1BLUA

Structure of the 2[4fe-4s] ferredoxin from chromatium vinosum
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
80
structure length
80
Chain Sequence
ALMITDECINCDVCEPECPNGAISQGDETYVIEPSLCTECVGHYETSQCVEVCPVDCIIKDPSHEETEDELRAKYERITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the 2[4Fe-4S] ferredoxin from Chromatium vinosum: evolutionary and mechanistic inferences for [3/4Fe-4S] ferredoxins.
pubmed rcsb
molecule tags Electron transport
molecule keywords FERREDOXIN
total genus 14
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 1996-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bluA00
2V4JB 2Z8QA 1FERA 2XSJB 6FDRA 4DHVA 5CHCB 3PNIA 1GTEA 3OR2B 1IQZA 5BYSA 2C42A 1G3OA 1FRKA 2O01C 2ZVSA 4XDDA 4XK8C 1FDDA 1ROFA 2FGOA 4YDDB 1VJWA 3IR7B 2C3MA 1Y5NB 4ID8A 5E7OB 2Y0SD 2C3UA 4RKUC 3MM8B 1FEHA 7FD1A 2UZAA 1DFDA 1H0HB 1GT8A 1F5CA 1FCAA 1FRLA 1JNRB 5L8RC 2FDNA 1DURA 1FRIA 2PMZD 3EXYA 1FDNA 1FD2A 2GMJA 1HFEL 1DAXA 1FTCA 2WSEC 1CLFA 1JNZB 1Y5LB 2WAQD 2FJBB 1B0PA 3OR1B 4Y28C 5CH7B 4L6V3 1FRMA 2FJDB 1BLUA 3MM5B 1WTFA 1H98A 3MM8A 3OR2A 2C3PA 3HKZD 3MMAB 1FRXA 1BD6A 2VPYB 3IR5B 2PDAA 1Y5IB 3C8YA 1Y4ZB 1GAOA 2GMHA 1SIWB 2XSJA 1AXQA 3MMBB 1FDBA 3MM9A 1PC4A 3MMCB 1H7WA 4KT0C 1FDAA 2V2KA 1IR0A 3EUNA 1SJ1A 5BYRA 2WSCC 4CI0B 1BWEA 1FRHA 1FXDA 1Q16B 1XERA 1C4AA 3MM7A 1F2GA 2FD2A 5BYQA 7FDRA 1GTHA 1KEKA 1B0VA 2WSFC 1G6BA 4XDCA 5FD1A 2VPXB 3MMCA 2VPWB 3MMBA 1D3WA 3MM9B 2VKRA 1F5BA 2WB1D 1FXRA 3MM6A 3EGWB 1FRJA 2IVFB 3MMAA 3IR6B 1A6LA 2C3OA 4AYBD 1PC5A 2PA8D 1BC6A 3MM5A 2VPZB 3GYXB 1K0TA 1RGVA 1R27B 1SIZA 1KQFB 1BQXA 6FD1A 1B0TA 2FJEB 3OR1A 3MM7B 1KQGB 1FF2A 1H7XA 1JB0C 2C3YA 3LW5C 3MM6B 4OV1A 4OMFG 1C4CA 2V4JA 2FJAB
chains in the Genus database with same CATH superfamily
3CJ3A 1YDLA 2VG5A 3D1HA 2EK1A 3I9V9 4DLEA 4F36A 2HVHA 3IM8A 4ZN1A 2P6TA 1PG5B 2XWYA 4K59A 4OI2A 1ZA2B 2VC0A 4RO0A 3TP2A 1S79A 3DU6A 1S0MA 1H2UX 3OR2B 2KYXA 1RT2A 2CXEA 5C24A 3VGTA 5B0DA 2DIVA 1MSWD 4DV3J 2B5JB 2B4VA 4KH1B 4P2FA 2MGZB 2E7XA 4NEYA 5E3RA 5T14A 4I4BA 4KC5A 1KP6A 5KFHA 1VRTA 1VQMS 4PR6A 2YNGA 4AFFA 4DV1J 2YKAA 5E7OB 5KFAA 1FWPA 2KZMA 4FYXB 3GV5B 3MM8B 3DRRA 2N82B 2UZAA 3HP6A 3AXKA 3P4UB 2K7KA 1JNRB 3V5RA 5HP1B 2F8HA 5D78A 2BQ3A 3NOCA 5L1IA 4I7FA 3U1LA 3TO8A 1T7PA 1TV6B 3OT9A 3BBCA 4NZ6A 2NYIA 1WDTA 3D6MB 1EX8A 3PYGA 4QWEA 3T19A 2X3GA 2MHEA 2Y8YA 3IS9B 3G87A 3ILIA 4M5MA 4F3MA 5ITHA 4ECUA 2DNYA 1TVRA 3M9NB 3RG6A 2NXJA 5LMNJ 1NKBA 1RTDA 2CWXA 2RKIA 3SDEA 4Y3CA 4DR5F 2JFKA 2LCWA 1VYAA 3IP0A 5A2QU 3OTOF 2ZHBA 1RHMB 2WOMB 1H72C 2WONB 4KE5A 3TZZA 1BLUA 2B9WA 2FHJD 3MM8A 4NLXA 4USUA 5F9NA 5DG9A 4Z7CA 2R7XA 3JXOA 2YBVA 2QV6A 4EBDA 1FRXA 5LJ5Y 4LRCA 2XMWA 2PDAA 2VFSA 1CULA 2UXBJ 4ELTA 2KM8B 4ICLB 3HXMA 2LKZA 4F0KA 1PAUB 3U02A 4EGLA 4TLRA 2BE9B 3V2UC 2MZQA 4DQIA 2RSQA 3NEKA 5I3UA 1CJTB 2ZDOA 3M7VA 1C1BA 1U8WA 2BW7A 4G1IA 2Q3PA 1RWWB 4NZ0A 4M5DA 1SL0A 1Q7YT 4C8KA 2J6SA 3MAAB 3ICLA 1XERA 3H4DA 1IBLJ 2Z2LA 3K5PA 2O3DA 4URQU 2XNRA 2OD6A 3CIZA 3B78A 1OS5A 3IRXB 1N34J 2CAJA 1RHJB 1OYEA 2XHWA 5KG0A 1FJEB 4K0KJ 4DFKA 3CC2S 3TVKA 5B0EA 1NM2A 2EFOA 1KLMB 3MMCA 2V2QA 1SV5A 4KB7A 4F2RA 3KUHA 2AV5A 2BANB 2C2KB 3BYPA 2WVCA 4DSIA 1APSA 2OAUA 2HVDA 3CCZA 3AD8C 4CO2A 3EMTA 1S10A 3MMAA 2OPPA 3D0HE 3L7PA 2YVSA 4K4WA 4URGA 1FKPA 5GAGU 2B0GA 1JLBA 1YITS 2EEYA 3DCAA 1Y00A 2BYCA 2UV8G 2UUCF 1M5SA 2HZCA 2LEAA 3R6GB 3P8BB 2LEBA 2GMLA 3O1LA 5RUBA 3MM7B 1N6QB 1J5EF 2GNKA 1N0VC 1N5VA 3ZNUA 3QT7A 3NY0A 1M1HA 1BGXT 1X7VA 5I42B 3MI7X 3CDAA 4OIXA 1NK7A 3DU5A 8AT1B 2DJWA 2E44A 1RTZA 3AODA 3KLEB 1IJFB 1R8BA 3DLGB 4XIUA 3BO3A 4USJC 4R8UB 4ANDA 2ZUAA 2D41A 4DHVA 4OI4A 5ETTA 2HBQB 4F3QA 2I5JA 3B8HA 2MZRA 1NK6A 4JV5F 4OYWA 4BCAA 1HNIA 3QFHA 4NEZA 1Z4UA 1MN9A 3DLJA 1TKXB 2ZH7A 1H38A 1DLOB 2RU9A 3LPYA 3EJMA 5J2NA 2HBYB 1W7WA 2Q43A 4UTGA 3VGSA 1FKPB 1SBRA 2FVCA 1E6VA 3NLCA 4X66J 4DPYA 3KK3A 4TN2A 3S6EA 2VFVA 1FRKA 5HBMB 1IWAA 3QBCA 1DY3A 4XK8C 4ECVA 5A8RA 5DDPC 3CC4S 2DNQA 2ZH4A 2MLYA 1FK9B 4PWDA 1ZAWA 1SL2A 1FXLA 5CABA 2NXUA 3MCOA 5EWGA 2E1MC 4O44A 1H74A 2KL8A 4NLQA 3OHBA 3BEGB 3CD7A 4CM2A 3SXLA 2W7PA 2FHMA 3IBFB 1R8PA 4CTAB 4KAIA 1D09B 1N48A 1N5TA 1UZDA 4FF2A 2HQFA 3EPIA 5IS2A 2IA6A 2R42A 5IFMA 4DUYF 2NQPA 1FE0A 1TAQA 1CJTA 2BXJA 4DG1B 1FDNA 3VZHA 4J9QA 1Q4RA 1ZH5A 4WK1A 3DOLA 3LP1B 4OHZA 3D5MA 1LWFA 1SJQA 5EDWA 2MKIA 1Y9OA 1QDUB 1FX2A 2FLPA 2XLIA 3M8ZA 5J2PA 1R8AA 2DXDA 4KFBA 2DEJA 3C6TA 1D8ZA 2MZTA 3DOMA 4NA1A 2XGPA 1IBLF 3ET6A 3D3CJ 2XQCA 1MWYA 4CH1A 3OL8A 3KJQB 1N5YB 1IBMJ 4WFXA 2EC2A 3OXGA 2R7QA 4NYOA 4AE5A 4B3MJ 4DFMA 2HPUA 2EI5A 3B6BA 1RA6A 2RJZA 1S1WB 2AWZA 3S01A 3R5BA 2F7VA 2KVQE 1NMEB 3A4TA 3FFIA 3MEDA 4LQ9A 4PWUA 4QIGA 4CNYA 4ZLLA 5IT4A 4MTPA 4GKKJ 1NUEA 2GA7A 1JWWA 1LK5A 1WC6A 3SIPB 1S59A 2K8GA 2V63A 2BKOA 2XI3A 3HSZA 4XAKA 1VC5A 4WZQA 2FB0A 1HBMA 4C3KA 4QQBA 1B99A 2PE8A 3BQ1A 4KT0C 2V69A 5G0RB 3FVYA 4LFAJ 3ENAA 3GSDA 3EUNA 3RGIA 5CD4A 2NXCA 3IRWP 4HACB 3BQ2A 4CIOA 3PJ9A 4H4OA 1TV6A 4C9DA 3UD3P 4WXWA 2GFFA 2V6AA 5KFSA 4U6PA 2HQCA 1Y0HA 2N3OA 1KD1T 2A6MA 2MKYA 4C11B 3NS7B 3OVAA 4RUBA 5H9EJ 3DLHA 1FJGF 3BO4A 2B8PA 3O6QA 7FDRA 2JFDA 2M5YA 2DCUB 3QIPB 2XB2D 3VAGA 3PW5A 3QRQA 4B9LA 4ETZA 4PXEA 4USIA 4K2JA 4B9MA 3W5XA 3R8YA 2HBZB 1L3TA 4DU8A 4KYZA 4DL0C 3M6XA 4ZCIA 2AX0A 4NASA 4LBPA 1NPPA 3FBCA 1Q53A 2LFVA 2R7OA 2WB1D 5H9FJ 4J9KA 1YBUA 3E01A 4IG0B 5KT2A 1LW2A 1KLNA 1IWGA 4N56A 1R0BG 1NJYA 2PFFB 3AB2B 4DV5J 3A3PB 1WWHA 4JI0J 4JYAF 2CQDA 3FFIB 3FQLA 3OTEA 4Z7YA 1JLAA 1K0TA 4P72A 1RGVA 1N54B 3BQ0A 4PUOA 2CQ4A 4X4SA 1LK7A 3CD5A 1EAYC 2YPZA 1CQNA 2QA1A 3S8SA 4RW9A 2DITA 2VC1A 3OLAA 1VBYA 2VOOA 5DG7A 2J5AA 4NYPA 1VQSA 3CCWA 3VZIA 3W66A 4QWAA 3CCVS 2IY5B 3T6BA 4ETXA 4C4WA 2JNJA 3PZPA 3QLHA 4DSEA 1NCLA 4Y2IA 1ELOA 5CYJA 2GGPB 3DGPA 3W2WB 4RU2A 4ED8A 2XSJB 3T1YJ 4OZLA 4IOCQ 2ZBCA 2XGQA 4IFYB 2W24A 4WP9A 2V9KA 3AOBA 2HFZA 4IKAA 2XC9A 1U1RA 2DR5A 2BV3A 4P9SA 3KJVA 3DLLQ 1WC0A 2EFGA 4ECTA 1RT7B 3CNQP 2IM3A 3TQEA 2V8PA 1VFJA 5BYSA 4B9SA 2E9ZA 3NRBA 2HFVA 2OPQB 2G0CA 3GIKA 3C14A 1R7IA 1JLQA 2DHSA 1S77D 4ZMMA 4NXNF 2NREA 2VL1A 4IDKB 4KO0B 1EETA 2KRRA 2CQ1A 3KXDA 1UCNA 3Q89A 2QZ8A 5KFJA 3O44A 3R5AA 4N8OA 4V1Ak 4ZIVA 2LECA 3NGTA 2FGCA 2ZM6J 3FDSA 1RP5A 4RW8B 4Y00A 3GR1A 1F9FA 3TUZC 5BR8F 4O3SA 3KJFB 1XQIA 1RWKB 1WTBA 3TZWA 4DXLA 2GJFA 4MKYA 2CZ4A 5ETOA 2QEXS 4TY9A 4B9VA 2OTLS 2QMWA 1I94J 2RNEA 4E98A 4C8OA 3ITHA 3KDOA 3QT5A 2VA2A 5IT9Y 2HS4A 4QPTA 3MECA 1AFJA 1SI9A 4QR0A 2ZOMA 1VRTB 5CZXA 4JV2A 3OFEA 4ZPDA 3HJVA 1VRUA 3CF5Q 5KFYA 4TY8A 3K57A 2DNMA 3V6DA 2UUBJ 4FF1A 4KR0B 3GG0A 2IM0A 4NLOA 2HYIB 2VOPA 3UFCX 3BM7A 1WC4A 4X64F 4IUFA 2XZWA 1U2RA 4WU3A 1XR6A 3W7BA 5GMEA 1UVIA 1QE1A 4CLTA 2MDAA 5IM0A 4NRTA 1RZMA 5EGYA 1RT1A 3KMSA 1JLEB 4ZP6A 3HKWA 1Q8BA 1TELA 9ATCB 2H5EA 3D54A 2AZ1A 3MM9A 1M5VC 2FVSA 2VONA 4JV0A 1UVKA 4RW4B 1YJNS 3J7YU 1F0XA 2XS7A 2HHSA 3RAQA 4J9UE 2WK4A 3NL0A 4O3PA 5CA5A 2XY5A 4PQUB 4CWBA 2MJUA 4P2XA 3VV2B 2R7TA 2YXLA 1RT4A 5J1EA 4H54A 3UN3A 2HLUA 3KWMA 4PXBA 4K5SA 3D2WA 2CNKB 2XMTA 1QD1A 1BQMB 1I6JA 4GVBB 4ID5A 1VBZA 2ZBRA 2HRUA 2LYVA 5I3UB 4L74A 2JEIA 2ZD1A 4E2FB 3GQCA 1WC1A 5LMUF 1TKZB 1LFPA 1U1MA 4G65A 5DM7Q 3JTNA 1G1XA 2CRLA 4WCEQ 1FE4A 2VPWB 2Y0BB 4ZJLA 2V4QA 1YJWS 3MR6A 1D3WA 3DLKB 3I5BA 5DDRC 1EP4A 2V67A 3JSRA 3HJFA 3NNHA 4G1QA 2BQRA 3QAUA 4UUXA 1DQ9A 5K8MA 1XIQA 1SUQA 1AZSB 2JLGA 5FIIA 1OPIA 1SC4B 2BJ3A 4QOTA 2AQ4A 3LP2A 1R43A 4F50A 4IQXA 4XO0A 3F73A 1OJ4A 2FUG9 5HVHA 1WSVA 2I5JB 2P9GA 2YKMA 3TYTA 1TK0A 4KTQA 2KFYA 1YI2S 5DQIA 2ZBQA 2ZJPQ 1HYSB 3ILJA 4X4TA 5E5NA 1W2IA 3DLGA 3MPYA 3VALA 2EVZA 2YY3A 4X4RA 2Y9HA 3N5BA 4WFAQ 1FNOA 1QTNB 4NI2A 4FF3A 4NCGA 1OQ6A 2GIQA 1S0OA 5LT5A 1JJ4A 1RWXB 5M2PA 1PCAA 1NPRA 4M5JA 2HAIA 4F7VA 3JQMA 3EVMA 5THWA 2HGNA 1YGYA 5A6WA 3JAMY 4X62F 2WTFA 2AEMA 1YJUA 1NDCA 1JLGB 4ZPTR 1TL7B 4QWCA 2XYPB 1HQEA 4RBVA 4MK7A 2B7BB 2DGUA 2CQ3A 4LSNB 1S4FA 2KKHA 2OPPB 3ZTOA 3Q8SB 3I6PA 4U67Q 2NZ4A 4IFVA 3NMRA 1QUVA 3WHIA 3KLIA 2HHHF 3K17A 3CJKB 4GVLA 1QVGR 3MD3A 4CYUB 1U26A 1TKZA 3DOLB 2DR9A 3UVJB 1CJKA 2WCXA 3MMJA 2XO6A 2XHCA 1TMJA 4ZVQB 2GV1A 3TOQA 4A8MP 4DEZA 4WU2A 1GT8A 1TUGB 3PYEA 1E6YB 3T5JA 4S0MA 4ZN3A 5C42B 1KN6A 4Q0BA 4EUVA 1CC8A 4K4UA 5KFFA 1UFWA 1U8SA 4L3NA 2FLOA 2QTWA 2H4WB 1RKIA 3CEDA 1XWLA 2QA4S 1DTQA 3M2RB 3T6JA 1HARA 1YTYA 2M7SA 4HTJA 3HFVA 3LO3A 1C1CA 3AJDA 1RXOB 1WHYA 1IBKF 4NMLA 3RB3A 4NLVA 1WKJA 2ZHAA 2QO3A 2M52A 1PJ7A 4NL5A 2BJ9A 4HH1A 1UA0A 2GQCA 1RLDA 2C2ZB 2CVEA 2WW8A 3I87A 1XEZA 3R3TA 2FJBB 3NGSA 2X1AA 2IA0A 1GFWB 4CLWA 4ZHRB 4ZJQA 2UUTA 1HQEB 4M5NA 5A0YA 2EFVA 1FRMA 1N52B 4DR6F 2GW8A 4ZOSA 2RQMA 3OD2A 4OYPA 4WP3A 1OMSA 4DMZA 1HIYA 5HI7A 3R2DJ 1SC3B 5ETMA 1FWKA 2DT9A 3CJKA 2CPYA 1TVRB 2DNHA 2R8KA 2XYHB 4K8RA 1FDBA 1JXVA 3DC2A 4YHHJ 1RWOB 1VQKS 1NRKA 3V4IA 2C1EB 1FDAA 4QR2A 4YHHF 3H4BA 4QIFA 2RS2A 3FSYA 3GPAA 2NPIA 1XNQF 4HDHA 3OTBA 4K4ZA 2DHHA 3IGVA 3IG1B 1IR2A 2XMVA 3TZYA 3CCLS 4RW6B 2Z58B 4P6QA 5AXLA 2W7OA 3BYRA 1KQSR 2XZDB 4CRJA 3RAMA 4QBUA 3IBWA 1HNIB 4HYKA 5AE1A 1A7GE 1S99A 4QYRA 5KT7A 2AJ2A 5K8PA 3EPGA 3GE9A 3PJXA 2PMHA 3DRRB 4BWMA 1RAOA 2I8EA 1X4AA 4PCQA 3CO9A 2DRDA 3NS6A 3AFGA 4YB6A 4NPOA 3H8YA 4U7UD 2PFDA 1V3RA 2QJ3A 1GMWD 5H9EK 4ZVRB 3DI6B 1T3OA 1FKOB 3C19A 4FYVB 2HVZA 3MM6A 5ETKA 1S57A 1JIHA 2HLTA 2ZKUA 3G2XA 3I31A 1HNWJ 1HKAA 2C3OA 3V4MA 1VK8A 3MHYA 2ZOFA 4RW7A 4AYBD 1N6QA 2AYGA 4EZ6A 4B3TF 2G0IA 5HLFB 3L9ZA 2VPZB 4DCPB 2H51B 3R7NB 4ZJOA 1KQFB 4X4OA 3CCSS 3T5KA 3K0JA 2HQDA 4RWWA 4MH8A 4C7QA 2RHQB 3OUYA 3E3XA 5ETPA 3IMQJ 3V81A 1I51B 2DD8S 1RJJA 2HS3A 2PMWA 3BS9A 2QL7B 2K3IA 2FY1A 4DV0J 1XMBA 4Z37A 1N5SA 1U2CA 4NA2A 3H20A 3GJSB 1SQFA 3QLHB 4PQAA 4DUTA 3MR5A 5IQQA 1HQUA 3ULHA 2Z0GA 1Q8KA 2M3DA 2JC0A 1Q8IA 1Y10A 3H2VE 3D66A 2PO4A 1RAHB 1ZAXA 2MY8A 2Z8QA 4RW4A 3PYDA 3G71S 3IM9A 2R7UA 1M0SA 4DSJA 4LF6F 2ILZA 2YNFB 2ZZTA 2FVRA 4JI1J 2HHPA 8RUCA 3H5UA 2VJUA 2JZ5A 2BJ8A 1R3NA 1DTTB 2U1AA 3BDPA 4I6AA 4PUOB 5A8WB 4USMA 4KKOB 2I9SA 4FYWB 4OYBA 5IV4A 4J9MA 1IQZA 2XEXA 1SJ3P 1HR0F 4EK2A 4QZVB 2DVIA 4DN9A 4EO6A 4AL7A 1WORA 2VBYA 3BGRB 4Y0FA 3OV7A 1DZ5A 4I6YA 1REGX 3CIMA 3IAS9 3FK4A 2MKJA 4U7CA 4JI2F 4AQYF 4N7TA 5KFQA 3KLIB 5DDQC 5EUHA 3Q8RB 4EMDA 1SQEA 3EGVA 3QO9A 2AU0A 2D69A 3LWMA 2PSZA 2Y1JA 1OWXA 2DO4A 2Y0SD 4LBIA 1UWBA 4F0HA 4ED3A 1W25A 1KKHA 1TL3B 1G7CB 2M2BA 1LNQA 3HZEA 3M2UA 5JVHQ 4UW2A 3LWLA 3M30B 1UPMB 3LANA 5AXKA 1M90T 4WF9Q 2W9BA 3HM9A 3AB4B 3UNYA 4AXJA 2E29A 2I6WA 2B6AB 2MSSA 1RUSA 2VH7A 3GWCA 2HHXA 3ZTSA 1VCTA 1JLFB 3M8SA 1HWIA 4UQTA 1S1VA 1HBMB 2J9DA 3CJSA 3JSYA 4FS1A 1WC3A 1XBWA 3J7Z5 5C2CA 3I0SB 3JQKA 3ZXWA 3NKYA 4QYZK 4NLTA 3HO1A 2AYMA 2Q79A 2RD5C 4E0DA 2AHOB 1ZA1B 3MEKA 4B02A 4OZ0A 1VC6A 2Y1LB 2E5HA 1U0HA 4IRKA 2OSQA 1T03B 2HEKA 1NH8A 1WEZA 1AZSA 3OR2A 2WVEA 3H5YA 2V68A 2RVJA 3R5CA 1S48A 2L08A 2VPYB 3FCVA 4WKYA 4ZLNA 1I94F 1GK8A 3VGVA 1YG0A 3W65A 3POTB 1JXEA 3FBBA 3EDRB 4H4MA 1NKCA 3D28A 5JUMA 2IDEA 2NSBA 2XWXA 2CKWA 1RT3B 3D1OA 3DRPA 4F25A 3K8WA 2WSCC 2OPSB 1RAFB 4NWBA 2KFZA 3QJPA 1TUVA 4I64A 2G1DA 2KJVA 1AUSL 5E3QA 1NJXA 3AD9C 1IBMF 1NSQA 4O3QA 2VG6A 2AGOA 4PXCA 3PJWA 2FD2A 4DSFA 1KQKA 3PV8A 2XULA 3NGRA 4HH0A 1J5OB 1IKWB 4I67A 4EZ9A 1B0VA 2BE2A 1G6BA 2UVUA 1A9NB 4CYUA 3HDSA 1MWQA 2XM3A 1RYSA 3FQKA 5A8RB 1C0TA 1B7YB 2BJ7A 2RHSB 1CVJA 2J9CA 1XMQJ 1UEKA 1U24A 5B0GA 3M9MB 4LSZB 1AB8A 4OHXA 1S0NA 3IR6B 3QZ7A 1JLEA 2HVEA 4RL1A 3I96A 4DQQA 3QGGA 2RAQA 2UUWA 2DY1A 3SSSA 2IJNA 2J0SD 2V0NA 2WBMA 3WDOA 5HLFA 1HNVB 2HFUA 4MIAA 3BSCA 1B0TA 2MQ8A 2AJ4A 4G6VB 3TX0A 4GKJF 1V5VA 1VIXA 2OD4A 2WRMA 4O3OA 2MHNA 4X64J 2C3YA 2CG8A 3MM6B 1TP7A 2J7WA 2MQLA 2P2CB 5JXSA 1UEUA 3N5FA 1IKYA 1FVQA 2W8KA 1HPZA 4MFBA 4GO5X 1CJUB 3QRPA 8ATCB 4TYAA 3PVXA 4USWA 4IYQA 5IOLA 4CLYA 3OHAA 4CNZA 3NMAA 2YWWA 3BR9A 1X4HA 2F40A 2W01A 2VBWA 4AT1B 4PYAA 4Y34A 1TUWA 1DRZA 3LP0A 3GFZA 3GV7B 2VU5A 5KFZA 3FNNA 1MMNA 3SI8A 3CCQS 4MK9A 5KFXA 2XMKA 4BC7A 5C7PA 3PG9A 3C15B 4UOHA 2GS8A 3VAFA 1B7FA 3IWXA 3HK2A 2CJKA 2V2VA 2WVFA 4DV6F 2E1CA 1UTAA 1HR0J 1EETB 2DXEA 2V94A 3CSKA 5A8KA 3WC0A 4X4QA 1S6QB 4PKDB 2V9WA 4ZPAA 1UKUA 3ZZZA 2JLFA 4MIWA 4AUKA 4DV2F 3QGHA 4LJMA 4OJHA 2BOAA 3F44A 2C3MA 1SKRA 2DPIA 1Y5NB 2B9YA 2W1BA 4OZ2A 1NB2A 3OTOJ 3O5TB 3TAPA 1RAIB 1T8EA 1ZZNA 1KBRA 5E33A 1KNZA 3CE8A 4WTOB 1FRLA 5L8RC 2DNPA 4IFYA 3NGDA 3D0IE 1PYTA 2W2OP 4YDXA 3U7JA 2KB2A 2P6SA 2M9KA 1G2EA 1RDRA 2AW0A 2W2PP 3TNVA 4RNMA 2PN6A 2R8JA 1X0FA 2O66A 3QJJA 3OTCA 4H4MB 4CQ1A 1EJ7L 1IM4A 2XMUA 2QYGA 4J5OA 2VB6A 1Y5LB 4PG8A 2R8IA 4B3SJ 3M2VA 2LU2A 3OUYB 4ZVFA 4LBHA 3NCPA 4R5PB 3G8SA 2A2DA 2E9TA 1IUJA 2E7WA 4DL2A 3IA0A 2CDRB 1KRPA 1UVJA 2QL9B 1QAYA 1FO1A 4FKYA 4DI6A 4DL7A 1EQ0A 2C3PA 1LQ9A 2ROGA 4UUWA 2AZ3A 4CP5A 1UVNA 1LEOA 1RTIA 1ITPA 1CJVB 1IN0A 1FKOA 4KGMA 3BREA 3CXCR 2JC1A 2WW4A 5FLXU 3CCES 4F4WA 1M5PC 1OYDA 3H90A 4YMEA 4I6WA 5KG5A 3TARA 1FWLA 4XTTA 3ENVA 4O3NA 2VQEJ 2RQKA 3MOZA 4HEA9 3PR4A 1QTMA 3G6ES 1Q1KA 2X3DA 2ASYA 1OY9A 3CJ8A 4U96A 1HI8A 1V3SA 3PDNA 4ZLJA 3OJUA 3GJTB 5J2QB 2DXFA 1VBKA 3M1VA 4QYZJ 2KDOA 1Q16B 1KWMA 3W9JA 5BXIA 2YKQA 1HNVA 4TU9A 1X4BA 2XI2A 3NAHA 1NHKL 2GZOA 4RPFA 5T41A 3KLFB 1MROB 3MZIA 4CLUA 1B4SA 2G2YA 3VF0B 3RAXA 3MCNA 3KMQA 3RBXA 3RRGA 3KLEA 1XNRJ 1GX5A 1NZAA 1U1QA 1N32F 3LUYA 4CH7A 2HMIB 1RHKB 1RHRB 4KGXB 3EVOA 2BDPA 1C0TB 5CYQA 1CJVA 2MQNA 2CUYA 4J7CA 3FBFA 2IVFB 4DR1F 4FBUA 1FD8A 2CPJA 5DRKA 4IH7A 1VQ9S 4NLRA 4JUZA 5KT4A 1S6UA 4JI6J 4EBCA 1XR5A 2BW2A 1IKWA 2DGVA 2NSCA 2XMMA 3PIPQ 1YRXA 3CDBA 1RT7A 3GYXB 2ZJRQ 3TQ1A 1LWXA 4DS5A 5JJBA 2YX4A 1VISA 3CJ0A 4YR2A 2GJIA 2XY7A 3HT3A 2WB4A 4HLBA 5B0AA 3UW1A 3MAQA 3M2VB 4DOZA 4ER8A 1TQLA 1UA1A 1HBOA 1RSCA 2F63A 1PYOB 1K44A 2YKNB 3M9OB 1U6FA 4PAAA 4YB7A 1UJ5A 1WEYA 2QSFA 1NDLA 1QAJA 2CNNB 4NCBA 4PQUA 2CIMA 1TKDA 1FKAF 1SVDA 3GIRA 3ILOA 3EWGA 1KHVA 4J37A 1XNRF 3CJ4A 3SQOP 1UW4A 5HROB 4W92B 4QIWD 1J2VA 4RNOA 3TWZA 2ZJQQ 4K2XA 4B9TA 2DCLA 3Q23A 3PX4A 4WIIA 1NK4A 4C8YA 4B08A 3GZ7A 3R9LA 1U7LA 1UAWA 1RKJA 2B9EA 3CCRS 2GIRA 1MLAA 4DR3J 5HQLA 3HHLC 1VQNS 3AQOA 4DX5A 5ETSA 1G3OA 1V9OA 2RKIB 2OIHA 2LQJA 4V19J 4XDDA 3I0RB 1RWMB 5IC6B 4A8OA 3M05A 4TNOA 2F65A 1R31A 3HULA 1NNDA 1RBAA 2IHR1 3W9HA 2ATCB 3T1HF 3IS9A 2ZE2B 1U4BA 3BR8A 2Q1LA 3QRRA 2UP1A 2Q6CA 2ZITA 3KG1A 2DKOB 4OL8A 2QLJB 2ACMA 1DARA 2VFTA 4QIVA 4ANEA 1T03A 1SB6A 5KG4A 4F04B 1GEHA 1LOUA 2RRNA 4Q45A 3HHLA 4LF8J 1KR4A 2XLKA 1VHFA 2PMZD 1FJ7A 4TLQA 3THTA 5J2QA 1X60A 2LQBA 2GHVC 3HVTB 5F8HA 1T9YA 2DH9A 4OJGA 1KONA 2N3LA 3PW0A 1Q81T 1DAXA 2BQUA 1X5PA 3FRYA 3RYLA 5CYMA 5KOXA 2M8DB 2DGSA 1GMVA 5D0GA 3CVKA 1SC6A 2KYZA 5KT3A 2K1RB 1FJCA 4ELUA 3OXFA 1U25A 2C2DA 1XMOF 3EZUA 3M6WA 3SCKE 4Y28C 3ETOA 1TL3A 2QC3A 5KG3A 4A8QA 5AE2A 4A8FA 2VIHA 4KHPJ 2P5VA 4ECRA 1PSDA 2WZ1A 2W9CB 1H6KX 1WTFA 1X0PA 1MG7A 2E5GA 2JX2A 3CDWA 5FLXY 4ED7A 3PW4A 4O0NA 3Q2SC 2DGOA 3VAIA 4I0WA 3MMAB 1YX2A 3TX8A 3DLBA 3JYTB 2CDQA 1WD6A 3DLEB 4P2MA 5GMKa 1Y4ZB 2OO4A 2J7KA 2QMXA 1SIWB 2XSJA 3PACA 3DOMB 4ILRA 1ZAVA 1TZ0A 3I4PA 3ZZRA 5A6PA 5KG2A 4DL3A 1GXLA 1KLMA 1V6HA 2DNGA 3C14B 3MMCB 2EG2A 4YN3B 5ETNA 1IR0A 4D3HA 2OTJS 1PJ6A 2BE2B 2DH8A 2HNYA 3OBIA 2KG1A 3D4JA 4DV5F 3H2UB 3RTVA 3KG4A 1Q8LA 3OPKA 4ECXA 2YKNA 2FJVA 2AF6A 3IRXA 3HPOA 3CMAS 4NLYA 1RQ0A 2BE7D 4DV6J 4C0HA 4IQMA 3EDQB 4OX7A 3PRVA 5E3CA 2W25A 4DX8H 5D0RA 2Y8WA 5DO2A 1NK9A 4URSA 1IVZA 3C6UB 3EX7B 4LUBA 4ATNA 1XMOJ 5GAEU 4FZVA 2E1RA 3HI9A 4O44B 1HBUA 1JKHB 3GYNA 4M5HA 3NOGA 3TJ9A 3CJQA 3GV8B 5D3GB 4IRCA 1TMMA 2BJ1A 2VJVA 5L9NA 1M1KT 2HMIA 5F9LA 2EK6A 4WFNQ 1I1GA 3GFXA 1RACB 3J7ZT 2E5LF 3BKFA 4NLGA 4R25A 2VQFJ 2QLWA 3H25A 1HLWA 1R6YA 3TRGA 3CO0P 3ONQA 2MTLA 4LFBF 1OQ3A 3C15A 1KVKA 4MKVA 3PKYA 1LWEB 3N9UC 1UVMA 2NCKL 3M4XA 5A76A 3GG1A 3U27A 1R0AB 3O3LA 2QA4G 2X1FA 1H7XA 2EBGA 4MK8A 5CYQB 5CAAA 3MEGA 3RRKA 1VRUB 3Q22A 3FC9A 1LV5A 4I69A 4DQRA 4Y2MA 4RBTA 3H0PA 2DHGA 3OL7A 2Y1RI 2IRXA 4LSLB 4D3GA 5LSLA 4F67A 3W8GA 4TU7A 1D9FA 3K8VA 1TK8A 2IJFA 2DGXA 4FS2A 5AXMA 4J9SA 1VI7A 5HP1A 2CG4A 2W4PA 4LREA 4TXSA 4M5GA 3F0NA 2OUGA 1LKZA 1MNEA 4RNHA 4RX6A 2GJ2A 3MEDB 4YR0A 2C22A 4M5IA 2W2MP 4H4KA 3IG1A 2CZ9A 1CSJA 1TTHB 3MPDA 4I1TA 1IR1A 1P27B 4ZVEA 4DR7J 1WF2A 4OZ3A 2GX8A 3KHGA 2X51A 3G4SS 3N6MA 2CQPA 1FJGJ 3EGNA 1NSAA 1Y3KA 2JDJA 5KFPA 2DR8A 3PFEA 2HWHA 3CDUA 1TL1B 3I0RA 3QT6A 5IT0A 3FSXA 4P2SA 3RBDA 1WHWA 3BDEA 4KHMA 2M8HA 4OI6A 3R5JB 1L3VA 3D3BJ 1NAQA 5E2QA 1RADB 3UNGC 4LF9F 2AYEA 3N28A 3FCWA 4Q2MA 4DR2F 2IRYA 3FCHA 4NLPA 1S6PA 3PX6A 1XMQF 1KC8T 1Z1ZA 2MY7A 2VG6B 2HKEA 1IKVB 3MPVA 5M2UA 3AAWB 2JJ4D 2NUUG 4M5DB 4JI6F 1N36J 1CBKA 4I2PA 4MT1A 2GO9A 1VS3A 4X66F 2JRSA 4ED0A 3JB9k 4JI7J 1WI6A 2R2UA 3HHDA 3K2YA 3KFWX 2BKPA 3OJSA 3DM2A 2BM0A 5KFVA 5GADI 1JQGA 3QMQA 5GMDA 2ZH9A 2M0GB 1RLCL 1GQEA 1HHSA 1FVSA 2E5JA 4TKTA 2JEGA 4DR5J 3LQVA 1JNZB 2HIYA 5KFCA 3QGIA 4HT7A 5D4NA 4ECWA 3J81U 3HVAA 1AA1B 3OR1B 4CLKA 5AJ3J 2R8GA 3M8WA 2FYXA 3LA0A 1EHWA 2Z2ZA 1N56A 4LRFA 2WVDA 3MM5B 1OIAA 1ZM3A 1K9MT 1TFYA 2VG7B 3UE2A 2GC8A 2A18A 4DS4A 3EGZA 4J9VA 1FK9A 4NMXA 4DPUA 1S76D 2CADA 4BC9A 3MAHA 1ZBTA 2W2QP 1HI1A 1P9YA 4OZJA 2KTQA 4YS2A 4LR9A 1DLOA 2JH3A 4IOBA 5J2NB 5DJBA 3W63A 1NJIT 3IWNC 4CT8A 2GHWA 3EICA 3MM7A 1LW0A 3J80Y 3CCJS 3ENWA 5BYQA 1Q78A 3KLVA 3KUGA 1ULRA 3G82A 4WWSA 3BN7A 2CJAA 2CQBA 1AUDA 3GFYA 3NG8A 2XSFA 2VPXB 4OJ3A 4XPCA 3JSMA 5CXTA 1RWVB 2E1PA 1IKYB 3MMBA 4C3MA 1K8AT 2EC0A 5DM6Q 1F5BA 1HNZJ 4O3RA 1EB0A 3ZZPA 1QLNA 3K5LA 4LF7J 2G2ZA 4K4XA 2F1FA 3D7SB 4EYIB 3VTIA 4M8LA 2IMOA 1X5TA 3MM5A 1J5OA 1R89A 2BJEA 2SXLA 1UFKA 4ID5B 3T9NA 1WEXA 3FEYB 3UN2A 3PIOQ 3V6HA 5J2MA 4M94A 3B54A 2CPFA 1S1UB 5D15A 2KRBA 1VIOA 2YKOA 1HQ2A 2YNFA 1RT4B 5J1EB 4LIRA 1Q0NA 3C6TB 4OV1A 4PEOA 4P75A 3S1TA 5C25B 3HT0A 3CW2C 3GSIA 5KFIA 1RT3A 3DRPB 2MQOA 4DR2J 4DJBA 1RB0A 1S97A 3V6JA 3LAKA 3N6LA 2RMLA 3TAMA 4K5RA 4O0IA 1FERA 3SZ2A 3C6UA 1DQ8A 1S1TB 5AT1B 2I0XA 5HMYA 4Q44A 4Q0BB 3KJNB 2BABA 4CTAA 1T95A 4PWWA 2H54B 2G0JA 1S72S 1I5OB 5IM0B 2W4CA 1N33F 1IBKJ 1TL4A 1SPBP 2HRTA 5K8NA 2PEBA 3F41A 4LF5F 4DCJB 1RBLA 3R5GA 2KHCA 1URNA 2DR6A 2NZCA 3WQPA 2O01C 3FBEA 4QW8A 3SQGA 4ITSA 4B17A 1Y3JA 4C2MA 2RH3A 1U1PA 4UY8T 2DB1A 3DLEA 3HSGA 1AW0A 4YDDB 4DR6J 4X4PA 3HVTA 2CJYB 4ID8A 3VVTA 4J9LA 5CCMA 2C2MB 2FIUA 1U1LA 4NX9A 2W9CA 7FD1A 2G4BA 2PI4A 1JLGA 3QIPA 3RBZA 5H9FK 3L7UA 4NLSA 5F41A 3DMJB 4WK3A 4UT4A 1Q82T 3IN5A 1NHUA 4AXIA 5F3TA 3WX4A 2E7VA 1FRIA 3D68A 4ES1A 3PY8A 4ES2A 1MWZA 1YJRA 4ED2A 3X1LB 4ED1A 2HHWA 2DNRA 2ZH8A 3VAMA 5HVGA 1HWJA 1YLXA 4C0OC 1S0VA 1N4LA 3HX9A 3SQGB 3QGPA 1L3KA 5HMWA 2AJ1A 5F8IA 4YY3J 3K5MA 3UD4P 2QLBB 3P5BP 2V8HA 1U1NA 1HA1A 2HZAA 1WJ9A 2HWIA 1YBAA 5LJ3Y 4ECSA 4LFCF 2B4OA 2OPRA 3GU0A 3BPSP 4KQZA 1Q79A 4DUZF 4J9RA 1HNZF 4G1QB 1N5YA 1BD6A 4MYUA 3QWPA 4FDFA 2V4RA 1BWVA 4YFUA 2AYBA 1PJ5A 5GADU 1VDHA 1AFIA 4ZVSB 5D3GA 3I4HX 2OLWA 2DEIA 4K4TA 1BXNA 1EARA 2QFIA 4I2PB 1BWEA 2VZ9A 3DKDA 3OXLA 3TEHB 3G8QA 4B3RJ 3ADAC 4U95A 4JI5F 4LRBA 4ZLPA 5L38A 2D3ZA 3TJAA 1JJ2R 1S6PB 2DR7A 4JV1A 4Z2XA 4B3SF 2H48B 1IKXA 5KT5A 5K5MA 2V8GA 3T1HJ 5BR8J 3L4BC 4I56A 3C2PA 1HQUB 1LXJA 3GP9A 4HKQA 1WOOA 2A10A 3Q8QB 1M1GA 2AKWB 3AQPA 5H1SV 7AT1B 4JV5J 3POTA 1N36F 1CEZA 1LFWA 3BBBA 1FXRA 1RWPB 1T9UA 2V2ZA 1FRJA 1UW9A 2LEPA 3EGWB 5HJYA 4EBEA 4ZPVR 4JI1F 4OHVA 2DTJA 2Q66A 2PA3A 1RT1B 2PA8D 3OL9A 1BC6A 2OPRB 1KVIA 2DGQA 2WONA 3H42A 2R9LA 3M8PA 4OZ5A 4TU8A 1F6TA 1WDDA 2LDYA 3M8YA 6FD1A 1W2BR 2GQQA 2UXDF 3UO0A 3J7AN 2ZWOA 2RF2B 1NDPA 2XCAA 2FLLA 1HL6A 1MMDA 1SKSA 4HI1A 3OQ2A 2HHUA 3DDKA 1YSJA 2RS8A 5LMUJ 2J9DE 1REVA 3EXCX 2CJ9A 2FPHX 2EXUA 2GQ2A 1KSPA 3K5OA 2V8VA 5HQMA 2K7JA 2QX0A 2ILYA 2X1GA 2W9AA 2IDLA 4L76A 4G3IA 1WKLA 3ITHB 2GVDB 2ERRA 3KK2A 4JI4J 1SJRA 3MEGB 1SKUB 3PR5B 3QPIA 3SSRA 4RUAA 2G2OA 2KVIA 1RAJA 3DN9A 3M6VA 3M30A 4JI4F 2VG7A 2YNIA 3DRSA 4JBCA 4KIAA 2L3MA 5I3QA 1QUPA 3W62A 3HF5A 2AD9A 2KT5A 2MB0B 1HMVA 3BV8A 4DF4A 2C42A 1CPZA 4ZCMA 1CS4B 3PW2A 1KHWA 1W26A 1L3UA 3G86A 4WFYA 3Q2TC 4BWJA 3UR3C 2ZVSA 2Y3YA 5HAOA 5K8OA 3RJMB 2BANA 4C6AA 1NEEA 2RUSA 3Q8PB 4J9PA 3WIVA 4PRFA 3IR7B 4J91A 4ZVGA 2OPQA 1X4DA 4LF1A 3J81Y 3AA8A 4KKOA 4GVBA 2UXBF 1F5CA 4FP9A 4RUHA 4ZHRA 4GO7X 2B9XA 3M8QA 3MF5A 3UD5A 2HQGA 1IM6A 3M8RA 4UF4A 1JLCA 2QA2A 4L72B 4Q2LA 1CC7A 2IFXA 3EE3A 3WX8A 1WF1A 3CWJA 1FEEA 2XMAA 4X4UA 2MPUA 3Q86A 3HHKA 1VQ4S 4Y2KA 4CLLA 3TZXA 4DSLA 3VVUA 1TL1A 2OEJA 3M2RA 3DDNA 3NGKA 5HL7Q 3DOKA 1H2TZ 3C16B 4A4JA 5CZVA 1HI0P 3A13A 1X4CA 3U1MA 3SCIE 3G6VA 3IWLA 1QVFR 2OI2A 3K7RA 4F3OA 3A8JA 5CH7B 3R97A 3RRHA 4QJVA 2B4UA 4OHWA 4N76A 4A8KA 3WZ0A 1JJHA 2W7AA 2HHTA 4DQSA 1R8HA 4UOGA 2L9WA 5KFEA 5MAOA 3HKZD 1RAEB 4OYIA 2ZM6F 3OSPA 4IG0A 1Q86T 3P3DA 2CVIA 2YKPA 3SV4A 1U49A 1P1LA 4HL9A 1RTDB 1WOSA 1X9WA 2K3KA 1YRUA 2LA4A 3UQSA 2XMJA 4ZVOB 2MKHA 5A8KB 1RWUA 2CNOB 4ZVPB 2AT1B 4DL5A 1KTVA 3IAM9 5BYRA 4CDIA 3HFZB 1NU4A 3MUVP 2D3UA 2XNQA 1PGZA 2FZKB 2R3VA 2R7RA 3BSNA 2E5IA 2UUBF 1QM9A 4DPWA 3U1NA 4QU6A 5F8JA 2J0WA 2K2PA 3HHLB 5G0RA 5KFKA 4J9NA 1NPKA 2HHHJ 5LSOA 3J81j 2XG8A 3KK2B 3I9ZA 4DLGA 1AYEA 2CPZA 3NWGA 2JEFA 1QJHA 3T5HA 1SJFA 3T9ZA 3D0GE 4DPOA 2YNGB 1PBUA 4ANCA 3BO2A 2M88A 5E3AA 1GX6A 3A12A 4MMOA 1JLQB 1S7HA 2IPOB 2K06A 4WKRA 1UP1A 2YKMB 5EWFA 3H59A 2NXEA 2VHGA 2B56A 2DHXA 4FXVA 1R0AA 2QGFB 1RCXB 4L75A 1IKXB 1SQGA 2DNZA 2P9EA 2UU9F 1Z2LA 1PKUA 5L46A 4LFAF 1WACA 3NBPA 2HQIA 3FEXB 2RRBA 2FJEB 2H4YB 4R0JA 4UOCA 3LW5C 1XJWB 1XTZA 2Z30B 2VF3A 4KSEB 4CT9A 2CJBA 3KLGB 3KHRA 2PGCA 2J0QD 2F9JA 2ACYA 3DGPB 4KH0B 2QYCA 3DM2B 4PG6A 3I55S 1BY9A 1S9GB 2FJAB 4CO0A 3IO1A 1SXLA 4LFCJ 2RUGA 3D6HB 4DN0A 4ICLA 5KFLA 1MMLA 3MFHA 3DHXA 2EFPA 3KDNA 3GJQB 4PZVA 1RA7A 4DUZJ 5EN1A 3PHTA 1NKEA 1Q7LB 4F4AA 1NO8A 3PNIA 5I4MA 5C42A 3R1LA 2B4PA 5KFRA 2UUCJ 1RT6A 1YJTA 4YEAA 2ZBIA 3MR3A 4ERDA 1C1BB 2VBXA 4P7TA 2IVMA 4EWTA 1WG1A 1EKRA 2OPSA 3K59A 4HDGA 4N8NA 1HBNB 5EHHA 2L48A 2W8LA 1YK9A 3HVRA 1SL1A 4JI3J 3V6DB 2F4VF 4JP8A 5FDLB 1JMTA 1DHMA 1IBCB 2G9OA 5CYMB 5D6GA 5F0UA 4AD6A 2EFQA 5GAHU 1F60B 2GO8A 2YQ0A 1VJWA 2ZNYA 4P7VA 2N7CA 2Z4PA 3K89A 5G4DA 4YB5A 2O1PA 3BJYA 2VICA 1E6VB 1OSCA 2O5DA 5A2QY 1HMVB 2FY8A 3PEHA 1VGYA 3KK3B 1MROA 2AEFA 3G96A 2ALZA 5IQ6A 3GIJA 4M63A 3MPWA 1Q5VA 3CCTA 2NXNA 4A8XA 1ZETA 1RU1A 4GC7A 4N41A 3ZTPA 2VD3A 3GB0A 1DURA 1FX4A 4WPAA 3EXYA 5EX0A 4G1PA 2GVDA 2OHDA 1YKWA 2YQ1A 3GR0A 5JVGQ 1C0UA 2BACA 3KK1B 1CJUA 4FYDA 1RHQB 4IDKA 1IJEB 4KO0A 3PXGa 3RBEA 4FVMA 3DHWC 4FKXA 4Q5VA 2XO7A 4DPTA 2ZKTA 3L7OA 5IWAF 4U9RA 3PW7A 4GKJJ 1L3SA 2FVQA 3I32A 2EG1A 4ELVA 4I68A 2ZDPA 4HR2A 1T02A 1LWEA 1EKSA 2NPFA 2ASLA 3UN5A 3CTRA 4L6V3 3TJ8A 2C28A 1S1WA 2FJDB 1U6ZA 2ZZMA 1FHTA 4JOUA 2MKSA 4HHUA 4R5PA 1IQTA 1F1BB 4LRDA 4QWDA 2BMBA 4FVCA 5F8NA 1RAGB 1EZZB 3IR5B 3LAMA 1Y5IB 1U1OA 2HFNA 3JTOA 2YWKA 1F9HA 4WE1A 5F8GA 1HWLA 1FFGB 2V50A 1UL3A 2XTJP 1M5KC 1HBUB 4CO3A 3IGNA 2B5JA 2CYYA 4ZPBA 4EFAC 2R8HA 4WYWA 3KHLA 2N4CA 1NK8A 4OYXA 1RT6B 3GLJA 4OZ1A 4OJ1A 4HI2A 4ZDNA 4IO9Q 2AGQA 2ZFHA 4CZCA 4C8ZA 3TVYA 2AJQA 3AA9A 1YJ9S 4MIBA 3QT8A 4LVOP 3MFIA 2ZH2A 3FKBA 3D67A 5HN0A 1U47A 1KEKA 3CMES 2H1YA 1HW8A 3TAMB 2HVIA 3UVJA 3T1YF 2CQ0A 1UFLA 4ZITA 2VODA 1TFWA 3W1YC 2PEHA 1VQ6S 4PYDA 3QWUA 5C25A 3Q0AA 3DI6A 4QCLA 4X62J 2UXCJ 2LMIA 2VKRA 4OX6A 5HATA 3PO4A 2G1HA 2MKKA 5HBMA 2U2FA 4KY3A 1F3VA 4USKA 2RQ4A 1ZM2A 2BZ2A 3VAKA 4F2SA 1XNQJ 4DF8A 2DISA 4MJKA 4LSNA 4Y6IA 4NCAA 2VBZA 5LOQA 5LSRA 1P6TA 2HRYA 2GHPA 1XK8A 2WOMA 4B3RF 5D0EA 2AEJA 1S6OA 1RU2A 2RDIA 4P73A 4ALZA 2HBRB 4C48A 2RQCA 2HNZA 4EEYA 4W90B 1X8DA 3E01B 1RT5B 4YUDA 4NXMJ 1SH3A 5KFBA 4OMFG 3UPFA 2H9ZA 4CLPA 1BMQB 4OX9F 3NCRA 5B7WA 3DYAB 1T11A 1T9VA 4C8MA 4CO4A 1NH7A 2B6AA 1HYSA 4L3KA 1YJ7A 1ZS6A 1CQMA 4BDPA 4LF7F 1S7IA 3OVBA 3MCSA 5E3PA 1QSSA 4B3TJ 5U47A 3BSOA 2LDIA 3IFEA 4LF8F 1VC0A 3SFUA 4YR3A 1HD1A 2MYFA 3W60A 1HWUA 2ZH1A 3CC7S 3DRXA 2J0XA 1UWBB 1Q95G 2VFRA 4N5SA 5K9FA 2HQ3A 2XY6A 2BOPA 4OZNA 3KUEA 5GAHI 3H40A 2L9NA 3CD0A 4HHJA 4KGKA 3DLKA 1VQYA 3ZFVA 2ROEA 2ZVIA 1X5SA 2DO0A 3NGUA 1S49A 5KT6A 4RUCA 1KTQA 1O51A 3HLUA 1TL5A 1GMWA 5KFTA 1FEHA 2FQQB 1G4CA 4NE9C 2HHVA 5FJ4A 2YH0A 2CNLB 5GAGI 1A0OB 4A46A 2R7SA 1DTTA 2VUGA 4A47A 4QWBA 3QJLA 4BHQA 3GONA 3JQJA 3Q24A 4BS2A 1GNKA 3ZZOA 4RNFA 1FTRA 4DV7J 3PHEA 2GGPA 1X5OA 2CA9A 2JSXA 3OFFA 4OQJA 4OI1A 1ZPVA 3W2WA 2ASDA 1U48A 2KU7A 2KZZA 2HNDB 1CG2A 1SH2A 3AY0A 2C2RA 5F0WA 4WE1B 5J1PA 4B9NA 4PWDB 1DTQB 4UQGA 2QE5A 4OYOA 2E9RX 4DV2J 4PPDA 2L41A 2MQMA 3KNAA 1HBOB 3AHPA 4IFVB 2DIUA 2RT3A 2WAQD 3B82A 1U6BA 4PG4A 3UDVA 4ZIWA 1MW7A 1B0PA 2OEMA 4ZPCA 5K14A 5DGBA 3KKFA 1TL7A 1TKTB 4DV1F 3ISZA 3VHQA 4O4RA 1UZHA 3GIMA 1CJKB 1ZPWX 2COLA 3LH2S 3QNWB 1T94A 2PI5A 4UOFA 3CCUS 4IR9A 1RISA 5IXUA 5EX3A 3HHNB 2RU3A 3MMBB 2JHEA 4JI8F 3UCZP 1RTHB 2GVZB 3DDIA 4OHYA 2HIQA 1F9EB 1ZM9A 1NBEB 1S1VB 2CQ2A 3MECB 4JI8J 1S9EA 3P96A 4I2QA 2UVVA 3GCXP 3H5SA 1VHIA 5EWEA 2H65B 3BH7B 4CI0B 2HFOA 3G6YA 4X4VA 3GMGA 4DR3F 4I7FB 2QT7A 3FMWA 1LW0B 4NYZA 4M5KA 5CQGA 2Z2MA 4FYYB 3VGUA 1MU2A 3ETMA 3B4MA 5CCLA 3H98A 3OL6A 3BB5A 3DNCA 3W9IA 1N88A 2ZNZA 3FZBA 1PBAA 4NLDA 5J1NA 1RAAB 2R7WA 2FVPA 3DFEA 4IH6A 2MSTA 1UMJA 4Y2AA 4F0MA 4R8UA 2DNNA 3I82A 4RJVA 1ACMB 4I2QB 5HO4A 3V6KA 4OLOA 4LF4F 3PFOA 3NNCA 3P49B 2NUHA 4OYMA 1B64A 3LOUA 1HNWF 5D77A 1UEVA 4C3LA 3AJ1A 4FPRA 5FDLA 2YTCA 1RWNB 1UETA 2N7YA 2KG0A 2Y1IA 4K7QA 2LQ8A 2MLXA 2IC3B 1PC5A 2GAHC 1VQPS 1QSYA 2CPHA 6AT1B 3CT9A 4DFPA 1QY7A 2CQGA 1UJ4A 4RU9A 3L09A 2ZUGA 1T05A 4RLEA 2RILA 4ZVUB 1VBXA 2EFNA 1D9DA 4RNNA 2E66A 4IR1A 2BKNA 1KFDA 3CUNA 3SSQA 3BGLA 2C2EA 4PABA 3QFWA 1P8GA 2XBPA 5HANA 2APOA 3HVWA 1WHXA 6FDRA 3H2LA 3Q8YA 1VJQA 1M5OC 3L95X 2MEWA 2VKZG 1U45A 2X1BA 3RW7A 4DFJA 3RB0A 3CPWR 4LF6J 3NBPB 3ISND 4ZP9A 3BKUA 3SCJE 5B08A 3UDEA 2CZVC 3B4DA 1FA0A 4R0EA 4QIEA 3WBZA 1D1UA 2UXDJ 5DZ7A 1ZTWA 4DR4F 2HGLA 1RE1B 2BM1A 1F2HA 1JK9B 1YJVA 4RZRA 3C3LA 2CFXA 1S5ZA 1IXKA 2O67A 2VFUA 1PAEX 1T0TV 3FEZA 4Q7AA 4O23A 1ROFA 3RU0A 1RI7A 2YQ3A 4USHA 2IM2A 3GILA 4PPZA 2OJ3A 4C8LA 1X4GA 2LP4A 4RWXA 2P8IA 4TQSA 4JI2J 4C8NA 3KNGA 4NLWA 3AH6A 1YRTA 5F8MA 4KHRA 2D9OA 3NCQA 4RBUA 2DGWA 3W5ZA 2UVWA 2JVOA 3KLFA 4W98A 1H0HB 4DR1J 4HTIA 1VOMA 2BUNA 4F4XA 1FCAA 2XLJA 1X4FA 3DMJA 4P74A 4C11A 2ZH3A 3ELHA 2CWKA 1VR6A 3I56S 2DRBA 4F02A 3VAHA 3OFHA 5HK4A 4ILMA 1RCOB 4IO1A 1LWCB 5ETQA 2JOQA 5HVFA 2XCPA 4NCGB 2EPIA 1J27A 3O2IA 3H7HB 4LSLA 4KJIA 2LQ5A 2V8DA 3TI0A 5D4PA 2GMJA 1HFEL 1N8RT 3CULA 4LFBJ 1QSLA 1Q5YA 3GCWP 4X2BA 4F4KA 3D1QA 4C97A 5I42A 1NK0A 4B3MF 4IOAQ 2VDHA 2E1AA 2PIIA 2MQQA 3W5YA 2DBBA 1HBNA 4LR8A 2HNZB 3KYLA 2R2SA 1RHUB 2HS0A 2LVWA 1T9WA 3HHEA 4WBFA 2NYHA 2QLFB 2QN6B 3FZ2A 3UI3A 3X3UA 5HMXA 1RT2B 1H98A 4HVZA 3D9BA 4DX6A 1GXUA 1K47A 1SUQB 3TAQA 1HNXJ 4IRDA 4FXDA 3SBMA 2DYAA 3FRZA 3QIDA 4ENOA 1T3NA 2ZE2A 3W64A 2WVBA 5IV3A 2J7UA 4ZP7A 3C8YA 5KTQA 4DUYJ 2KI2A 2KJWA 5DETA 3QZ8A 2IMWP 1WHVA 4WFBQ 1YQHA 3BGOP 2F3JA 2MGZA 4GC6A 2OEKA 3UCUP 1C1CB 4OFZA 2YWGA 4CO5A 1RTJB 3EM1A 2R2TA 1SJ1A 2B43A 3OLBA 4P10A 3TEGA 5L39A 2HHQA 1UJ6A 2KFNA 1KOHA 3J7A1 1V5IB 1X4EA 2VV5A 5L1JA 4DL6A 4RW9B 1BQMA 1P9QC 2QMUB 1FXDA 4DWIA 4WIQA 3N79A 3ZNJ1 5ETVA 2FLNA 1Y7PA 3FSIA 4C98A 4GKKF 4WP8A 2ZH6A 1VRQC 1DBDA 4RW7B 2VG5B 2ADBA 4OI0A 1VLYA 2IC3A 3MPUB 5DLFA 2EKNA 2CPDA 2XZTB 1LW2B 4NRUA 2CJXB 1PYSB 3J80U 3NP5A 3JTPA 3CJ2A 3R7BB 3THVA 2JWNA 2I2YA 2BR0A 4LF2A 5L9XA 2Z57B 2LXIA 2HZVA 1FFWB 3V81B 2WBRA 2D3OR 2D1CA 2KM8C 3CJRA 4USVA 4LT6A 4OI3A 4ZPWR 4ILLA 3IC1A 1U0HB 4QU7A 4DL4A 2VASA 1R27B 3HD2A 4JI7F 3R7SB 1BQXA 4M5LA 3KLHA 2Q6BA 2Z2YB 3MGJA 1K1QA 3LP0B 3QSIA 4OYAA 4LF5J 3M32A 2AMCB 4K4VA 1ZM4A 3LGMA 5I3PA 4J9OA 2IAJB 5DGAA 2B8QA 2BRKA 3A3NB 2KT3A 2FHJA 3QYYA 2PC6A 3PRBA 4IG3A 4BLGA 3LALA 1C4CA 4EI2A 1J5EJ 3G9CA 3CJTA 5LL6d 3FMBA 4Y65A 3A3OB 4U8VA 3AXMA 5ETLA 5T7LB 1QAIA 3IBCB 1RTHA 2FZCB 2GVZA 3G82B 3P45B 5AXNA 4MAKA 2R2RA 2RE1A 1LWCA 3RR8A 5KFMA 2F9DA 3IXQA 4V19X 3G6XA 2Z56B 1RK8A 4LRAA 3EZ5A 3GFHA 1X9MA 4NOHA 5LM7E 3AJ2A 2R7VA 3M2UB 3MCMA 4OLPA 4TVAB 5DQGA 2MQPA 1XC9A 3QATA 4Y2CA 2HFSA 1O0PA 2ROPA 4H4OB 3TVZA 2FZGB 2IYGA 3VQTA 1U09A 5ADZA 2YX1A 4X65F 2J76E 3N0VA 4AL5A 1S9EB 2MZSA 2YWFA 3TR5A 3V4IB 3MUMP 1N5QA 3MEEA 2EKYA 3T41A 4DDFA 3J7YI 1I3OB 2EBEA 2DY9A 2JLEA 4KFBB 3Q83A 1SV5B 4A48A 5C2GA 3SFGA 1U02A 3R2CJ 4CLZA 4AQYJ 2OFGX 3GJRB 4KV8B 5KG1A 3CDEA 2AIRB 5KAKA 2ADCA 1YIJS 2ZZNA 1V3ZA 3HFKA 3T5LA 5D8HB 3GYGA 5KFOA 3OTDA 4ECZA 3PYFA 3A8KA 5KG7A 1SJ4P 5C24B 1S1XA 1XN9A 1R8CA 3C66A 4F26A 3ENQA 3MURP 4YB1P 4JB8B 2CPEA 4DSKA 3H5XA 2FHOB 5M2RA 2I38A 1S1TA 2DGTA 3LTOA 2AJ0A 2CJQA 4A8SA 2ATLA 1WF0A 4EU0A 2D9PA 2NR0A 4Q8EA 2HK2A 1LWFB 2ZEJA 1WG5A 3ISNC 1R0CB 2QL5B 1VQ8S 4DZDA 1CULB 5D4LA 3ZO7A 3KLGA 1Z2ZA 3MEEB 1CLFA 2IYIA 3D6FB 3EYZA 1KVJA 4OYZA 1N34F 3HSDA 5LMNF 1CS4A 5C5JA 2YWEA 1FNXH 1E6YA 3HMJG 2VDIA 2FC8A 3PEJA 4DV4J 1O5JA 2A2CA 1D0EA 3FJ2A 1EIYB 1H2VZ 2IM1A 2FC9A 2W4DA 5KFNA 2MZJA 4ZA1A 2D3O1 4KPCA 1TK5A 4CLSA 5J2MB 2NLWA 2ZC4A 2MMYA 2LA6A 4PG5A 1PC4A 1RYRA 4DR7F 1WC5A 1JLFA 2H3EB 3DXSX 4Q8FA 3TW0A 3UWTA 3JAMU 3KK1A 2YH1A 2UUAF 3HHLD 2KT2A 1FRHA 1O6XA 1S4EA 2DH7A 3DXBA 3Q8UA 3SV3A 2DK2A 1VQ5S 3THPA 2RF2A 3ZTRA 1F2GA 2H5IB 3KLHB 5HJXA 3M1VB 1DJ0A 3LP2B 4L73A 4RW6A 4RW8A 4ZP8A 4WFZA 3MUTP 4ZCLA 4CH0S 2A0FB 1HHQA 4HACA 3KOAA 2G13A 4XDCA 5FD1A 2ASJA 4KHPF 4P52A 3QO9B 2JEJA 1HPZB 3FGVA 2HWTA 4MFBB 2A6OA 3I5AA 3NAIA 4LF9J 5HQ8A 2F8MA 2BX6A 2QG9B 1F3FA 2IVYA 1X31C 2QRRA 1RTIB 4CM0A 4CLFA 3JS9A 4FNHA 4ECYA 1KDNA 3M32B 2AX1A 1A6LA 2DHAA 3EVWA 2BJDA 3SCLE 3NNAA 3CD6S 1NXIA 3VCDA 5DQHA 1HD0A 5L1LA 2FJWA 3BKTA 3TUIC 4EO8A 5A0YB 4BBYA 1URRA 1SIZA 4FBTA 2CQIA 3OR1A 2A3JA 2QSWA 4ZVTB 5LXRA 5DDOC 4NXMF 4O4GB 4UY85 1N32J 2XS5A 1KQGB 3TUPA 3NWRA 5B0FA 5GAEI 2BEFA 2LXFA 3ET6B 2NS1B 3ILLA 4H4KC 4YQWA 2J6TA 3US5A 4DCOB 4YY3F 1R6VA 1S9GA 4YOEA 1ZZFA 4ED5A 3CCMS 1OPZA 1B70B 2EWHA 2V4JB 4DPXA 4DU7A 3OFGA 3GTYX 3HCXA 3TANA 2HSEB 5F8LA 5SZTA 1YHQS 4FN5A 4CCHA 4PG7A 5CD4H 2A1BA 3P5TL 1EQMA 2C2OB 3MAAA 1GTEA 1WG4A 1K73T 2AP6A 2VA3A 4DQPA 5E41A 1JLAB 2E5LJ 4KPYA 2M4MA 5JMNA 2HNYB 1WOPA 5KFUA 4KV8A 3SDEB 1RABB 2K1RA 2R4FA 3RB4A 1VK3A 1FESA 2ZBPA 1FDDA 1S6QA 3ZZYA 1YZ6A 1ZOTA 4U8YA 4K0KF 4JI5J 1SKWA 1KFSA 2V5HG 3CMQA 4FXWA 1S12A 3MR2A 1C0UB 2C3UA 2UVRA 3BSAA 1DFDA 2BBEA 1QE1B 1TKXA 2N4DA 2W9BB 4OX9J 2KN4A 2UV8A 4PXDA 3VR1A 5AE3A 4P71A 2HURA 4UZCA 1TU0B 1UPPA 1H73A 1RBOB 1YVFA 3DRYA 3FUYA 4M1KA 5E0OA 2IRUA 4E8UA 3JSBA 1UVLA 4WZMA 5IT9U 1SC1B 1U0SA 2OP5A 2XYGB 1PIEA 1WELA 2YNHA 2P9CA 2ZWPA 3HZGA 3NXZA 1KS2A 2BA9A 1U2FA 3MD1A 3O8WA 4NI2B 1OY6A 1VMBA 4YP3A 3E2EA 3S7RA 4NZ7A 3A8EA 2IBKA 4HHHA 1YWXA 2QIFA 4A8YA 1OSDA 1RT5A 5HMZA 3MOJB 4N77A 1D8YA 2OMOA 3BGRA 5ETRA 5BJRA 3G8TA 4KGZB 4A8WA 3P6YC 2DPJA 5KFGA 2OH2A 3CGIA 2RB7A 3N01A 2DRAA 3GIIA 2B51A 2FHKA 3SYZA 3KTQA 4M95A 1M5HA 3TUJC 4DV4F 3R6LB 2ALYB 1X9SA 1NB7A 5HROA 5F3ZA 2L9DA 3N6NA 3SMZA 3ZZ0A 3BGUA 3MTKA 1GAOA 1HW9A 1NJWA 2B3TB 1AXQA 3C16A 2PD1A 3PTWA 1LXNA 1XR7A 1NDKA 2MKCA 3EZOA 4GMKA 4KGVB 2QLXA 2UU9J 1H7WA 1Y11A 2OGUA 1FT8A 2MZ1A 2V2KA 1BQNB 5DS7A 3UDLA 4DR4J 3WC2A 2D74B 2ZD1B 4DG1A 3VWSA 5IZHA 2VQEF 1PO6A 3ZZUA 4QW9A 1QAXA 1BUXA 4OX8A 3ZTQA 3ZC4A 1JJCB 3M8QB 1C4AA 1S1UA 4FPIA 1ZYQA 1S1XB 5B0BA 3K5NA 4ZVHA 4DZ6A 3UDCA 2OKQA 1OY8A 1PILA 3E8OA 4ED6A 2X7IA 1NHVA 2IIHA 3A8IA 2RRAA 1BQNA 2KH9A 2UXCF 2IBOA 1DQAA 2GAGC 3BBFA 4F8RA 3MM9B 2HK3A 5DZ6A 4UZBA 5KOWA 4WXOA 3F56A 1KOOA 4IH5A 5LXYA 3JYTA 4O4GA 3W61A 4WTYA 2B7CB 2AGPA 2IJRA 2WHOA 1T05B 3VQSA 5DLGA 1O8BA 4X4NA 1TR0A 2J6UA 3TA1A 3AD7C 5D0HA 4KBIA 2POKA 5K20B 4K4SA 4CO1A 2OSRA 2KXHA 2KO1A 2YNIB 2LQ9A 3DRSB 3TA2A 4ECQA 4NXNJ 1WNEA 1OO0B 3NS5A 1FF2A 2DNOA 1JB0C 1BHNA 3I0SA 4TY8B 3MTJA 2HAFA 4B3OA 3W8PA 1FNMA 3KHHA 1JXLA 4MYTA 5D4OA 4J90A 3AOAA 1BE4A 1C2PA 1NSPA 1NSKL 1AT1B 1REVB 1L5UA 1F5AA 3SEOA 3BF4A 2YNHB 4IG3B 3OW2R 2LLZA 5B09A 1SCJB 5CHCB 4N47A 1SH0A 2QFJA 1MU2B 4F4YA 1N33J 4ZS6A 1HHTP 1WKKA 2KXNB 4FF4A 3MDFA 2ZHOA 3HSJA 3BGFA 4ES3A 2W2NP 1JLBB 3LGNA 3BZQA 5MLCV 2F4FA 1YBTA 2RIJA 2UUAJ 4WYLA 4JI3F 2F4VJ 3QAEA 2KHDA 4EYHB 1T9XA 2FGOA 5B0CA 2YPYA 1WI8A 3AT1B 1JKHA 1NLKL 4RKUC 3W2VB 5KFWA 1GXTA 1VQLS 2ZOGA 1JLCB 1ICEB 1TKTA 5SUHA 2J8AA 4KRWA 3RZAA 2J8SA 2H5JB 1T9TA 1FI4A 5DG8A 1AROP 4GRSA 2HGMA 4F4ZA 2LXUA 4W4MA 4USTA 3QSYB 2FDNA 1NJZA 1FFSB 3I5CA 1D9AA 1HWKA 4MKAA 3DGVA 4X65J 3L3CA 1JX4A 4LQ3A 2CQHA 3R27A 1FD2A 2HNDA 1MN7A 4DV7F 3T3FA 2FJXA 3UCGA 3LP1A 3R1HA 2ZC3A 2HG4A 4ZCKA 1FTCA 2XS2A 2OELA 2LU1A 2WSEC 1H3DA 3RUBL 5AJ3F 4B9UA 3LPEA 2D7SA 2YX7A 2YWHA 3M6UA 3C46A 4NA3A 1IKVA 1VQOS 3PO5A 1HNXF 2C2NA 4K4YA 3PX0A 3PM9A 2GCFA 3A1YG 3W2VA 4TYBA 1B3TA 2RDDA 2BVZA 2M70A 1YZ7A 3VAJA 4OV6A 3K58A 1GH8A 5IC4B 4JYAJ 5KG6A 1NZ8A 2JVRA 1WSRA 5KFDA 2GMHA 2VQFF 4C0BA 3R5DA 5GVQA 2CQCA 1ZTTA 4NLUA 2BRLA 2FTRA 2MJNA 3RB6A 1S9FA 1UWAA 3OVSA 5T7LA 3JSMB 4LR7A 2ZH5A 3BPDA 2DNKA 2PT0A 1NK5A 2V34A 2GIFA 3QQCD 4JI0F 3N4WA 2JL9A 4XPEA 4DV3F 2IAJA 2J9EA 3CJ5A 4B3OB 9RUBA 1K1SA 3AOCA 4LMZA 3ZZTA 4ZKAA 4QR1A 3LF0A 3PCOB 3W3SA 1GTHA 2CPIA 2F8EX 3MR7A 2ABYA 3PKMA 4LF4J 3RW6A 2OMLA 4WJBA 2WSFC 4FNIA 4HT5A 3DYAA 3UR0A 3PRDA 4LVNP 3T1AA 2EW9A 4K50A 2HW3A 1EP4B 3Q8VA 2AJFE 4DBQA 5HSPA 3BH6B 2I1RA 1P1TA 4X84A 1GMUA 3MXHP 1N0UA 3E51A 5L1KA 4MKBA 4RR5A 4LIWA 4U7UK 2DNLA 4QPXA 3WIUA 3M8PB 4ED4A 1VQ7S 3HD1A 5A8WA 3BN4A 2OFHX 3KJVB 1WUUA 5K14B 5IWAJ 1VLOA 3OSNA 3KG0A 3D6TB 3RR7A 4Q43A 2MLZA 4DX7A 3LGHA 2KXFA 3CB4A 4ZK7M 1U1KA 1TAUA 2CPXA 3DOKB 3MWBA 1K0VA 3TA0A 5J2PB 2V4JA 1RTJA 2F5GA 2MXYA 4TQRA 2RDJA 4AL6A 4DV0F
chains in the Genus database with same CATH topology
3CJ3A 2VG5A 3D1HA 2EK1A 3I9V9 4DLEA 2HVHA 2P6TA 4OI2A 2XWYA 4K59A 3TP2A 2VC0A 1S79A 3DU6A 1S0MA 1H2UX 3OR2B 2KYXA 1RT2A 5C24A 5B0DA 2DIVA 1MSWD 2B5JB 2B4VA 2MGZB 2E7XA 5T14A 5E3RA 4I4BA 4KC5A 5KFHA 1VRTA 1VQMS 4PR6A 2YNGA 4AFFA 2YKAA 5E7OB 5KFAA 2KZMA 3GV5B 3MM8B 3DRRA 2N82B 2UZAA 3HP6A 2K7KA 1JNRB 3V5RA 5HP1B 2F8HA 5D78A 2BQ3A 5L1IA 4I7FA 3U1LA 3TO8A 1T7PA 1TV6B 4NZ6A 2NYIA 4QWEA 3T19A 2X3GA 2MHEA 3IS9B 4F3MA 5ITHA 4ECUA 2DNYA 1TVRA 3M9NB 1NKBA 1RTDA 2RKIA 3SDEA 4Y3CA 4DR5F 2JFKA 2LCWA 2ZHBA 3OTOF 2WOMB 2WONB 4KE5A 1BLUA 2B9WA 2FHJD 3MM8A 4NLXA 5DG9A 5F9NA 2R7XA 2QV6A 4EBDA 1FRXA 5LJ5Y 2XMWA 2PDAA 2VFSA 4ELTA 2KM8B 4ICLB 3HXMA 2LKZA 3U02A 4EGLA 4TLRA 3V2UC 2MZQA 4DQIA 2RSQA 5I3UA 2ZDOA 1C1BA 4G1IA 4NZ0A 4M5DA 2Q3PA 1SL0A 1Q7YT 4C8KA 2J6SA 3H4DA 3ICLA 1XERA 2Z2LA 3K5PA 2O3DA 4URQU 2XNRA 2OD6A 3CIZA 3B78A 1OS5A 3IRXB 2XHWA 5KG0A 1FJEB 4DFKA 3CC2S 3TVKA 5B0EA 2EFOA 1KLMB 3MMCA 1SV5A 4KB7A 4F2RA 2AV5A 2BANB 1APSA 4DSIA 2OAUA 1S10A 3CCZA 4CO2A 3MMAA 2OPPA 3D0HE 3L7PA 2YVSA 4K4WA 4URGA 1FKPA 5GAGU 2B0GA 1JLBA 1YITS 3DCAA 1Y00A 2BYCA 2UV8G 2UUCF 1M5SA 2HZCA 2LEAA 2LEBA 2GMLA 3O1LA 3MM7B 1N6QB 1J5EF 2GNKA 1N0VC 1N5VA 1BGXT 1X7VA 5I42B 3MI7X 3CDAA 4OIXA 1NK7A 3DU5A 2DJWA 2E44A 2C28A 3KLEB 1IJFB 1R8BA 3DLGB 4XIUA 3BO3A 4USJC 4R8UB 2D41A 4DHVA 4OI4A 4F3QA 2I5JA 3B8HA 2MZRA 1NK6A 4JV5F 4BCAA 1HNIA 1Z4UA 3DLJA 1TKXB 2ZH7A 1H38A 1DLOB 2RU9A 3LPYA 5J2NA 2Q43A 1FKPB 1SBRA 2FVCA 1E6VA 3NLCA 3KK3A 4TN2A 3S6EA 2VFVA 1FRKA 5HBMB 4XK8C 4ECVA 5A8RA 5DDPC 3CC4S 2DNQA 2ZH4A 4PWDA 1FK9B 1ZAWA 1SL2A 1FXLA 2NXUA 5EWGA 2E1MC 4O44A 4NLQA 3OHBA 3BEGB 3CD7A 3SXLA 2W7PA 2FHMA 1R8PA 4CTAB 4KAIA 1N48A 1N5TA 4FF2A 2IA6A 3EPIA 5IS2A 2NQPA 5IFMA 4DUYF 1FE0A 1TAQA 2BXJA 4DG1B 1FDNA 3VZHA 4J9QA 1Q4RA 1ZH5A 4WK1A 3DOLA 3LP1B 4OHZA 3D5MA 1LWFA 1SJQA 5EDWA 2MKIA 1Y9OA 2FLPA 2XLIA 5J2PA 1R8AA 4KFBA 1IBLF 3C6TA 3DOMA 1D8ZA 2MZTA 4NA1A 2XGPA 1MWYA 4CH1A 3OL8A 1N5YB 4WFXA 4AE5A 3OXGA 2R7QA 4NYOA 4DFMA 2HPUA 2EI5A 1RA6A 2RJZA 1S1WB 2AWZA 3S01A 3R5BA 2F7VA 3MEDA 4PWUA 3FFIA 4CNYA 4LQ9A 5IT4A 4QIGA 4MTPA 1JWWA 2GA7A 1LK5A 2K8GA 2XI3A 4XAKA 4WZQA 1VC5A 2FB0A 1HBMA 4C3KA 4QQBA 2PE8A 3BQ1A 4KT0C 1YJNS 3FVYA 3GSDA 3EUNA 3IRWP 3BQ2A 4CIOA 4H4OA 1TV6A 4C9DA 3UD3P 4WXWA 2GFFA 5KFSA 4U6PA 1Y0HA 2N3OA 1KD1T 4C11B 3DLHA 3OVAA 5H9EJ 1FJGF 3BO4A 3O6QA 7FDRA 2JFDA 2M5YA 2DCUB 3QIPB 2XB2D 3VAGA 3PW5A 4B9LA 4ETZA 4PXEA 4USIA 4B9MA 1L3TA 4DL0C 3M6XA 4ZCIA 2AX0A 1Q53A 2R7OA 2WB1D 5H9FJ 4J9KA 1KLNA 3E01A 4IG0B 5KT2A 1LW2A 2PFFB 4N56A 1NJYA 3AB2B 1WWHA 4JYAF 2CQDA 3FFIB 3FQLA 3OTEA 1JLAA 1K0TA 1RGVA 1N54B 3BQ0A 4PUOA 2CQ4A 4X4SA 1LK7A 3CD5A 1CQNA 2QA1A 3S8SA 4RW9A 2DITA 2VC1A 3OLAA 1VBYA 2VOOA 5DG7A 2J5AA 4NYPA 1VQSA 3CCWA 3VZIA 4QWAA 3CCVS 3T6BA 4ETXA 4C4WA 3PZPA 3QLHA 4DSEA 4Y2IA 1ELOA 5CYJA 2GGPB 3DGPA 3W2WB 4RU2A 4ED8A 2XSJB 4OZLA 4IOCQ 2ZBCA 2XGQA 4IFYB 2W24A 2V9KA 2HFZA 4IKAA 2XC9A 1U1RA 2DR5A 2BV3A 3KJVA 3DLLQ 2EFGA 4ECTA 1RT7B 2IM3A 1VFJA 5BYSA 2E9ZA 3NRBA 2OPQB 2G0CA 3GIKA 1R7IA 1JLQA 2DHSA 1S77D 4ZMMA 4NXNF 2NREA 2VL1A 4IDKB 4KO0B 1EETA 2KRRA 2CQ1A 4TU9A 4WZMA 5KFJA 2QZ8A 2LECA 3O44A 3R5AA 4N8OA 2FGCA 3FDSA 1RP5A 4RW8B 4Y00A 3GR1A 1F9FA 3TUZC 5BR8F 4O3SA 1WTBA 4MKYA 2CZ4A 2QEXS 4TY9A 4B9VA 2OTLS 2QMWA 2RNEA 4E98A 4C8OA 3ITHA 2VA2A 5IT9Y 2HS4A 4QPTA 3MECA 1AFJA 1SI9A 4QR0A 2ZOMA 1VRTB 5CZXA 4JV2A 3OFEA 4ZPDA 3CF5Q 1VRUA 5KFYA 4TY8A 3K57A 2DNMA 3V6DA 4FF1A 4KR0B 3GG0A 2IM0A 4NLOA 2HYIB 2VOPA 3UFCX 3BM7A 4X64F 4IUFA 1UVIA 2XZWA 1U2RA 4WU3A 1XR6A 3W7BA 1QE1A 2MDAA 5IM0A 4NRTA 5EGYA 1RT1A 3KMSA 1JLEB 4ZP6A 3HKWA 1Q8BA 2H5EA 3D54A 2VONA 3MM9A 1M5VC 2FVSA 4JV0A 1UVKA 4RW4B 2XS7A 3J7YU 1F0XA 2HHSA 3RAQA 2WK4A 3NL0A 4O3PA 5CA5A 2XY5A 4PQUB 2MJUA 2R7TA 1RT4A 5J1EA 4H54A 2HLUA 3KWMA 4PXBA 4K5SA 3D2WA 2XMTA 1BQMB 4ID5A 1VBZA 2HRUA 2LYVA 5I3UB 2JEIA 2ZD1A 3GQCA 5LMUF 1TKZB 1LFPA 1U1MA 5DM7Q 3JTNA 1G1XA 2CRLA 1FE4A 2VPWB 2V4QA 1YJWS 3MR6A 1D3WA 3DLKB 3I5BA 5DDRC 1EP4A 3NNHA 3JSRA 3HJFA 4G1QA 2BQRA 3QAUA 4UUXA 1DQ9A 5K8MA 1SUQA 2JLGA 5FIIA 1OPIA 4QOTA 2AQ4A 3LP2A 1R43A 4F50A 4IQXA 4XO0A 3F73A 2FUG9 2I5JB 2P9GA 2YKMA 3TYTA 1TK0A 4KTQA 2KFYA 1YI2S 5DQIA 2ZJPQ 1HYSB 4X4TA 5E5NA 1W2IA 3DLGA 3MPYA 3VALA 2EVZA 2YY3A 4X4RA 3N5BA 4WFAQ 1FNOA 4FF3A 4NCGA 1OQ6A 2GIQA 1S0OA 5LT5A 1JJ4A 5M2PA 2HAIA 5THWA 2HGNA 1YGYA 5A6WA 3JAMY 4X62F 2WTFA 1YJUA 1JLGB 4ZPTR 4QWCA 1HQEA 4RBVA 4MK7A 2B7BB 2DGUA 2CQ3A 4LSNB 1S4FA 2KKHA 2OPPB 3Q8SB 3I6PA 4U67Q 4IFVA 3NMRA 1QUVA 3KLIA 2HHHF 3CJKB 1QVGR 3MD3A 1U26A 1TKZA 3DOLB 2DR9A 2WCXA 3MMJA 4A8MP 2GV1A 3TOQA 4DEZA 4WU2A 1GT8A 1E6YB 3T5JA 5C42B 1KN6A 4Q0BA 4EUVA 1CC8A 4K4UA 5KFFA 1UFWA 1U8SA 4L3NA 2FLOA 1RKIA 3CEDA 1XWLA 2QA4S 1DTQA 3M2RB 3T6JA 1HARA 1YTYA 2M7SA 4HTJA 3LO3A 1C1CA 1WHYA 1IBKF 4NMLA 3RB3A 4NLVA 2ZHAA 2QO3A 2M52A 4NL5A 4HH1A 1UA0A 2GQCA 2CVEA 2WW8A 3I87A 1XEZA 3R3TA 2FJBB 2X1AA 2IA0A 4ZHRB 2UUTA 1HQEB 5A0YA 2EFVA 1FRMA 1N52B 4DR6F 2GW8A 4ZOSA 2RQMA 4DMZA 5HI7A 2DT9A 3CJKA 2CPYA 1TVRB 2DNHA 2R8KA 1FDBA 3DC2A 1VQKS 1NRKA 3V4IA 4QR2A 1FDAA 4YHHF 3H4BA 4QIFA 2RS2A 3FSYA 2NPIA 1XNQF 4HDHA 3OTBA 4K4ZA 3IGVA 3IG1B 2XMVA 3CCLS 4RW6B 5AXLA 4P6QA 2W7OA 1KQSR 3RAMA 4QBUA 3IBWA 1HNIB 4HYKA 5AE1A 1A7GE 1S99A 4QYRA 5KT7A 5K8PA 3EPGA 3GE9A 3PJXA 2PMHA 3DRRB 4BWMA 2I8EA 1X4AA 4PCQA 3CO9A 4YB6A 3NS6A 4NPOA 3H8YA 1V3RA 3DI6B 1T3OA 1FKOB 2XY6A 2HVZA 3MM6A 1JIHA 2HLTA 2ZKUA 3I31A 3V4MA 2C3OA 4AYBD 1VK8A 3MHYA 2ZOFA 4RW7A 1N6QA 2AYGA 4EZ6A 4B3TF 5HLFB 2VPZB 3CCSS 3T5KA 4X4OA 1KQFB 3K0JA 4RWWA 4MH8A 4C7QA 3OUYA 1I6JA 3E3XA 3V81A 2HS3A 2DD8S 1RJJA 3BS9A 2K3IA 2FY1A 1XMBA 4Z37A 1N5SA 4NA2A 3H20A 3QLHB 3MR5A 4PQAA 5IQQA 1HQUA 3ULHA 2Z0GA 2M3DA 2JC0A 1Q8IA 3H2VE 4RW4A 4C2MA 2PO4A 1ZAXA 2Z8QA 2MY8A 3G71S 2R7UA 1M0SA 4DSJA 4LF6F 2ILZA 2YNFB 2FVRA 2HHPA 3H5UA 2JZ5A 1R3NA 1DTTB 2U1AA 3BDPA 4I6AA 4PUOB 5A8WB 4KKOB 2I9SA 4J9MA 1SJ3P 1IQZA 2XEXA 1HR0F 4QZVB 2DVIA 4DN9A 4EO6A 4AL7A 2VBYA 3BGRB 4Y0FA 3OV7A 1DZ5A 4I6YA 3CIMA 4U7CA 3IAS9 4AQYF 2MKJA 4JI2F 5KFQA 3KLIB 5DDQC 5EUHA 3Q8RB 1SQEA 3QO9A 2AU0A 3LWMA 2PSZA 2Y1JA 1OWXA 2DO4A 2Y0SD 1UWBA 4ED3A 1W25A 1TL3B 1G7CB 2M2BA 3HZEA 3M2UA 5JVHQ 4UW2A 3LWLA 3M30B 5AXKA 3LANA 1M90T 4WF9Q 2W9BA 3HM9A 3AB4B 4AXJA 2E29A 2B6AB 2MSSA 2VH7A 3GWCA 2HHXA 1JLFB 3M8SA 1HWIA 4UQTA 1S1VA 1HBMB 2J9DA 3JSYA 4FS1A 1XBWA 3J7Z5 3I0SB 3NKYA 4NLTA 3HO1A 2AYMA 2Q79A 2RD5C 4E0DA 3MEKA 4B02A 4OZ0A 1VC6A 2E5HA 4IRKA 2OSQA 1T03B 1NH8A 1WEZA 3OR2A 3H5YA 2RVJA 3R5CA 1S48A 2L08A 2VPYB 4WKYA 1I94F 1YG0A 3POTB 1JXEA 4H4MA 1NKCA 3D28A 5JUMA 2NSBA 2XWXA 2CKWA 1RT3B 3D1OA 3DRPA 4F25A 3K8WA 2WSCC 2OPSB 4NWBA 2KFZA 3QJPA 1TUVA 4I64A 2G1DA 2KJVA 5E3QA 1NJXA 1IBMF 4O3QA 2VG6A 2AGOA 4PXCA 3PJWA 2FD2A 4DSFA 1KQKA 3PV8A 2XULA 4HH0A 1J5OB 1IKWB 4I67A 4EZ9A 1B0VA 2BE2A 1G6BA 2UVUA 1A9NB 3HDSA 1RYSA 3FQKA 5A8RB 1C0TA 2J9CA 1U24A 5B0GA 3M9MB 4OHXA 1S0NA 3IR6B 3QZ7A 1JLEA 4DQQA 3I96A 3QGGA 2UUWA 3SSSA 2IJNA 2J0SD 2V0NA 2WBMA 3WDOA 5HLFA 1HNVB 4MIAA 3BSCA 1B0TA 4G6VB 2AJ4A 4GKJF 1VIXA 2OD4A 2WRMA 4O3OA 2MHNA 2C3YA 3MM6B 1TP7A 2J7WA 2MQLA 5JXSA 1UEUA 3N5FA 1IKYA 1FVQA 2W8KA 1HPZA 4MFBA 4GO5X 4TYAA 3PVXA 4IYQA 3OHAA 4CNZA 3NMAA 3BR9A 1X4HA 2F40A 2VBWA 4Y34A 1DRZA 3LP0A 3GFZA 3GV7B 5KFZA 3FNNA 1MMNA 3SI8A 3CCQS 4MK9A 5KFXA 2XMKA 4BC7A 1B7FA 3VAFA 3IWXA 3HK2A 2CJKA 4DV6F 2E1CA 1EETB 2V94A 3CSKA 5A8KA 3WC0A 4X4QA 1S6QB 4PKDB 2V9WA 4ZPAA 1UKUA 3ZZZA 2JLFA 4MIWA 4AUKA 4DV2F 3QGHA 4LJMA 4OJHA 3F44A 2C3MA 1SKRA 2DPIA 1Y5NB 2B9YA 3O5TB 3TAPA 1T8EA 1ZZNA 1KNZA 5E33A 3CE8A 1FRLA 5L8RC 2DNPA 4IFYA 3NGDA 3D0IE 4YDXA 3U7JA 2KB2A 2P6SA 2M9KA 1G2EA 1RDRA 2AW0A 3TNVA 4RNMA 2PN6A 2R8JA 1X0FA 2O66A 3QJJA 3OTCA 4H4MB