4GVBA

Crystal structure of the virally encoded antifungal protein, kp6, heterodimer
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Atomic Structure of the Virally Encoded Antifungal Protein, KP6.
pubmed doi rcsb
molecule tags Toxin
molecule keywords KP6 killer toxin subunit alpha
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2012-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.440 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Killer toxin KP6 alpha-subunit 4gvbA00
4GVBA 4GVBB 1KP6A
chains in the Genus database with same CATH superfamily
3VAJA 2DITA 2G1HA 2P6TA 3THVA 3EXCX 3FBEA 3H59A 1KLMB 1RHUB 1BQMA 4P2FA 1EHWA 2CJQA 4IG0A 1RWNB 2DNZA 1TL1A 3AJ2A 4RL1A 5LM7E 4LF7F 2HZCA 4DV0J 3CJ4A 2NPIA 4NLYA 1CQNA 2Y1JA 3A12A 2UV8G 5HROB 1RKJA 3P5BP 1FHTA 1F5AA 2RNEA 4IDKA 2ADBA 2WK4A 4PQUA 2R7RA 4JI6J 2POKA 1N34F 4PZVA 4NLGA 4NLVA 5EX3A 1J5OB 4IFVA 3AD9C 1X4GA 2NXJA 2H9ZA 3NAHA 4JP8A 3JAMY 3ILOA 3DLEA 3D54A 2J7KA 4I7FA 4NE9C 2VQFJ 2I1RA 2MLXA 3AQPA 1SQEA 2DNHA 1X0PA 2WW4A 3ZTSA 5KG2A 2DRAA 3D1QA 2R7XA 1UL3A 2LP4A 1NKEA 1S1TB 2I5JA 1KS2A 1PJ5A 1X5OA 2K7JA 3GPAA 4FVMA 5M2RA 3RZAA 1C2PA 4P2MA 1CULB 3OTEA 5CYQA 5KFHA 2KTQA 2HQFA 4OYBA 3I56S 2FVSA 1UFWA 2H5EA 1VQPS 1EETA 1UAWA 3CC7S 2IC3A 4GKKJ 3NRBA 4MYTA 1PC5A 4PXEA 2HHHF 1AYEA 3D1HA 3O5TB 3BGRB 1WSRA 2P5VA 1CULA 3OPKA 3OR1A 5KFLA 3D6HB 2HHUA 3BB5A 4I67A 1RTDA 2CDQA 1UFKA 3H90A 3SDEA 1WTFA 1DLOB 2C42A 3SMZA 4C0HA 5M2UA 1D0EA 4PUOB 5I3UB 4X64F 3CO9A 2GVZA 2AHOB 2KT3A 2OH2A 1GTHA 2MKSA 1R0BG 1YJVA 4WXWA 3A13A 1RSCA 1SV5B 2LYVA 1KQGB 4Q8EA 2IFXA 3HI9A 1YWXA 2ZH3A 1IQZA 3ZZ0A 5J2QA 2CUYA 4HHHA 3MCSA 3LP0B 1G1XA 5ETVA 2O66A 5KFUA 1OY9A 3RW7A 2W4CA 3HP6A 3E01A 2H3EB 3M2UA 4ZCMA 5KFYA 5G4DA 1HD1A 1Q7LB 1VRQC 2NUHA 4ZLNA 4IQMA 2O5DA 1QE1A 1TL4A 3LPEA 3CCMS 4RW8B 2ZH8A 3WDOA 3IR5B 4B3MF 4CO3A 3CW2C 4DUZJ 2GQ2A 4ZPBA 2AJQA 3KK1B 2BM1A 4OI6A 1VI7A 1FFWB 1FDDA 3CB4A 3DC2A 3GE9A 3HVRA 1QVGR 2YY3A 3I5BA 2FB0A 2F5GA 4MT1A 4URSA 3CMES 3HT0A 4DSKA 2FC9A 2EG1A 4ILLA 1RTIB 5IV3A 3DGPA 1DQ8A 3I31A 4GMKA 2M3DA 4O3QA 4ZKAA 2AGOA 4JI5F 2CRLA 1G7CB 3HHNB 2COLA 4XDCA 4PXCA 1UZHA 3BO4A 2YNFA 4H4MA 3VGUA 3GSIA 2ZBIA 4AQYF 3PHTA 5F3TA 3PV8A 1N34J 1VQ5S 5D0RA 2GIRA 1D3WA 3KLVA 4A8FA 2I38A 2LCWA 4LF6J 3CJ8A 2MPUA 2KXNB 2X3GA 4QPXA 3X1LB 4MK8A 4P7VA 3TAPA 3T3FA 4RWXA 2DGSA 1WI6A 2QGFB 3F0NA 3U7JA 1ELOA 5K8OA 1JB0C 2YPYA 2EVZA 1DTQB 4TNOA 1GK8A 1WD6A 2BW2A 4UUWA 1X4FA 3RGIA 2B8QA 3TUIC 4A4JA 4QYRA 8AT1B 5K20B 4LIWA 2FJBB 4PR6A 2OSQA 1U47A 1YJ7A 2C3MA 5E41A 3C6UA 3KJFB 2R2UA 1Q0NA 4J9MA 2HLUA 3OL6A 4DR1J 3C6TB 3DMJA 4DCJB 4ZLPA 3G8SA 2XY6A 2OFHX 2R9LA 1WOSA 1VC6A 4ETXA 1RT7A 2P9CA 2JX2A 4IR1A 2BOPA 1TV6B 3CMQA 3K7RA 5CD4H 4DG1A 2QIFA 5C24A 3KLHB 3EYZA 4RBTA 4DV3F 1S72S 1M1HA 3H7HB 3IWXA 5KG1A 5I42B 1S6OA 1OJ4A 3BGUA 3GZ7A 3QIPB 3EWGA 4UF4A 4ES1A 1S6UA 2WSEC 2ZNYA 4X62J 4OI2A 3FBFA 4OYXA 4ZOSA 5IOLA 1XK8A 1SC4B 2DGTA 2YKMA 1LWXA 1RXOB 4I0WA 5HVGA 5JMNA 5KFMA 3CCES 4LIRA 2HAFA 2DNKA 3GIRA 1KTQA 3PEJA 4CTAB 4TLQA 3FSIA 1S77D 2VOPA 4OZ3A 2WSFC 3OXLA 2XS2A 2C2RA 1V5VA 2OPSB 2QSWA 5LSOA 2CNOB 1HI8A 5D0HA 1Q8BA 4YFUA 4DUYJ 4GKJJ 3MMCB 5AE3A 2IVFB 1K0TA 1RBLA 3L7PA 1IJEB 2WOMB 5HQLA 4BS2A 3G6XA 4JI7F 3GJRB 5KFZA 1VRTA 5L38A 4HT7A 3VR1A 3ADAC 3FC9A 4F3QA 1UA1A 3X3UA 4C6AA 1NK0A 2FLNA 4GC6A 3KLEA 1WUUA 5HVHA 2DH8A 1RAHB 3M6VA 3W61A 2IDEA 1S49A 2BJ7A 1F3FA 1RWVB 3J7YI 5HP1A 4DR5J 4UW2A 3FRZA 2V8HA 3GQCA 2GA7A 4C8OA 3MUMP 3HO1A 1XR5A 4DX7A 3PM9A 3R1LA 2C3PA 1SUQB 1BHNA 1S99A 2XMWA 1IR0A 3CJTA 2JFKA 4MH8A 2DNQA 4KAIA 1HIYA 2X3DA 1NHVA 3GG0A 1RABB 2ZJRQ 1TV6A 3V5RA 3V6DA 2XLKA 1E6YB 3ZZUA 3ZC4A 3DOLB 3RUBL 2QA2A 1JXLA 1REVA 2IJFA 2KKHA 4B9MA 3T5LA 4U7UD 4TVAB 2KHDA 2MKKA 4YY3J 2YX1A 3CCWA 3BPDA 4LREA 3AD8C 4NLPA 4U95A 2V4RA 3FMWA 4MIWA 2YPZA 3UFCX 2ZE2A 4DV7J 2LEBA 4DL5A 5AXMA 1FJEB 2HRUA 4PWDA 3OFHA 2BYCA 1SJQA 1WWHA 1XMBA 4KB7A 3H5XA 3KLFA 3OTBA 1O51A 3VTIA 5ETNA 5KAKA 1KEKA 1X4HA 4I4BA 2XMJA 4G1QB 5LJ3Y 3V6KA 2VPWB 3AB2B 1QTNB 1H2VZ 2MGZA 2NREA 3KLIA 1I3OB 5AXNA 5ETPA 1HLWA 1P1TA 3WBZA 2XGPA 2BX6A 2IVYA 4G1PA 3VCDA 3VAKA 1Y0HA 3SQGB 4CIOA 2ZD1B 3AD7C 1QUPA 2ROEA 4H4OB 3EMTA 1NH8A 4DUTA 2BE9B 3NCPA 2BQRA 2HQCA 2E29A 1GT8A 3CNQP 5E7OB 1RE1B 2XCPA 2FVPA 1MWZA 5KFGA 5GAHI 1M1KT 4FYDA 4U8YA 3H2UB 2E5IA 3UW1A 4UY85 4QJVA 5FD1A 2OELA 5AJ3F 2PI4A 4X2BA 1X9SA 3MM8B 4K4XA 2O01C 4ATNA 5EN1A 4LSNB 5CH7B 3MCNA 4FYWB 3PEHA 3PZPA 1U2CA 3IWNC 3BH6B 3OVBA 4DV4F 1NDCA 5BYSA 1FXRA 2B4VA 3Q8RB 1ZH5A 1A9NB 3IO1A 3MR5A 1UVKA 1UJ5A 1T94A 1S1UB 1AA1B 3VZHA 3W62A 1QE1B 6AT1B 2LA4A 3M9OB 2D3OR 2FIUA 3QFHA 1N56A 1NNDA 2OJ3A 2Q6CA 4URQU 4DXLA 3M7VA 4N47A 5HMXA 5KG5A 2JFDA 1H38A 3CF5Q 2HRTA 2W01A 4RBVA 4X65F 3W9JA 4Z2XA 3DYAA 3B8HA 2B43A 4DR5F 1U24A 4ANEA 3GIKA 2HHWA 1FCAA 5I3UA 4NLRA 2AZ1A 4I2PA 4B3RF 3K8VA 3P96A 1F5BA 1R6VA 3M05A 1CPZA 2XG8A 3HVWA 1RB0A 2BMBA 2H51B 1H7WA 1OQ3A 2YVSA 3GU0A 5HK4A 3TI0A 2UUBF 2GVZB 2ZOGA 3BGRA 3FQLA 4L72B 4PYDA 3BDPA 1KFDA 3ZTPA 3P49B 1EKSA 1ACMB 1Q95G 2G0JA 4DQIA 3PIOQ 1XR6A 2R2SA 2IC3B 3TNVA 4PUOA 3HVAA 4C8YA 3SDEB 2V0NA 1YI2S 4BWJA 3LQVA 1MROB 4ILMA 2HVHA 2A3JA 2MQMA 1DTTB 2ILYA 4HTIA 1FDBA 3NLCA 2N3OA 1IKVB 4CLFA 4QOTA 1OSCA 1ZETA 4CYUA 2ROPA 4NASA 1L3SA 1MU2A 1W7WA 4NYPA 4DQPA 3EPIA 1VLYA 1O0PA 4QQBA 4CLSA 4OYZA 4K5SA 3FZBA 2ZHOA 3EDQB 1UFLA 2DXEA 3OXFA 5I4MA 1GTEA 2R7OA 5H1SV 5IC6B 4O3RA 2J7UA 1JXEA 2RB7A 1T0TV 1RTHA 4QYZJ 2HFZA 3A1YG 2FLLA 3CC2S 4MAKA 3NGTA 4DDFA 2DO4A 1YBUA 1LW2B 1TKXB 2W24A 3UDVA 1Y00A 3RAQA 4JUZA 5GAHU 1N8RT 4E0DA 1U1QA 2EFPA 2MKCA 1RAGB 4A48A 1Q4RA 3OUYA 1X5SA 5B0AA 3EVMA 2DCLA 1TMJA 3HHLA 1H2UX 3KUHA 2W4PA 1KKHA 3QNWB 4I7FB 4L74A 4NMLA 4P2SA 4XAKA 5T7LB 2QA4S 1KVIA 2Q79A 3K8WA 2VBWA 3GIJA 3N4WA 3F56A 3KJQB 3MR3A 5JVHQ 1BGXT 1D8ZA 3OSPA 5K8NA 3FBBA 4UOGA 2XQCA 3EX7B 2XNQA 1TTHB 2MQLA 2AZ3A 4DX5A 2L9NA 2BA9A 1VQYA 3HSGA 4JBCA 3QQCD 2GHPA 2BQ3A 1NB7A 1DFDA 3C3LA 3UWTA 2A10A 2W9CB 4DV4J 1NJIT 2H5IB 2QLJB 1BQNB 5KOWA 1VC5A 1VQ6S 1IKWB 3EXYA 4DPOA 4B9LA 4DV2F 2VU5A 4FF1A 4LT6A 1WG4A 1ZPVA 4RW7B 3IG1B 1YX2A 1LW0B 3D0HE 3CJKB 1OPZA 2DR7A 1CEZA 1N5YB 4X84A 3NMAA 1FNOA 1PYTA 4G1IA 4Z7CA 3KK2A 3J81Y 1GX5A 3W5ZA 4LFAF 1JLQA 1S1VB 3LOUA 1W2IA 2QLFB 3RAMA 3CCVS 3RBEA 2UVWA 2P8IA 3M30B 4V19X 3U1LA 1Z4UA 2HVEA 2NCKL 4OZ1A 3CCSS 2JWNA 2M5YA 1TELA 1U2RA 2F4VJ 2MGZB 1IKYB 4RW7A 3HHKA 1KSPA 2H1YA 1F2HA 3HFKA 3D6TB 1KQKA 1RYRA 4WE1B 3GJSB 1IN0A 4C8NA 4R5PB 5LT5A 4YS2A 2OEJA 1G3OA 4K4WA 2F9DA 2MZSA 4BLGA 3T5JA 5H9EK 5H9FK 4OJHA 4CLWA 2OD4A 3GV7B 2AGQA 3LW5C 4NRUA 1OIAA 2E66A 3BKUA 4K7QA 2W7OA 4K0KJ 2BRKA 1U1KA 4NCGB 4JI8J 2WSCC 2BABA 3POTA 4USUA 4AE5A 3J7A1 3N6NA 2G0CA 2ERRA 2HHSA 1CJKA 2J8AA 2DIUA 3IS9B 3O1LA 1Y5NB 2R2TA 2A6OA 1JLGB 1I1GA 4MK7A 3H20A 3KOAA 3LH2S 1FKOA 1TFYA 4RX6A 2EXUA 1FVQA 1T95A 1H72C 3R5JB 3I32A 4FBUA 2M52A 4Q7AA 5EDWA 4F50A 5B0GA 2HS4A 3MEDA 5U47A 4TU8A 1A7GE 2ZFHA 2B7BB 2QJ3A 5T7LA 5IT4A 3VAHA 4F4WA 1WI8A 1QSSA 2DHGA 4XK8C 2OUGA 4IG3A 4LRCA 1YKWA 2J7WA 9RUBA 4ZIWA 3MWBA 2MQOA 3KHGA 3EGZA 3KG4A 4B9UA 4OZ2A 1B99A 2OEMA 4OQJA 2QLXA 2DR8A 2HMIB 4UY8T 5K14B 1JNZB 5KT2A 1VRTB 2UVVA 3BDEA 1Q5VA 2HIYA 3PCOB 4RPFA 1MSWD 3OVSA 1ZS6A 1C4CA 2HG4A 3ZNUA 1S6QA 4CLPA 4R25A 4YMEA 4ZVQB 5J1EB 1IM6A 5L39A 1WF2A 5J2PA 1DRZA 2G9OA 3PW0A 3LP1A 1HBMB 1SL0A 1S76D 1GXLA 1ROFA 4ANDA 4LRAA 3ICLA 4ZITA 4ERDA 1N36J 2DH9A 2K1RB 1V3ZA 2CADA 3JSYA 1SH3A 3H2LA 1SJRA 4I6WA 4M1KA 3VGVA 4F0KA 2V5HG 3D2WA 2IMWP 2L08A 3SSQA 4KHMA 1ZA2B 7FDRA 4Q45A 3T5KA 2MLZA 4U7UK 2UUTA 2FHMA 2BACA 2XM3A 5L9XA 5C24B 1KC8T 4TU7A 4DG1B 3T1YJ 2UXDJ 2RHSB 4PWWA 4UQTA 4ZIVA 2GNKA 5L9NA 3W2WA 1VRUB 1KHWA 3DDKA 4N8NA 1H74A 1U02A 2HNZA 5D4LA 5KFQA 1YJRA 4ECZA 2UVRA 4F8RA 1UVJA 5K9FA 3MEEB 1WC3A 1XNQJ 1FX4A 4NLWA 5EX0A 2D74B 2VV5A 4LFCF 1HMVA 3TVZA 2XS7A 4DS5A 2JVRA 1TKTA 1VK8A 1ZBTA 2XSJA 4DR2J 3J7AN 2Q1LA 4C97A 8ATCB 2CFXA 3CEDA 5HMYA 2R2RA 2LFVA 2V4JA 2RS8A 3ILJA 1RACB 4EK2A 4DFKA 4W90B 5JXSA 3THPA 4Y2CA 1SC1B 4DZDA 5J2MA 4K0KF 3MM8A 2V8DA 4IFYB 3Q23A 4MK9A 4RZRA 5AT1B 2A2CA 3WIUA 4WU3A 4ZMMA 2CPFA 4ED1A 1VBZA 3ZFVA 4NXMF 1U1MA 4F67A 4DFPA 3OV7A 4QPTA 1U8SA 3DDIA 4ECUA 1TUWA 2CDRB 1C1CB 1MWQA 5K5MA 4MFBB 1IM4A 4CLLA 2E7WA 1F6TA 1JLBA 2MQQA 3PX4A 4B9SA 3VZIA 2E9TA 4O0IA 1WHXA 3SFUA 1JJ2R 1CLFA 1F9FA 4HHJA 5D15A 3E2EA 4EO8A 3DRSB 3GYXB 4PEOA 3C8YA 3MMBB 3KHRA 3PKYA 2JEIA 4HACA 4QIWD 3VVUA 2KVIA 4YDDB 1UJ6A 3UVJA 4AYBD 2U1AA 5CCMA 1NAQA 3EZUA 3LUYA 1HNXF 2GHVC 1JIHA 2MXYA 4C7QA 2R8GA 4QU7A 4EBDA 3M2UB 4ECWA 1B0VA 3DHXA 4G1QA 3QWPA 2RMLA 2MKJA 4TY9A 1T9WA 4HH0A 1QAXA 2KJVA 4ICLB 3SEOA 3UNYA 3KLFB 2E1CA 1B0TA 2M70A 3NCQA 1J5EF 4DSLA 1PKUA 3FRYA 1WORA 3JYTB 3DLKA 3NGSA 5D0GA 3W7BA 2ZZMA 1HPZA 4Y0FA 3DNCA 3EJMA 3QRPA 2N7CA 1CG2A 1P1LA 3OTCA 5B0FA 3MM7A 5HSPA 4ED6A 3HHLD 4ZPWR 5F8GA 4JI0J 2KHCA 4C2MA 3PRBA 1REGX 2J9DE 4O4GB 4WF9Q 3N6LA 4UOFA 5HQ8A 1S5ZA 5LMNF 3T1HJ 2C3UA 1VK3A 4C0BA 2KM8C 1WHYA 3KG0A 5DQIA 3A4TA 4CI0B 1SJ4P 1X7VA 1KBRA 4K2XA 2ZDOA 2VHGA 2DNNA 4N77A 2C2EA 3TX8A 1S4FA 1S97A 2CQPA 2ZUGA 3TA1A 1VBYA 2VBXA 3M32B 1FTCA 1OQ6A 3MUVP 2QL5B 1ZA1B 4R8UA 3PTWA 2D7SA 2ACYA 2PC6A 5A8RA 2LDYA 1WG5A 2RU3A 4NA2A 1JQGA 2UXCF 4F4YA 2HK3A 4F2SA 4PG7A 5F9LA 4OZLA 2VZ9A 3DGVA 3BYRA 2FVCA 1VQ4S 1S1XB 1Z2LA 1RTJB 2WONA 2ZBPA 4NI2B 4DQRA 3MECA 1RAOA 3MM5B 1XMQF 3ZZTA 2C2DA 1RYSA 4IG3B 3R2DJ 4DR7J 1YSJA 2W2PP 3IAS9 4ZVEA 1FK9B 1N33J 1HWJA 2YKMB 2ZM6F 4JYAF 2E44A 2D1CA 4RNFA 2DR6A 3BH7B 5J1NA 2HMIA 3MEDB 4XPEA 3K17A 2PD1A 4USIA 1ZM4A 2YWHA 2J6TA 1PIEA 2FHOB 2MJNA 3JSBA 4CTAA 2BKNA 3C14B 3WX8A 2QL9B 3UR3C 4C8ZA 3UQSA 1FDAA 4LF8J 1RT7B 2YNHB 1ZTTA 2AYMA 2LXIA 1ZYQA 1EKRA 2B9YA 4ZP8A 4O3SA 2YKNB 3G96A 1Q8KA 2BQUA 2CQ4A 3QFWA 3KLHA 2V9WA 5IQQA 4M5KA 3LP2A 4IQXA 4LF5J 2FHJA 2I0XA 4J91A 4FS2A 4CH0S 3FBCA 2DH7A 4NA3A 2CNNB 1LXNA 2LU2A 3TEHB 4LSLA 3IS9A 1HHTP 1F0XA 5ETSA 1GFWB 2ZHBA 4ELTA 3DRPA 3CCUS 2CJYB 2CPDA 2UVUA 1FJGJ 3DXBA 1LEOA 2APOA 4ZPTR 2Y1IA 3G2XA 3PFOA 3S1TA 4CM0A 3OSNA 5F8MA 1WC5A 3IBCB 3FCWA 3PIPQ 1E6VA 2F3JA 3HDSA 2YX7A 4QR0A 4OZ0A 3TZZA 2V94A 4DV0F 3R5BA 4LQ9A 4DQSA 3BSNA 2BM0A 1RWWB 1JK9B 2LQ5A 3QRQA 3TWZA 4LMZA 2VONA 3T1HF 3BM7A 3L09A 3MTJA 4F4XA 2EC2A 2KXFA 2HVZA 3D0IE 5A8WA 1WEYA 4JI1J 2YNFB 1U0HA 4H4MB 4E8UA 1KVJA 3UCZP 3M2RA 3PKMA 3J80Y 4BWMA 2ZBQA 2LQ8A 3EDRB 4L73A 2ZH6A 1SH2A 4QIVA 4F26A 5H9EJ 1N5YA 1B4SA 1RA6A 1VGYA 5BR8F 3R3TA 1Q86T 5DJBA 4XDDA 3I87A 3B4MA 3PR5B 2QLBB 1IKWA 3N5FA 1Q5YA 2DGWA 4KRWA 3GILA 4ZP9A 3QT8A 2JOQA 4QIGA 2XO6A 5KFKA 2G2ZA 5L46A 3J81U 3R1HA 1SJ3P 4OI1A 5J2QB 2AV5A 2C1EB 4P6QA 1YJUA 4EU0A 4GC7A 2JEGA 4DR6F 2HQGA 1TKDA 4KGVB 1RBAA 1LOUA 1Y5IB 1YQHA 3IC1A 2VKZG 2OO4A 4J7CA 3TOQA 4ED3A 3V81A 2V2QA 3DLHA 1GEHA 1WELA 2OHDA 4IOAQ 1N33F 2R7UA 3M8SA 1HKAA 2ZM6J 1XJWB 1SQFA 2R4FA 3HJVA 3R27A 4P9SA 4B02A 1MW7A 3SZ2A 3MMJA 2FJWA 3OL9A 2HNZB 4HYKA 2EW9A 4M5LA 1R8CA 2ATCB 2IAJB 4J9LA 3K59A 5F8NA 1RQ0A 2D3ZA 5D6GA 4X66F 4ECYA 1RTHB 2ACMA 3ULHA 2GAHC 1HBNB 1NPRA 4ZDNA 2KZMA 2RVJA 1TVRB 2UP1A 2R7WA 2DB1A 3EGVA 3WQPA 1Q81T 3NEKA 5KT5A 1RTDB 4IH6A 5B7WA 5KFFA 2FDNA 3OR1B 4NRTA 3CC4S 3BPSP 1Z1ZA 1HFEL 1IR1A 3M9MB 3ENVA 3IRXB 5KFEA 1FWLA 4NPOA 3TQEA 3CJRA 4RW6B 1I6JA 4RNHA 1LFWA 4M5DB 4RW9A 2L48A 2D3UA 3NNHA 4LF7J 1KHVA 4P73A 1IBLF 4Y2AA 4HHUA 3OL7A 3BO3A 4DL7A 1XQIA 4CO2A 2X1AA 4QWDA 3DLEB 4LBHA 5CZVA 2IY5B 2GJFA 2IAJA 3G8TA 1FRMA 3MI7X 1ICEB 1X9WA 2CYYA 1XEZA 1H73A 3ENQA 1TVRA 2YKPA 2YKQA 2UU9J 4IDKB 1EJ7L 1SJ1A 5M2PA 4PWUA 2C2NA 4RKUC 5HAOA 2XZDB 4ENOA 4FYXB 4YB1P 4ZVHA 1J5OA 4IG0B 3QMQA 4JI2F 2UUCJ 1NDPA 3QGGA 3V2UC 5LXRA 3RTVA 7AT1B 1KFSA 2E5JA 4LFBF 2JEFA 1FWPA 2ASLA 2ZH9A 2MJUA 2NS1B 1R31A 2YWWA 5E5NA 3ZZYA 3K5NA 5KFBA 4CLZA 3R5CA 4F0HA 2M8DB 1TL1B 4ALZA 1JJHA 2VB6A 1R27B 2YQ3A 1N32F 1XMOJ 2IBOA 1KLMA 5HJXA 3OFFA 1HBUB 1S7IA 2CQ2A 3POTB 1RZMA 1UP1A 1Y10A 1OY8A 7FD1A 5IZHA 3KJVB 2XY7A 1ZAVA 1QVFR 4K4SA 2PEHA 4K4YA 2ZC3A 1ZAWA 4ECSA 2FD2A 4R0EA 3R7SB 3DRYA 3K89A 4R5PA 1ZOTA 3O3LA 3PJXA 2MKIA 2F7VA 4ITSA 4WZQA 3D28A 1SI9A 3CTRA 3EGNA 3HULA 2OP5A 5KT7A 4YR2A 2HYIB 3UO0A 3W9IA 1U1RA 2V8GA 4B9VA 3W2VB 1C0TB 1FJCA 4JV5J 2CZVC 3CDUA 4J9VA 2C2ZB 1F2GA 2C3OA 4J9KA 1X5TA 1M5HA 2FY1A 3ZZRA 4EO6A 5CZXA 4JV2A 4I2QB 1RLDA 1JNRB 3DRPB 3G6YA 2ZKUA 4QYZK 5KFDA 4CO4A 3CSKA 4DV5F 3OR2B 2B5JB 2DHXA 2XMTA 3C15A 4DUYF 2RF2B 1FXDA 1IWAA 3ZZOA 4GKJF 1KRPA 3CT9A 3HFVA 1OWXA 2KO1A 5ETTA 3PR4A 1NK8A 2ZOFA 2HPUA 4C11A 2E5LF 1HNWJ 4JI7J 3M1VA 5L1JA 2F40A 4P2XA 2HHXA 1AW0A 2F9JA 2W9CA 2XMAA 3K58A 1RT5B 3W5YA 3PACA 3G71S 2J6SA 2CG4A 1PJ7A 2DYAA 4Q2MA 4FPRA 2OFGX 3RBDA 3A8JA 2IRYA 2KG0A 2ZH4A 3SFGA 2OGUA 3LTOA 1UPMB 2AU0A 3P3DA 3ZO7A 2BR0A 3GWCA 2HNYB 1U26A 1Y4ZB 1RUSA 1TKZB 3ELHA 3FFIA 3W64A 2KZZA 2W7AA 2V2VA 5CCLA 3J80U 3R7NB 2HHPA 3ISND 2MYFA 1FK9A 2MMYA 3QWUA 2EEYA 2A0FB 4KO0A 5IT0A 2V4QA 4DV6J 3CD7A 5HP1B 1AUDA 2YX4A 1YJNS 2HHTA 2V9KA 3BKTA 2XHWA 1SKRA 2RSQA 2BJ3A 3HSDA 4PG4A 1WC4A 1TKXA 2AYEA 1UA0A 1T03B 4QW9A 2CNLB 1U4BA 2JLEA 4RW4A 1UJ4A 5IM0A 3MD3A 5BYRA 2Y1RI 1UEVA 2JLFA 2VG5B 3O8WA 2GZOA 3MM5A 1VCTA 3AA9A 1KQFB 1LK5A 5A8RB 3IM8A 2JSXA 1R6YA 2LEPA 3MMCA 2V67A 4DV7F 3PRDA 1G6BA 2J0WA 2IM1A 3EZOA 1FERA 3TW0A 4CWBA 5CXTA 3F73A 1T03A 2CQ3A 4A8XA 4WFAQ 3TUPA 5HMZA 5KT3A 1PBUA 1HW9A 2Z8QA 3B54A 5KG3A 2XMKA 1A6LA 4TQRA 1S0NA 3M2VA 5KG6A 3BSAA 4DCPB 4KO0B 4CNZA 1FE4A 2WVFA 3FEZA 5A0YB 3ISNC 2EKNA 5CD4A 3MURP 2QRRA 3K5LA 2MY8A 5H9FJ 3OQ2A 5GMEA 4GO7X 5I42A 4NWBA 2AT1B 2UZAA 2RQCA 2W1BA 3CJ5A 1EP4B 5KG0A 2QFJA 1UCNA 2GO8A 4K4UA 2WHOA 3IAM9 2MSSA 1HA1A 2VL1A 2Z56B 2ZJPQ 3V6JA 1AFJA 2O67A 4ZA1A 1VBXA 1X4EA 1RAEB 2OMOA 1T02A 4J5OA 4WBFA 1WHWA 4MTPA 2E5GA 5DZ7A 1M5SA 1N0VC 1TL7B 2GAGC 3R6GB 4ZVOB 4U96A 3OTDA 2GHWA 3SCJE 5CYJA 3JS9A 3CJQA 3HVTB 2XYGB 5C42B 2VJVA 1U1PA 1VMBA 3G82B 3GR1A 4WWSA 2BBEA 2EBEA 1NMEB 3K5MA 2LQJA 1BUXA 3GB0A 3MTKA 1SVDA 1KTVA 1VDHA 4RBUA 5DO2A 4EMDA 2FJEB 4DJBA 3KHHA 2DIVA 2ABYA 1YHQS 3ETOA 3F41A 3PO5A 5BJRA 2VFVA 1T9VA 2ZDPA 5D4PA 1HQEB 1RK8A 1HYSB 2KG1A 4RU9A 5E3QA 2DEJA 4M5GA 2OPPB 3UDCA 4NCAA 1X4BA 3C2PA 2R7VA 3TANA 1U09A 4MFBA 4FYYB 5GMDA 1ZZNA 2OPQB 2EFGA 3T19A 1W2BR 3PX6A 3HHLC 3TX0A 1U1OA 2GGPA 3GG1A 2CKWA 4F3MA 2M2BA 5E2QA 4A8KA 4WYLA 3T41A 1ULRA 2QYCA 1VJQA 1SL1A 3NWGA 1NUEA 1S48A 4H4KC 1N0UA 3OHAA 2YBVA 1X4AA 4IFYA 2CPIA 4PYAA 2UUBJ 3T6BA 1WG1A 2HFSA 1HBUA 1VIXA 5J2NB 2AEMA 2VA2A 1HD0A 4NLDA 2W9BB 3VAIA 3HXMA 2DXFA 4X4PA 3KTQA 1U2FA 4GVBB 3E01B 2CQ0A 2QO3A 3H25A 2F8EX 2JVOA 1JLAA 4M5JA 4Y2KA 3GCXP 5J2MB 2DNPA 1TAUA 4J9SA 2XI2A 4IO9Q 3SCIE 1HNIB 1Q1KA 2ZUAA 3Q8UA 1RKIA 3MPDA 2GMLA 4RLEA 4Q8FA 4LRFA 5F0WA 5KFTA 4ELVA 2X7IA 3R8YA 1SV5A 5AXKA 2HNDA 1AUSL 1K47A 1KVKA 3OBIA 4KTQA 2IM0A 4QIEA 1VQKS 2Y8WA 4ECRA 2OIHA 3LP0A 5FJ4A 4EI2A 3GP9A 4FXWA 4Q44A 1FFGB 1R3NA 3SCLE 4CNYA 1UWAA 1MNEA 1RI7A 1VHIA 2HBYB 3C16B 1XR7A 3DRXA 4ZP7A 2XBPA 4A47A 3OTOF 3RB6A 2LQBA 2HLTA 1CS4B 3I6PA 2X1BA 2DHAA 3I0SB 3NWRA 2KXHA 4G65A 4KIAA 4WIQA 1EP4A 4X4OA 1QAJA 2Z4PA 4NEYA 4DBQA 2KU7A 1KNZA 1HHQA 1KDNA 1HWKA 3B4DA 5A6PA 1XWLA 2GV1A 1B7YB 1DLOA 1YRTA 3AFGA 4ZCKA 3UR0A 2RD5C 1IBKJ 2HZAA 4LQ3A 4WKRA 4YR3A 1QAIA 2W7PA 2HFVA 1MMLA 4DI6A 2AF6A 2R7TA 2G2YA 2D9OA 1HWUA 1SIZA 2WVCA 3G9CA 4AFFA 2BE7D 2ZC4A 1EETB 3BJYA 4FNHA 5J1EA 2QC3A 1EARA 1CJVA 1KD1T 1TQLA 4ED2A 1I5OB 1WSVA 3R5GA 4C98A 3JSMB 3BR8A 2UXBF 5F0UA 3W60A 1SCJB 4WYWA 2P2CB 3MEGA 5K14A 2YWEA 2ZVSA 3N6MA 5KFRA 3W1YC 3BBBA 2K8GA 4OHXA 1RWPB 5K8PA 4X4SA 4DFMA 4LF9F 1UVLA 4LFAJ 2UUAJ 2HIQA 2CQIA 2VBYA 1TKZA 2HBQB 1YTYA 3CO0P 4DR3J 5B0DA 3NNAA 3HT3A 5E33A 2IIHA 3ILLA 2RAQA 3OW2R 1XC9A 3KYLA 2EFVA 4IH7A 1JX4A 3FEXB 1BMQB 1UZDA 3JTOA 1BQMB 4QZVB 2XY5A 4KH1B 2DO0A 2F8HA 2MHNA 1HNZJ 1NK6A 1SH0A 2SXLA 3LAKA 3FNNA 1FO1A 1RISA 1X8DA 2XCAA 2RDIA 3EVWA 1RAJA 1VLOA 3IMQJ 1PCAA 3CJSA 3QBCA 4GVLA 4P72A 4ZVRB 2J0XA 1QUVA 2FPHX 2GX8A 2RF2A 1RT5A 2HVIA 4M94A 1OMSA 1V6HA 3HF5A 1QDUB 4Q5VA 1WNEA 1DURA 5ETLA 4Y2IA 2JEJA 1HI1A 1BY9A 2DY1A 2BANB 1NO8A 2FHJD 2IHR1 1S6PB 2Z2ZA 3HX9A 3M1VB 3NGRA 2M4MA 4OYOA 2DISA 1NSKL 2DGXA 4USHA 5A8WB 2YNIA 5IV4A 2BUNA 3GJQB 4QIFA 4K4TA 5IT9U 4TQSA 1RT1A 1VC0A 1F1BB 3I0RB 2LA6A 4IR9A 2LMIA 3GMGA 5D4OA 3K0JA 1TL3B 4H4KA 2VG6A 4RUAA 4IYQA 1VYAA 1YG0A 4OX9J 1B0PA 1HI0P 4NXNF 1V5IB 1F3VA 3KDNA 4I56A 2K3IA 2C22A 2ATLA 4M95A 4YB6A 1J27A 2XZTB 4FP9A 3GR0A 3RRKA 3V4IA 5EUHA 5IXUA 4KH0B 1BQNA 3PHEA 3SIPB 2RU9A 2M0GB 1SL2A 3IG1A 2UUWA 3BR9A 4LVOP 4ZVPB 3MMAA 4LF4J 1RDRA 4UUXA 2EK1A 4W4MA 2XLJA 5E3PA 3E8OA 2FVQA 2OI2A 4NLXA 5KFIA 1PGZA 2YKNA 3VQTA 2V6AA 2NXUA 3K57A 3DKDA 4C4WA 1N6QA 2QA1A 2VFRA 1X0FA 2BOAA 3FSYA 1TZ0A 4ZJQA 1WEXA 6FDRA 1Q82T 2W2OP 3OUYB 5DDPC 4WTOB 2HBRB 4B3SJ 4PRFA 3NL0A 1JKHA 1RAFB 2HQ3A 3MUTP 3VF0B 3H4BA 2CNKB 4WPAA 1YJWS 1RBOB 2QE5A 5KFAA 5KFPA 4ZVFA 3CE8A 2AX0A 4Q2LA 1OSDA 1OPIA 2IPOB 2KT5A 1RWUA 5T41A 5LSLA 4IRCA 1RTJA 5HATA 1GMWA 1XTZA 4RUCA 2ZNZA 3A8IA 4KGXB 1WF0A 4D3HA 4C3KA 5DDOC 1MU2B 1XIQA 2OLWA 1K73T 1VQLS 2KI2A 2D9PA 2HWTA 2JC0A 1NZAA 2KL8A 3CJ2A 5LXYA 3JSMA 4PG8A 1X31C 2GQQA 2GS8A 3D4JA 5A2QY 3Q8QB 4UOHA 5DGBA 2N3LA 4R8UB 1MMNA 2B4OA 3O6QA 1SIWB 2MZ1A 2AJ1A 2B4UA 4USWA 3MF5A 2VQEF 2KYZA 1SKSA 1QLNA 4EZ9A 2Y3YA 1TU0B 2I8EA 4KJIA 3RU0A 4I2PB 3HD1A 2QL7B 2VIHA 2DY9A 4TKTA 1K1QA 3VAFA 3PG9A 5CA5A 5LMUJ 2LQ9A 4FXVA 4ECTA 4B9TA 4DS4A 5EWGA 3I0SA 3UCGA 2PA3A 5LSRA 4UQGA 3MOJB 2CJBA 3DXSX 2HFOA 2W2MP 2DRBA 3MM9A 1RWMB 1NH7A 5F8HA 3CMAS 4EYHB 2J76E 2L9DA 4DL6A 4QR2A 3SSRA 1C1BA 3KNGA 2FHKA 2AD9A 1BWEA 5HROA 1HNVA 3BYPA 3QPIA 4AUKA 1HHSA 1R0AA 2JRSA 1D9DA 1HQ2A 2XYPB 4NOHA 3I55S 2YTCA 5ETOA 5GAGU 4Q0BA 2AJ2A 1HQUA 4P52A 2LLZA 3AA8A 2E1PA 3NS7B 4Z7YA 3O2IA 4DPYA 3D0GE 4CH1A 2W9BA 4ER8A 4BDPA 4LF4F 1RAAB 3TP2A 4BC7A 1N36F 5DDRC 5KFOA 2VA3A 3RR8A 3IXQA 1DJ0A 1J5EJ 4NLUA 1LQ9A 1UVMA 3JQJA 1JJ4A 2QMWA 3L3CA 3MOZA 3MCMA 2AIRB 2BJ8A 3I9ZA 5MAOA 1R7IA 4F36A 5MLCV 2J9CA 3M2RB 3Q0AA 2UXDF 2RJZA 3Q8SB 2X51A 1FT8A 5I3QA 1JLEA 3ET6B 4LR7A 4ZJLA 2VF3A 1B64A 3I96A 1FKPA 2XEXA 3OXGA 4WKYA 4WFYA 5I3PA 4F7VA 2VC1A 1HBOA 2EG2A 1UVNA 1S1WB 2KN4A 4A46A 4PPZA 1JLCA 4LFCJ 1N48A 2E1RA 4OIXA 2XHCA 2OTJS 1TAQA 2QMXA 5EHHA 3HM9A 2PIIA 1HQEA 3S6EA 3G82A 2YNIB 2V4JB 3M8WA 3Q8PB 2N4DA 2B0GA 2DPIA 3M8QB 3JXOA 1TKTB 1S6PA 4DOZA 4HI2A 4KKOB 4KV8A 3PW4A 1K9MT 4DPTA 2NZ4A 1WOPA 1FWKA 2DPJA 2HBZB 3U1MA 2HW3A 5D78A 4LSLB 3RB4A 2H5JB 4PWDB 4KR0B 1N5QA 2Q66A 1S12A 2B9EA 3DM2B 1I94J 2RQKA 1U49A 3CDEA 3HHEA 4OV6A 3PW7A 3MM6A 3IR6B 4ZLLA 1NB2A 1WC0A 2DVIA 3CIZA 3AQOA 5KG7A 4X4RA 4NLTA 5CHCB 4JYAJ 3TQ1A 2VFTA 2PSZA 4ID5A 3BZQA 3R9LA 2RIJA 2ZVIA 3H98A 5A0YA 2QX0A 1X5PA 2H4WB 4DU7A 3OHBA 3TAQA 3JB9k 1AFIA 1S9GB 2DD8S 1VOMA 3K5OA 3JTPA 5DQHA 1HNXJ 1ZZFA 2AP6A 4NMXA 2IVMA 1S1XA 1PC4A 3NXZA 4HL9A 4USTA 1BC6A 2Z2LA 1BWVA 1H2TZ 3MEGB 4KBIA 2QEXS 3TJAA 1U1NA 2HRYA 5CQGA 3NMRA 4PXBA 5LJ5Y 2FZGB 2J0QD 2WBMA 1CJVB 5KFSA 2WVEA 4J37A 1NCLA 1RHRB 2WOMA 4U7CA 1IKXA 5CYMB 5B09A 2R8IA 4ECQA 1NK5A 3PO4A 2B6AB 3HKWA 4C8LA 4MKYA 2F4FA 4OZNA 3K2YA 5DS7A 2V34A 2MZQA 3A8KA 3ZZPA 3DI6B 3PYDA 2MQPA 2NLWA 2L3MA 4DV2J 4EYIB 3DLBA 1S0VA 1LWFB 5AE2A 4J9NA 4E2FB 3AOCA 4JI6F 2N7YA 5LMNJ 5D3GB 5KFVA 3BGLA 2OPSA 1K0VA 2PEBA 2B3TB 4K50A 4F4KA 2VUGA 1FI4A 4O4GA 5KFJA 4DSJA 1NBEB 3TA2A 5DG7A 4F0MA 4DCOB 4OYMA 3OLBA 1CS4A 1N52B 2MZRA 2CVIA 3JQKA 4WFNQ 4CLUA 3CCLS 2R8JA 1H7XA 3C16A 1YLXA 4KFBA 2BEFA 2Z0GA 3UN2A 2AQ4A 2KB2A 2W9AA 3FZ2A 1PAEX 5IQ6A 2ZH7A 2MEWA 2QMUB 3TO8A 3C6UB 5E3AA 4DF4A 1HW8A 3I4PA 1JXVA 2BJ9A 2WVDA 2G13A 4HLBA 4DL0C 1F9EB 3R5DA 3DCAA 2XO7A 2OPRA 3TUZC 1YDLA 2QA4G 4ED8A 1YITS 4PABA 5BR8J 1FRXA 2FZCB 4P74A 3TA0A 2FC8A 3LGMA 4TYAA 4C9DA 4DPXA 3H0PA 3ENAA 4FZVA 4KKOA 4KV8B 4TY8B 1AT1B 4WTYA 4MMOA 4JI8F 3RRHA 4HACB 4I68A 3NGDA 4ILRA 3PRVA 2A6MA 1RT2B 1LV5A 2MLYA 2B5JA 3C15B 4C3LA 3MR2A 1C0TA 4WU2A 1I94F 1NLKL 2QTWA 1BLUA 4X64J 3AXMA 2AKWB 1YZ7A 1LNQA 1C1CA 3O44A 1OS5A 1UWBA 2DRDA 2V8VA 4N56A 3CGIA 3DOMB 4FF4A 4USKA 4QU6A 1FRKA 2HGMA 2M88A 1LW0A 3CJKA 2F8MA 1GAOA 2R3VA 3VGSA 1LWCA 4J9RA 1JLBB 4OI3A 1HR0F 2IJNA 1RADB 2IJRA 1YGYA 2Y9HA 4X4NA 2HQDA 1UEUA 4LF5F 4YHHF 4HDGA 1U6BA 2L9WA 5DETA 1QSLA 2BV3A 5C25A 2H65B 1DQ9A 2HEKA 3SQOP 3NGUA 5IC4B 5KT4A 4QR1A 1XNRJ 2J0SD 2XSJB 3P8BB 1RT6A 2VKRA 1EQMA 3LANA 2KFYA 1KLNA 4B3TJ 1UVIA 1R8HA 1FJGF 4MIAA 3GV5B 1IVZA 4HDHA 2Y0BB 3OT9A 4V1Ak 4ZVUB 4Y00A 4PG6A 5C2CA 1NSAA 2GFFA 2NZCA 3UN5A 1FXLA 4WZMA 3U1NA 1KWMA 3DU6A 3GV8B 1TL7A 2IYGA 4JI5J 4O0NA 4C8KA 5KTQA 1WF1A 4UT4A 2XC9A 2FJXA 4IRKA 4YOEA 1TR0A 2WTFA 1NU4A 2HFUA 4HEA9 4RUBA 1JMTA 2NUUG 5E0OA 1VQSA 4OYAA 5D4NA 3V4MA 2CZ4A 2RS2A 1ZAXA 2MZTA 2RKIB 4OHWA 3ITHA 3BBFA 2ZEJA 3T9NA 3ZXWA 1T3OA 4JI1F 1CVJA 3CCJS 3GSDA 1IWGA 2EWHA 3R7BB 4BHQA 4DZ6A 5HJYA 1NSPA 1CC7A 4WJBA 1S0MA 4RW9B 3L95X 3MCOA 4CLYA 2WBRA 2ASDA 1XNQF 3LP1B 4I6AA 1WACA 5F41A 1S0OA 3IRXA 4CQ1A 4USJC 3FEYB 3W5XA 3W66A 1FNMA 5IWAJ 2GIFA 3MPVA 4K8RA 3GFYA 2B9WA 4NX9A 4DR2F 4X4QA 1P8GA 2CPHA 4DR1F 1VQ9S 1N32J 1MROA 2CPXA 3KG1A 2DGOA 3LO3A 1LWEA 4K4VA 4NLSA 4B17A 1N4LA 3A3OB 2W25A 2PMWA 4A8WA 1NZ8A 4QBUA 3QT5A 4R0JA 4I1TA 4WP9A 2KFZA 1LXJA 1HWLA 3ITHB 2RKIA 2PFFB 4FKXA 3AH6A 4RW4B 3QO9B 1S9EA 4RO0A 4ZVGA 4NXMJ 1X4DA 1K1SA 1CJUB 1GQEA 1L3KA 2LXFA 4QWEA 1TUVA 2EFNA 4F04B 3QAEA 1SQGA 3I5CA 2NXEA 5JVGQ 1PG5B 3V81B 4ZN1A 3MD1A 3M6WA 3N28A 4YR0A 3Q2TC 5FLXU 2HURA 1FDNA 2DJWA 1KOHA 1IXKA 1JKHB 1Z2ZA 3MR6A 3GIIA 2VDIA 1CJKB 1RHKB 3Q86A 2NXNA 3TZWA 1FRLA 2BDPA 1S1UA 4CLKA 1VIOA 5HN0A 3AXKA 1FKOB 4A8QA 3G86A 2JHEA 5A8KB 1RT6B 3MFHA 2CQ1A 2DGQA 4LRBA 2AEJA 4CDIA 2HK2A 4I6YA 1T3NA 3DRRB 3MPYA 3QJJA 4URGA 1XNRF 3AHPA 4YDXA 4M8LA 5FDLA 1QTMA 1FESA 3RYLA 3QZ8A 2AYBA 3BGOP 3KK3B 2F65A 4B08A 1IBLJ 4G3IA 4B3TF 4NLOA 5KT6A 1X4CA 4LBPA 2YNGB 3VALA 4FKYA 1YBAA 3DDNA 4FBTA 4O3OA 4EZ6A 2QLWA 2BJEA 4ANCA 4AXJA 1U45A 1UTAA 1H6KX 4DR4F 3IGVA 3P45B 3DOMA 3JTNA 1FTRA 3K5PA 2MHEA 1XERA 2WW8A 3D1OA 4I2QA 4WE1A 3UDEA 3G6ES 3BN7A 1KOOA 3V4IB 1S59A 2UU9F 2XLIA 1U0HB 3N01A 4I69A 1EIYB 4DSIA 2ZD1A 2V2KA 4F4ZA 1S79A 2E9ZA 1E6VB 4A8OA 3AOAA 2E9RX 3KMQA 4CLTA 3MXHP 1FFSB 3ILIA 3NOCA 4BBYA 3W8PA 4XPCA 2VQFF 4DV6F 3KKFA 4YN3B 2VG7A 4Q43A 4N41A 4TLRA 5DG8A 1URNA 3PYGA 2DEIA 4TY8A 3T6JA 3H5YA 2AX1A 3KK3A 3D68A 2HVDA 3VQSA 5SZTA 5FDLB 3LGNA 3C46A 3UPFA 4DL4A 3Q2SC 4Y6IA 2FGCA 1U7LA 4U67Q 1XMOF 4RNOA 5JJBA 2YWGA 2YNGA 4N8OA 5DG9A 3LAMA 4GRSA 5IWAF 5D77A 3KJVA 4DL2A 3UCUP 1TK8A 2RRBA 2UXCJ 3SV3A 3IWLA 1ZM3A 1VISA 3EE3A 3SCKE 4CP5A 3CIMA 3PJWA 5L8RC 4PCQA 3G8QA 2R8HA 1S10A 2CWKA 4OFZA 3KWMA 2FYXA 1WOOA 2MTLA 3J81j 2YKAA 3CCRS 1XMQJ 1SKWA 1KR4A 3FQKA 3SSSA 1B3TA 3W65A 1PYSB 4MKBA 5E3RA 3LWMA 2A1BA 1AZSA 4JI4J 4OYPA 2FTRA 2GJIA 5DLFA 3N0VA 2H54B 3ZZZA 4USMA 1EZZB 5D3GA 5B0BA 1GNKA 3G87A 4OX6A 5AJ3J 3MAAB 3QIDA 2B4PA 4PKDB 2ZH2A 1RWKB 4OZ5A 2RRNA 3BV8A 5G0RA 3UD4P 4LRDA 4NEZA 4DV5J 2WZ1A 1M0SA 2XI3A 5ITHA 2WCXA 3QO9A 1AB8A 4O3PA 2IRXA 1Y3KA 1U25A 4TN2A 5GAEI 4NYOA 2EFOA 1IKVA 3KJNB 4ED4A 5DGAA 2GIQA 2CPEA 2LEAA 2VICA 5THWA 2ADCA 4N7TA 3TYTA 1M5OC 4M5DA 1Y7PA 3Q89A 1NJWA 3RB3A 5D0EA 4RW6A 1FE0A 2HHQA 3N79A 4PQUB 4CYUB 4B3MJ 4OI0A 4ES3A 1BE4A 2HFNA 2FJDB 3IA0A 1RLCL 2XTJP 3MAQA 3AY0A 1W26A 2IYIA 3L7OA 5HVFA 1IUJA 1RWOB 3IRWP 3VWSA 1N88A 2JZ5A 3QYYA 4M5IA 3RBZA 3CCTA 2NPFA 5KFXA 1TP7A 5F8IA 4HTJA 4DR4J 5C5JA 4ID5B 4B3RJ 3P5TL 3P6YC 2YH1A 3I82A 4OJ1A 4NZ7A 4CO0A 2RQMA 2DNRA 1Y3JA 2VPYB 2HWIA 4UZCA 4AQYJ 3V6HA 2M8HA 2Y8YA 2ASYA 2DNGA 3IM9A 5C7PA 3MFIA 2J9EA 2RE1A 3JYTA 2XNRA 4LF6F 3R2CJ 2BKOA 2DKOB 1OYDA 4F3OA 2E1MC 5J2NA 2PE8A 4ZN3A 4O4RA 3DLGB 3C66A 2X1FA 2HHHJ 1VFJA 1XN9A 4W98A 1NXIA 1U6ZA 2IDLA 3NGKA 3QLHA 4ED5A 1IBCB 2DTJA 4GVBA 1H0HB 4KSEB 4TXSA 1RCOB 1UMJA 2Z2MA 2F63A 2AGPA 5C25B 3OJUA 4LF9J 3QAUA 1S4EA 3GIMA 3IFEA 1G2EA 2W8LA 4K5RA 1T9XA 3CJ0A 1NDLA 4KE5A 4ZPAA 3UVJB 1VQ7S 1RT3A 4DV3J 3CPWR 1LWCB 2AJFE 1FEEA 1S57A 2OPPA 2N4CA 4FYVB 2BJ1A 4EBCA 4X62F 3FCVA 3DRSA 3MPWA 4P10A 3TARA 1UW9A 4DQQA 1SC6A 1RHJB 2P9EA 1NKCA 2CJAA 3HPOA 3DOKA 5DZ6A 3NP5A 3KHLA 1NHKL 2JNJA 2C2OB 1RA7A 4F02A 3P4UB 3TAMA 5KFNA 3JSRA 1T05B 4JOUA 4RW8A 2ZWOA 5IFMA 2RDJA 2Y0SD 4IRDA 2QN6B 1HQUB 1R8AA 3PFEA 1IBKF 4Q0BB 4FNIA 4MJKA 4Y2MA 3HD2A 3CVKA 1AXQA 2VDHA 3DHWC 1R0AB 3WZ0A 4DUZF 2CXEA 4NZ6A 2P6SA 4C8MA 2GQCA 2R7QA 3MHYA 3PX0A 1TK5A 3DLGA 1FD8A 2JLGA 4LR8A 4USVA 4LUBA 2QFIA 5F3ZA 3AAWB 5ETKA 4OJGA 2H48B 3JAMU 3RAXA 3HVTA 1PILA 1BQXA 2ZE2B 3RR7A 1E6YA 3KXDA 4UTGA 3QGPA 4AD6A 3V6DB 1HMVB 2OKQA 2VPXB 3GONA 4KGMA 5B0CA 4KC5A 3BGFA 4U6PA 3D3CJ 3BF4A 4A8SA 2ZZNA 1R0CB 2YQ0A 5B0EA 2OD6A 2YNHA 2CQGA 3DOLA 3QT7A 2UUAF 4C0OC 2FQQB 4C3MA 5A76A 1NJZA 2CPJA 4ID8A 4DR3F 1SXLA 1X60A 2FJAB 2C2MB 4JB8B 4QWBA 1A0OB 1VQ8S 3BSOA 1DBDA 2XSFA 3HZGA 1RHQB 2UUCF 1O8BA 2WRMA 3EICA 2B8PA 4ECXA 4P75A 1HNZF 4L3KA 1UETA 3D7SB 2CJKA 4OL8A 2H4YB 3R5AA 2WVBA 1S9FA 1MWYA 2CQBA 4YB5A 4CRJA 4DR6J 3Q22A 2R8KA 2NYHA 3M2VB 4QWAA 3MECB 3VAMA 1U6FA 2WONB 3A3PB 5IM0B 3D6MB 4O44A 4DU8A 3KLGB 2JJ4D 2B7CB 3MZIA 4LFBJ 1W25A 1PJ6A 5J2PB 2ILZA 1YRXA 1WJ9A 3HMJG 1Q53A 3IBWA 1MLAA 2ZKTA 3FMBA 4NXNJ 3ETMA 3M6XA 3ENWA 4PXDA 4ZJOA 3M32A 2CQCA 3HSJA 4ZPVR 3G4SS 3OTOJ 4DPUA 4G6VB 5RUBA 2HNYA 1T8EA 2I2YA 1Y9OA 3NG8A 3UNGC 1GX6A 2BW7A 4K59A 2ASJA 1S9GA 4BC9A 5IT9Y 3T9ZA 2NSBA 1FRIA 3PW5A 1NEEA 4D3GA 2ZITA 3H8YA 1FRHA 4U8VA 1N6QB 1DZ5A 4H54A 4JV5F 1ZPWX 1VBKA 3LF0A 4LF1A 3QIPA 5A2QU 5HI7A 3SXLA 4L75A 3S01A 2DHSA 5CABA 2HS3A 1WEZA 1FNXH 3MM6B 3BQ1A 3BSCA 3Q8VA 4C11B 2PT0A 2CJXB 3JQMA 3PVXA 2ALYB 1HPZB 2BVZA 2LDIA 1EAYC 3AJ1A 2KVQE 3HFZB 2G1DA 3DLKB 2RDDA 3NCRA 3BEGB 4S0MA 5DRKA 5BYQA 2N82B 3UN3A 4Z37A 2MDAA 2OTLS 2VBZA 4K4ZA 3IGNA 4ICLA 2MB0B 2K7KA 3VAGA 4LVNP 4P71A 4CT8A 4PAAA 4EUVA 2VG7B 2UXBJ 3M8QA 1WTBA 1OO0B 3KDOA 3PJ9A 4Y28C 3RBXA 3S8SA 2HQIA 4LJMA 1R8BA 4WK1A 4MKAA 3OR2A 3ET6A 3FK4A 4ED0A 3W2VA 1L3VA 1F9HA 3D66A 4TYBA 1TL3A 4X65J 1TMMA 1B70B 3M30A 4AT1B 5FLXY 2GJ2A 1JLCB 3OFEA 4FPIA 2BZ2A 3TZYA 2FVRA 3EUNA 1HBOB 3M8PA 2KH9A 4WFZA 2AJ4A 4B3SF 1GMWD 1U0SA 2DHHA 4FXDA 1QM9A 2Q43A 1Q7YT 3M9NB 5K8MA 2MZJA 1K8AT 3GLJA 3IBFB 2Q6BA 1YIJS 3NNCA 4YY3F 1Q8LA 2IA0A 3T5HA 2XULA 3BQ2A 2GMHA 4AL6A 3H40A 1YVFA 2CPZA 3UI3A 3SV4A 2IA6A 3DGPB 4WXOA 1EQ0A 2IM2A 3CDAA 3BREA 4L6V3 4AL7A 3E51A 4PPDA 1O5JA 3DRRA 3OFGA 1L3TA 4FN5A 1ZM9A 1LK7A 2YQ1A 3NKYA 1RT4B 1NDKA 2XMVA 2AYGA 4F2RA 3A8EA 2OSRA 2ZBCA 2F1FA 3WC2A 4J9OA 3TR5A 3N9UC 1NSQA 1P27B 2HWHA 1SKUB 1EX8A 2RH3A 3MGJA 2PDAA 2DBBA 1SJFA 2DNMA 3FJ2A 3PNIA 3HHLB 4J90A 1HNVB 4YQWA 2OMLA 1OY6A 1RWXB 3ZTOA 1ZM2A 1JWWA 2XZWA 3R6LB 1KQSR 4KHPJ 1HWIA 3IP0A 2ZJQQ 2E5HA 2XMMA 1RP5A 1APSA 8RUCA 1LW2A 4OX9F 3IR7B 3QSYB 1S9EB 2XWYA 1VRUA 2V50A 3TUJC 3E3XA 5D8HB 2M7SA 3FCHA 5GAGI 2VC0A 1VS3A 1M90T 4ELUA 2XS5A 4ZVTB 4IKAA 5JUMA 4TU9A 3R97A 5BXIA 5AXLA 2A18A 5DQGA 4OMFG 1S7HA 2CIMA 4KHRA 1NRKA 1IR2A 1WC6A 5CYQB 4DPWA 2K1RA 1WKLA 2Q3PA 4OHYA 4LSZB 3AB4B 4YB7A 1S1TA 2I5JB 2KYXA 4C48A 1URRA 1GXUA 2CPYA 2J6UA 1GH8A 1D1UA 1QAYA 5EGYA 2J9DA 4OX8A 4ZK7M 4KT0C 2A2DA 2ZBRA 1R43A 1HBNA 3PW2A 3H42A 3OD2A 2G0IA 1DTTA 4YP3A 5CAAA 2BE2B 4CM2A 3LPYA 3CUNA 4B3OA 2D3O1 1B7FA 6FD1A 3H5UA 5HBMA 3VHQA 1BD6A 4OYIA 1T9UA 3FUYA 4OZJA 1EB0A 1J2VA 5GADI 3MAAA 2W2NP 4A8MP 2GMJA 2XGQA 2AEFA 2HGNA 1JJCB 3NOGA 4DL3A 4OJ3A 2LVWA 1TL5A 3ONQA 3QSIA 4IOCQ 2QSFA 2VPZB 2F4VF 3CULA 3UD3P 4DV1F 4KGKA 5SUHA 5IS2A 3DYAB 3RW6A 4CO5A 1SBRA 1R89A 1RT4A 1OYEA 3MMAB 3CJ3A 3PY8A 3L7UA 2D69A 2UV8A 3EVOA 2VJUA 4IOBA 1RCXB 2IM3A 3OL8A 5GAEU 3NBPB 2GCFA 3AT1B 4LSNA 3W8GA 4NCGA 2AJ0A 1N54B 2GVDB 3FVYA 3M8YA 2R42A 5E3CA 2R7SA 2WB1D 3B6BA 1XBWA 2W8KA 2ALZA 4J9UE 2W4DA 3U02A 2V63A 3LWLA 3B78A 3C19A 2RT3A 1Q16B 4RUHA 3BS9A 3WC0A 3CD5A 4HT5A 2DNYA 3T1AA 5L1LA 4X4VA 3FKBA 4KHPF 2GC8A 1RT1B 2NYIA 1IKYA 2QZ8A 2J5AA 5HMWA 3CXCR 4JI3J 3QGIA 3CDWA 1N5TA 3GTYX 4N5SA 2FLPA 3KLIB 2E7VA 3G6VA 2YWKA 1FEHA 1UWBB 1CJTA 3CCZA 4UZBA 2X1GA 1K44A 9ATCB 1JLQB 1S1VA 3HSZA 4IUFA 2QV6A 3SQGA 3SYZA 4DN0A 1DHMA 2LU1A 3AOBA 2AMCB 5C42A 2CG8A 1NJYA 1QSYA 2B51A 4NL5A 5LOQA 3PYFA 3HCXA 1H3DA 1UEKA 2GO9A 3B82A 1BXNA 1M1GA 2BANA 1U1LA 3GFXA 4OV1A 1P9QC 3H5SA 4PG5A 3MEKA 3TVKA 2G4BA 4QCLA 1ZTWA 1NKBA 4KY3A 5DM6Q 4ECVA 1FA0A 1NK4A 3GYGA 4KFBB 3RRGA 2Z58B 4OYWA 2CA9A 2FLOA 2OPRB 2ROGA 3M8ZA 2OEKA 3MAHA 5A8KA 2VD3A 2FGOA 3LP2B 4WIIA 4FS1A 4DLEA 5FIIA 1FRJA 3HZEA 3TEGA 1D8YA 1GXTA 1RAIB 2EFQA 2I9SA 4ZPCA 4U9RA 2DR5A 1SUQA 1JLFB 3D3BJ 1F5CA 1FVSA 1REVB 1T9TA 3GFZA 3UD5A 3VVTA 3H2VE 3F44A 1TUGB 3CDBA 4UOCA 2ZH5A 4RNNA 2ZHAA 3J7ZT 4OX7A 5EWEA 2YH0A 3C14A 4DX6A 2O3DA 3T1YF 1C0UB 4DEZA 4NYZA 1L3UA 4WP8A 4A8YA 5A6WA 2JL9A 1DAXA 5B08A 4ES2A 2FUG9 2HAIA 4RNMA 1CJUA 3KNAA 1NPKA 3UE2A 3L9ZA 4P7TA 3SBMA 4EEYA 2HS0A 4X4UA 4DV1J 2B6AA 3CD6S 4FF2A 1LWFA 3LALA 1IKXB 4M5NA 5CYMA 3ZTQA 1C4AA 4WP3A 1FD2A 2DT9A 4IO1A 2VG5A 1I51B 1MN7A 4NI2A 2V68A 1IQTA 2XB2D 4K2JA 2KT2A 3DI6A 3J7YU 1LWEB 2RUGA 2EKYA 3S7RA 1KONA 1RGVA 4O44B 3HHDA 1CQMA 3KLGA 2RRAA 1WDDA 2FZKB 1VR6A 1NM2A 2VFUA 1M5PC 4YUDA 5HLFB 1RU2A 1U8WA 1R8PA 2DGVA 5DDQC 1VQMS 1WDTA 2B56A 1VHFA 2MKYA 4AXIA 5F8LA 2IBKA 2PA8D 4CCHA 4Y34A 2YXLA 5L1IA 3QRRA 2EK6A 3DLLQ 2CJ9A 3D5MA 4DF8A 1VJWA 3HJFA 1CBKA 1Q8IA 1UW4A 3KFWX 5ETMA 2BXJA 2EI5A 4EBEA 2ZOMA 3QJLA 1DQAA 1MMDA 2B9XA 4JI3F 1CC8A 3TJ8A 2PMHA 1KP6A 4CT9A 1N5VA 4X4TA 2FY8A 2U2FA 1HR0J 1HNIA 5KOXA 3FSXA 3DN9A 2HSEB 2NQPA 1AROP 3MM7B 1JLAB 4YHHJ 2HNDB 3ZTRA 1L5UA 4B9NA 5HO4A 4PQAA 2GW8A 2XYHB 1YK9A 4XIUA 2EPIA 1V9OA 4HR2A 4XO0A 5KFWA 1SC3B 5J1PA 5LL6d 3C6TA 3CCQS 2LECA 4Y65A 4M63A 2BKPA 1LFPA 2IRUA 5HL7Q 3Q83A 1SPBP 2C28A 2Z30B 2KJWA 1FX2A 4O23A 3DOKB 4DMZA 2HKEA 3Q24A 4J9PA 1JLEB 1PYOB 2GGPB 4ZHRA 3OVAA 3LGHA 4OLPA 2CQHA 4L76A 4JV1A 4NLQA 3TAMB 2OPQA 4ZCLA 1S1WA 1RT3B 2KM8B 5KG4A 1T05A 3BBCA 4AL5A 3VGTA 5GVQA 3MMBA 4CO1A 4ZVSB 1FKPB 4OI4A 1RTIA 1QY7A 1HARA 3ISZA 3EPGA 2NSCA 3D6FB 2HZVA 1HYSA 4ED7A 2K3KA 2KDOA 4L3NA 3VV2B 4JI2J 2JH3A 4DSEA 4OHVA 1MG7A 1V3RA 3WHIA 4KPYA 4NCBA 2VOOA 1WC1A 1WKKA 2C3YA 2NXCA 3TVYA 2MSTA 1NJXA 1HL6A 3QLHB 2NR0A 4H4OA 2Z57B 4ZP6A 1WHVA 3NAIA 4GO5X 1TK0A 1SB6A 4B3OB 2HHVA 2PN6A 4CH7A 4F4AA 4ZHRB 2PGCA 4KGZB 4MYUA 4OLOA 1T11A 3QT6A 1YZ6A 5HQMA 3M8RA 4DSFA 1T7PA 1RT2A 1UKUA 2J8SA 3TZXA 1CSJA 2PFDA 1DY3A 3ZNJ1 5EWFA 3KK1A 4DFJA 3HKZD 3KUGA 4RU2A 2YKOA 4HKQA 4WK3A 2D41A 2CZ9A 3EGWB 1C1BB 2G2OA 1Q79A 4ZS6A 1IBMF 4CZCA 4BCAA 4EWTA 2CAJA 1H98A 2VQEJ 2DNLA 3QATA 2ZH1A 4QW8A 3AJDA 3EM1A 5GADU 1MN9A 3MEEA 4Y3CA 5HANA 2DK2A 2L41A 3BKFA 5HBMB 3DU5A 2C2KB 2RHQB 2V8PA 4MIBA 3PDNA 3MM9B 4KPCA 3H4DA 3NS6A 3W2WB 5LMUF 2BE2A 2MKHA 2RUSA 2E1AA 4FDFA 2YWFA 4M5MA 3HK2A 2IMOA 3GCWP 4WCEQ 4IH5A 1O6XA 4ZLJA 5F8JA 1KN6A 5HLFA 2W2QP 1Y11A 3BN4A 4HVZA 2JC1A 1P9YA 4HI1A 1NPPA 2EC0A 1FJ7A 2WB4A 5C2GA 4RJVA 3QJPA 4DLGA 3W3SA 2E5LJ 1HNWF 2M9KA 5ETRA 2MQNA 1VQOS 2FJVA 4O3NA 1RJJA 2BJDA 2DXDA 3QGHA 3TJ9A 3GFHA 5ADZA 2PI5A 1PO6A 2AW0A 4LBIA 1T9YA 1FF2A 1N5SA 1QJHA 2KRRA 4LF2A 4LR9A 2CWXA 3W9HA 1HBMA 1RTZA 2CQDA 5GMKa 4FF3A 1VQNS 4RWWA 2AWZA 2QG9B 1GMUA 1RHMB 1S6QB 4JI0F 3IN5A 3RB0A 3WX4A 2QYGA 1Y5LB 2XWXA 3BO2A 1YJ9S 1FKAF 3DFEA 4ZCIA 4YEAA 3MDFA 4DHVA 3EZ5A 3CWJA 2CVEA 3HLUA 3D9BA 2VFSA 4NA1A 4RR5A 2K2PA 4ZPDA 3I5AA 1QD1A 2LXUA 1JLFA 2MQ8A 3GJTB 2ZZTA 3BQ0A 5G0RB 3US5A 1AZSB 1NHUA 4DN9A 1C0UA 4E98A 5KFCA 1IJFB 5ETQA 1YJTA 3M6UA 3TRGA 1V3SA 3NY0A 3MPUB 1WKJA 2RQ4A 2V2ZA 1LKZA 2E7XA 3MR7A 4IFVB 3THTA 4WFBQ 3J7Z5 3KLEB 1PAUB 2O1PA 3OLAA 3A3NB 3FFIB 3PYEA 1D09B 3FGVA 3I4HX 2ZWPA 3PXGa 1TFWA 3L4BC 1F60B 2BRLA 2I6WA 2QT7A 2OAUA 1YRUA 1M5VC 3DM2A 1JLGA 3QZ7A 4WFXA 1D9FA 4KQZA 4JV0A 4MKVA 3SI8A 4NZ0A 2DCUB 3GYNA 4DX8H 4GKKF 2V69A 1M5KC 3DMJB 3KMSA 2HGLA 3AODA 4OHZA 2MY7A 2DGUA 2XMUA 4F25A 2LKZA 4M5HA 4DR7F 4KYZA 2Z2YB 1DTQA 3CD0A 3FDSA 1U48A 4EGLA 2PMZD 4QWCA 3UDLA 5L1KA 1X9MA 1IBMJ 4DWIA 5DLGA 1NK9A 4V19J 2VG6B 2VODA 2KFNA 4HH1A 4EFAC 3M8PB 1GMVA 4N76A 1PSDA 4JI4F 1CJTB 1YBTA 2P9GA 5AE1A 1NK7A 2EBGA 2VH7A 3KUEA 1P6TA 3KK2B 2K06A 4J9QA 1PBAA 3I9V9 5F9NA 4LF8F 2DR9A 1D9AA 3LA0A 3WIVA 4XTTA 3Q8YA 2Y1LB 4X66J 2PO4A 1Q78A 3I0RA 1UPPA 3M4XA 2WAQD 2GVDA 5T14A 1RU1A 3U27A 1ITPA 3RG6A 5DM7Q 3W63A 2RILA 3NBPA 2DNOA 3RJMB 3NS5A 2JDJA 3N5BA 4I64A 3OJSA 2VASA 4FVCA 4W92B 1DARA 1G4CA 2KRBA 3D67A 4ETZA 3DLJA
chains in the Genus database with same CATH topology
4GVBA 4GVBB 1KP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GVB A;  4GVB B;  1KP6 A; 
#chains in the Genus database with same CATH topology
 3VAJ A;  2DIT A;  2G1H A;  2P6T A;  3THV A;  3EXC X;  3FBE A;  3H59 A;  1KLM B;  1RHU B;  1BQM A;  4P2F A;  1EHW A;  2CJQ A;  4IG0 A;  1RWN B;  2DNZ A;  1TL1 A;  3AJ2 A;  4RL1 A;  5LM7 E;  4LF7 F;  2HZC A;  4DV0 J;  3CJ4 A;  2NPI A;  4NLY A;  1CQN A;  2Y1J A;  3A12 A;  2UV8 G;  5HRO B;  1RKJ A;  3P5B P;  1FHT A;  1F5A A;  2RNE A;  4IDK A;  2ADB A;  2WK4 A;  4PQU A;  2R7R A;  4JI6 J;  2POK A;  1N34 F;  4PZV A;  4NLG A;  4NLV A;  5EX3 A;  1J5O B;  4IFV A;  3AD9 C;  1X4G A;  2NXJ A;  2H9Z A;  3NAH A;  4JP8 A;  3JAM Y;  3ILO A;  3DLE A;  3D54 A;  2J7K A;  4I7F A;  4NE9 C;  2VQF J;  2I1R A;  2MLX A;  3AQP A;  1SQE A;  2DNH A;  1X0P A;  2WW4 A;  3ZTS A;  5KG2 A;  2DRA A;  3D1Q A;  2R7X A;  1UL3 A;  2LP4 A;  1NKE A;  1S1T B;  2I5J A;  1KS2 A;  1PJ5 A;  1X5O A;  2K7J A;  3GPA A;  4FVM A;  5M2R A;  3RZA A;  1C2P A;  4P2M A;  1CUL B;  3OTE A;  5CYQ A;  5KFH A;  2KTQ A;  2HQF A;  4OYB A;  3I56 S;  2FVS A;  1UFW A;  2H5E A;  1VQP S;  1EET A;  1UAW A;  3CC7 S;  2IC3 A;  4GKK J;  3NRB A;  4MYT A;  1PC5 A;  4PXE A;  2HHH F;  1AYE A;  3D1H A;  3O5T B;  3BGR B;  1WSR A;  2P5V A;  1CUL A;  3OPK A;  3OR1 A;  5KFL A;  3D6H B;  2HHU A;  3BB5 A;  4I67 A;  1RTD A;  2CDQ A;  1UFK A;  3H90 A;  3SDE A;  1WTF A;  1DLO B;  2C42 A;  3SMZ A;  4C0H A;  5M2U A;  1D0E A;  4PUO B;  5I3U B;  4X64 F;  3CO9 A;  2GVZ A;  2AHO B;  2KT3 A;  2OH2 A;  1GTH A;  2MKS A;  1R0B G;  1YJV A;  4WXW A;  3A13 A;  1RSC A;  1SV5 B;  2LYV A;  1KQG B;  4Q8E A;  2IFX A;  3HI9 A;  1YWX A;  2ZH3 A;  1IQZ A;  3ZZ0 A;  5J2Q A;  2CUY A;  4HHH A;  3MCS A;  3LP0 B;  1G1X A;  5ETV A;  2O66 A;  5KFU A;  1OY9 A;  3RW7 A;  2W4C A;  3HP6 A;  3E01 A;  2H3E B;  3M2U A;  4ZCM A;  5KFY A;  5G4D A;  1HD1 A;  1Q7L B;  1VRQ C;  2NUH A;  4ZLN A;  4IQM A;  2O5D A;  1QE1 A;  1TL4 A;  3LPE A;  3CCM S;  4RW8 B;  2ZH8 A;  3WDO A;  3IR5 B;  4B3M F;  4CO3 A;  3CW2 C;  4DUZ J;  2GQ2 A;  4ZPB A;  2AJQ A;  3KK1 B;  2BM1 A;  4OI6 A;  1VI7 A;  1FFW B;  1FDD A;  3CB4 A;  3DC2 A;  3GE9 A;  3HVR A;  1QVG R;  2YY3 A;  3I5B A;  2FB0 A;  2F5G A;  4MT1 A;  4URS A;  3CME S;  3HT0 A;  4DSK A;  2FC9 A;  2EG1 A;  4ILL A;  1RTI B;  5IV3 A;  3DGP A;  1DQ8 A;  3I31 A;  4GMK A;  2M3D A;  4O3Q A;  4ZKA A;  2AGO A;  4JI5 F;  2CRL A;  1G7C B;  3HHN B;  2COL A;  4XDC A;  4PXC A;  1UZH A;  3BO4 A;  2YNF A;  4H4M A;  3VGU A;  3GSI A;  2ZBI A;  4AQY F;  3PHT A;  5F3T A;  3PV8 A;  1N34 J;  1VQ5 S;  5D0R A;  2GIR A;  1D3W A;  3KLV A;  4A8F A;  2I38 A;  2LCW A;  4LF6 J;  3CJ8 A;  2MPU A;  2KXN B;  2X3G A;  4QPX A;  3X1L B;  4MK8 A;  4P7V A;  3TAP A;  3T3F A;  4RWX A;  2DGS A;  1WI6 A;  2QGF B;  3F0N A;  3U7J A;  1ELO A;  5K8O A;  1JB0 C;  2YPY A;  2EVZ A;  1DTQ B;  4TNO A;  1GK8 A;  1WD6 A;  2BW2 A;  4UUW A;  1X4F A;  3RGI A;  2B8Q A;  3TUI C;  4A4J A;  4QYR A;  8AT1 B;  5K20 B;  4LIW A;  2FJB B;  4PR6 A;  2OSQ A;  1U47 A;  1YJ7 A;  2C3M A;  5E41 A;  3C6U A;  3KJF B;  2R2U A;  1Q0N A;  4J9M A;  2HLU A;  3OL6 A;  4DR1 J;  3C6T B;  3DMJ A;  4DCJ B;  4ZLP A;  3G8S A;  2XY6 A;  2OFH X;  2R9L A;  1WOS A;  1VC6 A;  4ETX A;  1RT7 A;  2P9C A;  2JX2 A;  4IR1 A;  2BOP A;  1TV6 B;  3CMQ A;  3K7R A;  5CD4 H;  4DG1 A;  2QIF A;  5C24 A;  3KLH B;  3EYZ A;  4RBT A;  4DV3 F;  1S72 S;  1M1H A;  3H7H B;  3IWX A;  5KG1 A;  5I42 B;  1S6O A;  1OJ4 A;  3BGU A;  3GZ7 A;  3QIP B;  3EWG A;  4UF4 A;  4ES1 A;  1S6U A;  2WSE C;  2ZNY A;  4X62 J;  4OI2 A;  3FBF A;  4OYX A;  4ZOS A;  5IOL A;  1XK8 A;  1SC4 B;  2DGT A;  2YKM A;  1LWX A;  1RXO B;  4I0W A;  5HVG A;  5JMN A;  5KFM A;  3CCE S;  4LIR A;  2HAF A;  2DNK A;  3GIR A;  1KTQ A;  3PEJ A;  4CTA B;  4TLQ A;  3FSI A;  1S77 D;  2VOP A;  4OZ3 A;  2WSF C;  3OXL A;  2XS2 A;  2C2R A;  1V5V A;  2OPS B;  2QSW A;  5LSO A;  2CNO B;  1HI8 A;  5D0H A;  1Q8B A;  4YFU A;  4DUY J;  4GKJ J;  3MMC B;  5AE3 A;  2IVF B;  1K0T A;  1RBL A;  3L7P A;  1IJE B;  2WOM B;  5HQL A;  4BS2 A;  3G6X A;  4JI7 F;  3GJR B;  5KFZ A;  1VRT A;  5L38 A;  4HT7 A;  3VR1 A;  3ADA C;  3FC9 A;  4F3Q A;  1UA1 A;  3X3U A;  4C6A A;  1NK0 A;  2FLN A;  4GC6 A;  3KLE A;  1WUU A;  5HVH A;  2DH8 A;  1RAH B;  3M6V A;  3W61 A;  2IDE A;  1S49 A;  2BJ7 A;  1F3F A;  1RWV B;  3J7Y I;  5HP1 A;  4DR5 J;  4UW2 A;  3FRZ A;  2V8H A;  3GQC A;  2GA7 A;  4C8O A;  3MUM P;  3HO1 A;  1XR5 A;  4DX7 A;  3PM9 A;  3R1L A;  2C3P A;  1SUQ B;  1BHN A;  1S99 A;  2XMW A;  1IR0 A;  3CJT A;  2JFK A;  4MH8 A;  2DNQ A;  4KAI A;  1HIY A;  2X3D A;  1NHV A;  3GG0 A;  1RAB B;  2ZJR Q;  1TV6 A;  3V5R A;  3V6D A;  2XLK A;  1E6Y B;  3ZZU A;  3ZC4 A;  3DOL B;  3RUB L;  2QA2 A;  1JXL A;  1REV A;  2IJF A;  2KKH A;  4B9M A;  3T5L A;  4U7U D;  4TVA B;  2KHD A;  2MKK A;  4YY3 J;  2YX1 A;  3CCW A;  3BPD A;  4LRE A;  3AD8 C;  4NLP A;  4U95 A;  2V4R A;  3FMW A;  4MIW A;  2YPZ A;  3UFC X;  2ZE2 A;  4DV7 J;  2LEB A;  4DL5 A;  5AXM A;  1FJE B;  2HRU A;  4PWD A;  3OFH A;  2BYC A;  1SJQ A;  1WWH A;  1XMB A;  4KB7 A;  3H5X A;  3KLF A;  3OTB A;  1O51 A;  3VTI A;  5ETN A;  5KAK A;  1KEK A;  1X4H A;  4I4B A;  2XMJ A;  4G1Q B;  5LJ3 Y;  3V6K A;  2VPW B;  3AB2 B;  1QTN B;  1H2V Z;  2MGZ A;  2NRE A;  3KLI A;  1I3O B;  5AXN A;  5ETP A;  1HLW A;  1P1T A;  3WBZ A;  2XGP A;  2BX6 A;  2IVY A;  4G1P A;  3VCD A;  3VAK A;  1Y0H A;  3SQG B;  4CIO A;  2ZD1 B;  3AD7 C;  1QUP A;  2ROE A;  4H4O B;  3EMT A;  1NH8 A;  4DUT A;  2BE9 B;  3NCP A;  2BQR A;  2HQC A;  2E29 A;  1GT8 A;  3CNQ P;  5E7O B;  1RE1 B;  2XCP A;  2FVP A;  1MWZ A;  5KFG A;  5GAH I;  1M1K T;  4FYD A;  4U8Y A;  3H2U B;  2E5I A;  3UW1 A;  4UY8 5;  4QJV A;  5FD1 A;  2OEL A;  5AJ3 F;  2PI4 A;  4X2B A;  1X9S A;  3MM8 B;  4K4X A;  2O01 C;  4ATN A;  5EN1 A;  4LSN B;  5CH7 B;  3MCN A;  4FYW B;  3PEH A;  3PZP A;  1U2C A;  3IWN C;  3BH6 B;  3OVB A;  4DV4 F;  1NDC A;  5BYS A;  1FXR A;  2B4V A;  3Q8R B;  1ZH5 A;  1A9N B;  3IO1 A;  3MR5 A;  1UVK A;  1UJ5 A;  1T94 A;  1S1U B;  1AA1 B;  3VZH A;  3W62 A;  1QE1 B;  6AT1 B;  2LA4 A;  3M9O B;  2D3O R;  2FIU A;  3QFH A;  1N56 A;  1NND A;  2OJ3 A;  2Q6C A;  4URQ U;  4DXL A;  3M7V A;  4N47 A;  5HMX A;  5KG5 A;  2JFD A;  1H38 A;  3CF5 Q;  2HRT A;  2W01 A;  4RBV A;  4X65 F;  3W9J A;  4Z2X A;  3DYA A;  3B8H A;  2B43 A;  4DR5 F;  1U24 A;  4ANE A;  3GIK A;  2HHW A;  1FCA A;  5I3U A;  4NLR A;  2AZ1 A;  4I2P A;  4B3R F;  3K8V A;  3P96 A;  1F5B A;  1R6V A;  3M05 A;  1CPZ A;  2XG8 A;  3HVW A;  1RB0 A;  2BMB A;  2H51 B;  1H7W A;  1OQ3 A;  2YVS A;  3GU0 A;  5HK4 A;  3TI0 A;  2UUB F;  2GVZ B;  2ZOG A;  3BGR A;  3FQL A;  4L72 B;  4PYD A;  3BDP A;  1KFD A;  3ZTP A;  3P49 B;  1EKS A;  1ACM B;  1Q95 G;  2G0J A;  4DQI A;  3PIO Q;  1XR6 A;  2R2S A;  2IC3 B;  3TNV A;  4PUO A;  3HVA A;  4C8Y A;  3SDE B;  2V0N A;  1YI2 S;  4BWJ A;  3LQV A;  1MRO B;  4ILM A;  2HVH A;  2A3J A;  2MQM A;  1DTT B;  2ILY A;  4HTI A;  1FDB A;  3NLC A;  2N3O A;  1IKV B;  4CLF A;  4QOT A;  1OSC A;  1ZET A;  4CYU A;  2ROP A;  4NAS A;  1L3S A;  1MU2 A;  1W7W A;  4NYP A;  4DQP A;  3EPI A;  1VLY A;  1O0P A;  4QQB A;  4CLS A;  4OYZ A;  4K5S A;  3FZB A;  2ZHO A;  3EDQ B;  1UFL A;  2DXE A;  3OXF A;  5I4M A;  1GTE A;  2R7O A;  5H1S V;  5IC6 B;  4O3R A;  2J7U A;  1JXE A;  2RB7 A;  1T0T V;  1RTH A;  4QYZ J;  2HFZ A;  3A1Y G;  2FLL A;  3CC2 S;  4MAK A;  3NGT A;  4DDF A;  2DO4 A;  1YBU A;  1LW2 B;  1TKX B;  2W24 A;  3UDV A;  1Y00 A;  3RAQ A;  4JUZ A;  5GAH U;  1N8R T;  4E0D A;  1U1Q A;  2EFP A;  2MKC A;  1RAG B;  4A48 A;  1Q4R A;  3OUY A;  1X5S A;  5B0A A;  3EVM A;  2DCL A;  1TMJ A;  3HHL A;  1H2U X;  3KUH A;  2W4P A;  1KKH A;  3QNW B;  4I7F B;  4L74 A;  4NML A;  4P2S A;  4XAK A;  5T7L B;  2QA4 S;  1KVI A;  2Q79 A;  3K8W A;  2VBW A;  3GIJ A;  3N4W A;  3F56 A;  3KJQ B;  3MR3 A;  5JVH Q;  1BGX T;  1D8Z A;  3OSP A;  5K8N A;  3FBB A;  4UOG A;  2XQC A;  3EX7 B;  2XNQ A;  1TTH B;  2MQL A;  2AZ3 A;  4DX5 A;  2L9N A;  2BA9 A;  1VQY A;  3HSG A;  4JBC A;  3QQC D;  2GHP A;  2BQ3 A;  1NB7 A;  1DFD A;  3C3L A;  3UWT A;  2A10 A;  2W9C B;  4DV4 J;  1NJI T;  2H5I B;  2QLJ B;  1BQN B;  5KOW A;  1VC5 A;  1VQ6 S;  1IKW B;  3EXY A;  4DPO A;  4B9L A;  4DV2 F;  2VU5 A;  4FF1 A;  4LT6 A;  1WG4 A;  1ZPV A;  4RW7 B;  3IG1 B;  1YX2 A;  1LW0 B;  3D0H E;  3CJK B;  1OPZ A;  2DR7 A;  1CEZ A;  1N5Y B;  4X84 A;  3NMA A;  1FNO A;  1PYT A;  4G1I A;  4Z7C A;  3KK2 A;  3J81 Y;  1GX5 A;  3W5Z A;  4LFA F;  1JLQ A;  1S1V B;  3LOU A;  1W2I A;  2QLF B;  3RAM A;  3CCV S;  3RBE A;  2UVW A;  2P8I A;  3M30 B;  4V19 X;  3U1L A;  1Z4U A;  2HVE A;  2NCK L;  4OZ1 A;  3CCS S;  2JWN A;  2M5Y A;  1TEL A;  1U2R A;  2F4V J;  2MGZ B;  1IKY B;  4RW7 A;  3HHK A;  1KSP A;  2H1Y A;  1F2H A;  3HFK A;  3D6T B;  1KQK A;  1RYR A;  4WE1 B;  3GJS B;  1IN0 A;  4C8N A;  4R5P B;  5LT5 A;  4YS2 A;  2OEJ A;  1G3O A;  4K4W A;  2F9D A;  2MZS A;  4BLG A;  3T5J A;  5H9E K;  5H9F K;  4OJH A;  4CLW A;  2OD4 A;  3GV7 B;  2AGQ A;  3LW5 C;  4NRU A;  1OIA A;  2E66 A;  3BKU A;  4K7Q A;  2W7O A;  4K0K J;  2BRK A;  1U1K A;  4NCG B;  4JI8 J;  2WSC C;  2BAB A;  3POT A;  4USU A;  4AE5 A;  3J7A 1;  3N6N A;  2G0C A;  2ERR A;  2HHS A;  1CJK A;  2J8A A;  2DIU A;  3IS9 B;  3O1L A;  1Y5N B;  2R2T A;  2A6O A;  1JLG B;  1I1G A;  4MK7 A;  3H20 A;  3KOA A;  3LH2 S;  1FKO A;  1TFY A;  4RX6 A;  2EXU A;  1FVQ A;  1T95 A;  1H72 C;  3R5J B;  3I32 A;  4FBU A;  2M52 A;  4Q7A A;  5EDW A;  4F50 A;  5B0G A;  2HS4 A;  3MED A;  5U47 A;  4TU8 A;  1A7G E;  2ZFH A;  2B7B B;  2QJ3 A;  5T7L A;  5IT4 A;  3VAH A;  4F4W A;  1WI8 A;  1QSS A;  2DHG A;  4XK8 C;  2OUG A;  4IG3 A;  4LRC A;  1YKW A;  2J7W A;  9RUB A;  4ZIW A;  3MWB A;  2MQO A;  3KHG A;  3EGZ A;  3KG4 A;  4B9U A;  4OZ2 A;  1B99 A;  2OEM A;  4OQJ A;  2QLX A;  2DR8 A;  2HMI B;  4UY8 T;  5K14 B;  1JNZ B;  5KT2 A;  1VRT B;  2UVV A;  3BDE A;  1Q5V A;  2HIY A;  3PCO B;  4RPF A;  1MSW D;  3OVS A;  1ZS6 A;  1C4C A;  2HG4 A;  3ZNU A;  1S6Q A;  4CLP A;  4R25 A;  4YME A;  4ZVQ B;  5J1E B;  1IM6 A;  5L39 A;  1WF2 A;  5J2P A;  1DRZ A;  2G9O A;  3PW0 A;  3LP1 A;  1HBM B;  1SL0 A;  1S76 D;  1GXL A;  1ROF A;  4AND A;  4LRA A;  3ICL A;  4ZIT A;  4ERD A;  1N36 J;  2DH9 A;  2K1R B;  1V3Z A;  2CAD A;  3JSY A;  1SH3 A;  3H2L A;  1SJR A;  4I6W A;  4M1K A;  3VGV A;  4F0K A;  2V5H G;  3D2W A;  2IMW P;  2L08 A;  3SSQ A;  4KHM A;  1ZA2 B;  7FDR A;  4Q45 A;  3T5K A;  2MLZ A;  4U7U K;  2UUT A;  2FHM A;  2BAC A;  2XM3 A;  5L9X A;  5C24 B;  1KC8 T;  4TU7 A;  4DG1 B;  3T1Y J;  2UXD J;  2RHS B;  4PWW A;  4UQT A;  4ZIV A;  2GNK A;  5L9N A;  3W2W A;  1VRU B;  1KHW A;  3DDK A;  4N8N A;  1H74 A;  1U02 A;  2HNZ A;  5D4L A;  5KFQ A;  1YJR A;  4ECZ A;  2UVR A;  4F8R A;  1UVJ A;  5K9F A;  3MEE B;  1WC3 A;  1XNQ J;  1FX4 A;  4NLW A;  5EX0 A;  2D74 B;  2VV5 A;  4LFC F;  1HMV A;  3TVZ A;  2XS7 A;  4DS5 A;  2JVR A;  1TKT A;  1VK8 A;  1ZBT A;  2XSJ A;  4DR2 J;  3J7A N;  2Q1L A;  4C97 A;  8ATC B;  2CFX A;  3CED A;  5HMY A;  2R2R A;  2LFV A;  2V4J A;  2RS8 A;  3ILJ A;  1RAC B;  4EK2 A;  4DFK A;  4W90 B;  5JXS A;  3THP A;  4Y2C A;  1SC1 B;  4DZD A;  5J2M A;  4K0K F;  3MM8 A;  2V8D A;  4IFY B;  3Q23 A;  4MK9 A;  4RZR A;  5AT1 B;  2A2C A;  3WIU A;  4WU3 A;  4ZMM A;  2CPF A;  4ED1 A;  1VBZ A;  3ZFV A;  4NXM F;  1U1M A;  4F67 A;  4DFP A;  3OV7 A;  4QPT A;  1U8S A;  3DDI A;  4ECU A;  1TUW A;  2CDR B;  1C1C B;  1MWQ A;  5K5M A;  4MFB B;  1IM4 A;  4CLL A;  2E7W A;  1F6T A;  1JLB A;  2MQQ A;  3PX4 A;  4B9S A;  3VZI A;  2E9T A;  4O0I A;  1WHX A;  3SFU A;  1JJ2 R;  1CLF A;  1F9F A;  4HHJ A;  5D15 A;  3E2E A;  4EO8 A;  3DRS B;  3GYX B;  4PEO A;  3C8Y A;  3MMB B;  3KHR A;  3PKY A;  2JEI A;  4HAC A;  4QIW D;  3VVU A;  2KVI A;  4YDD B;  1UJ6 A;  3UVJ A;  4AYB D;  2U1A A;  5CCM A;  1NAQ A;  3EZU A;  3LUY A;  1HNX F;  2GHV C;  1JIH A;  2MXY A;  4C7Q A;  2R8G A;  4QU7 A;  4EBD A;  3M2U B;  4ECW A;  1B0V A;  3DHX A;  4G1Q A;  3QWP A;  2RML A;  2MKJ A;  4TY9 A;  1T9W A;  4HH0 A;  1QAX A;  2KJV A;  4ICL B;  3SEO A;  3UNY A;  3KLF B;  2E1C A;  1B0T A;  2M70 A;  3NCQ A;  1J5E F;  4DSL A;  1PKU A;  3FRY A;  1WOR A;  3JYT B;  3DLK A;  3NGS A;  5D0G A;  3W7B A;  2ZZM A;  1HPZ A;  4Y0F A;  3DNC A;  3EJM A;  3QRP A;  2N7C A;  1CG2 A;  1P1L A;  3OTC A;  5B0F A;  3MM7 A;  5HSP A;  4ED6 A;  3HHL D;  4ZPW R;  5F8G A;  4JI0 J;  2KHC A;  4C2M A;  3PRB A;  1REG X;  2J9D E;  4O4G B;  4WF9 Q;  3N6L A;  4UOF A;  5HQ8 A;  1S5Z A;  5LMN F;  3T1H J;  2C3U A;  1VK3 A;  4C0B A;  2KM8 C;  1WHY A;  3KG0 A;  5DQI A;  3A4T A;  4CI0 B;  1SJ4 P;  1X7V A;  1KBR A;  4K2X A;  2ZDO A;  2VHG A;  2DNN A;  4N77 A;  2C2E A;  3TX8 A;  1S4F A;  1S97 A;  2CQP A;  2ZUG A;  3TA1 A;  1VBY A;  2VBX A;  3M32 B;  1FTC A;  1OQ6 A;  3MUV P;  2QL5 B;  1ZA1 B;  4R8U A;  3PTW A;  2D7S A;  2ACY A;  2PC6 A;  5A8R A;  2LDY A;  1WG5 A;  2RU3 A;  4NA2 A;  1JQG A;  2UXC F;  4F4Y A;  2HK3 A;  4F2S A;  4PG7 A;  5F9L A;  4OZL A;  2VZ9 A;  3DGV A;  3BYR A;  2FVC A;  1VQ4 S;  1S1X B;  1Z2L A;  1RTJ B;  2WON A;  2ZBP A;  4NI2 B;  4DQR A;  3MEC A;  1RAO A;  3MM5 B;  1XMQ F;  3ZZT A;  2C2D A;  1RYS A;  4IG3 B;  3R2D J;  4DR7 J;  1YSJ A;  2W2P P;  3IAS 9;  4ZVE A;  1FK9 B;  1N33 J;  1HWJ A;  2YKM B;  2ZM6 F;  4JYA F;  2E44 A;  2D1C A;  4RNF A;  2DR6 A;  3BH7 B;  5J1N A;  2HMI A;  3MED B;  4XPE A;  3K17 A;  2PD1 A;  4USI A;  1ZM4 A;  2YWH A;  2J6T A;  1PIE A;  2FHO B;  2MJN A;  3JSB A;  4CTA A;  2BKN A;  3C14 B;  3WX8 A;  2QL9 B;  3UR3 C;  4C8Z A;  3UQS A;  1FDA A;  4LF8 J;  1RT7 B;  2YNH B;  1ZTT A;  2AYM A;  2LXI A;  1ZYQ A;  1EKR A;  2B9Y A;  4ZP8 A;  4O3S A;  2YKN B;  3G96 A;  1Q8K A;  2BQU A;  2CQ4 A;  3QFW A;  3KLH A;  2V9W A;  5IQQ A;  4M5K A;  3LP2 A;  4IQX A;  4LF5 J;  2FHJ A;  2I0X A;  4J91 A;  4FS2 A;  4CH0 S;  3FBC A;  2DH7 A;  4NA3 A;  2CNN B;  1LXN A;  2LU2 A;  3TEH B;  4LSL A;  3IS9 A;  1HHT P;  1F0X A;  5ETS A;  1GFW B;  2ZHB A;  4ELT A;  3DRP A;  3CCU S;  2CJY B;  2CPD A;  2UVU A;  1FJG J;  3DXB A;  1LEO A;  2APO A;  4ZPT R;  2Y1I A;  3G2X A;  3PFO A;  3S1T A;  4CM0 A;  3OSN A;  5F8M A;  1WC5 A;  3IBC B;  3FCW A;  3PIP Q;  1E6V A;  2F3J A;  3HDS A;  2YX7 A;  4QR0 A;  4OZ0 A;  3TZZ A;  2V94 A;  4DV0 F;  3R5B A;  4LQ9 A;  4DQS A;  3BSN A;  2BM0 A;  1RWW B;  1JK9 B;  2LQ5 A;  3QRQ A;  3TWZ A;  4LMZ A;  2VON A;  3T1H F;  3BM7 A;  3L09 A;  3MTJ A;  4F4X A;  2EC2 A;  2KXF A;  2HVZ A;  3D0I E;  5A8W A;  1WEY A;  4JI1 J;  2YNF B;  1U0H A;  4H4M B;  4E8U A;  1KVJ A;  3UCZ P;  3M2R A;  3PKM A;  3J80 Y;  4BWM A;  2ZBQ A;  2LQ8 A;  3EDR B;  4L73 A;  2ZH6 A;  1SH2 A;  4QIV A;  4F26 A;  5H9E J;  1N5Y A;  1B4S A;  1RA6 A;  1VGY A;  5BR8 F;  3R3T A;  1Q86 T;  5DJB A;  4XDD A;  3I87 A;  3B4M A;  3PR5 B;  2QLB B;  1IKW A;  3N5F A;  1Q5Y A;  2DGW A;  4KRW A;  3GIL A;  4ZP9 A;  3QT8 A;  2JOQ A;  4QIG A;  2XO6 A;  5KFK A;  2G2Z A;  5L46 A;  3J81 U;  3R1H A;  1SJ3 P;  4OI1 A;  5J2Q B;  2AV5 A;  2C1E B;  4P6Q A;  1YJU A;  4EU0 A;  4GC7 A;  2JEG A;  4DR6 F;  2HQG A;  1TKD A;  4KGV B;  1RBA A;  1LOU A;  1Y5I B;  1YQH A;  3IC1 A;  2VKZ G;  2OO4 A;  4J7C A;  3TOQ A;  4ED3 A;  3V81 A;  2V2Q A;  3DLH A;  1GEH A;  1WEL A;  2OHD A;  4IOA Q;  1N33 F;  2R7U A;  3M8S A;  1HKA A;  2ZM6 J;  1XJW B;  1SQF A;  2R4F A;  3HJV A;  3R27 A;  4P9S A;  4B02 A;  1MW7 A;  3SZ2 A;  3MMJ A;  2FJW A;  3OL9 A;  2HNZ B;  4HYK A;  2EW9 A;  4M5L A;  1R8C A;  2ATC B;  2IAJ B;  4J9L A;  3K59 A;  5F8N A;  1RQ0 A;  2D3Z A;  5D6G A;  4X66 F;  4ECY A;  1RTH B;  2ACM A;  3ULH A;  2GAH C;  1HBN B;  1NPR A;  4ZDN A;  2KZM A;  2RVJ A;  1TVR B;  2UP1 A;  2R7W A;  2DB1 A;  3EGV A;  3WQP A;  1Q81 T;  3NEK A;  5KT5 A;  1RTD B;  4IH6 A;  5B7W A;  5KFF A;  2FDN A;  3OR1 B;  4NRT A;  3CC4 S;  3BPS P;  1Z1Z A;  1HFE L;  1IR1 A;  3M9M B;  3ENV A;  3IRX B;  5KFE A;  1FWL A;  4NPO A;  3TQE A;  3CJR A;  4RW6 B;  1I6J A;  4RNH A;  1LFW A;  4M5D B;  4RW9 A;  2L48 A;  2D3U A;  3NNH A;  4LF7 J;  1KHV A;  4P73 A;  1IBL F;  4Y2A A;  4HHU A;  3OL7 A;  3BO3 A;  4DL7 A;  1XQI A;  4CO2 A;  2X1A A;  4QWD A;  3DLE B;  4LBH A;  5CZV A;  2IY5 B;  2GJF A;  2IAJ A;  3G8T A;  1FRM A;  3MI7 X;  1ICE B;  1X9W A;  2CYY A;  1XEZ A;  1H73 A;  3ENQ A;  1TVR A;  2YKP A;  2YKQ A;  2UU9 J;  4IDK B;  1EJ7 L;  1SJ1 A;  5M2P A;  4PWU A;  2C2N A;  4RKU C;  5HAO A;  2XZD B;  4ENO A;  4FYX B;  4YB1 P;  4ZVH A;  1J5O A;  4IG0 B;  3QMQ A;  4JI2 F;  2UUC J;  1NDP A;  3QGG A;  3V2U C;  5LXR A;  3RTV A;  7AT1 B;  1KFS A;  2E5J A;  4LFB F;  2JEF A;  1FWP A;  2ASL A;  2ZH9 A;  2MJU A;  2NS1 B;  1R31 A;  2YWW A;  5E5N A;  3ZZY A;  3K5N A;  5KFB A;  4CLZ A;  3R5C A;  4F0H A;  2M8D B;  1TL1 B;  4ALZ A;  1JJH A;  2VB6 A;  1R27 B;  2YQ3 A;  1N32 F;  1XMO J;  2IBO A;  1KLM A;  5HJX A;  3OFF A;  1HBU B;  1S7I A;  2CQ2 A;  3POT B;  1RZM A;  1UP1 A;  1Y10 A;  1OY8 A;  7FD1 A;  5IZH A;  3KJV B;  2XY7 A;  1ZAV A;  1QVF R;  4K4S A;  2PEH A;  4K4Y A;  2ZC3 A;  1ZAW A;  4ECS A;  2FD2 A;  4R0E A;  3R7S B;  3DRY A;  3K89 A;  4R5P A;  1ZOT A;  3O3L A;  3PJX A;  2MKI A;  2F7V A;  4ITS A;  4WZQ A;  3D28 A;  1SI9 A;  3CTR A;  3EGN A;  3HUL A;  2OP5 A;  5KT7 A;  4YR2 A;  2HYI B;  3UO0 A;  3W9I A;  1U1R A;  2V8G A;  4B9V A;  3W2V B;  1C0T B;  1FJC A;  4JV5 J;  2CZV C;  3CDU A;  4J9V A;  2C2Z B;  1F2G A;  2C3O A;  4J9K A;  1X5T A;  1M5H A;  2FY1 A;  3ZZR A;  4EO6 A;  5CZX A;  4JV2 A;  4I2Q B;  1RLD A;  1JNR B;  3DRP B;  3G6Y A;  2ZKU A;  4QYZ K;  5KFD A;  4CO4 A;  3CSK A;  4DV5 F;  3OR2 B;  2B5J B;  2DHX A;  2XMT A;  3C15 A;  4DUY F;  2RF2 B;  1FXD A;  1IWA A;  3ZZO A;  4GKJ F;  1KRP A;  3CT9 A;  3HFV A;  1OWX A;  2KO1 A;  5ETT A;  3PR4 A;  1NK8 A;  2ZOF A;  2HPU A;  4C11 A;  2E5L F;  1HNW J;  4JI7 J;  3M1V A;  5L1J A;  2F40 A;  4P2X A;  2HHX A;  1AW0 A;  2F9J A;  2W9C A;  2XMA A;  3K58 A;  1RT5 B;  3W5Y A;  3PAC A;  3G71 S;  2J6S A;  2CG4 A;  1PJ7 A;  2DYA A;  4Q2M A;  4FPR A;  2OFG X;  3RBD A;  3A8J A;  2IRY A;  2KG0 A;  2ZH4 A;  3SFG A;  2OGU A;  3LTO A;  1UPM B;  2AU0 A;  3P3D A;  3ZO7 A;  2BR0 A;  3GWC A;  2HNY B;  1U26 A;  1Y4Z B;  1RUS A;  1TKZ B;  3ELH A;  3FFI A;  3W64 A;  2KZZ A;  2W7A A;  2V2V A;  5CCL A;  3J80 U;  3R7N B;  2HHP A;  3ISN D;  2MYF A;  1FK9 A;  2MMY A;  3QWU A;  2EEY A;  2A0F B;  4KO0 A;  5IT0 A;  2V4Q A;  4DV6 J;  3CD7 A;  5HP1 B;  1AUD A;  2YX4 A;  1YJN S;  2HHT A;  2V9K A;  3BKT A;  2XHW A;  1SKR A;  2RSQ A;  2BJ3 A;  3HSD A;  4PG4 A;  1WC4 A;  1TKX A;  2AYE A;  1UA0 A;  1T03 B;  4QW9 A;  2CNL B;  1U4B A;  2JLE A;  4RW4 A;  1UJ4 A;  5IM0 A;  3MD3 A;  5BYR A;  2Y1R I;  1UEV A;  2JLF A;  2VG5 B;  3O8W A;  2GZO A;  3MM5 A;  1VCT A;  3AA9 A;  1KQF B;  1LK5 A;  5A8R B;  3IM8 A;  2JSX A;  1R6Y A;  2LEP A;  3MMC A;  2V67 A;  4DV7 F;  3PRD A;  1G6B A;  2J0W A;  2IM1 A;  3EZO A;  1FER A;  3TW0 A;  4CWB A;  5CXT A;  3F73 A;  1T03 A;  2CQ3 A;  4A8X A;  4WFA Q;  3TUP A;  5HMZ A;  5KT3 A;  1PBU A;  1HW9 A;  2Z8Q A;  3B54 A;  5KG3 A;  2XMK A;  1A6L A;  4TQR A;  1S0N A;  3M2V A;  5KG6 A;  3BSA A;  4DCP B;  4KO0 B;  4CNZ A;  1FE4 A;  2WVF A;  3FEZ A;  5A0Y B;  3ISN C;  2EKN A;  5CD4 A;  3MUR P;  2QRR A;  3K5L A;  2MY8 A;  5H9F J;  3OQ2 A;  5GME A;  4GO7 X;  5I42 A;  4NWB A;  2AT1 B;  2UZA A;  2RQC A;  2W1B A;  3CJ5 A;  1EP4 B;  5KG0 A;  2QFJ A;  1UCN A;  2GO8 A;  4K4U A;  2WHO A;  3IAM 9;  2MSS A;  1HA1 A;  2VL1 A;  2Z56 B;  2ZJP Q;  3V6J A;  1AFJ A;  2O67 A;  4ZA1 A;  1VBX A;  1X4E A;  1RAE B;  2OMO A;  1T02 A;  4J5O A;  4WBF A;  1WHW A;  4MTP A;  2E5G A;  5DZ7 A;  1M5S A;  1N0V C;  1TL7 B;  2GAG C;  3R6G B;  4ZVO B;  4U96 A;  3OTD A;  2GHW A;  3SCJ E;  5CYJ A;  3JS9 A;  3CJQ A;  3HVT B;  2XYG B;  5C42 B;  2VJV A;  1U1P A;  1VMB A;  3G82 B;  3GR1 A;  4WWS A;  2BBE A;  2EBE A;  1NME B;  3K5M A;  2LQJ A;  1BUX A;  3GB0 A;  3MTK A;  1SVD A;  1KTV A;  1VDH A;  4RBU A;  5DO2 A;  4EMD A;  2FJE B;  4DJB A;  3KHH A;  2DIV A;  2ABY A;  1YHQ S;  3ETO A;  3F41 A;  3PO5 A;  5BJR A;  2VFV A;  1T9V A;  2ZDP A;  5D4P A;  1HQE B;  1RK8 A;  1HYS B;  2KG1 A;  4RU9 A;  5E3Q A;  2DEJ A;  4M5G A;  2OPP B;  3UDC A;  4NCA A;  1X4B A;  3C2P A;  2R7V A;  3TAN A;  1U09 A;  4MFB A;  4FYY B;  5GMD A;  1ZZN A;  2OPQ B;  2EFG A;  3T19 A;  1W2B R;  3PX6 A;  3HHL C;  3TX0 A;  1U1O A;  2GGP A;  3GG1 A;  2CKW A;  4F3M A;  2M2B A;  5E2Q A;  4A8K A;  4WYL A;  3T41 A;  1ULR A;  2QYC A;  1VJQ A;  1SL1 A;  3NWG A;  1NUE A;  1S48 A;  4H4K C;  1N0U A;  3OHA A;  2YBV A;  1X4A A;  4IFY A;  2CPI A;  4PYA A;  2UUB J;  3T6B A;  1WG1 A;  2HFS A;  1HBU A;  1VIX A;  5J2N B;  2AEM A;  2VA2 A;  1HD0 A;  4NLD A;  2W9B B;  3VAI A;  3HXM A;  2DXF A;  4X4P A;  3KTQ A;  1U2F A;  4GVB B;  3E01 B;  2CQ0 A;  2QO3 A;  3H25 A;  2F8E X;  2JVO A;  1JLA A;  4M5J A;  4Y2K A;  3GCX P;  5J2M B;  2DNP A;  1TAU A;  4J9S A;  2XI2 A;  4IO9 Q;  3SCI E;  1HNI B;  1Q1K A;  2ZUA A;  3Q8U A;  1RKI A;  3MPD A;  2GML A;  4RLE A;  4Q8F A;  4LRF A;  5F0W A;  5KFT A;  4ELV A;  2X7I A;  3R8Y A;  1SV5 A;  5AXK A;  2HND A;  1AUS L;  1K47 A;  1KVK A;  3OBI A;  4KTQ A;  2IM0 A;  4QIE A;  1VQK S;  2Y8W A;  4ECR A;  2OIH A;  3LP0 A;  5FJ4 A;  4EI2 A;  3GP9 A;  4FXW A;  4Q44 A;  1FFG B;  1R3N A;  3SCL E;  4CNY A;  1UWA A;  1MNE A;  1RI7 A;  1VHI A;  2HBY B;  3C16 B;  1XR7 A;  3DRX A;  4ZP7 A;  2XBP A;  4A47 A;  3OTO F;  3RB6 A;  2LQB A;  2HLT A;  1CS4 B;  3I6P A;  2X1B A;  2DHA A;  3I0S B;  3NWR A;  2KXH A;  4G65 A;  4KIA A;  4WIQ A;  1EP4 A;  4X4O A;  1QAJ A;  2Z4P A;  4NEY A;  4DBQ A;  2KU7 A;  1KNZ A;  1HHQ A;  1KDN A;  1HWK A;  3B4D A;  5A6P A;  1XWL A;  2GV1 A;  1B7Y B;  1DLO A;  1YRT A;  3AFG A;  4ZCK A;  3UR0 A;  2RD5 C;  1IBK J;  2HZA A;  4LQ3 A;  4WKR A;  4YR3 A;  1QAI A;  2W7P A;  2HFV A;  1MML A;  4DI6 A;  2AF6 A;  2R7T A;  2G2Y A;  2D9O A;  1HWU A;  1SIZ A;  2WVC A;  3G9C A;  4AFF A;  2BE7 D;  2ZC4 A;  1EET B;  3BJY A;  4FNH A;  5J1E A;  2QC3 A;  1EAR A;  1CJV A;  1KD1 T;  1TQL A;  4ED2 A;  1I5O B;  1WSV A;  3R5G A;  4C98 A;  3JSM B;  3BR8 A;  2UXB F;  5F0U A;  3W60 A;  1SCJ B;  4WYW A;  2P2C B;  3MEG A;  5K14 A;  2YWE A;  2ZVS A;  3N6M A;  5KFR A;  3W1Y C;  3BBB A;  2K8G A;  4OHX A;  1RWP B;  5K8P A;  4X4S A;  4DFM A;  4LF9 F;  1UVL A;  4LFA J;  2UUA J;  2HIQ A;  2CQI A;  2VBY A;  1TKZ A;  2HBQ B;  1YTY A;  3CO0 P;  4DR3 J;  5B0D A;  3NNA A;  3HT3 A;  5E33 A;  2IIH A;  3ILL A;  2RAQ A;  3OW2 R;  1XC9 A;  3KYL A;  2EFV A;  4IH7 A;  1JX4 A;  3FEX B;  1BMQ B;  1UZD A;  3JTO A;  1BQM B;  4QZV B;  2XY5 A;  4KH1 B;  2DO0 A;  2F8H A;  2MHN A;  1HNZ J;  1NK6 A;  1SH0 A;  2SXL A;  3LAK A;  3FNN A;  1FO1 A;  1RIS A;  1X8D A;  2XCA A;  2RDI A;  3EVW A;  1RAJ A;  1VLO A;  3IMQ J;  1PCA A;  3CJS A;  3QBC A;  4GVL A;  4P72 A;  4ZVR B;  2J0X A;  1QUV A;  2FPH X;  2GX8 A;  2RF2 A;  1RT5 A;  2HVI A;  4M94 A;  1OMS A;  1V6H A;  3HF5 A;  1QDU B;  4Q5V A;  1WNE A;  1DUR A;  5ETL A;  4Y2I A;  2JEJ A;  1HI1 A;  1BY9 A;  2DY1 A;  2BAN B;  1NO8 A;  2FHJ D;  2IHR 1;  1S6P B;  2Z2Z A;  3HX9 A;  3M1V B;  3NGR A;  2M4M A;  4OYO A;  2DIS A;  1NSK L;  2DGX A;  4USH A;  5A8W B;  2YNI A;  5IV4 A;  2BUN A;  3GJQ B;  4QIF A;  4K4T A;  5IT9 U;  4TQS A;  1RT1 A;  1VC0 A;  1F1B B;  3I0R B;  2LA6 A;  4IR9 A;  2LMI A;  3GMG A;  5D4O A;  3K0J A;  1TL3 B;  4H4K A;  2VG6 A;  4RUA A;  4IYQ A;  1VYA A;  1YG0 A;  4OX9 J;  1B0P A;  1HI0 P;  4NXN F;  1V5I B;  1F3V A;  3KDN A;  4I56 A;  2K3I A;  2C22 A;  2ATL A;  4M95 A;  4YB6 A;  1J27 A;  2XZT B;  4FP9 A;  3GR0 A;  3RRK A;  3V4I A;  5EUH A;  5IXU A;  4KH0 B;  1BQN A;  3PHE A;  3SIP B;  2RU9 A;  2M0G B;  1SL2 A;  3IG1 A;  2UUW A;  3BR9 A;  4LVO P;  4ZVP B;  3MMA A;  4LF4 J;  1RDR A;  4UUX A;  2EK1 A;  4W4M A;  2XLJ A;  5E3P A;  3E8O A;  2FVQ A;  2OI2 A;  4NLX A;  5KFI A;  1PGZ A;  2YKN A;  3VQT A;  2V6A A;  2NXU A;  3K57 A;  3DKD A;  4C4W A;  1N6Q A;  2QA1 A;  2VFR A;  1X0F A;  2BOA A;  3FSY A;  1TZ0 A;  4ZJQ A;  1WEX A;  6FDR A;  1Q82 T;  2W2O P;  3OUY B;  5DDP C;  4WTO B;  2HBR B;  4B3S J;  4PRF A;  3NL0 A;  1JKH A;  1RAF B;  2HQ3 A;  3MUT P;  3VF0 B;  3H4B A;  2CNK B;  4WPA A;  1YJW S;  1RBO B;  2QE5 A;  5KFA A;  5KFP A;  4ZVF A;  3CE8 A;  2AX0 A;  4Q2L A;  1OSD A;  1OPI A;  2IPO B;  2KT5 A;  1RWU A;  5T41 A;  5LSL A;  4IRC A;  1RTJ A;  5HAT A;  1GMW A;  1XTZ A;  4RUC A;  2ZNZ A;  3A8I A;  4KGX B;  1WF0 A;  4D3H A;  4C3K A;  5DDO C;  1MU2 B;  1XIQ A;  2OLW A;  1K73 T;  1VQL S;  2KI2 A;  2D9P A;  2HWT A;  2JC0 A;  1NZA A;  2KL8 A;  3CJ2 A;  5LXY A;  3JSM A;  4PG8 A;  1X31 C;  2GQQ A;  2GS8 A;  3D4J A;  5A2Q Y;  3Q8Q B;  4UOH A;  5DGB A;  2N3L A;  4R8U B;  1MMN A;  2B4O A;  3O6Q A;  1SIW B;  2MZ1 A;  2AJ1 A;  2B4U A;  4USW A;  3MF5 A;  2VQE F;  2KYZ A;  1SKS A;  1QLN A;  4EZ9 A;  2Y3Y A;  1TU0 B;  2I8E A;  4KJI A;  3RU0 A;  4I2P B;  3HD1 A;  2QL7 B;  2VIH A;  2DY9 A;  4TKT A;  1K1Q A;  3VAF A;  3PG9 A;  5CA5 A;  5LMU J;  2LQ9 A;  4FXV A;  4ECT A;  4B9T A;  4DS4 A;  5EWG A;  3I0S A;  3UCG A;  2PA3 A;  5LSR A;  4UQG A;  3MOJ B;  2CJB A;  3DXS X;  2HFO A;  2W2M P;  2DRB A;  3MM9 A;  1RWM B;  1NH7 A;  5F8H A;  3CMA S;  4EYH B;  2J76 E;  2L9D A;  4DL6 A;  4QR2 A;  3SSR A;  1C1B A;  3KNG A;  2FHK A;  2AD9 A;  1BWE A;  5HRO A;  1HNV A;  3BYP A;  3QPI A;  4AUK A;  1HHS A;  1R0A A;  2JRS A;  1D9D A;  1HQ2 A;  2XYP B;  4NOH A;  3I55 S;  2YTC A;  5ETO A;  5GAG U;  4Q0B A;  2AJ2 A;  1HQU A;  4P52 A;  2LLZ A;  3AA8 A;  2E1P A;  3NS7 B;  4Z7Y A;  3O2I A;  4DPY A;  3D0G E;  4CH1 A;  2W9B A;  4ER8 A;  4BDP A;  4LF4 F;  1RAA B;  3TP2 A;  4BC7 A;  1N36 F;  5DDR C;  5KFO A;  2VA3 A;  3RR8 A;  3IXQ A;  1DJ0 A;  1J5E J;  4NLU A;  1LQ9 A;  1UVM A;  3JQJ A;  1JJ4 A;  2QMW A;  3L3C A;  3MOZ A;  3MCM A;  2AIR B;  2BJ8 A;  3I9Z A;  5MAO A;  1R7I A;  4F36 A;  5MLC V;  2J9C A;  3M2R B;  3Q0A A;  2UXD F;  2RJZ A;  3Q8S B;  2X51 A;  1FT8 A;  5I3Q A;  1JLE A;  3ET6 B;  4LR7 A;  4ZJL A;  2VF3 A;  1B64 A;  3I96 A;  1FKP A;  2XEX A;  3OXG A;  4WKY A;  4WFY A;  5I3P A;  4F7V A;  2VC1 A;  1HBO A;  2EG2 A;  1UVN A;  1S1W B;  2KN4 A;  4A46 A;  4PPZ A;  1JLC A;  4LFC J;  1N48 A;  2E1R A;  4OIX A;  2XHC A;  2OTJ S;  1TAQ A;  2QMX A;  5EHH A;  3HM9 A;  2PII A;  1HQE A;  3S6E A;  3G82 A;  2YNI B;  2V4J B;  3M8W A;  3Q8P B;  2N4D A;  2B0G A;  2DPI A;  3M8Q B;  3JXO A;  1TKT B;  1S6P A;  4DOZ A;  4HI2 A;  4KKO B;  4KV8 A;  3PW4 A;  1K9M T;  4DPT A;  2NZ4 A;  1WOP A;  1FWK A;  2DPJ A;  2HBZ B;  3U1M A;  2HW3 A;  5D78 A;  4LSL B;  3RB4 A;  2H5J B;  4PWD B;  4KR0 B;  1N5Q A;  2Q66 A;  1S12 A;  2B9E A;  3DM2 B;  1I94 J;  2RQK A;  1U49 A;  3CDE A;  3HHE A;  4OV6 A;  3PW7 A;  3MM6 A;  3IR6 B;  4ZLL A;  1NB2 A;  1WC0 A;  2DVI A;  3CIZ A;  3AQO A;  5KG7 A;  4X4R A;  4NLT A;  5CHC B;  4JYA J;  3TQ1 A;  2VFT A;  2PSZ A;  4ID5 A;  3BZQ A;  3R9L A;  2RIJ A;  2ZVI A;  3H98 A;  5A0Y A;  2QX0 A;  1X5P A;  2H4W B;  4DU7 A;  3OHB A;  3TAQ A;  3JB9 k;  1AFI A;  1S9G B;  2DD8 S;  1VOM A;  3K5O A;  3JTP A;  5DQH A;  1HNX J;  1ZZF A;  2AP6 A;  4NMX A;  2IVM A;  1S1X A;  1PC4 A;  3NXZ A;  4HL9 A;  4UST A;  1BC6 A;  2Z2L A;  1BWV A;  1H2T Z;  3MEG B;  4KBI A;  2QEX S;  3TJA A;  1U1N A;  2HRY A;  5CQG A;  3NMR A;  4PXB A;  5LJ5 Y;  2FZG B;  2J0Q D;  2WBM A;  1CJV B;  5KFS A;  2WVE A;  4J37 A;  1NCL A;  1RHR B;  2WOM A;  4U7C A;  1IKX A;  5CYM B;  5B09 A;  2R8I A;  4ECQ A;  1NK5 A;  3PO4 A;  2B6A B;  3HKW A;  4C8L A;  4MKY A;  2F4F A;  4OZN A;  3K2Y A;  5DS7 A;  2V34 A;  2MZQ A;  3A8K A;  3ZZP A;  3DI6 B;  3PYD A;  2MQP A;  2NLW A;  2L3M A;  4DV2 J;  4EYI B;  3DLB A;  1S0V A;  1LWF B;  5AE2 A;  4J9N A;  4E2F B;  3AOC A;  4JI6 F;  2N7Y A;  5LMN J;  5D3G B;  5KFV A;  3BGL A;  2OPS A;  1K0V A;  2PEB A;  2B3T B;  4K50 A;  4F4K A;  2VUG A;  1FI4 A;  4O4G A;  5KFJ A;  4DSJ A;  1NBE B;  3TA2 A;  5DG7 A;  4F0M A;  4DCO B;  4OYM A;  3OLB A;  1CS4 A;  1N52 B;  2MZR A;  2CVI A;  3JQK A;  4WFN Q;  4CLU A;  3CCL S;  2R8J A;  1H7X A;  3C16 A;  1YLX A;  4KFB A;  2BEF A;  2Z0G A;  3UN2 A;  2AQ4 A;  2KB2 A;  2W9A A;  3FZ2 A;  1PAE X;  5IQ6 A;  2ZH7 A;  2MEW A;  2QMU B;  3TO8 A;  3C6U B;  5E3A A;  4DF4 A;  1HW8 A;  3I4P A;  1JXV A;  2BJ9 A;  2WVD A;  2G13 A;  4HLB A;  4DL0 C;  1F9E B;  3R5D A;  3DCA A;  2XO7 A;  2OPR A;  3TUZ C;  1YDL A;  2QA4 G;  4ED8 A;  1YIT S;  4PAB A;  5BR8 J;  1FRX A;  2FZC B;  4P74 A;  3TA0 A;  2FC8 A;  3LGM A;  4TYA A;  4C9D A;  4DPX A;  3H0P A;  3ENA A;  4FZV A;  4KKO A;  4KV8 B;  4TY8 B;  1AT1 B;  4WTY A;  4MMO A;  4JI8 F;  3RRH A;  4HAC B;  4I68 A;  3NGD A;  4ILR A;  3PRV A;  2A6M A;  1RT2 B;  1LV5 A;  2MLY A;  2B5J A;  3C15 B;  4C3L A;  3MR2 A;  1C0T A;  4WU2 A;  1I94 F;  1NLK L;  2QTW A;  1BLU A;  4X64 J;  3AXM A;  2AKW B;  1YZ7 A;  1LNQ A;  1C1C A;  3O44 A;  1OS5 A;  1UWB A;  2DRD A;  2V8V A;  4N56 A;  3CGI A;  3DOM B;  4FF4 A;  4USK A;  4QU6 A;  1FRK A;  2HGM A;  2M88 A;  1LW0 A;  3CJK A;  2F8M A;  1GAO A;  2R3V A;  3VGS A;  1LWC A;  4J9R A;  1JLB B;  4OI3 A;  1HR0 F;  2IJN A;  1RAD B;  2IJR A;  1YGY A;  2Y9H A;  4X4N A;  2HQD A;  1UEU A;  4LF5 F;  4YHH F;  4HDG A;  1U6B A;  2L9W A;  5DET A;  1QSL A;  2BV3 A;  5C25 A;  2H65 B;  1DQ9 A;  2HEK A;  3SQO P;  3NGU A;  5IC4 B;  5KT4 A;  4QR1 A;  1XNR J;  2J0S D;  2XSJ B;  3P8B B;  1RT6 A;  2VKR A;  1EQM A;  3LAN A;  2KFY A;  1KLN A;  4B3T J;  1UVI A;  1R8H A;  1FJG F;  4MIA A;  3GV5 B;  1IVZ A;  4HDH A;  2Y0B B;  3OT9 A;  4V1A k;  4ZVU B;  4Y00 A;  4PG6 A;  5C2C A;  1NSA A;  2GFF A;  2NZC A;  3UN5 A;  1FXL A;  4WZM A;  3U1N A;  1KWM A;  3DU6 A;  3GV8 B;  1TL7 A;  2IYG A;  4JI5 J;  4O0N A;  4C8K A;  5KTQ A;  1WF1 A;  4UT4 A;  2XC9 A;  2FJX A;  4IRK A;  4YOE A;  1TR0 A;  2WTF A;  1NU4 A;  2HFU A;  4HEA 9;  4RUB A;  1JMT A;  2NUU G;  5E0O A;  1VQS A;  4OYA A;  5D4N A;  3V4M A;  2CZ4 A;  2RS2 A;  1ZAX A;  2MZT A;  2RKI B;  4OHW A;  3ITH A;  3BBF A;  2ZEJ A;  3T9N A;  3ZXW A;  1T3O A;  4JI1 F;  1CVJ A;  3CCJ S;  3GSD A;  1IWG A;  2EWH A;  3R7B B;  4BHQ A;  4DZ6 A;  5HJY A;  1NSP A;  1CC7 A;  4WJB A;  1S0M A;  4RW9 B;  3L95 X;  3MCO A;  4CLY A;  2WBR A;  2ASD A;  1XNQ F;  3LP1 B;  4I6A A;  1WAC A;  5F41 A;  1S0O A;  3IRX A;  4CQ1 A;  4USJ C;  3FEY B;  3W5X A;  3W66 A;  1FNM A;  5IWA J;  2GIF A;  3MPV A;  4K8R A;  3GFY A;  2B9W A;  4NX9 A;  4DR2 F;  4X4Q A;  1P8G A;  2CPH A;  4DR1 F;  1VQ9 S;  1N32 J;  1MRO A;  2CPX A;  3KG1 A;  2DGO A;  3LO3 A;  1LWE A;  4K4V A;  4NLS A;  4B17 A;  1N4L A;  3A3O B;  2W25 A;  2PMW A;  4A8W A;  1NZ8 A;  4QBU A;  3QT5 A;  4R0J A;  4I1T A;  4WP9 A;  2KFZ A;  1LXJ A;  1HWL A;  3ITH B;  2RKI A;  2PFF B;  4FKX A;  3AH6 A;  4RW4 B;  3QO9 B;  1S9E A;  4RO0 A;  4ZVG A;  4NXM J;  1X4D A;  1K1S A;  1CJU B;  1GQE A;  1L3K A;  2LXF A;  4QWE A;  1TUV A;  2EFN A;  4F04 B;  3QAE A;  1SQG A;  3I5C A;  2NXE A;  5JVG Q;  1PG5 B;  3V81 B;  4ZN1 A;  3MD1 A;  3M6W A;  3N28 A;  4YR0 A;  3Q2T C;  5FLX U;  2HUR A;  1FDN A;  2DJW A;  1KOH A;  1IXK A;  1JKH B;  1Z2Z A;  3MR6 A;  3GII A;  2VDI A;  1CJK B;  1RHK B;  3Q86 A;  2NXN A;  3TZW A;  1FRL A;  2BDP A;  1S1U A;  4CLK A;  1VIO A;  5HN0 A;  3AXK A;  1FKO B;  4A8Q A;  3G86 A;  2JHE A;  5A8K B;  1RT6 B;  3MFH A;  2CQ1 A;  2DGQ A;  4LRB A;  2AEJ A;  4CDI A;  2HK2 A;  4I6Y A;  1T3N A;  3DRR B;  3MPY A;  3QJJ A;  4URG A;  1XNR F;  3AHP A;  4YDX A;  4M8L A;  5FDL A;  1QTM A;  1FES A;  3RYL A;  3QZ8 A;  2AYB A;  3BGO P;  3KK3 B;  2F65 A;  4B08 A;  1IBL J;  4G3I A;  4B3T F;  4NLO A;  5KT6 A;  1X4C A;  4LBP A;  2YNG B;  3VAL A;  4FKY A;  1YBA A;  3DDN A;  4FBT A;  4O3O A;  4EZ6 A;  2QLW A;  2BJE A;  4ANC A;  4AXJ A;  1U45 A;  1UTA A;  1H6K X;  4DR4 F;  3IGV A;  3P45 B;  3DOM A;  3JTN A;  1FTR A;  3K5P A;  2MHE A;  1XER A;  2WW8 A;  3D1O A;  4I2Q A;  4WE1 A;  3UDE A;  3G6E S;  3BN7 A;  1KOO A;  3V4I B;  1S59 A;  2UU9 F;  2XLI A;  1U0H B;  3N01 A;  4I69 A;  1EIY B;  4DSI A;  2ZD1 A;  2V2K A;  4F4Z A;  1S79 A;  2E9Z A;  1E6V B;  4A8O A;  3AOA A;  2E9R X;  3KMQ A;  4CLT A;  3MXH P;  1FFS B;  3ILI A;  3NOC A;  4BBY A;  3W8P A;  4XPC A;  2VQF F;  4DV6 F;  3KKF A;  4YN3 B;  2VG7 A;  4Q43 A;  4N41 A;  4TLR A;  5DG8 A;  1URN A;  3PYG A;  2DEI A;  4TY8 A;  3T6J A;  3H5Y A;  2AX1 A;  3KK3 A;  3D68 A;  2HVD A;  3VQS A;  5SZT A;  5FDL B;  3LGN A;  3C46 A;  3UPF A;  4DL4 A;  3Q2S C;  4Y6I A;  2FGC A;  1U7L A;  4U67 Q;  1XMO F;  4RNO A;  5JJB A;  2YWG A;  2YNG A;  4N8O A;  5DG9 A;  3LAM A;  4GRS A;  5IWA F;  5D77 A;  3KJV A;  4DL2 A;  3UCU P;  1TK8 A;  2RRB A;  2UXC J;  3SV3 A;  3IWL A;  1ZM3 A;  1VIS A;  3EE3 A;  3SCK E;  4CP5 A;  3CIM A;  3PJW A;  5L8R C;  4PCQ A;  3G8Q A;  2R8H A;  1S10 A;  2CWK A;  4OFZ A;  3KWM A;  2FYX A;  1WOO A;  2MTL A;  3J81 j;  2YKA A;  3CCR S;  1XMQ J;  1SKW A;  1KR4 A;  3FQK A;  3SSS A;  1B3T A;  3W65 A;  1PYS B;  4MKB A;  5E3R A;  3LWM A;  2A1B A;  1AZS A;  4JI4 J;  4OYP A;  2FTR A;  2GJI A;  5DLF A;  3N0V A;  2H54 B;  3ZZZ A;  4USM A;  1EZZ B;  5D3G A;  5B0B A;  1GNK A;  3G87 A;  4OX6 A;  5AJ3 J;  3MAA B;  3QID A;  2B4P A;  4PKD B;  2ZH2 A;  1RWK B;  4OZ5 A;  2RRN A;  3BV8 A;  5G0R A;  3UD4 P;  4LRD A;  4NEZ A;  4DV5 J;  2WZ1 A;  1M0S A;  2XI3 A;  5ITH A;  2WCX A;  3QO9 A;  1AB8 A;  4O3P A;  2IRX A;  1Y3K A;  1U25 A;  4TN2 A;  5GAE I;  4NYO A;  2EFO A;  1IKV A;  3KJN B;  4ED4 A;  5DGA A;  2GIQ A;  2CPE A;  2LEA A;  2VIC A;  5THW A;  2ADC A;  4N7T A;  3TYT A;  1M5O C;  4M5D A;  1Y7P A;  3Q89 A;  1NJW A;  3RB3 A;  5D0E A;  4RW6 A;  1FE0 A;  2HHQ A;  3N79 A;  4PQU B;  4CYU B;  4B3M J;  4OI0 A;  4ES3 A;  1BE4 A;  2HFN A;  2FJD B;  3IA0 A;  1RLC L;  2XTJ P;  3MAQ A;  3AY0 A;  1W26 A;  2IYI A;  3L7O A;  5HVF A;  1IUJ A;  1RWO B;  3IRW P;  3VWS A;  1N88 A;  2JZ5 A;  3QYY A;  4M5I A;  3RBZ A;  3CCT A;  2NPF A;  5KFX A;  1TP7 A;  5F8I A;  4HTJ A;  4DR4 J;  5C5J A;  4ID5 B;  4B3R J;  3P5T L;  3P6Y C;  2YH1 A;  3I82 A;  4OJ1 A;  4NZ7 A;  4CO0 A;  2RQM A;  2DNR A;  1Y3J A;  2VPY B;  2HWI A;  4UZC A;  4AQY J;  3V6H A;  2M8H A;  2Y8Y A;  2ASY A;  2DNG A;  3IM9 A;  5C7P A;  3MFI A;  2J9E A;  2RE1 A;  3JYT A;  2XNR A;  4LF6 F;  3R2C J;  2BKO A;  2DKO B;  1OYD A;  4F3O A;  2E1M C;  5J2N A;  2PE8 A;  4ZN3 A;  4O4R A;  3DLG B;  3C66 A;  2X1F A;  2HHH J;  1VFJ A;  1XN9 A;  4W98 A;  1NXI A;  1U6Z A;  2IDL A;  3NGK A;  3QLH A;  4ED5 A;  1IBC B;  2DTJ A;  4GVB A;  1H0H B;  4KSE B;  4TXS A;  1RCO B;  1UMJ A;  2Z2M A;  2F63 A;  2AGP A;  5C25 B;  3OJU A;  4LF9 J;  3QAU A;  1S4E A;  3GIM A;  3IFE A;  1G2E A;  2W8L A;  4K5R A;  1T9X A;  3CJ0 A;  1NDL A;  4KE5 A;  4ZPA A;  3UVJ B;  1VQ7 S;  1RT3 A;  4DV3 J;  3CPW R;  1LWC B;  2AJF E;  1FEE A;  1S57 A;  2OPP A;  2N4C A;  4FYV B;  2BJ1 A;  4EBC A;  4X62 F;  3FCV A;  3DRS A;  3MPW A;  4P10 A;  3TAR A;  1UW9 A;  4DQQ A;  1SC6 A;  1RHJ B;  2P9E A;  1NKC A;  2CJA A;  3HPO A;  3DOK A;  5DZ6 A;  3NP5 A;  3KHL A;  1NHK L;  2JNJ A;  2C2O B;  1RA7 A;  4F02 A;  3P4U B;  3TAM A;  5KFN A;  3JSR A;  1T05 B;  4JOU A;  4RW8 A;  2ZWO A;  5IFM A;  2RDJ A;  2Y0S D;  4IRD A;  2QN6 B;  1HQU B;  1R8A A;  3PFE A;  1IBK F;  4Q0B B;  4FNI A;  4MJK A;  4Y2M A;  3HD2 A;  3CVK A;  1AXQ A;  2VDH A;  3DHW C;  1R0A B;  3WZ0 A;  4DUZ F;  2CXE A;  4NZ6 A;  2P6S A;  4C8M A;  2GQC A;  2R7Q A;  3MHY A;  3PX0 A;  1TK5 A;  3DLG A;  1FD8 A;  2JLG A;  4LR8 A;  4USV A;  4LUB A;  2QFI A;  5F3Z A;  3AAW B;  5ETK A;  4OJG A;  2H48 B;  3JAM U;  3RAX A;  3HVT A;  1PIL A;  1BQX A;  2ZE2 B;  3RR7 A;  1E6Y A;  3KXD A;  4UTG A;  3QGP A;  4AD6 A;  3V6D B;  1HMV B;  2OKQ A;  2VPX B;  3GON A;  4KGM A;  5B0C A;  4KC5 A;  3BGF A;  4U6P A;  3D3C J;  3BF4 A;  4A8S A;  2ZZN A;  1R0C B;  2YQ0 A;  5B0E A;  2OD6 A;  2YNH A;  2CQG A;  3DOL A;  3QT7 A;  2UUA F;  4C0O C;  2FQQ B;  4C3M A;  5A76 A;  1NJZ A;  2CPJ A;  4ID8 A;  4DR3 F;  1SXL A;  1X60 A;  2FJA B;  2C2M B;  4JB8 B;  4QWB A;  1A0O B;  1VQ8 S;  3BSO A;  1DBD A;  2XSF A;  3HZG A;  1RHQ B;  2UUC F;  1O8B A;  2WRM A;  3EIC A;  2B8P A;  4ECX A;  4P75 A;  1HNZ F;  4L3K A;  1UET A;  3D7S B;  2CJK A;  4OL8 A;  2H4Y B;  3R5A A;  2WVB A;  1S9F A;  1MWY A;  2CQB A;  4YB5 A;  4CRJ A;  4DR6 J;  3Q22 A;  2R8K A;  2NYH A;  3M2V B;  4QWA A;  3MEC B;  3VAM A;  1U6F A;  2WON B;  3A3P B;  5IM0 B;  3D6M B;  4O44 A;  4DU8 A;  3KLG B;  2JJ4 D;  2B7C B;  3MZI A;  4LFB J;  1W25 A;  1PJ6 A;  5J2P B;  2ILZ A;  1YRX A;  1WJ9 A;  3HMJ G;  1Q53 A;  3IBW A;  1MLA A;  2ZKT A;  3FMB A;  4NXN J;  3ETM A;  3M6X A;  3ENW A;  4PXD A;  4ZJO A;  3M32 A;  2CQC A;  3HSJ A;  4ZPV R;  3G4S S;  3OTO J;  4DPU A;  4G6V B;  5RUB A;  2HNY A;  1T8E A;  2I2Y A;  1Y9O A;  3NG8 A;  3UNG C;  1GX6 A;  2BW7 A;  4K59 A;  2ASJ A;  1S9G A;  4BC9 A;  5IT9 Y;  3T9Z A;  2NSB A;  1FRI A;  3PW5 A;  1NEE A;  4D3G A;  2ZIT A;  3H8Y A;  1FRH A;  4U8V A;  1N6Q B;  1DZ5 A;  4H54 A;  4JV5 F;  1ZPW X;  1VBK A;  3LF0 A;  4LF1 A;  3QIP A;  5A2Q U;  5HI7 A;  3SXL A;  4L75 A;  3S01 A;  2DHS A;  5CAB A;  2HS3 A;  1WEZ A;  1FNX H;  3MM6 B;  3BQ1 A;  3BSC A;  3Q8V A;  4C11 B;  2PT0 A;  2CJX B;  3JQM A;  3PVX A;  2ALY B;  1HPZ B;  2BVZ A;  2LDI A;  1EAY C;  3AJ1 A;  2KVQ E;  3HFZ B;  2G1D A;  3DLK B;  2RDD A;  3NCR A;  3BEG B;  4S0M A;  5DRK A;  5BYQ A;  2N82 B;  3UN3 A;  4Z37 A;  2MDA A;  2OTL S;  2VBZ A;  4K4Z A;  3IGN A;  4ICL A;  2MB0 B;  2K7K A;  3VAG A;  4LVN P;  4P71 A;  4CT8 A;  4PAA A;  4EUV A;  2VG7 B;  2UXB J;  3M8Q A;  1WTB A;  1OO0 B;  3KDO A;  3PJ9 A;  4Y28 C;  3RBX A;  3S8S A;  2HQI A;  4LJM A;  1R8B A;  4WK1 A;  4MKA A;  3OR2 A;  3ET6 A;  3FK4 A;  4ED0 A;  3W2V A;  1L3V A;  1F9H A;  3D66 A;  4TYB A;  1TL3 A;  4X65 J;  1TMM A;  1B70 B;  3M30 A;  4AT1 B;  5FLX Y;  2GJ2 A;  1JLC B;  3OFE A;  4FPI A;  2BZ2 A;  3TZY A;  2FVR A;  3EUN A;  1HBO B;  3M8P A;  2KH9 A;  4WFZ A;  2AJ4 A;  4B3S F;  1GMW D;  1U0S A;  2DHH A;  4FXD A;  1QM9 A;  2Q43 A;  1Q7Y T;  3M9N B;  5K8M A;  2MZJ A;  1K8A T;  3GLJ A;  3IBF B;  2Q6B A;  1YIJ S;  3NNC A;  4YY3 F;  1Q8L A;  2IA0 A;  3T5H A;  2XUL A;  3BQ2 A;  2GMH A;  4AL6 A;  3H40 A;  1YVF A;  2CPZ A;  3UI3 A;  3SV4 A;  2IA6 A;  3DGP B;  4WXO A;  1EQ0 A;  2IM2 A;  3CDA A;  3BRE A;  4L6V 3;  4AL7 A;  3E51 A;  4PPD A;  1O5J A;  3DRR A;  3OFG A;  1L3T A;  4FN5 A;  1ZM9 A;  1LK7 A;  2YQ1 A;  3NKY A;  1RT4 B;  1NDK A;  2XMV A;  2AYG A;  4F2R A;  3A8E A;  2OSR A;  2ZBC A;  2F1F A;  3WC2 A;  4J9O A;  3TR5 A;  3N9U C;  1NSQ A;  1P27 B;  2HWH A;  1SKU B;  1EX8 A;  2RH3 A;  3MGJ A;  2PDA A;  2DBB A;  1SJF A;  2DNM A;  3FJ2 A;  3PNI A;  3HHL B;  4J90 A;  1HNV B;  4YQW A;  2OML A;  1OY6 A;  1RWX B;  3ZTO A;  1ZM2 A;  1JWW A;  2XZW A;  3R6L B;  1KQS R;  4KHP J;  1HWI A;  3IP0 A;  2ZJQ Q;  2E5H A;  2XMM A;  1RP5 A;  1APS A;  8RUC A;  1LW2 A;  4OX9 F;  3IR7 B;  3QSY B;  1S9E B;  2XWY A;  1VRU A;  2V50 A;  3TUJ C;  3E3X A;  5D8H B;  2M7S A;  3FCH A;  5GAG I;  2VC0 A;  1VS3 A;  1M90 T;  4ELU A;  2XS5 A;  4ZVT B;  4IKA A;  5JUM A;  4TU9 A;  3R97 A;  5BXI A;  5AXL A;  2A18 A;  5DQG A;  4OMF G;  1S7H A;  2CIM A;  4KHR A;  1NRK A;  1IR2 A;  1WC6 A;  5CYQ B;  4DPW A;  2K1R A;  1WKL A;  2Q3P A;  4OHY A;  4LSZ B;  3AB4 B;  4YB7 A;  1S1T A;  2I5J B;  2KYX A;  4C48 A;  1URR A;  1GXU A;  2CPY A;  2J6U A;  1GH8 A;  1D1U A;  1QAY A;  5EGY A;  2J9D A;  4OX8 A;  4ZK7 M;  4KT0 C;  2A2D A;  2ZBR A;  1R43 A;  1HBN A;  3PW2 A;  3H42 A;  3OD2 A;  2G0I A;  1DTT A;  4YP3 A;  5CAA A;  2BE2 B;  4CM2 A;  3LPY A;  3CUN A;  4B3O A;  2D3O 1;  1B7F A;  6FD1 A;  3H5U A;  5HBM A;  3VHQ A;  1BD6 A;  4OYI A;  1T9U A;  3FUY A;  4OZJ A;  1EB0 A;  1J2V A;  5GAD I;  3MAA A;  2W2N P;  4A8M P;  2GMJ A;  2XGQ A;  2AEF A;  2HGN A;  1JJC B;  3NOG A;  4DL3 A;  4OJ3 A;  2LVW A;  1TL5 A;  3ONQ A;  3QSI A;  4IOC Q;  2QSF A;  2VPZ B;  2F4V F;  3CUL A;  3UD3 P;  4DV1 F;  4KGK A;  5SUH A;  5IS2 A;  3DYA B;  3RW6 A;  4CO5 A;  1SBR A;  1R89 A;  1RT4 A;  1OYE A;  3MMA B;  3CJ3 A;  3PY8 A;  3L7U A;  2D69 A;  2UV8 A;  3EVO A;  2VJU A;  4IOB A;  1RCX B;  2IM3 A;  3OL8 A;  5GAE U;  3NBP B;  2GCF A;  3AT1 B;  4LSN A;  3W8G A;  4NCG A;  2AJ0 A;  1N54 B;  2GVD B;  3FVY A;  3M8Y A;  2R42 A;  5E3C A;  2R7S A;  2WB1 D;  3B6B A;  1XBW A;  2W8K A;  2ALZ A;  4J9U E;  2W4D A;  3U02 A;  2V63 A;  3LWL A;  3B78 A;  3C19 A;  2RT3 A;  1Q16 B;  4RUH A;  3BS9 A;  3WC0 A;  3CD5 A;  4HT5 A;  2DNY A;  3T1A A;  5L1L A;  4X4V A;  3FKB A;  4KHP F;  2GC8 A;  1RT1 B;  2NYI A;  1IKY A;  2QZ8 A;  2J5A A;  5HMW A;  3CXC R;  4JI3 J;  3QGI A;  3CDW A;  1N5T A;  3GTY X;  4N5S A;  2FLP A;  3KLI B;  2E7V A;  3G6V A;  2YWK A;  1FEH A;  1UWB B;  1CJT A;  3CCZ A;  4UZB A;  2X1G A;  1K44 A;  9ATC B;  1JLQ B;  1S1V A;  3HSZ A;  4IUF A;  2QV6 A;  3SQG A;  3SYZ A;  4DN0 A;  1DHM A;  2LU1 A;  3AOB A;  2AMC B;  5C42 A;  2CG8 A;  1NJY A;  1QSY A;  2B51 A;  4NL5 A;  5LOQ A;  3PYF A;  3HCX A;  1H3D A;  1UEK A;  2GO9 A;  3B82 A;  1BXN A;  1M1G A;  2BAN A;  1U1L A;  3GFX A;  4OV1 A;  1P9Q C;  3H5S A;  4PG5 A;  3MEK A;  3TVK A;  2G4B A;  4QCL A;  1ZTW A;  1NKB A;  4KY3 A;  5DM6 Q;  4ECV A;  1FA0 A;  1NK4 A;  3GYG A;  4KFB B;  3RRG A;  2Z58 B;  4OYW A;  2CA9 A;  2FLO A;  2OPR B;  2ROG A;  3M8Z A;  2OEK A;  3MAH A;  5A8K A;  2VD3 A;  2FGO A;  3LP2 B;  4WII A;  4FS1 A;  4DLE A;  5FII A;  1FRJ A;  3HZE A;  3TEG A;  1D8Y A;  1GXT A;  1RAI B;  2EFQ A;  2I9S A;  4ZPC A;  4U9R A;  2DR5 A;  1SUQ A;  1JLF B;  3D3B J;  1F5C A;  1FVS A;  1REV B;  1T9T A;  3GFZ A;  3UD5 A;  3VVT A;  3H2V E;  3F44 A;  1TUG B;  3CDB A;  4UOC A;  2ZH5 A;  4RNN A;  2ZHA A;  3J7Z T;  4OX7 A;  5EWE A;  2YH0 A;  3C14 A;  4DX6 A;  2O3D A;  3T1Y F;  1C0U B;  4DEZ A;  4NYZ A;  1L3U A;  4WP8 A;  4A8Y A;  5A6W A;  2JL9 A;  1DAX A;  5B08 A;  4ES2 A;  2FUG 9;  2HAI A;  4RNM A;  1CJU A;  3KNA A;  1NPK A;  3UE2 A;  3L9Z A;  4P7T A;  3SBM A;  4EEY A;  2HS0 A;  4X4U A;  4DV1 J;  2B6A A;  3CD6 S;  4FF2 A;  1LWF A;  3LAL A;  1IKX B;  4M5N A;  5CYM A;  3ZTQ A;  1C4A A;  4WP3 A;  1FD2 A;  2DT9 A;  4IO1 A;  2VG5 A;  1I51 B;  1MN7 A;  4NI2 A;  2V68 A;  1IQT A;  2XB2 D;  4K2J A;  2KT2 A;  3DI6 A;  3J7Y U;  1LWE B;  2RUG A;  2EKY A;  3S7R A;  1KON A;  1RGV A;  4O44 B;  3HHD A;  1CQM A;  3KLG A;  2RRA A;  1WDD A;  2FZK B;  1VR6 A;  1NM2 A;  2VFU A;  1M5P C;  4YUD A;  5HLF B;  1RU2 A;  1U8W A;  1R8P A;  2DGV A;  5DDQ C;  1VQM S;  1WDT A;  2B56 A;  1VHF A;  2MKY A;  4AXI A;  5F8L A;  2IBK A;  2PA8 D;  4CCH A;  4Y34 A;  2YXL A;  5L1I A;  3QRR A;  2EK6 A;  3DLL Q;  2CJ9 A;  3D5M A;  4DF8 A;  1VJW A;  3HJF A;  1CBK A;  1Q8I A;  1UW4 A;  3KFW X;  5ETM A;  2BXJ A;  2EI5 A;  4EBE A;  2ZOM A;  3QJL A;  1DQA A;  1MMD A;  2B9X A;  4JI3 F;  1CC8 A;  3TJ8 A;  2PMH A;  1KP6 A;  4CT9 A;  1N5V A;  4X4T A;  2FY8 A;  2U2F A;  1HR0 J;  1HNI A;  5KOX A;  3FSX A;  3DN9 A;  2HSE B;  2NQP A;  1ARO P;  3MM7 B;  1JLA B;  4YHH J;  2HND B;  3ZTR A;  1L5U A;  4B9N A;  5HO4 A;  4PQA A;  2GW8 A;  2XYH B;  1YK9 A;  4XIU A;  2EPI A;  1V9O A;  4HR2 A;  4XO0 A;  5KFW A;  1SC3 B;  5J1P A;  5LL6 d;  3C6T A;  3CCQ S;  2LEC A;  4Y65 A;  4M63 A;  2BKP A;  1LFP A;  2IRU A;  5HL7 Q;  3Q83 A;  1SPB P;  2C28 A;  2Z30 B;  2KJW A;  1FX2 A;  4O23 A;  3DOK B;  4DMZ A;  2HKE A;  3Q24 A;  4J9P A;  1JLE B;  1PYO B;  2GGP B;  4ZHR A;  3OVA A;  3LGH A;  4OLP A;  2CQH A;  4L76 A;  4JV1 A;  4NLQ A;  3TAM B;  2OPQ A;  4ZCL A;  1S1W A;  1RT3 B;  2KM8 B;  5KG4 A;  1T05 A;  3BBC A;  4AL5 A;  3VGT A;  5GVQ A;  3MMB A;  4CO1 A;  4ZVS B;  1FKP B;  4OI4 A;  1RTI A;  1QY7 A;  1HAR A;  3ISZ A;  3EPG A;  2NSC A;  3D6F B;  2HZV A;  1HYS A;  4ED7 A;  2K3K A;  2KDO A;  4L3N A;  3VV2 B;  4JI2 J;  2JH3 A;  4DSE A;  4OHV A;  1MG7 A;  1V3R A;  3WHI A;  4KPY A;  4NCB A;  2VOO A;  1WC1 A;  1WKK A;  2C3Y A;  2NXC A;  3TVY A;  2MST A;  1NJX A;  1HL6 A;  3QLH B;  2NR0 A;  4H4O A;  2Z57 B;  4ZP6 A;  1WHV A;  3NAI A;  4GO5 X;  1TK0 A;  1SB6 A;  4B3O B;  2HHV A;  2PN6 A;  4CH7 A;  4F4A A;  4ZHR B;  2PGC A;  4KGZ B;  4MYU A;  4OLO A;  1T11 A;  3QT6 A;  1YZ6 A;  5HQM A;  3M8R A;  4DSF A;  1T7P A;  1RT2 A;  1UKU A;  2J8S A;  3TZX A;  1CSJ A;  2PFD A;  1DY3 A;  3ZNJ 1;  5EWF A;  3KK1 A;  4DFJ A;  3HKZ D;  3KUG A;  4RU2 A;  2YKO A;  4HKQ A;  4WK3 A;  2D41 A;  2CZ9 A;  3EGW B;  1C1B B;  2G2O A;  1Q79 A;  4ZS6 A;  1IBM F;  4CZC A;  4BCA A;  4EWT A;  2CAJ A;  1H98 A;  2VQE J;  2DNL A;  3QAT A;  2ZH1 A;  4QW8 A;  3AJD A;  3EM1 A;  5GAD U;  1MN9 A;  3MEE A;  4Y3C A;  5HAN A;  2DK2 A;  2L41 A;  3BKF A;  5HBM B;  3DU5 A;  2C2K B;  2RHQ B;  2V8P A;  4MIB A;  3PDN A;  3MM9 B;  4KPC A;  3H4D A;  3NS6 A;  3W2W B;  5LMU F;  2BE2 A;  2MKH A;  2RUS A;  2E1A A;  4FDF A;  2YWF A;  4M5M A;  3HK2 A;  2IMO A;  3GCW P;  4WCE Q;  4IH5 A;  1O6X A;  4ZLJ A;  5F8J A;  1KN6 A;  5HLF A;  2W2Q P;  1Y11 A;  3BN4 A;  4HVZ A;  2JC1 A;  1P9Y A;  4HI1 A;  1NPP A;  2EC0 A;  1FJ7 A;  2WB4 A;  5C2G A;  4RJV A;  3QJP A;  4DLG A;  3W3S A;  2E5L J;  1HNW F;  2M9K A;  5ETR A;  2MQN A;  1VQO S;  2FJV A;  4O3N A;  1RJJ A;  2BJD A;  2DXD A;  3QGH A;  3TJ9 A;  3GFH A;  5ADZ A;  2PI5 A;  1PO6 A;  2AW0 A;  4LBI A;  1T9Y A;  1FF2 A;  1N5S A;  1QJH A;  2KRR A;  4LF2 A;  4LR9 A;  2CWX A;  3W9H A;  1HBM A;  1RTZ A;  2CQD A;  5GMK a;  4FF3 A;  1VQN S;  4RWW A;  2AWZ A;  2QG9 B;  1GMU A;  1RHM B;  1S6Q B;  4JI0 F;  3IN5 A;  3RB0 A;  3WX4 A;  2QYG A;  1Y5L B;  2XWX A;  3BO2 A;  1YJ9 S;  1FKA F;  3DFE A;  4ZCI A;  4YEA A;  3MDF A;  4DHV A;  3EZ5 A;  3CWJ A;  2CVE A;  3HLU A;  3D9B A;  2VFS A;  4NA1 A;  4RR5 A;  2K2P A;  4ZPD A;  3I5A A;  1QD1 A;  2LXU A;  1JLF A;  2MQ8 A;  3GJT B;  2ZZT A;  3BQ0 A;  5G0R B;  3US5 A;  1AZS B;  1NHU A;  4DN9 A;  1C0U A;  4E98 A;  5KFC A;  1IJF B;  5ETQ A;  1YJT A;  3M6U A;  3TRG A;  1V3S A;  3NY0 A;  3MPU B;  1WKJ A;  2RQ4 A;  2V2Z A;  1LKZ A;  2E7X A;  3MR7 A;  4IFV B;  3THT A;  4WFB Q;  3J7Z 5;  3KLE B;  1PAU B;  2O1P A;  3OLA A;  3A3N B;  3FFI B;  3PYE A;  1D09 B;  3FGV A;  3I4H X;  2ZWP A;  3PXG a;  1TFW A;  3L4B C;  1F60 B;  2BRL A;  2I6W A;  2QT7 A;  2OAU A;  1YRU A;  1M5V C;  3DM2 A;  1JLG A;  3QZ7 A;  4WFX A;  1D9F A;  4KQZ A;  4JV0 A;  4MKV A;  3SI8 A;  4NZ0 A;  2DCU B;  3GYN A;  4DX8 H;  4GKK F;  2V69 A;  1M5K C;  3DMJ B;  3KMS A;  2HGL A;  3AOD A;  4OHZ A;  2MY7 A;  2DGU A;  2XMU A;  4F25 A;  2LKZ A;  4M5H A;  4DR7 F;  4KYZ A;  2Z2Y B;  1DTQ A;  3CD0 A;  3FDS A;  1U48 A;  4EGL A;  2PMZ D;  4QWC A;  3UDL A;  5L1K A;  1X9M A;  1IBM J;  4DWI A;  5DLG A;  1NK9 A;  4V19 J;  2VG6 B;  2VOD A;  2KFN A;  4HH1 A;  4EFA C;  3M8P B;  1GMV A;  4N76 A;  1PSD A;  4JI4 F;  1CJT B;  1YBT A;  2P9G A;  5AE1 A;  1NK7 A;  2EBG A;  2VH7 A;  3KUE A;  1P6T A;  3KK2 B;  2K06 A;  4J9Q A;  1PBA A;  3I9V 9;  5F9N A;  4LF8 F;  2DR9 A;  1D9A A;  3LA0 A;  3WIV A;  4XTT A;  3Q8Y A;  2Y1L B;  4X66 J;  2PO4 A;  1Q78 A;  3I0R A;  1UPP A;  3M4X A;  2WAQ D;  2GVD A;  5T14 A;  1RU1 A;  3U27 A;  1ITP A;  3RG6 A;  5DM7 Q;  3W63 A;  2RIL A;  3NBP A;  2DNO A;  3RJM B;  3NS5 A;  2JDJ A;  3N5B A;  4I64 A;  3OJS A;  2VAS A;  4FVC A;  4W92 B;  1DAR A;  1G4C A;  2KRB A;  3D67 A;  4ETZ A;  3DLJ A; 
#chains in the Genus database with same CATH homology
 4GVB A;  4GVB B;  1KP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...