1BLUA

Structure of the 2[4fe-4s] ferredoxin from chromatium vinosum
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
80
structure length
80
Chain Sequence
ALMITDECINCDVCEPECPNGAISQGDETYVIEPSLCTECVGHYETSQCVEVCPVDCIIKDPSHEETEDELRAKYERITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the 2[4Fe-4S] ferredoxin from Chromatium vinosum: evolutionary and mechanistic inferences for [3/4Fe-4S] ferredoxins.
pubmed rcsb
molecule tags Electron transport
molecule keywords FERREDOXIN
total genus 14
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 1996-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bluA00
1Y5NB 1H7WA 6FDRA 7FDRA 1F5BA 2VPXB 1SIZA 4ID8A 1F5CA 1BWEA 1DFDA 2FGOA 3LW5C 1H0HB 2V4JA 4XDDA 5BYRA 2WSCC 1A6LA 1Y5IB 3HKZD 2PMZD 4AYBD 2Z8QA 2O01C 1GTHA 3MMAA 5CHCB 2C3PA 3MM9B 1FDAA 1GTEA 3MMCB 3MM6A 6FD1A 2XSJA 3MM8A 2C42A 3OR2B 1SIWB 1BQXA 1H98A 1VJWA 2PA8D 1FRHA 1D3WA 1RGVA 2WAQD 1FDDA 1AXQA 3GYXB 3MM5A 3OR1A 1FRMA 1PC5A 4DHVA 2VKRA 2C3YA 2WSEC 3IR6B 1BLUA 1KQFB 1FD2A 4CI0B 2C3UA 2ZVSA 4OMFG 4Y28C 4RKUC 1K0TA 1SJ1A 5BYSA 4YDDB 2C3OA 1C4AA 1FTCA 1DAXA 3PNIA 1FDBA 2VPYB 4OV1A 2VPZB 2FJBB 1G3OA 1R27B 1FERA 1H7XA 2UZAA 1JNZB 3EXYA 1C4CA 3MM7A 3C8YA 3MMBA 1FXRA 1FRXA 1JB0C 1FRJA 2V4JB 1KQGB 5E7OB 1B0PA 1FF2A 1Y4ZB 1B0VA 1GT8A 1ROFA 5CH7B 3MMAB 2FJEB 2IVFB 1FRIA 1IR0A 5FD1A 3MM6B 4XK8C 1CLFA 2XSJB 1FEHA 2VPWB 1GAOA 1FCAA 1BD6A 1Y5LB 1FRKA 1B0TA 1HFEL 1IQZA 1DURA 3MM9A 2C3MA 3MMCA 3MM5B 3EUNA 1WTFA 2PDAA 1FRLA 3OR1B 2Y0SD 3MM8B 7FD1A 3OR2A 2V2KA 2GMJA 1JNRB 1FDNA 1KEKA 3IR5B 5BYQA 4L6V3 1F2GA 1PC4A 1Q16B 2WB1D 2FD2A 3IR7B 3EGWB 2GMHA 1G6BA 2WSFC 3MM7B 4XDCA 2FJAB 3MMBB 1BC6A 4KT0C 1FXDA 2FJDB 1XERA 2FDNA 5L8RC
chains in the Genus database with same CATH superfamily
1IKYA 2N7CA 4ZLPA 3MEEB 1E6YB 1WEXA 3ILOA 1GMWD 3I9ZA 5HAOA 1S9EA 3L7OA 4NI2B 1BWEA 1DFDA 2HHVA 4P74A 4DR6J 2JWNA 4IFYB 3FNNA 5KFMA 5LOQA 3OD2A 2V4JA 3PTWA 5MAOA 1T11A 1WHXA 3BH6B 4F4AA 4Z37A 1S1WB 5CQGA 3L09A 1GK8A 3BO4A 3PW7A 1UA0A 2JEGA 2YTCA 1V9OA 2V34A 4MKAA 3W2VA 3FZ2A 1ZYQA 1S97A 2D69A 1MG7A 1L3UA 2DY1A 1RB0A 5HN0A 1KDNA 1N5VA 3MMAA 3KHRA 1SL0A 4AE5A 2C3PA 3KWMA 1NK7A 2E5LJ 1IVZA 5K8OA 1FDAA 2VB6A 4KGMA 3JSMA 1RAJA 1U4BA 1YDLA 3QLHA 3BO3A 3MPWA 4RBVA 4DX8H 5KG6A 2V69A 3OVAA 1RU2A 5F8GA 1CC7A 2QO3A 1GQEA 3W66A 3PW5A 3QJJA 3NKYA 4RWWA 3SYZA 3C3LA 1FDDA 2QLJB 2DNGA 3ILIA 4IOCQ 2MEWA 3GR0A 3K58A 4JI1J 3D54A 4IYQA 1HBMB 2UUCF 4JYAF 2CJ9A 1NK6A 3VAKA 4DQIA 2BJ7A 4ENOA 1QSYA 2VKRA 4LRBA 1P27B 4LF9J 1YJTA 1ZM4A 2ZH3A 4ED3A 1S6PA 2OD6A 1FNOA 1KP6A 1HQUA 1RT3B 3PEJA 4A8YA 4RKUC 3W65A 1PO6A 4B3TF 4ELTA 2DHXA 3BSAA 3NRBA 3EYZA 4EBDA 2PSZA 1ZAVA 4QU7A 4JI2J 4NLGA 4RW7A 3HHLD 2CZVC 4TVAB 5IM0B 1DAXA 3MCSA 2OEMA 3MPUB 1VLYA 2IC3A 3GONA 1Q82T 2NR0A 2IVYA 3WQPA 4Q0BA 1B99A 2N4DA 2PEHA 3KHGA 2A0FB 3LALA 3L9ZA 4DV2F 1JXVA 2MZRA 3FC9A 4JP8A 4P71A 2YNHB 3PFEA 4MAKA 3GZ7A 4OZ0A 5KTQA 2KO1A 2DRBA 2XMMA 4FS2A 1RT6A 1TL7B 1QTNB 4EYIB 5E7OB 5SZTA 4N77A 5DDRC 3I0SB 1C1BA 4G65A 5IV4A 5I3UA 1VDHA 2ZH7A 4NLDA 3BSNA 2LKZA 1ROFA 2VZ9A 2V2ZA 2KM8B 4NXMF 1NSKL 2MHNA 4QQBA 4CO4A 4DJBA 3N6NA 2IFXA 2Z30B 3IS9B 1UJ4A 3Q8SB 2W9AA 3BBBA 4K5RA 1X0PA 4RNHA 3V2UC 1WKKA 3E01A 2KVQE 4MFBA 3VQSA 3W7BA 3HI9A 1U0SA 4DDFA 1OQ3A 1NJXA 1N4LA 2IDEA 2LXIA 1DURA 4L3KA 3MM9A 1V3SA 5A0YB 3JTOA 1Q53A 3H59A 4NLOA 5K8PA 1HHQA 3H8YA 3NBPB 3T9ZA 1BMQB 2KT2A 4WFZA 3VAJA 4M8LA 4IDKB 5C2GA 4WIIA 1LXNA 3DLKB 4KR0B 5IT4A 4J9VA 2WOMB 3CE8A 4JI3J 2GVDA 4C3MA 4IRKA 3I56S 2G4BA 1AZSA 1T95A 2EWHA 2LA6A 4R0EA 4DR4F 4R25A 4GVBA 1RYRA 2ATLA 2VFUA 1T05A 1WOOA 4DS5A 1UZHA 2E1AA 4EZ9A 3SFUA 1MSWD 3RBEA 4Q2MA 2V4QA 4CIOA 3T3FA 2KZMA 3MEGA 2HFVA 3JQMA 3TA2A 1X4FA 2J6TA 1PIEA 2BVZA 2CRLA 3C16A 4NX9A 3WX4A 3H25A 4A8QA 4KV8B 4HKQA 1RHQB 3I87A 3UD5A 1VHFA 3QSYB 2RDDA 5H9EJ 2R8GA 1TTHB 4EO8A 1FEEA 4IG0B 1NLKL 4U8YA 3GU0A 4KPYA 1BUXA 1BQNA 1TUGB 3CJ8A 4NLYA 1S6QA 2XQCA 1FFSB 1O0PA 5J1PA 1U1LA 2EFOA 1YX2A 4NZ6A 5L46A 3F73A 2E7VA 2OMOA 3M2RA 3BGRA 5K14B 1U1KA 2N7YA 2DNMA 4PXCA 2K3KA 2W7PA 3FBBA 3NCPA 3UPFA 4H4KC 3GB0A 2ZJRQ 2W24A 2Z58B 3L95X 1KWMA 1VK8A 4LREA 3R5JB 1U48A 2COLA 3HD1A 2Z57B 3MCMA 4LF5F 4HI1A 1GMWA 3M9NB 2FVPA 5D4OA 1S72S 1U7LA 4J9KA 1RE1B 4JV5F 5F3ZA 3UDLA 1OMSA 1DTQA 3AD7C 3VV2B 5G0RB 3DRPB 4PG6A 5T41A 2MSTA 1DQAA 2GO8A 4B3OA 3FDSA 4NA3A 4OI6A 4C8NA 5F8HA 2PA8D 1ITPA 1YK9A 4CQ1A 3P45B 2KTQA 3QIDA 1RA6A 2WAQD 5KG5A 3D1OA 4X4TA 1FKPB 1GX5A 1S7IA 4UQGA 3QPIA 3WZ0A 3PKMA 1RT2A 1JLQA 3CCES 4RPFA 3ZZUA 1UFWA 2V94A 5D3GB 4O3PA 5M2UA 1M5OC 1D09B 2XS7A 3TWZA 2OAUA 1GXTA 4QJVA 3I0RB 3MHYA 4NLWA 1RCXB 2CPHA 2ZE2B 3NS6A 3TEHB 2QTWA 1J5OA 3ZTOA 2DPIA 4J9OA 5DGAA 4NYZA 2VIHA 2V8HA 3W64A 1KC8T 4CLYA 1N5TA 4KGZB 1S1XB 4F2SA 3JSYA 1VIOA 2DD8S 2BX6A 3DHXA 5K8NA 1I94J 2Y1JA 3S1TA 1TKXA 4JV2A 1TL3A 2NZCA 1VLOA 4NZ7A 1R3NA 4C48A 2FHKA 3DOMB 1WC5A 4ILRA 1IN0A 4LF1A 2VUGA 4EWTA 1VBXA 4LJMA 1S9EB 4NI2A 3ZFVA 5BXIA 5C25A 4QBUA 1SQFA 4OJGA 1K0VA 3MZIA 2BMBA 2JNJA 2LDYA 2VC1A 4PZVA 1M1HA 4BHQA 3V81A 1NKCA 3NMAA 1K47A 2OPSA 3AJ1A 4HT7A 2W01A 3MD1A 1N6QB 3FFIA 3G82B 1RLCL 4ZVGA 3UD3P 1K9MT 1W25A 2MKKA 4V1Ak 3MMAB 2CXEA 3I5CA 1SC1B 4DCPB 2Z0GA 4ZVPB 2AX0A 2NLWA 3AD9C 3BYRA 5FD1A 5K9FA 1F1BB 5KT5A 2MLYA 4X4RA 2RB7A 2FUG9 3A3PB 4JI6F 3IAM9 1IM4A 3G6ES 2A2DA 3H2UB 2PFDA 4U6PA 4DV7J 1OWXA 2J0XA 3NCQA 1KTVA 3CJ0A 4BC7A 2C2ZB 2J0WA 5DM7Q 4LUBA 5DZ7A 3VTIA 4OHZA 3J7ZT 4X65F 2QA4S 2XZWA 3PW2A 3G4SS 3CWJA 2AZ1A 3MM8B 3KNGA 1NDPA 3SMZA 1TP7A 1FKAF 2RHSB 4JV0A 5KFYA 4UT4A 2P5VA 4DFMA 2E9ZA 1NHVA 2GW8A 4OJ3A 3W3SA 1JMTA 3UN2A 2XWXA 2V8VA 5F3TA 5KFXA 4DV7F 1N32F 1HHSA 2PN6A 5L1KA 4AD6A 1IBLF 3PRDA 4JBCA 2CQIA 4ECYA 2XI2A 1P9QC 3NMRA 1PAEX 2HLTA 1GX6A 1XBWA 2YNIB 3DMJB 3RBZA 5CYMA 4TU7A 2BQRA 5KG0A 2E7XA 4DR6F 2CG4A 3M4XA 1LWFB 2CJAA 4IG3B 5E3RA 4KSEB 4L3NA 3SIPB 2YX4A 1N5QA 1LWXA 2HS4A 3I0SA 2G13A 2NSCA 2OPPA 2CZ4A 2CVEA 3ADAC 4ID8A 1NSAA 4LR9A 4OYZA 4PYDA 2W8LA 3T1HJ 4IO9Q 3PW0A 4GKJF 3CJTA 1SCJB 3MPDA 3LW5C 3PYDA 4G1QA 1WKLA 3CIZA 3H5YA 3GILA 3NCRA 2GHVC 1IXKA 1FX4A 3EE3A 3UCGA 4DV2J 2AJFE 5J1NA 2ILZA 1ZA1B 2KU7A 1YJRA 3ZTPA 4FYYB 2BE2B 3TJ8A 4PG5A 5LSRA 1RTHA 1YJ7A 1GMUA 1ZZFA 2JZ5A 4N56A 1SKRA 4B9TA 2ASYA 3OLAA 3H5SA 4FKYA 2AJ2A 4ED1A 3MM6A 4OZ2A 1RTJA 3MI7X 2VKZG 1EJ7L 3NBPA 2JHEA 2XSJA 3CIMA 3FEZA 3UVJB 4Q43A 1AFJA 3AA8A 2AV5A 2CJYB 1RQ0A 3VVUA 3WX8A 5F9LA 3VQTA 3DLKA 2I9SA 3I9V9 4FYWB 4XPEA 2AJ4A 4BCAA 2GVDB 2XWYA 5KFSA 3BDEA 5E33A 2CNKB 5KG4A 3OSPA 1J5EJ 1AZSB 1X0FA 1IJEB 1L3VA 1ACMB 1NRKA 1TKTB 2X7IA 3D7SB 5J2QB 1HPZA 2Q1LA 1W2BR 4J9UE 1S49A 9RUBA 5HJYA 1HBUA 1JQGA 1UAWA 2W9BA 3CO0P 3PM9A 4V19J 3BSCA 2EBGA 2YWFA 3IRXB 4NEZA 3UN5A 4C98A 3KLEA 2K1RA 2YBVA 5H1SV 1Q0NA 3HULA 3ZO7A 1NZ8A 3LP1B 3NY0A 4Y65A 3G8TA 2BYCA 3CJ4A 4B17A 1MWZA 1BQNB 5HI7A 1DTTB 4NXMJ 2HGMA 4CLPA 4B9MA 1YVFA 4RUAA 3MOZA 1Q78A 2ZH5A 4W4MA 3VAMA 4DFPA 4FYDA 2C2MB 3X3UA 3MD3A 2DB1A 5ETOA 2WCXA 4MK8A 3TX0A 1CQNA 2FVQA 2EEYA 1SBRA 4PEOA 2MQ8A 1UEUA 1FF2A 1VRTA 2F40A 2J76E 4H4OB 5HROB 1GH8A 1RUSA 3RB3A 2DXDA 2OH2A 1VYAA 2W2PP 2JH3A 4K2XA 4BDPA 4M5MA 2IVFB 1BQMA 4LF8F 2M8HA 2HMIB 1QSLA 3SDEA 3V6JA 2XG8A 4MIWA 3N01A 5ETPA 2LYVA 3D2WA 2KL8A 5B0FA 4KFBB 1FJGF 2E1RA 4JI3F 1S12A 1RHMB 2IAJB 2BJ9A 2YX1A 2E29A 3MTJA 3ZTRA 4EBCA 1VQ6S 2HK2A 5T7LA 3BB5A 5F8LA 1SL1A 2D3ZA 2OGUA 3W60A 3K5MA 1KVJA 4ES1A 2YKAA 1UMJA 3CJ2A 2VQFF 3MUVP 3ITHB 2QC3A 5JMNA 2RKIA 2MGZB 2FGCA 1RJJA 3H90A 2KHDA 1WUUA 1JLFA 3RJMB 4XTTA 5KOWA 3BQ2A 1KEKA 2HHQA 1TL1B 2QL5B 8AT1B 3M8PA 1N56A 2NPFA 4I64A 2FHOB 2P2CB 2E1CA 4U7UD 4AQYF 1UEVA 2XNQA 1F2GA 3AQOA 1SXLA 3KKFA 3BKFA 3J7YU 2CDQA 1YJ9S 4LRDA 1KQSR 2OP5A 1QAIA 4DR3J 1SKWA 2DKOB 3KOAA 2DO0A 4F50A 3W9JA 1Q5YA 5B0GA 1U6BA 2QA4G 5LMUJ 1VQOS 2G2OA 5EGYA 1JLEA 2R7TA 1MROB 1T3OA 2BQUA 1IBKJ 3C14B 4IH5A 4XPCA 3OL8A 4G1IA 3W61A 3M8RA 4FPRA 6FDRA 2IVMA 1L3TA 1F5BA 2WTFA 4P9SA 3CO9A 2GGPA 5EUHA 3A8IA 2NXUA 3RB4A 3FFIB 4DMZA 4RNMA 4DV0J 3R1LA 1D9FA 3CC7S 4AL5A 4JV5J 2FGOA 1F3FA 3DOLB 3G86A 3JYTB 3FRYA 1WHWA 2YY3A 4X4PA 3UR3C 2DR9A 3PYGA 4XDDA 4K4ZA 3D4JA 3MURP 2XO6A 3BJYA 2QE5A 3BGUA 5F0UA 1VQNS 2DITA 4OX9J 2HS3A 2J7UA 1T9XA 1KQKA 2DH8A 2DNHA 4KC5A 2A1BA 3GIRA 4ATNA 1F9HA 1CJTB 4NPOA 4YB1P 1RAGB 2AGOA 2BEFA 4KHPJ 4X4NA 4C8MA 3MM8A 2YNFA 4DV6J 1DZ5A 4B3SF 1T0TV 3TUJC 3TZYA 5GAGI 2BR0A 3QGHA 4HVZA 1KSPA 4F0KA 4ZHRB 1UWBA 5D0EA 1QUVA 1Q8LA 1S5ZA 3GYXB 4ZPDA 5J2PB 3OLBA 3EX7B 4KKOB 1JLGB 2P6SA 2F9JA 2OKQA 1BWVA 3A3OB 4K50A 1P1LA 1KONA 2BA9A 2MY7A 3M8SA 1RTDA 2ACMA 4QIEA 2ZVIA 1VBZA 3O2IA 2UU9J 2YWGA 2ZZMA 2LQJA 4LSLB 1FO1A 4TY8B 2BKNA 4M95A 2V50A 5BYSA 2RU9A 4YDDB 4RNOA 3DHWC 3RRKA 4P2XA 3V4MA 1ZZNA 3N6LA 1M1GA 3KLGA 4DUZJ 4F0HA 1PYSB 4Y6IA 1AA1B 1NJYA 3MR2A 3GIJA 1RWNB 2MKCA 2ZH9A 2L41A 2BUNA 3P49B 1Y7PA 2LQ9A 5BR8F 4TQSA 4LFCF 2CPXA 1JNZB 3KJFB 1R0AB 3QRRA 4D3HA 2ZNYA 3HK2A 3TQ1A 4CH1A 2KM8C 2XC9A 1UVIA 2IBOA 2LMIA 1KQGB 2E5GA 4DUYJ 4C8LA 3L7UA 4CYUA 3MEDB 3K5NA 1S1UA 3I4PA 2KHCA 1DLOA 3LH2S 3QFWA 4DV5F 3EGNA 1NJZA 2OPQB 3EMTA 1R8AA 1R8HA 1EETA 1GT8A 3EWGA 3KK1A 4PUOA 2ALZA 3KUEA 5KFHA 5GMEA 3AB4B 3IGNA 1VMBA 1WC6A 2GQQA 2IM3A 2MPUA 2Y1LB 2IHR1 3Q8VA 4XK8C 4ZJOA 2QLXA 2BW2A 3K59A 1XN9A 1IUJA 1FCAA 2D74B 3KHHA 4OQJA 2ROPA 2AP6A 1XMQF 3DU5A 2UVWA 2UXBF 2HFSA 1DY3A 2R8KA 2BOAA 4F26A 1HNZF 1N0UA 2MY8A 1REGX 2C2DA 3UCUP 2PDAA 1Y9OA 1IBLJ 4B9LA 1TR0A 3DRSA 1FD8A 1G1XA 2NSBA 5J2QA 3OR2A 2Q43A 1HPZB 2FB0A 2QJ3A 1X9MA 3A8KA 2DRDA 2VBXA 2F5GA 2B4PA 4WPAA 2VG5A 5HP1A 3BPDA 2L08A 3BGFA 1RT7B 4HDGA 4DQRA 5J2NB 4F4WA 4DL7A 2I2YA 5IQQA 3K57A 4DR1J 3I31A 2IMWP 2B5JA 3ET6A 3LP0A 3ZZYA 4CO5A 3GIIA 2EFVA 1F5AA 4EI2A 4Q5VA 2XO7A 3FVYA 3EICA 3PJXA 2UXCF 2JLGA 4AUKA 1DTTA 2UUAF 2RJZA 2YNHA 4I4BA 1KHVA 2C2KB 4PG7A 5ETNA 2ROGA 3FBCA 3P4UB 1FK9A 4X4OA 4XDCA 3G96A 3LQVA 1SKUB 1X4AA 1MN7A 3QZ7A 2DHHA 2IMOA 1VQPS 1F9FA 3Q22A 2VPXB 3R6GB 3X1LB 4LIWA 2KXHA 1QUPA 4CRJA 2IY5B 2GCFA 3P6YC 1LWCB 2VDIA 4WCEQ 1ZM3A 2Y1RI 1UFLA 1R6YA 5GADI 2FIUA 2M9KA 2HQFA 2RMLA 1FJ7A 1IKVB 1T9TA 1EKSA 1XK8A 4PWWA 4P52A 1EP4A 3MAAB 8RUCA 3RBDA 2IRXA 1DQ9A 2IAJA 1Q5VA 3DRRA 1VBYA 4U7CA 2W7OA 4Y0FA 4DV6F 1YG0A 1RWUA 3DGVA 4HEA9 3MM9B 2E1PA 1RKJA 4LF7F 3NNCA 1BE4A 4KPCA 5GMDA 3RTVA 1R0BG 1FNMA 1VK3A 1YRUA 3ITHA 4Y2IA 3GV7B 1BQXA 2HHWA 4IDKA 3K2YA 3CD5A 3VGTA 1M5PC 1G2EA 2WOMA 3DOKA 5A2QU 3L7PA 1L3SA 2RQCA 1TL1A 2WW8A 4Z7CA 4NXNF 4A4JA 3MM5A 5KG3A 2CJXB 2PO4A 3JSBA 4PPDA 4I2PB 1HNIB 2BRKA 2DBBA 2VF3A 2VH7A 4N7TA 4OYOA 2A6MA 1HWUA 2K3IA 5B0CA 3TUZC 4AFFA 1QM9A 3N28A 4OX6A 3QQCD 2A2CA 2HIYA 1FA0A 2KT5A 3R9LA 4WFBQ 4F7VA 3CJ5A 4HACB 4RW6B 1C4AA 2DIVA 2GIQA 3NGRA 4HI2A 4LBIA 1MROA 3WBZA 4YQWA 1KOOA 1UVMA 1IQTA 5KAKA 4QR1A 3M6UA 2X3DA 3PRBA 2LFVA 4ZVRB 5T14A 4RUBA 1RHRB 4ALZA 1ZS6A 1H38A 1NMEB 1Q8KA 1WELA 2G2ZA 3CDAA 1RK8A 2H4YB 4OI2A 5KFCA 1FHTA 1KN6A 2EW9A 4LF8J 3T41A 1OIAA 2ZUAA 2HFZA 3EGVA 4Y2MA 4YEAA 1REVB 4AXJA 4CLFA 3KLFB 3BGRB 2R4FA 3D28A 1RWOB 5K14A 2HSEB 2P9CA 3W5ZA 4F2RA 4ILLA 1EB0A 4RW4B 2HNYA 4M5JA 4PKDB 2AQ4A 1DARA 4ID5B 3OXGA 5KFIA 2CPYA 3FRZA 2UVRA 4JYAJ 1WOSA 4IFYA 2VQFJ 2Q6BA 2B9EA 1MMLA 2GQ2A 2V0NA 4JI8F 4DN9A 3TJAA 4K0KF 3NAHA 3IBCB 4H4KA 2KYXA 1AYEA 4KY3A 4P73A 3ONQA 2RSQA 3EDQB 3H40A 2DVIA 1MNEA 3P5BP 3R5GA 4EYHB 3UDVA 4C3LA 2DNKA 2MQOA 5KT6A 4A8WA 2KT3A 4USIA 3HVTA 4JI2F 4O0NA 2FLOA 2HW3A 1C2PA 1F9EB 1FKPA 1Y00A 5J2PA 4C11B 1F3VA 4ETZA 1U2CA 1Z2ZA 1RT2B 5M2RA 1VIXA 5E41A 2Y0SD 2IJFA 3ZZ0A 3M2UB 3H2LA 1Q8IA 4Q2LA 3ENAA 4CDIA 5LMNF 2ZE2A 5LMUF 2FY1A 4NLQA 3IR5B 3JAMY 1TK8A 1Q1KA 5C5JA 4R8UA 3HPOA 2P8IA 3TA1A 1XIQA 4ZPTR 3HZGA 3SCJE 1Q16B 3VALA 2ZWPA 1N48A 3BREA 4FVMA 5L1LA 2CQ2A 3MCOA 1TK5A 3NP5A 1N5YA 3IR7B 4L76A 2OO4A 5AT1B 5KFZA 2IM2A 1O51A 2GMHA 3AHPA 5KG7A 3FKBA 2PT0A 2XMAA 3OW2R 3Q8QB 1T9UA 5CAAA 4HYKA 2JC0A 2ROEA 4CLSA 4DZDA 2QA2A 5CCLA 3HHEA 4JI0F 2OPSB 2VD3A 1WF2A 1HL6A 3UD4P 3QJLA 2ATCB 1UVJA 2B4UA 4I0WA 1VC5A 4Y00A 2WB4A 3HSGA 4PUOB 1T9WA 2N4CA 3RR7A 1OSCA 1T94A 2XLJA 3IFEA 1Q95G 1N52B 1WDDA 1H2VZ 3HCXA 1AT1B 3GTYX 2VJVA 2R7XA 3H7HB 2BM1A 1QVFR 1NJWA 1UP1A 5L39A 4N47A 2LA4A 4HT5A 2V8DA 1YQHA 4DS4A 1RAOA 3MR3A 1ZPVA 1EAYC 3OPKA 3GV5B 2BKOA 3O44A 4MKYA 1N5SA 4EMDA 3FBFA 2G9OA 4A46A 3TUIC 4FNHA 3C6UB 3LWMA 1X4BA 2DISA 1SQEA 1HMVA 2MDAA 1ZOTA 2QFIA 3LAKA 4I7FA 2ZUGA 1JJ2R 2R8JA 4MMOA 1V3RA 1VJWA 1WOPA 2V8GA 4C7QA 2B7BB 1D3WA 2PFFB 3E01B 1F6TA 5D6GA 4J9SA 2UVUA 4IFVB 4LSNB 1Z4UA 4CWBA 5ITHA 3RRGA 4DSKA 2DCUB 4OZJA 2FHMA 2FZGB 3KMQA 5DJBA 3AA9A 4N8NA 3AJDA 4USUA 1PSDA 3SEOA 4LF6F 3QSIA 1RWWB 2K2PA 4O3RA 4NCGA 5BR8J 5DS7A 2C3UA 2MZJA 1T3NA 4LFCJ 2BANB 2KRRA 2X51A 3P3DA 4RW8B 4FBUA 2BJDA 2ZZNA 2UUWA 2YWKA 3FBEA 4G6VB 5J1EA 1FTCA 2XEXA 4IG3A 2BBEA 3PG9A 3PNIA 2QL7B 5IXUA 2O67A 4F4KA 3PIOQ 1HI0P 1FE4A 1MWYA 1TVRB 4WFNQ 3MFIA 2ZJQQ 1LV5A 2IM1A 1VISA 3HVWA 4WE1A 4Y3CA 4M5KA 3KJVB 4LF5J 4ICLB 5A8WB 1LWEB 1FESA 3HDSA 3D6TB 3TAPA 2MKJA 1FRXA 3A8EA 3TA0A 3D3BJ 3DDKA 4R5PA 4V19X 3KK3A 1JJHA 1VQSA 4DQQA 1OY8A 3NNHA 1YTYA 1IKVA 1YJNS 1S0VA 2F8EX 3TARA 1EX8A 3DRRB 3R97A 5G4DA 3HHDA 2OUGA 5DRKA 5IS2A 5JUMA 4W92B 3I82A 2J5AA 3PZPA 4R0JA 5KT7A 2EC2A 4TU8A 1IKXA 4KO0A 2KXFA 3A3NB 1C1CB 2NUUG 1NDKA 3BEGB 1XQIA 1WF0A 1M5HA 4PYAA 5I4MA 1K44A 1VS3A 1WHYA 4X4SA 1N36F 1M5VC 2CQCA 3SXLA 2BJ8A 3BQ1A 3V4IA 2RAQA 4Q45A 5FIIA 3CCQS 3H5UA 4DR1F 2VICA 3R1HA 4RLEA 2BV3A 4JB8B 4K2JA 5HSPA 1APSA 4ELVA 2JL9A 1WWHA 1RZMA 4Z7YA 4YMEA 2UXCJ 2UUAJ 4X84A 1HW9A 3SCLE 1HBUB 5C7PA 1UFKA 4F25A 4TY9A 3MXHP 1CJKB 3GYGA 2X3GA 5DO2A 3TQEA 1B70B 5C24A 4DV3J 3PHTA 3ELHA 2HHTA 1QE1A 1R7IA 3DLGB 3SFGA 1U2FA 3CDUA 5ETQA 2QSWA 3OV7A 4CM2A 2HBZB 2KYZA 5AJ3J 4ED0A 2I0XA 2O66A 1S10A 3JTPA 2XLKA 2K7JA 2QLFB 4K4XA 2RUGA 5GAEU 2HNDB 4GC7A 4ZCIA 3Q24A 3Q8YA 1BC6A 2RQMA 4WTOB 1VQYA 3W2WB 1H7WA 1RA7A 3OBIA 3BN4A 4TNOA 2CQ4A 1WC4A 2DR5A 4LFBF 2HNYB 2PE8A 4H4OA 1SQGA 4EU0A 1NH7A 2V2QA 4ID5A 5IQ6A 3G71S 2IJNA 3NLCA 5HQLA 2J6UA 1FJCA 2P6TA 5DM6Q 4LF7J 3F41A 1BQMB 1IWGA 3ISND 2I1RA 3SDEB 1YBTA 5IFMA 3NXZA 4OLOA 4ZPVR 3MGJA 4F67A 3RZAA 4BWJA 1IJFB 3THVA 3G82A 3JXOA 4J37A 4OHXA 4WKYA 4NASA 1XR5A 3A8JA 4YUDA 2XGPA 1RAFB 4DF4A 3HVTB 4OYPA 3M1VA 4IH6A 2ASJA 1PCAA 2KJWA 2XMVA 2HLUA 3MMCB 2HQCA 4KGVB 3OFHA 2V63A 4Y34A 4DL6A 2RKIB 2QV6A 4FS1A 2B6AA 1VFJA 3QO9B 2G0JA 1VC0A 3O1LA 4ZVTB 2W9CA 3M8PB 4K5SA 2C2RA 3NWGA 2NCKL 4R8UB 3OR1A 1FNXH 5LL6d 1XMBA 2OIHA 3KDNA 2DEJA 2KVIA 2A3JA 1FTRA 2HYIB 2VONA 3T1HF 3VGUA 4GKJJ 3BDPA 4OYXA 2XMWA 1EKRA 2CQPA 1EQ0A 4G1PA 4OZ1A 4EO6A 1Y0HA 3EXCX 1SH2A 1LK7A 3EZUA 1NDLA 4IR1A 2JRSA 5GMKa 2JLEA 2XYHB 3MPVA 4N76A 3GCXP 3EDRB 3EZOA 4EFAC 4RWXA 3E8OA 1JXEA 2MTLA 2HPUA 1G7CB 1QVGR 2VPYB 1TFYA 1N0VC 1S77D 5KFJA 3CC2S 3K0JA 3TW0A 3CMQA 5ETSA 3NL0A 2M4MA 1NB7A 2F8MA 4H4MA 1X7VA 1H7XA 3EVWA 3MM7A 3IM8A 2ZBQA 3C8YA 4OJHA 3JYTA 4JI8J 3NS7B 5A6WA 4B3OB 1SUQB 3PJ9A 2J8SA 2HHXA 1IKYB 2H54B 3LAMA 4DPYA 9ATCB 2OPPB 3MEEA 3ENQA 4LRFA 2PEBA 4C3KA 3GE9A 4ZLJA 1J2VA 3NEKA 3A13A 2KG1A 2ALYB 3CB4A 3D68A 4G1QB 2NUHA 2UXDJ 5D4PA 5KOXA 2K8GA 1JXLA 1CS4B 1JK9B 1F0XA 3KLIB 1HMVB 4I7FB 4RNNA 1LW0B 4L75A 2D7SA 2QMWA 5LMNJ 2VPWB 2KFNA 2CWXA 2ADCA 3BQ0A 3A4TA 3U02A 3G8SA 2EBEA 2OEKA 4J7CA 2PIIA 5A8RA 3RBXA 5HVGA 3MOJB 4QU6A 5JXSA 1RWXB 5EN1A 1S9GA 3VF0B 3JSMB 3LUYA 4KKOA 5ETLA 4CLTA 1M0SA 3QLHB 2R2TA 5GAGU 2VOOA 3FQKA 2XY6A 2M7SA 1S0NA 2RF2B 5KFTA 1CG2A 1C0TB 1UWAA 3NNAA 1PJ6A 3TAMB 4TY8A 1XWLA 4BBYA 4OZ5A 2AU0A 1RP5A 2A18A 1H6KX 1TKTA 2YQ1A 4DL4A 2GQCA 2LLZA 3OHAA 5DETA 2FD2A 4DZ6A 2W4CA 1S6PB 2YKNA 3T6JA 4QCLA 2EC0A 1SUQA 1TVRA 1X31C 3LPYA 2D3UA 2XCPA 3ETOA 1GXLA 4EUVA 2W9BB 4WE1B 2ZJPQ 1URRA 2MSSA 5C2CA 5EHHA 2OTLS 5HBMA 1H2TZ 3MMJA 1G6BA 1O5JA 1R89A 1RHKB 4DU7A 2FJAB 3BKTA 3DLHA 1WHVA 2HWIA 3EVMA 4UY8T 2M5YA 2WRMA 5L8RC 1Y5NB 4CYUB 2BZ2A 1NSQA 4EEYA 4MT1A 4QWAA 2OPQA 4LRCA 1RT6B 3GFZA 1OQ6A 1TL7A 3BBCA 1H2UX 3BS9A 2YKMA 3ILLA 2ZH4A 5BYRA 4IR9A 4F0MA 3QRPA 3GLJA 1U47A 2E1MC 4YB7A 2G1HA 3IMQJ 1LFWA 2VBZA 4LQ9A 2PC6A 5D77A 1HIYA 2D9OA 2OD4A 2E5JA 3DYAA 4DF8A 3PYEA 4LR7A 3EPGA 1XTZA 5AE2A 1XNRJ 5D8HB 3TZWA 4LF6J 1GTEA 3HP6A 3OL7A 3IG1B 1OJ4A 1S59A 1J5EF 3QRQA 1B64A 3I5AA 4CO3A 1YZ6A 2AWZA 2OSRA 2QSFA 3AXMA 1R8PA 3S01A 4CH7A 4EZ6A 1M5KC 2BW7A 4WU2A 2EKYA 4ZVFA 2M70A 4URGA 2VG5B 3QGGA 2KH9A 2AHOB 1S99A 2Z2YB 3GJTB 2NQPA 2MKHA 1FRMA 4CT9A 3TAQA 2QX0A 4O3QA 2XM3A 3N9UC 1RACB 3H4DA 4CI0B 4DV4J 3LF0A 3TI0A 1QE1B 3DLGA 3FGVA 5B09A 2CAJA 2LDIA 5AE3A 3CF5Q 3G87A 4DV0F 5AE1A 2XSFA 4DG1A 3JB9k 1HR0F 1RAHB 4O0IA 2DXEA 1FFGB 2B3TB 5CYJA 3BSOA 1W7WA 2DRAA 3FCHA 5LSLA 5EDWA 3HJFA 4B3RJ 1ICEB 4HHHA 4UQTA 1S7HA 1DQ8A 4OX9F 2MZQA 1PYTA 1RTIB 2B56A 2ZD1A 1QAYA 1U02A 4KV8A 1QY7A 2PI5A 2Y8YA 2BACA 2IRYA 3EM1A 4U7UK 4XIUA 3MMBA 1FXRA 5LSOA 3KJNB 4AT1B 1U1NA 1Q8BA 1Q4RA 4M5IA 2JEIA 2JEJA 4IG0A 2HZAA 2HRTA 3C19A 1QLNA 1N36J 3Q2TC 1EP4B 1URNA 4D3GA 2V9KA 4X4VA 3NGKA 4C2MA 2HAIA 3FJ2A 1YBAA 2HEKA 3FK4A 2DT9A 2IJRA 2CG8A 3DOLA 1I6JA 4OFZA 3M2RB 4I68A 1CPZA 3OTOJ 3NS5A 4PXEA 4OI0A 1FRIA 2DR8A 1JJ4A 3BM7A 5HQ8A 2R7WA 2PI4A 2VBWA 1KFDA 3OVBA 2UU9F 1JLBA 3CJRA 2JJ4D 1HWKA 1KTQA 3DDNA 1YIJS 2DGXA 4DCJB 4ZJLA 3CD0A 1XR6A 2Z2LA 3PXGa 4DUZF 2XS5A 1HNIA 1KLMA 4MYTA 4B08A 1KKHA 1P8GA 1N33J 3RAQA 1RT5B 1RAEB 2RDJA 2GMJA 4NMLA 5CABA 1IBCB 5AJ3F 2NS1B 2OEJA 2QA1A 3DM2A 2ZH8A 3MUMP 4FXDA 2CQBA 2MJNA 4HL9A 1JLGA 3B78A 4IQXA 4OHYA 4PPZA 1CEZA 1TAQA 2ZFHA 3TEGA 2DPJA 1FWKA 1HNXF 2WB1D 3I0RA 3V6HA 4DFKA 1UVLA 1TQLA 3OTDA 5GADU 2MYFA 3CCWA 3HT0A 4LSLA 3KMSA 2HBQB 4DL3A 2XNRA 4ILMA 3T1AA 3BV8A 3GCWP 1NAQA 2F65A 4FF2A 1HBNA 5D78A 4DEZA 3MM7B 5D0RA 4OL8A 1E6VA 1UETA 1RTZA 2VU5A 3I32A 3U7JA 5A6PA 5DQIA 2EFPA 3R7SB 2IA6A 4U95A 2HQIA 1FVSA 4MH8A 2R7QA 3B54A 1XMQJ 4O3SA 1NM2A 3U1LA 3OUYA 4J9RA 2UXBJ 3D9BA 1HNZJ 2HKEA 1A7GE 4OYIA 5C25B 1A9NB 3KG1A 1H0HB 2HVZA 4C0BA 4LF4J 1Y10A 2IYIA 3N6MA 3V81B 2WSCC 2YX7A 2BABA 3GPAA 3KLIA 4HTIA 1G4CA 1DLOB 3HM9A 2OELA 3QFHA 4LSZB 3CW2C 3KK1B 4BS2A 3FCVA 1EETB 3GJSB 5LJ5Y 1XR7A 2GIFA 3I5BA 4X4QA 5HVFA 2C1EB 4GVLA 5B0DA 3DU6A 4NLPA 2E5IA 3VR1A 2P9EA 4ZN3A 4TXSA 5EWFA 1JKHB 4PQUB 3NAIA 4DL2A 1CBKA 1RWPB 3VGSA 2BXJA 4QWDA 3Q0AA 3CULA 1V3ZA 3I55S 1WC1A 2FY8A 1U8WA 3CDBA 3S7RA 4LMZA 1U0HB 2BJ1A 1HYSA 2YWWA 4FF3A 4O23A 2KN4A 3TVKA 3QJPA 3V6KA 2H4WB 2DNLA 1HBOA 2LXFA 2RILA 3K8VA 1B4SA 2DNQA 7AT1B 3OJSA 1QD1A 3BN7A 1NU4A 2ZVSA 3CEDA 1H72C 3UCZP 4ERDA 3W5XA 3K8WA 1SJ1A 3CJSA 1YBUA 4FXVA 4CT8A 1RT7A 3M8ZA 5LXRA 3KUHA 3PYFA 5DG8A 4ZMMA 2QL9B 4IOAQ 2NXJA 4X64F 5HLFB 3MECA 4B02A 3HZEA 2YNIA 3DMJA 3IRWP 4DR2F 4DBQA 2RIJA 1R0CB 1S6UA 3UWTA 4ZLLA 4QPXA 4ECVA 3PVXA 3ENVA 1B3TA 4KJIA 1LW2A 1XJWB 2EKNA 4K4YA 2UXDF 1RYSA 5B0BA 4XAKA 2QMUB 2MHEA 2XI3A 3TYTA 8ATCB 1RDRA 2YKMB 1SL2A 5J2MA 1FRJA 4K4TA 2BQ3A 3H20A 5GAHI 3EPIA 5KFBA 4QYZK 1ZA2B 4M63A 4S0MA 4WXWA 2GAGC 1B0PA 2X1FA 1FKOA 5FLXU 1HD1A 2DO4A 2HURA 3TJ9A 4QYZJ 2R8IA 1YJUA 2AKWB 3D6HB 2DNNA 3CCJS 4DSEA 4JOUA 2ZDOA 3TVYA 3D0IE 5HO4A 1A0OB 4C9DA 1YGYA 1PILA 3MAAA 3RW7A 3RR8A 2EG2A 3UFCX 2GFFA 2HG4A 2HWHA 4QYRA 5AXKA 1FRKA 4ED4A 1B0TA 1X5TA 4YY3F 3BPSP 3OTOF 2DGWA 3M6XA 2Z4PA 3PJWA 2F8HA 2RT3A 1JLAA 2GJ2A 4FYVB 4I2QA 4OYWA 2DNPA 2APOA 1B7YB 3M30A 2UV8G 3Q8RB 3VHQA 3HX9A 5K8MA 2BANA 2HBYB 2HQ3A 2DJWA 2H51B 4ZLNA 4ECRA 1XMOF 4DWIA 2ZOGA 4WIQA 4OHVA 2QLWA 2CPZA 1D9AA 2J7KA 3W9HA 3QATA 1JWWA 4URSA 1ZTWA 5HJXA 1FX2A 3C15B 3R7BB 1GFWB 1FT8A 3R3TA 4HACA 4C6AA 1NHUA 4P10A 3KJVA 1LOUA 4J9PA 2D3OR 2GC8A 3V6DA 1H3DA 3J81j 5I42A 2BRLA 1RBOB 2JOQA 1VQ8S 2LU1A 2ZH2A 3T5KA 3E2EA 1FXDA 4K0KJ 3OQ2A 3LP1A 4IOBA 4ZITA 3KK3B 3THPA 1V5VA 1NEEA 3D0GE 4OYMA 1ZBTA 4QIVA 3KXDA 1X60A 3POTB 3QIPA 3CVKA 3UR0A 2GJIA 2XBPA 3GG1A 4F4YA 1OY6A 3R5CA 3BO2A 1XNRF 3PW4A 1U6FA 3HF5A 5EX3A 2GO9A 1S1TA 3G8QA 2U2FA 3CTRA 2W8KA 4UY85 4F3OA 2EFQA 1VRTB 2CPJA 5HROA 5GVQA 1JIHA 2FC8A 2HHHJ 1WSVA 3UI3A 2JVOA 1UA1A 4I6AA 1UKUA 2F3JA 3MCNA 4IKAA 3OTEA 1KRPA 2XGQA 1FFWB 2D1CA 4JV1A 1WI8A 4UOGA 4RBUA 2ZBCA 3L4BC 5DGBA 3AB2B 2ZHOA 1PYOB 4KFBA 2R9LA 2LEBA 1I1GA 2IDLA 4WFXA 3PFOA 1RT5A 1K8AT 3M32B 4USVA 4H54A 3C6TA 4C8YA 3CJQA 3OXLA 1VGYA 1QSSA 3VZIA 1RT4A 2Z56B 3M8QA 2I5JB 4ZN1A 4M5DA 4ZOSA 4W98A 4ED6A 1IBMF 4B3RF 1PC5A 4O3OA 2MKIA 4JI0J 2W1BA 2MGZA 4OZLA 1SJQA 2R2SA 5LJ3Y 4DL0C 1JLFB 1TK0A 3C46A 1HWLA 2E7WA 1K0TA 5LM7E 2YQ3A 1DJ0A 3B4MA 3ILJA 3N79A 3M6WA 3R6LB 1HARA 2LEPA 3SQOP 3UNYA 4ANCA 4GMKA 4WTYA 5H9EK 1WACA 2RRAA 1MLAA 2H9ZA 5E3PA 3UDCA 5KFWA 3W8GA 2ZC3A 3W2WA 1RSCA 5CYQA 1G3OA 1N5YB 2AX1A 4WKRA 3BBFA 1S6OA 3N5FA 2HWTA 2Z2MA 3U27A 1PJ7A 1T02A 2MXYA 3GR1A 4DXLA 1U1MA 1D8YA 5DZ6A 3OFGA 2XMKA 1WJ9A 2M3DA 2VHGA 3HHNB 6AT1B 2RDIA 1RWKB 2FTRA 3CJKB 2GGPB 2DHGA 2NXEA 3W2VB 3J80U 1KD1T 2MJUA 1B7FA 4QIFA 4J90A 4NLRA 2AJQA 1OYDA 2AJ1A 2QN6B 1N33F 1CQMA 1U26A 2O1PA 5K5MA 2R8HA 4DV1F 1T8EA 4CCHA 3HSJA 4I6YA 1JKHA 4PQUA 4C0OC 3IM9A 3C2PA 1WEZA 2F4VJ 3CCZA 4P2MA 3NWRA 2MZTA 1IQZA 1K73T 2QZ8A 3AOCA 3IA0A 3DC2A 1S48A 1AUSL 2OMLA 1TUWA 1CJTA 1PG5B 3HHLC 2BE7D 4ECTA 3PEHA 1VOMA 1P6TA 2GVZA 2GX8A 4ER8A 7FD1A 3QGPA 4K59A 3R8YA 4QWCA 2RS2A 2XMJA 3E3XA 1EHWA 3QT6A 2DHAA 3D6FB 3CMAS 4RW9A 5E3AA 4YOEA 1SJFA 1FXLA 4C97A 4CZCA 2J9DA 2G2YA 1UCNA 4RUHA 5BYQA 5IZHA 5L9NA 2IRUA 1LK5A 1EZZB 4WP8A 4F4XA 5HLFA 2CPEA 4HDHA 4NCGB 4O4GB 4C4WA 2PMHA 3R5AA 1U1OA 2YWEA 1QTMA 1UL3A 2GS8A 4RO0A 1N54B 3D1HA 3CDWA 3SV3A 2WSFC 2HRUA 3KLGB 4LQ3A 4CNYA 3QWPA 2CPFA 1MU2A 2HGNA 3OL6A 1XERA 3RRHA 2NXNA 1NKEA 1NK0A 1WORA 2YXLA 1F5CA 1JLCA 4LBHA 2K7KA 2DNRA 1PBUA 1T9VA 4DQSA 1LWEA 3ISNC 1SC4B 4R5PB 4NLVA 2NYIA 3RU0A 2H3EB 1CS4A 2DH9A 1S1UB 2EFGA 3MAHA 2CQHA 2ILYA 3HSZA 4Y2KA 2NPIA 2BJEA 5LT5A 3VAFA 2V8PA 3QGIA 4P7TA 2NXCA 4K8RA 1U45A 1SC6A 5HMYA 2MZSA 2ZWOA 3ISZA 2VC0A 2FJVA 3M9OB 4DFJA 1IKXB 4KO0B 1C1CA 1WEYA 2ZBRA 4NRUA 4DV3F 1QAXA 1C0TA 2HFUA 2OSQA 3J80Y 4TKTA 3HO1A 1MWQA 1ZM9A 3V4IB 3BKUA 4MYUA 1T03A 4W90B 2HRYA 4ED7A 4RR5A 4X64J 4DR7J 1M90T 2HQGA 1UVKA 4ZCLA 3CCRS 2FZKB 4DR5J 2QG9B 3SSSA 4E8UA 4LFBJ 1EQMA 1R6VA 2C3YA 3DFEA 1KQFB 2XLIA 2GNKA 1FD2A 2DNOA 3FZBA 3PR5B 4IRCA 1CVJA 2VG6B 4KAIA 2V4RA 3WC0A 5IOLA 2P9GA 2FC9A 2PMWA 3C16B 4PG4A 5HP1B 2B43A 3R27A 4FKXA 5HL7Q 5F8MA 5I42B 3GJRB 2UV8A 1CJKA 3M9MB 2CYYA 1OO0B 2JEFA 2B5JB 3ET6B 3LP0B 3N5BA 4UUWA 5B08A 3OTCA 2OFHX 5C24B 4X62F 1D1UA 4WXOA 2J0QD 1MMDA 2LXUA 1R27B 4NLXA 2G0IA 2CIMA 3CCTA 1S6QB 1X4CA 4YR3A 3SV4A 3MPYA 2UZAA 1VBKA 1FK9B 4UOCA 2ZHBA 2JFDA 4WZQA 1UZDA 5KFEA 4BC9A 1S1TB 2XYPB 3DI6B 4YHHF 2UVVA 4UTGA 1C0UB 5H9FJ 4WK3A 2NZ4A 3T1YJ 4PRFA 3QNWB 2CZ9A 4P7VA 3FSIA 4CTAA 4RUCA 1RAAB 4DU8A 2A6OA 4WP9A 1RADB 4DSJA 5EWGA 4PR6A 1IR0A 4DSFA 2IIHA 2UUBF 1YLXA 4I1TA 4LIRA 3UNGC 4DI6A 2DYAA 2AGQA 2CQ0A 2ZBPA 3CCVS 4GC6A 3BGLA 2CADA 3UW1A 2PD1A 2LQ5A 2RH3A 2WBMA 3M32A 4J9MA 1Y5LB 5KFPA 1VQKS 1WNEA 4A8KA 1HWJA 1YITS 2EG1A 3BR9A 2FHJD 4WYWA 5CXTA 5KFAA 1CSJA 3EUNA 3R2CJ 1WTFA 4M5DB 2M52A 1HNWJ 1JLQB 1YRXA 2DIUA 3DLLQ 2ZH6A 3MTKA 4QR2A 2V2KA 4B3MJ 4K4SA 3N0VA 3H5XA 3T6BA 2VFTA 1ZETA 3P8BB 1TL5A 3ZTSA 1GXUA 1TKZA 3KG4A 4OZ3A 3GJQB 4LFAJ 2H1YA 2ZH1A 2HQDA 2N3OA 4B9SA 3PCOB 5DLGA 3HHKA 1KR4A 2VFRA 3DLEA 1T7PA 3ZNUA 1JX4A 3HFVA 4Q8FA 2LEAA 2YQ0A 2OFGX 3JQJA 3W8PA 3AT1B 3WIVA 4M5NA 2RNEA 5HMZA 2R7VA 1CULA 3Q89A 3RAXA 3M6VA 2J9EA 1RTIA 4PWUA 2F1FA 2W2OP 4U67Q 2MZ1A 4QPTA 1VQ9S 4NL5A 4JI7J 2Q3PA 4RW6A 4E2FB 3LOUA 3WC2A 2UUTA 2R7OA 1D9DA 3MMBB 5HMWA 4ZVHA 3RYLA 2GAHC 5F9NA 4NA1A 2FDNA 2WVBA 4QW9A 4UOHA 3SZ2A 2HHHF 5KFVA 2HVHA 5E3CA 2ZKTA 4WWSA 3TANA 1MMNA 4PWDB 3LPEA 2Q6CA 4ZPAA 4Q44A 3LTOA 4ZIVA 2LQ8A 2B4OA 5F41A 1TFWA 2ERRA 3LGHA 1F60B 4IH7A 5HQMA 4Q8EA 2BE9B 4NLSA 4RW4A 2NYHA 2RQKA 1NKBA 2B8QA 3ZTQA 2B51A 2CNNB 5AXLA 4CNZA 5M2PA 1RXOB 4FXWA 2Y0BB 4O4RA 2C2OB 1GNKA 1R31A 2A10A 2H65B 3WIUA 1QJHA 1IBMJ 3GYNA 3K7RA 3IC1A 3LA0A 4E98A 2ADBA 2AYEA 2B4VA 1UPMB 1S57A 1KLMB 1LW0A 3IWLA 4ZJQA 2DR6A 1H98A 4U96A 1LXJA 1Q79A 1FRHA 5D0HA 3TX8A 2VA3A 1RU1A 4OIXA 3KLVA 2KFYA 4KHPF 4GKKF 3V5RA 3DM2B 5IC4B 4DPUA 4WFAQ 1OPZA 4DL5A 4USMA 1TV6B 1Q81T 1KLNA 2QEXS 3HXMA 4JI5J 2C2EA 2WVDA 4NMXA 5EX0A 1CJVB 2V68A 4CLZA 4EK2A 2RF2A 1SV5A 3A1YG 1DRZA 1X9WA 4CM0A 1SJRA 4UOFA 5CYMB 1DHMA 3DKDA 2EI5A 4BLGA 2C3OA 3JAMU 1X5OA 3K17A 4YP3A 4A8FA 3ZZZA 2GZOA 1ZH5A 4ZVQB 4ZVEA 2IBKA 1NK4A 1MU2B 3LANA 3TZZA 1Q86T 4OI3A 2RUSA 2YKNB 4NLTA 3GIMA 2AYGA 4Z2XA 4F4ZA 1IR2A 2JFKA 2Y8WA 4IRDA 3GP9A 1E6YA 3SBMA 5E5NA 1TELA 2HBRB 3SSQA 5KFNA 2K06A 3GSIA 4DV1J 3GFYA 2V4JB 4F3MA 4PXBA 2VL1A 4NLUA 3FMWA 4WYLA 5THWA 1ZAXA 4ZCKA 4K4WA 1FI4A 2LCWA 1RAIB 1PJ5A 3BZQA 2LP4A 4LVOP 3DRYA 2VDHA 3VAHA 3GMGA 4CO1A 4C8ZA 2ASDA 1LFPA 2ZHAA 1NXIA 2DTJA 3K5OA 3Q86A 4DN0A 4A8MP 2FLLA 2XZTB 1U25A 2UP1A 1NCLA 3MM6B 1RTJB 4USTA 2MB0B 2XSJB 4I56A 4UZCA 1RLDA 3H0PA 3UVJA 4DV4F 1GAOA 1S4FA 3DYAB 4JUZA 2WONA 3D6MB 3JSRA 2IA0A 1S79A 3VVTA 1HR0J 2GJFA 2Q79A 3NGTA 2DR7A 5HMXA 1LNQA 3C6UA 4NE9C 1FRLA 2AT1B 4UZBA 1MW7A 4RX6A 2H5IB 1Q7LB 1RHUB 3G6VA 1ZAWA 3THTA 2DGTA 3SQGA 1RT3A 2HHSA 4P6QA 3QBCA 5B7WA 3IWXA 2OJ3A 1YRTA 2AEMA 3IRXA 4L6V3 5D15A 4O3NA 4URQU 2EK6A 4HTJA 3KLEB 5HVHA 2K1RB 1XNQF 2VG7A 3VCDA 3ZC4A 2IC3B 2HK3A 5L1JA 4Q0BB 3MECB 2E9RX 3BGOP 2GIRA 5AXNA 3CDEA 4RW8A 3HD2A 3D1QA 1UTAA 5D4NA 1LW2B 2MQQA 5J1EB 4ECUA 4JI1F 4DSLA 4WF9Q 2M88A 2UUCJ 4KT0C 3KK2B 4KTQA 4ELUA 3CNQP 1L5UA 4P72A 5ETRA 1WD6A 3OL9A 1C0UA 2WZ1A 2OTJS 2ZD1B 1SPBP 1SIZA 1NHKL 4LF9F 4O44A 1NK5A 4G3IA 1RBAA 2CJBA 4B3TJ 4CTAB 3FUYA 2OPRB 2FHJA 1OSDA 2AIRB 4ICLA 4ZKAA 4A47A 2I38A 5A8WA 3HT3A 1HQ2A 3J7AN 1X5PA 3DN9A 1RT1B 1XEZA 4OJ1A 5RUBA 3PIPQ 3CCSS 3CUNA 3HKZD 2W7AA 4YN3B 1NDCA 4J9QA 4HH0A 1NSPA 2HZCA 2DNZA 2IM0A 1AB8A 1IKWA 1HNVB 2EK1A 1UEKA 2J7WA 4MFBB 5CHCB 3ULHA 4ES2A 2Y1IA 2W25A 3G9CA 4DR7F 1M5SA 2O5DA 2V67A 4CP5A 4J91A 1L3KA 5CD4H 6FD1A 4DR5F 1HNXJ 2ZZTA 2YPYA 5F8IA 4NCBA 1TAUA 2XTJP 2XZDB 3EZ5A 2XS2A 2CNOB 1OY9A 2LU2A 5L9XA 2ZM6F 3HVRA 3CSKA 2KJVA 3KJQB 2QFJA 4OLPA 2MKSA 1QDUB 4ECQA 3OSNA 2FJXA 5IT0A 1AXQA 2MQLA 1I5OB 2VA2A 2KZZA 2FJWA 4DSIA 4X62J 2AW0A 4JI4J 4DX7A 4RZRA 3KDOA 2YKPA 4TU9A 1X8DA 1KHWA 4OI1A 1CULB 3QT7A 4CO2A 2YKOA 1SC3B 2HFOA 3DGPA 3MEGB 2DH7A 2JVRA 4PAAA 4DLGA 5DLFA 2AD9A 1VHIA 1RBLA 3U1MA 2R7SA 3BH7B 1WC0A 1HHTP 4LF4F 3OXFA 4YHHJ 4NA2A 1U09A 2M2BA 4NZ0A 5LXYA 4KQZA 4DPTA 4ZCMA 2DGVA 1TKDA 2VPZB 4J9LA 5KFGA 1O6XA 3GFXA 5DG9A 3NOGA 3MDFA 4YR2A 4TYBA 4NOHA 4YDXA 3POTA 1YJWS 3EXYA 1C4CA 4PWDA 2HNDA 1HQEA 2MQMA 4Y2AA 2BKPA 3WDOA 1JB0C 3H42A 3LGMA 1TU0B 1FE0A 1WKJA 4CO0A 4DR4J 2ZEJA 1SVDA 1S1VB 3Q8PB 5IT9Y 4RNFA 1VQ5S 2AZ3A 1U49A 3JS9A 3D66A 3IXQA 4U8VA 2IYGA 3CCMS 2D9PA 2RRNA 2XB2D 3FEYB 3CT9A 3H98A 1SKSA 2CWKA 4FBTA 2F9DA 3R7NB 1SH3A 2E44A 4OX7A 5ADZA 5GAEI 4FF4A 4K4UA 3T5JA 2AGPA 5G0RA 3DRPA 3J7A1 1O8BA 2YNFB 5I3PA 2N82B 3ZZRA 4WZMA 3P5TL 3C6TB 3SCIE 4LFAF 4A8SA 4KB7A 3PRVA 4TN2A 2XY7A 3M1VB 1UWBB 1RT4B 2HVEA 2M0GB 2I5JA 3N4WA 3MMCA 2FQQB 4UUXA 3US5A 3DRXA 1S0MA 1RCOB 1ULRA 3Q83A 4A48A 3O8WA 2J0SD 3OFEA 4L72B 4DR2J 1SV5B 2QLBB 3F44A 1FDNA 4LBPA 4M5GA 4WU3A 2CFXA 2AYBA 4K7QA 1CC8A 1J5OB 4JI7F 1U0HA 1FWPA 1HKAA 2FPHX 2QGFB 4FN5A 4HLBA 2FLNA 2GV1A 2HZVA 1TUVA 1OPIA 1HBOB 3M2VB 1VI7A 2B9XA 1P1TA 2ZITA 4MIAA 2CJQA 2OI2A 3CCUS 4I67A 5JJBA 4M1KA 1TL3B 1HQUB 2AEFA 4ZVUB 2OHDA 3DOMA 1NK8A 2CVIA 1K1SA 4ZIWA 1X4DA 3I6PA 1J27A 5IM0A 2AEJA 4ECWA 1NH8A 1MN9A 2HIQA 3Q23A 4KE5A 3W5YA 5CZVA 3EJMA 4X66F 3RB0A 7FDRA 2X1AA 2XHWA 1UW9A 1OS5A 3CJKA 3PR4A 4A8XA 2C28A 4H4MB 4QW8A 4YY3J 3I4HX 1N8RT 4KBIA 5IV3A 1N6QA 3CPWR 3WHIA 5KFUA 3J81U 3OJUA 3GV8B 2W2MP 2YPZA 3HLUA 5J2MB 3D5MA 2XULA 2W2NP 2E66A 1C1BB 1Y5IB 3ICLA 1HI8A 2PMZD 5CD4A 1VRUB 1VCTA 1Y11A 4LRAA 1NNDA 4MKBA 4F3QA 5I3UB 1CJUB 1GTHA 5IWAF 1R43A 1XMOJ 3SCKE 4DLEA 3PHEA 2EFNA 4PQAA 1SJ3P 1VC6A 3DLJA 4YR0A 1NK9A 2SXLA 2R2RA 2BJ3A 4JI5F 1RWVB 2F63A 4KGKA 4ED2A 1EIYB 5KFFA 1VJQA 2GVZB 3IS9A 2W2QP 3AY0A 3OR2B 4MJKA 1WTBA 3GSDA 2GHWA 3GWCA 2U1AA 4ZP8A 5A8RB 1RGVA 2CUYA 4HHJA 5CA5A 1NPKA 4ZK7M 1RWMB 1S9GB 2ABYA 2N3LA 2F4FA 3AH6A 5SUHA 2HS0A 4C8OA 1AROP 4AXIA 3AJ2A 3SI8A 2QYGA 3M30B 2WSEC 5B0AA 1BLUA 3R5BA 1U6ZA 2V2VA 4OI4A 3MUTP 3VAIA 4Y28C 4XO0A 3TAMA 3H2VE 2RRBA 5ETMA 1VQ7S 3QYYA 4ZPBA 2DK2A 4CLLA 1WDTA 4KH0B 2LVWA 3BYPA 4CLUA 3VAGA 1LWFA 2GHPA 4YB6A 2V9WA 3GIKA 3CC4S 3NGSA 4TLQA 5A8KB 4NYPA 1D8ZA 4KHMA 3KK2A 3PO4A 3K5LA 1FDBA 1HNWF 4I69A 2H48B 1U2RA 2HGLA 1IM6A 2JX2A 2H5JB 2X1BA 3ZZTA 2MLXA 1AUDA 1JLCB 2BDPA 3EGZA 1D0EA 4IUFA 4CLKA 1LWCA 5HBMB 3V6DB 5HATA 4QWBA 4Y2CA 5D4LA 4ITSA 3UQSA 4M5HA 1ZTTA 4PG8A 1RT1A 2CJKA 1VQLS 1HW8A 1RABB 3MWBA 1UPPA 3DLBA 3O3LA 5F8JA 3HKWA 1YZ7A 3IBWA 2RQ4A 3LWLA 1Y4ZB 2BE2A 2L9WA 4N8OA 2ASLA 1KNZA 1RTHB 5CH7B 1IKWB 1HNVA 1X4EA 1KBRA 2B9YA 2LQBA 2QYCA 2GMLA 2YKQA 3M7VA 4ZPWR 2I6WA 5C42A 1S0OA 3D67A 3HHLB 3HMJG 1PKUA 2QIFA 1P9YA 2VASA 2M8DB 2HNZB 4MKVA 4DPWA 4B9UA 2VFVA 2YWHA 3CMES 1NUEA 3U1NA 3IWNC 4GO5X 3DOKB 3RGIA 2WVCA 3A12A 2XY5A 1T03B 1XNQJ 1I51B 3J81Y 3OT9A 3IG1A 4I2PA 4ZDNA 5KFDA 1NJIT 2PGCA 3LGNA 3KHLA 1Z1ZA 2WK4A 2WVEA 1BY9A 2VJUA 1N88A 3J7Z5 2Z2ZA 2B9WA 2FYXA 2OLWA 3AAWB 5D0GA 2RS8A 2VG6A 3DGPB 3E51A 3L3CA 3M8QB 1ZM2A 3SSRA 1X4GA 1GMVA 3C66A 2E9TA 5D3GA 5FDLA 2D41A 2VQEJ 2DCLA 5DQGA 3R5DA 5ETVA 1U24A 2IPOB 1UJ5A 1WG1A 1KVKA 1RKIA 2XHCA 3B4DA 2WW4A 4HR2A 3NGUA 3DXSX 3ZZPA 4ANEA 4DG1B 4ECSA 4QIWD 3EGWB 2CDRB 4LVNP 4GRSA 2FVRA 2J6SA 4NYOA 1N34F 2AYMA 2AMCB 1HA1A 3PKYA 4WFYA 4ANDA 1HQEB 2DNYA 3KLHA 1REVA 3ETMA 2HFNA 4WK1A 3ZNJ1 2ACYA 3KLFA 2RD5C 3DNCA 3DI6A 1NPPA 1S1VA 1FWLA 1BGXT 2EVZA 4LF2A 1S9FA 5CYQB 2FLPA 1TMJA 2EXUA 2F4VF 1S4EA 3UE2A 4E0DA 5U47A 5F8NA 1S76D 1Z2LA 4FNIA 2CQ1A 2MKYA 4KYZA 4ZPCA 2HMIA 2ZOFA 4NRTA 3PV8A 4B9NA 4RBTA 1HI1A 5KFRA 2ZM6J 1A6LA 4P2SA 2C22A 2VBYA 3FCWA 4AYBD 5MLCV 3HFZB 1HWIA 4FDFA 3G6XA 2J8AA 5CZXA 3OHBA 4Q7AA 2MMYA 3IAS9 3S8SA 1NZAA 1U8SA 1V6HA 3BR8A 3IGVA 3LP2B 4DQPA 2DHSA 2RE1A 4JI4F 3H4BA 4WBFA 1NPRA 1WG5A 2WVFA 2G0CA 4C11A 5GAHU 1YWXA 4I6WA 2YNGA 4ZP7A 2FVSA 1DBDA 2C42A 1JLBB 3M2UA 4YS2A 4KHRA 2ZDPA 5KG2A 1U1PA 2JLFA 3CD6S 4F8RA 2DGSA 4RU2A 2CA9A 3K5PA 4BWMA 2ZNZA 4LR8A 5DQHA 3GG0A 1WG4A 3TO8A 2YH1A 2HHUA 3OTBA 5FJ4A 1UVNA 3M2VA 3VWSA 2E5LF 3O6QA 1BXNA 4QOTA 4USJC 4MK7A 3DXBA 1FJGJ 3KNAA 3PDNA 3ENWA 5L1IA 4RW9B 4OMFG 5F0WA 3MEKA 3O5TB 4IQMA 4DOZA 5FLXY 1YSJA 2KKHA 5KT4A 2RVJA 2EPIA 4YB5A 3C14A 2KXNB 1UJ6A 5KT3A 5EWEA 2ZKUA 3CJ3A 4ETXA 4O4GA 5A2QY 1VR6A 4DPOA 2PA3A 2ZBIA 2FJBB 5IC6B 3KTQA 4F02A 3IN5A 3PX6A 1HBNB 4PABA 4IO1A 3D0HE 1E6VB 3GFHA 1JJCB 4AQYJ 2DXFA 3OVSA 1KVIA 2XYGB 2KDOA 4DCOB 3JTNA 1VRUA 4TYAA 3OUYB 3W9IA 4DR3F 3KFWX 1B0VA 1CJUA 1YI2S 3MF5A 3HVAA 4GO7X 1W2IA 2CKWA 3PX4A 2R7UA 3PY8A 2FZCB 1R8BA 2NREA 1R8CA 3T19A 2DGOA 1SJ4P 3AQPA 4ZP9A 2ZOMA 1S1WA 1IBKF 3QAEA 1QAJA 1FJEB 5I3QA 4P2FA 4WP3A 3VZHA 1H73A 1AFIA 3EVOA 3ZZOA 2YVSA 4MTPA 1NBEB 3RB6A 4OV6A 2HHPA 1TZ0A 3IP0A 2R2UA 4IFVA 4LSNA 1Q7YT 3QMQA 4ZHRA 2D3O1 3JQKA 2C3MA 1KS2A 3QZ8A 5KFOA 4ECZA 5IT9U 2MQNA 3R2DJ 2V5HG 5DG7A 2AJ0A 4DX6A 1RISA 4DX5A 3AOAA 4ZVOB 4HH1A 4KGXB 2JDJA 1JNRB 4AL6A 4ZS6A 2KRBA 3CGIA 1HYSB 1HBMA 5HK4A 2HAFA 3CCLS 4ED5A 3FQLA 2POKA 4X66J 4USHA 5AXMA 2YH0A 3VGVA 5A8KA 4RL1A 5DDQC 1SI9A 4ECXA 3T1YF 1KFSA 4B3SJ 3IO1A 3GQCA 3FMBA 4M94A 4YFUA 2MLZA 2H5EA 3FEXB 4B9VA 2DGUA 2E5HA 1LKZA 3RUBL 4CH0S 4QWEA 3AFGA 4TQRA 4RW7B 2J9DE 1R0AA 3T5LA 3MR7A 2UUBJ 1F2HA 5HANA 4EBEA 1XC9A 4J9NA 3AOBA 2FJDB 3TR5A 4MK9A 5IWAJ 1BHNA 1U1RA 3MEDA 3W62A 1PAUB 2G1DA 2LECA 2B0GA 2QRRA 1RI7A 3MR6A 3F0NA 4FZVA 3AD8C 4M5LA 1Y3JA 2X1GA 2KI2A 2DEIA 5E0OA 3TVZA 3NG8A 2AF6A 1OYEA 5C42B 5JVGQ 3FSYA 3HHLA 4UF4A 3B82A 4FPIA 4B3MF 1NB2A 1WSRA 1X4HA 3NOCA 4P75A 1FKOB 2B8PA 2HNZA 2Z8QA 5BJRA 2O01C 3CD7A 4RJVA 3PX0A 3RG6A 1IR1A 2L48A 3Q2SC 2WONB 1TL4A 3TRGA 4KIAA 3QWUA 1X9SA 4USKA 3B6BA 2Y3YA 5A76A 5E3QA 2DY9A 4X4UA 1I3OB 4KRWA 3DRSB 2I8EA 5L38A 4DUYF 1SIWB 1HD0A 2QT7A 1HLWA 2CQGA 3W63A 1UW4A 2R3VA 2WHOA 3SQGB 4DV5J 2MQPA 1IWAA 2XMUA 4QR0A 5ETKA 1WF1A 5A0YA 5T7LB 5KT2A 3KYLA 1SH0A 1JLAB 2CPDA 3UO0A 1KOHA 2CNLB 2V6AA 4I2QB 4CLWA 4DHVA 5FDLB 2GA7A 5J2NA 4WJBA 2ZC4A 2VG7B 3IR6B 2F7VA 2FVCA 2Q66A 2L9DA 3PACA 4DUTA 3T5HA 1TKZB 4OX8A 3OFFA 1RHJB 4A8OA 4AL7A 3TZXA 4X2BA 4HHUA 1YJVA 3S6EA 3MR5A 5DDPC 3DLEB 1U1QA 4GVBB 1VQMS 3TOQA 1T05B 3PO5A 1LQ9A 1SB6A 3P96A 4UW2A 4K4VA 1AW0A 3AODA 4OHWA 4C0HA 2KG0A 4OV1A 3C15A 3QT5A 2VOPA 1YHQS 1FERA 4J5OA 1ZPWX 3M05A 4KH1B 3DDIA 4O44B 4NEYA 3T9NA 3TNVA 3F56A 4EGLA 2OPRA 1JLEB 1PBAA 2RU3A 4QZVB 3NGDA 4MIBA 1LEOA 2DGQA 2W4PA 4DPXA 3K89A 5KFQA 1X5SA 1NO8A 4OYAA 2BOPA 4OZNA 1I94F 2WBRA 2VV5A 3DCAA 2XMTA 5ETTA 5CCMA 4GKKJ 2CQ3A 3QIPB 5K20B 4L74A 3MFHA 3UN3A 2B7CB 3BF4A 3LP2A 2FJEB 3RAMA 5KFLA 2KB2A 3G2XA 4ES3A 4RU9A 4N41A 3I96A 1CLFA 1WI6A 2YNGB 1FEHA 2CPIA 3D3CJ 3W1YC 4F36A 2HVDA 4ED8A 1BD6A 2VFSA 5KG1A 4TLRA 4NCAA 2B6AB 3HJVA 3KUGA 3AXKA 1HFEL 3QO9A 3FSXA 3QAUA 3Q8UA 3KLHB 1FVQA 3M8WA 2JC1A 2W9CB 2VQEF 2R42A 3MM5B 4QIGA 4FF1A 1DTQB 3OR1B 2L9NA 2W4DA 2VODA 4ZA1A 2HVIA 1VQ4S 2QMXA 1Y3KA 4NWBA 2Y9HA 5JVHQ 4PCQA 2XCAA 4FVCA 2RHQB 1H74A 3G6YA 1WC3A 1M1KT 4L73A 1GEHA 2O3DA 3IBFB 4PXDA 4ZVSB 4JI6J 4LT6A 1N34J 1W26A 4F04B 5H9FK 3TUPA 1TMMA 2BM0A 1TV6A 2JSXA 1ELOA 3M8YA 3B8HA 2C2NA 4FP9A 4U9RA 3UDEA 3ZXWA 1PC4A 2R7RA 1RTDB 5E2QA 2KFZA 4X65J 1CJVA 2L3MA 5B0EA 3J7YI 3CXCR 3LO3A 1K1QA 3MAQA 1EARA 1V5IB 1VRQC 4C8KA 3QT8A 3TP2A 2J9CA 5DDOC 3KG0A 3HFKA 2CQDA 5KFKA 1S1XA 4USWA 4N5SA 4NXNJ 4FYXB 3RW6A 4OYBA 4ZP6A 1YKWA 3HSDA 1T9YA 1N32J 1TKXB 1PGZA
chains in the Genus database with same CATH topology
1IKYA 2N7CA 4ZLPA 3MEEB 1E6YB 1WEXA 3I9ZA 1BWEA 1S9EA 3L7OA 1DFDA 2HHVA 2JWNA 4IFYB 3FNNA 5KFMA 2V4JA 1WHXA 4Z37A 1S1WB 5CQGA 3L09A 3BO4A 1UA0A 3PW7A 2JEGA 2YTCA 1V9OA 4MKAA 3W2VA 1ZYQA 3FZ2A 1S97A 5HN0A 3KHRA 1N5VA 3MMAA 1SL0A 4AE5A 2C3PA 3KWMA 1NK7A 5K8OA 1FDAA 2VB6A 4KGMA 3JSMA 1RAJA 1U4BA 3QLHA 3BO3A 3MPWA 4RBVA 4DX8H 5KG6A 3OVAA 5F8GA 1CC7A 2QO3A 1GQEA 3PW5A 3QJJA 3NKYA 4RWWA 3SYZA 3C3LA 1FDDA 4IOCQ 2DNGA 3GR0A 3K58A 4JYAF 3D54A 4IYQA 1HBMB 2UUCF 2CJ9A 1NK6A 3VAKA 4DQIA 1QSYA 2VKRA 1P27B 1YJTA 1ZM4A 2ZH3A 4ED3A 1S6PA 2OD6A 1FNOA 1RT3B 1HQUA 3PEJA 4A8YA 1PO6A 4RKUC 4B3TF 4ELTA 2DHXA 3BSAA 3NRBA 3EYZA 4EBDA 2PSZA 1ZAVA 4QU7A 4NLGA 4RW7A 3HHLD 2CZVC 5IM0B 1DAXA 3MCSA 1VLYA 2IC3A 1Q82T 2NR0A 4Q0BA 2IVYA 2N4DA 2PEHA 3KHGA 3LALA 4DV2F 2MZRA 4N76A 2YNHB 3PFEA 4MAKA 3GZ7A 4OZ0A 5KTQA 2KO1A 2DRBA 2XMMA 4FS2A 1RT6A 4EYIB 5E7OB 5SZTA 4N77A 5DDRC 3I0SB 1C1BA 5I3UA 2ZH7A 4NLDA 3BSNA 2LKZA 1ROFA 2VZ9A 2KM8B 4NXMF 2MHNA 4QQBA 4CO4A 4DJBA 3N6NA 2IFXA 3IS9B 1UJ4A 3Q8SB 2W9AA 4K5RA 1X0PA 4RNHA 3V2UC 3W7BA 3E01A 4MFBA 4DDFA 1NJXA 3HI9A 1N4LA 1OQ3A 2LXIA 1DURA 5A0YB 3MM9A 1V3SA 5K8PA 3JTOA 1Q53A 3H59A 4NLOA 3H8YA 3NBPB 3T9ZA 2KT2A 4WFZA 3VAJA 4M8LA 4IDKB 2XNRA 4WIIA 1LXNA 3DLKB 4KR0B 5IT4A 2WOMB 3CE8A 4C3MA 4IRKA 3I56S 2G4BA 1T95A 2EWHA 2LA6A 4R0EA 4DR4F 4R25A 1RYRA 2ATLA 2VFUA 1T05A 4DS5A 1MSWD 2E1AA 4EZ9A 3SFUA 3RBEA 4Q2MA 2V4QA 4CIOA 3T3FA 2KZMA 3MEGA 3TA2A 1X4FA 2J6TA 2BVZA 2CRLA 4NX9A 3WX4A 3H25A 4A8QA 4KV8B 4HKQA 3I87A 1VHFA 5H9EJ 2R8GA 4EO8A 1FEEA 4IG0B 4KPYA 1BQNA 4NLYA 1S6QA 1O0PA 5J1PA 1U1LA 2EFOA 4NZ6A 3F73A 2OMOA 3M2RA 3BGRA 5K14B 1U1KA 2N7YA 2DNMA 4PXCA 2K3KA 2W7PA 3NCPA 3UPFA 4H4KC 3GB0A 2ZJRQ 2W24A 3L95X 1VK8A 1U48A 2COLA 4LF5F 4HI1A 3M9NB 2FVPA 5D4OA 1S72S 1U7LA 4J9KA 4JV5F 5F3ZA 3UDLA 1DTQA 5G0RB 3DRPB 4PG6A 5T41A 2MSTA 1DQAA 2GO8A 4B3OA 3FDSA 4NA3A 4OI6A 4C8NA 5F8HA 2PA8D 4CQ1A 2KTQA 3QIDA 1RA6A 2WAQD 5KG5A 3D1OA 4X4TA 1FKPB 1GX5A 4UQGA 3QPIA 3WZ0A 3PKMA 1RT2A 1JLQA 3CCES 3ZZUA 1UFWA 2V94A 5D3GB 4O3PA 5M2UA 2XS7A 2OAUA 1GXTA 4QJVA 3I0RB 3MHYA 4NLWA 2CPHA 2DPIA 2ZE2B 3NS6A 1J5OA 4J9OA 5DGAA 4NYZA 2V8HA 1KC8T 1N5TA 1S1XB 4F2SA 3JSYA 1VIOA 2DD8S 3DHXA 5K8NA 2Y1JA 3S1TA 1TKXA 4JV2A 1TL3A 4NZ7A 1R3NA 2FHKA 4ILRA 1IN0A 2VUGA 4EWTA 1VBXA 4LJMA 1S9EB 3ZFVA 1K0VA 5C25A 4QBUA 4OJGA 3MZIA 2LDYA 2VC1A 4BHQA 1NKCA 3V81A 3NMAA 2OPSA 3AJ1A 4HT7A 3MD1A 1N6QB 3FFIA 4ZVGA 1K9MT 3UD3P 1W25A 2MKKA 3MMAB 3I5CA 2Z0GA 2AX0A 2NLWA 5FD1A 5KT5A 1U1PA 5K9FA 4X4RA 2RB7A 2FUG9 4JI6F 3IAM9 1IM4A 3G6ES 2A2DA 3H2UB 4U6PA 5DM7Q 1OWXA 2J0XA 3NCQA 1KTVA 3CJ0A 4BC7A 2J0WA 1L3UA 4LUBA 3VTIA 3PW2A 4OHZA 3J7ZT 4X65F 2QA4S 2XZWA 3G4SS 3CWJA 3MM8B 3KNGA 3SMZA 1TP7A 1FKAF 4JV0A 5KFYA 4DFMA 2P5VA 2E9ZA 1NHVA 2GW8A 4OJ3A 3W3SA 1JMTA 2XWXA 2V8VA 5F3TA 5KFXA 1N32F 1HHSA 2PN6A 5L1KA 1IBLF 3PRDA 4JBCA 2CQIA 4ECYA 2XI2A 1P9QC 3NMRA 5F8NA 2HLTA 1GX6A 1XBWA 2YNIB 3DMJB 2BQRA 5CYMA 4TU7A 5KG0A 2E7XA 4DR6F 2CG4A 3M4XA 1LWFB 2CJAA 4IG3B 5E3RA 4KSEB 4L3NA 2YX4A 1N5QA 2HS4A 3I0SA 2G13A 2NSCA 2OPPA 2CZ4A 2CVEA 4ID8A 2W8LA 2ZHAA 4GKJF 3PW0A 4IO9Q 3LW5C 4G1QA 3CIZA 3H5YA 3GILA 3NCRA 2GHVC 1IXKA 3UCGA 2AJFE 5J1NA 2ILZA 2KU7A 1YJRA 2BE2B 4PG5A 5LSRA 1RTHA 2JZ5A 1ZZFA 1SKRA 4N56A 4B9TA 2ASYA 3OLAA 3H5SA 4ED1A 3MM6A 1RTJA 3MI7X 2VKZG 3NBPA 2JHEA 2XSJA 3CIMA 3FEZA 4Q43A 1AFJA 3AA8A 2AV5A 1RQ0A 5F9LA 3VQTA 3DLKA 2I9SA 3I9V9 4XPEA 2AJ4A 4BCAA 5KFSA 2XWYA 3BDEA 5E33A 5KG4A 3OSPA 1X0FA 1IJEB 1L3VA 1NRKA 1TKTB 5J2QB 1HPZA 2Q1LA 1W2BR 1S49A 1HBUA 1UAWA 2W9BA 3PM9A 4V19J 3BSCA 2EBGA 2YWFA 3IRXB 4C98A 3KLEA 2K1RA 5H1SV 3G8TA 4Y65A 3LP1B 2BYCA 3CJ4A 4B17A 1MWZA 1BQNB 5HI7A 1DTTB 3OL9A 2HGMA 1YVFA 4RUAA 3MOZA 1Q78A 2ZH5A 3VAMA 4DFPA 4FYDA 3X3UA 3MD3A 2DB1A 2WCXA 4MK8A 1CQNA 2FVQA 1SBRA 4IR1A 1UEUA 1FF2A 1VRTA 2F40A 2J76E 4H4OB 5HROB 1GH8A 3RB3A 2OH2A 2JH3A 4K2XA 4BDPA 2IVFB 1BQMA 4LF8F 2M8HA 2HMIB 1QSLA 3SDEA 3V6JA 2XG8A 4MIWA 3N01A 3D2WA 2LYVA 5B0FA 1FJGF 4KFBB 2E1RA 4JI3F 2IAJB 2YX1A 2E29A 3MTJA 4EBCA 1VQ6S 5T7LA 3BB5A 5F8LA 1SL1A 2D3ZA 3K5MA 1KVJA 4ES1A 2YKAA 1UMJA 3CJ2A 2VQFF 3MUVP 3ITHB 2RKIA 2MGZB 2FGCA 1RJJA 2KHDA 1JLFA 5KOWA 3BQ2A 2HHQA 1KEKA 1TL1B 3M8PA 1N56A 2NPFA 4I64A 2FHOB 2E1CA 4AQYF 1UEVA 2XNQA 1F2GA 3AQOA 1SXLA 3KKFA 3J7YU 2CDQA 1YJ9S 1KQSR 2OP5A 1QAIA 1SKWA 3KOAA 2DO0A 4F50A 5B0GA 1U6BA 2QA4G 1VQOS 5EGYA 1JLEA 2R7TA 1MROB 1T3OA 2BQUA 4IH5A 4XPCA 3OL8A 4G1IA 3M8RA 4FPRA 6FDRA 2IVMA 1L3TA 1F5BA 2WTFA 3CO9A 2GGPA 5EUHA 2NXUA 3RB4A 3FFIB 4DMZA 4RNMA 3R1LA 1D9FA 3CC7S 4AL5A 2FGOA 3DOLB 3G86A 3JYTB 4DL7A 3FRYA 1WHWA 2YY3A 4X4PA 3UR3C 2DR9A 4XDDA 4K4ZA 3MURP 3BJYA 2QE5A 3BGUA 5F0UA 1VQNS 2DITA 2HS3A 2J7UA 1KQKA 2DH8A 2DNHA 4KC5A 2A1BA 4ATNA 4NPOA 4YB1P 2AGOA 4X4NA 4C8MA 3MM8A 2YNFA 4B3SF 3TUJC 5GAGI 2BR0A 3QGHA 4HVZA 1KSPA 4ZHRB 1UWBA 3OLBA 1QUVA 1Q8LA 3GYXB 4ZPDA 3EX7B 5J2PB 4KKOB 1JLGB 2P6SA 2F9JA 2OKQA 4K50A 1P1LA 1KONA 2BA9A 2MY7A 3M8SA 1RTDA 4QIEA 1VBZA 3O2IA 2YWGA 2ZZMA 2LQJA 4LSLB 1FO1A 4TY8B 4M95A 5BYSA 2RU9A 4YDDB 4RNOA 3DHWC 3RRKA 3V4MA 1ZZNA 3N6LA 3KLGA 4Y6IA 1NJYA 3MR2A 3GIJA 2MKCA 2ZH9A 2L41A 2BUNA 3P49B 1Y7PA 2LQ9A 5BR8F 4TQSA 4LFCF 2CPXA 1JNZB 1R0AB 4D3HA 2ZNYA 3HK2A 3TQ1A 4CH1A 2KM8C 2XC9A 1UVIA 2IBOA 2LMIA 1KQGB 2E5GA 4C8LA 3MEDB 3K5NA 1S1UA 3I4PA 2KHCA 1DLOA 3LH2S 4OL8A 4DV5F 3EGNA 1NJZA 2OPQB 3KK1A 1R8AA 1R8HA 1EETA 1GT8A 4PUOA 2ALZA 5KFHA 3AB4B 3IGNA 1VMBA 2GQQA 2IM3A 2MPUA 4XK8C 2IHR1 3K59A 2QLXA 2BW2A 1XN9A 1IUJA 1FCAA 2D74B 3KHHA 4OQJA 2ROPA 2AP6A 1XMQF 3DU5A 2UVWA 2UXBF 2R8KA 4F26A 1HNZF 1N0UA 2MY8A 2C2DA 3UCUP 2PDAA 1Y9OA 4B9LA 1TR0A 3DRSA 1FD8A 1G1XA 2NSBA 5J2QA 3OR2A 2Q43A 1HPZB 2FB0A 1X9MA 2VBXA 2B4PA 2VG5A 5HP1A 2L08A 3BGFA 1RT7B 4HDGA 4DQRA 5J2NB 4F4WA 2I2YA 5IQQA 3K57A 2IMWP 3I31A 4B9MA 2B5JA 3LP0A 3ZZYA 4CO5A 3GIIA 2EFVA 1F5AA 4Q5VA 2XO7A 3FVYA 3PJXA 2UXCF 2JLGA 4AUKA 1DTTA 2UUAF 2RJZA 2YNHA 4I4BA 1KHVA 4PG7A 4X4OA 3G96A 2ROGA 1FK9A 4XDCA 3LQVA 1X4AA 3QZ7A 2IMOA 1VQPS 1F9FA 3Q22A 2VPXB 3X1LB 4LIWA 2KXHA 1QUPA 2GCFA 3P6YC 1LWCB 4WCEQ 1ZM3A 2Y1RI 1UFLA 1R6YA 5GADI 2FIUA 2M9KA 2RMLA 1FJ7A 1IKVB 1XK8A 1EP4A 3RBDA 2IRXA 1DQ9A 2IAJA 1VBYA 3DRRA 4U7CA 2W7OA 4Y0FA 4DV6F 1YG0A 1RWUA 4HEA9 1RKJA 3MM9B 4LF7F 3NNCA 3RTVA 1FNMA 1VK3A 1YRUA 3ITHA 4Y2IA 3GV7B 1BQXA 2HHWA 4IDKA 3K2YA 3CD5A 1M5PC 1G2EA 2WOMA 3DOKA 3L7PA 1L3SA 2RQCA 1TL1A 2WW8A 4NXNF 4A4JA 3MM5A 5KG3A 3JSBA 2PO4A 5MAOA 4PPDA 4I2PB 1HNIB 2BRKA 2DBBA 2VH7A 4Q8EA 2K3IA 1HWUA 5B0CA 3TUZC 4AFFA 1QM9A 3N28A 4OX6A 2A2CA 1FA0A 2KT5A 4WFBQ 3CJ5A 4RW6B 1C4AA 2DIVA 2GIQA 4HI2A 3WBZA 1MROA 4YQWA 1KOOA 1UVMA 1IQTA 5KAKA 4QR1A 3M6UA 3PRBA 5T14A 4ALZA 1H38A 3CDAA 1WELA 4OI2A 1FHTA 1RK8A 5KFCA 2EW9A 1OIAA 4Y2MA 2HFZA 4YEAA 1REVB 4AXJA 3KLFB 3KLHB 3BGRB 2R4FA 3D28A 5K14A 2P9CA 4F2RA 4ILLA 4RW4B 2HNYA 4PKDB 2AQ4A 1DARA 4ID5B 3OXGA 5KFIA 2CPYA 3FRZA 2UVRA 4IFYA 2Q6BA 1MMLA 2GQ2A 2V0NA 4JI8F 4DN9A 4K0KF 3NAHA 4H4KA 2KYXA 3ONQA 2RSQA 4B3OB 3H40A 2DVIA 1MNEA 4EYHB 4C3LA 2MQOA 2DNKA 5KT6A 4A8WA 2KT3A 4USIA 3HVTA 4JI2F 2FLOA 1C2PA 1Y00A 1FKPA 5J2PA 4C11B 4ETZA 1Z2ZA 1RT2B 5M2RA 1VIXA 5E41A 2Y0SD 2IJFA 3ZZ0A 3M2UB 3H2LA 1Q8IA 4Q2LA 5LMNF 2ZE2A 5LMUF 2FY1A 4NLQA 3IR5B 3JAMY 1TK8A 1Q1KA 5C5JA 4R8UA 3HPOA 3TA1A 4ZPTR 3HZGA 3SCJE 1Q16B 3VALA 1N48A 3BREA 4FVMA 5L1LA 2CQ2A 1TK5A 3NP5A 1N5YA 3IR7B 2OO4A 5KFZA 2IM2A 1O51A 2GMHA 3AHPA 5KG7A 3OW2R 2PT0A 3Q8QB 4HYKA 2JC0A 2ROEA 2QA2A 5CCLA 3HHEA 4JI0F 2OPSB 2VD3A 1WF2A 1HL6A 3UD4P 3QJLA 1UVJA 2B4UA 4I0WA 1VC5A 4Y00A 2WB4A 4PUOB 2N4CA 1OSCA 1T94A 2XLJA 3IFEA 1N52B 1H2VZ 2R7XA 2BM1A 1QVFR 1NJWA 1UP1A 5L39A 4N47A 2LA4A 4HT5A 2V8DA 1YQHA 4DS4A 3MR3A 1ZPVA 3OPKA 3GV5B 3O44A 4MKYA 1N5SA 2G9OA