3KNGA

Crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, determined to 1.9 resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
98
structure length
98
Chain Sequence
ADEVTFVNRFTVHGAPAEFESVFARTAAFFARQPGFVRHTLLRERDKDNSYVNIAVWTDHDAFRRALAQPGFLPHATALRALSTSEHGLFTARQTLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SnoaB
publication title Crystal structure of the cofactor-independent monooxygenase SnoaB from Streptomyces nogalater: implications for the reaction mechanism
pubmed doi rcsb
source organism Streptomyces nogalater
molecule tags Oxidoreductase
total genus 26
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature ec 1.13.12.22: Deoxynogalonate monooxygenase.
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kngA00
3VTIA 1OPZA 2OFGX 1TR0A 4OJHA 4Y2MA 1Y3JA 1JWWA 2OD4A 3BGUA 2BJEA 2PD1A 5F0WA 1YRXA 4DN9A 1Q53A 1QUPA 1TL5A 2K2PA 2RILA 1K0VA 4FNIA 1SB6A 2ZDPA 5IXUA 2W4PA 2K1RB 2GCFA 2OAUA 4HI1A 5B0BA 3BF4A 3KNGA 5B0DA 4FNHA 1Y3KA 2BUNA 2N7YA 2OD6A 3MCSA 4ZOSA 1X7VA 2G9OA 3HDSA 3KKFA 4EFAC 1SI9A 1S6UA 1KVIA 2N4CA 2OP5A 1JK9B 2FHMA 2HQIA 1IUJA 2W4CA 2RSQA 5T7LB 1VQSA 2ROEA 4OIXA 4U9RA 2HIQA 3F44A 5K9FA 5B09A 1U7LA 1W2IA 1FE4A 2IYIA 1AFJA 1Y0HA 2XMJA 5B0GA 2KT2A 2PGCA 2XMTA 4HH0A 3TNVA 1TL4A 2L3MA 2ROGA 3K7RA 2FIUA 1YJVA 1P8GA 3HX9A 5KAKA 4HH1A 2BYCA 2FB0A 4YEAA 2N4DA 2XMKA 3TRGA 1GXTA 1YG0A 2K1RA 2BJDA 1FEEA 2IYGA 2ROPA 2XMUA 3UDCA 3GZ7A 4Q2LA 1TUVA 3IWXA 4A47A 2LXFA 4A48A 2CRLA 3I9ZA 1SQEA 2ACYA 3WDOA 2VV5A 3IWLA 4Y2KA 2HFNA 2KKHA 1OQ3A 4Y2IA 2KT3A 1APSA 1CC8A 3BR8A 1X8DA 1R6YA 1YJRA 1YJTA 3FRYA 3HHLB 1V3ZA 2LQBA 5B0EA 2KYZA 3KG1A 2W4DA 4F67A 2VH7A 5F0UA 1FESA 1WD6A 2FTRA 3E8OA 2AP6A 1Q8LA 5B0FA 2AJ1A 1S6OA 4HI2A 4OJ1A 4NL5A 5A6WA 1VQYA 1AFIA 4Q2MA 3T9NA 5B0CA 4QOTA 3BM7A 3KG0A 4HL9A 2HFOA 1OSDA 2QLWA 1N5VA 1N5QA 1URRA 3QGPA 2ZDOA 2GFFA 1MWYA 3FGVA 1FVQA 2EW9A 2XMVA 2RMLA 1YJUA 4NPOA 3HHLC 2JDJA 1KQKA 2IFXA 1X0PA 3FMBA 4OJ3A 2OMOA 4ZA1A 5T7LA 2OKQA 2BBEA 2GA7A 3CJKB 3MZIA 2GGPB 1N5SA 4YDXA 1TZ0A 1Q8BA 2LDIA 2OFHX 4A46A 1MWZA 2HLUA 3DXSX 1AW0A 1CPZA 2QLXA 1ULRA 2K7KA 1FD8A 3LO3A 5B08A 1LQ9A 2LQ9A 1OQ6A 3BB5A 1CC7A 3TOQA 2QIFA 4DPOA 4DL0C 2XMWA 2GV1A 3HFKA 1P6TA 1N5TA 1XBWA 2GO8A 1FVSA 2AJ0A 1FE0A 1GXUA 2XMMA 3HHLD 1RJJA 3LGNA 3QMQA 3BDEA 4OJGA 3BN7A 3LGMA 2AW0A 1Q4RA 1Y9OA 2HLTA 2GGPA 3HHLA 3CJKA 4A4JA 5A6PA 1KVJA 2ASYA 3DCAA 2K7JA 3HF5A 2QYCA 2Q3PA 5B0AA 2RU9A
chains in the Genus database with same CATH superfamily
1NLKL 2MQOA 2YWWA 3KLFB 5IXUA 3W65A 4G1QB 4XAKA 1JLQB 1PAEX 1RUSA 5F8GA 2E1PA 4OX9F 2H5JB 4MMOA 4F7VA 3TNVA 5IM0B 3HX9A 4RNNA 1JLBB 2DTJA 1NO8A 5GMDA 2EEYA 1EZZB 4P52A 3M8YA 2C2EA 1JLFB 1WC5A 1WC0A 4JYAJ 2B4VA 2O67A 4CLUA 2YBVA 3ZZUA 5A6WA 1PKUA 3MAQA 4URSA 1YHQS 1DTTA 3R5GA 5IC6B 4EO8A 4J9RA 2RRAA 5KFLA 5JVGQ 2HQGA 3OJSA 4CCHA 4WE1A 5H9EK 4X4UA 2EKYA 3T41A 4OV6A 4ZJLA 3R2DJ 4GVLA 4TYAA 2QSFA 2VOPA 2ZH4A 4LRDA 2NZ4A 1LKZA 3MI7X 1QE1A 3LP2A 1QTNB 2QYCA 4LR7A 1CS4A 1Y3JA 2OHDA 2D74B 2PE8A 2BV3A 3GJQB 3U1MA 4A8KA 4DCJB 4W98A 4K8RA 3JSMB 3MEGA 2FHJD 1OY8A 3OL7A 1IBLF 2OPPB 4X4NA 2MTLA 2DNGA 3H2UB 3ZZ0A 4PABA 2XMKA 1S57A 1UP1A 5AJ3J 2LXFA 3MD3A 3RG6A 5I3PA 1SQEA 2M5YA 5HJXA 1S12A 4LFBF 3H98A 3MPYA 2J6UA 4EBCA 2LQBA 4HVZA 5J2PB 5FLXY 5IT4A 1MG7A 5KFZA 1DARA 2EW9A 3V6KA 1TELA 1H2UX 5DZ7A 4CT9A 2VPZB 4M1KA 5CD4H 1Q8IA 5E33A 3CUNA 3M2UB 2M8DB 1FI4A 4FF1A 4DL0C 1U6ZA 2V63A 3SMZA 2HHWA 2KT5A 2L08A 4JV1A 4DSJA 3NNAA 2OMLA 4C7QA 2JX2A 1SH3A 1UPMB 1NRKA 1LW0B 2QL5B 3B4DA 2XS7A 1F3FA 1N52B 3FMWA 1H2TZ 1F9HA 2DD8S 3DHXA 2VZ9A 1TL4A 4ELVA 2V8GA 2BJDA 1FEEA 2CVIA 1UA0A 1HD0A 5I3UA 2BJ3A 4DL5A 1F5BA 5IQ6A 2XSFA 1L3UA 2YWGA 1HBMB 4XIUA 4KE5A 3F56A 4ZVQB 4AQYF 2MY7A 5KFRA 3NMAA 3ZNJ1 2KL8A 3BEGB 2DHAA 3ILOA 3VAHA 1KOOA 1D0EA 1WTBA 1ZAWA 2RNEA 3HO1A 1WKJA 4DUZF 4H54A 3NMRA 4NASA 1U1LA 3AFGA 1K8AT 1S4FA 4LF8J 3BH7B 1N32F 2M9KA 1ACMB 4PWUA 2IAJB 1R31A 4F4WA 4PWDA 1SB6A 5IS2A 4WCEQ 2QL9B 2BMBA 2G9OA 4PRFA 3C46A 1XN9A 1WSVA 1TUWA 3NCRA 4ZIVA 5H9EJ 2QMXA 2V0NA 1QLNA 4JI1J 3N9UC 4Y65A 1VRTA 2J9EA 3PFEA 3T1YJ 4KC5A 1UETA 2YY3A 2Y1LB 2D3O1 5AXKA 3MCNA 1BQNA 3MM8A 1NPRA 4U95A 2E7WA 4WXOA 3FBFA 4ECSA 2B43A 4P6QA 2ZD1A 4DZDA 2ZUAA 4WFZA 1H98A 3ILIA 2DT9A 2MKKA 3FQKA 2FYXA 3KLIA 4F0MA 2R8IA 2E5JA 3GG0A 1SC1B 4OX8A 2PMHA 1WKKA 4K0KF 1OMSA 5IV4A 4Q45A 4JI4F 3OUYA 4E8UA 5HO4A 4C8ZA 4IG0A 4A8FA 3DLEA 1BGXT 1BLUA 2DNZA 4UOCA 3MM7A 2HQCA 3VVTA 1HBUB 5C42B 2GAHC 1FNOA 5KFBA 2HQIA 4DSKA 4F2RA 1N56A 3RBXA 1FE4A 2V4RA 1VHIA 3NP5A 4JYAF 2FB0A 4IFYA 4C6AA 1DTQA 4QW8A 4P73A 1K47A 4AD6A 4K5SA 4V1Ak 4ALZA 3SSSA 1S6PA 2J5AA 5B0FA 2XZWA 1S6OA 1TV6A 4Y0FA 2EPIA 3BPSP 2PIIA 2ZKTA 4RW9B 1VQ7S 1HNIB 2R7OA 5HL7Q 4PXBA 4FF4A 1KVKA 3OSPA 2OLWA 3OLAA 2EBEA 4ECWA 1RHRB 3HHLD 1HPZB 4MKYA 2UVWA 1J5OB 1BMQB 1BXNA 2JC1A 2CQPA 2O3DA 3WZ0A 5AE3A 2WB1D 3D4JA 1VK8A 1NJZA 4LF1A 5AJ3F 5KFOA 2QA4S 4PXCA 4USVA 5EX0A 4N7TA 1KRPA 5F3TA 1EKSA 1YITS 2IIHA 1VJWA 1RTJB 2VKZG 4C8MA 2XG8A 5D0EA 3O8WA 1X5OA 4F36A 4B3MJ 1CVJA 2ZBIA 1VCTA 4UUXA 1Y4ZB 3G6ES 1WI8A 1YVFA 3JS9A 3H40A 4OIXA 1U47A 1HWIA 2XNQA 3OVSA 4H4KC 4DL4A 2R2UA 4J7CA 4CDIA 5U47A 4GMKA 4PXEA 4J9PA 2HNYA 5IOLA 3ISNC 3DLLQ 1P6TA 3VZHA 3KK3B 1FE0A 1BHNA 3HVWA 1HQEA 1S4EA 5J1PA 1WHYA 1S1VA 2OD4A 3K17A 4PEOA 2J7UA 4ZPAA 1RISA 2L9NA 2KJVA 1X5PA 2AYEA 2C2KB 1S9GB 3UO0A 3SYZA 1UVMA 4A8YA 3TQEA 5E3QA 2BJ1A 2ZH7A 5L1LA 1KLMA 4EU0A 1ZTWA 2ZE2A 5L8RC 1SJQA 3BGOP 5KT3A 1NJIT 1TAQA 2XULA 2VC0A 1NXIA 1M90T 1A9NB 1UEVA 3FEZA 3BH6B 5J2MA 2CQCA 4OZ2A 4RBUA 1RABB 1F5CA 2CJXB 4WWSA 1RTDB 1U49A 2IMWP 2GO9A 3G86A 1K9MT 4ELUA 4PG5A 1N6QB 4LF8F 2VFRA 3RTVA 5C24A 1D8ZA 1IM4A 3Q8QB 4TN2A 1JLCA 4XTTA 2YPZA 3GIKA 2AZ3A 4WP8A 1SBRA 2G0JA 5KOWA 4ZPCA 1UFKA 3KLEA 1NMEB 1IBMJ 2UV8G 2D7SA 2J0XA 4JI1F 3DLGB 4HI1A 1VMBA 2HQ3A 1KBRA 3PJWA 3K0JA 3T1YF 5D15A 5DRKA 1BY9A 4J9MA 2GMHA 1H7WA 3M6VA 2LA6A 5LSOA 2GMJA 1MU2B 3AY0A 3K7RA 5HSPA 2ZBCA 1U4BA 1NJXA 1NHUA 3C66A 1SCJB 5M2PA 4L76A 3KOAA 3M30B 3TVYA 5DM6Q 3SCIE 1X4BA 4OHXA 1RTHA 4I67A 3CB4A 1REVB 5A0YB 4J91A 5J1EB 3QAEA 3EZ5A 2HWIA 3I5CA 3LQVA 4PXDA 1C0UA 3FGVA 3FVYA 3A12A 2BJ9A 2CJ9A 2DY9A 1PJ6A 1TL7B 2VQFJ 4CO4A 2XBPA 2K7KA 2NLWA 4PPDA 2A0FB 3I6PA 3KJQB 2FC8A 1SPBP 1FJ7A 4Y2AA 4PQUA 5HVFA 2AYBA 4ICLA 3B54A 3BN7A 1NJWA 2LFVA 4LIWA 1Z1ZA 3I0SA 1CJUA 1AZSA 2V34A 2ZC3A 2XNRA 2FHOB 1KVIA 2N4CA 3ENWA 5DS7A 2BE7D 3MMBA 1NNDA 4RZRA 2HZVA 4HH0A 3PIPQ 1RAAB 3QBCA 4J9VA 2CPYA 2QMWA 4DV7J 3I9ZA 3LAKA 2WRMA 2DNMA 5A8WA 3CEDA 3KHLA 4E0DA 1EX8A 2EK6A 5F0UA 2VKRA 4N47A 5DG9A 4F50A 3DRRA 1BC6A 3DOLB 1NK9A 4CO0A 1FWPA 3ZZZA 4DV1J 1Q81T 4KTQA 1ZAVA 4X65J 2LP4A 3N01A 2AMCB 5DQGA 3BYRA 4RUCA 2DGOA 4Z2XA 3R6LB 2XWYA 3HFKA 4Q0BB 1O0PA 2EFOA 1X0FA 3SI8A 3V4IB 2E7VA 3BDEA 2IY5B 1Q4RA 2X51A 2E29A 4IG3B 3KXDA 1R27B 5JMNA 4YDDB 3CCLS 4LF5F 1SI9A 3M7VA 3OHAA 1MMLA 1AFJA 4V19J 2KT2A 1WDTA 1B7YB 3TZYA 3HD1A 1PO6A 4LF7J 4QIGA 2OEMA 2YPYA 1MROB 1N88A 2NR0A 4HI2A 4OJ1A 1RT1B 3IBWA 2G0CA 3OL9A 2Q66A 3TEHB 7AT1B 2YNGB 4ED3A 4CNZA 3C19A 4ZMMA 3BV8A 4EGLA 1M5SA 3WIUA 4A46A 2VICA 2BVZA 2MZJA 1IKXA 4O0IA 2FC9A 4X64F 1NSPA 3LTOA 3V6DA 2EBGA 3UDEA 5KFEA 2UXBJ 3NG8A 2K7JA 1RBOB 4ZCKA 2XCAA 1WC6A 5B0DA 5LSLA 4CTAB 4M95A 3N79A 1RCOB 5AT1B 1PJ7A 4FF3A 1IUJA 2YKMA 4WXWA 4KPCA 3M2RB 1UVIA 2R7SA 2PFFB 3Q8PB 2JLEA 3PCOB 1R8CA 3G87A 1HMVA 1VHFA 4C9DA 2VV5A 5E2QA 2WTFA 2MB0B 2LA4A 4WFBQ 4KGKA 1X60A 4MIBA 5HMXA 2HHQA 5KFVA 1PILA 5EX3A 5ETKA 3CT9A 2CA9A 2V8PA 3NBPB 5DDRC 5FJ4A 5IV3A 2ABYA 4NPOA 1OJ4A 2HIYA 3MM6B 1F5AA 4CWBA 3CJKB 4UQGA 1CJTB 1UFWA 2CPHA 1PC4A 1IBMF 3C15B 1R3NA 2KHDA 2CPXA 3AD9C 3OTDA 4CO1A 1AA1B 3UE2A 2MQQA 3H25A 3NAIA 4BWMA 3RB3A 4CLZA 3BGFA 1X4CA 1F2HA 4QIWD 1N34J 3IS9A 2W4CA 1N33J 3MECA 1A6LA 4U8YA 3CD7A 1NK7A 1VQ9S 1YRUA 2IDLA 3FDSA 3W63A 2XLIA 2XMAA 4NLDA 3MUVP 1U8SA 2QX0A 3OTBA 3CDEA 3DMJA 2ZOGA 1JMTA 3IBCB 4RKUC 5D4NA 2VQFF 4RNMA 1RXOB 2CQBA 4F3MA 3C6TB 1S9FA 2YH0A 1UA1A 3WQPA 4XK8C 1TFWA 4PQAA 3W3SA 3CXCR 5IT9U 4ED7A 2BE2B 3GV7B 2AGQA 1EAYC 2PFDA 1B0TA 2BZ2A 4RW7A 4OI1A 3SXLA 3GILA 3NNCA 2GGPA 3OPKA 4A48A 3MEDB 1PBUA 1QUPA 2MQMA 1H7XA 5KFSA 3DI6B 4RL1A 2ASDA 4DV7F 3UPFA 4OL8A 2ZBQA 2E5HA 1T02A 2ROGA 4AYBD 3PYFA 2Y1JA 3CCRS 1FKPA 3UDCA 2ACMA 3G8QA 2HAFA 3VQSA 3KWMA 1PJ5A 4KY3A 2IC3A 2VG6B 1HWJA 3VV2B 2EFVA 1S9EB 3M2VB 4DV1F 4C0OC 5CYMB 4X65F 4DV4J 4YOEA 3THPA 1GX6A 5E3AA 4RNHA 1HNVB 1TVRB 5KFYA 1S0VA 4DV3J 1PYOB 2XM3A 2BX6A 3U7JA 3GYXB 2M2BA 5KFHA 1MNEA 4ECVA 2MJUA 2XI2A 3GCXP 3N28A 4L72B 2LEAA 2AJ4A 1K44A 4XO0A 5HLFB 4RLEA 5SUHA 1IQTA 3CJ3A 4ZVHA 2RE1A 3D67A 3PKYA 4B9SA 3RAXA 1ZM4A 2UXCJ 5L1IA 1JXVA 1VBKA 3PRDA 3W5YA 2PN6A 2FHMA 1U0HB 3HHKA 4X66F 5T7LB 1UEKA 3D6HB 4LF7F 4DG1A 2L3MA 4L75A 1YZ6A 2YNFA 1GXTA 2DJWA 2NSCA 3PYEA 4NXMF 3TAQA 2I5JB 4C98A 1WOOA 1T03A 3GMGA 2YQ1A 2RRNA 1HNZF 5B0EA 3CIMA 4C0BA 2HBRB 3H59A 1L3KA 4QR2A 1HBUA 2HG4A 3FCHA 5JXSA 5K8OA 4NXNJ 4KFBB 2BJ7A 1O5JA 1EHWA 2UXBF 3Q8SB 1YIJS 1VQPS 4HTJA 4NCGA 3TOQA 1RT3B 4LF6J 3DLHA 2F4VJ 3DGPA 1HR0J 2MZTA 4ILLA 4EYIB 2W8KA 4DPTA 1X4FA 2DB1A 1H3DA 2MJNA 2N82B 3DYAB 2RKIA 4QPTA 1YWXA 4JI3J 5LJ5Y 2CQGA 3GFXA 2OUGA 1VFJA 1SV5A 4F4KA 2YKNA 4KR0B 1HBOB 1TMMA 3TJ8A 3TUPA 5KFKA 1S5ZA 2IA6A 1HPZA 1U0SA 1FT8A 3QYYA 4Q7AA 3CCSS 1J5OA 1KQSR 1X4DA 3DDIA 4HKQA 4OZ0A 4CLPA 2EC2A 1SC3B 3HSJA 4UOHA 5L38A 4OJ3A 2KXHA 2Z2YB 2H4WB 3GONA 4USJC 5DGAA 5B08A 5F9NA 3PO5A 3K57A 3W62A 1B0VA 3AQPA 2XI3A 3CMES 2NUUG 1N34F 4YY3J 1DJ0A 2WONA 3HSZA 4QBUA 4HLBA 2Z2LA 2J7KA 4H4KA 1N33F 2B5JA 2APOA 4NI2B 3D68A 3OD2A 1HNWJ 3MMAA 3PTWA 1FK9B 3DGVA 1FXLA 5KFWA 2CPDA 2OI2A 1S48A 3OTCA 2DGXA 4H4MB 4A8SA 2DNPA 5D4LA 2B7BB 2QYGA 2JEFA 1YTYA 5ETRA 1JLEB 4NLYA 1FFWB 3A8EA 2CNLB 1WWHA 2W2QP 3BKFA 4ELTA 3DM2B 1S0NA 4ZJQA 3KG0A 4O3OA 3UFCX 4YB7A 3J81Y 2L41A 4V19X 2Y3YA 3M9NB 4C4WA 2IVMA 5K14A 3O5TB 1FRKA 3HKWA 4PG8A 2VBWA 2KXFA 3CC7S 1HYSB 4WYWA 3ULHA 1OWXA 3R8YA 4U8VA 1VC6A 3KK1B 3VGSA 3EPGA 2HVIA 5KG0A 3BF4A 3OSNA 1F2GA 1JNZB 2VJUA 4KV8B 1S97A 3HSDA 2G4BA 3GQCA 2LQ8A 5DDQC 1RACB 2W2OP 1N6QA 2FLOA 4JI8F 4G65A 4IR9A 3W2WB 1TL1A 1RBAA 1QUVA 5DM7Q 1UW4A 3H5SA 4LF2A 4FVCA 4N8NA 2M70A 3RU0A 3BR8A 3TW0A 4DV3F 4N41A 5A2QU 4X4TA 3SCJE 1OYDA 2AYMA 3IG1B 4UOGA 1BQMA 1WEYA 3NGRA 2LXIA 5DDOC 2HGMA 1VK3A 3KLGA 1I6JA 2ZWOA 3GSIA 4IOCQ 3LANA 1N36J 1GMVA 2JL9A 2ATCB 3DRPB 3GCWP 4Q5VA 1R0AB 3D1OA 3UVJB 4FYWB 3FSXA 3MD1A 1CJKA 2GZOA 2BOAA 3G71S 3M30A 2UXCF 2XGPA 2L48A 2FHJA 1REVA 2AKWB 5A0YA 2V9KA 4C8NA 3G4SS 3KLHB 3J81j 2B7CB 5KFNA 1MW7A 5HN0A 4KO0B 1NPPA 1N48A 4DLGA 5F8LA 1FJGF 2GCFA 3RYLA 2W9CA 2X7IA 3HLUA 1FKOB 1I5OB 4CT8A 1YSJA 2VG7B 5M2UA 1S1UB 1T94A 2BABA 3ET6A 1CULB 4LSLB 2FGCA 4FKYA 4YEAA 5E3RA 2GS8A 2OO4A 3MR5A 2CWKA 1R43A 5SZTA 1GT8A 1X5TA 2SXLA 1RA6A 3GFZA 3HI9A 2KXNB 3KG1A 4NXNF 2KU7A 1F0XA 3IRXA 3PHEA 4OX7A 4LSNB 1EIYB 2HYIB 1R8BA 5HP1B 3HVTA 5LOQA 2F4VF 4CLSA 2BM0A 1HR0F 2BEFA 4W90B 2AT1B 1TZ0A 4DPXA 4GO5X 1LWCA 3UDLA 5D3GA 3M8RA 2NZCA 3Q89A 3JXOA 5FDLB 5A8RA 3OR1B 2HW3A 3ZTOA 1IJEB 1OO0B 3CCUS 1VISA 4JI3F 4CH0S 1R7IA 5F8JA 2EVZA 3E3XA 3KG4A 1RT6A 2IVYA 1K0VA 5IC4B 1ZM3A 2AQ4A 1NPKA 2ZZNA 4C0HA 8RUCA 4K4WA 3IGNA 3OTEA 3AOBA 3BSCA 4I4BA 2YTCA 2HGLA 2BOPA 4MKVA 4I68A 3WBZA 4PR6A 3I0RA 4B02A 1S79A 2ATLA 4M5LA 3DLBA 3CJTA 2VPYB 3V4IA 4WFXA 3VZIA 2LMIA 5LXRA 4IFVB 3DC2A 3SQGB 4M5DA 2ZWPA 3EGNA 2UUWA 4IR1A 2B4PA 2DNOA 3A3NB 2AWZA 2O1PA 2V94A 4BC9A 2HBYB 2CQ2A 3CMQA 3Q2TC 2RDIA 1LWEA 2V68A 4RW4B 2E5LJ 1RSCA 4YY3F 4GKKJ 5JUMA 4O3PA 2GVDA 4U96A 4I6AA 1M0SA 4DFKA 3QIPB 2RUGA 1RJJA 3LF0A 2EI5A 3ZZPA 1MROA 2PEBA 2KB2A 2MHEA 1ZZFA 4KHRA 1LWFB 4RU2A 1AT1B 2HNZB 4F4YA 1SUQB 1WHVA 1RT2B 5KG1A 2VOOA 4MJKA 4JP8A 3ETMA 1U8WA 4J9KA 1YJVA 5LXYA 5I42A 4J9QA 4C3KA 3PDNA 4ZLNA 3KJFB 4F26A 3AB2B 3LAMA 4LRCA 3HPOA 2RUSA 5F3ZA 2E7XA 3B78A 2Z8QA 3OR2B 1EKRA 4DPUA 1YJRA 1KOHA 1D9FA 2ADBA 4WFYA 1RLCL 2JC0A 5B0CA 4FYXB 1R6VA 2WZ1A 4K7QA 2DY1A 4ZPDA 4LQ9A 3L09A 2HFSA 4IO1A 2B6AA 3QGHA 2DGWA 4RBVA 4CM2A 3CE8A 1PIEA 3S1TA 1AB8A 5EUHA 1I1GA 1SXLA 5E3CA 4QYZK 3PX0A 4W92B 5J1NA 3KUHA 4FYVB 2UXDJ 2HRYA 2A6OA 4WPAA 1GK8A 3OXFA 2NXUA 3BBBA 5F8NA 1U25A 3A8IA 1FTCA 2RF2A 3UD5A 1F3VA 4EMDA 1IJFB 3JSYA 3R2CJ 1HHQA 3IN5A 2ZH8A 3BGRB 3NLCA 5H1SV 3UD3P 2D41A 1CJVA 4PUOB 1IR2A 4WKYA 3P45B 1QM9A 3HHEA 3G8TA 2R7QA 2OPSA 3DDNA 5ETNA 2QZ8A 1IKWB 2F5GA 5GADU 1FDAA 3AQOA 3SZ2A 4ITSA 1JLAA 2KYZA 3VAKA 2DH7A 3H7HB 1I94J 3R5AA 3CC2S 2QO3A 4P2XA 5JVHQ 2QLWA 2QSWA 1RHQB 4JI5F 4CNYA 2F8MA 1MMDA 2R8HA 1BWEA 1RP5A 3LW5C 3GR0A 2D1CA 2HRTA 3ICLA 2XHCA 4KHPJ 3CCMS 2BA9A 1U09A 3D1HA 2CJQA 2OPQA 4O23A 5KFQA 2CYYA 2W9BB 2MGZB 3LGMA 2YWKA 1B99A 2FZKB 3W2VA 3T3FA 2ZH6A 5G0RB 1E6VA 4NX9A 4NEZA 4EFAC 2HKEA 1P9QC 3PJ9A 3DKDA 3R5BA 3BO2A 1M5HA 4OYZA 2K1RA 5KG2A 2BE2A 3N6LA 1IWAA 1GMUA 5MLCV 1G7CB 1URNA 2KKHA 1RAHB 2V69A 3K8VA 1RAFB 1CC8A 4QJVA 5KFDA 3W7BA 1UL3A 4LRAA 3G9CA 4JV2A 2Q43A 3MEDA 4I2PA 2FQQB 1WNEA 4OYIA 4Y00A 3J7AN 4B3RJ 2V8HA 4RBTA 3LP0B 2YQ3A 3K5NA 4O3RA 1WJ9A 5FIIA 3DI6A 4R5PB 3X3UA 4NZ7A 3L7PA 2XB2D 4JI0F 3FCVA 2XC9A 2HHUA 3POTB 1U02A 4B9UA 3A4TA 1XR7A 2HS4A 1LFWA 4CZCA 1GX5A 1CEZA 4MFBB 2ALYB 2RMLA 1HI1A 2LKZA 2D3ZA 1H73A 3AXKA 3OBIA 4EZ9A 3GWCA 3MUTP 1RWXB 1XR5A 1XMQJ 2HBQB 5DG8A 2UUBJ 4JV0A 4P10A 1X9SA 3CWJA 2DNRA 4KIAA 4FYDA 3ISZA 1T11A 1U26A 5L1JA 6AT1B 4OI3A 1OSCA 3BS9A 5E5NA 3TA2A 1FX4A 2FJDB 4ANCA 4BDPA 2YQ0A 4JBCA 4ZDNA 2QV6A 2DXEA 4C3LA 1G1XA 4GKKF 2CJYB 4Q2MA 2CDQA 2XS2A 1FKAF 2UUTA 3SEOA 2F9JA 1QVGR 5EGYA 4XPCA 5T7LA 2Q6CA 3PW5A 3RR7A 1WUUA 2F3JA 1LW2A 4DPOA 2ZM6J 3QZ8A 1VQ4S 3IA0A 2Z58B 2AEJA 3QT7A 4NOHA 5KT5A 5HBMB 1WF1A 3W61A 2KO1A 4K5RA 2PA3A 2CIMA 2W7OA 4DZ6A 3VGTA 4UW2A 1KQGB 1NKCA 3K5LA 4UQTA 5MAOA 4EK2A 4X2BA 4B3OA 4KFBA 2F40A 4JI6J 4FXVA 3Q23A 4OZ3A 4J37A 2BYCA 4YUDA 1RT3A 2YNIA 1RTIA 3AJ2A 3PFOA 1SL1A 3AOCA 1FRIA 1RT4A 4Y2KA 4LBIA 2Y1IA 1EP4A 3D6TB 4NYPA 1UWBB 1X8DA 2UP1A 2NSBA 2ZOMA 1H6KX 3SFUA 4FN5A 3GSDA 1NDCA 2D69A 2LLZA 1KC8T 3NS6A 2UXDF 4O3QA 3M8WA 3CCJS 1FD8A 1WSRA 4P75A 4WK1A 3F41A 4DI6A 3NEKA 5DQHA 1JLGB 3QRPA 3NOCA 3TZWA 4X4RA 1HQUB 3QSYB 2QG9B 3A3PB 5KT7A 2ASYA 2PA8D 1TR0A 4EZ6A 3C8YA 4FDFA 4IDKB 1RHJB 5JJBA 1MWQA 3O2IA 3JQJA 2BANA 5ETLA 4DL2A 3CJSA 3MCMA 2DRDA 4WJBA 1ZETA 1FXRA 3JQMA 1FERA 3P6YC 2HHTA 1Y5IB 2DNHA 1I94F 1T9UA 2POKA 4QCLA 4HTIA 4DV6F 2JEIA 1J2VA 3N5FA 3Q24A 2V6AA 5HK4A 4ID5B 3DXBA 4FXWA 1S1TB 3Q2SC 1OS5A 1C1BA 2QMUB 3HM9A 1RK8A 5HJYA 4KHPF 2W2PP 4CI0B 2OMOA 2ADCA 3MEEB 4DR3J 2HK3A 4F8RA 4U6PA 2DH9A 3FEYB 5I4MA 2HLUA 2MSTA 3ITHA 5CYQA 2E1AA 1C2PA 4KB7A 2DK2A 1HIYA 3R7BB 2FZGB 2H54B 1IKYB 5D4OA 3MF5A 2B8QA 1D8YA 3M6WA 3PR4A 4X62J 2NXNA 3GJSB 3VTIA 2LECA 4USIA 3DM2A 1QAIA 3NGKA 3OFHA 5A76A 3ENAA 2DO4A 3TUIC 3BGLA 5ETSA 4DX5A 3A8JA 2WK4A 3VVUA 4CLFA 3F44A 3C14B 3E01B 4B9VA 2J8SA 2E5IA 3VAFA 1KNZA 1VQ8S 2O66A 3IWXA 4AUKA 1HWLA 5D0RA 4B3RF 4I7FB 5IZHA 4MH8A 4JI7J 2IJFA 1WELA 3M8PA 1U6FA 4YMEA 3KK1A 2C2DA 2CQ1A 5E7OB 3T9NA 1N0UA 4KV8A 5HMYA 2C1EB 2OPRB 3TA0A 2MLYA 2JDJA 2NPFA 3BYPA 3D1QA 1S1XB 3CD5A 2J0WA 3GE9A 1RE1B 2E1RA 1ULRA 5J2NB 3W8GA 3P4UB 4LRBA 1FRMA 2YKAA 3R1HA 4K4ZA 2DGTA 2IM0A 3M8QA 3AAWB 1LXNA 3UQSA 2YXLA 3RAQA 2UUBF 4P74A 3SCLE 1ZM2A 2V5HG 2AIRB 2Z30B 2QC3A 5BXIA 2PO4A 4IOBA 5K9FA 2XYPB 2CG4A 3PO4A 1R0AA 3HK2A 3IM9A 3GZ7A 2DR6A 2PC6A 5CAAA 5LL6d 5IWAJ 2VF3A 4GC6A 4KH0B 3NS7B 1JJHA 3KLHA 2CG8A 5BYSA 2DRBA 4KO0A 2V4JB 1FKOA 1XJWB 3BM7A 4RNFA 1U6BA 5EN1A 2ZM6F 2YX1A 2VG7A 2XZDB 5KFUA 4NE9C 1S1UA 5BJRA 3CD6S 2GHVC 1CULA 4RW8B 1RKJA 4FXDA 2XSJA 3IO1A 2IDEA 2XMWA 4B08A 1IKVA 2HMIB 3TVZA 2LEPA 2V50A 1MMNA 4ZVFA 2W01A 1E6YA 1EJ7L 3MM9B 3O44A 2CQIA 5A2QY 2UUAF 3HDSA 3BKUA 1IBKF 2DIVA 2JSXA 4B3SJ 3G82B 2ROEA 2IRYA 2Q1LA 3DFEA 2JZ5A 4JB8B 4HHUA 4ECRA 3SQOP 2N3LA 3KHRA 4OX6A 5C7PA 4N77A 3MEKA 4C8OA 3OR1A 3PG9A 3MMCB 4C97A 3K5OA 5L46A 1BQXA 3SBMA 2G2ZA 4DF4A 2VFTA 2JEGA 2CFXA 2RQ4A 4Q43A 2C42A 5E0OA 1RYSA 1TU0B 1WC3A 3DLJA 3N4WA 1NDKA 3R6GB 3MZIA 1VOMA 5T14A 1NJYA 4J9NA 2GIQA 2Z57B 2RQCA 3LO3A 4ZPBA 1UJ4A 1OY9A 2VJVA 1FTRA 1XBWA 3HULA 1XNRJ 3LGNA 2MLXA 2E9TA 3QLHB 4A8QA 1FFGB 5A8KA 2ZZMA 3K5MA 1SQGA 4FNHA 4GC7A 3TO8A 3NL0A 3BQ2A 4OZLA 3Q8UA 2PGCA 1VQ6S 2MKHA 1M5OC 1MN9A 1DHMA 5BR8J 3MR2A 2GNKA 3R27A 4IRDA 2ACYA 4YQWA 2C3MA 3A8KA 5C5JA 2WB4A 4ZS6A 2UVRA 5K20B 2CPZA 4DR3F 1YRTA 1S10A 1Q78A 3JYTA 2G2OA 3IWNC 2MKCA 2IRUA 2VONA 1LWFA 5B7WA 2HNZA 1WG5A 2IFXA 4RUHA 2WVEA 4ZPWR 2GA7A 2MSSA 4ZHRA 3LP2B 5GAGU 2J6TA 1CS4B 4X62F 5DJBA 1OQ6A 5AXLA 1DLOA 2RQMA 3HFVA 3UCZP 1H38A 3PIOQ 1TKDA 3MEGB 2QFIA 4G1PA 3ZZOA 1VQNS 2RILA 2DR5A 1RB0A 4QWCA 1HD1A 1WEXA 4D3GA 4DL6A 2JJ4D 2CPFA 3KHGA 1HBNA 2EXUA 2R9LA 1TMJA 5B09A 4JI7F 2XTJP 3V2UC 4HH1A 2GJIA 2WW8A 3FCWA 4EBEA 2CNOB 3D3CJ 4IH5A 2VPWB 3AHPA 3ELHA 1APSA 4L3KA 1I3OB 4USMA 2KFNA 7FD1A 3MAHA 1VIXA 4LFCJ 2DCLA 3OXGA 3CULA 1UZDA 3WIVA 1S49A 2ZNYA 2CAJA 4CQ1A 4EO6A 2NREA 1NKBA 1FJCA 1TL3B 3N6NA 3HJFA 4FVMA 4R8UA 1IM6A 1YQHA 4IOAQ 5KFCA 4GKJJ 2KTQA 3MURP 3HHNB 3KLVA 3P5TL 1SL0A 2MYFA 1R8HA 3I5AA 3E2EA 3KYLA 1Y9OA 3GIIA 3FSIA 4QZVB 3F0NA 3OL8A 4ZVTB 2BJEA 2O01C 5DDPC 4UY8T 5GAHU 1WI6A 4PKDB 5I3UB 2HNDA 4ED8A 3PNIA 2UV8A 3GG1A 1VQSA 2YNHA 5IWAF 2FIUA 2MQLA 4N56A 3QFWA 3OXLA 3E51A 4C3MA 1S76D 2N3OA 4RR5A 2Z0GA 2PI5A 3FFIA 3CCVS 3IXQA 2EK1A 2COLA 4NA1A 4ZPVR 4DR4J 2AJQA 1T9TA 4O44A 2H51B 3DOMB 1NAQA 1Q7YT 5K5MA 3NWGA 5G0RA 2ZDOA 1MWYA 2G1HA 4X4QA 1RT7A 5E3PA 4FYYB 4F4AA 2QGFB 2FZCB 4AXJA 4X4VA 2LDIA 5GMEA 4S0MA 4PWDB 2P9CA 1RAJA 1OPIA 4DX6A 2AJ0A 4EI2A 1ZBTA 4P7VA 4YN3B 1GTHA 4OQJA 1BD6A 5IT0A 4B3SF 1VRTB 1RWMB 4LVOP 3TJ9A 3LPEA 1H72C 2KH9A 1MSWD 1KWMA 4R5PA 4N5SA 2GJ2A 1BQNB 2M52A 3MM8B 1G4CA 2KVQE 2DYAA 2ZD1B 4USTA 3WDOA 4F25A 3EXYA 4ILMA 3CJ2A 4U7CA 3OFFA 4DUYJ 1Z4UA 4DSIA 2BQ3A 2F8HA 3BBFA 3KMQA 1R0CB 1X4AA 2Z56B 4PAAA 2D9PA 1ZPVA 2JLFA 3OUYB 2VB6A 2HFUA 2RAQA 2HZCA 4IG0B 4I56A 2GHPA 3DLEB 3ZXWA 4P2FA 3FBEA 4WP3A 3J81U 3FQLA 2V4QA 4K4YA 2W1BA 1QAJA 2ZZTA 1ICEB 2RRBA 2MZ1A 2XYHB 3PXGa 1XERA 1C0TA 3M1VA 4IFYB 3M32A 3THVA 4RUBA 4F04B 2XHWA 1DTQB 3J80U 4F0HA 1YBTA 4TXSA 2FUG9 2BKPA 1S6PB 2CPEA 2HHVA 3MTJA 4YR2A 3WC0A 3MPVA 1SIWB 3PVXA 1TV6B 1YGYA 3KK2B 5LMNJ 4Y2IA 3QATA 5HBMA 3MPUB 1S7HA 3UDVA 2BKOA 1HQ2A 2BDPA 2V2ZA 1Q79A 4XPEA 2CQDA 3UCGA 3ZFVA 4ZN3A 4ZP8A 2DNKA 2W2NP 4GVBA 1T9YA 4ZVGA 3D7SB 4TY9A 3BR9A 3G8SA 4O4GA 4HDHA 2KI2A 4MKAA 3C6UA 2CKWA 2FVPA 2R4FA 4CYUB 4LF9J 2FJBB 3TR5A 1SKSA 5J2QA 3BKTA 4F02A 4YR0A 4DOZA 2RS8A 2K3KA 3K58A 1L3TA 2HZAA 2R8KA 5CYJA 2MKIA 2GVZA 3VALA 2OTJS 3KFWX 4X4OA 4PCQA 4URGA 5HVGA 2GX8A 3RUBL 3LP1B 2MEWA 1R8PA 1TUVA 4USKA 4LFCF 3IM8A 1HQUA 5D0HA 3T9ZA 1TKXA 4F4ZA 4AL5A 5GAEU 4C2MA 1RWPB 3RW7A 2YKPA 3CJ0A 1DBDA 5BYRA 2CQ4A 3CTRA 1NB7A 4DFPA 1JNRB 1GMWD 4DSEA 3NOGA 4DCPB 2DR9A 4OX9J 5HVHA 3DLKB 3EVWA 4Y3CA 1HQEB 1Z2LA 1Y10A 1S1VB 4NA3A 2MZRA 4ZPTR 1DQAA 3RB4A 2QIFA 4OZ5A 4LJMA 3H42A 4DL3A 1KKHA 4M5MA 2HFZA 4TVAB 4DLEA 3C3LA 3H5YA 4BC7A 1T9WA 5C25A 4Y2MA 1S1TA 3QO9A 1NZ8A 5F0WA 1KLMB 1VRUA 3CIZA 1HW8A 2ZE2B 2GQCA 2HS3A 4IRCA 1T05B 1EETA 3KKFA 1S7IA 4OYPA 3FRZA 2FY1A 1LNQA 1WKLA 3MEEA 4ATNA 5KFXA 3ENVA 2DHXA 3TI0A 3CDWA 4RW6A 2WVDA 2V2QA 1R89A 3R5JB 5J2MB 4DR4F 1U2FA 4KSEB 3DRSA 2QN6B 1LEOA 1IKYA 1G6BA 1ZOTA 3ZZTA 1XMBA 2KG1A 4LSZB 3X1LB 1M1HA 4L73A 3BDPA 3PW4A 3Q0AA 2MMYA 2VA3A 3DN9A 5C24B 2BR0A 1F6TA 3K2YA 3T19A 1OSDA 4YFUA 2NYIA 2E9RX 1V3RA 2BACA 5L9NA 2WSFC 1Y7PA 3E01A 2XY6A 1ZPWX 1Q8BA 3W64A 4DX8H 4LF4J 3QT5A 1VQ5S 3QRQA 1LK5A 4NLXA 2F8EX 4WIIA 3W9IA 3ZTQA 3I32A 1F1BB 5KFIA 2C2NA 5F8IA 2IHR1 3RW6A 4OYAA 2QLBB 1KDNA 1KVJA 1X4EA 1S6QA 2VHGA 5HAOA 4J9UE 3QWUA 1KS2A 4Z7YA 2YWEA 5GADI 3VHQA 2VC1A 1RT5A 1D09B 2CJAA 3P96A 3RBZA 1P1LA 1B4SA 4H4OA 4TU7A 1NKEA 4M5JA 2R2TA 1RU2A 1RTHB 1RAEB 3BQ0A 4DUYF 4YHHJ 4HDGA 1FD2A 2WOMB 3LA0A 5KFPA 3LGHA 2QT7A 1V6HA 1JKHB 3L95X 3NNHA 1C0UB 2VODA 1N5YB 1KONA 2ALZA 2MKJA 3TARA 2X1AA 3EJMA 3HT3A 1EB0A 4NLTA 2WVFA 1WHWA 4F67A 3TX0A 2ZNZA 4IYQA 4Z7CA 1SKRA 2XWXA 5CH7B 2VDHA 1YBUA 2PMWA 2CZ4A 1TKTA 1KP6A 4DU8A 4PQUB 1P9YA 1FWKA 2MDAA 3W60A 9RUBA 2HVHA 3O3LA 4WP9A 4NLUA 1IR0A 2KHCA 2M4MA 2RB7A 2WCXA 3AJ1A 3DNCA 1NBEB 4X4PA 1CJUB 5L1KA 2HHPA 3C16B 1AZSB 2DGUA 1QSSA 3SDEA 1X5SA 4DPWA 1RI7A 4C11A 4B9TA 5B0AA 4B3MF 4KQZA 3MHYA 4ZVEA 2BM1A 3V81B 4GRSA 4NLOA 1UPPA 5DETA 5CXTA 3R7SB 4A8OA 4K4TA 2HBZB 4CM0A 4ENOA 5A8WB 2EG1A 3G6XA 5LMNF 1X4GA 2J9DE 1D9DA 3NAHA 4DUZJ 3KLFA 2KN4A 1YDLA 3DRRB 4G1QA 4A47A 4Q8FA 1YLXA 4K50A 2B56A 3M8SA 1JLQA 3ZZRA 1N32J 3C2PA 1W2BR 1F60B 2XY7A 2Y0BB 4MYUA 5IM0A 3FC9A 1Z2ZA 3E8OA 1JLBA 4KYZA 4PWWA 1JLFA 5HQMA 4J5OA 4ZP7A 1WACA 3GR1A 4LF9F 1YZ7A 1DZ5A 3I31A 3R97A 4TLQA 1U1QA 4OHVA 3H8YA 3MMCA 3A1YG 1GH8A 1BWVA 2LU1A 3O6QA 1U1NA 4OJHA 2WSEC 4BWJA 4UY85 2PD1A 4KKOB 3TANA 4F3OA 5F41A 4CLTA 5DG7A 3R9LA 3J7ZT 1Y3KA 4HHHA 1QAXA 3G6VA 4B9NA 4USHA 2VFUA 3VGUA 5K8PA 3AXMA 2P2CB 1XMOJ 4WZMA 4W4MA 2ROPA 2QLFB 5KFTA 1SC6A 3JSMA 4JI4J 3RRHA 1HKAA 2ASJA 2OPPA 1TTHB 1LOUA 2B9EA 3AA8A 5FD1A 2UU9J 1YJTA 3QLHA 2A18A 3EYZA 3MAAB 2AP6A 1O51A 3G96A 1IKXB 1QTMA 1ZZNA 1XNQJ 3TA1A 3V6DB 1Q0NA 2C2OB 4TNOA 2DH8A 4OHYA 2W25A 3TWZA 3TUZC 3BPDA 5J2PA 1AW0A 3DRXA 3PW0A 3HD2A 2K8GA 3D0IE 4X4SA 3HVRA 2B0GA 3PYGA 2HGNA 2YKMB 4G6VB 4TKTA 9ATCB 3M2UA 2HHSA 2ZJQQ 4EUVA 2DHGA 1X9WA 3CO9A 3SSQA 4CIOA 2P5VA 2HRUA 1HMVB 4EEYA 2CQ3A 1K0TA 2QEXS 4J9SA 4M5NA 1VI7A 1SC4B 4ZLJA 3GU0A 4M5HA 1LW0A 4A8MP 2JHEA 2VU5A 4DMZA 3JTNA 1QDUB 4ZVUB 2CPJA 2ZHOA 1JJ4A 1FRJA 2VFVA 4LF4F 1XTZA 5KG4A 3I87A 1LV5A 4ED0A 1FVQA 4PG4A 3SFGA 1HBMA 5HROB 2PMZD 2LQ5A 2VBZA 4ECTA 2KFYA 2KRBA 1M5PC 3IS9B 3VGVA 2VIHA 1AROP 4DJBA 3MCOA 3D0GE 3MECB 3QIDA 2VBYA 2OFGX 3U1LA 1RWKB 5EHHA 1IVZA 1YK9A 1GFWB 4YHHF 3NS5A 1FNXH 1WDDA 5IQQA 1RLDA 2ZOFA 4BBYA 4DR2J 1RWNB 1TL3A 3RB0A 4FBUA 1Y0HA 5B0GA 4YB6A 2OGUA 3DMJB 3MM5B 2IAJA 5D4PA 3EE3A 3DOKB 3KTQA 2BKNA 4NLSA 1PGZA 2KRRA 5AXNA 2UVVA 3NCPA 1IBCB 4Q8EA 1B64A 1HHTP 3PV8A 4ED5A 3FNNA 4DV2J 3CC4S 4ZN1A 6FDRA 2KZMA 4RW7B 1CLFA 2GGPB 2B9WA 3BSOA 2QFJA 4DUTA 3D66A 3ONQA 3EDRB 2GJFA 1NU4A 2RDDA 1S1WB 3QMQA 3GJTB 3QFHA 3M05A 5A6PA 1KLNA 1FX2A 4DSFA 3DOMA 1Q8KA 3RAMA 1FKPB 2VFSA 4LFAJ 3M6UA 2C3OA 2IC3B 3KHHA 1JJ2R 1VC5A 3W1YC 3N0VA 5LMUJ 2A3JA 1RZMA 2MKSA 1CQMA 4USUA 2J9CA 4DR7J 1P8GA 4DEZA 3MOJB 3BZQA 2DRAA 1ZM9A 2JFKA 3GLJA 5C42A 3EPIA 3T1HJ 3I5BA 3OW2R 1G3OA 3K8WA 4K4XA 1S77D 2HVDA 1FESA 1VS3A 1Q8LA 1C4CA 1H0HB 2RJZA 3ENQA 2PEHA 2A1BA 1HHSA 1QSLA 4TY8B 3CF5Q 4BLGA 4NLVA 1U48A 2FVQA 1SJRA 1N5TA 3EUNA 4KAIA 3CCTA 3K89A 2E44A 4B9LA 1L5UA 2E1CA 4AXIA 3KDNA 5DZ6A 3VAGA 4RW9A 2KG0A 3BGUA 4DG1B 1HNIA 4J90A 2YNFB 5KG6A 5B0BA 1T95A 1XMOF 4JV5J 3QZ7A 2I2YA 2J76E 1RWUA 3M9OB 2PT0A 4B17A 1T03B 2UU9F 3QT6A 4DF8A 1NUEA 2Y0SD 3H20A 2YH1A 1XNQF 1ZA1B 4KT0C 3CJ8A 3PYDA 1T3OA 2DHSA 3I82A 4B3TJ 3HVAA 2XGQA 2W4DA 4NCGB 4A8XA 3DGPB 1RTJA 4NA2A 1VQMS 1MWZA 2M0GB 3IRWP 1VR6A 4NRUA 3IR6B 3UW1A 5KG3A 3R3TA 1JJCB 3KK2A 2FPHX 2NQPA 2RKIB 2GQQA 4ECXA 4MK9A 3EGZA 5D6GA 5CHCB 1UAWA 3KUGA 1YJNS 3VCDA 2NS1B 1SV5B 5C2CA 3RRKA 3H0PA 3D0HE 2W4PA 2YKNB 2OAUA 5KG5A 1SKWA 5G4DA 4ECYA 3KK3A 3UN3A 2RSQA 3MXHP 2LVWA 2NPIA 3Q86A 1NM2A 1T8EA 2N4DA 1JX4A 4MT1A 2NXCA 4Q2LA 5CD4A 2CZ9A 1NCLA 2B51A 1S9GA 3KDOA 3I55S 2HFNA 5HQLA 4OI2A 4XDCA 2EWHA 4TQSA 4CYUA 2WVCA 2FTRA 4HT5A 3KJVB 2R2SA 4LF5J 2C3UA 2VPXB 2N7CA 3WC2A 4Y6IA 2WONB 3J80Y 4QIFA 4KGXB 4DFMA 1FDNA 2B5JB 1QY7A 3LP1A 2XEXA 4LUBA 1IQZA 2R7VA 1WC4A 4QIVA 1RTDA 1TK8A 3MMAB 2W7AA 2OEKA 4NCAA 1Q95G 3U27A 4DR2F 4WFNQ 1VQLS 3TJAA 4DV4F 1FNMA 1UZHA 1YJ9S 3PW7A 5KFJA 3GJRB 5LJ3Y 1SL2A 3OFGA 1H2VZ 4FBTA 3DLKA 4I0WA 4R25A 1SKUB 4J9LA 4X64J 3DLGA 2K06A 5IFMA 2HWHA 2D3OR 2AJ2A 3AOAA 1PSDA 3K5PA 3UN2A 2LYVA 4ZVSB 1JIHA 1ZYQA 3B6BA 5GAGI 1RDRA 4DV2F 3VQTA 4WU2A 4OYWA 1MU2A 2HK2A 4ECQA 3T5KA 2L9DA 5K14B 4ZJOA 4KGVB 3BJYA 5M2RA 3EX7B 1T05A 2YVSA 2FJEB 5K8MA 2C2RA 4PYDA 5J1EA 2X3DA 4JI2J 4YDXA 2IJRA 1Q7LB 3S6EA 4DN0A 2QLXA 3TUJC 2I1RA 2LQ9A 1B3TA 4LR8A 1S59A 2CVEA 4LFAF 4I64A 1FRLA 2AW0A 4XDDA 1TL7A 1WF2A 5LMUF 2H5IB 1Q53A 3D2WA 3J7Z5 1TL1B 4CP5A 4DR7F 2M88A 1NK5A 3SCKE 4ZITA 1XR6A 4LREA 2X3GA 2RHSB 4CLWA 3H4BA 1KHWA 3NGSA 3T1HF 1UVLA 5KAKA 2P9EA 1BQMB 4LF6F 5KTQA 1O6XA 2C3PA 3KLGB 2R7TA 1R6YA 4K4UA 3CJQA 3H4DA 2VH7A 2V2VA 3JAMU 1VQYA 3OTOJ 1NEEA 1CJKB 2WHOA 3NWRA 2HFVA 4NRTA 2E66A 2FLLA 2MQNA 5LM7E 1IR1A 1CQNA 3IGVA 5GAHI 4DX7A 2WOMA 1HNXJ 4JUZA 3OVBA 1G2EA 1FJEB 4F3QA 2W9CB 5KT4A 2RIJA 3DOLA 5HANA 1JKHA 2W7PA 1N5YA 5D8HB 4JV5F 1LK7A 1YI2S 3ET6B 5ETVA 3P49B 3NGDA 4KGMA 1UVJA 3AD7C 2DPJA 3BREA 4M8LA 4CO3A 1UFLA 2R2RA 4Q0BA 4QQBA 4DR6J 3S8SA 3EGVA 1S6UA 1JK9B 2BQUA 3BN4A 4PYAA 1W2IA 3VWSA 2HSEB 2NUHA 4URQU 3L3CA 4DDFA 3LWLA 1U1MA 4IG3A 2DCUB 2MXYA 4B3TF 2R8JA 4LQ3A 1IWGA 3H2VE 3IRXB 3C16A 4NYZA 1U1KA 2E9ZA 5CABA 4DR5J 2MKYA 3FBCA 3HVTB 4NMLA 4KRWA 2DR8A 1QJHA 1A0OB 4UF4A 1XEZA 5ETPA 3QGPA 1LWCB 3V81A 1HL6A 2XMVA 5D3GB 4OLOA 1HNWF 1OY6A 5A8RB 3W9HA 2ERRA 4LIRA 4P7TA 2AEMA 1VIOA 2ZJPQ 3HP6A 4ZVRB 4NLGA 2I6WA 2I38A 1RT1A 1RT6B 5DLFA 3IBFB 3QJPA 1MN7A 7FDRA 3HMJG 1DURA 1WORA 2YNGA 1V5IB 3QGGA 4EBDA 4DQRA 3H5XA 3QGIA 3GIMA 2U1AA 1D1UA 2MQPA 2Y8WA 4DQSA 3CJ5A 3I0RB 1AXQA 4DCOB 2DPIA 1TFYA 1KN6A 3NKYA 4RWWA 2OIHA 2LXUA 5DLGA 1TAUA 4RPFA 4M5DB 2JFDA 2DITA 4ED4A 3PKMA 3OHBA 3PJXA 4CTAA 4QWBA 4C8YA 2Z4PA 4NEYA 3CDBA 2NXEA 1LWEB 3M2RA 5ETQA 4BS2A 1Y11A 4KKOA 4CH1A 4NZ0A 1QAYA 2GVDB 3J7YU 4LR9A 2ZVIA 4X66J 4C8KA 3IR5B 1YKWA 4CLLA 2GAGC 3EICA 3PW2A 1XC9A 2OTLS 3B8HA 5D0GA 4NXMJ 3W5ZA 1LQ9A 3NBPA 1RHMB 3MM6A 1HNZJ 2MY8A 3CJKA 1CJTA 2A2CA 1GQEA 2F4FA 3MAAA 4ZP6A 5THWA 4A8WA 3C15A 3KNAA 5I42B 1U2RA 5E41A 5I3QA 4ZCIA 4NLWA 4BCAA 4K2JA 4U9RA 2XMJA 1N36F 1KFSA 3OT9A 4ED1A 4DWIA 2UUCJ 3JB9k 1Q1KA 2XMUA 1W25A 3MFIA 3FZ2A 2ZEJA 1DAXA 2RQKA 2J8AA 4IQXA 1OQ3A 1NK0A 4TU9A 1GXLA 1FEHA 2AHOB 2B6AB 5H9FK 4YB5A 3GFHA 4OFZA 3QJJA 4JI2F 1VGYA 1YX2A 2VG5B 2NCKL 1PYSB 4UUWA 2J0QD 2O5DA 2H4YB 2GFFA 2QJ3A 1UKUA 4WK3A 1VQKS 2P6SA 3FMBA 2I0XA 4MK7A 4DQIA 1U1RA 2DKOB 2D3UA 1KR4A 1FDBA 4AE5A 2W24A 2RF2B 1M1KT 4X84A 1F9FA 1DRZA 3B82A 4ETZA 2DNLA 3C6TA 4FF2A 2V8DA 3HF5A 1CJVB 3MPDA 5ETTA 3Q83A 2CPIA 3ZTRA 2EFPA 2Z2ZA 3B4MA 4ED2A 2MPUA 1JXLA 2BUNA 1M5VC 5KT6A 3QJLA 2OPSB 2DGVA 5GAEI 5HROA 2OSQA 3IMQJ 3K59A 3CCWA 4DPYA 1JLAB 3H90A 1RU1A 2DXDA 3JQKA 2XLKA 3NY0A 3N6MA 4RWXA 3OTOF 3IWLA 1FCAA 2E5GA 3HHLB 1NSAA 4TLRA 2DIUA 4KBIA 4ANDA 4UZBA 1X9MA 3KUEA 2C22A 3KJNB 1VQOS 2AGPA 4N76A 4DQPA 1HNXF 1XIQA 1L3VA 2OPQB 3BO4A 3HHLC 2VG6A 1UCNA 1H74A 1S9EA 3M2VA 1U1PA 5CYMA 4MK8A 5LT5A 1FF2A 1V5VA 3W2VB 4KPYA 3MM5A 4CRJA 3DOKA 4ID8A 4D3HA 3J7A1 5EWFA 1WOPA 2PDAA 2AX1A 2DBBA 2IM1A 1HNVA 1E6VB 1TVRA 4ERDA 1KHVA 4G3IA 1QSYA 4FS2A 4DR6F 3FUYA 4QR0A 2VDIA 4RX6A 3L4BC 1RAOA 1CG2A 5HMWA 3CW2C 2K1RB 3R5DA 4MYTA 2OD6A 1X7VA 1WG4A 4QW9A 4OHWA 2AYGA 1TKZB 2PSZA 1RHUB 4DS5A 5HLFA 3AD8C 4WU3A 4DR5F 2IYIA 4DSLA 3ADAC 1XWLA 3A3OB 1VBZA 1BUXA 1CBKA 4I2PB 2E5LF 1CSJA 1ELOA 4ZLPA 1YG0A 2XO7A 1M1GA 1NDLA 2BRLA 1S1WA 2CJKA 1K1SA 2DEJA 1GMWA 4Y28C 3QRRA 1EQMA 1FWLA 1U0HA 2XCPA 4DFJA 2F65A 1UTAA 3D6MB 1W7WA 2AGOA 2RT3A 2H5EA 5KG7A 2IBKA 2I5JA 1N5VA 4KH1B 5DQIA 4DV0J 2H9ZA 2OKQA 4JI8J 3UD4P 2WBMA 2RU3A 1NK6A 2Q3PA 4YR3A 5H9FJ 1JQGA 4KJIA 2AZ1A 3GIRA 4U7UD 4TY8A 4RO0A 2GMLA 4CLKA 2WSCC 2P8IA 3M6XA 4P2MA 2W8LA 2MQ8A 3D54A 4OYXA 3DYAA 3QWPA 3FSYA 3O1LA 4LRFA 1T0TV 4P9SA 3HZGA 1FJGJ 3NCQA 1IN0A 5AE1A 2GHWA 1UWAA 1HBOA 1LWXA 3W9JA 1LW2B 4HL9A 2BE9B 1J27A 3LPYA 4RU9A 2R42A 3AODA 1FHTA 3T6JA 2CNKB 4C8LA 4M5KA 1RGVA 2OFHX 2YWFA 3T1AA 4HACB 2C28A 1DQ9A 2JVOA 1CC7A 4HT7A 1RAIB 2FVRA 1I51B 2HHHJ 4NLQA 5CZVA 1GXUA 1NSQA 4OJGA 4B3OB 1TL5A 3WX4A 4FS1A 3KNGA 2UUCF 2YNIB 1RTIB 4HHJA 1RT4B 2IJNA 3VAIA 1EP4B 1HWUA 2HIQA 2ZUGA 1VBXA 4DL7A 4M5IA 4NI2A 4DU7A 2DEIA 1AUDA 1GEHA 5KFMA 2ZKUA 1FK9A 1HI8A 2ZH2A 4UT4A 3GPAA 3P8BB 4H4MA 3MDFA 3Q8YA 4QOTA 1JLEA 2JH3A 2G1DA 2FY8A 2U2FA 5L39A 4Y34A 2F63A 3T5HA 4I2QB 2YKOA 1Y5NB 4I69A 3TYTA 3VR1A 2J6SA 4HYKA 3OLBA 1Y5LB 1RAGB 2JRSA 2P9GA 3D9BA 2J0SD 4WBFA 4WF9Q 3SIPB 2IBOA 2BANB 3IP0A 3I4HX 4ZVOB 1C1CB 3W5XA 3KJVA 3LUYA 2ZDPA 1K1QA 1NK8A 3L7UA 3HSGA 3MCSA 2KZZA 6FD1A 4OZNA 1PCAA 1HYSA 4R0JA 3MPWA 2Q6BA 3EWGA 1V3SA 2ZHAA 1X31C 3AJDA 3MTKA 2M7SA 3TRGA 2IYGA 1C1BB 2FHKA 2CRLA 1S0OA 2IM3A 4CO5A 3UCUP 2BJ8A 4CO2A 2VL1A 5EDWA 1ZS6A 3W2WA 3KMSA 2H3EB 3ITHB 5CYQB 4IRKA 4OYOA 3MR7A 2D9OA 4C48A 2A10A 2KJWA 1XMQF 2E1MC 1QD1A 3MMJA 3FBBA 5HI7A 2UVUA 1RCXB 1KQFB 4ZIWA 3T5JA 3IG1A 1HFEL 3JTOA 3TAMB 1FXDA 3HHDA 2DGSA 5HATA 1U24A 3DRPA 1REGX 3UVJA 2EFGA 2JLGA 2B4OA 4EWTA 3M4XA 4OI0A 3SV4A 3ZO7A 3OVAA 4DR1J 3HFZB 2IPOB 2IMOA 1NHKL 1RBLA 2Q79A 3M8PB 2FJXA 3U02A 3V6JA 5ITHA 2VD3A 3M8ZA 3HZEA 3US5A 1TUGB 2IA0A 2QA4G 2CADA 1TK0A 1NH8A 3P3DA 4FPIA 1VDHA 4WTOB 3ILJA 3HCXA 3I56S 4DV0F 1V9OA 1VRQC 3BO3A 2B9YA 4LSLA 5D77A 3VAMA 4WYLA 2OH2A 1WG1A 3SV3A 3GP9A 4QWDA 1R0BG 3DU6A 1KQKA 2Y9HA 4ZA1A 2YKQA 2V2KA 1A7GE 4OHZA 2HEKA 3M8QB 2QL7B 3GV8B 1HARA 1OYEA 4FPRA 4JI6F 4OZ1A 4LSNA 3OJUA 2HURA 5HP1A 1SJ3P 3CJRA 1UVKA 2H48B 3HT0A 4LT6A 5GMKa 2CNNB 1YRXA 1AYEA 2K2PA 1Q5YA 3S7RA 8AT1B 4JI5J 4AL7A 2RH3A 4O3SA 2DISA 3MOZA 2LEBA 5FDLA 1JXEA 2V9WA 3RGIA 2CQHA 1Y00A 4K4SA 4OMFG 3ZTPA 5HQ8A 3ETOA 1WHXA 1U2CA 3DRYA 3W8PA 3DU5A 4ECZA 2BQRA 2G13A 1RADB 2Y1RI 3TQ1A 2JVRA 1LXJA 4Y2CA 2KVIA 2HQFA 1LFPA 1R8AA 2VUGA 2XSJB 2AF6A 1EARA 1IKVB 5GVQA 2OELA 4OI4A 4I6WA 1B0PA 4IFVA 3PM9A 2HHHF 3CJ4A 3SQGA 1SQFA 4P71A 4M94A 1E6YB 1RKIA 1DFDA 2X1GA 4QU7A 2M8HA 2ZH3A 2R7RA 1QVFR 4WTYA 4YB1P 3EM1A 2ZHBA 4M5GA 4BHQA 1NHVA 4RW4A 5FLXU 2RU9A 1NSKL 3MGJA 3EDQB 4AL6A 2JOQA 4DV5J 1DTTB 1W26A 3QIPA 3JAMY 1NK4A 2J7WA 2FJVA 4ECUA 5RUBA 4FP9A 2HAIA 4WE1B 3OL6A 2R7XA 3FZBA 4JI0J 2MHNA 3IR7B 1S99A 4ILRA 4L74A 2FVSA 2HWTA 2ZJRQ 3NRBA 3THTA 2F1FA 1SUQA 1QE1B 3RBEA 1RT2A 2XLJA 5F8MA 2DGQA 3EZUA 2FGOA 4K59A 4MIWA 4O3NA 1RWVB 4IH7A 4CLYA 5DGBA 1RTZA 4NL5A 3V5RA 1HI0P 3OR2A 2BRKA 5A8KB 1GAOA 3EVMA 4QWAA 2EG2A 3CO0P 1ZA2B 3I96A 3VAJA 1U1OA 4QIEA 3NGTA 2G0IA 4ES3A 2ZVSA 1N4LA 3PR5B 4DN9A 3EZOA 4FNIA 2LU2A 2CQ0A 2DHHA 5EWEA 3UNYA 3QNWB 2C2MB 1GTEA 1PC5A 3FJ2A 4NLRA 4FKXA 2JNJA 1UW9A 3TAPA 4MAKA 1WF0A 1FRHA 1T7PA 3UR0A 1WEZA 3LOUA 1BE4A 2QTWA 4B9MA 1UJ5A 2DNYA 2ILYA 3JYTB 3CMAS 4NCBA 1VLOA 2BW7A 3ZC4A 3BGRA 4GO7X 3TVKA 1TK5A 2QA2A 2NYHA 3GIJA 1YJWS 2LDYA 3G2XA 4ZHRB 4PUOA 2A2DA 2EFNA 4PPZA 1KSPA 1VLYA 1RWOB 1VYAA 3ZNUA 4UOFA 1DLOB 4G1IA 1URRA 1IKWA 4DQQA 5C2GA 4NZ6A 5KFGA 2KDOA 1Q5VA 3DXSX 4K2XA 3M9MB 2XZTB 3CPWR 1P1TA 4CH7A 2XY5A 1SH0A 1T9VA 4DR1F 1HBNB 3MFHA 3MR3A 1Q82T 3JSBA 1RHKB 2EC0A 1XQIA 2LCWA 2RDJA 1KD1T 2VG5A 2ZH1A 3HKZD 3PRVA 5K8NA 2HVZA 4UTGA 4F0KA 1SIZA 3PZPA 1PG5B 1KTQA 2W9BA 2QLJB 2MGZA 3RBDA 1U7LA 1RQ0A 4AT1B 3NGUA 3PX6A 4ZLLA 2P6TA 2KM8B 3IFEA 2OEJA 3S01A 3SSRA 4MKBA 5ETOA 1PBAA 4UZCA 1WOSA 1N8RT 1RWWB 3Q22A 2AD9A 4R8UB 2KM8C 3D5MA 5AXMA 4M63A 1AFIA 2VA2A 3WX8A 1N5QA 2ASLA 2VQEJ 3RJMB 2CXEA 5ETMA 2DNNA 3I4PA 2KFZA 2R7UA 1D9AA 4WIQA 2C3YA 3LP0A 4ZP9A 4DV6J 2FD2A 2GV1A 2GIRA 4OYBA 5D78A 2M3DA 2FLPA 2HNDB 1HWKA 2HLTA 2YNHB 3HHLA 4A4JA 4TU8A 3DCAA 5CQGA 4WFAQ 2RS2A 1OPZA 4EYHB 4U7UK 4ES1A 3POTA 2N7YA 4DHVA 2QE5A 3H2LA 4AFFA 3FFIB 2HPUA 3TZXA 3AH6A 2CWXA 3KLIB 4TYBA 2K3IA 2B3TB 4MFBA 4U67Q 2XMTA 3T6BA 1UEUA 2B9XA 4O44B 2NXJA 3FK4A 3UWTA 1FFSB 1HW9A 1RT7B 2RHQB 2X1BA 1XNRF 4OYMA 1V3ZA 4QYRA 1N0VC 1WD6A 1ROFA 3Q8VA 1J5EJ 4QWEA 3MM7B 2BXJA 2LQJA 2W9AA 3QPIA 1YJUA 3TX8A 1SJ1A 1TKZA 2G2YA 3MWBA 2DR7A 5KFAA 4F2SA 2GW8A 1SH2A 2KYXA 2ZITA 1FA0A 3IC1A 3WHIA 4YS2A 1XK8A 3GYNA 5BR8F 2CZVC 3V4MA 4DV5F 2VASA 3UR3C 3UNGC 2MZQA 4DBQA 1KTVA 1N54B 2V67A 4USWA 4ZOSA 4KHMA 3BBCA 3TP2A 4QPXA 4NWBA 5EWGA 3HJVA 3FKBA 4ZKAA 4KGZB 1Q16B 1F9EB 2XS5A 4RUAA 2KT3A 2XYGB 3OFEA 3ZTSA 2BW2A 4OV1A 2YX4A 2HHXA 5CZXA 2GC8A 3ILLA 1P27B 1IXKA 5IT9Y 3V6HA 4QYZJ 2VBXA 1UWBA 2Z2MA 4LBHA 3JTPA 4JOUA 2H65B 1CPZA 3U1NA 2H1YA 4HR2A 1C0TB 2FJAB 1ZAXA 4L3NA 1GNKA 3M1VB 3D3BJ 3M32B 2YWHA 3RRGA 3CDUA 1FRXA 1FVSA 3R1LA 1B70B 5AE2A 3GYGA 1KEKA 3MUMP 1WTFA 1YJ7A 1NH7A 1AUSL 3MR6A 1NB2A 2DO0A 1FDDA 3R5CA 2AU0A 1ZTTA 4O4RA 1JLGA 3LH2S 2JEJA 2RD5C 3FEXB 4OI6A 4YP3A 4RNOA 3L9ZA 2HQDA 3AB4B 3PEHA 2DVIA 3PRBA 1VJQA 4HACA 2HNYB 4IDKA 3T5LA 3PY8A 1O8BA 1MLAA 4GKJF 4ED6A 1WC1A 2B8PA 4OLPA 3BSAA 2UUAJ 1IBKJ 3BSNA 2R8GA 4GVBB 2R3VA 2R7WA 4L6V3 3GTYX 4O4GB 4ID5A 3CNQP 3C6UB 4ES2A 4TQRA 3IAS9 4PZVA 2PI4A 5J2QB 4MTPA 4K4VA 3BB5A 1SJFA 3LALA 2IRXA 1PYTA 3RR8A 1S0MA 2GVZB 1S72S 1FO1A 3PEJA 2ZBRA 3CDAA 4PG6A 3W66A 1T9XA 3DHWC 5KT2A 3BQ1A 3RB6A 1SJ4P 2CJBA 3CSKA 3QSIA 4ANEA 2AJFE 2DXFA 4I2QA 3GFYA 1TKXB 2EFQA 4ZVPB 3J7YI 3PX4A 5KOXA 1JLCB 3ZZYA 1IBLJ 4Z37A 3EGWB 5BYQA 2AV5A 3TZZA 2VQEF 3VF0B 2RVJA 3C14A 3KLEB 2ZH9A 1HLWA 3PACA 2MLZA 1C1CA 4R0EA 5CCMA 1RYRA 2QA1A 2FLNA 4IKAA 1X4HA 3I9V9 4I7FA 4LFBJ 2I8EA 1VC0A 1YBAA 1EQ0A 2UZAA 3AA9A 2L9WA 4QR1A 2BBEA 2GQ2A 1DQ8A 5CCLA 5C25B 2HVEA 3QO9B 1VRUB 1VBYA 2ILZA 2B4UA 3D6FB 2JWNA 3H5UA 2OPRA 1EETB 4E98A 1M5KC 4O0NA 2XMMA 3F73A 1JB0C 3DDKA 3N5BA 1SVDA 2OSRA 1S1XA 5F8HA 5F9LA 2Y8YA 5L9XA 4ZK7M 5LSRA 2AX0A 4RW6B 5J2NA 1UJ6A 2IM2A 4NYOA 2IVFB 3EMTA 3DRSB 2ZFHA 2DNQA 3RZAA 2CUYA 5T41A 4P72A 2WW4A 2V8VA 4ZCLA 2A6MA 2EKNA 4WKRA 1J5EF 3JSRA 3CCQS 3L7OA 3TAMA 2C2ZB 3NXZA 4ER8A 3A13A 2FVCA 4ICLB 2OJ3A 4J9OA 3FRYA 2WBRA 3CCZA 1RA7A 3IAM9 3I0SB 2I9SA 3GB0A 3AT1B 4DS4A 2J9DA 1X0PA 3TEGA 5KFFA 1Q86T 3EVOA 2ZH5A 3P5BP 3MMBB 8ATCB 4N8OA 1N5SA 1S6QB 3Q8RB 3LWMA 4AQYJ 2V4JA 3GV5B 3R7NB 5HMZA 3OV7A 4RJVA 2HS0A 2WVBA 1RT5B 4E2FB 3QAUA 2ZC4A 2GO8A 4LMZA 4H4OB 4ZCMA 4DXLA 2W2MP 1TP7A 4LBPA 2F7VA 4RW8A 2AEFA 1JWWA 4ETXA 3CCES 2X1FA 2MZSA 2FJWA 4MIAA 2HMIA 3UN5A 2OP5A 2GIFA 5DO2A 1ITPA 1NZAA 4PG7A 1B7FA 1C4AA 4FZVA 4I6YA 1NDPA 3MM9A 3EXCX 5CA5A 2CDRB 4WZQA 4IO9Q 1K73T 2XO6A 1UVNA 3ISND 1TKTB 3UI3A 3G82A 4IH6A 1PAUB 2XQCA 3CGIA 4QU6A 2YX7A 2F9DA 2AJ1A 4I1TA 4OZJA 2HFOA 3OQ2A 3HXMA 4LVNP 1HA1A 1KFDA 2WAQD 1T3NA 1ZH5A 4HEA9 3SDEB 3CD0A 5ADZA 4C11B 2FDNA 3G6YA 3D28A 3PHTA 4NMXA 4IQMA 1UMJA 1TQLA 4NLPA 4Q44A 4F4XA 2QRRA 1L3SA 3QQCD 1OIAA 3QT8A 1D3WA 4IUFA 1DY3A 1U45A 4K0KJ 2ZBPA 3CVKA 4P2SA
chains in the Genus database with same CATH topology
1VC6A 1XERA 1C0TA 2CPIA 2MQOA 3KK1B 3EPGA 2EFPA 2HVIA 3B4MA 4ED2A 3KLFB 5IXUA 2MPUA 3M1VA 1JXLA 4IFYB 5KG0A 3BF4A 3OSNA 3M32A 3THVA 1JNZB 1F2GA 4G1QB 2BUNA 2XHWA 4KV8B 1M5VC 4XAKA 5KT6A 1S97A 3QJLA 2OPSB 1DTQB 1JLQB 2G4BA 3GQCA 2DGVA 5GAEI 5HROA 2OSQA 4TXSA 5DDQC 5F8GA 4OX9F 3K59A 2FUG9 3CCWA 1N6QA 4MMOA 1S6PB 1JLAB 2CPEA 2FLOA 3TNVA 4JI8F 5IM0B 4IR9A 3HX9A 3W2WB 4RNNA 1TL1A 2HHVA 3MTJA 1QUVA 1JLBB 2DTJA 1NO8A 3WC0A 4YR2A 2XLKA 5DM7Q 1UW4A 3MPVA 1SIWB 3N6MA 3PVXA 3H5SA 4RWXA 3OTOF 1TV6B 1YGYA 3KK2B 3IWLA 1FCAA 4FVCA 4N8NA 2M70A 4Y2IA 2E5GA 3RU0A 3BR8A 5HBMA 3TW0A 2C2EA 3HHLB 1JLFB 4DV3F 4TLRA 2DIUA 4N41A 4KBIA 2B4VA 2O67A 3ZZUA 4X4TA 1X9MA 5A6WA 3SCJE 2C22A 1S7HA 1VQOS 2AGPA 4N76A 3MAQA 4URSA 1YHQS 4DQPA 2AYMA 1HNXF 1DTTA 3IG1B 1BQMA 1WEYA 1L3VA 4EO8A 2OPQB 2LXIA 4J9RA 3BO4A 5DDOC 2HGMA 2RRAA 3HHLC 1VK3A 2VG6A 3KLGA 1I6JA 5KFLA 5JVGQ 4IOCQ 3LANA 3OJSA 4CCHA 4WE1A 2BDPA 4X4UA 1S9EA 3M2VA 1U1PA 5CYMA 4MK8A 5LT5A 2EKYA 2JL9A 1FF2A 3DRPB 1Q79A 3W2VB 4XPEA 4KPYA 4Q5VA 1R0AB 3D1OA 3MM5A 3DOKA 4ID8A 4D3HA 4TYAA 2CQDA 3UCGA 3J7A1 3ZFVA 3FSXA 3MD1A 5EWFA 4ZP8A 2DNKA 2QSFA 2PDAA 2AX1A 3G71S 3M30A 2DBBA 2IM1A 1HNVA 2UXCF 2ZH4A 1E6VB 2VOPA 2XGPA 4ZVGA 1TVRA 2L48A 4TY9A 3BR9A 3G8SA 4O4GA 1KHVA 1LKZA 4G3IA 3MI7X 4ERDA 2NZ4A 1QSYA 1QE1A 4HDHA 2FHJA 2KI2A 4MKAA 3C6UA 4FS2A 4DR6F 1REVA 4QR0A 3LP2A 5A0YA 2V9KA 4RX6A 4C8NA 2CKWA 2FVPA 2QYCA 3G4SS 3KLHB 2B7CB 2R4FA 5KFNA 1MW7A 1Y3JA 2FJBB 1CG2A 3TR5A 4KO0B 5HMWA 5HN0A 1SKSA 1N48A 5J2QA 4DLGA 2D74B 2PE8A 5F8LA 2BV3A 1FJGF 2K1RB 2GCFA 3RYLA 2W9CA 3U1MA 4A8KA 3HLUA 4F02A 1FKOB 4YR0A 3R5DA 4MYTA 4DOZA 2RS8A 2OD6A 3JSMB 2K3KA 1X7VA 1WG4A 4QW9A 4CT8A 3K58A 3MEGA 4OHWA 2FHJD 1YSJA 1L3TA 2AYGA 2VG7B 1TKZB 2PSZA 3OL7A 5M2UA 5HLFA 4DS5A 2R8KA 1S1UB 5CYJA 2MKIA 1IBLF 1T94A 2OPPB 4WU3A 4DR5F 3VALA 2BABA 2IYIA 4DSLA 4X4NA 2OTJS 3KFWX 1XWLA 2DNGA 4LSLB 4X4OA 2FGCA 1VBZA 3H2UB 4PCQA 4I2PB 4URGA 3ZZ0A 2E5LF 1CSJA 1ELOA 2GX8A 4YEAA 4ZLPA 2XMKA 1YG0A 3LP1B 2XO7A 1UP1A 5E3RA 1R8PA 1TUVA 2LXFA 3MD3A 2OO4A 2BRLA 4LFCF 3MR5A 1S1WA 5I3PA 2CJKA 1K1SA 1HQUA 1SQEA 2M5YA 4Y28C 3T9ZA 1R43A 2XCPA 4LFBF 3H98A 5SZTA 1GT8A 1X5TA 2SXLA 1RA6A 3MPYA 4DFJA 1TKXA 4F4ZA 3GFZA 3HI9A 2LQBA 4EBCA 2J6UA 4HVZA 2KXNB 3KG1A 5GAEU 4NXNF 5J2PB 2KU7A 1F0XA 4C2MA 2RT3A 3IRXA 3RW7A 2AGOA 5FLXY 2H5EA 5KG7A 2J0QD 2YKPA 3CJ0A 3PHEA 4OX7A 2IBKA 2I5JA 4LSNB 1DBDA 5BYRA 5IT4A 2CQ4A 3CTRA 1NB7A 4DFPA 1N5VA 1JNRB 5KFZA 5DQIA 4DSEA 2HYIB 1DARA 1R8BA 2EW9A 2DR9A 3V6KA 5HP1B 3HVTA 2F4VF 2H9ZA 1H2UX 2OKQA 2BM0A 1HR0F 3DLKB 4CT9A 4Y3CA 3UD4P 4W90B 1HQEB 1Z2LA 2VPZB 4M1KA 1TZ0A 5CD4H 1Q8IA 1S1VB 5E33A 3CUNA 4NA3A 3M2UB 4GO5X 2MZRA 4ZPTR 2M8DB 1DQAA 3RB4A 2QIFA 4FF1A 4OZ5A 4DL0C 1U6ZA 4LJMA 1LWCA 3UDLA 4DL3A 2WBMA 5D3GA 3M8RA 2RU3A 3SMZA 2HHWA 2HFZA 5FDLB 2KT5A 5A8RA 3OR1B 2HW3A 2L08A 1NK6A 4JV1A 4DLEA 4DSJA 1IJEB 3C3LA 1OO0B 3H5YA 4BC7A 3NNAA 3CCUS 2Q3PA 2OMLA 4CH0S 5C25A 1R7IA 4YR3A 5H9FJ 4JI3F 4Y2MA 1S1TA 3QO9A 5F0WA 1KLMB 1VRUA 3CIZA 2EVZA 3E3XA 4C7QA 5F8JA 3KG4A 1HW8A 1RT6A 2IVYA 2JX2A 2ZE2B 1K0VA 2GQCA 1SH3A 4KJIA 2HS3A 1NRKA 4IRCA 1LW0B 1ZM3A 1T05B 2AQ4A 3B4DA 2ZZNA 1EETA 3KKFA 4C0HA 4K4WA 2XS7A 3FRZA 2FY1A 1N52B 3FMWA 3IGNA 3MEEA 3OTEA 4TY8A 4ATNA 5KFXA 3ENVA 2DHXA 1H2TZ 2GMLA 3BSCA 3TI0A 2DD8S 3DHXA 2VZ9A 4I4BA 2WSCC 1TL4A 3CDWA 4RW6A 3M6XA 2YTCA 4ELVA 1R89A 5J2MB 4DR4F 2HGLA 2BOPA 2V8GA 2W8LA 4I68A 2BJDA 1FEEA 3WBZA 1U2FA 4KSEB 2CVIA 3DRSA 1UA0A 1HD0A 3D54A 5I3UA 4PR6A 4DL5A 1F5BA 1IKYA 1G6BA 1S79A 3DYAA 3I0RA 4B02A 5IQ6A 2ATLA 1ZOTA 3QWPA 2XSFA 1L3UA 2YWGA 3DLBA 2VPYB 3FSYA 3ZZTA 1XMBA 2KG1A 3O1LA 1HBMB 4WFXA 3VZIA 3V4IA 3X1LB 2LMIA 5LXRA 4IFVB 3DC2A 4XIUA 3BDPA 4KE5A 3PW4A 3SQGB 3Q0AA 4M5DA 3HZGA 2MMYA 3NCQA 1IN0A 3EGNA 3F56A 2VA3A 2UUWA 3DN9A 4IR1A 2B4PA 2GHWA 5AE1A 5C24B 2DNOA 1HBOA 2BR0A 2AWZA 2O1PA 2V94A 4AQYF 1LW2B 4HL9A 3K2YA 3T19A 1OSDA 4BC9A 4YFUA 2NYIA 3LPYA 2MY7A 2CQ2A 4RU9A 5KFRA 3Q2TC 2E9RX 2RDIA 4Q0BB 1V3RA 3NMAA 2BACA 1FHTA 3T6JA 5L9NA 1LWEA 3BEGB 2WSFC 4C8LA 4RW4B 2DHAA 1Y7PA 3VAHA 3E01A 2XY6A 1RGVA 1KOOA 4YY3F 1ZPWX 1Q8BA 2OFHX 4DX8H 5JUMA 4O3PA 2YWFA 1D0EA 1WTBA 3T1AA 1ZAWA 2RNEA 1VQ5S 2C28A 1DQ9A 3HO1A 1LK5A 2JVOA 4NLXA 1CC7A 4HT7A 4DUZF 4H54A 4I6AA 1M0SA 2F8EX 3NMRA 4DFKA 4WIIA 3QIPB 3I32A 5KFIA 1U1LA 2FVRA 2RUGA 4NLQA 1K8AT 5F8IA 2IHR1 5CZVA 1GXUA 1S4FA 3RW6A 1RJJA 3LF0A 4OJGA 4B3OB 1N32F 2EI5A 2M9KA 3ZZPA 1KVJA 1MROA 1X4EA 1S6QA 2KB2A 2MHEA 4PWUA 1ZZFA 3QWUA 2IAJB 1R31A 4F4WA 1TL5A 4KHRA 4PWDA 1KS2A 1SB6A 3WX4A 4FS1A 2YWEA 5IS2A 5GADI 4WCEQ 1LWFB 3KNGA 2VC1A 1RT5A 4RU2A 3P96A 2CJAA 2UUCF 2YNIB 1RTIB 2G9OA 2HNZB 4PRFA 4F4YA 3C46A 4HHJA 1RT4B 2IJNA 1P1LA 1XN9A 1SUQB 3VAIA 1EP4B 1HWUA 4H4OA 4TU7A 1NKEA 2R2TA 1WHVA 1RT2B 2HIQA 1RTHB 3NCRA 5KG1A 5H9EJ 2QMXA 2V0NA 2ZUGA 2VOOA 1QLNA 4MJKA 3BQ0A 4DUYF 3N9UC 4Y65A 4HDGA 1VRTA 2J9EA 1FD2A 1VBXA 4DL7A 3PFEA 1YJVA 4J9KA 2WOMB 5KFPA 4KC5A 5LXYA 5I42A 1AUDA 2QT7A 4J9QA 4C3KA 1V6HA 3PDNA 1UETA 5KFMA 2YY3A 1JKHB 3L95X 4F26A 3NNHA 1C0UB 3AB2B 2VODA 3LAMA 1N5YB 3HPOA 1KONA 2ZKUA 2ALZA 2MKJA 5F3ZA 5AXKA 3TARA 2E7XA 3B78A 3HT3A 2Z8QA 3OR2B 2X1AA 1BQNA 1FK9A 1HI8A 1YJRA 3MM8A 4NLTA 2ZH2A 1KOHA 1D9FA 2ADBA 1WHWA 4F67A 2E7WA 2ZNZA 4IYQA 4WXOA 4ECSA 4H4MA 3MDFA 2B43A 4WFYA 4P6QA 2ZD1A 2JC0A 5B0CA 4QOTA 1SKRA 2XWXA 5CH7B 4WFZA 4ZPDA 1H98A 2CZ4A 2DT9A 1TKTA 1JLEA 4LQ9A 2MKKA 3FQKA 2JH3A 2G1DA 2U2FA 3L09A 4PQUB 3KLIA 5L39A 2R8IA 4Y34A 3T5HA 2MDAA 4I2QB 4IO1A 2B6AA 2HVHA 3QGHA 2DGWA 3O3LA 2YKOA 2E5JA 3GG0A 4RBVA 4OX8A 2PMHA 4NLUA 1IR0A 1Y5NB 3CE8A 2KHCA 2M4MA 2RB7A 2WCXA 3AJ1A 4I69A 3TYTA 3DNCA 4K0KF 3S1TA 3VR1A 4X4PA 2J6SA 5L1KA 2HHPA 5EUHA 1I1GA 4HYKA 1SXLA 5E3CA 3OLBA 1Y5LB 2DGUA 4Q45A 3PX0A 1QSSA 5J1NA 4W92B 4JI4F 2JRSA 2HRYA 2P9GA 3OUYA 2J0SD 3SDEA 4E8UA 5HO4A 4WF9Q 1X5SA 2IBOA 4C8ZA 2BANB 3OXFA 3I4HX 2NXUA 1RI7A 5F8NA 1C1CB 4C11A 4B9TA 1U25A 4IG0A 5B0AA 4A8FA 3DLEA 4B3MF 1BGXT 1FTCA 2RF2A 1BLUA 2DNZA 4KQZA 4UOCA 3MM7A 3KJVA 3LUYA 2ZDPA 1K1QA 1NK8A 1IJFB 3JSYA 3MHYA 4ZVEA 1HBUB 2BM1A 3MCSA 2KZZA 6FD1A 3V81B 3IN5A 4NLOA 2ZH8A 4OZNA 5C42B 3BGRB 5DETA 5CXTA 3NLCA 1FNOA 4A8OA 5KFBA 2HQIA 5H1SV 4DSKA 4K4TA 1HYSA 4F2RA 4R0JA 3UD3P 5A8WB 2D41A 1N56A 3MPWA 1FE4A 2V4RA 2Q6BA 1V3SA 2EG1A 3G6XA 2ZHAA 5LMNF 4PUOB 1X4GA 3NP5A 2J9DE 1D9DA 3NAHA 4WKYA 1QM9A 3MTKA 2FB0A 3KLFA 4JYAF 2M7SA 3TRGA 2KN4A 4IFYA 2IYGA 1C1BB 3HHEA 2FHKA 3DRRB 4G1QA 4A47A 4Q8FA 4K50A 2CRLA 2B56A 3G8TA 3M8SA 2R7QA 2OPSA 1DTQA 3DDNA 1S0OA 2QZ8A 1JLQA 1IKWB 3ZZRA 5GADU 2IM3A 4QW8A 3C2PA 1W2BR 4CO5A 1F60B 3UCUP 4K5SA 1FDAA 3AQOA 4CO2A 3SZ2A 4ITSA 4ALZA 3SSSA 2XY7A 1S6PA 1JLAA 2J5AA 2KYZA 4MYUA 3VAKA 2VL1A 2DH7A 5IM0A 5EDWA 3W2WA 1Z2ZA 3E8OA 3KMSA 3ITHB 1JLBA 5B0FA 2XZWA 3R5AA 1S6OA 3CC2S 5CYQB 2QO3A 5JVHQ 2QLWA 1TV6A 2QSWA 4IRKA 4JI5F 4CNYA 4Y0FA 2F8MA 1MMDA 2R8HA 1BWEA 2D9OA 1JLFA 2EPIA 2A10A 2KJWA 2PIIA 2ZKTA 1XMQF 1RP5A 4J5OA 2E1MC 3LW5C 4ZP7A 3GR0A 3MMJA 2D1CA 3ICLA 4RW9B 5HI7A 1WACA 1VQ7S 1HNIB 2UVUA 1KQFB 3GR1A 2R7OA 3CCMS 3T5JA 5HL7Q 4PXBA