A;  5LXR A;  4WCE Q;  3CO0 P;  1R27 B;  1N34 F;  3TQE A;  1UW4 A;  2BJE A;  2KDO A;  1WF2 A;  2JHE A;  2HRY A;  4JI3 J;  1CBK A;  2EEY A;  2ZUG A;  1T3O A;  3TAN A;  2DHG A;  4Q7A A;  1YJ9 S;  3BB5 A;  3RUB L;  2DNG A;  3IAS 9;  8RUC A;  4ZMM A;  3MR3 A;  2L9N A;  4MT1 A;  1X60 A;  3VCD A;  2Y1L B;  1YKW A;  3D7S B;  2A6O A;  4DFK A;  3FK4 A;  2KO1 A;  5CYQ A;  4JI2 J;  1TU0 B;  3GG1 A;  4OZ0 A;  2DGV A;  2BJ3 A;  3MR7 A;  1XBW A;  1TUW A;  2AMC B;  4B3R F;  2EFN A;  3OJS A;  2LKZ A;  4DBQ A;  3EYZ A;  1E6Y B;  3JSY A;  4LVO P;  3W60 A;  2W8L A;  1VHI A;  1QTN B;  4RW4 B;  4DMZ A;  1X4C A;  3EGZ A;  2MGZ A;  1IJF B;  4DX7 A;  1IBM F;  3RR7 A;  4P52 A;  3FZ2 A;  4LR9 A;  4JI1 J;  3H8Y A;  4CTA A;  2HW3 A;  3Q2T C;  4DR5 J;  3KJQ B;  1CJT B;  4WZM A;  3MCM A;  3IS9 B;  2DGW A;  5THW A;  5CYM A;  4DPT A;  1K73 T;  2XMM A;  1FRI A;  1ZTW A;  2YXL A;  1Y9O A;  3BR8 A;  3KLG A;  2MQQ A;  1ZM2 A;  2RQ4 A;  2RHQ B;  4CO5 A;  1TL1 A;  4OI6 A;  5L9N A;  3W62 A;  2NRE A;  2D3Z A;  2Z30 B;  1DY3 A;  1FJ7 A;  3Q86 A;  3BDE A;  1RT7 B;  2J9D E;  1UVL A;  1WSV A;  3DRR B;  2XY7 A;  3US5 A;  1RHK B;  5B0A A;  4WK1 A;  3BBC A;  2OFG X;  2BV3 A;  2AJ0 A;  1Q8L A;  2Y3Y A;  2V94 A;  4WP8 A;  1XR6 A;  2VQE F;  1IM4 A;  2YVS A;  4A8X A;  2H4Y B;  5B0D A;  4ZLP A;  5IV3 A;  3RBX A;  2F5G A;  3CD5 A;  2YKA A;  4DUY J;  1GH8 A;  1HQU A;  4RUB A;  2BQU A;  2AYB A;  3VVU A;  4NEY A;  3VV2 B;  2JH3 A;  3I96 A;  5A2Q U;  3UD4 P;  1N5V A;  2AEJ A;  3GCX P;  4GMK A;  3HJF A;  2Q79 A;  4NLY A;  2ZM6 F;  2MKK A;  1N54 B;  3GMG A;  2MST A;  4IO1 A;  1WEY A;  5DGB A;  3FJ2 A;  3R9L A;  3EGW B;  2CDR B;  1IVZ A;  1A0O B;  4K4U A;  1WC6 A;  4OX9 J;  4RO0 A;  1TP7 A;  5D15 A;  4FS2 A;  2BJD A; 
#chains in the Genus database with same CATH homology
 2G0I A;  2G0J A;  4PEO A;  2IDL A;  1S12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...