4DR3F

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dr3F00
4B3TF 1XMOF 4DR4F 2KJVA 5LMNF 2UUCF 2HHHF 4DR2F 3R3TA 1HNWF 5IWAF 4JI1F 5BR8F 4JYAF 1LOUA 2KJWA 1HR0F 1CQNA 2ZM6F 4DV4F 2J5AA 3T1YF 4LF8F 4JI2F 4DV2F 4GKKF 4NXMF 4X64F 4OX9F 1J5EF 4X65F 1IBLF 4DR5F 4JI3F 1IJFB 4JI0F 4B3MF 2RJZA 1I94F 4LF9F 1B64A 2BVZA 2B7BB 1RISA 1G1XA 2UXBF 1N36F 4LFCF 4DR1F 4DR7F 4DUZF 4JI8F 1XMQF 2E5LF 1HNZF 2UXDF 4GKJF 4B3SF 4DV3F 2UUAF 4JI4F 4X66F 4YY3F 4JI6F 2VQEF 4DV7F 4LF4F 4B3RF 4NXNF 4DR3F 1XNQF 2UUBF 4YHHF 4KHPF 1IBMF 1FJGF 3OTOF 4LFAF 4JV5F 4LFBF 2B7CB 1F60B 1VMBA 1N34F 4LF6F 4JI7F 4DUYF 2VQFF 4DV0F 1IJEB 4X62F 4DV5F 1FKAF 1CQMA 2BXJA 2UU9F 5AJ3F 2YY3A 1XNRF 3T1HF 4JI5F 5LMUF 1GH8A 2F4VF 4LF7F 1QJHA 1HNXF 1N33F 1IBKF 2UXCF 3ZZPA 1N32F 4DV6F 4DV1F 4LF5F 4K0KF 1G7CB 4DR6F 4AQYF
chains in the Genus database with same CATH superfamily
1RHMB 1VRTA 4DV1J 4K0KJ 4DL6A 4WXOA 5KFWA 2UP1A 4WKRA 3RTVA 3EPIA 1VS3A 3CMQA 1N5TA 1X7VA 1T11A 3SXLA 4LF8J 2XI2A 1HHTP 4GVBB 5E33A 3P4UB 2UXBF 2IYIA 4OQJA 2QYCA 2A6MA 4ED8A 2ASYA 2AD9A 1HW9A 2AGQA 4ID5B 1U7LA 1RT1A 1UEUA 4GKJJ 3MEKA 1F6TA 2W01A 4DG1A 4TKTA 4Y0FA 3GV7B 1RK8A 1JLQA 4Y2IA 1MU2A 1FE4A 1KS2A 2EFNA 4ZVPB 2DNPA 3H7HB 1JKHB 3WC2A 2ERRA 1RSCA 4ZJQA 2BRLA 1LWCB 2VFTA 1FO1A 3CC4S 1IM4A 2JL9A 1H2UX 1HNXF 3TANA 3I9ZA 2ZWPA 1VLOA 1HNWJ 3PYGA 1NHKL 4WKYA 5T14A 4K4XA 2G2ZA 3QYYA 3NNAA 2DNRA 2BYCA 3PY8A 1XWLA 5EWGA 2GO8A 3Q22A 5K9FA 5HMWA 3CDUA 5F9LA 2OSRA 3OR2B 3MECA 4WU3A 2ZBQA 1R43A 2UV8A 3E51A 3UN3A 4QCLA 5H9EJ 3H90A 2QX0A 3WIUA 5I3PA 5ETLA 4IH5A 5A0YB 1T9VA 1M0SA 1TKZA 4NXNF 1N5VA 2YQ0A 1BMQB 2DNQA 2JEJA 4ED3A 3HHDA 2IHR1 4ZVGA 2BKPA 1LW0B 3MEEB 4AL5A 2BMBA 3MEDA 2RRAA 3G8QA 2ZH3A 4U8VA 4KBIA 3CTRA 1IBMJ 4C0BA 3TQEA 2CQCA 3VAIA 1F3FA 3CDBA 4L74A 3EGWB 3W1YC 2HBZB 2YNIA 2E1MC 3R27A 1Y10A 1FWLA 4C8NA 4HR2A 1P1LA 2XGPA 1TTHB 2FVPA 4DQSA 2VIHA 4C97A 5DLFA 2V5HG 3S6EA 3GFXA 1AFJA 2V4JA 3MI7X 3LUYA 4DL7A 2HVZA 2PC6A 1HI1A 2MSSA 2R2SA 1DTTA 1S0OA 3KXDA 2JFKA 3UDVA 3POTB 3VZIA 4CDIA 5J2MB 3DNCA 4PWWA 4CCHA 1S6PA 5D0HA 1F0XA 3AODA 1UFWA 2N4CA 3R5AA 1R0AB 1IUJA 3NRBA 1R6YA 1UA1A 3KLEB 2LMIA 4ITSA 1KHVA 3BREA 2XZWA 2OPSB 1PCAA 1V3SA 2MEWA 1XEZA 4WK3A 3BDPA 1FA0A 2NCKL 2LQ9A 3TJAA 4ANEA 4JI6J 4MK8A 3QNWB 2UU9J 2KRRA 4KR0B 1PO6A 2XWXA 3M2UB 3K5LA 1LFWA 1Q78A 4ZVRB 1SL2A 2P2CB 1QTNB 3MM8A 4M5JA 2RDJA 1FEEA 4PG6A 3HSJA 2QLXA 2E7XA 1K8AT 1RT3A 3L7OA 1R8BA 1BWVA 2PI4A 2HSEB 3N6NA 4ZPTR 3UPFA 2MHNA 2GAGC 3PVXA 5DG7A 4RLEA 5L9XA 1HD1A 3ENAA 2BKOA 4BHQA 4KO0A 3OSNA 5LMNF 4F4KA 3RAQA 3C6TA 1ZA2B 4ER8A 4HVZA 1HI0P 1S5ZA 1RT5A 1HLWA 2ZVIA 5IT9Y 4LR9A 4X4PA 1WEXA 2FY1A 4DR1J 2AJQA 4OX9F 4RR5A 4ID8A 3A3PB 4DU8A 2DPIA 2R42A 2ACYA 2V2KA 3M2RB 2F8HA 3R97A 4AL6A 3U1LA 2LECA 2BJ8A 2CPEA 1YJWS 1IBLJ 2LEBA 2JNJA 5A6PA 1WC4A 1K9MT 4B3SF 1H2VZ 4DCOB 3D1HA 2CNNB 5DDOC 3NGDA 2QL9B 3FSXA 1RWWB 4YY3J 5C5JA 1C1BA 3DOLB 3M7VA 2F5GA 4P73A 3EXYA 3OVSA 2H48B 2PA8D 4LREA 4EWTA 1M1GA 2WB1D 2YKNB 2QC3A 4WP8A 1RHRB 3BJYA 1S7HA 2LFVA 3C19A 4J9OA 3HSGA 3HHKA 3BQ1A 2GMLA 1DQ8A 5L1IA 2VPXB 3IBCB 2AMCB 1SKWA 3MAHA 1U25A 5KT5A 2CJAA 1GMWD 1ZBTA 3QIDA 4IOBA 2QLJB 3KNAA 2F9DA 3SMZA 5KG7A 2B6AB 4DV2F 2ZH9A 1F3VA 2WVFA 3PACA 4A8XA 2XYHB 1UKUA 2VF3A 1N5YB 5HLFA 1AW0A 2ZH5A 1KNZA 1N48A 4AUKA 4MKAA 2RKIB 4BCAA 1TMMA 3D2WA 4DV3J 3BGRB 1V5VA 1CBKA 3J7ZT 4GC7A 3N0VA 5DGBA 2VONA 2R7QA 3AOAA 4E2FB 1NDLA 3PX0A 3UN2A 3DRRB 3BSAA 5EDWA 4MAKA 3H5XA 1QE1A 5L46A 1IKVB 1RWNB 3D5MA 2E66A 3TAPA 4RWWA 2GVZA 4LF1A 3LAKA 4U8YA 2GJFA 1GX5A 2BEFA 1MMDA 2VASA 3MR2A 2YKMB 3O8WA 3RR7A 2C3UA 2DY9A 2VG7B 3L95X 1B64A 2CQ4A 3KLIA 1N36F 1AUDA 2XCPA 1XMBA 3JSYA 4H4OB 4RW9A 2VKRA 5ETVA 4KHPJ 1WI6A 4M5DB 2RRBA 2KT5A 3W9JA 3N6LA 2VKZG 1OIAA 1NJXA 1VQ9S 3NOCA 4ECUA 4ZHRB 2ZOGA 2E9RX 2NXUA 2IA6A 1FRHA 3HX9A 1GQEA 1RAHB 4AQYJ 2DT9A 4LF7F 4DV0J 3MTKA 4OI4A 1SPBP 3FJ2A 3UI3A 1RAGB 3DXBA 2M8HA 3CD0A 4LBHA 2A10A 1F5BA 1S49A 4USKA 3I6PA 4MJKA 1RU2A 2PT0A 1HWJA 2YVSA 2KYXA 3PYDA 1LOUA 4R0JA 1GMUA 4A48A 4RNHA 4PXDA 3W8GA 3FUYA 2GMJA 3TX0A 3GFZA 3QZ7A 1XR5A 4ZVHA 1B0TA 4X64J 1TL1A 4OZ1A 1WORA 2XO6A 1NUEA 3NBPA 1KTQA 5F8JA 2ZD1B 4I7FA 3O44A 1VOMA 1F5AA 4OV6A 5IT0A 1Q82T 5H9EK 4Z37A 2G1HA 1JNZB 5AE2A 3D7SB 1JMTA 2CKWA 4WU2A 3G6YA 1HNVB 1D0EA 1W25A 3TR5A 3QIPA 1FJGJ 1NJYA 2CVEA 3IWXA 1LWFB 1HPZB 3DRPB 2Z8QA 4F4XA 3G8SA 1N5SA 2DYAA 3G96A 1W26A 4Y2KA 2WOMB 1HBOA 5GAHI 2B4PA 3CDEA 4ZKAA 3QWUA 1A7GE 1KQFB 1HI8A 3V6DB 3F41A 1XC9A 1X5TA 4URSA 5KFPA 1NLKL 2KHDA 5J2NB 4RX6A 2EC0A 2LA6A 1K1QA 2IFXA 1GAOA 2Y3YA 2CG4A 3C3LA 1MNEA 2XMKA 5KFCA 1RACB 1P27B 4A4JA 3TYTA 1HWIA 3D28A 1P9YA 2BM1A 2H5IB 3F56A 5ETKA 4RW7A 2RT3A 2OFGX 3G6ES 1CS4B 2JZ5A 4USUA 1FK9A 2P5VA 2WTFA 1U49A 2DNMA 3VGSA 4Q0BB 2OSQA 1RT4B 5CYMB 4O44A 4ZCMA 1L3SA 4K5SA 2F9JA 2ZUGA 1VI7A 4OLOA 2GC8A 2D9OA 2A2DA 2F4FA 3ZTRA 1EKSA 2MQNA 1S79A 4JUZA 3OR1B 3BR9A 1XBWA 2N3LA 4KJIA 5F8IA 4TLQA 1L3KA 5F3TA 2HQFA 4P2FA 2RILA 5EWEA 4IH6A 1C0UA 5IWAF 1WOOA 2YWEA 1BQMB 2KJWA 3W3SA 1R27B 2QA1A 4I69A 1FJEB 2R7OA 2RIJA 4F67A 3FNNA 1NK7A 1R0CB 4KV8A 3UD3P 5ETTA 3AAWB 4P74A 2EG1A 5M2PA 3EM1A 4DS5A 2J9DE 1VQLS 1IKXA 4NPOA 1JLCB 5DM6Q 1A0OB 1K0TA 3M2VA 3EX7B 4YUDA 2HMIA 1U2FA 3K5MA 4U7UK 2NXEA 4PWDB 4YB5A 2E5GA 5F8NA 1P8GA 2CUYA 3U7JA 4YHHF 2UVWA 1XNQJ 3TX8A 1JXVA 2YKOA 2FLNA 5J1NA 4OX8A 1PSDA 2M5YA 4PRFA 4JI5F 5LMUF 2VBWA 5DQGA 3AJDA 1WUUA 1TP7A 1B7FA 4EBCA 3UCZP 3V4IA 1N0VC 5CD4A 2V34A 1DJ0A 1HBMB 1SIWB 3TNVA 4LF5F 2ZM6J 2DY1A 3PJWA 1VQMS 4FYWB 1P1TA 1Q86T 2DH8A 5KFLA 1ZZFA 3R3TA 1J2VA 3NG8A 4JI0J 4TY8B 1WHXA 2IPOB 5E3RA 3DLKB 2OO4A 2ZOMA 4OHVA 1RHUB 1SUQB 4RBTA 1DY3A 4NXMF 1H6KX 3GONA 4DFPA 1HR0J 2DHAA 3RU0A 2B56A 1OWXA 1LQ9A 3OJSA 4K2JA 1Q8BA 1YGYA 2YTCA 2BANA 1NDCA 3S1TA 1RP5A 2IDLA 3IO1A 3QJLA 3M1VB 1NK0A 5C42B 3LANA 1YSJA 1NDPA 3AQOA 2DGTA 3GJQB 2E9TA 1FFGB 5CCMA 4HT5A 5ITHA 4H4MB 2FVQA 1KOOA 1NJIT 2FC9A 3CSKA 3ILIA 2YQ3A 2DGWA 4HEA9 4HHHA 1PILA 3FMWA 3VR1A 1O5JA 4Y28C 3MEGB 5FLXY 4ELVA 5DETA 3HFVA 1S6QA 3W65A 4WFYA 1YDLA 2YBVA 4AE5A 2WVBA 3FDSA 4F02A 1GX6A 1U1KA 1N6QA 1HMVB 3RR8A 3IC1A 3T3FA 3QJPA 3LPYA 4ZOSA 3G71S 1H7WA 3VAJA 1JJHA 4U96A 4G6VB 1RWMB 2IIHA 4F7VA 5HL7Q 3MDFA 2R7RA 1TMJA 3DM2A 4YR0A 2J0WA 2UUAF 4Q45A 1PC4A 4UZBA 4Q5VA 2HHWA 2RU3A 2YPYA 5BYSA 3HHEA 5GVQA 2V8HA 2YWWA 3R9LA 3VGVA 3EE3A 2ZJRQ 3MAAA 3RAXA 2EXUA 3MCMA 1RAFB 4N76A 3KLFB 1R89A 1CJVB 3IGVA 3CO9A 4F8RA 4DJBA 4OHZA 4ZMMA 4LFAJ 3HVRA 3IG1B 3M30A 1M5HA 2NYHA 1RGVA 1SV5B 1X4HA 2DK2A 4ZPAA 4CH0S 1SJ4P 1WHWA 2RF2B 4KFBB 2HZVA 3RBDA 1AZSB 2LVWA 1OY8A 4V19J 4ZPDA 1RCOB 5KFJA 5G0RA 1KKHA 2Q43A 2JEGA 4GKKF 1MROB 3EVWA 2GS8A 4TU7A 2RHSB 4B3RJ 1RCXB 1DTQA 3R5DA 3OUYB 2VPZB 2ZJPQ 1MLAA 4PPDA 2DHGA 3W2VB 1BD6A 4JV5J 4J9NA 2E1RA 3SSSA 1TAUA 3SEOA 3HULA 4K50A 1YBTA 3DDIA 1T05B 3AA8A 1YKWA 2A1BA 4N47A 1VHIA 1FT8A 1N88A 3QJJA 1N34J 2D3ZA 2DRBA 4U67Q 3T5KA 3GU0A 1GH8A 2JEFA 4RNFA 4P52A 5C24A 1D1UA 3GE9A 2DHXA 5K8PA 2ZFHA 1FNXH 4L3NA 2KXNB 1HL6A 1G7CB 4NZ0A 2M3DA 4RJVA 2HQ3A 1U47A 2V67A 2VU5A 5BR8F 4ZIVA 5KG2A 1C2PA 2X51A 3WHIA 3UCUP 5KT7A 2YWHA 4X4TA 1Q81T 2DGSA 2FJDB 2J76E 3M8SA 2BRKA 3DDNA 3GQCA 3W9IA 2XYPB 2KFZA 3MPUB 2CJQA 4U6PA 5A8RB 3NWRA 2BV3A 2VG5A 2MKHA 3SYZA 4IYQA 3KHLA 2AYBA 3SQGB 5LSOA 1DAXA 2IC3A 3KFWX 2CQ1A 2DJWA 2CPIA 4HL9A 2Z2ZA 2IMOA 5KFNA 2UUBF 3OD2A 5CCLA 2C2NA 2N4DA 5IC4B 4CLPA 4IFVA 4X4OA 2PA3A 4Z7YA 1WSVA 2D9PA 2ZKTA 3E3XA 1K73T 4I56A 4GC6A 2IM2A 5C25A 2CNOB 2MZRA 1LKZA 1FERA 2QSWA 4DX5A 3K8VA 4CTAA 1XIQA 1FD2A 3MPYA 3CE8A 4TU8A 4CO5A 4DR6F 3MUMP 3SV4A 3KUEA 3GILA 3NOGA 1Q0NA 3C16A 4FP9A 3BBCA 4PG4A 2BQ3A 3JB9k 2GNKA 2GO9A 2WAQD 4LR7A 3WX4A 4P72A 2GVDA 2E1AA 3NGSA 1G2EA 2R3VA 4CM2A 2LP4A 1G4CA 3TA0A 4LRBA 1KP6A 3HP6A 4WIQA 4UOGA 1NBEB 3A8JA 1U2RA 5HQ8A 2AT1B 4DUZF 4JI8F 1LEOA 4FYVB 1GXLA 1M90T 1VK8A 1WF1A 3D1QA 4ZPVR 1EETA 3A8KA 2ROPA 2HFSA 4DFKA 5KOXA 3QO9A 2MSTA 2ABYA 3R1LA 4OYXA 1RUSA 4NXNJ 4ANCA 2W24A 4YDDB 2CJBA 1IKWB 1R3NA 3GJTB 4Q2MA 3NMAA 1V9OA 1HNIB 4IDKB 4LR8A 3EICA 2XO7A 1JKHA 4USVA 1LWCA 2IJFA 2A2CA 3CC2S 3KJVA 7AT1B 1H0HB 2DPJA 4W92B 4DBQA 5ETMA 2WRMA 1RT7B 2LQ8A 1XTZA 3D68A 2LDIA 5KFMA 1YBAA 4PXCA 2ADBA 4H4KA 2V0NA 2ZJQQ 2CQ3A 2P9CA 3B8HA 1I51B 1W2IA 3IS9B 3I32A 2CQ2A 1HWUA 2NR0A 2HAFA 3D6FB 1S1XB 2KHCA 4ZLLA 1JLBB 1IR1A 1WC5A 2KKHA 3DYAB 4J9SA 4ZIWA 2OPQB 4ED0A 4IFYA 3LP2B 3M8QB 2IBOA 4OI3A 3TUIC 3VGUA 1Y5NB 4K4TA 2H4WB 1I3OB 1DURA 4DOZA 5HMXA 9ATCB 1S4EA 5K8NA 2LA4A 3PZPA 1TELA 2YXLA 4O4RA 4K4YA 3PFEA 4NEYA 4NRTA 4O3OA 4C8OA 3X1LB 3QFWA 4HACB 1FNMA 3H5SA 2IJNA 1OO0B 3RRHA 3MFIA 1S99A 1KQGB 3VGTA 4O4GB 3LGMA 3W61A 2HURA 2K8GA 5GMDA 2V9WA 3DI6A 4DHVA 3V81A 4ERDA 2Z58B 4G65A 1IM6A 1KLNA 3T5LA 1H2TZ 4B9TA 3US5A 2XULA 4LF9F 1SL0A 4OX9J 2XNRA 3BS9A 1S10A 1TUGB 3EGZA 1N54B 3Q0AA 1HW8A 2LEAA 3FMBA 2L48A 3KJQB 3PW5A 4C11B 2HVIA 2J7UA 4ES2A 2PE8A 4F0HA 1YJ9S 2BKNA 1MSWD 4OHXA 3NNCA 3JTNA 3PEJA 2L9DA 4I6YA 4CLKA 4X4RA 1VIXA 1X9MA 1JQGA 4ZN3A 2HS0A 4F50A 4WYWA 3GIKA 3AJ2A 4B3OB 1QVGR 3R6LB 4IOAQ 3UDCA 1C1CA 3S7RA 1R0BG 4ECYA 2KT3A 4U9RA 3UNGC 3KK2A 4J9KA 2ZH8A 4PUOB 1V3ZA 4OX6A 4KY3A 3NAIA 4ZP9A 2B9WA 3GMGA 3ICLA 1U0SA 3KMSA 4TN2A 3LP1A 2DGXA 2NS1B 2JSXA 5E0OA 5LT5A 4B08A 4FYXB 2H5JB 3E01B 3W5XA 3DXSX 3NKYA 4DV7F 4DV5J 3BB5A 4FNIA 3AHPA 2NQPA 3B6BA 4CO2A 4F2RA 3HJFA 3CJ3A 3CCTA 4A47A 4OYOA 1URRA 4RW4B 5CABA 2MHEA 4ECVA 3HT3A 2FHJD 3K17A 3L9ZA 2NPFA 3SDEB 2WBMA 2LXUA 3GV5B 4OZ2A 4KH1B 1KN6A 1I94J 2ZBPA 2YH1A 1U0HB 3J81U 4YMEA 2W25A 2RB7A 1RAAB 1U1RA 2QO3A 3V6KA 3GG1A 4PCQA 2B8QA 4LFCF 3FC9A 4AD6A 4YDXA 1N36J 2HWIA 2C22A 2DGUA 2G2YA 5L1JA 4YR3A 2C2OB 2JVRA 4UOFA 1BHNA 1HHQA 3OFFA 2B8PA 1BQXA 2RKIA 1XNRJ 2RS2A 4J37A 4YS2A 1S72S 2VH7A 5IFMA 3LGHA 3FEZA 5I4MA 2K7JA 1QAYA 1TKTB 3M6XA 4UW2A 1RJJA 4KRWA 5IV4A 1IWGA 4HLBA 5A8KB 4LIWA 4OZLA 1NHVA 1WKLA 1E6VA 2MQLA 2J0XA 1U1MA 5SUHA 2PI5A 5J2PA 4LF7J 4A8FA 5DDQC 1RWKB 1N5QA 5H9FK 3LAMA 2HS3A 3DU5A 3W5YA 5AXKA 5KFDA 2QN6B 3CVKA 4RL1A 3CJ0A 2VA2A 1IKVA 2OELA 2DEJA 3HF5A 1SKUB 4B3MJ 3AD8C 3FRYA 1Z4UA 2AX1A 3SFGA 1J5EF 4X65F 2LDYA 2LQJA 3DLJA 3ITHB 3CIMA 3J80U 2H5EA 2AEJA 2IJRA 2DXEA 4OJ3A 3H98A 2DGOA 2YKQA 4FBTA 1SQGA 3LO3A 1EX8A 3DLLQ 2C2RA 3THPA 4BWMA 2EW9A 4FZVA 1FDNA 2DR8A 1ITPA 4NCAA 4RW8B 3DRSA 3EVOA 4LSNA 3TOQA 4UOCA 4LUBA 2ZHAA 1BLUA 2QT7A 1J5OA 3NCRA 4MIWA 1VRUB 2FHOB 1JLGA 3VQTA 1D8ZA 5DS7A 1HBUB 2A6OA 2GQ2A 3N4WA 4IO9Q 2Q66A 4LJMA 1SQEA 1N32F 5A8WB 2OD6A 4OHWA 5IT4A 2K1RB 3SCIE 4X4SA 1AROP 2E44A 5DM7Q 3OT9A 3T6BA 2ALYB 5GAEU 2R8HA 5KT6A 4IOCQ 4IUFA 3GIJA 2KI2A 2FJBB 3HZGA 1YBUA 5IC6B 4PQUB 4FVCA 2FHMA 2H4YB 2AYGA 1LNQA 1RT2B 3KLVA 4I67A 1MG7A 4WP9A 1REVB 1BXNA 1HQEA 3AY0A 5CYQA 1L3VA 5HP1A 2KU7A 3G82B 2HNYB 2HHSA 2XMMA 2C28A 2DXFA 1DARA 3QGPA 4WK1A 1MN9A 2L41A 4EU0A 4MIAA 3IRWP 3CJTA 3PM9A 2SXLA 3Q8PB 1VBZA 3KK3A 3MCOA 3KHHA 3QLHB 3RRKA 2ZHOA 4NCBA 2V2VA 4RU9A 3CEDA 1S0NA 1R6VA 2U1AA 2OMLA 3W2WB 3CMAS 2Y1JA 3W5ZA 3HKZD 3K57A 3K89A 3D4JA 1RTDA 2F40A 5AE3A 1FJCA 2XSJA 1T3OA 1CC7A 4NLPA 4M94A 2WOMA 2MGZB 4ZVEA 3M32B 3BR8A 3CJQA 1XQIA 4TLRA 3V6DA 9RUBA 2PN6A 1NXIA 2XYGB 3M4XA 3CC7S 4YB6A 2DTJA 2DNYA 5IS2A 2JLFA 1UMJA 3AFGA 4IG3B 2OEMA 3BKTA 2ZBCA 1BQNB 2X1BA 3J80Y 4QU7A 3EPGA 4FPRA 3CJKB 3BO2A 4X62J 2J7WA 4C98A 1NB2A 1F60B 4CM0A 2MQQA 3RGIA 6AT1B 3PKMA 3K5PA 3MMCB 2EWHA 3D6HB 3NS7B 3HSZA 2KM8C 2M0GB 2EFGA 4NCGA 2FJAB 1EQ0A 1WKJA 1C0TB 3D3CJ 4JI5J 5LMUJ 2B5JA 5FD1A 4E8UA 2CQHA 3CJ4A 1FTRA 4ZITA 2J7KA 3CCES 4DV6F 3FFIA 2YX4A 2VG6A 2Z56B 3I82A 3GYGA 4JB8B 2CPYA 2FZCB 4LF5J 3NCQA 3SQOP 3CCUS 1RTJB 2VL1A 3KTQA 1F9HA 2WW4A 3GP9A 3QATA 5HQMA 3CCSS 4P10A 2HBRB 3OFGA 4EZ9A 4NXMJ 1VQOS 3CCWA 1PG5B 2W9BB 3IFEA 1YZ7A 4Y2MA 2ROGA 3I0RB 1PBUA 5D78A 3F0NA 5D4NA 1HQUB 1VQ8S 3P5TL 1Z2ZA 3Q86A 1RE1B 4A8OA 1MWYA 2D41A 2Z2MA 3BPSP 1TVRB 2Y1RI 4M5HA 2XLKA 2C2MB 1Y5LB 3CGIA 2Z57B 3PW4A 2EBEA 2KM8B 4KKOB 4L3KA 2DR7A 1S9GA 5DZ7A 4Q8FA 2BOAA 1NDKA 1TUWA 2D1CA 4Q44A 4LSZB 2ILYA 5THWA 2VBYA 2WW8A 1FRLA 4QYZJ 4YEAA 2FQQB 3MHYA 5KFBA 5HANA 3ZZPA 4K4UA 2XMVA 5C2GA 2OPRA 2GIFA 3LGNA 4ZP6A 2ZBRA 4QWDA 2OEJA 3LP0A 2QMXA 3D66A 2R7SA 3OTDA 4WCEQ 1SC4B 1IVZA 1I1GA 4DQRA 1VQYA 3W63A 4B9SA 4FKXA 3ZTOA 3KJFB 1T03B 1S1TB 2FVRA 2GW8A 3SSQA 3ET6B 4BBYA 3MTJA 4DX6A 3J7AN 3PIOQ 1FKPB 3TRGA 4I2QB 4NLYA 1FVQA 3TAMB 4G1PA 1S77D 1D8YA 2LCWA 3L7UA 2PFFB 1B99A 3QBCA 1B0PA 1SBRA 4C0HA 3NL0A 2UZAA 4CI0B 1EZZB 4C4WA 1FDAA 3GPAA 3MFHA 4KYZA 4ICLA 3P45B 3CDWA 4NLDA 3JYTB 1NKCA 2WB4A 2GHPA 3MD1A 4WXWA 1SC6A 3IRXB 4OJGA 2OKQA 1QUPA 2J6UA 1RABB 3UDEA 4P6QA 5C42A 2H1YA 2JVOA 3LTOA 5D4OA 2F4VF 4NOHA 2BACA 4EO8A 1LXNA 3GV8B 5F0UA 2DCUB 2OP5A 2QEXS 1X9WA 2ZZNA 5KG3A 1T94A 3HMJG 5D0EA 4JI1F 3RB4A 2IM0A 3MM9B 4RBVA 4GKKJ 2MLZA 2RE1A 2H9ZA 4USMA 1TK8A 2VFRA 3ONQA 4KH0B 2XZTB 1FI4A 1SKRA 2PSZA 2GCFA 1NZAA 3WX8A 1NJZA 1M1KT 1NM2A 1W7WA 2CNKB 5E7OB 3KHRA 2RAQA 2G9OA 4RNOA 1GNKA 3TO8A 4DSFA 1REGX 1S12A 3KLFA 4GRSA 2UVRA 1CJUB 3E8OA 1DLOB 4OYWA 4U95A 1VDHA 1S9EA 2HHPA 1T9WA 4NL5A 5HBMA 2M2BA 4DL3A 5E41A 1LWXA 1VRTB 3CD7A 4OZ0A 1UWAA 3D1OA 4PQAA 4NMLA 3HFKA 1HBNB 3QFHA 2KO1A 2UV8G 2YNGA 4DPXA 2MMYA 4B9VA 2FJEB 4QWEA 4WP3A 1UWBA 1YX2A 3LQVA 1PJ7A 4ECRA 1A6LA 4LF4F 4PEOA 1WD6A 1VQ7S 3VZHA 1E6YB 1H74A 2VQFJ 4B9LA 1RT1B 1S1UB 4DG1B 2DGQA 1VMBA 2MQOA 2UUBJ 1RTHA 1JLQB 4JI7F 3ETMA 1MU2B 1RU1A 1JNRB 2XY5A 2C1EB 1S1WA 3CJRA 5B7WA 4DLEA 3MZIA 4C0OC 4NMXA 4LRDA 1NO8A 1HQ2A 1UEVA 1T3NA 4DR4F 2HHUA 4KGZB 2XMUA 4C3LA 3HZEA 1H38A 1SIZA 2F63A 2I38A 1SH0A 5CAAA 1YIJS 2VHGA 1RISA 3J7A1 3UCGA 2CRLA 2V8DA 4OIXA 4G1QA 3MECB 2PEBA 2A3JA 2DCLA 4DUZJ 4JI8J 3Q8RB 3BEGB 3MUVP 1TKXB 2ZOFA 2M52A 2XHWA 4KGVB 4DSEA 1TKZB 2C3PA 3SQGA 4DFJA 3SV3A 2MZJA 1OY9A 3MXHP 4R8UA 1FJ7A 1UZHA 3MEDB 5M2RA 3GSIA 2DBBA 3T1HF 1Z2LA 3O6QA 4OMFG 3FGVA 3LWMA 4B3TJ 2W7PA 3GIIA 1IBKF 3FKBA 1PBAA 2N7CA 4LQ3A 2YNIB 4WWSA 2BJ7A 1WSRA 2EFVA 4ZJOA 3KLHA 3TUZC 4Y6IA 4ZN1A 5ETSA 1HNWF 4ED2A 2CQIA 2VB6A 2V4JB 2CJKA 2ZZMA 1CQNA 4DFMA 2H65B 5DQIA 2YNHA 1YI2S 4MFBA 2OPPB 4QJVA 1HKAA 2CDRB 3DHXA 4ED7A 1X5SA 4AYBD 5IM0B 2I2YA 3UR0A 4AXIA 3LALA 3CCJS 4A46A 4NA2A 3EZ5A 4KSEB 2MDAA 4ENOA 5I3QA 4F04B 3CJ5A 1ZAVA 1NH8A 4O3NA 5LSRA 1IWAA 2V2QA 4PPZA 3VWSA 2KG1A 3FEYB 5CXTA 3LW5C 2KTQA 3DOMB 4R5PA 4USJC 4YOEA 4M8LA 3RBZA 3M8ZA 3UD5A 1O0PA 1NZ8A 4M5GA 2E7WA 4N8NA 3M8RA 3OFHA 4DUTA 3C15B 2R7WA 2YQ1A 3FZBA 5LXRA 1ZM9A 1HNIA 3UD4P 4QYZK 3AOCA 1X8DA 1RT3B 2H51B 3M6VA 5ADZA 3MPVA 2JH3A 1CEZA 4DQQA 1Y5IB 4KO0B 1S6OA 3EVMA 3W62A 3QGGA 3OW2R 3JQKA 4KGMA 1IXKA 4CO1A 1AFIA 5DJBA 5KG1A 4RNNA 1X4GA 5D6GA 5HAOA 4N8OA 3HPOA 2B0GA 2BE2A 3L09A 4U7UD 4M63A 1MW7A 3HO1A 3LH2S 3OTOF 1YRUA 3M8YA 5IT9U 1C1BB 3P5BP 3TEGA 5KFRA 3M9NB 1CQMA 2UU9F 2XTJP 3WQPA 3BPDA 4K5RA 3TUJC 7FDRA 1KVIA 1VJQA 3C6UA 1UFKA 2IDEA 2UUWA 4MYUA 3GIMA 1U1LA 3D67A 1F1BB 1F9FA 4OYMA 2X1FA 2MXYA 2BJEA 2R7VA 3MWBA 1OS5A 4HACA 3OBIA 2RNEA 2W8KA 5EN1A 3IR7B 4O4GA 2K06A 2GJIA 3I5BA 1UW9A 3ZO7A 5F9NA 1WKKA 3B82A 3DFEA 3M8WA 1U6ZA 1BY9A 1WJ9A 5J1PA 4DR1F 4EK2A 1RQ0A 5B0CA 2FD2A 3EMTA 1S0MA 3DGPA 3U1MA 1PIEA 1SL1A 2G2OA 4X2BA 4DV7J 3QMQA 2J8AA 1S1VA 2AHOB 4LRCA 3ZNJ1 2DHSA 2QYGA 2RUGA 4NZ6A 5DG8A 1TL4A 3R5CA 1C4CA 1TZ0A 3RW6A 3HHLA 4F3MA 3DRYA 1NKBA 4ECXA 2LQ5A 5HN0A 4F4YA 5JXSA 1NU4A 2GIRA 1QAIA 2NZ4A 2FJXA 2DITA 1KONA 1HWKA 3GCWP 2PGCA 1QE1B 5GAGI 4B3OA 2V8GA 3DGVA 2HKEA 8RUCA 1X5OA 2XGQA 3VAHA 5D8HB 2GVZB 1RAIB 2Y8YA 2JC0A 5I3UA 3TA1A 5JVGQ 4UY8T 3B78A 3WZ0A 2VOPA 1KFDA 3I4HX 2HHQA 3ZTSA 2RUSA 4L76A 5DRKA 3VALA 3JQJA 3PXGa 1BE4A 3KLIB 3UE2A 5JVHQ 4F3QA 1JJ2R 4RW9B 3FRZA 2RQMA 1ZAWA 2J9CA 1WEZA 4BWJA 4MIBA 2JOQA 3NGUA 2ADCA 1RHKB 5CYJA 3TAQA 4B02A 1Q8IA 2CZ9A 3PKYA 3HHNB 5B09A 4I4BA 1Y11A 5T41A 3R8YA 4C48A 3KG1A 4LRAA 3DRXA 4DXLA 4ZVFA 5HMYA 1KLMA 3M8PA 1JJ4A 2VFSA 1N56A 1UZDA 4RW4A 2QV6A 1NRKA 2J0SD 2AF6A 3CULA 1N4LA 1NEEA 1LW2A 1CPZA 4DQIA 2E5JA 4HT7A 4S0MA 5EX3A 1RWPB 1CC8A 4X65J 3MR3A 2HBYB 4D3GA 4G1IA 3TARA 4F36A 4ZJLA 3NBPB 4XPCA 3Q8VA 1ZTTA 1SH3A 1NAQA 2RD5C 4DUYJ 2J8SA 5E5NA 3HVTB 2R8IA 3MMBB 3TWZA 5C2CA 1VBXA 4KHPF 4C8MA 4PAAA 2B7CB 1RAJA 3ETOA 2UXCJ 1FEHA 4FYDA 4IG0B 4PXBA 4NYPA 1S76D 2ZEJA 3T19A 3A3NB 3HKWA 3QIPB 3EWGA 3QWPA 3H4DA 1VJWA 1TKTA 3C2PA 4MKBA 3GCXP 1ZETA 4AQYF 5A8KA 1HIYA 3B4DA 2XQCA 2GAHC 1BWEA 4FF4A 3UNYA 3GTYX 3VAKA 1UJ4A 5AXLA 2E9ZA 5D3GA 3AH6A 4CLFA 4O0NA 3H2UB 4NRUA 1X4CA 1VC5A 3LOUA 4XIUA 5T7LB 4HDGA 1Y3KA 1Y00A 4FPIA 2XC9A 4RW7B 4P71A 4X66F 2OMOA 5J1EA 3DOKA 1RZMA 3PNIA 3FQLA 4L72B 1FK9B 4QW9A 5D0GA 3I5AA 5AJ3J 2HFOA 3BQ2A 1UVKA 1N33J 2VA3A 2GHVC 1U8WA 1KC8T 5CA5A 1GTEA 1JLFA 4PR6A 1KQSR 3DMJA 2WHOA 3UW1A 3IGNA 1FXDA 4P2MA 1LXJA 3I56S 3BSCA 4ZP8A 1U02A 1VRUA 3H59A 5GMKa 2W2OP 5HK4A 2UUCF 3BYRA 4DR5J 2DNZA 3PIPQ 3OSPA 3CF5Q 1AXQA 4ED5A 2WONA 4RW6A 5KFAA 1C0UB 1JLAA 1AT1B 2CQ0A 4B17A 1X0PA 4DL0C 4PQUA 2Q1LA 2VQEJ 4C8YA 4KV8B 4EGLA 2EFOA 2FTRA 4OL8A 3A8EA 3HT0A 1RT6A 4N5SA 2KXHA 1B4SA 2HNYA 4I1TA 2HMIB 3ENQA 2DNGA 4C8KA 3MGJA 3OV7A 2BDPA 3BH7B 5D0RA 3H2VE 2FZKB 1WF0A 1TL7B 3EGNA 4KE5A 3MPWA 1M5SA 2X1GA 1HWLA 3FQKA 4DF4A 1TQLA 2YWFA 3CCMS 1RYRA 3SCJE 4DR2J 2HNDA 3ILLA 4NLRA 4LSLA 2VBZA 3MM6A 4JYAJ 4JBCA 1WOPA 2ZH4A 3V4IB 1XMOF 3BZQA 1NHUA 2HHHF 2IRYA 2RRNA 2F8EX 2W2QP 1KEKA 4DL2A 3Q89A 2C3YA 4DR7J 3GG0A 2HS4A 3M32A 3BM7A 5B0FA 1CULA 2C2ZB 2EBGA 2R4FA 5D77A 5F3ZA 1S7IA 1U1QA 1WHYA 2F65A 3IR5B 4BLGA 5D4LA 5KFUA 4OI1A 2BANB 2M7SA 3GJSB 4KC5A 3OL9A 1RTIA 3NY0A 2QTWA 3CJKA 1Z1ZA 3ZZYA 2ZWOA 1PYTA 2VC1A 3HD2A 4DU7A 3OXFA 3HI9A 4Q8EA 2FLLA 2HK3A 3OL6A 1QM9A 2HVHA 1TK5A 2RMLA 4PG7A 3W64A 5KG0A 3EDRB 3A12A 3MM7A 2V68A 2QFIA 2ZC4A 1S6QB 1LWEA 4ZVSB 2Y0SD 1ZPWX 3IAS9 5KG6A 2ZM6F 4DV4F 4J9RA 2OIHA 4JI3F 4JI0F 1N6QB 1P6TA 3TVYA 4I6AA 2OTLS 4I2PA 2I5JB 4CLLA 3L7PA 2UXDF 3HM9A 3C14A 2E29A 3GLJA 5FLXU 3A3OB 3TZWA 4YB1P 4M95A 3DM2B 5IV3A 2HHXA 3WIVA 5J2QB 2JDJA 3ENWA 1FRIA 4X4QA 3IBFB 3JAMU 4O3PA 2GHWA 2DNLA 2C42A 1KOHA 4QWAA 4RUCA 1CJTA 5I42A 2W9CA 3N9UC 1X4AA 3ENVA 4TXSA 4Q7AA 4OYBA 3M30B 2F4VJ 2GQQA 4XAKA 2HK2A 1FRMA 3PO5A 4Q2LA 4KHMA 1ZOTA 3VAGA 4FXDA 1NK9A 1F2HA 3E2EA 3CUNA 1RADB 2O5DA 3CCVS 2OHDA 2O67A 4OFZA 5G0RB 1WC6A 4JI1J 8AT1B 3DLGB 3CJ2A 4LVOP 2VV5A 1M1HA 2JX2A 4DPUA 2Z0GA 4I6WA 2R2TA 3QT5A 2BZ2A 4ECSA 1NMEB 4R25A 4ZDNA 4FN5A 3KK1B 1XMQF 2N82B 1KD1T 4I2QA 4TNOA 3JTOA 1GK8A 1N8RT 1RDRA 1NH7A 1WACA 2XSFA 1OSCA 1XR7A 2EEYA 1RXOB 3G2XA 3K59A 4EUVA 4EBDA 2R7TA 3PEHA 2X1AA 2HW3A 3N01A 3RG6A 1SKSA 1LK7A 2ZH2A 1ZZNA 5KTQA 2CQDA 2XLIA 2NPIA 5GMEA 4IR1A 1G6BA 4EYIB 3O2IA 2BW7A 1UW4A 1QJHA 3H20A 1IR0A 4Z2XA 3LA0A 5L1LA 2FGOA 2FZGB 3BYPA 1UP1A 4NZ7A 2BQUA 4NASA 3OHBA 1T0TV 4UUWA 2VOOA 1WG5A 4RKUC 5FJ4A 2K2PA 1YJ7A 2RJZA 5GAHU 1KBRA 3KLGA 4JV0A 3PRDA 4IR9A 4PKDB 2E1CA 2QZ8A 4DN9A 1FF2A 4NLGA 3RB6A 3FSIA 1TFYA 1I5OB 2AQ4A 4I0WA 4B3RF 2VG5B 2G1DA 2VZ9A 4YB7A 1WTBA 2JHEA 1M5KC 2QA4S 4JV5F 3NCPA 2YNFA 2Q6CA 3QQCD 1FNOA 2GIQA 3Q8QB 5DLGA 3X3UA 4DCJB 1GTHA 4IFVB 4MYTA 2ZDOA 2KL8A 3JAMY 1Q53A 1CJKA 5M2UA 2Z2LA 5CHCB 5C25B 2W1BA 3KMQA 4CTAB 1EJ7L 3IM8A 2XMAA 2YWKA 6FDRA 4HKQA 2RQCA 1CSJA 4URGA 4F0KA 4DR4J 2LKZA 2YPZA 3C16B 1QAJA 3QAUA 5HROA 1EB0A 4HI1A 1T02A 5K8OA 5HQLA 4WF9Q 2GVDB 3UQSA 3DLEA 4USTA 4OI0A 1HBNA 4H4KC 3T1AA 2E5LF 4GMKA 2ZBIA 2CIMA 3JQMA 3R7NB 4ZS6A 4DSKA 3W60A 1EETB 4DEZA 3JS9A 4WFAQ 1RAOA 1HARA 2GGPB 3J7YI 3QO9B 1W2BR 1GMWA 4GO5X 5HI7A 2IVMA 1E6YA 4W4MA 5CZXA 1QY7A 4UTGA 1S1UA 4ECZA 3EZOA 2AP6A 3A13A 3T1HJ 2OFHX 4OHYA 3PRVA 5K14A 3I5CA 4CZCA 1G3OA 1QLNA 1B7YB 2OD4A 1IBKJ 5LJ5Y 2HQGA 1IKYB 1OYDA 5FDLA 3KJVB 1JK9B 5L9NA 1S9FA 3I0SA 4M5MA 1PKUA 2ALZA 1H3DA 3ELHA 2J9EA 4WE1A 2CQBA 2JFDA 2QE5A 2R8GA 3MMAA 2B3TB 4LBIA 3THTA 2OAUA 3CB4A 5E3CA 4BC7A 4OJ1A 2ZHBA 1TL5A 5F8LA 1VQPS 4XDCA 4USHA 4B9UA 1WNEA 2L3MA 1Q4RA 1WI8A 1U09A 2MTLA 2CPZA 4IFYB 2BJ1A 2UVUA 4LFBF 1TKXA 1X5PA 4NE9C 4C9DA 1FKOA 2ZUAA 5AXMA 4NX9A 2EG2A 4MH8A 4D3HA 2DRAA 2AZ1A 2HG4A 4NYZA 3FBCA 4Y2AA 4J7CA 1ZS6A 4KAIA 2FLPA 2WVCA 4KHRA 3EZUA 1VYAA 2CPJA 1X4EA 2HRUA 3OHAA 2UXBJ 3G4SS 2NXCA 4PZVA 4ETZA 5LSLA 4DX7A 3DI6B 3V81B 5RUBA 3UR3C 3R5GA 4YN3B 1TFWA 2K3IA 2KRBA 3MM5B 4DSIA 1Y4ZB 3AD9C 1U1PA 4XO0A 2OPPA 2XMWA 3QSYB 1R31A 1QDUB 2MKJA 5SZTA 2CPFA 4OJHA 3FEXB 2PO4A 5IM0A 2V4RA 5H9FJ 1UJ6A 2JJ4D 4YQWA 1HNXJ 4N77A 2V63A 4LF6F 3G6VA 1KQKA 4ZVOB 3OTOJ 3KNGA 2DH7A 1OPIA 3C46A 1SVDA 1C4AA 4K4VA 8ATCB 4CYUA 2X7IA 4FBUA 2MKSA 3Q83A 4FNHA 3GFHA 3DOMA 1TV6A 2EI5A 2UVVA 4PYAA 2DNNA 1R8PA 2NUHA 4KB7A 1F5CA 3I9V9 3R7SB 3C15A 4ZA1A 2CJXB 1C1CB 2BABA 3IXQA 4DPYA 4K2XA 3QGHA 4K4SA 3NLCA 3BKUA 4NLOA 4CWBA 4GVBA 3KK2B 2ASJA 2VPWB 1AYEA 5HVFA 4IRCA 3FCHA 2W7OA 4RPFA 3J7YU 1RA7A 2GX8A 1T7PA 4ID5A 2EPIA 1Q7LB 2PIIA 2X3GA 4EI2A 4Y2CA 3LP1B 3OL8A 5KFYA 3D54A 2O66A 1Y9OA 4IQXA 5IOLA 4OYAA 5DDRC 3MURP 3OXGA 4B9MA 1FXRA 5BJRA 1EKRA 1U48A 1ZM4A 1SB6A 4C3KA 2NXNA 2NREA 2EKYA 2Y0BB 3EJMA 1VCTA 3PCOB 2LXIA 3SCKE 2ZH7A 4ZVTB 1ZYQA 1NPRA 2E5IA 3OR2A 3AQPA 1EAYC 1M5OC 3CXCR 1MMLA 1WC3A 2JLGA 5KFIA 3D3BJ 4X4UA 1T9TA 2Q3PA 1N52B 3KJNB 1WOSA 3RUBL 4RU2A 2O1PA 5A0YA 2ZZTA 3B4MA 3H5UA 2FB0A 1NK4A 3RBEA 2J6SA 3K58A 1VBYA 1LW0A 3MEEA 3IP0A 2QL7B 1YRTA 3CNQP 3HCXA 1D9FA 4ES1A 4NI2B 5DG9A 4P9SA 4F4ZA 3V4MA 2QGFB 2FLOA 2HZAA 3SFUA 4DV5F 1F9EB 1X4BA 2Y1LB 3GJRB 3RYLA 2COLA 2G13A 2FC8A 5LMNJ 2BW2A 4UUXA 4QPXA 3BN4A 1FCAA 2AJ0A 1E6VB 5J2PB 1XR6A 2IAJB 3POTA 2ZC3A 1V6HA 3PHTA 1DQ9A 2QRRA 5J2MA 5KFXA 2D3OR 1R0AA 3EGVA 4DQPA 2QMWA 4MK7A 1VQ4S 2MKCA 3KLEA 4L6V3 1ACMB 1GT8A 5HSPA 1EP4B 1SH2A 5EUHA 4B3SJ 1OQ3A 1IJFB 1I94F 1VR6A 4NLUA 2OPSA 4ETXA 5E3QA 3DC2A 4F3OA 1IR2A 1U2CA 2MYFA 4X4NA 1HNZF 2AJFE 4OI6A 3QAEA 4FS1A 1FESA 3AXMA 2B51A 3M2UA 3ISNC 2HFNA 2ZITA 3SSRA 1TAQA 1Y3JA 3DHWC 1VQKS 2VICA 1XNRF 2CFXA 3DRSB 2KDOA 4LRFA 4LSNB 1J5OB 4TYAA 3IA0A 1JLGB 2QL5B 3VVUA 4DV2J 3PTWA 4PG8A 3R5BA 3FCWA 4J9QA 3R1HA 5HMZA 3M2RA 4WPAA 3OLAA 1D9DA 2XBPA 4K7QA 4B3MF 3R2DJ 2NSCA 4WIIA 1SXLA 3UO0A 1Q5YA 3DKDA 2KT2A 4EBEA 1HQEB 3DOLA 3MCSA 4M5LA 4ZLPA 4TVAB 4OZJA 5CYQB 5HP1B 3BBBA 4X66J 3PR5B 1HYSB 3OL7A 3ZZ0A 2V2ZA 5E3PA 1X4DA 3VCDA 2FUG9 2YKNA 3CCQS 4HDHA 1QSSA 3HVTA 2KH9A 3KDOA 3VHQA 2EFQA 3MMBA 3KK3B 1L3TA 2OJ3A 1RYSA 2PFDA 2AEFA 1FHTA 2MKKA 1TUVA 4OYZA 3BBFA 3T9NA 4IG0A 1QVFR 2UUTA 1PJ6A 3QGIA 2HWTA 1VC6A 4QQBA 3MOJB 2B6AA 1RTDB 2XSJB 4KT0C 2FIUA 5HJXA 1RHQB 3M6UA 4DPOA 4ED1A 2UUCJ 1GMVA 2AJ2A 3KWMA 4JI2F 3CIZA 1N5YA 5KG4A 4CT8A 1FFWB 3PV8A 3ISZA 2X3DA 3EUNA 3DN9A 4WFNQ 2VFUA 3BGRA 3F73A 4C6AA 1WELA 5T7LA 3P6YC 2DD8S 4QIVA 1SJFA 1FFSB 2XM3A 3LWLA 2AW0A 3CMES 3WDOA 1ZPVA 4ED6A 1VISA 2EFPA 4TU9A 5LJ3Y 3D6TB 3RAMA 3TUPA 2WVEA 3DRRA 4UY85 2JRSA 3R2CJ 3PO4A 4K4WA 2BXJA 4CO3A 4HYKA 4YP3A 4A8WA 4HH0A 4F26A 3OJUA 4NCGB 1UVJA 1U4BA 4URQU 3SZ2A 2B5JB 3ZTPA 3JSMB 3FZ2A 5KFQA 3GR0A 2YKMA 3FFIB 3IR6B 3KHGA 2VG6B 1H7XA 1DZ5A 1XMOJ 1JLEB 1PGZA 3ZZRA 4W90B 2VG7A 2HHHJ 2DNKA 5GADI 3Q2TC 1QD1A 3THVA 2V6AA 1Q1KA 2NZCA 5F8MA 2I9SA 4ATNA 4EEYA 4H4OA 1GEHA 1KDNA 3O3LA 3S8SA 4K4ZA 1N0UA 1HFEL 1G1XA 1K47A 3BO4A 3QPIA 4M5DA 3BF4A 5KFHA 1WDTA 2MKYA 2YX1A 5EHHA 1RTZA 1OMSA 2ZH1A 1IN0A 2QLWA 4ECQA 4FVMA 4Z7CA 1WC1A 1UPPA 3HDSA 5LM7E 4ZHRA 1U1OA 4V1Ak 1YLXA 2C2KB 1X31C 3BGOP 4USWA 3RBXA 3U02A 3HVAA 2MLYA 4X62F 3HFZB 2MQPA 1S9GB 3TVKA 4OZ5A 4KPYA 1NSQA 4OZNA 2AWZA 1YJVA 1OYEA 1TL7A 4CT9A 4K59A 1RB0A 2OPRB 4IRDA 3TA2A 3LP0B 5KFEA 3CPWR 4HH1A 4AL7A 1Q79A 3SBMA 3IM9A 5U47A 4ZK7M 1YK9A 3PG9A 1VQNS 1DHMA 4F2SA 1WDDA 4DV4J 2ZNZA 2HIQA 3W66A 2ZD1A 2GV1A 4JI3J 4DZ6A 3GYXB 1Q95G 3I31A 1UFLA 5LXYA 2UXDJ 3H0PA 1OSDA 4FF2A 3TW0A 4RUBA 1R8CA 3FCVA 2XWYA 1VGYA 5HO4A 3F44A 1HNVA 2R7XA 1TU0B 2D74B 2W2NP 1LWFA 2HNZB 3VF0B 4ICLB 1HPZA 1TL3B 4ANDA 1PYSB 3DRPA 2MLXA 1FKAF 2CZVC 2HQCA 2YH0A 2R8JA 1XK8A 4KGKA 2V9KA 2ZE2B 3MR6A 1O8BA 4IO1A 1RWUA 5BYRA 4WZQA 5IWAJ 3J7Z5 5J2NA 1VRQC 1NKEA 5KFVA 2DRDA 2VC0A 2Y8WA 1QTMA 1YWXA 2KVQE 1S0VA 1FX2A 5BYQA 3V2UC 2J5AA 4TY9A 2JLEA 2XB2D 2CPDA 5F41A 2HVDA 1CS4A 4DN0A 4DZDA 4LT6A 1UETA 4FYYB 4XDDA 3OLBA 4Q0BA 5F0WA 1RT4A 5CYMA 3OQ2A 3KG0A 4YHHJ 4F25A 2GA7A 1XMQJ 1KTVA 1Q7YT 3NAHA 2I5JA 3KG4A 2GMHA 1X60A 3MUTP 2ZKUA 2I1RA 3GB0A 4XPEA 3JXOA 1RA6A 4QIWD 2BBEA 3I55S 2MPUA 1ROFA 3JSBA 4WJBA 5J2QA 2M4MA 4FS2A 2Z30B 2DR6A 1CLFA 1R7IA 3PYFA 4FKYA 5GADU 3OR1A 2V94A 1RLDA 3GFYA 3ILOA 2MQMA 2QSFA 3MCNA 5HVHA 1FDBA 1WF2A 2QA2A 2QMUB 4QW8A 2W2PP 2RHQB 1BQMA 5E2QA 1S9EB 3T5JA 2HLUA 2YKAA 5HBMB 1A9NB 1KFSA 4M5IA 1P9QC 2XS7A 3DLHA 1JLCA 1D09B 1FXLA 1OQ6A 1VC0A 4B9NA 2XY6A 3MR7A 3T5HA 3DLGA 2HHTA 2YNGB 4CLUA 2MZQA 2CVIA 1UWBB 1D9AA 2W4DA 4LBPA 4PWDA 1XN9A 3KK1A 2CXEA 3SIPB 3OTBA 2QLFB 2VFVA 4EYHB 1PYOB 4QBUA 2KZZA 2E5HA 1B70B 3PX6A 2XZDB 4Y65A 2OGUA 1U24A 4JOUA 2LYVA 2VD3A 3KDNA 4CH1A 3TJ9A 1NPKA 4H54A 1VQSA 2XEXA 1HBMA 1RTHB 1DRZA 3LPEA 4OX7A 3GR1A 4R0EA 1Q8KA 3ADAC 1S1WB 3SI8A 2NYIA 3PW2A 4TY8A 4HHJA 3DLKA 4FF3A 1SUQA 2LLZA 3DDKA 4Y34A 1KSPA 1SJ3P 3G6XA 2G0JA 3H42A 1ZH5A 2P8IA 2Q6BA 2F7VA 1SJQA 2UUAJ 1JX4A 2CG8A 2AX0A 5A2QU 4CO4A 4N56A 1UVLA 3KKFA 1IBCB 2I6WA 3M1VA 4DDFA 1APSA 1JJCB 3U27A 3OPKA 1UCNA 2E5LJ 2ZDPA 2XS2A 1U45A 4G1QB 3QT8A 2NSBA 4N41A 3MF5A 2APOA 4QWBA 5L1KA 1LK5A 4H4MA 2IMWP 2OLWA 2MY7A 1S97A 4W98A 5CD4H 3ISND 2VQFF 3H40A 2G0IA 4CNZA 2VDHA 1XJWB 3BGLA 3MEGA 1V5IB 4R8UB 2W4CA 2AYEA 3VAMA 3DLBA 1SCJB 2NLWA 3FVYA 2FJVA 1NB7A 4CNYA 4QU6A 1HMVA 3H2LA 5L38A 3UDLA 6FD1A 3RW7A 3T1YF 2BJ3A 3KLHB 3UVJB 2VJUA 3V5RA 1O51A 1RKIA 4RUAA 1KRPA 7FD1A 2YNHB 1UJ5A 1VQ6S 5E3AA 4C3MA 3BSNA 2HRTA 4MFBB 3K7RA 2P6SA 3VQSA 2RH3A 3R5JB 4JI4F 3NS5A 1VIOA 3P49B 1PC5A 2FHJA 2F1FA 1UVNA 1CJVA 5C7PA 2L9NA 1SI9A 2E7VA 2R2RA 1KWMA 1U1NA 1WC0A 3IG1A 4CIOA 3D0HE 4AFFA 3TVZA 1SV5A 4ELUA 4JP8A 4DX8H 4LFBJ 2KB2A 2GZOA 2RF2A 4KFBA 3AJ1A 1AZSA 2GGPA 4R5PB 3G87A 4C7QA 1B0VA 4NLWA 2A0FB 5LOQA 2MJUA 3H25A 1I6JA 4TQSA 5BR8J 3T41A 4BC9A 3V6JA 2WK4A 4B3TF 1PJ5A 3CJ8A 4M5NA 3AB4B 4KGXB 1DFDA 1VHFA 2O3DA 1FRKA 1MROA 1WG1A 2CQGA 4X84A 3QRRA 2V8PA 1IKYA 1CG2A 3U1NA 3HXMA 2DR9A 4QWCA 3QT7A 2FGCA 3OUYA 2B7BB 2MZTA 3TZZA 4F4WA 3W2VA 3OTCA 3NEKA 4DL4A 5JMNA 3MR5A 1ZAXA 2FJWA 1NSAA 2D7SA 3G8TA 2ILZA 5B0EA 1JXEA 1O6XA 2QG9B 1T05A 5A2QY 1UVIA 2BE2B 4DR3F 4I64A 2DHHA 1EIYB 5JUMA 2FYXA 4PG5A 4F4AA 3IWLA 2JC1A 3H4BA 3GIRA 4O3RA 4WFZA 4ALZA 2FPHX 1NK6A 4OLPA 1YTYA 4LF6J 2WBRA 4DR6J 3VVTA 2IA0A 2HAIA 3T9ZA 4UQGA 1U6BA 3BH6B 2AGPA 4ELTA 3MPDA 4DV1F 4K0KF 2R2UA 3C6UB 4N7TA 1PAUB 4WBFA 5ETQA 5KOWA 2HGNA 2B43A 1VFJA 3NWGA 4P7TA 3HHLC 2DKOB 5KFZA 3TQ1A 4LF8F 4XK8C 3BSOA 2ASDA 3D0IE 4MKYA 1SJ1A 4CP5A 1YQHA 4PXEA 4USIA 2BQRA 1RLCL 1HHSA 1UL3A 3A8IA 5A8RA 5AE1A 3NNHA 2FVSA 4NEZA 2HFZA 1RAEB 4GKJF 4NLQA 4TQRA 2WZ1A 1PAEX 2M70A 3MM5A 3D6MB 5D15A 3Q8SB 2B9EA 2B9YA 3O1LA 1MN7A 3DGPB 3K2YA 3ILJA 2WSFC 3EXCX 3Q24A 2IBKA 1Y0HA 1S1VB 1QSYA 3BQ0A 4LMZA 1NJWA 4BDPA 4QR0A 2R8KA 5DO2A 2PMHA 4QOTA 2PD1A 2IYGA 1IQTA 1L3UA 3HHLB 2QFJA 4OZ3A 3WBZA 1DTTB 1ZM3A 1RWVB 2P9EA 2DO4A 2DGVA 1S6PB 2VUGA 5EWFA 1TK0A 3GSDA 3VTIA 4ED4A 3FBEA 1HA1A 3CO0P 2LU1A 2HLTA 3JSRA 3KYLA 5I3UB 1JIHA 2CADA 3W9HA 4IQMA 2RS8A 3FBBA 4DPWA 3K5NA 3ZFVA 1YJNS 3C8YA 1YJUA 5KT3A 1FRXA 2V4QA 1RBLA 2KG0A 2R7UA 2AV5A 1S59A 3D9BA 3CJSA 3K8WA 2L9WA 2EC2A 5L39A 1EQMA 1YZ6A 1XERA 4LQ9A 3MM8B 3OVBA 2OH2A 4IRKA 2VJVA 1IKWA 1ZM2A 1IBMF 3S01A 1UEKA 4IDKA 3PW7A 2WSEC 2IRXA 4J9UE 5GAEI 4DMZA 3HSDA 4WFBQ 2R9LA 3AA9A 4CLTA 2JEIA 2W8LA 1JWWA 2CWXA 4MMOA 2W4PA 4ILLA 5FIIA 4O0IA 1BC6A 3TI0A 3Q8YA 1YG0A 4A8YA 2N7YA 3C6TB 2LXFA 4CQ1A 4NLSA 1RT7A 1RT5B 1KLMB 3M8PB 2DR5A 4DCPB 2EK6A 2MQ8A 1OPZA 3IS9A 4LF9J 2LQBA 5KFFA 4ZLNA 4QYRA 1RBOB 2C3MA 4RNMA 1VQ5S 1S57A 1S1XA 4NA1A 3BO3A 4V19X 5D4PA 3QT6A 1JLBA 1LW2B 5IZHA 2BVZA 3HLUA 3DYAA 3H5YA 2AJ4A 2OPQA 5IQQA 3NXZA 2FDNA 2DNHA 3LP2A 4DWIA 1K1SA 3M8QA 2LEPA 4JI6F 3HVWA 1HNZJ 2XMTA 3EDQB 4KTQA 1S4FA 5G4DA 2CA9A 2EKNA 2MZSA 2EVZA 1CVJA 2AEMA 3IAM9 1X0FA 1KVJA 2CPHA 4WFXA 4NYOA 3QZ8A 3VV2B 2NXJA 1OY6A 3I4PA 4NI2A 4NLXA 5DQHA 4HHUA 4A8MP 1NSKL 3P3DA 4ECWA 3N5BA 4CLWA 1AUSL 1MWQA 2M9KA 4RBUA 5HVGA 3L3CA 4ZCIA 4P7VA 1TKDA 3TZYA 3G9CA 1H72C 3AB2B 3GZ7A 2PMZD 2E1PA 4HTJA 3GWCA 5HLFB 2IAJA 2XNQA 3OTEA 4A8QA 1EHWA 3UN5A 1IBLF 5EX0A 2XI3A 1X4FA 1ZA1B 5D3GB 4DF8A 4JV2A 3OFEA 4ZVUB 4RZRA 1LFPA 1EP4A 4ZPWR 4C8ZA 4C11A 2VDIA 3MD3A 2Z4PA 2IVYA 2B4UA 1FTCA 2ROEA 4YY3F 5AT1B 4G3IA 1GFWB 2Y1IA 2BA9A 5J1EB 1F2GA 1H73A 3DOKB 2AU0A 1RWXB 1U8SA 1X9SA 2FVCA 1AB8A 3KOAA 2DISA 1H98A 4DUYF 3P96A 2BJ9A 5EGYA 1FRJA 2P9GA 2HQDA 2XY7A 3CT9A 1JLFB 1B3TA 2UXCF 3DMJB 1DBDA 5KG5A 3AD7C 3ZXWA 3AT1B 4U7CA 4TYBA 3M9MB 1T9UA 2HVEA 3NGTA 4DL5A 4GO7X 4C2MA 4PUOA 2KJVA 5B08A 4P2SA 3UFCX 4E98A 2IM3A 1VK3A 4I68A 4WTOB 1YHQS 2BX6A 4KIAA 4LFCJ 5K8MA 4ILMA 2YX7A 2DO0A 4ZP7A 2WONB 4JI2J 1UPMB 1WHVA 4RW6B 2O01C 2HGMA 4E0DA 2KFNA 3Q23A 5KFSA 2HFVA 1JLAB 5KT2A 5KFTA 3KUHA 3N6MA 3E01A 3VAFA 3RJMB 2HZCA 1T8EA 3QRQA 4RWXA 4DV3F 3OXLA 4FXWA 5A6WA 3D0GE 1UA0A 2HRYA 4A8KA 4EZ6A 4MKVA 3PDNA 5IXUA 1RT6B 3J81Y 2Y9HA 1HYSA 5JJBA 3CD6S 2POKA 4EMDA 4JV1A 2HQIA 5AJ3F 2CJYB 4WYLA 4DPTA 3W8PA 1ULRA 1L5UA 3CCZA 3CCRS 1N33F 2MKIA 3SDEA 3JTPA 1NSPA 3DU6A 5CH7B 5CZVA 5F8HA 2HNDB 3KUGA 4LSLB 1J5EJ 1U0HA 1SC3B 1S48A 3MM6B 1RHJB 4L73A 4O3QA 4HTIA 1TL1B 4K8RA 2HBQB 5AXNA 2ATLA 2OTJS 4DR5F 2MY8A 2CZ4A 1YITS 4I7FB 2B4OA 2D69A 1FVSA 2N3OA 4NWBA 1CULB 5DDPC 4RUHA 4PABA 5DZ6A 3RB0A 2VQEF 1D3WA 2WSCC 4M5KA 3CCLS 2M8DB 2V69A 2J6TA 1KHWA 4DSJA 4WTYA 3R6GB 5K5MA 3EYZA 1RTIB 2AJ1A 5ETRA 1N32J 3ZC4A 4DV0F 1HBOB 3PJ9A 3DCAA 1M5VC 5ETOA 2RQ4A 3ZZTA 5F8GA 5ETNA 2L08A 2KYZA 1NCLA 3C66A 4C8LA 4MTPA 2QA4G 4HI2A 4YFUA 3GYNA 3IWNC 1WWHA 3M05A 4DR2F 3BV8A 1RI7A 3MM7B 4JYAF 2HEKA 3M9OB 3R7BB 4AT1B 3ITHA 3JSMA 3QSIA 1Y7PA 1LWEB 4X64F 1SQFA 1FWPA 4O3SA 1JLEA 3UWTA 2I0XA 2V50A 2HWHA 2I8EA 5GAGU 2HPUA 4O44B 4DR7F 4CH7A 2DNOA 4I2PB 3HK2A 5KFGA 2YWGA 2V8VA 2JWNA 3NS6A 2DXDA 4RW8A 3C14B 2WVDA 3BGUA 3IBWA 1ZTWA 2IM1A 3A4TA 4DS4A 4QIGA 3I96A 1FJGF 4LIRA 1UTAA 3WC0A 2KXFA 2ACMA 1TR0A 1HBUA 2EK1A 2H54B 3ZNUA 2BE7D 4Y00A 2LU2A 1S6UA 5A8WA 1URNA 1EARA 1OJ4A 2K1RA 2MZ1A 1CJTB 5I42B 2DVIA 2W9CB 4EFAC 4QPTA 4J9VA 5BXIA 3I87A 2RU9A 2K7KA 1Q16B 3BN7A 2W7AA 4KPCA 2B9XA 3RB3A 4GVLA 2CDQA 4XTTA 1RT2A 2VODA 1IKXB 3HHLD 3PW0A 2PEHA 1FDDA 2BE9B 1U6FA 4DLGA 4A8SA 1REVA 4ES3A 1MWZA 2C2EA 4AXJA 3G86A 3AOBA 1FX4A 3G82A 3M2VB 5MLCV 1WG4A 1T9YA 3MMJA 5ETPA 1FE0A 2CYYA 3ZZOA 3SCLE 4IKAA 1IQZA 1Q8LA 2CNLB 3N28A 1SC1B 1NPPA 3PRBA 1HD0A 4M1KA 3QLHA 3NGRA 2QLBB 3ZZZA 4O23A 4J9PA 2P6TA 5LL6d 4MK9A 3W2WA 3L4BC 3TJ8A 4ZLJA 1QUVA 4DV6J 4FXVA 4MT1A 3IMQJ 2HNZA 2DB1A 3PX4A 3TP2A 1TL3A 2G4BA 3CW2C 3IN5A 2QJ3A 1KR4A 2MGZA 2FY8A 2CQPA 4RO0A 2NUUG 2F3JA 4LVNP 2ZE2A 2OI2A 1NNDA 1ICEB 3ULHA 1AA1B 5K20B 5B0GA 1NK8A 4IG3A 2BUNA 2W2MP 3T6JA 1BQNA 3CDAA 4KQZA 2XS5A 3N79A 5H1SV 4UOHA 4J90A 5KFOA 3KLGB 4ZCKA 5L8RC 5KAKA 1RWOB 2AKWB 1YJTA 2GJ2A 1R8HA 3QRPA 1XNQF 1YRXA 3MMCA 2B4VA 4Y3CA 3NMRA 2QIFA 3N5FA 1Q5VA 3W7BA 3K0JA 2VBXA 2YKPA 2CWKA 4F0MA 3FBFA 2XMJA 1C0TA 2HGLA 4IH7A 2CAJA 2YNFB 1WEYA 2Q79A 3RRGA 2HFUA 1RBAA 4ZVQB 1K0VA 1K44A 4ZPBA 1ELOA 3BKFA 1U26A 4QIEA 5HJYA 4J9MA 4J5OA 1CJKB 4LF2A 1RTJA 2ZH6A 2ZVSA 2CJ9A 2RSQA 4OI2A 4PWUA 2KFYA 2M88A 1JB0C 2DIUA 5B0AA 1HR0F 3M6WA 3J81j 2W9BA 2C2DA 3I0RA 1KVKA 5HROB 1HQUA 3CWJA 4FF1A 1TVRA 3DLEB 4QZVB 2ASLA 2F8MA 4BS2A 4CO0A 1NK5A 3MAAB 5CQGA 2K3KA 3FSYA 4KKOA 4CLSA 1DQAA 1LV5A 2PDAA 4CLYA 2WCXA 1UAWA 3FK4A 3BDEA 3ZTQA 3MAQA 3NGKA 3P8BB 1VBKA 2J0QD 1J27A 1VLYA 2YY3A 2BOPA 2W9AA 3OVAA 3PFOA 2IVFB 2KN4A 3PYEA 1R8AA 1BGXT 4L75A 1RKJA 2HYIB 5DGAA 5K14B 1T03A 1S1TA 2U2FA 4P75A 1YVFA 3CD5A 3ET6A 5B0DA 4QR2A 4UT4A 1FKPA 3V6HA 1FD8A 2H3EB 2XG8A 5FDLB 3I0SB 1SJRA 3TAMA 1DTQB 3ZZUA 2AZ3A 3T1YJ 3H8YA 2CPXA 1T95A 1JXLA 2ZNYA 1UVMA 2DIVA 2GQCA 2AIRB 4WE1B 2A18A 2AYMA 3MOZA 4OYIA 1WTFA 3MMAB 3LF0A 4J9LA 3K5OA 3HJVA 4ZCLA 4CRJA 4UQTA 3JYTA 4JI4J 4ECTA 2C3OA 4DI6A 3IRXA 2HIYA 4QR1A 3PR4A 4LFAF 4UZCA 1QSLA 2BJDA 3B54A 2J9DA 5C24B 1M5PC 1GXTA 1GXUA 3Q8UA 3Q2SC 4FDFA 4DSLA 1FKOB 4YR2A 2DEIA 2AGOA 2KZMA 4ILRA 2VPYB 3NP5A 4ZPCA 2XHCA 2G0CA 1BUXA 2PMWA 4OV1A 2MJNA 1FWKA 3MM9A 2OEKA 2RQKA 4CLZA 4NLTA 2Z2YB 1YJRA 3BGFA 2RDIA 5KFKA 5A76A 1T9XA 2OUGA 4EO6A 4NLVA 2XLJA 4QIFA 3UVJA 4LF4J 1V3RA 2IC3B 4Q43A 2IY5B 4WZMA 2HHVA 2FHKA 4X4VA 2IRUA 2D3UA 2XCAA 4JI7J 2GFFA 2KVIA 4J91A 4OYPA 3A1YG 1QAXA 1N34F 4DR3J 2RVJA 1CJUA 4UF4A 2ATCB 3HD1A 4P2XA 2RDDA 3RZAA 1IJEB 1DLOA 5HATA 2BR0A 2D3O1 1MMNA 2BM0A 3PJXA 5KT4A 5IQ6A 3PHEA 3O5TB 2DH9A 4CYUB 5MAOA 4PYDA 3AXKA 4NA3A 3TEHB 5B0BA 1TV6B 2MB0B 3TZXA
chains in the Genus database with same CATH topology
4ECYA 5GMKa 1BQMA 1VRTA 2KT3A 5E2QA 4U9RA 4DL6A 1S9EB 4WXOA 3UNGC 3T5JA 2UUCF 2HLUA 3KK2A 2DNZA 2YKAA 4J9KA 3PIPQ 3OSPA 2ZH8A 5KFWA 5HBMB 2UP1A 3CF5Q 1AXQA 4ED5A 4WKRA 4PUOB 3RTVA 1A9NB 2WONA 1V3ZA 1KFSA 4OX6A 3EPIA 4RW6A 5KFAA 1VS3A 1P9QC 1N5TA 2XS7A 1C0UB 1JLAA 2CQ0A 3DLHA 4B17A 1X7VA 3NAIA 1X0PA 3SXLA 1JLCA 4DL0C 2XI2A 1FXLA 1HHTP 1OQ6A 1VC0A 4PQUA 4ZP9A 4B9NA 2B9WA 5E33A 2XY6A 3GMGA 3ICLA 2Q1LA 2UXBF 3T5HA 4C8YA 4KV8B 2IYIA 3DLGA 3KMSA 2HHTA 4TN2A 4OQJA 2QYCA 3LP1A 4EGLA 4ED8A 2DGXA 2NS1B 2JSXA 2ASYA 2EFOA 2YNGB 5E0OA 5LT5A 2MZQA 4B08A 2FTRA 4OL8A 2CVIA 3A8EA 2AD9A 1HW9A 1D9AA 1UWBB 2W4DA 2AGQA 4PWDA 3E01B 1XN9A 4ID5B 1U7LA 1RT1A 3DXSX 1UEUA 3KK1A 3NKYA 4DV7F 3MEKA 1RT6A 3OTBA 4N5SA 2VFVA 2KXHA 4EYHB 4DG1A 2HNYA 4QBUA 4TKTA 4Y0FA 2KZZA 3GV7B 2E5HA 4I1TA 3BB5A 1RK8A 2HMIB 1JLQA 3ENQA 1MU2A 1FE4A 2DNGA 4Y2IA 1KS2A 4C8KA 2EFNA 2DNPA 4FNIA 3PX6A 3AHPA 4Y65A 2NQPA 1U24A 4JOUA 3MGJA 2LYVA 2VD3A 1JKHB 4CH1A 3WC2A 3OV7A 2BDPA 4CO2A 3H2VE 2ERRA 3CC4S 2BRLA 1LWCB 1VQSA 1FO1A 2VFTA 1WF0A 4H54A 3EGNA 4F2RA 1IM4A 2JL9A 2XEXA 3MPWA 1M5SA 4KE5A 2X1GA 1HWLA 1H2UX 3HJFA 3FQKA 1HBMA 1RTHB 4DF4A 3CJ3A 3CCTA 1HNXF 1DRZA 3TANA 3I9ZA 1TQLA 4OX7A 3GR1A 4R0EA 4A47A 1URRA 4RW4B 2YWFA 3CCMS 1RYRA 3SCJE 2MHEA 4ECVA 3HT3A 2HNDA 2FHJD 4NLRA 4LSLA 1S1WB 2VBZA 3MM6A 4JBCA 2ZH4A 3SI8A 2NYIA 3V4IB 2NPFA 3SDEB 3PW2A 4TY8A 2WBMA 1XMOF 4HHJA 4WKYA 3DLKA 2LXUA 3GV5B 5T14A 3BZQA 4FF3A 1NHUA 1SUQA 4K4XA 2HHHF 2LLZA 3QYYA 3DDKA 4Y34A 1KN6A 3NNAA 2IRYA 2DNRA 2YH1A 2BYCA 1KSPA 2RRNA 2F8EX 1SJ3P 3G6XA 1KEKA 4DL2A 3PY8A 1XWLA 2C3YA 4YMEA 2W25A 2RB7A 5EWGA 2GO8A 3GG0A 1U1RA 1ZH5A 2HS4A 3M32A 3Q22A 2Q6BA 3BM7A 2F7VA 1SJQA 5K9FA 5HMWA 5B0FA 1JX4A 3CDUA 2QO3A 5F9LA 3V6KA 3GG1A 2OSRA 4PCQA 3OR2B 3MECA 4WU3A 2AX0A 4N56A 4CO4A 1R43A 4LFCF 2EBGA 2R4FA 2UV8A 3KKFA 5D77A 3E51A 5F3ZA 1U1QA 1UVLA 1WHYA 4QCLA 4YDXA 3M1VA 3IR5B 5D4LA 4DDFA 1APSA 2HWIA 5H9EJ 2C22A 2DGUA 5KFUA 5L1JA 3U27A 4YR3A 4OI1A 5I3PA 3OPKA 4IH5A 2ZDPA 2XS2A 1U45A 4G1QB 2BANB 2JVRA 5A0YB 2M7SA 4KC5A 1M0SA 1TKZA 4NXNF 2NSBA 3OFFA 1N5VA 4N41A 2DNQA 3MF5A 2APOA 1BQXA 2RKIA 4QWBA 2JEJA 1RTIA 4ED3A 3OL9A 3HHDA 2RS2A 2IHR1 4ZVGA 1LK5A 4H4MA 4J37A 5L1KA 1LW0B 3MEEB 2IMWP 4AL5A 2OLWA 3MEDA 1S72S 2VH7A 2RRAA 2MY7A 1S97A 3G8QA 5IFMA 2ZH3A 3FEZA 5I4MA 5CD4H 2K7JA 4KBIA 3CJKA 3CTRA 1QAYA 4C0BA 1Z1ZA 1TKTB 3ISND 3ZZYA 2VQFF 3VAIA 2CQCA 3H40A 3CDBA 3M6XA 4UW2A 4CNZA 1RJJA 3EGWB 4KRWA 2VC1A 3BGLA 3MEGA 3OXFA 4HLBA 2YNIA 3HI9A 5A8KB 2E1MC 3R27A 4LIWA 4R8UB 4OZLA 1NHVA 4C8NA 4Q8EA 1E6VA 2W4CA 1P1LA 2MQLA 2XGPA 2J0XA 1U1MA 2FLLA 5SUHA 2PI5A 2AYEA 5J2PA 4DQSA 2FVPA 4C97A 3OL6A 3VAMA 3DLBA 5DLFA 1QM9A 2NLWA 4A8FA 2V5HG 2HVHA 3S6EA 5DDQC 3FVYA 2FJVA 1NB7A 1N5QA 2RMLA 3GFXA 4PG7A 1TK5A 3LAMA 2HS3A 3DU5A 5KG0A 5AXKA 5KFDA 1AFJA 2V4JA 3MM7A 3MI7X 3CVKA 4CNYA 3LUYA 3CJ0A 4DL7A 2HVZA 2VA2A 1IKVA 4QU6A 2PC6A 1HI1A 2ZC4A 2MSSA 1HMVA 3HF5A 2R2SA 1S6QB 1DTTA 1LWEA 3H2LA 1S0OA 5L38A 2Y0SD 1ZPWX 3UDLA 3FRYA 6FD1A 3IAS9 2JFKA 5KG6A 3POTB 3RW7A 2ZM6F 4DV4F 3T1YF 1Z4UA 3KLHB 2AX1A 3V5RA 3VZIA 3SFGA 5J2MB 1J5EF 1O51A 4J9RA 3DNCA 1RKIA 4X65F 2LDYA 4RUAA 2OIHA 2LQJA 4CCHA 1S6PA 1R0AB 1F0XA 3R5AA 1UFWA 2N4CA 4JI0F 1KRPA 1IUJA 3NRBA 7FD1A 1N6QB 3DLJA 2YNHB 3ITHB 3CIMA 1R6YA 1UJ5A 1UA1A 3KLEB 1P6TA 3TVYA 2H5EA 1VQ6S 5E3AA 4C3MA 3BSNA 4I6AA 4MFBB 2OTLS 2LMIA 4I2PA 4ITSA 3K7RA 1KHVA 4OJ3A 2I5JB 2P6SA 3BREA 3L7PA 3VQSA 2RH3A 3H98A 2DGOA 2XZWA 2OPSB 2UXDF 3HM9A 1V3SA 4JI4F 2YKQA 4FBTA 1XEZA 2E29A 3LO3A 4WK3A 3NS5A 3BDPA 3DLLQ 1VIOA 1FA0A 2C2RA 3P49B 1PC5A 2FHJA 2F1FA 4YB1P 4M95A 3DM2B 3THPA 1UVNA 4BWMA 2HHXA 2EW9A 2LQ9A 5J2QB 2JDJA 4FZVA 3ENWA 2L9NA 1FRIA 1SI9A 4MK8A 4X4QA 2R2RA 2KRRA 1FDNA 1U1NA 2DR8A 3IG1A 4KR0B 4NCAA 4CIOA 4RW8B 4O3PA 3D0HE 2XWXA 1PO6A 3DRSA 4AFFA 3M2UB 2GHWA 3TVZA 3K5LA 2DNLA 1LFWA 1Q78A 1SV5A 2C42A 1SL2A 4ELUA 1KOHA 3MM8A 4LSNA 3TOQA 4DX8H 4UOCA 4LUBA 2ZHAA 1BLUA 2QT7A 2RDJA 4QWAA 1J5OA 3NCRA 1FEEA 4MIWA 2KB2A 1VRUB 2FHOB 4PG6A 4RUCA 5I42A 1JLGA 2RF2A 4KFBA 2W9CA 3VQTA 1D8ZA 5DS7A 3AJ1A 4R5PB 2GGPA 3N9UC 2QLXA 1HBUB 1X4AA 3ENVA 4TXSA 4Q7AA 4C7QA 2GQ2A 2E7XA 3M30B 3N4WA 1B0VA 4NLWA 1RT3A 3L7OA 4IO9Q 4LJMA 1K8AT 1R8BA 2Q66A 2GQQA 4XAKA 2PI4A 2MJUA 3N6NA 3H25A 1SQEA 1N32F 1I6JA 4ZPTR 3UPFA 1FRMA 4TQSA 3PO5A 2MHNA 4Q2LA 4BC9A 5A8WB 4KHMA 3V6JA 3PVXA 1ZOTA 5DG7A 2OD6A 4OHWA 4RLEA 5L9XA 2K1RB 5IT4A 3VAGA 4FXDA 2WK4A 4B3TF 1HD1A 3SCIE 3OSNA 4BHQA 4KO0A 4X4SA 1NK9A 1AROP 3AB4B 2E44A 5DM7Q 5LMNF 4F4KA 3E2EA 3RAQA 3T6BA 3C6TA 5GAEU 1DFDA 2R8HA 3CUNA 1VHFA 2O3DA 4HVZA 5KT6A 1FRKA 2O5DA 3CCVS 4IOCQ 1HI0P 3GIJA 4IUFA 1MROA 2KI2A 1RT5A 1WG1A 2FJBB 3HZGA 5IT9Y 2CQGA 4FVCA 4X84A 4PQUB 2O67A 2FHMA 4X4PA 1WEXA 2FY1A 1IKYA 4OFZA 5G0RB 2AYGA 1CG2A 3DLGB 3CJ2A 4LVOP 4OX9F 3U1NA 3HXMA 2AJQA 2VV5A 2DR9A 2JX2A 4ID8A 4QWCA 2Z0GA 2DPIA 2ACYA 4I6WA 1RT2B 2R2TA 2V2KA 3M2RB 2FGCA 2BZ2A 2F8HA 3KLVA 4ECSA 3OUYA 4I67A 2B7BB 4R25A 2MZTA 4FN5A 4ZDNA 3U1LA 2CPEA 4AL6A 2LECA 1YJWS 1REVB 3KK1B 1HQEA 4F4WA 3W2VA 3AY0A 2LEBA 3OTCA 5A6PA 5CYQA 1L3VA 5HP1A 2KU7A 2HHSA 2HNYB 4DL4A 2XMMA 2N82B 1XMQF 1KD1T 1K9MT 2C28A 3MR5A 4B3SF 1ZAXA 1DARA 1H2VZ 4I2QA 4TNOA 3D1HA 2FJWA 3JTOA 2D7SA 3QGPA 4WK1A 1N8RT 3G8TA 1RDRA 1NH7A 5DDOC 2L41A 3NGDA 1WACA 2XSFA 4EU0A 1OSCA 2ILZA 1XR7A 5B0EA 4MIAA 1JXEA 3FSXA 1T05A 3IRWP 3K59A 5A2QY 1UVIA 4EUVA 5C5JA 1C1BA 3DOLB 4EBDA 2BE2B 3PM9A 2SXLA 4DR3F 4I64A 3Q8PB 5JUMA 4PG5A 3IWLA 2JC1A 1VBZA 3H4BA 4O3RA 3EXYA 3OVSA 3KK3A 2R7TA 4WFZA 3PEHA 2PA8D 4ALZA 2X1AA 2FPHX 2HW3A 3N01A 1SKSA 3KHHA 1LK7A 2ZH2A 1ZZNA 1NK6A 4EWTA 3QLHB 5KTQA 3RRKA 2WB1D 2ZHOA 2CQDA 4OLPA 1YTYA 2XLIA 2NPIA 4NCBA 2YKNB 4RU9A 2WBRA 4IR1A 1G6BA 3CEDA 4EYIB 1S0NA 2IA0A 2HAIA 3O2IA 3BJYA 3T9ZA 4UQGA 2U1AA 1S7HA 1UW4A 2OMLA 3W2WB 1QJHA 3CMAS 2Y1JA 3H20A 1IR0A 4Z2XA 4J9OA 3HKZD 1U6BA 3K57A 2AGPA 4ELTA 3HHKA 3BQ1A 5L1LA 2FGOA 4DV1F 4K0KF 1RTDA 2R2UA 2F40A 3C6UB 2GMLA 5AE3A 1DQ8A 1FJCA 5L1IA 2VPXB 2XSJA 1T3OA 1CC7A 4NLPA 5KOWA 1SKWA 1UP1A 3MAHA 2HGNA 4M94A 1U25A 2WOMA 2B43A 2CJAA 4NZ7A 1ZBTA 5KT5A 2MGZB 2BQUA 3QIDA 4ZVEA 1VFJA 3NWGA 4P7TA 3M32B 3HHLC 3BR8A 3OHBA 4IOBA 3KNAA 2F9DA 4TLRA 3SMZA 5KFZA 5KG7A 3V6DA 4UUWA 3TQ1A 2VOOA 2B6AB 2PN6A 4LF8F 1WG5A 4XK8C 4DV2F 3BSOA 3M4XA 2ASDA 3CC7S 4YB6A 2DTJA 2ZH9A 2DNYA 5IS2A 2JLFA 3D0IE 1UMJA 4RKUC 3PACA 4MKYA 4A8XA 5FJ4A 2K2PA 1UKUA 1SJ1A 4IG3B 1YQHA 4PXEA 4USIA 2RJZA 2BQRA 5GAHU 1HHSA 1N5YB 1UL3A 5A8RA 5HLFA 5AE1A 3NNHA 1AW0A 2ZBCA 1BQNB 3KLGA 4JV0A 2ZH5A 3PRDA 2FVSA 2DVIA 2HFZA 4IR9A 4PKDB 2E1CA 1KNZA 2QZ8A 4AUKA 4MKAA 1N48A 4GKJF 2X1BA 1FF2A 4DN9A 2RKIB 4NLGA 3RB6A 3FSIA 4NLQA 1TFYA 4TQRA 4BCAA 2M70A 3J80Y 3D2WA 4QU7A 3MM5A 2AQ4A 4I0WA 3BGRB 4B3RF 3Q8SB 3EPGA 2B9YA 2VG5B 4FPRA 3CJKB 2G1DA 2VZ9A 4YB7A 3O1LA 1WTBA 3BO2A 2JHEA 2J7WA 3K2YA 4C98A 4GC7A 3J7ZT 1M5KC 2WSFC 3N0VA 5DGBA 2QA4S 3EXCX 2VONA 4JV5F 3Q24A 2R7QA 2IBKA 1F60B 3NCPA 2YNFA 1Y0HA 2MQQA 3PKMA 3K5PA 3MMCB 2Q6CA 1FNOA 2GIQA 2EWHA 3Q8QB 5DLGA 1S1VB 1QSYA 3X3UA 3PX0A 3BQ0A 4LMZA 1GTHA 4IFVB 4MYTA 1NJWA 2KM8C 2M0GB 2ZDOA 4QR0A 4BDPA 2R8KA 3DRRB 2EFGA 5DO2A 4NCGA 3JAMY 3BSAA 2FJAB 2PMHA 4QOTA 2PD1A 5EDWA 1Q53A 1C0TB 4MAKA 3H5XA 2IYGA 1IQTA 1QE1A 1IKVB 1L3UA 2B5JA 5FD1A 5M2UA 2Z2LA 5CHCB 4E8UA 3HHLB 2QFJA 2CQHA 5C25B 3D5MA 3WBZA 2E66A 3CJ4A 1FTRA 1DTTB 2J7KA 3CCES 4DV6F 3TAPA 3FFIA 2YX4A 2VG6A 3I82A 4RWWA 1ZM3A 3LAKA 3KMQA 2CPYA 4CTAB 2P9EA 2DO4A 2YWKA 3NCQA 6FDRA 3CCUS 4HKQA 2RQCA 1CSJA 1GX5A 2DGVA 4URGA 1RTJB 1S6PB 1MMDA 2VUGA 5EWFA 3GSDA 1TK0A 2VL1A 2VASA 3VTIA 3KTQA 2LKZA 3MR2A 2YKMB 3O8WA 3QAUA 5HROA 1QAJA 1HA1A 3RR7A 2LU1A 2HLTA 2C3UA 4HI1A 3JSRA 1T02A 5K8OA 3CCSS 3KYLA 3OFGA 4EZ9A 5I3UB 4WF9Q 1JIHA 2VG7B 3L95X 2RS8A 4IQMA 3UQSA 1VQOS 1B64A 2CQ4A 3DLEA 3CCWA 2W9BB 3KLIA 3IFEA 3K5NA 3ZFVA 1YJNS 4Y2MA 2ROGA 3C8YA 1N36F 1YJUA 1AUDA 3I0RB 5KT3A 2XCPA 1FRXA 5D78A 2V4QA 1XMBA 3JSYA 4H4OB 4RW9A 5D4NA 2KG0A 1HQUB 1VQ8S 3P5TL 1HBNA 4H4KC 4OI0A 3T1AA 2AV5A 2VKRA 4GMKA 2E5LF 2R7UA 1Z2ZA