2CQCA

Solution structure of the rna recognition motif in arginine/serine-rich splicing factor 10
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
95
structure length
95
Chain Sequence
GSSGSSGNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Arginine/serine-rich splicing factor 10
publication title Solution Structure of the RNA recognition motif in Arginine/serine-rich splicing factor 10
rcsb
source organism Homo sapiens
total genus 11
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cqcA01
3CCUS 1M1KT 2G4BA 3CMAS 2XS5A 4WFBQ 2AYBA 2DGSA 2MJNA 4WIIA 5JVGQ 1FJCA 1U1PA 5IM0B 2BZ2A 3CCQS 2X1FA 2KVIA 2L9WA 3CCRS 2ZJRQ 1NU4A 1U2FA 2JX2A 3PIPQ 3U1MA 1D8ZA 1WG5A 2DGOA 3ULHA 2LECA 3EGNA 5CXTA 3HHNB 3P3DA 1HD1A 1YWXA 1N52B 2MZ1A 2CPHA 4W90B 1UFWA 1VC0A 3EX7B 1WEYA 2CQHA 1Q86T 3JB9k 1P1TA 5LJ3Y 2M8HA 3SDEB 1B7FA 1DRZA 2BOPA 1KC8T 2LMIA 4TU7A 3B4MA 3MUTP 3I56S 2A3JA 2MY7A 2CQBA 5DM6Q 2V94A 2VONA 2DH9A 1YJNS 4ZKAA 2KI2A 1KOOA 1X5PA 2M9KA 4TU8A 2CQ0A 5IQQA 1M5VC 4LJMA 5IM0A 4YUDA 2LXIA 2OIHA 2G1DA 2JVOA 2MZJA 2MSSA 1SJRA 1A7GE 2CPDA 2F9JA 1CVJA 2KHCA 2M2BA 2DO4A 3SXLA 2KXFA 3R27A 1X4EA 2MYFA 3IWNC 2RVJA 3DXBA 3SDEA 1S72S 2MKIA 2RUGA 2EK6A 4WCEQ 2MKKA 2N3OA 4FXWA 2KXNB 1H2TZ 4EGLA 2KRBA 1WHWA 2NLWA 2M70A 2RU3A 1WTBA 1QVFR 3G8SA 2FPHX 1JJHA 1VQ8S 3CC4S 3NS5A 4QU6A 4J5OA 1VQ4S 1PO6A 2MQQA 3UD3P 2RS8A 3VAHA 5HO4A 3OW2R 2YTCA 4UY8T 1DHMA 3BS9A 3CXCR 1WF0A 3VAIA 1YTYA 2CPXA 4PR6A 1RK8A 5DDQC 2KYXA 3MDFA 3NS6A 3MURP 3CCES 1YJWS 2JRSA 3TP2A 3SMZA 2LXUA 2MB0B 3G6ES 2LA6A 2MQLA 2E5JA 2MQNA 3V4MA 2RRAA 2D9OA 1FXLA 3TO8A 1U1QA 5DDPC 2OSQA 2CPYA 3HI9A 2OTLS 2RQ4A 2FC9A 2CPZA 3S8SA 3R1HA 4C4WA 5GAHU 3G4SS 3CCLS 1X4BA 1URNA 2DGUA 3ZZYA 1QM9A 2KXHA 4CH1A 2M52A 2Q79A 2I2YA 1VBYA 3U1LA 2MSTA 2KU7A 2MHNA 2DNYA 1F9FA 2KFYA 5EN1A 2XB2D 4IOCQ 2LEAA 3EGZA 4Y00A 2LQ5A 1WEZA 1FJEB 2DNGA 4WFNQ 1OPIA 2MXYA 3BO4A 4F02A 4P6QA 3CD6S 3S01A 1X5TA 3CC2S 2DHGA 1K8AT 3L3CA 3UCGA 5DDRC 2X1GA 1ZZFA 3NNHA 1H2UX 2CJKA 2FY1A 1YJ9S 2RT3A 2F9DA 1N54B 4QPTA 1X4AA 2MQPA 1SJFA 5DDOC 2DO0A 2SXLA 1H2VZ 1RKJA 1WHVA 2CQPA 1L3KA 3CF5Q 1YIJS 1SJQA 3N9UC 5D78A 2KH9A 3VAKA 3R1LA 2M0GB 1OWXA 2DK2A 2D9PA 3UE2A 1WG1A 2XS7A 3Q2SC 2DGTA 2U1AA 2XNQA 1U1KA 2RNEA 2DGWA 4CQ1A 2FHOB 5LXYA 3J7YU 5CYJA 2CQ4A 3G8TA 4BS2A 3P5TL 3UCUP 4C0OC 2MZRA 3VAJA 2DNOA 2DHSA 2D3OR 3TYTA 1VQMS 1VQKS 3FEYB 1VBXA 4CIOA 2DB1A 1WEXA 1KOHA 5GMKa 5MLCV 4F26A 4RU2A 3Q2TC 4LMZA 5CA5A 1Q81T 3S6EA 2DIUA 2M7SA 2CPJA 3I55S 2VODA 1YITS 2DIVA 1FJ7A 1WI6A 3BEGB 1JJ4A 3LPYA 1WF2A 1M5OC 2AYGA 2MMYA 1JJ2R 3CCJS 3THPA 3RW6A 2NZ4A 2AYMA 2VOPA 2X1BA 1VQPS 1VC5A 2AD9A 2CQ2A 5LSOA 1X4DA 1WHXA 1VQLS 5LXRA 1M5PC 3VF0B 1U1NA 2DNZA 1OO0B 2N82B 3CCSS 1N8RT 2E5GA 4M5DB 2RS2A 2OTJS 2HZCA 2YWKA 5JVHQ 1HL6A 2CQIA 2WBRA 1VQ6S 2XS2A 2E5HA 4V19X 1FNXH 4YB1P 2MZQA 2J0SD 1WWHA 2KRRA 2DNKA 1NO8A 5DETA 4IUFA 1SJ3P 5HL7Q 3CUNA 1M5KC 3UWTA 3H2VE 1HD0A 1IQTA 2DGXA 2MKHA 4TLQA 4PKDB 5LJ5Y 2QFJA 3G96A 1X5OA 1Q7YT 1AUDA 1Q82T 5LSLA 3VAFA 2LA4A 2ERRA 2MJUA 4LIRA 2CPEA 4IOAQ 2DITA 2FC8A 3CPWR 3BO2A 1JMTA 3VAGA 2I38A 2J76E 1WI8A 2DHAA 1WELA 2YH1A 4Y0FA 3IRWP 2MKJA 1VQ9S 1U1MA 3CCMS 1ZH5A 1S79A 2F3JA 1VC6A 3B4DA 1FO1A 1XN9A 2KG0A 2ZJQQ 1K9MT 1U6FA 2K8GA 1O0PA 2L41A 1G2EA 3MOJB 1X4CA 1WF1A 4W92B 1D9AA 3UD4P 2LCWA 3FEXB 1QVGR 4OZ0A 4OZ1A 1SXLA 1H6KX 5GAGU 2DNNA 2CQ3A 1PGZA 2GHPA 3CMES 2OSRA 2XNRA 4FXVA 5IFMA 5D77A 1U1RA 2LEBA 2YKAA 1ZZNA 1WG4A 2MKCA 3VALA 2DNLA 1YI2S 3RW7A 1P27B 1X4FA 2RRBA 4WKRA 2DHXA 2JVRA 2CQGA 2ZJPQ 2B0GA 2DNHA 3G9CA 2LYVA 2MGZB 3THTA 3MUMP 1VQ5S 1SJ4P 2MQMA 4WF9Q 2CQDA 2DNRA 1FHTA 3G71S 1YHQS 2E5IA 1U1OA 3LQVA 5DM7Q 3MI7X 1OIAA 4F25A 3CCVS 2DISA 2ADCA 1HA1A 3CULA 3K0JA 4Z2XA 2G0CA 1VQOS 3UCZP 2DGQA 2U2FA 1U1LA 1R8PA 1DZ5A 3PIOQ 3MUVP 2CPFA 4A8XA 4PRFA 2QEXS 1R8HA 2ADBA 1U6BA 2M4MA 2HVZA 5FJ4A 1UAWA 3CC7S 2RQCA 2J0QD 2CQ1A 2MPUA 1A9NB 4CH0S 2UP1A 2JWNA 2MKSA 2VOOA 4IO9Q 3NNCA 1KQSR 2DH8A 3P6YC 2OJ3A 4C7QA 2YH0A 3H2UB 2DH7A 1NJIT 5BJRA 1WHYA 1X5SA 2MGZA 2AYEA 2PEHA 2HGNA 4QQBA 2N7CA 2M8DB 4QU7A 5GAEU 2DNQA 4WFAQ 3D2WA 3NNAA 3P49B 2N3LA 2EK1A 2MY8A 5GVQA 2L08A 2MQOA 2QA4S 4UQTA 3MXHP 1KD1T 2E44A 2PE8A 3US5A 1UW4A 3J7ZT 1K73T 3DLLQ 3NMRA 2DNMA 2MZTA 2DNPA 4TU9A 1M90T 1VQNS 1VBZA 4ED5A 4YOEA 4ERDA 1X4HA 2M88A 2KT5A 4U67Q 2J8AA 2LKZA 1DBDA 2CQCA 2HYIB 1N88A 2XSFA 3CTRA 3ZZZA 3MD1A 2X1AA 3VAMA 2O3DA 5H1SV 2EVZA 2KN4A 1BY9A 1FT8A 2K3KA 1X4GA 3S7RA 1UP1A 2HGMA 1W2BR 2KM8B 2MZSA 2HGLA 2KM8C 5GADU 1VQ7S 3BO3A 1X0FA 5ITHA 2DGVA 2CPIA 2KG1A 2GO9A 3MD3A
chains in the Genus database with same CATH superfamily
1P1LA 4PQUB 2V34A 2N7YA 2MJNA 3W9IA 1U2FA 2JX2A 4CLPA 1RSCA 1L3SA 5M2PA 4Q0BB 4IFVB 4TU7A 3CEDA 5DM6Q 5AE1A 4ZKAA 3L7PA 3GJQB 1AROP 3M8QB 1TK8A 1WKJA 3D1QA 2YQ1A 4LJMA 5IM0A 1AW0A 3VVUA 1VYAA 2YQ3A 1X4EA 5A0YA 2HHHJ 4K4VA 1S72S 2KXNB 2KRBA 3BSCA 3G8SA 3PX6A 1VQ4S 1FI4A 2JC1A 3UD3P 2FLOA 4UY8T 3VAIA 1YTYA 1SUQB 1XJWB 3PHEA 1FDNA 3G6ES 5SUHA 5EWEA 1WTFA 4DV0J 1U8SA 3RB6A 5F0WA 4LF7F 2RRNA 1LFPA 4P75A 4C0BA 4C4WA 4WXOA 1CULA 4OQJA 2HPUA 2RIJA 3TX0A 3BQ2A 2WTFA 1HHQA 1XTZA 2KU7A 5J1NA 1K0TA 3RAQA 1OY6A 5KFTA 2AEJA 3AXKA 1YQHA 5HVFA 3LH2S 2HZAA 2DNGA 5AJ3F 5KFIA 2IM3A 2ZE2A 1FWPA 1Y7PA 1BGXT 4TN2A 4UUWA 3T6JA 1J5OA 3N9UC 2D3O1 2GQQA 5DGBA 2JOQA 2DGWA 3T5LA 3ZTSA 3DRRB 4X66F 5CQGA 4YN3B 4Q2LA 5HMYA 3NXZA 1MN7A 1RCOB 3SFUA 4CZCA 3PW7A 2Z0GA 2QTWA 2CZVC 2HAFA 3AJ1A 4F0KA 1IKVB 4KR0B 1MU2B 2DXEA 2VFUA 1JLEA 3R5CA 2XO6A 2NZ4A 2HRTA 3H5YA 1FWLA 2NXNA 3BV8A 5KFQA 4DV3F 1S97A 4B9TA 4M5DB 2NCKL 4F04B 3QIDA 1HR0F 2J0SD 2HHXA 1UVMA 2GQ2A 3DLBA 2QFJA 4LFCF 2H5IB 4ZVPB 1CJVA 2XBPA 4H4OB 4DUTA 3EZUA 4CDIA 1Y5IB 1JK9B 3FQKA 2KG0A 4GKJJ 3QYYA 1HWKA 5LSRA 5E41A 3HF5A 4KO0B 2NYHA 1T02A 2XYHB 4LBPA 2OSRA 2BX6A 3PHTA 1TKDA 2VDHA 4N41A 2ZH8A 5FDLA 1C0UA 2K1RB 5HROA 1T3NA 4U95A 3OTOF 1X4FA 3ITHB 2W7PA 5HAOA 3TVKA 5J2MA 1VQ5S 3THTA 1XNQF 1TK0A 1TKZB 4P2FA 2E5IA 1U1OA 2LEPA 3MPVA 1T9UA 3UCZP 2BKPA 1U1LA 4O3PA 2Z4PA 2AMCB 5F8LA 2AU0A 2RE1A 4QIWD 3MEEB 3UW1A 3FSIA 2UV8A 2VA3A 3MOZA 4ELVA 5IZHA 3IS9A 1U26A 2Q6CA 2DR9A 1UL3A 4QJVA 2EK1A 2HVHA 2KHDA 3MR6A 1UW4A 5HJYA 3M2UB 1JLBA 2J0WA 5I42B 3J7A1 5H9EK 3X3UA 3DRPB 4YB5A 1M5HA 2DBBA 4ZVEA 5A8WB 3GFXA 4N7TA 4G3IA 4UOFA 3KJVB 1MSWD 5H1SV 3DU5A 4BDPA 3MMCA 3PO5A 4WXWA 2XHCA 1VHFA 1NJZA 2DR8A 3HVAA 4FYWB 5LMNJ 1TV6A 3NOGA 2CPIA 4LF5F 3LGHA 3CMAS 4ANEA 1FJCA 4RR5A 3KJNB 4BC9A 2B4PA 5ETSA 3AOAA 1FRIA 4F67A 1NU4A 3EGNA 5CXTA 2CPHA 4LUBA 3GV7B 3POTB 1O8BA 2HFUA 2IM1A 4A8SA 3JB9k 3HHLD 1HBNA 3PRBA 1R0AB 4PXEA 4B9NA 3GYGA 1APSA 2VG7B 3ISNC 1MLAA 2CQBA 4I7FA 3IC1A 3BGUA 1IVZA 1N5YA 2V94A 2VONA 2BKOA 3QJPA 2QE5A 4QBUA 4ECYA 1AXQA 2LU1A 3V81B 1X5PA 3MCSA 2G1DA 4IFYB 2Q3PA 2F9JA 1Q5VA 2ZH3A 3IWNC 3V4IA 1NKBA 5L39A 1FKOA 2NPFA 1T3OA 1VLOA 5E3CA 3WHIA 2V2QA 4J9QA 4CO5A 2ZVSA 3JTPA 4URGA 2EFPA 1RT4B 1F2GA 4B3RF 1RT2A 2P6SA 4DR6F 3B6BA 2H54B 1U1QA 5AXLA 1R0BG 2RH3A 4USIA 3BM7A 2ZC3A 3QWUA 4NXNJ 3DN9A 5C24B 2B9WA 4XDCA 2I2YA 4JBCA 1C1CA 1S6PB 4NMXA 5G0RB 2Z2LA 2R7UA 3EYZA 3E01B 3OJUA 4AL5A 4P6QA 4BBYA 3S01A 3CD6S 4GVBB 2JEGA 1H2UX 3VTIA 1R89A 3C66A 2FUG9 1X4AA 2IM0A 2MQPA 1EP4A 4RW6B 4JV0A 1KFSA 3AAWB 5D4OA 1HNIA 2E29A 2MKYA 1VGYA 3VQTA 1S0NA 4DR5F 2BM1A 2GHWA 2IA6A 3IAM9 3DGPB 2VG6B 2FVRA 3J7YU 4YQWA 3G8TA 2C28A 3SSQA 4ZLJA 1T7PA 4CRJA 3KNGA 2IVMA 3N5FA 2V4QA 4USWA 1T03A 4F8RA 1S76D 2CJYB 3N5BA 3ZNUA 1F6TA 3VR1A 5KG3A 2AYMA 1N6QB 1Z2LA 3ENAA 1BQNA 3W2WB 1CSJA 4KH1B 1B0PA 2UVWA 2AJFE 2CJQA 1PCAA 2WBRA 2W4PA 5CYMB 3DOKB 5DETA 4DV1J 3HFZB 3W8PA 5IV4A 3DDKA 2PFDA 3C6UB 4NX9A 2ZDOA 4F0HA 3D0IE 3MAAA 4A8QA 2ASYA 2R8KA 4AQYJ 1N56A 2H48B 4OJ3A 3IRWP 3CCMS 2EFOA 1ZH5A 1S79A 2YKQA 5KFOA 3M6VA 1XN9A 3UDCA 4ZN3A 2L41A 3T19A 3KLEB 1X4CA 3ONQA 4R8UB 3MPYA 1N32J 1H7XA 4CI0B 1H6KX 1D9FA 4PG8A 2H1YA 2CQ3A 2GHPA 3OVSA 5HBMB 1W25A 3RRKA 4DL6A 1JLFB 5K8PA 1YZ7A 5I3UA 4WKRA 2VU5A 2DEJA 2ZJPQ 1RHRB 4Q45A 1U6ZA 1N5TA 4OYMA 1LWCA 1ICEB 2D1CA 2VUGA 4F25A 5KOXA 3CCVS 3W1YC 2IIHA 1G6BA 3A8IA 3W60A 1HA1A 3OJSA 4NLPA 2HHVA 2DGQA 5L1JA 3BBBA 1UPPA 1R0CB 6AT1B 1QUPA 2FVPA 2RQCA 1CS4A 4A47A 4FVMA 1D0EA 3HCXA 2LQ9A 3ZZRA 4IO9Q 3B78A 4DR7F 3DI6B 2DH7A 1NSKL 2FVQA 1BMQB 2AYEA 4LF9J 3TAPA 4TY8A 2YNHB 5GAEU 4DZDA 1NJYA 5AXMA 1RAOA 2PDAA 3K5NA 5THWA 1HBUB 4JI6J 2FHMA 3DMJB 3NWRA 2ZH9A 4ZPCA 3LTOA 5F8JA 3H20A 4LSLA 1N88A 1DTQA 5FLXY 2ZH4A 2HVIA 5C42A 4K59A 2V4JB 3AJ2A 4IO1A 1X9WA 1FESA 4F7VA 4UF4A 3GG1A 2C3PA 2WBMA 1S6QB 3ZZUA 4DV6F 2XMVA 3I0RB 4KYZA 1PAEX 4ES1A 5IWAJ 2JFKA 4MIWA 2AYBA 3ZTRA 2VFVA 1U1PA 3RAMA 3TUPA 2L9WA 4C6AA 4Y34A 4NLSA 3BGLA 4M5KA 5KG1A 1HNXF 3BN4A 3RBEA 2F4FA 2E1AA 3OXFA 5KT3A 3RRGA 2VBZA 4OFZA 1PILA 2M8HA 4IR9A 4ID8A 3BBCA 1JLQB 2O66A 2NR0A 3M7VA 4MIAA 2GVDB 4K2XA 3GR1A 4IOBA 3EZ5A 1FVQA 4DV2F 3C46A 3R6GB 1X7VA 3BSNA 1M5VC 5L1LA 4OZLA 4YUDA 4UTGA 4A4JA 2LFVA 1S5ZA 2M5YA 3V6DA 4B3MF 9RUBA 3NEKA 1EB0A 2M2BA 3R5DA 2VQEF 1WOSA 2GGPA 3VCDA 4EGLA 1Y5NB 1VRTA 4B9UA 3NS5A 1CG2A 4QU6A 3ENQA 5LL6d 3AD7C 1ACMB 2CWXA 2ZNZA 2G1HA 4U7UK 1RK8A 1TL7A 2W4DA 3TP2A 3KDNA 1FD2A 3KLHA 2MQLA 5AXNA 5L38A 4CLSA 2MLXA 1VIXA 2VPWB 3R1HA 4ZCIA 1URNA 2KFNA 3O3LA 4KIAA 5KFVA 3OTEA 3P8BB 1UZHA 4RKUC 4CH1A 3P4UB 3H90A 3DLKA 3AOCA 4Y00A 4Y3CA 2MXYA 1WJ9A 4MIBA 3CC2S 2XMTA 1LK5A 2X1GA 4NZ0A 1PJ6A 3JYTA 3DRSA 2ZZTA 1N4LA 4UUXA 3OTDA 3GFZA 4I68A 1JLGA 3ZTOA 1OQ6A 1WHVA 2CQPA 4QWAA 2EFQA 1YIJS 1MROA 3BKUA 1RTHA 2QC3A 4K4TA 2GMHA 1G3OA 4I2PB 3EE3A 3BPDA 2BANA 3AA8A 3HLUA 5J1EA 5IT9Y 1NJXA 3PYGA 4BS2A 2V63A 1C1BA 1HQEA 4KV8A 2OPQB 2RSQA 2E5LF 4KT0C 3ETMA 2DD8S 2IRYA 1OJ4A 1KN6A 4LMZA 3OL8A 4ICLA 1XBWA 3K5MA 2IFXA 1E6YA 1RKIA 1IR2A 1V9OA 4J9SA 1WF2A 1N34F 1IR0A 4C48A 2R7RA 5KFPA 4UT4A 3TQEA 4HH0A 3HSJA 2W4CA 3TX8A 1OQ3A 6FD1A 3CCSS 1UVNA 1T9XA 2HZCA 4DMZA 4YB1P 3KK3A 3CJQA 4PKDB 1T05B 1RWUA 5G4DA 3Q8YA 1Q82T 3AB2B 4ED0A 1TKXA 4LIRA 1YSJA 4LF7J 1U48A 2MKJA 1V5VA 2DCLA 3DLJA 3R7BB 4O4RA 2L48A 4O44A 4CLWA 2B4UA 3KDOA 1QVGR 3GONA 1M1HA 2VASA 5K8MA 2Z2MA 1JXVA 3MM6B 2JEJA 5AJ3J 4I6WA 5IFMA 2XCPA 3O2IA 4KTQA 4O3SA 2BVZA 3VALA 1U0HB 1YI2S 2AKWB 3G9CA 1PYTA 4ZMMA 1TL1B 1T95A 3T9ZA 3EPGA 5GAHI 3HJVA 4USMA 5B09A 4DSLA 1H72C 1VS3A 2KB2A 2ZZMA 1LK7A 3GB0A 3PJWA 4X66J 5KOWA 3R97A 5KG2A 2PEBA 1MWZA 1LWXA 3NOCA 4ED6A 2HHTA 3UDEA 4TY9A 1A9NB 2UP1A 4JUZA 1KQSR 2F4VF 4FKYA 1NH7A 1UWBA 1RAAB 5B0EA 4CH7A 3OUYB 2QA4S 1VQYA 4C8OA 2ZBRA 3CVKA 3CCTA 4KSEB 4HKQA 4OJHA 4PPDA 3ZZZA 2J7KA 1YX2A 2KN4A 2POKA 2LQJA 2AV5A 1W2BR 1HR0J 1SKSA 3BH6B 3TUZC 2UUWA 3MMAA 3TZYA 4LFCJ 2BRKA 1KHWA 5IM0B 2ZJRQ 4ZPTR 4JI4J 2C3UA 3IWXA 2YWEA 1WG5A 3R5JB 4HTIA 2X3DA 5A0YB 4EBCA 4G1QA 1B64A 2HHWA 4A8KA 1WC5A 1MMNA 2UXBF 3PACA 3C19A 4A46A 4B3TF 2YQ0A 1WORA 2DT9A 4RLEA 5K20B 4CLFA 4XTTA 3OTOJ 4HT5A 5T14A 2YNIA 4ZVQB 1U09A 1XNQJ 4OI4A 1J5EF 3DOMA 2A10A 4A8YA 1H2TZ 3KHLA 4C8LA 1CULB 2M70A 1HHSA 1KVJA 4JV2A 1IM4A 1Q1KA 4RW8A 2H3EB 2HVEA 1LV5A 3N79A 3IAS9 4DOZA 3AJDA 3CCES 4DV5F 2YX7A 5BYQA 1U8WA 3E3XA 2VKZG 3J7YI 1TK5A 2ZE2B 3M32A 2I0XA 2GZOA 1TP7A 2OPRA 1RYSA 3MR3A 4Y2IA 1JLCA 2V8GA 3V6HA 1J5OB 2H51B 2XZWA 3D6TB 3K7RA 1PIEA 1FJEB 1LXNA 2AZ3A 2PMHA 1VOMA 2Y1IA 4J9NA 4NYPA 3KLVA 2EW9A 2W7OA 4DBQA 3PYFA 5L1IA 3BREA 4NLTA 3GG0A 4Y28C 2DO0A 2Z8QA 2B9YA 4LF5J 2GX8A 3PJ9A 5T41A 2B3TB 2JFDA 4CLLA 5CZVA 4CT9A 3SSSA 4OYWA 1VJWA 1GK8A 3Q2SC 3M9OB 1LWEA 2RNEA 1JLEB 2L9NA 4P7TA 3BN7A 1NUEA 3RTVA 1QD1A 2N4CA 2VPZB 2DNOA 3TYTA 3ZZOA 2DB1A 3QT8A 2BE2A 3PEHA 4WP9A 4PG6A 1EARA 3HD2A 1U0SA 2GJFA 4HVZA 2XI2A 2HBZB 3DNCA 1JJ2R 4IRDA 1ZYQA 4I67A 2FJVA 2UV8G 1CJVB 4U7UD 5BXIA 4ZVGA 4C97A 3ZZPA 4HHUA 3RAXA 4E98A 2RUSA 1OO0B 2E5GA 2GV1A 1XR7A 2FLPA 3J81j 2CQIA 2XS2A 4FN5A 3ZZ0A 1DJ0A 4MKBA 3E51A 3T1YJ 1YBTA 2L3MA 4MYTA 2WVFA 4LF1A 3X1LB 1Q7YT 3EICA 1FTCA 4ECUA 2LA4A 4B3RJ 4DR6J 5FDLB 4KKOA 4F4XA 4IOAQ 1VK8A 5HROB 3L9ZA 1RU2A 1NZAA 2ZBQA 3RB4A 3BSOA 2OI2A 1WACA 4TXSA 3IXQA 3IP0A 2F3JA 5J2MB 3CD7A 1NSPA 2KJVA 2HFVA 3OR1A 4NCGA 5GAEI 2JLEA 2BOAA 2Z57B 4G1PA 1M0SA 3HULA 1Q7LB 3D9BA 1FERA 3MR2A 3UVJA 2DNLA 3M2VA 3RW7A 2QLFB 1IBKF 3IS9B 4MTPA 3H7HB 2NYIA 2OPSA 2CQDA 3GJSB 1Q79A 3RJMB 1QY7A 1FRLA 5B7WA 4DR5J 3SSRA 3GPAA 1JLBB 4M5HA 1ZM3A 4MT1A 4KGMA 1URRA 2JNJA 1R8HA 1PJ7A 4K4YA 3M4XA 4LIWA 5K5MA 4J7CA 2UUAF 1LW2A 4WKYA 4RW7A 4LBHA 3MMCB 4DXLA 2RKIA 3LF0A 3V2UC 1WHYA 2W9CA 1VHIA 2OEMA 2N7CA 4ZCMA 4WFAQ 2N3LA 3OXGA 4IG0A 1TV6B 3FBEA 2ZHAA 1JLAA 3G8QA 4DSIA 3FRYA 4WWSA 3JQJA 2HHUA 2J6UA 4R5PA 1Y10A 2XSFA 2X1AA 4ZPVR 2Y1JA 4IQMA 2WB1D 4WU2A 1X4GA 2QSFA 3HK2A 1HBNB 4PUOA 4EFAC 4DUZF 5F8IA 1YDLA 3G82A 4H4KC 4I7FB 4ZVRB 2HMIA 4AFFA 1N5YB 4MKAA 5FLXU 4CLUA 1RTIA 2KVIA 3PIPQ 3ULHA 4DL0C 3P3DA 1WOOA 1N52B 2HBQB 3OHBA 3V4IB 1P1TA 4QCLA 4IRKA 4CO0A 5ETNA 3DOLA 1CBKA 3HSGA 4M63A 2O67A 1MG7A 1FKOB 3EUNA 1S7HA 1T9WA 3A8JA 2DHHA 4W98A 3M8YA 3F73A 1F2HA 4LR8A 1ZS6A 3QO9A 2KT2A 1NZ8A 1CQNA 1RT2B 3N4WA 2O5DA 2FHKA 3AXMA 4JI0F 4FXWA 2BJ7A 1NPRA 4U8VA 3CDEA 5ETOA 1YZ6A 3KHRA 1C1CB 1VQSA 4DI6A 5HO4A 3OW2R 2E9RX 4R0JA 1RWPB 1WF0A 8RUCA 3NS6A 4DR7J 4PWDA 1HBMA 1FRMA 1RTDA 2XMJA 5IOLA 2OSQA 3DGVA 2OTLS 4OL8A 1EP4B 1HNIB 1WD6A 2GIQA 2M52A 1RHUB 5CYQA 3WQPA 3J80Y 3OQ2A 4OI0A 2JDJA 2MHNA 2DNYA 3FVYA 4NWBA 2VHGA 3BYRA 4WFNQ 3TQ1A 1X5TA 1U2CA 1ZZFA 3KXDA 2B6AA 4FS2A 4DV6J 2KJWA 2H5EA 5JJBA 4NZ7A 3OPKA 4RBVA 2V8VA 1T03B 1EKSA 3GIJA 1YVFA 2QMUB 2DK2A 1PBAA 2ZWOA 2CJ9A 3O5TB 4YDXA 4ZA1A 1HNXJ 4RNHA 3TUIC 7AT1B 1BQNB 3QJLA 4USHA 1VQMS 1VQKS 3CO9A 4L72B 4C3LA 3S6EA 4DLGA 2CPJA 4CM2A 3SBMA 4DV2J 2LVWA 1BQXA 4USVA 4ES3A 4ECQA 3IG1A 4Q8FA 5IT9U 3D7SB 3LPYA 3OV7A 1N33J 4ER8A 4IQXA 1XNRJ 2D69A 4K4UA 4B3MJ 2E1CA 3MAAB 2VQEJ 4JV5J 2CQ2A 2MLYA 2WAQD 3HSDA 5KFCA 1WHXA 2CJXB 3NGUA 2BM0A 2ZBPA 3HVWA 4ZVUB 4LVNP 4P2SA 3D54A 1M5KC 3CT9A 3PX4A 4I0WA 5ETTA 1X5OA 4HDGA 3DLGA 5E33A 1UCNA 1XMQJ 1F5AA 3SQGB 5I3UB 2ZOMA 4KGXB 1S7IA 1WELA 2GMLA 1VQ9S 3B4DA 3D5MA 1LWCB 2C3OA 2K8GA 1HLWA 5KFRA 3CDWA 3TJ8A 1NHVA 4LVOP 1HW8A 1NSAA 1FE0A 1HARA 4OI2A 5LM7E 2W8LA 2LEBA 2YKAA 3K2YA 1VI7A 2ASDA 2FVCA 1CS4B 3A3PB 2XMWA 2KTQA 4FNHA 2YKPA 2R8JA 3BGOP 3LW5C 4TY8B 3NCRA 5KFKA 2I6WA 2ROPA 1KQGB 3WZ0A 2FJEB 3UR3C 2AT1B 4DR1F 4YMEA 4LSLB 1KR4A 3Q8VA 4GO5X 4P2MA 2E5LJ 5C42B 2VOOA 1S4FA 1FF2A 4ZK7M 2B5JA 1NJIT 4I2QA 1X5SA 3H5SA 3KFWX 2MY8A 5HVHA 4DX8H 3JSBA 2A6OA 4P2XA 4DS4A 1JWWA 2PE8A 3US5A 1S0MA 3T3FA 2MZTA 1VQNS 1HNZJ 2QGFB 4DUYF 4ERDA 2IMWP 1V3ZA 2V50A 3QSYB 3LAKA 2IVFB 3H8YA 2W8KA 1MWQA 2EVZA 2ZH5A 3U27A 2ZKTA 2OGUA 4DPYA 1B70B 2OEKA 3QRQA 2GAHC 1X0FA 3J7AN 1IKWA 2WOMA 4ETZA 2KZMA 2UUCF 2EXUA 4DFJA 1JJCB 3R2DJ 3HHNB 3V6DB 4M5LA 1GT8A 2RB7A 2WVBA 2O1PA 1XR6A 1Q86T 2UXCJ 2BJ3A 3PZPA 4NXMJ 1Q78A 3C6TA 1YBUA 2GGPB 4HTJA 3W8GA 1RHJB 2K06A 3KUEA 5KFAA 1VRTB 3QT6A 2ZM6F 1RT3A 2H5JB 1VISA 1V3SA 2CIMA 1KOOA 2PFFB 2HNZA 4NI2A 1C4CA 2M9KA 5HLFA 2RD5C 3KLGA 4K50A 2CDRB 1TL7B 3WBZA 2CPDA 1LWFA 3KLHB 1R6YA 3HMJG 4PG5A 1G4CA 2RUGA 4OLPA 3DRXA 1AT1B 4KPYA 5RUBA 1F3VA 4ILMA 1KONA 4L3KA 3A3OB 1PJ5A 3CDAA 1UPMB 4X4SA 3DLKB 1IBCB 1FRJA 3JYTB 3DRSB 1FFGB 5IC6B 5DDPC 3TANA 2CAJA 1JLGB 1TZ0A 2CUYA 1NK4A 1MROB 3QSIA 3M8PA 1SIWB 1RTHB 4KGZB 3DCAA 3MM8A 4PPZA 4WIQA 3M8RA 3CJRA 2BANB 2LQ5A 4OX8A 2YXLA 1OPIA 5J1EB 4F02A 2GFFA 3GILA 1C1BB 1HQEB 4KV8B 1TKTA 3QGHA 2HWIA 4YFUA 4O23A 1D3WA 1S9EA 1SV5A 4ICLB 2IRXA 1E6YB 4FYVB 4PYAA 4FP9A 3ILJA 2VF3A 3C6UA 4ZDNA 5MAOA 1WG1A 1NRKA 3OVAA 1F3FA 3GIRA 3E2EA 1JQGA 2QO3A 5C2GA 3Q0AA 3UN5A 5CYJA 3PW5A 2YY3A 3CJ0A 3DFEA 4J9PA 5DJBA 2UXBJ 4FYXB 5MLCV 3LAMA 3U7JA 2W9AA 1Y00A 3KK3B 2VODA 1FK9A 3W9JA 5B0DA 5L46A 3D0GE 1FFWB 4NLGA 1TKXB 3PKMA 4HLBA 4NZ6A 1N5QA 4ZJQA 1J5EJ 3NCQA 2IJRA 2B8PA 1VQLS 4K8RA 1EX8A 1H73A 2N82B 4WK3A 4WU3A 5IT0A 2V0NA 4O44B 1WWHA 2B4OA 3JS9A 3QWPA 3D66A 1NKEA 3RU0A 3ICLA 5D0HA 2DYAA 3VAFA 1AFJA 3W62A 3W61A 2QA1A 3T1HF 2WVDA 4NL5A 3MR7A 1TQLA 3PVXA 3K58A 2GC8A 3UD4P 2HVDA 2XY5A 3DMJA 3IRXA 3HT3A 2AWZA 3FBBA 1SCJB 2JLFA 2C22A 2VC0A 3R5BA 2YX4A 4ZP9A 4X64F 3CJKB 3OBIA 1O5JA 2Q1LA 1GXLA 1UWBB 1Q8BA 1NK9A 2Y9HA 3W3SA 3R7NB 3LQVA 1OIAA 2ADCA 2MHEA 3PW0A 2HQDA 5LOQA 3T1AA 4DV7F 1QUVA 3D6FB 1X31C 3VZIA 3DLEA 2YNGA 1CPZA 2JWNA 4AXJA 2IRUA 4Y2CA 3NNCA 2V8HA 3KKFA 2HHSA 3FSXA 3KLFA 4NEZA 2UUTA 4X62J 1SBRA 1Y4ZB 3GMGA 5GVQA 5CD4A 4DFMA 2XM3A 4OYBA 3MMAB 1SKUB 5HANA 3AD8C 1REVA 4YS2A 2LKZA 3IGVA 3OL6A 1S4EA 3W7BA 4C3MA 4NASA 5L1KA 4G1QB 2QZ8A 1W26A 1H38A 1Y0HA 2BACA 2DKOB 2XULA 2HWHA 3BO3A 3D1HA 4J9RA 2KL8A 3CCUS 2ZH2A 5HN0A 4OYPA 4DEZA 3VV2B 2YNIB 2LECA 4GRSA 4F4AA 4KFBA 4P74A 5A6PA 4PEOA 3EX7B 3K5LA 3DOMB 2RQMA 2CZ4A 3R7SB 4ITSA 1HQUA 4CLKA 2OD4A 1NK7A 2APOA 4PQAA 1HW9A 4ELTA 2CJAA 4RW8B 1C4AA 4XPCA 4YR0A 5J2QA 2Y3YA 3DHXA 2VBWA 3RR8A 2C42A 3TNVA 3QGGA 4ETXA 3PW2A 2DO4A 3R27A 1SH2A 1HWJA 4LF4F 3M32B 5FIIA 2OPRB 4WE1A 3HP6A 1ZM4A 1JLCB 4KAIA 2BRLA 3PYDA 3J7Z5 2UUAJ 2E7WA 3CXCR 4QYZJ 2GJIA 4EUVA 1LEOA 5KFWA 2X51A 4DR2F 2C2RA 1JIHA 4DV4F 3Q8QB 3EGVA 1NDKA 2W2MP 1KVKA 3ZZYA 4WTOB 2V9WA 2GA7A 1LWEB 5H9EJ 1R31A 2HS3A 5HATA 1WOPA 1P6TA 3LPEA 1K8AT 4E8UA 3UCGA 3NNHA 1RWNB 2OFHX 2KT3A 4DUZJ 4X4PA 2W9BA 2BE2B 3KUGA 4KY3A 4DF4A 2NQPA 1H2VZ 5HMXA 2MLZA 2HNYA 4OHZA 5D78A 1WSVA 1DQAA 1RADB 3UE2A 1F1BB 4OMFG 2A1BA 5F0UA 2XNQA 1HNVA 1PC4A 4CQ1A 2OELA 4MKYA 2FHOB 2EBGA 2CVEA 1F0XA 1I6JA 4CIOA 4RL1A 5GMKa 2W24A 3RBDA 4DWIA 2H9ZA 3M6WA 3FMWA 1DAXA 4UOCA 4CO2A 4N77A 2DIVA 5EUHA 2XGQA 2HBRB 4IKAA 4RW9A 4EBEA 5E5NA 1MNEA 4KKOB 3CDBA 2CFXA 2VBXA 4ZITA 4KQZA 5CAAA 4USTA 5D6GA 2CJBA 1Z1ZA 4I4BA 3K17A 2AQ4A 5JUMA 3OR1B 4NCGB 1FNXH 2HS4A 2YWGA 1RT7A 2XZTB 2KRRA 3I0SA 4RNOA 4WK1A 4OHVA 5LMUJ 1WNEA 2FJWA 1KQKA 1RAGB 2KVQE 1T9TA 4RNFA 3CPWR 3O8WA 3UVJB 3M2VB 4DSEA 2J76E 1EZZB 3EWGA 4TVAB 5KFGA 1GFWB 2YVSA 3K57A 2OPSB 1D8YA 3ILOA 3Q86A 1RLCL 4Q5VA 1TELA 2XHWA 2EI5A 3C8YA 1RJJA 4ZPDA 2JL9A 1B4SA 5K8NA 3G6VA 1ZZNA 1LW2B 4RW7B 2XY6A 4HEA9 2DHXA 2RKIB 2P9CA 2W9CB 3MUMP 1QSLA 4C11A 2YNFA 2AJ2A 3GCWP 3AFGA 1FHTA 1K47A 3KK2A 4IG0B 5T7LA 2UU9F 1JLAB 5DG9A 1I5OB 2GO8A 1DARA 3I87A 4R5PB 4PRFA 2QEXS 5M2RA 1U6BA 3BQ0A 4ID5A 1T9VA 2FIUA 5F41A 3KUHA 4OHXA 2FQQB 4PUOB 1OY8A 3D28A 4IH5A 4PCQA 2M8DB 1I94F 3MEDA 3D2WA 4K2JA 1YK9A 3G82B 2KO1A 2HMIB 4P71A 3OLBA 3M9NB 1VBZA 4BCAA 2ZOGA 1RTIB 3FJ2A 1SL0A 5BYRA 2HQIA 2Y0SD 1Y9OA 1FJGF 1RT5A 4DN0A 4DQIA 3K8VA 1S1WB 1S6UA 1K44A 4ANDA 1FKPA 4X4TA 1RISA 5CCMA 1BWEA 4Q43A 3UPFA 2HGLA 3DOLB 3MTKA 5IC4B 3HM9A 3D6MB 4WFBQ 4WIIA 2WVCA 1RHMB 1ZBTA 4WZMA 3TAMA 4YHHJ 3QO9B 1MWYA 3FUYA 3R2CJ 3I96A 4X4UA 2FJXA 1S10A 2UZAA 2UXDF 3L7OA 4CT8A 4B9MA 3A13A 3GIMA 1SB6A 2MY7A 1KQFB 1B0TA 4ECTA 3TARA 3RZAA 1YKWA 3JAMY 3OD2A 1AFIA 5CD4H 4P10A 2A18A 5B0AA 4PWDB 2MSSA 1HBMB 1A7GE 1RTDB 2Z58B 5B0BA 5AT1B 3BGFA 3CO0P 2RVJA 2R7WA 2E1MC 5BR8F 4PG7A 1SPBP 2ZVIA 4ZLNA 1DTTA 2NLWA 1JJHA 4EO8A 5CYQB 1LW0A 1EIYB 1V5IB 4DR1J 4DF8A 3NGDA 2PMZD 2EG2A 1ZETA 1X0PA 4LQ3A 2B6AB 3M05A 1VFJA 3L95X 4WFYA 2F63A 2CPYA 4DQPA 1PBUA 3R3TA 2DGUA 1WSRA 4C8ZA 1NLKL 2PGCA 2XMMA 3TVZA 1OYDA 4B3SF 1EQMA 3L3CA 1I51B 2FY1A 3KG4A 4JI3F 1N54B 3B54A 1KEKA 2EEYA 5D0GA 1L5UA 4USKA 5F3ZA 1UEUA 2UUCJ 3T9NA 3CF5Q 1SC3B 4K4WA 4WYLA 3IG1B 2VQFJ 1RWOB 5LXYA 3D0HE 2MQ8A 1QE1A 3P5TL 1NAQA 1RAHB 4RNNA 2DHSA 4CLYA 4GMKA 4L73A 1UJ5A 2ZM6J 3EVMA 2OH2A 1K1QA 5J2NA 4KJIA 4CTAA 2W1BA 1HKAA 1CQMA 4QYZK 4ECVA 4EZ9A 3DLGB 3FBCA 1VR6A 3THPA 2EC0A 2X1BA 2R2RA 1VQPS 2C3YA 1VC5A 3FEZA 1FDDA 4U7CA 1WDTA 2XWYA 3CW2C 2ZZNA 1UEKA 2KZZA 1NK8A 2BV3A 2RDIA 2HZVA 5CHCB 1FA0A 2DY1A 5HL7Q 2MEWA 3H2VE 2QLXA 4EZ6A 3CJ2A 3G2XA 1TTHB 2GJ2A 2DPIA 3BO2A 2DR5A 2C2ZB 2I38A 1WI8A 1ZM9A 3CDUA 3PRDA 4Y0FA 1YJVA 4J9VA 2R7VA 3Q8RB 2HSEB 1ZAXA 4UOHA 1U24A 1G2EA 5I3QA 2V8PA 3QFWA 3FEXB 4EYIB 1SXLA 3VGVA 5DG7A 1NM2A 2NUHA 3JTOA 1AA1B 1WG4A 3D1OA 4IDKA 2QN6B 2KDOA 3MWBA 4C8YA 3RRHA 2B5JB 2PA3A 4I2QB 1J2VA 2Q6BA 3A12A 4WF9Q 5KT6A 3LGMA 4QWBA 4I64A 2XLKA 2PT0A 2ATLA 4CM0A 3K0JA 1RA7A 2QT7A 1RHKB 1RU1A 2K7JA 4HHHA 3AD9C 1UA0A 4H4MA 2YKMA 2NXJA 2M4MA 4RBUA 5DQGA 2OJ3A 3WIVA 5BJRA 3C16B 4M95A 5DO2A 4RWWA 3NG8A 1GMUA 4BC7A 3W2VA 3CE8A 1IKWB 1HWLA 2WOMB 1R8BA 3J7ZT 4I56A 4NA2A 3FQLA 4YP3A 2ROGA 1RBAA 2R7SA 3VQSA 2Z30B 3JQKA 1S1VA 2D7SA 1CLFA 1FEEA 2BE9B 3MZIA 1AB8A 1S12A 3IR7B 5E7OB 3KK1A 1UP1A 1B3TA 3C6TB 3DM2A 2G0IA 4OIXA 2RDDA 1BLUA 2C3MA 1RT3B 4LREA 2G4BA 2HNZB 4NI2B 5K14A 5HLFB 5KFYA 3KLGB 2BZ2A 1T8EA 3OTCA 3ETOA 1LWFB 2P9EA 4TYAA 4ZVHA 4OX7A 3KYLA 1U4BA 3W65A 3T6BA 3PG9A 5F8HA 2OMLA 3CIZA 2H4WB 3QMQA 4C98A 3R5AA 1FRKA 4I1TA 4DSKA 2KI2A 2EC2A 1U47A 4P73A 3QZ7A 5A76A 3BDEA 4X64J 2D74B 2R7QA 1SQGA 1KSPA 2C1EB 3FDSA 4QW8A 3SDEA 1OS5A 4DCOB 2JEIA 1QAIA 2ZHOA 1GXTA 2N3OA 5DQHA 5KFSA 1R8CA 2DRBA 4Y2AA 1YBAA 4IYQA 3NCPA 5D8HB 4K5SA 4J5OA 1Z4UA 3M8PB 4EK2A 2RMLA 3MM8B 1FX2A 2Z2ZA 1UVKA 4PR6A 5DDQC 2NREA 4WYWA 4I6YA 3SMZA 2MQNA 4CO1A 2E66A 2RRAA 2V2KA 1BQMA 1TKTB 1FXLA 3CGIA 3SV3A 4XO0A 3MM9A 3G87A 5H9FK 4O4GA 2K3IA 2UVRA 2QYGA 2UUBJ 1S9EB 1SV5B 2JEFA 1H0HB 1CJKA 1KLMA 1PAUB 4K7QA 2JZ5A 1VK3A 2Q79A 3AOBA 1UA1A 5KTQA 1RWKB 2P5VA 2V69A 3HXMA 1EAYC 1M1GA 5GMEA 2VG5A 4PWWA 1FRXA 1H7WA 4RZRA 4E2FB 3LP2A 2RT3A 1MN9A 2ABYA 4RWXA 2J6SA 1XK8A 1RKJA 1FK9B 3R1LA 3RBXA 1NK6A 3VGTA 3LOUA 2IC3A 3J81Y 3SQGA 4C8NA 4ZS6A 2CQ4A 4X84A 4U6PA 1IM6A 3VAJA 2JH3A 3CJ5A 1IUJA 4OV1A 5CA5A 2DIUA 1UJ6A 2LLZA 4KHMA 4LF6J 3UFCX 2YKNA 3TA2A 3BEGB 2LU2A 1YJ7A 3RG6A 3QZ8A 2BE7D 5KFMA 3M8SA 2BKNA 1VLYA 2QFIA 3FZ2A 1T0TV 2QJ3A 2BXJA 4OJGA 1JNZB 2W2QP 5LXRA 3VF0B 2CNNB 3UQSA 1N48A 1W2IA 2ZHBA 2XLIA 4KE5A 5K8OA 3QAEA 2DNKA 1NO8A 3OFHA 4FZVA 4NLXA 3UWTA 1IQTA 3I6PA 3IRXB 2HRUA 4Q2MA 2NS1B 4M5GA 4F3OA 4DR2J 3EM1A 4DV4J 3BQ1A 3TZWA 3CMQA 4DLEA 5DG8A 1NPKA 4DX7A 3HDSA 1SVDA 1S49A 2A0FB 5A2QY 4ZVTB 1NXIA 3DLEB 2Y1RI 2YNGB 5L9XA 1E6VA 1S0VA 3JSRA 2ZC4A 2VBYA 4MKVA 3VGUA 3KLFB 3G71S 1KP6A 1TL3A 1ZTWA 2DISA 3VVTA 4Y6IA 2B7CB 3EMTA 3D3CJ 1R27B 1DZ5A 1REVB 2RJZA 4JI7F 3WC2A 4M5MA 5FJ4A 2CWKA 1QTNB 2J0QD 2MPUA 3MPUB 3ILLA 1ELOA 2YH0A 4X2BA 3THVA 5KFNA 2VKRA 2RF2A 2PEHA 3IBFB 1GTEA 1SKRA 5HMZA 1KDNA 4KH0B 2MQOA 1EETA 1KD1T 4C3KA 2XTJP 2DNMA 4X4NA 4EU0A 2OEJA 5F9LA 2ZOFA 5IWAF 3GYXB 4ECSA 4B17A 1JXLA 3BGRA 1YG0A 3BKTA 4KFBB 4DFKA 4Q44A 2XCAA 4DPOA 3VHQA 2HRYA 3I5AA 4ZPWR 2IBKA 1Y11A 3MCNA 2XZDB 3EJMA 3GU0A 1GTHA 3GQCA 1HQUB 2DJWA 1QSSA 1WDDA 2NSBA 4KGVB 3M1VA 2CG8A 4JI8J 1A0OB 2QSWA 1KLNA 5BYSA 3IR6B 5JVGQ 1ZOTA 3MECA 5J2QB 5JMNA 2VPXB 4JI1J 1N5VA 2H65B 1D8ZA 3RYLA 4OZJA 1JKHA 5KG5A 2QIFA 3TUJC 1ROFA 4TYBA 3BYPA 4LFAF 2BOPA 4LR7A 4DQRA 4WE1B 4O3QA 2A3JA 1TUVA 4NLDA 2LDIA 3BJYA 2R2TA 1T94A 2W2OP 2QL7B 3KNAA 4ED1A 1BUXA 3FFIA 4OYXA 3CJ4A 2JVOA 4OLOA 3IA0A 4CLTA 3H5XA 1NMEB 2HG4A 4URSA 3Q89A 2MKKA 2UU9J 2QRRA 1QJHA 2DXDA 2RU3A 3UN2A 3JAMU 3MM7A 1B0VA 2J6TA 2KFZA 3VAHA 1R43A 1CEZA 2BMBA 3Q8PB 4ECWA 2A6MA 4U8YA 3IO1A 4XK8C 4NCAA 2XGPA 2FZCB 1I94J 2VICA 4DL4A 3LWMA 1VRQC 2W9BB 2AIRB 3K5OA 4N76A 1RBLA 1FXDA 3H98A 3CCLS 1WC1A 4UW2A 2YPYA 2HNYB 2KXHA 1SC1B 2XO7A 4AD6A 2MSTA 3K89A 5I4MA 1HNVB 1FJGJ 1WEZA 1HMVA 2Q43A 3BO4A 5B08A 4AE5A 2AEFA 4WFZA 1YJTA 1SJFA 5DDOC 2SXLA 2O01C 1GQEA 4C0HA 3CD5A 3H59A 2IVYA 2CNOB 4H4KA 1RZMA 4KRWA 2D9PA 3AQPA 2KKHA 4RW9B 4U9RA 5C25A 1TL5A 2UXDJ 2FJDB 2B56A 3RB0A 2V6AA 4DG1A 2MZRA 3ILIA 1H98A 1TVRA 3QRRA 1SH0A 1KOHA 2CNKB 2P2CB 3ENWA 3MCMA 2JHEA 2M7SA 3I0SB 1RT7B 3R6LB 1LKZA 1X9MA 1FJ7A 2QLWA 3AH6A 1RTZA 3CWJA 4OZNA 1A6LA 5E3AA 2QLBB 1IWAA 3CJKA 2ZBIA 3Q24A 1N36F 3CJSA 5BR8J 1KRPA 1VRUA 1IJFB 3RB3A 1EJ7L 1SKWA 5ETVA 1VQ6S 2E5HA 9ATCB 3DKDA 3FK4A 4TLQA 3NGSA 3BH7B 3G96A 4N8OA 1AUDA 4DV3J 2QV6A 2CPEA 2FC8A 3FNNA 4J90A 5AXKA 2ZWPA 3AODA 4BWJA 1TUGB 2GS8A 4C11B 1FO1A 2YNFB 3C15B 3QBCA 2G2ZA 3L09A 4DDFA 3KK2B 5T7LB 1YRTA 5KFXA 4AL7A 5HP1A 2NSCA 4D3HA 2HK2A 1FFSB 2IBOA 3MM5A 3NAHA 5ETLA 2G13A 3T5JA 4B3SJ 5D77A 3MCOA 1SL2A 4ID5B 2DPJA 1SJ1A 3RR7A 3L7UA 4RUBA 2P9GA 1LNQA 1UW9A 5ETRA 4JI3J 4C9DA 2PIIA 2JVRA 2QMWA 3D3BJ 1DLOA 5B0GA 2MQMA 2ATCB 3F56A 4F0MA 3B82A 2GIRA 5EHHA 2D41A 3MEDB 2ZITA 2JSXA 4KGKA 2AF6A 4PAAA 3JXOA 3TEHB 1WKLA 1VJQA 2XQCA 3IWLA 2CPFA 3QGIA 3EDRB 1NKCA 1EHWA 2ADBA 3QAUA 1SC6A 1RT5B 1CC8A 4QWDA 1PKUA 1FKPB 2HFZA 1PYOB 4QU7A 1ZM2A 1GX6A 1I3OB 4ILLA 4Q7AA 1Q16B 2VFRA 5EWFA 3DLLQ 1M90T 3OT9A 3TAMB 2KT5A 4U67Q 2BQRA 2CQCA 3FKBA 2ZH6A 3MD1A 3PRVA 2O3DA 2XYPB 2QLJB 4JI4F 5HVGA 4DFPA 2B7BB 1JB0C 3CJTA 2P6TA 5GADU 4O3NA 2HURA 3OHAA 3UR0A 3UN3A 2G2YA 3PFEA 1AYEA 4UZBA 5AE2A 3P96A 2PA8D 1RWMB 2VC1A 1C0TA 3ZC4A 3D68A 3BF4A 1T11A 2WRMA 4OZ5A 4DU7A 1OSCA 1DTTB 1NB2A 2EKNA 3HO1A 1RTJA 2D3UA 2J5AA 1D09B 3GFYA 4F4KA 1I1GA 1LW0B 3NGRA 3E8OA 1NDLA 4WZQA 4RW4A 4RBTA 1FE4A 2BW7A 4QR0A 4LRAA 1Q8KA 3CIMA 4V1Ak 2DTJA 1CVJA 3EDQB 1U7LA 2KXFA 2MYFA 4CO3A 2BJEA 8ATCB 5AE3A 4N8NA 1QVFR 1VQ8S 1GEHA 3M8WA 4YB6A 4C8KA 3MEGA 2B8QA 1U49A 4CYUA 4QWEA 4LRFA 3MDFA 3MURP 3HHLA 5LT5A 3HFVA 4K4SA 3V4MA 3BSAA 3HVTA 2GIFA 2UVUA 1P9YA 2JC0A 2RQ4A 5ETKA 1S9GA 5GAHU 5HI7A 2IPOB 3JSMA 2YWFA 2CRLA 1KNZA 2KFYA 3EZOA 4HL9A 3IMQJ 2ASJA 4TLRA 2RILA 2C2MB 3I9V9 2J7WA 2DHGA 1QE1B 2FB0A 1YLXA 1FVSA 1HI8A 3KJFB 3V5RA 2R8GA 5KG0A 4C2MA 3NRBA 1P8GA 2IJNA 4HYKA 2LDYA 3QLHA 3ADAC 5J2NB 4DPXA 3VAKA 4CTAB 3WX8A 5KT2A 4DZ6A 5KFJA 3FCWA 2OUGA 2U1AA 4M5IA 2AGOA 2FLLA 4NLUA 5KT7A 1NHKL 3QGPA 2D3OR 2LXFA 4NMLA 2X7IA 1WEXA 4CWBA 4HACA 2EFGA 3G86A 3J81U 4OYIA 2ZNYA 3K8WA 3FRZA 1JJ4A 1M5OC 2CA9A 2W7AA 4ANCA 3CCJS 4ED8A 3W9HA 5KAKA 3T1YF 5I3PA 4LR9A 4CNYA 1X4DA 2VIHA 3TJAA 1WC4A 1DFDA 2DNZA 1U45A 3TZZA 2EWHA 2OTJS 2GQCA 3ZZTA 5JVHQ 1WC3A 4JB8B 2MZQA 4DSFA 4CP5A 4IUFA 2FZGB 1QAYA 4KPCA 1S0OA 2DGXA 2MKHA 5LJ5Y 1UVLA 3VWSA 1BD6A 5LSLA 5F3TA 4ZP6A 2IDEA 2AP6A 2DITA 2WONA 3VAGA 4FVCA 4IDKB 2YH1A 5DLFA 3TAQA 1KTQA 1HNWF 5HJXA 3ELHA 4A8MP 1WF1A 1D9AA 3O44A 3WX4A 1TMMA 3H4BA 4MK8A 2EFVA 3GIIA 2XNRA 3MGJA 4H4MB 2YKMB 4ELUA 1S1WA 1LQ9A 1XQIA 2RRBA 2B0GA 3IBWA 4J91A 2FJAB 4R0EA 3NAIA 3I5CA 3W2VB 5IXUA 1HPZA 6FDRA 5C7PA 5A2QU 4MMOA 4Z2XA 4YY3F 4IR1A 5ETMA 2BABA 1S1VB 1VIOA 1UMJA 1NSQA 1GXUA 4XAKA 2FD2A 2AW0A 3KK1B 3MEKA 4AYBD 2FLNA 1HBOA 3DM2B 5EGYA 3P49B 4FNIA 1RE1B 5EX3A 1S6OA 2I9SA 3A8EA 3LP1A 4JI2F 2M3DA 5K14B 7FDRA 3FZBA 4ATNA 3SV4A 2HK3A 3F44A 4P72A 3AB4B 4M5JA 4PG4A 5HQLA 2J7UA 2E1RA 2K2PA 1O51A 4DS5A 2MZSA 2ROEA 3NMAA 2HKEA 1RBOB 4ZP7A 1HWIA 4USJC 1EKRA 5EWGA 1M1KT 2V2VA 3I4PA 2WCXA 4RUHA 3NWGA 3D67A 3UI3A 2ALYB 1UZDA 4MAKA 1HD1A 3I82A 3V6JA 3QRPA 4L3NA 3LGNA 1UFWA 1WEYA 2CQHA 4N5SA 2Y8WA 3GWCA 3SDEB 1B7FA 3M6XA 1RYRA 5KFFA 2LMIA 2AGPA 3B8HA 3B4MA 4OHYA 3W5XA 1KKHA 5KFDA 4LF8F 2X3GA 4HR2A 2PMWA 4MJKA 5KT4A 1CJTA 2PSZA 4DQQA 3VGSA 1BQMB 3N6NA 3IN5A 3MM9B 1SC4B 2EK6A 4O4GB 2ALZA 4BHQA 1CJKB 1KLMB 3ZO7A 3RGIA 4LQ9A 3CC4S 4JI7J 4ZLPA 2RS8A 3HJFA 1HYSA 4WPAA 3DLHA 2VG5B 1RI7A 3U02A 3MAQA 2ILYA 2KYXA 3DYAA 3KJQB 1GX5A 2E7VA 2LA6A 1RAFB 1N5SA 1IKXA 5EDWA 2R4FA 3LP2B 2EFNA 3FGVA 3HI9A 1RGVA 1X4BA 4FBUA 4DL5A 2AZ1A 4LF2A 1IWGA 2IC3B 2F1FA 4UZCA 4GKKF 3NKYA 2AJ1A 1X8DA 2E1PA 3EGZA 1XMOF 3W5ZA 4JP8A 2FGCA 1Q5YA 3W66A 5A8RA 3ZTPA 3C3LA 2IJFA 3TW0A 2IA0A 1V6HA 2F9DA 4QPTA 2F7VA 4O0NA 2OHDA 1SIZA 3SIPB 2YKNB 2M0GB 3IGNA 4OZ3A 1DQ9A 4L75A 3PYEA 4F4YA 2BJDA 3AA9A 4K4ZA 4ZN1A 1S1TA 2BA9A 4YR3A 4MYUA 2ACYA 1N33F 3UCUP 2HNDA 2NXUA 1XNRF 4LFAJ 1RACB 3N0VA 3MMJA 4DL7A 3H25A 1Q81T 3C14A 4JV5F 3NGKA 4ES2A 2QL9B 1QAXA 3V6KA 3WIUA 2JJ4D 4WJBA 2R8HA 4X4OA 1NPPA 2WW4A 4DPUA 1FX4A 4IH7A 3RW6A 4ZP8A 4PYDA 3CJ8A 2GVZA 3TVYA 1M5PC 1XMQF 1SQFA 2I1RA 4UQGA 1IKYA 4MFBA 3GCXP 4LSNA 1N34J 1SQEA 1S1UA 4CCHA 2J9EA 2FHJA 4FF3A 1K0VA 2C2KB 4ED7A 1E6VB 1UEVA 1XR5A 1R7IA 2DHAA 3C16A 4LRBA 1QTMA 3PR5B 1NH8A 1K9MT 1OPZA 1TL3B 2RQKA 4OI6A 2NZCA 1IBLF 2RHQB 1F5BA 5GAGU 5A6WA 2DNNA 2VL1A 3GV5B 4FXVA 3M8ZA 2FHJD 2MKCA 3M30A 3QPIA 1U2RA 3SEOA 3CNQP 3BR9A 2DNHA 4X4QA 5JXSA 5DS7A 2RF2B 3TA0A 2NPIA 1YHQS 1R6VA 3EVWA 1IQZA 3LP0A 2YBVA 4B3OA 3F41A 1EETB 1GMVA 2VPYB 2Y1LB 1Y5LB 5GADI 5J2PA 2U2FA 3T41A 3BGRB 4NE9C 3A8KA 1HNZF 5J1PA 3P6YC 3KLIA 4C7QA 4I69A 1UKUA 5KG6A 4N56A 2MGZA 4FS1A 2N4DA 4KBIA 2ZKUA 4OYZA 1VCTA 4YR2A 3N6MA 1WKKA 2YWHA 1RT6A 3M1VB 2HHPA 2W2NP 5DQIA 3I31A 2BJ8A 2PC6A 2OKQA 2DNPA 1RDRA 1HWUA 2QX0A 3MECB 2PI5A 3N28A 2M88A 1M5SA 4Z7CA 2F4VJ 4RO0A 1N36J 1KFDA 3R9LA 2UVVA 1JKHB 2HQGA 3GZ7A 2XY7A 2ILZA 3AQOA 3KMSA 2HGMA 3MPWA 3O6QA 4J37A 3DU6A 2UXCF 3GSDA 3PY8A 4QIEA 4NXMF 3JSYA 1F9EB 2OPPA 2ASLA 2VJVA 1LFWA 5E3QA 2QMXA 4YDDB 3FFIB 5D0EA 1RLDA 2V2ZA 3SFGA 1AZSA 1VC0A 1RAIB 2QYCA 1KC8T 4CO4A 2PI4A 1NJWA 2HQFA 2HFNA 1QSYA 3MM7B 2Q66A 3QT7A 4PZVA 5DLGA 3SCLE 1RAJA 3MMBA 5CCLA 2G0JA 2OIHA 1SI9A 1SJRA 1F60B 1XC9A 1R3NA 4EYHB 2KHCA 4DCJB 4K4XA 3NP5A 4RX6A 1QAJA 1RHQB 4IG3A 3OR2A 3SYZA 3MR5A 1Q0NA 3M2RA 4B3TJ 2C2NA 3EXCX 1ITPA 3ZXWA 1FKAF 3GYNA 1OSDA 1WTBA 3NBPA 4O3OA 4URQU 4ILRA 1GAOA 2CPXA 1HMVB 2JRSA 2LXUA 2EKYA 2FZKB 2BYCA 3Q83A 2GW8A 3TO8A 2CPZA 3S8SA 5DZ7A 3QQCD 4JI5F 4MK7A 3WC0A 4DV5J 4FPIA 1FWKA 1KWMA 3GSIA 4NLWA 1SL1A 2HQ3A 4X65F 5C25B 2EPIA 4USUA 4DR4F 2V9KA 3ZTQA 7FD1A 2BQUA 3N01A 2AJQA 3EGWB 4DG1B 2CJKA 1UFKA 4W4MA 1TVRB 3G6XA 4ZPBA 2IM2A 4A8OA 5CH7B 2L9DA 1KS2A 2ZD1A 4ZCKA 4F2SA 1YRXA 2OAUA 1L3UA 4YEAA 4YB7A 3H4DA 4ZJOA 3HD1A 3LANA 4HT7A 1QLNA 1REGX 4KC5A 1FDBA 3PTWA 4LBIA 2BDPA 5D3GA 2A2DA 2BJ1A 3CCWA 2FDNA 1VRUB 3LALA 4RU2A 1KTVA 3MPDA 2HIQA 5A8KA 4NEYA 2HLTA 3ISZA 3FC9A 1S1XA 3QIPA 3TZXA 3PXGa 4RNMA 1IBMF 4NA1A 1RABB 4TNOA 2W01A 3HHDA 3OLAA 1N0VC 1U1NA 4GO7X 4ZVSB 4FF2A 3PDNA 1HL6A 4EI2A 2PN6A 3OFEA 2H4YB 1PG5B 1SJ3P 5HP1B 1HFEL 1YRUA 1DURA 3MM5B 2J9DE 2DR7A 3QNWB 1HI0P 1X60A 4RPFA 4ZHRA 2F8MA 3ENVA 4QW9A 4KB7A 1RAEB 4NCBA 4EWTA 4WTYA 3AY0A 2ZH7A 1VC6A 4J9OA 1DLOB 2B43A 2ZJQQ 5C5JA 2R7XA 5KFUA 2P8IA 3FMBA 2XWXA 4TKTA 3O1LA 3D6HB 3A1YG 2B4VA 4OZ0A 2R3VA 1N0UA 1ZA1B 4RU9A 5IQ6A 4ZOSA 4QOTA 3PCOB 4X4RA 1P27B 3KOAA 3CSKA 2C2EA 5DZ6A 1VBKA 2DNRA 3N6LA 4K0KF 5DM7Q 2LP4A 4J9KA 3PEJA 5D4PA 1MW7A 4X62F 4NYOA 4LFBF 3PIOQ 1IBKJ 3GP9A 2HVZA 1CJUA 1UAWA 2YKOA 5KFBA 2MKSA 2BQ3A 5D4NA 2XSJA 4DR3F 2V5HG 4OX9F 3UO0A 2HGNA 4QQBA 1NEEA 2VD3A 3GJRB 2QA4G 1NNDA 2I5JA 1FTRA 2E44A 2BUNA 4FDFA 3ET6A 3IR5B 4TU9A 1X4HA 5HQMA 4FPRA 3GJTB 1ZAVA 2IAJA 1Q4RA 4DN9A 1PC5A 1LOUA 3VAMA 1C0TB 1C0UB 2MDAA 4N47A 1RTJB 2BW2A 3HX9A 3MD3A 2NXCA 1KHVA 2VH7A 1RT1A 5IT4A 2FTRA 5L9NA 2ZUGA 4RW4B 1D9DA 2X1FA 4NLQA 3U1MA 5KG4A 3GLJA 3PW4A 2VZ9A 2MZ1A 1HNWJ 3TWZA 2ZDPA 1F5CA 1S99A 2CVIA 4QWCA 5D0RA 3PM9A 4Z37A 3MUTP 1TAQA 2IDLA 2DH9A 4PQUA 1YJNS 4S0MA 5F8MA 3SCIE 2CQ0A 5IQQA 3MEGB 3BB5A 4Y2MA 2IHR1 2LXIA 4CYUB 4U96A 2HS0A 3HHLB 3IFEA 4C8MA 4Q0BA 4IFVA 5DGAA 3SXLA 3HVTB 2CKWA 5D4LA 2B9EA 4WCEQ 3ZFVA 2DVIA 3BKFA 1S9GB 4JYAF 1WHWA 1C2PA 3JSMB 4YY3J 4Y65A 4BLGA 4OZ2A 3GV8B 1DQ8A 3M8QA 3GIKA 1YGYA 2YTCA 2AHOB 1DHMA 3GR0A 2IYGA 4JI0J 4F50A 2MB0B 1RUSA 2ACMA 4QPXA 4HI1A 4B08A 2PO4A 1ZA2B 2FYXA 3I5BA 4M8LA 4JI2J 3QLHB 1ZAWA 3NY0A 1XMBA 4RUCA 3ISND 1VBYA 3U1LA 4DHVA 1NDPA 4ALZA 1F9FA 1RP5A 2XB2D 3D4JA 2FJBB 2IY5B 1KVIA 1ZPWX 4IOCQ 1SUQA 1IR1A 3Q23A 5DDRC 2W25A 1YJ9S 1MMLA 3P5BP 8AT1B 4HACB 1TR0A 5HSPA 2F8EX 1FD8A 4O0IA 1SJQA 2KH9A 4A8WA 3BDPA 1BXNA 3QJJA 2DGTA 1U1KA 2XG8A 3NGTA 2G2OA 4F4WA 5B0CA 3W63A 2ZUAA 3H40A 4C0OC 3C15A 4KHPF 5HMWA 3FEYB 4LF8J 4JOUA 2NUUG 1RA6A 3I55S 4HH1A 4M94A 3PJXA 1S9FA 1NCLA 3PKYA 1S57A 4X4VA 2V8DA 1G1XA 3DRRA 5GAGI 2VOPA 2WONB 4OX6A 4DU8A 5LMUF 3EXYA 2AD9A 3KTQA 5LSOA 1RCXB 3Q8SB 4O3RA 1UVJA 5F8NA 5KFZA 1B7YB 4ENOA 3CUNA 1YJUA 2CYYA 1IKVA 3DDIA 4EMDA 1MU2A 4F3QA 2MJUA 5KT5A 2CDQA 1NK0A 4IH6A 5CABA 3PR4A 1UETA 1U1MA 1XIQA 5H9FJ 4M5DA 4CLZA 1BE4A 4J9MA 1O0PA 3HT0A 1HPZB 3PFOA 4WP8A 4GKKJ 1NDCA 4ZPAA 1XMOJ 5KFLA 4PXBA 4EBDA 4ZJLA 2YPZA 4H4OA 2Z2YB 3OL7A 1BWVA 1UFLA 2LYVA 4DCPB 2HIYA 1SJ4P 1RWXB 1HBOB 5IS2A 3RUBL 2HHHF 3TOQA 3MI7X 4B9VA 1GNKA 3FBFA 1LXJA 4Q8EA 4KO0A 1JNRB 2AJ0A 2D3ZA 3LP1B 4DQSA 3LA0A 1U02A 3MUVP 5HK4A 4A8XA 2HHQA 2K1RA 3CC7S 1OY9A 3SZ2A 1GH8A 3CCZA 1U25A 4CH0S 3ITHA 4H54A 3G6YA 3TA1A 3W64A 2EBEA 2ZEJA 3HPOA 2R7OA 2XMUA 4DV0F 2DNQA 3PNIA 1TKZA 1RWVB 5FD1A 5KFHA 3LWLA 2L08A 4UQTA 1S59A 4ECZA 1AUSL 4ED5A 1HI1A 3UNGC 2J8AA 3PX0A 1DBDA 3MEEA 3I32A 4PXCA 3CTRA 2V4RA 3C2PA 3T5HA 4E0DA 4ZIWA 3EVOA 4YHHF 2Y0BB 2K3KA 1Q8LA 2YX1A 2PD1A 4DUYJ 2WVEA 5F8GA 2E7XA 2KG1A 2GO9A 1HIYA 2DGSA 3M2UA 5ADZA 5KFEA 2DRDA 3KMQA 5I42A 3A3NB 2R8IA 4OJ1A 3DRPA 4B02A 3CCRS 4ED4A 3F0NA 4XDDA 1QDUB 1FXRA 2K7KA 2DGOA 1CJTB 5A8WA 4OV6A 2R2SA 4LT6A 3KJVA 4FF4A 4DX5A 3KHGA 5LJ3Y 1H3DA 2WB4A 4Y2KA 4ZIVA 3HSZA 1DRZA 3JTNA 1IBLJ 4J9UE 4OI1A 4EO6A 2XMAA 3KHHA 3OFGA 1BC6A 2R2UA 4TU8A 1HYSB 1P9QC 3HFKA 1T9YA 3DYAB 4PABA 3MFIA 1IXKA 2B9XA 3POTA 1DTQB 1IKXB 3HHLC 4D3GA 1R0AA 3IM9A 2MKIA 4NRUA 2VG7A 1W7WA 1X9SA 2WW8A 5E2QA 1TFWA 3HHKA 5U47A 2FPHX 4F2RA 5D15A 4AUKA 1ULRA 2XLJA 2MQQA 3NS7B 3V81A 1TU0B 1Q8IA 4IFYA 3WDOA 1YJWS 5E3RA 5ETPA 5A8RB 2E5JA 3M6UA 3R5GA 2D9OA 1WC0A 2AX1A 4PWUA 4Z7YA 2WSCC 1EQ0A 3G4SS 4GKJF 4A48A 4JV1A 4FYYB 3Q8UA 1V3RA 4M1KA 3NLCA 3OTBA 5EN1A 2LEAA 3OXLA 1RT4A 1VMBA 4FYDA 1S1TB 2VQFF 2GHVC 5M2UA 4L74A 2HNDB 2DY9A 3MTJA 2COLA 3I4HX 3C14B 4L76A 1L3KA 5C24A 4BWMA 4AT1B 2G9OA 4MH8A 1S6PA 3GE9A 1MMDA 5G0RA 2HAIA 4NLOA 3E01A 5CZXA 4GVBA 1OYEA 3JQMA 2GVZB 1L3VA 2XI3A 3H42A 3HKZD 4IRCA 2ZFHA 1VBXA 1IKYB 4F3MA 2QA2A 3Q2TC 4RW6A 4MFBB 4P7VA 1Y3JA 4LSNB 1WUUA 4AXIA 2F40A 1S1UB 4WFXA 1YITS 4NRTA 4L6V3 1WI6A 2RHSB 2MMYA 4G1IA 4UY85 2HFOA 2YWWA 3DGPA 2VG6A 2FVSA 3BZQA 1HHTP 2BR0A 5E3PA 4FBTA 2QL5B 2RS2A 3AHPA 1UWAA 3FCVA 2VA2A 4V19X 2F5GA 2IYIA 3UDLA 1NK5A 4ECXA 5LMNF 1UVIA 4HDHA 3OL9A 3BR8A 1N6QA 2J9CA 3M30B 1JMTA 2VV5A 1S48A 5IV3A 2C2OB 3W5YA 3W2WA 4QR2A 1XERA 3FSYA 2OO4A 4JI5J 1U6FA 1XWLA 3LP0B 3UDVA 5CYMA 4B3OB 2F65A 3DOKA 1RWWB 4V19J 2LCWA 4ZLLA 2OD6A 2J0XA 3HVRA 4OZ1A 5J2PB 4X65J 1IJEB 2BBEA 4NYZA 3T1HJ 3QFHA 3CMES 4DR4J 3L4BC 5L8RC 4LRDA 1FDAA 4P9SA 4OI3A 5K9FA 2BJ9A 3KLIB 1HQ2A 1TL4A 2MGZB 3KWMA 4FF1A 4TQSA 3KLEA 3TRGA 3MFHA 2BEFA 4R8UA 1RT6B 1VQOS 2ZBCA 1Q95G 3TJ9A 5HBMA 1NB7A 2FGOA 1O6XA 4DL3A 2MTLA 2AJ4A 3H0PA 1JLFA 1G7CB 5ETQA 4NLYA 2DH8A 3H2UB 1IN0A 2OP5A 1F9HA 3SI8A 2HWTA 3SCKE 2OMOA 3SQOP 4NXNF 4DV7J 2VJUA 2HLUA 3NMRA 1IBMJ 3DC2A 2OPPB 4YOEA 2EG1A 4GVLA 2F8HA 4LSZB 2HYIB 2J8SA 4F36A 1FNOA 4FKXA 2CXEA 3TR5A 1AZSB 4ECRA 3DI6A 1UTAA 2KM8B 4ZVFA 3GTYX 2YNHA 1VQ7S 2DGVA 3MAHA 1UJ4A 2WK4A 1FCAA 1HBUA 3LO3A 2XS5A 2WSFC 5EX0A 2C2DA 3MMBB 3EPIA 3CCQS 3SCJE 2DXFA 2QG9B 2CZ9A 4QYRA 1PSDA 1YWXA 2V4JA 4NOHA 4W90B 1NBEB 4QR1A 4NA3A 4GC7A 1L3TA 3HKWA 1D1UA 4IG3B 3OR2B 1ZPVA 1S6QA 3OSPA 3VZHA 2DR6A 3M2RB 3I0RA 4ED2A 4QZVB 2DEIA 3I56S 2AGQA 3LUYA 3NBPB 4AL6A 1TMJA 2HFSA 5F9NA 2AEMA 1JXEA 1NHUA 2FY8A 1TUWA 2XMKA 4DPWA 1ZTTA 4B9LA 2MZJA 2HQCA 1DY3A 4RJVA 3DXBA 4K0KJ 4EEYA 1RQ0A 1JLQA 2KYZA 1TFYA 3S1TA 3Q22A 2CG4A 4LFBJ 2GVDA 1PO6A 3A4TA 2UUBF 4DV1F 4B9SA 3DHWC 3BS9A 3HZEA 2CNLB 4LF4J 4M5NA 2ZH1A 4OHWA 5C2CA 2RDJA 4DR3J 4OX9J 3RBZA 2I8EA 4AQYF 3CJ3A 2FC9A 4G6VB 1J27A 1JX4A 3R8YA 2XC9A 1K1SA 2ZD1B 2V68A 1QM9A 1FEHA 4HI2A 2WSEC 4HHJA 1N32F 3MHYA 4A8FA 2GNKA 2R9LA 4OYAA 4QIVA 2CADA 3ZNJ1 4XIUA 1SH3A 3H5UA 2A2CA 2WHOA 5D3GB 2VB6A 3I9ZA 3CD0A 1PYSB 2V67A 4F4ZA 4RUAA 5A8KB 1Y3KA 1OWXA 2JLGA 3T5KA 2XS7A 1S1XB 3NL0A 3TEGA 2AX0A 3QIPB 3QATA 4ZCLA 4LF6F 2VDIA 1OMSA 1R8AA 2W2PP 4NPOA 3KG1A 1S77D 4TQRA 4PXDA 4F26A 3TI0A 5DRKA 4LF9F 2Z56B 3U1NA 4FXDA 5HQ8A 3HHEA 2AYGA 3K59A 3KG0A 1B99A 3AT1B 2NXEA 4GC6A 4I2PA 4JI6F 4ZHRB 3DDNA 3K5PA 4QIFA 5SZTA 2RAQA 1Q53A 3P45B 2OPQA 4JYAJ 5GMDA 2OFGX 1TAUA 4DJBA 3QT5A 3MF5A 1N8RT 4WP3A 2YWKA 4LRCA 3UD5A 5KG7A 4K5RA 1HD0A 2VFSA 4P52A 3DRYA 2E9ZA 2ERRA 2E9TA 4CNZA 2R42A 1CC7A 5B0FA 3CB4A 2R7TA 4R25A 2J9DA 4DL2A 2WZ1A 3PV8A 2HBYB 3H2LA 4WBFA 2DRAA 2LQBA 3MOJB 4W92B 3J80U 4J9LA 4I6AA 3FCHA 1T05A 1PGZA 3M9MB 3IM8A 2OLWA 3HZGA 1U1RA 3OFFA 3OSNA 1CJUB 4NLRA 2RU9A 4DX6A 3GFHA 1KBRA 2CQGA 4NLVA 2XSJB 2IMOA 2VFTA 2HEKA 4ED3A 1GMWA 5E0OA 2I5JB 2DCUB 2HW3A 3CULA 2G0CA 2GMJA 3BPSP 3IBCB 1R8PA 3ET6B 3MM6A 4XPEA 1Z2ZA 4ZVOB 2IAJB 4DSJA 1U0HA 4KHPJ 1RXOB 2CQ1A 1WC6A 4G65A 4KHRA 1VDHA 1YJRA 3PO4A 2LQ8A 1XEZA 1TL1A 4OYOA 3NNAA 3UNYA 4UOGA 2B51A 1BHNA 3MXHP 2Y8YA 1K73T 4MK9A 1RB0A 1RT1B 1GMWD 2GCFA 2XEXA 2GAGC 1H74A 4JI8F 2XYGB 4QIGA 4JI1F 1BY9A 1FT8A 3S7RA 3OVBA 1FRHA 3DXSX 2KM8C 1FNMA 4DPTA 3BBFA 5ITHA 3OUYA
chains in the Genus database with same CATH topology
4AFFA 1N5YB 4MKAA 3PY8A 1P1LA 4QIEA 4NXMF 2G4BA 4PQUB 2N7YA 3JSYA 2HNZB 5K14A 2MJNA 5HLFB 2OPPA 2ASLA 5KFYA 3KLGB 1LFWA 2BZ2A 2QMXA 5E3QA 4YDDB 1RTIA 1T8EA 2KVIA 3FFIB 3OTCA 1U2FA 2JX2A 3PIPQ 3ULHA 4DL0C 3ETOA 3P3DA 1LWFB 1N52B 2P9EA 1L3SA 5M2PA 4TYAA 4ZVHA 3SFGA 4Q0BB 4IFVB 1VC0A 3OHBA 4OX7A 3V4IB 3KYLA 1P1TA 4QCLA 1U4BA 4IRKA 3T6BA 4CO0A 2QYCA 5F8HA 1KC8T 2OMLA 3CIZA 4TU7A 3DOLA 4M63A 2O67A 4CO4A 4ECYA 1NJWA 2PI4A 3CEDA 3QMQA 4C98A 3R5AA 2HFNA 5DM6Q 1FKOB 1FRKA 4I1TA 5AE1A 3EUNA 1QSYA 4DSKA 4ZKAA 3L7PA 2KI2A 3MM7B 1U47A 1AROP 3M8QB 1S7HA 1TK8A 2Q66A 5DLGA 3QZ7A 3D1QA 3SCLE 3F73A 1RAJA 3MMBA 4LJMA 3BDEA 5CCLA 5IM0A 1AW0A 2OIHA 2D74B 2R7QA 1SI9A 3QO9A 2KT2A 1SJRA 1F60B 1CQNA 1XC9A 1R3NA 1RT2B 4EYHB 2KHCA 1KSPA 3N4WA 3FDSA 2YQ3A 2O5DA 4QW8A 2FHKA 3NP5A 4RX6A 1X4EA 4K4XA 5A0YA 1QAJA 3SDEA 4K4VA 1OS5A 1S72S 4IG3A 4JI0F 2JEIA 3OR2A 1QAIA 3SYZA 2ZHOA 1GXTA 2N3OA 3MR5A 4FXWA 2KXNB 3M2RA 5DQHA 5KFSA 3EXCX 2KRBA 1FKAF 3CDEA 1R8CA 3GYNA 1OSDA 2DRBA 3BSCA 4Y2AA 1WTBA 1YBAA 4IYQA 3G8SA 3PX6A 3NCPA 5D8HB 4K5SA 3NBPA 4J5OA 1VQ4S 1Z4UA 3KHRA 1C1CB 2JC1A 3UD3P 3M8PB 1VQSA 4O3OA 5HO4A 3OW2R 4URQU 2FLOA 2E9RX 2RMLA 3MM8B 4R0JA 4ILRA 4UY8T 1GAOA 1WF0A 3VAIA 1YTYA 1UVKA 1SUQB 2CPXA 4PR6A 5DDQC 1HMVB 3NS6A 2NREA 4PWDA 3PHEA 1HBMA 4WYWA 2JRSA 4I6YA 3SMZA 2LXUA 1FRMA 1FDNA 3G6ES 1RTDA 2EKYA 2MQNA 5SUHA 4CO1A 2E66A 2XMJA 5EWEA 2RRAA 2V2KA 1BQMA 1TKTB 1U8SA 1WTFA 2BYCA 1FXLA 3CGIA 2GW8A 3TO8A 3RB6A 2OSQA 3SV3A 5F0WA 4XO0A 4LF7F 3MM9A 2OTLS 2RRNA 4O4GA 2K3IA 1EP4B 4OL8A 2UVRA 1LFPA 2CPZA 4C0BA 3S8SA 1S9EB 1SV5B 2JEFA 4C4WA 1H0HB 1KLMA 4WXOA 1HNIB 4OQJA 1WD6A 4JI5F 4MK7A 2HPUA 2GIQA 2RIJA 3WC0A 2JZ5A 2M52A 1VK3A 3BQ2A 5CYQA 2Q79A 2WTFA 3CC2S 1UA1A 3J80Y 3OQ2A 5KTQA 2P5VA 1XTZA 3HXMA 4OI0A 2KU7A 2JDJA 5J1NA 2MHNA 2DNYA 3FVYA 4NLWA 4NWBA 3RAQA 1K0TA 5KFTA 1SL1A 2HQ3A 1YQHA 4X65F 5C25B 2VG5A 1FRXA 1H7WA 2EPIA 3LH2S 2DNGA 4WFNQ 3TQ1A 5AJ3F 5KFIA 4DR4F 1X5TA 2V9KA 7FD1A 2BQUA 4RZRA 3N01A 1ZZFA 2AJQA 3EGWB 4DG1B 2CJKA 2B6AA 2IM3A 4FS2A 2KJWA 3LP2A 2RT3A 2H5EA 1TVRB 2ABYA 2ZE2A 4RWXA 3G6XA 4ZPBA 2J6SA 2IM2A 4A8OA 5JJBA 5CH7B 2L9DA 4NZ7A 1Y7PA 1KS2A 1BGXT 3OPKA 4RBVA 2ZD1A 1XK8A 4ZCKA 2V8VA 1RKJA 1T03B 4F2SA 4TN2A 4UUWA 3T6JA 1YRXA 3GIJA 3N9UC 1J5OA 1FK9B 3R1LA 2GQQA 2OAUA 1YVFA 1L3UA 2DK2A 1NK6A 4YEAA 3LOUA 2IC3A 4YB7A 3J81Y 5DGBA 3H4DA 3SQGA 2CJ9A 3O5TB 3LANA 2JOQA 4HT7A 2DGWA 4YDXA 4ZA1A 3T5LA 1QLNA 4RNHA 3DRRB 4KC5A 1FDBA 4C8NA 4X66F 4ZS6A 5CQGA 4Q2LA 5HMYA 2CQ4A 4X84A 4U6PA 3TUIC 2BDPA 5D3GA 1BQNB 2A2DA 3VAJA 3QJLA 4USHA 2JH3A 3CJ5A 1VQMS 1VQKS 3CO9A 4L72B 3SFUA 1IUJA 3CCWA 2FDNA 4CZCA 3PW7A 1VRUB 3LALA 4RU2A 4OV1A 4C3LA 5CA5A 3S6EA 2DIUA 4DLGA 1UJ6A 2CPJA 2Z0GA 1KTVA 2LLZA 4KHMA 2LVWA 2HIQA 2CZVC 3AJ1A 5A8KA 1BQXA 3UFCX 2HLTA 2YKNA 3ISZA 4ES3A 3TA2A 1IKVB 4ECQA 3IG1A 4Q8FA 1S1XA 3BEGB 3LPYA 3OV7A 2LU2A 3QIPA 4KR0B 1MU2B 2VFUA 3QZ8A 4IQXA 3PXGa 5KFMA 4RNMA 3M8SA 1IBMF 4K4UA 1JLEA 3R5CA 4NA1A 2NZ4A 4TNOA 3H5YA 2E1CA 1VLYA 3FZ2A 3HHDA 3OLAA 2BXJA 2CQ2A 2WAQD 4OJGA 5KFCA 5KFQA 1WHXA 4DV3F 1JNZB 5LXRA 3VF0B 1N0VC 1U1NA 2BM0A 1S97A 4GO7X 4B9TA 3UQSA 1N48A 1W2IA 4M5DB 3HVWA 2ZHBA 4FF2A 3PDNA 2XLIA 1HL6A 2PN6A 3OFEA 3QIDA 4LVNP 4P2SA 4KE5A 5K8OA 3D54A 3QAEA 1HR0F 2J0SD 2HHXA 2DNKA 1NO8A 1UVMA 1SJ3P 1M5KC 3OFHA 5HP1B 4FZVA 4NLXA 1HFEL 2GQ2A 3UWTA 3CT9A 3PX4A 3DLBA 1IQTA 1YRUA 3I6PA 1DURA 3MM5B 4I0WA 2J9DE 3IRXB 2HRUA 2DR7A 4Q2MA 2QFJA 1X5OA 1HI0P 4LFCF 2NS1B 4HDGA 3DLGA 5E33A 4F3OA 4ZHRA 1F5AA 2F8MA 3ENVA 2XBPA 3SQGB 4QW9A 4H4OB 4KB7A 4NCBA 4EWTA 5I3UB 2ZOMA 3EZUA 1WELA 2GMLA 1VQ9S 1Y5IB 4WTYA 3AY0A 2ZH7A 1VC6A 3BQ1A 3B4DA 4J9OA 1DLOB 3D5MA 1JK9B 2B43A 3FQKA 2KG0A 2ZJQQ 5C5JA 3QYYA 1LWCB 2C3OA 2K8GA 4DLEA 1HWKA 2R7XA 5KFUA 5LSRA 3FMBA 5DG8A 5E41A 5KFRA 3HF5A 2XWXA 3CDWA 4KO0B 1NHVA 3HDSA 4TKTA 4LVOP 1HW8A 3O1LA 1S49A 3A1YG 2B4VA 4OZ0A 1T02A 1FE0A 1HARA 4OI2A 1N0UA 2OSRA 2W8LA 4RU9A 5IQ6A 5A2QY 1TKDA 4ZOSA 2LEBA 2YKAA 4N41A 2ZH8A 4QOTA 5FDLA 3K2YA 1C0UA 1VI7A 2K1RB 2ASDA 3DLEB 2Y1RI 2YNGB 5L9XA 5HROA 2FVCA 1T3NA 1E6VA 4X4RA 1P27B 1X4FA 2XMWA 3CSKA 3OTOF 1S0VA 3KOAA 3ITHB 4FNHA 2YKPA 2W7PA 3JSRA 2ZC4A 2R8JA 2C2EA 2VBYA 3TVKA 5J2MA 1VQ5S 3THTA 3KLFB 3LW5C 1XNQF 1TK0A 4TY8B 3NCRA 2DNRA 1TKZB 3N6LA 3G71S 2E5IA 1TL3A 1U1OA 4K0KF 5DM7Q 1ZTWA 2LEPA 5KFKA 4J9KA 2DISA 2ROPA 4Y6IA 3MPVA 1KQGB 3PEJA 5D4PA 2B7CB 3UCZP 1MW7A 4X62F 4NYOA 1R27B 3WZ0A 1U1LA 1REVB 3PIOQ 4O3PA 2Z4PA 2RJZA 1DZ5A 4LFBF 2FJEB 3UR3C 5F8LA 2AU0A 4JI7F 2RE1A 3WC2A 4DR1F 4YMEA 4LSLB 4QIWD 3MEEB 3UW1A 3FSIA 1KR4A 2HVZA 5FJ4A 1UAWA 4GO5X 2UV8A 2VA3A 3MOZA 2J0QD 2YKOA 2MPUA 5C42B 5KFBA 4ELVA 2MKSA 2BQ3A 2VOOA 1S4FA 1ELOA 5IZHA 1FF2A 2YH0A 4X2BA 4ZK7M 3IS9A 1U26A 3THVA 2B5JA 2XSJA 5D4NA 1NJIT 4I2QA 5KFNA 1X5SA 4DR3F 2V5HG 2VKRA 4OX9F 2RF2A 2PEHA