4IG0B

Hiv-1 reverse transcriptase with bound fragment at the 507 site
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
424
structure length
416
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 116
structure length 416
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ig0B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig0B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig0B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig0B03
3QIPB 3V81B 3SFGA 3M8PB 3GILA 4NLQA 2J6SA 1RA7A 1QE1B 3JYTB 1JLFA 4RW6B 5C24A 5HLFA 5D3GA 5EUHA 5EWEA 4KFBA 3BQ2A 4TLRA 3I5AA 3DI6B 3T19A 1IKYB 4R5PA 1JLQB 3VQSA 4RNMA 1IKXB 1HNVA 3MEDB 2C22A 2FJXA 4LQ3A 4O3PA 1RTHB 1RTJB 4K4VA 3QGGA 1S9EA 2UUTA 3FFIB 4ECVA 3G86A 3KLIA 5L1KA 1T03A 3RB6A 4Q43A 5KFDA 2W8KA 1FKOB 3PW2A 3PW5A 2F8EX 4TY9A 3IG1A 2ASDA 4Y2AA 2BRLA 2E9ZA 2W9BB 2CKWA 2HWIA 3DRRA 3KK3B 4PWDB 3BSOA 2XWYA 1RT2A 3E51A 4F4XA 5KFNA 4MIAA 3DOKB 1T05A 5C42B 4J9LA 2JEJA 1JIHA 3I0SA 4Q45A 2R2SA 1KLMB 4ZP8A 1SH2A 2YKNA 5C25B 1RTIB 4R8UB 3BR9A 4O3SA 1RT6B 4IOBA 4JV2A 4RW9A 4K4TA 4RUCA 1N48A 5I3UB 1BQNB 1EP4B 4G1QA 3PHEA 4WFZA 4YR3A 5I42B 4J9PA 1VRTB 2VA3A 4K4UA 2ILZA 5K14A 3HVWA 1LW0A 3KHHA 1XR7A 4O4GA 2C28A 4KBIA 3BGRA 3LP2A 4ICLB 4MFBA 3DOLB 3BSAA 3NKYA 4NLPA 4RUAA 4NLSA 2OPQA 4MK9A 3BJYA 4IQXA 2HNYB 4XPEA 4H4OB 3LP0A 4PQUA 2J6UA 3GIJA 4ECSA 2BQUA 1ZETA 4WXWA 4K50A 3KLFB 4RW7A 5KFCA 2DPIA 3KK2B 1DTTA 4NLRA 4FBUA 4NZ0A 1LW2B 4NLDA 2QV6A 5CYMB 2C2DA 1VRUB 1IKWA 5DQHA 3FDSA 2B6AB 1RT5B 4ID5B 4PUOA 1TQLA 4TY8B 4YQWA 1HYSB 3EPGA 1OS5A 2AGOA 1TVRB 2E9TA 1S97A 4RW8B 1UWBB 1RT3A 3DYAB 4KHRA 1T3NA 4DG1A 4QW9A 3SFUA 2ZD1B 3QO9A 1LWEA 4NRUA 4NLWA 4ED6A 1IKVA 4WE1B 5F8NA 1HPZA 5HBMB 3KMSA 1S49A 4RNHA 2WOMA 2E9RX 4TYAA 1RT1A 2YNIA 3PJWA 4FS2A 3GYNA 5CYQA 2VG6A 4O3OA 1RDRA 3C6TB 1LWCA 3RBEA 3PW0A 4RZRA 4KKOB 3CJ4A 4H4MB 1S9FA 2IM2A 1REVA 3MEGB 5KG7A 2OPPA 4LSLA 3PR5B 2B5JB 3OLAA 3RB4A 2JEFA 4XPCA 4ECZA 2ATLA 2W9CB 4IG0B 5FDLB 2ZE2B 1HMVB 3CJ0A 3DRSA 5JXSA 5EDWA 4I2QB 2FVSA 3H40A 1SUQB 5J1EB 5JUMA 2XI2A 5L1IA 1TKXA 3DLEA 4KSEB 3MFIA 4NLGA 1TL3B 4KHMA 4JUZA 3E01B 1JX4A 3PJXA 5KFGA 1JLAA 2YNGA 2WK4A 5T14A 3MF5A 1JLEB 3KHRA 4DL6A 3NBPA 1JLGA 3MEEB 2W8LA 3RAQA 2AX0A 5KG6A 3OHAA 1TV6B 4H54A 3H5XA 1S1WB 1C2PA 3CIZA 4FBTA 3ITHA 3LAMA 4Q44A 3BQ1A 3KLHA 2RF2A 2C2EA 1S9GB 1T94A 3UR0A 2AU0A 4I2PB 3GIMA 3BQ0A 3V6DB 1S6QB 5HP1A 1XR5A 4IDKA 4Y2CA 1C0UB 2BANB 2VG7B 2FLNA 2XCPA 3LP1B 4URSA 4EYIB 1TL1A 1K1SA 2R8KA 5KFUA 3N6MA 1C1CA 1N6QB 5KFBA 2FLLA 2IA6A 1TP7A 3CDUA 4IKAA 3MTKA 3N6NA 1HNIB 4IR9A 3QIPA 3V81A 3M8PA 1RT7B 4Y3CA 3H4DA 3M8QB 1MU2B 3HKWA 4IH7A 1QE1A 5J2QB 3JYTA 2OPRB 1NNDA 4RW6A 4ED3A 2YNHB 3CJ2A 2AGPA 3PZPA 3CJ3A 1S1UB 3DI6A 1N56A 1IKYA 5J2NB 1JLQA 2B43A 1IKXA 3DM2B 3MEDA 3T1AA 2HAIA 5KT5A 1FK9B 4NCGB 5J2PB 1S1XB 3GV7B 1NHUA 1RTHA 5DLFA 1RTJA 2EC0A 3FFIA 2IJFA 4Q0BB 5KT6A 3OL8A 4J9NA 4ECYA 4IRDA 4IRKA 4ZPDA 4KAIA 3HHKA 4ED8A 5KFSA 4Q8FA 5HROB 4QW8A 4TQRA 3OSNA 2AGQA 5DG7A 4B3OB 3RBDA 1MMLA 4QWDA 2W9BA 4J9MA 1DLOB 3KK1B 3KK3A 3QGHA 3ISND 4PWDA 3HVAA 1FKPB 4ZP6A 3DOKA 5C42A 5HLFB 2C2RA 1JLCB 4KO0B 4KV8B 1S1TB 4M94A 3D5MA 3DDKA 1KLMA 4NLUA 5KFJA 1S0MA 5C25A 1RTIA 4IH6A 4R8UA 2I1RA 3GV8B 4ECWA 1RT6A 4DL7A 4LSNB 2HMIB 5I3UA 1BQNA 1EP4A 4R0EA 4EBEA 2IC3B 1HQUB 5I42A 1S4FA 2WTFA 4IFYB 1VRTA 2XGQA 5KFAA 3MR5A 2UVVA 2GIQA 4DL3A 4GC6A 2O5DA 4ICLA 2UVUA 4ED2A 4TYBA 3DOLA 1EETB 2HNYA 2I5JB 3TAMB 2IM0A 4ZPCA 3JSMB 1RYRA 4H4OA 3HVTB 3KLEB 3TVKA 4HKQA 3KLFA 2RDIA 3GV5B 3NL0A 2JEIA 3KK2A 4O3NA 3UQSA 4YR2A 1DTQB 1LW2A 2J6TA 5KFXA 5CYMA 3QZ8A 5F8IA 3KJVB 1VRUA 4Q8EA 2B6AA 1RT5A 3DRPB 4ID5A 1N4LA 4KB7A 4TY8A 1HYSA 4MIBA 1C1BB 1HQEB 1TVRA 3C6UB 4OL8A 3LANA 1SH0A 4RW8A 1UWBA 3DYAA 1D1UA 3KHLA 5L1JA 3PW4A 4RW4B 3UPFA 4MH8A 2ZD1A 2AX1A 1Z4UA 1N5YB 4J9RA 1SH3A 1R0AB 3KMQA 4ECUA 4WE1A 2FVQA 2XCAA 5L1LA 2WCXA 3H2LA 3RAXA 5HBMA 4J9KA 1ZTWA 3I5BA 4RNFA 4URQU 3V4IB 4WZQA 3H5UA 1S0OA 4ZVGA 3V6HA 3NMAA 1SV5B 5KFYA 2V9WA 3C6TA 3H59A 1NHVA 3QGIA 3KOAA 2YNFB 4KKOA 3OHBA 4H4MA 3CDWA 5F8GA 3MEGA 3Q8SB 1S10A 3FSIA 1YVFA 2B5JA 4WFYA 2ZKUA 2WONB 1TKTB 4ZPAA 4DL5A 1S6PB 2W9CA 4IG0A 2BE2B 2ZE2A 1HMVA 2IAJB 5FDLA 4ZHRB 5KFWA 3QZ7A 2IMWP 4I2QA 2UVWA 1S1VB 2HWHA 4ZMMA 4IH5A 4WXOA 1SUQA 5J1EA 3N6LA 3H5SA 5KFOA 2IM3A 4IG3B 1TL3A 4NLOA 2D41A 4EBDA 3E01A 4MKBA 2R8HA 1JLEA 5J2MB 3T5HA 4G3IA 3MEEA 2W7PA 2ASLA 1RT4B 2JLEA 5KFMA 1W25A 4O4RA 1TV6A 4YP3A 1S1WA 2V4QA 3IS9A 5KT4A 1JXLA 3DLGB 2UUWA 2CJQA 5F9NA 3ICLA 4ED0A 4O3RA 1S9GA 4NLVA 4I2PA 4I7FB 4F4ZA 5KFKA 3V6DA 1S6QA 3CDEA 3KLGB 4U6PA 4RU9A 2RKIB 1C0UA 2BANA 1TKZB 2VG7A 3I0RB 3M9NB 3LP1A 4KE5A 2HNZB 2OPSB 5KT3A 2R2TA 3CWJA 1N6QA 1QUVA 2FVCA 2XI3A 3QYYA 3G6YA 5KFPA 3UDLA 1RYSA 2ASJA 4O44B 1BQMB 3MECB 3T5JA 1HNIA 1RT7A 3H5YA 1RTDB 4JV0A 5KG1A 3CVKA 5KG0A 3MFHA 3M8QA 1C0TB 1MU2A 4EO8A 3KLVA 5J2QA 2OPRA 2ALZA 3DMJB 4NRTA 2YNHA 4IFVB 1S1UA 1XR6A 1QAIA 5J2NA 4YR0A 1JKHB 2HNDB 3DM2A 1J5OB 2WRMA 4F4WA 4QWEA 1FK9A 2BRKA 5J2PA 1S1XA 3IRXB 3G6VA 4ECRA 1IM4A 2AQ4A 4ECQA 2FVRA 4IR1A 1JLBB 4ECTA 2YKMB 4Q0BA 2V0NA 1CSJA 3DLKB 4URGA 2VG5B 1FKOA 5KFIA 3KHGA 1LWFB 2D3UA 4J9SA 2R8IA 5HROA 1WNEA 4IRCA 4B3OA 3QLHB 5L9XA 1DLOA 3KK1A 3D28A 4XO0A 4TQSA 5KFHA 4JV1A 5F8LA 1FKPA 2ILYA 1JLFB 5C24B 5D3GB 4M95A 1JLCA 4KO0A 4KV8A 1S1TA 4KFBB 2R2UA 3V6JA 3BREA 4NYZA 5F8HA 3IN5A 4X2BA 4R5PB 4NLYA 4EYHB 1HNVB 5KFQA 4WZMA 4LSNA 3CO9A 4ZP7A 4EO6A 2HMIA 1S9EB 4K4ZA 3KLIB 2IC3A 1HQUA 1T03B 3GIIA 4IFYA 3H98A 4ZP9A 3FRZA 4DL2A 5F8MA 3IG1B 4NLTA 2DPJA 5DLGA 4QPXA 4DL4A 3DRRB 4QWBA 1RT2B 1EETA 1KHVA 3M9MB 3T5LA 2I5JA 3TAMA 1T05B 2JC1A 3SI8A 3JSMA 4ZPBA 5C5JA 4K4SA 3MR2A 3HVTA 3I0SB 5DQGA 5DGAA 3KLEA 4F50A 3OL9A 4ECXA 2YKNB 3CJ5A 4RNNA 3PVXA 4J9QA 5KT2A 4RW9B 3LAKA 3EPIA 1DTQA 4G1QB 3NGDA 2UVRA 2XC9A 3KJVA 3BSNA 1S0NA 2VA2A 2OH2A 3V6KA 1ZTTA 4Y34A 3DRPA 5K14B 1LW0B 4NLXA 2BQRA 3Q8PB 4O4GB 3H4BA 1C1BA 1HQEA 3BGRB 3C6UA 3LP2B 3MR3A 4MFBB 3QIDA 3I5CA 4MK7A 1I6JA 2FLPA 4EBCA 2OPQB 4RW4A 2IBKA 2GC8A 2QE5A 2R2RA 2W7OA 1U09A 3LP0B 1N5YA 4PQUB 1R0AA 3FQLA 4YMEA 3TQ1A 2JEGA 2W9AA 1QAJA 4RW7B 5DG8A 1DTTB 2D3ZA 5DQIA 3V4IA 2BR0A 2IM1A 2BQ3A 4DEZA 2WHOA 1SV5A 3GIKA 3IGVA 1IKWB 5KG4A 3T5KA 3FQKA 4PUOB 2YNFA 4K4XA 3OL6A 3M9OB 4RNOA 4GC7A 2R8GA 4U7CA 1RA6A 3MR6A 1RT3B 1TKTA 2WONA 5KFEA 1S6PA 4DG1B 3QO9B 4K4YA 2BE2A 1LWEB 2IAJA 4ZHRA 2JC0A 1IKVB 3Q8QB 1S1VA 2D7SA 2GIRA 3RB0A 4ZVFA 5F9LA 1HPZB 2FJWA 3IGNA 3G6XA 4ED1A 2WOMB 4WFXA 1RT1B 1K1QA 2YNIB 5DGBA 4J9OA 3LALA 4ED7A 4IG3A 5CYQB 2VG6B 5F8JA 3NAHA 2IJNA 1LWCB 5J2MA 3PR4A 2XGPA 1RT4A 4MKAA 1REVB 3RB3A 2OPPB 4LSLB 4QWCA 1KHWA 3PW7A 4O3QA 3GQCA 2V4RA 3DLGA 4K4WA 3Q8RB 3DRSB 3NAIA 4LQ9A 4I7FA 4MK8A 3KLGA 5KFTA 2RKIA 5DG9A 1TKZA 1TKXB 3I0RA 3DLEB 4ZVEA 2HNZA 2OPSA 5EWGA 3KNAA 5KFRA 1JLAB 2YNGB 2WB4A 3NBPB 1JLGB 3EZUA 3OSPA 4O44A 1D0EA 1BQMA 3MECA 2RDJA 5KFVA 1S48A 5KFFA 5KG2A 4EEYA 5KFLA 1RTDA 2FVPA 3IS9B 1C0TA 4TXSA 4WYLA 3ITHB 1GX6A 3DMJA 3BSCA 4F4YA 3KLHB 2RF2B 4IFVA 5KFZA 4HYKA 1HARA 5HP1B 3ISNC 1JKHA 2HNDA 4WYWA 1J5OA 4IDKB 4NCGA 1RAJA 3IRXA 2FJVA 1JLBA 1TL1B 5EWFA 1GX5A 2YKMA 3OLBA 2R8JA 1C1CB 3DLKA 2AWZA 4TN2A 5KT7A 3OL7A 4QWAA 2VG5A 1LWFA 4FS1A 4ZVHA 5KG5A 3QLHA 5KG3A
chains in the Genus database with same CATH superfamily
4WFNQ 1FE0A 1HA1A 4NLQA 1PILA 3MHYA 1WWHA 3BQ2A 4I1TA 2KZZA 5EWEA 1DFDA 1S5ZA 4JI0F 3B54A 3MCSA 2D9PA 2MHEA 3RB6A 2G13A 4OX9J 2IMOA 3NS6A 4ZIVA 5IM0A 2BUNA 3CCRS 1YX2A 3G4SS 4R0JA 3NGUA 3E51A 1U1PA 3GIRA 1M5HA 5C42B 2OSQA 3MUVP 3PIOQ 2I6WA 4B08A 1WF0A 2LXIA 1ZZNA 4DQPA 1ZS6A 5K8NA 4PPDA 2QL9B 2G0IA 4IQXA 3TUPA 4OLPA 1VBKA 4OV6A 1ZETA 1OPZA 2CJYB 4Z7CA 1WG5A 3CTRA 4NZ0A 3CMAS 2QV6A 2MQNA 1OS5A 1KOHA 4KHRA 1T3NA 1URRA 4EZ6A 2CDQA 1H98A 1VBYA 4GVLA 3BGLA 4UZCA 3PR5B 2RT3A 2R7SA 1U49A 2DNGA 4HLBA 1URNA 4JUZA 2ZBQA 4DL6A 3C2PA 3W7BA 1M1KT 1DRZA 3OTDA 4P2XA 4KHPF 4FYYB 4ZCMA 2P9EA 1X4DA 3AOBA 5FLXY 2BANB 4EYIB 1TL1A 2HHXA 5KFBA 2F8HA 3FRYA 3JSRA 4QYZJ 1I1GA 2V9KA 4LRBA 4Y3CA 4U7UK 2VASA 5HANA 2UP1A 1VHFA 3K8WA 5J2NB 1JLQA 1IKXA 2CWXA 1KQFB 1RTJA 4CTAA 1U8WA 3FFIA 2YTCA 2HHHF 2YWFA 2QL5B 4PWDA 4A46A 4HACB 2C2RA 3TUZC 3AXKA 1BQNA 4OHYA 1K0TA 4LREA 5G0RB 4X4RA 2Z8QA 2HHWA 3HD1A 3GE9A 1OIAA 5LT5A 1HQ2A 4TU8A 3VF0B 1T8EA 4CH0S 1DQAA 4YR2A 1Q4RA 1NK5A 2GVDB 2FHJA 1HQEB 4DV5J 2VPZB 4KIAA 5L1JA 2VDIA 3Q22A 3CCVS 3M2UB 3IR6B 2CAJA 3CDWA 2B5JA 2V6AA 1U6FA 3HPOA 4B3MF 3ET6B 4DL5A 5AJ3J 2DH7A 4I2QA 3E2EA 2OFGX 4A8WA 1FJCA 5LMNF 3W9JA 2XO6A 3BM7A 4ED0A 3ZZUA 2PI4A 4I7FB 1OPIA 3EGVA 2JHEA 3ENQA 1TKZB 4KE5A 3MPDA 1ZA1B 2AEFA 1HNZF 4B9MA 3ZZRA 1YRUA 4I69A 3DMJB 2ZZTA 2AF6A 4IR1A 4TLQA 2QZ8A 2IYIA 1VC6A 5ETNA 2MGZB 3CJ8A 3J81Y 3A8JA 1D09B 4NYZA 4PG6A 1HNVB 3UFCX 4X84A 4X4VA 2YQ3A 3IR5B 1NB2A 4LF6J 4OYWA 4OMFG 5E3AA 4ATNA 3D66A 4OYMA 3I0SB 4FXDA 2Y0SD 3HHLB 3PM9A 4M5DB 3AJ1A 1NJWA 2V69A 2C3YA 2GHPA 4B3SJ 1RZMA 3OTBA 3F73A 2RILA 3DRPA 4A8FA 1R27B 4O4GB 2DNRA 3BGRB 1Y0HA 1UZDA 3RJMB 5IQQA 2FYXA 2XMMA 1WTBA 2EFPA 5LXYA 4TKTA 2RVJA 3C66A 3RRGA 3FSYA 2WVFA 5A0YA 3IGVA 1IKWB 3UN3A 5HQLA 2W7AA 1VYAA 3BO4A 4KT0C 3FK4A 3VAFA 2EBEA 1CS4B 5BYRA 2VF3A 2WSFC 2XGPA 3IM9A 2CPZA 2Q1LA 1XERA 3MI7X 4I6AA 1ITPA 4CO5A 2DHSA 2V68A 2ZH4A 2KDOA 1BQXA 2OUGA 3KG0A 6FD1A 3UN2A 2FHJD 1GX6A 3KLHB 3MMAA 4HVZA 3N28A 4JI8F 1K73T 1RHRB 3PTWA 1UWAA 3AOAA 3QIPB 3V81B 3WHIA 4RW6B 2MSSA 3I5AA 2C22A 1B7YB 4A48A 3THTA 2UUTA 3MM5B 4N77A 1LK7A 3QJPA 1B99A 1KLMB 2VJVA 5HMXA 4RUCA 2NUHA 3MM9A 4CYUB 4RL1A 4JI7F 4QPTA 3FZ2A 1S7HA 4PQAA 1G7CB 1FDAA 2Z58B 2C2ZB 1FEHA 2VBZA 5KFCA 2MY8A 4NLRA 1QVGR 1JK9B 3CJTA 1VRUB 2B6AB 2ZDOA 5LMUJ 3M8SA 2OJ3A 2VPYB 2ZD1B 4ED6A 3R6LB 3R1HA 2MSTA 1FVSA 2YWKA 4RNHA 2WOMA 3GYNA 1EB0A 3OFGA 4WIIA 2W25A 3LWMA 3ADAC 4NWBA 4CLFA 2OFHX 3PJ9A 2F65A 1JXVA 4DUZF 1JX4A 3PJXA 1U2FA 3AQOA 1GTHA 2HHTA 2AX0A 2VPXB 3CCMS 2KJWA 2NCKL 2RF2A 4FVCA 3GIMA 3R3TA 2IVYA 3GYGA 2CQ3A 4UOCA 2R8KA 3L7OA 3MTKA 1GTEA 1UZHA 2NYIA 3PYDA 4NYPA 1NU4A 1S0VA 5J2PB 3MXHP 5B0FA 4EZ9A 4B3OB 3KK3A 1HBNB 1BGXT 3HVAA 3D9BA 3TP2A 4KV8B 5KFJA 2A3JA 3ZZOA 1RBLA 4R0EA 4R25A 2WTFA 2XO7A 3P49B 4NASA 1HW8A 3ZZZA 4X65J 2BM1A 1NK0A 2HFSA 5D78A 2IM0A 4ZPCA 3ZTPA 3FC9A 3OJUA 3D2WA 1TR0A 4HKQA 2RDIA 3WQPA 3Q8UA 4O3NA 1F3FA 1EQMA 3G71S 2VBXA 1N5YB 3OTOJ 4WZQA 5HL7Q 3MOJB 2CRLA 2XG8A 1S10A 2CQ2A 3FSIA 4ZJQA 3FJ2A 1DURA 4USUA 5D6GA 2ZE2A 2IAJB 1ZM9A 2O66A 1MW7A 4Y6IA 4DMZA 2R8HA 2NPIA 3W60A 2B0GA 5B0AA 4G1PA 4BWMA 2JLEA 2EW9A 4ALZA 2ZEJA 3MAAA 3IS9A 2VONA 3MMCB 4PPZA 1JXLA 4F4ZA 5KFKA 3I0RB 1PCAA 3M9NB 3FBBA 2C3UA 2ZBPA 2Y9HA 1N54B 4O44B 4WK1A 4GO7X 2B4OA 3C14B 4EO8A 4IFVB 2H48B 4FF4A 4B9LA 1D8ZA 2FVRA 1B0PA 3AD7C 3PV8A 3G96A 4YHHF 2MQ8A 3KK1A 5F8LA 1FKPA 1JLCA 1X0FA 4F25A 2V4JA 2IA0A 3SIPB 4F26A 3AXMA 4Y28C 2VIHA 2NREA 4QWBA 4B9NA 3IRWP 4LR9A 4J9QA 1SCJB 3PXGa 3V6KA 4Y34A 2HQFA 4OZ5A 3LP2B 5EX0A 3G82B 2M8DB 1HLWA 2OPQB 2A18A 2XQCA 3TA0A 1FNMA 2C3MA 2BMBA 4LR8A 2FPHX 4OLOA 2BQ3A 5KG4A 4MTPA 4X4TA 1A0OB 4TVAB 4ZHRA 3I31A 3MM7A 5A8KB 3HX9A 4XTTA 1GH8A 1N5TA 4YS2A 1QJHA 1RT4A 2RS8A 1F5BA 3IWLA 4CCHA 4CH7A 4QWCA 2BJ7A 5IV3A 3PRVA 5HAOA 4OI3A 3F0NA 3PNIA 3UR3C 3PFOA 5CH7B 4CT9A 3FEYB 2WBMA 5BYSA 4NI2A 2HNZA 4AUKA 1CJKA 3N01A 5DJBA 3E3XA 4NCBA 1BQMA 5KG2A 5I3QA 3D0GE 1RTDA 1OWXA 1FF2A 3IS9B 3MMBA 4EWTA 4F4YA 1P9YA 3ISNC 4IDKB 2BDPA 3OLBA 1C1CB 2VG5A 4EUVA 3CCSS 2CQIA 1YZ6A 4FVMA 4AQYF 5C24A 2J0XA 3RR7A 3DI6B 1IM6A 1RTHB 1G3OA 3G86A 4PRFA 1YJ7A 2QG9B 4Y2AA 2OAUA 1T05A 2CPXA 1KOOA 1VQ9S 2YX4A 3A3PB 1VRTB 1HHQA 3AJ2A 1NPKA 2C2MB 2V50A 4MK9A 1Y9OA 3MDFA 4ZS6A 2KKHA 1RK8A 4WK3A 1IN0A 1R8CA 3C19A 2NS1B 5CYQA 5IS2A 3ISZA 1FDBA 2JZ5A 1VJQA 4CH1A 1HMVB 4IYQA 1SIWB 5L1IA 2ZH5A 4DPOA 2DBBA 5IQ6A 2CPFA 4FBTA 3AB4B 1Q8LA 1RWOB 2EFQA 2C2EA 3OUYA 1Q7LB 3N5FA 5DDOC 3PKMA 3H4DA 1KN6A 4F67A 1RWKB 3CJ2A 3TEHB 4AL5A 3HHKA 3JAMY 1AYEA 1VR6A 4DV7F 1NLKL 4M94A 4N7TA 4HH0A 1M5KC 4EBEA 5GAGU 1V5VA 5FIIA 4ZCLA 4DL3A 2V94A 3ELHA 4JI0J 3MAQA 1T7PA 1RUSA 4HHJA 2MZSA 1CULA 2MKKA 3GV5B 3AODA 3TYTA 1Q16B 3QZ8A 4Q8EA 1IJFB 4X4PA 3CPWR 4OI2A 2OTLS 1VQ8S 1Y00A 5K8OA 2FVQA 2FGOA 3PO4A 4URQU 2AJ2A 1WG1A 2VOPA 1Y5LB 4EU0A 5KFYA 3GSIA 3AD8C 5IXUA 1ZA2B 3QZ7A 2PA3A 2M3DA 1LEOA 1HIYA 1CC7A 1G4CA 1TU0B 3HMJG 4HI2A 3M30B 2DRDA 4YP3A 3VAHA 3MPYA 1D9AA 4O3RA 4RU9A 4F4KA 4L3KA 4CLLA 2R2TA 4BBYA 4L3NA 4LSZB 2BV3A 4AYBD 2ASJA 4RBUA 3SCJE 5AE3A 5KG0A 2QLFB 5DDRC 5F41A 2FZGB 1NPRA 1WKJA 3TO8A 1VQSA 2VPWB 5D77A 3THVA 3KHGA 2D3UA 2ZH2A 2AHOB 5A76A 4B3TF 2YPZA 3W8PA 5D3GB 2WW4A 3U1NA 1FERA 2F9DA 3VAJA 4R5PB 3JQMA 3Q2SC 4Q5VA 3D1HA 1T03B 5GAHU 1T0TV 2Q43A 2QFJA 4A8XA 4WBFA 2FHOB 2OD6A 1HBOA 2F3JA 4FZVA 2HHHJ 2RUSA 4G1QB 4F02A 2DISA 3HSJA 5K14B 1LW0B 3CJSA 3H4BA 1V3SA 2ZBCA 2FLPA 3S1TA 4PQUB 2E5HA 1R0AA 2I2YA 2KYXA 4Q7AA 1DTTB 1X9MA 2AYBA 4PZVA 3H8YA 2H5IB 2BE9B 3QO9B 2DIVA 4OX6A 1HPZB 3CIMA 2M8HA 4WFXA 1RT1B 5DGBA 2VOOA 1WF1A 1LWCB 3MUMP 3RB3A 2FZKB 1FWPA 1FD2A 2EG2A 4DPTA 5DG9A 4DV6F 3G87A 4OYZA 2F5GA 2Y1IA 1F9FA 1QSYA 4B3MJ 2CWKA 1SJ1A 3S8SA 4DFJA 3VHQA 3ZTOA 4DLEA 1NUEA 4WYWA 3HM9A 3IRXA 2AKWB 2GGPB 5LMNJ 1S7IA 4DX8H 1CQNA 1IKYB 2MZ1A 4M1KA 3MEDB 4C0OC 4F3OA 4HHUA 3P3DA 3WDOA 1RTZA 3DGPB 3PW5A 4DR3F 4U9RA 3IMQJ 2FQQB 4DU8A 3BSOA 4N8NA 3PACA 4NA1A 5C25B 4NA3A 3TZYA 5IC6B 3C3LA 1QAXA 4YR3A 4DCJB 2M88A 2RHQB 3CB4A 1J2VA 3C16B 4HDHA 2ZC4A 2JSXA 2BQUA 3SV3A 4EFAC 2A6MA 5E41A 1U2RA 4CIOA 2E9TA 4DUYF 3DOMA 3T1HF 1OY9A 1R0BG 3VGTA 1S49A 3W1YC 3R5BA 2H1YA 5BJRA 3GSDA 2VG6A 4YUDA 1XIQA 3JSYA 4WTOB 2FY8A 2F4FA 5EDWA 4E2FB 2FVSA 3CW2C 1TKXA 2YNGA 3F41A 2J76E 3MEEB 1NK8A 1E6YA 1WHYA 1OSCA 5E2QA 5LSRA 2E5LJ 3K7RA 4LF2A 3FEZA 4ERDA 4I2PB 2KT5A 3V6DB 4URSA 2KG0A 4P7TA 2IA6A 1T9TA 2MKSA 2CZ9A 5AXLA 1BC6A 6AT1B 2OPRB 1NNDA 3UVJB 4RUHA 4LF9J 3PZPA 1S1UB 3GU0A 5KT5A 5CXTA 1FK9B 3UE2A 1Q5YA 4Y2KA 4A8OA 2F1FA 3VTIA 4NXNF 5GMEA 1XTZA 3MMJA 4CO2A 5MLCV 2ZHAA 1X5PA 3IBFB 4JI8J 1S0MA 5E3PA 2C1EB 5H9EJ 2OD4A 1HHSA 2HIQA 1RT6A 1FFWB 4DL7A 2GA7A 3LA0A 3D6MB 5KFAA 2KFYA 4ICLA 2VL1A 3DLJA 1TFYA 3MEKA 3H25A 2I5JB 1RYRA 3JSMB 4H4OA 3Q86A 1UVJA 3KLFA 3UQSA 1MMDA 2M70A 3GFZA 2ZWOA 1MN9A 2IY5B 1TVRA 5HSPA 1SH0A 1L3VA 3EE3A 2EG1A 1VJWA 3G8QA 5L1LA 3POTB 2AT1B 3PX4A 1IWGA 2FC8A 3KOAA 1RI7A 1YVFA 5ETMA 2WONB 3N0VA 5KFOA 2ERRA 4ILMA 2ZH7A 2YWEA 4DZDA 1M90T 3LGNA 1NEEA 2QA4G 2DGQA 1D8YA 1HBMA 1S9GA 4IQMA 1X9SA 1R3NA 3P96A 1S6QA 3HJFA 3KLGB 2VUGA 5IZHA 1W2BR 1VQYA 2PFFB 3TRGA 4YN3B 3T5JA 2I0XA 2OMLA 3KLVA 2RJZA 2YNHA 2DIUA 2F9JA 4DUZJ 2WRMA 2AQ4A 4Q0BA 1SL1A 2R8IA 2RS2A 4TQSA 5AT1B 3L9ZA 5MAOA 4KFBB 3BREA 2CA9A 2EFVA 4K4ZA 4DR2F 4CDIA 3NOCA 2Q6CA 4J5OA 3QT5A 1RAGB 3OL9A 1N36F 4IOAQ 3CGIA 2XC9A 4NZ6A 3CCES 1D3WA 1DAXA 4RW4A 8AT1B 2W9AA 3NWRA 3AA8A 1SC6A 1CPZA 2BR0A 2IM1A 3B6BA 5C2CA 1VI7A 2CNOB 1KONA 2W2QP 3UDCA 3QJJA 2GQQA 3SEOA 3TJ8A 3TVZA 1V6HA 2QRRA 4HI1A 1IR1A 4DV0F 1YJNS 4I56A 3J7YU 2V5HG 3GQCA 1L3UA 1S4EA 3RTVA 2UZAA 3CD0A 3VR1A 2AV5A 3AAWB 5KFRA 3WIVA 4UOGA 2H51B 1FRJA 4C98A 1J5OA 1TZ0A 2CJAA 1JLBA 4USWA 1GX5A 3U1MA 2LLZA 1FNOA 4X4OA 1Q8IA 1SL2A 2V8VA 1QE1B 5C2GA 3D0HE 3CD6S 1G1XA 4OIXA 3GCWP 1KVKA 3H90A 1DY3A 5B0BA 4TY9A 2E9ZA 3DRRA 3HF5A 2ALYB 3QRQA 2IPOB 4DPYA 3DRYA 2MB0B 4IOBA 3IFEA 5I3UB 5K8MA 4YHHJ 4ZN1A 3HT3A 3M6XA 3T1YJ 4RWXA 3C46A 3DOLB 3BSAA 4RUAA 1S79A 3N4WA 2XZWA 3GONA 2DPIA 3OQ2A 2POKA 2PO4A 4ID5B 3ZFVA 3EM1A 4PG8A 4PR6A 2ZFHA 2YY3A 1ZOTA 3W2VA 1HR0F 2IVMA 3CF5Q 3DXSX 3B4DA 3PJWA 1HHTP 4O3OA 4Q2MA 3C15B 3PW0A 1FJGF 1OSDA 1S9FA 1IR0A 3CDAA 3UNYA 1B0TA 4BS2A 4BC9A 3SQGA 1XWLA 1FRIA 3I6PA 3KUEA 4KSEB 4KHMA 1NJYA 3Q8YA 3NBPA 4QIVA 4DN9A 2GV1A 1CJTB 5K5MA 1F0XA 5KG6A 1DARA 5A8WA 3KG4A 5E3QA 1C0UB 3H42A 5IC4B 1HWLA 4RWWA 3R1LA 1HNIB 1Q53A 4UUWA 1B4SA 2B8QA 3GV7B 2EC0A 3TZWA 1RLCL 2F8MA 5A6PA 5B0CA 1XMQF 5HROB 2W9BA 4QWDA 4J91A 2Z30B 3ISND 3ONQA 4CT8A 3BPDA 3THPA 3D5MA 1UKUA 4IUFA 5HI7A 1U25A 1MWZA 4R8UA 1UVKA 5GAEU 1S4FA 1JWWA 4IFYB 5CCMA 2XGQA 1WC5A 4X64F 2B7BB 2QL7B 4AQYJ 3KLEB 2DH9A 4PCQA 2ZJPQ 2KI2A 3RGIA 1KTQA 2QYCA 1RT5A 4DS5A 1HYSA 4U8VA 5BYQA 1C1BB 5U47A 2KH9A 4E8UA 2HRUA 2XMAA 2XCAA 4OI1A 2R7RA 3V4IB 7FD1A 1N34F 2RU9A 1HKAA 3K58A 4KKOA 1JB0C 4ZPAA 2W9CA 2BE2B 2UVWA 3OFFA 5KFWA 1TTHB 4DR7F 1G6BA 3U02A 3P45B 2KHDA 2QA2A 2N7YA 2LEPA 2DK2A 3NCQA 4M63A 4DX5A 2HQIA 3QYYA 2GW8A 4P74A 1RT7A 4WF9Q 5B09A 2JJ4D 2MQQA 2DGUA 2LDYA 2PT0A 2Z57B 4P2SA 4ECQA 2AIRB 4C8YA 1CJVA 5HK4A 3AHPA 3M7VA 4XK8C 3K0JA 1Q7YT 1S1TA 2VFVA 2MKYA 4DFKA 3O1LA 3DLBA 1KQGB 2EI5A 3GIIA 1UEVA 1UA0A 1U1MA 1OYEA 2VQEF 2VFSA 1R6YA 3M9MB 3TAMA 4KGVB 2GAGC 2K8GA 5KT2A 3MAHA 2OH2A 1GT8A 2KYZA 4NLXA 3C6UA 5D4PA 4DV7J 1BMQB 3CJKB 2R2RA 3FQLA 1SJQA 1Q95G 5K20B 1ZM2A 1QLNA 2UUCF 5HQ8A 1X31C 4ZOSA 4BCAA 4QIWD 2G2OA 4CWBA 2DY1A 1WOSA 5ETPA 3G6XA 4J9OA 2YNIB 4IG3A 4LT6A 3TJ9A 1REVB 2FB0A 4DR4F 3A12A 2XLJA 3DLGA 5FD1A 4C11A 3CJQA 3QT8A 4W92B 1EIYB 1N5SA 1JLAB 4M5MA 3MECA 3R7SB 5JVHQ 3KNGA 1RQ0A 2MQOA 1FRKA 5ETTA 2MQLA 1RADB 3W2WB 1YI2S 2B9EA 2C3OA 4ES1A 1B7FA 5EGYA 4RR5A 2FJVA 1K44A 1BLUA 1VBXA 3HT0A 4C8NA 4LQ3A 3JS9A 4F0KA 2NZ4A 5L1KA 3KLIA 4G6VB 1WJ9A 4RKUC 2XWYA 1RT2A 2QMUB 3DOKB 1ULRA 3NNHA 4N76A 3GG0A 4O3SA 2DH8A 3HP6A 1AW0A 2KN4A 1KDNA 2VA3A 4B3TJ 2W4CA 1Q8BA 2HKEA 4NXMF 2DR6A 1YRXA 2B4VA 5DM6Q 4CLZA 2J6UA 2NPFA 4ECSA 1FX2A 3S7RA 3PHTA 1RAAB 3J80U 5HMYA 1WC0A 3MGJA 4K2XA 1S97A 1UWBB 3DYAB 2KFZA 1U1QA 3SFUA 1IKVA 2DRBA 2H3EB 4TYAA 2HG4A 4FS2A 1KNZA 2HBRB 3AY0A 4H4MB 2HHQA 2WW8A 5HJXA 2ZC3A 3IBCB 1H38A 1I51B 4IG0B 1UMJA 3CJ0A 3ZTQA 4ES3A 2J0WA 2M5YA 2IDLA 4CO3A 2KT3A 4B17A 5KOWA 4X4SA 4L6V3 3MM8B 1T94A 4QQBA 4C8KA 5HP1A 3F56A 1XR5A 4Y2CA 2BKOA 2FLLA 3CDUA 2B8PA 1RAEB 4K7QA 2VBWA 3B4MA 3J7A1 2HQGA 3JSBA 4DV6J 4E98A 1NDCA 2B43A 2PEHA 3M2RA 5CAAA 1HBUA 3OL8A 5AXKA 4PXEA 2Z4PA 3K5LA 1S72S 1RTIA 2I1RA 3HJVA 1EP4A 4OHWA 3MR5A 1LKZA 2HHVA 4YFUA 3IAM9 4LRCA 2HYIB 2PD1A 2M4MA 1VC5A 1R8AA 1NK9A 2JX2A 3BF4A 2OHDA 4DR3J 2LQJA 2AZ1A 4ES2A 4MIBA 2ZH6A 4OL8A 4RW8A 1SBRA 4LMZA 1Z4UA 5CZXA 2J0SD 4A8YA 3H59A 3SSSA 1APSA 2HHUA 1FE4A 1RU1A 1S6PB 1Q81T 1U0HA 2HK3A 5HATA 3K59A 1IBLF 1WACA 2W7PA 3T1HJ 2ADCA 2DNMA 2FJDB 1NHKL 4AXJA 4Q2LA 1K47A 4XDDA 4ANCA 2KXNB 2B4PA 3VALA 5IT4A 3KYLA 3P6YC 3AA9A 4H4KC 2OPSB 3S01A 4YEAA 4C8MA 4I64A 3HO1A 3H5YA 3BS9A 2H4WB 1QUPA 4DQSA 5A8RA 5M2UA 1NPPA 3M2VB 2XWXA 3DM2A 1KP6A 1RU2A 2DR9A 2J9DE 2CQCA 3DLKB 3MD3A 3TR5A 4RU2A 2FJAB 4ELUA 3VAMA 4KO0A 3FEXB 2FHMA 4EYHB 3I32A 1UVNA 4LSNA 1N0UA 3OBIA 2HMIA 2L41A 4C8LA 3FRZA 4DL2A 2CVIA 3MCOA 1CG2A 2OI2A 2GVZB 3JQKA 3FCWA 4K4SA 3HVTA 2CQBA 2RDDA 4RNNA 1RAOA 4NXNJ 3DRXA 1FDDA 1KR4A 1YKWA 2IDEA 2V67A 3Q8VA 4OZ1A 3DHWC 1SQGA 1I6JA 2DNZA 2Z2ZA 5IFMA 4YMEA 4YY3F 3ILJA 4DU7A 2UXDF 2VD3A 2EWHA 2DGSA 3BH6B 2GCFA 3HCXA 3SDEB 3EVOA 2CPHA 3ZTSA 1TKTA 1X4CA 4WKRA 4DG1B 4P7VA 3J7AN 3BGOP 2HVEA 2F63A 3SCKE 4I4BA 4MYUA 5D8HB 4B9VA 1SXLA 1IBKF 1PYTA 4LQ9A 2W2NP 4ELTA 2P5VA 5B08A 3UW1A 1WOOA 4YB5A 3HSZA 2RDJA 1CC8A 2XHCA 3EGZA 5F3TA 1MROB 4HYKA 2H65B 2IJRA 4ZVPB 2YKMA 1N52B 3OL7A 4PXDA 4QWAA 2A2CA 3QLHA 2EEYA 3RYLA 2FLOA 2YPYA 5HJYA 1JLFA 2A0FB 1KVIA 2GO8A 1U26A 1E6VB 1AUSL 5SZTA 1SC4B 3IG1A 4OFZA 3LF0A 1Q78A 2HWIA 2ZDPA 4YB6A 1T9VA 1NJIT 1FT8A 1Q79A 1FDNA 1NB7A 2HBZB 4RW9A 1NH8A 1XN9A 2XSJB 4V1Ak 2ILZA 4K59A 2VC0A 4MFBA 3TEGA 2ZM6F 4OJ3A 2X1AA 3M32B 2D3OR 2MPUA 1LW2B 4DR2J 2VODA 1TELA 4PUOA 3EPGA 2IYGA 3JXOA 3I96A 1N36J 4QW9A 3A8EA 1P1LA 3RW7A 1RAHB 2YH0A 5ETOA 2E9RX 2R7UA 5GADI 3P5BP 3TNVA 4LSLA 4HR2A 4XPCA 1PJ7A 3S6EA 4EMDA 2OLWA 2H5EA 2KT2A 4ELVA 5B0DA 2HRYA 1B0VA 2WK4A 2X3GA 1JLEB 3B8HA 1JLGA 2YKQA 1S1WB 5D0RA 4O0NA 4C3KA 4Z7YA 1KQKA 2DJWA 4MMOA 4DV0J 3H2UB 1Y11A 2FTRA 4DX6A 1F3VA 4BHQA 3N6NA 3BZQA 2EKYA 4AXIA 1S1XB 1NHUA 4KAIA 2YKOA 1TL7B 3QJLA 2U2FA 5GMKa 5H1SV 5C42A 2WVEA 4LFAJ 4M5GA 4PG4A 4KPYA 3LW5C 3BO3A 1X5OA 1RXOB 1WSRA 4MKYA 4JI4F 4DF4A 1DJ0A 1XNRF 1SJRA 1K9MT 4A8KA 3BN4A 2ZVIA 1QSSA 4X4QA 2FDNA 5E3CA 4ZIWA 4G65A 1PJ6A 1YBAA 1TUVA 4DPWA 3HFKA 4L75A 3SMZA 1SV5B 3QGIA 2KL8A 5F8GA 3H2VE 2QA4S 3Q83A 4A8SA 4LVOP 3GJTB 4USIA 4O23A 3GG1A 1H74A 4EBDA 4MKBA 2QC3A 1HR0J 3HLUA 4ZITA 3ULHA 3W9HA 3CDEA 2BANA 1FJGJ 1M5PC 4WP8A 4V19X 4UF4A 3R5GA 4CLTA 5J2NA 4YR0A 1YQHA 1JKHB 2H5JB 3I55S 2DCUB 3BYPA 2ROPA 2DXEA 4BLGA 2IRXA 4C7QA 4HACA 3A13A 3MUTP 2MLXA 1NDKA 2CPYA 3LPYA 2HLUA 3CO9A 4FF3A 2AD9A 5G0RA 4QPXA 2XHWA 7AT1B 2EBGA 2ZWPA 1KHVA 1EKRA 3T5LA 5C5JA 4F0HA 1NKEA 1AUDA 1XMQJ 4JOUA 2GVDA 3BSNA 1NZ8A 3D6HB 1JJHA 2RIJA 1HQEA 3MR3A 1Q8KA 1AZSB 2YQ0A 3CEDA 2COLA 5LJ3Y 3LP0B 2JEGA 3NS5A 2XMKA 3M2UA 4X64J 3ILIA 1CLFA 5ETQA 2YKAA 5H9FK 3ET6A 2RRNA 3UNGC 4UY8T 4NEYA 1LWEB 2GIRA 3BV8A 2WAQD 3Q23A 4N8OA 3NY0A 4O3QA 2FD2A 2R7QA 2RD5C 1P8GA 1ZYQA 1N34J 4I7FA 2E7WA 4NZ7A 1O6XA 1TKZA 3DLEB 5EWGA 2R7XA 2MDAA 5AE2A 1D0EA 2CVEA 4OX9F 4P6QA 3RG6A 4PYDA 4DR7J 3D3BJ 4UY85 2VDHA 3ITHB 3DMJA 2MZRA 5EWFA 2AWZA 4PWUA 4JI3F 2MGZA 3M8PB 2GJIA 4DR1F 2J6SA 1LQ9A 5JJBA 2G1DA 3JYTB 4TLRA 3T19A 1HNVA 1N8RT 3PO5A 4O3PA 3CSKA 2RB7A 4KGKA 4PXBA 2WBRA 1IR2A 4NEZA 3OV7A 4MIAA 2JLFA 3I0SA 4Q45A 2HPUA 4YDDB 1VGYA 4JV2A 3HHLA 4M5DA 4K4TA 1NZAA 5AXNA 4O4GA 3BGRA 2APOA 3ILLA 1U1KA 2HNYB 3KXDA 3NXZA 1T9WA 3K5NA 4CLYA 2DNYA 3QFWA 2DR5A 2ZITA 1VLYA 1IKWA 2VQEJ 3WC2A 2PMHA 5K9FA 1SIZA 5D0EA 4ID8A 4RBVA 5HBMB 3W66A 1CS4A 4PWWA 3FVYA 2VKRA 2ZH8A 2IM2A 4YB7A 2DO4A 4F04B 4ECZA 4B9TA 5FDLB 3KUHA 5JXSA 3I4PA 3L09A 1MN7A 5JUMA 1QDUB 1TL3B 2XYHB 3E01B 3ENVA 3MF5A 3NNCA 2X51A 1TV6B 2MTLA 1C2PA 3KLHA 2XMWA 1YJWS 1VRQC 1TL5A 5ETVA 2YWGA 2NZCA 4KC5A 3T6BA 4DR4J 3QIPA 3V81A 1H2TZ 4CLKA 3M8QB 1VQ4S 2MKIA 5J2QB 4RW6A 2MKHA 3AT1B 3PYFA 2HZAA 1KKHA 2EPIA 5DETA 1H6KX 3MM5A 1RAIB 2DITA 4ZVRB 1DLOB 2HGLA 4PEOA 2A2DA 1KLMA 3KJQB 2HQ3A 2BKPA 1F2HA 4CYUA 4GC6A 4QCLA 4WU3A 1EETB 4LBIA 4CO4A 2F40A 3MM6B 1FI4A 1IUJA 3KJVB 1VRUA 2B6AA 2V2QA 2DEIA 3M1VB 4OZJA 3LANA 1KFDA 3GZ7A 2NXUA 2ZD1A 4XDCA 1D9DA 2V2KA 1MWYA 4NXMJ 1HNWF 5D4NA 1X4HA 2OGUA 2ZUAA 4FPRA 3U27A 3F44A 3MCMA 3HHLD 4ZPTR 2PA8D 2CQHA 1W25A 3LH2S 3IR7B 3OXLA 5F0UA 1YTYA 3NRBA 2UUWA 1EARA 1R6VA 3NS7B 2ATCB 3J80Y 1X4GA 1RYSA 1FWLA 2CPDA 4ED4A 2ALZA 3UN5A 2HNDB 5J2PA 4ECRA 5D4LA 5B0GA 5DO2A 1OYDA 4B3OA 2F4VF 5L9XA 2GMHA 1HBNA 4C48A 7FDRA 5ETSA 2CG4A 2NUUG 2PDAA 4KV8A 3OR2B 1XMOF 1S9EB 3DU6A 2KXHA 5F8MA 5DLGA 1HW9A 4QIFA 2AMCB 4Y2IA 2BACA 1Y10A 2W2MP 4ZPBA 1HNXF 1UJ5A 4F50A 1FCAA 4DLGA 4OX8A 4X4UA 1VS3A 3CC7S 2K1RB 4C97A 2HQCA 2RSQA 3R6GB 2Y1RI 3IWNC 4ZA1A 4LF4F 3GYXB 5D4OA 1RKIA 2GC8A 1YIJS 1TUGB 5H9FJ 1N5YA 4RW7B 1AFJA 3OR1B 4DEZA 1S77D 3GIKA 3HHDA 4DSJA 1VQMS 3KKFA 1Q5VA 4U7CA 3EZOA 3T9NA 3SYZA 2ASYA 1UTAA 4DBQA 1FXLA 2IAJA 3RB0A 1GXUA 5E7OB 2AW0A 2HS4A 2OPPB 4WTYA 1NK6A 3MMCA 3W64A 4M5NA 4ENOA 3DRSB 1REGX 3CE8A 2LECA 3I0RA 4CM0A 2O3DA 2WB4A 4MT1A 4O44A 1GMWD 2FY1A 3C14A 2UU9F 2VC1A 3RU0A 4IFVA 3DDIA 3R5DA 4LIRA 1IBLJ 5ADZA 2R8JA 5KT7A 2DGTA 4KRWA 4FS1A 3GCXP 1X5TA 3SFGA 1F5CA 1L3KA 1RA7A 1N32F 1F5AA 1ICEB 2NXJA 4ANDA 4KQZA 2X1FA 2Z56B 4MKVA 2HBQB 3OW2R 5KFDA 2ASDA 4OX7A 2WVCA 1EZZB 2RQ4A 5BR8F 4J9LA 2HK2A 4DV2F 1XC9A 1UFKA 3GB0A 5I42B 2OKQA 4CQ1A 3SSQA 3R27A 1VBZA 1XR7A 3LP2A 3G82A 1IQZA 2K7KA 4NLSA 2OPQA 3DU5A 2G2ZA 4DQRA 3D7SB 5KAKA 5CYMB 3DC2A 2C2DA 4DV1F 2BJ8A 3Q24A 1TKDA 5CD4H 2ABYA 2QGFB 4NLWA 4WE1B 4GKJF 5A8KA 2OELA 1UCNA 2CQ1A 3BYRA 4GVBB 2CJKA 3PEHA 2XMTA 3MEGB 3RB4A 5KG7A 2CIMA 1PAEX 4YY3J 2ATLA 4ZVOB 2UXDJ 3OD2A 1HI1A 4OZLA 3MWBA 3SV4A 3AFGA 2VKZG 1BWVA 3TUIC 5SUHA 5ITHA 4IDKA 2VG7B 2XCPA 3LP1B 2NLWA 1K1SA 1C1CA 1N6QB 1TP7A 5B7WA 4JB8B 3FKBA 2Q66A 2B7CB 1IBKJ 2MZJA 5A2QU 4TU9A 2AGPA 1SKWA 3DI6A 1P1TA 1FFGB 2C2KB 1RTHA 3G8SA 4FF1A 4ECYA 4ANEA 1Y4ZB 2ZBRA 4J9MA 2HAFA 3RBDA 1XEZA 4FXVA 4C0HA 4ZCIA 1ZZFA 1VRTA 1SJ3P 3EYZA 1UPMB 2YX1A 1FFSB 1RWMB 2N4CA 4LJMA 1DTQB 3CCWA 5LOQA 4HEA9 1FXDA 5GAHI 1NMEB 3CD7A 3DN9A 3LPEA 1CJUB 4NMXA 3KMQA 3BBFA 3D1QA 2V9WA 2P2CB 3MPWA 1WEXA 2YNFB 3HHEA 1J27A 1V3RA 2ZM6J 4OJGA 2V2VA 4QIEA 2W4PA 1XNQF 1HMVA 3IA0A 1HWIA 2LXUA 4ZMMA 3IXQA 1B3TA 3PIPQ 2BOPA 3NP5A 3K5OA 4KH1B 2FC9A 4DV3F 1NKCA 2V4QA 2PIIA 4NLVA 5EX3A 2DGWA 1RP5A 2RKIB 5KT3A 2HFVA 2FVCA 4P71A 3UDLA 1R43A 3M6UA 2ACYA 1C0TB 1YJUA 2LYVA 1XR6A 4L74A 3PYEA 2LP4A 4QYZK 3AJDA 2J9DA 2BW2A 4CP5A 1WNEA 2CADA 4IRCA 2C3PA 4OYOA 4OYPA 3ZO7A 2DKOB 1C4CA 5DDQC 4X4NA 4C3MA 3TAPA 2BE7D 1UFLA 1WC1A 3H98A 3I4HX 1CBKA 2KVQE 2DHAA 2AJFE 4FYXB 4JV5J 2YKNB 1VISA 1VK8A 2ZZMA 2EFGA 3P4UB 1ZTTA 3W3SA 1LOUA 1VQKS 4QR1A 1YJVA 2AYEA 3EXCX 2PC6A 1UW9A 1GXLA 3CMES 5DQIA 3CCLS 2OTJS 1GAOA 1Y5IB 4JI4J 4P52A 1XNRJ 2JOQA 1U8SA 4GC7A 4RLEA 1RT3B 5KFEA 1FRXA 3ZXWA 2FJBB 2JC0A 1WELA 1PC4A 5F8JA 1XJWB 2IJNA 3PR4A 1WI6A 2G2YA 4EK2A 4MKAA 3OTEA 2OEMA 3SQOP 3M30A 1PAUB 1T11A 2KTQA 3TOQA 1EJ7L 4Y00A 3CXCR 4K2JA 1RHQB 4PYAA 4MK8A 1UFWA 3OTCA 2HIYA 4CNZA 4X62F 2Y8WA 4WP3A 2AJ0A 9ATCB 1EKSA 2J9CA 5KFZA 2DHXA 2L3MA 2O1PA 1VLOA 2WVDA 2HFOA 2LA6A 2V2ZA 4ZVHA 1PYSB 3VAGA 2X1GA 3WX8A 1X5SA 5D3GA 4R5PA 2CDRB 2VFUA 1T03A 2Z0GA 3PW2A 1UAWA 5HO4A 1WKKA 3KWMA 2HS0A 1JIHA 3UDVA 4ZJOA 2HGMA 3K5PA 4G1QA 4WCEQ 1LWXA 5K14A 2ZOFA 1LW0A 1UJ6A 1YBTA 4DXLA 1BHNA 2LEBA 4PQUA 2DGVA 4B9SA 1EQ0A 1SB6A 3KK2B 4KYZA 1NAQA 1DTTA 3LTOA 4J90A 3M6WA 2W2PP 2GQCA 4FKYA 4TY8B 1BE4A 3QO9A 3EWGA 3PX6A 2DNLA 4FXWA 1SJ4P 5F8NA 1HPZA 3VZIA 1RT1A 4MJKA 2OMOA 3TWZA 3GJQB 3C6TB 2DRAA 1LWCA 4KJIA 2JH3A 3UD5A 2JEFA 2FUG9 3ZZTA 4IO9Q 2FHKA 2MKJA 2LU1A 3TJAA 1SUQB 1WHXA 5J1EB 5KFGA 2OIHA 4RPFA 3O5TB 4I68A 2VH7A 3CNQP 2M0GB 3LAMA 1WC6A 3O8WA 1HWUA 3SXLA 2RHSB 2QSWA 1YK9A 2GGPA 5EHHA 1M1HA 1YLXA 2I8EA 4IR9A 1VQNS 1MU2B 2PEBA 3CJ3A 1IKYA 1FWKA 3MEDA 2QMXA 3GJRB 3DGPA 2K2PA 2PGCA 4J9UE 4IRKA 3UD4P 3OSNA 2AGQA 5DG7A 4DDFA 4KHPJ 2KJVA 1NSPA 2GAHC 1YJTA 4OZNA 5C25A 1RCXB 4JI3J 2IC3B 1HQUB 4DR1J 2DT9A 4WU2A 2EXUA 4ED2A 3ZZ0A 3C16A 4DQQA 3UD3P 2DR8A 1FA0A 2XS2A 2DNOA 4WIQA 4LF5F 2W01A 5T7LB 1YDLA 1ZTWA 1GFWB 1UP1A 4OHXA 1NK4A 2KXFA 1NO8A 2AP6A 3TANA 3CCJS 1S6OA 4XIUA 2IRYA 3R5AA 1S1VB 3OFHA 2Y0BB 4NLOA 2CJXB 1P6TA 5J2MB 4G3IA 3MEEA 2HGNA 2XNRA 1R7IA 3EUNA 3ICLA 4DSLA 3KDOA 4I2PA 1BUXA 1RE1B 2VB6A 3D68A 2Z2MA 3V6DA 4K0KF 4OYIA 3CWJA 4FYWB 3J7YI 1SL0A 2OPRA 3UVJA 1S1UA 1U0SA 1FK9A 2W1BA 2DNKA 3SSRA 2MXYA 1SVDA 2KU7A 2PMZD 1FKOA 1R8PA 5KFIA 4URGA 1LWFB 2N7CA 1VQ5S 4JV1A 4AE5A 1Y3JA 3W5YA 2Q6BA 4I6WA 3HZGA 3NWGA 4AFFA 1HNZJ 2XZTB 5HMWA 3OJSA 5IM0B 4F3MA 4F8RA 1S76D 4JI1F 2I5JA 3JSMA 4QBUA 5DQGA 4FKXA 4CLUA 4LF7F 1KQSR 5GADU 5ETRA 3ZC4A 2Z2LA 1K8AT 3GR1A 3PRDA 4FN5A 2ZKTA 1O51A 3R5JB 4LFBF 1CEZA 1B70B 4A4JA 3J81j 4OZ0A 2ZHOA 4MYTA 1U09A 2R42A 3POTA 3W62A 3M8RA 4GKKF 3CT9A 4WFAQ 2WHOA 1RBAA 1RKJA 3FQKA 1PKUA 4K4XA 3M9OB 4RNOA 1YZ7A 3QBCA 3MR6A 2WONA 1HI0P 4PG5A 3EZ5A 1VDHA 3TZXA 4ZVFA 3IGNA 4ED1A 3EDQB 2BYCA 3BBCA 3QFHA 3QMQA 4ZLLA 4MIWA 3Q8RB 5I3PA 3KLGA 1GQEA 1RWWB 4DS4A 2CQ0A 1HNWJ 1WHWA 3EZUA 2D1CA 4OV1A 1RISA 2JLGA 3GFXA 2FVPA 5T41A 4WYLA 3R97A 2E5IA 3BH7B 2G4BA 4NMLA 1TL1B 1X0PA 2QX0A 4KGZB 2MJUA 2JFDA 5KG5A 1PIEA 4P72A 2E1CA 5HLFA 1GXTA 4KFBA 3EVMA 1YGYA 3LO3A 4P10A 1JLQB 2WB1D 1IKXB 2RAQA 1RTJB 4CTAB 3QGGA 3FFIB 1H0HB 1FKOB 3NGRA 3OVAA 5CHCB 4DSEA 4PWDB 3OPKA 3FGVA 1P9QC 4DZ6A 4ZN3A 1BQNB 2XBPA 1RWXB 2F4VJ 1PSDA 3BKFA 5IT9U 2CJBA 3KFWX 1XMOJ 3VV2B 3WC0A 2EK1A 3TX8A 4K50A 3KUGA 2XY6A 3J7ZT 5GAEI 1X4BA 2DHHA 2I9SA 5L39A 1HNXJ 3GMGA 3EMTA 3G2XA 1HWKA 3UWTA 4TU7A 1KSPA 2E5LF 2O01C 3OVSA 4OI4A 1VC0A 2MQPA 4DOZA 2QIFA 4LF4J 2DHGA 4JI7J 1WDDA 1RDRA 4M5IA 1DBDA 2B5JB 2XMUA 2E5GA 4A8MP 4I2QB 2PN6A 4WP9A 3MTJA 4LF9F 3QT7A 4C8OA 3J7Z5 2V8GA 1U2CA 5DDPC 3I87A 3H5XA 1RB0A 4UT4A 2ZHBA 3UR0A 3QSIA 3H7HB 1VCTA 3BQ0A 4JYAF 1N88A 1S57A 1JJ2R 5ETLA 3ZZYA 1QY7A 3A1YG 3EXYA 2ZJQQ 2UXBF 2HZVA 4OQJA 1QE1A 1TK5A 1ZM4A 5CA5A 3TUJC 1N56A 2IJFA 4J9NA 1SQEA 4TQRA 4Q8FA 2UU9J 3EX7B 1ACMB 2ZOGA 1AA1B 4ED5A 5HLFB 4ZCKA 4NLUA 1RGVA 4ECWA 3LQVA 4I67A 5I3UA 2LU2A 4F0MA 2NSBA 4V19J 1N32J 1PO6A 2GIQA 1TK8A 4FP9A 2UVUA 3KTQA 3DOLA 3ENWA 2X1BA 4LF1A 4QZVB 2E66A 2X7IA 3TVKA 2BA9A 3H0PA 1FTRA 2J6TA 5BXIA 5AE1A 1U7LA 3DRPB 4ID5A 4DCOB 5BR8J 3NGSA 2CXEA 4DV2J 2HFUA 2JVRA 1T95A 4J9RA 4RO0A 3H5UA 3DCAA 5A0YB 2KB2A 3C15A 2PMWA 4JP8A 4DPXA 2UUBF 3R8YA 4J9VA 2CYYA 1F2GA 3I56S 4DV1J 1TMJA 3DXBA 2L9NA 2LXFA 1CJTA 4DQIA 4U7UD 5THWA 3UDEA 1WKLA 4GKJJ 1UVIA 3O44A 3D4JA 3MPUB 1C0UA 3JQJA 5KFPA 5A6WA 1HNIA 1KFSA 2ADBA 3CVKA 3T41A 1YHQS 3MMAB 2DGOA 4QWEA 3G6VA 2HURA 5HROA 1WD6A 3Q0AA 2BJ3A 4XO0A 2RQKA 1F60B 2N3OA 4X2BA 4C2MA 1U1OA 4ZP7A 4EO6A 1RHKB 1IBMF 2J7WA 2YXLA 4IFYA 4ZP9A 2M52A 4DL4A 2JNJA 2W4DA 1WI8A 2XLKA 4FPIA 1TL4A 3MR2A 3KLEA 2RE1A 3EGWB 3LAKA 3MM9B 3NGDA 4YOEA 1LK5A 4N5SA 1C1BA 2OSRA 1DZ5A 5A2QY 2QE5A 3K89A 3TQ1A 1RSCA 1QAJA 3HULA 3V4IA 2QMWA 4B3RF 3T5KA 2R7WA 1EX8A 1YG0A 1IWAA 2W2OP 4LFCF 2BE2A 4DHVA 2VJUA 3FZBA 4UW2A 2WOMB 3GLJA 4ED7A 3QSYB 3RZAA 3GR0A 1NSKL 5HQMA 1SI9A 4ITSA 1BXNA 2W24A 4OZ3A 2LEAA 3FMWA 3W8GA 4HHHA 2MKCA 3L7UA 3RBXA 1XNQJ 5KFLA 1RABB 1FX4A 2RF2B 4NCGA 4DV3J 5LXRA 1RBOB 1IBCB 3GILA 1X4FA 1ZM3A 3T1YF 2L9WA 2AEMA 4RNMA 3NMRA 2ZNYA 2SXLA 3TVYA 4NYOA 1SKSA 3TZZA 1R8BA 4M8LA 1WC4A 1W7WA 5LM7E 2CKWA 3KK3B 4ZLPA 5KFNA 2NQPA 4EGLA 2JEJA 1H3DA 2R2SA 2UXCF 2Q79A 4WPAA 2QN6B 3BR9A 3QAEA 3AQPA 1GEHA 3HVWA 3D6FB 3ENAA 1U1LA 3CJKA 3M8ZA 3GIJA 3G6ES 1VMBA 2HBYB 4DSFA 1OQ3A 2AGOA 2MY7A 1OO0B 4D3GA 1DQ8A 3KMSA 3AH6A 3CUNA 2YNIA 1Q0NA 1X4EA 2GMJA 4RZRA 1REVA 2BKNA 3FCHA 3OLAA 1PJ5A 3BPSP 1YJRA 2ZE2B 3CCQS 4QU7A 2AYMA 1JLAA 5T14A 2MEWA 4DI6A 4F7VA 3MAAB 3W2WA 3BQ1A 4KY3A 2IBOA 1U48A 2FLNA 4DR6F 3FUYA 1NK7A 3N6MA 5HN0A 3RRHA 1H7XA 3R7BB 1F1BB 3A4TA 2QJ3A 4NCGB 3BDEA 2VQFF 1UEUA 5LJ5Y 6FDRA 1TUWA 4X62J 4YDXA 5ETKA 3T9ZA 5HMZA 1MG7A 4Y65A 1UVLA 2DCLA 1B64A 3KK1B 1FXRA 3GTYX 1FKPB 3DOKA 1JLCB 2V4JB 4PKDB 3A3NB 4J37A 3TW0A 1JNZB 5K8PA 1F9HA 3LGHA 1H72C 1YITS 2CJ9A 3CCZA 2G0CA 4TYBA 3EDRB 2WSCC 4N41A 5EN1A 4Y0FA 4P2MA 2VFRA 4A8QA 4DF8A 3BDPA 4KGMA 4HTJA 2WSEC 1NDLA 3QT6A 4C4WA 3VGSA 3KHLA 1UWBA 3DYAA 1XK8A 4LVNP 3BB5A 4WKYA 1NDPA 3T3FA 3RAXA 1X9WA 4DR5F 3D3CJ 3V6HA 3M6VA 1Q86T 2LMIA 1ELOA 4H4MA 3ETOA 2V8HA 2DNNA 2E7XA 3B82A 4DX7A 4UQTA 4IG0A 4ZHRB 1C4AA 3MM7B 1FRHA 4WXOA 2KZMA 1IXKA 1U1RA 2JWNA 2D41A 3JTOA 2E29A 4B02A 4U95A 1UW4A 1S6UA 1RT4B 3W65A 3K5MA 3MM8A 2CJQA 1OMSA 1O5JA 4NI2B 2IRUA 5JVGQ 2HNZB 1CJKB 1BQMB 4JI2F 1RTDB 2RNEA 1IQTA 2AJQA 3MMBB 1W2IA 2M2BA 4F2SA 4ER8A 4C6AA 1QAIA 4ZVSB 4PABA 1L3TA 3A8KA 4F2RA 4ZVQB 4HH1A 2VG5B 1WEYA 4J9SA 2QEXS 4USTA 1NJZA 2A6OA 2MZTA 5KFHA 2ILYA 3I9V9 5C24B 3L4BC 2EKNA 4ZLJA 3VGVA 4NLYA 4FDFA 4WZMA 1ZAWA 3B78A 1GNKA 2UV8A 2MJNA 2H54B 1T05B 5H9EK 2BEFA 1N33F 3CJ5A 2O67A 2RRBA 1JQGA 1X7VA 3BBBA 3Q8PB 5M2PA 3I5CA 4QIGA 2W7OA 1VK3A 2DVIA 3E8OA 3DLLQ 2YWHA 2D3ZA 1VQPS 2GZOA 3NOGA 3O2IA 3RAMA 3VWSA 1FJEB 4RJVA 4QR0A 1AFIA 1GK8A 4S0MA 1S6PA 2UUAF 1FRLA 2CG8A 3QNWB 4KGXB 5CYJA 3EVWA 4LF5J 1TFWA 1Z2LA 4DUTA 5CYQB 5RUBA 4RUBA 2KM8C 2FZCB 2HRTA 2V4RA 1FVQA 2DB1A 1ZH5A 1OQ6A 4DPUA 2NYHA 1UEKA 2OPSA 2QTWA 3KNAA 2LQ9A 2VICA 4QR2A 2ZZNA 5E33A 2V8PA 5KFFA 3OUYB 3M2VA 2R9LA 8RUCA 4QJVA 3KDNA 4OI0A 3DLKA 3JB9k 3K8VA 3V2UC 3SCIE 2PSZA 1BWEA 5EUHA 4K0KJ 2B51A 5E3RA 4ECVA 2E1MC 3CCTA 2QO3A 3EICA 4Q43A 2ZH1A 2OP5A 5F0WA 3ZNJ1 4USMA 1MMNA 2GVZA 4WFBQ 2HWTA 2DR7A 3HSGA 1SH2A 2XSFA 2XLIA 4WWSA 1N48A 5AXMA 3LUYA 5J1PA 2KO1A 4NLPA 4F4AA 3BJYA 4ZDNA 1CULB 1JNRB 3NG8A 4FBUA 1FESA 2QLXA 1EHWA 3V5RA 4UZBA 2VU5A 5DQHA 1U4BA 1NSAA 4JI1J 3SDEA 3FBCA 4GRSA 3N79A 2CQPA 3NGKA 4DG1A 2BZ2A 5CQGA 4LF7J 4K8RA 3L95X 1LXJA 2B9WA 3VCDA 3CJ4A 4LFBJ 2M9KA 2L08A 3W61A 1QVFR 2QT7A 3K17A 4PG7A 4USHA 1QSLA 4GKKJ 3LOUA 3CJRA 2J0QD 4NLGA 1OY8A 4DUYJ 4ETXA 5D0GA 4H54A 5DS7A 1MROA 4G1IA 2HHSA 4NOHA 3I82A 2RUGA 4IOCQ 2MLZA 3NCRA 1JJ4A 4DV4F 1T9UA 1CVJA 3HKWA 3GPAA 4JI5F 3UCZP 1E6VA 2ZNZA 3HFVA 1U02A 4ED8A 3IP0A 4C8ZA 3BEGB 2HVZA 2HVDA 1UJ4A 2JFKA 2CNLB 1Y7PA 5CZVA 2Y1JA 2YWWA 2OEKA 1I94F 2XSJA 3TI0A 4U96A 3HKZD 1GMVA 3ZZPA 4FYVB 3CULA 2BJ9A 1NRKA 2XMJA 2H9ZA 3M32A 1HBOB 1YSJA 4M5HA 4LUBA 2XEXA 1LW2A 5KFXA 3US5A 1WF2A 2CZ4A 1U24A 2FGCA 3P8BB 4CLSA 3DLHA 1D1UA 3DDNA 4MH8A 1R0AB 1T9YA 2CPEA 2WCXA 3H2LA 1Z2ZA 2J7KA 2C42A 4RNFA 4L76A 1M5OC 3PCOB 2R7VA 1Q82T 1A7GE 4IH5A 1KBRA 3LGMA 1JLEA 3T5HA 4OJ1A 4RBTA 5IWAF 5IT9Y 1S1WA 2XNQA 4IO1A 2E1AA 2YBVA 4ZJLA 4FNHA 3HI9A 2MHNA 3D1OA 3DNCA 4Y2MA 4CLPA 2VFTA 2EFNA 2ZOMA 3GP9A 1HWJA 3FBFA 5KG1A 1O8BA 5L9NA 1R0CB 2BRKA 1S1XA 3IRXB 1SC1B 1IM4A 1KD1T 4LRFA 1TL7A 5LSLA 2YKPA 1J5EF 4JYAJ 2LQ5A 1P27B 2R2UA 2XS5A 1H2UX 2JDJA 1VHIA 3ETMA 4ZPWR 4UTGA 2UXBJ 4N47A 3CMQA 2HFZA 3V4MA 3QATA 4XAKA 1JJCB 4ECXA 3D67A 4U67Q 3PVXA 1M5VC 3JTNA 1A6LA 2EK6A 2JVOA 4L72B 4USKA 1A9NB 5GVQA 4ILLA 2QA1A 1F9EB 3DFEA 2GJ2A 1SV5A 3OL6A 2ROEA 2JL9A 3IM8A 1ZBTA 2IIHA 3DOMB 3N9UC 3TAQA 4M5LA 3RBZA 1K1QA 1ZPWX 4OHZA 4ETZA 2VG6B 2DO0A 3AB2B 2I38A 5KFTA 1TKXB 3MCNA 3VAIA 4ZVEA 2YNGB 2B3TB 3OSPA 2G0JA 2CQDA 1RJJA 1VQOS 1S48A 3UCUP 1HL6A 2UUBJ 1E6YB 2BVZA 4CM2A 1WUUA 2MQMA 1JKHA 1WTFA 1RAJA 5J1NA 2DGXA 4P75A 1FJ7A 4TN2A 1UL3A 3TARA 4Z37A 3FCVA 1SQFA 1XMBA 1X8DA 2GJFA 1NXIA 1R31A 1LV5A 2X3DA 2FJXA 4K4VA 1WG4A 1NH7A 4DCPB 4JI6F 2BRLA 3GFYA 2KHCA 1LFPA 3M4XA 3A8IA 2R4FA 4F4XA 4LF8F 1KRPA 3M05A 1V5IB 2RQMA 4F36A 4ZP8A 1RT6B 1R89A 3PHEA 4J9PA 2ROGA 2PI5A 3HK2A 4K4UA 3DKDA 4OI6A 2C28A 4KBIA 3N5BA 4U8YA 4ICLB 1AZSA 4Z2XA 4XPEA 4H4OB 3LP0A 3PEJA 1IBMJ 3QRPA 3KLFB 4HT5A 2XMVA 3U1LA 2B4UA 3R9LA 1TVRB 1FKAF 1LWEA 4WJBA 2LVWA 3AD9C 3W5XA 2GHVC 1UETA 2R7OA 5LSOA 3RBEA 5F3ZA 3HDSA 4X66F 2GS8A 4LBPA 5CABA 2XB2D 4CNYA 2ZVSA 3BKTA 1CQMA 4B3RJ 3DLEA 3FSXA 3MFIA 2BABA 2Z2YB 4LFCJ 4HTIA 4K5SA 3OHAA 2HW3A 2RU3A 2YH1A 2L48A 3CIZA 1N0VC 3ITHA 3CC4S 1HBMB 1S9GB 3EJMA 1QD1A 2QLJB 1S6QB 5DRKA 4LFAF 2H4YB 1VQ6S 4LBHA 1NSQA 3M8PA 2IHR1 3IO1A 4CO1A 3JYTA 2YNHB 2BBEA 2HAIA 5HVHA 1QM9A 3PY8A 4Q0BB 3C8YA 5KFSA 3ILOA 2K7JA 1OJ4A 4KH0B 3QGHA 3HVRA 2QFIA 2R3VA 4ZK7M 1AXQA 3AOCA 2XTJP 3DDKA 1RHJB 2RRAA 5CCLA 2ZJRQ 2C2NA 1MLAA 2OEJA 1T3OA 4YB1P 1SJFA 3VZHA 4OJHA 2HNYA 2MYFA 5G4DA 5HVFA 4ZKAA 3NL0A 4M5JA 1AROP 2F7VA 1N4LA 2M7SA 3RW6A 3PW4A 2UXCJ 4RW4B 3UPFA 2E44A 1U45A 5HBMA 4J9KA 1U6BA 3BKUA 4OYXA 1MNEA 4NX9A 4ZVGA 1HI8A 1Y3KA 3I9ZA 2R7TA 2OO4A 4WFYA 5FDLA 2GMLA 3PYGA 5IT0A 2V63A 3N6LA 1KWMA 3A3OB 2IM3A 3RRKA 1TL3A 3E01A 2A1BA 5KTQA 2LKZA 4ZLNA 2ASLA 2HS3A 2XY5A 4O4RA 1TV6A 5KT4A 4DL0C 5F9NA 4PXCA 3HHNB 1QUVA 2WVBA 3G6YA 4DSIA 1KLNA 3FMBA 4JV0A 3MFHA 3OVBA 3M8QA 5J2QA 3R7NB 1VOMA 1J5OB 3FBEA 1JLBB 1CSJA 1DLOA 1PG5B 3D28A 3QAUA 1XBWA 1YBUA 1QTNB 1MWQA 1SC3B 4DFPA 4OZ2A 4DR6J 2BW7A 2HSEB 4NL5A 2CNNB 3RR8A 3X1LB 2DPJA 4AL7A 3G9CA 3DRRB 1H2VZ 1EETA 1LNQA 2VQFJ 5DGAA 1Z1ZA 3MM6A 3HFZB 3EPIA 4KR0B 1VQ7S 2UVRA 3KJVA 2HHPA 3CC2S 3M1VA 3BR8A 3HSDA 4MK7A 4EBCA 3TX0A 2IBKA 5IV4A 5FLXU 5DG8A 2N82B 4EI2A 5FJ4A 3OXGA 3IAS9 3W2VB 3CCUS 3LALA 2B56A 3WBZA 4DSKA 3NAHA 3M8YA 2G9OA 3PW7A 1YJ9S 3VAKA 4MAKA 4DR5J 3Q89A 3SQGB 1V9OA 3BGFA 2UUCJ 1DHMA 3WZ0A 1SPBP 3NBPB 4LRDA 5KFVA 4UUXA 1D9FA 3MD1A 5A8WB 4TXSA 2U1AA 3BSCA 3PG9A 2BOAA 1HARA 1RWPB 2HNDA 2KVIA 2N4DA 2IVFB 2EC2A 4DFMA 3OR2A 3T6JA 3VQSA 3UI3A 1M1GA 5KOXA 1S9EA 4JI2J 2W8KA 2F8EX 4HT7A 2XS7A 2W9BB 4DV5F 4R8UB 3NGTA 2CPJA 2E7VA 2K1RA 2XULA 1Q1KA 2HFNA 2MLYA 1S59A 4ILRA 2AYGA 4W4MA 5AJ3F 1QTMA 4RW7A 3L7PA 4NLDA 3MOZA 3OR1A 2P9GA 3FDSA 1NBEB 2EFOA 1RT5B 4YQWA 1HYSB 5D0HA 1GMWA 1N33J 2VBYA 2ACMA 1WEZA 4W98A 2KM8B 4PAAA 3PX0A 4C9DA 2LQBA 1L3SA 1I5OB 4KKOB 2GIFA 2OPPA 3J81U 4FNIA 3BO2A 2Q3PA 1SKUB 2W9CB 4H4KA 3DRSA 1K0VA 3H40A 4CLWA 1PBUA 2XI2A 1RWNB 2CQGA 1W26A 3SZ2A 2EVZA 3NEKA 4KTQA 2W8LA 3PFEA 2UUAJ 1H7WA 2K3IA 3UO0A 2RH3A 2C2OB 2NXNA 2J9EA 2AU0A 4BDPA 1X4AA 2QSFA 3BN7A 2KFNA 2K06A 4LF6F 1RT7B 4IH7A 4ED3A 2BJEA 3CO0P 4NE9C 3T1AA 1N5QA 2YQ1A 5DLFA 1UPPA 1VIXA 2ZUGA 5E0OA 2A10A 1CJVB 4DN0A 4IRDA 2LCWA 4ZVUB 4QW8A 2QLBB 4B3SF 4USJC 2CUYA 4ZP6A 1S1TB 4DJBA 3HXMA 3D6TB 4A47A 3IC1A 1YWXA 5I42A 3W9IA 2HZCA 3PRBA 2O5DA 1N5VA 1FTCA 3TAMB 3PKYA 4I0WA 3W5ZA 4E0DA 4J7CA 1NM2A 2CFXA 3X3UA 5CYMA 5F8IA 3C6UB 3JTPA 3HHLC 4QYRA 4OHVA 2AX1A 2XYGB 1SH3A 4CZCA 4ECUA 4WE1A 4M5KA 2GQ2A 2UV8G 3I5BA 4UOFA 1S0OA 2Y1LB 4GVBA 2D9OA 2LDIA 2AEJA 1TK0A 3OHBA 3Q8SB 3MEGA 2HLTA 3VQTA 2GHWA 2ZKUA 5C7PA 1KC8T 3K2YA 3H5SA 4IG3B 1YRTA 4AT1B 1TAQA 2V8DA 5KFMA 3LWLA 2DD8S 4FYDA 2DTJA 2HVHA 3DLGB 4C11B 1WOPA 1IJEB 2VG7A 2P6TA 2CZVC 3LP1A 3FNNA 3K57A 1N6QA 2XI3A 2XM3A 2L9DA 3MECB 4ZVTB 2CNKB 1U6ZA 4NRTA 3DGVA 1KS2A 4ECTA 3TA2A 1RCOB 2AJ4A 3O6QA 2JRSA 2LQ8A 3L3CA 5F8HA 3IN5A 1NKBA 3SBMA 4P73A 3KLIB 4DV4J 3Q2TC 4B9UA 2CQ4A 4NLTA 4QOTA 1I3OB 3PDNA 3QQCD 3MPVA 4P9SA 1RT2B 4JI5J 5LMUF 4BC7A 4D3HA 1MSWD 2PE8A 3WIUA 1VFJA 1DTQA 3KJFB 3QRRA 1O0PA 2BQRA 2BM0A 2IFXA 3D54A 3QIDA 2J8SA 2DNPA 5HVGA 1CJUA 2KRBA 1I94J 4OYBA 1ZAVA 2KRRA 2N3LA 3VVTA 2Y3YA 2HEKA 2YNFA 3TQEA 5GAGI 2R8GA 1JMTA 1RA6A 2D74B 2P6SA 1IKVB 2D7SA 4CI0B 1FNXH 4RX6A 3KG1A 3H20A 3MR7A 3CDBA 3P5TL 3R5CA 3NAIA 2RKIA 4C3LA 4F3QA 2AZ3A 1C0TA 2DEJA 3M8WA 3SCLE 5HP1B 1QAYA 3QWPA 1T02A 2D3O1 3DHXA 5IWAJ 1AT1B 5KG3A 1RWVB 1RWUA 2GFFA 3KJNB 3NLCA 4X65F 1TAUA 2AJ1A 3IWXA 4DWIA 1SKRA 3OT9A 3M2RB 3OXFA 2DYAA 1HBUB 3WX4A 2NXEA 4UQGA 2E5JA 4TNOA 5L8RC 2RQCA 1EAYC 2LA4A 2XYPB 1RHUB 2YKNA 1RTIB 1RHMB 1EP4B 4WFZA 2DXDA 2DY9A 3ZTRA 3OTOF 1J5EJ 3KHHA 2DXFA 2BX6A 1RACB 3NKYA 3UCGA 4OYAA 2BXJA 4WXWA 1ZAXA 1WC3A 1TQLA 4RW8B 1FEEA 2QLWA 1RT3A 1VIOA 2J7UA 1VQLS 4NRUA 1ROFA 3TA1A 3GJSB 4UOHA 1FO1A 3HZEA 4FF2A 3MZIA 2ZH9A 4USVA 3VGUA 4L73A 1U1NA 4NPOA 5L46A 1U0HB 1DQ9A 2E1RA 1R8HA 3RUBL 1KEKA 3KHRA 2E1PA 3RAQA 4Q44A 1M0SA 4GO5X 4N56A 3ZNUA 1HD0A 5KFUA 5I4MA 1WHVA 5D15A 3EGNA 4IKAA 2XY7A 2J8AA 5A8RB 2B9YA 3VVUA 3DM2B 2GO9A 4JBCA 5KT6A 3MURP 1L5UA 4ZPDA 2D69A 1G2EA 1MMLA 1RLDA 2MMYA 1ZPVA 2DNHA 4KO0B 1NCLA 4IH6A 5L38A 3GV8B 2ZBIA 4LSNB 2LFVA 1U47A 2HMIB 1BD6A 1LFWA 2UVVA 4QU6A 4HDGA 1LXNA 2VZ9A 2YX7A 1UVMA 2V34A 3HVTB 1JXEA 5IOLA 2GNKA 1KVJA 1PBAA 2JEIA 3KK2A 4JI6J 4KB7A 4TY8A 4LF8J 4K5RA 3W63A 2PFDA 4GMKA 2P8IA 9RUBA 3O3LA 2QYGA 1Y5NB 5DZ6A 2DNQA 4ZPVR 4LIWA 3NMAA 3C6TA 4HL9A 1NHVA 3QPIA 2BJDA 1TKTB 2IMWP 3R2CJ 4P2FA 2HWHA 1SUQA 4BWJA 5J1EA 2ZH3A 1WSVA 5M2RA 2MZQA 1BY9A 4AD6A 1S99A 1RAFB 3D0IE 3QGPA 1H73A 4U6PA 4LRAA 4X66J 1X60A 5E5NA 5JMNA 1FRMA 1OY6A 5CD4A 3OFEA 1T9XA 1MU2A 2G1HA 2RMLA 4F4WA 2VHGA 1V3ZA 4JV5F 1FD8A 2YKMB 2P9CA 2V0NA 3QWUA 4NCAA 5DM7Q 3QLHB 2FJEB 4NA2A 4KPCA 1HD1A 1JLFB 4M95A 1S12A 3V6JA 2K3KA 5DZ7A 5KFQA 2J5AA 4O0IA 2IC3A 1HQUA 2NXCA 3IG1B 2Y8YA 2KG1A 1WORA 1XQIA 1WDTA 3SI8A 2NR0A 2JC1A 2B9XA 4RW9B 3NCPA 1NJXA 1S0NA 2VA2A 2FIUA 1GMUA 5T7LA 4AL6A 2HVIA 3BGUA 4MFBB 1IVZA 5LL6d 4I6YA 5B0EA 3U7JA 1PYOB 3HD2A 4W90B 4PUOB 1AB8A 1F6TA 1KTVA 2VV5A 8ATCB 4K4YA 5GMDA 4LR7A 1HFEL 3Q8QB 1S1VA 3GWCA 2WZ1A 5F9LA 3CD5A 2FJWA 4CRJA 2BJ1A 3GFHA 5J2MA 4CO0A 2GX8A 3JAMU 4LSLB 1KHWA 2XZDB 4K4WA 1TMMA 3NNAA 2CPIA 1FHTA 1JLGB 1UA1A 4EEYA 1PGZA 3R2DJ 1PC5A 4C0BA 3IBWA 2HQDA 2NSCA 1LWFA 2YVSA 1M5SA 3G8TA
chains in the Genus database with same CATH topology
1X5TA 3SFGA 1FE0A 4WFNQ 1SL2A 1F5CA 1HA1A 1L3KA 1PILA 2PSZA 4NLQA 1BWEA 1RA7A 2V8VA 1N32F 3MHYA 1QE1B 1WWHA 5EUHA 3BQ2A 4I1TA 2KZZA 5EWEA 1F5AA 2B51A 1DFDA 3CD6S 3D0HE 4KQZA 1G1XA 4OIXA 4JI0F 2X1FA 5E3RA 3MCSA 3OW2R 2D9PA 2E1MC 2MHEA 3CCTA 4ECVA 2QO3A 3RB6A 4Q43A 2G13A 5KFDA 2ZH1A 2IMOA 3NS6A 5IM0A 5B0BA 2BUNA 2OP5A 4TY9A 3CCRS 2ASDA 4OX7A 2E9ZA 5F0WA 3DRRA 3G4SS 2RQ4A 4R0JA 1U1PA 3E51A 3HF5A 5BR8F 1MMNA 1M5HA 4WFBQ 4J9LA 5C42B 2HWTA 2OSQA 3MUVP 2DR7A 4DV2F 1SH2A 3PIOQ 3DRYA 2XSFA 2MB0B 1XC9A 4B08A 4IOBA 2XLIA 1N48A 3IFEA 5I3UB 1WF0A 3GB0A 5AXMA 5I42B 5K8MA 2OKQA 2LXIA 1ZZNA 4CQ1A 4DQPA 5K8NA 4PPDA 3HT3A 3SSQA 3LUYA 3R27A 5J1PA 1XR7A 1VBZA 3M6XA 2KO1A 3LP2A 1IQZA 2K7KA 4RWXA 3C46A 3DOLB 3BSAA 4NLPA 1S79A 3N4WA 4NLSA 2OPQA 4RUAA 3BJYA 4ZDNA 2XZWA 3DU5A 4OLPA 1ZETA 4DQRA 1OPZA 1WG5A 3CTRA 1JNRB 2DPIA 3NG8A 3OQ2A 4FBUA 4NZ0A 3CMAS 2QV6A 5KAKA 5CYMB 1FESA 2QLXA 2POKA 3DC2A 2C2DA 3V5RA 2PO4A 5DQHA 4ID5B 3ZFVA 4DV1F 2MQNA 1U4BA 4PG8A 1OS5A 4PR6A 3SDEA 2ZFHA 2YY3A 3Q24A 3N79A 1TKDA 2CQPA 3NGKA 1KOHA 4KHRA 5CD4H 4DG1A 1T3NA 2ABYA 1ZOTA 2BZ2A 5CQGA 4NLWA 4WE1B 3W2VA 1HR0F 2IVMA 4GKJF 1URRA 3L95X 5A8KA 1LXJA 3CF5Q 4EZ6A 3DXSX 2CDQA 3B4DA 3PJWA 2B9WA 1H98A 3VCDA 1HHTP 2CQ1A 4O3OA 4Q2MA 1VBYA 3PW0A 2CJKA 3BGLA 3PEHA 1FJGF 3CJ4A 1OSDA 2XMTA 1S9FA 3MEGB 3PR5B 5KG7A 3RB4A 2CIMA 2M9KA 1IR0A 2L08A 3CDAA 2ATLA 1QVFR 4BS2A 1B0TA 2RT3A 2QT7A 4BC9A 2R7SA 4PG7A 1U49A 4USHA 1QSLA 2DNGA 4HLBA 3SQGA 1XWLA 1FRIA 1URNA 3LOUA 3I6PA 1HI1A 4KSEB 2J0QD 4NLGA 4KHMA 4JUZA 4OZLA 1NJYA 3MWBA 4DL6A 3NBPA 4QIVA 4DN9A 3C2PA 2GV1A 4ETXA 3SV4A 5K5MA 1F0XA 3W7BA 1M1KT 5KG6A 4H54A 1DRZA 1DARA 5A8WA 3KG4A 2VKZG 3OTDA 4KHPF 5E3QA 4ZCMA 5DS7A 3TUIC 2P9EA 5SUHA 1X4DA 1MROA 4G1IA 5ITHA 5FLXY 2HHSA 4IDKA 1C0UB 2BANB 2VG7B 4NOHA 1HWLA 3I82A 2XCPA 2RUGA 3LP1B 4RWWA 4EYIB 1TL1A 4IOCQ 2NLWA 1K1SA