1YG0A

Solution structure of apo-copp from helicobacter pylori
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
MKATFQVPSITCNHCVDKIEKFVGEIEGVSFIDVSVEKKSVVVEFDAPATQDLIKEALLDAGQEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COP associated protein
publication title Solution structure of apo-CopP from Helicobacter pylori
rcsb
source organism Helicobacter pylori
molecule tags Metal transport
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1yg0A00
3F44A 5B0DA 2OFGX 3KG0A 1CC7A 1TUVA 2OFHX 3UDCA 4F67A 2OD6A 2RU9A 2ZDPA 3K7RA 2BBEA 4HH1A 5KAKA 2QLWA 5B09A 4Q2MA 3HHLC 3KKFA 1YRXA 5B0BA 2GGPB 2LQ9A 3LGMA 1YJRA 4OIXA 2HQIA 2AJ1A 1VQSA 1KVJA 2W4CA 2BJEA 2JDJA 4A47A 5B0GA 2XMKA 4HH0A 3LGNA 2ZDOA 1ULRA 1Q8BA 1Q53A 2GV1A 4OJ1A 1FVQA 4A4JA 2ASYA 3IWXA 3WDOA 4DPOA 2XMWA 1X7VA 3HHLA 4A48A 2ACYA 5B0CA 2AW0A 1S6OA 3BN7A 2ROPA 3TOQA 1VQYA 4OJHA 5B0FA 1KQKA 2HFNA 2LDIA 5A6PA 4FNHA 2BUNA 2OD4A 1OQ6A 3MCSA 1JWWA 2OMOA 2BJDA 2OAUA 1OPZA 1AFJA 1WD6A 3MZIA 5T7LA 1S6UA 1W2IA 1JK9B 1MWYA 3HHLB 2FHMA 3I9ZA 1YG0A 2KT3A 1CPZA 4ZOSA 1LQ9A 1OSDA 2XMVA 1X0PA 1X8DA 3HHLD 5B08A 3TNVA 2N4DA 2OP5A 4Q2LA 1SB6A 3DXSX 1R6YA 4U9RA 2KKHA 2K1RA 3BM7A 3QMQA 1V3ZA 4EFAC 1MWZA 3FGVA 5B0AA 2ROGA 3LO3A 2EW9A 4A46A 3BGUA 1GXUA 1Q4RA 4YDXA 4HL9A 1FD8A 3T9NA 1AW0A 1N5VA 1AFIA 2XMMA 2K7KA 3KG1A 2HLTA 2G9OA 2KT2A 3DCAA 1CC8A 5A6WA 1TR0A 1FEEA 1IUJA 4DL0C 2K1RB 4DN9A 5F0WA 4OJ3A 1TZ0A 1U7LA 3HF5A 2GCFA 2OKQA 1SI9A 1RJJA 5IXUA 2QIFA 1TL5A 1SQEA 3HX9A 4YEAA 1FE0A 1FE4A 1URRA 4ZA1A 1APSA 2QLXA 2RILA 2XMUA 2RSQA 3FRYA 3QGPA 4Y2MA 1GXTA 2ROEA 1N5QA 4HI1A 2K2PA 5T7LB 3HDSA 3VTIA 2CRLA 2LXFA 5F0UA 4Y2IA 2IFXA 1YJTA 1OQ3A 4FNIA 4NL5A 1P6TA 1P8GA 1K0VA 2AJ0A 5K9FA 1YJVA 2HFOA 4HI2A 3BF4A 2K7JA 2QYCA 1YJUA 3HFKA 1FVSA 3CJKA 4OJGA 2W4PA 2HLUA 1Y9OA 2VH7A 1Y3JA 1XBWA 2IYIA 2VV5A 2HIQA 1Q8LA 1N5TA 1Y0HA 2N4CA 3E8OA 2LQBA 3IWLA 1TL4A 2FTRA 2GFFA 2W4DA 3GZ7A 1QUPA 4NPOA 3CJKB 2GO8A 2GA7A 1KVIA 2N7YA 3BDEA 2RMLA 2FB0A 2L3MA 4Y2KA 1Y3KA 2Q3PA 3FMBA 3TRGA 2BYCA 3KNGA 2PGCA 1N5SA 2XMTA 2KYZA 5B0EA 2FIUA 2AP6A 2PD1A 2XMJA 1FESA 3BR8A 2GGPA 4QOTA 3BB5A 2IYGA
chains in the Genus database with same CATH superfamily
1BY9A 3MD1A 5L1IA 2IM3A 3I5BA 5B0BA 1Z4UA 1XNRJ 2ZHBA 1TUGB 4HH0A 2RD5C 2JSXA 2IA0A 1UA0A 1UWAA 3GILA 4PXCA 2HS4A 2MQ8A 1JLBB 1VJWA 2OEKA 1WORA 4KKOB 2PFDA 3B82A 2F4FA 3KK1B 1GMWD 1TUWA 1PO6A 1X8DA 5GMEA 2CADA 1FT8A 2E9ZA 4ECYA 2XNRA 3HPOA 3OR1A 4XO0A 3JYTB 2QYGA 1HI8A 4JYAF 3R9LA 1HWJA 2QA2A 1N36J 1ZS6A 1WF0A 4B02A 3KHRA 3VTIA 1S6PB 2AJFE 2KXHA 1IJFB 4EBCA 1JNRB 1NCLA 1S1TB 4TY9A 2VPXB 1OS5A 3VZHA 2AF6A 2ASLA 3EICA 2HBYB 3PR4A 4RBVA 5E3AA 2XMTA 3GFHA 3DLKB 1SBRA 2OGUA 4U7UD 2R2TA 2OTLS 2Y8YA 2ZZTA 3PR5B 1YRXA 2UV8A 3IM8A 1JLEA 3T5LA 1VGYA 3TA2A 2BOPA 1LW2A 5HROA 3VF0B 2A3JA 1HD0A 4DUZF 2CQ0A 3C16B 4HEA9 3DU5A 1TKDA 3CE8A 3CDWA 1E6VB 4BBYA 2VDIA 2I1RA 4TNOA 4HHUA 3N6NA 3B6BA 3LH2S 4IRCA 5DJBA 2NCKL 2N7CA 4F4YA 3ZC4A 2J76E 2HQ3A 1APSA 3GSIA 4ZVGA 5K8OA 1N88A 2RJZA 2CJ9A 2HIYA 3GYXB 2HFZA 3DI6B 5KFMA 4USTA 3TX8A 2VOPA 3A8JA 4DSFA 4DS4A 2ZHOA 3B4MA 4RR5A 3UI3A 4FYWB 1VLOA 2GQQA 1U8WA 2KVIA 4CO0A 3UPFA 4IG3A 3F44A 4A8XA 2ZH5A 3OXLA 1KSPA 4FYXB 1YJRA 2DJWA 5KT5A 3G8QA 1KNZA 1RYSA 4ID5A 2JX2A 3P96A 1S6OA 2HS0A 2Y0BB 3DU6A 1AT1B 2XWXA 3D0GE 3PW4A 1OPZA 4WE1A 3KMQA 1X4FA 1MMDA 3QJPA 1GX5A 2IJFA 2POKA 1NJZA 2BE2A 1VHFA 1WC6A 2BM0A 5GVQA 2I0XA 1UA1A 2O67A 2HVHA 1U8SA 4JI2F 1HI0P 5A6WA 1WHVA 1SPBP 2MB0B 1S7IA 1HNXF 4Q44A 2FVQA 3OLAA 2WBMA 2VD3A 4Y2MA 3CCVS 4AL7A 1H2VZ 3MM9A 1LWFA 1P8GA 1JNZB 3HHNB 2W9CA 2ZBIA 4NCGA 1UVIA 3R7BB 5LSRA 3BDPA 2AWZA 4DPWA 4ZMMA 4YB6A 1UFLA 4ZHRB 3F41A 3EGZA 1HR0J 2MHEA 3PM9A 4BWJA 4A8YA 1F2HA 3D3BJ 4Z37A 6FDRA 1E6YB 2G2ZA 3PVXA 1UKUA 4KB7A 1KKHA 2EFQA 1H0HB 1S48A 1R8BA 2ACYA 3ZTOA 8ATCB 2UXBJ 1BQXA 1H2UX 3HSJA 4KRWA 3BSOA 2B56A 3SSQA 4N56A 4NMLA 3AODA 2WW8A 2IM2A 4DQSA 4IR1A 3VZIA 2KKHA 2P8IA 4OHWA 2MKHA 3T9NA 3AQPA 1F5AA 4K59A 4X2BA 5D8HB 4KC5A 1T9UA 2QIFA 4N47A 3TVYA 4G1PA 1ZM4A 2JOQA 3RAQA 4OQJA 2FGOA 1U2RA 1GXTA 3MCNA 5MLCV 5C7PA 2AGOA 3IGVA 1K0VA 2M3DA 2P9GA 2YWKA 4CNYA 1IBLF 1VQPS 1I5OB 1U6FA 3J7YU 4JI4J 1BWEA 5HP1B 1TKTA 2C2NA 3RW6A 4PG7A 2KH9A 4DX5A 3U02A 3FBCA 1R0CB 1RWNB 2IVFB 4LSLA 2J0XA 3K7RA 2VF3A 4RNMA 4G3IA 5HQLA 5EWEA 3CDAA 3RUBL 1RHQB 3T5HA 1ZM3A 4B9VA 1M5PC 3FUYA 4DLEA 2CZ9A 4LUBA 5L39A 2EC0A 1GFWB 2N3LA 2B9WA 1UW4A 4ZP9A 3W3SA 2NXNA 3SIPB 3S7RA 3M9OB 3DHWC 4M94A 4OLPA 4U9RA 3LWMA 2XGPA 1RT5B 1NKEA 2ROGA 2HK2A 2VODA 4J9RA 2FD2A 1F1BB 4K7QA 4DI6A 3ITHB 1X4AA 3GP9A 3ISNC 4BDPA 2CPZA 3BV8A 3DDNA 3EX7B 1MWQA 2VB6A 2VG5A 1FJCA 2X3DA 4LF8J 2IFXA 3VQTA 5D77A 1VBKA 2DNKA 2AJQA 3OHBA 2V94A 1Y9OA 4PQUB 4KPCA 4RNFA 3V6HA 3NEKA 4C6AA 1Y5NB 2EG1A 2OPQB 1IKWB 3CCES 2BA9A 1YQHA 4NXNF 4ZPTR 2LKZA 3UR0A 3VAJA 5C5JA 3DHXA 4O3RA 2PMZD 2OJ3A 3VGUA 4MAKA 4F04B 1NKCA 3NMRA 1KOOA 4ZVEA 3U1NA 3K5NA 2V8VA 5IT0A 3RB0A 5I42A 3MM5A 2HVZA 5ETLA 2AEMA 2VFTA 3UN5A 2M7SA 1Q8KA 2HVEA 5A0YA 5BYSA 1NDCA 4LFAF 4UUWA 5K20B 2VBWA 4DMZA 3OR1B 1UVKA 4PRFA 2EKYA 3V6KA 4CYUA 3D28A 3OTDA 3A3OB 1NH8A 1EIYB 2BZ2A 2CQBA 3F0NA 2V4QA 4CLPA 5F3ZA 4F4KA 1KOHA 3B8HA 4HT7A 3GU0A 4NA3A 2IMWP 5IQ6A 4NX9A 4DHVA 3FMBA 3L7PA 1VBXA 1WHWA 4E98A 4JI1F 2BANA 1KD1T 2B6AA 5BXIA 3UE2A 4L76A 3UDLA 2OIHA 3M8ZA 5LMNF 4MH8A 2UXCF 1TKXA 4USUA 4O4RA 2RUSA 4Y00A 4I64A 4LFCF 1JLEB 2NPIA 1ZPVA 2B43A 1HQEB 2GVZA 3OL6A 1RT3B 5HROB 3HVRA 2YWEA 4NLOA 4F3MA 4EFAC 4C8ZA 1S1VA 2FY8A 5A8RA 1LXNA 5D4PA 4K4UA 1J27A 4QWAA 5ETOA 4QWEA 2RDIA 4Q7AA 1IM4A 1VMBA 2M52A 1XC9A 1OQ3A 3V4IA 4IO9Q 4AQYF 5L9NA 2ZVIA 2HHSA 3JAMY 1Q8LA 2J9CA 1GMUA 2VONA 2AX0A 1VQ8S 2ALZA 1HBMA 5KT3A 3FEZA 2LEPA 3KG0A 1CJKA 2DB1A 3C46A 3CMAS 5KAKA 3AT1B 4IG3B 2C3YA 3H59A 4YB7A 3ISZA 1J5OA 3W1YC 2XSJA 2M5YA 3UWTA 2IC3A 4ID5B 2CPJA 2B5JB 3WC0A 1S97A 2QMUB 1T11A 1FFSB 2VBZA 4ZCKA 5KT4A 4WE1B 2BR0A 4A8SA 3D0HE 3GG1A 5E2QA 2WSFC 2WVEA 5GADI 1SH0A 2MYFA 1GX6A 2HLTA 4TU9A 2KT2A 2BE2B 3HJFA 4LR8A 1U7LA 3DLEA 1WTFA 3IBCB 4LRFA 3CUNA 1EARA 2AZ3A 3HX9A 4UQTA 4LQ3A 4M5DB 1IN0A 3DGVA 3X1LB 4ZIVA 2F8EX 5C24A 4WZMA 4BHQA 3MM9B 1LWFB 2W9CB 4EZ9A 3NNCA 4K0KJ 5CYMB 1JJCB 2F9JA 4NCGB 2GO8A 4XTTA 3CJQA 1WF2A 2XLKA 4FNHA 1SJRA 2KZMA 5HSPA 4ZS6A 5CA5A 1VBZA 3UN2A 4QYZJ 1ITPA 4NLGA 1UFKA 3MR2A 1NO8A 3UNYA 4DL4A 1VK8A 2KM8C 1HQ2A 4LQ9A 1FA0A 1XTZA 1PYTA 5ITHA 3O2IA 1XMOJ 2ZH9A 2BM1A 5KT6A 4CM0A 4RWWA 2VZ9A 5IV3A 4DV1J 2UVVA 1NBEB 3W62A 2XB2D 4C0HA 2A1BA 4X4NA 3M8QA 1FNXH 4ICLA 3IA0A 2B51A 2KT5A 3MMBB 4I7FA 2EBGA 2W2MP 3FRZA 4WFBQ 1IBMJ 3K57A 5ETNA 4W90B 2UU9F 3IO1A 3D1HA 2XNQA 3H5SA 1D0EA 1K1QA 1CEZA 3D5MA 3ISND 3HKWA 4KFBA 3AJDA 2VL1A 4TLRA 3VALA 2BJ1A 1X9SA 3THVA 3D6TB 2VA3A 1TKTB 4BLGA 5K8MA 3KLIA 2R9LA 3OSPA 3W63A 3KYLA 4OX8A 1IR2A 1UZDA 4J9VA 4ZPBA 2WCXA 2BJEA 4LSLB 1U1LA 1SL2A 1LWXA 2WW4A 4Q45A 3ZZTA 4J90A 3SCLE 3OR2A 2ROPA 1RHUB 5D15A 2KFYA 2P2CB 2WBRA 2M2BA 2Y3YA 4CLUA 3HSZA 2FHMA 4PYAA 2CQCA 2HBZB 3JS9A 4WU2A 5IC6B 4FPIA 1V3SA 1BQNA 1FX2A 2N4DA 3H2VE 4B3OA 3EUNA 5KFRA 2HRYA 2DEJA 5SUHA 3PX6A 5DETA 3CD0A 2HHXA 3RB3A 4DL5A 2ZC4A 3W5ZA 1S10A 4NRUA 1D9DA 1BXNA 4NLXA 3MAHA 8RUCA 1IJEB 1CVJA 4JI0J 3M6UA 4EEYA 1U4BA 4P7TA 1X31C 1Q86T 1YLXA 2ZOGA 3BKTA 3OD2A 2HFUA 5KFAA 4NXMF 2VG5B 2I5JA 3BBBA 5GAGI 2RS8A 1NK7A 3LAMA 4B9NA 2BQ3A 1DY3A 1N34J 3BGOP 2PFFB 2HURA 3I87A 1UVNA 3EWGA 3NCQA 1PYSB 4CO1A 3CPWR 3D3CJ 2SXLA 5DG8A 3R2CJ 4WWSA 1SQFA 1H3DA 4LF7J 1DURA 3N5BA 2H3EB 4CTAA 1HI1A 1IR0A 2AGQA 2FJWA 4AT1B 3MPDA 4GKJJ 2J8AA 3HZGA 1FKOA 3PYFA 3VAMA 2NYHA 2FJAB 4ETXA 3MFIA 1REVA 4P72A 2ZM6J 1BWVA 1RAHB 1FDNA 2F40A 1HNWJ 5I42B 3KDNA 1XQIA 3I82A 1JX4A 5A0YB 3VAKA 3OL9A 1SUQA 2ILYA 4RO0A 2YH1A 2AD9A 4R5PB 2QFJA 2WONA 4ES2A 3TAQA 4IYQA 1LWCB 4DPXA 4CYUB 3ZZOA 1YJUA 3C14A 3DM2A 3GQCA 3IRXA 2RU3A 3G9CA 3KHGA 1HLWA 4CLFA 1FJGJ 4MIWA 1H73A 2HGLA 4XPEA 2ZBRA 4DR4F 1S79A 1NK4A 3QGIA 4PPDA 3KKFA 2E1MC 4LMZA 2BANB 4MFBA 1XR7A 2B6AB 2F8MA 5CCLA 3GJQB 3W2WA 3Q8QB 3RJMB 1TKXB 5D0HA 3UNGC 3N0VA 5KG0A 2YKOA 3UN3A 3OHAA 3I32A 4YFUA 2GVZB 3MEGA 4NA1A 1WOOA 4OV1A 4L3KA 3NGRA 2W8LA 2XCPA 1S1VB 1QAXA 4CWBA 1HWKA 1URRA 2IRYA 3K2YA 5A8RB 2RILA 1RWXB 1XNRF 3CNQP 4K2JA 2X1BA 3R7SB 2QFIA 1WC1A 2YNIA 2CUYA 3V4IB 4K50A 2AJ2A 2DNYA 4DWIA 3P4UB 1FJEB 3PFEA 2KHDA 3OTOJ 2RU9A 2FDNA 2HHWA 1HBMB 3FSXA 2IVMA 3G4SS 1N36F 4B9TA 2MLXA 1XEZA 3R5DA 1CJKB 4LF6J 2ZNYA 2HSEB 4EBDA 5C25A 4FPRA 1KQSR 3ZFVA 3TUZC 1VC0A 4TU7A 2XSJB 2IC3B 1S9EA 3FK4A 4ZVRB 5HBMA 1IQTA 5CHCB 3KLFA 2W2NP 2R3VA 1TAQA 3DCAA 5AXMA 1TL7B 2EK6A 3W9HA 1PJ7A 3H42A 3LUYA 4HR2A 3DLEB 2CPHA 4P7VA 4FNIA 3FDSA 3Q22A 2D69A 3NNHA 2W25A 3BSCA 1Y3JA 1KTQA 4MK7A 3RB6A 5C24B 1IQZA 2GA7A 2LXIA 1IKXA 5HMWA 3IMQJ 5KFUA 1FCAA 2N3OA 2F5GA 3UDCA 2I2YA 3L3CA 1D8YA 4I69A 4DCPB 2CA9A 3GTYX 4Q43A 3VVTA 2GNKA 4QU7A 4A47A 2COLA 4BC9A 3PHTA 2IRXA 3QAUA 1JXLA 3QGHA 1KTVA 3M8PA 2MZJA 2MY7A 4J9PA 4HLBA 3JXOA 4ZVSB 1L3TA 2R2SA 2EFGA 2QJ3A 3CW2C 2YWHA 2K8GA 5KFYA 2PN6A 2NYIA 5KFJA 4K5RA 4RNNA 2WVBA 2XMAA 1WC3A 2AEJA 4ICLB 2M8DB 4ZJOA 1RAJA 2VG6A 5D4OA 1S7HA 4F2SA 1NK0A 4I7FB 3TUPA 2FC8A 3VGSA 1R8CA 2V34A 3FCVA 1XERA 2DNRA 2DR5A 2BV3A 2W2QP 3D1QA 1DHMA 4QIEA 2C2KB 3GZ7A 2J9DA 2XHWA 1FTCA 3AA9A 1QUVA 2RQMA 3FJ2A 5DDRC 4KFBB 1FKPB 2ZDPA 1TU0B 1ELOA 1VS3A 4USWA 2AYEA 3ETMA 1KC8T 1VQSA 2H5IB 3UO0A 5LSOA 4Q8FA 2JVRA 3GIRA 2ZJQQ 1M90T 1I1GA 1RHKB 2CQIA 2XULA 2D3OR 4F4ZA 1TL3A 1OY9A 3OR2B 1XIQA 1NSPA 3KHLA 1KFDA 3OFFA 3T1HJ 2L08A 1BQNB 1HR0F 3M05A 1X9WA 2G9OA 3CJ0A 2IJNA 3KDOA 4B3OB 2C2MB 4DF4A 4PEOA 5DM6Q 3U1LA 1S6QA 3SEOA 4F50A 1C0TA 4JI7J 2D1CA 4DPUA 4GKKJ 4J9MA 3EGNA 3V4MA 5F8LA 4OJGA 1YJNS 5LM7E 2VFUA 5D4NA 1IBCB 2I5JB 2ZD1A 3LP2A 3KNGA 1UPPA 3HM9A 3BR8A 3ZNUA 1IKYB 4QPTA 1FWKA 1I3OB 4V1Ak 2D7SA 4KGZB 1URNA 2WVCA 3MUMP 2EFVA 3QIDA 2Q43A 1MMNA 4CTAB 3IR6B 2YQ3A 3M30A 3G82B 1U1NA 1QVGR 1FKOB 1T02A 1HW9A 4JI4F 5B08A 1U6BA 2OHDA 1REVB 3CF5Q 2MZQA 1WEXA 4YY3J 4M5LA 4KBIA 3GV7B 1MWZA 1B64A 1P1TA 4I2PA 4W92B 3K5PA 4DL7A 3KXDA 4ILMA 2MJUA 1SI9A 3U1MA 2IHR1 2EG2A 1QJHA 3ZXWA 3FBFA 4N76A 1VHIA 3IG1A 2WONB 5RUBA 1OIAA 3UR3C 5HL7Q 1X4DA 3VVUA 3D2WA 1SL0A 2B3TB 3SDEA 2N4CA 4HDHA 4LF2A 2GO9A 3C14B 1MNEA 3WHIA 5C2CA 3IRXB 1PSDA 3VGVA 4ILRA 4DV3J 2AP6A 1S4EA 3DXBA 3NP5A 4CO5A 3W66A 3D9BA 2V68A 1JJ4A 1U48A 2ABYA 2O1PA 3MM8A 1FVQA 4ENOA 1NDPA 2YH0A 3T5JA 3P8BB 4PG6A 1HFEL 1UCNA 5A6PA 3EPGA 3JQMA 1WD6A 5CYJA 2VKZG 5DO2A 1T9VA 1TL1A 2IM1A 1RXOB 2WB4A 4YS2A 2CQHA 3W2WB 4B3TF 1B7FA 3J81U 3HK2A 2P9CA 2OI2A 2KM8B 2DGQA 3O6QA 2C28A 4IG0A 5DDQC 3MEGB 3ZTPA 2FUG9 4CDIA 2R7TA 4NYZA 1MN9A 2QEXS 2HWIA 5LXYA 3U27A 4UTGA 4NL5A 1B4SA 4DX8H 2QSFA 4WTOB 4I6YA 3CJKA 1SC6A 3FCWA 1VRTA 4TQRA 3OJSA 4QR2A 3JTPA 3FFIA 2WVFA 2YNIB 5KFCA 4MKAA 1HW8A 1WJ9A 2QSWA 3O44A 9RUBA 3EVOA 1T0TV 4CLKA 2VBXA 5B09A 4DJBA 1VQMS 3MPUB 1ZH5A 2LLZA 2XMKA 4OJ1A 1ZAVA 1TKZA 1WC5A 1T95A 1KS2A 1FRMA 4M5JA 5C25B 1KRPA 4CLZA 1NUEA 2UP1A 3DGPA 3OJUA 2NQPA 3C2PA 4DQRA 1RT7A 1S9EB 2F7VA 3AD9C 5HBMB 4ED8A 3KLFB 3CJ5A 2GIRA 4EI2A 4DUYJ 4OI0A 2DR6A 3JTOA 2LU2A 2VPZB 1JLAA 3QWUA 3BH6B 1TVRB 2WTFA 4RX6A 1VR6A 3NS6A 2W01A 2FJEB 2DHXA 4O3OA 4U8VA 1VQOS 4OZ2A 2HGNA 4OX9J 3EZUA 3G71S 2PE8A 1RT1A 5KFOA 2MSTA 1WI8A 4O3SA 4MKYA 3ZTRA 2YNFB 1N32J 3PO4A 4ELUA 4DR7J 3EXYA 4BWMA 3CDBA 4O44A 3QBCA 2MLYA 4GO7X 2FJDB 2EEYA 4NLQA 3M8PB 1HARA 3RYLA 1WUUA 3QJJA 2A2DA 1F5CA 3FC9A 3KUEA 2G13A 1CJVA 3K17A 3O3LA 4IH6A 2MZTA 3EPIA 3MPVA 2C2ZB 4MTPA 2HFOA 2VG6B 3QATA 1RB0A 4ID8A 3T19A 3ILLA 4P2XA 4IUFA 2YQ0A 3ILJA 4RKUC 5IT4A 1VC6A 4QJVA 2FB0A 2BMBA 5DQHA 1NSQA 4ATNA 1S12A 2FHJA 4I1TA 4GVBA 3IP0A 4ZVOB 3BPSP 2DK2A 3HKZD 4ECRA 1DJ0A 2CJYB 2DPJA 1SIWB 3QSYB 2FQQB 5H9EK 2NREA 1KQGB 1S5ZA 3NCRA 4CO2A 2NLWA 2Y0SD 4USIA 1NU4A 1UVMA 4KV8B 4UW2A 4DV2J 4ECZA 1RWUA 3DRPA 2OD4A 5DGBA 4M5NA 1TK5A 2E7WA 5HLFA 2JZ5A 5ETVA 2DR8A 2DH7A 5EGYA 1U25A 2R7QA 3HI9A 3OUYB 4Q2LA 4K0KF 1FX4A 4O3NA 1G3OA 1LFWA 4ALZA 3N6MA 3DYAA 4JBCA 2CPYA 3CJ4A 1FTRA 1YK9A 5CZXA 4NOHA 4UZCA 2AMCB 2DGXA 1QD1A 2BRKA 2HWTA 1I51B 1S6QB 2DY1A 1FK9B 5E7OB 3OV7A 1C0TB 4NI2A 2DRBA 2VH7A 4C8LA 4DBQA 1L5UA 1G1XA 1Y0HA 3NNAA 1O6XA 4NWBA 4UF4A 4PXEA 2RMLA 1Y00A 1ZOTA 4DV1F 2VFSA 4ZJLA 4DU7A 2DT9A 2ZD1B 4KT0C 2OO4A 2Q79A 3LP2B 4CQ1A 2RRBA 2RE1A 5CCMA 1IBMF 3MEEB 4QPXA 3OFGA 5F9LA 2FHJD 1CSJA 5B0FA 1QE1B 1NHUA 4ZVHA 2J6TA 2X7IA 3NCPA 2L9WA 3D67A 3KG4A 2PI5A 4BCAA 2LU1A 1UW9A 3ZO7A 3AXKA 3M30B 4O3QA 4UOHA 1U26A 3EDRB 1RCXB 4U8YA 4ZCIA 1G4CA 1JLGB 4M8LA 3GFZA 2ZH3A 1CJUA 4I2PB 5D78A 3G96A 4EBEA 3UW1A 2CXEA 2QA4G 3BN4A 1Q1KA 4P2FA 4ZPAA 5E0OA 1ZZNA 2AYGA 3IG1B 4H4MA 2MDAA 1SC3B 3TZXA 2MQNA 1RTIA 4ES1A 5AXLA 3SDEB 3JQKA 1M5HA 4OI4A 2H5EA 1I94J 4C11A 4X62J 3W7BA 3R2DJ 3G8SA 3CDUA 5HI7A 2ADCA 4JI3J 1HA1A 4LVOP 4X84A 2NXEA 4JI0F 5K5MA 2BQUA 1P27B 3CCRS 3QZ8A 3MM8B 1FF2A 3VR1A 2J7WA 1NRKA 4J91A 4OHZA 2D9OA 2XMVA 3GJSB 1QTMA 1BC6A 1PILA 3TAPA 2HFVA 1N34F 4FBTA 2CZVC 1X5TA 3TJ9A 3B4DA 2HGMA 4DV6J 2ZHAA 1KVKA 2KFZA 2ZVSA 4NRTA 4LF7F 3Q8VA 4IG0B 4P2SA 2DHHA 3D4JA 4GKJF 2G2OA 2LA4A 4RW4A 4F4WA 3FBBA 1TELA 3H0PA 4MIAA 1S1XB 2W9BA 4TY8A 3VHQA 2ZM6F 3UCUP 2E5LJ 2IYIA 1G2EA 2DIVA 3CJKB 4KKOA 4DQPA 1HNWF 1NK5A 3M8YA 1PIEA 2VC1A 2BJ8A 2H54B 3FFIB 5LL6d 4J9OA 2HYIB 3E01A 4K4YA 3NGKA 3CCWA 4RBUA 1X4CA 3GJTB 2AGPA 1Q81T 2DGOA 4O4GB 1YBUA 1BMQB 1RGVA 1Q82T 1SXLA 1TKZB 2YX4A 2KT3A 3K0JA 2UUWA 4M5GA 2A0FB 2ZKUA 2DISA 1FJGF 4DG1A 3HCXA 3KK2B 3BM7A 2JJ4D 4WFYA 4ES3A 3AD7C 3NAHA 1RT7B 4YEAA 3CCUS 4IH5A 3HVWA 1N48A 1YSJA 4J9NA 1R27B 5KFGA 3SYZA 4DQIA 2APOA 2O66A 5KFKA 1VBYA 1A6LA 4OZ5A 5GMKa 5CYQA 1LV5A 2D3O1 1JLAB 4RBTA 5CZVA 3IWLA 1RKIA 1TL4A 4B9LA 4KTQA 5ETQA 3DRXA 2ZWOA 5HVFA 1Y3KA 1UP1A 4C8KA 3VCDA 4HACB 5KG3A 3T41A 1E6VA 2BBEA 4F3OA 3S01A 2E9TA 1FDBA 2R7WA 1RT1B 3ZTQA 2AJ1A 1U1RA 1NPPA 4A4JA 3QFHA 2AW0A 2HZAA 2FLPA 2NS1B 4KAIA 2OPRA 2XZDB 4ZK7M 2O01C 3POTB 3HD1A 3H5YA 1BHNA 1LQ9A 3SV3A 3OFEA 5LMUF 3DI6A 3L7OA 4O44B 1S9FA 3PY8A 2E5HA 1H2TZ 4YDXA 1Y4ZB 3MR5A 5AT1B 1DLOA 4TVAB 3H25A 3LP1A 2KJVA 2OKQA 3HFVA 2IPOB 3GR0A 2DHAA 2QE5A 1FD2A 4HI1A 5LSLA 4LF6F 1K8AT 1CJVB 4C8OA 2MZRA 3QWPA 3QNWB 4R8UA 1FERA 4YR2A 4ERDA 4HDGA 1NM2A 3H5UA 1YZ6A 6FD1A 4RWXA 4EMDA 5IC4B 1NZAA 1VIOA 2DNZA 2XS7A 4P10A 4IR9A 1SKWA 1P9YA 1ZAXA 5KFVA 1KP6A 2ZBQA 2V9KA 2DYAA 1T03A 2QT7A 1RBLA 4OIXA 1MROB 2E29A 3ZZUA 2J0SD 2KXNB 4GVBB 1FJ7A 4FKYA 2BW7A 4Y2CA 2NZ4A 3CJ2A 1YRTA 1WOPA 4ZCMA 3RR8A 3DRPB 4R0JA 1ACMB 3OTBA 3M32A 2QLFB 2FVRA 3HD2A 3CCZA 5HLFB 2R42A 3WBZA 1YBAA 4UY8T 1HHQA 2A2CA 1FEEA 3OSNA 3DYAB 4RUAA 1UL3A 2GVDA 1K0TA 3G6XA 2B0GA 1UVJA 2OPPA 2CQ4A 3PDNA 1JXVA 2HG4A 1IVZA 4JV5J 1R8HA 1OMSA 3ZZRA 5HQMA 4Y34A 3AXMA 3ICLA 2E1RA 3PCOB 3J7YI 4NI2B 5I3QA 2X1FA 2K3IA 1ZETA 4WFAQ 4C7QA 4I0WA 3DRRA 4M95A 1FHTA 3NS7B 2NXCA 2FZGB 2ZH8A 1WTBA 5E3CA 2ILZA 2WOMB 4UT4A 4A8WA 4X4VA 3PW0A 4LREA 1NDLA 2MKKA 4WZQA 1NJIT 4DV7F 4RUBA 4M5MA 3W65A 3FKBA 3J7Z5 1K73T 3ZTSA 4K4VA 1GT8A 2OH2A 2EWHA 2ZFHA 2Q6BA 4QYRA 2XS5A 1OYEA 4WXWA 2QLJB 4GVLA 2DNLA 1AFIA 1TR0A 1RWKB 1A0OB 3I31A 4GC6A 3AHPA 2HHPA 3W60A 2G0IA 1U02A 4CNZA 4UQGA 3Q24A 4KHRA 1YJTA 2X3GA 3AOCA 1CJUB 5BYRA 3M2RB 3TVZA 2CVEA 3BF4A 2HMIA 3TW0A 2CPIA 4UOCA 2KU7A 4H54A 3UCGA 3CJRA 3TJ8A 3GJRB 4MIBA 3OPKA 1FFWB 2PO4A 3H5XA 2BKNA 3OL8A 2MJNA 2VHGA 1GMWA 1RTHA 2E5JA 2CQ3A 4H4MB 5GAGU 2KN4A 2Y1LB 1RE1B 2JEFA 4PZVA 1C1BA 3HO1A 2VQEJ 1RTIB 2DY9A 2FGCA 5A8KB 3EJMA 2U2FA 2UV8G 4C11B 4Q0BA 5J2PA 5IFMA 4DFKA 4JI7F 1U09A 2FYXA 5KFSA 4GKKF 1MSWD 2UVUA 2B4PA 4AXIA 3THPA 2YNHA 3NKYA 3THTA 1F9FA 1IM6A 2ZH7A 3QZ7A 2DRDA 1WF1A 4S0MA 3LGHA 1RI7A 4L3NA 4PXBA 5KFTA 2V6AA 1OJ4A 1K44A 2NXJA 1IKWA 3FZ2A 1FE4A 2XMUA 3MAAB 4URQU 4ECVA 3H2UB 1YVFA 1P6TA 2F63A 4OX7A 5FD1A 5KOXA 1X4BA 1AB8A 3R5CA 2PA8D 3RB4A 4RW4B 3TQ1A 3KUGA 2W9BB 4TY8B 4YY3F 2KZZA 2PD1A 4KY3A 2R7UA 3SBMA 5EDWA 4AFFA 2VPWB 3PJWA 2QLWA 4Q2MA 2V2VA 4DV5J 4JI5J 1X4GA 1XMQJ 4DDFA 5J1EB 5B0GA 3DDIA 3E01B 4TU8A 3J81j 5GAEU 3C19A 3QIPB 1ZZFA 4IFYA 3FEXB 4LF1A 4D3GA 1U1MA 3ENWA 4ZP7A 1F0XA 1U1KA 2MQOA 1A9NB 2GJIA 2V5HG 3MTKA 5DZ7A 3KLGA 2V50A 4QZVB 3MM7A 4DV3F 3KG1A 1F2GA 4DG1B 3F56A 4QIWD 4K4XA 1UETA 2XY6A 3I9V9 5HN0A 2FJBB 1BLUA 4WBFA 1RBAA 3RBEA 5THWA 1YGYA 5EX3A 4OZ3A 1L3KA 5M2RA 4ANDA 1J2VA 1ZTWA 1HQEA 4HHJA 4QYZK 5CYQB 5D0EA 3TYTA 5DGAA 1RT3A 2BJ7A 2NPFA 3V6DA 1TP7A 1YIJS 4USMA 1VQ9S 3MM6A 1D1UA 3DNCA 4C3LA 3K5MA 3FBEA 5U47A 4C0BA 1V9OA 2X51A 4OHYA 3T3FA 4DS5A 1YJ9S 1NHVA 5HJYA 3FCHA 1WDDA 1OSDA 2V2KA 4PABA 4QW9A 2OPRB 2B7BB 1JLCA 2XS2A 3Q8PB 4WP3A 3DXSX 2BDPA 3R5JB 3M4XA 5IT9U 2AU0A 2XZWA 4OZLA 1S0VA 4Z2XA 1F5BA 3GCWP 2XC9A 2DH8A 4ZVFA 2HRUA 2RAQA 2ATCB 1NZ8A 1W26A 5HMYA 2RH3A 1DLOB 3IR5B 3LP1B 2BE7D 4B08A 3DKDA 2C1EB 4TQSA 4X4QA 2KG1A 2J7KA 3DLBA 4GO5X 2ZH2A 4D3HA 3X3UA 1Y7PA 4USKA 1N52B 4R8UB 3TX0A 4ZITA 5DLFA 1SKRA 3BR9A 2B5JA 3PRVA 2ASDA 2KJWA 2CQ2A 2GGPA 2CQ1A 4B3RJ 1RHJB 3BH7B 2IDLA 5BYQA 1PCAA 3GIKA 3UDEA 3M6VA 1SL1A 2YWFA 4DXLA 3OW2R 4DUYF 1QSLA 2K3KA 4LRCA 2N82B 1T03B 2M88A 1NKBA 2A6OA 4ECXA 5JJBA 4ED1A 4M5DA 4E2FB 2V8HA 3C6UB 1RAAB 3M2UA 4GMKA 3BQ0A 1PGZA 3HSGA 3G86A 4CLLA 5HATA 4U67Q 1WKLA 4G1QB 3L9ZA 4OX9F 4PCQA 1WOSA 3M32B 5CYMA 5KT7A 3OVSA 4DN9A 5H9FJ 2WK4A 1WHYA 5F8HA 3NXZA 1VQ7S 3MECA 4Q8EA 4NLRA 3CD7A 4F8RA 4NYPA 3HXMA 1RU1A 3CD6S 3S6EA 3CWJA 3UDVA 1N32F 1Q79A 2GVDB 4DR7F 4A8KA 2DGUA 2ACMA 5IS2A 4DR6F 2OPPB 3BPDA 3G6YA 3E3XA 3AH6A 1HBOA 3U7JA 2ZKTA 4C3MA 1ICEB 3EGWB 1KR4A 2IYGA 1U47A 2W2OP 3DRRB 3NGTA 2R7RA 4PKDB 2HQIA 3IGNA 3TZZA 4H4KC 3TZWA 3AY0A 1OO0B 1Q78A 1GXLA 3SV4A 3MMBA 4NMXA 3MUVP 3PW2A 2HHHJ 4ELVA 4ZVQB 4U6PA 2Z30B 2ZH1A 3NS5A 2CKWA 2CJKA 4DX7A 4CI0B 2Z2LA 1GH8A 3M2VA 3TEGA 1CS4A 2I9SA 2KFNA 3NWGA 5AE1A 2CPDA 2V8GA 1DTQA 1M5SA 4DN0A 4J9QA 2XI2A 4NE9C 3V5RA 2YVSA 4ZLLA 3ILIA 3R97A 4J5OA 4DV4J 4DV2F 4L6V3 4NLWA 1S0NA 3KFWX 1RWPB 2W4PA 2QRRA 2GFFA 3BO3A 2HMIB 2GAGC 1HIYA 4DEZA 4DSEA 2Q3PA 2V63A 4YP3A 4Y28C 2HQGA 1DTTA 5C2GA 2OFGX 1RTHB 5L1KA 4C98A 1B0PA 2H1YA 3CC7S 4ANCA 1C1BB 1WG1A 4DZ6A 2J7UA 4ED3A 3CSKA 4L73A 2OUGA 4OMFG 2J6UA 3AB2B 4Q0BB 2AHOB 5J2PB 2BVZA 4A8MP 2MZ1A 3BQ1A 4J9UE 5ETTA 3EZOA 3HSDA 1QLNA 5EUHA 5EWFA 3PRDA 1YZ7A 2YNHB 5T41A 1Z2ZA 3OXGA 5F8GA 2HQCA 4WXOA 1R43A 1TTHB 1VQ6S 4NZ7A 4ZP8A 3FSYA 2F3JA 1EP4A 4OJ3A 5ETSA 4GC7A 4B3TJ 1FE0A 3SSRA 1V5VA 5D6GA 3RRGA 1DQ8A 3W2VA 4PG8A 5AJ3J 5DM7Q 2ZOMA 1JLQA 2VUGA 3CCQS 2BABA 3BYRA 2ZE2B 1RUSA 4Y0FA 4OI3A 3FQKA 3TA1A 4H4OA 5CABA 3ET6B 4IOBA 1QVFR 4LR7A 2PMWA 2YTCA 2QG9B 1Q8BA 1YRUA 5LXRA 2UUBJ 3GCXP 2XMWA 3OXFA 3WZ0A 4R5PA 5EN1A 3T1YJ 4LJMA 4YUDA 3NOCA 3V2UC 4NEYA 4N77A 5FLXU 3AFGA 3UD5A 1LWCA 3CB4A 4IFYB 1AA1B 2FHKA 1S0OA 3R1HA 4WFZA 4NLSA 2K06A 1R6YA 4C8YA 5AE2A 4CO3A 2K7KA 4NLYA 2QV6A 3WX8A 3CT9A 3Q8YA 3KLGB 1I94F 4X62F 3MM7B 2RIJA 1YJ7A 3C6TA 2M9KA 1M1KT 3MCOA 4CIOA 4JI3F 3KJNB 3M1VB 2L9NA 2B7CB 1FXDA 4P74A 1FDAA 1XBWA 3US5A 1TK0A 4KH0B 4DOZA 1U49A 2JC0A 4AL5A 2DNPA 1X9MA 4KGXB 2NR0A 4YN3B 3KK3A 4CH1A 3P49B 1RHMB 2QMXA 1MLAA 2HNYA 3TA0A 2ZH4A 5A2QU 2VG7A 2WHOA 3HHLC 3BGRB 4DV6F 3V6DB 3KJVA 1HQUA 3AOAA 1SH3A 5F8NA 2ATLA 4FYDA 3MM6B 1NK8A 2HFNA 4QIFA 4U7CA 4H4KA 1S6UA 1JK9B 1R0AA 2AYBA 2E5LF 1V6HA 3GE9A 3ZZPA 2XLJA 5HO4A 5B0AA 4DCOB 4OYPA 3Q8UA 1JLCB 4J9SA 2DHGA 5HVHA 2MKCA 1VOMA 3A3NB 3R1LA 2FC9A 3GPAA 2E1CA 4F0HA 2B4VA 5B7WA 4ED5A 1T05B 2XYPB 4B9UA 3Q8SB 4DSJA 1FRLA 1FWPA 4DL6A 3QO9A 4FXVA 1U1QA 4W4MA 2ZNZA 2V4JA 4EWTA 4XDCA 2XGQA 5HJXA 1UEVA 1LKZA 2C2DA 2VJUA 2KB2A 4C0OC 3HMJG 4WYWA 4FXWA 4USJC 3GR1A 4ETZA 2DO0A 1T8EA 4G6VB 2GGPB 4LRBA 1NNDA 3JSMA 1TL7A 3OLBA 3EVWA 4L75A 3TARA 2FZKB 2VU5A 3RW7A 1NJYA 2F4VJ 4B17A 4IFVB 4NYOA 2V8DA 2V4RA 3AB4B 1HNIA 1WG5A 5DDOC 2ASJA 3M2UB 1JXEA 3ZZ0A 1C0UA 1NJXA 2CPEA 1SQEA 1EETA 7FD1A 5T7LB 2KDOA 2DD8S 3Q89A 1KONA 2AZ1A 3L4BC 3MECB 4MK8A 5M2PA 3PJ9A 1KBRA 1Y11A 4PWDA 1F9EB 5F8MA 4RUCA 1RAGB 1L3VA 4CLSA 3IS9A 3LA0A 1FXRA 2H51B 2KYZA 5HVGA 2VFVA 2MMYA 1MU2A 1HBOB 2Y8WA 4RU9A 3OL7A 1SV5A 4DR2J 4ELTA 3ENAA 4LRDA 4DR3F 3RRKA 1X7VA 4DFMA 3G2XA 3T6BA 4OJHA 3MUTP 4NLTA 2XG8A 2GS8A 1S4FA 1YG0A 2ZBPA 2GMLA 2GW8A 3UQSA 5KFDA 4XAKA 1R3NA 3M2VB 2DIUA 1CS4B 3EVMA 4NLDA 4CCHA 3OVBA 1UAWA 2CNOB 3PXGa 5IZHA 4LFBF 1D9FA 1DTQB 3FMWA 5JXSA 1FKPA 4B3SJ 5KFWA 1R8AA 3LALA 2HHQA 3GWCA 2HZVA 3WQPA 2BRLA 2C3OA 5GMDA 2XEXA 2MQPA 4ECSA 1K47A 5LT5A 3MMCB 2BKOA 1NLKL 4FXDA 4JP8A 3QT6A 1YX2A 4AL6A 2DR9A 1DTTB 1X0FA 4X65J 1XR6A 1XWLA 1J5EJ 3HHLA 2Z4PA 4C8NA 1CJTB 4JV5F 4LSNA 3W64A 1FRIA 1BE4A 3I4HX 1FXLA 3I0RA 2KG0A 1XNQJ 3H4BA 3FZBA 4NLVA 1Q4RA 4UY85 3DN9A 3BO4A 1H7XA 5F0WA 3H98A 4CRJA 1VRQC 2G1HA 1JJHA 1IKYA 3JQJA 1FI4A 2DPIA 1EP4B 2WB1D 1GNKA 4WFNQ 4DV0F 1D3WA 1PJ5A 1YJVA 4ZN1A 3GONA 1RHRB 2BJ9A 4ZVUB 4OI1A 2KYXA 1JMTA 2P6TA 1LNQA 3CEDA 3W2VB 1QUPA 1KVIA 3PRBA 1JLQB 4ZPCA 3G82A 5I3UA 1RA7A 1Q16B 1SJ3P 1FESA 5E3RA 3A4TA 2DEIA 4QIVA 3KMSA 4H4OB 3RAXA 4ANEA 2C42A 5KG7A 2YKNA 3CXCR 1TFWA 4WKRA 2LDIA 2BUNA 1W25A 1JWWA 1HWLA 2G4BA 4OYXA 3CTRA 4QWDA 3HHLD 3SQOP 3TNVA 1SB6A 2LCWA 1VQNS 2R8GA 1FD8A 3M8SA 4F7VA 1LW0B 4KHPJ 4WIQA 2VQEF 1G6BA 1YJWS 5BR8J 4PPZA 2DGTA 3OFHA 3C6TB 2E44A 3M8RA 2CNLB 3HVTA 2JEGA 2VOOA 4ZDNA 1C4AA 2W8KA 4U95A 1N33J 2RF2A 3BEGB 4NZ6A 1X5PA 2IAJA 3KUHA 4QWCA 1VQ5S 3TUJC 4U7UK 4F4AA 4M5KA 4HH1A 4DSKA 2Z56B 2RDDA 4URSA 3KK3B 1NK6A 1HNZJ 1ULRA 2HNYB 2VG7B 3PZPA 3KJVB 3QSIA 1HQUB 1R7IA 5L1LA 2YNGA 1CULA 2ZUAA 5FJ4A 1RABB 1OPIA 5DLGA 1R0AB 2EW9A 3BBFA 5D0GA 2XMMA 5M2UA 2ADBA 5J2QA 2OLWA 4QR0A 3FQLA 3GIMA 2DNHA 5LMUJ 4HVZA 4DV5F 4JI5F 1XMQF 1KWMA 3QT8A 2CRLA 3VGTA 2EBEA 2H65B 3H20A 2C22A 3KLHA 2XTJP 9ATCB 3IFEA 2HNDA 4F4XA 2BW2A 1SJFA 3G8TA 3NRBA 5DQGA 1O5JA 5T14A 4I68A 2JRSA 3QO9B 1CLFA 2JL9A 3LPEA 3CC2S 2BYCA 4QIGA 1RZMA 1VRUA 2UUAJ 4KE5A 2V4JB 3SXLA 2LXUA 4EUVA 5B0DA 2YY3A 1N4LA 2CZ4A 4Y65A 1WC0A 4C48A 4Y2AA 1YDLA 1XR5A 5E5NA 4ED4A 4F25A 4ILLA 4HTIA 5KFFA 2FLOA 7FDRA 1VQYA 4IQXA 1OYDA 3MGJA 4NASA 3JSMB 2KO1A 4HYKA 3G87A 1AFJA 1W2IA 3EXCX 1KLMB 1U2FA 1CQMA 1TVRA 2OP5A 2CQPA 2IMOA 3W5YA 4X64J 2OEJA 2QA1A 1CC8A 2JFDA 4DR5J 1HNIB 2EKNA 3CIMA 3MF5A 1TZ0A 1ZM9A 3F73A 2A6MA 5IXUA 4EYIB 2HRTA 4O0IA 1RAIB 3PEHA 4ED0A 1RT2A 1C0UB 1HWUA 5FIIA 2LQJA 1DBDA 4ED7A 1KFSA 1EETB 2WVDA 1RWOB 2DGWA 4KGKA 3BO2A 2YNFA 2MKJA 1Q95G 3ETOA 3UFCX 4C97A 4X4OA 3SZ2A 3A1YG 5DZ6A 4DFPA 4PWDB 3L95X 5F41A 3B54A 3DC2A 2WZ1A 3SI8A 4NCBA 4ECTA 1CC7A 3Q83A 3IS9B 3MDFA 3ADAC 3J7ZT 3FVYA 1Z2LA 2J5AA 1RCOB 1MU2B 2MLZA 3EDQB 3A8EA 5KFBA 2E7VA 1SV5B 1SIZA 4A48A 5IT9Y 1BQMA 2D3UA 1EAYC 2XYHB 2YXLA 6AT1B 5J1NA 2NSBA 4AYBD 2AEFA 2X1AA 4N5SA 4DV7J 4KO0B 3W8PA 4C4WA 1JB0C 1HPZA 4B3RF 1RJJA 3TWZA 2BJ3A 2RSQA 3QGPA 2K2PA 7AT1B 2IBOA 4JI8F 3Q86A 2LQ8A 1DARA 4PXDA 3I5AA 2UUCJ 1PAUB 4DCJB 2HLUA 2CNKB 4KV8A 2CQDA 3QT7A 2V9WA 5E3PA 5MAOA 3W9IA 2EFPA 1KLNA 1YWXA 3RR7A 5LJ5Y 4PG5A 4IOCQ 2XMJA 4DU8A 1CBKA 4XPCA 4JUZA 2C2EA 4QBUA 3OUYA 4JV1A 3ZZZA 4HTJA 2Z58B 2EPIA 3LTOA 4OZ1A 1UTAA 1T3NA 5GAHI 4RW6A 2W7OA 3WDOA 1YI2S 5JVHQ 3I4PA 2OEMA 1GAOA 2NUUG 3H2LA 3TP2A 3H90A 1Q8IA 3TAMB 2R7OA 3HHLB 3L7UA 3K59A 4FF4A 1FK9A 2I8EA 1S0MA 3BS9A 4RU2A 2XCAA 4YR3A 1VYAA 1VI7A 4LSNB 2AV5A 2LDYA 3I0RB 2FY1A 2LMIA 3BGUA 3CDEA 4KSEB 4OFZA 4DL0C 1IUJA 3MOJB 1X5SA 3WC2A 4LVNP 2VBYA 2C3PA 2FLLA 1QM9A 4L74A 3HT3A 4TN2A 2PEHA 2CJXB 4F02A 3MD3A 3MEEA 2HHHF 3PO5A 4M5HA 2M4MA 1FVSA 1MMLA 4KHMA 2LEAA 4R0EA 1D8ZA 3E51A 3W5XA 1QE1A 2Y9HA 5EWGA 2ZUGA 1PG5B 1DZ5A 1IBKJ 4KJIA 1RLDA 2JWNA 2MZSA 5ETPA 4A8QA 1O0PA 2RVJA 3C15A 2RUGA 2LYVA 1MN7A 2MXYA 5I3UB 3Q23A 1U0HA 3A8IA 2IIHA 2KHCA 2R7SA 1TMMA 1X60A 5KG2A 1JLGA 5KT2A 4DV4F 5DS7A 4RW7A 2YKNB 1RTJA 3A13A 2FPHX 2H5JB 2F1FA 1TAUA 5J1PA 3VV2B 2L41A 4DZDA 3A12A 1ZA1B 3VAGA 3NMAA 1T9XA 3IXQA 4FS2A 1XK8A 3M6XA 4ECUA 3DOLA 3BYPA 2B8QA 4Y2IA 2QL7B 1ZYQA 3EGVA 3N9UC 4MT1A 3AA8A 3EZ5A 4TLQA 2W4DA 2QZ8A 2XI3A 2CAJA 3A8KA 3P6YC 3HVTB 1PJ6A 4DUTA 1NXIA 1RT4A 3TJAA 4M1KA 2M8HA 2FLNA 1RQ0A 2RF2B 2IAJB 3EYZA 2AKWB 2IA6A 3O1LA 5DRKA 3RTVA 4JB8B 2BOAA 4KQZA 5A8WA 4CH7A 1LK5A 1F3FA 4RL1A 2IDEA 1EQMA 4NLPA 5AJ3F 1QSSA 1T9TA 2CIMA 4C9DA 1Q5VA 2E9RX 3SCKE 4X4PA 3MR6A 1S1XA 2DHSA 2R8HA 1WDTA 4YHHJ 1IXKA 1SJ1A 4XIUA 2YNGB 1CULB 2MY8A 5C42A 2FJXA 3HF5A 3J80U 1NSKL 1F6TA 2VFRA 2IRUA 1LW2B 4UZBA 5J2QB 3R5GA 3BSAA 2ROEA 2UUBF 1S1UA 3HULA 1RWVB 3T1YF 3MI7X 3KLEA 3HLUA 4O4GA 5I3PA 3MPYA 3KLHB 4I2QA 2HNDB 2C2OB 4FF1A 4EZ6A 2MPUA 1HHSA 3PIPQ 2WSCC 3S1TA 3KJQB 1VQLS 5FLXY 3KK2A 1IWGA 2CPXA 1UMJA 2KTQA 3KTQA 3OVAA 3MR3A 1VRUB 2RT3A 2XQCA 3AJ1A 3HHDA 3ZNJ1 1RSCA 3LGNA 2OSQA 4IO1A 1H98A 2B4UA 1OQ6A 4DSLA 2OMOA 3DRSA 3NBPA 1FKAF 3LQVA 5G4DA 1H38A 3I9ZA 3GLJA 4C3KA 1OY8A 2MQQA 4OI2A 4USVA 1U24A 2OTJS 1VQ4S 1PAEX 4CT9A 2P6SA 5L8RC 2XLIA 3TZYA 1K1SA 5ETKA 4C2MA 2GMJA 3MWBA 2GJFA 1LWEA 3CCMS 5DG7A 4DSIA 1DFDA 4HACA 1R89A 3Q8RB 4K4SA 1GTHA 4KIAA 1RT2B 2AJ0A 4ZLJA 3DOMA 3LAKA 4CP5A 1DQ9A 2DO4A 5A2QY 1U1OA 2DR7A 4LR9A 1B7YB 1T3OA 4ZIWA 3POTA 2RRAA 4PWWA 2ZOFA 4DR6J 2OFHX 5D4LA 3I0SA 3J7AN 4K4TA 2YKQA 2CDRB 2GV1A 2MGZA 2BX6A 2W24A 5IM0A 3BGLA 1RAEB 1SJ4P 3MZIA 3CVKA 5JUMA 3P5BP 3DLGA 1BQMB 2XY7A 5IV4A 3TI0A 2MEWA 1FNOA 1EHWA 1RYRA 4DR1J 4WP9A 1HHTP 3UD4P 1KHWA 2F8HA 4LF9J 3CGIA 4MJKA 2EK1A 4ZVTB 5ETRA 3HZEA 2IY5B 2GCFA 4N7TA 2DNOA 4ITSA 1HPZB 3BQ2A 1X4HA 2F65A 3QLHA 2KRBA 5KFLA 1RWMB 4X66J 5KFPA 5F0UA 4OYAA 2PC6A 1MROA 4B9SA 4LBIA 1UEKA 3L09A 2YQ1A 5DQIA 2XSFA 4FF2A 2VASA 2B4OA 3QRRA 1PC4A 2F4VF 1NB2A 2MKSA 1FRXA 3HT0A 3PV8A 2CJBA 2V69A 3SMZA 4WKYA 2GMHA 2ZBCA 2CJQA 2JDJA 4PQAA 2ASYA 3Q2TC 5AXNA 1RBOB 1WG4A 1IWAA 4RW6B 2JFKA 4O3PA 3M8WA 1NPRA 3PIOQ 2PI4A 4PWUA 4F3QA 4X4UA 2CDQA 3VAHA 3FGVA 3ULHA 2UVWA 3DFEA 3VQSA 3HP6A 1WC4A 4E0DA 4DR2F 5KFZA 2WOMA 1HBNA 1HBUA 2YPZA 1L3UA 1M1GA 5D0RA 1EX8A 1VJQA 1Q0NA 3TEHB 3M7VA 4ZCLA 4Y2KA 1ZTTA 2IBKA 2HQDA 3T1AA 2VQFJ 2DBBA 4F67A 3R7NB 2OD6A 3R6GB 3S8SA 2WAQD 3AAWB 4LIRA 1S77D 1KEKA 3C15B 3TUIC 1Q53A 3RAMA 2EFNA 5HK4A 2E5GA 1FRHA 5B0CA 2PDAA 2XM3A 5ETMA 1WNEA 4RW8A 1U0HB 5K8NA 4B3SF 4LF5J 3V81A 3BBCA 3I96A 1YKWA 2C2RA 3M2RA 4RW7B 2J6SA 2U1AA 3SFGA 1OWXA 1RTJB 4KR0B 1ZAWA 2AYMA 4QWBA 2FJVA 3DMJA 4J7CA 4JV2A 3SSSA 4ZPWR 1NSAA 4M5IA 3SFUA 2EXUA 3M6WA 4X65F 3MM5B 5A8KA 5L38A 3CMQA 1J5EF 1HKAA 3CMES 3BKUA 3DOLB 1AUSL 3HJVA 3JB9k 2GHPA 1EB0A 2FTRA 1XNQF 1ZM2A 1T7PA 4OV6A 1FNMA 1B70B 3LPYA 3OBIA 1FFGB 5CAAA 4YDDB 2JEJA 1LFPA 4ZPVR 1RT4B 4FF3A 1RT6A 4F36A 3G6ES 2XZTB 3MHYA 2LP4A 1U0SA 1WEZA 1RK8A 4LF4J 5GAEI 2HVDA 3MAAA 4F26A 2QTWA 4JI6J 5A8WB 1PC5A 4OHVA 3ILOA 2RQKA 3WX4A 4DFJA 3GFYA 4BC7A 1SC1B 4FZVA 4HL9A 4EU0A 1YTYA 2VKRA 3AOBA 3K5LA 4RNOA 2J8SA 2QL5B 3CJTA 4MKBA 5C42B 3QT5A 2RKIA 2FZCB 2B9XA 5CD4H 1QAIA 5KFIA 5JVGQ 5J1EA 2HZCA 4P52A 2HVIA 3QJLA 3QIPA 1U1PA 2NUHA 1S1UB 3UVJA 3JTNA 3VWSA 3KLEB 2ZWPA 5L1JA 4IKAA 2HQFA 3NOGA 4I2QB 2MTLA 4OLOA 4MMOA 3BB5A 4ZP6A 4G65A 4KHPF 2D9PA 5G0RA 5BR8F 1N6QA 3D6FB 2W1BA 1IR1A 3M9NB 4ZJQA 4QU6A 3RG6A 5E3QA 1QTNB 3DRSB 4P75A 3NBPB 5H9FK 3MMJA 3K5OA 2HAIA 3VAFA 1N33F 2G0JA 2CWXA 5KFXA 1UJ4A 3QGGA 2JEIA 2Z0GA 1J5OB 2JHEA 3KJFB 1RADB 2HHUA 1HNZF 4P9SA 1LWEB 1VLYA 3I6PA 4DX6A 1FO1A 1AUDA 1NAQA 5K14A 2PIIA 4WYLA 1VISA 3E2EA 4JOUA 3DOMB 3GV5B 1ZPWX 5IOLA 5KG4A 2OELA 3BDEA 3DDKA 3LWLA 4RUHA 4O23A 3GV8B 5IWAJ 2ZJPQ 4LIWA 4WTYA 2Y1RI 1N0UA 3BJYA 1S57A 4ZVPB 2EFOA 3TO8A 3ELHA 2UXDJ 3C8YA 2C3MA 2VC0A 1P9QC 3BREA 5L46A 1NJWA 3I0SB 3CJ8A 4CLWA 3H8YA 3R27A 2YKMA 3K8VA 2MGZB 4EO8A 5F3TA 2FVPA 5IM0B 2A18A 3I5CA 2Z8QA 4DR3J 3MAQA 5GADU 4I6AA 5CH7B 3DLGB 2RDJA 4IQMA 3GMGA 1S72S 2UUAF 4IRDA 1SH2A 2G0CA 2E66A 1REGX 3PFOA 1YITS 3IN5A 4FKXA 3GG0A 3LF0A 2OPSA 5KOWA 3DOKA 4YQWA 1CG2A 2YWWA 3QRPA 2IM0A 2HS3A 4LFBJ 2GC8A 4I56A 3QLHB 2R8IA 1RACB 1LEOA 1UJ5A 3RBDA 4OX6A 3M8QB 4FYVB 4F2RA 2BXJA 5A76A 3C6UA 1NDKA 1NB7A 4WJBA 2R8KA 1W7WA 3MMAA 4X64F 4G1QA 3KHHA 4DR5F 2A10A 3NGUA 1P1LA 2I6WA 4RPFA 1C1CA 4X4RA 1GTEA 1AXQA 2FHOB 3IAS9 5D3GA 1RTDA 4IDKA 1HNVA 2Z2MA 2V0NA 2BE9B 1UWBA 1CPZA 2H4YB 1HL6A 4NEZA 3KLIB 3JSYA 3ONQA 3CIZA 2MKYA 1C2PA 5J2MA 4EO6A 2VDHA 3TANA 2GIQA 2NSCA 2LQ5A 1YHQS 4DL2A 2FVCA 2BQRA 3R5BA 1WSVA 1RTZA 2L48A 4OZ0A 1FRKA 3OT9A 4XK8C 1N54B 1HBNB 1HBUB 1AYEA 1LXJA 4DV0J 4B3MJ 4OYZA 3D6MB 4IH7A 2J9DE 4F0MA 4QOTA 1PBAA 1NPKA 2UXBF 2CVIA 1TUVA 4ECWA 1R31A 1S76D 2DXEA 3PX0A 1FWLA 1U45A 2Q66A 3R5AA 4RLEA 3CD5A 3PX4A 2PEBA 1Q7LB 1NMEB 1PYOB 1WACA 3D0IE 3VAIA 2UUCF 4LSZB 4KGVB 3V6JA 4RW8B 2W2PP 3AD8C 5HAOA 3V81B 4WK1A 2BACA 4OI6A 2D74B 3NAIA 1SQGA 4YB5A 3IC1A 2GHWA 5HMXA 4WFXA 1QSYA 2HFSA 4XDDA 3DMJB 2VJVA 2LXFA 3NL0A 3T9ZA 1MG7A 4AXJA 3HVAA 1TK8A 4CLYA 2GQCA 2DNGA 1K9MT 3K8WA 3PKYA 2R7XA 2RHQB 1T9WA 4AUKA 1O8BA 1SUQB 3HFZB 4V19J 2Z2ZA 4WIIA 1SCJB 4FP9A 2RHSB 4JYAJ 2DCLA 3Q2SC 2YX7A 2HHTA 2V67A 2E7XA 2DH9A 2HEKA 3DM2B 1UJ6A 3QRQA 1RT6B 4PR6A 3ENVA 2J0QD 5DDPC 2CNNB 5DG9A 4USHA 1H7WA 1AZSA 4Z7CA 1T94A 3DLJA 3GYGA 3NGSA 2G1DA 1AW0A 1IBKF 1M5OC 4LF8F 2MQMA 2ZE2A 4MFBB 2R8JA 3LANA 1KHVA 3BSNA 2DXDA 5KFQA 3WIVA 3JSBA 3ET6A 4P2MA 1DQAA 1WI6A 3FRYA 1VIXA 3SCJE 1R8PA 3QPIA 5I4MA 1X4EA 3CCLS 3GFXA 2RKIB 2ZH6A 3FSIA 2VV5A 4DUZJ 5KFNA 1D9AA 4NPOA 4B9MA 2HKEA 2L3MA 3ENQA 2IJRA 2V8PA 3UVJB 3IBFB 3H7HB 3LOUA 3PTWA 3CO9A 3CCJS 1R6VA 2ZZMA 2QA4S 2CFXA 3D54A 1WEYA 4PG4A 2MHNA 5E41A 4BS2A 1WELA 4M63A 3AQOA 5G0RB 4QCLA 2BEFA 4WF9Q 3M1VA 1NH7A 1N6QB 2D3ZA 3EMTA 2K1RA 2Y1JA 4WCEQ 2PSZA 2HK3A 2DVIA 4ZLNA 2GX8A 1RAOA 3N6LA 4LT6A 1AROP 3NLCA 2LVWA 3MEDA 1VK3A 1NK9A 4I67A 3BGRA 2AT1B 5F8JA 1GEHA 3K58A 2H9ZA 3R6LB 1Y5IB 2JLEA 3J81Y 5K14B 1VC5A 4JI2J 2FIUA 4YHHF 5AXKA 5HMZA 4HT5A 1WKJA 3W61A 1HNXJ 4RW9A 2YX1A 3D66A 3MEKA 5ADZA 2KL8A 2FVSA 1RAFB 3EM1A 3UCZP 2QL9B 1Z1ZA 2PT0A 4CM2A 4NZ0A 3RZAA 3FNNA 4MYUA 2OAUA 4FYYB 2YKPA 1T05A 4N8NA 2V2QA 1IKXB 3J80Y 2YKMB 4V19X 1XMBA 3MURP 4UUXA 2JC1A 4EYHB 5BJRA 5AE3A 4MKVA 5KFEA 4P73A 1H74A 2VIHA 4IOAQ 4DL3A 1JKHA 2RS2A 1HWIA 4FN5A 3NG8A 2DXFA 1SJQA 1BUXA 2DNNA 3PHEA 2DRAA 1TMJA 4FBUA 3CCTA 1F3VA 2OPSB 2EI5A 2D41A 3NWRA 3DOKB 5HANA 1F60B 4F0KA 2OSRA 3TQEA 4EK2A 4OZNA 4JI8J 2AJ4A 5B0EA 4IFVA 2JH3A 5LOQA 1JIHA 1KN6A 1V5IB 3PG9A 4J9KA 5FDLA 3MMAB 3CO0P 4TYAA 4KH1B 1KQFB 4J37A 1A7GE 1IBLJ 3TR5A 4LBHA 1VDHA 1C1CB 1B3TA 4P6QA 5T7LA 5D3GB 1MWYA 1RTDB 1EZZB 3MFHA 4FDFA 4IDKB 1HNVB 4RNHA 1N5YA 1UWBB 3IAM9 3KOAA 2MQLA 3CULA 1NHKL 3SCIE 4I4BA 1FEHA 1TV6A 2AIRB 2YPYA 1IKVA 4DF8A 2KXFA 2C3UA 1BD6A 4OHXA 4OYMA 3MOZA 5J2MB 3MTJA 2EVZA 1TL3B 3DLHA 4PUOA 1S59A 3WIUA 3BGFA 1S9GA 1S1WA 2OMLA 1JQGA 3H40A 2QLBB 1RKJA 4DR1F 1DRZA 2JLGA 3TRGA 1XN9A 3LP0A 4WU3A 1KDNA 4HKQA 2HBRB 4LF9F 4GRSA 2AX1A 1BGXT 5F9NA 4ZLPA 3MR7A 2HHVA 2R7VA 1XJWB 1XMOF 5J2NA 4NA2A 2NXUA 3IR7B 1ROFA 2VPYB 4TXSA 1SKSA 4X66F 2E1AA 3P45B 4CZCA 3O5TB 5SZTA 3PYEA 1HYSA 5GAHU 3N79A 3SQGA 2V2ZA 2QN6B 4ECQA 1X0PA 2CWKA 1SVDA 3ZZYA 1WKKA 2AQ4A 1EKSA 4A8FA 4NXNJ 1GXUA 3KWMA 1HMVA 2I38A 3AJ2A 5KG6A 1N56A 3MMCA 3GB0A 4K4WA 1LK7A 1DAXA 4I6WA 1N5QA 5E33A 5F8IA 4KYZA 2XYGB 3HFKA 5EHHA 2B8PA 2JNJA 2RB7A 2O5DA 1RDRA 2CG4A 3Q0AA 4LFAJ 1CJTA 2ALYB 4CH0S 1RP5A 4JV0A 1C4CA 1H6KX 3RGIA 1QY7A 3GIJA 4KGMA 2DGVA 3LGMA 2W4CA 1U2CA 1UFWA 1Q5YA 3C66A 5LJ3Y 3BN7A 5CQGA 4LRAA 1EQ0A 2X1GA 2ZJRQ 2ZZNA 4Z7YA 2Z57B 4P71A 4K8RA 4ZOSA 2L9DA 3PNIA 2DNMA 2HNZA 4OL8A 2Q6CA 2P5VA 4FVMA 1JLFA 4DLGA 1AZSB 4WK3A 4JI1J 4J9LA 1QAJA 3MPWA 2W9AA 4CO4A 2VQFF 2HPUA 2XWYA 5LMNJ 4OZJA 5H1SV 2UXCJ 2J0WA 3A3PB 8AT1B 4LFCJ 5KTQA 2XY5A 1TL1B 3GSDA 3P5TL 2QGFB 2Z2YB 1CQNA 2ZEJA 2DGSA 1SC4B 4LF5F 5CD4A 2LEBA 4FVCA 3IWNC 4NLUA 3E8OA 3G6VA 3PW7A 4TKTA 4MYTA 1N5SA 4YMEA 1GMVA 3DRYA 2B9YA 4X4TA 2LFVA 2PMHA 3JAMU 2QO3A 5L9XA 1JLBA 4ED2A 4KPYA 1LW0A 1UZHA 1VRTB 3IWXA 4DPOA 3KK1A 2QX0A 4L72B 2E1PA 4AQYJ 2BJDA 4ZN3A 1RWWB 4O0NA 1MW7A 4K4ZA 4YB1P 3JYTA 4TYBA 2BKPA 2H48B 5KG1A 2CPFA 3J7A1 1D09B 2K1RB 4ER8A 1WSRA 4IRKA 3H4DA 4EGLA 1S6PA 3W9JA 2HW3A 2QC3A 4WPAA 1S1TA 3PYGA 3HDSA 1G7CB 1QDUB 2IVYA 5K9FA 3DGPB 1VQKS 4LF4F 1M1HA 3MEDB 4JI6F 3T6JA 2JVOA 3DLKA 2N7YA 4Y3CA 2KI2A 3TVKA 2PGCA 4FS1A 2XHCA 2VICA 3MCMA 3PKMA 4CLTA 1U6ZA 4OYBA 3D7SB 2CG8A 3NGDA 1TFYA 2Y1IA 2RQ4A 2HBQB 2ZDOA 4RW9B 3K89A 3N5FA 2CJAA 1VCTA 2NZCA 2W7PA 3I56S 1EJ7L 2MKIA 3C16A 3R8YA 1WWHA 2GQ2A 3KNAA 4X4SA 4MK9A 4ZPDA 3B78A 3RBZA 4ZKAA 5EX0A 1RU2A 2YKAA 2CQGA 1V3RA 3QMQA 1V3ZA 2DCUB 3LO3A 4A46A 2LA6A 4K5SA 2LECA 1N5VA 1O51A 3EE3A 1B99A 2WRMA 5JMNA 5KFHA 4AD6A 2YWGA 4QQBA 3FEYB 4OYWA 1VFJA 2HAFA 4A8OA 1S49A 1JKHB 5KG5A 4U96A 3OTOF 3RRHA 2ZITA 1OY6A 2HIQA 1N5TA 2B9EA 3QYYA 1KLMA 1F9HA 1B0TA 4YR0A 1UEUA 3PEJA 3N01A 1NEEA 1T9YA 3BZQA 2M70A 2VA2A 1HD1A 1KVJA 1L3SA 4C8MA 3UD3P 3CJSA 2UU9J 3O8WA 2M0GB 4PYDA 5FDLB 2R4FA 4E8UA 2J9EA 3RBXA 2F9DA 5CXTA 1ZA2B 1N5YB 2P9EA 2E5IA 5IWAF 3GIIA 2UVRA 3PYDA 1GK8A 1TL5A 2PA3A 1TV6B 1IKVB 2DTJA 4G1IA 3IRWP 2UXDF 4DQQA 3HHKA 2JLFA 2K7JA 2QYCA 1S99A 3IBWA 4ZHRA 3OQ2A 4PUOB 4RZRA 1S9GB 1S1WB 1M5KC 2GZOA 3NY0A 2KRRA 1E6YA 2RRNA 1ZBTA 3JSRA 3PJXA 1PBUA 1GQEA 4K2XA 4CT8A 3BKFA 2GIFA 4KO0A 3LP0B 2H4WB 3PACA 3QQCD 3N28A 4OYOA 2WSEC 1SKUB 4N8OA 2R2RA 1N0VC 1Y5LB 3TOQA 1KQKA 4NXMJ 2KVQE 5J2NB 3N4WA 3MCSA 3RU0A 4NCAA 3MXHP 4Y6IA 1N8RT 1QAYA 4N41A 1EKRA 1FDDA 2UUTA 1PKUA 2MSSA 3IM9A 1HYSB 3R3TA 1LOUA 3SQGB 4LBPA 2GJ2A 2O3DA 5IQQA 4QW8A 1YBTA 3C3LA 2ERRA 3KLVA 2EC2A 4ED6A 3GYNA 1HMVB 2QLXA 2XO7A 1M0SA 2RNEA 4HI2A 4UOFA 5HP1A 1R0BG 4UOGA 2Q1LA 1TQLA 3QFWA 2ZC3A 3LW5C 3DLLQ 3HHEA 1UPMB 4RJVA 1Y10A 3TAMA 3D6HB 2UZAA 4QR1A 3QAEA 3M9MB 2RQCA 2CYYA 1B0VA 2LQ9A 2XBPA 3CJ3A 2DKOB 4OYIA 4YOEA 3T1HF 1M5VC 5H9EJ 4DPYA 1Q7YT 1RT5A 2HWHA 1RLCL 3OTEA 2GHVC 1X5OA 3ITHA 4B3MF 4DR4J 4WP8A 4R25A 1RISA 2QMWA 3CCSS 2HNZB 3OTCA 1W2BR 3CC4S 4W98A 1JLFB 5HQ8A 4DPTA 4AE5A 3D68A 4ZA1A 4HHHA 4Q5VA 2W7AA 1JJ2R 3D1OA 4PQUA 3P3DA 3PW5A 2GAHC 3W8GA 2DNQA 5K8PA 2OPQA 1UVLA 2LQBA 3I55S 1WHXA 2YBVA 2R2UA 3T5KA 1H72C 1OSCA 4URGA 1I6JA 1RA6A 2G2YA 4PAAA 1FRJA 2DITA 2XO6A
chains in the Genus database with same CATH topology
1BY9A 3OBIA 4IOBA 3DXBA 1QVFR 3MD1A 5L1IA 4YDDB 3NP5A 2JEJA 4CO5A 2IM3A 3I5BA 1LFPA 4ZPVR 1RT4B 2YTCA 5B0BA 1JJ4A 4FF3A 1U48A 1Z4UA 2ABYA 2O1PA 1RT6A 2ZHBA 3MM8A 4HH0A 2RD5C 2JSXA 1Q8BA 3G6ES 1FVQA 1YRUA 5LXRA 3MHYA 2IA0A 2XMWA 1UA0A 2YH0A 3GILA 3T5JA 3OXFA 1WEZA 1RK8A 4PG6A 2HS4A 1HFEL 4PXCA 3WZ0A 4R5PA 5A6PA 1JLBB 5EN1A 1VJWA 4LJMA 5GAEI 4YUDA 3EPGA 4F26A 3V2UC 4KKOB 1WD6A 5CYJA 3B82A 4N77A 5A8WB 2VKZG 1PC5A 5DO2A 3KK1B 1LWCA 1TL1A 2IM1A 3CB4A 4IFYB 2FHKA 2WB4A 1S0OA 3R1HA 4WFZA 2CQHA 4NLSA 4OHVA 3W2WB 1PO6A 1X8DA 4B3TF 1FT8A 2RQKA 3WX4A 4ECYA 4DFJA 3GFYA 2E9ZA 1R6YA 1B7FA 3HK2A 4BC7A 2XNRA 3HPOA 3OR1A 4C8YA 5AE2A 4XO0A 2P9CA 2KM8B 3JYTB 4CO3A 2DGQA 3O6QA 4FZVA 4HL9A 4EU0A 2C28A 2K7KA 4NLYA 2QV6A 1YTYA 2VKRA 1HI8A 4IG0A 5DDQC 3MEGB 3CT9A 1I94F 3KLGB 4JYAF 2FUG9 3K5LA 1HWJA 4RNOA 2QA2A 4X62F 4MKBA 3MM7B 2RIJA 5C42B 2R7TA 1WF0A 3C6TA 2M9KA 4NYZA 4B02A 1M1KT 3KHRA 4CIOA 2QEXS 4JI3F 3M1VB 2L9NA 3VTIA 1S6PB 2AJFE 2HWIA 2RKIA 2KXHA 5LXYA 2B9XA 3U27A 5CD4H 1QAIA 1IJFB 5KFIA 4EBCA 4NL5A 1FXDA 2B7CB 1JNRB 5JVGQ 5J1EA 2HZCA 4DX8H 2QSFA 2HVIA 4I6YA 1S1TB 3QJLA 4TY9A 3CJKA 1SC6A 2VPXB 1FDAA 1VRTA 1OS5A 3VZHA 4TQRA 3QIPA 1U1PA 3OJSA 2NUHA 2AF6A 2ASLA 1XBWA 1S1UB 3JTNA 3US5A 1TK0A 4QR2A 3JTPA 4DOZA 3FFIA 1U49A 3VWSA 2YNIB 3PR4A 2JC0A 4AL5A 2DNPA 3KLEB 5KFCA 4RBVA 5E3AA 1X9MA 5L1JA 4IKAA 2NR0A 4I2QB 4MKAA 2XMTA 3GFHA 1HW8A 3KK3A 4CH1A 3P49B 3DLKB 2QSWA 4MMOA 4OLOA 1SBRA 3O44A 3BB5A 4ZP6A 2QMXA 2R2TA 2OTLS 2HNYA 3TA0A 2ZH4A 2VBXA 2VG7A 4KHPF 3PR5B 5B09A 2WHOA 4DJBA 1VQMS 2D9PA 3HHLC 1ZH5A 1YRXA 2LLZA 3BGRB 5G0RA 2UV8A 1JLEA 4DV6F 3V6DB 2XMKA 3KJVA 4OJ1A 5BR8F 1HQUA 1ZAVA 3T5LA 1SH3A 1TKZA 1VGYA 5F8NA 2ATLA 4FYDA 3MM6B 3TA2A 1NK8A 2HFNA 4QIFA 4U7CA 1N6QA 4H4KA 1T95A 2BOPA 1LW2A 5HROA 3VF0B 1KS2A 3M9NB 1S6UA 1FRMA 1JK9B 4QU6A 5C25B 1KRPA 5E3QA 1R0AA 2UP1A 3DGPA 2A3JA 2AYBA 3OJUA 1HD0A 4DUZF 2E5LF 3DRSB 1V6HA 2CQ0A 4HEA9 3DU5A 3GE9A 3NBPB 1TKDA 3MMJA 3ZZPA 3CE8A 2NQPA 3K5OA 2XLJA 2HAIA 3CDWA 1E6VB 4BBYA 5HO4A 5B0AA 3VAFA 1N33F 2I1RA 4TNOA 3C2PA 5KFXA 3N6NA 1UJ4A 4DQRA 1JLCB 1RT7A 3LH2S 4J9SA 3QGGA 1S9EB 2F7VA 2DHGA 4IRCA 5DJBA 2JEIA 5HBMB 2Z0GA 4ED8A 1J5OB 2MKCA 2N7CA 4F4YA 1VOMA 3ZC4A 3KLFB 3R1LA 3CJ5A 2J76E 2GIRA 2FC9A 2HQ3A 2JHEA 1APSA 4OI0A 2HHUA 4ZVGA 2E1CA 3JTOA 2B4VA 5B7WA 1HNZF 4ED5A 5K8OA 1N88A 1T05B 2LU2A 4B9UA 1LWEB 2RJZA 2VPZB 2CJ9A 1VLYA 1JLAA 3Q8SB 3QWUA 3GYXB 3I6PA 4DSJA 2HFZA 1TVRB 2WTFA 1FRLA 4RX6A 3DI6B 5KFMA 3NS6A 4DL6A 1FO1A 3TX8A 2FJEB 4DSFA 3QO9A 2DHXA 4FXVA 1NAQA 2ZHOA 3B4MA 5K14A 2PIIA 4O3OA 4WYLA 4DS4A 1U1QA 3E2EA 4JOUA 3UI3A 1VQOS 2ZNZA 3GV5B 1ZPWX 2V4JA 4EWTA 4XDCA 5KG4A 2XGQA 2HGNA 1UEVA 2GQQA 3BDEA 1LKZA 2C2DA 3DDKA 3LWLA 4RUHA 2KB2A 2KVIA 3EZUA 4O23A 4C0OC 4CO0A 3UPFA 3G71S 3HMJG 4WYWA 4FXWA 2PE8A 3GV8B 4IG3A 2ZJPQ 1RT1A 5KFOA 2MSTA 3F44A 4LIWA 4USJC 4WTYA 4A8XA 2ZH5A 2Y1RI 3GR1A 1N0UA 1WI8A 3OXLA 4ETZA 3BJYA 2DO0A 1KSPA 1T8EA 4G6VB 2EFOA 2GGPB 4O3SA 1YJRA 3TO8A 2DJWA 1NNDA 5KT5A 3C8YA 3JSMA 2C3MA 4MKYA 2VC0A 1P9QC 3BREA 3G8QA 1NJWA 4ID5A 1RYSA 1KNZA 3I0SB 2JX2A 3OLBA 2YNFB 3P96A 1S6OA 3H8YA 2HS0A 3R27A 2YKMA 3PO4A 3K8VA 4ELUA 3TARA 3EXYA 3DU6A 2XWXA 3D0GE 3PW4A 4BWMA 1OPZA 3CDBA 2MGZB 4WE1A 4EO8A 5F3TA 3KMQA 3RW7A 1NJYA 1X4FA 4O44A 2FVPA 5IM0B 2A18A 1MMDA 3I5CA 2Z8QA 3QJPA 4GO7X 4B17A 4IFVB 4NYOA 1GX5A 2IJFA 2POKA 2V8DA 3MAQA 1NJZA 2FJDB 5GADU 2BE2A 4I6AA 2V4RA 1VHFA 4NLQA 5CH7B 3AB4B 3M8PB 1HNIA 1WG5A 2BM0A 3DLGB 5DDOC 2RDJA 2ASJA 3M2UB 5GVQA 1HARA 1JXEA 2I0XA 1UA1A 4IQMA 3GMGA 2O67A 1S72S 3RYLA 2HVHA 1U8SA 2UUAF 3QJJA 3ZZ0A 2A2DA 4JI2F 1HI0P 4IRDA 1SH2A 5A6WA 2G0CA 1C0UA 2E66A 1WHVA 2MB0B 1F5CA 1HNXF 1NJXA 3PFOA 4Q44A 1YITS 2FVQA 3OLAA 2G13A 2WBMA 2CPEA 1SQEA 1EETA 3IN5A 3GG0A 3LF0A 2VD3A 2OPSA 3O3LA 4Y2MA 5T7LB 7FD1A 2KDOA 5KOWA 2DD8S 4IH6A 1KONA 2MZTA 3DOKA 3CCVS 4YQWA 4AL7A 1H2VZ 3EPIA 1CG2A 3MECB 4MK8A 3MPVA 3MM9A 5M2PA 1P8GA 1LWFA 1JNZB 3HHNB 2W9CA 2IM0A 2HS3A 4MTPA 2ZBIA 2HFOA 2VG6B 2GC8A 4I56A 3QLHB 4NCGA 1UVIA 2R8IA 5LSRA 4ID8A 1UJ5A 4PWDA 3T19A 3BDPA 3RBDA 4IUFA 5F8MA 2AWZA 4OX6A 4RUCA 3M8QB 4RKUC 5IT4A 1VC6A 4ZMMA 1L3VA 4YB6A 4F2RA 4QJVA 1UFLA 3IS9A 2BXJA 2FB0A 4ZHRB 3C6UA 1FXRA 5DQHA 3F41A 3EGZA 2KYZA 2VFVA 1NB7A 4ATNA 2MHEA 2MMYA 4WJBA 1MU2A 2R8KA 2FHJA 1HBOB 3PM9A 4BWJA 4I1TA 4A8YA 3MMAA 4X64F 4Z37A 4G1QA 4RU9A 3OL7A 2DK2A 6FDRA 1E6YB 3KHHA 3HKZD 4DR5F 2VOPA 1SV5A 2A10A 1DJ0A 4ECRA 3PVXA 1UKUA 4KB7A 2DPJA 1P1LA 1SIWB 2NREA 2EFQA 1H0HB 1S48A 1C1CA 4ELTA 4X4RA 1KQGB 1GTEA 3NCRA 1AXQA 2FHOB 2NLWA 3IAS9 4CO2A 4DR3F 1R8BA 3RRKA 2Y0SD 4USIA 5D3GA 1X7VA 1NU4A 2ACYA 4DFMA 1RTDA 1UVMA 4KV8B 4UW2A 3T6BA 1BQXA 4ECZA 1RWUA 4OJHA 3MUTP 4IDKA 1HNVA 3DRPA 1H2UX 4NLTA 2XG8A 4KRWA 2OD4A 5DGBA 3BSOA 2Z2MA 1TK5A 2V0NA 1S4FA 1UWBA 2B56A 3SSQA 4N56A 2E7WA 5HLFA 2JZ5A 4NMLA 1YG0A 1CPZA 2GMLA 2DR8A 2DH7A 5EGYA 1U25A 2WW8A 2IM2A 2R7QA 2GW8A 1HL6A 3HI9A 4DQSA 4IR1A 3OUYB 3VZIA 4Q2LA 3KLIB 3UQSA 4K0KF 5KFDA 2KKHA 3JSYA 3ONQA 4XAKA 4O3NA 1G3OA 1R3NA 4OHWA 3CIZA 3M2VB 1LFWA 2DIUA 2MKHA 4ALZA 3T9NA 1C2PA 4NLDA 3AQPA 4CCHA 3N6MA 3DYAA 1F5AA 4JBCA 3OVBA 5J2MA 4EO6A 2CPYA 4K59A 3CJ4A 1UAWA 3PXGa 5IZHA 4LFBF 3TANA 4X2BA 2NSCA 2GIQA 1D9FA 1DTQB 3FMWA 5D8HB 1FTRA 4KC5A 5JXSA 2QIFA 1FKPA 2LQ5A 1YHQS 5CZXA 4DL2A 2FVCA 2BQRA 4NOHA 4N47A 3TVYA 4G1PA 1ZM4A 2JOQA 3RAQA 4OQJA 2DGXA 2FGOA 1U2RA 1GXTA 5MLCV 2BRKA 3R5BA 2HWTA 1S6QB 2L48A 4OZ0A 1FRKA 5KFWA 1FK9B 3IGVA 5E7OB 2M3DA 2P9GA 2YWKA 4CNYA 2AGOA 1IBLF 1VQPS 1K0VA 4XK8C 3OV7A 1C0TB 1R8AA 3LALA 1N54B 1U6FA 2HHQA 2DRBA 1HBNB 3J7YU 2VH7A 3GWCA 4C8LA 1BWEA 1HBUB 4DBQA 1L5UA 1G1XA 1Y0HA 3NNAA 5HP1B 1TKTA 4NWBA 3RW6A 2BRLA 1LXJA 4PXEA 4PG7A 2C3OA 2RMLA 2XEXA 2KH9A 2MQPA 3U02A 1Y00A 4ECSA 1ZOTA 4DV1F 4IH7A 2VFSA 5LT5A 3MMCB 2J9DE 4QOTA 2IVFB 2UXBF 2DT9A 2ZD1B 2CVIA 1TUVA 4LSLA 4FXDA 4KT0C 2J0XA 2OO4A 2Q79A 3K7RA 4RNMA 4ECWA 3LP2B 1R31A 4G3IA 1S76D 4CQ1A 2RRBA 4AL6A 2RE1A 3PX0A 2DR9A 5CCMA 1DTTB 1IBMF 3MEEB 1X0FA 1U45A 2Q66A 4QPXA 3R5AA 5EWEA 3OFGA 3CDAA 4RLEA 3CD5A 3PX4A 5F9LA 1XR6A 1XWLA 2FHJD 1CSJA 3HHLA 3T5HA 1ZM3A 4B9VA 5B0FA 1M5PC 1Q7LB 1QE1B 4DLEA 1NHUA 4LUBA 5L39A 2EC0A 1WACA 4ZVHA 2Z4PA 2J6TA 2N3LA 2B9WA 3D0IE 4C8NA 3VAIA 2UUCF 3NCPA 1UW4A 4JV5F 4ZP9A 4LSNA 2L9WA 3W3SA 1FRIA 3V6JA 3I4HX 3KG4A 4RW8B 2PI5A 1FXLA 4BCAA 3I0RA 2KG0A 2LU1A 3S7RA 3M9OB 3DHWC 4M94A 4OLPA 3V81B 4U9RA 2BACA 4OI6A 2D74B 3M30B 4WK1A 3NAIA 2XGPA 3LWMA 4YB5A 3H4BA 3FZBA 1RT5B 1NKEA 2ROGA 4NLVA 4O3QA 2VODA 1Q4RA 4UY85 4J9RA 3DN9A 3IC1A 2GHWA 2FD2A 1U26A 5HMXA 3ITHB 1X4AA 4WFXA 3BO4A 1H7XA 3ISNC 5F0WA 3H98A 4ZCIA 1QSYA 1JLGB 4M8LA 4BDPA 2CPZA 3GFZA 3DDNA 4XDDA 3DMJB 1JJHA 2ZH3A 1IKYA 3EX7B 4I2PB 2DPIA 5D78A 3G96A 2VB6A 4EBEA 2VG5A 1EP4B 1FJCA 2WB1D 3UW1A 1GNKA 4WFNQ 2LXFA 4DV0F 2IFXA 3VQTA 5D77A 1D3WA 2QA4G 3NL0A 1YJVA 2DNKA 3T9ZA 3BN4A 4AXJA 2AJQA 1Q1KA 3OHBA 2V94A 3HVAA 1TK8A 4ZPAA 1Y9OA 2GQCA 2DNGA 5E0OA 4OI1A 1ZZNA 3K8WA 1K9MT 4PQUB 2AYGA 3IG1B 3PKYA 2R7XA 2KYXA 1JMTA 2P6TA 4H4MA 4RNFA 3V6HA 3CEDA 3W2VB 2MDAA 1QUPA 2MQNA 1KVIA 1Y5NB 3PRBA 2EG1A 1JLQB 2OPQB 1IKWB 1O8BA