1YG0A

Solution structure of apo-copp from helicobacter pylori
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
MKATFQVPSITCNHCVDKIEKFVGEIEGVSFIDVSVEKKSVVVEFDAPATQDLIKEALLDAGQEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords COP associated protein
publication title Solution structure of apo-CopP from Helicobacter pylori
rcsb
source organism Helicobacter pylori
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1yg0A00
2LQ9A 1FE4A 2KT2A 3CJKB 4OJ3A 1JK9B 1Y9OA 1TL4A 1YJVA 1KQKA 4A47A 1AFJA 1CC8A 3E8OA 4HH0A 5B0CA 4ZA1A 2OD4A 3BM7A 4F67A 2LXFA 2ROEA 3LGMA 4Q2MA 4FNIA 2GFFA 4FNHA 2VH7A 1AFIA 5T7LA 4HI1A 2CRLA 4OJGA 5B0AA 2HFNA 3HHLA 2PD1A 4EFAC 2ROGA 2LDIA 4Y2KA 2ZDPA 1APSA 3HFKA 1N5QA 2N4CA 4YEAA 1Y3JA 4HL9A 2XMTA 2RU9A 1WD6A 2GCFA 5B0GA 1LQ9A 3FRYA 3MCSA 1P8GA 1FD8A 2K1RA 1SQEA 3KG0A 4Y2MA 4DN9A 2XMVA 3LGNA 3I9ZA 1Q8LA 3HHLC 2EW9A 3TOQA 1TZ0A 1X7VA 3F44A 1S6UA 2HIQA 1AW0A 1YJTA 5B0EA 5T7LB 1Y3KA 3KKFA 3HHLB 1FESA 2ASYA 2FHMA 5B0BA 1W2IA 5F0UA 3DCAA 3T9NA 2K2PA 3BDEA 2OKQA 1GXTA 3KNGA 2BJDA 5A6WA 2HLUA 4HI2A 2AJ1A 2RMLA 1S6OA 4OIXA 2KT3A 5B08A 5KAKA 2W4PA 3KG1A 2XMJA 2AJ0A 2K1RB 1IUJA 1N5SA 1URRA 4A4JA 3BB5A 2XMMA 3BN7A 3WDOA 2IFXA 3FMBA 4YDXA 2OD6A 1SB6A 2ACYA 1MWYA 5B0DA 3LO3A 1KVIA 1YRXA 5A6PA 1QUPA 1X8DA 1FVQA 5IXUA 2GV1A 1TL5A 1OSDA 1VQYA 1ULRA 1OQ3A 3QGPA 2N7YA 1Q53A 1YJUA 3TRGA 1P6TA 1XBWA 2HFOA 1MWZA 3HHLD 2IYGA 2Q3PA 2QLXA 1Y0HA 1U7LA 2OAUA 4OJ1A 1TR0A 2XMUA 1V3ZA 3K7RA 1OPZA 2ROPA 2IYIA 2OFGX 2OP5A 3HF5A 3BF4A 1Q8BA 4DPOA 1FVSA 1N5TA 3VTIA 4NL5A 3BGUA 1OQ6A 2AW0A 2BJEA 2LQBA 2GA7A 4A46A 3QMQA 2JDJA 3TNVA 3DXSX 2QLWA 3MZIA 1N5VA 1RJJA 2K7KA 2KYZA 4NPOA 4A48A 5F0WA 2FB0A 4U9RA 2W4CA 3UDCA 2RSQA 4QOTA 4OJHA 3BR8A 2VV5A 1YG0A 2HQIA 3IWLA 2GGPA 2OFHX 2BBEA 4ZOSA 1K0VA 2QIFA 3CJKA 2BUNA 2XMKA 1VQSA 5B09A 5B0FA 2KKHA 1X0PA 2W4DA 1CPZA 1JWWA 3FGVA 2FIUA 3GZ7A 4Q2LA 2BYCA 3IWXA 1Q4RA 2G9OA 3HDSA 2K7JA 1GXUA 2OMOA 3HX9A 1YJRA 4Y2IA 2ZDOA 5K9FA 4DL0C 1KVJA 1FEEA 2GO8A 2XMWA 2HLTA 2QYCA 4HH1A 2FTRA 1FE0A 1SI9A 1TUVA 2N4DA 2AP6A 2PGCA 1CC7A 2RILA 1R6YA 2L3MA 2GGPB
chains in the Genus database with same CATH superfamily
1YBAA 1WHXA 1S1WA 2GMHA 1TFWA 1VOMA 5AE1A 5GAEU 1RWKB 4MKVA 1PILA 2GFFA 2EBEA 4RJVA 2VD3A 3CE8A 4M5KA 1ZTTA 3IO1A 3IC1A 1H7XA 2MHEA 1U1LA 3CJ4A 3CCTA 4ZK7M 1NJWA 2HWHA 3KTQA 3I9ZA 5A8KA 4Y0FA 1IN0A 2KN4A 1FTRA 2P2CB 3HHLB 3UVJB 5KG5A 4BHQA 3DLJA 2HHXA 1WKKA 4F2RA 4F0HA 1HFEL 2AGQA 4YS2A 2IRYA 5HAOA 2EC2A 3S7RA 1VQKS 3R8YA 3V6HA 3N4WA 4V19J 2Z0GA 3OSNA 1NH7A 4URGA 3HM9A 5ETMA 2IMWP 3C15A 5L1IA 2A0FB 1EQMA 4TLQA 1NKEA 1WKJA 4LRBA 1RLDA 1FWKA 4OV1A 3PW5A 2EFQA 5C25B 1BHNA 4C11A 3UCGA 1YLXA 3IWXA 2BANA 4I6YA 5GAEI 2W2OP 3HKZD 4K2JA 3HJVA 2N7CA 1Q0NA 2J7KA 4PAAA 2RS2A 4JI8J 1UVKA 3DYAB 2BA9A 3MECB 3OVAA 4X64J 4FYDA 3MEEA 1QTNB 4ALZA 2Y8YA 5KFIA 4AXIA 2BKOA 4KTQA 5K8OA 4FS2A 1VCTA 4WKRA 1NDCA 8RUCA 2HNYA 1BQMA 4YB6A 2FHMA 3D5MA 4NYZA 1TKTA 3T9NA 2W2MP 2OLWA 2BJ8A 1UEVA 3PJ9A 1HWLA 3M2VB 3IRXA 3THPA 1RKIA 5EX3A 3LW5C 3DXBA 1LW0B 1F6TA 4NLUA 2AD9A 3CSKA 1RT5A 4X62J 1YITS 3QIPA 2ZOFA 1NB2A 3GG1A 4P73A 4LVNP 3WHIA 2J6UA 1N5VA 1VBZA 5L9NA 2XLJA 1CJVB 5DRKA 3OPKA 3NBPB 3KMSA 1S97A 2MMYA 2WSCC 4Y2IA 2O5DA 5BYRA 4DR2J 2VOOA 4HH1A 3M6UA 3PHEA 3KUGA 5F9LA 2VFUA 1KQKA 3E8OA 3Q8PB 3G6VA 2ILZA 4B9LA 1PG5B 2C3YA 5C42A 2P9EA 2XC9A 5A0YA 5KFUA 3M1VB 2UP1A 2LA4A 3U7JA 4DV2F 4V19X 2GCFA 4A8OA 4L73A 4P74A 3EVMA 3V6JA 1PBUA 1NH8A 2WVBA 4FF4A 4DSKA 2HRTA 3QWPA 3DLBA 1M0SA 1Q7LB 2EC0A 2WAQD 1RWMB 3DRRA 4C98A 5HMXA 4USIA 4GC7A 1RT4B 3M2UA 4W90B 2DTJA 3AY0A 1GTHA 4IUFA 2CWKA 1Y10A 5K8NA 4J5OA 2HS0A 4NA3A 4JI6J 4LR9A 1SC1B 4ZLNA 4XK8C 4OQJA 2E7WA 4C11B 2ZBRA 4AL7A 1H74A 3TVKA 2YX1A 3FBCA 4OHVA 3A8EA 4YQWA 3SSRA 4OI0A 4KQZA 3PKYA 2JC0A 2YNIA 3FEYB 3Q0AA 2LXFA 2ACMA 2PO4A 5BR8F 2F4FA 3G6ES 2AEJA 4NYPA 1N0UA 3K5OA 4L72B 5D3GB 2E1MC 4TVAB 2XB2D 1TV6B 3LWLA 3T5JA 5LXYA 3L09A 4NCGA 4EBDA 1U2RA 2A6OA 2RF2A 4QPTA 1TK0A 2Z30B 2PE8A 1B7FA 4JI8F 2UXDJ 3GU0A 1VQ8S 3KUEA 1VQMS 2CG4A 3GE9A 3I82A 4DPOA 3ZZUA 4MFBB 2DR6A 3Q2TC 1N0VC 4DUZJ 3HD2A 1NDKA 4N77A 2KL8A 3PXGa 4KAIA 1WHYA 1W2BR 4PWDB 2FB0A 4U9RA 2WVCA 5KOXA 1YJ7A 4LSLB 4K0KF 1IBCB 1S59A 2ATCB 1FKOA 4QW8A 1OYEA 3HD1A 1T9WA 3TAMA 2KU7A 3BQ1A 3VGTA 5HSPA 4NWBA 4I7FA 3DOLB 1FXRA 2HSEB 3VGVA 4C0BA 1VJWA 5K5MA 1HW8A 3KK2B 3HVAA 1AUSL 1TQLA 3MR6A 4NLXA 2BR0A 3M6WA 4ES3A 5LXRA 4AQYF 2XHWA 3QYYA 3BDEA 3DLKB 2FJDB 2OEMA 3CMQA 1FA0A 2HGLA 1CJTA 2MB0B 4WE1A 3FQKA 1TL3A 3FJ2A 2OEJA 3AXMA 1H2VZ 1SKSA 3HVTB 3BBBA 4G6VB 2VQEF 1R31A 2RQMA 3VHQA 2CDRB 4QR0A 3FK4A 1UZHA 2C42A 2V2VA 3QMQA 1SUQA 1KLNA 4QU7A 4OHWA 4ZP6A 4PG7A 4ED6A 4PG8A 4I1TA 5HVFA 4DSFA 5F8LA 4OZ1A 1RAHB 2VIHA 4J9UE 5CQGA 1PSDA 4OZ3A 2IM3A 3GJSB 3NY0A 2LQJA 1WACA 4J9SA 2V4QA 3H4DA 1FKPA 4WU2A 2GJFA 1WKLA 2JJ4D 3GFHA 4DEZA 1SIWB 4BWJA 4KRWA 2B6AB 1RSCA 1U0HB 1FNOA 1YJTA 1PJ5A 4C8OA 3CCMS 4LVOP 1RYSA 4M1KA 1T0TV 5ETOA 1U1KA 4XIUA 1IR2A 5KFPA 3HI9A 1SKWA 2XSFA 1Q5VA 3D9BA 2CKWA 2HGNA 1V3ZA 3R6LB 3G82B 3Q8VA 5AE3A 5D4LA 5DM6Q 4M94A 2BJEA 4I4BA 3IG1B 1PAUB 1FFGB 2EKYA 4MT1A 2N3OA 5LSLA 2OPPA 3B6BA 9ATCB 5ETVA 3CD7A 4CCHA 4HACA 1H2UX 2JFDA 3NS5A 3BKTA 3EZUA 2OEKA 3PHTA 4LRFA 1F5CA 4MH8A 3NL0A 1Y00A 4HHHA 1RHKB 3LGMA 4Q0BA 3U1LA 3V81A 1JLEA 1MN9A 2UZAA 4PUOB 4S0MA 1XNQF 4ILLA 2B43A 2ZUGA 3LP0B 4N7TA 1HHTP 1VBKA 3FSXA 4W92B 4B3SJ 3MMAB 5LMUJ 3H20A 3D3CJ 4B9UA 1FX2A 1T3OA 4RBTA 5DDPC 3TZWA 3WX8A 2ZHAA 1NKBA 1S1VB 4X66J 2XBPA 2ADCA 1QAJA 3QGGA 4EYHB 2UUTA 4FF3A 1S49A 4ED3A 5IC6B 1TVRB 4KFBB 5F0WA 2PDAA 4ILRA 2UUBF 2RJZA 3MOZA 2HNZA 1F9HA 4ANCA 5LT5A 1S7IA 3PYDA 3K57A 4F4YA 4P10A 1UFWA 3G86A 3C16B 3QZ8A 3GWCA 1F9FA 3PO4A 4QWCA 2OIHA 4J7CA 5KG7A 1CJUB 1S9GA 4LSNA 3FQLA 3CPWR 2R7UA 1X4HA 2RKIB 4RW4B 2W25A 3O2IA 3F44A 1KVKA 3KHRA 5LSRA 1RT7B 1IBMJ 4OYBA 1P1TA 3GJQB 2XSJB 5EX0A 2VASA 4DR5J 5A8WA 3LUYA 4CLWA 4DPXA 3CDAA 4EK2A 2MQLA 2CNLB 4IH7A 1VBYA 3TUIC 3UW1A 3ZZPA 1YBTA 1V3RA 2G0IA 3W2VB 5GAGI 1UVNA 1OJ4A 3NS7B 1I6JA 2W4CA 4I56A 2HPUA 2WW4A 1U26A 1QJHA 4PR6A 1XWLA 1I94F 3NNCA 2K8GA 2KG0A 3GMGA 4IFVA 3ZZRA 1EB0A 5KFFA 4EO6A 3D28A 4EUVA 3VAGA 4LREA 1FEEA 2RRBA 3D0IE 4IKAA 2KG1A 4DR3J 2E1PA 2JEIA 3NGDA 2DIVA 2YNGA 4Q2MA 1RT6A 1VYAA 4RPFA 2RD5C 4YEAA 2DNLA 2PEHA 3JSRA 3CJ2A 4A8FA 2J6TA 2IBKA 1AW0A 4LSZB 5M2PA 4PZVA 1NK4A 3M8QA 4G65A 2NXUA 2DD8S 4H4OA 3I5BA 2FPHX 3BH6B 1T05B 1XJWB 2W2PP 2YKMA 3N6LA 3TUJC 1Q16B 4UTGA 3H5SA 1SQFA 4MKBA 4FXDA 3K8VA 4DCPB 3SIPB 3WIVA 2NXNA 1R6VA 2IAJB 2V94A 3MDFA 1RUSA 3H5YA 5J2NA 1P27B 1FK9A 2IBOA 4I6AA 2DR9A 1G1XA 4ETXA 3M05A 3KLVA 2VBXA 1OWXA 3PZPA 3LGHA 3ONQA 1HL6A 4KGVB 3D6MB 3CJKB 4X66F 4ECSA 2OTLS 4RX6A 2OD4A 1RE1B 1NK9A 4HI1A 1H2TZ 1SJ1A 4J90A 4C0HA 2QEXS 1S9EB 1RAIB 4DN9A 5HJXA 2HHHF 4MIBA 3BPDA 2PC6A 4GVBB 3MPUB 2GQ2A 1U25A 2Z8QA 5DDOC 1CQNA 2HNDB 2VFVA 5F8GA 4RW7A 5HBMA 2NSCA 5K20B 3SMZA 2PMWA 4CLUA 2GAGC 1RK8A 3TEGA 2E7XA 3M8ZA 2VG5A 2XYGB 3C6TA 1RA7A 3MPDA 2B4OA 2M8HA 1RTHA 1WC1A 3IGVA 1CS4B 2EXUA 1RTDB 1CEZA 4ZJLA 2QN6B 3NOCA 1RYRA 1IBMF 1X0PA 3RBXA 2CG8A 5L1JA 1B70B 2M9KA 4DR1J 3SCKE 2ZKUA 1HBOB 4DR5F 3MR3A 1KHWA 3MFIA 3UNGC 2YNGB 1FF2A 3IMQJ 5EUHA 5HP1B 5B0CA 5KFQA 4WWSA 3SDEB 3N6NA 2FVCA 1AXQA 4WYLA 1LW2B 3LGNA 1HIYA 3IR5B 4I2PB 4HHJA 4ZIVA 3SZ2A 3FFIB 2CQPA 1HBNA 5L39A 2XWXA 1HNWJ 1FWLA 2E1AA 3T5HA 1V3SA 2B0GA 4ZPDA 2HK2A 1HWKA 2HMIA 2YNHA 1LWEA 3QO9A 1T9VA 5M2UA 1E6YA 1NDLA 4NPOA 3TA0A 1IQZA 2QLJB 3DLGA 5DO2A 2CQ2A 4FVCA 2CJKA 1JLGB 2AMCB 3C14B 4ID8A 3H5UA 2IIHA 4RU2A 3PRVA 1IKVA 1DAXA 4JUZA 3DNCA 4NE9C 4O0IA 2DNGA 4Y2KA 4KGKA 5FIIA 1NZAA 2MXYA 4DR7J 3ZTQA 1QE1B 4JBCA 1HWJA 4R25A 5EGYA 2PI5A 2DT9A 3NCRA 5HBMB 1UFKA 2NCKL 4FXWA 1HR0J 4K50A 3TYTA 2GMJA 2G1DA 4DUTA 2AQ4A 2OGUA 2MKYA 3L7PA 1X4GA 2JC1A 2YWFA 4NLSA 4ZVHA 3OTCA 1XBWA 4PXCA 1FO1A 4D3HA 1IKWA 3QLHA 4OJ1A 5KG1A 1QD1A 3OHAA 4ZVGA 4C2MA 1AT1B 3EVOA 1VQPS 4MKAA 1U6BA 1L3UA 1QSSA 3D0GE 1JJ4A 1U49A 3OQ2A 1C2PA 3GV8B 3OJUA 2V9WA 4RUBA 4NXMF 3VV2B 3EXYA 4EU0A 1HBUA 1K0TA 4PYAA 4BLGA 1FRXA 3FRYA 1ZTWA 1OIAA 2YKQA 3BGFA 3MPWA 2ZH9A 2RVJA 5EDWA 1H38A 1QVFR 2LXUA 5A6WA 4B9TA 4DJBA 1REVB 3TVZA 3R7SB 4URSA 2K1RB 4DR1F 1QDUB 2DGOA 5C24A 4OYIA 2CQ0A 1YRXA 4DPTA 5IFMA 1F2HA 4TU8A 1SKRA 1U6ZA 1N5TA 2BX6A 3QRPA 1IKXA 4OMFG 1VFJA 4CDIA 2R8GA 1LWCB 3HT0A 4P52A 4P72A 1FXDA 2E5JA 3M6XA 4WKYA 2AT1B 2JFKA 4U96A 3MM8B 1RWNB 3I9V9 2DISA 3LQVA 4B9MA 3DRSA 2BYCA 2RE1A 4U67Q 2BKNA 1RHUB 3J81U 1E6VB 4ZHRA 1NEEA 4HT5A 1RAEB 1HNWF 5HMYA 2BJ9A 3MURP 3BH7B 4F67A 1JXLA 3D1HA 2LEAA 3DKDA 1S72S 4P2SA 1RACB 2B9WA 3ENVA 4RW9B 5EWEA 2GJ2A 1QUVA 1U8WA 2G1HA 4DZ6A 3AB4B 3FSYA 2ILYA 1RXOB 5J1PA 5T7LB 4Q44A 4NOHA 2HHVA 3R1HA 1UZDA 3EICA 2CPJA 3MEGB 5KG3A 1VQYA 1HI1A 2PMHA 4O44A 5KT6A 1GXLA 3PTWA 3P5BP 2JLGA 3P96A 2GQQA 3OVSA 2DXEA 2NXJA 4DR7F 2V8DA 4N8NA 4Q45A 4ZKAA 3QT8A 3GJTB 4F50A 3KHLA 4OL8A 2CIMA 4B9VA 5KFDA 5EWGA 2RB7A 1YG0A 2IPOB 1MROB 2POKA 5KG2A 4OI1A 1HR0F 3U02A 4M5DA 1WSVA 5K14A 1CBKA 4N76A 4WP3A 5E3QA 3HT3A 1SJ3P 5IT0A 3C6UB 3VCDA 4NMLA 1MMDA 2WBMA 3KLIA 3O1LA 3TANA 4ILMA 1NU4A 3AA9A 4ECRA 2CNNB 4YB5A 3DU6A 3RW6A 2XY6A 3CULA 2R7OA 2YX7A 3OTOJ 3GFZA 3M8PB 2VODA 1LXNA 3UO0A 1VQ7S 4H4MA 3LP2B 2RRNA 4OI3A 5KAKA 1RLCL 3BQ2A 1VQ6S 1S0VA 2V8HA 2V68A 1C1BA 1HNZJ 5U47A 1YJUA 3CC2S 2MKCA 5HROB 1IBLF 1FXLA 2RQCA 3MF5A 3VR1A 3HF5A 2YWHA 1I5OB 2AW0A 2R3VA 4WP9A 3D67A 3ETMA 2CPIA 4OJHA 3K5LA 4DV5J 1QAIA 2WONB 4M5MA 4ELTA 2W01A 3BKUA 2VPZB 3CVKA 1XEZA 4X4UA 3SBMA 2FY1A 3TARA 4OZ0A 1H98A 2MQNA 2G0CA 3M7VA 5CYQA 5ETNA 1VRQC 4A8YA 4UY85 3POTA 1D9AA 4B9SA 4DL6A 4LF2A 4BC9A 3DOKB 2MQPA 2JRSA 2E5IA 3IR7B 3TQ1A 5B0EA 4JI7J 4DPWA 2IM2A 3MMCA 3UQSA 1QY7A 4J9KA 2QO3A 3C3LA 1ITPA 4WCEQ 1A7GE 3PCOB 3U1MA 1HD1A 2GVZB 5HL7Q 2JL9A 3GIRA 1HD0A 4TU7A 1DLOB 2YBVA 2V5HG 1MNEA 1M5VC 4NL5A 3MAQA 1RAFB 4PG5A 4K7QA 5KFSA 2HVHA 2EK6A 3I96A 1B3TA 3T1YF 1FDDA 3G8TA 3J7Z5 4Q2LA 3Q89A 2KHDA 1SBRA 1TL7A 2OHDA 3OFFA 3IWNC 5ETLA 1T11A 4ICLA 2CAJA 3HJFA 2R7XA 2C1EB 4R0EA 3W61A 3N0VA 2G0JA 2MTLA 2CJBA 3AQPA 4H4MB 4J37A 4PG4A 1EHWA 4K4ZA 3MTJA 4XDDA 5KFRA 2DNHA 5ETSA 1R8PA 2KT3A 1C1BB 3CJRA 1D9DA 1PKUA 1X4DA 2IDEA 5EHHA 4A8MP 4FPRA 1YK9A 2E7VA 5FDLA 1SJQA 1M5KC 4HDHA 2X1AA 5GMKa 1VLOA 1NHUA 3BF4A 2QSFA 4NA2A 2EI5A 2AX1A 1XR5A 2RSQA 3OTOF 5CZXA 4O3RA 1WNEA 2ZH7A 2KFYA 3P4UB 2DGWA 1PYTA 4RW6B 4DBQA 5D0HA 5IWAJ 1M5SA 2YKPA 4ZVOB 1CC7A 1UAWA 1HNZF 4B3MJ 4UOHA 2P6TA 3DHXA 3ET6A 2RAQA 2XHCA 2ROGA 1APSA 1U1MA 3KDOA 4USMA 3RZAA 1WD6A 1C0UB 4CQ1A 3KG0A 3DGPB 2YPYA 2CPDA 3C8YA 1XNRJ 3T19A 4DL2A 1ZYQA 1KRPA 3KNGA 3A8JA 3M8RA 2W2NP 1S1UA 5A2QY 4DV0J 3MCOA 4AFFA 2BM0A 1VR6A 1DTTB 3BREA 3R6GB 3BQ0A 2EFPA 3A8IA 3OUYA 1ZM2A 4ITSA 2QJ3A 4K2XA 3NGTA 2LYVA 3LP1B 3MAAA 1ZA2B 1NJYA 3AOAA 1TR0A 2QX0A 4Y2AA 4Y65A 1ZS6A 1FVSA 3T41A 3BO2A 1Z4UA 3JSMA 4YN3B 1DARA 2KYZA 1ZM9A 5H9FK 3PFOA 1RT2B 2DGQA 4JI7F 3HSGA 1HQUB 1R27B 2B9XA 5E3RA 5JXSA 4EBEA 1H72C 3RAXA 1SI9A 2ZJRQ 3CGIA 3UDVA 3TZZA 4NLDA 4PEOA 1VQ9S 1HQEB 2B4PA 1T3NA 2HHWA 2X7IA 7FDRA 2NREA 1YKWA 2VBZA 5L8RC 4IDKB 2VPWB 3F56A 4EFAC 1O0PA 1FHTA 1IR1A 2BE7D 4OYMA 4J9OA 4QIWD 3BYPA 2MEWA 4YHHJ 1XK8A 3KJQB 2DNYA 4HYKA 2ZBPA 4JI0J 1F3FA 2HVEA 3CUNA 4RNHA 1EZZB 3BBFA 3R5GA 4IR1A 5FDLB 1JQGA 4R8UA 5FLXU 5I3UA 4JYAJ 1IVZA 4E98A 4KGXB 4I67A 2CQ4A 4I64A 1F5BA 1OQ6A 3RBZA 5IS2A 2DPJA 3H98A 2W1BA 4ED4A 3N28A 2IVFB 2V4JA 4JV1A 2M3DA 2OPRB 2VG7A 3I0SB 4C6AA 4H54A 4DWIA 2W9CB 2W2QP 1C1CA 1U45A 1N34J 3TAQA 2AJ2A 3U1NA 4CM0A 1JLBA 2CPZA 4WZQA 5LSOA 3FSIA 3UFCX 2XS7A 3VALA 4JV5J 3D68A 3AJ2A 3J7YU 2KFNA 5HJYA 1L3VA 4I0WA 4Y6IA 1R8AA 3EGNA 2V9KA 4K4UA 2WHOA 4YY3F 3OXFA 1S1UB 1GXTA 4OFZA 2KFZA 2B8PA 1L3SA 5IWAF 8ATCB 3CCLS 1NDPA 4DDFA 3FVYA 4KHMA 2WB4A 5A6PA 3NNAA 2WVFA 3TO8A 2FY8A 2LVWA 4B08A 4ZCLA 3W2WB 3CO9A 2C2DA 5J2MA 3GIIA 1WI6A 1PYOB 4MIWA 4ELUA 2WZ1A 2J8SA 2KZZA 2HQDA 1XNRF 1JKHA 1R8CA 1KFSA 1XQIA 3R2DJ 1JLFA 1I51B 4EYIB 1ELOA 2D3OR 1FRLA 1SH3A 5HLFA 1HYSB 3J7YI 2AWZA 1VHIA 2BJ1A 5SUHA 1KS2A 2C2EA 3GIMA 1YHQS 2BACA 5D15A 1RT1B 2LCWA 1OPIA 2OKQA 1FRKA 4ELVA 1S0NA 2QMXA 2XMMA 4P71A 5I3UB 1H3DA 1NSPA 1WC4A 3X1LB 1B0TA 1S7HA 5MAOA 2KM8C 4GMKA 5AXMA 3OFGA 2IM0A 2Q1LA 3SV4A 4Y3CA 2F65A 4E8UA 5GAHU 3KHGA 5IOLA 4DF8A 3L7UA 4USJC 3QRQA 3BSNA 3DMJB 3MEDA 3HCXA 4HTJA 3B4DA 1RAAB 2DHAA 1U1PA 4JI0F 4CP5A 1VQSA 5B7WA 3PYEA 3M2RA 2V34A 1UWAA 4LF6J 2B4VA 1VJQA 3ILIA 2QYCA 4USKA 2FTRA 2R2SA 3VVTA 3K5NA 2M0GB 1VRTA 5IT4A 4IH5A 4F3OA 3QAUA 4USWA 2DNPA 3SSSA 3CCJS 2XGPA 4WFAQ 2DHXA 1Q8LA 2CQDA 4XTTA 3MGJA 3P49B 3JTOA 5LJ3Y 2C2KB 3K2YA 2ZC3A 4ANDA 1S6PB 3D0HE 3CMAS 2W9BA 1GFWB 1MMNA 2YWEA 1RHQB 3EUNA 4JI1J 2E5LJ 2N7YA 2RDIA 3DDIA 2NQPA 5GAHI 4O3PA 1U1OA 4JV5F 3GCXP 3G87A 3SSQA 2GIQA 3TNVA 1JKHB 1SH0A 2JVOA 3MZIA 5CCLA 2B5JB 2GVDA 2IA0A 1K47A 2AIRB 1K0VA 3DM2A 1CJKA 1RWWB 3FBBA 3HX9A 4NLOA 2XMWA 4P6QA 5H9EK 3EDQB 2CXEA 4OJ3A 2PMZD 3GONA 3EZ5A 2IJNA 4WFZA 4KGMA 3D54A 4LFCF 3FBEA 2CRLA 3BZQA 2YWWA 2MZ1A 3UR0A 2RH3A 3MEKA 4O3QA 4CYUA 4WXOA 2V50A 1G6BA 1XIQA 4USVA 3QAEA 1RTJA 2FZCB 1NSQA 3KJVA 2HLUA 3RB4A 2AU0A 2XLIA 1WG4A 3CCQS 3H59A 2FHJA 1HNVB 5HVGA 1YJ9S 4U7UK 5E7OB 1TK5A 1VQNS 1RADB 2DNQA 1S6QB 1JJ2R 3QT5A 2DGXA 1OPZA 2NUHA 2MGZA 4C8LA 2IHR1 4IQMA 1MU2A 3UCZP 4DHVA 1HHQA 5IQQA 2Z2LA 2UVRA 3UCUP 4WXWA 4QOTA 2GMLA 4X4OA 4RU9A 1N6QB 2X3GA 1U09A 3GYNA 3MMBB 3TI0A 2FHOB 5CYMB 1C4CA 2ERRA 5GMEA 1MWQA 1UA1A 3W9IA 1RBAA 3AAWB 4IRCA 1JNRB 1Z2LA 2OPSB 3EPGA 4A47A 1TK8A 1FFWB 2WOMA 1C0TA 2VH7A 1AFIA 1RZMA 5L46A 2V69A 2HIYA 3Q8UA 4YR0A 2C22A 1V9OA 1FFSB 1MMLA 4ECTA 4DV3F 4RBUA 3IA0A 4MMOA 4DV4F 1U0SA 1S4FA 2OJ3A 1WHVA 4UUWA 5HMZA 2YQ0A 3OHBA 4CLYA 4UZCA 3TRGA 1P6TA 2CUYA 4TY9A 1Q8IA 4L74A 3FC9A 2KHCA 3FCWA 4ZVUB 2KJVA 5J2PB 4E0DA 3R97A 4Z7YA 5G0RA 4CI0B 4WIQA 3QJLA 3BR8A 1GAOA 2ZH5A 3A13A 3NGRA 3HZGA 4OYAA 4W98A 1GXUA 2XYPB 3IS9A 3TR5A 3PEJA 3LANA 5KT2A 4O23A 4JI1F 4CZCA 4Q7AA 2E5LF 2RIJA 2DH7A 5IZHA 4UUXA 3GB0A 3BEGB 3PRBA 4CO5A 4CH0S 1WORA 4A8KA 2JLEA 1N33J 2HFUA 3ENAA 1X9SA 4LQ9A 1FX4A 3ISZA 2K06A 2V63A 3CXCR 3BN7A 4LF7J 4ZN1A 1B64A 1P9QC 5E3AA 3NWGA 2M88A 1EP4A 2MQMA 4AL5A 1TL1A 1SH2A 1NXIA 4ZVQB 2VKZG 4ZVFA 2C2MB 3DDKA 1NK0A 4DV6J 3GR1A 4FDFA 2QL9B 4CIOA 1BC6A 4ECYA 2NXEA 4ED0A 2UXBF 1TTHB 2NLWA 4P2XA 2HK3A 1A6LA 2O3DA 4WTOB 3QSYB 3AH6A 4NYOA 5RUBA 2DRAA 3H4BA 4A8WA 1Q86T 1WC0A 3T1HJ 3O5TB 3OBIA 3HHLA 3UVJA 2VKRA 3R2CJ 1IM6A 4G1PA 4OZ2A 3Q8RB 2XMTA 5DLGA 1S1XA 3TZYA 4GKKJ 4NLVA 1HWUA 4HHUA 3RRHA 1XR7A 4YB1P 3RR7A 4O4GA 3KUHA 3HSZA 1KSPA 4K4SA 2DR8A 2HG4A 2WCXA 3H42A 5KT7A 4OZLA 2NXCA 2MQ8A 4DS5A 5KG4A 4X4SA 3KLGB 3VAHA 2RQ4A 2GAHC 1S1TA 2RQKA 2LMIA 1HKAA 1JLQB 4PXDA 1UWBB 3I0RB 2AHOB 3W9JA 1JMTA 3I55S 5C25A 3AD7C 4XPCA 4G1IA 4WFNQ 1S5ZA 3MECA 2UVUA 4M8LA 4QR2A 2F40A 1LNQA 3ZZOA 2LEPA 4OX9F 4OYPA 3EXCX 2RNEA 3QPIA 2G4BA 1NSKL 1SPBP 5K8MA 3HHNB 2EKNA 1D3WA 2CADA 1QTMA 4PQUB 2Z2ZA 4H4KA 5B0AA 3IGNA 3F0NA 3EYZA 2QT7A 3CIMA 2PI4A 1YX2A 2QV6A 2DRBA 3M2VA 2B7BB 2ZOMA 3PEHA 2K2PA 1LW0A 1LWXA 2FJEB 3GFXA 3HO1A 4QIEA 2PSZA 4IO1A 3BJYA 1U2FA 3HFZB 2FDNA 5DQIA 1PAEX 4ES2A 1CJVA 1U7LA 3NBPA 5T41A 1ZOTA 5AJ3J 1UTAA 2GA7A 3CJ5A 1D8YA 1TKZB 4CWBA 2VPXB 3MI7X 2F4VJ 1O6XA 1YZ6A 4DL3A 2GIRA 3T9ZA 2G9OA 1ICEB 4NCAA 3M1VA 3ZFVA 2EK1A 4EI2A 2GGPB 4O3OA 2V8GA 1UPPA 3AODA 4F4KA 3GP9A 1S1XB 1UCNA 1ZM3A 4OLOA 1G7CB 3SEOA 4O4GB 4Y2MA 4DV6F 4AD6A 1RT4A 2Y8WA 2B51A 1TZ0A 1S6UA 4E2FB 3BKFA 1ZAXA 4ED2A 2DHSA 1FJ7A 3TX0A 4KSEB 3GCWP 3T6JA 2ZM6J 3HMJG 3CD6S 2IVYA 1N5SA 5J1NA 1S1TB 1S48A 1UJ5A 1WEYA 4HTIA 1U47A 2HFOA 2YNFB 3T1HF 2LU1A 1XMQJ 2MKJA 4MK7A 2DIUA 1DQ8A 4V1Ak 2UVWA 3UR3C 2IYIA 1T94A 2GC8A 5J2QB 3LOUA 2I1RA 3MCNA 4DCOB 2FJXA 2VICA 1NPKA 1RJJA 2A1BA 5KFCA 2I8EA 4N41A 2MJNA 3QRRA 4P75A 3QFHA 3CD0A 2BE2B 2JSXA 3SFUA 2F9DA 5D3GA 1MG7A 5CD4H 3SQGB 2X51A 1TV6A 4CO3A 4C3KA 2QLFB 4LF8J 4DQQA 3HFKA 1XTZA 5E3PA 1WDTA 1U8SA 4CLFA 3V4IB 3AJ1A 3ILOA 4ZCIA 3H2VE 2MZQA 1Y3KA 2QYGA 2PFDA 2V0NA 3Q8QB 2QLBB 3I87A 2FLLA 5E41A 2ZE2B 3IR6B 4MFBA 3VAMA 1OQ3A 4UW2A 4MIAA 4ZJQA 4PWDA 2VPYB 1KDNA 2XO7A 1T8EA 2WVEA 1HI0P 3PO5A 1Q8BA 4LSLA 4WBFA 1JXEA 1IBKF 3D2WA 4EZ6A 2VDIA 2VG6B 1WC5A 2FVPA 1IJFB 1HQ2A 3GV7B 2ZZMA 5KFTA 2QL5B 1IWAA 1CQMA 2K7JA 1DTQB 1KLMB 3R9LA 1VS3A 3DOLA 1D09B 3DLEB 2C3MA 1R43A 3KK2A 3IP0A 2OSQA 4OJGA 5DG9A 3TA2A 2NZCA 2BE9B 1RP5A 3QT7A 4LF4F 3DLKA 1U1RA 3DRYA 1N8RT 1GEHA 4Z2XA 3CCWA 1J27A 2J6SA 3MCMA 3HVTA 2W4PA 1K73T 5D4OA 1FI4A 1NHVA 1SB6A 2ACYA 2EFOA 1FVQA 2W7OA 2VB6A 4KHPJ 1T9UA 3V5RA 2ZH8A 4ZPWR 4A46A 1KC8T 4OI4A 4MTPA 2CPEA 4PG6A 1DRZA 2ZHOA 3G6YA 3UDLA 2W7PA 5AE2A 2Y9HA 3M8WA 3NGUA 1NAQA 4F0MA 2PIIA 1IKYB 1KBRA 2W7AA 3Q24A 4DR6J 4Q8FA 3ZTSA 2B6AA 4DLEA 1U0HA 2UVVA 4GVLA 2VHGA 2CNOB 2N4CA 2YH0A 1KOOA 1WDDA 4RBVA 3NAIA 2W24A 3H8YA 2BVZA 4IR9A 4RWXA 1XMBA 2MKIA 4X64F 4NMXA 2HVDA 2ZWPA 2DBBA 7AT1B 1RTIA 4RNOA 2XCPA 5D0RA 5FD1A 3G82A 2OD6A 1UA0A 2WTFA 4YP3A 1S9FA 2HW3A 3IG1A 2P8IA 1QVGR 4NXNJ 4EZ9A 3CWJA 4HEA9 5HQLA 3QNWB 2XS5A 1IM4A 4LF8F 4QPXA 1MW7A 4NLTA 4WP8A 4IFYB 3MUTP 1RCOB 3LALA 1VC6A 1XR6A 4GC6A 3J7A1 5DQGA 4X62F 3US5A 4KO0A 2QA1A 4PUOA 4YB7A 3LP0A 1M5HA 3JQJA 4ZMMA 1WC3A 4FZVA 4P7TA 2H5EA 3JAMU 5DETA 2KXNB 1RB0A 3TX8A 3W9HA 2XI3A 4OHZA 4K4XA 4DR2F 3MMAA 4LRDA 3M32B 4DX7A 2AJFE 2XMVA 4JI4J 3ZZYA 2M52A 2WBRA 5I3QA 3J81Y 1Q8KA 4OLPA 1FRJA 2C2NA 1S1VA 4U7UD 4ZS6A 2CVIA 4KKOB 1BQNB 3JTNA 2A6MA 1KVIA 3HHKA 2I5JB 3JYTB 4P9SA 1TVRA 4KFBA 2AGOA 1TP7A 4ED5A 2D9PA 2QA4S 3CJQA 2ROPA 3GSIA 3M8SA 3DI6B 2GX8A 4CLTA 1FD2A 3OTEA 3C16A 3P8BB 4ZCMA 4JI6F 2XGQA 1CJUA 1UMJA 5CABA 2BQUA 2RKIA 3KLFB 1UVIA 4RW4A 5ETTA 3FZ2A 4PCQA 1M5OC 3D66A 2CZ4A 1RT7A 4KHPF 2XSJA 3CJ3A 2J7UA 2EW9A 3ZTPA 4RUCA 1WWHA 1RTIB 1RWXB 3LPEA 4HI2A 2QRRA 4TU9A 2L41A 2LP4A 1D9FA 1T02A 2EPIA 3D6TB 3W2VA 5I42B 5ADZA 1VISA 3RAMA 4XPEA 3KK1B 1X5PA 4JI2J 2BJ3A 4KIAA 1N88A 4RZRA 2UXDF 3DRXA 2RUGA 3TUZC 1B7YB 4CM2A 1WEZA 1WTFA 1A9NB 5KG6A 3MM5B 3ITHA 2EBGA 4KO0B 5DJBA 2W4DA 2OMOA 4DUZF 2H4WB 3IM9A 1K1QA 3DFEA 1XN9A 3MM9B 4U95A 2DEIA 3W1YC 2V8PA 5KFYA 3M30B 3RRKA 4FNHA 1EIYB 4DF4A 4USHA 3PW7A 2YQ1A 2KH9A 2NUUG 1T05A 1TUGB 1FNMA 2RUSA 1EETB 1FESA 3UN3A 4FVMA 1FDBA 1J2VA 4NLGA 2HBRB 1X60A 4RUAA 2HS4A 1B99A 1P9YA 3WQPA 5DZ7A 4WK3A 4KB7A 5J1EB 2IAJA 2ZH2A 2X1GA 4GO7X 2WSFC 3AD9C 5GAGU 3VVUA 4TLRA 1FRIA 2LDYA 4TYBA 3TW0A 2U2FA 1PC4A 1S79A 4AE5A 4WJBA 1X4CA 1DQ9A 4YOEA 2KVIA 3KLHA 3Q22A 1M5PC 2VC1A 2QIFA 3CJKA 1VIOA 3TWZA 3UD5A 1BD6A 2APOA 4FPIA 1LOUA 3CIZA 2A2DA 3EPIA 3KLEA 2K3KA 2CZ9A 1WOOA 3MM6B 4CRJA 2HYIB 2KTQA 4OHYA 3FCVA 1S9EA 1JLCB 2HHPA 4QU6A 2UV8A 2DKOB 3N79A 2XG8A 3FUYA 3BGRB 3G71S 4FP9A 2DXDA 4GVBA 1U1QA 2HNDA 5HVHA 4QWEA 3P6YC 2MQQA 2AGPA 5IV3A 1YJWS 1IWGA 4LFBJ 3OR1B 1RABB 2R7RA 4KE5A 2YKOA 1X5TA 2DYAA 2MKHA 3MFHA 1CS4A 3AB2B 2AJ4A 3KK3B 1RTDA 2QLXA 1Y0HA 3I5CA 4F25A 4OYOA 2J0WA 3TA1A 1X4BA 3W5ZA 3LAKA 3N5FA 2DO4A 1HPZB 2A3JA 4TNOA 4ZVSB 2FZGB 4XAKA 3ITHB 1HBOA 3HSDA 2C3PA 2L9DA 2QGFB 2VC0A 3NGKA 5HP1A 4DSEA 1GNKA 5HN0A 4NI2B 3SDEA 2XULA 4CTAB 1R6YA 4DFKA 1OO0B 3OR2B 4EMDA 3DHWC 1LW2A 2BW2A 1YJVA 4IG0A 2HHSA 4RWWA 4I2PA 4X4PA 1FJCA 3N9UC 1N5QA 1FJEB 2D7SA 3VWSA 4NCBA 3FFIA 1SQEA 2WK4A 3PIOQ 2HIQA 5F41A 1U6FA 4OYWA 1RAOA 4QJVA 4OI6A 5IXUA 2QFIA 2RU3A 2ZITA 4B3SF 1BXNA 5LMUF 1SVDA 2UUCJ 3LAMA 1HI8A 1RBLA 2N82B 3KLHB 2LQBA 1JLGA 3W62A 5HO4A 3C14A 3N5BA 2D1CA 3X3UA 5LL6d 5KFAA 3DLHA 3W5XA 3KLEB 2CPHA 2W8KA 3S6EA 4N47A 5DGBA 4M5NA 3FBFA 3R5BA 2IC3A 4ZIWA 2MZSA 1AYEA 3PKMA 2ZNZA 1SV5A 1PJ7A 1BUXA 1QE1A 3B82A 4IRDA 3L3CA 2LDIA 4B3OB 2MJUA 2HURA 2O66A 2YKNB 4QYZJ 2RU9A 4NASA 3PDNA 1WG5A 3KYLA 1LXJA 2HRUA 1T03B 1FD8A 3Q8YA 3D1QA 2CVEA 1CVJA 3M8YA 2HEKA 3UN5A 2QL7B 1VQ4S 3Q8SB 2VONA 3S01A 1NJZA 1JLAB 3OSPA 1SCJB 3LWMA 2KI2A 3DRPB 3FDSA 1SJRA 1R0AB 3BR9A 4ID5B 4X4VA 1BQXA 2VDHA 2I2YA 5KFGA 3D6HB 2NPFA 5EN1A 4F8RA 4LF1A 3IN5A 1DZ5A 1LK7A 3VF0B 1Q81T 4MAKA 1DJ0A 5FLXY 4DI6A 1FKAF 4LFBF 1Q4RA 2CQBA 2PFFB 3MAHA 1KQSR 4NLRA 4IG0B 3K5MA 2LQ9A 3MOJB 2GIFA 4DX5A 1Q79A 5DS7A 4ZCKA 2VQFJ 2J76E 2RDJA 1REGX 5CA5A 1WOSA 3KFWX 2Q79A 1REVA 3K89A 3GIKA 1BY9A 2K1RA 4NLPA 3MR2A 3JTPA 2FHKA 4M5GA 4DR3F 4EBCA 5F8JA 4L76A 2IFXA 3M9MB 2I6WA 1OY9A 3RUBL 3PW4A 3GJRB 4H4KC 1NPPA 3GYGA 4R5PB 2EFNA 1LWCA 1KHVA 2ZH1A 4DLGA 3EJMA 4GRSA 1Z2ZA 3MM8A 4CT9A 1S77D 2AZ3A 4YDDB 3CNQP 3VTIA 2LEBA 3NMAA 3UWTA 3IAM9 2HVZA 3I6PA 1WTBA 4I68A 1Y4ZB 1E6VA 2CQHA 3CDWA 3DGVA 3K5PA 4YFUA 1OY8A 3G9CA 1EJ7L 2LLZA 4Z37A 5BR8J 1L3KA 2IC3B 3VZIA 4C3MA 2H5JB 4RW9A 1SV5B 2M4MA 3C66A 2HQFA 2J8AA 3L9ZA 2NR0A 4K4TA 2J9DE 3FKBA 5T7LA 3OJSA 2ZVIA 4ECXA 3TEHB 2UUCF 2HQ3A 4F3QA 4DZDA 1NM2A 1H7WA 2CQ3A 3MEGA 5F8HA 3IRWP 5A8RA 2DEJA 1X4FA 2HHQA 4DU7A 1JJHA 2MZRA 1ZPVA 5GVQA 2QZ8A 1NO8A 5D8HB 1HBMB 5K8PA 3C19A 3C46A 4F4ZA 4K0KJ 3WIUA 1MROA 2DGVA 4XDCA 4DSJA 1EKRA 1SC4B 2M7SA 3OTDA 2QLWA 3J80U 4J9LA 4C3LA 1J5OB 2R2TA 3AT1B 2GJIA 4B02A 4OZ5A 3C6UA 3RTVA 1R0BG 2OPQB 2QMWA 2XZDB 5ETKA 1D1UA 3CJ8A 2GHVC 2BABA 5KOWA 3CCUS 2XNQA 2JHEA 3EGVA 1KKHA 1N5YB 3LTOA 2F8HA 4FNIA 3M8PA 4AQYJ 4ZVPB 4RNNA 4O4RA 1VK8A 3FEXB 1X5OA 5KTQA 4OX6A 3LP2A 3V6KA 3VQTA 2XS2A 2NPIA 1S1WB 2IM1A 4N56A 1T7PA 2BW7A 3D3BJ 1FTCA 1KP6A 4CNYA 2VQEJ 1KD1T 3PW0A 3ENQA 4ECUA 4C7QA 3TJ8A 5HROA 1S76D 1VLYA 5A8KB 2DGSA 5E0OA 2C3UA 3OFEA 4ECZA 2DJWA 3ELHA 1RWOB 3G8SA 1NJXA 1TU0B 2AYBA 4DL4A 2VQFF 1BLUA 2LA6A 5H9EJ 1Y7PA 1Y5NB 2HVIA 3BGUA 2WONA 3OV7A 4Z7CA 1GMVA 3RW7A 4WFBQ 3OT9A 3H2LA 1SIZA 2X3DA 3OFHA 1ZA1B 2FUG9 4PRFA 2BUNA 4FKXA 5B0FA 3PW2A 1LKZA 3FCHA 1NUEA 2E5GA 3I56S 4K4VA 3C15B 2VA3A 3DOKA 5T14A 4J9MA 2N3LA 4LIWA 1GX5A 2BANB 2O67A 1VHFA 3NOGA 2Y1LB 3G96A 4Y28C 3G8QA 1O5JA 4FXVA 9RUBA 5A8RB 3MEEB 2M8DB 3TQEA 5B0BA 2GVZA 3J81j 3QFWA 1WF1A 2MKSA 3DC2A 1NBEB 4B9NA 1DLOA 1WC6A 2JH3A 1SL0A 3FMBA 1FJGJ 3ZTOA 2ALZA 2HNYB 1BQMB 1X8DA 2NYHA 1NSAA 1TKTB 4U7CA 3ISND 3BBCA 5DGAA 4WFYA 2MLZA 3IRXB 2H48B 3BGLA 4X84A 4OX7A 5DZ6A 1C4AA 1F5AA 1X31C 1WF0A 2OTJS 4X4NA 2ZH4A 3BV8A 3OL8A 5DDRC 2JEFA 1RT5B 2C28A 1NJIT 2UUAJ 2AEFA 3QIPB 2KXHA 4HKQA 3EE3A 4EGLA 2YVSA 3HDSA 3DU5A 2LQ8A 1XNQJ 1DY3A 2XMAA 3MUMP 4J91A 2DCUB 2FGCA 1UVMA 1JIHA 4JI3J 4KPYA 1RCXB 2HGMA 4ZA1A 1QAYA 3BM7A 1WJ9A 2YH1A 5D78A 2CPYA 4HLBA 2CDQA 2MLXA 3HP6A 1P1LA 2ZBCA 2HHUA 3J7AN 1B0PA 4WFXA 4K8RA 1LQ9A 4FBUA 4QWAA 5AXNA 2J5AA 5A0YB 5C42B 3SV3A 4FYWB 2KZMA 3FZBA 3M4XA 1F1BB 2BMBA 4C8MA 4BC7A 4KC5A 3OTBA 4RW8A 2VBWA 1S0OA 2IA6A 4NX9A 2R7TA 2UUBJ 5FJ4A 4F4AA 5CYJA 3DRRB 2YWGA 4ZPTR 3ZO7A 2G2ZA 3M2UB 4RW6A 4URQU 1HA1A 4DQPA 4GKJJ 2E1RA 2JLFA 2R8HA 1Q5YA 1AZSA 4BCAA 1I3OB 3TJ9A 4PPDA 2BQRA 1WEXA 4J9PA 2DGTA 3W7BA 2JNJA 2OFHX 2V67A 3NKYA 2AZ1A 1VMBA 4DV1J 4DQSA 2ASJA 3O44A 1BE4A 4JOUA 1RT3A 4O3SA 3ZC4A 2I0XA 3CD5A 2JX2A 2UXCJ 1C0UA 1KFDA 1VIXA 3PRDA 4ZDNA 2V4RA 3F73A 3DGPA 4Q5VA 6AT1B 4DSLA 4CLPA 4YMEA 3R3TA 5ETRA 1VQ5S 3NP5A 4K4WA 2NYIA 2YNIB 4WIIA 5C2GA 1WUUA 3P3DA 1DTTA 4KR0B 1PJ6A 1YIJS 4HR2A 3ZZ0A 3LP1A 5DQHA 2XMJA 2HHTA 1Y11A 4I69A 3MR7A 4EWTA 2D3O1 4NCGB 1I94J 2Q3PA 3MPVA 1X0FA 2RF2B 4TQSA 1RT2A 2XMUA 2QA2A 5KFNA 1HQUA 4O0NA 1RWPB 4ES1A 2FGOA 2FQQB 2JEGA 2YPZA 4ETZA 2P9GA 3MXHP 3FMWA 2OELA 2FLNA 4ZP8A 3QGIA 2C2RA 3PR4A 4ED7A 5IC4B 4L6V3 3A8KA 4ERDA 1HQEA 1SL1A 2AJQA 4AL6A 1NKCA 3BYRA 4IDKA 1FJGF 5IV4A 2RHQB 3I32A 1AFJA 1VQLS 3CCES 5L1LA 2G2YA 2J9CA 1FKOB 2MSTA 2WB1D 1R8HA 3RR8A 2D74B 3CT9A 4DFMA 3IBCB 3MCSA 3MHYA 2H9ZA 3TAMB 4AUKA 1RU2A 1RHMB 4IQXA 2ZVSA 2UUAF 4BS2A 2J9DA 3NCQA 4I7FB 4GO5X 4A8SA 1SQGA 1GH8A 3THTA 4RW8B 3BB5A 1RDRA 4FN5A 3LO3A 1DBDA 1TAQA 4CO2A 5D0GA 4JI3F 2H5IB 3PJWA 4YR2A 1ZBTA 1F3VA 3JQKA 1CJTB 1U48A 5CD4A 3LPYA 1AZSB 4WE1B 1TL3B 2OPRA 6FD1A 3N01A 3I0SA 2W9CA 1NCLA 2KO1A 4WU3A 2VV5A 2CA9A 2DK2A 1RT3B 3QJPA 2JWNA 1VC5A 2CJ9A 1SUQB 4HDGA 2FHJD 4FYVB 4YR3A 2HLTA 3JSBA 1YVFA 2VF3A 4DV5F 2HHHJ 3CCZA 3VAIA 4J9NA 1RI7A 2FZKB 4DUYJ 4LR8A 5KFOA 2B9YA 4GKJF 4DU8A 1FKPB 1K8AT 2XZWA 7FD1A 3QWUA 4LBHA 3NG8A 4L75A 5E3CA 4DV1F 3DOMA 3W2WA 2E29A 4OIXA 4B3RJ 1UEUA 2J0XA 1JX4A 2UXCF 3W5YA 2GQCA 1QUPA 1ULRA 3CJSA 4UY8T 2F1FA 2AKWB 2E9TA 2A2CA 5CH7B 5KT3A 3IM8A 3S8SA 4P7VA 3K0JA 4UT4A 3R27A 3PX4A 2JOQA 2DR7A 2Y0SD 2FIUA 4CT8A 1BWVA 1X5SA 1HYSA 3OD2A 2HQCA 5K9FA 3S1TA 1KR4A 4G1QA 2P6SA 3KHHA 5ETQA 4B17A 5L9XA 2OPPB 2EWHA 1RT1A 4HACB 1BWEA 1ZH5A 3OL9A 4OYZA 1KEKA 1DQAA 4NEZA 4LUBA 1Q95G 5DG7A 1U4BA 1R3NA 3D6FB 3QATA 1DFDA 3KJFB 4TKTA 1GT8A 2E9ZA 3J7ZT 4Q0BB 1GTEA 3V81B 1JLEB 1YTYA 4O3NA 4NA1A 1NZ8A 2X1FA 5CZVA 3R5AA 2FJAB 4EO8A 2F7VA 2F3JA 3DMJA 4LIRA 4MYUA 1WHWA 2M70A 5JUMA 2HZCA 1EQ0A 1FNXH 4DX8H 4UF4A 1GMWD 3QBCA 1UETA 2CWXA 3O3LA 3GR0A 1W26A 1DURA 1TKDA 3FRZA 1ZETA 1G3OA 1R8BA 5JJBA 4C8ZA 3IWLA 5CCMA 2DGUA 2XMKA 1Y5LB 3OLAA 2BJ7A 2FJBB 2MZJA 2HFZA 4OZNA 2N4DA 2AP6A 2IDLA 2HNZB 2OUGA 2F8EX 1N32J 1EARA 3AA8A 4ZLPA 1YRTA 1WELA 3BGOP 3CC7S 3HVWA 1Y3JA 4OI2A 1S6PA 1P8GA 2MZTA 3BSCA 2BDPA 2MY8A 4B3MF 1RWUA 2G2OA 2CNKB 3RJMB 3DOMB 2QC3A 2P5VA 1S9GB 4LSNB 3SI8A 3UDEA 4PABA 2FD2A 3CDEA 4ZITA 3HHDA 1F2GA 3ICLA 4X2BA 2P9CA 4C8KA 4KT0C 2HAIA 3VAKA 3HHLD 2B5JA 5BYQA 4DUYF 3MD3A 1XC9A 2EEYA 2ZJPQ 3O8WA 5A8WB 1UVLA 4DV0F 1NPRA 3K58A 3QQCD 5F8NA 3SFGA 1LV5A 2UUWA 4DFPA 4K59A 2AF6A 2DHHA 2AV5A 4ZOSA 4KGZB 4NXMJ 6FDRA 2RDDA 1MN7A 4B3RF 2WW8A 1RAGB 4G1QB 1MSWD 3A3OB 2RMLA 3PX0A 2RT3A 4IRKA 4IFVB 4JV2A 1CSJA 4F04B 1AUDA 3Q2SC 1DHMA 2KJWA 2Q43A 3QSIA 3I4PA 2MHNA 4OZJA 3PX6A 2CZVC 1TMMA 1HNVA 2Z57B 1RT6B 5A76A 2BV3A 4Y34A 5KFJA 2A10A 1S6QA 4QIVA 1KWMA 4ECVA 4YHHF 1S4EA 3IBWA 5E33A 4ZVRB 3M8QB 1OY6A 4CO0A 4H4OB 1UEKA 2HKEA 1N6QA 2ALYB 3MMBA 4KYZA 2XY7A 2R8KA 2YKMB 1LEOA 1NB7A 3JS9A 5CYMA 4JYAF 2EFGA 2WSEC 3PV8A 4QCLA 1RQ0A 1YSJA 2OPSA 5SZTA 4RKUC 4MJKA 4YUDA 4MK9A 4Q43A 2GS8A 3MPYA 2X1BA 3MMJA 5J2NB 4FYXB 1FK9B 1RAJA 5IQ6A 3AOCA 1GQEA 3MWBA 3IFEA 1Q78A 2YKAA 2FVQA 2R7VA 5F8MA 1U02A 3QGHA 3B78A 3GG0A 4CLKA 3CEDA 3T6BA 4F4WA 3QJJA 1AA1B 4CH1A 3MTKA 3ZZTA 1N34F 5ITHA 4NLWA 4F4XA 1NMEB 3PY8A 2BRKA 1ACMB 4OHXA 4ZPVR 1TFYA 3NWRA 1KN6A 4ZP9A 3D4JA 1KTQA 2BJDA 1IR0A 2KM8B 5HQMA 4A4JA 5AT1B 4U8VA 3VGUA 5B0DA 5J2PA 1K44A 2AX0A 2VA2A 1N32F 2GO9A 1M90T 1FEHA 4JB8B 3DLLQ 3ETOA 1UJ6A 4RW7B 1V6HA 1UJ4A 3W64A 3R5CA 4TYAA 1W25A 3H25A 2Z2YB 3K8WA 2VG5B 3EWGA 3C6TB 3TJAA 2J7WA 1RTHB 1WG1A 4DPYA 5I3PA 4KH1B 1VBXA 3CDUA 1U2CA 4ATNA 4B3TJ 1CLFA 4R0JA 1WI8A 4AXJA 2KT2A 2R7QA 2OI2A 4C4WA 2PT0A 1CC8A 3RB6A 4RNMA 2ROEA 1X4AA 1URNA 2WVDA 5LOQA 4IG3A 3GV5B 2L9WA 4LF5J 2Q66A 3OW2R 3GTYX 4X4TA 3PJXA 5DG8A 1AB8A 2Y3YA 4DL5A 2V2QA 1NNDA 3AQOA 1IBLJ 2DXFA 2AJ0A 4RO0A 2XNRA 3JAMY 4LMZA 3GIJA 1VDHA 2IJFA 1F60B 4ED1A 2IRXA 4CLLA 2ZKTA 2IYGA 2R42A 1LFWA 4DCJB 3K7RA 1HBNB 1VK3A 3KNAA 5BYSA 2EG1A 3UPFA 2BOPA 5BJRA 1PO6A 2HMIB 3HK2A 2YNHB 1LWEB 4LBIA 3GYXB 3QO9B 2ZD1A 3GZ7A 5DLFA 2XQCA 3NS6A 1E6YB 4C97A 5I4MA 4LRAA 3DLGB 2ZH3A 4Y2CA 1PBAA 2R2UA 1OS5A 3W66A 3PYFA 1YJNS 2VL1A 4I2QA 2DNRA 2CJXB 2PD1A 2PA3A 4N8OA 4LF6F 2OSRA 3UI3A 2DNNA 2V6AA 3LH2S 1IKVB 2YXLA 4LRCA 3G4SS 3UNYA 3KLGA 1H0HB 1BGXT 1JLQA 1UWBA 3I0RA 4JV0A 4JP8A 3FNNA 2AJ1A 5C5JA 5HATA 3BO3A 2FVRA 5ETPA 4M5JA 3KMQA 3T1YJ 1H73A 1TUWA 4DV7J 3AFGA 1VGYA 2LXIA 2E66A 2DR5A 1ZPWX 2CQCA 2ZUAA 3OLBA 4DX6A 3NAHA 3UDCA 1IKWB 1XERA 3QLHB 1K9MT 2C2ZB 3RU0A 1CULA 4LJMA 3R7NB 2VOPA 4PQUA 2L48A 2Z56B 4QW9A 1YJRA 3UD3P 1GMWA 2R2RA 5HI7A 1FE4A 4HH0A 4IG3B 2DNMA 1FRMA 4XO0A 1WSRA 2CJYB 2XWYA 2LKZA 5HK4A 2PA8D 4EEYA 1QLNA 1T9TA 1HBUB 2ASYA 4MYTA 1W2IA 2J0SD 3V6DA 4DR4J 4QYRA 5M2RA 1SC3B 2JVRA 2A18A 2F9JA 2FC9A 3R5DA 4B3TF 1EKSA 1LFPA 1HHSA 1SL2A 3IBFB 3H2UB 3THVA 1G2EA 2FVSA 3WC2A 1TKZA 4F2SA 3H90A 5C24B 3Q23A 2Y1RI 4LF5F 1R0CB 5L38A 4QR1A 1N54B 2ADBA 4ZPBA 1ZM4A 2MY7A 2ZD1B 2GGPA 2BBEA 1KONA 2Z58B 1IKXB 2R4FA 4U6PA 2ABYA 1TMJA 1NRKA 3PIPQ 2Y1JA 3T1AA 1JK9B 4I2QB 1LWFA 4L3KA 2OH2A 2LECA 3DRSB 4PXBA 3OL7A 4ZHRB 3OL6A 4QQBA 3W65A 4FYYB 2FYXA 4G3IA 5LMNJ 4QBUA 3A3PB 3RB3A 4IO9Q 4LT6A 3V4MA 1X9WA 2DPIA 3SQOP 4JI5J 4I6WA 4IOCQ 2YNFA 2F63A 3NNHA 5J2QA 2DVIA 1VRUA 1JB0C 3VGSA 1S10A 3EMTA 4F0KA 1HLWA 2VFSA 2MKKA 4K5SA 3EDRB 1U1NA 2MLYA 2UU9J 4LFAJ 1IJEB 2E44A 2ZEJA 3DXSX 2BE2A 3E01A 4Q8EA 4OX8A 1CULB 2HQIA 4O44B 1WF2A 4WTYA 3SQGA 3FGVA 5D4PA 2ASLA 4DL0C 1V5IB 3BSOA 3CF5Q 2ZOGA 1FE0A 1TUVA 3JB9k 4CO4A 3V4IA 3SXLA 3NLCA 4M5DB 3K59A 4F3MA 4F26A 4DV7F 5K14B 4ENOA 5KFZA 1FDAA 1RISA 2ZE2A 3T3FA 3KLIB 4J9QA 1OMSA 4DQIA 3V6DB 4M5HA 1YRUA 3E2EA 4BDPA 3UE2A 1O8BA 3PYGA 4OYXA 4ZPAA 5KT5A 1BMQB 4DN0A 4PPZA 1N33F 2Y1IA 4C9DA 3ZXWA 1M1HA 2IY5B 2VG6A 3CDBA 5D4NA 4WK1A 1L3TA 1HWIA 2OP5A 3SCLE 1KTVA 4LF7F 2XO6A 5KFVA 3GILA 4F7VA 3B54A 2JDJA 2D3UA 8AT1B 1L5UA 4ZVTB 3W8GA 1DTQA 4A48A 1KLMA 3DLEA 4DQRA 4DR4F 2AYGA 1UL3A 5G4DA 3W8PA 1ZAWA 3A3NB 3VAJA 4NEYA 1LWFB 2PGCA 1LK5A 2Z4PA 4USUA 4RNFA 2HBZB 1U24A 4YY3J 4F36A 2NS1B 3AHPA 1T95A 2NZ4A 2C2OB 4LBPA 4PYDA 4ZLLA 3CW2C 4M5IA 2XLKA 3RBDA 1X7VA 4FF1A 5CYQB 2HZVA 3EZOA 1OSCA 3POTB 4KBIA 3R5JB 2IJRA 4QIFA 1VRUB 2YTCA 4WPAA 2HQGA 4GKKF 3M9OB 3MMCB 2H65B 2OFGX 5KG0A 5F9NA 3PVXA 1B0VA 5LMNF 1V5VA 3E01B 5HANA 3OVBA 2LQ5A 1S57A 1IKYA 2VU5A 2I38A 2AYMA 4JI5F 2KKHA 3NCPA 4N5SA 2ZDOA 4AT1B 1KVJA 4CLZA 2MYFA 1KNZA 3EGZA 4QWDA 5HMWA 1TL7B 2IRUA 2ZWOA 1RKJA 4C8NA 2DITA 3CCSS 2UU9F 4LFAF 3QZ7A 3WBZA 2FC8A 4FS1A 4ICLB 1HMVA 3A12A 3WC0A 2XTJP 3H40A 2DH8A 1YGYA 3ZZZA 3PFEA 2ZNYA 4BBYA 1JJCB 5IT9Y 1ROFA 1NK8A 2COLA 1FERA 1MLAA 1MWYA 3JSYA 2CPXA 4IFYA 2FLPA 1GX6A 1MWZA 1RA6A 2DY1A 1FDNA 3NRBA 3L4BC 3WZ0A 2VFRA 2QG9B 3ILLA 2DCLA 3G6XA 4KH0B 1HNXJ 4RL1A 1X9MA 4Y00A 3HSJA 2ZBIA 4QYZK 1KQFB 1NLKL 5AJ3F 2JZ5A 1QSYA 1SXLA 2EFVA 5AXLA 2O01C 2RILA 5DM7Q 2L08A 4KHRA 3P5TL 3MR5A 3M32A 3LA0A 2F4VF 4LF9J 3K17A 3E51A 4X65J 3AXKA 3HHEA 1N48A 1VI7A 3CB4A 4ZN3A 2I9SA 2V2ZA 5KFXA 2MPUA 1F0XA 4KKOA 4DXLA 1BQNA 3ET6B 3RB0A 2B3TB 2CPFA 2I5JA 3HPOA 5CAAA 3JYTA 1K1SA 4DFJA 4DOZA 2Y0BB 3Q83A 3ULHA 3CTRA 4C8YA 3BO4A 2VFTA 3LF0A 3DI6A 5JVHQ 3GLJA 4RUHA 4NLYA 2CQGA 5IM0A 2ZFHA 2ZM6F 4FBTA 1T9YA 3KXDA 1PC5A 4TXSA 3ZNUA 3GFYA 2KDOA 3OUYB 5AXKA 2DB1A 2MDAA 4RR5A 3MAAB 3KLFA 3HVRA 5GMDA 1XMQF 3QIDA 4LFCJ 3JSMB 2D3ZA 2ZHBA 3CCVS 4DS4A 5KFLA 2C3OA 4W4MA 5KFMA 3QT6A 4UZBA 2XCAA 4P2MA 3J80Y 2XM3A 3ZTRA 2CQIA 3KOAA 2HFNA 4J9RA 1HMVB 2FJWA 3RG6A 2HFSA 3AOBA 3ISNC 3VQSA 3TOQA 4IYQA 1X4EA 3KKFA 5I42A 1VC0A 2EVZA 1N52B 2ASDA 5B08A 2QSWA 4LR7A 3IXQA 2HRYA 3RBEA 2IMOA 1N36J 4A8XA 2JEJA 3KK1A 3PG9A 1CG2A 2GV1A 1TL5A 2H51B 1OSDA 3QGPA 1M1GA 4NRTA 3O6QA 1UVJA 2BEFA 1SC6A 3MM5A 2CYYA 3FEZA 3ZNJ1 2HAFA 1XMOJ 4R8UB 2LU2A 4ZPCA 3VZHA 5KT4A 2KYXA 2E5HA 3D7SB 1TELA 3Q86A 3MM9A 1D8ZA 3KJNB 5B09A 2VJUA 2KRRA 3M30A 2K3IA 2U1AA 4M5LA 2Q6CA 2QA4G 2YQ3A 2W9AA 3OXGA 2ZJQQ 3AD8C 2V4JB 4DV3J 1FWPA 4DV4J 2VG7B 2PN6A 1EETA 4DG1A 3ADAC 1C1CB 1NHKL 3L7OA 5B0GA 1JLBB 2B9EA 3BDPA 1HNXF 5J1EA 3E3XA 5KFBA 2BRLA 2Z2MA 1FT8A 5F0UA 4USTA 1S6OA 3KG1A 1URRA 1T9XA 4YDXA 4CLSA 4MKYA 1HNIA 5IM0B 2AEMA 4K5RA 3PR5B 2HWIA 4PQAA 4ECQA 4LF9F 5JVGQ 3HLUA 4X65F 3R1LA 3N6MA 3SCJE 5KFEA 2R9LA 2FJVA 2H54B 1PYSB 3R7BB 2HS3A 2GHPA 3MM6A 2F5GA 2L9NA 5J2MB 1PGZA 3JXOA 1JLCA 1YZ7A 2DRDA 1JWWA 5HQ8A 5GADU 1UKUA 3BGRA 1S99A 2KB2A 3U27A 3H0PA 3RYLA 4KPCA 3BSAA 4U8YA 3DDNA 1VQOS 3CJ0A 1QSLA 1JLFB 4L3NA 1H6KX 2ZDPA 1OYDA 3G2XA 5KFHA 2GW8A 4A8QA 3TUPA 4DR6F 5CXTA 3OR1A 5HLFB 5C7PA 4UOGA 1FCAA 3TZXA 3DCAA 3GPAA 3KK3A 2QMUB 4ZLJA 4LQ3A 1W7WA 2E9RX 4NZ0A 4TY8A 1HPZA 3AJDA 2XEXA 3ILJA 3H7HB 3UD4P 2OAUA 2UXBJ 1Q7YT 1HW9A 5KFWA 3KDNA 1AROP 1KOHA 3EGWB 4NI2A 2K7KA 3P45B 1TAUA 4NXNF 4CTAA 5GADI 4BWMA 3OR2A 4QIGA 3RAQA 2H4YB 1TKXA 4UOFA 5DDQC 4DMZA 3MEDB 4KY3A 2B8QA 1N36F 3H5XA 1F9EB 1UFLA 2L3MA 3RGIA 3TAPA 3NGSA 3M2RB 1PCAA 4DG1B 3I4HX 2D41A 1RHRB 2XI2A 5LJ5Y 1QM9A 4ZP7A 1D0EA 1KQGB 2J9EA 2BKPA 2DO0A 1XMOF 3CCRS 3WX4A 1VRTB 3SCIE 1RTZA 2W8LA 3GQCA 4IH6A 2F8MA 3RRGA 2E1CA 1B4SA 4TQRA 1J5EJ 1RBOB 4J9VA 4AYBD 3KWMA 1HNIB 5E2QA 3C2PA 4C48A 4JI4F 2UV8G 4FF2A 2VUGA 1RHJB 1RWVB 5BXIA 5D0EA 3I5AA 3OXLA 4PKDB 5KFKA 4PWUA 2HFVA 3PACA 2W9BB 3BN4A 5JMNA 3NMRA 1EAYC 2CJAA 3ENWA 4DPUA 2HBYB 3BS9A 4OX9J 3PM9A 3F41A 2YY3A 4ZVEA 2EG2A 2V8VA 4X4RA 1NK6A 4HT7A 1I1GA 3HKWA 4B3OA 2GVDB 3W60A 2YKNA 3W63A 1EX8A 2MSSA 2RS8A 1T03A 4ECWA 3BPSP 3DM2B 4FKYA 1RGVA 2R8JA 2ZC4A 1CJKB 3CO0P 4D3GA 4NZ7A 1S12A 3B4MA 1JLAA 2XY5A 2ATLA 1NK5A 3W3SA 3DRPA 4PXEA 3IAS9 1R0AA 4ID5A 2PEBA 3KG4A 2QE5A 4UOCA 2OMLA 1M1KT 2O1PA 4QWBA 3NXZA 1PIEA 3MM7A 4TY8B 4CYUB 2KT5A 2YWKA 3I31A 3UN2A 1UW4A 1R89A 2R7WA 1RTJB 3HXMA 4CO1A 1Q53A 3KJVB 4KV8A 2FLOA 1NK7A 2HWTA 4UQTA 2KVQE 2BZ2A 1UW9A 3CJTA 4NLQA 1TKXB 2G13A 2SXLA 2MGZB 1MU2B 2DNOA 2R7SA 2VBYA 2V2KA 2QFJA 4JI2F 1ZZFA 3MD1A 2GO8A 1G4CA 4HVZA 3TVYA 1Y9OA 4F02A 4QZVB 2R8IA 2BXJA 1JNZB 1QAXA 5C2CA 4WYWA 5H9FJ 4IOAQ 1YDLA 2IVMA 4HL9A 1ZZNA 2XYHB 2WRMA 2XZTB 1GMUA 3T5KA 1YI2S 4ER8A 1R7IA 2OO4A 3VAFA 2H3EB 2BQ3A 3EM1A 2WOMB 3EVWA 2CJQA 1C0TB 1SJ4P 2J0QD 2B56A 3TP2A 4R5PA 2D9OA 3EX7B 3PNIA 4PWWA 4K4YA 1GK8A 1UPMB 3WDOA 4ED8A 2DNKA 4DL7A 2GNKA 4UQGA 4MK8A 3SYZA 3GSDA 1SJFA 3JQMA 5THWA 4M63A 2VZ9A 3HZEA 1RU1A 2KRBA 4TN2A 2GZOA 3M6VA 1IXKA 1Q1KA 2DY9A 5L1KA 3M9NB 1S0MA 1J5EF 1YQHA 1Q82T 1SKUB 1CPZA 2LFVA 2VJVA 2Q6BA 3CC4S 2AYEA 2ZZTA 5G0RB 5LM7E 1YWXA 4M95A 4KJIA 4OV6A 2DNZA 2H1YA 1TL4A 5D6GA 2RRAA 3T5LA 2B4UA 5EWFA 3DYAA 5E5NA 3L95X 5A2QU 1ZAVA 2ZZNA 3IS9B 5F8IA 2ZBQA 4WZMA 2D69A 1A0OB 1N56A 3NEKA 3MUVP 1FRHA 3DN9A 5MLCV 2DHGA 2KXFA 3HHLC 1N4LA 4WF9Q 2MQOA 1O51A 4P2FA 1HBMA 1WOPA 3MM7B 1YBUA 4NZ6A 2HBQB 4IOBA 2RHSB 1Y5IB 2CFXA 2M5YA 2NSBA 1UP1A 4ANEA 1IUJA 2M2BA 1IBKJ 2ZH6A 2GHWA 5D77A 5F3TA 3HULA 4KV8B 3CMES 2B7CB 1IQTA 2BM1A 1J5OA 4DV2J 4ZJOA 2QTWA 5CHCB 2DH9A 2OPQA 2YX4A 1EP4B 1TL1B 4C0OC 5IT9U 4RLEA 1HARA 5F3ZA 2CQ1A 4CNZA 4DSIA 1N5YA 1Z1ZA 3V2UC 3HFVA 2BOAA 4CH7A 1JXVA 3A4TA 4NRUA 4LF4J 2HZAA 3A1YG 3D1OA 5H1SV 4X4QA 3B8HA
chains in the Genus database with same CATH topology
1YBAA 2YKAA 4RW4A 2FVQA 1WHXA 1S1WA 2GMHA 1TFWA 2R7VA 1VOMA 3FZ2A 4PCQA 5AE1A 5F8MA 5GAEU 4ICLA 3QGHA 1PILA 3B78A 1M5OC 2GFFA 2EBEA 2VD3A 3HJFA 2R7XA 3GG0A 3CE8A 1ZTTA 3IO1A 3IC1A 1H7XA 1RT7A 2CZ4A 2MHEA 3CEDA 3T6BA 4F4WA 1U1LA 3QJJA 4KHPF 4R0EA 3CJ4A 3CCTA 4ZK7M 4CH1A 1NJWA 2XSJA 3MTKA 3ZZTA 2HWHA 5ITHA 1N34F 3CJ3A 4NLWA 3KTQA 3N0VA 2J7UA 3I9ZA 5A8KA 4Y0FA 4F4XA 2EW9A 2CJBA 1IN0A 2KN4A 3AQPA 1FTRA 3PY8A 2BRKA 4H4MB 4J37A 4PG4A 3HHLB 4RUCA 4K4ZA 4OHXA 1WWHA 3MTJA 4XDDA 4ZPVR 5KG5A 5KFRA 1TFYA 4ZP9A 1KN6A 1RTIB 4BHQA 1KTQA 2DNHA 2BJDA 1IR0A 3DLJA 2KM8B 1R8PA 4HI2A 2HHXA 2KT3A 1C1BB 2QRRA 4TU9A 2L41A 4A4JA 4F2RA 1D9FA 1HFEL 1T02A 2AGQA 1D9DA 1X4DA 5B0DA 2EPIA 5EHHA 5J2PA 2IRYA 3W2VA 2AX0A 4A8MP 5I42B 3S7RA 4FPRA 1VQKS 5ADZA 2VA2A 1N32F 5FDLA 2GO9A 1M90T 1FEHA 1SJQA 3V6HA 1M5KC 3DLLQ 3N4WA 3ETOA 4HDHA 4V19J 2Z0GA 1UJ6A 4RW7B 3RAMA 2X1AA 5GMKa 3OSNA 4XPEA 1V6HA 1NHUA 3BF4A 1UJ4A 2QSFA 4NA2A 3KK1B 1NH7A 2EI5A 1X5PA 2AX1A 3R5CA 4URGA 4TYAA 1W25A 3H25A 3HM9A 4KIAA 2IMWP 3K8WA 2VG5B 3C6TB 1N88A 5L1IA 4RZRA 2UXDF 3DRXA 2RUGA 4TLQA 1XR5A 1NKEA 2RSQA 3OTOF 3TUZC 5CZXA 4O3RA 1WNEA 1WEZA 2ZH7A 1WTFA 2J7WA 2KFYA 1A9NB 1RTHB 2DGWA 4OV1A 5KG6A 3MM5B 3ITHA 3PW5A 2EFQA 1WG1A 2EBGA 4KO0B 4RW6B 5C25B 5DJBA 2W4DA 3UCGA 4C11A 4DBQA 5I3PA 3IWXA 1VBXA 1M5SA 2BANA 4I6YA 2OMOA 4DUZF 3CDUA 2YKPA 5GAEI 4ATNA 3HKZD 1CLFA 2N7CA 2J7KA 2RS2A 1CC7A 1UAWA 1UVKA 1HNZF 4R0JA 1K1QA 1WI8A 4AXJA 3DYAB 2KT2A 2BA9A 2R7QA 3MECB 3DFEA 1XN9A 3MM9B 4C4WA 2PT0A 1CC8A 2P6TA 3DHXA 5KFYA 3RB6A 3M30B 4RNMA 2ROEA 3OVAA 3RRKA 4FYDA 1X4AA 3MEEA 4FNHA 1URNA 4ALZA 4IG3A 2ROGA 3GV5B 1APSA 4DF4A 4USHA 1U1MA 2L9WA 5KFIA 3RZAA 4AXIA 4KTQA 3PW7A 1WD6A 1C0UB 2Q66A 5K8OA 4CQ1A 4FS2A 3OW2R 3KG0A 4X4TA 2KH9A 2NUUG 3PJXA 5DG8A 4WKRA 1T05A 2CPDA 3C8YA 1FNMA 2HNYA 4DL5A 1BQMA 3T19A 1NNDA 4YB6A 4DL2A 1ZYQA 1EETB 1FESA 2FHMA 3D5MA 4FVMA 4NYZA 1FDBA 1TKTA 1J2VA 3AQOA 3T9NA 4NLGA 1KRPA 3KNGA 2OLWA 3M8RA 4RUAA 2HS4A 4WK3A 2AJ0A 1UEVA 1S1UA 2XNRA 5A2QY 4KB7A 4AFFA 3JAMY 1HWLA 2BM0A 3M2VB 4LMZA 3GIJA 1DTTB 3IRXA 3THPA 1RKIA 3BREA 5J1EB 2IAJA 3LW5C 5EX3A 3BQ0A 2ZH2A 2EFPA 2X1GA 3OUYA 1ZM2A 4GO7X 2IJFA 3DXBA 4ITSA 1F60B 2WSFC 1LW0B 5GAGU 4ED1A 2IRXA 4TLRA 1FRIA 2LDYA 2ZKTA 4K2XA 2IYGA 4NLUA 2LYVA 4TYBA 3TW0A 1LFWA 2AD9A 2U2FA 3LP1B 3CSKA 1NJYA 1RT5A 1TR0A 4Y2AA 3K7RA 4Y65A 1YITS 1PC4A 1HBNB 1S79A 4AE5A 3QIPA 1FVSA 2ZOFA 4WJBA 1VK3A 1X4CA 3BO2A 3T1YF 3GG1A 1DQ9A 3KNAA 1Z4UA 4LVNP 3JSMA 5BYSA 2EG1A 2J6UA 3UPFA 1N5VA 4YOEA 1DARA 2KYZA 1VBZA 2KVIA 5BJRA 1ZM9A 5L9NA 3KLHA 3Q22A 1PO6A 1M5PC 2BOPA 2XLJA 3PFOA 3OPKA 5DRKA 1RT2B 2VC1A 2DGQA 2HMIB 2QIFA 3NBPB 3CJKA 4JI7F 1VIOA 1HQUB 3HK2A 3KMSA 1S97A 2MMYA 2YNHB 1BD6A 1LWEB 3GYXB 3QO9B 1R27B 2ZD1A 3GZ7A 5DLFA 2B9XA 2APOA 5E3RA 3NS6A 2WSCC 1E6YB 1LOUA 3CIZA 2A2DA 5JXSA 4EBEA 3EPIA 4Y2IA 2O5DA 4C97A 3KLEA 2K3KA 5BYRA 3MM6B 2VOOA 5I4MA 3RAXA 2HYIB 4HH1A 3M6UA 1SI9A 3PHEA 3DLGB 2ZH3A 5F9LA 4Y2CA 2ZJRQ 4OHYA 2KTQA 1S9EA 1JLCB 3CGIA 2HHPA 4QU6A 4NLDA 1VQ9S 2UV8A 2R2UA 1HQEB 2B4PA 2VFUA 1OS5A 3E8OA 1KQKA 1T3NA 2HHWA 7FDRA 2NREA 2VBZA 3Q8PB 3N79A 3G6VA 5L8RC 2VL1A 2XG8A 2ILZA 1YJNS 4B9LA 4IDKB 2C3YA 4I2QA 2P9EA 2VPWB 3BGRB 2DNRA 3F56A 5A0YA 5C42A 4FP9A 4EFAC 2PD1A 2PA3A 1O0PA 3G71S 4N8OA 5KFUA 4LF6F 2OSRA 3M1VB 1FHTA 1U1QA 2UP1A 3UI3A 2LA4A 2DNNA 3U7JA 4DV2F 4V19X 2GCFA 4A8OA 4J9OA 2HNDA 3LH2S 4QIWD 3V6JA 4QWEA 3P6YC 1NH8A 1IKVB 1XK8A 2DNYA 4HYKA 3G4SS 2MQQA 4FF4A 3KLGA 1H0HB 4DSKA 1BGXT 3QWPA 3DLBA 2AGPA 3CUNA 1M0SA 1JLQA 1Q7LB 1UWBA 4RNHA 3I0RA 4JV0A 2EC0A 3FNNA 2WAQD 2AJ1A 1YJWS 3DRRA 4C98A 5C5JA 5HMXA 4USIA 3OR1B 4GC7A 1RT4B 3M2UA 4W90B 2DTJA 3AY0A 2R7RA 4IR1A 4KE5A 2YKOA 5FDLB 1X5TA 2MKHA 1GTHA 4IUFA 3MFHA 4R8UA 3BO3A 5I3UA 2FVRA 3AB2B 5K8NA 2AJ4A 3KK3B 1RTDA 3KMQA 2QLXA 4E98A 1Y0HA 3I5CA 2HS0A 4J5OA 4F25A 2J0WA 3TA1A 4I67A 4NA3A 2CQ4A 1X4BA 3LAKA 4I64A 1F5BA 1OQ6A 1VGYA 3N5FA 2LXIA 5IS2A 2DO4A 2E66A 1HPZB 2DR5A 1ZPWX 2A3JA 2DPJA 4TNOA 3H98A 2CQCA 3OLBA 4XK8C 4XAKA 4OQJA 3NAHA 3UDCA 3ITHB 1HBOA 1IKWB 1XERA 2E7WA 3QLHB 4C11B 3N28A 1K9MT 2IVFB 2V4JA 2C3PA 2L9DA 4JV1A 3RU0A 4AL7A 2VC0A 2M3DA 3NGKA 5HP1A 4LJMA 3TVKA 4DSEA 1GNKA 2OPRB 2YX1A 5HN0A 2VOPA 4PQUA 2L48A 2VG7A 4QW9A 3I0SB 1YJRA 4OHVA 3UD3P 4H54A 4DWIA 2W9CB 2R2RA 1C1CA 5HI7A 3SDEA 1U45A 3A8EA 2XULA 3TAQA 3U1NA 4CTAB 3SSRA 4YQWA 1R6YA 4DFKA 1JLBA 1OO0B 3OR2B 1FE4A 4OI0A 4KQZA 3PKYA 3DHWC 1LW2A 2BW2A 1YJVA 2JC0A 2YNIA 2CPZA 4IG0A 2HHSA 4HH0A 4IG3B 3FEYB 3Q0AA 2DNMA 2LXFA 4WZQA 5LSOA 2PO4A 5BR8F 4RWWA 3FSIA 3UFCX 3G6ES 4I2PA 4X4PA 1FJCA 2XS7A 1FRMA 3N9UC 3VALA 1N5QA 1FJEB 2D7SA 4NYPA 3AJ2A 3VWSA 4NCBA 1N0UA 3FFIA 4XO0A 3J7YU 3K5OA 4L72B 5D3GB 2E1MC 2XWYA 2KFNA 2LKZA 1SQEA 2XB2D 2PA8D 1TV6B 2WK4A 3PIOQ 3LWLA 4EEYA 1L3VA 1QLNA 4I0WA 3T5JA 4Y6IA 1R8AA 2HIQA 3EGNA 1HBUB 2V9KA 4K4UA 2ASYA 4MYTA 1W2IA 2WHOA 5LXYA 5F41A 3L09A 3OXFA 4YY3F 2J0SD 1S1UB 1GXTA 3V6DA 4OFZA 2KFZA 4NCGA 4EBDA 4QYRA 1U6FA 1U2RA 5M2RA 2RF2A 4QPTA 1L3SA 2JVRA 2A18A 5IWAF 1TK0A 3CCLS 2F9JA 2FC9A 2PE8A 3R5DA 1B7FA 4QJVA 4B3TF 4DDFA 3FVYA 4KHMA 2WB4A 4JI8F 4OI6A 5A6PA 3NNAA 1LFPA 3TO8A 1HHSA 5IXUA 1SL2A 2LVWA 4B08A 4ZCLA 3W2WB 3H2UB 3THVA 1VQ8S 1G2EA 2FVSA 3WC2A 3CO9A 2ZITA 2RU3A 4B3SF 1TKZA 2C2DA 4F2SA 5J2MA 3GIIA 1VQMS 5C24B 1WI6A 2CG4A 3GE9A 3I82A 4MIWA 5LMUF 4ELUA 3Q23A 2Y1RI 4DPOA 4LF5F 3LAMA 3ZZUA 1HI8A 4MFBB 2N82B 3KLHB 3Q2TC 1N0VC 2LQBA 1JLGA 4N77A 5L38A 3PXGa 4QR1A 4KAIA 1WHYA 2KZZA 1N54B 5HO4A 1W2BR 4PWDB 2ADBA 2FB0A 4U9RA 4ZPBA 3N5BA 1XNRF 2D1CA 1ZM4A 3X3UA 5LL6d 2MY7A 1JKHA 5KOXA 2ZD1B 2GGPA 5KFAA 2BBEA 3DLHA 1KONA 4LSLB 4K0KF 1R8CA 3KLEB 1IKXB 1KFSA 2CPHA 2R4FA 2W8KA 3S6EA 4U6PA 2ABYA 1NRKA 1JLFA 4N47A 5DGBA 1FKOA 3R5BA 4QW8A 3PIPQ 2Y1JA 2IC3A 4EYIB 3T1AA 2MZSA 1JK9B 4I2QB 1LWFA 2OH2A 3TAMA 1ELOA 2KU7A 1FRLA 2D3OR 1SH3A 2LECA 5HLFA 3BQ1A 2ZNZA 3PKMA 3DRSB 1SV5A 1HYSB 3J7YI 1QE1A 4PXBA 3OL7A 2AWZA 3B82A 4IRDA 4ZHRB 3OL6A 4QQBA 2LDIA 4NWBA 3L3CA 4B3OB 2MJUA 5SUHA 4G3IA 1KS2A 2O66A 4I7FA 2C2EA 2YKNB 4QYZJ 2RU9A 3PDNA 1WG5A 3DOLB 4QBUA 1LXJA 2HRUA 3KYLA 3GIMA 1T03B 1FXRA 1FD8A 1YHQS 4C0BA 3D1QA 2BACA 3RB3A 2CVEA 1VJWA 5K5MA 1HW8A 3KK2B 4IO9Q 1CVJA 1RT1B 3HVAA 1TQLA 3MR6A 4LT6A 2LCWA 4NLXA 1VQ4S 3V4MA 3Q8SB 1OPIA 3M6WA 2BR0A 4ES3A 5LXRA 1X9WA 2DPIA 4AQYF 2VONA 3S01A 2XHWA 3QYYA 3BDEA 2OKQA 4I6WA 4IOCQ 1JLAB 2FJDB 3DLKB 1NJZA 3OSPA 1FRKA 4ELVA 2YNFA 1S0NA 1FA0A 2HGLA 3LWMA 2QMXA 2XMMA 2MB0B 2KI2A 3NNHA 5I3UB 1H3DA 5J2QA 3DRPB 2DVIA 3FDSA 4WE1A 1SJRA 1R0AB 3X1LB 1B0TA 1S7HA 3BR9A 1TL3A 1VRUA 3FJ2A 3FQKA 4ID5B 4X4VA 1JB0C 1BQXA 1H2VZ 1SKSA 1S10A 2I2YA 3HVTB 5KFGA 2VQEF 4G6VB 1R31A 2RQMA 5MAOA 2VFSA 2MKKA 2KM8C 4GMKA 5AXMA 3OFGA 2IM0A 2Q1LA 4K5SA 4QR0A 2NPFA 3SV4A 1U1NA 5EN1A 4F8RA 4Y3CA 4E8UA 2C42A 5GAHU 3IN5A 1DZ5A 3QMQA 3KHGA 1SUQA 4DF8A 1IJEB 4USJC 1KLNA 3BSNA 2E44A 4QU7A 3DMJB 3DXSX 3MEDA 4OHWA 4PG7A 4ZP6A 1LK7A 4ED6A 2BE2A 3VF0B 4PG8A 3E01A 1Q81T 4HTJA 3B4DA 4I1TA 4OX8A 4DSFA 4Q8EA 5F8LA 4OZ1A 2HQIA 4O44B 1WF2A 2DHAA 4MAKA 1U1PA 4JI0F 5CQGA 1PSDA 1DJ0A 1VQSA 4WTYA 5FLXY 5B7WA 3SQGA 3M2RA 3FGVA<