1S12A

Crystal structure of tm1457
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
MIKVTVTNSFFEVTGHAPDKTLCASVSLLTQHVANFLKAEKKAKIKKESGYLKVKFEELENCEVKVLAAMVRSLKELEQKFPSQIRVEVIDNGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TM1457 from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein TM1457
total genus 30
structure length 94
sequence length 94
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04327 Peptidase_Prp Cysteine protease Prp
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1490 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Cysteine protease Prp 1s12A00
2G0IA 4PEOA 2G0JA 2IDLA 1S12A
chains in the Genus database with same CATH superfamily
4ZVHA 3GYNA 4O3OA 4F4AA 2LYVA 4WU3A 4RUCA 1S1TA 2FHKA 3DLGB 4RJVA 3RUBL 3PJWA 2EG1A 1U49A 4ERDA 4PRFA 3GYGA 5CYQB 1K44A 1T94A 4DSFA 1S1WB 2IA0A 4DUYF 1M5KC 1B7YB 4OYWA 1JKHA 3HJFA 3JSMA 1DBDA 4NYPA 1RT1B 2V69A 3RTVA 2PD1A 3GJTB 2MY7A 3L09A 3C16B 4KY3A 3WIVA 4ED4A 4WTOB 5L8RC 2ROEA 3NOGA 2DO4A 1N33J 1JNRB 3JAMU 5AJ3J 1YZ6A 2DNNA 3H5YA 2VQEJ 4KC5A 2W25A 3FCWA 1RYSA 4NLGA 3T9NA 1IBMF 2WK4A 3T5LA 1S6QB 5KFQA 1JK9B 2VD3A 2CNLB 4F7VA 4A48A 2XEXA 4CZCA 3OLAA 2D3OR 3RBXA 4HH0A 3R7BB 1KLMB 1S4FA 2YWFA 3I5AA 3G8SA 5KFNA 4YHHJ 1DTTB 1HHTP 2YQ1A 2HHPA 2UZAA 4NLPA 2R2SA 1XN9A 2I8EA 1X4GA 4J9PA 1NPKA 4GC7A 3M6WA 1VCTA 3NGUA 3TVKA 1BQMA 4DFPA 1RKIA 5A2QU 2QX0A 5HQMA 3DOKA 4P2MA 2AWZA 2CG4A 3Q8VA 1VLOA 2FLOA 2AJ4A 4ZPTR 2OPQA 2FTRA 3CF5Q 4XK8C 3ISND 1WHVA 2DH8A 1U2CA 3J80Y 3U02A 1KSPA 1D0EA 2QO3A 2N3OA 4IQMA 1Y5IB 4CLFA 1XJWB 2VONA 2UXCJ 2KXFA 5F0WA 1S97A 3DFEA 3QO9B 4PPDA 4MIWA 5J1PA 1GEHA 2V8PA 3ITHB 1CULB 1AYEA 5EWFA 1XC9A 4OI4A 2CJKA 2Z0GA 4GKJF 2DH7A 2JL9A 2LEAA 3ZZ0A 2ABYA 2CZ4A 1EKRA 3NOCA 1IJFB 5L38A 5LSLA 2AYGA 4NXMF 4I67A 4KO0B 3M32A 5KG1A 3IN5A 3ILIA 3CUNA 1PCAA 4LF4F 1FFGB 1QY7A 1X4DA 2HWTA 2HGLA 3QAEA 4YEAA 2EFQA 1HWUA 3BB5A 1S6UA 4G1QB 3CCUS 2KZZA 3G82A 4V19J 2KFNA 3NLCA 2YNFA 4UY85 4NLDA 4NLVA 1HHQA 3H2VE 2F3JA 4NXMJ 2AYEA 2MKYA 1CJTA 4OHWA 3KUHA 4PKDB 3Q0AA 3Q23A 2N82B 1J5OB 1V3RA 2K7KA 3ETOA 2KM8C 3E2EA 4HEA9 4MKYA 3BH6B 1WUUA 4GVBA 2YWKA 4B3TF 4I68A 2AJ0A 4I6WA 3HMJG 3WX4A 3WIUA 4CM0A 2FUG9 2DIVA 3EVOA 5HVFA 3IS9A 4JOUA 3M30B 3VAMA 3R27A 1N56A 4X64J 3T5JA 1XK8A 3V6DA 4TYAA 4CDIA 1DTQB 1Y11A 5KTQA 5DGBA 2BRLA 1LK7A 5MAOA 4C9DA 2UV8G 4LBPA 3UDVA 4MFBA 5KFWA 1H7WA 3GIJA 2YKOA 2KI2A 4IH7A 2NXCA 2QSFA 3UE2A 5T7LB 4KSEB 1HNIA 2UUWA 1SKUB 1YJUA 2LEBA 4JB8B 4ZN1A 1D9FA 3MMBB 2QL7B 4USHA 3MF5A 4RNNA 5EN1A 3D2WA 1YJWS 2A1BA 3VCDA 4ZVQB 2ASJA 1PAEX 5LMUJ 1RT4B 2C3OA 3AFGA 1RK8A 1U09A 4M5DB 1IN0A 1XMBA 3AJDA 1SL2A 2RRBA 4ETXA 2OP5A 5K20B 1NH8A 5C2CA 3EICA 2V94A 3IC1A 3ZZYA 1QE1A 2VJUA 2HWHA 4HTIA 1Y5LB 3V6HA 1UPMB 1WTBA 3M2VA 4DX8H 3H5SA 5E41A 5HROA 4B3OB 2IFXA 3MMJA 3PO5A 3V2UC 4ED8A 1FD2A 2EC0A 2IIHA 5CCLA 2R8HA 1U1RA 5ETNA 1UA1A 1PSDA 2KB2A 4ZPCA 4Y00A 2DNLA 3KUEA 2Y1IA 1RT6B 3HHEA 1EB0A 2CUYA 2WVCA 4Y3CA 4ELVA 3P49B 1XR7A 1QLNA 2Q6BA 2FY8A 4DL7A 3R6LB 3GIKA 2C2RA 1K73T 4F4XA 2CQIA 3R5CA 1REGX 3W62A 4ECVA 2FLNA 4LFCF 2XTJP 1HQUA 1XMOF 1HPZB 2XG8A 1KNZA 5GAHI 2HQCA 5KAKA 4FYVB 3VV2B 1MROA 1P9YA 2WOMB 4OZLA 4MK8A 3WDOA 5F8JA 1JMTA 3RR7A 4JI3F 3W9IA 4F26A 4N8NA 1DLOB 1XR6A 4QYZJ 1XTZA 1A6LA 1HNVB 5CD4H 1BQMB 2BJ3A 5J1EB 2KXHA 2OTLS 5F9NA 2NPIA 5BYRA 4RW8B 4ZIWA 3D6MB 4KGVB 3ULHA 2Q1LA 3PW2A 3SSQA 4ZHRA 2F1FA 1H2VZ 2X3GA 3UD5A 1JLCB 4ED6A 2IMWP 1K1SA 4IDKB 1FXDA 3N0VA 3IMQJ 3CJ3A 1WJ9A 2BJEA 2HGNA 3O3LA 5D0GA 3PDNA 5ETQA 2VDHA 3QSYB 4K4WA 2DXEA 4PXEA 3KG1A 3FJ2A 3MWBA 2YNIB 3F41A 3R5JB 5ETSA 4JV5F 3BR8A 1VJQA 2D41A 4RBVA 4DQSA 2BM0A 5LM7E 2KM8B 1YVFA 2ZEJA 5JVGQ 1IXKA 3IGNA 3KYLA 2XMJA 5AT1B 2ATLA 1U48A 3W8GA 2BKNA 5AXKA 2QGFB 3R1HA 1QAIA 4N76A 3HK2A 1S49A 5KG0A 5IQQA 1FRJA 3UDLA 4DPTA 3PKYA 1U0HA 2WB1D 4AUKA 4LF6J 2SXLA 3W5YA 3W1YC 1ZTTA 2H5JB 4UY8T 3OFGA 4F25A 5IC4B 4WPAA 1FE4A 5DO2A 2P6SA 4EUVA 1V5IB 1URRA 1SH3A 2IDEA 2MKHA 2M3DA 2A10A 2BV3A 2YKAA 3IG1A 4HR2A 5HI7A 2YPYA 2BM1A 2YX7A 3TUIC 2P2CB 4N8OA 2YX4A 1RE1B 1XMQF 4V19X 1GTHA 4ED5A 2CQ1A 1BC6A 3V6DB 4Y2CA 3MI7X 2ZM6J 4WK1A 3MD1A 1N48A 3FBFA 3LGHA 2DR6A 1RT2B 2MSTA 3LA0A 3TAMB 3R5BA 4JI1F 4QU7A 4CYUB 4RWXA 3QIPA 3BM7A 1U26A 1MMNA 2H54B 2L9NA 5GMEA 1R43A 1CJVA 5FLXU 3HHNB 4QIFA 4C8NA 2GO9A 2AMCB 3PW7A 1RT4A 1V6HA 3VAIA 2HHUA 2BE2A 4DF4A 1M5OC 2YH1A 4DOZA 3B6BA 4USMA 1F2GA 2PMWA 3HSDA 3Q8SB 1ZTWA 2ERRA 3CDWA 3Q2SC 4X84A 1VBKA 5MLCV 1HWLA 1F6TA 4I2QB 4RW7A 2GFFA 4ZP8A 2P6TA 4LSNA 5KFIA 4X64F 3NWRA 2EI5A 1SKWA 3MCNA 1JIHA 4GVLA 4FKYA 3W5ZA 2D3ZA 2ZUAA 2CQPA 4EU0A 3SI8A 2ILYA 5FIIA 3OTDA 4M63A 3D1OA 3B54A 1NMEB 1Q4RA 3LPEA 5DM6Q 3HVTA 4FYWB 2JVRA 1VC5A 3CO0P 3CIZA 5KG7A 2AZ1A 1R0CB 4DN9A 3CJ0A 5HMZA 1ZETA 2AF6A 2CJYB 4NCGB 3K89A 1WSVA 2VPWB 3JTNA 4Y28C 1HL6A 3ZFVA 4LF2A 2HNYA 2J6TA 4DJBA 3NNAA 2PFFB 5U47A 2Z57B 2MXYA 1VC0A 2XYPB 4I7FB 1TL3B 1NEEA 5D77A 4EBDA 1QD1A 3P6YC 3FNNA 5F8NA 4ECWA 2XI2A 2WZ1A 5J1EA 4NRUA 5I3UB 4LF7J 4M5HA 4H4MB 3M1VB 4DQQA 1KDNA 4KQZA 1UJ5A 5AXLA 5DLFA 2A3JA 3VWSA 1ELOA 2DTJA 1SB6A 2PA8D 1F5AA 1H2TZ 3KXDA 4C0HA 4DS5A 4A8KA 5DGAA 1RT7B 1GX5A 1HW8A 1TK8A 4V1Ak 1RAJA 1K47A 1VIOA 3D54A 1H74A 2MQQA 4FPRA 5CABA 4DR4F 3QLHB 4NRTA 4AD6A 2M8DB 1A0OB 2G4BA 1JQGA 1PJ6A 1RHRB 2YKNB 1RHMB 2UP1A 1RTIB 4B9LA 1SJFA 2LEPA 1TKTA 2GMLA 1AUSL 2Q43A 3M7VA 2G2ZA 1F5CA 1ZAXA 1ZPWX 5H1SV 1PYSB 4WCEQ 4ZK7M 3NRBA 3M9OB 4QOTA 3LGNA 3KKFA 1TMJA 2ZE2A 3PRDA 4JP8A 1U0HB 4XDCA 3TEHB 4N47A 1Q95G 5ETRA 3OTOJ 2VC0A 2HHTA 2LKZA 3GG1A 4Z7CA 4R8UB 3ADAC 1BWVA 2W2QP 1DQ9A 2HS0A 1NHUA 3MCMA 2RAQA 5CHCB 2AGQA 2YKQA 3UNYA 2IBKA 1FVSA 2L41A 4DPUA 1YSJA 3QMQA 3WBZA 3EZOA 1JLQA 2R7RA 2MSSA 3C2PA 2QMUB 5BR8J 1FNXH 5IV4A 1RT5A 1JLGB 2H65B 3LO3A 4NI2A 4LF6F 2PEBA 2OH2A 2XHWA 4TY8B 4JUZA 5A8RA 2YTCA 3VZIA 1X4FA 4CO0A 1NPRA 3I5BA 4P52A 3G8TA 2DO0A 5J2MA 4QWCA 4USIA 3IAM9 4CYUA 3BR9A 2WONB 4LJMA 5G0RA 2R2RA 4NLXA 2CJ9A 3PW4A 3TAPA 2CPFA 3POTB 3R9LA 3EJMA 1XBWA 1WOSA 3EXCX 2MJUA 4J37A 3PFOA 4R0EA 5C5JA 1YJVA 1FNOA 2VBZA 4IFYB 5HJYA 3SDEA 1KD1T 4K0KF 3T1YJ 1JJ2R 5LSRA 4C8LA 1RTHB 3D68A 3UDCA 3NL0A 3FQKA 3FZ2A 1JB0C 4QYRA 2RQCA 3U1NA 4I2QA 1UAWA 1HBUB 2CPZA 1PILA 2QN6B 2GJIA 5GVQA 2R7OA 2AGOA 2HMIB 1MN7A 1NHVA 2AHOB 2IDLA 1JXVA 4EI2A 2CPDA 3EDRB 5LSOA 2HKEA 4JI8F 5M2PA 1REVB 2RIJA 5CYMA 2AIRB 4JI8J 3HXMA 3OPKA 4AQYJ 4NCAA 3L7UA 4WFAQ 2XLJA 1YQHA 2E29A 2PO4A 2VBYA 1KS2A 2LXFA 2ZBIA 4J9OA 2QLXA 3AA8A 3W65A 3HVTB 4NPOA 3KHGA 5ITHA 1WF1A 3DLHA 2CWXA 5ETKA 3LP2A 3BO3A 1RACB 1YJRA 3LF0A 1WOPA 4A8OA 3DMJB 3DRRA 3SCJE 4OYZA 4H4OA 1YGYA 2E5JA 1B0TA 1MU2B 1S1VB 3FVYA 4WE1A 2XGPA 2H1YA 3D3CJ 4PXBA 4TLRA 3SBMA 4LFCJ 1QAXA 2RU3A 2DNHA 1FKAF 2Q79A 3P45B 4KGMA 2Y1JA 2PFDA 3WC0A 2MLXA 2RH3A 1T03B 1D1UA 1RJJA 3MM5B 2CFXA 2BOAA 1H7XA 2HGMA 4YDDB 1C1CB 5K8NA 1NH7A 4YN3B 3CJKA 1S1UB 3TVYA 3D4JA 4P72A 3AHPA 3VVUA 2XZWA 3M2UA 4JYAF 1R6VA 3PM9A 1WG4A 2BYCA 4QZVB 1VLYA 2WTFA 4CO4A 3CCSS 5K5MA 4LF5J 1FWKA 3ISNC 2XY6A 2MDAA 2P9EA 1TKXB 1M1HA 2J7UA 4QWBA 1W26A 1Q79A 5DG7A 2ACYA 3MM9A 2MGZA 3HI9A 2EWHA 4I4BA 3GILA 4WJBA 1SJ1A 2R4FA 3DLKA 3QJJA 1EAYC 3HVWA 1EQMA 1RT7A 4DUZF 2WAQD 4CLKA 4DLGA 1RWWB 3CJ2A 4DUTA 2X1AA 2QTWA 3NGKA 4PR6A 1N36J 3AXMA 5L9XA 1ZZNA 2RVJA 3OBIA 3ZTOA 3A3PB 3V5RA 4J7CA 4U67Q 2J5AA 1EJ7L 1FFWB 1LK5A 1VQSA 1XERA 3CJSA 2R8GA 2J8SA 2LXUA 2F9JA 4DQRA 3BYPA 3M6VA 1E6VB 1HBMA 3DNCA 4J9VA 4KHRA 2VUGA 4XIUA 4LBIA 2XCPA 4DV3J 3A13A 4EZ9A 2GZOA 2F8EX 1JLBB 2GVDA 3OR2B 4QIVA 4RO0A 4EYHB 3W3SA 1R89A 2HBRB 2E1MC 1RU1A 1GK8A 4O23A 4USKA 4EYIB 4L3KA 2IVFB 1RAHB 2GQQA 2D1CA 3CIMA 2WVEA 2E66A 4X4VA 2NCKL 2AEJA 4OYOA 3ZZPA 1EETA 1RADB 1JLQB 4C2MA 1IKYA 1I3OB 3UNGC 4CLUA 4PQAA 3OL8A 4LF9J 1GTEA 5KFCA 1F60B 1RT5B 5DG8A 2PE8A 3KDOA 5DS7A 1U1MA 3OHBA 2ZJPQ 1KVJA 1X4CA 4TY8A 4MIAA 1HHSA 4F4ZA 3KMSA 2NXUA 4P2XA 4CLWA 4CIOA 3ZZRA 3H25A 2R7UA 3P5BP 4LR9A 2LQBA 2QC3A 3BKFA 3MEDB 4LRDA 2XS5A 4F3MA 3QRQA 2PSZA 2GC8A 4WK3A 5H9EK 3A8EA 3IWNC 5GADI 2C2NA 4XTTA 2UVUA 2C2OB 4UZCA 1VQYA 1B0VA 1FESA 3JSRA 1WKJA 1WORA 2GS8A 1Y7PA 4YOEA 3ISZA 4KGZB 2DRAA 3OTCA 3TNVA 4B3RF 3UQSA 1QJHA 3EYZA 2DNZA 1T9VA 3HJVA 1OJ4A 2LU1A 3LH2S 2BEFA 4WIIA 2PDAA 1S77D 2FY1A 1N5YA 4PEOA 2MKIA 1ZBTA 1YRXA 3T5HA 5KFSA 3M8ZA 1REVA 5CYMB 2OPSB 4OYBA 1VQPS 1XMOJ 4UT4A 4A8FA 3JSMB 2EPIA 4LQ3A 2Z58B 4WFZA 1JLFB 4YP3A 5SUHA 5EHHA 2DR5A 3MR5A 2C2MB 2ASYA 3UDEA 4ILRA 2VQFJ 3ONQA 2GMJA 5J2NA 1N34J 4DQPA 4NXNJ 4AYBD 4FBTA 2DY9A 1YRUA 2YBVA 5A8KB 4O4RA 5JXSA 1HYSB 3K7RA 5RUBA 5HK4A 3PX6A 1M5PC 2PT0A 4PPZA 3VGTA 2VFTA 1CC8A 2RNEA 1RUSA 2MTLA 5I42B 4DV2J 4DSEA 1RDRA 1KLMA 2UUCF 4UQTA 4B9SA 3FEYB 2KJWA 3Q22A 2CZVC 1X4AA 5F41A 1CJKB 3AY0A 3OT9A 1IKXA 2HRTA 4I6AA 4KKOA 1T9UA 5KFUA 3IBWA 4YUDA 3HD1A 1U2FA 1HQEA 1VFJA 3LPYA 4WWSA 2L48A 2WSCC 3W63A 3K5NA 4TY9A 2JLFA 2Z8QA 3CJTA 3ZTQA 4CLTA 2ZM6F 3EPGA 2ZH3A 4ECQA 2J0SD 3CCES 4KHPF 2YY3A 1VGYA 3VGVA 3UCUP 2UU9F 5CQGA 3AB4B 3QPIA 2V68A 4XPEA 2MZQA 1T9YA 2KG1A 3MFIA 3RAXA 1U1KA 4LFBJ 1F0XA 2G13A 3MEEB 3DGVA 1RA7A 5KG3A 4OL8A 1GH8A 2A6MA 3U27A 1KRPA 3MXHP 2F4VF 5D15A 1UCNA 2D3UA 2KZMA 2KL8A 3OR1B 4ZVOB 2VQEF 3DXBA 1AW0A 3OJSA 3OVSA 4DV1J 3DRXA 1F2HA 2F7VA 4QW8A 1SJ4P 4Q44A 2FLPA 4RUBA 1PBAA 2HBQB 2O67A 3C6UA 2W9BB 1TR0A 3KLFA 2ZH4A 2J9EA 2Y3YA 5L1KA 3BBFA 4ED3A 2HQIA 2AD9A 2YWWA 1AFJA 4CH1A 2RUSA 3IP0A 2CXEA 1RWNB 2B43A 2CNKB 4C11A 4F67A 2E9TA 1JLBA 1LNQA 2GVDB 3UFCX 3H4DA 4HTJA 5IWAF 1S9GA 3C14A 1OIAA 4DZ6A 1IM6A 1GMWA 2KXNB 4RW4A 2W7PA 2R7XA 2VPZB 2GCFA 2QLWA 2VG7A 2OFGX 3CJRA 2JOQA 4ZOSA 5C2GA 4JV1A 3QJLA 2OTJS 4KB7A 3RB4A 1BQNB 1X8DA 2CQHA 4AXIA 4NZ0A 4IG0A 1GQEA 1RWVB 1UEVA 4L74A 2XMTA 3GR1A 3I31A 2B0GA 4MFBB 4CO2A 3OV7A 3O8WA 3K5MA 4DV5J 1KONA 1NNDA 3K0JA 3MAQA 3TWZA 5F8LA 5B08A 3NGRA 4U7CA 3DRSA 4EZ6A 2FJBB 3GFYA 3HFZB 1O8BA 1Q8KA 1RAFB 1DFDA 5J2QA 1D8ZA 2Y8WA 4NLSA 2E7WA 3M05A 5D8HB 1NSKL 3I4PA 4DV5F 2LA4A 1S9FA 1G4CA 2XNRA 2ZH7A 2CJAA 5ETLA 2LQJA 3K5PA 4KGXB 1RWXB 4K4UA 3VHQA 1ZM4A 2R7TA 2WB4A 4TQRA 4W92B 2MQNA 1VS3A 2VC1A 2VV5A 3RYLA 3W2WA 4CH7A 5KG6A 1NJYA 2MHEA 3IRXB 2CNNB 3T3FA 2HK3A 2MY8A 4YQWA 1KFDA 4X2BA 1RSCA 3GYXB 1MN9A 5AXNA 2YKMA 2NXEA 3M8QA 2P5VA 4EO8A 5ADZA 2DCLA 2W7AA 1FWLA 1PC5A 1XWLA 4X4PA 5L1LA 2J6SA 1UJ6A 1G7CB 2GA7A 3QJPA 3RG6A 4GC6A 1RT6A 3PYDA 1AUDA 5KFAA 2HIQA 1FTCA 5K8OA 2WVDA 3LUYA 2IY5B 5E0OA 4O0NA 4JYAJ 4KPCA 4DV1F 5LXRA 3L9ZA 4OFZA 4USJC 1R0BG 1WHWA 1GMVA 2RILA 3V6JA 3MECB 4JI3J 2B4PA 4LSZB 4OZ3A 1K0VA 2H5EA 2RE1A 4OHVA 3EM1A 3R1LA 3J7YU 1RCXB 1UKUA 2HG4A 1MROB 1VQ9S 2HHHJ 2Y0SD 4R5PA 4B9TA 2WSFC 4FVCA 1J2VA 4QJVA 1FKOB 3R6GB 1DLOA 2ZD1B 1J5EF 1CJKA 2RSQA 1HNVA 4A47A 3N28A 3TA2A 5B0CA 3B8HA 4KKOB 2OI2A 2XMUA 4P2SA 3KLGA 3PYGA 1UWAA 3M8PA 3KK2A 1L3VA 1HR0F 3KLHA 2AYBA 1HQEB 3NMAA 1UA0A 4DX6A 3GU0A 4ECSA 4BCAA 4FS1A 2PEHA 2MZJA 3UVJB 1HNXJ 3CCRS 3M8YA 2HFZA 1BQXA 1RP5A 1W25A 3LAKA 3TEGA 4M8LA 4X65F 1RKJA 2DHAA 1S6PA 1RHKB 2CWKA 1SCJB 3DGPA 4B3TJ 3T1HJ 1K1QA 4DU8A 4NCBA 4DEZA 3MEEA 3QYYA 3LWLA 2KRBA 5CZVA 4JI6F 3D5MA 2J9CA 3CO9A 1YJ9S 1F9FA 4I2PB 5B0AA 1S9EA 4B3MF 1C2PA 2HPUA 3DLGA 8AT1B 3TO8A 4PQUB 1HFEL 1VQ7S 4PWDB 5CYQA 1DURA 3N79A 3QNWB 2YQ3A 1Y3JA 1KTQA 5BJRA 2MJNA 3D67A 1N54B 4LF9F 1FEHA 3CCJS 2CA9A 2XSJB 2EFVA 1YZ7A 2ZH2A 2ZC3A 1NBEB 2AP6A 2J76E 3C14B 4MMOA 3N6MA 4MTPA 3K2YA 5EX3A 1S6QA 2K2PA 2MZ1A 2VICA 2CPEA 2FZCB 5J2PB 4DFJA 3PEJA 3V4MA 4C48A 4B9NA 3AD7C 4AL6A 2GQCA 1FI4A 5B0EA 5T41A 3NBPB 4A8MP 1T0TV 4K4ZA 4ENOA 4DCJB 2VF3A 1IKWA 2BE9B 3OTEA 5HN0A 4L73A 4N56A 4O44B 1S7HA 3QIPB 4L6V3 2UUAF 2EBGA 2I2YA 1I5OB 1H6KX 1WKKA 4FKXA 3TA0A 4RX6A 4CP5A 5KFFA 3GFZA 1LWEA 2VFSA 3CCTA 4IFVB 5IQ6A 1FJGJ 3PACA 1M1GA 2DXDA 2KVQE 3MZIA 3QT8A 2BE2B 2DD8S 3CC2S 2H51B 2XI3A 1NXIA 2B56A 3FMBA 3NY0A 3W61A 4PWUA 3IFEA 2NPFA 2WRMA 1FWPA 2XMWA 4YDXA 1FD8A 4DZDA 1UVNA 3W2WB 1CQMA 1NK0A 3DKDA 3D0IE 1UETA 4NMXA 1WHXA 4E98A 2L3MA 2V2KA 3ENQA 3DYAA 2JFKA 3MR3A 4QIGA 4LRCA 3W2VB 5CXTA 1DJ0A 1R8HA 1BXNA 2GQ2A 2Y1LB 2Z2ZA 3ZO7A 4Q5VA 1WOOA 2OEMA 3NAIA 2K7JA 2HVHA 3MM8A 3QGHA 2IRXA 4HACB 1U25A 3RZAA 4QR0A 2KFYA 3RB6A 1M5VC 4IYQA 1FX2A 3EGWB 3Q89A 4ZPAA 3E01A 3FZBA 5HQLA 2W8KA 2ASLA 2R2TA 4H4KC 4EBEA 2FZKB 1RXOB 2UUTA 3ENAA 3OTBA 2VA3A 1C0TA 3DHWC 1T02A 1RT3A 2RD5C 2E7VA 2JRSA 3A3NB 3BGOP 3BJYA 3JTPA 1L3UA 4UOFA 4RUHA 3HPOA 1F3VA 3KG0A 2KTQA 3KK3B 4LVOP 3CNQP 2I5JA 4OJGA 3HHLA 1RAAB 1FKOA 4C7QA 1KVKA 3EMTA 2R7VA 5HMYA 2X7IA 2NZCA 1HBOA 2QIFA 4NE9C 5EUHA 4CM2A 1Y0HA 2HSEB 3G8QA 1SV5A 1FFSB 3HDSA 3H59A 3PIPQ 4AL7A 2AU0A 1CS4B 2P9GA 3F0NA 3WX8A 4URGA 4ANEA 1C4AA 1NPPA 4NA3A 4ZVRB 3ZNUA 1ZM3A 1OSDA 3CJ5A 1VMBA 4MAKA 2HHWA 1H72C 2PC6A 3BGRA 4DPXA 1U1NA 3D1HA 2GGPA 4LFAF 5E3PA 5B0DA 4UZBA 5DDPC 3DGPB 3J81U 1FRMA 3TX0A 1TL5A 3R3TA 2AX0A 2PI4A 2YKPA 1URNA 4CTAB 4PUOA 2BW2A 2EK1A 4JI7F 4F2RA 4ID8A 1HNZJ 4C6AA 1YBUA 5HP1A 1IKVA 4WKYA 3GLJA 1RBAA 4A46A 3DRPA 3HFVA 5DZ6A 2NZ4A 2GVZA 5D4LA 3GJQB 1FRHA 3KJVB 4DV4J 4K2JA 2D3O1 4DLEA 2CPXA 2ZBQA 1ULRA 3D1QA 4H54A 4LIRA 2FHOB 2DY1A 2M8HA 4X66F 2L9DA 2W9CB 3JQKA 4ZJLA 2YH0A 1RHQB 2M52A 4K2XA 4FVMA 2F40A 2J7KA 4P75A 5DRKA 2XMAA 1YTYA 2XSJA 3K5OA 1RA6A 1TVRA 3FKBA 3NP5A 2HW3A 3PJXA 1S1XB 2IYGA 3HM9A 1VBYA 2BJ7A 2KYXA 2VKRA 1FDBA 2CPYA 2NXJA 4FNIA 3OW2R 2G1HA 1U45A 2BJDA 3ZC4A 1U4BA 1TAUA 3L7OA 4NI2B 2XWXA 4J90A 2V67A 3RU0A 3H4BA 4OZ1A 3MUMP 1M5SA 2BZ2A 2HS4A 2X3DA 3AD8C 3LP1B 5A8RB 3J81j 1F9EB 4DHVA 1KOOA 1GXUA 2NQPA 2QJ3A 3MMAB 3UR0A 4J9UE 1IVZA 1LKZA 1WEZA 1XEZA 2EFNA 1VBZA 4MKBA 4A8WA 3OFHA 1YHQS 1T05B 3IR5B 4G1PA 4RU9A 1FF2A 5B0GA 2XSFA 2ROGA 3HHLC 1QSYA 1V3SA 2DGVA 3PNIA 4K5RA 1VR6A 1DZ5A 1BGXT 4PCQA 5F3TA 1TK5A 3SSSA 3V4IA 1Z2ZA 4IDKA 3HHDA 3BEGB 1S1WA 4IOBA 2ZVSA 3SDEB 2NUUG 1NDKA 2IM1A 5D6GA 1RTHA 2AYMA 5ETMA 2C2ZB 3ET6A 3AQOA 4H4KA 5K14B 2XS7A 4I56A 1UZHA 2HHXA 1WSRA 1IWGA 2Q3PA 2VBXA 3CJQA 5T14A 4LFBF 1W2IA 3HD2A 2VG5A 4ZP7A 3RGIA 3H5XA 2EK6A 7FDRA 2JLEA 1YJTA 2KT2A 1QUPA 4FF4A 1QAYA 2CDQA 2X51A 3AH6A 4ZVTB 2DHSA 2MZRA 4RNMA 5LT5A 3G71S 3EWGA 3PHTA 3MM8B 4ZKAA 3KLEB 1X9WA 3BSCA 4RBTA 2DGOA 1Y9OA 4HKQA 3DI6B 3KMQA 2B51A 1UWBA 4KH1B 2DNOA 2B7BB 5I3QA 4C8OA 3DU6A 2WBMA 1Y10A 2M5YA 1UZDA 1VQ8S 3RAMA 1T03A 2JNJA 3MGJA 3MAHA 4ALZA 2GIRA 1J27A 4ZIVA 1JJCB 2DGQA 1IQTA 1RWUA 5EWGA 1C1CA 3MAAB 3T1AA 2C42A 1TTHB 3CCVS 1JX4A 1YJ7A 1HBOB 3BKUA 3TJ9A 2N7CA 2OPRB 2CYYA 1RU2A 4TNOA 1LV5A 1CJVB 4QR2A 3NS6A 4OHYA 4KHPJ 4KO0A 2RHSB 3KJQB 3M32B 5BYQA 3DOMA 4M1KA 5C25A 3MCOA 5F3ZA 5HQ8A 2QLFB 2KDOA 5DG9A 1SJ3P 5D4NA 1TMMA 3ILJA 3BQ2A 2POKA 2CVEA 1H73A 2WBRA 3MM7B 1UVJA 2HLTA 2JEIA 3DLKB 2CRLA 3CCQS 3UI3A 1CPZA 3CDUA 3SEOA 4CTAA 4M5LA 2XCAA 1UFWA 3JQJA 3O1LA 4OQJA 4LSNB 4DSJA 2DGSA 3GB0A 3TA1A 1H2UX 3ILLA 2DGXA 4ZLPA 5THWA 4IOAQ 3HT3A 4KV8B 3AOCA 1SJQA 4HI1A 3I32A 2F8HA 4A8XA 3IS9B 2DJWA 4USUA 2HQ3A 1O51A 2IRUA 2OPPB 2ZFHA 3SFUA 4QWDA 3H7HB 2BBEA 3ICLA 3IGVA 4NLRA 1XMQJ 1NK5A 1G1XA 3Q8RB 4GKKJ 1UL3A 1IR1A 3QFWA 5EX0A 5KFGA 5D3GB 4NCGA 2CADA 2XGQA 1R8AA 2MB0B 4ZCLA 4U9RA 2R8IA 3PHEA 3VALA 2BQUA 2PI5A 4ICLA 4UQGA 4W90B 1TQLA 1AB8A 3QWPA 2DHHA 4QWEA 5C42B 4PUOB 2KHCA 3KJNB 3WC2A 4Y6IA 4IRCA 1JJHA 1RWOB 2HBZB 1KQGB 2QA4S 2DGUA 2RKIB 3LP1A 3PY8A 3TZXA 2FC8A 4R25A 5IT0A 4USTA 2M2BA 2XY5A 1NZAA 3BS9A 5D0RA 4DV0F 3ILOA 4EO6A 1S59A 4IQXA 1OY8A 2DKOB 4PYDA 1NSQA 5HROB 3RRGA 2F9DA 2DK2A 1Q5YA 4WZQA 1QUVA 4DPWA 3V4IB 2B5JB 1FJEB 1N36F 2XO7A 1U1OA 3UR3C 1FRKA 2XZTB 2BXJA 4B17A 1LW0B 1WF0A 3ET6B 3QQCD 4CO1A 2GIQA 4YR3A 2ZHBA 4ECXA 4LMZA 2V8HA 1RHUB 2AEMA 1TK0A 1I6JA 5L9NA 5FDLB 3C8YA 1TU0B 3BN4A 1WC3A 1HQUB 2CPJA 4I64A 4URSA 1TKTB 2AZ3A 3DU5A 4UUWA 5B0FA 2CQDA 3ENVA 3BBBA 5F9LA 1N5TA 1RZMA 3T9ZA 3W64A 2M9KA 5KFLA 5L1IA 2XLKA 1DAXA 2F4FA 2IAJA 3G87A 1K8AT 3HZGA 1HQ2A 3K8WA 3BGUA 3KLEA 5J2NB 2ZITA 2NXNA 5EDWA 5KFHA 3EX7B 2FVSA 2HYIB 4CCHA 4DL0C 4I6YA 2JSXA 4FBUA 2MQLA 1UWBB 3BF4A 1ZM2A 5LL6d 1RTJB 3HSGA 3A4TA 1VI7A 4Y2MA 4RNFA 4J9MA 2NYHA 2V9WA 5KFVA 2Y9HA 1NCLA 2H3EB 4HL9A 1JLGA 2JH3A 1WI6A 3BDEA 3I87A 5H9FJ 4IRKA 4NLTA 4QPTA 2I1RA 2DHXA 5LXYA 1IKXB 1WKLA 4B3SJ 4A4JA 2GHWA 5KT3A 5GAEU 4OV6A 4OX8A 4ZPVR 3T6JA 3S1TA 1EIYB 3K57A 1Y3KA 2B3TB 3KDNA 4M5NA 4KHMA 4ANDA 1BWEA 2BA9A 1X9SA 3PIOQ 3T1HF 2W2PP 4AQYF 3POTA 4WP9A 2MKSA 1VJWA 4IR9A 1EP4B 1KP6A 2EFPA 4OJHA 1WI8A 4JI0F 4IFYA 2MMYA 4B9MA 4ES3A 3MM7A 1UP1A 3QZ8A 3F56A 2XO6A 2HIYA 4RWWA 3H40A 4NZ6A 4RW6B 2W24A 2UUBF 1P6TA 2G0IA 3FSXA 5FJ4A 2DGTA 5A6PA 1D8YA 2CQGA 2K3IA 2W9AA 1U1LA 1HA1A 1KHWA 2M88A 2DEIA 4HT5A 4WXOA 3ZZZA 2HMIA 4IUFA 1A9NB 1MWQA 2X1BA 3HO1A 1X4EA 1WG1A 3IG1B 3VVTA 2B4VA 2E9ZA 2ZBCA 3C6TB 1EARA 3WZ0A 3WQPA 3I0RA 1BD6A 3SMZA 4YB5A 5KT2A 3SV3A 1H3DA 3CJ4A 3BQ0A 3R2CJ 2OPPA 4IH5A 3T19A 4B9UA 4C11B 2A18A 4BWJA 1PJ7A 2CQCA 3NGTA 1JLEB 5IFMA 2E1RA 3IR6B 2RRAA 4ECYA 1NK7A 1IR2A 2UXBF 2XWYA 4AFFA 2UVVA 3QIDA 4H4OB 4C97A 4HHJA 4BDPA 1SIWB 4GRSA 4ZA1A 4PYAA 2W2NP 4OZJA 2B4OA 2FLLA 2ZBPA 4OYPA 1T9TA 3K8VA 4LQ9A 2R7WA 2W2MP 2LP4A 5C42A 5HLFA 1KHVA 4CWBA 2P9CA 2XY7A 2QFJA 1R31A 4C8ZA 1P9QC 1N6QA 2JEJA 1UEUA 1WACA 2I6WA 5IWAJ 1Q0NA 3I0SA 1C1BB 3OXGA 3M8WA 2HNDB 5AE2A 1KKHA 5LJ3Y 3PRBA 5KG2A 3NGSA 3R8YA 5CAAA 3AD9C 1Q78A 2FJWA 4NEYA 2L08A 2VG6A 5A0YB 1S5ZA 2KFZA 1ICEB 4DR5F 1CLFA 2HAIA 3EZUA 3MM9B 2D7SA 2OSQA 2MGZB 1SQGA 2XYGB 4ZITA 2ZZMA 4DR6J 4NLUA 1F9HA 4L72B 2KG0A 2V5HG 1AZSA 4OI1A 1JLAB 3MPUB 3EGZA 1DARA 3NGDA 1LW0A 2K8GA 3H2LA 1X4HA 3SQOP 4RNOA 1TL1A 4OYMA 5KFYA 2ZC4A 3IWLA 3K17A 3CWJA 4RZRA 1SC6A 1GT8A 4RU2A 3TJAA 4NLOA 1FE0A 3W9HA 1X9MA 1LEOA 3NAHA 5E7OB 5KFKA 2OO4A 4DPYA 4YB1P 2ZH9A 4Z2XA 4EGLA 2VKZG 1SXLA 2Z2LA 4YHHF 3G6ES 2M4MA 3NCRA 2ZWPA 4C3MA 2IC3B 2V50A 2IVYA 4KJIA 4ZP6A 4F04B 4OZ0A 4B3MJ 2DT9A 5C24B 5I3UA 3UO0A 4LSLB 4DR1F 4C0BA 5KFJA 3CE8A 2OELA 4H4MA 4KGKA 4OJ3A 3NXZA 3CC4S 1NRKA 1R27B 1WC5A 1WC1A 3LAMA 1I94F 2UUCJ 3CCLS 2ZD1A 4X4RA 4ECZA 5KFMA 2JZ5A 3B82A 3BGFA 2P8IA 2ZVIA 3DOLB 3N01A 4XO0A 4FNHA 1YBAA 7AT1B 3OHAA 3KK2B 3G4SS 1IWAA 1VQLS 2QL5B 4AL5A 2B6AA 2CQ0A 3QLHA 2XZDB 3DDIA 2V63A 2XMVA 1RTIA 3LP0B 4WFXA 1KQFB 4DL5A 2OMOA 3GV7B 2ASDA 2DPIA 3IM8A 2FGCA 4I69A 1J5EJ 2NYIA 2J8AA 2ZH1A 3M8SA 5KFTA 2VU5A 4U8YA 5FLXY 4ZCIA 5JMNA 1L3TA 2DNRA 4NLQA 5DDRC 1MG7A 4DPOA 1IBMJ 2QEXS 1M90T 4C4WA 2VB6A 2HAFA 3EVWA 5I4MA 5KFEA 4DV6J 1N5YB 4X4TA 4LRBA 1N33F 2RT3A 3I82A 5C7PA 1R7IA 4WP8A 3UCZP 2OPSA 1GFWB 4DR5J 4I0WA 2ATCB 4J5OA 1E6YB 1JLFA 4J9LA 3OXLA 2RDDA 1JNZB 1PKUA 1T95A 2HFNA 2COLA 1TV6B 2DXFA 4PG4A 1JLEA 5J2MB 3QZ7A 3MR2A 1TL7A 4OZNA 2R2UA 2K06A 2WONA 2GO8A 3GSIA 3MR7A 3P3DA 3RB0A 1O0PA 1DQ8A 1ZAWA 2OD6A 3CEDA 5HO4A 2QE5A 2R9LA 5I42A 3DLLQ 2R8KA 5F8GA 1R0AA 3RR8A 1RWMB 3WHIA 3PR4A 5HMWA 4YR2A 2V4JA 5F8IA 5HLFB 1O6XA 2QMXA 3AOAA 1FJCA 2XQCA 1IKWB 3RBZA 2QRRA 6FDRA 1N6QB 3QSIA 1D9DA 4O44A 2LQ5A 3I0SB 1C1BA 3CVKA 3AJ2A 5D78A 1TKZB 4B08A 3V81A 1ZYQA 2NUHA 4ZDNA 1UMJA 4UOGA 2DNPA 2N4DA 2DPJA 8ATCB 2O66A 1SC3B 2QT7A 1MMLA 1IBKF 4KFBB 4URQU 1Q7LB 3IXQA 3OVBA 5GAGI 1QM9A 3N5BA 4DV7F 1YJNS 3S7RA 4A8YA 4X62J 3BO4A 5HL7Q 1H98A 4JV5J 4OYIA 4EMDA 1AZSB 1JLAA 5AE1A 3Q24A 1RTDA 1C0UA 1GNKA 3FFIB 4P6QA 4ZJOA 1XNQF 3KUGA 3RAQA 2Z56B 3M2RA 1VK8A 1Y4ZB 1XQIA 1TZ0A 3DMJA 3A12A 4HYKA 1WHYA 2V6AA 1MU2A 2GIFA 1S1VA 4WE1B 5CCMA 6AT1B 4N7TA 1NJXA 1NJWA 1B99A 4NZ7A 1X5TA 4QW9A 2KN4A 3B4MA 3TQ1A 5KFOA 4WBFA 2YXLA 5IXUA 3KLFB 3RRHA 4HACA 3LW5C 4IR1A 5KOXA 2VODA 4OMFG 2ZHOA 4KTQA 4TVAB 2DNYA 3DM2B 3E01B 5DDQC 4LF5F 4J91A 4L76A 3GONA 1XIQA 2DRDA 3GTYX 4F4WA 1S9GB 1ZS6A 5D0EA 2CZ9A 2IC3A 1UFKA 1HLWA 1UPPA 3M2UB 1PYOB 4P7VA 3OFFA 4RNHA 3R7NB 4K5SA 2YWGA 4MT1A 3ZNJ1 3RB3A 4OX9J 4ID5B 2FGOA 2MLYA 3FSIA 3SZ2A 4IRDA 1ZZFA 4ILMA 2BUNA 1G3OA 1NDLA 1BQNA 3CXCR 2E9RX 1VIXA 2I5JB 3W5XA 4BC9A 5HVHA 1TUVA 1Q82T 4TKTA 1R8BA 2LU2A 3HVAA 1HI0P 4KPYA 2XS2A 3NEKA 1SV5B 4N5SA 3DOLA 2OKQA 4ED7A 1U6BA 2F63A 1NJZA 2DH9A 2N4CA 3AODA 5KFBA 1FO1A 1A7GE 1SJRA 4P73A 3DDNA 2DISA 2PGCA 2ILZA 2VPXB 3BPDA 3UN5A 2YNGA 5J2QB 2U1AA 2BACA 3OQ2A 1U6FA 4QCLA 1SQFA 1RWKB 2NS1B 4RW9A 3S01A 4B9VA 4UUXA 4DN0A 4LR8A 1SL1A 2K1RA 4G65A 3FUYA 3UCGA 4KIAA 1HWIA 3KJFB 1R3NA 3I96A 2VOOA 2V4QA 2FD2A 2HRYA 3OR2A 4AE5A 2WW8A 3RW6A 3RJMB 3KWMA 4QIWD 1QTNB 3HX9A 2VDIA 1CSJA 2DNKA 2YKMB 1FDNA 4BBYA 4C3KA 1WEYA 2J9DE 2JEGA 4JI7J 1KC8T 4P10A 3KJVA 1EETB 2YX1A 2MKKA 1YLXA 5HATA 1PJ5A 5F0UA 4DCPB 3CDEA 1OWXA 1PGZA 2IHR1 4QWAA 3TZYA 1NK8A 2W9CA 4LFAJ 4DWIA 1X5SA 3GFHA 4DV0J 2WVBA 1LWXA 4N41A 1EZZB 1RLDA 1TV6A 3MDFA 4HDHA 4WYWA 4G6VB 2IMOA 2BW7A 4OI0A 3ZTSA 2IPOB 4OYAA 3K59A 3MEDA 2J0WA 2O01C 2IJRA 4PZVA 3MOJB 3TQEA 4DL2A 3BSAA 2H5IB 3O44A 4FXDA 1NZ8A 2M70A 4JI5F 2OUGA 1CC7A 2AEFA 3MCSA 4JI2F 4LUBA 4JI4F 4Q8FA 3JSBA 1HIYA 1SIZA 3W9JA 4DG1A 3MEKA 1ROFA 3MMAA 4OV1A 2HQFA 2UXDJ 4FPIA 1UFLA 2DIUA 4NEZA 1MWZA 1YBTA 4J9RA 3MHYA 5HAOA 4Y34A 3N5FA 2KJVA 2BJ8A 2FYXA 5HBMA 4C3LA 2G2OA 4OI6A 2UUAJ 3HSZA 4CLSA 3FRYA 2LMIA 2M0GB 2CPIA 2A6OA 4LIWA 2I38A 1G2EA 4C8YA 2ZWOA 1RBOB 3M8RA 5KG4A 4F8RA 4JI5J 3I4HX 2HNZA 4LVNP 4C98A 5K14A 5EGYA 4DR4J 1LWFB 4K8RA 3GIIA 1NDCA 3G86A 3N4WA 3RRKA 4I2PA 1VQNS 1FXLA 1R8PA 1X5OA 1WF2A 2VG5B 1NK6A 4BWMA 4ER8A 1FCAA 4PQUA 5KT6A 3C19A 3BO2A 2FIUA 4MJKA 2CKWA 5IT9U 4PWDA 4G1QA 1JXLA 3I6PA 4CLYA 2KYZA 4EWTA 5M2UA 5KG5A 1UVLA 5CYJA 5E3CA 3PKMA 4FXVA 3TOQA 4IKAA 4A8SA 2V34A 5ETOA 3K58A 1FJ7A 2C2DA 3H90A 3DI6A 3M4XA 4OX6A 5GAEI 2PN6A 3LWMA 3BSNA 2HQDA 4W4MA 1PAUB 1B70B 1YDLA 2EXUA 2QA2A 2OEJA 3DLBA 3I55S 2R42A 3QWUA 3BDPA 2ADBA 2MZSA 1X7VA 2Z2YB 3KNAA 4JV0A 3IWXA 3MAAA 5IZHA 4HDGA 3KK1B 2BABA 4DL3A 4ZN3A 4PXCA 1OY6A 1HNIB 2L9WA 1EX8A 4F4YA 2YQ0A 1TAQA 3OR1A 4IFVA 2LDIA 1ZA1B 2ROPA 5LJ5Y 1T9WA 1KQSR 4FYXB 1S0OA 1IUJA 5JJBA 3E3XA 5E33A 3M6XA 1SL0A 1FRIA 2ZOGA 3W8PA 4BHQA 4OYXA 3C6UB 4X4OA 2KU7A 1Z2LA 1NJIT 2K1RB 1OS5A 4LF7F 1M1KT 1X0PA 3MM6B 4DL4A 2AT1B 2QLBB 1YITS 1KOHA 2BQRA 3UW1A 1T8EA 5D4OA 2HFVA 1SKSA 1RTZA 4ETZA 3CMAS 2FJAB 3P8BB 4Q43A 1OQ3A 3M2VB 2ZBRA 1UVMA 4B3OA 3CJ8A 3NWGA 1K0TA 2FVRA 4RW4B 4FN5A 1FTRA 4P9SA 3OLBA 4Q0BB 4Z37A 1X5PA 2APOA 3EUNA 3OXFA 2LA6A 4IG0B 5LOQA 4HLBA 2QA4G 3H42A 5IOLA 2GAGC 2X1GA 3VGUA 1W2BR 1AROP 4ZLLA 5DDOC 5A8WB 1HW9A 5D3GA 4EBCA 2Z2MA 3A8JA 2R8JA 1OSCA 1KQKA 3G6XA 2W4CA 4DQIA 4LT6A 2JWNA 3D9BA 3F44A 2EFOA 3S8SA 2WOMA 2QL9B 3AXKA 2PMZD 5L46A 4KH0B 1N4LA 1OYEA 2GV1A 2WCXA 1S0VA 1BE4A 2B4UA 1RHJB 4IH6A 3UD4P 1LWCA 3QGIA 3US5A 3UPFA 1QTMA 3SXLA 1N52B 2RKIA 1N0UA 2RS8A 4KR0B 1F1BB 1L3SA 4DG1B 3IM9A 2EFGA 3OFEA 4QR1A 2BDPA 3IRXA 3Q2TC 3CCZA 4PABA 4RW8A 1IR0A 4LF8F 1Q5VA 2HVZA 4GKKF 2O1PA 4ZHRB 3VAKA 1WC4A 2HVEA 1S1TB 2WHOA 3BGRB 3H98A 1N8RT 2ZNYA 4O3SA 4FS2A 3MPWA 2LQ9A 2J0QD 1HBNA 2EEYA 2UVWA 1RB0A 1JKHB 4GO5X 3KHRA 1QSLA 2ZUGA 2HFOA 3GCXP 3MOZA 3VAGA 1VQMS 1ZM9A 2LLZA 1OMSA 1X4BA 4MK9A 1LWFA 2RF2B 1Q8BA 4OHZA 4ES1A 1S0MA 3L7PA 3D7SB 1ACMB 1N88A 4K4TA 1GX6A 2QMWA 4F2SA 2BX6A 2CAJA 5BXIA 2KKHA 2OD4A 2CVIA 2ZKTA 4F0KA 3HLUA 3BBCA 3TARA 1S10A 2DGWA 2GVZB 2E7XA 3D66A 1VC6A 3PO4A 1U0SA 2B7CB 3DDKA 1H0HB 3PCOB 1HWJA 2F65A 3Q8YA 4P7TA 4R5PB 2HEKA 2IAJB 1VISA 1GAOA 1Y5NB 4ZLJA 4X62F 2ZH5A 4WKRA 3KLIB 3PX0A 2OSRA 2W2OP 4DFMA 2J6UA 4HI2A 6FD1A 1B64A 2GMHA 1ZPVA 3GFXA 4CI0B 5HSPA 2C2EA 1HWKA 2XNQA 2RJZA 3KLVA 5A2QY 3M8PB 4X66J 5M2RA 1B4SA 3GV5B 5CA5A 2OPQB 3R5DA 3PV8A 3G6YA 3J7A1 1KWMA 4Y2IA 1NHKL 1T11A 2BRKA 4ITSA 3UD3P 1IBLJ 1HARA 4YY3J 5JUMA 3TANA 3I5CA 1SPBP 1SI9A 3PR5B 3GE9A 4IG3B 3JYTB 1VQ5S 4ECTA 4X4UA 1PYTA 4ED2A 2LECA 4PAAA 4CQ1A 5JVHQ 3JB9k 2A0FB 1T05A 3O6QA 1RWPB 4E0DA 5HMXA 3TJ8A 1QDUB 2V8GA 2VJVA 4UW2A 4OI2A 3CC7S 3CD7A 1BHNA 2CJBA 3ENWA 4ED0A 3PG9A 4F4KA 2IM2A 2FVPA 1MWYA 2E1CA 3G82B 4OLPA 3CPWR 4WIQA 1NB7A 1VRTA 4R0JA 4CNYA 4CRJA 5KFDA 3VAHA 2H9ZA 3BV8A 3MM6A 4RW7B 4EK2A 1N5VA 2QYGA 1BUXA 3NCQA 3H0PA 3NG8A 4OIXA 1TKDA 2DNMA 3A8KA 3D6HB 2OAUA 9RUBA 4BS2A 1Q81T 5E2QA 1N32J 2F4VJ 1EQ0A 2RRNA 1PBUA 2HLUA 2BANB 3M30A 3QATA 1FJGF 1VHIA 1FHTA 3ELHA 1RYRA 3JQMA 4NA2A 1TFWA 2RQMA 2VFUA 1PO6A 2XHCA 2F5GA 3NNCA 2R7SA 1NSAA 1NUEA 1IM4A 4TU7A 4F3QA 2ADCA 1QSSA 3R2DJ 2EBEA 2XC9A 5LMNJ 3BPSP 1N0VC 2JHEA 3TZZA 2A2DA 3MMBA 4Y65A 1S76D 1QVFR 1CEZA 4L75A 4ZVUB 4YS2A 4ECRA 3CTRA 3DXSX 4NYOA 4DX5A 3HVRA 3KTQA 1C4CA 1P1LA 1TUGB 1S79A 3EVMA 1TL3A 2CQBA 1YIJS 4C8KA 4LF1A 5D0HA 4U7UD 1ZA2B 4MIBA 2ZJRQ 4DR6F 3HF5A 3H2UB 4DR2J 4P2FA 3IBFB 4XDDA 3MPVA 4DBQA 2K3KA 2Y0BB 3PJ9A 1FX4A 2OHDA 1RAIB 1VRUA 3H5UA 4ZJQA 2FZGB 3CB4A 3HHLD 3EPIA 3PW0A 3GMGA 3M1VA 4MKAA 2FJEB 1HMVA 4NLYA 2XBPA 2KRRA 5C25B 3J7YI 3W2VA 4F3OA 2KT5A 5IC6B 4FXWA 2FHMA 1N34F 4PWWA 3TUPA 2U2FA 3R7SB 2B9WA 1V9OA 4FDFA 4CO3A 5GAHU 1HBNB 3MURP 3PW5A 3RBDA 1CJUA 1UTAA 1ZAVA 3FC9A 4PXDA 2E44A 2B9XA 2RF2A 4JI6J 1WNEA 3X3UA 2VA2A 2QA1A 2JC1A 5E5NA 2UXCF 4ATNA 3D6FB 1RT3B 4DX7A 3FRZA 1HPZA 1LQ9A 2ZDOA 3VQTA 5KT4A 4X65J 3HHKA 2NSBA 4K4SA 1RI7A 2J7WA 3A1YG 3C15A 5KFXA 1YRTA 3DLEB 5H9EJ 2NSCA 3OUYB 1HNWF 3NNHA 2YNHB 2ZKUA 2GNKA 3EGVA 3KLIA 1U8WA 2MKCA 3I9V9 3PVXA 2KO1A 2V8VA 1SQEA 2VBWA 5KT5A 1VDHA 2HK2A 2RHQB 4W98A 2HFSA 1WTFA 4PG6A 2IA6A 4HT7A 3MEGA 1IJEB 1CS4A 5GADU 4DF8A 4LSLA 4HVZA 4U95A 4LBHA 5EWEA 2IJFA 2MQPA 2DB1A 2V0NA 4M5MA 4ICLB 2XULA 4RKUC 5DETA 2VASA 2CJQA 1VQKS 2HWIA 3AT1B 1DHMA 1KEKA 1JLCA 5KFPA 1OO0B 1FKPA 1MW7A 1W7WA 1GXTA 2GGPB 4LRAA 3ZZUA 4WFNQ 1S72S 1MLAA 3IR7B 1S6OA 2EVZA 3IAS9 3MD3A 1TELA 2B8PA 2OGUA 3FBBA 4MKVA 2GHPA 2MQMA 4P71A 3THPA 2XB2D 3D3BJ 4ED1A 4FP9A 5G0RB 3J7AN 2IYIA 4J9NA 2YNIA 2QFIA 3W7BA 1WDTA 4DI6A 3Q8QB 4M94A 3CMQA 2IRYA 3CULA 4ZPWR 2B5JA 4O0IA 3R97A 2FJVA 4DV3F 2D69A 4FF3A 2HVIA 2QLJB 4B3SF 3Q8UA 3U7JA 3OVAA 3O5TB 3AOBA 3MPDA 1VRTB 1HR0J 1X0FA 1JWWA 2JDJA 1R6YA 1HBUA 1O5JA 2GJFA 4UOCA 2MQ8A 5FDLA 3TZWA 2KH9A 1TVRB 2Q6CA 4U8VA 2JEFA 2E5GA 4DXLA 5K8MA 1S12A 9ATCB 4ZVEA 4DV7J 2HHHF 1WC6A 1BLUA 1TUWA 2C3PA 2BANA 4DCOB 1EKSA 2G0JA 4OX9F 3MTJA 3HULA 3L95X 2UUBJ 2RB7A 1N5SA 3H8YA 3EZ5A 1D9AA 3TAQA 4MYUA 1QAJA 4HHUA 4CLPA 2QZ8A 4YR0A 1V5VA 2KT3A 1LXJA 3DRRB 3DOKB 3PYEA 5KFRA 4EFAC 1RAOA 1NLKL 2MHNA 4EEYA 1DRZA 1KBRA 4DUYJ 1YKWA 4J9QA 3BYRA 3FBCA 3VTIA 4C0OC 2E5LF 4FYDA 4Q8EA 1NDPA 2CQ2A 2C3MA 2V8DA 3I9ZA 2OFHX 3TYTA 2BKOA 1SVDA 1U6ZA 2RDIA 1FERA 3T1YF 5DQHA 2RQ4A 1RLCL 1XNQJ 3QO9A 1I51B 2JX2A 2QSWA 3MTKA 4U96A 1TKZA 4GMKA 4CO5A 3EGNA 3J80U 3QT6A 2G0CA 1QVGR 3VAJA 1TKXA 3MR6A 1EP4A 1NB2A 2BE7D 5GAGU 4U6PA 5A76A 5DM7Q 3DCAA 4DSLA 4FF1A 4ZVPB 5HVGA 3OJUA 4DV6F 1VK3A 1RBLA 3TR5A 1NK9A 5IM0B 2V9KA 1C0UB 1L3KA 3FFIA 1CJUB 2LVWA 5BR8F 3P96A 1CJTB 2IM3A 3J7Z5 4Z7YA 2NLWA 1B3TA 4DR3F 2N3LA 4YFUA 1FRXA 1UEKA 5LMNF 1KVIA 1NAQA 3IBCB 5B7WA 3C6TA 5K9FA 3OSPA 4L3NA 2LCWA 4WF9Q 2HNYB 5CZXA 3QT5A 2XLIA 3KFWX 1PC4A 3DLEA 2C3UA 2VPYB 3PFEA 2DHGA 1DTQA 2G9OA 4K0KJ 4Q2MA 4NXNF 3DM2A 2YNHA 3CSKA 3U1MA 3D6TB 4PG8A 4O3RA 1U02A 2RQKA 3KOAA 3EXYA 1F3FA 1MNEA 4LF4J 2OPRA 2W1BA 1N32F 3MEGB 4DU7A 2ZOMA 4Q45A 5ETPA 4OLOA 4CH0S 1YWXA 2R3VA 5E3RA 3DOMB 2ZDPA 3SCLE 1NKCA 5AXMA 3GPAA 4DV2F 4FZVA 4LRFA 1AFIA 2CNOB 2D9OA 3SFGA 4AT1B 1VOMA 4ZMMA 4KRWA 4DR1J 1OQ6A 3MMCB 2X1FA 1S99A 3A8IA 4TN2A 4A8QA 3VGSA 1U1PA 2PIIA 1XNRF 3ZTPA 2VZ9A 3M9NB 1WELA 3HKZD 2XYHB 2VG6B 3NCPA 2AGPA 2YKNA 5A0YA 4KV8A 1U2RA 1FNMA 2GHVC 1WC0A 3GWCA 3BREA 3G6VA 3CD6S 3QBCA 4K4YA 3LQVA 3DLJA 2OMLA 3HZEA 2V2VA 3GIMA 1LW2B 4TQSA 4ECUA 4YY3F 1SH2A 1VQ4S 3VF0B 1UVKA 2B8QA 1N5QA 4Y2KA 4R8UA 3S6EA 1X60A 1NKEA 5B09A 2DCUB 1VHFA 2FQQB 1TL1B 3P5TL 5AJ3F 1T3NA 4CT8A 3M6UA 3KG4A 1ZOTA 3N6NA 2J9DA 3TP2A 2AJFE 4ES2A 2MZTA 2C28A 1HI8A 1VRQC 3FBEA 1Q7YT 4O4GB 3VR1A 4DFKA 1ITPA 2QV6A 4UF4A 1OY9A 5IT9Y 1D3WA 3ZZOA 5DLGA 3SSRA 2MYFA 1OYDA 2WSEC 2YPZA 5IV3A 2VQFF 3QGPA 1NM2A 1UW9A 1S48A 4YMEA 1HYSA 4K59A 1AXQA 4YB6A 4ZVGA 2VOPA 3TI0A 1P8GA 1GMUA 2W7OA 1KTVA 2HHVA 3HKWA 3MUVP 3CDAA 2RDJA 3PEHA 3Q8PB 2H4WB 2MKJA 2MLZA 3EE3A 4ZP9A 4DL6A 1NK4A 2NREA 1EHWA 5F8MA 4NOHA 4QIEA 2E1AA 2WW4A 3NS5A 2FB0A 5KOWA 3UN3A 4S0MA 3BQ1A 2HHSA 2W01A 3HSJA 1IBLF 1AA1B 4ZPDA 5L39A 4B3RJ 4RUAA 3B78A 2B6AB 3OL6A 3EDQB 3RBEA 1Q86T 1LXNA 3CT9A 1JXEA 1RQ0A 2WVFA 2JJ4D 3CD5A 1HKAA 2AJ1A 2HHQA 2HBYB 3AQPA 2HQGA 3LTOA 4K4XA 1M0SA 2FDNA 1FK9B 2E1PA 4KAIA 8RUCA 3KHLA 2HNZB 3VAFA 3IA0A 3BSOA 3GP9A 4I1TA 3MUTP 2BQ3A 3TUJC 5IM0A 4RR5A 5J1NA 3QRPA 1Q8LA 1DQAA 2R7QA 3PYFA 1GXLA 1RISA 1SUQB 1Z1ZA 2EKNA 1LOUA 2IM0A 4LR7A 4RLEA 4XAKA 3SQGA 4RPFA 5KFZA 2HZCA 2BR0A 2DR7A 1RAEB 3ZZTA 2B9EA 2RU9A 5SZTA 4JI2J 5DJBA 4BC7A 4DR7J 1FDDA 1RTJA 4RBUA 5L1JA 3FCVA 2PA3A 2W9BA 3JXOA 4RL1A 1E6YA 4CLZA 2HZAA 1SBRA 3CCWA 2FJXA 2D9PA 1Q53A 2E5HA 1TP7A 2C1EB 1RT2A 2GX8A 3SIPB 3TAMA 1KR4A 1S1UA 1TL7B 2ALYB 2FHJD 5E3QA 2Y1RI 3W60A 2LXIA 1OPIA 4O3PA 1G6BA 1IQZA 2JFDA 3KNGA 3T41A 1MSWD 2YWEA 1FRLA 2YWHA 4F50A 3TVZA 3GJSB 3PTWA 2JC0A 5A6WA 2EG2A 2FPHX 2FHJA 3JAMY 1XR5A 1YX2A 4M5GA 2DITA 1FEEA 1NSPA 3MMCA 3QRRA 3KK1A 1VQOS 3CGIA 3NKYA 3C46A 1Y00A 4RW6A 4DUZJ 4Q7AA 3V81B 4MH8A 4PG5A 1WD6A 3DHXA 1F5BA 4JBCA 5CH7B 2Z4PA 4NA1A 2E5LJ 7FD1A 1RGVA 4E8UA 4DSIA 2ZZTA 3BH7B 3QGGA 5ETTA 4JI0J 4KFBA 1FA0A 1X31C 4USWA 2EC2A 3AB2B 2BKPA 3I0RB 5I3PA 4B02A 4JV2A 2Q66A 5KT7A 2UXDF 1TL4A 3GIRA 4ZCMA 2ZOFA 3BGLA 1UJ4A 3B4DA 3HP6A 1K9MT 2LDYA 1LW2A 4G3IA 5H9FK 3TW0A 3IO1A 5CD4A 4F02A 2AQ4A 1Q1KA 3M2RB 3F73A 2I0XA 3FCHA 3LANA 2AX1A 4ANCA 2V4RA 5BYSA 2H48B 3M8QB 3HFKA 2GW8A 1WG5A 1UVIA 4QYZK 4D3HA 1B0PA 4IO1A 1U8SA 1KFSA 4Q0BA 4D3GA 4M5KA 1IKYB 3GV8B 5HANA 2Z30B 2UV8A 1Q16B 4O4GA 2CG8A 2HFUA 4NASA 4ZS6A 4IO9Q 1U1QA 4I7FA 1ZH5A 2CPHA 4NLWA 3PZPA 4KE5A 5A8WA 4X4NA 1FXRA 2HNDA 2MQOA 3E51A 3Q86A 1GMWD 3A3OB 3ETMA 3CW2C 1AT1B 2FVQA 3GQCA 1V3ZA 2G1DA 4Y0FA 4X4QA 2NR0A 2BVZA 1SC4B 2W4PA 4E2FB 1TFYA 3PXGa 1B7FA 2AJ2A 1FDAA 3THVA 2A2CA 1MMDA 4ZLNA 1FT8A 4OZ2A 2QG9B 4OJ1A 4Q2LA 1L5UA 3C3LA 1NO8A 3SCIE 1BY9A 1YK9A 4K7QA 3OTOF 3AA9A 3UN2A 4LREA 3R5GA 4DSKA 2RMLA 3GR0A 3W66A 3IRWP 3P4UB 4OI3A 3D28A 4ZVFA 1RABB 1M5HA 4RW9B 1IBKJ 1S6PB 3G96A 2VHGA 5DQIA 4ILLA 2FC9A 2HS3A 3GZ7A 1FK9A 4MK7A 1PG5B 1WDDA 1HNWJ 2VL1A 1H38A 2ZE2B 4OZ5A 1T3OA 3SYZA 4K50A 1I1GA 4IOCQ 2E5IA 3LOUA 4DR2F 2ZNZA 4KYZA 1OPZA 1SUQA 1PIEA 3SQGB 3AJ1A 1S9EB 5D4PA 5A8KA 2EW9A 5G4DA 5C24A 3BKTA 3CMES 2GAHC 2Y8YA 2DEJA 2VH7A 1YG0A 2HRUA 3N6LA 4WFBQ 1APSA 4WXWA 1LFWA 3CCMS 5ETVA 2ZZNA 3DN9A 3NS7B 5DZ7A 3M9MB 3U1LA 2EKYA 3UWTA 5LMUF 1UW4A 3ZXWA 1JJ4A 3GSDA 2C22A 4GO7X 2ACMA 3PX4A 1S0NA 1R8CA 1CG2A 3HCXA 5J2PA 4NL5A 3BN7A 3JS9A 3LP0A 3TRGA 4N77A 2OLWA 4JI4J 3NBPA 2AJQA 2ZH6A 3C66A 3R5AA 4IG3A 4TU9A 3JYTA 4OX7A 2ZHAA 2PMHA 4WTYA 2F8MA 4M5JA 3OL7A 2G2YA 3GJRB 4ELUA 4X4SA 1LWEB 2YVSA 3K5LA 2DNQA 4WU2A 3RW7A 1BMQB 3D0HE 2JLGA 2C2KB 4ELTA 5HBMB 3E8OA 1CBKA 1WEXA 1DY3A 4NYZA 3N9UC 2DNGA 2ZH8A 3X1LB 5DQGA 1HI1A 1VBXA 2KVIA 3V6KA 3CDBA 3DRYA 1RT1A 2BOPA 2N7YA 3NMRA 2O3DA 3C16A 4WYLA 1T7PA 2FVCA 3D0GE 3T5KA 1S7IA 3KHHA 2DR8A 1XNRJ 5IS2A 3DYAB 3LP2B 1HD1A 4AXJA 1CQNA 1U47A 1Q8IA 4ZVSB 2C3YA 3FEXB 3G2XA 3QAUA 2DRBA 2J0XA 4C8MA 4HH1A 2VG7B 1I94J 2BJ1A 3THTA 4DMZA 3TX8A 1R0AB 4GKJJ 3FDSA 1DTTA 4ZPBA 3JSYA 5F8HA 1S57A 1WWHA 2XMKA 4BLGA 2V4JB 3FGVA 4F36A 4K4VA 4U7UK 4CNZA 3MM5A 5GMKa 2W8LA 1CVJA 4WZMA 2CJXB 1RAGB 3BZQA 3OD2A 1HNXF 1U7LA 3DC2A 2I9SA 1SH0A 3CJKB 5E3AA 4CLLA 4CT9A 3T6BA 2DBBA 1C0TB 1P27B 2RUGA 3JTOA 1D09B 2D74B 2V2ZA 3DRSB 4WP3A 2BMBA 2CQ4A 3SV4A 2UVRA 1S4EA 4UTGA 2IBOA 3TUZC 1U24A 3KK3A 1RCOB 3OL9A 4OHXA 2DVIA 3HHLB 3VZHA 3H20A 4FYYB 4QBUA 2VIHA 1KN6A 4NX9A 1P1TA 2V2QA 3ITHA 1CULA 4DR3J 4TXSA 4TU8A 3VQSA 2XMMA 3Q83A 3I56S 4J9KA 2MEWA 2OJ3A 2VFRA 1RTDB 1VRUB 4O3QA 4F0MA 4P74A 3QT7A 3MFHA 1HMVB 2BJ9A 3FEZA 2CDRB 3GCWP 4KBIA 2RS2A 4QPXA 3MPYA 2HZVA 2MPUA 4LF8J 2YNFB 2LFVA 4M5IA 4FF2A 1E6VA 1HBMB 2ALZA 4XPCA 1HNZF 2ZJQQ 4J9SA 4TYBA 4JI1J 1J5OA 2QYCA 1NU4A 3PRVA 4DR7F 2HURA 4GVBB 4QQBA 5HP1B 2CQ3A 1IKVB 2LQ8A 3FSYA 4YB7A 3MECA 3QFHA 5B0BA 2HVDA 3SCKE 4Y2AA 1T9XA 2AW0A 3DRPB 1FVQA 2IVMA 4ID5A 2IJNA 3AAWB 4TLQA 4DS4A 3C15B 1VQ6S 3G9CA 5AE3A 4O3NA 3FQLA 3OUYA 1YI2S 4WFYA 1LFPA 3CD0A 2VFVA 4MYTA 2H4YB 1KLNA 1VYAA 5K8PA 3LALA 4F0HA 1Z4UA 2M7SA 1NKBA 1SC1B 1SKRA 5FD1A 2UXBJ 3LGMA 3KLGB 2DR9A 5T7LA 3O2IA 4HHHA 4ZCKA 2AKWB 4NMLA 3OSNA 1HD0A 4PG7A 3KLHB 3FMWA 1S1XA 3ZTRA 4G1IA 3L4BC 3FK4A 2KHDA 4UOHA 4DV4F 4QU6A 2JVOA 4USVA 4NWBA 2AV5A 2YNGB 4M95A 3UVJA 4KT0C 3GG0A 2B9YA 1FKPB 3J7ZT 5IT4A 4M5DA 3J81Y 1LWCB 2O5DA 2GJ2A 5HJXA 2OEKA 1IBCB 2DYAA 5GMDA 2FJDB 2W4DA 3HT0A 2XM3A 2OIHA 2UU9J 1QE1B 2CIMA 4DDFA 3L3CA
chains in the Genus database with same CATH topology
2G0IA 4PEOA 2G0JA 2IDLA 1S12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G0I A;  4PEO A;  2G0J A;  2IDL A;  1S12 A; 
#chains in the Genus database with same CATH topology
 4ZVH A;  3GYN A;  4O3O A;  4F4A A;  2LYV A;  4WU3 A;  4RUC A;  1S1T A;  2FHK A;  3DLG B;  4RJV A;  3RUB L;  3PJW A;  2EG1 A;  1U49 A;  4ERD A;  4PRF A;  3GYG A;  5CYQ B;  1K44 A;  1T94 A;  4DSF A;  1S1W B;  2IA0 A;  4DUY F;  1M5K C;  1B7Y B;  4OYW A;  1JKH A;  3HJF A;  3JSM A;  1DBD A;  4NYP A;  1RT1 B;  2V69 A;  3RTV A;  2PD1 A;  3GJT B;  2MY7 A;  3L09 A;  3C16 B;  4KY3 A;  3WIV A;  4ED4 A;  4WTO B;  5L8R C;  2ROE A;  3NOG A;  2DO4 A;  1N33 J;  1JNR B;  3JAM U;  5AJ3 J;  1YZ6 A;  2DNN A;  3H5Y A;  2VQE J;  4KC5 A;  2W25 A;  3FCW A;  1RYS A;  4NLG A;  3T9N A;  1IBM F;  2WK4 A;  3T5L A;  1S6Q B;  5KFQ A;  1JK9 B;  2VD3 A;  2CNL B;  4F7V A;  4A48 A;  2XEX A;  4CZC A;  3OLA A;  2D3O R;  3RBX A;  4HH0 A;  3R7B B;  1KLM B;  1S4F A;  2YWF A;  3I5A A;  3G8S A;  5KFN A;  4YHH J;  1DTT B;  1HHT P;  2YQ1 A;  2HHP A;  2UZA A;  4NLP A;  2R2S A;  1XN9 A;  2I8E A;  1X4G A;  4J9P A;  1NPK A;  4GC7 A;  3M6W A;  1VCT A;  3NGU A;  3TVK A;  1BQM A;  4DFP A;  1RKI A;  5A2Q U;  2QX0 A;  5HQM A;  3DOK A;  4P2M A;  2AWZ A;  2CG4 A;  3Q8V A;  1VLO A;  2FLO A;  2AJ4 A;  4ZPT R;  2OPQ A;  2FTR A;  3CF5 Q;  4XK8 C;  3ISN D;  1WHV A;  2DH8 A;  1U2C A;  3J80 Y;  3U02 A;  1KSP A;  1D0E A;  2QO3 A;  2N3O A;  4IQM A;  1Y5I B;  4CLF A;  1XJW B;  2VON A;  2UXC J;  2KXF A;  5F0W A;  1S97 A;  3DFE A;  3QO9 B;  4PPD A;  4MIW A;  5J1P A;  1GEH A;  2V8P A;  3ITH B;  1CUL B;  1AYE A;  5EWF A;  1XC9 A;  4OI4 A;  2CJK A;  2Z0G A;  4GKJ F;  2DH7 A;  2JL9 A;  2LEA A;  3ZZ0 A;  2ABY A;  2CZ4 A;  1EKR A;  3NOC A;  1IJF B;  5L38 A;  5LSL A;  2AYG A;  4NXM F;  4I67 A;  4KO0 B;  3M32 A;  5KG1 A;  3IN5 A;  3ILI A;  3CUN A;  1PCA A;  4LF4 F;  1FFG B;  1QY7 A;  1X4D A;  2HWT A;  2HGL A;  3QAE A;  4YEA A;  2EFQ A;  1HWU A;  3BB5 A;  1S6U A;  4G1Q B;  3CCU S;  2KZZ A;  3G82 A;  4V19 J;  2KFN A;  3NLC A;  2YNF A;  4UY8 5;  4NLD A;  4NLV A;  1HHQ A;  3H2V E;  2F3J A;  4NXM J;  2AYE A;  2MKY A;  1CJT A;  4OHW A;  3KUH A;  4PKD B;  3Q0A A;  3Q23 A;  2N82 B;  1J5O B;  1V3R A;  2K7K A;  3ETO A;  2KM8 C;  3E2E A;  4HEA 9;  4MKY A;  3BH6 B;  1WUU A;  4GVB A;  2YWK A;  4B3T F;  4I68 A;  2AJ0 A;  4I6W A;  3HMJ G;  3WX4 A;  3WIU A;  4CM0 A;  2FUG 9;  2DIV A;  3EVO A;  5HVF A;  3IS9 A;  4JOU A;  3M30 B;  3VAM A;  3R27 A;  1N56 A;  4X64 J;  3T5J A;  1XK8 A;  3V6D A;  4TYA A;  4CDI A;  1DTQ B;  1Y11 A;  5KTQ A;  5DGB A;  2BRL A;  1LK7 A;  5MAO A;  4C9D A;  2UV8 G;  4LBP A;  3UDV A;  4MFB A;  5KFW A;  1H7W A;  3GIJ A;  2YKO A;  2KI2 A;  4IH7 A;  2NXC A;  2QSF A;  3UE2 A;  5T7L B;  4KSE B;  1HNI A;  2UUW A;  1SKU B;  1YJU A;  2LEB A;  4JB8 B;  4ZN1 A;  1D9F A;  3MMB B;  2QL7 B;  4USH A;  3MF5 A;  4RNN A;  5EN1 A;  3D2W A;  1YJW S;  2A1B A;  3VCD A;  4ZVQ B;  2ASJ A;  1PAE X;  5LMU J;  1RT4 B;  2C3O A;  3AFG A;  1RK8 A;  1U09 A;  4M5D B;  1IN0 A;  1XMB A;  3AJD A;  1SL2 A;  2RRB A;  4ETX A;  2OP5 A;  5K20 B;  1NH8 A;  5C2C A;  3EIC A;  2V94 A;  3IC1 A;  3ZZY A;  1QE1 A;  2VJU A;  2HWH A;  4HTI A;  1Y5L B;  3V6H A;  1UPM B;  1WTB A;  3M2V A;  4DX8 H;  3H5S A;  5E41 A;  5HRO A;  4B3O B;  2IFX A;  3MMJ A;  3PO5 A;  3V2U C;  4ED8 A;  1FD2 A;  2EC0 A;  2IIH A;  5CCL A;  2R8H A;  1U1R A;  5ETN A;  1UA1 A;  1PSD A;  2KB2 A;  4ZPC A;  4Y00 A;  2DNL A;  3KUE A;  2Y1I A;  1RT6 B;  3HHE A;  1EB0 A;  2CUY A;  2WVC A;  4Y3C A;  4ELV A;  3P49 B;  1XR7 A;  1QLN A;  2Q6B A;  2FY8 A;  4DL7 A;  3R6L B;  3GIK A;  2C2R A;  1K73 T;  4F4X A;  2CQI A;  3R5C A;  1REG X;  3W62 A;  4ECV A;  2FLN A;  4LFC F;  2XTJ P;  1HQU A;  1XMO F;  1HPZ B;  2XG8 A;  1KNZ A;  5GAH I;  2HQC A;  5KAK A;  4FYV B;  3VV2 B;  1MRO A;  1P9Y A;  2WOM B;  4OZL A;  4MK8 A;  3WDO A;  5F8J A;  1JMT A;  3RR7 A;  4JI3 F;  3W9I A;  4F26 A;  4N8N A;  1DLO B;  1XR6 A;  4QYZ J;  1XTZ A;  1A6L A;  1HNV B;  5CD4 H;  1BQM B;  2BJ3 A;  5J1E B;  2KXH A;  2OTL S;  5F9N A;  2NPI A;  5BYR A;  4RW8 B;  4ZIW A;  3D6M B;  4KGV B;  3ULH A;  2Q1L A;  3PW2 A;  3SSQ A;  4ZHR A;  2F1F A;  1H2V Z;  2X3G A;  3UD5 A;  1JLC B;  4ED6 A;  2IMW P;  1K1S A;  4IDK B;  1FXD A;  3N0V A;  3IMQ J;  3CJ3 A;  1WJ9 A;  2BJE A;  2HGN A;  3O3L A;  5D0G A;  3PDN A;  5ETQ A;  2VDH A;  3QSY B;  4K4W A;  2DXE A;  4PXE A;  3KG1 A;  3FJ2 A;  3MWB A;  2YNI B;  3F41 A;  3R5J B;  5ETS A;  4JV5 F;  3BR8 A;  1VJQ A;  2D41 A;  4RBV A;  4DQS A;  2BM0 A;  5LM7 E;  2KM8 B;  1YVF A;  2ZEJ A;  5JVG Q;  1IXK A;  3IGN A;  3KYL A;  2XMJ A;  5AT1 B;  2ATL A;  1U48 A;  3W8G A;  2BKN A;  5AXK A;  2QGF B;  3R1H A;  1QAI A;  4N76 A;  3HK2 A;  1S49 A;  5KG0 A;  5IQQ A;  1FRJ A;  3UDL A;  4DPT A;  3PKY A;  1U0H A;  2WB1 D;  4AUK A;  4LF6 J;  2SXL A;  3W5Y A;  3W1Y C;  1ZTT A;  2H5J B;  4UY8 T;  3OFG A;  4F25 A;  5IC4 B;  4WPA A;  1FE4 A;  5DO2 A;  2P6S A;  4EUV A;  1V5I B;  1URR A;  1SH3 A;  2IDE A;  2MKH A;  2M3D A;  2A10 A;  2BV3 A;  2YKA A;  3IG1 A;  4HR2 A;  5HI7 A;  2YPY A;  2BM1 A;  2YX7 A;  3TUI C;  2P2C B;  4N8O A;  2YX4 A;  1RE1 B;  1XMQ F;  4V19 X;  1GTH A;  4ED5 A;  2CQ1 A;  1BC6 A;  3V6D B;  4Y2C A;  3MI7 X;  2ZM6 J;  4WK1 A;  3MD1 A;  1N48 A;  3FBF A;  3LGH A;  2DR6 A;  1RT2 B;  2MST A;  3LA0 A;  3TAM B;  3R5B A;  4JI1 F;  4QU7 A;  4CYU B;  4RWX A;  3QIP A;  3BM7 A;  1U26 A;  1MMN A;  2H54 B;  2L9N A;  5GME A;  1R43 A;  1CJV A;  5FLX U;  3HHN B;  4QIF A;  4C8N A;  2GO9 A;  2AMC B;  3PW7 A;  1RT4 A;  1V6H A;  3VAI A;  2HHU A;  2BE2 A;  4DF4 A;  1M5O C;  2YH1 A;  4DOZ A;  3B6B A;  4USM A;  1F2G A;  2PMW A;  3HSD A;  3Q8S B;  1ZTW A;  2ERR A;  3CDW A;  3Q2S C;  4X84 A;  1VBK A;  5MLC V;  1HWL A;  1F6T A;  4I2Q B;  4RW7 A;  2GFF A;  4ZP8 A;  2P6T A;  4LSN A;  5KFI A;  4X64 F;  3NWR A;  2EI5 A;  1SKW A;  3MCN A;  1JIH A;  4GVL A;  4FKY A;  3W5Z A;  2D3Z A;  2ZUA A;  2CQP A;  4EU0 A;  3SI8 A;  2ILY A;  5FII A;  3OTD A;  4M63 A;  3D1O A;  3B54 A;  1NME B;  1Q4R A;  3LPE A;  5DM6 Q;  3HVT A;  4FYW B;  2JVR A;  1VC5 A;  3CO0 P;  3CIZ A;  5KG7 A;  2AZ1 A;  1R0C B;  4DN9 A;  3CJ0 A;  5HMZ A;  1ZET A;  2AF6 A;  2CJY B;  4NCG B;  3K89 A;  1WSV A;  2VPW B;  3JTN A;  4Y28 C;  1HL6 A;  3ZFV A;  4LF2 A;  2HNY A;  2J6T A;  4DJB A;  3NNA A;  2PFF B;  5U47 A;  2Z57 B;  2MXY A;  1VC0 A;  2XYP B;  4I7F B;  1TL3 B;  1NEE A;  5D77 A;  4EBD A;  1QD1 A;  3P6Y C;  3FNN A;  5F8N A;  4ECW A;  2XI2 A;  2WZ1 A;  5J1E A;  4NRU A;  5I3U B;  4LF7 J;  4M5H A;  4H4M B;  3M1V B;  4DQQ A;  1KDN A;  4KQZ A;  1UJ5 A;  5AXL A;  5DLF A;  2A3J A;  3VWS A;  1ELO A;  2DTJ A;  1SB6 A;  2PA8 D;  1F5A A;  1H2T Z;  3KXD A;  4C0H A;  4DS5 A;  4A8K A;  5DGA A;  1RT7 B;  1GX5 A;  1HW8 A;  1TK8 A;  4V1A k;  1RAJ A;  1K47 A;  1VIO A;  3D54 A;  1H74 A;  2MQQ A;  4FPR A;  5CAB A;  4DR4 F;  3QLH B;  4NRT A;  4AD6 A;  2M8D B;  1A0O B;  2G4B A;  1JQG A;  1PJ6 A;  1RHR B;  2YKN B;  1RHM B;  2UP1 A;  1RTI B;  4B9L A;  1SJF A;  2LEP A;  1TKT A;  2GML A;  1AUS L;  2Q43 A;  3M7V A;  2G2Z A;  1F5C A;  1ZAX A;  1ZPW X;  5H1S V;  1PYS B;  4WCE Q;  4ZK7 M;  3NRB A;  3M9O B;  4QOT A;  3LGN A;  3KKF A;  1TMJ A;  2ZE2 A;  3PRD A;  4JP8 A;  1U0H B;  4XDC A;  3TEH B;  4N47 A;  1Q95 G;  5ETR A;  3OTO J;  2VC0 A;  2HHT A;  2LKZ A;  3GG1 A;  4Z7C A;  4R8U B;  3ADA C;  1BWV A;  2W2Q P;  1DQ9 A;  2HS0 A;  1NHU A;  3MCM A;  2RAQ A;  5CHC B;  2AGQ A;  2YKQ A;  3UNY A;  2IBK A;  1FVS A;  2L41 A;  4DPU A;  1YSJ A;  3QMQ A;  3WBZ A;  3EZO A;  1JLQ A;  2R7R A;  2MSS A;  3C2P A;  2QMU B;  5BR8 J;  1FNX H;  5IV4 A;  1RT5 A;  1JLG B;  2H65 B;  3LO3 A;  4NI2 A;  4LF6 F;  2PEB A;  2OH2 A;  2XHW A;  4TY8 B;  4JUZ A;  5A8R A;  2YTC A;  3VZI A;  1X4F A;  4CO0 A;  1NPR A;  3I5B A;  4P52 A;  3G8T A;  2DO0 A;  5J2M A;  4QWC A;  4USI A;  3IAM 9;  4CYU A;  3BR9 A;  2WON B;  4LJM A;  5G0R A;  2R2R A;  4NLX A;  2CJ9 A;  3PW4 A;  3TAP A;  2CPF A;  3POT B;  3R9L A;  3EJM A;  1XBW A;  1WOS A;  3EXC X;  2MJU A;  4J37 A;  3PFO A;  4R0E A;  5C5J A;  1YJV A;  1FNO A;  2VBZ A;  4IFY B;  5HJY A;  3SDE A;  1KD1 T;  4K0K F;  3T1Y J;  1JJ2 R;  5LSR A;  4C8L A;  1RTH B;  3D68 A;  3UDC A;  3NL0 A;  3FQK A;  3FZ2 A;  1JB0 C;  4QYR A;  2RQC A;  3U1N A;  4I2Q A;  1UAW A;  1HBU B;  2CPZ A;  1PIL A;  2QN6 B;  2GJI A;  5GVQ A;  2R7O A;  2AGO A;  2HMI B;  1MN7 A;  1NHV A;  2AHO B;  2IDL A;  1JXV A;  4EI2 A;  2CPD A;  3EDR B;  5LSO A;  2HKE A;  4JI8 F;  5M2P A;  1REV B;  2RIJ A;  5CYM A;  2AIR B;  4JI8 J;  3HXM A;  3OPK A;  4AQY J;  4NCA A;  3L7U A;  4WFA Q;  2XLJ A;  1YQH A;  2E29 A;  2PO4 A;  2VBY A;  1KS2 A;  2LXF A;  2ZBI A;  4J9O A;  2QLX A;  3AA8 A;  3W65 A;  3HVT B;  4NPO A;  3KHG A;  5ITH A;  1WF1 A;  3DLH A;  2CWX A;  5ETK A;  3LP2 A;  3BO3 A;  1RAC B;  1YJR A;  3LF0 A;  1WOP A;  4A8O A;  3DMJ B;  3DRR A;  3SCJ E;  4OYZ A;  4H4O A;  1YGY A;  2E5J A;  1B0T A;  1MU2 B;  1S1V B;  3FVY A;  4WE1 A;  2XGP A;  2H1Y A;  3D3C J;  4PXB A;  4TLR A;  3SBM A;  4LFC J;  1QAX A;  2RU3 A;  2DNH A;  1FKA F;  2Q79 A;  3P45 B;  4KGM A;  2Y1J A;  2PFD A;  3WC0 A;  2MLX A;  2RH3 A;  1T03 B;  1D1U A;  1RJJ A;  3MM5 B;  2CFX A;  2BOA A;  1H7X A;  2HGM A;  4YDD B;  1C1C B;  5K8N A;  1NH7 A;  4YN3 B;  3CJK A;  1S1U B;  3TVY A;  3D4J A;  4P72 A;  3AHP A;  3VVU A;  2XZW A;  3M2U A;  4JYA F;  1R6V A;  3PM9 A;  1WG4 A;  2BYC A;  4QZV B;  1VLY A;  2WTF A;  4CO4 A;  3CCS S;  5K5M A;  4LF5 J;  1FWK A;  3ISN C;  2XY6 A;  2MDA A;  2P9E A;  1TKX B;  1M1H A;  2J7U A;  4QWB A;  1W26 A;  1Q79 A;  5DG7 A;  2ACY A;  3MM9 A;  2MGZ A;  3HI9 A;  2EWH A;  4I4B A;  3GIL A;  4WJB A;  1SJ1 A;  2R4F A;  3DLK A;  3QJJ A;  1EAY C;  3HVW A;  1EQM A;  1RT7 A;  4DUZ F;  2WAQ D;  4CLK A;  4DLG A;  1RWW B;  3CJ2 A;  4DUT A;  2X1A A;  2QTW A;  3NGK A;  4PR6 A;  1N36 J;  3AXM A;  5L9X A;  1ZZN A;  2RVJ A;  3OBI A;  3ZTO A;  3A3P B;  3V5R A;  4J7C A;  4U67 Q;  2J5A A;  1EJ7 L;  1FFW B;  1LK5 A;  1VQS A;  1XER A;  3CJS A;  2R8G A;  2J8S A;  2LXU A;  2F9J A;  4DQR A;  3BYP A;  3M6V A;  1E6V B;  1HBM A;  3DNC A;  4J9V A;  4KHR A;  2VUG A;  4XIU A;  4LBI A;  2XCP A;  4DV3 J;  3A13 A;  4EZ9 A;  2GZO A;  2F8E X;  1JLB B;  2GVD A;  3OR2 B;  4QIV A;  4RO0 A;  4EYH B;  3W3S A;  1R89 A;  2HBR B;  2E1M C;  1RU1 A;  1GK8 A;  4O23 A;  4USK A;  4EYI B;  4L3K A;  2IVF B;  1RAH B;  2GQQ A;  2D1C A;  3CIM A;  2WVE A;  2E66 A;  4X4V A;  2NCK L;  2AEJ A;  4OYO A;  3ZZP A;  1EET A;  1RAD B;  1JLQ B;  4C2M A;  1IKY A;  1I3O B;  3UNG C;  4CLU A;  4PQA A;  3OL8 A;  4LF9 J;  1GTE A;  5KFC A;  1F60 B;  1RT5 B;  5DG8 A;  2PE8 A;  3KDO A;  5DS7 A;  1U1M A;  3OHB A;  2ZJP Q;  1KVJ A;  1X4C A;  4TY8 A;  4MIA A;  1HHS A;  4F4Z A;  3KMS A;  2NXU A;  4P2X A;  4CLW A;  4CIO A;  3ZZR A;  3H25 A;  2R7U A;  3P5B P;  4LR9 A;  2LQB A;  2QC3 A;  3BKF A;  3MED B;  4LRD A;  2XS5 A;  4F3M A;  3QRQ A;  2PSZ A;  2GC8 A;  4WK3 A;  5H9E K;  3A8E A;  3IWN C;  5GAD I;  2C2N A;  4XTT A;  2UVU A;  2C2O B;  4UZC A;  1VQY A;  1B0V A;  1FES A;  3JSR A;  1WKJ A;  1WOR A;  2GS8 A;  1Y7P A;  4YOE A;  3ISZ A;  4KGZ B;  2DRA A;  3OTC A;  3TNV A;  4B3R F;  3UQS A;  1QJH A;  3EYZ A;  2DNZ A;  1T9V A;  3HJV A;  1OJ4 A;  2LU1 A;  3LH2 S;  2BEF A;  4WII A;  2PDA A;  1S77 D;  2FY1 A;  1N5Y A;  4PEO A;  2MKI A;  1ZBT A;  1YRX A;  3T5H A;  5KFS A;  3M8Z A;  1REV A;  5CYM B;  2OPS B;  4OYB A;  1VQP S;  1XMO J;  4UT4 A;  4A8F A;  3JSM B;  2EPI A;  4LQ3 A;  2Z58 B;  4WFZ A;  1JLF B;  4YP3 A;  5SUH A;  5EHH A;  2DR5 A;  3MR5 A;  2C2M B;  2ASY A;  3UDE A;  4ILR A;  2VQF J;  3ONQ A;  2GMJ A;  5J2N A;  1N34 J;  4DQP A;  4NXN J;  4AYB D;  4FBT A;  2DY9 A;  1YRU A;  2YBV A;  5A8K B;  4O4R A;  5JXS A;  1HYS B;  3K7R A;  5RUB A;  5HK4 A;  3PX6 A;  1M5P C;  2PT0 A;  4PPZ A;  3VGT A;  2VFT A;  1CC8 A;  2RNE A;  1RUS A;  2MTL A;  5I42 B;  4DV2 J;  4DSE A;  1RDR A;  1KLM A;  2UUC F;  4UQT A;  4B9S A;  3FEY B;  2KJW A;  3Q22 A;  2CZV C;  1X4A A;  5F41 A;  1CJK B;  3AY0 A;  3OT9 A;  1IKX A;  2HRT A;  4I6A A;  4KKO A;  1T9U A;  5KFU A;  3IBW A;  4YUD A;  3HD1 A;  1U2F A;  1HQE A;  1VFJ A;  3LPY A;  4WWS A;  2L48 A;  2WSC C;  3W63 A;  3K5N A;  4TY9 A;  2JLF A;  2Z8Q A;  3CJT A;  3ZTQ A;  4CLT A;  2ZM6 F;  3EPG A;  2ZH3 A;  4ECQ A;  2J0S D;  3CCE S;  4KHP F;  2YY3 A;  1VGY A;  3VGV A;  3UCU P;  2UU9 F;  5CQG A;  3AB4 B;  3QPI A;  2V68 A;  4XPE A;  2MZQ A;  1T9Y A;  2KG1 A;  3MFI A;  3RAX A;  1U1K A;  4LFB J;  1F0X A;  2G13 A;  3MEE B;  3DGV A;  1RA7 A;  5KG3 A;  4OL8 A;  1GH8 A;  2A6M A;  3U27 A;  1KRP A;  3MXH P;  2F4V F;  5D15 A;  1UCN A;  2D3U A;  2KZM A;  2KL8 A;  3OR1 B;  4ZVO B;  2VQE F;  3DXB A;  1AW0 A;  3OJS A;  3OVS A;  4DV1 J;  3DRX A;  1F2H A;  2F7V A;  4QW8 A;  1SJ4 P;  4Q44 A;  2FLP A;  4RUB A;  1PBA A;  2HBQ B;  2O67 A;  3C6U A;  2W9B B;  1TR0 A;  3KLF A;  2ZH4 A;  2J9E A;  2Y3Y A;  5L1K A;  3BBF A;  4ED3 A;  2HQI A;  2AD9 A;  2YWW A;  1AFJ A;  4CH1 A;  2RUS A;  3IP0 A;  2CXE A;  1RWN B;  2B43 A;  2CNK B;  4C11 A;  4F67 A;  2E9T A;  1JLB A;  1LNQ A;  2GVD B;  3UFC X;  3H4D A;  4HTJ A;  5IWA F;  1S9G A;  3C14 A;  1OIA A;  4DZ6 A;  1IM6 A;  1GMW A;  2KXN B;  4RW4 A;  2W7P A;  2R7X A;  2VPZ B;  2GCF A;  2QLW A;  2VG7 A;  2OFG X;  3CJR A;  2JOQ A;  4ZOS A;  5C2G A;  4JV1 A;  3QJL A;  2OTJ S;  4KB7 A;  3RB4 A;  1BQN B;  1X8D A;  2CQH A;  4AXI A;  4NZ0 A;  4IG0 A;  1GQE A;  1RWV B;  1UEV A;  4L74 A;  2XMT A;  3GR1 A;  3I31 A;  2B0G A;  4MFB B;  4CO2 A;  3OV7 A;  3O8W A;  3K5M A;  4DV5 J;  1KON A;  1NND A;  3K0J A;  3MAQ A;  3TWZ A;  5F8L A;  5B08 A;  3NGR A;  4U7C A;  3DRS A;  4EZ6 A;  2FJB B;  3GFY A;  3HFZ B;  1O8B A;  1Q8K A;  1RAF B;  1DFD A;  5J2Q A;  1D8Z A;  2Y8W A;  4NLS A;  2E7W A;  3M05 A;  5D8H B;  1NSK L;  3I4P A;  4DV5 F;  2LA4 A;  1S9F A;  1G4C A;  2XNR A;  2ZH7 A;  2CJA A;  5ETL A;  2LQJ A;  3K5P A;  4KGX B;  1RWX B;  4K4U A;  3VHQ A;  1ZM4 A;  2R7T A;  2WB4 A;  4TQR A;  4W92 B;  2MQN A;  1VS3 A;  2VC1 A;  2VV5 A;  3RYL A;  3W2W A;  4CH7 A;  5KG6 A;  1NJY A;  2MHE A;  3IRX B;  2CNN B;  3T3F A;  2HK3 A;  2MY8 A;  4YQW A;  1KFD A;  4X2B A;  1RSC A;  3GYX B;  1MN9 A;  5AXN A;  2YKM A;  2NXE A;  3M8Q A;  2P5V A;  4EO8 A;  5ADZ A;  2DCL A;  2W7A A;  1FWL A;  1PC5 A;  1XWL A;  4X4P A;  5L1L A;  2J6S A;  1UJ6 A;  1G7C B;  2GA7 A;  3QJP A;  3RG6 A;  4GC6 A;  1RT6 A;  3PYD A;  1AUD A;  5KFA A;  2HIQ A;  1FTC A;  5K8O A;  2WVD A;  3LUY A;  2IY5 B;  5E0O A;  4O0N A;  4JYA J;  4KPC A;  4DV1 F;  5LXR A;  3L9Z A;  4OFZ A;  4USJ C;  1R0B G;  1WHW A;  1GMV A;  2RIL A;  3V6J A;  3MEC B;  4JI3 J;  2B4P A;  4LSZ B;  4OZ3 A;  1K0V A;  2H5E A;  2RE1 A;  4OHV A;  3EM1 A;  3R1L A;  3J7Y U;  1RCX B;  1UKU A;  2HG4 A;  1MRO B;  1VQ9 S;  2HHH J;  2Y0S D;  4R5P A;  4B9T A;  2WSF C;  4FVC A;  1J2V A;  4QJV A;  1FKO B;  3R6G B;  1DLO A;  2ZD1 B;  1J5E F;  1CJK A;  2RSQ A;  1HNV A;  4A47 A;  3N28 A;  3TA2 A;  5B0C A;  3B8H A;  4KKO B;  2OI2 A;  2XMU A;  4P2S A;  3KLG A;  3PYG A;  1UWA A;  3M8P A;  3KK2 A;  1L3V A;  1HR0 F;  3KLH A;  2AYB A;  1HQE B;  3NMA A;  1UA0 A;  4DX6 A;  3GU0 A;  4ECS A;  4BCA A;  4FS1 A;  2PEH A;  2MZJ A;  3UVJ B;  1HNX J;  3CCR S;  3M8Y A;  2HFZ A;  1BQX A;  1RP5 A;  1W25 A;  3LAK A;  3TEG A;  4M8L A;  4X65 F;  1RKJ A;  2DHA A;  1S6P A;  1RHK B;  2CWK A;  1SCJ B;  3DGP A;  4B3T J;  3T1H J;  1K1Q A;  4DU8 A;  4NCB A;  4DEZ A;  3MEE A;  3QYY A;  3LWL A;  2KRB A;  5CZV A;  4JI6 F;  3D5M A;  2J9C A;  3CO9 A;  1YJ9 S;  1F9F A;  4I2P B;  5B0A A;  1S9E A;  4B3M F;  1C2P A;  2HPU A;  3DLG A;  8AT1 B;  3TO8 A;  4PQU B;  1HFE L;  1VQ7 S;  4PWD B;  5CYQ A;  1DUR A;  3N79 A;  3QNW B;  2YQ3 A;  1Y3J A;  1KTQ A;  5BJR A;  2MJN A;  3D67 A;  1N54 B;  4LF9 F;  1FEH A;  3CCJ S;  2CA9 A;  2XSJ B;  2EFV A;  1YZ7 A;  2ZH2 A;  2ZC3 A;  1NBE B;  2AP6 A;  2J76 E;  3C14 B;  4MMO A;  3N6M A;  4MTP A;  3K2Y A;  5EX3 A;  1S6Q A;  2K2P A;  2MZ1 A;  2VIC A;  2CPE A;  2FZC B;  5J2P B;  4DFJ A;  3PEJ A;  3V4M A;  4C48 A;  4B9N A;  3AD7 C;  4AL6 A;  2GQC A;  1FI4 A;  5B0E A;  5T41 A;  3NBP B;  4A8M P;  1T0T V;  4K4Z A;  4ENO A;  4DCJ B;  2VF3 A;  1IKW A;  2BE9 B;  3OTE A;  5HN0 A;  4L73 A;  4N56 A;  4O44 B;  1S7H A;  3QIP B;  4L6V 3;  2UUA F;  2EBG A;  2I2Y A;  1I5O B;  1H6K X;  1WKK A;  4FKX A;  3TA0 A;  4RX6 A;  4CP5 A;  5KFF A;  3GFZ A;  1LWE A;  2VFS A;  3CCT A;  4IFV B;  5IQ6 A;  1FJG J;  3PAC A;  1M1G A;  2DXD A;  2KVQ E;  3MZI A;  3QT8 A;  2BE2 B;  2DD8 S;  3CC2 S;  2H51 B;  2XI3 A;  1NXI A;  2B56 A;  3FMB A;  3NY0 A;  3W61 A;  4PWU A;  3IFE A;  2NPF A;  2WRM A;  1FWP A;  2XMW A;  4YDX A;  1FD8 A;  4DZD A;  1UVN A;  3W2W B;  1CQM A;  1NK0 A;  3DKD A;  3D0I E;  1UET A;  4NMX A;  1WHX A;  4E98 A;  2L3M A;  2V2K A;  3ENQ A;  3DYA A;  2JFK A;  3MR3 A;  4QIG A;  4LRC A;  3W2V B;  5CXT A;  1DJ0 A;  1R8H A;  1BXN A;  2GQ2 A;  2Y1L B;  2Z2Z A;  3ZO7 A;  4Q5V A;  1WOO A;  2OEM A;  3NAI A;  2K7J A;  2HVH A;  3MM8 A;  3QGH A;  2IRX A;  4HAC B;  1U25 A;  3RZA A;  4QR0 A;  2KFY A;  3RB6 A;  1M5V C;  4IYQ A;  1FX2 A;  3EGW B;  3Q89 A;  4ZPA A;  3E01 A;  3FZB A;  5HQL A;  2W8K A;  2ASL A;  2R2T A;  4H4K C;  4EBE A;  2FZK B;  1RXO B;  2UUT A;  3ENA A;  3OTB A;  2VA3 A;  1C0T A;  3DHW C;  1T02 A;  1RT3 A;  2RD5 C;  2E7V A;  2JRS A;  3A3N B;  3BGO P;  3BJY A;  3JTP A;  1L3U A;  4UOF A;  4RUH A;  3HPO A;  1F3V A;  3KG0 A;  2KTQ A;  3KK3 B;  4LVO P;  3CNQ P;  2I5J A;  4OJG A;  3HHL A;  1RAA B;  1FKO A;  4C7Q A;  1KVK A;  3EMT A;  2R7V A;  5HMY A;  2X7I A;  2NZC A;  1HBO A;  2QIF A;  4NE9 C;  5EUH A;  4CM2 A;  1Y0H A;  2HSE B;  3G8Q A;  1SV5 A;  1FFS B;  3HDS A;  3H59 A;  3PIP Q;  4AL7 A;  2AU0 A;  1CS4 B;  2P9G A;  3F0N A;  3WX8 A;  4URG A;  4ANE A;  1C4A A;  1NPP A;  4NA3 A;  4ZVR B;  3ZNU A;  1ZM3 A;  1OSD A;  3CJ5 A;  1VMB A;  4MAK A;  2HHW A;  1H72 C;  2PC6 A;  3BGR A;  4DPX A;  1U1N A;  3D1H A;  2GGP A;  4LFA F;  5E3P A;  5B0D A;  4UZB A;  5DDP C;  3DGP B;  3J81 U;  1FRM A;  3TX0 A;  1TL5 A;  3R3T A;  2AX0 A;  2PI4 A;  2YKP A;  1URN A;  4CTA B;  4PUO A;  2BW2 A;  2EK1 A;  4JI7 F;  4F2R A;  4ID8 A;  1HNZ J;  4C6A A;  1YBU A;  5HP1 A;  1IKV A;  4WKY A;  3GLJ A;  1RBA A;  4A46 A;  3DRP A;  3HFV A;  5DZ6 A;  2NZ4 A;  2GVZ A;  5D4L A;  3GJQ B;  1FRH A;  3KJV B;  4DV4 J;  4K2J A;  2D3O 1;  4DLE A;  2CPX A;  2ZBQ A;  1ULR A;  3D1Q A;  4H54 A;  4LIR A;  2FHO B;  2DY1 A;  2M8H A;  4X66 F;  2L9D A;  2W9C B;  3JQK A;  4ZJL A;  2YH0 A;  1RHQ B;  2M52 A;  4K2X A;  4FVM A;  2F40 A;  2J7K A;  4P75 A;  5DRK A;  2XMA A;  1YTY A;  2XSJ A;  3K5O A;  1RA6 A;  1TVR A;  3FKB A;  3NP5 A;  2HW3 A;  3PJX A;  1S1X B;  2IYG A;  3HM9 A;  1VBY A;  2BJ7 A;  2KYX A;  2VKR A;  1FDB A;  2CPY A;  2NXJ A;  4FNI A;  3OW2 R;  2G1H A;  1U45 A;  2BJD A;  3ZC4 A;  1U4B A;  1TAU A;  3L7O A;  4NI2 B;  2XWX A;  4J90 A;  2V67 A;  3RU0 A;  3H4B A;  4OZ1 A;  3MUM P;  1M5S A;  2BZ2 A;  2HS4 A;  2X3D A;  3AD8 C;  3LP1 B;  5A8R B;  3J81 j;  1F9E B;  4DHV A;  1KOO A;  1GXU A;  2NQP A;  2QJ3 A;  3MMA B;  3UR0 A;  4J9U E;  1IVZ A;  1LKZ A;  1WEZ A;  1XEZ A;  2EFN A;  1VBZ A;  4MKB A;  4A8W A;  3OFH A;  1YHQ S;  1T05 B;  3IR5 B;  4G1P A;  4RU9 A;  1FF2 A;  5B0G A;  2XSF A;  2ROG A;  3HHL C;  1QSY A;  1V3S A;  2DGV A;  3PNI A;  4K5R A;  1VR6 A;  1DZ5 A;  1BGX T;  4PCQ A;  5F3T A;  1TK5 A;  3SSS A;  3V4I A;  1Z2Z A;  4IDK A;  3HHD A;  3BEG B;  1S1W A;  4IOB A;  2ZVS A;  3SDE B;  2NUU G;  1NDK A;  2IM1 A;  5D6G A;  1RTH A;  2AYM A;  5ETM A;  2C2Z B;  3ET6 A;  3AQO A;  4H4K A;  5K14 B;  2XS7 A;  4I56 A;  1UZH A;  2HHX A;  1WSR A;  1IWG A;  2Q3P A;  2VBX A;  3CJQ A;  5T14 A;  4LFB F;  1W2I A;  3HD2 A;  2VG5 A;  4ZP7 A;  3RGI A;  3H5X A;  2EK6 A;  7FDR A;  2JLE A;  1YJT A;  2KT2 A;  1QUP A;  4FF4 A;  1QAY A;  2CDQ A;  2X51 A;  3AH6 A;  4ZVT B;  2DHS A;  2MZR A;  4RNM A;  5LT5 A;  3G71 S;  3EWG A;  3PHT A;  3MM8 B;  4ZKA A;  3KLE B;  1X9W A;  3BSC A;  4RBT A;  2DGO A;  1Y9O A;  4HKQ A;  3DI6 B;  3KMQ A;  2B51 A;  1UWB A;  4KH1 B;  2DNO A;  2B7B B;  5I3Q A;  4C8O A;  3DU6 A;  2WBM A;  1Y10 A;  2M5Y A;  1UZD A;  1VQ8 S;  3RAM A;  1T03 A;  2JNJ A;  3MGJ A;  3MAH A;  4ALZ A;  2GIR A;  1J27 A;  4ZIV A;  1JJC B;  2DGQ A;  1IQT A;  1RWU A;  5EWG A;  1C1C A;  3MAA B;  3T1A A;  2C42 A;  1TTH B;  3CCV S;  1JX4 A;  1YJ7 A;  1HBO B;  3BKU A;  3TJ9 A;  2N7C A;  2OPR B;  2CYY A;  1RU2 A;  4TNO A;  1LV5 A;  1CJV B;  4QR2 A;  3NS6 A;  4OHY A;  4KHP J;  4KO0 A;  2RHS B;  3KJQ B;  3M32 B;  5BYQ A;  3DOM A;  4M1K A;  5C25 A;  3MCO A;  5F3Z A;  5HQ8 A;  2QLF B;  2KDO A;  5DG9 A;  1SJ3 P;  5D4N A;  1TMM A;  3ILJ A;  3BQ2 A;  2POK A;  2CVE A;  1H73 A;  2WBR A;  3MM7 B;  1UVJ A;  2HLT A;  2JEI A;  3DLK B;  2CRL A;  3CCQ S;  3UI3 A;  1CPZ A;  3CDU A;  3SEO A;  4CTA A;  4M5L A;  2XCA A;  1UFW A;  3JQJ A;  3O1L A;  4OQJ A;  4LSN B;  4DSJ A;  2DGS A;  3GB0 A;  3TA1 A;  1H2U X;  3ILL A;  2DGX A;  4ZLP A;  5THW A;  4IOA Q;  3HT3 A;  4KV8 B;  3AOC A;  1SJQ A;  4HI1 A;  3I32 A;  2F8H A;  4A8X A;  3IS9 B;  2DJW A;  4USU A;  2HQ3 A;  1O51 A;  2IRU A;  2OPP B;  2ZFH A;  3SFU A;  4QWD A;  3H7H B;  2BBE A;  3ICL A;  3IGV A;  4NLR A;  1XMQ J;  1NK5 A;  1G1X A;  3Q8R B;  4GKK J;  1UL3 A;  1IR1 A;  3QFW A;  5EX0 A;  5KFG A;  5D3G B;  4NCG A;  2CAD A;  2XGQ A;  1R8A A;  2MB0 B;  4ZCL A;  4U9R A;  2R8I A;  3PHE A;  3VAL A;  2BQU A;  2PI5 A;  4ICL A;  4UQG A;  4W90 B;  1TQL A;  1AB8 A;  3QWP A;  2DHH A;  4QWE A;  5C42 B;  4PUO B;  2KHC A;  3KJN B;  3WC2 A;  4Y6I A;  4IRC A;  1JJH A;  1RWO B;  2HBZ B;  1KQG B;  2QA4 S;  2DGU A;  2RKI B;  3LP1 A;  3PY8 A;  3TZX A;  2FC8 A;  4R25 A;  5IT0 A;  4UST A;  2M2B A;  2XY5 A;  1NZA A;  3BS9 A;  5D0R A;  4DV0 F;  3ILO A;  4EO6 A;  1S59 A;  4IQX A;  1OY8 A;  2DKO B;  4PYD A;  1NSQ A;  5HRO B;  3RRG A;  2F9D A;  2DK2 A;  1Q5Y A;  4WZQ A;  1QUV A;  4DPW A;  3V4I B;  2B5J B;  1FJE B;  1N36 F;  2XO7 A;  1U1O A;  3UR3 C;  1FRK A;  2XZT B;  2BXJ A;  4B17 A;  1LW0 B;  1WF0 A;  3ET6 B;  3QQC D;  4CO1 A;  2GIQ A;  4YR3 A;  2ZHB A;  4ECX A;  4LMZ A;  2V8H A;  1RHU B;  2AEM A;  1TK0 A;  1I6J A;  5L9N A;  5FDL B;  3C8Y A;  1TU0 B;  3BN4 A;  1WC3 A;  1HQU B;  2CPJ A;  4I64 A;  4URS A;  1TKT B;  2AZ3 A;  3DU5 A;  4UUW A;  5B0F A;  2CQD A;  3ENV A;  3BBB A;  5F9L A;  1N5T A;  1RZM A;  3T9Z A;  3W64 A;  2M9K A;  5KFL A;  5L1I A;  2XLK A;  1DAX A;  2F4F A;  2IAJ A;  3G87 A;  1K8A T;  3HZG A;  1HQ2 A;  3K8W A;  3BGU A;  3KLE A;  5J2N B;  2ZIT A;  2NXN A;  5EDW A;  5KFH A;  3EX7 B;  2FVS A;  2HYI B;  4CCH A;  4DL0 C;  4I6Y A;  2JSX A;  4FBU A;  2MQL A;  1UWB B;  3BF4 A;  1ZM2 A;  5LL6 d;  1RTJ B;  3HSG A;  3A4T A;  1VI7 A;  4Y2M A;  4RNF A;  4J9M A;  2NYH A;  2V9W A;  5KFV A;  2Y9H A;  1NCL A;  2H3E B;  4HL9 A;  1JLG A;  2JH3 A;  1WI6 A;  3BDE A;  3I87 A;  5H9F J;  4IRK A;  4NLT A;  4QPT A;  2I1R A;  2DHX A;  5LXY A;  1IKX B;  1WKL A;  4B3S J;  4A4J A;  2GHW A;  5KT3 A;  5GAE U;  4OV6 A;  4OX8 A;  4ZPV R;  3T6J A;  3S1T A;  1EIY B;  3K57 A;  1Y3K A;  2B3T B;  3KDN A;  4M5N A;  4KHM A;  4AND A;  1BWE A;  2BA9 A;  1X9S A;  3PIO Q;  3T1H F;  2W2P P;  4AQY F;  3POT A;  4WP9 A;  2MKS A;  1VJW A;  4IR9 A;  1EP4 B;  1KP6 A;  2EFP A;  4OJH A;  1WI8 A;  4JI0 F;  4IFY A;  2MMY A;  4B9M A;  4ES3 A;  3MM7 A;  1UP1 A;  3QZ8 A;  3F56 A;  2XO6 A;  2HIY A;  4RWW A;  3H40 A;  4NZ6 A;  4RW6 B;  2W24 A;  2UUB F;  1P6T A;  2G0I A;  3FSX A;  5FJ4 A;  2DGT A;  5A6P A;  1D8Y A;  2CQG A;  2K3I A;  2W9A A;  1U1L A;  1HA1 A;  1KHW A;  2M88 A;  2DEI A;  4HT5 A;  4WXO A;  3ZZZ A;  2HMI A;  4IUF A;  1A9N B;  1MWQ A;  2X1B A;  3HO1 A;  1X4E A;  1WG1 A;  3IG1 B;  3VVT A;  2B4V A;  2E9Z A;  2ZBC A;  3C6T B;  1EAR A;  3WZ0 A;  3WQP A;  3I0R A;  1BD6 A;  3SMZ A;  4YB5 A;  5KT2 A;  3SV3 A;  1H3D A;  3CJ4 A;  3BQ0 A;  3R2C J;  2OPP A;  4IH5 A;  3T19 A;  4B9U A;  4C11 B;  2A18 A;  4BWJ A;  1PJ7 A;  2CQC A;  3NGT A;  1JLE B;  5IFM A;  2E1R A;  3IR6 B;  2RRA A;  4ECY A;  1NK7 A;  1IR2 A;  2UXB F;  2XWY A;  4AFF A;  2UVV A;  3QID A;  4H4O B;  4C97 A;  4HHJ A;  4BDP A;  1SIW B;  4GRS A;  4ZA1 A;  4PYA A;  2W2N P;  4OZJ A;  2B4O A;  2FLL A;  2ZBP A;  4OYP A;  1T9T A;  3K8V A;  4LQ9 A;  2R7W A;  2W2M P;  2LP4 A;  5C42 A;  5HLF A;  1KHV A;  4CWB A;  2P9C A;  2XY7 A;  2QFJ A;  1R31 A;  4C8Z A;  1P9Q C;  1N6Q A;  2JEJ A;  1UEU A;  1WAC A;  2I6W A;  5IWA J;  1Q0N A;  3I0S A;  1C1B B;  3OXG A;  3M8W A;  2HND B;  5AE2 A;  1KKH A;  5LJ3 Y;  3PRB A;  5KG2 A;  3NGS A;  3R8Y A;  5CAA A;  3AD9 C;  1Q78 A;  2FJW A;  4NEY A;  2L08 A;  2VG6 A;  5A0Y B;  1S5Z A;  2KFZ A;  1ICE B;  4DR5 F;  1CLF A;  2HAI A;  3EZU A;  3MM9 B;  2D7S A;  2OSQ A;  2MGZ B;  1SQG A;  2XYG B;  4ZIT A;  2ZZM A;  4DR6 J;  4NLU A;  1F9H A;  4L72 B;  2KG0 A;  2V5H G;  1AZS A;  4OI1 A;  1JLA B;  3MPU B;  3EGZ A;  1DAR A;  3NGD A;  1LW0 A;  2K8G A;  3H2L A;  1X4H A;  3SQO P;  4RNO A;  1TL1 A;  4OYM A;  5KFY A;  2ZC4 A;  3IWL A;  3K17 A;  3CWJ A;  4RZR A;  1SC6 A;  1GT8 A;  4RU2 A;  3TJA A;  4NLO A;  1FE0 A;  3W9H A;  1X9M A;  1LEO A;  3NAH A;  5E7O B;  5KFK A;  2OO4 A;  4DPY A;  4YB1 P;  2ZH9 A;  4Z2X A;  4EGL A;  2VKZ G;  1SXL A;  2Z2L A;  4YHH F;  3G6E S;  2M4M A;  3NCR A;  2ZWP A;  4C3M A;  2IC3 B;  2V50 A;  2IVY A;  4KJI A;  4ZP6 A;  4F04 B;  4OZ0 A;  4B3M J;  2DT9 A;  5C24 B;  5I3U A;  3UO0 A;  4LSL B;  4DR1 F;  4C0B A;  5KFJ A;  3CE8 A;  2OEL A;  4H4M A;  4KGK A;  4OJ3 A;  3NXZ A;  3CC4 S;  1NRK A;  1R27 B;  1WC5 A;  1WC1 A;  3LAM A;  1I94 F;  2UUC J;  3CCL S;  2ZD1 A;  4X4R A;  4ECZ A;  5KFM A;  2JZ5 A;  3B82 A;  3BGF A;  2P8I A;  2ZVI A;  3DOL B;  3N01 A;  4XO0 A;  4FNH A;  1YBA A;  7AT1 B;  3OHA A;  3KK2 B;  3G4S S;  1IWA A;  1VQL S;  2QL5 B;  4AL5 A;  2B6A A;  2CQ0 A;  3QLH A;  2XZD B;  3DDI A;  2V63 A;  2XMV A;  1RTI A;  3LP0 B;  4WFX A;  1KQF B;  4DL5 A;  2OMO A;  3GV7 B;  2ASD A;  2DPI A;  3IM8 A;  2FGC A;  4I69 A;  1J5E J;  2NYI A;  2J8A A;  2ZH1 A;  3M8S A;  5KFT A;  2VU5 A;  4U8Y A;  5FLX Y;  4ZCI A;  5JMN A;  1L3T A;  2DNR A;  4NLQ A;  5DDR C;  1MG7 A;  4DPO A;  1IBM J;  2QEX S;  1M90 T;  4C4W A;  2VB6 A;  2HAF A;  3EVW A;  5I4M A;  5KFE A;  4DV6 J;  1N5Y B;  4X4T A;  4LRB A;  1N33 F;  2RT3 A;  3I82 A;  5C7P A;  1R7I A;  4WP8 A;  3UCZ P;  2OPS A;  1GFW B;  4DR5 J;  4I0W A;  2ATC B;  4J5O A;  1E6Y B;  1JLF A;  4J9L A;  3OXL A;  2RDD A;  1JNZ B;  1PKU A;  1T95 A;  2HFN A;  2COL A;  1TV6 B;  2DXF A;  4PG4 A;  1JLE A;  5J2M B;  3QZ7 A;  3MR2 A;  1TL7 A;  4OZN A;  2R2U A;  2K06 A;  2WON A;  2GO8 A;  3GSI A;  3MR7 A;  3P3D A;  3RB0 A;  1O0P A;  1DQ8 A;  1ZAW A;  2OD6 A;  3CED A;  5HO4 A;  2QE5 A;  2R9L A;  5I42 A;  3DLL Q;  2R8K A;  5F8G A;  1R0A A;  3RR8 A;  1RWM B;  3WHI A;  3PR4 A;  5HMW A;  4YR2 A;  2V4J A;  5F8I A;  5HLF B;  1O6X A;  2QMX A;  3AOA A;  1FJC A;  2XQC A;  1IKW B;  3RBZ A;  2QRR A;  6FDR A;  1N6Q B;  3QSI A;  1D9D A;  4O44 A;  2LQ5 A;  3I0S B;  1C1B A;  3CVK A;  3AJ2 A;  5D78 A;  1TKZ B;  4B08 A;  3V81 A;  1ZYQ A;  2NUH A;  4ZDN A;  1UMJ A;  4UOG A;  2DNP A;  2N4D A;  2DPJ A;  8ATC B;  2O66 A;  1SC3 B;  2QT7 A;  1MML A;  1IBK F;  4KFB B;  4URQ U;  1Q7L B;  3IXQ A;  3OVB A;  5GAG I;  1QM9 A;  3N5B A;  4DV7 F;  1YJN S;  3S7R A;  4A8Y A;  4X62 J;  3BO4 A;  5HL7 Q;  1H98 A;  4JV5 J;  4OYI A;  4EMD A;  1AZS B;  1JLA A;  5AE1 A;  3Q24 A;  1RTD A;  1C0U A;  1GNK A;  3FFI B;  4P6Q A;  4ZJO A;  1XNQ F;  3KUG A;  3RAQ A;  2Z56 B;  3M2R A;  1VK8 A;  1Y4Z B;  1XQI A;  1TZ0 A;  3DMJ A;  3A12 A;  4HYK A;  1WHY A;  2V6A A;  1MU2 A;  2GIF A;  1S1V A;  4WE1 B;  5CCM A;  6AT1 B;  4N7T A;  1NJX A;  1NJW A;  1B99 A;  4NZ7 A;  1X5T A;  4QW9 A;  2KN4 A;  3B4M A;  3TQ1 A;  5KFO A;  4WBF A;  2YXL A;  5IXU A;  3KLF B;  3RRH A;  4HAC A;  3LW5 C;  4IR1 A;  5KOX A;  2VOD A;  4OMF G;  2ZHO A;  4KTQ A;  4TVA B;  2DNY A;  3DM2 B;  3E01 B;  5DDQ C;  4LF5 F;  4J91 A;  4L76 A;  3GON A;  1XIQ A;  2DRD A;  3GTY X;  4F4W A;  1S9G B;  1ZS6 A;  5D0E A;  2CZ9 A;  2IC3 A;  1UFK A;  1HLW A;  1UPP A;  3M2U B;  1PYO B;  4P7V A;  3OFF A;  4RNH A;  3R7N B;  4K5S A;  2YWG A;  4MT1 A;  3ZNJ 1;  3RB3 A;  4OX9 J;  4ID5 B;  2FGO A;  2MLY A;  3FSI A;  3SZ2 A;  4IRD A;  1ZZF A;  4ILM A;  2BUN A;  1G3O A;  1NDL A;  1BQN A;  3CXC R;  2E9R X;  1VIX A;  2I5J B;  3W5X A;  4BC9 A;  5HVH A;  1TUV A;  1Q82 T;  4TKT A;  1R8B A;  2LU2 A;  3HVA A;  1HI0 P;  4KPY A;  2XS2 A;  3NEK A;  1SV5 B;  4N5S A;  3DOL A;  2OKQ A;  4ED7 A;  1U6B A;  2F63 A;  1NJZ A;  2DH9 A;  2N4C A;  3AOD A;  5KFB A;  1FO1 A;  1A7G E;  1SJR A;  4P73 A;  3DDN A;  2DIS A;  2PGC A;  2ILZ A;  2VPX B;  3BPD A;  3UN5 A;  2YNG A;  5J2Q B;  2U1A A;  2BAC A;  3OQ2 A;  1U6F A;  4QCL A;  1SQF A;  1RWK B;  2NS1 B;  4RW9 A;  3S01 A;  4B9V A;  4UUX A;  4DN0 A;  4LR8 A;  1SL1 A;  2K1R A;  4G65 A;  3FUY A;  3UCG A;  4KIA A;  1HWI A;  3KJF B;  1R3N A;  3I96 A;  2VOO A;  2V4Q A;  2FD2 A;  2HRY A;  3OR2 A;  4AE5 A;  2WW8 A;  3RW6 A;  3RJM B;  3KWM A;  4QIW D;  1QTN B;  3HX9 A;  2VDI A;  1CSJ A;  2DNK A;  2YKM B;  1FDN A;  4BBY A;  4C3K A;  1WEY A;  2J9D E;  2JEG A;  4JI7 J;  1KC8 T;  4P10 A;  3KJV A;  1EET B;  2YX1 A;  2MKK A;  1YLX A;  5HAT A;  1PJ5 A;  5F0U A;  4DCP B;  3CDE A;  1OWX A;  1PGZ A;  2IHR 1;  4QWA A;  3TZY A;  1NK8 A;  2W9C A;  4LFA J;  4DWI A;  1X5S A;  3GFH A;  4DV0 J;  2WVB A;  1LWX A;  4N41 A;  1EZZ B;  1RLD A;  1TV6 A;  3MDF A;  4HDH A;  4WYW A;  4G6V B;  2IMO A;  2BW7 A;  4OI0 A;  3ZTS A;  2IPO B;  4OYA A;  3K59 A;  3MED A;  2J0W A;  2O01 C;  2IJR A;  4PZV A;  3MOJ B;  3TQE A;  4DL2 A;  3BSA A;  2H5I B;  3O44 A;  4FXD A;  1NZ8 A;  2M70 A;  4JI5 F;  2OUG A;  1CC7 A;  2AEF A;  3MCS A;  4JI2 F;  4LUB A;  4JI4 F;  4Q8F A;  3JSB A;  1HIY A;  1SIZ A;  3W9J A;  4DG1 A;  3MEK A;  1ROF A;  3MMA A;  4OV1 A;  2HQF A;  2UXD J;  4FPI A;  1UFL A;  2DIU A;  4NEZ A;  1MWZ A;  1YBT A;  4J9R A;  3MHY A;  5HAO A;  4Y34 A;  3N5F A;  2KJV A;  2BJ8 A;  2FYX A;  5HBM A;  4C3L A;  2G2O A;  4OI6 A;  2UUA J;  3HSZ A;  4CLS A;  3FRY A;  2LMI A;  2M0G B;  2CPI A;  2A6O A;  4LIW A;  2I38 A;  1G2E A;  4C8Y A;  2ZWO A;  1RBO B;  3M8R A;  5KG4 A;  4F8R A;  4JI5 J;  3I4H X;  2HNZ A;  4LVN P;  4C98 A;  5K14 A;  5EGY A;  4DR4 J;  1LWF B;  4K8R A;  3GII A;  1NDC A;  3G86 A;  3N4W A;  3RRK A;  4I2P A;  1VQN S;  1FXL A;  1R8P A;  1X5O A;  1WF2 A;  2VG5 B;  1NK6 A;  4BWM A;  4ER8 A;  1FCA A;  4PQU A;  5KT6 A;  3C19 A;  3BO2 A;  2FIU A;  4MJK A;  2CKW A;  5IT9 U;  4PWD A;  4G1Q A;  1JXL A;  3I6P A;  4CLY A;  2KYZ A;  4EWT A;  5M2U A;  5KG5 A;  1UVL A;  5CYJ A;  5E3C A;  3PKM A;  4FXV A;  3TOQ A;  4IKA A;  4A8S A;  2V34 A;  5ETO A;  3K58 A;  1FJ7 A;  2C2D A;  3H90 A;  3DI6 A;  3M4X A;  4OX6 A;  5GAE I;  2PN6 A;  3LWM A;  3BSN A;  2HQD A;  4W4M A;  1PAU B;  1B70 B;  1YDL A;  2EXU A;  2QA2 A;  2OEJ A;  3DLB A;  3I55 S;  2R42 A;  3QWU A;  3BDP A;  2ADB A;  2MZS A;  1X7V A;  2Z2Y B;  3KNA A;  4JV0 A;  3IWX A;  3MAA A;  5IZH A;  4HDG A;  3KK1 B;  2BAB A;  4DL3 A;  4ZN3 A;  4PXC A;  1OY6 A;  1HNI B;  2L9W A;  1EX8 A;  4F4Y A;  2YQ0 A;  1TAQ A;  3OR1 A;  4IFV A;  2LDI A;  1ZA1 B;  2ROP A;  5LJ5 Y;  1T9W A;  1KQS R;  4FYX B;  1S0O A;  1IUJ A;  5JJB A;  3E3X A;  5E33 A;  3M6X A;  1SL0 A;  1FRI A;  2ZOG A;  3W8P A;  4BHQ A;  4OYX A;  3C6U B;  4X4O A;  2KU7 A;  1Z2L A;  1NJI T;  2K1R B;  1OS5 A;  4LF7 F;  1M1K T;  1X0P A;  3MM6 B;  4DL4 A;  2AT1 B;  2QLB B;  1YIT S;  1KOH A;  2BQR A;  3UW1 A;  1T8E A;  5D4O A;  2HFV A;  1SKS A;  1RTZ A;  4ETZ A;  3CMA S;  2FJA B;  3P8B B;  4Q43 A;  1OQ3 A;  3M2V B;  2ZBR A;  1UVM A;  4B3O A;  3CJ8 A;  3NWG A;  1K0T A;  2FVR A;  4RW4 B;  4FN5 A;  1FTR A;  4P9S A;  3OLB A;  4Q0B B;  4Z37 A;  1X5P A;  2APO A;  3EUN A;  3OXF A;  2LA6 A;  4IG0 B;  5LOQ A;  4HLB A;  2QA4 G;  3H42 A;  5IOL A;  2GAG C;  2X1G A;  3VGU A;  1W2B R;  1ARO P;  4ZLL A;  5DDO C;  5A8W B;  1HW9 A;  5D3G A;  4EBC A;  2Z2M A;  3A8J A;  2R8J A;  1OSC A;  1KQK A;  3G6X A;  2W4C A;  4DQI A;  4LT6 A;  2JWN A;  3D9B A;  3F44 A;  2EFO A;  3S8S A;  2WOM A;  2QL9 B;  3AXK A;  2PMZ D;  5L46 A;  4KH0 B;  1N4L A;  1OYE A;  2GV1 A;  2WCX A;  1S0V A;  1BE4 A;  2B4U A;  1RHJ B;  4IH6 A;  3UD4 P;  1LWC A;  3QGI A;  3US5 A;  3UPF A;  1QTM A;  3SXL A;  1N52 B;  2RKI A;  1N0U A;  2RS8 A;  4KR0 B;  1F1B B;  1L3S A;  4DG1 B;  3IM9 A;  2EFG A;  3OFE A;  4QR1 A;  2BDP A;  3IRX A;  3Q2T C;  3CCZ A;  4PAB A;  4RW8 A;  1IR0 A;  4LF8 F;  1Q5V A;  2HVZ A;  4GKK F;  2O1P A;  4ZHR B;  3VAK A;  1WC4 A;  2HVE A;  1S1T B;  2WHO A;  3BGR B;  3H98 A;  1N8R T;  2ZNY A;  4O3S A;  4FS2 A;  3MPW A;  2LQ9 A;  2J0Q D;  1HBN A;  2EEY A;  2UVW A;  1RB0 A;  1JKH B;  4GO5 X;  3KHR A;  1QSL A;  2ZUG A;  2HFO A;  3GCX P;  3MOZ A;  3VAG A;  1VQM S;  1ZM9 A;  2LLZ A;  1OMS A;  1X4B A;  4MK9 A;  1LWF A;  2RF2 B;  1Q8B A;  4OHZ A;  4ES1 A;  1S0M A;  3L7P A;  3D7S B;  1ACM B;  1N88 A;  4K4T A;  1GX6 A;  2QMW A;  4F2S A;  2BX6 A;  2CAJ A;  5BXI A;  2KKH A;  2OD4 A;  2CVI A;  2ZKT A;  4F0K A;  3HLU A;  3BBC A;  3TAR A;  1S10 A;  2DGW A;  2GVZ B;  2E7X A;  3D66 A;  1VC6 A;  3PO4 A;  1U0S A;  2B7C B;  3DDK A;  1H0H B;  3PCO B;  1HWJ A;  2F65 A;  3Q8Y A;  4P7T A;  4R5P B;  2HEK A;  2IAJ B;  1VIS A;  1GAO A;  1Y5N B;  4ZLJ A;  4X62 F;  2ZH5 A;  4WKR A;  3KLI B;  3PX0 A;  2OSR A;  2W2O P;  4DFM A;  2J6U A;  4HI2 A;  6FD1 A;  1B64 A;  2GMH A;  1ZPV A;  3GFX A;  4CI0 B;  5HSP A;  2C2E A;  1HWK A;  2XNQ A;  2RJZ A;  3KLV A;  5A2Q Y;  3M8P B;  4X66 J;  5M2R A;  1B4S A;  3GV5 B;  5CA5 A;  2OPQ B;  3R5D A;  3PV8 A;  3G6Y A;  3J7A 1;  1KWM A;  4Y2I A;  1NHK L;  1T11 A;  2BRK A;  4ITS A;  3UD3 P;  1IBL J;  1HAR A;  4YY3 J;  5JUM A;  3TAN A;  3I5C A;  1SPB P;  1SI9 A;  3PR5 B;  3GE9 A;  4IG3 B;  3JYT B;  1VQ5 S;  4ECT A;  4X4U A;  1PYT A;  4ED2 A;  2LEC A;  4PAA A;  4CQ1 A;  5JVH Q;  3JB9 k;  2A0F B;  1T05 A;  3O6Q A;  1RWP B;  4E0D A;  5HMX A;  3TJ8 A;  1QDU B;  2V8G A;  2VJV A;  4UW2 A;  4OI2 A;  3CC7 S;  3CD7 A;  1BHN A;  2CJB A;  3ENW A;  4ED0 A;  3PG9 A;  4F4K A;  2IM2 A;  2FVP A;  1MWY A;  2E1C A;  3G82 B;  4OLP A;  3CPW R;  4WIQ A;  1NB7 A;  1VRT A;  4R0J A;  4CNY A;  4CRJ A;  5KFD A;  3VAH A;  2H9Z A;  3BV8 A;  3MM6 A;  4RW7 B;  4EK2 A;  1N5V A;  2QYG A;  1BUX A;  3NCQ A;  3H0P A;  3NG8 A;  4OIX A;  1TKD A;  2DNM A;  3A8K A;  3D6H B;  2OAU A;  9RUB A;  4BS2 A;  1Q81 T;  5E2Q A;  1N32 J;  2F4V J;  1EQ0 A;  2RRN A;  1PBU A;  2HLU A;  2BAN B;  3M30 A;  3QAT A;  1FJG F;  1VHI A;  1FHT A;  3ELH A;  1RYR A;  3JQM A;  4NA2 A;  1TFW A;  2RQM A;  2VFU A;  1PO6 A;  2XHC A;  2F5G A;  3NNC A;  2R7S A;  1NSA A;  1NUE A;  1IM4 A;  4TU7 A;  4F3Q A;  2ADC A;  1QSS A;  3R2D J;  2EBE A;  2XC9 A;  5LMN J;  3BPS P;  1N0V C;  2JHE A;  3TZZ A;  2A2D A;  3MMB A;  4Y65 A;  1S76 D;  1QVF R;  1CEZ A;  4L75 A;  4ZVU B;  4YS2 A;  4ECR A;  3CTR A;  3DXS X;  4NYO A;  4DX5 A;  3HVR A;  3KTQ A;  1C4C A;  1P1L A;  1TUG B;  1S79 A;  3EVM A;  1TL3 A;  2CQB A;  1YIJ S;  4C8K A;  4LF1 A;  5D0H A;  4U7U D;  1ZA2 B;  4MIB A;  2ZJR Q;  4DR6 F;  3HF5 A;  3H2U B;  4DR2 J;  4P2F A;  3IBF B;  4XDD A;  3MPV A;  4DBQ A;  2K3K A;  2Y0B B;  3PJ9 A;  1FX4 A;  2OHD A;  1RAI B;  1VRU A;  3H5U A;  4ZJQ A;  2FZG B;  3CB4 A;  3HHL D;  3EPI A;  3PW0 A;  3GMG A;  3M1V A;  4MKA A;  2FJE B;  1HMV A;  4NLY A;  2XBP A;  2KRR A;  5C25 B;  3J7Y I;  3W2V A;  4F3O A;  2KT5 A;  5IC6 B;  4FXW A;  2FHM A;  1N34 F;  4PWW A;  3TUP A;  2U2F A;  3R7S B;  2B9W A;  1V9O A;  4FDF A;  4CO3 A;  5GAH U;  1HBN B;  3MUR P;  3PW5 A;  3RBD A;  1CJU A;  1UTA A;  1ZAV A;  3FC9 A;  4PXD A;  2E44 A;  2B9X A;  2RF2 A;  4JI6 J;  1WNE A;  3X3U A;  2VA2 A;  2QA1 A;  2JC1 A;  5E5N A;  2UXC F;  4ATN A;  3D6F B;  1RT3 B;  4DX7 A;  3FRZ A;  1HPZ A;  1LQ9 A;  2ZDO A;  3VQT A;  5KT4 A;  4X65 J;  3HHK A;  2NSB A;  4K4S A;  1RI7 A;  2J7W A;  3A1Y G;  3C15 A;  5KFX A;  1YRT A;  3DLE B;  5H9E J;  2NSC A;  3OUY B;  1HNW F;  3NNH A;  2YNH B;  2ZKU A;  2GNK A;  3EGV A;  3KLI A;  1U8W A;  2MKC A;  3I9V 9;  3PVX A;  2KO1 A;  2V8V A;  1SQE A;  2VBW A;  5KT5 A;  1VDH A;  2HK2 A;  2RHQ B;  4W98 A;  2HFS A;  1WTF A;  4PG6 A;  2IA6 A;  4HT7 A;  3MEG A;  1IJE B;  1CS4 A;  5GAD U;  4DF8 A;  4LSL A;  4HVZ A;  4U95 A;  4LBH A;  5EWE A;  2IJF A;  2MQP A;  2DB1 A;  2V0N A;  4M5M A;  4ICL B;  2XUL A;  4RKU C;  5DET A;  2VAS A;  2CJQ A;  1VQK S;  2HWI A;  3AT1 B;  1DHM A;  1KEK A;  1JLC A;  5KFP A;  1OO0 B;  1FKP A;  1MW7 A;  1W7W A;  1GXT A;  2GGP B;  4LRA A;  3ZZU A;  4WFN Q;  1S72 S;  1MLA A;  3IR7 B;  1S6O A;  2EVZ A;  3IAS 9;  3MD3 A;  1TEL A;  2B8P A;  2OGU A;  3FBB A;  4MKV A;  2GHP A;  2MQM A;  4P71 A;  3THP A;  2XB2 D;  3D3B J;  4ED1 A;  4FP9 A;  5G0R B;  3J7A N;  2IYI A;  4J9N A;  2YNI A;  2QFI A;  3W7B A;  1WDT A;  4DI6 A;  3Q8Q B;  4M94 A;  3CMQ A;  2IRY A;  3CUL A;  4ZPW R;  2B5J A;  4O0I A;  3R97 A;  2FJV A;  4DV3 F;  2D69 A;  4FF3 A;  2HVI A;  2QLJ B;  4B3S F;  3Q8U A;  3U7J A;  3OVA A;  3O5T B;  3AOB A;  3MPD A;  1VRT B;  1HR0 J;  1X0F A;  1JWW A;  2JDJ A;  1R6Y A;  1HBU A;  1O5J A;  2GJF A;  4UOC A;  2MQ8 A;  5FDL A;  3TZW A;  2KH9 A;  1TVR B;  2Q6C A;  4U8V A;  2JEF A;  2E5G A;  4DXL A;  5K8M A;  1S12 A;  9ATC B;  4ZVE A;  4DV7 J;  2HHH F;  1WC6 A;  1BLU A;  1TUW A;  2C3P A;  2BAN A;  4DCO B;  1EKS A;  2G0J A;  4OX9 F;  3MTJ A;  3HUL A;  3L95 X;  2UUB J;  2RB7 A;  1N5S A;  3H8Y A;  3EZ5 A;  1D9A A;  3TAQ A;  4MYU A;  1QAJ A;  4HHU A;  4CLP A;  2QZ8 A;  4YR0 A;  1V5V A;  2KT3 A;  1LXJ A;  3DRR B;  3DOK B;  3PYE A;  5KFR A;  4EFA C;  1RAO A;  1NLK L;  2MHN A;  4EEY A;  1DRZ A;  1KBR A;  4DUY J;  1YKW A;  4J9Q A;  3BYR A;  3FBC A;  3VTI A;  4C0O C;  2E5L F;  4FYD A;  4Q8E A;  1NDP A;  2CQ2 A;  2C3M A;  2V8D A;  3I9Z A;  2OFH X;  3TYT A;  2BKO A;  1SVD A;  1U6Z A;  2RDI A;  1FER A;  3T1Y F;  5DQH A;  2RQ4 A;  1RLC L;  1XNQ J;  3QO9 A;  1I51 B;  2JX2 A;  2QSW A;  3MTK A;  4U96 A;  1TKZ A;  4GMK A;  4CO5 A;  3EGN A;  3J80 U;  3QT6 A;  2G0C A;  1QVG R;  3VAJ A;  1TKX A;  3MR6 A;  1EP4 A;  1NB2 A;  2BE7 D;  5GAG U;  4U6P A;  5A76 A;  5DM7 Q;  3DCA A;  4DSL A;  4FF1 A;  4ZVP B;  5HVG A;  3OJU A;  4DV6 F;  1VK3 A;  1RBL A;  3TR5 A;  1NK9 A;  5IM0 B;  2V9K A;  1C0U B;  1L3K A;  3FFI A;  1CJU B;  2LVW A;  5BR8 F;  3P96 A;  1CJT B;  2IM3 A;  3J7Z 5;  4Z7Y A;  2NLW A;  1B3T A;  4DR3 F;  2N3L A;  4YFU A;  1FRX A;  1UEK A;  5LMN F;  1KVI A;  1NAQ A;  3IBC B;  5B7W A;  3C6T A;  5K9F A;  3OSP A;  4L3N A;  2LCW A;  4WF9 Q;  2HNY B;  5CZX A;  3QT5 A;  2XLI A;  3KFW X;  1PC4 A;  3DLE A;  2C3U A;  2VPY B;  3PFE A;  2DHG A;  1DTQ A;  2G9O A;  4K0K J;  4Q2M A;  4NXN F;  3DM2 A;  2YNH A;  3CSK A;  3U1M A;  3D6T B;  4PG8 A;  4O3R A;  1U02 A;  2RQK A;  3KOA A;  3EXY A;  1F3F A;  1MNE A;  4LF4 J;  2OPR A;  2W1B A;  1N32 F;  3MEG B;  4DU7 A;  2ZOM A;  4Q45 A;  5ETP A;  4OLO A;  4CH0 S;  1YWX A;  2R3V A;  5E3R A;  3DOM B;  2ZDP A;  3SCL E;  1NKC A;  5AXM A;  3GPA A;  4DV2 F;  4FZV A;  4LRF A;  1AFI A;  2CNO B;  2D9O A;  3SFG A;  4AT1 B;  1VOM A;  4ZMM A;  4KRW A;  4DR1 J;  1OQ6 A;  3MMC B;  2X1F A;  1S99 A;  3A8I A;  4TN2 A;  4A8Q A;  3VGS A;  1U1P A;  2PII A;  1XNR F;  3ZTP A;  2VZ9 A;  3M9N B;  1WEL A;  3HKZ D;  2XYH B;  2VG6 B;  3NCP A;  2AGP A;  2YKN A;  5A0Y A;  4KV8 A;  1U2R A;  1FNM A;  2GHV C;  1WC0 A;  3GWC A;  3BRE A;  3G6V A;  3CD6 S;  3QBC A;  4K4Y A;  3LQV A;  3DLJ A;  2OML A;  3HZE A;  2V2V A;  3GIM A;  1LW2 B;  4TQS A;  4ECU A;  4YY3 F;  1SH2 A;  1VQ4 S;  3VF0 B;  1UVK A;  2B8Q A;  1N5Q A;  4Y2K A;  4R8U A;  3S6E A;  1X60 A;  1NKE A;  5B09 A;  2DCU B;  1VHF A;  2FQQ B;  1TL1 B;  3P5T L;  5AJ3 F;  1T3N A;  4CT8 A;  3M6U A;  3KG4 A;  1ZOT A;  3N6N A;  2J9D A;  3TP2 A;  2AJF E;  4ES2 A;  2MZT A;  2C28 A;  1HI8 A;  1VRQ C;  3FBE A;  1Q7Y T;  4O4G B;  3VR1 A;  4DFK A;  1ITP A;  2QV6 A;  4UF4 A;  1OY9 A;  5IT9 Y;  1D3W A;  3ZZO A;  5DLG A;  3SSR A;  2MYF A;  1OYD A;  2WSE C;  2YPZ A;  5IV3 A;  2VQF F;  3QGP A;  1NM2 A;  1UW9 A;  1S48 A;  4YME A;  1HYS A;  4K59 A;  1AXQ A;  4YB6 A;  4ZVG A;  2VOP A;  3TI0 A;  1P8G A;  1GMU A;  2W7O A;  1KTV A;  2HHV A;  3HKW A;  3MUV P;  3CDA A;  2RDJ A;  3PEH A;  3Q8P B;  2H4W B;  2MKJ A;  2MLZ A;  3EE3 A;  4ZP9 A;  4DL6 A;  1NK4 A;  2NRE A;  1EHW A;  5F8M A;  4NOH A;  4QIE A;  2E1A A;  2WW4 A;  3NS5 A;  2FB0 A;  5KOW A;  3UN3 A;  4S0M A;  3BQ1 A;  2HHS A;  2W01 A;  3HSJ A;  1IBL F;  1AA1 B;  4ZPD A;  5L39 A;  4B3R J;  4RUA A;  3B78 A;  2B6A B;  3OL6 A;  3EDQ B;  3RBE A;  1Q86 T;  1LXN A;  3CT9 A;  1JXE A;  1RQ0 A;  2WVF A;  2JJ4 D;  3CD5 A;  1HKA A;  2AJ1 A;  2HHQ A;  2HBY B;  3AQP A;  2HQG A;  3LTO A;  4K4X A;  1M0S A;  2FDN A;  1FK9 B;  2E1P A;  4KAI A;  8RUC A;  3KHL A;  2HNZ B;  3VAF A;  3IA0 A;  3BSO A;  3GP9 A;  4I1T A;  3MUT P;  2BQ3 A;  3TUJ C;  5IM0 A;  4RR5 A;  5J1N A;  3QRP A;  1Q8L A;  1DQA A;  2R7Q A;  3PYF A;  1GXL A;  1RIS A;  1SUQ B;  1Z1Z A;  2EKN A;  1LOU A;  2IM0 A;  4LR7 A;  4RLE A;  4XAK A;  3SQG A;  4RPF A;  5KFZ A;  2HZC A;  2BR0 A;  2DR7 A;  1RAE B;  3ZZT A;  2B9E A;  2RU9 A;  5SZT A;  4JI2 J;  5DJB A;  4BC7 A;  4DR7 J;  1FDD A;  1RTJ A;  4RBU A;  5L1J A;  3FCV A;  2PA3 A;  2W9B A;  3JXO A;  4RL1 A;  1E6Y A;  4CLZ A;  2HZA A;  1SBR A;  3CCW A;  2FJX A;  2D9P A;  1Q53 A;  2E5H A;  1TP7 A;  2C1E B;  1RT2 A;  2GX8 A;  3SIP B;  3TAM A;  1KR4 A;  1S1U A;  1TL7 B;  2ALY B;  2FHJ D;  5E3Q A;  2Y1R I;  3W60 A;  2LXI A;  1OPI A;  4O3P A;  1G6B A;  1IQZ A;  2JFD A;  3KNG A;  3T41 A;  1MSW D;  2YWE A;  1FRL A;  2YWH A;  4F50 A;  3TVZ A;  3GJS B;  3PTW A;  2JC0 A;  5A6W A;  2EG2 A;  2FPH X;  2FHJ A;  3JAM Y;  1XR5 A;  1YX2 A;  4M5G A;  2DIT A;  1FEE A;  1NSP A;  3MMC A;  3QRR A;  3KK1 A;  1VQO S;  3CGI A;  3NKY A;  3C46 A;  1Y00 A;  4RW6 A;  4DUZ J;  4Q7A A;  3V81 B;  4MH8 A;  4PG5 A;  1WD6 A;  3DHX A;  1F5B A;  4JBC A;  5CH7 B;  2Z4P A;  4NA1 A;  2E5L J;  7FD1 A;  1RGV A;  4E8U A;  4DSI A;  2ZZT A;  3BH7 B;  3QGG A;  5ETT A;  4JI0 J;  4KFB A;  1FA0 A;  1X31 C;  4USW A;  2EC2 A;  3AB2 B;  2BKP A;  3I0R B;  5I3P A;  4B02 A;  4JV2 A;  2Q66 A;  5KT7 A;  2UXD F;  1TL4 A;  3GIR A;  4ZCM A;  2ZOF A;  3BGL A;  1UJ4 A;  3B4D A;  3HP6 A;  1K9M T;  2LDY A;  1LW2 A;  4G3I A;  5H9F K;  3TW0 A;  3IO1 A;  5CD4 A;  4F02 A;  2AQ4 A;  1Q1K A;  3M2R B;  3F73 A;  2I0X A;  3FCH A;  3LAN A;  2AX1 A;  4ANC A;  2V4R A;  5BYS A;  2H48 B;  3M8Q B;  3HFK A;  2GW8 A;  1WG5 A;  1UVI A;  4QYZ K;  4D3H A;  1B0P A;  4IO1 A;  1U8S A;  1KFS A;  4Q0B A;  4D3G A;  4M5K A;  1IKY B;  3GV8 B;  5HAN A;  2Z30 B;  2UV8 A;  1Q16 B;  4O4G A;  2CG8 A;  2HFU A;  4NAS A;  4ZS6 A;  4IO9 Q;  1U1Q A;  4I7F A;  1ZH5 A;  2CPH A;  4NLW A;  3PZP A;  4KE5 A;  5A8W A;  4X4N A;  1FXR A;  2HND A;  2MQO A;  3E51 A;  3Q86 A;  1GMW D;  3A3O B;  3ETM A;  3CW2 C;  1AT1 B;  2FVQ A;  3GQC A;  1V3Z A;  2G1D A;  4Y0F A;  4X4Q A;  2NR0 A;  2BVZ A;  1SC4 B;  2W4P A;  4E2F B;  1TFY A;  3PXG a;  1B7F A;  2AJ2 A;  1FDA A;  3THV A;  2A2C A;  1MMD A;  4ZLN A;  1FT8 A;  4OZ2 A;  2QG9 B;  4OJ1 A;  4Q2L A;  1L5U A;  3C3L A;  1NO8 A;  3SCI E;  1BY9 A;  1YK9 A;  4K7Q A;  3OTO F;  3AA9 A;  3UN2 A;  4LRE A;  3R5G A;  4DSK A;  2RML A;  3GR0 A;  3W66 A;  3IRW P;  3P4U B;  4OI3 A;  3D28 A;  4ZVF A;  1RAB B;  1M5H A;  4RW9 B;  1IBK J;  1S6P B;  3G96 A;  2VHG A;  5DQI A;  4ILL A;  2FC9 A;  2HS3 A;  3GZ7 A;  1FK9 A;  4MK7 A;  1PG5 B;  1WDD A;  1HNW J;  2VL1 A;  1H38 A;  2ZE2 B;  4OZ5 A;  1T3O A;  3SYZ A;  4K50 A;  1I1G A;  4IOC Q;  2E5I A;  3LOU A;  4DR2 F;  2ZNZ A;  4KYZ A;  1OPZ A;  1SUQ A;  1PIE A;  3SQG B;  3AJ1 A;  1S9E B;  5D4P A;  5A8K A;  2EW9 A;  5G4D A;  5C24 A;  3BKT A;  3CME S;  2GAH C;  2Y8Y A;  2DEJ A;  2VH7 A;  1YG0 A;  2HRU A;  3N6L A;  4WFB Q;  1APS A;  4WXW A;  1LFW A;  3CCM S;  5ETV A;  2ZZN A;  3DN9 A;  3NS7 B;  5DZ7 A;  3M9M B;  3U1L A;  2EKY A;  3UWT A;  5LMU F;  1UW4 A;  3ZXW A;  1JJ4 A;  3GSD A;  2C22 A;  4GO7 X;  2ACM A;  3PX4 A;  1S0N A;  1R8C A;  1CG2 A;  3HCX A;  5J2P A;  4NL5 A;  3BN7 A;  3JS9 A;  3LP0 A;  3TRG A;  4N77 A;  2OLW A;  4JI4 J;  3NBP A;  2AJQ A;  2ZH6 A;  3C66 A;  3R5A A;  4IG3 A;  4TU9 A;  3JYT A;  4OX7 A;  2ZHA A;  2PMH A;  4WTY A;  2F8M A;  4M5J A;  3OL7 A;  2G2Y A;  3GJR B;  4ELU A;  4X4S A;  1LWE B;  2YVS A;  3K5L A;  2DNQ A;  4WU2 A;  3RW7 A;  1BMQ B;  3D0H E;  2JLG A;  2C2K B;  4ELT A;  5HBM B;  3E8O A;  1CBK A;  1WEX A;  1DY3 A;  4NYZ A;  3N9U C;  2DNG A;  2ZH8 A;  3X1L B;  5DQG A;  1HI1 A;  1VBX A;  2KVI A;  3V6K A;  3CDB A;  3DRY A;  1RT1 A;  2BOP A;  2N7Y A;  3NMR A;  2O3D A;  3C16 A;  4WYL A;  1T7P A;  2FVC A;  3D0G E;  3T5K A;  1S7I A;  3KHH A;  2DR8 A;  1XNR J;  5IS2 A;  3DYA B;  3LP2 B;  1HD1 A;  4AXJ A;  1CQN A;  1U47 A;  1Q8I A;  4ZVS B;  2C3Y A;  3FEX B;  3G2X A;  3QAU A;  2DRB A;  2J0X A;  4C8M A;  4HH1 A;  2VG7 B;  1I94 J;  2BJ1 A;  3THT A;  4DMZ A;  3TX8 A;  1R0A B;  4GKJ J;  3FDS A;  1DTT A;  4ZPB A;  3JSY A;  5F8H A;  1S57 A;  1WWH A;  2XMK A;  4BLG A;  2V4J B;  3FGV A;  4F36 A;  4K4V A;  4U7U K;  4CNZ A;  3MM5 A;  5GMK a;  2W8L A;  1CVJ A;  4WZM A;  2CJX B;  1RAG B;  3BZQ A;  3OD2 A;  1HNX F;  1U7L A;  3DC2 A;  2I9S A;  1SH0 A;  3CJK B;  5E3A A;  4CLL A;  4CT9 A;  3T6B A;  2DBB A;  1C0T B;  1P27 B;  2RUG A;  3JTO A;  1D09 B;  2D74 B;  2V2Z A;  3DRS B;  4WP3 A;  2BMB A;  2CQ4 A;  3SV4 A;  2UVR A;  1S4E A;  4UTG A;  2IBO A;  3TUZ C;  1U24 A;  3KK3 A;  1RCO B;  3OL9 A;  4OHX A;  2DVI A;  3HHL B;  3VZH A;  3H20 A;  4FYY B;  4QBU A;  2VIH A;  1KN6 A;  4NX9 A;  1P1T A;  2V2Q A;  3ITH A;  1CUL A;  4DR3 J;  4TXS A;  4TU8 A;  3VQS A;  2XMM A;  3Q83 A;  3I56 S;  4J9K A;  2MEW A;  2OJ3 A;  2VFR A;  1RTD B;  1VRU B;  4O3Q A;  4F0M A;  4P74 A;  3QT7 A;  3MFH A;  1HMV B;  2BJ9 A;  3FEZ A;  2CDR B;  3GCW P;  4KBI A;  2RS2 A;  4QPX A;  3MPY A;  2HZV A;  2MPU A;  4LF8 J;  2YNF B;  2LFV A;  4M5I A;  4FF2 A;  1E6V A;  1HBM B;  2ALZ A;  4XPC A;  1HNZ F;  2ZJQ Q;  4J9S A;  4TYB A;  4JI1 J;  1J5O A;  2QYC A;  1NU4 A;  3PRV A;  4DR7 F;  2HUR A;  4GVB B;  4QQB A;  5HP1 B;  2CQ3 A;  1IKV B;  2LQ8 A;  3FSY A;  4YB7 A;  3MEC A;  3QFH A;  5B0B A;  2HVD A;  3SCK E;  4Y2A A;  1T9X A;  2AW0 A;  3DRP B;  1FVQ A;  2IVM A;  4ID5 A;  2IJN A;  3AAW B;  4TLQ A;  4DS4 A;  3C15 B;  1VQ6 S;  3G9C A;  5AE3 A;  4O3N A;  3FQL A;  3OUY A;  1YI2 S;  4WFY A;  1LFP A;  3CD0 A;  2VFV A;  4MYT A;  2H4Y B;  1KLN A;  1VYA A;  5K8P A;  3LAL A;  4F0H A;  1Z4U A;  2M7S A;  1NKB A;  1SC1 B;  1SKR A;  5FD1 A;  2UXB J;  3LGM A;  3KLG B;  2DR9 A;  5T7L A;  3O2I A;  4HHH A;  4ZCK A;  2AKW B;  4NML A;  3OSN A;  1HD0 A;  4PG7 A;  3KLH B;  3FMW A;  1S1X A;  3ZTR A;  4G1I A;  3L4B C;  3FK4 A;  2KHD A;  4UOH A;  4DV4 F;  4QU6 A;  2JVO A;  4USV A;  4NWB A;  2AV5 A;  2YNG B;  4M95 A;  3UVJ A;  4KT0 C;  3GG0 A;  2B9Y A;  1FKP B;  3J7Z T;  5IT4 A;  4M5D A;  3J81 Y;  1LWC B;  2O5D A;  2GJ2 A;  5HJX A;  2OEK A;  1IBC B;  2DYA A;  5GMD A;  2FJD B;  2W4D A;  3HT0 A;  2XM3 A;  2OIH A;  2UU9 J;  1QE1 B;  2CIM A;  4DDF A;  3L3C A; 
#chains in the Genus database with same CATH homology
 2G0I A;  4PEO A;  2G0J A;  2IDL A;  1S12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...