1RT5B

Hiv-1 reverse transcriptase complexed with uc10
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
427
structure length
406
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 116
structure length 406
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt5B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt5B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt5B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt5B03
4NLVA 2UVVA 1EETB 1I6JA 5DG9A 4URGA 4RUCA 5KFNA 3PZPA 4IR9A 1IKXA 3H4DA 1BQMA 4K4ZA 3JYTA 4WXWA 2XCPA 1IM4A 5KFSA 4XO0A 4J9SA 4MK9A 4ZVGA 2XGPA 4JV1A 5KFFA 1HARA 3FRZA 3UPFA 4KHRA 5K14A 1S9EB 5L1LA 3I0SB 4EBCA 4ICLB 3BSCA 1HQUA 3QYYA 4ECTA 3KK3B 1QUVA 1C1BB 3T1AA 1TP7A 3DLGB 4QWAA 2R8KA 3MF5A 1LWFB 5FDLA 2FVQA 2FVCA 4EYHB 2ZKUA 1RT7A 4NCGB 3SFGA 4ECVA 1J5OB 1C1CA 2OPSB 5KG5A 1FK9B 3Q8PB 1TL1B 5L1JA 2IJNA 4J9PA 5I42A 1S4FA 2O5DA 2IAJA 2YKMA 1RYSA 2W9AA 3RB0A 5HLFB 4ED2A 2ATLA 3BREA 1K1QA 3KHHA 3DRRA 4RW7B 4K4XA 2OPQA 3OLBA 2FVPA 3CJ3A 2IM0A 3KK1A 4IOBA 4DL5A 1EP4B 3CDUA 5KFBA 5C25A 3UR0A 1DTQA 2R2UA 3QGGA 4O4GA 1SV5A 1TKTB 4MFBB 3V4IB 3DLEA 3DRPB 3GV8B 4RNOA 5KFCA 2BQRA 4IRDA 3OL7A 3LAKA 1S1VA 3GIKA 1T3NA 2ZD1A 4TY8A 1TV6B 3DOLB 5HROB 1IKWA 4HYKA 1S9FA 4WE1B 4ZVHA 2JEIA 1MU2A 2ILZA 1RTHB 5C24B 2UUWA 1QE1A 3T5HA 4K4VA 1IKYA 3H98A 4WZQA 1R0AA 1RT2B 1C0UB 3QZ7A 1JLAB 2AX0A 5I3UB 3CIZA 2IM1A 4R8UB 3NBPB 3KLFB 3BQ1A 2IM3A 4K4SA 4RU9A 3KHGA 2YKNB 1ZTWA 2ZE2B 3MFHA 1S9GA 4ZVFA 2W9CB 2YNHB 2J6SA 4YP3A 3DM2A 4HKQA 5J1EA 5HP1B 1HQEB 4RUAA 1S48A 3CO9A 1WNEA 4QWEA 4QW9A 5KFZA 3RB3A 3IRXA 1N5YA 5EUHA 3MEGA 2HNYA 3HVWA 4WFYA 2C2RA 2R2TA 5T14A 1RT1A 2WK4A 3BR9A 2BE2A 4QWBA 3RBEA 3FSIA 2AQ4A 3OSPA 2OH2A 1T05A 5CYQB 1HNVB 4JV2A 4TYBA 3ICLA 3PW7A 2HNZB 2I1RA 3KLEA 3KLHA 5DGBA 2R2SA 1KLMB 1FKOB 2YNFB 1RA7A 3GQCA 4LSNA 5F9LA 3MR2A 1HMVB 4KO0A 4ED0A 3TAMA 2WTFA 3MTKA 1VRTA 4MIAA 4NYZA 4ZVEA 1DTTA 2WONA 4B3OA 4TN2A 2DPJA 3MEEA 3MECA 4DL6A 4DL2A 5KT4A 1S1XA 3CWJA 5J2PB 5HBMA 4RNHA 4ZPBA 5J2QB 1JKHB 4ZP6A 4RNMA 1IKVA 3PW5A 2BQ3A 1HNIB 4H4MA 3HVTB 4RW8B 3DMJA 1KHVA 4KFBA 3PW4A 5F8MA 1DLOB 4ID5A 1S6QB 4RW4B 3PR5B 2OPRA 4Q0BA 3IS9B 2HMIA 3RBDA 5DG7A 3IGNA 4TY9A 4F50A 2W9BB 4XPEA 4TLRA 3QZ8A 1S0NA 2IJFA 4J9OA 3QGHA 1RT5B 2FLPA 5D3GA 4IH6A 1S6PA 4I2PA 2RDIA 4Y2AA 4EEYA 2BANB 2ASLA 4EO6A 3LP2A 2R2RA 4NLRA 1TL3A 1RTIA 3V6DA 1U09A 3BSOA 4IDKB 1TKZB 5KFKA 3SI8A 5KFMA 1JLFA 2OPPA 2YNIA 1QAJA 3N6NA 5C42B 1RT4A 4QWCA 1NHVA 4IR1A 1REVA 2D3UA 1RTJA 4DG1B 3GIJA 4K4WA 4EBDA 3KJVA 5J2NB 2XCAA 2XWYA 3TQ1A 3DYAA 1SH2A 1N6QB 5KFYA 2UVRA 4K4UA 3ITHB 3CDEA 2XI2A 3PJXA 5J2MA 2V0NA 3C6UA 3PVXA 3KLGB 3H2LA 4ZHRB 2ASJA 1EETA 1NNDA 2RKIB 3CVKA 3CJ0A 4IG0B 3GYNA 3EPIA 5EWGA 2V4QA 1S0MA 3V81A 1RTDA 1GX6A 3NMAA 1S1UA 1RT6B 2B5JA 3JYTB 5KFUA 4G1QA 3G6VA 2FJXA 4LQ3A 2IC3B 4J9RA 1S9EA 3MFIA 2R8HA 3I0SA 4ICLA 4IH7A 4RW6B 3KK3A 3FDSA 2JEJA 5KFHA 3QLHA 4FS2A 5C5JA 1T03B 1YVFA 3H59A 1LW2A 4YQWA 2R8IA 2WOMB 3C6TA 3GIMA 2FJWA 1LWFA 3HVAA 5F8HA 3I5BA 4PQUB 4IFVB 5KFQA 3OHBA 4ECYA 4NCGA 1J5OA 4PWDB 5KG0A 1CSJA 5FDLB 1MMLA 1S10A 1FK9A 1JIHA 1TL1A 1RT7B 3M8PA 1VRUB 3IGVA 4WYWA 1HYSA 5JXSA 1C1CB 4H54A 4NLYA 5L1KA 3MEDA 4O3PA 3Q8RB 3IG1B 5KFXA 1RYRA 3ISND 2E9RX 5KFVA 5KT3A 1HPZA 2IMWP 5EWEA 4Q43A 4IG3B 2VG5B 1EP4A 4F4WA 3KK1B 1JLQA 2HAIA 3UDLA 3M8QB 3G6YA 1TKTA 3V4IA 1JLEB 3FQLA 3BJYA 4R0EA 5C25B 4KKOA 4JV0A 2AU0A 4QWDA 5KG6A 4Y2CA 4NLWA 1TV6A 3DOLA 1SV5B 3KLIB 4O4GB 5HROA 3DLEB 4WE1A 4KV8A 3QGIA 4NLDA 5KFAA 5C24A 1LW0A 4TY8B 3KLVA 2JC1A 2VG7B 4TYAA 1N56A 1RT2A 1C0UA 4NLXA 3KHLA 1S0OA 4I2QB 1R0AB 5I3UA 2CJQA 2DPIA 4R8UA 3NBPA 3KLFA 1C2PA 5F8NA 1TVRB 4K4TA 1S1WB 1NHUA 4R5PB 3ISNC 2YKNA 3H5UA 4U6PA 2ZE2A 5KG3A 3E51A 2I5JB 2W9CA 2YNHA 1Z4UA 1UWBB 3DRSA 1XR6A 1N48A 4I7FA 5HP1A 1HQEA 4WYLA 5KT2A 2RF2B 1TKXB 5L1IA 3I0RB 2AGOA 5KT6A 3EPGA 2VA3A 2ALZA 4G3IA 2IBKA 1BQNB 3QO9A 3RB6A 4NLTA 4LSLA 4YR3A 4TQRA 4ECWA 1LWEB 2JC0A 4URSA 2VG6B 3NL0A 5DG8A 3MEGB 4O44A 3EZUA 5CYQA 1HNVA 1S1TB 4ZMMA 3LP0B 3HKWA 1N4LA 3M9MB 1SUQB 4ECQA 2HWHA 1JX4A 2HNZA 5KG2A 4ZP9A 3CDWA 1JLGB 1KLMA 1FKOA 4ECXA 1S97A 3V6KA 1HMVA 2GIRA 3PHEA 3OLAA 3MR5A 3RAXA 4IFYA 2FVSA 3H5YA 3JSMA 2W7PA 4ECZA 1RAJA 5CYMB 3DDKA 2BRLA 2AGQA 1FKPB 2QE5A 5J2PA 3FFIA 1XR5A 4MKAA 4O3NA 5KG1A 4MH8A 3QIPA 5F8IA 2YNGA 1HNIA 3HVTA 1S1XB 5F8GA 2B6AB 1JLBA 1KHWA 2GIQA 4PUOA 5KG7A 3MR3A 3GIIA 2W8LA 4H4MB 4WZMA 3DMJB 4RW4A 4KAIA 3GV5B 4Y34A 3IS9A 4O3SA 1ZETA 4ID5B 2W9BA 4TXSA 3D28A 3BGRA 4NRUA 5KFWA 1RA6A 1D0EA 3N6LA 2HWIA 3V6JA 2B43A 3PJWA 1RT5A 4KE5A 3DOKA 4O3QA 4ZP7A 5KFIA 2JLEA 1LWCB 4MIBA 4F4XA 2C22A 2D41A 3CJ4A 4DL3A 2BANA 4K4YA 1S6PB 4I2PB 2VA2A 4TQSA 4O3OA 3G86A 3KK2B 4KBIA 1JLCA 1S49A 2D3ZA 2W8KA 1TL3B 5C42A 3E01B 3Q8SB 4Y3CA 1C0TB 4GC7A 4IRCA 4NLOA 3N6MA 3NAHA 3DLKB 4J9LA 2OPPB 4H4OA 3LP1B 4XPCA 1K1SA 5J2NA 4RW9B 1GX5A 1T94A 2AWZA 1REVB 3DI6B 3D5MA 5DQHA 2HNDB 2IM2A 1RT3B 4IH5A 3H40A 3T5KA 2FLLA 4X2BA 5KFPA 1IKXB 1BQMB 3KOAA 3OL8A 3KLGA 4ZHRA 4RZRA 2RKIA 4ED7A 2ILYA 4NLQA 5KFOA 2QV6A 5K14B 1RT6A 5KFEA 2JEGA 2GC8A 1C1BA 3V81B 1RTDB 5DQGA 1HQUB 1S1UB 2UUTA 3DLGA 4DEZA 3BQ0A 2B5JB 2IC3A 2JEFA 3KNAA 4G1QB 5KFDA 5L9XA 4QPXA 4Q8FA 4RW6A 3T5LA 4RNFA 2UVWA 1SH3A 3PR4A 2XC9A 4J9MA 5KFJA 3PW0A 2J6UA 5EDWA 4ZPCA 2OPSA 1T03A 2RDJA 4J9NA 4ED6A 2V9WA 2WOMA 3SFUA 5DLGA 2R8JA 4MK8A 3RB4A 3QLHB 3RAQA 2D7SA 3OHAA 2BR0A 4PQUA 4IFVA 1LW2B 5HLFA 4NLUA 5I42B 3C6TB 4K50A 4PWDA 2IAJB 2YKMB 1XR7A 5KFLA 4RW7A 4M94A 1VRUA 4Q44A 3LAMA 5F9NA 5KFTA 3DRRB 3M8PB 3NAIA 2OPQB 1HYSB 4IQXA 3IG1A 4IRKA 1W25A 4MFBA 5EWFA 3MEDB 3DRPA 4IG3A 1ZTTA 1DTQB 2J6TA 4NLPA 2VG5A 4ZP8A 5DQIA 5DLFA 1HPZB 4KSEB 3LANA 4FS1A 1JXLA 2C2EA 2WRMA 1RTHA 1S1VB 4J9QA 4EO8A 2ZD1B 3M8QA 3BSAA 4ECUA 3CJ5A 1IKWB 3PW2A 1JLEA 4WXOA 3FQKA 4MK7A 1MU2B 1JLAA 1JLQB 1QE1B 1IKYB 3KLIA 3I5AA 3KHRA 4KKOB 4FBTA 3OL9A 2R8GA 2C2DA 1D1UA 2VG7A 2F8EX 4KV8B 4FBUA 4O3RA 3V6HA 2ASDA 2UVUA 3OSNA 5KG4A 1LW0B 5JUMA 4I2QA 4NLSA 1S9GB 5KT5A 1TVRA 4NRTA 1S1WA 3DM2B 4R5PA 2FLNA 5J1EB 4Q45A 5F8LA 4NLGA 2I5JA 5F8JA 3IN5A 4DL4A 1UWBA 4OL8A 3IRXB 1N5YB 4IKAA 2HNYB 2XGQA 4O4RA 2RF2A 2BRKA 1RT1B 1TKXA 3DRSB 2BE2B 3NKYA 4I7FB 3I0RA 4EBEA 1T05B 3BQ2A 1BQNA 1LWEA 4WFZA 3KMQA 2VG6A 5DGAA 2YNFA 3QO9B 3KLEB 1S1TA 3KLHB 3LP0A 4LSLB 3VQSA 1SUQA 1QAIA 4O44B 2WHOA 3HHKA 4MKBA 4YR0A 2IA6A 4F4YA 4LSNB 4F4ZA 4KO0B 3TAMB 4ED1A 1JLGA 3T5JA 4GC6A 1VRTB 4U7CA 2C28A 1OS5A 4ECSA 5J2QA 1JKHA 4LQ9A 1DTTB 2WONB 2HNDA 4B3OB 4KB7A 3MEEB 3MECB 3M9OB 4ED8A 5CYMA 4RW8A 3QIDA 5HBMB 4URQU 4JUZA 2V4RA 1IKVB 1FKPA 4IFYB 4ZPDA 1DLOA 3Q8QB 3JSMB 1S6QA 3TVKA 4KFBB 3LALA 3KMSA 2AGPA 1SH0A 3FFIB 2OPRB 4ZPAA 2WCXA 4Q0BB 2B6AA 3QIPB 2HMIB 5KFGA 4EYIB 2YNGB 3MR6A 1TQLA 3H5SA 4QW8A 3UQSA 1JLBB 2FJVA 3M9NB 4PUOB 2EC0A 2FVRA 2BQUA 5D3GB 2CKWA 4YMEA 3H5XA 3GV7B 3BGRB 4IDKA 3G6XA 1LWCA 1TKZA 3LP2B 2XI3A 4ECRA 3CJ2A 1RTIB 3V6DB 3I5CA 3DOKB 3NGDA 3T19A 4DG1A 1JLFB 2YNIB 1RT4B 3KK2A 3OL6A 3GILA 4RNNA 1N6QA 1RTJB 4NZ0A 4J9KA 3ITHA 3KJVB 5KFRA 4YR2A 3E01A 1JLCB 4Q8EA 2E9TA 1C0TA 4ED3A 3DYAB 3BSNA 3DLKA 4DL7A 2AX1A 3H4BA 3LP1A 2W7OA 2E9ZA 4RW9A 4KHMA 4WFXA 3DI6A 1RDRA 4IG0A 5J2MB 5KT7A 3C6UB 4M95A 1RT3A 2WB4A 4H4OB
chains in the Genus database with same CATH superfamily
3PZPA 4USUA 2O67A 2FHJA 2XCPA 1YJ9S 2IIHA 1S79A 5L1LA 3L4BC 3MAQA 1XBWA 3DLJA 1R7IA 3LH2S 4KJIA 2GO9A 4NE9C 4C11A 2CPXA 1JJHA 1RAIB 3HMJG 3GCXP 3VWSA 1TV6B 1DY3A 1HBUA 4K4SA 5IT9U 2ZKTA 1WF1A 1U24A 1R89A 1S48A 4LRCA 1WNEA 2HVHA 3HX9A 2Z57B 2C2RA 2DNLA 1MMNA 2F40A 2JLGA 2QJ3A 1F9HA 1UMJA 3KLHA 2N7CA 3ZFVA 3GFXA 4ETZA 2R7XA 4LSNA 4KO0A 2MJUA 1IUJA 5DDPC 3MECA 1P27B 4RUBA 1F3VA 3R9LA 1X0FA 1FRMA 2KYXA 4M5KA 4TU9A 3GJSB 2HMIA 1S0NA 4DSKA 3SIPB 3MPVA 2Y1IA 4CO0A 2I6WA 1FJGF 1F9FA 1YWXA 2VJUA 2PEBA 2VQFF 5KFMA 4OZ0A 3QWUA 2OAUA 5LT5A 2XEXA 3CJSA 4X4NA 1VQ9S 4CQ1A 1ZA1B 2HAFA 3OXGA 2ASJA 1EETA 3BYPA 2VASA 4IG0B 1P1LA 4ZITA 4DV5J 2M0GB 2RB7A 4OX9J 5DM7Q 1NSQA 2XYPB 1CBKA 4DR3J 2FJDB 2GVDB 2WOMB 2I8EA 4EZ6A 3HVAA 4IFVB 3SYZA 1CSJA 2R42A 2B9EA 4Q43A 1BD6A 2YPZA 4YY3J 1Q8KA 4KGXB 1DZ5A 5KFAA 2PC6A 1N56A 1TVRB 1GMWD 3JQKA 4USMA 1SJQA 3QNWB 1Z4UA 4DL0C 5HP1A 2RILA 2EFOA 4OZ3A 2VA3A 2HBRB 1FXLA 4TQRA 1LWEB 2E1CA 2DNRA 3M9MB 2KFYA 4DR4F 1LK7A 3UI3A 2B8PA 4A48A 2CA9A 3CMQA 3I4PA 4LVOP 2QE5A 2QSFA 2LP4A 4ERDA 3W8PA 2VPZB 4KAIA 4ID5B 2W9BA 4F02A 2B43A 2MKYA 2K1RA 3LGHA 3JSBA 2W2QP 3SMZA 2W8KA 2ASYA 4CLYA 3CJKB 2AWZA 4HTIA 1GX5A 5G0RB 3C15A 3OD2A 3ELHA 1IKXB 1BQMB 3PRVA 1ITPA 4W92B 2HQFA 2PO4A 2CPJA 3SXLA 4CLTA 2ZJPQ 4DBQA 2GC8A 2V68A 1DJ0A 2UUTA 2CPYA 3PW0A 4DUZJ 4AL6A 4OYIA 4I64A 1X4AA 5E3AA 1VRUA 3LAMA 3QFWA 2M8DB 3MCOA 4LF4J 3M4XA 5BYRA 4NLPA 1UFKA 3K5LA 2C2EA 4CTAB 2WB1D 2G13A 3I55S 4O3RA 3FBCA 3Q2SC 1M5KC 4R5PA 4NLGA 3FUYA 2B9XA 1S6OA 2RF2A 5F41A 4USTA 1LFPA 2BM1A 4JI8J 1X8DA 1JLGA 3KUHA 1VRTB 1TKDA 5F3ZA 4Q2MA 4OYAA 2XS2A 3GG1A 3QIPB 3M1VA 2AV5A 3KJFB 1NMEB 2W4DA 4ZOSA 2GHVC 4DV6J 2KB2A 5A8RA 3HDSA 3IR5B 5J1PA 1LOUA 3GP9A 2QA4G 4ER8A 1FDNA 4ED3A 4C3KA 2AX1A 1FF2A 3CD6S 3ZZZA 3BO2A 2BE7D 4J9SA 2HFOA 5DG9A 4RUCA 4K4ZA 1OYEA 3P5BP 1FD8A 2H5IB 1FO1A 2K06A 3LPYA 3D0GE 1D8YA 5IT9Y 4DUYF 2H51B 2ZHAA 1FHTA 1V6HA 3HZGA 3W62A 2YKMA 2YX1A 2HHWA 4QU7A 3OLBA 1TELA 1FFSB 1IR0A 4C48A 1KNZA 1T9WA 4MKYA 4PG7A 3SZ2A 4WE1B 3POTB 2K3IA 4FXDA 1SC4B 3VAFA 4V1Ak 2CNLB 1KC8T 5M2RA 5ITHA 3ZTRA 3MFHA 2W9CB 2YNHB 2HURA 1CVJA 1HQEB 4RUAA 3AB2B 2MSSA 1RHUB 4U8VA 3NOCA 1ZYQA 2LLZA 1D8ZA 3IR6B 4ED0A 1NM2A 2C3OA 3MTKA 1G2EA 2KT3A 2VF3A 4F04B 4ZLPA 3PW5A 3DMJA 5F8MA 1RWUA 1W2IA 2C2NA 2R7OA 5D3GA 2XSJB 4I2PA 2Z8QA 2BA9A 3SQGA 1FWKA 1Y3KA 1UFWA 4WTOB 3CULA 2UXCJ 1HFEL 3DYAA 5KFYA 3CDEA 1NO8A 3ENVA 1WC6A 4B9MA 3VGSA 4Y0FA 4AXJA 3UDVA 3V81A 1YJWS 5FJ4A 4EI2A 1CJKA 5D0EA 4ZN3A 3RJMB 5IOLA 4TKTA 2R8IA 1VC6A 4CM0A 3C6TA 2F8MA 4DPYA 3GIMA 2D9PA 1VIXA 1CS4A 1C1CB 1Y4ZB 1SJ4P 2MY8A 3W8GA 2XMTA 1P8GA 2YKQA 4Y2CA 2N3OA 1FERA 1RT2A 4YB1P 1APSA 1S0OA 4OZJA 4GKKF 3KLFA 2Y1RI 4K4TA 4F3OA 3U7JA 1UWBB 1XR6A 1CULA 2CADA 2MZRA 1BQNB 5LL6d 3KDNA 5K5MA 1JX4A 4A8SA 3BGLA 1VFJA 3M2UA 3V6KA 4KC5A 1R31A 1KP6A 4RBUA 4YEAA 4ECZA 1CQNA 4MH8A 3M2VA 1DQ9A 5A8WA 1ZH5A 3HVTA 1N88A 3MR3A 4LR9A 2JX2A 4Y34A 1X4BA 1TK8A 3JQMA 5KFWA 3N6LA 3NWRA 3V6JA 3PJWA 4O3QA 1B4SA 4FYYB 3ENQA 2CPIA 1YQHA 4O3OA 3C16B 1B99A 1L3KA 2RQMA 5IC6B 3UW1A 3H40A 5LMUF 5CD4H 2FHJD 4H4KC 2FLLA 1WI8A 1UFLA 4CH7A 5E3PA 3PKYA 3D1HA 2ILYA 3PEJA 3W60A 1S76D 2LVWA 1YBUA 1AZSB 4OZLA 4NEYA 2J6UA 3JSRA 4J9NA 2LDYA 2CVEA 2ZM6F 3FNNA 3RRGA 1KD1T 1VGYA 2KO1A 3MEDB 2J6TA 4ANDA 3CXCR 5HMYA 3M8QA 2RMLA 2V63A 3S1TA 1X9MA 5AXLA 1SJ1A 4DCOB 1X4GA 2EWHA 2YQ0A 2P5VA 2FY8A 1MMDA 2ZBQA 4AQYJ 1Q53A 1X31C 1UZDA 1ZA2B 3VR1A 2VJVA 3FC9A 1RAAB 3QO9B 3KLEB 4DS5A 2AMCB 3RTVA 4LR8A 2KHDA 2C28A 3EGVA 4A8XA 2F5GA 3CDBA 2K7JA 3KMSA 5H9EJ 3PO5A 2OPRB 1FESA 1Q0NA 3NS5A 2IA0A 4FDFA 1OY8A 3QT7A 1HKAA 3CO0P 3CMAS 1OSCA 3H5XA 1R6YA 3PO4A 3BGRB 2GMHA 2YWFA 2CQIA 4JI1F 4X66F 2SXLA 2HFZA 2QC3A 2CG4A 3BKTA 2AJ0A 3MMAB 4YB7A 3FK4A 5IM0B 4UZBA 4LF7J 2OFHX 4OJ1A 5MAOA 1O5JA 5KFFA 1NDPA 2L48A 1WHXA 4JI3F 3IWLA 4B3TF 3TEGA 3QYYA 2B0GA 4FKXA 3HHDA 2D9OA 5KG5A 5I42A 1SC6A 2ATLA 2H54B 1UW9A 1Q5YA 2JOQA 4RNOA 2BQRA 4YN3B 1T9XA 1R0AA 3C3LA 1XMQJ 5EX0A 3R1HA 2YKNB 1ZM3A 2EPIA 2R3VA 3DDNA 1V5VA 3MEGA 1Z1ZA 2R2TA 2BE2A 1HNVB 3QRQA 4XTTA 2RAQA 4TVAB 2R2SA 1KVIA 2EW9A 3UN3A 2B9WA 1Y0HA 1X0PA 4HTJA 5G4DA 2B4OA 1DTTA 4DL2A 4DV4J 3RRHA 4DUTA 3TO8A 3UNGC 2IVFB 2Z58B 4RW4B 3PR5B 4J90A 3J7YI 3IGNA 1NKEA 2CQBA 2OFGX 2FLPA 4EEYA 1EB0A 2FJEB 4NLRA 3RU0A 3N6NA 2RD5C 5LSLA 3MM8A 2L08A 3K5PA 2YWHA 4UOCA 3TAPA 4FPRA 4DCPB 4ZHRB 1NNDA 3EZ5A 1RTDA 2FJXA 5CD4A 3DLBA 2U2FA 2IC3B 3MFIA 2R8HA 4QIFA 2G1DA 5KFHA 4W4MA 4WP8A 2O1PA 4QPTA 1LWFA 5D15A 4ECYA 2DNHA 2XQCA 1MMLA 4U95A 1L3UA 2DHHA 3FBEA 5CCLA 3H7HB 4RPFA 4DR5J 3DOMA 3J81j 1BY9A 1JLQA 1UETA 3HD1A 3FQLA 3PG9A 3DOLA 5HJYA 5E3RA 1XNQF 2DIVA 4IO9Q 3W1YC 4NLXA 1C0UA 2FLOA 4JI2F 2PDAA 3ZZYA 4ZCLA 3ISNC 4UTGA 4ZCIA 1U1QA 2CJBA 1TAUA 2AGOA 1HHQA 1ZAWA 1M0SA 1XQIA 2G2ZA 2CYYA 4LRDA 4ED4A 3H5YA 2BRLA 3NMRA 2DY9A 2QL5B 4LRAA 1P6TA 2GIQA 2LQJA 6FDRA 4X4RA 5CZXA 2W8LA 5IS2A 2YTCA 3GYXB 3NGSA 1HWJA 5CHCB 5K8OA 5KFIA 2GHWA 2D41A 2UZAA 4KBIA 3AD8C 5C42A 3N6MA 4E2FB 3Q8VA 2OEKA 4PG6A 1HA1A 3DLGA 2O3DA 2IVMA 3EZOA 4RNFA 3PR4A 3T9NA 2BJ7A 5GVQA 5KOXA 2PI5A 2OELA 1H2VZ 2QYCA 4KHPF 3THTA 2WAQD 3M8PB 2QMXA 4OX6A 3DKDA 2BDPA 1PBUA 3DRPA 3J7ZT 5T7LB 1VHIA 2AYMA 1FRIA 3BB5A 2QA1A 1QE1B 3NCRA 1E6VA 1KSPA 1SXLA 4ZVTB 1IVZA 3ZC4A 4P52A 3GB0A 4KV8B 4I2QA 5KT5A 3VAGA 1YRTA 5F8LA 1PGZA 4GVLA 2W2MP 4DL4A 4OL8A 3VCDA 4IKAA 2OJ3A 3QT6A 3KMQA 3HF5A 4ES3A 4R25A 1QAXA 1QD1A 2VFSA 1NB2A 3W65A 2RU9A 3T6JA 4P9SA 4URQU 3MM6B 3D9BA 4DU7A 3C19A 5K8PA 4KFBB 1WHWA 2M3DA 4CO5A 3UNYA 2KVIA 3F56A 2IJRA 4CLUA 1RTZA 2H48B 1FJGJ 4EZ9A 2V9KA 2LQ9A 2VQFJ 3V6DB 2X1GA 4DG1A 4FNHA 5AXMA 3GILA 4M5MA 3K7RA 3KJVB 4LF1A 1WC4A 4DL7A 3MUVP 5D0RA 5F8IA 4Y2MA 2GIFA 2QZ8A 2ZVSA 5U47A 1AA1B 4ECTA 4AXIA 3LUYA 1GXUA 3ENWA 1D9FA 3TA1A 1QLNA 2ZWPA 3FCHA 3HLUA 4J9PA 2DXFA 4CDIA 1JJCB 3THVA 3ENAA 3DRRA 4NPOA 4OZ1A 2HRTA 4IOBA 1U6BA 1ULRA 2CUYA 1B7FA 3QGGA 3DLEA 1Q1KA 1JNZB 4X4VA 3IBWA 2DO4A 1H0HB 4WZQA 2CQ3A 1EIYB 4R8UB 3RYLA 3EE3A 4X4QA 1S9GA 2AHOB 1L3TA 2HNYA 2AEMA 1RT1A 4WJBA 1N33F 1VQSA 4P2FA 2DBBA 4DR4J 2MKJA 3M6VA 1RA7A 1N0VC 1OY6A 4PR6A 5E0OA 5THWA 1KHVA 1V3ZA 5DDQC 3CD5A 2I9SA 3G4SS 3DHWC 1HBOB 2BANB 3BSOA 3NNCA 3C14A 3AOBA 1XEZA 2UVRA 3PDNA 1NSAA 4B9NA 2HSEB 2M2BA 1XJWB 3K57A 5LOQA 3NEKA 2GQQA 4FS2A 5JVHQ 5F8HA 2ZWOA 4A46A 1VLYA 1S10A 2MTLA 2V8DA 3EVOA 5KFVA 1UVJA 1HPZA 4DJBA 4N76A 1JLEB 3BZQA 2KZMA 1TV6A 4X62F 3J80Y 4DWIA 2OEMA 1OMSA 3OTDA 4DF8A 3TZZA 4JP8A 2E66A 4RL1A 7FDRA 2IBKA 4ZMMA 3CCSS 4BC7A 3W9JA 3CDWA 4M5DA 2FC9A 4QCLA 3SV4A 3OTOF 3S6EA 3U27A 4ZA1A 3ZTPA 3OJUA 3BGUA 3W2VA 3GV5B 3IP0A 1G6BA 4ZP7A 4DQIA 3CJ4A 4X84A 4K2XA 2B9YA 2MLZA 5GAGI 3AOAA 1PCAA 2OIHA 2ZOMA 3A8EA 4FYDA 2RJZA 1R8BA 1FTCA 1SQFA 3H59A 1AW0A 3MI7X 3U02A 1B64A 3MMJA 2HHPA 2OSRA 1K0TA 1SKWA 2JEGA 4A8WA 3FMWA 5AT1B 4DUYJ 5M2UA 1FDAA 5IV3A 2IYGA 4WTYA 4J9MA 2WOMA 4LBPA 4OHWA 3QBCA 4IFVA 3M7VA 3SCJE 3BGOP 2JJ4D 3OR1B 4BHQA 4Z7YA 1UA1A 1DTQB 4M5IA 4ZP8A 1P1TA 3CCLS 2WRMA 1RTHA 3BEGB 1YRXA 1IKYB 3D67A 3KHRA 3KTQA 1KWMA 2C2DA 5KG4A 2KFNA 4DPOA 1TVRA 3TQEA 3IRXB 2XGQA 1FXRA 4P2XA 3QQCD 1DRZA 1LWEA 2CWKA 1QAIA 4YR0A 1WEYA 4F4ZA 1E6YB 4WIIA 3OTEA 3GJRB 4GO5X 4QIWD 1UJ6A 3CNQP 3VGTA 3TAQA 3HM9A 3O5TB 2ZBCA 2FJVA 3O1LA 3AHPA 2MSTA 4ECRA 2B3TB 1FTRA 2MQQA 1GH8A 2ZOFA 2MHEA 1VQ8S 3U1LA 3B8HA 1JB0C 5KFRA 2FZKB 3H4BA 2W7OA 2UVVA 4IR9A 1IKXA 1BQMA 1MNEA 1FCAA 2VFVA 1FI4A 1ZPVA 2HBYB 1HI8A 2YX7A 2PMHA 2HHQA 3Q8PB 2XHCA 1NJXA 1G1XA 1K1QA 3OUYB 2I0XA 3J7YU 2ALYB 2R2UA 4JI0F 2W7AA 4CTAA 1TUWA 3TANA 4HYKA 3UDCA 1RBOB 5ETNA 2QX0A 4GKKJ 2CQGA 4DXLA 3BQ1A 4P7VA 3MMCB 4OI3A 3W9HA 1URNA 1U6ZA 2ZE2B 4FYVB 5D4LA 4PG8A 4KGMA 4QWEA 4HI1A 4QW9A 4P74A 2K3KA 3RB3A 2HK3A 2HS0A 3OW2R 3HCXA 3BR9A 3OSPA 1RK8A 1U2CA 3QSIA 4E0DA 2R7VA 5IT0A 3JQJA 2WTFA 1VRTA 4MIAA 5DJBA 1NPKA 2NCKL 1RHJB 4TN2A 1S1XA 1K0VA 1X4FA 5KAKA 1KKHA 4CP5A 2N82B 2NS1B 2U1AA 3BN7A 3MPDA 2DD8S 2XZTB 4EO6A 3AAWB 2G1HA 3HK2A 4KGZB 5A8RB 2OPPA 1REVA 3T9ZA 2V8VA 5LMUJ 4WP3A 1D9DA 5J2NB 2XCAA 2V8GA 4WWSA 4IUFA 3SCIE 1S0MA 1S1UA 2ZC4A 1RT6B 4OHZA 4LQ3A 1UCNA 3L95X 4WK1A 4B08A 4DR1F 4RW6B 2P9CA 4KTQA 2ZM6J 1WEXA 2GFFA 4I4BA 1FRKA 2FHKA 3PXGa 1NJWA 4C8KA 3IGVA 4J9VA 4RLEA 4IOCQ 1CLFA 2VG5B 4F4WA 4ZLLA 2HFNA 3G6YA 3BJYA 5LM7E 4KKOA 4NLWA 4WE1A 1KDNA 3K8VA 4PABA 4B9VA 4UF4A 5AE2A 2I5JB 2W9CA 2YNHA 1VBKA 1HQEA 2HFSA 4CWBA 1NSPA 3LA0A 3HVRA 4LSLA 2IRXA 2GGPB 4URSA 1UWAA 5C7PA 3V4MA 1O8BA 2BE9B 2CQPA 4FF3A 1BWVA 3A13A 5H1SV 3RAXA 4B9LA 3CPWR 4HHUA 2ZZNA 4FXVA 1RE1B 2V6AA 3A3OB 1Q86T 2ATCB 2B6AB 1VK8A 2GJFA 3WZ0A 3DMJB 3R27A 4OJGA 4ELTA 2F9DA 2F65A 2QTWA 4JI1J 2XSJA 4X66J 3R5BA 4I2PB 2VA2A 3ZZPA 4CYUB 3KUEA 2VV5A 2OI2A 1C4AA 3LP1B 3PX0A 3H2VE 4HACA 3HSZA 5KFPA 3W9IA 2QFIA 3WIVA 4JI3J 1CJTB 4B3TJ 3V81B 4P71A 4C4WA 5ETLA 4Q8FA 1Z2LA 3QMQA 5KFJA 5EDWA 4ED6A 1MN9A 2BR0A 2MZJA 3C6TB 1CG2A 2OUGA 5IT4A 1CS4B 3OFFA 3OTCA 2PE8A 3U1MA 4KSEB 4UUWA 4ECUA 2ZD1B 2F8HA 1MU2B 4A8YA 3CDAA 4YB6A 2F8EX 3OSNA 4NLSA 1KONA 5D0GA 5F8JA 1UWBA 1XTZA 4L3NA 2D3O1 1CULB 1BQNA 4WKRA 1YRUA 1KFDA 2ROGA 1YTYA 3WIUA 1U1PA 2MZSA 2BW7A 4OIXA 4DMZA 4ZJOA 1SIWB 4K8RA 5GMDA 3M2UB 1GTHA 2HVDA 4DV3F 4AUKA 1RWVB 2VPXB 3GMGA 3DU5A 2JH3A 3BPSP 1QVGR 5ETQA 4EYIB 1GMVA 3M2VB 3UDEA 5A8WB 3MR6A 1J5EF 1BE4A 4OLPA 2MQMA 4FF2A 1TKZA 1N8RT 2LEAA 4EMDA 2DYAA 1AFIA 3MM9A 1RWMB 3T19A 1UPPA 4KPYA 3TVYA 4RNNA 1T02A 3C16A 2E9TA 4CLLA 1RI7A 2GJIA 5J2MB 3C6UB 1M90T 3M6UA 2C2KB 3JYTA 6AT1B 2FYXA 4WXWA 4PWUA 1EZZB 2DEIA 3UPFA 2LA6A 4ZLNA 4OI6A 3S8SA 1AZSA 1ZAXA 1Y11A 1EKRA 2CQ4A 3P4UB 5FDLA 4Z2XA 1RT7A 2KM8B 4QZVB 1KEKA 3PX4A 2KXFA 5ETKA 1Y00A 2VC0A 3KNGA 5C25A 1SV5A 1O6XA 3J81U 1XNQJ 4JI7F 4KRWA 4IRDA 2HVIA 3FMBA 1U1KA 1B7YB 4CO1A 1RWOB 4V19X 1GXTA 4JI2J 1BC6A 1YDLA 7AT1B 2A3JA 2VDHA 4I67A 4Y6IA 4F36A 1SC1B 4P2SA 5EUHA 1NCLA 2AQ4A 2E5IA 3VZHA 3KLEA 1WHYA 1T7PA 4RR5A 4LRBA 4NYZA 1SL0A 3I32A 5LSOA 2Q79A 1HNIB 3IBFB 3M30B 1KRPA 1OY9A 2OPRA 1F3FA 3K5MA 1WUUA 4X4PA 3AOCA 1NKBA 1UPMB 2DO0A 2DITA 2PA8D 2FQQB 3N5FA 3NGUA 2YWWA 2GS8A 2XWYA 3MMAA 1SH2A 4HVZA 5IM0A 4PPZA 2QN6B 2ACMA 5I4MA 3GR1A 4DOZA 4ZCMA 2M52A 4B3MF 2HVZA 3UVJA 4OHXA 1UEKA 2X51A 4PQUB 5J1NA 4KHPJ 2DGVA 4U7UK 1UA0A 2NR0A 2FHOB 3VTIA 2E9RX 1S5ZA 4JBCA 4IG3B 4DPUA 2AEJA 1D9AA 4A8MP 2PMZD 1XWLA 3DN9A 4R0EA 3P5TL 2VB6A 5HVFA 5L9NA 4NLDA 2EEYA 2Y1JA 1LW0A 2ZH3A 5GAGU 1MWZA 2W01A 1R0AB 2Y9HA 2YKNA 5D4PA 3KDOA 4YHHF 5KT2A 4TU8A 2HW3A 5DRKA 4NLTA 4YR3A 5DG8A 3MEGB 4WBFA 1HNVA 1XC9A 2V94A 3D2WA 3DLHA 2Y8WA 3HSJA 3PHEA 3EGNA 1RAJA 4KYZA 2AGQA 4F26A 3MOJB 4O3NA 3OR2A 4HH1A 1YI2S 1RAEB 1KHWA 3M6XA 2FC8A 4RW4A 2PMWA 1NK0A 2CPHA 4NWBA 4KE5A 2JLEA 2RH3A 3LO3A 3MM7B 2KVQE 2ABYA 1U26A 1R43A 4ZPVR 3Q8SB 3BBFA 4A47A 3N9UC 2CNOB 3HFZB 2HQDA 4ENOA 4RW9B 1QTNB 3KG4A 3W2WA 4OYXA 4ZHRA 4F3QA 3EX7B 4NLQA 2P9GA 1C1BA 1RTDB 1X4HA 2IC3A 5EGYA 2CVIA 3C8YA 4K50A 2BJ8A 4YB5A 4S0MA 2BACA 5A2QU 2K8GA 1VISA 3NWGA 4F0MA 3LANA 4ELVA 1IN0A 2EG1A 3EUNA 4RJVA 1JLQB 2R4FA 5ETTA 1VQMS 4FBTA 3Q8UA 3JB9k 3V6HA 4V19J 4DX6A 1TR0A 2UU9F 3VHQA 3CB4A 1N33J 2QG9B 4DSLA 2D3OR 4OZ5A 3AY0A 3J7AN 1HLWA 4L3KA 4AQYF 4ILLA 4ED1A 3DXBA 4GC6A 4U7CA 4XAKA 5J2QA 4XIUA 3MEEB 5AXNA 4NYOA 1S6QA 1UJ4A 3R5CA 3VAMA 3BBCA 4QYRA 3TZYA 3H5SA 4ZVOB 1IM6A 3TOQA 3ILLA 2R7SA 4OHYA 4YR2A 2G4BA 1JXEA 3J81Y 3HJVA 3QJJA 2ZHOA 2HHHF 1IM4A 2GJ2A 4LRFA 4C8NA 2HIYA 3FRZA 1OQ3A 2FGOA 1HL6A 1K9MT 4ICLB 1F9EB 4HH0A 3KK3B 4JI5F 2DGSA 2RE1A 3DLGB 2DNQA 1HR0F 1J5OB 3EXCX 1FK9B 3R2CJ 4QU6A 5L1JA 1CC7A 1WC0A 1UTAA 1PJ5A 1OO0B 3P3DA 2RHQB 2RUGA 5T7LA 2NREA 4O4GA 1YJUA 4X62J 3DRPB 3ULHA 3O3LA 3FSYA 2YKAA 2UUWA 5C24B 1QE1A 4Y28C 2DR8A 1E6VB 5I3UB 4PG5A 3TX8A 2H65B 5JVGQ 5D6GA 1TMJA 3IR7B 1PJ6A 3T41A 1JQGA 4IYQA 1NH8A 1VOMA 3TW0A 3K59A 1HNWF 2C2MB 3W7BA 1RHQB 2HYIB 2IVYA 1Q7YT 4F4KA 1FKOB 1HMVB 1HBNB 2DJWA 1VQ4S 3OTOJ 2KU7A 4ZPBA 3MM6A 3GSDA 2W2OP 4ZP6A 5FD1A 4LVNP 3TZXA 4RWXA 5DO2A 4KFBA 1YJRA 2E5GA 2YKPA 2H5EA 5DS7A 5DG7A 4TLRA 2ZC3A 4O23A 3HXMA 2E1RA 1RKIA 1FDBA 2Z2ZA 3AT1B 2FIUA 3VAJA 3GYGA 3V6DA 1CC8A 2RT3A 5D0HA 2VICA 4DG1B 1RLCL 3KJVA 4AYBD 4K5SA 2XI2A 1A0OB 2RKIB 3EPIA 1GX6A 3IWNC 2B7BB 2J9CA 2R7UA 1YVFA 5CXTA 1U1MA 4PXDA 1DBDA 3GE9A 1IQZA 3IG1B 4RO0A 3QJLA 5B0EA 1B3TA 1O0PA 2BJDA 1Y5LB 1ACMB 2AU0A 4OYWA 2YPYA 3DLEB 2XMKA 2ZH9A 5KOWA 4B9TA 4AE5A 2FB0A 1RKJA 3O2IA 4R8UA 4ZPWR 2DIUA 4I7FA 2PD1A 5L1IA 2LEBA 4O44A 3EZUA 5FIIA 4C8ZA 3LP0B 2L9NA 3CCJS 3NS6A 4X65F 3G6ES 1RGVA 3MR5A 2FVSA 4UOFA 4OYBA 3K2YA 3D28A 2RQCA 1A7GE 3DOKA 1R8HA 3GPAA 1HBOA 5D78A 3M8SA 2BANA 1PYOB 4OHVA 5CZVA 1KQSR 5A2QY 1S49A 3PJ9A 4LFCF 1R27B 4J9UE 4J9KA 3CCTA 1KQKA 3KWMA 1VQPS 1DURA 1U2RA 1KQGB 4GKJF 5DQGA 1HQUB 3ZZTA 2W2PP 2UUBF 3AXMA 1PC5A 3HHLC 5FLXY 2R8JA 4PXBA 5EX3A 4HDGA 3CCES 3D1QA 4GVBB 4WP9A 4UY85 5B0FA 4EUVA 1HWLA 4P10A 2XO6A 1QM9A 4KQZA 4JI0J 5DQIA 1HPZB 3JSYA 1S1VB 4JYAF 2MXYA 2QLWA 1FNOA 2XYHB 1JLEA 3FQKA 1VQOS 1VBZA 2CZVC 2R9LA 1M5OC 2RVJA 2ASDA 3SDEB 3JXOA 1Q8LA 4DZDA 3OBIA 5HVHA 2X1BA 4ZLJA 1CPZA 1VQYA 3LGNA 1ZZNA 2PSZA 4ZCKA 3N79A 2Z2YB 1RHKB 2MDAA 1HW9A 2WHOA 2M70A 4BS2A 2K7KA 3N4WA 3TAMB 4P73A 2CQ0A 4OI1A 3M9OB 4JUZA 5BYSA 1AFJA 1ZZFA 4M5DB 1NZ8A 2BKPA 2XYGB 3ADAC 2EXUA 4O0IA 5IZHA 1WSRA 2HGMA 3W2VB 2BVZA 3GV7B 3LP2B 3AJ1A 2FJAB 4F4AA 4O0NA 1WTFA 3SSQA 1RT4B 1FJ7A 2CG8A 1U47A 1RTJB 3S01A 3DHXA 2Q6CA 3M2RB 5LSRA 2UVWA 4NLVA 2CZ4A 4DFKA 4DR1J 1ZOTA 3H2UB 4B9SA 2RQKA 2DCUB 2L9DA 2FVCA 2VONA 4WU2A 9RUBA 1NJZA 2W9AA 5IFMA 2VKZG 2DGWA 3FGVA 2FVPA 3KK1A 3OR1A 4FKYA 5C2GA 2R7QA 1DTQA 2L9WA 1VRQC 1TKTB 2CIMA 4TY8A 5D4NA 4ZVHA 4EK2A 1RTHB 4DFJA 1IKYA 1VMBA 1BQXA 4F0KA 3W3SA 3PHTA 2F9JA 4M8LA 1S12A 2XB2D 2V2VA 4I1TA 2HEKA 2BOPA 1FEEA 4PG4A 2J0QD 2DCLA 3CO9A 3IRXA 3NGRA 3OFGA 4L75A 3UFCX 5HANA 2G0JA 3B78A 4YDDB 4JV2A 2XS7A 3UCUP 1S57A 2GCFA 1KLMB 2HLTA 1E6YA 1QTMA 1PG5B 2HHSA 3V2UC 2JL9A 2X7IA 2XY6A 2DR9A 1UL3A 3CWJA 1H7WA 1Q16B 2HZCA 3PW4A 5ETMA 4U7UD 2HK2A 2VC1A 1WC5A 1L3SA 4F67A 4LF5F 4OX8A 3K5OA 1ZM9A 2EC2A 1MWQA 2QFJA 1TL3A 3HI9A 4QQBA 1N36F 2ZNYA 4DI6A 2J8SA 2QA2A 4MIWA 1U7LA 1FVQA 3PVXA 1D3WA 1RB0A 5EWGA 4CT9A 4DR7F 3CF5Q 5KFUA 2NZCA 4F25A 1VR6A 2GNKA 3MMBB 4OYOA 1I1GA 1U0HA 3CC2S 2PEHA 3OT9A 4JI4F 1YSJA 4NLYA 4PQAA 4O3PA 3JS9A 4LFBF 2WBRA 2IMWP 3OUYA 4K2JA 2NXUA 2VG7B 3OPKA 4UQTA 3MMCA 1C2PA 1S1WB 3A3NB 2ZE2A 2LXFA 4AFFA 3Q86A 3L7PA 4ILRA 2GX8A 3G96A 3EPGA 3NL0A 4UOHA 1W2BR 2A1BA 3DNCA 4DV3J 3OLAA 2XLIA 2HHXA 3JSMA 2HGNA 3DFEA 4OMFG 4DQQA 1J5EJ 1S1XB 1KVJA 1SB6A 1N5SA 5KG7A 3F73A 4QJVA 4JV5F 2KXNB 4HLBA 1H3DA 4NRUA 1RA6A 2DR5A 3AB4B 2PI4A 1V5IB 3Q22A 4DL3A 2N4CA 3MWBA 2ADBA 4RUHA 2LMIA 3G86A 2MJNA 1RWWB 3B6BA 2XS5A 4K7QA 2ZH2A 1C0TB 4X64F 4GC7A 2OPPB 4ALZA 5J2NA 1REVB 1WOPA 3D5MA 4IH5A 1IBMF 2PIIA 3GONA 1Q4RA 3QATA 2V2KA 3BDEA 1FNXH 5L8RC 1KOOA 1N32F 3OTBA 1RT6A 3NGTA 1S1UB 2DK2A 2BJ9A 5L9XA 2N7YA 2BM0A 4RW6A 3T5LA 5F3TA 1SH3A 3FEYB 3W61A 2IHR1 1TZ0A 2D7SA 4OI2A 4NLUA 4PXEA 5KFLA 4RW7A 2ZVIA 4NCBA 3NAIA 2J9DE 4MFBA 1IQTA 3FEZA 2G9OA 4JI7J 2VG5A 1RCOB 4FS1A 2OMOA 1JLAA 1PYSB 3R5JB 4KKOB 3RAMA 3AJDA 1FWPA 1HHTP 1BWEA 3DM2B 2I5JA 1N5YB 2B51A 4Y00A 3MXHP 4N47A 3NKYA 2VD3A 2WVEA 2GGPA 2AJ4A 5DGAA 5K8MA 4LSLB 2COLA 3PCOB 1F2GA 3HD2A 2MKSA 1EX8A 1FE4A 2KKHA 3TA0A 2B6AA 2E5LF 1RXOB 2YWKA 1VQLS 1IBCB 2XI3A 4RKUC 1FJCA 4ZK7M 3MDFA 2YNIB 2UXDF 4CYUA 3RW7A 3D68A 1I51B 3LP1A 2OSQA 2E9ZA 2ERRA 3LGMA 4B17A 3UD5A 4HACB 2DGXA 3UR3C 1CJTA 1DAXA 4B3MJ 1QUVA 3RR7A 3ZZRA 3BO3A 1EAYC 4OV1A 3IC1A 1HW8A 3PY8A 5CYJA 2O5DA 3MZIA 1RYSA 1KOHA 4FPIA 3IAS9 3I96A 2IM0A 3I9ZA 2IRYA 4CLWA 5KFCA 3W5YA 2VBWA 2ZD1A 3HZEA 1SC3B 3NG8A 2DH8A 5HJXA 1KFSA 1MU2A 1NPRA 4K4VA 1M1HA 2D1CA 3QZ7A 1HNXF 3KHGA 4RWWA 4YHHJ 2MZ1A 2L3MA 1WG1A 4CO4A 2H3EB 2NQPA 2ZH5A 2WK4A 4B3SF 4J5OA 1NK4A 1RAHB 1IR1A 3BYRA 3EM1A 3TX0A 4TYBA 2VPYB 1PSDA 3CCUS 1R0CB 2HS3A 2M7SA 4NA2A 3WBZA 1RBLA 3ZZOA 2KYZA 5J2PB 1WKJA 4RNMA 2BQ3A 3SCKE 2DNYA 5B0GA 1TAQA 1QVFR 3Q23A 3EGZA 1NZAA 3I87A 4XPEA 3LOUA 1FVSA 3WC0A 2RDIA 3ZTQA 1XMOF 1EHWA 1U09A 1TKZB 4KGVB 5HQMA 3MM9B 4K4WA 2NXJA 2FZCB 4K4UA 2HRYA 5J2MA 3C6UA 1SIZA 3KLGB 1H2UX 3H2LA 1N54B 3KYLA 1V9OA 3JYTB 3P96A 4QR2A 4J9RA 1XMBA 2QLXA 3QLHA 4HEA9 3HSDA 4YQWA 2FJWA 4R0JA 3CW2C 3EXYA 4PWDB 5KG0A 5FDLB 1UVIA 1RT7B 1HYSA 3D1OA 2DH9A 3OXFA 5L1KA 3ETOA 1RYRA 1GT8A 2HLUA 3GFZA 1U6FA 2HAIA 1IJEB 5C25B 1FRLA 1SV5B 3QJPA 1XN9A 3KLVA 2RUSA 5BYQA 1WOOA 2DPIA 5HATA 2UU9J 3H20A 5K9FA 3H5UA 2E1AA 2VZ9A 3R8YA 3DRSA 1K47A 2PFDA 1FKAF 2APOA 4WYLA 3I0RB 4LIRA 2VG6B 3M32A 3OV7A 1S1TB 2KL8A 3LF0A 5H9EK 4LSZB 4WU3A 2XULA 4MT1A 1S97A 1SL1A 4FN5A 3DDKA 3D6HB 3EDRB 3D0HE 3FFIA 1HNIA 3M30A 1UAWA 1JLBA 4PUOA 1BHNA 3PM9A 4O3SA 2M8HA 1D0EA 2FZGB 2MLYA 2ZUGA 1BXNA 4UT4A 1QUPA 1SI9A 1HI1A 4N7TA 1F2HA 2Z2LA 4LFAF 2JVRA 2MKCA 4PEOA 3DLKB 2HHHJ 3BKUA 2AYBA 3KOAA 3NCQA 1F0XA 2DRDA 1JJ2R 2BX6A 5KFOA 2RS2A 4JI5J 1B0VA 1EKSA 2DHGA 2NPFA 4C98A 1HR0J 4LJMA 3EVMA 2P2CB 2RDJA 3UVJB 4PQUA 2CZ9A 5LJ5Y 2IAJB 2GA7A 1TL5A 1M1GA 4IG3A 2X3GA 3RGIA 5DLFA 3NNAA 1ZPWX 3AQOA 3PW2A 3WX4A 4MYTA 4TNOA 1LW0B 2KXHA 4HDHA 1FJEB 4Q45A 2J0WA 1HNWJ 4MYUA 4CH0S 1T05B 2ZZTA 2BMBA 2E29A 4DN9A 5B0AA 1T11A 1VC0A 1T0TV 5K20B 3LTOA 2LFVA 4OQJA 1OPIA 4YOEA 4KB7A 5HBMB 1LQ9A 3L09A 1DLOA 4OZNA 1KVKA 3OR2B 4Q0BB 3OVBA 3MUTP 3UO0A 1RADB 2W25A 2Z30B 2FVRA 1L3VA 4H4KA 4IDKA 2V2ZA 2ADCA 1RTIB 3MD1A 5A0YB 3MM7A 4C8OA 4Z37A 2HQ3A 3UD3P 2X3DA 4Q8EA 2XZWA 4RW9A 3LWMA 3QT5A 1PBAA 3TA2A 4URGA 3H4DA 2WVBA 4XO0A 4ZVGA 2WW4A 3W2WB 1VDHA 2XGPA 4HT7A 1JWWA 1HARA 1QY7A 1HWUA 1NUEA 1WF0A 2CPZA 3I0SB 3BSCA 2DT9A 5GADI 2XLKA 1C1BB 3T1AA 1TP7A 2Y0SD 4QWAA 4WFNQ 2FVQA 2ZKUA 4NCGB 4CZCA 1MN7A 3EYZA 4MAKA 2MMYA 2MGZB 2R7RA 1J27A 3ETMA 4FYWB 3V4IB 2ZZMA 2OHDA 3OL7A 3GIKA 3IM8A 5HROB 5D4OA 4NI2A 3KG0A 2MEWA 1M5VC 1WG5A 3N5BA 2KJWA 3ISZA 1OIAA 3CJTA 3NBPB 4EU0A 1ZTWA 2EI5A 2MZTA 1VJWA 5LMNF 2OH2A 1JNRB 2G2OA 4X65J 5CYQB 2ZOGA 3GG0A 5E5NA 4C8MA 3GQCA 1JMTA 3E8OA 3CC7S 2NUUG 3MEEA 1XERA 4RNHA 4U96A 5J2QB 4H4MA 2OO4A 3HT3A 2HWTA 1S6QB 3J80U 3UD4P 1RT5B 3GIRA 1S6PA 2HHTA 1VQ7S 2ASLA 4NXMF 2R2RA 1YK9A 1H6KX 5I3QA 2V34A 3F0NA 4LFCJ 3C2PA 2CRLA 1U45A 2OMLA 1XK8A 1U49A 2RIJA 1YLXA 5F0WA 2FHMA 3PYFA 3IWXA 1IXKA 2XLJA 1VYAA 3CJ0A 4GKJJ 2LKZA 1GNKA 2AKWB 3ZZ0A 3H8YA 1GFWB 2XO7A 2UUBJ 4X4UA 2W2NP 4ICLA 4QR1A 3KK3A 1PO6A 1ZBTA 2FY1A 1M1KT 1T03B 3DXSX 1BMQB 2NSCA 3I5BA 1J5OA 3L7OA 1FK9A 2DGOA 1FD2A 4CO3A 1NXIA 2YQ1A 1DFDA 4WYWA 5JXSA 2MY7A 3Q8RB 1WF2A 4JYAJ 1WDTA 3WDOA 4BWJA 3MCSA 3QRRA 2EFVA 2HGLA 2RSQA 4O4GB 4NOHA 5C24A 5HAOA 4TYAA 3KHLA 2XMAA 1RLDA 5I3UA 4TU7A 2OP5A 4U6PA 2DR7A 3TARA 1IJFB 2KTQA 3M6WA 2Z0GA 4UQGA 2AZ3A 1S6UA 4ZVSB 2VH7A 3DCAA 2G0CA 3HKWA 1WD6A 1SUQB 4HT5A 1FKOA 2B56A 1HMVA 2GIRA 8RUCA 2E5JA 4IFYA 1HBNA 3CTRA 1F6TA 3SEOA 4B3RF 3FKBA 2LYVA 1MG7A 4ES2A 1VCTA 2MQLA 3IO1A 4M5LA 1AXQA 1REGX 4TXSA 2ZH8A 4N41A 4C3LA 3HHNB 2AZ1A 2BOAA 1MROA 4F4XA 4WFAQ 4KPCA 1VJQA 1EJ7L 2QL7B 4K4YA 3KK2B 2MKHA 4CLZA 2D3ZA 4DQRA 1KR4A 4DV2F 3TR5A 1SKRA 2HNDB 1RT3B 3RZAA 3CE8A 3VAHA 2WVDA 2RKIA 1X4EA 4X4SA 2JLFA 2XC9A 4LT6A 4ZPCA 2V9WA 5DLGA 5HLFA 3MAAB 1XR7A 4XDDA 3PNIA 3G82B 4MJKA 3R2DJ 3MURP 1RBAA 3MOZA 3GFYA 2H4WB 5H9FK 3IG1A 3A1YG 4DFMA 4FF1A 1R3NA 1HD0A 1H7XA 1NSKL 1G3OA 3R5GA 3BM7A 1FEHA 1SQGA 3VGVA 4USJC 3FBFA 4FBUA 3DGPA 1M5HA 2BW2A 5JUMA 4J7CA 5J1EB 1WKKA 2E7XA 1OQ6A 5AXKA 4I7FB 1UKUA 2A6OA 2NXEA 3N0VA 3LP0A 1RAOA 4O44B 1RUSA 3UCZP 1SL2A 1KBRA 3MEKA 3HJFA 2HRUA 2IMOA 2LEPA 2YWEA 1IKVB 2YH1A 2KRBA 4ILMA 1ZS6A 2EKNA 1IBKF 3LALA 3ZZUA 4LF5J 4QW8A 1HBMA 1KLNA 3G8SA 4YMEA 4E98A 1N36J 3MR7A 3DOKB 1HNZF 2D74B 4ZN1A 1F5AA 1GQEA 4YUDA 1CEZA 4KHMA 4DR7J 4PRFA 3KJNB 3HPOA 4MK9A 4JV1A 1YZ6A 2XHWA 4BDPA 2XMVA 1U1RA 2EBEA 1HQUA 2AJQA 1RJJA 1SKUB 3EMTA 1AB8A 1YZ7A 4JI4J 1TL7A 4ECVA 5HO4A 2VIHA 1H98A 1WHVA 4LFBJ 3RB0A 4ED2A 4C9DA 4GVBA 2O01C 2M88A 3LW5C 3PFOA 3K58A 4CRJA 1HI0P 1YJTA 1PJ7A 1S1VA 3BV8A 3RBXA 1S9FA 4L73A 1HIYA 3T5HA 1RAGB 5CH7B 3R5DA 3TUZC 1NDLA 2RHSB 3SDEA 2IM3A 1SKSA 1ZM4A 2J6SA 2IPOB 4YP3A 1LK5A 4N8NA 4FP9A 3RBEA 1X4DA 1G7CB 3ICLA 3PW7A 4LF9F 5DGBA 1RU1A 2VPWB 4PWWA 3AA8A 2H9ZA 3MR2A 3TAMA 2Q6BA 2RNEA 2YY3A 5SZTA 5KT4A 4JV5J 1FNMA 2RQ4A 1UVLA 4Y2IA 3QZ8A 4QBUA 2ACYA 4NEZA 4Y2AA 1X5TA 1N5TA 3LP2A 2LQBA 4F8RA 3NLCA 3JAMU 4X64J 5C2CA 1RT4A 1I3OB 2VBZA 4QWCA 1VBYA 3J7A1 2AYGA 1RTJA 1IBMJ 4G1PA 4P72A 2ZH7A 4ID8A 2W24A 3FRYA 3M2RA 3TJ8A 2J8AA 1N32J 2Z2MA 2Q43A 5HL7Q 3CVKA 3NMAA 2CDQA 4C0OC 1LXJA 3R6GB 2VQEF 2PFFB 5CA5A 1NK7A 2UXBF 2JEJA 3FDSA 5D77A 1NJYA 5KFQA 1RHRB 1JIHA 2YH0A 3M05A 1YJ7A 2XY5A 2KHCA 4NXNF 2Z56B 4ZVRB 3CJQA 2KM8C 1YITS 1KQFB 3SBMA 3KK1B 2PGCA 3R7NB 1TKTA 3BKFA 4JV0A 4TY8B 1NDCA 2HKEA 3R1LA 2OD6A 1NHUA 1LV5A 2DNGA 1ROFA 1FRJA 3DGVA 1VQKS 4OFZA 4NZ7A 4CNYA 5KT6A 2XMWA 2ALZA 2DXEA 5E2QA 3BBBA 3DRXA 2O66A 2DVIA 2HWHA 2YBVA 4C8YA 4QR0A 1KLMA 4ECXA 2LCWA 2F4VF 2RDDA 4DX5A 2W7PA 1VHFA 4YDXA 2E5LJ 3GIIA 2V69A 4I68A 1T8EA 2KJVA 4B02A 2VKRA 4MIBA 3KG1A 2C22A 1U0SA 2GV1A 2UXDJ 1JLCA 2UP1A 4I69A 2FJBB 1TL3B 4ZKAA 4DR6J 4F0HA 4HR2A 4DQPA 3M8WA 4WIQA 4H4OA 3CCWA 4L76A 1SQEA 3DI6B 3HHLB 3MTJA 2BJEA 2CFXA 4LBIA 4L74A 1PKUA 3KFWX 5E7OB 2VHGA 2A18A 2JEFA 4OLOA 3MMBA 3MM5A 3HFKA 3A8KA 3E2EA 2OPSA 4DSJA 2WSCC 1QJHA 1U0HB 3HHEA 3UN2A 5F9NA 1AUDA 4IRKA 1W25A 4UUXA 2WSEC 4C97A 2DXDA 5B0CA 1JXLA 4EO8A 2B4UA 1M5SA 4N56A 3VZIA 1R8CA 1HNXJ 2VG7A 1N34J 4QYZK 2XMJA 2CQDA 4A8OA 1S1WA 3PIPQ 2FLNA 2GO8A 4Q7AA 4EGLA 3IN5A 4B3SJ 3KKFA 4J91A 1ELOA 4O4RA 2W4CA 4ITSA 4WFZA 2YNFA 2C3PA 5CABA 2V8PA 3TUJC 1U02A 1SBRA 5HQ8A 2J0XA 3TNVA 2R7WA 2AF6A 5GADU 2OD4A 2HHVA 5LJ3Y 3BGFA 4B3OB 1VQ5S 1RCXB 4RW8A 2YVSA 2VL1A 2DGUA 3JSMB 2J7KA 3G87A 4DF4A 2AGPA 5ETOA 4ZPAA 3L9ZA 3F44A 1U4BA 2EC0A 1XMOJ 3BS9A 4I6AA 1QSYA 2CAJA 3NGDA 1RU2A 5KTQA 1N6QA 1CJUA 1C0TA 3BSNA 2DTJA 2E1MC 2I38A 4WFXA 1RDRA 3DU6A 3IXQA 2JHEA 4TLQA 5HMZA 5A8KA 2FPHX 3PIOQ 3AD9C 2C3MA 4P2MA 1R8PA 2V4JA 4DR2F 2AIRB 1VK3A 2P6SA 3MD3A 5HMWA 4HI2A 3TZWA 1TL1B 2NXCA 3IMQJ 1NU4A 4OYPA 3KHHA 4RW7B 4LF8F 4PKDB 4DL5A 4GRSA 3T1YF 2EKYA 4MFBB 3LAKA 1PC4A 3IM9A 4KR0B 1JLAB 5B7WA 4DHVA 3CEDA 3VQTA 4RU9A 3DM2A 1L5UA 2KN4A 1N5YA 3HVWA 5L39A 3B54A 5T14A 4F2SA 3FSIA 3FCWA 4FVMA 3JAMY 2Y8YA 2A2DA 4LUBA 4C3MA 3UN5A 3MHYA 5ADZA 4DV1F 2HZVA 3MPWA 4M1KA 3D3BJ 5E33A 2EK6A 3G9CA 4TY9A 3GJQB 3WX8A 3CGIA 2AEFA 3L7UA 2Q3PA 1UVNA 4LFAJ 4QIVA 4DS4A 4P6QA 5LXRA 1SJFA 4IR1A 2YNIA 5ETVA 2VFUA 4EBDA 3CSKA 2PA3A 3PJXA 3VGUA 2JRSA 2RS8A 3KJQB 3ONQA 4DSFA 1HHSA 4N5SA 4G1QA 3V5RA 3CIMA 5GMEA 2E1PA 1LKZA 2DNPA 4ED5A 3D66A 3TUPA 2J76E 2OEJA 1WJ9A 1LFWA 4H54A 3KUGA 3ISND 1AYEA 5KT3A 4C0HA 2YKOA 3P8BB 1F5BA 4G1IA 1FFWB 3KLIB 2KH9A 2H4YB 1U25A 4NZ6A 3CJ8A 5GAHI 2CJQA 2JNJA 2XM3A 3D3CJ 3EJMA 1B0PA 2HFVA 3D0IE 1D09B 2VDIA 3E3XA 1YIJS 4NMXA 2QRRA 3D6TB 4ECQA 5KG2A 2AJ1A 3HSGA 5IC4B 4FF4A 1FE0A 1B0TA 4OJ3A 5DETA 5CYMB 4LF6F 5LXYA 1G4CA 5J2PA 2UUAF 4DV0F 2YNGA 1CJVB 2J9DA 4J37A 2LXIA 3GU0A 2HFUA 1LWCB 4CLSA 3EDQB 4HHJA 3ZNJ1 3JTPA 1LNQA 2CDRB 4QIGA 2GAHC 3H42A 3ZO7A 3OL8A 3KLGA 1OWXA 3CD7A 2XY7A 2Y0BB 5K14B 1S4EA 4Y2KA 2MPUA 4ZIWA 5MLCV 3KNAA 1DQAA 1URRA 4A8KA 2UUCF 3T1HF 3QLHB 3OJSA 5BR8F 4PWDA 1V3SA 2OPQB 2H5JB 1HYSB 2MHNA 1VBXA 2NUHA 2N3LA 2POKA 1IKWB 5IWAF 1W7WA 4B9UA 2R8GA 2UVUA 3PRDA 3X3UA 3QWPA 4RU2A 1IWAA 2P6TA 2DNKA 3TUIC 5GAEI 5LMNJ 4KY3A 5EHHA 3DRSB 2JWNA 3I0RA 1UZHA 3PV8A 3BQ2A 4BC9A 2VG6A 3VVTA 2K2PA 2GMLA 4ZDNA 1S1TA 3M32B 1UEUA 4MKBA 4F4YA 2XZDB 2FGCA 2DNNA 3CCQS 1JKHA 2WONB 4ED8A 2V4RA 1W26A 2PT0A 1A9NB 5B0BA 3DC2A 3OVSA 4JOUA 4CH1A 3FFIB 2WCXA 2C3YA 5HVGA 2CJXB 1JLBB 4PUOB 3I6PA 4NXMJ 2HBQB 3G6XA 2GVZA 4I0WA 1JLFB 4IQMA 3EWGA 3T3FA 4DZ6A 2BABA 1X5SA 3ITHA 4I6WA 3ET6B 2HIQA 3DLKA 2HG4A 5AE1A 3KXDA 3MCMA 2IBOA 1EARA 4P7TA 2WB4A 1I6JA 2QIFA 5KFNA 5L38A 5KFSA 2NZ4A 1S9EB 1X9WA 3M8ZA 3FEXB 2F7VA 4USHA 2R8KA 5IV4A 1S7IA 4EYHB 2KG0A 2QSWA 3A12A 2IJNA 2IAJA 4NA1A 3BREA 2ZHBA 2BXJA 3H25A 2L41A 1EP4B 2CPDA 2Z4PA 3OVAA 3CDUA 3Q8YA 3Q24A 3IBCB 1Z2ZA 1Q8BA 2DISA 3B82A 5B08A 4ZVUB 1GEHA 2ZEJA 1FX4A 4DU8A 4HKQA 2IDEA 5AJ3F 3BO4A 4DSIA 1RHMB 2HQGA 4QWBA 2JZ5A 1T05A 3HFVA 4ZJLA 2XWXA 4W90B 1BGXT 2HNZB 2I1RA 1YJNS 4OJHA 5ETPA 2CJ9A 4B3RJ 5DZ6A 4C7QA 5HBMA 1Q78A 2EFQA 2NSBA 4ELUA 1NB7A 1DLOB 1UW4A 3RBZA 2LDIA 5HMXA 4Q0BA 3IS9B 4M5HA 1Q81T 3OFEA 1H38A 1NEEA 1RTIA 4IDKB 5KFKA 5A0YA 3VV2B 4DV2J 2D3UA 3S7RA 3Q89A 1HQ2A 1YJVA 1GAOA 3IA0A 1RACB 3GYNA 3HP6A 1Y7PA 2B5JA 3OXLA 5SUHA 4LF2A 2M5YA 3G6VA 3W66A 5BJRA 2CJYB 4N77A 3I0SA 2AJ2A 4IH7A 1AUSL 1LW2A 3ILJA 4U8YA 4UY8T 4MTPA 4BCAA 4KIAA 4NCGA 1VIOA 2QA4S 1DHMA 3RW6A 1RWXB 1M5PC 2MGZA 1VLOA 3X1LB 3VF0B 3ILIA 3NGKA 1HWKA 3V4IA 5H9FJ 5RUBA 2EBGA 5HROA 2A10A 4F3MA 2JC1A 2NXNA 3EGWB 4D3GA 4NI2B 4UOGA 1TL4A 4K59A 3NBPA 3E51A 2CJKA 2LQ8A 1HWIA 1TKXB 3K8WA 2DHSA 3RB6A 2GZOA 4ECWA 5IQ6A 2JC0A 5FLXU 4DQSA 5CYQA 2QO3A 3CD0A 1ICEB 1RWPB 3CCRS 4ZP9A 4BBYA 3ZNUA 4MKVA 2F1FA 1IBKJ 1FKPB 2JDJA 2HVEA 4RX6A 4MKAA 4PYDA 4H4MB 1FT8A 1ZETA 3R7SB 2QLBB 2CPEA 3N28A 1RT5A 4M5GA 1HNZJ 2H1YA 1S6PB 1FX2A 3AH6A 3E01B 4P75A 4Y3CA 2VBYA 2VODA 4XPCA 3DRYA 1S0VA 2EG2A 4DV7F 3T5KA 4X2BA 1NK6A 1XNRF 3CT9A 2W4PA 3OQ2A 2MB0B 3P49B 1YKWA 3M8RA 4FYXB 4Q5VA 3BQ0A 2VUGA 3AXKA 4QPXA 2CWXA 2LECA 1T03A 1EQMA 5A6PA 3W64A 4E8UA 1AROP 2OGUA 3A8IA 1NK5A 3MCNA 4C11B 3FZBA 1YG0A 3K0JA 4ZS6A 3FBBA 4CCHA 5EWFA 4QOTA 1ZTTA 4PZVA 2WZ1A 2X1FA 4K0KF 2E44A 5DM6Q 2F3JA 1HBUB 5HI7A 1D1UA 1IBLF 3RG6A 1T3OA 4NRTA 1T95A 2IY5B 2CNKB 1MWYA 4LF9J 4GMKA 5T41A 1BUXA 3KLHB 1SUQA 2C1EB 5DDOC 3PRBA 3AA9A 4LSNB 4KO0B 2AJFE 1R6VA 2XMMA 1RABB 1OS5A 2HS4A 3I4HX 3MECB 1WG4A 3Q8QB 4IFYB 5HQLA 3AQPA 1N5QA 5KFGA 2M4MA 2HMIB 2G0IA 3AJ2A 2CKWA 4I56A 1MROB 4NX9A 1JK9B 3KK2A 2ROPA 2P8IA 3K17A 3D6FB 1WSVA 3R5AA 4NZ0A 4JI6F 3Q83A 4LIWA 4X4TA 5KT7A 4IG0A 2HNDA 1RT3A 1EETB 4LBHA 2VBXA 2NLWA 2VQEJ 3PYDA 1YBTA 2UXBJ 2GVDA 3PYGA 1J2VA 1FDDA 3H0PA 2IRUA 2C3UA 2ZBIA 4DFPA 3MAAA 1S4FA 2RRAA 4NXNJ 5HLFB 3G82A 3VVUA 1I94F 4K4XA 1WI6A 4LR7A 3FSXA 1T3NA 1EQ0A 2JFDA 1GTEA 3NS7B 2AX0A 3J7Z5 2FD2A 3P6YC 1TUVA 2IM1A 2MQNA 8ATCB 2XNQA 1T9VA 3DGPB 5HN0A 4CLFA 1GMUA 5J1EA 5HP1B 1VQ6S 3NP5A 5M2PA 3F41A 1VQNS 4U67Q 1SVDA 3UCGA 1TK5A 4ANEA 1VS3A 2F4VJ 5ETRA 5F9LA 2FTRA 2HPUA 4EFAC 4FNIA 1WKLA 3GCWP 1P9YA 1IKVA 3W5XA 4CM2A 3GZ7A 1UVMA 1RAFB 3PEHA 4ID5A 4IOAQ 1BLUA 2MLXA 4F50A 2W9BB 3L3CA 2IJFA 1WWHA 2YQ3A 3NOGA 1OJ4A 2K1RB 1HBMB 2XNRA 2RRBA 1SCJB 2ZBPA 3CJKA 5E3CA 1QAJA 1NHVA 5B0DA 5G0RA 4N8OA 3LQVA 5GAHU 3TQ1A 3C15B 3CCMS 4USWA 2J7UA 2MQPA 2V4QA 4NYPA 3TRGA 4DCJB 1HD1A 3R3TA 5C5JA 3TWZA 2VFRA 3K5NA 1S7HA 1H74A 1TL7B 1VRUB 3QPIA 2C2ZB 1UJ5A 3I31A 2DGTA 2XSFA 2YWGA 3W5ZA 5KFXA 4JB8B 2DRAA 1S99A 1NHKL 4QWDA 1N52B 2DNOA 2AD9A 4XK8C 2DB1A 2B8QA 2LA4A 2EK1A 5F8NA 1X7VA 2DR6A 2KG1A 4R5PB 1Q8IA 1GXLA 4KH1B 5GMKa 5IQQA 2RF2B 4QYZJ 4RBTA 4G3IA 3M8YA 1RISA 1X5PA 4L72B 1N4LA 2ZH1A 5A6WA 4DPTA 1JLGB 1WORA 2LU2A 7FD1A 2V8HA 3MPYA 1C4CA 4LMZA 3QIPA 3A8JA 4USVA 1WTBA 1KN6A 5EN1A 4WZMA 4OYMA 1U1LA 1YGYA 3M1VB 3TVZA 3MGJA 3AODA 2BUNA 3RRKA 4CNZA 2D69A 4NMLA 3FJ2A 1A6LA 4OI4A 3NAHA 3LPEA 2IM2A 2ZDOA 3VALA 4CLKA 4ED7A 5GAEU 1Y9OA 2I2YA 2GHPA 1U8SA 5KFEA 3ILOA 2QL9B 4DV5F 4DR2J 3MAHA 4OX9F 2VFTA 1DQ8A 2J9EA 4DR3F 4MK8A 3RAQA 3C66A 2YKMB 3I9V9 4EWTA 1FWLA 4LF8J 3T1YJ 1Q5VA 4USKA 1JJ4A 3PX6A 4DLEA 3POTA 3BSAA 4WXOA 4YY3F 1TFYA 3G8TA 2RRNA 3I5AA 4OI0A 3OL9A 3SSRA 1FFGB 2GMJA 4FVCA 2CQ2A 3TI0A 1PAEX 2VOPA 2AW0A 4WFBQ 1JXVA 2CJAA 3QAEA 2JVOA 2HHUA 2NYIA 2ZJQQ 1DARA 1B70B 2DY1A 4DV1J 3UWTA 2KFZA 2BYCA 3CJRA 1YBAA 3FCVA 4G6VB 2IFXA 1KTVA 1NLKL 2Y1LB 4M5JA 1X4CA 3THPA 1SH0A 1ZM2A 5JMNA 2MKIA 4G65A 2BQUA 5D3GB 4ETXA 5E3QA 3SQGB 3CJ2A 2E7VA 2AYEA 4DN0A 3HKZD 1JLCB 1TTHB 3DYAB 1I5OB 2EFNA 2ZH6A 3DI6A 4M95A 3NXZA 4ZPTR 1S59A 4H4OB 3HHLA 1TUGB 1RP5A 4WF9Q 4AT1B 2LXUA 4KHRA 1CJKB 1H72C 4EBCA 3B4DA 1X5OA 2XMUA 3MF5A 1PIEA 2GQCA 3MM5B 3SFGA 4DUZF 1C1CA 1U1OA 2OPSB 1RSCA 3P45B 4CT8A 2MZQA 2BKOA 3CJ3A 2QEXS 2EVZA 1Q7LB 4LF4F 3TP2A 3UR0A 1F5CA 3GV8B 2A2CA 3PTWA 2BJ1A 2ILZA 3H98A 3CC4S 1RT2B 3CIZA 3KLFB 1N5VA 2ZUAA 4PPDA 5KFZA 4WFYA 3VAKA 1NAQA 4AD6A 3NY0A 4DSEA 2QLJB 3GJTB 2YNFB 2LQ5A 4JI8F 4IO1A 4LF6J 4F2RA 2ZBRA 4ZVEA 2UUAJ 4DV0J 2DPJA 4B3OA 1WELA 2A0FB 3HVTB 4RW8B 4WK3A 1WC3A 5IXUA 3RBDA 2OTLS 3Q2TC 4KH0B 4IH6A 3JTNA 1Y5NB 2C2OB 4DV6F 1OYDA 2DGQA 3SI8A 4KGKA 4AL5A 2WSFC 3PFEA 3GIJA 1N6QB 3IAM9 1CJUB 2V0NA 1YHQS 1PAUB 2EFGA 2NYHA 5A8KB 2FDNA 2UUCJ 8AT1B 2WVCA 3T1HJ 1KS2A 2QMWA 3TYTA 5BR8J 2V4JB 4I6YA 3O44A 2ZITA 3NNHA 1TL1A 2F63A 3HULA 3MEDA 5EWEA 1QSLA 1NK8A 5IWAJ 3UDLA 3M8QB 1PILA 2WVFA 1TK0A 3R97A 2QMUB 5F0UA 4KT0C 4NASA 2WW8A 2WBMA 2R7TA 5KG3A 6FD1A 1T9TA 3CCZA 4DDFA 2KRRA 3QO9A 1K73T 4C8LA 1NK9A 2KT5A 2B4VA 1SPBP 1XIQA 2J0SD 2XBPA 2V67A 2M9KA 1NDKA 1N0UA 1XR5A 5KG1A 1T9UA 5F8GA 4ZVQB 1VI7A 4A8QA 4M5NA 2GAGC 2QYGA 3RUBL 2PN6A 3BGRA 3TEHB 3BPDA 1R0BG 3C46A 2QGFB 3BR8A 4ZIVA 5AE3A 2UXCF 3QFHA 1T94A 1K1SA 2E5HA 2G2YA 3N01A 5L46A 3UE2A 2KT2A 4DR6F 2CQ1A 1Q79A 2QV6A 4HL9A 1O51A 4DEZA 4G1QB 5KFDA 4GO7X 1RWKB 1NRKA 1IWGA 3EVWA 1H2TZ 3RB4A 4ZJQA 5I42B 2HZAA 2ZFHA 2ZNZA 5KFTA 2BV3A 3VAIA 3SQOP 5HSPA 1UEVA 5CAAA 4PXCA 4OYZA 4ATNA 3TJAA 3KLIA 2C42A 1LWXA 4M63A 3AD7C 3A3PB 1TFWA 5AJ3J 2CNNB 1WOSA 1GMWA 2DHAA 4A4JA 1N34F 4F7VA 3HO1A 2DNMA 1F1BB 2BE2B 3D4JA 2HQCA 4CO2A 2AP6A 2IDLA 4BLGA 1FXDA 1NBEB 4CI0B 3NRBA 2CXEA 3R7BB 1DTTB 2W1BA 5CYMA 4C6AA 2A6MA 4ZPDA 3TVKA 2BBEA 1X60A 1CJVA 2YNGB 1TQLA 2LU1A 3QT8A 3M9NB 3GWCA 3B4MA 3U1NA 1GK8A 1MW7A 4NCAA 1LWCA 3A4TA 4HHHA 3OL6A 4PYAA 3MM8B 5A76A 1MLAA 5B09A 2CQCA 2DEJA 3BH7B 5CCMA 2NPIA 1TMMA 3MPUB 2QLFB 4D3HA 2BKNA 2V2QA 3K89A 5K14A 1K8AT 2CPFA 2OLWA 1LWFB 2F4FA 3FZ2A 5D8HB 1KTQA 2DNZA 4Y65A 1R8AA 3SV3A 1T9YA 1NH7A 1RWNB 3DOMB 2OPQA 5KFBA 2BEFA 3DOLB 1IKWA 4PAAA 2JEIA 1VC5A 3LWLA 1C0UB 3SSSA 3IFEA 4X4OA 4ZVFA 4OV6A 3GSIA 1Y5IB 2YXLA 1QDUB 2MYFA 5DZ7A 2WONA 3GFHA 1UVKA 1UP1A 4DL6A 1U2FA 1JKHB 2J7WA 1SJRA 4XDCA 1LEOA 4DLGA 1NKCA 3TJ9A 1MSWD 4J9OA 3QGHA 3G71S 3OFHA 2JFKA 3CUNA 1FRXA 4C0BA 2XTJP 2GVZB 1JLFA 3US5A 5C42B 4UW2A 4NL5A 4ANCA 3I82A 2N4DA 4CLPA 4DV7J 3O8WA 3ET6A 1XNRJ 3ITHB 3QRPA 1WDDA 5JJBA 2DH7A 2Y3YA 4LF7F 2V5HG 2QT7A 1S9EA 4WCEQ 5I3PA 1IR2A 1RQ0A 3OHBA 4UZCA 1QAYA 1RZMA 1YX2A 3M8PA 2ROEA 3DLLQ 4DPWA 1X9SA 4C2MA 1WEZA 4K0KJ 3MUMP 1EP4A 4PCQA 2Q66A 3IRWP 3QGPA 5KG6A 1K44A 4YFUA 1IBLJ 3QGIA 2KDOA 4KV8A 4QIEA 2EFPA 4I2QB 1ZAVA 4ES1A 5E41A 1XMQF 3EICA 1V3RA 2VOOA 3ZTOA 1N48A 4NA3A 4WKYA 1QSSA 1P9QC 3CMES 4W98A 2HNZA 4MMOA 4DX7A 3I56S 2UV8G 1Y10A 1LXNA 2B4PA 2B7CB 3WQPA 2MKKA 2X1AA 2DKOB 4DV4F 2KZZA 5HK4A 1S77D 2FUG9 5K8NA 3PKMA 2MQOA 3IS9A 1NPPA 2HWIA 3QAUA 4OX7A 2BJ3A 4Z7CA 2HQIA 1U8WA 2BZ2A 4TQSA 1SJ3P 4JI6J 1CQMA 2AT1B 4FZVA 4U9RA 4Q2LA 4L6V3 1PYTA 4BWMA 4IRCA 4NLOA 3GLJA 4J9LA 3G8QA 3HHLD 5CQGA 5DQHA 4YS2A 3SCLE 4RZRA 1NJIT 2CQHA 2OKQA 9ATCB 1OPZA 3JTOA 2J5AA 2V50A 1TU0B 3ZTSA 2B5JB 3D54A 3ZXWA 3GTYX 2GQ2A 1FA0A 2RU3A 3BH6B 3W63A 3QSYB 3HT0A 3WC2A 3SFUA 4A8FA 3GR0A 3BDPA 3OHAA 3AFGA 1LW2B 4WPAA 4DX8H 4FXWA 1I94J 4M94A 2YX4A 4Q44A 2XG8A 3DRRB 1U1NA 4IQXA 2Q1LA 4DPXA 4DR5F 1WC1A 3PACA 4J9QA 3CJ5A 4OZ2A 4MK7A 1Q82T 2OTJS 3RR8A 3G2XA 2IYIA 3H90A 1AT1B 3BF4A 1S9GB 2ZJRQ 2DHXA 2DRBA 3Q0AA 3BN4A 4USIA 4AL7A 5DDRC 2HNYB 4RBVA 2BRKA 1RT1B 1TKXA 3T6BA 4EBEA 5ETSA 3FVYA 2UV8A 3VQSA 4ZVPB 3R6LB 5BXIA 3HHKA 2IA6A 1S72S 3NCPA 3T5JA 4ECSA 1WACA 4LQ9A 1Q95G 2VU5A 3QIDA 1FKPA 4CIOA 3WHIA 2P9EA 2ZDPA 3O6QA 1OSDA 2GW8A 2JSXA 1FRHA 2ZH4A 2MQ8A 2KI2A 1F60B 3UQSA 3D6MB 2HBZB 1H73A 4K5RA 3I5CA 3C14B 3CCVS 4LREA 3DDIA 3D7SB 3E01A 1U48A 2E7WA 3PYEA 1Y3JA
chains in the Genus database with same CATH topology
2UVVA 1I6JA 3LGMA 3PZPA 2QIFA 5KFNA 4IR9A 1IKXA 4B17A 1BQMA 5L38A 2O67A 2FHJA 2XCPA 5KFSA 1MNEA 1YJ9S 2DGXA 1FCAA 3UR3C 2NZ4A 1DAXA 1S79A 1S9EB 1X9WA 5L1LA 2VFVA 3FEXB 2F7VA 1QUVA 4USHA 3RR7A 1ZPVA 3ZZRA 2R8KA 1HI8A 3BO3A 2YX7A 2PMHA 4OV1A 4EYHB 2KG0A 3IC1A 2HHQA 1HW8A 2QSWA 3MAQA 3PY8A 5CYJA 3Q8PB 1XBWA 2IJNA 1R7IA 3DLJA 2O5DA 3LH2S 3MZIA 2IAJA 4NA1A 4KJIA 2GO9A 1RYSA 1NJXA 1KOHA 4C11A 2CPXA 1JJHA 3BREA 2ZHBA 1G1XA 1K1QA 3HMJG 3IAS9 3I96A 3OUYB 2BXJA 2IM0A 2I0XA 3H25A 2L41A 1EP4B 2CPDA 2Z4PA 3OVAA 3CDUA 3I9ZA 2IRYA 3J7YU 2R2UA 4JI0F 5KFCA 3VWSA 2VBWA 3Q24A 2W7AA 4CTAA 2ZD1A 3HZEA 1TV6B 3NG8A 2DH8A 3TANA 4HYKA 1KFSA 1MU2A 3UDCA 4K4VA 1Z2ZA 1HBUA 1Q8BA 2DISA 2D1CA 3QZ7A 2CQGA 3B82A 5B08A 3BQ1A 4P7VA 3MMCB 1HNXF 4OI3A 4K4SA 1URNA 1U6ZA 3KHGA 2ZKTA 4RWWA 2ZE2B 1WF1A 5D4LA 2MZ1A 1U24A 4HKQA 4PG8A 1R89A 4KGMA 1S48A 5AJ3F 1WNEA 2HVHA 4QWEA 4HI1A 4QW9A 3BO4A 2L3MA 1WG1A 4CO4A 4DSIA 2K3KA 3RB3A 3HX9A 2NQPA 2C2RA 2DNLA 1MMNA 2ZH5A 2HS0A 2F40A 3OW2R 2WK4A 3BR9A 4QWBA 2JLGA 4J5OA 4B3SF 1NK4A 2JZ5A 3OSPA 1T05A 1RK8A 2XWXA 4TYBA 4W90B 1BGXT 2HNZB 1UMJA 2I1RA 3KLHA 2VPYB 2N7CA 3ZFVA 1PSDA 3GFXA 1YJNS 3CCUS 4E0DA 4OJHA 2R7VA 4ETZA 2R7XA 2HS3A 4LSNA 5IT0A 4KO0A 2WTFA 2M7SA 2MJUA 2CJ9A 4NA2A 1VRTA 3WBZA 4MIAA 3ZZOA 4C7QA 5DJBA 1IUJA 4TN2A 5DDPC 3MECA 1P27B 2KYZA 1S1XA 5J2PB 5HBMA 1Q78A 4RNMA 2BQ3A 3SCKE 1FRMA 2EFQA 2KYXA 1X0FA 2DNYA 5B0GA 1K0VA 2NSBA 4ELUA 1TAQA 1NB7A 4TU9A 1QVFR 1DLOB 1X4FA 5KAKA 1UW4A 3Q23A 2LDIA 2N82B 3EGZA 5HMXA 2NS1B 4Q0BA 3IS9B 2HMIA 1NZAA 3I87A 4XPEA 2U1AA 3BN7A 1S0NA 3LOUA 4DSKA 2DD8S 1FVSA 3WC0A 3MPVA 2Y1IA 4CO0A 1Q81T 2RDIA 1FJGF 1F9FA 1XMOF 1YWXA 3OFEA 4EO6A 1H38A 3AAWB 1NEEA 1RTIA 1U09A 3HK2A 4IDKB 1TKZB 5KFKA 5A0YA 5A8RB 2VQFF 5KFMA 2OPPA 4OZ0A 1REVA 3MM9B 3T9ZA 2D3UA 2V8VA 3S7RA 4K4WA 3QWUA 1D9DA 5J2NB 2OAUA 5LT5A 2XCAA 4K4UA 2XEXA