1BLUA

Structure of the 2[4fe-4s] ferredoxin from chromatium vinosum
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
80
structure length
80
Chain Sequence
b'ALMITDECINCDVCEPECPNGAISQGDETYVIEPSLCTECVGHYETSQCVEVCPVDCIIKDPSHEETEDELRAKYERITG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Crystal structure of the 2[4Fe-4S] ferredoxin from Chromatium vinosum: evolutionary and mechanistic inferences for [3/4Fe-4S] ferredoxins.
pubmed rcsb
molecule tags Electron transport
total genus 14
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 1996-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bluA00
1H7WA 1AXQA 1SIZA 3IR7B 2Z8QA 1Y5LB 1Y5NB 3PNIA 1BQXA 3OR1A 5BYRA 3MM8B 2C3OA 2FJAB 1BD6A 3MM6A 1H7XA 1FCAA 1HFEL 3EUNA 5CHCB 2V4JA 3IR5B 2GMHA 1Y5IB 4XDCA 3MM5A 1C4CA 2GMJA 3OR2A 1FF2A 1A6LA 1GT8A 1IQZA 7FDRA 1FDAA 1FRJA 3MM7B 4DHVA 1B0VA 1FEHA 2WSFC 4AYBD 2C3PA 2IVFB 4KT0C 3MMBB 1R27B 1KQGB 3MM8A 4ID8A 3HKZD 3EGWB 4RKUC 1Q16B 1GTHA 4YDDB 1FXRA 1FTCA 1FXDA 1WTFA 6FDRA 1JNZB 1FDBA 5BYSA 1FERA 1FDNA 2XSJB 2FGOA 4CI0B 1GAOA 2C3MA 2C3UA 2WSCC 3MM7A 1G6BA 2VPYB 2C42A 2VPZB 3C8YA 4OV1A 2WSEC 1KEKA 2FJEB 5L8RC 3MMBA 2FDNA 6FD1A 1DAXA 2O01C 1RGVA 3EXYA 1ROFA 1FDDA 1B0PA 1SIWB 5E7OB 2ZVSA 3LW5C 1BLUA 2VKRA 2Y0SD 2WAQD 2XSJA 7FD1A 1JNRB 1H0HB 2VPWB 1DURA 1H98A 4OMFG 2PMZD 1G3OA 3MMCB 4XDDA 5CH7B 1FD2A 1VJWA 2VPXB 5FD1A 1CLFA 1FRMA 3MMAB 3MM9B 4Y28C 2UZAA 2FD2A 1PC4A 1GTEA 1B0TA 1D3WA 2PA8D 4XK8C 4L6V3 2FJDB 1FRKA 3OR1B 1FRXA 3MM6B 1F5BA 2PDAA 1SJ1A 1FRIA 1Y4ZB 1FRHA 2V4JB 1F2GA 1FRLA 2WB1D 3GYXB 1PC5A 2C3YA 2FJBB 3IR6B 5BYQA 1KQFB 3MM5B 1F5CA 3OR2B 3MMCA 1BC6A 1BWEA 1K0TA 1IR0A 3MMAA 3MM9A 1C4AA 1XERA 2V2KA 1DFDA 1JB0C
chains in the Genus database with same CATH superfamily
1N33F 1SJQA 5HK4A 1KN6A 1IM4A 2NZ4A 2R8IA 1AROP 2F4VJ 3HVAA 3QAUA 4Y2KA 1TU0B 1GT8A 4A8XA 1MW7A 2MKJA 5F0UA 4DG1B 4UOFA 4LSLA 4I2PA 4M5GA 1UKUA 3DOLB 4ID5A 3VAMA 1U6BA 4OJGA 5KFXA 3DHXA 1SJFA 1YITS 5HP1A 5EX3A 5HI7A 4WTYA 3M8ZA 1RACB 1UZHA 3MEDB 4DPOA 4I1TA 4F2SA 1CQMA 1Y7PA 3AQOA 4TU8A 2ILZA 2EK1A 3KTQA 1WKJA 2ZUAA 2CQCA 2E1RA 2LQ5A 1R43A 2CPFA 2VASA 3LPYA 2CPXA 3AOAA 1SI9A 3DNCA 4K4SA 3MPYA 2V0NA 1LFPA 3MD1A 2HNYA 4UOCA 1QTMA 1XR7A 1FE0A 2AJ0A 4PG4A 3MMJA 4DSLA 1BXNA 3EZ5A 4RW7B 5LXYA 2YX4A 5H9FK 4EUVA 3GQCA 1YJRA 2EWHA 5ETQA 2OJ3A 2BEFA 3AJ1A 1CG2A 3Q8PB 3SYZA 1JNZB 2VIHA 4ECWA 5CYQB 3P5BP 2MQQA 3J81U 2E5HA 3I5CA 4ECQA 3PW7A 5D8HB 1H6KX 4TNOA 4EFAC 2DO4A 2NZCA 2J9EA 5L1LA 1R89A 3RW6A 1VQMS 1TL7B 2AX1A 1TK5A 1FRMA 1S79A 2WOMB 1N5YB 3BO3A 3D54A 2E9TA 4QPTA 3SIPB 1FJ7A 4E0DA 2VQFF 2H5IB 1S76D 3CJ5A 4RW6B 4ANDA 1IJFB 2HQIA 2EG2A 2VFSA 5JVHQ 1NZ8A 4R25A 4DL3A 3PRDA 3IGNA 3MR3A 3SZ2A 1DTTB 3HD2A 1KVKA 2RILA 2BANB 2G0IA 1NXIA 3MM8A 4JI0J 5KFFA 4IKAA 1FXDA 3DFEA 1FO1A 1REGX 1WG4A 4M94A 4C11B 2B0GA 2WVEA 2GV1A 4DV2F 1CEZA 1S9EA 3ET6A 1RTJB 5DZ7A 4PG5A 2AT1B 4I6YA 4QIWD 4TU7A 1C0TB 1RISA 3DDIA 4UOHA 1NK7A 1PJ7A 1JNRB 1RT6B 3ZTOA 4N5SA 4LFCJ 2VODA 1IJEB 4O44B 2MKYA 2VC1A 2I8EA 2DIVA 2ASLA 4B3MF 3B6BA 2DGOA 4DL4A 1T05A 1XQIA 3IAM9 4NLQA 1VI7A 2OMLA 4USJC 4PQAA 5DQGA 4CLKA 1D9AA 2ZOGA 2PEBA 3IR5B 2ZH4A 3R7BB 4KR0B 3NGDA 3OUYB 3CC2S 3N5FA 4ECVA 1WF0A 3ELHA 4U96A 2YWKA 1JK9B 2LVWA 4B08A 1IBLJ 4ER8A 1SL1A 2XS5A 5AXMA 3H42A 3Q2TC 3BYPA 1OMSA 1T9TA 3AXMA 2JOQA 4OX9F 2BJ7A 3FCVA 3NGKA 2M70A 1X0FA 2VG7B 4F4ZA 4QIEA 4DU7A 1Q7YT 1W2BR 3LPEA 3GU0A 4LR7A 5LXRA 3NWRA 4DV1F 4C48A 2BE7D 4ZPAA 2KJWA 4Q5VA 3MCOA 4J7CA 3E3XA 2RNEA 3TVZA 2LKZA 3TNVA 2CVEA 2HBYB 2ZE2B 2PFFB 1KP6A 2BBEA 4QIVA 2P9CA 4C0BA 2RB7A 5KFOA 2CQ0A 1YJ9S 4KV8A 1Q5YA 3RAMA 3PW0A 5BR8J 4CH0S 4ZVFA 4J37A 3H40A 3D7SB 2CG8A 2PC6A 2RF2B 2BM1A 5E0OA 2MZTA 3DLEB 3LP2B 2KYXA 1FF2A 4DCOB 2Y1IA 3V2UC 2VJUA 5I3UB 3BR8A 2OFGX 1U25A 3A3PB 1QAJA 1N36F 1RCOB 3ENVA 1JX4A 3IA0A 3CCVS 2IVYA 2NLWA 1YVFA 3I0SA 5L1KA 2E44A 3EDRB 4B02A 1RWUA 1TKZA 3LWMA 4B3RJ 1RHJB 2YWGA 4F50A 2FLOA 2W2OP 4ZLNA 4LF9F 3GYNA 1JLGA 3CJ3A 4RZRA 3GR0A 5A76A 3OT9A 4DR4J 3EYZA 3KLIA 3QYYA 2HVDA 1FNXH 4WWSA 1BWEA 4OZ2A 2CXEA 4QR1A 3OJSA 4LSLB 5F8HA 4KHPF 1FX2A 3QGHA 1S0MA 4ID5B 4ED0A 1A7GE 1CULA 3VGTA 1U1LA 4AYBD 8AT1B 5HP1B 4ZP9A 4USKA 2UUBF 2OIHA 2XWYA 2B6AA 1LK7A 1HMVA 4M5LA 1S5ZA 4DR3F 4P71A 2BX6A 3MMBA 3W62A 5C25A 3SQGA 3WX8A 3PXGa 4DPXA 2Y8YA 3NMRA 1SKUB 4WFYA 5IT0A 1UVMA 3CB4A 3Q8RB 2GQQA 2KFYA 4ELVA 1RWWB 3OL8A 2VG6A 5D4NA 5E3CA 3G6YA 3CCZA 1NJZA 4P2SA 1S0NA 3M8YA 3T6BA 1XR6A 2HNYB 2GS8A 4JI2J 5JVGQ 4G1PA 3MOZA 3GPAA 4U7CA 3TZXA 3CCLS 1YLXA 3VAJA 4B9SA 5KFTA 2FHJA 3VQTA 4NA1A 1J5EJ 3CCJS 5HQMA 2E1AA 5ETMA 3PW4A 3CULA 2RS2A 1Q8KA 1U1NA 3NNAA 5ETSA 5HMXA 5AXLA 5IC6B 4DFPA 3TYTA 2CYYA 3BBFA 1NO8A 1CQNA 1RDRA 3DOMA 3JB9k 1P6TA 2V5HG 1KHVA 4AXJA 3QLHA 1HI8A 2FJWA 2HWIA 3MFIA 1PYOB 4YR3A 4PPZA 3HZEA 3CMAS 3DCAA 3QZ8A 1VQOS 2VA3A 5LL6d 3D4JA 3MR5A 2XYHB 5IV4A 2DYAA 4DCPB 1U6ZA 4HHUA 4F8RA 4OX8A 1NDPA 4DSKA 3MM8B 1QY7A 3M32A 3GZ7A 1V9OA 3KXDA 2YKQA 3B8HA 2GMJA 1VQLS 1KRPA 2WSFC 1S9EB 3ET6B 2FLPA 3H7HB 4Y2MA 5HQ8A 4YDDB 1YWXA 5HBMA 4EBCA 2XHCA 2AX0A 2YKPA 1YX2A 4CO3A 5B0BA 2K7KA 1FE4A 2KT3A 1T05B 3E2EA 1Q8BA 2K3KA 2IM1A 3IMQJ 2BRLA 1DURA 2XLJA 2F65A 2VZ9A 1SJRA 5CH7B 3OTOJ 4NA2A 2DD8S 1F2HA 3AA8A 2P5VA 2FYXA 1QUVA 2H3EB 3I9V9 4U9RA 1P8GA 2XY5A 1VLYA 1S6UA 2ZITA 4RUHA 1TV6A 4WF9Q 4RBUA 5AT1B 3UNGC 4OQJA 1R6VA 1B4SA 2JJ4D 1N34J 2CQGA 5F8GA 3J7YI 5KOWA 1D9DA 5EDWA 2GJ2A 5DM7Q 3ILOA 2ROPA 4DHVA 3ADAC 2LDIA 2J0SD 3G96A 3PYGA 4A8WA 1CBKA 4DR7F 2CAJA 2AEJA 2DXEA 2C3MA 4DMZA 4F0MA 1TQLA 2W7PA 1LW2A 4LJMA 2V67A 4KJIA 1B7YB 2VL1A 3SFUA 5K8NA 4X2BA 2AU0A 1HBMA 4HACA 1GX6A 3E51A 4DQIA 4KIAA 1OQ3A 2VV5A 4LT6A 4X4TA 1LWCA 2LYVA 4B3SJ 3VVUA 4KV8B 1KSPA 3D1QA 2XYGB 5D0EA 4TLRA 3PW2A 1UL3A 2FD2A 4LRDA 4JI1F 1GEHA 3W8PA 4USWA 2B9XA 1RU2A 1JJ4A 1UEVA 1SL2A 2BV3A 4F3MA 2OSQA 5HMZA 1U48A 2J7UA 3HD1A 4P7VA 3FSXA 2JLEA 4ETXA 2HIQA 1T9WA 5HJYA 4NLGA 2CDQA 2FZCB 2WBMA 1HI1A 3OR2A 5D4OA 4IDKA 8RUCA 1R8BA 5EWFA 2DCUB 3FBCA 4A8KA 3M8SA 5KFCA 5D78A 4WBFA 2UVRA 4ID8A 3CEDA 3I0SB 4ZVSB 3MAAA 3G8SA 5HMWA 3W9JA 4OZLA 1RT5A 3MAHA 1TKZB 3CDEA 3H98A 4QWAA 3QJJA 2BJDA 3MECA 2LQJA 1JLGB 3DRRA 2JWNA 2O3DA 1T03A 1T95A 2EC0A 1QM9A 5DETA 3KLIB 3NCQA 2C2DA 3IC1A 2OP5A 3J80Y 4X4QA 1FD2A 1TAUA 3ENWA 2MB0B 1VGYA 4Y28C 2ZD1A 4U7UK 4DFJA 4NZ6A 4C4WA 2CPHA 2VU5A 2RVJA 1KQFB 1CULB 3FMBA 1EKSA 4ILRA 1K47A 4GKJJ 2IYGA 1HWIA 1AXQA 4EK2A 5I4MA 2NYIA 2Z8QA 2KZZA 2HG4A 3LWLA 1VQ5S 5B0GA 2F4VF 4NCAA 4USUA 2A18A 1V3SA 2PSZA 2B6AB 4RU9A 4A46A 1JIHA 1NSPA 1R7IA 4E2FB 2RQ4A 1HMVB 4Z7CA 1VYAA 1B0VA 4MKAA 3MMBB 5DM6Q 5KFJA 1KQGB 3IM8A 5KFWA 5C25B 3SQGB 3SSRA 1U45A 1WACA 1T9YA 2DH7A 5HLFA 2JHEA 1HW8A 4F3QA 2IM0A 2EFQA 2XNQA 2E7VA 7AT1B 3HVTA 2RQCA 4F04B 5HSPA 4C3KA 2VG6B 2NXJA 4RBTA 4WFNQ 4ZA1A 2GIRA 2KXFA 1QVGR 2DJWA 4PR6A 1TAQA 2PA3A 3CJ2A 4B9NA 2DHHA 4KE5A 3RUBL 1FWKA 1TL3A 4NXMJ 2EG1A 2MQMA 2QIFA 3KK2A 2ZZTA 3MMCA 4DEZA 1NMEB 3MMAA 2XMKA 3AH6A 4ZVEA 3A8IA 1I1GA 2J0WA 2Q3PA 1VBZA 3FRZA 1MROA 3LA0A 2OELA 1UPPA 2WCXA 2ZKUA 3SFGA 4CM0A 1Z4UA 3DOMB 1BGXT 2HHHJ 3O5TB 5JJBA 4WYLA 2E1MC 3MUTP 2BQRA 1YKWA 4OZ0A 2AEFA 2JH3A 2R7QA 4HR2A 3QLHB 3OTEA 3BQ2A 1RT2A 5FJ4A 3R9LA 2Z4PA 4ZKAA 1KVJA 3CTRA 1UA0A 5KG2A 4ES3A 4OZJA 1ITPA 5E7OB 1NDLA 2D74B 4DBQA 3W3SA 1XMQJ 1ZA2B 4UQTA 1LK5A 5CZVA 2W2MP 1QSSA 3MZIA 4LF6J 4RNFA 4PPDA 5L46A 3JTOA 4CDIA 1F60B 2YWEA 3M32B 3RG6A 4P2XA 5CZXA 2X1FA 3IR6B 4RU2A 4HEA9 1N32F 3GIKA 4DV6J 1JB0C 1O51A 4I6WA 2ZBCA 3VZIA 1QE1A 1XTZA 5HBMB 4ZPDA 3C46A 1L3KA 4QQBA 1AFJA 2QTWA 3UCZP 4JI0F 4Z7YA 1GMVA 3K0JA 2ZKTA 3TX8A 4DV4J 2QE5A 5C2GA 3GB0A 1SL0A 4A8SA 1F3VA 1BQMA 2VOOA 3H0PA 3PO4A 4WE1A 4C3MA 4ZVRB 3C8YA 4BLGA 3PO5A 3UD4P 4AT1B 3LQVA 4LFCF 4RW9A 1KHWA 2XEXA 4JP8A 4TKTA 4DWIA 4ZVOB 4C8ZA 3N5BA 1TV6B 2JNJA 5K8OA 2PEHA 2ASYA 2QLJB 2NSCA 2GGPA 2OPQA 1S1XA 1PGZA 2PDAA 2Z0GA 3DMJA 1U2FA 2IC3A 4FYWB 2W24A 2RMLA 2DR5A 4JI6J 1UVLA 2OHDA 1N5VA 3HJVA 4Y2CA 3KUGA 3I0RA 3CJKA 3FQKA 4IQXA 1FX4A 3HMJG 5GMKa 2V4JA 2QV6A 1Y5IB 5T7LA 2QYCA 4WPAA 2BDPA 5LSRA 1LW2B 4NLSA 1HWJA 3TA1A 1H73A 1HBMB 4HACB 3CDAA 1I5OB 3PZPA 1RAAB 1N0UA 1LWCB 4YEAA 3R27A 1WOPA 1GQEA 3KG0A 4MTPA 5CYMA 1MU2A 4RWWA 1UW9A 2EFGA 3TRGA 4C7QA 3K59A 5GAHU 1JXEA 1QSLA 3RBZA 3H4BA 2R7UA 2ZJRQ 3AB2B 3QSIA 1NKBA 1IBKJ 1M1KT 2JC0A 3DDNA 1VQKS 5BR8F 1JLEA 3OR2B 4MK8A 4IDKB 3T1AA 4ANEA 3VQSA 2LEAA 1S7HA 4ECZA 2KT5A 3EZOA 5GAEU 2FVCA 4NEYA 2RSQA 2G1DA 5FIIA 3JAMY 1HA1A 1BQNA 1LOUA 3MAAB 2B51A 1XNQJ 1RT5B 2MQNA 3BQ1A 3MECB 3F41A 3DRRB 1FVSA 1T03B 2BR0A 4B9MA 4LR9A 2B4PA 4PABA 2RDDA 2E7XA 4OIXA 3W2WA 3ZC4A 2V4RA 5K5MA 1RE1B 4DL5A 2ZD1B 4RWXA 3NOGA 2ZH7A 3EPGA 4ICLA 2ZVSA 2HNZA 1PJ6A 4YQWA 2GO8A 3MEKA 2CJXB 4B3RF 3DGPA 3P45B 4C8LA 3KMQA 4RO0A 4FS2A 3LAMA 4DR4F 3VWSA 2FLLA 4W90B 3N4WA 2AEMA 4WFXA 1F5BA 4WIQA 3BO4A 3CT9A 1NM2A 3EGZA 1ZAWA 3GJTB 4IO9Q 2C1EB 5J2QA 4URSA 4DQSA 5ADZA 2P9EA 2FHJD 1FESA 1KLNA 2IJFA 3TQ1A 2LXIA 1JLQA 5HLFB 2SXLA 4I2QA 4X4SA 4AL6A 5DJBA 2GJFA 5MLCV 2ZH5A 4CLZA 2HVZA 3HVTB 2D3UA 2CPZA 4L3NA 3BSCA 2LEBA 4NMLA 2GX8A 3N79A 2W2QP 3S01A 2DGVA 5BJRA 4ZMMA 2MKCA 4QWDA 2ZHOA 1OYEA 2KYZA 3GJQB 4NRTA 2HZCA 1SBRA 1NK6A 1S9GA 5EWEA 2Y1RI 4DLGA 1TL3B 3ZTPA 4PXCA 3KK2B 1T3OA 4OL8A 4ZIVA 3GMGA 3MMCB 4CLUA 3MMAB 1U1MA 1RAEB 2YWFA 3NS7B 1RWPB 1XWLA 1S97A 3A1YG 1MROB 3KKFA 2G2ZA 4JI2F 4YB6A 1TL1A 4ED2A 4HHHA 1VRUA 4UZCA 2HBQB 4OI0A 1J5EF 4H4KC 2B8QA 5E3PA 3ZNUA 1BQXA 1AYEA 2F7VA 3PW5A 3KUEA 2QG9B 2E66A 2KL8A 3TZZA 2XCPA 1HR0J 2ZNZA 2YKNA 2XCAA 4KGMA 1RT2B 1YJNS 1RAJA 1NK5A 4F0KA 1T02A 1FXRA 2HAFA 3CSKA 3R7NB 1KDNA 2LA4A 2DGTA 2KVQE 5F8LA 1RWMB 3H2LA 1QTNB 1KLMA 1K0VA 3SV3A 4B17A 4OI2A 5KG7A 4JV1A 1X0PA 2H48B 4NLVA 1O6XA 2OEMA 2WZ1A 3BKFA 5FD1A 2DVIA 3PDNA 1W7WA 5M2PA 4NOHA 1D3WA 2PA8D 3PYDA 1IBMF 2YBVA 4I6AA 3EVMA 4BCAA 5KT6A 1IKXA 1YJTA 1QE1B 4TN2A 2WB1D 4NXNJ 2QLXA 3UQSA 3O44A 3GFYA 1UMJA 2RDIA 1XR5A 1KC8T 2CDRB 1K1QA 2CFXA 3CE8A 3QQCD 1NHVA 2EKYA 4F2RA 1BQMB 2V8PA 4XPCA 2R2SA 4WE1B 3K57A 1FKPA 3LANA 3TANA 4TY8A 3SCIE 4OJ3A 3QT8A 4QWEA 2W7AA 3BH6B 4RW9B 1HWLA 4JI8F 1U6FA 3QGIA 2GVDA 1ZPWX 4WP3A 1WC5A 1ZTTA 2A2CA 1WHVA 5THWA 2MKSA 4FS1A 3GIRA 5IZHA 2GGPB 2OPQB 1S1XB 3K17A 1R8AA 3DMJB 4C0OC 4HH1A 1J2VA 3OTOF 5JMNA 1KS2A 2IC3B 1SXLA 2UXBJ 1IKYA 2PMZD 1G3OA 3RR8A 2AYBA 2KHDA 2W7OA 2KVIA 3CJKB 3IWXA 5KG0A 3IGVA 2V4JB 2RAQA 2FJBB 1B7FA 4OI3A 3LTOA 2UUAJ 1S1UA 5T7LB 1N34F 3CIZA 3MXHP 3QATA 3FFIA 3PNIA 2QEXS 1R0BG 4PG7A 2NXCA 1UVNA 5I3PA 2RQKA 2DHAA 2X1GA 4ERDA 4C6AA 3TUJC 1JJ2R 2MZQA 2HW3A 2G2YA 2O67A 1PO6A 5CYMB 3KG4A 1HHSA 3E8OA 2Y9HA 1MU2B 1QLNA 5T41A 4WIIA 2QSWA 4DX8H 2GMLA 2FJEB 4DFKA 3IN5A 4OJ1A 1ACMB 3G86A 3MEGA 3L09A 1CC7A 4B3SF 5F0WA 1B3TA 3F56A 4KGKA 1JLEB 1RTDA 1NK9A 4ZP8A 3NCRA 1DQAA 3MUVP 2MTLA 4A8YA 1TL4A 1BQNB 1KOHA 3MPUB 4R8UA 4J9PA 4NLRA 2ROGA 2HQDA 4RBVA 2W1BA 2RRBA 4CO2A 1JJHA 4RUAA 3W2WB 4USVA 3CC4S 1MG7A 3QO9A 1VBYA 3FCWA 5A6WA 3ONQA 4HDGA 2HWHA 4ICLB 4PYDA 2HNZB 4JBCA 2M7SA 2IRXA 4TY9A 5LMUJ 3DGPB 2HZAA 1UZDA 2LXFA 2XQCA 1DAXA 2MQ8A 1DQ9A 2WVFA 2ZNYA 3SV4A 3Q8YA 3PM9A 4ZLLA 2XZDB 4IYQA 1QAYA 2B4VA 5B0AA 4ZCMA 2DNOA 3NS6A 4Q2LA 5KFZA 1NK8A 4ZPVR 3DXSX 4GC6A 1RK8A 5J2QB 3BH7B 2XWXA 2AYGA 1RKJA 1FRKA 4F4YA 3FRYA 4P73A 2KXNB 5LMNJ 3R8YA 4GKJF 3V6DA 1JLQB 3QT6A 4I2QB 5AXNA 4NPOA 3FMWA 5GMEA 2GAHC 5KFDA 4LMZA 3NL0A 1H2UX 2YH1A 4Q8EA 3TAQA 4Q0BA 4TQRA 4FPIA 5KTQA 1N5QA 5KFNA 2ATLA 5KFIA 3VF0B 4KC5A 3H8YA 1JLAA 3NGRA 1S9GB 1WTFA 1S0VA 2H9ZA 3TEGA 1M1GA 3C6UA 2WSCC 3PX0A 4NE9C 2FDNA 2DRDA 4FPRA 4CT9A 3NS5A 2AD9A 5E3RA 3EX7B 3IFEA 1TL1B 3SCJE 3ILLA 1SC6A 1VRUB 2BJ8A 4IR1A 2WRMA 1KTVA 1N6QA 2PGCA 3IAS9 2BA9A 1OYDA 4NXMF 3W2VA 5EHHA 5AJ3J 3Q8QB 1FNMA 4C8YA 2DR6A 2VDIA 2YKNB 3NRBA 1WHWA 4I67A 2VBWA 3DLJA 1BY9A 5D4PA 4N56A 1M5VC 2F8HA 1HPZA 5KFSA 2OD6A 5DO2A 3NMAA 1V3ZA 2HHHF 5DDQC 1VIOA 1WHXA 3JSYA 1M1HA 2DRBA 4OYWA 3FJ2A 5DLGA 4JOUA 3UO0A 3DI6A 4A8FA 1J27A 1LWXA 1NBEB 2VFTA 1KLMB 4A47A 3GR1A 3CJSA 4UQGA 1F6TA 2R2TA 4W92B 3HFKA 1RAFB 4L74A 1EP4A 2X3GA 2ZC4A 5F8MA 5KT5A 2C2ZB 3VALA 3G6ES 4KSEB 3G2XA 4YN3B 1IKXB 2L3MA 4J9SA 1XMQF 5IFMA 2VBZA 1TKDA 4KGXB 1IWGA 3J7A1 5E3AA 1RHUB 2CZ9A 1PC4A 4DZDA 3KK3A 4LF6F 1U0SA 4RUBA 4OHWA 5KFBA 4OZNA 2HRTA 3OHAA 2D3ZA 2CZVC 2MSSA 2XS2A 4E98A 3TZYA 4DV6F 3GTYX 3UFCX 2HQCA 2GIFA 5D0HA 5EX0A 3CD5A 2VHGA 2D9PA 4NCGA 3W60A 4ZVGA 1FKPB 4IOCQ 1YRUA 1T9XA 3U7JA 1M5PC 2AP6A 4TY8B 1LWFA 2B8PA 4OYAA 2DRAA 1YBTA 1IQZA 4ITSA 2GVDB 1WC3A 2IY5B 3MUMP 1UJ4A 3ISND 4EO8A 2NXUA 2DHGA 3IG1A 4DV4F 2DGSA 3TVKA 4Y2IA 4UUWA 4PWDB 3K89A 4PXBA 1JWWA 1TTHB 2R7OA 3WZ0A 3J7YU 1IKYB 1ZPVA 2CJKA 4EYIB 1F9HA 1I3OB 2BRKA 3ILJA 4ED3A 2HS0A 4ZPTR 4IH5A 2CA9A 3L4BC 2MLXA 4FVMA 3KLFA 1UWBA 2ZH8A 1S1UB 2V8VA 4OYIA 4NZ7A 2CNOB 3FFIB 2P6TA 2YTCA 2V2QA 4MKYA 2JVOA 1KONA 2F63A 2HMIA 1FHTA 2W9BA 1Y10A 4JI6F 2LECA 3HLUA 3OTDA 3CVKA 4K59A 2DBBA 2GCFA 2HIYA 4EWTA 2K06A 4ELTA 1QDUB 2CJQA 1RWNB 3PRVA 4XTTA 4K5SA 2MKIA 3MHYA 3CDWA 3M1VA 4HYKA 1R27B 2GQ2A 3K5NA 2DH8A 3OQ2A 2HVEA 3MEGB 2DR7A 3NXZA 3QT5A 3KWMA 2EFVA 4Y3CA 1R0AA 4HTJA 4KH1B 5J1PA 3PR5B 1RTDB 3OXGA 4WZMA 1HWUA 3W5ZA 4RW4A 3AA9A 2OD4A 2XSJA 3Q2SC 4ZDNA 3H25A 1A9NB 2QN6B 3HXMA 1NUEA 1IN0A 4R8UB 3UCUP 2HS4A 2CPDA 4DF4A 3A4TA 2EFNA 1VFJA 2FJDB 3EZUA 3Q8UA 1IBKF 2RT3A 5I42A 3G8QA 3MPVA 1AW0A 2VOPA 3D68A 2B7BB 3CUNA 4O3SA 3QO9B 3T41A 4Z2XA 2GHVC 3UE2A 2POKA 3CCSS 3T1YJ 1XNQF 2BOAA 3L7OA 2A6MA 2C3PA 1Q82T 3T19A 3LAKA 1UVJA 2M0GB 4F67A 4CM2A 4ILLA 2IVMA 3CD7A 3QBCA 4QYRA 4KYZA 1JJCB 3UR3C 1K1SA 4LBIA 1CS4A 2VPZB 3F73A 1QD1A 1HNXJ 1X31C 3RB6A 1O5JA 1PJ5A 3KLVA 3QIPA 5B7WA 5SZTA 1ZZFA 3KUHA 3DC2A 3W5YA 3J7ZT 3IS9A 3V6DB 3BSOA 1CLFA 1IR1A 1S10A 1OY9A 2L9DA 1UVIA 3UD5A 4WP9A 2HQGA 1C1BA 3RB3A 4A8OA 1FFGB 4G1IA 1NDCA 1K44A 4Q0BB 4ECXA 3CDBA 1XNRJ 4KPYA 3R5DA 4P10A 1AA1B 4TQSA 4LR8A 1E6YA 1JLAB 3LALA 3Q22A 3R5BA 1MWZA 2R3VA 4JYAJ 4FF1A 3C6UB 1RA7A 5L9XA 2CNNB 4RNOA 4DQRA 1T8EA 1HI0P 4NASA 2B9EA 1RJJA 1NJWA 2M3DA 5KFKA 4LBPA 5J1EA 2X1AA 5IT4A 3BSNA 2DPIA 4LFAJ 1YZ7A 1JLBA 4WFAQ 2EEYA 4MKVA 3CC7S 2HK3A 1N6QB 2KU7A 2M52A 2H54B 2LXUA 2HHUA 3M2UA 2QT7A 5CXTA 5KFAA 2OMOA 3W2VB 3W8GA 1DZ5A 5J2NA 3O3LA 2J0QD 4K4ZA 2FHMA 2GVZA 3O1LA 1UETA 2NUHA 1S1WB 1P1LA 2YX1A 3OD2A 4BWMA 4H54A 2KM8B 3VVTA 1HPZB 4ECTA 3RR7A 2IAJA 4ED8A 3KNGA 1FRHA 4MMOA 3BEGB 3M6XA 5KFHA 4UY8T 2Y1JA 1Y5NB 3DI6B 5A2QY 1HR0F 4NLOA 5HJXA 3ZZZA 1AT1B 3EUNA 3S1TA 3G6VA 4LVNP 4ZK7M 1ZOTA 2HURA 3PCOB 1X9MA 3V81A 1EP4B 1SH2A 4KKOA 5IQ6A 2NREA 1GMUA 1FDNA 1E6VA 3WC2A 4KY3A 5GAEI 4YHHJ 2OUGA 1M5SA 1R8CA 3MPWA 4X4RA 2E5LJ 3KK3B 4J9MA 3C66A 4PG6A 1VQSA 2QMXA 5L1JA 3ZZTA 1NJYA 2OO4A 3V5RA 1NH8A 1C0UA 1FWPA 2UUCJ 4NCGB 4G3IA 1MN7A 3BGFA 2JDJA 2RUGA 4KAIA 2Z2MA 4LRFA 2KN4A 2N4DA 5C7PA 4NXNF 1LWFB 4OYPA 1PBAA 2WONB 4CZCA 3IO1A 1RZMA 1CJTA 1EZZB 3AY0A 4L73A 4PQUA 1NPPA 2KG1A 2PMHA 4U6PA 5KG6A 5B08A 3AXKA 1L3SA 3IG1B 4YB5A 3D3CJ 3M8QA 2HS3A 3TJ9A 3QGGA 3TA2A 2EVZA 1IKWA 1WOOA 5B0FA 4BC7A 3PG9A 4QU7A 2Y8WA 5CYJA 3X1LB 5LM7E 1F9EB 1H72C 2RJZA 4FF4A 2QA1A 3PR4A 3KLFB 1UWBB 2VPYB 1N5TA 4DL6A 4JI3J 4MT1A 4WTOB 2MKHA 4C0HA 2DXDA 2ALZA 4FBUA 2Y3YA 2UXBF 3MGJA 2HMIB 1ZTWA 2W9BB 2OSRA 4ALZA 2Q1LA 2RUSA 4GMKA 2MLZA 5GVQA 3UNYA 3P4UB 2KM8C 1LQ9A 2B3TB 2F9DA 2UUAF 1N0VC 2LQ9A 3B54A 1M0SA 1KOOA 3M1VB 1HNZF 1HYSA 3TR5A 2C3OA 3VGUA 2YNFA 4OYBA 2G0JA 2BABA 5HVGA 2DNNA 4USIA 1HNIA 2AGOA 1GFWB 2FZKB 1R0AB 1WELA 3LH2S 2FJVA 2P2CB 2P9GA 1PG5B 5IT9Y 3NWGA 3U1LA 2G9OA 1U8WA 4CQ1A 2YKAA 4RW4B 5C24A 3QSYB 3N28A 2ZDPA 3ETMA 1G1XA 5BYSA 3NGUA 2XSJB 2C2EA 1MNEA 1CJUA 2XNRA 3BGRA 3GSDA 3HX9A 4L75A 5EGYA 3KNAA 3SI8A 1DHMA 3J7Z5 5I42B 3BKUA 3OSPA 4UUXA 2DB1A 2XS7A 5DLFA 3BF4A 2I0XA 3A3NB 4NI2A 1Q95G 3D6MB 2CPJA 1GTEA 3PEHA 3BZQA 2BKNA 4Q8FA 3VAGA 4PZVA 5KT7A 2V4QA 2Z2ZA 1FRIA 3U27A 2A6OA 1WI6A 2UV8A 4ES2A 1PIEA 4P74A 2H5JB 5IQQA 2IDEA 1U4BA 2I1RA 3IR7B 1YGYA 2IM2A 8ATCB 1IVZA 1VK8A 2MY7A 2PT0A 4FXWA 1FCAA 1S6PA 3Q24A 2V9KA 2DNZA 1CS4B 3CMQA 2X3DA 1RQ0A 2ACMA 3Q83A 4I7FA 4R5PA 3K2YA 2CKWA 2DTJA 3QIPB 1UEUA 5LMUF 1D8ZA 4MIWA 2JVRA 3IS9B 1JXVA 5ETTA 2XMMA 3KDNA 2KKHA 4W4MA 2VF3A 1YDLA 3CCES 1S49A 1URRA 4IRDA 1C1BB 4OHZA 3BPSP 1H0HB 1HD0A 2BVZA 2EBGA 4IRCA 4DR2J 2JFKA 3DOKA 3ZZYA 2FLNA 1WSRA 3K58A 5F9NA 4RJVA 4MKBA 3U1NA 5LMNF 3GIJA 5KFUA 2YNIA 1E6YB 3I6PA 1SV5A 4N77A 1ZYQA 3R2CJ 4PEOA 1G2EA 2XI3A 3W61A 1V5IB 2COLA 3GE9A 4IH7A 3MDFA 4UY85 4LSZB 1LXJA 2ZUGA 2V69A 1TK8A 3BN7A 2F8MA 2PD1A 3CCMS 3R5CA 5J1EB 3M9NB 2DHXA 3SSQA 1SH3A 3PY8A 4P52A 1JLBB 1SQEA 2CPIA 3FK4A 2DNLA 4X65J 2VG5A 4BBYA 2PN6A 2MYFA 2XC9A 4B9LA 3HKZD 4NCBA 3M2UB 2YQ0A 2NPFA 5KFLA 4C8MA 5HVHA 2LQBA 1RU1A 3BN4A 3QRRA 5J2NB 1DJ0A 1RAOA 2GVZB 2R4FA 2VONA 2GNKA 4DR5J 3ULHA 2W8KA 2CQ3A 2R8KA 3UR0A 3T9NA 3NNHA 2DR8A 1HARA 2IAJB 4S0MA 4FXDA 2HHPA 1RT1A 3JSRA 4LIWA 2V94A 2MJNA 2UXDJ 3PX6A 5HATA 5AJ3F 2J9CA 1VCTA 2AMCB 2FVPA 4K4WA 5D0GA 1RAHB 4K4TA 1X4CA 5CD4A 2W4DA 4PAAA 3RYLA 1YJUA 3M30A 2BACA 4FYXB 3MPDA 1U49A 3L3CA 4BS2A 3QWPA 4FP9A 1NK0A 3QRPA 4X4NA 5KFRA 3V81B 1DQ8A 2J8SA 4KKOB 5HAOA 3A8EA 1YBUA 3EMTA 3M8RA 2E1PA 3FVYA 1FXLA 1E6VB 4DPYA 1F5AA 1MMDA 3QGPA 2MQLA 2HSEB 1P1TA 3GIMA 4M5MA 1T9UA 1R0CB 2XLIA 3TVYA 1C0UB 2B5JA 4DV0J 2AV5A 3Q89A 1C1CA 1GH8A 4X4OA 3EXYA 2KB2A 5IC4B 3OPKA 1WEZA 2HQ3A 5DDOC 2DNRA 3SCKE 3ETOA 4DV5F 1N36J 3DN9A 1CJTB 4PQUB 5K14A 1X4HA 3IBFB 1FJEB 1B0TA 2K8GA 1TKXA 4I2PB 1T94A 1XMOJ 2DNYA 5BYQA 1RT3A 3M8QB 5ETVA 3EJMA 3ISZA 2JEJA 2HAIA 4AL7A 3HHKA 3H2UB 4FXVA 1IKWB 5B0DA 4YR0A 2HRYA 3H5YA 4FKYA 3W9IA 4NMXA 4P7TA 1NCLA 2G13A 2MLYA 4IFVA 2FHOB 1URNA 2ZH3A 4NWBA 1A6LA 1H2TZ 1NZAA 4CH7A 3AFGA 4U95A 2OPPA 4DFMA 5IWAJ 4O3OA 4DS4A 1HW9A 2H4WB 6FDRA 4EZ6A 3NAHA 3B78A 3CD0A 1WC0A 2QZ8A 4DUZJ 4FBTA 1EKRA 2D3O1 5DG9A 1SJ4P 3VR1A 1TMMA 2GHWA 4DCJB 4P75A 3TA0A 2V63A 1H98A 2DISA 3FZ2A 4P2FA 1G4CA 3M4XA 4NLWA 4GO7X 1UVKA 2YPYA 4U7UD 3KG1A 4L72B 3OTBA 1HYSB 3JQMA 4D3GA 2YNFB 4NYPA 5A8RA 2KHCA 1T7PA 1W2IA 2DGQA 5K8PA 1HNIB 3KHLA 1BHNA 2QLBB 5G0RA 1REVA 3W1YC 2AIRB 2BUNA 1X7VA 4WFZA 2K2PA 3CD6S 1NAQA 5C24B 2JRSA 3V4IA 1RUSA 2A0FB 2Q66A 4M1KA 1WF2A 4DSEA 1CJUB 3CXCR 3M6WA 5MAOA 3VGVA 3BGRB 4AD6A 4ZVHA 1PAUB 3GJSB 4IFYA 4KPCA 2DPJA 1RP5A 2Z2LA 5ETLA 5E5NA 2UU9J 1FERA 1GAOA 3R3TA 1EJ7L 4NI2B 3THTA 5RUBA 3CF5Q 2R7XA 2XTJP 2ABYA 4HLBA 1RT4A 4UT4A 1T3NA 4CLYA 3I32A 1WDTA 3VGSA 1W25A 3Q86A 4HT7A 2DGWA 3OSNA 2AYEA 3PHTA 1N5SA 2OPRA 4KHRA 1VS3A 3WBZA 3I5AA 4Q45A 4HDHA 2VICA 2MZSA 3BSAA 2V68A 3LGHA 3R6GB 4UTGA 4ZP7A 2VH7A 1ZH5A 3PTWA 3TQEA 1S6PB 3KOAA 1VMBA 1IR0A 3M8WA 1L5UA 1KVIA 4AQYF 3T1YF 2Z56B 4UOGA 3AODA 2H4YB 4I7FB 1RHKB 3G8TA 4R5PB 3RZAA 5FLXU 1AFIA 5A6PA 2C2OB 3MCSA 3QFHA 3HHDA 4NLPA 2PI5A 3TZWA 2R7RA 5HN0A 2W9AA 3FEZA 3PYFA 1O0PA 3TX0A 2RRAA 5EWGA 2ZBQA 3SQOP 2NUUG 3JQKA 4E8UA 4DU8A 1HNXF 2CWXA 1HNWJ 3HULA 3DOKB 1KEKA 2F5GA 1SKRA 2ZEJA 1AUSL 3VV2B 4WXWA 3CNQP 2YNIB 2DNGA 1SV5B 2YY3A 4ZITA 1CSJA 3HSGA 4RUCA 4IG3A 2XO6A 3BREA 1TUVA 2KFZA 4LVOP 3UPFA 1FRXA 4DN9A 1CC8A 2FB0A 4QPXA 2C3YA 2CZ4A 2QO3A 2EPIA 1XNRF 4NYOA 3MM9A 3WX4A 2YQ1A 2VG5B 2AZ3A 1KD1T 3CW2C 2FJAB 3PVXA 2J6TA 3I4PA 5J2MA 1Y3KA 1VIXA 4CO0A 3ZTSA 3MTJA 3ZTQA 1H74A 3A8JA 1S12A 3L9ZA 3D1OA 4YY3J 2CJ9A 4LFAF 2IPOB 1WI8A 2Y0BB 4MYTA 4H4MA 4ZN3A 5HO4A 2KG0A 4OV1A 3JQJA 5L8RC 1VOMA 1VHFA 3UWTA 2RU9A 2LMIA 3D67A 4USHA 1EQMA 2RQMA 3CJTA 3NLCA 2XULA 3J81j 4DR7J 4Y6IA 1KR4A 1B99A 4GVLA 3M30B 1LV5A 3HHNB 4M63A 5EN1A 3JSMA 4YP3A 3T1HJ 4X4VA 2RKIA 5L1IA 3HSZA 4LF2A 3MCMA 2V50A 2X1BA 3HK2A 2KZMA 1LXNA 5F8IA 2XMWA 5J1NA 3W7BA 4WZQA 2CADA 1BD6A 2A1BA 2I6WA 1EAYC 4OHXA 1YI2S 1C1CB 4P72A 4M5IA 2BQ3A 1PAEX 3GG0A 4WP8A 3VAFA 4JV2A 4YHHF 4C8NA 3WIUA 1HD1A 4J9LA 2E5LF 5K14B 2H51B 4CO5A 1TKXB 1FFWB 3TW0A 3DLHA 3AOBA 1IR2A 3KLHA 3PIOQ 1BE4A 2UUCF 1RT3B 4EO6A 3N01A 2E5GA 3B4MA 1T9VA 3MFHA 5F3TA 2MZJA 3HSDA 1X5TA 3HHEA 1RA6A 4ENOA 2BJ1A 2D41A 3GSIA 3KJQB 2R7VA 1WORA 3G71S 1FJCA 4WK1A 1U8SA 4IFVB 3W63A 9ATCB 2CQHA 2O5DA 3JYTA 3FKBA 2DGXA 3ZZRA 3SDEA 3TARA 2JC1A 4RX6A 3WDOA 1K9MT 2OPPB 2WB4A 4DUTA 2Q6CA 3MM6A 2BW7A 3RGIA 2EK6A 3MR7A 3OFEA 2R7TA 2M88A 5B0EA 3R6LB 1UWAA 3OXLA 3O8WA 4RW8A 1FEHA 2Q6BA 1WDDA 3H5UA 1FD8A 5M2RA 3D6FB 1Q16B 3POTA 1LWEA 1UAWA 4DV3J 3UD3P 4F3OA 2JEFA 1UJ5A 1VRTA 3NGSA 4JI3F 4C8KA 1KKHA 4DXLA 4TYBA 3IRXA 2VFRA 2J6UA 1TVRA 1N88A 3MEEA 5A8RB 1VQ6S 5ETOA 5DZ6A 5G0RB 1REVB 2MPUA 4DX5A 3BKTA 2Q43A 2OGUA 1WF1A 4HKQA 1L3TA 4F0HA 2L08A 1XEZA 3V4IB 2N4CA 2ZHAA 4CLLA 3CCQS 2IRUA 4V19J 5IM0A 2LU2A 3HI9A 3RRKA 3IWNC 1PBUA 3CMES 2W2NP 3HDSA 3I5BA 4LF1A 4ED1A 4Y0FA 2ASDA 2HBZB 4IFYB 2ZC3A 1AB8A 4Q7AA 2YPZA 5DRKA 2EKNA 3CO0P 2IJRA 1FRJA 2M8HA 4ZPCA 4WKRA 2W01A 2XZTB 2V8DA 4QW8A 1M5OC 1RT4B 2ZJPQ 4ZOSA 1TKTA 1G7CB 4O3NA 2DNMA 1KQSR 4YFUA 2AJFE 4G1QA 2WSEC 2M8DB 4Q2MA 5HVFA 3UN3A 4DUYJ 2OPRB 1RHMB 3BJYA 3ZO7A 3D6TB 2XG8A 3EDQB 3ZZPA 4O4RA 4CLFA 1U26A 3FGVA 3I82A 3T5HA 2NSBA 1TK0A 1WTBA 4OMFG 1NB2A 1NJIT 3LP0A 5F3ZA 3R5GA 4TVAB 2N7YA 1S6QA 3C6TA 2ZOMA 5LJ3Y 2G4BA 1Y4ZB 5GADI 2CQ2A 3PFEA 5DG8A 1BC6A 1SC3B 1JMTA 4OI6A 3AB4B 3SEOA 4Y2AA 1Q8IA 4Q44A 1OY6A 2YH0A 1WD6A 3FC9A 2RHSB 1PYTA 3S6EA 1ELOA 4K8RA 3EXCX 4ZLPA 5GAGI 3DRYA 4EYHB 2CWKA 1N32J 1IM6A 2C2MB 5F9LA 4DSJA 2KJVA 1S57A 3EWGA 5HQLA 4MH8A 2CRLA 4QCLA 4IG3B 2Z30B 3B4DA 3Q8VA 2OLWA 3K8WA 3BS9A 2APOA 2BKPA 2ASJA 5HROA 1M90T 5KT3A 4DR2F 2DXFA 5HANA 2VUGA 1P9QC 2VPXB 1F0XA 1RADB 3R2DJ 1ZM3A 3MM9B 2E5IA 2W2PP 1RTHA 4OZ5A 2DY1A 4ZCIA 3G4SS 2LFVA 2ZOFA 2VFUA 4RNHA 2UVWA 2QSFA 1X5OA 4ATNA 1LEOA 2K1RA 5J2MB 5ETRA 1RTIA 1Z1ZA 3DYAA 1HQEA 1RWOB 1O8BA 1IBLF 4LF7J 2VFVA 1SIZA 2YWHA 2HPUA 4LFBJ 4LRAA 2W9CA 4UW2A 4WFBQ 3Q8SB 1HFEL 1H38A 3FUYA 4N76A 3QWUA 3MM5A 4CT8A 2B4UA 4EBEA 4H4MB 4X65F 2HHXA 1JLCA 2V34A 2OH2A 2ZBRA 3QFWA 4F4WA 4NLXA 5H9EJ 3OBIA 3AAWB 1VK3A 3CO9A 4DR5F 4DL0C 1RBLA 5KFPA 3TEHB 2N3LA 3JSMB 2AJ4A 3C15A 4WKYA 1KFSA 4AFFA 3IWLA 4HT5A 2FTRA 2RKIB 3DLBA 2IHR1 2QGFB 4CLPA 2UXDF 2BW2A 1X5PA 3BB5A 4HH0A 4QJVA 1S72S 2FY8A 4LF5J 3PJWA 4KQZA 4GRSA 3QPIA 1FRLA 3DGVA 4K2JA 2F40A 4KHMA 2U2FA 2V2KA 3DDKA 3GV5B 3Q23A 1RI7A 1RT7A 2NS1B 3MCNA 3N6NA 2R7SA 4X62J 2XY6A 4DSFA 5K8MA 5AE3A 4F02A 3M9MB 3MTKA 1FK9A 5C5JA 4USMA 4M5JA 1X4BA 3JSBA 1FTCA 1HBOA 4OZ3A 2HGMA 3KLHB 5KFYA 4DV0F 1I6JA 1VBXA 1U7LA 3TAMA 4KO0A 1WC6A 1YBAA 1N56A 3HM9A 1U47A 4K4YA 2ZH2A 1ZM9A 4F7VA 2O66A 3JYTB 5CCMA 3SDEB 2I9SA 2ZM6J 3HPOA 1P9YA 2IYIA 2LU1A 3G87A 1XMOF 2VKZG 1NKCA 2DK2A 2HHVA 4I69A 2HFUA 3MM6B 2C2KB 1F2GA 3HVWA 2CPYA 1KFDA 2KO1A 4RW8B 3RRHA 4FF2A 1QVFR 2AF6A 3KLGA 1FJGJ 3POTB 2PIIA 1LWEB 1KNZA 3AD9C 3DLKA 1Y9OA 2V6AA 3OL7A 1VRTB 2R2UA 5IWAF 3R5JB 1HKAA 3IRXB 4RKUC 1QJHA 5A2QU 1VRQC 2MGZA 1TVRB 4QOTA 1PILA 4CI0B 4DUZF 1H3DA 3MEEB 1Q81T 2OTJS 4LIRA 2RH3A 3JS9A 4OV6A 5AE2A 3US5A 1S77D 5E2QA 4QW9A 4K7QA 5IM0B 2DCLA 4CLWA 2R8GA 4WXOA 5C42A 2VC0A 1I94J 4AE5A 1RKIA 4I4BA 4ECYA 1SH0A 2F4FA 1Q7LB 3ENAA 4URGA 2DR9A 3OTCA 4FKXA 3RJMB 4B3OA 2D1CA 1TKTB 3TJAA 5E41A 2JX2A 2N82B 2F8EX 7FDRA 3M2VA 3B82A 4WJBA 1VC5A 4G1QB 4DLEA 1SB6A 2QYGA 2HFOA 4R0JA 1AUDA 5KAKA 5CA5A 3I4HX 2UU9F 4Y00A 1QSYA 2NXEA 4URQU 3I96A 2FHKA 2V8GA 2FY1A 2AJQA 5KG5A 1YJVA 3BYRA 3GLJA 3LP0B 4CLSA 2QL7B 1X4AA 1Q8LA 4C2MA 1S6QB 1UCNA 3JXOA 3C6TB 4NLYA 2ERRA 3OVSA 2L9NA 5D15A 4MIAA 1SPBP 4WU3A 2BYCA 3MI7X 3T5KA 2B9YA 4CTAA 2Z2YB 4EZ9A 3D0HE 3H5SA 4OI1A 4X66J 1NDKA 4DSIA 4L6V3 5GMDA 2ZH6A 5A8KA 3SSSA 2J7WA 3S8SA 3QT7A 1RSCA 1X4FA 4UZBA 1WG1A 4OHYA 3IP0A 3M05A 3HFZB 5D3GA 2VQEJ 1WHYA 2N7CA 3TI0A 1IBMJ 2DHSA 1YSJA 5CHCB 3CJ8A 2F1FA 2A10A 1S9FA 2W4PA 3P49B 2JEIA 2J5AA 4P6QA 4PXDA 2XMJA 3D0IE 2ZH9A 4DV7J 3HHLA 4LF8J 3M6UA 4IRKA 5HROB 1LFWA 1Y3JA 1HNWF 4M5KA 4K4VA 4FYVB 3L7PA 4ZHRA 4HI2A 3GV8B 2YVSA 5A8WA 3ZZUA 4GKKJ 2R2RA 3C19A 2VDHA 5IT9U 1RTHB 3I0RB 4Z37A 2YNGA 2AZ1A 2HFNA 4KB7A 3NP5A 3KDOA 2K1RB 4OX6A 1IWAA 1RTIB 3GONA 3DYAB 1HQEB 4JI8J 1SUQA 5KFGA 2OAUA 5KG3A 1VQ7S 2W9CB 3UDEA 4YUDA 3FEYB 2XYPB 1Q1KA 3MM5B 1JLCB 4EI2A 1C4AA 1XERA 4YB1P 3RAXA 2M5YA 3KJVA 1UTAA 4LQ3A 1S4FA 1QAIA 3CCUS 4QBUA 3A12A 3ITHA 3KK1A 3VCDA 1TP7A 2XI2A 4UF4A 4F26A 3QAEA 4JV5J 4O4GA 4YY3F 4M5HA 1F9FA 4DR1J 2MZ1A 3C15B 4OYOA 1VHIA 2KRBA 4LSNA 1RLCL 3ZNJ1 4LBHA 2IRYA 4XPEA 4ZIWA 4I68A 4RL1A 3VZHA 4PYAA 2FZGB 2DIUA 3BBCA 3LP1A 3NY0A 1ZETA 4EU0A 3C16A 2DGUA 3V6KA 3D66A 1VQYA 4O0NA 2B4OA 3LO3A 3T1HF 2QX0A 1RT7B 4K2XA 1RTZA 1Y11A 5CAAA 1SJ1A 2NCKL 2HHWA 4RNMA 1TR0A 3RB0A 3MURP 4QYZJ 3AQPA 3U02A 1DLOA 1EB0A 2MJUA 1FK9B 2RDJA 1RCXB 1PCAA 1IKVA 2WTFA 4C9DA 4EBDA 2MSTA 2OEKA 2V2ZA 1HBOB 4XDCA 1BWVA 4PKDB 2NQPA 2YQ3A 3M8PA 3TAMB 3TUZC 4KO0B 2BJ3A 2R8JA 3I87A 3TJ8A 3G6XA 2GO9A 1S59A 2FVQA 2Q79A 3BGUA 4USTA 2EC2A 3NCPA 3LF0A 3MF5A 4HL9A 4ZJLA 2C3UA 2RS8A 1GMWA 2UUWA 5SUHA 3MM7A 4A8MP 3M7VA 4H4KA 2WBRA 3W65A 4W98A 1EX8A 4J9RA 3VAHA 1KQKA 3PJXA 4EMDA 1PKUA 4EEYA 2OPSA 1ZAXA 2DO0A 2UP1A 3ISNC 4P2MA 2GZOA 4J9NA 4LF4J 5B09A 4GVBA 2MY8A 1TFYA 1N4LA 2XZWA 3KLGB 3CJRA 1B70B 2GAGC 2MQPA 2XMVA 2CG4A 3KJNB 3DHWC 2ZBPA 3DLKB 3RB4A 3R1LA 1DFDA 1VQ8S 4BDPA 4NX9A 1WWHA 3OV7A 3NAIA 3OFGA 2RIJA 2QRRA 1RB0A 2MGZB 2D9OA 4YB7A 4DX7A 1HNVA 2L9WA 4L3KA 3GIIA 1S7IA 3VAIA 3TO8A 4DV3F 5LJ5Y 2PMWA 3THPA 2BJ9A 3UCGA 4C97A 2FGOA 2HFSA 4OYXA 3ZZOA 5M2UA 2BE9B 4N47A 1W26A 3PYEA 3FBBA 3PV8A 3EVWA 3ZTRA 1FKAF 4IUFA 5C42B 1MLAA 4ES1A 1BLUA 4N8OA 1VC0A 1ZS6A 1WUUA 1GXTA 4CYUA 3PFOA 2YKMA 3D6HB 1D8YA 4Y34A 5CD4H 2CJBA 4B3OB 1WJ9A 4WCEQ 3H59A 3M2VB 3MR6A 4M8LA 2YNHA 5ETKA 4FYDA 5K20B 3V6JA 3SXLA 1L3VA 1VJQA 1Y0HA 2LDYA 5K9FA 3VAKA 1S48A 1S0OA 2XMTA 3OVAA 3PX4A 3A8KA 2ADBA 2NPIA 3KHGA 1UEKA 3RU0A 4OLOA 1WC4A 3G9CA 4ECUA 1GTHA 4X64J 4KBIA 4DUYF 1XN9A 4CP5A 2QC3A 2DKOB 4CTAB 3GV7B 1RGVA 1SKWA 4PCQA 2DITA 1U1PA 5A8KB 2G2OA 3T5JA 1H2VZ 5DDPC 4ECRA 3GP9A 2IJNA 1VJWA 3DM2A 2D3OR 4KH0B 4YOEA 4B9UA 3O2IA 5D3GB 2R8HA 4KFBA 2AQ4A 3KLEA 1NKEA 1FA0A 4MK7A 1CVJA 1UPMB 2ZWPA 4DJBA 1Z2LA 5DQIA 2D69A 2KRRA 2N3OA 4A48A 2G1HA 1JLFA 1OS5A 1U0HA 3HHLB 3VHQA 4L76A 2EW9A 2FVRA 3ZFVA 2LA6A 4NYZA 3J81Y 3T3FA 4ZHRB 2FJXA 4D3HA 1NB7A 2MMYA 5A8WB 3CJ4A 3TOQA 3MWBA 1DTQA 5CCLA 2YNGB 1HQ2A 1NU4A 1WEXA 1S1TA 1RLDA 4ED4A 2JL9A 4TXSA 1G6BA 5KG4A 4H4OA 5E3QA 3N6MA 5CQGA 1OO0B 1SUQB 5KG1A 5LOQA 1Q5VA 5HMYA 3EGNA 5D4LA 4MYUA 1UW4A 3WHIA 3HKWA 4MFBA 3T9ZA 3UN5A 4OFZA 4ETZA 4XDDA 4Q43A 4B9TA 4DR6J 2D7SA 2VBXA 3K5PA 3KJVB 5IXUA 1D1UA 4RPFA 4BHQA 1OSDA 2DY9A 1MWYA 3ZZ0A 4FDFA 4IG0A 2WVCA 3ITHB 4DF8A 4PRFA 3KK1B 1F5CA 4LF7F 4O3PA 2OTLS 1NJXA 1N52B 4LFBF 1UFKA 4YS2A 4O4GB 3RTVA 1XIQA 1Y5LB 3BDPA 1OPZA 2CQPA 2JSXA 1X4GA 4CCHA 3PRBA 2Z57B 1X60A 1NSKL 1HL6A 4LSNB 1T0TV 3D5MA 4JI5J 1OY8A 2EFPA 4CO4A 1X9SA 1F1BB 3LP1B 2X51A 4F4AA 4O3RA 4U8VA 5DQHA 4BWJA 3C16B 3DKDA 1JQGA 3W9HA 3MR2A 3RRGA 3LGNA 2KTQA 2LEPA 4CH1A 3THVA 2OI2A 4ZCKA 3E01A 3KHRA 1X8DA 4DQPA 2HHQA 3RBDA 2BZ2A 3K5OA 4C98A 2IBKA 3OHBA 1DLOB 2UZAA 3OXFA 1GK8A 2OFHX 4LF5F 1ZAVA 2HVHA 1IKVB 1N48A 2MDAA 1ZM4A 2OEJA 2JFDA 1RHQB 2CQDA 2HVIA 3OFFA 4K0KJ 3AD8C 3M8PB 2E5JA 2MHEA 2HFVA 3CDUA 4X62F 3HHLC 1C2PA 4PWUA 3UN2A 4OYZA 2X7IA 3R1HA 3MM7B 1LW0A 2NR0A 4X4PA 4HHJA 4J9QA 2YX7A 3S7RA 3P5TL 4HI1A 2XMAA 2XB2D 3OLBA 2KT2A 3DU6A 2BM0A 2HHTA 1ZZNA 2WW8A 3FSYA 2OPSB 5H9FJ 2A2DA 1NH7A 1PYSB 2LLZA 3NEKA 1RAGB 1DARA 5KOXA 4FYYB 1B64A 4GVBB 5AXKA 1UJ6A 2QFIA 4J5OA 3SBMA 1R8HA 2H1YA 3HSJA 2ZM6F 5B0CA 2Z58B 1CJVA 3BM7A 2GW8A 2KH9A 1XC9A 2CQBA 3QJLA 3IM9A 1QAXA 1ICEB 3DLLQ 4OJHA 3AHPA 1CJKA 5DG7A 4M95A 5KFEA 3ICLA 1WKLA 3WC0A 4CWBA 1SKSA 1HNVB 4MK9A 2R7WA 1FJGF 3GFHA 2FIUA 3OR1A 4ZPWR 3H20A 2VB6A 1VC6A 2UV8G 3BO2A 5ITHA 1R6YA 2DNHA 3NOCA 2IVFB 4J9VA 4N41A 3OLAA 2NYHA 2YXLA 1PSDA 4O3QA 4JI7J 1YIJS 3ENQA 3U1MA 1FKOA 3NBPA 1KBRA 4ZLJA 3HF5A 3FBFA 2R9LA 4CYUB 1IUJA 2YKMB 5JUMA 3DRPA 3MD3A 1M5HA 4OLPA 3FEXB 3WQPA 2ALYB 3CJQA 3QNWB 2WAQD 2IA0A 2JEGA 2LQ8A 2M4MA 3C14A 3GFZA 4F4XA 3J80U 5T14A 4B3TJ 1IQTA 2YNHB 3N6LA 1WNEA 2UUTA 4AUKA 1I94F 5IS2A 1TMJA 1U02A 1GX5A 1ULRA 4XIUA 4ZVQB 2JLFA 4QZVB 3SMZA 3CGIA 1U1OA 2ATCB 1C4CA 2I5JA 1S1VA 2C28A 5GADU 2VD3A 5BXIA 3T5LA 2GQCA 2J0XA 4WU2A 3EGWB 4RR5A 5LSLA 3HHLD 3FBEA 2GC8A 3R7SB 3BV8A 1FEEA 4EGLA 4DX6A 4ED5A 2C42A 2XBPA 5U47A 4N8NA 3DM2B 2L48A 2DNKA 1FDDA 4KFBB 5GAGU 5L39A 3KLEB 4JI4J 5KT4A 5KFQA 4DN0A 1ZBTA 4X66F 1U2RA 5D6GA 1JLFB 4TU9A 2UXCJ 1WSVA 1U0HB 4JB8B 2HQFA 1RYSA 2ZDOA 1RABB 4A4JA 2DEIA 5DDRC 2RRNA 2VQEF 3PEJA 1YTYA 1RAIB 3HP6A 3FZBA 1N33J 2AJ2A 1H7XA 1DTQB 3D2WA 2LP4A 2ZZMA 1S1TB 2J9DA 1R3NA 3IXQA 4A8QA 4IOAQ 5H9EK 1FDAA 4RNNA 1S4EA 4DL7A 4H4OB 4DV7F 4LF8F 1XK8A 3W5XA 2WVDA 3CJ0A 4YR2A 1UFWA 4QU6A 4MFBB 4WK3A 1NHUA 1UFLA 1FT8A 3IBWA 4GKKF 2YKOA 3F44A 3AT1B 4PG8A 2R42A 3CCWA 1S6OA 4K50A 3KFWX 4AXIA 1NPKA 2Y0SD 3GFXA 3ILIA 4IG0B 4J9OA 3D3BJ 1DRZA 3A13A 4ZP6A 3HT3A 3FDSA 2HWTA 4XK8C 3H5XA 1VISA 4F25A 2F3JA 3UVJA 1X4EA 2AGPA 4PWDA 1MSWD 2AGQA 4ILMA 2QMUB 3GYXB 2QL9B 1NSQA 3NNCA 2CQ1A 3GCXP 5J2PA 4ZN1A 1EQ0A 5FLXY 1VQNS 3CCTA 2IMWP 4KRWA 1OIAA 3MOJB 1EIYB 1APSA 2GMHA 4DPTA 3TUIC 3NGTA 2J7KA 2BE2A 1V3RA 4JV5F 5A0YA 1X9WA 4CO1A 3DRSA 4DR1F 3P3DA 4KGZB 4V19X 1TELA 4JV0A 2IA6A 2VJVA 1HNZJ 5KT2A 1VR6A 1N54B 3E01B 3H2VE 2H65B 1YHQS 2HKEA 2ROEA 1GMWD 1S99A 1V5VA 3VTIA 4G65A 1D0EA 2FGCA 1ROFA 2PFDA 2JZ5A 4MIBA 3OW2R 2QMWA 4DDFA 1TZ0A 4NLUA 2IM3A 2XLKA 1F3FA 1HBNA 3DLGA 1BMQB 2HZVA 2HBRB 3KMSA 3UDLA 1VBKA 3RBXA 5H1SV 1J5OA 1GNKA 1Z2ZA 1UP1A 3LUYA 3TWZA 2XGPA 2ZHBA 2VQFJ 1LW0B 2AKWB 1H7WA 1VDHA 3KJFB 2AHOB 1ZM2A 1NHKL 3BQ0A 3AOCA 1YQHA 3DRXA 1OPIA 3O6QA 4X84A 1MMLA 3HCXA 1WC1A 4QR0A 4F4KA 4HVZA 4FNIA 3UDVA 4IO1A 3GJRB 1EARA 5C2CA 3V4MA 4ZVPB 1CJVB 3M6VA 2J76E 4DPUA 4M5NA 4DV2J 5E33A 3K8VA 1JKHA 4ZJQA 2NXNA 2PO4A 5DGBA 3C3LA 4CRJA 3M2RA 2G0CA 3G82A 2K7JA 1CJKB 1ZA1B 5LT5A 2IBOA 4LREA 4LF4F 2HNDA 3R97A 1WEYA 2WVBA 3NKYA 2E1CA 3RW7A 3OR1B 4B3MJ 2V8HA 5L9NA 3QZ7A 3JTPA 2AWZA 3EM1A 1RXOB 3EGVA 1YK9A 3J7AN 2FUG9 4CIOA 1MMNA 3TUPA 1U2CA 4NL5A 4ZS6A 4OX7A 2C2NA 2WK4A 4NEZA 1V6HA 3JAMU 3LGMA 3HVRA 1FKOB 4KTQA 3NBPB 3TP2A 4ZPBA 5F8NA 1KTQA 2CPEA 1YRXA 4DS5A 3DRPB 3IRWP 1OJ4A 4K4XA 1HQUA 3HT0A 2DNQA 1TUWA 3OFHA 4O0IA 1FDBA 1U09A 5ETNA 4QIGA 4LRCA 2U1AA 3C14B 3EICA 2M9KA 4ANCA 3BBBA 4OX9J 1VLOA 2EI5A 2XO7A 5F41A 4AL5A 2AJ1A 2P8IA 3K5LA 1KWMA 4DV1J 1D09B 3FCHA 3RAQA 3GYGA 3KHHA 1TUGB 2ZFHA 2QL5B 1L3UA 1FFSB 4M5DA 5LSOA 3QIDA 3D28A 1AZSA 1X4DA 1MWQA 4LUBA 2L41A 2ZZNA 2I5JB 1S1VB 5FDLA 4PUOA 3GWCA 2E9RX 1FNOA 2DT9A 4GO5X 2FC9A 1GXLA 4ZJOA 4U8YA 3BPDA 2ADCA 2ZWOA 1T11A 1HBUA 1NRKA 2Y1LB 2HHSA 1JXLA 1DY3A 1EETA 1S1WA 3HJFA 4ZVUB 3M9OB 2H5EA 2XMUA 4X64F 2PE8A 2V9WA 1BUXA 1TFWA 2XHWA 3QRQA 2MKKA 1M5KC 1DBDA 4FZVA 2IDLA 2CQIA 3RBEA 2WW4A 4I56A 1NSAA 4G6VB 4B9VA 4NZ0A 1Y00A 2DH9A 3N9UC 2VKRA 3T6JA 3K5MA 5HL7Q 1FTRA 2FQQB 3D9BA 4ED7A 5IV3A 3SCLE 2CUYA 4LF9J 1HIYA 3HZGA 3I56S 2M2BA 1FI4A 4FVCA 1HHQA 1PC5A 3L7UA 3PACA 4ZCLA 3PKMA 4QWBA 4DV5J 4ELUA 2RD5C 3OJUA 1SVDA 2GHPA 5L38A 4F36A 4NA3A 1WG5A 1NK4A 2RHQB 3R5AA 4I0WA 4KHPJ 2UVVA 2QLWA 2HRUA 1P27B 1YRTA 1SQGA 2ILYA 3OVBA 2E9ZA 3K7RA 4MAKA 1HHTP 3UI3A 3GG1A 3BR9A 2WONA 4YMEA 2UUBJ 1IXKA 4NRUA 2B9WA 1XJWB 2O1PA 4C3LA 1R8PA 4DG1A 2HEKA 3DXBA 5ETPA 1NEEA 2ACYA 2J8AA 4DR3J 2O01C 3DOLA 2MXYA 2CVIA 3UVJB 2HGNA 1HLWA 2GFFA 4J9UE 3CIMA 3CCRS 4DR6F 4MJKA 4DQQA 3EE3A 1RBOB 4QYZK 2IIHA 5J2PB 1YJWS 2HK2A 1OQ6A 1I51B 4DPWA 3PKYA 4CLTA 5F8JA 5KFMA 3D1HA 4K5RA 3MEDA 1SCJB 2BQUA 2MHNA 3IBCB 2BE2B 3Q0AA 4IR9A 5A0YB 2ZJQQ 4RLEA 1NNDA 2W25A 3DRSB 1Q86T 5IOLA 4NLDA 1YJ7A 2MZRA 1K73T 1D9FA 3OL6A 2CNLB 4JI5F 2MEWA 2B43A 5G4DA 3HFVA 5DS7A 2CJYB 1VQ4S 3NG8A 2KDOA 4BC9A 4GC7A 1U1QA 4J90A 1Q79A 3L95X 4LRBA 2BJEA 4P9SA 4RW7A 1XBWA 2KI2A 1HBNB 3GILA 3DLGB 9RUBA 2EXUA 2BOPA 4PWWA 4WYWA 2I2YA 4R0EA 3AJDA 3CWJA 3PIPQ 3EPIA 1Q53A 1SC4B 2XGQA 2C22A 1J5OB 5CYQA 1SC1B 1YG0A 2PI4A 1UA1A 5EUHA 2EBEA 4OZ1A 3WIVA 2B7CB 1GXUA 3PHEA 4K0KF 1TL7A 1X5SA 2BXJA 3I31A 4XAKA 4OHVA 2RE1A 2CNKB 2QA4S 1NLKL 1LKZA 2WOMA 1N5YA 1RWKB 2VBYA 1SJ3P 5BYRA 1N8RT 3FNNA 3BGLA 2FVSA 2HYIB 2VA2A 4ZVTB 2J9DE 2HFZA 3LOUA 4Y65A 4RW6A 5D77A 2EFOA 1Q4RA 3HO1A 1WOSA 4XO0A 1JKHB 3FQLA 4AQYJ 1CPZA 1TL5A 3M2RB 4JUZA 4DZ6A 3EVOA 3G82B 2C2RA 4J9KA 1DTTA 2K3IA 2KXHA 4IQMA 4K4UA 2HNDB 2W4CA 4TYAA 1LNQA 2BANA 2V2VA 2DEJA 4DI6A 2B56A 4IOBA 1SIWB 4V1Ak 2JLGA 3LW5C 1RYRA 2HGLA 2J6SA 1FVQA 7FD1A 4C11A 2CQ4A 3JTNA 2A3JA 2OKQA 5AE1A 3KYLA 1RTJA 3N0VA 3BGOP 3GCWP 4FF3A 4KGVB 1C0TA 2BKOA 3I55S 2P6SA 1U1KA 3H4DA 4JYAF 2UVUA 3UW1A 4X4UA 1RT6A 3DU5A 4QR2A 4O23A 1Q78A 4O44A 2F9JA 3I9ZA 4C8OA 1NPRA 4I64A 2ZVIA 1Q0NA 2HLTA 1RWXB 5JXSA 1HQUB 1RHRB 2CIMA 3C2PA 2E29A 2QA2A 3P96A 2IMOA 3H90A 4DL2A 1U1RA 1RT1B 2XY7A 3TAPA 3OL9A 4IH6A 1YZ6A 4JI7F 4J91A 4OYMA 2QFJA 2MQOA 3OUYA 3QJPA 3F0NA 3W66A 6FD1A 6AT1B 2YWWA 2RU3A 4M5DB 1B0PA 2ZBIA 1RBAA 1AZSB 3AJ2A 2VPWB 2XM3A 1K8AT 4YDXA 4B3TF 2VG7A 1XMBA 5FDLB 2BMBA 4PUOB 1IBCB 2AW0A 3AD7C 1A0OB 2FC8A 3D0GE 4JI1J 4FN5A 3A3OB 2I38A 4CNZA 1HBUB 3ZXWA 2ZH1A 4OI4A 2XSFA 1EHWA 3CPWR 1SQFA 2B5JB 2ZE2A 1U24A 2DNPA 1EETB 3UDCA 3W64A 1R31A 3BDEA 3X3UA 4DOZA 2GJIA 1FWLA 5I3QA 4CNYA 2KFNA 2LCWA 4KT0C 4N7TA 5CABA 2RF2A 4HTIA 5GAHI 4U67Q 3DLEA 2GA7A 4NLTA 3LP2A 2E7WA 2QA4G 5I3UA 1MN9A 2W8LA 3P8BB 3PJ9A 1VQPS 4JI4F 3QMQA 1RWVB 2QJ3A 2WHOA 4ECSA 2GIQA 2HLUA 2FPHX 4QIFA 3P6YC 1HWKA 1OWXA 2UXCF 2CJAA 4LQ9A 1WKKA 5D0RA 4TLQA 5KFVA 1VQ9S 2QLFB 4QWCA 3FSIA 3MAQA 1QUPA 3V6HA 2AYMA 5DGAA 4PXEA 2IFXA 1K0TA 4ED6A 1OSCA 4FNHA
chains in the Genus database with same CATH topology
3HHKA 4FYDA 4X4NA 3H2UB 5E3PA 4FXVA 1IKWB 3V6JA 3SXLA 1L3VA 1N33F 1SJQA 1Y0HA 5B0DA 1BQXA 2HRYA 4YR0A 3H5YA 2F7VA 1KN6A 3PW5A 1IM4A 2LDYA 5K9FA 2E66A 3VAKA 1S48A 4P7TA 2NZ4A 2G13A 2R8IA 2XCPA 4IFVA 2FHOB 1AROP 2ZNZA 1URNA 1S0OA 2ZH3A 2XMTA 3OVAA 2YKNA 3HVAA 2XCAA 4NWBA 3QAUA 3PX4A 1A6LA 4Y2KA 1GT8A 1H2TZ 4A8XA 1MW7A 1NZAA 4CH7A 2ADBA 2MKJA 4KGMA 2NPIA 5F0UA 4DG1B 1RT2B 1YJNS 2OPPA 3KHGA 1RAJA 3RU0A 4DFMA 1NK5A 4O3OA 4OLOA 4DS4A 4LSLA 4I2PA 3G9CA 4ECUA 1T02A 1UKUA 1GTHA 3DOLB 4ID5A 1FXRA 1HW9A 6FDRA 3VAMA 1U6BA 4OJGA 4EZ6A 3NAHA 3CSKA 3B78A 3CD0A 5KFXA 3DHXA 4KBIA 4DUYF 2QZ8A 1SJFA 1XN9A 4FBTA 1YITS 2LA4A 2DGTA 5HP1A 4CTAB 5EX3A 5HI7A 5F8LA 5DG9A 3GV7B 1SJ4P 1RGVA 3H2LA 1SKWA 4PCQA 2DITA 2AJQA 1U1PA 1KLMA 3VR1A 5A8KB 1K0VA 4WTYA 2GHWA 3SV3A 4B17A 4OI2A 5KG7A 3T5JA 3TA0A 4F2SA 3MEDB 4DPOA 4I1TA 4JV1A 1H2VZ 1X0PA 4NLVA 1H98A 5DDPC 4ECRA 1CQMA 2IJNA 5FD1A 1VJWA 1Y7PA 2DISA 3FZ2A 3PDNA 2DVIA 3AQOA 3DM2A 3M4XA 2D3OR 4NLWA 4TU8A 4GO7X 1UVKA 5M2PA 4NOHA 4YOEA 3KG1A 1D3WA 2PA8D 4B9UA 1IBMF 3O2IA 5D3GB 2R8HA 4L72B 2ILZA 4KFBA 3OTBA 2EK1A 4I6AA 2AQ4A 1HYSB 3KLEA 3KTQA 4BCAA 1NKEA 1FA0A 5KT6A 4MK7A 1CVJA 1IKXA 4D3GA 2YNFB 4DJBA 1Z2LA 5DQIA 1YJTA 1QE1B 4NYPA 2KRRA 4TN2A 2WB1D 5A8RA 2CQCA 2KHCA 2N3OA 1T7PA 1W2IA 2DGQA 2E1RA 2LQ5A 1HNIB 2QLXA 5K8PA 3KHLA 4A48A 3UQSA 5G0RA 1R43A 1REVA 2CPFA 2VASA 3LPYA 3O44A 3GFYA 2CPXA 1JLFA 1SI9A 1UMJA 2BUNA 3DNCA 1X7VA 2RDIA 4WFZA 2K2PA 1XR5A 1OS5A 1KC8T 3CD6S 1NAQA 1K1QA 4K4SA 3MPYA 2CFXA 2V0NA 3HHLB 1LFPA 3CE8A 3MD1A 5C24B 1NHVA 2EKYA 2JRSA 3V4IA 4F2RA 4QYZJ 2HNYA 2EW9A 4UOCA 1QTMA 2FVRA 3ZFVA 1XR7A 2Q66A 1BQMB 1FE0A 4M1KA 1WF2A 2AJ0A 4XPCA 2LA6A 4DSEA 4PG4A 3CXCR 4NYZA 3MMJA 3J81Y 3M6WA 2R2SA 4WE1B 3K57A 5MAOA 1FKPA 3T3FA 4DSLA 4ZHRB 4RW7B 3EZ5A 3LANA 3BGRB 4D3HA 5LXYA 2FJXA 2YX4A 1NB7A 4ZVHA 3TANA 2MMYA 4EUVA 5A8WB 3GQCA 1YJRA 2EWHA 4TY8A 3CJ4A 2OJ3A 3SCIE 4OJ3A 3TOQA 3MWBA 4IFYA 1DTQA 4QWEA 5CCLA 2DPJA 1RP5A 2YNGB 1WEXA 1CG2A 1NU4A 2Z2LA 3AJ1A 2W7AA 1S1TA 1JNZB 5E5NA 3Q8PB 3SYZA 4RW9B 1FERA 1HWLA 2JL9A 1GAOA 4JI8F 4ECWA 1U6FA 4TXSA 3R3TA 3QGIA 5CYQB 1ZPWX 1G6BA 5KG4A 3THTA 4H4OA 2MQQA 5E3QA 1ZTTA 2A2CA 3N6MA 2E5HA 1WHVA 3CF5Q 5THWA 2R7XA 2MKSA 5CQGA 3I5CA 1OO0B 4ECQA 2ABYA 4HLBA 1SUQB 5KG1A 3PW7A 5D8HB 1RT4A 4FS1A 1T3NA 1H6KX 5HMYA 3EGNA 5D4LA 5IZHA 2GGPB 2OPQB 1UW4A 3I32A 4MYUA 1S1XB 3HKWA 4TNOA 4EFAC 2DO4A 4MFBA 1R8AA 3DMJB 4C0OC 4HH1A 1W25A 2J9EA 1J2VA 3OTOF 5L1LA 1R89A 4HT7A 3RW6A 1KS2A 3T9ZA 2IC3B 1SXLA 2DGWA 1VQMS 3OSNA 1IKYA 2AX1A 4OFZA 2PMZD 2AYEA 1G3OA 4ETZA 4XDDA 4Q43A 1TK5A 4B9TA 2D7SA 1FRMA 2VBXA 2AYBA 3RR8A 1N5SA 1S79A 2OPRA 4KHRA 3K5PA 1VS3A 2KHDA 2W7OA 3WBZA 2WOMB 3KJVB 1N5YB 5IXUA 1D1UA 3BO3A 3I5AA 4Q45A 4HDHA 2KVIA 2MZSA 4BHQA 3CJKB 3BSAA 3D54A 2E9TA 3IWXA 4ZP7A 1OSDA 5KG0A 3IGVA 4QPTA 1MWYA 1FJ7A 2VH7A 3ZZ0A 1ZH5A 2V4JB 4IG0A 3ITHB 4DF8A 2FJBB 4E0DA 4PRFA 3KK1B 2VQFF 1S6PB 3KOAA 1F5CA 1B7FA 4OI3A 1VMBA 1S1UA 5T7LB 1IR0A 4LF7F 4O3PA 1S76D 3CJ5A 4RW6B 1L5UA 1NJXA 2OTLS 1KVIA 1N52B 1N34F 4LFBF 4AQYF 3T1YF 3CIZA 4O4GB 1IJFB 3RTVA 3MXHP 2HQIA 3FFIA 1Y5LB 4I7FB 2EG2A 3PNIA 1OPZA 3G8TA 2QEXS 2CQPA 2JSXA 2VFSA 3RZAA 4PG7A 4R5PB 1AFIA 5JVHQ 1X4GA 5I3PA 4R25A 4DL3A 2RQKA 3PRDA 2DHAA 4CCHA 1UVNA 3PRBA 5A6PA 2X1GA 4ERDA 3IGNA 3MR3A 3MCSA 3SZ2A 1HL6A 3HHDA 3TUJC 1DTTB 4LSNB 1JJ2R 4NLPA 3D5MA 2RILA 2PI5A 2MZQA 2R7RA 5HN0A 2HW3A 2BANB 2W9AA 3FEZA 2O67A 1PO6A 1O0PA 5CYMB 3KG4A 3MM8A 2RRAA 5KFFA 1HHSA 3E8OA 5EWGA 2EFPA 4IKAA 1MU2B 4CO4A 1QLNA 1X9SA 5T41A 1FXDA 3DFEA 2NUUG 3LP1B 4WIIA 2X51A 1FO1A 2QSWA 1WG4A 4E8UA 4O3RA 4M94A 4C11B 2B0GA 4BWJA 5DQHA 2GV1A 4DX8H 1HNXF 2GMLA 4DV2F 1CEZA 1KEKA 3DOKB 2FJEB 4DFKA 1S9EA 3MR2A 1RTJB 3RRGA 3IN5A 4OJ1A 4PG5A 1SKRA 3G86A 4I6YA 4QIWD 4WXWA 3LGNA 4TU7A 1C0TB 2KTQA 1RISA 3MEGA 3L09A 2LEPA 1CC7A 4B3SF 4CH1A 1NK7A 3THVA 5F0WA 4ZCKA 3E01A 2YNIB 3KHRA 2DNGA 1SV5B 1JNRB 1X8DA 1RT6B 2YY3A 4N5SA 4DQPA 2VODA 2HHQA 3F56A 4KGKA 3RBDA 2BZ2A 1IJEB 1CSJA 1JLEB 4O44B 2VC1A 2I8EA 2DIVA 3K5OA 4C98A 2IBKA 3OHBA 1DLOB 2UZAA 1RTDA 4RUCA 3OXFA 2OFHX 2ASLA 1NK9A 4LF5F 4IG3A 1ZAVA 3BREA 4B3MF 2HVHA 1TUVA 2KFZA 1IKVB 2DGOA 4ZP8A 4LVOP 3NCRA 4DL4A 1N48A 1T05A 1DQAA 3IAM9 3MUVP 3UPFA 1FRXA 4NLQA 4A8YA 2MDAA 1ZM4A 4DN9A 1CC8A 2FB0A 1TL4A 2C3YA 1BQNB 1VI7A 1KOHA 2CZ4A 2QO3A 4QPXA 2JFDA 2CQDA 2EPIA 2OMLA 4R8UA 4J9PA 1XNRF 4NYOA 2HVIA 3OFFA 3MM9A 3WX4A 4NLRA 4USJC 3M8PB 2E5JA 4PQAA 2VG5B 5DQGA 1D9AA 2MHEA 1KD1T 3CDUA 4X62F 3HHLC 2ZOGA 1C2PA 2ROGA 2FJAB 4RBVA 3PVXA 4PWUA 2J6TA 2RRBA 3IR5B 2ZH4A 3I4PA 4CO2A 4KR0B 5J2MA 1Y3KA 1VIXA 4CO0A 3MTJA 1JJHA 4RUAA 3W2WB 3NGDA 3R1HA 3OUYB 3CC2S 3MM7B 3CC4S 1LW0A 3N5FA 3QO9A 4ECVA 1VBYA 1WF0A 2NR0A 4X4PA 2YWKA 5A6WA 4HHJA 4J9QA 2YX7A 3S7RA 1JK9B 3ONQA 2LVWA 3P5TL 4HI1A 4HDGA 2HWHA 3D1OA 2XB2D 4ICLB 4B08A 3OLBA 2CJ9A 2KT2A 3DU6A 1SL1A 4LFAF 2XS5A 5AXMA 2HNZB 4JBCA 2BM0A 3Q2TC 2HHTA 1WI8A 2M7SA 2IRXA 4TY9A 4MYTA 4H4MA 5HO4A 1ZZNA 2JOQA 2WW8A 3FSYA 4OX9F 2OPSB 3NGKA 5H9FJ 2A2DA 2M70A 2KG0A 1NH7A 4OV1A 2VG7B 4F4ZA 1X0FA 2LLZA 2LXFA 5L8RC 4QIEA 1DAXA 1VOMA 1DARA 1VHFA 5KOXA 1Q7YT 1W2BR 1B64A 1DQ9A 2ZNYA 5LXRA 3SV4A 3UWTA 2RU9A 5AXKA 4DV1F 3PM9A 2LMIA 4USHA 2RQMA 1UJ6A 4IYQA 1QAYA 2B4VA 5B0AA 4J5OA 3NLCA 4ZCMA 2DNOA 1R8HA 3NS6A 4ZPAA 2XULA 2KJWA 5B0CA 2ZM6F 4Q5VA 4Y6IA 3BM7A 4Q2LA 3E3XA 5KFZA 1KR4A 1NK8A 4ZPVR 2GW8A 2KH9A 2RNEA 3DXSX 3TVZA 3M30B 1LV5A 4GC6A 3HHNB 1RK8A 2LKZA 4M63A 2CVEA 2ZE2B 3TNVA 5J2QB 2PFFB 2XWXA 2AYGA 1XC9A 2CQBA 3QJLA 1RKJA 2BBEA 1QAXA 1FRKA 2P9CA 4QIVA 3JSMA 4F4YA 4C0BA 5EN1A 2RB7A 3DLLQ 3FRYA 5KFOA 4YP3A 2CQ0A 3AHPA 4OJHA 2KXNB 4X4VA 1YJ9S 2RKIA 5L1IA 4KV8A 4GKJF 5DG7A 3V6DA 1JLQB 4M95A 5KFEA 2X1BA 4I2QB 3ICLA 3HK2A 3RAMA 5AXNA 3PW0A 2KZMA 1LXNA 4NPOA 3WC0A 5F8IA 2XMWA 4CH0S 3FMWA 1SKSA 4ZVFA 4J37A 1HNVB 3H40A 4MK9A 2R7WA 1FJGF 3GFHA 2PC6A 5J1NA 3W7BA 2FIUA 4WZQA 5KFDA 3OR1A 2RF2B 2BM1A 1BD6A 4LMZA 4ZPWR 5E0OA 2A1BA 3H20A 2MZTA 2VB6A 3DLEB 3NL0A 1H2UX 1VC6A 3LP2B 2KYXA 2YH1A 4Q8EA 3TAQA 2UV8G 3BO2A 1FF2A 5ITHA 2Y1IA 3V2UC 4Q0BA 1R6YA 5I3UB 2DNHA 4TQRA 5KTQA 1N5QA 5KFNA 2IVFB 2ATLA 5KFIA 4OHXA 1YI2S 3BR8A 1C1CB 3VF0B 4N41A 2OFGX 2BQ3A 3OLAA 1U25A 4KC5A 3H8YA 3GG0A 1JLAA 3VAFA 1QAJA 1PSDA 4O3QA 1N36F 4JV2A 1S9GB 1WTFA 1S0VA 3ENVA 2H9ZA 4YHHF 4C8NA 1JX4A 1YIJS 3C6UA 3ENQA 3U1MA 1FKOA 1HD1A 2WSCC 3IA0A 3NBPA 3CCVS 4J9LA 3HF5A 3PX0A 2R9LA 2E5LF 1IUJA 2FDNA 5K14B 2YKMB 4FPRA 5JUMA 3DRPA 3MD3A 2IVYA 1M5HA 4OLPA 2FY1A 3FEXB 4CT9A 3NS5A 4CO5A 2AD9A 1TKXB 2NLWA 5E3RA 3EX7B 1YVFA 3IFEA 3I0SA 3TW0A 3DLHA 5L1KA 2WAQD 2IA0A 2E44A 1TL1B 3KLHA 2JEGA 3SCJE 4B02A 1RWUA 1TKZA 2M4MA 3PIOQ 2UUCF 3GFZA 4F4XA 1RT3B 3LWMA 1SC6A 1VRUB 5T14A 4EO6A 4IR1A 2YWGA 2WRMA 4F50A 2FLOA 1KTVA 1N6QA 4LF9F 3GYNA 1JLGA 3N01A 2PGCA 1IQTA 2YNHB 3N6LA 2E5GA 3CJ3A 3B4MA 3GR0A 2UUTA 3IAS9 4RZRA 3MFHA 2BA9A 1WNEA 4AUKA 5F3TA 2MZJA 1I94F 1X5TA 3EYZA 4NXMF 3HHEA 3W2VA 5EHHA 1RA6A 3KLIA 5IS2A 2D41A 2R7VA 3Q8QB 3G71S 1FJCA 4WK1A 1U8SA 4IFVB 3QYYA 1GX5A 2CQHA 1FNMA 1ULRA 2O5DA 3JYTA 1FNXH 4C8YA 2YKNB 2DGXA 3NRBA 1BWEA 4XIUA 3ZZRA 3SDEA 3TARA 2JLFA 2JC1A 1WHWA 4RX6A 4I67A 3WDOA 4QZVB 2VBWA 3DLJA 1BY9A 1K9MT 5D4PA 3SMZA 2OPPB 2WB4A 4QR1A 4N56A 1M5VC 3OJSA 2F8HA 4LSLB 5F8HA 1HPZA 2Q6CA 4KHPF 5KFSA 3MM6A 3QGHA 1S0MA 2OD6A 3CGIA 2EK6A 4ID5B 1U1OA 3OFEA 5DO2A 4ED0A 2R7TA 1A7GE 1C4CA 2M88A 3NMAA 5B0EA 1V3ZA 2I5JA 1S1VA 3OXLA 2HHHF 3O8WA 2C28A 4RW8A 5DDQC 1VIOA 1FEHA 1WHXA 2Q6BA 5GADU 3JSYA 1U1LA 2VD3A 4AYBD 2DRBA 3FJ2A 3T5LA 5HP1B 5DLGA 2GQCA 4JOUA 2J0XA 3DI6A 4WU2A 4A8FA 3H5UA 1FD8A 3EGWB 5LSLA 2VFTA 5M2RA 1Q16B 3HHLD 3POTA 4ZP9A 1KLMB 2GC8A 4A47A 1LWEA 2UUBF 2OIHA 1UAWA 2XWYA 3GR1A