1BLUA

Structure of the 2[4fe-4s] ferredoxin from chromatium vinosum
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
80
structure length
80
Chain Sequence
ALMITDECINCDVCEPECPNGAISQGDETYVIEPSLCTECVGHYETSQCVEVCPVDCIIKDPSHEETEDELRAKYERITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Crystal structure of the 2[4Fe-4S] ferredoxin from Chromatium vinosum: evolutionary and mechanistic inferences for [3/4Fe-4S] ferredoxins.
pubmed rcsb
molecule tags Electron transport
total genus 14
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 1996-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bluA00
1BLUA 1R27B 7FD1A 2VPWB 1Y4ZB 1GT8A 1B0PA 3MMBB 7FDRA 3MMBA 4DHVA 1GAOA 1FRKA 1Q16B 1ROFA 3MM7B 1HFEL 3MMCB 1DURA 1PC5A 3MM7A 4ID8A 3MMCA 1FXRA 5CH7B 1SIWB 4XDDA 1JB0C 2C3MA 4AYBD 2VKRA 1DFDA 1D3WA 2WAQD 3IR7B 3PNIA 1FRXA 1Y5NB 1A6LA 3MMAB 1RGVA 2VPZB 2V4JB 3MMAA 1FDBA 5BYRA 2V4JA 3EXYA 2FJDB 4YDDB 1FRMA 2C3UA 1FD2A 2GMJA 2FJBB 1JNRB 1FRIA 3IR6B 2UZAA 1H7WA 1FTCA 1SIZA 2FGOA 1FDNA 1BC6A 5E7OB 1FCAA 2VPXB 2IVFB 1G6BA 2Y0SD 5CHCB 1G3OA 5BYQA 3MM8A 2FD2A 3HKZD 2WSCC 2C3YA 1FXDA 2PA8D 1WTFA 3MM5B 1VJWA 2XSJB 5L8RC 2WSEC 3MM5A 2XSJA 3GYXB 1BQXA 1GTEA 2ZVSA 1BWEA 3IR5B 5BYSA 2Z8QA 6FDRA 1KQFB 3EGWB 4Y28C 2FDNA 1AXQA 1GTHA 4CI0B 1H7XA 2C42A 3OR2B 1SJ1A 1C4AA 3OR2A 3OR1B 1FRHA 1F2GA 3LW5C 1FDAA 1C4CA 1FEHA 2O01C 3MM8B 3OR1A 4L6V3 4XK8C 1IR0A 1F5BA 1K0TA 3EUNA 2V2KA 4XDCA 6FD1A 3MM9A 2PMZD 1FERA 3MM6A 2PDAA 1KQGB 1DAXA 2VPYB 1H98A 4OV1A 1Y5IB 1FF2A 1Y5LB 1FRJA 1FDDA 2FJEB 1H0HB 1FRLA 1PC4A 2GMHA 1B0VA 1CLFA 5FD1A 1BD6A 2C3OA 2WB1D 4OMFG 2WSFC 1B0TA 4RKUC 1XERA 4KT0C 1F5CA 1IQZA 1JNZB 2FJAB 1KEKA 3MM9B 3MM6B 3C8YA 2C3PA
chains in the Genus database with same CATH superfamily
1XQIA 4GRSA 3C6UA 4DEZA 3HZGA 4OHYA 1OY8A 1R8HA 3D7SB 3D68A 5F8MA 3UDLA 3KKFA 4LFCJ 2DRBA 3HI9A 4JI2J 2GMJA 5E3QA 5AXLA 2V8VA 3NG8A 2DEJA 3ET6B 4YHHF 4GKKJ 3TAMB 2R8GA 2BE7D 1N4LA 1XMBA 4YFUA 3QIDA 1VMBA 2E1MC 1UFLA 1JLBB 1S5ZA 4NCGB 3J80Y 5DJBA 3GYXB 2QSFA 4RO0A 1VGYA 4ETZA 2WW8A 4USKA 1UZDA 4ZVGA 2IVMA 2LA6A 4K4XA 4DJBA 1G2EA 3QAEA 2JLGA 3C6TB 2YKPA 5A8RB 4HEA9 3KLFB 3ZZ0A 3KMQA 1S7HA 4BDPA 4DQSA 1RHMB 2HFSA 2CJYB 3S8SA 1QAIA 4FYDA 1LW0A 1NDPA 4WKYA 4QWCA 3EGNA 3GFZA 3LGMA 3DNCA 2HNDB 1I6JA 2CJQA 2DGSA 2L41A 2ZC4A 1FWLA 5A8WA 2KYXA 4ZIWA 4ZP7A 4IG3A 1X9MA 3ENAA 2ZOFA 4DUYF 1G7CB 3O44A 2V4QA 1DTTA 4K4TA 1SKSA 2AJQA 4FZVA 2R3VA 1K8AT 2QLFB 4NI2A 3HFKA 4RUAA 1S57A 4Z2XA 2KXHA 2DHGA 3G8SA 3W61A 3G4SS 3OVBA 4QIWD 4RNFA 2ALYB 4K7QA 1PAUB 2HVEA 5I42A 2B4UA 3F0NA 2VA2A 3H5XA 4KYZA 4OZJA 4CM2A 4WXWA 2MTLA 4N77A 4EO6A 2GW8A 1KQGB 3TJ8A 4PRFA 3I5CA 3TA2A 3OD2A 3FZBA 4I7FB 1U0HB 1FNXH 1HBOB 3NCQA 1XMQJ 2RQCA 1FJEB 4A8OA 3LF0A 3HD2A 3ZTPA 1FESA 4F0HA 3KJVB 4UQTA 3A1YG 3CJ3A 1X4EA 2J0QD 2XZDB 2VKZG 2CYYA 1K0VA 5DQIA 3VZHA 4OJ3A 1JLFB 2NUUG 4DQIA 4H4KA 3B8HA 3HT3A 3CJ8A 2MQPA 3GU0A 1SC1B 2IJNA 2ZVIA 3GJTB 1N0VC 4IH7A 1JXVA 1TV6A 2HIYA 5CHCB 3GTYX 1WHXA 2IRUA 4I2PA 3EZ5A 4UW2A 4KHPF 5L8RC 4J7CA 1T9XA 1S0NA 4X66F 4JI7J 2AJFE 4ZLLA 5RUBA 4XTTA 1M1HA 5J2NB 4HHHA 4N8NA 4KV8B 1BGXT 2YH1A 2KL8A 4KHRA 4A47A 2KFYA 1PBUA 5CZVA 3U1MA 1ZA2B 3VCDA 5C24A 4IFYB 5KFDA 4ECRA 1TELA 3QT8A 3VTIA 3IG1B 1ZA1B 1B0TA 5L39A 3C15A 2FVQA 1D8YA 1HMVA 2VJUA 2B9YA 4LSNA 2A18A 2DR7A 2L9WA 5KFAA 1RCOB 2L48A 1UPMB 1HYSA 2MGZA 4DSIA 1O6XA 4ZVRB 1N34F 3HDSA 1M5VC 3GMGA 3V4MA 1V5IB 2LA4A 1PYTA 1NHUA 4O0NA 2KT3A 3DRSA 3DRPA 2HWIA 1QSLA 3EPGA 4NE9C 3CEDA 3BKTA 4FBUA 4MIBA 4ZVEA 2ERRA 4F50A 2QLWA 2Q1LA 2MSTA 3W9HA 2CPZA 1OY9A 4URGA 3GFHA 1TFWA 3OR1B 3CIMA 4PCQA 4OI0A 1WHWA 2YNIA 3AXMA 3OT9A 4HR2A 3A3PB 4NMXA 5ETSA 2CWXA 1RT6B 5J2QB 3KUEA 2FHOB 1RTDB 3TZZA 1OYEA 2BKNA 5HMWA 1RHUB 2OPRA 4C3MA 2ZNZA 4USUA 5DDQC 4M5JA 4DZDA 2B4PA 4R0JA 3WX8A 1YX2A 4ECTA 4RW9B 4QWDA 3VAKA 3MPDA 4B3OB 5B0EA 1YJ9S 3H5UA 2XMAA 5B0CA 3PW7A 4RW4B 5E41A 1HBNA 2EFOA 3ISND 1S6QB 1IKXA 3C46A 4K4ZA 3FMBA 1G4CA 4KPCA 5KT3A 2HMIA 5L1KA 2LYVA 2C3YA 4P10A 2HK2A 2CWKA 3ITHA 2BQRA 3PDNA 5IQQA 3VQSA 3HFZB 3P5TL 5F8HA 1C4AA 2RJZA 3H25A 2B6AB 2MHEA 3ISNC 1L3VA 3QFWA 4RW7A 1Y5LB 4UT4A 1P6TA 1W7WA 2YNFB 2EKNA 3CC4S 5LMUF 1IM6A 4HACB 1U4BA 3K8VA 3M1VA 2XQCA 4FPIA 3GONA 3QPIA 1ROFA 3BSNA 2Q3PA 3LUYA 1XR5A 2COLA 2N4DA 3EVOA 2C2DA 4ZN1A 2UUCF 1MNEA 3IFEA 1VRQC 8RUCA 3PR4A 2CZ9A 2FB0A 4KFBB 3ZZOA 2DH7A 3BO2A 4DU7A 4YY3F 2IDLA 1J27A 1OJ4A 2QMXA 3KLGA 3IGVA 3OFGA 4JI8F 3H2UB 4MYUA 3FDSA 4ILLA 5CCMA 4ES1A 1RKIA 2CVIA 4FF4A 1MWQA 2BOAA 3DOMB 1X4FA 4XDCA 3RB3A 4E2FB 2GJ2A 3TP2A 2IYIA 4JI0F 2FHMA 1WHVA 3R1LA 2GZOA 2R8HA 1K1QA 2IRYA 3S01A 1JLQA 3X1LB 1S1TB 2O1PA 2DR8A 1Q82T 1XR7A 3EZUA 1WC1A 1ZYQA 2I1RA 4DV0F 1WEZA 2EPIA 3LGNA 4F4ZA 5B7WA 2IJFA 3ZTOA 3MWBA 4DL0C 1Q5YA 4AL5A 4LRAA 3CC2S 3T1YJ 4ZCMA 1ZM4A 2DBBA 3AXKA 2R7TA 2AWZA 5HROB 4WFAQ 3OTBA 5D3GA 4QW9A 4LF9F 2GVDA 2IJRA 2OIHA 4DPWA 3CCLS 4CWBA 1CC8A 4WU3A 3RBXA 2D9OA 2QC3A 3M2RA 4DV1J 2WVEA 4YN3B 2AU0A 2HGNA 5K5MA 4HH0A 1P9QC 1RA7A 4CLYA 1X4GA 4USVA 3L95X 3Q24A 4LF2A 1HA1A 4RU9A 5F3TA 1JKHA 3RB0A 1MMLA 4L74A 3OLBA 1UA0A 4OJGA 5E3RA 3L9ZA 4KT0C 4U95A 1SCJB 2D3OR 4DV7J 4LFBF 2UUTA 5KFPA 1Q7LB 4B08A 1BQNA 2PEBA 5IWAJ 3HULA 1NPRA 2H51B 4PWDA 2YX1A 2HWHA 4ICLB 5ITHA 2R9LA 3LPEA 2JL9A 5L9XA 4LRDA 4X4RA 3SEOA 4FN5A 2CQPA 2GS8A 5M2PA 1IUJA 4OL8A 1EJ7L 3D0IE 1F1BB 2OTJS 1Q79A 3RGIA 3DGPB 3FC9A 3NCPA 1IN0A 1RWXB 1QAXA 2RH3A 4WP9A 2YQ1A 1HNVB 2VG7A 4QIGA 2VONA 1S59A 5KG2A 5T14A 3NOGA 2LQ8A 1SJ1A 3FFIB 3DLKB 1K0TA 1GX6A 1YJ7A 1VQKS 1FTRA 1IBKJ 4OLOA 2DVIA 4JI3F 2HLUA 3T5JA 3QMQA 3I32A 5KFUA 1AUSL 2EFGA 1Z2LA 1TUVA 1FD8A 2U1AA 5DS7A 1NJZA 4LF1A 2GGPB 2CPHA 2DHSA 2X3DA 3CGIA 5KFZA 3TQEA 3KMSA 3Q89A 4DUTA 1RT7B 2NZ4A 2BMBA 1JJHA 2K7JA 1CVJA 1XMOJ 3KUGA 4P75A 3IR7B 4DR1F 5KFBA 4E98A 4LF6J 2CNNB 2Y8WA 3JAMY 2HG4A 4C11B 4CLSA 2MSSA 2YY3A 3TA0A 1U48A 2V68A 3QJJA 2QFIA 2H65B 2GJFA 1T94A 5IT4A 4WE1A 5ETQA 1WHYA 4KGKA 4M5MA 3N6LA 2VODA 2J8SA 2HBYB 4ZLJA 3SV4A 1HBMA 3UD5A 3CCRS 3H5SA 2OP5A 4FVMA 5AE2A 1LEOA 3CDUA 5HLFA 1JJCB 2NXNA 1JLCA 2AJ1A 4LF5F 2CJAA 1M0SA 4K4SA 4U8VA 3JYTB 1IQTA 1UPPA 3HHDA 3UD3P 1L3TA 3FEXB 3FBBA 1C1BA 1R27B 3N6MA 1Z4UA 2ZM6F 4F3MA 4B3MF 4LF7J 2E9RX 2ZC3A 1E6YB 2ZWPA 3DOLB 4CYUA 2RQKA 3W63A 1N32F 3FEZA 4JV5J 2V2VA 1I1GA 2FVSA 1VBKA 5HQ8A 5K8NA 2PFDA 2BW2A 5F41A 3N01A 3NGUA 2ZBIA 2KXFA 4DX8H 1WTBA 1K47A 5H9EK 2MKCA 4MFBB 3NY0A 2W4PA 4LQ3A 1HWLA 5K8OA 5LSOA 4IQMA 4QYZJ 3LAMA 2ILZA 3IBWA 3RBEA 3I9ZA 2ZEJA 1FEEA 3S6EA 2CKWA 4IO9Q 1N36J 4MKYA 4NOHA 3MEDB 1FEHA 3DRXA 2VIHA 4RLEA 2WBRA 2WVCA 2CPEA 3CE8A 5GADU 2UUBF 1H0HB 4OZNA 4EZ6A 1JLGB 1N5YA 4CLZA 3LOUA 5CXTA 1RBAA 4RWWA 1RT5A 1SV5B 4X2BA 1WDTA 2Z2YB 1TKTA 3C6UB 5BJRA 5HJXA 3P4UB 2F65A 4Y00A 3QO9A 5IT0A 1IBLF 4LF8F 3NNHA 3KLIA 1JK9B 4DR3J 1D3WA 2ZUGA 5A76A 3H4DA 4BWJA 1PYSB 4ZJOA 2VOOA 4O3RA 3M6UA 3VVTA 1Q0NA 4GKJF 1LWCA 1IWGA 2MLYA 5DDRC 3PX4A 4OX7A 3HVRA 1HPZA 3SQGA 1K1SA 2GVZA 4P7TA 1RT1A 1APSA 3MTKA 3MPWA 3JSYA 4DR2J 2RDIA 4NA1A 3W2WA 2ZZMA 3AH6A 3QSYB 1TUWA 4NLPA 3AB2B 1VHIA 5CYMA 2ACMA 2YX4A 3R5GA 2MXYA 3WBZA 1YHQS 2HHSA 4IH6A 2A0FB 3M2VA 1CLFA 2OD4A 3FRZA 4ZMMA 1LW0B 2KVIA 1EQ0A 5SZTA 2KM8C 2GFFA 1U1MA 1OSDA 5A8WB 2N4CA 1FE0A 3I0RA 4IG3B 4TU7A 2P9CA 2A3JA 2BM0A 2CQ1A 5CAAA 4CZCA 4F3OA 4PXBA 2IVYA 4N41A 5B0AA 5JUMA 4YR0A 3HFVA 4NI2B 2AW0A 2VDIA 2ACYA 3UFCX 4QWEA 4EBDA 1OO0B 3QT6A 4JI5F 2NCKL 2CJKA 3WX4A 3JXOA 2BQ3A 3OPKA 4PG4A 3MM5A 3EVWA 3B6BA 2UVUA 2R8KA 3PYDA 5I42B 1NEEA 4P2XA 3M9MB 5JVGQ 2Z30B 4OYOA 3I82A 4ZVHA 1RAOA 2X1FA 3KXDA 4ZN3A 4ZVUB 2W2QP 1NK8A 2KRRA 3DM2A 1RT2A 2IBOA 4KY3A 2VFUA 3CCES 4OZ3A 3TZXA 4R0EA 2PO4A 3HSJA 3D9BA 2P5VA 3KUHA 3PW0A 1RWOB 2F9DA 5BXIA 3RU0A 4FKYA 2IRXA 5D6GA 4PG8A 2JHEA 4YB1P 5B0DA 2VDHA 2HBQB 4Q44A 3PKMA 2M4MA 1RHKB 3MEKA 1YGYA 1XK8A 4KE5A 4YDDB 3EM1A 1PGZA 3CD0A 1BMQB 3BYRA 4DFMA 4PXCA 4AQYJ 1ZZNA 3AB4B 2N82B 2XCAA 1X5PA 4QU7A 4QR2A 3H2LA 4HI2A 4X4OA 4I2PB 1KFDA 2HQCA 4DUZJ 1CQNA 2C28A 4UY8T 3CCTA 3HSGA 4DI6A 1OQ3A 3NXZA 4C6AA 3EJMA 3ZTSA 4Q5VA 1XNQF 2BJ8A 2QTWA 1QSYA 5C24B 2NXEA 3DDNA 2ZH3A 1HNXJ 2RILA 4ECXA 5FD1A 1RWWB 3EX7B 1FX4A 2M5YA 4BBYA 5A2QU 1F3VA 3C15B 4MK9A 5F8NA 1T8EA 1MWZA 3W9JA 3MM9B 3V6JA 1N54B 1HMVB 3TJ9A 2W7OA 3FNNA 2FZGB 4LSNB 5CD4H 4IR9A 2OSQA 5E3CA 2M7SA 3OJSA 4HKQA 1SQFA 2MGZB 3P96A 4HTIA 1Q8IA 2W2OP 1FJGJ 1TR0A 1M5PC 1FDBA 1UVIA 3DRSB 2HQIA 4F7VA 2GJIA 2CQCA 4H4OB 2K3KA 1KLMB 2YQ0A 4P2SA 3W60A 5LT5A 1S6UA 5J1EA 1YI2S 3HMJG 1UEUA 4OHWA 4Q0BA 4LBHA 3TVZA 3D28A 4C0HA 1T9VA 4B3SJ 3A3OB 2P9GA 2E5JA 4OX9F 2DY1A 3OR2A 3NWRA 2FPHX 2YNIB 4PQUA 3CT9A 4A8FA 3M32A 1NDKA 4ZPAA 4JOUA 5LJ3Y 2ZJRQ 2GHWA 4OYWA 2FJVA 2OPRB 4GO5X 3BO4A 2G0CA 1JNZB 2NSCA 3MURP 3BH6B 4PZVA 2XBPA 1I94J 4B9NA 2N3LA 3E8OA 1HARA 1FT8A 3QFHA 4CP5A 3AT1B 2Z4PA 4NLGA 2R7OA 3JB9k 2HHHJ 1WI6A 1NUEA 1X5SA 2F40A 2VBYA 2OSRA 4RUBA 3MEGA 1HBNB 3UCGA 2CJ9A 1IKXB 1WF0A 4FS2A 2I0XA 1FCAA 1DTQA 4LF4F 3OBIA 2XHCA 2HMIB 1AZSA 1U2FA 4DSJA 2PSZA 4C8KA 1DHMA 4NLXA 4Q8EA 1SL0A 5KAKA 5EX3A 4Q2MA 2IM2A 5DDOC 1R7IA 4CO2A 2BOPA 4ANDA 4O0IA 1YRUA 1HNWF 2RDJA 1S9GB 4DV3F 1WJ9A 3PJWA 2HPUA 3A8JA 1HQUA 2V34A 2Y1RI 2RUGA 3FGVA 3NOCA 1NJWA 4YB6A 3HVWA 2RUSA 2UV8A 1V6HA 1L5UA 4PWUA 3M1VB 3SIPB 2FHKA 5HVFA 1EP4A 2R8IA 1PBAA 2G0IA 2Z2LA 5KFRA 1GAOA 4CLTA 4LRFA 3M6XA 2AEMA 1DJ0A 4J9MA 1AFIA 3IWLA 4M5LA 4C8OA 1U1RA 2GHVC 1NO8A 2HBZB 1T9YA 3GZ7A 1Q8LA 2XC9A 2H5IB 3PIOQ 3UN3A 5E7OB 4N56A 1S10A 4I67A 5FJ4A 3WIVA 3KLGB 2QO3A 4LMZA 2CQDA 1EETA 4DFJA 4P9SA 4IG0A 5G4DA 3OTDA 1S6PA 2M8DB 4E8UA 4U96A 1XEZA 2DEIA 4ZVPB 1KLNA 2UXBF 4HDHA 1X0PA 2OEMA 2WK4A 4QYZK 2LEBA 3RJMB 2CNLB 3R1HA 4UZCA 1EAYC 4HHUA 4RU2A 2XY7A 1LFWA 2QA2A 3SZ2A 2BEFA 3VAJA 4OQJA 5D3GB 1GMUA 4WP3A 3AOBA 4IR1A 4IOBA 2W4CA 1N0UA 2E44A 4KGXB 1KS2A 1RHJB 4DV5J 1DBDA 1ZETA 1JXEA 3M2RB 4RJVA 1KDNA 2J9EA 2VU5A 4EMDA 3CJ5A 4K50A 3K59A 3BBCA 3WHIA 5KFLA 3M8QA 4KBIA 4DL7A 1ICEB 1NPPA 2GV1A 2ZJPQ 3H5YA 3TJAA 4DR7F 1IBMF 1JKHB 1OQ6A 1DARA 1RADB 1CS4A 2B4VA 3TVKA 1ZM2A 3J7YI 2FLNA 2ZHOA 1KTQA 3P45B 4OIXA 1BQNB 3BREA 4WIIA 3CNQP 3I5AA 4TY8A 2IA6A 2OJ3A 1ZTTA 4PWDB 2JEFA 3GIRA 3BBBA 1RK8A 5LM7E 4EI2A 2OFHX 2PEHA 3ENQA 1N5SA 2C2MB 6AT1B 3MI7X 1XNRF 2BJ9A 2A2CA 4B9MA 3HX9A 5KFQA 2PFFB 1RZMA 3QQCD 2E1CA 3QGHA 2BXJA 2VG7B 2DKOB 3UCUP 2HAIA 1IJFB 2MY7A 3SFUA 2XMVA 5K14A 4X66J 4I64A 5KFOA 1XTZA 5E5NA 3OUYA 3B4MA 4MMOA 4B9TA 1FF2A 2ZKUA 2QLJB 5ETLA 2D7SA 1VS3A 1S1VA 3FSIA 2ZBRA 1VC5A 3VALA 3QRQA 2FIUA 3TVYA 2RDDA 1N88A 4IUFA 4KRWA 3MM7A 2E29A 1VHFA 5B08A 2MQQA 3A4TA 3NS6A 1PG5B 3FQKA 2AX0A 4J9QA 1SPBP 1YRXA 3HD1A 1UVMA 2R8JA 2MKJA 1K9MT 4V19J 4GC7A 3EGVA 1VIOA 3Q8VA 3HO1A 1U7LA 1N34J 4RW6A 2DGWA 3ZZRA 1NNDA 2MLXA 1P1TA 4PEOA 2I9SA 4WE1B 3KK1A 3N6NA 3PX6A 1R0CB 3UR3C 3O1LA 2OPPA 3T19A 2EI5A 3SCIE 1HBMB 3WZ0A 4KGVB 2HGLA 3R6GB 5KG4A 3VGSA 3G6YA 2JLEA 1LKZA 1CEZA 2FJEB 5KFCA 1QAJA 5GAGU 4YMEA 2I6WA 1KQSR 1B0VA 5ETNA 1JLFA 4Q2LA 1H72C 4K2XA 2IIHA 2B7CB 1C1BB 5HAOA 1LXNA 5J1NA 4WKRA 4CYUB 3J7Z5 4J9LA 3M8WA 3T6JA 5A0YB 4QQBA 4ELTA 3BKFA 1RAGB 3RRGA 2ZD1A 3BGUA 1DY3A 1RU2A 2MKYA 2LMIA 3LWLA 4HL9A 1KBRA 1Y00A 1GX5A 2CZ4A 5J2NA 3FBFA 4ED0A 5KOWA 5F0UA 2K2PA 1T05A 1WC0A 3SV3A 4O44A 4C4WA 1RB0A 1Q86T 3IG1A 4O3SA 4KHMA 4U7UK 3M8ZA 5JVHQ 4K4YA 2VPYB 2I8EA 4G65A 3MAAA 2DR5A 4KQZA 4U7CA 1N5YB 2FLLA 2HVIA 1RBOB 3MUVP 3TZYA 1DRZA 1RT5B 4X64J 3D5MA 3KHHA 1T11A 3R9LA 2BYCA 2HFNA 2B51A 1TKTB 5KT2A 2KZZA 1NJIT 3QO9B 2CUYA 1D0EA 4JI1F 5ETRA 2VJVA 3E2EA 1FO1A 2MJNA 3KLIB 1PJ7A 4CTAA 2DGOA 2H3EB 5DRKA 3CWJA 4DN0A 2ZH5A 2F1FA 4DDFA 3D1HA 4M8LA 1ZS6A 1AB8A 1NSKL 2YKQA 5FIIA 3OL7A 4TLQA 1CBKA 2DD8S 3CMAS 2F8MA 3C2PA 1HPZB 3SQGB 2UUCJ 3DLHA 2GVZB 4FP9A 4CO5A 1RTIA 1GMWD 4DCJB 1W2BR 1RT1B 4IQXA 1FE4A 3I9V9 3MD1A 3RTVA 3TEGA 2ALZA 2EBEA 2B9WA 3IC1A 4OV6A 3W2WB 4YY3J 3H20A 4EK2A 2ZH4A 5CYMB 3BR8A 2MKKA 3PVXA 3VQTA 1U1LA 2Z56B 4RW9A 4DN9A 4J9NA 3QNWB 2E1PA 3M2VB 2IM3A 1Q53A 2KHCA 1BQMA 4ZP9A 1LWEA 2ASLA 2CQ3A 2DYAA 3QT5A 4OYXA 1QVGR 1S76D 1NH8A 4B3TF 4RW4A 3QBCA 1CULA 4ZIVA 1LXJA 2UU9F 4Y2CA 1FK9A 1D09B 1S1XA 5DDPC 1BXNA 2R42A 4J9PA 1KP6A 2A1BA 1CJVA 1JXLA 2JNJA 3I0RB 3MMCA 1WOSA 1VQ4S 4JI4F 1RXOB 1TQLA 3Q83A 2DH9A 3V81B 3MPUB 3R2DJ 2ZH9A 2VBWA 1FRIA 4J5OA 3G9CA 2DCUB 4GVLA 5LOQA 2PIIA 3BN4A 1HNZF 3BQ0A 4RNHA 1FKPA 2M0GB 3KG1A 4AUKA 2RT3A 3ULHA 4UUWA 4WCEQ 3MM5B 1SVDA 3BQ2A 2W7PA 4F36A 3C14A 4KH1B 3K5OA 1D1UA 2YX7A 4XK8C 4PWWA 4EZ9A 1HI8A 3DM2B 1RT2B 2B8QA 4ZK7M 4W4MA 2DXEA 4OMFG 1SKWA 1XWLA 5A2QY 1BE4A 3MR2A 1YZ6A 2FJAB 2GQCA 2HQFA 4ZJLA 2F4VF 2HHXA 2GCFA 4KB7A 1B0PA 1LFPA 2ROPA 3JSRA 4KFBA 4LFBJ 3ZZZA 1ZM9A 3PKYA 4O3OA 2XY5A 4EFAC 1YJRA 2VOPA 3CC7S 4OYMA 3RZAA 4PG5A 5AXMA 1WUUA 4PUOA 2ASDA 3MF5A 2A10A 4DSLA 4NRUA 4Y65A 1RWVB 1RHRB 3OTEA 4JI2F 1Q4RA 2HNYA 2NYIA 4GKKF 3E51A 5KFSA 1MLAA 4USTA 2OLWA 6FDRA 4W98A 4B3RJ 4FDFA 4DL4A 1S1TA 1F9EB 2RU3A 4M5HA 4M63A 1H2UX 3ENVA 4JBCA 3CD6S 2QN6B 3TI0A 3GJRB 1S7IA 3SI8A 1TL1A 2QT7A 2OPSA 2QZ8A 1OWXA 4JI3J 3THPA 3T6BA 3FMWA 3PYGA 4HYKA 1F5CA 4CT9A 2JFKA 3THTA 1HWKA 1NPKA 4X62J 2XTJP 4U9RA 2DH8A 4NX9A 2BACA 1FXRA 4XDDA 1T9UA 5F9LA 3I4PA 4QJVA 1VBZA 1SJFA 1F60B 3TUIC 1N33J 1FA0A 1UMJA 2OH2A 5KT5A 1N48A 4O4RA 3LA0A 4DR1J 1OPZA 5F3ZA 1SIZA 2HZAA 3Q23A 4FXVA 4CH7A 4IH5A 3HCXA 5J1EB 1S0MA 4A46A 1VYAA 3I55S 2DITA 4Q0BB 2AP6A 3PXGa 3MUTP 2F9JA 2UUWA 2BJ7A 4ER8A 5D15A 3G96A 3D1OA 2KFZA 3OR2B 3ZZTA 2YNHA 4PQUB 1TU0B 1AT1B 3CDWA 2LP4A 3UR0A 3M32B 1QE1A 4C0OC 4LFAF 2ZH7A 1BUXA 1WEXA 1MMNA 4DG1A 3EVMA 2IMWP 4LF5J 2D3ZA 4OYAA 3FEYB 3ZZUA 2G4BA 1SB6A 4DX6A 2V50A 3MXHP 1XMQF 3DCAA 1YIJS 4ED5A 3GE9A 3RBDA 5B0FA 3W64A 2AX1A 3R7BB 3TUZC 2ZM6J 3VVUA 4DL6A 2HQDA 2Y1LB 1YVFA 3MEGB 2ZBQA 1T3OA 3S1TA 3UD4P 1SKRA 3FSYA 2KRBA 4ZPDA 2VL1A 2CDQA 3KK2A 1TTHB 1DTQB 3D4JA 2V9KA 4I0WA 3CJSA 2HKEA 2PT0A 4ILRA 1GFWB 1S72S 1H2VZ 3TAPA 4L3NA 3TANA 2PA3A 1RAIB 1PILA 3R6LB 4JI7F 1HQUB 4IRDA 5DG9A 5EGYA 1RT7A 1C1CA 2W25A 3N4WA 4AXIA 3W1YC 4B9SA 3R3TA 2FC8A 4O3QA 1EP4B 2MPUA 1IVZA 2HBRB 1RT4A 2PMHA 4DPOA 3SXLA 5HP1A 2XI2A 2EKYA 4OZ2A 2KHDA 2D3UA 5CH7B 5MAOA 1OMSA 4DPYA 1WG1A 4DPTA 3FJ2A 3FCWA 4LF8J 1AA1B 1DQ8A 4XAKA 1N5TA 2VUGA 1YJWS 1F6TA 4UUXA 2RS2A 5L1LA 4PPDA 2ZOGA 5L38A 2AJ4A 4PG7A 1OYDA 2QMUB 4GKJJ 2DK2A 4DS5A 4LT6A 4QU6A 2XM3A 1XN9A 5KTQA 2IBKA 2IDEA 1HWJA 1FHTA 4IO1A 1EETB 1AXQA 3OHAA 2MMYA 1JJ4A 5DGBA 3L7PA 1LWXA 1S6PB 1H98A 1PAEX 2H9ZA 4NLDA 2O3DA 3BDEA 2XO7A 1QAYA 1EIYB 2LXUA 3WQPA 4JYAJ 4KSEB 3T41A 3PRBA 3CPWR 2Y3YA 2JEJA 2VPWB 3OVAA 3K17A 4UTGA 4NLWA 4LR9A 2KDOA 1CPZA 1A6LA 3GYGA 1KKHA 4Q7AA 3HZEA 2QLXA 9ATCB 4CT8A 2RRNA 4FKXA 2W9BB 4GO7X 1YSJA 3LGHA 4H4KC 1H2TZ 4ZHRB 1WTFA 4I1TA 5D8HB 2WB4A 1HR0F 4JI5J 3W2VA 1L3UA 1Q81T 3N5BA 4LVNP 4DLGA 1OSCA 1GK8A 2MLZA 3M8QB 2EWHA 1X7VA 4F26A 4NRTA 2J76E 4J9OA 2EXUA 4WIQA 1WSVA 1FRJA 1YJUA 4KPYA 1PC4A 3UDEA 1NSAA 3W62A 1O8BA 4CO1A 3D0GE 1FX2A 2GC8A 2QA1A 1CS4B 3VR1A 1TAQA 1NJXA 4USHA 2IFXA 4YDXA 4H4MA 3DDKA 4A8YA 2FJXA 4J9VA 4L76A 1KNZA 1LK5A 4TY8B 2CQ4A 4WU2A 4ZP8A 1UFKA 5H1SV 1YBTA 1FFWB 4YUDA 2J7KA 2E5IA 5KFXA 2KG0A 1A7GE 2R7QA 3DU6A 2AJ0A 3R5CA 4I56A 2CJXB 1KWMA 1NU4A 1KVJA 2CIMA 3KDNA 3K5LA 1IKVA 1EKSA 3UDCA 5FDLA 3BPDA 2ZDPA 4HLBA 3FKBA 4KH0B 2DR9A 5J1PA 1YLXA 4QIEA 2HEKA 2IYGA 3MCMA 5K14B 1HD0A 3OQ2A 3OUYB 3MM8B 4YB5A 4L75A 3IWNC 1NRKA 2Z2MA 3EYZA 2AF6A 3ISZA 2ASJA 1S1VB 4X4VA 1HKAA 4WZMA 4K2JA 2QJ3A 3KJNB 3BV8A 2ZZTA 4DBQA 2CPJA 2DO0A 2ZWOA 3MHYA 3CJKA 3O5TB 5LMNF 2Q66A 3JQJA 3MM7B 2QFJA 2DB1A 3MR5A 1GXUA 3OTOJ 3UN5A 3EDQB 1EHWA 2WAQD 5K8MA 4ZDNA 4WTOB 2V8DA 2KH9A 1EX8A 4LRBA 3W9IA 1VQLS 2N7YA 4PYDA 3LAKA 3VGUA 1BHNA 4RW6B 2HS3A 2WVDA 4DSFA 4X4SA 2MZQA 2JOQA 4YR3A 2P6TA 3T1YF 1G3OA 1J2VA 2CQBA 2KKHA 3KK1B 1VOMA 2NR0A 2OPPB 3PFEA 4ZOSA 4DF8A 1GTEA 2YKNA 5KFTA 3TUPA 3N28A 4B9UA 2HVHA 3EUNA 2IM0A 2OEKA 2ZKTA 3VAGA 3N9UC 4DV1F 3L3CA 4OX9J 4WYLA 2WCXA 1NK5A 4GVBA 5E33A 1VQ8S 4GC6A 3HHEA 3ZO7A 1VBYA 2QMWA 1XERA 3A8EA 2AYGA 5EHHA 2I2YA 3RRHA 5HBMA 4F2SA 2D69A 4ED3A 2MZRA 5IOLA 2W24A 2CQGA 3ONQA 2ZD1B 2ZE2A 2BQUA 4PAAA 5IWAF 3H7HB 3NMRA 3CB4A 2N7CA 2IVFB 1X4AA 1FFSB 4A8QA 2KFNA 3ZXWA 4M5KA 1SQEA 1D8ZA 2BJ3A 4LF4J 2G0JA 1T05B 3GV5B 4O44B 2WTFA 5H9EJ 4ED8A 2EFQA 1L3SA 1ZAXA 1Y11A 3N79A 1UW9A 4C3LA 1HNWJ 1NK6A 3NAIA 3DI6A 3MM9A 4FXWA 2VFSA 4CLWA 1ZPWX 1HI0P 4NA3A 2FTRA 3MAAB 3MFIA 4M5IA 4ZJQA 3VAFA 2HZCA 3NRBA 3G8TA 1UW4A 3AY0A 4AE5A 2MKIA 1W25A 1IBKF 4A8SA 3TR5A 4DL3A 2MQLA 2RB7A 3TZWA 2VASA 3MCSA 9RUBA 3T5HA 1Y4ZB 1HQ2A 4MAKA 2EFVA 3LALA 3D66A 2DNZA 4CTAB 4B9LA 1DURA 2MZSA 3OL8A 4H4OA 1GXLA 2KJWA 3ETMA 2BDPA 5E3PA 1KLMA 2ZITA 5AXNA 1KVKA 1YK9A 2NYHA 2B3TB 1PO6A 3PX0A 4EU0A 2R7RA 1XMOF 2FHJD 3PACA 2BUNA 2GNKA 2HVDA 3NMAA 3BSCA 3HVAA 3DOKA 2V63A 1L3KA 2VQEJ 1I51B 1RTIB 4ZP6A 4UQGA 2V2ZA 3NP5A 2NPIA 3TO8A 2W8LA 5D78A 2W1BA 3CTRA 5LJ5Y 2EC0A 1RISA 2FZKB 2KVQE 3K58A 4RNMA 3AODA 3BSOA 4DV4J 1B64A 3BN7A 3D67A 2H4WB 3M4XA 4ZLNA 3LTOA 5GADI 1NZ8A 2E7XA 4J9UE 2BV3A 2YWKA 1MG7A 2W9CA 1YDLA 1HD1A 1RU1A 1CJUB 1BQMB 4NYPA 3PJXA 1BD6A 1LWEB 2E7VA 1ZM3A 2L3MA 4ECSA 2YWHA 1R6VA 1ZPVA 3CCZA 3DLBA 1X31C 2PGCA 1CULB 4ZPWR 1Y0HA 2X1GA 3MOZA 5BR8F 1FK9B 3KHRA 1S1XB 1UZHA 4YQWA 2UXBJ 1FI4A 4M94A 1CJVB 3MMCB 3P49B 4DPXA 1SH0A 3CMES 2CRLA 1X0FA 3UWTA 3PY8A 2EG2A 4F2RA 4LF7F 2HYIB 1FRMA 4AL7A 2J6SA 2CG8A 1QLNA 1VC6A 2NSBA 2FGOA 3ILLA 2OELA 2DNHA 3NGDA 2M3DA 3H42A 1FKPB 2DNOA 1S9GA 5D77A 2V8HA 2FD2A 2V94A 4W92B 1REGX 2VFRA 1RCXB 3M6VA 1N8RT 1I5OB 5ETKA 2CPXA 2IMOA 4OI3A 2ZFHA 1H38A 3C14B 5BYSA 3AA8A 2C2OB 2UVWA 5GAHU 4CLUA 3A13A 1N36F 1D9AA 1S0VA 2CQ0A 1SJ4P 1C0TA 3P5BP 4G1PA 1X9SA 1GNKA 3AFGA 4DCOB 2MKHA 3LH2S 3M8PA 4DR7J 5IQ6A 5ETMA 4HDGA 1TKZB 2KB2A 3MAQA 4X4NA 1HQEA 5KFFA 4XPCA 1LNQA 2YWFA 4NMLA 1Y5NB 1KOHA 1T3NA 2D9PA 4PUOB 4TQRA 2AJ2A 4DR3F 5B0BA 2LVWA 1S49A 3UCZP 2J5AA 4KAIA 1XNRJ 2UXDF 2PA8D 4ATNA 3BPSP 2HNYB 4KC5A 1RWPB 4WWSA 1XR6A 4FYWB 2VH7A 4DR2F 2KYZA 1C4CA 2FLOA 2R4FA 2PDAA 1DAXA 1AUDA 1TL1B 4DR6J 2R7VA 2OPSB 1DLOB 1HBUA 1MU2A 2B5JA 1NK7A 2GMHA 1VBXA 2H5EA 3PYEA 3QWUA 4PYAA 2LQ5A 2J9DA 5I3UA 3FBCA 5ADZA 4RZRA 2P8IA 2X3GA 1UVNA 3MCNA 1ACMB 2HFUA 2BRKA 2PN6A 1EZZB 3KG4A 3BR9A 4G3IA 4P2FA 2G1DA 4WFZA 4YP3A 2FHJA 2XWYA 1H7WA 2WOMA 2XCPA 1UEKA 1U09A 3SCJE 3HJFA 4ZPTR 1SBRA 2OMLA 2XYGB 3NAHA 4OYBA 4MKBA 5D4NA 2VA3A 4X4QA 1KQKA 4ED7A 4C97A 2NUHA 1Q78A 2RD5C 2XB2D 4KIAA 5L1JA 2EVZA 3V4IA 1TVRA 2YNHB 4OHVA 1N5VA 5HANA 4FYVB 3TAQA 3GILA 3EXCX 1NB7A 2V5HG 3Q8PB 3DDIA 1QE1B 2RF2A 3BSAA 3OSPA 2DNRA 3ELHA 2OPQA 3AQOA 4DG1B 2M2BA 3EWGA 2R2SA 4WBFA 2LXIA 4DFKA 3VHQA 2RVJA 1TUGB 3SBMA 1O51A 5HQLA 4MT1A 3CW2C 5DZ6A 1J5OA 1Q8BA 1Q16B 5A8KA 1RYRA 2DNYA 5T41A 4ZCLA 4R5PA 2Y0BB 1U6BA 5HATA 3IWXA 4PXEA 1H3DA 1NDLA 3KK2B 3G87A 1D9FA 3TX0A 5IT9U 4X65J 3TYTA 3R7NB 3GR0A 2SXLA 2VG5A 1E6VA 4TU8A 4Y0FA 2MKSA 4F04B 2HS0A 4P72A 1VK3A 2V2KA 4A8KA 5LXRA 2DNMA 3HK2A 1C1CB 1C2PA 4S0MA 2MB0B 3TA1A 2JC1A 1S48A 1R8CA 3SSSA 2BM1A 4TY9A 4KGMA 3D1QA 2BX6A 2UUAF 1SC3B 2CAJA 3PFOA 3H4BA 2QA4G 5EN1A 3JTOA 3MM6B 1RT4B 2QLBB 2F8EX 2XG8A 5HP1B 3IA0A 5JXSA 3CVKA 4OI4A 1M5OC 3DHWC 3NCRA 1M1KT 1B99A 4JI1J 1WELA 1Q5VA 2VPZB 1UWAA 4R8UA 1AYEA 1W26A 3SSQA 3M30A 4A8WA 3GG0A 2DIVA 2DGTA 5GVQA 3R5BA 2CPIA 3ZTRA 4E0DA 4U6PA 4K4WA 1ZZFA 3OXGA 3AJ2A 4WYWA 3CJ0A 3HKZD 2EFNA 1RAJA 2EW9A 1NKCA 2ZVSA 3IXQA 3QZ8A 3E01A 5KG3A 1NHVA 3NLCA 3TX8A 3F73A 2QG9B 1FRHA 2HHWA 3G2XA 1F2GA 4ZCKA 2W2MP 1RLCL 2W4DA 5I4MA 3BQ1A 2OGUA 4KTQA 3K5MA 4OJHA 3Q8QB 3W7BA 4B3SF 2J7WA 3SYZA 4F0MA 5A0YA 4NCAA 2R7WA 2E5LJ 3CF5Q 3CCMS 4TN2A 3PW5A 2FZCB 1S9FA 2AV5A 3FQLA 2RRBA 5T7LA 4B3TJ 3IM9A 3O3LA 3VGTA 4TYBA 1TK0A 1WF1A 2OEJA 3LP1A 4CLFA 2AGQA 1GQEA 4PG6A 3ZC4A 4DV6F 5DQHA 1OS5A 3HF5A 4HH1A 3KDOA 2JWNA 2EBGA 3TRGA 2DNLA 4JI4J 3CIZA 4NEZA 3P3DA 3UPFA 1U2RA 2Y0SD 2R2RA 5I3QA 4NZ6A 4X4UA 4EBEA 1HNZJ 2EK6A 2XSJA 3W2VB 3J81U 3ICLA 3I6PA 3IBFB 1EKRA 3T5LA 1KSPA 2YQ3A 3X3UA 1XJWB 3A8KA 3M7VA 3CD5A 4LBIA 2LDIA 4AFFA 2I38A 3QIPA 4M95A 3Q8YA 3AHPA 4ANCA 2FQQB 3I56S 2CQ2A 4NXNJ 4C98A 3FCHA 1AFJA 3IGNA 1T9TA 4ED4A 3RB4A 4H4MB 3RR7A 2V2QA 2KT5A 1YWXA 2MQ8A 1M5SA 2OKQA 4F67A 2WW4A 1QJHA 2MHNA 7FDRA 2GIFA 1FWKA 2F4VJ 3OTCA 5CYQA 4L3KA 1J5EJ 2HFZA 3KLEA 3T1HF 4KR0B 4NLYA 3HHNB 5DG8A 4L73A 3A12A 4LSZB 1NZAA 1JIHA 2BJDA 3U1NA 3NEKA 1QDUB 2J6TA 4Y34A 4NEYA 2XMMA 1IKVB 3KLHA 3W3SA 2YH0A 2F8HA 2Y1IA 1TL7A 5FDLB 4G6VB 1YKWA 1SL1A 1F2HA 5HVHA 2EFPA 1U24A 1KRPA 1QVFR 3CSKA 2HLTA 1VRUA 3OFEA 1Z1ZA 2U2FA 2YNGB 2J0WA 3RUBL 1F5BA 1VK8A 3UO0A 4OJ1A 3ENWA 5ETOA 1RAAB 3RG6A 2OTLS 2VFTA 4NL5A 2N3OA 2DY9A 1T7PA 1VFJA 1VCTA 1BY9A 3M8SA 2B7BB 4HI1A 2P2CB 1FWPA 1CSJA 5H9FJ 1S79A 3V81A 3CJKB 1VQOS 1VR6A 3F56A 3LP0A 2KJVA 4C8LA 4KO0A 3SQOP 4CH1A 3U1LA 3KLVA 3B82A 2YWEA 1S99A 3SCKE 3VGVA 3EDRB 3NS5A 2NXCA 3H0PA 2DT9A 2XMWA 5DM6Q 2AMCB 4DPUA 2KG1A 3UN2A 2K3IA 4N76A 2RKIA 1WD6A 4FYYB 1R31A 3M8RA 1M1GA 2F4FA 1U0SA 2M88A 1FNMA 2C1EB 1NSPA 3I0SB 4I68A 2A2DA 1RAHB 2YKNB 2BE9B 2J9CA 4F25A 4DX7A 5C2GA 3GB0A 1Y9OA 3ILIA 3M2UA 4TKTA 1RE1B 4DV5F 2VC1A 5LXYA 4NLUA 1X4CA 3QGIA 4GVBB 5L1IA 1TK5A 4BS2A 5E3AA 2VQFF 4OX8A 8AT1B 4LFAJ 4WFBQ 4LBPA 1Z2ZA 3CDEA 2ZH6A 2H54B 5HBMB 1NCLA 1REVA 3MMBA 3S7RA 4C8NA 1U25A 1X5TA 5D4OA 3BGOP 2ZOMA 4ID8A 4FXDA 2VKRA 1RTJA 2ZE2B 2ZH8A 3SMZA 1NSQA 3JSMA 1IKYA 3MZIA 2FJDB 4DQQA 3TEHB 3V6HA 3WIUA 3VWSA 5IC6B 4F4AA 5AE1A 1LWFA 2HIQA 2K1RB 4Y6IA 2JX2A 3FCVA 1IKWA 2POKA 3Q2TC 3H2VE 1MW7A 1P9YA 1VISA 1R8BA 4BC9A 4DS4A 4ITSA 4DL2A 2QGFB 3MFHA 3DI6B 4OI2A 5GAGI 3MTJA 2V69A 4OZ5A 1UA1A 1TL5A 4ALZA 2DNPA 1EB0A 5KFKA 2YPYA 3CMQA 4Q43A 2VHGA 5C25B 4LR8A 4GMKA 4QZVB 4DL5A 4N47A 1XIQA 1NJYA 3F41A 1SJ3P 4NLVA 2MQMA 2GMLA 1SC4B 3V6DA 3DU5A 2F7VA 3EE3A 3BEGB 2C3MA 1NB2A 2HK3A 2E7WA 4F4KA 1NXIA 1VQ6S 2JDJA 1FD2A 2DGXA 1YITS 3DOKB 5HN0A 2DRAA 2ZBPA 2E9ZA 3IM8A 3CCJS 1XBWA 1F5AA 4WTYA 2NQPA 3VAIA 2ZHBA 1U6ZA 3PO5A 1WC3A 4MIAA 5FLXU 1RWMB 2JC0A 2BRLA 4CLLA 2PC6A 4OYIA 3H98A 3GLJA 1KONA 4YOEA 4A4JA 5ETTA 1CJTA 4ANEA 4OV1A 2W9CB 1NK9A 1VJQA 1SXLA 1URNA 4QWAA 3BBFA 4OFZA 2AHOB 3GPAA 3CD7A 3DGVA 5KFHA 1KEKA 2ATLA 2P6SA 4CCHA 3PEJA 2QL7B 2QA4S 2NZCA 4J37A 1RWUA 3ZTQA 2AYBA 5EDWA 3UVJA 1YTYA 2XSFA 1QD1A 2WVFA 2WONA 3GR1A 4URSA 5AJ3F 2HRUA 3GJQB 2ROGA 1WOPA 4NASA 4RBUA 2W8KA 3VV2B 1A0OB 4ID5A 4I2QA 3HP6A 3AOCA 3IR5B 1P1LA 4K0KF 3GV8B 1HR0J 5J2MA 1O0PA 2X7IA 4M5DA 1VQMS 2MDAA 1ZTWA 1NK0A 2LECA 5A6WA 3MMJA 3TQ1A 1OIAA 1HIYA 2KN4A 2BANA 3QWPA 1C0TB 4CDIA 2C3OA 2WB1D 2HWTA 1KR4A 3M8PB 2BBEA 3BGLA 1TL3A 4QWBA 2KZMA 4DHVA 4HHJA 4X64F 2XLIA 1JQGA 2V8PA 1RHQB 1HQEB 5JMNA 5G0RA 3T9ZA 4YHHJ 3GCWP 3OV7A 2HRYA 2HS4A 2C3UA 4DFPA 4NXMF 4Q45A 2YWGA 2C2EA 1CJKA 3KNAA 1OPIA 1G1XA 3FZ2A 5BYQA 3DLEA 4UOGA 2ZDOA 1S4FA 2XS7A 4PKDB 2CXEA 4WK3A 1QM9A 4FNIA 4USWA 1TMMA 2YKMA 2HHQA 5KOXA 3K8WA 2DIUA 2CADA 1HHSA 1X60A 2Y1JA 4ERDA 2E5HA 1HBUB 4O4GA 1MU2B 2B5JB 4OYPA 3R5DA 2CQHA 1QTMA 2R7UA 1SKUB 3GFYA 3CJ4A 5KFYA 3EGZA 1U8SA 5I3UB 4LIRA 4P6QA 3AOAA 1V9OA 1EQMA 2W9BA 2V9WA 4DUYJ 2PI5A 3D2WA 1IWAA 2PMWA 5LMNJ 1HW9A 3M05A 1URRA 2AT1B 4I6YA 4ZHRA 5LSLA 3D6TB 2W7AA 4IKAA 1MWYA 2J0SD 3CJRA 2WOMB 4JV0A 4CIOA 5IT9Y 3R5AA 4F4YA 2QL5B 5CABA 2RIJA 3LP2A 3DFEA 2CPFA 1V3RA 3BM7A 3US5A 1N56A 1DQ9A 2K7KA 4EEYA 1VQ9S 3L7UA 2G2OA 4NCBA 1KQFB 3V4IB 1TVRB 2RNEA 3DHXA 2HQGA 4I69A 1H7XA 3RR8A 1FDAA 1X8DA 3BKUA 2JEGA 2RF2B 2XYHB 3W66A 3AJ1A 2IA0A 1X5OA 1U1KA 2OPQB 1HL6A 1K73T 1RBLA 1FJ7A 2JRSA 3GIIA 1PKUA 3QSIA 5E0OA 2J7UA 8ATCB 2LFVA 2XNRA 3QJLA 2JEIA 2RRAA 1KTVA 7FD1A 1S6OA 1Q1KA 2BW7A 4NLRA 1RTZA 1MN9A 1J5OB 3HVTA 3G6VA 5A8KB 1JMTA 4IFVA 2IAJA 4RW8A 4DXLA 1HHQA 4R5PB 1TKXA 1U02A 4IOCQ 3OLAA 5K20B 3R5JB 1UP1A 2XZWA 5IM0A 4KHPJ 1WG4A 1ZBTA 1H6KX 4ZITA 5M2UA 2IPOB 3MM8A 5F0WA 1TAUA 5H9FK 2VG5B 1DQAA 2G13A 1E6VB 2HW3A 1T95A 4USMA 4ZVOB 4EYIB 2CPYA 1SUQA 2C2NA 2B9XA 1KC8T 2BE2A 2QX0A 1H74A 1RACB 4TNOA 3BGRB 3EZOA 5J2PA 2ADCA 1P8GA 4J91A 3NGTA 5F8GA 1UJ6A 4B3RF 4ECQA 1HNIA 4YS2A 1FXLA 1UJ4A 4RBTA 3DYAB 2CFXA 4O3PA 4RKUC 3O8WA 2ATCB 4L72B 2OMOA 3C19A 2RQ4A 4CLPA 2J0XA 3C8YA 3I5BA 3SDEA 4BHQA 4JI6F 2FLPA 5EWEA 4UY85 4Z7YA 1X4HA 1NKBA 1F9HA 1JB0C 2MEWA 3QJPA 1DFDA 1NAQA 2XI3A 4I4BA 1S0OA 3R8YA 4X62F 4R8UB 2LU1A 3BZQA 2LQ9A 2BR0A 3GYNA 3PRVA 3M30B 2V4JA 2D3O1 1RAFB 4ED1A 2LXFA 5IV3A 2JZ5A 1N33F 4F4WA 3HHLB 4EWTA 2HGMA 2XYPB 4RNOA 5EX0A 1K44A 4ECYA 3J81Y 4MKVA 2Z2ZA 4K4UA 3E01B 4TYAA 1RABB 3W65A 2UVRA 5KT4A 1FVQA 4NWBA 2VF3A 3ADAC 3D54A 3PHEA 3PHTA 2UXCF 2HHPA 2EG1A 1VQNS 1D9DA 3T3FA 1C0UA 3JQMA 1RA6A 4C2MA 2YKOA 3DKDA 2RHQB 3DLGA 1CG2A 3BDPA 1MSWD 3HJVA 5T7LB 5C2CA 3W5XA 1WKLA 1WNEA 2DJWA 3E3XA 3CCQS 1WSRA 5BR8J 1UFWA 3CO9A 4WXOA 3LP1B 3PRDA 1U8WA 2EEYA 3PEHA 4NLOA 2ZHAA 1AROP 1SL2A 4EO8A 4NLSA 4LSLA 1RTHA 3B4DA 3RW7A 1UL3A 3JSBA 1A9NB 4NZ7A 4U7UD 1VQYA 3CXCR 1JWWA 3IBCB 2YPZA 2XSJB 1VC0A 2BA9A 5THWA 2H48B 2HQ3A 5DG7A 5AXKA 3N5FA 4QW8A 3POTA 4OHXA 2F63A 2BJ1A 2IY5B 2XNQA 2YTCA 3QIPB 5LMUJ 3A3NB 2HHVA 3Q8RB 5IFMA 1T03A 2UP1A 1T9WA 4QCLA 3UE2A 4QIVA 2Y8YA 5KG6A 3J7AN 2DGVA 1WI8A 3FBEA 3AD8C 3H59A 1GEHA 3MEEA 3RYLA 1JLEA 4C0BA 1U1OA 2FVCA 1YJVA 5CYQB 3PO4A 3KLEB 2OHDA 5C42A 1M5KC 4DV2F 1FRXA 2DR6A 1RQ0A 2DRDA 5BYRA 4Y2IA 4I6WA 2ZZNA 4O23A 1RWNB 4ECWA 3K5PA 2I5JA 3UQSA 3KK3A 2VPXB 1R3NA 2XHWA 4JI8J 2NLWA 2NPFA 3KLHB 3CCWA 5F8JA 3P8BB 1TL7B 2X1AA 4Z37A 4DR5F 5KFWA 3GFXA 4FBTA 3BB5A 2CNKB 1VRUB 2UXDJ 3L4BC 1CJUA 5LSRA 1VRTA 3HKWA 3OFFA 3NNAA 2CDRB 4JI0J 2GQ2A 4LRCA 2AQ4A 1FJCA 4ED2A 2OAUA 1FERA 2FYXA 2KI2A 5HJYA 3ETOA 1JJ2R 3G82A 4M5GA 2E1AA 3EICA 4DV0J 3DC2A 2XS2A 1BWVA 3OVSA 3IN5A 2XGPA 1TP7A 3HSZA 2WVBA 4M5NA 3U27A 4Q8FA 2DPJA 2E1RA 2XEXA 3ZFVA 5CZXA 3H8YA 5DM7Q 1RSCA 2GIRA 3VAMA 5C7PA 2C3PA 3LP0B 3BS9A 1KHVA 1Q95G 1GH8A 4KO0B 4JB8B 4JYAF 1B3TA 1WOOA 1UVLA 1WG5A 1MN7A 3R7SB 4LF9J 3F44A 3MUMP 2E66A 5GAEI 2YXLA 1WC4A 1JNRB 1TL4A 1FTCA 4OLPA 2RKIB 3P6YC 4LJMA 2HVZA 5D4PA 1V3SA 1TKDA 2LKZA 4RUHA 1VQ5S 3FRYA 4IDKA 4XO0A 1DTTB 2WBMA 3OXLA 1PIEA 3THVA 3M2UB 4DCPB 3MR7A 1T02A 3R27A 6FD1A 2PMZD 1S1UA 4KGZB 1TKZA 3GIJA 1FRLA 4DR4F 4UF4A 3V2UC 4ELVA 4BLGA 4JV1A 3DRRA 4JP8A 1U1PA 1Y7PA 1SC6A 1KN6A 2VB6A 4ECVA 1REVB 3BJYA 3MMBB 4R25A 4I6AA 5DETA 1Y10A 2YKAA 3KG0A 4LFCF 1PYOB 1SIWB 1RTJB 3PCOB 3RAMA 3OFHA 4P74A 2HURA 4NYOA 3Q22A 3MD3A 3JSMB 1IKYB 1UETA 3NBPA 4LR7A 2HZVA 3JQKA 2XMKA 4RR5A 1N6QA 1LWFB 3RBZA 2KU7A 1RLDA 3Q86A 3FK4A 2VFVA 5HMZA 3L7OA 1IKWB 3HPOA 2RMLA 2MQOA 2OFGX 5FLXY 1DLOA 3NS7B 2IC3A 1LW2A 4QIFA 3OHBA 3DLLQ 2R2TA 3QYYA 2HFOA 1TV6B 3B54A 3OSNA 4B9VA 3ZNUA 4F3QA 2G2ZA 2CG4A 4YEAA 2GIQA 1VQ7S 4C8YA 3OJUA 4ZCIA 4KKOA 1TK8A 1UVKA 2PE8A 1RAEB 3AA9A 2RAQA 1S4EA 4FYXB 2V6AA 2L08A 3MPVA 2IHR1 3IS9A 1U47A 3LWMA 2RE1A 1YBAA 3R97A 5KFJA 1ELOA 2W9AA 4OYZA 1HW8A 4OI1A 1LQ9A 2UUAJ 1QTNB 5IZHA 3V6DB 4Y2AA 4G1QA 2VG6A 1FRKA 3GIMA 4OZ1A 3CCSS 1UJ5A 4J9KA 1CQMA 3QRPA 2DO4A 2WZ1A 2JFDA 1H73A 4CH0S 4YB7A 1YG0A 3OTOF 3CJQA 2OI2A 4AL6A 2GAHC 1HYSB 1HHTP 3GG1A 2VBXA 3NNCA 1F3FA 3AD7C 2JLFA 2XMTA 3N0VA 3CUNA 2UVVA 4H54A 5KFVA 3J7ZT 5KFIA 2LQBA 3EMTA 2G2YA 3DRPB 3IRXA 5IXUA 3M9NB 2AZ1A 3EGWB 2QE5A 4RPFA 1GTHA 1PJ6A 3C16A 4CO4A 3I87A 1S9EA 4AXJA 4B02A 1FKOA 1SI9A 4DU8A 1CJTB 2RQMA 1KOOA 2E5GA 4RL1A 1FVSA 3LANA 4ES3A 2W2NP 3DN9A 4OZLA 5DGAA 5HO4A 1X4BA 4B3MJ 4OI6A 1N32J 3RW6A 1IXKA 1WWHA 4QOTA 3PM9A 2JVRA 4P71A 1YZ7A 3MECA 1HWUA 4LVOP 3UW1A 3KJQB 1U6FA 4UOCA 2ZNYA 3HLUA 3J81j 2HFVA 3UVJB 3I4HX 3D6HB 3ILOA 4ZVSB 3MMAA 3O6QA 2WONB 4DV6J 1NMEB 2GO8A 2Q6CA 1TMJA 4MJKA 4PABA 2RHSB 1R0AA 1M5HA 3W8PA 3KTQA 4ID5B 1ZAVA 1VLOA 4HT7A 4I2QB 2K06A 4TLRA 3IAM9 4PPZA 1WKJA 5J2MB 2UUBJ 3GJSB 4M5DB 1F9FA 4WF9Q 3D6FB 5KT6A 3MM6A 3ITHB 4UOHA 3SFGA 4KJIA 2QRRA 2BANB 3PIPQ 2A6MA 2FJWA 3J7A1 2LU2A 4WJBA 4CNZA 2QIFA 4ZPVR 3VF0B 1IBLJ 3KNGA 2DCLA 4EUVA 3NL0A 4ECZA 1TL3B 4RW7B 4N5SA 1KD1T 4NZ0A 2MJUA 4N7TA 5D0RA 1HFEL 3QLHA 2O5DA 5G0RB 2G1HA 4URQU 4IOAQ 2BVZA 5EWGA 3T1HJ 1JLAA 3K5NA 3I96A 4C48A 4ZS6A 3DLJA 4MIWA 1CJKB 2DNGA 2P9EA 2GHPA 2B8PA 3C3LA 3LQVA 3DLEB 3Q8SB 3H90A 5MLCV 3NGKA 1V3ZA 5KG0A 5CA5A 1UEVA 3T5KA 3R2CJ 1VJWA 3QZ7A 3PW4A 2VQEF 2D74B 2APOA 2MZJA 3MGJA 5GAHI 2ADBA 2YKMB 1IR0A 4U8YA 1PCAA 4YR2A 2FUG9 1O5JA 4O4GB 2BKOA 4DV4F 5KT7A 4J9RA 1LOUA 1MROA 4B17A 1QUPA 2AIRB 4C9DA 3CCUS 5SUHA 5HI7A 2FY8A 4QR1A 3CO0P 4G1IA 3KHGA 3UNYA 1PC5A 1JLQB 1YBUA 4TVAB 5GMDA 2V0NA 4UOFA 4K4VA 3PR5B 4ZLPA 5F8IA 2NXJA 1RJJA 4D3HA 3LP2B 1S1WA 1UWBA 1R6YA 5B0GA 1I3OB 2CVEA 2HNZA 1TFYA 3JTNA 1WC5A 3AAWB 3QGPA 2KO1A 1BWEA 4WK1A 3RRKA 2MQNA 1HI1A 3IMQJ 3K89A 2GVDB 1RT3A 3EPIA 3KJFB 4DZ6A 3VZIA 5GMEA 1HWIA 4CLKA 2GQQA 3QRRA 2UV8G 2VBZA 4ELUA 2GO9A 5JJBA 3RB6A 2Q79A 5E2QA 1V5VA 1KHWA 2W2PP 1WKKA 3ZZYA 4CM0A 2VQFJ 4C8ZA 3DMJA 4WFNQ 3T1AA 3AD9C 4TXSA 3T9NA 2M70A 2LLZA 2YWWA 3HVTB 4V19X 4P73A 2VC0A 1U49A 3FSXA 1B7YB 5GAEU 1R8PA 4IFVB 2IAJB 2DNNA 4RW8B 2M52A 3RAQA 1TKXB 3CCVS 5CYJA 5F9NA 2ROEA 1WDDA 2F5GA 4XPEA 2FJBB 3HHKA 3IO1A 5IM0B 3D3CJ 1W2IA 3SCLE 5DLFA 3ET6A 1VQPS 3O2IA 3TAMA 4QPXA 2YNGA 1QY7A 2Z0GA 2ASYA 1U1QA 1YJNS 2R2UA 1NH7A 2H1YA 1JLBA 4NCGA 3BGFA 1XNQJ 3HT0A 1SUQB 4DLEA 4EYHB 1XC9A 2Z58B 4DMZA 2BE2B 1U26A 2PD1A 4J90A 4L6V3 5J2PB 1UKUA 3C6TA 2XMUA 1FNOA 5A8RA 3KLFA 5HK4A 2L9DA 1HNIB 2XO6A 5DQGA 4AT1B 2DNQA 4DR6F 1Y3KA 3KFWX 1NLKL 1R8AA 4ZKAA 2QYCA 1GXTA 4F8RA 3SDEB 4OX6A 2HNDA 3QATA 3MR6A 4QR0A 4DWIA 2AGOA 1NBEB 4Y3CA 3Q0AA 5B09A 4O3NA 4PR6A 1SJQA 3I0SA 3L09A 2V4JB 4Y2MA 3QGGA 2DNKA 2B0GA 2AGPA 2DPIA 1T0TV 4A8MP 1LK7A 4MTPA 2R7SA 4ENOA 3MCOA 3PG9A 4FNHA 4TU9A 4K5RA 4BCAA 3TOQA 2CJBA 2B4OA 4D3GA 3NWGA 2ZBCA 2WSEC 1VQSA 1LV5A 1FKAF 2QYGA 3DXBA 3J80U 3BH7B 3PZPA 5HMYA 4HT5A 4JV2A 4P52A 4C7QA 1S77D 5AT1B 4CRJA 1YJTA 4ZVTB 2J9DE 3M8YA 5CQGA 2DGUA 1C0UB 1Y5IB 2KTQA 4USIA 2O66A 3TWZA 4I7FA 1U0HA 3GCXP 3HSDA 2JSXA 2C2RA 1HBOA 3W5ZA 4C3KA 4DV7F 2BJEA 2XULA 1FFGB 4HTJA 4NPOA 2FVPA 3DLGB 3RAXA 5HLFB 2XMJA 3V5RA 3WC2A 1JLCB 4ED6A 3KJVA 3C66A 1BLUA 2D41A 4OZ0A 1ZH5A 4DQRA 2ABYA 1WORA 2AZ3A 4WP8A 1Q7YT 5K8PA 2Z57B 2XLJA 2K1RA 2CA9A 4Z7CA 3EXYA 4LSLB 1RTHB 2F3JA 3PYFA 3D6MB 3OL9A 1BC6A 1NHKL 2XS5A 5AJ3J 3FUYA 2GA7A 4QYRA 4FF3A 1IR2A 3GSIA 4DV3J 4CQ1A 4X65F 3K7RA 2XGQA 3U02A 3POTB 4C8MA 4CI0B 4FPRA 3PTWA 4CNYA 5C25A 4A8XA 4KV8A 3FVYA 4K0KJ 5IS2A 2LDYA 1WEYA 4A48A 3CJTA 1T03B 1KFSA 2XWXA 2HSEB 4IFYA 2QV6A 3BYPA 2DHXA 2H4YB 5ETVA 2BABA 2IM1A 2FY1A 2MY8A 3WDOA 2NREA 3MEEB 1GT8A 1JLEB 1RP5A 3G86A 2M8HA 4LQ9A 5AE3A 2MYFA 5KG1A 3LPYA 5C42B 2LEPA 4LF6F 2W01A 2OD6A 3VAHA 1VIXA 1R43A 2H5JB 2R7XA 4BWMA 4J9SA 1NDCA 4M1KA 2I5JB 2C2ZB 1S12A 1FDNA 3KK3B 2A6OA 4NXMJ 1UCNA 2Q43A 2XY6A 4ZVFA 4USJC 3IP0A 1ZOTA 2QEXS 1SH2A 2QL9B 4LUBA 1LWCB 2LEAA 3GP9A 1VRTB 3G8QA 3M6WA 5F8LA 2FC9A 3OR1A 4P2MA 2G9OA 2GAGC 1SQGA 1ZAWA 5CD4A 3G82B 4JUZA 4K8RA 1FDDA 1RT6A 2VV5A 2V8GA 3HM9A 1S97A 1N5QA 4K5SA 5J2QA 4PQAA 1RTDA 2B9EA 5IC4B 4N8OA 3GWCA 3KYLA 1JX4A 5KFGA 3KHLA 2LQJA 5C5JA 4JV5F 2E5LF 4TQSA 4DQPA 4WFXA 2C22A 4ZA1A 4RBVA 5M2RA 4B3OA 2ZH1A 1PJ5A 3BF4A 3IRWP 2GX8A 1B4SA 3K2YA 1QUVA 2WRMA 1S6QA 1UTAA 4NYZA 3CJ2A 3K0JA 5DLGA 5A6PA 1Y3JA 2JH3A 2ZUAA 4IDKB 3JS9A 1RYSA 3TNVA 2EK1A 5LL6d 3AJDA 4BC7A 3UI3A 1IBMJ 5D0GA 1UVJA 3A8IA 2K8GA 3G6ES 4NLQA 4EGLA 1TZ0A 1S1UB 2RS8A 1UAWA 2B6AA 4MYTA 2YNFA 2XLKA 4QBUA 3DXSX 1U1NA 3DRRB 4HACA 2Q6BA 3OL6A 2QSWA 3TARA 2J6UA 4NXNF 5HSPA 3NGSA 5EWFA 4IYQA 4RX6A 3UNGC 1ULRA 4FF1A 2HHTA 3GSDA 2ZH2A 1IR1A 4AYBD 3HHLD 3QT7A 2FVRA 1U45A 1RGVA 1J5EF 3NBPB 2CZVC 2NXUA 1QSSA 1HLWA 2V4RA 1N6QB 2HAFA 1MMDA 1RUSA 7AT1B 4UZBA 3K57A 1B70B 1FXDA 4HVZA 3JTPA 2ZJQQ 1EARA 2IC3B 1LW2B 4AD6A 2Z8QA 3HHLC 2EC2A 1RI7A 4RUCA 3MPYA 3LW5C 3DOMA 1M90T 3M9OB 4ZPCA 2MZTA 1OY6A 4KKOB 3G71S 2V67A 2CQIA 3IS9B 1RDRA 3OW2R 2E9TA 2NS1B 2XZTB 3J7YU 4G1QB 2VG6B 1VLYA 3MR3A 1X4DA 4JI6J 2KT2A 3B78A 2M9KA 1IM4A 4WZQA 2DXFA 3IR6B 2LCWA 5HROA 2DXDA 4DF4A 3QAUA 4IRCA 3LO3A 3BO3A 3ILJA 3IRXB 2VICA 2FGCA 1DZ5A 3C16B 2L9NA 2OUGA 1GMWA 4ZVQB 2YBVA 3KWMA 1S9EB 3W5YA 3GIKA 1FKOB 2C2KB 2X51A 2D1CA 3UDVA 4DSEA 2KM8B 2DGQA 5K9FA 2UXCJ 1Q8KA 4MK8A 4CO0A 2ILYA 2JVOA 1PSDA 3MECB 2X1BA 4ZPBA 1RKJA 4DOZA 1ITPA 4F4XA 1R89A 4ICLA 1CC7A 5L9NA 3TW0A 3MMAB 4AQYF 4P7VA 1U2CA 1NM2A 4DUZF 5CCLA 2VZ9A 5I3PA 1N52B 1R0AB 5DZ7A 3H40A 3OXFA 3PV8A 3BGRA 3G6XA 2WSCC 3DGPA 2CNOB 4WPAA 1GMVA 1KVIA 5D4LA 4X4TA 1HNVA 4CO3A 5HQMA 3PJ9A 2FDNA 5HVGA 3DYAA 4ILMA 2O67A 5KFEA 2BKPA 2C42A 4F0KA 3D3BJ 4Y2KA 3FFIA 1AZSB 3DLKA 1YRTA 2O01C 2DISA 1HNXF 4ECUA 1R0BG 4LIWA 2AEFA 4ETXA 2DHHA 2GGPA 3I31A 5KFMA 2B43A 1NKEA 5HMXA 4NLTA 2AEJA 3CDAA 1IJEB 3QLHB 1FJGF 2JJ4D 4K59A 4MH8A 2DTJA 3HHLA 1YQHA 2HHUA 5GMKa 3WC0A 3SSRA 1SJRA 2PI4A 1NK4A 4ES2A 3PNIA 5U47A 2AYEA 1JLAB 1IBCB 1WC6A 2AD9A 1VDHA 2RU9A 4DV2J 3IAS9 4C11A 2B56A 1X9WA 3HXMA 1WACA 3DRYA 5KG5A 1VI7A 5L46A 3Q2SC 5DO2A 3CDBA 4RNNA 3GQCA 1BQXA 1F0XA 4XIUA 4DR5J 1WF2A 1AW0A 3KOAA 4FF2A 1SH3A 4V1Ak 4X84A 3MOJB 2Y9HA 1MROB 4MK7A 2UU9J 5HL7Q 3W8GA 2WSFC 3JYTA 4FVCA 1I94F 4FS1A 4X4PA 4W90B 4RWXA 5ETPA 4IG0B 4DX5A 2HHHF 1E6YA 4F02A 3DOLA 5D0HA 3Q8UA 3D0HE 4QPTA 3V6KA 5EUHA 4U67Q 4LREA 2HRTA 2OO4A 5IV4A 2YVSA 2VD3A 3AQPA 3JAMU 4IRKA 2UZAA 5KG7A 3PW2A 1S1WB 1G6BA 1UWBB 4MFBA 4WFYA 4NA2A 2RSQA 2HNZB 3TUJC 4DSKA 3MAHA 3CULA 3NGRA 1B7FA 4PXDA 5D0EA 2WHOA 4Y28C 1RT3B 4EBCA 2AKWB 3NKYA 3MEDA 1P27B 2MZ1A 3MDFA 2BZ2A 2KXNB 1RWKB 3ZZPA 3ZNJ1 2DHAA 2CPDA 1JLGA 2J8AA 4OHZA 3DMJB 1IQZA 5KFNA 1SV5A 4DR4J 3GV7B 2AYMA 3U7JA 4MKAA
chains in the Genus database with same CATH topology
3BS9A 3C6UA 1KHVA 4HDGA 3R1HA 1TKZB 4DEZA 1GH8A 2KB2A 3MAQA 3HZGA 4KO0B 4OHYA 4JYAF 4X4NA 1UVLA 1R8HA 1WG5A 1HQEA 5KFFA 5GAEU 4XPCA 2YWFA 3F44A 4NMLA 4RU2A 2XY7A 1Y5NB 5F8MA 3UDLA 3KKFA 3MUMP 1KOHA 1T3NA 2E66A 2DRBA 2D9PA 1LFWA 5GAEI 2QA2A 3SZ2A 4PUOB 4TQRA 3HI9A 2GMJA 5E3QA 1JNRB 1TL4A 4OQJA 5AXLA 3VAJA 1FTCA 4DR3F 2V8VA 5D3GB 3NG8A 5B0BA 4OLPA 2LVWA 4IR1A 4YHHF 1S49A 4IOBA 2RKIB 2W4CA 3TAMB 3UCZP 2R8GA 3P6YC 1N0UA 1N4LA 2E44A 4LJMA 2J5AA 2HVZA 4KAIA 5D4PA 1V3SA 1XMBA 4YFUA 2UXDF 1TKDA 2PA8D 2LKZA 1KS2A 3QIDA 1VMBA 4ATNA 2HNYB 4KC5A 4RUHA 2E1MC 1UFLA 1VQ5S 1JLBB 1ZETA 1DBDA 3FRYA 4IDKA 4NCGB 3J80Y 4XO0A 5DJBA 1DTTB 2WBMA 1JXEA 3GYXB 3OXLA 3M2RB 2QSFA 1VGYA 4ETZA 3THVA 2WW8A 1XR6A 3M2UB 2J9EA 4ZVGA 2IVMA 2LA6A 3CJ5A 4K50A 3K59A 2VH7A 4K4XA 4DJBA 1G2EA 3QAEA 2JLGA 4DR2F 2KYZA 1C4CA 5KFLA 1T02A 3R27A 3M8QA 2FLOA 3C6TB 4KBIA 4DL7A 2R4FA 2YKPA 6FD1A 2PMZD 5A8RB 1S1UA 2PDAA 4HEA9 1DAXA 3KLFB 2GV1A 2ZJPQ 1AUDA 1TL1B 3ZZ0A 2R7VA 2OPSB 1DLOB 1HBUA 1MU2A 3H5YA 3KMQA 2B5JA 1S7HA 1TKZA 1FRLA 3GIJA 2GMHA 1NK7A 4BDPA 1IBMF 4DR7F 4DQSA 1VBXA 2H5EA 4DR4F 1JKHB 3V2UC 1OQ6A 3S8SA 4ELVA 1QAIA 4FYDA 1LW0A 3QWUA 4WKYA 1DARA 4QWCA 4JV1A 3EGNA 3GFZA 2B4VA 3DRRA 3LGMA 2LQ5A 3TVKA 1U1PA 1ZM2A 3DNCA 3J7YI 2J9DA 2FLNA 5I3UA 1Y7PA 1SC6A 5ADZA 4RZRA 2HNDB 2ZHOA 1I6JA 1KN6A 2VB6A 1KTQA 2CJQA 4OIXA 4ECVA 1REVB 3BJYA 3MMBB 2DGSA 2X3GA 1BQNB 3BREA 4WIIA 2L41A 1UVNA 2ZC4A 3I5AA 4R25A 4I6AA 5A8WA 2YKAA 4TY8A 5DETA 2IA6A 2KYXA 3KG0A 2OJ3A 4LFCF 1ZTTA 4PWDB 4ZP7A 1SIWB 2JEFA 1RTJB 3RAMA 3OFHA 4IG3A 4NYOA 2BRKA 2PN6A 3Q22A 1RK8A 3MD3A 1X9MA 3KG4A 3JSMB 3BR9A 1IKYB 2ZOFA 4DUYF 2OFHX 4G3IA 2PEHA 3ENQA 1UETA 1G7CB 2G1DA 3O44A 2V4QA 1N5SA 4WFZA 1DTTA 3NBPA 4K4TA 4YP3A 2FHJA 1SKSA 2AJQA 4FZVA 2XWYA 1H7WA 2WOMA 1K8AT 2XCPA 1U09A 3SCJE 3MI7X 1XNRF 3HFKA 4RUAA 2XMKA 4ZPTR 3HJFA 4Z2XA 1N6QA 1SBRA 1LWFB 2KXHA 2OMLA 3NAHA 2KU7A 4MKBA 2DHGA 5D4NA 3G8SA 2A2CA 4B9MA 3HX9A 5KFQA 2VFVA 2VA3A 4X4QA 1KQKA 4ED7A 5HMZA 3L7OA 2PFFB 2E1CA 1IKWB 3HPOA 3G4SS 2RMLA 4C97A 2MQOA 2OFGX 5FLXY 1DLOA 3OVBA 2NUHA 3QGHA 2BXJA 2VG7B 4QIWD 1Q78A 2IC3A 2RD5C 4RNFA 2XB2D 4KIAA 1LW2A 4QIFA 3OHBA 3DLLQ 2R2TA 3QYYA 3UCUP 2HAIA 5I42A 1IJFB 2MY7A 5L1JA 2B4UA 2EVZA 3V4IA 1TVRA 2HFOA 3SFUA 2XMVA 2VA2A 3H5XA 2YNHB 1TV6B 4OHVA 4OZJA 5K14A 1N5VA 3OSNA 4I64A 4B9VA 5KFOA 1XTZA 3TAQA 5E5NA 4WXWA 3OUYA 3GILA 4N77A 4F3QA 4EO6A 3EXCX 1NB7A 2CG4A 2V5HG 3B4MA 2GW8A 4MMOA 4YEAA 3Q8PB 2GIQA 1KQGB 1QE1B 1VQ7S 4PRFA 2RF2A 3BSAA 3I5CA 3TA2A 4B9TA 1FF2A 2ZKUA 3OSPA 3OJUA 4ZCIA 4KKOA 1TK8A 4C8YA 1UVKA 2PE8A 3FZBA 2DNRA 4I7FB 2OPQA 2D7SA 3AA9A 3AQOA 4DG1B 2M2BA 1VS3A 1S1VA 3FSIA 1FNXH 1VC5A 1HBOB 3NCQA 2RQCA 2R2SA 1FJEB 3VALA 2L08A 3MPVA 2IHR1 4A8OA 3LF0A 3IS9A 2LXIA 1U47A 1FESA 2FIUA 3LWMA 2RE1A 1YBAA 3KJVB 4DFKA 3TVYA 4UQTA 3A1YG 2RVJA 3CJ3A 5KFJA 1ELOA 2W9AA 1X4EA 1HW8A 4OI1A 1O51A 1LQ9A 1N88A 5IZHA 4IUFA 3V6DB 4Y2AA 4G1QA 1J5OA 2VG6A 1FRKA 1Q8BA 2J0QD 1Q16B 3GIMA 5A8KA 4KRWA 2VKZG 2CYYA 3MM7A 2E29A 1VHFA 4OZ1A 5B08A 5DQIA 1UJ5A 3VZHA 3CCSS 1K0VA 2MQQA 4J9KA 1RYRA 2DNYA 3NS6A 4OJ3A 1JLFB 5T41A 3FQKA 4ZCLA 2NUUG 2AX0A 4J9QA 4R5PA 1YRXA 4DQIA 1UVMA 2R8JA 1CQMA 4H4KA 2DO4A 2MKJA 3B8HA 3HT3A 1U6BA 2MQPA 1K9MT 2JFDA 2IJNA 4V19J 4GC7A 4CH0S 4YB7A 1VIOA 1YG0A 3IWXA 3OTOF 4PXEA 1H3DA 3HO1A 1U7LA 4RW6A 3KK2B 1D9FA 1N0VC 4AL6A 2DGWA 4IH7A 3TYTA 1HYSB 1TV6A 3ZZRA 1HHTP 3GG1A 5CHCB 1NNDA 1P1TA 1WHXA 2VBXA 2IRUA 3NNCA 2I9SA 4I2PA 4WE1B 3GR0A 2JLFA 3EZ5A 4UW2A 2XMTA 3KK1A 3N6NA 3PX6A 2SXLA 4KHPF 3N0VA 3UR3C 2VG5A 3O1LA 4H54A 5L8RC 5KFVA 3CUNA 2OPPA 5KFIA 3J7ZT 2UVVA 3T19A 2EI5A 1E6VA 2LQBA 4X66F 1S0NA 3DRPB 4TU8A 3IRXA 3SCIE 2AJFE 4Y0FA 5IXUA 3M9NB 3EGWB 2MKSA 2QE5A 1HBMB 3WZ0A 1GTHA 2HGLA 4CO4A 3I87A 5KG4A 2HS0A 5J2NB 1S9EA 4AXJA 1VK3A 2JLEA 4N8NA 1FKOA 1BGXT 4KV8B 1SI9A 4B02A 2YH1A 2V2KA 1LKZA 4KHRA 4A47A 2KFYA 1CEZA 4A8KA 2RQMA 5LXRA 1KOOA 5CZVA 2E5GA 2DNMA 3U1MA 3HK2A 3VCDA 1FVSA 1C1CB 1C2PA 2FJEB 5KFCA 2MB0B 5C24A 1QAJA 5GAGU 3LANA 3TA1A 2JC1A 4YMEA 1S48A 4ES3A 1KQSR 1B0VA 3DN9A 1R8CA 4IFYB 4OZLA 5DGAA 3SSSA 5KFDA 2BM1A 4ECRA 3VTIA 5HO4A 4TY9A 1X4BA 3IG1B 1JLFA 4OI6A 1B0TA 5L39A 4KGMA 3D1QA 4Q2LA 2UUAF 3PFOA 3H4BA 4K2XA 3RW6A 2QA4G 1IXKA 5EN1A 1WWHA 2B7CB 4QOTA 3JTOA 2FVQA 3MM6B 1D8YA 1C1BB 3PM9A 2JVRA 1RT4B 1HMVA 1LXNA 2F8EX 2XG8A 2B9YA 5HP1B 4LSNA 3MECA 2A18A 3IA0A 1HWUA 5J1NA 2DR7A 5JXSA 4LVOP 4WKRA 3J7Z5 2L9WA 3UW1A 5KFAA 3CVKA 4OI4A 1U6FA 4UOCA 4J9LA 3T6JA 1M5OC 3DHWC 2L48A 2ZNYA 3NCRA 3HLUA 5A0YB 1M1KT 4QQBA 1HYSA 4ELTA 3I4HX 3RRGA 1WELA 2MGZA 2ZD1A 4DSIA 3BGUA 1N34F 3HDSA 1M5VC 3GMGA 3V4MA 2VPZB 4R8UA 3MMAA 3O6QA 2LMIA 3SSQA 2LA4A 3M30A 4A8WA 3GG0A 1NHUA 2KT3A 2DIVA 2WONB 3DRSA 3LWLA 3DRPA 2DGTA 2HWIA 5GVQA 1QSLA 4HL9A 3R5BA 2CPIA 1Y00A 3EPGA 4E0DA 4C8ZA 4U6PA 1GX5A 4K4WA 2GO8A 1ZZFA 3OXGA 3CEDA 2Q6CA 3AJ2A 4MJKA 4WYWA 1R0AA 2CZ4A 5J2NA 1M5HA 3CJ0A 3KTQA 4FBUA 3HKZD 4ED0A 4ID5B 1ZAVA 2EFNA 4MIBA 4ZVEA 5KOWA 4HT7A 1RAJA 2ERRA 5F0UA 2EW9A 4F50A 2K2PA 4I2QB 2QLWA 2Q1LA 1NKCA 2MSTA 1T05A 4TLRA 2ZVSA 3IXQA 2CPZA 3IAM9 4PPZA 3SV3A 3QZ8A 3E01A 4O44A 4C4WA 5KG3A 4URGA 1NHVA 3NLCA 5J2MB 3TX8A 3F73A 1Q86T 3GFHA 3IG1A 1TFWA 4M5DB 1F9FA 3OR1B 4O3SA 3CIMA 1FRHA 4PCQA 4KHMA 2HHWA 1F2GA 4ZCKA 2W4DA 4WF9Q 5I4MA 4U7UK 1WHWA 2YNIA 3BQ1A 4OI0A 5KT6A 5JVHQ 4KTQA 3K5MA 4K4YA 3MM6A 4OJHA 2VPYB 3ITHB 3SFGA 3Q8QB 4KJIA 3W7BA 4B3SF 2QRRA 2J7WA 2BANB 3SYZA 2I8EA 1RT6B 3PIPQ 2FJWA 2DR5A 3J7A1 4KQZA 2LU2A 4WJBA 4U7CA 5J2QB 2FHOB 1N5YB 1RTDB 2FLLA 4CNZA 2QIFA 5A0YA 4NCAA 2HVIA 4ZPVR 3VF0B 3MUVP 2R7WA 3CF5Q 3CCMS 1DRZA 5HMWA 1RT5B 2OPRA 3D5MA 4TN2A 3KHHA 3PW5A 4C3MA 3KNGA 2DCLA 2ZNZA 5DDQC 2BYCA 1S9FA 4EUVA 2HFNA 2AV5A 2B51A 2B4PA 1TKTB 3FQLA 5KT2A 2KZZA 4R0JA 1NJIT 4ECTA 4ECZA 1TL3B 3NL0A 4RW9B 4RW7B 4N5SA 2RRBA 1KD1T 3QO9B 1D0EA 4NZ0A 5T7LA 2MJUA 4JI1F 4QWDA 3VAKA 3O3LA 3E2EA 4TYBA 1FO1A 2MJNA 3KLIB 1HFEL 3QLHA 2O5DA 4CTAA 1TK0A 1WF1A 4B3OB 5G0RB 5B0EA 2DGOA 1YJ9S 5DRKA 3CWJA 3H5UA 4DN0A 2ZH5A 2F1FA 3LP1A 5B0CA 4DDFA 3D1HA 4URQU 3PW7A 1GQEA 2AGQA 4IOAQ 4PG6A 4M8LA 2BVZA 4RW4B 5E41A 5EWGA 3ZC4A 4DV6F 5DQHA 1JLAA 1HBNA 2EFOA 2YKQA 3I96A 1OS5A 5FIIA 3K5NA 3HF5A 4HH1A 3OL7A 2JWNA 4TLQA 2EBGA 3TRGA 4ZS6A 2DNLA 3ISND 3DLJA 2DD8S 1S6QB 3CMAS 1IKXA 3CIZA 2F8MA 3C2PA 3C46A 4MIWA 1HPZB 3SQGB 3DLHA 2DNGA 2P9EA 4K4ZA 4FP9A 4CO5A 2GHPA 3P3DA 3UPFA 1RTIA 1U2RA 1W2BR 2Y0SD 3FMBA 2R2RA 3LQVA 1RT1B 3DLEB 5I3QA 3Q8SB 3C3LA 5MLCV 5KT3A 1FE4A 3NGKA 5L1KA 4NZ6A 2HMIA 4IQXA 1V3ZA 2LYVA 2C3YA 3I9V9 3MD1A 3RTVA 5KG0A 4X4UA 4EBEA 5CA5A 1UEVA 2ALZA 3ITHA 2BQRA 2EBEA 3T5KA 1VJWA 2EK6A 2B9WA 3IC1A 3PDNA 5IQQA 3QZ7A 3W2WB 2VQEF 3PW4A 2XSJA 3VQSA 3W2VB 2D74B 3H20A 2APOA 2MZJA 3I6PA 3ICLA 3MGJA 2ZH4A 5GAHI 3P5TL 3T5LA 1KSPA 5CYMB 2YQ3A 2ADBA 3BR8A 2YKMB 3X3UA 5F8HA 2MKKA 1C4AA 3PVXA 3VQTA 1U1LA 3CD5A 2RJZA 1IR0A 2LDIA 4YR2A 3H25A 2FUG9 2B6AB 2MHEA 3ISNC 1O5JA 4AFFA 1L3VA 4O4GB 2I38A 3QIPA 4M95A 4RW9A 4RW7A 4DV4F 1Y5LB 3AHPA 5KT7A 1P6TA 4DN9A 4J9RA 3I56S 4J9NA 1LOUA 2CQ2A 3M2VB 1MROA 2YNFB 2IM3A 4B17A 4C98A 3FCHA 1Q53A 3CC4S 1AFJA 2KHCA 3IGNA 1BQMA 1QUPA 4ZP9A 1LWEA 2ASLA 2CQ3A 5LMUF 1S76D 1QVGR 1NH8A 3RB4A 3K8VA 3CCUS 1U4BA 4B3TF 4C9DA 3M1VA 4RW4A 4H4MB 3RR7A 5SUHA 5HI7A 2UU9F 1LXJA 2KT5A 1YWXA 1M5SA 2OKQA 1FK9A 4QR1A 1S1XA 4Y2CA 4F67A 5DDPC 1QJHA 2MHNA 7FDRA 3QPIA 4G1IA 3KHGA 4J9PA 2A1BA 3OTCA 5CYQA 1ROFA 1JXLA 3I0RB 1PC5A 2HFZA 3KLEA 1JLQB 3BSNA 4KR0B 2Q3PA 3MMCA 3T1HF 4NLYA 3LUYA 3HHNB 2V0NA 5DG8A 1XR5A 1VQ4S 4JI4F 2COLA 1TQLA 2N4DA 2DH9A 2C2DA 3V81B 1NZAA 1JIHA 2UUCF 1MNEA 3IFEA 2ZH9A 4K4VA 3PR5B 4ZLPA 5F8IA 2BJDA 2VBWA 3U1NA 3PR4A 1FRIA 4J5OA 3G9CA 2J6TA 2DCUB 1RJJA