4GVBA

Crystal structure of the virally encoded antifungal protein, kp6, heterodimer
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Atomic Structure of the Virally Encoded Antifungal Protein, KP6.
pubmed doi rcsb
molecule tags Toxin
molecule keywords KP6 killer toxin subunit alpha
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2012-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.440 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Killer toxin KP6 alpha-subunit 4gvbA00
4GVBA 4GVBB 1KP6A
chains in the Genus database with same CATH superfamily
2F65A 3KKFA 1RWVB 1B0TA 1DY3A 1DURA 4RU2A 4DR4J 4DL3A 3MMAB 3WHIA 3V6JA 1R89A 5JMNA 2K3KA 2KU7A 3P5TL 1YK9A 2H65B 5HO4A 3U1LA 2MKKA 5KFRA 5FJ4A 4WU2A 2NYHA 3KWMA 4F7VA 1DQAA 3C19A 3DRSA 4IH7A 3CCUS 2A1BA 3G82B 3N6MA 4B3SF 3E3XA 2DNRA 2Z58B 1RI7A 1UZHA 2E7VA 4DQQA 2HGMA 2QA1A 3RW6A 4RUAA 1O51A 4C2MA 1NKCA 2R4FA 3LP2A 3I5AA 4WYLA 2B9YA 5EWGA 2QLJB 1RTDB 1M5HA 3HPOA 4ERDA 1RLCL 1SQGA 3V6HA 4PWDA 4DR4F 2JVRA 1Y00A 2E66A 2MQLA 5C24A 3KLFB 4K4YA 1SJFA 2MQMA 1KEKA 3W5YA 4LF4J 3MGJA 2MHEA 2YX7A 3BDEA 5J2PB 2IVMA 2BQ3A 2XB2D 5HSPA 5DG9A 3PYDA 3R5DA 4K4TA 1Q4RA 2CIMA 3DRRA 2V69A 2YY3A 2VUGA 1OJ4A 3UN3A 2DRDA 2RQCA 1WC1A 4RUCA 2H1YA 1YKWA 2DNGA 4U67Q 5F9NA 3LP1B 2OGUA 1WORA 3U02A 2ACMA 1VQOS 5JUMA 4C0HA 1VYAA 1Y3JA 1VQKS 1F5AA 1FKOA 1QUVA 2FDNA 3QIDA 1ZAXA 3IG1B 2I9SA 4DL7A 1BQMB 3TAMA 3MAAB 1WACA 5BYRA 2G0JA 5T14A 2JC0A 3W2VA 1U47A 1IKXB 2D69A 1NZAA 4MKVA 4P10A 3TRGA 4GC7A 3QT5A 2XSJA 3MR3A 5E0OA 2D9OA 4M5DA 2VOOA 1B64A 1WKJA 1HW9A 3KJNB 3W2WA 1N0VC 3FSYA 1FXDA 1BQXA 2RDIA 1EHWA 2MTLA 4LFBJ 3QJPA 1OQ3A 4TXSA 4CNZA 5MAOA 1UEKA 2Y0SD 5HN0A 1RAIB 4PXEA 2M3DA 3CMQA 4ID5A 5KTQA 1WG4A 1T9VA 2IDLA 3FCWA 2BUNA 1RBLA 2YWKA 9ATCB 4GKJF 1H74A 4OZ2A 2UUCF 1NSKL 3J80U 2E9ZA 3R2CJ 2DNLA 2G0IA 3LH2S 2AYBA 4V19J 1MN9A 4NLVA 2KN4A 4OYPA 5LM7E 3UVJB 3FEZA 2CQ0A 3BS9A 4YY3J 1Q8IA 5KFHA 3QLHA 2MGZB 1AROP 1CJKB 1P9QC 2ZVIA 3M30A 3PYGA 3TOQA 2ZZTA 4DMZA 2R2UA 3R5BA 3FFIA 3IBFB 3MPUB 1Y5IB 1T9WA 2Z57B 1ELOA 3MMCA 1HYSA 1FFWB 1OIAA 2YQ1A 5J2QA 2FHJA 1X5OA 1HBNB 5KFGA 5AXKA 2XLJA 4DFKA 4OL8A 1R0AA 1DBDA 4DQRA 1SKSA 2C3MA 2RILA 1E6VA 1RACB 4DX8H 3B78A 3FUYA 2BE9B 3POTB 5EX0A 2V5HG 3JAMY 3GV5B 2HNDB 3KK2B 2ZJQQ 2QA4G 1L3UA 2R8JA 1UVMA 3V81A 4DPUA 4ZJQA 2DHHA 2GC8A 3W65A 5MLCV 2HHXA 4GKKF 3W63A 2X3DA 3I0SB 3SDEB 4QIWD 3KK3A 2RF2B 3MUTP 1CQMA 1IR2A 4J9QA 1K0TA 3OXLA 3HSDA 2BACA 3I0RA 1NUEA 3LPYA 3ZTOA 1FRLA 3JQMA 3LP0A 5LXRA 3MM5B 4WZMA 1S99A 3PRBA 3KK3B 1Y4ZB 4WFZA 2VG6B 4C97A 4RNNA 1VBZA 4FPIA 1XQIA 1WUUA 3BEGB 2C28A 2RAQA 3AT1B 4KPYA 4XDCA 3DI6A 2O3DA 2KJWA 1HQUA 1S1VB 4DR3J 4X84A 2GHPA 1VQ5S 2V8DA 1TKZA 5KG1A 1N5SA 4KBIA 1IBCB 5DS7A 5F3TA 4AXJA 4YR2A 4B02A 4OI1A 3Q8PB 4HI1A 2LVWA 2QL9B 3D67A 4MH8A 1G6BA 3F0NA 1TTHB 2H51B 2RMLA 4A8WA 2I5JA 5D0HA 1TKZB 1X5PA 1VRTA 3GG1A 1S6OA 3ENVA 3W1YC 2XC9A 1SUQB 5I42A 4PWUA 2XG8A 1FXLA 4R25A 1RWUA 4LIRA 5LOQA 4M5IA 3U1NA 4DR2F 2CJAA 3I4HX 3IGVA 3S8SA 5LMUF 4G6VB 4BS2A 4TVAB 2QO3A 2IJRA 3EVOA 3KLGA 4U9RA 3VAFA 3M2UA 5KFYA 2WVCA 3HF5A 5KG4A 1QAIA 1HPZA 2CQIA 1SPBP 2EFVA 4F3MA 4F2RA 4OYIA 3ZFVA 4EUVA 1Q7YT 2D3UA 4H4KA 2HNZB 2RF2A 4ZOSA 5E33A 3BJYA 4OX8A 4Q5VA 2CPEA 4FKYA 1RA7A 1GK8A 1YJRA 4A8FA 2N3LA 2JEJA 4ZMMA 3H4DA 3ULHA 4KV8B 2FVSA 3GJRB 2HVHA 3CDWA 5D0RA 2M2BA 4WJBA 7FDRA 3ITHA 1NK8A 5KFLA 4B3MJ 4K4VA 2HAIA 2RE1A 2GQQA 1S7IA 2YKNB 5HAOA 4PXBA 4EWTA 4PUOA 2B5JB 2ZNZA 3P3DA 3BKFA 3W9HA 4ZCIA 2Z8QA 1KLMA 4ZP9A 3GILA 3EZ5A 3CWJA 1N48A 1MNEA 2CJ9A 5LSOA 5DGAA 2ZWPA 1S1TA 2MKSA 4FVMA 3R6GB 2M4MA 3C14B 2BE2A 1GAOA 1VC5A 2GGPB 2W2PP 1F2GA 1V3SA 4CO4A 5KFVA 3TO8A 2EC2A 2G4BA 4OX6A 3CB4A 3GR1A 2DISA 3GJQB 2VG7A 3OR1A 4OLOA 5CH7B 5DDRC 3SZ2A 2VASA 2UV8A 4CIOA 2HRYA 1PYOB 3K7RA 2H54B 2WB4A 1DARA 1RYSA 1Q95G 4Z37A 2IYIA 3O3LA 4QU7A 4YOEA 2E5HA 4TQSA 4A47A 4AXIA 1D8YA 4UOFA 2QFIA 1XWLA 1SJRA 3IM8A 5L1IA 1QJHA 2HNYA 4WE1A 3HT3A 4PG5A 2V0NA 4OI4A 4HL9A 4PXCA 3FK4A 4WFBQ 5D6GA 2UXBF 2BABA 2R9LA 1CULA 2IRYA 3CCWA 1CPZA 3QSIA 4USMA 2CVEA 2VBYA 3LTOA 4WKYA 4WIIA 1U49A 2F4VJ 3D0IE 4OV1A 2OSRA 1UJ5A 2M5YA 1S79A 2XLIA 4DUZF 2HIQA 4LR8A 4A8QA 3V4IA 1BQNA 3TUIC 3QRQA 1RWWB 2XSFA 4WIQA 3DCAA 1FWPA 3O44A 2X1GA 4YHHJ 3KLGB 1VI7A 4LQ3A 3IS9B 4P2FA 4UTGA 1XJWB 3MAHA 4DU8A 2HRUA 2HZAA 4DX7A 2LMIA 4H4KC 1X9MA 4R5PB 4NX9A 1NSPA 2B9EA 2LFVA 2RHSB 3W2VB 5F8LA 1K1SA 3I6PA 5B09A 3M9OB 4J9RA 3MHYA 1SC1B 3MMAA 1RWMB 2RQ4A 3SQOP 1VOMA 1ZBTA 4I4BA 2E5JA 4C48A 4XIUA 1KC8T 2KFNA 5C25B 1HQ2A 2MZRA 3ISZA 1FFGB 2V8PA 2ZKUA 3AD8C 5KAKA 5LT5A 5E41A 1IBKF 4EI2A 3OTOF 3SBMA 2LA6A 5DLFA 1U48A 4PCQA 4ZK7M 3J7YU 3G4SS 2RD5C 2R3VA 1SJ1A 1DZ5A 3PCOB 4EGLA 1FA0A 4QWDA 3W3SA 5KFKA 4ECYA 1H72C 3LP2B 1T8EA 1L3KA 4TU9A 2VU5A 2FHMA 3UWTA 4A46A 2RS2A 2NR0A 4ZN1A 3UNGC 5IFMA 5I42B 3I32A 3JSMA 1HW8A 2L9DA 2LQ8A 3FC9A 2X51A 2R7XA 4DSIA 2V4JB 4NXMJ 3GV8B 3TUPA 2RDDA 1KOHA 5CXTA 1MWQA 2NXUA 3OL6A 3V81B 4FKXA 1RXOB 2YKPA 5CCMA 3GMGA 4D3GA 2XGQA 2P9CA 4FXVA 3FNNA 1WI6A 1H3DA 4LVOP 3MM9A 1F5BA 2OD6A 4NZ0A 5H1SV 1R0AB 3KDOA 1ITPA 4NCGA 1N56A 3NCPA 3MPVA 2FJWA 3OSNA 3K5OA 2QGFB 1U45A 2CZ9A 1H98A 3ILIA 2V2QA 3GP9A 3W66A 2UXDF 1OPIA 2JNJA 4A48A 4UZCA 7AT1B 4FS2A 3MM9B 2B51A 4NLXA 1HR0J 2POKA 2MQ8A 3WBZA 1N5VA 1LK7A 4I6YA 2KG0A 2D9PA 4NXNJ 1FTCA 3Q8UA 4CT8A 1WF1A 3IAM9 1YITS 4CNYA 4WZQA 4RW8A 2VPXB 3OXFA 3PM9A 5D4NA 2VKRA 5KFZA 2YWHA 3KXDA 1F1BB 5CZVA 4CLSA 3G6VA 3T6BA 3BQ0A 1RK8A 2AD9A 4X66F 1TKTA 4U7UK 1HBNA 4ANEA 1KS2A 3M9NB 3G6ES 3UR0A 2J0SD 3D66A 1VLYA 2BM1A 5ETOA 1GMVA 4M5DB 3JSBA 2IIHA 2J0XA 2OPPB 2XZTB 3TYTA 4USUA 2FVRA 2PEBA 2FZKB 2VG6A 4M63A 4DR1J 1PC5A 2CJYB 2YH1A 4QR2A 2FLLA 1JNZB 2JLFA 1FD2A 2NZCA 4M94A 4EYIB 2FZGB 4B3SJ 4WFAQ 4Y00A 4P2SA 3SDEA 1DJ0A 2QG9B 4TY8A 4HHJA 4C98A 5I3UA 1TL4A 2BE7D 4DU7A 6AT1B 5L1KA 1ACMB 4WP3A 1YBAA 1F9HA 4ZLPA 5CAAA 3EZOA 4QWEA 3TJAA 2B7BB 2GO8A 1U8WA 2AGQA 4P75A 2PA3A 2RU3A 2P9GA 4LRBA 1QLNA 3QT6A 1D0EA 3CDBA 1V5VA 3SFGA 1JLFB 1RHJB 2OKQA 2HGLA 3LAKA 3SEOA 2P5VA 5J2QB 2HWTA 4LFBF 3MM6A 4MKBA 2CQ4A 3CVKA 5BXIA 2HZVA 5D4PA 1YHQS 2HEKA 4MKAA 1F2HA 1D8ZA 4IG3A 3CCJS 4YQWA 1PJ6A 4UT4A 3ILLA 1D09B 4LT6A 4Q2LA 1CQNA 2KZZA 2QRRA 1C0UB 2Y1RI 4OI3A 3I56S 1YJVA 2ZHBA 4B3RF 1WG5A 5GAGI 2AKWB 4TLRA 4QPTA 4X4UA 3CO9A 3G87A 3IRWP 3NG8A 4M5LA 2YNGB 4C6AA 2BKPA 4ZVHA 2J76E 4LFCJ 3CO0P 1EETA 4MKYA 1TK0A 3BSAA 2LEAA 2Z4PA 3AOBA 1G4CA 2IC3B 2D41A 3NWRA 2MHNA 3IRXA 3IFEA 5E7OB 5IT0A 3IN5A 3VGTA 1RU2A 3THTA 4C11A 5F8IA 4DV7J 2F40A 3IRXB 2BW7A 1GXUA 1X5SA 2LLZA 3BKUA 1FKPB 5A76A 5AJ3F 4B9UA 2KT3A 3HJVA 4OHZA 1FJ7A 1C1CA 4MYTA 1WHYA 5ITHA 3OPKA 4LF5F 3HVTA 1NLKL 4NI2A 5B0EA 5IV3A 5H9FK 2V2VA 1M1KT 3FRZA 2DCUB 2E1RA 1RAGB 3NCRA 3QWUA 3DRPB 3MEEA 1VBXA 3ZZRA 5HVGA 1U8SA 2E1MC 2YPZA 3FEXB 3CGIA 3KJQB 2VPYB 4OJ3A 4U96A 4F0HA 4ZLNA 2HW3A 1JNRB 2ZITA 5FDLA 2HS0A 5EDWA 2B6AB 4NXMF 2VQEJ 3J7A1 1SV5B 3GFXA 3KJVA 3SV4A 5D3GB 3PFEA 4Y2IA 1W26A 2XI3A 3FCVA 4HLBA 4DZ6A 4DBQA 1BD6A 5KOWA 1RT5A 1BHNA 2PI5A 1N52B 1N32J 4LF5J 1S1XA 2DH7A 2MKHA 2HBZB 2KDOA 4NE9C 5J1EA 4CO0A 1K9MT 2DNQA 3GG0A 5GADU 3BO3A 2BEFA 1BGXT 3AJ2A 3EGVA 4LFCF 2KYZA 2XMTA 3H5SA 4J9SA 3GFZA 3LALA 4NZ7A 5DZ6A 1EAYC 1V5IB 3MD3A 3W9IA 4N77A 1S9EB 1B4SA 4TYBA 5ADZA 5DDOC 2J0WA 3TW0A 1VDHA 3BB5A 2CPHA 1NK5A 2HPUA 1HHQA 4OJHA 5KOXA 2CPYA 1FVSA 4NRTA 2I2YA 4W98A 2R8HA 3NNCA 1X0FA 4IDKB 1ZOTA 2BJ1A 4NLRA 4KTQA 5DO2A 4DUZJ 2B4VA 4DV6J 3BSOA 3BGUA 2EC0A 3CJ4A 3KLEA 1OPZA 2V4JA 1WF2A 3FZBA 4X66J 2KXNB 4OX9F 4K4UA 2EFGA 1VBKA 4KGZB 1TU0B 4ICLB 4P73A 1RAAB 4HTJA 3MFHA 3D6TB 4I2PB 4ZP8A 1LOUA 1OY6A 3EMTA 3CMAS 2XYGB 2BOPA 1RA6A 1LFPA 1RAHB 1FK9A 1X0PA 2UXBJ 4ETZA 1FF2A 5HQ8A 1RBOB 1PBUA 2XCAA 2GJIA 3BR9A 2IM1A 2DBBA 2DHGA 2GHWA 3PW7A 3I31A 3SCJE 3UCGA 3R5JB 2KKHA 5GMKa 1QE1B 3L7OA 1HHSA 1RHKB 3FBCA 2VA3A 4L3NA 5CYMB 2ZNYA 1TL7A 4C8ZA 3CULA 4JI4J 2ALYB 2VFTA 1LQ9A 2ZJPQ 4DL4A 2OSQA 2GVZA 2MEWA 4WTYA 2E5LF 3RR7A 3SFUA 4N76A 3CC2S 2MKJA 3IS9A 2R7RA 2WVFA 3KMQA 3PACA 2BW2A 3OVBA 2JEGA 5F8NA 2JFDA 3V6DA 4TU8A 5KFIA 1X31C 1AW0A 1S72S 2G1DA 4O3NA 2NPFA 1GNKA 6FDRA 3E2EA 5CD4H 1RAJA 1HL6A 4Y0FA 2D3O1 4WYWA 1V6HA 4OZ3A 2RKIA 1KQKA 1WELA 5F8HA 2KG1A 3KK1A 4DR5J 3DYAA 2BQRA 3FEYB 1FE0A 1Q8KA 1XC9A 2DXEA 4IFYA 1YIJS 1JJHA 2H4YB 3O6QA 3VZIA 2DHXA 2H5JB 5A6PA 1WKKA 3AD9C 1HKAA 2C2RA 1U1NA 3GSIA 4B17A 4OZJA 3DGVA 2Q1LA 4K2XA 2AJ2A 4A8YA 2WONB 4NPOA 1SH3A 4DG1A 2NZ4A 1SXLA 1QTMA 1HBMB 4CO3A 3V5RA 2ROGA 2FLOA 4ANCA 5CD4A 4JI1F 4IOAQ 1OQ6A 2MKYA 3C15A 4MK7A 3R7BB 1XMOJ 1S4EA 1YQHA 1W25A 3VAJA 2GQ2A 2HMIA 1FCAA 4USJC 5I3QA 1LWEA 4CQ1A 1BQNB 3R5CA 5RUBA 4HR2A 5FIIA 1B7FA 3Q8VA 3MECA 3E8OA 2FJAB 3M8PB 4AE5A 3G71S 3K58A 3QPIA 2VQEF 3EJMA 1PC4A 2IDEA 4DOZA 1NB7A 5JJBA 2DPIA 2MB0B 2CJQA 4YR0A 1URNA 1RAEB 1FDNA 5EX3A 2HFZA 2JC1A 3D4JA 3ADAC 4DPWA 2KZMA 3JYTA 2UU9J 2YNHA 4CH0S 1IKYA 3VAHA 4NLYA 4G1IA 4ZHRB 3N9UC 3DC2A 3UDCA 1OY9A 1C0TA 5IOLA 4ZVRB 4NYPA 4GKKJ 2N7CA 3NRBA 2UVUA 2UUAF 1R3NA 1HI1A 1LWCA 4OJ1A 1T3OA 2C22A 1L3TA 3VALA 3M9MB 4P71A 1IR1A 2W2NP 1KVKA 1Y5NB 1S49A 1REGX 5F0UA 1MWYA 4MYUA 3M2UB 3FQLA 1UZDA 3IAS9 5IQQA 4B9TA 1ZYQA 1NKBA 3KJFB 2OEKA 1EKRA 4A8OA 3PR4A 3S6EA 1I5OB 4WK3A 4LF8J 3V2UC 3VGUA 2HHWA 3O8WA 1JMTA 2CPFA 1PAEX 2K7JA 4DL0C 3GZ7A 1VRTB 4FXWA 2JVOA 3OUYB 1REVA 1WD6A 3EE3A 1RT3B 1IWAA 2AZ3A 4YY3F 2DRAA 1P8GA 1NB2A 2RJZA 1PKUA 2I6WA 2AJ4A 3MAQA 5K14B 3X1LB 3RRHA 1SL0A 2YKAA 3MM8B 3CXCR 3PYEA 3VCDA 5HMXA 2BJ3A 2A0FB 2GMHA 3BH7B 4RX6A 4ZCLA 4D3HA 2YH0A 3FJ2A 5CQGA 4ZVSB 4ZPWR 4YN3B 5M2PA 1S0MA 2COLA 3H98A 2FVQA 1KFSA 1YRUA 4ATNA 1NH7A 3ZTPA 4ZDNA 1U1RA 2IBKA 3B6BA 1NPKA 2N3OA 2VG5B 2W25A 2W8KA 3HHLB 1FDAA 1FX2A 4F0MA 1NK7A 1EZZB 2YKNA 1O5JA 4C3MA 4K4SA 2Z2MA 1RAOA 3ZZZA 2GJFA 3DGPA 5B08A 4KGMA 5LSLA 3SV3A 3DGPB 4DN9A 2W9CB 1JX4A 2PMWA 4X62J 3T5JA 1RT7A 2I38A 3NNHA 2JEFA 1XN9A 2JEIA 1JLEB 3CJKB 4H4OB 3EYZA 2GV1A 2HNZA 3I0RB 3H40A 4F3OA 3ETMA 4ECZA 3B54A 4WBFA 2EK6A 2J8SA 2MLZA 1N4LA 3OBIA 4CH7A 3OTOJ 2WCXA 3W5ZA 4LRAA 5KT3A 1MW7A 4DV3J 1T9TA 1PAUB 2SXLA 1S6QB 2YKQA 3BYRA 3M6UA 4Z7CA 2MQPA 2XGPA 2BQUA 1RCOB 2J7KA 2MSTA 1RHMB 2OAUA 2RB7A 1EARA 3ILJA 3M32A 4QWBA 2DB1A 2HAFA 4DR1F 2OHDA 3QRPA 1IJFB 1NDCA 2ZOMA 2HZCA 4U8VA 1LW0A 2CADA 3BSNA 3NWGA 1QD1A 1WOSA 1S1WB 2ATCB 3N01A 2YWWA 2ZH8A 4KHPF 1RKIA 5H9EJ 2F3JA 3J7AN 4O3PA 2R7QA 1ZPWX 4MIWA 5B0DA 2YNFA 2ZBIA 2F8EX 4J9UE 5K14A 4IO9Q 1BQMA 3TAMB 4IFVB 3IWXA 3R9LA 4B9SA 1FWKA 1WF0A 2OMLA 5E3CA 2VQFF 3BQ2A 3UNYA 5HL7Q 5HQLA 3D6HB 5L1LA 4H4OA 4OFZA 2BR0A 3X3UA 4I1TA 1VQ9S 2DNZA 1UVKA 2CVIA 1JLQB 4ES3A 2LCWA 1UAWA 3D6MB 4CTAA 5AE3A 1VHFA 4QIEA 3S7RA 3EUNA 3CUNA 2X1FA 4GVBB 5HMYA 4OI0A 3HP6A 4ZPCA 2ZH1A 2VFVA 2DGWA 4FDFA 4DXLA 4AL5A 2F5GA 1UJ6A 3MAAA 4IOBA 1AUDA 3I5CA 4RBVA 2R8KA 2HHSA 1MWZA 4RNMA 4NL5A 1M5PC 3W2WB 2O1PA 3GV7B 2Z2LA 4A8KA 1PILA 4X64F 2M0GB 2B7CB 3M8YA 1FKOB 1CJKA 3MWBA 3PHTA 3TX0A 1OYDA 3KLFA 1HBUB 5THWA 5C24B 1Q78A 4ECUA 3D0GE 1CBKA 2XWYA 3HFVA 4CLKA 4EO8A 3TUJC 4ZLJA 1H2UX 3ENAA 4M8LA 1PJ7A 4RW9B 2VBWA 4OLPA 1CS4A 2E5GA 2PO4A 3JQKA 3HJFA 1VQSA 2MYFA 3B4DA 3GPAA 4HYKA 2UUWA 1JB0C 2V4QA 1R8HA 2B3TB 4KB7A 4DHVA 3LA0A 2H5EA 3F41A 1LXNA 2ABYA 1SJ3P 1SKWA 2V8HA 2HFVA 3FSIA 3NMRA 3NS7B 3E51A 2AJFE 2PA8D 4LSLB 4PG4A 3VGVA 4YDXA 2J9DA 2RIJA 2OEMA 2J6SA 1UP1A 1TL1A 5HBMA 1RKJA 1RGVA 1HA1A 3F44A 1RU1A 3LGHA 3TA1A 4OIXA 1FDBA 3PR5B 4HACA 3HSJA 5AXMA 1KDNA 5IWAJ 3NGDA 2H9ZA 4E8UA 4J9VA 2K3IA 3R5GA 3NMAA 4RJVA 1LEOA 5HANA 1P27B 4CLTA 5C7PA 2LXFA 3MOZA 1EX8A 3CSKA 2QL7B 4L72B 4IG3B 4RW7A 1SH2A 4X4OA 2QLXA 2QZ8A 4NLDA 4OHVA 2C2OB 3QWPA 4B08A 1S48A 1RTIA 4KC5A 3T1HJ 1HWLA 2QT7A 3AAWB 4KO0A 3K57A 2VJUA 5HLFB 3DN9A 2F9DA 4ZITA 1R6YA 3N0VA 4OHXA 4DL6A 4F26A 3CDAA 4JI0J 3NL0A 3TVZA 3PO5A 3TZXA 4ILMA 4KAIA 2E7WA 4EBCA 1H2VZ 2W2OP 5D0EA 3M8RA 2JSXA 4PPZA 2N82B 1LWFB 5IT4A 3HM9A 3Q22A 5DZ7A 1ICEB 1QE1A 2H3EB 4LFAJ 2VB6A 1TV6B 4CM2A 1H73A 3O5TB 1D9AA 1O0PA 1F9FA 1VK8A 2QSFA 3BGFA 3BN4A 3QNWB 4ENOA 2XMWA 1UJ4A 1MU2A 4ELVA 4H54A 2VOPA 4B3MF 4M5HA 3GIMA 2ZH5A 5KFPA 3D2WA 3PVXA 1C1BA 3BBBA 4ZVFA 3C15B 3D54A 1VC0A 1S1TB 1ZZNA 2XZWA 1U4BA 1RT2B 3NS5A 4HDHA 1KFDA 2XEXA 2IAJA 3ET6B 3HVWA 4QR0A 3V6DB 4YB1P 1I94J 3PTWA 4JYAJ 1PYSB 2QA2A 2IVFB 4ED7A 1LW2A 1SB6A 2KHCA 4FBUA 4ECXA 3PIOQ 1KVIA 1R27B 2BVZA 4KY3A 1VRUA 1S7HA 2C2EA 1YBTA 3AXMA 3M8SA 1CJUA 3OW2R 2PT0A 2F4FA 2MQNA 2A2CA 3AJ1A 2R7VA 5F8GA 1OSDA 1R31A 1VRUB 2B43A 2ZUGA 2E1PA 3H25A 5DM7Q 1K8AT 5LJ5Y 2VC0A 2DHAA 4PAAA 4FF2A 2UU9F 2IM3A 5DQIA 1R6VA 3DI6B 2WAQD 3BM7A 3KMSA 4PQAA 1URRA 2YPYA 5BR8J 1RT2A 1BC6A 1I1GA 3TJ8A 3M6XA 3P5BP 1GMWA 5T7LB 2BRLA 5E3AA 3UD4P 1QSSA 2Y1IA 1VK3A 4LR9A 2XS7A 2HG4A 2F8HA 3RW7A 2G1HA 3EVWA 3IA0A 3T1YF 4DFMA 3QT7A 2I5JB 4ALZA 4CLFA 3R1LA 4DCJB 2FVPA 2A6MA 3BBCA 2J9EA 2VV5A 2OPQA 2ZDPA 5HI7A 4QWCA 2MZ1A 3TNVA 1CLFA 1LW2B 4ED3A 5ETNA 3PO4A 2BKOA 1HWUA 4NA1A 4TNOA 2BA9A 2VONA 4B3RJ 1HQEA 2MY8A 3M6VA 3M1VB 3Q89A 3LAMA 4UZBA 4QYZK 4JBCA 4WP9A 2HS4A 1JQGA 3GTYX 1M1GA 4Y2CA 4DUYF 3V6KA 2VPWB 4O3RA 1YJNS 1YZ6A 2PD1A 2XS2A 2OLWA 2BZ2A 1JJCB 4F2SA 2ASDA 1T9UA 2MJNA 2FHKA 2ZH7A 1FK9B 2HQGA 3M8QA 1QVGR 2C3UA 3SCLE 1JXVA 1GX6A 1HD0A 2AW0A 3QFWA 4IG0A 3C3LA 4PG6A 4PG8A 4DV5J 4USKA 3T9NA 1RT6B 3WC0A 4RBTA 2GW8A 4N56A 3IR7B 4F50A 2NXJA 1U25A 2IHR1 2YKMB 2UV8G 2AEMA 2WSFC 4JI8F 4NLTA 3PV8A 1H6KX 1Q1KA 2CQ1A 1XR5A 3L4BC 3CJ8A 4USHA 4C3LA 4JB8B 4ILLA 4L6V3 2ATLA 3FMBA 1S6UA 1ZA2B 1YBUA 3V4IB 8ATCB 4DQSA 1IKXA 4JV0A 3DRPA 3MEEB 5LJ3Y 2HWHA 3F73A 4JI3J 1TL5A 2HGNA 2CNLB 1U1QA 1ZAVA 3CTRA 1GEHA 2WBMA 1DTQB 3C6TB 3OJSA 3GLJA 3SSRA 1C1CB 4R5PA 1S4FA 1X4BA 3DNCA 4TQRA 2HNYB 4JI5F 3CMES 2DJWA 3GIJA 2PMHA 3BGRA 3EDQB 1RHRB 2JH3A 4Q45A 4DI6A 2WBRA 3KLHB 4CTAB 3G8SA 2Q66A 4OX7A 1JLQA 4NXNF 4RW4B 3O2IA 1WC3A 3CT9A 4AD6A 2XY7A 3AOCA 2D74B 1HFEL 1RT6A 3LOUA 2OMOA 5F3ZA 1QSYA 5KT7A 1IXKA 2GX8A 3CCZA 4UQGA 2BX6A 1KSPA 2PEHA 5FDLB 4ZJOA 1K0VA 4Q8EA 2WRMA 1FJGF 3OVAA 1I94F 3DM2B 1RBAA 4Q7AA 1LV5A 2AIRB 1S0NA 4WK1A 2L41A 2VD3A 1E6YB 1AUSL 3DLGA 3DLBA 2MLYA 3TQ1A 4MTPA 3D5MA 4CZCA 2HVDA 1L3VA 2CQPA 3EICA 3KNGA 4MIBA 3QIPB 3FGVA 5ETTA 3TAPA 2BV3A 2L9NA 5CHCB 3ENWA 2KH9A 1YJ9S 5DDPC 4PRFA 2GVDA 4OI2A 2DTJA 3G82A 2MKCA 2O01C 4RL1A 2LDIA 3TEGA 3M32B 2UXCJ 3N4WA 4J7CA 2Z30B 3FKBA 4CWBA 1W2IA 4RW6B 3ZTQA 2UUCJ 4K50A 2R7TA 1RSCA 4PYAA 4ED2A 4WF9Q 4LF1A 1UA1A 3KG4A 3N6LA 3Q8YA 1S9GA 2Q79A 1NRKA 2C3OA 4X4RA 2VFUA 1LNQA 3EPIA 4MK8A 1TUGB 2F8MA 3C6UB 2BANB 3MM6B 4ECWA 2V9WA 1RT4B 2O66A 2XO7A 1NDPA 1QTNB 3ZZ0A 1HNZJ 2ADBA 4FPRA 3OSPA 1FVQA 2EWHA 3K5PA 2V4RA 4OQJA 1SUQA 4ZIVA 2EG2A 4IH5A 3PEHA 4USVA 3HD1A 4JV5J 3PX6A 2WTFA 1P9YA 4P9SA 4I0WA 1Q8LA 1Z2ZA 3JS9A 4I2QB 4XTTA 2HVIA 1PG5B 4DSEA 1GXLA 1X4DA 1CJUB 3HULA 2J6TA 1HBOB 3GR0A 5KT6A 3MR2A 2EFNA 2RNEA 5H9EK 4LF9F 1KN6A 2KT2A 2DNKA 2KFZA 4WP8A 2KHDA 4O0IA 2HS3A 3G6YA 1SKRA 3CDEA 3CE8A 3ET6A 3PRDA 2GHVC 4HTIA 5SUHA 2HK3A 4F4YA 1U1KA 2XLKA 4ZIWA 3GIIA 3DOMB 4DPYA 4LFAF 3PZPA 5L39A 4LUBA 3KUEA 4A4JA 4PZVA 3ZNJ1 4ZPDA 1N0UA 3HD2A 2R7UA 5B0GA 4N47A 1U0SA 1Y7PA 2CPIA 1JLAA 3HSGA 1S1UB 2MZJA 3KG1A 4NMXA 3TP2A 4RNOA 2UVRA 3NNAA 1AFIA 5LMUJ 1FRXA 1UEUA 4PG7A 2W8LA 1LXJA 3K8VA 4RU9A 4DUTA 4C7QA 1MMNA 3CEDA 2R42A 2ZC3A 2E1AA 3R7SB 3MM5A 2JWNA 3JAMU 2HHHF 3UI3A 1OSCA 2EK1A 3HLUA 1IKVA 5H9FJ 4EMDA 4HKQA 2C3YA 3CJ5A 3DOLA 1UVJA 4EBDA 1TMJA 2AHOB 2AYEA 3BBFA 1JLCA 2MSSA 4YB6A 3Q83A 5EUHA 2AT1B 3SIPB 2FLNA 2IM0A 4N5SA 2HLUA 3M2RA 1U2FA 4BC7A 1FWLA 2ZOGA 3MEDA 2YNHB 1U2CA 2FJEB 3A8JA 3K5LA 4DL5A 4L74A 4CLWA 1VQ6S 4QIFA 2A6OA 1IN0A 1J5EJ 4EO6A 2XM3A 2X1BA 2XHCA 1JLGA 3VR1A 3QRRA 1F60B 3TVKA 4KT0C 4UOCA 1A6LA 4JI5J 4DCPB 2CJKA 5HP1A 2K7KA 3HSZA 2IJNA 2WVDA 5L9NA 1M5VC 3GQCA 2HQDA 3HZGA 2AX1A 2HFNA 2QL5B 3M8WA 3HHLC 2OI2A 3DHWC 4UUWA 3KG0A 2W4DA 1WOPA 5B0AA 3PX0A 1DTQA 1TR0A 2W2QP 1VMBA 2OPRA 2VL1A 5CYQB 2ERRA 3PRVA 1BY9A 4K7QA 1N33F 2KI2A 3PYFA 3AH6A 5CYQA 2EW9A 2WW8A 2CQ3A 2IA0A 4JI6F 2DXFA 3RZAA 1YJWS 2J8AA 2W7OA 2W1BA 1FEEA 4F3QA 4YDDB 2MQOA 3UCUP 2E5LJ 1RTJA 1TVRA 2BJ7A 2K1RA 3I9ZA 3DLLQ 5IM0B 4LSNA 1LWXA 3VVTA 4CM0A 3BR8A 5HMWA 1EKSA 3QYYA 3RBXA 5A2QY 3BGLA 3D1OA 4E0DA 2OD4A 3L09A 4NCBA 4NCAA 5KFWA 2I1RA 1CC7A 3T3FA 1WOOA 1UFLA 3HVRA 2LU2A 1GX5A 3U7JA 3DMJB 3U1MA 1R8CA 2YNIB 2LQBA 2G13A 1KD1T 3BKTA 3Q2TC 1RB0A 1OY8A 3DRYA 2GAGC 4BLGA 4B9VA 5M2UA 1ZH5A 1HBUA 3PHEA 3H59A 2CXEA 5D4LA 3R1HA 4I7FA 2GVZB 5K8MA 4LF6F 2OPRB 1FFSB 4K2JA 4NYZA 3UDLA 3D1HA 5F9LA 5E5NA 1JKHA 5AE2A 2FJDB 1OO0B 3DRSB 3H8YA 3OL8A 1N5QA 5HVHA 4X4NA 2BJ9A 2CQGA 3OJUA 2YNFB 1F3VA 1KKHA 3CJ2A 4DV0J 3HHKA 4C9DA 1KR4A 2DGUA 3MEDB 4IYQA 3DDNA 4WFXA 1DHMA 4LSNB 4B3TF 1Q86T 3NOGA 4MIAA 3ZZYA 3C2PA 4B3TJ 4FS1A 1S1WA 3RB4A 2EBGA 3NCQA 4NLOA 5KG5A 2BE2B 2QC3A 1RTDA 5GAEI 5KFMA 1TKXB 2OJ3A 4ZLLA 1HNIB 1XTZA 4OZLA 3NS6A 5J1PA 4X4PA 3OVSA 3MDFA 4ICLA 5KFTA 4ZPVR 4JP8A 1LWEB 4G1PA 1RDRA 4FNIA 4IFVA 2Y0BB 2QEXS 2DNHA 3ETOA 4Q44A 5EN1A 2Z2ZA 1Z4UA 3FQKA 4DSLA 3D6FB 4FYWB 4IDKA 4KHMA 3T1HF 2C2KB 1R8AA 4DF8A 1TUWA 1ZTWA 2WSCC 4ZJLA 3DOKB 5IZHA 1N8RT 2ASJA 1J5EF 2CWKA 4YMEA 3P49B 4ZPTR 1XR7A 2C3PA 3W64A 2BYCA 2VJVA 4I6AA 3LF0A 1X4HA 2FY8A 5CZXA 1O8BA 4IRDA 2RQMA 5G0RB 2ZM6J 4NLGA 1WC4A 4TKTA 3SMZA 1FERA 3EGNA 1M5SA 2JDJA 2BKNA 3OLBA 5GAGU 5KFDA 2ZM6F 4BCAA 3WX8A 3OFFA 3QJJA 2HWIA 3O1LA 2CRLA 1VQPS 5KFJA 2PDAA 4WWSA 2HHHJ 1EB0A 2YWFA 2KFYA 2V8VA 3IR6B 1MU2B 1S9GB 3RGIA 3A13A 1RLDA 3N28A 1M1HA 3NBPB 4PYDA 4ZPAA 4W4MA 4A8SA 4JI6J 2Y8YA 1EQ0A 1P1LA 1MLAA 2QTWA 5FLXU 1CJVB 3NLCA 1T05A 2IRUA 2HNDA 3C66A 3UO0A 3DLKB 3KK2A 3POTA 1CVJA 2DH8A 2DR6A 2B8QA 2ILYA 1N34F 1U6FA 3ISND 2LA4A 3TI0A 3HCXA 4NLUA 1JLAB 4O3QA 3BO4A 4F4WA 2KB2A 3Q24A 4WFYA 3LP0B 3P8BB 3PX4A 2YKOA 4DPXA 3RAQA 1FI4A 3K5MA 1V9OA 2DPJA 3OFGA 3QLHB 4LF7J 3MMJA 5DETA 3UVJA 2AJ0A 2HVEA 3ISNC 1RHQB 3DLEA 1YRTA 1S5ZA 4USIA 2IMOA 2UP1A 1KQFB 4OHWA 1RWKB 1VR6A 1X8DA 1VHIA 3UN2A 3Q8SB 3MCMA 2RDJA 1AA1B 2VFRA 3KDNA 3ONQA 1E6VB 2DCLA 1SVDA 4ZS6A 2RRBA 1TKXA 3ILOA 1DTTB 3ZZTA 2M9KA 2BXJA 2KJVA 3F56A 4JI3F 4P7TA 5AXNA 1IM4A 1TL3B 2DGVA 1C0TB 2BOAA 3D7SB 1RTIB 4M5JA 4P2MA 1HYSB 1FE4A 3DLGB 1NPRA 3W60A 3BO2A 5GADI 4PQUA 2ZFHA 1NHVA 3IR5B 4CLLA 1IWGA 3MCSA 5L1JA 2ACYA 5K20B 2H48B 3PFOA 3RRKA 1L3SA 1VQNS 3PKMA 1J5OA 4C8NA 5CABA 3B4MA 4LRCA 5IT9Y 4RW9A 4URQU 2MXYA 3GYXB 3MCOA 4ID5B 1AZSA 2V2KA 3H4BA 1IKWA 1AYEA 2DK2A 1I3OB 3QT8A 4KSEB 1RWOB 2R8IA 4NZ6A 1J5OB 4BDPA 2GFFA 2L3MA 3M7VA 4Y65A 2EBEA 2L9WA 4LSZB 3WZ0A 2ALZA 3VQTA 3RAMA 4B9LA 1XR6A 4J9NA 4DV4F 4PABA 5ETSA 4EZ6A 3DRXA 4ECRA 1XNQF 3PEJA 3TA2A 3G9CA 3JYTB 3TANA 4O44A 5CA5A 1XNQJ 3AB4B 3A8EA 3BREA 2DEIA 3T6JA 1V3ZA 3A8IA 5AT1B 3R97A 3HKZD 2HRTA 1QSLA 3NAIA 2DYAA 3N6NA 4WU3A 4ZKAA 1DQ8A 2DGXA 1Y10A 1U2RA 4NA3A 1N5YB 1C0UA 3LANA 1U6ZA 5D8HB 5E2QA 4GMKA 4PPDA 3MF5A 2A18A 2A2DA 3UR3C 8RUCA 2KM8C 1FT8A 2Y1LB 3P4UB 1WEYA 4H4MB 4ZPBA 4F8RA 1HMVA 2HQCA 3EGWB 5DJBA 5BYSA 2JJ4D 5KFUA 2W9AA 2CNNB 3HDSA 4F04B 4P6QA 1TK8A 4AUKA 4DV3F 2C2ZB 2VBXA 3Q0AA 2EG1A 4L73A 4PEOA 2CWXA 3M8QB 2XY5A 2HIYA 5KG7A 2W4PA 5FD1A 2XS5A 3HHDA 1EETB 2W9BA 3WC2A 3UPFA 1LW0B 1YJUA 1C4CA 2DIVA 3GFHA 4QPXA 2ZHAA 2XNRA 5KFNA 3TZYA 2X3GA 2RHQB 2XMJA 2DITA 1MROA 2QJ3A 3ZTRA 2LKZA 1P1TA 1VFJA 2C2NA 3W62A 5G4DA 3FBFA 5ETQA 5ETVA 3GYGA 5EWFA 3R3TA 1FKAF 2QA4S 3A12A 2ZVSA 3JSYA 1RT1A 1FJGJ 2BJEA 4XAKA 2ZH4A 3TUZC 4DV6F 3K5NA 2Q3PA 3K89A 4ECSA 3FZ2A 2KXHA 3IXQA 1YX2A 5I3PA 2IMWP 2GNKA 4KFBA 3THPA 1SIWB 1JWWA 3HX9A 2QLWA 2QE5A 1HNZF 4DV1J 4ED1A 2W24A 4M95A 2J5AA 1GTEA 2X7IA 4RNFA 2G2OA 1WHWA 2KRRA 4F4XA 1F9EB 1S6QA 3IO1A 3KLIB 3OQ2A 4J9PA 2AJ1A 3KUHA 3JTPA 5B0CA 4TY9A 4UQTA 5CYJA 4Q0BA 5LL6d 4JV5F 3DLHA 3H5UA 1FNMA 2HBRB 2V34A 4WXWA 3OTEA 1K1QA 4I69A 5M2RA 4JI0F 2EI5A 3KUGA 5T7LA 2JFKA 4DSJA 1IJEB 1HWKA 4K0KF 3A8KA 4K59A 4O4RA 4YHHF 5K9FA 1NSQA 2QFJA 1YTYA 1IBMJ 4FXDA 1G1XA 2E29A 1FNOA 2APOA 2LQ5A 3HI9A 4DR7J 1VIOA 3NOCA 4ED0A 3KLEB 4G1QB 3NXZA 3MUMP 5C25A 5IWAF 3UFCX 1VQLS 1T9YA 1VLOA 1Z1ZA 2Q6BA 3D3CJ 4ZVPB 3NP5A 4JUZA 1RJJA 2U2FA 4DN0A 3K59A 3RR8A 4JI7J 2Y8WA 1Q5YA 2ZHOA 1K47A 2OFGX 4KFBB 4U7UD 2V2ZA 3AQPA 3G8QA 2DKOB 3ZZUA 4R8UB 1YJTA 2RU9A 3BQ1A 2CG8A 1S6PA 1UFKA 2ZE2A 3MM7B 2GJ2A 4Y2MA 4F67A 2V67A 4YS2A 1RADB 4YEAA 2ZH9A 1NK0A 2CKWA 1U0HB 1SH0A 2YVSA 1N36J 1GH8A 2VICA 1JJ2R 3NEKA 1SC4B 4M5NA 3OFEA 2CPZA 4CDIA 3AFGA 1RT4A 1NMEB 4IQMA 3AHPA 2HKEA 1UWBB 4DUYJ 1ZAWA 3HVTB 4NI2B 2CPJA 5A8RA 1O6XA 4C8KA 4KGVB 4N41A 2CNOB 2HHTA 4I68A 3SXLA 5HLFA 3UQSA 3CC4S 4GVLA 3J7YI 5A0YA 2WK4A 3GFYA 2QSWA 3OL9A 4HEA9 5DQGA 2NUHA 1NPPA 4CH1A 1JKHB 2XBPA 3Q2SC 1TL3A 1H2TZ 2UUAJ 3A3NB 4C8OA 4FYVB 4HI2A 3SQGB 1F0XA 2P8IA 2DNOA 4WPAA 1HNXF 5C42B 1RABB 4U8YA 4USWA 1FEHA 3M8PA 1CS4B 1WEZA 3VF0B 2QLBB 4OYOA 5C42A 4DR2J 1X4CA 1RWNB 2NXCA 2P2CB 5KFOA 4O3SA 4ZN3A 3HO1A 3L9ZA 3H42A 1HWIA 4ECQA 1AB8A 3M6WA 2GIFA 3RUBL 1WEXA 2ROPA 2F1FA 3CDUA 4RNHA 3T5HA 3C8YA 1HR0F 1YWXA 4Y2KA 1WC5A 3S1TA 4ANDA 1G3OA 5KG0A 2NLWA 2UXCF 4R0JA 2VH7A 1B70B 1WHXA 1Q0NA 1Q8BA 1UL3A 2HHQA 1EP4A 2OUGA 2WONA 1OWXA 1UWBA 2R7SA 1UMJA 1YRXA 3GSDA 4LBIA 5BYQA 1DTTA 1N5TA 3P45B 2XY6A 4IQXA 2GQCA 4K5SA 3UW1A 4FBTA 4KJIA 3NKYA 1RTHB 4I64A 1HD1A 2PSZA 2I0XA 3LGNA 2XI2A 3PJ9A 4RW7B 3W5XA 5K5MA 3L3CA 3RAXA 2RKIB 2Z56B 2VBZA 2E7XA 2PN6A 2M70A 3BGOP 3KK1B 4Q43A 4TY8B 1T02A 3CD5A 4HDGA 3BYPA 3DOLB 3KHLA 2CDRB 4NMLA 3VGSA 4J9MA 1G2EA 4IRKA 3HHEA 1ZS6A 4IOCQ 1ZM3A 2RT3A 2V9KA 4IRCA 2HK2A 5A8WA 1KWMA 1NHKL 2VDIA 5F8MA 3AB2B 1JLFA 4WE1B 2J0QD 2KVIA 1YI2S 5IM0A 2EPIA 1VQ4S 2ZBPA 2AP6A 1S1UA 4LF6J 1VQ8S 3BSCA 1JLGB 1K44A 4OYWA 5IXUA 4DV1F 3P6YC 2BJDA 2HSEB 2YX4A 1U1PA 1BUXA 2GMJA 3T9ZA 3PW4A 3AY0A 3Q8QB 3BDPA 2WZ1A 3GWCA 3GCWP 4GKJJ 1I51B 1R0BG 2MPUA 4ID8A 4MAKA 1YJ7A 1XMQJ 1IBKJ 1HI8A 3PNIA 3EXYA 3R8YA 4XK8C 2AYGA 4PXDA 4AFFA 1JJ4A 3IM9A 4ZVTB 2HFSA 3QATA 5L38A 2LYVA 3R27A 3KHHA 1UTAA 2FD2A 1TZ0A 5F0WA 4URGA 3NGSA 3HHLD 3B8HA 1ZPVA 1NK4A 2CZVC 2D7SA 2CJBA 4DZDA 3D28A 5CCLA 1ZA1B 5HATA 5J1NA 3VTIA 2NSCA 3GE9A 3HKWA 4S0MA 3QQCD 2BM0A 4GC6A 1X9WA 5DDQC 4DQPA 2R2SA 1Q7LB 3MEGA 3DXSX 2NXNA 3ELHA 3M30B 4R0EA 5HBMB 4GVBA 1NKEA 2AZ1A 4ED6A 4EZ9A 4KV8A 2HHUA 4J37A 2B4UA 4DR6J 3W9JA 3CD7A 1S57A 4IH6A 4N7TA 3I9V9 1S9EA 1HNXJ 3CD6S 1FXRA 1XERA 3JSMB 2ZH2A 3W61A 4NRUA 2G9OA 2GS8A 1Q81T 4GRSA 1CJTA 4LQ9A 1RWPB 3MUVP 1B3TA 4PUOB 3M05A 8AT1B 2B9WA 3OTCA 4NLPA 4JYAF 2FB0A 4XO0A 2ADCA 3JTNA 1KVJA 1YSJA 1Q82T 1RT5B 2HURA 2L08A 4LBPA 5T41A 3RB3A 3HXMA 2DGQA 4HH0A 1S76D 5IS2A 4NLWA 3CJKA 3H2VE 3HT0A 3LPEA 4X4SA 1Q5VA 5GAHI 2C2DA 4C0BA 5AJ3J 1FTRA 4P2XA 4ZCKA 3DOKA 3QIPA 3PY8A 1REVB 2JOQA 2PGCA 2QN6B 4FVCA 4C0OC 4CYUA 3PDNA 4X64J 2OH2A 4IR1A 1S1VA 2HQIA 2NSBA 4QJVA 2C2MB 2GA7A 3D9BA 3V4MA 4LVNP 3PXGa 2HVZA 1FX4A 3CW2C 2YQ0A 3MFIA 3CD0A 2UZAA 1GXTA 1APSA 3HFZB 2AWZA 3D1QA 3L7UA 2BRKA 3MM8A 3I96A 3R6LB 3KHRA 2YWGA 1S59A 1HNIA 4FF3A 1D3WA 4DLGA 3EM1A 2MKIA 1GQEA 2LQJA 4OYAA 1RP5A 1F6TA 3RYLA 4DCOB 5A8KA 3PG9A 1RAFB 2HHPA 4NEYA 4YP3A 1T03B 5D3GA 1KQSR 2DIUA 2B8PA 2QLFB 4KKOA 3WIUA 2MQQA 2W9CA 4Y2AA 1N33J 4FZVA 2X1AA 1T7PA 1BE4A 1AFJA 1XBWA 3NY0A 4K0KJ 2CQHA 5B7WA 3BPSP 4J9KA 4MT1A 4CLYA 4O4GB 3HHNB 4ZP6A 3DRRB 2J7UA 4J91A 3OR2B 3H7HB 3LQVA 2XO6A 1FESA 4KGKA 5I4MA 4EYHB 5J2PA 3LWLA 4GO5X 3UCZP 3J81U 3GCXP 2CQBA 3NGRA 1OS5A 4I7FB 4V1Ak 4EFAC 3UDVA 2ZWOA 1M5OC 1UKUA 4OX9J 5LSRA 2FGOA 3VAMA 4ZVUB 2ZC4A 5HJXA 3SQGA 4K4XA 1HI0P 2DO4A 4RW6A 4X65F 3MI7X 4B3OA 1CULB 1RZMA 2WOMA 3LO3A 1TQLA 3T5KA 5DRKA 1TUVA 1NJWA 4WKRA 4Z7YA 1IKYB 5IT9U 2OEJA 1UPMB 4DJBA 4JV1A 4Y28C 1KRPA 4ILRA 1HBMA 3PW0A 2F9JA 4LF9J 4NEZA 2EKNA 3TX8A 3QSYB 1K73T 4RW4A 1DFDA 2FTRA 1KONA 4DQIA 1TL1B 2V94A 3OR2A 2BMBA 2V63A 1XEZA 1YZ7A 2W01A 4CI0B 3DLJA 5JVHQ 4G1QA 3CPWR 1U1MA 2MDAA 3PJXA 3Q8RB 1S10A 2DR8A 1SCJB 2FUG9 4JI7F 4C4WA 1QUPA 2LEBA 3J7Z5 3CJ3A 2F7VA 3OXGA 3J81Y 4NA2A 5F8JA 1AXQA 1HNVA 3SSQA 5KG6A 3IG1A 4QWAA 3G96A 1QAJA 4B3OB 4HVZA 1KLNA 1NCLA 1N88A 3ENQA 3G2XA 5HJYA 1S6PB 1GT8A 2ZE2B 2HMIB 2IA6A 1XK8A 5HVFA 4DSKA 2XMVA 2ASYA 1SC6A 2XZDB 3DDKA 5DGBA 4Q0BB 3CCES 1ZM9A 4DV2F 1WSVA 1NBEB 2B56A 2FZCB 3AD7C 3B82A 3FSXA 4HT5A 4Y6IA 3SCKE 4ED4A 4ZHRA 3PIPQ 4DR3F 1U7LA 4LREA 1YGYA 5DM6Q 1HBOA 5I3UB 1XIQA 1RYRA 1T3NA 5K8PA 2FPHX 3OL7A 4LJMA 2CAJA 2CZ4A 2W4CA 5CYMA 3WX4A 3KYLA 3FVYA 3PKYA 3AODA 2LDYA 3TA0A 1U1LA 1WC6A 3AQOA 1S77D 4RR5A 5JXSA 2DY9A 3H0PA 4KIAA 4UOGA 4X2BA 1NZ8A 1UW9A 3BPDA 5FLXY 1X7VA 1IUJA 3C16B 4P74A 2F63A 1HWJA 1RCXB 4RZRA 3K2YA 2OPPA 3DYAB 1G7CB 5GAHU 4CO5A 2OIHA 2NYIA 3JQJA 4BWJA 3EPGA 1WTBA 4IUFA 1IKVB 1NU4A 1XMBA 4RPFA 4CCHA 2EXUA 4N8NA 3OTDA 3QFHA 1FRJA 2DGSA 3CCSS 2B4PA 1TK5A 2OTJS 4I2QA 2DR7A 4QQBA 2C42A 1ULRA 5KFXA 4FYDA 2NUUG 2OPSB 2QYCA 3TQEA 5KG3A 5D4OA 5DLGA 1FJCA 2P6SA 5BR8F 1HQUB 2RUGA 1IQZA 2QIFA 3MEGB 3W8GA 1EJ7L 5C2GA 5IQ6A 2LECA 1TL7B 2GIQA 2WVEA 3THVA 5L8RC 3PW5A 1N34J 3QZ7A 1QAYA 3MMCB 1SI9A 2HHVA 3I5BA 1QAXA 4PR6A 2XMAA 3MR6A 3TJ9A 2RUSA 4YR3A 2ZBCA 1LKZA 1FHTA 2DRBA 3CJSA 1IBLF 1VJQA 1TP7A 2U1AA 3AA9A 4L76A 5HQMA 1T11A 1PO6A 2H4WB 2OPSA 2W7PA 3A3OB 1YVFA 5L9XA 2XTJP 1LWFA 4DV5F 3CJQA 2JX2A 3EZUA 3OTBA 3ZTSA 2YBVA 4RUHA 2JLGA 2OFHX 2QMWA 1TMMA 2JL9A 4JI8J 1N6QB 2EFOA 3WDOA 4L75A 3M2VB 2FHJD 3GIRA 2XCPA 1JK9B 5ETMA 2AQ4A 1R8PA 3QGPA 2RS8A 5IC4B 1NJIT 5GMDA 2Y3YA 3JSRA 4OZ1A 3KLHA 2G0CA 2VKZG 4K4WA 2HYIB 4CLPA 2OO4A 4KYZA 4KH1B 4DV0F 4KRWA 3R2DJ 2YNIA 1IKWB 5J1EB 2DNYA 1QM9A 2VG5A 2HFOA 1S12A 1T94A 2P6TA 4DL2A 2M88A 2RVJA 1HIYA 1MN7A 3ICLA 3MPWA 2HBYB 4OI6A 3G6XA 3BH6B 4DR5F 2ASLA 4IR9A 2E1CA 5IC6B 4DSFA 4O44B 3Q23A 2CQ2A 3VAIA 1CC8A 1N5YA 1Q79A 1SJQA 2NCKL 4G3IA 4UY85 4NWBA 1SV5A 4J5OA 3MURP 1UPPA 1SIZA 2B6AA 2DT9A 2RRNA 4ZVGA 4ZCMA 2VDHA 2CDQA 4HH1A 1B99A 4AL6A 3RBDA 5A2QU 4EEYA 4B9NA 2DXDA 3KJVB 3VAKA 4TLQA 1HMVB 4LRFA 3C6TA 3DU5A 4DV4J 4DR6F 3CCMS 2AMCB 3ZO7A 2V8GA 2BBEA 3ZNUA 3QGGA 2DR9A 3QJLA 1ROFA 3I87A 5EWEA 3HVAA 3US5A 5IV4A 2D3OR 1TAQA 3IC1A 2FGCA 1WHVA 5HP1B 1UCNA 1U1OA 1U24A 3L95X 1M0SA 1U09A 3MTKA 2B5JA 2XULA 2YKMA 3DHXA 4MFBA 4O4GA 3MR5A 1J2VA 4MFBB 2AX0A 1B7YB 1JLBA 3MXHP 4UW2A 4L3KA 3QAUA 1T0TV 3W7BA 1YDLA 3HK2A 1Y11A 1H7XA 4CLZA 1DQ9A 1FRMA 2AEJA 2EVZA 2XWXA 3DLKA 3IBWA 1OMSA 2CG4A 3MPDA 4IG0B 1NM2A 1PCAA 1PIEA 4KKOB 2PFFB 2JHEA 1JLBB 1RTZA 4FYXB 1R8BA 4IO1A 4M1KA 4F25A 2VIHA 2WB1D 3ZXWA 1M90T 4DF4A 1VJWA 2MMYA 2DVIA 5KFAA 3VWSA 2JZ5A 4P7VA 4Q2MA 3DXBA 1RISA 3CIZA 4ER8A 2GZOA 3VZHA 3LWMA 2E5IA 2Z2YB 4FF4A 4F4ZA 5J2MA 1U02A 3T1YJ 1KTVA 1KOOA 1UW4A 2QX0A 2Y9HA 1TAUA 3EDRB 3DLEB 1U0HA 2FC9A 3NGTA 4LSLA 5D77A 3VQSA 4LF7F 1HNWF 5GMEA 4XPCA 1R0CB 4C11B 4HHHA 2D3ZA 3K0JA 2XYPB 1CJVA 1BWEA 1KBRA 4Y34A 4Y3CA 1NEEA 2O67A 4XDDA 4ZP7A 3GIKA 2DNPA 1VC6A 2WVBA 4UOHA 4B9MA 4DFPA 3L7PA 3DOMA 1UVNA 4OZ5A 4ECTA 1I6JA 3MMBB 2RRAA 4JI4F 2VC1A 3RBZA 3N5FA 3N79A 2PE8A 3W8PA 3UD5A 3NBPA 4O0NA 2W2MP 1UVLA 4CO1A 4N8OA 3TAQA 1X4GA 4FF1A 5KFFA 1N6QA 2R2RA 4WTOB 3PJWA 4ZVOB 4C3KA 2J9DE 1VCTA 1CEZA 4DLEA 1S0OA 1NJXA 2EFPA 4CO2A 2GIRA 4OZNA 2WHOA 1NJYA 3KLIA 3CC7S 1TV6A 1X60A 2KM8B 2KTQA 2FJBB 1W7WA 2IFXA 4WFNQ 2CQCA 1T05B 4J90A 5KT4A 3ZC4A 4BC9A 1XNRF 2DHSA 4ELUA 2BANA 1QY7A 3EWGA 1LFWA 3IP0A 3R7NB 4C8LA 2HBQB 2P9EA 2MGZA 1L5UA 4DR7F 1GFWB 2MZTA 2VODA 2IRXA 4KO0B 2ZEJA 2VF3A 2K8GA 2CNKB 3I0SA 4ECVA 1B0PA 9RUBA 3NAHA 1IQTA 2HQ3A 1Y9OA 3KLVA 3FCHA 4UF4A 1HNVB 3C16A 2UUBF 2KO1A 4F4KA 1RE1B 2NPIA 2GVDB 2Z0GA 4KR0B 1H7WA 4O3OA 4DPTA 2H5IB 4Q8FA 2F4VF 1IM6A 1WJ9A 4UUXA 4E2FB 4K8RA 1VQ7S 3CCQS 3MD1A 1NXIA 1C4AA 1XNRJ 4YFUA 4RW8B 3T5LA 1N36F 2FJVA 2LP4A 5KT2A 1VIXA 4RLEA 4OV6A 4BHQA 1H38A 3RG6A 2A10A 2N7YA 3TZWA 4TYAA 2WOMB 1WDTA 2IPOB 3VHQA 2AYMA 3HZEA 5E3PA 1DLOA 4OYZA 2KVQE 5KFCA 1N54B 2B4OA 4MMOA 5C5JA 4LBHA 2R7WA 2B0GA 3EX7B 5DG7A 1VQMS 4HACB 4V19X 1MROB 1LWCB 3H5YA 2PFDA 2CYYA 5C2CA 4NCGB 2ZDOA 4NLSA 1KP6A 1FD8A 4RWXA 5K8OA 2IBOA 4EK2A 1VGYA 1ZM2A 1Y5LB 2XSJB 3TVYA 1H0HB 2UVWA 4W92B 3CIMA 4KHPJ 2AU0A 2KYXA 3AXKA 1YLXA 3DMJA 3DU6A 4K5RA 1R43A 3RB0A 1W2BR 1D9DA 2FJXA 2PI4A 4OHYA 2G2YA 5A8WB 4X4TA 1RT3A 3UD3P 4AYBD 4LF8F 2DY1A 3LGMA 3OUYA 2VZ9A 1TELA 2M8HA 2ZOFA 5LMNF 4ED8A 2VHGA 3KOAA 3QGIA 2VG7B 1F5CA 1WDDA 2JLEA 5AE1A 5LXYA 5KG2A 2AGPA 4I6WA 4JI2J 2AV5A 1RTJB 1TVRB 2K1RB 3RJMB 1WTFA 1CSJA 3C14A 3EGZA 2DNNA 2RQKA 4ZVQB 2CQDA 4DS4A 4EBEA 1KQGB 1KTQA 2YXLA 1EQMA 6FD1A 1FJEB 4QCLA 4DPOA 1DLOB 3FRYA 1NNDA 2UXDJ 3KNAA 2IVYA 2XMMA 4QIGA 1QDUB 1T9XA 4NOHA 3MR7A 2AGOA 3CJ0A 3TARA 4GO7X 4OJGA 2N4DA 2O5DA 1TKDA 2VA2A 2FLPA 4PQUB 1IBLJ 1PGZA 4NASA 3KFWX 3GYNA 3MPYA 1VS3A 2LU1A 1HLWA 3FBEA 2IC3A 1NK6A 4PWDB 1R7IA 1UFWA 1X5TA 2ZBRA 3LW5C 1SL1A 3MZIA 1SBRA 2Q6CA 3FDSA 4FP9A 3RU0A 2DEJA 3WIVA 2IM2A 1SQFA 4U7CA 1SL2A 2IY5B 4XPEA 4MJKA 1J27A 3K17A 2ROEA 3OR1B 3K8WA 3M1VA 5E3QA 3T19A 4DX6A 1D1UA 2J9CA 3AJDA 4X4VA 1FO1A 2JRSA 2QMXA 2R7OA 3DFEA 2YTCA 4CRJA 1NH8A 4ETXA 1JLCB 3HMJG 1NJZA 2K2PA 3AA8A 3ITHB 5B0FA 3M4XA 4KE5A 3RB6A 4R8UA 2AEFA 2D1CA 4QR1A 1Y0HA 4CYUB 4KQZA 2XHWA 3H90A 4QBUA 2GMLA 5JVGQ 3OLAA 2QYGA 5HROA 1HHTP 5A8RB 1KLMB 3SCIE 4KPCA 4QIVA 3PW2A 1KNZA 3TZZA 5A8KB 1A0OB 1VBYA 4ITSA 2IJFA 3SSSA 4F36A 1OYEA 2N4CA 3CCVS 2LXIA 1HPZB 4RBUA 2FIUA 3GJSB 1TFWA 5J2NB 2CA9A 2KL8A 4OZ0A 2GGPA 3MEKA 3I55S 4LF4F 3HFKA 2PMZD 4ZA1A 1WSRA 5KFEA 2NXEA 4WCEQ 1T03A 3DDIA 4ED5A 3BF4A 1WG1A 3RRGA 5ETPA 5D15A 1MG7A 5GAEU 4AT1B 4I2PA 3CCLS 2V6AA 1AT1B 2OELA 1A9NB 3EVMA 4KHRA 4M5KA 3H20A 3E01A 5SZTA 4ELTA 3QMQA 3P96A 2FQQB 4IFYB 4YB5A 5G0RA 4X4QA 1X4FA 5KFQA 2KRBA 3E01B 1UWAA 3OHBA 1TKTB 2IYGA 1PJ5A 3BZQA 3VV2B 1D9FA 1PYTA 2J7WA 1CJTB 2ZUAA 3C6UA 3CJTA 4QYRA 2ZJRQ 1RQ0A 4W90B 1JIHA 4TN2A 1E6YA 3U27A 3NGUA 4TU7A 4AQYJ 1RT1B 3BN7A 2RH3A 1WC0A 3DM2A 2NREA 1YG0A 1S9FA 1MMDA 3JXOA 3WQPA 4YUDA 4ZVEA 1SKUB 1NDLA 3MMBA 1WI8A 2J6UA 2M8DB 2ZH3A 1T95A 2W7AA 3OFHA 5KT5A 2DGOA 1MMLA 1NSAA 2MJUA 2UVVA 1WKLA 1RT7B 3A4TA 4BBYA 1HNWJ 1P6TA 3JTOA 4P72A 4KGXB 5D78A 4RUBA 4E98A 5EGYA 3BV8A 3H5XA 7FD1A 2E9RX 2YWEA 1IVZA 3BGRB 2EKYA 1FRHA 1KHWA 4OYMA 3UDEA 1NDKA 5ETKA 3J81j 3OHAA 1U26A 4AL7A 2UUTA 1QVFR 2B9XA 4WXOA 2VPZB 4J9OA 3QZ8A 1S97A 1BXNA 4JI2F 3KHGA 3R5AA 1IR0A 5ETLA 1RWXB 5LMNJ 3LUYA 2QMUB 4NYOA 2LEPA 5GVQA 2NQPA 3FFIB 1SQEA 3H2LA 4HHUA 4X62F 3MOJB 3D0HE 3IGNA 2HFUA 3CCTA 1LK5A 3IMQJ 3FMWA 4OMFG 2GO9A 3Q86A 1FRKA 1GMUA 4QZVB 1N32F 1HARA 4M5MA 1Y3KA 4FYYB 3I82A 1VISA 3IWNC 3GONA 4DDFA 5B0BA 2DR5A 1A7GE 1NAQA 2DGTA 2WW4A 3M8ZA 4LRDA 4LR7A 5A0YB 2OTLS 1BLUA 3VAGA 4RKUC 4HT7A 5KFBA 4C8MA 3QBCA 5BJRA 3ZZOA 2M7SA 1XMQF 2R2TA 2FHOB 2DNMA 3G86A 4DWIA 5HK4A 2YX1A 5EHHA 4FNHA 2MLXA 2YQ3A 2ZD1A 4M5GA 2QV6A 2ZBQA 4QW9A 4QU6A 2CJXB 4PKDB 4RO0A 1PSDA 5F41A 3UE2A 2PIIA 4BWMA 4G65A 5J2MB 4DV2J 1FDDA 3TEHB 5DG8A 2V68A 3LP1A 4DV7F 2ZKTA 3ZZPA 4QYZJ 2ZD1B 3CNQP 5HMZA 3D3BJ 1ZTTA 4LF2A 4DS5A 5AXLA 4FN5A 4U95A 2XQCA 1UEVA 3GB0A 5DQHA 3CJRA 2AF6A 1RUSA 2VQFJ 1RHUB 1Z2LA 1EP4B 4KH0B 1ZZFA 3T41A 3CCRS 1UVIA 5E3RA 1XMOF 4C8YA 4I67A 4F02A 1RTHA 4O23A 4ES1A 2CUYA 3RTVA 2UUBJ 1UETA 2R8GA 1JXLA 2A3JA 4ES2A 2G2ZA 5D0GA 2ZH6A 1AZSB 3JB9k 1C2PA 1GTHA 2E44A 2MY7A 2OP5A 3MCNA 3TWZA 4YB7A 5KFSA 1ZM4A 3MECB 3RBEA 2ILZA 2KXFA 4DX5A 3M2RB 1FKPA 1Q53A 4P52A 4A8MP 1EIYB 4A8XA 1MSWD 1X4EA 2LQ9A 2PC6A 2VFSA 1V3RA 3A3PB 3IBCB 3SI8A 4JV2A 4UY8T 1BMQB 2ZZNA 2C1EB 4Z2XA 4EU0A 3TR5A 2OPQB 2XMKA 2CPXA 4URSA 5K8NA 3M2VA 5U47A 2Q43A 1B0VA 1F3FA 1PBAA 4DEZA 2AJQA 2GCFA 3KTQA 2CFXA 4DG1B 3H2UB 1HQEB 2EFQA 2YNGA 4U6PA 4J9LA 4F0KA 3FBBA 4LIWA 3OV7A 4QOTA 1S0VA 2HQFA 2FY1A 3QAEA 1WWHA 1U6BA 2GAHC 3UN5A 4AQYF 3QGHA 4QW8A 2FYXA 3S01A 4F4AA 4RWWA 1VQYA 2LXUA 3J80Y 2BDPA 4LMZA 2BJ8A 1X4AA 2HLTA 2FC8A 1TFYA 5ETRA 3MTJA 3VVUA 2WSEC 4JI1J 2NS1B 1JLEA 3DKDA 1NK9A 1IBMF 1BWVA 2M52A 2MZSA 2MZQA 2V50A 3I4PA 5J2NA 4I56A 1VRQC 2EEYA 3GJTB 4JOUA 2KT5A 4CT9A 5L46A 3J7ZT 3CF5Q 3AOAA 3N5BA 1JXEA 2DH9A 4CLUA 2W9BB 1SJ4P 1M5KC 4IKAA 2XMUA 3MM7A 2DO0A 2CPDA 1S1XB 4DFJA 1X9SA 3D68A 3HHLA 4MK9A 1Q16B 1DRZA 2XYHB 3QO9A 2L48A 5A6WA 5HROB 1CG2A 3OT9A 3GU0A 1ZETA 3C46A 3QO9B 4X65J 3SYZA 3EXCX 1WNEA 1NO8A 2I8EA 1C1BB 1KHVA 4OYBA 3A1YG 4PWWA 3G8TA 1UA0A 3T1AA 1FRIA 1SC3B 2Y1JA 1NHUA 4H4MA 2FVCA 1FNXH 4OYXA 2ZZMA 2XNQA 1DAXA 2IAJB 2RSQA 3OD2A 4K4ZA 1GMWD 4CP5A 3IWLA 2DD8S 4USTA 4NLQA 2E9TA 3NGKA 2K06A
chains in the Genus database with same CATH topology
4GVBA 4GVBB 1KP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GVB A;  4GVB B;  1KP6 A; 
#chains in the Genus database with same CATH topology
 2F65 A;  3KKF A;  1RWV B;  1B0T A;  1DY3 A;  1DUR A;  4RU2 A;  4DR4 J;  4DL3 A;  3MMA B;  3WHI A;  3V6J A;  1R89 A;  5JMN A;  2K3K A;  2KU7 A;  3P5T L;  1YK9 A;  2H65 B;  5HO4 A;  3U1L A;  2MKK A;  5KFR A;  5FJ4 A;  4WU2 A;  2NYH A;  3KWM A;  4F7V A;  1DQA A;  3C19 A;  3DRS A;  4IH7 A;  3CCU S;  2A1B A;  3G82 B;  3N6M A;  4B3S F;  3E3X A;  2DNR A;  2Z58 B;  1RI7 A;  1UZH A;  2E7V A;  4DQQ A;  2HGM A;  2QA1 A;  3RW6 A;  4RUA A;  1O51 A;  4C2M A;  1NKC A;  2R4F A;  3LP2 A;  3I5A A;  4WYL A;  2B9Y A;  5EWG A;  2QLJ B;  1RTD B;  1M5H A;  3HPO A;  4ERD A;  1RLC L;  1SQG A;  3V6H A;  4PWD A;  4DR4 F;  2JVR A;  1Y00 A;  2E66 A;  2MQL A;  5C24 A;  3KLF B;  4K4Y A;  1SJF A;  2MQM A;  1KEK A;  3W5Y A;  4LF4 J;  3MGJ A;  2MHE A;  2YX7 A;  3BDE A;  5J2P B;  2IVM A;  2BQ3 A;  2XB2 D;  5HSP A;  5DG9 A;  3PYD A;  3R5D A;  4K4T A;  1Q4R A;  2CIM A;  3DRR A;  2V69 A;  2YY3 A;  2VUG A;  1OJ4 A;  3UN3 A;  2DRD A;  2RQC A;  1WC1 A;  4RUC A;  2H1Y A;  1YKW A;  2DNG A;  4U67 Q;  5F9N A;  3LP1 B;  2OGU A;  1WOR A;  3U02 A;  2ACM A;  1VQO S;  5JUM A;  4C0H A;  1VYA A;  1Y3J A;  1VQK S;  1F5A A;  1FKO A;  1QUV A;  2FDN A;  3QID A;  1ZAX A;  3IG1 B;  2I9S A;  4DL7 A;  1BQM B;  3TAM A;  3MAA B;  1WAC A;  5BYR A;  2G0J A;  5T14 A;  2JC0 A;  3W2V A;  1U47 A;  1IKX B;  2D69 A;  1NZA A;  4MKV A;  4P10 A;  3TRG A;  4GC7 A;  3QT5 A;  2XSJ A;  3MR3 A;  5E0O A;  2D9O A;  4M5D A;  2VOO A;  1B64 A;  1WKJ A;  1HW9 A;  3KJN B;  3W2W A;  1N0V C;  3FSY A;  1FXD A;  1BQX A;  2RDI A;  1EHW A;  2MTL A;  4LFB J;  3QJP A;  1OQ3 A;  4TXS A;  4CNZ A;  5MAO A;  1UEK A;  2Y0S D;  5HN0 A;  1RAI B;  4PXE A;  2M3D A;  3CMQ A;  4ID5 A;  5KTQ A;  1WG4 A;  1T9V A;  2IDL A;  3FCW A;  2BUN A;  1RBL A;  2YWK A;  9ATC B;  4GKJ F;  1H74 A;  4OZ2 A;  2UUC F;  1NSK L;  3J80 U;  2E9Z A;  3R2C J;  2DNL A;  2G0I A;  3LH2 S;  2AYB A;  4V19 J;  1MN9 A;  4NLV A;  2KN4 A;  4OYP A;  5LM7 E;  3UVJ B;  3FEZ A;  2CQ0 A;  3BS9 A;  4YY3 J;  1Q8I A;  5KFH A;  3QLH A;  2MGZ B;  1ARO P;  1CJK B;  1P9Q C;  2ZVI A;  3M30 A;  3PYG A;  3TOQ A;  2ZZT A;  4DMZ A;  2R2U A;  3R5B A;  3FFI A;  3IBF B;  3MPU B;  1Y5I B;  1T9W A;  2Z57 B;  1ELO A;  3MMC A;  1HYS A;  1FFW B;  1OIA A;  2YQ1 A;  5J2Q A;  2FHJ A;  1X5O A;  1HBN B;  5KFG A;  5AXK A;  2XLJ A;  4DFK A;  4OL8 A;  1R0A A;  1DBD A;  4DQR A;  1SKS A;  2C3M A;  2RIL A;  1E6V A;  1RAC B;  4DX8 H;  3B78 A;  3FUY A;  2BE9 B;  3POT B;  5EX0 A;  2V5H G;  3JAM Y;  3GV5 B;  2HND B;  3KK2 B;  2ZJQ Q;  2QA4 G;  1L3U A;  2R8J A;  1UVM A;  3V81 A;  4DPU A;  4ZJQ A;  2DHH A;  2GC8 A;  3W65 A;  5MLC V;  2HHX A;  4GKK F;  3W63 A;  2X3D A;  3I0S B;  3SDE B;  4QIW D;  3KK3 A;  2RF2 B;  3MUT P;  1CQM A;  1IR2 A;  4J9Q A;  1K0T A;  3OXL A;  3HSD A;  2BAC A;  3I0R A;  1NUE A;  3LPY A;  3ZTO A;  1FRL A;  3JQM A;  3LP0 A;  5LXR A;  3MM5 B;  4WZM A;  1S99 A;  3PRB A;  3KK3 B;  1Y4Z B;  4WFZ A;  2VG6 B;  4C97 A;  4RNN A;  1VBZ A;  4FPI A;  1XQI A;  1WUU A;  3BEG B;  2C28 A;  2RAQ A;  3AT1 B;  4KPY A;  4XDC A;  3DI6 A;  2O3D A;  2KJW A;  1HQU A;  1S1V B;  4DR3 J;  4X84 A;  2GHP A;  1VQ5 S;  2V8D A;  1TKZ A;  5KG1 A;  1N5S A;  4KBI A;  1IBC B;  5DS7 A;  5F3T A;  4AXJ A;  4YR2 A;  4B02 A;  4OI1 A;  3Q8P B;  4HI1 A;  2LVW A;  2QL9 B;  3D67 A;  4MH8 A;  1G6B A;  3F0N A;  1TTH B;  2H51 B;  2RML A;  4A8W A;  2I5J A;  5D0H A;  1TKZ B;  1X5P A;  1VRT A;  3GG1 A;  1S6O A;  3ENV A;  3W1Y C;  2XC9 A;  1SUQ B;  5I42 A;  4PWU A;  2XG8 A;  1FXL A;  4R25 A;  1RWU A;  4LIR A;  5LOQ A;  4M5I A;  3U1N A;  4DR2 F;  2CJA A;  3I4H X;  3IGV A;  3S8S A;  5LMU F;  4G6V B;  4BS2 A;  4TVA B;  2QO3 A;  2IJR A;  3EVO A;  3KLG A;  4U9R A;  3VAF A;  3M2U A;  5KFY A;  2WVC A;  3HF5 A;  5KG4 A;  1QAI A;  1HPZ A;  2CQI A;  1SPB P;  2EFV A;  4F3M A;  4F2R A;  4OYI A;  3ZFV A;  4EUV A;  1Q7Y T;  2D3U A;  4H4K A;  2HNZ B;  2RF2 A;  4ZOS A;  5E33 A;  3BJY A;  4OX8 A;  4Q5V A;  2CPE A;  4FKY A;  1RA7 A;  1GK8 A;  1YJR A;  4A8F A;  2N3L A;  2JEJ A;  4ZMM A;  3H4D A;  3ULH A;  4KV8 B;  2FVS A;  3GJR B;  2HVH A;  3CDW A;  5D0R A;  2M2B A;  4WJB A;  7FDR A;  3ITH A;  1NK8 A;  5KFL A;  4B3M J;  4K4V A;  2HAI A;  2RE1 A;  2GQQ A;  1S7I A;  2YKN B;  5HAO A;  4PXB A;  4EWT A;  4PUO A;  2B5J B;  2ZNZ A;  3P3D A;  3BKF A;  3W9H A;  4ZCI A;  2Z8Q A;  1KLM A;  4ZP9 A;  3GIL A;  3EZ5 A;  3CWJ A;  1N48 A;  1MNE A;  2CJ9 A;  5LSO A;  5DGA A;  2ZWP A;  1S1T A;  2MKS A;  4FVM A;  3R6G B;  2M4M A;  3C14 B;  2BE2 A;  1GAO A;  1VC5 A;  2GGP B;  2W2P P;  1F2G A;  1V3S A;  4CO4 A;  5KFV A;  3TO8 A;  2EC2 A;  2G4B A;  4OX6 A;  3CB4 A;  3GR1 A;  2DIS A;  3GJQ B;  2VG7 A;  3OR1 A;  4OLO A;  5CH7 B;  5DDR C;  3SZ2 A;  2VAS A;  2UV8 A;  4CIO A;  2HRY A;  1PYO B;  3K7R A;  2H54 B;  2WB4 A;  1DAR A;  1RYS A;  1Q95 G;  4Z37 A;  2IYI A;  3O3L A;  4QU7 A;  4YOE A;  2E5H A;  4TQS A;  4A47 A;  4AXI A;  1D8Y A;  4UOF A;  2QFI A;  1XWL A;  1SJR A;  3IM8 A;  5L1I A;  1QJH A;  2HNY A;  4WE1 A;  3HT3 A;  4PG5 A;  2V0N A;  4OI4 A;  4HL9 A;  4PXC A;  3FK4 A;  4WFB Q;  5D6G A;  2UXB F;  2BAB A;  2R9L A;  1CUL A;  2IRY A;  3CCW A;  1CPZ A;  3QSI A;  4USM A;  2CVE A;  2VBY A;  3LTO A;  4WKY A;  4WII A;  1U49 A;  2F4V J;  3D0I E;  4OV1 A;  2OSR A;  1UJ5 A;  2M5Y A;  1S79 A;  2XLI A;  4DUZ F;  2HIQ A;  4LR8 A;  4A8Q A;  3V4I A;  1BQN A;  3TUI C;  3QRQ A;  1RWW B;  2XSF A;  4WIQ A;  3DCA A;  1FWP A;  3O44 A;  2X1G A;  4YHH J;  3KLG B;  1VI7 A;  4LQ3 A;  3IS9 B;  4P2F A;  4UTG A;  1XJW B;  3MAH A;  4DU8 A;  2HRU A;  2HZA A;  4DX7 A;  2LMI A;  4H4K C;  1X9M A;  4R5P B;  4NX9 A;  1NSP A;  2B9E A;  2LFV A;  2RHS B;  3W2V B;  5F8L A;  1K1S A;  3I6P A;  5B09 A;  3M9O B;  4J9R A;  3MHY A;  1SC1 B;  3MMA A;  1RWM B;  2RQ4 A;  3SQO P;  1VOM A;  1ZBT A;  4I4B A;  2E5J A;  4C48 A;  4XIU A;  1KC8 T;  2KFN A;  5C25 B;  1HQ2 A;  2MZR A;  3ISZ A;  1FFG B;  2V8P A;  2ZKU A;  3AD8 C;  5KAK A;  5LT5 A;  5E41 A;  1IBK F;  4EI2 A;  3OTO F;  3SBM A;  2LA6 A;  5DLF A;  1U48 A;  4PCQ A;  4ZK7 M;  3J7Y U;  3G4S S;  2RD5 C;  2R3V A;  1SJ1 A;  1DZ5 A;  3PCO B;  4EGL A;  1FA0 A;  4QWD A;  3W3S A;  5KFK A;  4ECY A;  1H72 C;  3LP2 B;  1T8E A;  1L3K A;  4TU9 A;  2VU5 A;  2FHM A;  3UWT A;  4A46 A;  2RS2 A;  2NR0 A;  4ZN1 A;  3UNG C;  5IFM A;  5I42 B;  3I32 A;  3JSM A;  1HW8 A;  2L9D A;  2LQ8 A;  3FC9 A;  2X51 A;  2R7X A;  4DSI A;  2V4J B;  4NXM J;  3GV8 B;  3TUP A;  2RDD A;  1KOH A;  5CXT A;  1MWQ A;  2NXU A;  3OL6 A;  3V81 B;  4FKX A;  1RXO B;  2YKP A;  5CCM A;  3GMG A;  4D3G A;  2XGQ A;  2P9C A;  4FXV A;  3FNN A;  1WI6 A;  1H3D A;  4LVO P;  3MM9 A;  1F5B A;  2OD6 A;  4NZ0 A;  5H1S V;  1R0A B;  3KDO A;  1ITP A;  4NCG A;  1N56 A;  3NCP A;  3MPV A;  2FJW A;  3OSN A;  3K5O A;  2QGF B;  1U45 A;  2CZ9 A;  1H98 A;  3ILI A;  2V2Q A;  3GP9 A;  3W66 A;  2UXD F;  1OPI A;  2JNJ A;  4A48 A;  4UZC A;  7AT1 B;  4FS2 A;  3MM9 B;  2B51 A;  4NLX A;  1HR0 J;  2POK A;  2MQ8 A;  3WBZ A;  1N5V A;  1LK7 A;  4I6Y A;  2KG0 A;  2D9P A;  4NXN J;  1FTC A;  3Q8U A;  4CT8 A;  1WF1 A;  3IAM 9;  1YIT S;  4CNY A;  4WZQ A;  4RW8 A;  2VPX B;  3OXF A;  3PM9 A;  5D4N A;  2VKR A;  5KFZ A;  2YWH A;  3KXD A;  1F1B B;  5CZV A;  4CLS A;  3G6V A;  3T6B A;  3BQ0 A;  1RK8 A;  2AD9 A;  4X66 F;  1TKT A;  4U7U K;  1HBN A;  4ANE A;  1KS2 A;  3M9N B;  3G6E S;  3UR0 A;  2J0S D;  3D66 A;  1VLY A;  2BM1 A;  5ETO A;  1GMV A;  4M5D B;  3JSB A;  2IIH A;  2J0X A;  2OPP B;  2XZT B;  3TYT A;  4USU A;  2FVR A;  2PEB A;  2FZK B;  2VG6 A;  4M63 A;  4DR1 J;  1PC5 A;  2CJY B;  2YH1 A;  4QR2 A;  2FLL A;  1JNZ B;  2JLF A;  1FD2 A;  2NZC A;  4M94 A;  4EYI B;  2FZG B;  4B3S J;  4WFA Q;  4Y00 A;  4P2S A;  3SDE A;  1DJ0 A;  2QG9 B;  4TY8 A;  4HHJ A;  4C98 A;  5I3U A;  1TL4 A;  2BE7 D;  4DU7 A;  6AT1 B;  5L1K A;  1ACM B;  4WP3 A;  1YBA A;  1F9H A;  4ZLP A;  5CAA A;  3EZO A;  4QWE A;  3TJA A;  2B7B B;  2GO8 A;  1U8W A;  2AGQ A;  4P75 A;  2PA3 A;  2RU3 A;  2P9G A;  4LRB A;  1QLN A;  3QT6 A;  1D0E A;  3CDB A;  1V5V A;  3SFG A;  1JLF B;  1RHJ B;  2OKQ A;  2HGL A;  3LAK A;  3SEO A;  2P5V A;  5J2Q B;  2HWT A;  4LFB F;  3MM6 A;  4MKB A;  2CQ4 A;  3CVK A;  5BXI A;  2HZV A;  5D4P A;  1YHQ S;  2HEK A;  4MKA A;  1F2H A;  1D8Z A;  4IG3 A;  3CCJ S;  4YQW A;  1PJ6 A;  4UT4 A;  3ILL A;  1D09 B;  4LT6 A;  4Q2L A;  1CQN A;  2KZZ A;  2QRR A;  1C0U B;  2Y1R I;  4OI3 A;  3I56 S;  1YJV A;  2ZHB A;  4B3R F;  1WG5 A;  5GAG I;  2AKW B;  4TLR A;  4QPT A;  4X4U A;  3CO9 A;  3G87 A;  3IRW P;  3NG8 A;  4M5L A;  2YNG B;  4C6A A;  2BKP A;  4ZVH A;  2J76 E;  4LFC J;  3CO0 P;  1EET A;  4MKY A;  1TK0 A;  3BSA A;  2LEA A;  2Z4P A;  3AOB A;  1G4C A;  2IC3 B;  2D41 A;  3NWR A;  2MHN A;  3IRX A;  3IFE A;  5E7O B;  5IT0 A;  3IN5 A;  3VGT A;  1RU2 A;  3THT A;  4C11 A;  5F8I A;  4DV7 J;  2F40 A;  3IRX B;  2BW7 A;  1GXU A;  1X5S A;  2LLZ A;  3BKU A;  1FKP B;  5A76 A;  5AJ3 F;  4B9U A;  2KT3 A;  3HJV A;  4OHZ A;  1FJ7 A;  1C1C A;  4MYT A;  1WHY A;  5ITH A;  3OPK A;  4LF5 F;  3HVT A;  1NLK L;  4NI2 A;  5B0E A;  5IV3 A;  5H9F K;  2V2V A;  1M1K T;  3FRZ A;  2DCU B;  2E1R A;  1RAG B;  3NCR A;  3QWU A;  3DRP B;  3MEE A;  1VBX A;  3ZZR A;  5HVG A;  1U8S A;  2E1M C;  2YPZ A;  3FEX B;  3CGI A;  3KJQ B;  2VPY B;  4OJ3 A;  4U96 A;  4F0H A;  4ZLN A;  2HW3 A;  1JNR B;  2ZIT A;  5FDL A;  2HS0 A;  5EDW A;  2B6A B;  4NXM F;  2VQE J;  3J7A 1;  1SV5 B;  3GFX A;  3KJV A;  3SV4 A;  5D3G B;  3PFE A;  4Y2I A;  1W26 A;  2XI3 A;  3FCV A;  4HLB A;  4DZ6 A;  4DBQ A;  1BD6 A;  5KOW A;  1RT5 A;  1BHN A;  2PI5 A;  1N52 B;  1N32 J;  4LF5 J;  1S1X A;  2DH7 A;  2MKH A;  2HBZ B;  2KDO A;  4NE9 C;  5J1E A;  4CO0 A;  1K9M T;  2DNQ A;  3GG0 A;  5GAD U;  3BO3 A;  2BEF A;  1BGX T;  3AJ2 A;  3EGV A;  4LFC F;  2KYZ A;  2XMT A;  3H5S A;  4J9S A;  3GFZ A;  3LAL A;  4NZ7 A;  5DZ6 A;  1EAY C;  1V5I B;  3MD3 A;  3W9I A;  4N77 A;  1S9E B;  1B4S A;  4TYB A;  5ADZ A;  5DDO C;  2J0W A;  3TW0 A;  1VDH A;  3BB5 A;  2CPH A;  1NK5 A;  2HPU A;  1HHQ A;  4OJH A;  5KOX A;  2CPY A;  1FVS A;  4NRT A;  2I2Y A;  4W98 A;  2R8H A;  3NNC A;  1X0F A;  4IDK B;  1ZOT A;  2BJ1 A;  4NLR A;  4KTQ A;  5DO2 A;  4DUZ J;  2B4V A;  4DV6 J;  3BSO A;  3BGU A;  2EC0 A;  3CJ4 A;  3KLE A;  1OPZ A;  2V4J A;  1WF2 A;  3FZB A;  4X66 J;  2KXN B;  4OX9 F;  4K4U A;  2EFG A;  1VBK A;  4KGZ B;  1TU0 B;  4ICL B;  4P73 A;  1RAA B;  4HTJ A;  3MFH A;  3D6T B;  4I2P B;  4ZP8 A;  1LOU A;  1OY6 A;  3EMT A;  3CMA S;  2XYG B;  2BOP A;  1RA6 A;  1LFP A;  1RAH B;  1FK9 A;  1X0P A;  2UXB J;  4ETZ A;  1FF2 A;  5HQ8 A;  1RBO B;  1PBU A;  2XCA A;  2GJI A;  3BR9 A;  2IM1 A;  2DBB A;  2DHG A;  2GHW A;  3PW7 A;  3I31 A;  3SCJ E;  3UCG A;  3R5J B;  2KKH A;  5GMK a;  1QE1 B;  3L7O A;  1HHS A;  1RHK B;  3FBC A;  2VA3 A;  4L3N A;  5CYM B;  2ZNY A;  1TL7 A;  4C8Z A;  3CUL A;  4JI4 J;  2ALY B;  2VFT A;  1LQ9 A;  2ZJP Q;  4DL4 A;  2OSQ A;  2GVZ A;  2MEW A;  4WTY A;  2E5L F;  3RR7 A;  3SFU A;  4N76 A;  3CC2 S;  2MKJ A;  3IS9 A;  2R7R A;  2WVF A;  3KMQ A;  3PAC A;  2BW2 A;  3OVB A;  2JEG A;  5F8N A;  2JFD A;  3V6D A;  4TU8 A;  5KFI A;  1X31 C;  1AW0 A;  1S72 S;  2G1D A;  4O3N A;  2NPF A;  1GNK A;  6FDR A;  3E2E A;  5CD4 H;  1RAJ A;  1HL6 A;  4Y0F A;  2D3O 1;  4WYW A;  1V6H A;  4OZ3 A;  2RKI A;  1KQK A;  1WEL A;  5F8H A;  2KG1 A;  3KK1 A;  4DR5 J;  3DYA A;  2BQR A;  3FEY B;  1FE0 A;  1Q8K A;  1XC9 A;  2DXE A;  4IFY A;  1YIJ S;  1JJH A;  2H4Y B;  3O6Q A;  3VZI A;  2DHX A;  2H5J B;  5A6P A;  1WKK A;  3AD9 C;  1HKA A;  2C2R A;  1U1N A;  3GSI A;  4B17 A;  4OZJ A;  3DGV A;  2Q1L A;  4K2X A;  2AJ2 A;  4A8Y A;  2WON B;  4NPO A;  1SH3 A;  4DG1 A;  2NZ4 A;  1SXL A;  1QTM A;  1HBM B;  4CO3 A;  3V5R A;  2ROG A;  2FLO A;  4ANC A;  5CD4 A;  4JI1 F;  4IOA Q;  1OQ6 A;  2MKY A;  3C15 A;  4MK7 A;  3R7B B;  1XMO J;  1S4E A;  1YQH A;  1W25 A;  3VAJ A;  2GQ2 A;  2HMI A;  1FCA A;  4USJ C;  5I3Q A;  1LWE A;  4CQ1 A;  1BQN B;  3R5C A;  5RUB A;  4HR2 A;  5FII A;  1B7F A;  3Q8V A;  3MEC A;  3E8O A;  2FJA B;  3M8P B;  4AE5 A;  3G71 S;  3K58 A;  3QPI A;  2VQE F;  3EJM A;  1PC4 A;  2IDE A;  4DOZ A;  1NB7 A;  5JJB A;  2DPI A;  2MB0 B;  2CJQ A;  4YR0 A;  1URN A;  1RAE B;  1FDN A;  5EX3 A;  2HFZ A;  2JC1 A;  3D4J A;  3ADA C;  4DPW A;  2KZM A;  3JYT A;  2UU9 J;  2YNH A;  4CH0 S;  1IKY A;  3VAH A;  4NLY A;  4G1I A;  4ZHR B;  3N9U C;  3DC2 A;  3UDC A;  1OY9 A;  1C0T A;  5IOL A;  4ZVR B;  4NYP A;  4GKK J;  2N7C A;  3NRB A;  2UVU A;  2UUA F;  1R3N A;  1HI1 A;  1LWC A;  4OJ1 A;  1T3O A;  2C22 A;  1L3T A;  3VAL A;  3M9M B;  4P71 A;  1IR1 A;  2W2N P;  1KVK A;  1Y5N B;  1S49 A;  1REG X;  5F0U A;  1MWY A;  4MYU A;  3M2U B;  3FQL A;  1UZD A;  3IAS 9;  5IQQ A;  4B9T A;  1ZYQ A;  1NKB A;  3KJF B;  2OEK A;  1EKR A;  4A8O A;  3PR4 A;  3S6E A;  1I5O B;  4WK3 A;  4LF8 J;  3V2U C;  3VGU A;  2HHW A;  3O8W A;  1JMT A;  2CPF A;  1PAE X;  2K7J A;  4DL0 C;  3GZ7 A;  1VRT B;  4FXW A;  2JVO A;  3OUY B;  1REV A;  1WD6 A;  3EE3 A;  1RT3 B;  1IWA A;  2AZ3 A;  4YY3 F;  2DRA A;  1P8G A;  1NB2 A;  2RJZ A;  1PKU A;  2I6W A;  2AJ4 A;  3MAQ A;  5K14 B;  3X1L B;  3RRH A;  1SL0 A;  2YKA A;  3MM8 B;  3CXC R;  3PYE A;  3VCD A;  5HMX A;  2BJ3 A;  2A0F B;  2GMH A;  3BH7 B;  4RX6 A;  4ZCL A;  4D3H A;  2YH0 A;  3FJ2 A;  5CQG A;  4ZVS B;  4ZPW R;  4YN3 B;  5M2P A;  1S0M A;  2COL A;  3H98 A;  2FVQ A;  1KFS A;  1YRU A;  4ATN A;  1NH7 A;  3ZTP A;  4ZDN A;  1U1R A;  2IBK A;  3B6B A;  1NPK A;  2N3O A;  2VG5 B;  2W25 A;  2W8K A;  3HHL B;  1FDA A;  1FX2 A;  4F0M A;  1NK7 A;  1EZZ B;  2YKN A;  1O5J A;  4C3M A;  4K4S A;  2Z2M A;  1RAO A;  3ZZZ A;  2GJF A;  3DGP A;  5B08 A;  4KGM A;  5LSL A;  3SV3 A;  3DGP B;  4DN9 A;  2W9C B;  1JX4 A;  2PMW A;  4X62 J;  3T5J A;  1RT7 A;  2I38 A;  3NNH A;  2JEF A;  1XN9 A;  2JEI A;  1JLE B;  3CJK B;  4H4O B;  3EYZ A;  2GV1 A;  2HNZ A;  3I0R B;  3H40 A;  4F3O A;  3ETM A;  4ECZ A;  3B54 A;  4WBF A;  2EK6 A;  2J8S A;  2MLZ A;  1N4L A;  3OBI A;  4CH7 A;  3OTO J;  2WCX A;  3W5Z A;  4LRA A;  5KT3 A;  1MW7 A;  4DV3 J;  1T9T A;  1PAU B;  2SXL A;  1S6Q B;  2YKQ A;  3BYR A;  3M6U A;  4Z7C A;  2MQP A;  2XGP A;  2BQU A;  1RCO B;  2J7K A;  2MST A;  1RHM B;  2OAU A;  2RB7 A;  1EAR A;  3ILJ A;  3M32 A;  4QWB A;  2DB1 A;  2HAF A;  4DR1 F;  2OHD A;  3QRP A;  1IJF B;  1NDC A;  2ZOM A;  2HZC A;  4U8V A;  1LW0 A;  2CAD A;  3BSN A;  3NWG A;  1QD1 A;  1WOS A;  1S1W B;  2ATC B;  3N01 A;  2YWW A;  2ZH8 A;  4KHP F;  1RKI A;  5H9E J;  2F3J A;  3J7A N;  4O3P A;  2R7Q A;  1ZPW X;  4MIW A;  5B0D A;  2YNF A;  2ZBI A;  2F8E X;  4J9U E;  5K14 A;  4IO9 Q;  1BQM A;  3TAM B;  4IFV B;  3IWX A;  3R9L A;  4B9S A;  1FWK A;  1WF0 A;  2OML A;  5E3C A;  2VQF F;  3BQ2 A;  3UNY A;  5HL7 Q;  5HQL A;  3D6H B;  5L1L A;  4H4O A;  4OFZ A;  2BR0 A;  3X3U A;  4I1T A;  1VQ9 S;  2DNZ A;  1UVK A;  2CVI A;  1JLQ B;  4ES3 A;  2LCW A;  1UAW A;  3D6M B;  4CTA A;  5AE3 A;  1VHF A;  4QIE A;  3S7R A;  3EUN A;  3CUN A;  2X1F A;  4GVB B;  5HMY A;  4OI0 A;  3HP6 A;  4ZPC A;  2ZH1 A;  2VFV A;  2DGW A;  4FDF A;  4DXL A;  4AL5 A;  2F5G A;  1UJ6 A;  3MAA A;  4IOB A;  1AUD A;  3I5C A;  4RBV A;  2R8K A;  2HHS A;  1MWZ A;  4RNM A;  4NL5 A;  1M5P C;  3W2W B;  2O1P A;  3GV7 B;  2Z2L A;  4A8K A;  1PIL A;  4X64 F;  2M0G B;  2B7C B;  3M8Y A;  1FKO B;  1CJK A;  3MWB A;  3PHT A;  3TX0 A;  1OYD A;  3KLF A;  1HBU B;  5THW A;  5C24 B;  1Q78 A;  4ECU A;  3D0G E;  1CBK A;  2XWY A;  3HFV A;  4CLK A;  4EO8 A;  3TUJ C;  4ZLJ A;  1H2U X;  3ENA A;  4M8L A;  1PJ7 A;  4RW9 B;  2VBW A;  4OLP A;  1CS4 A;  2E5G A;  2PO4 A;  3JQK A;  3HJF A;  1VQS A;  2MYF A;  3B4D A;  3GPA A;  4HYK A;  2UUW A;  1JB0 C;  2V4Q A;  1R8H A;  2B3T B;  4KB7 A;  4DHV A;  3LA0 A;  2H5E A;  3F41 A;  1LXN A;  2ABY A;  1SJ3 P;  1SKW A;  2V8H A;  2HFV A;  3FSI A;  3NMR A;  3NS7 B;  3E51 A;  2AJF E;  2PA8 D;  4LSL B;  4PG4 A;  3VGV A;  4YDX A;  2J9D A;  2RIJ A;  2OEM A;  2J6S A;  1UP1 A;  1TL1 A;  5HBM A;  1RKJ A;  1RGV A;  1HA1 A;  3F44 A;  1RU1 A;  3LGH A;  3TA1 A;  4OIX A;  1FDB A;  3PR5 B;  4HAC A;  3HSJ A;  5AXM A;  1KDN A;  5IWA J;  3NGD A;  2H9Z A;  4E8U A;  4J9V A;  2K3I A;  3R5G A;  3NMA A;  4RJV A;  1LEO A;  5HAN A;  1P27 B;  4CLT A;  5C7P A;  2LXF A;  3MOZ A;  1EX8 A;  3CSK A;  2QL7 B;  4L72 B;  4IG3 B;  4RW7 A;  1SH2 A;  4X4O A;  2QLX A;  2QZ8 A;  4NLD A;  4OHV A;  2C2O B;  3QWP A;  4B08 A;  1S48 A;  1RTI A;  4KC5 A;  3T1H J;  1HWL A;  2QT7 A;  3AAW B;  4KO0 A;  3K57 A;  2VJU A;  5HLF B;  3DN9 A;  2F9D A;  4ZIT A;  1R6Y A;  3N0V A;  4OHX A;  4DL6 A;  4F26 A;  3CDA A;  4JI0 J;  3NL0 A;  3TVZ A;  3PO5 A;  3TZX A;  4ILM A;  4KAI A;  2E7W A;  4EBC A;  1H2V Z;  2W2O P;  5D0E A;  3M8R A;  2JSX A;  4PPZ A;  2N82 B;  1LWF B;  5IT4 A;  3HM9 A;  3Q22 A;  5DZ7 A;  1ICE B;  1QE1 A;  2H3E B;  4LFA J;  2VB6 A;  1TV6 B;  4CM2 A;  1H73 A;  3O5T B;  1D9A A;  1O0P A;  1F9F A;  1VK8 A;  2QSF A;  3BGF A;  3BN4 A;  3QNW B;  4ENO A;  2XMW A;  1UJ4 A;  1MU2 A;  4ELV A;  4H54 A;  2VOP A;  4B3M F;  4M5H A;  3GIM A;  2ZH5 A;  5KFP A;  3D2W A;  3PVX A;  1C1B A;  3BBB A;  4ZVF A;  3C15 B;  3D54 A;  1VC0 A;  1S1T B;  1ZZN A;  2XZW A;  1U4B A;  1RT2 B;  3NS5 A;  4HDH A;  1KFD A;  2XEX A;  2IAJ A;  3ET6 B;  3HVW A;  4QR0 A;  3V6D B;  4YB1 P;  1I94 J;  3PTW A;  4JYA J;  1PYS B;  2QA2 A;  2IVF B;  4ED7 A;  1LW2 A;  1SB6 A;  2KHC A;  4FBU A;  4ECX A;  3PIO Q;  1KVI A;  1R27 B;  2BVZ A;  4KY3 A;  1VRU A;  1S7H A;  2C2E A;  1YBT A;  3AXM A;  3M8S A;  1CJU A;  3OW2 R;  2PT0 A;  2F4F A;  2MQN A;  2A2C A;  3AJ1 A;  2R7V A;  5F8G A;  1OSD A;  1R31 A;  1VRU B;  2B43 A;  2ZUG A;  2E1P A;  3H25 A;  5DM7 Q;  1K8A T;  5LJ5 Y;  2VC0 A;  2DHA A;  4PAA A;  4FF2 A;  2UU9 F;  2IM3 A;  5DQI A;  1R6V A;  3DI6 B;  2WAQ D;  3BM7 A;  3KMS A;  4PQA A;  1URR A;  2YPY A;  5BR8 J;  1RT2 A;  1BC6 A;  1I1G A;  3TJ8 A;  3M6X A;  3P5B P;  1GMW A;  5T7L B;  2BRL A;  5E3A A;  3UD4 P;  1QSS A;  2Y1I A;  1VK3 A;  4LR9 A;  2XS7 A;  2HG4 A;  2F8H A;  3RW7 A;  2G1H A;  3EVW A;  3IA0 A;  3T1Y F;  4DFM A;  3QT7 A;  2I5J B;  4ALZ A;  4CLF A;  3R1L A;  4DCJ B;  2FVP A;  2A6M A;  3BBC A;  2J9E A;  2VV5 A;  2OPQ A;  2ZDP A;  5HI7 A;  4QWC A;  2MZ1 A;  3TNV A;  1CLF A;  1LW2 B;  4ED3 A;  5ETN A;  3PO4 A;  2BKO A;  1HWU A;  4NA1 A;  4TNO A;  2BA9 A;  2VON A;  4B3R J;  1HQE A;  2MY8 A;  3M6V A;  3M1V B;  3Q89 A;  3LAM A;  4UZB A;  4QYZ K;  4JBC A;  4WP9 A;  2HS4 A;  1JQG A;  3GTY X;  1M1G A;  4Y2C A;  4DUY F;  3V6K A;  2VPW B;  4O3R A;  1YJN S;  1YZ6 A;  2PD1 A;  2XS2 A;  2OLW A;  2BZ2 A;  1JJC B;  4F2S A;  2ASD A;  1T9U A;  2MJN A;  2FHK A;  2ZH7 A;  1FK9 B;  2HQG A;  3M8Q A;  1QVG R;  2C3U A;  3SCL E;  1JXV A;  1GX6 A;  1HD0 A;  2AW0 A;  3QFW A;  4IG0 A;  3C3L A;  4PG6 A;  4PG8 A;  4DV5 J;  4USK A;  3T9N A;  1RT6 B;  3WC0 A;  4RBT A;  2GW8 A;  4N56 A;  3IR7 B;  4F50 A;  2NXJ A;  1U25 A;  2IHR 1;  2YKM B;  2UV8 G;  2AEM A;  2WSF C;  4JI8 F;  4NLT A;  3PV8 A;  1H6K X;  1Q1K A;  2CQ1 A;  1XR5 A;  3L4B C;  3CJ8 A;  4USH A;  4C3L A;  4JB8 B;  4ILL A;  4L6V 3;  2ATL A;  3FMB A;  1S6U A;  1ZA2 B;  1YBU A;  3V4I B;  8ATC B;  4DQS A;  1IKX A;  4JV0 A;  3DRP A;  3MEE B;  5LJ3 Y;  2HWH A;  3F73 A;  4JI3 J;  1TL5 A;  2HGN A;  2CNL B;  1U1Q A;  1ZAV A;  3CTR A;  1GEH A;  2WBM A;  1DTQ B;  3C6T B;  3OJS A;  3GLJ A;  3SSR A;  1C1C B;  4R5P A;  1S4F A;  1X4B A;  3DNC A;  4TQR A;  2HNY B;  4JI5 F;  3CME S;  2DJW A;  3GIJ A;  2PMH A;  3BGR A;  3EDQ B;  1RHR B;  2JH3 A;  4Q45 A;  4DI6 A;  2WBR A;  3KLH B;  4CTA B;  3G8S A;  2Q66 A;  4OX7 A;  1JLQ A;  4NXN F;  4RW4 B;  3O2I A;  1WC3 A;  3CT9 A;  4AD6 A;  2XY7 A;  3AOC A;  2D74 B;  1HFE L;  1RT6 A;  3LOU A;  2OMO A;  5F3Z A;  1QSY A;  5KT7 A;  1IXK A;  2GX8 A;  3CCZ A;  4UQG A;  2BX6 A;  1KSP A;  2PEH A;  5FDL B;  4ZJO A;  1K0V A;  4Q8E A;  2WRM A;  1FJG F;  3OVA A;  1I94 F;  3DM2 B;  1RBA A;  4Q7A A;  1LV5 A;  2AIR B;  1S0N A;  4WK1 A;  2L41 A;  2VD3 A;  1E6Y B;  1AUS L;  3DLG A;  3DLB A;  2MLY A;  3TQ1 A;  4MTP A;  3D5M A;  4CZC A;  2HVD A;  1L3V A;  2CQP A;  3EIC A;  3KNG A;  4MIB A;  3QIP B;  3FGV A;  5ETT A;  3TAP A;  2BV3 A;  2L9N A;  5CHC B;  3ENW A;  2KH9 A;  1YJ9 S;  5DDP C;  4PRF A;  2GVD A;  4OI2 A;  2DTJ A;  3G82 A;  2MKC A;  2O01 C;  4RL1 A;  2LDI A;  3TEG A;  3M32 B;  2UXC J;  3N4W A;  4J7C A;  2Z30 B;  3FKB A;  4CWB A;  1W2I A;  4RW6 B;  3ZTQ A;  2UUC J;  4K50 A;  2R7T A;  1RSC A;  4PYA A;  4ED2 A;  4WF9 Q;  4LF1 A;  1UA1 A;  3KG4 A;  3N6L A;  3Q8Y A;  1S9G A;  2Q79 A;  1NRK A;  2C3O A;  4X4R A;  2VFU A;  1LNQ A;  3EPI A;  4MK8 A;  1TUG B;  2F8M A;  3C6U B;  2BAN B;  3MM6 B;  4ECW A;  2V9W A;  1RT4 B;  2O66 A;  2XO7 A;  1NDP A;  1QTN B;  3ZZ0 A;  1HNZ J;  2ADB A;  4FPR A;  3OSP A;  1FVQ A;  2EWH A;  3K5P A;  2V4R A;  4OQJ A;  1SUQ A;  4ZIV A;  2EG2 A;  4IH5 A;  3PEH A;  4USV A;  3HD1 A;  4JV5 J;  3PX6 A;  2WTF A;  1P9Y A;  4P9S A;  4I0W A;  1Q8L A;  1Z2Z A;  3JS9 A;  4I2Q B;  4XTT A;  2HVI A;  1PG5 B;  4DSE A;  1GXL A;  1X4D A;  1CJU B;  3HUL A;  2J6T A;  1HBO B;  3GR0 A;  5KT6 A;  3MR2 A;  2EFN A;  2RNE A;  5H9E K;  4LF9 F;  1KN6 A;  2KT2 A;  2DNK A;  2KFZ A;  4WP8 A;  2KHD A;  4O0I A;  2HS3 A;  3G6Y A;  1SKR A;  3CDE A;  3CE8 A;  3ET6 A;  3PRD A;  2GHV C;  4HTI A;  5SUH A;  2HK3 A;  4F4Y A;  1U1K A;  2XLK A;  4ZIW A;  3GII A;  3DOM B;  4DPY A;  4LFA F;  3PZP A;  5L39 A;  4LUB A;  3KUE A;  4A4J A;  4PZV A;  3ZNJ 1;  4ZPD A;  1N0U A;  3HD2 A;  2R7U A;  5B0G A;  4N47 A;  1U0S A;  1Y7P A;  2CPI A;  1JLA A;  3HSG A;  1S1U B;  2MZJ A;  3KG1 A;  4NMX A;  3TP2 A;  4RNO A;  2UVR A;  3NNA A;  1AFI A;  5LMU J;  1FRX A;  1UEU A;  4PG7 A;  2W8L A;  1LXJ A;  3K8V A;  4RU9 A;  4DUT A;  4C7Q A;  1MMN A;  3CED A;  2R42 A;  2ZC3 A;  2E1A A;  3R7S B;  3MM5 A;  2JWN A;  3JAM U;  2HHH F;  3UI3 A;  1OSC A;  2EK1 A;  3HLU A;  1IKV A;  5H9F J;  4EMD A;  4HKQ A;  2C3Y A;  3CJ5 A;  3DOL A;  1UVJ A;  4EBD A;  1TMJ A;  2AHO B;  2AYE A;  3BBF A;  1JLC A;  2MSS A;  4YB6 A;  3Q83 A;  5EUH A;  2AT1 B;  3SIP B;  2FLN A;  2IM0 A;  4N5S A;  2HLU A;  3M2R A;  1U2F A;  4BC7 A;  1FWL A;  2ZOG A;  3MED A;  2YNH B;  1U2C A;  2FJE B;  3A8J A;  3K5L A;  4DL5 A;  4L74 A;  4CLW A;  1VQ6 S;  4QIF A;  2A6O A;  1IN0 A;  1J5E J;  4EO6 A;  2XM3 A;  2X1B A;  2XHC A;  1JLG A;  3VR1 A;  3QRR A;  1F60 B;  3TVK A;  4KT0 C;  4UOC A;  1A6L A;  4JI5 J;  4DCP B;  2CJK A;  5HP1 A;  2K7K A;  3HSZ A;  2IJN A;  2WVD A;  5L9N A;  1M5V C;  3GQC A;  2HQD A;  3HZG A;  2AX1 A;  2HFN A;  2QL5 B;  3M8W A;  3HHL C;  2OI2 A;  3DHW C;  4UUW A;  3KG0 A;  2W4D A;  1WOP A;  5B0A A;  3PX0 A;  1DTQ A;  1TR0 A;  2W2Q P;  1VMB A;  2OPR A;  2VL1 A;  5CYQ B;  2ERR A;  3PRV A;  1BY9 A;  4K7Q A;  1N33 F;  2KI2 A;  3PYF A;  3AH6 A;  5CYQ A;  2EW9 A;  2WW8 A;  2CQ3 A;  2IA0 A;  4JI6 F;  2DXF A;  3RZA A;  1YJW S;  2J8A A;  2W7O A;  2W1B A;  1FEE A;  4F3Q A;  4YDD B;  2MQO A;  3UCU P;  2E5L J;  1RTJ A;  1TVR A;  2BJ7 A;  2K1R A;  3I9Z A;  3DLL Q;  5IM0 B;  4LSN A;  1LWX A;  3VVT A;  4CM0 A;  3BR8 A;  5HMW A;  1EKS A;  3QYY A;  3RBX A;  5A2Q Y;  3BGL A;  3D1O A;  4E0D A;  2OD4 A;  3L09 A;  4NCB A;  4NCA A;  5KFW A;  2I1R A;  1CC7 A;  3T3F A;  1WOO A;  1UFL A;  3HVR A;  2LU2 A;  1GX5 A;  3U7J A;  3DMJ B;  3U1M A;  1R8C A;  2YNI B;  2LQB A;  2G13 A;  1KD1 T;  3BKT A;  3Q2T C;  1RB0 A;  1OY8 A;  3DRY A;  2GAG C;  4BLG A;  4B9V A;  5M2U A;  1ZH5 A;  1HBU A;  3PHE A;  3H59 A;  2CXE A;  5D4L A;  3R1H A;  4I7F A;  2GVZ B;  5K8M A;  4LF6 F;  2OPR B;  1FFS B;  4K2J A;  4NYZ A;  3UDL A;  3D1H A;  5F9L A;  5E5N A;  1JKH A;  5AE2 A;  2FJD B;  1OO0 B;  3DRS B;  3H8Y A;  3OL8 A;  1N5Q A;  5HVH A;  4X4N A;  2BJ9 A;  2CQG A;  3OJU A;  2YNF B;  1F3V A;  1KKH A;  3CJ2 A;  4DV0 J;  3HHK A;  4C9D A;  1KR4 A;  2DGU A;  3MED B;  4IYQ A;  3DDN A;  4WFX A;  1DHM A;  4LSN B;  4B3T F;  1Q86 T;  3NOG A;  4MIA A;  3ZZY A;  3C2P A;  4B3T J;  4FS1 A;  1S1W A;  3RB4 A;  2EBG A;  3NCQ A;  4NLO A;  5KG5 A;  2BE2 B;  2QC3 A;  1RTD A;  5GAE I;  5KFM A;  1TKX B;  2OJ3 A;  4ZLL A;  1HNI B;  1XTZ A;  4OZL A;  3NS6 A;  5J1P A;  4X4P A;  3OVS A;  3MDF A;  4ICL A;  5KFT A;  4ZPV R;  4JP8 A;  1LWE B;  4G1P A;  1RDR A;  4FNI A;  4IFV A;  2Y0B B;  2QEX S;  2DNH A;  3ETO A;  4Q44 A;  5EN1 A;  2Z2Z A;  1Z4U A;  3FQK A;  4DSL A;  3D6F B;  4FYW B;  4IDK A;  4KHM A;  3T1H F;  2C2K B;  1R8A A;  4DF8 A;  1TUW A;  1ZTW A;  2WSC C;  4ZJL A;  3DOK B;  5IZH A;  1N8R T;  2ASJ A;  1J5E F;  2CWK A;  4YME A;  3P49 B;  4ZPT R;  1XR7 A;  2C3P A;  3W64 A;  2BYC A;  2VJV A;  4I6A A;  3LF0 A;  1X4H A;  2FY8 A;  5CZX A;  1O8B A;  4IRD A;  2RQM A;  5G0R B;  2ZM6 J;  4NLG A;  1WC4 A;  4TKT A;  3SMZ A;  1FER A;  3EGN A;  1M5S A;  2JDJ A;  2BKN A;  3OLB A;  5GAG U;  5KFD A;  2ZM6 F;  4BCA A;  3WX8 A;  3OFF A;  3QJJ A;  2HWI A;  3O1L A;  2CRL A;  1VQP S;  5KFJ A;  2PDA A;  4WWS A;  2HHH J;  1EB0 A;  2YWF A;  2KFY A;  2V8V A;  3IR6 B;  1MU2 B;  1S9G B;  3RGI A;  3A13 A;  1RLD A;  3N28 A;  1M1H A;  3NBP B;  4PYD A;  4ZPA A;  4W4M A;  4A8S A;  4JI6 J;  2Y8Y A;  1EQ0 A;  1P1L A;  1MLA A;  2QTW A;  5FLX U;  1CJV B;  3NLC A;  1T05 A;  2IRU A;  2HND A;  3C66 A;  3UO0 A;  3DLK B;  3KK2 A;  3POT A;  1CVJ A;  2DH8 A;  2DR6 A;  2B8Q A;  2ILY A;  1N34 F;  1U6F A;  3ISN D;  2LA4 A;  3TI0 A;  3HCX A;  4NLU A;  1JLA B;  4O3Q A;  3BO4 A;  4F4W A;  2KB2 A;  3Q24 A;  4WFY A;  3LP0 B;  3P8B B;  3PX4 A;  2YKO A;  4DPX A;  3RAQ A;  1FI4 A;  3K5M A;  1V9O A;  2DPJ A;  3OFG A;  3QLH B;  4LF7 J;  3MMJ A;  5DET A;  3UVJ A;  2AJ0 A;  2HVE A;  3ISN C;  1RHQ B;  3DLE A;  1YRT A;  1S5Z A;  4USI A;  2IMO A;  2UP1 A;  1KQF B;  4OHW A;  1RWK B;  1VR6 A;  1X8D A;  1VHI A;  3UN2 A;  3Q8S B;  3MCM A;  2RDJ A;  1AA1 B;  2VFR A;  3KDN A;  3ONQ A;  1E6V B;  2DCL A;  1SVD A;  4ZS6 A;  2RRB A;  1TKX A;  3ILO A;  1DTT B;  3ZZT A;  2M9K A;  2BXJ A;  2KJV A;  3F56 A;  4JI3 F;  4P7T A;  5AXN A;  1IM4 A;  1TL3 B;  2DGV A;  1C0T B;  2BOA A;  3D7S B;  1RTI B;  4M5J A;  4P2M A;  1HYS B;  1FE4 A;  3DLG B;  1NPR A;  3W60 A;  3BO2 A;  5GAD I;  4PQU A;  2ZFH A;  1NHV A;  3IR5 B;  4CLL A;  1IWG A;  3MCS A;  5L1J A;  2ACY A;  5K20 B;  2H48 B;  3PFO A;  3RRK A;  1L3S A;  1VQN S;  3PKM A;  1J5O A;  4C8N A;  5CAB A;  3B4M A;  4LRC A;  5IT9 Y;  4RW9 A;  4URQ U;  2MXY A;  3GYX B;  3MCO A;  4ID5 B;  1AZS A;  2V2K A;  3H4B A;  1IKW A;  1AYE A;  2DK2 A;  1I3O B;  3QT8 A;  4KSE B;  1RWO B;  2R8I A;  4NZ6 A;  1J5O B;  4BDP A;  2GFF A;  2L3M A;  3M7V A;  4Y65 A;  2EBE A;  2L9W A;  4LSZ B;  3WZ0 A;  2ALZ A;  3VQT A;  3RAM A;  4B9L A;  1XR6 A;  4J9N A;  4DV4 F;  4PAB A;  5ETS A;  4EZ6 A;  3DRX A;  4ECR A;  1XNQ F;  3PEJ A;  3TA2 A;  3G9C A;  3JYT B;  3TAN A;  4O44 A;  5CA5 A;  1XNQ J;  3AB4 B;  3A8E A;  3BRE A;  2DEI A;  3T6J A;  1V3Z A;  3A8I A;  5AT1 B;  3R97 A;  3HKZ D;  2HRT A;  1QSL A;  3NAI A;  2DYA A;  3N6N A;  4WU3 A;  4ZKA A;  1DQ8 A;  2DGX A;  1Y10 A;  1U2R A;  4NA3 A;  1N5Y B;  1C0U A;  3LAN A;  1U6Z A;  5D8H B;  5E2Q A;  4GMK A;  4PPD A;  3MF5 A;  2A18 A;  2A2D A;  3UR3 C;  8RUC A;  2KM8 C;  1FT8 A;  2Y1L B;  3P4U B;  1WEY A;  4H4M B;  4ZPB A;  4F8R A;  1HMV A;  2HQC A;  3EGW B;  5DJB A;  5BYS A;  2JJ4 D;  5KFU A;  2W9A A;  2CNN B;  3HDS A;  4F04 B;  4P6Q A;  1TK8 A;  4AUK A;  4DV3 F;  2C2Z B;  2VBX A;  3Q0A A;  2EG1 A;  4L73 A;  4PEO A;  2CWX A;  3M8Q B;  2XY5 A;  2HIY A;  5KG7 A;  2W4P A;  5FD1 A;  2XS5 A;  3HHD A;  1EET B;  2W9B A;  3WC2 A;  3UPF A;  1LW0 B;  1YJU A;  1C4C A;  2DIV A;  3GFH A;  4QPX A;  2ZHA A;  2XNR A;  5KFN A;  3TZY A;  2X3G A;  2RHQ B;  2XMJ A;  2DIT A;  1MRO A;  2QJ3 A;  3ZTR A;  2LKZ A;  1P1T A;  1VFJ A;  2C2N A;  3W62 A;  5G4D A;  3FBF A;  5ETQ A;  5ETV A;  3GYG A;  5EWF A;  3R3T A;  1FKA F;  2QA4 S;  3A12 A;  2ZVS A;  3JSY A;  1RT1 A;  1FJG J;  2BJE A;  4XAK A;  2ZH4 A;  3TUZ C;  4DV6 F;  3K5N A;  2Q3P A;  3K89 A;  4ECS A;  3FZ2 A;  2KXH A;  3IXQ A;  1YX2 A;  5I3P A;  2IMW P;  2GNK A;  4KFB A;  3THP A;  1SIW B;  1JWW A;  3HX9 A;  2QLW A;  2QE5 A;  1HNZ F;  4DV1 J;  4ED1 A;  2W24 A;  4M95 A;  2J5A A;  1GTE A;  2X7I A;  4RNF A;  2G2O A;  1WHW A;  2KRR A;  4F4X A;  1F9E B;  1S6Q A;  3IO1 A;  3KLI B;  3OQ2 A;  4J9P A;  2AJ1 A;  3KUH A;  3JTP A;  5B0C A;  4TY9 A;  4UQT A;  5CYJ A;  4Q0B A;  5LL6 d;  4JV5 F;  3DLH A;  3H5U A;  1FNM A;  2HBR B;  2V34 A;  4WXW A;  3OTE A;  1K1Q A;  4I69 A;  5M2R A;  4JI0 F;  2EI5 A;  3KUG A;  5T7L A;  2JFK A;  4DSJ A;  1IJE B;  1HWK A;  4K0K F;  3A8K A;  4K59 A;  4O4R A;  4YHH F;  5K9F A;  1NSQ A;  2QFJ A;  1YTY A;  1IBM J;  4FXD A;  1G1X A;  2E29 A;  1FNO A;  2APO A;  2LQ5 A;  3HI9 A;  4DR7 J;  1VIO A;  3NOC A;  4ED0 A;  3KLE B;  4G1Q B;  3NXZ A;  3MUM P;  5C25 A;  5IWA F;  3UFC X;  1VQL S;  1T9Y A;  1VLO A;  1Z1Z A;  2Q6B A;  3D3C J;  4ZVP B;  3NP5 A;  4JUZ A;  1RJJ A;  2U2F A;  4DN0 A;  3K59 A;  3RR8 A;  4JI7 J;  2Y8W A;  1Q5Y A;  2ZHO A;  1K47 A;  2OFG X;  4KFB B;  4U7U D;  2V2Z A;  3AQP A;  3G8Q A;  2DKO B;  3ZZU A;  4R8U B;  1YJT A;  2RU9 A;  3BQ1 A;  2CG8 A;  1S6P A;  1UFK A;  2ZE2 A;  3MM7 B;  2GJ2 A;  4Y2M A;  4F67 A;  2V67 A;  4YS2 A;  1RAD B;  4YEA A;  2ZH9 A;  1NK0 A;  2CKW A;  1U0H B;  1SH0 A;  2YVS A;  1N36 J;  1GH8 A;  2VIC A;  1JJ2 R;  3NEK A;  1SC4 B;  4M5N A;  3OFE A;  2CPZ A;  4CDI A;  3AFG A;  1RT4 A;  1NME B;  4IQM A;  3AHP A;  2HKE A;  1UWB B;  4DUY J;  1ZAW A;  3HVT B;  4NI2 B;  2CPJ A;  5A8R A;  1O6X A;  4C8K A;  4KGV B;  4N41 A;  2CNO B;  2HHT A;  4I68 A;  3SXL A;  5HLF A;  3UQS A;  3CC4 S;  4GVL A;  3J7Y I;  5A0Y A;  2WK4 A;  3GFY A;  2QSW A;  3OL9 A;  4HEA 9;  5DQG A;  2NUH A;  1NPP A;  4CH1 A;  1JKH B;  2XBP A;  3Q2S C;  1TL3 A;  1H2T Z;  2UUA J;  3A3N B;  4C8O A;  4FYV B;  4HI2 A;  3SQG B;  1F0X A;  2P8I A;  2DNO A;  4WPA A;  1HNX F;  5C42 B;  1RAB B;  4U8Y A;  4USW A;  1FEH A;  3M8P A;  1CS4 B;  1WEZ A;  3VF0 B;  2QLB B;  4OYO A;  5C42 A;  4DR2 J;  1X4C A;  1RWN B;  2NXC A;  2P2C B;  5KFO A;  4O3S A;  4ZN3 A;  3HO1 A;  3L9Z A;  3H42 A;  1HWI A;  4ECQ A;  1AB8 A;  3M6W A;  2GIF A;  3RUB L;  1WEX A;  2ROP A;  2F1F A;  3CDU A;  4RNH A;  3T5H A;  3C8Y A;  1HR0 F;  1YWX A;  4Y2K A;  1WC5 A;  3S1T A;  4AND A;  1G3O A;  5KG0 A;  2NLW A;  2UXC F;  4R0J A;  2VH7 A;  1B70 B;  1WHX A;  1Q0N A;  1Q8B A;  1UL3 A;  2HHQ A;  1EP4 A;  2OUG A;  2WON A;  1OWX A;  1UWB A;  2R7S A;  1UMJ A;  1YRX A;  3GSD A;  4LBI A;  5BYQ A;  1DTT A;  1N5T A;  3P45 B;  2XY6 A;  4IQX A;  2GQC A;  4K5S A;  3UW1 A;  4FBT A;  4KJI A;  3NKY A;  1RTH B;  4I64 A;  1HD1 A;  2PSZ A;  2I0X A;  3LGN A;  2XI2 A;  3PJ9 A;  4RW7 B;  3W5X A;  5K5M A;  3L3C A;  3RAX A;  2RKI B;  2Z56 B;  2VBZ A;  2E7X A;  2PN6 A;  2M70 A;  3BGO P;  3KK1 B;  4Q43 A;  4TY8 B;  1T02 A;  3CD5 A;  4HDG A;  3BYP A;  3DOL B;  3KHL A;  2CDR B;  4NML A;  3VGS A;  4J9M A;  1G2E A;  4IRK A;  3HHE A;  1ZS6 A;  4IOC Q;  1ZM3 A;  2RT3 A;  2V9K A;  4IRC A;  2HK2 A;  5A8W A;  1KWM A;  1NHK L;  2VDI A;  5F8M A;  3AB2 B;  1JLF A;  4WE1 B;  2J0Q D;  2KVI A;  1YI2 S;  5IM0 A;  2EPI A;  1VQ4 S;  2ZBP A;  2AP6 A;  1S1U A;  4LF6 J;  1VQ8 S;  3BSC A;  1JLG B;  1K44 A;  4OYW A;  5IXU A;  4DV1 F;  3P6Y C;  2BJD A;  2HSE B;  2YX4 A;  1U1P A;  1BUX A;  2GMJ A;  3T9Z A;  3PW4 A;  3AY0 A;  3Q8Q B;  3BDP A;  2WZ1 A;  3GWC A;  3GCW P;  4GKJ J;  1I51 B;  1R0B G;  2MPU A;  4ID8 A;  4MAK A;  1YJ7 A;  1XMQ J;  1IBK J;  1HI8 A;  3PNI A;  3EXY A;  3R8Y A;  4XK8 C;  2AYG A;  4PXD A;  4AFF A;  1JJ4 A;  3IM9 A;  4ZVT B;  2HFS A;  3QAT A;  5L38 A;  2LYV A;  3R27 A;  3KHH A;  1UTA A;  2FD2 A;  1TZ0 A;  5F0W A;  4URG A;  3NGS A;  3HHL D;  3B8H A;  1ZPV A;  1NK4 A;  2CZV C;  2D7S A;  2CJB A;  4DZD A;  3D28 A;  5CCL A;  1ZA1 B;  5HAT A;  5J1N A;  3VTI A;  2NSC A;  3GE9 A;  3HKW A;  4S0M A;  3QQC D;  2BM0 A;  4GC6 A;  1X9W A;  5DDQ C;  4DQP A;  2R2S A;  1Q7L B;  3MEG A;  3DXS X;  2NXN A;  3ELH A;  3M30 B;  4R0E A;  5HBM B;  4GVB A;  1NKE A;  2AZ1 A;  4ED6 A;  4EZ9 A;  4KV8 A;  2HHU A;  4J37 A;  2B4U A;  4DR6 J;  3W9J A;  3CD7 A;  1S57 A;  4IH6 A;  4N7T A;  3I9V 9;  1S9E A;  1HNX J;  3CD6 S;  1FXR A;  1XER A;  3JSM B;  2ZH2 A;  3W61 A;  4NRU A;  2G9O A;  2GS8 A;  1Q81 T;  4GRS A;  1CJT A;  4LQ9 A;  1RWP B;  3MUV P;  1B3T A;  4PUO B;  3M05 A;  8AT1 B;  2B9W A;  3OTC A;  4NLP A;  4JYA F;  2FB0 A;  4XO0 A;  2ADC A;  3JTN A;  1KVJ A;  1YSJ A;  1Q82 T;  1RT5 B;  2HUR A;  2L08 A;  4LBP A;  5T41 A;  3RB3 A;  3HXM A;  2DGQ A;  4HH0 A;  1S76 D;  5IS2 A;  4NLW A;  3CJK A;  3H2V E;  3HT0 A;  3LPE A;  4X4S A;  1Q5V A;  5GAH I;  2C2D A;  4C0B A;  5AJ3 J;  1FTR A;  4P2X A;  4ZCK A;  3DOK A;  3QIP A;  3PY8 A;  1REV B;  2JOQ A;  2PGC A;  2QN6 B;  4FVC A;  4C0O C;  4CYU A;  3PDN A;  4X64 J;  2OH2 A;  4IR1 A;  1S1V A;  2HQI A;  2NSB A;  4QJV A;  2C2M B;  2GA7 A;  3D9B A;  3V4M A;  4LVN P;  3PXG a;  2HVZ A;  1FX4 A;  3CW2 C;  2YQ0 A;  3MFI A;  3CD0 A;  2UZA A;  1GXT A;  1APS A;  3HFZ B;  2AWZ A;  3D1Q A;  3L7U A;  2BRK A;  3MM8 A;  3I96 A;  3R6L B;  3KHR A;  2YWG A;  1S59 A;  1HNI A;  4FF3 A;  1D3W A;  4DLG A;  3EM1 A;  2MKI A;  1GQE A;  2LQJ A;  4OYA A;  1RP5 A;  1F6T A;  3RYL A;  4DCO B;  5A8K A;  3PG9 A;  1RAF B;  2HHP A;  4NEY A;  4YP3 A;  1T03 B;  5D3G A;  1KQS R;  2DIU A;  2B8P A;  2QLF B;  4KKO A;  3WIU A;  2MQQ A;  2W9C A;  4Y2A A;  1N33 J;  4FZV A;  2X1A A;  1T7P A;  1BE4 A;  1AFJ A;  1XBW A;  3NY0 A;  4K0K J;  2CQH A;  5B7W A;  3BPS P;  4J9K A;  4MT1 A;  4CLY A;  4O4G B;  3HHN B;  4ZP6 A;  3DRR B;  2J7U A;  4J91 A;  3OR2 B;  3H7H B;  3LQV A;  2XO6 A;  1FES A;  4KGK A;  5I4M A;  4EYH B;  5J2P A;  3LWL A;  4GO5 X;  3UCZ P;  3J81 U;  3GCX P;  2CQB A;  3NGR A;  1OS5 A;  4I7F B;  4V1A k;  4EFA C;  3UDV A;  2ZWO A;  1M5O C;  1UKU A;  4OX9 J;  5LSR A;  2FGO A;  3VAM A;  4ZVU B;  2ZC4 A;  5HJX A;  3SQG A;  4K4X A;  1HI0 P;  2DO4 A;  4RW6 A;  4X65 F;  3MI7 X;  4B3O A;  1CUL B;  1RZM A;  2WOM A;  3LO3 A;  1TQL A;  3T5K A;  5DRK A;  1TUV A;  1NJW A;  4WKR A;  4Z7Y A;  1IKY B;  5IT9 U;  2OEJ A;  1UPM B;  4DJB A;  4JV1 A;  4Y28 C;  1KRP A;  4ILR A;  1HBM A;  3PW0 A;  2F9J A;  4LF9 J;  4NEZ A;  2EKN A;  3TX8 A;  3QSY B;  1K73 T;  4RW4 A;  1DFD A;  2FTR A;  1KON A;  4DQI A;  1TL1 B;  2V94 A;  3OR2 A;  2BMB A;  2V63 A;  1XEZ A;  1YZ7 A;  2W01 A;  4CI0 B;  3DLJ A;  5JVH Q;  4G1Q A;  3CPW R;  1U1M A;  2MDA A;  3PJX A;  3Q8R B;  1S10 A;  2DR8 A;  1SCJ B;  2FUG 9;  4JI7 F;  4C4W A;  1QUP A;  2LEB A;  3J7Z 5;  3CJ3 A;  2F7V A;  3OXG A;  3J81 Y;  4NA2 A;  5F8J A;  1AXQ A;  1HNV A;  3SSQ A;  5KG6 A;  3IG1 A;  4QWA A;  3G96 A;  1QAJ A;  4B3O B;  4HVZ A;  1KLN A;  1NCL A;  1N88 A;  3ENQ A;  3G2X A;  5HJY A;  1S6P B;  1GT8 A;  2ZE2 B;  2HMI B;  2IA6 A;  1XK8 A;  5HVF A;  4DSK A;  2XMV A;  2ASY A;  1SC6 A;  2XZD B;  3DDK A;  5DGB A;  4Q0B B;  3CCE S;  1ZM9 A;  4DV2 F;  1WSV A;  1NBE B;  2B56 A;  2FZC B;  3AD7 C;  3B82 A;  3FSX A;  4HT5 A;  4Y6I A;  3SCK E;  4ED4 A;  4ZHR A;  3PIP Q;  4DR3 F;  1U7L A;  4LRE A;  1YGY A;  5DM6 Q;  1HBO A;  5I3U B;  1XIQ A;  1RYR A;  1T3N A;  5K8P A;  2FPH X;  3OL7 A;  4LJM A;  2CAJ A;  2CZ4 A;  2W4C A;  5CYM A;  3WX4 A;  3KYL A;  3FVY A;  3PKY A;  3AOD A;  2LDY A;  3TA0 A;  1U1L A;  1WC6 A;  3AQO A;  1S77 D;  4RR5 A;  5JXS A;  2DY9 A;  3H0P A;  4KIA A;  4UOG A;  4X2B A;  1NZ8 A;  1UW9 A;  3BPD A;  5FLX Y;  1X7V A;  1IUJ A;  3C16 B;  4P74 A;  2F63 A;  1HWJ A;  1RCX B;  4RZR A;  3K2Y A;  2OPP A;  3DYA B;  1G7C B;  5GAH U;  4CO5 A;  2OIH A;  2NYI A;  3JQJ A;  4BWJ A;  3EPG A;  1WTB A;  4IUF A;  1IKV B;  1NU4 A;  1XMB A;  4RPF A;  4CCH A;  2EXU A;  4N8N A;  3OTD A;  3QFH A;  1FRJ A;  2DGS A;  3CCS S;  2B4P A;  1TK5 A;  2OTJ S;  4I2Q A;  2DR7 A;  4QQB A;  2C42 A;  1ULR A;  5KFX A;  4FYD A;  2NUU G;  2OPS B;  2QYC A;  3TQE A;  5KG3 A;  5D4O A;  5DLG A;  1FJC A;  2P6S A;  5BR8 F;  1HQU B;  2RUG A;  1IQZ A;  2QIF A;  3MEG B;  3W8G A;  1EJ7 L;  5C2G A;  5IQ6 A;  2LEC A;  1TL7 B;  2GIQ A;  2WVE A;  3THV A;  5L8R C;  3PW5 A;  1N34 J;  3QZ7 A;  1QAY A;  3MMC B;  1SI9 A;  2HHV A;  3I5B A;  1QAX A;  4PR6 A;  2XMA A;  3MR6 A;  3TJ9 A;  2RUS A;  4YR3 A;  2ZBC A;  1LKZ A;  1FHT A;  2DRB A;  3CJS A;  1IBL F;  1VJQ A;  1TP7 A;  2U1A A;  3AA9 A;  4L76 A;  5HQM A;  1T11 A;  1PO6 A;  2H4W B;  2OPS A;  2W7P A;  3A3O B;  1YVF A;  5L9X A;  2XTJ P;  1LWF A;  4DV5 F;  3CJQ A;  2JX2 A;  3EZU A;  3OTB A;  3ZTS A;  2YBV A;  4RUH A;  2JLG A;  2OFH X;  2QMW A;  1TMM A;  2JL9 A;  4JI8 J;  1N6Q B;  2EFO A;  3WDO A;  4L75 A;  3M2V B;  2FHJ D;  3GIR A;  2XCP A;  1JK9 B;  5ETM A;  2AQ4 A;  1R8P A;  3QGP A;  2RS8 A;  5IC4 B;  1NJI T;  5GMD A;  2Y3Y A;  3JSR A;  4OZ1 A;  3KLH A;  2G0C A;  2VKZ G;  4K4W A;  2HYI B;  4CLP A;  2OO4 A;  4KYZ A;  4KH1 B;  4DV0 F;  4KRW A;  3R2D J;  2YNI A;  1IKW B;  5J1E B;  2DNY A;  1QM9 A;  2VG5 A;  2HFO A;  1S12 A;  1T94 A;  2P6T A;  4DL2 A;  2M88 A;  2RVJ A;  1HIY A;  1MN7 A;  3ICL A;  3MPW A;  2HBY B;  4OI6 A;  3G6X A;  3BH6 B;  4DR5 F;  2ASL A;  4IR9 A;  2E1C A;  5IC6 B;  4DSF A;  4O44 B;  3Q23 A;  2CQ2 A;  3VAI A;  1CC8 A;  1N5Y A;  1Q79 A;  1SJQ A;  2NCK L;  4G3I A;  4UY8 5;  4NWB A;  1SV5 A;  4J5O A;  3MUR P;  1UPP A;  1SIZ A;  2B6A A;  2DT9 A;  2RRN A;  4ZVG A;  4ZCM A;  2VDH A;  2CDQ A;  4HH1 A;  1B99 A;  4AL6 A;  3RBD A;  5A2Q U;  4EEY A;  4B9N A;  2DXD A;  3KJV B;  3VAK A;  4TLQ A;  1HMV B;  4LRF A;  3C6T A;  3DU5 A;  4DV4 J;  4DR6 F;  3CCM S;  2AMC B;  3ZO7 A;  2V8G A;  2BBE A;  3ZNU A;  3QGG A;  2DR9 A;  3QJL A;  1ROF A;  3I87 A;  5EWE A;  3HVA A;  3US5 A;  5IV4 A;  2D3O R;  1TAQ A;  3IC1 A;  2FGC A;  1WHV A;  5HP1 B;  1UCN A;  1U1O A;  1U24 A;  3L95 X;  1M0S A;  1U09 A;  3MTK A;  2B5J A;  2XUL A;  2YKM A;  3DHX A;  4MFB A;  4O4G A;  3MR5 A;  1J2V A;  4MFB B;  2AX0 A;  1B7Y B;  1JLB A;  3MXH P;  4UW2 A;  4L3K A;  3QAU A;  1T0T V;  3W7B A;  1YDL A;  3HK2 A;  1Y11 A;  1H7X A;  4CLZ A;  1DQ9 A;  1FRM A;  2AEJ A;  2EVZ A;  2XWX A;  3DLK A;  3IBW A;  1OMS A;  2CG4 A;  3MPD A;  4IG0 B;  1NM2 A;  1PCA A;  1PIE A;  4KKO B;  2PFF B;  2JHE A;  1JLB B;  1RTZ A;  4FYX B;  1R8B A;  4IO1 A;  4M1K A;  4F25 A;  2VIH A;  2WB1 D;  3ZXW A;  1M90 T;  4DF4 A;  1VJW A;  2MMY A;  2DVI A;  5KFA A;  3VWS A;  2JZ5 A;  4P7V A;  4Q2M A;  3DXB A;  1RIS A;  3CIZ A;  4ER8 A;  2GZO A;  3VZH A;  3LWM A;  2E5I A;  2Z2Y B;  4FF4 A;  4F4Z A;  5J2M A;  1U02 A;  3T1Y J;  1KTV A;  1KOO A;  1UW4 A;  2QX0 A;  2Y9H A;  1TAU A;  3EDR B;  3DLE B;  1U0H A;  2FC9 A;  3NGT A;  4LSL A;  5D77 A;  3VQS A;  4LF7 F;  1HNW F;  5GME A;  4XPC A;  1R0C B;  4C11 B;  4HHH A;  2D3Z A;  3K0J A;  2XYP B;  1CJV A;  1BWE A;  1KBR A;  4Y34 A;  4Y3C A;  1NEE A;  2O67 A;  4XDD A;  4ZP7 A;  3GIK A;  2DNP A;  1VC6 A;  2WVB A;  4UOH A;  4B9M A;  4DFP A;  3L7P A;  3DOM A;  1UVN A;  4OZ5 A;  4ECT A;  1I6J A;  3MMB B;  2RRA A;  4JI4 F;  2VC1 A;  3RBZ A;  3N5F A;  3N79 A;  2PE8 A;  3W8P A;  3UD5 A;  3NBP A;  4O0N A;  2W2M P;  1UVL A;  4CO1 A;  4N8O A;  3TAQ A;  1X4G A;  4FF1 A;  5KFF A;  1N6Q A;  2R2R A;  4WTO B;  3PJW A;  4ZVO B;  4C3K A;  2J9D E;  1VCT A;  1CEZ A;  4DLE A;  1S0O A;  1NJX A;  2EFP A;  4CO2 A;  2GIR A;  4OZN A;  2WHO A;  1NJY A;  3KLI A;  3CC7 S;  1TV6 A;  1X60 A;  2KM8 B;  2KTQ A;  2FJB B;  1W7W A;  2IFX A;  4WFN Q;  2CQC A;  1T05 B;  4J90 A;  5KT4 A;  3ZC4 A;  4BC9 A;  1XNR F;  2DHS A;  4ELU A;  2BAN A;  1QY7 A;  3EWG A;  1LFW A;  3IP0 A;  3R7N B;  4C8L A;  2HBQ B;  2P9E A;  2MGZ A;  1L5U A;  4DR7 F;  1GFW B;  2MZT A;  2VOD A;  2IRX A;  4KO0 B;  2ZEJ A;  2VF3 A;  2K8G A;  2CNK B;  3I0S A;  4ECV A;  1B0P A;  9RUB A;  3NAH A;  1IQT A;  2HQ3 A;  1Y9O A;  3KLV A;  3FCH A;  4UF4 A;  1HNV B;  3C16 A;  2UUB F;  2KO1 A;  4F4K A;  1RE1 B;  2NPI A;  2GVD B;  2Z0G A;  4KR0 B;  1H7W A;  4O3O A;  4DPT A;  2H5I B;  4Q8F A;  2F4V F;  1IM6 A;  1WJ9 A;  4UUX A;  4E2F B;  4K8R A;  1VQ7 S;  3CCQ S;  3MD1 A;  1NXI A;  1C4A A;  1XNR J;  4YFU A;  4RW8 B;  3T5L A;  1N36 F;  2FJV A;  2LP4 A;  5KT2 A;  1VIX A;  4RLE A;  4OV6 A;  4BHQ A;  1H38 A;  3RG6 A;  2A10 A;  2N7Y A;  3TZW A;  4TYA A;  2WOM B;  1WDT A;  2IPO B;  3VHQ A;  2AYM A;  3HZE A;  5E3P A;  1DLO A;  4OYZ A;  2KVQ E;  5KFC A;  1N54 B;  2B4O A;  4MMO A;  5C5J A;  4LBH A;  2R7W A;  2B0G A;  3EX7 B;  5DG7 A;  1VQM S;  4HAC B;  4V19 X;  1MRO B;  1LWC B;  3H5Y A;  2PFD A;  2CYY A;  5C2C A;  4NCG B;  2ZDO A;  4NLS A;  1KP6 A;  1FD8 A;  4RWX A;  5K8O A;  2IBO A;  4EK2 A;  1VGY A;  1ZM2 A;  1Y5L B;  2XSJ B;  3TVY A;  1H0H B;  2UVW A;  4W92 B;  3CIM A;  4KHP J;  2AU0 A;  2KYX A;  3AXK A;  1YLX A;  3DMJ A;  3DU6 A;  4K5R A;  1R43 A;  3RB0 A;  1W2B R;  1D9D A;  2FJX A;  2PI4 A;  4OHY A;  2G2Y A;  5A8W B;  4X4T A;  1RT3 A;  3UD3 P;  4AYB D;  4LF8 F;  2DY1 A;  3LGM A;  3OUY A;  2VZ9 A;  1TEL A;  2M8H A;  2ZOF A;  5LMN F;  4ED8 A;  2VHG A;  3KOA A;  3QGI A;  2VG7 B;  1F5C A;  1WDD A;  2JLE A;  5AE1 A;  5LXY A;  5KG2 A;  2AGP A;  4I6W A;  4JI2 J;  2AV5 A;  1RTJ B;  1TVR B;  2K1R B;  3RJM B;  1WTF A;  1CSJ A;  3C14 A;  3EGZ A;  2DNN A;  2RQK A;  4ZVQ B;  2CQD A;  4DS4 A;  4EBE A;  1KQG B;  1KTQ A;  2YXL A;  1EQM A;  6FD1 A;  1FJE B;  4QCL A;  4DPO A;  1DLO B;  3FRY A;  1NND A;  2UXD J;  3KNA A;  2IVY A;  2XMM A;  4QIG A;  1QDU B;  1T9X A;  4NOH A;  3MR7 A;  2AGO A;  3CJ0 A;  3TAR A;  4GO7 X;  4OJG A;  2N4D A;  2O5D A;  1TKD A;  2VA2 A;  2FLP A;  4PQU B;  1IBL J;  1PGZ A;  4NAS A;  3KFW X;  3GYN A;  3MPY A;  1VS3 A;  2LU1 A;  1HLW A;  3FBE A;  2IC3 A;  1NK6 A;  4PWD B;  1R7I A;  1UFW A;  1X5T A;  2ZBR A;  3LW5 C;  1SL1 A;  3MZI A;  1SBR A;  2Q6C A;  3FDS A;  4FP9 A;  3RU0 A;  2DEJ A;  3WIV A;  2IM2 A;  1SQF A;  4U7C A;  1SL2 A;  2IY5 B;  4XPE A;  4MJK A;  1J27 A;  3K17 A;  2ROE A;  3OR1 B;  3K8W A;  3M1V A;  5E3Q A;  3T19 A;  4DX6 A;  1D1U A;  2J9C A;  3AJD A;  4X4V A;  1FO1 A;  2JRS A;  2QMX A;  2R7O A;  3DFE A;  2YTC A;  4CRJ A;  1NH8 A;  4ETX A;  1JLC B;  3HMJ G;  1NJZ A;  2K2P A;  3AA8 A;  3ITH B;  5B0F A;  3M4X A;  4KE5 A;  3RB6 A;  4R8U A;  2AEF A;  2D1C A;  4QR1 A;  1Y0H A;  4CYU B;  4KQZ A;  2XHW A;  3H90 A;  4QBU A;  2GML A;  5JVG Q;  3OLA A;  2QYG A;  5HRO A;  1HHT P;  5A8R B;  1KLM B;  3SCI E;  4KPC A;  4QIV A;  3PW2 A;  1KNZ A;  3TZZ A;  5A8K B;  1A0O B;  1VBY A;  4ITS A;  2IJF A;  3SSS A;  4F36 A;  1OYE A;  2N4C A;  3CCV S;  2LXI A;  1HPZ B;  4RBU A;  2FIU A;  3GJS B;  1TFW A;  5J2N B;  2CA9 A;  2KL8 A;  4OZ0 A;  2GGP A;  3MEK A;  3I55 S;  4LF4 F;  3HFK A;  2PMZ D;  4ZA1 A;  1WSR A;  5KFE A;  2NXE A;  4WCE Q;  1T03 A;  3DDI A;  4ED5 A;  3BF4 A;  1WG1 A;  3RRG A;  5ETP A;  5D15 A;  1MG7 A;  5GAE U;  4AT1 B;  4I2P A;  3CCL S;  2V6A A;  1AT1 B;  2OEL A;  1A9N B;  3EVM A;  4KHR A;  4M5K A;  3H20 A;  3E01 A;  5SZT A;  4ELT A;  3QMQ A;  3P96 A;  2FQQ B;  4IFY B;  4YB5 A;  5G0R A;  4X4Q A;  1X4F A;  5KFQ A;  2KRB A;  3E01 B;  1UWA A;  3OHB A;  1TKT B;  2IYG A;  1PJ5 A;  3BZQ A;  3VV2 B;  1D9F A;  1PYT A;  2J7W A;  1CJT B;  2ZUA A;  3C6U A;  3CJT A;  4QYR A;  2ZJR Q;  1RQ0 A;  4W90 B;  1JIH A;  4TN2 A;  1E6Y A;  3U27 A;  3NGU A;  4TU7 A;  4AQY J;  1RT1 B;  3BN7 A;  2RH3 A;  1WC0 A;  3DM2 A;  2NRE A;  1YG0 A;  1S9F A;  1MMD A;  3JXO A;  3WQP A;  4YUD A;  4ZVE A;  1SKU B;  1NDL A;  3MMB A;  1WI8 A;  2J6U A;  2M8D B;  2ZH3 A;  1T95 A;  2W7A A;  3OFH A;  5KT5 A;  2DGO A;  1MML A;  1NSA A;  2MJU A;  2UVV A;  1WKL A;  1RT7 B;  3A4T A;  4BBY A;  1HNW J;  1P6T A;  3JTO A;  4P72 A;  4KGX B;  5D78 A;  4RUB A;  4E98 A;  5EGY A;  3BV8 A;  3H5X A;  7FD1 A;  2E9R X;  2YWE A;  1IVZ A;  3BGR B;  2EKY A;  1FRH A;  1KHW A;  4OYM A;  3UDE A;  1NDK A;  5ETK A;  3J81 j;  3OHA A;  1U26 A;  4AL7 A;  2UUT A;  1QVF R;  2B9X A;  4WXO A;  2VPZ B;  4J9O A;  3QZ8 A;  1S97 A;  1BXN A;  4JI2 F;  3KHG A;  3R5A A;  1IR0 A;  5ETL A;  1RWX B;  5LMN J;  3LUY A;  2QMU B;  4NYO A;  2LEP A;  5GVQ A;  2NQP A;  3FFI B;  1SQE A;  3H2L A;  4HHU A;  4X62 F;  3MOJ B;  3D0H E;  3IGN A;  2HFU A;  3CCT A;  1LK5 A;  3IMQ J;  3FMW A;  4OMF G;  2GO9 A;  3Q86 A;  1FRK A;  1GMU A;  4QZV B;  1N32 F;  1HAR A;  4M5M A;  1Y3K A;  4FYY B;  3I82 A;  1VIS A;  3IWN C;  3GON A;  4DDF A;  5B0B A;  2DR5 A;  1A7G E;  1NAQ A;  2DGT A;  2WW4 A;  3M8Z A;  4LRD A;  4LR7 A;  5A0Y B;  2OTL S;  1BLU A;  3VAG A;  4RKU C;  4HT7 A;  5KFB A;  4C8M A;  3QBC A;  5BJR A;  3ZZO A;  2M7S A;  1XMQ F;  2R2T A;  2FHO B;  2DNM A;  3G86 A;  4DWI A;  5HK4 A;  2YX1 A;  5EHH A;  4FNH A;  2MLX A;  2YQ3 A;  2ZD1 A;  4M5G A;  2QV6 A;  2ZBQ A;  4QW9 A;  4QU6 A;  2CJX B;  4PKD B;  4RO0 A;  1PSD A;  5F41 A;  3UE2 A;  2PII A;  4BWM A;  4G65 A;  5J2M B;  4DV2 J;  1FDD A;  3TEH B;  5DG8 A;  2V68 A;  3LP1 A;  4DV7 F;  2ZKT A;  3ZZP A;  4QYZ J;  2ZD1 B;  3CNQ P;  5HMZ A;  3D3B J;  1ZTT A;  4LF2 A;  4DS5 A;  5AXL A;  4FN5 A;  4U95 A;  2XQC A;  1UEV A;  3GB0 A;  5DQH A;  3CJR A;  2AF6 A;  1RUS A;  2VQF J;  1RHU B;  1Z2L A;  1EP4 B;  4KH0 B;  1ZZF A;  3T41 A;  3CCR S;  1UVI A;  5E3R A;  1XMO F;  4C8Y A;  4I67 A;  4F02 A;  1RTH A;  4O23 A;  4ES1 A;  2CUY A;  3RTV A;  2UUB J;  1UET A;  2R8G A;  1JXL A;  2A3J A;  4ES2 A;  2G2Z A;  5D0G A;  2ZH6 A;  1AZS B;  3JB9 k;  1C2P A;  1GTH A;  2E44 A;  2MY7 A;  2OP5 A;  3MCN A;  3TWZ A;  4YB7 A;  5KFS A;  1ZM4 A;  3MEC B;  3RBE A;  2ILZ A;  2KXF A;  4DX5 A;  3M2R B;  1FKP A;  1Q53 A;  4P52 A;  4A8M P;  1EIY B;  4A8X A;  1MSW D;  1X4E A;  2LQ9 A;  2PC6 A;  2VFS A;  1V3R A;  3A3P B;  3IBC B;  3SI8 A;  4JV2 A;  4UY8 T;  1BMQ B;  2ZZN A;  2C1E B;  4Z2X A;  4EU0 A;  3TR5 A;  2OPQ B;  2XMK A;  2CPX A;  4URS A;  5K8N A;  3M2V A;  5U47 A;  2Q43 A;  1B0V A;  1F3F A;  1PBA A;  4DEZ A;  2AJQ A;  2GCF A;  3KTQ A;  2CFX A;  4DG1 B;  3H2U B;  1HQE B;  2EFQ A;  2YNG A;  4U6P A;  4J9L A;  4F0K A;  3FBB A;  4LIW A;  3OV7 A;  4QOT A;  1S0V A;  2HQF A;  2FY1 A;  3QAE A;  1WWH A;  1U6B A;  2GAH C;  3UN5 A;  4AQY F;  3QGH A;  4QW8 A;  2FYX A;  3S01 A;  4F4A A;  4RWW A;  1VQY A;  2LXU A;  3J80 Y;  2BDP A;  4LMZ A;  2BJ8 A;  1X4A A;  2HLT A;  2FC8 A;  1TFY A;  5ETR A;  3MTJ A;  3VVU A;  2WSE C;  4JI1 J;  2NS1 B;  1JLE A;  3DKD A;  1NK9 A;  1IBM F;  1BWV A;  2M52 A;  2MZS A;  2MZQ A;  2V50 A;  3I4P A;  5J2N A;  4I56 A;  1VRQ C;  2EEY A;  3GJT B;  4JOU A;  2KT5 A;  4CT9 A;  5L46 A;  3J7Z T;  3CF5 Q;  3AOA A;  3N5B A;  1JXE A;  2DH9 A;  4CLU A;  2W9B B;  1SJ4 P;  1M5K C;  4IKA A;  2XMU A;  3MM7 A;  2DO0 A;  2CPD A;  1S1X B;  4DFJ A;  1X9S A;  3D68 A;  3HHL A;  4MK9 A;  1Q16 B;  1DRZ A;  2XYH B;  3QO9 A;  2L48 A;  5A6W A;  5HRO B;  1CG2 A;  3OT9 A;  3GU0 A;  1ZET A;  3C46 A;  3QO9 B;  4X65 J;  3SYZ A;  3EXC X;  1WNE A;  1NO8 A;  2I8E A;  1C1B B;  1KHV A;  4OYB A;  3A1Y G;  4PWW A;  3G8T A;  1UA0 A;  3T1A A;  1FRI A;  1SC3 B;  2Y1J A;  1NHU A;  4H4M A;  2FVC A;  1FNX H;  4OYX A;  2ZZM A;  2XNQ A;  1DAX A;  2IAJ B;  2RSQ A;  3OD2 A;  4K4Z A;  1GMW D;  4CP5 A;  3IWL A;  2DD8 S;  4UST A;  4NLQ A;  2E9T A;  3NGK A;  2K06 A; 
#chains in the Genus database with same CATH homology
 4GVB A;  4GVB B;  1KP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...