1S12A

Crystal structure of tm1457
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
MIKVTVTNSFFEVTGHAPDKTLCASVSLLTQHVANFLKAEKKAKIKKESGYLKVKFEELENCEVKVLAAMVRSLKELEQKFPSQIRVEVIDNGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein TM1457
publication title Crystal structure of TM1457 from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 30
structure length 94
sequence length 94
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04327 Peptidase_Prp Cysteine protease Prp
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1490 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Cysteine protease Prp 1s12A00
2G0JA 2G0IA 2IDLA 4PEOA 1S12A
chains in the Genus database with same CATH superfamily
3AJDA 4DR1F 3B54A 2A6OA 4DPXA 3AD7C 3DYAB 2HBYB 5AE2A 5I4MA 1BE4A 4BC7A 1OY9A 3HP6A 1XNQJ 2LQ9A 4QIVA 2OSRA 1VQMS 1SQGA 3DOLB 4ZCLA 3NEKA 5KFOA 5CXTA 4ZVPB 4DPWA 1HKAA 4U9RA 2VIHA 1S57A 3OTCA 4HTIA 4PQAA 1NKEA 4HLBA 1VOMA 3FCHA 1IBLF 5FLXU 2B6AA 3NGUA 2ZZTA 4B9SA 4KRWA 4QIWD 2CPXA 3UDVA 4RWWA 3GMGA 5DLFA 2HRYA 2RDIA 3JS9A 3QGPA 4TVAB 4C8OA 2BE2A 1JNRB 3D0IE 3N4WA 1WNEA 1N34F 3RR8A 2YNGB 1JLEB 2V2ZA 1KOHA 2ZUGA 4C4WA 1WSRA 5K8PA 3L4BC 2LMIA 4MKVA 5D0GA 4CDIA 4WFNQ 1RHKB 2R7WA 1RT5A 1X4AA 4I7FA 4NPOA 5E5NA 4JI2J 1C1BB 5HLFA 2VC1A 3HSZA 3Q86A 5JXSA 4QIFA 3I5CA 3QZ8A 2HHVA 3NBPA 4W98A 4JI0J 1NDKA 3TOQA 4X66F 4U67Q 3HJVA 3IAS9 3CCJS 1RTJA 3BKTA 5CYJA 2AF6A 2VKRA 3BR8A 1UFLA 1NJYA 5ETPA 1B0PA 1F9EB 2C2MB 3RJMB 5KT6A 3OQ2A 1BUXA 3KYLA 2MXYA 4CH7A 1A0OB 3GWCA 1FXDA 5AE3A 5KT2A 1K0TA 3KNAA 2FLLA 3G6VA 3MM5A 1Q86T 4GVLA 1U2CA 1VLYA 3OLBA 1X5SA 4Q0BB 4DBQA 4G65A 2DEIA 2HHSA 1G1XA 1R43A 3HVTB 4NLTA 3GJQB 4J7CA 1IQTA 1H38A 2CPIA 5H9FK 4U8VA 2Y0BB 1FESA 4ED6A 3OSPA 1B0TA 3CJ8A 3K59A 4ZA1A 4KGXB 5E3QA 2C3OA 2CPJA 2P9CA 3J7YU 4Y2KA 4DV6J 1RTDB 1RU1A 2K3KA 3BBBA 1RADB 1IKYA 4ANDA 3R6LB 4I2PB 3FJ2A 1RT2A 3IR5B 4K4YA 4P2SA 5KFXA 3FZBA 4GO7X 3PXGa 4ECWA 3AODA 4ZP8A 5KT3A 2ZD1B 3SCJE 4LF7F 1W25A 3KXDA 4FVCA 1OO0B 1WDTA 3CD5A 4LFAF 2HW3A 5D8HB 3DN9A 1SJRA 4B9TA 2D3OR 1HBOB 3V6DA 2LEAA 3M6XA 4H4KC 1J5OB 2EKNA 3CJKB 3M8YA 2D7SA 1Z2ZA 2QO3A 1AT1B 1UPMB 5JUMA 5H9EK 4EEYA 3I9V9 4HL9A 2H54B 4ZHRA 4RUBA 4MT1A 1DARA 1U24A 2MKYA 2N3OA 3O2IA 2PEBA 1YJ7A 1AROP 4AE5A 5DQGA 2VQFF 3POTA 4JI4J 3AT1B 1T11A 1F5CA 4ZVEA 5HAOA 1S10A 2GQCA 1RDRA 4NXMJ 3IBFB 1JLQA 1YIJS 1LKZA 1KKHA 3QRPA 1HNZF 2PFFB 4C8LA 1RWMB 4ZOSA 3G4SS 3EPGA 3KLGB 3Q22A 4I6WA 5HMZA 4NLRA 4DR2J 1H72C 3JXOA 3CJ3A 3F44A 4KY3A 1SKRA 1JKHA 5G0RB 2D41A 2BACA 4DQQA 2R42A 2RILA 4KO0B 2B43A 4O3QA 1M5OC 4A8WA 3Q2SC 2MQNA 4NA3A 1NDCA 3A3NB 1ZPWX 1JLFB 1NEEA 1U09A 2DKOB 5J2NB 3DU6A 2XI3A 5F8LA 5CAAA 1FEHA 5F41A 1U2RA 3D3CJ 1SI9A 4HH0A 1HD0A 4DMZA 1B99A 3DRSB 2VD3A 4DV5J 2XZWA 1MROA 2RH3A 1YRUA 3QRRA 2XSJB 3LP0A 2AMCB 3Q8UA 2BOAA 2EXUA 2BUNA 4DV4F 1HQ2A 1QAIA 1T9UA 2P9EA 3CMES 3RTVA 1U1QA 2ZJRQ 2DD8S 3MM9B 5EX3A 3MECB 1T03B 3G6XA 1FDDA 4PG4A 4FYDA 1IR1A 2HVZA 1J5OA 4KR0B 1BWVA 1RTIB 1DJ0A 2RUSA 2V50A 3P4UB 2HVIA 3MHYA 2AJ1A 4ENOA 2NXNA 4N8NA 1N54B 4MIWA 4PPDA 2HBZB 2WVDA 3JSYA 5GADU 4DSIA 3MD1A 4FYVB 5CZVA 4F8RA 4RW6B 1APSA 3CCMS 1N5YA 4CO5A 3CJQA 1UZHA 1RA6A 3MR5A 2Q6CA 3M2UA 2WHOA 2F8HA 2IY5B 1KHWA 4I4BA 3IRXA 4P7TA 3BGRB 4QWDA 2V8DA 3CCLS 4AQYF 3TZYA 2I5JB 3ILJA 2FHJD 2HK3A 2FJEB 1JLGA 4L76A 4FBTA 3QJLA 2HHWA 2XB2D 3VF0B 2XI2A 5IT4A 2JEFA 3W9JA 4FS2A 5HK4A 2IAJA 2GQ2A 2DNOA 2UVRA 4IO9Q 1QE1A 1SV5B 1JLAA 1FTCA 3G82B 2B9XA 2V4JB 1VQ8S 2LYVA 4FBUA 3EZUA 3H5YA 3T1AA 3OTOF 2HVDA 2WTFA 2X1FA 1WF2A 5ETMA 2L9NA 2DGSA 1RJJA 2Z8QA 2V5HG 1S77D 2BJ8A 3K0JA 3CIMA 2YH0A 3OFEA 1Y5IB 5EHHA 3TUZC 2XCAA 1CQNA 5FDLB 4MKYA 4ED2A 2ZE2A 2AYBA 4CTAA 4YB7A 2WSCC 2MZTA 1I5OB 3C16A 3I82A 5CA5A 4O4RA 5M2PA 1YJWS 5L46A 2CVIA 3N6LA 5DRKA 1KVIA 1I51B 4K4VA 2IJFA 3HHDA 2L41A 3OFGA 4WYLA 4AL6A 5HSPA 5KFAA 2Z30B 5CYMA 4DFKA 3AQPA 2MQ8A 5KFFA 2JC1A 3V4IA 1H74A 1KR4A 1NRKA 1XMQF 1X4CA 3DKDA 4WKRA 3TVZA 2VBXA 3UDEA 1X4HA 2OD4A 2OHDA 4OI0A 3CTRA 2CQHA 2RQKA 1UFKA 4L6V3 4DUTA 2F65A 2L9WA 4JYAJ 3J80U 3D0HE 1R7IA 1M1GA 3I6PA 4IQMA 1RHRB 1KRPA 2JSXA 2OAUA 3NG8A 2MTLA 5I3QA 3P96A 2HMIB 2KTQA 1RE1B 2RIJA 4MKBA 1HMVA 3LPYA 2W7OA 1TK5A 3JSMA 4OZJA 3QLHA 1YTYA 2MMYA 4Y2CA 5HVFA 1TL3B 3ITHA 5SZTA 4LR9A 3R2DJ 4UUWA 4I6AA 1VBYA 3MEGB 4ZVFA 4NCBA 2KRRA 4OHZA 3HZGA 5IS2A 3FBCA 4DUYJ 2DXEA 1N56A 5L9XA 2FHOB 1PSDA 3BGRA 4DL5A 3QT7A 4JI6F 1FEEA 4A8QA 1SIWB 4NRUA 5EWEA 1B3TA 4KC5A 1P9YA 2FC9A 5HP1A 1TK8A 2GJIA 1C4CA 3PW2A 1LWCA 4WP3A 4NE9C 2V6AA 2MLYA 1IVZA 2FDNA 2R7OA 4DI6A 5HBMB 1X5TA 3CMQA 2NUHA 2FZCB 2C2NA 3CT9A 3M6UA 3C14A 4ZVRB 4NCGA 2GVDA 3CCTA 4OZLA 2WVEA 5CH7B 4J9VA 2RQMA 3Q8QB 5E41A 4N7TA 4OYIA 4LF2A 4Y65A 3NOCA 2M7SA 2E5IA 5KFKA 3U7JA 5ETNA 2RU9A 5A6PA 1IQZA 1G4CA 1UKUA 2NSCA 5HJXA 2F4VF 1BXNA 4H4OB 2PDAA 1FWLA 2UUAF 3OTEA 1S1UA 4QJVA 2WVBA 2F4FA 3EGWB 4WFAQ 2DPJA 2R7RA 4WCEQ 1VJQA 2CJYB 2M70A 2R2UA 4WYWA 3TX0A 2ASYA 4IH7A 1MN9A 2OPQB 4U7CA 2ZZMA 2V8VA 5I3PA 1BMQB 3PO5A 4RW4A 1ZM2A 2KG0A 4DV0J 3QSYB 2OJ3A 3QT6A 4WU2A 2JOQA 3M32A 4CWBA 3BH6B 4ZIVA 2BA9A 2AZ1A 2KH9A 3D5MA 1L3SA 2VASA 1RP5A 2KHDA 2Q79A 1X4GA 2B51A 3JSBA 1X31C 2KI2A 3H40A 2RRAA 3K89A 3IGVA 2ZNZA 2Y3YA 4QIGA 2D3UA 3C15B 3VAGA 4P71A 3R1LA 3UNGC 1PKUA 3IP0A 1CQMA 3M8PA 1FF2A 4J9RA 2H5EA 1TL5A 2DPIA 1UEUA 5CYQB 3U1MA 4C0OC 3BQ2A 4QPTA 4QPXA 2ZBQA 4PG5A 1D0EA 2HGLA 2XLIA 1CG2A 2YKAA 1YLXA 5IV3A 4YR2A 2OTLS 4FF1A 4JI7F 1Q7YT 2FJWA 2Y9HA 5I42A 3PYDA 1BY9A 2B9YA 4P72A 1SB6A 2VBYA 3WC2A 3M8WA 1HIYA 1N5SA 3FEYB 4U7UD 3M05A 3Q89A 2PI4A 3V2UC 3IG1B 2FJXA 3H20A 2UUCF 2EG1A 4ZPWR 4K4ZA 3KLVA 2XYHB 4UTGA 1JB0C 3B78A 4RBUA 1FXRA 1PAEX 1MWQA 2F1FA 2B7BB 4JI5J 4B9MA 2K7JA 1B4SA 3R5AA 1RACB 1RAAB 5KFVA 4K0KJ 1S99A 4ECVA 1FE4A 1C4AA 2IBKA 4Q8EA 2ABYA 1L3VA 3T1YJ 2VOPA 1IBKF 5AJ3J 2DHSA 2E29A 5T7LB 3OXFA 1LV5A 4FXDA 1BLUA 2ROEA 5DM6Q 2XULA 2WVCA 2E5LF 1KLNA 3IS9B 3OPKA 1SUQB 4M5DA 2RHQB 3SFGA 3KK2A 5LOQA 1D8YA 2RD5C 3R5GA 3BEGB 3F41A 5D4OA 4NYOA 2EG2A 4J37A 2HHHJ 2UXDF 1UJ6A 2R8HA 4YDDB 2CWXA 1T8EA 1I3OB 3UN2A 3T3FA 4LREA 4EZ9A 5IT9Y 4UUXA 5U47A 4B9VA 4B9NA 4DV7F 3ZXWA 3CIZA 4OI2A 4OQJA 3D1QA 4QWBA 3HSJA 4JV5J 3KLHB 1XK8A 1M5PC 4KBIA 5AXLA 4IO1A 5J2QB 3GILA 4CCHA 4ZLJA 4W4MA 2IM3A 2Q66A 1SPBP 4EFAC 3G6ES 3DLBA 1VS3A 1SIZA 2BRLA 4DR3F 4EO6A 3N6NA 1KQGB 2VG7A 3GV7B 4I68A 1ZAVA 2GZOA 2CQ4A 3ISNC 4HR2A 1S1VB 1WHWA 1A9NB 5E7OB 2HLUA 1YKWA 2VV5A 5F8HA 1FX4A 1Y0HA 2B5JB 2MKIA 4HI1A 3L7OA 2HS3A 2VKZG 4TU7A 4JV0A 3PJXA 3MXHP 3RBZA 3UPFA 1LK7A 5A0YB 1VRUB 3GFZA 3DMJA 3H42A 2IRYA 3ISZA 4DG1A 2DGQA 2UUWA 2L3MA 4YY3F 4DV1J 4H4MB 2F8MA 2W2MP 2YKMB 5ADZA 3WIUA 3GU0A 3NY0A 1RLCL 3KLIB 1PYTA 4OHXA 1GNKA 3M2VB 1DHMA 3PX0A 1MU2B 5J1PA 3R97A 1VYAA 4A8FA 2HYIB 1XNRF 1PG5B 4F7VA 3K17A 4KV8B 4ZCKA 5F9LA 3A8EA 4KT0C 2NUUG 1XC9A 5T7LA 2WSEC 2RHSB 2ZBPA 2HFSA 3NRBA 1RTZA 3ZTRA 4TNOA 2HNZB 3LGNA 1S72S 1P9QC 1VQLS 2HHQA 2CXEA 2OFGX 3VGSA 1K44A 2LU1A 3DLHA 4DS4A 5I3UB 1RGVA 3K5LA 2QIFA 3BBFA 2QN6B 2J0WA 3GYNA 2N82B 2KO1A 4NLXA 4XK8C 1B7YB 3T9ZA 2IVFB 1VIOA 1VQYA 3QIPA 5AT1B 2MZ1A 4UT4A 5K9FA 1QAXA 1B7FA 4DV2F 2XMVA 4L75A 2RKIA 4DR1J 1F6TA 3HHEA 4IKAA 1FERA 4WXWA 3PNIA 3J7YI 1X8DA 2QMXA 3K8VA 1RHUB 3KK3B 4ES2A 4GC6A 2BJ1A 4ED1A 1LWXA 2YNHA 3M8QA 3M9OB 2XBPA 4HYKA 3TZZA 3EX7B 4OYXA 4O3NA 5KG5A 3KKFA 4WK3A 5A2QU 1VQKS 3D4JA 3VVUA 1J5EJ 1SJ1A 3S1TA 2ZOMA 2MHEA 1IN0A 2UXBF 4M5NA 1HQUB 3JTNA 2IYGA 2VQEF 3FBBA 9ATCB 3ZZPA 1Y3KA 5C25B 2CDQA 2RT3A 1HYSB 2UV8G 1TV6B 3DNCA 1RK8A 2RQ4A 2BQ3A 1N34J 3LANA 2CADA 2RVJA 1FO1A 4HHUA 1RT1A 3B4MA 4M5JA 2E9TA 3LWMA 4L74A 4DR6F 3M6WA 2KXHA 1NJZA 1HW9A 3UR3C 5HROA 1IM6A 1N0UA 1VI7A 4TU9A 2WW4A 3SSSA 3MPDA 1EETA 3GCWP 1RT6A 3AJ2A 2C3YA 2GHWA 4X66J 4TY8A 4K4SA 2JLGA 2RDJA 3V6KA 1C0TA 3TARA 1XR5A 4QU6A 3NGTA 1RT4A 3PJ9A 1LXNA 3D6MB 3QAUA 1FNXH 1HWKA 3LH2S 5THWA 3CDAA 6FD1A 3BGFA 2GFFA 3ENWA 1SKWA 2W9BB 2H9ZA 3KHLA 4GKKJ 1LEOA 1WJ9A 2W7PA 1NK4A 2JWNA 2V2VA 4J9NA 1J2VA 1IUJA 4EU0A 2G13A 2OKQA 3DLGB 4UOGA 5D4LA 1U2FA 3FNNA 4ES3A 1VHIA 1U7LA 1RHMB 1BQXA 2UVWA 3W65A 5T14A 4OZ3A 2FLNA 4J9SA 2J8AA 1IKXB 1WD6A 4M5MA 3NS7B 1Q81T 1JXVA 1TTHB 2HSEB 3FCVA 1HWJA 5KFHA 4L3KA 2IM1A 2DNQA 3NMRA 1CJUB 2HHXA 3PY8A 3CUNA 3EE3A 2UUBF 3EVMA 3OJSA 4MFBB 2HK2A 1AXQA 4ZVUB 2JZ5A 3PEJA 3GJRB 4XTTA 3THVA 1ZETA 3EZOA 4CYUA 4LF7J 2G2YA 3GIIA 2ZEJA 2FY1A 4LFAJ 1YX2A 2CPEA 1FKOA 1KWMA 2E7WA 3SMZA 2J6TA 2CJAA 3CC2S 4GC7A 3P45B 3QMQA 4LSLB 1LFWA 1HHTP 2ADCA 2XWXA 1A7GE 1H2VZ 3OR1B 3HFKA 2E66A 3SBMA 3T1HF 4HEA9 5GVQA 3QPIA 1EAYC 4WE1A 1I94F 4B9UA 1HYSA 1XR6A 3UVJA 4DQIA 2BOPA 3CPWR 1RWPB 4LFBJ 1N5VA 2BZ2A 1QAYA 4EZ6A 3JQMA 2W01A 1MW7A 2Z4PA 3HHLA 3TEHB 4YHHF 2HQDA 2WW8A 2QC3A 2CQBA 2HS0A 5GADI 2CQGA 4IG3A 5FLXY 2V67A 4HACB 1WACA 2YNFB 3MMBA 1ZBTA 2J9CA 3M1VA 4N76A 4A48A 3T19A 3TAQA 2CPFA 1RTHB 2P2CB 2VFSA 1HNZJ 1S6PB 4ZP9A 2BANB 3AA8A 4EBEA 2N4DA 3KFWX 3LP2B 1KS2A 3EVWA 5DM7Q 4P73A 1C0UA 4XDDA 2APOA 4JP8A 1DQAA 5C5JA 4IUFA 4K4TA 2F40A 1S6QA 1HNVA 2GGPB 4PUOA 1IXKA 3SDEB 3A12A 3R5CA 3IWLA 4TY9A 4KAIA 2KZMA 5B0GA 2GMLA 3V81A 3NNCA 1SC1B 1S9EA 2VUGA 1ICEB 3KLEB 1CS4B 2CFXA 4OYPA 3K5MA 3H0PA 2I0XA 2AIRB 1KQKA 3SQGB 4ZJLA 4OJHA 1XQIA 4ELUA 1WWHA 3PM9A 3JQJA 4ZPVR 4J91A 2ATCB 2AT1B 4AT1B 2R8JA 4TXSA 5LXYA 4DFJA 1UVMA 3GIJA 4YP3A 2E1MC 2CQ0A 1B64A 1TK0A 3O3LA 2K1RA 4HT7A 3P49B 1CJVB 5KG7A 1PCAA 5E3AA 3CO0P 1DTTA 4USMA 4CT8A 2HURA 2DIUA 3QFHA 5SUHA 1FE0A 2ZM6F 3VAHA 1U45A 1NXIA 1W7WA 1YZ7A 1FVSA 3W62A 2AJFE 2I1RA 1PBAA 4B3OA 4Q44A 5L1IA 4FYWB 1QUVA 1ZZFA 3DGPB 1EARA 4LFCF 5DZ7A 4A8MP 5G4DA 1TU0B 1TAQA 1TKZB 4J90A 3GG0A 3GIMA 4I6YA 1CPZA 1S1TB 3I9ZA 1RT7A 1ZAXA 3PFEA 2DRBA 2EK1A 5GAHU 3RBEA 2R8IA 5B09A 1QTNB 2M9KA 4KGMA 2YY3A 1D9AA 1GX5A 4OI4A 4YFUA 4KSEB 4OYAA 3SCLE 2NSBA 2WOMB 4DZDA 4B3TF 4OZ2A 4LF4J 2W25A 3ET6B 3CJ0A 4KKOB 3EGNA 1NPPA 2K06A 3PW7A 4O23A 4YB6A 2R7UA 4OZ0A 1TR0A 2M8DB 5D3GB 2UXCJ 2YX4A 4PWDB 2MY8A 2IPOB 1OIAA 1KLMB 2YWHA 2A10A 2ERRA 2R3VA 1TUWA 2QA1A 3W2WA 4PWUA 4DPYA 1O0PA 1KTQA 2K8GA 3KDNA 4DN0A 2GO8A 4Y28C 4C3KA 5IM0B 1H98A 3DC2A 4CRJA 2HQCA 3OTOJ 3MAAA 2HKEA 4ECYA 4PQUB 4KH0B 1BGXT 2ZH2A 3ILLA 5KT5A 4C11A 2IVYA 3Q24A 4DL7A 1AW0A 3M6VA 4OX6A 2UV8A 2RF2B 3BSNA 4LF8F 3G8QA 3BKFA 4ELVA 4ZJQA 3TW0A 4IRDA 3K57A 3CB4A 2AGQA 1Q8LA 2AJ0A 3HSDA 2DISA 3QIDA 3FBEA 2IRXA 2QLBB 4OJ1A 3HFVA 3KLFA 5D0EA 1HBNA 4E8UA 3DCAA 4YR0A 1NK8A 1FJEB 3SI8A 2D9PA 1L3TA 3N79A 2VA3A 3HZEA 3OL6A 2IJRA 1OQ3A 5H9FJ 2Q1LA 1Q1KA 1XMQJ 5DS7A 1Q8IA 2MZSA 4PZVA 4IRCA 3SXLA 1UVJA 2C42A 1MN7A 1ZAWA 5A8RA 1FNOA 2C1EB 2V69A 1ZM4A 3OTDA 2VFRA 1NM2A 4UQGA 3MM8A 2ZVSA 3KWMA 1SC4B 1UEVA 4OZNA 2EC0A 2GAGC 4DSEA 2OSQA 4M5HA 3NWGA 1P27B 5DLGA 1T3OA 4ICLB 3ZTOA 4WBFA 2BQUA 1HBUB 3VALA 4F4ZA 1S1WA 2OPPA 1KOOA 2DVIA 2XQCA 3SIPB 2GS8A 1IKWA 3HULA 2COLA 3K8WA 3PR4A 1SH0A 4ZPTR 1S1XB 1KHVA 3MM7A 3TQ1A 4RW9A 3M30B 4X2BA 2JFKA 1NNDA 3NL0A 3QGIA 3AB2B 4G3IA 4JI6J 4F3OA 3C6UB 5H9EJ 4LBHA 5C2GA 3MM6A 4K50A 2ACYA 2F63A 1K1QA 5CZXA 4RLEA 4OX9F 1Q5YA 4P2XA 1VRTA 1HI0P 1KP6A 2CZVC 2R7TA 4DWIA 3LTOA 3JTOA 1Y10A 1RHJB 3RRHA 2CVEA 3UDLA 2GC8A 2HNYB 1REGX 3QSIA 2P6SA 1HNIB 2Y1IA 2ZKUA 5L1LA 3CDBA 4WFYA 5CCLA 4RWXA 1NDLA 2N3LA 5B0AA 2V68A 4NZ6A 3OVSA 1YBUA 1CJTB 2KT2A 5IT9U 4HH1A 2Y1LB 1WTFA 3TA1A 3LP1A 4FKYA 3MR3A 3ETMA 4EYIB 1TVRA 2DR7A 3PEHA 1GK8A 1TKXA 2F4VJ 2H5IB 3P5BP 3CDUA 1S6OA 2PI5A 2LA6A 1T9VA 2UUAJ 5K14B 2ALZA 3D3BJ 3ZZYA 2XM3A 1LOUA 2BJ7A 1M5HA 2SXLA 3RG6A 4BBYA 3P6YC 4PWWA 3JYTB 2HWIA 4HHHA 2XZTB 4F4YA 1BQNA 3ZZRA 4LSZB 3HVRA 3DRRB 4M5KA 4USKA 4OYBA 4LQ3A 4RW7A 2VPWB 4FPRA 2EI5A 5CHCB 1BQMB 3DDNA 1UZDA 3CJ4A 4B3MJ 3B8HA 2MQPA 2W9CA 3CW2C 3GONA 2MPUA 3NOGA 3ZC4A 3U02A 3C6TB 3W2VB 4O44B 1MWZA 3BKUA 4DF8A 1WC3A 1HQEB 3FSXA 3B4DA 2JHEA 1YVFA 2DIVA 3GP9A 5KFWA 3PW0A 2CQ1A 1Z4UA 4CO1A 4OV1A 4RW8B 4EYHB 4WZQA 3QT8A 1ZTTA 2NYHA 3KJQB 3QZ7A 2ALYB 2GMHA 3BGOP 3I0RB 2E1CA 2VICA 3OUYB 3HK2A 3E51A 2MLZA 5B0BA 1O51A 2JEGA 2H65B 4M63A 2GO9A 3J80Y 2V94A 2HRTA 4ZP7A 1S9GB 3Q8VA 2KXFA 2CQDA 2EFNA 5DZ6A 2A0FB 4X64F 1UVNA 1VBZA 2KG1A 2QLJB 1NKBA 3PRVA 1GX6A 4KH1B 1F1BB 2JNJA 2GJFA 2N4CA 4TLRA 3TVKA 2CNOB 3DI6A 3KJVA 3TUJC 4JI7J 1JJ4A 3W63A 3BGLA 3N5BA 5A8WA 2KT3A 4IH5A 4PABA 4UZBA 3M8SA 2PN6A 4E2FB 4DQPA 1I6JA 2YKNB 1T05A 5K8OA 4OFZA 1HNIA 3HD1A 2OEKA 2GX8A 2AEFA 2M88A 4J5OA 5D4NA 2I9SA 3RGIA 3TZXA 1AFIA 1NJXA 1WC6A 2W4PA 4DQRA 1LW0B 5IV4A 2UUCJ 4ZVGA 1JWWA 3OFHA 4R5PA 3BO4A 4NI2B 3THTA 1XEZA 1GEHA 2WSFC 1SC3B 4QW8A 4F4XA 4HDGA 2V2QA 2XG8A 4F4KA 4DR7F 2R7VA 2FHJA 3WX8A 4FF4A 3R6GB 1XBWA 3WC0A 3TANA 4KGVB 2AYMA 3DDKA 3AAWB 4B3SF 1IBKJ 2MGZB 1YJUA 2YNIB 4PCQA 2YX1A 1U1NA 2CZ4A 2GQQA 3IAM9 3R7BB 1HBMB 2KYXA 4DXLA 2AJ4A 4RNNA 2LDIA 1QAJA 4JI2F 3BPDA 4NOHA 3B82A 2CQPA 1U26A 4IFVB 3FRYA 4RZRA 4DUZF 3D7SB 3BSOA 3H4BA 5JVHQ 3MCNA 2DHXA 4NZ7A 5H1SV 2UXDJ 4QCLA 2VDIA 1F9HA 1PIEA 2KVQE 1CVJA 4I2QB 3TO8A 3CCRS 4X4QA 3DRXA 3KHGA 3GE9A 3MAQA 1X60A 4C2MA 2X1GA 4G1PA 1Q79A 1AYEA 2N7CA 2MDAA 2RUGA 3ZTPA 2DITA 2ZH9A 1U0SA 1U47A 4HHJA 3K58A 1VQ4S 2OGUA 1LWFA 3CD7A 5KOXA 3ZZ0A 1FWKA 4LVOP 1FK9B 4R8UB 4UY8T 1FFWB 2FVPA 4P75A 1LW2B 1C1CA 1E6VB 1UCNA 4AXJA 3M2RB 4MIBA 4ES1A 2J9DE 3FC9A 4R0JA 3Q8SB 3C2PA 4DR3J 2NQPA 1CEZA 2M8HA 1REVB 2MQQA 3MR6A 4N8OA 3RBXA 1M1KT 4WU3A 4DL2A 1SL2A 2R7XA 4KFBB 3AD8C 1GMWD 2RE1A 1VLOA 4GVBA 1RYSA 2VFTA 3ONQA 3H25A 4OIXA 3MMJA 3W1YC 4NMLA 3CC7S 4A8KA 4J9OA 3GV8B 1YI2S 3EXCX 2DCUB 2XO7A 1Z2LA 4IG0A 1E6YA 2W2NP 4YY3J 4I1TA 5D0RA 1FRXA 3I0SA 4C3MA 3QAEA 3FFIB 1UW4A 2CUYA 4FPIA 1H73A 4IQXA 3TQEA 3CJRA 1CJKA 2XMJA 2GV1A 2HEKA 5EWFA 2OLWA 1YITS 4IDKB 5C42B 2EEYA 2GIFA 1WELA 2NYIA 3R7SB 2FHKA 4FS1A 1JLBB 3H2UB 3AXMA 1S7IA 5CD4A 1XNRJ 1EP4A 2RB7A 2YKPA 3MMCA 1ULRA 3K5PA 2EKYA 3HO1A 1DLOA 3G9CA 4PRFA 1RLDA 3VGUA 2O01C 4ZVSB 5C7PA 3SCKE 4C7QA 1RSCA 1X4FA 2QRRA 3H7HB 4KPCA 1HNWF 3UW1A 1NHVA 2ZOFA 3CCWA 4X4SA 5HO4A 2QGFB 3DLKB 4NXMF 4OV6A 4NLYA 4J9LA 2MZJA 4W92B 1DURA 3DOKB 4EWTA 4LSNB 3ENVA 3DLEA 2Q43A 1IKVB 2EW9A 3Q83A 3K7RA 1NK7A 1RT3B 4ZS6A 4X84A 3ZZZA 1YDLA 2CPZA 2J7KA 2ZBIA 3A4TA 3I87A 5K8NA 3FZ2A 1TL1B 1LWEB 1JLCB 5L1JA 3MPVA 2IDEA 1VMBA 5KG4A 1GMUA 3DRPA 2A2DA 1NH7A 4M95A 4JI1F 2QMWA 3L3CA 4WPAA 2GJ2A 3H4DA 1FKPB 1NBEB 2OI2A 1S0NA 2KM8C 2GVZB 4UW2A 2Z0GA 2ZHOA 3VV2B 2YQ1A 4YDXA 4WFXA 4QR0A 3MUMP 4XDCA 2MHNA 2VG5B 4K4WA 2UXBJ 1MWYA 4LJMA 3Q2TC 2B56A 1AZSA 3QATA 3OR2A 2VQEJ 2FYXA 4Y6IA 4DV5F 5JMNA 2CNKB 4RUAA 3W5YA 3TJAA 2C2EA 3D6HB 4QR1A 1VBKA 4G1QA 3BYPA 3LOUA 3DM2B 1FJ7A 2QTWA 5J1EA 1RWWB 5ETVA 1F5BA 5E0OA 4K7QA 4P2FA 3UD4P 3SZ2A 2QJ3A 3Q8YA 1U02A 2HAFA 4CNZA 3D1HA 3WBZA 1CC8A 2RSQA 3OXGA 4O4GA 2DEJA 1TUVA 3GJSB 5A8KB 3KJNB 5KG3A 5C24B 1YWXA 4WFBQ 3FSIA 5B0FA 3MEEA 4QWCA 1LK5A 3UD5A 3I56S 3MURP 5LSLA 4HDHA 2XHCA 1WG5A 3MFIA 3M8ZA 2H5JB 2VC0A 4RPFA 2EBEA 2V8PA 2MSTA 4KHRA 2DRAA 4TLQA 2XGPA 3DYAA 4Z7CA 1FFSB 5K8MA 5HANA 3H5SA 3EGZA 5ETRA 2IM2A 3DOLA 2PMWA 2PSZA 3VVTA 3MI7X 2MQLA 5ETTA 3O5TB 1FT8A 4AYBD 1S7HA 1SKSA 1DAXA 1N6QB 2QV6A 2FTRA 4RJVA 4UOCA 2ZHAA 5KG2A 1IM4A 2LQ8A 2Z56B 2HS4A 2DNNA 5MAOA 2B7CB 4U95A 1CULB 4CIOA 1WKKA 2QL9B 1U4BA 5BYSA 2QA4S 2PIIA 2KDOA 3UO0A 4DR5F 2UUBJ 3QJPA 3R2CJ 2J7UA 2Z2MA 2YNGA 1JLEA 2YWFA 4ZPCA 2X3GA 2YH1A 1J27A 3D9BA 4F50A 3H8YA 3LF0A 3ZTQA 4ALZA 4WIQA 4C9DA 4FYYB 2ROPA 2J5AA 3KJFB 2K2PA 1HFEL 2E1PA 1YHQS 2RRBA 4G6VB 5KFMA 2ZDOA 4G1IA 1BD6A 1YG0A 2CJXB 1V3ZA 1P6TA 1C1BA 1ZTWA 3HHNB 3PCOB 2YTCA 4I69A 1Q4RA 4BWJA 4K4XA 1SBRA 4MAKA 1NO8A 3T1HJ 3X1LB 4USJC 4DFMA 1I94J 1R0AB 1HNXJ 4ZPAA 4DS5A 3F0NA 4EK2A 1UA0A 4YHHJ 2C28A 4I56A 2ASJA 3TAMB 3RUBL 5A2QY 4AFFA 3HVAA 3MZIA 3PKMA 2ZDPA 1YJ9S 1WG4A 3H90A 4Q0BA 5HI7A 2C3PA 5GAHI 1WUUA 3GPAA 4JYAF 1RAGB 4ZLNA 4IR9A 3HVTA 2NCKL 1EJ7L 2R2TA 5J1NA 3A8IA 2IRUA 3NMAA 2QX0A 3G6YA 3RRKA 2LCWA 2JEJA 5KFZA 1WI6A 4JV1A 1NLKL 2XY5A 3KK1B 3EDQB 1RTDA 3C46A 3BYRA 4UQTA 1EIYB 4I2PA 1Q0NA 2MJNA 4ECZA 4HT5A 4ER8A 4C8KA 5E3PA 2DK2A 3BREA 5KG0A 1Q53A 2XGQA 2DBBA 1FX2A 1EQMA 4C0BA 2YQ3A 2IYIA 1D9DA 2O67A 4RKUC 2ZD1A 2ZH1A 1ZH5A 5IC4B 4IFYB 1WI8A 3PW4A 2ASLA 2J0XA 4USHA 1R0BG 1IBCB 2HLTA 3MEDB 2QFIA 1HBOA 3KG0A 5HJYA 3GSIA 1OPZA 3OSNA 3R5BA 4U8YA 3GYXB 4ZK7M 5LJ3Y 2IA0A 1GFWB 4YN3B 3CJKA 4ZN1A 4MIAA 1KEKA 2A2CA 3OVBA 2HIQA 2HHUA 2OPSB 3L95X 1F5AA 2E7VA 1W2BR 1F3VA 3AH6A 4CO4A 1RWXB 2GA7A 3HT0A 5K20B 1NU4A 4J9QA 2LLZA 3TP2A 4KHPJ 3RR7A 2AHOB 3D28A 1N33J 2FJBB 2G0JA 3K2YA 2CQ3A 1FRJA 3DXSX 4F4WA 2FPHX 3D68A 1RHQB 1IWAA 3KUHA 1KQSR 1S59A 1IJFB 4JUZA 3CDWA 1RABB 1TL7B 3M9MB 4UZCA 2OH2A 1K1SA 5L1KA 3CVKA 3CEDA 2VFUA 2XEXA 3KLGA 4LFCJ 3C8YA 2AD9A 5KFNA 1QSSA 4DL3A 3E01B 2MKSA 2ZUAA 2BBEA 2KRBA 5DJBA 1FTRA 4LF6J 4O0IA 2CG8A 4NCAA 2ZC3A 5GMEA 5G0RA 1QVFR 3RB6A 2BKNA 1RKIA 4KO0A 5GAEU 2HVEA 3CCUS 1S0VA 3VAIA 4YB1P 1JLFA 3HXMA 2D3O1 1HWUA 3QGGA 2MSSA 1WOOA 5J2NA 3NGKA 3PR5B 3E2EA 1O5JA 2I2YA 1SCJB 3ELHA 3DOMB 2RJZA 3DRSA 4ETXA 3D2WA 1UL3A 1RAIB 3MMAB 1HPZB 2ATLA 1Q7LB 2WONB 1OQ6A 2XSJA 4XPCA 5KFBA 2KB2A 2BRKA 4XO0A 1GQEA 2BJDA 1SJQA 2KFNA 4ID8A 2XS7A 1HHQA 4CZCA 4MH8A 3MM9A 3QO9B 5M2RA 1TUGB 2BV3A 4I64A 4DX5A 2FY8A 3MECA 1RAHB 2WB1D 1T03A 4LF8J 3MF5A 2YPYA 1TKTB 1SKUB 4A47A 3BBCA 4CI0B 5LJ5Y 1RTIA 3KDOA 3HX9A 1T9XA 2UZAA 4RO0A 2HBQB 5J2PB 4UOFA 1RB0A 1PILA 4LIWA 2GMJA 2H4YB 3JSRA 4AXIA 3R8YA 3CCQS 2DGOA 3L7PA 2HNDB 3HKZD 2DNYA 2WK4A 4RW6A 3VAJA 2DNMA 2VOOA 2YX7A 4M8LA 4K2XA 4RNHA 2A6MA 2VPYB 3ISND 3QYYA 3MUVP 3UDCA 3NCRA 4QYRA 3W3SA 4ID5B 2VG6B 5J2MB 3HPOA 4JBCA 1S4FA 2D74B 3O6QA 2X3DA 1JMTA 4B3RJ 1H6KX 2I5JA 2KT5A 2EFPA 3T1YF 1KVKA 2CQ2A 3J7AN 2CYYA 1IR2A 3TJ8A 1FRLA 1UWBB 4NZ0A 3G71S 3PIPQ 4CT9A 3ENAA 2NR0A 2Z58B 2QA2A 2V9WA 1F2GA 2IMOA 2XHWA 2ZH8A 5LMUF 4NLVA 1SV5A 2D9OA 4F2SA 1R3NA 1R8CA 3G82A 5ETOA 1UETA 2OPRB 2V4JA 2KFYA 2P6TA 3V4MA 3OV7A 1NHKL 3ZTSA 5L8RC 2NS1B 4K5SA 2Z2YB 2IC3B 1H7XA 3DGVA 2LP4A 1T9YA 4OX9J 3HJFA 5FDLA 3OVAA 2H48B 3B6BA 2J8SA 3RZAA 3DXBA 4NX9A 1FDBA 2C2KB 1HPZA 1RI7A 2PMHA 3OHBA 1S0OA 1X0FA 3QFWA 1WOPA 2CQCA 2BR0A 5DDRC 3VGVA 1XMOF 4TKTA 4ECUA 5BR8F 1Q8KA 4RBVA 2CQIA 2B6AB 1VQPS 1RA7A 2BYCA 4ZKAA 4RL1A 3RAXA 3EYZA 3RW6A 1YRXA 1DTQB 5F0WA 2BE2B 2BDPA 5KFUA 1RWNB 8RUCA 3AB4B 1M90T 3NNHA 5GAGU 1D8ZA 6FDRA 4USVA 2R2SA 2HMIA 4C98A 2GIRA 1UWAA 5DDOC 2W9AA 2RS2A 4LR8A 3HCXA 2LKZA 2CWKA 1H2UX 1RT5B 1VR6A 2HQGA 4I7FB 3HMJG 1WSVA 3OW2R 1TL3A 2CJ9A 1F2HA 3H5XA 3PKYA 4DV1F 5HLFB 3T6BA 4ID5A 3MEGA 3NBPB 1K9MT 1U6BA 2H4WB 3D6FB 3PVXA 5IWAF 2E44A 1RTJB 4L73A 2HGNA 1S5ZA 2DXDA 3BF4A 1UW9A 2K7KA 3NAIA 3N01A 3PO4A 1Q16B 2DNGA 5E3CA 3MM5B 4USUA 3BH7B 4C8NA 3CDEA 5HBMA 4USIA 2E5HA 1S49A 2PT0A 3MCOA 2OD6A 1V5IB 2VODA 1CBKA 2PC6A 3RB0A 2XMUA 1FWPA 3DU5A 2W2PP 3DRYA 4X64J 1OS5A 3NKYA 3CSKA 4PYDA 2VF3A 5F8MA 4FKXA 4K2JA 5L38A 3BN7A 2NPIA 1TQLA 1IKYB 2LQ5A 2C2DA 2LVWA 2JEIA 4CM0A 2Q3PA 1OMSA 1RT2B 2XMTA 1MSWD 3PIOQ 4H4OA 1XJWB 2KU7A 1M5VC 1DFDA 1ZM3A 4FDFA 2MQMA 5DQIA 1UTAA 4CLFA 1RISA 9RUBA 3OL9A 4ANEA 1GXTA 2L9DA 4Q2LA 2PE8A 4LF5F 3KUGA 2AEMA 3VAFA 3CXCR 1R8HA 1YRTA 4A8OA 1J5EF 1HARA 1DQ9A 2OPQA 4KYZA 2O3DA 4LT6A 1D1UA 4ZIWA 3V6DB 4HI2A 4L3NA 4F67A 2HHPA 2F7VA 4DR7J 5HN0A 1DTQA 4OI1A 2AWZA 2RDDA 3EGVA 4ZDNA 3MAHA 1NB7A 3H98A 3IM8A 1VC5A 3UN3A 4B3SJ 2VJVA 2RRNA 4ZHRB 2FJVA 2FJAB 4PXEA 4OI6A 3ILIA 1N32F 2R7QA 3FRZA 3BSAA 3AJ1A 3POTB 2RNEA 3BS9A 2E1AA 1HR0F 1QJHA 3C15A 1YZ6A 4ECSA 2R4FA 3U1LA 1GXLA 1Z1ZA 2V34A 3BZQA 2AYGA 3I32A 4TQSA 1LQ9A 4DUZJ 5FJ4A 4PAAA 1DBDA 1JLQB 2IFXA 4DV3F 1S0MA 4OZ1A 1JIHA 5CYQA 2ZHBA 2JX2A 1XERA 5CABA 2RU3A 3UFCX 2YWWA 4Y2AA 3TR5A 4ZVTB 3FQKA 4GKKF 1JKHB 1GH8A 2B9EA 4TN2A 5LMNF 4BC9A 1RAEB 3W9IA 3C66A 1VBXA 4X65F 3PACA 1Y00A 4KGKA 3VAKA 2HWHA 3IXQA 2JH3A 2HFVA 1KD1T 4FF3A 4DR4F 3OHAA 3W5XA 5HQMA 4QBUA 4M94A 1NSAA 3VHQA 3DHWC 3T5KA 3BN4A 3IG1A 4ZLLA 3K5NA 1VJWA 3CC4S 1U1KA 2H3EB 4NLUA 3S8SA 2W2QP 3PG9A 2A18A 2IMWP 1MROB 3WHIA 2G2OA 1PJ5A 4CH0S 2Z2LA 5DO2A 3LP0B 3LQVA 3MDFA 3FQLA 1WC1A 2KM8B 4ZPDA 4NLGA 2DXFA 3FK4A 3PRBA 1GAOA 3O44A 2C2OB 3MOZA 5EX0A 2CKWA 5L39A 2EBGA 3LA0A 2BW2A 4IYQA 2WZ1A 3HHLC 5M2UA 2FC8A 1EZZB 2M5YA 1KONA 2YWKA 3N0VA 2XZDB 1OSDA 2Z2ZA 1U49A 3IS9A 3UQSA 3W7BA 1SUQA 2W4CA 4OLOA 1KFDA 2MJUA 3WX4A 1WF0A 1W2IA 2NREA 2DCLA 4DDFA 1T9TA 2WCXA 4IR1A 4LFBF 1H7WA 4DL0C 2VPZB 4A4JA 4ILRA 3V6JA 2FVRA 3KHRA 2U2FA 4CQ1A 4RU2A 1EX8A 3EUNA 1N5YB 4YS2A 2WVFA 4ECTA 1EQ0A 3IWXA 2HHTA 2MLXA 2W2OP 5D4PA 3UCZP 1RUSA 2PGCA 2FVSA 4DPUA 1X5PA 3HVWA 1U1OA 1HNWJ 1OYEA 3M2UB 3O1LA 3TZWA 3KLHA 2KXNB 3OTBA 1SJ4P 3IRXB 2DNZA 2J76E 4CO0A 2I38A 5J2QA 2PD1A 3TX8A 4PPZA 2HFZA 4DPOA 4NLSA 2YWEA 1JLGB 4V19J 2PMZD 3MPUB 4ED3A 1IBLJ 2FJDB 4ECQA 1S1VA 1T94A 1UVKA 2IAJB 2UU9F 2KKHA 2DT9A 1QE1B 2QE5A 2HPUA 1JLAB 3WIVA 2B5JA 2NZ4A 3IN5A 4CNYA 1HI1A 4A8SA 2VJUA 3EMTA 4JI1J 3S7RA 3RW7A 5A0YA 1PO6A 3CJSA 1VRUA 2Z57B 3CMAS 2ZKTA 4RR5A 2I6WA 2NXCA 2BE9B 2NXJA 5F8IA 4H4MA 1A6LA 2ZE2B 4CTAB 5F8JA 2YKMA 3CCZA 1M5KC 3C16B 1Q78A 4DCOB 3KLIA 1F0XA 3M2VA 1MU2A 4AL7A 3ULHA 4WIIA 4M5GA 1Y5LB 2LXUA 3PDNA 5CYMB 1V3SA 3BO3A 4KV8A 3V4IB 4F36A 2AX1A 1YJNS 3MR2A 3J81U 3FEZA 1TKDA 1DRZA 3RB4A 1RQ0A 1FJGF 1IBMF 3GR0A 5KT7A 2OELA 1M1HA 2HNZA 3QBCA 3G86A 1SL0A 3HM9A 3DLLQ 4NA1A 4P6QA 4MYUA 1F3FA 5I3UA 3NNAA 1P1TA 4LBIA 2QT7A 1N36F 4QZVB 5KFRA 2BQRA 3CNQP 2NXEA 3OFFA 4LR7A 3CF5Q 1KDNA 1XR7A 4ECRA 4CLYA 3GSDA 3BDPA 1HMVB 3JSMB 3BJYA 1RBOB 3R7NB 5EGYA 3QLHB 4ZN3A 4DSJA 1U1LA 3W8GA 2KN4A 3ITHB 1UJ5A 3IA0A 3NLCA 4WZMA 4J9PA 3NGDA 3PHTA 2B3TB 2V2KA 1QTMA 3KK3A 4LRBA 2ADBA 2YWGA 4ZP6A 1WKLA 4A8XA 4LF4F 1KQFB 3A1YG 1XTZA 3P5TL 4XPEA 1OWXA 3AY0A 3A8KA 2VBWA 2V8HA 3IRWP 2KHCA 5DETA 4WP9A 3W60A 2DGWA 4ZCIA 4EMDA 5HMYA 2UXCF 2JJ4D 1KC8T 2RAQA 3IR7B 4ED8A 5HP1B 4ECXA 5EUHA 1LWCB 1SH2A 3MTJA 3PX4A 2DRDA 2V4QA 3VR1A 4PR6A 1TMJA 3ICLA 1HQUA 1HWIA 4OJ3A 1D3WA 1TFYA 1PYSB 4C8MA 1U0HB 4DR5J 5C25A 3FDSA 1B70B 3GG1A 1TV6A 3C14B 1NSKL 4U96A 4NCGB 4WTYA 4C0HA 5CCMA 2GVDB 4UF4A 5A76A 4YOEA 4K8RA 3NXZA 1T95A 2G0CA 2BJEA 2HQ3A 4Y2MA 1DZ5A 3AOCA 4H4KA 2VQFJ 1RCXB 4AL5A 5T41A 2LDYA 1SQFA 2R9LA 3UI3A 4WP8A 5DDQC 3OXLA 4RNFA 4K59A 2BJ3A 3GR1A 4QIEA 2CPYA 1Q5VA 1S1UB 1S9FA 3T6JA 1H0HB 4EI2A 4CLKA 1EB0A 1ACMB 1W26A 4LRCA 1RCOB 3IM9A 2AGOA 1P1LA 2MKJA 2W9BA 4DSFA 1VQSA 3IWNC 1XMBA 1QUPA 1ZA1B 3A3OB 3MPWA 4TU8A 1X7VA 1Y9OA 4RW4B 2X7IA 5A6WA 3ETOA 2ZOGA 3DLGA 2E9ZA 2ZJPQ 3D66A 3M32B 3RAQA 4WKYA 5GAEI 4QYZK 1RAFB 2X51A 1IKXA 1N48A 3PJWA 4OHYA 4QU7A 5KFLA 4IOCQ 4F3QA 2MKKA 3P3DA 2A1BA 1L3UA 2XLKA 2DGTA 4W90B 3PFOA 2ILYA 5KFTA 1GMWA 1U1MA 1CJUA 3FBFA 1NUEA 2RMLA 3UR0A 4X4UA 3NCQA 3VZIA 1RZMA 3PV8A 1NZAA 3LGHA 4OHVA 5KTQA 2B0GA 4KE5A 3NS5A 4MFBA 3M8PB 4HKQA 1WC4A 1ZM9A 4F2RA 4DV4J 3PYEA 3EICA 1K8AT 2HWTA 4Y0FA 1R6YA 4DX7A 4LRDA 1QM9A 5IT0A 1R31A 4F3MA 1S6UA 3JTPA 4DX8H 2JVOA 4JI8F 4LSLA 4BLGA 1H3DA 3GIRA 5I42B 2F5GA 2FQQB 1T9WA 2P5VA 3OR1A 2DYAA 1U0HA 3G8SA 1G2EA 3DLJA 2MYFA 1X0PA 2LXFA 4X4PA 2CJQA 1GXUA 3NCPA 2VU5A 4ERDA 2FVCA 4F26A 5KOWA 3AA9A 3CO9A 4QWEA 4QOTA 5CQGA 4MJKA 5ITHA 2J6UA 4YMEA 2J9DA 1VQ9S 4ZCMA 4AUKA 2EPIA 1VCTA 1RAOA 2GHPA 4HACA 1WHVA 2YNFA 4MK7A 2FLOA 3KOAA 4P10A 1YK9A 2E9RX 2R7SA 3G2XA 1RTHA 4GMKA 2MKCA 2LEBA 1AB8A 1HWLA 3VQSA 2ZITA 1S6PA 4AQYJ 2BANA 5AE1A 1VFJA 3CJ5A 4J9KA 3LP2A 2VB6A 3VWSA 3UCGA 1UAWA 3GV5B 1RWVB 2VPXB 5KFSA 2GGPA 4M5DB 3SDEA 2OMOA 1TP7A 1OYDA 4B3MF 3KK2B 2DY9A 2RQCA 5F3TA 1V6HA 2ZH7A 1B0VA 2GAHC 2P9GA 4URQU 1T7PA 2V8GA 2VONA 1D09B 3MGJA 1BHNA 2XYPB 3KLEA 4GKJF 4D3HA 2HAIA 1CS4A 3SSRA 1S48A 3ILOA 1T0TV 4YR3A 2CA9A 5D78A 1VC6A 2X1BA 3PTWA 3SQGA 3OT9A 2JC0A 2DR6A 1RBAA 1VISA 1JXEA 1PBUA 1ZPVA 2G0IA 4C48A 4Q45A 1TELA 1UFWA 4U7UK 1AFJA 3EM1A 5KT4A 1WDDA 4NASA 4R0EA 2QG9B 4NXNF 1CJVA 5F8NA 1WC0A 3W5ZA 1TL4A 2QEXS 3EDRB 2VG7B 1VQ5S 3HDSA 5HQLA 2DH8A 2KZZA 1KNZA 3S6EA 2AKWB 2MKHA 2GNKA 5LSOA 4N47A 1WC5A 2FHMA 4PKDB 1SJ3P 3T5JA 5JJBA 4YEAA 2B4VA 2VL1A 4X62F 2JDJA 2J6SA 5LL6d 2AW0A 2QA4G 2YVSA 3FGVA 3CD0A 3BM7A 5DG7A 3BB5A 2W24A 1FD2A 4DF4A 4OX8A 1JQGA 1CSJA 1ZYQA 2MEWA 3DGPA 1XIQA 2VZ9A 3DMJB 2M4MA 3DDIA 4Y34A 5KFQA 5GAGI 4DG1B 5IOLA 3MOJB 1TKZA 4C6AA 1NHUA 1S1TA 2NPFA 1PJ6A 2DGUA 2F9JA 3BQ0A 3L09A 1FHTA 1OPIA 2G2ZA 3JQKA 1X9WA 4QW9A 4LF9F 2WOMA 4PG7A 2HGMA 3KTQA 3ET6A 2VDHA 4KKOA 1WG1A 3NGRA 2AYEA 2DHAA 5F9NA 2DNLA 2MY7A 3CULA 2IVMA 3NWRA 3G87A 1YBTA 5D3GA 3VGTA 4PWDA 3N5FA 1KLMA 5KFCA 3SQOP 1FFGB 4FP9A 1N8RT 3SV3A 3I31A 1K73T 4BHQA 3F56A 1RAJA 2BJ9A 4OYOA 2AX0A 5LMUJ 2E5JA 1FCAA 5AXMA 3AFGA 3IGNA 2AQ4A 2CPDA 3C3LA 4X4RA 2DNPA 5IM0A 1URNA 1R89A 5JVGQ 2LU2A 1IJEB 2L08A 1DY3A 3M9NB 4DLEA 3JAMY 4PQUA 1VC0A 4F4AA 3QIPB 1GTHA 1KVJA 2EVZA 1FVQA 4OLPA 2RKIB 2DH9A 1KTVA 2RF2A 3F73A 3H2VE 5KFDA 1OSCA 4NRTA 2LXIA 4ZVQB 1RXOB 2DGVA 1PC4A 2XC9A 2YNHB 3M8QB 2WBMA 4FXVA 2E7XA 4JI3F 1R8BA 1XMOJ 5E2QA 1WF1A 2XTJP 1Y3JA 4KHMA 2ZH6A 5BR8J 1X4BA 1WEXA 5KFEA 2AJQA 2D69A 3I4HX 2QYCA 4UOHA 2M0GB 2UVVA 3GTYX 4FYXB 4DSKA 2OP5A 3PRDA 1RBLA 4OJGA 5HQ8A 3EWGA 3GLJA 4CLPA 5RUBA 2C3MA 2LA4A 3HFZB 4R25A 1Q95G 5DG9A 2VHGA 4RNOA 1NJIT 1RT1B 1N5QA 4FZVA 4NLOA 4ICLA 4LF1A 4I67A 5KFGA 1HBUA 4KTQA 3UWTA 2OEMA 4IOBA 3R3TA 4F0HA 1HW8A 2YPZA 3A13A 4AD6A 5HROB 1IR0A 1VQOS 3FUYA 2ROGA 1S1XA 1UVIA 1HA1A 5D15A 1EETB 1VHFA 3M30A 3MR7A 1RT6B 4B17A 5E33A 5ETLA 4TY8B 2ZH3A 2ZH4A 3I5BA 5IWAJ 2ZBCA 3QRQA 1C0TB 3J7A1 1RT4B 2BX6A 1U1RA 1EKSA 1NZ8A 3C6UA 2IM0A 5IXUA 2XMWA 2ZVIA 3T9NA 2XLJA 3AD9C 4JV2A 2PEHA 2WAQD 3E8OA 2KYZA 2DHGA 4PXDA 4ANCA 2GIQA 1U1PA 1XNQF 1CLFA 4NA2A 1SC6A 2HNYA 4WF9Q 4ED7A 3PZPA 1S97A 4BDPA 2DGXA 3IO1A 4B02A 5LSRA 1X4DA 1HD1A 1NSPA 2CRLA 3GFYA 2M3DA 1UA1A 4OL8A 1QLNA 3GZ7A 4B08A 3TWZA 5B7WA 1N52B 3TI0A 1CJTA 3W61A 3I5AA 4KGZB 4WXOA 5HMWA 4ZLPA 4MK9A 3Q8PB 1VDHA 5K14A 4N5SA 2LQBA 4ED5A 3AOBA 4NLDA 4V1Ak 2XCPA 4CYUB 4DFPA 4CLWA 1JJHA 3JYTA 1TFWA 1QSLA 1N4LA 2BMBA 1EKRA 4LF5J 1JNZB 3JB9k 1QDUB 3V5RA 3GFXA 4TQRA 1FKOB 3NS6A 3DRRA 1FI4A 3I96A 2E5LJ 2ZFHA 3TJ9A 2XY7A 2B4OA 1BQMA 2IA6A 2BM1A 3UN5A 2DO0A 4PXBA 1K0VA 2HFNA 1T3NA 3C6TA 5D6GA 3W2VA 4WE1B 4CLUA 5ETSA 4O44A 4JI0F 3PX6A 3UVJB 1HQEA 4OMFG 1URRA 3GFHA 1S12A 3U27A 2NLWA 3I4PA 2LEPA 3HHLB 2W8LA 2C3UA 2BEFA 2ZC4A 4DX6A 4RW8A 1YJVA 2Q6BA 3NAHA 1N32J 4IG3B 4F04B 5LT5A 3GYGA 3I0RA 4DV7J 1HR0J 3MMBB 3OUYA 2BE7D 2J7WA 3M1VB 3QNWB 2VH7A 3A3PB 1MMNA 1OY6A 4LRFA 1S9GA 4DV3J 1XN9A 5DG8A 1JJCB 3KG1A 4LVNP 3HSGA 2FIUA 1QSYA 1H2TZ 3N9UC 4PXCA 2DR8A 2J9EA 3ZO7A 1C0UB 3TNVA 3MWBA 3N28A 4DV6F 5ETQA 2FVQA 1MMDA 1TAUA 7FD1A 5LMNJ 1NDPA 1S6QB 1HNVB 4PUOB 4GO5X 3W9HA 3CE8A 1O8BA 4X65J 2CNNB 1LNQA 2U1AA 2AGPA 3V81B 4MTPA 1NH8A 2LECA 1U8WA 1S9EB 1V9OA 5BXIA 2YKNA 3PYGA 4EGLA 2B4UA 4DU7A 1X9MA 5LXRA 4DR4J 4NL5A 2XY6A 3LUYA 2PA3A 4YUDA 4P74A 4RX6A 1TMMA 2PFDA 1LW0A 1KN6A 1VRQC 4NI2A 4EBDA 4ZMMA 3VQTA 4DEZA 4I0WA 2EK6A 3GB0A 2XS5A 3FMBA 1OJ4A 3T5HA 3IBWA 4DHVA 2AV5A 2ASDA 2K1RB 2MZRA 4Z2XA 2GHVC 1DTTB 3FKBA 5KFIA 2MGZA 2YNIA 1NMEB 2W8KA 1T02A 4Q43A 3P8BB 4ED4A 7FDRA 1HBMA 2EFOA 3O8WA 4JI4F 2Y8YA 2QSFA 3LGMA 3BR9A 5IZHA 4IFVA 2NZCA 4OYZA 1FRIA 4X4TA 2WRMA 2CJBA 4WTOB 3T5LA 4DN9A 3U1NA 1HNXF 4CO2A 4KJIA 4B3OB 2W4DA 3ZZOA 4KQZA 2DR9A 4I2QA 2LQJA 1L5UA 1YJRA 2EC2A 4X4VA 4DV2J 2XO6A 4DR2F 2BKPA 3LPEA 1RT7B 6AT1B 2B8QA 1NK5A 2W7AA 4URSA 1VQ7S 1PGZA 2FZGB 2J0QD 2EFVA 3TUIC 1PAUB 2CDRB 2ILZA 2HFUA 4ILMA 3THPA 3R9LA 1FK9A 2P8IA 4R8UA 3Q0AA 4DU8A 3LW5C 2HQFA 1LW2A 4ZPBA 2Y0SD 2AEJA 5FIIA 1AUDA 2M2BA 4F0MA 1E6VA 2BM0A 3M2RA 3RBDA 2AP6A 5BYQA 2V4RA 3Q23A 3RRGA 4TYBA 4ZVOB 4EO8A 1REVA 3DFEA 3J7Z5 3G8TA 1N88A 2GCFA 3A8JA 3LALA 2VA2A 5GMDA 2XYGB 3W2WB 2CNLB 2HFOA 2KJVA 2CG4A 4UY85 4DCJB 8AT1B 1RKJA 4IOAQ 2B8PA 2FGCA 1Y4ZB 2JVRA 2UU9J 4OYMA 2DNHA 4OHWA 4MYTA 4KFBA 2QMUB 4HVZA 3FVYA 2YQ0A 4Y2IA 1FRMA 2C22A 2CZ9A 2DHHA 3HI9A 3UCUP 3L9ZA 2L48A 4NMXA 1WTBA 2Y1JA 3MAAB 1WEYA 3SYZA 2G4BA 5HVGA 3M4XA 2F8EX 4C11B 3EPIA 4IH6A 4F02A 1FA0A 5AXNA 3SV4A 2FZKB 1R8AA 4DR6J 2IDLA 1MLAA 3FFIA 5HATA 4Z37A 4KIAA 1IWGA 2G1HA 2HG4A 3KMQA 3GQCA 5IFMA 1JXLA 4IDKA 5C42A 2A3JA 3OD2A 3TAPA 1JLBA 3KLFB 4K5RA 1FXLA 1HBNB 1K47A 2WBRA 4LRAA 1RWOB 2QL7B 2OUGA 4C97A 3OBIA 4Y3CA 2KJWA 2B4PA 5CD4H 1SJFA 3VZHA 3MPYA 4KB7A 4KHPF 5AXKA 1N33F 5HL7Q 1FJGJ 1FRKA 2QZ8A 1IBMJ 2HQIA 1SL1A 1MG7A 5KG1A 5A8RB 2FD2A 4ELTA 3LWLA 4X4OA 1NAQA 4YQWA 3ZZUA 2ZJQQ 3MM8B 3CD6S 4NEZA 3DLKA 3ZNUA 2XNQA 3UD3P 5IQQA 1N36J 4FN5A 2KL8A 3DOKA 4JB8B 4LSNA 3OLAA 4FNHA 1RWUA 5C2CA 1YBAA 1IKVA 3D1OA 3RYLA 3BO2A 1RT3A 1S1WB 4LF6F 2OPPB 3MUTP 1FJCA 4XAKA 5KFJA 4USWA 4P52A 1IKWB 2G1DA 1TL1A 1LWEA 2DTJA 2XMKA 4FNIA 1JLCA 1X5OA 3E3XA 3MM7B 4L72B 3SFUA 4RW9B 3IFEA 4WJBA 2DNRA 1R8PA 5B0DA 1EHWA 3KNGA 1FKPA 4ZVHA 4B9LA 1WKJA 1RWKB 2GVZA 1NK0A 3WZ0A 1TZ0A 1ZA2B 2YKOA 1VGYA 3MM6B 4F0KA 1DQ8A 2RS8A 2VG5A 1UMJA 1VIXA 1VRTB 4OX7A 1QD1A 1YQHA 4ED0A 2R8GA 3NGSA 4NLQA 3W66A 1M5SA 3QJJA 1N5TA 4F25A 2XSFA 2JL9A 2YBVA 1KSPA 2O5DA 2E1RA 1P8GA 3HD2A 3DM2A 4GRSA 1LFPA 4CLZA 2MZQA 3BGUA 4NLPA 4M1KA 1G7CB 3CJTA 3LP1B 3UNYA 1F60B 3TYTA 2F9DA 4CLSA 1TVRB 3GJTB 2OMLA 5EN1A 1TKXB 2D1CA 1MMLA 4Q7AA 2V9KA 2WB4A 5A8KA 4O3RA 2JLEA 1NB2A 5C24A 3K5OA 3HKWA 1NK6A 3SCIE 1HL6A 3MEKA 4XIUA 3MFHA 1BQNB 4P7VA 5KAKA 1VQ6S 4MMOA 4RW7B 3G96A 2E5GA 3PHEA 3M8RA 2HIYA 1NKCA 4LMZA 2W9CB 3QQCD 5KFYA 3AXKA 2JLFA 4ETZA 4M5LA 2KFZA 1Q82T 4URGA 4O0NA 2GW8A 1U8SA 3IBCB 4DUYF 1WOSA 1WORA 1V5VA 2QYGA 4B3RF 1HI8A 5BYRA 3BV8A 2XS2A 3Q8RB 1N6QA 1PYOB 1R27B 2QL5B 8ATCB 3S01A 3J81Y 3LAKA 3TA0A 3TA2A 1CULA 3LAMA 2M52A 3QT5A 4BWMA 1CC7A 2EFQA 1YJTA 3TRGA 7AT1B 4PG6A 2OEJA 3QGHA 2DJWA 4J9UE 2CIMA 5B0EA 1GT8A 4LIRA 5DDPC 1OY8A 1R6VA 2Y8WA 5HVHA 1JK9B 3OJUA 4DL6A 1Y7PA 2ZM6J 3DI6B 4YB5A 3FMWA 3KJVB 2QLWA 2NXUA 3CCSS 1Y5NB 2IHR1 2BKOA 4P2MA 4N41A 2Y1RI 4JI8J 3W64A 5A8WB 5IC6B 2HRUA 4LBPA 1U25A 1RYRA 2MB0B 3ADAC 2FUG9 2K3IA 1L3KA 5L9NA 1ELOA 2QFJA 4Q2MA 1T05B 1R0AA 3AQOA 1PC5A 3CWJA 4DPTA 4QWAA 5EDWA 3SEOA 2EFGA 3JAMU 5KG6A 2DH7A 5F0UA 5DQHA 1ROFA 2DNKA 3H5UA 3TAMA 3ZFVA 3WQPA 5F3ZA 4CO3A 2R8KA 4R5PB 2H51B 3MD3A 1HLWA 1AUSL 4DV0F 4ITSA 5EWGA 4B3TJ 2DR5A 3FCWA 3VAMA 3KG4A 3IR6B 3MCSA 4ZITA 2O1PA 1NJWA 2YXLA 4CP5A 4OI3A 3EVOA 1ITPA 3D54A 3J81j 4O3PA 4J9MA 4H54A 3HLUA 1FNMA 3KK1A 4DQSA 4C8ZA 3L7UA 1I1GA 2JRSA 1G3OA 3DHXA 3M7VA 2OTJS 1BWEA 3HF5A 1SH3A 1KFSA 4JOUA 1VQNS 4P9SA 4E98A 2CPHA 1U6FA 5E3RA 2VFVA 2X1AA 4LQ9A 1X9SA 4V19X 4IRKA 2QSWA 1WEZA 4RNMA 3ENQA 4GKJJ 2AU0A 4BS2A 1NPRA 3US5A 3H2LA 4DL4A 2ZH5A 4U6PA 2BW7A 4IFYA 1ZZNA 2ZNYA 5FD1A 2JFDA 3MTKA 2XNRA 2G9OA 3MEDA 4WFZA 1LWFB 4RU9A 3V6HA 2OO4A 4Y00A 3BQ1A 3HT3A 2OPSA 1C1CB 5K5MA 4NXNJ 1YGYA 4BCAA 1C2PA 1X4EA 3IMQJ 4K4UA 2BXJA 1UP1A 1VK3A 4C3LA 1Y11A 2QLXA 2HZVA 3ZNJ1 3N6MA 2OIHA 4ZJOA 3WDOA 4A46A 1SXLA 2D3ZA 2BABA 3CJ2A 4CH1A 4MKAA 1G6BA 2CAJA 3TUPA 4OYWA 2FLPA 3KUEA 1NPKA 4X62J 4JI5F 3NP5A 4FF2A 4QR2A 3KMSA 2I8EA 4N77A 4RUCA 2R2RA 3D67A 4DJBA 3OL7A 4EUVA 3R27A 4K0KF 1TL7A 3I55S 4LUBA 2W1BA 4X4NA 4GVBB 5D77A 4Q8FA 3R1HA 3VCDA 3FSYA 2BVZA 2LFVA 2N7YA 1RU2A 1AA1B 3BSCA 1FDNA 2QLFB 4M5IA 5AJ3F 3C19A 3X3UA 3EJMA 3E01A 3VTIA 3CCES 1BC6A 1Q8BA 4IG0B 1E6YB 3EZ5A 2ZBRA 1GMVA 3IC1A 3I0SB 3PW5A 3W8PA 1MNEA 2DB1A 1CJKB 4E0DA 1UVLA 3TEGA 2J0SD 4LF9J 2AZ3A 3PYFA 5DGAA 4PEOA 1S4EA 1S76D 3FEXB 2HHHF 4RBTA 2V0NA 2FB0A 4NEYA 2V63A 3RB3A 1EP4B 2POKA 4FXWA 3MMCB 4TYAA 2UP1A 4D3GA 1SVDA 2PO4A 3R5DA 1S79A 1XWLA 4PYAA 2PA8D 2ZWPA 1DLOB 3HHLD 1JJ2R 1U48A 3DOMA 4OZ5A 4ILLA 5IQ6A 2MQOA 4HTJA 2IJNA 2VBZA 2FGOA 3MMAA 4JV5F 2WONA 3GIKA 2HZAA 1FD8A 1WHYA 4DLGA 2HVHA 3T41A 5DGBA 2O66A 3H59A 4CLTA 1LXJA 4QQBA 3DLEB 2UVUA 4O3SA 4A8YA 3CGIA 3QO9A 2AJ2A 2CJKA 4DOZA 2YKQA 1ZOTA 1F9FA 4NYPA 2XMAA 2XWYA 1TKTA 1WHXA 3J7ZT 1N0VC 1NK9A 3GCXP 3DRPB 3UE2A 5D0HA 5LM7E 3RAMA 1FDAA 5J2PA 4S0MA 2OFHX 2F3JA 3ZZTA 2C2RA 1R0CB 4DSLA 4KPYA 1QY7A 4JI3J 5GMKa 2DO4A 1U6ZA 4QYZJ 3EXYA 2HNDA 3TVYA 4NWBA 1GTEA 4CM2A 5HMXA 2UUTA 3OL8A 1AZSB 1UJ4A 3OR2B 3AOAA 5B0CA 1SQEA 3CCVS 2VG6A 5KFPA 5J2MA 4RUHA 4C8YA 1FRHA 3D0GE 2HBRB 4G1QB 1D9FA 4PG8A 4Z7YA 1M0SA 4O3OA 4WK1A 5J1EB 3D6TB 4MK8A 1HHSA 3QWUA 1UPPA 3BDEA 2KVIA 5MLCV 3BPSP 1ZS6A 1NSQA 1KBRA 2ZZNA 1JX4A 4DZ6A 3RU0A 2IIHA 1UWBA 4NYZA 1YSJA 4WWSA 2XMMA 1PJ7A 4DCPB 1NCLA 3AHPA 1UEKA 3QWPA 4NLWA 4CLLA 1V3RA 1VK8A 2EWHA 4O4GB 5F8GA 5ETKA 2IBOA 2H1YA 2ACMA 3R5JB 2OPRA 2ZWOA 2HZCA 1O6XA 3MEEB 3KHHA 3HHKA 3LO3A 3MCMA 4EBCA 5BJRA 2DY1A 2B9WA 2C2ZB 4Q5VA 5B08A 1FKAF 4N56A 2IC3A 3SSQA 4FVMA 4USTA 1QVGR 4ATNA
chains in the Genus database with same CATH topology
2G0JA 2G0IA 2IDLA 4PEOA 1S12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G0J A;  2G0I A;  2IDL A;  4PEO A;  1S12 A; 
#chains in the Genus database with same CATH topology
 3AJD A;  4DR1 F;  3B54 A;  2A6O A;  4DPX A;  3AD7 C;  3DYA B;  2HBY B;  5AE2 A;  5I4M A;  1BE4 A;  4BC7 A;  1OY9 A;  3HP6 A;  1XNQ J;  2LQ9 A;  4QIV A;  2OSR A;  1VQM S;  1SQG A;  3DOL B;  4ZCL A;  3NEK A;  5KFO A;  5CXT A;  4ZVP B;  4DPW A;  1HKA A;  4U9R A;  2VIH A;  1S57 A;  3OTC A;  4HTI A;  4PQA A;  1NKE A;  4HLB A;  1VOM A;  3FCH A;  1IBL F;  5FLX U;  2B6A A;  3NGU A;  2ZZT A;  4B9S A;  4KRW A;  4QIW D;  2CPX A;  3UDV A;  4RWW A;  3GMG A;  5DLF A;  2HRY A;  2RDI A;  3JS9 A;  3QGP A;  4TVA B;  4C8O A;  2BE2 A;  1JNR B;  3D0I E;  3N4W A;  1WNE A;  1N34 F;  3RR8 A;  2YNG B;  1JLE B;  2V2Z A;  1KOH A;  2ZUG A;  4C4W A;  1WSR A;  5K8P A;  3L4B C;  2LMI A;  4MKV A;  5D0G A;  4CDI A;  4WFN Q;  1RHK B;  2R7W A;  1RT5 A;  1X4A A;  4I7F A;  4NPO A;  5E5N A;  4JI2 J;  1C1B B;  5HLF A;  2VC1 A;  3HSZ A;  3Q86 A;  5JXS A;  4QIF A;  3I5C A;  3QZ8 A;  2HHV A;  3NBP A;  4W98 A;  4JI0 J;  1NDK A;  3TOQ A;  4X66 F;  4U67 Q;  3HJV A;  3IAS 9;  3CCJ S;  1RTJ A;  3BKT A;  5CYJ A;  2AF6 A;  2VKR A;  3BR8 A;  1UFL A;  1NJY A;  5ETP A;  1B0P A;  1F9E B;  2C2M B;  3RJM B;  5KT6 A;  3OQ2 A;  1BUX A;  3KYL A;  2MXY A;  4CH7 A;  1A0O B;  3GWC A;  1FXD A;  5AE3 A;  5KT2 A;  1K0T A;  3KNA A;  2FLL A;  3G6V A;  3MM5 A;  1Q86 T;  4GVL A;  1U2C A;  1VLY A;  3OLB A;  1X5S A;  4Q0B B;  4DBQ A;  4G65 A;  2DEI A;  2HHS A;  1G1X A;  1R43 A;  3HVT B;  4NLT A;  3GJQ B;  4J7C A;  1IQT A;  1H38 A;  2CPI A;  5H9F K;  4U8V A;  2Y0B B;  1FES A;  4ED6 A;  3OSP A;  1B0T A;  3CJ8 A;  3K59 A;  4ZA1 A;  4KGX B;  5E3Q A;  2C3O A;  2CPJ A;  2P9C A;  3J7Y U;  4Y2K A;  4DV6 J;  1RTD B;  1RU1 A;  2K3K A;  3BBB A;  1RAD B;  1IKY A;  4AND A;  3R6L B;  4I2P B;  3FJ2 A;  1RT2 A;  3IR5 B;  4K4Y A;  4P2S A;  5KFX A;  3FZB A;  4GO7 X;  3PXG a;  4ECW A;  3AOD A;  4ZP8 A;  5KT3 A;  2ZD1 B;  3SCJ E;  4LF7 F;  1W25 A;  3KXD A;  4FVC A;  1OO0 B;  1WDT A;  3CD5 A;  4LFA F;  2HW3 A;  5D8H B;  3DN9 A;  1SJR A;  4B9T A;  2D3O R;  1HBO B;  3V6D A;  2LEA A;  3M6X A;  4H4K C;  1J5O B;  2EKN A;  3CJK B;  3M8Y A;  2D7S A;  1Z2Z A;  2QO3 A;  1AT1 B;  1UPM B;  5JUM A;  5H9E K;  4EEY A;  3I9V 9;  4HL9 A;  2H54 B;  4ZHR A;  4RUB A;  4MT1 A;  1DAR A;  1U24 A;  2MKY A;  2N3O A;  3O2I A;  2PEB A;  1YJ7 A;  1ARO P;  4AE5 A;  5DQG A;  2VQF F;  3POT A;  4JI4 J;  3AT1 B;  1T11 A;  1F5C A;  4ZVE A;  5HAO A;  1S10 A;  2GQC A;  1RDR A;  4NXM J;  3IBF B;  1JLQ A;  1YIJ S;  1LKZ A;  1KKH A;  3QRP A;  1HNZ F;  2PFF B;  4C8L A;  1RWM B;  4ZOS A;  3G4S S;  3EPG A;  3KLG B;  3Q22 A;  4I6W A;  5HMZ A;  4NLR A;  4DR2 J;  1H72 C;  3JXO A;  3CJ3 A;  3F44 A;  4KY3 A;  1SKR A;  1JKH A;  5G0R B;  2D41 A;  2BAC A;  4DQQ A;  2R42 A;  2RIL A;  4KO0 B;  2B43 A;  4O3Q A;  1M5O C;  4A8W A;  3Q2S C;  2MQN A;  4NA3 A;  1NDC A;  3A3N B;  1ZPW X;  1JLF B;  1NEE A;  1U09 A;  2DKO B;  5J2N B;  3DU6 A;  2XI3 A;  5F8L A;  5CAA A;  1FEH A;  5F41 A;  1U2R A;  3D3C J;  1SI9 A;  4HH0 A;  1HD0 A;  4DMZ A;  1B99 A;  3DRS B;  2VD3 A;  4DV5 J;  2XZW A;  1MRO A;  2RH3 A;  1YRU A;  3QRR A;  2XSJ B;  3LP0 A;  2AMC B;  3Q8U A;  2BOA A;  2EXU A;  2BUN A;  4DV4 F;  1HQ2 A;  1QAI A;  1T9U A;  2P9E A;  3CME S;  3RTV A;  1U1Q A;  2ZJR Q;  2DD8 S;  3MM9 B;  5EX3 A;  3MEC B;  1T03 B;  3G6X A;  1FDD A;  4PG4 A;  4FYD A;  1IR1 A;  2HVZ A;  1J5O A;  4KR0 B;  1BWV A;  1RTI B;  1DJ0 A;  2RUS A;  2V50 A;  3P4U B;  2HVI A;  3MHY A;  2AJ1 A;  4ENO A;  2NXN A;  4N8N A;  1N54 B;  4MIW A;  4PPD A;  2HBZ B;  2WVD A;  3JSY A;  5GAD U;  4DSI A;  3MD1 A;  4FYV B;  5CZV A;  4F8R A;  4RW6 B;  1APS A;  3CCM S;  1N5Y A;  4CO5 A;  3CJQ A;  1UZH A;  1RA6 A;  3MR5 A;  2Q6C A;  3M2U A;  2WHO A;  2F8H A;  2IY5 B;  1KHW A;  4I4B A;  3IRX A;  4P7T A;  3BGR B;  4QWD A;  2V8D A;  3CCL S;  4AQY F;  3TZY A;  2I5J B;  3ILJ A;  2FHJ D;  2HK3 A;  2FJE B;  1JLG A;  4L76 A;  4FBT A;  3QJL A;  2HHW A;  2XB2 D;  3VF0 B;  2XI2 A;  5IT4 A;  2JEF A;  3W9J A;  4FS2 A;  5HK4 A;  2IAJ A;  2GQ2 A;  2DNO A;  2UVR A;  4IO9 Q;  1QE1 A;  1SV5 B;  1JLA A;  1FTC A;  3G82 B;  2B9X A;  2V4J B;  1VQ8 S;  2LYV A;  4FBU A;  3EZU A;  3H5Y A;  3T1A A;  3OTO F;  2HVD A;  2WTF A;  2X1F A;  1WF2 A;  5ETM A;  2L9N A;  2DGS A;  1RJJ A;  2Z8Q A;  2V5H G;  1S77 D;  2BJ8 A;  3K0J A;  3CIM A;  2YH0 A;  3OFE A;  1Y5I B;  5EHH A;  3TUZ C;  2XCA A;  1CQN A;  5FDL B;  4MKY A;  4ED2 A;  2ZE2 A;  2AYB A;  4CTA A;  4YB7 A;  2WSC C;  2MZT A;  1I5O B;  3C16 A;  3I82 A;  5CA5 A;  4O4R A;  5M2P A;  1YJW S;  5L46 A;  2CVI A;  3N6L A;  5DRK A;  1KVI A;  1I51 B;  4K4V A;  2IJF A;  3HHD A;  2L41 A;  3OFG A;  4WYL A;  4AL6 A;  5HSP A;  5KFA A;  2Z30 B;  5CYM A;  4DFK A;  3AQP A;  2MQ8 A;  5KFF A;  2JC1 A;  3V4I A;  1H74 A;  1KR4 A;  1NRK A;  1XMQ F;  1X4C A;  3DKD A;  4WKR A;  3TVZ A;  2VBX A;  3UDE A;  1X4H A;  2OD4 A;  2OHD A;  4OI0 A;  3CTR A;  2CQH A;  2RQK A;  1UFK A;  4L6V 3;  4DUT A;  2F65 A;  2L9W A;  4JYA J;  3J80 U;  3D0H E;  1R7I A;  1M1G A;  3I6P A;  4IQM A;  1RHR B;  1KRP A;  2JSX A;  2OAU A;  3NG8 A;  2MTL A;  5I3Q A;  3P96 A;  2HMI B;  2KTQ A;  1RE1 B;  2RIJ A;  4MKB A;  1HMV A;  3LPY A;  2W7O A;  1TK5 A;  3JSM A;  4OZJ A;  3QLH A;  1YTY A;  2MMY A;  4Y2C A;  5HVF A;  1TL3 B;  3ITH A;  5SZT A;  4LR9 A;  3R2D J;  4UUW A;  4I6A A;  1VBY A;  3MEG B;  4ZVF A;  4NCB A;  2KRR A;  4OHZ A;  3HZG A;  5IS2 A;  3FBC A;  4DUY J;  2DXE A;  1N56 A;  5L9X A;  2FHO B;  1PSD A;  3BGR A;  4DL5 A;  3QT7 A;  4JI6 F;  1FEE A;  4A8Q A;  1SIW B;  4NRU A;  5EWE A;  1B3T A;  4KC5 A;  1P9Y A;  2FC9 A;  5HP1 A;  1TK8 A;  2GJI A;  1C4C A;  3PW2 A;  1LWC A;  4WP3 A;  4NE9 C;  2V6A A;  2MLY A;  1IVZ A;  2FDN A;  2R7O A;  4DI6 A;  5HBM B;  1X5T A;  3CMQ A;  2NUH A;  2FZC B;  2C2N A;  3CT9 A;  3M6U A;  3C14 A;  4ZVR B;  4NCG A;  2GVD A;  3CCT A;  4OZL A;  2WVE A;  5CH7 B;  4J9V A;  2RQM A;  3Q8Q B;  5E41 A;  4N7T A;  4OYI A;  4LF2 A;  4Y65 A;  3NOC A;  2M7S A;  2E5I A;  5KFK A;  3U7J A;  5ETN A;  2RU9 A;  5A6P A;  1IQZ A;  1G4C A;  1UKU A;  2NSC A;  5HJX A;  2F4V F;  1BXN A;  4H4O B;  2PDA A;  1FWL A;  2UUA F;  3OTE A;  1S1U A;  4QJV A;  2WVB A;  2F4F A;  3EGW B;  4WFA Q;  2DPJ A;  2R7R A;  4WCE Q;  1VJQ A;  2CJY B;  2M70 A;  2R2U A;  4WYW A;  3TX0 A;  2ASY A;  4IH7 A;  1MN9 A;  2OPQ B;  4U7C A;  2ZZM A;  2V8V A;  5I3P A;  1BMQ B;  3PO5 A;  4RW4 A;  1ZM2 A;  2KG0 A;  4DV0 J;  3QSY B;  2OJ3 A;  3QT6 A;  4WU2 A;  2JOQ A;  3M32 A;  4CWB A;  3BH6 B;  4ZIV A;  2BA9 A;  2AZ1 A;  2KH9 A;  3D5M A;  1L3S A;  2VAS A;  1RP5 A;  2KHD A;  2Q79 A;  1X4G A;  2B51 A;  3JSB A;  1X31 C;  2KI2 A;  3H40 A;  2RRA A;  3K89 A;  3IGV A;  2ZNZ A;  2Y3Y A;  4QIG A;  2D3U A;  3C15 B;  3VAG A;  4P71 A;  3R1L A;  3UNG C;  1PKU A;  3IP0 A;  1CQM A;  3M8P A;  1FF2 A;  4J9R A;  2H5E A;  1TL5 A;  2DPI A;  1UEU A;  5CYQ B;  3U1M A;  4C0O C;  3BQ2 A;  4QPT A;  4QPX A;  2ZBQ A;  4PG5 A;  1D0E A;  2HGL A;  2XLI A;  1CG2 A;  2YKA A;  1YLX A;  5IV3 A;  4YR2 A;  2OTL S;  4FF1 A;  4JI7 F;  1Q7Y T;  2FJW A;  2Y9H A;  5I42 A;  3PYD A;  1BY9 A;  2B9Y A;  4P72 A;  1SB6 A;  2VBY A;  3WC2 A;  3M8W A;  1HIY A;  1N5S A;  3FEY B;  4U7U D;  3M05 A;  3Q89 A;  2PI4 A;  3V2U C;  3IG1 B;  2FJX A;  3H20 A;  2UUC F;  2EG1 A;  4ZPW R;  4K4Z A;  3KLV A;  2XYH B;  4UTG A;  1JB0 C;  3B78 A;  4RBU A;  1FXR A;  1PAE X;  1MWQ A;  2F1F A;  2B7B B;  4JI5 J;  4B9M A;  2K7J A;  1B4S A;  3R5A A;  1RAC B;  1RAA B;  5KFV A;  4K0K J;  1S99 A;  4ECV A;  1FE4 A;  1C4A A;  2IBK A;  4Q8E A;  2ABY A;  1L3V A;  3T1Y J;  2VOP A;  1IBK F;  5AJ3 J;  2DHS A;  2E29 A;  5T7L B;  3OXF A;  1LV5 A;  4FXD A;  1BLU A;  2ROE A;  5DM6 Q;  2XUL A;  2WVC A;  2E5L F;  1KLN A;  3IS9 B;  3OPK A;  1SUQ B;  4M5D A;  2RHQ B;  3SFG A;  3KK2 A;  5LOQ A;  1D8Y A;  2RD5 C;  3R5G A;  3BEG B;  3F41 A;  5D4O A;  4NYO A;  2EG2 A;  4J37 A;  2HHH J;  2UXD F;  1UJ6 A;  2R8H A;  4YDD B;  2CWX A;  1T8E A;  1I3O B;  3UN2 A;  3T3F A;  4LRE A;  4EZ9 A;  5IT9 Y;  4UUX A;  5U47 A;  4B9V A;  4B9N A;  4DV7 F;  3ZXW A;  3CIZ A;  4OI2 A;  4OQJ A;  3D1Q A;  4QWB A;  3HSJ A;  4JV5 J;  3KLH B;  1XK8 A;  1M5P C;  4KBI A;  5AXL A;  4IO1 A;  5J2Q B;  3GIL A;  4CCH A;  4ZLJ A;  4W4M A;  2IM3 A;  2Q66 A;  1SPB P;  4EFA C;  3G6E S;  3DLB A;  1VS3 A;  1SIZ A;  2BRL A;  4DR3 F;  4EO6 A;  3N6N A;  1KQG B;  2VG7 A;  3GV7 B;  4I68 A;  1ZAV A;  2GZO A;  2CQ4 A;  3ISN C;  4HR2 A;  1S1V B;  1WHW A;  1A9N B;  5E7O B;  2HLU A;  1YKW A;  2VV5 A;  5F8H A;  1FX4 A;  1Y0H A;  2B5J B;  2MKI A;  4HI1 A;  3L7O A;  2HS3 A;  2VKZ G;  4TU7 A;  4JV0 A;  3PJX A;  3MXH P;  3RBZ A;  3UPF A;  1LK7 A;  5A0Y B;  1VRU B;  3GFZ A;  3DMJ A;  3H42 A;  2IRY A;  3ISZ A;  4DG1 A;  2DGQ A;  2UUW A;  2L3M A;  4YY3 F;  4DV1 J;  4H4M B;  2F8M A;  2W2M P;  2YKM B;  5ADZ A;  3WIU A;  3GU0 A;  3NY0 A;  1RLC L;  3KLI B;  1PYT A;  4OHX A;  1GNK A;  3M2V B;  1DHM A;  3PX0 A;  1MU2 B;  5J1P A;  3R97 A;  1VYA A;  4A8F A;  2HYI B;  1XNR F;  1PG5 B;  4F7V A;  3K17 A;  4KV8 B;  4ZCK A;  5F9L A;  3A8E A;  4KT0 C;  2NUU G;  1XC9 A;  5T7L A;  2WSE C;  2RHS B;  2ZBP A;  2HFS A;  3NRB A;  1RTZ A;  3ZTR A;  4TNO A;  2HNZ B;  3LGN A;  1S72 S;  1P9Q C;  1VQL S;  2HHQ A;  2CXE A;  2OFG X;  3VGS A;  1K44 A;  2LU1 A;  3DLH A;  4DS4 A;  5I3U B;  1RGV A;  3K5L A;  2QIF A;  3BBF A;  2QN6 B;  2J0W A;  3GYN A;  2N82 B;  2KO1 A;  4NLX A;  4XK8 C;  1B7Y B;  3T9Z A;  2IVF B;  1VIO A;  1VQY A;  3QIP A;  5AT1 B;  2MZ1 A;  4UT4 A;  5K9F A;  1QAX A;  1B7F A;  4DV2 F;  2XMV A;  4L75 A;  2RKI A;  4DR1 J;  1F6T A;  3HHE A;  4IKA A;  1FER A;  4WXW A;  3PNI A;  3J7Y I;  1X8D A;  2QMX A;  3K8V A;  1RHU B;  3KK3 B;  4ES2 A;  4GC6 A;  2BJ1 A;  4ED1 A;  1LWX A;  2YNH A;  3M8Q A;  3M9O B;  2XBP A;  4HYK A;  3TZZ A;  3EX7 B;  4OYX A;  4O3N A;  5KG5 A;  3KKF A;  4WK3 A;  5A2Q U;  1VQK S;  3D4J A;  3VVU A;  1J5E J;  1SJ1 A;  3S1T A;  2ZOM A;  2MHE A;  1IN0 A;  2UXB F;  4M5N A;  1HQU B;  3JTN A;  2IYG A;  2VQE F;  3FBB A;  9ATC B;  3ZZP A;  1Y3K A;  5C25 B;  2CDQ A;  2RT3 A;  1HYS B;  2UV8 G;  1TV6 B;  3DNC A;  1RK8 A;  2RQ4 A;  2BQ3 A;  1N34 J;  3LAN A;  2CAD A;  2RVJ A;  1FO1 A;  4HHU A;  1RT1 A;  3B4M A;  4M5J A;  2E9T A;  3LWM A;  4L74 A;  4DR6 F;  3M6W A;  2KXH A;  1NJZ A;  1HW9 A;  3UR3 C;  5HRO A;  1IM6 A;  1N0U A;  1VI7 A;  4TU9 A;  2WW4 A;  3SSS A;  3MPD A;  1EET A;  3GCW P;  1RT6 A;  3AJ2 A;  2C3Y A;  2GHW A;  4X66 J;  4TY8 A;  4K4S A;  2JLG A;  2RDJ A;  3V6K A;  1C0T A;  3TAR A;  1XR5 A;  4QU6 A;  3NGT A;  1RT4 A;  3PJ9 A;  1LXN A;  3D6M B;  3QAU A;  1FNX H;  1HWK A;  3LH2 S;  5THW A;  3CDA A;  6FD1 A;  3BGF A;  2GFF A;  3ENW A;  1SKW A;  2W9B B;  2H9Z A;  3KHL A;  4GKK J;  1LEO A;  1WJ9 A;  2W7P A;  1NK4 A;  2JWN A;  2V2V A;  4J9N A;  1J2V A;  1IUJ A;  4EU0 A;  2G13 A;  2OKQ A;  3DLG B;  4UOG A;  5D4L A;  1U2F A;  3FNN A;  4ES3 A;  1VHI A;  1U7L A;  1RHM B;  1BQX A;  2UVW A;  3W65 A;  5T14 A;  4OZ3 A;  2FLN A;  4J9S A;  2J8A A;  1IKX B;  1WD6 A;  4M5M A;  3NS7 B;  1Q81 T;  1JXV A;  1TTH B;  2HSE B;  3FCV A;  1HWJ A;  5KFH A;  4L3K A;  2IM1 A;  2DNQ A;  3NMR A;  1CJU B;  2HHX A;  3PY8 A;  3CUN A;  3EE3 A;  2UUB F;  3EVM A;  3OJS A;  4MFB B;  2HK2 A;  1AXQ A;  4ZVU B;  2JZ5 A;  3PEJ A;  3GJR B;  4XTT A;  3THV A;  1ZET A;  3EZO A;  4CYU A;  4LF7 J;  2G2Y A;  3GII A;  2ZEJ A;  2FY1 A;  4LFA J;  1YX2 A;  2CPE A;  1FKO A;  1KWM A;  2E7W A;  3SMZ A;  2J6T A;  2CJA A;  3CC2 S;  4GC7 A;  3P45 B;  3QMQ A;  4LSL B;  1LFW A;  1HHT P;  2ADC A;  2XWX A;  1A7G E;  1H2V Z;  3OR1 B;  3HFK A;  2E66 A;  3SBM A;  3T1H F;  4HEA 9;  5GVQ A;  3QPI A;  1EAY C;  4WE1 A;  1I94 F;  4B9U A;  1HYS A;  1XR6 A;  3UVJ A;  4DQI A;  2BOP A;  3CPW R;  1RWP B;  4LFB J;  1N5V A;  2BZ2 A;  1QAY A;  4EZ6 A;  3JQM A;  2W01 A;  1MW7 A;  2Z4P A;  3HHL A;  3TEH B;  4YHH F;  2HQD A;  2WW8 A;  2QC3 A;  2CQB A;  2HS0 A;  5GAD I;  2CQG A;  4IG3 A;  5FLX Y;  2V67 A;  4HAC B;  1WAC A;  2YNF B;  3MMB A;  1ZBT A;  2J9C A;  3M1V A;  4N76 A;  4A48 A;  3T19 A;  3TAQ A;  2CPF A;  1RTH B;  2P2C B;  2VFS A;  1HNZ J;  1S6P B;  4ZP9 A;  2BAN B;  3AA8 A;  4EBE A;  2N4D A;  3KFW X;  3LP2 B;  1KS2 A;  3EVW A;  5DM7 Q;  4P73 A;  1C0U A;  4XDD A;  2APO A;  4JP8 A;  1DQA A;  5C5J A;  4IUF A;  4K4T A;  2F40 A;  1S6Q A;  1HNV A;  2GGP B;  4PUO A;  1IXK A;  3SDE B;  3A12 A;  3R5C A;  3IWL A;  4TY9 A;  4KAI A;  2KZM A;  5B0G A;  2GML A;  3V81 A;  3NNC A;  1SC1 B;  1S9E A;  2VUG A;  1ICE B;  3KLE B;  1CS4 B;  2CFX A;  4OYP A;  3K5M A;  3H0P A;  2I0X A;  2AIR B;  1KQK A;  3SQG B;  4ZJL A;  4OJH A;  1XQI A;  4ELU A;  1WWH A;  3PM9 A;  3JQJ A;  4ZPV R;  4J91 A;  2ATC B;  2AT1 B;  4AT1 B;  2R8J A;  4TXS A;  5LXY A;  4DFJ A;  1UVM A;  3GIJ A;  4YP3 A;  2E1M C;  2CQ0 A;  1B64 A;  1TK0 A;  3O3L A;  2K1R A;  4HT7 A;  3P49 B;  1CJV B;  5KG7 A;  1PCA A;  5E3A A;  3CO0 P;  1DTT A;  4USM A;  4CT8 A;  2HUR A;  2DIU A;  3QFH A;  5SUH A;  1FE0 A;  2ZM6 F;  3VAH A;  1U45 A;  1NXI A;  1W7W A;  1YZ7 A;  1FVS A;  3W62 A;  2AJF E;  2I1R A;  1PBA A;  4B3O A;  4Q44 A;  5L1I A;  4FYW B;  1QUV A;  1ZZF A;  3DGP B;  1EAR A;  4LFC F;  5DZ7 A;  4A8M P;  5G4D A;  1TU0 B;  1TAQ A;  1TKZ B;  4J90 A;  3GG0 A;  3GIM A;  4I6Y A;  1CPZ A;  1S1T B;  3I9Z A;  1RT7 A;  1ZAX A;  3PFE A;  2DRB A;  2EK1 A;  5GAH U;  3RBE A;  2R8I A;  5B09 A;  1QTN B;  2M9K A;  4KGM A;  2YY3 A;  1D9A A;  1GX5 A;  4OI4 A;  4YFU A;  4KSE B;  4OYA A;  3SCL E;  2NSB A;  2WOM B;  4DZD A;  4B3T F;  4OZ2 A;  4LF4 J;  2W25 A;  3ET6 B;  3CJ0 A;  4KKO B;  3EGN A;  1NPP A;  2K06 A;  3PW7 A;  4O23 A;  4YB6 A;  2R7U A;  4OZ0 A;  1TR0 A;  2M8D B;  5D3G B;  2UXC J;  2YX4 A;  4PWD B;  2MY8 A;  2IPO B;  1OIA A;  1KLM B;  2YWH A;  2A10 A;  2ERR A;  2R3V A;  1TUW A;  2QA1 A;  3W2W A;  4PWU A;  4DPY A;  1O0P A;  1KTQ A;  2K8G A;  3KDN A;  4DN0 A;  2GO8 A;  4Y28 C;  4C3K A;  5IM0 B;  1H98 A;  3DC2 A;  4CRJ A;  2HQC A;  3OTO J;  3MAA A;  2HKE A;  4ECY A;  4PQU B;  4KH0 B;  1BGX T;  2ZH2 A;  3ILL A;  5KT5 A;  4C11 A;  2IVY A;  3Q24 A;  4DL7 A;  1AW0 A;  3M6V A;  4OX6 A;  2UV8 A;  2RF2 B;  3BSN A;  4LF8 F;  3G8Q A;  3BKF A;  4ELV A;  4ZJQ A;  3TW0 A;  4IRD A;  3K57 A;  3CB4 A;  2AGQ A;  1Q8L A;  2AJ0 A;  3HSD A;  2DIS A;  3QID A;  3FBE A;  2IRX A;  2QLB B;  4OJ1 A;  3HFV A;  3KLF A;  5D0E A;  1HBN A;  4E8U A;  3DCA A;  4YR0 A;  1NK8 A;  1FJE B;  3SI8 A;  2D9P A;  1L3T A;  3N79 A;  2VA3 A;  3HZE A;  3OL6 A;  2IJR A;  1OQ3 A;  5H9F J;  2Q1L A;  1Q1K A;  1XMQ J;  5DS7 A;  1Q8I A;  2MZS A;  4PZV A;  4IRC A;  3SXL A;  1UVJ A;  2C42 A;  1MN7 A;  1ZAW A;  5A8R A;  1FNO A;  2C1E B;  2V69 A;  1ZM4 A;  3OTD A;  2VFR A;  1NM2 A;  4UQG A;  3MM8 A;  2ZVS A;  3KWM A;  1SC4 B;  1UEV A;  4OZN A;  2EC0 A;  2GAG C;  4DSE A;  2OSQ A;  4M5H A;  3NWG A;  1P27 B;  5DLG A;  1T3O A;  4ICL B;  3ZTO A;  4WBF A;  2BQU A;  1HBU B;  3VAL A;  4F4Z A;  1S1W A;  2OPP A;  1KOO A;  2DVI A;  2XQC A;  3SIP B;  2GS8 A;  1IKW A;  3HUL A;  2COL A;  3K8W A;  3PR4 A;  1SH0 A;  4ZPT R;  1S1X B;  1KHV A;  3MM7 A;  3TQ1 A;  4RW9 A;  3M30 B;  4X2B A;  2JFK A;  1NND A;  3NL0 A;  3QGI A;  3AB2 B;  4G3I A;  4JI6 J;  4F3O A;  3C6U B;  5H9E J;  4LBH A;  5C2G A;  3MM6 A;  4K50 A;  2ACY A;  2F63 A;  1K1Q A;  5CZX A;  4RLE A;  4OX9 F;  1Q5Y A;  4P2X A;  1VRT A;  1HI0 P;  1KP6 A;  2CZV C;  2R7T A;  4DWI A;  3LTO A;  3JTO A;  1Y10 A;  1RHJ B;  3RRH A;  2CVE A;  3UDL A;  2GC8 A;  2HNY B;  1REG X;  3QSI A;  2P6S A;  1HNI B;  2Y1I A;  2ZKU A;  5L1L A;  3CDB A;  4WFY A;  5CCL A;  4RWX A;  1NDL A;  2N3L A;  5B0A A;  2V68 A;  4NZ6 A;  3OVS A;  1YBU A;  1CJT B;  2KT2 A;  5IT9 U;  4HH1 A;  2Y1L B;  1WTF A;  3TA1 A;  3LP1 A;  4FKY A;  3MR3 A;  3ETM A;  4EYI B;  1TVR A;  2DR7 A;  3PEH A;  1GK8 A;  1TKX A;  2F4V J;  2H5I B;  3P5B P;  3CDU A;  1S6O A;  2PI5 A;  2LA6 A;  1T9V A;  2UUA J;  5K14 B;  2ALZ A;  3D3B J;  3ZZY A;  2XM3 A;  1LOU A;  2BJ7 A;  1M5H A;  2SXL A;  3RG6 A;  4BBY A;  3P6Y C;  4PWW A;  3JYT B;  2HWI A;  4HHH A;  2XZT B;  4F4Y A;  1BQN A;  3ZZR A;  4LSZ B;  3HVR A;  3DRR B;  4M5K A;  4USK A;  4OYB A;  4LQ3 A;  4RW7 A;  2VPW B;  4FPR A;  2EI5 A;  5CHC B;  1BQM B;  3DDN A;  1UZD A;  3CJ4 A;  4B3M J;  3B8H A;  2MQP A;  2W9C A;  3CW2 C;  3GON A;  2MPU A;  3NOG A;  3ZC4 A;  3U02 A;  3C6T B;  3W2V B;  4O44 B;  1MWZ A;  3BKU A;  4DF8 A;  1WC3 A;  1HQE B;  3FSX A;  3B4D A;  2JHE A;  1YVF A;  2DIV A;  3GP9 A;  5KFW A;  3PW0 A;  2CQ1 A;  1Z4U A;  4CO1 A;  4OV1 A;  4RW8 B;  4EYH B;  4WZQ A;  3QT8 A;  1ZTT A;  2NYH A;  3KJQ B;  3QZ7 A;  2ALY B;  2GMH A;  3BGO P;  3I0R B;  2E1C A;  2VIC A;  3OUY B;  3HK2 A;  3E51 A;  2MLZ A;  5B0B A;  1O51 A;  2JEG A;  2H65 B;  4M63 A;  2GO9 A;  3J80 Y;  2V94 A;  2HRT A;  4ZP7 A;  1S9G B;  3Q8V A;  2KXF A;  2CQD A;  2EFN A;  5DZ6 A;  2A0F B;  4X64 F;  1UVN A;  1VBZ A;  2KG1 A;  2QLJ B;  1NKB A;  3PRV A;  1GX6 A;  4KH1 B;  1F1B B;  2JNJ A;  2GJF A;  2N4C A;  4TLR A;  3TVK A;  2CNO B;  3DI6 A;  3KJV A;  3TUJ C;  4JI7 J;  1JJ4 A;  3W63 A;  3BGL A;  3N5B A;  5A8W A;  2KT3 A;  4IH5 A;  4PAB A;  4UZB A;  3M8S A;  2PN6 A;  4E2F B;  4DQP A;  1I6J A;  2YKN B;  1T05 A;  5K8O A;  4OFZ A;  1HNI A;  3HD1 A;  2OEK A;  2GX8 A;  2AEF A;  2M88 A;  4J5O A;  5D4N A;  2I9S A;  3RGI A;  3TZX A;  1AFI A;  1NJX A;  1WC6 A;  2W4P A;  4DQR A;  1LW0 B;  5IV4 A;  2UUC J;  4ZVG A;  1JWW A;  3OFH A;  4R5P A;  3BO4 A;  4NI2 B;  3THT A;  1XEZ A;  1GEH A;  2WSF C;  1SC3 B;  4QW8 A;  4F4X A;  4HDG A;  2V2Q A;  2XG8 A;  4F4K A;  4DR7 F;  2R7V A;  2FHJ A;  3WX8 A;  4FF4 A;  3R6G B;  1XBW A;  3WC0 A;  3TAN A;  4KGV B;  2AYM A;  3DDK A;  3AAW B;  4B3S F;  1IBK J;  2MGZ B;  1YJU A;  2YNI B;  4PCQ A;  2YX1 A;  1U1N A;  2CZ4 A;  2GQQ A;  3IAM 9;  3R7B B;  1HBM B;  2KYX A;  4DXL A;  2AJ4 A;  4RNN A;  2LDI A;  1QAJ A;  4JI2 F;  3BPD A;  4NOH A;  3B82 A;  2CQP A;  1U26 A;  4IFV B;  3FRY A;  4RZR A;  4DUZ F;  3D7S B;  3BSO A;  3H4B A;  5JVH Q;  3MCN A;  2DHX A;  4NZ7 A;  5H1S V;  2UXD J;  4QCL A;  2VDI A;  1F9H A;  1PIE A;  2KVQ E;  1CVJ A;  4I2Q B;  3TO8 A;  3CCR S;  4X4Q A;  3DRX A;  3KHG A;  3GE9 A;  3MAQ A;  1X60 A;  4C2M A;  2X1G A;  4G1P A;  1Q79 A;  1AYE A;  2N7C A;  2MDA A;  2RUG A;  3ZTP A;  2DIT A;  2ZH9 A;  1U0S A;  1U47 A;  4HHJ A;  3K58 A;  1VQ4 S;  2OGU A;  1LWF A;  3CD7 A;  5KOX A;  3ZZ0 A;  1FWK A;  4LVO P;  1FK9 B;  4R8U B;  4UY8 T;  1FFW B;  2FVP A;  4P75 A;  1LW2 B;  1C1C A;  1E6V B;  1UCN A;  4AXJ A;  3M2R B;  4MIB A;  4ES1 A;  2J9D E;  3FC9 A;  4R0J A;  3Q8S B;  3C2P A;  4DR3 J;  2NQP A;  1CEZ A;  2M8H A;  1REV B;  2MQQ A;  3MR6 A;  4N8O A;  3RBX A;  1M1K T;  4WU3 A;  4DL2 A;  1SL2 A;  2R7X A;  4KFB B;  3AD8 C;  1GMW D;  2RE1 A;  1VLO A;  4GVB A;  1RYS A;  2VFT A;  3ONQ A;  3H25 A;  4OIX A;  3MMJ A;  3W1Y C;  4NML A;  3CC7 S;  4A8K A;  4J9O A;  3GV8 B;  1YI2 S;  3EXC X;  2DCU B;  2XO7 A;  1Z2L A;  4IG0 A;  1E6Y A;  2W2N P;  4YY3 J;  4I1T A;  5D0R A;  1FRX A;  3I0S A;  4C3M A;  3QAE A;  3FFI B;  1UW4 A;  2CUY A;  4FPI A;  1H73 A;  4IQX A;  3TQE A;  3CJR A;  1CJK A;  2XMJ A;  2GV1 A;  2HEK A;  5EWF A;  2OLW A;  1YIT S;  4IDK B;  5C42 B;  2EEY A;  2GIF A;  1WEL A;  2NYI A;  3R7S B;  2FHK A;  4FS1 A;  1JLB B;  3H2U B;  3AXM A;  1S7I A;  5CD4 A;  1XNR J;  1EP4 A;  2RB7 A;  2YKP A;  3MMC A;  1ULR A;  3K5P A;  2EKY A;  3HO1 A;  1DLO A;  3G9C A;  4PRF A;  1RLD A;  3VGU A;  2O01 C;  4ZVS B;  5C7P A;  3SCK E;  4C7Q A;  1RSC A;  1X4F A;  2QRR A;  3H7H B;  4KPC A;  1HNW F;  3UW1 A;  1NHV A;  2ZOF A;  3CCW A;  4X4S A;  5HO4 A;  2QGF B;  3DLK B;  4NXM F;  4OV6 A;  4NLY A;  4J9L A;  2MZJ A;  4W92 B;  1DUR A;  3DOK B;  4EWT A;  4LSN B;  3ENV A;  3DLE A;  2Q43 A;  1IKV B;  2EW9 A;  3Q83 A;  3K7R A;  1NK7 A;  1RT3 B;  4ZS6 A;  4X84 A;  3ZZZ A;  1YDL A;  2CPZ A;  2J7K A;  2ZBI A;  3A4T A;  3I87 A;  5K8N A;  3FZ2 A;  1TL1 B;  1LWE B;  1JLC B;  5L1J A;  3MPV A;  2IDE A;  1VMB A;  5KG4 A;  1GMU A;  3DRP A;  2A2D A;  1NH7 A;  4M95 A;  4JI1 F;  2QMW A;  3L3C A;  4WPA A;  2GJ2 A;  3H4D A;  1FKP B;  1NBE B;  2OI2 A;  1S0N A;  2KM8 C;  2GVZ B;  4UW2 A;  2Z0G A;  2ZHO A;  3VV2 B;  2YQ1 A;  4YDX A;  4WFX A;  4QR0 A;  3MUM P;  4XDC A;  2MHN A;  2VG5 B;  4K4W A;  2UXB J;  1MWY A;  4LJM A;  3Q2T C;  2B56 A;  1AZS A;  3QAT A;  3OR2 A;  2VQE J;  2FYX A;  4Y6I A;  4DV5 F;  5JMN A;  2CNK B;  4RUA A;  3W5Y A;  3TJA A;  2C2E A;  3D6H B;  4QR1 A;  1VBK A;  4G1Q A;  3BYP A;  3LOU A;  3DM2 B;  1FJ7 A;  2QTW A;  5J1E A;  1RWW B;  5ETV A;  1F5B A;  5E0O A;  4K7Q A;  4P2F A;  3UD4 P;  3SZ2 A;  2QJ3 A;  3Q8Y A;  1U02 A;  2HAF A;  4CNZ A;  3D1H A;  3WBZ A;  1CC8 A;  2RSQ A;  3OXG A;  4O4G A;  2DEJ A;  1TUV A;  3GJS B;  5A8K B;  3KJN B;  5KG3 A;  5C24 B;  1YWX A;  4WFB Q;  3FSI A;  5B0F A;  3MEE A;  4QWC A;  1LK5 A;  3UD5 A;  3I56 S;  3MUR P;  5LSL A;  4HDH A;  2XHC A;  1WG5 A;  3MFI A;  3M8Z A;  2H5J B;  2VC0 A;  4RPF A;  2EBE A;  2V8P A;  2MST A;  4KHR A;  2DRA A;  4TLQ A;  2XGP A;  3DYA A;  4Z7C A;  1FFS B;  5K8M A;  5HAN A;  3H5S A;  3EGZ A;  5ETR A;  2IM2 A;  3DOL A;  2PMW A;  2PSZ A;  3VVT A;  3MI7 X;  2MQL A;  5ETT A;  3O5T B;  1FT8 A;  4AYB D;  1S7H A;  1SKS A;  1DAX A;  1N6Q B;  2QV6 A;  2FTR A;  4RJV A;  4UOC A;  2ZHA A;  5KG2 A;  1IM4 A;  2LQ8 A;  2Z56 B;  2HS4 A;  2DNN A;  5MAO A;  2B7C B;  4U95 A;  1CUL B;  4CIO A;  1WKK A;  2QL9 B;  1U4B A;  5BYS A;  2QA4 S;  2PII A;  2KDO A;  3UO0 A;  4DR5 F;  2UUB J;  3QJP A;  3R2C J;  2J7U A;  2Z2M A;  2YNG A;  1JLE A;  2YWF A;  4ZPC A;  2X3G A;  2YH1 A;  1J27 A;  3D9B A;  4F50 A;  3H8Y A;  3LF0 A;  3ZTQ A;  4ALZ A;  4WIQ A;  4C9D A;  4FYY B;  2ROP A;  2J5A A;  3KJF B;  2K2P A;  1HFE L;  2E1P A;  1YHQ S;  2RRB A;  4G6V B;  5KFM A;  2ZDO A;  4G1I A;  1BD6 A;  1YG0 A;  2CJX B;  1V3Z A;  1P6T A;  1C1B A;  1ZTW A;  3HHN B;  3PCO B;  2YTC A;  4I69 A;  1Q4R A;  4BWJ A;  4K4X A;  1SBR A;  4MAK A;  1NO8 A;  3T1H J;  3X1L B;  4USJ C;  4DFM A;  1I94 J;  1R0A B;  1HNX J;  4ZPA A;  4DS5 A;  3F0N A;  4EK2 A;  1UA0 A;  4YHH J;  2C28 A;  4I56 A;  2ASJ A;  3TAM B;  3RUB L;  5A2Q Y;  4AFF A;  3HVA A;  3MZI A;  3PKM A;  2ZDP A;  1YJ9 S;  1WG4 A;  3H90 A;  4Q0B A;  5HI7 A;  2C3P A;  5GAH I;  1WUU A;  3GPA A;  4JYA F;  1RAG B;  4ZLN A;  4IR9 A;  3HVT A;  2NCK L;  1EJ7 L;  2R2T A;  5J1N A;  3A8I A;  2IRU A;  3NMA A;  2QX0 A;  3G6Y A;  3RRK A;  2LCW A;  2JEJ A;  5KFZ A;  1WI6 A;  4JV1 A;  1NLK L;  2XY5 A;  3KK1 B;  3EDQ B;  1RTD A;  3C46 A;  3BYR A;  4UQT A;  1EIY B;  4I2P A;  1Q0N A;  2MJN A;  4ECZ A;  4HT5 A;  4ER8 A;  4C8K A;  5E3P A;  2DK2 A;  3BRE A;  5KG0 A;  1Q53 A;  2XGQ A;  2DBB A;  1FX2 A;  1EQM A;  4C0B A;  2YQ3 A;  2IYI A;  1D9D A;  2O67 A;  4RKU C;  2ZD1 A;  2ZH1 A;  1ZH5 A;  5IC4 B;  4IFY B;  1WI8 A;  3PW4 A;  2ASL A;  2J0X A;  4USH A;  1R0B G;  1IBC B;  2HLT A;  3MED B;  2QFI A;  1HBO A;  3KG0 A;  5HJY A;  3GSI A;  1OPZ A;  3OSN A;  3R5B A;  4U8Y A;  3GYX B;  4ZK7 M;  5LJ3 Y;  2IA0 A;  1GFW B;  4YN3 B;  3CJK A;  4ZN1 A;  4MIA A;  1KEK A;  2A2C A;  3OVB A;  2HIQ A;  2HHU A;  2OPS B;  3L95 X;  1F5A A;  2E7V A;  1W2B R;  1F3V A;  3AH6 A;  4CO4 A;  1RWX B;  2GA7 A;  3HT0 A;  5K20 B;  1NU4 A;  4J9Q A;  2LLZ A;  3TP2 A;  4KHP J;  3RR7 A;  2AHO B;  3D28 A;  1N33 J;  2FJB B;  2G0J A;  3K2Y A;  2CQ3 A;  1FRJ A;  3DXS X;  4F4W A;  2FPH X;  3D68 A;  1RHQ B;  1IWA A;  3KUH A;  1KQS R;  1S59 A;  1IJF B;  4JUZ A;  3CDW A;  1RAB B;  1TL7 B;  3M9M B;  4UZC A;  2OH2 A;  1K1S A;  5L1K A;  3CVK A;  3CED A;  2VFU A;  2XEX A;  3KLG A;  4LFC J;  3C8Y A;  2AD9 A;  5KFN A;  1QSS A;  4DL3 A;  3E01 B;  2MKS A;  2ZUA A;  2BBE A;  2KRB A;  5DJB A;  1FTR A;  4LF6 J;  4O0I A;  2CG8 A;  4NCA A;  2ZC3 A;  5GME A;  5G0R A;  1QVF R;  3RB6 A;  2BKN A;  1RKI A;  4KO0 A;  5GAE U;  2HVE A;  3CCU S;  1S0V A;  3VAI A;  4YB1 P;  1JLF A;  3HXM A;  2D3O 1;  1HWU A;  3QGG A;  2MSS A;  1WOO A;  5J2N A;  3NGK A;  3PR5 B;  3E2E A;  1O5J A;  2I2Y A;  1SCJ B;  3ELH A;  3DOM B;  2RJZ A;  3DRS A;  4ETX A;  3D2W A;  1UL3 A;  1RAI B;  3MMA B;  1HPZ B;  2ATL A;  1Q7L B;  2WON B;  1OQ6 A;  2XSJ A;  4XPC A;  5KFB A;  2KB2 A;  2BRK A;  4XO0 A;  1GQE A;  2BJD A;  1SJQ A;  2KFN A;  4ID8 A;  2XS7 A;  1HHQ A;  4CZC A;  4MH8 A;  3MM9 A;  3QO9 B;  5M2R A;  1TUG B;  2BV3 A;  4I64 A;  4DX5 A;  2FY8 A;  3MEC A;  1RAH B;  2WB1 D;  1T03 A;  4LF8 J;  3MF5 A;  2YPY A;  1TKT B;  1SKU B;  4A47 A;  3BBC A;  4CI0 B;  5LJ5 Y;  1RTI A;  3KDO A;  3HX9 A;  1T9X A;  2UZA A;  4RO0 A;  2HBQ B;  5J2P B;  4UOF A;  1RB0 A;  1PIL A;  4LIW A;  2GMJ A;  2H4Y B;  3JSR A;  4AXI A;  3R8Y A;  3CCQ S;  2DGO A;  3L7P A;  2HND B;  3HKZ D;  2DNY A;  2WK4 A;  4RW6 A;  3VAJ A;  2DNM A;  2VOO A;  2YX7 A;  4M8L A;  4K2X A;  4RNH A;  2A6M A;  2VPY B;  3ISN D;  3QYY A;  3MUV P;  3UDC A;  3NCR A;  4QYR A;  3W3S A;  4ID5 B;  2VG6 B;  5J2M B;  3HPO A;  4JBC A;  1S4F A;  2D74 B;  3O6Q A;  2X3D A;  1JMT A;  4B3R J;  1H6K X;  2I5J A;  2KT5 A;  2EFP A;  3T1Y F;  1KVK A;  2CQ2 A;  3J7A N;  2CYY A;  1IR2 A;  3TJ8 A;  1FRL A;  1UWB B;  4NZ0 A;  3G71 S;  3PIP Q;  4CT9 A;  3ENA A;  2NR0 A;  2Z58 B;  2QA2 A;  2V9W A;  1F2G A;  2IMO A;  2XHW A;  2ZH8 A;  5LMU F;  4NLV A;  1SV5 A;  2D9O A;  4F2S A;  1R3N A;  1R8C A;  3G82 A;  5ETO A;  1UET A;  2OPR B;  2V4J A;  2KFY A;  2P6T A;  3V4M A;  3OV7 A;  1NHK L;  3ZTS A;  5L8R C;  2NS1 B;  4K5S A;  2Z2Y B;  2IC3 B;  1H7X A;  3DGV A;  2LP4 A;  1T9Y A;  4OX9 J;  3HJF A;  5FDL A;  3OVA A;  2H48 B;  3B6B A;  2J8S A;  3RZA A;  3DXB A;  4NX9 A;  1FDB A;  2C2K B;  1HPZ A;  1RI7 A;  2PMH A;  3OHB A;  1S0O A;  1X0F A;  3QFW A;  1WOP A;  2CQC A;  2BR0 A;  5DDR C;  3VGV A;  1XMO F;  4TKT A;  4ECU A;  5BR8 F;  1Q8K A;  4RBV A;  2CQI A;  2B6A B;  1VQP S;  1RA7 A;  2BYC A;  4ZKA A;  4RL1 A;  3RAX A;  3EYZ A;  3RW6 A;  1YRX A;  1DTQ B;  5F0W A;  2BE2 B;  2BDP A;  5KFU A;  1RWN B;  8RUC A;  3AB4 B;  1M90 T;  3NNH A;  5GAG U;  1D8Z A;  6FDR A;  4USV A;  2R2S A;  2HMI A;  4C98 A;  2GIR A;  1UWA A;  5DDO C;  2W9A A;  2RS2 A;  4LR8 A;  3HCX A;  2LKZ A;  2CWK A;  1H2U X;  1RT5 B;  1VR6 A;  2HQG A;  4I7F B;  3HMJ G;  1WSV A;  3OW2 R;  1TL3 A;  2CJ9 A;  1F2H A;  3H5X A;  3PKY A;  4DV1 F;  5HLF B;  3T6B A;  4ID5 A;  3MEG A;  3NBP B;  1K9M T;  1U6B A;  2H4W B;  3D6F B;  3PVX A;  5IWA F;  2E44 A;  1RTJ B;  4L73 A;  2HGN A;  1S5Z A;  2DXD A;  3BF4 A;  1UW9 A;  2K7K A;  3NAI A;  3N01 A;  3PO4 A;  1Q16 B;  2DNG A;  5E3C A;  3MM5 B;  4USU A;  3BH7 B;  4C8N A;  3CDE A;  5HBM A;  4USI A;  2E5H A;  1S49 A;  2PT0 A;  3MCO A;  2OD6 A;  1V5I B;  2VOD A;  1CBK A;  2PC6 A;  3RB0 A;  2XMU A;  1FWP A;  3DU5 A;  2W2P P;  3DRY A;  4X64 J;  1OS5 A;  3NKY A;  3CSK A;  4PYD A;  2VF3 A;  5F8M A;  4FKX A;  4K2J A;  5L38 A;  3BN7 A;  2NPI A;  1TQL A;  1IKY B;  2LQ5 A;  2C2D A;  2LVW A;  2JEI A;  4CM0 A;  2Q3P A;  1OMS A;  1RT2 B;  2XMT A;  1MSW D;  3PIO Q;  4H4O A;  1XJW B;  2KU7 A;  1M5V C;  1DFD A;  1ZM3 A;  4FDF A;  2MQM A;  5DQI A;  1UTA A;  4CLF A;  1RIS A;  9RUB A;  3OL9 A;  4ANE A;  1GXT A;  2L9D A;  4Q2L A;  2PE8 A;  4LF5 F;  3KUG A;  2AEM A;  3VAF A;  3CXC R;  1R8H A;  1YRT A;  4A8O A;  1J5E F;  1HAR A;  1DQ9 A;  2OPQ A;  4KYZ A;  2O3D A;  4LT6 A;  1D1U A;  4ZIW A;  3V6D B;  4HI2 A;  4L3N A;  4F67 A;  2HHP A;  2F7V A;  4DR7 J;  5HN0 A;  1DTQ A;  4OI1 A;  2AWZ A;  2RDD A;  3EGV A;  4ZDN A;  3MAH A;  1NB7 A;  3H98 A;  3IM8 A;  1VC5 A;  3UN3 A;  4B3S J;  2VJV A;  2RRN A;  4ZHR B;  2FJV A;  2FJA B;  4PXE A;  4OI6 A;  3ILI A;  1N32 F;  2R7Q A;  3FRZ A;  3BSA A;  3AJ1 A;  3POT B;  2RNE A;  3BS9 A;  2E1A A;  1HR0 F;  1QJH A;  3C15 A;  1YZ6 A;  4ECS A;  2R4F A;  3U1L A;  1GXL A;  1Z1Z A;  2V34 A;  3BZQ A;  2AYG A;  3I32 A;  4TQS A;  1LQ9 A;  4DUZ J;  5FJ4 A;  4PAA A;  1DBD A;  1JLQ B;  2IFX A;  4DV3 F;  1S0M A;  4OZ1 A;  1JIH A;  5CYQ A;  2ZHB A;  2JX2 A;  1XER A;  5CAB A;  2RU3 A;  3UFC X;  2YWW A;  4Y2A A;  3TR5 A;  4ZVT B;  3FQK A;  4GKK F;  1JKH B;  1GH8 A;  2B9E A;  4TN2 A;  5LMN F;  4BC9 A;  1RAE B;  3W9I A;  3C66 A;  1VBX A;  4X65 F;  3PAC A;  1Y00 A;  4KGK A;  3VAK A;  2HWH A;  3IXQ A;  2JH3 A;  2HFV A;  1KD1 T;  4FF3 A;  4DR4 F;  3OHA A;  3W5X A;  5HQM A;  4QBU A;  4M94 A;  1NSA A;  3VHQ A;  3DHW C;  3T5K A;  3BN4 A;  3IG1 A;  4ZLL A;  3K5N A;  1VJW A;  3CC4 S;  1U1K A;  2H3E B;  4NLU A;  3S8S A;  2W2Q P;  3PG9 A;  2A18 A;  2IMW P;  1MRO B;  3WHI A;  2G2O A;  1PJ5 A;  4CH0 S;  2Z2L A;  5DO2 A;  3LP0 B;  3LQV A;  3MDF A;  3FQL A;  1WC1 A;  2KM8 B;  4ZPD A;  4NLG A;  2DXF A;  3FK4 A;  3PRB A;  1GAO A;  3O44 A;  2C2O B;  3MOZ A;  5EX0 A;  2CKW A;  5L39 A;  2EBG A;  3LA0 A;  2BW2 A;  4IYQ A;  2WZ1 A;  3HHL C;  5M2U A;  2FC8 A;  1EZZ B;  2M5Y A;  1KON A;  2YWK A;  3N0V A;  2XZD B;  1OSD A;  2Z2Z A;  1U49 A;  3IS9 A;  3UQS A;  3W7B A;  1SUQ A;  2W4C A;  4OLO A;  1KFD A;  2MJU A;  3WX4 A;  1WF0 A;  1W2I A;  2NRE A;  2DCL A;  4DDF A;  1T9T A;  2WCX A;  4IR1 A;  4LFB F;  1H7W A;  4DL0 C;  2VPZ B;  4A4J A;  4ILR A;  3V6J A;  2FVR A;  3KHR A;  2U2F A;  4CQ1 A;  4RU2 A;  1EX8 A;  3EUN A;  1N5Y B;  4YS2 A;  2WVF A;  4ECT A;  1EQ0 A;  3IWX A;  2HHT A;  2MLX A;  2W2O P;  5D4P A;  3UCZ P;  1RUS A;  2PGC A;  2FVS A;  4DPU A;  1X5P A;  3HVW A;  1U1O A;  1HNW J;  1OYE A;  3M2U B;  3O1L A;  3TZW A;  3KLH A;  2KXN B;  3OTB A;  1SJ4 P;  3IRX B;  2DNZ A;  2J76 E;  4CO0 A;  2I38 A;  5J2Q A;  2PD1 A;  3TX8 A;  4PPZ A;  2HFZ A;  4DPO A;  4NLS A;  2YWE A;  1JLG B;  4V19 J;  2PMZ D;  3MPU B;  4ED3 A;  1IBL J;  2FJD B;  4ECQ A;  1S1V A;  1T94 A;  1UVK A;  2IAJ B;  2UU9 F;  2KKH A;  2DT9 A;  1QE1 B;  2QE5 A;  2HPU A;  1JLA B;  3WIV A;  2B5J A;  2NZ4 A;  3IN5 A;  4CNY A;  1HI1 A;  4A8S A;  2VJU A;  3EMT A;  4JI1 J;  3S7R A;  3RW7 A;  5A0Y A;  1PO6 A;  3CJS A;  1VRU A;  2Z57 B;  3CMA S;  2ZKT A;  4RR5 A;  2I6W A;  2NXC A;  2BE9 B;  2NXJ A;  5F8I A;  4H4M A;  1A6L A;  2ZE2 B;  4CTA B;  5F8J A;  2YKM A;  3CCZ A;  1M5K C;  3C16 B;  1Q78 A;  4DCO B;  3KLI A;  1F0X A;  3M2V A;  1MU2 A;  4AL7 A;  3ULH A;  4WII A;  4M5G A;  1Y5L B;  2LXU A;  3PDN A;  5CYM B;  1V3S A;  3BO3 A;  4KV8 A;  3V4I B;  4F36 A;  2AX1 A;  1YJN S;  3MR2 A;  3J81 U;  3FEZ A;  1TKD A;  1DRZ A;  3RB4 A;  1RQ0 A;  1FJG F;  1IBM F;  3GR0 A;  5KT7 A;  2OEL A;  1M1H A;  2HNZ A;  3QBC A;  3G86 A;  1SL0 A;  3HM9 A;  3DLL Q;  4NA1 A;  4P6Q A;  4MYU A;  1F3F A;  5I3U A;  3NNA A;  1P1T A;  4LBI A;  2QT7 A;  1N36 F;  4QZV B;  5KFR A;  2BQR A;  3CNQ P;  2NXE A;  3OFF A;  4LR7 A;  3CF5 Q;  1KDN A;  1XR7 A;  4ECR A;  4CLY A;  3GSD A;  3BDP A;  1HMV B;  3JSM B;  3BJY A;  1RBO B;  3R7N B;  5EGY A;  3QLH B;  4ZN3 A;  4DSJ A;  1U1L A;  3W8G A;  2KN4 A;  3ITH B;  1UJ5 A;  3IA0 A;  3NLC A;  4WZM A;  4J9P A;  3NGD A;  3PHT A;  2B3T B;  2V2K A;  1QTM A;  3KK3 A;  4LRB A;  2ADB A;  2YWG A;  4ZP6 A;  1WKL A;  4A8X A;  4LF4 F;  1KQF B;  3A1Y G;  1XTZ A;  3P5T L;  4XPE A;  1OWX A;  3AY0 A;  3A8K A;  2VBW A;  2V8H A;  3IRW P;  2KHC A;  5DET A;  4WP9 A;  3W60 A;  2DGW A;  4ZCI A;  4EMD A;  5HMY A;  2UXC F;  2JJ4 D;  1KC8 T;  2RAQ A;  3IR7 B;  4ED8 A;  5HP1 B;  4ECX A;  5EUH A;  1LWC B;  1SH2 A;  3MTJ A;  3PX4 A;  2DRD A;  2V4Q A;  3VR1 A;  4PR6 A;  1TMJ A;  3ICL A;  1HQU A;  1HWI A;  4OJ3 A;  1D3W A;  1TFY A;  1PYS B;  4C8M A;  1U0H B;  4DR5 J;  5C25 A;  3FDS A;  1B70 B;  3GG1 A;  1TV6 A;  3C14 B;  1NSK L;  4U96 A;  4NCG B;  4WTY A;  4C0H A;  5CCM A;  2GVD B;  4UF4 A;  5A76 A;  4YOE A;  4K8R A;  3NXZ A;  1T95 A;  2G0C A;  2BJE A;  2HQ3 A;  4Y2M A;  1DZ5 A;  3AOC A;  4H4K A;  2VQF J;  1RCX B;  4AL5 A;  5T41 A;  2LDY A;  1SQF A;  2R9L A;  3UI3 A;  4WP8 A;  5DDQ C;  3OXL A;  4RNF A;  4K59 A;  2BJ3 A;  3GR1 A;  4QIE A;  2CPY A;  1Q5V A;  1S1U B;  1S9F A;  3T6J A;  1H0H B;  4EI2 A;  4CLK A;  1EB0 A;  1ACM B;  1W26 A;  4LRC A;  1RCO B;  3IM9 A;  2AGO A;  1P1L A;  2MKJ A;  2W9B A;  4DSF A;  1VQS A;  3IWN C;  1XMB A;  1QUP A;  1ZA1 B;  3A3O B;  3MPW A;  4TU8 A;  1X7V A;  1Y9O A;  4RW4 B;  2X7I A;  5A6W A;  3ETO A;  2ZOG A;  3DLG A;  2E9Z A;  2ZJP Q;  3D66 A;  3M32 B;  3RAQ A;  4WKY A;  5GAE I;  4QYZ K;  1RAF B;  2X51 A;  1IKX A;  1N48 A;  3PJW A;  4OHY A;  4QU7 A;  5KFL A;  4IOC Q;  4F3Q A;  2MKK A;  3P3D A;  2A1B A;  1L3U A;  2XLK A;  2DGT A;  4W90 B;  3PFO A;  2ILY A;  5KFT A;  1GMW A;  1U1M A;  1CJU A;  3FBF A;  1NUE A;  2RML A;  3UR0 A;  4X4U A;  3NCQ A;  3VZI A;  1RZM A;  3PV8 A;  1NZA A;  3LGH A;  4OHV A;  5KTQ A;  2B0G A;  4KE5 A;  3NS5 A;  4MFB A;  3M8P B;  4HKQ A;  1WC4 A;  1ZM9 A;  4F2R A;  4DV4 J;  3PYE A;  3EIC A;  1K8A T;  2HWT A;  4Y0F A;  1R6Y A;  4DX7 A;  4LRD A;  1QM9 A;  5IT0 A;  1R31 A;  4F3M A;  1S6U A;  3JTP A;  4DX8 H;  2JVO A;  4JI8 F;  4LSL A;  4BLG A;  1H3D A;  3GIR A;  5I42 B;  2F5G A;  2FQQ B;  1T9W A;  2P5V A;  3OR1 A;  2DYA A;  1U0H A;  3G8S A;  1G2E A;  3DLJ A;  2MYF A;  1X0P A;  2LXF A;  4X4P A;  2CJQ A;  1GXU A;  3NCP A;  2VU5 A;  4ERD A;  2FVC A;  4F26 A;  5KOW A;  3AA9 A;  3CO9 A;  4QWE A;  4QOT A;  5CQG A;  4MJK A;  5ITH A;  2J6U A;  4YME A;  2J9D A;  1VQ9 S;  4ZCM A;  4AUK A;  2EPI A;  1VCT A;  1RAO A;  2GHP A;  4HAC A;  1WHV A;  2YNF A;  4MK7 A;  2FLO A;  3KOA A;  4P10 A;  1YK9 A;  2E9R X;  2R7S A;  3G2X A;  1RTH A;  4GMK A;  2MKC A;  2LEB A;  1AB8 A;  1HWL A;  3VQS A;  2ZIT A;  1S6P A;  4AQY J;  2BAN A;  5AE1 A;  1VFJ A;  3CJ5 A;  4J9K A;  3LP2 A;  2VB6 A;  3VWS A;  3UCG A;  1UAW A;  3GV5 B;  1RWV B;  2VPX B;  5KFS A;  2GGP A;  4M5D B;  3SDE A;  2OMO A;  1TP7 A;  1OYD A;  4B3M F;  3KK2 B;  2DY9 A;  2RQC A;  5F3T A;  1V6H A;  2ZH7 A;  1B0V A;  2GAH C;  2P9G A;  4URQ U;  1T7P A;  2V8G A;  2VON A;  1D09 B;  3MGJ A;  1BHN A;  2XYP B;  3KLE A;  4GKJ F;  4D3H A;  2HAI A;  1CS4 A;  3SSR A;  1S48 A;  3ILO A;  1T0T V;  4YR3 A;  2CA9 A;  5D78 A;  1VC6 A;  2X1B A;  3PTW A;  3SQG A;  3OT9 A;  2JC0 A;  2DR6 A;  1RBA A;  1VIS A;  1JXE A;  1PBU A;  1ZPV A;  2G0I A;  4C48 A;  4Q45 A;  1TEL A;  1UFW A;  4U7U K;  1AFJ A;  3EM1 A;  5KT4 A;  1WDD A;  4NAS A;  4R0E A;  2QG9 B;  4NXN F;  1CJV A;  5F8N A;  1WC0 A;  3W5Z A;  1TL4 A;  2QEX S;  3EDR B;  2VG7 B;  1VQ5 S;  3HDS A;  5HQL A;  2DH8 A;  2KZZ A;  1KNZ A;  3S6E A;  2AKW B;  2MKH A;  2GNK A;  5LSO A;  4N47 A;  1WC5 A;  2FHM A;  4PKD B;  1SJ3 P;  3T5J A;  5JJB A;  4YEA A;  2B4V A;  2VL1 A;  4X62 F;  2JDJ A;  2J6S A;  5LL6 d;  2AW0 A;  2QA4 G;  2YVS A;  3FGV A;  3CD0 A;  3BM7 A;  5DG7 A;  3BB5 A;  2W24 A;  1FD2 A;  4DF4 A;  4OX8 A;  1JQG A;  1CSJ A;  1ZYQ A;  2MEW A;  3DGP A;  1XIQ A;  2VZ9 A;  3DMJ B;  2M4M A;  3DDI A;  4Y34 A;  5KFQ A;  5GAG I;  4DG1 B;  5IOL A;  3MOJ B;  1TKZ A;  4C6A A;  1NHU A;  1S1T A;  2NPF A;  1PJ6 A;  2DGU A;  2F9J A;  3BQ0 A;  3L09 A;  1FHT A;  1OPI A;  2G2Z A;  3JQK A;  1X9W A;  4QW9 A;  4LF9 F;  2WOM A;  4PG7 A;  2HGM A;  3KTQ A;  3ET6 A;  2VDH A;  4KKO A;  1WG1 A;  3NGR A;  2AYE A;  2DHA A;  5F9N A;  2DNL A;  2MY7 A;  3CUL A;  2IVM A;  3NWR A;  3G87 A;  1YBT A;  5D3G A;  3VGT A;  4PWD A;  3N5F A;  1KLM A;  5KFC A;  3SQO P;  1FFG B;  4FP9 A;  1N8R T;  3SV3 A;  3I31 A;  1K73 T;  4BHQ A;  3F56 A;  1RAJ A;  2BJ9 A;  4OYO A;  2AX0 A;  5LMU J;  2E5J A;  1FCA A;  5AXM A;  3AFG A;  3IGN A;  2AQ4 A;  2CPD A;  3C3L A;  4X4R A;  2DNP A;  5IM0 A;  1URN A;  1R89 A;  5JVG Q;  2LU2 A;  1IJE B;  2L08 A;  1DY3 A;  3M9N B;  4DLE A;  3JAM Y;  4PQU A;  1VC0 A;  4F4A A;  3QIP B;  1GTH A;  1KVJ A;  2EVZ A;  1FVQ A;  4OLP A;  2RKI B;  2DH9 A;  1KTV A;  2RF2 A;  3F73 A;  3H2V E;  5KFD A;  1OSC A;  4NRT A;  2LXI A;  4ZVQ B;  1RXO B;  2DGV A;  1PC4 A;  2XC9 A;  2YNH B;  3M8Q B;  2WBM A;  4FXV A;  2E7X A;  4JI3 F;  1R8B A;  1XMO J;  5E2Q A;  1WF1 A;  2XTJ P;  1Y3J A;  4KHM A;  2ZH6 A;  5BR8 J;  1X4B A;  1WEX A;  5KFE A;  2AJQ A;  2D69 A;  3I4H X;  2QYC A;  4UOH A;  2M0G B;  2UVV A;  3GTY X;  4FYX B;  4DSK A;  2OP5 A;  3PRD A;  1RBL A;  4OJG A;  5HQ8 A;  3EWG A;  3GLJ A;  4CLP A;  5RUB A;  2C3M A;  2LA4 A;  3HFZ B;  4R25 A;  1Q95 G;  5DG9 A;  2VHG A;  4RNO A;  1NJI T;  1RT1 B;  1N5Q A;  4FZV A;  4NLO A;  4ICL A;  4LF1 A;  4I67 A;  5KFG A;  1HBU A;  4KTQ A;  3UWT A;  2OEM A;  4IOB A;  3R3T A;  4F0H A;  1HW8 A;  2YPZ A;  3A13 A;  4AD6 A;  5HRO B;  1IR0 A;  1VQO S;  3FUY A;  2ROG A;  1S1X A;  1UVI A;  1HA1 A;  5D15 A;  1EET B;  1VHF A;  3M30 A;  3MR7 A;  1RT6 B;  4B17 A;  5E33 A;  5ETL A;  4TY8 B;  2ZH3 A;  2ZH4 A;  3I5B A;  5IWA J;  2ZBC A;  3QRQ A;  1C0T B;  3J7A 1;  1RT4 B;  2BX6 A;  1U1R A;  1EKS A;  1NZ8 A;  3C6U A;  2IM0 A;  5IXU A;  2XMW A;  2ZVI A;  3T9N A;  2XLJ A;  3AD9 C;  4JV2 A;  2PEH A;  2WAQ D;  3E8O A;  2KYZ A;  2DHG A;  4PXD A;  4ANC A;  2GIQ A;  1U1P A;  1XNQ F;  1CLF A;  4NA2 A;  1SC6 A;  2HNY A;  4WF9 Q;  4ED7 A;  3PZP A;  1S97 A;  4BDP A;  2DGX A;  3IO1 A;  4B02 A;  5LSR A;  1X4D A;  1HD1 A;  1NSP A;  2CRL A;  3GFY A;  2M3D A;  1UA1 A;  4OL8 A;  1QLN A;  3GZ7 A;  4B08 A;  3TWZ A;  5B7W A;  1N52 B;  3TI0 A;  1CJT A;  3W61 A;  3I5A A;  4KGZ B;  4WXO A;  5HMW A;  4ZLP A;  4MK9 A;  3Q8P B;  1VDH A;  5K14 A;  4N5S A;  2LQB A;  4ED5 A;  3AOB A;  4NLD A;  4V1A k;  2XCP A;  4CYU B;  4DFP A;  4CLW A;  1JJH A;  3JYT A;  1TFW A;  1QSL A;  1N4L A;  2BMB A;  1EKR A;  4LF5 J;  1JNZ B;  3JB9 k;  1QDU B;  3V5R A;  3GFX A;  4TQR A;  1FKO B;  3NS6 A;  3DRR A;  1FI4 A;  3I96 A;  2E5L J;  2ZFH A;  3TJ9 A;  2XY7 A;  2B4O A;  1BQM A;  2IA6 A;  2BM1 A;  3UN5 A;  2DO0 A;  4PXB A;  1K0V A;  2HFN A;  1T3N A;  3C6T A;  5D6G A;  3W2V A;  4WE1 B;  4CLU A;  5ETS A;  4O44 A;  4JI0 F;  3PX6 A;  3UVJ B;  1HQE A;  4OMF G;  1URR A;  3GFH A;  1S12 A;  3U27 A;  2NLW A;  3I4P A;  2LEP A;  3HHL B;  2W8L A;  2C3U A;  2BEF A;  2ZC4 A;  4DX6 A;  4RW8 A;  1YJV A;  2Q6B A;  3NAH A;  1N32 J;  4IG3 B;  4F04 B;  5LT5 A;  3GYG A;  3I0R A;  4DV7 J;  1HR0 J;  3MMB B;  3OUY A;  2BE7 D;  2J7W A;  3M1V B;  3QNW B;  2VH7 A;  3A3P B;  1MMN A;  1OY6 A;  4LRF A;  1S9G A;  4DV3 J;  1XN9 A;  5DG8 A;  1JJC B;  3KG1 A;  4LVN P;  3HSG A;  2FIU A;  1QSY A;  1H2T Z;  3N9U C;  4PXC A;  2DR8 A;  2J9E A;  3ZO7 A;  1C0U B;  3TNV A;  3MWB A;  3N28 A;  4DV6 F;  5ETQ A;  2FVQ A;  1MMD A;  1TAU A;  7FD1 A;  5LMN J;  1NDP A;  1S6Q B;  1HNV B;  4PUO B;  4GO5 X;  3W9H A;  3CE8 A;  1O8B A;  4X65 J;  2CNN B;  1LNQ A;  2U1A A;  2AGP A;  3V81 B;  4MTP A;  1NH8 A;  2LEC A;  1U8W A;  1S9E B;  1V9O A;  5BXI A;  2YKN A;  3PYG A;  4EGL A;  2B4U A;  4DU7 A;  1X9M A;  5LXR A;  4DR4 J;  4NL5 A;  2XY6 A;  3LUY A;  2PA3 A;  4YUD A;  4P74 A;  4RX6 A;  1TMM A;  2PFD A;  1LW0 A;  1KN6 A;  1VRQ C;  4NI2 A;  4EBD A;  4ZMM A;  3VQT A;  4DEZ A;  4I0W A;  2EK6 A;  3GB0 A;  2XS5 A;  3FMB A;  1OJ4 A;  3T5H A;  3IBW A;  4DHV A;  2AV5 A;  2ASD A;  2K1R B;  2MZR A;  4Z2X A;  2GHV C;  1DTT B;  3FKB A;  5KFI A;  2MGZ A;  2YNI A;  1NME B;  2W8K A;  1T02 A;  4Q43 A;  3P8B B;  4ED4 A;  7FDR A;  1HBM A;  2EFO A;  3O8W A;  4JI4 F;  2Y8Y A;  2QSF A;  3LGM A;  3BR9 A;  5IZH A;  4IFV A;  2NZC A;  4OYZ A;  1FRI A;  4X4T A;  2WRM A;  2CJB A;  4WTO B;  3T5L A;  4DN9 A;  3U1N A;  1HNX F;  4CO2 A;  4KJI A;  4B3O B;  2W4D A;  3ZZO A;  4KQZ A;  2DR9 A;  4I2Q A;  2LQJ A;  1L5U A;  1YJR A;  2EC2 A;  4X4V A;  4DV2 J;  2XO6 A;  4DR2 F;  2BKP A;  3LPE A;  1RT7 B;  6AT1 B;  2B8Q A;  1NK5 A;  2W7A A;  4URS A;  1VQ7 S;  1PGZ A;  2FZG B;  2J0Q D;  2EFV A;  3TUI C;  1PAU B;  2CDR B;  2ILZ A;  2HFU A;  4ILM A;  3THP A;  3R9L A;  1FK9 A;  2P8I A;  4R8U A;  3Q0A A;  4DU8 A;  3LW5 C;  2HQF A;  1LW2 A;  4ZPB A;  2Y0S D;  2AEJ A;  5FII A;  1AUD A;  2M2B A;  4F0M A;  1E6V A;  2BM0 A;  3M2R A;  3RBD A;  2AP6 A;  5BYQ A;  2V4R A;  3Q23 A;  3RRG A;  4TYB A;  4ZVO B;  4EO8 A;  1REV A;  3DFE A;  3J7Z 5;  3G8T A;  1N88 A;  2GCF A;  3A8J A;  3LAL A;  2VA2 A;  5GMD A;  2XYG B;  3W2W B;  2CNL B;  2HFO A;  2KJV A;  2CG4 A;  4UY8 5;  4DCJ B;  8AT1 B;  1RKJ A;  4IOA Q;  2B8P A;  2FGC A;  1Y4Z B;  2JVR A;  2UU9 J;  4OYM A;  2DNH A;  4OHW A;  4MYT A;  4KFB A;  2QMU B;  4HVZ A;  3FVY A;  2YQ0 A;  4Y2I A;  1FRM A;  2C22 A;  2CZ9 A;  2DHH A;  3HI9 A;  3UCU P;  3L9Z A;  2L48 A;  4NMX A;  1WTB A;  2Y1J A;  3MAA B;  1WEY A;  3SYZ A;  2G4B A;  5HVG A;  3M4X A;  2F8E X;  4C11 B;  3EPI A;  4IH6 A;  4F02 A;  1FA0 A;  5AXN A;  3SV4 A;  2FZK B;  1R8A A;  4DR6 J;  2IDL A;  1MLA A;  3FFI A;  5HAT A;  4Z37 A;  4KIA A;  1IWG A;  2G1H A;  2HG4 A;  3KMQ A;  3GQC A;  5IFM A;  1JXL A;  4IDK A;  5C42 A;  2A3J A;  3OD2 A;  3TAP A;  1JLB A;  3KLF B;  4K5R A;  1FXL A;  1HBN B;  1K47 A;  2WBR A;  4LRA A;  1RWO B;  2QL7 B;  2OUG A;  4C97 A;  3OBI A;  4Y3C A;  2KJW A;  2B4P A;  5CD4 H;  1SJF A;  3VZH A;  3MPY A;  4KB7 A;  4KHP F;  5AXK A;  1N33 F;  5HL7 Q;  1FJG J;  1FRK A;  2QZ8 A;  1IBM J;  2HQI A;  1SL1 A;  1MG7 A;  5KG1 A;  5A8R B;  2FD2 A;  4ELT A;  3LWL A;  4X4O A;  1NAQ A;  4YQW A;  3ZZU A;  2ZJQ Q;  3MM8 B;  3CD6 S;  4NEZ A;  3DLK A;  3ZNU A;  2XNQ A;  3UD3 P;  5IQQ A;  1N36 J;  4FN5 A;  2KL8 A;  3DOK A;  4JB8 B;  4LSN A;  3OLA A;  4FNH A;  1RWU A;  5C2C A;  1YBA A;  1IKV A;  3D1O A;  3RYL A;  3BO2 A;  1RT3 A;  1S1W B;  4LF6 F;  2OPP B;  3MUT P;  1FJC A;  4XAK A;  5KFJ A;  4USW A;  4P52 A;  1IKW B;  2G1D A;  1TL1 A;  1LWE A;  2DTJ A;  2XMK A;  4FNI A;  1JLC A;  1X5O A;  3E3X A;  3MM7 B;  4L72 B;  3SFU A;  4RW9 B;  3IFE A;  4WJB A;  2DNR A;  1R8P A;  5B0D A;  1EHW A;  3KNG A;  1FKP A;  4ZVH A;  4B9L A;  1WKJ A;  1RWK B;  2GVZ A;  1NK0 A;  3WZ0 A;  1TZ0 A;  1ZA2 B;  2YKO A;  1VGY A;  3MM6 B;  4F0K A;  1DQ8 A;  2RS8 A;  2VG5 A;  1UMJ A;  1VIX A;  1VRT B;  4OX7 A;  1QD1 A;  1YQH A;  4ED0 A;  2R8G A;  3NGS A;  4NLQ A;  3W66 A;  1M5S A;  3QJJ A;  1N5T A;  4F25 A;  2XSF A;  2JL9 A;  2YBV A;  1KSP A;  2O5D A;  2E1R A;  1P8G A;  3HD2 A;  3DM2 A;  4GRS A;  1LFP A;  4CLZ A;  2MZQ A;  3BGU A;  4NLP A;  4M1K A;  1G7C B;  3CJT A;  3LP1 B;  3UNY A;  1F60 B;  3TYT A;  2F9D A;  4CLS A;  1TVR B;  3GJT B;  2OML A;  5EN1 A;  1TKX B;  2D1C A;  1MML A;  4Q7A A;  2V9K A;  2WB4 A;  5A8K A;  4O3R A;  2JLE A;  1NB2 A;  5C24 A;  3K5O A;  3HKW A;  1NK6 A;  3SCI E;  1HL6 A;  3MEK A;  4XIU A;  3MFH A;  1BQN B;  4P7V A;  5KAK A;  1VQ6 S;  4MMO A;  4RW7 B;  3G96 A;  2E5G A;  3PHE A;  3M8R A;  2HIY A;  1NKC A;  4LMZ A;  2W9C B;  3QQC D;  5KFY A;  3AXK A;  2JLF A;  4ETZ A;  4M5L A;  2KFZ A;  1Q82 T;  4URG A;  4O0N A;  2GW8 A;  1U8S A;  3IBC B;  4DUY F;  1WOS A;  1WOR A;  1V5V A;  2QYG A;  4B3R F;  1HI8 A;  5BYR A;  3BV8 A;  2XS2 A;  3Q8R B;  1N6Q A;  1PYO B;  1R27 B;  2QL5 B;  8ATC B;  3S01 A;  3J81 Y;  3LAK A;  3TA0 A;  3TA2 A;  1CUL A;  3LAM A;  2M52 A;  3QT5 A;  4BWM A;  1CC7 A;  2EFQ A;  1YJT A;  3TRG A;  7AT1 B;  4PG6 A;  2OEJ A;  3QGH A;  2DJW A;  4J9U E;  2CIM A;  5B0E A;  1GT8 A;  4LIR A;  5DDP C;  1OY8 A;  1R6V A;  2Y8W A;  5HVH A;  1JK9 B;  3OJU A;  4DL6 A;  1Y7P A;  2ZM6 J;  3DI6 B;  4YB5 A;  3FMW A;  3KJV B;  2QLW A;  2NXU A;  3CCS S;  1Y5N B;  2IHR 1;  2BKO A;  4P2M A;  4N41 A;  2Y1R I;  4JI8 J;  3W64 A;  5A8W B;  5IC6 B;  2HRU A;  4LBP A;  1U25 A;  1RYR A;  2MB0 B;  3ADA C;  2FUG 9;  2K3I A;  1L3K A;  5L9N A;  1ELO A;  2QFJ A;  4Q2M A;  1T05 B;  1R0A A;  3AQO A;  1PC5 A;  3CWJ A;  4DPT A;  4QWA A;  5EDW A;  3SEO A;  2EFG A;  3JAM U;  5KG6 A;  2DH7 A;  5F0U A;  5DQH A;  1ROF A;  2DNK A;  3H5U A;  3TAM A;  3ZFV A;  3WQP A;  5F3Z A;  4CO3 A;  2R8K A;  4R5P B;  2H51 B;  3MD3 A;  1HLW A;  1AUS L;  4DV0 F;  4ITS A;  5EWG A;  4B3T J;  2DR5 A;  3FCW A;  3VAM A;  3KG4 A;  3IR6 B;  3MCS A;  4ZIT A;  2O1P A;  1NJW A;  2YXL A;  4CP5 A;  4OI3 A;  3EVO A;  1ITP A;  3D54 A;  3J81 j;  4O3P A;  4J9M A;  4H54 A;  3HLU A;  1FNM A;  3KK1 A;  4DQS A;  4C8Z A;  3L7U A;  1I1G A;  2JRS A;  1G3O A;  3DHX A;  3M7V A;  2OTJ S;  1BWE A;  3HF5 A;  1SH3 A;  1KFS A;  4JOU A;  1VQN S;  4P9S A;  4E98 A;  2CPH A;  1U6F A;  5E3R A;  2VFV A;  2X1A A;  4LQ9 A;  1X9S A;  4V19 X;  4IRK A;  2QSW A;  1WEZ A;  4RNM A;  3ENQ A;  4GKJ J;  2AU0 A;  4BS2 A;  1NPR A;  3US5 A;  3H2L A;  4DL4 A;  2ZH5 A;  4U6P A;  2BW7 A;  4IFY A;  1ZZN A;  2ZNY A;  5FD1 A;  2JFD A;  3MTK A;  2XNR A;  2G9O A;  3MED A;  4WFZ A;  1LWF B;  4RU9 A;  3V6H A;  2OO4 A;  4Y00 A;  3BQ1 A;  3HT3 A;  2OPS A;  1C1C B;  5K5M A;  4NXN J;  1YGY A;  4BCA A;  1C2P A;  1X4E A;  3IMQ J;  4K4U A;  2BXJ A;  1UP1 A;  1VK3 A;  4C3L A;  1Y11 A;  2QLX A;  2HZV A;  3ZNJ 1;  3N6M A;  2OIH A;  4ZJO A;  3WDO A;  4A46 A;  1SXL A;  2D3Z A;  2BAB A;  3CJ2 A;  4CH1 A;  4MKA A;  1G6B A;  2CAJ A;  3TUP A;  4OYW A;  2FLP A;  3KUE A;  1NPK A;  4X62 J;  4JI5 F;  3NP5 A;  4FF2 A;  4QR2 A;  3KMS A;  2I8E A;  4N77 A;  4RUC A;  2R2R A;  3D67 A;  4DJB A;  3OL7 A;  4EUV A;  3R27 A;  4K0K F;  1TL7 A;  3I55 S;  4LUB A;  2W1B A;  4X4N A;  4GVB B;  5D77 A;  4Q8F A;  3R1H A;  3VCD A;  3FSY A;  2BVZ A;  2LFV A;  2N7Y A;  1RU2 A;  1AA1 B;  3BSC A;  1FDN A;  2QLF B;  4M5I A;  5AJ3 F;  3C19 A;  3X3U A;  3EJM A;  3E01 A;  3VTI A;  3CCE S;  1BC6 A;  1Q8B A;  4IG0 B;  1E6Y B;  3EZ5 A;  2ZBR A;  1GMV A;  3IC1 A;  3I0S B;  3PW5 A;  3W8P A;  1MNE A;  2DB1 A;  1CJK B;  4E0D A;  1UVL A;  3TEG A;  2J0S D;  4LF9 J;  2AZ3 A;  3PYF A;  5DGA A;  4PEO A;  1S4E A;  1S76 D;  3FEX B;  2HHH F;  4RBT A;  2V0N A;  2FB0 A;  4NEY A;  2V63 A;  3RB3 A;  1EP4 B;  2POK A;  4FXW A;  3MMC B;  4TYA A;  2UP1 A;  4D3G A;  1SVD A;  2PO4 A;  3R5D A;  1S79 A;  1XWL A;  4PYA A;  2PA8 D;  2ZWP A;  1DLO B;  3HHL D;  1JJ2 R;  1U48 A;  3DOM A;  4OZ5 A;  4ILL A;  5IQ6 A;  2MQO A;  4HTJ A;  2IJN A;  2VBZ A;  2FGO A;  3MMA A;  4JV5 F;  2WON A;  3GIK A;  2HZA A;  1FD8 A;  1WHY A;  4DLG A;  2HVH A;  3T41 A;  5DGB A;  2O66 A;  3H59 A;  4CLT A;  1LXJ A;  4QQB A;  3DLE B;  2UVU A;  4O3S A;  4A8Y A;  3CGI A;  3QO9 A;  2AJ2 A;  2CJK A;  4DOZ A;  2YKQ A;  1ZOT A;  1F9F A;  4NYP A;  2XMA A;  2XWY A;  1TKT A;  1WHX A;  3J7Z T;  1N0V C;  1NK9 A;  3GCX P;  3DRP B;  3UE2 A;  5D0H A;  5LM7 E;  3RAM A;  1FDA A;  5J2P A;  4S0M A;  2OFH X;  2F3J A;  3ZZT A;  2C2R A;  1R0C B;  4DSL A;  4KPY A;  1QY7 A;  4JI3 J;  5GMK a;  2DO4 A;  1U6Z A;  4QYZ J;  3EXY A;  2HND A;  3TVY A;  4NWB A;  1GTE A;  4CM2 A;  5HMX A;  2UUT A;  3OL8 A;  1AZS B;  1UJ4 A;  3OR2 B;  3AOA A;  5B0C A;  1SQE A;  3CCV S;  2VG6 A;  5KFP A;  5J2M A;  4RUH A;  4C8Y A;  1FRH A;  3D0G E;  2HBR B;  4G1Q B;  1D9F A;  4PG8 A;  4Z7Y A;  1M0S A;  4O3O A;  4WK1 A;  5J1E B;  3D6T B;  4MK8 A;  1HHS A;  3QWU A;  1UPP A;  3BDE A;  2KVI A;  5MLC V;  3BPS P;  1ZS6 A;  1NSQ A;  1KBR A;  2ZZN A;  1JX4 A;  4DZ6 A;  3RU0 A;  2IIH A;  1UWB A;  4NYZ A;  1YSJ A;  4WWS A;  2XMM A;  1PJ7 A;  4DCP B;  1NCL A;  3AHP A;  1UEK A;  3QWP A;  4NLW A;  4CLL A;  1V3R A;  1VK8 A;  2EWH A;  4O4G B;  5F8G A;  5ETK A;  2IBO A;  2H1Y A;  2ACM A;  3R5J B;  2OPR A;  2ZWO A;  2HZC A;  1O6X A;  3MEE B;  3KHH A;  3HHK A;  3LO3 A;  3MCM A;  4EBC A;  5BJR A;  2DY1 A;  2B9W A;  2C2Z B;  4Q5V A;  5B08 A;  1FKA F;  4N56 A;  2IC3 A;  3SSQ A;  4FVM A;  4UST A;  1QVG R;  4ATN A; 
#chains in the Genus database with same CATH homology
 2G0J A;  2G0I A;  2IDL A;  4PEO A;  1S12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...