3KNGA

Crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, determined to 1.9 resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
98
structure length
98
Chain Sequence
ADEVTFVNRFTVHGAPAEFESVFARTAAFFARQPGFVRHTLLRERDKDNSYVNIAVWTDHDAFRRALAQPGFLPHATALRALSTSEHGLFTARQTLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SnoaB
publication title Crystal structure of the cofactor-independent monooxygenase SnoaB from Streptomyces nogalater: implications for the reaction mechanism
pubmed doi rcsb
source organism Streptomyces nogalater
total genus 26
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature ec 1.13.12.22: Deoxynogalonate monooxygenase.
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kngA00
3IWXA 1GXTA 5B0BA 5B0DA 1IUJA 2LQ9A 4YEAA 4EFAC 2GO8A 3BGUA 5F0WA 2K7JA 3KNGA 2K1RB 2W4PA 2ZDPA 4ZA1A 4Y2IA 2BUNA 2FTRA 2GV1A 1OQ3A 5T7LB 1KVJA 2XMJA 3BN7A 3BR8A 2W4DA 5F0UA 1YJRA 2K1RA 3CJKB 3BF4A 4OJHA 2PGCA 2ASYA 1R6YA 3HHLB 1Q8LA 1Y0HA 4FNIA 4HL9A 1FD8A 2JDJA 3UDCA 3KG0A 3DXSX 2EW9A 3QMQA 4QOTA 3BB5A 3F44A 4Y2KA 1OPZA 5KAKA 4DL0C 1YG0A 4Q2MA 3HHLA 2GGPB 2OFGX 1VQSA 2GFFA 3K7RA 2ROPA 2QYCA 4Q2LA 2K2PA 1N5QA 1TR0A 3HHLD 1AW0A 1WD6A 5K9FA 2ZDOA 1TL5A 2GGPA 1P6TA 1FVSA 1YJUA 2AJ0A 3FMBA 2KYZA 3T9NA 2AP6A 2N4CA 2FIUA 2ACYA 1YJTA 1YRXA 3KG1A 1Q53A 2OAUA 1SI9A 5B0AA 1OSDA 3I9ZA 2BYCA 4HI1A 3FGVA 1VQYA 2OFHX 3HHLC 2K7KA 4DN9A 5B08A 1W2IA 2LDIA 3LO3A 1FESA 2RILA 2HFNA 3LGMA 3HX9A 1MWYA 2OKQA 1RJJA 1V3ZA 5B0EA 4A47A 1Q8BA 5T7LA 4FNHA 1FE0A 4YDXA 3GZ7A 2FHMA 3CJKA 5IXUA 1Y3JA 1N5SA 2L3MA 2ROGA 1Q4RA 1SQEA 4HH1A 2FB0A 5A6PA 1Y9OA 4A46A 2Q3PA 2N4DA 4A4JA 1Y3KA 2LXFA 1XBWA 3HFKA 2AJ1A 1TL4A 2HQIA 2PD1A 1GXUA 1N5TA 2OMOA 3DCAA 1X0PA 4U9RA 1CC8A 2W4CA 4OIXA 2LQBA 2G9OA 2HFOA 5B0CA 1TUVA 1X8DA 2N7YA 1TZ0A 4OJ1A 3KKFA 5B0FA 3IWLA 4ZOSA 3HF5A 3LGNA 4OJ3A 1CPZA 2KKHA 2ROEA 4OJGA 2RMLA 2IYGA 2OD4A 1SB6A 2BBEA 1KVIA 1JK9B 3TNVA 2XMMA 3TOQA 1URRA 1FE4A 4NL5A 2XMVA 1X7VA 2KT2A 3E8OA 1APSA 1ULRA 4HH0A 5B0GA 2OD6A 3WDOA 1LQ9A 2XMWA 3BM7A 1OQ6A 5A6WA 2CRLA 2GCFA 1MWZA 2BJDA 4HI2A 1AFJA 2RSQA 2KT3A 4Y2MA 2HLTA 2BJEA 3QGPA 2AW0A 4NPOA 4DPOA 3VTIA 3TRGA 1JWWA 2VH7A 2HLUA 4A48A 2XMKA 1FVQA 2HIQA 1S6UA 1QUPA 2VV5A 1KQKA 2OP5A 3FRYA 5B09A 1U7LA 2XMUA 1K0VA 1N5VA 2GA7A 1P8GA 2QLWA 3HDSA 4F67A 1FEEA 2XMTA 2IYIA 1AFIA 3MZIA 1CC7A 2IFXA 2RU9A 2QIFA 3BDEA 3MCSA 2QLXA 1YJVA 1S6OA
chains in the Genus database with same CATH superfamily
3PM9A 3P49B 3M1VB 3NCPA 4DN0A 2Z30B 4C2MA 2IBKA 2AIRB 2GIFA 2F8HA 2KXHA 4F3MA 2POKA 3DRYA 4MFBB 1Q78A 2IRYA 1VQ6S 4MTPA 2GX8A 4FVCA 2KG1A 2QSWA 3BPDA 2F9DA 2UVRA 2A18A 4JV5F 2NUHA 4QIVA 4ZITA 2C2EA 1OY6A 3A8JA 1LW0B 3K8VA 3CUNA 3GZ7A 4ZVQB 5AXNA 1FEHA 3O8WA 4KO0B 2Z2YB 1WEXA 3GSIA 1S9FA 3KHLA 2H1YA 1NDLA 3TNVA 2G4BA 2D7SA 1IXKA 2M9KA 4HACB 2CNOB 5CQGA 4DX7A 3IAS9 4WFYA 2W01A 2IYIA 3OL8A 2JNJA 1CJTB 2HWHA 3MWBA 4QIWD 3EGWB 4I64A 2W4PA 5CYQB 3TP2A 3M8RA 1GX6A 4OI6A 2MZTA 3G6VA 2RUSA 3MPWA 4PG5A 1VJQA 3QFHA 4KT0C 2HGMA 2R4FA 3M2UA 2R7VA 2D9PA 3VALA 3ILIA 2C2MB 2ZH4A 4RUCA 1M5OC 3PG9A 1JLQB 4I0WA 4ETXA 3C6TB 4OZNA 2EFVA 3KJNB 1NHKL 5AE1A 1KC8T 4OLOA 1EETB 2F8MA 2IM0A 4U9RA 4JI3F 1KNZA 1HBNB 2PE8A 3HF5A 3W5XA 4YY3J 1BQMA 3GONA 1S9EB 4E98A 1HBMB 4NCAA 1KR4A 4FN5A 4G1IA 3W66A 4URGA 2FZCB 2Y8WA 5AE2A 1RSCA 2GW8A 2DPIA 2V67A 1Q7YT 3D0GE 2GIQA 2CJXB 3FQLA 5D0EA 3VZIA 2ZWOA 2FC9A 4OI3A 1Q86T 1VQ4S 5DLFA 1LEOA 4Z37A 4B08A 2FLPA 5H9EK 2C1EB 4OFZA 2H51B 3T41A 1SJ4P 4IRKA 3L95X 2D9OA 2Q1LA 2EK1A 1H6KX 4I6YA 2E5LJ 2UUAJ 1QAXA 3F56A 1Y5LB 1XNQF 1XMOF 3HZGA 3VAFA 3X1LB 2HS0A 2XC9A 1TKTB 3Q83A 1HNXJ 4LRFA 3W8GA 4RNNA 3IG1A 3R7SB 1QLNA 2HGLA 4M5NA 1JQGA 1JLGB 2F63A 4UW2A 5EN1A 2VDIA 3BYPA 3GR1A 3IRXA 3H90A 2E7WA 5ETTA 3O2IA 3T5LA 4DQRA 1VR6A 1S1VA 2V34A 2IRUA 4ELTA 2NYIA 3VVTA 3EVOA 5KFBA 5J1PA 3K0JA 1OO0B 5KFSA 2C2DA 3DOKB 4RNHA 2YNIA 1O51A 1RKIA 2P9CA 4GKJF 1WNEA 3W61A 2DD8S 3R5GA 3HDSA 1RHRB 4RW4A 3C19A 3M8WA 2MQNA 3JTNA 2VQFF 2HHXA 2B9YA 5FD1A 3FSYA 3F41A 1NSPA 5HBMA 1R8HA 4P6QA 2O5DA 2V9WA 1K44A 2ZH2A 4GC7A 2ZD1A 5BYQA 1AYEA 4D3GA 4CLZA 1YG0A 3PW4A 3W63A 1JLBA 4DR1F 4JI5J 1IWGA 1KN6A 1O5JA 4WE1B 2HHHJ 1S6PA 2PEBA 4RO0A 2ATLA 1S0VA 4FBTA 5ETQA 1TL3B 2HBZB 5IWAJ 3MPVA 3HO1A 1OMSA 2H5EA 2C2KB 2CPFA 2QFJA 2BBEA 4Q8FA 4WU3A 1UVMA 2KN4A 4ECUA 4C8KA 2VBZA 3S01A 1T3NA 2G0JA 1RI7A 4Q43A 5EHHA 4JI4J 2HIQA 4IUFA 3NAIA 2WRMA 2NQPA 2HNDB 4F67A 1IBKF 1ZZNA 3KFWX 2CPEA 1SC1B 3NBPA 3QQCD 4C3LA 4G1PA 5SUHA 2RHQB 3M8PA 2CPXA 4DV5F 4FNIA 1CJVA 3UR3C 1NEEA 3LP2A 1KQSR 4X4OA 3DGPB 5HK4A 3K7RA 2FD2A 2ZKUA 3DOMA 3H5SA 4RKUC 5KOWA 3TEHB 3JSMA 3N79A 5D15A 4HEA9 1NKCA 4CYUA 4ED2A 1OYDA 1UVIA 3NOCA 4H4KC 1X4FA 5EDWA 2CDRB 3P8BB 4V1Ak 4C48A 4NLQA 2MGZA 1LXNA 5IZHA 2XTJP 1RT5B 1R8CA 3D3CJ 3PIPQ 1Q16B 1IBCB 1WSRA 4RW4B 3MM6A 3OBIA 3D2WA 2MHEA 1FO1A 1JIHA 2WK4A 4N8NA 3H98A 4ECYA 3DC2A 1FWLA 1VK8A 3MF5A 4ZCMA 2G1HA 1Y0HA 3TAPA 1Y10A 1IR1A 2J7WA 3GU0A 2IDEA 2XHCA 3A13A 4DPXA 2Q66A 2KYZA 1LWFA 4CO4A 2YNFA 3CJQA 3HHLC 1WHWA 1MWYA 1FDAA 5ETNA 3JQMA 5CABA 5LSRA 1FRIA 5A6PA 1HWKA 5KFQA 3DCAA 4AQYF 4X4SA 3MMCB 3PRVA 4MIAA 3MM7B 5HMXA 1YBTA 2NCKL 3EVWA 1R0BG 4U96A 2HHTA 9ATCB 4MK8A 1KQGB 1NNDA 3AOBA 4U6PA 1EQMA 1MMNA 3KMQA 3BBBA 4WYLA 4Q5VA 3ZZRA 5KFXA 4JV2A 5DS7A 3M8PB 4E8UA 3RW6A 1RGVA 7FD1A 1FKOA 3G9CA 3MMBA 3DOMB 3W9HA 3HCXA 4J9MA 4CO0A 3SFGA 4DHVA 3JSMB 3TZYA 2QTWA 2FHOB 3PY8A 3T9NA 3UD3P 3FGVA 4RUAA 3PFEA 2MB0B 3FK4A 2JSXA 2XYGB 1N6QB 5F8MA 1CEZA 2MZRA 3G8SA 3B6BA 4NI2B 5I3PA 4USKA 5A8KB 2RQMA 1U1KA 4ID5B 4MYUA 3RRGA 2E1MC 3CWJA 2B4OA 2AYBA 1O6XA 2BANA 3OTOF 4DPOA 1HFEL 4P2SA 1KQKA 1EQ0A 3UW1A 2JEFA 2MQLA 1WG1A 5LOQA 1IN0A 4ZP6A 4PPDA 4F3QA 1F0XA 1UFWA 1JLAA 1UWBA 4TU7A 4DG1A 2ASYA 4X62F 1PJ6A 2ZH1A 3DXSX 1S59A 4QIEA 4B3SF 2OJ3A 2IC3A 4LJMA 2QZ8A 3KTQA 4ZLPA 2GHPA 2FIUA 1QAJA 1RYSA 3I9ZA 1GX5A 2E1CA 1R7IA 1QE1A 1TKZA 1U2RA 4FPRA 3QIPB 2ABYA 1FA0A 1S77D 1WKLA 2MKIA 3WHIA 3FBFA 2M8DB 1RBAA 1SJFA 1ZA2B 1RWMB 4NASA 1HI1A 2A3JA 1JJCB 5M2RA 1HYSB 3HVAA 1HHQA 5G4DA 4EYIB 4Y2CA 3J7ZT 1BHNA 5IQQA 4DXLA 1NB7A 1OY9A 2OSRA 2VIHA 2XY7A 5B09A 3MR5A 1VGYA 3JSYA 1T9YA 4FF4A 2CZ9A 1TL7A 2P9GA 3OFEA 4DV7J 1RT2B 3JQKA 3J7Z5 1HBOB 2IMWP 2C3PA 3SV3A 1FKOB 3IP0A 3GIIA 1FKAF 3H8YA 3GE9A 3T19A 2OEMA 3D0HE 4QPXA 4LF6F 3SSQA 3ILJA 4TYAA 1KLNA 1XQIA 3PW7A 3KG1A 1DBDA 4HI1A 1VI7A 2WONB 5GADU 2R7XA 1HQEA 3IM9A 2W7AA 3W2VB 3D67A 5BYSA 3KWMA 3R3TA 1ZM4A 4IFYB 2QA4G 1GMWD 3FBCA 3V6JA 3NWRA 2UUTA 3R7BB 4LF4J 1NCLA 2A2DA 5GAGI 3GCXP 2VFVA 5D4PA 5D78A 3RU0A 1CBKA 4KHPF 1YJ9S 2PMHA 3G86A 2VC1A 1FF2A 2WVFA 3KXDA 5EUHA 3VQSA 4N8OA 2YQ1A 2WSCC 2XZWA 4DLGA 3HPOA 2BE7D 4JI6F 3G6ES 3ZXWA 4DG1B 1V9OA 4LSNB 4NLSA 4A8SA 4DU7A 4RW7A 2BQ3A 1IWAA 3KG0A 1FNMA 3AAWB 4QWDA 3F44A 4YP3A 3OL6A 5DZ6A 2W9CA 3CO9A 4ILRA 2O3DA 4LF5F 1QE1B 3LAMA 1HARA 1UJ6A 2V4QA 2ZBIA 1UP1A 1U2CA 2H4WB 1HWUA 3CO0P 5KG7A 4LQ3A 4ECQA 3CDUA 4A8YA 4P75A 3T5KA 3NP5A 3LANA 1XWLA 3GYNA 2VF3A 1YX2A 3D3BJ 3M2RB 5IT0A 4FKXA 5C25A 1RT7B 4YB1P 4Z7CA 3BM7A 4CM0A 3E01A 3HM9A 1RHUB 2ZVIA 3OTEA 4OZ0A 4OZ1A 2GQ2A 3KK1A 2B9XA 4K4VA 5AJ3F 5J2PA 2G2YA 1NBEB 2V9KA 2DNYA 4LFAF 2BRLA 5IV4A 5HQLA 2A6OA 3BN7A 1QSYA 4DSLA 2V50A 3UVJA 2CPYA 4LRBA 1L3VA 3HXMA 3CIMA 3UR0A 2Y1RI 4N76A 4O3QA 3CCES 2VA3A 4LMZA 2AT1B 3IS9B 1N88A 2CQ2A 4OX8A 5KFIA 3M32B 3QJLA 3RR8A 2ZZMA 3FVYA 1SCJB 3OD2A 3RUBL 1LFWA 2IAJB 3PJ9A 2ADCA 2I1RA 2ZNYA 1N56A 2F7VA 1PBAA 1LK5A 2DO4A 3A1YG 4CLYA 5IT9Y 2OPSA 1D09B 4CH1A 2DVIA 4C11A 3GFYA 1TK8A 1XNQJ 1XMOJ 4DZDA 2IVMA 3TQ1A 3PX4A 3R5BA 1YJWS 2BKNA 1ELOA 3T1HJ 4ES1A 1FFSB 2RQ4A 3KHRA 5E3AA 1UEUA 3BKFA 4G65A 1GEHA 2BJ1A 3TAMB 5T41A 4NA2A 2Z8QA 4QOTA 5I42B 4EZ6A 4NLTA 1EAYC 1R89A 4WWSA 3QBCA 2XSJB 4ECSA 4PQUA 1TL5A 1R27B 2B9EA 4ZPBA 3TJAA 4ZVEA 1IBMF 2OFHX 3ENVA 3KDOA 3SQGB 1T3OA 4ERDA 4Q0BB 3P45B 4OZ3A 5IXUA 4HDGA 1J5EJ 4HH1A 3TYTA 2FPHX 3GQCA 1RTJA 1N5YA 1LKZA 1CC8A 5B0CA 4KBIA 4YMEA 2PEHA 1X8DA 2KRRA 3GJTB 5C25B 1JNZB 2XCAA 4UZBA 4I67A 1RBLA 3B54A 4TY8A 1HIYA 2CNLB 5K5MA 3PHEA 1U1RA 4V19X 4DWIA 2RAQA 3M30A 5DDPC 4USUA 2PDAA 3K8WA 4PG4A 3J7AN 3N01A 1UCNA 4KGZB 3NCRA 2HK3A 2CVIA 4ECRA 2PFDA 1IQZA 5A8RA 2AV5A 1DRZA 2UXBJ 2ZNZA 4I2PA 4J9OA 1PAEX 5HVHA 3C16A 3F0NA 4YFUA 4UZCA 4OHYA 4FS1A 2KTQA 1WWHA 1FJGF 1BQXA 2VKRA 1HKAA 4N5SA 1V6HA 2OPRA 2K3KA 4FBUA 1N36J 3H5YA 2FB0A 1IBKJ 3JYTB 6FD1A 3R27A 2MZJA 4AUKA 4GVLA 1PC4A 2UXDF 2XMVA 2M7SA 3R6GB 1C1BB 4ANEA 4X4TA 2LP4A 3HKZD 3D5MA 1QDUB 2HVIA 4FDFA 3PIOQ 1JWWA 2HLUA 1L3TA 3CJ2A 3CPWR 1X0FA 4USWA 1UVNA 4LBIA 2D3OR 1FRLA 1G4CA 1YKWA 2DY9A 1JKHB 3MMAA 4IR9A 4AT1B 5L1IA 3ZZ0A 1R8AA 4RUBA 2PT0A 4DFPA 4IO1A 2IJRA 5DG7A 3VAHA 2CJYB 4PQUB 3CB4A 2VB6A 5KG3A 2JL9A 2OPQA 2DK2A 4ZS6A 1M5HA 2FJWA 1GQEA 2ZBPA 4K4TA 3EZOA 2DNOA 3BSAA 4OYBA 3W5YA 2CQ1A 1RTJB 2YKPA 1N5YB 2YY3A 1SQEA 3H2VE 4WJBA 3VAMA 4N77A 1S9GA 4DV3J 2JX2A 4OX9F 2NSCA 3GV8B 2J0WA 4FYXB 5KFGA 3M30B 2GHWA 1R0CB 3SXLA 4CLLA 3Q2TC 4OYOA 2XS2A 1HHSA 3GYGA 4JI7F 2R9LA 4LSLA 3JAMU 2Y9HA 3H20A 2U1AA 3CJ8A 1CULA 1GMVA 1K73T 3UQSA 1Q79A 1S7IA 4HHUA 3O3LA 2XMAA 5KFTA 2HVHA 3ZZOA 4AQYJ 3C16B 2PA3A 4ZLJA 2NZCA 2WHOA 4ZVUB 4U67Q 2LU1A 4G1QA 4DL5A 1FDDA 5DRKA 2W7PA 3KG4A 2HFZA 3GTYX 1NJYA 3RRKA 2NSBA 4C98A 5L8RC 3G87A 4TU9A 5FIIA 3ISND 4W98A 3CCVS 5L39A 2HKEA 4OX6A 4USHA 5LXRA 4LFCJ 1W2BR 1KHWA 3U1MA 3HJFA 1S48A 2XI3A 2J9DE 2D1CA 1XBWA 3I82A 3DLLQ 2MLXA 2J9CA 4OIXA 1R31A 1X4HA 4ECVA 3LP0A 1R3NA 1SB6A 2X1GA 1S12A 3CDWA 4TYBA 4UUWA 4CO1A 4WTYA 1UETA 2AEJA 3J81Y 2IM3A 1FCAA 3UCZP 2BR0A 1GH8A 4NPOA 2UVUA 3RG6A 2FLLA 4X84A 1RDRA 1Q81T 3EPGA 2APOA 3H2LA 3IMQJ 4UOHA 1R0AB 4NLDA 2CPIA 3SYZA 2HQCA 5BR8J 3LP1A 4O44A 1WEZA 4J9QA 1WOSA 2K1RA 2BXJA 1VIXA 2HWTA 3PX0A 2QG9B 3ZFVA 1DTQA 3NG8A 4JP8A 3H2UB 3BGFA 5D0RA 4ZCLA 2AP6A 3M4XA 2C28A 3M8SA 1M5PC 5B08A 2LDIA 4PWWA 2R2SA 4PEOA 4Q45A 2CUYA 4MK9A 3FSIA 1M5KC 1Q8BA 1TV6B 4YB5A 1S9GB 4USTA 4ZCKA 3AB4B 4P52A 3MECA 2ZZTA 1VMBA 2IMOA 2YKAA 3KLHB 4ZOSA 1MMLA 1HI0P 1UJ5A 1IR0A 5KG0A 3FEZA 3DHWC 4GO7X 4LRCA 3GILA 2VJVA 3JTOA 1YDLA 5CCMA 4F0MA 4LSLB 5GAEU 5LMUF 3PR5B 4J9LA 2MHNA 3RJMB 4RR5A 1CULB 1VLYA 1PIEA 2FUG9 3M2VA 5IQ6A 2HFSA 4DLEA 3AD9C 5DG8A 3CSKA 1CVJA 4PYAA 4EO6A 1T9WA 1OJ4A 2QV6A 2NXEA 2JDJA 1T05A 2ALZA 1QAYA 2E5HA 2W24A 4LF8J 4MT1A 2MY8A 4FXWA 4NLVA 1X4EA 1F60B 2WSEC 2K7KA 5IC6B 3UCUP 1SUQA 4MH8A 4XIUA 1F9HA 2Y1JA 2O67A 4ENOA 1EB0A 3OW2R 1C1CB 9RUBA 2QX0A 2YXLA 3HHNB 3H40A 4NEYA 2FVQA 2KFZA 2RRNA 3N6MA 5A6WA 2F4FA 2NYHA 4M63A 3OTCA 3ZZPA 3TRGA 2OI2A 3A8KA 4YS2A 2EKNA 4IG3A 3KLIA 4ZVGA 3LPEA 4A8QA 1LWXA 1F2HA 2XSFA 2B43A 3LP1B 4O44B 2HVDA 1B99A 4WP3A 2K1RB 4LFBJ 3TWZA 1KEKA 2OH2A 1FKPB 1RU2A 4PUOB 4P10A 1FJ7A 3Q86A 1DTQB 2QGFB 4B9NA 3SV4A 4XAKA 2AX0A 1PC5A 3D6HB 5GAHU 3MEGA 2NREA 4DL4A 2R2RA 3J80U 3OT9A 1S0MA 5ETKA 3UN3A 2JVOA 1SH2A 2DNNA 4USMA 1YGYA 1MWQA 1BC6A 2ROGA 3C66A 3HFKA 1YVFA 1DQ8A 4JI6J 1KBRA 3U27A 2V69A 4NWBA 1KS2A 2RJZA 4K4UA 4BCAA 3L09A 4ELUA 2UU9F 3DLEA 3T1YF 3U1LA 2KYXA 5F8HA 3PZPA 4N56A 1WC5A 4J9VA 1HR0F 4LF1A 1B7FA 1TK0A 3SSSA 3BQ0A 2C2NA 1RAIB 2VV5A 4JI0F 2KU7A 3FQKA 2MXYA 2GAHC 4DV4F 3M2VB 1ICEB 3T3FA 4OYIA 2KJWA 1RTIA 3IN5A 1WSVA 4QIGA 1T05B 3NMRA 1RT3A 1XMBA 5HQMA 1ZOTA 2EW9A 2W9BA 2XULA 4LIRA 5F8LA 2YVSA 5KFJA 2ZDOA 4WKRA 5H9EJ 4P7VA 1FTRA 2IPOB 1BWEA 4KHRA 2R42A 1CS4A 5LM7E 4FNHA 1YBUA 2MYFA 3I32A 2WBMA 2YNHA 2BQUA 3R5DA 5HP1A 3FBBA 4WP8A 2CJAA 1UFKA 3FCVA 3I5AA 4OJ1A 4QZVB 2FJVA 1GK8A 3ZTRA 2GVDA 4U7UK 2KT2A 4ES2A 2QO3A 1X60A 5L9NA 3EGZA 1HWJA 3VTIA 2KM8B 1Y5IB 3BO3A 3NOGA 3RB4A 4NLGA 2DNHA 2Y8YA 4NZ6A 4AL6A 3IBWA 3QGIA 4I7FA 4FXDA 4RWWA 1UA1A 1X31C 4BHQA 3UDEA 2VG5B 1AROP 4NCGA 2EC2A 3BQ2A 3TEGA 4UTGA 3CJKB 3RGIA 3C8YA 2G0IA 4PG6A 3MEGB 1LXJA 4A8OA 1N5QA 3KJQB 2C22A 4K4XA 4CDIA 2KFNA 3G8QA 1U1QA 4AD6A 4B3OB 3LOUA 5IT4A 1OSCA 3I6PA 4DR6F 5T7LA 3NGKA 2E44A 2RDJA 4QYZK 1V3SA 4HYKA 3OTBA 4CTAB 5KFUA 3E51A 2DH9A 1O8BA 4IO9Q 2HIYA 1NK7A 2ROEA 1AZSA 2AU0A 2OIHA 1FFWB 2MQQA 5HMWA 4H4MB 3BZQA 4O4GA 5HMZA 1JNRB 4PRFA 1SPBP 1HI8A 2YX1A 2L48A 2EWHA 4K4SA 2CQGA 1SH0A 1IBMJ 1A7GE 2R7WA 2V5HG 1NPRA 2CPDA 1WEYA 4YR0A 4I2QB 2VQEF 3K59A 1HNWF 1OQ3A 3QAUA 1G7CB 1S49A 3ET6B 4B02A 4GRSA 1N54B 1LOUA 3R8YA 3OLBA 4CRJA 1CJUA 2RS8A 1C0TA 2PA8D 1U8SA 3QZ8A 5KFVA 4AL7A 3DLGA 5C24A 1SI9A 4DQIA 1WC4A 3I56S 3C6UA 5I3QA 2Y0BB 1EHWA 2F40A 3H7HB 4KPYA 1BQNA 4JI1J 1MU2A 4PR6A 4DR3F 3GG1A 3HJVA 1NK4A 4CP5A 2J7KA 4MKAA 4DR7J 3I96A 4DPTA 4DX5A 2P6SA 1JLEB 3B8HA 4O23A 2WVEA 2G13A 4V19J 3DLKB 4RNFA 3MM8B 1SBRA 2GMLA 1AFJA 2RUGA 2Y3YA 4L74A 4DR4F 5CYMB 3N9UC 3PRDA 1FDNA 1QSSA 1FJGJ 1FEEA 5F8JA 1AFIA 2UUCF 4J90A 5HJYA 4RBVA 2YTCA 2DB1A 1FTCA 5D4NA 3BF4A 1RKJA 4ZPDA 2ROPA 2L41A 3QT6A 1X4CA 2XLJA 3C15A 1S4EA 2RKIB 4CNYA 2HFVA 2MJNA 1IKVA 4M5HA 2R8JA 1FXDA 1C4AA 4CO5A 1G1XA 1G6BA 4F36A 1Q82T 4KV8B 1V3ZA 3AJ1A 1V5VA 3QT5A 3PW5A 1AZSB 4J7CA 2KI2A 1H2TZ 4MKYA 4K0KJ 1PYTA 3W2WA 4Y6IA 3RYLA 2I38A 1RT1A 4DPWA 2QL9B 3CD6S 3I0SB 2RH3A 4QCLA 2HHUA 2CQ0A 3J81j 2CZVC 5C42A 5ETSA 1YJVA 2GVZA 1Z4UA 2LEPA 1Y5NB 1S6QB 4U7UD 2CDQA 3WC2A 1FJCA 3D66A 3M8YA 4OX9J 4DL3A 2IA0A 2VG7B 3MTJA 5J2MA 2W8KA 2DITA 5LSLA 2W2MP 5LJ3Y 2DXFA 3DLGB 3DLBA 3HHKA 3UD4P 2J0QD 1S1UA 3D6MB 5DZ7A 1RJJA 3M6VA 4K4WA 1RTDB 4X66F 5A2QU 2DGTA 4W92B 1RTZA 3FMWA 1Y9OA 4JI7J 5I3UB 3Q0AA 3HSJA 2RMLA 2YKMA 2WVBA 4QPTA 3B78A 3G82A 2FGOA 1N33F 4X4RA 3TA0A 3TJ8A 2PIIA 2BJDA 1RWKB 2QA1A 4MK7A 2ASDA 4CLPA 3Q8PB 2DNPA 1S1TA 1HL6A 1XR5A 4WFAQ 3MCNA 1R8BA 4MAKA 1LWEB 2AYEA 2YH1A 2HMIA 3BGUA 3H5UA 1P1TA 3BO2A 4ED5A 3MOZA 4KKOA 2EFNA 4ZPAA 3PKMA 2G2ZA 3MR7A 3PEJA 2DHXA 4M5LA 4DV1F 1WTFA 5HLFA 1TMJA 3VR1A 4R0JA 2WOMB 5JVGQ 5J1NA 1RAJA 3DRRA 2NXCA 3MAQA 3U02A 3IBFB 4DN9A 4KQZA 1M0SA 4QR2A 3KK3B 1S57A 4PQAA 3MAHA 4TQSA 5E3CA 3GIKA 3ICLA 1Q4RA 3D4JA 2F9JA 1RISA 3PJWA 3DI6A 4U8YA 1Q8KA 3TVZA 1EKRA 1TZ0A 3R97A 1KDNA 2XS5A 1FRHA 2BZ2A 4ZVHA 2XMMA 2C2RA 2RT3A 2Y0SD 4PAAA 4E2FB 2M70A 3K57A 1SVDA 2FQQB 5EWGA 4W4MA 3NGRA 2XMKA 1S6UA 2ZZNA 4ED6A 3E2EA 3CJ5A 1VRQC 1Q1KA 1IKXA 1KHVA 2PSZA 1K47A 3P4UB 2FHJA 2MZ1A 3AD8C 5DM6Q 2E1PA 1IBLF 3EGNA 2AJ2A 1H73A 1VQ8S 2YQ0A 2FTRA 2M3DA 1SIZA 2CWXA 2B4UA 3K5MA 4URSA 2ZH5A 4CWBA 1TK5A 4ES3A 2XCPA 1UZHA 3NRBA 4BWMA 1S1UB 3LTOA 2B4PA 2ZE2A 3FZ2A 2ZH8A 2RD5C 3R6LB 4LR7A 3J7YI 3W7BA 5LMUJ 4WPAA 2BE9B 2L3MA 4YQWA 3F73A 2IA6A 5C2CA 2YKMB 3SFUA 3PX6A 3M9MB 1BLUA 5BYRA 1SIWB 3SCJE 3KMSA 2JLFA 2HWIA 4WYWA 4YN3B 4NMLA 3THTA 1VK3A 4QBUA 1NK5A 2QFIA 3NLCA 5D6GA 3FUYA 3WC0A 4H4OA 3N4WA 3BGRB 2ZOGA 4I69A 5HANA 2HMIB 3A3NB 2J9DA 4ZPVR 4C9DA 3KLGA 1VC0A 2CNKB 3TR5A 3GFXA 1HPZB 5A8WA 1Q8LA 3CJTA 5HLFB 3DYAB 1ZAVA 2ERRA 4YB6A 3HKWA 5LT5A 4F4XA 3B82A 1RLCL 2DIVA 3DRRB 4OQJA 3HHLD 3QLHB 1IKWA 2G0CA 4I1TA 1KLMA 3I9V9 4FP9A 4MMOA 3DM2B 1UJ4A 2DIUA 2MKCA 2OUGA 3MCMA 3E3XA 1PAUB 3TZZA 1TAUA 1Q0NA 1VIOA 4IDKA 5ETLA 1TUVA 4KJIA 2XBPA 2LQJA 1JLCB 5B0FA 8AT1B 4DQSA 1JK9B 2ZFHA 4LR9A 3TUIC 5J1EA 1MWZA 2Z2MA 3V6KA 2HAIA 4DR2F 4A8FA 1E6YB 1RHJB 1CSJA 2DRBA 1LWCA 1NKEA 2BE2B 4ZPTR 1UVKA 2CVEA 2QLXA 2BACA 2E5JA 2DNGA 2UUBF 2VL1A 3OFHA 2HNYA 3MUTP 3PV8A 3FZBA 2I6WA 4ZN3A 4F50A 2FLOA 5D3GB 1HBUB 1U48A 4JYAF 3T1YJ 4C3KA 4TY9A 3DMJB 2ZE2B 3G4SS 4K7QA 4DOZA 3G2XA 1ZH5A 1HR0J 1RT6B 1SJ3P 2YWKA 2I8EA 1DZ5A 4RLEA 1P9QC 1PSDA 2YKOA 1NJZA 4JI0J 2L08A 3GIMA 3OFFA 3GFZA 1X5OA 2E29A 3NGTA 1NAQA 4BS2A 1N52B 1L3UA 4DUTA 3V6DB 4PXEA 4R5PB 4UOGA 4EZ9A 3KHHA 4ETZA 2CQ3A 3DOLA 3O6QA 1APSA 1FK9A 2AEMA 5K8OA 2LKZA 4NA3A 4H54A 2RQCA 3I4PA 1DFDA 4B17A 3ADAC 1SQFA 4NRUA 4RW6A 2V4JA 4J9NA 1HW9A 1NDKA 1DLOA 4ZVRB 2DGUA 4TQRA 3ITHB 4LF9F 3G6YA 4RBTA 1JMTA 2LLZA 4WP9A 4IRDA 3Q8VA 4DR5J 4NXMF 5F0WA 2HVEA 2RU3A 1RU1A 2VZ9A 4WKYA 3OXLA 4IFVB 4PXCA 5HJXA 3RTVA 2LDYA 1E6VB 3CDAA 2CJ9A 4QU7A 4R8UB 1SL1A 2HHWA 5BXIA 4AL5A 3K5LA 1IR2A 1VRUB 1KLMB 4OYMA 1G2EA 4NCBA 1U0HA 4F0KA 4NLYA 1CG2A 2HGNA 2AZ3A 5GVQA 4NYPA 2MKJA 4RW9A 4XK8C 1F3VA 3P3DA 4JI2J 2KJVA 2N82B 4NA1A 1WDTA 2EI5A 4JI8F 2QMWA 2D3ZA 2OPPB 3GLJA 3OTDA 5HROA 3LGNA 4K50A 4ZPWR 1Q8IA 2IYGA 1JLFA 1HHTP 3GV5B 4WBFA 2QE5A 5J1EB 3M6XA 3TOQA 1NH8A 3B4DA 1T9XA 2CKWA 2N7CA 7AT1B 3U1NA 1HNZF 2W7OA 1NDPA 2WVDA 4WTOB 2YX7A 3QRQA 3FRYA 2LEAA 2E9TA 2KDOA 4DSKA 1SJ1A 3R7NB 3IWXA 4X4NA 1EARA 1GXTA 2H3EB 4DR6J 1J5OA 3CCTA 5K20B 1N34F 2D41A 2EBGA 1WELA 3M9NB 2FLNA 2GMJA 3LF0A 4YHHF 4WK3A 1I5OB 6FDRA 2XO6A 1RT4B 2RF2B 1VQMS 2GFFA 3R5AA 5D0GA 1I94J 3Q22A 1S1XB 4DUZJ 2SXLA 4TN2A 3QZ7A 1TKXA 2VOPA 2OKQA 1B0TA 1WF1A 1FX2A 2E9ZA 4O3OA 3DFEA 3BREA 2FY1A 3C46A 2DEIA 1N0UA 2KFYA 4NZ7A 2FVSA 2VQEJ 1KOHA 3Q8RB 4YR2A 3RB3A 3VHQA 4ANDA 2KG0A 1LQ9A 2EXUA 2X1AA 2ZH9A 3BSNA 5E33A 2KT3A 4RW6B 4NEZA 2V4JB 5HATA 1VBKA 2XGPA 3KLEA 4PCQA 1NPPA 5E3PA 2XMUA 1CLFA 1FX4A 2XMTA 1LFPA 1MSWD 3KJVA 3IGVA 1NSQA 5ETPA 1NH7A 1B0PA 2DNRA 2DTJA 4DDFA 1KRPA 1NSAA 3QNWB 2V94A 4URQU 4Y2AA 2BOPA 1YJRA 1N32F 1R6YA 2R8HA 4A8MP 5GADI 1L3SA 2HQDA 4DV0F 3T6JA 2GZOA 1SC6A 3AODA 1U26A 4DSJA 1EKSA 4RW9B 4ZP9A 3UWTA 1REGX 3ULHA 4K2XA 4AXJA 2J6UA 3VQTA 2MMYA 2EFQA 2ZH3A 5HAOA 2YQ3A 3FFIA 1TU0B 4F4WA 1JJ2R 5KG6A 2Z56B 1LW2A 1PCAA 1NPKA 4UUXA 3ZNJ1 3PO5A 2RIJA 4R25A 5JUMA 3BYRA 1T95A 1UWAA 3DKDA 4CT9A 3QIDA 3M2UB 4N41A 3HSZA 3CT9A 3TAQA 1J5OB 1QJHA 2ZJRQ 3MFHA 2ASLA 2ZWPA 3JXOA 5EX3A 3UDVA 2UUWA 3VF0B 3I0RA 3M8QA 4OJHA 3LALA 5L46A 4USIA 2QLBB 3CD0A 2CG8A 2H5IB 2V8HA 1F5BA 3DGVA 4W90B 1JJHA 3NS5A 4PABA 5FDLA 1FVSA 2I9SA 1TKXB 3BBCA 1BQMB 5KFWA 4NZ0A 1X9MA 5KFNA 2MQOA 3S1TA 1GXUA 2H4YB 1RQ0A 3BKUA 1AB8A 3POTA 2CAJA 5D8HB 2XMWA 1SKRA 1YHQS 4A8KA 2WBRA 1S79A 2E5LF 2UUAF 3FDSA 3ZTOA 4FYYB 3ZO7A 2P5VA 3KJVB 4DV6J 4ILMA 4WIIA 2XYPB 4P7TA 2LCWA 2AJQA 3CEDA 2WZ1A 4DPYA 1H72C 2QRRA 1NM2A 3EXCX 4LF2A 4K4ZA 5B0BA 1HNXF 3IG1B 1RP5A 2HS4A 5LJ5Y 1TMMA 2VODA 4CT8A 2HHSA 5J2NA 3O44A 1K1QA 1NDCA 3IRXB 4PXDA 1C0UA 2JC0A 3R1LA 2V4RA 1WG5A 3OFGA 2VFSA 4X4PA 4PPZA 1S1VB 1YRUA 3G8TA 5CD4A 4HKQA 3LGMA 2ZC3A 3QAEA 2B6AA 2WAQD 3OXFA 2QA4S 2YNIB 2F4VF 3FFIB 2XGQA 4USVA 1B64A 4ZHRA 2MY7A 1LW2B 3TVKA 1TVRA 3EJMA 3MR6A 2LXIA 2MQ8A 2VPZB 4ZKAA 1XTZA 5HBMB 4F8RA 2QT7A 1M5VC 2FHKA 2ZD1B 2LFVA 3SCKE 1FXLA 3ZZUA 1JLBB 2ZVSA 1RLDA 4XTTA 2LA6A 4JI5F 2RDDA 1SJRA 1Z2ZA 2H5JB 2HHHF 5KFYA 1S6PB 5KTQA 2HRYA 2LECA 3OUYA 5M2PA 4CLFA 5KOXA 2YKNA 2F8EX 3ZTQA 5FDLB 4X65J 3O5TB 5IWAF 1TKDA 3LH2S 3OQ2A 1UPMB 4RW8A 3NNHA 3TZWA 5I4MA 3K5OA 4DUYF 2DNKA 3NEKA 1RAHB 2MKKA 2BM1A 4CCHA 1CJKA 4C8LA 1FRKA 2ATCB 4JI4F 5IV3A 2AJ1A 2HQIA 3HVRA 1PJ7A 2DPJA 4OHVA 1XK8A 3NBPB 4FZVA 3V4IA 5KFCA 1JXEA 4B3RJ 1XNRJ 4GKKF 2FDNA 3HLUA 1KWMA 1CJVB 2WB1D 1N8RT 2ZOMA 3EWGA 3LP2B 3QGHA 4ATNA 4OL8A 4KB7A 3CIZA 1LK7A 1U7LA 5J2QA 2KHCA 2LEBA 2Q79A 3HD1A 4KY3A 1SV5A 4ZPCA 1QVFR 2C2ZB 2OEKA 2RU9A 4CLSA 3PW0A 4CNZA 5B7WA 1Z2LA 2YKQA 4B3MF 4CYUB 1VQKS 1HNIA 4UQGA 1WHVA 2DH7A 4F4AA 1HMVA 2ZM6J 3M8ZA 5CZVA 2X51A 1BUXA 3M05A 4Q8EA 4NE9C 4UT4A 4AYBD 1DQ9A 3JTPA 2XZDB 1U8WA 2NXNA 4M5DA 3GIJA 2WVCA 2MGZB 1VYAA 2DGOA 3CJSA 3W9JA 4X64J 2AKWB 3VV2B 4OV6A 3D28A 5AXMA 3R2DJ 2R8KA 3ZTPA 3MM6B 2W4CA 4K5SA 2DYAA 4L72B 3KKFA 2MPUA 5MLCV 4ZDNA 1AA1B 3MEEA 3ZNUA 1IJEB 2HBQB 4F2RA 5B0GA 1YJ7A 5F9LA 1RHKB 4R0EA 4QW8A 3SBMA 1RAEB 3HHDA 3UNGC 3WX4A 5H9FJ 1AUDA 2W2QP 1B0VA 1YLXA 1S97A 3MCSA 3HFVA 5ETOA 2AJ4A 3VVUA 1LWFB 1Y11A 4DL2A 2YNFB 2GO8A 4P72A 1VLOA 3QYYA 3BR8A 1ZETA 4ZIWA 4EYHB 1ZM9A 3MPYA 3RB6A 2YWEA 1WOOA 2R8GA 1QM9A 2B7BB 3W1YC 4P9SA 1TELA 4BC9A 2EK6A 1H7WA 5G0RA 1M5SA 4BDPA 3JAMY 5U47A 1F6TA 1TFWA 2YWHA 5A0YA 4PG8A 4WIQA 3GSDA 4O3RA 3MURP 4DS4A 4AFFA 2MZQA 1Z1ZA 1TL4A 2PD1A 2FC8A 3OL9A 3O1LA 2YPZA 3V4IB 4K5RA 2CJBA 5KFLA 2DNQA 1X7VA 2CFXA 2OTLS 2QMXA 1N0VC 1F1BB 2OSQA 3PYDA 5F3ZA 4RU2A 3RAMA 4NYOA 3MMBB 2F1FA 3DRPA 1FI4A 2B8QA 4MJKA 4MIBA 2XLIA 4JYAJ 2GQQA 3HVWA 3IAM9 1VQ7S 3SEOA 3RR7A 1P8GA 1MROA 3SZ2A 1WI6A 3ZC4A 2A2CA 2DHAA 1AXQA 4F26A 2EG2A 2ZHAA 4DV2F 4U8VA 2HZVA 2DEJA 3CXCR 4Y2KA 2B9WA 3CMQA 3BO4A 3R9LA 4Q44A 3V81A 1YRXA 3M1VA 3NAHA 4WCEQ 2HG4A 3OV7A 3Q8QB 1Y7PA 4J9RA 4YDXA 1L3KA 2FHMA 2BANB 4QR0A 4A46A 4MFBA 4LF9J 2XG8A 4C8MA 4I68A 3D6TB 3MEEB 4EGLA 1VCTA 2GNKA 2BKOA 4NXMJ 4C8NA 2KKHA 4JV5J 2C42A 1D3WA 3EDQB 4FF1A 1JLAB 4QYZJ 1UWBB 2Z58B 3UN5A 4FS2A 1VHIA 2HSEB 2HK2A 2JEGA 1FVQA 4KRWA 4KO0A 2IC3B 2OEJA 1HD0A 2KH9A 3RBZA 2BV3A 4M5GA 4M8LA 1XN9A 4HACA 2FVPA 3CDEA 4IQXA 1TKZB 5F3TA 2EEYA 4JI8J 2YPYA 1S99A 2VUGA 1CJTA 2L9DA 4B9TA 2XWYA 4H4KA 2BEFA 1Q5VA 3CJ4A 1RA7A 5IM0A 5EGYA 1M1GA 1VJWA 4CM2A 2VBXA 3IWLA 1TL7B 4OJ3A 5GAEI 1D8YA 1DY3A 3RBEA 1FE4A 4LRDA 1JLQA 2YX4A 1N4LA 1KP6A 1S4FA 5E2QA 3C6TA 4WF9Q 4YHHJ 1O0PA 4HTIA 2RSQA 4XDDA 3W8PA 1EETA 4WFXA 2OP5A 3FJ2A 4JI3J 3NGSA 1FNXH 1GT8A 1U1LA 1HBNA 1OPIA 5GMEA 2RRBA 4YEAA 2X1FA 4MYTA 1B3TA 2EFOA 1KTVA 1S9EA 4ZIVA 5DQIA 2LYVA 1HBMA 1ZAWA 4CQ1A 1HQEB 3VZHA 2M2BA 3MFIA 5IC4B 4Y0FA 3JQJA 3ISZA 3HHLA 2ZC4A 1XR7A 3V81B 2ZBQA 2GJIA 2OELA 2VKZG 1RHQB 3MI7X 2GC8A 3AQPA 4DX8H 1RABB 4HDHA 1Q53A 3IWNC 4LF4F 2KT5A 3MGJA 1PGZA 1ZM2A 1VHFA 3EGVA 1UAWA 3W65A 1D9FA 2MKSA 3VGSA 1BMQB 2N7YA 2KO1A 3AHPA 1TKTA 3FCWA 2E7VA 3TW0A 1N32J 2GCFA 3V5RA 3UN2A 1JLGA 3J80Y 4RW7B 2B51A 3PW2A 3N5FA 2K8GA 3Q8UA 3FNNA 4DV0J 3MXHP 2W9CB 2GA7A 2DGWA 2ZJPQ 5CH7B 1U6BA 5E3RA 2IFXA 1EP4A 2QL7B 3UPFA 3MDFA 4DL6A 3AJDA 4I4BA 4ZJQA 3CD7A 5GAHI 1UA0A 4ED7A 2EFPA 1T94A 1RXOB 2V8DA 5HI7A 3DOKA 4HL9A 2B0GA 3IO1A 1OPZA 4GKJJ 1I6JA 3IFEA 4ILLA 2QYCA 4F3OA 4P71A 4ED0A 3D7SB 4ZMMA 5HO4A 3OHBA 2VQFJ 1OSDA 5DO2A 2CPHA 2QJ3A 5E41A 3E01B 2V2VA 5IM0B 1VOMA 4OYPA 1RCXB 3PXGa 2QEXS 2Q3PA 3V6HA 3DRXA 3KK1B 4B3TF 2MKHA 3EE3A 1X9WA 4DR1J 3EUNA 3QFWA 5J2PB 4LQ9A 3L7PA 4JBCA 4FF3A 4WE1A 1QUVA 1M1HA 1KVKA 2FHJD 1REVA 3CC7S 3NL0A 3N6NA 3CJ0A 1H0HB 3UVJB 2BW7A 2GQCA 1TL3A 1RWXB 3IM8A 2AGOA 3FBEA 1U4BA 1XEZA 5F41A 4O4RA 4OI4A 2L9NA 2AX1A 3HHLB 4QW9A 3UD5A 1WJ9A 4ZCIA 2A1BA 4QU6A 4M5KA 1S7HA 1NUEA 1U45A 5KFMA 2FJXA 3K5NA 2HNDA 2P2CB 2R7TA 4X2BA 4RPFA 3N6LA 3SDEA 2OPSB 4OHZA 4C11B 1VQPS 5K8NA 5JMNA 4DV5J 3HVTA 1Y3JA 4ECZA 3QRRA 1U2FA 1XC9A 1DHMA 1HA1A 1GAOA 4KH1B 2IIHA 3DGPA 4WK1A 2V8PA 3BJYA 3T1HF 5CA5A 4LR8A 1YBAA 3Q8YA 4K59A 2HYIB 5BJRA 2UV8A 2QL5B 2K06A 2YNGA 4XPEA 1EP4B 3NNCA 2DXDA 2MQPA 2HNZA 2RQKA 1T03A 4OZ5A 1S6OA 4IH5A 5IS2A 3PACA 3WBZA 4QR1A 2VBWA 5EWEA 3MPDA 3ENWA 2DRDA 3OL7A 2F4VJ 1RT5A 1URNA 2CWKA 2XWXA 1J5EF 2NLWA 4DBQA 3N0VA 5GMDA 3OPKA 5E7OB 2N3OA 4ZP8A 3KYLA 2MEWA 1WC1A 1D0EA 1PYSB 4TY8B 1ZS6A 3KUHA 2KZZA 3AB2B 2DCUB 3BH6B 5HN0A 4IRCA 1RAFB 2CQPA 2QLFB 4IR1A 4IQMA 2GHVC 1HLWA 2FZKB 1REVB 3C14A 4TKTA 3QPIA 1F2GA 5A8RB 1KTQA 2UXBF 2XEXA 3OVAA 1H38A 1A0OB 4I2PB 3KK2A 3J7YU 1RUSA 3GP9A 2WW8A 1WC3A 4B9MA 1H74A 3IR7B 1NK8A 2MLZA 1TUGB 2R7RA 3MMCA 4DUYJ 3VAKA 2IM2A 3MM7A 3MM5A 4MIWA 3D1QA 2DGVA 3MUVP 2ZJQQ 2OPRB 4NYZA 3OJUA 1M90T 3CMES 1BY9A 2XQCA 1N36F 1FERA 4UOFA 2DHGA 4FPIA 4J91A 1TUWA 1R43A 3SDEB 4GKKJ 1MW7A 1A6LA 4GC6A 2XNRA 3GJRB 3HVTB 5B0EA 2IVFB 3PYGA 3DDIA 1NO8A 1S0NA 3PVXA 3DDNA 3A8IA 3ENAA 1PILA 3PFOA 4NXNF 2OMLA 1KQFB 4TVAB 4B3MJ 2EFGA 1QSLA 3ETMA 2ZBRA 4IH6A 2CPJA 4C3MA 1TAQA 3MMAB 2R7QA 1N6QA 4CH7A 2V68A 4Y2MA 2YNGB 3L9ZA 2HNZB 1T03B 4NI2A 1N5VA 1K0VA 2BKPA 1K1SA 2OPQB 3MZIA 3LQVA 5A8KA 1T0TV 3JSBA 2BVZA 4QWCA 4ID5A 5H1SV 2IRXA 4F25A 1GMUA 2XMJA 5KG4A 5F0UA 4OI0A 3R1HA 3OTOJ 1C2PA 3UDCA 1RWWB 1FT8A 5KAKA 3EYZA 4J9KA 2V8VA 4OYWA 4DV3F 2C3MA 3VAIA 1RAGB 3QSIA 2DR7A 1U02A 3TUJC 3PEHA 4OYZA 3MD1A 3RBDA 3MOJB 2R2UA 2CIMA 4X62J 1WKJA 4IG0A 3ZZYA 1VDHA 1U49A 4L3KA 4B3SJ 2JFDA 3U7JA 2AWZA 5ADZA 5AXLA 3GJQB 3C14B 4ALZA 2ALYB 5CYJA 1RWVB 3KLFA 5FLXU 3EMTA 5T14A 1IKYA 1LV5A 1GXLA 4EBEA 3QIPA 3KK2B 3GYXB 3NWGA 3FEYB 1RADB 4WXOA 4G1QB 4ZLLA 3NS7B 4HHJA 3MM5B 5A2QY 1LNQA 3CCMS 1PJ5A 1HYSA 2KVQE 3OR1A 3FRZA 2E5IA 5KFEA 4B9UA 2V2KA 4LFCF 3OLAA 1UW9A 3ILOA 2F5GA 3VAJA 4BLGA 3CJ3A 4PWUA 2AJ0A 3LP0B 1RT2A 1ZTWA 4RNOA 2N4CA 1YJTA 4PYDA 1HBOA 3RAXA 1DARA 1SJQA 2UV8G 3GG0A 5KT6A 3TARA 2PMWA 4F4YA 2O66A 5ETMA 1NHUA 4LF6J 2IDLA 4KGXB 3V4MA 2EKYA 4OJGA 4EWTA 4LF7F 2D69A 2JH3A 2CQIA 5BR8F 4PKDB 1PKUA 2HBYB 2WONA 4DV2J 1RZMA 2VC0A 2CXEA 3W2VA 3CMAS 1JX4A 4IFYA 1X4DA 1U1PA 4UY8T 2RB7A 2XI2A 1KOOA 2ADBA 4KGMA 2VBYA 3D1OA 3AOAA 1RWNB 4NLPA 3AFGA 2EG1A 2BUNA 4J37A 1WHXA 4KHPJ 3H25A 3M7VA 3NKYA 4ID8A 3RW7A 2HQGA 4UY85 2Z2ZA 3K89A 1FRMA 3MECB 1Y4ZB 2JLEA 4M5JA 1S72S 4EI2A 2LQ8A 3GPAA 1W2IA 4LSNA 4A47A 4IG0B 3QJPA 1U1NA 4ER8A 1WOPA 3TO8A 2GMHA 2BJ3A 4DFKA 3K2YA 3KLFB 4LF5J 1IKYB 4CLUA 2RE1A 3T6BA 4OLPA 3TJ9A 3AJ2A 2MDAA 2BQRA 2ZH6A 1RBOB 1PYOB 4FF2A 3NGUA 1W26A 4WU2A 3BKTA 3HP6A 5KT7A 2B5JA 4LF8F 3OR1B 3M2RA 3MM9A 5B0DA 2C3UA 1RT7A 1SUQB 2HVZA 3HD2A 3HSGA 2X7IA 1T9VA 1RA6A 3CULA 3EPIA 3NCQA 5AJ3J 3NY0A 2VFTA 2D3O1 2RNEA 1VFJA 4LFAJ 4RX6A 1TFYA 4GMKA 2A0FB 2HHPA 5DM7Q 4I56A 2RS2A 3SMZA 1WHYA 4L3NA 4HR2A 4DL7A 5F9NA 4P74A 4IG3B 3KLIB 3L4BC 4C97A 5LMNF 3PRBA 1NJIT 4YR3A 5F8NA 3WQPA 1EZZB 2AJFE 4MKBA 3ILLA 1M1KT 3IS9A 4LFBF 5DGBA 3QT7A 2D3UA 5L1LA 2VA2A 3M32A 1ZPWX 4LVOP 2DISA 3Q2SC 2LVWA 1WKKA 4Q7AA 2IAJA 2R7SA 3OJSA 4ZVFA 2MTLA 4YUDA 3GWCA 2W8LA 4KE5A 2I5JA 3PJXA 1F9FA 4DJBA 4Y2IA 1BD6A 3IBCB 3SSRA 5M2UA 1U47A 3CCQS 1QY7A 3H4BA 1NHVA 4EEYA 2K2PA 1TR0A 2VD3A 2ZH7A 1YIJS 2V63A 3TANA 4FKYA 3DLEB 3CJRA 1SC4B 2WTFA 5DG9A 1MMDA 3TAMA 3EM1A 2UP1A 8RUCA 1WC0A 3GCWP 2ILYA 1L5UA 3M6WA 2PFFB 5I42A 3OSNA 2XSJA 4J9UE 4IOAQ 4YDDB 3NS6A 1T11A 2OO4A 1JJ4A 2DNLA 5CAAA 4RU9A 1RTIB 4O3NA 1R6VA 4IH7A 3SQGA 1FNOA 1BWVA 4Q0BA 1RT3B 2H54B 2X3GA 2YH0A 1TTHB 2W9BB 4HT5A 3I4HX 2B5JB 1YRTA 5KFRA 3MM9B 3UI3A 1CC7A 4GVBA 3AH6A 4GO5X 3BSCA 1VQ9S 5IFMA 3GJSB 5LXYA 2K7JA 3W5ZA 1CS4B 5C2GA 3DLHA 1RWPB 3CCWA 4B3TJ 3THVA 1NZAA 2YNHB 2I2YA 2IJNA 5HP1B 2KXNB 4PXBA 1XMQF 4Q2LA 4ECTA 2CPZA 4NLOA 2R3VA 3JSRA 3AXKA 1D9AA 2GVDB 3LUYA 3UCGA 4NLXA 3AOCA 4CI0B 3CD5A 1OIAA 3BQ1A 3HT3A 3P5BP 4ED3A 4ZP7A 2DBBA 2NPIA 4ICLA 4I7FB 1EJ7L 3OR2A 5D77A 1IM4A 3WX8A 3R5JB 5A76A 3LWMA 4NCGB 4USJC 5JVHQ 2J5AA 2J7UA 1YZ7A 2AQ4A 3JYTA 2QMUB 1SXLA 3DU5A 4DSEA 2CQCA 4DZ6A 2XNQA 3BSOA 3Q8SB 1J2VA 5CHCB 4QYRA 2I5JB 2UXDJ 2HAFA 3HFZB 1VS3A 4M5MA 4NLWA 4F4ZA 2WW4A 4DF8A 3NNAA 1C1BA 5T7LB 4KYZA 3DLJA 4I6WA 1T8EA 2PI4A 1RHMB 4U95A 4CO3A 3M6UA 1YITS 3SCLE 1WD6A 3GB0A 2VG6A 3DRSA 3FMBA 5HQ8A 3BS9A 3T1AA 2O01C 3EZ5A 3UE2A 1K9MT 1UW4A 4WFNQ 1JKHA 2GJ2A 1D1UA 1NSKL 2KRBA 1S1WA 4C0OC 2VONA 1NLKL 4O4GB 4PG7A 3UNYA 4RL1A 3ZZZA 5ITHA 4DI6A 3TA1A 2OMOA 2L9WA 3I5BA 4LREA 3KNAA 5KFDA 5DETA 1N48A 2M0GB 1V3RA 5RUBA 2CJQA 3PTWA 3RBXA 1ZZFA 1DAXA 3DDKA 2HHQA 2DR9A 3A8EA 1VQNS 2VH7A 5DDOC 5HSPA 4GVBB 2BMBA 1CJUB 3ELHA 2JZ5A 2DR8A 1C0TB 3CDBA 3CCLS 3CVKA 1FWPA 5IOLA 4C0BA 3CCSS 3PYFA 2DGSA 2MQMA 5C24B 3MR2A 5L38A 2LA4A 1F3FA 2V0NA 2KM8C 5CXTA 3C6UB 4O3PA 2GV1A 4RWXA 1KVJA 1BQNB 1MU2B 2V2ZA 4JI1F 4EMDA 1CQNA 3TZXA 3KUEA 4HTJA 4DSFA 5DGAA 2EBEA 4NX9A 4Q2MA 4KC5A 4XPCA 1VQSA 1PO6A 4EUVA 4DR7F 4KGVB 1FXRA 5C5JA 2GS8A 4RNMA 2P9EA 3HMJG 4EBDA 3MEDA 4ZVSB 2G1DA 2VPXB 1W25A 2VDHA 2XM3A 2XHWA 4A4JA 2LXFA 4C8OA 4CIOA 4ICLB 1FJEB 1X0PA 3HT0A 3OR2B 2HZAA 3W3SA 2NPFA 3HZEA 3QJJA 1OQ6A 2CRLA 3EICA 3LWLA 2VOOA 3KOAA 3OHAA 4JV0A 2M4MA 1SKWA 2QSFA 4K2JA 4C4WA 1U1OA 4OZ2A 3I55S 2IBOA 3C15B 4DEZA 2HRTA 1IKVB 4KGKA 2DRAA 1IJFB 5K8MA 4QWBA 2W2PP 2O1PA 1EIYB 3QATA 5KFKA 2FVCA 1H2VZ 3GR0A 4NXNJ 4IKAA 2UXCF 2VG6B 3VCDA 3DRSB 3AA8A 1U6FA 3DN9A 4K0KF 3W2WB 1S1WB 1R0AA 8ATCB 3LA0A 2BYCA 1H98A 4C6AA 1RT1B 3HX9A 5KT5A 3IGNA 3SQOP 2RVJA 4A8WA 1NB2A 1RCOB 1W7WA 4FXVA 4Y00A 2H65B 1DJ0A 1OWXA 5ETVA 1WC6A 2VFUA 2HFUA 5C42B 2DO0A 1UFLA 2GVZB 1BGXT 2E5GA 4LT6A 3DHXA 2OD6A 4HI2A 2BJEA 1TV6A 2XLKA 5HL7Q 2VJUA 3H4DA 5J2MB 5AT1B 4F4KA 3KLHA 2E7XA 2JJ4D 1WTBA 4JV1A 2E1AA 3P5TL 5L9XA 4P73A 1T7PA 4QWAA 2V2QA 3C3LA 5K9FA 1HNVA 4EBCA 3MEDB 1QTNB 1YTYA 1PG5B 5GMKa 3G82B 1FESA 2HFNA 5DQHA 4FYVB 4KAIA 1YWXA 1NJWA 1VBXA 4F7VA 6AT1B 2ZKTA 1IQTA 4RZRA 1X5TA 2M88A 1RB0A 3N5BA 3TQEA 1S1TB 3P6YC 2Z0GA 2HURA 4DQQA 2LQ5A 2VU5A 2OHDA 1D9DA 1ACMB 5E0OA 1NRKA 4KKOB 1UMJA 1Q5YA 3S6EA 2UVWA 3TX0A 2YWWA 1WUUA 1YZ6A 3D6FB 3IRWP 3M9OB 3BGLA 2BRKA 2ZHOA 3D68A 2Q6BA 3L7OA 5GAGU 1C1CA 3BDEA 1Q7LB 1RWUA 3NMAA 4ZVOB 2VICA 2BDPA 2W2OP 3PCOB 2B4VA 4ED1A 5DDRC 1XERA 3QGGA 2AYMA 3N28A 3DI6B 3IR6B 4QJVA 4ZVPB 3QRPA 3BN4A 2ZHBA 3H59A 1NK9A 1KSPA 4LF7J 4ED8A 1H7XA 1MLAA 4DQPA 2CYYA 1QAIA 2PMZD 3MR3A 1NKBA 5K14A 4ELVA 1FKPA 4KSEB 2M5YA 1T9TA 2DKOB 4PUOA 5KT3A 3TA2A 3FCHA 1YK9A 1ZAXA 4A8XA 2YBVA 4L6V3 2FYXA 4OHXA 1NK0A 3MMJA 2E66A 5KFZA 2DHSA 4KPCA 4F04B 1IKXB 2ZUAA 4OX7A 1EX8A 1XJWB 4Z7YA 4LBHA 7FDRA 2P6TA 2ILZA 3HSDA 2FJBB 1AUSL 2AGPA 3AD7C 1WG4A 3QGPA 4J9SA 2JEIA 2JFKA 4TLRA 4A48A 1OS5A 4KH0B 4BBYA 1H2UX 1SKSA 2QA2A 4LUBA 2UU9J 3US5A 4X4QA 1B70B 3MEKA 4LBPA 3OXGA 4M1KA 4KTQA 4F02A 1KFDA 4TXSA 1PBUA 3RRHA 2GJFA 4DF4A 2CQBA 1VBZA 1SH3A 1HNVB 2AHOB 1S76D 4DV4J 2Z2LA 5CZXA 1FWKA 2JWNA 5KG1A 4ZJLA 2R8IA 1MG7A 4DU8A 2VHGA 2KZMA 3VGVA 2MJUA 2HRUA 4NLUA 5KFFA 3IR5B 2G9OA 2HFOA 3L3CA 4ECXA 1FDBA 3P96A 4H4OB 4PWDA 1NK6A 4J9PA 5JXSA 1TP7A 1URRA 3KLGB 1UVLA 1FRXA 2WCXA 3CCZA 1HWLA 4P2FA 5A8WB 2ZOFA 2NR0A 3Q89A 1VBYA 2AZ1A 2WSFC 1ZTTA 3UO0A 5KT4A 3NXZA 2CADA 1FHTA 2ZUGA 1QTMA 4G3IA 3T5HA 1KKHA 3HHEA 1IKWB 2C3OA 1ZA1B 1UTAA 3Q24A 4FYDA 2FZGB 2KL8A 3D9BA 2MSTA 4AE5A 4ZA1A 2FVRA 4TLQA 4Y28C 2A10A 1K0TA 3TX8A 3BB5A 5LMNJ 4IDKB 1YQHA 1MN9A 3RAQA 5IT9U 2DHHA 1VISA 4XO0A 5F8IA 5K14B 1BE4A 2ACYA 1FD2A 2E1RA 2VG5A 1NMEB 2KXFA 4RUHA 2F65A 3W64A 3C2PA 2C2OB 4YB7A 3CJKA 4DFJA 1LWCB 2J9EA 1N5TA 1RYRA 3MAAA 3MHYA 4K8RA 3K58A 3CF5Q 5L1KA 1HWIA 2YWFA 2HNYB 4B3OA 3CW2C 5SZTA 2J6TA 4RBUA 1X5PA 2RDIA 2DXEA 1VRTA 4CTAA 5H9FK 4YOEA 1RTHA 3QT8A 2DGQA 2HEKA 1F5AA 1IUJA 2MSSA 2CQ4A 3HULA 4DMZA 3QO9A 1R8PA 4H4MA 1NJXA 3G6XA 2Y1LB 1S0OA 2DJWA 1U6ZA 4LIWA 3AY0A 2BJ9A 3Q23A 4ZVTB 4C7QA 2OFGX 2B8PA 3HK2A 1P1LA 3W60A 2BJ8A 3TVYA 3HI9A 2FGCA 2M8HA 2CJKA 5EWFA 4I2QA 3ETOA 3DOLB 5MAOA 3A3OB 2RILA 5C7PA 1WDDA 1FK9B 4P2XA 1HNWJ 2J8AA 3B4MA 3ET6A 5L1JA 4Y34A 3CC2S 5HVGA 4PWDB 5KT2A 1ZPVA 5AE3A 1DLOB 1RAAB 3QWPA 3THPA 5HVFA 2CG4A 4B9VA 1SL0A 4IOCQ 1KVIA 1U09A 4DR5F 1X4GA 3WIUA 5DJBA 4Z2XA 1SKUB 2H9ZA 4DR3J 3QWUA 1XMQJ 4NMXA 3EZUA 2UVVA 1UEVA 5CD4H 3KUGA 1U0HB 1JLEA 2PN6A 1T9UA 5HMYA 1GTEA 4F0HA 3MPUB 1ZM3A 3DLKA 3MM8A 1SL2A 4CH0S 4DR4J 2DNZA 4JI2F 1J27A 4KIAA 2J6SA 2JEJA 5CYMA 2JLGA 4C0HA 2BX6A 2FY8A 2HBRB 3MCOA 2GIRA 5HROB 4BWJA 2UUCJ 1JLFB 1UPPA 3FEXB 1RAOA 3K17A 3BGOP 2W1BA 5JJBA 4M5IA 3MAAB 2N4DA 3WZ0A 2G2OA 2XB2D 2ACMA 5LSOA 2DR6A 2FJEB 1WACA 5CCLA 3EVMA 2DNMA 3CE8A 3SI8A 2RKIA 4WFZA 3KHGA 2IJFA 2MKYA 3D1HA 2LXUA 4G6VB 1X9SA 3H0PA 3WDOA 3KLVA 4KV8A 1VRTB 4ECWA 2DGXA 2QLJB 1KD1T 1QUPA 2HS3A 2E9RX 5AXKA 1RTHB 3FC9A 4WXWA 2W9AA 1I94F 2HQ3A 2CQHA 3QO9B 4DUZF 3GMGA 2NXJA 2AD9A 3KNGA 4IYQA 4YY3F 2BABA 1V5IB 2KVIA 2W2NP 4JUZA 3I5CA 3I0SA 4P2MA 4S0MA 3I31A 3QMQA 2CZ4A 3V2UC 1FRJA 4DPUA 3KJFB 2JOQA 4EU0A 1AW0A 3FSXA 3K5PA 2B3TB 4OZJA 1S6QA 4LRAA 2Z4PA 1F9EB 3GIRA 2FJDB 1A9NB 5ETRA 2ZEJA 4X4UA 3L7UA 4OYAA 2GAGC 3KLEB 2VG7A 2V6AA 1ROFA 2AEFA 3ENQA 3PYEA 1I3OB 2X1BA 2MZSA 3CCUS 2EC0A 4N7TA 3OVBA 2B56A 2XYHB 1GMWA 4X66J 1QVGR 1RTDA 2NUUG 3MUMP 3GFHA 5I3UA 1K8AT 5KG5A 4O3SA 1JXVA 2XS7A 2QLWA 2YWGA 4HT7A 4ED4A 1WI8A 2Y1IA 4NL5A 4HLBA 3G71S 1HW8A 2LQ9A 4EFAC 1NZ8A 1N33J 2ZDPA 4LVNP 2KHDA 2PGCA 4X4VA 2R2TA 2J76E 3SCIE 1P27B 1GTHA 1P9YA 3OSPA 1U24A 3A3PB 1B7YB 5D4LA 3CC4S 3S8SA 3J81U 2BA9A 2HW3A 1LWEA 4K4YA 4OHWA 4CZCA 1CQMA 2JC1A 3TI0A 3VGUA 3ISNC 4DV1J 3ONQA 1VC5A 1UEKA 1NXIA 1H3DA 1U25A 2MLYA 2WOMA 2DT9A 1RACB 3BR9A 2J8SA 3CTRA 4HVZA 2HQFA 1ULRA 4OV1A 3KK3A 1QD1A 2JVRA 3D54A 3I0RB 3M8QB 2UXCJ 4ANCA 1JXLA 4JB8B 2RRAA 5E3QA 2Q43A 3JB9k 3PNIA 2U2FA 3MTKA 1OY8A 2HZCA 2IVYA 2QIFA 2UZAA 2BJ7A 4L73A 3CGIA 4TNOA 2COLA 2DH8A 5KFPA 3A4TA 3BBFA 3JS9A 4EK2A 2ZBCA 1TQLA 3QSYB 2VASA 2Z57B 1YJUA 2DR5A 4IOBA 2QN6B 3POTB 1IBLJ 1UVJA 1VQYA 2PC6A 3LPYA 2OTJS 1T02A 3ZZTA 3LW5C 1N5SA 2R7OA 2ASJA 2QYGA 1HQ2A 4DV6F 3RB0A 3AT1B 4ZJOA 4DCPB 3EXYA 2AMCB 4I6AA 4DCJB 2OD4A 3H42A 4ZN1A 4DSIA 3KDNA 3PDNA 2W25A 3T5JA 1Q95G 3TUPA 3AXMA 2CNNB 2DCLA 5J2NB 2NZ4A 1XR6A 1C0UB 1U0SA 1Y00A 1S10A 1DURA 1NU4A 4QIFA 4QWEA 2H48B 2EPIA 4CLWA 2B6AB 1JB0C 3UDLA 3W62A 1X4AA 3H5XA 4DL0C 2OLWA 4CO2A 4TU8A 4ZHRB 3AQOA 3BGRA 4MKVA 4OI1A 1P6TA 1TL1A 2JRSA 1FFGB 1TVRB 5THWA 4B9SA 4BC7A 2CA9A 5B0AA 4ITSA 2XO7A 1HPZA 1RWOB 1FE0A 4F2SA 3I87A 4UQTA 4OMFG 3DYAA 2J0XA 2FJAB 2IHR1 1SQGA 1RE1B 4OI2A 3QLHA 2BW2A 1C4CA 2A6MA 3BEGB 1IM6A 2F3JA 3DM2A 4FVMA 4L75A 3UFCX 2RHSB 2V8GA 1ZBTA 2HLTA 3ZTSA 3PO4A 3OUYB 5F8GA 2YKNB 4X65F 1DTTA 4DS5A 3PR4A 4KHMA 1JLCA 1DQAA 4RW8B 2PO4A 1YI2S 3AA9A 2M52A 3BV8A 1G3OA 1UKUA 5LL6d 4CLTA 3A12A 4DR2J 2R7UA 1F5CA 1CJKB 2LU2A 1E6YA 4UOCA 2I0XA 1VC6A 3BPSP 4ZLNA 2BE2A 4OYXA 1I1GA 1ZYQA 5K8PA 2GGPA 2OGUA 2UUBJ 1XIQA 4WFBQ 2OAUA 2NXUA 3EX7B 3VAGA 3LO3A 1KFSA 2HHVA 5D4OA 5FJ4A 4B3RF 1XNRF 1HQUA 4B9LA 1WF0A 2J0SD 4OZLA 2IY5B 4C8YA 1I51B 1X5SA 2BOAA 4O0IA 1HD1A 5D3GA 1VQOS 5J2QB 1D8ZA 3R2CJ 3VWSA 3PKYA 2LQBA 1HBUA 1SV5B 2GO9A 4CLKA 2C3YA 3DMJA 1GNKA 4O0NA 2VPYB 1RT6A 3E8OA 1OYEA 4HH0A 1HNIB 4KFBA 4L76A 3G96A 4E0DA 1UZDA 1HMVB 2AW0A 2ZM6F 1GFWB 4EO8A 2CQDA 3IC1A 2VFRA 5KFHA 2NS1B 4J5OA 2LMIA 4NRTA 3V6DA 5KFOA 4R5PA 4M5DB 3R5CA 4FYWB 3LAKA 2W4DA 4KR0B 4QQBA 4X64F 1FD8A 1VQ5S 3RZAA 1VQLS 2BM0A 1TL1B 5DQGA 4DX6A 3ITHA 2X3DA 2K3IA 2N3LA 3CNQP 1MN7A 2AYGA 3SIPB 4D3HA 4U7CA 3DNCA 4PZVA 5DLGA 4IFVA 2DY1A 1E6VA 1LW0A 4R8UA 3T9ZA 1YSJA 2B7CB 1WORA 1VRUA 4XDCA 4WZQA 4ZK7M 4UF4A 2VPWB 3FKBA 2XY6A 3BDPA 1KONA 4NLRA 1YJNS 2EVZA 3OVSA 2HPUA 1DTTB 3S7RA 1S5ZA 2D74B 3GV7B 2AF6A 2OPPA 3TUZC 2KB2A 1ITPA 5KFAA 1X4BA 5G0RB 1SC3B 3WIVA 3J7A1 2ZITA 3DU6A 5A0YB 1HNZJ 5CYQA 3DXBA 3X3UA 3VGTA 5FLXY 2GGPB 3IA0A 3EDRB 4HHHA 2P8IA 1RK8A 5EX0A 1AT1B 3PHTA 2IM1A 1HQUB 1UL3A 3CCRS 3D0IE 5KG2A 4DV7F 1N34J 4AXIA 4WZMA 1IVZA 3BH7B 1U1MA 1B4SA 3CCJS 5E5NA 3W9IA 3DRPB 1Y3KA 4DCOB 1RT4A 2RF2A 1MROB 4LSZB 4DFMA 4NOHA 4Y65A 1S1XA 2Q6CA 2PI5A 2WB4A 1CPZA 4RJVA 2XY5A 4KFBB 2JHEA 4JOUA 4M95A 4C8ZA 2QC3A 4M94A 4N47A 1WF2A 5DDQC 3LGHA 5D0HA 2AGQA 1BXNA 1MNEA 3IXQA 4Y3CA 3NGDA 2XZTB 3MD3A
chains in the Genus database with same CATH topology
2FUG9 2I5JB 3PM9A 3P49B 1SJRA 3M1VB 3NCPA 3M2VA 4DN0A 1VS3A 4NLWA 4C2MA 2IBKA 1Z2ZA 4F4ZA 5IQ6A 4DLEA 2HHHF 5DG8A 4DF8A 5KFYA 3CSKA 1S6PB 1CVJA 4EO6A 5KTQA 3NNAA 1C1BA 5T7LB 2F8HA 2KXHA 4F3MA 2HRYA 2QV6A 2POKA 2LECA 3DLJA 2JDJA 4I6WA 3DRYA 3OUYA 5M2PA 1T05A 4MFBB 5KOXA 2YKNA 2F8EX 1T8EA 2PI4A 1Q78A 2IRYA 1VQ6S 4MTPA 5FDLB 2ALZA 1QAYA 4CO3A 2GX8A 4FVCA 3O5TB 3M6UA 2E5HA 1YITS 2KG1A 2QSWA 1WD6A 3SCLE 5IWAF 3GB0A 2VG6A 2W24A 1TKDA 2F9DA 3DRSA 3FMBA 3LH2S 5HQ8A 2UVRA 3OQ2A 3BS9A 2A18A 2MY8A 4FXWA 2NUHA 4NLVA 4RW8A 1X4EA 3T1AA 4JV5F 3NNHA 1F60B 2O01C 5I4MA 2WSEC 3EZ5A 3UE2A 4QIVA 1K9MT 1UW4A 2K7KA 3K5OA 1JKHA 2GJ2A 4WFNQ 2KRBA 4DUYF 2C2EA 1D1UA 1S1WA 2DNKA 4C0OC 1LW0B 2VONA 3K8VA 3UCUP 4O4GB 3CUNA 4PG7A 1SUQA 3GZ7A 3ZZZA 2MKKA 5ITHA 2BM1A 4MH8A 4XIUA 4CCHA 3TA1A 2Y1JA 4C8LA 1FRKA 4JI4F 2AJ1A 5AXNA 2HQIA 1FEHA 3O8WA 2OMOA 4KO0B 3HVRA 2O67A 2L9WA 3I5BA 1WEXA 3OW2R 1C1CB 2DPJA 3KNAA 5KFDA 5DETA 1S9FA 4OHVA 3KHLA 1XK8A 3HHNB 3NBPB 4FZVA 1N48A 2M0GB 3H40A 3V4IA 3TNVA 2G4BA 2D7SA 5KFCA 2FVQA 1V3RA 1JXEA 2KFZA 1IXKA 2M9KA 4GKKF 2RRNA 2CJQA 3N6MA 5A6WA 4M63A 1ZZFA 1DAXA 3DDKA 5CQGA 2HHQA 2FDNA 3HLUA 3A8EA 2DR9A 3OTCA 2WB1D 3IAS9 3ZZPA 1N8RT 2ZOMA 1VQNS 4WFYA 3TRGA 2VH7A 3LP2B 3QGHA 4ATNA 5DDOC 4OL8A 4KB7A 3CIZA 1LK7A 1U7LA 5J2QA 2KHCA 2JZ5A 2LEBA 2DR8A 1C0TB 3CDBA 4IG3A 3KLIA 3CCLS 3CVKA 2Q79A 4ZPCA 4ZVGA 1SV5A 2IYIA 1QVFR 4C0BA 3CCSS 3OL8A 4A8QA 2RU9A 2DGSA 3PW0A 2XSFA 4CNZA 2B43A 5B7WA 3LP1B 2MQMA 4O44B 2HWHA 5C24B 3MR2A 5L38A 3MWBA 1Z2LA 2YKQA 2LA4A 4QIWD 3EGWB 4B3MF 4I64A 2K1RB 2V0NA 2W4PA 1KEKA 2KM8C 5CXTA 3C6UB 1FKPB 1HNIA 1VQKS 2OH2A 4O3PA 4UQGA 5CYQB 2GV1A 4RWXA 4PUOB 3TP2A 1KVJA 1WHVA 1BQNB 1MU2B 4JI1F 2DH7A 3M8RA 1FJ7A 1GX6A 1HMVA 1CQNA 4OI6A 1DTQB 2MZTA 3G6VA 4HTJA 4DSFA 5DGAA 2EBEA 3MPWA 4PG5A 5CZVA 4B9NA 4NX9A 3SV4A 4XAKA 2AX0A 4Q2MA 4KC5A 1PC5A 2X51A 4KT0C 4XPCA 1VQSA 2HGMA 3M05A 5GAHU 1PO6A 4Q8EA 2R4FA 3M2UA 3MEGA 4EUVA 4DR7F 2R7VA 2NREA 2D9PA 3VALA 4DL4A 2ZH4A 4AYBD 4RUCA 1DQ9A 3JTPA 2R2RA 1M5OC 1FXRA 1S0MA 5C5JA 2JVOA 4RNMA 1SH2A 4M5DA 2P9EA 3GIJA 3HMJG 1JLQB 2MGZB 4EBDA 4I0WA 3MEDA 2DNNA 4ETXA 2G1DA 3C6TB 4OZNA 2VPXB 2DGOA 1W25A 2EFVA 1YGYA 1BC6A 2ROGA 2XHWA 5AE1A 1KC8T 4OLOA 1EETB 3C66A 4A4JA 2LXFA 3D28A 3HFKA 2F8MA 2IM0A 4C8OA 5AXMA 4CIOA 2R8KA 1YVFA 1DQ8A 4ICLB 1FJEB 1X0PA 4U9RA 3MM6B 2W4CA 3OR2B 4JI3F 3U27A 4NWBA 4K5SA 1KNZA 1HBNB 1KS2A 4L72B 2PE8A 3KKFA 2MPUA 2RJZA 3W3SA 4K4UA 3HF5A 4BCAA 5MLCV 3L09A 2NPFA 4ZDNA 4ELUA 2UU9F 3DLEA 3MEEA 3T1YF 1IJEB 3U1LA 2KYXA 5F8HA 1BQMA 1S9EB 4F2RA 4E98A 3HZEA 5B0GA 4N56A 3PZPA 3QJJA 5F9LA 1HBMB 4R0EA 4QW8A 1OQ6A 1KR4A 2CRLA 4FN5A 1HR0F 3LWLA 4NCAA 2VOOA 3KOAA 3OHAA 4G1IA 4JV0A 1B7FA 4URGA 5AE2A 2GW8A 3HHDA 3UNGC 3SSSA 2M4MA 1TK0A 1SKWA 3BQ0A 2QSFA 2DPIA 3WX4A 2VV5A 1Q7YT 4C4WA 3D0GE 1U1OA 4JI0F 5H9FJ 2GIQA 1AUDA 3I55S 2KU7A 3FQKA 2MXYA 1B0VA 2IBOA 3FQLA 3M2VB 3VZIA 3MCSA 4DV4F 1S97A 2AJ4A 2FC9A 4OI3A 1LWFB 1Q86T 1VQ4S 5DLFA 4DEZA 2W7PA 3T3FA 1IKVB 4DL2A 4Z37A 2YNFB 4B08A 2GO8A 4KGKA 2FLPA 2DRAA 2KJWA 1RTIA 1IJFB 3IN5A 5K8MA 3QYYA 4QWBA 4OFZA 4QIGA 1SJ4P 4IRKA 3L95X 2O1PA 3BR8A 2D9OA 2Q1LA 1T05B 3NMRA 2EK1A 1RT3A 5KFKA 1XMBA 2FVCA 1H6KX 4I6YA 1ZETA 1ZOTA 4EYHB 1H2VZ 1ZM9A 1QAXA 3GR0A 2EW9A 3F56A 4IKAA 2W9BA 2XULA 4LIRA 5F8LA 2UXCF 3MPYA 2VG6B 1Y5LB 3RB6A 2YVSA 3VCDA 5KFJA 3DRSB 1XNQF 2YWEA 1XMOF 3HZGA 3VAFA 3AA8A 3X1LB 1U6FA 1QM9A 2B7BB 2R8GA 3DN9A 2ZDOA 4WKRA 5H9EJ 4P7VA 4K0KF 1FTRA 2HS0A 3W2WB 4BC9A 1S1WB 1R0AA 2XC9A 1TKTB 2EK6A 1H7WA 2BYCA 4KHRA 4RNNA 1BWEA 5G0RA 1H98A 3IG1A 1RT1B 1QLNA 2HGLA 3HX9A 5KT5A 3IGNA 2RVJA 1M5SA 4BDPA 4A8WA 3JAMY 4FNHA 5U47A 4FXVA 1JLGB 4UW2A 1TFWA 2YWHA 5A0YA 4PG8A 4Y00A 2MYFA 5EN1A 3I32A 2WBMA 3GR1A 1DJ0A 3GSDA 4O3RA 3MURP 1OWXA 2YNHA 4DS4A 4AFFA 2BQUA 3R5DA 2MZQA 1Z1ZA 3IRXA 5HP1A 1TL4A 2PD1A 2VFUA 2FC8A 3OL9A 3O1LA 2E7WA 2CJAA 5C42B 3I5AA 2DO0A 3V4IB 1UFLA 4OJ1A 3O2IA 4QZVB 2FJVA 4K5RA 3T5LA 2CJBA 4DQRA 1BGXT 1S1VA 2E5GA 4LT6A 2IRUA 5KFLA 4ELTA 2NYIA 2DNQA 4U7UK 1X7VA 2KT2A 3DHXA 4ES2A 2CFXA 2OD6A 5KFBA 2QMXA 2QO3A 2OTLS 1N0VC 5J1PA 3K0JA 5L9NA 2OSQA 1OO0B 5F3ZA 4RU2A 4HI2A 3RAMA 5KFSA 4NYOA 2BJEA 2C2DA 1TV6A 3EGZA 3DOKB 3MMBB 4RNHA 2XLKA 2F1FA 1HWJA 3VTIA 3DRPA 2YNIA 2KM8B 5HL7Q 4MJKA 1O51A 4MIBA 1Y5IB 1RKIA 2XLIA 3H4DA 2GQQA 2P9CA 3HVWA 3BO3A 5J2MB 4GKJF 1WNEA 3RB4A 2DD8S 3IAM9 1VQ7S 4NLGA 2DNHA 3SEOA 3RR7A 1P8GA 1MROA 3HDSA 4NZ6A 4AL6A 3IBWA 3QGIA 4F4KA 3KLHA 4RW4A 4I7FA 4FXDA 4RWWA 2E7XA 1UA1A 2JJ4D 3SZ2A 4BHQA 1WI6A 2MQNA 3ZC4A 2VG5B 2A2CA 3JTNA 2VQFF 2HHXA 2B9YA 5FD1A 3FSYA 1AROP 3F41A 2DHAA 5HBMA 1AXQA 4NCGA 4F26A 1WTBA 4JV1A 2EG2A 1R8HA 4P6QA 3BQ2A 2E1AA 2O5DA 3P5TL 5L9XA 2ZHAA 3CJKB 3C8YA 4DV2F 2V9WA 2ZH2A 4GC7A 1T7PA 4PG6A 2ZD1A 5BYQA 4QWAA 3CXCR 3MEGB 4D3GA 4Y2KA 1YG0A 2B9WA 1LXJA 3C3LA 3PW4A 4A8OA 3BO4A 1N5QA 1JLBA 4K4XA 4DR1F 2C22A 5K9FA 1HNVA 4Q44A 2KFNA 3G8QA 3V81A 4EBCA 1KN6A 1O5JA 1YRXA 3M1VA 3MEDB 3NAHA 1U1QA 4WE1B 4WCEQ 2HG4A 1YTYA 5GMKa 4B3OB 3OV7A 3LOUA 1FESA 2HFNA 3Q8QB 1Y7PA 5DQHA 1S6PA 5IT4A 1OSCA 3I6PA 4KAIA 4DR6F 4J9RA 1YWXA 1NJWA 5T7LA 4YDXA 1L3KA 3NGKA 2FHMA 2ATLA 1VBXA 2BANB 2E44A 2RDJA 1S0VA 4QR0A 1V3SA 4A46A 4MFBA 4HYKA 3OTBA 2XG8A 2ZKTA 4FBTA 1IQTA 4CTAB 5KFUA 4C8MA 1X5TA 2M88A 4RZRA 3E51A 3N5BA 2DH9A 1O8BA 4I68A 1TL3B 1S1TB 4IO9Q 3MEEB 3MPVA 4EGLA 3HO1A 2GNKA 2H5EA 1NK7A 4C8NA 2KKHA 2ROEA 3P6YC 2Z0GA 4DQQA 2CPFA 2LQ5A 2AU0A 2OIHA 2QFJA 2BBEA 4Q8FA 4WU3A 2C42A 2MQQA 1D3WA 1D9DA 1UVMA 5HMWA 2KN4A 4H4MB 3BZQA 5E0OA 1NRKA 4ECUA 4C8KA 4FF1A 1JLAB 4O4GA 4QYZJ 5HMZA 4KKOB 1JNRB 1UMJA 1UWBB 2VBZA 3S01A 4FS2A 1T3NA 4PRFA 3S6EA 2UVWA 1HI8A 2YX1A 2L48A 2EWHA 1RI7A 4Q43A 2JEGA 5EHHA 1FVQA 2HIQA 4KRWA 4IUFA 4K4SA 3IRWP 3NAIA 2CQGA 2WRMA 2NQPA 4KO0A 3M9OB 3BGLA 2BRKA 1SH0A 2HNDB 2IC3B 4F67A 1IBKF 2ZHOA 1ZZNA 2Q6BA 1HD0A 3KFWX 3L7OA 5GAGU 2KH9A 1C1CA 1A7GE 2R7WA 3BDEA 1Q7LB 1RWUA 2V5HG 2CPEA 2BV3A 3NMAA 3NBPA 2CPDA 1WEYA 4YR0A 4C3LA 4I2QB 4M8LA 2BDPA 4G1PA 1XN9A 2FVPA 2VQEF 2B4VA 4ED1A 3K59A 5SUHA 1HNWF 3CDEA 1OQ3A 3M8PA 5DDRC 4IQXA 3QAUA 1XERA 1G7CB 1TKZB 5F3TA 1S49A 2CPXA 4DV5F 3QGGA 4B02A 4FNIA 3UR3C 1NEEA 2AYMA 1N54B 3LP2A 3N28A 1KQSR 3DI6B 3IR6B 1S99A 1LOUA 4QJVA 3OLBA 4X4OA 2VUGA 2RS8A 3BN4A 2FD2A 3H59A 1C0TA 2ZKUA 3K7RA 2ZHBA 3DOMA 3H5SA 4ED8A 1H7XA 1NK9A 2PA8D 4DQPA 4RKUC 5KOWA 1U8SA 2CYYA 3JSMA 2L9DA 3N79A 3QZ8A 4B9TA 1QAIA 5KFVA 4AL7A 2PMZD 2XWYA 3DLGA 5C24A 1SI9A 4HEA9 4DQIA 3MR3A 1NKBA 3I56S 4H4KA 1NKCA 5K14A 4ELVA 3C6UA 1FKPA 4KSEB 5I3QA 2M5YA 2F40A 4PUOA 5KT3A 4ED2A 4KPYA 3TA2A 1BQNA 1MU2A 3FCHA 4PR6A 1UVIA 4DR3F 1ZAXA 3GG1A 4A8XA 1NK4A 4L6V3 2J7KA 3CJ4A 1X4FA 4H4KC 4MKAA 4OHXA 1RA7A 5IM0A 1NK0A 3MMJA 2E66A 5KFZA 5EGYA 2DHSA 5EDWA 1VJWA 3I96A 2VBXA 1IKXB 2P6SA 3IWLA 1JLEB 3B8HA 4O23A 4OJ3A 4OX7A 2G13A 5GAEI 1D8YA 3RBEA 4NLQA 1FE4A 7FDRA 4V19J 2P6TA 1JLQA 2YX4A 2MGZA 1N4LA 2ILZA 1S4FA 5E2QA 2FJBB 3DLKB 1LXNA 3C6TA 4WF9Q 5IZHA 4RNFA 2AGPA 3MM8B 1SBRA 1RT5B 2GMLA 1AFJA 2RUGA 1O0PA 4HTIA 2RSQA 1R8CA 1WG4A 3QGPA 4XDDA 4DR4F