1RT5B

Hiv-1 reverse transcriptase complexed with uc10
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
427
structure length
406
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Nucleotidyltransferase
total genus 116
structure length 406
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt5B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt5B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt5B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt5B03
2RKIB 3H40A 2HNZA 2W9CB 5KFEA 4J9NA 4LSNB 3I0SA 3PW4A 1S9EA 2BANB 3QO9B 4G1QA 2YNGB 3QIPA 2R2SA 5KFPA 2W9BA 2C28A 2R8KA 1UWBB 4MIBA 4ECZA 4TY8B 1S1UA 1JLEA 2O5DA 3GIMA 1RA7A 1C0TB 1N5YB 5D3GA 4NLPA 4FS1A 2J6TA 5F8GA 2OPSA 4TLRA 1S6QB 3IN5A 2BQ3A 4NYZA 3BSCA 1MMLA 3MECB 1ZTTA 1RAJA 3IRXB 2C22A 5J2MA 3H59A 4RZRA 2R8IA 5K14A 3GV8B 1R0AB 5KG4A 4ICLA 4O44B 4IDKA 1SV5A 1LW0A 3KLIB 3H5YA 2OPRA 3RB0A 3DLEA 4DL6A 1ZETA 4LQ9A 1RTJB 4RNFA 1SH0A 5C25B 4O4RA 3BSAA 4Q43A 4MK8A 4U7CA 4EO8A 4KV8B 2YNHB 2IM0A 2XGPA 3OSNA 3RBEA 5JUMA 3DRPA 1RT7B 4WZMA 4NLVA 5F8MA 3C6UB 3DLGB 2IAJB 1HQEB 4Q0BB 1S49A 1TL1A 3MFHA 3HVTA 3IGVA 4R8UA 3T5KA 2XWYA 1FKPA 1LWCB 1KHWA 2HMIB 1SH2A 5KG0A 3DMJA 3ICLA 1JLAB 3M8PA 1EETA 3BQ1A 5F8IA 1LWEB 1D1UA 4KFBB 5KT2A 4KKOA 4YR3A 3LP0B 4EYHB 1RT1B 1TKZA 5KFFA 3MR6A 3KMQA 3JSMB 1TQLA 2IM2A 2BQRA 3FFIA 5HLFB 4ID5A 1MU2B 4J9PA 2GC8A 3KLHB 2RF2B 3IGNA 5KG5A 4IFVB 1N56A 2AQ4A 5DQGA 4O3NA 5HP1A 4IRCA 5DGAA 2ATLA 2B5JB 1LW2B 3H5SA 2R2RA 2B6AB 4PUOA 4KB7A 5CYQA 1T03B 5KT4A 4IH6A 4RNOA 3CJ4A 3PR4A 3IG1B 5J2NB 5KG2A 3LP1A 3T5HA 5KT7A 4KSEB 3N6LA 2V9WA 5DG7A 5KFYA 4DG1A 4R0EA 4KO0B 4WFYA 3GIJA 2C2EA 1TKXA 3KLFB 4IR1A 4JV0A 1FKOB 1S4FA 4FBUA 3EPIA 3CIZA 1T94A 2HNYB 1TL3B 1S9GA 4K50A 2OPQB 3HHKA 1K1QA 4K4ZA 3I0RB 2ZKUA 2D7SA 3OSPA 3KHGA 4RW8A 5KFTA 2AGOA 1S0NA 3CDWA 2FJVA 3Q8QB 2OPPA 1JIHA 4ZVHA 1QAIA 4RNMA 5DG9A 1REVB 1KLMA 3LP2B 3V81B 5I42A 3OHBA 4WYLA 4J9MA 1HMVB 1SUQB 3C6TA 3RB6A 4WYWA 1IKYA 1QE1B 2UVVA 4NLWA 1TVRB 4J9KA 1S1WA 4NLYA 4ED2A 5HBMA 3QIDA 3RAXA 3QZ8A 1C1BA 2JLEA 5KG3A 5EWFA 2FVRA 3DRSB 5F8LA 2IC3B 3GIIA 4QWEA 4XPCA 5KFGA 4EO6A 4ZVGA 1HNIB 3DM2A 3PW2A 2YNIB 4URGA 2XI2A 4KE5A 3KK3A 3E01B 5KG7A 3CJ5A 3DLKA 4K4YA 4ZPDA 4YR2A 3BSOA 3KLGB 4RNHA 3ISND 1J5OB 2YNFA 4IKAA 3IS9B 3FDSA 4QWBA 4U6PA 3V4IB 2VG7A 2W8LA 1DTTB 1ZTWA 4PQUB 3DOLA 3KLVA 2R8JA 3KK2A 2BRLA 5KFAA 3OL8A 3DI6A 4ED7A 4Q8EA 1RTHA 1RT5A 3I0SB 1BQMA 1S9EB 4G1QB 2FVQA 2D3UA 3QIPB 2JC1A 3PR5B 3GV5B 2W9BB 5EWGA 4YQWA 4K4TA 1S1UB 1JLEB 2ZE2A 3EPGA 5D3GB 3FQLA 2BQUA 2UVWA 3KK1B 3QLHB 5KFBA 4X2BA 5KFNA 4WXWA 4J9SA 4GC7A 2AWZA 3T19A 1LWFA 3DYAA 1S48A 4HYKA 2DPJA 1S6PA 5J2MB 2HWIA 5DG8A 2VG5A 5K14B 4KHRA 4ZP8A 1NNDA 4I7FB 4I2QA 2AGQA 4IDKB 1SV5B 1LW0B 5FDLA 3DLEB 1JLCA 5J1EA 4WFZA 5KT5A 2VA2A 2XCAA 4NCGA 1OS5A 4IQXA 2B43A 4ZPCA 1W25A 3M9NB 4ED3A 3KNAA 5KFIA 2FVPA 1I6JA 1JLBA 3LALA 3DRPB 1IM4A 5DQHA 2WOMA 1GX6A 5KFZA 5KFCA 3E51A 4F4ZA 1TKTA 4RW6A 1TL1B 3D28A 3HVTB 4R8UB 3TQ1A 3MTKA 4ECWA 4MIAA 5KFXA 1FKPB 4IOBA 1D0EA 3CJ3A 3H98A 3M8PB 1EETB 3H2LA 4FBTA 1TV6A 1FK9A 4KKOB 4IH5A 2ILYA 3D5MA 1TKZB 3PW5A 3CDUA 3BSNA 3FFIB 4ID5B 4F4WA 5I3UA 5KFRA 4O3SA 2AU0A 5L1IA 4H4OA 4URQU 5HP1B 2HNDA 1RTDA 4M94A 3N6MA 2E9TA 3CWJA 3BGRA 1HNVA 5CYQB 3NKYA 2WONB 3KHRA 4ECRA 2FLNA 3LANA 4LQ3A 1XR6A 4O4GA 4Q44A 3M9OB 4O3QA 3T5LA 1JKHA 2FJXA 2XGQA 1N48A 4IRDA 4DG1B 3G6YA 1TKXB 4ZHRA 2JEFA 5KFMA 3NBPA 3UQSA 4F4XA 4TXSA 4WE1A 3QGIA 2V4RA 3MEDA 4I2PA 3JYTA 2FVCA 4RUAA 3G6VA 1S9GB 4DL7A 5DQIA 3PJXA 5L1KA 1S1XA 1WNEA 1K1SA 4RW8B 2W7OA 3SFUA 4R5PA 1RT6A 4NLOA 2OPPB 5L1LA 1C1CA 4B3OA 1XR5A 3Q8RB 3HVAA 4ZVEA 1C0UA 1KLMB 5DGBA 5I42B 4QWCA 2FLLA 2C2RA 3NAHA 2ASLA 5KFWA 3V6HA 3C6TB 2YKMA 3MEEA 3KJVA 1IKYB 1KHVA 3KLEA 4RW9A 1S1WB 5J2PA 3CVKA 2YKNA 5HBMB 2F8EX 1T3NA 1C1BB 3NMAA 1VRUA 4ECSA 3FQKA 4RW7A 4H4MA 3GILA 4ECUA 4NRTA 4Y2CA 2UVUA 4MK7A 3H5XA 3DM2B 4ECTA 4Q0BA 1U09A 5EWEA 4WZQA 4PWDA 4IR9A 2YNFB 5J2QA 4NLQA 4NLRA 5F8JA 2VG7B 4ED1A 3I5CA 4Y34A 2JEIA 4ZVFA 3DOLB 4EBEA 3GIKA 3NL0A 3JSMA 1NHUA 4K4SA 2BRKA 3DOKA 3KK2B 1S10A 3DDKA 3DI6B 2DPIA 2BE2A 1RT5B 1RTHB 4ECYA 1BQMB 4ECXA 3HKWA 4WXOA 4FS2A 4G3IA 1N4LA 2ZE2B 1SH3A 5EUHA 2HWHA 5C24A 3QYYA 4GC6A 1S0MA 4J9RA 4IG0A 2FVSA 1RYSA 1T03A 4ED6A 3UR0A 1S9FA 5JXSA 1YVFA 4J9OA 2E9RX 4DL3A 1QUVA 4ZP7A 3KOAA 2ASJA 1DTQA 3DYAB 1S6PB 2RDIA 2D41A 3T5JA 2WK4A 2VG5B 2UUWA 1IKXA 4F50A 4I2QB 2HNZB 5FDLB 4K4XA 1JX4A 5CYMA 4YP3A 1JLCB 5J1EB 5KFQA 3PVXA 1VRTA 2I5JA 1JXLA 4TN2A 2IM1A 1JLGA 3PW0A 4Y3CA 2FJWA 4XPEA 3HVWA 1JLBB 3PHEA 2OPSB 2AX1A 3OL9A 1JLQA 2WOMB 1IKWA 4URSA 3EZUA 5KFLA 5F9NA 4F4YA 1TKTB 4RW6B 4ED8A 3V6DA 4IG3A 4IFYA 4EBCA 5KFKA 3T1AA 3M8QA 2R2TA 4ICLB 1N6QA 4J9QA 1S97A 2XCPA 3DRRA 3NGDA 1DLOA 1FK9B 1TV6B 2OPRB 1HYSA 3DRSA 2E9ZA 1S0OA 2J6SA 4DL5A 4O3PA 2W9AA 4K4UA 2J6UA 2VG6A 3LAKA 5I3UB 3VQSA 4EYIB 4JV2A 4MH8A 4K4VA 5KT3A 4H4OB 4RW4A 1XR7A 4HKQA 2R8HA 3TAMA 3MR3A 1RTDB 2HNDB 3MEGA 1RA6A 2JC0A 1RT3A 1RTIA 5HROA 3GYNA 3UPFA 3BGRB 1HNVB 4DL2A 4IRKA 1RT2A 3TVKA 4TY9A 1S1TA 4O4GB 3DMJB 3G6XA 1S1VA 5KT6A 4RNNA 1T05A 2AGPA 1HQUA 4ZP9A 1JKHB 4MFBA 1HPZA 5KG6A 5KFHA 4ECQA 3V6KA 3ITHA 1HARA 3Q8PB 2V4QA 1IKVA 4ZHRB 4RUCA 1EP4A 3NBPB 4JV1A 3OHAA 4WE1B 3FSIA 3MEDB 4I2PB 1BQNA 1RT4A 4LSLA 3JYTB 4NZ0A 4QWAA 3GQCA 4EEYA 2ZD1A 3QLHA 3KK1A 1S1XB 3UDLA 1JLFA 2WTFA 2CJQA 4R5PB 1RT6B 1CSJA 5KG1A 3H4DA 4OL8A 1C1CB 4B3OB 2V0NA 4PUOB 3Q8SB 4O3OA 1C0UB 3MR5A 3LP1B 5F9LA 4EBDA 5C42A 4I7FA 2RKIA 4NLXA 2W9CA 2YKMB 3MEEB 3KJVB 4LSNA 2IA6A 2BANA 3QO9A 2YNGA 3KLEB 4RW9B 5J2PB 1UWBA 2YKNB 3GV7B 4TY8A 1VRUB 3KHHA 3BQ0A 1C0TA 1N5YA 4ECVA 4NLGA 3M9MB 4RW7B 3I5BA 4H4MB 1S6QA 3OL7A 2W7PA 1C2PA 4MKAA 5DLGA 3MECA 2QE5A 2WB4A 4ZPAA 3CDEA 2QV6A 3IRXA 2WRMA 3MR2A 4Y2AA 4PWDB 3RB3A 3CJ0A 2JEJA 5J2QB 3RAQA 2ALZA 1R0AA 5KFSA 3ISNC 4TYAA 4O44A 3KLIA 4KHMA 4YR0A 1RTJA 2AX0A 4NLDA 4KAIA 5C25A 3DOKB 4TYBA 2IJFA 3SI8A 2BE2B 2GIRA 4KV8A 2YNHA 2OH2A 2GIQA 4J9LA 5KFDA 3MFIA 1RT7A 1NHVA 2WCXA 3C6UA 4QW8A 3DLGA 5KFOA 2IAJA 1HQEA 2FLPA 3KK3B 2JEGA 5C24B 3DLKB 5F8NA 4IG0B 2R2UA 3BREA 2BR0A 2WONA 1LWCA 2HMIA 5T14A 1JLAA 2EC0A 1LWEA 1DTQB 4KFBA 2HAIA 3LP0A 3PZPA 1RT1A 4NRUA 1IKXB 2W8KA 4TQSA 2ASDA 5HLFA 2ILZA 3N6NA 4ED0A 1MU2A 2UUTA 5CYMB 3OLAA 1VRTB 2I5JB 2RF2A 3KLHA 3QGGA 4IFVA 4QPXA 1JLGB 3H4BA 2IBKA 4TQRA 3RB4A 2IJNA 1QAJA 2B5JA 1LW2A 3MF5A 4YMEA 2B6AA 4NLUA 4K4WA 5DLFA 4MKBA 1JLQB 1IKWB 1RDRA 1Z4UA 3IG1A 5J2NA 3RBDA 1LWFB 4M95A 3V6DB 3KHLA 4IG3B 4IFYB 4ZPBA 3CO9A 4KO0A 5EDWA 3KLFA 3M8QB 1N6QB 1FKOA 5KFVA 4XO0A 2WHOA 3DRRB 4MK9A 1DLOB 1HYSB 3OL6A 2VA3A 2R8GA 2HNYA 1TL3A 3BJYA 4Q8FA 4NCGB 2OPQA 3I0RA 2I1RA 5F8HA 3BQ2A 2UVRA 2D3ZA 4O3RA 5L9XA 2VG6B 4ZP6A 5KFUA 5L1JA 1REVA 4RW4B 3QGHA 3QZ7A 3FRZA 4RU9A 3LP2A 3V81A 3CJ2A 2C2DA 1RYRA 3TAMB 2IMWP 3I5AA 3MEGB 1HMVA 1SUQA 1RT3B 1RTIB 3LAMA 5HROB 4Q45A 4KBIA 1RT2B 1QE1A 1S1TB 1TVRA 2CKWA 4WFXA 1S1VB 3V6JA 1T05B 1HQUB 4MFBB 3BR9A 1HPZB 2IM3A 3PJWA 4NLTA 3NAIA 5C5JA 3ITHB 4QWDA 2IC3A 1GX5A 1IKVB 1EP4B 1HNIA 3PW7A 4IH7A 4DEZA 2YNIA 1BQNB 1RT4B 4LSLB 1TP7A 3E01A 3SFGA 4ZMMA 2ZD1B 4QW9A 2RDJA 3KLGA 3H5UA 1JLFB 4H54A 1J5OA 4JUZA 2XC9A 3IS9A 4DL4A 3V4IA 5KFJA 3OLBA 1DTTA 3KMSA 4PQUA 4NLSA 3G86A 2XI3A 5C42B
chains in the Genus database with same CATH superfamily
2ZJRQ 2J7KA 3BGOP 3I87A 4AFFA 1S6OA 4KQZA 2W2OP 4NYZA 3OR1A 4DDFA 3C14A 1XIQA 4O44B 1SV5A 3I6PA 1ZETA 3AD9C 1RHQB 1DBDA 2YNHB 2XGPA 3DRPA 5L9NA 3ILLA 4R8UA 3T5KA 1FKAF 1LWCB 2OIHA 1TQLA 1TFWA 3N9UC 3AY0A 3HULA 1T03B 3LP1A 2V2KA 3NGKA 5I4MA 5GAHU 2GV1A 1TKXA 4P9SA 4C3KA 1AZSB 3EPIA 4DPTA 3U1MA 4Q5VA 1P27B 1VQPS 2GA7A 1GXLA 3MMAB 1PJ6A 1NH8A 2W2PP 1KLMA 3PKYA 3RB6A 2VONA 4YB6A 2MDAA 2EFQA 4WBFA 1FVSA 2XLJA 4NLYA 3QIDA 5DO2A 5EWFA 2AV5A 3HJFA 3OXFA 2XZDB 1U49A 1NXIA 4ZPWR 1J5OB 2KRRA 3OJSA 4QWBA 5EGYA 4CLYA 1HL6A 3TARA 1CS4A 2MZSA 4EUVA 2BKNA 4OYWA 2JSXA 2QC3A 1BQMA 3FSYA 5K8OA 2HG4A 3K5PA 1RAOA 3L7OA 3T19A 3OR1B 3CULA 1KWMA 3C14B 1FD8A 2GO9A 2HGNA 4ZITA 1N5VA 2GVDA 1SV5B 1UJ6A 1W25A 4AL6A 2Y1IA 3DRPB 2LKZA 2KT5A 3P49B 2GAGC 5CCLA 4R8UB 3L3CA 1JJCB 1VQ9S 2KU7A 1YK9A 1WOSA 2ILYA 3HHEA 4LFBJ 4K0KJ 2VFTA 4F2RA 2V8DA 2RQ4A 3OFFA 1VC0A 3GIRA 3G82A 2HSEB 1TKXB 1SJ3P 3NBPA 3QGIA 1RCXB 3K0JA 2CWXA 3O6QA 3SFUA 2CNKB 3FCWA 1KLMB 4P6QA 2YWEA 3CCRS 3AD8C 1T3NA 4F26A 3DC2A 3SQGA 2LXFA 3W3SA 1CC7A 3AJDA 2AYMA 4FF4A 1RLDA 2X1BA 3RRKA 1KVJA 3JS9A 4DQIA 3IR6B 3NGSA 4EBEA 3JSMA 1CS4B 4U8YA 4CCHA 4F4AA 3MWBA 1FNMA 1BQMB 3GONA 5IQ6A 1OYEA 3UR0A 4QJVA 5JXSA 3VV2B 2VU5A 2GVDB 2MYFA 2HIYA 1VRTA 4MYTA 1F2HA 2HFVA 4XPEA 4ZCMA 4IG3A 4EBCA 5KFKA 1N6QA 1MMDA 4C4WA 4C2MA 1QD1A 4TU9A 2FHKA 4P72A 2OEKA 5KT3A 1F0XA 4BCAA 4ZCIA 2JC0A 3GYNA 3UPFA 4LF9F 3G6XA 1HQUA 3G82B 2L9WA 3Q8PB 3NBPB 3OHAA 4QWAA 2M88A 4Q2MA 4L72B 3BO3A 3PX6A 4NLXA 4LSNA 4X84A 1RACB 2BANA 4N77A 1Q81T 4WTOB 3SQGB 5HQLA 5LMUJ 2W7PA 4ELUA 3CDEA 3RRHA 2ZUAA 3SV4A 4F04B 3TVZA 3K5OA 2V68A 2C3YA 1YGYA 4I6WA 1N8RT 5C25A 1WDTA 1Q8LA 2OH2A 2M3DA 5DM7Q 5FD1A 7AT1B 2CIMA 2E1AA 4ED0A 3C15A 4QIVA 1VRTB 3U27A 4RR5A 4LVOP 2ACMA 1K47A 2LQBA 3BO4A 2F3JA 1HHTP 4M95A 4IG3B 2C42A 1FD2A 1N6QB 1LKZA 1CEZA 1YRXA 4ES2A 2XMVA 4NCGB 2I1RA 5FLXY 4K5RA 1U47A 2XHWA 4RU9A 3V81A 3BKFA 3LAMA 3JSBA 3PTWA 2CPIA 5F0UA 1HQUB 3EZ5A 2QYCA 3BKTA 4QWDA 2ZFHA 3CJKA 4ZA1A 3EVWA 2YNIA 3KG0A 3CCZA 1SC4B 2ZJQQ 3GJTB 1MG7A 3NGUA 4GKJF 4LSNB 2BANB 2W9BA 2AJFE 1CC8A 4PXDA 5A2QY 3BSCA 1N0UA 1HNZF 5A6WA 1EZZB 5ITHA 2MKCA 2FPHX 4DR4F 4I1TA 1RAAB 5JVHQ 3H5YA 2GQCA 1Q8BA 1TAUA 1SB6A 1SH0A 3NP5A 5C25B 2V2ZA 3NOCA 4ID8A 4V19X 5F8MA 1WEYA 2MZRA 1C4CA 3BO2A 2VHGA 4ECYA 5LJ5Y 3GTYX 2NSCA 3GWCA 2A1BA 3C15B 2DNPA 5ETLA 1NDLA 4LR7A 4IRCA 2R2RA 1FX2A 4WU2A 5ETKA 4ITSA 5KG2A 3T5HA 4UOCA 3J81U 3HHKA 4K4ZA 3T1HF 5KFTA 2YX4A 4OX9F 3QGPA 3MAHA 3EYZA 3V81B 2Q43A 1SKWA 1ZPVA 2VBXA 3CJKB 4XPCA 5E5NA 2YNIB 5GADU 4QU6A 2CQBA 1FFWB 5B7WA 2HHWA 2NXCA 1RTHA 2W9BB 1EX8A 2A3JA 4UF4A 3PCOB 3DLBA 3FEXB 2ZH1A 3IBCB 3NS5A 3KNAA 1VBKA 2W25A 1FJCA 1LXNA 2OELA 5K5MA 4ECWA 6AT1B 4IH5A 1J5EF 1TMMA 3N0VA 3QT5A 3TAQA 4DV5F 4B08A 2OEJA 2ZEJA 4DS5A 1IQTA 5BR8F 2B7CB 2JEFA 4DUTA 2RILA 2FVCA 3W62A 3X3UA 3TQEA 1UL3A 2RH3A 2IFXA 2IVFB 4KJIA 1XR5A 3P3DA 1NEEA 2DGQA 2YKMA 2HHPA 4RW9A 2LP4A 5ADZA 3UCUP 4ECSA 5GVQA 5AJ3J 2DCUB 2UVUA 2EG2A 2N3LA 4JI6F 1U8SA 1XQIA 2ZH6A 3I5CA 2E1RA 1Q0NA 1RTHB 1RHUB 1N4LA 5C24A 3QYYA 3HVRA 5C2CA 2MSTA 2DNKA 3TZXA 3M30A 3OBIA 1JXLA 5KFQA 1OPIA 2JLFA 1OY8A 2OPSB 3Q22A 3EZUA 4NYOA 4CLWA 2HZVA 1BWVA 3FEYB 4A8XA 2K1RA 4ICLB 5D4NA 1S97A 1U6ZA 1HYSA 3CB4A 4I4BA 2ZH9A 2CXEA 4EYIB 6FD1A 4Z2XA 1NH7A 3KG1A 3MR3A 1VGYA 3H90A 3DMJB 3TJ8A 3M8WA 4ZP9A 2PN6A 1QSYA 1AFIA 4B9TA 1WHWA 1U45A 1JLFA 2CJQA 4DV2F 2ZM6F 4OL8A 1HR0J 3Q8SB 1BLUA 2HYIB 2FHJA 3ILJA 1XEZA 2A0FB 2W9CA 2YKMB 5BYRA 2DIUA 4RW9B 1UVMA 2DRAA 4TY8A 4ECVA 5H1SV 4DL0C 4USVA 3RB3A 3QSYB 2J0XA 3ISNC 5HI7A 2BJ9A 1FEEA 1SQEA 2ZVIA 4NPOA 4LFAF 3SI8A 2BJ8A 1NHVA 4PG4A 2BACA 2MQNA 1XWLA 3KK3B 3AXKA 5C24B 2KFYA 3AAWB 2RRAA 1AUSL 2HAIA 1RAIB 1S76D 4C97A 1AFJA 3M30B 4NRUA 2W8KA 4KGVB 1UTAA 4YDXA 2AP6A 2VC0A 4FKYA 1WF0A 3H4BA 2EKNA 4AXJA 5HN0A 2K1RB 4P7VA 1HYSB 4C8LA 2JZ5A 3BBCA 5KFUA 5HJYA 2R7RA 3QZ7A 5D8HB 4FP9A 5LT5A 4DV4J 5CCMA 2MGZA 2GGPA 3LTOA 3O44A 2YWHA 2WVDA 2WB1D 1JLFB 4CLZA 2BJDA 1SKSA 2R7TA 2NXNA 4NLSA 1HIYA 2W9CB 4TY8B 3W61A 2O5DA 2H9ZA 2BQ3A 3F73A 4S0MA 4OI0A 3O2IA 1OQ6A 3VAHA 3ZO7A 2VH7A 4WZMA 4Q0BB 3MFHA 4DPWA 3MZIA 3VGTA 1Q4RA 5F8IA 2XHCA 3QAEA 3MR6A 2UZAA 1XNQF 3T6BA 1L3VA 4ZS6A 3MR7A 4HT7A 4O3NA 1IBMJ 4RNOA 1KFDA 3CJ4A 2MPUA 2V9WA 3ZZUA 2M2BA 2VPYB 4NL5A 2CADA 2ZOGA 4CH1A 4F2SA 4K50A 3H25A 3M6UA 1J27A 3EGVA 4ILLA 4DCJB 2ZBIA 4Y2IA 4PEOA 3GFYA 4RLEA 2ROPA 2MGZB 2GGPB 4ED2A 2DHSA 4U95A 2FVRA 1KQGB 5KFGA 1FVQA 4LMZA 2AZ1A 4KE5A 4J7CA 4ZPDA 2EWHA 4BS2A 1WELA 4RNHA 1HI1A 3HKZD 1S99A 4LF6J 5EX3A 3TR5A 2GQ2A 2LA4A 3AA8A 1FO1A 1ULRA 1KEKA 3HFZB 3IR7B 4Y6IA 2J76E 2ZE2A 3O8WA 4DR7F 3LOUA 2XMWA 3CCMS 9ATCB 2OGUA 2Q6BA 1Y10A 5A8WA 4WFZA 2L9DA 4FYYB 2FTRA 1T9UA 3S7RA 1WJ9A 4A47A 4F4ZA 1KKHA 1KTVA 3MD1A 4RO0A 4FXWA 1LK7A 1O5JA 1RAHB 5ETVA 1FDNA 1A0OB 3MURP 1JKHA 4DR5F 2DEJA 4ELVA 1WNEA 2PIIA 4CLUA 2KT3A 1HHQA 4OYOA 3BKUA 3HDSA 1AYEA 2RQMA 2YKNA 2RS2A 4QIFA 3AB4B 3CCSS 2IY5B 3TUPA 1H98A 3PEHA 5DS7A 1X4CA 2N7CA 4MKYA 4DJBA 1S5ZA 4ED1A 3CT9A 4CM0A 1S59A 1NHUA 4DPYA 4ZJOA 4KTQA 4X65F 2CDRB 2ZE2B 1N36J 3EVOA 4KY3A 3IXQA 3KOAA 3RTVA 2HKEA 5A8WB 3LGMA 4CO4A 2BABA 1M5VC 1RWXB 1RISA 3QT6A 1M1HA 4OHXA 4OYBA 4CM2A 2XQCA 4YUDA 4HDGA 3R5JB 5ETSA 3MM7A 3M1VA 4J9QA 1GMWA 1LWXA 2YWWA 2HIQA 3DDIA 5HAOA 3UE2A 2OO4A 3GJRB 5A8KA 1Y5LB 2PT0A 2QLFB 1RT2A 3HO1A 5KG6A 1JKHB 5AE2A 2XY6A 3D1HA 1Q5VA 3M8ZA 3S01A 3MUTP 4BDPA 5A0YA 3SCJE 4ED4A 5CAAA 2RRNA 2EFOA 3AXMA 2IA6A 2G2YA 2AZ3A 2YKNB 2RD5C 5ETNA 5EN1A 4MKAA 4PPZA 1P1TA 2QIFA 2U2FA 4DQPA 1G4CA 3CMAS 4NLDA 2B8PA 3M4XA 1B0TA 1AROP 1WOOA 3PYDA 4C0HA 4Y28C 4ZVQB 5H9EJ 1X4EA 4OQJA 1RBOB 2CPEA 3H8YA 5CZVA 1EKRA 3F0NA 4CDIA 2IBKA 2ZDOA 4DR1F 2ZWPA 1U02A 2HEKA 1TL4A 1O6XA 3MM7B 2AEMA 4KO0A 1L3KA 3M1VB 2Q3PA 1UJ4A 2DH7A 1CJKA 4DV3F 2WAQD 5A8KB 3GYXB 1ZPWX 1RT2B 2HFOA 4PXCA 3EE3A 2G1DA 3QBCA 3FCVA 4CH0S 2QA4S 1VBZA 5A0YB 3E01A 4QW9A 2RDJA 1MN7A 1NZ8A 1HHSA 3FJ2A 2OI2A 2CUYA 4J9NA 2KT2A 2HQ3A 4LT6A 2BE9B 3HPOA 2J6TA 2QEXS 4U96A 1FNOA 3S1TA 2F4VF 2AJ4A 1PYSB 3UD3P 4ZKAA 3MUVP 4N41A 4W92B 1F60B 1MWQA 3WIVA 3QAUA 1KBRA 1NSAA 1N5SA 2ATCB 4PPDA 5KT2A 4KKOA 1R3NA 4EYHB 4NYPA 4XAKA 4M5KA 4XDCA 2A2DA 3NWRA 2NPFA 2ATLA 3UI3A 1UKUA 4KO0B 1HBOA 1S72S 1CJKB 4CO3A 3Q8QB 1R8AA 1QAIA 3W66A 1G7CB 2CJAA 4WFAQ 3DXBA 5LJ3Y 3NWGA 1NK5A 1K44A 4P75A 1IKYA 1NKBA 4A8SA 3CD5A 3DRSB 3GIIA 2DGUA 2MJUA 4GKKJ 4HH1A 5HMXA 2LMIA 3E01B 3FDSA 1JWWA 1NK9A 3JQMA 5JMNA 1BXNA 2XO6A 2IVMA 3R6GB 2BVZA 2HURA 3FQLA 4BWJA 2BBEA 3MM6A 5KFNA 4J9SA 4OLOA 2YY3A 3VHQA 1SVDA 1S48A 3UNGC 2QFJA 4F02A 4DSIA 1ZBTA 2M52A 4B02A 2FVPA 1IBCB 1RADB 5DQHA 1Y11A 3MM9A 2J9CA 4GKJJ 1I5OB 4QIGA 3SMZA 2NXUA 2X1FA 4RPFA 4KKOB 3GSIA 3D5MA 2G9OA 4Y65A 1HNZJ 4F4WA 3P5TL 3T1YF 1Y5NB 3ENQA 2E9TA 2NLWA 2FLNA 4O0IA 1FNXH 4Q44A 2PE8A 2Z57B 1HBOB 4F4XA 2W7OA 3Q8RB 3KJFB 5LM7E 3Q8VA 3NAHA 3MEEA 4EWTA 2YX1A 1IKYB 2XYPB 3UN3A 4CH7A 1Y0HA 3FQKA 2DO0A 2NUHA 5HQMA 4QIWD 4OHVA 1S0VA 1NU4A 4AQYF 3WX8A 4OX9J 3I31A 2EG1A 2LQ8A 3H20A 4ED6A 3MM6B 1QSSA 2E1PA 4DL3A 4KH0B 2CNNB 4PRFA 1SKUB 3RGIA 1DQ8A 4HVZA 2E7WA 3GPAA 2I5JA 4F0KA 1QVFR 1PKUA 4DV7F 3KUEA 4NZ7A 3MM9B 3V6DA 2KZMA 3A3PB 6FDRA 3UWTA 3M8QA 1S4EA 2XCPA 1DAXA 1XERA 2J0WA 2J6SA 3UDEA 1GMUA 4TKTA 1RTIA 1WF1A 4XTTA 4K4SA 5KT6A 2DPIA 3CMQA 2XS2A 3HP6A 4EEYA 3UDLA 2QLXA 1BD6A 4P2XA 4Z7YA 4CYUA 4MTPA 3MEEB 2HVZA 3HM9A 4CO5A 4DV5J 4OX7A 2ZH3A 1N5YA 1B99A 2PI5A 3Q86A 3MECA 2WB4A 2CQHA 4BWMA 4USUA 1EHWA 3QJJA 4KHMA 1PYTA 2VOPA 3W8PA 4FYXB 3MFIA 4J5OA 3BH7B 3BGLA 1M5SA 2IAJA 1M1GA 2JEGA 2YWKA 1FX4A 2WONA 1FFSB 1YBUA 2MKSA 2ASDA 3OLAA 3NNAA 2I5JB 1YKWA 1W2IA 1A6LA 4QYRA 2ZOFA 3CF5Q 2VPWB 4YMEA 4ZIWA 2D9PA 2AHOB 3QWUA 2EKYA 3IG1A 3V6DB 8RUCA 3M8QB 1Y5IB 2R42A 1KQSR 1OO0B 3M8RA 3QATA 4CO1A 2FZKB 3I5AA 1RTIB 1RI7A 4JI8J 2VZ9A 2M0GB 3BR9A 1HNXF 2IC3A 2DGXA 2MJNA 5E3CA 4ZCKA 4L6V3 2EK6A 2XZWA 1HFEL 3PHEA 4CYUB 1YJ7A 4CO2A 2HNZA 2VF3A 4HTJA 2A6OA 3QIPA 1SIZA 1RA7A 1N5YB 5D3GA 3KJNB 3UFCX 1F5BA 3MECB 1RWUA 4RBUA 1PO6A 3FMWA 2HBYB 3K7RA 4DL6A 4WWSA 3LO3A 1NAQA 3OSNA 5JUMA 3L95X 2IAJB 4LF4F 3PYGA 1RU2A 5KG0A 3BQ1A 3R7NB 1D1UA 3JQKA 3MCSA 2GC8A 1B3TA 4USKA 5DDOC 1TFYA 2RVJA 2VKRA 3IG1B 3A8JA 4LFAJ 4P10A 3TJ9A 2ZBPA 1VIXA 5HSPA 4YHHF 1H2VZ 3NS6A 1TK5A 5IT9U 2ZBRA 2YX7A 1Z1ZA 1JIHA 4QR2A 2UXBF 2BX6A 4J9MA 3N28A 2H4WB 1DURA 3QZ8A 4OI4A 2IC3B 3SCIE 4F25A 2HBQB 4CLKA 4DHVA 2M9KA 4C7QA 2CPDA 1R8PA 3QIPB 4X64J 1QSLA 1K0TA 1VQMS 3Q24A 1NCLA 5D3GB 1N52B 3CCVS 4CT8A 2YQ1A 1WHVA 3MMCA 1UEVA 4HYKA 4FVCA 4I7FB 2XTJP 2B43A 4X62F 2FIUA 2IRUA 2YKQA 2NXJA 5KFZA 2C1EB 4B17A 5KFXA 3AD7C 3CJ3A 1S57A 1FK9A 3CDUA 5H9FK 1WEZA 5T7LB 2G2ZA 1P1LA 1SC6A 2QZ8A 3SEOA 2OMOA 1M1KT 1S1XA 4ED5A 4M1KA 3QMQA 3MOZA 3HVAA 5BYSA 2APOA 4DBQA 3IWNC 1XNQJ 2EEYA 3OJUA 3KLEA 3HXMA 3CVKA 4CT9A 4W90B 3L4BC 3G8QA 3G8TA 2VASA 3P96A 2NYHA 3GJQB 2KYZA 1AW0A 4YB5A 2JEIA 1FRXA 2MHNA 3GIKA 4I67A 3NNHA 2JWNA 2CFXA 3FGVA 4LF1A 4IG0A 4H4KC 1LQ9A 1YRUA 5IXUA 3I82A 2RDIA 1RHMB 3J80U 1J2VA 2B7BB 3Q83A 2GZOA 4IYQA 4Y3CA 2Z2LA 1IKWA 4PG7A 4P2SA 4JOUA 2R2TA 1Q7LB 4DR7J 1FK9B 2DHGA 2E9ZA 4JYAF 1NUEA 2W9AA 3A13A 4JV2A 2OAUA 3OT9A 1XR7A 3U1NA 3OW2R 4MFBA 2C3MA 4RUCA 1R8CA 5M2RA 4OHZA 4LSLA 4O23A 3GQCA 1S1XB 5AE3A 2WTFA 4LFBF 3TO8A 4N5SA 4K0KF 7FD1A 2CPJA 1BHNA 4X4PA 2YNGA 3KLEB 2MTLA 3DRYA 3E2EA 1PBUA 4DR5J 3ELHA 3KLIA 1NHKL 2XNRA 1NK7A 4UUWA 1EIYB 5HK4A 1F9HA 2Y0BB 5GMDA 2Z2YB 3C6UA 4WP3A 3J7YU 4KPCA 4IG0B 3FZ2A 4N76A 4FZVA 5B08A 1FWPA 4J91A 4Y00A 1MU2A 3KLHA 2BOAA 4LREA 3DGVA 4M5NA 2B5JA 2B6AA 4K4WA 1IKWB 2KH9A 2KZZA 1WACA 4X65J 2FLOA 4ZPBA 1VQ8S 1VQKS 4JI7J 4XO0A 5M2UA 4MK9A 3R5DA 2VFRA 2R8GA 3CTRA 4U7UK 2NZCA 2I38A 3VAJA 2PMZD 2B51A 1SUQA 4B3MF 1F5AA 3HT0A 4MFBB 3HSDA 2XNQA 1VLOA 3G4SS 1HWLA 4LSLB 5G0RA 4H54A 5LSRA 2UUBF 3ZXWA 1KFSA 5I3QA 2FC9A 3DLHA 1OWXA 3PW4A 2YNGB 4MIBA 1O8BA 3IN5A 1RAJA 5K8MA 4E0DA 2ACYA 1MW7A 3KLIB 2CJBA 2LEBA 1HWIA 3BSAA 1N88A 1LOUA 3C6UB 1C4AA 2EFVA 3B82A 4FYVB 2ZH4A 2K06A 5LMUF 1GFWB 3WC0A 4B3TJ 5C7PA 2I9SA 1MU2B 4ZDNA 3KLHB 3IGNA 1R27B 3PX0A 1XN9A 2HK3A 2MHEA 2B5JB 4PUOA 2B6AB 3N6LA 1SJ1A 4LF7J 5DG7A 1U2CA 4F67A 4CLPA 2XMKA 4LR8A 4ZVHA 1EARA 1SUQB 4BC7A 3DGPA 5B0BA 4OZ0A 1Q7YT 5HBMA 4DR1J 2RUSA 4ZVGA 3C19A 1NK6A 5KG7A 5G0RB 2QA4G 3BSOA 4IKAA 2QFIA 4U9RA 3FEZA 4DV3J 4L73A 2R8JA 4O0NA 2L08A 3BDPA 2A6MA 3VR1A 5D0HA 1ZS6A 4HT5A 4GC7A 3OVBA 1RCOB 3OPKA 3A8EA 1UCNA 4NWBA 4QU7A 2DR8A 2VUGA 3M2UA 4JI1F 5KFCA 2KHCA 1GAOA 4P52A 1NK0A 5IT9Y 3H98A 3HHNB 3QRPA 1EAYC 1VHFA 4WIIA 4JI2F 3MMJA 2F4VJ 2HHQA 5L1IA 2C3OA 3FSXA 4X4OA 5K8PA 3LGHA 2DR9A 2KB2A 2ZZNA 2XGQA 2ZBCA 4IRDA 2EW9A 4I2PA 2OHDA 4HEA9 5DETA 2CQ3A 4CTAA 3OVAA 3DGPB 1NPKA 2E5LF 4U8VA 2A18A 5HBMB 1XMQJ 5LXYA 4PKDB 4DF4A 1NDPA 2BOPA 1RKJA 1HBMA 3ILOA 4DR3F 1YIJS 2AF6A 1N5TA 4PG5A 4DV6J 1WKKA 3DOKA 3CCES 3PM9A 2GMHA 3HKWA 1FXRA 2KTQA 4UZCA 4DV0J 2E9RX 1UW9A 2LXIA 3J81j 1U48A 4F50A 5G4DA 3M2UB 4D3GA 3W9IA 1KDNA 2H51B 2GHPA 3K17A 1YJWS 1W26A 3T1AA 4L75A 3IM8A 1H73A 1WF2A 3MCOA 2IMOA 4K4UA 1AA1B 3SCLE 2J6UA 4LF5F 3ZZTA 3TAMA 1S79A 3G87A 2D3O1 2D3OR 1JQGA 2V4QA 2Z4PA 3R1HA 2DR7A 3FSIA 4I2PB 1FRHA 1X0FA 2I2YA 1CSJA 4CTAB 4O3OA 3QNWB 4W4MA 1ZAVA 5F9LA 3KDNA 3LA0A 1UFKA 2XLKA 1UWBA 2CNLB 3L7PA 2E29A 2W2QP 5ETPA 2HLTA 1HWJA 3BM7A 4LBPA 5D15A 1HBMB 3V5RA 5GMKa 3D0GE 1R0AA 2G0IA 1F6TA 4YR0A 3DOKB 3IRWP 1S12A 2V69A 4LRAA 4OZ3A 5AJ3F 2IA0A 3MD3A 5AXLA 3LP0A 3PZPA 1RT1A 4WK3A 4GVBA 1VFJA 2M8DB 1WHXA 2YQ0A 3RBZA 4FDFA 4OJ3A 2DITA 1VQ5S 2G0CA 1U0SA 2XG8A 3MEKA 5F8HA 1X9WA 2CG8A 1JJ2R 3CJ2A 3TAMB 2F65A 4AXIA 3BN4A 4DV7J 2FDNA 1DFDA 1QTMA 2LEPA 5IT4A 3LGNA 2BXJA 2VDIA 1UAWA 5GAGI 2HFUA 2J0QD 4C0OC 1UWBB 5IM0A 1DQ9A 1I1GA 2F5GA 5F8GA 3CEDA 2DXEA 4UTGA 4AT1B 4RUHA 1S77D 1OQ3A 3GV8B 1R0AB 3RB0A 9RUBA 1HR0F 2UUCF 4A8OA 2BYCA 3PRDA 1NJXA 2DVIA 2N4DA 1RABB 3KNGA 1RWWB 4GRSA 4ANDA 1YDLA 3HHLD 3LP0B 1RT1B 5KFFA 3I56S 4LR9A 1D8YA 4GVBB 4KC5A 1R6VA 1NSQA 1RUSA 1CG2A 2RDDA 2ZZTA 2I8EA 2E66A 2YKAA 3GIJA 2NZ4A 4HI2A 4FBUA 1MMNA 1T94A 2VOOA 3IBFB 2QL5B 3CDWA 4OYPA 4OX8A 5DG9A 2HHXA 5I42A 2JH3A 4ETXA 2MQQA 2XEXA 4LIWA 1OPZA 4J9KA 1RK8A 3PIPQ 2H1YA 4AE5A 2VQEJ 2UXCJ 3PW2A 4K4YA 3WZ0A 2GMLA 4YR2A 2ZC3A 2ZH7A 3CNQP 5CD4A 2C2MB 5IM0B 3DKDA 5DG8A 3CPWR 1NNDA 2KFZA 3UNYA 2AGQA 5FDLA 4WFNQ 1T9TA 3TUIC 4UOHA 2HQFA 1PC4A 3LALA 3E51A 2DNRA 4BC9A 4Z7CA 4IOBA 4CLSA 4WP8A 3ONQA 1W2BR 3PW5A 1LNQA 1H6KX 2HS3A 4QPTA 4URQU 1WG4A 1VCTA 4M94A 1HNVA 3KHRA 1IXKA 4O4GA 3B6BA 4ZVPB 2FJXA 4NASA 1SXLA 4AL5A 1HQ2A 1KONA 1FJGJ 1GT8A 1BUXA 3G6VA 4DL7A 2DHXA 2ALYB 1QY7A 1A7GE 1X4AA 2P8IA 5I42B 2C2RA 3KJVA 1IBMF 4MT1A 2GS8A 1X4BA 3GLJA 4CNZA 2M4MA 4X4NA 5EWEA 3HSJA 4YHHJ 1K8AT 3QJPA 1IJFB 1NZAA 1OSDA 2YH1A 2RQCA 3MPUB 1YLXA 2V2VA 5GAEU 2WVCA 3GU0A 4WXOA 2UXBJ 5E3AA 3CC2S 1T02A 3NGTA 8ATCB 4C8MA 4J9RA 1T03A 4RBTA 4DSJA 1DTQA 3KG4A 2UV8G 2OTJS 4ES3A 5FDLB 3PVXA 1QTNB 2WVFA 1JLGA 2KDOA 5FJ4A 2CDQA 4F4YA 2PFDA 1UVIA 1GEHA 1U1KA 4P73A 2PEBA 4MH8A 4OI3A 4RW4A 3AA9A 3EM1A 5HROA 1HNVB 1ZAXA 4OV6A 4O4GB 2LQ5A 3OQ2A 2CPHA 3ITHA 3BGUA 5IWAF 1CQMA 3CDBA 1YJ9S 5KG1A 3VCDA 3H4DA 4YOEA 4HI1A 2VBWA 2IIHA 4Q2LA 4OI1A 2MY7A 2FUG9 3KJVB 1UP1A 1NSPA 2LCWA 1ACMB 5HQ8A 3OL7A 2R7WA 3MR2A 3P8BB 2VBZA 2PEHA 2MEWA 4UT4A 1RTJA 3Q8UA 4EI2A 2IJFA 1RQ0A 2GIRA 2Y1RI 3SSSA 1JB0C 1KSPA 2KXFA 2V63A 4EGLA 1M5HA 3BN7A 3DLKB 1B7YB 3BREA 4R0JA 4DFKA 1DTQB 3AQOA 5HLFA 5J1NA 4CLFA 3PHTA 4LVNP 2B8QA 4OZNA 3QGGA 4IFVA 1JLGB 3AFGA 3RB4A 2A10A 2VFUA 2EFPA 3MPVA 5J2NA 1N54B 1N36F 1ELOA 1VLYA 2YWFA 1UZDA 1SL1A 4F0HA 5ETRA 4X4RA 5E0OA 3I0RA 3BQ2A 2P9CA 4KPYA 1REVA 4RW4B 2NXEA 2R7OA 4Q45A 5HROB 2Q6CA 2QRRA 1QE1A 4HL9A 2CJKA 3UR3C 4UUXA 1NJZA 3ITHB 1HBUB 2XC9A 1NB2A 3QRQA 1LEOA 3DNCA 5F3ZA 2F9DA 4JYAJ 2Y8YA 4LRCA 5IFMA 2R8KA 2ZH8A 5LMNF 1FDDA 3UD5A 3P6YC 4QQBA 3EGWB 4FVMA 4M5LA 4IDKA 1RTJB 3C3LA 3O1LA 1X4DA 2VJVA 1TL1A 3ETMA 1SH2A 2CQ4A 2AW0A 1PILA 4B9UA 3AH6A 4YR3A 4GO5X 3EUNA 1OSCA 4C8KA 5HLFB 4ID5A 2DK2A 1YITS 4IFVB 1Q82T 3OTDA 3KJQB 5HP1A 4M5GA 4ZPTR 3H5SA 5CYQA 3MDFA 5J2NB 4R25A 4A8YA 4PG8A 1KD1T 4DG1A 3C66A 2NR0A 2DKOB 3I0RB 1CLFA 3KWMA 1REVB 4WU3A 3BGFA 2OFGX 2H54B 2BE7D 3MI7X 1QE1B 2QO3A 2L48A 3RAXA 3TX8A 1TUGB 4URGA 1F2GA 3IWXA 1S7HA 4ZVRB 4DSLA 1FCAA 2PC6A 1SBRA 3T9ZA 4NCAA 4OZ2A 1TUVA 4B3MJ 3KK1B 5KFBA 1NJWA 3PYEA 2HW3A 3M6WA 4I2QA 4IDKB 2OSRA 2PDAA 1VBYA 5A8RA 4NCGA 1QM9A 2UUBJ 4ZPCA 4FNHA 1I6JA 3EMTA 2WOMA 1SQFA 3W60A 4RW6A 1TL1B 3MTKA 2DGSA 4FBTA 1X0PA 4RUBA 2DXDA 4ID5B 2QL9B 2FYXA 2J7UA 5HP1B 1RTDA 3ZZYA 3JTPA 5CYQB 2X7IA 3IM9A 1XR6A 1FF2A 4C8NA 3KTQA 3M9OB 4DG1B 5IT0A 2IBOA 4DPOA 5L46A 5KFMA 2V8VA 2RUGA 2KVIA 2DEIA 3PKMA 3ET6B 3ZZRA 4UZBA 1Y3JA 3GILA 1MWZA 3R5BA 3AJ2A 4EZ6A 5D6GA 4DR2F 1IWAA 5LSOA 1VC5A 1U6BA 4OHWA 2AJ0A 1OY6A 3FKBA 4ECXA 2ASYA 1JNZB 1Q86T 4GC6A 3VAGA 4GKKF 2V34A 3HFKA 2DCLA 2FHJD 2J9DE 2UUWA 1IKXA 2D69A 4I2QB 2VFVA 4Z37A 5IOLA 2IJRA 1UA1A 1JX4A 2HRYA 1A9NB 5A8RB 3D6TB 4KHPF 2FQQB 2AJQA 2WOMB 4C8YA 5KFLA 4RW6B 1NPRA 3LQVA 3W63A 4C8OA 1DLOA 2DNOA 2OPRB 2V94A 5LL6d 2V4JA 2GX8A 2VB6A 2DNMA 4KGMA 4YY3J 1RTDB 3VTIA 1RA6A 4JI1J 1U0HA 2SXLA 4LF8J 2HHTA 1RBAA 2DHAA 1YX2A 3RBXA 1LK5A 3FZBA 3THTA 4JI2J 2K2PA 5L39A 2RKIA 4NEYA 1R8BA 5MAOA 2BEFA 2WRMA 2MKJA 3DLLQ 3CCUS 1BGXT 1L3TA 4LBHA 2QN6B 1KLNA 3D1QA 1KVKA 1V6HA 3TWZA 1H2TZ 1P9QC 3QQCD 4WKYA 3BBBA 3LH2S 5B0AA 2FLPA 3IR5B 2XY7A 3BDEA 2E5LJ 4JI5J 1VQSA 1RAGB 1IKXB 2KXNB 2CZVC 2JLGA 4L3NA 2G4BA 1VYAA 4DR3J 1YJTA 4QPXA 4JB8B 4TQRA 3OXGA 2IJNA 3PFEA 2UXDJ 4ATNA 4NXMF 3D2WA 3KHLA 1TR0A 3HI9A 1DLOB 3OL6A 2XS5A 1TL3A 2V4JB 2OPQA 2D3ZA 2OFHX 5L9XA 2KG0A 5L1JA 1YG0A 3Q8YA 1PYOB 3LP2A 5HL7Q 3RRGA 1U0HB 2W2MP 1VQLS 2CRLA 1VISA 2E5JA 2IM3A 3HJVA 3OXLA 2YWGA 3MAAA 1HNIA 1MROA 4IO1A 2WSCC 4PAAA 3QFHA 5CYJA 3RJMB 4C98A 3OFEA 4DL4A 1HI0P 2XI3A 3W2WA 2R7UA 2RKIB 1P9YA 4LF5J 1Q8IA 3I0SA 2C2ZB 3GG0A 1JLEA 3ZTRA 5C2GA 1V3SA 2OPSA 4TLRA 2DNYA 4G6VB 4ICLA 1H74A 4F8RA 4K59A 4OHYA 1JMTA 4CWBA 1T8EA 4OZLA 1FKPA 3DMJA 2QSFA 5AT1B 3JXOA 1TKZA 1WHYA 2O3DA 5KG5A 3OD2A 1HA1A 4LRDA 2QTWA 4KB7A 4LUBA 4JV0A 1F9FA 3CIZA 4NI2A 1TL3B 4L3KA 2OPQB 4ILMA 1S0NA 2FJVA 4ZCLA 3ISZA 4LRFA 3DOMA 3LP2B 2JJ4D 1C1BA 3ZTSA 3MAAB 1HNIB 1MROB 4GMKA 3KK3A 3QSIA 2H4YB 1MSWD 2MB0B 1X5PA 4G1PA 3W2WB 5A6PA 3OL8A 2DT9A 4Q8EA 1RT5A 3I0SB 4JI8F 2HVHA 1JLEB 1SPBP 2BQUA 2XWXA 3QLHB 4X2BA 3WX4A 2LDYA 4E98A 3VALA 2H48B 3D1OA 5L38A 3CO0P 4G1IA 3MPWA 2IPOB 3MCMA 2VA2A 3MM5A 4IQXA 3M8SA 1Q1KA 2WZ1A 2M8HA 2XYGB 2NSBA 3HHDA 4BBYA 4LBIA 2XMJA 1FKPB 2J8SA 3KUGA 4QCLA 1TKZB 3D7SB 1Y3KA 4B3RJ 1EJ7L 2AU0A 3R5AA 2HK2A 2R7SA 2UUCJ 4ETZA 3LANA 1T9VA 4LQ3A 4NCBA 2AEFA 5D4LA 3BV8A 1N48A 1DJ0A 2MKYA 4ZHRA 5IC4B 3NEKA 4DPXA 4NI2B 2WVBA 3M7VA 2FB0A 1K1SA 1PC5A 2PO4A 3FCHA 2PI4A 3DOMB 4QWCA 4K5SA 1GMWD 3A4TA 3VWSA 3NMAA 1C1BB 1RU1A 4H4MA 4Q0BA 4JI0F 2P6TA 4M5IA 4ZVFA 1IM6A 2Q66A 1RT5B 3D66A 4DF8A 3ZNJ1 4DX5A 2HWHA 3PG9A 4RL1A 2CVEA 1QUVA 1UVJA 3JSRA 1DHMA 3D54A 3GFHA 1APSA 3BPSP 4YP3A 3MM5B 4URSA 1VJQA 4P74A 4X64F 4ED8A 1GK8A 2CPZA 4O3PA 3O5TB 3LAKA 4K4VA 2B56A 3F56A 4ZHRB 3SQOP 2LFVA 3BZQA 1RWMB 2ZD1A 1ZAWA 2HHVA 2GMJA 3OTCA 5CQGA 3FNNA 5C42A 5B0DA 1Q95G 2B4VA 1C0TA 3ADAC 3BQ0A 4H4MB 1S6QA 2JOQA 4BLGA 1YWXA 4B3SJ 1RE1B 4QOTA 5F0WA 1HI8A 2KRBA 4UQTA 1SC3B 4OZJA 5F8NA 2HMIA 5D4PA 2GW8A 2RB7A 1IBKF 4TQSA 4YB1P 4I68A 3N6NA 2R7VA 2ROEA 4MJKA 1RB0A 4QR0A 1T0TV 5DJBA 3F41A 2UP1A 1U2RA 2A2CA 4RKUC 5D0EA 1LWFB 3R1LA 4MAKA 3SIPB 2MQLA 5KFVA 2HNYA 4ZP6A 2V8GA 2HHHF 3S8SA 1X4HA 1FHTA 4DUYJ 5F3TA 3PJWA 3RU0A 1GX5A 4WIQA 2M5YA 4DEZA 1KQKA 4C48A 3Q2TC 2ZD1B 1N33F 4DSKA 4V1Ak 2HS0A 1FESA 2BJEA 4PQUA 4FF1A 4ED7A 5C42B 4Y2KA 2R2SA 2C28A 4UOFA 2F7VA 1C0TB 3N01A 2BW7A 2BDPA 1S6QB 5KOWA 1VDHA 5HJXA 4DX7A 2FGCA 4RZRA 5IWAJ 3J81Y 2D9OA 3PY8A 4U7CA 4EO8A 4YFUA 4NLVA 3UDCA 1Z2ZA 3DXSX 2HMIB 1EETA 1RWKB 4WFBQ 5L8RC 4HLBA 2KVQE 4JI4J 4IH6A 1ROFA 1WC3A 1V9OA 2HNYB 5CHCB 3ZZZA 2D7SA 4N56A 5JVGQ 1NJIT 1DQAA 2MMYA 4DCPB 3IC1A 2K7JA 4NMLA 3EGNA 2NYIA 5DDQC 4QWEA 4YS2A 4JI7F 3K2YA 1UW4A 3ZTPA 2VV5A 3NXZA 2RHSB 3ILIA 1CBKA 4PQUB 2HRUA 3RR8A 3TRGA 4HHJA 2MZ1A 3GV5B 1NBEB 3EPGA 4QZVB 4PQAA 2AYGA 1NJYA 3DYAA 2DPJA 3PYFA 2RRBA 3T3FA 2KKHA 3EWGA 4CLTA 5J1EA 2ZITA 2IRYA 4FNIA 1OS5A 2DGTA 3IFEA 4ZN1A 3HSGA 1OMSA 5KFIA 1X5TA 3TQ1A 2HQGA 2OJ3A 3PACA 5LMNJ 1EETB 1NRKA 2DRBA 3D6HB 2HPUA 3TA1A 4ECRA 4KIAA 2HS4A 3T5LA 4I64A 2EFGA 1X8DA 3TA2A 4B3TF 2XY5A 5L1KA 1QJHA 3BR8A 5L1LA 3TA0A 1JJ4A 1WOPA 5DGBA 4RWWA 3DN9A 2VFSA 4LF7F 2W2NP 1T9XA 3T41A 3H5XA 5E2QA 1X9MA 4KYZA 2JRSA 3R97A 4QYZJ 5J2QA 4NLQA 2ZNYA 2R7QA 3DU5A 2X1GA 2MSSA 4WF9Q 4DFMA 3VGVA 1S10A 4I56A 1RYSA 1XK8A 4PG6A 3CCTA 2Y9HA 1TL7A 2ASJA 2VIHA 3DYAB 2CQDA 3HHLA 3I4PA 4C11A 2HHUA 3PFOA 2JFDA 5J1EB 1UFWA 1UFLA 2FJWA 4CNYA 2GCFA 1H7XA 2M7SA 2DISA 1T9WA 4OYMA 4DWIA 3DRSA 2Z2ZA 2UUAJ 1XMOJ 4TLQA 1IR2A 2QLWA 5HVHA 1S1TA 3MHYA 1U1NA 4P71A 1BMQB 3US5A 1HPZA 5KFHA 1UVLA 4X4SA 2KM8B 5HMWA 5HATA 4XDDA 4J37A 2C2KB 3LP1B 5EHHA 1IJEB 1LV5A 1HNWJ 1UMJA 3QO9A 3N5BA 2I0XA 3GV7B 1RJJA 5HO4A 2QE5A 1YQHA 5IZHA 4Y2AA 4ER8A 5J2QB 3RAQA 3THPA 2ALZA 4PWWA 5KFSA 5J1PA 1WC5A 1U24A 5E3PA 3SSRA 2X3DA 2F4FA 1V3ZA 4J9LA 3VVTA 4TU7A 2VODA 5IV3A 3DLGA 4DPUA 1XMQF 3R7SB 1TL7B 1D9AA 3UN5A 1U1PA 2BZ2A 3HHLB 4ZN3A 2V67A 3DDNA 4C11B 2RF2A 4DR2J 1M5PC 4QYZK 4DV6F 1QAJA 1GNKA 4JI3J 1D09B 5H9EK 1RDRA 1M90T 1SC1B 2XMMA 4DV0F 4USMA 1FKOA 2D74B 1P6TA 1WWHA 1TUWA 1OIAA 4DR6J 4DU7A 1CJUA 2XB2D 1HD0A 1IR0A 4G65A 4KHPJ 1S1TB 2IRXA 1YJRA 3V6JA 2W1BA 1HPZB 1SL0A 2PSZA 2BJ7A 2CPXA 3EX7B 1YTYA 3S6EA 3H5UA 4AL7A 1R0BG 2HVEA 4U67Q 1FT8A 3R27A 4NX9A 3H40A 1G1XA 3QO9B 1FI4A 1S1UA 3GIMA 3HF5A 4NLPA 2VPZB 1PAUB 2K8GA 1IVZA 3WBZA 4DLEA 3W2VA 2CA9A 4IUFA 3H59A 5AXMA 4LQ9A 1UJ5A 4LFCF 2DNQA 2LQJA 4FXVA 3K58A 3DLGB 5CXTA 2LECA 1X31C 3IGVA 3TP2A 4X4TA 4DUZJ 4HHHA 3G71S 3JSMB 2RF2B 2VQFJ 4WKRA 1N56A 1OY9A 2AMCB 3N5FA 1Z2LA 5KT4A 4HDHA 3RYLA 2AYBA 1MLAA 2VL1A 4KSEB 4R0EA 1Q5YA 1FKOB 4C0BA 3DFEA 3GR0A 3TNVA 3CJQA 4H4KA 2JVOA 3OSPA 1ZM4A 4RW8A 2C2NA 4W98A 1KOHA 1CJUB 2IYIA 4ANEA 1PGZA 2UU9J 4YN3B 3H2UB 2HQIA 3O3LA 1SKRA 2F1FA 2ZHOA 3FBCA 1S1WA 1TZ0A 4NZ6A 1WC6A 3ZZ0A 4NXMJ 4OFZA 3AOBA 4I6AA 4U6PA 5B0FA 3OFGA 4PZVA 2V6AA 1NKEA 3H7HB 2D3UA 3ENVA 1TK8A 4DLGA 1FJEB 1S1UB 2GAHC 1GXTA 4QIEA 3MTJA 4WXWA 2OP5A 1EQMA 1JJHA 3W2VB 2UV8A 3GFZA 2FJAB 1VQ4S 5DDPC 3K59A 2IYGA 2GHVC 5ETMA 1PCAA 1VI7A 2QT7A 5KTQA 2DR5A 4MIAA 3DCAA 2ZH5A 2D1CA 2XM3A 1TV6A 3LWMA 5I3UA 2AD9A 5KFRA 2R3VA 2VDHA 3CE8A 1T11A 3BGRA 2ZUGA 2DNHA 3UCZP 2JHEA 2Y1LB 2V4RA 2J0SD 1YHQS 3M6VA 4RW8B 2MKIA 2FD2A 2AYEA 3V6HA 3U1LA 3R5GA 2MZJA 2B4PA 1S1WB 3N4WA 3PRBA 5LSLA 4ZLLA 4Y2CA 2KM8C 4YB7A 3VAKA 4PABA 2WBMA 4FXDA 4NLRA 3MMBA 2MLXA 3NL0A 2CPFA 4HH0A 2BE2A 4XK8C 2KN4A 1SCJB 2L41A 1VS3A 2M70A 3B4DA 2VQEF 2Z0GA 1YVFA 4J9OA 2UXCF 1NLKL 4ILRA 2CQ2A 1FWKA 1AB8A 3T5JA 1UZHA 4N8OA 4TN2A 2QSWA 2AX1A 2AIRB 4WCEQ 2MXYA 3W9HA 1NDCA 4WK1A 1TV6B 2V8HA 3GZ7A 3UN2A 3JB9k 1S0OA 3HHLC 2VG6A 5I3UB 1XNRF 3BGRB 4NA1A 1MN9A 2C3UA 3TVKA 1S1VA 3R2CJ 4ECQA 3V6KA 3L09A 3GCXP 4JV1A 1VMBA 3CJRA 4ZIVA 2DBBA 1RP5A 3GCWP 1HBNA 2FJEB 4EBDA 2VD3A 4I7FA 2QG9B 5DDRC 4GO7X 2WW8A 1SJQA 3M9MB 3I5BA 3K89A 3FVYA 1FJGF 4ZPAA 1XJWB 1YBAA 2FZGB 3MMBB 3SBMA 1N34J 1HW9A 4KAIA 4TYBA 2BE2B 4NEZA 2GIQA 4F4KA 4U7UD 3GP9A 5T7LA 1KC8T 4IOCQ 1JLAA 3MOJB 5MLCV 5K8NA 1ZOTA 3IAM9 3Q89A 4JI0J 3ZC4A 4NLUA 4ZPVR 5DLFA 3D6FB 3RBDA 3J7YI 1ITPA 3EXCX 3CO9A 3MUMP 2YVSA 4C9DA 2OSQA 2CQIA 2YQ3A 2DB1A 2VG6B 5SUHA 3RR7A 2CQGA 3NGRA 2AKWB 1S1VB 3I96A 2DD8S 5C5JA 1R7IA 3NAIA 2G13A 1FRMA 4ZVUB 3PW7A 4IH7A 4ZMMA 5BJRA 1TP7A 1G2EA 3KLGA 4LRBA 2BJ1A 4JUZA 4RU2A 2CQ1A 3OLBA 4F3MA 1HBNB 2F63A 4DN0A 3KUHA 4FS1A 2YKOA 1ZM3A 4D3HA 5K20B 2C2OB 2C22A 5K14A 3PNIA 3QFWA 2W4CA 2VC1A 2CQPA 2J8AA 3DLEA 3HZGA 1FDAA 4MK8A 3RBEA 2YKPA 3R9LA 1JXVA 3WC2A 2H5EA 4USTA 2V8PA 1KHWA 4PYAA 1H3DA 1JLAB 2B0GA 2HWTA 2BQRA 4J9PA 1R43A 2ZHAA 5DGAA 5ETTA 1KTQA 4HHUA 3TZYA 1LXJA 2C2EA 2VPXB 3TANA 3QT7A 1Y7PA 1K1QA 3CDAA 3TYTA 2KO1A 5T41A 1IBKJ 4WYWA 2N82B 3JTNA 5F8LA 2B3TB 2HGLA 3BPDA 1KQFB 1YZ7A 3KLGB 2GHWA 3BF4A 2YNFA 3V2UC 2CAJA 4LF2A 4YEAA 2HBZB 4X66F 2B9XA 2ZNZA 2BRLA 2HGMA 5KFAA 2HHHJ 3G2XA 1IBLJ 4NE9C 3PR5B 1UPPA 5EWGA 3I32A 3VQTA 1WKLA 4KGXB 1GMVA 3R8YA 3LW5C 2H3EB 5K14B 4OZ1A 2EVZA 2CWKA 2MQMA 3DLEB 1JLCA 5KT5A 2O01C 1N33J 3NOGA 2LU2A 1QVGR 4ED3A 2H5JB 3R2DJ 2PA3A 3GB0A 3L7UA 5I3PA 2KG1A 2XMAA 5IS2A 2RQKA 3VZIA 4DI6A 2G2OA 3M8YA 2ROGA 3N6MA 3CWJA 4CP5A 2QA1A 3GSDA 4O3QA 1B0VA 4DV1F 3ENAA 4DOZA 4AD6A 2JVRA 1G3OA 4B3OA 4KGZB 1ZA1B 2KI2A 3SSQA 2FLLA 5KFWA 2EXUA 1VRUA 1EQ0A 2PA8D 3C8YA 1NPPA 3D3BJ 1BQXA 1U1RA 4PWDA 3BB5A 4WZQA 2YNFB 2EPIA 3M2RA 2NPIA 2DY9A 1JXEA 1PIEA 2FGOA 4CLLA 4FS2A 1M5OC 2BV3A 3A3OB 2BW2A 1R31A 5EX0A 2HFSA 2LU1A 1JLCB 1URNA 2N7YA 3D4JA 2Q79A 4NXNJ 4HR2A 3T9NA 4JP8A 2JDJA 1QAXA 4LJMA 3G9CA 1PSDA 1WTBA 2X1AA 3U02A 1TMJA 2Y8WA 1OYDA 2R8HA 4DZ6A 3MEGA 3CCLS 4LSZB 2BKOA 3CC4S 1B0PA 1TTHB 1HARA 3ZZPA 1H7WA 1WC4A 4B3OB 1H0HB 3CCQS 2QYGA 2MLZA 4P7TA 2CNOB 2B4UA 4HACA 3RAMA 2MQ8A 3K8VA 1VRUB 3A8KA 1WD6A 4C3MA 2E7VA 4USWA 4PWDB 3CD7A 1NK8A 3M2RB 2HAFA 3G8SA 4A8FA 2WCXA 4LIRA 4QW8A 3K5NA 1WKJA 5T14A 2FJDB 1LWEA 4KFBA 1CPZA 1VQ6S 2QLJB 1S7IA 4F3OA 3KDOA 3W5YA 2CQ0A 2JX2A 5EDWA 3TZZA 4DFJA 2IVYA 2WHOA 4WTYA 3BJYA 3B8HA 2UVRA 2ZWOA 4FPRA 1KNZA 2BM0A 2C2DA 1RYRA 2WVEA 3MEGB 2GO8A 5DM6Q 4A8QA 3DLJA 2HRTA 1TVRA 3FBFA 1Q16B 3X1LB 2ZJPQ 2LVWA 4K8RA 5E33A 1VRQC 1UEUA 4X62J 3HD1A 1GTEA 3K5MA 3AHPA 2B9YA 3HK2A 4YY3F 4HACB 3TVYA 5KFPA 1FJ7A 4LF8F 2MQOA 3EVMA 3CD6S 1E6VA 1ZTTA 2XO7A 5J2MA 2J5AA 5KG4A 2N3OA 3VGUA 5ETOA 3CJTA 1VC6A 5IQQA 1IN0A 2CZ9A 2IM0A 4USIA 1GXUA 1S49A 2RU3A 1Y9OA 4OX6A 1HWKA 4UY85 1LWEB 4KFBB 4FYDA 2P9GA 2IM2A 4UOGA 1FTRA 2HHSA 2HZAA 1D8ZA 4X4UA 3PR4A 2MZQA 5GMEA 3GMGA 2RIJA 4N47A 4JI5F 3LUYA 3R3TA 1N5QA 2HZCA 2ZKUA 4A8MP 3V4MA 1N32F 2DNNA 1XTZA 2V2QA 1F5CA 2QJ3A 2UXDF 3G96A 1TVRB 4TNOA 4DSFA 2DGVA 3IAS9 1LFPA 2P9EA 3DM2A 3ZTQA 2PFFB 1X5OA 1KP6A 2AT1B 4M8LA 1ZTWA 3K8WA 2FVQA 4Q7AA 1E6VB 1RAEB 3EXYA 4E2FB 1NKCA 5J2MB 2X51A 4C6AA 1EKSA 2B4OA 4LF9J 1JLBA 1IM4A 1RXOB 4RWXA 4KRWA 1RWVB 1TKTA 2DYAA 1U2FA 5CH7B 1D0EA 3W1YC 1SJRA 3BSNA 2ADBA 3NY0A 4DQSA 2Z58B 3MPDA 3SDEA 2IDLA 4O3SA 2OD4A 4LFCJ 2Z2MA 3PRVA 1K9MT 3W65A 1VQOS 2XYHB 4K2XA 4TXSA 2ZC4A 3OUYA 4DSEA 2HFZA 2P5VA 1L5UA 3QPIA 1YZ6A 4R5PA 3OTOF 3J80Y 5A76A 4ZVEA 1R8HA 2ASLA 3J7Z5 1KHVA 8AT1B 2CJXB 3TAPA 4RW7A 2NCKL 2OKQA 3FMBA 4ECUA 3DM2B 4XIUA 1U09A 1JK9B 4PXEA 1R6YA 3HX9A 1I94F 1DRZA 2XSFA 5IV4A 2EFNA 3W7BA 4ZLPA 2QA2A 1SH3A 2RNEA 3C2PA 1TL5A 4IO9Q 2BUNA 5CD4H 4CRJA 1K73T 3TUJC 2D41A 2E1MC 3MGJA 4DU8A 2F9JA 4UQGA 1T7PA 4DX6A 3JSYA 2NS1B 5GAEI 1JLBB 1ZM9A 3OL9A 1IUJA 1Q8KA 1TKTB 2V9KA 3DRRA 3NGDA 2Z56B 4C3LA 4PXBA 1FRIA 4EU0A 4RJVA 3SDEB 4HKQA 3JTOA 1RT3A 4ALZA 4J9UE 3PIOQ 2KJVA 2G1HA 1T05A 1O0PA 2COLA 3P4UB 4N8NA 3HLUA 4A46A 3OUYB 1AUDA 1BQNA 3A12A 1WG1A 2E7XA 4B3RF 3VZHA 4DR4J 4R5PB 2K3KA 2ZVSA 4AYBD 1RHRB 1T3OA 4HTIA 3U7JA 1NO8A 2RSQA 3CJSA 4RW7B 3K57A 5AE1A 3OTBA 2KHDA 2IHR1 4RX6A 2JEJA 3NRBA 2ADCA 4TYAA 1VBXA 1Q53A 2DNZA 2WW4A 1TKDA 4TU8A 4KV8A 1M0SA 1L3UA 1RT7A 5KFOA 1TAQA 2R2UA 2RHQB 3SV3A 2OMLA 3OV7A 2BM1A 2LLZA 2J7WA 4AUKA 3T1HJ 3Q23A 5HVFA 2DH9A 4C8ZA 1MNEA 5B0EA 3NG8A 1LW2A 3B78A 3CIMA 4MKBA 1KOOA 1IR1A 2HQDA 1CJVA 3DRRB 1WDDA 1HD1A 2DH8A 2JL9A 5E7OB 2CPYA 5GAHI 1N0VC 2HQCA 2LA6A 4Y2MA 1XC9A 2DIVA 2YPZA 1XBWA 1XMBA 1I3OB 1HMVA 1RT3B 2KL8A 4KBIA 1UVNA 1VQ7S 4OJGA 1WTFA 1T05B 1PBAA 1W7WA 5D78A 3CCWA 4NA3A 2K3IA 4QBUA 1BQNB 1X4FA 3UDVA 2OEMA 1QUPA 1ZM2A 3IS9A 1BE4A 5KFJA 4B9MA 3KMSA 3G86A 3FBBA 5BXIA 1RTZA 1XNRJ 1YJVA 5U47A 3SCKE 4J90A 1J5EJ 2EBGA 3RUBL 1UEKA 5M2PA 3AODA 2ZZMA 1LW0A 4DMZA 4O4RA 4Q43A 4KV8B 1QDUB 1RT7B 1YBTA 5BR8J 3HVTA 3R7BB 2FY1A 3M8PA 3DHWC 1SJFA 1B7FA 4OYZA 3KMQA 1NSKL 2CJYB 3FFIA 1M5KC 4B3SF 1Y00A 4A8KA 4GVLA 4A8WA 3NMRA 1WEXA 1FWLA 3PW0A 1LW2B 3LF0A 2MKHA 4I69A 5KT7A 3NCRA 4I0WA 4A4JA 1CJVB 4JI6J 5HMZA 1QAYA 1T9YA 4KR0B 3ETOA 3KHGA 4ANCA 1Y4ZB 5D77A 4RNMA 2RMLA 1HWUA 2Q1LA 3HT3A 3OHBA 4WYLA 1HMVB 2UVVA 2LYVA 3TUZC 5KG3A 1X9SA 3M32A 1FE0A 1GQEA 2XI2A 3DLKA 3ISND 1SL2A 3IS9B 5D4OA 2VG7A 1RSCA 4ELTA 1CVJA 1FEHA 1GH8A 4NMXA 4OJ1A 3NS7B 3D68A 4IQMA 4DUYF 1SI9A 4YQWA 4K4TA 4F0MA 3CW2C 5E41A 1UWAA 2AWZA 1YI2S 4FKXA 2VG5A 4KHRA 2W24A 3IO1A 1LW0B 3M9NB 1RLCL 5H9FJ 1U1OA 2QMUB 3D28A 3HVTB 1X7VA 2XLIA 1HLWA 1CJTA 3JAMU 1FDBA 3M8PB 1VK3A 3MM8A 2U1AA 2H65B 4DV2J 3FFIB 2ZM6J 1HBUA 2GQQA 3QRRA 2QLBB 4ERDA 2GVZA 1WG5A 2HNDA 3PO5A 2WONB 3AB2B 4OMFG 1R89A 4PYDA 3Q2SC 3VAMA 3MEDA 3ZTOA 1ZYQA 4M5JA 1C0UA 1H38A 3CSKA 4V19J 4JI4F 2GJ2A 1U6FA 4NA2A 4USJC 4JV5F 3M32B 3N79A 4NRTA 4MK7A 1OJ4A 4CIOA 5FIIA 2KYXA 2VG7B 4Y34A 2OTLS 1CQNA 2ZHBA 1U7LA 2BRKA 3FRYA 2X3GA 2E5GA 5EUHA 1WSVA 1X60A 2VKZG 3EDQB 5BYQA 2VG5B 2HNZB 3Q0AA 2KFNA 3H0PA 2GNKA 3HVWA 4F3QA 3RW7A 1U1QA 4X66J 2XMTA 2DNLA 3W8GA 1RZMA 3TOQA 1CJTB 4M5HA 5KOXA 3MM8B 3PJ9A 3VQSA 3HZEA 2GVZB 1WI6A 2V5HG 2HNDB 4ES1A 1WSRA 1KRPA 2RJZA 1IQZA 2BKPA 3RZAA 4OJHA 3W9JA 3RW6A 3MEDB 4ENOA 4NZ0A 3KK1A 1NM2A 3QWPA 2G0JA 1PG5B 1C0UB 1VOMA 3MR5A 5F41A 3KXDA 5E3RA 5D0RA 3M2VA 4B9VA 3KHHA 4NLGA 2BMBA 1CULA 3CCJS 2P6SA 3K5LA 4DV1J 1V3RA 1BY9A 2R4FA 3B54A 1YRTA 1NK4A 4J9VA 1FRLA 2POKA 2ZKTA 4UY8T 4WP9A 1D9DA 2F8HA 3VVUA 4MYUA 3HCXA 3UD4P 2EC0A 1PJ7A 2W4PA 5THWA 3KYLA 2UUTA 1U1MA 2N4CA 3C46A 3ET6A 4TVAB 2CYYA 4DXLA 3MMCB 4OYXA 4ZK7M 4DX8H 1VIOA 3OR2A 1TU0B 4Q8FA 2RU9A 3GYGA 4O3RA 3QGHA 3FRZA 3UCGA 1F9EB 4DQQA 4OYAA 1QLNA 4ZLNA 3J7AN 1WC0A 4NLTA 2DGWA 4KGKA 4F36A 1RWPB 5GADI 3W5XA 3L9ZA 2UUAF 1S6UA 1XMOF 2MZTA 5KFEA 3R5CA 1S9EA 4G1QA 3M2VB 3D6MB 4EFAC 3D9BA 1RWNB 3TEGA 1CULB 2LDIA 1MMLA 1BC6A 2PMWA 1B4SA 1REGX 2R8IA 3OTEA 1Q78A 3M05A 2AEJA 2OPRA 4OV1A 4RNFA 1VK8A 3TI0A 1KN6A 1HNWF 3WQPA 2XWYA 3ICLA 2XSJA 1KVIA 1FFGB 1L3SA 2VICA 2XMUA 3SZ2A 2AQ4A 2QGFB 5AXKA 3E3XA 3FK4A 5KFYA 3EDRB 4WFYA 3J7ZT 1SIWB 3EZOA 3D3CJ 3OR2B 1S9GA 2PD1A 3PXGa 2XZTB 1WC1A 4M5DA 4DFPA 3WHIA 3UVJA 4JI3F 2MQPA 3OVSA 2Z8QA 7FDRA 2JLEA 2R7XA 1RBLA 4EO6A 3CJ5A 2WSEC 4DCOB 2BJ3A 1P8GA 4DR6F 3DOLA 2RE1A 3I9ZA 3KLVA 1UVKA 2ZBQA 1S9EB 4G1QB 3GFXA 4USHA 2UVWA 5RUBA 2LEAA 2GJIA 1S6PA 4MKVA 4A48A 4ZP8A 5KAKA 5IC6B 3CC7S 1RKIA 4CO0A 1GX6A 4EMDA 3AOCA 3H2LA 2DGOA 3VAFA 4M63A 2XSJB 2I6WA 1FA0A 2PGCA 3MAQA 3NKYA 1TELA 3PEJA 3G6YA 3ENWA 2RAQA 3JYTA 4DUZF 1S9GB 2WSFC 5DQIA 3NCPA 4ZJQA 2VQFF 4M5DB 2BA9A 1DZ5A 3UVJB 3AOAA 1F3VA 2DNGA 2GJFA 3QT8A 1TK0A 4IOAQ 5AXNA 4IR9A 4K2JA 3IMQJ 1U4BA 5B09A 1DY3A 3WIUA 3DOLB 4X4VA 2UU9F 1N32J 4Y0FA 2F40A 4G3IA 3E8OA 2FHMA 1S0MA 3HFVA 3JAMY 2FVSA 1UETA 3PO4A 1S6PB 5K9FA 3ZNUA 4K4XA 4EK2A 5JJBA 3BYPA 2IM1A 4DS4A 1SQGA 1JLQA 1SJ4P 3DHXA 1FRKA 2EK1A 5DRKA 3ULHA 3FBEA 3CMES 2DHHA 3WDOA 2K7KA 3CD0A 3ZFVA 2ZDPA 2HVDA 2B9EA 4DL2A 4IRKA 4CI0B 3AJ1A 4RNNA 2AGPA 3FC9A 3TW0A 4K7QA 4P2MA 1IKVA 5LXRA 1U25A 3JYTB 1RT4A 2Y3YA 1X4GA 3CJ8A 3ZZOA 3QLHA 3C16A 5CZXA 4PUOB 1R0CB 2VBYA 3IP0A 5HVGA 3POTA 2J9DA 4OZ5A 2LQ9A 3G6ES 1VJWA 3IRXA 2YH0A 3CJ0A 3UO0A 1ZZFA 2AJ2A 3VF0B 2AX0A 3TX0A 3AQPA 3OTOJ 3M6XA 1I51B 1X5SA 1DARA 2QMXA 2YXLA 2JFKA 3BS9A 2IDEA 1HQEA 3EICA 3D0IE 4L74A 4B9LA 5DZ7A 1T95A 4I6YA 3R6LB 3TZWA 3LPYA 2QX0A 2XS7A 4ZOSA 4CQ1A 4ZVTB 4E8UA 1JLQB 1I94J 3GE9A 1LFWA 4MMOA 1JNRB 3KLFA 2XULA 3KKFA 3I4HX 4UW2A 3DU6A 2OD6A 1H72C 3AT1B 3JQJA 5LOQA 3HSZA 3HD2A 3IWLA 3D0HE 1HKAA 2GFFA 1IKVB 3H2VE 4ZLJA 5KFDA 1RT4B 3SFGA 2P2CB 2GIFA 3C16B 3V4IA 1FRJA 3PDNA 1DTTA 2FY8A 4ECZA 2E1CA 1VQYA 1VQNS 3POTB 4DQRA 4JBCA 4QR1A 2HBRB 2O1PA 3IRXB 3THVA 5D0GA 1V5VA 5SZTA 1RGVA 2W01A 4F7VA 3T1YJ 3A3NB 1UPMB 2KXHA 1HQEB 3J7A1 2MLYA 2CQCA 5ETQA 4DZDA 2B9WA 4M5MA 1AXQA 3IBWA 2EBEA 1PAEX 3H42A 1N34F 1HW8A 2W4DA 5DQGA 2AJ1A 1NMEB 1RHJB 3KLFB 4IR1A 1MWYA 1S4FA 2XBPA 2YPYA 4B9NA 4YDDB 1IWGA 4AQYJ 2AGOA 4N7TA 2OPPA 3EGZA 3NCQA 4FPIA 4FF3A 3C6TA 3BEGB 1URRA 4NLWA 4PR6A 1V5IB 3SXLA 4KT0C 3NNCA 1FXDA 2ERRA 2W7AA 3V4IB 2W8LA 1DTTB 3RG6A 3KK2A 4BHQA 3DI6A 2CG4A 1YSJA 2JC1A 1D3WA 4OI2A 3GR1A 3KFWX 2Y1JA 4OIXA 1FERA 2VJUA 1LWFA 2HWIA 4ZVSB 3W64A 3FUYA 2R9LA 2HVIA 2XCAA 1O51A 3BH6B 1ZZNA 2FC8A 2FHOB 3IA0A 3P5BP 3DRXA 1E6YA 3A1YG 1WORA 2CJ9A 4PWUA 2DY1A 4OLPA 2O66A 3HMJG 4H4OA 3PX4A 3GJSB 3GG1A 1BWEA 1KR4A 4WPAA 3BYRA 5B0CA 1RHKB 4EZ9A 1G6BA 2OLWA 2H5IB 3UQSA 4WE1A 4RUAA 3PJXA 3A8IA 2KJWA 4KH1B 4WJBA 1RT6A 4NLOA 2OPPB 1C1CA 1K0VA 4FYWB 2EC2A 1RAFB 5CABA 2E5HA 3C6TB 4RBVA 2DJWA 2ZOMA 2E44A 5J2PA 2F8EX 3VGSA 3TJAA 1F3FA 4ECTA 1FXLA 2F8MA 3W5ZA 5F8JA 4OI6A 2HLUA 3KK2B 3DDKA 3DI6B 2C3PA 4NOHA 1Q79A 3EJMA 1WI8A 2LXUA 3T6JA 1S9FA 3LWLA 4ZP7A 2L3MA 5HANA 2MY8A 2WK4A 1VHIA 3NLCA 1NDKA 1EB0A 4DV4F 5CYMA 4P2FA 1U1LA 4MIWA 1IBLF 4ZVOB 5F9NA 2CVIA 1E6YB 1HNXJ 1FE4A 4IFYA 1WUUA 4DL5A 3I55S 5B0GA 4H4OB 2NUUG 3B4MA 2NREA 3UW1A 2YTCA 4OYIA 2YBVA 4TY9A 2DXFA 3BBFA 1ICEB 1VR6A 1PJ5A 1EP4A 2FJBB 2ZH2A 4WE1B 3OFHA 2PMHA 1FTCA 3CGIA 1RT6B 1C1CB 2V0NA 3TEHB 4X4QA 5FLXU 3F44A 3MXHP 1B64A 2CZ4A 3QJLA 2QL7B 5E3QA 2OUGA 5J2PB 3D67A 1ZH5A 4LF4J 2HFNA 2ABYA 3CXCR 1C2PA 5DLGA 1GTHA 4CZCA 2QV6A 1NB7A 2MKKA 2RS8A 5DZ6A 2DR6A 4O44A 2YNHA 3LPEA 3I9V9 1U8WA 2BR0A 1LWCA 1H2UX 2O67A 5A2QU 2RT3A 4JV5J 1B70B 1YJNS 2ILZA 5CYMB 3P45B 1UA0A 3MF5A 4ZJLA 2V50A 1KS2A 1Z4UA 2FZCB 2Z30B 4IFYB 1AZSA 4FF2A 1F1BB 2VA3A 4LF6F 1YJUA 1RWOB 3MMAA 2DRDA 5GAGU 2QMWA 4PCQA 2DTJA 3VAIA 4L76A 3MCNA 2IMWP 5HMYA 1D9FA 1ZA2B 4FN5A 2J9EA 4NXNF 5CA5A 2CKWA 4WFXA 3SYZA 3CUNA 2E5IA 1AT1B 1EP4B 2JNJA 3PV8A 1U26A 2Y0SD 4B9SA 3MPYA 4DN9A 2NQPA 2L9NA 2EI5A 1J5OA 2DO4A 2WBRA
chains in the Genus database with same CATH topology
2RKIB 2J7KA 2ZJRQ 4CO2A 2HNZA 1Q8IA 3I0SA 4HTJA 3GG0A 3TVYA 5KFPA 3QIPA 3I87A 1FJ7A 4LF8F 4AFFA 2MQOA 1JLEA 1SIZA 1RA7A 1S6OA 1N5YB 5D3GA 4KQZA 3CD6S 1V3SA 1E6VA 2OPSA 4TLRA 3UFCX 1F5BA 4NYZA 3MECB 1RWUA 3OR1A 2DNYA 4RBUA 1ZTTA 4DDFA 1PO6A 2XO7A 5J2MA 2J5AA 4G6VB 5KG4A 4ICLA 3FMWA 2N3OA 4O44B 1SV5A 3I6PA 3K7RA 4F8RA 4DL6A 1ZETA 4K59A 3LO3A 1VC6A 5IQQA 1IN0A 4OHYA 1DBDA 1JMTA 2YNHB 1NAQA 2IM0A 4USIA 3OSNA 2XGPA 5JUMA 3DRPA 3L95X 5L9NA 1T8EA 4OZLA 2IAJB 1GXUA 1S49A 2RU3A 4LF4F 4R8UA 3T5KA 1Y9OA 4OX6A 1HWKA 1FKAF 1FKPA 1LWCB 2OIHA 5KG0A 4UY85 3DMJA 3BQ1A 2QSFA 1LWEB 1D1UA 4KFBB 1TKZA 4FYDA 2P9GA 1TQLA 1WHYA 2IM2A 3MCSA 2O3DA 1TFWA 3N9UC 2GC8A 5KG5A 1FTRA 3AY0A 2HHSA 1HA1A 5DDOC 1D8ZA 1TFYA 4X4UA 4KB7A 1T03B 3PR4A 2RVJA 2MZQA 2VKRA 3IG1B 3LP1A 2V2KA 3GMGA 3NGKA 4LUBA 5I4MA 1VIXA 5GAHU 2GV1A 2RIJA 1TKXA 4YHHF 4JV0A 4C3KA 1H2VZ 3EPIA 1F9FA 3CIZA 3NS6A 4N47A 3U1MA 4Q5VA 1TK5A 3LUYA 1P27B 3R3TA 1N5QA 1TL3B 1VQPS 2GA7A 2HZCA 2OPQB 1GXLA 2ZKUA 4A8MP 3MMAB 3V4MA 4ILMA 2YX7A 1S0NA 1Z1ZA 2FJVA 4ZCLA 1N32F 1JIHA 1NH8A 3ISZA 2DNNA 1XTZA 4QR2A 3DOMA 2UXBF 1KLMA 3LP2B 4J9MA 2JJ4D 3PKYA 1F5CA 3RB6A 2UXDF 2VONA 4YB6A 3G96A 2MDAA 1TVRB 2EFQA 1FVSA 3N28A 1DURA 4NLYA 4TNOA 3QIDA 5DO2A 3QZ8A 1C1BA 2DGVA 3IAS9 4DSFA 5EWFA 2AV5A 3HJFA 4OI4A 2IC3B 1LFPA 3SCIE 4F25A 1HNIB 1MROB 2P9EA 3OXFA 3DM2A 4GMKA 2PFFB 3KK3A 1X5OA 1U49A 4ZPWR 1J5OB 2KRRA 3OJSA 4QWBA 5EGYA 4M8LA 4DHVA 1MSWD 2MB0B 1ZTWA 1HL6A 2M9KA 3TARA 3K8WA 1X5PA 2MZSA 4G1PA 3W2WB 4C7QA 2CPDA 4EUVA 5A6PA 3OL8A 1R8PA 2DT9A 2JSXA 4Q8EA 1RT5A 3I0SB 1BQMA 2FVQA 4JI8F 3QIPB 3FSYA 5K8OA 2HVHA 1QSLA 1K0TA 1JLEB 2HG4A 1VQMS 3K5PA 4Q7AA 3Q24A 5D3GB 1N52B 2BQUA 3L7OA 2XWXA 3QLHB 3CCVS 1E6VB 3WX4A 2LDYA 4CT8A 4X2BA 1WHVA 4E98A 3EXYA 3VALA 3T19A 3OR1B 3CULA 1NKCA 3MMCA 1UEVA 3D1OA 1FD8A 2GO9A 4HYKA 5J2MB 4FVCA 2HGNA 5L38A 1N5VA 4G1I