4GVBA

Crystal structure of the virally encoded antifungal protein, kp6, heterodimer
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords KP6 killer toxin subunit alpha
publication title The Atomic Structure of the Virally Encoded Antifungal Protein, KP6.
pubmed doi rcsb
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2012-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.440 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Killer toxin KP6 alpha-subunit 4gvbA00
4GVBA 4GVBB 1KP6A
chains in the Genus database with same CATH superfamily
2B6AB 4V19J 2KN4A 3KG0A 2E1RA 4C2MA 4C6AA 1TL7B 1RTDA 4IOBA 1LXJA 2LCWA 4ZVPB 3VF0B 2QEXS 3W9HA 4I6YA 1YJWS 2HPUA 2XHCA 2D1CA 3MAAA 3J7YI 3OT9A 2E1PA 2VDHA 4ATNA 3KK3A 3QGHA 2B51A 3MMJA 4RW6B 4OFZA 4OZLA 3DRXA 1AZSB 2Z57B 2UUBJ 1F9EB 1S6QA 2EKNA 2OEMA 4IH7A 1FKAF 3R2CJ 3BGOP 5L39A 2ASJA 4KB7A 2HIYA 4O3PA 2AGPA 4DSEA 3SSSA 5E3CA 2FZGB 2ZHOA 4PG4A 3CE8A 4KR0B 1NJXA 1WEZA 4FS2A 2VC0A 2QL7B 2XMJA 2OEKA 4QIGA 2DXDA 2VQFF 4FBTA 4FS1A 4TY8A 3EJMA 1DFDA 1IBMJ 4ZOSA 4WXOA 5LMNF 3RR8A 4H4OB 2QT7A 1NZ8A 3IS9A 1RU2A 3LALA 3QIDA 2UUCF 2XSJB 3A8JA 3R5JB 2KYXA 4DUYF 2QYGA 2ZWPA 3QBCA 2E5JA 1LK5A 2IJRA 3T19A 3G2XA 5KFLA 2VFUA 1NJZA 4G1IA 1RT6B 1O0PA 1TK0A 1KFSA 1N36J 2XLKA 3W2VA 2WK4A 1Q95G 1SV5A 2CG8A 1SKSA 4O3NA 4ERDA 4DR7F 3K8WA 2YKQA 1A6LA 3DGPB 3OSPA 3HSZA 2DHSA 5AJ3F 2WVDA 2HIQA 1YRUA 4M1KA 2KXFA 2AYEA 1NKBA 4Y3CA 1QY7A 4EO8A 5JMNA 5H1SV 4JI1F 1FRHA 2XB2D 1BY9A 1RWVB 4TN2A 4GO5X 4Q2LA 3KLGB 3BQ0A 4X66J 3IM9A 3AT1B 4RUHA 2W2OP 1SC1B 3UN5A 4ITSA 1RLCL 3M8YA 2J6SA 3PZPA 5A8WB 2SXLA 2IC3B 3NWRA 1B7YB 4CQ1A 2YPYA 3OW2R 3NNAA 2ZC4A 1UFLA 4S0MA 5HQMA 5KG2A 1RACB 3DOLB 1R8BA 4EEYA 5KFUA 3K2YA 4H54A 3BH7B 3S01A 3D2WA 1VS3A 2HVDA 1U6ZA 3EE3A 2ZKUA 1HQEA 1WELA 1PAUB 3SCKE 5HJXA 3NGTA 3G9CA 2BV3A 1M5HA 3M30B 4OI1A 3PRBA 1RT2B 3TWZA 3CPWR 4C4WA 2ZZTA 4C8YA 2HBYB 1X9SA 4C9DA 2BQRA 3NKYA 4HI2A 4NE9C 3RUBL 2XY7A 4KPYA 4XPCA 3BGRB 4NXMJ 1HBMA 3OBIA 1FJCA 2H5EA 3Q22A 1S6PB 4DMZA 3MM6B 1EAYC 1KVIA 2PIIA 3Q24A 5DRKA 1DTTB 4L3NA 2CPFA 3G6VA 2FDNA 2XMMA 1ZPWX 3MMCB 1FK9A 3M1VA 3K59A 4IUFA 1KS2A 5EX3A 3MTJA 1DJ0A 3PEJA 4NA3A 2GA7A 2ZNZA 4NLOA 4IQMA 2DNLA 3LAMA 1VBYA 4F4YA 3H90A 3UDLA 3NNHA 1X4GA 3LOUA 5M2RA 4RL1A 4F7VA 2AJ0A 3GPAA 3LH2S 1RAHB 2UXBF 1IJFB 3FSYA 4C0OC 4IDKA 4AFFA 2BE9B 5HLFA 1VC0A 2DGOA 1M5VC 3FMBA 3CD0A 3MGJA 2MLYA 3LP0B 4J9KA 3DHXA 5A0YB 1NB7A 3GQCA 1RT4A 3M9NB 2E29A 4QQBA 3SQGA 2HSEB 1RHUB 5JUMA 3SIPB 2DNHA 2AD9A 4DV6F 3IG1B 1QLNA 3ICLA 2VASA 3U1MA 5I42B 2A0FB 2RE1A 2ILYA 2MLZA 4DV7J 4C7QA 1FESA 4ECSA 2ASYA 4I7FA 3KJNB 3NG8A 3DRPB 3H5XA 1G4CA 1I94J 2D9PA 3AQOA 4LQ9A 3W1YC 4YN3B 5HN0A 3VQSA 1K0VA 2ZOGA 1N32F 3GONA 3IO1A 3N6MA 3TUPA 3NY0A 3ADAC 1FX4A 4GKJF 5IS2A 4KHPJ 4X4PA 3BSNA 2A3JA 2B4UA 3TO8A 2CYYA 1VLOA 1X4AA 1REGX 1TL1A 4DL4A 4M5IA 2ZJPQ 2WVEA 3UDCA 1Y11A 1F5AA 1W25A 1SCJB 1L3TA 1BQNB 1S1WB 3OFGA 1U0HB 3C46A 4JI7J 5D3GA 4PPZA 1LW0B 1PJ5A 1YBAA 3T1HJ 1Z2ZA 3H25A 3D6MB 3JSMA 5ETVA 2HFZA 4B3SJ 4BC7A 1HNWF 4O3OA 3D6FB 3RRKA 4ICLB 4Z2XA 2WOMA 2HEKA 5KG4A 1XNQF 3OTBA 3GYNA 1UWBB 2KXHA 1O5JA 5F8IA 2Q43A 1CS4B 4CT9A 3M2UA 2HHUA 1RSCA 2WW4A 2BUNA 5LM7E 1TVRA 4LF9F 1U1NA 3PYFA 5JVHQ 2KG1A 1RT1B 4RR5A 2FLNA 3MEEB 5KFAA 3GG1A 1UJ5A 1VI7A 1S1UA 3CUNA 2PA3A 4HHUA 4A8OA 2DNOA 3ITHB 4J91A 2LVWA 1SUQB 3JB9k 1X9WA 2HLTA 3DNCA 3SMZA 3KLHA 1REVB 3IRXB 3DRSA 1JLQA 3RZAA 2JDJA 4U7UK 2JVRA 5KT3A 2EFPA 4DV2J 4DPWA 2J9DA 1TK5A 2B9XA 3GR1A 3U7JA 2DNPA 1U02A 2G1HA 5F9LA 2UU9J 3LGHA 4QU7A 3CC2S 4PXEA 1OY9A 4DHVA 3CW2C 4P2XA 1U1MA 3TAQA 5KFMA 4DQRA 1KTQA 3UN3A 4KGMA 5F3TA 2B43A 4PQUB 3C66A 3DLEB 4BWMA 1HPZB 3MI7X 4RLEA 2ZHBA 2EFNA 2OSRA 1HBNB 4CH7A 3HSGA 4DUZJ 1T8EA 2NZCA 2BJ8A 3THPA 2BANB 2CPDA 2V8VA 2DHAA 5KG5A 2F63A 2PI5A 5FJ4A 3J81j 1ITPA 5KG1A 1WD6A 4UQGA 1RWNB 2ZH1A 1RKIA 2L48A 2R7QA 1QVFR 2AZ1A 2Q3PA 2XZWA 3I5AA 4XDCA 6AT1B 4DR2F 3DDNA 1RAFB 2LQ5A 4EGLA 5IFMA 2ACMA 2MY8A 4DL5A 2P8IA 1M5SA 1MSWD 1SJ3P 4HACB 1DURA 3BSOA 1FEEA 3MM8B 4DLGA 3KLEA 4FYVB 4DF4A 4WFYA 4Y65A 1N52B 2JC1A 2QLJB 4HT7A 1EKSA 1C4CA 1DTQB 2ASLA 3WX4A 4CRJA 3T1YJ 2ZD1B 3BJYA 1MROB 2J76E 1VQ8S 1O8BA 1TKTA 2MZTA 2RF2A 4ZPCA 1UCNA 4DR1J 3NBPA 3OL6A 1RAAB 4DV5J 2HHHF 1JQGA 2PI4A 4U9RA 3VAGA 5IWAJ 2RJZA 4OIXA 2ATLA 3TRGA 4DSKA 2VBWA 2CPHA 2XULA 2HAIA 2GGPB 4QIEA 3PY8A 2ZDOA 3UCZP 2CJBA 4P10A 1FRXA 1TL3B 4P73A 2MKJA 3CMES 4KTQA 4OI0A 4DV3J 1S76D 4DR5J 4RUCA 3K5LA 1JKHA 2KTQA 4BDPA 4M94A 1LFWA 1HWJA 1SH0A 4X64J 2YQ0A 1Q86T 4DX6A 1NK7A 5JJBA 1T9TA 1IM4A 2K3IA 1DBDA 4KAIA 4M5LA 4RNNA 2ZOFA 1Z4UA 3M2RA 2K7JA 2QG9B 4DCOB 3BO3A 5KFHA 4AE5A 2YKPA 4Y28C 4B9MA 3OXLA 2XMTA 2OPPB 2RDDA 3SFUA 4P2FA 3GJQB 3Q8RB 3JAMY 5LOQA 4ENOA 4E2FB 3W9IA 2MGZA 4NYZA 1PO6A 3TZXA 3THTA 1EP4A 4FZVA 2R2TA 3ENAA 2OD6A 4F36A 2G0JA 2JWNA 4FYYB 4R8UB 2VV5A 3M9OB 2Q1LA 4H4MA 4X2BA 1JNRB 1X5SA 1VK3A 2E9RX 2YKMB 3RJMB 2J7UA 1RJJA 3CCES 2W7OA 3P49B 1CPZA 4OHVA 5J2MB 3N5FA 2J7WA 2AJFE 2WCXA 4QIWD 5KAKA 2QFIA 5T7LA 5AT1B 1JLBB 3MPDA 4L3KA 2CQCA 4ECZA 4IG3A 2BW7A 3OSNA 4WWSA 4KGKA 2D41A 1X5TA 4X4NA 1TQLA 3GLJA 2UUAF 2LA4A 2I38A 3DKDA 5FLXY 4F26A 4JV2A 2VG5B 1Y00A 3W5YA 3LPYA 1WHXA 1FTRA 2GQCA 3RBZA 4C8MA 4BHQA 2FQQB 3QIPB 1BE4A 1CJUB 1VQ7S 3DN9A 2MJUA 4KIAA 2JFKA 2GQQA 4ZN1A 2J6TA 4F0KA 1WSRA 2ZH6A 3MM9B 4I4BA 4WKYA 1VIXA 4ZVSB 3N5BA 2IA6A 1BQMB 3D1QA 3A3OB 3OR1A 2QLXA 3I0SA 1ACMB 1R0BG 3TQ1A 1RB0A 1ZAWA 4CDIA 3K89A 2VJUA 1HNXF 3GR0A 3BKUA 3ZZRA 5E2QA 2V9WA 1M90T 2R7XA 4RBVA 4N8NA 1V5IB 2J0SD 5A8RB 2MLXA 3MMCA 3VR1A 1HNVB 4DV7F 2AEJA 1PKUA 1U6BA 3TJ8A 4KHRA 1JLFA 4ZPWR 2HBRB 2LMIA 5GAEI 4LF8J 4PKDB 1XNRF 4OV1A 2NSBA 4V1Ak 2X1GA 2W9BB 4PR6A 2R8HA 5B0AA 4B3TJ 1R27B 3P3DA 4JUZA 2V0NA 2JRSA 4PWWA 4C11A 2BX6A 4ETZA 3M9MB 1C1CA 1NHVA 4JP8A 1KVJA 5ETQA 1FO1A 3QJPA 2QA2A 2ZH8A 5CYMB 1N88A 5J2NB 3AOBA 2ZBRA 2CQ1A 2FJVA 5A0YA 4NLGA 4QWEA 4PWDA 1VBKA 2B5JA 5D4NA 5HMXA 4FVCA 2D3OR 4B3SF 5D0RA 2GCFA 4KC5A 3IMQJ 3ZTPA 4IH6A 2MB0B 3BZQA 4LF6F 5U47A 5KT5A 5HMYA 2VF3A 4MIAA 5CXTA 2BYCA 4TLRA 4DL2A 3PTWA 2ZBIA 2DHXA 1VRUB 1RYSA 3A3PB 2W24A 4ZITA 4CNZA 4WIQA 1NK6A 2K2PA 3LGNA 4CT8A 2OAUA 1TV6B 4YFUA 1YTYA 4DR6J 2GS8A 1NHUA 3S6EA 1L5UA 3FC9A 2XM3A 2QL9B 1RT3A 1UEUA 3VAHA 1S0MA 1IKWA 2YH0A 1KVKA 4Q0BA 4XIUA 4LREA 4PG8A 1S1WA 2PGCA 3HZGA 5G0RA 2LKZA 1H7XA 1KP6A 3QO9A 2WVBA 2Q6CA 3M32A 2OFGX 1R8AA 1R8PA 5D4PA 4DR4J 3H8YA 3DI6A 4Z7CA 3RB6A 3UVJB 1T03B 2MHNA 4KH1B 3AAWB 1S9GB 2W2MP 1U8WA 5LL6d 2PT0A 1MWYA 2IPOB 2V8GA 5KFCA 2E5LJ 1NK4A 4QPXA 1CS4A 2EEYA 3QPIA 1P9QC 1B3TA 1N34F 4C0HA 5GADI 4IRCA 1Q53A 2CVIA 4KRWA 2IVYA 1FFWB 1NU4A 1MW7A 3U1NA 1U47A 2AEFA 4K4XA 3CT9A 2YH1A 1HYSB 2XNRA 5HJYA 4USMA 3OTOF 1Y5LB 4BC9A 3J7Z5 1LV5A 3D66A 4OI4A 2L9DA 3IWLA 1SH3A 1RI7A 4CLTA 4DG1B 2RQCA 4MJKA 1B4SA 3BN7A 3JYTB 3D5MA 1ZA2B 4RO0A 4F02A 1FNMA 1N4LA 2HS0A 5GVQA 3UN2A 2HNDA 4ZCIA 3QAUA 5K9FA 4ECTA 4I6WA 2C2EA 5A8KA 2XLIA 2RILA 2B4OA 2ZJQQ 1IWAA 3UR3C 1VR6A 4QIFA 4X84A 3EICA 2KZZA 2MKCA 4HLBA 5GAHI 4MFBA 4K0KJ 4TU9A 2EI5A 4WE1B 5C2GA 3FSXA 5B0CA 4FYWB 1Q5VA 4PUOB 5H9FJ 1Y3KA 2QSFA 4EK2A 3H98A 2WONB 1UJ4A 3E8OA 2VL1A 1J5OB 5A2QU 1KQFB 3CDAA 2MQMA 4ECQA 4EZ6A 2MKYA 3M6WA 2KJVA 1EETB 2B4VA 2GJFA 1VLYA 1IKVA 1HQUA 2QLFB 4ED2A 2JH3A 4E8UA 5KFZA 1YGYA 4X64F 2G2YA 4F4XA 1NJIT 2RUSA 1RTJB 5KT7A 3C15B 3PKYA 4K4SA 2QN6B 1XC9A 3PKMA 3T5LA 4F04B 2HRUA 2OPQA 4OQJA 3OD2A 5B7WA 3RBDA 1GTEA 2V94A 2MQNA 1MROA 4QWCA 4P6QA 4IOCQ 5EUHA 2RAQA 1ZETA 2BJDA 4JYAJ 3C6UB 4X4RA 5C24A 1QE1B 2MSTA 3OXFA 2IJFA 5LSOA 2RKIB 4NLPA 1VQPS 4JI5J 4JI6J 1CJKB 4DPTA 2BQ3A 1TKZB 3M7VA 4LSNA 2GVDB 4RUAA 4FF2A 2AYGA 2Q6BA 1FWLA 1DY3A 4L6V3 4E0DA 3FVYA 1LXNA 3PM9A 1WF2A 5KFIA 4K2JA 3DM2B 2JL9A 2BDPA 2FC9A 3A3NB 3N28A 1VQKS 5KFTA 4YQWA 5KOWA 5J2QB 1VQSA 4NX9A 2BE2A 4U96A 2D74B 1YI2S 3RGIA 2KHDA 2V4RA 4QJVA 3QJJA 3AXMA 3V6KA 3MPYA 2WVFA 1H98A 2E66A 3HULA 3TA2A 5BYQA 1VRQC 3MFHA 1S1XB 3ZNUA 2VFRA 2KDOA 4HHJA 1KQKA 4YUDA 3TJAA 1WKKA 4NI2B 4IYQA 4NLTA 4ER8A 4KFBB 2VG7B 2CJAA 5E3PA 4ZP8A 1FDAA 3QAEA 3FEZA 2DCLA 3TOQA 2JHEA 1WG4A 2CVEA 5F41A 3GCWP 3HHLA 2GAHC 1U24A 1YITS 1VQ6S 3ZO7A 1WOOA 3ET6B 6FDRA 2ALYB 1R0AB 4L76A 3Q8PB 3FBCA 3VAJA 3JTPA 4F8RA 2XY5A 5B0BA 3EDRB 3CXCR 5KFSA 2ZHAA 4F4WA 4ES3A 2W7AA 5AE2A 1FRJA 1YLXA 2GMLA 3CJ5A 2UVWA 4NASA 4CYUB 1GT8A 1JNZB 3H4DA 3QFWA 1LWCB 4M5MA 4WYWA 5AXNA 3CGIA 4K7QA 1VC6A 3TW0A 3GIJA 1YRTA 3Q89A 3GYGA 3M6UA 3KLIB 5BR8F 2WSCC 1S1VA 2UV8A 4F0HA 5DZ7A 4B3TF 2OD4A 2CNKB 2RRBA 2RD5C 2VB6A 3GJSB 5IOLA 4MT1A 3KNAA 2W25A 1KLMA 4NZ6A 2CQHA 3KTQA 3TVKA 2V5HG 4RX6A 4DQSA 2FZKB 1FEHA 1UL3A 4X65J 4NLQA 3I31A 4EI2A 1URNA 1HW9A 3PR4A 2XC9A 2QO3A 2BJ9A 2QMXA 1U0SA 1F2HA 3FMWA 2ROPA 3KJQB 2OPSB 2HFVA 3R6LB 2C2DA 1IR2A 3R5GA 5KT2A 3KLFB 2Q79A 1C0UB 4NEYA 2XO7A 4WF9Q 2QRRA 2V8DA 5LMUJ 3UFCX 4KKOA 4CZCA 3D6HB 1WC3A 4OZ3A 3MFIA 2YKAA 3VVTA 3C6TB 1FT8A 1U4BA 2WVCA 3TX8A 3SV4A 3GU0A 1UP1A 3OPKA 1V6HA 1U2CA 2HZVA 1NJYA 2FPHX 1N5YB 2UP1A 2Z2LA 1IN0A 3TYTA 1HARA 2W9BA 2IDEA 4ED3A 3I0RB 3MM5B 2D3UA 2J7KA 4DR6F 2ZKTA 5D0HA 4NLXA 4ALZA 3SCLE 3NL0A 1NJWA 1CEZA 2HW3A 1JJ2R 4DV1J 4ZPTR 5H9FK 5HK4A 3BM7A 1VFJA 2Z58B 1YDLA 1W2IA 1Y0HA 5DDQC 4A4JA 1RXOB 2CZ9A 3G8SA 1N5SA 1T9WA 2VODA 3OQ2A 3CJSA 1GMUA 1RAGB 4CTAA 1KBRA 3L7OA 1P27B 1CQMA 3CF5Q 2ILZA 2VD3A 1TELA 2KRRA 3POTA 3IRWP 1I5OB 5J1PA 4NCAA 2BBEA 1DQAA 4ZP6A 2ABYA 1P1TA 3HHNB 2EG1A 3E01A 1XERA 5FDLA 1WC4A 4B3OB 5HP1B 2BABA 3FNNA 4P2SA 1U7LA 2J0WA 2W9CA 4B9VA 4ZVUB 2ASDA 3NWGA 4KH0B 1HWLA 3S8SA 3FBEA 1JJHA 1T05A 4ZCKA 3IFEA 1VGYA 1F1BB 3KG4A 5CABA 1HA1A 2KT3A 2FJAB 1UMJA 4WFAQ 3W2WA 1PGZA 3X3UA 3A13A 4IQXA 2HFUA 5HL7Q 2DHHA 1BHNA 5DDRC 2R8GA 3CCZA 4JV5J 5MAOA 2AT1B 4JOUA 2GO8A 1V3SA 1KR4A 1OQ3A 4LF7F 3G8QA 1GMWD 4RPFA 1TKXA 1CJVB 3ETOA 2DPIA 1B0TA 3O5TB 3UE2A 4LSLB 5LJ5Y 1PYSB 1AYEA 3KG1A 2HHWA 1BD6A 4YY3J 3BGUA 1S57A 3FZ2A 3LQVA 2LQ8A 2XYGB 2E9ZA 4ID5A 3OLBA 4K0KF 1VHFA 3D67A 4DBQA 1ZH5A 1OS5A 3PVXA 1OY8A 1AW0A 4A8SA 1IQZA 3UDEA 3BGLA 3FSIA 1NUEA 4X4QA 2MQPA 3MR6A 4N76A 3PG9A 2Z56B 2DGUA 1LEOA 3C19A 1V3RA 3GIRA 3DOKB 2EW9A 2CUYA 2OGUA 2ZDPA 1R43A 4QWBA 2G1DA 2D3O1 1VCTA 4N8OA 4WJBA 1OYDA 1KD1T 2B56A 2DH8A 1XR5A 1JLGB 1D9AA 2J5AA 2GV1A 4DSLA 2GMJA 2OHDA 4DPOA 1XMOJ 1EQ0A 4M95A 3BQ2A 2C2OB 2OEJA 1HD1A 3TR5A 1SC4B 1JXEA 3W60A 2XI3A 5D6GA 2YNFA 4NLDA 1QAJA 2AP6A 3GJRB 4AL6A 1HKAA 4HYKA 3M8SA 5J1EA 1XR7A 2AW0A 3EWGA 1KQGB 1D1UA 3CJKA 1C1BB 4FDFA 4DQIA 2IM1A 1S6OA 4UZCA 2DRDA 1RWOB 1MG7A 2ZE2A 3LP1B 3BYPA 3K0JA 1TKDA 1IJEB 4JI3F 1HQ2A 2P9GA 2WSFC 2F4FA 1J5EF 1FE0A 2DHGA 4JI5F 2W2QP 4RW7A 3P5TL 2W4DA 4N5SA 1FVQA 4K8RA 4UOFA 4IRDA 3HJFA 2F9DA 3QWUA 3W65A 3CCMS 3ZZZA 1K73T 3DU5A 3UR0A 2PSZA 3SSQA 2MY7A 1H7WA 2A6MA 5ETLA 4C3MA 2HFNA 2QFJA 2E5HA 1QAXA 2FUG9 3BREA 4WK3A 4CO5A 2R8KA 4X4OA 1PBUA 3KDNA 2LFVA 1JB0C 1X0FA 2XWXA 2A2DA 1PYOB 1HBUA 2V63A 5LXYA 2GJIA 3C3LA 1XQIA 1B0VA 4O0NA 4ZPVR 1YJNS 2WW8A 4IFYB 2DO4A 4ZIWA 4USVA 4XDDA 1S9EB 3C6UA 3GCXP 4MKYA 1QE1A 1SL1A 4K4YA 3HVTA 1TMJA 2YQ3A 1KC8T 3CC4S 3HF5A 2Y1IA 1FXLA 5BJRA 2FVCA 3DHWC 2R2RA 4DFKA 2ZH9A 3LPEA 2V9KA 2NZ4A 4O4GB 2N3LA 1IUJA 1UAWA 4P75A 3GV8B 1HNZF 3HHKA 2ROEA 2RDJA 4ILMA 1TAQA 2IVFB 5KG7A 2HQIA 3TEGA 3OUYA 1AUDA 2F8EX 3NGUA 3VAFA 3NCQA 1QUVA 2HNZB 4JB8B 4DN0A 2CXEA 2E5GA 5EDWA 3M8QA 2QJ3A 2KT2A 1S1XA 1S0VA 1VISA 2KO1A 3QJLA 5KOXA 4FF1A 4M5KA 4UY85 3Q2TC 5HROA 1QTNB 2F9JA 4USUA 1LW2A 3CSKA 2R7OA 3PYDA 2XGQA 1FKOA 1HR0F 2DYAA 2RDIA 3J7YU 4DOZA 4ECWA 1FNOA 1HHQA 3W7BA 2HGMA 1T94A 1U1QA 3V5RA 5E5NA 1NLKL 2L9WA 4NZ7A 2BXJA 3G6YA 4P9SA 1R0AA 3LGMA 1VK8A 1E6YA 2VQFJ 3TAMA 1WTFA 1DQ8A 4OYOA 1N54B 2RRNA 3BB5A 3MWBA 3C16B 4EMDA 2M2BA 5EWEA 3B82A 1V3ZA 1O51A 4ES1A 3QGPA 4I56A 3WZ0A 2UUCJ 5KFXA 4WKRA 1RTHB 4K5RA 5EX0A 3ZZ0A 4ZVEA 1GNKA 3R8YA 4M5GA 4ECYA 2ADCA 3FBFA 1BXNA 4OX9F 5KT6A 5I4MA 3GV7B 2IAJB 3MEDA 3AOCA 4USTA 4DJBA 4DV1F 4CI0B 2ZH5A 2APOA 2G2ZA 1ZOTA 3DRRB 2JEFA 3C14A 1U2FA 4KGVB 4U67Q 4DR7J 1YKWA 1VYAA 4CWBA 3IBWA 4QW8A 3Q8SB 3TJ9A 1RWXB 1GTHA 2K06A 5AJ3J 1RADB 2G4BA 1VQ4S 1IKYA 2E1MC 2YNGA 1PJ7A 2BE7D 5B08A 4OI2A 3KHHA 4TY9A 2CPIA 2KU7A 1T3OA 2UXCF 2ALZA 2CFXA 4JI1J 4ZVRB 1UEVA 4RWWA 4DN9A 1N6QB 1YSJA 4G1QA 4YEAA 3RRGA 2AJ4A 1YRXA 4FXDA 1BWEA 2OTLS 2H4YB 4RKUC 5CD4H 4XPEA 3HHEA 4CM2A 3MM7A 1U1LA 3WX8A 5HVFA 1CULA 3RBEA 3ZTQA 3JTOA 1EIYB 1NAQA 1G6BA 2A1BA 4C97A 3RTVA 1WC0A 4U7CA 2JX2A 3LP2A 2AJ1A 4NLSA 2KT5A 4AQYF 2N7YA 2MZ1A 3J7ZT 1ZM9A 4UOGA 5JXSA 4PRFA 2UV8G 5GMDA 2FHOB 8AT1B 2EKYA 2R7SA 2RU9A 1HI8A 2K1RA 5EHHA 1XEZA 1IBKJ 1RAOA 2CPJA 4FYDA 2XZTB 1H3DA 4P52A 2MZJA 4J9VA 4LFBF 3VHQA 1MMNA 1DLOA 5CYQA 1CSJA 4ZIVA 5L1KA 2UVVA 3H5SA 4OLPA 5HP1A 3DLKB 4F4AA 2X3GA 4N47A 3SI8A 2XMAA 1WC5A 4KV8B 3D4JA 2VDIA 2VA2A 5IT9Y 2RVJA 2OH2A 4LVNP 1RP5A 4YR3A 2JEGA 4NA1A 3DOMA 4I1TA 4WTOB 5A6WA 2Y1LB 3KK1A 4Y2IA 3PO5A 2L3MA 4MKAA 3MR2A 2VONA 3PW4A 3H42A 2YY3A 2MZQA 3TVYA 4LBIA 1RZMA 3PNIA 3V81A 3WBZA 1RT5A 1FNXH 3EX7B 1URRA 3KJVB 2W1BA 2G13A 1H38A 5RUBA 3DMJB 4IG0B 2DH7A 3DLGA 4YHHF 2DCUB 2YWGA 1FKPB 1O6XA 2UXBJ 4DZDA 1Z2LA 3LANA 4TXSA 3ONQA 1RLDA 4CLLA 2G9OA 3NS5A 5F0WA 4USHA 3HHLC 3N6LA 3OVAA 4HTIA 2ZUGA 2DR9A 2GVZA 3V6DB 4F4ZA 2GIQA 3HD1A 2JSXA 2HQDA 2W4CA 5DZ6A 1TU0B 2W2NP 3AODA 4DV6J 1R7IA 6FD1A 2HNYA 2R2SA 5A6PA 3DLHA 2HHSA 1HI0P 4OX8A 4TVAB 4CO2A 4F3MA 3GZ7A 3N01A 1AB8A 4ECVA 4X4VA 3MECB 4NLWA 4B3MJ 2CJYB 3BO2A 1CVJA 3V4IA 3T5JA 1Q5YA 2KFNA 4FPRA 1LNQA 2JZ5A 2LQBA 4R0JA 1M0SA 2KFZA 2YNIB 1N32J 1FF2A 3HVRA 1U25A 1Q78A 1N5TA 5K8OA 2GZOA 2HVIA 4GKJJ 1JLGA 1OPZA 4C8ZA 5KFNA 3NRBA 2DD8S 2JEIA 2O01C 3EZUA 2YKNB 4KO0A 1WTBA 2VOPA 1KEKA 1D09B 4WCEQ 2UXDJ 4HHHA 5CH7B 1HWUA 4YR0A 2MKKA 3IR6B 1L3SA 1H6KX 3U1LA 4WU3A 1HNWJ 2B4PA 4Q44A 3MCMA 2BJ3A 2NPFA 1S0OA 1M5OC 3SQOP 1AXQA 1XNQJ 4DZ6A 3QT5A 1NK8A 3CCSS 5ETRA 3OVSA 5KFWA 1MLAA 1F5CA 3Q8QB 2H1YA 4A8YA 2NXCA 4LF9J 3OR2B 4N41A 1KONA 3ZZOA 5HQ8A 2EWHA 2ZWOA 4ED5A 3VGTA 1OJ4A 3HM9A 1RTIB 1JLEA 1VQ9S 3JTNA 1HNIA 1HIYA 5IM0A 1SJ1A 3RR7A 3MOZA 3IN5A 1CJTB 1TK8A 2I8EA 4NYPA 4NEZA 1OY6A 2ZEJA 4PEOA 1WOSA 3M05A 2CNLB 1AROP 1N33F 5F8GA 4EYIB 2U2FA 4NCBA 2C3UA 7FDRA 3UCUP 3R5BA 1EKRA 3VZIA 3NEKA 1I51B 3TA0A 4IFYA 3EM1A 3UPFA 2K8GA 2VFVA 1SH2A 3FCHA 1K1QA 3NMRA 5DQGA 5C2CA 4J9NA 4QWAA 5CZXA 4R5PA 2V4JB 2YNHA 2BZ2A 3ISND 2CDQA 4LJMA 2CQIA 1P9YA 2DT9A 3H20A 4AXIA 1WHYA 3QT8A 3EZ5A 2VH7A 4RUBA 3DGVA 2PA8D 2HMIA 4IRKA 3AD7C 3HKZD 2ZITA 1IBCB 3MMAA 3RAXA 1GMVA 2HQCA 3M2VB 4KY3A 1C0TB 2BVZA 1K47A 3LTOA 3GIIA 3AY0A 4HTJA 2ZNYA 2VZ9A 3D54A 3P4UB 2Y0SD 4URGA 2DISA 4DR2J 1U1RA 5AXLA 3O44A 1MU2B 3I9V9 1RTZA 3MMBB 2JVOA 2PEHA 4TQRA 1XMBA 2KKHA 4UOCA 2IYIA 2YTCA 4ZP9A 2WSEC 4WIIA 4DDFA 1DHMA 3CJ3A 2FVQA 3FRYA 4ZLNA 4F50A 3HT0A 4OL8A 1RA7A 4DQPA 1BMQB 5L46A 4RNOA 2EFGA 3UI3A 1S5ZA 2FVPA 2EG2A 3CIMA 3CWJA 3EGNA 2I5JA 1SJFA 2HHHJ 3SV3A 4ZJLA 4M5DB 1JLAA 2OIHA 4G1PA 3TZZA 2R9LA 1SIWB 1R8CA 4DV4F 1BLUA 2D69A 2W9AA 4B3RJ 1UW9A 1TFYA 2QX0A 1LWXA 1NPKA 4RW4B 3BGFA 2CKWA 5EWGA 3QYYA 5F8LA 3OJSA 1FFGB 3IM8A 3W8PA 1HBOA 3QLHB 3NS7B 3BO4A 1GX6A 1LWEB 4TLQA 3AA8A 4CO0A 4LBPA 1KWMA 2VG6B 1VRTB 1B0PA 1E6VB 4DPUA 3G87A 3NNCA 3UD3P 3HPOA 1OYEA 1KQSR 3GFZA 2LA6A 4Q7AA 2DBBA 4TYAA 1DARA 1ZM2A 4NYOA 5M2UA 3FFIA 4X62F 2LP4A 4O44A 2DR6A 3B4DA 5C7PA 1NZAA 1TTHB 4JI8J 2XY6A 2GJ2A 2RH3A 1UW4A 3AJ1A 4O3QA 1NM2A 1G3OA 3M8PA 1IBKF 2AEMA 3G86A 4K4WA 2IYGA 1NCLA 4EBEA 3SDEA 4DWIA 3T1AA 2IM2A 2FLPA 1S49A 3CCTA 2UVRA 1R3NA 3BKFA 5K14B 1WKJA 4B02A 1WDTA 3KK2A 3ELHA 2KJWA 1HMVB 2DK2A 4OHYA 1H2TZ 2OO4A 4I2PA 3BS9A 1NDPA 1BUXA 2C3PA 4GVBB 1X0PA 3VGSA 1U49A 5KFRA 4ZCMA 4C8OA 4P2MA 4WPAA 4AXJA 1ZPVA 2UUAJ 5E7OB 3VAIA 2YX7A 2FGOA 2CAJA 4WTYA 1D9FA 5I3UB 3SYZA 4QWDA 4LRCA 2I9SA 3KJFB 1NRKA 3NMAA 3CCQS 2E44A 2J9DE 2HQ3A 3K5MA 5K8MA 2CJQA 1YJTA 3PFEA 2ZBQA 1Y5NB 2X3DA 4IFVB 5CAAA 4W4MA 3I96A 2J9EA 1Q8IA 3EDQB 1LWFA 2YXLA 4AL5A 1HLWA 2ZH4A 4LFAF 2G0CA 2N3OA 1DZ5A 3CD6S 3EPGA 1PSDA 4LRDA 1RTDB 1VQMS 3L4BC 2HWIA 4ZK7M 3PEHA 1TUGB 1HNXJ 3D0HE 1IQTA 3SSRA 3CD5A 1DAXA 4QOTA 3ZZYA 3VZHA 3MAAB 4DEZA 1QTMA 3KK3B 1UPMB 2EBGA 4B3MF 1SJRA 1UFKA 3A8KA 2EBEA 1S6QB 1RWKB 2W8LA 2OI2A 1X7VA 1U2RA 3TQEA 1AUSL 2EFQA 1XNRJ 1M1HA 2CWKA 3F44A 3IGVA 1UA1A 2ZVSA 3MEGA 4IG0A 1JLCA 3K5NA 2PE8A 1UJ6A 1RQ0A 3R1HA 2UXDF 4LIWA 3BBBA 5GAEU 3US5A 4FNIA 4Y00A 4O3RA 5IV4A 4RW9A 4TY8B 1P8GA 4HDHA 1W2BR 3CCRS 3JAMU 2LXIA 2DR7A 3IS9B 3AJDA 2KL8A 2YBVA 1F2GA 1IXKA 3EUNA 4LF6J 2BQUA 2WBMA 1K0TA 4OYXA 2LEAA 1S1TA 3BR9A 5LXRA 3PR5B 2BKPA 1VQLS 1S4EA 4U8VA 1FRIA 2LQJA 4F2SA 2VUGA 3U02A 1M5KC 3GG0A 1K8AT 3W9JA 4FXWA 2OSQA 2UUWA 1QD1A 5J2PA 3W2VB 1VOMA 2HWHA 3FZBA 3GMGA 2B9WA 1UVJA 1RHMB 1LFPA 1WEXA 1YHQS 1RDRA 2LXUA 2Y1RI 5FLXU 4QU6A 3GE9A 4NCGA 3MR3A 2HHVA 3ZC4A 1WHWA 3MCOA 1GXTA 4OYIA 2ZH3A 4CM0A 4EU0A 4LUBA 4OI6A 3IR5B 3WC2A 5F0UA 4FKYA 3UWTA 1ZZNA 2AKWB 3H40A 3HFVA 1MN9A 4WK1A 1GX5A 4K5SA 2MXYA 4ED6A 4UY8T 1IM6A 2V4QA 1H72C 4CO4A 1N34J 4WFBQ 1UVKA 1ZTTA 4NZ0A 2HS4A 2DNGA 4I6AA 5HQLA 3HVAA 3MDFA 5IT4A 1YZ7A 3QFHA 4FNHA 3BPDA 2M3DA 3QZ8A 1HQEB 2AGQA 2E5IA 4CP5A 3QSIA 3Q23A 1V5VA 5SZTA 2FVRA 2OJ3A 3F73A 3ISNC 2B6AA 3J7A1 3OTOJ 2XGPA 4OHXA 2FB0A 1TL7A 5GADU 2P6SA 2QTWA 5KFDA 4J9RA 5FD1A 2NPIA 1Q8LA 2FJWA 5D8HB 2VIHA 5K8PA 3NS6A 4RNMA 4EYHB 2OMLA 1FJGF 4DCJB 1N5VA 4JI4F 3JQKA 2RNEA 4RW6A 1AZSA 2HGLA 4UZBA 1HBMB 4NXNF 2ZM6F 1T0TV 1HW8A 4F3OA 2D7SA 4FYXB 4OV6A 4PYAA 5J1NA 2H9ZA 2VJVA 1L3VA 1C2PA 4DS4A 3MPUB 3HSDA 3P8BB 1FK9B 3M1VB 4EBDA 1YJVA 4AL7A 1OIAA 4CLWA 2XS2A 3R9LA 1WG1A 1SKWA 4UT4A 5D77A 1MWZA 4YDDB 1C0TA 5GAHU 4B3RF 1HWIA 3EGVA 4GC7A 1TFWA 4PPDA 4H4OA 4ANDA 1HL6A 1S79A 4NWBA 2ADBA 4IDKB 4LRAA 2XSJA 2O3DA 5HLFB 1U1PA 2KFYA 3OL8A 2YPZA 5EWFA 3QRPA 1EARA 3GFYA 4WYLA 1FXRA 1TL4A 1RT4B 3KMQA 4J9LA 2HFSA 2MDAA 1RAEB 2MKHA 4JI0F 4OLOA 1RT6A 2KVQE 3Q8VA 4F3QA 3MOJB 4FVMA 4X4TA 3UW1A 1SB6A 3F41A 3SBMA 3UQSA 1G1XA 1YX2A 3JSYA 1RWPB 3DFEA 3RAQA 2DPJA 1SI9A 1H0HB 5T14A 3DGPA 2DR8A 2C2KB 4I7FB 4ZJOA 2MKSA 5DJBA 2ZZNA 2PFFB 3NCRA 4JI8F 4ZVHA 4F2RA 5E3QA 1UA0A 5KT4A 2M88A 3DYAB 4OX7A 1CG2A 1S0NA 3D9BA 4C3LA 1J27A 3GB0A 1TL1B 1YJUA 3NP5A 3KLGA 3CCVS 4UUXA 2NXUA 3PW5A 4HH0A 3JQJA 5A8WA 3QLHA 4HDGA 2IC3A 4NLUA 1RCXB 1R31A 2VHGA 2GAGC 2F1FA 3TVZA 3ISZA 3W64A 5D3GB 2CG4A 1ROFA 3DOLA 4HT5A 3GTYX 3JSMB 3BSCA 4L72B 2WRMA 4WFNQ 1T9UA 2NLWA 2LXFA 2HK3A 1A9NB 2WOMB 3PJWA 3PYEA 4WP9A 3Q8YA 3WIUA 4ECUA 2DIVA 2MPUA 3R7BB 1OQ6A 1C4AA 2MKIA 4MK8A 3GWCA 4ES2A 3M2UB 5IC6B 4LT6A 2CA9A 4J9MA 4OYZA 1TVRB 5L38A 3M30A 3MAHA 1RT2A 3IAS9 4JV1A 1KDNA 4ED7A 1NK5A 1U6FA 3CNQP 3R7SB 3N6NA 3WQPA 2DXEA 1S1UB 1N8RT 1VQ5S 4OZJA 2HG4A 3J81Y 3T5HA 1FRKA 2GC8A 3BGRA 2PMHA 1UZDA 1PILA 3D1OA 2OELA 4WP3A 2DNMA 3KLHB 1YBUA 4GC6A 1S6PA 4B9NA 1JLQB 3MM6A 1VQYA 1JMTA 1DTTA 1NKEA 3ULHA 2N82B 3NOGA 2AQ4A 5B0DA 4U6PA 4PWUA 4ECRA 1D8YA 2BJEA 2IVMA 3ETMA 2YX1A 2HAFA 2YWEA 2XCPA 2NR0A 2HHTA 4YB1P 1TMMA 3KHRA 2EXUA 2Q66A 3LUYA 4Q45A 4Y6IA 5BR8J 2A10A 5MLCV 2X1AA 2AV5A 3ILJA 1KTVA 3LF0A 4M5HA 2MQLA 4A8KA 3VCDA 4V19X 4L73A 3Q2SC 3I9ZA 2HURA 1GH8A 1UZHA 3EGWB 3QNWB 1Q8BA 3LP0A 2QIFA 2P9EA 1NSPA 5KFOA 3CJ4A 3KFWX 3IG1A 3ZZPA 1KOHA 1JWWA 3WDOA 3FEXB 1F5BA 1TL5A 2W2PP 4PG7A 4C0BA 1X4BA 5C25B 3G71S 4C98A 1KSPA 3CB4A 1F6TA 5I42A 4MH8A 2CJXB 4I69A 1F3VA 3PIOQ 1YJRA 3UCGA 4K2XA 4N56A 1QAYA 1MMDA 3DRPA 2ROGA 1FDDA 1FRMA 1FFSB 4A48A 1DRZA 4IR9A 3KLEB 3EPIA 1S72S 2NS1B 4OHZA 3QGIA 3BKTA 2HVZA 1NK9A 4TU8A 2GQ2A 1APSA 1TKTB 2RF2B 2FGCA 3W61A 4QYZK 3O3LA 3NBPB 3QRRA 3H2UB 1KNZA 2M70A 3SZ2A 5HATA 3W63A 2Y8YA 1BQNA 5HAOA 1U0HA 5BXIA 4ZS6A 1LW0A 5K20B 2KM8C 1RISA 2R7VA 3H0PA 3IR7B 3N4WA 3EVOA 2MSSA 1JKHB 5D4LA 4ICLA 1Q4RA 4EBCA 1UWBA 3ILLA 2V69A 1Q7YT 3MTKA 3IGNA 1R6VA 4N77A 2GHPA 3QQCD 1UWAA 1RT1A 2DGQA 3MEEA 3M2RB 1NB2A 2VKZG 3RYLA 4LF2A 3MHYA 3G6XA 4W90B 1EZZB 1RWUA 4OZ0A 3ITHA 2ZBPA 1SUQA 2MGZB 1VIOA 1YWXA 1S59A 1EP4B 3FKBA 1ZA1B 4DV0F 1REVA 3IRXA 2CQGA 2MQ8A 2Z0GA 1GXLA 4G3IA 2BW2A 1IR1A 3Q86A 4H4MB 4USJC 2BKOA 3RBXA 4WBFA 4LF7J 1QUPA 2KRBA 3JS9A 2RHSB 1T9YA 2F8MA 1Q16B 1KOOA 5T7LB 1T02A 2XS5A 2MMYA 4ZHRB 4IG3B 4PQUA 2FHJA 3DLEA 5F8MA 1GEHA 1HPZA 1RK8A 3NCPA 1RCOB 1F3FA 1HBNA 2V2ZA 2Z2YB 3RW6A 1RAJA 2BANA 2V2KA 3T9NA 3RB3A 2CIMA 2JC0A 5KFYA 4ZVFA 5DQHA 4FXVA 5B0EA 2DIUA 1NH8A 3AFGA 3MURP 2FLOA 1FD2A 2Z30B 4OJ1A 1NBEB 4MIBA 2C22A 3FEYB 4OZ5A 1T9XA 4JI2F 3KUGA 2VBZA 1OWXA 1FX2A 2P6TA 4XO0A 2UVUA 4UOHA 1VJWA 4RU9A 8RUCA 3GIMA 3J80Y 3KUEA 2IRUA 4H4KA 2C2RA 3OR1B 3A4TA 1JJ4A 1HHSA 4HACA 3I0SB 3R3TA 4O0IA 1KRPA 4MYUA 5DG9A 1WSVA 3MM8A 2K3KA 4OX6A 1LQ9A 5ETKA 3QATA 1RKJA 2QYCA 4LF4F 2IM0A 1DTQA 3NAHA 2ZD1A 4CLPA 1L3KA 1JLFB 3EGZA 2E7WA 5DQIA 2BOPA 5HBMB 4JI3J 3DU6A 1KLNA 4P71A 1J5EJ 5FIIA 2IMOA 2DGXA 2H5JB 2GGPA 1XMQJ 2FJXA 1OPIA 2ATCB 2J9CA 4DU7A 2EK6A 1WNEA 4AD6A 1TL3A 4C11B 2R3VA 3CMQA 4DR3F 2B0GA 1C1CB 4GKKF 1PYTA 4KBIA 5CA5A 4Y2MA 1FE4A 2DNRA 4DU8A 1GMWA 2XLJA 1Y5IB 1YIJS 1D9DA 2FLLA 1WI6A 3CJQA 4W98A 3HI9A 2AZ3A 1LOUA 3P6YC 4PWDB 2CPXA 2B5JB 7AT1B 4QZVB 5KTQA 4I67A 3PACA 2VQEF 3AH6A 5KG6A 2DR5A 3CJTA 1VDHA 3N9UC 2E7XA 2WBRA 4QYRA 2OPPA 1ZAXA 1GFWB 2YWWA 1FVSA 3R5DA 2BJ1A 1VC5A 1WI8A 3BBCA 4MK7A 1SL0A 1EHWA 1Y4ZB 2VC1A 4WFZA 3LO3A 4NL5A 1KN6A 4AYBD 5GAGI 5E0OA 2CQPA 3CO0P 3DYAA 2ZH2A 4R8UA 2DGTA 3OHBA 3CJRA 2OUGA 2WHOA 3V6HA 2HGNA 2YKMA 1RT3B 2J8SA 3HHDA 3BQ1A 4ANCA 1IKWB 5DM6Q 2F4VF 3IAM9 3RG6A 5J2MA 4Q0BB 3IA0A 3LW5C 4LQ3A 3MF5A 1XN9A 2HBQB 5ADZA 5G0RB 2PD1A 4DCPB 1JLBA 1HNZJ 3QO9B 2KB2A 1OSCA 2W01A 4PQAA 4MAKA 3TANA 2XBPA 2PFDA 3M32B 1NNDA 3DI6B 3DXBA 1IBLF 1X8DA 2H4WB 3CCLS 2VG5A 2Y3YA 1WEYA 4LFCJ 4M5NA 1S97A 3LA0A 4NLVA 2IY5B 3QIPA 2PMWA 1CQNA 3CD7A 1CJUA 1UTAA 1K9MT 1H74A 4PG5A 5KFVA 1U48A 2BOAA 1Q1KA 3VAKA 1T9VA 5E41A 3D1HA 3PXGa 1XJWB 3IBFB 3CDEA 5DDOC 2YKOA 3TUJC 1SJ4P 1HR0J 4F67A 2CQ3A 2U1AA 3MM9A 4XK8C 3G82B 1UVLA 5AXKA 1BQMA 5KFKA 1FWPA 2OKQA 4YOEA 4U8YA 4MYTA 4I68A 4UQTA 3SCJE 3JXOA 2WAQD 3ILIA 4NRTA 3V2UC 4RBTA 3HZEA 2E9TA 5EGYA 5GMKa 1F60B 1WF0A 3D28A 3QT6A 3PW2A 5A8RA 1I6JA 1HNVA 2HNDB 2UUBF 2WB4A 2XEXA 3EZOA 1F0XA 2ZUAA 5A8KB 5CHCB 1YJ7A 5F3ZA 4MFBB 2XO6A 2Z2ZA 4OX9J 1N0UA 1X31C 2V8HA 3ZZTA 4CLKA 4Z7YA 4ELVA 4DSFA 3X1LB 3TX0A 1YVFA 2XMVA 3C8YA 3HP6A 1M1GA 1WOPA 3OVBA 3NLCA 5CYMA 5J2NA 2X1BA 3HK2A 4AT1B 1JK9B 1IBMF 2AJ2A 1AT1B 5ETPA 2EK1A 2F65A 3VALA 4ETXA 1IKVB 5IV3A 2UXCJ 2BM0A 4IH5A 1HQUB 2CNNB 5C25A 5HMZA 2B8QA 5I3QA 2AWZA 4CLSA 5C5JA 4G65A 1VRUA 3FQLA 2C3MA 2V2QA 2OPQB 1TV6A 3O6QA 1N36F 2NXEA 2HRYA 1D8ZA 4ID8A 4NMXA 5CYJA 3OJUA 4YS2A 4MKVA 1NHKL 4AQYJ 5C24B 3NGKA 3R1LA 4OZ2A 2YWHA 1HFEL 2FJDB 1Q82T 3TP2A 3WC0A 4LSNB 2D9OA 3UVJA 4X66F 2LEBA 4L75A 2AYMA 2MZRA 1T03A 1UVNA 3MPWA 2DKOB 4HR2A 1S9GA 2C42A 4ZA1A 3AB2B 1QSLA 2DNKA 4LFBJ 1SPBP 3OHAA 4QW9A 1QVGR 2OLWA 2BE2B 3D0IE 3I87A 4E98A 3PHTA 5HI7A 1DQ9A 4IO9Q 2NYHA 3G8TA 3K58A 3MD1A 3ZTSA 3UD4P 3CO9A 5ETTA 1PG5B 1SQGA 3VGVA 2XG8A 1HYSA 3CDUA 2H54B 2IRXA 1QSYA 1FXDA 4TKTA 4BS2A 2FZCB 1TAUA 2DB1A 2B9YA 4QIVA 4DG1A 2QC3A 4YB5A 1RA6A 2FVSA 1YJ9S 1AFIA 4ELTA 3JYTA 3HHLB 3AA9A 1JJCB 4YHHJ 2RS2A 3F56A 5DLFA 2PN6A 2C2NA 4NXMF 2AGOA 4CH0S 1GAOA 4Z37A 4W92B 2H48B 2ZC3A 4ZHRA 2M8HA 4NA2A 2F7VA 3GJTB 1KKHA 2CJKA 4WE1A 4C8KA 1TR0A 4O4RA 4IO1A 2VPZB 4ANEA 4BLGA 1SKUB 3FCVA 2ZFHA 2O1PA 1D0EA 5C42B 4PUOA 2MJNA 3PYGA 4KT0C 4TQSA 2RT3A 2WONA 5BYRA 4PABA 2O5DA 3PHEA 1J5OA 2HS3A 2POKA 1S1VB 2I0XA 4RNFA 4B9TA 1SVDA 4EUVA 1XMQF 4RU2A 2VOOA 2Y1JA 3NXZA 4ZVQB 1EETA 3M6XA 4DUTA 2AU0A 1KLMB 3HSJA 1Q8KA 3W3SA 3H2LA 2V8PA 4KGXB 4K4TA 3Q8UA 1JIHA 5IQQA 3FQKA 4OJ3A 1PC4A 1RTJA 3TUZC 2V67A 4R0EA 3AOAA 3C15A 1FRLA 3JQMA 1RHJB 3V6JA 3T5KA 2H65B 1NSAA 5HVHA 4FKXA 3MAQA 4LVOP 3UO0A 3H59A 4KKOB 4DL6A 4ED8A 3ENVA 1FERA 3MEKA 3MUMP 1S9FA 4TYBA 4P72A 5IXUA 3TAPA 3PW0A 4J5OA 2AMCB 1I94F 2WB1D 5HBMA 2QL5B 4FF3A 3D3CJ 1Q81T 3NGRA 2RKIA 1CJKA 3W5ZA 2VBXA 4PZVA 1WACA 3GSIA 1TKZA 4NLRA 4Y2AA 2GW8A 2GVDA 4KHPF 3OL7A 1SC6A 4ZPBA 4Q8FA 1M1KT 2CQBA 9ATCB 2XS7A 5IT9U 1F9HA 3DM2A 1T95A 5J2QA 1RHRB 4JI7F 1EJ7L 2VU5A 3JSRA 2DY1A 4CTAB 1RUSA 1T3NA 3T1HF 3I6PA 3HVWA 2DGWA 4OYMA 2J0QD 2V50A 1R0CB 3POTB 1N33J 4MTPA 5CCMA 3PX4A 2BACA 3GIKA 3L95X 4LFCF 4EO6A 4U7UD 1EQMA 3O2IA 1RHKB 3E01B 5FDLB 1A7GE 2H3EB 4NI2A 2QLBB 2AYBA 5HO4A 4C48A 4KFBA 2VG7A 2W9CB 1I3OB 4CLFA 2QZ8A 3TZYA 2NQPA 3VTIA 2DY9A 1IVZA 1T05B 2HHQA 4QR0A 4A8QA 5IC4B 1LKZA 4P74A 3ET6A 2KH9A 1X4DA 2OTJS 3W2WB 3E51A 4I2QB 2PC6A 5SUHA 4TNOA 4ED1A 2EFVA 1ZM3A 2E7VA 2F5GA 5D4OA 2GMHA 4DV2F 2M52A 2I1RA 3CTRA 2DGSA 4A8FA 4RW8B 4PG6A 1JXVA 1U09A 2L9NA 4CYUA 3R27A 1X4CA 2GHVC 1VQNS 1LWCA 2UU9F 2QSWA 3K8VA 1N0VC 1TKXB 1ELOA 4OYPA 3QGGA 3KLIA 1BGXT 2CJ9A 3DRYA 1NPRA 2LYVA 2NUUG 1VHIA 3PFOA 4ID5B 1FHTA 2QMWA 2C2MB 2H51B 4YB6A 2RRAA 2PEBA 4ZPDA 4DUZF 1FJ7A 2DJWA 4ZVGA 4TU7A 4Y0FA 3B8HA 4HI1A 1UFWA 5DDPC 2FHKA 3KMSA 2NYIA 3G96A 3G82A 1EB0A 3HXMA 5CCLA 1TUWA 4QCLA 2OPSA 3RAMA 2BKNA 5LSRA 5KFQA 2LDIA 3R7NB 4DV4J 3KLFA 1C0UA 2CPYA 4K59A 1WHVA 4PXDA 2P9CA 3B54A 2VKRA 2AF6A 4NPOA 2HQFA 1HWKA 2HWTA 3K7RA 3C6TA 2KVIA 3CULA 2M5YA 3OTEA 3CCJS 2YWFA 4ILRA 4C3KA 2ZBCA 4JV0A 2YNFB 2DVIA 4CLUA 1WJ9A 1N5YA 3HJVA 4GRSA 5AE1A 3W66A 2B7BB 4I64A 3CDBA 1AFJA 4H4KC 3T6JA 1YG0A 3I0RA 3HFZB 3ILOA 1RBAA 3MM5A 2K7KA 4B17A 2GHWA 3D6TB 5J1EB 4OYWA 3I55S 3BH6B 3CJKB 3T1YF 2RQMA 1OSDA 4U95A 2KHCA 1R89A 4DR1F 3M8ZA 3IXQA 2ZE2B 4DV5F 4X62J 2Z4PA 5IWAF 5ETNA 1WC1A 2LDYA 3FDSA 4RW7B 2M8DB 3OFHA 2HFOA 4Y2KA 5DLGA 1FA0A 2A2CA 4C8LA 4DV3F 2HLUA 4DR5F 4OYAA 2J6UA 1QM9A 3L7UA 1X4EA 3CCWA 4IKAA 3I56S 4R25A 3W62A 4J9OA 4CH1A 1U1KA 4B3OA 3BV8A 4J9SA 2HZCA 5DM7Q 2YX4A 1ZYQA 3A8IA 2DTJA 3ENWA 3PJXA 3T9ZA 2CQDA 1HBUB 1S6UA 4LR9A 4DS5A 3BN4A 3T6BA 4ELUA 2CZVC 5DGAA 1ZZFA 4FP9A 1JX4A 1KFDA 2H5IB 2HVEA 3HVTB 3CMAS 5L8RC 1S4FA 4MMOA 4KSEB 1F9FA 4L74A 4UTGA 1FJEB 4AUKA 4DLEA 3KNGA 3KWMA 3L9ZA 5DG8A 4DSJA 2HRTA 1IWGA 4DQQA 4RBUA 4KJIA 3QWPA 4LFAJ 4UF4A 1CJVA 3A8EA 2JOQA 2XNQA 4KE5A 4LSLA 4ECXA 2LU2A 3THVA 2QA4G 5D0GA 4ZLJA 5B0GA 2WTFA 4Q2MA 3OUYB 3D0GE 1TP7A 3FRZA 3ZZUA 2I2YA 4ZP7A 4GMKA 1QAIA 1WF1A 4KYZA 3M8QB 4MK9A 2COLA 4O23A 3TARA 4UW2A 2VPXB 3A1YG 3I4HX 5KG0A 4CO1A 2QV6A 4LMZA 2BM1A 1U45A 5HROB 2R2UA 4WZQA 3DCAA 1XR6A 3DOKA 3G4SS 2CRLA 1LW2B 2ZOMA 3HCXA 1FD8A 2BJ7A 2KG0A 2VA3A 2A18A 1RHQB 1U26A 1FDNA 1FKOB 1G7CB 2OP5A 4ZN3A 2PMZD 2D3ZA 4F4KA 3MUTP 2HQGA 5AXMA 2MTLA 4LRBA 1UVMA 3FUYA 4Y34A 1RU1A 1E6YB 2C3YA 4OI3A 3EVMA 3TAMB 1MNEA 3AQPA 2V6AA 5KFJA 5AE3A 4PYDA 2FD2A 3IP0A 3D68A 2C28A 3VV2B 2DXFA 2FHMA 5GMEA 2M4MA 1C1BA 1WORA 2IRYA 1ZS6A 5C42A 2F40A 1SBRA 3DLBA 5F8NA 1NKCA 2M0GB 3GYXB 3LP1A 5E3RA 4LF8F 1VQOS 2LLZA 3HO1A 2BRLA 1ZBTA 2MHEA 1WC6A 1HI1A 2Y9HA 3CC7S 2A6OA 4P7TA 3GSDA 3D7SB 2B8PA 3MEDB 3I4PA 1S99A 3KLVA 1FCAA 2R7WA 3MCNA 3C14B 1PC5A 4F25A 3M8RA 3P5BP 3AD9C 4DFPA 5LSLA 3OFEA 3SXLA 5JVGQ 3OXGA 2ZH7A 1A0OB 1RAIB 1N56A 1IKYB 1XTZA 3HMJG 2YNGB 1N5QA 3WIVA 4RZRA 2NXNA 3N79A 4IOAQ 2NSCA 2CPZA 3GFHA 5ETMA 2JLEA 3SFGA 4WU2A 5A2QY 1GQEA 4G1QB 5F9NA 3VWSA 4A8MP 3S7RA 2R7RA 3HKWA 4OHWA 1LK7A 2HKEA 1YBTA 1S9EA 2LU1A 2JEJA 1VMBA 3MM7B 2FHJD 1B64A 1YZ6A 4K4VA 3V4MA 1YQHA 5THWA 1SKRA 1CULB 1QJHA 3EMTA 4HL9A 3DDIA 3CDWA 3MPVA 4FPIA 4DF8A 2W4PA 4Q8EA 2MQOA 1HD0A 2VPWB 1T7PA 1K1SA 3U27A 3LP2B 5DG7A 4USIA 4EZ9A 2CQ0A 3OFFA 4KQZA 2RU3A 5H9EJ 4O4GA 4A8XA 3K5PA 3M8WA 4LRFA 3NOCA 3FGVA 2HHPA 3MUVP 4URQU 2Z8QA 3NAIA 3H4BA 2K1RB 4DR4F 5D15A 3PV8A 2F3JA 4ZLLA 4OJHA 2VICA 2E1AA 3T3FA 3Q83A 1NEEA 3KUHA 1U8SA 2HNZA 3DDKA 3PJ9A 4XAKA 1S77D 1XWLA 3CIZA 1FJGJ 2BEFA 4JI4J 2X7IA 1CC8A 4JBCA 1DLOB 5CYQB 2E5LF 4NXNJ 3OL9A 2ZM6J 2MQQA 1NH7A 1X5OA 2BMBA 2P2CB 4OMFG 2OPRB 3LAKA 2AHOB 4OYBA 4J90A 2OFHX 2DGVA 4DPXA 4ZVTB 2FC8A 4ZDNA 3DOMB 1N48A 2HYIB 4ZVOB 1PCAA 3KK1B 1H2UX 3MR7A 1UKUA 2IHR1 4Y2CA 2P5VA 3BBFA 4I2QA 4RJVA 2W8KA 4Q43A 3V81B 1W7WA 3PIPQ 2RS8A 5L9NA 4WFXA 1RT5B 1SQEA 1H73A 3C16A 2N7CA 1T11A 2XTJP 4RW8A 3DLGB 1FTCA 4HH1A 4OJGA 4DI6A 2HZAA 2MYFA 4LF5J 2R42A 3WHIA 2CQ4A 2RIJA 1UVIA 8ATCB 5T41A 2FY1A 1XIQA 1RGVA 2GVZB 1RTHA 2L41A 1S48A 2XHWA 2XSFA 4CO3A 1NMEB 1U1OA 4JI0J 4I0WA 2HNYB 1WG5A 2R7TA 2IAJA 1PBAA 3I32A 1RT7B 2Z2MA 4EWTA 3DRRA 2XMKA 3OV7A 3HFKA 4FF4A 3V4IB 4N7TA 4P7VA 1BQXA 2NUHA 4ZLPA 4K4UA 4F0MA 4WZMA 4QR2A 2G2OA 3HHLD 4DFMA 3MR5A 3RRHA 3AXKA 3KOAA 3BDEA 2JFDA 4K4ZA 5ITHA 1N6QA 4KO0B 2GO9A 2DH9A 3MCSA 4LIRA 1GK8A 2XWYA 2IFXA 1XBWA 1RBOB 5ETOA 4DL3A 3CJ0A 3R5CA 3H7HB 4CCHA 2CNOB 2M7SA 3Q0AA 3CVKA 1CBKA 2F8HA 1B70B 5KFBA 2VBYA 3R5AA 2EC0A 4HKQA 1IKXB 4M63A 2ERRA 3FJ2A 2C2ZB 5F8HA 4LR8A 1SIZA 2ACYA 1D3WA 1Q79A 2RMLA 3MXHP 2C3OA 3GILA 2CWXA 4C8NA 4JYAF 3QRQA 4FN5A 1WDDA 3CEDA 4NOHA 2C1EB 2CDRB 4GO7X 1MMLA 3T41A 4ZPAA 2QMUB 3MD3A 4JI6F 2L08A 3BYRA 5EN1A 1Q0NA 3KDOA 2VFTA 1B99A 3UD5A 2KXNB 3H2VE 3DXSX 1Y10A 3L09A 5I3PA 1W26A 1MWQA 3E3XA 1JLEB 4YDXA 1OMSA 1ULRA 1HNIB 3MZIA 2GX8A 5IM0B 3KYLA 2DO0A 1CC7A 1S7HA 2QGFB 3DLKA 3P96A 2ZJRQ 3LWMA 4CNYA 4KV8A 5A76A 1OO0B 2IM3A 2PDAA 5L1JA 3GFXA 2R8IA 5E3AA 1WWHA 1RWWB 5DETA 1I1GA 1EX8A 1NPPA 5G4DA 3B4MA 4CIOA 3BF4A 2DITA 4ILLA 1QSSA 4O3SA 4BWJA 3DC2A 3FBBA 1NK0A 4NLYA 3W5XA 2UZAA 4R5PB 2YNHB 5DO2A 3JSBA 1RYRA 4QPTA 3KJVA 2QE5A 3DMJA 3PRVA 1FKPA 3L3CA 2UUTA 3W8GA 2GIRA 2Y0BB 5H9EK 1PIEA 2FJEB 1S10A 1ZAVA 5E33A 2XMWA 3RU0A 2HMIB 1CLFA 4DPYA 3CJ8A 3MMAB 1SXLA 2RSQA 3V6DA 4ED4A 5L1LA 2RHQB 2HHXA 3UNGC 3EXYA 1Y7PA 4B9SA 3PRDA 4RNHA 4ED0A 1KHWA 2YWKA 5M2PA 2CQ2A 3N0VA 2N4CA 1SQFA 3MECA 3HD2A 2DNQA 4B9LA 5K5MA 2XZDB 4CLYA 1S12A 2BA9A 2E1CA 2HVHA 3CJ2A 4D3GA 3RW7A 2CZ4A 5ETSA 2W7PA 2J0XA 3CCUS 2RQ4A 1RABB 2YNIA 4ZJQA 1WKLA 4QBUA 2M9KA 2EFOA 3QSYB 1P6TA 1SV5B 4G6VB 1ZTWA 1NXIA 2GIFA 4DX5A 4X65F 3IWXA 2X1FA 2DRAA 2YKNA 1BC6A 1R6YA 2I5JB 4DL0C 1SJQA 2FIUA 2KM8B 2N4DA 1JLAB 3RB0A 3TZWA 2FJBB 2JLGA 3A12A 2ZZMA 1ZM4A 1M5PC 4WXWA 5LMNJ 5LMUF 5F8JA 1VJQA 4MKBA 2DNZA 3NGSA 3H5UA 2GNKA 3NGDA 2DRBA 1AA1B 2HBZB 3ZTRA 1S7IA 1HBOB 1SC3B 3BDPA 4DUYJ 2IJNA 3S1TA 1X9MA 5B09A 3QT7A 2O67A 3R97A 3J81U 2ZVIA 4J37A 1RWMB 4A8WA 4USKA 3AJ2A 1YK9A 3OR2A 2FTRA 2RUGA 3FCWA 3J7AN 3TNVA 4OZ1A 3DLJA 3K17A 4D3HA 1FWKA 1RTIA 3FFIB 3TUIC 2Y8WA 4O44B 2LEPA 2FY8A 2LQ9A 4DX8H 1X5PA 3PCOB 2R4FA 4LBHA 1CJTA 1FDBA 4PCQA 1H2VZ 2XI2A 4DV0J 3VAMA 3BEGB 2KI2A 3M8PB 4XTTA 4NRUA 5KFGA 5L9XA 5HVGA 1NDKA 1PAEX 5IT0A 3PW7A 5B0FA 5IZHA 3M6VA 3R2DJ 3TA1A 3SDEB 1MN7A 4DFJA 1FI4A 2I6WA 3ZFVA 3KK2B 3F0NA 3D3BJ 3UDVA 3EYZA 4YP3A 4I2PB 3KKFA 2YQ1A 2V34A 2DEJA 3HX9A 3G6ES 1RE1B 2V4JA 3C2PA 3O8WA 3IWNC 5LJ3Y 1X4FA 3AB4B 2X51A 3BR8A 2RB7A 3FK4A 4HEA9 3VGUA 3B6BA 2DNNA 4EFAC 2BR0A 2VPYB 4M8LA 3HDSA 2HK2A 4QYZJ 3M2VA 4M5JA 5CZVA 5CD4A 2OMOA 4JV5F 1WUUA 2XMUA 5CQGA 4YR2A 1Z1ZA 5KG3A 2B9EA 3OLAA 4LSZB 4Q5VA 4KPCA 4JI2J 3QMQA 4LF5F 1LWFB 2G0IA 2R8JA 3TI0A 1MU2A 4HVZA 2XQCA 3MMBA 2IBOA 5D0EA 4NMLA 4YY3F 2KYZA 4A47A 3DLLQ 2AIRB 2LECA 2QA4S 1R8HA 4J7CA 3SQGB 9RUBA 2OPRA 4ZCLA 3I5CA 3AD8C 4X4SA 3ZXWA 5HMWA 2RQKA 3O1LA 4LF4J 2PO4A 4DX7A 5BYSA 4USWA 1K44A 1ICEB 1NO8A 1JXLA 1Y9OA 2IDLA 2V68A 3HLUA 4MIWA 2XYPB 4J9PA 1VBXA 1NSQA 1Y3JA 3KHGA 7FD1A 4M5DA 1PJ6A 1G2EA 5L1IA 2EC2A 3VQTA 3ZNJ1 2JNJA 4X4UA 4B08A 3PO4A 4J9QA 3IC1A 3MEGB 3GV5B 1JLCB 5LT5A 2FYXA 5IQ6A 4RW4A 2QA1A 1Q7LB 4PXCA 3PX0A 2KZMA 1XMOF 2DNYA 2MZSA 3P45B 4DR3J 4GKKJ 4K50A 4YB7A 3B78A 4KGZB 1KHVA 1P1LA 5D78A 2QLWA 2B7CB 1TZ0A 2J8AA 4DL7A 1LWEA 2B3TB 1L3UA 5HSPA 5DGBA 4RWXA 4RW9B 4FBUA 1X60A 2O66A 2VG6A 1VRTA 4UUWA 2IMWP 2YVSA 2MEWA 1E6VA 3ZTOA 2BRKA 1B7FA 5KFEA 1V9OA 3KXDA 4J9UE 5DS7A 1RT7A 2VQEJ 1S1TB 3OTDA 2CPEA 2AX0A 4B9UA 1QDUB 4A46A 2DEIA 1RBLA 4ZMMA 5K8NA 1X4HA 1GXUA 4ZKAA 1TUVA 2R7UA 4BCAA 2JJ4D 4LF1A 2XCAA 2IA0A 2JLFA 4DSIA 3ENQA 5J2PB 2V2VA 2NXJA 4BBYA 3TEHB 2AX1A 1UETA 3BPSP 3SCIE 3K5OA 3UNYA 2IIHA 2F4VJ 3KHLA 5K14A 2NREA 1UEKA 1HMVA 4WP8A 2CADA 4YMEA 3VVUA 4NCGB 5KFFA 5GAGU 3DRSB 2GFFA 4GVBA 3E2EA 1VBZA 3SEOA 1NDLA 3EVWA 1NSKL 2NCKL 3M4XA 4KHMA 1J2VA 3LWLA 1IR0A 3HT3A 1HHTP 3I5BA 1IKXA 1IBLJ 3PDNA 5HANA 4DXLA 4URSA 2WZ1A 1UPPA 3IBCB 3GP9A 4CLZA 4LR7A 3K57A 5I3UA 2IBKA 2VFSA 3L7PA 3OTCA 4GVLA 3BSAA 4QR1A 1SL2A 3J80U 1XK8A 2EVZA 4IR1A 1NDCA 4PAAA 3R6GB 3EXCX 2XYHB 3I82A 4PXBA 3RB4A 4IFVA 2EPIA 3PX6A 3AHPA 3QZ7A 2AJQA 5KFPA 4OZNA 1BWVA 3H5YA
chains in the Genus database with same CATH topology
4GVBA 4GVBB 1KP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GVB A;  4GVB B;  1KP6 A; 
#chains in the Genus database with same CATH topology
 2B6A B;  4V19 J;  2KN4 A;  3KG0 A;  2E1R A;  4C2M A;  4C6A A;  1TL7 B;  1RTD A;  4IOB A;  1LXJ A;  2LCW A;  4ZVP B;  3VF0 B;  2QEX S;  3W9H A;  4I6Y A;  1YJW S;  2HPU A;  2XHC A;  2D1C A;  3MAA A;  3J7Y I;  3OT9 A;  2E1P A;  2VDH A;  4ATN A;  3KK3 A;  3QGH A;  2B51 A;  3MMJ A;  4RW6 B;  4OFZ A;  4OZL A;  3DRX A;  1AZS B;  2Z57 B;  2UUB J;  1F9E B;  1S6Q A;  2EKN A;  2OEM A;  4IH7 A;  1FKA F;  3R2C J;  3BGO P;  5L39 A;  2ASJ A;  4KB7 A;  2HIY A;  4O3P A;  2AGP A;  4DSE A;  3SSS A;  5E3C A;  2FZG B;  2ZHO A;  4PG4 A;  3CE8 A;  4KR0 B;  1NJX A;  1WEZ A;  4FS2 A;  2VC0 A;  2QL7 B;  2XMJ A;  2OEK A;  4QIG A;  2DXD A;  2VQF F;  4FBT A;  4FS1 A;  4TY8 A;  3EJM A;  1DFD A;  1IBM J;  4ZOS A;  4WXO A;  5LMN F;  3RR8 A;  4H4O B;  2QT7 A;  1NZ8 A;  3IS9 A;  1RU2 A;  3LAL A;  3QID A;  2UUC F;  2XSJ B;  3A8J A;  3R5J B;  2KYX A;  4DUY F;  2QYG A;  2ZWP A;  3QBC A;  2E5J A;  1LK5 A;  2IJR A;  3T19 A;  3G2X A;  5KFL A;  2VFU A;  1NJZ A;  4G1I A;  1RT6 B;  1O0P A;  1TK0 A;  1KFS A;  1N36 J;  2XLK A;  3W2V A;  2WK4 A;  1Q95 G;  1SV5 A;  2CG8 A;  1SKS A;  4O3N A;  4ERD A;  4DR7 F;  3K8W A;  2YKQ A;  1A6L A;  3DGP B;  3OSP A;  3HSZ A;  2DHS A;  5AJ3 F;  2WVD A;  2HIQ A;  1YRU A;  4M1K A;  2KXF A;  2AYE A;  1NKB A;  4Y3C A;  1QY7 A;  4EO8 A;  5JMN A;  5H1S V;  4JI1 F;  1FRH A;  2XB2 D;  1BY9 A;  1RWV B;  4TN2 A;  4GO5 X;  4Q2L A;  3KLG B;  3BQ0 A;  4X66 J;  3IM9 A;  3AT1 B;  4RUH A;  2W2O P;  1SC1 B;  3UN5 A;  4ITS A;  1RLC L;  3M8Y A;  2J6S A;  3PZP A;  5A8W B;  2SXL A;  2IC3 B;  3NWR A;  1B7Y B;  4CQ1 A;  2YPY A;  3OW2 R;  3NNA A;  2ZC4 A;  1UFL A;  4S0M A;  5HQM A;  5KG2 A;  1RAC B;  3DOL B;  1R8B A;  4EEY A;  5KFU A;  3K2Y A;  4H54 A;  3BH7 B;  3S01 A;  3D2W A;  1VS3 A;  2HVD A;  1U6Z A;  3EE3 A;  2ZKU A;  1HQE A;  1WEL A;  1PAU B;  3SCK E;  5HJX A;  3NGT A;  3G9C A;  2BV3 A;  1M5H A;  3M30 B;  4OI1 A;  3PRB A;  1RT2 B;  3TWZ A;  3CPW R;  4C4W A;  2ZZT A;  4C8Y A;  2HBY B;  1X9S A;  4C9D A;  2BQR A;  3NKY A;  4HI2 A;  4NE9 C;  3RUB L;  2XY7 A;  4KPY A;  4XPC A;  3BGR B;  4NXM J;  1HBM A;  3OBI A;  1FJC A;  2H5E A;  3Q22 A;  1S6P B;  4DMZ A;  3MM6 B;  1EAY C;  1KVI A;  2PII A;  3Q24 A;  5DRK A;  1DTT B;  4L3N A;  2CPF A;  3G6V A;  2FDN A;  2XMM A;  1ZPW X;  3MMC B;  1FK9 A;  3M1V A;  3K59 A;  4IUF A;  1KS2 A;  5EX3 A;  3MTJ A;  1DJ0 A;  3PEJ A;  4NA3 A;  2GA7 A;  2ZNZ A;  4NLO A;  4IQM A;  2DNL A;  3LAM A;  1VBY A;  4F4Y A;  3H90 A;  3UDL A;  3NNH A;  1X4G A;  3LOU A;  5M2R A;  4RL1 A;  4F7V A;  2AJ0 A;  3GPA A;  3LH2 S;  1RAH B;  2UXB F;  1IJF B;  3FSY A;  4C0O C;  4IDK A;  4AFF A;  2BE9 B;  5HLF A;  1VC0 A;  2DGO A;  1M5V C;  3FMB A;  3CD0 A;  3MGJ A;  2MLY A;  3LP0 B;  4J9K A;  3DHX A;  5A0Y B;  1NB7 A;  3GQC A;  1RT4 A;  3M9N B;  2E29 A;  4QQB A;  3SQG A;  2HSE B;  1RHU B;  5JUM A;  3SIP B;  2DNH A;  2AD9 A;  4DV6 F;  3IG1 B;  1QLN A;  3ICL A;  2VAS A;  3U1M A;  5I42 B;  2A0F B;  2RE1 A;  2ILY A;  2MLZ A;  4DV7 J;  4C7Q A;  1FES A;  4ECS A;  2ASY A;  4I7F A;  3KJN B;  3NG8 A;  3DRP B;  3H5X A;  1G4C A;  1I94 J;  2D9P A;  3AQO A;  4LQ9 A;  3W1Y C;  4YN3 B;  5HN0 A;  3VQS A;  1K0V A;  2ZOG A;  1N32 F;  3GON A;  3IO1 A;  3N6M A;  3TUP A;  3NY0 A;  3ADA C;  1FX4 A;  4GKJ F;  5IS2 A;  4KHP J;  4X4P A;  3BSN A;  2A3J A;  2B4U A;  3TO8 A;  2CYY A;  1VLO A;  1X4A A;  1REG X;  1TL1 A;  4DL4 A;  4M5I A;  2ZJP Q;  2WVE A;  3UDC A;  1Y11 A;  1F5A A;  1W25 A;  1SCJ B;  1L3T A;  1BQN B;  1S1W B;  3OFG A;  1U0H B;  3C46 A;  4JI7 J;  5D3G A;  4PPZ A;  1LW0 B;  1PJ5 A;  1YBA A;  3T1H J;  1Z2Z A;  3H25 A;  3D6M B;  3JSM A;  5ETV A;  2HFZ A;  4B3S J;  4BC7 A;  1HNW F;  4O3O A;  3D6F B;  3RRK A;  4ICL B;  4Z2X A;  2WOM A;  2HEK A;  5KG4 A;  1XNQ F;  3OTB A;  3GYN A;  1UWB B;  2KXH A;  1O5J A;  5F8I A;  2Q43 A;  1CS4 B;  4CT9 A;  3M2U A;  2HHU A;  1RSC A;  2WW4 A;  2BUN A;  5LM7 E;  1TVR A;  4LF9 F;  1U1N A;  3PYF A;  5JVH Q;  2KG1 A;  1RT1 B;  4RR5 A;  2FLN A;  3MEE B;  5KFA A;  3GG1 A;  1UJ5 A;  1VI7 A;  1S1U A;  3CUN A;  2PA3 A;  4HHU A;  4A8O A;  2DNO A;  3ITH B;  4J91 A;  2LVW A;  1SUQ B;  3JB9 k;  1X9W A;  2HLT A;  3DNC A;  3SMZ A;  3KLH A;  1REV B;  3IRX B;  3DRS A;  1JLQ A;  3RZA A;  2JDJ A;  4U7U K;  2JVR A;  5KT3 A;  2EFP A;  4DV2 J;  4DPW A;  2J9D A;  1TK5 A;  2B9X A;  3GR1 A;  3U7J A;  2DNP A;  1U02 A;  2G1H A;  5F9L A;  2UU9 J;  3LGH A;  4QU7 A;  3CC2 S;  4PXE A;  1OY9 A;  4DHV A;  3CW2 C;  4P2X A;  1U1M A;  3TAQ A;  5KFM A;  4DQR A;  1KTQ A;  3UN3 A;  4KGM A;  5F3T A;  2B43 A;  4PQU B;  3C66 A;  3DLE B;  4BWM A;  1HPZ B;  3MI7 X;  4RLE A;  2ZHB A;  2EFN A;  2OSR A;  1HBN B;  4CH7 A;  3HSG A;  4DUZ J;  1T8E A;  2NZC A;  2BJ8 A;  3THP A;  2BAN B;  2CPD A;  2V8V A;  2DHA A;  5KG5 A;  2F63 A;  2PI5 A;  5FJ4 A;  3J81 j;  1ITP A;  5KG1 A;  1WD6 A;  4UQG A;  1RWN B;  2ZH1 A;  1RKI A;  2L48 A;  2R7Q A;  1QVF R;  2AZ1 A;  2Q3P A;  2XZW A;  3I5A A;  4XDC A;  6AT1 B;  4DR2 F;  3DDN A;  1RAF B;  2LQ5 A;  4EGL A;  5IFM A;  2ACM A;  2MY8 A;  4DL5 A;  2P8I A;  1M5S A;  1MSW D;  1SJ3 P;  4HAC B;  1DUR A;  3BSO A;  1FEE A;  3MM8 B;  4DLG A;  3KLE A;  4FYV B;  4DF4 A;  4WFY A;  4Y65 A;  1N52 B;  2JC1 A;  2QLJ B;  4HT7 A;  1EKS A;  1C4C A;  1DTQ B;  2ASL A;  3WX4 A;  4CRJ A;  3T1Y J;  2ZD1 B;  3BJY A;  1MRO B;  2J76 E;  1VQ8 S;  1O8B A;  1TKT A;  2MZT A;  2RF2 A;  4ZPC A;  1UCN A;  4DR1 J;  3NBP A;  3OL6 A;  1RAA B;  4DV5 J;  2HHH F;  1JQG A;  2PI4 A;  4U9R A;  3VAG A;  5IWA J;  2RJZ A;  4OIX A;  2ATL A;  3TRG A;  4DSK A;  2VBW A;  2CPH A;  2XUL A;  2HAI A;  2GGP B;  4QIE A;  3PY8 A;  2ZDO A;  3UCZ P;  2CJB A;  4P10 A;  1FRX A;  1TL3 B;  4P73 A;  2MKJ A;  3CME S;  4KTQ A;  4OI0 A;  4DV3 J;  1S76 D;  4DR5 J;  4RUC A;  3K5L A;  1JKH A;  2KTQ A;  4BDP A;  4M94 A;  1LFW A;  1HWJ A;  1SH0 A;  4X64 J;  2YQ0 A;  1Q86 T;  4DX6 A;  1NK7 A;  5JJB A;  1T9T A;  1IM4 A;  2K3I A;  1DBD A;  4KAI A;  4M5L A;  4RNN A;  2ZOF A;  1Z4U A;  3M2R A;  2K7J A;  2QG9 B;  4DCO B;  3BO3 A;  5KFH A;  4AE5 A;  2YKP A;  4Y28 C;  4B9M A;  3OXL A;  2XMT A;  2OPP B;  2RDD A;  3SFU A;  4P2F A;  3GJQ B;  3Q8R B;  3JAM Y;  5LOQ A;  4ENO A;  4E2F B;  3W9I A;  2MGZ A;  4NYZ A;  1PO6 A;  3TZX A;  3THT A;  1EP4 A;  4FZV A;  2R2T A;  3ENA A;  2OD6 A;  4F36 A;  2G0J A;  2JWN A;  4FYY B;  4R8U B;  2VV5 A;  3M9O B;  2Q1L A;  4H4M A;  4X2B A;  1JNR B;  1X5S A;  1VK3 A;  2E9R X;  2YKM B;  3RJM B;  2J7U A;  1RJJ A;  3CCE S;  2W7O A;  3P49 B;  1CPZ A;  4OHV A;  5J2M B;  3N5F A;  2J7W A;  2AJF E;  2WCX A;  4QIW D;  5KAK A;  2QFI A;  5T7L A;  5AT1 B;  1JLB B;  3MPD A;  4L3K A;  2CQC A;  4ECZ A;  4IG3 A;  2BW7 A;  3OSN A;  4WWS A;  4KGK A;  2D41 A;  1X5T A;  4X4N A;  1TQL A;  3GLJ A;  2UUA F;  2LA4 A;  2I38 A;  3DKD A;  5FLX Y;  4F26 A;  4JV2 A;  2VG5 B;  1Y00 A;  3W5Y A;  3LPY A;  1WHX A;  1FTR A;  2GQC A;  3RBZ A;  4C8M A;  4BHQ A;  2FQQ B;  3QIP B;  1BE4 A;  1CJU B;  1VQ7 S;  3DN9 A;  2MJU A;  4KIA A;  2JFK A;  2GQQ A;  4ZN1 A;  2J6T A;  4F0K A;  1WSR A;  2ZH6 A;  3MM9 B;  4I4B A;  4WKY A;  1VIX A;  4ZVS B;  3N5B A;  2IA6 A;  1BQM B;  3D1Q A;  3A3O B;  3OR1 A;  2QLX A;  3I0S A;  1ACM B;  1R0B G;  3TQ1 A;  1RB0 A;  1ZAW A;  4CDI A;  3K89 A;  2VJU A;  1HNX F;  3GR0 A;  3BKU A;  3ZZR A;  5E2Q A;  2V9W A;  1M90 T;  2R7X A;  4RBV A;  4N8N A;  1V5I B;  2J0S D;  5A8R B;  2MLX A;  3MMC A;  3VR1 A;  1HNV B;  4DV7 F;  2AEJ A;  1PKU A;  1U6B A;  3TJ8 A;  4KHR A;  1JLF A;  4ZPW R;  2HBR B;  2LMI A;  5GAE I;  4LF8 J;  4PKD B;  1XNR F;  4OV1 A;  2NSB A;  4V1A k;  2X1G A;  2W9B B;  4PR6 A;  2R8H A;  5B0A A;  4B3T J;  1R27 B;  3P3D A;  4JUZ A;  2V0N A;  2JRS A;  4PWW A;  4C11 A;  2BX6 A;  4ETZ A;  3M9M B;  1C1C A;  1NHV A;  4JP8 A;  1KVJ A;  5ETQ A;  1FO1 A;  3QJP A;  2QA2 A;  2ZH8 A;  5CYM B;  1N88 A;  5J2N B;  3AOB A;  2ZBR A;  2CQ1 A;  2FJV A;  5A0Y A;  4NLG A;  4QWE A;  4PWD A;  1VBK A;  2B5J A;  5D4N A;  5HMX A;  4FVC A;  2D3O R;  4B3S F;  5D0R A;  2GCF A;  4KC5 A;  3IMQ J;  3ZTP A;  4IH6 A;  2MB0 B;  3BZQ A;  4LF6 F;  5U47 A;  5KT5 A;  5HMY A;  2VF3 A;  4MIA A;  5CXT A;  2BYC A;  4TLR A;  4DL2 A;  3PTW A;  2ZBI A;  2DHX A;  1VRU B;  1RYS A;  3A3P B;  2W24 A;  4ZIT A;  4CNZ A;  4WIQ A;  1NK6 A;  2K2P A;  3LGN A;  4CT8 A;  2OAU A;  1TV6 B;  4YFU A;  1YTY A;  4DR6 J;  2GS8 A;  1NHU A;  3S6E A;  1L5U A;  3FC9 A;  2XM3 A;  2QL9 B;  1RT3 A;  1UEU A;  3VAH A;  1S0M A;  1IKW A;  2YH0 A;  1KVK A;  4Q0B A;  4XIU A;  4LRE A;  4PG8 A;  1S1W A;  2PGC A;  3HZG A;  5G0R A;  2LKZ A;  1H7X A;  1KP6 A;  3QO9 A;  2WVB A;  2Q6C A;  3M32 A;  2OFG X;  1R8A A;  1R8P A;  5D4P A;  4DR4 J;  3H8Y A;  3DI6 A;  4Z7C A;  3RB6 A;  3UVJ B;  1T03 B;  2MHN A;  4KH1 B;  3AAW B;  1S9G B;  2W2M P;  1U8W A;  5LL6 d;  2PT0 A;  1MWY A;  2IPO B;  2V8G A;  5KFC A;  2E5L J;  1NK4 A;  4QPX A;  1CS4 A;  2EEY A;  3QPI A;  1P9Q C;  1B3T A;  1N34 F;  4C0H A;  5GAD I;  4IRC A;  1Q53 A;  2CVI A;  4KRW A;  2IVY A;  1FFW B;  1NU4 A;  1MW7 A;  3U1N A;  1U47 A;  2AEF A;  4K4X A;  3CT9 A;  2YH1 A;  1HYS B;  2XNR A;  5HJY A;  4USM A;  3OTO F;  1Y5L B;  4BC9 A;  3J7Z 5;  1LV5 A;  3D66 A;  4OI4 A;  2L9D A;  3IWL A;  1SH3 A;  1RI7 A;  4CLT A;  4DG1 B;  2RQC A;  4MJK A;  1B4S A;  3BN7 A;  3JYT B;  3D5M A;  1ZA2 B;  4RO0 A;  4F02 A;  1FNM A;  1N4L A;  2HS0 A;  5GVQ A;  3UN2 A;  2HND A;  4ZCI A;  3QAU A;  5K9F A;  4ECT A;  4I6W A;  2C2E A;  5A8K A;  2XLI A;  2RIL A;  2B4O A;  2ZJQ Q;  1IWA A;  3UR3 C;  1VR6 A;  4QIF A;  4X84 A;  3EIC A;  2KZZ A;  2MKC A;  4HLB A;  5GAH I;  4MFB A;  4K0K J;  4TU9 A;  2EI5 A;  4WE1 B;  5C2G A;  3FSX A;  5B0C A;  4FYW B;  1Q5V A;  4PUO B;  5H9F J;  1Y3K A;  2QSF A;  4EK2 A;  3H98 A;  2WON B;  1UJ4 A;  3E8O A;  2VL1 A;  1J5O B;  5A2Q U;  1KQF B;  3CDA A;  2MQM A;  4ECQ A;  4EZ6 A;  2MKY A;  3M6W A;  2KJV A;  1EET B;  2B4V A;  2GJF A;  1VLY A;  1IKV A;  1HQU A;  2QLF B;  4ED2 A;  2JH3 A;  4E8U A;  5KFZ A;  1YGY A;  4X64 F;  2G2Y A;  4F4X A;  1NJI T;  2RUS A;  1RTJ B;  5KT7 A;  3C15 B;  3PKY A;  4K4S A;  2QN6 B;  1XC9 A;  3PKM A;  3T5L A;  4F04 B;  2HRU A;  2OPQ A;  4OQJ A;  3OD2 A;  5B7W A;  3RBD A;  1GTE A;  2V94 A;  2MQN A;  1MRO A;  4QWC A;  4P6Q A;  4IOC Q;  5EUH A;  2RAQ A;  1ZET A;  2BJD A;  4JYA J;  3C6U B;  4X4R A;  5C24 A;  1QE1 B;  2MST A;  3OXF A;  2IJF A;  5LSO A;  2RKI B;  4NLP A;  1VQP S;  4JI5 J;  4JI6 J;  1CJK B;  4DPT A;  2BQ3 A;  1TKZ B;  3M7V A;  4LSN A;  2GVD B;  4RUA A;  4FF2 A;  2AYG A;  2Q6B A;  1FWL A;  1DY3 A;  4L6V 3;  4E0D A;  3FVY A;  1LXN A;  3PM9 A;  1WF2 A;  5KFI A;  4K2J A;  3DM2 B;  2JL9 A;  2BDP A;  2FC9 A;  3A3N B;  3N28 A;  1VQK S;  5KFT A;  4YQW A;  5KOW A;  5J2Q B;  1VQS A;  4NX9 A;  2BE2 A;  4U96 A;  2D74 B;  1YI2 S;  3RGI A;  2KHD A;  2V4R A;  4QJV A;  3QJJ A;  3AXM A;  3V6K A;  3MPY A;  2WVF A;  1H98 A;  2E66 A;  3HUL A;  3TA2 A;  5BYQ A;  1VRQ C;  3MFH A;  1S1X B;  3ZNU A;  2VFR A;  2KDO A;  4HHJ A;  1KQK A;  4YUD A;  3TJA A;  1WKK A;  4NI2 B;  4IYQ A;  4NLT A;  4ER8 A;  4KFB B;  2VG7 B;  2CJA A;  5E3P A;  4ZP8 A;  1FDA A;  3QAE A;  3FEZ A;  2DCL A;  3TOQ A;  2JHE A;  1WG4 A;  2CVE A;  5F41 A;  3GCW P;  3HHL A;  2GAH C;  1U24 A;  1YIT S;  1VQ6 S;  3ZO7 A;  1WOO A;  3ET6 B;  6FDR A;  2ALY B;  1R0A B;  4L76 A;  3Q8P B;  3FBC A;  3VAJ A;  3JTP A;  4F8R A;  2XY5 A;  5B0B A;  3EDR B;  3CXC R;  5KFS A;  2ZHA A;  4F4W A;  4ES3 A;  2W7A A;  5AE2 A;  1FRJ A;  1YLX A;  2GML A;  3CJ5 A;  2UVW A;  4NAS A;  4CYU B;  1GT8 A;  1JNZ B;  3H4D A;  3QFW A;  1LWC B;  4M5M A;  4WYW A;  5AXN A;  3CGI A;  4K7Q A;  1VC6 A;  3TW0 A;  3GIJ A;  1YRT A;  3Q89 A;  3GYG A;  3M6U A;  3KLI B;  5BR8 F;  2WSC C;  1S1V A;  2UV8 A;  4F0H A;  5DZ7 A;  4B3T F;  2OD4 A;  2CNK B;  2RRB A;  2RD5 C;  2VB6 A;  3GJS B;  5IOL A;  4MT1 A;  3KNA A;  2W25 A;  1KLM A;  4NZ6 A;  2CQH A;  3KTQ A;  3TVK A;  2V5H G;  4RX6 A;  4DQS A;  2FZK B;  1FEH A;  1UL3 A;  4X65 J;  4NLQ A;  3I31 A;  4EI2 A;  1URN A;  1HW9 A;  3PR4 A;  2XC9 A;  2QO3 A;  2BJ9 A;  2QMX A;  1U0S A;  1F2H A;  3FMW A;  2ROP A;  3KJQ B;  2OPS B;  2HFV A;  3R6L B;  2C2D A;  1IR2 A;  3R5G A;  5KT2 A;  3KLF B;  2Q79 A;  1C0U B;  4NEY A;  2XO7 A;  4WF9 Q;  2QRR A;  2V8D A;  5LMU J;  3UFC X;  4KKO A;  4CZC A;  3D6H B;  1WC3 A;  4OZ3 A;  3MFI A;  2YKA A;  3VVT A;  3C6T B;  1FT8 A;  1U4B A;  2WVC A;  3TX8 A;  3SV4 A;  3GU0 A;  1UP1 A;  3OPK A;  1V6H A;  1U2C A;  2HZV A;  1NJY A;  2FPH X;  1N5Y B;  2UP1 A;  2Z2L A;  1IN0 A;  3TYT A;  1HAR A;  2W9B A;  2IDE A;  4ED3 A;  3I0R B;  3MM5 B;  2D3U A;  2J7K A;  4DR6 F;  2ZKT A;  5D0H A;  4NLX A;  4ALZ A;  3SCL E;  3NL0 A;  1NJW A;  1CEZ A;  2HW3 A;  1JJ2 R;  4DV1 J;  4ZPT R;  5H9F K;  5HK4 A;  3BM7 A;  1VFJ A;  2Z58 B;  1YDL A;  1W2I A;  1Y0H A;  5DDQ C;  4A4J A;  1RXO B;  2CZ9 A;  3G8S A;  1N5S A;  1T9W A;  2VOD A;  3OQ2 A;  3CJS A;  1GMU A;  1RAG B;  4CTA A;  1KBR A;  3L7O A;  1P27 B;  1CQM A;  3CF5 Q;  2ILZ A;  2VD3 A;  1TEL A;  2KRR A;  3POT A;  3IRW P;  1I5O B;  5J1P A;  4NCA A;  2BBE A;  1DQA A;  4ZP6 A;  2ABY A;  1P1T A;  3HHN B;  2EG1 A;  3E01 A;  1XER A;  5FDL A;  1WC4 A;  4B3O B;  5HP1 B;  2BAB A;  3FNN A;  4P2S A;  1U7L A;  2J0W A;  2W9C A;  4B9V A;  4ZVU B;  2ASD A;  3NWG A;  4KH0 B;  1HWL A;  3S8S A;  3FBE A;  1JJH A;  1T05 A;  4ZCK A;  3IFE A;  1VGY A;  1F1B B;  3KG4 A;  5CAB A;  1HA1 A;  2KT3 A;  2FJA B;  1UMJ A;  4WFA Q;  3W2W A;  1PGZ A;  3X3U A;  3A13 A;  4IQX A;  2HFU A;  5HL7 Q;  2DHH A;  1BHN A;  5DDR C;  2R8G A;  3CCZ A;  4JV5 J;  5MAO A;  2AT1 B;  4JOU A;  2GO8 A;  1V3S A;  1KR4 A;  1OQ3 A;  4LF7 F;  3G8Q A;  1GMW D;  4RPF A;  1TKX A;  1CJV B;  3ETO A;  2DPI A;  1B0T A;  3O5T B;  3UE2 A;  4LSL B;  5LJ5 Y;  1PYS B;  1AYE A;  3KG1 A;  2HHW A;  1BD6 A;  4YY3 J;  3BGU A;  1S57 A;  3FZ2 A;  3LQV A;  2LQ8 A;  2XYG B;  2E9Z A;  4ID5 A;  3OLB A;  4K0K F;  1VHF A;  3D67 A;  4DBQ A;  1ZH5 A;  1OS5 A;  3PVX A;  1OY8 A;  1AW0 A;  4A8S A;  1IQZ A;  3UDE A;  3BGL A;  3FSI A;  1NUE A;  4X4Q A;  2MQP A;  3MR6 A;  4N76 A;  3PG9 A;  2Z56 B;  2DGU A;  1LEO A;  3C19 A;  1V3R A;  3GIR A;  3DOK B;  2EW9 A;  2CUY A;  2OGU A;  2ZDP A;  1R43 A;  4QWB A;  2G1D A;  2D3O 1;  1VCT A;  4N8O A;  4WJB A;  1OYD A;  1KD1 T;  2B56 A;  2DH8 A;  1XR5 A;  1JLG B;  1D9A A;  2J5A A;  2GV1 A;  4DSL A;  2GMJ A;  2OHD A;  4DPO A;  1XMO J;  1EQ0 A;  4M95 A;  3BQ2 A;  2C2O B;  2OEJ A;  1HD1 A;  3TR5 A;  1SC4 B;  1JXE A;  3W60 A;  2XI3 A;  5D6G A;  2YNF A;  4NLD A;  1QAJ A;  2AP6 A;  3GJR B;  4AL6 A;  1HKA A;  4HYK A;  3M8S A;  5J1E A;  1XR7 A;  2AW0 A;  3EWG A;  1KQG B;  1D1U A;  3CJK A;  1C1B B;  4FDF A;  4DQI A;  2IM1 A;  1S6O A;  4UZC A;  2DRD A;  1RWO B;  1MG7 A;  2ZE2 A;  3LP1 B;  3BYP A;  3K0J A;  1TKD A;  1IJE B;  4JI3 F;  1HQ2 A;  2P9G A;  2WSF C;  2F4F A;  1J5E F;  1FE0 A;  2DHG A;  4JI5 F;  2W2Q P;  4RW7 A;  3P5T L;  2W4D A;  4N5S A;  1FVQ A;  4K8R A;  4UOF A;  4IRD A;  3HJF A;  2F9D A;  3QWU A;  3W65 A;  3CCM S;  3ZZZ A;  1K73 T;  3DU5 A;  3UR0 A;  2PSZ A;  3SSQ A;  2MY7 A;  1H7W A;  2A6M A;  5ETL A;  4C3M A;  2HFN A;  2QFJ A;  2E5H A;  1QAX A;  2FUG 9;  3BRE A;  4WK3 A;  4CO5 A;  2R8K A;  4X4O A;  1PBU A;  3KDN A;  2LFV A;  1JB0 C;  1X0F A;  2XWX A;  2A2D A;  1PYO B;  1HBU A;  2V63 A;  5LXY A;  2GJI A;  3C3L A;  1XQI A;  1B0V A;  4O0N A;  4ZPV R;  1YJN S;  2WW8 A;  4IFY B;  2DO4 A;  4ZIW A;  4USV A;  4XDD A;  1S9E B;  3C6U A;  3GCX P;  4MKY A;  1QE1 A;  1SL1 A;  4K4Y A;  3HVT A;  1TMJ A;  2YQ3 A;  1KC8 T;  3CC4 S;  3HF5 A;  2Y1I A;  1FXL A;  5BJR A;  2FVC A;  3DHW C;  2R2R A;  4DFK A;  2ZH9 A;  3LPE A;  2V9K A;  2NZ4 A;  4O4G B;  2N3L A;  1IUJ A;  1UAW A;  4P75 A;  3GV8 B;  1HNZ F;  3HHK A;  2ROE A;  2RDJ A;  4ILM A;  1TAQ A;  2IVF B;  5KG7 A;  2HQI A;  3TEG A;  3OUY A;  1AUD A;  2F8E X;  3NGU A;  3VAF A;  3NCQ A;  1QUV A;  2HNZ B;  4JB8 B;  4DN0 A;  2CXE A;  2E5G A;  5EDW A;  3M8Q A;  2QJ3 A;  2KT2 A;  1S1X A;  1S0V A;  1VIS A;  2KO1 A;  3QJL A;  5KOX A;  4FF1 A;  4M5K A;  4UY8 5;  3Q2T C;  5HRO A;  1QTN B;  2F9J A;  4USU A;  1LW2 A;  3CSK A;  2R7O A;  3PYD A;  2XGQ A;  1FKO A;  1HR0 F;  2DYA A;  2RDI A;  3J7Y U;  4DOZ A;  4ECW A;  1FNO A;  1HHQ A;  3W7B A;  2HGM A;  1T94 A;  1U1Q A;  3V5R A;  5E5N A;  1NLK L;  2L9W A;  4NZ7 A;  2BXJ A;  3G6Y A;  4P9S A;  1R0A A;  3LGM A;  1VK8 A;  1E6Y A;  2VQF J;  3TAM A;  1WTF A;  1DQ8 A;  4OYO A;  1N54 B;  2RRN A;  3BB5 A;  3MWB A;  3C16 B;  4EMD A;  2M2B A;  5EWE A;  3B82 A;  1V3Z A;  1O51 A;  4ES1 A;  3QGP A;  4I56 A;  3WZ0 A;  2UUC J;  5KFX A;  4WKR A;  1RTH B;  4K5R A;  5EX0 A;  3ZZ0 A;  4ZVE A;  1GNK A;  3R8Y A;  4M5G A;  4ECY A;  2ADC A;  3FBF A;  1BXN A;  4OX9 F;  5KT6 A;  5I4M A;  3GV7 B;  2IAJ B;  3MED A;  3AOC A;  4UST A;  4DJB A;  4DV1 F;  4CI0 B;  2ZH5 A;  2APO A;  2G2Z A;  1ZOT A;  3DRR B;  2JEF A;  3C14 A;  1U2F A;  4KGV B;  4U67 Q;  4DR7 J;  1YKW A;  1VYA A;  4CWB A;  3IBW A;  4QW8 A;  3Q8S B;  3TJ9 A;  1RWX B;  1GTH A;  2K06 A;  5AJ3 J;  1RAD B;  2G4B A;  1VQ4 S;  1IKY A;  2E1M C;  2YNG A;  1PJ7 A;  2BE7 D;  5B08 A;  4OI2 A;  3KHH A;  4TY9 A;  2CPI A;  2KU7 A;  1T3O A;  2UXC F;  2ALZ A;  2CFX A;  4JI1 J;  4ZVR B;  1UEV A;  4RWW A;  4DN9 A;  1N6Q B;  1YSJ A;  4G1Q A;  4YEA A;  3RRG A;  2AJ4 A;  1YRX A;  4FXD A;  1BWE A;  2OTL S;  2H4Y B;  4RKU C;  5CD4 H;  4XPE A;  3HHE A;  4CM2 A;  3MM7 A;  1U1L A;  3WX8 A;  5HVF A;  1CUL A;  3RBE A;  3ZTQ A;  3JTO A;  1EIY B;  1NAQ A;  1G6B A;  2A1B A;  4C97 A;  3RTV A;  1WC0 A;  4U7C A;  2JX2 A;  3LP2 A;  2AJ1 A;  4NLS A;  2KT5 A;  4AQY F;  2N7Y A;  2MZ1 A;  3J7Z T;  1ZM9 A;  4UOG A;  5JXS A;  4PRF A;  2UV8 G;  5GMD A;  2FHO B;  8AT1 B;  2EKY A;  2R7S A;  2RU9 A;  1HI8 A;  2K1R A;  5EHH A;  1XEZ A;  1IBK J;  1RAO A;  2CPJ A;  4FYD A;  2XZT B;  1H3D A;  4P52 A;  2MZJ A;  4J9V A;  4LFB F;  3VHQ A;  1MMN A;  1DLO A;  5CYQ A;  1CSJ A;  4ZIV A;  5L1K A;  2UVV A;  3H5S A;  4OLP A;  5HP1 A;  3DLK B;  4F4A A;  2X3G A;  4N47 A;  3SI8 A;  2XMA A;  1WC5 A;  4KV8 B;  3D4J A;  2VDI A;  2VA2 A;  5IT9 Y;  2RVJ A;  2OH2 A;  4LVN P;  1RP5 A;  4YR3 A;  2JEG A;  4NA1 A;  3DOM A;  4I1T A;  4WTO B;  5A6W A;  2Y1L B;  3KK1 A;  4Y2I A;  3PO5 A;  2L3M A;  4MKA A;  3MR2 A;  2VON A;  3PW4 A;  3H42 A;  2YY3 A;  2MZQ A;  3TVY A;  4LBI A;  1RZM A;  3PNI A;  3V81 A;  3WBZ A;  1RT5 A;  1FNX H;  3EX7 B;  1URR A;  3KJV B;  2W1B A;  2G13 A;  1H38 A;  5RUB A;  3DMJ B;  4IG0 B;  2DH7 A;  3DLG A;  4YHH F;  2DCU B;  2YWG A;  1FKP B;  1O6X A;  2UXB J;  4DZD A;  1Z2L A;  3LAN A;  4TXS A;  3ONQ A;  1RLD A;  4CLL A;  2G9O A;  3NS5 A;  5F0W A;  4USH A;  3HHL C;  3N6L A;  3OVA A;  4HTI A;  2ZUG A;  2DR9 A;  2GVZ A;  3V6D B;  4F4Z A;  2GIQ A;  3HD1 A;  2JSX A;  2HQD A;  2W4C A;  5DZ6 A;  1TU0 B;  2W2N P;  3AOD A;  4DV6 J;  1R7I A;  6FD1 A;  2HNY A;  2R2S A;  5A6P A;  3DLH A;  2HHS A;  1HI0 P;  4OX8 A;  4TVA B;  4CO2 A;  4F3M A;  3GZ7 A;  3N01 A;  1AB8 A;  4ECV A;  4X4V A;  3MEC B;  4NLW A;  4B3M J;  2CJY B;  3BO2 A;  1CVJ A;  3V4I A;  3T5J A;  1Q5Y A;  2KFN A;  4FPR A;  1LNQ A;  2JZ5 A;  2LQB A;  4R0J A;  1M0S A;  2KFZ A;  2YNI B;  1N32 J;  1FF2 A;  3HVR A;  1U25 A;  1Q78 A;  1N5T A;  5K8O A;  2GZO A;  2HVI A;  4GKJ J;  1JLG A;  1OPZ A;  4C8Z A;  5KFN A;  3NRB A;  2DD8 S;  2JEI A;  2O01 C;  3EZU A;  2YKN B;  4KO0 A;  1WTB A;  2VOP A;  1KEK A;  1D09 B;  4WCE Q;  2UXD J;  4HHH A;  5CH7 B;  1HWU A;  4YR0 A;  2MKK A;  3IR6 B;  1L3S A;  1H6K X;  3U1L A;  4WU3 A;  1HNW J;  2B4P A;  4Q44 A;  3MCM A;  2BJ3 A;  2NPF A;  1S0O A;  1M5O C;  3SQO P;  1AXQ A;  1XNQ J;  4DZ6 A;  3QT5 A;  1NK8 A;  3CCS S;  5ETR A;  3OVS A;  5KFW A;  1MLA A;  1F5C A;  3Q8Q B;  2H1Y A;  4A8Y A;  2NXC A;  4LF9 J;  3OR2 B;  4N41 A;  1KON A;  3ZZO A;  5HQ8 A;  2EWH A;  2ZWO A;  4ED5 A;  3VGT A;  1OJ4 A;  3HM9 A;  1RTI B;  1JLE A;  1VQ9 S;  3JTN A;  1HNI A;  1HIY A;  5IM0 A;  1SJ1 A;  3RR7 A;  3MOZ A;  3IN5 A;  1CJT B;  1TK8 A;  2I8E A;  4NYP A;  4NEZ A;  1OY6 A;  2ZEJ A;  4PEO A;  1WOS A;  3M05 A;  2CNL B;  1ARO P;  1N33 F;  5F8G A;  4EYI B;  2U2F A;  4NCB A;  2C3U A;  7FDR A;  3UCU P;  3R5B A;  1EKR A;  3VZI A;  3NEK A;  1I51 B;  3TA0 A;  4IFY A;  3EM1 A;  3UPF A;  2K8G A;  2VFV A;  1SH2 A;  3FCH A;  1K1Q A;  3NMR A;  5DQG A;  5C2C A;  4J9N A;  4QWA A;  5CZX A;  4R5P A;  2V4J B;  2YNH A;  2BZ2 A;  3ISN D;  2CDQ A;  4LJM A;  2CQI A;  1P9Y A;  2DT9 A;  3H20 A;  4AXI A;  1WHY A;  3QT8 A;  3EZ5 A;  2VH7 A;  4RUB A;  3DGV A;  2PA8 D;  2HMI A;  4IRK A;  3AD7 C;  3HKZ D;  2ZIT A;  1IBC B;  3MMA A;  3RAX A;  1GMV A;  2HQC A;  3M2V B;  4KY3 A;  1C0T B;  2BVZ A;  1K47 A;  3LTO A;  3GII A;  3AY0 A;  4HTJ A;  2ZNY A;  2VZ9 A;  3D54 A;  3P4U B;  2Y0S D;  4URG A;  2DIS A;  4DR2 J;  1U1R A;  5AXL A;  3O44 A;  1MU2 B;  3I9V 9;  1RTZ A;  3MMB B;  2JVO A;  2PEH A;  4TQR A;  1XMB A;  2KKH A;  4UOC A;  2IYI A;  2YTC A;  4ZP9 A;  2WSE C;  4WII A;  4DDF A;  1DHM A;  3CJ3 A;  2FVQ A;  3FRY A;  4ZLN A;  4F50 A;  3HT0 A;  4OL8 A;  1RA7 A;  4DQP A;  1BMQ B;  5L46 A;  4RNO A;  2EFG A;  3UI3 A;  1S5Z A;  2FVP A;  2EG2 A;  3CIM A;  3CWJ A;  3EGN A;  2I5J A;  1SJF A;  2HHH J;  3SV3 A;  4ZJL A;  4M5D B;  1JLA A;  2OIH A;  4G1P A;  3TZZ A;  2R9L A;  1SIW B;  1R8C A;  4DV4 F;  1BLU A;  2D69 A;  2W9A A;  4B3R J;  1UW9 A;  1TFY A;  2QX0 A;  1LWX A;  1NPK A;  4RW4 B;  3BGF A;  2CKW A;  5EWG A;  3QYY A;  5F8L A;  3OJS A;  1FFG B;  3IM8 A;  3W8P A;  1HBO A;  3QLH B;  3NS7 B;  3BO4 A;  1GX6 A;  1LWE B;  4TLQ A;  3AA8 A;  4CO0 A;  4LBP A;  1KWM A;  2VG6 B;  1VRT B;  1B0P A;  1E6V B;  4DPU A;  3G87 A;  3NNC A;  3UD3 P;  3HPO A;  1OYE A;  1KQS R;  3GFZ A;  2LA6 A;  4Q7A A;  2DBB A;  4TYA A;  1DAR A;  1ZM2 A;  4NYO A;  5M2U A;  3FFI A;  4X62 F;  2LP4 A;  4O44 A;  2DR6 A;  3B4D A;  5C7P A;  1NZA A;  1TTH B;  4JI8 J;  2XY6 A;  2GJ2 A;  2RH3 A;  1UW4 A;  3AJ1 A;  4O3Q A;  1NM2 A;  1G3O A;  3M8P A;  1IBK F;  2AEM A;  3G86 A;  4K4W A;  2IYG A;  1NCL A;  4EBE A;  3SDE A;  4DWI A;  3T1A A;  2IM2 A;  2FLP A;  1S49 A;  3CCT A;  2UVR A;  1R3N A;  3BKF A;  5K14 B;  1WKJ A;  4B02 A;  1WDT A;  3KK2 A;  3ELH A;  2KJW A;  1HMV B;  2DK2 A;  4OHY A;  1H2T Z;  2OO4 A;  4I2P A;  3BS9 A;  1NDP A;  1BUX A;  2C3P A;  4GVB B;  1X0P A;  3VGS A;  1U49 A;  5KFR A;  4ZCM A;  4C8O A;  4P2M A;  4WPA A;  4AXJ A;  1ZPV A;  2UUA J;  5E7O B;  3VAI A;  2YX7 A;  2FGO A;  2CAJ A;  4WTY A;  1D9F A;  5I3U B;  3SYZ A;  4QWD A;  4LRC A;  2I9S A;  3KJF B;  1NRK A;  3NMA A;  3CCQ S;  2E44 A;  2J9D E;  2HQ3 A;  3K5M A;  5K8M A;  2CJQ A;  1YJT A;  3PFE A;  2ZBQ A;  1Y5N B;  2X3D A;  4IFV B;  5CAA A;  4W4M A;  3I96 A;  2J9E A;  1Q8I A;  3EDQ B;  1LWF A;  2YXL A;  4AL5 A;  1HLW A;  2ZH4 A;  4LFA F;  2G0C A;  2N3O A;  1DZ5 A;  3CD6 S;  3EPG A;  1PSD A;  4LRD A;  1RTD B;  1VQM S;  3L4B C;  2HWI A;  4ZK7 M;  3PEH A;  1TUG B;  1HNX J;  3D0H E;  1IQT A;  3SSR A;  3CD5 A;  1DAX A;  4QOT A;  3ZZY A;  3VZH A;  3MAA B;  4DEZ A;  1QTM A;  3KK3 B;  1UPM B;  2EBG A;  4B3M F;  1SJR A;  1UFK A;  3A8K A;  2EBE A;  1S6Q B;  1RWK B;  2W8L A;  2OI2 A;  1X7V A;  1U2R A;  3TQE A;  1AUS L;  2EFQ A;  1XNR J;  1M1H A;  2CWK A;  3F44 A;  3IGV A;  1UA1 A;  2ZVS A;  3MEG A;  4IG0 A;  1JLC A;  3K5N A;  2PE8 A;  1UJ6 A;  1RQ0 A;  3R1H A;  2UXD F;  4LIW A;  3BBB A;  5GAE U;  3US5 A;  4FNI A;  4Y00 A;  4O3R A;  5IV4 A;  4RW9 A;  4TY8 B;  1P8G A;  4HDH A;  1W2B R;  3CCR S;  3JAM U;  2LXI A;  2DR7 A;  3IS9 B;  3AJD A;  2KL8 A;  2YBV A;  1F2G A;  1IXK A;  3EUN A;  4LF6 J;  2BQU A;  2WBM A;  1K0T A;  4OYX A;  2LEA A;  1S1T A;  3BR9 A;  5LXR A;  3PR5 B;  2BKP A;  1VQL S;  1S4E A;  4U8V A;  1FRI A;  2LQJ A;  4F2S A;  2VUG A;  3U02 A;  1M5K C;  3GG0 A;  1K8A T;  3W9J A;  4FXW A;  2OSQ A;  2UUW A;  1QD1 A;  5J2P A;  3W2V B;  1VOM A;  2HWH A;  3FZB A;  3GMG A;  2B9W A;  1UVJ A;  1RHM B;  1LFP A;  1WEX A;  1YHQ S;  1RDR A;  2LXU A;  2Y1R I;  5FLX U;  4QU6 A;  3GE9 A;  4NCG A;  3MR3 A;  2HHV A;  3ZC4 A;  1WHW A;  3MCO A;  1GXT A;  4OYI A;  2ZH3 A;  4CM0 A;  4EU0 A;  4LUB A;  4OI6 A;  3IR5 B;  3WC2 A;  5F0U A;  4FKY A;  3UWT A;  1ZZN A;  2AKW B;  3H40 A;  3HFV A;  1MN9 A;  4WK1 A;  1GX5 A;  4K5S A;  2MXY A;  4ED6 A;  4UY8 T;  1IM6 A;  2V4Q A;  1H72 C;  4CO4 A;  1N34 J;  4WFB Q;  1UVK A;  1ZTT A;  4NZ0 A;  2HS4 A;  2DNG A;  4I6A A;  5HQL A;  3HVA A;  3MDF A;  5IT4 A;  1YZ7 A;  3QFH A;  4FNH A;  3BPD A;  2M3D A;  3QZ8 A;  1HQE B;  2AGQ A;  2E5I A;  4CP5 A;  3QSI A;  3Q23 A;  1V5V A;  5SZT A;  2FVR A;  2OJ3 A;  3F73 A;  3ISN C;  2B6A A;  3J7A 1;  3OTO J;  2XGP A;  4OHX A;  2FB0 A;  1TL7 A;  5GAD U;  2P6S A;  2QTW A;  5KFD A;  4J9R A;  5FD1 A;  2NPI A;  1Q8L A;  2FJW A;  5D8H B;  2VIH A;  5K8P A;  3NS6 A;  4RNM A;  4EYH B;  2OML A;  1FJG F;  4DCJ B;  1N5V A;  4JI4 F;  3JQK A;  2RNE A;  4RW6 A;  1AZS A;  2HGL A;  4UZB A;  1HBM B;  4NXN F;  2ZM6 F;  1T0T V;  1HW8 A;  4F3O A;  2D7S A;  4FYX B;  4OV6 A;  4PYA A;  5J1N A;  2H9Z A;  2VJV A;  1L3V A;  1C2P A;  4DS4 A;  3MPU B;  3HSD A;  3P8B B;  1FK9 B;  3M1V B;  4EBD A;  1YJV A;  4AL7 A;  1OIA A;  4CLW A;  2XS2 A;  3R9L A;  1WG1 A;  1SKW A;  4UT4 A;  5D77 A;  1MWZ A;  4YDD B;  1C0T A;  5GAH U;  4B3R F;  1HWI A;  3EGV A;  4GC7 A;  1TFW A;  4PPD A;  4H4O A;  4AND A;  1HL6 A;  1S79 A;  4NWB A;  2ADB A;  4IDK B;  4LRA A;  2XSJ A;  2O3D A;  5HLF B;  1U1P A;  2KFY A;  3OL8 A;  2YPZ A;  5EWF A;  3QRP A;  1EAR A;  3GFY A;  4WYL A;  1FXR A;  1TL4 A;  1RT4 B;  3KMQ A;  4J9L A;  2HFS A;  2MDA A;  1RAE B;  2MKH A;  4JI0 F;  4OLO A;  1RT6 A;  2KVQ E;  3Q8V A;  4F3Q A;  3MOJ B;  4FVM A;  4X4T A;  3UW1 A;  1SB6 A;  3F41 A;  3SBM A;  3UQS A;  1G1X A;  1YX2 A;  3JSY A;  1RWP B;  3DFE A;  3RAQ A;  2DPJ A;  1SI9 A;  1H0H B;  5T14 A;  3DGP A;  2DR8 A;  2C2K B;  4I7F B;  4ZJO A;  2MKS A;  5DJB A;  2ZZN A;  2PFF B;  3NCR A;  4JI8 F;  4ZVH A;  4F2R A;  5E3Q A;  1UA0 A;  5KT4 A;  2M88 A;  3DYA B;  4OX7 A;  1CG2 A;  1S0N A;  3D9B A;  4C3L A;  1J27 A;  3GB0 A;  1TL1 B;  1YJU A;  3NP5 A;  3KLG A;  3CCV S;  4UUX A;  2NXU A;  3PW5 A;  4HH0 A;  3JQJ A;  5A8W A;  3QLH A;  4HDG A;  2IC3 A;  4NLU A;  1RCX B;  1R31 A;  2VHG A;  2GAG C;  2F1F A;  3TVZ A;  3ISZ A;  3W64 A;  5D3G B;  2CG4 A;  1ROF A;  3DOL A;  4HT5 A;  3GTY X;  3JSM B;  3BSC A;  4L72 B;  2WRM A;  4WFN Q;  1T9U A;  2NLW A;  2LXF A;  2HK3 A;  1A9N B;  2WOM B;  3PJW A;  3PYE A;  4WP9 A;  3Q8Y A;  3WIU A;  4ECU A;  2DIV A;  2MPU A;  3R7B B;  1OQ6 A;  1C4A A;  2MKI A;  4MK8 A;  3GWC A;  4ES2 A;  3M2U B;  5IC6 B;  4LT6 A;  2CA9 A;  4J9M A;  4OYZ A;  1TVR B;  5L38 A;  3M30 A;  3MAH A;  1RT2 A;  3IAS 9;  4JV1 A;  1KDN A;  4ED7 A;  1NK5 A;  1U6F A;  3CNQ P;  3R7S B;  3N6N A;  3WQP A;  2DXE A;  1S1U B;  1N8R T;  1VQ5 S;  4OZJ A;  2HG4 A;  3J81 Y;  3T5H A;  1FRK A;  2GC8 A;  3BGR A;  2PMH A;  1UZD A;  1PIL A;  3D1O A;  2OEL A;  4WP3 A;  2DNM A;  3KLH B;  1YBU A;  4GC6 A;  1S6P A;  4B9N A;  1JLQ B;  3MM6 A;  1VQY A;  1JMT A;  1DTT A;  1NKE A;  3ULH A;  2N82 B;  3NOG A;  2AQ4 A;  5B0D A;  4U6P A;  4PWU A;  4ECR A;  1D8Y A;  2BJE A;  2IVM A;  3ETM A;  2YX1 A;  2HAF A;  2YWE A;  2XCP A;  2NR0 A;  2HHT A;  4YB1 P;  1TMM A;  3KHR A;  2EXU A;  2Q66 A;  3LUY A;  4Q45 A;  4Y6I A;  5BR8 J;  2A10 A;  5MLC V;  2X1A A;  2AV5 A;  3ILJ A;  1KTV A;  3LF0 A;  4M5H A;  2MQL A;  4A8K A;  3VCD A;  4V19 X;  4L73 A;  3Q2S C;  3I9Z A;  2HUR A;  1GH8 A;  1UZH A;  3EGW B;  3QNW B;  1Q8B A;  3LP0 A;  2QIF A;  2P9E A;  1NSP A;  5KFO A;  3CJ4 A;  3KFW X;  3IG1 A;  3ZZP A;  1KOH A;  1JWW A;  3WDO A;  3FEX B;  1F5B A;  1TL5 A;  2W2P P;  4PG7 A;  4C0B A;  1X4B A;  5C25 B;  3G71 S;  4C98 A;  1KSP A;  3CB4 A;  1F6T A;  5I42 A;  4MH8 A;  2CJX B;  4I69 A;  1F3V A;  3PIO Q;  1YJR A;  3UCG A;  4K2X A;  4N56 A;  1QAY A;  1MMD A;  3DRP A;  2ROG A;  1FDD A;  1FRM A;  1FFS B;  4A48 A;  1DRZ A;  4IR9 A;  3KLE B;  3EPI A;  1S72 S;  2NS1 B;  4OHZ A;  3QGI A;  3BKT A;  2HVZ A;  1NK9 A;  4TU8 A;  2GQ2 A;  1APS A;  1TKT B;  2RF2 B;  2FGC A;  3W61 A;  4QYZ K;  3O3L A;  3NBP B;  3QRR A;  3H2U B;  1KNZ A;  2M70 A;  3SZ2 A;  5HAT A;  3W63 A;  2Y8Y A;  1BQN A;  5HAO A;  1U0H A;  5BXI A;  4ZS6 A;  1LW0 A;  5K20 B;  2KM8 C;  1RIS A;  2R7V A;  3H0P A;  3IR7 B;  3N4W A;  3EVO A;  2MSS A;  1JKH B;  5D4L A;  4ICL A;  1Q4R A;  4EBC A;  1UWB A;  3ILL A;  2V69 A;  1Q7Y T;  3MTK A;  3IGN A;  1R6V A;  4N77 A;  2GHP A;  3QQC D;  1UWA A;  1RT1 A;  2DGQ A;  3MEE A;  3M2R B;  1NB2 A;  2VKZ G;  3RYL A;  4LF2 A;  3MHY A;  3G6X A;  4W90 B;  1EZZ B;  1RWU A;  4OZ0 A;  3ITH A;  2ZBP A;  1SUQ A;  2MGZ B;  1VIO A;  1YWX A;  1S59 A;  1EP4 B;  3FKB A;  1ZA1 B;  4DV0 F;  1REV A;  3IRX A;  2CQG A;  2MQ8 A;  2Z0G A;  1GXL A;  4G3I A;  2BW2 A;  1IR1 A;  3Q86 A;  4H4M B;  4USJ C;  2BKO A;  3RBX A;  4WBF A;  4LF7 J;  1QUP A;  2KRB A;  3JS9 A;  2RHS B;  1T9Y A;  2F8M A;  1Q16 B;  1KOO A;  5T7L B;  1T02 A;  2XS5 A;  2MMY A;  4ZHR B;  4IG3 B;  4PQU A;  2FHJ A;  3DLE A;  5F8M A;  1GEH A;  1HPZ A;  1RK8 A;  3NCP A;  1RCO B;  1F3F A;  1HBN A;  2V2Z A;  2Z2Y B;  3RW6 A;  1RAJ A;  2BAN A;  2V2K A;  3T9N A;  3RB3 A;  2CIM A;  2JC0 A;  5KFY A;  4ZVF A;  5DQH A;  4FXV A;  5B0E A;  2DIU A;  1NH8 A;  3AFG A;  3MUR P;  2FLO A;  1FD2 A;  2Z30 B;  4OJ1 A;  1NBE B;  4MIB A;  2C22 A;  3FEY B;  4OZ5 A;  1T9X A;  4JI2 F;  3KUG A;  2VBZ A;  1OWX A;  1FX2 A;  2P6T A;  4XO0 A;  2UVU A;  4UOH A;  1VJW A;  4RU9 A;  8RUC A;  3GIM A;  3J80 Y;  3KUE A;  2IRU A;  4H4K A;  2C2R A;  3OR1 B;  3A4T A;  1JJ4 A;  1HHS A;  4HAC A;  3I0S B;  3R3T A;  4O0I A;  1KRP A;  4MYU A;  5DG9 A;  1WSV A;  3MM8 A;  2K3K A;  4OX6 A;  1LQ9 A;  5ETK A;  3QAT A;  1RKJ A;  2QYC A;  4LF4 F;  2IM0 A;  1DTQ A;  3NAH A;  2ZD1 A;  4CLP A;  1L3K A;  1JLF B;  3EGZ A;  2E7W A;  5DQI A;  2BOP A;  5HBM B;  4JI3 J;  3DU6 A;  1KLN A;  4P71 A;  1J5E J;  5FII A;  2IMO A;  2DGX A;  2H5J B;  2GGP A;  1XMQ J;  2FJX A;  1OPI A;  2ATC B;  2J9C A;  4DU7 A;  2EK6 A;  1WNE A;  4AD6 A;  1TL3 A;  4C11 B;  2R3V A;  3CMQ A;  4DR3 F;  2B0G A;  1C1C B;  4GKK F;  1PYT A;  4KBI A;  5CA5 A;  4Y2M A;  1FE4 A;  2DNR A;  4DU8 A;  1GMW A;  2XLJ A;  1Y5I B;  1YIJ S;  1D9D A;  2FLL A;  1WI6 A;  3CJQ A;  4W98 A;  3HI9 A;  2AZ3 A;  1LOU A;  3P6Y C;  4PWD B;  2CPX A;  2B5J B;  7AT1 B;  4QZV B;  5KTQ A;  4I67 A;  3PAC A;  2VQE F;  3AH6 A;  5KG6 A;  2DR5 A;  3CJT A;  1VDH A;  3N9U C;  2E7X A;  2WBR A;  4QYR A;  2OPP A;  1ZAX A;  1GFW B;  2YWW A;  1FVS A;  3R5D A;  2BJ1 A;  1VC5 A;  1WI8 A;  3BBC A;  4MK7 A;  1SL0 A;  1EHW A;  1Y4Z B;  2VC1 A;  4WFZ A;  3LO3 A;  4NL5 A;  1KN6 A;  4AYB D;  5GAG I;  5E0O A;  2CQP A;  3CO0 P;  3DYA A;  2ZH2 A;  4R8U A;  2DGT A;  3OHB A;  3CJR A;  2OUG A;  2WHO A;  3V6H A;  2HGN A;  2YKM A;  1RT3 B;  2J8S A;  3HHD A;  3BQ1 A;  4ANC A;  1IKW B;  5DM6 Q;  2F4V F;  3IAM 9;  3RG6 A;  5J2M A;  4Q0B B;  3IA0 A;  3LW5 C;  4LQ3 A;  3MF5 A;  1XN9 A;  2HBQ B;  5ADZ A;  5G0R B;  2PD1 A;  4DCP B;  1JLB A;  1HNZ J;  3QO9 B;  2KB2 A;  1OSC A;  2W01 A;  4PQA A;  4MAK A;  3TAN A;  2XBP A;  2PFD A;  3M32 B;  1NND A;  3DI6 B;  3DXB A;  1IBL F;  1X8D A;  2H4W B;  3CCL S;  2VG5 A;  2Y3Y A;  1WEY A;  4LFC J;  4M5N A;  1S97 A;  3LA0 A;  4NLV A;  2IY5 B;  3QIP A;  2PMW A;  1CQN A;  3CD7 A;  1CJU A;  1UTA A;  1K9M T;  1H74 A;  4PG5 A;  5KFV A;  1U48 A;  2BOA A;  1Q1K A;  3VAK A;  1T9V A;  5E41 A;  3D1H A;  3PXG a;  1XJW B;  3IBF B;  3CDE A;  5DDO C;  2YKO A;  3TUJ C;  1SJ4 P;  1HR0 J;  4F67 A;  2CQ3 A;  2U1A A;  3MM9 A;  4XK8 C;  3G82 B;  1UVL A;  5AXK A;  1BQM A;  5KFK A;  1FWP A;  2OKQ A;  4YOE A;  4U8Y A;  4MYT A;  4I68 A;  4UQT A;  3SCJ E;  3JXO A;  2WAQ D;  3ILI A;  4NRT A;  3V2U C;  4RBT A;  3HZE A;  2E9T A;  5EGY A;  5GMK a;  1F60 B;  1WF0 A;  3D28 A;  3QT6 A;  3PW2 A;  5A8R A;  1I6J A;  1HNV A;  2HND B;  2UUB F;  2WB4 A;  2XEX A;  3EZO A;  1F0X A;  2ZUA A;  5A8K B;  5CHC B;  1YJ7 A;  5F3Z A;  4MFB B;  2XO6 A;  2Z2Z A;  4OX9 J;  1N0U A;  1X31 C;  2V8H A;  3ZZT A;  4CLK A;  4Z7Y A;  4ELV A;  4DSF A;  3X1L B;  3TX0 A;  1YVF A;  2XMV A;  3C8Y A;  3HP6 A;  1M1G A;  1WOP A;  3OVB A;  3NLC A;  5CYM A;  5J2N A;  2X1B A;  3HK2 A;  4AT1 B;  1JK9 B;  1IBM F;  2AJ2 A;  1AT1 B;  5ETP A;  2EK1 A;  2F65 A;  3VAL A;  4ETX A;  1IKV B;  5IV3 A;  2UXC J;  2BM0 A;  4IH5 A;  1HQU B;  2CNN B;  5C25 A;  5HMZ A;  2B8Q A;  5I3Q A;  2AWZ A;  4CLS A;  5C5J A;  4G65 A;  1VRU A;  3FQL A;  2C3M A;  2V2Q A;  2OPQ B;  1TV6 A;  3O6Q A;  1N36 F;  2NXE A;  2HRY A;  1D8Z A;  4ID8 A;  4NMX A;  5CYJ A;  3OJU A;  4YS2 A;  4MKV A;  1NHK L;  4AQY J;  5C24 B;  3NGK A;  3R1L A;  4OZ2 A;  2YWH A;  1HFE L;  2FJD B;  1Q82 T;  3TP2 A;  3WC0 A;  4LSN B;  2D9O A;  3UVJ A;  4X66 F;  2LEB A;  4L75 A;  2AYM A;  2MZR A;  1T03 A;  1UVN A;  3MPW A;  2DKO B;  4HR2 A;  1S9G A;  2C42 A;  4ZA1 A;  3AB2 B;  1QSL A;  2DNK A;  4LFB J;  1SPB P;  3OHA A;  4QW9 A;  1QVG R;  2OLW A;  2BE2 B;  3D0I E;  3I87 A;  4E98 A;  3PHT A;  5HI7 A;  1DQ9 A;  4IO9 Q;  2NYH A;  3G8T A;  3K58 A;  3MD1 A;  3ZTS A;  3UD4 P;  3CO9 A;  5ETT A;  1PG5 B;  1SQG A;  3VGV A;  2XG8 A;  1HYS A;  3CDU A;  2H54 B;  2IRX A;  1QSY A;  1FXD A;  4TKT A;  4BS2 A;  2FZC B;  1TAU A;  2DB1 A;  2B9Y A;  4QIV A;  4DG1 A;  2QC3 A;  4YB5 A;  1RA6 A;  2FVS A;  1YJ9 S;  1AFI A;  4ELT A;  3JYT A;  3HHL B;  3AA9 A;  1JJC B;  4YHH J;  2RS2 A;  3F56 A;  5DLF A;  2PN6 A;  2C2N A;  4NXM F;  2AGO A;  4CH0 S;  1GAO A;  4Z37 A;  4W92 B;  2H48 B;  2ZC3 A;  4ZHR A;  2M8H A;  4NA2 A;  2F7V A;  3GJT B;  1KKH A;  2CJK A;  4WE1 A;  4C8K A;  1TR0 A;  4O4R A;  4IO1 A;  2VPZ B;  4ANE A;  4BLG A;  1SKU B;  3FCV A;  2ZFH A;  2O1P A;  1D0E A;  5C42 B;  4PUO A;  2MJN A;  3PYG A;  4KT0 C;  4TQS A;  2RT3 A;  2WON A;  5BYR A;  4PAB A;  2O5D A;  3PHE A;  1J5O A;  2HS3 A;  2POK A;  1S1V B;  2I0X A;  4RNF A;  4B9T A;  1SVD A;  4EUV A;  1XMQ F;  4RU2 A;  2VOO A;  2Y1J A;  3NXZ A;  4ZVQ B;  1EET A;  3M6X A;  4DUT A;  2AU0 A;  1KLM B;  3HSJ A;  1Q8K A;  3W3S A;  3H2L A;  2V8P A;  4KGX B;  4K4T A;  3Q8U A;  1JIH A;  5IQQ A;  3FQK A;  4OJ3 A;  1PC4 A;  1RTJ A;  3TUZ C;  2V67 A;  4R0E A;  3AOA A;  3C15 A;  1FRL A;  3JQM A;  1RHJ B;  3V6J A;  3T5K A;  2H65 B;  1NSA A;  5HVH A;  4FKX A;  3MAQ A;  4LVO P;  3UO0 A;  3H59 A;  4KKO B;  4DL6 A;  4ED8 A;  3ENV A;  1FER A;  3MEK A;  3MUM P;  1S9F A;  4TYB A;  4P72 A;  5IXU A;  3TAP A;  3PW0 A;  4J5O A;  2AMC B;  1I94 F;  2WB1 D;  5HBM A;  2QL5 B;  4FF3 A;  3D3C J;  1Q81 T;  3NGR A;  2RKI A;  1CJK A;  3W5Z A;  2VBX A;  4PZV A;  1WAC A;  3GSI A;  1TKZ A;  4NLR A;  4Y2A A;  2GW8 A;  2GVD A;  4KHP F;  3OL7 A;  1SC6 A;  4ZPB A;  4Q8F A;  1M1K T;  2CQB A;  9ATC B;  2XS7 A;  5IT9 U;  1F9H A;  3DM2 A;  1T95 A;  5J2Q A;  1RHR B;  4JI7 F;  1EJ7 L;  2VU5 A;  3JSR A;  2DY1 A;  4CTA B;  1RUS A;  1T3N A;  3T1H F;  3I6P A;  3HVW A;  2DGW A;  4OYM A;  2J0Q D;  2V50 A;  1R0C B;  3POT B;  1N33 J;  4MTP A;  5CCM A;  3PX4 A;  2BAC A;  3GIK A;  3L95 X;  4LFC F;  4EO6 A;  4U7U D;  1EQM A;  3O2I A;  1RHK B;  3E01 B;  5FDL B;  1A7G E;  2H3E B;  4NI2 A;  2QLB B;  2AYB A;  5HO4 A;  4C48 A;  4KFB A;  2VG7 A;  2W9C B;  1I3O B;  4CLF A;  2QZ8 A;  3TZY A;  2NQP A;  3VTI A;  2DY9 A;  1IVZ A;  1T05 B;  2HHQ A;  4QR0 A;  4A8Q A;  5IC4 B;  1LKZ A;  4P74 A;  3ET6 A;  2KH9 A;  1X4D A;  2OTJ S;  3W2W B;  3E51 A;  4I2Q B;  2PC6 A;  5SUH A;  4TNO A;  4ED1 A;  2EFV A;  1ZM3 A;  2E7V A;  2F5G A;  5D4O A;  2GMH A;  4DV2 F;  2M52 A;  2I1R A;  3CTR A;  2DGS A;  4A8F A;  4RW8 B;  4PG6 A;  1JXV A;  1U09 A;  2L9N A;  4CYU A;  3R27 A;  1X4C A;  2GHV C;  1VQN S;  1LWC A;  2UU9 F;  2QSW A;  3K8V A;  1N0V C;  1TKX B;  1ELO A;  4OYP A;  3QGG A;  3KLI A;  1BGX T;  2CJ9 A;  3DRY A;  1NPR A;  2LYV A;  2NUU G;  1VHI A;  3PFO A;  4ID5 B;  1FHT A;  2QMW A;  2C2M B;  2H51 B;  4YB6 A;  2RRA A;  2PEB A;  4ZPD A;  4DUZ F;  1FJ7 A;  2DJW A;  4ZVG A;  4TU7 A;  4Y0F A;  3B8H A;  4HI1 A;  1UFW A;  5DDP C;  2FHK A;  3KMS A;  2NYI A;  3G96 A;  3G82 A;  1EB0 A;  3HXM A;  5CCL A;  1TUW A;  4QCL A;  2OPS A;  3RAM A;  2BKN A;  5LSR A;  5KFQ A;  2LDI A;  3R7N B;  4DV4 J;  3KLF A;  1C0U A;  2CPY A;  4K59 A;  1WHV A;  4PXD A;  2P9C A;  3B54 A;  2VKR A;  2AF6 A;  4NPO A;  2HQF A;  1HWK A;  2HWT A;  3K7R A;  3C6T A;  2KVI A;  3CUL A;  2M5Y A;  3OTE A;  3CCJ S;  2YWF A;  4ILR A;  4C3K A;  2ZBC A;  4JV0 A;  2YNF B;  2DVI A;  4CLU A;  1WJ9 A;  1N5Y A;  3HJV A;  4GRS A;  5AE1 A;  3W66 A;  2B7B B;  4I64 A;  3CDB A;  1AFJ A;  4H4K C;  3T6J A;  1YG0 A;  3I0R A;  3HFZ B;  3ILO A;  1RBA A;  3MM5 A;  2K7K A;  4B17 A;  2GHW A;  3D6T B;  5J1E B;  4OYW A;  3I55 S;  3BH6 B;  3CJK B;  3T1Y F;  2RQM A;  1OSD A;  4U95 A;  2KHC A;  1R89 A;  4DR1 F;  3M8Z A;  3IXQ A;  2ZE2 B;  4DV5 F;  4X62 J;  2Z4P A;  5IWA F;  5ETN A;  1WC1 A;  2LDY A;  3FDS A;  4RW7 B;  2M8D B;  3OFH A;  2HFO A;  4Y2K A;  5DLG A;  1FA0 A;  2A2C A;  4C8L A;  4DV3 F;  2HLU A;  4DR5 F;  4OYA A;  2J6U A;  1QM9 A;  3L7U A;  1X4E A;  3CCW A;  4IKA A;  3I56 S;  4R25 A;  3W62 A;  4J9O A;  4CH1 A;  1U1K A;  4B3O A;  3BV8 A;  4J9S A;  2HZC A;  5DM7 Q;  2YX4 A;  1ZYQ A;  3A8I A;  2DTJ A;  3ENW A;  3PJX A;  3T9Z A;  2CQD A;  1HBU B;  1S6U A;  4LR9 A;  4DS5 A;  3BN4 A;  3T6B A;  4ELU A;  2CZV C;  5DGA A;  1ZZF A;  4FP9 A;  1JX4 A;  1KFD A;  2H5I B;  2HVE A;  3HVT B;  3CMA S;  5L8R C;  1S4F A;  4MMO A;  4KSE B;  1F9F A;  4L74 A;  4UTG A;  1FJE B;  4AUK A;  4DLE A;  3KNG A;  3KWM A;  3L9Z A;  5DG8 A;  4DSJ A;  2HRT A;  1IWG A;  4DQQ A;  4RBU A;  4KJI A;  3QWP A;  4LFA J;  4UF4 A;  1CJV A;  3A8E A;  2JOQ A;  2XNQ A;  4KE5 A;  4LSL A;  4ECX A;  2LU2 A;  3THV A;  2QA4 G;  5D0G A;  4ZLJ A;  5B0G A;  2WTF A;  4Q2M A;  3OUY B;  3D0G E;  1TP7 A;  3FRZ A;  3ZZU A;  2I2Y A;  4ZP7 A;  4GMK A;  1QAI A;  1WF1 A;  4KYZ A;  3M8Q B;  4MK9 A;  2COL A;  4O23 A;  3TAR A;  4UW2 A;  2VPX B;  3A1Y G;  3I4H X;  5KG0 A;  4CO1 A;  2QV6 A;  4LMZ A;  2BM1 A;  1U45 A;  5HRO B;  2R2U A;  4WZQ A;  3DCA A;  1XR6 A;  3DOK A;  3G4S S;  2CRL A;  1LW2 B;  2ZOM A;  3HCX A;  1FD8 A;  2BJ7 A;  2KG0 A;  2VA3 A;  2A18 A;  1RHQ B;  1U26 A;  1FDN A;  1FKO B;  1G7C B;  2OP5 A;  4ZN3 A;  2PMZ D;  2D3Z A;  4F4K A;  3MUT P;  2HQG A;  5AXM A;  2MTL A;  4LRB A;  1UVM A;  3FUY A;  4Y34 A;  1RU1 A;  1E6Y B;  2C3Y A;  4OI3 A;  3EVM A;  3TAM B;  1MNE A;  3AQP A;  2V6A A;  5KFJ A;  5AE3 A;  4PYD A;  2FD2 A;  3IP0 A;  3D68 A;  2C28 A;  3VV2 B;  2DXF A;  2FHM A;  5GME A;  2M4M A;  1C1B A;  1WOR A;  2IRY A;  1ZS6 A;  5C42 A;  2F40 A;  1SBR A;  3DLB A;  5F8N A;  1NKC A;  2M0G B;  3GYX B;  3LP1 A;  5E3R A;  4LF8 F;  1VQO S;  2LLZ A;  3HO1 A;  2BRL A;  1ZBT A;  2MHE A;  1WC6 A;  1HI1 A;  2Y9H A;  3CC7 S;  2A6O A;  4P7T A;  3GSD A;  3D7S B;  2B8P A;  3MED B;  3I4P A;  1S99 A;  3KLV A;  1FCA A;  2R7W A;  3MCN A;  3C14 B;  1PC5 A;  4F25 A;  3M8R A;  3P5B P;  3AD9 C;  4DFP A;  5LSL A;  3OFE A;  3SXL A;  5JVG Q;  3OXG A;  2ZH7 A;  1A0O B;  1RAI B;  1N56 A;  1IKY B;  1XTZ A;  3HMJ G;  2YNG B;  1N5Q A;  3WIV A;  4RZR A;  2NXN A;  3N79 A;  4IOA Q;  2NSC A;  2CPZ A;  3GFH A;  5ETM A;  2JLE A;  3SFG A;  4WU2 A;  5A2Q Y;  1GQE A;  4G1Q B;  5F9N A;  3VWS A;  4A8M P;  3S7R A;  2R7R A;  3HKW A;  4OHW A;  1LK7 A;  2HKE A;  1YBT A;  1S9E A;  2LU1 A;  2JEJ A;  1VMB A;  3MM7 B;  2FHJ D;  1B64 A;  1YZ6 A;  4K4V A;  3V4M A;  1YQH A;  5THW A;  1SKR A;  1CUL B;  1QJH A;  3EMT A;  4HL9 A;  3DDI A;  3CDW A;  3MPV A;  4FPI A;  4DF8 A;  2W4P A;  4Q8E A;  2MQO A;  1HD0 A;  2VPW B;  1T7P A;  1K1S A;  3U27 A;  3LP2 B;  5DG7 A;  4USI A;  4EZ9 A;  2CQ0 A;  3OFF A;  4KQZ A;  2RU3 A;  5H9E J;  4O4G A;  4A8X A;  3K5P A;  3M8W A;  4LRF A;  3NOC A;  3FGV A;  2HHP A;  3MUV P;  4URQ U;  2Z8Q A;  3NAI A;  3H4B A;  2K1R B;  4DR4 F;  5D15 A;  3PV8 A;  2F3J A;  4ZLL A;  4OJH A;  2VIC A;  2E1A A;  3T3F A;  3Q83 A;  1NEE A;  3KUH A;  1U8S A;  2HNZ A;  3DDK A;  3PJ9 A;  4XAK A;  1S77 D;  1XWL A;  3CIZ A;  1FJG J;  2BEF A;  4JI4 J;  2X7I A;  1CC8 A;  4JBC A;  1DLO B;  5CYQ B;  2E5L F;  4NXN J;  3OL9 A;  2ZM6 J;  2MQQ A;  1NH7 A;  1X5O A;  2BMB A;  2P2C B;  4OMF G;  2OPR B;  3LAK A;  2AHO B;  4OYB A;  4J90 A;  2OFH X;  2DGV A;  4DPX A;  4ZVT B;  2FC8 A;  4ZDN A;  3DOM B;  1N48 A;  2HYI B;  4ZVO B;  1PCA A;  3KK1 B;  1H2U X;  3MR7 A;  1UKU A;  2IHR 1;  4Y2C A;  2P5V A;  3BBF A;  4I2Q A;  4RJV A;  2W8K A;  4Q43 A;  3V81 B;  1W7W A;  3PIP Q;  2RS8 A;  5L9N A;  4WFX A;  1RT5 B;  1SQE A;  1H73 A;  3C16 A;  2N7C A;  1T11 A;  2XTJ P;  4RW8 A;  3DLG B;  1FTC A;  4HH1 A;  4OJG A;  4DI6 A;  2HZA A;  2MYF A;  4LF5 J;  2R42 A;  3WHI A;  2CQ4 A;  2RIJ A;  1UVI A;  8ATC B;  5T41 A;  2FY1 A;  1XIQ A;  1RGV A;  2GVZ B;  1RTH A;  2L41 A;  1S48 A;  2XHW A;  2XSF A;  4CO3 A;  1NME B;  1U1O A;  4JI0 J;  4I0W A;  2HNY B;  1WG5 A;  2R7T A;  2IAJ A;  1PBA A;  3I32 A;  1RT7 B;  2Z2M A;  4EWT A;  3DRR A;  2XMK A;  3OV7 A;  3HFK A;  4FF4 A;  3V4I B;  4N7T A;  4P7V A;  1BQX A;  2NUH A;  4ZLP A;  4K4U A;  4F0M A;  4WZM A;  4QR2 A;  2G2O A;  3HHL D;  4DFM A;  3MR5 A;  3RRH A;  3AXK A;  3KOA A;  3BDE A;  2JFD A;  4K4Z A;  5ITH A;  1N6Q A;  4KO0 B;  2GO9 A;  2DH9 A;  3MCS A;  4LIR A;  1GK8 A;  2XWY A;  2IFX A;  1XBW A;  1RBO B;  5ETO A;  4DL3 A;  3CJ0 A;  3R5C A;  3H7H B;  4CCH A;  2CNO B;  2M7S A;  3Q0A A;  3CVK A;  1CBK A;  2F8H A;  1B70 B;  5KFB A;  2VBY A;  3R5A A;  2EC0 A;  4HKQ A;  1IKX B;  4M63 A;  2ERR A;  3FJ2 A;  2C2Z B;  5F8H A;  4LR8 A;  1SIZ A;  2ACY A;  1D3W A;  1Q79 A;  2RML A;  3MXH P;  2C3O A;  3GIL A;  2CWX A;  4C8N A;  4JYA F;  3QRQ A;  4FN5 A;  1WDD A;  3CED A;  4NOH A;  2C1E B;  2CDR B;  4GO7 X;  1MML A;  3T41 A;  4ZPA A;  2QMU B;  3MD3 A;  4JI6 F;  2L08 A;  3BYR A;  5EN1 A;  1Q0N A;  3KDO A;  2VFT A;  1B99 A;  3UD5 A;  2KXN B;  3H2V E;  3DXS X;  1Y10 A;  3L09 A;  5I3P A;  1W26 A;  1MWQ A;  3E3X A;  1JLE B;  4YDX A;  1OMS A;  1ULR A;  1HNI B;  3MZI A;  2GX8 A;  5IM0 B;  3KYL A;  2DO0 A;  1CC7 A;  1S7H A;  2QGF B;  3DLK A;  3P96 A;  2ZJR Q;  3LWM A;  4CNY A;  4KV8 A;  5A76 A;  1OO0 B;  2IM3 A;  2PDA A;  5L1J A;  3GFX A;  2R8I A;  5E3A A;  1WWH A;  1RWW B;  5DET A;  1I1G A;  1EX8 A;  1NPP A;  5G4D A;  3B4M A;  4CIO A;  3BF4 A;  2DIT A;  4ILL A;  1QSS A;  4O3S A;  4BWJ A;  3DC2 A;  3FBB A;  1NK0 A;  4NLY A;  3W5X A;  2UZA A;  4R5P B;  2YNH B;  5DO2 A;  3JSB A;  1RYR A;  4QPT A;  3KJV A;  2QE5 A;  3DMJ A;  3PRV A;  1FKP A;  3L3C A;  2UUT A;  3W8G A;  2GIR A;  2Y0B B;  5H9E K;  1PIE A;  2FJE B;  1S10 A;  1ZAV A;  5E33 A;  2XMW A;  3RU0 A;  2HMI B;  1CLF A;  4DPY A;  3CJ8 A;  3MMA B;  1SXL A;  2RSQ A;  3V6D A;  4ED4 A;  5L1L A;  2RHQ B;  2HHX A;  3UNG C;  3EXY A;  1Y7P A;  4B9S A;  3PRD A;  4RNH A;  4ED0 A;  1KHW A;  2YWK A;  5M2P A;  2CQ2 A;  3N0V A;  2N4C A;  1SQF A;  3MEC A;  3HD2 A;  2DNQ A;  4B9L A;  5K5M A;  2XZD B;  4CLY A;  1S12 A;  2BA9 A;  2E1C A;  2HVH A;  3CJ2 A;  4D3G A;  3RW7 A;  2CZ4 A;  5ETS A;  2W7P A;  2J0X A;  3CCU S;  2RQ4 A;  1RAB B;  2YNI A;  4ZJQ A;  1WKL A;  4QBU A;  2M9K A;  2EFO A;  3QSY B;  1P6T A;  1SV5 B;  4G6V B;  1ZTW A;  1NXI A;  2GIF A;  4DX5 A;  4X65 F;  3IWX A;  2X1F A;  2DRA A;  2YKN A;  1BC6 A;  1R6Y A;  2I5J B;  4DL0 C;  1SJQ A;  2FIU A;  2KM8 B;  2N4D A;  1JLA B;  3RB0 A;  3TZW A;  2FJB B;  2JLG A;  3A12 A;  2ZZM A;  1ZM4 A;  1M5P C;  4WXW A;  5LMN J;  5LMU F;  5F8J A;  1VJQ A;  4MKB A;  2DNZ A;  3NGS A;  3H5U A;  2GNK A;  3NGD A;  2DRB A;  1AA1 B;  2HBZ B;  3ZTR A;  1S7I A;  1HBO B;  1SC3 B;  3BDP A;  4DUY J;  2IJN A;  3S1T A;  1X9M A;  5B09 A;  3QT7 A;  2O67 A;  3R97 A;  3J81 U;  2ZVI A;  4J37 A;  1RWM B;  4A8W A;  4USK A;  3AJ2 A;  1YK9 A;  3OR2 A;  2FTR A;  2RUG A;  3FCW A;  3J7A N;  3TNV A;  4OZ1 A;  3DLJ A;  3K17 A;  4D3H A;  1FWK A;  1RTI A;  3FFI B;  3TUI C;  2Y8W A;  4O44 B;  2LEP A;  2FY8 A;  2LQ9 A;  4DX8 H;  1X5P A;  3PCO B;  2R4F A;  4LBH A;  1CJT A;  1FDB A;  4PCQ A;  1H2V Z;  2XI2 A;  4DV0 J;  3VAM A;  3BEG B;  2KI2 A;  3M8P B;  4XTT A;  4NRU A;  5KFG A;  5L9X A;  5HVG A;  1NDK A;  1PAE X;  5IT0 A;  3PW7 A;  5B0F A;  5IZH A;  3M6V A;  3R2D J;  3TA1 A;  3SDE B;  1MN7 A;  4DFJ A;  1FI4 A;  2I6W A;  3ZFV A;  3KK2 B;  3F0N A;  3D3B J;  3UDV A;  3EYZ A;  4YP3 A;  4I2P B;  3KKF A;  2YQ1 A;  2V34 A;  2DEJ A;  3HX9 A;  3G6E S;  1RE1 B;  2V4J A;  3C2P A;  3O8W A;  3IWN C;  5LJ3 Y;  1X4F A;  3AB4 B;  2X51 A;  3BR8 A;  2RB7 A;  3FK4 A;  4HEA 9;  3VGU A;  3B6B A;  2DNN A;  4EFA C;  2BR0 A;  2VPY B;  4M8L A;  3HDS A;  2HK2 A;  4QYZ J;  3M2V A;  4M5J A;  5CZV A;  5CD4 A;  2OMO A;  4JV5 F;  1WUU A;  2XMU A;  5CQG A;  4YR2 A;  1Z1Z A;  5KG3 A;  2B9E A;  3OLA A;  4LSZ B;  4Q5V A;  4KPC A;  4JI2 J;  3QMQ A;  4LF5 F;  1LWF B;  2G0I A;  2R8J A;  3TI0 A;  1MU2 A;  4HVZ A;  2XQC A;  3MMB A;  2IBO A;  5D0E A;  4NML A;  4YY3 F;  2KYZ A;  4A47 A;  3DLL Q;  2AIR B;  2LEC A;  2QA4 S;  1R8H A;  4J7C A;  3SQG B;  9RUB A;  2OPR A;  4ZCL A;  3I5C A;  3AD8 C;  4X4S A;  3ZXW A;  5HMW A;  2RQK A;  3O1L A;  4LF4 J;  2PO4 A;  4DX7 A;  5BYS A;  4USW A;  1K44 A;  1ICE B;  1NO8 A;  1JXL A;  1Y9O A;  2IDL A;  2V68 A;  3HLU A;  4MIW A;  2XYP B;  4J9P A;  1VBX A;  1NSQ A;  1Y3J A;  3KHG A;  7FD1 A;  4M5D A;  1PJ6 A;  1G2E A;  5L1I A;  2EC2 A;  3VQT A;  3ZNJ 1;  2JNJ A;  4X4U A;  4B08 A;  3PO4 A;  4J9Q A;  3IC1 A;  3MEG B;  3GV5 B;  1JLC B;  5LT5 A;  2FYX A;  5IQ6 A;  4RW4 A;  2QA1 A;  1Q7L B;  4PXC A;  3PX0 A;  2KZM A;  1XMO F;  2DNY A;  2MZS A;  3P45 B;  4DR3 J;  4GKK J;  4K50 A;  4YB7 A;  3B78 A;  4KGZ B;  1KHV A;  1P1L A;  5D78 A;  2QLW A;  2B7C B;  1TZ0 A;  2J8A A;  4DL7 A;  1LWE A;  2B3T B;  1L3U A;  5HSP A;  5DGB A;  4RWX A;  4RW9 B;  4FBU A;  1X60 A;  2O66 A;  2VG6 A;  1VRT A;  4UUW A;  2IMW P;  2YVS A;  2MEW A;  1E6V A;  3ZTO A;  2BRK A;  1B7F A;  5KFE A;  1V9O A;  3KXD A;  4J9U E;  5DS7 A;  1RT7 A;  2VQE J;  1S1T B;  3OTD A;  2CPE A;  2AX0 A;  4B9U A;  1QDU B;  4A46 A;  2DEI A;  1RBL A;  4ZMM A;  5K8N A;  1X4H A;  1GXU A;  4ZKA A;  1TUV A;  2R7U A;  4BCA A;  2JJ4 D;  4LF1 A;  2XCA A;  2IA0 A;  2JLF A;  4DSI A;  3ENQ A;  5J2P B;  2V2V A;  2NXJ A;  4BBY A;  3TEH B;  2AX1 A;  1UET A;  3BPS P;  3SCI E;  3K5O A;  3UNY A;  2IIH A;  2F4V J;  3KHL A;  5K14 A;  2NRE A;  1UEK A;  1HMV A;  4WP8 A;  2CAD A;  4YME A;  3VVU A;  4NCG B;  5KFF A;  5GAG U;  3DRS B;  2GFF A;  4GVB A;  3E2E A;  1VBZ A;  3SEO A;  1NDL A;  3EVW A;  1NSK L;  2NCK L;  3M4X A;  4KHM A;  1J2V A;  3LWL A;  1IR0 A;  3HT3 A;  1HHT P;  3I5B A;  1IKX A;  1IBL J;  3PDN A;  5HAN A;  4DXL A;  4URS A;  2WZ1 A;  1UPP A;  3IBC B;  3GP9 A;  4CLZ A;  4LR7 A;  3K57 A;  5I3U A;  2IBK A;  2VFS A;  3L7P A;  3OTC A;  4GVL A;  3BSA A;  4QR1 A;  1SL2 A;  3J80 U;  1XK8 A;  2EVZ A;  4IR1 A;  1NDC A;  4PAA A;  3R6G B;  3EXC X;  2XYH B;  3I82 A;  4PXB A;  3RB4 A;  4IFV A;  2EPI A;  3PX6 A;  3AHP A;  3QZ7 A;  2AJQ A;  5KFP A;  4OZN A;  1BWV A;  3H5Y A; 
#chains in the Genus database with same CATH homology
 4GVB A;  4GVB B;  1KP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...