1BLUA

Structure of the 2[4fe-4s] ferredoxin from chromatium vinosum
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
80
structure length
80
Chain Sequence
ALMITDECINCDVCEPECPNGAISQGDETYVIEPSLCTECVGHYETSQCVEVCPVDCIIKDPSHEETEDELRAKYERITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN
publication title Crystal structure of the 2[4Fe-4S] ferredoxin from Chromatium vinosum: evolutionary and mechanistic inferences for [3/4Fe-4S] ferredoxins.
pubmed rcsb
total genus 14
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 1996-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bluA00
5L8RC 5BYQA 3MM6B 1F5BA 1DFDA 2GMHA 3MMAA 2VPXB 1FRIA 4DHVA 2WSFC 1FRLA 2FGOA 3MM8A 2WB1D 1BWEA 1DURA 3EUNA 2C3OA 4RKUC 2IVFB 1FEHA 3MM9A 5BYSA 3MM6A 3C8YA 1FDDA 1Y5LB 1HFEL 2WSEC 3LW5C 3MM7B 1FRHA 2PDAA 1FERA 1H98A 1B0VA 1FCAA 1BLUA 2UZAA 7FDRA 1ROFA 3EXYA 1KEKA 3MMCB 1FDBA 1H7XA 7FD1A 1JNRB 2PMZD 4CI0B 1BD6A 1FXRA 2ZVSA 1H7WA 4ID8A 1CLFA 1GTHA 4OV1A 1JNZB 3MM7A 1SJ1A 2VPWB 3OR1B 2FJDB 1SIWB 1FRMA 1KQGB 1FRKA 3MMBB 3MMCA 2WSCC 2VPYB 1K0TA 1C4AA 2FJEB 2C3UA 1PC5A 3IR6B 5BYRA 1FRJA 2C3PA 1VJWA 1GT8A 2FDNA 2PA8D 4XDCA 3IR5B 1B0TA 1Q16B 1GTEA 1B0PA 3OR1A 5CH7B 2V2KA 1GAOA 1SIZA 1FDAA 1FRXA 2C3MA 1WTFA 1Y5NB 2FJAB 3MMBA 2C3YA 3OR2B 3HKZD 2WAQD 3EGWB 3IR7B 1FTCA 1XERA 1Y5IB 2VPZB 4KT0C 1A6LA 1RGVA 2XSJB 2O01C 2VKRA 1C4CA 6FDRA 1IR0A 1D3WA 1JB0C 1Y4ZB 1F2GA 2V4JB 2GMJA 3MM9B 3MM5B 3OR2A 1FDNA 3GYXB 1BC6A 2C42A 4L6V3 5FD1A 4OMFG 4Y28C 1FXDA 1IQZA 2Y0SD 1AXQA 4XDDA 5CHCB 1PC4A 2FJBB 2XSJA 1R27B 2V4JA 3MMAB 1F5CA 3MM5A 1BQXA 2Z8QA 1KQFB 1FD2A 1H0HB 3MM8B 4XK8C 4AYBD 3PNIA 2FD2A 1FF2A 1G6BA 6FD1A 4YDDB 1DAXA 1G3OA 5E7OB
chains in the Genus database with same CATH superfamily
4B3MF 3V6JA 5IZHA 5H9EK 2PMHA 4NCAA 2MZQA 3SQGB 1R8AA 4DSFA 2BACA 4FS1A 3VWSA 2UZAA 4X66J 2WVFA 1QJHA 1S6QB 2RKIB 1WC3A 1IM4A 1H7WA 2JEFA 2ZOMA 2XSFA 1SIWB 4HACB 3KLHA 3QRRA 3NGKA 2GFFA 1VGYA 4OZ1A 4GO7X 2Y1IA 1RTJA 3OR1A 3RAXA 1FO1A 4I7FA 4F4KA 1WG5A 2W9BA 1EP4B 4B17A 3HVWA 2OPRB 1ZTTA 3H40A 4KBIA 3V6KA 1RTHA 2BW2A 1X7VA 4PWWA 2KU7A 3V4MA 1Y4ZB 4EO8A 4BWMA 4ECZA 4LF4J 1SKUB 4OMFG 4LF2A 1W7WA 1EQ0A 2XEXA 4B9TA 3MEEB 1TELA 4ENOA 1JWWA 2WOMB 2XULA 3KLEA 5D77A 3HULA 4LSZB 2ZUAA 1UJ5A 3T6JA 2GMHA 1N5SA 2FLPA 4K4TA 3MM8A 3KJNB 1RT6B 2PI4A 1T11A 4ANCA 3ZNUA 1Q8KA 3CCRS 1HQUA 4QIWD 4PZVA 4UTGA 4JYAJ 2ZE2B 1U8SA 4O3RA 4X4QA 2FHOB 1CJUB 2JEGA 2R7UA 4OI6A 4NXNJ 4RW4A 4MK8A 3OTOF 1IR1A 1GXTA 5K8NA 3KWMA 3RZAA 4X4TA 2VB6A 3VTIA 1JLEA 1HKAA 4UOGA 1VBZA 5C42B 2LQ5A 2FTRA 3UCUP 3DOKA 2J0XA 2OIHA 1FT8A 4HT7A 4NYOA 1VRUB 4ECVA 2B4PA 3M8QB 4C8NA 5LMNJ 1HI0P 4GMKA 1IWAA 2UV8A 2AJ2A 3OVBA 2B9YA 3KMQA 2LEBA 3QT8A 3DDIA 4MYTA 4K4SA 3S8SA 1R31A 2QSFA 2DRAA 2HFUA 3MM6A 4BCAA 2HZVA 2WSEC 1HPZB 2ZH2A 4HKQA 3QT6A 3RB0A 4L3KA 1C0TA 1QE1B 1N88A 4HI1A 5ETSA 5DDQC 1RWOB 3OL9A 1QAIA 1TKTB 1FRMA 4AT1B 2KHCA 1WI6A 3H8YA 1ZPWX 2DNQA 2HAFA 1QAXA 1JJCB 1S6PB 4O4RA 2PA8D 1GTEA 5A0YA 4GKJJ 2NZ4A 2JFKA 1XERA 1HBUA 1XNRF 2G4BA 2N3LA 5I3UB 1S7HA 3MEDB 5KFJA 4WKRA 2XMKA 3B54A 3EGZA 4X65J 1KTVA 3VV2B 3IC1A 4B9VA 3CJ3A 1S77D 3OFFA 4PYDA 4CZCA 3CF5Q 4YR0A 3Q86A 2JEIA 4C7QA 1V3ZA 3VQTA 3G2XA 1OMSA 2YWEA 5DETA 2MLXA 1TL1A 1X5PA 3FSYA 1N34F 3PX0A 5KFKA 1SCJB 1KD1T 1APSA 2BUNA 5KFDA 2F4FA 5F41A 2ZNYA 2IDLA 3M8PB 1TP7A 4IQXA 4ZCMA 4KAIA 2AJ0A 2MQMA 2CQHA 3KK3B 4L75A 3K5PA 2A6OA 1IKXA 2FHJD 3MM7A 1Q5YA 3BV8A 1LWEA 5FDLA 2YX4A 2E1AA 3THPA 3PJWA 1S9EA 2VQEF 4ZPBA 3D5MA 4X4OA 2KH9A 4A8QA 2Z2YB 2X1FA 3V81A 4NEZA 2KZZA 3D7SB 4OJGA 2XC9A 3IAS9 4CWBA 4KGZB 3LGHA 3HSZA 8AT1B 1WUUA 2GMJA 3LGNA 4JI0J 4ECYA 1CG2A 3GYXB 1Q79A 3OD2A 3PYFA 1QDUB 3PEHA 2CQCA 2BJ1A 4F0KA 3BR8A 3TQEA 2K1RB 3PNIA 1OPIA 4EBCA 2JSXA 3FJ2A 1WF1A 5HMYA 4O3NA 2HHPA 2D7SA 2G2ZA 4NA1A 5DQHA 4OX9F 1OSDA 1U6FA 2MQLA 3B6BA 4MTPA 3HVTB 5AJ3F 3DHXA 2MSSA 3FRYA 3BPDA 4JI3J 1MU2A 3DRRB 1VHIA 3CMES 3C2PA 1GTHA 2YQ3A 3AB4B 2VFTA 2AX1A 3M2VB 4DR1J 2VC0A 3EE3A 3WHIA 2UUTA 3NGDA 4R8UB 1OS5A 5F8LA 4ZVEA 2GO8A 3NCPA 1X8DA 3TUIC 2ACMA 4QR2A 4KT0C 2KI2A 1UL3A 2R42A 1ZM2A 2UXDF 5MAOA 2ZM6F 1ITPA 1HA1A 2UVUA 1N6QB 2WVEA 1U1QA 4KO0B 3OXGA 3RU0A 4WYWA 4HHJA 1BUXA 2I0XA 5HVHA 1M1KT 5D4LA 4JI6J 4FF3A 3KHGA 3EWGA 3U7JA 4U96A 4DHVA 3GYGA 3ZTRA 2ZJPQ 1HWIA 2X7IA 2MTLA 3ZC4A 2QL9B 1PAUB 4C98A 1FJCA 2WONB 2VHGA 2CQ4A 3DLJA 4NLPA 4RNHA 3OTDA 1TV6B 3HD1A 3PXGa 4Z37A 2R8KA 2RHSB 2VOOA 2DT9A 3NNCA 3DLEB 3H90A 1PCAA 4FDFA 2KXFA 5D6GA 3HFKA 2Q3PA 2CJKA 2YKMA 1NM2A 1N0VC 4DPOA 4K2XA 2DHSA 2OMLA 4DCOB 2QEXS 1IBLF 5HATA 3DRPA 3G6VA 2OFGX 2BW7A 3PW7A 1HNIA 1U1KA 3AOCA 4DL3A 2Z57B 4NXMF 4DV1J 5C24B 2YWGA 3QWUA 2RRBA 1X5TA 4OX6A 2PEHA 3E2EA 2E7WA 1S59A 2OPSB 3MCMA 2ASDA 1HBNA 2FC9A 2H3EB 3U27A 2VOPA 2QO3A 5BR8J 2DHAA 3AA8A 4HT5A 3C6UB 1X4AA 1X5OA 2JHEA 3LPYA 2NXUA 2B4UA 3BKFA 3MECA 2RVJA 2KB2A 3DU5A 3RBXA 4AUKA 5ETQA 1MW7A 1FNXH 3FBBA 5L1LA 4DR3J 1Z4UA 1DTQB 1T9XA 1SIZA 1FDAA 2DNRA 1MN7A 1CEZA 2BV3A 3FBCA 2E7XA 4BC9A 2GV1A 4DX8H 1N0UA 2VG6B 2GQCA 4PUOB 3QFWA 2XI2A 8ATCB 1VQOS 3KDOA 1OWXA 1C0UB 2LU2A 3T1YJ 1KN6A 4XDDA 1K8AT 1MMLA 4ECSA 2CJAA 2MMYA 2HVIA 3QBCA 2QYCA 5KFNA 2LXFA 2R7RA 3OL6A 3R5JB 3MUMP 2QIFA 1U1LA 3GE9A 4DUZJ 2C3OA 3PKYA 2FJVA 5E0OA 8RUCA 3UCGA 2Z30B 3D1OA 4LRBA 4DR7F 3O44A 5IV3A 1AB8A 3TAMB 2M70A 2N3OA 1QTNB 4HYKA 4YN3B 3HJVA 4PQAA 1TAUA 2B8QA 4KKOA 3KG4A 5E5NA 1WF0A 2AYEA 3X1LB 1TU0B 1NZAA 2UUCF 2HFNA 4EUVA 3PR5B 2BRKA 3IWXA 1HWUA 5HN0A 4ZP8A 1VIXA 1X0FA 3IS9A 3THTA 1IKVB 1U2RA 1UWBB 1TKZB 3TZXA 3R1HA 1JQGA 2GAHC 3FVYA 2R7XA 4RNMA 1R27B 1IBCB 1JLAB 4TLRA 1WI8A 2KKHA 1VBXA 5BYQA 4ECTA 2RIJA 3H59A 5DQIA 2OPPA 1UKUA 3DI6B 4C8LA 3PX6A 2YXLA 4B9SA 1FWKA 4K4XA 4FYYB 2UVWA 4DV5J 1N8RT 2E7VA 2ZKTA 5KFXA 3BSCA 1RBAA 1RWWB 3N6NA 2F8MA 5EWEA 2VA2A 2X51A 1WTBA 4DQPA 1NHKL 5D78A 1NH8A 6AT1B 2GQ2A 4NZ6A 2QE5A 4L73A 5FJ4A 1HNZF 3POTB 3QFHA 2V8PA 3BYPA 4MAKA 2VG7B 5LT5A 2UVVA 2OD6A 1BXNA 2AJ1A 3M32B 1DLOA 2IIHA 1LQ9A 5KFWA 1Q7LB 2LDIA 4WFBQ 2H4WB 3O6QA 3BZQA 2PEBA 3AOBA 3R1LA 4B3RF 4RW7B 2PN6A 1I94J 2E9ZA 1HQEA 3M8RA 2VJVA 1LW2A 1OY8A 3HMJG 1H38A 5KG4A 1FVQA 2HWTA 1YBTA 2VPXB 2JH3A 4I2QA 3FBEA 2F8HA 3NY0A 1LK5A 1RAEB 3T5KA 2BR0A 5EWFA 4ETZA 2QLFB 1DQ9A 3MEGB 2QV6A 1YJ9S 5F3ZA 1JIHA 3MF5A 5DO2A 2DBBA 1FKPB 4ZVTB 1H3DA 4DG1A 2J7KA 3HHLD 3ET6B 4A8YA 3CJSA 3IFEA 5HSPA 3KLIB 2EFQA 2R3VA 1N5YB 4KSEB 4LR9A 2AGPA 4G6VB 2FHKA 4QU6A 4F36A 2PE8A 1M5PC 4RBVA 3CO0P 3BO2A 2R8IA 3MZIA 4QWCA 2UXBF 1ZM3A 3ZZ0A 3MM9B 2YNFA 3MM5B 3NS6A 4M1KA 1S48A 1T8EA 2IRUA 4PRFA 1RT1A 4OYMA 3D6MB 2RNEA 4X62F 4JI1F 1Q82T 5DZ7A 4IKAA 1GEHA 1VFJA 2AZ3A 2HFVA 3MAHA 1J5OA 1IKWA 4KFBA 3J7YU 1K44A 3G8QA 4EBDA 1S1XB 3M9OB 2RDDA 1RA7A 1FRLA 2FGOA 2ILYA 2WW4A 1BQNA 3C14B 4RW6B 1U49A 4ED4A 3DMJA 1T03B 2HQDA 3IWLA 2IC3A 1RACB 4U7UK 1YRUA 2JC0A 1Z2LA 2N82B 4NOHA 5B0DA 3A8EA 2CWKA 3KJQB 1Q8BA 1NB7A 1LKZA 1C1BA 4DV0F 1TVRA 2ABYA 4K50A 1B0PA 2V2KA 3GPAA 3D2WA 2B5JB 1TL5A 2KT2A 4LBHA 2J9DE 3H2VE 3L7PA 2LKZA 3SZ2A 2DPJA 1T9TA 3M7VA 2OTLS 1HR0J 1RWUA 2EKYA 3W5YA 5LSLA 2B56A 2HQ3A 2OH2A 4HVZA 3CCQS 1RXOB 1VI7A 3V5RA 4XAKA 4DR5F 2OFHX 4P71A 3NGSA 4RNNA 4M5HA 3TZZA 5GADI 3N5FA 1YJVA 3D6HB 4K4WA 3OSNA 3BDPA 4DOZA 1D1UA 2OELA 2M52A 4U8VA 3BR9A 4DX5A 4ALZA 1Y00A 4E0DA 1YZ6A 1FKOA 2CNOB 2RT3A 1ROFA 1RWMB 2H5EA 3K5OA 2XCAA 2HFSA 4F25A 1VQLS 3TZYA 1JLCB 4LRDA 1S6UA 4TYBA 5DM6Q 3CD0A 4ZVOB 4NASA 3MOJB 3VAFA 1QTMA 1JXLA 3KHHA 4CLUA 2C3MA 1JLBA 2O5DA 3ENVA 3U1LA 5HK4A 2D3UA 1D3WA 3GCXP 3BGFA 2DH7A 4P75A 2DKOB 3D28A 1K47A 2UUAJ 1YKWA 3TZWA 4N41A 1TL4A 3M8WA 5J1NA 2RAQA 4P10A 4S0MA 1A0OB 4K59A 1UZHA 2QLBB 3UCZP 3OL8A 3CB4A 5A8RA 3MTKA 1E6YB 2DH9A 3MPUB 4C4WA 5GMEA 3SDEA 4NLYA 2MXYA 4W4MA 2CQPA 3EXYA 1HL6A 2YWFA 5CYMB 3VF0B 4ZMMA 1CLFA 5ADZA 2IY5B 3TI0A 1HQ2A 3J80Y 2V2QA 2RRAA 2D74B 5J2QB 1R43A 3CDBA 4RU2A 4IG3A 1J2VA 3SSRA 2FC8A 4TXSA 1SC1B 1IR2A 4TNOA 4CO1A 2XI3A 1NPPA 2HNYB 4ANDA 1U25A 2G1DA 3BREA 3GILA 1KS2A 4LFBF 1FESA 2MQOA 4LIRA 4C0OC 4A8WA 2XMTA 1QSSA 4O3OA 4ZPTR 4C6AA 4EI2A 4PQUB 1UEUA 5A2QU 3KLFB 4WU2A 1TL7B 3OPKA 3FMWA 3C15A 2G1HA 2MZSA 1RWPB 3W61A 3SEOA 2ZD1B 2ZH9A 4PPZA 4JV0A 3WQPA 1CQNA 4MIWA 4YEAA 2XB2D 2ATCB 1F3FA 4CO5A 1UPMB 5HVFA 1Q95G 3GG0A 4PR6A 1UVIA 3DLHA 1F2HA 1VC5A 3M6UA 1RHQB 3BGRB 5KFIA 1X4CA 1LW0A 1QAYA 1UCNA 1P9QC 2R7VA 3IXQA 4DPYA 3JSYA 2BOPA 4ZVGA 2OAUA 3G9CA 2RE1A 4P74A 4RWXA 4Y28C 2F65A 4IOCQ 2Y0SD 2V4JA 2VDHA 2R7TA 1EX8A 2APOA 2BANB 5GMKa 1RAGB 4GVBB 1AYEA 1MWZA 4RW9B 3LWMA 1CQMA 4WP8A 3MURP 4MKBA 2RDJA 4MT1A 3OV7A 3HFZB 3T41A 1FJ7A 1OSCA 1H74A 1R8BA 2XYHB 4HHUA 1L5UA 4K5RA 4CH1A 1GK8A 2XY6A 3CNQP 1M0SA 3JAMY 3KJVA 1KLNA 4OZLA 3Q8VA 4DUYJ 3G82B 2DHHA 2MQQA 5H9FK 5HANA 2UUBJ 2W4PA 4CLYA 5KT6A 3ZNJ1 1HNVA 1X31C 4RO0A 4DQIA 1LNQA 4MK7A 5HVGA 3GJRB 1WOOA 1GFWB 4A47A 3NOGA 4FZVA 3EX7B 3CTRA 3DM2B 3T3FA 1SXLA 4MYUA 3ILJA 4CIOA 3K89A 5CCLA 1RCOB 4OZ0A 1EAYC 4B3MJ 2CZVC 2CQ1A 4ZVHA 3C6TA 2FJXA 4HL9A 6FD1A 5KT4A 2DNZA 5JMNA 3IGVA 1CS4B 5BXIA 4F4ZA 4Y0FA 5EX3A 3GFYA 1P9YA 4RW8B 1X4FA 2CDQA 1VBYA 3C8YA 3RAMA 4K4UA 1I6JA 1SC6A 3CCWA 2J8SA 1H98A 4ZVUB 4ILLA 5SZTA 3W62A 3V2UC 5C25B 3LF0A 3OW2R 3OFHA 4EBEA 4C2MA 2ZVSA 3CGIA 2VBWA 3MMBB 1CJKB 1SL1A 2GJ2A 2A2CA 2VQFF 1FXLA 3W5ZA 1RBOB 2EWHA 3DOLB 4BDPA 2HKEA 2UP1A 1LWCB 3TYTA 1NSKL 1XEZA 1JB0C 1GQEA 3VGTA 5KFSA 2BE2A 4Y65A 1QD1A 3BBCA 2GVZB 4OZ5A 3ENWA 3VZHA 5C2GA 3OHAA 5D3GB 5G0RA 2LEAA 3G71S 1S1UB 2D1CA 1KOOA 4P73A 2DH8A 3BH7B 5K14A 3BYRA 4A8KA 2RUGA 3ISNC 1VRTA 3R8YA 3A3NB 5E3PA 3T5LA 2HVDA 1SI9A 4NLOA 2IBKA 5KT2A 4G3IA 2RRNA 3CJQA 4J9VA 3N5BA 2AF6A 4J91A 3DGVA 4BLGA 4TY8B 5KOWA 1VIOA 2BMBA 1T02A 4Y2IA 3N79A 5ETTA 4DR2F 3OVSA 2NQPA 3LANA 1F9EB 2HHHF 2GIQA 2BJEA 2W2OP 4V19J 4C8MA 3NNHA 2Q66A 3H2UB 2JL9A 4ES1A 4TU8A 2B9EA 4AXJA 2ZBPA 2ZNZA 4NRUA 1PSDA 3LO3A 1NUEA 2Y1LB 2V34A 1U7LA 4QPTA 1DQAA 5HMZA 2OEMA 1KQFB 2VFUA 3AB2B 4WBFA 1YSJA 2DNOA 1FFWB 3NAHA 3CCVS 1GX5A 4KY3A 3TW0A 3H5YA 4B3OA 3R7SB 3KHLA 2I6WA 4E98A 4U7UD 2AEMA 3KLHB 1WSRA 5HI7A 4DV6J 3LTOA 4D3GA 2EG2A 3UNYA 2CJBA 3NL0A 2Q43A 1CSJA 3UVJA 4TU7A 3OR1B 2E5IA 2E5GA 2ALZA 4I7FB 4ECWA 2W9BB 5IT4A 5J2MB 2GGPA 1RTHB 4NLRA 2QG9B 1TQLA 2WHOA 1IBKF 4ZP9A 4NMLA 5JVGQ 1Z1ZA 3GCWP 3P49B 3PFOA 2A6MA 2OMOA 2P9GA 3PW2A 1HI8A 1LXJA 2HSEB 3KLEB 1VBKA 3TOQA 9RUBA 1RHUB 2RQKA 3GSDA 4M8LA 3EXCX 1SUQA 3J7AN 3KLVA 4EFAC 2R2SA 3MM8B 4K0KF 1KOHA 4IFVB 4W90B 1QVGR 1UVLA 1HQUB 3IGNA 2GCFA 1RB0A 2H65B 1DFDA 2H9ZA 2CPJA 1PILA 3LGMA 1T9WA 3CJTA 2DNYA 2M0GB 1D9FA 4ZIWA 5FIIA 3TJAA 3LP1B 1YG0A 3CJ4A 1WORA 1SV5A 4RUCA 2UXCJ 1JLQA 4RW4B 3HFVA 1VC0A 3ZZZA 1JNRB 1TMMA 2GVDA 5K8PA 4LF1A 4ITSA 2NREA 3A4TA 1JNZB 1SJ1A 3W2VA 2EG1A 2CNKB 1FX4A 4ED0A 4J9QA 1VJWA 3DNCA 3DOKB 4PXBA 2QYGA 4KYZA 1TL3A 4XPEA 4BC7A 3BO3A 3D0IE 2ZBCA 2E66A 2XM3A 3J81U 3FRZA 2M2BA 3E8OA 4UW2A 3VGUA 2XO6A 1XBWA 2DGWA 2IM3A 5M2UA 4AL6A 4OX9J 2XMMA 4F4YA 1K1SA 4PG5A 2YVSA 3MM6B 1XR7A 2XMWA 3I56S 1NPRA 4DLGA 4CNYA 1HNWF 3I82A 4OI1A 1C0TB 4IDKB 4KGVB 4I0WA 4DXLA 5KFVA 5EX0A 2UUWA 1NSPA 1AW0A 3V4IA 4L76A 4QWEA 1VQYA 5KG1A 3ELHA 5HJXA 3X3UA 2LECA 1F3VA 1JJ2R 1MSWD 3V6DA 5F3TA 2X3GA 1WC4A 1HBUB 4EMDA 4P2FA 4WZMA 1U2FA 3CE8A 3LOUA 4H4OA 5KFAA 4LSNA 1FJGJ 4QW9A 2KT5A 3GJTB 4QJVA 1I3OB 2ZC3A 5ETVA 3OUYB 1H73A 2FHJA 2RQ4A 2V8VA 3DKDA 4MFBA 3VR1A 5ETKA 3CPWR 1PYOB 4OI0A 2CJ9A 5B0AA 3DXBA 3GIJA 3GYNA 5CYJA 3K5MA 1HNXF 4LSLA 2CIMA 2ZBIA 2C22A 4JI4F 4USVA 1ZTWA 1NPKA 3TR5A 2CPEA 1RT3B 2IDEA 3PM9A 1UAWA 2F9JA 2QZ8A 5FLXY 2Y3YA 1IKXB 3MI7X 2KRBA 3EDRB 3MM7B 4CP5A 3O3LA 4FPRA 3FFIA 1FCAA 3RRHA 2B6AA 1LWEB 2W4DA 2GO9A 1XMOJ 2DNGA 5FDLB 1WC1A 1O51A 5F8HA 2XS5A 5ETRA 1S9EB 1KTQA 2PI5A 2VKZG 4JI7F 3V81B 1IBLJ 1W2IA 1JK9B 2KFNA 1URRA 2EEYA 1Q4RA 3I0SA 2IRXA 2AX0A 4KRWA 1X0PA 3W60A 2AJQA 2CWXA 2O01C 2W2NP 1S6QA 1LFWA 1R0AA 1SL2A 2C42A 4IFYA 2CFXA 3Q24A 1UJ6A 2IM1A 1YITS 3KHRA 2B8PA 3GTYX 3GQCA 2DXDA 1ZA1B 2JZ5A 1WSVA 3FNNA 2C2NA 1FRIA 2PA3A 3BJYA 1MU2B 4WP9A 4K4ZA 1SC4B 2IVYA 4LF6F 2FVPA 3QO9B 2EKNA 3MXHP 4ZP6A 4QYZK 5CZXA 2W7PA 3FBFA 3H98A 4LMZA 4N7TA 1JKHA 3HZEA 3FUYA 2R2UA 4PKDB 1V3SA 5IOLA 3GJSB 1R0BG 1S4EA 1O0PA 4FYXB 2GHPA 2D3ZA 1PYTA 4USTA 1T95A 1B4SA 2A2DA 4ED1A 2HMIB 1FTCA 4A8FA 2QLWA 3C19A 3R5BA 4KGMA 4J9OA 4C8YA 5L1JA 1U8WA 2PSZA 4KGXB 4A8MP 2W01A 4JB8B 3I96A 1S97A 2OI2A 4NRTA 3EGVA 1WKJA 2NSBA 2KG0A 2DNMA 2RF2A 3N6MA 1WEZA 1SVDA 3G8TA 2HQCA 3CD5A 2MKKA 2M8HA 3OFEA 5RUBA 1XN9A 2L9DA 4ED7A 1MN9A 1S1TA 5GADU 3L9ZA 3HVAA 4NCBA 4ECUA 2LXUA 4YUDA 1M1HA 2HWHA 1H2VZ 4YB1P 4Q5VA 2VPWB 2L3MA 2OUGA 4XO0A 5MLCV 1DRZA 4DQQA 2AWZA 3B4DA 2YKMB 3UI3A 2MKIA 2LEPA 2UUCJ 2MLYA 3D6FB 4WE1A 2KN4A 4DPUA 2ZUGA 4U9RA 1UVJA 4ZK7M 4LF5F 4F50A 1HNIB 2GC8A 3HKZD 2WAQD 1EB0A 4ZJOA 3T1AA 4RU9A 1DTTA 4O0IA 2JNJA 5KFOA 1YJRA 3GWCA 3CDAA 3DOMA 3W1YC 3OQ2A 5T7LA 3Q8QB 2KJWA 2Q79A 1VQMS 3IG1A 4M63A 2MJUA 1HBNB 5E41A 3VVUA 3EVOA 1RU2A 3ZZTA 1WEXA 5A6PA 1SH2A 3CEDA 4CT8A 4LF4F 4J9KA 3PW4A 5IXUA 2U1AA 2HHUA 3T19A 3GJQB 3QT5A 3U1NA 2P6TA 1MWYA 2LCWA 4ZA1A 3C46A 1S9GA 4LT6A 1B70B 2HVZA 2KM8B 1S9FA 3F56A 5KFZA 2EPIA 3RB4A 1WHVA 2HRYA 2AYMA 2HS0A 4DSKA 2ROGA 4AL7A 3G6YA 4FXDA 2V8HA 1NHUA 2C3YA 1F6TA 1S49A 1RWKB 4B3RJ 4N8NA 2J9DA 4JYAF 3ZTPA 2ZH1A 4KIAA 4N47A 2QFIA 2M5YA 5LJ5Y 1IQZA 4OYZA 3Q2TC 2HRTA 2NYIA 2XHCA 4CLLA 3OJUA 1U24A 3H0PA 1Y0HA 3KNAA 2LA6A 3HP6A 4OYPA 3LP0A 3MCNA 1XWLA 2ATLA 1XQIA 2W2MP 2MZJA 4MJKA 4JI8F 1FA0A 3LA0A 1D0EA 3NGUA 4QIGA 5LMNF 4WFNQ 4DL0C 3W5XA 4NA3A 3GONA 4QIVA 2DJWA 4DV7J 1WHXA 3JSRA 3TA0A 4KKOB 4YB5A 4H4MA 4DLEA 1UTAA 1S1VA 1WG1A 3TQ1A 2GIRA 3NRBA 1B0TA 3KYLA 3JYTA 3BPSP 5CZVA 1HBMA 2JC1A 5DS7A 2YKOA 2G2OA 5B08A 4LUBA 1JLFA 2VPZB 2Q1LA 4X62J 4JI1J 4URGA 3DRRA 4USHA 4NI2B 2FVQA 3QGHA 2FZKB 3SCKE 4A8XA 3M2UA 4J9RA 4JI2F 2JVOA 2Z2MA 4FKXA 4PYAA 2HAIA 2BJ9A 3UQSA 2XLJA 2CNNB 3H42A 4U67Q 1BWVA 2OPPB 1UMJA 2HIQA 4GKJF 1UA0A 3ZXWA 2FZGB 3QAUA 2W9CA 1V9OA 4WTOB 1VQ4S 1QM9A 2RMLA 4KPCA 3BQ2A 1RT2B 3H5SA 3T1HJ 2OLWA 1U6BA 3A13A 1P1LA 4XTTA 2HEKA 2VZ9A 3UD5A 3QPIA 1FRKA 3MPVA 2RJZA 2C3UA 3I32A 5A8KA 3A1YG 1NK7A 2HQFA 4QWDA 1NJIT 2EK6A 2C2EA 1DLOB 2EC0A 1SB6A 1AA1B 3AXKA 4FXVA 1E6VA 4ILRA 3G96A 3KXDA 4H4KC 4HDHA 3QGIA 4DSJA 1PO6A 2QC3A 1TFWA 2F40A 1WNEA 4HH1A 2QA2A 2M88A 4DL2A 4LF8J 3FEXB 3A3OB 4YDDB 1KHVA 3SFUA 4FP9A 1ICEB 1JLGA 2Z56B 2KHDA 4MKAA 4DG1B 3M30B 4ECRA 2WCXA 1L3TA 4DL5A 4M5IA 2QT7A 4Y34A 2NCKL 3OVAA 1N32F 4FYDA 3TP2A 1U1PA 3OJSA 4G1IA 1C1CA 4U95A 3KUGA 3CUNA 3WX8A 1HHTP 4CRJA 5K8OA 4NE9C 3A3PB 3L4BC 2OPSA 3MDFA 3QIDA 4AXIA 3QJLA 3TVKA 3IR5B 3SSQA 1Q16B 3PJ9A 2CQGA 4ZLNA 3LUYA 3K58A 2YNFB 3FCVA 1DHMA 1MMNA 2XYGB 2ZBQA 4Q8FA 3GMGA 2YNHA 1RZMA 2ZKUA 3Q8UA 1RT1B 4LFCF 1EKRA 4OIXA 3BQ0A 2RSQA 4U8YA 1BGXT 1N5QA 1J5OB 2C2ZB 4TU9A 1IKWB 2FYXA 4KFBB 4DR1F 1JJ4A 4F8RA 4GC6A 2X1GA 1F5CA 1PBAA 1M90T 1R0CB 1FE4A 3N28A 1L3KA 3DCAA 1BQNB 5KG5A 3DMJB 2PO4A 5CXTA 2IC3B 3G86A 2OTJS 5F0UA 2KYZA 3R6GB 2N4CA 3TVYA 2IVFB 1FEHA 1WD6A 2OEKA 3DC2A 1T3OA 2WBRA 3QJJA 2AJFE 3TEGA 1FHTA 1C1BB 5D8HB 3UDCA 5E3CA 2NPFA 1TVRB 4KJIA 1KFDA 2SXLA 2C2DA 2WSCC 3N6LA 5HQ8A 2G2YA 5KFBA 4ZPCA 2OKQA 3HHEA 2FY1A 4NEYA 2E1CA 3MUVP 2FJAB 4N8OA 1UA1A 4KC5A 3K5NA 4ZKAA 3DGPA 3R6LB 4LFBJ 9ATCB 4CYUA 2CDRB 1G2EA 1NK5A 5FD1A 4WU3A 5HJYA 2E5LF 3VGSA 2Y1JA 1BQXA 3ZTSA 3BEGB 5EGYA 3ILOA 2KG1A 3SCIE 5D0EA 3UW1A 3D1QA 3DYAA 5L39A 1IQTA 1FKOB 3MPWA 1N4LA 5E33A 3Q89A 1UPPA 4OYIA 1YHQS 4ED8A 3ITHA 3PRDA 2ZWOA 2BDPA 4ED3A 3V6HA 4KE5A 1NK9A 3ONQA 4WZQA 2AV5A 1FVSA 3IWNC 3CJRA 2JVRA 3RG6A 1B3TA 3JQKA 5LXYA 3M2RB 4DDFA 2HVEA 1U47A 4F2RA 3CIMA 4WXWA 3ZZPA 3QIPA 3MCOA 2FHMA 3SCLE 2YTCA 4CTAA 3L95X 2FLOA 3E51A 4IUFA 5L9XA 2KVIA 2Z0GA 2YH1A 2XZDB 4DN9A 4O3QA 2P2CB 3FEZA 1WHYA 2YH0A 3AH6A 1TKXA 4DR3F 4CLKA 4ZHRB 3SIPB 5A8RB 3R27A 3UN2A 4U6PA 1YBUA 3JS9A 3IBWA 3SDEB 4IO9Q 2R7QA 1VCTA 2QLXA 5IQQA 2Z58B 3PACA 3W2WA 3RW7A 3T1YF 4YHHJ 1NZ8A 3US5A 2HHQA 2MLZA 5KG6A 3F0NA 2DRBA 2BX6A 3GR0A 3MEKA 4WFYA 2PD1A 4F4WA 4MKYA 3B4MA 4IG3B 2DNHA 2YX1A 4C3KA 2DGTA 1LWXA 2NSCA 4G1PA 5A8WA 1RWXB 3UDEA 1Q1KA 2RH3A 3MEGA 1NJZA 2OPQA 4OLPA 2HYIB 2CJYB 2DR7A 4DL4A 1ZBTA 3QGGA 1RT5B 4O4GB 4URQU 1QSLA 4OYXA 3RJMB 3CCMS 1EETA 2XCPA 3C15B 3OL7A 2F5GA 1O8BA 1FKAF 2HURA 3ZFVA 5IWAJ 3KLGA 2BOAA 1KKHA 4ZIVA 4Y3CA 3PJXA 4M5MA 1XMQF 4USKA 2KFZA 5ETOA 1MNEA 3MM9A 2QFJA 2W7OA 2HBZB 2GA7A 4C9DA 4LF9F 1X4DA 1Q7YT 3PDNA 1LW0B 3BSAA 5C7PA 1M5OC 2XNQA 1ELOA 5D0RA 3MMCA 1V5IB 2VPYB 3JSMA 1M5HA 1HBOA 5ETNA 3TUJC 4YR2A 4BWJA 5T41A 4WJBA 1B99A 4N77A 4YR3A 3EDQB 3KNGA 5K5MA 3RBDA 3AQPA 2ZH5A 4FVMA 3UFCX 4OZ2A 2XS7A 2DIVA 2HBRB 2R7SA 2V4JB 4DZDA 4IH6A 2WB4A 4UZCA 4DV5F 1BMQB 1FXDA 3UNGC 2ZITA 2AHOB 1T05A 1IJFB 1NHVA 3CCSS 3QATA 3H5UA 2XGQA 3LP2A 2FD2A 3IP0A 2NS1B 1KBRA 2HBQB 2LA4A 3S1TA 1YLXA 3IA0A 2ACYA 3DDKA 2C1EB 1CULA 3HDSA 3BF4A 2XMAA 2DGVA 1F60B 2R9LA 3KJVB 1D09B 4ELUA 3AA9A 5HROA 4ZDNA 4X2BA 1P8GA 3FGVA 1KFSA 2XMVA 5KFUA 3FSXA 4DR2J 1RTZA 1KQGB 1HNVB 4LRCA 4CO2A 1FRJA 2FDNA 4CLWA 1UWAA 5CABA 1Y5NB 4J5OA 3CT9A 3EJMA 2J6UA 2NXEA 4PXDA 1BE4A 2MY7A 2A18A 2GHVC 3QSYB 4DR4F 3NS7B 1VISA 2PFFB 3EPGA 2CZ9A 1MMDA 4CO0A 1M5KC 2UU9F 2X3DA 1NSQA 3P6YC 2AZ1A 5GAEI 5GMDA 4UUWA 4F04B 2MDAA 3EVMA 4A48A 1K9MT 4LR7A 2ZHAA 4PXCA 4B9LA 1BWEA 2H48B 1QVFR 1O6XA 3L3CA 2BXJA 2CVIA 4FF2A 1GH8A 2CQIA 7AT1B 3H4BA 1WOPA 3HI9A 2K3KA 2XLIA 4EGLA 4NLWA 2D9PA 2QGFB 5H1SV 3MR6A 2VFRA 2ZH4A 2OHDA 1Y11A 3SSSA 3AJ2A 2VJUA 2Y9HA 3PTWA 1UP1A 2B9XA 3HM9A 1P27B 1U1RA 1YI2S 4J9UE 4ECQA 4IG0A 2AW0A 1UVNA 3HF5A 2DEIA 4WK3A 2BE2B 2V2ZA 1FWLA 4NCGA 4X4SA 3BGOP 5CD4A 4NWBA 4CLSA 1NJYA 3JTOA 5HO4A 2MJNA 2V4RA 1RAIB 2W4CA 1Y9OA 1W25A 4D3HA 2MZ1A 4B9NA 2I2YA 1XMBA 1REVA 5K14B 1WWHA 1GMWD 1YRXA 1VRTB 1F0XA 2DK2A 2HS4A 4ED5A 4ZVPB 3HK2A 5IT9U 2D9OA 4QWBA 3NBPA 4WFAQ 5I42A 3AAWB 3RAQA 1R8CA 5B0GA 1R3NA 1BQMA 5IC6B 5BYSA 2XY5A 2DXFA 4TQSA 3KTQA 5DDOC 4DFKA 3GFXA 3BN4A 4OYAA 1DQ8A 3AODA 4RUHA 1PYSB 1VQ6S 2RUSA 2RD5C 2PT0A 4PQUA 4DQRA 1SKWA 4K5SA 3KFWX 2GJFA 1RHMB 1XJWB 2C3PA 5EHHA 3FDSA 2ZD1A 3AOAA 4A46A 1UJ4A 2MKSA 3GLJA 1XR6A 4ZPAA 4EZ9A 4QIFA 1RDRA 5HP1A 4NYPA 1OYDA 3T9NA 1KNZA 4HH0A 4M5GA 5K9FA 2DNNA 4ZJQA 3KUEA 3BGRA 4ICLB 2ADCA 4Y00A 4B3OB 3T5JA 4YQWA 4CO3A 2WSFC 2W8KA 2YBVA 2RILA 4OI4A 4C8ZA 1DJ0A 2BA9A 3UVJB 4X84A 5A2QY 1U4BA 3A8IA 3OSPA 2IM2A 3WIVA 2KYXA 2GGPB 2RU3A 5J2PA 1S6OA 3MAQA 3DLKA 2HGLA 2BJ8A 2U2FA 4IOAQ 4X64F 4C48A 2MZTA 4Y2CA 2L9WA 1WEYA 2QL5B 5JJBA 3I9ZA 2BQRA 2P8IA 3WC2A 1SUQB 5GAGI 3T5HA 3B78A 4X4VA 4K8RA 4QIEA 1URNA 3I9V9 4TYAA 1RISA 5IV4A 3PEJA 3BM7A 5B7WA 4RNFA 1WC5A 2NUUG 1LV5A 4CH7A 2CA9A 1AT1B 1R7IA 1WKKA 1YQHA 4EEYA 1SV5B 4ANEA 5KFLA 4XPCA 2RHQB 3ISND 4WCEQ 2FVSA 1JLQB 2BQ3A 3EZUA 4LR8A 1VQ7S 1WJ9A 2KM8C 1RADB 4I2PA 3HKWA 2GVDB 3W2VB 3CW2C 1TAQA 2L48A 3M1VA 4NPOA 5DLGA 1YJ7A 4JI7J 1IWGA 4DCJB 1CC7A 4ZLJA 1TL3B 2QLJB 5EUHA 4YP3A 1CJVA 4F2SA 1S7IA 1C4AA 2GIFA 4AL5A 2JRSA 3Q23A 3R5CA 1V5VA 2ZOGA 5LMUF 2WVBA 1MROA 2VD3A 4B08A 2PMWA 2DGQA 3UO0A 2PC6A 3TUZC 1H6KX 3EGWB 1HI1A 2UVRA 1GXLA 2VKRA 6FDRA 3M6WA 4NX9A 4PEOA 5IFMA 3BH6B 1FDNA 2AP6A 4DFPA 2W9AA 2POKA 4Q7AA 2J0SD 2DXEA 2NR0A 3L09A 3ILIA 1P1TA 1CJKA 1K1QA 4WF9Q 4JOUA 2IRYA 1RT7B 4PG6A 2QL7B 1RKIA 4YY3F 4LF6J 4JBCA 1P6TA 3M9NB 4ZN1A 2BKPA 1I5OB 5L46A 2H5JB 1LWCA 4CQ1A 4DFJA 3V4IB 4JV5J 2P5VA 3RBZA 5FLXU 4BS2A 1I1GA 2A0FB 3CIZA 4A4JA 3V6DB 3IM8A 1KDNA 3BSOA 1HARA 5D0GA 5D3GA 1FXRA 1ZAXA 1YRTA 1XR5A 1OQ6A 4U7CA 4H4OB 2FPHX 3VAGA 4LSNB 1YDLA 4DSLA 2A10A 3KDNA 1AZSA 2CRLA 2DHXA 3CMAS 4C3MA 5L9NA 3C66A 3CDWA 1LWFA 4TVAB 1KP6A 5KT7A 1NSAA 2YKNA 2NLWA 4MMOA 4OL8A 4LQ3A 2YPYA 4MFBB 5KFYA 4RNOA 2IA6A 1J5EJ 1JMTA 4LSLB 4GKKF 3W9HA 2FQQB 3PVXA 4FNIA 3ENAA 1X60A 3HLUA 1X9SA 1RKJA 1IUJA 3P96A 4UZBA 4IR1A 1R89A 3MR2A 3FEYB 1AROP 3QRPA 4QU7A 2HNZA 3TANA 3FFIB 2CVEA 2B6AB 2IMWP 1DURA 3MUTP 3VAJA 1VK3A 4HTJA 2JOQA 5E3AA 1CJTA 1N48A 1KLMA 1RT4A 2W25A 3F44A 1NDKA 3MFIA 2J9EA 4MH8A 3SXLA 4USJC 1N5TA 4LF5J 2PGCA 3R9LA 3I0SB 5K8MA 1N5VA 3N01A 4C0HA 5HBMA 1UFLA 3G4SS 4KHPF 1R0AB 2M3DA 2HG4A 3UN3A 3W3SA 4DX6A 4IFYB 1N52B 1IR0A 2YQ0A 3E01A 1ZOTA 4Q43A 2DCUB 3D68A 5J2MA 4OZNA 3MPDA 1CPZA 2HW3A 2D3O1 5T14A 2JFDA 3GV5B 3NG8A 1NKBA 4PCQA 4RUBA 2M7SA 5L8RC 2DHGA 2JLFA 3C16B 1SC3B 1V3RA 5EN1A 1WHWA 1HHQA 1JKHB 4IYQA 3HX9A 1CC8A 2V0NA 5IM0A 1U0HA 3CWJA 7FD1A 4MKVA 3I4PA 3KK2A 1U1MA 4AQYF 2B7CB 2LFVA 4IFVA 4ZPVR 3TX8A 2ZDOA 3PYGA 2VBYA 2BM0A 2ZHOA 1AFJA 2YNGA 5AXMA 3LP1A 1U09A 1FFGB 3VAMA 1DBDA 4V19X 3MWBA 4YMEA 3CC2S 2DY9A 5LSOA 5KG7A 4DV2F 2HGMA 5AXKA 2RF2B 5L38A 1HMVA 2E9RX 4JI8J 1S1TB 1PJ7A 1UVMA 3K5LA 4EWTA 4G65A 4Q44A 4ILMA 1UVKA 3R2CJ 2O3DA 4X4PA 1NO8A 3JB9k 1TKDA 5HQMA 3GV7B 2QSWA 3LW5C 5D15A 4O23A 1NKEA 3IRXA 5KAKA 2K3IA 4NLGA 2DIUA 2QRRA 5DG8A 2R4FA 1S76D 2E1PA 4WE1B 3NS5A 5E2QA 2VC1A 2FLNA 1RAJA 2EFOA 2FZCB 5KT5A 1X9MA 1B64A 5GAHI 4DU7A 3UPFA 3IR6B 5H9EJ 3DXSX 1NCLA 2EK1A 3MD1A 4FYVB 1X4GA 1GXUA 3TEHB 2V4QA 4ZCIA 4IDKA 4I67A 4Y2KA 4DV3F 1RABB 3Q8YA 1DTTB 1NU4A 4Q0BA 3A8KA 2MGZB 3DOMB 4MIBA 5T7LB 4DV6F 4ID5B 5CA5A 4JI2J 4DBQA 1RTDA 3IG1B 4R5PA 3VQSA 3P5BP 2MQ8A 3ETOA 4I6WA 2DPIA 4PG7A 3IAM9 2FJBB 1YJNS 4QCLA 3AD7C 1TUWA 1X9WA 4JI5F 2YNIA 2H1YA 3GIMA 2I5JA 3J81Y 4L74A 5ETMA 4O0NA 3CC7S 3HZGA 3OUYA 4NA2A 1X4BA 3TA2A 3K8VA 3CJKA 2HLTA 1S9GB 1VC6A 1KWMA 1MWQA 1XNQJ 2IJRA 2DR8A 2YY3A 1U0SA 2G13A 4HEA9 1DY3A 1PG5B 2CNLB 1IVZA 3P3DA 4M5NA 4OHXA 5IT0A 3HHNB 1B7YB 4ZVFA 3IMQJ 4G1QA 4A8SA 4CM0A 4PXEA 3M6XA 2M9KA 1RT3A 3OBIA 4HLBA 2G0IA 4M5KA 3ZTOA 5JVHQ 2A3JA 1IBMF 3HCXA 5L1KA 3TARA 4DPWA 2UXCF 2KDOA 4OZ3A 1S79A 5C5JA 3OR2A 3MAAA 2LP4A 3RRGA 2JEJA 3DRYA 2HS3A 1N33F 3JTPA 3VZIA 2MY8A 3DRSA 4RWWA 1VQPS 3LP0B 5SUHA 5KFCA 1NJXA 4PAAA 5KFRA 3MR5A 1SKRA 2BKNA 4DV4J 4WWSA 4DF4A 1N32J 3VALA 5DDRC 5AE1A 4P6QA 2L41A 4BBYA 2FVRA 3FZBA 1OY6A 3HSJA 4H4MB 1S1VB 2GHWA 3GB0A 2GNKA 3TWZA 3JYTB 3BN7A 4C11B 2R2TA 1TFYA 1HBMB 4OV6A 2V5HG 1PJ6A 1JLFB 4ES2A 3QLHA 4LFCJ 1ZYQA 4I56A 2HQGA 3W8PA 2A1BA 2DYAA 3QO9A 2CQBA 4PWDB 5B0EA 3F41A 3I4HX 1YVFA 1KONA 5CYQA 2QA4S 3HXMA 4J90A 2V94A 4OI2A 3H7HB 4RJVA 3M2UB 1TZ0A 3BBFA 1NMEB 2CPYA 3TX0A 3D0GE 1GX6A 3RB6A 1HD0A 2Y8WA 4ED6A 2KJVA 4B02A 2XQCA 3Q83A 1SBRA 4USIA 1RJJA 2ROPA 2ASJA 2ZDPA 4ED2A 2W9CB 2EI5A 2IVMA 4ZJLA 2ZHBA 2MYFA 1UEVA 2NPIA 3G87A 3NWRA 2HMIA 3MMAA 1FJGF 2ZWPA 2WW8A 2EFPA 2W2QP 3R3TA 4B9UA 3CMQA 3R2DJ 4K2JA 4GVLA 3NEKA 1VQNS 5DGAA 4NL5A 1FERA 1VQ9S 1RTIB 2HK2A 1IM6A 2ALYB 5A8KB 4Y2AA 5CCMA 3UD4P 2NXCA 2VBZA 2LQ9A 3VVTA 4YS2A 1E6VB 1N36F 4P2XA 1L3VA 2DR6A 2HIYA 3C3LA 3HHLB 4KHRA 3P5TL 1KR4A 3AD9C 2R8GA 1A6LA 1FD8A 4DS5A 2E5LJ 1XMOF 2QJ3A 3NMAA 5KOXA 2I8EA 2QA1A 1R8HA 2J0WA 4O44A 1SJ3P 4J9PA 2ZC4A 1IN0A 1FFSB 1C2PA 4RUAA 4X4RA 3S01A 1JLGB 4QBUA 2B4OA 2CQ2A 4WKYA 4Y2MA 4URSA 3OTOJ 3HSDA 4R25A 4P72A 3GP9A 4QWAA 2QN6B 4LFAF 5GAEU 1ZM4A 2VG5B 3G8SA 1EARA 2ERRA 1C1CB 4HDGA 4KV8A 4P52A 3G6XA 1H2UX 4EO6A 1RWNB 2X1AA 2LLZA 5KG3A 1WELA 4UOCA 4DUTA 2QMXA 5DJBA 1MLAA 1ZZFA 4DPTA 2F63A 2EFVA 5KFPA 2KT3A 2YNHB 1SKSA 2EFNA 4M5DA 2CQDA 3EM1A 5AT1B 1HW9A 1X5SA 3DU6A 1AUDA 1YX2A 3J7Z5 2J6TA 4WFXA 1F2GA 1X4EA 5J1EA 1ZS6A 4C8OA 1NNDA 4TLQA 4Q2MA 4ATNA 3D4JA 1NH7A 3FMBA 3TNVA 1S1WA 1QSYA 3I87A 2IJFA 3SFGA 1NBEB 1Q0NA 3NCRA 1RTJB 2MPUA 2YWKA 1HWKA 2R7WA 2KRRA 3HT0A 1FDDA 4J9LA 3K17A 2NZCA 3G6ES 1QUVA 1XNRJ 2IAJA 1T94A 1U1NA 3DLBA 4E8UA 2AT1B 3W9IA 3AJDA 2BM1A 1Q5VA 2XWYA 3DGPB 2J6SA 5DM7Q 1VQKS 3P4UB 4CYUB 4OJ1A 1DZ5A 3KK1A 1KVIA 4YFUA 3PRVA 1N34J 3J7A1 1TK0A 2H4YB 3H2LA 4QR1A 1KHWA 3Q22A 4I6AA 2VH7A 4ERDA 1XIQA 4Z2XA 4UY85 1QY7A 3DLGA 5JXSA 3OTCA 4F3MA 3OHBA 3DYAB 1R8PA 1S57A 5IC4B 1XMQJ 1KQSR 3ITHB 4DPXA 3OFGA 3RYLA 2VQEJ 2XG8A 4LF9J 5K20B 1JLEB 4NI2A 2OP5A 2P9EA 4TQRA 2AMCB 2ILZA 2O66A 4KHMA 4KGKA 1IKYA 1ULRA 3TAQA 3QIPB 3AD8C 1RA6A 4C8KA 1FNOA 3ZZYA 2ZBRA 3JQJA 4EYIB 1TUGB 4CTAB 2X1BA 1LOUA 3I0RA 1Y7PA 3D0HE 1RE1B 3M6VA 1RT2A 2DB1A 1OQ3A 1G7CB 2YKQA 5LL6d 1HYSA 5AJ3J 4F0MA 1REGX 3DRXA 1W2BR 1JXEA 1TKXB 4WPAA 2H5IB 4NZ0A 2XSJA 4HHHA 1PGZA 2VIHA 5GAGU 4CCHA 2BKOA 2CZ4A 3EZOA 2CAJA 2BJ7A 3KOAA 3W2WB 1G3OA 2AGQA 5E7OB 2C2KB 3ZZUA 2F1FA 1SL0A 1SJ4P 5AE3A 1TTHB 5F0WA 4ZITA 2BYCA 5A0YB 4RKUC 2H51B 2EXUA 5HLFA 5J2NA 3HSGA 2CQ0A 1Z2ZA 1EKSA 1WKLA 2ZH6A 3Q0AA 2NYHA 4LRAA 1S0NA 2YWHA 2UXDJ 2ZM6J 4ID8A 4OHVA 5A8WB 3WIUA 2GMLA 5B0CA 5F8GA 5U47A 2HNDA 1J27A 1AUSL 3W9JA 3QZ8A 4PPDA 2OPQB 2G0JA 2E1RA 1GT8A 3N4WA 4B3SF 3GFHA 2L08A 5HL7Q 3HT3A 1BY9A 3D1HA 1RWVB 2DISA 3PIOQ 3M30A 1T9YA 3BB5A 1TL1B 3QAEA 4DR4J 1FK9A 3JQMA 3VAIA 3UR3C 4F3OA 2R2RA 1MG7A 2UU9J 4H54A 4DV7F 5DRKA 4NLQA 1EETB 3UWTA 1VRQC 4J7CA 4UT4A 3IN5A 1HWJA 2C2OB 5CHCB 4L3NA 3KLGB 4FF1A 3JTNA 4JV2A 2FB0A 2ASLA 3KG1A 3ULHA 1FF2A 5F9LA 1G6BA 3JSBA 3D66A 2DGUA 1RUSA 2CJQA 5F8JA 2DGXA 2W7AA 1RHRB 3EUNA 3CVKA 2OO4A 3ZZRA 2F4VF 1B0VA 4F67A 3MMCB 3M9MB 3JSMB 1NK8A 2PMZD 1BD6A 5DZ6A 1HBOB 3SQGA 4NXMJ 4I1TA 2HWIA 4DI6A 2J9CA 2VUGA 1WDDA 2RKIA 2Q6CA 4M5JA 1T7PA 3CULA 2VDIA 1YK9A 2CPFA 4N56A 4FBTA 4HACA 1WTFA 3GIRA 2XHWA 3IM9A 3T1HF 1Q8LA 3PG9A 4IH7A 4LF7F 1T05B 5DQGA 1EP4A 1H2TZ 4GC7A 2OPRA 2LDYA 1BC6A 4LVOP 1B7FA 3LP2B 1RBLA 4QR0A 2K7JA 1U45A 4EYHB 1SJQA 3H4DA 4GRSA 3CXCR 4FN5A 4AE5A 1CULB 2XNRA 3NNAA 3PFEA 2JX2A 4OJ3A 2Y1RI 1UFKA 3BBBA 2E5HA 3MEEA 2GS8A 1RYRA 3ICLA 5KT3A 5HROB 2WOMA 4CO4A 4HI2A 3SV4A 4F4XA 3LH2S 3GU0A 4DCPB 4B3TF 1NK4A 1M5VC 2V63A 3TA1A 1RT6A 2G0CA 3WDOA 2GX8A 2N7YA 1SH3A 4LF8F 2ZE2A 2MSTA 1QLNA 2E1MC 1AFIA 4OX8A 2FJEB 1CJUA 4CH0S 4M95A 2JLEA 4C97A 2MHEA 5J1PA 3QYYA 1S5ZA 4DR6F 3Q8PB 5LSRA 3H5XA 4AD6A 1IXKA 1JXVA 2PFDA 2EBGA 3BSNA 3OLBA 5C42A 2V67A 4LBPA 2B4VA 3PYDA 1LEOA 4WIIA 2VV5A 4DR7J 1RYSA 4PG8A 1U2CA 3FC9A 1ZA2B 3M2RA 5B0FA 2BJDA 1VRUA 4JUZA 3M8QA 2XS2A 3PHEA 4FYWB 2C28A 2WZ1A 4ZPWR 3SI8A 2IPOB 3GIKA 4P2SA 1Y5LB 4UUXA 4CT9A 1GMWA 3DRPB 4FS2A 4X64J 2P9CA 1S10A 4ZHRA 2LMIA 4IG0B 1HPZA 4PABA 4NLSA 4X66F 4DSIA 3PY8A 2I1RA 1QE1A 2AEFA 3I6PA 2CPZA 2W1BA 4NCGB 2W8LA 4F3QA 1TKTA 3PW0A 4YB7A 3D67A 1KSPA 3IR7B 3BS9A 1Q8IA 1KRPA 1S6PA 4ZN3A 3HVRA 1RLCL 1REVB 4K4YA 2WBMA 4B9MA 3AFGA 2AIRB 5CQGA 1UW4A 4OZJA 2HHWA 5I3UA 3RW6A 3MEDA 4LRFA 5IS2A 2FLLA 2RDIA 3NBPB 5I42B 2HGNA 5ITHA 3CC4S 3GIIA 3MECB 1BQMB 1F5BA 3I31A 3OLAA 3NLCA 1UEKA 4Z7YA 1HW8A 1YBAA 1HNZJ 3OTBA 1RT5A 3HHDA 4O4GA 2VASA 1HWLA 3S6EA 2E9TA 2IYIA 3M8PA 5LMUJ 1NB2A 3CJ2A 1S12A 3ISZA 2O1PA 2DEJA 2VBXA 3LALA 3HHKA 2Y8YA 1KVJA 3KK3A 1M5SA 2CPDA 2ZVIA 3CD7A 5HP1B 2IM0A 5G4DA 5LXRA 2XWXA 2MKHA 3I5CA 2V9KA 2BRLA 1NKCA 3VCDA 4NXNF 2C2MB 1RP5A 2EVZA 5GAHU 1Y5IB 2B9WA 1EQMA 4DSEA 2H54B 4I4BA 1V6HA 4ER8A 1WC6A 4OHYA 4MK9A 4YY3J 1EJ7L 4CLZA 1SJFA 2B51A 3WBZA 5KFEA 2DY1A 3UN5A 5DDPC 1HD1A 1RQ0A 4WYLA 4YDXA 4WXOA 4FBUA 4NLTA 4IO1A 2M4MA 4DFMA 3BGLA 2K1RA 3UDLA 4ZVSB 3T6BA 3ZO7A 3Q8SB 4WK1A 2VODA 5J2PB 4ELTA 1RAAB 3DLKB 1KVKA 1S99A 2UXBJ 2Z4PA 4M5LA 2GW8A 2V9WA 3HVTA 2ZFHA 1H7XA 1NRKA 3J81j 2M8DB 4W92B 3IS9B 3NMRA 1QUPA 5ETPA 5A76A 1WG4A 4ZLLA 2QTWA 4V1Ak 4JV1A 3PKMA 5KFGA 2ZOFA 4HTIA 4ZVRB 4Q45A 4ELVA 5HAOA 3M2VA 5KFQA 3THVA 2VICA 5KFFA 1PIEA 2LXIA 3MCSA 3RGIA 4LBIA 3TJ8A 4GKKJ 3TVZA 2VF3A 4R8UA 3F73A 4YHHF 2F8EX 2DTJA 1SQGA 2LQJA 1C4CA 3NGRA 2QMUB 5I4MA 1PC4A 1U6ZA 1FWPA 3EMTA 2EFGA 3CCLS 1T9VA 1N6QA 2K7KA 2YKPA 2JDJA 4X65F 1T3NA 1LXNA 4KO0A 2DVIA 3NGTA 3LAKA 4I2PB 3H25A 3K0JA 1T0TV 4WP3A 2DR5A 4DV0J 1SQFA 3M1VB 3QQCD 2WTFA 4I69A 2LYVA 1YGYA 3QSIA 1EIYB 2P6SA 1ZETA 4I64A 4OHZA 4R0EA 1CJVB 3CCJS 1KEKA 3BDEA 2XYPB 2CYYA 3CCTA 2KXHA 2B43A 2BABA 3PO5A 2WONA 4KHPJ 2OEJA 1MROB 4I6YA 5BJRA 5IWAF 1OY9A 1TV6A 1HQEB 1K0TA 1WOSA 2WRMA 1LW2B 2VFSA 4C3LA 2KXNB 2HZAA 4XDCA 3Q2SC 4P7VA 4DR5J 3DLEA 3BO4A 2MB0B 5KFMA 2RQCA 1NDLA 4P7TA 5F8MA 4I2QB 1RGVA 4QQBA 2HZCA 3W8GA 4ZS6A 3PX4A 4LREA 1X4HA 4Q2LA 3ILLA 2HQIA 2E5JA 3KUHA 4OI3A 4CLTA 1RU1A 3CO9A 1OIAA 4DF8A 3D9BA 1UW9A 3M05A 4JI0F 1H0HB 4ES3A 3RR7A 1XTZA 2HHSA 5C24A 3M8SA 3LAMA 2D69A 2NXNA 3R5DA 3SYZA 1VLYA 5KG2A 3MR7A 2BEFA 4RBTA 4USMA 2F7VA 3EGNA 3M8ZA 2W2PP 4Z7CA 4AQYJ 1HFEL 3ADAC 3FKBA 2HK3A 1NK0A 3WC0A 2MHNA 4KH0B 7FDRA 2ZJRQ 1RSCA 3MGJA 2I9SA 2JJ4D 2CJXB 3ETMA 3O5TB 1AZSB 3CD6S 1NAQA 4JI3F 1HIYA 2COLA 2XY7A 1LWFB 4IH5A 3C6UA 4WIQA 2YKNB 1RHKB 1XK8A 3FZ2A 4A8OA 2KL8A 1YIJS 4DV2J 4R0JA 3LQVA 4GO5X 1PAEX 1F9FA 2R8JA 3ZZOA 2PIIA 1DTQA 3DLLQ 2HFOA 1VS3A 5D4PA 4DMZA 3VAKA 1TR0A 5KTQA 2KTQA 1SH0A 4LVNP 3D3BJ 2VG6A 4PUOA 2DNPA 3T9ZA 1C0UA 3GSIA 2HNZB 5H9FJ 4XK8C 1OO0B 1JX4A 2XLKA 3MMJA 2RB7A 2DRDA 3CDUA 1CJTB 2HHXA 4ZCKA 3L7UA 4JI6F 1KLMB 1RT4B 2LQ8A 1VQ5S 3QNWB 3AT1B 2HHVA 5LJ3Y 5IT9Y 3HPOA 2UV8G 1KC8T 1Q81T 1FDBA 5D4OA 2ZH7A 4ICLA 3HHLC 4CI0B 2VU5A 1IJEB 5HBMB 5HQLA 3PR4A 3E3XA 3MHYA 3FQKA 4DV3J 2W24A 2N7CA 4O3SA 4OX7A 3TAMA 3VGVA 1ZPVA 4P9SA 1OJ4A 1RAOA 3W63A 4OJHA 4F02A 5KG0A 3PO4A 4FF4A 2ROEA 2JWNA 1RHJB 3PCOB 3E01B 2DO0A 1GMVA 1BHNA 3SQOP 5B0BA 3MFHA 4JI5J 1VQSA 4X4NA 5CD4H 1EHWA 4N76A 2IHR1 1WDTA 3IBFB 1IKVA 5GVQA 1UWBA 1TKZA 1TK8A 2MKYA 2R7OA 4DV1F 1NDPA 2ZJQQ 1JLAA 4FVCA 1RCXB 2CUYA 5IM0B 3J80U 1U0HB 4ECXA 1JLBB 1VMBA 3CJ5A 3KK2B 3HO1A 1I51B 3J7ZT 1FI4A 3DI6A 5BR8F 2YNGB 3TRGA 3RTVA 4EU0A 2O67A 3NXZA 2B3TB 4WTYA 1VLOA 1IBMJ 2K8GA 2AEJA 4DJBA 2NXJA 4FXWA 2DNKA 3R7BB 3VHQA 3O1LA 4LJMA 2R8HA 1SQEA 2ASYA 1N33J 2CPXA 2FGCA 4NLVA 3PHTA 2ZH8A 4L72B 3QWPA 2K2PA 4CM2A 1HMVB 3FSIA 3POTA 2LQBA 3OT9A 1VHFA 3Q8RB 4OLOA 3UE2A 4K7QA 2VG7A 3PV8A 3B82A 4W98A 1AXQA 4I68A 2VL1A 1ZAVA 2J8AA 3M32A 5M2RA 4XIUA 3SCJE 2MQNA 1T9UA 4QPXA 3GFZA 4PG4A 2QA4G 4RW7A 2DCLA 2V8DA 4TY9A 1N54B 3MOZA 3FCWA 4ETXA 3DFEA 3IRXB 1S4FA 2V50A 5B09A 1ZM9A 4RX6A 2HLUA 1GMUA 3FQLA 3EPIA 3K59A 3DN9A 3NKYA 3W7BA 2FUG9 2VFVA 1Q53A 4DUZF 2EC2A 3NCQA 1RT7A 2FY8A 3RB3A 3SV3A 2OSQA 3HD2A 1L3SA 3GG1A 4ZOSA 2AGOA 1FKPA 1KQKA 5I3PA 4UY8T 4IQMA 3FK4A 4Q0BB 5BYRA 3ET6A 2XTJP 5F8NA 3KLIA 2V68A 3RBEA 3I55S 1RTDB 4R5PB 1SJRA 1N5YA 4QW8A 1VDHA 1TMJA 4OHWA 3B8HA 4UQTA 1JJHA 1VK8A 2YWWA 2Z2ZA 4ZCLA 2YNIB 2F9DA 2I5JB 4DL7A 1D9DA 2MQPA 1W26A 3MM5A 2KO1A 4C0BA 2OGUA 4AYBD 1VR6A 4AFFA 4J9SA 4QYRA 5HMXA 3CJKB 2CKWA 1YJWS 2DO4A 4IR9A 2VQFJ 4WFZA 3UDVA 3JAMU 2AKWB 3PRBA 1D8ZA 3ZTQA 4PWUA 1Y3KA 1HHSA 1YJUA 1S1XA 2MKCA 3K57A 1VOMA 1N56A 1WACA 3MTJA 2HFZA 1BLUA 1U02A 2K06A 3C14A 4ZLPA 4RW6A 3AY0A 4G1QB 1N36J 4KR0B 2HVHA 1T03A 2B7BB 4IRDA 1ACMB 1G1XA 4NZ7A 3D6TB 1U26A 2DGSA 2RS2A 1A7GE 3PZPA 4J9MA 4EZ6A 4KPYA 4KH1B 4DQSA 3EZ5A 2IJNA 4LQ9A 4RR5A 3OR2B 4F26A 3MAAB 5DG7A 3DRSB 4RLEA 3KMSA 1S0OA 2B5JA 3OXLA 1TK5A 4L6V3 1PBUA 3GR1A 1YZ7A 1M1GA 3CJ0A 4LFAJ 2L9NA 3AHPA 2QMWA 1I94F 1FNMA 2JLGA 1RK8A 2WB1D 4X4UA 4Y6IA 5DLFA 5L1IA 1YTYA 1U1OA 3O2IA 4UOFA 2HHHJ 1QAJA 4USUA 2MZRA 1CVJA 2GJIA 1FTRA 1XC9A 2IMOA 4TKTA 2HRUA 4OV1A 3QMQA 3QLHB 2I38A 3CCZA 1YWXA 5I3QA 2HHTA 3QGPA 3C16A 3MD3A 3AJ1A 3R7NB 3C6TB 5CYQB 4DWIA 4CLPA 2N4DA 1L3UA 1JLCA 3U1MA 2J5AA 4DU8A 4JV5F 1NJWA 4UF4A 2XZTB 1U48A 5E3QA 5LM7E 4IRKA 3BGUA 2QX0A 1NK6A 3QRQA 2GQQA 5AE2A 2E29A 4DS4A 1UETA 2FIUA 2J7WA 2CXEA 2OJ3A 3CJ8A 4ZP7A 2IYGA 2FVCA 3MMAB 2HBYB 2KVQE 2AU0A 1K73T 3GZ7A 1Y10A 3CCUS 1DAXA 3VAHA 3IO1A 3BKTA 1IBKJ 2VA3A 3P8BB 2FJWA 4RL1A 2DITA 1J5EF 3TUPA 1D9AA 3LPEA 3OTEA 3O8WA 3IBCB 5D4NA 1ZH5A 1G4CA 1E6YA 3KJFB 4OYOA 2DGOA 3U02A 2FJDB 1UZDA 2XMJA 3BQ1A 3MPYA 2XGPA 2ZZMA 5CYMA 2ZZNA 2IFXA 5G0RB 4K0KJ 3KKFA 1FEEA 1FRXA 2F3JA 1ZAWA 2ZZTA 2D3OR 4FKYA 4O44B 5J2QA 1OYEA 4DL6A 1ZZNA 4UQGA 1WC0A 4J37A 3K2YA 3SMZA 2YQ1A 3ENQA 3NP5A 2HNYA 2XO7A 4IRCA 1PKUA 3R5AA 2Z8QA 1UFWA 1R6VA 3PIPQ 1HR0F 4DN0A 4KTQA 3D54A 2MGZA 4KV8B 1RLDA 1D8YA 3SBMA 4ID5A 1NDCA 2VONA 2Q6BA 3I5BA 1OPZA 3FCHA 3KLFA 1TL7A 1S72S 2RS8A 4DZ6A 4TN2A 2J76E 2AJ4A 2RQMA 3QT7A 4F4AA 5ETLA 3MR3A 1TUVA 2WK4A 5M2PA 3P45B 4M5DB 4O3PA 5JUMA 2XMUA 1YJTA 2IA0A 4MIAA 4KQZA 1SPBP 3QJPA 3CSKA 2DD8S 2EBEA 5J1EB 4QYZJ 4UOHA 1F5AA 4FPIA 1HNWJ 3RUBL 4NYZA 2XZWA 2WVDA 1S1WB 5F8IA 3A8JA 3IRWP 4BHQA 5EWGA 1DARA 2AD9A 4CNZA 4YB6A 4EK2A 2YKAA 3CDEA 4ZVQB 4IOBA 5D0HA 1O5JA 2UUAF 4CLFA 2BANA 4OQJA 4GVBA 4H4KA 4CDIA 2IAJB 3W65A 4RW9A 2AQ4A 4J9NA 5DG9A 1S0VA 1RAFB 1HLWA 3TO8A 1LK7A 4RPFA 1FRHA 3DHWC 4LIWA 5EDWA 2XBPA 2KZMA 5KFTA 3GV8B 4B3SJ 2B0GA 3QZ7A 3KK1B 2V8GA 1NLKL 3PW5A 2D41A 4F7VA 1HNXJ 1NXIA 5CH7B 2BZ2A 3G82A 4JI4J 1VYAA 4RBUA 1A9NB 2GZOA 1S0MA 2V2VA 3DLGB 2CG8A 2BQUA 5DGBA 4KB7A 2RU9A 3W66A 5THWA 3UD3P 3TAPA 2IBOA 4DEZA 4NMXA 4C11A 4F0HA 2AYBA 4NLUA 5LOQA 3K7RA 3DM2A 1FD2A 3DDNA 2J0QD 3R5GA 2E44A 4E2FB 3NAIA 4PWDA 2F4VJ 2LU1A 3WX4A 1WF2A 3AXMA 3S7RA 2WVCA 2BJ3A 5IQ6A 1CS4A 2YX7A 2NUHA 1FX2A 4N5SA 1EZZB 1IKYB 1FE0A 3JXOA 3HJFA 4RW8A 2Y0BB 2GAGC 5A6WA 3EYZA 1LFPA 5CAAA 3I0RB 5C25A 3I5AA 4QZVB 4QOTA 4M94A 2BVZA 5C2CA 2CG4A 5HMWA 4LF7J 2ADBA 1HYSB 4YOEA 5AXLA 2CPIA 3A12A 1GAOA 4DX7A 2C2RA 3MMBA 2DNLA 1F1BB 1XNQF 4HR2A 1PJ5A 4RZRA 3LWLA 2XSJB 3DOLA 1RTIA 3BKUA 2V69A 3CCES 4Q8EA 2ZH3A 1RAHB 2DR9A 4JP8A 2BBEA 3R97A 2CADA 3J7YI 4OYBA 3HHLA 4NLDA 2J7UA 3W64A 3M4XA 2CPHA 4B3TJ 2GVZA 5HLFB 5J2NB 1NEEA 1Y3JA 1VJQA 4K4VA 3N9UC 1S1UA 2LVWA 2G9OA 3N0VA 2OSRA 2OD4A 5F9NA 1CBKA 5E3RA 2PDAA 1F9HA 3RR8A 3NWGA 1K0VA 2HNDB 3UR0A 2CQ3A 2YPZA 3M8YA 2BE9B 1GNKA 1R6YA 3L7OA 4P2MA 4OFZA 1VQ8S 4DR6J 3EICA 4ZPDA 3OXFA 4NLXA 1FK9B 1PC5A 2AYGA 4DV4F 4TY8A 3PYEA 2V6AA 3TJ9A 4DUYF 2VG5A 1RI7A 4USWA 3NOCA 3WZ0A 2ZEJA 3K8WA 3AQOA 2UUBF 4FNHA 1Q86T 1Q78A 1H72C 2KFYA 4OYWA 3RRKA 2BE7D 3H20A 1FJEB 5KFHA 2MKJA 5AXNA 3EVWA 2MEWA 2HPUA 2EW9A 3KG0A 3D3CJ 2Z2LA
chains in the Genus database with same CATH topology
5K14A 4B3MF 2E5HA 3MEEA 3V6JA 5IZHA 2MDAA 4A8KA 4A48A 1RYRA 3ICLA 2RUGA 5KT3A 1K9MT 3ISNC 1VRTA 5HROB 2WOMA 4CO4A 2ZHAA 4PXCA 4HI2A 4B9LA 2PMHA 3SV4A 1BWEA 1QVFR 4F4XA 4NCAA 5E3PA 3T5LA 3LH2S 2MZQA 1SI9A 3L3CA 2BXJA 4NLOA 2IBKA 2CVIA 4B3TF 1NK4A 1M5VC 3SQGB 3TA1A 4FF2A 1GH8A 2CQIA 5KT2A 1R8AA 4G3IA 4DSFA 3H4BA 2BACA 2RRNA 4FS1A 1RT6A 3HI9A 3VWSA 2UZAA 2G0CA 2K3KA 3WDOA 2GX8A 2N7YA 2AF6A 3N5BA 2XLIA 1QJHA 4EGLA 1S6QB 4NLWA 2D9PA 2RKIB 5H1SV 1IM4A 1H7WA 3MR6A 2VFRA 2ZH4A 2JEFA 2ZOMA 4TY8B 2XSFA 3SSSA 3AJ2A 5KOWA 1SH3A 4LF8F 1SIWB 3KLHA 3NGKA 1VIOA 2ZE2A 2MSTA 1QLNA 1UP1A 2B9XA 2E1MC 1AFIA 3HM9A 1T02A 2GFFA 1VGYA 1P27B 4OZ1A 1U1RA 1YI2S 4OX8A 2FJEB 4CH0S 4M95A 2JLEA 4C97A 4GO7X 2Y1IA 4Y2IA 1RTJA 3N79A 4IG0A 2MHEA 4ECQA 3OR1A 3QYYA 5J1PA 4DR2F 1FO1A 2AW0A 3RAXA 4I7FA 4F4KA 3OVSA 2NQPA 3LANA 1WG5A 4DR6F 3Q8PB 2W9BA 1EP4B 5LSRA 1UVNA 3H5XA 2HHHF 4B17A 2GIQA 2BJEA 2OPRB 3HF5A 3HVWA 3H40A 1ZTTA 4KBIA 3V6KA 1RTHA 1IXKA 4V19J 4WK3A 2BE2B 4C8MA 2BW2A 3NNHA 2EBGA 3BSNA 1X7VA 2Q66A 4NCGA 3OLBA 3H2UB 2KU7A 4X4SA 2JL9A 4ES1A 4TU8A 4NWBA 3V4MA 1NJYA 3JTOA 1Y4ZB 4EO8A 4BWMA 5HO4A 4ECZA 4AXJA 2MJNA 2V4RA 5C42A 2ZNZA 4NRUA 2W4CA 1PSDA 2B4VA 3LO3A 1Y9OA 4OMFG 1W25A 4D3HA 2MZ1A 4B9NA 2I2YA 4WIIA 2XEXA 4B9TA 1XMBA 2VV5A 1RYSA 1REVA 4PG8A 5K14B 3MEEB 3M2RA 1U7LA 1WWHA 4QPTA 5B0FA 1YRXA 2BJDA 1JWWA 1DQAA 1F0XA 1VRTB 2WOMB 5HMZA 1KQFB 2XULA 1VRUA 2DK2A 2HS4A 2VFUA 3AB2B 4JUZA 3M8QA 5D77A 1YSJA 3KLEA 4ED5A 3HK2A 2XS2A 3PHEA 2DNOA 2C28A 3NAHA 1UJ5A 2D9OA 3T6JA 2GMHA 4QWBA 1N5SA 3CCVS 3NBPA 4WFAQ 1GX5A 4ZPWR 5I42A 2FLPA 4K4TA 3TW0A 3MM8A 3H5YA 1RT6B 3AAWB 2PI4A 4B3OA 3SI8A 3RAQA 1R8CA 3KHLA 3GIKA 5B0GA 1R3NA 1BQMA 4E98A 4P2SA 5BYSA 1HQUA 3CCRS 2XY5A 4TQSA 1Y5LB 3KTQA 4UUXA 4QIWD 5DDOC 4DFKA 3GFXA 4CT9A 3BN4A 1DQ8A 3KLHB 4RUHA 5HI7A 1VQ6S 2ZE2B 3DRPB 1U8SA 4D3GA 4O3RA 2EG2A 2RD5C 4X4QA 2FHOB 4FS2A 2JEGA 2CJBA 2PT0A 2P9CA 3NL0A 2Q43A 1S10A 4PQUA 2R7UA 1CSJA 2LMIA 4ZHRA 4IG0B 4TU7A 4DQRA 1SKWA 1HPZA 3OR1B 4K5SA 2E5IA 2E5GA 2ALZA 4I7FB 4NLSA 4OI6A 4ECWA 3KFWX 2W9BB 4RW4A 4X66F 5IT4A 4DSIA 5J2MB 2GGPA 3PY8A 4MK8A 1RTHB 2I1RA 4NLRA 3OTOF 1QE1A 1GXTA 1TQLA 3I6PA 2C3PA 5EHHA 5K8NA 2CPZA 2WHOA 3FDSA 4NCGB 1IBKF 2W8LA 4F3QA 3KWMA 3RZAA 4X4TA 4ZP9A 2VB6A 1TKTA 2ZD1A 4A46A 3VTIA 1UJ4A 2MKSA 3PW0A 1JLEA 4YB7A 1VBZA 4NMLA 5JVGQ 5C42B 1Z1ZA 2LQ5A 1XR6A 2FTRA 4ZPAA 1KSPA 4EZ9A 3PFOA 3IR7B 3P49B 3BS9A 1Q8IA 4QIFA 1KRPA 2OMOA 1S6PA 3UCUP 1RDRA 3DOKA 5HP1A 2J0XA 4NYPA 2OIHA 3HVRA 1FT8A 2P9GA 3PW2A 1HI8A 1REVB 4K4YA 2WBMA 1LXJA 4HT7A 3T9NA 4B9MA 1KNZA 4NYOA 5CQGA 1VRUB 4HH0A 4ECVA 2B4PA 3KLEB 3M8QB 5K9FA 4C8NA 1UW4A 4OZJA 3TOQA 2HHWA 2DNNA 2RQKA 3GSDA 4M8LA 5I3UA 3RW6A 3BGRA 3MEDA 1HI0P 4GMKA 5IS2A 3EXCX 2FLLA 2RDIA 3NBPB 4ICLB 1SUQA 2UV8A 3KLVA 4EFAC 5I42B 2R2SA 2ADCA 3MM8B 4K0KF 2HGNA 4Y00A 4B3OB 3OVBA 2B9YA 5ITHA 3CC4S 3T5JA 3GIIA 1KOHA 3KMQA 3MECB 1BQMB 2LEBA 4IFVB 4W90B 1QVGR 1UVLA 1HQUB 3IGNA 2GCFA 1F5BA 4YQWA 1DFDA 2H9ZA 4MYTA 4CO3A 2CPJA 2WSFC 1PILA 3LGMA 2W8KA 2DNYA 2M0GB 1D9FA 2RILA 3I31A 3OLAA 3NLCA 4OI4A 5FIIA 4K4SA 3S8SA 1R31A 3LP1B 1HW8A 2QSFA 4C8ZA 1YBAA 2DRAA 1YG0A 3CJ4A 3MM6A 1DJ0A 2BA9A 4BCAA 1SV5A 2WSEC 4X84A 5A2QY 1HPZB 2ZH2A 1U4BA 3OTBA 4RUCA 1JLQA 1RT5A 3HHDA 4O4GA 4RW4B 2VASA 3OSPA 2IM2A 1VC0A 1HWLA 4HKQA 2KYXA 3S6EA 2GGPB 3ZZZA 2RU3A 1JNRB 5J2PA 1S6OA 1C0TA 2IYIA 3M8PA 1QE1B 3MAQA 3RB0A 5K8PA 1N88A 4HI1A 4ITSA 2NREA 5DDQC 3CJ2A 3OL9A 3DLKA 1JNZB 1SJ1A 1QAIA 2HGLA 3W2VA 3ISZA 1TKTB 2O1PA 1FRMA 2KHCA 2EG1A 2U2FA 2VBXA 4IOAQ 3LALA 3HHKA 1WI6A 3H8YA 1KVJA 1ZPWX 3KK3A 2DNQA 1M5SA 4ED0A 1QAXA 2CPDA 4J9QA 4X64F 1S6PB 4O4RA 1VJWA 2PA8D 3DNCA 2MZTA 3DOKB 3CD7A 4PXBA 5HP1B 2IM0A 1GTEA 5G4DA 5LXRA 2XWXA 5A0YA 2MKHA 3I5CA 4Y2CA 1TL3A 2V9KA 4XPEA 2BRLA 2NZ4A 1NKCA 3VCDA 4NXNF 2JFKA 2L9WA 1RP5A 1WEYA 2EVZA 5GAHU 4BC7A 1XERA 1Y5IB 3BO3A 5JJBA 3D0IE 2ZBCA 2E66A 3I9ZA 2B9WA 1HBUA 2BQRA 1XNRF 2G4BA 2N3LA 5I3UB 1S7HA 3MEDB 5KFJA 4DSEA 4WKRA 2XMKA 3WC2A 4I4BA 1V6HA 1SUQB 3FRZA 5GAGI 3T5HA 3EGZA 2M2BA 3B78A 4X4VA 4OHYA 1KTVA 3E8OA 4MK9A 4QIEA 3IC1A 1URNA 4B9VA 3CJ3A 1S77D 3OFFA 3I9V9 4TYAA 1RISA 4UW2A 4CZCA 1SJFA 2B51A 3PEJA 3CF5Q 1XBWA 2DGWA 4YR0A 3WBZA 5KFEA 2IM3A 2JEIA 5M2UA 3BM7A 4C7QA 1V3ZA 3VQTA 5B7WA 4RNFA 4AL6A 2NUUG 5DDPC 1LV5A 1HD1A 1RQ0A 2XMMA 2YWEA 4CH7A 4F4YA 1K1SA 5DETA 4WYLA 4YDXA 4PG5A 4WXOA 2YVSA 4NLTA 1TL1A 3MM6B 1R7IA 1X5PA 1XR7A 3FSYA 4IO1A 2M4MA 2XMWA 1YQHA 4EEYA 1SV5B 4DFMA 3I56S 5KFLA 4XPCA 3BGLA 3PX0A 1N34F 5KFKA 2K1RA 3UDLA 3ISND 1KD1T 3T6BA 4WCEQ 4DLGA 2FVSA 1JLQB 4CNYA 2BQ3A 1APSA 1HNWF 2BUNA 3EZUA 3I82A 5KFDA 3Q8SB 1VQ7S 5F41A 2ZNYA 4WK1A 4OI1A 2VODA 2KM8C 5J2PB 1C0TB 3M8PB 1TP7A 4IDKB 4I2PA 3HKWA 4ELTA 4I0WA 4IQXA 3DLKB 4ZCMA 3W2VB 1S99A 4KAIA 5KFVA 2Z4PA 5EX0A 1TAQA 2GW8A 2AJ0A 2UUWA 2L48A 2V9WA 2MQMA 3M1VA 3HVTA 1AW0A 3V4IA 2ZFHA 4NPOA 1H7XA 2CQHA 5DLGA 3KK3B 1NRKA 4QWEA 1VQYA 3K5PA 5KG1A 2M8DB 4W92B 3IS9B 3NMRA 1QUPA 1IKXA 1WG4A 3X3UA 2FHJD 3MM7A 2LECA 1CC7A 4JV1A 3PKMA 1TL3B 2ZOFA 4HTIA 5EUHA 5KFGA 4YP3A 1JJ2R 1LWEA 3V6DA 1MSWD 4Q45A 4ELVA 5F3TA 4F2SA 5FDLA 1C4AA 4AL5A 2X3GA 2JRSA 2YX4A 3Q23A 3R5CA 2ZOGA 2E1AA 3THPA 5LMUF 1HBUB 3PJWA 1S9EA 3M2VA 5KFQA 2VQEF 1MROA 4WZMA 1U2FA 2VD3A 3CE8A 4ZPBA 4B08A 3THVA 3LOUA 4H4OA 5KFFA 2DGQA 2LXIA 3D5MA 3MCSA 5KFAA 2PC6A 3TUZC 1H6KX 4LSNA 4X4OA 2KH9A 4QW9A 4A8QA 3EGWB 2X1FA 3TVZA 3V81A 2KT5A 4R8UA 1HI1A 3F73A 4YHHF 2UVRA 2KZZA 4QJVA 1GXLA 4OJGA 2F8EX 2ZC3A 3IAS9 3OUYB 2XC9A 2DTJA 2LQJA 2VKRA 1C4CA 6FDRA 3M6WA 2FHJA 4NX9A 2GMJA 3LGNA 4ECYA 1CG2A 5IFMA 1FDNA 2RQ4A 1Q79A 3GYXB 2AP6A 2V8VA 4DFPA 5I4MA 2W9AA 3PEHA 3Q2TC 2CQCA 2POKA 4Q7AA 2J0SD 4MFBA 3VR1A 2NR0A 1PC4A 3L09A 1U6ZA 3CPWR 4OI0A 2CJ9A 1P1TA 5B0AA 2EFGA 1K1QA 4WF9Q 3BR8A 3DXBA 3GIJA 3GYNA 3CCLS 5CYJA 4JOUA 2IRYA 1RT7B 1N6QA 2K1RB 3K5MA 4PG6A 2K7KA 2YKPA 1HNXF 3PNIA 1OPIA 4LSLA 2CIMA 2JDJA 4X65F 2ZBIA 1T3NA 1RKIA 4EBCA 4YY3F 2JSXA 1LXNA 4KO0A 3FJ2A 2C22A 2DVIA 4JI4F 4JBCA 3LAKA 4I2PB 3H25A 1P6TA 1WF1A 5HMYA 3M9NB 3K0JA 4O3NA 2HHPA 2D7SA 1ZTWA 2DR5A 4NA1A 3TR5A 2CPEA 5DQHA 4OX9F 1LWCA 1OSDA 1RT3B 1U6FA 2MQLA 3PM9A 4MTPA 4CQ1A 3M1VB 3HVTB 5AJ3F 4DFJA 3V4IB 3DHXA 2MSSA 1UAWA 3FRYA 2WTFA 4I69A 2F9JA 2LYVA 2QZ8A 2P5VA 5FLXY 1YGYA 2P6SA 1IKXB 3MI7X 4I64A 2KRBA 1ZETA 1I1GA 4BS2A 3MM7B 4OHZA 3O3LA 4FPRA 4R0EA 3FFIA 3CIZA 1MU2A 1FCAA 3RRHA 4A4JA 2B6AA 1LWEB 2W4DA 2GO9A 1KEKA 3CCJS 3V6DB 3BDEA 2DNGA 1HARA 3DRRB 3BSOA 5FDLB 5F8HA 1O51A 1FXRA 2CYYA 3CMES 1ZAXA 5D3GA 1YRTA 3C2PA 1GTHA 1XR5A 3CCTA 2KXHA 1OQ6A 2B43A 2XS5A 2YQ3A 3AB4B 2VFTA 2AX1A 2BABA 1S9EB 3PO5A 2WONA 3M2VB 4U7CA 1MROB 4I6YA 5BJRA 5IWAF 1KTQA 4H4OB 2PI5A 2FPHX 2VKZG 3VAGA 2VC0A 1TV6A 1HQEB 4LSNB 1K0TA 2WRMA 4DSLA 1LW2B 2UUTA 2VFSA 4R8UB 3NGDA 2A10A 4C3LA 2KXNB 3V81B 4JI7F 1OS5A 1W2IA 2CRLA 4XDCA 5F8LA 1JK9B 4ZVEA 2KFNA 1URRA 2DHXA 3Q2SC 4P7VA 3DLEA 3CMAS 1Q4RA 3BO4A 4C3MA 5L9NA 3I0SA 3C66A 2MB0B 5KFMA 2GO8A 3CDWA 2RQCA 1LWFA 3NCPA 1X8DA 2IRXA 4P7TA 2AX0A 5F8MA 4KRWA 3TUIC 1X0PA 5KT7A 4QR2A 2YKNA 2AJQA 2NLWA 4MMOA 4OL8A 4LQ3A 4I2QB 4KT0C 4MFBB 1RGVA 2O01C 2KI2A 1UL3A 4QQBA 2HZCA 5KFYA 1S6QA 1LFWA 1R0AA 4RNOA 1ZM2A 4ZS6A 2IA6A 2UXDF 5MAOA 2ZM6F 1HA1A 3PX4A 1JMTA 1SL2A 2UVUA 1N6QB 2C42A 1X4HA 4Q2LA 1U1QA 4LSLB 2HQIA 2E5JA 4GKKF 4OI3A 4IFYA 3CO9A 1OIAA 4KO0B 3PVXA 3OXGA 4DF8A 4FNIA 3RU0A 2CFXA 4WYWA 3Q24A 1UJ6A 2IM1A 3M05A 4HHJA 1YITS 4JI0F 3HLUA 3KHRA 1H0HB 4ES3A 3RR7A 1XTZA 2I0XA 2HHSA 1M1KT 5D4LA 5C24A 3M8SA 1X9SA 4FF3A 3KHGA 3GQCA 1RKJA 3LAMA 1IUJA 3P96A 2JZ5A 3FNNA 4IR1A 1R89A 3U7JA 3R5DA 3SYZA 3MR2A 1VLYA 5KG2A 1FRIA 3FEYB 2PA3A 4DHVA 1AROP 4QU7A 2ZJPQ 1HWIA 2HNZA 3TANA 3FFIB 2CVEA