1YG0A

Solution structure of apo-copp from helicobacter pylori
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
b'MKATFQVPSITCNHCVDKIEKFVGEIEGVSFIDVSVEKKSVVVEFDAPATQDLIKEALLDAGQEVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COP associated protein
publication title Solution structure of apo-CopP from Helicobacter pylori
rcsb
source organism Helicobacter pylori
molecule tags Metal transport
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1yg0A00
2ZDOA 4QOTA 2KT2A 2LXFA 5T7LB 2GCFA 3DCAA 3GZ7A 3KNGA 1AFJA 2ACYA 4OJ1A 2ASYA 2IFXA 2RU9A 2W4DA 1U7LA 3F44A 5B08A 3LO3A 3TNVA 2BYCA 2W4CA 4Q2MA 3IWXA 3KG1A 4Y2IA 5F0UA 2XMKA 4DPOA 2L3MA 1GXUA 2ROPA 2HFNA 2FHMA 2QLWA 1P6TA 2GFFA 4HI2A 1CPZA 1FVSA 1X0PA 1WD6A 2XMUA 2ROGA 4OJGA 5B0CA 5B0BA 2Q3PA 1SI9A 1JWWA 4OJHA 2AJ0A 2VV5A 2FTRA 3KKFA 4Y2KA 5T7LA 3I9ZA 1X7VA 2XMJA 3BR8A 1Q53A 1Y9OA 1KVJA 1N5SA 1OQ3A 1YG0A 1FESA 1VQSA 2BJEA 3HF5A 5B0EA 3HFKA 2IYIA 2FIUA 1Y0HA 2GGPB 2PGCA 1OPZA 1FD8A 1ULRA 4HH1A 3TRGA 3WDOA 1FE0A 1YJTA 2JDJA 5A6PA 1P8GA 2HQIA 4A48A 5B09A 3HX9A 5K9FA 4DL0C 1W2IA 2FB0A 1N5QA 1Y3JA 2N4CA 1N5TA 1KVIA 2GO8A 1K0VA 3HHLC 1FVQA 2W4PA 2N4DA 2HLUA 4HL9A 4Q2LA 4F67A 2GGPA 1AW0A 2OFHX 3T9NA 1AFIA 2LDIA 1SB6A 3MCSA 1XBWA 1KQKA 5IXUA 2GA7A 2OD6A 4ZOSA 4YDXA 1YJUA 1RJJA 2LQ9A 1X8DA 3BN7A 2LQBA 3BDEA 1OQ6A 2K2PA 3TOQA 2QYCA 3IWLA 1QUPA 2BBEA 1Q4RA 2XMMA 4A47A 2OFGX 1TR0A 2OD4A 1SQEA 2HFOA 3UDCA 2BJDA 2N7YA 2OKQA 1N5VA 4HH0A 5B0AA 2XMTA 1CC7A 1R6YA 3LGMA 4NL5A 2K1RB 1VQYA 3QGPA 2K7JA 1GXTA 3DXSX 1Q8BA 1YJVA 2QIFA 2AW0A 2RMLA 3MZIA 2HLTA 2EW9A 2K7KA 5B0DA 3BB5A 4DN9A 2AP6A 1TZ0A 3HHLB 2RILA 1TL4A 2PD1A 2KT3A 1OSDA 3K7RA 4NPOA 4OJ3A 2G9OA 2OAUA 1LQ9A 1YJRA 1V3ZA 2KKHA 3BGUA 4A46A 1APSA 2K1RA 2ZDPA 1Q8LA 3HHLD 1MWZA 3CJKB 3FRYA 1Y3KA 1MWYA 3KG0A 2AJ1A 1IUJA 5A6WA 1FEEA 4FNHA 2CRLA 1TUVA 4YEAA 3FGVA 2HIQA 1S6OA 1S6UA 5KAKA 3HHLA 3VTIA 4HI1A 1JK9B 2ROEA 3FMBA 3LGNA 2XMVA 4A4JA 4OIXA 3QMQA 2RSQA 2BUNA 2XMWA 2IYGA 4FNIA 4ZA1A 1CC8A 4U9RA 2OMOA 4EFAC 5F0WA 1YRXA 2KYZA 3BM7A 3BF4A 3HDSA 2OP5A 2QLXA 3E8OA 4Y2MA 5B0FA 3CJKA 2VH7A 1TL5A 2GV1A 1FE4A 5B0GA 1URRA
chains in the Genus database with same CATH superfamily
4IRDA 3CO0P 4TKTA 3V6HA 1R3NA 4FF2A 4MKVA 4Y2CA 1RT7B 2M8HA 1EKRA 1T03A 5L46A 4WWSA 1M0SA 4DJBA 2J0XA 2CJAA 4O4GB 5H9EJ 1VQ4S 1UEKA 2BE2A 3JSRA 2ZZNA 2C2KB 3OTBA 4MIBA 3D67A 2HW3A 1I1GA 2NSCA 3GJQB 3RBEA 4NXNF 2DH7A 3VGSA 1N52B 2FQQB 4RW6B 3IBCB 4ZVTB 3CD7A 2M5YA 3QATA 1ROFA 4O4RA 1UVIA 2RDDA 4B9UA 5THWA 4YMEA 2YKNB 3LP2A 4FN5A 2C3UA 1NK9A 4F3OA 2YNFB 1VRTB 1TFYA 2VZ9A 3MM8B 2JZ5A 2BRKA 4NLOA 4RW8A 4M5GA 3KNAA 2L9NA 4LF1A 2LXFA 3C2PA 1NLKL 2GCFA 2RE1A 4DCPB 2ZJRQ 2C42A 3ICLA 4ZVRB 3MM9A 2DO4A 3J7ZT 2ZM6J 1NHKL 1EB0A 3HZEA 4GC7A 5HMZA 5HAOA 1FJ7A 1V9OA 4I2PA 2HKEA 2DJWA 2HBRB 3LQVA 3KJVB 5CYJA 1BQNB 1WG1A 3WC2A 3QWUA 3AY0A 1TV6B 2U1AA 1AW0A 2X1GA 3Q8SB 4DL3A 3VQTA 3UR3C 5KFWA 2JEJA 4TY9A 5HI7A 4Y65A 1IJEB 2LMIA 2HFOA 2ACMA 2YKQA 4F3MA 4A8FA 3GYGA 4L3KA 4DQRA 1IR0A 4WBFA 4QYZJ 2UZAA 3OSNA 4IR1A 5KT3A 1G1XA 5IT4A 2YWKA 1KSPA 2ILYA 4KKOA 2OHDA 3DMJB 4FBUA 2B43A 1B0VA 3MURP 2Z58B 4DLEA 4HHUA 3MF5A 2D3OR 5BR8F 2JLEA 2QC3A 1FCAA 4K8RA 5E7OB 1WOSA 4LF7F 3RB3A 5EHHA 3HCXA 3ZTOA 4N8NA 2E5HA 1Z2ZA 3DLGA 1KS2A 1U0HB 3FK4A 2DRAA 3QRPA 1TKTB 4CO5A 1EZZB 2VG6B 2FVQA 1N5TA 1FFWB 3EGVA 3ETOA 3DC2A 4F67A 1JJHA 2LDIA 4V1Ak 4F50A 1AZSB 1N8RT 2VA2A 2E9TA 2K2PA 5C2GA 5KG1A 3W9HA 1SQEA 2MKKA 1S0NA 1S1TB 2K1RB 5DGBA 2VPXB 3T5LA 1MN9A 1ZPVA 2BANA 1F9HA 3PEJA 2W8LA 4B9SA 2RILA 1IR1A 4Q0BA 1S10A 1YRUA 3W61A 3E2EA 1IKYA 4IQXA 1R0AA 4B3OB 3FRYA 3KJQB 4QBUA 4Z2XA 3TI0A 5L1LA 1S1VA 3CB4A 5JUMA 4ED6A 4RW9B 1TP7A 3UVJA 1SV5B 4S0MA 3J7YI 1RWVB 4BC7A 4J9LA 2ZOGA 2CJ9A 2ZDOA 2MJNA 2DH9A 4ZP9A 1WOPA 1RHMB 4Q2MA 3VAJA 1U2RA 4DPOA 3EGNA 3H5YA 3C16A 2LEBA 3HLUA 1Y11A 2OELA 2PSZA 3ISND 3ZFVA 3D4JA 3M30A 2J6SA 2YQ0A 1NHVA 1WC4A 4O44B 4KJIA 3TZWA 3IN5A 5GMKa 2R8HA 1LWEA 2RS2A 3HVTA 1B64A 4I7FA 2CPXA 1VRUA 1XR7A 4W98A 2CJQA 2RRNA 1RWKB 2VD3A 3N5FA 4NASA 3A8JA 3KK1B 2PN6A 1GXTA 1FRXA 2DNQA 3R97A 3D6TB 4WE1A 2MGZB 4WU3A 5HLFB 2Z2LA 3NCQA 2XY6A 4JI2F 3VHQA 1RT1A 4C8ZA 2XI2A 1HWIA 1PGZA 2J9CA 2XMVA 3QIDA 4DPTA 1CLFA 2HZCA 5BR8J 2KYZA 4Y28C 2XB2D 2NLWA 3ITHB 3MMCA 1J5OA 1N33J 2M0GB 5KFOA 4UZCA 3PW4A 3EVWA 2FHMA 4CM2A 2A6MA 3KHGA 3CJ2A 1KTVA 2NCKL 4WFBQ 4CLFA 3BKUA 3MCMA 4ZCLA 4BWMA 4UOGA 2DISA 2X1AA 1UJ6A 4CLPA 4KPYA 3KLIA 4J9PA 5CYMA 1ICEB 2GHPA 2R7OA 3MI7X 3IRWP 4M5JA 2DRBA 1OO0B 1DBDA 4C8LA 2YKOA 4K4SA 4QW9A 1JJ4A 3OSPA 2R42A 2NREA 4G6VB 2R7TA 1AYEA 3MAAA 1QAYA 4ED2A 5AXLA 4NMLA 1KOOA 4P74A 1N5YA 3KJFB 3GPAA 2FJBB 3SI8A 4ZVEA 3GTYX 4PWWA 4WFXA 4KE5A 3D66A 1WC0A 3HSDA 1N88A 3HHEA 1SJFA 3PR4A 4NZ6A 2QX0A 1T3NA 2B4OA 3M6UA 3TAMB 2FHJA 2KJWA 2MQOA 3D5MA 1NK7A 5AE1A 3TX0A 1RBLA 4AUKA 3W9JA 2LYVA 1HPZB 2JL9A 2VIHA 3DLKA 4DLGA 1Y00A 3WX4A 3T6BA 1FWPA 4F4ZA 2R7XA 2M7SA 2JDJA 2X1FA 4F02A 2B8PA 2MJUA 3MCNA 1SV5A 2KG1A 2MQQA 1K1QA 4CIOA 4Y2AA 4DSKA 3TJAA 9RUBA 1NBEB 2YNHB 1F60B 5LJ3Y 3OT9A 3DYAB 4KFBA 1VYAA 2M4MA 4ZP7A 4DSIA 1RBAA 1RWMB 2X51A 1YJVA 4DV2F 5LMUF 1RQ0A 3G6XA 2CQ1A 1IKWB 1BC6A 1D09B 5CH7B 3CJ5A 2HWHA 2RIJA 3VALA 1X9SA 3D0HE 3SDEA 1S48A 8AT1B 1FEEA 1CG2A 1RAHB 2DHAA 1IWGA 4Z7CA 4CLKA 3G86A 3K57A 2YVSA 4TXSA 4MK8A 4I56A 3DRSA 3HHDA 2VODA 2WSCC 2ZBPA 3SCKE 5GAGI 3QO9A 4EUVA 2DGTA 3C14A 4LF9J 4ECZA 4FXVA 1GTHA 3THPA 2X3GA 4CH7A 4LRAA 3BGRA 5D6GA 1S9FA 1S0VA 4HACA 4KGVB 3RJMB 2BKPA 1RT6B 1X4DA 2KXFA 2ZH2A 5DLGA 3NP5A 4IG3B 3MEGA 1CC7A 2MZQA 4MH8A 3QGPA 1DURA 5L9XA 4KGKA 4I2QA 5E3CA 3H4BA 3I96A 2LP4A 4DF8A 3DLBA 2ZWPA 2RS8A 4PQUB 4ZPVR 2V2VA 1XK8A 2ZDPA 1YBAA 1WEYA 2RAQA 2DEJA 1RTHA 4WXWA 4JI3J 3CE8A 3PX6A 1ZS6A 4M5NA 1QVGR 1HFEL 3CJSA 1JNRB 4DX7A 2DEIA 4C11B 1U2FA 3R5CA 3M2VB 5IFMA 3K2YA 2L48A 4DBQA 4PAAA 4C8OA 5T7LB 3OFEA 4NE9C 4H4OB 1X9WA 2UUBF 3DGPB 3TUJC 3PFOA 4LSNA 1LKZA 4ZVPB 1GXLA 5AE2A 2MQLA 4ICLB 3LP0A 3OLBA 1PYOB 4HDGA 2IYIA 2M70A 4HDHA 3D0GE 3T6JA 3PRDA 4CTAA 4IFVB 1UVNA 2KFYA 4DL7A 3MWBA 4NCGB 4DV1J 4J9VA 2WTFA 3BO2A 5I3UB 1HBUB 1HBNA 2WVDA 2OTLS 2L9DA 2K7JA 2O3DA 2OO4A 3OVBA 3I5BA 4LF6J 2GAHC 4V19J 2VU5A 4NYPA 1S9EB 4C2MA 1IBCB 1RUSA 2MLZA 2V4QA 4EU0A 4BS2A 1W2BR 4CZCA 2YNHA 1TL1B 2KXNB 3SV4A 5J1PA 5ETOA 5KFAA 3U1LA 4F3QA 1HNXF 4KRWA 4ID5B 4O3QA 3EDQB 3FCHA 3NEKA 2CZVC 4AT1B 2X1BA 3KLEB 2CQ2A 3C6TB 1T05A 3MMAB 2BQRA 2JRSA 1FESA 2G2YA 4EI2A 3NNAA 4IDKA 1PBUA 1MROB 1X4GA 4WU2A 3H5SA 2E1MC 3J7AN 3U7JA 3BS9A 3CJQA 1VHIA 3H8YA 3GFXA 4OX7A 2EKNA 2CQDA 1N6QA 2AGQA 1VOMA 3BN7A 3K58A 2B4UA 5D77A 2FYXA 4C97A 1HIYA 6FDRA 4CP5A 4F2RA 1FFGB 3RB6A 2RKIA 1B7YB 2QIFA 3IR7B 1G2EA 1IQTA 2N3LA 2A1BA 1DAXA 1HNZJ 2L9WA 2LLZA 2YWWA 3HVWA 2WOMB 3EE3A 3VVTA 3A3NB 2UXCJ 1S99A 5JVHQ 5DDRC 3OJSA 3AB2B 1RHRB 3DOLA 3GZ7A 5HATA 1KTQA 1KOHA 3IWXA 2BOPA 2VBZA 4HI2A 5I42A 3PZPA 2CZ9A 4CI0B 2Z2MA 2AJQA 3QT8A 4PG6A 2HK2A 3OHBA 5KFTA 2V5HG 1NDLA 3BPSP 2BJ8A 4DR2J 2OPPB 4JI0F 1BMQB 1O5JA 3B6BA 1K0VA 2KVQE 4OYPA 2KN4A 2D74B 2I5JA 1L3SA 2FZGB 1S49A 2EXUA 3K5LA 1RJJA 4LF5F 3ILLA 3OQ2A 2ZWOA 1X0FA 5ETTA 3BBCA 5L8RC 4JI6F 4Y34A 1LXNA 3P8BB 1Z2LA 4USWA 3K0JA 4AQYJ 4OLPA 1CS4A 5A8KB 1Z4UA 2CXEA 2I6WA 1XNQJ 1H98A 2FC9A 4NA3A 3LW5C 1D8ZA 1D9DA 2P8IA 2XMWA 4K4WA 1JLAA 3HHNB 3UN2A 1HNXJ 4YY3F 3K17A 1CJTA 2W7OA 3V81A 4AL7A 1WF0A 2GC8A 4CQ1A 2CNOB 2UU9F 2ZZTA 3PY8A 1SH2A 4DS5A 3B78A 4PYAA 3IS9B 1N56A 5IQQA 4QW8A 1YG0A 2GGPB 4PXEA 1H2UX 1DQ9A 2VKZG 1SJ3P 2XNQA 2EKYA 1L3KA 3M7VA 1G6BA 3BSAA 2W4PA 2N4DA 1V3RA 3TZYA 2HGLA 4ED8A 2VONA 2J8AA 2IBKA 3VAHA 1VS3A 2CPZA 2DCUB 1T3OA 4P2FA 4Q45A 4OHWA 4P9SA 2MKHA 1K44A 1B0PA 4B9NA 2E7VA 3KLGA 3D68A 5KFSA 2KT3A 4IFYB 3NS5A 2OTJS 2BJ9A 1ITPA 2GQCA 4ED4A 2LDYA 1AA1B 5A6WA 1HNIA 1ZTWA 2E7XA 1ZAVA 2EVZA 3NMRA 1GAOA 5EWEA 2OIHA 3RRHA 4JV2A 1P9QC 4KGXB 3HULA 3MEKA 2W8KA 5KFKA 1HD1A 1LWFB 4CLTA 2EI5A 1J5EJ 2GS8A 2XO7A 5GVQA 4RPFA 3I0RA 5LL6d 4RWXA 2R7VA 3PIPQ 2VG5A 1P8GA 5F9NA 1XMBA 3KLFB 3R5DA 4QR1A 4LF5J 4DR7J 4YR0A 2W24A 3L4BC 1XR6A 3ILOA 1TVRB 3FQKA 2MZJA 4KIAA 3WIUA 1PJ6A 4JI6J 2YNGA 3IXQA 4K4UA 3DLEB 2DNMA 2AW0A 2IMWP 4FVCA 3ZTRA 4YHHJ 1WHYA 4PQAA 4A8YA 4K0KF 3G8SA 3PW7A 2I8EA 5KT6A 3ET6B 4DQIA 5EGYA 1U47A 1RA7A 2AJ4A 2COLA 3HK2A 4YY3J 3W2VB 1IBLF 4H54A 5HQLA 3PHTA 2RT3A 1KWMA 2HRTA 2ALZA 4U8VA 1X0PA 5HP1A 4QWEA 2RJZA 3CCWA 2KB2A 4R25A 5D3GB 1SC6A 1RTDB 5JVGQ 1FJCA 3H5UA 2VFRA 1LK5A 1WHWA 2GMHA 2NUUG 2FJWA 3BSCA 2Y1RI 3TR5A 3VAKA 4DV3F 1UWBB 3R5JB 2B51A 3GP9A 2V4RA 4LFCF 1RCXB 2CQ3A 4IKAA 4N5SA 3O6QA 2DR5A 3SSSA 3AH6A 3OTOF 1NO8A 1TTHB 3QGIA 1YBUA 2FGCA 2AJ2A 1LQ9A 2QMXA 1DRZA 2GNKA 4MKYA 1XMQF 4CLLA 1HBOB 1IKVA 2RNEA 3BYRA 4OLOA 2AJ1A 3J81j 4L76A 4WP3A 3R6LB 1S1UB 1OWXA 4OX8A 2B7BB 2E29A 3L95X 4ZPAA 4FNIA 2KRRA 2OPQB 4PKDB 3BBBA 2B9EA 1S72S 3DHXA 1HWUA 1FWLA 2UUCF 1LOUA 2QN6B 5G4DA 3HJFA 1U1NA 3UWTA 1B3TA 2HFSA 1OY6A 4I64A 2LQ8A 3RU0A 4TNOA 4J9QA 3D28A 5ETPA 3NG8A 2Z4PA 2YBVA 3N28A 1TQLA 4TU9A 2KJVA 5FIIA 1FDDA 2O01C 2ZJPQ 4UT4A 5D0GA 4CO0A 3NCRA 4ANCA 1DARA 2H5JB 4UZBA 1KVKA 1V3SA 3M8SA 1SKWA 1Q1KA 4K0KJ 4U95A 4OI0A 2GVZA 2B9YA 2RDJA 3DLJA 1Q8IA 1MWYA 3NNHA 1MU2B 2GO9A 2D41A 2BQUA 3Q89A 5KFHA 1JLEB 4RJVA 4K59A 2EEYA 4U9RA 3QLHA 1IBLJ 3QFWA 3NAHA 4JI4F 3LALA 4LBIA 3BJYA 4G1IA 3IFEA 4J90A 2PC6A 3TNVA 4I0WA 4JBCA 3EPGA 3SCIE 1JMTA 3GILA 2P6TA 4OZ2A 2CUYA 4ZK7M 3MD3A 3FDSA 1VC0A 4MIAA 1QE1A 2V9WA 4R8UB 2H54B 1N0VC 4ATNA 1ACMB 2H9ZA 1F5BA 2VBWA 1SC1B 1JKHA 4JI7F 5C7PA 3K5MA 1BQMA 2UXBF 3IRXB 1CSJA 1R6YA 1TL3B 4M5KA 2APOA 2DHXA 3PCOB 3NGRA 4RLEA 1XMQJ 3G9CA 3IG1A 4QYRA 3MFHA 1MN7A 1VJQA 2A18A 2V50A 1S6OA 1OS5A 2GZOA 3AT1B 2E1AA 3B54A 5IOLA 2HHHF 5J2NA 4JI1J 1NK0A 2V94A 1M5HA 5HBMA 4ZJLA 1DLOA 1RYRA 4KHPF 1PC5A 4DUYF 2OPSA 1G3OA 1KEKA 2ZD1B 5LT5A 1NKEA 3HM9A 2J9DE 3MOZA 2ADCA 2CWKA 2RVJA 2ZE2B 4NLWA 1UMJA 4UF4A 1W2IA 2JH3A 2VDIA 1RTJB 1RU1A 3HHLC 3CMQA 2PMHA 2IMOA 3GJTB 2DGOA 3TAQA 3JSMA 3E01A 2OJ3A 5LMNF 4O3RA 1M1KT 1S9GA 1H6KX 2H5EA 3RAXA 3TUIC 1NPKA 4OYBA 2DHGA 3GR1A 4LR8A 3T1HJ 3TUZC 3KHHA 1S6PB 1UWAA 2MLXA 1S76D 4RUHA 1Z1ZA 1FJEB 3PW5A 4NRUA 4WK1A 5FD1A 5AJ3J 1YTYA 1C0TB 2CRLA 1GFWB 3JYTB 1H7WA 2WSFC 2EG2A 3QYYA 4NLGA 3GR0A 1HD0A 4JI4J 5B0FA 3ZZRA 1IN0A 1YRTA 2HQDA 3SQGA 3GSIA 5ETNA 2E5LJ 3MR3A 2DHHA 1X31C 1MW7A 2IHR1 4RUBA 5CHCB 1T95A 2L3MA 1WACA 1HWJA 4X4VA 1NU4A 4OJGA 3QBCA 5B0BA 1HR0F 4Y2KA 2W2MP 1PILA 2MDAA 5KFXA 4NCBA 1VQPS 5SZTA 3NL0A 4L72B 1TKZB 1URNA 2JC1A 2QO3A 3MFIA 4GKJF 3TARA 2C2OB 5J2PB 3HP6A 3CC7S 4RW4B 4DR6J 2OFGX 3UDCA 2P9EA 3NGSA 3KLHB 3D7SB 3LWLA 3EZ5A 4IOBA 1YDLA 5I3PA 2XSJA 3BGUA 4YR2A 1QTMA 3FZBA 2K3IA 3M8WA 1KDNA 2AF6A 2BEFA 4UY85 2BUNA 4KO0B 4ELTA 2WVFA 3M6XA 3M2UB 3VAGA 5T41A 2ACYA 1BQXA 3GQCA 5GADU 3OW2R 3V5RA 2RQCA 4DUYJ 2HFNA 3TANA 3V6KA 5DG9A 2W9AA 4K4XA 1JLGB 2R8IA 2ZKUA 3CJ8A 4NXMF 5J1EA 1U1QA 5IM0A 3OBIA 1L3VA 2NPIA 3R7SB 5K14B 4JV0A 1NXIA 4CYUA 1XIQA 3FEYB 2HS3A 5LMNJ 1FRKA 3FZ2A 4F26A 2KYXA 3OUYA 1H74A 1YSJA 4A8WA 3PRBA 3GB0A 3VGVA 4HH0A 1HLWA 1HHSA 4RUAA 2VFUA 2ZVIA 3WBZA 3K7RA 2VPWB 2DY1A 2ZE2A 2EK6A 2Q66A 3LA0A 3W2WA 1MWZA 1F3FA 1B4SA 1H38A 4YP3A 4K5RA 2G1DA 3H7HB 4RWWA 2HZVA 3AJ2A 2IIHA 2VH7A 4P10A 4ETZA 3RAMA 4CDIA 3QIPB 1ZZFA 4ECQA 1U6ZA 2CVIA 1RT2A 2DXDA 2J0SD 4XDDA 3KTQA 3M2RA 2M9KA 1YJNS 4LF8J 5KFRA 2XCAA 4B9MA 4X64F 4QWBA 3BN4A 4DPUA 3BR8A 3IC1A 1VR6A 5HJYA 1C2PA 1HHQA 5F9LA 1DTQA 1DHMA 1RKIA 2H5IB 1S6QA 4ELUA 1WG4A 1SJ1A 2HLUA 1L5UA 3I4HX 3PKMA 3CMAS 4ZP8A 4QCLA 1V5IB 2OD4A 2CPIA 3GSDA 1WG5A 3MUTP 3EXYA 4H4MB 3VAIA 1C0UB 1P1LA 1ZA2B 3BB5A 3JSBA 3T3FA 2C1EB 5C24B 5JMNA 4QIWD 1R31A 4C0OC 2UVRA 4F0KA 4KAIA 2HG4A 3GV8B 3CEDA 5LOQA 3RBXA 4X4RA 3BF4A 2N82B 4X4OA 1VBYA 2OSRA 1E6VB 5F8MA 5KFCA 1TU0B 1UW4A 1DJ0A 2LU2A 2C22A 3CD6S 4QWCA 3OFGA 4TLQA 2ZBQA 5DS7A 1Q53A 2NXJA 4QWAA 4FZVA 3C6UA 4MIWA 2KDOA 1RWNB 3G8TA 3KUHA 2V4JB 1RAEB 2XWXA 2DNYA 1REGX 3G6YA 3FMWA 5J1NA 1FXRA 4LSZB 1VJWA 2ZITA 3L7UA 2VFSA 1NJYA 4RW7B 4EBEA 1F3VA 4ERDA 1X8DA 4R0EA 1XWLA 4ZPCA 2YKAA 2KU7A 5IV3A 4NYOA 1RT5A 2Y0BB 5IT0A 5HROA 3JTNA 3KK2B 3W5ZA 3G8QA 1N32F 3NAIA 2W9CA 3EVMA 3VQSA 3B82A 4WPAA 3ADAC 1TK0A 3U27A 4Y2MA 1SUQA 3LTOA 4HT5A 4M5DA 1J2VA 3W1YC 3F44A 4IG0A 3T1YF 1JWWA 5C42B 1VQ6S 4LBPA 1WHVA 4AE5A 3Q8YA 1EJ7L 4YR3A 4WFNQ 2XS2A 2VICA 1FD8A 1FXLA 3US5A 2DO0A 2ZZMA 4LBHA 4EWTA 3S01A 3FRZA 3W60A 2ZH9A 1Q78A 4KTQA 4EK2A 2V67A 3X1LB 2VPZB 4U7UK 1B7FA 1UW9A 3QIPA 1XTZA 2HNYA 4OYIA 2QSFA 1RA6A 1QVFR 1QDUB 4N41A 1J27A 5FLXY 1IXKA 3ILJA 2VB6A 1FNXH 1IBKJ 3TEHB 2OAUA 2XZTB 2Z2ZA 2W9BB 3BR9A 1PBAA 5L39A 4BC9A 2FHOB 3ZZ0A 1S4FA 5D0EA 1UP1A 5A8WA 1T9WA 4YFUA 3GIMA 5KFFA 4DV6F 2AYGA 1S1WA 3DOMA 1WD6A 1SL0A 5CD4A 4RNHA 1CJVB 4CNZA 1P1TA 3SFUA 4DOZA 2GIFA 4F4WA 1Q7YT 3VV2B 4HR2A 1WKLA 1JLCB 2YWEA 2ILZA 3S7RA 2FLNA 4X4NA 1WNEA 5D4LA 3CCQS 1UKUA 3GE9A 4YB7A 2HFVA 2OKQA 2DGVA 1I3OB 3ZC4A 2YWGA 1N32J 3HD2A 4DN9A 3QFHA 3TJ9A 3GFHA 2DNNA 3BEGB 3G82B 4TY8B 4Z7YA 3OFHA 2D3UA 2VASA 4F36A 3AOBA 4J9NA 3W66A 1X4CA 4HHHA 4B3RF 2DR7A 2B5JB 2YTCA 2A0FB 1YRXA 4C3LA 3Q2SC 4MAKA 4RNMA 5E33A 4KBIA 4F04B 4BLGA 5BYQA 1F9FA 2VJVA 4ZVGA 1HW8A 2MY8A 3FCWA 2YQ3A 3HJVA 5DGAA 1QTNB 3MECA 1NCLA 2CQ4A 2FIUA 1UZHA 1YJ9S 3HZGA 1KN6A 4GVBB 3A3PB 3NRBA 3T5JA 3M32A 3TA2A 2VUGA 2BJ3A 4GMKA 2G2OA 2BKNA 4JI5F 2RHQB 2ZC3A 4KC5A 4HL9A 3LPYA 1XBWA 4F2SA 2C3YA 3UCUP 1EAYC 2J7WA 1WELA 1HQUA 4ZP6A 4O3NA 2QG9B 4P71A 4K4YA 3HHLB 2RQKA 3P49B 3CCRS 3Q86A 2CQCA 4PCQA 1FTCA 3M8QB 3HVAA 2KHCA 4Z37A 1R89A 4B3MF 4ZA1A 4UOCA 4EFAC 4JV1A 3MM5A 2DNPA 3MD1A 2B4PA 5A8RA 5KT7A 3LAMA 4FKXA 4EMDA 3MR5A 1KLMB 2ZH6A 4IH6A 3M8YA 4ZJOA 3BV8A 1FRMA 2UV8G 3PDNA 4PWDB 3TW0A 4X4TA 1VQNS 4KR0B 4R5PB 2XLJA 3MMBB 2FY8A 3HPOA 2B9WA 3T1AA 2B56A 1RDRA 4ITSA 4X4PA 1ZA1B 2M52A 4LFBJ 3BQ1A 8RUCA 3CF5Q 3CIZA 5KT5A 4FDFA 5KFIA 4OV1A 4BDPA 4FF3A 2DITA 3FFIA 3TP2A 4LFAF 2CJBA 1JLCA 5LM7E 2JLFA 3S8SA 4I1TA 2DYAA 3NBPA 4B3SJ 2HNZA 2MZSA 3LUYA 1NDKA 4TLRA 4PUOB 2NXEA 2R7UA 3ENVA 3GYNA 1N54B 2RSQA 2ZOFA 1NSPA 2DGUA 1S4EA 1RAOA 4NLYA 4UUWA 2OMLA 2DVIA 2BX6A 2UUWA 3NLCA 2OPRB 3Q2TC 5JJBA 2F4VJ 1FTRA 4WK3A 3KG1A 4F7VA 3DRRA 4ZIVA 2CPJA 5GAHI 5C25A 1TFWA 3O8WA 2EFVA 1UTAA 1KBRA 3V4IB 2AWZA 1UJ5A 1M1GA 3M9MB 3NGTA 3BSNA 4JI5J 2BM1A 5H9FJ 5M2RA 1UEUA 4DR1F 4ZVHA 1OY8A 1CJUB 1MG7A 2GHWA 4JV5J 2YKMB 4G1QB 2CQ0A 2GAGC 1D9AA 4O3OA 2DD8S 4KV8B 2BJDA 5G0RA 4G1PA 3CTRA 3UD5A 2WONA 2QA2A 1HARA 3Q22A 3TA1A 1NK4A 2G9OA 3C15B 4ZPBA 3CJKB 2VG7A 1WORA 1QY7A 2GVDB 1FKPA 1K1SA 3LOUA 2KI2A 3FUYA 2DGQA 2KM8C 3ISZA 3Q83A 2AKWB 1F0XA 1NB2A 1ZM2A 3GLJA 3UE2A 5FLXU 2WVBA 2E5JA 5HVGA 2F9JA 1LW0B 2IM0A 1FK9B 4ZVOB 2PE8A 3MM7B 3BREA 3AAWB 1FX4A 5J2MA 1N5QA 2Y8WA 3ZZZA 4J9RA 4NLSA 3FCVA 3OL9A 2KXHA 2BQ3A 3MEEA 5E3AA 2I2YA 1VIOA 2O1PA 4IRCA 4ECSA 4BHQA 3FNNA 1GMWD 2LXUA 5DLFA 4G3IA 4ILRA 2LEAA 2V8VA 4C6AA 4LFAJ 5CCLA 3HD1A 1UL3A 3M1VA 2PD1A 4RKUC 1RLCL 1SL1A 1HNWJ 2VQFF 1NPPA 1X9MA 4PXDA 4NZ7A 2BE9B 3AXMA 4HEA9 2AEMA 2P9GA 3BGLA 1S79A 1CULA 1JLQB 2XI3A 5KFUA 1T7PA 5A0YA 3HFZB 2E1RA 4DV4F 1TMMA 5ETSA 1N34J 2C3PA 2J76E 2VF3A 1Q16B 4K4TA 3UN5A 1FVSA 4OJHA 1RTZA 2F7VA 1N36F 2AYBA 4DSFA 4OZNA 5F3ZA 2FJEB 2Q43A 4F4KA 1S59A 1YBTA 4ZS6A 2OUGA 4Y0FA 4DG1B 5ADZA 4NLUA 5H9EK 4USJC 4DR1J 1IKXA 1QSLA 1XMOJ 4X62J 1TAUA 4DR3J 4CLWA 4DU7A 5D4PA 1U6BA 4BBYA 2Z30B 1UEVA 4LRDA 1X5OA 4LIRA 5F8GA 3H20A 3ZZTA 2MQMA 3MEDA 2PEBA 2I9SA 2FLOA 2Z57B 1FKOB 4N8OA 2JVRA 5KG4A 4A8QA 5KFLA 1CJKA 4M5HA 2IJRA 4OI4A 1VMBA 1CC8A 1QAJA 1WSRA 3ZZOA 4QOTA 1S1XA 1U2CA 3ULHA 1VQ8S 4FPRA 1TKXA 4DR4F 4WXOA 1K8AT 2CJYB 3GIIA 1KFDA 2MKCA 4FS1A 2V2ZA 3NGDA 1MLAA 1RAAB 3IBFB 4HTJA 4C8YA 1IBMJ 2HMIA 2D3O1 3HKZD 4Q44A 4OI3A 2BW2A 4B08A 3LPEA 2BBEA 2XMMA 1RWOB 2XTJP 3Q8RB 1ZTTA 5BXIA 5GAGU 1EETA 4PR6A 2IC3B 4DDFA 3DXSX 3UDVA 2JLGA 3J7Z5 1ZETA 1JLFA 4N7TA 4AL5A 2YNIB 2VQFJ 3MM7A 2C2ZB 1TUGB 4CLZA 3DGVA 2H51B 2XM3A 4JYAJ 3IA0A 3PXGa 1GEHA 5IV4A 4QYZK 2ROEA 3T19A 3AODA 4LR7A 3KK3A 3M9NB 4PZVA 4OJ1A 4EGLA 4ED5A 2W4DA 1D3WA 3PNIA 2W7AA 3HT3A 4DV0J 3QAEA 2IDEA 4PEOA 4P7VA 3H40A 1WEXA 3EM1A 4USMA 3AD7C 1JLQA 3DHWC 1E6YA 3X3UA 3QPIA 1HQEA 1U48A 4ECRA 2QV6A 5CYQB 3IAM9 1KQKA 1NNDA 4MKAA 1K47A 1T9UA 1RTIA 2WHOA 4B3TF 4K5SA 3OJUA 3EICA 3G6ES 5DQGA 2XSFA 1KQFB 4KH0B 4UOFA 3W65A 3IMQJ 4EZ9A 3KFWX 3I32A 3ENWA 3DOKA 1WI8A 3L3CA 4ANEA 2J7UA 1OSDA 2G0IA 2QMWA 2RU3A 2RF2A 3L09A 3OR1B 4USVA 4ZVSB 4XAKA 2OSQA 3PW0A 2IAJA 2B6AB 4DUZF 4DX6A 2E44A 4DL5A 3KLVA 1GTEA 2XHCA 3UN3A 4NEZA 3IGNA 1TL7B 7FD1A 3NS7B 1T11A 2CJKA 4DR4J 4RO0A 4NXNJ 4PG5A 4P6QA 1RT7A 2CPFA 2CPHA 4ID8A 3FQLA 1Q86T 1WHXA 4A48A 5AT1B 2BXJA 3JAMY 2GO8A 4O4GA 4M5IA 2HNDB 4NRTA 2XQCA 2MZTA 4B17A 1JLBB 3OL8A 1V5VA 1QAIA 4M8LA 2XLKA 3D6FB 2CVEA 2QL7B 1PKUA 4AD6A 2OLWA 4F4YA 4P72A 3RZAA 1M5PC 1X5SA 3LF0A 2DNKA 1BGXT 5I4MA 2G4BA 4CRJA 4RW6A 2VBYA 4DZ6A 1F9EB 4NA2A 3WHIA 3PJXA 3AB4B 2R3VA 3TEGA 2WK4A 2PO4A 2IVMA 4LF4F 3HHKA 2QLJB 2OEKA 2C3MA 2YKNA 4FF4A 4DSJA 3PHEA 2ABYA 3KHRA 5D4NA 4DPWA 1QSSA 1NUEA 2BW7A 2YNFA 1VRTA 3MM8A 3A12A 2R7RA 1ZM4A 2WVEA 5K8NA 2BDPA 1Y9OA 3R6GB 2HIYA 3TRGA 1YJTA 4NLDA 5CCMA 2VOPA 2FVRA 1HBMB 4QR2A 1RT4B 4CT9A 2KRBA 3JXOA 5LSOA 4C7QA 3BZQA 1F2HA 2M2BA 1LWCB 2V8GA 3PEHA 5D0RA 3KJVA 3R3TA 2B4VA 3BDEA 1BQNA 1HW9A 5HANA 1TV6A 4PPZA 4AL6A 1EHWA 1W26A 2J0QD 1YZ6A 3OD2A 2QT7A 3W64A 2D7SA 1HQ2A 3KJNB 1HNVB 1ZPWX 4ZHRB 4NPOA 3IBWA 1AXQA 4NLRA 4C4WA 2NYHA 2Y1LB 4CO4A 2CWXA 1WI6A 4LF7J 3T9ZA 3THTA 4YB5A 3ZNJ1 3EYZA 5CYQA 4CO2A 2OH2A 2ALYB 4QU6A 2QYGA 1HMVB 1R0CB 3I55S 1RAFB 1QJHA 4JI8F 1NDCA 3DMJA 1HI1A 4I6YA 5EWFA 5CD4H 2XMUA 2Q6CA 1REVB 4MJKA 2W1BA 1O8BA 5KG7A 3CULA 1SQFA 3M8PB 1N48A 3W5XA 3QRRA 5IC6B 2LEPA 2NSBA 1D0EA 4DL0C 2MZRA 1U0HA 4DV5F 4P73A 2CPDA 4PXBA 4FF1A 1TKTA 4F8RA 2VG6A 3M6WA 3Q23A 3HVRA 3DRPB 1ZAWA 3NWRA 4J9OA 4X4QA 1EIYB 2HLTA 1AZSA 5M2UA 1RHJB 2HHQA 3GV5B 3MR6A 1S1TA 4A46A 3V6DB 2MQNA 2K1RA 4KQZA 4UW2A 2J8SA 1X4AA 4M95A 3OR2B 2CNKB 2IJNA 2V34A 4LF4J 2QFIA 2ASDA 4NMXA 2CADA 4DX5A 3QGGA 2I0XA 4B3OA 2IPOB 4P52A 5DJBA 3JB9k 2YXLA 3W63A 4RW9A 1UA1A 3GCXP 3CD5A 4OYWA 4KGZB 2MHEA 1SI9A 2V8DA 2ASJA 4EYHB 2KM8B 3FBBA 4W90B 1LW2B 2HQ3A 3IR6B 5B09A 3D9BA 5B7WA 4EBDA 4U67Q 1PAUB 3D6HB 5FDLB 3TZXA 4ZLLA 3UQSA 1HHTP 3CO9A 1C1CB 2G0CA 3L7PA 4JI2J 3J81Y 1UA0A 4O44A 3CCSS 3H2UB 2HK3A 4Y6IA 1WSVA 3TJ8A 4FXWA 1NSKL 2MTLA 4RNNA 2MKSA 4DPYA 5KFGA 1NJIT 3PACA 4J91A 3KK1A 4XPEA 3HXMA 3CD0A 3HHLD 1RCOB 3OLAA 3OFFA 5KT4A 1AUSL 1LNQA 1NSAA 1WKJA 2KZZA 4PPDA 2MGZA 2UVVA 5HLFA 1MNEA 2FLLA 1OIAA 3DLHA 1XNRF 1Q5VA 2Q79A 2ASYA 1YZ7A 3O1LA 1KONA 5D4OA 2N7CA 2E1CA 4DUTA 5B0CA 3ITHA 2A10A 2FJAB 1Y10A 3OTEA 2KH9A 1KVJA 2PFDA 2W2QP 3LH2S 3N6NA 1UVMA 4WCEQ 2VQEF 2Z2YB 1SKUB 1PJ7A 1HYSB 2EC2A 3BGOP 2C2RA 3TQ1A 4DV5J 1AUDA 3CPWR 2FVCA 1VC5A 1O6XA 1Q81T 3DM2B 5DZ6A 2PMZD 2ZHAA 1MMLA 1D1UA 3NCPA 2HHUA 2FC8A 2NUHA 4NI2B 4RNFA 4URGA 2EW9A 2DB1A 4GO5X 1X4BA 4KY3A 5F8IA 5DO2A 2D3ZA 2QL9B 5J2QB 3MHYA 3MM6B 2MKYA 1EP4B 2DXFA 1IUJA 1OJ4A 5HSPA 2VFVA 1C1BB 3IP0A 1VIXA 3G71S 1R8CA 1FDNA 3JAMU 4URQU 1TUWA 4U7CA 2R2RA 3M05A 3OTCA 2KFNA 1AFJA 1NK6A 1XEZA 1U26A 1FO1A 2DIVA 5LXRA 4NX9A 3R1LA 2HGMA 2GFFA 4IO9Q 1SJQA 1WF1A 4KYZA 2CQIA 3TAMA 1EARA 3BH7B 3I31A 2ZOMA 3A1YG 2QLFB 4DV2J 2FB0A 5LMUJ 1HPZA 2WZ1A 4LREA 2PT0A 5EX0A 3N01A 1DTTB 1R8PA 3G87A 3M6VA 4F0MA 3DU6A 3KYLA 3R7BB 3CT9A 2XULA 1WDDA 4K7QA 4NL5A 1WC1A 3H2LA 5DZ7A 5D8HB 2EBEA 3P6YC 1RAIB 3DYAA 3BH6B 5HVFA 1AROP 4TYAA 4OYMA 3P4UB 2UXDF 4QQBA 5KG2A 5IWAF 2EFQA 3RRKA 4WTOB 2VPYB 1RYSA 2EBGA 1IKWA 1VBKA 3N9UC 1YKWA 2A3JA 3GIKA 3QQCD 1T03B 1XQIA 2HS4A 1XNRJ 4H4KA 1R8HA 3I82A 3DLLQ 3LWMA 2BE2B 2D9OA 3V4MA 1XERA 3N6LA 4NLPA 1NJZA 3OPKA 2VQEJ 5B0EA 2BJEA 3V2UC 2HQIA 1U24A 1U1PA 4MMOA 3I5AA 3PVXA 2R8JA 4KB7A 2N3OA 4QIFA 3TOQA 2QA4G 2MKJA 1Q4RA 3MAQA 3EGWB 3MOJB 3LP2B 5L38A 1KNZA 2RMLA 4K2XA 4MKBA 1RT6A 1TZ0A 2QMUB 2Z56B 3BO4A 2GIRA 4I67A 4I68A 4IG3A 3CW2C 3NGKA 2UUBJ 2G1HA 5KOWA 5CXTA 4RW8B 3TX8A 1RKJA 4QJVA 4PQUA 4D3GA 1VLYA 3MM9B 1VFJA 2HBQB 3I9V9 3RR7A 5KFJA 4KHMA 3VVUA 4DF4A 4C11A 1OSCA 4I2PB 1RT3B 5DG8A 3M2VA 1P9YA 3DNCA 2HWIA 5FJ4A 5GAEI 5T7LA 4CLYA 4H4OA 3DGPA 3BO3A 1LXJA 2RRBA 4MK7A 2GX8A 4ICLA 2DGWA 3CDAA 2G13A 4L74A 1ZM3A 3TAPA 3QNWB 1QM9A 3SYZA 1SB6A 4MYTA 4XTTA 4IFVA 2GMJA 4U6PA 3EJMA 3CDWA 3AFGA 3AJ1A 4DL4A 3F41A 4NCGA 2UV8A 4DQQA 5C2CA 4YS2A 4IOAQ 3AD8C 4KKOB 5I3UA 1HBUA 2DR6A 4OJ3A 3GONA 2CDRB 2HVEA 2AT1B 4TYBA 1F5CA 2ZEJA 4OX6A 5U47A 1JK9B 1S9EA 2F3JA 1VISA 1A6LA 4FYYB 3J81U 2HBZB 1Y4ZB 4P2XA 4USUA 2CA9A 3WQPA 3DLGB 1TL1A 5CA5A 3EXCX 5DG7A 4IRKA 1YX2A 4ID5A 1V6HA 5BYSA 3H4DA 1FNOA 4UTGA 2ZHOA 2QLBB 2J9EA 2HEKA 4J5OA 3KLEA 5A6PA 3C6TA 5EN1A 2U2FA 3MMAA 3I87A 4ZITA 4JP8A 4M1KA 3CMES 4FKYA 1GK8A 3UCGA 2MB0B 4MT1A 4I6WA 1YITS 1NEEA 2BANB 1X5TA 4OI1A 3MPUB 2YX4A 1MROA 4YDDB 5HO4A 5DQIA 4RU9A 4Q0BB 1IKYB 1N5VA 3LGMA 3PKYA 1Y5LB 1R0AB 4OZJA 4OL8A 4ZN3A 1A9NB 2JHEA 1S1VB 2MYFA 2IVFB 1WWHA 4ZVFA 3M9OB 2XGPA 3D0IE 3CVKA 3SQOP 3UVJB 3IM8A 2QA4S 1FKAF 3C46A 4ZVQB 4NOHA 2HHTA 2DR8A 2DGXA 3BKFA 2WOMA 3BM7A 3LP1B 3C16B 3HT0A 5DM6Q 2J7KA 4JI0J 4QIGA 3QSYB 3QT6A 3M30B 2MPUA 2B8QA 1G4CA 3SSQA 5DM7Q 3OTDA 4LSLB 1LWEB 3G2XA 2SXLA 3RW6A 3HVTB 1RABB 3BYPA 1BWVA 1FDBA 4TQRA 4I7FB 2IRYA 2YPYA 1VRUB 2IM2A 1KD1T 2R7SA 5E5NA 2CNNB 4WFAQ 3GJRB 1CQMA 5IXUA 2F8EX 4ZLPA 4K2JA 2OPPA 1RWUA 1RT3A 4DSLA 1ZAXA 4WE1B 1FRLA 2NS1B 3NNCA 5MLCV 1RT1B 3FC9A 3K5PA 3MZIA 4HT7A 3B4DA 2BV3A 2HURA 1BE4A 4RZRA 6AT1B 2UU9J 4KSEB 1S0MA 3N4WA 4OI6A 2C2MB 5KFYA 3MMCB 2R2UA 2KO1A 1J5OB 2HHVA 3JSYA 4ZDNA 2CG8A 3QMQA 2BE7D 1KQGB 4YQWA 5A8KA 4IYQA 4GO7X 2ZUGA 3QT5A 2E5IA 3AJDA 3ZZYA 3MAHA 2J0WA 1KKHA 4P75A 2AHOB 2XS5A 2WB4A 3KLIB 1U02A 4AFFA 5CYMB 4M5MA 2AQ4A 3GV7B 1FE0A 3K89A 1N33F 3CC2S 3OHAA 5K8PA 3IS9A 2M8DB 1FVQA 2GGPA 2OFHX 3W8PA 4I6AA 1YVFA 3MAAB 4J37A 2ZJQQ 1C4CA 1NSQA 4FYVB 1HI0P 3P5TL 1LFWA 4ETXA 3JS9A 1N5YB 3M8ZA 2WAQD 3H0PA 1K9MT 5IQ6A 1IJFB 1RSCA 4WFYA 1GH8A 2RHSB 4L6V3 2FGOA 5HQ8A 1VQ9S 3DDKA 2JVOA 2BA9A 2F8MA 3U1MA 2WSEC 4IFYA 1BHNA 3TQEA 3HDSA 4E0DA 1U25A 3SCLE 1D9FA 2YPZA 1IR2A 3DLKB 2CJXB 2CQGA 2AYEA 2A2CA 1H0HB 4PRFA 4CH1A 2XZDB 5KTQA 4IH5A 2ZKTA 2E1PA 2ZBCA 3KMSA 2O5DA 5F3TA 2HRUA 1LWFA 3HFKA 1Y0HA 1VGYA 4ZMMA 5HL7Q 2XWYA 2G0JA 4KFBB 1NK5A 2N4CA 3J7A1 3LP1A 4CO3A 2XZWA 4ECWA 1UETA 4RBUA 3P3DA 2MHNA 2V63A 2JFDA 2ZNYA 2E9RX 3VAFA 3KLFA 2J9DA 2ZVSA 3VGUA 2YQ1A 1PYSB 3SDEB 4LSLA 1U1OA 2RQMA 1TVRA 3IGVA 2BMBA 1H72C 2HVDA 2XNRA 2W01A 2MQ8A 1BLUA 2CIMA 2H3EB 3DLEA 4USKA 3VTIA 4RNOA 3MTJA 3AD9C 3N6MA 3DRSB 1N0UA 3DDNA 3ONQA 3ET6A 1VK3A 4DV3J 3KHLA 4O3PA 1RWPB 3QO9B 3C14B 1R6VA 3FEXB 1EKSA 4ES2A 3W2VA 3UCZP 4LFCJ 5DETA 1VBZA 1MMDA 5KFNA 3H98A 1H3DA 3CCTA 4OQJA 3BGRB 2RUGA 4OHVA 2QTWA 3OTOJ 4CH0S 5D3GA 3E51A 4HACB 1RTDA 1T9YA 1U8SA 2YKPA 2VL1A 2QZ8A 1FD2A 3MEGB 1CQNA 2I38A 2GA7A 4I2QB 3KUEA 1UWBA 2PI5A 1LK7A 1H2VZ 4LF9F 2DHSA 4ZPWR 2Y1IA 1RTHB 4OYAA 2ADBA 4E2FB 2K7KA 3BPDA 3UW1A 3SSRA 2F8HA 1JIHA 3IWNC 4ZCIA 3W8GA 2CPEA 5E3RA 2QRRA 1XN9A 2UUCJ 3KDNA 4GKKF 1RB0A 1WC3A 2B7CB 4NLVA 4LRFA 3UDLA 1Q79A 2CZ4A 4LSNB 3QZ8A 2ZH3A 1HBOA 3CCES 1TKDA 2L08A 1DFDA 2WRMA 4C48A 2FLPA 1S1UA 3GFYA 4CT8A 3CJ4A 3LO3A 3LP0B 4QIEA 4B02A 5ETKA 4WYLA 4MTPA 1I51B 4JI3F 1ELOA 2OPQA 2MY7A 3QT7A 4Q7AA 1S97A 3MMJA 3RW7A 4CTAB 4ZLNA 2M88A 1AT1B 3GMGA 2UUTA 4AXIA 1R43A 2LA6A 3WDOA 4CM0A 2ATLA 2K06A 3D54A 4DV7F 2PIIA 2IJFA 2FJVA 1HBNB 2RH3A 2AX0A 1OYDA 2EFGA 2PDAA 1H2TZ 1VQKS 3PJ9A 4HLBA 3UFCX 1K0TA 3C19A 4DQPA 1QUPA 3H90A 1X4FA 5B0AA 3Q8QB 3FSIA 1S12A 3MPYA 1FFSB 4EEYA 1Y5IB 1O51A 4X65F 4HTIA 3K8VA 1FWKA 4AXJA 1G7CB 2JNJA 4DV1F 1KRPA 3BQ2A 4J7CA 3TA0A 2CQBA 3N79A 1Y5NB 4CLUA 4OYZA 3PV8A 2HZAA 4X4UA 1QSYA 3CCUS 3NGUA 1MU2A 4LF6F 4F4AA 2HFZA 3DCAA 1T05B 1JLEA 2AX1A 3I5CA 1VLOA 2H4YB 6FD1A 3WZ0A 2GW8A 3FBCA 2DNGA 4IDKB 1L3UA 4ECUA 1CBKA 3IR5B 3EX7B 4JI7J 5KFZA 9ATCB 2XG8A 2XHWA 2VHGA 4PG7A 2UXBJ 2PMWA 2V2QA 1S7IA 3ZTSA 2EFNA 3PJWA 1N6QB 4LT6A 2CQHA 3EMTA 2Y1JA 1HA1A 4C0HA 2Z8QA 2O66A 5HJXA 2RKIB 1L3TA 4R8UA 1UVLA 1JXVA 1BY9A 3JQKA 4U8YA 2N7YA 4LVNP 3QWPA 4DI6A 4OX9F 2HHHJ 4B9VA 2EK1A 3IRXA 1FI4A 2GJ2A 4HHJA 3AQPA 1TL3A 3U02A 4KHPJ 3NOCA 1NJXA 2F1FA 4GKKJ 2DNZA 2RQ4A 2HHSA 1VQ7S 3DOLB 2F63A 3CDUA 3QJPA 3PG9A 5LSLA 2VC1A 3GCWP 3KWMA 3GIJA 1S5ZA 2QLXA 5I42B 2V69A 1HNZF 1YGYA 3KNGA 2P2CB 4QWDA 5B08A 4Y2IA 4QPTA 3EVOA 2UXCF 1RZMA 3BDPA 1SH3A 3AA9A 1X7VA 2MLYA 1SJ4P 3AOCA 1M5VC 4DV7J 1NDPA 4O3SA 2I5JB 2DGSA 1RI7A 3GIRA 2ZD1A 1SJRA 5IS2A 5E2QA 5LSRA 2DBBA 3T9NA 3CCJS 1VQLS 3CJ0A 5KG3A 4NLXA 3PW2A 2AEFA 2MSTA 1RTJA 4DFKA 1ZBTA 2H65B 2IVYA 1B0TA 2PFFB 1CS4B 2LECA 3SV3A 4DR2F 3PFEA 1GMWA 4X65J 4OZ0A 1JLAB 2AIRB 1EX8A 1RE1B 1S6PA 2WBMA 1CJTB 5ITHA 1HR0J 2HQGA 3V81B 2LXIA 1RAGB 2HRYA 4ECYA 1C0TA 2JEGA 3JYTA 2EPIA 2W25A 4AQYF 3POTB 4RX6A 3F56A 2BYCA 4GKJJ 1PIEA 5F0UA 4ZLJA 2A2DA 4LQ9A 1XNQF 2DNLA 3K59A 3HSZA 4DZDA 3EWGA 2Y0SD 5IT9Y 3N5BA 2MSSA 2FZKB 1OPZA 2MXYA 5KFVA 3R5AA 4FP9A 3NKYA 1RHKB 4CWBA 2IRUA 4Q2LA 1SH0A 4K4VA 2H4WB 1SC4B 1TKZA 3KLGB 1D8YA 1UJ4A 2G2ZA 5GAHU 2XGQA 1IM6A 4OX9J 2R2SA 3ELHA 5L1KA 1RBOB 5J2PA 2GJIA 1MWQA 3BSOA 4RW4A 4L73A 4A8XA 1HNIB 2B9XA 1WC6A 1HWKA 4EZ6A 2KKHA 3KLHA 3AQOA 3VF0B 1DQAA 2I1RA 2CQPA 2PA8D 2LQ5A 3RB4A 2POKA 2HVZA 4J9MA 2YX1A 4QZVB 2W2NP 1YIJS 4NXMJ 4M63A 1HWLA 2WW8A 3HKWA 2AZ3A 3PR5B 3B8HA 4KO0A 3I0RB 1P6TA 3M2UA 1RAJA 1YHQS 2VG5B 3I9ZA 1PYTA 2VJUA 2KL8A 1S0OA 2HS0A 1GQEA 2KFZA 2ZH8A 3P5BP 4HH1A 3D6MB 2LU1A 4ZPTR 1SXLA 3OL7A 1JLGA 4XPCA 3G6VA 3CXCR 2XYHB 2YNGB 2KG0A 3CCMS 1J5EF 1NKCA 4OV6A 1GMUA 1FRJA 1LFPA 3QGHA 1WTBA 3LANA 5K14A 1TR0A 2V0NA 2PEHA 3H59A 3HI9A 3MPDA 2HBYB 4C98A 1QAXA 1TK8A 1F1BB 4WKRA 5K8MA 2P6SA 5KFPA 1NH7A 1Q8LA 4DCJB 4DR7F 4EO8A 2AD9A 5A76A 4RUCA 4DL6A 4X64J 1Q95G 5HP1B 4DL2A 1URRA 4YHHF 2QE5A 5CZXA 1S7HA 3FSYA 1U09A 4LJMA 2IA0A 3HF5A 2DK2A 1C4AA 2JEIA 5AE3A 4TU7A 3Q0AA 3TWZA 2YH1A 4ED7A 3PX4A 4P2MA 2GQ2A 1Q7LB 2WB1D 3POTA 2WVCA 3UD4P 3ENQA 5LJ5Y 5AXKA 3T41A 1IKVB 2HFUA 2K8GA 3GJSB 3O3LA 1X4HA 3K8WA 2AP6A 4JOUA 1U1LA 4NYZA 1B70B 4H4MA 1EQMA 1X60A 5MAOA 2MKIA 1C0UA 3AA8A 5CABA 4FNHA 1KHWA 3MCOA 3PTWA 1HL6A 2ASLA 5HK4A 4A4JA 2H1YA 2C2EA 5C24A 3C3LA 4RR5A 4QU7A 1FNMA 1O0PA 4FYXB 4OHXA 2F40A 3W5YA 3RTVA 2BOAA 2AYMA 2W4CA 1W25A 3KKFA 2FUG9 1E6VA 2AZ1A 2DNHA 1XJWB 4WZQA 4MYUA 1OQ3A 1SL2A 2ZC4A 4DS4A 2ZUAA 4RU2A 2VFTA 4XDCA 3O2IA 3CCLS 3HSJA 4EBCA 3I4PA 2VDHA 3RAQA 4A8KA 3GFZA 2V4JA 1UFWA 1R8BA 1PCAA 5BYRA 2BM0A 2GQQA 1WF2A 2GVZB 3R1HA 2E5GA 4RW7A 3EUNA 3Q24A 1NMEB 3IM9A 5D78A 5EX3A 2DT9A 3OXGA 3R9LA 3QLHB 3KK2A 3T1YJ 2NYIA 1DZ5A 1TELA 4PYDA 5KAKA 3VZHA 3RBDA 1IWAA 1NKBA 1XR5A 1TL5A 4ZPDA 2H48B 4DMZA 3EGZA 3PYFA 1QE1B 5ETMA 5KFQA 2JSXA 2NZ4A 3R7NB 2Y8YA 4PG4A 5ETQA 3C8YA 3DN9A 5C42A 1JKHB 1BQMB 4WIIA 1T9XA 5ETLA 1NZ8A 3DDIA 5DDOC 4N77A 4KH1B 1FDAA 3IG1B 1YK9A 3RRGA 2YX7A 3CSKA 4YUDA 2CKWA 5IT9U 4DV6J 3ZTQA 3D3BJ 5J2NB 4DN0A 5HMYA 3ISNC 5KFBA 4YEAA 1S6UA 3BBFA 5HN0A 3H25A 5HBMB 5GMDA 2OEJA 1DLOB 3SFGA 1UZDA 3ZO7A 2OP5A 2W9BA 2FHJD 2DRDA 2OPSB 3VR1A 2RU9A 3O44A 2DPIA 2JX2A 4OMFG 3TVYA 4M5LA 5HMWA 2NR0A 2XMKA 4X2BA 4C8MA 2ROGA 4ILLA 3EPIA 3OVAA 2HHPA 2BJ7A 4RBTA 1MSWD 4JI1F 3JSMB 3E01B 1S77D 1VQMS 2BKOA 4IH7A 1VQOS 1UVKA 2ZH4A 1Y3JA 4OZ5A 5KG5A 1CJVA 1S9GB 3UPFA 1F6TA 2FHKA 5SUHA 2AGOA 1UPPA 3E3XA 4LR9A 5D15A 1RGVA 2XO6A 2DPJA 5H9FK 4X84A 3NY0A 4LRBA 4B3RJ 2IDLA 2D9PA 3CCVS 1Q8KA 4DXLA 1RWWB 3SCJE 4WZMA 4FXDA 1SPBP 1KC8T 2J5AA 4XIUA 3SQGB 1FRHA 3LGNA 3T1HF 3PRVA 3G82A 3PYGA 4TY8A 3DXBA 2DIUA 2UVWA 4WP9A 2AV5A 5B0GA 3J80Y 2XYGB 3HSGA 3VZIA 2B5JA 3J7YU 4E8UA 5AJ3F 5JXSA 3B4MA 3U1NA 1UVJA 3MR2A 2AJ0A 3TVZA 1FJGF 1DQ8A 2V8PA 3AOAA 4Q8FA 5IC4B 2E5LF 2HVHA 4KHRA 2F4FA 1KP6A 3QAUA 3TZZA 1NAQA 4Q5VA 4GVBA 1NHUA 4WKYA 1BD6A 3MXHP 2ZNZA 2XSJB 4B3MJ 3W7BA 3W9IA 3PYEA 1Q8BA 1U8WA 3RR8A 1A0OB 2FY1A 4O0IA 3TYTA 3MDFA 2J6TA 4DWIA 1UAWA 1TUVA 4DR6F 3HHLA 2WBRA 4USTA 5DQHA 4CLSA 2NQPA 2P5VA 4V19X 2AGPA 5BJRA 3M8QA 3TO8A 4MFBB 4URSA 5F8JA 2MEWA 3ZTPA 2KVIA 2HWTA 1SKSA 1WTFA 3WC0A 1X5PA 5J1EB 3EDRB 2V6AA 3CGIA 2LQJA 5IM0B 5F8HA 2W7PA 3DI6B 3UNGC 2R8KA 3RBZA 1Q82T 5DDQC 3K5OA 3VCDA 4CYUB 2XS7A 4YB6A 1U0SA 1KLMA 3OUYB 4WF9Q 1JJ2R 2QL5B 1F5AA 3MPWA 4DPXA 1FEHA 1AFIA 4PWUA 3CJTA 4PWDA 1HI8A 4UQGA 1OQ6A 2E66A 4DFJA 2CAJA 2PA3A 4X4SA 4R5PA 3MMBA 1NRKA 3SIPB 1ZM9A 3W2WB 3NS6A 2BACA 3SMZA 4Q8EA 2W2OP 1V3ZA 4PG8A 2FVPA 1PC4A 3D2WA 1Y7PA 2RB7A 2DH8A 3FKBA 5C5JA 1VI7A 4USIA 2XMAA 3FSXA 1RT2B 5HQMA 3M2RB 1VHFA 3RB0A 1UFLA 2ATCB 3DRXA 4L3NA 4PUOA 4NEYA 5IZHA 3ZZUA 1U45A 1DY3A 3GWCA 5KT2A 1VQ5S 2DNRA 1FA0A 2QLWA 3CJRA 3PYDA 4ENOA 5AXMA 2X3DA 4ED1A 1FJGJ 1DTQB 2OPRA 4QPXA 4LIWA 1S6QB 1FF2A 4N47A 1WKKA 2CNLB 1ULRA 1GNKA 2R7WA 3LAKA 4IQMA 4ES1A 1QUVA 5EWGA 3V4IA 4LF8F 3JQMA 3DU5A 3L7OA 4YN3B 1ZOTA 3I6PA 2Y3YA 1QLNA 3D3CJ 3RUBL 1CJUA 2Q6BA 4U96A 2YKMA 4G1QA 4W4MA 4KGMA 1NZAA 3EZOA 2LCWA 4OHYA 4KV8A 4ES3A 1N4LA 3F73A 2HSEB 2GHVC 2XY5A 2ERRA 4BWJA 1GX6A 2B3TB 1KLNA 5EUHA 3C15A 2R7QA 4C3KA 4WFZA 4UUXA 3CJKA 4OYXA 2GVDA 3ZZPA 4KT0C 4I69A 4FS2A 1K73T 2F5GA 3C6UB 2UVUA 2Q3PA 4J9KA 3ENAA 3R27A 3QJJA 3GG0A 5KFMA 2CDQA 4TU8A 2XLIA 2BJ1A 2Y9HA 3OVSA 3O5TB 1M5OC 2FDNA 1U1MA 4UY8T 4W92B 1LW0A 1YJWS 4GC6A 2BR0A 1FK9A 4MFBA 4LUBA 1RT5B 5HROB 2LA4A 3KUGA 4UOHA 3Q8UA 2XC9A 4M94A 4JB8B 2QYCA 4OZ3A 4DQSA 3KDOA 2W9CB 1M5KC 1T9VA 3DI6A 3MR7A 2FZCB 3DKDA 4DV4J 3I0SB 1MMNA 3FVYA 4X66F 1YJRA 5E0OA 4NCAA 3KG4A 1SUQB 4M5DB 1N36J 3R5GA 1PAEX 5KG6A 2QSWA 1OMSA 4IG0B 3W3SA 2IYGA 3OXLA 4F25A 2CG4A 1NK8A 1FE4A 2K3KA 3UO0A 3WIVA 1CVJA 2RRAA 1FX2A 2C3OA 3R2CJ 2C2NA 1GX5A 4FBTA 2DXEA 5H1SV 1RHQB 3PO4A 3M4XA 1TMJA 4N76A 3UDEA 2FPHX 4ZCMA 4XK8C 1Q0NA 2HNYB 4J9UE 3V6JA 2NZCA 3NOGA 2EFOA 3VAMA 4DG1A 3T5KA 3J80U 4HKQA 5L1IA 3MGJA 3UNYA 2XMTA 4EYIB 2D69A 5ETVA 7AT1B 3Q8PB 2ZFHA 1FRIA 1YQHA 5A8WB 3VWSA 5E41A 5F8LA 3H5XA 4OZ1A 4NZ0A 1KR4A 1Y3KA 1SIWB 2D1CA 3KG0A 3C66A 5D0HA 4CO1A 2E9ZA 1B99A 1FKOA 3HFVA 3G4SS 1S1WB 3DOMB 2KT2A 2ZH1A 2DTJA 1IBKF 2HVIA 1A7GE 2V68A 4NWBA 1GT8A 1SBRA 5CZVA 1ZH5A 2XMJA 2JC0A 1YJ7A 2HGNA 1HKAA 1RACB 2IM3A 3QRQA 1PSDA 1KVIA 4Q43A 1R0BG 1JXLA 2YH0A 1H7XA 3IO1A 2HQCA 4O0NA 2HHWA 2CFXA 3DRYA 3IWLA 1X4EA 4TN2A 5RUBA 3GYXB 5EDWA 4ILMA 1LEOA 4X66J 4N56A 4NLTA 2KTQA 2RUSA 2V8HA 3H2VE 1P27B 3CC4S 4TQSA 3OL6A 2IC3A 4ZN1A 4PXCA 1AB8A 2YNIA 4OIXA 3N0VA 2OI2A 3MTKA 5F0WA 4K50A 2EG1A 4EO6A 3E8OA 4CCHA 2FJXA 2XEXA 2WW4A 5CAAA 2JFKA 3MECB 4C8KA 3P45B 2LVWA 3I0SA 1CPZA 2UUAF 3M32B 2R2TA 4B3TJ 1XC9A 1N5SA 4C8NA 2AEJA 2JWNA 1BUXA 4ZCKA 2FD2A 1RISA 2DY9A 1HQUB 1LWXA 3DFEA 4ALZA 2OD6A 3MUMP 1WEZA 1I6JA 5GAEU 1ZZNA 5DDPC 3SBMA 3F0NA 4DUZJ 1VQYA 1RWXB 4OI2A 2F9DA 1VBXA 3CCZA 1RLDA 2V2KA 4G65A 2HHXA 3RG6A 1YWXA 4FYDA 2ZBIA 2EWHA 3H42A 3MM5B 1CEZA 5A8RB 1JQGA 5CQGA 1R8AA 4U7UD 3I56S 3OR1A 4OHZA 5E3QA 3R2DJ 4OFZA 2QJ3A 3GG1A 2J6UA 4QR0A 2B6AA 2RDIA 4DFMA 1BXNA 4P7TA 3G96A 3UR0A 3PX0A 2FTRA 2NXCA 1TL7A 4HVZA 4DCOB 3CJ3A 4O23A 1FHTA 2VC0A 1WUUA 2C2DA 3JTPA 3HX9A 3KMQA 4ER8A 4ECTA 3ZXWA 2HPUA 1F2GA 2DKOB 3MCSA 4K4ZA 3QJLA 2YY3A 3A8IA 4JUZA 4ZOSA 3D1QA 3FFIB 4A47A 2HNDA 4DU8A 1GMVA 1JLBA 1JNZB 1U1KA 3NBPB 2HNZB 2WCXA 2L41A 1SKRA 5A2QY 2VOOA 4ZJQA 3A4TA 2A6OA 4L75A 5L9NA 4ED0A 3GU0A 3FBEA 4DSEA 4LFBF 4HI1A 5L1JA 4LQ3A 1U49A 2EFPA 4USHA 3DRRB 2YWHA 5C25B 5KFEA 2IFXA 3NXZA 3QZ7A 1PO6A 2ROPA 4B3SF 2YWFA 3TUPA 2UUAJ 4DHVA 4B9TA 2VV5A 3CDBA 4DR5F 2PI4A 4UQTA 5KFDA 2DNOA 1U6FA 2AJFE 3R8YA 1QD1A 2GMLA 2F4VF 4KPCA 3SXLA 2BVZA 3CUNA 5G0RB 4DFPA 3A13A 4Y00A 2WONB 4WJBA 2LFVA 1YJUA 2KHDA 1VCTA 1HBMA 2AU0A 1RT4A 5HVHA 4ECVA 1T8EA 1VC6A 1RXOB 1SC3B 4YB1P 3UD3P 3CWJA 1LWCA 2VG7B 3PM9A 5GADI 1FKPB 5E3PA 1NM2A 4ELVA 4JI8J 4IOCQ 4JV5F 2C28A 4F4XA 1FT8A 4RL1A 3KOAA 3VGTA 4XO0A 1BWEA 1RU2A 2X7IA 1HNVA 1M1HA 4ZHRA 2IBOA 2OMOA 2AMCB 3AHPA 4BCAA 4WTYA 3Q8VA 1UFKA 5GMEA 2V9KA 5K20B 5KG0A 2JEFA 4FYWB 2VA3A 1GXUA 1I94F 1HMVA 3JQJA 2Q1LA 2BABA 4PABA 1FERA 5J2MB 5LXYA 4OYOA 3W62A 4FPIA 2P9CA 1VQSA 2PGCA 3NWGA 3SZ2A 4J9SA 3MEEB 2ZHBA 1REVA 2JJ4D 4WYWA 2R8GA 2OGUA 1KQSR 3BGFA 4IUFA 2W2PP 4R0JA 3OV7A 2RD5C 1VRQC 3M8PA 2NPFA 2O67A 1UPMB 4YDXA 2QEXS 3M1VB 1NJWA 4TVAB 4ZKAA 4Y3CA 4GRSA 5T14A 1T94A 1TL4A 1M5SA 1CULB 1ZYQA 5A0YB 3DRPA 3P96A 3OXFA 2HIQA 4ANDA 3M8RA 2R9LA 2IM1A 2NXUA 3V6DA 1SIZA 2BZ2A 4DX8H 4IO1A 4IR9A 5F8NA 2QA1A 3OR2A 2VKRA 1U7LA 1HNWF 5F41A 3HMJG 4C9DA 4HYKA 2MMYA 4DR5J 1LV5A 1IKXB 4ZVUB 1WOOA 3CDEA 2CYYA 1N34F 2E7WA 5K9FA 1WDTA 2R4FA 1RHUB 2CPYA 1NB7A 3MEDB 2LKZA 4WP8A 3ILIA 2GJFA 1U1RA 1LW2A 1Q5YA 4I4BA 3PIOQ 2GIQA 4WIQA 5FDLA 5ETRA 2M3DA 1C1CA 4ZIWA 2MZ1A 1WJ9A 2XCPA 1CJKB 1XMOF 4X62F 1RP5A 4DR3F 1T0TV 2FJDB 1H73A 1T02A 4ED3A 3FBFA 4RBVA 1JJCB 5KOXA 3CNQP 2QGFB 1S1XB 1PJ5A 1NPRA 3K5NA 1OYEA 1TKXB 5I3QA 3SEOA 3FJ2A 3CIMA 1NH8A 1UCNA 4NA1A 3LGHA 1I94J 1WC5A 4P2SA 4LF2A 2XBPA 2EC0A 1JB0C 1U4BA 1FXDA 2HAIA 7FDRA 4QIVA 1KFSA 2KZMA 1S57A 4OZLA 2ZBRA 2ZH5A 3TVKA 1TAQA 2HMIB 1RK8A 3RYLA 1VK8A 1T9TA 4DEZA 1SQGA 1I5OB 3KXDA 5K5MA 1EETB 2B0GA 8ATCB 4D3HA 3R5BA 1HYSA 4A8SA 2LQ9A 4H4KC 2DR9A 4AYBD 2HQFA 1JLFB 3A8KA 2BRLA 5AXNA 1YLXA 2VBXA 2XY7A 2KT5A 4F0HA 1YI2S 4C3MA 3THVA 4GVLA 3NMAA 3DM2A 4E98A 2F65A 1IBMF 5K8OA 4NI2A 3MUVP 3KK3B 2XYPB 1SVDA 3ETMA 1IQZA 3ZNUA 3FGVA 2FVSA 3FMBA 2HAFA 3S1TA 2Z0GA 3WX8A 5J2QA 1OPIA 3MM6A 1EP4A 3HO1A 2JOQA 4MK9A 1C1BA 2OEMA 1R27B 5HMXA 4YOEA 1KHVA 4JYAF 1VDHA 3JTOA 1JXEA 3AXKA 3UI3A 5DRKA 4C0BA 2ZM6F 2NXNA 3A3OB 1E6YB 3MPVA 3RGIA 1HQEB 1PG5B 4ECXA 5A2QU 5M2PA 2QFJA 4FVMA 4A8OA 1RTIB 4CNYA 4NLQA 2MQPA 3FEZA 4B9LA 2IRXA 1IVZA 3L9ZA 2HYIB 2DCLA 3EZUA 2UXDJ 3A8EA 3DOKB 5IWAJ 4DV0F 4LVOP 3QSIA 3T5HA 3IAS9 2ZH7A 2LQBA 1R7IA 1M90T 2IY5B 1DTTA 2RF2B 3BQ0A 4A8MP 1EQ0A 4LMZA 5B0DA 1RADB 2IAJB 3PO5A 1APSA 1OY9A 1SCJB 3S6EA 1W7WA 4LRCA 3D1HA 3BKTA 1IM4A 1TK5A 2IA6A 3D1OA 2UP1A 1JX4A 2GV1A
chains in the Genus database with same CATH topology
4OHXA 5DJBA 3JB9k 4IRDA 2F40A 3SQGA 4TKTA 3V6HA 3RTVA 3MR3A 1R3NA 4RW9A 4FF2A 2AYMA 1MW7A 1UA1A 4Y2CA 2W4CA 2IHR1 1RT7B 3CD5A 5CHCB 1T95A 1W25A 2L3MA 1WACA 2M8HA 1HWJA 4X4VA 1NU4A 1T03A 4OJGA 2MHEA 5B0BA 1SI9A 1HR0F 3KKFA 1M0SA 4Y2KA 2FUG9 4DJBA 2J0XA 2CJAA 1PILA 1E6VA 2V8DA 2DNHA 4WZQA 4O4GB 2ASJA 5H9EJ 4EYHB 1VQ4S 2MDAA 4MYUA 5KFXA 1OQ3A 4NCBA 2KM8B 1VQPS 1SL2A 2ZC4A 2BE2A 5SZTA 4DS4A 3NL0A 4L72B 4RU2A 2VFTA 4XDCA 3JSRA 4W90B 1LW2B 2HQ3A 1TKZB 3IR6B 3O2IA 5B09A 1URNA 2ZZNA 3CCLS 2JC1A 2QO3A 5B7WA 4EBCA 3I4PA 4EBDA 4U67Q 3OTBA 5FDLB 3MFIA 4MIBA 4GKJF 3TARA 2HW3A 3UQSA 1I1GA 1HHTP 2NSCA 3RAQA 3CO9A 3RBEA 1C1CB 5J2PB 2G0CA 4A8KA 4NXNF 3L7PA 3HP6A 3GFZA 2DH7A 2V4JA 3J81Y 1UA0A 4O44A 3CCSS 3CC7S 3H2UB 4RW4B 1UFWA 4Y6IA 1R8BA 1N52B 2OFGX 3UDCA 4RW6B 5BYRA 2P9EA 4FXWA 2BM0A 2GQQA 1WF2A 3R1HA 4RNNA 2MKSA 3KLHB 3CD7A 2M5YA 2E5GA 5KFGA 3LWLA 4RW7A 1ROFA 3EUNA 1BC6A 3EZ5A 4O4RA 4IOBA 3Q24A 1NJIT 1UVIA 3PACA 5D78A 4B9UA 5I3PA 2XSJA 5EX3A 3BGUA 2DT9A 3OXGA 5THWA 4YR2A 3FZBA 3KK1A 4YMEA 2YKNB 3CD0A 3QLHB 4XPEA 3HHLD 3LP2A 3HXMA 4FN5A 3KK2A 3OLAA 3OFFA 2C3UA 2NYIA 5KT4A 1DZ5A 2K3IA 2AF6A 5KAKA 2KZZA 3VZHA 3RBDA 4PPDA 2MGZA 2UVVA 5HLFA 1NK9A 4F3OA 4UY85 2BUNA 1NKBA 1MNEA 4KO0B 4ELTA 2YNFB 1VRTB 3M6XA 2FLLA 2VZ9A 1TFYA 3MM8B 2JZ5A 3M2UB 2BRKA 4NLOA 1OIAA 4RW8A 3VAGA 1XR5A 1TL5A 3KNAA 4ZPDA 2L9NA 2LXFA 3C2PA 2RE1A 2GCFA 5T41A 3DLHA 2ZJRQ 1XNRF 2ACYA 2C42A 2ASYA 2Q79A 1BQXA 3ICLA 3GQCA 3O1LA 4DMZA 3EGZA 5GADU 3MM9A 1KONA 5D4OA 3V5RA 3OW2R 2RQCA 1QE1B 2N7CA 2DO4A 2HFNA 2JSXA 5KFQA 2E1CA 3J7ZT 3TANA 3V6KA 5B0CA 2NZ4A 3ITHA 2A10A 2FJAB 5DG9A 3HZEA 2W9AA 4GC7A 4K4XA 3OTEA 5HMZA 1JLGB 2R8IA 2KH9A 1KVJA 1FJ7A 4PG4A 2ZKUA 1V9OA 4I2PA 3C8YA 2DJWA 3LH2S 3N6NA 1UVMA 3LQVA 4WCEQ 2VQEF 4NXMF 3DN9A 5J1EA 1HYSB 5C42A 1JKHB 3KJVB 1U1QA 5IM0A 3OBIA 5CYJA 1L3VA 2C2RA 1BQMB 2NPIA 1BQNB 1WG1A 3TQ1A 5K14B 3WC2A 4WIIA 3QWUA 3AY0A 4JV0A 1TV6B 2U1AA 1AW0A 3FEYB 2HS3A 2X1GA 3Q8SB 1AUDA 3CPWR 1FRKA 3FZ2A 4F26A 2KYXA 3OUYA 4DL3A 2FVCA 3VQTA 1VC5A 3UR3C 5DDOC 4N77A 1Q81T 5KFWA 2JEJA 1YSJA 4TY9A 5HI7A 4Y65A 4A8WA 3DM2B 1IJEB 3PRBA 1FDAA 3GB0A 2LMIA 2HFOA 2PMZD 3IG1B 2ZHAA 4HH0A 1MMLA 1D1UA 3NCPA 1HHSA 2HHUA 2FC8A 2YKQA 2NUHA 4RUAA 4F3MA 4RNFA 4A8FA 4URGA 2EW9A 3RRGA 2YX7A 3CSKA 2VFUA 3WBZA 2DB1A 4DQRA 1IR0A 3K7RA 1X4BA 2VPWB 4GO5X 2ZE2A 4YUDA 4QYZJ 2CKWA 5F8IA 2EK6A 5DO2A 2UZAA 3OSNA 2Q66A 4IR1A 5KT3A 2D3ZA 5J2QB 3MHYA 3MM6B 3W2WA 1MWZA 1G1XA 5IT4A 1EP4B 5J2NB 4DN0A 1H38A 1IUJA 5HMYA 3ISNC 2VFVA 2YWKA 5KFBA 4YEAA 1KSPA 1C1BB 4YP3A 1S6UA 1VIXA 4K5RA 2ILYA 3G71S 4KKOA 2G1DA 3DMJB 5HN0A 3H25A 1R8CA 1FDNA 4FBUA 2B43A 1B0VA 5HBMB 4RWWA 4URQU 3MURP 1DLOB 4U7CA 3AJ2A 3SFGA 2R2RA 3M05A 4DLEA 2OP5A 3OTCA 2W9BA 3MF5A 2KFNA 2VH7A 2FHJD 2D3OR 4ETZA 3RAMA 5BR8F 2JLEA 2OPSB 1FCAA 1AFJA 3QIPB 5E7OB 1ZZFA 3VR1A 1NK6A 1XEZA 2RU9A 4ECQA 1U26A 1FO1A 2DIVA 3O44A 2DPIA 1U6ZA 2JX2A 2CVIA 4OMFG 3TVYA 1RT2A 5LXRA 4LF7F 4NX9A 5HMWA 2J0SD 2XMKA 4XDDA 3R1LA 3KTQA 2NR0A 3M2RA 4X2BA 2HGMA 2GFFA 4IO9Q 4C8MA 2M9KA 2ROGA 1YJNS 1SJQA 4ILLA 5KFRA 1WF1A 5EHHA 4X64F 2XCAA 3RB3A 4B9MA 3EPIA 4N8NA 2E5HA 3OVAA 1Z2ZA 3BN4A 4QWBA 2HHPA 3BR8A 3IC1A 2CQIA 3DLGA 1KS2A 3TAMA 4RBTA 1MSWD 4JI1F 3JSMB 3E01B 1C2PA 2ZOMA 3I31A 1S77D 1VQMS 5F9LA 1DTQA 4IH7A 1VQOS 1UVKA 1DHMA 2DRAA 3A1YG 1RKIA 2ZH4A 1TKTB 2FB0A 1Y3JA 4CO5A 1S6QA 4OZ5A 2VG6B 5KG5A 1HPZA 1N5TA 1S9GB 2FVQA 3UPFA 4ELUA 1WG4A 2FHKA 2PT0A 3ETOA 1SJ1A 5EX0A 3DC2A 2HLUA 1JJHA 3N01A 5SUHA 1DTTB 4F67A 1R8PA 2AGOA 1L5UA 2LDIA 3E3XA 3I4HX 1RGVA 3PKMA 2DPJA 4F50A 3M6VA 1N8RT 3CMAS 2VA2A 3DU6A 4ZP8A 2E9TA 2K2PA 3KYLA 4QCLA 4X84A 5KG1A 3CT9A 2OD4A 1SQEA 2MKKA 2XULA 1S0NA 2CPIA 1S1TB 3GSDA 4NL5A 1WG5A 3MUTP 2K1RB 3H2LA 2D9PA 5DGBA 2VPXB 3CCVS 3T5LA 3EXYA 4H4MB 5D8HB 1ZPVA 2BANA 2EBEA 3VAIA 3P6YC 1C0UB 1P1LA 3PEJA 2W8LA 4B9SA 3DYAA 3BB5A 3JSBA 3SCJE 1AROP 4WZMA 2RILA 4TYAA 3T3FA 1S10A 1YRUA 4Q0BA 3E2EA 1IKYA 4FXDA 4IQXA 5C24B 2UXDF 4QQBA 5KG2A 1R0AA 5IWAF 4B3OB 2EFQA 3FRYA 4QIWD 1KC8T 2J5AA 3RRKA 4QBUA 4Z2XA 1R31A 4XIUA 2VPYB 3TI0A 5L1LA 1S1VA 3CB4A 1RYSA 2EBGA 4C0OC 3SQGB 1IKWA 2UVRA 5JUMA 4ED6A 1FRHA 4KAIA 4RW9B 3LGNA 2HG4A 3T1HF 3GV8B 4TY8A 3CEDA 1TP7A 3N9UC 1SV5B 4X4RA 2A3JA 3DXBA 3BF4A 3J7YI 3GIKA 2DIUA 2UVWA 4BC7A 4J9LA 1T03B 2AV5A 2HS4A 2N82B 4X4OA 2ZOGA 4H4KA 1VBYA 5B0GA 2CJ9A 2ZDOA 3J80Y 2OSRA 1E6VB 1R8HA 2MJNA 3I82A 3VZIA 2DH9A 4ZP9A 5F8MA 5KFCA 3DLLQ 3LWMA 1UW4A 2B5JA 4Q2MA 3J7YU 1DJ0A 3VAJA 2LU2A 1U2RA 4DPOA 4E8UA 2BE2B 2C22A 4QWCA 3OFGA 5AJ3F 4TLQA 3CD6S 3EGNA 2D9OA 5JXSA 3H5YA 3V4MA 3B4MA 3U1NA 1UVJA 3MR2A 2AJ0A 1XERA 3N6LA 3TVZA 5DS7A 1FJGF 2LEBA 3HLUA 1DQ8A 4NLPA 1Q53A 2PSZA 1NJZA 3OPKA 3ISND 4QWAA 4FZVA 5B0EA 2BJEA 4PWDB 3C6UA 3ZFVA 3M30A 4MIWA 2KDOA 2J6SA 3G8TA 1NHVA 2V4JB 3V2UC 4Q8FA 2XWXA 2HQIA 2DNYA 4O44B 1U24A 4KJIA 2E5LF 1U1PA 3G6YA 2HVHA 3IN5A 4KHRA 3FMWA 5J1NA 1FXRA 5GMKa 2R8HA 1LWEA 2RS2A 1VJWA 3QAUA 4MMOA 3HVTA 1NAQA 1B64A 2ZITA 4Q5VA 4I7FA 3I5AA 2VFSA 3PVXA 1NJYA 2R8JA 2CPXA 4RW7B 4EBEA 1VRUA 1XR7A 1NHUA 4KB7A 2N3OA 4WKYA 2CJQA 1X8DA 2RRNA 1BD6A 4QIFA 3MXHP 2ZNZA 4R0EA 3TOQA 2QA4G 2MKJA 1Q4RA 1XWLA 2VD3A 4ZPCA 3MAQA 3EGWB 3N5FA 2XSJB 2YKAA 2KU7A 3W7BA 3MOJB 3KK1B 4NYOA 2PN6A 1RT5A 3LP2B 5IT0A 5HROA 5L38A 3JTNA 3KK2B 1GXTA 1Q8BA 1KNZA 2RMLA 4K2XA 4MKBA 1FRXA 2DNQA 3G8QA 1RT6A 1TZ0A 3RR8A 4WE1A 1N32F 3BO4A 2FY1A 2MGZB 4WU3A 2GIRA 5HLFB 4I67A 3NAIA 2Z2LA 4I68A 4IG3A 4O0IA 3NCQA 3NGKA 2W9CA 3VQSA 3TYTA 2XY6A 3MDFA 4JI2F 2J6TA 5KOWA 1RT1A 3B82A 1TK0A 5CXTA 4C8ZA 4RW8B 2XI2A 4DWIA 3TX8A 1UAWA 3U27A 1TUVA 4DR6F 1HWIA 1RKJA 3HHLA 4QJVA 1PGZA 2J9CA 2WBRA 5DQHA 2XMVA 3QIDA 4PQUA 4D3GA 2NQPA 1VLYA 3MM9B 1CLFA 1VFJA 2P5VA 4V19X 2AGPA 2HZCA 3I9V9 5BJRA 2KYZA 3M8QA 4Y2MA 4Y28C 2XB2D 3TO8A 2NLWA 1SUQA 3ITHB 4MFBB 3MMCA 4HT5A 1J5OA 3RR7A 4M5DA 5KFJA 1J2VA 2M0GB 5KFOA 4KHMA 4URSA 4DF4A 3F44A 5F8JA 4IG0A 3PW4A 4C11A 1OSCA 4I2PB 4ERDA 2KVIA 1RT3B 5DG8A 3M2VA 2HWTA 3T1YF 2FHMA 1SKSA 3KHGA 3DNCA 1WTFA 3CJ2A 1X5PA 3WC0A 5J1EB 1JWWA 3CGIA 2HWIA 1KTVA 2LQJA 5GAEI 5C42B 5T7LA 5FJ4A 1VQ6S 5IM0B 5F8HA 2W7PA 1WHVA 4AE5A 3DI6B 4H4OA 4WFBQ 3UNGC 2R8KA 3DGPA 4WFNQ 4YR3A 3BO3A 5DDQC 1Q82T 4ZCLA 2XS2A 3K5OA 4BWMA 1LXJA 2RRBA 3VCDA 4MK7A 2GX8A 1FD8A 1FXLA 2XS7A 2DISA 4YB6A 3US5A 2DO0A 2ZZMA 4EWTA 1KLMA 2X1AA 3OUYB 3S01A 1UJ6A 3FRZA 4WF9Q 4KPYA 3KLIA 4J9PA 4ICLA 2ZH9A 1JJ2R 2DGWA 1Q78A 1F5AA 3CDAA 2G13A 5CYMA 4KTQA 1ZM3A 3MPWA 3X1LB 2GHPA 2R7OA 3TAPA 2VPZB 1QM9A 1FEHA 3MI7X 4U7UK 3IRWP 3SYZA 1AFIA 2DRBA 1B7FA 1SB6A 4MYTA 4PWUA 1OO0B 1DBDA 3QIPA 4C8LA 1XTZA 4PWDA 2YKOA 4K4SA 1HI8A 4QW9A 4UQGA 2HNYA 4IFVA 1JJ4A 1OQ6A 3OSPA 2E66A 4DFJA 2GMJA 2PA3A 4U6PA 2QSFA 4X4SA 4R5PA 2NREA 4G6VB 2R7TA 3MMBA 3CDWA 1RA6A 1NRKA 1QVFR 3AJ1A 1ZM9A 4N41A 3W2WB 4DL4A 3NS6A 3F41A 4NCGA 5FLXY 2BACA 2UV8A 4DQQA 3SMZA 1IXKA 4IOAQ 1QAYA 4ED2A 5AXLA 2VB6A 4Q8EA 4KKOB 1FNXH 5I3UA 1HBUA 4NMLA 4OJ3A 2OAUA 1V3ZA 4PG8A 1KOOA 2FVPA 1N5YA 1PC4A 3D2WA 2W9BB 1Y7PA 2FJBB 3BR9A 5L39A 3SI8A 4BC9A 2RB7A 2DH8A 4TYBA 5C5JA 2FHOB 1F5CA 3ZZ0A 1VI7A 1S4FA 4ZVEA 4OX6A 4USIA 1UP1A