4DR3F

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dr3F00
4JI6F 2UUBF 4JI7F 2UXBF 1G1XA 4LF9F 4B3RF 1XMQF 2F4VF 5BR8F 4DR6F 2UXDF 4B3MF 4DV4F 4DR4F 3R3TA 4LFBF 1FKAF 1RISA 1CQMA 5AJ3F 2BXJA 4DUYF 1I94F 4X64F 3OTOF 4GKKF 2HHHF 4LF6F 4DV7F 1IJEB 4JI5F 4K0KF 4LF4F 4LF8F 4YY3F 1IBLF 4B3SF 4LFAF 1HNZF 1IBMF 4DR5F 2UUCF 2UUAF 4JYAF 4DR3F 2KJVA 2RJZA 2B7CB 1XNRF 2ZM6F 4DV0F 1HNXF 1XMOF 1N34F 4JV5F 1F60B 1QJHA 4JI8F 4DV1F 4JI1F 4JI2F 1J5EF 1N33F 4LF7F 1XNQF 4DUZF 4NXNF 2YY3A 1IJFB 1N32F 1IBKF 5LMNF 3ZZPA 2VQFF 4YHHF 4DV5F 4X66F 5IWAF 2UXCF 1G7CB 4X62F 4JI3F 2VQEF 4DR7F 1FJGF 1GH8A 4JI4F 4DR1F 1LOUA 1HR0F 4B3TF 4DR2F 4OX9F 1CQNA 2BVZA 4LF5F 2J5AA 5LMUF 4JI0F 3T1YF 2B7BB 2E5LF 4X65F 1HNWF 4DV2F 4KHPF 2KJWA 1N36F 4GKJF 4AQYF 1VMBA 4DV3F 3T1HF 4DV6F 4NXMF 2UU9F 4LFCF 1B64A
chains in the Genus database with same CATH superfamily
4JI6F 2FHMA 2AYMA 2H51B 5DG7A 2IRYA 1ZM2A 4CLWA 2DXDA 2BDPA 5JVGQ 2A10A 3Q8PB 3BM7A 1FEEA 4YHHJ 2CPFA 3M8RA 4X62J 2HK2A 5CYQA 5E3RA 4YS2A 4FKXA 5F9LA 1RT7A 2VPZB 5SZTA 4B3SF 3V6DB 4I6AA 1XQIA 1UA1A 3HKWA 2C22A 1S0VA 3J80Y 5L39A 1DLOA 3H4DA 2W4PA 1XNQF 2ZH9A 5K8MA 5HP1A 5F8JA 2YX1A 1S72S 1QE1B 2VPXB 3BKUA 2PSZA 3JSMA 2VFTA 2F3JA 4K4ZA 1NEEA 3W9JA 1H73A 3HK2A 4TKTA 2RRAA 3OVBA 1WHXA 4FPIA 3M30B 2XHWA 4TY8A 1FESA 1AUSL 1IR2A 3M8QB 3DU6A 1F6TA 2IHR1 4WYLA 3A13A 1U1RA 2ZZMA 3MR2A 3MCNA 2H1YA 3N5BA 3PO4A 1NH8A 5F0UA 3KJFB 4M5LA 1Q1KA 2M0GB 4LFAF 2DGUA 2QMXA 1JLQB 5ETRA 3IR7B 2VH7A 3CCUS 4LT6A 1RTHB 4LRFA 1JNRB 3BEGB 5ETPA 1U0HA 4PWDB 2HRTA 3DMJA 1RAEB 3MMJA 3VAKA 2KRRA 3QZ8A 3H98A 1T05B 2HNZA 3MM7B 1Q8KA 1N6QA 1ZM9A 1NJIT 5K5MA 5K20B 4P2MA 3GZ7A 1UWBB 3SZ2A 1S1VB 3QAEA 3FFIA 2HNDB 2E66A 2A18A 1XK8A 3F0NA 3FDSA 4QYZK 2DNMA 3HMJG 3BV8A 2CFXA 4NX9A 3WHIA 2V2VA 1CC8A 2Z56B 4UF4A 2V6AA 4KC5A 2KU7A 4NXNJ 3EVMA 5HAOA 1JLFB 1YKWA 2XSFA 1TKDA 2O66A 2DNHA 2F9DA 1H0HB 4B3TJ 2AIRB 2MKIA 2E5LJ 1QSYA 3OLBA 1N48A 2JEJA 2OTJS 5CAAA 1AT1B 1DRZA 4GVBA 2IBOA 3NGTA 1OSDA 5KOWA 4IH7A 2GMHA 5DG8A 3U02A 4ZP7A 4I6YA 2PGCA 5EX3A 3I0SB 1Q16B 5J2MB 1RWUA 2UXDJ 2QYCA 2R7RA 3US5A 4RW9B 1PC5A 3UN3A 1PYSB 3GFZA 2Y1LB 3DNCA 3FCHA 5HI7A 2XCAA 3DRPB 2VKRA 3PFOA 5IS2A 5LJ3Y 3B6BA 3IWXA 3DLHA 1UKUA 1REVB 1TL7B 3OPKA 5AJ3J 4ILRA 2WVCA 3EWGA 5A8WA 4JI7F 4RW6A 4OI2A 4P2SA 2DR9A 1IKYB 3VTIA 4G6VB 4WIIA 2RKIB 3UN5A 2QFJA 5KTQA 4DL4A 1YX2A 2HLTA 3TJAA 1L3TA 1RLDA 3OL7A 1RAHB 2ALYB 1KLMA 5GAGI 1TP7A 2B5JB 1X0FA 2VBYA 4G1PA 4ED8A 1Q79A 2A1BA 4ECTA 1MU2A 4KQZA 3PYFA 2EFVA 2MKSA 2ZDOA 4DQIA 3RTVA 3SV3A 4WP3A 3BREA 2LQ5A 4J90A 2OGUA 3RAQA 4DV4J 3CO0P 1FX4A 1JXEA 4P7VA 3MM8B 4PG7A 5CH7B 4RUHA 3OTOJ 3UE2A 5KFYA 3R8YA 2YKMA 2JOQA 3HHNB 1RT6B 2G0JA 2Y0SD 3GFXA 4F7VA 2B0GA 5JXSA 2AX0A 1Y10A 2H9ZA 1YBTA 1N52B 1YBUA 4CO1A 3C14B 4LBHA 3UR3C 3DGPB 4RZRA 1H6KX 3AOAA 3MHYA 3I6PA 4J9KA 3LUYA 1PKUA 2BOPA 4OYAA 3CMQA 2V9WA 3WBZA 3K2YA 3J80U 1GTEA 3MEEA 4M5HA 4I4BA 3IGVA 4ECYA 5D4LA 1DJ0A 2VZ9A 3KLIA 2JHEA 8ATCB 3ILJA 4MJKA 1YITS 3CJQA 2QL5B 2OHDA 1RACB 4ZJOA 3W8GA 1D9AA 1VQOS 2JDJA 4J9PA 2QX0A 2PO4A 1KWMA 2RUGA 3EGZA 2GX8A 2G4BA 1NU4A 2OD6A 4DN0A 1DURA 2KB2A 1KFDA 3PJ9A 3IRXB 4E98A 2DKOB 4FBUA 2J6SA 3PKYA 3FEYB 3THTA 4TQSA 2M3DA 3KJNB 4H4KA 3NGUA 4NLOA 1HARA 4WTYA 3W5ZA 1Y7PA 1GQEA 4OJHA 3VF0B 3QT7A 1VGYA 2HGLA 1KHVA 5HN0A 2BRLA 4FVMA 2VOPA 2NZ4A 2HAIA 1YLXA 4DCOB 4CH1A 4I7FB 3BGRB 5KFUA 3DI6A 3EJMA 1AZSA 4Z7CA 2FJAB 3EX7B 1RTDB 1EQMA 2UV8A 2HVIA 2JEIA 2W7PA 3PHEA 3EMTA 4B3MJ 3VGVA 2IYIA 2XEXA 4I6WA 2NREA 1HI1A 2VFRA 1QSLA 4K0KJ 3TUIC 1LWXA 2AZ1A 5FJ4A 3QJLA 4P75A 2PEBA 4RW4B 2OSRA 2HNYA 5IM0A 2ZZNA 3ZTSA 1IWGA 4DHVA 1VS3A 2JJ4D 4I2PB 2LDIA 1U1OA 2W9CB 3A3NB 3JYTB 3AOBA 3NG8A 3MAAB 4LR9A 4IUFA 2OPQB 2WHOA 4FXWA 5L38A 4X4TA 3HD2A 3IS9B 1T7PA 2RS2A 4CM0A 3LGHA 1LXNA 4CWBA 4YB1P 3CJKA 2YNHB 2ZHOA 2M5YA 4A8QA 2SXLA 5LSOA 2MSSA 4OZNA 1FRHA 2J0QD 1QAJA 3FCWA 3BGUA 1RWXB 3Q8YA 4HT7A 1G3OA 4FF2A 1LQ9A 4IH5A 4Y28C 4NYPA 3G82A 2HWIA 1RWPB 4Y34A 4ZLNA 4ZIVA 3K59A 5A8KA 4JYAJ 2KVQE 2B51A 2VPWB 4BS2A 2DCLA 4O23A 1TAQA 2VG7A 2WW4A 2PA3A 1JJ2R 5A2QU 1VIOA 1EARA 3PY8A 5A8RB 4JI1J 2MDAA 4CZCA 1RWWB 4ES2A 1XR6A 4P6QA 4LBPA 2R8HA 3BJYA 3W62A 1VRUA 2FJVA 3OQ2A 4UTGA 1RJJA 3ELHA 1NBEB 5J2NB 1KONA 4J37A 4ECZA 2P5VA 4A46A 3VGUA 4P2XA 2AEMA 4I56A 3EVWA 3F56A 3MECA 3IO1A 5CA5A 3GSDA 4EMDA 2QMUB 1U8WA 2HQ3A 5I42B 3K5NA 3HHLC 1NRKA 4LR7A 2VBZA 3O8WA 3Q8SB 1HNVB 4USWA 1M5PC 3A1YG 3KDOA 1N36F 5KFEA 4PG6A 2HQDA 4OFZA 2M9KA 3JQJA 5HBMA 2BM1A 3GIJA 1NJWA 3ENWA 4DPXA 2Z0GA 1PILA 1S97A 2DNOA 4AUKA 2FUG9 3TZXA 2H65B 3QO9A 4ECWA 2KXNB 3MGJA 5AE1A 4F3MA 4Q45A 2D3UA 2HBZB 4C8NA 2UUCF 1P1TA 3V4IB 3NEKA 3HVTA 1RDRA 2FJEB 3KUEA 4RW8A 5LSRA 4YB7A 1XTZA 3CDEA 1WKLA 1NB7A 4N8OA 2V4JA 3RB4A 2J8AA 4JI2F 4DUZF 4NLUA 3PRBA 4QR2A 5CYJA 3KK3A 2HK3A 2XYPB 5B08A 1S1UB 3GU0A 4PG8A 3EE3A 1C0UA 4O3SA 1UW9A 1LW0B 1ZZFA 3ILLA 3ET6B 4MIBA 1HBUB 1WWHA 3MEKA 3V6HA 5F8IA 5ETNA 2CAJA 1S9FA 3MM9A 1UMJA 2HHTA 1FNOA 1UJ5A 2KN4A 3DKDA 1VFJA 2COLA 3OTBA 4DLGA 3TZYA 3AXMA 1JLEB 4ETXA 1PO6A 4QCLA 4QU7A 4C0OC 1I1GA 3CJSA 3LGNA 5ETQA 3ILOA 2HFNA 1M5KC 1HWUA 1X4EA 3GFHA 3P6YC 1NLKL 4KFBA 3C16B 5H9FK 5LOQA 3DFEA 3M9OB 2CRLA 4URSA 1MWQA 4H4OA 5B0FA 4HHJA 3E01A 1D09B 3DLEA 1BQXA 3HF5A 4WYWA 4ID5B 4CLLA 4JV2A 5I3UA 2J0SD 4F04B 2ROPA 3GWCA 2GHVC 3UDEA 4DR4J 3KUGA 3ISND 1X4HA 3VR1A 3MMBA 2ZH7A 4DN9A 3J7A1 4OYBA 2CXEA 2DISA 2ZKUA 1ZETA 4JI5J 3ZZUA 3KKFA 1SXLA 4KHPF 2FQQB 2CPEA 4WF9Q 1SC4B 1U6FA 3DLKA 2NSBA 4NI2B 2CNOB 3OR1A 4CO5A 3BBBA 3K5PA 3V4MA 1N33J 4BHQA 2BJ9A 1X0PA 3TUZC 4ZPWR 1IBKJ 3GJQB 3H8YA 1AA1B 3LW5C 4PXEA 6FD1A 1U2CA 1Y11A 3FMWA 1E6YA 3H5XA 3KLGA 1NKEA 1XR7A 3W3SA 4F2SA 5CXTA 4RNNA 2DJWA 2NSCA 4OI6A 2DR6A 1PBAA 3KLHA 1TUVA 2AEJA 4C11A 3KK2A 3NAIA 3NNHA 5E41A 1S77D 1JLAA 5D0HA 2BZ2A 2OP5A 1N32F 1PC4A 2PI5A 4CTAB 1FFGB 2QGFB 4DV5F 3HZGA 3HDSA 1GT8A 4RUBA 1UFKA 1CULB 4A8WA 3SDEA 2IY5B 1ZOTA 1TKTA 2XS2A 2GNKA 2H3EB 4FYXB 3K8WA 1TL4A 2MXYA 1LWCB 3OFEA 4IYQA 3PFEA 4OIXA 2XGQA 1TR0A 1LWFB 4JV5J 1RA6A 1RAAB 2Y0BB 4NLVA 1K73T 1X8DA 5CZXA 1U47A 1LFPA 4URQU 3ZZZA 1NM2A 1QUPA 2CNLB 4P9SA 1WG1A 1HNIA 2CQ4A 3N6MA 3R9LA 1LNQA 4W4MA 4RWXA 2YWKA 4Q0BA 2W2PP 4X4VA 1TK8A 1KTQA 1KDNA 4K50A 4LJMA 3CJ5A 2FVRA 3PIPQ 3A8KA 2WW8A 3M4XA 1ZYQA 1J2VA 3K57A 2WSEC 1YRUA 2BRKA 5A76A 5DLFA 3MM6A 2KT3A 1ZA1B 4WU3A 2OPSA 1HKAA 3ZZPA 2PEHA 3T1AA 5E7OB 4IRDA 2BJ8A 1U48A 2YX7A 1YQHA 3DOKA 2MKJA 3CCRS 3FNNA 4C0BA 1HNZJ 3M6XA 2YH1A 2UVUA 2ZE2A 2J9DE 4R5PB 2OSQA 5G4DA 5DDOC 1RWKB 4P10A 4ZP9A 5MLCV 2X51A 4DV1J 1V5IB 4K4VA 3N28A 4OL8A 2QC3A 3DRRA 1IXKA 1LW2A 4ELUA 5K14A 4USMA 1WF2A 4NZ0A 1X60A 5BYQA 4O4GA 4LF4F 1VQ6S 4J9LA 1UW4A 1QTMA 1TU0B 4NA1A 3PG9A 1YRXA 2V8GA 5HMWA 5KT7A 4F4ZA 1LFWA 2XBPA 4DV2J 2YQ0A 4LBIA 3QJPA 3DU5A 2RMLA 3CE8A 1RT4B 5G0RA 1D1UA 3VQTA 3AD7C 2FB0A 3R7SB 3M6WA 2Z4PA 1S9GA 2YPZA 2XMAA 3KUHA 2GQ2A 1SC1B 3K0JA 5C24A 1RAGB 1SJRA 4NLWA 2QLFB 1U49A 4YFUA 2I0XA 4N7TA 3NOGA 5DM6Q 4M94A 3EZOA 1Y3KA 2Q6BA 2RDJA 2ZBIA 5KG5A 4X65F 4Y2IA 1CJUA 2NZCA 2HVHA 5DGBA 5KT3A 4NLYA 1FRLA 3JSYA 1YG0A 4ZN3A 2XSJA 2UUBF 3FMBA 7FD1A 1R6VA 5IQ6A 3Q8QB 3W64A 1F5CA 2B4PA 2E9TA 1FKAF 1EAYC 4PQAA 2ZUGA 4XDCA 2XMWA 4X4UA 2FHJD 4DV7F 4TY9A 4B9VA 2C2DA 4ZIWA 4CLTA 3I0RA 1XNRF 1JLGA 1NK7A 4GKJJ 2Q1LA 4DCPB 1F60B 5KG7A 1YGYA 4ZVQB 2XZDB 5KFZA 2E29A 3BPSP 1XMQJ 5KFGA 4IG0B 5KFRA 1JX4A 1XERA 2DNKA 5HQMA 2RQKA 2Q66A 5AXKA 2EFNA 2BJEA 4LF6J 2CQCA 1WSRA 4HDGA 1L3SA 3D1QA 4NLTA 2AU0A 4WE1B 1SIZA 4FZVA 3X3UA 3CJ0A 3UDLA 3PYGA 1O51A 2ZD1B 1AFIA 4IKAA 4PG5A 1MN7A 3K17A 4MFBA 2OPRA 1WNEA 1T9XA 1LWEB 1B99A 4CYUA 1DTTB 5KFOA 2QE5A 2RF2B 2NXEA 4KKOB 4M5DA 4ED0A 3B4MA 5IC4B 1NJXA 3AJ2A 3HHKA 2DGTA 4YY3F 3CCLS 4NLXA 3D3CJ 4OYWA 1KD1T 3D3BJ 1JQGA 4WBFA 3KJVB 4JI0J 4UY8T 1F5AA 4ICLB 1I51B 3I4PA 1NK6A 4Q2LA 3TWZA 4FF1A 3DDNA 2Y1JA 3Q23A 4C0HA 3IN5A 2RQCA 2Q43A 2GGPB 2HHPA 4PABA 1FHTA 2AWZA 4IFVA 4RU9A 3RBEA 4ZVHA 4DS4A 3PRDA 5E3QA 1GMVA 1FJ7A 1HW8A 1DZ5A 5LMUF 2Y8WA 2DYAA 4A8KA 1VQPS 2Z30B 4NZ6A 4HI2A 3OL9A 4FVCA 4ZLPA 3FSXA 2KH9A 3LP0B 4PYDA 4I2QA 2ACYA 3TYTA 3QWUA 3JAMU 2O1PA 3OUYB 1OY6A 3HLUA 4FXVA 4C4WA 3QT8A 2KFNA 1X5PA 5D3GB 1PAEX 2D3ZA 3NMRA 2YWHA 2W2QP 4OI0A 2YKOA 3O1LA 5EDWA 3MEGB 1KQGB 4IFYB 3MMAA 2K1RA 1Q53A 2DHAA 2A3JA 1VI7A 4DV0F 3MPWA 1XC9A 1VLOA 2RU9A 4RNOA 4C9DA 5DDQC 2ZHAA 2ZJPQ 2I5JB 2CQ0A 3HULA 2WK4A 3VZIA 1GEHA 5LMNF 5AXNA 5D4NA 4E8UA 1IKVA 4B9NA 1N5SA 4X84A 4CO2A 1RLCL 1VQYA 3JQKA 2ZWOA 2PIIA 3H2LA 3BPDA 2HW3A 2CPZA 3DGVA 1X7VA 3SCKE 3GTYX 4UQGA 2N7CA 2N3OA 3U27A 1KOHA 3CD7A 2YNGA 3G87A 2ZM6J 3I9V9 3L7PA 5CCLA 5FIIA 4ZK7M 3M1VB 1WOPA 1W25A 1PJ5A 3DRSA 5DQGA 2KHDA 1QSSA 1U6BA 4DZ6A 1T3NA 5K8OA 3IAM9 1EETB 2X1GA 1IR0A 2KDOA 4DU7A 4F0KA 3CPWR 4MT1A 2QIFA 1F3VA 5AXMA 5KFFA 2HYIB 2KO1A 3ZTPA 3GJRB 4ZDNA 2JSXA 4ELVA 4B9UA 4QR1A 4DFMA 5CZVA 4XAKA 1JJHA 5CYMA 4DR6J 1VJWA 1G7CB 4WFXA 3M8WA 3LP2B 5KG4A 3QATA 3SQGB 1VC0A 1RHMB 2HVZA 4ZHRA 1RT3A 2DNQA 2YNFA 3DYAB 1FXDA 3L7UA 2WVBA 2W7AA 1T9YA 2BYCA 4MKAA 3MPVA 2RHQB 1FK9A 1JK9B 3IWNC 3B4DA 4DSLA 3HVRA 2B4OA 3SCJE 3FRZA 3CUNA 1OS5A 3V81B 4F26A 1SIWB 2Z2LA 2RE1A 3UI3A 1KC8T 3ITHB 3AD9C 3KHRA 4O3PA 2HZVA 1AUDA 2C2EA 1YJWS 3DHXA 3MCOA 1K47A 3RYLA 3H40A 1R0BG 4FDFA 2JC1A 3HI9A 4WIQA 1EIYB 2XWXA 5E33A 2FVQA 2EPIA 3OTCA 1FRKA 5F8HA 3M05A 3CMAS 4UZBA 2IRXA 1RT2A 2J7WA 2F4VJ 3ISNC 4ERDA 1RABB 5KFHA 2CPJA 5C2CA 2FTRA 4TQRA 4DUYJ 2QN6B 3HO1A 2MZ1A 1DFDA 2GHWA 1HQEB 1ZBTA 2MQLA 1U4BA 2DT9A 4J9MA 2KXHA 2QLWA 3Q2TC 2IJNA 4CI0B 3POTB 5A6PA 5LT5A 3RRHA 4MTPA 1C1BB 1YJRA 3K89A 2Z2ZA 3PYEA 2UXBF 2XMUA 1PJ6A 2YWEA 1SH0A 1J5OA 1OWXA 1FRMA 5J2QA 3LWLA 2VA2A 4WP8A 5H1SV 2V2ZA 1KBRA 1ZTTA 1NSPA 4LRAA 2IJRA 2IAJA 4A8SA 4M5MA 2VIHA 4DR3F 4DFKA 5EX0A 2EC2A 2CPYA 1FERA 1XMOF 2CQ2A 2DGOA 4U6PA 2R7VA 1VQ4S 1ZM3A 3SIPB 2P9GA 1T9VA 2NUUG 4LF7F 2W9BB 1LEOA 1BQMB 1HBNA 3CF5Q 4F2RA 1P1LA 2M52A 1NDCA 5KT5A 3KLEB 3CO9A 1T0TV 3NS7B 3SSQA 4C97A 2FY1A 4XK8C 3ZNUA 1V5VA 3LALA 2VBWA 2DHSA 2ZH2A 3HHDA 2ZVIA 4OLOA 4TYAA 2U2FA 1APSA 3QGIA 4LVNP 3NBPA 2W4CA 1G2EA 1R8HA 1MNEA 4ZPAA 4DPTA 1BMQB 1HI0P 2AT1B 3U1MA 4ECUA 2ILZA 1I94F 4DR7J 5D77A 2MZQA 1S1XA 1N0VC 2XB2D 4CIOA 5DETA 1FX2A 1ICEB 3RRKA 2BQUA 2C28A 4I67A 3FBEA 2GMJA 3MUMP 2O5DA 5A6WA 2LXUA 2M8HA 4QWAA 3RB3A 3MR7A 4YP3A 1FNXH 4P73A 3BDPA 2IM2A 2UP1A 2X1BA 1HR0F 3SFUA 1FCAA 2ZH4A 1TFWA 1Y9OA 3I55S 1WC3A 2LEPA 3CCTA 4I0WA 5CHCB 1TV6A 3P5BP 2IM3A 4IO1A 3LA0A 2IFXA 1VQLS 4L3NA 3C6UA 4EK2A 3Q8RB 4V1Ak 2C3OA 2XY6A 2VQEJ 2VJVA 3VGTA 3CD0A 1B7FA 3G9CA 4NCGB 4LSNA 2CNNB 3DOLA 1N5TA 1O6XA 1A7GE 2CADA 4FXDA 3TI0A 2C2RA 3BN7A 1R8PA 4F4XA 3CJ8A 4AQYJ 4DL0C 1IKXB 3CTRA 5U47A 4X4SA 4U7CA 1H72C 3ZZOA 1U1KA 2CG4A 5GAEU 3TAMA 1CEZA 3MPUB 1WTFA 3BSCA 2MPUA 3EZUA 1S6QA 1S4EA 1UZDA 2LECA 2DGXA 3OJSA 1SL1A 4QIGA 4LF8J 2V2QA 3PKMA 1CJTB 1N56A 4ECSA 3TW0A 3MMCA 2ERRA 1X9WA 1MW7A 5KT2A 2E5JA 2KJWA 1S7HA 1UPMB 3HJFA 9ATCB 3K58A 3IG1B 3PX4A 2LQBA 3QLHB 2VC0A 4PAAA 2XLIA 1YJ7A 2GJFA 2DHGA 2V0NA 5F8MA 3KTQA 3QFHA 2VC1A 4RUAA 5E2QA 2NXCA 5IWAJ 4JI3J 4O44B 3IBCB 1PSDA 4TVAB 2WOMA 1OPIA 1U1NA 3IP0A 4PQUB 4OHWA 4OX9J 1ZH5A 5A0YA 3WC0A 2QZ8A 5IT9U 1VHIA 1PBUA 3OLAA 5DGAA 4P7TA 1NZ8A 1JKHB 1IJFB 1UETA 4B3RJ 4Y2CA 4DI6A 5GAGU 2QLXA 4ETZA 3QGPA 4DL6A 4ZVFA 5IOLA 2QO3A 1S0MA 3FZ2A 3DXBA 1HD0A 3I4HX 1RUSA 1TL3B 4AXJA 5FDLB 3NNCA 4K4XA 2IM0A 1UA0A 4B3OA 1VQNS 1FKOB 1FRJA 1BQNB 3IFEA 3FEXB 3HFVA 5ETKA 2EC0A 1T94A 5D0GA 4DX5A 3R2DJ 5GADU 1OJ4A 3VV2B 3GV8B 1ZAWA 1HBOA 1T9TA 4ZCIA 3TQEA 1RHKB 2JZ5A 2PC6A 3GCWP 1CS4B 2Q3PA 1WC4A 4OJ3A 2DD8S 3O44A 2DGVA 1Q5VA 2VG5A 5HQLA 3OT9A 4DV3J 1E6VB 4BWJA 2DXEA 2W7OA 4KGXB 2FJDB 4L75A 2MQQA 1WOOA 2RQ4A 4ZS6A 2MLZA 2HS3A 1SKSA 3JB9k 2CPHA 1MN9A 3QJJA 4RW7B 2LEBA 1WI6A 3JQMA 2YWWA 4ER8A 4UQTA 1I5OB 5IZHA 2DHXA 4KJIA 1X31C 3SSRA 3TAQA 4UOFA 3M32A 2YKPA 4NMXA 5C7PA 3VAHA 1FVQA 4P52A 2RRBA 2AYGA 3H90A 1Z1ZA 3ICLA 1OQ6A 4ELTA 4ZITA 3M2VA 2C3MA 2HGMA 4NEYA 5CABA 2IMWP 1WHYA 1H2VZ 2MGZA 3KLFB 5CQGA 4UUXA 2GVZB 1NCLA 4ZLLA 1DQ9A 3EDRB 2P9EA 3D4JA 1NH7A 3C15A 2F7VA 2Q6CA 4NZ7A 1AROP 2EWHA 3ZC4A 2XM3A 4OZ0A 1S6UA 3FBCA 3S7RA 1EP4A 5DDRC 4IRKA 5CYQB 3S6EA 1RT7B 2BJ1A 1D8ZA 1D3WA 3DM2A 1RWNB 3MPYA 4JI4F 2L48A 4DWIA 4N5SA 3RZAA 3CJRA 2LDYA 4NLRA 1DLOB 2E5GA 1TK5A 4LF5F 2W2NP 3IBWA 3T1YF 3KHLA 2Z2MA 3DXSX 3R5BA 4UOHA 3TEHB 2WVEA 4LVOP 3THPA 5HP1B 5KFIA 4OI3A 3JSMB 2QSWA 2N7YA 3M8ZA 4CQ1A 4QPXA 3PIOQ 2DK2A 2QT7A 2XY5A 4U67Q 4C3LA 4Q43A 3EXYA 4DX8H 4C6AA 4TY8B 3LTOA 2UUAF 1HPZA 1N54B 1KKHA 4DR2J 2EFQA 4D3GA 1R0AA 2VDIA 4RX6A 3H42A 1XMBA 4KO0A 2ATLA 4G3IA 4V19X 1Q5YA 1Q8LA 3LO3A 1HNXF 4BBYA 4USKA 1N34F 4ZCLA 4OZ5A 4NXMJ 4HR2A 4QR0A 1J5EF 1VQ7S 3DDKA 1Q0NA 4C8ZA 4J7CA 1R8BA 2HFOA 4QQBA 5HROA 2BABA 3AB2B 4WKRA 4H4MA 3PNIA 3HSJA 4WCEQ 2HHHJ 2G2ZA 1U1LA 3R5CA 2BVZA 3CCQS 1BGXT 4ITSA 4QIVA 1HMVA 4MIWA 1U0HB 1PG5B 3DMJB 3CCJS 1HQUA 1JWWA 2VFSA 2MY7A 1N88A 4G65A 2HNZB 1JNZB 1N6QB 2RH3A 2R4FA 3FFIB 4RJVA 3EGNA 1RISA 3KWMA 2XZTB 4KAIA 1BC6A 3BH7B 3UDCA 2V34A 1SQGA 4PXDA 1U25A 3HSDA 1H3DA 1XN9A 2HQGA 4QWCA 1MG7A 1DTQA 2CJBA 4M5IA 3AXKA 1Z2ZA 1RHRB 2NXJA 3ZO7A 1PYTA 3KHGA 4NWBA 2QA4S 2B6AA 1C1CA 3RJMB 4RU2A 2J9DA 2LLZA 2MLYA 3Q0AA 3S01A 1KQSR 2ZDPA 2FIUA 4K59A 1JLBA 3BR9A 1VBZA 5HVFA 1RWMB 2R7WA 2GJ2A 4GVBB 3WZ0A 3PJWA 2LMIA 2G1HA 5ADZA 1U0SA 3QFWA 3HSZA 1WF1A 1OY9A 5F8GA 1KQKA 2R9LA 1R8CA 2GIRA 2DHHA 4Q8FA 1IN0A 1F3FA 1AYEA 4A4JA 3QWPA 4R8UA 2ZH3A 4ZCKA 4IOCQ 4JUZA 1IQTA 1M5OC 1JMTA 4X64F 1RAOA 1P9QC 1H2TZ 2JRSA 4DZDA 5A8WB 3HJVA 2XI2A 4RW6B 2MQMA 5KFWA 3DLGA 3BS9A 3LP1A 2IJFA 4HDHA 1RT5A 1TKZA 4M63A 4QW8A 4DX6A 3GYNA 5L9NA 1KLMB 2Y8YA 1FJGF 2HIYA 3O6QA 1FDDA 2KTQA 4WFNQ 3AOCA 1N5YA 1MU2B 3R6LB 4EWTA 3RRGA 3T19A 3PACA 1EHWA 5L1KA 4NLSA 3BF4A 2ZFHA 3RG6A 3G6XA 4OYXA 2X1AA 2OFGX 3SCLE 2FLLA 3TJ9A 3GYGA 3DLLQ 4QIFA 3O5TB 2LCWA 2YKMB 4LFBF 2OPPA 2WB1D 3SBMA 2IMOA 2H4YB 2YH0A 1TFYA 4LREA 1IBMF 4DR5F 4F25A 4J9SA 2APOA 2LVWA 4L72B 3UD5A 4C48A 2XMTA 3D9BA 2JLFA 4B02A 4N47A 3ZTQA 3CVKA 4PEOA 3PM9A 2MQOA 3P5TL 3OJUA 1Z4UA 1T95A 4WK3A 1K9MT 1U1MA 3G4SS 4AD6A 1NK8A 3MI7X 3U1NA 3CC2S 5AXLA 5HK4A 2KKHA 6FDRA 3MEEB 1TMMA 4F67A 4X4RA 2VG6A 4ZVSB 1LV5A 1KQFB 1S9EA 3KLIB 3PW5A 5KT4A 3F73A 1HBMA 2ZHBA 4DV6F 2ASJA 1R31A 1UEUA 4WU2A 1ZZNA 4UY85 3MEDA 2RD5C 4NLDA 3I56S 3W61A 1VBKA 2AHOB 2IA0A 1VQ8S 1RT1A 1U7LA 4FP9A 1OMSA 2MEWA 1V9OA 3KG1A 4DSJA 3WIUA 4K7QA 1UTAA 1F5BA 2WRMA 4JP8A 1K0TA 4NA3A 3AB4B 5DG9A 1JB0C 3SCIE 4N41A 4EEYA 2VJUA 3MUVP 1G6BA 2IA6A 2B3TB 2YNIA 4FS2A 1WKJA 4NOHA 1QAIA 3QAUA 3D6TB 2WBRA 5EHHA 2G1DA 2P2CB 1WUUA 4MK9A 2NXUA 1FXRA 1RB0A 1VBXA 2ZH1A 2J5AA 3DI6B 1AZSB 1QY7A 2Z58B 1FT8A 1UVMA 4EBEA 2XNRA 3RU0A 3R5JB 5L8RC 1RU1A 2ZBRA 1SC3B 2M70A 2DVIA 3KOAA 2IDEA 5GAEI 1I3OB 3UNYA 3ZZ0A 5HL7Q 1TVRA 3D0GE 1KN6A 4U96A 1YK9A 4EO8A 3KYLA 2L9DA 5DZ7A 1WHWA 1NHUA 2E1RA 2HNYB 2RDIA 5IM0B 2I2YA 2B8QA 4HT5A 4F4WA 2GS8A 1SJQA 3QNWB 4QW9A 3JTOA 1TL1A 2BW7A 1WKKA 4TLQA 3OTEA 4F0HA 3T1HJ 4FYVB 5AE3A 4B9LA 2YWFA 2VD3A 2V50A 1GMWA 1RE1B 1FF2A 2H5IB 2BM0A 4DF4A 4PCQA 2LXFA 5J1EA 3B8HA 1GAOA 2MSTA 2PFDA 4LRCA 4DR1F 2POKA 1HA1A 5HATA 2DNLA 1C0TA 3CJKB 3W8PA 2W2MP 4MKVA 3CT9A 5HQ8A 2JLGA 4BWMA 1NK4A 5ETTA 3FCVA 5FLXU 4OHZA 4EO6A 1FWPA 3CDAA 1VRTA 3CJ3A 1TQLA 1MMNA 3QQCD 3G82B 3OL6A 4ED7A 5C42A 3JSRA 4KTQA 5A8KB 1TTHB 4P72A 4NLGA 4ZP6A 1U8SA 4HEA9 1NDLA 2LA6A 2VG7B 1IBLF 3MM5A 2QLBB 2E1PA 1JJ4A 2YKAA 1SJFA 4U8YA 1CJVA 3UCGA 2KFZA 1FEHA 5GADI 3ILIA 3L95X 4FKYA 1EB0A 1VRUB 4YHHF 4X62F 4YDXA 3QRPA 4HHHA 1VK3A 4GKKJ 4C8LA 3R5GA 2IYGA 1SBRA 4TYBA 2L41A 1HFEL 4YUDA 3MECB 3BSAA 2WVFA 2J9EA 4AE5A 2ASYA 4DBQA 4QWBA 3RW6A 1NJZA 4M8LA 2WB4A 4ZOSA 1REGX 1R8AA 4W98A 3ISZA 1RADB 4HACA 5T7LA 4RNHA 1XR5A 3TA2A 2DTJA 2GAGC 1UEVA 4PYAA 3UCZP 1BWVA 3OXGA 1P27B 1D0EA 5D15A 5LXRA 1JIHA 2VQFJ 3FZBA 3BR8A 2EK1A 2UXCJ 2J6UA 1MWYA 4TXSA 3AJDA 3I31A 1RWOB 3OFFA 5HBMB 2CYYA 2YX4A 2RT3A 5HVHA 4AL5A 1HNWJ 1FA0A 3CJ2A 2AX1A 2HIQA 4NEZA 3G6ES 4LFCJ 3QO9B 1HI8A 3D1HA 1FI4A 1T03A 2VL1A 4KGKA 4OJGA 4FYWB 3HVTB 5KAKA 4RW8B 1RCXB 2V2KA 3W2WA 4DFJA 1P6TA 1EQ0A 4DEZA 1W7WA 2XMMA 1VYAA 1S48A 2V4JB 3CDWA 3SYZA 1XIQA 3AQOA 2ROEA 3MR5A 1GTHA 1S59A 3MOZA 3KK3B 5EWFA 3QT6A 2W8KA 8AT1B 1YTYA 2UV8G 4JI8J 2A2CA 3TVYA 4DSIA 4NA2A 1C0UB 2BANA 2GMLA 3UFCX 2V63A 1UEKA 5M2RA 2D3OR 4ZN1A 1M1KT 3VGSA 2HVEA 2ZBCA 3ZZRA 4OYPA 3UQSA 3MWBA 5C25A 3HX9A 3MM9B 4KHMA 4OI1A 3T6JA 3HT3A 2GQCA 2WSFC 4Y0FA 2UU9J 4Z37A 1WC0A 3NGSA 5HVGA 4NXNF 2CQ3A 1F1BB 2JLEA 5BR8J 2XLKA 4WZMA 3MF5A 4KFBB 3VAIA 4B3TF 3FJ2A 3GR1A 4H4OB 1Y5NB 3E01B 2E5LF 4ZJQA 3DLEB 2XNQA 4IO9Q 3BQ2A 4N8NA 3QIDA 4C8MA 2BUNA 1VRQC 3H20A 5I3UB 5LSLA 4EZ6A 4PRFA 1FKPA 4DPYA 1NKBA 4ZCMA 3MMBB 1URRA 4A48A 4Z2XA 3THVA 3KMSA 1S76D 2UXDF 2DNNA 3CD6S 4X66J 4M5KA 3OR2A 1LXJA 5IQQA 4ECVA 3QGHA 2KFYA 3ADAC 3DLKB 5B0AA 3W5XA 3OR1B 5HJXA 4KPCA 1U24A 3A8EA 2BQRA 2FJXA 1M1HA 3NL0A 2BMBA 4YEAA 2V8DA 4JI6J 4IG3A 5JMNA 1CC7A 1WDDA 2FVSA 2LQ9A 1RSCA 3IMQJ 4GO7X 1GFWB 4RBTA 1E6YB 1AXQA 2R42A 2ASLA 3KLGB 2R7TA 3Q8VA 3CXCR 5C5JA 4P74A 1V3SA 3KLHB 2BKNA 4B3SJ 4C11B 3DOMA 5KG0A 3MAHA 3KK2B 3D0IE 5KFDA 1H7XA 2GIFA 1JLAB 1NPPA 4ED1A 3SXLA 5KFKA 5HMYA 4GO5X 4LFBJ 2M4MA 1A6LA 1HWJA 1IM6A 2QLJB 3KLVA 1GNKA 3T6BA 2BOAA 1X4BA 2FZCB 4PKDB 2XY7A 3SDEB 3T5LA 4J9QA 1XNQJ 2PI4A 1TKTB 4DV4F 4KB7A 2ABYA 3CJ4A 1X5SA 3NY0A 4TU7A 4TU9A 4F3QA 3OTOF 4BLGA 3H0PA 3HHEA 4EU0A 1CLFA 4R25A 1WACA 2BW2A 4RWWA 3PW2A 1SJ4P 2FLNA 2D74B 2KXFA 1H7WA 4DSEA 1FDAA 3M2RA 4BCAA 3WIVA 3UR0A 2HLUA 2BE9B 4N56A 4HI1A 2DPIA 1HNIB 3WQPA 1Q4RA 1DQ8A 1VC5A 3GYXB 2C42A 4Q0BB 4OZ2A 3TARA 1H2UX 5B7WA 1OY8A 2M88A 5ITHA 4K2XA 3LF0A 2D41A 1ZAVA 3I5CA 5EGYA 2AEFA 3D28A 2XMKA 3DHWC 3AJ1A 4LFAJ 2P8IA 4W92B 3MM6B 1YRTA 2B7BB 2VFVA 1RBLA 2OPSB 4UW2A 4HL9A 5L1JA 1OPZA 1ZTWA 2CJKA 3OXLA 4PUOA 2MJUA 3DOKB 2OUGA 1Y3JA 2GAHC 1QVGR 3EUNA 3M8PA 4K5RA 2ZE2B 4KT0C 1P9YA 1FFSB 2FLPA 1SV5A 1WC1A 3C46A 4Z7YA 4O0IA 3PW7A 2LEAA 1S1WA 4G1QA 1RU2A 3UVJA 3N0VA 1LK7A 3GLJA 3DRRB 1LW2B 3V2UC 3EGWB 2R2TA 2XTJP 2IVYA 4NYOA 4HVZA 1YZ7A 2FJBB 3Q22A 4DLEA 3HHLA 5K14B 1HYSA 2NS1B 1FD2A 4O4GB 1RKIA 2VFUA 1D8YA 1SH2A 1MMDA 4OYOA 4JV1A 4YR2A 3J81j 3B82A 2P9CA 2OIHA 1YVFA 4Y2AA 2ZWPA 5G0RB 1IM4A 2MZTA 1RP5A 4USUA 3TVZA 2ZITA 2R2SA 2UVRA 4CLSA 4QYZJ 1U09A 1S9GB 2ZJQQ 1IKWA 1RWVB 3M2UA 2ZKTA 3AODA 1F9FA 1Q78A 1SC6A 5C24B 3P49B 4B3MF 2KT5A 2N3LA 1S12A 2XC9A 5IV3A 1S6PA 4Y2KA 1CJUB 4PZVA 4K0KF 4MMOA 4LSLA 1FVSA 4RLEA 2VU5A 4X4PA 1U26A 2XSJB 2GVDA 3KK1A 3NWRA 4JBCA 5KFTA 1HHTP 2Z2YB 3GILA 1NDPA 4HKQA 5ETOA 1Q95G 2E7XA 2YKNA 3TZZA 1UL3A 3J7ZT 4JI7J 1DARA 1JLCA 3R6GB 4DF8A 1X5OA 2J76E 4C3MA 3QZ7A 3GCXP 2EBGA 2VDHA 3I0RB 2RNEA 1JLGB 1FXLA 3D2WA 1WTBA 5KOXA 3R27A 4YR3A 4CLZA 1RTJA 2XS7A 2HFVA 5D0EA 1ZAXA 4AL6A 1X9SA 2DNPA 2XULA 1OQ3A 2VODA 1K0VA 2R2RA 1EJ7L 3M9MB 1QAXA 4MYUA 3K7RA 2ZEJA 4J9OA 2LKZA 4G1IA 4NRUA 3P8BB 3CIMA 3IC1A 2CIMA 1X5TA 4ZVUB 1YJTA 1WF0A 3TP2A 1RI7A 4WP9A 2KRBA 4QIEA 3R3TA 4ES3A 4K8RA 1LKZA 1RTIA 4IDKA 4K4UA 1YJ9S 1ZS6A 5I3PA 4MFBB 4JYAF 2D9OA 2OO4A 2VOOA 1CJKA 2OPRB 5B09A 4Y2MA 1SUQA 2W2OP 4LSZB 3VCDA 2QEXS 2E5HA 4CYUB 2EKYA 4DXLA 2AZ3A 4JI1F 2H48B 4M5DB 1XWLA 2HS0A 1SJ3P 2C1EB 5KG2A 3C8YA 2ZBPA 1DBDA 2B9YA 2XGPA 2HHXA 2FVPA 1VK8A 2QJ3A 2LXIA 5EUHA 3TANA 3C6TA 1UJ4A 1UFLA 3C2PA 2CQBA 1X4GA 4BDPA 3KNGA 4ED2A 1PAUB 4QIWD 2R7QA 2CJXB 2CQIA 3I87A 1UVKA 1NHKL 4IFVB 4HTIA 2A6OA 3GR0A 1SJ1A 2KYXA 3KG0A 5HMZA 1Y00A 3FSYA 3OHBA 3ETMA 1BD6A 3IA0A 3MAQA 3CCSS 4ZLJA 4Y65A 2L9WA 3HSGA 3BN4A 2PMHA 1HL6A 4I2QB 5HO4A 2U1AA 2XYHB 4F4YA 1DAXA 1KOOA 1WHVA 1YDLA 2OFHX 4U7UK 2DRAA 4R0EA 2BE2A 1M5VC 3T9NA 1SKWA 2Z57B 3IR6B 3A3OB 5L1IA 5ETSA 2J0WA 3MMAB 2K1RB 4QWDA 1WORA 5LM7E 5L1LA 3MZIA 2RILA 5DQHA 3JS9A 4WKYA 3QIPA 2EFOA 3CDUA 7AT1B 3L09A 2HGNA 3GJSB 4DL2A 1MROA 1YSJA 2KL8A 3EXCX 2N82B 5HLFA 1A9NB 2ILYA 2F8MA 1S4FA 3D66A 4CH0S 1S1TA 1EKRA 1IKVB 3N79A 3B78A 3KNAA 1M0SA 2HVDA 2OAUA 3CC7S 1AFJA 3ZTOA 1GK8A 2LU2A 1RTZA 1IJEB 2HRYA 2YNGB 4DG1A 3CNQP 1R3NA 2AGQA 3TEGA 4IR9A 1NDKA 1XEZA 2F63A 2WBMA 3MTKA 2QTWA 4RO0A 3DRYA 3DRSB 3GQCA 3TOQA 3BGFA 4TNOA 5J2PA 2YXLA 2XG8A 3W1YC 2FGOA 1U2FA 3R5AA 2KZMA 4UOCA 3CCZA 4B9SA 2OEJA 1CSJA 4DSFA 4CCHA 2F9JA 4OZ1A 2HURA 1ACMB 2DNZA 4KSEB 3BDEA 1YHQS 2GZOA 1CQNA 2CNKB 4EFAC 4ZVEA 2PDAA 3QRRA 1ROFA 3MXHP 4OYIA 2IC3A 2VICA 4GC6A 3KG4A 2IRUA 1TKXA 5CYMB 2NXNA 4UOGA 1L3UA 2AD9A 4DQPA 2HMIA 3TAPA 4ZHRB 1RT3B 3SEOA 4DR4F 2YNFB 2HHUA 5A2QY 5D0RA 4ZA1A 4JI5F 2J7KA 2JX2A 1FK9B 2R2UA 1DQAA 4WXOA 3NGDA 2E1MC 1JXVA 3W2VA 3CMES 2DY9A 2B7CB 2FHOB 2PMWA 3HVWA 3W7BA 5F9NA 3VHQA 4DSKA 1V3ZA 2MKCA 3PW0A 1N33F 1N4LA 3NAHA 1WEYA 4CO4A 2C3YA 2YBVA 4ATNA 4KV8A 1IBKF 2OJ3A 2WONA 2DB1A 1TL5A 2RS8A 3HFZB 2XS5A 3FKBA 1S99A 2B9WA 2CQHA 1ELOA 1CPZA 3G71S 4A8MP 4M5JA 1V6HA 3GMGA 4CLFA 3HXMA 2EFPA 1RT2B 1LK5A 5KT6A 3NOCA 1MMLA 3W63A 3QT5A 3LGMA 3V6DA 1CQMA 2DGSA 3IWLA 3BH6B 5DQIA 2GHPA 5F8LA 1WI8A 3R7BB 3R7NB 2ADCA 4H4KC 4LIWA 3KJQB 2XMJA 1QE1A 2DY1A 2Q79A 2VKZG 3J7YI 2ZNZA 3ZNJ1 1N36J 3PZPA 4LQ3A 4HHUA 4JV5F 3MCSA 1J5OB 2ZH5A 2BEFA 5J2QB 3H7HB 3M30A 5J1NA 4OZLA 2A0FB 3M8QA 3N6NA 3G96A 2A2DA 4Y00A 1UFWA 1GXUA 2IAJB 3VAFA 1JXLA 3CC4S 2HQFA 1FWKA 5K8PA 4GVLA 1SL0A 2H5EA 4F3OA 2UUCJ 4AYBD 2PA8D 1GMUA 3FC9A 4CNYA 1Q8BA 2C2KB 5KFCA 1VQSA 2XCPA 1HBNB 4WFYA 4OV1A 1T3OA 2AJ4A 1JLQA 4WFAQ 1SL2A 3AA9A 1B0PA 1D9FA 3HFKA 4URGA 2NPFA 1RTHA 4JI2J 4F8RA 5LL6d 4DUZJ 5BYRA 1PYOB 2WAQD 4CM2A 2CQPA 3PXGa 3HKZD 3PVXA 4PR6A 2E44A 4PWDA 1Q86T 4B9MA 3CB4A 3VVUA 2GC8A 1KHWA 1HNZF 1T05A 3MM7A 2GO8A 1M1GA 5DZ6A 5GMEA 2W8LA 2MMYA 1FJCA 3FBFA 3SSSA 3NNAA 3NBPB 4USIA 4CLPA 1RAJA 3BKFA 1UWBA 1VDHA 3TX8A 1S1VA 2JEFA 2HNDA 3D7SB 4EYIB 3CCWA 4DV1F 2LQJA 2UZAA 1FJEB 4EUVA 4AT1B 4USTA 3H5YA 3PR4A 2R8GA 1S1XB 5DS7A 2AP6A 3VZHA 5LXYA 2BBEA 5DO2A 4EI2A 3BZQA 1OSCA 1M5SA 1JLFA 2X7IA 4NLQA 4DV2F 2DH8A 2M7SA 3OFGA 1WDTA 2C2OB 3W9HA 1X4AA 3HPOA 1L3KA 4J91A 5IT0A 2HWTA 3BGLA 4OX6A 2YWGA 4Y6IA 3GJTB 4J5OA 4ECRA 1PJ7A 3NGKA 1Y5LB 2GCFA 3N5FA 3PR5B 3VAGA 3I0SA 5J2MA 4MAKA 1TV6B 1SQFA 2HBRB 2E9RX 2QMWA 4PWWA 1N5VA 2E7WA 3TA1A 4RW9A 2KHCA 4KHPJ 3C6UB 3DRPA 3MUTP 1QJHA 5AT1B 5H9FJ 4HTJA 2UVWA 5KFBA 3UDVA 3G8QA 1FRXA 1KSPA 2K2PA 1REVA 4LSNB 1TL7A 3DOLB 1A0OB 3N9UC 4L73A 4CH7A 4ZVTB 2JVOA 1IKYA 3D0HE 2RSQA 1ZPVA 2RKIA 5FD1A 2B9XA 3N4WA 2K3KA 4GKJF 3ZTRA 3OD2A 2RB7A 2CQ1A 4XDDA 4DQRA 4DL3A 3NMAA 3TAMB 4ANEA 2J8SA 2B5JA 2HHQA 1XMQF 1S6QB 4XTTA 1N32J 1NK9A 3SMZA 2CJQA 3BB5A 2HS4A 3TA0A 2QA2A 4DV5J 2LFVA 3MMCB 2EG1A 3QRQA 4DQQA 2BXJA 5JJBA 4LF6F 1FTCA 5E3AA 3IXQA 3IAS9 2F8HA 2CZVC 3MM8A 2HZAA 1RAFB 4LRBA 1FWLA 5KFMA 3GIMA 1RT6A 1U1QA 2V4QA 5B0GA 2ZOMA 2OI2A 2WOMB 1IWAA 3FQKA 1YIJS 3KXDA 3G6VA 3C14A 1RHJB 3ZZTA 3QBCA 5DLGA 2FGCA 3CCVS 3DGPA 3OVAA 1VC6A 2RDDA 5A0YB 2DO0A 4JI0F 2R8KA 2CJYB 4YB6A 5KFLA 1XJWB 5JVHQ 5ETVA 4DL7A 1S10A 1PGZA 2CKWA 2OEMA 3V6KA 3D54A 3D67A 3DLBA 4LMZA 3S1TA 2WTFA 4NCBA 1T02A 3QYYA 2E9ZA 5KG1A 1TAUA 1QD1A 3UCUP 3AAWB 4NPOA 3JSBA 3NWGA 1QLNA 3CULA 4B3OB 3QGGA 2WSCC 4XIUA 4CT9A 5KFNA 1VQMS 2AV5A 3OSPA 3WC2A 3P3DA 4OHXA 4FF4A 4K4WA 3T5JA 4QBUA 4KHRA 1HBOB 3E2EA 2MLXA 4J9NA 5E5NA 5T41A 4EGLA 4YN3B 5IFMA 5BXIA 2DH7A 2HRUA 3HM9A 2J6TA 5LJ5Y 3E3XA 3IRXA 3OVSA 4V19J 4ANDA 2CUYA 2K3IA 2H4WB 3NLCA 2VG5B 4LF4J 4ALZA 1OYDA 2MKYA 2CQDA 2Z8QA 1Q8IA 2ZBQA 2D69A 2G2OA 3GB0A 1SKUB 1B0VA 4RBVA 4FN5A 5D8HB 3BSNA 2ZUAA 3EPIA 5F41A 2CJ9A 2KVIA 3EDQB 3RW7A 2JFDA 3PEJA 4I7FA 3BGRA 1RHUB 1NPKA 1RTDA 1O5JA 3UO0A 1NMEB 4ECQA 3M32B 2QA1A 3OFHA 3BO3A 4JV0A 4B17A 2VV5A 2V69A 3UWTA 3EICA 3NCRA 2OD4A 1FNMA 2KT2A 3M2VB 4X65J 2RIJA 2ZM6F 3PX0A 2CWXA 1W26A 4RBUA 3GG0A 2MGZB 4OJ1A 2UUBJ 4RW4A 1F0XA 3BKTA 3AT1B 5HJYA 3RBDA 5ETMA 3H2UB 4YDDB 4A8FA 1BXNA 2RAQA 4KGVB 3ZXWA 2C2MB 3C15B 5KG6A 4LIRA 4I2PA 2DRDA 1GH8A 2Y1RI 3NCPA 2W9CA 1DY3A 4TU8A 1K44A 3G8SA 4DV7J 3JYTA 3Q24A 1VQ5S 4OV6A 2E5IA 3MAAA 4FF3A 4I69A 1EP4B 1X9MA 3HD1A 1HD1A 2OPQA 2MQ8A 2MKKA 1XNRJ 3UW1A 3TJ8A 3DN9A 3D1OA 5I3QA 3IS9A 2HPUA 3DM2B 1RAIB 1G1XA 2CVIA 2B56A 3TUJC 5KFVA 4QZVB 2MQPA 2C3UA 4DR6F 1RZMA 3NXZA 1UCNA 2YNHA 1RQ0A 1FD8A 3ONQA 2VF3A 4ZVGA 5GAHU 1C4AA 3X1LB 4N76A 4EBCA 3PDNA 2NYHA 9RUBA 2OMOA 5D4PA 1HWIA 3RBXA 4FNHA 4X4NA 3M6UA 3WX8A 2ZZTA 1YZ6A 2HKEA 3PO5A 2R8IA 4ED5A 2BE7D 2YY3A 3FK4A 1HPZB 3LH2S 5D4OA 4PXCA 2V8HA 4Q7AA 1R0AB 5A8RA 4KO0B 5DDPC 4X4QA 2YTCA 2I1RA 3D6MB 4YY3J 1GXLA 2AGOA 2ASDA 3AFGA 2ACMA 1VQ9S 5J2NA 2LA4A 2KG1A 5HROB 4RUCA 3GV5B 4LF9F 1AW0A 3I82A 2W01A 4X4OA 2JL9A 4H4MB 4ZP8A 2F4VF 3BGOP 3M9NB 1Q7YT 1SKRA 4Q44A 3H5UA 1X4FA 1HMVB 4DUYF 5M2UA 3JAMY 1RKJA 2ZNYA 1HQUB 5I42A 1H98A 1WG5A 1GX5A 5LMUJ 1KVJA 5CD4H 3AH6A 1L3VA 3KDNA 3FEZA 2F40A 3GSIA 2HFZA 4C2MA 1HNVA 5BJRA 4EYHB 3ENQA 4DOZA 3F44A 3FVYA 3L4BC 3MPDA 3NP5A 2PMZD 1FFWB 2LYVA 2R8JA 4EBDA 1WSVA 2K06A 2F65A 1QTNB 2HEKA 5K9FA 2DR7A 4ANCA 1I6JA 1DTQB 1AB8A 2NQPA 1UPPA 2EK6A 1SI9A 2KG0A 1KTVA 3I96A 2B6AB 4DV0J 4HH0A 3V4IA 1C1CB 1T8EA 3VWSA 2R7UA 2CZ4A 1JLBB 3R2CJ 1S6OA 2FHJA 2HFUA 3J7AN 2V67A 4OYMA 4WTOB 4KBIA 1VBYA 5LMNJ 3RAMA 3ULHA 3ZFVA 3RR7A 3LAMA 1YJNS 4J9UE 2K8GA 3MR3A 3RBZA 1W2BR 4IQXA 1S1UA 1YI2S 1YJUA 4A47A 3BQ0A 2V94A 4ED4A 2DIVA 1Y4ZB 3DLJA 1LW0A 1VR6A 4R8UB 2BACA 4OHVA 2NR0A 4C8KA 3R1LA 2QV6A 3ET6A 3OXFA 2DRBA 1HBUA 2OELA 3QPIA 2DBBA 3VAJA 2FC8A 4DR7F 1F2HA 4MKBA 4ZPBA 2KM8B 2FD2A 1RYSA 2AQ4A 2B43A 1D9DA 1N0UA 3DLGB 3LP1B 1RT5B 1JLEA 3CWJA 1TKZB 2CZ9A 2QL7B 3LPYA 1KFSA 3TVKA 1H74A 1NJYA 2M8DB 3RB0A 4OX7A 3C16A 2F1FA 4U9RA 4KGMA 4J9VA 4O3NA 4LQ9A 5B0EA 1N5YB 1O0PA 3CW2C 2MYFA 2J9CA 3G2XA 3OSNA 2QSFA 2ZH8A 2V5HG 3BYPA 1HQ2A 5EWGA 3MOJB 3PRVA 4ID5A 3J7Z5 2MQNA 1B0TA 1FRIA 3HZEA 4FS1A 1ZA2B 1UP1A 5ETLA 4PG4A 2W9AA 2F4FA 2DIUA 3R5DA 3CIZA 3Q89A 2HSEB 5RUBA 4ZPCA 2AYEA 4XPCA 2OPPB 4DX7A 4LF1A 4IOBA 3IBFB 1X4DA 3NGRA 4NI2A 1R43A 1S0OA 1T9UA 3N01A 3JTNA 4O3OA 2EFGA 5F0WA 2VQEF 2HQCA 2VHGA 2G0IA 4FBTA 5KFXA 1MLAA 1BE4A 3W9IA 2BR0A 1F2GA 4CP5A 3W60A 3MR6A 4AQYF 3UD4P 1SCJB 5C2GA 3MCMA 3MFHA 2E1AA 3FSIA 2Y1IA 3AD8C 2PFFB 2GV1A 2FDNA 1UVLA 1HHQA 5KFJA 4MIAA 2FLOA 3TQ1A 4P2FA 2CPIA 4DL5A 2V4RA 2MZSA 3K5MA 4XO0A 2VG6B 4NYZA 3OV7A 1RBAA 1S9EB 4CTAA 1R89A 1HBMB 4CLYA 4LF8F 2R7SA 2N4CA 3DC2A 2JNJA 1KLNA 4PWUA 5DJBA 3LAKA 3HVAA 5HSPA 4KH0B 1CULA 4FNIA 2EW9A 3RAXA 4Q2MA 2E7VA 1BY9A 3MEDB 3UPFA 5I4MA 1DHMA 3MFIA 1TELA 3OTDA 5IT4A 3FQLA 2UXBJ 1LWCA 5DRKA 1VJQA 1YWXA 2RVJA 4GRSA 1RT1B 1UVIA 2G2YA 2XO6A 5IWAF 1LWFA 4B9TA 3JTPA 4JI3F 2YPYA 5KFSA 1QUVA 2FC9A 4ZKAA 3SQOP 2OMLA 2AJ1A 1LOUA 3B54A 4OX9F 3U1LA 1TUWA 5CCMA 2RUSA 4F36A 2I8EA 5HANA 2YNIB 2JC0A 4DR3J 4RPFA 1XMOJ 5B0DA 2R7XA 1MWZA 1KS2A 3K8VA 5B0BA 2LQ8A 4LF7J 4B3RF 3J81Y 1QVFR 4C8OA 4RL1A 2GO9A 2HBQB 2X3DA 4S0MA 2ZC4A 1CG2A 1R27B 2D9PA 4K5SA 3R97A 1NKCA 4PXBA 1MSWD 3PX6A 1HWKA 4NMLA 1KEKA 2JEGA 3AHPA 3GP9A 3ENAA 1TVRB 3A8JA 3K5OA 4LR8A 2AGPA 1JJCB 1VHFA 4Y3CA 4QWEA 2XO7A 3LQVA 4R5PA 4CO0A 4F4KA 3TUPA 2GA7A 4KYZA 4CNZA 1TUGB 1TL1B 3KHHA 2QRRA 4XPEA 1I94J 4QU6A 3IRWP 3D6HB 5AE2A 1R0CB 4WFBQ 1S5ZA 5J1PA 2EG2A 3W65A 2E1CA 2CVEA 1RGVA 3GE9A 4DV3F 5J1EB 4K4TA 2CG8A 4DS5A 4KY3A 5D78A 3H5SA 2CA9A 1TZ0A 5KFAA 2VASA 1RT4A 4D3HA 1NUEA 1C0TB 4ECXA 3T41A 2F5GA 4TN2A 4IQMA 1KR4A 2CJAA 3PHTA 1HR0J 1U2RA 3R1HA 2YQ3A 1VRTB 1M90T 5L46A 2ZJRQ 1K1SA 2J0XA 2YVSA 5C42B 3P4UB 2I9SA 5BYSA 3P96A 4QPTA 8RUCA 3WDOA 1L5UA 1QM9A 4USHA 3C66A 1RXOB 1FDNA 1SH3A 4C3KA 3MM5B 1KVKA 4YOEA 3FBBA 1RCOB 4H54A 1CJVB 2V8VA 4DPUA 3T9ZA 4OI4A 3GV7B 1Q7LB 2EVZA 5IV4A 4MK7A 1NHVA 2VPYB 2V8PA 1K1QA 4KH1B 3AY0A 3A12A 2X1FA 3MURP 3T5HA 1YBAA 3VAMA 2FZGB 4DU8A 3MDFA 2OLWA 4AXIA 2O3DA 3VALA 5T14A 2XZWA 5E3CA 2KZZA 4U8VA 3CD5A 3MTJA 4M5NA 3D6FB 4RNFA 3TZWA 2BV3A 4HH1A 4CT8A 4IG0A 2C3PA 2ZOGA 1FE0A 5MAOA 5IXUA 3CCMS 5H9EK 4HACB 5T7LB 2KI2A 1VISA 2OEKA 3PJXA 4UZCA 5GMKa 4WE1A 2UVVA 4OYZA 5F8NA 2ZD1A 3PW4A 2ALZA 3BQ1A 2NPIA 4ED3A 1VQKS 2J7UA 4M1KA 2DGQA 4CDIA 4OZ3A 1LWEA 2HWHA 1F9EB 5IT9Y 1DTTA 2W24A 2RF2A 3L7OA 4DR2F 4P71A 4LF9J 3O2IA 4KKOA 2JWNA 4WZQA 2AJ2A 1YJVA 1T03B 4NXMF 1B64A 3KJVA 4ICLA 4DDFA 3RGIA 3MD1A 4JB8B 2O67A 1NSQA 4HYKA 3W2WB 2GGPA 3T5KA 2HHHF 1RHQB 3IGNA 4X2BA 3RB6A 2XLJA 2VA3A 1S49A 3EM1A 3C3LA 2RU3A 3Q83A 4BC9A 2HZCA 2W4DA 2M2BA 1BHNA 1PIEA 2Y9HA 4F0MA 3DRXA 2IBKA 2BANB 2I6WA 1ITPA 3I32A 2P6TA 1RK8A 2UUTA 4MH8A 3LP0A 2D3O1 3D68A 1S0NA 5GAHI 3H2VE 1OO0B 2QL9B 3DDIA 5C25B 3OUYA 4FYDA 4OX8A 1S79A 2NCKL 1GX6A 5D3GA 4I68A 2CPDA 3OBIA 1HLWA 2Y3YA 3TO8A 4ILMA 2ROGA 1HHSA 3ENVA 1VMBA 3MEGA 2CQGA 3NS5A 4IFYA 4L6V3 1EZZB 4C98A 4U95A 2JH3A 4F4AA 5KG3A 2BKPA 2HBYB 2IM1A 3M6VA 3J81U 2AMCB 4YB5A 2W25A 2AF6A 3H25A 4KPYA 5JUMA 2R3VA 1S57A 2I5JA 4PPZA 1NNDA 1K8AT 1UZHA 1EX8A 4YQWA 4RNMA 4DJBA 1FKPB 4DPOA 4A8OA 2DITA 3I5AA 2IDLA 3BO2A 1IR1A 3OR2B 2AJFE 2RHSB 4F02A 1NAQA 4IOAQ 2CDQA 4OMFG 3M8YA 1ZPWX 4C8YA 2GQQA 2DEJA 1HW9A 5KFQA 3M1VA 1CVJA 4O0NA 4WFZA 2CPXA 4WWSA 2BJDA 2FVCA 4DPWA 2IPOB 4IG3B 1EETA 3A4TA 3AQPA 1T11A 1HWLA 2K7JA 1P8GA 2MKHA 2DNRA 1VOMA 1W2IA 3A3PB 4L74A 3D5MA 3TR5A 3DOMB 1NSAA 2XWYA 4PPDA 2XYGB 4JI4J 3TNVA 1WC5A 5KFPA 2QYGA 4ID8A 2PE8A 2D1CA 1S7IA 4LF5J 3LP2A 3T1YJ 2ADBA 3SQGA 2L9NA 3EPGA 3LPEA 2H54B 3I5BA 2V68A 4O3RA 3PEHA 4TLRA 5D6GA 4J9RA 1U6ZA 3DYAA 3I9ZA 5DM7Q 2RQMA 2HFSA 2L3MA 4NLPA 1IUJA 4AL7A 1U02A 2OH2A 4UUWA 2DH9A 1UWAA 3PV8A 4ES1A 1GMWD 3M2RB 4OLPA 3V81A 1O8BA 1TMJA 2NLWA 1WJ9A 2B4VA 5CD4A 2UUAJ 4KIAA 2W1BA 2P6SA 3ITHA 4IH6A 4M95A 4ZPDA 2ATCB 1HNXJ 1N34J 2EEYA 1J5EJ 4Q5VA 2YQ1A 2O01C 3Q86A 4YR0A 4GC7A 2ZOFA 1FDBA 3V6JA 4WPAA 2FHKA 5GVQA 4M5GA 1F9HA 3GIKA 3TX0A 2OKQA 3AA8A 2MHEA 3W66A 1B70B 2DGWA 1R7IA 4PUOB 1HQEA 2PN6A 3ZZYA 3M8PB 2FY8A 2F8EX 1IBCB 3CCES 3V5RA 3G8TA 4ENOA 1WELA 1Z2LA 3POTA 4KGZB 4CO3A 1BWEA 3WX4A 3M8SA 1C1BA 2BKOA 1SV5B 1NZAA 2MHNA 3SI8A 4LRDA 3RR8A 1UJ6A 2OTLS 4I64A 1S1WB 4G1QB 1RYRA 3UVJB 3Q2SC 2DCUB 2HG4A 1FTRA 4NL5A 1N5QA 1Y0HA 3HHLB 5E3PA 3RUBL 1NO8A 3VQSA 4L3KA 1HYSB 4WJBA 1H38A 2ZH6A 4AFFA 4CLKA 2XMVA 4WK1A 3C19A 3E51A 1SQEA 3MD3A 1OIAA 3OL8A 4EZ9A 3GIRA 2WVDA 4NE9C 2LP4A 2AJ0A 1NXIA 2C2ZB 2W9BA 2B9EA 1Q81T 4MK8A 1BQMA 7FDRA 2GW8A 5L9XA 1T9WA 1IQZA 2DEIA 1IKWB 3PCOB 3P45B 3IR5B 1C2PA 3M2UB 4I1TA 1EKSA 3KLEA 2BX6A 1SPBP 1IVZA 3GFYA 2EKNA 1S6PB 4QOTA 1G4CA 1UAWA 3OHAA 3G86A 1WEXA 3DCAA 4LSLB 2WZ1A 1V3RA 2XI3A 3LWMA 2YKQA 2GVDB 1B4SA 3KK1B 4RR5A 3J7YU 1UVJA 2BA9A 2VBXA 4X64J 2AKWB 1NPRA 2IVMA 4NASA 1QAYA 4CRJA 4ZJLA 2YKNB 4OQJA 3NKYA 2G13A 4Q8EA 3HT0A 2XHCA 1JLCB 3T1HF 1J27A 1SB6A 4IRCA 1B7YB 1PCAA 3GPAA 1BLUA 4HLBA 4KRWA 2ZC3A 1RTJB 4DFPA 5AJ3F 1KP6A 4KE5A 3QSYB 1FJGJ 1WG4A 2MZRA 5B0CA 2BQ3A 4DMZA 2G0CA 3PYDA 4FPRA 3EYZA 2B8PA 1BUXA 2VONA 4USJC 5IC6B 2QG9B 2VUGA 2L08A 1RTIB 4IDKB 2MB0B 2BJ7A 3FGVA 1Q82T 3FRYA 1CJKB 2WCXA 3SFGA 4C7QA 1HIYA 1SUQB 4CLUA 4DQSA 3CEDA 3W5YA 3UN2A 2NYIA 2IIHA 1U45A 1IBMJ 4DR5J 3BO4A 2FJWA 3FUYA 2DXFA 5THWA 2FYXA 3Q8UA 4NCGA 4O4RA 1VCTA 1ZM4A 2UUWA 3IM9A 1FO1A 1VIXA 2I38A 5K8NA 3EZ5A 1IKXA 3C6TB 4F50A 1RBOB 2H5JB 5E0OA 3JXOA 1NB2A 3KFWX 1ULRA 4OHYA 3G6YA 4U7UD 4GKKF 1SVDA 2NUHA 2PD1A 1VLYA 1R6YA 1NSKL 2CWKA 2LU1A 1XBWA 2C2NA 2KYZA 4O3QA 1RA7A 2KJVA 2RJZA 2EXUA 2AJQA 2VB6A 3NCQA 2XQCA 4DV6J 1CJTA 4JOUA 1KRPA 3N6LA 2MJNA 3O3LA 2VQFF 3IG1A 2UXCF 3QLHA 3L3CA 5SUHA 1UVNA 5H9EJ 4QJVA 4MKYA 3CSKA 4DCJB 2BE2B 1N8RT 2PT0A 4O44A 3UNGC 1HNWF 1Y5IB 4N77A 4W90B 4LFCF 4PQUA 4UT4A 4B08A 2DR8A 2JVRA 5F3TA 4NCAA 4LF2A 3PTWA 1QDUB 4ZPVR 4RKUC 3QIPB 1NK0A 5F3ZA 3BYRA 3H4BA 2A6MA 3IM8A 3U7JA 4OZJA 1JKHA 3GIIA 1B3TA 4ILLA 1WEZA 1MROB 2DR5A 4E0DA 4FYYB 5EN1A 4YMEA 5HLFB 3EGVA 1S1TB 4NRTA 1CBKA 2MY8A 1M5HA 3A8IA 3K5LA 1TL3A 5FDLA 4E2FB 2KM8C 4JI8F 3F41A 2HHVA 3LANA 3UD3P 2ZVSA 2AYBA 3GG1A 4ZVRB 4ED6A 1FKOA 4DG1B 3CJTA 2V9KA 3BBFA 1BQNA 1U1PA 1X4CA 3EVOA 4USVA 1GXTA 3OW2R 3NS6A 3VVTA 5J2PB 3S8SA 4ZMMA 6AT1B 2IVFB 1CS4A 3SV4A 1FE4A 2MZJA 2GFFA 2UU9F 4QYRA 1WOSA 4BC7A 3LOUA 4WXWA 4ZPTR 3T3FA 3TRGA 4K2JA 2MTLA 5BR8F 1E6VA 2AW0A 2N4DA 2JFKA 4KR0B 2FZKB 4DUTA 4ZVOB 3CDBA 2DPJA 3HCXA 3L9ZA 1OYEA 5FLXY 4DR1J 2HQIA 4ZVPB 4A8YA 2HHWA 3BBCA 3NRBA 2IC3B 3CGIA 1TKXB 4LUBA 4IR1A 3QSIA 2G9OA 4R0JA 4RW7A 1NK5A 1URNA 1WC6A 3QMQA 4MYTA 2GJIA 3H59A 3M7VA 2EBEA 2HMIB 4GMKA 2DNYA 2D7SA 2HHSA 1WD6A 3HP6A 1C4CA 4K4YA 1KNZA 4A8XA 2QA4G 4K4SA 2BJ3A 1TK0A 2K7KA 2QFIA 2B4UA 4X66F 5M2PA 3BSOA 4L76A 5EWEA 5GMDA 3W2VB 1KVIA 3HHLD 2CDRB 2R7OA 3E8OA 1IBLJ 3KLFA 2EI5A 5HMXA 2X3GA 2HAFA 3ETOA 2GVZA 3KMQA 3GONA 2RRNA 2DNGA 2FPHX 4KV8B 2WONB 2GIQA 2DO4A
chains in the Genus database with same CATH topology
4JI6F 4ZK7M 1YTYA 2KG1A 5HROB 4RUCA 2FHMA 2AYMA 3M1VB 2UV8G 3GV5B 5DG7A 4LF9F 1AW0A 2A2CA 3I82A 1W25A 2IRYA 3TVYA 1ZM2A 4X4OA 2JL9A 4DSIA 4H4MB 4ZP8A 2F4VF 3DRSA 3M9NB 4NA2A 2BDPA 5DQGA 2KHDA 5JVGQ 1Q7YT 2A10A 1QSSA 3Q8PB 1C0UB 1U6BA 1SKRA 3BM7A 1FEEA 2BANA 2GMLA 4Q44A 3H5UA 1T3NA 1X4FA 3W3SA 1HMVB 2CPFA 5K8OA 3UFCX 3IAM9 3M8RA 4DUYF 5M2RA 1EETB 5CYQA 5E3RA 2D3OR 5M2UA 3JAMY 1RT7A 5F9LA 2VPZB 2X1GA 1RKJA 5SZTA 2ZNYA 1HQUB 4B3SF 1M1KT 5I42A 1IR0A 4I6AA 3V6DB 2KDOA 2ZBCA 1H98A 1WG5A 3ZZRA 3UQSA 1UA1A 1GX5A 3MWBA 3HKWA 5C25A 3HX9A 3CPWR 2C22A 1S0VA 2QIFA 3J80Y 3MM9B 4KHMA 4OI1A 3T6JA 3HT3A 2GQCA 2WSFC 3AH6A 5CD4H 5L39A 4Y0FA 1L3VA 3FEZA 1DLOA 2F40A 5AXMA 5KFFA 3H4DA 2HYIB 2HFZA 2KO1A 4C2MA 1HNVA 2W4PA 5BJRA 4EYHB 3ENQA 4DOZA 4Z37A 4ZDNA 2JSXA 4ELVA 1XNQF 4B9UA 4QR1A 2ZH9A 4DFMA 5CZVA 4XAKA 1JJHA 4NXNF 3F44A 2CQ3A 5K8MA 5HP1A 5F8JA 3FVYA 2YX1A 5CYMA 1S72S 2JLEA 1QE1B 2VPXB 1VJWA 1G7CB 4WFXA 2XLKA 4WZMA 3NP5A 3LP2B 5KG4A 2PMZD 2LYVA 2R8JA 2PSZA 3MF5A 4EBDA 3JSMA 3SQGB 1VC0A 2HVZA 2VFTA 4KFBB 2F3JA 4K4ZA 3VAIA 1NEEA 5K9FA 1RT3A 4ZHRA 2DNQA 4B3TF 2DR7A 3FJ2A 3GR1A 2YNFA 4H4OB 1I6JA 1DTQB 3DYAB 1FXDA 1Y5NB 3E01B 2E5LF 3HK2A 4TKTA 2RRAA 3OVBA 2NQPA 2W7AA 1WHXA 2EK6A 3DLEB 2BYCA 2XNQA 4MKAA 3MPVA 4IO9Q 1SI9A 3M30B 3QIDA 1FK9A 4N8NA 4C8MA 3BQ2A 1JK9B 2XHWA 2BUNA 4TY8A 1FESA 2KG0A 1KTVA 3H20A 2B6AB 3I96A 3IWNC 5I3UB 3M8QB 4HH0A 3B4DA 3DU6A 3V4IA 4DSLA 5LSLA 1C1CB 3HVRA 4EZ6A 2IHR1 4WYLA 1T8EA 4PRFA 2B4OA 3VWSA 1FKPA 2R7UA 1U1RA 1NKBA 4ZCMA 2CZ4A 3MMBB 1URRA 4A48A 3SCJE 1JLBB 4Z2XA 1S6OA 2FHJA 3KMSA 3MR2A 3THVA 2ZZMA 3N5BA 3FRZA 3CUNA 1OS5A 3V81B 4KBIA 4F26A 1S76D 1VBYA 1SIWB 3PO4A 2Z2LA 2UXDF 2RE1A 1NH8A 5F0UA 3RAMA 3ULHA 3ZFVA 3UI3A 2DNNA 3CD6S 1KC8T 3OR2A 3ITHB 1LXJA 5IQQA 3KHRA 3RR7A 4O3PA 3LAMA 3QGHA 4ECVA 1YJNS 1Q1KA 2KFYA 2K8GA 1AUDA 2M0GB 3MR3A 2C2EA 1YJWS 4LFAF 2DGUA 3DHXA 2QMXA 3RYLA 1JLQB 3DLKB 3H40A 1W2BR 4IQXA 5B0AA 1S1UA 3IR7B 2VH7A 3OR1B 1YI2S 3CCUS 2JC1A 3HI9A 1YJUA 4LT6A 4A47A 3BQ0A 1RTHB 2V94A 2XWXA 5E33A 1U24A 2FVQA 2EPIA 1JNRB 3BEGB 2DIVA 3A8EA 2BQRA 3OTCA 1Y4ZB 2FJXA 3NL0A 1FRKA 3DLJA 1LW0A 4YEAA 2V8DA 4R8UB 5F8HA 3M05A 3CMAS 4IG3A 2BACA 4OHVA 2NR0A 4C8KA 3R1LA 1CC7A 2IRXA 1RT2A 2FVSA 2QV6A 4PWDB 3DMJA 3MMJA 3VAKA 2LQ9A 3OXFA 2DRBA 4GO7X 1HBUA 2KRRA 2J7WA 3QZ8A 3ISNC 4RBTA 4ERDA 1E6YB 3H98A 1T05B 1AXQA 3QPIA 2ASLA 2DBBA 3KLGB 2HNZA 5KFHA 3VAJA 3MM7B 2CPJA 2FC8A 2FTRA 1N6QA 4DR7F 2R7TA 1ZM9A 4MKBA 5K5MA 1NJIT 4TQRA 3GZ7A 4ZPBA 2KM8B 3CXCR 5C5JA 2FD2A 1RYSA 1V3SA 3KLHB 3HO1A 2MZ1A 1UWBB 3SZ2A 2AQ4A 2B43A 1DFDA 2GHWA 1HQEB 1S1VB 3FFIA 1ZBTA 3QAEA 1D9DA 2HNDB 2MQLA 1U4BA 2DT9A 4C11B 1N0UA 3DLGB 3DOMA 3LP1B 5KG0A 2E66A 2A18A 3MAHA 3D0IE 3KK2B 1XK8A 4J9MA 1RT5B 1JLEA 2KXHA 2QLWA 3CWJA 5KFDA 1TKZB 1H7XA 3FDSA 3Q2TC 3LPYA 1JLAB 2IJNA 4CI0B 3POTB 1KFSA 3TVKA 2DNMA 4ED1A 3SXLA 1NJYA 5KFKA 2M8DB 5A6PA 4GO5X 5HMYA 5LT5A 3HMJG 3RRHA 2M4MA 1A6LA 1HWJA 1C1BB 1YJRA 2CFXA 4MTPA 1GNKA 3KLVA 3T6BA 3RB0A 1X4BA 4PKDB 2XY7A 4OX7A 2UXBF 4NX9A 1CC8A 3SDEB 3T5LA 2XMUA 4J9QA 2F1FA 4KC5A 4U9RA 4KGMA 2KU7A 2PI4A 1TKTB 4LQ9A 4O3NA 5B0EA 2YWEA 1N5YB 1JLFB 4KB7A 4DV4F 1O0PA 1SH0A 2MYFA 2ABYA 3CJ4A 1X5SA 1J5OA 1OWXA 2J9CA 2XSFA 3OSNA 4TU7A 2QSFA 1FRMA 4TU9A 2V5HG 2ZH8A 5J2QA 4F3QA 3OTOF 5EWGA 1TKDA 3MOJB 3LWLA 2VA2A 4ID5A 3J7Z5 2MQNA 2O66A 1B0TA 1FRIA 3HHEA 4EU0A 3HZEA 5H1SV 1CLFA 4R25A 2DNHA 2F9DA 4FS1A 1H0HB 1WACA 1UP1A 1ZTTA 2BW2A 4RWWA 3PW2A 2IAJA 4A8SA 4PG4A 1SJ4P 2FLNA 2MKIA 2D74B 2KXFA 1H7WA 4DR3F 4DSEA 2W9AA 4DFKA 2DIUA 1FDAA 3CIZA 3R5DA 1QSYA 5EX0A 3OLBA 1N48A 3M2RA 2CPYA 4BCAA 2JEJA 3UR0A 2HLUA 1FERA 1XMOF 2CQ2A 2OTJS 4ZPCA 2DGOA 4U6PA 2R7VA 4N56A 1DRZA 4HI1A 1VQ4S 1ZM3A 2IBOA 1OSDA 2DPIA 2AYEA 5KOWA 4IH7A 4XPCA 2GMHA 2P9GA 5DG8A 3U02A 2OPPB 1HNIB 2NUUG 4ZP7A 4I6YA 2W9BB 4LF7F 2PGCA 1Q4RA 1BQMB 1DQ8A 1HBNA 4IOBA 3I0SB 5EX3A 1Q16B 1X4DA 5J2MB 1VC5A 3CF5Q 1RWUA 3GYXB 4F2RA 1R43A 2C42A 1S0OA 3N01A 3JTNA 4Q0BB 4O3OA 2QYCA 2EFGA 1H2UX 3TARA 1P1LA 5F0WA 5B7WA 2M88A 5ITHA 2R7RA 2VQEF 2M52A 3US5A 5KT5A 4K2XA 4FBTA 3LF0A 5KFXA 4RW9B 1PC5A 1ZAVA 2D41A 3KLEB 3I5CA 3CO9A 5EGYA 3GFZA 3D28A 2BR0A 2XMKA 3DHWC 3DNCA 3AJ1A 3SSQA 3FCHA 5HI7A 4C97A 2XCAA 1F2GA 3DRPB 3MM6B 4W92B 1YRTA 2B7BB 2VFVA 2FY1A 2VKRA 3MR6A 4XK8C 3PFOA 2OPSB 4AQYF 4UW2A 3LALA 4HL9A 5IS2A 5L1JA 5LJ3Y 1OPZA 2VBWA 3UD4P 3IWXA 3DLHA 1ZTWA 1UKUA 2DHSA 1REVB 3MFHA 2ZH2A 2CJKA 3OPKA 2E1AA 3FSIA 3HHDA 4ILRA 2Y1IA 3OXLA 4OLOA 4TYAA 5A8WA 4JI7F 2PFFB 2U2FA 4RW6A 1APSA 4OI2A 2GV1A 2FDNA 3QGIA 4LVNP 1UVLA 3NBPA 5KFJA 2W4CA 4P2SA 4PUOA 1R8HA 2MJUA 3DOKB 4MIAA 1G2EA 2FLOA 1MNEA 1Y3JA 3TQ1A 1IKYB 2DR9A 3VTIA 1QVGR 4ZPAA 4G6VB 3EUNA 4WIIA 3M8PA 2CPIA 2RKIB 2QFJA 4DL5A 4K5RA 5KTQA 4DL4A 2V4RA 2MZSA 3K5MA 1HI0P 3U1MA 4ECUA 2HLTA 2ILZA 2ZE2B 4XO0A 4KT0C 1L3TA 1I94F 2VG6B 5D77A 3OL7A 4NYZA 3OV7A 2MZQA 1S9EB 4CTAA 1R89A 1HBMB 4LF8F 1S1XA 2FLPA 2R7SA 2N4CA 3DC2A 1KLNA 4PWUA 1N0VC 5DJBA 2XB2D 1SV5A 3LAKA 1KLMA 3HVAA 4CIOA 5GAGI 5DETA 4FNIA 3C46A 1TP7A 2B5JB 4O0IA 2EW9A 3RAXA 3PW7A 2LEAA 4Q2MA 1S1WA 1X0FA 4G1QA 1BY9A 2VBYA 4G1PA 3MEDB 3RRKA 4ED8A 1Q79A 2A1BA 3N0VA 3UPFA 4ECTA 5I4MA 1LK7A 1DHMA 1MU2A 2C28A 2BQUA 4KQZA 3MFIA 3DRRB 3OTDA 1LW2B 3V2UC 3EGWB 4I67A 2R2TA 5IT4A 2IVYA 2GMJA 4NYOA 3MUMP 2O5DA 3FQLA 4HVZA 5A6WA 2FJBB 2EFVA 2LXUA 2MKSA 2M8HA 3HHLA 5K14B 4QWAA 3Q22A 1LWCA 2ZDOA 5DRKA 4DLEA 1YWXA 4DQIA 2RVJA 3RTVA 3SV3A 3RB3A 2NS1B 1FD2A 4YP3A 3BREA 4O4GB 1RT1B 1HYSA 1RKIA 2LQ5A 1FNXH 1UVIA 3RAQA 2VFUA 5IWAF 1LWFA 1D8YA 4B9TA 3BDPA 3JTPA 1SH2A 4JI3F 1MMDA 4JV1A 5KFSA 1JXEA 2IM2A 4P7VA 1QUVA 2FC9A 4YR2A 3MM8B 4PG7A 4ZKAA 2UP1A 5CH7B 3B82A 2P9CA 4RUHA 2OMLA 2AJ1A 1LOUA 3UE2A 2X1BA 5KFYA 3SFUA 1HR0F 4OX9F 2YKMA 3U1LA 2JOQA 3HHNB 2OIHA 1RT6B 2Y0SD 3GFXA 1YVFA 1FCAA 5CCMA 2ZH4A 1TFWA 4Y2AA 2I8EA 1Y9OA 5G0RB 1IM4A 2MZTA 2YNIB 1RP5A 3I55S 2JC0A 2B0GA 3TVZA 2ZITA 5JXSA 2AX0A 2LEPA 3CCTA 4I0WA 5CHCB 1TV6A 2R2SA 2H9ZA 2UVRA 4QYZJ 5B0DA 1U09A 1S9GB 2ZJQQ 1N52B 2R7XA 1MWZA 1KS2A 4CO1A 2IM3A 3K8VA 1IKWA 5B0BA 4IO1A 3M2UA 2ZKTA 3UR3C 1F9FA 1Q78A 1SC6A 2IFXA 4B3RF 3J81Y 5C24B 1QVFR 4RZRA 1VQLS 4C8OA 3P49B 4L3NA 4B3MF 3C6UA 3Q8RB 1H6KX 2KT5A 2N3LA 2C3OA 2XC9A 2XY6A 2GO9A 1S6PA 3MHYA 4Y2KA 3CD0A 1B7FA 3G9CA 3I6PA 4J9KA 4K0KF 2ZC4A 3LUYA 4MMOA 4LSLA 4NCGB 4LSNA 1CG2A 3DOLA 1R27B 1FVSA 1N5TA 2D9PA 4K5SA 4RLEA 2BOPA 1A7GE 4X4PA 1NKCA 1U26A 2XSJB 4PXBA 3KK1A 1MSWD 3PX6A 4JBCA 1HWKA 5KFTA 1HHTP 4FXDA 4NMLA 1KEKA 2V9WA 3TI0A 2JEGA 3AHPA 3WBZA 2C2RA 1TVRB 3BN7A 1R8PA 3K2YA 3GILA 4F4XA 3K5OA 1GTEA 2AGPA 4DL0C 3MEEA 1IKXB 3CTRA 4HKQA 4I4BA 1VHFA 3IGVA 2E7XA 4Y3CA 4QWEA 4ECYA 2YKNA 5U47A 4X4SA 2XO7A 1UL3A 4U7CA 3J7ZT 5D4LA 3ZZOA 3LQVA 4R5PA 4CO0A 1DJ0A 2VZ9A 3KLIA 1DARA 1JLCA 4DF8A 2JHEA 1X5OA 4F4KA 2J76E 4C3MA 2GA7A 1U1KA 2CG4A 4CNZA 5GAEU 3QZ7A 4MJKA 3TAMA 1YITS 1CEZA 1TL1B 2EBGA 1WTFA 3KHHA 3BSCA 2QRRA 1D9AA 1VQOS 4XPEA 2MPUA 3EZUA 3I0RB 2JDJA 1S6QA 2RNEA 1JLGB 4QU6A 1FXLA 3IRWP 2LECA 2DGXA 3D2WA 4J9PA 1WTBA 5AE2A 2PO4A 5KOXA 3OJSA 1SL1A 2RUGA 4WFBQ 3R27A 4QIGA 2GX8A 4YR3A 3EGZA 2G4BA 1RTJA 2XS7A 3PKMA 5J1PA 1N56A 4ECSA 1NU4A 3TW0A 3MMCA 2ERRA 1X9WA 2EG2A 1ZAXA 2E1CA 4AL6A 2OD6A 4DN0A 1MW7A 2CVEA 5KT2A 1RGVA 2E5JA 2KJWA 3GE9A 1X9SA 1S7HA 2DNPA 2XULA 1OQ3A 4DV3F 3HJFA 1DURA 2VODA 2KB2A 1K0VA 1KFDA 2R2RA 5J1EB 3K58A 4K4TA 3IG1B 3M9MB 3PX4A 2LQBA 1QAXA 4MYUA 3IRXB 3K7RA 3QLHB 4DS5A 2VC0A 4E98A 4J9OA 4FBUA 2LKZA 4G1IA 4NRUA 5D78A 3CIMA 3IC1A 3PKYA 3H5SA 2J6SA 2XLIA 2CIMA 1X5TA 2DHGA 3FEYB 1YJTA 2V0NA 1WF0A 3THTA 3TP2A 1RI7A 2M3DA 5F8MA 4TQSA 3KTQA 1TZ0A 2KRBA 5KFAA 2VASA 4H4KA 4QIEA 1RT4A 2VC1A 1HARA 3R3TA 4NLOA 4D3HA 4RUAA 4WTYA 1C0TB 5E2QA 4ES3A 4ECXA 4O44B 1LKZA 1PSDA 1RTIA 1Y7PA 1GQEA 4IDKA 2WOMA 4K4UA 1YJ9S 1OPIA 4TN2A 1U1NA 4IQMA 5I3PA 4MFBB 1KR4A 2CJAA 4OJHA 3VF0B 4JYAF 4PQUB 1VGYA 1U2RA 2D9OA 2HGLA 2OO4A 1KHVA 2OPRB 4OHWA 5B09A 2VOOA 3R1HA 4Y2MA 5HN0A 1SUQA 2YQ3A 2BRLA 4FVMA 3VCDA 2VOPA 1VRTB 2QEXS 2NZ4A 1M90T 1ZH5A