1BLUA

Structure of the 2[4fe-4s] ferredoxin from chromatium vinosum
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
80
structure length
80
Chain Sequence
ALMITDECINCDVCEPECPNGAISQGDETYVIEPSLCTECVGHYETSQCVEVCPVDCIIKDPSHEETEDELRAKYERITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Crystal structure of the 2[4Fe-4S] ferredoxin from Chromatium vinosum: evolutionary and mechanistic inferences for [3/4Fe-4S] ferredoxins.
pubmed rcsb
molecule tags Electron transport
total genus 14
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 1996-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bluA00
2FJBB 1FXRA 5BYRA 2WAQD 1AXQA 1RGVA 4XDCA 2IVFB 3OR2A 5E7OB 2FDNA 1ROFA 3MM7B 1FRIA 2V2KA 4ID8A 1K0TA 2FD2A 1PC5A 1CLFA 6FDRA 5FD1A 4Y28C 3IR6B 2FGOA 3LW5C 1FDAA 3MM5A 1WTFA 2Z8QA 4KT0C 1FRJA 2PMZD 1F5BA 2VPWB 3GYXB 2GMJA 1FDDA 1D3WA 1SIWB 1SJ1A 1BLUA 2V4JB 1GAOA 1DURA 1HFEL 3MMCB 1BQXA 2C3UA 1A6LA 1H7WA 2XSJA 1FDBA 3HKZD 2VKRA 3MM8A 3PNIA 1FD2A 3C8YA 2C3OA 1KQFB 4YDDB 3MM9A 1FXDA 1XERA 2V4JA 5CH7B 2VPXB 4DHVA 2FJAB 1G3OA 1BD6A 3IR5B 2C42A 2WSCC 1B0VA 4OV1A 2FJEB 1IQZA 2VPZB 2O01C 1F2GA 3MM7A 4XK8C 4OMFG 2FJDB 4XDDA 1H0HB 2WB1D 3MM6B 1Y5IB 5CHCB 1FTCA 3IR7B 3MMBB 5L8RC 2Y0SD 1GTEA 1FCAA 5BYSA 3EUNA 3EGWB 1DAXA 1FF2A 1FRLA 1FERA 3OR1B 1FRKA 1IR0A 2VPYB 2ZVSA 1GTHA 1Q16B 4CI0B 1FRXA 1G6BA 1C4CA 1BWEA 3MMAB 7FD1A 2GMHA 2C3PA 3MMCA 1BC6A 1FEHA 2C3YA 1Y5NB 4L6V3 2UZAA 1H7XA 2PDAA 1H98A 1F5CA 4AYBD 3OR2B 1VJWA 6FD1A 1Y5LB 1PC4A 1B0TA 1FRHA 1FDNA 1JNZB 1Y4ZB 3EXYA 1KEKA 5BYQA 3MM6A 2PA8D 1C4AA 1KQGB 3MM5B 3MMBA 2C3MA 1GT8A 1JB0C 2WSEC 1JNRB 1B0PA 1FRMA 2WSFC 1DFDA 1SIZA 3OR1A 2XSJB 3MM8B 1R27B 7FDRA 4RKUC 3MM9B 3MMAA
chains in the Genus database with same CATH superfamily
1NM2A 3PHTA 1G4CA 1IKWA 2B8PA 3QQCD 2ZH8A 1S48A 4WZQA 2MY7A 1UKUA 1YITS 2X3DA 1KSPA 3T6JA 4CT9A 4GKJJ 3AT1B 1DTQB 5KG6A 1N6QA 4LFBJ 2ZVIA 1KLNA 5IWAJ 2CQ2A 3G6YA 2R8IA 5AXNA 3W3SA 1DLOA 5JXSA 4GVLA 1RWPB 2RT3A 4ES3A 3HXMA 3MURP 2GVZB 1EKSA 3Q8YA 2YQ1A 5AE2A 3IBCB 2PFDA 3SBMA 1YDLA 3MAQA 4KR0B 2YNFB 4JOUA 4D3GA 4KGZB 2QA1A 2XCPA 4I56A 4P73A 1IXKA 4CH0S 1T95A 3AD8C 3T9ZA 4TY8B 1D9DA 4U9RA 1SXLA 3C2PA 1C0UA 2JC0A 4P2SA 1B64A 1YJWS 5CXTA 4DR1J 2I1RA 3EZ5A 2FVSA 1MU2B 3IWXA 2RDDA 1RHJB 5D8HB 4PR6A 3RB6A 2YNIA 3PJ9A 2F65A 4DSEA 3EDQB 4C8YA 2B7BB 4DFJA 2OP5A 2XLIA 1RU2A 3UDVA 4UZCA 3SCLE 1R7IA 4KGKA 2CVEA 4CCHA 2R7WA 1VBXA 4OI6A 3P3DA 1X5PA 2F9DA 4DR6F 4DL5A 2MZJA 3KG4A 3DOKB 2LFVA 3ETOA 1VRQC 4FZVA 2MKIA 2DXFA 5EDWA 4FYVB 1Q82T 2MHNA 2DNKA 5G0RA 4DV2J 4ANDA 2MHEA 3GCXP 3I4PA 3HSZA 1VBYA 3NEKA 5K14A 3GMGA 4OYZA 4F0MA 4FNHA 4HHHA 2RH3A 2PE8A 2AEMA 2HW3A 4LIWA 1F5AA 4EYIB 3I6PA 1YBTA 4UZBA 1CQMA 4MIBA 1RAEB 3MEGB 3D4JA 3ZTRA 4NL5A 3QIPB 1C0TB 2CNLB 4U96A 1N5SA 3LWLA 1NU4A 3E51A 2ALZA 2ZH9A 2X1GA 2XTJP 2EEYA 1HNXJ 2PMWA 3P4UB 1MROB 2NQPA 1XJWB 3QO9B 4ED5A 3DI6A 4CLUA 2FVPA 3DOMB 1TL3A 3BBCA 3OTOF 2HQCA 4X66F 1RT6B 4PAAA 4H4MA 4N56A 5D78A 3U02A 2OPQB 4OX8A 1TMMA 2MYFA 4WPAA 1U6FA 2OPSB 4P2MA 2JNJA 3AY0A 1P1LA 5ETOA 4LRDA 4B3SJ 2VFRA 4USIA 5F41A 4WP8A 2O3DA 2XWYA 1OY9A 4LF2A 2CNKB 3OXFA 2IJFA 3RB0A 1EQ0A 3ONQA 1CPZA 3IO1A 5K8OA 4JI7J 4GVBA 3BEGB 4CH1A 3Q2TC 3GB0A 4BBYA 1FFGB 1TAQA 3W62A 1GQEA 3TQ1A 3OR2A 2KKHA 2V2KA 3GFZA 4MK9A 1VISA 3EM1A 1NJYA 5J1EA 2W7PA 1WJ9A 2NR0A 3BO3A 4LSNB 3KLGA 3GE9A 4PYDA 1S1TA 4Y65A 2HMIB 2IJRA 2SXLA 1DURA 1SC3B 3LP0A 3DLEB 1HHSA 1RHKB 2DJWA 3QJLA 2RD5C 1UJ6A 1U8WA 4JYAF 4ZJQA 4DCJB 4DHVA 3RTVA 4WCEQ 1M1GA 1CJTB 3QRRA 2UXDF 4MIWA 2RS2A 3H8YA 3KLHA 1VQSA 3LO3A 1F9HA 1Q78A 4RJVA 5LM7E 1YBUA 2JFKA 4K4VA 3IXQA 4QYRA 2BE7D 1QDUB 5D0EA 5K9FA 2CQ3A 2ZUAA 1TKDA 5A0YA 1KFDA 2BANB 2J0QD 4Y2AA 1GK8A 2W2QP 5F8IA 2YX4A 2ZD1A 1TK0A 4NMLA 1Y3JA 2R2SA 1RDRA 2GMLA 1RBOB 2HVZA 1V5IB 2KT5A 3S1TA 3MM9B 4ZLLA 4Q2LA 3T5HA 4ZVGA 3DDIA 1UWBA 1HBOA 4EBDA 1WEZA 5F9LA 5IC4B 4DV4F 5J2QB 2CJAA 4OLOA 1HD0A 1B99A 2QTWA 4Q2MA 1SPBP 2KVIA 3JB9k 4USTA 5KT3A 1LXNA 5HP1B 1OPZA 2PI5A 2FJAB 4AQYF 3EWGA 4MH8A 3J81j 4IH5A 4QPXA 1RTZA 4EFAC 3ELHA 5L8RC 1BQNA 4Y00A 1N5VA 2J9CA 2MQLA 2ABYA 1Q8IA 2QLFB 4PWWA 4NXMJ 4DXLA 2DH8A 3ILLA 1F5CA 4IRDA 3LGNA 2F1FA 3O6QA 1M0SA 3H2VE 3HHEA 3CPWR 1UCNA 2IVMA 2RAQA 1XMQJ 1GXTA 2ZITA 2AGOA 3K8VA 4F3MA 3OR1A 4EEYA 1GMWD 3VQTA 2OKQA 2W2OP 2YKQA 3SFGA 3CCJS 2MZSA 2ROPA 1XBWA 3I82A 4L3NA 2UUWA 2EXUA 3OUYB 1R8CA 2GGPB 1J5OB 4L76A 2W9CB 1ZA1B 3TA2A 2Z8QA 1PYSB 5KG2A 2ZH6A 4LMZA 3QAEA 2KM8B 4N5SA 5E3QA 3CIMA 4KH0B 1XMOJ 4DEZA 3TRGA 3DLBA 1NK7A 3TWZA 3MFIA 2W9AA 1KLMB 1MMDA 3OFHA 4UTGA 3BJYA 3V6KA 2PD1A 5H9FJ 1S4FA 1UTAA 2RF2B 3Q86A 4U7CA 2V8GA 4NX9A 2KDOA 3NS6A 4ES1A 2JL9A 4KGXB 1BWEA 2A10A 1U0HB 1Z1ZA 3CDEA 2L9WA 3KFWX 1U8SA 3JSBA 2V9KA 5MLCV 4OZJA 5HLFA 3UCUP 1QLNA 4DG1A 3CMES 4DX5A 2HWTA 5CYQB 2H54B 3T1YF 2HBZB 3IS9B 3SDEA 4TYAA 3L7OA 3GFHA 3VAJA 3DMJA 3OVBA 4JI5F 4IG0B 3IG1B 1DBDA 3M2RA 1RADB 1ZBTA 3VAFA 4OYBA 1S7IA 2YWFA 3M2VB 2OH2A 3PACA 2EPIA 2GZOA 1RT7B 5KFLA 1UW4A 2F4VF 3EDRB 2HBRB 3QZ7A 2EWHA 3TZXA 4CDIA 1Y5IB 2FPHX 2WRMA 3PW0A 3PDNA 1FVQA 2R4FA 2JOQA 4JI3F 1FJGJ 3UWTA 4ANCA 4PZVA 1RHRB 3M8RA 4RW8A 2Q1LA 3LOUA 1DY3A 3MAAB 2LU1A 1JLEB 4JP8A 2AZ3A 3UI3A 4FBUA 4B3TJ 3VVTA 1PC4A 2FZGB 3Q8RB 4O0IA 1IQTA 5C42A 4KBIA 2N4CA 5B0BA 1R8BA 3FVYA 3T5JA 1FK9A 1LW0B 3EZUA 1RHUB 1F9FA 1S1WB 2U2FA 2IA0A 2R7QA 1K0TA 1NKCA 3ENAA 3V5RA 2AYBA 2OTLS 1CLFA 1T9UA 3W9IA 1VRUB 1HQ2A 1S9EA 2HVHA 3CCLS 2PMZD 5AT1B 4MFBA 1E6YB 3O2IA 1JLCB 3WIUA 3ZTPA 4K0KF 1RYSA 5GADU 3VAHA 4O3NA 4ED2A 1FD2A 1MW7A 5D4PA 3VTIA 4CO5A 1HNIA 3FSXA 2O01C 2UU9F 1HBMB 3CJ3A 3H4DA 2C2NA 3EXCX 4AXJA 4DBQA 1NZ8A 1WI8A 2UUBF 2CQCA 3LP2B 1RYRA 2WW4A 2FHOB 3EGZA 3BQ1A 3RBDA 3TX8A 4LIRA 3OHAA 2M70A 1H7XA 1K73T 1H98A 1LW2B 3UD3P 6FD1A 2W2PP 5I42B 4P7TA 4TYBA 2CPDA 1IN0A 2QG9B 3HVTB 1LWFA 3M4XA 1ZETA 3TAMB 2BJ1A 3F56A 2VD3A 4B3MJ 2ZH1A 4NA2A 5RUBA 2VA3A 5DG9A 4X4RA 2OPRA 2FTRA 3GFXA 1FNOA 5E7OB 4ZP7A 2W8KA 3M8PB 2GHPA 2JHEA 4Y28C 3MM5A 3AHPA 2QRRA 5KFGA 2VC1A 3HT0A 1U7LA 2VICA 3D1OA 1H73A 1T9XA 1A6LA 3ZZZA 4JV5J 2W25A 3KK1A 2B4PA 4FVMA 4YB6A 2RJZA 4PPDA 1ZS6A 1H2VZ 2XQCA 4JI1F 3HVWA 3OTBA 3VGTA 4YUDA 2NXUA 4URGA 3EUNA 4Y6IA 2W2NP 5IT9Y 2WONB 2BKNA 1WD6A 2R8HA 1RA6A 2D3UA 3TYTA 4NEZA 2ASJA 1KEKA 3CW2C 4ELVA 1HQEB 1GT8A 1M5HA 5KFUA 2VDHA 4CLPA 2JSXA 3QAUA 3PJWA 1RWVB 4DL0C 5EUHA 1JXVA 3KMQA 5A8KB 4LUBA 2DCUB 3DN9A 2AT1B 2N3OA 1X9WA 1YTYA 2BM1A 1N5YA 1OYDA 3H2UB 4WKRA 5D3GA 2GQCA 2DT9A 2FGCA 3KLEA 3P5BP 5ETQA 2DEJA 4B17A 4LRAA 2QA2A 3GYXB 1WEXA 1A0OB 3ZNJ1 4CYUB 2CQGA 1KOOA 2BR0A 1BQXA 1Y3KA 5FDLB 3KNAA 2I8EA 2BX6A 1RT4A 2XI2A 1Q95G 3H5UA 2POKA 4R8UB 4QIEA 2KYXA 4DR5J 4NI2A 4WIQA 2PN6A 2XGPA 1WACA 2HHPA 2IPOB 1T03B 4XDDA 1VHIA 3TJ8A 4J7CA 1NRKA 3OTCA 2AHOB 2HK3A 1FRXA 2YWGA 3DRRA 2CWXA 1JLAB 3KJQB 2XO7A 1PKUA 5K8NA 2B3TB 4X62F 5J2MA 1SVDA 3E3XA 3CJQA 3BDPA 2Z2ZA 1EAYC 2VKZG 3OL6A 3EPGA 5B0FA 2ATCB 2JJ4D 3AOAA 1XNQF 3BR8A 3VAIA 3ZZYA 3I4HX 4ELUA 5GAHU 2Z2LA 1IKYA 2FZKB 4LR8A 3W2WB 3PFOA 2QZ8A 1UW9A 4JI2J 2K1RB 5GAGI 4Y2MA 3Q23A 2GIRA 3BF4A 4LFBF 3MMCB 3KG0A 4ZMMA 2X3GA 2O67A 4WE1A 3SQGB 2FLOA 4R5PA 3WX8A 3DFEA 1LWCA 2MTLA 3OJSA 3IM9A 3JAMY 1PIEA 1Y7PA 1S49A 3KUGA 3CULA 4DR2F 3W5YA 4LRFA 4USJC 1TL1A 3AFGA 5HMZA 4C3LA 4DV0J 1NO8A 3X3UA 4RUAA 1JQGA 3UNYA 1SL2A 4TY8A 4X4VA 4YMEA 4DR1F 3UN5A 2EFGA 5AXLA 1NH7A 3TA1A 5HMWA 1OSCA 4DSFA 4XO0A 4IRKA 2MLZA 2PFFB 1MU2A 2HFOA 5E3RA 1PO6A 5DLFA 3HPOA 3LW5C 2ADBA 3PHEA 4ZHRA 2LQJA 3ZZRA 4ECVA 3BKUA 1H72C 5ADZA 2DO4A 4DUZJ 4I6YA 1HPZB 3SCJE 4ED8A 3CCQS 2GV1A 1IKXB 2J76E 3MAHA 1KBRA 1UJ5A 1Q0NA 1J5EJ 4I2QA 2NUHA 2WVDA 1NDLA 4IDKB 2HQIA 4CQ1A 2BA9A 3CIZA 2M4MA 1UZHA 1RE1B 3B78A 3IGVA 2UZAA 1HBNA 2JLFA 3RR7A 1CBKA 4IOBA 2LU2A 4J9VA 3M8QB 3IRWP 2V2ZA 4TU7A 1X5OA 2OEJA 5LL6d 4U67Q 2MDAA 3H5XA 1CJUA 2AIRB 4DCPB 1UFKA 4PYAA 4Z37A 5GMDA 3KJNB 1U2RA 2QYGA 1CULA 1TKTB 3W2VA 1U09A 2MMYA 4QZVB 1RT1A 4KY3A 2RRNA 1WSVA 4EUVA 3TQEA 1C0TA 3W9HA 5D4LA 2XZWA 1FXDA 4HLBA 3EVWA 2CFXA 4ZVOB 2DNYA 2JWNA 1JX4A 4LF8J 2IDEA 2LQ5A 1FE0A 4LFCJ 5DDPC 1XR7A 1GTEA 4F4WA 3GJRB 3DOMA 4E0DA 3UW1A 3PV8A 2CQDA 3HD1A 2IAJB 4EU0A 4JB8B 4K4ZA 5ETRA 1SQEA 3KYLA 1T9VA 4AL5A 2V5HG 1RWKB 2MKKA 3C6UA 3CC7S 2KRBA 3LGMA 2OPSA 2YVSA 5HI7A 2FC9A 3CCRS 1VQOS 4KO0A 5LMNF 1X4DA 2VG6B 3BREA 5DDOC 2F8MA 3ZZOA 1U1RA 2IM3A 3DM2B 1D09B 3CJKA 4CLWA 1U2CA 3BYPA 5KG7A 3OL9A 3KJFB 4OJGA 3QYYA 2HNDB 4RW6B 1YRTA 2LA4A 2V6AA 1RT3B 2J6TA 3MFHA 1VQMS 1S9GB 3CCSS 3PO4A 3M1VB 3HSGA 5CHCB 2DXDA 2K3IA 4DV6J 3C16A 1PBUA 4WKYA 5L9NA 1D8YA 3M30B 2HPUA 4OYIA 2XY5A 2KTQA 1A7GE 5DRKA 1LK5A 2HRUA 4DSJA 1T05B 2GVDA 4FYYB 5L1JA 5HVHA 1RKJA 2MKYA 4M5MA 1GMWA 1FE4A 1N48A 3NNCA 4ZPAA 3TR5A 2LCWA 4DV1F 2N4DA 3NG8A 1IBLJ 1I3OB 3UPFA 4QPTA 3FSYA 1S5ZA 1U48A 4OZLA 2HBQB 3K7RA 5BYRA 3BKTA 4KPCA 2BQRA 4QR2A 4L74A 4P7VA 2IRYA 1UEUA 3CO0P 2EC0A 2V4RA 2B4VA 4RNHA 3PIOQ 1VBKA 3TJ9A 4B9MA 4ED6A 4QW9A 2GO8A 1VYAA 4JI4F 1KQKA 2VQEJ 4GKKF 3DRPA 5KFVA 1S1XA 1VDHA 4CLTA 2G2OA 4AD6A 3CDUA 4G65A 1NB7A 1HWKA 2BACA 3NS5A 2G0CA 3KLIA 2R2TA 3DRXA 1W2BR 3DLLQ 2M9KA 5F8LA 1PJ7A 3J7YU 1N33F 4ZJOA 1VMBA 3KHGA 1SI9A 1WWHA 3D0GE 2HBYB 4OI2A 3FBEA 4YR2A 2YWHA 3GONA 5C24B 2FLPA 1SV5A 8ATCB 3MCMA 2UUTA 3FEZA 2HS0A 1KOHA 4B3OA 3HLUA 2M8HA 2KI2A 1W26A 1PC5A 1S1VB 4LF5J 3AOBA 1Z4UA 2V69A 2C1EB 1JLBB 3L9ZA 2IY5B 2Y8WA 2RHSB 5IQQA 1T3OA 4M5DB 1X9SA 2R7TA 2W9CA 4WYWA 3D1HA 2JC1A 3RRKA 1S72S 5GMKa 1H6KX 1DTTB 1WSRA 4KQZA 1H2TZ 2ZWPA 2HVIA 3JQMA 4WK1A 1DAXA 4K50A 4PUOB 4LBPA 3K5PA 3DRSB 2GJFA 4G1PA 2VFVA 1JLGA 3UN2A 1U2FA 2HVDA 3MR2A 5F3TA 1C1CA 4O3RA 2C2OB 2P9EA 1ZAVA 1NHVA 3ET6A 3N79A 2MQQA 3MMBA 3HI9A 3ICLA 5LT5A 2HWHA 3D0IE 3K5OA 1FO1A 2HS3A 5C5JA 4PCQA 5DGAA 3LAMA 1RACB 1P8GA 4C2MA 5LXRA 1M5PC 5KT7A 2LQBA 3DDNA 2W8LA 4HACB 1L3UA 1LFWA 4XPEA 1TV6A 4PXBA 1SJ1A 3PY8A 5EWEA 3G8SA 3A3NB 4J9PA 3M6XA 4EI2A 4DX6A 4NLYA 2DGXA 3DGPB 1X8DA 3CUNA 2ZE2B 1K8AT 1SH0A 1JLQB 4BC9A 1VQKS 4TY9A 4YP3A 1IKWB 2J9EA 2UXBF 3ZZUA 2R7SA 1JLEA 1N36J 5L9XA 3NNHA 2CPXA 4UOCA 3KK2A 2QMWA 2IIHA 1N6QB 1S4EA 2V8VA 2LXUA 3UE2A 4TU9A 4M95A 2ZH7A 1WELA 2J7WA 3DCAA 4C8KA 3FBBA 1DLOB 3BSOA 1BE4A 4AL7A 2WVFA 2GAGC 3U27A 5DO2A 1LW0A 4WF9Q 5E3AA 2IBOA 3M32B 2CADA 4DWIA 4A8MP 4OHYA 3ILIA 6FDRA 4KV8A 2WBRA 4F4YA 3RBXA 2VJUA 3N0VA 1IBCB 3MHYA 4IQMA 2AEJA 5CD4A 4B9UA 1X4CA 4PXDA 2XHWA 4X4TA 1SKWA 4I64A 2HFUA 1NBEB 1OYEA 5DZ7A 4YDXA 2BQUA 3UR0A 3BR9A 4QYZJ 4IG3A 3EX7B 4ERDA 2FHKA 1HBMA 2OFHX 2DHHA 2XEXA 4EBCA 3LTOA 3LWMA 1ULRA 1ZZNA 3LP2A 2MKHA 3NCPA 3BSCA 4RBUA 3UN3A 2J9DA 1TK5A 2YNIB 4F04B 2O1PA 1LW2A 4YHHF 1IR1A 3SQOP 2EG2A 2G1HA 5I42A 1RUSA 2J7KA 3OFFA 1KONA 3RJMB 5LSLA 3MZIA 2CUYA 3TAMA 2ZJRQ 3FFIB 4WXOA 5IT9U 1KFSA 5KFBA 4ECWA 3EJMA 1YJTA 3IA0A 2B6AA 4DR6J 3NS7B 3C6TA 1Y9OA 2XLJA 4B3RJ 1YG0A 1RWUA 1BWVA 3J7AN 3D6FB 4C11A 1F60B 1HFEL 3OQ2A 5G0RB 1VI7A 1EKRA 1RTDA 5K5MA 1NDPA 3OBIA 1HNVA 1FFSB 5K14B 3T5KA 3TANA 2H3EB 3U1MA 1KNZA 2Z57B 2AKWB 3RGIA 3N6NA 2ZBIA 3US5A 3KHRA 1VQ5S 2DGVA 1FNMA 3MCSA 2X1FA 2E9TA 4HI2A 2DRDA 3AB2B 3UDCA 1NHUA 4F4XA 4PQUA 1NKBA 3CMAS 1SCJB 2CNNB 2ZUGA 3QJPA 3H42A 4DF4A 1X4GA 4DL2A 3BH6B 3H0PA 2F63A 2KT2A 3BDEA 1RISA 3CJ8A 2FHJA 3DI6B 4C0BA 5A8KA 3W66A 3A8EA 1TL3B 3IC1A 4WWSA 4HH1A 2J8AA 4J9UE 3TEGA 3NMRA 9RUBA 4H4MB 3OTOJ 1YZ7A 4X66J 2AJ1A 1NJIT 3F44A 1C1BB 4U7UK 3CGIA 5FDLA 2R7OA 4UQGA 2DNOA 4DR5F 4R8UA 1B0VA 2VJVA 4OX6A 2N7YA 5AE1A 1K1QA 2FLLA 2XS7A 3M9OB 3QWPA 2OI2A 3SXLA 5KFMA 4GRSA 3TA0A 2ACYA 4ZN1A 1NPPA 2Y1RI 3OR2B 1FHTA 1JLAA 4NCBA 1AW0A 2UUAF 5J1EB 3D2WA 5L1KA 3R7SB 2LEAA 3RBEA 2EFOA 3DRYA 2BDPA 4DUYF 2AJQA 3FBFA 3KLGB 1S1TB 5LXYA 2R7RA 3RUBL 2MXYA 3JAMU 3O44A 4IH6A 4L73A 3D6HB 1LWXA 4ZPWR 4W98A 4JYAJ 4USVA 4ES2A 3GV7B 4NCAA 5J2PA 2DNNA 3FCVA 2UXDJ 3EZOA 5I3QA 4J9NA 5JVHQ 3PFEA 1XN9A 2V4JB 3GIJA 3E8OA 2VKRA 2RRBA 2KB2A 4P72A 3K89A 5A0YB 2BW7A 1PYOB 2Q79A 4HT5A 3P96A 1G3OA 3Q24A 2ZD1B 4CRJA 1HHQA 2ALYB 3D68A 2I0XA 4WZMA 2HIYA 1KVIA 2JVRA 3P8BB 1F1BB 3QIDA 2DNMA 2WVCA 5KFCA 3CT9A 1Q86T 3AA8A 1TUGB 4Q0BA 1LFPA 2VZ9A 3NKYA 2Y1IA 3HF5A 1UWBB 3L09A 1HBOB 1MG7A 1YJVA 4ILRA 3KLVA 1Y4ZB 2HNYA 3MXHP 4LFAF 4PG5A 4CLSA 3RB4A 2DYAA 2HNZA 4LSZB 2WSFC 4TQSA 4RBTA 2HHXA 1TVRB 4M63A 2UXCF 2ZJPQ 1UEVA 3QZ8A 1U0SA 4LJMA 1NXIA 3VR1A 2QE5A 1RAJA 2FDNA 3PR5B 4UQTA 4AQYJ 2DR6A 1TUVA 1BQNB 2VBYA 1AFJA 2AJFE 3CJTA 3ENWA 4KJIA 2BUNA 4IFVA 3TNVA 4F67A 1N0VC 2R7VA 1HI8A 4X64F 2W4DA 2VFUA 3QMQA 1K1SA 3T41A 2CQ1A 2OFGX 2NPIA 1NK9A 3OVAA 1ZPWX 3SIPB 2P9CA 2YKMB 2Y0SD 2A18A 4A46A 4X4SA 2CQHA 3OR1B 4QCLA 1V3SA 2DHSA 3WHIA 1HYSA 4LVOP 1L3SA 2CPEA 2VODA 4F02A 5DGBA 3OL7A 1FKPA 4OZ3A 1N52B 2CAJA 1IVZA 3GFYA 1D9AA 3DXSX 4U8VA 5SUHA 2QL7B 1EIYB 3Q8VA 2DO0A 1CG2A 4F25A 1YZ6A 4A8SA 2XHCA 4F2RA 3CCES 1HW8A 1R3NA 2E44A 4EZ9A 2NXEA 4GMKA 2R3VA 2ZWOA 1UPPA 2DH7A 1GAOA 5KFZA 1QAYA 2AEFA 1REVB 1NNDA 1O5JA 3M7VA 5HLFB 1L3TA 4XK8C 1PAUB 4RW4A 2ZHOA 3SDEB 3WQPA 1WC5A 2CPYA 3IAS9 3T1YJ 4DN0A 5HQ8A 4CTAB 4DU8A 4F4KA 1RBAA 2ZBQA 3M2RB 4JI5J 1Q4RA 2BJ3A 3C14A 4RR5A 3P49B 4F26A 5SZTA 4LBHA 2B43A 3U1LA 3NAHA 1C4AA 1FESA 4MYUA 2LECA 3ENVA 4GC6A 3QJJA 2HURA 2BRLA 2ZC3A 3DXBA 2FJBB 1R0CB 4ZVSB 2RE1A 4U95A 2F4VJ 4A8QA 3DHWC 4C98A 4QQBA 4X4PA 2E29A 5EX0A 3HZEA 5IT0A 1WKLA 4JI3J 3J80Y 3E2EA 2OLWA 2QL9B 2JVOA 3MECB 1RCXB 2KFZA 1FKOA 1RT3A 5C42B 5GADI 3GZ7A 2QO3A 1UEKA 1F6TA 1UAWA 4KHPF 3VHQA 1ZM4A 1FK9B 1UA1A 4ILLA 2IM0A 3KOAA 3MTKA 1OSDA 4WYLA 2XG8A 1UP1A 3FZ2A 4JV0A 3S7RA 1NSPA 1WC3A 3AJDA 2WSEC 3HULA 1SC6A 1XIQA 5KT4A 4K0KJ 1URNA 2AJ0A 4ICLA 5FIIA 1HNIB 4OHVA 1TL4A 2Z2MA 1CJKA 4WU3A 2UU9J 2E1RA 3TO8A 3G71S 3V81A 1QM9A 3R27A 1FRJA 2UUBJ 4OL8A 3K59A 1S6OA 3MM8A 1ZTTA 1SJ4P 1E6VA 3FNNA 5T14A 2VQEF 2J8SA 1EB0A 4OMFG 1LWFB 2J6SA 2QYCA 5D0GA 4I7FA 1SKRA 1WEYA 2R8KA 2H5JB 3NGKA 2OEKA 5DDQC 1QY7A 2IRUA 5ETVA 4RO0A 1X4HA 2XMTA 3V6HA 1DJ0A 3MM5B 3IBFB 4H4KC 2VFSA 4ATNA 1RP5A 4DL3A 1GH8A 4K4SA 3MMAA 2WBMA 3HSDA 5C2CA 5KFHA 3D28A 4ID8A 5B0CA 1FJ7A 4O23A 3HK2A 5KFQA 3FCWA 4JI6J 4DX8H 4CM0A 4ZK7M 3MDFA 4JI1J 3D3CJ 2ZKTA 4TKTA 5B7WA 4M5DA 3BH7B 2HHHJ 2H65B 2HS4A 4J9RA 4W4MA 1W25A 1VR6A 5DQHA 1DTTA 4OZ2A 1V5VA 5IFMA 5A76A 2DNHA 4J9SA 4C3KA 2XSFA 1QAXA 1G6BA 2BJEA 4NASA 2RUGA 4DL6A 1F3FA 1X9MA 1N5YB 2N7CA 5D3GB 2RSQA 3KLEB 3PXGa 1RU1A 1VQ9S 2MZTA 4ANEA 2DISA 2AV5A 3C66A 1EQMA 1IBMF 3Q83A 3I5CA 5T41A 3OLBA 2AGQA 3PW2A 2B8QA 3R8YA 5BJRA 2RDIA 3OJUA 4UOHA 5KG1A 4USHA 4NI2B 4LF1A 5IV3A 3D9BA 3FQKA 5H1SV 1XR6A 3M6WA 2I5JB 3N6MA 5GAHI 4YB5A 2GMJA 3CDBA 4P52A 1U47A 3DRRB 2WK4A 4JBCA 3R5JB 2E5JA 4I0WA 5J2MB 2P2CB 2QA4S 3GU0A 4X62J 3F73A 3ADAC 1KVKA 2JEJA 4OZNA 1O51A 3PYFA 4KFBA 1YGYA 3HHLC 4C6AA 4AUKA 3MR5A 3Q8PB 3TUPA 2DVIA 1XNQJ 4ZJLA 2FJVA 4NWBA 3K58A 2IC3A 2A6OA 1N36F 3ZZ0A 4H54A 5BXIA 2NPFA 2XNRA 3ITHA 5HBMA 1NK8A 4FN5A 2XMUA 3ZTQA 4WE1B 1RTHA 3TEHB 4R5PB 5AXMA 4C4WA 2CG8A 4LRCA 5KG4A 4WFBQ 1LWCB 1KR4A 1XMBA 3M32A 4G1QA 3BSNA 3W60A 2ZNZA 1U6ZA 3OTEA 3A3OB 4UOFA 3I0RA 2ILZA 3UCZP 4DR2J 1TL1B 4QWBA 2QGFB 5K20B 1QUPA 5CH7B 4ECRA 3QT6A 1Y10A 4ECQA 2V8DA 1R6VA 3VVUA 4RWXA 1VLYA 3UD5A 3OVSA 1PILA 3MOZA 1V3RA 2ZDOA 1FXLA 4CP5A 2ZH5A 4NLUA 3CCMS 2VBXA 4BS2A 1MMNA 1YJ9S 1N54B 4DPYA 3JTOA 1MSWD 3GSDA 2MSTA 4DU7A 4M94A 4OV6A 4ZHRB 3SV3A 1PG5B 2UUCF 3V6DB 5A6PA 1X0PA 2AMCB 4NXNF 5HVFA 2MQOA 1WOPA 4KHRA 3RZAA 5CCMA 2XULA 3G8QA 1DQ8A 2XMMA 3D7SB 3FFIA 1NZAA 1T8EA 5HMYA 1G7CB 4FXVA 4I2QB 4YR3A 2V8PA 3U1NA 1Q1KA 4B9SA 4YEAA 4YB7A 3AODA 4B3RF 2KJWA 1CS4A 1HL6A 3NY0A 2BRKA 3P5TL 1HBNB 3WC2A 3R5DA 2YX7A 4OJHA 4QIFA 5J1PA 2B9YA 4LQ9A 2WB1D 5DM6Q 2XCAA 3CJ0A 2R7XA 2FB0A 2CDQA 1S59A 5T7LA 2HQFA 1R0AB 1CJUB 2Y8YA 2YH1A 2C3PA 2C2KB 4PABA 5F0WA 3QRPA 4UY8T 1NPKA 1CULB 2I38A 3AH6A 3W2VB 2QA4G 2QLJB 1RT1B 3QSIA 3A8IA 1GEHA 3A8KA 2B4UA 1RLDA 2CVIA 3SSQA 5KFXA 4E2FB 3DC2A 2EI5A 5JJBA 4OFZA 3Q89A 2EW9A 1S57A 3P6YC 3MTJA 3QGHA 1RAFB 1SUQA 2WW8A 3CCTA 2OAUA 2JLEA 4QW8A 3MEDB 1TMJA 2ZKUA 2EFPA 4J9MA 3VGUA 4FYXB 4MMOA 1VGYA 1NDCA 1T0TV 3PNIA 3S8SA 4KC5A 2XMAA 2MQPA 3C6UB 3M8WA 1C1BA 4NLPA 2XMKA 1H0HB 5IM0A 3WC0A 1WF0A 3ENQA 3W61A 3WX4A 2VIHA 4KO0B 3G86A 5EN1A 3OT9A 2E1MC 1VLOA 2RVJA 5LMNJ 3T5LA 2ZZNA 5B09A 4FNIA 4ZPCA 3HHLD 4RW7B 4OIXA 3BGFA 1N5TA 3CJKB 2KXFA 4ZIVA 5LOQA 3HSJA 1U1PA 3CJ4A 2NUUG 3DKDA 3D67A 2HLUA 2G0JA 2GFFA 3UVJA 4CIOA 4CZCA 3FGVA 2FY8A 3TZWA 5AJ3F 3I0SB 1QTNB 3O1LA 3C16B 1GMVA 1V9OA 4NLXA 2AGPA 4HH0A 5IQ6A 3N5BA 3V4IA 4DUTA 3NNAA 4MKVA 2GVDB 2V4JA 3G82A 1MLAA 2YKOA 4V1Ak 2XWXA 4DL4A 3IMQJ 4BWJA 1R43A 1QE1B 3OSNA 4DV1J 4IH7A 4C3MA 3BGOP 3B4MA 4ETZA 1OQ3A 3CVKA 1S76D 5CYJA 1MWZA 4NMXA 2GHVC 2H1YA 3KLFA 5IS2A 2Y0BB 5HQLA 4Q8EA 4C48A 3GYNA 2HVEA 2W1BA 3EE3A 3QFWA 2FVCA 2M8DB 1V3ZA 1U1KA 2FJWA 2JDJA 4U8YA 3J7YI 1XR5A 2A1BA 3MUTP 3SYZA 3DRPB 2BOPA 1X4EA 1L5UA 4JI4J 1KTVA 1TVRA 1S1XB 5CD4H 4GKKJ 3W63A 4ED1A 3ULHA 4HR2A 5LSRA 2MZ1A 2IHR1 4RU9A 5MAOA 3QGGA 3SCIE 1BLUA 1RWOB 1G1XA 3KLIB 4WFXA 3EVOA 1PJ5A 1SH2A 1WG4A 3UD4P 1UVJA 5M2UA 4MKBA 4C7QA 1N33J 5IC6B 4K2XA 2Q6BA 1WNEA 3L3CA 2YKMA 1SV5B 2B9EA 2DK2A 3IFEA 4B3OB 1RAHB 4ECXA 4R25A 1NJXA 2XMJA 4J9KA 1BUXA 2M88A 1T94A 4Z7CA 1QD1A 3ZXWA 3IRXA 2MGZB 3MD1A 3SCKE 5L1LA 2CNOB 2HG4A 3LUYA 1PBAA 1M1KT 1NEEA 2HRYA 2KHCA 4W92B 3LH2S 1ROFA 4WJBA 2FYXA 1HNZF 1U1LA 4QIWD 1N32F 3BYRA 1CC8A 1R8PA 4UUXA 4AL6A 3ISNC 4NRTA 4C8LA 2V94A 1FX4A 2GQQA 3AQOA 1YK9A 4F4ZA 1P9QC 4M5KA 5KFSA 4C97A 1JLGB 3GIKA 4O44B 2LDIA 2C3OA 3CC4S 1C1CB 4NRUA 4K2JA 3BN4A 3SZ2A 4W90B 1IQZA 3GPAA 1JLFA 1REVA 1YWXA 1U4BA 4PWDA 3ET6B 2M2BA 3MMBB 4FBTA 4TU8A 3C19A 5KFTA 2ZH2A 1EX8A 2RQKA 1C4CA 3N28A 4ED4A 5DETA 1S1UB 5KFWA 4CTAA 2XYPB 3AJ1A 3AOCA 1VJWA 1DQAA 1UVIA 1Q8KA 3W64A 4OYOA 2FVQA 5M2PA 4TLQA 1TV6B 2CG4A 3GV5B 3SFUA 2IM1A 7FDRA 4Z7YA 1FTRA 2QIFA 1ITPA 1N88A 5CZVA 3CJSA 1N8RT 1NJZA 3T9NA 2A2DA 4BCAA 1Y00A 2EKNA 4B02A 3GQCA 1DHMA 2ACMA 3MR6A 5JUMA 4M5IA 2EFQA 3G87A 3FKBA 1JJ4A 1NCLA 3H20A 2OPPA 2VASA 8RUCA 3PEJA 1FWPA 3MECA 2UXBJ 4M5JA 3WZ0A 3KHHA 4B9TA 3W7BA 3JYTA 1JXEA 1FJCA 3KK2B 3TAPA 5KFRA 6AT1B 1HW9A 1FRLA 2D9PA 4DPOA 4ZA1A 1VJQA 5EWFA 4ED3A 3RR8A 2NSBA 2BE2A 1S99A 3IAM9 1B0TA 2MPUA 4KV8B 3CCZA 5HVGA 4WTOB 4USKA 2E5GA 1R8HA 2OIHA 5ETMA 3H7HB 2RNEA 4MIAA 1J27A 4CO4A 2WAQD 3PR4A 1LWEB 2YNHA 3M6VA 2COLA 2P5VA 2KYZA 3HHNB 4OJ3A 5GAEU 4IG3B 4G1IA 2HAIA 4LVNP 4TN2A 4J90A 5CYMA 2BMBA 1N34F 3DGVA 2YY3A 3E01A 1UFLA 4ITSA 5C25A 3SSSA 1I6JA 2L3MA 3NAIA 2E1PA 1N5QA 1T02A 1UVNA 1Q5YA 4P71A 1RTJA 1B4SA 4LSLA 4YHHJ 1JKHB 4DL7A 2N82B 5KT5A 3B6BA 4HDGA 1Y0HA 2YX1A 5D4NA 2GJIA 3TUIC 1S97A 1GXLA 3MD3A 2I2YA 1PYTA 3N4WA 3OXLA 2NXNA 2MKSA 4KYZA 2B6AB 4PWUA 2K2PA 4LREA 3C6TB 2XMVA 4C11B 4IYQA 1JJ2R 1RB0A 5ITHA 4DV7F 2DHAA 3QATA 1RTDB 1J2VA 3M8SA 3PRBA 3GIMA 3HCXA 2Q6CA 3GSIA 4N76A 1HNVB 2XI3A 3MI7X 4O3OA 2IJNA 5HK4A 4V19X 4P74A 5ETPA 4DSLA 2Y9HA 4JI6F 3BQ2A 5HJYA 2Y1JA 3CCUS 3PJXA 1VQ8S 4TXSA 3HJVA 2YBVA 3ISND 3RYLA 4I2PA 2OEMA 2VPXB 2HHHF 3HVAA 4OQJA 2CJKA 4PQUB 3ZC4A 2BEFA 3TW0A 4CM2A 2FZCB 2CA9A 2RS8A 2V2VA 1BHNA 2ZBRA 4OHXA 1FF2A 3NOCA 3TVZA 2WOMA 1KDNA 3UDLA 1Q16B 3H2LA 2VA2A 4C8MA 3OHBA 2H4YB 2BKOA 3LP1A 4G6VB 4BC7A 1JWWA 2QV6A 2QX0A 5DM7Q 5ETLA 2U1AA 3AJ2A 3L95X 4DI6A 4ECUA 2UP1A 3W1YC 5KFAA 3OD2A 5L1IA 3M6UA 3A4TA 1XQIA 2G0IA 1TK8A 4K5RA 2GIQA 4ZVQB 2ROGA 2M52A 1U45A 2LKZA 2YNGA 2AX0A 4X2BA 4QU6A 3OPKA 2KXHA 1CEZA 2FGOA 3BB5A 5DDRC 1PCAA 2RDJA 4N8OA 2I5JA 2CQBA 3M9NB 2E1AA 5KG5A 1SL0A 3K57A 2X1BA 2KU7A 5AE3A 2VC0A 3T19A 4LF7F 1FJEB 1RJJA 2QSFA 2R8GA 1Q81T 2F3JA 2UUAJ 2XBPA 1DZ5A 3NGUA 4X4UA 4DUYJ 4NA1A 3R9LA 3NCRA 3A3PB 1GTHA 4CI0B 4O4RA 1RTIB 1FEHA 2E7VA 1BQMA 3SMZA 4RX6A 1VIXA 3EMTA 5J2PB 1FRHA 2HHWA 3MM6A 4Q45A 4H4KA 2ZOMA 4OYAA 4XTTA 5HL7Q 4HI1A 3M2UA 2Z58B 4OI4A 1SQFA 3GG1A 4TLRA 5F8NA 2YPYA 4HL9A 5L39A 3EYZA 3CD5A 2DBBA 2AYMA 4XDCA 2OGUA 4GC7A 1VQLS 3TARA 3PVXA 1FT8A 2XYHB 1AUSL 4RUBA 2RKIB 2V67A 2APOA 4USMA 2Z56B 3BO2A 2XSJA 3VQSA 2B4OA 2P6SA 2VG7A 4Q0BB 3TUZC 1WTBA 1QVGR 1HBUA 2FJEB 3L4BC 2DGQA 2HNYB 4N8NA 4IR9A 5F8MA 1CVJA 4A8XA 4CLZA 2HNZB 4KKOA 1RAOA 4LFAJ 1EZZB 1IR0A 1WC6A 3B54A 1NMEB 2YKPA 3DLGA 2UXCJ 3VF0B 4P9SA 3NBPB 2VQFF 2GW8A 2GQ2A 2UVWA 2YQ0A 4M5GA 1WG5A 4IFVB 1VQ6S 3POTA 3IN5A 3TI0A 1SJQA 2XO6A 2VV5A 4RW9A 2KZZA 1I5OB 7AT1B 1Q5VA 5E41A 1EP4A 5KFFA 3V6DA 4X64J 1RAAB 4F3OA 3GTYX 2GIFA 1RT2B 3QBCA 2DHGA 1APSA 1KS2A 5AXKA 4IKAA 4J37A 4JUZA 3K2YA 1QUVA 1UPMB 2G4BA 1B7FA 1HYSB 2XYGB 4U7UD 2PEHA 5A6WA 3UCGA 3C8YA 1L3KA 4PG4A 2BJ7A 2LQ9A 1C2PA 3BQ0A 4NLQA 1FKPB 1LNQA 4NE9C 4B08A 3HHLA 2Q3PA 4QWCA 1YSJA 4LR9A 4DF8A 3NGDA 1Y5NB 3M05A 4AYBD 1R0AA 4B9NA 2CQPA 4LF9F 3IWNC 3R3TA 5D6GA 2QL5B 3G6XA 4YOEA 2PC6A 2XC9A 2FQQB 5JMNA 4MAKA 1ZTWA 5ETTA 2ZM6F 1NLKL 3MUMP 3AD9C 1X60A 2L9DA 1QSYA 2A3JA 3BBBA 3DYAA 4RW4B 3GCWP 4KTQA 3OL8A 2BQ3A 4PRFA 1UZDA 2W4CA 1X7VA 3IWLA 3MEDA 1HWIA 1W2IA 3ZNUA 3B4DA 2VUGA 1VOMA 3C14B 2CQIA 3PCOB 1RA7A 2V0NA 1IBKF 3N01A 2K7JA 4X4OA 4J91A 3DOLB 1KHVA 2ZVSA 4ZP9A 2YKNB 1RBLA 3R6GB 2VDIA 3D0HE 3MEEA 4LF4F 2HHSA 1ZPVA 1ZOTA 4OYWA 1S0NA 1HD1A 4OI3A 3VAGA 1WDDA 1NUEA 2DXEA 4RW7A 4LF6F 1VC6A 4ZLNA 4DV5J 4PPZA 3DDKA 1FX2A 3PX0A 1RWXB 2R8JA 1DARA 2ZOFA 2KT3A 3BGRA 1SKSA 3A8JA 1FKOB 1KTQA 2D3O1 3GIIA 2AQ4A 2HHQA 3I0SA 3QLHA 2KFYA 4X84A 4ZVRB 3AB4B 2C2DA 2EC2A 1FKAF 4KHPJ 2W9BB 3K5LA 2OUGA 3CD7A 1XTZA 4A8WA 5CZXA 4A48A 5A8RA 1OJ4A 2C28A 4NLOA 3HDSA 3TVYA 2ZJQQ 4YY3F 4Q8FA 4DS5A 3G8TA 1KWMA 2CIMA 2GA7A 1S0MA 1QE1A 2KM8C 3JSMB 3RRGA 3HT3A 3BPDA 1S7HA 4ICLB 3VAKA 2KHDA 4DQPA 2DIUA 5F8JA 1R89A 3GP9A 3R97A 4C8ZA 2ZHAA 1CJKB 2W7AA 2MQNA 1XNRF 4MT1A 3V81B 5CQGA 3BSAA 2L48A 2X51A 4NZ0A 1DFDA 5KFKA 4OYMA 2DKOB 3PRVA 3MM8B 3CTRA 3L7UA 5DZ6A 1E6VB 1AZSB 3H98A 2BXJA 2GCFA 3RAMA 1ACMB 4LBIA 1AYEA 1YI2S 2RU3A 5KT2A 3MMJA 4DPXA 1IKVA 3ZTSA 1AA1B 2IYGA 1YVFA 4I7FB 3OV7A 5HANA 2ZOGA 2G2YA 4TVAB 1RT5B 4DQRA 4DV3F 4YDDB 2C2EA 4YN3B 1QVFR 1RSCA 4JI0J 2IBKA 2BM0A 4URSA 1VRTA 3D5MA 3GJTB 3MMAB 4CO2A 4PXEA 2H5EA 4UUWA 2EVZA 2BW2A 4QYZK 3D6MB 4Y2CA 1FDNA 3FEYB 3ZO7A 3AA9A 1QAJA 4CNZA 2OELA 1AB8A 2HZAA 1YHQS 2B5JA 3R6LB 3FRYA 5C2GA 1FRMA 4Y34A 2HLTA 1SIZA 3HFKA 2MGZA 1OY8A 1VQ7S 4UT4A 4WIIA 1UVLA 4I4BA 2FIUA 2OSRA 3CJ2A 3JSYA 1X4BA 4OZ1A 1BXNA 3U7JA 3QFHA 4L3KA 1CSJA 2RQ4A 1F3VA 2K7KA 4PG7A 2DR7A 1OPIA 2UVVA 2DNQA 2CJBA 4O44A 2C42A 5KFOA 3NGRA 2C2MB 3UDEA 3LA0A 4ID5B 4FDFA 1JJCB 2HRTA 3R5AA 3JQJA 2IRXA 4C0OC 1R6YA 1IBMJ 3WBZA 1IUJA 3BS9A 3KK3A 3AQPA 4NYOA 4TNOA 1FEEA 5I3UA 1S1UA 3KUEA 5KFDA 1CQNA 5THWA 3MF5A 4C9DA 3T1HF 4K4YA 3J81Y 4UF4A 1SJ3P 3RAXA 1YRUA 3UR3C 5J2NA 4Y0FA 1JJHA 1WUUA 2DR8A 3C15A 2WCXA 3N6LA 4O0NA 3D6TB 3PO5A 3H25A 4ILMA 2FY1A 1Q7LB 2DNRA 4LRBA 3FBCA 4A4JA 4KFBB 1FDDA 4RUCA 5B0DA 4Q44A 4KE5A 1S6PB 2XS5A 2C3UA 3PX6A 4PEOA 2PMHA 1XC9A 1IJEB 2DHXA 3RG6A 2IC3B 3K5NA 4IRCA 2HFVA 3MM7A 1NB2A 4TQRA 5LMUF 4EMDA 1ZZFA 2E9RX 4OI1A 1S0OA 3DNCA 1ELOA 2XZTB 3ITHB 5HBMB 4IFYA 1RTHB 3WIVA 3QWUA 3PIPQ 4YS2A 4ZP6A 4DQIA 1LOUA 1U6BA 4CLKA 2ATLA 5E3PA 2ASLA 3AXKA 1M5SA 3THTA 2IYIA 3LANA 4G1QB 3SSRA 2MEWA 2HIQA 1RAGB 2OD6A 4F8RA 3I0RB 1TTHB 5A8WA 1QSLA 1FNXH 3MGJA 1VC0A 2E7XA 2EBGA 1RGVA 2BV3A 3UO0A 3RRHA 3TZZA 1LWEA 4ZLPA 1FWLA 4FS2A 2E5HA 4YQWA 3FZBA 1ZAXA 3KKFA 4M8LA 1URRA 3PEHA 2F40A 4H4OA 2L41A 1GX6A 2DY1A 1TELA 1T9YA 5BR8F 1FD8A 4MKAA 3I87A 5KFEA 3KDOA 2ZEJA 3AAWB 4USUA 1T9WA 4CNYA 2GJ2A 3EGWB 1O8BA 2DGUA 2IMOA 1JKHA 2UUCJ 3MPWA 3V2UC 2R2UA 3BN7A 1X4AA 3THPA 4ELTA 2PDAA 9ATCB 2LP4A 4NXNJ 3D3BJ 2RQCA 1IM6A 4QWAA 1HQUA 4ZCLA 1JNZB 1VQNS 4I6WA 4CLYA 2PA8D 4K59A 3UFCX 1YJNS 3W5ZA 1CS4B 2L9NA 3CCVS 4DR7J 3PX4A 3FCHA 1HHTP 2A0FB 4B9LA 1NK0A 5KFYA 1S9FA 1Y11A 2H48B 5T7LB 4I68A 5CABA 2CZVC 4Q5VA 1S6QA 1REGX 2G1DA 3G2XA 1B3TA 1MWQA 4UOGA 3W8GA 1YIJS 1HR0F 4KSEB 4ECSA 1WOOA 1I94F 5FLXY 2M3DA 2VG5A 4C8NA 1PAEX 2CWKA 1RABB 2KL8A 1FERA 2XM3A 3OSPA 2WZ1A 4M1KA 3P45B 2OHDA 4JV2A 1WC4A 4A8OA 1HMVB 2XMWA 5HROA 3VCDA 4QR0A 2EBEA 5B08A 1TL5A 2V2QA 2K06A 1SUQB 4RNNA 4DR4F 3D66A 4ZITA 2HZCA 4JI8F 3H90A 1KQGB 3G6VA 4MK7A 5IT4A 2BJ9A 1EETA 2CPHA 2OMOA 2E5LF 4ZOSA 1XK8A 5IXUA 4NLVA 3FMWA 1P1TA 1TKXA 2C22A 1KP6A 2DB1A 1BGXT 4OI0A 2BBEA 5M2RA 3ETMA 1KD1T 1WHYA 1ZAWA 3KG1A 5IM0B 1IM4A 1CJVA 3DU5A 1L3VA 4HHJA 4C8OA 4DSIA 2VPWB 1N4LA 4ZPTR 3Q0AA 3R7BB 2NXJA 2FHMA 2JFDA 1IJFB 3GIRA 4MTPA 2CPIA 2DNLA 4OX9F 4KB7A 2XB2D 2NYIA 1S0VA 4HT7A 1IWAA 2YWWA 3UVJB 2D3OR 2KH9A 4I69A 1LV5A 2QT7A 3Q8QB 1RTIA 3KJVA 2VOPA 5KFJA 1R8AA 3EXYA 1GNKA 2R7UA 3FSIA 2ASYA 5F9NA 5AJ3J 5E0OA 1JNRB 1JK9B 3V4IB 3NP5A 4NCGB 3W65A 2LEPA 2RQMA 4WK3A 1R0BG 3EPIA 4ZPDA 2RHQB 2V8HA 3G82B 4QJVA 2RRAA 2OTJS 2ERRA 4XAKA 3DLKA 4DQQA 3WDOA 2LMIA 3FJ2A 3OW2R 1YJUA 4RPFA 2DGOA 2CXEA 1HNWJ 4ZDNA 1TR0A 2HAFA 5E33A 4YB1P 2H51B 1V6HA 2AWZA 2VU5A 2RKIA 5B0GA 4DLEA 1XERA 3R5CA 3KLFB 4IO1A 5C7PA 4I1TA 4FP9A 1YBAA 4HVZA 2YWEA 5H9EK 1DRZA 5E3CA 3CEDA 2EK6A 4GKJF 2FHJD 1RLCL 3I55S 2LVWA 2CJYB 3I32A 4EO6A 1DTQA 2BVZA 2MJNA 5ETNA 5IWAF 4HHUA 3CDAA 2PI4A 2GMHA 1U24A 3QGPA 1YLXA 3D1QA 4KHMA 3NMAA 4DFMA 3K17A 3NBPA 2GVZA 4CWBA 4EO8A 1IWGA 3CDWA 1GFWB 2LEBA 3G96A 2YNFA 5EHHA 3CB4A 3VALA 4RKUC 2MJUA 1S79A 2Z0GA 3O8WA 3HD2A 3CJRA 3LF0A 4USWA 1U1QA 4J9LA 1NK4A 2WB4A 1N56A 5EX3A 4E8UA 4OHWA 3KDNA 1D1UA 4RZRA 2MKCA 1RT2A 4NPOA 4JV1A 3HKWA 5K8PA 2HHTA 5G4DA 5KAKA 2LQ8A 2P9GA 3IR5B 2WSCC 2A2CA 1F2GA 4URQU 2LYVA 3L7PA 3IRXB 1TU0B 3MUVP 1ZM2A 4DOZA 1WF1A 2QLBB 2HHVA 2DR9A 3JXOA 1VS3A 3GR0A 4S0MA 4ZP8A 2ADCA 2CPZA 3A1YG 2IFXA 2GX8A 3OTDA 3PKYA 2RILA 3UNGC 3K8WA 1HNZJ 3DOKA 2AX1A 1N32J 3W8PA 3HVRA 3GR1A 4CLFA 1B70B 4DV2F 5CCLA 4K4UA 4O3PA 2RB7A 1XEZA 2CRLA 5DQIA 3N5FA 2KFNA 1JLFB 4RNFA 5D15A 4LR7A 4PWDB 3H4BA 3CCWA 4F7VA 5D4OA 4DQSA 2W01A 1GXUA 4EK2A 3IR6B 4QOTA 4EWTA 4NA3A 1LEOA 1K0VA 2EFNA 4MK8A 3RW7A 3M9MB 4A8KA 3EGVA 2YWKA 2YKAA 3MEGA 2DTJA 3I9ZA 2UVRA 3HFZB 4IOCQ 3R7NB 4PG8A 3QIPA 2LXIA 1NK5A 2WVBA 1U25A 4RWWA 3DOLA 1HNXF 3M8ZA 3PZPA 2DH9A 2K3KA 2YKNA 3A12A 4ETXA 1MROA 4AE5A 2V9WA 3QO9A 1SC1B 2E5IA 2N3LA 3VV2B 1EARA 3Q22A 4DV5F 1RT6A 2OPPB 4QIVA 1HARA 2OPQA 3TZYA 3DHXA 1AXQA 1G2EA 3S01A 1SH3A 4FYDA 1FA0A 5KFNA 2GNKA 2BJDA 1LKZA 5I3PA 4B3SF 3JYTB 3TAQA 2AJ2A 2RMLA 5FD1A 2QLWA 1OIAA 2LDYA 3TVKA 3FRZA 3PW4A 1X0FA 2W7OA 4JI7F 4M5NA 2Z4PA 2LA6A 5GAEI 2MZRA 3CE8A 2BE2B 4KGVB 2W4PA 2W9BA 2HZVA 5D0RA 4DDFA 2HEKA 4OZ5A 1QTMA 1M90T 3FEXB 2QFIA 1NHKL 4RNMA 4LSNA 2HMIA 4HYKA 2HQDA 1VCTA 3DLEA 4IR1A 2AP6A 2B9XA 4PKDB 2YNHB 4ZVUB 3JSMA 4NZ7A 3CNQP 4Q7AA 4PG6A 3I96A 1CJTA 4HEA9 3CF5Q 4L75A 4ZVFA 3SEOA 2C2RA 1U1MA 3LAKA 1P9YA 1HWUA 4C0HA 4GO7X 1UA0A 5CYMB 2OSQA 1TKZB 5DG7A 2DRBA 4EBEA 3IBWA 1ZA2B 2XS2A 3E01B 2Y3YA 1N34J 1UVKA 5C25B 2V4QA 4YFUA 2BANA 2AW0A 1AZSA 2UV8G 2FD2A 1RTJB 2BOAA 5F0UA 3QT8A 4LSLB 4ENOA 4OX7A 5EGYA 3ILJA 1FDAA 1JXLA 3V4MA 2C2ZB 4ER8A 4DN9A 3QRQA 2BE9B 2FJXA 1H7WA 3B82A 3MM9A 1TAUA 4ED7A 1RT5A 5JVGQ 2DIVA 1RQ0A 4ZS6A 4JI0F 1HIYA 4R0EA 2FJDB 3NRBA 4M5LA 4X65J 4FXWA 5HATA 2QFJA 2HKEA 3EICA 4P2FA 1UETA 4Y2IA 4F0KA 3KWMA 5J2QA 1SJRA 1U49A 1K47A 1WC0A 2QN6B 2XGQA 2GO9A 2BABA 3F41A 1TL7B 5HP1A 1TFWA 2HGMA 4DV7J 2JEFA 1Y5LB 2CPFA 2HK2A 2J0XA 3IM8A 1QAIA 3FQLA 3Q2SC 4F0HA 3VGSA 3CSKA 4ZKAA 3R2DJ 5KFPA 2VB6A 4NXMF 1DQ9A 4ZVPB 3HP6A 5CA5A 5HSPA 3H59A 4DMZA 4IQXA 4I2PB 2JRSA 3C46A 1KRPA 3SI8A 2GAHC 3NGSA 3HM9A 3JTNA 1NH8A 1XMQF 5DQGA 2MB0B 3TX0A 2D1CA 3BPSP 2WOMB 3HO1A 3HHKA 2A6MA 4Y2KA 4F3QA 1R31A 3R5GA 2CQ0A 1KQFB 1PJ6A 3LP1B 2PIIA 5IOLA 1YQHA 2QC3A 1T3NA 5KG3A 3J81U 1OS5A 1WKKA 3IGNA 3THVA 1NKEA 1RWWB 2P6TA 4KGMA 2KG0A 1UL3A 3T3FA 4NEYA 3OUYA 1YJRA 4HDHA 2GGPA 1J5OA 4N77A 3LPYA 3PM9A 4ID5A 1XMOF 2ZBPA 2CJQA 2CDRB 2YTCA 2E1CA 3GJSB 3EGNA 3QT5A 4OJ1A 2HGLA 2EKYA 2YNGB 4RL1A 1AT1B 1KLMA 1Q79A 5ETKA 4R0JA 3ZZPA 4K5SA 1OWXA 4CO3A 1F0XA 3G9CA 2RF2A 2C3MA 5L46A 2ZNYA 4RBVA 3DU6A 3MR3A 2HFSA 3MEKA 1KHWA 1FFWB 4O4GB 2KG1A 1O6XA 1WDTA 3GG0A 2HYIB 1U0HA 3I5AA 5E2QA 2ILYA 2HHUA 4Y3CA 1NAQA 4ZVTB 2VONA 2CJ9A 4LF7J 2JEIA 2CPJA 4WXWA 1VHFA 4FKXA 3HFVA 2B56A 3CMQA 4KT0C 5CYQA 3IS9A 1D3WA 1Q8BA 4FXDA 1BQMB 2NCKL 1S6PA 3RB3A 4IG0A 3IG1A 1QSSA 3PYGA 1KC8T 1TFYA 4DJBA 3NLCA 3MM6B 4FPIA 3KMSA 2JZ5A 3M2UB 1MWYA 4QR1A 2F8EX 1EJ7L 4CO1A 5LSOA 3H5SA 2QMXA 3BGLA 5IV4A 1YRXA 3M2VA 5KT6A 2AYGA 4DR3J 4L6V3 2Q43A 1RT7A 2DRAA 3J7Z5 2NZCA 4NOHA 4IOAQ 2PGCA 1RI7A 2B0GA 1FJGF 4NLWA 1SB6A 2CZ4A 4ZVHA 3MPDA 3MWBA 1H74A 2VBWA 2XSJB 2J5AA 1FVSA 2VG7B 4OLPA 5A2QY 2DEIA 2GHWA 2CKWA 3MAAA 4B3TF 1SKUB 1F9EB 1M5OC 5LJ3Y 2Y1LB 1HBUB 3HHDA 3QGIA 2NSCA 4MYTA 3BM7A 4ZCMA 2VBZA 2W2MP 3QPIA 4KKOB 2OMLA 1PGZA 3DLGB 4KIAA 2EG1A 4ECYA 3CJ5A 3MPVA 1WI6A 1NDKA 2VH7A 1U26A 1S1WA 2NYHA 2QJ3A 1SL1A 2BJ8A 3HMJG 5U47A 4CH7A 2NZ4A 2VQFJ 1VQYA 1VRUA 3POTB 2MLXA 4RW9B 4WFAQ 1E6YA 4ZCKA 1JLCA 2BKPA 2F7VA 1EP4B 2RU9A 2C3YA 4F2SA 5EWGA 1C0UB 1KQSR 3MOJB 2UVUA 3JTPA 1K44A 2H9ZA 2HFZA 1LQ9A 4DFKA 2VFTA 3KHLA 1HA1A 5FLXU 3K5MA 2D7SA 1WF2A 3BZQA 3T1AA 1RAIB 2ZFHA 4DR7F 4PQAA 1K9MT 1RHMB 2D41A 4F4AA 2DCLA 4QIGA 5KOWA 4O3QA 3HVTA 3MPUB 3PW7A 1Q53A 4B3MF 3LQVA 2E7WA 3LPEA 2HQGA 3HHLB 4RLEA 1TUWA 1FDBA 2RIJA 1RCOB 3SV4A 1RK8A 1SJFA 2DNGA 4A8FA 5HMXA 4FF2A 4ZCIA 4I67A 2VPZB 1MMLA 2XY7A 1YX2A 4LF9J 3VWSA 2D3ZA 3M8PA 2CJXB 5F8HA 3NGTA 1WHXA 4WFZA 2KXNB 4I6AA 3A13A 2KVQE 4JV5F 1I51B 4GO5X 3JSRA 1TP7A 3TOQA 2ZM6J 2K8GA 4HTIA 4N47A 2DY9A 1HMVA 2ZBCA 3DYAB 3G4SS 3VZIA 3FK4A 5BYQA 2DNPA 3ZFVA 3PKMA 2V63A 5K8MA 5DG8A 2ZDPA 2B7CB 1H2UX 2WONA 2AU0A 2WHOA 1VK3A 1XWLA 2Z30B 1IBKJ 2NLWA 2O66A 1VQ4S 2Z2YB 1HQEA 3ILOA 2DPIA 2AYEA 2KRRA 2E66A 3NL0A 4DSKA 2OJ3A 4KAIA 2F4FA 3IP0A 1VBZA 2QMUB 2YXLA 3MEEB 4CLLA 4NYZA 3LGHA 4K4XA 2PEBA 1VIOA 3OXGA 2KJVA 4LF4J 4BHQA 5H9FK 1RZMA 1TZ0A 1H3DA 3IR7B 4BLGA 2F5GA 2XY6A 3I9V9 1O0PA 3FUYA 1RKIA 1FRKA 4NZ6A 4LF6J 4CYUA 1SQGA 5F3ZA 2DNZA 4OZ0A 3AXMA 3BGRB 1Z2LA 4DFPA 4HKQA 1M1HA 5DS7A 2WTFA 2R42A 2QLXA 4UW2A 1JIHA 1T03A 3CO9A 2I9SA 2L08A 4EYHB 3H5YA 5GVQA 3QLHB 4GVBB 2AD9A 1GX5A 2EFVA 2FVRA 1OY6A 1ZM3A 1LK7A 3BO4A 4NCGA 1FXRA 1WHVA 5A8RB 2IVFB 3Q8UA 3X1LB 2J0SD 4K4WA 3DLHA 2ROEA 3LP0B 1WTFA 4YY3J 4ZVEA 4RNOA 1VFJA 2J7UA 5L38A 1KN6A 1YKWA 2MKJA 1HNWF 4YR0A 2J6UA 3KLHB 4JI2F 4DCOB 3JQKA 3W2WA 1PSDA 1Z2ZA 1XNRJ 2K1RA 4J9QA 3R2CJ 4J5OA 4L72B 1A9NB 4M5HA 3MMCA 2PT0A 3SQGA 5HO4A 1UFWA 2ZZMA 1OQ6A 2OD4A 1D8ZA 3RBZA 3CD6S 2G13A 1IKVB 4WFNQ 1H38A 4QWDA 4IO9Q 1NJWA 2H5IB 4WTYA 4DV0F 5GAGU 4WBFA 2V68A 4DV3J 3PTWA 2DPJA 1X31C 1NSAA 3DLJA 4EGLA 5F8GA 4DV4J 1VRTB 4P75A 2P8IA 3C3LA 4AFFA 2V34A 2NS1B 1U1NA 1I1GA 3KTQA 3KNGA 1RWNB 2DD8S 2NREA 1ICEB 2JH3A 5D0HA 4BWMA 5DLGA 2H4WB 3RU0A 2O5DA 5IZHA 4UY85 2B5JB 3S6EA 4PXCA 1BMQB 1MNEA 2J0WA 5BYSA 3HX9A 4NLGA 5B0EA 4DUZF 1P6TA 4FYWB 2AF6A 2FUG9 1HPZA 3Q8SB 4N7TA 1IKXA 1J5EF 4DPWA 1NSKL 1VK8A 3GYGA 2PA3A 2OO4A 2YPZA 2LLZA 5GMEA 4KH1B 5E5NA 5J1NA 4IDKA 4AT1B 1T9TA 1SBRA 3EVMA 4LT6A 2V50A 5B0AA 4K4TA 3FMBA 4RU2A 3F0NA 1OMSA 4FPRA 3TUJC 3ISZA 4DZ6A 2D74B 2MZQA 3W5XA 4ZPVR 3M8QA 2HFNA 2IA6A 2UV8A 5CAAA 3B8HA 2DGSA 4G3IA 3VAMA 3NWRA 2HQ3A 1S6UA 4ZIWA 3KK3B 3PG9A 3R5BA 4MJKA 4FVCA 4O3SA 2VL1A 2IVYA 5I3UB 2X1AA 3J80U 1TKTA 1RWMB 4WP3A 3MCNA 3ZZTA 1M5VC 3T1HJ 3PYDA 3GJQB 3NWGA 4DPUA 3VZHA 4LF8F 1AROP 2G9OA 5J2NB 2LXFA 1YJ7A 4DG1B 1UVMA 2MQMA 3AD7C 4LFCF 3C15B 5D77A 2MQ8A 3KXDA 2KO1A 3HZGA 4DLGA 3O3LA 2X7IA 4A8YA 3DMJB 4DX7A 3N9UC 3GV8B 2D9OA 2IAJA 3HJFA 1MN9A 3LALA 1T7PA 3QNWB 2GC8A 4RUHA 4A47A 1QJHA 1WOSA 2WVEA 3MM7B 2MSSA 4V19J 3TJAA 4D3HA 2IM2A 4U6PA 5LMUJ 2DR5A 1NPRA 3RW6A 4IFYB 2ZH3A 4ECZA 1LXJA 1NSQA 4OHZA 4OYXA 1IR2A 4LQ3A 2D69A 2VG6A 1KKHA 4NLSA 3I56S 4FF4A 3R1HA 1EHWA 5DJBA 4XPCA 2FC8A 5KFIA 2HGNA 2JX2A 3GLJA 5H9EJ 4NLDA 5HAOA 3DM2A 3R1LA 4RW8B 4EZ6A 5KG0A 2FLNA 5A8WB 1UWAA 2VPYB 4IUFA 2JLGA 2ZHBA 2HNDA 4RW6A 3VGVA 3PYEA 4DS4A 2HWIA 4FKYA 1S9GA 2XZDB 3MR7A 1HKAA 4QWEA 5ETSA 4DV6F 2MY8A 1S77D 3M1VA 1WORA 1NK6A 2G2ZA 4CT8A 3I5BA 3KUHA 3K0JA 1B0PA 1BY9A 1D0EA 2XNQA 2CZ9A 3D54A 3M30A 2M5YA 3V6JA 3I31A 1FWKA 4H4OB 1T05A 1TKZA 1AUDA 1WHWA 1S9EB 5BR8J 4MFBB 1IBLF 4ECTA 3FC9A 5I4MA 4BDPA 3J7ZT 1UMJA 2PSZA 1SIWB 2F9JA 4KRWA 3HKZD 5KOXA 2J9DE 4WFYA 2KZMA 2RUSA 4WU2A 2BZ2A 2AJ4A 3NOGA 2PO4A 4ZLJA 1HQUB 1FI4A 4P6QA 4F50A 4X65F 1FTCA 3BV8A 1FCAA 1HI1A 1AFIA 4FS1A 2R9LA 2DGTA 2IDLA 2F8HA 1S12A 2B9WA 1JMTA 1TL7A 3QT7A 1U1OA 1SC4B 3FDSA 4Q43A 2VHGA 1B7YB 1S6QB 4QU7A 2MLYA 2OPRB 3GWCA 3T6BA 4CO0A 5HQMA 3OLAA 1VC5A 5HN0A 1HR0J 1RXOB 2VG5B 1I94J 4ALZA 4AXIA 1S10A 4KPYA 1HI0P 4ZPBA 2XLKA 1F5BA 2VOOA 4HTJA 1F2HA 5C24A 4FF3A 1VQPS 1X4FA 2ASDA 5HROB 1HLWA 3KK1B 5FJ4A 4P10A 2DITA 1RHQB 1BD6A 2KN4A 4LF5F 4OV1A 2JEGA 1HWLA 4ZN3A 4X4NA 1S1VA 4DR4J 2E9ZA 1EETB 1JLBA 3W9JA 4QBUA 4JI8J 4WP9A 1X5TA 1X5SA 2E5LJ 1WKJA 1TKXB 1BC6A 4FF1A 3NCQA 1WC1A 4ED0A 2IMWP 2YQ3A 1ZM9A 1Q8LA 3M8YA 4Z2XA 1M5KC 2AZ1A 3JS9A 1CJVB 4K8RA 3MCOA 1ZH5A 2NXCA 3CXCR 4OYPA 1JB0C 2EK1A 2QEXS 3CWJA 4X4QA 3G6ES 4PUOA 3TP2A 4NYPA 3DRSA 3PRDA 3BKFA 4O4GA 1N0UA 3PW5A 4NLRA 3QSYB 1FRIA 3CC2S 1P27B 2M7SA 3MPYA 4P2XA 1ZYQA 1MN7A 1TQLA 3J7A1 4OX9J 3O5TB 3NXZA 4B9VA 1RT4B 2W24A 2ZZTA 2YH0A 5LJ5Y 2GS8A 2ZC4A 3OFGA 1T11A 3RAQA 1UJ4A 4J9OA 3KJVB 4XIUA 3H40A 5A2QU 3BGUA 4MKYA 2R2RA 2ZH4A 1D9FA 3CD0A 4DZDA 4HACA 4NLTA 1HWJA 2QSWA 1CC7A 2B51A 4E98A 2CYYA 5KTQA 4F36A 7FD1A 2DGWA 4K7QA 1U02A 2I6WA 4DR3F 2CQ4A 3UQSA 2VF3A 3GILA 3ZTOA 3DGPA 1WG1A 2Q66A 8AT1B 1GMUA 3DLKB 2BYCA 4N41A 1W7WA 2ZE2A 5HJXA 1KVJA 1JLQA 2M0GB 3BBFA 3OFEA 4DPTA 2HSEB 1OO0B 1R27B 1Q7YT 1IKYB
chains in the Genus database with same CATH topology
4PCQA 1S79A 1IKWA 3LAMA 5DGAA 1M1KT 2Z0GA 1NEEA 1P8GA 2HRYA 1S48A 2KHCA 2ZH8A 4W92B 4WZQA 3O8WA 4C2MA 2MY7A 3LH2S 1UKUA 3LF0A 5LXRA 1M5PC 1ROFA 1U1QA 4WJBA 4J9LA 5KT7A 1NK4A 2WB4A 1YITS 1HNZF 2LQBA 3DDNA 1U1LA 1N56A 2W8LA 4QIWD 1KSPA 5EX3A 1N32F 3T6JA 4OHWA 4E8UA 4CT9A 1D1UA 4RZRA 2MKCA 1RT2A 1CC8A 1R8PA 4UUXA 4AL6A 1L3UA 3ISNC 4NRTA 4C8LA 1DTQB 2V94A 1LFWA 2GQQA 5KG6A 1TV6A 4XPEA 3AQOA 1N6QA 4PXBA 4NPOA 1P9QC 4F4ZA 4JV1A 1SJ1A 3HKWA 5KFSA 3PY8A 5K8PA 4C97A 5EWEA 1JLGB 3GIKA 4O44B 1KLNA 3G8SA 2HHTA 2LDIA 2C3OA 3CC4S 2CQ2A 4J9PA 3M6XA 3G6YA 5G4DA 1C1CB 4NLYA 4NRUA 5KAKA 2DGXA 3BN4A 5AXNA 2R8IA 3SZ2A 1DLOA 5JXSA 3W3SA 2P9GA 3IR5B 4W90B 2WSCC 2RT3A 4ES3A 1IQZA 1JLFA 2A2CA 3HXMA 1F2GA 1X8DA 1REVA 1YWXA 3MURP 1U4BA 4PWDA 3CUNA 4URQU 2LYVA 2M2BA 2ZE2B 1K8AT 3L7PA 3MMBB 3IRXB 1SH0A 5AE2A 4FBTA 4TU8A 1JLQB 4BC9A 3MAQA 1VQKS 3MUVP 4TY9A 4KR0B 4YP3A 5KFTA 2ZH2A 2YNFB 1ZM2A 4DOZA 1WF1A 4JOUA 4D3GA 2RQKA 2HHVA 2QA1A 2XCPA 4I56A 1C4CA 2DR9A 1VS3A 3N28A 1IXKA 1IKWB 3GR0A 2J9EA 4ZP8A 4CH0S 1T95A 5DETA 2UXBF 1S1UB 3T9ZA 2ADCA 4TY8B 5KFWA 1D9DA 4CTAA 2CPZA 3A1YG 3ZZUA 2IFXA 3AJ1A 1VJWA 1DQAA 4U9RA 2R7SA 1SXLA 1UVIA 2GX8A 3OTDA 3PKYA 2RILA 1JLEA 3C2PA 3UNGC 1C0UA 3K8WA 2JC0A 5L9XA 4P2SA 2FVQA 5M2PA 3NNHA 1B64A 1YJWS 5CXTA 2CPXA 3DOKA 4UOCA 3KK2A 4TLQA 2QMWA 2AX1A 2I1RA 1N6QB 1TV6B 2CG4A 2V8VA 2LXUA 3UE2A 3GV5B 3HVRA 4TU9A 4M95A 3GR1A 3SFUA 4DV2F 5CCLA 2IM1A 7FDRA 2ZH7A 1WELA 2J7WA 3DCAA 4C8KA 3EZ5A 1FTRA 2FVSA 4K4UA 1MU2B 1DLOB 3IWXA 4O3PA 2QIFA 3BSOA 4AL7A 2RB7A 1XEZA 5D8HB 2CRLA 1N88A 5CZVA 3U27A 5DQIA 4PR6A 3N5FA 3RB6A 2KFNA 1JLFB 4RNFA 5DO2A 1N8RT 1LW0A 2YNIA 4WF9Q 5E3AA 4PWDB 1NJZA 2IBOA 3M32B 3T9NA 2A2DA 4BCAA 4DSEA 4C8YA 3H4BA 1Y00A 3CCWA 5D4OA 4DQSA 2B7BB 4B02A 4DFJA 3GQCA 4DWIA 4A8MP 4OHYA 1DHMA 1GXUA 6FDRA 4KV8A 3IR6B 3MR6A 4QOTA 5JUMA 2WBRA 4F4YA 2OP5A 2XLIA 2EFQA 4EWTA 4NA3A 3N0VA 3MHYA 3SCLE 4IQMA 1K0VA 2EFNA 1JJ4A 1R7IA 4B9UA 3H20A 4KGKA 2CVEA 4MK8A 2OPPA 1X4CA 2VASA 4PXDA 3RW7A 2XHWA 3M9MB 4X4TA 4CCHA 2R7WA 3PEJA 1SKWA 4I64A 4A8KA 1VBXA 2YWKA 3MECA 4OI6A 2YKAA 3P3DA 4YDXA 3MEGA 1X5PA 3WZ0A 2BQUA 2F9DA 3UR0A 4DR6F 3KHHA 4DL5A 2DTJA 3BR9A 3I9ZA 4B9TA 2UVRA 2MZJA 3W7BA 3JYTA 3KG4A 4QYZJ 1JXEA 4IOCQ 1FJCA 3DOKB 4IG3A 3EX7B 3KK2B 4PG8A 3TAPA 4ERDA 2FHKA 5KFRA 3ETOA 1HBMA 2OFHX 4FZVA 1HW9A 3QIPA 2XEXA 2LXIA 4EBCA 2MKIA 3LWMA 1FRLA 1NK5A 1U25A 2D9PA 5EDWA 1ULRA 1ZZNA 4RWWA 3DOLA 3LP2A 1Q82T 1HNXF 2MKHA 4ZA1A 4DPOA 2MHNA 3NCPA 5EWFA 4ED3A 2DNKA 3PZPA 3BSCA 5G0RA 2DH9A 2NSBA 4RBUA 3RR8A 2J9DA 2K3KA 2MHEA 1TK5A 2YKNA 3I4PA 2BE2A 2YNIB 1S99A 2O1PA 3IAM9 1MROA 4AE5A 4ETXA 1B0TA 1LW2A 4YHHF 1VBYA 2V9WA 3QO9A 2EG2A 2MPUA 2E5IA 2N3LA 4KV8B 5K14A 3GMGA 4FNHA 3CCZA 5I42A 2J7KA 2E5GA 3Q22A 2RH3A 3OFFA 1R8HA 4DV5F 2PE8A 1KONA 1RT6A 2OIHA 5LSLA 2HW3A 3MZIA 4LIWA 2OPPB 1F5AA 4EYIB 3TAMA 2ZJRQ 3I6PA 4QIVA 1HARA 2OPQA 2RNEA 3FFIB 4MIAA 4CO4A 2WAQD 1CQMA 4WXOA 3PR4A 3DHXA 1AXQA 1KFSA 1G2EA 4MIBA 3S01A 1LWEB 1SH3A 2YNHA 5KFBA 1FA0A 3M6VA 3MEGB 5KFNA 4ECWA 1YJTA 2COLA 2GNKA 2BJDA 1LKZA 2P5VA 2KYZA 3IA0A 5I3PA 4B3SF 3JYTB 3HHNB 4OJ3A 5GAEU 3TAQA 2RMLA 2B6AA 4IG3B 5FD1A 2QLWA 2HAIA 4G1IA 4NL5A 1OIAA 3QIPB 1C0TB 2LDYA 4LVNP 4TN2A 3C6TA 1Y9OA 3FRZA 3TVKA 2XLJA 3PW4A 1N5SA 3LWLA 1X0FA 1NU4A 2W7OA 3E51A 4JI7F 1YG0A 1RWUA 2ALZA 5CYMA 4C11A 1F60B 1HFEL 3OQ2A 2ZH9A 1N34F 2X1GA 2Z4PA 5G0RB 2LA6A 2YY3A 5GAEI 2MZRA 3CE8A 2BE2B 3E01A 1VI7A 2W4PA 1UFLA 4ITSA 1RTDA 5K5MA 5C25A 3SSSA 1I6JA 2W9BA 2L3MA 3NAIA 1MROB 1N5QA 1T02A 2NQPA 3OBIA 3QO9B 4ED5A 3DI6A 4DDFA 1HNVA 2FVPA 1UVNA 5K14B 4OZ5A 1RTJA 1TL3A 3T5KA 3TANA 4LSLA 1QTMA 1JKHB 1M90T 3U1MA 3FEXB 4DL7A 1KNZA 2N82B 5KT5A 4RNMA 4HDGA 3OTOF 4LSNA 3N6NA 2ZBIA 1Y0HA 3US5A 2YX1A 4X66F 3KHRA 1RT6B 1VQ5S 2HMIA 2DGVA 4H4MA 4N56A 4HYKA 5D4NA 2GJIA 5D78A 3U02A 3TUIC 3DLEA 4IR1A 1S97A 1FNMA 3MCSA 1GXLA 2OPQB 2X1FA 2AP6A 4OX8A 2E9TA 2B9XA 3MD3A 4HI2A 2MYFA 1U6FA 3AB2B 2YNHB 4PKDB 2I2YA 2OPSB 3JSMA 3UDCA 1NHUA 3N4WA 3OXLA 4NZ7A 4Q7AA 4F4XA 4PQUA 4PG6A 1NKBA 3AY0A 3I96A 4HEA9 3CF5Q 1P1LA 2MKSA 3CMAS 2B6AB 3QJPA 2ZUGA 4PWUA 2K2PA 4ZVFA 4DF4A 1X4GA 4DL2A 3SEOA 2VFRA 4USIA 5F41A 3C6TB 2C2RA 2O3DA 2XWYA 1U1MA 3LAKA 1HWUA 4C0HA 4GO7X 2KT2A 3OXFA 2XMVA 1UA0A 2IJFA 5CYMB 2OSQA 4IYQA 4C11B 3RB0A 1JJ2R 1TKZB 5DG7A 3ONQA 1CPZA 3BDEA 2DRBA 3IO1A 5ITHA 5K8OA 4DV7F 3IBWA 4EBEA 2DHAA 2XS2A 3E01B 3BEGB 1UVKA 1RTDB 1RISA 1J2VA 5C25B 2V4QA 4CH1A 3Q2TC 3M8SA 3GB0A 3PRBA 4BBYA 4YFUA 1TAQA 3GIMA 1GQEA 3TQ1A 3OR2A 2BANA 2FHJA 2AW0A 2Q6CA 2KKHA 3DI6B 2V2KA 3GFZA 1HNVB 2XI3A 2UV8G 4MK9A 2FD2A 3MI7X 4O3OA 4C0BA 3A8EA 5A8KA 1RTJB 1TL3B 2IJNA 1NJYA 5J1EA 5F0UA 3IC1A 4LSLB 4V19X 2W7PA 4DSLA 2NR0A 3BO3A 4OX7A 5EGYA 4HH1A 4JI6F 3BQ2A 2J8AA 1FDAA 4LSNB 3KLGA 1JXLA 3NMRA 3GE9A 3V4MA 1S1TA 4Y65A 2Y1JA 2HMIB 4H4MB 4DN9A 2SXLA 3CCUS 3PJXA 1VQ8S 1DURA 2FJXA 3LP0A 4TXSA 3DLEB 1H7WA 1HHSA 2AJ1A 3B82A 1NJIT 3F44A 1C1BB 2DJWA 3QJLA 2RD5C 3ISND 3MM9A 4U7UK 3RYLA 1UJ6A 4JYAF 1TAUA 4ED7A 4I2PA 2VPXB 2HHHF 1RT5A 4DHVA 3RTVA 3CGIA 3HVAA 5FDLA 2R7OA 4WCEQ 4UQGA 2DNOA 4OQJA 2CJKA 4PQUB 4DR5F 4R8UA 1B0VA 3ZC4A 5JVGQ 2DIVA 1RQ0A 4ZS6A 4OX6A 4JI0F 3TW0A 2N7YA 2UXDF 5AE1A 1K1QA 4R0EA 4MIWA 2FJDB 3NRBA 4FXWA 2QFJA 2FLLA 2RS2A 3H8YA 2RS8A 3KLHA 1UETA 4Y2IA 3KWMA 5J2QA 1VQSA 2XS7A 1SJRA 3M9OB 3QWPA 3LO3A 1U49A 1Q78A 4OHXA 1FF2A 3TVZA 2WOMA 3SXLA 5KFMA 3UDLA 2XGQA 1Q16B 2JFKA 4K4VA 3IXQA 4QYRA 3TA0A 2GO9A 3H2LA 2ACYA 5K9FA 2BABA 2VA2A 3F41A 4C8MA 3OHBA 2CQ3A 3LP1A 5HP1A 4G6VB 1TFWA 2HGMA 2Y1RI 1TKDA 5A0YA 2JEFA 3OR2B 1KFDA 2BANB 1Y5LB 2CPFA 2J0QD 1FHTA 1JLAA 4Y2AA 4NCBA 4BC7A 1AW0A 2UUAF 5J1EB 3D2WA 5F8IA 2YX4A 1JWWA 2QV6A 5L1KA 2ZD1A 2LEAA 5DM7Q 2U1AA 2J0XA 1TK0A 3RBEA 2EFOA 4NMLA 3DRYA 1Y3JA 3AJ2A 3L95X 1QAIA 4DUYF 2BDPA 2R2SA 2AJQA 3FQLA 3KLGB 4ECUA 1RDRA 3Q2SC 1S1TB 2GMLA 2UP1A 5LXYA 2R7RA 3CSKA 2HVZA 4ZKAA 5KFAA 5KFPA 2KT5A 5L1IA 2MXYA 2VB6A 3M6UA 4NXMF 1DQ9A 3HP6A 3O44A 4IH6A 5CA5A 3S1TA 3MM9B 1TK8A 4K5RA 3H59A 2GIQA 4Q2LA 4ZPWR 4DMZA 2ROGA 4I2PB 2JRSA 2M52A 3T5HA 1U45A 4ZVGA 2LKZA 1KRPA 3SI8A 3C46A 2YNGA 2AX0A 4X2BA 1UWBA 3HM9A 4ES2A 1HBOA 3JTNA 4QU6A 4EBDA 1WEZA 3GV7B 5F9LA 4NCAA 1NH8A 5J2PA 1XMQF 5DQGA 3OPKA 2DNNA 2MB0B 2KXHA 2D1CA 4DV4F 5J2QB 1CEZA 2CJAA 2FGOA 4OLOA 3BB5A 1HD0A 5I3QA 5DDRC 4J9NA 5JVHQ 2WOMB 3HO1A 4Q2MA 3HHKA 2KVIA 4Y2KA 2RDJA 4N8OA 3PFEA 1XN9A 2I5JA 2CQBA 2V4JB 3M9NB 4F3QA 1R31A 2E1AA 3E8OA 5KG5A 3GIJA 5KT3A 2VKRA 2RRBA 3K57A 2KB2A 1SL0A 2CQ0A 1LXNA 1KQFB 3LP1B 2PIIA 5HP1B 2X1BA 1YQHA 2KU7A 5A0YB 1OPZA 1T3NA 5AE3A 2VC0A 3T19A 2Q79A 4HT5A 2PI5A 4LF7F 5KG3A 3P96A 1FJEB 2FJAB 1G3OA 3Q24A 1RJJA 4AQYF 1OS5A 3IGNA 3THVA 1NKEA 2ZD1B 4MH8A 2P6TA 2QSFA 2R8GA 4IH5A 1Q81T 4QPXA 4KGMA 2KG0A 4EFAC 1UL3A 2F3JA 2XBPA 3T3FA 3OUYA 5L8RC 1BQNA 1YJRA 4HDHA 2I0XA 2GGPA 4Y00A 4N77A 1J5OA 1DZ5A 3LPYA 4WZMA 3PM9A 4X4UA 1KVIA 4ID5A 1N5VA 2JVRA 4NA1A 1XMOF 2J9CA 2MQLA 2ABYA 2CJQA 1Q8IA 3NCRA 3QIDA 2YTCA 2DNMA 1GTHA 4CI0B 2E1CA 5KFCA 4O4RA 1RTIB 1FEHA 3EGNA 3CT9A 1Q86T 3AA8A 1BQMA 4OJ1A 2HGLA 2DH8A 2EKYA 2YNGB 1F5CA 1LFPA 4Q0BA 2VZ9A 3SMZA 3NKYA 4IRDA 4RX6A 3HF5A 2Y1IA 1VIXA 1KLMA 1Q79A 3LGNA 1UWBB 3L09A 1HBOB 4R0JA 3ZZPA 2F1FA 1YJVA 4K5SA 3O6QA 1M0SA 5J2PB 1OWXA 4CO3A 1FRHA 4ILRA 3H2VE 1Y4ZB 3HHEA 3KLVA 3CPWR 1F0XA 2IVMA 2HHWA 3MM6A 2HNYA 4Q45A 3G9CA 4H4KA 2ZOMA 3MXHP 2RF2A 2C3MA 5HL7Q 4LFAF 1GXTA 4HI1A 2ZNYA 4PG5A 3M2UA 4RBVA 2ZITA 3DU6A 3RB4A 3MR3A 2HNZA 2WSFC 2AGOA 3K8VA 4F3MA 4TQSA 3MEKA 1KHWA 3OR1A 4EEYA 4O4GB 2KG1A 4OI4A 3VQTA 4RBTA 2HHXA 3GG1A 3GG0A 1TVRB 2OKQA 4M63A 4TLRA 2UXCF 2HYIB 2ZJPQ 5F8NA 1UEVA 4HL9A 2YKQA 3QZ8A 5L39A 3EYZA 3CD5A 2DBBA 2ILYA 3I5AA 4LJMA 4Y3CA