4DR3F

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dr3F00
4JI0F 4B3TF 1CQNA 4JI4F 5AJ3F 4GKJF 1N32F 1G1XA 1F60B 4JI2F 1QJHA 4JI6F 4DR1F 1FKAF 4JI3F 4DR6F 4JI1F 1N33F 4DV2F 4JI8F 1CQMA 1GH8A 1IJEB 1HR0F 4JI7F 4DV5F 4DV6F 4AQYF 1XNRF 4DV3F 1G7CB 4JYAF 2BXJA 3T1YF 2J5AA 4LFCF 2KJWA 2KJVA 1FJGF 4LF7F 4B3RF 4YHHF 2HHHF 4LF4F 5BR8F 1XMOF 1RISA 4DV4F 2UXBF 4DV1F 1IBLF 2UXDF 2BVZA 2UU9F 4NXMF 1IBKF 1VMBA 4OX9F 4DR5F 4GKKF 2B7CB 4K0KF 1XNQF 4LF8F 4LFAF 2UUCF 4DUYF 4B3SF 4X62F 1N36F 2UUBF 4X64F 1XMQF 4KHPF 3OTOF 4LF9F 2UXCF 4DR2F 2E5LF 2RJZA 2UUAF 1I94F 5LMNF 5IWAF 1HNXF 4NXNF 2VQEF 4DV7F 4DV0F 4X66F 1J5EF 1HNZF 1IJFB 2F4VF 4DR7F 2ZM6F 4LF5F 4DUZF 4JV5F 4YY3F 4LFBF 3R3TA 2VQFF 4DR3F 4JI5F 5LMUF 3T1HF 1LOUA 4X65F 4DR4F 2B7BB 1IBMF 3ZZPA 4LF6F 4B3MF 1B64A 1N34F 2YY3A 1HNWF
chains in the Genus database with same CATH superfamily
1RTHA 1GMWA 5ADZA 1KLNA 3PXGa 3M8YA 1OYDA 1D8YA 2MKYA 4USIA 1RQ0A 4JI1F 3M4XA 4DFKA 1S9GB 2HQGA 3EICA 4OZLA 2J9CA 3SDEA 2JL9A 1M5HA 4E8UA 2KFNA 1VQSA 3KHHA 2IPOB 3SQOP 4C8LA 1RA6A 2XMVA 2DNHA 2QL7B 3GIKA 2AYBA 3B4MA 2W7PA 5JJBA 4HR2A 2H1YA 2L41A 3MTJA 2HQFA 5L39A 3IAS9 3Q8PB 4DL4A 4DL0C 2XHCA 3GFHA 4LUBA 1BHNA 5C2GA 5GVQA 4C8KA 5EDWA 2Y8WA 3DYAA 5KFGA 1VC6A 3RYLA 3Q8UA 2XC9A 3H2UB 5KG7A 1U1LA 2BZ2A 1Z4UA 4X66J 1KKHA 2KT5A 4IYQA 2BJ9A 2O67A 4ZPAA 3KJVB 2CZ9A 2RRBA 3JQKA 3W5ZA 2ZITA 4NLSA 2MQNA 2BW2A 4FYVB 1N34F 4IFYB 3KOAA 2V8DA 1TK8A 2PGCA 4KPYA 3I5BA 2M0GB 2MKCA 4LIRA 3U02A 2CNKB 4IRKA 3HXMA 2HQDA 1IKXB 3HSJA 5L9NA 2R7XA 3C15A 3BKTA 1XNRJ 4Y34A 2MHEA 4RBTA 1FXRA 3P45B 2JEIA 5AJ3J 3N0VA 2MZJA 4G6VB 4IQXA 3B78A 3K0JA 1DTTA 4IDKB 3GQCA 2B6AB 4X4UA 3QJPA 1RWWB 1N8RT 3WC0A 1ZTWA 1PBAA 1V3ZA 5DG7A 3TJ8A 4P2MA 4DR2F 4DEZA 3S8SA 5EN1A 3EXYA 4J9UE 4Z7CA 3KLHA 4J9QA 2UU9J 1RTIB 5KFTA 4RR5A 1RT6B 4NYPA 3KXDA 2RHSB 2YKMA 3Q22A 3AFGA 3A4TA 3I56S 3GV8B 1F1BB 4L72B 3BPDA 3NP5A 4CYUA 1XQIA 3ZTPA 3ZTQA 2HBZB 1DARA 1PKUA 4GKJF 3HPOA 2OTJS 4O3QA 1K73T 2FLLA 4DV5F 4CLFA 5H1SV 4OLPA 1Z1ZA 3G8QA 1HKAA 2VJVA 3DLGA 3M8QA 2I9SA 3K5PA 4DPTA 3BO4A 2VFSA 1Q1KA 1JJ2R 1EETA 3DRSA 3AD9C 3OSPA 2YX4A 1MWQA 1H74A 2CQCA 2YPZA 4EYIB 1RT5B 2RT3A 3NGUA 1CEZA 1N5YA 4FYXB 3M2RA 1Y4ZB 1HHSA 1TL5A 5DDQC 1C1BB 4HDGA 3BN7A 3NS6A 1U6FA 2QLFB 2OFHX 2FHOB 2O5DA 5DLFA 1F3FA 2OSRA 1TV6A 4OI0A 2ZM6F 1IXKA 2BR0A 4L76A 3MFIA 4O44B 3F41A 3ZTRA 5J2NB 5ETOA 2BJ3A 3ZZTA 1EAYC 3TO8A 4RBVA 5J2PA 4DQSA 4DFPA 2RKIA 1YIJS 3MPYA 4BCAA 1VQMS 2F40A 3THTA 1QTMA 5G0RA 2JLEA 2W2OP 3CT9A 4UZCA 4B9TA 2WSEC 1PG5B 2CQ4A 5L1KA 2QN6B 5LSOA 2NSCA 2CRLA 4USTA 1JLCA 3OJUA 2CPHA 3CWJA 2DHGA 2RS2A 2JEGA 3TI0A 3CO9A 2OEMA 3TUPA 3EWGA 4NL5A 1HBUB 4RJVA 3T5JA 4KBIA 2X51A 3HKWA 3CJTA 1AFJA 1S6QA 3LAKA 2U2FA 3SXLA 2UV8G 4QU7A 4KV8A 4M8LA 5G4DA 1FDBA 3TVYA 1S72S 4PUOA 1DAXA 1VIOA 2UUAJ 4X66F 3CJRA 1A0OB 1IN0A 2VG7A 2CDQA 4U96A 4X64J 3MWBA 2DGXA 2HQCA 1VYAA 5DM7Q 2B5JA 1CLFA 1S4FA 4CH0S 2L9DA 2GVZA 2AHOB 1VOMA 4IG3A 3CD7A 1XNRF 1G7CB 2N7CA 3I0SA 3FJ2A 1FX2A 3OVAA 3FFIB 1O6XA 2CWKA 2ROPA 4PAAA 3CJKA 3X1LB 3GSDA 3PX0A 2ZOGA 3QRQA 5C42A 2XI2A 2ZH2A 5KFFA 4KB7A 1TL3B 2HS0A 1MG7A 2DNQA 2LQ5A 3UDCA 2CQ0A 3PG9A 3PYFA 1KSPA 2K1RB 4FF1A 2UUCF 1Y5IB 1FJCA 2XLJA 4LSLB 1FKPB 3B82A 3PFOA 4QBUA 1VRTA 2W01A 2VFRA 1TL7A 2QG9B 1DZ5A 4P2SA 2W24A 3ZZOA 2UXBJ 4TKTA 5K5MA 3QQCD 4O4RA 2JFKA 3R1HA 2AGOA 3VR1A 3G6XA 1YG0A 2V2QA 1YBUA 5LL6d 1L5UA 2G2YA 4TQSA 4Q8EA 3HSZA 3MCSA 2C3MA 4OHVA 2QYCA 2DGQA 2AP6A 5A8WB 4PXCA 1PYSB 4NZ7A 1IKVB 3DU6A 1RT3A 2XYPB 5F41A 2XG8A 3OXGA 4PXEA 2OPPA 4OYPA 2BOPA 4CP5A 3WIVA 1EIYB 1KQKA 1NSQA 1JLAB 3SSQA 2W4PA 3MEEA 4X84A 1K8AT 5KG4A 4ED5A 2GO9A 2CPXA 5LSRA 4RNMA 3RB0A 1RAFB 4MMOA 2QLWA 3OVBA 1NU4A 2X3DA 4CLSA 2XZWA 4K4SA 4IH5A 2MPUA 2QJ3A 2NPIA 1SIZA 1NAQA 1NSKL 2BANB 2DH8A 1QAIA 3GMGA 3TYTA 3V5RA 3DRXA 2QEXS 2PMWA 3ZZZA 1H7WA 4PYAA 3IGNA 2I5JB 4PG8A 3GYGA 3PRDA 5J2QB 2MLYA 3G4SS 3DLJA 3TVKA 1U2RA 5K8MA 4F50A 1M5PC 4DSKA 2NXJA 4GO5X 2VQFJ 3ITHB 4UOFA 4ZHRB 4JB8B 3HVAA 2XSJB 1RTJA 2MMYA 3NGSA 4OX9F 4DPYA 1XN9A 3DDIA 1Z2LA 4K0KF 3HVTB 4ZPCA 4DF4A 3UN5A 2DR5A 4LF8F 2GHPA 2LYVA 1NHUA 5H9FJ 1UJ4A 2PI4A 4V19J 2UUAF 5GAHI 4OHYA 1I6JA 3TOQA 3KNAA 4CLYA 3K5NA 2RQCA 2N82B 1SV5B 1NMEB 3JAMY 4YFUA 4F4YA 3Q24A 3LH2S 3G96A 3JTOA 1BQXA 1S48A 3PTWA 4L74A 4KRWA 1ULRA 2W9CB 2KFZA 1NM2A 2WCXA 3I4PA 3KLIB 3FVYA 1GH8A 4PG7A 2Y1LB 4LFBJ 4JI2J 4QWCA 2EFOA 2CJAA 5K20B 1DRZA 1NJWA 4YB1P 3M9MB 3D0IE 5A0YA 2VOPA 2L9WA 2QTWA 2XS5A 4NLYA 3S1TA 3FBFA 2HNYA 3K58A 2R42A 3PYGA 5KFYA 1WOSA 4NLQA 3FK4A 3IRWP 1BQNB 1Q16B 1RJJA 1ZTTA 3QIPA 2A6MA 2YH0A 3OUYA 1H2TZ 4NI2A 3KHLA 1S7IA 3Q8QB 1CVJA 3DGVA 2MY8A 2L9NA 4PQAA 3W2WB 1FRIA 3DOKA 3QT8A 1S99A 4I64A 3TVZA 2WAQD 2D69A 1BD6A 4C11B 2XY5A 1WSVA 3UD3P 3IRXA 1VBYA 3PKYA 4C97A 4XTTA 1APSA 3DLKA 1MROA 5B7WA 4K59A 1R8AA 4LVOP 1QJHA 1DQ8A 2DCLA 2EFGA 4A8FA 2JDJA 3RBEA 2BACA 2O66A 3PO4A 4RX6A 3MAAB 4K4WA 1NK9A 1N88A 1C4AA 1T7PA 1J2VA 2HVHA 1HI1A 4ZVOB 3CCSS 2WONB 2FZKB 3T19A 1OQ6A 4DUTA 4B9MA 4ZVTB 3FQLA 4WP9A 4X4NA 4DV3J 2XY7A 1S1UA 2GVDA 4LFCJ 4EEYA 1R43A 4FP9A 2CJ9A 5HVHA 4FS2A 4M5MA 2HHVA 1LKZA 2N3OA 1NSPA 3MECA 2Z2MA 1VGYA 1TKXA 2NLWA 1R31A 3GJRB 4MIWA 2PE8A 2Z2LA 3HD2A 2G13A 3M30A 3MMCA 4B3SJ 2CQBA 4EZ6A 2LECA 3BEGB 5HP1A 3NNAA 1JLBA 2MKKA 1TUVA 2FDNA 2B9EA 1GTEA 2FD2A 4N41A 3KK2B 4K4VA 1IKWB 4DR7J 1NKEA 1ZBTA 4QW8A 3V6DA 3EUNA 2HZVA 2FLPA 1VBXA 3WIUA 3HFKA 2OFGX 4F67A 4G1QB 2WHOA 1E6YA 2F5GA 4WKYA 1VC0A 4PPZA 2M5YA 2GGPB 2ZHAA 1BUXA 2DH9A 1RHKB 3IM8A 2GHVC 3H8YA 2B8QA 5LXYA 4B9NA 1Q0NA 2V68A 1HI0P 1TMMA 3SYZA 2GQ2A 3M8WA 1V5IB 2VBYA 5HI7A 3T5KA 4KHRA 2VC0A 2FZCB 1FRLA 2HSEB 2M2BA 4LRAA 4QR1A 3UDVA 4NYZA 1ROFA 1SJRA 1AB8A 3C14B 1FHTA 3ET6B 2IJRA 4P72A 4HH0A 1T02A 3JSMA 1YJUA 2F7VA 3IG1B 3EVWA 3ZZPA 4AYBD 4J37A 3OSNA 2ASLA 3M1VA 3W8PA 1HQUB 3OR2A 4AUKA 5CYMA 2CKWA 4Y2IA 1PYTA 4JI2F 4DR6F 3H5SA 4ED1A 5CAAA 3WX4A 4ZVUB 3R2CJ 3LTOA 3UNGC 3G82A 3GYNA 4B9SA 1UTAA 3BKUA 1R3NA 2E9ZA 2JEJA 4GVBB 3P6YC 4K4ZA 2RE1A 4FF2A 2HURA 3F73A 1RT7A 2BKOA 3VAFA 1CJUA 5DQGA 1RBOB 3CCQS 4Q8FA 4Q45A 3G8SA 3LP0B 2JH3A 3D3BJ 2V2KA 4NZ0A 2UUTA 1WELA 2R7TA 4Q44A 3CCWA 4OI4A 2YNFB 1WUUA 1VQ7S 2KL8A 2J9DA 4LREA 1T3OA 2IMOA 2XGQA 1YJNS 1SKRA 1M5VC 2L08A 2QA1A 1MN9A 1HHQA 4CTAA 2GAGC 3JSYA 4Y2AA 4ZPWR 3I32A 2G2OA 3O1LA 5GAEU 3IS9B 3IN5A 4ZCLA 3T9NA 1FTRA 1O5JA 2V63A 3RBZA 3VQTA 4IFVB 4USHA 1X4HA 1VK3A 3MPVA 1RA7A 5E3RA 1N5QA 4USUA 1HBNB 4R8UA 3DDKA 2ATCB 1EX8A 1ZM9A 2VG5A 4NWBA 2MHNA 4CO4A 1IKYB 1Q5VA 2FC9A 1LV5A 4IRDA 4CLPA 3QLHA 3CCES 5GMKa 3W9IA 4NA3A 4RW9A 3CDBA 3V4IA 3GFXA 1Q8BA 2DIUA 2Z56B 4P71A 4LF1A 5IT9U 1FKOA 2MQPA 1RKJA 2HLTA 2WTFA 1WHXA 3CVKA 4DCJB 2VOOA 1V6HA 4ETZA 3BQ0A 2ZUGA 1T05A 3TAMB 3OL8A 2YKQA 1SI9A 3GR0A 3J81j 3O3LA 3FMWA 5E3AA 3MEGB 2V4JA 1YHQS 2EC2A 2R8JA 4P6QA 1F5AA 2YWFA 1RTZA 2MKJA 3MR3A 4PG6A 1RTDB 4N47A 3N28A 2HVZA 4YY3J 2CDRB 4Y2CA 4MTPA 2WVDA 1S0MA 4ZJQA 2RS8A 3K8VA 4LQ9A 3SZ2A 3H98A 2B9XA 4UT4A 3LP2B 1LK7A 2AEFA 2GMLA 1UEUA 1KTQA 1U45A 1NK4A 4WKRA 2Z2ZA 1FESA 4YR3A 2MQLA 2RNEA 3AXMA 1Y5NB 3PHEA 2V67A 3MMJA 5KG2A 1XNQJ 4W98A 2OELA 2GAHC 2W4DA 1EKRA 1X4CA 8AT1B 7AT1B 1RI7A 4MK9A 4JP8A 4WIQA 5EWGA 1A7GE 1WWHA 2WW8A 2C22A 2KRRA 4J9MA 2QC3A 3BN4A 3I96A 1NH8A 2HGMA 3AXKA 4KH1B 5K8OA 2RUGA 1FNOA 1GK8A 1YBTA 1X5SA 2GQCA 2QX0A 4DPWA 2UUBJ 2VF3A 3GJQB 4TYAA 1JLEB 1SUQB 2E1PA 2J0XA 2CYYA 3SI8A 1TZ0A 3E3XA 5GAHU 3TAQA 4JI4F 4I0WA 4TU8A 2ZNYA 3M32A 1UWBB 4XIUA 5ITHA 4LR7A 2DY9A 2KB2A 2HVEA 3AH6A 3QJJA 3NCQA 2BKNA 4WTOB 1LWEA 4OYXA 1NK0A 1RADB 4PABA 3BPSP 1RYSA 4LSNA 4N77A 3I9V9 3T9ZA 3ILJA 2ZOMA 3HHNB 3LP1B 2FHJD 4M1KA 1EQMA 3JYTA 2MZSA 4ANCA 4DLGA 5EHHA 2HHHJ 3AQPA 2FGCA 2LKZA 3ZC4A 2FJDB 3THPA 2RQKA 2KM8B 2RU9A 1VK8A 2V2VA 2LA4A 3SCJE 5FDLB 3M8RA 1T3NA 2OPRA 2Z2YB 4CO1A 2D1CA 2KHCA 3GCWP 1CJVA 1OYEA 3OBIA 1DURA 2KDOA 1FKAF 3EPIA 2BV3A 2F9JA 2BE2A 2EI5A 2GS8A 1NBEB 3GSIA 4JI8J 5KFAA 3DCAA 3T6JA 4U95A 4WCEQ 3Q8SB 3KWMA 3C15B 4WFNQ 4KGVB 2F3JA 1YJWS 3W66A 3MM5A 4ZLJA 4JOUA 5BR8J 1ZAVA 1AXQA 1HI8A 2YKPA 4ZITA 5F8GA 1JLQA 4DU7A 4I6WA 2UZAA 3I5CA 1T9VA 3D7SB 1GQEA 1NB7A 1FJGJ 2ASDA 2R9LA 2ILZA 2KKHA 3KG0A 4ZVPB 2HNZB 1SJ4P 4LT6A 5IC6B 1H2UX 1HBMA 3GG1A 1KNZA 1CJKB 3IWLA 5B0BA 1T03A 4X4VA 1LW2B 2BBEA 2QO3A 2WBMA 2OEKA 4CM2A 1TL1A 2J9DE 3DLEA 3LALA 3QATA 4DPOA 2DR9A 2KN4A 4QIEA 2N7YA 2JZ5A 5KFCA 2DB1A 2QLXA 3HM9A 2J8AA 1K0TA 3DLGB 2HQIA 3MR2A 4NRTA 3PX4A 4HHJA 2KFYA 3R7BB 3FSXA 3ISND 2AJFE 3DRSB 4F4WA 1FEEA 3U7JA 2Y9HA 3HVWA 5E0OA 1UZDA 2IM1A 3TUJC 2JVRA 5B09A 2NZ4A 2AQ4A 3EE3A 1XNQF 1N5YB 5DQHA 2YKNA 1YSJA 4X4OA 3QT5A 1YZ6A 3QSIA 2AU0A 3HMJG 1H73A 3ZTOA 2JWNA 3ZZ0A 4ER8A 4HVZA 3KKFA 3VGTA 3D0GE 3TUIC 1TV6B 1IBKJ 3MMAA 1C2PA 4EUVA 2ZBRA 5HROB 2RD5C 3BM7A 5D3GA 3OPKA 3NS7B 4RBUA 1OQ3A 2WW4A 1QE1A 5J2PB 4CNYA 3D66A 3KLVA 2LQBA 3R5DA 1VQKS 4ECYA 1U4BA 2XHWA 4B3TJ 1KQGB 2HRTA 3H2VE 3J7YU 2KYXA 1F9FA 3CCRS 4PQUA 3TZZA 4IQMA 2VL1A 5J1EA 2W25A 4E98A 3MI7X 4RW4B 2VJUA 1JIHA 2KJVA 5F8LA 5HAOA 3I4HX 3ZTSA 3QFWA 4P2XA 3CDWA 2R8IA 2OJ3A 4LF7J 1SH3A 2FVQA 1AW0A 1QM9A 3W65A 1VISA 2I0XA 3KLEA 1UPPA 1IBLJ 1S6QB 4AD6A 2BJEA 4LFAJ 2QSWA 4KV8B 2DHAA 3DKDA 3R97A 2E5JA 4PUOB 1V5VA 2A10A 4ALZA 4IO1A 2GZOA 5LMNJ 4CH7A 1U1OA 2BM1A 5C25B 2VG7B 1S4EA 1S1TB 2R8HA 4RNOA 3KUHA 4WF9Q 3QSYB 2ZD1A 3M2UA 2VU5A 2B5JB 2RMLA 3N6NA 4UZBA 4CZCA 4FF4A 4DX7A 4JI8F 4IG3B 2DNRA 1SKSA 4V19X 1B3TA 2M8DB 2LXIA 1VDHA 5KG1A 2HZAA 3I0SB 4CI0B 4DSEA 5J1NA 2EEYA 1TUGB 4M5DB 5BR8F 3VVUA 3DRPB 2B9YA 5KT7A 3ILOA 1FE0A 5F0WA 4ZVSB 3W8GA 2V34A 2Q66A 2J7KA 3KK3B 3AOAA 2P6TA 1JXLA 1HNVB 1LK5A 5EWFA 1KEKA 4BS2A 2DXDA 1OSCA 1RCOB 3UVJA 1WC5A 4DUZF 5J2MA 4C6AA 4R25A 1T11A 4J9NA 1VQ4S 2DHXA 3MEDB 4ANEA 1P9YA 2QMUB 2DO4A 4KHPJ 3CMES 2NUHA 2YWHA 3IGVA 2NXEA 2UVRA 3P49B 2IJFA 4FKYA 1CQNA 4LF6J 3SCIE 2C2MB 1RT3B 3MM6A 2J76E 4EZ9A 3W7BA 1TL4A 4ZDNA 5KFKA 3R5JB 2ADBA 2N4DA 3KDOA 1LWFB 3I0RA 3J80U 1RHJB 3PJ9A 1X9SA 2OPSB 1RT1A 3MD3A 2RU3A 4ZIWA 1X0FA 4LF9F 4ZN3A 1HNIA 1T95A 2LDYA 4O0IA 2HAIA 4X4RA 2ZKTA 4RW6A 3NWGA 4MKYA 1RSCA 1YRTA 3HSGA 1REVA 2ZWOA 4J9VA 2D41A 4YDDB 5DLGA 3QO9A 2B7BB 4RW8A 4B3OB 4EBEA 2FJVA 2SXLA 4B3TF 3QWPA 3FBCA 1CULB 3C6UA 2ALZA 5DDPC 5T7LB 2G1HA 2MB0B 2EKYA 4Y00A 2EK1A 3HHLA 1R0AB 2HMIB 4J9OA 2DJWA 2MTLA 2OI2A 2QMXA 1R8HA 3DLHA 2B4OA 3TA0A 3WQPA 1VHFA 4LF7F 3DM2A 2PEBA 1UJ5A 2OAUA 1IBLF 2BVZA 2E1RA 3BBCA 4C4WA 4NXMJ 2ZBPA 4DSJA 4LFAF 1SQFA 2DISA 2VASA 2RH3A 1WEYA 5LMNF 3OTOJ 2BKPA 4FDFA 2B51A 2G0JA 3RAXA 4DV1J 2RRNA 3A13A 3BO2A 3OLAA 4ZCKA 5CD4H 2VFVA 2CUYA 1WTBA 4OX7A 2LVWA 1S0VA 5L38A 4WFBQ 1MU2B 3CXCR 4OI1A 1D9AA 2RQ4A 2HWTA 4B9VA 4K2XA 3AJDA 2PD1A 2KG0A 4DPUA 4HTJA 4KH0B 4WK1A 4KO0A 3DMJA 2R7RA 4U67Q 1YRXA 3DHXA 3IBWA 3FMBA 5DGAA 1RLDA 2HHQA 1PO6A 3BZQA 1U1PA 1HW9A 3FBEA 2M7SA 3P96A 3PYDA 3K5MA 3U1NA 2RSQA 1URNA 3OUYB 2HKEA 2CPIA 1FF2A 1MWZA 4ICLB 4NI2B 1NZAA 3KNGA 1ZM4A 1KC8T 4NEYA 4NCGB 5IWAF 2RB7A 3DOKB 1FE4A 2P9EA 2XMTA 4F36A 5DO2A 1FI4A 5KFXA 1I1GA 4GRSA 1SXLA 2LXFA 4DCPB 2VFUA 5A8RA 2BJ8A 3OR1A 2BQ3A 3IRXB 3FCWA 3L7UA 4LF6F 4F7VA 1Y3JA 2NQPA 3VAMA 3NBPB 1URRA 2VB6A 2BMBA 3AHPA 2XTJP 3I82A 1H72C 3IO1A 1CS4A 2FVRA 3R7SB 3D68A 3SSRA 2GFFA 3K8WA 5HLFA 4Q5VA 2IM3A 2XCAA 2V8GA 1X5TA 3M6VA 4EI2A 3GJSB 1U6ZA 4ES1A 4YHHF 3CIMA 2DIVA 2VC1A 1S1XB 2VPXB 2GCFA 1Q8KA 1B0PA 1F2GA 3BJYA 2DH7A 1XMQF 4IKAA 3T1YJ 3POTA 1WC1A 3AOCA 1LQ9A 1NJIT 4I7FB 2DBBA 2QFIA 5KG6A 2C2ZB 3M30B 2PI5A 2DHSA 3VAKA 1F5CA 1S79A 5F8NA 1ZM2A 4DX5A 2LQ9A 4F04B 5L1LA 2Y1RI 1KBRA 1JLBB 1W25A 3U27A 1UEKA 3DXBA 1HNWJ 4I67A 4JI6F 3E51A 3I55S 4OYIA 3LUYA 2GW8A 4UY85 2OUGA 1EJ7L 3IFEA 2J5AA 5B08A 5KT6A 1RAEB 1RWVB 1HQEA 1IR0A 1IUJA 2W2PP 3UN2A 3R5AA 4EGLA 2E9TA 3ZNJ1 2DKOB 1FVQA 2WBRA 4LBHA 4NXMF 3BGUA 4ECZA 5HVFA 2XNQA 3OTOF 2VA3A 4OZJA 4RLEA 3GB0A 1YJ7A 2CJYB 1NUEA 1WC4A 3RR8A 4TN2A 3C6TA 2MQQA 3MR5A 3W2VB 5HJXA 2ZH8A 2VDIA 1XIQA 2H5IB 3C16A 4DG1B 2AYEA 3LGMA 2AV5A 1U1MA 2MKSA 2YNGA 4E2FB 4ZN1A 1JXEA 2H5EA 4CT9A 4BWJA 1M1HA 4PKDB 1SVDA 4K4XA 2M8HA 3O2IA 4QIGA 4C0HA 1HPZA 1HMVA 1WKLA 1QSLA 3TEGA 1W7WA 1UAWA 1UVIA 3ZNUA 2QL9B 2F8HA 3RB6A 3CSKA 3PIPQ 3J7A1 3VZHA 1B70B 4A8YA 1JJHA 1XERA 4NOHA 2XGPA 4USMA 1RT7B 3P3DA 3MXHP 4XO0A 3ENWA 5IT4A 4NMXA 2ZJPQ 5K14A 4KFBB 4W4MA 2CQHA 3DI6B 5BYSA 4J91A 2W2NP 4WIIA 1X9WA 1K47A 4KGZB 2PO4A 4JV5F 1F2HA 2VG6A 3C66A 3D6FB 3B6BA 4ZJOA 1J27A 1EB0A 1M90T 4OI6A 2RIJA 3D3CJ 3D5MA 1F5BA 3WX8A 2CQPA 2YNHA 2E7VA 4WYWA 3TUZC 1QLNA 2R7VA 3HHLC 4O4GA 1FWLA 3RAMA 3CUNA 1GX6A 2EWHA 5CHCB 4ZP8A 2HLUA 5CZVA 1VC5A 1M1KT 2EFVA 4CRJA 4A47A 1VQ8S 4Y2MA 3EM1A 4ELUA 2OH2A 1EP4B 5IFMA 4ZLNA 2AKWB 1S9GA 4IR1A 3UD4P 4OL8A 3VTIA 3W9HA 2F9DA 2PIIA 1RWPB 1B7FA 2L3MA 2JFDA 3DU5A 2FZGB 3K89A 1TKZA 4RW9B 1S9EB 3MD1A 2XMMA 1SL2A 2OPQA 3V4IB 3NXZA 1X4BA 4ELVA 1SL1A 2ERRA 3CC2S 2HIQA 1R7IA 1O51A 1JLGB 1FK9A 3GFZA 4P7TA 2W8KA 4K7QA 1ZAWA 4RO0A 5JUMA 1L3TA 4JI5J 1Q7YT 3C3LA 2HBYB 4X65J 1HNWF 2Q79A 2X3GA 2VQEJ 1R27B 1FNXH 1DBDA 2GIRA 1WD6A 4P7VA 3EYZA 1RHQB 3VZIA 3KJVA 4DZDA 5KFJA 1UZHA 3W63A 1Q78A 4ZP7A 1OPZA 2LCWA 1TKTB 2ZZNA 3CJ5A 3HT0A 4IFYA 1AROP 4UOHA 1MMNA 1RT4A 4EO6A 3L9ZA 1NPRA 3A3OB 1JJ4A 3H25A 2YQ3A 1GMVA 2XLIA 4DV4J 4DR5F 2LU1A 4GKKF 5D8HB 3WC2A 3G8TA 5GADU 1J5OB 2V9KA 4CWBA 2VODA 4OZ0A 4TXSA 2AYGA 4WXOA 4C8OA 3J7AN 3OFEA 4CM0A 4F26A 2PC6A 4ITSA 1RGVA 4IDKA 2B6AA 1UETA 2W2MP 3LWMA 4M5NA 3AAWB 1RT2B 1OS5A 2LMIA 1SL0A 1PJ7A 1VRQC 3PNIA 1NJYA 2XMAA 3B4DA 2V4RA 2IDEA 5LMUJ 4M5KA 3SQGB 2CPFA 1IBMJ 1RTIA 4CO0A 3C8YA 4TQRA 1CPZA 2DNKA 3MTKA 3KJNB 3IR7B 3M32B 3HKZD 3GP9A 2HZCA 2CVIA 4YB7A 3BDEA 3SBMA 2N4CA 2E1AA 3BSCA 3KMQA 4L3KA 1VR6A 2AEMA 3SIPB 4C0BA 3HULA 4OV6A 4J9PA 4MFBB 3ADAC 3BYRA 3V6KA 1FERA 4JI7J 1XWLA 4ZOSA 3LGNA 3AY0A 4A48A 3M6XA 3EJMA 3CCMS 1F3VA 3JYTB 2NXUA 2MYFA 4LRFA 5A6WA 4PZVA 2X1GA 5ETVA 4FXDA 4A4JA 3QGGA 1HBOA 5B0CA 3T6BA 1FVSA 1KVIA 1DFDA 4ZMMA 2ACYA 4QJVA 2WVFA 2AWZA 4EBCA 3K57A 2ZH1A 3M7VA 2DNMA 4F4KA 3KLGB 4QWDA 4FBTA 1CJVB 2D3OR 1YK9A 2FJAB 4OQJA 1MLAA 4DQRA 5A8KA 2BE2B 5J2NA 2EFPA 3PRBA 1A9NB 4DR3J 3H90A 1M0SA 2XULA 1N4LA 4JYAJ 2V69A 1SIWB 2ASJA 1F9EB 4DDFA 2V9WA 3MM5B 3L4BC 2CWXA 2DRAA 2JEFA 1X4AA 1SKUB 5I42A 1YI2S 2FHMA 2GX8A 3M05A 1KHVA 4I68A 2E5LF 3KK1B 2IFXA 2HK2A 4NCBA 2HHUA 4LR9A 1Q86T 4ENOA 3BBBA 5A6PA 4ECQA 4U9RA 1HBMB 2XBPA 4DL6A 2HS4A 4DLEA 2LQ8A 4YUDA 4FZVA 4Q0BA 4JI5F 3LANA 2B4VA 3SMZA 4HT5A 3TX0A 5FD1A 4X65F 5EWEA 3OXLA 2IVFB 1N0VC 2KYZA 2QT7A 3NAIA 5HMXA 3PW7A 1BE4A 4CQ1A 1RHRB 3FSIA 1FRKA 2OP5A 2FY1A 2G9OA 2ZE2B 2VZ9A 5D77A 2J0WA 5CYQA 4J9KA 2MDAA 1YJRA 4USKA 1AUSL 2MEWA 2K7JA 2HFNA 3R9LA 4M94A 2BJDA 2DGOA 4RL1A 3CW2C 4DV4F 3BSOA 3P4UB 3PY8A 3OFHA 5B0DA 2OMLA 2PMZD 5ETTA 2YKNB 4DSFA 3GLJA 5IV4A 1X5OA 5KT2A 1WG5A 3V81A 3G9CA 2R2TA 1NJZA 2K1RA 3RU0A 3MMAB 2BJ7A 2J9EA 1RKIA 3PFEA 4RW7B 4LSLA 1FKPA 5LMUF 4USVA 2DNZA 5D6GA 1IBMF 2LQJA 3TANA 1TQLA 2OMOA 2MZRA 2A1BA 3D6MB 4A8OA 2AJ1A 5KTQA 3BB5A 4PWUA 4Q7AA 1RZMA 1HNZJ 4W92B 3H5XA 1YX2A 1UFWA 2CQ1A 4H54A 1XJWB 4M5GA 3AQOA 3NNHA 5M2RA 4ED7A 4N8OA 2N3LA 5J1EB 3FBBA 1N48A 2B4UA 2F8EX 2BQUA 2YWGA 2I1RA 3BDPA 2XYGB 1G3OA 1T0TV 2R7WA 5A8WA 2M4MA 1YJTA 1IKVA 1HFEL 4DV2J 3ISZA 4NMLA 2XMWA 1U47A 1SC1B 4ZPVR 3EZ5A 1WEZA 3OQ2A 3TR5A 1WHYA 1P27B 4WU3A 2E29A 1JLAA 1Y0HA 2UUWA 4DSIA 4YDXA 4HEA9 2ILYA 1J5EJ 2QYGA 3FRZA 3HCXA 3AD7C 5HN0A 7FDRA 3BH7B 5KFSA 1DQ9A 2DNPA 4M5LA 4DR4J 3PHTA 2ZD1B 1VQOS 5KFPA 4MT1A 1FT8A 1TFWA 2D3O1 3PEHA 2MQMA 4C8MA 1UP1A 4O3NA 2JOQA 1VLOA 1B99A 1WHWA 4RPFA 1UFLA 2I5JA 3PKMA 4JYAF 1RWMB 3M9OB 4WJBA 4B3MJ 2IDLA 3VAGA 2LEPA 1B7YB 2CQ3A 2HHWA 3MUMP 2AGQA 2LFVA 2EK6A 2GO8A 3KHGA 3HFVA 1CJTB 2E5GA 2Z4PA 3OTBA 1XC9A 4ZHRA 1IQZA 3RBDA 1JNZB 2K2PA 3FSYA 1SJFA 1ACMB 3PYEA 4URSA 1BLUA 3MUVP 2C3PA 4DZ6A 3FZBA 5L1IA 1I5OB 1KVJA 3HVTA 5J2MB 1VIXA 3JAMU 1WG1A 3NOCA 4N56A 1UW9A 2QV6A 1ZPVA 4MIAA 4MJKA 1JKHB 1WG4A 3GR1A 4NXNJ 1FWPA 1SV5A 2DNOA 3M6WA 2RAQA 5AJ3F 5ETMA 1A6LA 5GAGU 1F60B 4HACB 3SSSA 3Q8VA 3MZIA 4NA1A 4U7CA 2YBVA 2G4BA 2PDAA 4B9UA 5C2CA 1S5ZA 5E5NA 4DJBA 3KLIA 2XM3A 5GAEI 3IR6B 1YQHA 2UU9F 4ZCIA 4NLUA 2MGZB 1NCLA 2VIHA 2ZJQQ 4G65A 4ZA1A 1LFPA 3ULHA 1HNIB 4DL2A 4LRCA 3CEDA 1XMBA 4CLUA 2MLXA 3RGIA 1XR7A 5IXUA 4WZMA 1BQNA 2DK2A 2HW3A 3D54A 4RW6B 2HGNA 4HHUA 3O8WA 1REVB 3MFHA 4DUYJ 3OXFA 2W9BB 4P2FA 1LOUA 1ZA2B 3W2WA 3TQEA 3E8OA 2BUNA 4DV7J 4D3GA 2MQ8A 2EBGA 4C11A 3T41A 3EMTA 3CO0P 2DCUB 2VUGA 5I3UB 3MR7A 4LRBA 1QDUB 3R27A 3OL9A 3AOBA 3M8ZA 4Z37A 1TR0A 2VBZA 1QAYA 3NKYA 1RB0A 3R6LB 2W1BA 3UQSA 4EK2A 2K3KA 2MQOA 1D3WA 2DITA 1IVZA 1LNQA 2M52A 3MAAA 3QIDA 1H98A 4WP8A 2IA6A 4FNHA 1BGXT 4XPCA 2IRYA 2KVQE 4KGMA 2WONA 1TU0B 4K5SA 3US5A 3H42A 1J5EF 1IJFB 4MK7A 2BEFA 3IWNC 4H4MB 1U0HA 4QR2A 2IAJA 4ZVEA 1V3SA 2VHGA 5CD4A 3KG4A 2DGWA 3W5XA 4DR4F 1LWXA 4WE1A 1YKWA 3HHEA 4XDCA 5SUHA 5IZHA 1S1VB 2AW0A 2EXUA 1BQMB 3R5CA 4DV0J 1B0VA 5F8MA 3EGVA 3GTYX 4JBCA 1WORA 2DRBA 3FGVA 1JB0C 4KO0B 3DMJB 2MJNA 2GIFA 3M2VA 1X9MA 5DDOC 3GZ7A 1H7XA 1EARA 1R8PA 3KK2A 2P9GA 1JXVA 2X7IA 4URQU 2QMWA 2ZDOA 3TNVA 1XBWA 1VQ6S 4N5SA 4L73A 4F2RA 1FD8A 4DL7A 4CIOA 5HMWA 3LW5C 2ROGA 4USJC 1PBUA 4FXVA 4G1QA 4X64F 2NYHA 1LXNA 2WVBA 3DN9A 2YQ0A 4DFMA 5KFHA 4WU2A 1FFGB 5DQIA 5KFZA 4KGXB 2ZWPA 2J8SA 2GJFA 1OPIA 5L9XA 5L1JA 1TVRA 1AYEA 1WC6A 4Y2KA 3I6PA 4PXBA 4CO3A 3NGRA 5AXMA 3GIMA 1L3UA 4OYOA 1IQTA 3A12A 4FVCA 1MMLA 3ET6A 3DFEA 4U7UK 4DL3A 1YLXA 2B43A 1CS4B 3CCZA 1S1WA 3IG1A 5IM0B 4WFAQ 3H5YA 4RKUC 3N4WA 1HR0J 1D09B 2XEXA 4RU2A 2NXNA 1HQUA 2MKHA 4IOCQ 2JC1A 5HBMB 3GE9A 3MM9B 2UXBF 1RE1B 2ATLA 6FDRA 1XMOJ 3D9BA 2E44A 1B0TA 4DQPA 1BXNA 1DLOB 3DOLB 2POKA 3W5YA 3RRGA 4O3RA 4FKXA 2IY5B 3KJQB 4GVBA 5AXKA 2W7AA 4ZPTR 1KLMB 2CXEA 4URGA 1MN7A 2MZ1A 4UUWA 2DXFA 2E1CA 2OTLS 1Y3KA 1K1QA 1UVNA 5FJ4A 3LP0A 4C8NA 1TMJA 1NKCA 1KP6A 1X4EA 2FVPA 3K5LA 1XR6A 1Q82T 3CJSA 4ZP6A 1NLKL 1YJVA 3NLCA 4OZ1A 6FD1A 3TX8A 2YNFA 3FCHA 5CQGA 3A3NB 3CJ0A 4QWAA 1VCTA 1WC0A 1CQMA 5HMYA 1X5PA 1PC5A 1Y11A 3UCZP 2F1FA 1Q4RA 4QU6A 2CADA 2LDIA 4RUAA 2HBRB 1QAJA 2H65B 2C2NA 1HQEB 4X4SA 3IS9A 1N34J 2AZ1A 4LMZA 2FC8A 1HD0A 2ZHOA 3CDEA 2B4PA 1CBKA 1BY9A 1U25A 2VA2A 4IFVA 4CDIA 5DG8A 3KYLA 1M5KC 4YR0A 1E6VB 3MM7B 3OHAA 3OL6A 8RUCA 3K5OA 1N5VA 1HBNA 3ICLA 2Y0BB 2FY8A 1PILA 3JSRA 4KE5A 4B9LA 4KJIA 4O3PA 1HWJA 4HH1A 2VQFF 2R7SA 2DO0A 1RP5A 3CGIA 4DR2J 1ZOTA 3CMQA 3H5UA 4OZNA 1X31C 5D0HA 4ZIVA 3HX9A 5HJYA 3UE2A 2CPEA 2ZC4A 1P1LA 5DG9A 5KFVA 3OVSA 3TAMA 1PJ5A 1HPZB 1EQ0A 1MMDA 3A8IA 1RXOB 2EC0A 3E01A 1GXUA 3MEGA 2HHXA 2KT3A 4FVMA 1AFIA 1G6BA 3PW4A 1RTDA 2HFOA 4H4KA 4TU9A 4IG0B 2D74B 2E9RX 2QGFB 1UFKA 1X7VA 2VFTA 3J7YI 2Y1JA 1WI8A 2D3ZA 2CPJA 4DOZA 2DYAA 3LP2A 5I4MA 3C19A 5HL7Q 2G1DA 2MLZA 1KN6A 3SCLE 3PV8A 4OI2A 3U1LA 5KT4A 1HQ2A 3W1YC 4LFBF 3S6EA 4ZCMA 1U02A 1Y10A 1ITPA 5A2QY 1OIAA 4X2BA 4IH7A 2ZNZA 3EGWB 1GMWD 2ZVSA 4JV1A 2WOMB 2D9PA 3PX6A 5DETA 2ZM6J 4J90A 1HR0F 3NWRA 4HKQA 2CG4A 2R3VA 3AODA 4OYZA 4XDDA 4FS1A 3DXSX 3BGRA 2H54B 4R5PB 1SUQA 1FTCA 1HA1A 4HYKA 4KTQA 1TELA 1HWIA 1U1NA 4WWSA 1XMOF 1UWBA 3GIRA 1NK6A 5D78A 1JLFB 1GNKA 3B8HA 3D1OA 2A6OA 2CNNB 2J7WA 1FFWB 2AJQA 1TKZB 3BF4A 4KT0C 2OPQB 2E66A 1Q81T 2NS1B 2VKRA 3VALA 4DF8A 3GV7B 3ELHA 4WBFA 2CFXA 5CCLA 2IC3B 2YXLA 4OYWA 1VQYA 2GHWA 4IOBA 3W61A 1RHUB 1UPMB 3LP1A 4V1Ak 1FK9B 1VRUB 1PJ6A 4TY8A 1SH2A 4PWDB 2KHDA 5KFBA 3ZO7A 3OV7A 1HARA 5ETRA 4ZP9A 2RDIA 1NSAA 4HI1A 5FDLA 1N32J 1S0OA 1FRJA 4DV3F 2JJ4D 4USWA 3MM8B 2AX0A 4DV6J 3PR5B 2E5HA 4LFCF 2PEHA 2XQCA 2YWEA 2KJWA 5HQLA 2RUSA 1RT4B 3CD5A 1AUDA 2F65A 2V0NA 5H9EK 2XSFA 2KVIA 1S6PB 5DJBA 1S59A 4B3SF 1YITS 2PMHA 1BMQB 2CJQA 4Z2XA 2XI3A 4NYOA 3VV2B 1RUSA 3MF5A 4DN0A 4TLQA 3UW1A 4UW2A 4DR7F 2YNIB 1N54B 2JLFA 5LOQA 2KI2A 1AZSB 5AXLA 2UUCJ 1C0UB 2DGVA 1ZS6A 1KHWA 1QTNB 3EVMA 4F8RA 3M8PA 5DM6Q 2HNZA 1PGZA 2HWHA 4U8VA 5F0UA 5K9FA 1T9TA 3J81Y 2DGTA 1CJKA 3CC7S 3QGHA 5BXIA 3JXOA 1LW2A 3F0NA 2WB1D 3FC9A 1P1TA 1DHMA 1Q8IA 4OIXA 4I6YA 4EU0A 1TFYA 5KFWA 3CJ8A 2C2EA 3B54A 1RBLA 4ZVGA 3GWCA 1S57A 2ZH4A 3MMBB 4WFYA 4C8ZA 4QPTA 1TP7A 4G1PA 1NPPA 2ZVIA 2V94A 1HWUA 1LW0A 3Q2SC 4IOAQ 1IM4A 2PFFB 1WDTA 3NS5A 5BYRA 4OX8A 6AT1B 1HBOB 2BE9B 2DVIA 1RTHB 1CC7A 1SJ1A 3O5TB 2F4VJ 1QD1A 5KFIA 1FNMA 1XTZA 2NR0A 2CVEA 3LOUA 1X4DA 4RWXA 4OYAA 3SDEB 4ECXA 3KUGA 1RAOA 2BRLA 3MCNA 5HROA 3UI3A 4MAKA 5A8KB 2C2DA 3TA2A 1ZZFA 3G87A 3HK2A 1W2IA 3HHDA 3UFCX 1WI6A 2BA9A 3M9NB 3S01A 2RF2A 5D15A 3H4DA 3UWTA 2M9KA 4ILMA 3DYAB 1DY3A 4NCAA 5GMDA 2QA4G 2W2QP 1U0SA 7FD1A 1F0XA 3Q86A 2BOAA 5HVGA 1KFDA 5I42B 3Q8RB 3PRVA 4RW4A 4OFZA 3AD8C 3D4JA 3G2XA 2FHJA 3NMAA 2DGSA 4OLOA 2V8PA 5L8RC 3W3SA 3D0HE 1BWEA 2MJUA 3VAJA 2AYMA 4OX9J 1DQAA 3R3TA 4K0KJ 1PC4A 4LF8J 4Q0BB 2J7UA 2BM0A 3N9UC 2VONA 3HSDA 2ZFHA 4XAKA 3UN3A 3JQJA 5AXNA 4DCOB 3QZ7A 3CJ2A 1RAJA 4FYWB 3HF5A 4A8XA 5C25A 5JVGQ 1N32F 3U1MA 1NKBA 3SV3A 1S6UA 3IBCB 1S1TA 3NCPA 2XMJA 3P5TL 4DV6F 1DTTB 5CYQB 3UDEA 4H4KC 2JX2A 3NY0A 4ES2A 2Y3YA 3LA0A 2NPFA 4DU8A 4RNNA 1K44A 4LVNP 1GMUA 2M88A 5F3ZA 4LF4J 4ZPDA 3KLHB 4FN5A 3KLFA 4OZ3A 1GTHA 1R0CB 1WKKA 4AXJA 2IM0A 3IXQA 5AE1A 1R8CA 1SC4B 4BDPA 1NRKA 1H38A 4M5JA 2FQQB 4M5DA 2YKMB 4I4BA 3DRPA 2UXCJ 5I3PA 3V81B 2HAFA 3QRRA 3BGOP 2YPYA 1UEVA 4CYUB 3PW5A 3N01A 3DDNA 2AJ2A 4YY3F 1C1CA 3KK3A 1U24A 4A8WA 3PVXA 4EBDA 2KG1A 3TARA 1HNVA 4LF2A 1NDLA 3AB2B 2H3EB 3IA0A 5B0GA 2OSQA 2FB0A 3M8QB 3EVOA 4IUFA 3EZUA 5IV3A 4LBPA 3MEDA 3MAQA 2HS3A 1EETB 4ES3A 3R5GA 1RWKB 2VDHA 3FDSA 4I2QA 2VBXA 2K3IA 2VPYB 1UVJA 3M2RB 4E0DA 2LP4A 2FLNA 5CZXA 2H5JB 1HWKA 5KFRA 2UUBF 4EO8A 3GV5B 5B0FA 2R2RA 4X62J 3DNCA 2ROEA 5F8HA 4G3IA 3Q2TC 1LWFA 3PO5A 1RYRA 3PW2A 2RKIB 2F4VF 3NGKA 2OPSA 3ZXWA 4CT8A 1KTVA 2PA3A 5G0RB 2MY7A 4F0HA 3T1AA 5IT0A 2KM8C 4B17A 2IVMA 4FPRA 1ZZNA 3CJ4A 4ZVHA 1JLCB 1N0UA 3VGUA 4JI0J 1JNRB 2KXNB 4NLPA 2JLGA 4C8YA 2LEAA 3BKFA 4K5RA 2GJ2A 3DHWC 3TP2A 2QFJA 1YWXA 2C1EB 3N6MA 4I2PA 4B3OA 1DTQA 1NPKA 2X1AA 3R6GB 3JS9A 4WTYA 3HI9A 2UVUA 3OFFA 3VAHA 1CULA 2R7QA 4CO5A 2XYHB 2DR7A 3FEZA 4ECTA 1VQ9S 5T7LA 2HHHF 4FYYB 3BQ1A 3UNYA 3RBXA 3CCVS 3D28A 3DRRA 3CJQA 1NK7A 1R0AA 2HMIA 2AGPA 3ZZUA 1YGYA 2LEBA 4PWWA 4DL5A 4OJ1A 1U1RA 3ILIA 4F2SA 4LQ3A 4UUXA 3FCVA 4L75A 4F0MA 2UVVA 4CH1A 1T9UA 5KOWA 3EPGA 2GQQA 3VCDA 2ZOFA 4LBIA 1X0PA 2GVZB 3GIIA 3QJLA 2EFQA 1D0EA 3AA9A 3DLLQ 1PCAA 5F3TA 4CLZA 1TAUA 4ED0A 3HFZB 2MXYA 2YTCA 3V2UC 2ZBQA 4DN9A 3GPAA 3RB4A 3CJKB 1FEHA 1FRHA 2HHSA 2BJ1A 1VHIA 5C42B 4DSLA 1EZZB 2KO1A 4JI3J 3TQ1A 2CZ4A 2BXJA 1MU2A 4ECRA 4QYZJ 1PAEX 3BS9A 4CO2A 2Q1LA 4DI6A 3WBZA 4MYUA 1U48A 3PEJA 1FJGF 2CPDA 4FYDA 4LF4F 4HLBA 2BW7A 2WK4A 1VRTB 5KT5A 4C98A 4MKBA 2B8PA 4DR6J 1TL7B 2WSFC 3LQVA 4ZK7M 4ECVA 2YWKA 2ZH7A 4MKVA 4OYMA 2UXCF 4PG4A 1U8SA 3IMQJ 1P8GA 4NRUA 1KVKA 4OX6A 2F63A 5KFNA 2HHPA 2ADCA 3GCXP 1WKJA 4DFJA 3BGLA 3DOMA 3GONA 5DZ7A 4ILRA 3VF0B 4ICLA 4CNZA 1D9FA 1SJQA 1VJQA 4NCGA 1RU2A 3SFUA 4ZKAA 5GMEA 2OPPB 3KJFB 4Y0FA 4N76A 1C0TA 5CA5A 4UF4A 3N6LA 1S97A 2A18A 3MEEB 3MPDA 1L3SA 5EX3A 1SJ3P 5FLXU 4FNIA 2IYIA 2QA2A 1SC6A 3BSNA 1N52B 2YX1A 1O0PA 5L46A 5KFMA 3NBPA 5T41A 4RUCA 4RWWA 3GILA 3N5BA 3MOZA 4DS5A 4UQGA 3W62A 2BE7D 4FPIA 5DZ6A 3ENQA 1S10A 4DQIA 1IBKF 4H4OA 4KKOA 3VQSA 4BHQA 4X62F 3TWZA 2AX1A 2WB4A 4I56A 1S1XA 1XK8A 3H4BA 3RR7A 2RHQB 1UVKA 2CZVC 1VQ5S 5JMNA 4QZVB 2WSCC 2CG8A 1SPBP 2MSSA 1HIYA 2EKNA 1NEEA 1NXIA 1U0HB 2ZH5A 2HK3A 2IAJB 2Z0GA 3NCRA 2FPHX 5GADI 4F02A 4R0EA 1RLCL 1SB6A 2VV5A 4NLWA 4WE1B 3O44A 1KFSA 4I7FA 1OY9A 3PACA 4JI0F 1YRUA 3Q8YA 3JTNA 4O0NA 2A3JA 3LO3A 4ZVRB 5EX0A 1IR2A 2H9ZA 4WK3A 3NEKA 1RWXB 1S0NA 2RQMA 3J7Z5 3ZZYA 2APOA 1RTJB 1U49A 2KRBA 3I9ZA 2HWIA 3OD2A 1HYSA 3M2VB 3L7OA 2XS2A 5F9NA 3UCUP 1OMSA 5B0AA 2ZBCA 1BC6A 2G2ZA 1OO0B 3OTCA 2CJKA 2NYIA 1ELOA 3BV8A 3BSAA 3QGPA 3R5BA 4AT1B 5F9LA 2A2CA 5LJ3Y 4B3RJ 2AIRB 4WPAA 2HNDA 3K59A 2EBEA 4ECWA 4N7TA 1NO8A 1YTYA 2FJEB 1FDDA 5ETQA 1WDDA 4LJMA 4X4PA 3G6YA 3A8EA 2FYXA 1VI7A 2XWXA 3R7NB 1UWAA 3VAIA 2XCPA 1X60A 3MPUB 2XLKA 1TVRB 2QL5B 3IAM9 4RU9A 1Q53A 4Y6IA 4CLLA 1KONA 1NH7A 2VPZB 1ZETA 4BC7A 4OV1A 1F9HA 1OSDA 2EPIA 2FUG9 1WNEA 5CYJA 1R6YA 1R8BA 4DQQA 4J7CA 5A0YB 3W2VA 4M5IA 2OEJA 2HNYB 1FRMA 5KFDA 4JI3F 4DG1A 1KQFB 3R2DJ 3SV4A 1VQPS 1S1WB 5HMZA 1SQEA 4QWEA 2DPIA 4ZJLA 1QSYA 2O01C 2IM2A 3QIPB 4ETXA 3ISNC 5K8NA 2EG1A 2V5HG 4JI4J 1ZYQA 4ID8A 4NE9C 4Q2LA 4QYRA 2H4YB 2LU2A 4XK8C 5KFUA 2R2UA 4OJ3A 2R7UA 4L6V3 2KXHA 2IBKA 1GXTA 4KHPF 2ACMA 3QAEA 1WF1A 1UJ6A 4O3OA 2NREA 3OTDA 3T5LA 3DLKB 1MROB 1RAHB 5KG0A 4X4TA 4F0KA 1JK9B 3K2YA 2E5IA 4RUHA 5D4OA 4NA2A 4ID5A 2ZZTA 2HGLA 1X4GA 4KFBA 3DI6A 3IM9A 5FLXY 2QA4S 4GVLA 3G6ES 2KZMA 3T1HJ 5IQ6A 4EWTA 3FEYB 3UPFA 1T8EA 3QMQA 3NMRA 2OGUA 4C7QA 4QIVA 5C7PA 4ZLPA 4QIFA 8ATCB 3J7ZT 1YJ9S 4NZ6A 1R0BG 4LSZB 4AL6A 3OT9A 3DGPA 1S1UB 2GVDB 5KT3A 3GU0A 1IR1A 2O1PA 4PCQA 1GEHA 5D0EA 1NNDA 1N6QA 3RW7A 2I38A 3MECB 3KG1A 2LXUA 1TKXB 3Q0AA 2C28A 3TZYA 3NNCA 2D9OA 3D6TB 2LLZA 2GC8A 4NLOA 3IBFB 3CF5Q 3MMCB 5D4PA 1JMTA 4ZPBA 1UA1A 5JVHQ 1RAAB 4UTGA 1SQGA 5HP1B 1EP4A 2D3UA 1SBRA 4PG5A 1GX5A 3HD1A 1EKSA 2K06A 4XPEA 5E2QA 2E7WA 4LF5J 4M95A 1S9EA 1YZ7A 3N79A 2A0FB 4YP3A 3Q23A 3EGZA 3V6DB 2Q3PA 4ED2A 3JQMA 5EUHA 1Y9OA 3GG0A 5HK4A 3R8YA 1E6YB 3MUTP 1JLGA 4F4ZA 3H7HB 3SEOA 1RWNB 2OD4A 1U1KA 1HD1A 3A8JA 4LR8A 3E01B 2P9CA 2HFSA 1HHTP 2DGUA 1QVGR 4B3RF 1SH0A 1OY6A 2CA9A 4P10A 4OHZA 4DV1F 1KOOA 3CMAS 2RDDA 1TKTA 3H20A 5IS2A 4C3MA 2XB2D 4NPOA 1FD2A 2RDJA 4ED8A 2DNYA 1FJ7A 3JSMB 4UOGA 4QR0A 2JVOA 4QCLA 1QAXA 3DLBA 1K0VA 1WTFA 5T14A 4Y65A 5FIIA 1NK8A 3GIJA 5C24A 3M1VB 2Z30B 2W7OA 2DR6A 5CH7B 3ETOA 3OR2B 5CYMB 4YN3B 4K8RA 3H40A 1J5OA 4IR9A 3TW0A 3G71S 2M70A 4P73A 4A8QA 3EDQB 4K4UA 4PR6A 1GAOA 2V4QA 3V6JA 2IRUA 2YY3A 2GMHA 3G82B 2V6AA 3GFYA 1RT2A 1T9XA 2UV8A 2AT1B 4ILLA 4JUZA 3DRYA 3KDNA 3SQGA 5CXTA 3BGRB 3CNQP 2JC0A 1CJUB 2AJ4A 3TJAA 1TK0A 2DHHA 2HRUA 5H9EJ 3H2LA 1BWVA 1GFWB 3D1HA 4TY9A 1RWOB 2CIMA 2Y0SD 3C2PA 1VMBA 3CCUS 2ZZMA 4I1TA 5LXRA 1HL6A 1N56A 3CC4S 1U2CA 2X1BA 2R2SA 1LFWA 2EFNA 4M63A 1WF0A 2VKZG 2ASYA 3OFGA 4MFBA 1S77D 2FVSA 5C5JA 2CPZA 5KFLA 2FVCA 4CTAB 4ZS6A 2EVZA 3N5FA 4MK8A 3T1HF 4TY8B 1SC3B 3RJMB 5LSLA 2CNLB 1LWCA 2QZ8A 2VH7A 3T3FA 4KPCA 3CTRA 2K8GA 1U09A 4WYLA 4CLTA 2MKIA 3RTVA 1S7HA 1GXLA 4KR0B 5F8IA 4R8UB 2HRYA 2HBQB 2VG5B 1VQNS 2W9AA 3AJ1A 2EW9A 3KLGA 3P5BP 5KAKA 3LPEA 1WHVA 3QLHB 3T1YF 2HFZA 4OJHA 1OY8A 3QWUA 2VICA 2GJIA 4OJGA 1FXLA 5GAGI 4KAIA 3CD0A 1TK5A 3LGHA 2P6SA 3D6HB 1FKOB 4F25A 2GA7A 1T05B 3ONQA 1I3OB 4P75A 2V4JB 2FTRA 5IT9Y 2O3DA 2FIUA 3H0PA 4LF5F 1H0HB 4DHVA 2XZDB 4BWMA 2IIHA 5E3CA 4NASA 3X3UA 3HP6A 1NDCA 5D4NA 4O3SA 3KUEA 3KK1A 1RBAA 5E33A 4FBUA 4GC6A 3V6HA 2Y1IA 2R4FA 4FXWA 3M8PB 3UD5A 2X1FA 3TA1A 3QPIA 4PXDA 2R8GA 2I6WA 4DUZJ 4QPXA 3VHQA 4X4QA 2FJXA 4MKAA 3BGFA 1IKXA 4KHMA 2V8HA 1Y00A 4KY3A 4OYBA 3M8SA 3K17A 4HTIA 4IRCA 4A8MP 2D7SA 4PEOA 2DNGA 2RVJA 2ZE2A 1AT1B 3OLBA 2HYIB 1KR4A 2P5VA 4F4AA 3ZFVA 2IA0A 5KG5A 4RUBA 4ZVFA 1U26A 2IYGA 1LW0B 2V8VA 3NRBA 2ZHBA 1Y5LB 4BC9A 1TAQA 1X4FA 5JXSA 5E7OB 2OO4A 4ELTA 4OZ2A 4KGKA 3NGDA 1RT6A 3QFHA 5AE2A 1D1UA 2PFDA 3NG8A 4LF9J 3CD6S 4TLRA 1EHWA 3TZWA 2LA6A 1CC8A 2NXCA 4RW7A 2C3OA 1R89A 5ETKA 3NOGA 1MSWD 1LWEB 3ETMA 2VPWB 3HVRA 4LSNB 5ETLA 1Q95G 2KH9A 1NZ8A 3S7RA 2RILA 1QSSA 1G2EA 2RF2B 4RNFA 5IOLA 1FXDA 5KFEA 3MGJA 4ED4A 1RT5A 3JB9k 3TEHB 1RAIB 5BJRA 3CPWR 4B02A 2ZH6A 2AZ3A 2I2YA 4NLTA 4ED3A 2OPRB 5MAOA 1C1BA 1N36J 2IVYA 5D4LA 1NHVA 1R6VA 1WACA 4NEZA 1HNXJ 2KT2A 1YVFA 2XMUA 3SCKE 3W9JA 3I31A 3PW0A 4O44A 4DPXA 2B56A 3BREA 1UA0A 2YX7A 3ENVA 4CLKA 2I8EA 3PJXA 4YMEA 1S6OA 2CQGA 2C3YA 3RAQA 4MIBA 4Q43A 1B4SA 4I6AA 3CB4A 1IJEB 3CE8A 2XY6A 2GNKA 3CCTA 3PZPA 1FJEB 1JLQB 5IC4B 1NJXA 4P52A 4HHHA 2QRRA 5I3QA 5KFOA 1WOPA 1HBUA 2DEIA 4BLGA 5ETPA 3KLFB 2C2KB 3IC1A 1NHKL 2UXDJ 4R0JA 2DNLA 2HVDA 2Z8QA 2XZTB 1C4CA 2L48A 1T03B 4DWIA 2QLBB 2H51B 2VQEF 4OI3A 2DPJA 1TL1B 4PYDA 3DLEB 1CJTA 3QT6A 1C1CB 1N5TA 3Q83A 1W2BR 4C3KA 1X8DA 2BX6A 4ECUA 5A76A 4U6PA 3OJSA 1F6TA 4EYHB 3BYPA 5IWAJ 2PN6A 4OZ5A 2ZH9A 3GYXB 2DTJA 2B9WA 1T94A 5D0RA 1QVFR 1I51B 2FLOA 4WFXA 1MWYA 1JKHA 3MR6A 4QQBA 4I2QB 5HO4A 4A8KA 3FFIA 4DS4A 4EFAC 2JRSA 4HACA 1JWWA 3ILLA 1Z2ZA 2HG4A 3MEKA 1TL3A 5B0EA 1T9WA 3L7PA 3OW2R 1NDPA 5LJ5Y 2HVIA 1QUVA 1U7LA 4YQWA 2ALYB 5D3GB 1JJCB 4WFZA 5IQQA 3QNWB 4YHHJ 1QE1B 4L3NA 5HQMA 4AXIA 5KOXA 3CDAA 2MGZA 1RU1A 3Q89A 4S0MA 4K4YA 1ZM3A 1UVLA 4PQUB 4ANDA 4ZVQB 1XMQJ 3I5AA 3KFWX 1B64A 4QIWD 4YEAA 2OLWA 4PPDA 1RK8A 1KDNA 3QYYA 4DXLA 2XS7A 1UW4A 3HHLD 1ZA1B 4JI7F 2W9BA 4ED6A 5LT5A 2OIHA 4I2PB 4YOEA 1DTQB 4J9LA 1H3DA 2AF6A 3KLEB 3PIOQ 5CABA 1XEZA 2Q6BA 3RRHA 2DD8S 4WP3A 1ICEB 5I3UA 4OHWA 3UCGA 2ZDPA 1UVMA 2OD6A 4JI6J 1WJ9A 3DRRB 1IWGA 1N36F 1KOHA 5CCMA 3HHKA 2VBWA 2HFVA 2P2CB 5E41A 1L3VA 4C9DA 1HNXF 1AA1B 2DR8A 3FKBA 1UL3A 3PJWA 4IH6A 4Y28C 1W26A 2BANA 3M2UB 4J9SA 3BO3A 3HZEA 2C3UA 4DR3F 3G6VA 3G86A 4ZLLA 1XR5A 4HL9A 5J2QA 4JV0A 1VLYA 4FF3A 1RHMB 4H4MA 1U1QA 2ZKUA 3CULA 3VGSA 1WEXA 4DR1J 1RWUA 4NLRA 3PM9A 3CJ3A 3ITHA 4AQYJ 2KXFA 3EXCX 4CLWA 1S1VA 1KD1T 1BQMA 3UDLA 2HIYA 2K7KA 1Y7PA 2XSJA 3CCJS 1U8WA 3QRPA 1RISA 3CDUA 3P8BB 2UXDF 1M1GA 3UVJB 2FJWA 1H6KX 4OHXA 5K8PA 1PIEA 2QE5A 2W4CA 3MDFA 4QOTA 2AD9A 3LF0A 2MZQA 3GJTB 3RG6A 3TRGA 3L95X 2B0GA 3DOMB 4K50A 1WSRA 2BRKA 3RB3A 3A3PB 2Q43A 2XMKA 1CG2A 1NDKA 3LAMA 4YB5A 1OJ4A 3MM6B 5DGBA 1S12A 5M2PA 2V2ZA 2ZC3A 3RUBL 5F8JA 1K1SA 1MW7A 1C0TB 2W9CA 1VS3A 4QWBA 2CJBA 2QSFA 3NL0A 4JV5J 2ZH3A 3I0RB 2XWYA 4DX8H 2YWWA 3H59A 3FEXB 4KSEB 2KU7A 1ZPWX 1RT1B 4YB6A 4AL7A 2IMWP 1KWMA 2W8LA 5HQ8A 4KYZA 3D67A 3J80Y 3OHBA 1FWKA 5IM0A 4TYBA 2C42A 4H4OB 4KKOB 4GC7A 3OL7A 4DMZA 2CAJA 3V4MA 4F3OA 2HQ3A 2GV1A 5RUBA 5HBMA 2G0CA 5LM7E 2VD3A 4ERDA 3TZXA 2DY1A 3MM9A 1N5SA 5H9FK 3QO9B 4RW8B 2J6SA 5D0GA 1I94J 4AL5A 4YS2A 1IBCB 3T5HA 3UO0A 1HNZF 2JHEA 1RDRA 1RABB 5HATA 3D2WA 3C6UB 1DLOA 4J5OA 3DOLA 5EGYA 3NAHA 1UKUA 2J6TA 3HHLB 1FDAA 3HT3A 3FZ2A 1KLMA 4B08A 4KQZA 3CIZA 3PR4A 2ZJRQ 5ETNA 1YBAA 2IHR1 2NUUG 3RZAA 1HW8A 4UOCA 4QYZK 1G1XA 4G1IA 3R1LA 3DM2B 2CQIA 2B3TB 3ZZRA 4DV2F 2YKAA 2U1AA 4WZQA 3LWLA 1WOOA 5AE3A 1HYSB 1N33J 3F56A 4C0OC 1LEOA 1V3RA 2AJ0A 2QIFA 2OHDA 5AT1B 3IP0A 4U8YA 2YVSA 4C3LA 4DX6A 2CNOB 2CQDA 2HNDB 4Z7YA 3IWXA 5J1PA 3MPWA 2FGOA 2B7CB 2JNJA 3QT7A 4NX9A 4TVAB 1DJ0A 3QZ8A 1HLWA 2XO6A 2ZEJA 5THWA 3WHIA 3TJ9A 2OKQA 3HJVA 1RCXB 2DXEA 3VGVA 3CCLS 4A8SA 1E6VA 4OMFG 1KS2A 4DR5J 4GKKJ 2PT0A 3MM7A 3BR9A 3BBFA 4C48A 4YR2A 2HFUA 5KG3A 2HHTA 2ABYA 3E2EA 4RZRA 3WDOA 4B3MF 2WVCA 2XNRA 3AB4B 1TKDA 2P8IA 3BR8A 1IKWA 3I87A 4DR1F 1FCAA 2QLJB 4F3MA 3MAHA 3AA8A 4AQYF 1D8ZA 3F44A 5E3PA 1U6BA 3A8KA 2J6UA 2M3DA 1Q8LA 4KIAA 3HO1A 1TTHB 2GGPA 2DEJA 3HJFA 2Q6CA 5M2UA 1JX4A 3MCOA 1FRXA 3UR0A 4Q2MA 5A8RB 3OR1B 2BABA 2IJNA 1T9YA 1UCNA 4NXNF 2NZCA 4IG0A 3EDRB 3RRKA 3QBCA 3MURP 3VVTA 1PSDA 3C14A 3QAUA 1Q5YA 2PA8D 5SZTA 4ID5B 2C2RA 3A1YG 5A2QU 5HLFB 3AT1B 2YH1A 2YQ1A 3FNNA 4I69A 1RACB 3FQKA 2ZUAA 4UQTA 1TUWA 1FX4A 4TNOA 4QW9A 4PRFA 3FUYA 2NCKL 2MZTA 2COLA 1IM6A 2H48B 3THVA 2DNNA 4JI1J 4LIWA 4EMDA 5ETSA 1GT8A 4MH8A 4Y3CA 2Z57B 2FJBB 4GO7X 2WVEA 3DGPB 1WF2A 2YKOA 2WZ1A 3POTB 4NLVA 2WOMA 5MLCV 4RNHA 2FHKA 2AEJA 3PDNA 4AE5A 3SFGA 2GMJA 2F4FA 1N6QB 4HI2A 4ECSA 5E3QA 1FFSB 4R5PA 4UY8T 4DBQA 4DUYF 3MHYA 2KZZA 2V50A 3O6QA 1VBKA 2CQ2A 2E1MC 3LPYA 3UR3C 5BYQA 4M5HA 1M5OC 1I94F 4U7UD 1VBZA 4CCHA 2A2DA 3M6UA 4DV7F 3HZGA 2CJXB 9RUBA 2GIQA 1JLFA 1G4CA 1IWAA 2UVWA 1YDLA 4P74A 2HPUA 3D1QA 2MSTA 1NK5A 3KTQA 1REGX 2E5LJ 3L3CA 1H2VZ 2PSZA 2IC3A 3EZOA 4MYTA 2DT9A 1FDNA 1VFJA 1SCJB 1VRUA 3WZ0A 1N33F 3KHRA 1FA0A 1ZAXA 4NLDA 2XO7A 4PWDA 4D3HA 4JV2A 2J0SD 2RRAA 3HLUA 2UP1A 2H4WB 2E7XA 4P9SA 2J0QD 2BQRA 1O8BA 3C6TB 1IKYA 4NLGA 5KFQA 2Z58B 3MM8A 3HDSA 1MNEA 1KQSR 1M5SA 3IR5B 5HANA 5DRKA 2BYCA 2JSXA 2KTQA 3C16B 3EX7B 2RJZA 1WC3A 4DV0F 1S6PA 1P6TA 2YNGB 4KC5A 1LXJA 2R8KA 3W60A 5C24B 4BBYA 4N8NA 1Q7LB 2HEKA 2DRDA 2C2OB 1PYOB 1SKWA 1Q79A 3DC2A 1HMVB 1ZH5A 1VQLS 5HSPA 1FO1A 4GMKA 3NGTA 2F8MA 1NB2A 3OTEA 1QUPA 3JTPA 1S9FA 3JSBA 1HWLA 2YNIA 1QY7A 2IBOA 3EGNA 3RW6A 4TU7A 3VWSA 4GKJJ 1KRPA 1AZSA 1JQGA 3TAPA 3J81U 2CPYA 1C0UA 3ENAA 5DS7A 1K9MT 4ATNA 4F3QA 1V9OA 1RAGB 2WRMA 4DV5J 2ZBIA 1L3KA 1D9DA 3FRYA 5K14B 2IRXA 4F4XA 3MCMA 3K7RA 1S49A 3AJ2A 4HDHA 3KMSA 1S76D 2G0IA 4W90B 4IO9Q 3BH6B 4NLXA 4C2MA 2VG6B 2EG2A 3W64A 4J9RA 3MOJB 1VJWA 2AMCB 2R7OA 3MMBA 4AFFA 5DDRC 4HT7A 4A46A 1P9QC 2NSBA 2YNHB 1CSJA 4O4GB 9ATCB 2Y8YA 3L09A 4K4TA 5U47A 4K2JA 4LRDA 3PCOB 3BQ2A 1PAUB 4WXWA 1JLEA 1OWXA 1UMJA 2BDPA 3QGIA 3C46A 1U2FA 1LWCB 4O23A
chains in the Genus database with same CATH topology
2BUNA 3UPFA 1T8EA 3KLVA 1VQKS 2LQBA 3QMQA 3R5DA 4D3GA 3NMRA 4ECYA 1U4BA 1RTHA 5ADZA 2XHWA 2EBGA 4C11A 1KLNA 1KQGB 3PXGa 3H2VE 1D8YA 2DCUB 4C7QA 2VUGA 4QIVA 4USIA 3J7YU 2KYXA 5I3UB 1RQ0A 1F9FA 4ZLPA 4JI1F 3CCRS 4QIFA 4PQUA 3M4XA 3J7ZT 4IQMA 3R27A 4DFKA 1YJ9S 1S9GB 4NZ6A 2VL1A 3OL9A 4OZLA 4AL6A 2J9CA 4Z37A 5J1EA 2W25A 1TR0A 2VBZA 3SDEA 2JL9A 1M5HA 4E98A 3MI7X 4RW4B 1QAYA 1JIHA 2KJVA 5F8LA 3NKYA 4E8UA 2KFNA 3DGPA 3I4HX 1S1UB 1VQSA 5KT3A 3KHHA 4C8LA 1RA6A 2XMVA 2O1PA 2DNHA 3UQSA 3CDWA 3GIKA 2AYBA 3B4MA 4PCQA 2R8IA 2OJ3A 2K3KA 2W7PA 2MQOA 1D3WA 1SH3A 2DITA 5JJBA 2FVQA 1NNDA 1N6QA 3RW7A 1AW0A 2I38A 3MECB 1QM9A 3KG1A 2I0XA 2L41A 2LXUA 3MTJA 1TKXB 3Q0AA 3KLEA 2C28A 5L39A 3IAS9 3NNCA 3Q8PB 2D9OA 2M52A 4DL4A 4DL0C 1S6QB 2LLZA 2GC8A 4NLOA 2BJEA 3QIDA 3CF5Q 3GFHA 1H98A 4LUBA 2IA6A 3MMCB 4FNHA 1BGXT 1JMTA 2QSWA 5D4PA 4ZPBA 4KV8B 5GVQA 2IRYA 4XPCA 4C8KA 2DHAA 1UA1A 4KGMA 5EDWA 5JVHQ 2WONA 2E5JA 3DYAA 5KFGA 4PUOB 2A10A 1VC6A 3RYLA 5HP1B 1EP4A 4K5SA 4ALZA 4IO1A 2D3UA 3US5A 1SBRA 4PG5A 1GX5A 2XC9A 4CH7A 3H2UB 4XPEA 1J5EF 1U1OA 2BM1A 1IJFB 5KG7A 1U1LA 2VODA 4MK7A 2BZ2A 1Z4UA 5C25B 2KT5A 4IYQA 3IWNC 2VG7B 4H4MB 5E2QA 2O67A 4ZPAA 4QR2A 2IAJA 4ZVEA 1S1TB 2E7WA 4M95A 1V3SA 2R8HA 3KJVB 2RRBA 4RNOA 1S9EA 3KG4A 3N79A 4YP3A 3Q23A 4WF9Q 3EGZA 2DGWA 3V6DB 4DR4F 2Q3PA 4WE1A 2ZITA 4NLSA 4ED2A 3HHEA 2MQNA 2BW2A 1N34F 4IFYB 4XDCA 5SUHA 5IZHA 1S1VB 2AW0A 5EUHA 3KOAA 1BQMB 3R5CA 1B0VA 1Y9OA 2ZD1A 3M2UA 2V8DA 3GG0A 1TK8A 2PGCA 2B5JB 4KPYA 3I5BA 1E6YB 2RMLA 2M0GB 3N6NA 3MUTP 5F8MA 2MKCA 1JLGA 4LIRA 3U02A 4F4ZA 4JBCA 4CZCA 4FF4A 3SEOA 2DRBA 3FGVA 4JI8F 3HXMA 4IG3B 1JB0C 4IRKA 2DNRA 1SKSA 2OD4A 3DMJB 4KO0B 4V19X 1U1KA 2MJNA 1HD1A 1IKXB 2M8DB 3M2VA 2LXIA 5L9NA 1X9MA 2R7XA 3E01B 5KG1A 5DDOC 3GZ7A 3I0SB 1H7XA 2P9CA 4CI0B 4Y34A 1R8PA 3KK2A 4DSEA 5J1NA 1HHTP 2P9GA 2MHEA 2DGUA 1QVGR 4URQU 2QMWA 4B3RF 4RBTA 2ZDOA 1FXRA 3TNVA 4M5DB 1XBWA 1VQ6S 2JEIA 4N5SA 3N0VA 1SH0A 2MZJA 4G6VB 5BR8F 3DRPB 4F2RA 2B9YA 4IQXA 1FD8A 5KT7A 3B78A 4OHZA 4DV1F 3K0JA 1DTTA 1KOOA 4DL7A 1FE0A 5HMWA 4CIOA 4IDKB 5F0WA 3GQCA 2B6AB 3LW5C 3CMAS 1TKTA 2ROGA 3H20A 5IS2A 4USJC 4X4UA 3QJPA 4C3MA 2XB2D 4NPOA 1N8RT 1FD2A 4FXVA 4G1QA 3WC0A 4X64F 1ZTWA 5DG7A 1V3ZA 2Q66A 2J7KA 1LXNA 3DN9A 2RDJA 4ED8A 3KK3B 2DNYA 4DR2F 4DEZA 1FJ7A 3JSMB 4DFMA 4QR0A 2JVOA 4QCLA 5KFHA 1QAXA 2P6TA 4WU2A 3S8SA 1JXLA 3DLBA 1HNVB 1K0VA 1LK5A 1WTFA 5EWFA 5DQIA 4Y65A 3EXYA 5FIIA 5KFZA 5T14A 5EN1A 1NK8A 1KEKA 4BS2A 3KLHA 3GIJA 4J9QA 1OSCA 5C24A 1OPIA 3M1VB 5L9XA 2W7OA 5CH7B 3ETOA 5L1JA 1RTIB 3OR2B 4DUZF 5CYMB 1TVRA 5KFTA 5J2MA 1RT6B 4R25A 4J9NA 1VQ4S 2DHXA 3MEDB 1J5OA 3H40A 4IR9A 4Y2KA 3I6PA 4NYPA 2YKMA 4PXBA 3Q22A 2DO4A 4CO3A 3I56S 3TW0A 3G71S 2M70A 4A8QA 3CMES 3GV8B 5AXMA 4L72B 3GIMA 4K4UA 3NP5A 1GAOA 4PR6A 2NUHA 2V4QA 3V6JA 1L3UA 2YWHA 2IRUA 3IGVA 2YY3A 2UVRA 1IQTA 2GMHA 3P49B 2IJFA 1CQNA 1DARA 3GFYA 4FVCA 4GKJF 1RT2A 3HPOA 1MMLA 3DFEA 2UV8A 2OTJS 4O3QA 1K73T 4U7UK 4DL3A 2FLLA 2B43A 3CCZA 3SCIE 4ILLA 1S1WA 4JUZA 4DV5F 3IG1A 1RT3B 5IM0B 4WFAQ 3DRYA 3H5YA 4RKUC 3N4WA 3SQGA 3MM6A 5CXTA 5H1SV 2J76E 3BGRB 4OLPA 4EZ9A 1Z1ZA 2XEXA 4RU2A 3G8QA 3W7BA 2JC0A 1TL4A 4ZDNA 5KFKA 1HQUA 3DLGA 3M8QA 2AJ4A 1TK0A 2MKHA 4IOCQ 2I9SA 2JC1A 2ADBA 2HRUA 3K5PA 5H9EJ 5HBMB 3BO4A 3GE9A 2VFSA 3H2LA 4TY9A 1Q1KA 3D1HA 3MM9B 1JJ2R 1EETA 2N4DA 3DRSA 2CIMA 2UXBF 1LWFB 2Y0SD 3OSPA 2YX4A 3C2PA 2ATLA 6FDRA 3I0RA 2CQCA 1VMBA 4EYIB 3CCUS 2ZZMA 1RT5B 4I1TA 2RT3A 1HL6A 5LXRA 1X9SA 2E44A 1N56A 2OPSB 1B0TA 1RT1A 4DQPA 3CC4S 1CEZA 3MD3A 2X1BA 2RU3A 1N5YA 1DLOB 3M2RA 2R2SA 1X0FA 1Y4ZB 1LFWA 1HHSA 2EFNA 4N76A 4M63A 1TL5A 3DOLB 1WF0A 2POKA 4LF9F 5DDQC 1HNIA 3RRGA 4O3RA 2VKZG 1C1BB 2ASYA 1T95A 4HDGA 3BN7A 2LDYA 4O0IA 5AXKA 3OFGA 3NS6A 2W7AA 1U6FA 1KLMB 4ZPTR 2HAIA 4URGA 2OFHX 4MFBA 4X4RA 1S77D 2FVSA 2ZKTA 2FHOB 5C5JA 2CPZA 2O5DA 5KFLA 2MZ1A 5DLFA 4RW6A 3NWGA 4UUWA 2FVCA 2OSRA 4CTAB 1TV6A 4OI0A 2ZM6F 1IXKA 2BR0A 2E1CA 3MFIA 2OTLS 1Y3KA 1K1QA 4ZS6A 4MKYA 1YRTA 1UVNA 5FJ4A 4O44B 1REVA 2EVZA 3F41A 3LP0A 5J2NB 3N5FA 4C8NA 2D41A 4MK8A 4YDDB 3T1HF 4TY8B 3ZZTA 1NKCA 5DLGA 3QO9A 5LSLA 3TO8A 1X4EA 2B7BB 4RW8A 2FVPA 4RBVA 5J2PA 4B3OB 3K5LA 1XR6A 4EBEA 4DQSA 1Q82T 4DFPA 2FJVA 4ZP6A 1YJVA 1LWCA 2SXLA 3NLCA 4OZ1A 6FD1A 4B3TF 2QZ8A 2RKIA 3QWPA 1YIJS 2VH7A 3MPYA 3TX8A 3T3FA 3CTRA 4BCAA 2YNFA 1VQMS 2K8GA 2F40A 3FCHA 3C6UA 1U09A 5CQGA 3THTA 1QTMA 4WYLA 5G0RA 2ALZA 3CJ0A 5DDPC 2JLEA 3CT9A 5T7LB 2MKIA 3RTVA 2MB0B 1S7HA 1GXLA 4KR0B 5F8IA 4QWAA 4R8UB 2EKYA 2HRYA 4Y00A 4B9TA 2EK1A 2WSEC 2VG5B 1CQMA 5HMYA 1VQNS 2CQ4A 3HHLA 5L1KA 1X5PA 1PC5A 3UCZP 2F1FA 5LSOA 2W9AA 1Q4RA 3AJ1A 4QU6A 2NSCA 1R0AB 2HMIB 4J9OA 2DJWA 2CRLA 2EW9A 3KLGA 5KAKA 2QMXA 2LDIA 4BDPA 4RUAA 1QAJA 1JLCA 1WHVA 3QLHB 3OJUA 3T1YF 1R8HA 3DLHA 1HQEB 2HFZA 4OJHA 2B4OA 2CPHA 3TA0A 3CWJA 4X4SA 2DHGA 2RS2A 3IS9A 1VHFA 2JEGA 4LF7F 3TI0A 3CO9A 3QWUA 4LMZA 3DM2A 2FC8A 2GJIA 1UJ5A 1HD0A 2OAUA 1HBUB 2ZHOA 4NL5A 4OJGA 1FXLA 3CDEA 5GAGI 2B4PA 3T5JA 4KBIA 1BY9A 1U25A 1IBLF 4KAIA 2VA2A 2BVZA 3CD0A 1TK5A 2P6SA 4IFVA 2X51A 2E1RA 1FKOB 3HKWA 5DG8A 4C4WA 3KYLA 1M5KC 4DSJA 1AFJA 4LFAF 1S6QA 3LAKA 4F25A 2U2FA 4YR0A 1E6VB 3SXLA 3MM7B 2UV8G 2DISA 3OHAA 4QU7A 2VASA 2GA7A 2RH3A 3K5OA 1N5VA 3OL6A 4KV8A 4M8LA 5G4DA 1FDBA 1HBNA 3ICLA 1T05B 1WEYA 3ONQA 3TVYA 5LMNF 1S72S 4PUOA 1DAXA 1VIOA 1PILA 3JSRA 4X66F 2B51A 4KE5A 4B9LA 2V4JB 2FTRA 5IT9Y 2O3DA 4KJIA 2FIUA 4O3PA 3RAXA 1IN0A 2RRNA 4LF5F 2VG7A 1HWJA 1H0HB 4HH1A 3BO2A 4DHVA 4BWMA 2CDQA 5E3CA 3OLAA 2VQFF 4ZCKA 3X3UA 3HP6A 5CD4H 5D4NA 4O3SA 2R7SA 2VFVA 3KK1A 1WTBA 5E33A 2DO0A 4OX7A 4GC6A 4FBUA 3V6HA 2Y1IA 2R4FA 1RP5A 3CGIA 1ZOTA 2LVWA 3H5UA 5L38A 4OZNA 1S0VA 3MWBA 2DGXA 4WFBQ 4FXWA 1MU2B 3M8PB 3CXCR 2X1FA 3TA1A 3QPIA 4OI1A 3HX9A 1D9AA 2RQ4A 2HWTA 4B9VA 5DM7Q 2B5JA 4PXDA 3UE2A 1CLFA 4K2XA 2CPEA 1S4FA 2PD1A 2L9DA 2ZC4A 4CH0S 2KG0A 1P1LA 2R8GA 1VOMA 4HTJA 4QPXA 4WK1A 4IG3A 5DG9A 4X4QA 5KFVA 3OVSA 4KO0A 3DMJA 3TAMA 4MKAA 2FJXA 3BGFA 1IKXA 1HPZB 3CD7A 1WNEA 4KHMA 1XNRF 2V8HA 1MMDA 2R7RA 1G7CB 1Y00A 2N7CA 4U67Q 2EC0A 1YRXA 1GXUA 3E01A 3MEGA 2HHXA 3I0SA 3FJ2A 3DHXA 2KT3A 3OVAA 4FVMA 3IBWA 3M8SA 3FFIB 3FMBA 2ROPA 4HTIA 5DGAA 3CJKA 4IRCA 1AFIA 4A8MP 3GSDA 1G6BA 3PW4A 1RTDA 3X1LB 2HHQA 1PO6A 3PX0A 2ZOGA 3BZQA 2HFOA 4H4KA 2D7SA 2DNGA 4TU9A 2RVJA 2ZE2A 4IG0B 2D74B 2XI2A 5C42A 2ZH2A 2E9RX 5KFFA 1U1PA 1HW9A 1X7VA 4KB7A 2VFTA 1TL3B 3J7YI 3OLBA 2M7SA 2Y1JA 3P96A 1KR4A 2HS0A 2P5VA 2HYIB 2DNQA 2LQ5A 3ZFVA 3UDCA 3K5MA 2CQ0A 1WI8A 2IA0A 5KG5A 1KSPA 2D3ZA 3U1NA 2K1RB 4ZVFA 2RSQA 1URNA 4FF1A 1U26A 3OUYB 1Y5IB 2IYGA 2UUCF 2CPIA 1FJCA 1FF2A 1MWZA 4ICLB 2XLJA 2CPJA 1NZAA 1LW0B 4DOZA 3KNGA 4LSLB 1FKPB 3B82A 2V8VA 3LP2A 3NRBA 1ZM4A 5I4MA 2ZHBA 1Y5LB 4BC9A 3PFOA 5HL7Q 1KC8T 4QBUA 2G1DA 4NCGB 5IWAF 1TAQA 1X4FA 5JXSA 1VRTA 5E7OB 1KN6A 2RB7A 3DOKB 3SCLE 3PV8A 1FE4A 4OI2A 2P9EA 2VFRA 2OO4A 2XMTA 4ELTA 4KGKA 1DZ5A 5DO2A 4P2SA 2W24A 3ZZOA 5KFXA 1I1GA 4TKTA 3U1LA 5K5MA 5KT4A 1SXLA 4O4RA 2LXFA 3NGDA 1RT6A 4LFBF 3S6EA 4ZCMA 2VFUA 5AE2A 5A8RA 1D1UA 2JFKA 3OR1A 3R1HA 2BQ3A 3IRXB 5A2QY 2AGOA 1OIAA 3VR1A 3G6XA 1YG0A 4X2BA 3NG8A 3CD6S 4IH7A 5LL6d 1L5UA 4TLRA 4LF6F 2ZNZA 3EGWB 1Y3JA 4TQSA 2NQPA 3VAMA 4Q8EA 3NBPB 1URRA 2LA6A 2VB6A 2ZZNA 3MCSA 1CC8A 2C3MA 3AHPA 3I82A 4RW7A 2C3OA 1R89A 4OHVA 2QYCA 2ZVSA 4JV1A 2WOMB 2D9PA 3PX6A 2DGQA 3IO1A 5DETA 1MSWD 2FVRA 1LWEB 3SSRA 2AP6A 5A8WB 1HR0F 4PXCA 4HKQA 2CG4A 2GFFA 3K8WA 4NZ7A 1IKVB 3DU6A 1RT3A 4Q5VA 5HLFA 4XDDA 2VPWB 2IM3A 3HVRA 4LSNB 2XCAA 4FS1A 5F41A 2XG8A 3DXSX 2KH9A 3BGRA 2V8GA 3OXGA 4PXEA 2OPPA 4R5PB 1SUQA 3S7RA 1FTCA 2RILA 2BOPA 1X5TA 1QSSA 3M6VA 1HA1A 1U6ZA 4ES1A 4HYKA 1G2EA 2RF2B 1KQKA 4YHHF 4RNFA 4KTQA 1JLAB 3CIMA 3SSQA 2DIVA 1HWIA 2W4PA 1U1NA 2VC1A 1XMOF 1S1XB 3MEEA 4X84A 2VPXB 1K8AT 5KG4A 2GCFA 1UWBA 1NK6A 4ED5A 2GO9A 5D78A 1FXDA 2CPXA 5KFEA 3MGJA 1JLFB 1GNKA 5LSRA 1RT5A 3JB9k 1B0PA 1F2GA 3BJYA 2DH7A 5BJRA 3B8HA 3D1OA 4RNMA 3CPWR 3RB0A 2J7WA 4B02A 2ZH6A 4MMOA 2QLWA 2I2YA 3OVBA 4NLTA 1XMQF 4IKAA 4ED3A