5D4PA

Structure of cpii bound to adp and bicarbonate, from thiomonas intermedia k12
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
102
Chain Sequence
b'AIKLYPLKKLEIILEGAHKEFATDLLDRAGVKGYTIVGNLSGKGSHGMYEGHLMDDALIMIIAAVPEELVGPLLEGFQPFFEAHSGVVFVHDIQVGRPIKFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Nitrogen regulatory protein P-II GlnB
publication title Structure of CPII bound to ADP and Bicarbonate, from Thiomonas intermedia K12
rcsb
source organism Thiomonas arsenitoxydans (strain dsm 22701 / cip 110005 / 3as)
molecule tags Signaling protein
total genus 18
structure length 102
sequence length 105
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d4pA00
2RD5C 1UKUA 1NAQA 4CO1A 3OPKA 1V3RA 3GSDA 4YB6A 5D4PA 2NUHA 4WK1A 3CE8A 3N5BA 3AH6A 2J9CA 1O5JA 2CZ4A 2O67A 3AHPA 2XZWA 3LF0A 2EG2A 2EG1A 1NZAA 4C3LA 2NUUG 3HLUA 4C3KA 1NH8A 2V5HG 4RWXA 2GNKA 4D3GA 1H3DA 4CO5A 1J2VA 5D4LA 2ZFHA 4YB5A 4YB7A 4R25A 2XBPA 1XK8A 4RWWA 4D3HA 5DRKA 4RLEA 2E66A 1VFJA 4RX6A 3TA0A 2GW8A 1PILA 1V9OA 1KR4A 2JJ4D 4IYQA 1UFLA 3L7PA 1V3SA 3O5TB 4CNZA 3BZQA 2DCLA 1P1LA 2Z0GA 5D4OA 1GNKA 4CO3A 4ZK7M 3NCPA 1V6HA 4NYOA 5L9NA 3O8WA 5DS7A 1QY7A 3AA9A 1UL3A 4WK3A 4Y65A 3TA2A 4OZLA 1HWUA 2GX8A 3AA8A 2J9DA 1OSCA 2XG8A 2J9DE 4AFFA 4USIA 2O66A 4Y6IA 3M05A 4OZJA 3NCRA 1NH7A 2NS1B 2VD3A 4USJC 2PIIA 3X3UA 2J9EA 5D4NA 1VHFA 1O51A 4OZNA 3TA1A 4CO2A 3NCQA 3T9ZA 4C3MA 4NYPA 4CO4A 2XULA 3DFEA 1UMJA 4USHA 4CO0A 2ZOMA 4CNYA 1Q1KA 4E98A 3MHYA
chains in the Genus database with same CATH superfamily
3UI3A 4PXEA 3GE9A 3RZAA 4X4RA 2GGPA 1V3RA 5IOLA 4JBCA 1HWIA 3GPAA 2OO4A 2M9KA 3C46A 2AYGA 4IFYB 1Y0HA 4C3LA 3KK1B 1BQNA 1IKYB 1JLFB 3QQCD 3WHIA 4DLGA 4NCGB 4DR1J 2HHWA 3EZOA 1E6VA 1IWGA 2VONA 3JSMA 1JJ2R 3NNCA 3I5CA 2QRRA 5A8RA 1XR7A 3IWXA 2WB4A 4ZVSB 2LECA 2M8DB 4CP5A 2WSFC 3MPUB 4DV0J 3Q8SB 1ZA2B 4WK3A 2ZH9A 2W2MP 2DR9A 4X4OA 3TAQA 1NJYA 2EBEA 4BBYA 1CULB 1OJ4A 4OZJA 2EEYA 2CDRB 2JH3A 2IAJB 3NNAA 1LWXA 1IN0A 3W66A 2B3TB 4NX9A 2HHHF 1F0XA 5H9FJ 4P52A 2RD5C 3CVKA 3R3TA 1RTZA 1KOHA 4MFBA 2CVIA 4PQUA 3BBCA 2BQ3A 2OD4A 5D15A 4C48A 2YNIB 5A6PA 3VAKA 2J8AA 3CDBA 5CZVA 2XBPA 4J90A 1PC4A 2Z2LA 1BD6A 3JSYA 3CCTA 2E9TA 3GLJA 5IT0A 2FDNA 4WFXA 1JLCA 5DG8A 1SC1B 2M7SA 2ZH6A 1KR4A 3MMJA 1TUVA 1VQNS 1FVQA 1FESA 1GX5A 2GMLA 4OX7A 3Q2TC 4FP9A 4ZCIA 1NSKL 3BR8A 4AD6A 2HK3A 3HF5A 2KN4A 3IBCB 5KT3A 1U6ZA 1HWLA 4U8VA 1NK9A 1H2UX 1YJUA 2KZMA 4MK9A 2C28A 4ZPDA 5CYJA 4EFAC 2V68A 1DTQA 4I2QA 4I64A 3VAMA 1NK7A 1SI9A 1TKDA 3OLBA 4WU2A 4Q45A 1U1OA 3HSJA 3W8GA 3MXHP 4PPDA 3DMJA 1VDHA 2V67A 1RISA 2PE8A 4U6PA 3ENAA 4IG3B 4XO0A 4LMZA 5T7LB 1JLEB 2F65A 4XPEA 2O67A 2Z56B 4O23A 4JI7J 1S9EA 2OGUA 4A8QA 2AX1A 3K58A 1E6YB 2RDJA 6AT1B 1GTEA 3VZHA 5KFUA 1V5IB 4IO9Q 3R7NB 2VQEF 2NYHA 4WKYA 3RBDA 5G0RB 2ASJA 3AOCA 3A3NB 1AYEA 2CZVC 2XZDB 5IS2A 3FSXA 4A8OA 4LR7A 3AB2B 2XY6A 3KMSA 1KQGB 1LFWA 2YKMA 3TZXA 2MQMA 4B3SJ 4RW6B 2HAIA 4H4KA 4ZPBA 2XI3A 3L7UA 4KQZA 3CJTA 2BJDA 1SJRA 3ILJA 2UVWA 1RTHA 2ALYB 2V6AA 1TZ0A 2MLZA 2ZDOA 1XIQA 3M6XA 4URSA 3OL7A 2EG1A 2PI4A 1S77D 1FFSB 5C25B 3IR5B 2XC9A 5DM7Q 2D69A 3UR3C 3RB3A 4MKVA 1C4AA 3E3XA 2DNPA 1FI4A 2Q1LA 4FF1A 1RGVA 1Y5IB 3MI7X 1ZAXA 3FFIA 3V6DA 4FKYA 3HVTA 5IQQA 1VQSA 3LOUA 1OPIA 4Y2AA 3GFYA 2LQ8A 3QO9A 3JSBA 1F3VA 4TLRA 4GVLA 4QWCA 3GWCA 3ITHB 1Y00A 2OPPA 3W5ZA 4AT1B 3V5RA 2RMLA 2ZD1A 4GO5X 2VJUA 2LMIA 3LAKA 3GIIA 5B0DA 4K4VA 3JYTA 1UJ4A 2UXBF 5D3GA 2YKNA 2LFVA 2SXLA 4FNIA 3P3DA 2YBVA 3M2UB 3DOMB 3IS9A 3TZZA 2HLUA 5ETKA 1S1VA 2GMHA 4OI6A 1H73A 4FKXA 5J2MA 4KO0A 5ETRA 3Q8PB 3PRVA 4OX8A 3IRXB 2H9ZA 3BN4A 5FDLB 2NPIA 2ZE2A 5KFGA 2NPFA 4ZJQA 3AJ2A 2LLZA 2GC8A 3F0NA 3SBMA 1VC0A 3OR2A 1Y5LB 4ZVGA 4UY85 1T9VA 4ZCMA 4JOUA 2CPXA 3UNGC 2LU1A 1B3TA 3QJLA 2DHSA 1IBMF 4HDGA 1X4BA 3M9OB 1RT7B 4B08A 4L74A 4TYBA 4A8KA 1PYTA 4C11A 3BB5A 3MM6B 2HRTA 5KFFA 2XY5A 2KL8A 1DBDA 3POTB 4WYWA 1BQMB 2C42A 4RBVA 2LDYA 2VH7A 1VQPS 2UP1A 1YGYA 1LNQA 1C2PA 1GXTA 1KHWA 1QSSA 4RZRA 2R4FA 3JAMY 4WFNQ 4N41A 2E5IA 3OW2R 1RSCA 1NSPA 1TV6A 2A6OA 3TUJC 5CYMA 3CGIA 5J2QA 4IOBA 3UFCX 4DX5A 3JB9k 3RYLA 4OMFG 1BQXA 2CQ2A 2M4MA 4ED6A 2AHOB 5KFOA 1DQ8A 2Q79A 3M6UA 1Y3JA 2HW3A 4QW9A 2G0CA 1UL3A 2BM1A 3J7YI 1U8SA 2H5JB 2KTQA 4C0HA 3QAUA 1KLMA 5GADI 3H2LA 3Q8UA 5CQGA 5KFTA 1NH7A 3KOAA 4KT0C 4OYWA 2XI2A 1S0MA 2FGOA 4GC6A 1KLNA 2GO8A 1B4SA 3Q8RB 4PG5A 4OYZA 4K4XA 3D54A 4FDFA 4OI4A 5E41A 3W60A 1YJNS 1WHWA 4KPYA 4ZKAA 1LWCA 2HHHJ 1HBMB 3I0RB 3HJVA 2ZH2A 1Y5NB 6FD1A 4UOFA 3GR0A 2DR8A 1F5CA 1MNEA 2B9EA 2DNRA 1M90T 4LF1A 1VIXA 1C1BA 5CYQA 3W9HA 4G6VB 4RLEA 4B9VA 5A8KB 5JVHQ 1G4CA 1WNEA 3JTNA 1UWAA 1C0UB 4O4GB 3NXZA 1ZBTA 2YTCA 3BZQA 2BE2B 1KHVA 3HSZA 2EFQA 2XYGB 4ZK7M 1VR6A 5KG2A 1VISA 4M1KA 4A47A 2GAGC 3KLIA 2YWGA 1RK8A 4PZVA 2H54B 1BXNA 3OBIA 4IKAA 2DGSA 1RT2A 3N6LA 3C2PA 4W98A 1NZ8A 3QFHA 5KFVA 3PV8A 1O51A 2QIFA 4ED0A 3G6XA 3Q0AA 1N5YA 1VBYA 4CO0A 2L08A 1TKZB 1Q1KA 2DXDA 2HHQA 2VG5B 4KAIA 3MGJA 2XLJA 2OELA 2Y1RI 4HACA 3QLHA 3MUTP 2WHOA 1N54B 1YITS 4CLYA 1AW0A 4J9SA 4ETZA 2OTLS 3R7SB 1R31A 3GSIA 3R97A 2D74B 4ZPAA 4NLQA 3KUGA 3QYYA 3OFFA 4O3SA 4DL2A 2GW8A 3OHAA 3DYAB 3TZWA 1VQYA 2OPQB 2UZAA 2FHKA 5D0GA 4E8UA 2VQEJ 5KT7A 3BGRA 1WOOA 1REGX 2Z2YB 2RAQA 2RUGA 5H9EK 4M5DA 2FIUA 3K5OA 2OFGX 4IQMA 3H59A 4USIA 4X84A 2LKZA 4P2XA 3NCRA 2RQMA 3SSSA 4DR4F 2PIIA 4J9OA 1FNXH 2KU7A 3AAWB 3V4IB 4P6QA 4FF4A 1RWWB 2V8HA 3JQKA 3DLJA 5EX3A 1I94F 1QAIA 3K7RA 2MQLA 1QVFR 3MPWA 2BW7A 1FDNA 3K0JA 2ZH8A 3FEXB 1KP6A 5KAKA 2VG6B 3O2IA 2JLGA 1UETA 4HTJA 1CJKA 2AYEA 2K7JA 5D8HB 2DO0A 3VAFA 4NCAA 1RWNB 2FTRA 4CWBA 2PMHA 1RKJA 4D3HA 1MN7A 2AZ3A 2LXUA 1REVA 4B3TF 1PILA 4FXWA 5HMYA 2J76E 3GILA 3O5TB 2EXUA 3BSOA 3DI6A 2V8VA 2HIYA 3SCLE 1LQ9A 5LT5A 8ATCB 3K89A 3TARA 3EGNA 4URGA 5AXKA 2AMCB 2N4CA 1NDKA 3UCZP 4F7VA 2O66A 4K4WA 1UPMB 3HD2A 5F8HA 2NS1B 1XJWB 5ADZA 4K4YA 1VBXA 1YQHA 1CQMA 2FC8A 3A3OB 5IM0A 5DDRC 1BMQB 2R42A 3UD4P 1U09A 2V2ZA 2DNNA 4KFBB 4ED2A 2KH9A 4X4TA 2E1AA 2FJWA 2RT3A 1SKUB 2UXBJ 4ED5A 3GFHA 2R7XA 2Z4PA 3K2YA 4DSJA 2VC0A 4P2MA 1HKAA 4D3GA 3CCSS 1T03A 4IOCQ 3HVRA 3TQ1A 1R8HA 1RT1B 1J5OA 3MPVA 3THPA 3CCMS 3GYNA 1RT4A 2YVSA 1K47A 2DCUB 5D77A 1S1TA 3HHKA 1TKTB 1U26A 3D5MA 4F2RA 1CJUB 1JK9B 1AB8A 3NBPA 3BGOP 1RI7A 2RU3A 3I32A 3GIKA 2GGPB 1NRKA 1P1TA 1IR2A 4WP3A 1RWVB 3DXSX 1BQNB 3M32A 1WC0A 3IGVA 5I4MA 3LP2A 4FPRA 1IBMJ 4RW4A 1E6VB 4J7CA 4DS4A 1OO0B 3JSMB 2CJBA 4Z2XA 4NLSA 2HVZA 1UJ5A 5A8RB 1HNZF 4TXSA 2Z2ZA 1FFGB 1Q8IA 2YKOA 3TI0A 1VQOS 5HQLA 2YX4A 1Q5YA 1FEHA 3UDVA 3V2UC 3SI8A 4UOGA 4IOAQ 2BQUA 4ZVFA 3C6TA 3I9V9 4C8YA 2KO1A 5L8RC 2AKWB 4NLXA 3RAMA 3KJVA 4ECYA 2JLEA 5C24A 2FVRA 4UY8T 1A6LA 2R2SA 1NSQA 1KBRA 1LFPA 5DS7A 1BY9A 5H9EJ 1K9MT 1A0OB 4A4JA 1LW0A 4USWA 3KHGA 1CS4A 2BV3A 2KRBA 3AXMA 4MFBB 4PQUB 1TK0A 2GHVC 3G2XA 2QE5A 2W2QP 3PYDA 4NLOA 1RTDA 1G2EA 3MR5A 4ILMA 4DPXA 3PR4A 4OHYA 4ZLLA 1U2RA 3A8EA 2V2QA 1T0TV 3M7VA 3QRPA 5KFSA 2VPWB 1QSYA 4ZPVR 3I9ZA 4OX9F 4IR9A 1HW9A 1AFJA 1CJTA 4ZOSA 4W4MA 1JLCB 4TQRA 2W9BA 2M88A 3MAAA 2V4RA 3VVUA 1S1XA 2EKYA 3MAHA 1D8ZA 5T14A 3T1AA 5K5MA 2VL1A 2XMKA 1RAOA 2QFIA 3HFVA 3IO1A 2J5AA 1D0EA 2AWZA 4KBIA 3W64A 1NDCA 1DTQB 4I2QB 2F4FA 4BWMA 3PG9A 3V81A 3ZZRA 2UUCF 1TUGB 3CJRA 3THTA 4NLYA 3DMJB 4PAAA 3RR8A 3OTCA 1KC8T 4RBUA 4J91A 5GAHU 3MR7A 3GIRA 2NREA 2COLA 1QDUB 2R2RA 3NNHA 1U6FA 5DQIA 3VAIA 1S9EB 3VGTA 4OYBA 4HH1A 1Z1ZA 1MWZA 4FVMA 2V0NA 2RDIA 3KDNA 2X3GA 4LF9F 1SCJB 2ZJRQ 3PY8A 2D3O1 1F9HA 3DLGA 2F8HA 2DNLA 4DL0C 4ILRA 1SJ3P 3M8QA 3OLAA 1QUVA 1NJXA 1PAUB 3N01A 4O3QA 3M6WA 4R25A 3ISNC 3ZNUA 2A18A 5E7OB 5EWGA 2HMIA 1O6XA 2YKMB 2V4JA 2DITA 7FDRA 4HEA9 3K57A 3SQOP 4LQ3A 1WG4A 2RRNA 4ANCA 2DGTA 2CNKB 4CLLA 5LL6d 4KV8A 1RTHB 3GQCA 4QYRA 3OTDA 1S6QA 2A6MA 2E5JA 3CDUA 1F6TA 2AIRB 2OPSA 2N4DA 1Q5VA 2YPZA 3CCRS 4DR4J 4USHA 1WG1A 4F4XA 3HT0A 2X1BA 1WKLA 2CPJA 1F9EB 3O3LA 5KG0A 3T5LA 3FFIB 3LUYA 3O6QA 3V6DB 2RRBA 1O5JA 3HVTB 3TANA 1I94J 3PKMA 4DR2F 3BPSP 4J9MA 3OXGA 4DPOA 2N82B 2E9RX 1M5VC 2QLWA 2OIHA 3J81U 2DJWA 5LSOA 5F8LA 3KLVA 1Q79A 2P6SA 3QO9B 2QX0A 1A9NB 1I3OB 1WKKA 3VV2B 2E44A 2VPXB 3Q22A 1FJ7A 1S10A 5HL7Q 2OPPB 2FLOA 1IM6A 4EGLA 4TY8A 2ZH3A 3D6TB 5C7PA 2JLFA 4HHUA 4LF6F 3ADAC 3HDSA 2ZD1B 4HDHA 4B3TJ 4DX8H 3OUYA 3DU6A 3CTRA 1EIYB 3JYTB 5MLCV 2OHDA 2ZJQQ 3NS5A 1K44A 2B7BB 3H42A 4RU2A 1D9AA 1HWUA 5D3GB 2YKNB 4OZ2A 1YX2A 3RTVA 1LWEA 1UW9A 3HHEA 4DL5A 1VLOA 3U27A 5DLGA 3IS9B 5HBMA 4U67Q 5BJRA 2F9JA 2HWIA 1S1VB 3EUNA 1UVIA 5J2MB 4KO0B 4WPAA 4H4KC 1FXDA 3VALA 2FGCA 4BLGA 3ETOA 2ZE2B 2EBGA 2CNNB 4JI0F 2HGLA 2K1RA 1UVNA 2XSJA 5KFBA 1HNXF 1HW8A 3GJQB 3W5XA 1TK5A 4S0MA 3OR2B 3MZIA 1WEYA 2ZFHA 4NLGA 2IVMA 2HSEB 1SC4B 1T9XA 3I31A 2Y9HA 2DHHA 1S72S 4F25A 2Z57B 3AODA 1W2IA 3MR3A 4C11B 2CJAA 1GXLA 1RAGB 1B0TA 1X7VA 2ROEA 4F02A 2FPHX 3VQTA 4H4MA 4TU7A 4OYAA 2XG8A 3N5FA 1H7XA 5E0OA 4I2PA 1KQSR 1UWBA 4KH0B 4I69A 2DGUA 2OAUA 4KTQA 1IBCB 4FXDA 3N0VA 2OEMA 4CYUA 5DDOC 4K59A 1TV6B 5CYMB 3SIPB 5J2QB 4MK7A 5KG5A 3SDEA 5D4PA 5B0EA 5GAEU 1WWHA 1KTVA 5E3CA 2IM0A 1HNZJ 2FJAB 3SZ2A 2ZUGA 4C6AA 5GMDA 4NA3A 3PW5A 5THWA 2W7OA 1SQFA 3OL9A 1R43A 2UUTA 1U0HA 1KLMB 3A12A 4LIWA 3D1QA 3R8YA 1HQEA 1WC6A 1UVJA 4DU7A 4UQGA 2H4WB 2QN6B 1A7GE 3A13A 2UUWA 2WVDA 3CIZA 1FKOA 3WDOA 5B7WA 1S1UA 3DU5A 3G8SA 3M6VA 4ZS6A 4YR3A 1LWCB 1U1LA 5RUBA 4NLVA 2YQ0A 2LQ5A 1AUSL 2O5DA 5DG7A 1SXLA 2QLFB 2YNFA 3NGUA 2NXNA 1IKWA 5EHHA 1G1XA 1C1BB 5CYQB 2DR6A 4J9UE 3KHHA 1PIEA 4OX9J 1Q8KA 3N5BA 2MKIA 4M5NA 3EPIA 3A8IA 4PG8A 1WSVA 3AQPA 5JUMA 2DPIA 3HHLD 1RHUB 3NKYA 4WBFA 3BN7A 2NLWA 5J1NA 3D0HE 3KLIB 3ZZUA 1TELA 4ZVHA 9RUBA 1DQAA 2BM0A 3D3BJ 2JOQA 3LALA 1RT2B 4QQBA 1OPZA 3T5JA 4NRTA 3M8YA 4H4OB 1CC8A 3LAMA 3NAHA 4ZJLA 3OFHA 3MCOA 1URRA 5LJ5Y 4QWEA 1KFSA 1N5YB 3L95X 3AQOA 4KB7A 2UUCJ 4FYWB 5KFEA 2FC9A 4ER8A 1FDDA 3PW4A 3C66A 4OZ5A 4K50A 4HACB 2BE7D 3QLHB 1KONA 2WAQD 1B64A 2DNGA 4ZVPB 1LXNA 5SUHA 1BWVA 3NY0A 5JJBA 4FPIA 2L3MA 1IVZA 2XB2D 4TY9A 4X65F 1P9QC 1NXIA 3I87A 1HPZA 1XR5A 1QE1A 4QW8A 3HJFA 4PYDA 4LF9J 3BGLA 3ZO7A 2ATCB 3BGRB 2B5JA 4F4AA 4DQSA 5K14A 1B0PA 5KFKA 4NYZA 1H3DA 3LGMA 5ETTA 4M5DB 4TNOA 1RXOB 4K4UA 4QU6A 2HFOA 2ZBCA 5DZ7A 3DCAA 1U1KA 3VZIA 3TX8A 1N0VC 4KGKA 1QSLA 5E5NA 5SZTA 2CA9A 2DH9A 4DUYF 1TMJA 1C1CA 3TEGA 4TU9A 1CC7A 1X5TA 3KJQB 2UVVA 2ZNYA 1S1WA 2XO6A 1P27B 1WORA 3ET6A 1CJKB 1DARA 1D09B 4I6YA 3D2WA 2X1FA 2R7UA 2EW9A 4LRBA 1XC9A 4KGXB 2GQCA 1REVB 2DK2A 4RPFA 1ULRA 1T9UA 4DSEA 3DI6B 3MM9A 4LFCF 2NUUG 1NHKL 1U24A 3ETMA 1DURA 3UCGA 2XLKA 1U1PA 2FVCA 4ZITA 3WIVA 2GJFA 4DCPB 1YJTA 4DR2J 4YB7A 4IUFA 3BO3A 2QL5B 5JMNA 1VQ8S 4P73A 2PN6A 1RAIB 1N4LA 1F60B 4PRFA 4PPZA 1RWKB 2VBXA 1FK9A 4LF6J 5IM0B 5LXYA 2J6TA 4LBHA 1M1GA 5F8NA 4DPYA 3VCDA 2XHWA 4DPTA 3J7YU 2KB2A 1VK3A 3MOZA 1X4AA 3M9NB 5GADU 1FCAA 5D0HA 1DFDA 1ZTTA 5KTQA 1FRJA 4O44A 3UQSA 4ID5B 2R2UA 4USJC 4ZVQB 2V69A 1PC5A 3FUYA 2M8HA 3QIDA 4I6AA 1VCTA 1T03B 2EPIA 1FNMA 5A76A 1QTMA 3TJ8A 2ILZA 1J5OB 1HNWF 5K8NA 1GH8A 2BJ8A 1RT4B 5B08A 2CPDA 1S1TB 1S6OA 1Q82T 4JI0J 2BOPA 2ZWOA 3NBPB 3OTOF 4OQJA 1HNXJ 3TEHB 1FD8A 2ZH5A 2JEGA 4F3OA 1WI6A 2W7PA 4JI3F 2VUGA 5FLXY 1WG5A 2BRKA 2XS5A 2YWEA 2WRMA 3GTYX 5F3ZA 4KE5A 3RAXA 4CM0A 5EWEA 5IT9U 2XYHB 1ELOA 2XWXA 3LP2B 4OI2A 3HSGA 4RW4B 1MU2A 2F4VF 4M94A 1PKUA 4QIVA 1FXRA 2MZJA 4YR2A 5F8MA 2A1BA 4WXWA 1RU1A 4O3OA 4F0HA 4DV3F 1GTHA 3MPDA 4DFKA 3AD9C 3C6TB 3CD7A 3EVMA 1JXLA 2DISA 2W4CA 2FJDB 3C3LA 3MHYA 2NZCA 4Q8FA 3FBFA 3F44A 3KJVB 1Y9OA 4K4ZA 2JX2A 2BKPA 1YRTA 5BXIA 5C24B 2FVQA 4L76A 4WE1A 1KVIA 2MMYA 2XZTB 1LW0B 1CS4B 3GFZA 3TP2A 2MJNA 2B9YA 3IC1A 2PFDA 2XMWA 2AGPA 2HAFA 1RTDB 2W2PP 3CD0A 5CCMA 2DIVA 1GEHA 3VTIA 3CO0P 4NYOA 3GG1A 3KLGB 3CD6S 1CJTB 2PEBA 5KG4A 2W9BB 2PT0A 3MAAB 8AT1B 1S1XB 3D1HA 3EMTA 4M5MA 2DNKA 5B0AA 5U47A 4NMXA 1MMLA 3THVA 1U8WA 4QPXA 1EP4A 2G4BA 3HX9A 4ZVEA 4MJKA 4E98A 5DDPC 4ZPTR 4U7UD 2RDDA 1FDBA 2VV5A 4AL5A 4OZ0A 2R7RA 1R6VA 3V81B 7AT1B 3CC7S 2JDJA 3GCWP 2C2OB 5KFPA 2R8JA 4C0OC 1YJ9S 3IRWP 2YX7A 2W2OP 4KH1B 1K1SA 1X8DA 5E33A 3PFEA 2IPOB 1MSWD 1SH0A 2J7WA 3RW6A 4JV2A 5F9LA 2ACYA 2M52A 2P9EA 4DL4A 3HZGA 1RAHB 3R5BA 3S1TA 2ZKUA 4F4YA 2IDEA 3PHEA 2HZCA 5KFYA 2AJQA 2A2DA 1SJFA 2QJ3A 3AA8A 4TVAB 1LW2A 3QT7A 2LQJA 3MDFA 3DLGB 1DQ9A 2VASA 3M8QB 5IXUA 1NK5A 5HLFA 1T9YA 1WF2A 1Q95G 4KJIA 1BWEA 1MMDA 1ZPVA 3FGVA 2JRSA 4X65J 2HMIB 3J7AN 4XDCA 2G0JA 2HNZA 5E2QA 3FBEA 1ROFA 2V4JB 5IC6B 2XMJA 1NB7A 2KT3A 2GO9A 1SL2A 2Y0SD 3FRYA 5HMXA 4M8LA 3BQ2A 5KG6A 2B8PA 4DCJB 2M3DA 4ZCLA 1VQ7S 2GA7A 5HO4A 4KV8B 1F2GA 2V63A 1U1QA 4G1PA 1Q86T 3RUBL 4RWWA 4DV2F 4FVCA 4OHWA 1M5PC 1S6QB 2HRYA 1R0AA 5ETSA 4WXOA 2OPSB 5AT1B 1Q8BA 1T7PA 4DQPA 1AROP 1RAAB 2HS3A 1EX8A 2FLLA 3GG0A 4DUYJ 3VGVA 1DHMA 3BH6B 2H5IB 2HS0A 3NWGA 4PWWA 2YNHA 3TVKA 3SFGA 2UUAF 3Q8VA 1PJ7A 4XPCA 3C19A 1S49A 4UT4A 2IHR1 4DCOB 3TAPA 2DY9A 2VBYA 2W7AA 3BBBA 1N5SA 2P2CB 4I68A 1U2CA 4TY8B 1VGYA 2E1MC 1VIOA 5J2PA 4MYTA 3PDNA 1SUQA 3OUYB 1PBAA 2FHJA 1FDAA 1RT6A 3G87A 4CDIA 1BHNA 2FLPA 4XIUA 4LFCJ 2V9KA 4PYAA 3EVWA 3B4MA 2IFXA 1LWEB 1RWOB 1D9FA 1NKEA 5HBMB 4UZBA 1EHWA 1W2BR 2EFVA 4F4KA 2I8EA 4F3MA 4L73A 3P4UB 4USTA 3LWMA 4MYUA 4TYAA 2DPJA 1RT3A 4Q2LA 1VQ5S 3S8SA 1DAXA 2QA4G 2B6AB 2K1RB 2CG4A 4E0DA 3K17A 1TFWA 4DSIA 2HNYA 2XSJB 2QTWA 4GMKA 3QT6A 1EQ0A 3MCMA 2LP4A 5KT2A 3KFWX 5D4NA 4JUZA 3DHXA 2ZHOA 4HR2A 2IMOA 3VR1A 4P10A 3PW7A 3T6JA 1JNZB 1OQ3A 2HFUA 3C16A 1ZS6A 4ECSA 2DHGA 1TKZA 1YZ7A 3AH6A 3L7OA 1HNWJ 4RJVA 2G1DA 2CPHA 1PGZA 2KG1A 1RHKB 1OIAA 2QFJA 3IM8A 2W9AA 2RKIA 5EGYA 3KXDA 4H4MB 3OTOJ 2FVSA 2YY3A 3BF4A 4DLEA 3RB4A 3GJRB 4I2PB 3CC2S 5E3AA 4JI3J 1UWBB 1JKHB 3U1LA 3PX6A 1Z2LA 4CYUB 4I67A 3NCPA 3NAIA 3HO1A 1O8BA 3KJFB 4P75A 1U4BA 2DKOB 4KHRA 5FJ4A 2F4VJ 2DBBA 1PJ5A 1NBEB 5HP1A 1RBOB 1ZM2A 2B9WA 2WW4A 4NI2A 4Q8EA 4A8MP 3W1YC 4ELTA 4AE5A 3VF0B 5A2QU 4DV3J 4IFVA 4DI6A 3PEHA 1U0HB 2KJVA 4CO4A 1FRKA 3DKDA 1IKXA 1HQEB 4ENOA 3PXGa 3UN5A 2ZVSA 5GAGI 3TOQA 1FKOB 1S1UB 5LJ3Y 3PW2A 5HROA 2BKNA 4LUBA 5HVGA 1XNQF 5DM6Q 4YB5A 4O0NA 2V2KA 2JC1A 3MEGA 4X4VA 2ASLA 4DV4F 3IFEA 3WX4A 2MHEA 4C8OA 5GAHI 2Q6BA 2IC3A 3Q8YA 2BANA 4FS1A 4A8WA 3KK3A 4RNNA 4K5RA 2YNFB 2M70A 3IAM9 2DNZA 5G4DA 4YB1P 3J81Y 3FVYA 1IKWB 1SH2A 2VF3A 3BSAA 1URNA 3LO3A 1DY3A 2BVZA 2R7SA 1YRUA 2ZBPA 1RTIA 5KFXA 1FX4A 3I0SA 3PRDA 2FYXA 4DN0A 2W9CA 3PHTA 1WC4A 2CXEA 3ZXWA 3PRBA 1K1QA 1M5KC 3SMZA 2PFFB 5HK4A 4EBDA 1Y4ZB 3BGFA 3D0IE 5KOXA 3C15A 2XCAA 3ENWA 4KFBA 3HD1A 2GQ2A 5HJYA 1XNRF 2CJ9A 2CQBA 5KFNA 4X4SA 4DSFA 1TL4A 1VJQA 4NASA 1XMOF 2I5JA 2KYXA 2G2YA 4EO8A 2EI5A 3WC2A 3DXBA 3H4BA 1EAYC 1CSJA 3M9MB 3LPEA 1HPZB 2IBOA 1QE1B 2DD8S 4IR1A 3F41A 1CPZA 2J0XA 2BYCA 4RBTA 2G13A 1SBRA 1NPKA 2B5JB 4YMEA 3PEJA 3B4DA 2MGZA 4N7TA 5K14B 2RNEA 3R2CJ 5HI7A 4LVOP 2V8GA 2KT2A 4CLZA 2PA3A 3U02A 1WTFA 3FBCA 3CF5Q 3F73A 2FY1A 5D6GA 2DXFA 2N3LA 1ZM9A 2CQHA 2HWTA 1VBZA 2K3IA 2Z30B 3M2VA 1HQUA 1DZ5A 1C1CB 3HK2A 2I38A 4LFBF 1I51B 1OS5A 4RO0A 4GVBA 4YHHF 1S1WB 1OMSA 1PYSB 4C97A 3CCJS 3J7A1 2QGFB 4FF3A 4DV2J 1UFLA 4QIGA 1VK8A 2PGCA 2ZZNA 3ET6B 4LSLA 4DUTA 1UZDA 2APOA 3CJ8A 5KG7A 5L1IA 1WEZA 2KFYA 3OL8A 2Z2MA 3TA2A 2LQBA 2D9OA 2GX8A 2RB7A 1UEKA 4G1IA 2A10A 1OSDA 2FQQB 3ZZYA 2HHSA 2MPUA 1HHSA 4ETXA 3MM9B 1AFIA 2AJ4A 3MTJA 4USUA 2UUAJ 3ZZ0A 2F7VA 2EFNA 1YBUA 1VQKS 3H90A 3PW0A 4ES3A 3MCSA 2MKHA 2MZQA 2HQFA 2W25A 1HNIA 2RQ4A 5KFJA 4DPUA 3CJKA 5LMUF 2O3DA 3K5LA 2JVOA 1Q0NA 1FK9B 3WX8A 2IM1A 2QMWA 3E51A 4HH0A 4RWXA 2IRUA 1KN6A 1X4EA 5A0YA 1AZSA 3D28A 1FO1A 1B99A 1NKBA 4IH6A 4CLPA 4O44B 5C2CA 3CJQA 1RA7A 2NXCA 3N6MA 2QMXA 4NLWA 3QNWB 4USVA 4LRAA 3M8PA 4QWAA 1HLWA 5FIIA 1U6BA 3B6BA 1GNKA 1OWXA 1N6QA 1RZMA 1V6HA 4UTGA 1XERA 3JTOA 4BWJA 3IR6B 1S99A 1X31C 4Y0FA 3BPDA 2NXEA 2JFDA 1HARA 5GAEI 3NGKA 2RH3A 1S4FA 4ATNA 4RNMA 4Q7AA 5EDWA 5BR8F 4CO2A 2FJEB 4IRDA 2ZH4A 2VB6A 1Q81T 1HYSA 4WKRA 3Q2SC 3AOBA 1KTQA 3EPGA 1QTNB 4PABA 5ETLA 3GYGA 2WCXA 5DJBA 4ZPCA 4PUOA 4NZ7A 2WVFA 1MU2B 4G1QA 2D41A 2XQCA 5KT5A 1JNRB 1GX6A 4MMOA 3QAEA 5DRKA 2W4PA 4RUCA 2DT9A 1S6PA 2WW8A 2DB1A 3NEKA 1UFKA 1QVGR 1UW4A 4OL8A 3CT9A 1JB0C 3DDNA 3DM2A 1JQGA 2BX6A 4OLOA 2DNOA 2GIRA 2XMUA 4B9NA 4LBIA 1S12A 4Y2MA 3NOCA 1RJJA 4WE1B 1VRTA 2UUBF 2GHWA 5HVHA 3X3UA 1SPBP 2ROGA 2ZITA 4CIOA 2AGQA 1GMWA 1LK5A 3TJAA 2W8LA 4ZMMA 4DJBA 3VAGA 2WBRA 3HKZD 2NQPA 2ROPA 1KNZA 1S0VA 2FHMA 4KGMA 2CQ3A 1XQIA 2OFHX 1HBUA 2GNKA 4ZJOA 2JHEA 2R7VA 4HLBA 3SSQA 2QV6A 3CMES 3Q23A 2UVUA 1XNQJ 5IFMA 1RACB 2VZ9A 1XWLA 2H3EB 1H6KX 3CJ3A 3ZFVA 1TR0A 1JWWA 4OJ3A 4DV4J 3RBZA 4N47A 5J1EA 2VODA 1EP4B 2MKKA 2J6UA 2LA4A 2GCFA 5HQ8A 3HHDA 2F1FA 2HZAA 3R5CA 1KQFB 3HHNB 3AJDA 1R6YA 4CLFA 2ZBRA 4DUZF 3NCQA 3FRZA 4KIAA 4QYZK 1EJ7L 1WUUA 1N5QA 4LF5F 1F1BB 2VJVA 3W63A 4FYVB 5KFLA 1T11A 5CAAA 2JNJA 4IH7A 2HQGA 3HMJG 1T3NA 2J6SA 1B0VA 3NL0A 1XNRJ 1JIHA 3MUMP 1LW2B 2HHTA 3OTEA 3ZZPA 2OMLA 1XMOJ 2W8KA 3J80Y 2LA6A 4TLQA 5HLFB 1S0OA 2BXJA 4WIIA 3PTWA 2HG4A 3M8ZA 4B3RF 2UXDF 3DDIA 2JC0A 2VICA 3PIPQ 1TL3A 2HNZB 2XMAA 3UDCA 4I4BA 2XTJP 4K8RA 4KYZA 1EQMA 1TTHB 3UW1A 3QGIA 3N28A 5IT9Y 4QZVB 5DQHA 2XS7A 3MMCA 2CJXB 1NK8A 4BS2A 1UMJA 1WTBA 4O4RA 3A4TA 4R8UA 3PACA 5F8GA 3ZTQA 2AU0A 3EVOA 1R0AB 4PEOA 4DBQA 5F41A 4IRKA 2V9WA 6FDRA 4UUWA 2EG2A 2FHJD 3UDLA 1GK8A 2JEIA 4YQWA 3KG0A 2V5HG 4DU8A 3MM7A 4CH1A 1CG2A 3AD8C 3QZ7A 4CLKA 3QWUA 1P9YA 1KDNA 1LK7A 1H7WA 2KVQE 1AUDA 3FK4A 4RR5A 4LFBJ 2YNHB 3DN9A 3NGRA 1QLNA 3FQKA 1V9OA 1Q8LA 4YHHJ 2DNMA 2AW0A 3DLKA 3HZEA 1R89A 2VFRA 4YS2A 3D6MB 5KFWA 4C8LA 3MPYA 2HBYB 4DFJA 4B9UA 2OI2A 4LF2A 3K5NA 2OPRA 2WSEC 1WJ9A 4PXDA 1Q4RA 5J2PB 3ZZOA 2CQ0A 2ZC3A 4WTOB 1G7CB 1SUQB 2ZC4A 4UOHA 2LCWA 1SKRA 5BYRA 3EX7B 2G1HA 1EZZB 1RT6B 3D68A 2NZ4A 3WQPA 4QCLA 5KOWA 4DV7F 4CTAA 3MTKA 3HPOA 1KWMA 3T1HF 1VQ9S 2MY7A 3HVAA 2W01A 4A48A 2J9CA 4CZCA 4OJ1A 3ELHA 1I1GA 2CFXA 3KLEA 5LMUJ 3VAHA 2RHSB 2DIUA 1HD1A 2G0IA 2HGMA 4HHJA 5HJXA 3WIUA 2XEXA 3S01A 5E3PA 1QJHA 1RT3B 2KDOA 1WELA 4XK8C 4ECXA 1FRLA 2MLYA 2AJ0A 4Q0BA 1UVMA 1WC3A 5IV4A 2HNYB 1RADB 3NG8A 3DHWC 1V3SA 1X9SA 3ZTOA 1RHMB 1K8AT 4MIAA 5KFMA 1FE0A 4YUDA 2CJQA 3IWLA 2U1AA 2RQKA 2B4UA 4H4OA 3TAMA 3TNVA 3G6YA 4U8YA 1RHRB 3C16B 3DLHA 3OHBA 4F36A 3MUVP 4EYIB 4Q2MA 5FLXU 1QAXA 3ZZTA 2MQQA 4ICLA 1U49A 1K0VA 2XLIA 2RKIB 3TA1A 3G82A 3J7ZT 3UE2A 4ZLPA 2D3UA 4QYZJ 1X4DA 5BR8J 3M30B 5D78A 1OY9A 1S48A 1C4CA 2XS2A 4USKA 1YBTA 2CYYA 2M0GB 3M1VA 3Q83A 1M1KT 5F3TA 2ZOGA 4C9DA 1NK0A 2VDIA 4RW7A 3TO8A 4CLTA 4NZ6A 3IA0A 2BZ2A 2C3YA 1RKIA 3PYFA 4V19X 2KXNB 5J2NA 1JLGA 5LM7E 2A3JA 4IRCA 5HP1B 2E5LF 2JFKA 2K3KA 4F4WA 4NI2B 2W1BA 1NK6A 2UXCF 3GB0A 4IFVB 4HL9A 4QIEA 4ZP9A 4M95A 1ITPA 1U7LA 1CLFA 4Y2CA 2R8GA 3GMGA 1IKXB 3CSKA 4Y65A 2MKYA 2DH7A 3W3SA 1NPRA 3KG4A 2ZDPA 5HROB 4JV0A 2RUSA 2A2CA 3KWMA 2RQCA 1MWQA 2WOMA 4V19J 2MSTA 4P72A 3J81j 4DQIA 3BSCA 2UUBJ 2KHDA 4RKUC 1TFYA 3MEGB 4LVNP 3RRHA 3DLBA 3BKFA 3MMBB 2HQCA 2GFFA 3EM1A 2DTJA 1TL7A 2IC3B 1HI8A 2FVPA 2NXUA 2BANB 3KMQA 3KK3B 3K5MA 4LR9A 3RRKA 4Q43A 3CW2C 1LV5A 3IG1A 1TU0B 2DGOA 3QGHA 1XR6A 2V8PA 2ERRA 3I55S 5AE3A 4YFUA 1YJ7A 1RTIB 2PC6A 3UNYA 4ZLNA 2MSSA 3I0SB 2HHVA 1NDLA 2GZOA 2DO4A 2W9CB 4L6V3 4EBCA 2CVEA 2VG7A 2PEHA 4U9RA 1FKAF 4Y2IA 4N76A 2HK2A 4OV1A 1Q16B 3NWRA 4ZIWA 4P7TA 4OYIA 3HFZB 2JWNA 2V34A 4B9LA 3TWZA 3C15B 1X9MA 5KFAA 2BJ1A 2N3OA 5A6WA 4Y6IA 4DG1A 3I4PA 3W5YA 2YQ1A 1YHQS 1V3ZA 3RRGA 4ZVTB 4ID5A 4PR6A 3CPWR 1KOOA 2MEWA 3MF5A 2FZKB 1UCNA 4UQTA 4G65A 1D1UA 4DUZJ 4B9MA 2I5JB 3OFGA 1YZ6A 1YJRA 2HBRB 3LQVA 3RJMB 1ZYQA 5B0CA 2DHXA 3IXQA 3QMQA 4LF5J 3BDEA 3I96A 2QA4S 2LXFA 4I1TA 2Y0BB 4URQU 3FNNA 3QPIA 3FMBA 4DFPA 1L3SA 1OYDA 2PMWA 4PXBA 4FYXB 1RTJA 2GVZA 1S7HA 3DLEB 3LGHA 3CO9A 4RX6A 2BOAA 2VPZB 1PBUA 2VC1A 2MGZB 1X9WA 4ECZA 4WF9Q 2MQNA 3D7SB 4YY3F 4DL6A 5LMNF 3VAJA 1YI2S 2E7VA 2MQPA 4BDPA 5CXTA 1R8CA 4B3RJ 2UXDJ 2B43A 1C0TA 1H74A 1Q7LB 2POKA 3M2VB 1HQUB 3LGNA 1F3FA 3GJSB 2AGOA 1FRXA 4MK8A 4E2FB 2WZ1A 2EC2A 2P5VA 3ISND 1TAUA 4Z7CA 1UVKA 3MM5A 5GMEA 2GQQA 1N36J 2VFUA 4GVBB 3LP0A 4DEZA 4FF2A 5B0FA 3SV4A 2V50A 2EK6A 3BBFA 3S7RA 4OI0A 1UPPA 4I0WA 4LSLB 4B3MF 3UDEA 3HULA 1R0BG 1L5UA 4EU0A 2YKPA 3DNCA 1IBLF 5KFRA 4B02A 5A2QY 2Q66A 1HHTP 1JJ4A 3UN2A 1JLAA 1LWFA 2BJEA 5KFHA 4AYBD 4YN3B 4NEYA 1FT8A 4WIQA 3HFKA 1APSA 2E9ZA 2C3UA 1L3TA 1X0FA 1IQZA 5L39A 2B4OA 1IR0A 1RAEB 1RLCL 1D9DA 5CD4A 1T05A 2D9PA 3O8WA 3U1MA 4N5SA 2JEJA 1HNIB 2YNGA 3PX0A 1YDLA 3CJKB 3KLGA 4Y2KA 4HYKA 2XHCA 1FD2A 2MXYA 3PR5B 4B9SA 3EXYA 5JVGQ 2EKNA 4EEYA 4PG6A 1HNVA 5A0YB 1AZSB 1WHYA 2IVYA 4YDXA 4CNYA 1UP1A 5F0UA 2Z8QA 2AEJA 4DV7J 3ZNJ1 2GS8A 3PJ9A 1NHUA 4X4NA 5GAGU 4RNHA 4KRWA 1YLXA 3EXCX 3M8PB 3T1HJ 1N6QB 2CPZA 3G8TA 2MB0B 4QWDA 3BM7A 4RW8A 4DSLA 2KVIA 3BQ1A 1S97A 3QRQA 3OSPA 2FB0A 1HA1A 4L75A 2DGQA 2MDAA 1PG5B 3HVWA 3CCZA 3CC4S 1MLAA 3CJSA 4CO3A 3VGUA 1VRQC 4M5LA 2HQIA 1X5PA 2ABYA 2BJ9A 5A8WA 2XMVA 2IM3A 2L9WA 2VHGA 3EGVA 1FF2A 1HYSB 2RS8A 1VQLS 1FTRA 1SJQA 3IM9A 1IWAA 4PUOB 1GMWD 1GQEA 4G1QB 3ILIA 3MURP 2HFNA 5DGBA 3W8PA 2YQ3A 4M5JA 3G6ES 1S6PB 2E29A 3VQSA 1N48A 4LT6A 5B09A 4K4TA 2R8HA 1LKZA 1IM4A 4DDFA 2V8DA 3MR6A 1H98A 4DFMA 3DM2B 4TU8A 1RT5A 4WP8A 4J9VA 1TQLA 2HBZB 3MAQA 1TAQA 3PM9A 2RVJA 5IZHA 2ZVIA 1Z4UA 1P8GA 2I0XA 2R8KA 2WK4A 4CLWA 2KYZA 2F40A 3MMAA 1VRTB 2CPIA 3JSRA 3AY0A 3KG1A 2HPUA 3B54A 1R8AA 2E5LJ 5K8OA 1VQMS 4ID8A 5M2RA 2YH0A 4FXVA 4LF7F 2ALZA 5ETMA 4DQQA 1NB2A 2UXCJ 1JJHA 1HI0P 3QZ8A 3N4WA 4CLSA 1YG0A 2J7KA 2L48A 2DEJA 2VFVA 1B70B 4NEZA 2C2DA 2QLBB 2EFGA 3D6FB 1HBUB 4DR7F 2J9EA 5K8MA 4AUKA 2HVHA 2VOOA 3MR2A 2BE9B 1JMTA 2BKOA 5MAOA 3KKFA 1RAFB 3GIMA 1UA0A 4B9TA 4LQ9A 3P49B 5J1EB 1NNDA 3E2EA 2EK1A 4CO5A 3IN5A 2E5HA 4LRFA 4I7FA 3PYEA 2F5GA 4FBUA 2WONA 3F56A 3P6YC 2AJFE 4KR0B 3W61A 2VKRA 3TA0A 2ZM6F 3G96A 4FN5A 2DRAA 2HLTA 2Z0GA 2ZBIA 2FY8A 3BH7B 3CMAS 2A0FB 3JQMA 1MMNA 3KLHA 1BGXT 3N79A 2EVZA 2OEJA 4M5HA 3Q8QB 1NO8A 1OSCA 2IYGA 3D3CJ 2B9XA 3EZ5A 4LRCA 3G9CA 3BR9A 2F8MA 3S6EA 4DOZA 3W9IA 3WZ0A 2B6AA 3AB4B 2BRLA 1CBKA 1RQ0A 3DRXA 1R8PA 4MH8A 3MEDA 5EWFA 4CLUA 1X4HA 3VHQA 5I3UA 3H0PA 4ANDA 4H54A 5CCLA 3OPKA 2BUNA 2CPEA 1SB6A 4NE9C 3H40A 3D66A 3HKWA 2ZHBA 9ATCB 3H2UB 1CJVA 2L41A 3H98A 5DGAA 3E8OA 2HHXA 1TL3B 4DR3F 4ES1A 4N56A 4LF4F 4GRSA 1VFJA 3P45B 2K2PA 4RW9A 4NXNF 3MMCB 1RCXB 4ELVA 4C2MA 2BR0A 2QMUB 1JKHA 4R8UB 2RF2A 2AYBA 3KDOA 2GAHC 3MD3A 5KFDA 4YY3J 5LMNJ 3DRPA 2OTJS 2Z58B 2ADBA 2OSQA 4XTTA 2DNQA 4JI5F 1RWPB 4W92B 3TUZC 3BKTA 3DGPA 1FWLA 3MM7B 2ZNZA 4ZN3A 1U2FA 1NEEA 2ZH7A 3IMQJ 1S4EA 3GSDA 4P9SA 1ACMB 2GHPA 3R5JB 3HSDA 3DLKB 2KG0A 3BREA 4B3MJ 3IAS9 3D9BA 3OD2A 4OHXA 2OMOA 2WBMA 3PZPA 1IBLJ 2OPRB 3Q24A 3CD5A 2AJ2A 1U25A 1FE4A 2E1PA 2C3OA 1YRXA 4L3NA 5CA5A 4IYQA 1IJEB 1RWXB 4ES2A 2KHCA 2JZ5A 5K20B 3NMRA 4CTAB 2HZVA 3C14A 3SCKE 1WI8A 3PKYA 1GAOA 1SV5A 2VIHA 2BW2A 3FJ2A 2AJ1A 4BC7A 1U0SA 3QSIA 3KLEB 2HURA 3K8VA 3M8WA 4DZ6A 4JYAF 4LIRA 2D3OR 1S79A 3TZYA 3W2VA 4C3MA 4DR6F 2R7QA 3SCIE 2W2NP 3GR1A 1N32F 1IQTA 5KFQA 4Q0BB 3L4BC 2HHPA 1RAJA 3UR0A 1M0SA 3SQGA 3IBFB 1FX2A 2MKSA 4CM2A 2ASDA 2RSQA 3TAMB 2R9LA 4ZVUB 1ZTWA 1H2TZ 2KKHA 3RU0A 2G2OA 3G6VA 3NP5A 2VDHA 2RHQB 3FZBA 4F2SA 4ICLB 2YKQA 4OIXA 1IBKF 5D4OA 3G8QA 3ICLA 3BYRA 2AZ1A 1JLQA 2M5YA 3G82B 1OQ6A 4X66F 1YWXA 2MQ8A 1F9FA 2DGWA 4LF8F 4G3IA 4IO1A 4ZN1A 3LPYA 3M8RA 3DRRA 5DO2A 4GO7X 3RBEA 3M1VB 1VLYA 4RU9A 1SL0A 2ZEJA 4RW7B 4HHHA 2EC0A 3ENQA 3PFOA 2CNOB 1HIYA 1HHQA 3CDEA 3P5TL 1JLGB 5J2NB 4NXMF 2XGPA 3R9LA 3V4MA 1TVRA 2HQDA 3M2RA 3OR1A 2IIHA 5DDQC 2I6WA 1IR1A 1YVFA 3T41A 1RYRA 1WEXA 4HKQA 3QFWA 2WVCA 1ZETA 4ZP7A 2ATLA 3P96A 1T9WA 1WF1A 2QT7A 2VKZG 5HQMA 5AJ3F 1WACA 1NCLA 1P1LA 4USMA 3KUEA 2WOMB 4JV1A 3HHLA 2QSFA 4ZP6A 1ZM4A 3IBWA 2DEIA 2L9DA 3W2WA 1JLBA 5AXLA 1PAEX 2IY5B 4ECQA 4LF7J 4A8XA 2H5EA 1N5TA 1TL7B 2J9DE 3OVSA 4FYYB 2V94A 1N52B 2R7OA 1FKPA 4F0KA 1JJCB 3FBBA 1JX4A 3A8JA 4Y00A 2FJVA 3EZUA 3IG1B 5I42A 2Q43A 3KLFA 2XULA 2FZCB 4DR7J 3OJUA 4EZ6A 5CABA 3H7HB 3T6BA 1KQKA 5K8PA 2B51A 3EGWB 5HMZA 2ZZMA 2VG7B 5CZXA 4KKOA 4MKAA 3QGGA 5ETPA 5GVQA 3VVTA 4OX6A 1XBWA 1WSRA 2IJRA 1HR0F 1X0PA 3FCWA 1J2VA 4ED3A 2YXLA 3CIMA 1S59A 3T1YF 1FWPA 4TN2A 4CI0B 4OHZA 3CDWA 2H4YB 4DG1B 3UD3P 2NCKL 2Q6CA 2QA1A 1RHQB 3KK2A 4CH7A 3R27A 3TYTA 2ZM6J 1SC3B 4RL1A 2XWYA 3H8YA 3D0GE 4FNHA 3AA9A 2HFVA 2AV5A 2BBEA 4Z7YA 2P6TA 2QC3A 1AA1B 2K06A 4PWDA 2KRRA 3J80U 1SJ4P 4PG4A 4WU3A 5F8JA 4MAKA 1RTJB 2GVZB 1U1MA 2VBZA 1TMMA 5I3QA 3GYXB 3C6UA 4P71A 3WC0A 5JXSA 4IG0A 4B3OA 3FSYA 2LVWA 3OFEA 1FVSA 1TKXA 2OSRA 2I9SA 4K2XA 3KUHA 4DQRA 3P8BB 3E01A 5AE2A 3RR7A 2XM3A 4OJHA 1U47A 3A3PB 3R6LB 4C98A 4RNFA 1C0TB 2G9OA 1X4CA 2AEFA 4DR3J 4R5PA 3FC9A 4LF4J 2H1YA 4OYPA 2WSCC 4X2BA 3MM5B 4YOEA 5ETOA 3CJ4A 4NXNJ 3K8WA 3LP0B 2XSFA 4OZLA 2E1CA 2B0GA 1N34F 3MCNA 3LWLA 1N8RT 1MROA 3PJWA 5AXNA 1PSDA 4U95A 4JI5J 2XMTA 4L3KA 4NLDA 2NR0A 3QJPA 1SC6A 2IA0A 4R0JA 2ZOMA 1NKCA 1JLAB 1LWFB 2FJBB 2R7WA 4Q5VA 4OV6A 3H4DA 1HBOA 4CO1A 4UUXA 3RGIA 1MW7A 2YPYA 1TUWA 4EO6A 4J9LA 3CE8A 4RNOA 5HANA 4F67A 2B56A 5ETVA 1KVJA 3R5GA 4C3KA 2QL7B 1T05B 4X62F 4ZHRA 2CNLB 3QIPA 2IJNA 2YNGB 1SQGA 2HFZA 1FRHA 1SVDA 1H2VZ 4PCQA 2LYVA 1HNVB 4LRDA 2CIMA 1F5BA 1SKWA 2E7WA 3BGUA 3SSRA 2ASYA 2YWWA 1NJIT 1CEZA 2EWHA 1M5SA 3PIOQ 1FA0A 4N8NA 2P8IA 3ULHA 1R8BA 2DGVA 1T02A 2IJFA 3EJMA 4RW8B 3JS9A 4JYAJ 4DR6J 1YBAA 3CNQP 1HBNA 3BS9A 1N32J 4QWBA 2VA3A 4CCHA 4X4QA 4FS2A 1X4GA 2XZWA 2MY8A 2VFTA 3CWJA 2GIFA 4DV1F 7FD1A 4JI6F 5A8WB 2N7CA 2CJKA 3ZC4A 3LH2S 4QR2A 2CAJA 1UZHA 2J0WA 4K0KF 3W7BA 5HVFA 1U1NA 2C22A 3G4SS 2JJ4D 2XNQA 5HAOA 4OYMA 3TVZA 2JL9A 5KG1A 5DQGA 1Q7YT 3UPFA 3EWGA 4DX7A 3FDSA 3G86A 4OI3A 1SQEA 1IBKJ 2PDAA 4X66J 1BC6A 4DR5F 2J9DA 4LF8J 1FNOA 3W62A 3PJXA 4V1Ak 1TL1A 2ZOFA 4KY3A 5C42A 4OYXA 1I5OB 2C3MA 5I3PA 1YSJA 2XMMA 1RT5B 1N56A 4GC7A 2IM2A 4JP8A 2LDIA 4WP9A 3TX0A 1VC6A 1LEOA 1FERA 5LSLA 3MMAB 4AXIA 2IYIA 3HI9A 4YDDB 4ECWA 4NRUA 4NXMJ 4PQAA 5KT6A 4AL7A 2CQ4A 1NM2A 4PWUA 3BO4A 1Q78A 4CQ1A 1LXJA 2QA2A 4EUVA 1HWKA 4DWIA 2IDLA 3FZ2A 5ITHA 2AQ4A 4HT7A 4CNZA 2DCLA 1MG7A 1M5HA 5AJ3J 4X4UA 2Y8WA 2B7CB 4NZ0A 3EE3A 1W26A 1EKRA 2CKWA 4W90B 2FZGB 1M5OC 1R3NA 2HS4A 4K5SA 3M05A 4FYDA 1U45A 2C2NA 4LFAF 2EFOA 1R27B 1DLOA 4IH5A 4NOHA 3TQEA 4I7FB 1HMVA 3UCUP 3B8HA 2WONB 1L3UA 3OQ2A 2AYMA 2XCPA 3GJTB 3R7BB 3IWNC 3MFHA 3FEZA 3ZTRA 4GKJF 2CZ4A 4IDKA 4CH0S 3DRSA 1XTZA 3ISZA 1NHVA 3NOGA 3HCXA 3KLHB 4JI8F 4Y28C 1GMVA 2NXJA 2HQ3A 3GV5B 2O1PA 3I5AA 2FHOB 1HR0J 2IA6A 4RUBA 2O01C 2HWHA 2N7YA 3MECA 3T1YJ 2IVFB 1SH3A 2B8QA 5KG3A 3BO2A 3JQJA 5FD1A 3D67A 2WVBA 1CQNA 1GXUA 1T3OA 4QIFA 3MEDB 3DOKA 4GKKF 2QG9B 5I3UB 4C7QA 1RABB 2PMZD 1V5VA 4NLRA 4WFZA 2EFPA 4ILLA 1L3KA 2HIQA 2KXHA 1S6UA 4LSNA 1RDRA 1NJWA 4WZMA 2Y1JA 3IR7B 2R3VA 3NRBA 4C8KA 4OJGA 3OXFA 1VHFA 1CJVB 4LJMA 4ELUA 4DMZA 2ZJPQ 2W24A 5M2PA 3H25A 5HATA 3M30A 4RW9B 1TL5A 1OY6A 3MM8A 2AX0A 4NA1A 4DSKA 3HT3A 2RF2B 3CJ5A 3O1LA 2IRXA 1ZH5A 1TP7A 1NSAA 2HVDA 3DRPB 2F9DA 1NUEA 3R1HA 4QOTA 4A46A 1DTTA 5L1KA 2HNDA 3DGPB 4F8RA 3RW7A 2F63A 3KTQA 4MKBA 3OT9A 2P9GA 1S5ZA 1ZAWA 1VS3A 2ZHAA 1S76D 2C2ZB 3KNAA 3QSYB 3BKUA 3I5BA 4NA2A 3M8SA 5DG9A 4P2FA 1WC1A 3N9UC 5DETA 1N34J 3CDAA 4JV5F 4YR0A 4MKYA 1XMBA 3QT8A 2BQRA 1S9GA 3EYZA 1FJGF 2X7IA 3PVXA 4KHMA 4M63A 3H5XA 2IMWP 1H38A 4TKTA 2DVIA 5L38A 3H20A 1NU4A 4QJVA 4Y3CA 4C0BA 1N33F 3MMBA 4O3NA 5LXRA 4F3QA 2CPFA 2BJ3A 1PCAA 1VI7A 1RYSA 1UAWA 3C14B 2DYAA 4IQXA 2HGNA 4ZCKA 3TUPA 5KT4A 4X62J 3VWSA 1SV5B 4MIWA 3NGDA 3GCXP 4U7UK 2KT5A 4LSZB 5HMWA 1S9FA 4F50A 1SIZA 3FCHA 4N77A 2MJUA 3NMAA 5F9NA 4X64F 2ZZTA 3W2VB 2KFNA 4DX6A 1X5SA 3BSNA 1IXKA 2DH8A 2MYFA 2GIQA 3RB0A 2PD1A 4BC9A 1VRUA 4OI1A 2GVDA 3Q89A 1IUJA 1R0CB 4UOCA 3SQGB 4QIWD 2WVEA 3RAQA 3AXKA 3GZ7A 2CRLA 4J9QA 4QPTA 2E7XA 5E3RA 1VBKA 4WFBQ 1ZPWX 3CB4A 2LEPA 1QAYA 1UKUA 4MIBA 3OSNA 2YWHA 4HVZA 4OZ1A 1JLQB 3H5UA 3V6HA 1IKVA 3FEYB 5D4LA 2MTLA 3TR5A 4NL5A 3T3FA 1ICEB 5KFZA 1L3VA 2J8SA 4DV1J 3DRRB 5IV3A 4JI6J 1S7IA 3V6KA 2AT1B 3SXLA 3LP1A 4ECRA 3TW0A 3W9JA 2R2TA 1D8YA 3DLEA 1HI1A 4K0KJ 5L1JA 1WOSA 1EETA 4RUAA 4ZA1A 3GU0A 2VOPA 1TVRB 4NCBA 4AFFA 1F5AA 2RE1A 2VU5A 2PI5A 3M2RB 3O44A 4DF4A 2HBQB 3OR1B 4DR5J 3T19A 2MZTA 1N5VA 2MLXA 1QM9A 3BQ0A 1T9TA 3LW5C 2QL9B 1OY8A 2W4DA 1PJ6A 1B7FA 3MEEA 2VPYB 2XYPB 2YWKA 3FQLA 5EX0A 4OLPA 2NUHA 2H48B 2MKCA 3UVJA 1BLUA 3OV7A 5CH7B 4AQYF 3LF0A 4PXCA 2J0SD 4DXLA 3BV8A 1SKSA 5T41A 3HHLB 2CQDA 3W2WB 1NLKL 2KZZA 1JLBB 3DOLA 4LBPA 4WJBA 3PNIA 1T95A 2E66A 2YWFA 1FKPB 1G6BA 2UU9F 2QEXS 2OP5A 3CCUS 3AD7C 3X1LB 1FJEB 3JTPA 2B4VA 3CJ2A 1NPPA 3DC2A 3T5KA 4IFYA 3KK1A 5I42B 4ED4A 4WCEQ 3KLFB 1IKYA 1JLFA 4QBUA 1KD1T 2DNHA 4NCGA 2DNYA 1N0UA 3PCOB 3PO5A 2LEAA 3R1LA 2HFSA 4KKOB 3J7Z5 1FTCA 3H5SA 1FWKA 2CWKA 1RUSA 4R0EA 3SFUA 3MOJB 1RB0A 4JI4F 4KC5A 1SL1A 5D0RA 1FJCA 4LFAJ 3OVBA 3UO0A 2GJIA 1GT8A 1FRMA 4WFYA 4YB6A 1PYOB 4WK1A 2DRBA 3CULA 2KI2A 3KK2B 1CULA 3FKBA 1XN9A 2IRYA 2ACMA 3DGVA 3HLUA 1KKHA 4GKJJ 4O3PA 5AE1A 3A1YG 2IAJA 2AD9A 2BJ7A 2RIJA 4KGZB 4DF8A 4JI8J 2C2KB 1BE4A 1SJ1A 1X60A 2CG8A 2Y3YA 4PWDB 4EWTA 5IQ6A 5M2UA 2FUG9 4Y34A 3SYZA 2ZBQA 4JI1F 1VYAA 2RILA 3CCLS 4MTPA 2GMJA 5LOQA 2CADA 3CCQS 1VMBA 2YNIA 1HL6A 2XGQA 4EZ9A 3UWTA 1JXVA 3HHLC 2X1AA 4GKKJ 3C6UB 2YKAA 1J5EF 4UZCA 2I2YA 1XMQF 4NWBA 3NGTA 4IG0B 4B3OB 5IT4A 3K5PA 2Y1LB 3MFIA 3ONQA 4K7QA 3US5A 1TKXB 3E01B 4CT9A 1P6TA 5L46A 4KHPF 2V2VA 3AJ1A 5DZ6A 1NAQA 2MKJA 4R5PB 2OLWA 2CDQA 3G71S 3OXLA 1EARA 1VHIA 2AEMA 2GV1A 3I82A 3K59A 3QT5A 2GJ2A 1VC5A 1RBLA 5DLFA 2KJWA 1DJ0A 2BA9A 3TJ9A 4HTIA 1EKSA 1B7YB 4IG3A 4PG7A 4BHQA 4F26A 4KGVB 1MROB 5T7LA 4LR8A 1JLEA 3EGZA 5IWAF 3L7PA 4ED1A 2NYIA 2H65B 3N6NA 2YH1A 1CVJA 3JXOA 1WKJA 1U02A 3L9ZA 4J9KA 1E6YA 1HBOB 1ZOTA 3HM9A 2WTFA 2QZ8A 3M4XA 1Q53A 3M32B 2MZ1A 4NLTA 3R5DA 2MZSA 5G0RA 3P5BP 2D7SA 4ZHRB 1KRPA 4P7VA 3JAMU 1I6JA 3QIPB 1X4FA 4CT8A 4JV5J 3B82A 3GV7B 5LSRA 4ECUA 1TK8A 4P2SA 2C1EB 1FJGJ 3LA0A 4DV5F 2F8EX 2DY1A 4UF4A 4J37A 1UA1A 2QLJB 2K7KA 3VGSA 4TQSA 2OD6A 3SV3A 1ZZNA 4RW6A 3LTOA 2HYIB 1N33J 4K4SA 2C2RA 2X3DA 5AXMA 3UD5A 3AFGA 2X51A 2VQFF 3ZZZA 1J27A 4DV6F 3ZTPA 4JI2F 1SIWB 3T9NA 2RU9A 1VQ6S 2E5GA 5C25A 2CQCA 2YX1A 2VBWA 1HD0A 4X64J 1UFWA 2QYCA 2ZKTA 8RUCA 4J9RA 4F4ZA 1HBNB 1S0NA 1S57A 1IJFB 2J0QD 2X1GA 4ZDNA 1XEZA 1YJVA 3BDPA 2VD3A 2LQ9A 2XNRA 1OYEA 1RCOB 1F2HA 1BUXA 1W7WA 4C8NA 3ILOA 1K73T 2MZRA 4EYHB 2OH2A 3GONA 2E1RA 3ITHA 4NLUA 2NSCA 3AHPA 2C3PA 1RE1B 2RS2A 4J9PA 1RLDA 2BACA 5H1SV 2IBKA 4Z37A 3Q86A 4UW2A 4C4WA 1TL1B 2DRDA 4NLPA 5C42B 3EICA 1DRZA 4YP3A 2UVRA 2CJYB 4A8YA 1NK4A 3M2UA 3DOMA 2HEKA 4ANEA 2PSZA 5GMKa 1W25A 2FJXA 1N36F 1RBAA 1H72C 3KNGA 3MD1A 1G3OA 4L72B 5J1PA 3KJNB 4X4PA 3T5HA 3IRXA 3A8KA 3OL6A 1HQ2A 5FDLA 1NJZA 5C2GA 2VFSA 3L3CA 2K8GA 3QRRA 3CEDA 1Y10A 2JEFA 2MQOA 5D0EA 2HHUA 2CQIA 4P74A 3IGNA 3DFEA 3V6JA 4K2JA 4U7CA 4C8MA 3IP0A 3NS7B 3CMQA 3KYLA 4KPCA 1U1RA 3PO4A 1NZAA 4DR1F 4NMLA 3KHRA 2R7TA 1RT7A 1WOPA 4AQYJ 5L9XA 5ETNA 4U96A 1WDTA 2M2BA 2CUYA 1JXEA 2CPYA 3MM6A 5CHCB 4PKDB 1Z2ZA 3TVYA 3SCJE 3POTA 4O0IA 4DV0F 1BQMA 1DLOB 2DXEA 5ETQA 2UU9J 2P9CA 2C2EA 5E3QA 5C5JA 4HI2A 1GFWB 1HMVB 1RA6A 1ZA1B 2XY7A 1KFDA 2MHNA 3D4JA 2LEBA 1UEVA 2DR5A 2KM8B 3OTBA 1T94A 4IDKB 4XAKA 3DRSB 4AXJA 4A8SA 4RUHA 4OZNA 2CWXA 3T9ZA 4O3RA 5BYSA 2WB1D 2HVEA 4JI4J 5B0GA 3CXCR 3MECB 3R6GB 1YJWS 4ERDA 4ITSA 4DHVA 3NGSA 2HKEA 3DLLQ 5IC4B 2I1RA 3NS6A 2XO7A 3DOKB 1YK9A 1Y11A 4ZPWR 2ZUAA 5EN1A 1UJ6A 1KEKA 5CD4H 4ZP8A 2Q3PA 2CQPA 2J7UA 4OFZA 1MN9A 4LSNB 3ZTSA 2R8IA 1RWUA 2PA8D 3CJ0A 3H5YA 4DL7A 1WHVA 1HBMA 5KFCA 3I0RA 2Y8YA 3U1NA 4ZVOB 4WTYA 4QR0A 4JI1J 1WC5A 2DR7A 2OUGA 4DN9A 3BJYA 4J5OA 2OJ3A 4ALZA 5B0BA 3FSIA 2QYGA 4HT5A 2DGXA 5A8KA 3MM8B 1H0HB 1RP5A 1J5EJ 1C0UA 4O4GA 4QR1A 1XMQJ 3D1OA 2BE2A 2KXFA 2QLXA 3TUIC 2FLNA 3GV8B 4EI2A 2HVIA 1M1HA 2ILYA 3MEKA 5K9FA 2F3JA 1DTTB 2UV8A 3RB6A 1MWYA 4QU7A 4KHPJ 4JI7F 2HNDB 3H2VE 4WYLA 4MT1A 4OYOA 3FMWA 4BCAA 1QAJA 1NH8A 1RU2A 3DDKA 2KM8C 4C8ZA 2KFZA 2ZWPA 1N88A 4AL6A 1Y7PA 2RRAA 2LXIA 2VG5A 3FCVA 4OZ3A 3R5AA 1EB0A 1FXLA 1WD6A 3EDRB 3SEOA 2HRUA 1S9GB 5IWAJ 2DHAA 4A8FA 1QY7A 4I6WA 4B3SF 1KS2A 2QO3A 3GFXA 1D3WA 3L09A 4ZLJA 5BYQA 3RG6A 2NSBA 3DYAA 2OPQA 2B4PA 4EBEA 2D3ZA 2LU2A 3CCWA 4FBTA 3OJSA 3ILLA 3UN3A 3QATA 4F04B 1KVKA 4NYPA 1GMUA 3R2DJ 2BMBA 2AF6A 1YIJS 3QBCA 3SDEB 3GIJA 4EMDA 3PX4A 5H9FK 2ADCA 2VA2A 4ED8A 2JVRA 3C8YA 3D6HB 4DV5J 3QGPA 2BDPA 4Q44A 1NMEB 1Y3KA 1O0PA 1WHXA 3V4IA 3B78A 2CQ1A 4OHVA 1VRUB 3ENVA 3W65A 2GVDB 1RHJB 2BEFA 1UEUA 2VQFJ 5F8IA 4EK2A 4DV6J 1VQ4S 1WDDA 2VG6A 4JI2J 3AT1B 2U2FA 3I56S 5L9NA 3WBZA 4M5KA 3EDQB 4N8OA 3LANA 2PO4A 3DRYA 2FD2A 4JB8B 3CUNA 3OVAA 2OKQA 4DL3A 3I4HX 5HSPA 2H51B 3QJJA 4M5IA 2BABA 1IKVB 2V4QA 3CCVS 4HI1A 1ZAVA 2G2ZA 1FHTA 1X5OA 1HFEL 3PYGA 1U48A 2UV8G 3NLCA 1AT1B 3LP1B 2L9NA 4ECVA 1QUPA 2ZH1A 4I56A 5EUHA 1RWMB 1EETB 4ZIVA 3CCES 2RJZA 1R7IA 1PO6A 5KFIA 4CRJA 3MWBA 2AP6A 4ZVRB 5F0WA 5HN0A 1YKWA 4KSEB 4WZQA 3QWPA 3BEGB 1UTAA 1XK8A 3BYPA 4LREA 1QD1A 1HWJA 3RBXA 3HP6A 4FZVA 1YTYA 3U7JA 4ECTA 1UVLA 3GP9A 2Y1IA 2CQGA 3AOAA 2CZ9A 4F0MA 3TRGA 5L1LA 3MEEB 2OEKA 4DZDA 3I6PA 1T8EA 4NPOA 1AXQA 3KHLA 1WF0A 1RT1A 4M5GA 2D1CA 4WWSA 1ZZFA 2C2MB 3UVJB 4J9NA 1NDPA 1LOUA 1ZM3A 1FEEA 1KSPA 4B17A 3HXMA 1FFWB 1K0TA 4WFAQ 1TKTA 4XDDA 4ED7A 1CJUA 3DOLB 2QSWA 1VOMA 1VJWA 1FRIA 4DPWA 4YEAA 2JSXA 4DS5A
chains in the Genus database with same CATH topology
2AU0A 3UI3A 4PXEA 3GE9A 3RZAA 4X4RA 2GGPA 1V3RA 3KHHA 1YBAA 1HBNA 1R0AB 4JBCA 1HWIA 3BS9A 4DBQA 5F41A 2OO4A 4QWBA 2VA3A 4CCHA 4X4QA 4FS2A 3N5BA 4IRKA 2MKIA 2V9WA 1X4GA 2M9KA 3C46A 6FDRA 2XZWA 4UUWA 2AYGA 2EG2A 3EPIA 2FHJD 4IFYB 2MY8A 1Y0HA 3UDLA 4C3LA 3KK1B 4PG8A 2JEIA 4YQWA 1BQNA 3KG0A 2VFTA 1IKYB 3CWJA 1JLFB 3AQPA 2V5HG 5JUMA 4DLGA 4NCGB 2DPIA 4DV1F 3MM7A 3HHLD 7FD1A 4CH1A 3NKYA 4JI6F 5A8WB 2HHWA 3BN7A 2NLWA 2N7CA 5J1NA 3D0HE 1CG2A 3KLIB 1E6VA 3ZZUA 2CJKA 2VONA 3ZC4A 3QZ7A 3LH2S 3JSMA 1JJ2R 3QWUA 3NNCA 4QR2A 4ZVHA 3I5CA 2QRRA 1DQAA 1LK7A 1H7WA 1AUDA 2J0WA 2BM0A 4K0KF 5A8RA 1XR7A 2JOQA 2WB4A 2YNHB 3DN9A 3IWXA 3LALA 3W7BA 1RT2B 1QLNA 3FQKA 1U1NA 1V9OA 1Q8LA 4QQBA 1OPZA 3G4SS 3T5JA 2C22A 2JJ4D 2XNQA 3TVZA 2LECA 2M8DB 2DNMA 2JL9A 4NRTA 2AW0A 5KG1A 4H4OB 1CC8A 5DQGA 3DLKA 3LAMA 3HZEA 3NAHA 3OFHA 1R89A 1Q7YT 1URRA 5LJ5Y 2VFRA 3UPFA 4QWEA 2WSFC 1KFSA 5KFWA 3FDSA 1N5YB 4C8LA 3L95X 3Q8SB 3AQOA 3MPYA 4KB7A 4DFJA 3G86A 4OI3A 4B9UA 4WK3A 5KFEA 1SQEA 2ZH9A 2DR9A 2FC9A 2PDAA 1FDDA 1BC6A 4X4OA 4DR5F 3TAQA 3K5NA 3PW4A 3C66A 2J9DA 4OZ5A 1NJYA 4K50A 2OPRA 2WSEC 2EBEA 3QLHB 1FNOA 1KONA 4BBYA 4PXDA 2WAQD 1Q4RA 5J2PB 3PJXA 3ZZOA 1B64A 1TL1A 2CQ0A 2DNGA 2ZC3A 2ZOFA 4OZJA 1LXNA 1G7CB 5SUHA 1SUQB 2ZC4A 5C42A 2LCWA 2C3MA 5JJBA 1SKRA 5BYRA 5I3PA 3EX7B 1YSJA 1RT6B 2L3MA 2NZ4A 2JH3A 2IAJB 2XB2D 3NNAA 2XMMA 1RT5B 4TY9A 1N56A 4X65F 1P9QC 4QCLA 1IN0A 5KOWA 4GC7A 2IM2A 4DV7F 2B3TB 4NX9A 4CTAA 2HHHF 1F0XA 3MTKA 2LDIA 3I87A 1HPZA 1XR5A 5H9FJ 1QE1A 3HPOA 2RD5C 1VC6A 1FERA 3CVKA 4QW8A 3T1HF 5LSLA 1VQ9S 3HJFA 3MMAB 4AXIA 2MY7A 3R3TA 1KOHA 4MFBA 2CVIA 3HVAA 4PQUA 4A48A 2IYIA 2J9CA 3HI9A 4YDDB 4CZCA 4ECWA 2BQ3A 3BGLA 4NRUA 4OJ1A 4PQAA 5KT6A 2OD4A 1I1GA 2CFXA 3KLEA 4AL7A 2CQ4A 3BGRB 2B5JA 3VAHA 2DIUA 1HD1A 4DQSA 2HGMA 4HHJA 4PWUA 2XEXA 5K14A 1B0PA 5KFKA 3BO4A 4NYZA 2YNIB 1H3DA 5A6PA 3S01A 5E3PA 3VAKA 3LGMA 1QJHA 2J8AA 4M5DB 3CDBA 4TNOA 5CZVA 1RT3B 1Q78A 2KDOA 4CQ1A 2XBPA 1WELA 1PC4A 2Z2LA 4XK8C 4K4UA 4ECXA 4QU6A 1BD6A 3JSYA 1FRLA 2HFOA 3CCTA 2E9TA 2AJ0A 4Q0BA 1LXJA 2QA2A 4EUVA 1UVMA 5IT0A 2FDNA 4WFXA 1JLCA 2ZBCA 5DG8A 2HNYB 1HWKA 2M7SA 3NG8A 4DWIA 2ZH6A 1KR4A 3FZ2A 3MMJA 5ITHA 3DCAA 2AQ4A 1TUVA 3DHWC 1VQNS 1V3SA 1X9SA 4HT7A 1U1KA 3VZIA 4CNZA 3TX8A 1FVQA 2DCLA 1FESA 1GX5A 2GMLA 4OX7A 4MIAA 1K8AT 1N0VC 1FE0A 4KGKA 5KFMA 1M5HA 1QSLA 3Q2TC 5E5NA 4YUDA 5SZTA 2CJQA 4FP9A 3IWLA 2DH9A 2U1AA 4ZCIA 3BR8A 4DUYF 4X4UA 2RQKA 3HF5A 2KN4A 2B4UA 4H4OA 5KT3A 1U6ZA 1C1CA 2B7CB 4NZ0A 3TAMA 4TU9A 1HWLA 3TNVA 1CC7A 1X5TA 3G6YA 1NK9A 1H2UX 2UVVA 1YJUA 2CKWA 2ZNYA 3DLHA 1S1WA 3OHBA 2KZMA 4W90B 3MUVP 4MK9A 2C28A 4EYIB 4Q2MA 4ZPDA 1M5OC 1QAXA 1R3NA 2HS4A 4EFAC 4K5SA 3M05A 5CYJA 3ZZTA 2MQQA 1DTQA 1P27B 4I2QA 4FYDA 4I64A 3VAMA 1U45A 1NK7A 1SI9A 1TKDA 4ICLA 3OLBA 4WU2A 4LFAF 2EFOA 4Q45A 1R27B 1U1OA 1U49A 1K0VA 1DLOA 1DARA 4IH5A 4I6YA 3D2WA 2X1FA 2XLIA 2R7UA 2RKIB 4NOHA 3TA1A 4I7FB 3J7ZT 3UE2A 2EW9A 4ZLPA 1HMVA 2D3UA 3MXHP 4QYZJ 3UCUP 4PPDA 1XC9A 3DMJA 3B8HA 2WONB 1L3UA 3OQ2A 1X4DA 2AYMA 1RISA 2PE8A 3M30B 2XCPA 5D78A 4U6PA 2GQCA 4IG3B 4XO0A 1REVB 3IWNC 3MFHA 1S48A 4LMZA 5T7LB 2DK2A 1JLEB 1C4CA 3FEZA 1ULRA 4GKJF 2XS2A 4XPEA 2CYYA 2CZ4A 2O67A 4IDKA 2M0GB 4CH0S 3M1VA 1M1KT 3DRSA 5F3TA 4DSEA 1XTZA 3DI6B 2ZOGA 3MM9A 4LFCF 3ISZA 1NHVA 2NUUG 4C9DA 4O23A 1U24A 1NK0A 1DURA 3UCGA 1S9EA 2XLKA 3KLHB 4JI8F 4RW7A 3TO8A 4Y28C 1U1PA 4A8QA 2FVCA 2AX1A 2HQ3A 3GV5B 2O1PA 1YJTA 3K58A 3I5AA 4NZ6A 1E6YB 4YB7A 2RDJA 3IA0A 4IUFA 1GTEA 2FHOB 2BZ2A 3VZHA 3BO3A 2C3YA 2IA6A 1RKIA 2O01C 4V19X 2KXNB 5KFUA 4IO9Q 1VQ8S 5J2NA 1JLGA 2HWHA 2A3JA 2N7YA 2VQEF 4IRCA 2PN6A 3MECA 5HP1B 2E5LF 1N4LA 2JFKA 2IVFB 1F60B 2K3KA 4F4WA 4WKYA 3RBDA 1SH3A 5G0RB 2ASJA 5KG3A 3BO2A 4PRFA 5FD1A 4PPZA 1NK6A 2UXCF 2VBXA 3GB0A 2CZVC 1FK9A 4IFVB 4HL9A 1CQNA 1GXUA 4QIEA 1T3OA 4QIFA 4ZP9A 4M95A 5IM0B 1U7LA 3MEDB 5LXYA 4Y2CA 2J6TA 1CLFA 2R8GA 3DOKA 5IS2A 4GKKF 3GMGA 1IKXB 3CSKA 5I3UB 5F8NA 3FSXA 3VCDA 4Y65A 4C7QA 2XHWA 3J7YU 4A8OA 2PMZD 2KB2A 1VK3A 3MOZA 4NLRA 1X4AA 4WFZA 2EFPA 3AB2B 3M9NB 5GADU 4ILLA 2XY6A 1L3KA 3KMSA 1FCAA 1KQGB 2HIQA 2DH7A 1S6UA 2KXHA 1RDRA 4LSNA 1DFDA 1NJWA 4WZMA 3W3SA 1ZTTA 5KTQA 1FRJA 1LFWA 4O44A 3UQSA 3KG4A 3IR7B 2Y1JA 2YKMA 4ID5B 2MQMA 2R2UA 4USJC 1PC5A 4RW6B 2M8HA 2HAIA 2ZDPA 4H4KA 5HROB 4ZPBA 2XI3A 3NRBA 4JV0A 4C8KA 4OJGA 3OXFA 2A2CA 3KWMA 2RQCA 3QIDA 4I6AA 1VHFA 2WOMA 4KQZA 4V19J 2MSTA 2BJDA 1SJRA 1T03B 4LJMA 4DQIA 4ELUA 2EPIA 3BSCA 4DMZA 2ZJPQ 2W24A 1FNMA 2KHDA 5M2PA 4RKUC 1QTMA 2UVWA 2ILZA 1TFYA 3MEGB 1RTHA 4LVNP 1TZ0A 3H25A 3RRHA 1J5OB 3DLBA 3MMBB 1HNWF 5K8NA 2GFFA 1GH8A 2ZDOA 2DTJA 1RT4B 5B08A 2IC3B 1HI8A 3M6XA 4URSA 2NXUA 2FVPA 2CPDA 3M30A 3OL7A 2BANB 1S1TB 4RW9B 3KMQA 2EG1A 1TL5A 1S6OA 3KK3B 1Q82T 3K5MA 2PI4A 3MM8A 1S77D 2AX0A 4NA1A 5C25B 2BOPA 3IR5B 4DSKA 2XC9A 3RRKA 4Q43A 3NBPB 3OTOF 3IG1A 3HT3A 5DM7Q 2DGOA 1LV5A 2RF2B 3CJ5A 3QGHA 3O1LA 1XR6A 3UR3C 3RB3A 2IRXA 1ZH5A 1TP7A 4OQJA 1C4AA 2ERRA 3E3XA 3I55S 5AE3A 4YFUA 1FD8A 3DRPB 2ZH5A 2JEGA 4F3OA 2F9DA 2DNPA 1WI6A 2W7PA 4JI3F 1RTIB 2VUGA 5FLXY 2Q1LA 1WG5A 2BRKA 2PC6A 3R1HA 4FF1A 4QOTA 1RGVA 2XS5A 2MSSA 1Y5IB 2YWEA 4A46A 1DTTA 3I0SB 3MI7X 2HHVA 2WRMA 1ZAXA 2DO4A 3FFIA 5F3ZA 4KE5A 2W9CB 5L1KA 3RAXA 4L6V3 4EBCA 3V6DA 2CVEA 2HNDA 2PEHA 2VG7A 5EWEA 3HVTA 4F8RA 3RW7A 5IQQA 1VQSA 4U9RA 1FKAF 1ELOA 4Y2IA 2XWXA 3KTQA 4N76A 3LOUA 1OPIA 3LP2B 4MKBA 4OI2A 4OV1A 1Q16B 4Y2AA 4RW4B 2P9GA 4P7TA 1MU2A 3GFYA 1ZAWA 3QO9A 4M94A 3JSBA 1VS3A 2F4VF 4QIVA 2ZHAA 2JWNA 1FXRA 1S76D 2MZJA 3KNAA 4TLRA 4YR2A 5F8MA 4B9LA 4QWCA 1X9MA 5KFAA 2A1BA 3I5BA 4NA2A 3GWCA 4WXWA 3ITHB 1Y00A 4O3OA 2N3OA 5A6WA 4Y6IA 4DG1A 5DG9A 3I4PA 3M8SA 2OPPA 4DV3F 1GTHA 3N9UC 5DETA 1YHQS 1V3ZA 3V5RA 2RMLA 3RRGA 3CDAA 4DFKA 4JV5F 4ID5A 2ZD1A 4GO5X 4YR0A 4MKYA 1XMBA 4PR6A 3CPWR 2LMIA 1KOOA 1S9GA 2BQRA 3LAKA 3MF5A 3C6TB 3CD7A 3GIIA 5B0DA 3EYZA 4K4VA 1FJGF 4UQTA 4KHMA 4M63A 3PVXA 3H5XA 3JYTA 1JXLA 2DISA 2W4CA 2FJDB 2IMWP 1D1UA 1H38A 3C3LA 1UJ4A 4B9MA 4TKTA 2I5JB 2UXBF 3MHYA 3OFGA 2DVIA 5L38A 5D3GA 1YJRA 2YKNA 3H20A 1NU4A 4QJVA 3LQVA 1ZYQA 2SXLA 4FNIA 4Y3CA 5B0CA 4Q8FA 3F44A 4C0BA 3KJVB 1Y9OA 2DHXA 4K4ZA 3IXQA 3QMQA 2JX2A 1N33F 3BDEA 1YRTA 3MMBA 3I96A 5C24B 3P3DA 2QA4S 2LXFA 4O3NA 2FVQA 5LXRA 3M2UB 4F3QA 4I1TA 3IS9A 4URQU 4WE1A 3FNNA 3QPIA 3FMBA 2CPFA 2HLUA 1KVIA 1VI7A 1RYSA 4DFPA 1L3SA 1UAWA 4IQXA 2HGNA 1S1VA 2GMHA 4OI6A 2MMYA 4ZCKA 5J2MA 1LW0B 4PXBA 4KO0A 5KT4A 3VWSA 1SV5B 3GFZA 4MIWA 3NGDA 3TP2A 4U7UK 2KT5A 3Q8PB 1RTJA 1S7HA 4OX8A 3IRXB 2H9ZA 2MJNA 3DLEB 5HMWA 1S9FA 3BN4A 2B9YA 3CO9A 5FDLB 4RX6A 3IC1A 2NPIA 4F50A 2XMWA 2ZE2A 5KFGA 2NPFA 2AGPA 2VPZB 1SIZA 3FCHA 4N77A 1RTDB 2VC1A 2MJUA 2MGZB 3AJ2A 3NMAA 5F9NA 1X9WA 4ECZA 3CD0A 4WF9Q 2MQNA 4X64F 5CCMA 2LLZA 3W2VB 2DIVA 2KFNA 3VTIA 2GC8A 4YY3F 4DL6A 5LMNF 4NYOA 1X5SA 3BSNA 1VC0A 3GG1A 1IXKA 3OR2A 3KLGB 3VAJA 1YI2S 2DH8A 2MYFA 2MQPA 1Y5LB 4ZVGA 4BDPA 4UY85 3CD6S 5KG4A 4ZCMA 5CXTA 2GIQA 4JOUA 3RB0A 1R8CA 2CPXA 3UNGC 2LU1A 2PD1A 4BC9A 2W9BB 1VRUA 2PT0A 1S1XB 4OI1A 3D1HA 3QJLA 2DHSA 1IUJA 1C0TA 2B43A 4UOCA 3SQGB 1Q7LB 2POKA 1IBMF 4HDGA 3M2VB 4QIWD 1HQUB 3LGNA 2AGOA 1X4BA 2DNKA 1FRXA 3M9OB 1RT7B 4MK8A 3RAQA 5B0AA 2P5VA 3ISND 5U47A 4B08A 3GZ7A 1TAUA 2CRLA 1MMLA 1UVKA 4TYBA 3MM5A 3THVA 4A8KA 4J9QA 4QPTA 4QPXA 1EP4A 2E7XA 5E3RA 2G4BA 3HX9A 2GQQA 4C11A 2VFUA 4ZVEA 4MJKA 3BB5A 4WFBQ 4E98A 1ZPWX 3CB4A 3LP0A 3MM6B 4DEZA 2LEPA 4FF2A 1QAYA 1UKUA 4MIBA 5B0FA 5DDPC 4ZPTR 3SV4A 5KFFA 2XY5A 3OSNA 1FDBA 2VV5A 2YWHA 1DBDA 3POTB 2EK6A 4AL5A 4OZ0A 2R7RA 3S7RA 4WYWA 1BQMB 2C42A 3V81B 4RBVA 4OI0A 4I0WA 4LSLB 2LDYA 2VH7A 1VQPS 2UP1A 3CC7S 4B3MF 2JDJA 1YGYA 4HVZA 4OZ1A 1JLQB 1L5UA 1C2PA 5KFPA 1GXTA 4EU0A 1KHWA 2YKPA 3H5UA 1QSSA 3DNCA 2R4FA 4RZRA 1IKVA 3FEYB 3V6HA 4C0OC 3JAMY 1IBLF 5KFRA 4B02A 2R8JA 5A2QY 1YJ9S 3IRWP 2Q66A 2YX7A 5D4LA 4WFNQ 3TR5A 4N41A 4NL5A 2E5IA 3OW2R 1K1SA 3T3FA 1X8DA 1TV6A 1HHTP 5KFZA 1L3VA 5E33A 1JJ4A 3TUJC 5CYMA 1JLAA 1LWFA