4GVBA

Crystal structure of the virally encoded antifungal protein, kp6, heterodimer
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KP6 killer toxin subunit alpha
publication title The Atomic Structure of the Virally Encoded Antifungal Protein, KP6.
pubmed doi rcsb
molecule tags Toxin
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2012-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.440 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Killer toxin KP6 alpha-subunit 4gvbA00
4GVBA 4GVBB 1KP6A
chains in the Genus database with same CATH superfamily
1OPZA 3CULA 1EETA 3UVJA 3NGSA 1IBMJ 2I38A 5KFGA 2OD4A 2ZOMA 1KVJA 2ZOFA 4ZPDA 3DRPA 4A8YA 1HWUA 2M9KA 2BKOA 5ETQA 4AQYJ 2MZSA 2RKIA 5KFWA 5KTQA 2BE2B 4KPCA 2JEIA 2KJWA 3JS9A 1XEZA 1HNWF 2CQ2A 4HHUA 1F6TA 5DG7A 4RNOA 1KP6A 2W9AA 3QJLA 2WBMA 3LAKA 1DTTB 2PD1A 1KLNA 1TKTA 1H73A 5B7WA 2JJ4D 3VAMA 4QZVB 4ZVOB 3OFEA 4O3RA 3R6LB 5AE2A 3I0RB 5J1EA 1HNVB 4YHHJ 4OX8A 3ONQA 1C0UA 3C16B 3GCXP 1GAOA 3FSXA 4RWWA 1FNOA 4X66J 4NX9A 2GAHC 4OYMA 5K5MA 2EFVA 1HI1A 1U49A 2QA4G 3CJ0A 4WFNQ 5CZVA 2HHHF 5F8NA 2IJFA 2YVSA 1DJ0A 1T9WA 3C6UA 4L73A 1Q86T 1YJTA 5DDOC 3J81j 3ULHA 4B02A 1XN9A 4ECZA 2X1FA 4RW8A 2QL5B 2W7OA 4J9RA 3R5AA 3DXSX 4DS5A 2VFSA 2V2QA 4WP9A 1S1UB 4RKUC 1APSA 1YK9A 3JSRA 3UD3P 1TL5A 3EGVA 2CRLA 5IT0A 3KLEB 1VC6A 3LF0A 4FN5A 4RW7A 3GCWP 4NLQA 1WDTA 2B3TB 3I9ZA 2MXYA 3MM7A 5F8JA 1M5SA 2C28A 3DLHA 3ET6B 2GVZA 1RHMB 3MMCA 1WJ9A 1QUVA 3MM5B 1M0SA 1QAXA 1JLGA 3N6MA 4C8KA 2E66A 5K20B 4JI4J 1XNQF 1VBKA 3AT1B 1RAOA 1YJVA 3QMQA 2UXDF 3ILJA 4ZN3A 3DU6A 1WKKA 1YDLA 3VGTA 3D0IE 3BSOA 5IZHA 4LVOP 4E2FB 1X9SA 3QT7A 5KFSA 5D15A 5KFYA 2L3MA 1N34J 2N82B 2J9DA 2GA7A 2XO6A 3D2WA 2G0CA 1DHMA 1I94J 1ZETA 3JYTB 1PAEX 4TY8B 1GX5A 2AJ1A 3DI6B 4ZVUB 1RACB 1IKYB 1BD6A 2ZDPA 2HNYA 1EQ0A 1G7CB 2Z58B 1RBOB 2DNNA 3OL8A 1UWBB 3H4BA 1FWKA 3IRXB 3N0VA 1VHFA 4ZLLA 2SXLA 4NOHA 2VBYA 2GO8A 2DR6A 2DPJA 3AJDA 4O44A 4DUTA 1VJWA 3DDKA 3M05A 1CEZA 3M8SA 4HLBA 3OD2A 2V9WA 4ECYA 2YKMB 3H2LA 1R3NA 1N32F 3EVOA 2ZKUA 4DBQA 1U09A 5KFMA 3HULA 2AW0A 1RAJA 3OXFA 5KFKA 5LJ5Y 1H6KX 4DR6J 3B78A 2LA6A 1U24A 2QE5A 4LBPA 1GMVA 2FC8A 3CCRS 2W2NP 2ASDA 1YJWS 2YH0A 4CO3A 4KGMA 1TMJA 3FFIB 1RTHA 2LDIA 1WC3A 2HLUA 3SQOP 3TWZA 3D67A 4HACA 4AYBD 3EZOA 3T1HF 4HL9A 3H25A 1T9UA 3M1VB 4EK2A 1ZAVA 3R27A 1D09B 2HHQA 5E7OB 1X5PA 3F44A 3VTIA 1GMWD 1P1LA 3RB3A 4U96A 2YKNA 2YQ0A 3QAEA 1OY8A 4R5PB 1IVZA 1S4FA 3DM2B 2ZKTA 4ZA1A 5C2GA 3V4IA 2IA6A 4PG8A 4QU7A 4NEYA 1C1CB 1UEUA 2HQIA 2HBZB 4ZPCA 2VG6A 2MQOA 2GO9A 3ILLA 4F3MA 3OXGA 1CJVB 5IFMA 2EG2A 2W2MP 4XDCA 1JJ4A 1KKHA 3M8ZA 1LOUA 1N4LA 3RB6A 3UDCA 3QZ8A 4CIOA 4LSNA 2C2EA 2OH2A 1S79A 3QJPA 1TUWA 1NHKL 2RD5C 3SSRA 2ZH8A 3CCZA 3K89A 1ZZNA 1K0TA 1WELA 2DEIA 3DFEA 4FPRA 5KFLA 5IM0A 1PBAA 4G1PA 4ZLJA 5J2PB 3W5XA 4CO5A 1TU0B 4I64A 4M5DB 4WK1A 4OYAA 4AFFA 3A4TA 2OSRA 4IFYA 2DHSA 4BHQA 4DU8A 1T3NA 4U6PA 1HPZB 5G4DA 4PCQA 4DV4J 3AA9A 1M1GA 3GIRA 1KBRA 3OR1B 2FHKA 3CC7S 5HQ8A 2VH7A 2BZ2A 4UF4A 3IR6B 5D3GB 3MEDB 1LEOA 4B3RJ 2WCXA 4X4PA 3U7JA 4TY9A 5EWEA 3BEGB 4LFBF 2PO4A 3TNVA 3CMQA 3N9UC 3MMAA 5L1LA 4URGA 2XWXA 3KDNA 5KFBA 4C11B 5A2QY 3FBEA 3T41A 1I3OB 1URNA 4BWJA 4ID5B 3MPDA 1MW7A 4Y2CA 4OMFG 3O44A 1NPPA 1RUSA 4KB7A 4C48A 4GVBA 1NJIT 1JLCB 3G6ES 2B4VA 2UXCJ 3PJXA 3I4HX 2XYHB 4QCLA 4QW9A 1JLAA 2GAGC 3HLUA 5KFPA 2KZMA 4JI7J 2XTJP 1S1TB 2GHPA 2YX7A 4TVAB 4ICLA 4ECTA 1K9MT 2CAJA 4KHMA 2XCAA 3KDOA 2J6SA 5F0WA 1S57A 2WSCC 4GO5X 4ELVA 1BQXA 1FFGB 2KT2A 2KI2A 5BR8J 3FQKA 3ZZPA 2DH8A 4ATNA 3QRPA 3N6LA 1YBTA 5CYJA 5B08A 1EIYB 3G6VA 2HQ3A 4OI0A 1PBUA 4UW2A 4WKRA 4LF9J 4HT5A 4P10A 3CDWA 3OFGA 4RZRA 1DTQB 5HSPA 3PCOB 1QAIA 4Q0BB 1ZA1B 1S59A 5T7LA 1BWVA 1TZ0A 5JXSA 4Q7AA 3M8PA 1Q16B 4KV8B 3NS7B 4H54A 3BZQA 4A8MP 1WI8A 1RADB 2HWTA 1TKZA 2YWGA 1VBXA 3GZ7A 4NA3A 4RL1A 3NLCA 4J9OA 4I0WA 2XYPB 3Q2SC 4NASA 4HHJA 3QNWB 5E3QA 3OPKA 5KFXA 4FF2A 3I0SB 3EDQB 3VQTA 2R2TA 1R89A 4OZJA 5J2NA 1IR2A 2ZBQA 2X51A 2LVWA 2H4YB 3IS9A 3D3CJ 3GG1A 3OFFA 2WVDA 5DQIA 4RU9A 3HJVA 2KN4A 3CCJS 3S7RA 1RT6A 2K06A 4UQTA 3V81A 3CJ3A 3FK4A 1I51B 1KTVA 2HGLA 2CJKA 4G1QA 3PZPA 4F2SA 3CW2C 4BC7A 3BN4A 4ANDA 1IBCB 3CT9A 1MLAA 4DR4J 3TX8A 3JSMB 3OLAA 1SV5A 2VOOA 3RR8A 1N34F 3CO9A 2VQEJ 2IRUA 4XPEA 3TOQA 2HFOA 2D3UA 3QIPA 1SJQA 3AQPA 1N0UA 4O23A 3D6MB 1RA7A 2AT1B 1R0AB 4B3SF 2ZFHA 3DC2A 5L38A 5BXIA 2OGUA 5DJBA 3BDPA 4TLQA 1RDRA 2CVIA 4RBTA 1EJ7L 2J0WA 1JXEA 1Y0HA 4MJKA 3QZ7A 1GMUA 3EPIA 4J9VA 4B17A 1Q78A 4LSZB 3G6YA 3MM9B 1IR0A 2HVDA 2PDAA 4ELTA 3FEZA 4DS4A 2MTLA 1R8BA 2DXDA 2U1AA 2JZ5A 1QUPA 4BLGA 5KFRA 3QATA 2HBQB 4DR6F 1N8RT 5FDLA 3JSBA 1CBKA 4IO1A 1HNXF 3JTNA 1QSSA 3IC1A 4NZ0A 2C22A 1JWWA 3RW6A 3A8JA 2MSSA 4DR1J 1K8AT 3D1HA 1LFPA 5LMNF 1M5KC 1O6XA 3V6DA 4KQZA 1VISA 3VF0B 2M52A 2PFDA 5FIIA 4KBIA 1NK9A 4J9LA 2ROGA 2VG7B 2FC9A 2O5DA 2VBXA 2CJAA 1RKJA 4PXDA 1RYRA 2VBWA 3WX4A 4DUYJ 4B9MA 3UNYA 2F65A 3Q8VA 2DIUA 3GG0A 2VA2A 3SV4A 4J9KA 4YN3B 3HHDA 1DRZA 4ITSA 5DO2A 4X62J 4ZKAA 3ENAA 1U1OA 2L41A 1EX8A 3CJRA 2C2RA 3DRPB 3KJNB 1R8AA 3GWCA 3N4WA 1OMSA 2FLPA 1S99A 1TUGB 2BOPA 3LP0B 4J5OA 2VQFF 2DGQA 4I6WA 4LSLA 2IHR1 2H4WB 5GADI 4XK8C 3HZEA 2R42A 4GMKA 5IC4B 2DYAA 1AFJA 2AEJA 5ETSA 3LPYA 5KFVA 3FBFA 2MLXA 4PWWA 4X64F 3RR7A 1TL1A 3CO0P 3ILIA 2HK3A 4C2MA 1YTYA 3UFCX 5KFAA 3L7OA 5EHHA 1M90T 1X5OA 2HPUA 3M8QA 3PHEA 1O51A 1UA0A 2ZZTA 1M5VC 1F9FA 5HL7Q 1C1BB 2DNMA 1XMOF 3KMQA 1CJKA 1HNZF 2OPQA 4FYWB 1RHUB 3MM8A 1HR0J 3EJMA 1S0MA 4N5SA 4NLVA 3C6UB 4B3RF 3QO9A 3TQEA 1RT5B 4DSKA 2FZCB 1PSDA 4A8FA 2DHGA 5KFUA 3HF5A 3M2VB 5LMUF 2YNHB 2W9BA 2PE8A 4MIAA 4OJ3A 3R1HA 1F5AA 4P2FA 1HBMB 4K4VA 3ADAC 4LRFA 2OELA 3RBXA 3OJUA 1R8PA 3H98A 4JP8A 1WC4A 3MUTP 2MSTA 3R3TA 3AY0A 2ZH7A 3D6TB 4DV5F 3I31A 1OJ4A 4JI6J 1S10A 4KE5A 3CDUA 2HZAA 4LF4F 1WTBA 5E3AA 4DV6J 1KC8T 2NPFA 5DGBA 5J1PA 3C6TB 4JV2A 5HMXA 4Q8FA 3T5KA 4PYDA 1RTIA 2BMBA 3GONA 2J8SA 2R8JA 2CKWA 4M1KA 5F8HA 4ECWA 4TU7A 1CPZA 2RVJA 4ILLA 1X4AA 1N36F 3C14B 5EWFA 3CDEA 3BDEA 4LF9F 2LQ5A 2G13A 3KLFA 2QX0A 5K8MA 4H4OB 3VAHA 2R7WA 1T03B 3DHWC 1RWKB 2MZ1A 2UUWA 2HSEB 5CCLA 4M63A 1DQAA 2O66A 1SH2A 3QGHA 5B0BA 2RUSA 4M5NA 4K4XA 3SXLA 1F5BA 2C3OA 4ZN1A 1K73T 3QFHA 2A3JA 3V5RA 1WUUA 5KFFA 4YDDB 3KLGA 2JWNA 2EFOA 1HFEL 4ED4A 4O44B 4DQPA 4CLKA 2GQQA 4OX7A 5LXRA 4PPDA 3OQ2A 3ZO7A 3FC9A 3BQ2A 2UUAF 2DGOA 5HATA 3CCTA 2OPSA 2DIVA 2NUHA 4EU0A 2H51B 1TELA 3M2RB 2AP6A 5EX3A 3FCWA 1NMEB 4DR3F 3MAAA 1RHKB 3PEHA 3GIMA 4RW4B 4F50A 3B4MA 2VFRA 4OYWA 1Z2ZA 1Q79A 1F5CA 1HWJA 2EK1A 2YNFA 1IQZA 4OL8A 3K7RA 2XB2D 2CDQA 1UJ5A 2AD9A 2Q1LA 4DR4F 1S9EB 3IM9A 4M5HA 1NDPA 2AYEA 4ENOA 3ITHB 3KHLA 2DISA 1F2GA 2AYGA 1FRJA 3P5BP 3GYXB 5HROA 3EYZA 5IS2A 1O8BA 3IGNA 2FY1A 5KT3A 3W9HA 4GKKF 4GKJJ 2BVZA 1HHSA 2W2PP 1VRUA 5ETTA 1LW0B 3V4IB 1YRXA 3TUPA 2UVWA 4RNNA 2HG4A 2KVIA 1JNRB 4YUDA 2WVCA 2KFYA 1LWFA 4WYLA 1V3ZA 4HT7A 4RNMA 3RRKA 4JI5J 4CH1A 2J0XA 2KT3A 3PYGA 4IH5A 2CWXA 1VQYA 1FERA 3D66A 2R7XA 1X60A 4J9SA 3I32A 2GNKA 2BE7D 3MZIA 1VC5A 1GTHA 2DNYA 1BE4A 1Q82T 3DLEB 3MCOA 3UQSA 3HHLB 1UVIA 4DLEA 3OL6A 4CH7A 1LWCB 3VAGA 2C1EB 4J7CA 1TUVA 4OZLA 1LWEA 4E8UA 3W65A 3R5DA 4NRUA 3CEDA 3CE8A 5M2UA 5IV4A 5GMDA 4DX8H 4DF8A 2W7AA 4EBCA 3NBPB 1Z2LA 1S9GA 4ZCIA 4GO7X 1LK5A 5F8GA 4HDHA 3OTOF 2VPWB 2IVYA 3VVUA 3GV5B 2JDJA 3R1LA 4OX9F 2KB2A 3C66A 1T05B 3N5FA 1TVRB 1SUQB 4MFBA 3JSYA 4DPUA 2A1BA 3E8OA 2D3O1 3GIJA 1NM2A 3H8YA 5FD1A 4DHVA 1EARA 2DGSA 2OMOA 2Y0SD 2M3DA 4X4SA 3J80U 2KYZA 5ETNA 3JAMY 4F4YA 4DV1F 1N5YB 4O4GA 4FF1A 5HMYA 5A6WA 4DCPB 1R8CA 4CP5A 3CDAA 4C4WA 4P52A 2CQ0A 1RWOB 1UEVA 1FWPA 4KAIA 3MAQA 4NYOA 5KT5A 4QJVA 2NLWA 4BDPA 3NMAA 5T14A 1HBNA 3PKMA 4RU2A 2FPHX 2E5JA 5F3TA 5L1JA 1A0OB 2E29A 1KS2A 1YSJA 4K2JA 1S1WB 1YJ7A 4Y28C 1X4EA 2CYYA 3H20A 4RNFA 4F4WA 1WOSA 3R5JB 1SH0A 4PZVA 8ATCB 3NNCA 4ECVA 1UFLA 2N3LA 2CZ9A 1D9AA 4CCHA 1HWKA 4DV0F 1UFKA 1VYAA 2GW8A 3L3CA 2VA3A 2VOPA 3NL0A 3QSIA 2JVRA 3W5ZA 3WC2A 4ANEA 2WBRA 3CWJA 4OX6A 1HR0F 3EWGA 2QFJA 4LREA 3RUBL 3M8PB 1A7GE 2WVBA 1RU1A 2UUCJ 1ZZFA 3A8KA 3IAM9 2ALYB 1CJTA 1S1VB 2HFVA 1IJFB 2A2CA 1Q8BA 4DL3A 1VMBA 5HQMA 4D3HA 1RTDA 2V69A 4PXBA 5KOXA 2FJWA 3AXMA 4EZ9A 5IT4A 1F2HA 3UWTA 1RLDA 2FJBB 3MUMP 5FLXY 1MWZA 4IYQA 3OSNA 2DO0A 2DXFA 2ZJPQ 2EBGA 2DO4A 4YMEA 1V3SA 1SVDA 2BM0A 2M2BA 4DR7J 4P2XA 3VALA 2GGPA 4RO0A 1KVKA 2IM0A 3PG9A 2V63A 4OZNA 3H5XA 3M32A 4DV7F 2RQMA 1FKPB 4LQ9A 3BR9A 2G9OA 4ZHRB 1IBLF 3IS9B 3LPEA 2V4QA 2AYMA 1UEKA 4XTTA 2E5LJ 1FHTA 2D3OR 3V2UC 1RT6B 4DV6F 2WW8A 1YITS 1QE1A 3FZBA 3AH6A 2B8QA 2NS1B 4DDFA 3T3FA 4WIIA 3IWLA 4K4WA 1BHNA 1IR1A 5J2QA 2RU3A 3G82A 4ERDA 1FRKA 4P6QA 2KU7A 3TANA 1RT4A 5JUMA 2KTQA 4BBYA 2AJ2A 4TU9A 1CS4B 4NRTA 4DCJB 4IFVB 4M8LA 2F7VA 2A6MA 2G2OA 1WSRA 2PEBA 1RT3B 3CMES 2FLNA 2EC0A 4WU2A 1YVFA 3IGVA 4NLSA 3RZAA 1RTJB 2W4CA 2H5JB 4DPXA 3NGUA 3NWGA 4FPIA 3RYLA 5KG3A 3NOCA 3ZTSA 3MPWA 3POTA 1ZTTA 3CF5Q 3HDSA 4CLTA 5CAAA 2CA9A 3A3OB 1HD1A 2QLJB 1KFDA 2XG8A 3PX4A 2ZWOA 3PJ9A 2VFUA 4DV3J 1SC1B 2QT7A 3ZFVA 3QGIA 2QYGA 1SJ4P 4ED2A 2B51A 1HW8A 1M5HA 1FXRA 4X84A 4MT1A 2GJ2A 4BC9A 4EBEA 4ZOSA 3ZZYA 3GIKA 7FD1A 1D8ZA 1H38A 2CZVC 4JV5F 2MZJA 4A8WA 2CNOB 2ZC3A 1FKOB 4DX5A 3QFWA 4DR5J 1HYSA 1YBUA 2F8EX 5I3PA 4UOGA 4Y2MA 2R2SA 4F04B 4WPAA 2CPJA 1W2IA 3M7VA 3FCHA 4B9NA 2HHSA 2WSEC 4X4QA 3V6DB 2PEHA 1B64A 2OUGA 2HQCA 4QIGA 5DLFA 4PWDB 1SKUB 1ZS6A 2HK2A 1VQKS 3PW4A 3J7YI 2CPYA 1XR6A 4K8RA 2GVDB 1Q7YT 2W8KA 3K17A 4HKQA 3MM6B 2HBYB 2EFQA 4DSFA 1YJRA 4RUHA 1UA1A 1FWLA 1R0CB 5B0GA 2HFSA 3HVTB 1J5EJ 5AXMA 5KAKA 5IOLA 3MCSA 3TEGA 4D3GA 3HD2A 2E7XA 1TFYA 3CTRA 4G65A 1QVFR 2BE2A 4QIVA 1PO6A 3L95X 4OHXA 2QA1A 2N7CA 4X4OA 1VHIA 2RDIA 2XNQA 4DMZA 3PY8A 4F3QA 4JOUA 4IOAQ 1QLNA 1Q1KA 1DTTA 3IR7B 3PW5A 2COLA 1N54B 1AXQA 3UN5A 5L9XA 1NDKA 3OTCA 4X4UA 2ZBPA 3BGLA 4JI2J 4RNHA 5KFHA 2ROPA 3I0RA 1HNVA 2B8PA 5GADU 3C16A 5HVFA 1NK7A 3V6KA 3CGIA 5JMNA 4C8LA 1RK8A 4TYAA 4F02A 1PYTA 1U8SA 5I3UA 4PR6A 4B3TF 4CYUB 1VC0A 1FFWB 2YX1A 1U0HB 4N76A 5E5NA 3MURP 1IKWB 3TX0A 5GMKa 1QAJA 3PHTA 4IRCA 4DLGA 3OTEA 1S1UA 5EX0A 2C42A 3KKFA 2WONB 1VQPS 4DU7A 2M5YA 3SCLE 1JX4A 2B5JB 2DEJA 3KLEA 3CJQA 3SYZA 2FB0A 1XNRF 2BDPA 5LXYA 1N33J 1FJGF 4GC6A 4OLPA 3ET6A 3PACA 3IM8A 1HBUA 4ZJQA 1P8GA 5T41A 1EB0A 5KG6A 4NXNF 3T5HA 1SJFA 4C0HA 1TL4A 4Q44A 1UL3A 1NSKL 4WWSA 2KZZA 3C46A 4KFBB 2QN6B 2MHNA 1DLOB 2DR7A 1L3VA 2ZVSA 2MKYA 1OS5A 1GX6A 1HKAA 3H5YA 3PW2A 4N8OA 3Q8PB 4YB1P 3W9IA 4ZP9A 2J6TA 2F40A 2J6UA 3JYTA 4TY8A 3SSQA 1RHJB 2HRUA 3U02A 4KJIA 1KRPA 1NK4A 1IKYA 4DUZF 3OW2R 1RISA 3R9LA 1VQ5S 4XPCA 2QLFB 1UWBA 2CPZA 1QD1A 4P9SA 1NPKA 3QWPA 4YB7A 1ICEB 1MSWD 7FDRA 4IH6A 4HH0A 2Y1IA 1NU4A 2DGVA 2QL7B 4N47A 5ADZA 1N48A 3FJ2A 3FRYA 5HANA 3O6QA 1GXUA 3PVXA 2YKMA 2A2DA 3Q0AA 1KSPA 4LRCA 1VLYA 2CPDA 4FP9A 2CQHA 4YEAA 1JJHA 1FF2A 2YKPA 2CNNB 4LQ3A 1RT2B 3D1QA 2YNIB 1BMQB 4K4UA 2RRAA 3IBCB 1YJNS 2HNZA 1OIAA 1WEXA 3BO2A 2VD3A 2Y1JA 2QMXA 4FF4A 1H2UX 2RUGA 3LQVA 2Y1RI 1FK9B 4FYXB 3TVYA 1Z1ZA 3K8WA 3KOAA 3FFIA 1WC6A 5D0EA 4DPTA 3DLJA 1RWUA 4K4TA 2MKIA 3Q23A 2K1RA 3DRYA 3HFVA 5ETPA 1DAXA 5AXKA 3M1VA 1RBAA 2I5JB 4FNIA 4LF7J 2KHDA 3C19A 1SC3B 1X4BA 4OZ2A 2PMWA 4HTJA 2DHXA 2DXEA 3WDOA 4RBUA 2Y8WA 2ZE2B 2JSXA 1AFIA 5DRKA 1YQHA 4LR8A 4C98A 4DEZA 4R5PA 2LCWA 3NCRA 3J7ZT 1Y3JA 3WX8A 1C1CA 2D74B 1NZAA 3EXCX 4TKTA 3DGVA 3TRGA 1S97A 3NGTA 3GFZA 3P49B 2RDJA 3HZGA 2DH9A 1XR7A 2E1RA 2ATLA 3D4JA 2HNDB 1T9YA 2A6OA 4L72B 3BPSP 4QPTA 2B0GA 2RH3A 2ZH2A 4HHHA 3JQJA 3FBCA 4Y65A 4ES2A 4N77A 3SI8A 2JHEA 4C3LA 4ZLPA 1GT8A 2VFVA 1Y3KA 5K8OA 3EZ5A 2BQRA 4DR5F 2Q6BA 3DRXA 4IDKB 4LFAF 2J7UA 2UVUA 1RWPB 4EZ6A 4M5DA 3MXHP 3I5AA 1WNEA 2YWHA 1JKHB 2D9PA 3ZZOA 1U2RA 4CO4A 3MCNA 2HHVA 1HPZA 1EAYC 4MKAA 4AT1B 3NNAA 3OR1A 1VQLS 2E1PA 2AZ3A 2CJ9A 1B4SA 2LU2A 2HHHJ 3I56S 2HS4A 5D3GA 1MG7A 1RWWB 2QFIA 1GK8A 3SDEB 4YFUA 3MEDA 3W2WB 4OYIA 4L75A 5D0HA 3NOGA 3Q8YA 4HYKA 1EP4B 4F36A 2MJNA 2BKNA 1VLOA 4B9VA 4R25A 2K2PA 2XS7A 5KOWA 3N6NA 1LW2B 4NCGB 2BJ8A 5A76A 3MMBB 4UQGA 4C11A 4EMDA 1S7IA 3Q24A 4DL7A 1UPMB 2C2NA 2QMWA 4ID5A 2QSFA 2F8MA 3KG1A 2H54B 2C2OB 2HAFA 4CM0A 4FDFA 2B7BB 2ZD1A 2CDRB 2R4FA 4O4GB 4LIWA 5EUHA 4E0DA 3ELHA 1IM4A 2G1DA 1FCAA 5CQGA 2EFNA 3PDNA 1W25A 1DARA 2AWZA 5BYQA 1PG5B 2HQFA 2UVVA 2MHEA 4WCEQ 1S1TA 1K0VA 4MMOA 5GAHI 4USIA 1NDLA 4LR7A 4RW9B 3CIMA 3EGNA 3DKDA 1XNQJ 2XLKA 3PX0A 3PYDA 4PWUA 2UXDJ 1BUXA 2VDIA 3KJVB 5A8KB 2GX8A 4MIBA 2XGQA 1E6YB 1ZAXA 3DRSB 4KIAA 2CJQA 2ZM6F 1DTQA 2FJEB 4UT4A 4Q0BA 1FDNA 1ZBTA 3RW7A 4OV6A 3ENQA 3CCMS 3OJSA 4JI1F 2R8HA 1N5QA 3HHKA 4KV8A 2HVEA 5MAOA 1LWXA 2XMTA 2IM3A 3VGSA 2BBEA 2CNLB 4KH1B 5CD4A 2MQQA 4NYPA 3TAMB 5KFCA 1CJTB 2BUNA 4WJBA 4C9DA 1RT7B 3TUZC 2N4DA 2PFFB 4WBFA 3HO1A 4JBCA 4O3PA 1RXOB 3H2VE 3IR5B 4UUWA 4KHRA 2YWEA 1N32J 4DSEA 3MEGA 5L39A 4DG1B 3TA1A 5IV3A 3I0SA 4FXVA 1V5IB 4UZCA 2D41A 1GEHA 5KFJA 1KONA 4NL5A 1T9TA 3D28A 2CQ3A 3GU0A 3JTOA 3TQ1A 3J7Z5 2E1MC 1RB0A 6FDRA 4F26A 2NPIA 3T9ZA 3AB2B 1NUEA 4QBUA 2Y3YA 3ZTQA 4JYAJ 2BQ3A 4A4JA 4F2RA 1NXIA 3T1HJ 3JSMA 3BSNA 5I3QA 2MDAA 2EW9A 5HP1B 2DY1A 4P2MA 2DK2A 2ZZNA 4TYBA 2ASJA 2OTJS 2P6SA 4ALZA 1PYSB 4P2SA 2PGCA 4NXMF 1R0AA 1YG0A 1REVB 2XO7A 1PIEA 3RB4A 1UMJA 3BN7A 3FVYA 4ECUA 3GV8B 5F3ZA 4QWBA 2C3UA 3WBZA 1OY6A 3POTB 3BM7A 4RUCA 2F5GA 1U6FA 1KOHA 1NDCA 2IMOA 4RUAA 1U25A 2V50A 3MM9A 3GFXA 3K57A 3UI3A 2KH9A 1WG5A 1FXDA 4RPFA 3QRQA 5AJ3F 2DGUA 2VKRA 2LECA 2V94A 3B6BA 3ENVA 4QR0A 2R8IA 3KXDA 2AGQA 2F4FA 2LQJA 5ETRA 3UR0A 1T95A 2M7SA 4M95A 3OFHA 2VUGA 4ED1A 2B56A 2NYIA 2CPEA 2QIFA 4RBVA 2ZJRQ 3A8EA 4CH0S 2RNEA 4LRAA 1DQ9A 4CLSA 2I2YA 4B9SA 4M5LA 4F7VA 2OJ3A 1YRTA 1WWHA 1FT8A 4ZVEA 3PIOQ 1RAGB 2CZ4A 1AT1B 2OLWA 3TARA 4LFBJ 3W3SA 3MR2A 2DPIA 4FF3A 2AEFA 2WB1D 3KLHB 3G87A 5L8RC 3OV7A 3VWSA 2RT3A 2W2OP 4M5GA 3LP0A 4FKXA 1IM6A 1VR6A 2XCPA 1U1MA 3AFGA 2FHMA 2LDYA 2PSZA 4TN2A 4K5SA 4JI3F 3ZNUA 4C7QA 4G6VB 4YQWA 1XR5A 3QLHB 4RR5A 2XMJA 3DOMB 3DLKA 3WQPA 2IC3B 3K2YA 1B0TA 4DL4A 3PYEA 3KNGA 3EUNA 3D0GE 1FKAF 2VICA 2AIRB 2QLBB 5ETKA 4OFZA 1S7HA 2K3KA 2XY7A 1ACMB 4NLXA 4QIWD 4DV2F 2DJWA 3MAHA 3C2PA 4Z2XA 1WSVA 4RW6B 3AJ2A 1KN6A 1XQIA 3AQOA 2BQUA 4PG5A 2CPFA 3G71S 4XIUA 1FX4A 4ZVRB 1C1BA 3I5CA 1D9FA 3DGPB 2I9SA 3PTWA 4CO1A 5I3UB 2R7SA 3W5YA 2QMUB 1IJEB 1LXJA 2KKHA 2JEGA 1YRUA 2XS2A 1DURA 4DL0C 1RT5A 2HQDA 3US5A 1QVGR 2VG5B 5G0RB 4FVMA 3M2VA 2JOQA 2YNHA 3OVAA 2AF6A 2E7VA 2QV6A 1XERA 9ATCB 1HBMA 1V3RA 5E2QA 1S0VA 3NS5A 4L74A 1WC1A 4CTAA 1RWMB 5KFOA 3A12A 2J5AA 2LQBA 3LGMA 1NBEB 4K5RA 1QSLA 1YZ7A 2QA4S 1Y5IB 2HFZA 1DFDA 1RCOB 4J9MA 5GAGI 1HWLA 4ZDNA 3FMBA 2ALZA 2YWFA 4JI8F 1OPIA 4J37A 3TVZA 2H65B 3QYYA 4QOTA 1NSQA 3W66A 1U47A 1HBUB 4ECSA 4J9UE 1TL7B 3C6TA 2N3OA 3P5TL 5AE3A 1ZYQA 3DOKB 2LP4A 4CM2A 5LOQA 1NHVA 3VV2B 1U4BA 3OHAA 2GS8A 4R0EA 5C7PA 2GFFA 3THPA 3RAQA 3IXQA 4IG3A 3QRRA 1VDHA 1WG4A 3C14A 1CQNA 3IRWP 1FI4A 3PX6A 1N5SA 1FVQA 4H4OA 2V6AA 3HKZD 1JLFA 3TZYA 3TJAA 1T03A 4PUOB 5KT7A 3M4XA 2ABYA 3W60A 2LQ9A 5DLGA 2CQIA 5CCMA 2WTFA 4ECXA 1X4HA 4OHYA 4DQRA 1LNQA 1A6LA 4ZPVR 4CNYA 5D4PA 1HNIA 4B3SJ 5A2QU 4IOBA 2I8EA 2FHOB 3DU5A 1D1UA 3U1MA 3OXLA 3N79A 4M5KA 4LF8F 2BJ1A 3AJ1A 5HO4A 2O3DA 2FIUA 2ATCB 2IVMA 3KTQA 4OZ0A 5HVHA 4J9QA 4PABA 2IYIA 2DRBA 4A8KA 1Q95G 2YTCA 1XMBA 4GVLA 2OEMA 3NXZA 2ROEA 2W8LA 2HNZB 3I87A 1ZH5A 1HNXJ 4DWIA 4NLDA 3W9JA 3G4SS 3M2RA 4NI2A 2W9CB 1FRXA 3JXOA 3G6XA 2R3VA 4RW4A 3OLBA 2G1HA 4KHPF 3T5LA 2CPHA 5LMNJ 1JLQB 4OHWA 2ZWPA 4DR2F 1NHUA 1FRLA 1NNDA 2K1RB 4JYAF 6AT1B 2NXEA 1G1XA 1S9EA 4ZCMA 4ZK7M 1MU2B 3ITHA 3HHNB 2MY7A 1V5VA 3CCSS 3UDLA 3IO1A 5DZ7A 2IJRA 4ANCA 3AD9C 5D4LA 4TQRA 1XBWA 2K7KA 1PKUA 4NMXA 3NAHA 4M5MA 3D68A 1S12A 2FVQA 1LW0A 1JJCB 2BYCA 1RABB 2VIHA 2E9TA 3CJSA 3HSJA 1F3FA 4OYBA 2X3GA 1RA6A 3HVAA 1WD6A 4ETXA 4C8MA 3NGRA 3LWLA 3CJ8A 2YXLA 3RBZA 3QPIA 1M1HA 4WP3A 2BX6A 4DPOA 5I42B 2VQFJ 5DETA 3T19A 1PAUB 4LT6A 3F73A 2BOAA 4K4ZA 3RRGA 3DLEA 3HHLA 2RIJA 4MK7A 1Y11A 3O3LA 4X64J 4B3MJ 1LWCA 3VHQA 4DCOB 4ES1A 5DDRC 5D0RA 3SEOA 1JIHA 3KFWX 1RBLA 1Q0NA 4X4TA 3R2CJ 3NBPA 2AX1A 1D9DA 2J76E 3C15B 2BW7A 1XMOJ 3OT9A 1UFWA 1U2FA 2EI5A 3M2UA 1HNZJ 2M88A 2DITA 5CYQB 3MR7A 1T05A 1TVRA 1SUQA 5EWGA 2ILYA 2V2VA 3CD6S 2Z57B 2HIQA 5DGAA 5LMUJ 2WAQD 1R43A 4YOEA 2RQ4A 4V19J 1MWYA 3NGKA 5CZXA 4DI6A 2W4DA 3PIPQ 3MCMA 3RBEA 1GH8A 2DRAA 3LGNA 3CD0A 3T1YF 1N5YA 2M4MA 4KGKA 3AXKA 1IKXB 4LF2A 4X4NA 2XMVA 2KHCA 1H74A 2GHVC 2PN6A 2ZD1B 3KG0A 2JH3A 1XMQJ 4ZCKA 1SJ1A 2B9XA 1VQ6S 2W25A 5HVGA 2NXNA 2P9EA 1S6QB 4NLUA 5IXUA 4DV5J 3AD8C 2E5IA 4LF4J 1PGZA 2BJ7A 2O1PA 2GMLA 4USTA 1S1WA 2KM8B 4FYVB 4LMZA 1YJ9S 1ZTWA 2H3EB 2Z0GA 2VPYB 4DX6A 5GAHU 2BJEA 1AYEA 3CJ4A 1GMWA 1N36J 2KXHA 4ZITA 1IKVB 1TL3B 4NYZA 2KO1A 2HLTA 3ISND 2F4VJ 4OJ1A 1RQ0A 5E3CA 3MF5A 3IAS9 2QL9B 3UN3A 2E5HA 1NK8A 3GE9A 1S1VA 2CPIA 1HHTP 1YWXA 1WEYA 3M6VA 4OJGA 4AXIA 1C0TB 3AA8A 4B9TA 4CWBA 4UTGA 5HMWA 4ZVPB 2AV5A 3NEKA 2ZITA 2CWKA 3NCQA 1VBZA 3S01A 4ED0A 3ZTRA 1T0TV 4KPYA 1C4CA 2M0GB 2BA9A 2L9NA 1CVJA 3T9NA 1YZ6A 3TZXA 2D9OA 5LT5A 2UUAJ 1JK9B 3MEGB 1NKBA 4CT9A 4DQIA 2MKCA 1P1TA 1WI6A 3FSYA 1FKPA 3R7SB 1JLBB 2ZH1A 4ZHRA 5RUBA 2CJBA 2JX2A 5DS7A 3PKYA 2B6AB 1R31A 4DR3J 2DCUB 5HBMB 5HN0A 2HIYA 4CZCA 1Q53A 2WRMA 3QAUA 1NKCA 3IBWA 3BJYA 2DR9A 2QEXS 4K59A 1MMNA 1S4EA 2CQCA 2BANB 2DNLA 2VASA 3GFHA 1UVJA 5A0YB 2F9JA 1W2BR 2L48A 1CS4A 5L46A 4IFVA 4AD6A 2LLZA 4PG7A 3HVWA 4ZP7A 4P74A 3VAFA 1RT3A 2OP5A 3PRVA 4NZ6A 3RU0A 2N4CA 1NO8A 1RTJA 2IPOB 1B7FA 4WKYA 4GKKJ 2FJVA 1CULB 1GTEA 1X4GA 1BQNA 4ZVQB 1FD8A 4V1Ak 5E3RA 5IWAF 1IBKF 1RKIA 3S6EA 2PC6A 3HP6A 4KT0C 4O3OA 4BCAA 2RHSB 3CVKA 4LRDA 3LANA 2C3MA 4UZBA 3GTYX 4FKYA 5K8PA 1TAQA 3M30B 3BSAA 2Z4PA 1VK8A 2GHWA 4O4RA 4NLTA 3PJWA 4R0JA 2OTLS 1X9WA 3ISZA 1UZHA 5HLFA 1X4FA 4USVA 3HCXA 4EEYA 1FKOA 3X3UA 2AJQA 1RAAB 3HMJG 4IR9A 5AXNA 1A9NB 2XLIA 1ZPWX 1IUJA 3HJFA 2V4RA 5DM6Q 1NK6A 4MKVA 2VKZG 2EFPA 2QO3A 4PWDA 3LAMA 2LEAA 3PW0A 4KYZA 4Q2LA 1HLWA 3NY0A 3EM1A 4ID8A 3KHGA 3PW7A 3A8IA 3HK2A 2GVDA 1VQOS 3OTOJ 3MR5A 1VRQC 2RILA 1O5JA 4DSIA 3MM6A 1S72S 3EVWA 2AHOB 4NA1A 4OX9J 2VL1A 4HDGA 4KGVB 4FXWA 3ZZZA 3KG4A 3HVTA 4QQBA 3AD7C 2XEXA 3W2VB 5EDWA 4L76A 2E9RX 2MEWA 2V4JB 3OVSA 2R7TA 4KGXB 2NXCA 2FHJA 1S5ZA 1VQ9S 4DV1J 3OUYB 3MD3A 3CB4A 2DR5A 2RHQB 4WE1B 1N52B 3D1OA 1SCJB 5KG4A 2QLXA 2HRTA 5GAEI 2O01C 4PKDB 3IG1B 1XIQA 1TAUA 2K7JA 2RDDA 1Y4ZB 2FQQB 3PNIA 2UXBF 1QM9A 3DLKB 3PXGa 1S6PA 3TI0A 2NSCA 4X65F 3K58A 5L1IA 3P96A 4KR0B 1RLCL 1JXVA 1U48A 2MZTA 4DQSA 4B3MF 4DL5A 4CO0A 3HSZA 2X7IA 2OFGX 3FCVA 3SQGB 5FJ4A 2MQPA 3ILOA 1L3SA 1OY9A 1SKSA 2VC1A 4YY3F 3KHHA 2UUBJ 2LU1A 3RB0A 1BY9A 2VZ9A 2D3ZA 1VIXA 3DMJA 1QY7A 2G0IA 3W64A 2YQ3A 5D77A 5A8WB 1RYSA 4DV0J 4CYUA 2G2YA 1AA1B 1NPRA 3HHEA 4DSLA 1FD2A 1U0HA 3CXCR 3QQCD 4O0NA 3MGJA 3MR6A 3KK2A 1PJ6A 1IKWA 4ZJLA 4USHA 4TXSA 2HGMA 3T1AA 1HL6A 3BO4A 2L08A 3CC4S 3I55S 4JV0A 3U27A 2YX4A 2IBOA 3OSPA 2WONA 3IWNC 5IT9Y 3MPVA 1X0PA 2B5JA 1TTHB 4CTAB 4YS2A 2EXUA 2X1GA 4C3KA 4WK3A 3M9MB 3D6FB 5DM7Q 4GRSA 2DGXA 3D54A 4QYRA 2DVIA 3PRBA 2MLZA 4F25A 1XMQF 3MEEB 2R8KA 2NSBA 2ERRA 5B0FA 3EE3A 2FVCA 2HWIA 4DV7J 4JUZA 2JC0A 3N5BA 1IBLJ 5D78A 1AUDA 1E6VB 2CIMA 3OTBA 3MHYA 4KFBA 1R0BG 1VFJA 1Y7PA 2E44A 5GAGU 1G6BA 3GP9A 1PILA 1DLOA 1FVSA 3MTKA 2IIHA 5D8HB 2A10A 4WF9Q 1HBOB 2E5GA 4I2PB 4NA2A 2HURA 2C2MB 4DN9A 4YR0A 4F4KA 3M9NB 4IG3B 4ZPWR 1L3TA 1VCTA 2Z2MA 4MYUA 1JLEA 1T3OA 2MYFA 2XMAA 2QA2A 1JLFB 1OSCA 2F4VF 1KQKA 3J81U 1S6UA 1WTFA 1U26A 4UUXA 4IG0A 3JAMU 2DHAA 3GILA 4ED3A 1HNIB 5KT6A 3NNHA 2MKSA 2KRRA 2H5EA 2LXIA 4PXEA 1WF0A 1NJYA 1UETA 1JMTA 4HH1A 2YH1A 3HFZB 2HKEA 4ZVGA 4U7UK 2DH7A 3MFIA 4EYIB 1RT2A 1B3TA 2YNIA 1NZ8A 3G86A 1GQEA 1F9EB 2IAJB 1RAEB 3DNCA 2FLLA 1GXLA 3T6JA 4RUBA 4DOZA 1FEEA 2XBPA 5D0GA 4JV5J 4FVCA 2XY5A 3MFHA 1S0NA 4N7TA 1MMLA 1FK9A 2OPRA 2AGOA 4ED8A 5KG0A 3SIPB 4WZQA 3G8QA 3H5SA 1XTZA 1WOPA 2V0NA 4NI2B 1YI2S 2CUYA 3R8YA 3E01B 4KKOB 2E7WA 2LYVA 1R8HA 1H3DA 2WVEA 5LM7E 2CG8A 3GIIA 4LFCJ 4WP8A 1L3KA 2IM1A 4AXJA 3ZZ0A 2I5JA 4OLOA 4OYPA 3CCQS 1F1BB 2UU9J 2H5IB 5M2RA 1JQGA 4ZP6A 2RE1A 2GC8A 1DZ5A 2B7CB 2K8GA 4N56A 2ZE2A 1RT1A 2CQPA 3Q8UA 1TQLA 2KFZA 3HVRA 4CI0B 1EKSA 1QAYA 3HHLD 3A3NB 5BJRA 3B54A 1OQ3A 2YWWA 1Y00A 2KVQE 2HHWA 2AJFE 4ZP8A 2XS5A 1G4CA 3I5BA 1N6QB 1ROFA 4P7VA 2KL8A 4F67A 2JL9A 1F0XA 3IMQJ 3HI9A 5FLXU 3FZ2A 2HNDA 1BWEA 1WG1A 4ZVHA 2HMIA 1K44A 3AODA 4CNZA 3W8PA 3BBBA 3F41A 4AL7A 4I68A 4LUBA 1Y5LB 1KHVA 4J90A 2VPZB 2CG4A 4R8UB 1J5OB 2KFNA 5CH7B 2R7RA 4QR2A 2B4UA 4IDKA 2FUG9 2GIRA 1KD1T 2V9KA 4WFYA 1VRTB 5D4OA 2P9GA 3WIVA 2IYGA 2QYCA 2APOA 4IUFA 1JKHA 4MH8A 1KR4A 3LWMA 1XJWB 2WOMB 5F0UA 3WHIA 2Q6CA 1RU2A 4ZCLA 2EC2A 1S77D 2QLWA 2D7SA 4HTIA 4ZPAA 3X1LB 4B3TJ 3GJQB 4K0KF 5SUHA 2QGFB 3SDEA 3PO5A 3W2WA 4A47A 3M2UB 3Q8SB 4LF5F 2PT0A 4PG6A 1KEKA 1EP4A 1SBRA 2CVEA 3DDIA 3OHBA 2DNGA 1VS3A 4X4RA 2WZ1A 3DLGB 2MQLA 5C25A 4NCGA 1LW2A 5KFIA 3K5PA 2M8HA 3MMBA 2OPPB 2VC0A 5H1SV 3QWUA 2D69A 3J81Y 3UDVA 3KLIA 4AL5A 3W7BA 2ZBIA 2H1YA 3BGOP 3LGHA 1J27A 2VF3A 2YNGB 1MN9A 5B0EA 1XNRJ 2B9YA 5ETLA 3VR1A 2YPYA 4O0IA 1FA0A 3SCIE 2C3PA 1FJGJ 1WF1A 4EFAC 4EO8A 2HFUA 2BRLA 4NLOA 2UUTA 1KTQA 1H7XA 4ZVSB 1LK7A 3W62A 4RW9A 1KLMB 1I1GA 3BV8A 4I7FB 4NXNJ 3AAWB 4IH7A 4LJMA 4U95A 2QRRA 3D3BJ 3KJQB 4OJHA 3RTVA 4NMLA 3CCUS 2FY8A 1IWGA 5EGYA 1F9HA 4Y00A 2MQ8A 3KJVA 4N41A 5A8KA 2ACMA 2XQCA 5E0OA 1ZM4A 2DHHA 2AU0A 1HMVA 2XULA 1E6YA 2MGZB 4CLZA 3UW1A 3M8RA 3GYNA 2VDHA 3DRSA 4C6AA 2BEFA 1FE4A 2UUBF 4XO0A 3EXYA 2YY3A 1UWAA 3DRRA 3Q8QB 4DUZJ 1CLFA 3BSCA 4HEA9 4IO9Q 3KK1A 3MPYA 1X0FA 3LP2B 4G3IA 3BKTA 4YR2A 2MLYA 3TAMA 2EKYA 1BLUA 4KO0A 3VAJA 1RT7A 2YKAA 2HGNA 1NJWA 3THVA 4TU8A 3W1YC 1TK5A 1RWXB 3CC2S 2PI4A 2HEKA 2P6TA 4DG1A 4U7UD 4DFJA 3RRHA 5CYMB 2RF2B 1IBMF 2KRBA 2BW2A 1YIJS 5LJ3Y 3DYAB 4KRWA 2XGPA 4AQYF 3AOAA 1TK8A 1HARA 1TKXB 3MR3A 1AUSL 2HHTA 4USWA 3GB0A 4J9NA 3HM9A 3NP5A 1VQSA 1VBYA 1IXKA 1LKZA 4C8ZA 2BV3A 5HP1A 4Y3CA 1EHWA 4P7TA 4B3OB 1XK8A 1LXNA 3TJ8A 1SB6A 3K59A 3JQKA 5CXTA 1H0HB 3MOZA 3ENWA 1AZSB 4BWMA 3GLJA 4K4YA 4S0MA 4JI0J 2NXUA 3WZ0A 1CSJA 3GJRB 2BKPA 2ZH6A 1REVA 2GV1A 5LL6d 3A1YG 2CQBA 4DFPA 4YHHF 3QT8A 2HVIA 4FS2A 3LH2S 1BQNB 1TP7A 4CRJA 4X66F 1NK0A 2BJ3A 2EG1A 5C2CA 1F60B 3LP1B 4Y6IA 1UW9A 3D5MA 5KFTA 2Z8QA 3H59A 3J7AN 4WTYA 4F4AA 2EBEA 2J9CA 3NCPA 4X2BA 4MIWA 3P3DA 1ZA2B 3DOLB 3BH6B 1ZPVA 4ECRA 5ETVA 1SKRA 4RWXA 2Y0BB 2XC9A 1OO0B 5H9FJ 4ED5A 2YWKA 2R9LA 2R7UA 3QJJA 3DLBA 4FBTA 5HLFB 3TA0A 2FJXA 1SL2A 2BJ9A 4LFAJ 4RLEA 5C42B 1S1XA 5HMZA 4A48A 1UVLA 2FHJD 5D4NA 4U7CA 5GVQA 4AL6A 4LFCF 3FMWA 4I6YA 2WW4A 4OI2A 3ZZTA 3PEJA 5KFDA 4I2QB 2WSFC 1PC4A 1NSPA 4NZ7A 2UU9F 2XSFA 4A8XA 3UDEA 5F9NA 5IQQA 2XI3A 4FBUA 4JI4F 4H4MA 2B43A 3KMSA 4KGZB 1HA1A 2XNRA 1WORA 4DQQA 2V68A 3KLHA 4W4MA 2HZCA 3TA2A 3ZZUA 2AGPA 2FVRA 2IJNA 3PFEA 1UJ4A 2J0SD 3S1TA 4H4KC 1U02A 2H48B 3CPWR 1H7WA 1I94F 1U1PA 3NS6A 3QT6A 3RAXA 1SQFA 2B4PA 2MZRA 3WC0A 1FESA 3QSYB 2MQNA 3H0PA 3GSDA 3Q2TC 4U8YA 1IQTA 1HQEB 3UR3C 1Z4UA 3QLHA 2DNRA 5DQGA 1VGYA 3TP2A 3DOMA 2JC1A 4KH0B 5A8RB 4QYZJ 3OR2B 2IC3A 3BBCA 4C0OC 2UV8A 1W26A 3UN2A 1KFSA 4LR9A 2G4BA 1QTMA 3R5GA 4FNHA 3KUEA 1S6PB 2FLOA 4L3NA 3HT3A 2BE9B 2I0XA 1HHQA 1MNEA 4NLGA 1YKWA 2KXFA 5GAEU 2HVZA 1QSYA 4RW6A 4N8NA 2R2UA 2V67A 1T8EA 3CMAS 5CA5A 3FEXB 3P4UB 5JVGQ 2AKWB 1GNKA 7AT1B 4NE9C 4I67A 4YDXA 2ZM6J 3DGPA 1Q81T 3DMJB 2B9WA 4ZIVA 2MKHA 4IOCQ 2P2CB 1U1QA 2HBRB 3MECB 3UO0A 4V19X 4JI1J 1Y9OA 2J7KA 3CSKA 2RS8A 3P8BB 3P6YC 2VG5A 5G0RA 1SC6A 4CT8A 4C8YA 3KK2B 1G3OA 3I82A 5C24A 3VGVA 2HVHA 1PJ5A 1ZOTA 5K14B 1SC4B 2ZC4A 4PQAA 2DNPA 1TKDA 3D6HB 4I69A 3UE2A 1R7IA 4CDIA 3M6WA 4F4XA 5E33A 3Q22A 1RJJA 3H2UB 2B4OA 4C8OA 5ITHA 3KWMA 3PV8A 4ECQA 2YKOA 2UV8G 2JLEA 1EETB 3UVJB 3DLLQ 2M8DB 1X4CA 2ILZA 3EVMA 3CD7A 5KG7A 2CPXA 3K8VA 1P6TA 1TL7A 3SFUA 4QWCA 2PI5A 2RKIB 4MTPA 3K5NA 3M6UA 1RAIB 5IC6B 1D0EA 1VIOA 3KNAA 1REGX 3DOKA 3MWBA 1F3VA 4IRDA 1ZM3A 4DL6A 1U2CA 4O3NA 5HI7A 2BABA 4NEZA 1B0VA 4GC7A 1LFWA 3GR1A 1W7WA 4U9RA 1N5TA 4ER8A 4PUOA 1TKTB 2HZVA 1SPBP 4NLYA 4PQUA 1JLEB 3VAIA 1NSAA 4NXMJ 1JJ2R 4RJVA 1KOOA 5AXLA 2V2KA 5J1EB 4C3MA 2KG0A 2CQ4A 1C0UB 4IG0B 2ZDOA 3PYFA 4DV4F 1FTCA 4WTOB 3R7BB 2J9EA 1Q5YA 4JB8B 4DZDA 4ZVTB 4H4KA 4QIEA 2QTWA 2MKKA 4DF4A 2E1AA 3HD1A 3DHXA 5B0CA 2CJYB 2PMZD 1B0PA 5AJ3J 3TO8A 1MMDA 4RW8B 3NRBA 3L4BC 2GIQA 5DDPC 3W8GA 1U1KA 2ASLA 4MK9A 2KM8C 2ZUGA 2W9CA 4LF6J 5D6GA 5J2MA 2OPRB 4HI1A 4DFMA 3VVTA 1PYOB 2V8HA 4DSJA 6FD1A 1JLQA 5DZ6A 4RW7B 3MPUB 3FGVA 1Q8LA 3MM7B 2UXCF 3G8SA 2XYGB 1EQMA 2GVZB 4NPOA 4WFBQ 4JI7F 5H9FK 3MMCB 1MU2A 4QU6A 1LV5A 5DG9A 3GYGA 4OZ5A 2P5VA 3HPOA 3TR5A 1JLGB 4OI6A 2MJUA 1B99A 2OEKA 1RT1B 3SCJE 2ZUAA 4JI0F 1IN0A 1OYEA 3TUJC 5BR8F 2R8GA 4WZMA 4OI4A 2DNHA 2NCKL 3SCKE 4ILMA 2LQ8A 3QT5A 2AMCB 4X4VA 1HWIA 2GCFA 2DY9A 5B0DA 2QC3A 8RUCA 3W63A 2KXNB 5CD4H 2VFTA 1L3UA 4PAAA 1SL1A 5I42A 4JI3J 2HNYB 3NG8A 2BXJA 2HMIB 1ZAWA 1NLKL 1DQ8A 3PFOA 1PJ7A 1U7LA 3ISNC 1M5OC 1ITPA 3EX7B 2G0JA 4W92B 3HX9A 3V6HA 1AROP 4I1TA 4O3QA 4DV2J 1SIWB 2ZZMA 4QYZK 4QPXA 4YR3A 4HVZA 2V8VA 2A0FB 2AX0A 4ED7A 1R6VA 4MKBA 1NJXA 1U1LA 3C15A 1YGYA 3MEKA 2IY5B 1Y10A 3AHPA 1Q8KA 1UVMA 4NCAA 2XMKA 3C8YA 2WB4A 4F0MA 5CYQA 2PIIA 4FXDA 3TZWA 3Q86A 3C3LA 4JV1A 1RTHB 3MTJA 1FRMA 4HACB 5L9NA 5C25B 3BREA 1S6OA 2UZAA 1RZMA 2V34A 3K5MA 2GJFA 4ZS6A 2Q66A 1QJHA 3FUYA 1XC9A 2V8GA 2VQEF 3KUHA 3H42A 1IKXA 4ZJOA 3BQ1A 3KLIB 3VGUA 3G96A 2YKNB 1FDBA 2ZBRA 2RQCA 2GQ2A 2LA4A 2R7QA 3H90A 1OYDA 2LEBA 3EGWB 4JI8J 1S6QA 3AOCA 2CNKB 4J91A 2XWYA 2AEMA 2AJ4A 4M94A 2VG6B 4OHZA 5J1NA 1NK5A 4OZ3A 1JNZB 2OMLA 1N56A 1J2VA 4C8NA 3BGUA 4A8SA 5E3PA 4Y2KA 4LSNB 3EDRB 1JXLA 3SBMA 1GXTA 1RI7A 2ACYA 2HS0A 5DG8A 4CLYA 3FRZA 1HMVB 3QGGA 2HHXA 1IKVA 2IA0A 1TL3A 4Y2AA 4FZVA 4PXCA 2NYHA 3BS9A 1D8YA 1ULRA 3QBCA 4DR1F 5ETMA 5IM0B 3F0NA 1VQ7S 1U1NA 3ZTOA 4DN0A 1U0SA 3DRRB 4ZVFA 3RG6A 3BR8A 1SQEA 1ZM2A 3VQSA 1KVIA 1NAQA 4OYOA 5MLCV 3KK1B 1C0TA 4F8RA 4IFYB 3D9BA 4FS1A 2CQGA 4LF8J 1UJ6A 4KO0B 4TLRA 2L9WA 4I56A 2PA8D 1NRKA 1UCNA 3P45B 1UPPA 2CFXA 2QG9B 3THTA 3TYTA 1EKRA 1SQGA 5CABA 3RBDA 4DUYF 5KG1A 4DL2A 3FSIA 4OI1A 2HQGA 2CJXB 2QJ3A 3BKFA 1FEHA 1FE0A 2XM3A 1JLBA 3MMAB 4X62F 2IMWP 4F0KA 5I4MA 3SZ2A 4URQU 2XY6A 3KLVA 4Y0FA 2Z2LA 4EI2A 2B6AA 1VQ4S 5HBMA 5KG5A 2VHGA 4KHPJ 2VV5A 1KQFB 1U8WA 3IP0A 1CC8A 4GVBB 4DR2J 1WHWA 2KYXA 1RSCA 2BANA 4WFAQ 1SJRA 2KJVA 3TEHB 2NQPA 2BACA 4EGLA 5A0YA 5KT4A 1JLAB 1MWQA 5HJXA 2GMHA 5EN1A 3D7SB 1Q4RA 2JFKA 4NLRA 2IDLA 1BQMA 4OV1A 3VZIA 4KTQA 2J0QD 4ICLB 4ZIWA 2X1BA 2ZH9A 1QDUB 1VQMS 1HQ2A 1TMMA 4ZLNA 1S9FA 4EUVA 1CULA 1HQUA 2XI2A 4OYXA 1NB7A 1UVKA 1KDNA 3KK3A 2C2DA 3BH7B 5IQ6A 2RB7A 2QSWA 1MN7A 5T7LB 3M30A 1VJQA 2RMLA 2VPXB 3ETOA 3BGRA 4ZPBA 3M9OB 2X1AA 4OHVA 2ZHBA 3OL7A 3Q89A 2E9ZA 2AQ4A 2FTRA 1TKZB 4WYWA 3A13A 4PEOA 4OI3A 1NJZA 3L7PA 3KJFB 4LF6F 2DNZA 4KSEB 1ZM9A 1HD0A 5C5JA 1AB8A 3N28A 1S1XB 4ED6A 2FGOA 1K1QA 2HS3A 3CJKA 1FNMA 5H9EJ 2Y8YA 2EFGA 1WC0A 5J2NB 3SV3A 2IVFB 4RX6A 2NZCA 4JI6F 3OBIA 3NGDA 3M8WA 4XAKA 1FO1A 2JRSA 1BXNA 3V81B 4MKYA 2BM1A 2LFVA 4HI2A 2W1BA 1FTRA 1FDAA 4DFKA 4H4MB 1RP5A 4G1QB 4LVNP 2XSJA 4BS2A 2MPUA 2JVOA 3IFEA 3K5LA 3W2VA 4U67Q 2L9DA 3PR4A 2C2KB 4ZPTR 2DGWA 2LEPA 2V4JA 4K7QA 1R27B 1L5UA 4Q8EA 1SXLA 1EZZB 3UCZP 2OD6A 3J7YU 1SV5B 1T7PA 3OUYA 3T1YJ 1RAFB 3R6GB 2W4PA 4WE1A 4EYHB 3EZUA 5ETOA 3QIDA 4QIFA 3CIZA 2D1CA 3MD1A 1X5TA 1PCAA 2LXFA 3FDSA 3QIPB 1P27B 2ZVIA 3TUIC 1NH7A 2V2ZA 2DTJA 3IA0A 1QTNB 2WVFA 3IG1A 3CJ5A 2GIFA 3SSSA 3Q83A 1V9OA 3GFYA 4NWBA 4Z7CA 2OEJA 2Z2ZA 2ZEJA 2F9DA 2ZH5A 1WKLA 5GMEA 2JNJA 4K2XA 4ELUA 4CQ1A 4Y2IA 1CJUA 2PA3A 3CDBA 3R97A 3J80Y 2LXUA 4Q45A 3SQGA 4PRFA 2XZDB 3LA0A 1X9MA 2J9DE 1MROA 3UCGA 2Y1LB 2DNOA 5A8WA 2Z2YB 4W98A 3PO4A 2YBVA 1WOOA 5FDLB 4F3OA 2RRBA 3E3XA 1SL0A 3I96A 4J9PA 2DCLA 5F8LA 3CJ2A 2NR0A 1DBDA 4QW8A 4TNOA 3BKUA 2OIHA 1BGXT 2ASYA 2POKA 2WK4A 5C24B 3SMZA 4PG4A 1K47A 3R5BA 2DRDA 1TV6A 1H98A 1SIZA 3CUNA 1FRHA 2MMYA 1NH8A 5LSOA 2BJDA 3IWXA 1UW4A 4IQMA 3TW0A 3K0JA 1AW0A 3RJMB 1HI0P 2I1RA 1SI9A 3DCAA 4Z37A 3H40A 4B08A 2JEFA 2ZJQQ 2VU5A 3MEEA 4GKJF 3CCLS 3FEYB 3HHLC 2ZNZA 2J8AA 1U6BA 1E6VA 1NEEA 2FZKB 2FDNA 2HRYA 4Y34A 3OTDA 3W61A 3Q8RB 1FJ7A 2AJ0A 4JI5F 1UKUA 1HBOA 1LQ9A 4KC5A 5AE1A 1Q5VA 4I2PA 4LSLB 8AT1B 3LOUA 1WHVA 4YB6A 2YQ1A 3FBBA 5KG2A 3CCWA 3JQMA 1HW9A 4P75A 2G2ZA 1TL1B 1NKEA 2FJAB 4P71A 1T9VA 3O8WA 4PQUB 2EEYA 4QWEA 3I6PA 2XLJA 2RQKA 2Q43A 5IWAJ 4M5JA 1T94A 1IBKJ 3M8QB 3UD4P 4L6V3 2FJDB 3DN9A 1X5SA 4U8VA 4USJC 3L7UA 3G9CA 2FYXA 2K3IA 3O2IA 3F56A 1CJKB 2OPQB 1C4AA 1RHRB 3H5UA 2X3DA 3MM8B 3HSGA 2ZH4A 1RHQB 2DR8A 2IAJA 2KDOA 2XZTB 3QO9B 2I6WA 2IRYA 1FJCA 3B8HA 1FX2A 4DPWA 2MZQA 2W9BB 4UY8T 1X8DA 2RU9A 2GJIA 3FQLA 4LIRA 2ZBCA 4I6AA 4EWTA 2ZH3A 4TQSA 1SH3A 3E01A 5J2MB 4KKOA 2ADBA 4IKAA 2XZWA 1OSDA 3OVBA 2W24A 1YBAA 1B70B 1OWXA 2C3YA 4W90B 3OL9A 3MI7X 3MM5A 2XHCA 4K4SA 3TVKA 3KUGA 5U47A 4DPYA 1FFSB 2F1FA 1WKJA 3CD5A 3L09A 3NMRA 1R6YA 3UCUP 2RAQA 5M2PA 2FGCA 5K9FA 5HAOA 5KT2A 2OO4A 4OZ1A 3R7NB 5HK4A 1UZDA 2E1CA 2DBBA 4URSA 1GFWB 1I5OB 1G2EA 4USMA 1RTIB 2FZGB 5BYSA 3GR0A 2NZ4A 2HFNA 2GMJA 1N6QA 5H9EK 1FDDA 4ZMMA 4LBIA 3ETMA 1XWLA 3DI6A 1U6ZA 3KLFB 1OQ6A 2W7PA 3TAQA 3EMTA 3S8SA 4M5IA 2RSQA 1YJUA 2HHPA 3HXMA 2XMWA 5CHCB 1ELOA 5THWA 1X31C 3IRXA 1YHQS 5A6PA 2KT5A 2DB1A 4CLPA 2UUCF 4F4ZA 1RCXB 1NB2A 3D0HE 3V6JA 2UXBJ 4R8UA 2JLFA 3DDNA 5LSLA 1J5OA 2DD8S 4ETZA 1O0PA 3VZHA 4X65J 2DNKA 3AOBA 3ZTPA 3B4DA 3IBFB 3KLGB 4WFZA 3HFKA 5B09A 1VRTA 1RWVB 1S49A 1FJEB 2CXEA 2OAUA 3BF4A 1WF2A 2WOMA 1K1SA 4DR7F 4YY3J 2Z56B 2VONA 2B9EA 1Q8IA 2OPSB 2NREA 4ES3A 4OYZA 2CADA 2E5LF 5F8IA 2XHWA 1KQSR 4E98A 2GQCA 3MAAB 4UOHA 2IBKA 1B7YB 3DLGA 3ZNJ1 4G1IA 4NLWA 3MMJA 2W2QP 2OPPA 2LMIA 3MUVP 4IR1A 4OQJA 2YNFB 3GPAA 4LRBA 1U45A 2KG1A 4A46A 1T11A 4LF1A 5DDQC 2HAIA 1WHYA 3O1LA 2YNGA 3V4MA 3RGIA 4AE5A 4O3SA 2V8DA 3ZZRA 4OIXA 1N88A 1M5PC 3GJTB 5HROB 3UD5A 5KFNA 3DM2A 1X4DA 4Q5VA 1U1RA 1UVNA 2OHDA 3EICA 1VRUB 3CJTA 4YP3A 1HI8A 1KLMA 4I7FA 1CJVA 5HJYA 3A3PB 1HIYA 3GSIA 4DV3F 3KYLA 4XDDA 4AUKA 2F3JA 2VJUA 3KHRA 3PM9A 1KHWA 1LWFB 4FYDA 1HNWJ 3EPGA 2NXJA 1VI7A 2MGZA 3BB5A 4MYTA 1URRA 3GJSB 2JLGA 2R2RA 3NAIA 3QGPA 1CC7A 2PMHA 4USUA 3VAKA 1Q7LB 1WHXA 3SFGA 3MDFA 3GQCA 4EBDA 4C0BA 5J2PA 2CQ1A 2RJZA 3MOJB 1BC6A 3AB4B 3G2XA 1V6HA 3E2EA 4UY85 3CCVS 2MY8A 3ZC4A 3N01A 3EGZA 2M70A 1LWEB 3LP2A 4A8QA 3JTPA 2JEJA 1KQGB 3J7A1 2MKJA 1N5VA 2Z30B 3L9ZA 2W01A 3GMGA 4CLLA 2EWHA 2ZNYA 1UAWA 4UOCA 4UOFA 2CQDA 1S76D 2H9ZA 1S9GB 2V8PA 1WEZA 4IRKA 2O67A 3UPFA 1RAHB 2F8HA 3BBFA 4CLWA 4MK8A 2MQMA 2LKZA 2HWHA 3E51A 1C2PA 2JFDA 4MFBB 5CYMA 2RF2A 4MAKA 4P72A 5E41A 1J5EF 3T5JA 5LSRA 1RGVA 1FRIA 1H2VZ 3GV7B 2P9CA 4K50A 1KNZA 1UTAA 3DYAA 4DJBA 4CLUA 1TKXA 3BQ0A 2A18A 3NWRA 1JLCA 2ADCA 2R7OA 2YKQA 3TAPA 3WIUA 2IDEA 2OI2A 3LALA 4NLPA 1VOMA 1PC5A 4B9LA 4B3OA 3VCDA 4C97A 3ZXWA 5F41A 1AZSA 1HBNB 3R2DJ 5KFQA 1BQMB 1IWAA 3H7HB 4JI2F 1N0VC 2FD2A 3HSDA 3UNGC 3HKWA 5IT9U 2VBZA 4WXWA 2GZOA 2Q3PA 1HQUB 2OFHX 1FXLA 2N7YA 1FNXH 1RWNB 2OKQA 1S48A 2FVPA 4Q2MA 3KK3B 3LP1A 3LUYA 1S0OA 1VK3A 2OSQA 2IFXA 4QWDA 4DXLA 3DOLA 3G8TA 1JB0C 3BGRB 3R5CA 3BYPA 2P8IA 2V5HG 2QZ8A 3PR5B 1T02A 2EVZA 2DGTA 2Q79A 2EKNA 1WACA 1RTDB 3LW5C 3M8YA 3BGFA 1WC5A 5C42A 2VB6A 4WIQA 4Q43A 5JVHQ 4Z7YA 1D3WA 2AZ1A 2U2FA 1N33F 4DX7A 1SKWA 1KWMA 2DT9A 3I9V9 2GGPB 4I2QA 5JJBA 2NUUG 4EO6A 3M32B 3CJKB 5DQHA 4K0KJ 3TJ9A 1Y5NB 5HQLA 4CLFA 1UP1A 4I4BA 4LF5J 1VQNS 1TFWA 3B82A 1I6JA 1QE1B 2J7WA 1SJ3P 1CQMA 4QR1A 2WHOA 2XSJB 4DZ6A 2EPIA 2RS2A 2EK6A 2MB0B 2DNQA 5J2QB 3G82B 3BPDA 1RT4B 4WFXA 4USKA 5B0AA 5AT1B 1H72C 2HW3A 3PRDA 3BO3A 4P73A 2ZHAA 2VODA 1HQEA 5F9LA 3O5TB 5L1KA 3LTOA 3RAMA 5A8RA 4FYYB 3OR2A 2FVSA 5SZTA 3M6XA 2HYIB 3IN5A 4IQXA 4PYAA 4PPZA 1T9XA 2UP1A 1TR0A 4F0HA 2YPZA 3JB9k 3NKYA 2XMUA 1X7VA 1VQ8S 4WU3A 1CJUB 4KY3A 2ZHOA 4WXOA 3T6BA 2Y9HA 2HHUA 4YB5A 5BYRA 1CG2A 3K5OA 4A8OA 1YLXA 1WDDA 1MROB 5KFEA 2IM2A 3MECA 2BR0A 4HR2A 3LO3A 3BYRA 1HYSB 2UVRA 3CCES 1P9YA 1P9QC 3HT0A 4CO2A 3ICLA 3FKBA 4L3KA 1YX2A 3TZZA 2ZOGA 2VJVA 3FNNA 2BRKA 5KFZA 3H4DA 5F8MA 1RE1B 1NCLA 2C2ZB 2VG7A 2XMMA 5K14A 3U1NA 2F63A 4ILRA 2IRXA 5K8NA 4LF7F 3CNQP 1H2TZ 4QWAA 1TV6B 3DXBA 2AYBA 3I4PA 1TK0A 2RRNA 2R7VA 4B9UA 4LBHA 3U1LA 1M1KT 1RTZA 2DKOB 4NCBA 1DY3A 9RUBA
chains in the Genus database with same CATH topology
4GVBA 4GVBB 1KP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GVB A;  4GVB B;  1KP6 A; 
#chains in the Genus database with same CATH topology
 1OPZ A;  3CUL A;  1EET A;  3UVJ A;  3NGS A;  1IBM J;  2I38 A;  5KFG A;  2OD4 A;  2ZOM A;  1KVJ A;  2ZOF A;  4ZPD A;  3DRP A;  4A8Y A;  1HWU A;  2M9K A;  2BKO A;  5ETQ A;  4AQY J;  2MZS A;  2RKI A;  5KFW A;  5KTQ A;  2BE2 B;  4KPC A;  2JEI A;  2KJW A;  3JS9 A;  1XEZ A;  1HNW F;  2CQ2 A;  4HHU A;  1F6T A;  5DG7 A;  4RNO A;  1KP6 A;  2W9A A;  3QJL A;  2WBM A;  3LAK A;  1DTT B;  2PD1 A;  1KLN A;  1TKT A;  1H73 A;  5B7W A;  2JJ4 D;  3VAM A;  4QZV B;  4ZVO B;  3OFE A;  4O3R A;  3R6L B;  5AE2 A;  3I0R B;  5J1E A;  1HNV B;  4YHH J;  4OX8 A;  3ONQ A;  1C0U A;  3C16 B;  3GCX P;  1GAO A;  3FSX A;  4RWW A;  1FNO A;  4X66 J;  4NX9 A;  2GAH C;  4OYM A;  5K5M A;  2EFV A;  1HI1 A;  1U49 A;  2QA4 G;  3CJ0 A;  4WFN Q;  5CZV A;  2HHH F;  5F8N A;  2IJF A;  2YVS A;  1DJ0 A;  1T9W A;  3C6U A;  4L73 A;  1Q86 T;  1YJT A;  5DDO C;  3J81 j;  3ULH A;  4B02 A;  1XN9 A;  4ECZ A;  2X1F A;  4RW8 A;  2QL5 B;  2W7O A;  4J9R A;  3R5A A;  3DXS X;  4DS5 A;  2VFS A;  2V2Q A;  4WP9 A;  1S1U B;  4RKU C;  1APS A;  1YK9 A;  3JSR A;  3UD3 P;  1TL5 A;  3EGV A;  2CRL A;  5IT0 A;  3KLE B;  1VC6 A;  3LF0 A;  4FN5 A;  4RW7 A;  3GCW P;  4NLQ A;  1WDT A;  2B3T B;  3I9Z A;  2MXY A;  3MM7 A;  5F8J A;  1M5S A;  2C28 A;  3DLH A;  3ET6 B;  2GVZ A;  1RHM B;  3MMC A;  1WJ9 A;  1QUV A;  3MM5 B;  1M0S A;  1QAX A;  1JLG A;  3N6M A;  4C8K A;  2E66 A;  5K20 B;  4JI4 J;  1XNQ F;  1VBK A;  3AT1 B;  1RAO A;  1YJV A;  3QMQ A;  2UXD F;  3ILJ A;  4ZN3 A;  3DU6 A;  1WKK A;  1YDL A;  3VGT A;  3D0I E;  3BSO A;  5IZH A;  4LVO P;  4E2F B;  1X9S A;  3QT7 A;  5KFS A;  5D15 A;  5KFY A;  2L3M A;  1N34 J;  2N82 B;  2J9D A;  2GA7 A;  2XO6 A;  3D2W A;  2G0C A;  1DHM A;  1I94 J;  1ZET A;  3JYT B;  1PAE X;  4TY8 B;  1GX5 A;  2AJ1 A;  3DI6 B;  4ZVU B;  1RAC B;  1IKY B;  1BD6 A;  2ZDP A;  2HNY A;  1EQ0 A;  1G7C B;  2Z58 B;  1RBO B;  2DNN A;  3OL8 A;  1UWB B;  3H4B A;  1FWK A;  3IRX B;  3N0V A;  1VHF A;  4ZLL A;  2SXL A;  4NOH A;  2VBY A;  2GO8 A;  2DR6 A;  2DPJ A;  3AJD A;  4O44 A;  4DUT A;  1VJW A;  3DDK A;  3M05 A;  1CEZ A;  3M8S A;  4HLB A;  3OD2 A;  2V9W A;  4ECY A;  2YKM B;  3H2L A;  1R3N A;  1N32 F;  3EVO A;  2ZKU A;  4DBQ A;  1U09 A;  5KFM A;  3HUL A;  2AW0 A;  1RAJ A;  3OXF A;  5KFK A;  5LJ5 Y;  1H6K X;  4DR6 J;  3B78 A;  2LA6 A;  1U24 A;  2QE5 A;  4LBP A;  1GMV A;  2FC8 A;  3CCR S;  2W2N P;  2ASD A;  1YJW S;  2YH0 A;  4CO3 A;  4KGM A;  1TMJ A;  3FFI B;  1RTH A;  2LDI A;  1WC3 A;  2HLU A;  3SQO P;  3TWZ A;  3D67 A;  4HAC A;  4AYB D;  3EZO A;  3T1H F;  4HL9 A;  3H25 A;  1T9U A;  3M1V B;  4EK2 A;  1ZAV A;  3R27 A;  1D09 B;  2HHQ A;  5E7O B;  1X5P A;  3F44 A;  3VTI A;  1GMW D;  1P1L A;  3RB3 A;  4U96 A;  2YKN A;  2YQ0 A;  3QAE A;  1OY8 A;  4R5P B;  1IVZ A;  1S4F A;  3DM2 B;  2ZKT A;  4ZA1 A;  5C2G A;  3V4I A;  2IA6 A;  4PG8 A;  4QU7 A;  4NEY A;  1C1C B;  1UEU A;  2HQI A;  2HBZ B;  4ZPC A;  2VG6 A;  2MQO A;  2GO9 A;  3ILL A;  4F3M A;  3OXG A;  1CJV B;  5IFM A;  2EG2 A;  2W2M P;  4XDC A;  1JJ4 A;  1KKH A;  3M8Z A;  1LOU A;  1N4L A;  3RB6 A;  3UDC A;  3QZ8 A;  4CIO A;  4LSN A;  2C2E A;  2OH2 A;  1S79 A;  3QJP A;  1TUW A;  1NHK L;  2RD5 C;  3SSR A;  2ZH8 A;  3CCZ A;  3K89 A;  1ZZN A;  1K0T A;  1WEL A;  2DEI A;  3DFE A;  4FPR A;  5KFL A;  5IM0 A;  1PBA A;  4G1P A;  4ZLJ A;  5J2P B;  3W5X A;  4CO5 A;  1TU0 B;  4I64 A;  4M5D B;  4WK1 A;  4OYA A;  4AFF A;  3A4T A;  2OSR A;  4IFY A;  2DHS A;  4BHQ A;  4DU8 A;  1T3N A;  4U6P A;  1HPZ B;  5G4D A;  4PCQ A;  4DV4 J;  3AA9 A;  1M1G A;  3GIR A;  1KBR A;  3OR1 B;  2FHK A;  3CC7 S;  5HQ8 A;  2VH7 A;  2BZ2 A;  4UF4 A;  3IR6 B;  5D3G B;  3MED B;  1LEO A;  4B3R J;  2WCX A;  4X4P A;  3U7J A;  4TY9 A;  5EWE A;  3BEG B;  4LFB F;  2PO4 A;  3TNV A;  3CMQ A;  3N9U C;  3MMA A;  5L1L A;  4URG A;  2XWX A;  3KDN A;  5KFB A;  4C11 B;  5A2Q Y;  3FBE A;  3T41 A;  1I3O B;  1URN A;  4BWJ A;  4ID5 B;  3MPD A;  1MW7 A;  4Y2C A;  4OMF G;  3O44 A;  1NPP A;  1RUS A;  4KB7 A;  4C48 A;  4GVB A;  1NJI T;  1JLC B;  3G6E S;  2B4V A;  2UXC J;  3PJX A;  3I4H X;  2XYH B;  4QCL A;  4QW9 A;  1JLA A;  2GAG C;  3HLU A;  5KFP A;  2KZM A;  4JI7 J;  2XTJ P;  1S1T B;  2GHP A;  2YX7 A;  4TVA B;  4ICL A;  4ECT A;  1K9M T;  2CAJ A;  4KHM A;  2XCA A;  3KDO A;  2J6S A;  5F0W A;  1S57 A;  2WSC C;  4GO5 X;  4ELV A;  1BQX A;  1FFG B;  2KT2 A;  2KI2 A;  5BR8 J;  3FQK A;  3ZZP A;  2DH8 A;  4ATN A;  3QRP A;  3N6L A;  1YBT A;  5CYJ A;  5B08 A;  1EIY B;  3G6V A;  2HQ3 A;  4OI0 A;  1PBU A;  4UW2 A;  4WKR A;  4LF9 J;  4HT5 A;  4P10 A;  3CDW A;  3OFG A;  4RZR A;  1DTQ B;  5HSP A;  3PCO B;  1QAI A;  4Q0B B;  1ZA1 B;  1S59 A;  5T7L A;  1BWV A;  1TZ0 A;  5JXS A;  4Q7A A;  3M8P A;  1Q16 B;  4KV8 B;  3NS7 B;  4H54 A;  3BZQ A;  4A8M P;  1WI8 A;  1RAD B;  2HWT A;  1TKZ A;  2YWG A;  1VBX A;  3GZ7 A;  4NA3 A;  4RL1 A;  3NLC A;  4J9O A;  4I0W A;  2XYP B;  3Q2S C;  4NAS A;  4HHJ A;  3QNW B;  5E3Q A;  3OPK A;  5KFX A;  4FF2 A;  3I0S B;  3EDQ B;  3VQT A;  2R2T A;  1R89 A;  4OZJ A;  5J2N A;  1IR2 A;  2ZBQ A;  2X51 A;  2LVW A;  2H4Y B;  3IS9 A;  3D3C J;  3GG1 A;  3OFF A;  2WVD A;  5DQI A;  4RU9 A;  3HJV A;  2KN4 A;  3CCJ S;  3S7R A;  1RT6 A;  2K06 A;  4UQT A;  3V81 A;  3CJ3 A;  3FK4 A;  1I51 B;  1KTV A;  2HGL A;  2CJK A;  4G1Q A;  3PZP A;  4F2S A;  3CW2 C;  4BC7 A;  3BN4 A;  4AND A;  1IBC B;  3CT9 A;  1MLA A;  4DR4 J;  3TX8 A;  3JSM B;  3OLA A;  1SV5 A;  2VOO A;  3RR8 A;  1N34 F;  3CO9 A;  2VQE J;  2IRU A;  4XPE A;  3TOQ A;  2HFO A;  2D3U A;  3QIP A;  1SJQ A;  3AQP A;  1N0U A;  4O23 A;  3D6M B;  1RA7 A;  2AT1 B;  1R0A B;  4B3S F;  2ZFH A;  3DC2 A;  5L38 A;  5BXI A;  2OGU A;  5DJB A;  3BDP A;  4TLQ A;  1RDR A;  2CVI A;  4RBT A;  1EJ7 L;  2J0W A;  1JXE A;  1Y0H A;  4MJK A;  3QZ7 A;  1GMU A;  3EPI A;  4J9V A;  4B17 A;  1Q78 A;  4LSZ B;  3G6Y A;  3MM9 B;  1IR0 A;  2HVD A;  2PDA A;  4ELT A;  3FEZ A;  4DS4 A;  2MTL A;  1R8B A;  2DXD A;  2U1A A;  2JZ5 A;  1QUP A;  4BLG A;  5KFR A;  3QAT A;  2HBQ B;  4DR6 F;  1N8R T;  5FDL A;  3JSB A;  1CBK A;  4IO1 A;  1HNX F;  3JTN A;  1QSS A;  3IC1 A;  4NZ0 A;  2C22 A;  1JWW A;  3RW6 A;  3A8J A;  2MSS A;  4DR1 J;  1K8A T;  3D1H A;  1LFP A;  5LMN F;  1M5K C;  1O6X A;  3V6D A;  4KQZ A;  1VIS A;  3VF0 B;  2M52 A;  2PFD A;  5FII A;  4KBI A;  1NK9 A;  4J9L A;  2ROG A;  2VG7 B;  2FC9 A;  2O5D A;  2VBX A;  2CJA A;  1RKJ A;  4PXD A;  1RYR A;  2VBW A;  3WX4 A;  4DUY J;  4B9M A;  3UNY A;  2F65 A;  3Q8V A;  2DIU A;  3GG0 A;  2VA2 A;  3SV4 A;  4J9K A;  4YN3 B;  3HHD A;  1DRZ A;  4ITS A;  5DO2 A;  4X62 J;  4ZKA A;  3ENA A;  1U1O A;  2L41 A;  1EX8 A;  3CJR A;  2C2R A;  3DRP B;  3KJN B;  1R8A A;  3GWC A;  3N4W A;  1OMS A;  2FLP A;  1S99 A;  1TUG B;  2BOP A;  3LP0 B;  4J5O A;  2VQF F;  2DGQ A;  4I6W A;  4LSL A;  2IHR 1;  2H4W B;  5GAD I;  4XK8 C;  3HZE A;  2R42 A;  4GMK A;  5IC4 B;  2DYA A;  1AFJ A;  2AEJ A;  5ETS A;  3LPY A;  5KFV A;  3FBF A;  2MLX A;  4PWW A;  4X64 F;  3RR7 A;  1TL1 A;  3CO0 P;  3ILI A;  2HK3 A;  4C2M A;  1YTY A;  3UFC X;  5KFA A;  3L7O A;  5EHH A;  1M90 T;  1X5O A;  2HPU A;  3M8Q A;  3PHE A;  1O51 A;  1UA0 A;  2ZZT A;  1M5V C;  1F9F A;  5HL7 Q;  1C1B B;  2DNM A;  1XMO F;  3KMQ A;  1CJK A;  1HNZ F;  2OPQ A;  4FYW B;  1RHU B;  3MM8 A;  1HR0 J;  3EJM A;  1S0M A;  4N5S A;  4NLV A;  3C6U B;  4B3R F;  3QO9 A;  3TQE A;  1RT5 B;  4DSK A;  2FZC B;  1PSD A;  4A8F A;  2DHG A;  5KFU A;  3HF5 A;  3M2V B;  5LMU F;  2YNH B;  2W9B A;  2PE8 A;  4MIA A;  4OJ3 A;  3R1H A;  1F5A A;  4P2F A;  1HBM B;  4K4V A;  3ADA C;  4LRF A;  2OEL A;  3RBX A;  3OJU A;  1R8P A;  3H98 A;  4JP8 A;  1WC4 A;  3MUT P;  2MST A;  3R3T A;  3AY0 A;  2ZH7 A;  3D6T B;  4DV5 F;  3I31 A;  1OJ4 A;  4JI6 J;  1S10 A;  4KE5 A;  3CDU A;  2HZA A;  4LF4 F;  1WTB A;  5E3A A;  4DV6 J;  1KC8 T;  2NPF A;  5DGB A;  5J1P A;  3C6T B;  4JV2 A;  5HMX A;  4Q8F A;  3T5K A;  4PYD A;  1RTI A;  2BMB A;  3GON A;  2J8S A;  2R8J A;  2CKW A;  4M1K A;  5F8H A;  4ECW A;  4TU7 A;  1CPZ A;  2RVJ A;  4ILL A;  1X4A A;  1N36 F;  3C14 B;  5EWF A;  3CDE A;  3BDE A;  4LF9 F;  2LQ5 A;  2G13 A;  3KLF A;  2QX0 A;  5K8M A;  4H4O B;  3VAH A;  2R7W A;  1T03 B;  3DHW C;  1RWK B;  2MZ1 A;  2UUW A;  2HSE B;  5CCL A;  4M63 A;  1DQA A;  2O66 A;  1SH2 A;  3QGH A;  5B0B A;  2RUS A;  4M5N A;  4K4X A;  3SXL A;  1F5B A;  2C3O A;  4ZN1 A;  1K73 T;  3QFH A;  2A3J A;  3V5R A;  1WUU A;  5KFF A;  4YDD B;  3KLG A;  2JWN A;  2EFO A;  1HFE L;  4ED4 A;  4O44 B;  4DQP A;  4CLK A;  2GQQ A;  4OX7 A;  5LXR A;  4PPD A;  3OQ2 A;  3ZO7 A;  3FC9 A;  3BQ2 A;  2UUA F;  2DGO A;  5HAT A;  3CCT A;  2OPS A;  2DIV A;  2NUH A;  4EU0 A;  2H51 B;  1TEL A;  3M2R B;  2AP6 A;  5EX3 A;  3FCW A;  1NME B;  4DR3 F;  3MAA A;  1RHK B;  3PEH A;  3GIM A;  4RW4 B;  4F50 A;  3B4M A;  2VFR A;  4OYW A;  1Z2Z A;  1Q79 A;  1F5C A;  1HWJ A;  2EK1 A;  2YNF A;  1IQZ A;  4OL8 A;  3K7R A;  2XB2 D;  2CDQ A;  1UJ5 A;  2AD9 A;  2Q1L A;  4DR4 F;  1S9E B;  3IM9 A;  4M5H A;  1NDP A;  2AYE A;  4ENO A;  3ITH B;  3KHL A;  2DIS A;  1F2G A;  2AYG A;  1FRJ A;  3P5B P;  3GYX B;  5HRO A;  3EYZ A;  5IS2 A;  1O8B A;  3IGN A;  2FY1 A;  5KT3 A;  3W9H A;  4GKK F;  4GKJ J;  2BVZ A;  1HHS A;  2W2P P;  1VRU A;  5ETT A;  1LW0 B;  3V4I B;  1YRX A;  3TUP A;  2UVW A;  4RNN A;  2HG4 A;  2KVI A;  1JNR B;  4YUD A;  2WVC A;  2KFY A;  1LWF A;  4WYL A;  1V3Z A;  4HT7 A;  4RNM A;  3RRK A;  4JI5 J;  4CH1 A;  2J0X A;  2KT3 A;  3PYG A;  4IH5 A;  2CWX A;  1VQY A;  1FER A;  3D66 A;  2R7X A;  1X60 A;  4J9S A;  3I32 A;  2GNK A;  2BE7 D;  3MZI A;  1VC5 A;  1GTH A;  2DNY A;  1BE4 A;  1Q82 T;  3DLE B;  3MCO A;  3UQS A;  3HHL B;  1UVI A;  4DLE A;  3OL6 A;  4CH7 A;  1LWC B;  3VAG A;  2C1E B;  4J7C A;  1TUV A;  4OZL A;  1LWE A;  4E8U A;  3W65 A;  3R5D A;  4NRU A;  3CED A;  3CE8 A;  5M2U A;  5IV4 A;  5GMD A;  4DX8 H;  4DF8 A;  2W7A A;  4EBC A;  3NBP B;  1Z2L A;  1S9G A;  4ZCI A;  4GO7 X;  1LK5 A;  5F8G A;  4HDH A;  3OTO F;  2VPW B;  2IVY A;  3VVU A;  3GV5 B;  2JDJ A;  3R1L A;  4OX9 F;  2KB2 A;  3C66 A;  1T05 B;  3N5F A;  1TVR B;  1SUQ B;  4MFB A;  3JSY A;  4DPU A;  2A1B A;  3E8O A;  2D3O 1;  3GIJ A;  1NM2 A;  3H8Y A;  5FD1 A;  4DHV A;  1EAR A;  2DGS A;  2OMO A;  2Y0S D;  2M3D A;  4X4S A;  3J80 U;  2KYZ A;  5ETN A;  3JAM Y;  4F4Y A;  4DV1 F;  1N5Y B;  4O4G A;  4FF1 A;  5HMY A;  5A6W A;  4DCP B;  1R8C A;  4CP5 A;  3CDA A;  4C4W A;  4P52 A;  2CQ0 A;  1RWO B;  1UEV A;  1FWP A;  4KAI A;  3MAQ A;  4NYO A;  5KT5 A;  4QJV A;  2NLW A;  4BDP A;  3NMA A;  5T14 A;  1HBN A;  3PKM A;  4RU2 A;  2FPH X;  2E5J A;  5F3T A;  5L1J A;  1A0O B;  2E29 A;  1KS2 A;  1YSJ A;  4K2J A;  1S1W B;  1YJ7 A;  4Y28 C;  1X4E A;  2CYY A;  3H20 A;  4RNF A;  4F4W A;  1WOS A;  3R5J B;  1SH0 A;  4PZV A;  8ATC B;  3NNC A;  4ECV A;  1UFL A;  2N3L A;  2CZ9 A;  1D9A A;  4CCH A;  1HWK A;  4DV0 F;  1UFK A;  1VYA A;  2GW8 A;  3L3C A;  2VA3 A;  2VOP A;  3NL0 A;  3QSI A;  2JVR A;  3W5Z A;  3WC2 A;  4ANE A;  2WBR A;  3CWJ A;  4OX6 A;  1HR0 F;  3EWG A;  2QFJ A;  4LRE A;  3RUB L;  3M8P B;  1A7G E;  2WVB A;  1RU1 A;  2UUC J;  1ZZF A;  3A8K A;  3IAM 9;  2ALY B;  1CJT A;  1S1V B;  2HFV A;  1IJF B;  2A2C A;  1Q8B A;  4DL3 A;  1VMB A;  5HQM A;  4D3H A;  1RTD A;  2V69 A;  4PXB A;  5KOX A;  2FJW A;  3AXM A;  4EZ9 A;  5IT4 A;  1F2H A;  3UWT A;  1RLD A;  2FJB B;  3MUM P;  5FLX Y;  1MWZ A;  4IYQ A;  3OSN A;  2DO0 A;  2DXF A;  2ZJP Q;  2EBG A;  2DO4 A;  4YME A;  1V3S A;  1SVD A;  2BM0 A;  2M2B A;  4DR7 J;  4P2X A;  3VAL A;  2GGP A;  4RO0 A;  1KVK A;  2IM0 A;  3PG9 A;  2V63 A;  4OZN A;  3H5X A;  3M32 A;  4DV7 F;  2RQM A;  1FKP B;  4LQ9 A;  3BR9 A;  2G9O A;  4ZHR B;  1IBL F;  3IS9 B;  3LPE A;  2V4Q A;  2AYM A;  1UEK A;  4XTT A;  2E5L J;  1FHT A;  2D3O R;  3V2U C;  1RT6 B;  4DV6 F;  2WW8 A;  1YIT S;  1QE1 A;  3FZB A;  3AH6 A;  2B8Q A;  2NS1 B;  4DDF A;  3T3F A;  4WII A;  3IWL A;  4K4W A;  1BHN A;  1IR1 A;  5J2Q A;  2RU3 A;  3G82 A;  4ERD A;  1FRK A;  4P6Q A;  2KU7 A;  3TAN A;  1RT4 A;  5JUM A;  2KTQ A;  4BBY A;  2AJ2 A;  4TU9 A;  1CS4 B;  4NRT A;  4DCJ B;  4IFV B;  4M8L A;  2F7V A;  2A6M A;  2G2O A;  1WSR A;  2PEB A;  1RT3 B;  3CME S;  2FLN A;  2EC0 A;  4WU2 A;  1YVF A;  3IGV A;  4NLS A;  3RZA A;  1RTJ B;  2W4C A;  2H5J B;  4DPX A;  3NGU A;  3NWG A;  4FPI A;  3RYL A;  5KG3 A;  3NOC A;  3ZTS A;  3MPW A;  3POT A;  1ZTT A;  3CF5 Q;  3HDS A;  4CLT A;  5CAA A;  2CA9 A;  3A3O B;  1HD1 A;  2QLJ B;  1KFD A;  2XG8 A;  3PX4 A;  2ZWO A;  3PJ9 A;  2VFU A;  4DV3 J;  1SC1 B;  2QT7 A;  3ZFV A;  3QGI A;  2QYG A;  1SJ4 P;  4ED2 A;  2B51 A;  1HW8 A;  1M5H A;  1FXR A;  4X84 A;  4MT1 A;  2GJ2 A;  4BC9 A;  4EBE A;  4ZOS A;  3ZZY A;  3GIK A;  7FD1 A;  1D8Z A;  1H38 A;  2CZV C;  4JV5 F;  2MZJ A;  4A8W A;  2CNO B;  2ZC3 A;  1FKO B;  4DX5 A;  3QFW A;  4DR5 J;  1HYS A;  1YBU A;  2F8E X;  5I3P A;  4UOG A;  4Y2M A;  2R2S A;  4F04 B;  4WPA A;  2CPJ A;  1W2I A;  3M7V A;  3FCH A;  4B9N A;  2HHS A;  2WSE C;  4X4Q A;  3V6D B;  2PEH A;  1B64 A;  2OUG A;  2HQC A;  4QIG A;  5DLF A;  4PWD B;  1SKU B;  1ZS6 A;  2HK2 A;  1VQK S;  3PW4 A;  3J7Y I;  2CPY A;  1XR6 A;  4K8R A;  2GVD B;  1Q7Y T;  2W8K A;  3K17 A;  4HKQ A;  3MM6 B;  2HBY B;  2EFQ A;  4DSF A;  1YJR A;  4RUH A;  1UA1 A;  1FWL A;  1R0C B;  5B0G A;  2HFS A;  3HVT B;  1J5E J;  5AXM A;  5KAK A;  5IOL A;  3MCS A;  3TEG A;  4D3G A;  3HD2 A;  2E7X A;  1TFY A;  3CTR A;  4G65 A;  1QVF R;  2BE2 A;  4QIV A;  1PO6 A;  3L95 X;  4OHX A;  2QA1 A;  2N7C A;  4X4O A;  1VHI A;  2RDI A;  2XNQ A;  4DMZ A;  3PY8 A;  4F3Q A;  4JOU A;  4IOA Q;  1QLN A;  1Q1K A;  1DTT A;  3IR7 B;  3PW5 A;  2COL A;  1N54 B;  1AXQ A;  3UN5 A;  5L9X A;  1NDK A;  3OTC A;  4X4U A;  2ZBP A;  3BGL A;  4JI2 J;  4RNH A;  5KFH A;  2ROP A;  3I0R A;  1HNV A;  2B8P A;  5GAD U;  3C16 A;  5HVF A;  1NK7 A;  3V6K A;  3CGI A;  5JMN A;  4C8L A;  1RK8 A;  4TYA A;  4F02 A;  1PYT A;  1U8S A;  5I3U A;  4PR6 A;  4B3T F;  4CYU B;  1VC0 A;  1FFW B;  2YX1 A;  1U0H B;  4N76 A;  5E5N A;  3MUR P;  1IKW B;  3TX0 A;  5GMK a;  1QAJ A;  3PHT A;  4IRC A;  4DLG A;  3OTE A;  1S1U A;  5EX0 A;  2C42 A;  3KKF A;  2WON B;  1VQP S;  4DU7 A;  2M5Y A;  3SCL E;  1JX4 A;  2B5J B;  2DEJ A;  3KLE A;  3CJQ A;  3SYZ A;  2FB0 A;  1XNR F;  2BDP A;  5LXY A;  1N33 J;  1FJG F;  4GC6 A;  4OLP A;  3ET6 A;  3PAC A;  3IM8 A;  1HBU A;  4ZJQ A;  1P8G A;  5T41 A;  1EB0 A;  5KG6 A;  4NXN F;  3T5H A;  1SJF A;  4C0H A;  1TL4 A;  4Q44 A;  1UL3 A;  1NSK L;  4WWS A;  2KZZ A;  3C46 A;  4KFB B;  2QN6 B;  2MHN A;  1DLO B;  2DR7 A;  1L3V A;  2ZVS A;  2MKY A;  1OS5 A;  1GX6 A;  1HKA A;  3H5Y A;  3PW2 A;  4N8O A;  3Q8P B;  4YB1 P;  3W9I A;  4ZP9 A;  2J6T A;  2F40 A;  2J6U A;  3JYT A;  4TY8 A;  3SSQ A;  1RHJ B;  2HRU A;  3U02 A;  4KJI A;  1KRP A;  1NK4 A;  1IKY A;  4DUZ F;  3OW2 R;  1RIS A;  3R9L A;  1VQ5 S;  4XPC A;  2QLF B;  1UWB A;  2CPZ A;  1QD1 A;  4P9S A;  1NPK A;  3QWP A;  4YB7 A;  1ICE B;  1MSW D;  7FDR A;  4IH6 A;  4HH0 A;  2Y1I A;  1NU4 A;  2DGV A;  2QL7 B;  4N47 A;  5ADZ A;  1N48 A;  3FJ2 A;  3FRY A;  5HAN A;  3O6Q A;  1GXU A;  3PVX A;  2YKM A;  2A2D A;  3Q0A A;  1KSP A;  4LRC A;  1VLY A;  2CPD A;  4FP9 A;  2CQH A;  4YEA A;  1JJH A;  1FF2 A;  2YKP A;  2CNN B;  4LQ3 A;  1RT2 B;  3D1Q A;  2YNI B;  1BMQ B;  4K4U A;  2RRA A;  3IBC B;  1YJN S;  2HNZ A;  1OIA A;  1WEX A;  3BO2 A;  2VD3 A;  2Y1J A;  2QMX A;  4FF4 A;  1H2U X;  2RUG A;  3LQV A;  2Y1R I;  1FK9 B;  4FYX B;  3TVY A;  1Z1Z A;  3K8W A;  3KOA A;  3FFI A;  1WC6 A;  5D0E A;  4DPT A;  3DLJ A;  1RWU A;  4K4T A;  2MKI A;  3Q23 A;  2K1R A;  3DRY A;  3HFV A;  5ETP A;  1DAX A;  5AXK A;  3M1V A;  1RBA A;  2I5J B;  4FNI A;  4LF7 J;  2KHD A;  3C19 A;  1SC3 B;  1X4B A;  4OZ2 A;  2PMW A;  4HTJ A;  2DHX A;  2DXE A;  3WDO A;  4RBU A;  2Y8W A;  2ZE2 B;  2JSX A;  1AFI A;  5DRK A;  1YQH A;  4LR8 A;  4C98 A;  4DEZ A;  4R5P A;  2LCW A;  3NCR A;  3J7Z T;  1Y3J A;  3WX8 A;  1C1C A;  2D74 B;  1NZA A;  3EXC X;  4TKT A;  3DGV A;  3TRG A;  1S97 A;  3NGT A;  3GFZ A;  3P49 B;  2RDJ A;  3HZG A;  2DH9 A;  1XR7 A;  2E1R A;  2ATL A;  3D4J A;  2HND B;  1T9Y A;  2A6O A;  4L72 B;  3BPS P;  4QPT A;  2B0G A;  2RH3 A;  2ZH2 A;  4HHH A;  3JQJ A;  3FBC A;  4Y65 A;  4ES2 A;  4N77 A;  3SI8 A;  2JHE A;  4C3L A;  4ZLP A;  1GT8 A;  2VFV A;  1Y3K A;  5K8O A;  3EZ5 A;  2BQR A;  4DR5 F;  2Q6B A;  3DRX A;  4IDK B;  4LFA F;  2J7U A;  2UVU A;  1RWP B;  4EZ6 A;  4M5D A;  3MXH P;  3I5A A;  1WNE A;  2YWH A;  1JKH B;  2D9P A;  3ZZO A;  1U2R A;  4CO4 A;  3MCN A;  2HHV A;  1HPZ A;  1EAY C;  4MKA A;  4AT1 B;  3NNA A;  3OR1 A;  1VQL S;  2E1P A;  2AZ3 A;  2CJ9 A;  1B4S A;  2LU2 A;  2HHH J;  3I56 S;  2HS4 A;  5D3G A;  1MG7 A;  1RWW B;  2QFI A;  1GK8 A;  3SDE B;  4YFU A;  3MED A;  3W2W B;  4OYI A;  4L75 A;  5D0H A;  3NOG A;  3Q8Y A;  4HYK A;  1EP4 B;  4F36 A;  2MJN A;  2BKN A;  1VLO A;  4B9V A;  4R25 A;  2K2P A;  2XS7 A;  5KOW A;  3N6N A;  1LW2 B;  4NCG B;  2BJ8 A;  5A76 A;  3MMB B;  4UQG A;  4C11 A;  4EMD A;  1S7I A;  3Q24 A;  4DL7 A;  1UPM B;  2C2N A;  2QMW A;  4ID5 A;  2QSF A;  2F8M A;  3KG1 A;  2H54 B;  2C2O B;  2HAF A;  4CM0 A;  4FDF A;  2B7B B;  2ZD1 A;  2CDR B;  2R4F A;  4O4G B;  4LIW A;  5EUH A;  4E0D A;  3ELH A;  1IM4 A;  2G1D A;  1FCA A;  5CQG A;  2EFN A;  3PDN A;  1W25 A;  1DAR A;  2AWZ A;  5BYQ A;  1PG5 B;  2HQF A;  2UVV A;  2MHE A;  4WCE Q;  1S1T A;  1K0V A;  4MMO A;  5GAH I;  4USI A;  1NDL A;  4LR7 A;  4RW9 B;  3CIM A;  3EGN A;  3DKD A;  1XNQ J;  2XLK A;  3PX0 A;  3PYD A;  4PWU A;  2UXD J;  1BUX A;  2VDI A;  3KJV B;  5A8K B;  2GX8 A;  4MIB A;  2XGQ A;  1E6Y B;  1ZAX A;  3DRS B;  4KIA A;  2CJQ A;  2ZM6 F;  1DTQ A;  2FJE B;  4UT4 A;  4Q0B A;  1FDN A;  1ZBT A;  3RW7 A;  4OV6 A;  3ENQ A;  3CCM S;  3OJS A;  4JI1 F;  2R8H A;  1N5Q A;  3HHK A;  4KV8 A;  2HVE A;  5MAO A;  1LWX A;  2XMT A;  2IM3 A;  3VGS A;  2BBE A;  2CNL B;  4KH1 B;  5CD4 A;  2MQQ A;  4NYP A;  3TAM B;  5KFC A;  1CJT B;  2BUN A;  4WJB A;  4C9D A;  1RT7 B;  3TUZ C;  2N4D A;  2PFF B;  4WBF A;  3HO1 A;  4JBC A;  4O3P A;  1RXO B;  3H2V E;  3IR5 B;  4UUW A;  4KHR A;  2YWE A;  1N32 J;  4DSE A;  3MEG A;  5L39 A;  4DG1 B;  3TA1 A;  5IV3 A;  3I0S A;  4FXV A;  1V5I B;  4UZC A;  2D41 A;  1GEH A;  5KFJ A;  1KON A;  4NL5 A;  1T9T A;  3D28 A;  2CQ3 A;  3GU0 A;  3JTO A;  3TQ1 A;  3J7Z 5;  2E1M C;  1RB0 A;  6FDR A;  4F26 A;  2NPI A;  3T9Z A;  3AB2 B;  1NUE A;  4QBU A;  2Y3Y A;  3ZTQ A;  4JYA J;  2BQ3 A;  4A4J A;  4F2R A;  1NXI A;  3T1H J;  3JSM A;  3BSN A;  5I3Q A;  2MDA A;  2EW9 A;  5HP1 B;  2DY1 A;  4P2M A;  2DK2 A;  2ZZN A;  4TYB A;  2ASJ A;  2OTJ S;  2P6S A;  4ALZ A;  1PYS B;  4P2S A;  2PGC A;  4NXM F;  1R0A A;  1YG0 A;  1REV B;  2XO7 A;  1PIE A;  3RB4 A;  1UMJ A;  3BN7 A;  3FVY A;  4ECU A;  3GV8 B;  5F3Z A;  4QWB A;  2C3U A;  3WBZ A;  1OY6 A;  3POT B;  3BM7 A;  4RUC A;  2F5G A;  1U6F A;  1KOH A;  1NDC A;  2IMO A;  4RUA A;  1U25 A;  2V50 A;  3MM9 A;  3GFX A;  3K57 A;  3UI3 A;  2KH9 A;  1WG5 A;  1FXD A;  4RPF A;  3QRQ A;  5AJ3 F;  2DGU A;  2VKR A;  2LEC A;  2V94 A;  3B6B A;  3ENV A;  4QR0 A;  2R8I A;  3KXD A;  2AGQ A;  2F4F A;  2LQJ A;  5ETR A;  3UR0 A;  1T95 A;  2M7S A;  4M95 A;  3OFH A;  2VUG A;  4ED1 A;  2B56 A;  2NYI A;  2CPE A;  2QIF A;  4RBV A;  2ZJR Q;  3A8E A;  4CH0 S;  2RNE A;  4LRA A;  1DQ9 A;  4CLS A;  2I2Y A;  4B9S A;  4M5L A;  4F7V A;  2OJ3 A;  1YRT A;  1WWH A;  1FT8 A;  4ZVE A;  3PIO Q;  1RAG B;  2CZ4 A;  1AT1 B;  2OLW A;  3TAR A;  4LFB J;  3W3S A;  3MR2 A;  2DPI A;  4FF3 A;  2AEF A;  2WB1 D;  3KLH B;  3G87 A;  5L8R C;  3OV7 A;  3VWS A;  2RT3 A;  2W2O P;  4M5G A;  3LP0 A;  4FKX A;  1IM6 A;  1VR6 A;  2XCP A;  1U1M A;  3AFG A;  2FHM A;  2LDY A;  2PSZ A;  4TN2 A;  4K5S A;  4JI3 F;  3ZNU A;  4C7Q A;  4G6V B;  4YQW A;  1XR5 A;  3QLH B;  4RR5 A;  2XMJ A;  3DOM B;  3DLK A;  3WQP A;  2IC3 B;  3K2Y A;  1B0T A;  4DL4 A;  3PYE A;  3KNG A;  3EUN A;  3D0G E;  1FKA F;  2VIC A;  2AIR B;  2QLB B;  5ETK A;  4OFZ A;  1S7H A;  2K3K A;  2XY7 A;  1ACM B;  4NLX A;  4QIW D;  4DV2 F;  2DJW A;  3MAH A;  3C2P A;  4Z2X A;  1WSV A;  4RW6 B;  3AJ2 A;  1KN6 A;  1XQI A;  3AQO A;  2BQU A;  4PG5 A;  2CPF A;  3G71 S;  4XIU A;  1FX4 A;  4ZVR B;  1C1B A;  3I5C A;  1D9F A;  3DGP B;  2I9S A;  3PTW A;  4CO1 A;  5I3U B;  2R7S A;  3W5Y A;  2QMU B;  1IJE B;  1LXJ A;  2KKH A;  2JEG A;  1YRU A;  2XS2 A;  1DUR A;  4DL0 C;  1RT5 A;  2HQD A;  3US5 A;  1QVG R;  2VG5 B;  5G0R B;  4FVM A;  3M2V A;  2JOQ A;  2YNH A;  3OVA A;  2AF6 A;  2E7V A;  2QV6 A;  1XER A;  9ATC B;  1HBM A;  1V3R A;  5E2Q A;  1S0V A;  3NS5 A;  4L74 A;  1WC1 A;  4CTA A;  1RWM B;  5KFO A;  3A12 A;  2J5A A;  2LQB A;  3LGM A;  1NBE B;  4K5R A;  1QSL A;  1YZ7 A;  2QA4 S;  1Y5I B;  2HFZ A;  1DFD A;  1RCO B;  4J9M A;  5GAG I;  1HWL A;  4ZDN A;  3FMB A;  2ALZ A;  2YWF A;  4JI8 F;  1OPI A;  4J37 A;  3TVZ A;  2H65 B;  3QYY A;  4QOT A;  1NSQ A;  3W66 A;  1U47 A;  1HBU B;  4ECS A;  4J9U E;  1TL7 B;  3C6T A;  2N3O A;  3P5T L;  5AE3 A;  1ZYQ A;  3DOK B;  2LP4 A;  4CM2 A;  5LOQ A;  1NHV A;  3VV2 B;  1U4B A;  3OHA A;  2GS8 A;  4R0E A;  5C7P A;  2GFF A;  3THP A;  3RAQ A;  3IXQ A;  4IG3 A;  3QRR A;  1VDH A;  1WG4 A;  3C14 A;  1CQN A;  3IRW P;  1FI4 A;  3PX6 A;  1N5S A;  1FVQ A;  4H4O A;  2V6A A;  3HKZ D;  1JLF A;  3TZY A;  3TJA A;  1T03 A;  4PUO B;  5KT7 A;  3M4X A;  2ABY A;  3W60 A;  2LQ9 A;  5DLG A;  2CQI A;  5CCM A;  2WTF A;  4ECX A;  1X4H A;  4OHY A;  4DQR A;  1LNQ A;  1A6L A;  4ZPV R;  4CNY A;  5D4P A;  1HNI A;  4B3S J;  5A2Q U;  4IOB A;  2I8E A;  2FHO B;  3DU5 A;  1D1U A;  3U1M A;  3OXL A;  3N79 A;  4M5K A;  4LF8 F;  2BJ1 A;  3AJ1 A;  5HO4 A;  2O3D A;  2FIU A;  2ATC B;  2IVM A;  3KTQ A;  4OZ0 A;  5HVH A;  4J9Q A;  4PAB A;  2IYI A;  2DRB A;  4A8K A;  1Q95 G;  2YTC A;  1XMB A;  4GVL A;  2OEM A;  3NXZ A;  2ROE A;  2W8L A;  2HNZ B;  3I87 A;  1ZH5 A;  1HNX J;  4DWI A;  4NLD A;  3W9J A;  3G4S S;  3M2R A;  4NI2 A;  2W9C B;  1FRX A;  3JXO A;  3G6X A;  2R3V A;  4RW4 A;  3OLB A;  2G1H A;  4KHP F;  3T5L A;  2CPH A;  5LMN J;  1JLQ B;  4OHW A;  2ZWP A;  4DR2 F;  1NHU A;  1FRL A;  1NND A;  2K1R B;  4JYA F;  6AT1 B;  2NXE A;  1G1X A;  1S9E A;  4ZCM A;  4ZK7 M;  1MU2 B;  3ITH A;  3HHN B;  2MY7 A;  1V5V A;  3CCS S;  3UDL A;  3IO1 A;  5DZ7 A;  2IJR A;  4ANC A;  3AD9 C;  5D4L A;  4TQR A;  1XBW A;  2K7K A;  1PKU A;  4NMX A;  3NAH A;  4M5M A;  3D68 A;  1S12 A;  2FVQ A;  1LW0 A;  1JJC B;  2BYC A;  1RAB B;  2VIH A;  2E9T A;  3CJS A;  3HSJ A;  1F3F A;  4OYB A;  2X3G A;  1RA6 A;  3HVA A;  1WD6 A;  4ETX A;  4C8M A;  3NGR A;  3LWL A;  3CJ8 A;  2YXL A;  3RBZ A;  3QPI A;  1M1H A;  4WP3 A;  2BX6 A;  4DPO A;  5I42 B;  2VQF J;  5DET A;  3T19 A;  1PAU B;  4LT6 A;  3F73 A;  2BOA A;  4K4Z A;  3RRG A;  3DLE A;  3HHL A;  2RIJ A;  4MK7 A;  1Y11 A;  3O3L A;  4X64 J;  4B3M J;  1LWC A;  3VHQ A;  4DCO B;  4ES1 A;  5DDR C;  5D0R A;  3SEO A;  1JIH A;  3KFW X;  1RBL A;  1Q0N A;  4X4T A;  3R2C J;  3NBP A;  2AX1 A;  1D9D A;  2J76 E;  3C15 B;  2BW7 A;  1XMO J;  3OT9 A;  1UFW A;  1U2F A;  2EI5 A;  3M2U A;  1HNZ J;  2M88 A;  2DIT A;  5CYQ B;  3MR7 A;  1T05 A;  1TVR A;  1SUQ A;  5EWG A;  2ILY A;  2V2V A;  3CD6 S;  2Z57 B;  2HIQ A;  5DGA A;  5LMU J;  2WAQ D;  1R43 A;  4YOE A;  2RQ4 A;  4V19 J;  1MWY A;  3NGK A;  5CZX A;  4DI6 A;  2W4D A;  3PIP Q;  3MCM A;  3RBE A;  1GH8 A;  2DRA A;  3LGN A;  3CD0 A;  3T1Y F;  1N5Y A;  2M4M A;  4KGK A;  3AXK A;  1IKX B;  4LF2 A;  4X4N A;  2XMV A;  2KHC A;  1H74 A;  2GHV C;  2PN6 A;  2ZD1 B;  3KG0 A;  2JH3 A;  1XMQ J;  4ZCK A;  1SJ1 A;  2B9X A;  1VQ6 S;  2W25 A;  5HVG A;  2NXN A;  2P9E A;  1S6Q B;  4NLU A;  5IXU A;  4DV5 J;  3AD8 C;  2E5I A;  4LF4 J;  1PGZ A;  2BJ7 A;  2O1P A;  2GML A;  4UST A;  1S1W A;  2KM8 B;  4FYV B;  4LMZ A;  1YJ9 S;  1ZTW A;  2H3E B;  2Z0G A;  2VPY B;  4DX6 A;  5GAH U;  2BJE A;  1AYE A;  3CJ4 A;  1GMW A;  1N36 J;  2KXH A;  4ZIT A;  1IKV B;  1TL3 B;  4NYZ A;  2KO1 A;  2HLT A;  3ISN D;  2F4V J;  4OJ1 A;  1RQ0 A;  5E3C A;  3MF5 A;  3IAS 9;  2QL9 B;  3UN3 A;  2E5H A;  1NK8 A;  3GE9 A;  1S1V A;  2CPI A;  1HHT P;  1YWX A;  1WEY A;  3M6V A;  4OJG A;  4AXI A;  1C0T B;  3AA8 A;  4B9T A;  4CWB A;  4UTG A;  5HMW A;  4ZVP B;  2AV5 A;  3NEK A;  2ZIT A;  2CWK A;  3NCQ A;  1VBZ A;  3S01 A;  4ED0 A;  3ZTR A;  1T0T V;  4KPY A;  1C4C A;  2M0G B;  2BA9 A;  2L9N A;  1CVJ A;  3T9N A;  1YZ6 A;  3TZX A;  2D9O A;  5LT5 A;  2UUA J;  1JK9 B;  3MEG B;  1NKB A;  4CT9 A;  4DQI A;  2MKC A;  1P1T A;  1WI6 A;  3FSY A;  1FKP A;  3R7S B;  1JLB B;  2ZH1 A;  4ZHR A;  5RUB A;  2CJB A;  2JX2 A;  5DS7 A;  3PKY A;  2B6A B;  1R31 A;  4DR3 J;  2DCU B;  5HBM B;  5HN0 A;  2HIY A;  4CZC A;  1Q53 A;  2WRM A;  3QAU A;  1NKC A;  3IBW A;  3BJY A;  2DR9 A;  2QEX S;  4K59 A;  1MMN A;  1S4E A;  2CQC A;  2BAN B;  2DNL A;  2VAS A;  3GFH A;  1UVJ A;  5A0Y B;  2F9J A;  1W2B R;  2L48 A;  1CS4 A;  5L46 A;  4IFV A;  4AD6 A;  2LLZ A;  4PG7 A;  3HVW A;  4ZP7 A;  4P74 A;  3VAF A;  1RT3 A;  2OP5 A;  3PRV A;  4NZ6 A;  3RU0 A;  2N4C A;  1NO8 A;  1RTJ A;  2IPO B;  1B7F A;  4WKY A;  4GKK J;  2FJV A;  1CUL B;  1GTE A;  1X4G A;  1BQN A;  4ZVQ B;  1FD8 A;  4V1A k;  5E3R A;  5IWA F;  1IBK F;  1RKI A;  3S6E A;  2PC6 A;  3HP6 A;  4KT0 C;  4O3O A;  4BCA A;  2RHS B;  3CVK A;  4LRD A;  3LAN A;  2C3M A;  4UZB A;  3GTY X;  4FKY A;  5K8P A;  1TAQ A;  3M30 B;  3BSA A;  2Z4P A;  1VK8 A;  2GHW A;  4O4R A;  4NLT A;  3PJW A;  4R0J A;  2OTL S;  1X9W A;  3ISZ A;  1UZH A;  5HLF A;  1X4F A;  4USV A;  3HCX A;  4EEY A;  1FKO A;  3X3U A;  2AJQ A;  1RAA B;  3HMJ G;  4IR9 A;  5AXN A;  1A9N B;  2XLI A;  1ZPW X;  1IUJ A;  3HJF A;  2V4R A;  5DM6 Q;  1NK6 A;  4MKV A;  2VKZ G;  2EFP A;  2QO3 A;  4PWD A;  3LAM A;  2LEA A;  3PW0 A;  4KYZ A;  4Q2L A;  1HLW A;  3NY0 A;  3EM1 A;  4ID8 A;  3KHG A;  3PW7 A;  3A8I A;  3HK2 A;  2GVD A;  1VQO S;  3OTO J;  3MR5 A;  1VRQ C;  2RIL A;  1O5J A;  4DSI A;  3MM6 A;  1S72 S;  3EVW A;  2AHO B;  4NA1 A;  4OX9 J;  2VL1 A;  4HDG A;  4KGV B;  4FXW A;  3ZZZ A;  3KG4 A;  3HVT A;  4QQB A;  3AD7 C;  2XEX A;  3W2V B;  5EDW A;  4L76 A;  2E9R X;  2MEW A;  2V4J B;  3OVS A;  2R7T A;  4KGX B;  2NXC A;  2FHJ A;  1S5Z A;  1VQ9 S;  4DV1 J;  3OUY B;  3MD3 A;  3CB4 A;  2DR5 A;  2RHQ B;  4WE1 B;  1N52 B;  3D1O A;  1SCJ B;  5KG4 A;  2QLX A;  2HRT A;  5GAE I;  2O01 C;  4PKD B;  3IG1 B;  1XIQ A;  1TAU A;  2K7J A;  2RDD A;  1Y4Z B;  2FQQ B;  3PNI A;  2UXB F;  1QM9 A;  3DLK B;  3PXG a;  1S6P A;  3TI0 A;  2NSC A;  4X65 F;  3K58 A;  5L1I A;  3P96 A;  4KR0 B;  1RLC L;  1JXV A;  1U48 A;  2MZT A;  4DQS A;  4B3M F;  4DL5 A;  4CO0 A;  3HSZ A;  2X7I A;  2OFG X;  3FCV A;  3SQG B;  5FJ4 A;  2MQP A;  3ILO A;  1L3S A;  1OY9 A;  1SKS A;  2VC1 A;  4YY3 F;  3KHH A;  2UUB J;  2LU1 A;  3RB0 A;  1BY9 A;  2VZ9 A;  2D3Z A;  1VIX A;  3DMJ A;  1QY7 A;  2G0I A;  3W64 A;  2YQ3 A;  5D77 A;  5A8W B;  1RYS A;  4DV0 J;  4CYU A;  2G2Y A;  1AA1 B;  1NPR A;  3HHE A;  4DSL A;  1FD2 A;  1U0H A;  3CXC R;  3QQC D;  4O0N A;  3MGJ A;  3MR6 A;  3KK2 A;  1PJ6 A;  1IKW A;  4ZJL A;  4USH A;  4TXS A;  2HGM A;  3T1A A;  1HL6 A;  3BO4 A;  2L08 A;  3CC4 S;  3I55 S;  4JV0 A;  3U27 A;  2YX4 A;  2IBO A;  3OSP A;  2WON A;  3IWN C;  5IT9 Y;  3MPV A;  1X0P A;  2B5J A;  1TTH B;  4CTA B;  4YS2 A;  2EXU A;  2X1G A;  4C3K A;  4WK3 A;  3M9M B;  3D6F B;  5DM7 Q;  4GRS A;  2DGX A;  3D54 A;  4QYR A;  2DVI A;  3PRB A;  2MLZ A;  4F25 A;  1XMQ F;  3MEE B;  2R8K A;  2NSB A;  2ERR A;  5B0F A;  3EE3 A;  2FVC A;  2HWI A;  4DV7 J;  4JUZ A;  2JC0 A;  3N5B A;  1IBL J;  5D78 A;  1AUD A;  1E6V B;  2CIM A;  3OTB A;  3MHY A;  4KFB A;  1R0B G;  1VFJ A;  1Y7P A;  2E44 A;  5GAG U;  1G6B A;  3GP9 A;  1PIL A;  1DLO A;  1FVS A;  3MTK A;  2IIH A;  5D8H B;  2A10 A;  4WF9 Q;  1HBO B;  2E5G A;  4I2P B;  4NA2 A;  2HUR A;  2C2M B;  4DN9 A;  4YR0 A;  4F4K A;  3M9N B;  4IG3 B;  4ZPW R;  1L3T A;  1VCT A;  2Z2M A;  4MYU A;  1JLE A;  1T3O A;  2MYF A;  2XMA A;  2QA2 A;  1JLF B;  1OSC A;  2F4V F;  1KQK A;  3J81 U;  1S6U A;  1WTF A;  1U26 A;  4UUX A;  4IG0 A;  3JAM U;  2DHA A;  3GIL A;  4ED3 A;  1HNI B;  5KT6 A;  3NNH A;  2MKS A;  2KRR A;  2H5E A;  2LXI A;  4PXE A;  1WF0 A;  1NJY A;  1UET A;  1JMT A;  4HH1 A;  2YH1 A;  3HFZ B;  2HKE A;  4ZVG A;  4U7U K;  2DH7 A;  3MFI A;  4EYI B;  1RT2 A;  1B3T A;  2YNI A;  1NZ8 A;  3G86 A;  1GQE A;  1F9E B;  2IAJ B;  1RAE B;  3DNC A;  2FLL A;  1GXL A;  3T6J A;  4RUB A;  4DOZ A;  1FEE A;  2XBP A;  5D0G A;  4JV5 J;  4FVC A;  2XY5 A;  3MFH A;  1S0N A;  4N7T A;  1MML A;  1FK9 A;  2OPR A;  2AGO A;  4ED8 A;  5KG0 A;  3SIP B;  4WZQ A;  3G8Q A;  3H5S A;  1XTZ A;  1WOP A;  2V0N A;  4NI2 B;  1YI2 S;  2CUY A;  3R8Y A;  3E01 B;  4KKO B;  2E7W A;  2LYV A;  1R8H A;  1H3D A;  2WVE A;  5LM7 E;  2CG8 A;  3GII A;  4LFC J;  4WP8 A;  1L3K A;  2IM1 A;  4AXJ A;  3ZZ0 A;  2I5J A;  4OLO A;  4OYP A;  3CCQ S;  1F1B B;  2UU9 J;  2H5I B;  5M2R A;  1JQG A;  4ZP6 A;  2RE1 A;  2GC8 A;  1DZ5 A;  2B7C B;  2K8G A;  4N56 A;  2ZE2 A;  1RT1 A;  2CQP A;  3Q8U A;  1TQL A;  2KFZ A;  3HVR A;  4CI0 B;  1EKS A;  1QAY A;  3HHL D;  3A3N B;  5BJR A;  3B54 A;  1OQ3 A;  2YWW A;  1Y00 A;  2KVQ E;  2HHW A;  2AJF E;  4ZP8 A;  2XS5 A;  1G4C A;  3I5B A;  1N6Q B;  1ROF A;  4P7V A;  2KL8 A;  4F67 A;  2JL9 A;  1F0X A;  3IMQ J;  3HI9 A;  5FLX U;  3FZ2 A;  2HND A;  1BWE A;  1WG1 A;  4ZVH A;  2HMI A;  1K44 A;  3AOD A;  4CNZ A;  3W8P A;  3BBB A;  3F41 A;  4AL7 A;  4I68 A;  4LUB A;  1Y5L B;  1KHV A;  4J90 A;  2VPZ B;  2CG4 A;  4R8U B;  1J5O B;  2KFN A;  5CH7 B;  2R7R A;  4QR2 A;  2B4U A;  4IDK A;  2FUG 9;  2GIR A;  1KD1 T;  2V9K A;  4WFY A;  1VRT B;  5D4O A;  2P9G A;  3WIV A;  2IYG A;  2QYC A;  2APO A;  4IUF A;  1JKH A;  4MH8 A;  1KR4 A;  3LWM A;  1XJW B;  2WOM B;  5F0U A;  3WHI A;  2Q6C A;  1RU2 A;  4ZCL A;  2EC2 A;  1S77 D;  2QLW A;  2D7S A;  4HTI A;  4ZPA A;  3X1L B;  4B3T J;  3GJQ B;  4K0K F;  5SUH A;  2QGF B;  3SDE A;  3PO5 A;  3W2W A;  4A47 A;  3M2U B;  3Q8S B;  4LF5 F;  2PT0 A;  4PG6 A;  1KEK A;  1EP4 A;  1SBR A;  2CVE A;  3DDI A;  3OHB A;  2DNG A;  1VS3 A;  4X4R A;  2WZ1 A;  3DLG B;  2MQL A;  5C25 A;  4NCG A;  1LW2 A;  5KFI A;  3K5P A;  2M8H A;  3MMB A;  2OPP B;  2VC0 A;  5H1S V;  3QWU A;  2D69 A;  3J81 Y;  3UDV A;  3KLI A;  4AL5 A;  3W7B A;  2ZBI A;  2H1Y A;  3BGO P;  3LGH A;  1J27 A;  2VF3 A;  2YNG B;  1MN9 A;  5B0E A;  1XNR J;  2B9Y A;  5ETL A;  3VR1 A;  2YPY A;  4O0I A;  1FA0 A;  3SCI E;  2C3P A;  1FJG J;  1WF1 A;  4EFA C;  4EO8 A;  2HFU A;  2BRL A;  4NLO A;  2UUT A;  1KTQ A;  1H7X A;  4ZVS B;  1LK7 A;  3W62 A;  4RW9 A;  1KLM B;  1I1G A;  3BV8 A;  4I7F B;  4NXN J;  3AAW B;  4IH7 A;  4LJM A;  4U95 A;  2QRR A;  3D3B J;  3KJQ B;  4OJH A;  3RTV A;  4NML A;  3CCU S;  2FY8 A;  1IWG A;  5EGY A;  1F9H A;  4Y00 A;  2MQ8 A;  3KJV A;  4N41 A;  5A8K A;  2ACM A;  2XQC A;  5E0O A;  1ZM4 A;  2DHH A;  2AU0 A;  1HMV A;  2XUL A;  1E6Y A;  2MGZ B;  4CLZ A;  3UW1 A;  3M8R A;  3GYN A;  2VDH A;  3DRS A;  4C6A A;  2BEF A;  1FE4 A;  2UUB F;  4XO0 A;  3EXY A;  2YY3 A;  1UWA A;  3DRR A;  3Q8Q B;  4DUZ J;  1CLF A;  3BSC A;  4HEA 9;  4IO9 Q;  3KK1 A;  3MPY A;  1X0F A;  3LP2 B;  4G3I A;  3BKT A;  4YR2 A;  2MLY A;  3TAM A;  2EKY A;  1BLU A;  4KO0 A;  3VAJ A;  1RT7 A;  2YKA A;  2HGN A;  1NJW A;  3THV A;  4TU8 A;  3W1Y C;  1TK5 A;  1RWX B;  3CC2 S;  2PI4 A;  2HEK A;  2P6T A;  4DG1 A;  4U7U D;  4DFJ A;  3RRH A;  5CYM B;  2RF2 B;  1IBM F;  2KRB A;  2BW2 A;  1YIJ S;  5LJ3 Y;  3DYA B;  4KRW A;  2XGP A;  4AQY F;  3AOA A;  1TK8 A;  1HAR A;  1TKX B;  3MR3 A;  1AUS L;  2HHT A;  4USW A;  3GB0 A;  4J9N A;  3HM9 A;  3NP5 A;  1VQS A;  1VBY A;  1IXK A;  1LKZ A;  4C8Z A;  2BV3 A;  5HP1 A;  4Y3C A;  1EHW A;  4P7T A;  4B3O B;  1XK8 A;  1LXN A;  3TJ8 A;  1SB6 A;  3K59 A;  3JQK A;  5CXT A;  1H0H B;  3MOZ A;  3ENW A;  1AZS B;  4BWM A;  3GLJ A;  4K4Y A;  4S0M A;  4JI0 J;  2NXU A;  3WZ0 A;  1CSJ A;  3GJR B;  2BKP A;  2ZH6 A;  1REV A;  2GV1 A;  5LL6 d;  3A1Y G;  2CQB A;  4DFP A;  4YHH F;  3QT8 A;  2HVI A;  4FS2 A;  3LH2 S;  1BQN B;  1TP7 A;  4CRJ A;  4X66 F;  1NK0 A;  2BJ3 A;  2EG1 A;  5C2C A;  1F60 B;  3LP1 B;  4Y6I A;  1UW9 A;  3D5M A;  5KFT A;  2Z8Q A;  3H59 A;  3J7A N;  4WTY A;  4F4A A;  2EBE A;  2J9C A;  3NCP A;  4X2B A;  4MIW A;  3P3D A;  1ZA2 B;  3DOL B;  3BH6 B;  1ZPV A;  4ECR A;  5ETV A;  1SKR A;  4RWX A;  2Y0B B;  2XC9 A;  1OO0 B;  5H9F J;  4ED5 A;  2YWK A;  2R9L A;  2R7U A;  3QJJ A;  3DLB A;  4FBT A;  5HLF B;  3TA0 A;  2FJX A;  1SL2 A;  2BJ9 A;  4LFA J;  4RLE A;  5C42 B;  1S1X A;  5HMZ A;  4A48 A;  1UVL A;  2FHJ D;  5D4N A;  4U7C A;  5GVQ A;  4AL6 A;  4LFC F;  3FMW A;  4I6Y A;  2WW4 A;  4OI2 A;  3ZZT A;  3PEJ A;  5KFD A;  4I2Q B;  2WSF C;  1PC4 A;  1NSP A;  4NZ7 A;  2UU9 F;  2XSF A;  4A8X A;  3UDE A;  5F9N A;  5IQQ A;  2XI3 A;  4FBU A;  4JI4 F;  4H4M A;  2B43 A;  3KMS A;  4KGZ B;  1HA1 A;  2XNR A;  1WOR A;  4DQQ A;  2V68 A;  3KLH A;  4W4M A;  2HZC A;  3TA2 A;  3ZZU A;  2AGP A;  2FVR A;  2IJN A;  3PFE A;  1UJ4 A;  2J0S D;  3S1T A;  4H4K C;  1U02 A;  2H48 B;  3CPW R;  1H7W A;  1I94 F;  1U1P A;  3NS6 A;  3QT6 A;  3RAX A;  1SQF A;  2B4P A;  2MZR A;  3WC0 A;  1FES A;  3QSY B;  2MQN A;  3H0P A;  3GSD A;  3Q2T C;  4U8Y A;  1IQT A;  1HQE B;  3UR3 C;  1Z4U A;  3QLH A;  2DNR A;  5DQG A;  1VGY A;  3TP2 A;  3DOM A;  2JC1 A;  4KH0 B;  5A8R B;  4QYZ J;  3OR2 B;  2IC3 A;  3BBC A;  4C0O C;  2UV8 A;  1W26 A;  3UN2 A;  1KFS A;  4LR9 A;  2G4B A;  1QTM A;  3R5G A;  4FNH A;  3KUE A;  1S6P B;  2FLO A;  4L3N A;  3HT3 A;  2BE9 B;  2I0X A;  1HHQ A;  1MNE A;  4NLG A;  1YKW A;  2KXF A;  5GAE U;  2HVZ A;  1QSY A;  4RW6 A;  4N8N A;  2R2U A;  2V67 A;  1T8E A;  3CMA S;  5CA5 A;  3FEX B;  3P4U B;  5JVG Q;  2AKW B;  1GNK A;  7AT1 B;  4NE9 C;  4I67 A;  4YDX A;  2ZM6 J;  3DGP A;  1Q81 T;  3DMJ B;  2B9W A;  4ZIV A;  2MKH A;  4IOC Q;  2P2C B;  1U1Q A;  2HBR B;  3MEC B;  3UO0 A;  4V19 X;  4JI1 J;  1Y9O A;  2J7K A;  3CSK A;  2RS8 A;  3P8B B;  3P6Y C;  2VG5 A;  5G0R A;  1SC6 A;  4CT8 A;  4C8Y A;  3KK2 B;  1G3O A;  3I82 A;  5C24 A;  3VGV A;  2HVH A;  1PJ5 A;  1ZOT A;  5K14 B;  1SC4 B;  2ZC4 A;  4PQA A;  2DNP A;  1TKD A;  3D6H B;  4I69 A;  3UE2 A;  1R7I A;  4CDI A;  3M6W A;  4F4X A;  5E33 A;  3Q22 A;  1RJJ A;  3H2U B;  2B4O A;  4C8O A;  5ITH A;  3KWM A;  3PV8 A;  4ECQ A;  2YKO A;  2UV8 G;  2JLE A;  1EET B;  3UVJ B;  3DLL Q;  2M8D B;  1X4C A;  2ILZ A;  3EVM A;  3CD7 A;  5KG7 A;  2CPX A;  3K8V A;  1P6T A;  1TL7 A;  3SFU A;  4QWC A;  2PI5 A;  2RKI B;  4MTP A;  3K5N A;  3M6U A;  1RAI B;  5IC6 B;  1D0E A;  1VIO A;  3KNA A;  1REG X;  3DOK A;  3MWB A;  1F3V A;  4IRD A;  1ZM3 A;  4DL6 A;  1U2C A;  4O3N A;  5HI7 A;  2BAB A;  4NEZ A;  1B0V A;  4GC7 A;  1LFW A;  3GR1 A;  1W7W A;  4U9R A;  1N5T A;  4ER8 A;  4PUO A;  1TKT B;  2HZV A;  1SPB P;  4NLY A;  4PQU A;  1JLE B;  3VAI A;  1NSA A;  4NXM J;  1JJ2 R;  4RJV A;  1KOO A;  5AXL A;  2V2K A;  5J1E B;  4C3M A;  2KG0 A;  2CQ4 A;  1C0U B;  4IG0 B;  2ZDO A;  3PYF A;  4DV4 F;  1FTC A;  4WTO B;  3R7B B;  2J9E A;  1Q5Y A;  4JB8 B;  4DZD A;  4ZVT B;  4H4K A;  4QIE A;  2QTW A;  2MKK A;  4DF4 A;  2E1A A;  3HD1 A;  3DHX A;  5B0C A;  2CJY B;  2PMZ D;  1B0P A;  5AJ3 J;  3TO8 A;  1MMD A;  4RW8 B;  3NRB A;  3L4B C;  2GIQ A;  5DDP C;  3W8G A;  1U1K A;  2ASL A;  4MK9 A;  2KM8 C;  2ZUG A;  2W9C A;  4LF6 J;  5D6G A;  5J2M A;  2OPR B;  4HI1 A;  4DFM A;  3VVT A;  1PYO B;  2V8H A;  4DSJ A;  6FD1 A;  1JLQ A;  5DZ6 A;  4RW7 B;  3MPU B;  3FGV A;  1Q8L A;  3MM7 B;  2UXC F;  3G8S A;  2XYG B;  1EQM A;  2GVZ B;  4NPO A;  4WFB Q;  4JI7 F;  5H9F K;  3MMC B;  1MU2 A;  4QU6 A;  1LV5 A;  5DG9 A;  3GYG A;  4OZ5 A;  2P5V A;  3HPO A;  3TR5 A;  1JLG B;  4OI6 A;  2MJU A;  1B99 A;  2OEK A;  1RT1 B;  3SCJ E;  2ZUA A;  4JI0 F;  1IN0 A;  1OYE A;  3TUJ C;  5BR8 F;  2R8G A;  4WZM A;  4OI4 A;  2DNH A;  2NCK L;  3SCK E;  4ILM A;  2LQ8 A;  3QT5 A;  2AMC B;  4X4V A;  1HWI A;  2GCF A;  2DY9 A;  5B0D A;  2QC3 A;  8RUC A;  3W63 A;  2KXN B;  5CD4 H;  2VFT A;  1L3U A;  4PAA A;  1SL1 A;  5I42 A;  4JI3 J;  2HNY B;  3NG8 A;  2BXJ A;  2HMI B;  1ZAW A;  1NLK L;  1DQ8 A;  3PFO A;  1PJ7 A;  1U7L A;  3ISN C;  1M5O C;  1ITP A;  3EX7 B;  2G0J A;  4W92 B;  3HX9 A;  3V6H A;  1ARO P;  4I1T A;  4O3Q A;  4DV2 J;  1SIW B;  2ZZM A;  4QYZ K;  4QPX A;  4YR3 A;  4HVZ A;  2V8V A;  2A0F B;  2AX0 A;  4ED7 A;  1R6V A;  4MKB A;  1NJX A;  1U1L A;  3C15 A;  1YGY A;  3MEK A;  2IY5 B;  1Y10 A;  3AHP A;  1Q8K A;  1UVM A;  4NCA A;  2XMK A;  3C8Y A;  2WB4 A;  4F0M A;  5CYQ A;  2PII A;  4FXD A;  3TZW A;  3Q86 A;  3C3L A;  4JV1 A;  1RTH B;  3MTJ A;  1FRM A;  4HAC B;  5L9N A;  5C25 B;  3BRE A;  1S6O A;  2UZA A;  1RZM A;  2V34 A;  3K5M A;  2GJF A;  4ZS6 A;  2Q66 A;  1QJH A;  3FUY A;  1XC9 A;  2V8G A;  2VQE F;  3KUH A;  3H42 A;  1IKX A;  4ZJO A;  3BQ1 A;  3KLI B;  3VGU A;  3G96 A;  2YKN B;  1FDB A;  2ZBR A;  2RQC A;  2GQ2 A;  2LA4 A;  2R7Q A;  3H90 A;  1OYD A;  2LEB A;  3EGW B;  4JI8 J;  1S6Q A;  3AOC A;  2CNK B;  4J91 A;  2XWY A;  2AEM A;  2AJ4 A;  4M94 A;  2VG6 B;  4OHZ A;  5J1N A;  1NK5 A;  4OZ3 A;  1JNZ B;  2OML A;  1N56 A;  1J2V A;  4C8N A;  3BGU A;  4A8S A;  5E3P A;  4Y2K A;  4LSN B;  3EDR B;  1JXL A;  3SBM A;  1GXT A;  1RI7 A;  2ACY A;  2HS0 A;  5DG8 A;  4CLY A;  3FRZ A;  1HMV B;  3QGG A;  2HHX A;  1IKV A;  2IA0 A;  1TL3 A;  4Y2A A;  4FZV A;  4PXC A;  2NYH A;  3BS9 A;  1D8Y A;  1ULR A;  3QBC A;  4DR1 F;  5ETM A;  5IM0 B;  3F0N A;  1VQ7 S;  1U1N A;  3ZTO A;  4DN0 A;  1U0S A;  3DRR B;  4ZVF A;  3RG6 A;  3BR8 A;  1SQE A;  1ZM2 A;  3VQS A;  1KVI A;  1NAQ A;  4OYO A;  5MLC V;  3KK1 B;  1C0T A;  4F8R A;  4IFY B;  3D9B A;  4FS1 A;  2CQG A;  4LF8 J;  1UJ6 A;  4KO0 B;  4TLR A;  2L9W A;  4I56 A;  2PA8 D;  1NRK A;  1UCN A;  3P45 B;  1UPP A;  2CFX A;  2QG9 B;  3THT A;  3TYT A;  1EKR A;  1SQG A;  5CAB A;  3RBD A;  4DUY F;  5KG1 A;  4DL2 A;  3FSI A;  4OI1 A;  2HQG A;  2CJX B;  2QJ3 A;  3BKF A;  1FEH A;  1FE0 A;  2XM3 A;  1JLB A;  3MMA B;  4X62 F;  2IMW P;  4F0K A;  5I4M A;  3SZ2 A;  4URQ U;  2XY6 A;  3KLV A;  4Y0F A;  2Z2L A;  4EI2 A;  2B6A A;  1VQ4 S;  5HBM A;  5KG5 A;  2VHG A;  4KHP J;  2VV5 A;  1KQF B;  1U8W A;  3IP0 A;  1CC8 A;  4GVB B;  4DR2 J;  1WHW A;  2KYX A;  1RSC A;  2BAN A;  4WFA Q;  1SJR A;  2KJV A;  3TEH B;  2NQP A;  2BAC A;  4EGL A;  5A0Y A;  5KT4 A;  1JLA B;  1MWQ A;  5HJX A;  2GMH A;  5EN1 A;  3D7S B;  1Q4R A;  2JFK A;  4NLR A;  2IDL A;  1BQM A;  4OV1 A;  3VZI A;  4KTQ A;  2J0Q D;  4ICL B;  4ZIW A;  2X1B A;  2ZH9 A;  1QDU B;  1VQM S;  1HQ2 A;  1TMM A;  4ZLN A;  1S9F A;  4EUV A;  1CUL A;  1HQU A;  2XI2 A;  4OYX A;  1NB7 A;  1UVK A;  1KDN A;  3KK3 A;  2C2D A;  3BH7 B;  5IQ6 A;  2RB7 A;  2QSW A;  1MN7 A;  5T7L B;  3M30 A;  1VJQ A;  2RML A;  2VPX B;  3ETO A;  3BGR A;  4ZPB A;  3M9O B;  2X1A A;  4OHV A;  2ZHB A;  3OL7 A;  3Q89 A;  2E9Z A;  2AQ4 A;  2FTR A;  1TKZ B;  4WYW A;  3A13 A;  4PEO A;  4OI3 A;  1NJZ A;  3L7P A;  3KJF B;  4LF6 F;  2DNZ A;  4KSE B;  1ZM9 A;  1HD0 A;  5C5J A;  1AB8 A;  3N28 A;  1S1X B;  4ED6 A;  2FGO A;  1K1Q A;  2HS3 A;  3CJK A;  1FNM A;  5H9E J;  2Y8Y A;  2EFG A;  1WC0 A;  5J2N B;  3SV3 A;  2IVF B;  4RX6 A;  2NZC A;  4JI6 F;  3OBI A;  3NGD A;  3M8W A;  4XAK A;  1FO1 A;  2JRS A;  1BXN A;  3V81 B;  4MKY A;  2BM1 A;  2LFV A;  4HI2 A;  2W1B A;  1FTR A;  1FDA A;  4DFK A;  4H4M B;  1RP5 A;  4G1Q B;  4LVN P;  2XSJ A;  4BS2 A;  2MPU A;  2JVO A;  3IFE A;  3K5L A;  3W2V A;  4U67 Q;  2L9D A;  3PR4 A;  2C2K B;  4ZPT R;  2DGW A;  2LEP A;  2V4J A;  4K7Q A;  1R27 B;  1L5U A;  4Q8E A;  1SXL A;  1EZZ B;  3UCZ P;  2OD6 A;  3J7Y U;  1SV5 B;  1T7P A;  3OUY A;  3T1Y J;  1RAF B;  3R6G B;  2W4P A;  4WE1 A;  4EYH B;  3EZU A;  5ETO A;  3QID A;  4QIF A;  3CIZ A;  2D1C A;  3MD1 A;  1X5T A;  1PCA A;  2LXF A;  3FDS A;  3QIP B;  1P27 B;  2ZVI A;  3TUI C;  1NH7 A;  2V2Z A;  2DTJ A;  3IA0 A;  1QTN B;  2WVF A;  3IG1 A;  3CJ5 A;  2GIF A;  3SSS A;  3Q83 A;  1V9O A;  3GFY A;  4NWB A;  4Z7C A;  2OEJ A;  2Z2Z A;  2ZEJ A;  2F9D A;  2ZH5 A;  1WKL A;  5GME A;  2JNJ A;  4K2X A;  4ELU A;  4CQ1 A;  4Y2I A;  1CJU A;  2PA3 A;  3CDB A;  3R97 A;  3J80 Y;  2LXU A;  4Q45 A;  3SQG A;  4PRF A;  2XZD B;  3LA0 A;  1X9M A;  2J9D E;  1MRO A;  3UCG A;  2Y1L B;  2DNO A;  5A8W A;  2Z2Y B;  4W98 A;  3PO4 A;  2YBV A;  1WOO A;  5FDL B;  4F3O A;  2RRB A;  3E3X A;  1SL0 A;  3I96 A;  4J9P A;  2DCL A;  5F8L A;  3CJ2 A;  2NR0 A;  1DBD A;  4QW8 A;  4TNO A;  3BKU A;  2OIH A;  1BGX T;  2ASY A;  2POK A;  2WK4 A;  5C24 B;  3SMZ A;  4PG4 A;  1K47 A;  3R5B A;  2DRD A;  1TV6 A;  1H98 A;  1SIZ A;  3CUN A;  1FRH A;  2MMY A;  1NH8 A;  5LSO A;  2BJD A;  3IWX A;  1UW4 A;  4IQM A;  3TW0 A;  3K0J A;  1AW0 A;  3RJM B;  1HI0 P;  2I1R A;  1SI9 A;  3DCA A;  4Z37 A;  3H40 A;  4B08 A;  2JEF A;  2ZJQ Q;  2VU5 A;  3MEE A;  4GKJ F;  3CCL S;  3FEY B;  3HHL C;  2ZNZ A;  2J8A A;  1U6B A;  1E6V A;  1NEE A;  2FZK B;  2FDN A;  2HRY A;  4Y34 A;  3OTD A;  3W61 A;  3Q8R B;  1FJ7 A;  2AJ0 A;  4JI5 F;  1UKU A;  1HBO A;  1LQ9 A;  4KC5 A;  5AE1 A;  1Q5V A;  4I2P A;  4LSL B;  8AT1 B;  3LOU A;  1WHV A;  4YB6 A;  2YQ1 A;  3FBB A;  5KG2 A;  3CCW A;  3JQM A;  1HW9 A;  4P75 A;  2G2Z A;  1TL1 B;  1NKE A;  2FJA B;  4P71 A;  1T9V A;  3O8W A;  4PQU B;  2EEY A;  4QWE A;  3I6P A;  2XLJ A;  2RQK A;  2Q43 A;  5IWA J;  4M5J A;  1T94 A;  1IBK J;  3M8Q B;  3UD4 P;  4L6V 3;  2FJD B;  3DN9 A;  1X5S A;  4U8V A;  4USJ C;  3L7U A;  3G9C A;  2FYX A;  2K3I A;  3O2I A;  3F56 A;  1CJK B;  2OPQ B;  1C4A A;  1RHR B;  3H5U A;  2X3D A;  3MM8 B;  3HSG A;  2ZH4 A;  1RHQ B;  2DR8 A;  2IAJ A;  2KDO A;  2XZT B;  3QO9 B;  2I6W A;  2IRY A;  1FJC A;  3B8H A;  1FX2 A;  4DPW A;  2MZQ A;  2W9B B;  4UY8 T;  1X8D A;  2RU9 A;  2GJI A;  3FQL A;  4LIR A;  2ZBC A;  4I6A A;  4EWT A;  2ZH3 A;  4TQS A;  1SH3 A;  3E01 A;  5J2M B;  4KKO A;  2ADB A;  4IKA A;  2XZW A;  1OSD A;  3OVB A;  2W24 A;  1YBA A;  1B70 B;  1OWX A;  2C3Y A;  4W90 B;  3OL9 A;  3MI7 X;  3MM5 A;  2XHC A;  4K4S A;  3TVK A;  3KUG A;  5U47 A;  4DPY A;  1FFS B;  2F1F A;  1WKJ A;  3CD5 A;  3L09 A;  3NMR A;  1R6Y A;  3UCU P;  2RAQ A;  5M2P A;  2FGC A;  5K9F A;  5HAO A;  5KT2 A;  2OO4 A;  4OZ1 A;  3R7N B;  5HK4 A;  1UZD A;  2E1C A;  2DBB A;  4URS A;  1GFW B;  1I5O B;  1G2E A;  4USM A;  1RTI B;  2FZG B;  5BYS A;  3GR0 A;  2NZ4 A;  2HFN A;  2GMJ A;  1N6Q A;  5H9E K;  1FDD A;  4ZMM A;  4LBI A;  3ETM A;  1XWL A;  3DI6 A;  1U6Z A;  3KLF B;  1OQ6 A;  2W7P A;  3TAQ A;  3EMT A;  3S8S A;  4M5I A;  2RSQ A;  1YJU A;  2HHP A;  3HXM A;  2XMW A;  5CHC B;  1ELO A;  5THW A;  1X31 C;  3IRX A;  1YHQ S;  5A6P A;  2KT5 A;  2DB1 A;  4CLP A;  2UUC F;  4F4Z A;  1RCX B;  1NB2 A;  3D0H E;  3V6J A;  2UXB J;  4R8U A;  2JLF A;  3DDN A;  5LSL A;  1J5O A;  2DD8 S;  4ETZ A;  1O0P A;  3VZH A;  4X65 J;  2DNK A;  3AOB A;  3ZTP A;  3B4D A;  3IBF B;  3KLG B;  4WFZ A;  3HFK A;  5B09 A;  1VRT A;  1RWV B;  1S49 A;  1FJE B;  2CXE A;  2OAU A;  3BF4 A;  1WF2 A;  2WOM A;  1K1S A;  4DR7 F;  4YY3 J;  2Z56 B;  2VON A;  2B9E A;  1Q8I A;  2OPS B;  2NRE A;  4ES3 A;  4OYZ A;  2CAD A;  2E5L F;  5F8I A;  2XHW A;  1KQS R;  4E98 A;  2GQC A;  3MAA B;  4UOH A;  2IBK A;  1B7Y B;  3DLG A;  3ZNJ 1;  4G1I A;  4NLW A;  3MMJ A;  2W2Q P;  2OPP A;  2LMI A;  3MUV P;  4IR1 A;  4OQJ A;  2YNF B;  3GPA A;  4LRB A;  1U45 A;  2KG1 A;  4A46 A;  1T11 A;  4LF1 A;  5DDQ C;  2HAI A;  1WHY A;  3O1L A;  2YNG A;  3V4M A;  3RGI A;  4AE5 A;  4O3S A;  2V8D A;  3ZZR A;  4OIX A;  1N88 A;  1M5P C;  3GJT B;  5HRO B;  3UD5 A;  5KFN A;  3DM2 A;  1X4D A;  4Q5V A;  1U1R A;  1UVN A;  2OHD A;  3EIC A;  1VRU B;  3CJT A;  4YP3 A;  1HI8 A;  1KLM A;  4I7F A;  1CJV A;  5HJY A;  3A3P B;  1HIY A;  3GSI A;  4DV3 F;  3KYL A;  4XDD A;  4AUK A;  2F3J A;  2VJU A;  3KHR A;  3PM9 A;  1KHW A;  1LWF B;  4FYD A;  1HNW J;  3EPG A;  2NXJ A;  1VI7 A;  2MGZ A;  3BB5 A;  4MYT A;  1URR A;  3GJS B;  2JLG A;  2R2R A;  3NAI A;  3QGP A;  1CC7 A;  2PMH A;  4USU A;  3VAK A;  1Q7L B;  1WHX A;  3SFG A;  3MDF A;  3GQC A;  4EBD A;  4C0B A;  5J2P A;  2CQ1 A;  2RJZ A;  3MOJ B;  1BC6 A;  3AB4 B;  3G2X A;  1V6H A;  3E2E A;  4UY8 5;  3CCV S;  2MY8 A;  3ZC4 A;  3N01 A;  3EGZ A;  2M70 A;  1LWE B;  3LP2 A;  4A8Q A;  3JTP A;  2JEJ A;  1KQG B;  3J7A 1;  2MKJ A;  1N5V A;  2Z30 B;  3L9Z A;  2W01 A;  3GMG A;  4CLL A;  2EWH A;  2ZNY A;  1UAW A;  4UOC A;  4UOF A;  2CQD A;  1S76 D;  2H9Z A;  1S9G B;  2V8P A;  1WEZ A;  4IRK A;  2O67 A;  3UPF A;  1RAH B;  2F8H A;  3BBF A;  4CLW A;  4MK8 A;  2MQM A;  2LKZ A;  2HWH A;  3E51 A;  1C2P A;  2JFD A;  4MFB B;  5CYM A;  2RF2 A;  4MAK A;  4P72 A;  5E41 A;  1J5E F;  3T5J A;  5LSR A;  1RGV A;  1FRI A;  1H2V Z;  3GV7 B;  2P9C A;  4K50 A;  1KNZ A;  1UTA A;  3DYA A;  4DJB A;  4CLU A;  1TKX A;  3BQ0 A;  2A18 A;  3NWR A;  1JLC A;  2ADC A;  2R7O A;  2YKQ A;  3TAP A;  3WIU A;  2IDE A;  2OI2 A;  3LAL A;  4NLP A;  1VOM A;  1PC5 A;  4B9L A;  4B3O A;  3VCD A;  4C97 A;  3ZXW A;  5F41 A;  1AZS A;  1HBN B;  3R2D J;  5KFQ A;  1BQM B;  1IWA A;  3H7H B;  4JI2 F;  1N0V C;  2FD2 A;  3HSD A;  3UNG C;  3HKW A;  5IT9 U;  2VBZ A;  4WXW A;  2GZO A;  2Q3P A;  1HQU B;  2OFH X;  1FXL A;  2N7Y A;  1FNX H;  1RWN B;  2OKQ A;  1S48 A;  2FVP A;  4Q2M A;  3KK3 B;  3LP1 A;  3LUY A;  1S0O A;  1VK3 A;  2OSQ A;  2IFX A;  4QWD A;  4DXL A;  3DOL A;  3G8T A;  1JB0 C;  3BGR B;  3R5C A;  3BYP A;  2P8I A;  2V5H G;  2QZ8 A;  3PR5 B;  1T02 A;  2EVZ A;  2DGT A;  2Q79 A;  2EKN A;  1WAC A;  1RTD B;  3LW5 C;  3M8Y A;  3BGF A;  1WC5 A;  5C42 A;  2VB6 A;  4WIQ A;  4Q43 A;  5JVH Q;  4Z7Y A;  1D3W A;  2AZ1 A;  2U2F A;  1N33 F;  4DX7 A;  1SKW A;  1KWM A;  2DT9 A;  3I9V 9;  2GGP B;  4I2Q A;  5JJB A;  2NUU G;  4EO6 A;  3M32 B;  3CJK B;  5DQH A;  4K0K J;  3TJ9 A;  1Y5N B;  5HQL A;  4CLF A;  1UP1 A;  4I4B A;  4LF5 J;  1VQN S;  1TFW A;  3B82 A;  1I6J A;  1QE1 B;  2J7W A;  1SJ3 P;  1CQM A;  4QR1 A;  2WHO A;  2XSJ B;  4DZ6 A;  2EPI A;  2RS2 A;  2EK6 A;  2MB0 B;  2DNQ A;  5J2Q B;  3G82 B;  3BPD A;  1RT4 B;  4WFX A;  4USK A;  5B0A A;  5AT1 B;  1H72 C;  2HW3 A;  3PRD A;  3BO3 A;  4P73 A;  2ZHA A;  2VOD A;  1HQE A;  5F9L A;  3O5T B;  5L1K A;  3LTO A;  3RAM A;  5A8R A;  4FYY B;  3OR2 A;  2FVS A;  5SZT A;  3M6X A;  2HYI B;  3IN5 A;  4IQX A;  4PYA A;  4PPZ A;  1T9X A;  2UP1 A;  1TR0 A;  4F0H A;  2YPZ A;  3JB9 k;  3NKY A;  2XMU A;  1X7V A;  1VQ8 S;  4WU3 A;  1CJU B;  4KY3 A;  2ZHO A;  4WXO A;  3T6B A;  2Y9H A;  2HHU A;  4YB5 A;  5BYR A;  1CG2 A;  3K5O A;  4A8O A;  1YLX A;  1WDD A;  1MRO B;  5KFE A;  2IM2 A;  3MEC A;  2BR0 A;  4HR2 A;  3LO3 A;  3BYR A;  1HYS B;  2UVR A;  3CCE S;  1P9Y A;  1P9Q C;  3HT0 A;  4CO2 A;  3ICL A;  3FKB A;  4L3K A;  1YX2 A;  3TZZ A;  2ZOG A;  2VJV A;  3FNN A;  2BRK A;  5KFZ A;  3H4D A;  5F8M A;  1RE1 B;  1NCL A;  2C2Z B;  2VG7 A;  2XMM A;  5K14 A;  3U1N A;  2F63 A;  4ILR A;  2IRX A;  5K8N A;  4LF7 F;  3CNQ P;  1H2T Z;  4QWA A;  1TV6 B;  3DXB A;  2AYB A;  3I4P A;  1TK0 A;  2RRN A;  2R7V A;  4B9U A;  4LBH A;  3U1L A;  1M1K T;  1RTZ A;  2DKO B;  4NCB A;  1DY3 A;  9RUB A; 
#chains in the Genus database with same CATH homology
 4GVB A;  4GVB B;  1KP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...