5D4PA

Structure of cpii bound to adp and bicarbonate, from thiomonas intermedia k12
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
102
Chain Sequence
AIKLYPLKKLEIILEGAHKEFATDLLDRAGVKGYTIVGNLSGKGSHGMYEGHLMDDALIMIIAAVPEELVGPLLEGFQPFFEAHSGVVFVHDIQVGRPIKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Putative Nitrogen regulatory protein P-II GlnB
publication title Structure of CPII bound to ADP and Bicarbonate, from Thiomonas intermedia K12
rcsb
source organism Thiomonas arsenitoxydans (strain dsm 22701 / cip 110005 / 3as)
total genus 18
structure length 102
sequence length 105
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d4pA00
2Z0GA 3CE8A 4USJC 4C3MA 3T9ZA 4CO5A 4CO2A 2GW8A 4USIA 2RD5C 4D3GA 1V3RA 2XBPA 4WK1A 5D4OA 4Y6IA 2VD3A 2V5HG 3MHYA 1NAQA 4D3HA 1UMJA 2J9DA 4CO4A 4OZNA 1O5JA 2NUHA 2XULA 2EG2A 2J9CA 4Y65A 3GSDA 4E98A 4NYOA 3NCQA 3M05A 1VHFA 2CZ4A 4C3KA 4RWXA 3L7PA 3NCRA 1V3SA 4RX6A 3TA2A 3AA8A 4IYQA 3TA1A 3LF0A 3NCPA 1HWUA 4NYPA 1V9OA 1J2VA 2GX8A 3O5TB 1O51A 3AH6A 2EG1A 1NH8A 3DFEA 3N5BA 1OSCA 4C3LA 4ZK7M 2J9EA 4OZJA 5DRKA 4YB7A 3X3UA 1UFLA 2XZWA 1Q1KA 3HLUA 1H3DA 4USHA 1VFJA 4CO3A 3OPKA 4OZLA 1UL3A 2PIIA 2NUUG 1QY7A 4YB5A 1P1LA 2DCLA 1V6HA 3AHPA 2JJ4D 1XK8A 5L9NA 2O66A 2ZOMA 4R25A 1KR4A 4CO1A 4YB6A 2E66A 3AA9A 2O67A 3O8WA 5D4LA 2ZFHA 1PILA 5D4PA 1UKUA 4WK3A 4AFFA 1NZAA 5DS7A 3TA0A 4CNZA 5D4NA 2NS1B 1GNKA 4RLEA 1NH7A 2GNKA 4CO0A 3BZQA 4CNYA 2XG8A 2J9DE 4RWWA
chains in the Genus database with same CATH superfamily
2J7KA 1VBZA 4ECXA 2C1EB 5THWA 2CJAA 3N01A 4PCQA 4K4SA 4OJGA 3RBDA 3UWTA 3RW6A 2W9CA 4UUWA 4Y2KA 2XSJA 2RU3A 2B43A 3OL9A 2ZEJA 3TVZA 4IRCA 4DFJA 2PSZA 1C0UA 2CNOB 1HR0F 4DV7J 3C2PA 3QQCD 3J7YI 2GHWA 4O4GA 3E2EA 2HPUA 3FBFA 4OZJA 1NRKA 4K4VA 3H59A 1U1LA 4WYWA 1NLKL 1VQ7S 2MZTA 4FYVB 1G3OA 1SJFA 5EHHA 1UA1A 1KTVA 4ZJOA 5KFGA 4O3RA 3Q24A 2ZDOA 2VZ9A 1O8BA 4G6VB 4N77A 4DR7F 1VK8A 5AJ3F 4EBEA 4HACA 5J1EB 2VBYA 5MAOA 3TI0A 5DS7A 2VBXA 2VG6A 2BKNA 5F8HA 4I2PB 1UVKA 3RRKA 3FRZA 3PACA 1B3TA 1TU0B 1VR6A 1YIJS 1FWLA 1AUDA 2D41A 5KT6A 2DRBA 1TFYA 5KT7A 2J7UA 2RE1A 2P6SA 3HO1A 2DNQA 4XO0A 3ISNC 3THVA 3SCIE 3QPIA 4URGA 3BV8A 4O0IA 3V4IA 4OYBA 2P9EA 4JI7J 1C1CB 5E3PA 4DV0J 2FLOA 3PY8A 3J80U 3V6JA 4ES1A 3NNHA 2XQCA 4ZK7M 1NJWA 4FF1A 3SFGA 2HNDA 1GMVA 3LP1A 1WD6A 4M5DB 3NAHA 5I3UB 1N48A 1N33J 3MDFA 1FRMA 2V9WA 4DV1J 1HBNB 1TVRB 3F0NA 3KK1A 3POTB 3CJ8A 1D1UA 3TJ8A 4DEZA 4I7FA 3PKMA 4CLWA 1T7PA 4K59A 3H25A 1ZM4A 3OR2A 4M95A 1CJVB 5DQIA 4C6AA 2XG8A 2VQEF 1BUXA 1PC5A 1TKZA 4IFYB 4YEAA 1RYRA 1LXNA 4HT5A 1T02A 1LQ9A 2HHXA 1OJ4A 1DTTB 1LWEA 2QA4S 2Q6CA 1Q8KA 1CS4A 3P3DA 5AXNA 4XPCA 3P49B 1NKEA 2W2PP 3NWGA 5F8GA 3EICA 5HROA 3D6FB 3DLKB 1RLCL 2VFTA 1MWYA 5RUBA 1REVA 3IG1A 3TZXA 5JVHQ 4Q43A 1Q1KA 4ZIVA 3AOBA 3PR5B 3CTRA 1FRIA 4A8FA 3C16B 1R6YA 2PIIA 3A8JA 4OJ1A 1FVSA 3KWMA 2ASYA 4IRKA 2WZ1A 3BPDA 4IO9Q 3HI9A 3LAKA 4RPFA 2J76E 2LEAA 3T1HF 4CLFA 2R2RA 5F3ZA 4K4WA 5D4LA 4U7UD 3ZTQA 1S1WA 3TA0A 4FBUA 2YKMA 4DL0C 2HMIB 3VWSA 1HPZB 4LFAJ 5I3PA 2QFIA 5CYQA 2HEKA 4AXIA 1NUEA 4PYDA 3M30A 3PR4A 2HHWA 1NPKA 4B9UA 5ETNA 1MMDA 3D2WA 3IM8A 1QAJA 1KOOA 1ZAVA 3AODA 2MKIA 1RTDA 4KRWA 3WBZA 2NUHA 5KG5A 3QZ8A 1D09B 4I4BA 3A8EA 2J6SA 1WEXA 4FBTA 2BANB 4Y2IA 3UD5A 1IWGA 3EM1A 3ET6A 3NLCA 4IYQA 2HLTA 2MHEA 1B70B 2J8SA 4IFVA 2LDYA 4F4ZA 1XIQA 4OLPA 4ZVEA 4BBYA 4WXWA 4DFMA 1AB8A 2QYGA 2YNGA 4C0OC 2AYBA 2Y9HA 1GTHA 4OHZA 3C6UB 5IC4B 5J2NB 4WP9A 8AT1B 4MIWA 2LXFA 1PG5B 1FJ7A 5KG7A 1Z2LA 5L9NA 2GMHA 4JI3F 4DUYJ 1SV5A 2JSXA 3MXHP 1HBUA 1JQGA 2DGSA 1FX2A 2KYXA 1ZZNA 5CYMA 1HLWA 4YS2A 4Q5VA 2CPIA 4CO0A 1DAXA 2C2NA 1UVNA 3D3BJ 1ZAXA 4CO2A 5CH7B 1X5OA 5B0EA 1Q16B 1SUQA 3BQ2A 3D0IE 3VGUA 3RBXA 4ALZA 2VFVA 4UTGA 2WRMA 4B3MJ 3QAUA 2EC2A 2GHVC 4P2XA 2V2VA 3KHLA 1SKWA 1S4FA 2HHSA 2VOPA 5KG3A 3T3FA 3QLHB 1EHWA 2HW3A 1SJQA 4WFAQ 3PX6A 2DNGA 5JMNA 2HVIA 1UJ6A 3M2RB 2HQ3A 1VJQA 4UOGA 2RDDA 2M7SA 2ZDPA 1S57A 2CQ3A 5DQGA 4YQWA 4L72B 3MPWA 4EK2A 1WI6A 1FE4A 2IC3A 1HNWF 1DARA 1TL4A 1Y10A 3LQVA 1UJ5A 1VJWA 4IDKB 2AJFE 3WC0A 1IR1A 2GNKA 5GAGI 2AX1A 4WTOB 4DPUA 3OUYB 4LREA 2GA7A 4PQAA 4CLYA 9RUBA 1HA1A 4JI4J 1WF2A 2ZJRQ 1X0PA 1PC4A 4DSFA 4CH1A 1S12A 3CJKA 1YHQS 2DKOB 1XNQF 2ZNZA 3C66A 4EFAC 4LRFA 3KUEA 1UA0A 4X4VA 4DZ6A 1HWUA 1RAHB 2WSCC 3KG0A 1GX6A 1SKSA 3TNVA 1VK3A 2Y1RI 2BVZA 5IZHA 4DUZF 4GKJJ 2UXCJ 1Z2ZA 4S0MA 2Y0BB 2FY1A 2KO1A 4OMFG 3OSNA 5M2UA 2V8PA 2YQ0A 4L3NA 4LJMA 5HMZA 3D6MB 4R25A 1ITPA 2F9JA 2JEFA 5JJBA 2E5GA 5EDWA 3OVSA 2R7WA 1UVJA 3KJVB 3I82A 3KK3B 3HD1A 2WSFC 5HMXA 5HAOA 4HHUA 3ETMA 2GVZB 3KK2B 3MM9B 3PNIA 2Y8WA 2RAQA 1PIEA 3KDNA 2RKIB 5EUHA 4ZCIA 2LQ8A 5KT3A 3MD3A 3ZO7A 2UUAF 4DV4F 4JI8F 3CCSS 3T19A 3M6UA 4Y34A 1IXKA 1KVJA 2P5VA 4J9MA 2VG5A 1IKYA 1WTBA 2E1CA 3J7AN 1UPMB 1VRTA 3WHIA 1VIOA 4TU8A 3CDUA 2NR0A 3U27A 1MW7A 3CD7A 4WIQA 2U2FA 2EEYA 3PIPQ 2X1FA 3T1YJ 1B7FA 5FDLA 3HHKA 2OH2A 5DGAA 2CZ9A 3EPIA 4ED6A 2Q6BA 3MMAA 4DR2J 3G82A 3HHLB 4F4YA 5GMDA 3M8WA 1Q95G 3PFEA 2KG1A 2JLFA 3W8PA 2OI2A 3BGRB 4J9VA 4ZN1A 4FF2A 1RQ0A 2HWIA 4F4XA 4WKRA 2X3GA 3ZTOA 1JLFB 2WBMA 1FJGF 1RCXB 3VF0B 5KFRA 4IH6A 3UD4P 1XR6A 3W2WA 4M5HA 4F25A 5BYQA 3S8SA 3D9BA 2CPXA 1ZOTA 3VZHA 1WUUA 3IXQA 1LWCA 1AUSL 3NCQA 5H9EJ 2AU0A 4LMZA 3DGVA 3JAMY 3HJFA 1Q82T 3PVXA 2BUNA 1UEVA 3NCPA 1LW2B 3E01A 1KLNA 3TAMA 1SC1B 2KG0A 3UDCA 5EGYA 3D4JA 3WX8A 2C3MA 3N4WA 4M5KA 2XMUA 1VRUA 1UEUA 3QMQA 4A8QA 3EVWA 1M5SA 2G2ZA 4JV1A 1DFDA 2I9SA 1XK8A 1MMLA 1UFWA 4N41A 3PHEA 2ATLA 2N7YA 1SL2A 1ZAWA 2ZE2B 1IBMJ 1RHJB 2N3LA 3W1YC 2DHGA 1FJCA 3M1VA 4MFBA 2VC0A 3TJ9A 1CEZA 4OV1A 3HPOA 2AGPA 1YLXA 2ZOFA 4F02A 1DBDA 5A6WA 3TVYA 4B3OA 1FESA 2QL9B 4WWSA 4D3HA 2PN6A 2C2MB 2XMAA 1F9EB 2LLZA 4LFCF 2LMIA 3PYDA 3U1NA 1Y3JA 1WELA 3KLEB 4Y00A 4O44A 2LU2A 3ZTRA 4C8ZA 2XCPA 4HI1A 2BM1A 1CG2A 2A18A 1FWKA 3QGGA 3SCKE 1VC5A 3MFIA 1HBOA 1RJJA 2UXDJ 2B6AA 5B09A 2K1RB 3KLHB 2W2QP 2HS3A 1FEEA 2DNPA 2F4FA 3PW5A 3CJ4A 2MMYA 5HBMA 1HIYA 3CDBA 3HVWA 5F3TA 4LBHA 3JTOA 3GYXB 4N7TA 7AT1B 4HH1A 1RHMB 4K4TA 1CBKA 4DXLA 2CWXA 1RAJA 3R7NB 4X66F 1U1KA 3MUMP 4RKUC 4RO0A 2QL5B 2YWFA 1VQNS 1YK9A 3HVTB 3F44A 2MY7A 3R6GB 2F8HA 2XULA 5KFZA 5DG8A 3I5CA 3EZOA 2A6MA 2AJ0A 2YXLA 1L3TA 3TA2A 2PE8A 4OFZA 1TELA 2WVEA 2HQFA 4V19X 1U6ZA 1HNXF 2O01C 2D3O1 3GR0A 2OMLA 2EK1A 1HL6A 1S59A 3SBMA 4B3TF 1YI2S 2MZ1A 3FZ2A 5E7OB 3UDLA 3TUZC 2HZCA 1IQZA 1T05B 2M8DB 5K14A 4B3RJ 3DYAB 5A0YA 4KGXB 4ED8A 5C24B 2OLWA 3NGRA 1R0AA 4OQJA 3BKTA 3AB2B 4TQRA 3C46A 4OHYA 4EBDA 3VAGA 3OSPA 3GIJA 2VPZB 4Q8FA 2XO6A 2XGPA 4OYIA 2DEIA 8ATCB 4WZQA 3UR3C 2BBEA 3M2VA 3ZNUA 5FJ4A 4J5OA 4USMA 3T9ZA 1PKUA 4TLQA 2M0GB 3M32A 5D4OA 1B64A 2ZWOA 4DPOA 3MR3A 4NXNF 1IBKF 4LF1A 3EXYA 1KQGB 2HS4A 3OTBA 1GTEA 4I1TA 3M6WA 2CUYA 3MOJB 1TKTA 3M8QA 2QC3A 3EX7B 2VUGA 2VODA 1H73A 3MM5B 5IWAJ 1XC9A 4TY8A 3IS9A 1PCAA 3NWRA 1AW0A 4L75A 1OYEA 3GCXP 5FIIA 2CZVC 3V4MA 1Q0NA 1GMWD 3FRYA 1P1LA 3QNWB 4LSZB 3QGPA 4ECSA 2UVVA 3IRXB 2RF2B 1S1TA 1LEOA 1MMNA 3TQ1A 3U02A 5CHCB 1VBKA 1VQYA 2YPZA 3MUVP 3VGVA 2JDJA 3PDNA 4WFZA 1ZM3A 4IH7A 4NWBA 4ELVA 5F8NA 2IFXA 1PGZA 2L3MA 4CYUA 5C7PA 3JQJA 3G6ES 2AEFA 2J0SD 1S6QA 2JL9A 4ZPAA 4OI1A 4X4UA 1U1NA 1RBOB 2ZKUA 1TL1B 4USVA 4Q7AA 4X4PA 2JWNA 2W7PA 2A0FB 2OP5A 2OPPB 1JLAB 2ILYA 1XMOF 2XS5A 2Z57B 2C3UA 4F0MA 1ZYQA 2QSWA 1VMBA 3GYNA 1UFLA 3BF4A 2E1AA 1QE1A 3T6JA 1WC0A 4CLTA 4C11B 3T5LA 4GO5X 2XMKA 4QIFA 2AD9A 4X65J 3JQKA 1RWXB 1FDNA 4B9VA 1X5PA 2RRBA 1H2VZ 5C5JA 4ED2A 4OX8A 4X64F 2WAQD 1OIAA 4M1KA 2B0GA 4C7QA 2V63A 2FVCA 2QLFB 1R8HA 4CZCA 5DM6Q 2RT3A 1W25A 1MU2A 5LOQA 2HYIB 2FIUA 2BJ8A 4A47A 5A8WB 4CTAA 2E7VA 1VQ4S 2ALYB 1HNVA 3FBBA 4KHPJ 2YTCA 3PHTA 2DY9A 3R5GA 4OJHA 2QA2A 2PO4A 3D7SB 1GMUA 2PA3A 4P7TA 4PQUA 4EEYA 1X4EA 2XHCA 2POKA 1N4LA 2NSCA 4ANDA 3I5BA 3V2UC 5L8RC 1M1GA 2VFSA 5SZTA 1WC1A 3LP2B 4FXWA 4BLGA 3DDNA 4ECRA 3UCGA 1HQEB 4TU9A 1K47A 3EGNA 4YHHJ 3PJ9A 2FJXA 2BJ1A 4PG4A 2F63A 1Y4ZB 3CC7S 1FCAA 1NJZA 4NCBA 1NDCA 4AT1B 3DOLA 4PYAA 3N9UC 2M70A 2ZH5A 3ZZPA 4A46A 4WTYA 4KHRA 1APSA 3OFFA 1U49A 3KUGA 2NS1B 4QYZJ 4KY3A 2J9DE 2XTJP 2Z0GA 2G0CA 4O4RA 3MMCB 2YKNB 2VICA 2RD5C 4DV5J 2C2RA 4DUTA 4OZ1A 1SH2A 2OMOA 2RQKA 2ACYA 4YOEA 2F8EX 4QIWD 4USKA 1Y0HA 3IR7B 3LA0A 4DR4J 1M90T 3VGTA 4P75A 2DNLA 2UUWA 2XLKA 4J9PA 1OWXA 4A48A 3WC2A 3I87A 2FLPA 1NSAA 2H48B 3W7BA 2BABA 2HVHA 3BGFA 2D69A 2MZQA 5J1EA 2H4YB 4AD6A 4QU6A 4DWIA 2EVZA 4ED3A 4I2PA 3Q8YA 1HW8A 4C0HA 3QWUA 3MAHA 4CM2A 2ILZA 2QL7B 1S76D 3IGNA 4IRDA 1UW4A 3J7Z5 3G6YA 4ED7A 2DCUB 1X4HA 2NCKL 3HVAA 1VQ9S 2HWTA 4GO7X 3HK2A 3LUYA 4K4XA 1SQEA 2Y3YA 4RNHA 1C1CA 1ULRA 2B8PA 2FDNA 1TUGB 3AQOA 2OSQA 1RAIB 2KRRA 4LR8A 3WQPA 2EG2A 3HX9A 4M5DA 5IT0A 2CQIA 1T94A 4O3QA 2L9DA 4U6PA 5I3UA 2FHMA 4I6AA 1HBNA 1BD6A 1TVRA 3POTA 4MAKA 1NSPA 4UOCA 4GVLA 2J9EA 3A12A 1YJVA 3FEYB 5DRKA 1A0OB 1N33F 3QJJA 1ZM9A 2YPYA 1B0PA 2DNNA 2IA6A 1CJVA 2ZH1A 2UV8G 1IKVB 1SC3B 2G4BA 3FC9A 4IFYA 1QUVA 3Q0AA 4Q2LA 2IMOA 1DTTA 5F8JA 2W4PA 4NRTA 2B4OA 5ADZA 4KKOB 2FC8A 2R2UA 1JXVA 5E3AA 2W8LA 4ZHRB 3IRWP 2R8JA 3G8TA 1VQOS 1XR5A 2WW8A 2DR6A 5CAAA 3I0RB 2ZWPA 3CC2S 4C8OA 3V6DB 3C16A 3SQGB 3EE3A 4NA3A 4F0HA 2YX4A 3MM8B 1KBRA 5L1IA 4ZLLA 3TQEA 3KMQA 1EB0A 2G13A 1F2GA 2NXJA 1TFWA 1KLMB 2F4VF 3LP1B 1HPZA 4USHA 2PT0A 2XZDB 2CPHA 2MKCA 2V8DA 4RUAA 3HF5A 5AXMA 2F8MA 4NX9A 4M5MA 2IA0A 1SIWB 2C2OB 3HD2A 2D1CA 4NLVA 2ACMA 1VISA 1NO8A 4RNNA 2BANA 3EPGA 4C8KA 4ED5A 1FA0A 3QFHA 1HQUB 1B7YB 1D9DA 3O1LA 4LF9J 4F4AA 3EVMA 4CO5A 1M5OC 4DHVA 3RJMB 2XB2D 5GAHU 3M6XA 1GFWB 3W9HA 2RIJA 1RSCA 4WF9Q 5KFTA 2ASJA 2ZHOA 3C6UA 1YRUA 5J2NA 3VV2B 3Q2SC 1KEKA 1OPZA 9ATCB 1IUJA 5L39A 2L41A 1N32F 4HDGA 3G96A 3K57A 3I6PA 4YR2A 1N5YB 4CLKA 1REVB 4O3SA 2DH9A 1OQ3A 2BQRA 3KLFB 3R5AA 2IVYA 4QR1A 1F3VA 3G86A 1B4SA 3MPDA 5AE2A 4F67A 2DHXA 4IOBA 1U2FA 2FJAB 2QRRA 2V67A 3DOMB 3IBFB 3RYLA 4PWDB 3NGDA 5A2QY 2AT1B 4DPTA 3I9ZA 5AE3A 5EX0A 3CCUS 2LECA 3BO3A 5FD1A 3MZIA 4QPTA 1IJFB 1YJNS 3RU0A 2DIVA 2JX2A 3QLHA 1PJ5A 3SDEB 1RA6A 4CO4A 4CP5A 5B08A 3MMJA 4UUXA 2BYCA 3M2RA 5IM0A 4QWAA 2IHR1 5E3QA 5J2QA 2HKEA 3AD8C 4QW8A 5DM7Q 1S72S 3HXMA 3DOKB 3ET6B 3HHEA 2CPEA 3CCQS 4IFVB 2QX0A 1NK5A 2ZC4A 2MKKA 2KKHA 2FY8A 4NXMF 1NMEB 2D3UA 1U7LA 3P45B 3UD3P 3KYLA 2IRUA 5JUMA 4EI2A 2OEKA 1FNXH 3LP0B 3OUYA 3JS9A 1OY9A 1F6TA 4DR1F 1SJ4P 2GC8A 4Q2MA 4DSJA 2C3PA 2PGCA 1NU4A 3DHXA 7FDRA 2EXUA 2IJRA 3NG8A 3NMAA 5HL7Q 4OYAA 1SKRA 4DPWA 4PXEA 3QJLA 4LF7J 1FNOA 2JLGA 2C2DA 2OKQA 4KBIA 2ABYA 2HRTA 4MKYA 2KYZA 3LW5C 3TARA 2YWGA 1JJHA 1VCTA 1LWXA 5D77A 2ERRA 4ZP8A 1TZ0A 4G1QB 1SUQB 4ECQA 3BDPA 5LXRA 2MTLA 5DZ7A 1MWQA 3MI7X 2YBVA 2AIRB 3FCWA 3AH6A 3VVTA 1JLQB 4B02A 2V4RA 4G1PA 1HARA 3KK3A 1QUPA 3EGWB 3BSCA 3HDSA 4RJVA 2VU5A 4Y2AA 2GVZA 1Q79A 3KK2A 3MM9A 2OSRA 1JJ4A 3V6HA 2BMBA 2RKIA 1F9FA 4EGLA 4WP8A 1Y5NB 1LFWA 2HGNA 5KFFA 3M8SA 2BW7A 1YRXA 3OLBA 2ZUGA 2HK2A 1GH8A 3JSYA 5IC6B 2K2PA 3U7JA 3GIIA 3IM9A 3W2VB 2XS7A 5F9LA 3PG9A 2EFGA 2KFNA 3VAMA 1NK6A 4TY9A 2WOMB 2GW8A 3EWGA 4LVNP 1C1BA 1JX4A 1WWHA 2ZHBA 1FDDA 1NAQA 2Q79A 5D0GA 4K2JA 1T9XA 2RVJA 3N28A 3H2VE 4HR2A 3GSDA 4E8UA 1KP6A 1KSPA 1KHVA 1WTFA 2IMWP 1X4AA 2QJ3A 4C4WA 2IYGA 4LBPA 2CPJA 4DU7A 3HHLA 4DQIA 1Q81T 5GMKa 4OI0A 1E6YB 4C3LA 3ILIA 3FCVA 4ED1A 1N5TA 1HD0A 3BGRA 2ZHAA 4A8SA 4PR6A 1AROP 1NBEB 1FFGB 5H9FK 3H8YA 1WKJA 3CMAS 4P73A 5A8RB 2OELA 2RRNA 4IO1A 2FJVA 1RXOB 2GQCA 1KOHA 3TJAA 2AP6A 3RB4A 2K3KA 4TU7A 4NOHA 2CWKA 2KJVA 2OD6A 3CMES 1YITS 1R43A 1WG1A 5FLXU 3R3TA 4FDFA 4QIEA 1P27B 5ETMA 4DV6F 5F8MA 1Y00A 1O5JA 4DOZA 1QM9A 4QQBA 2B4PA 3NBPA 2B9WA 2Y1IA 5B0DA 5CD4H 2CQHA 3IR6B 4RW8B 2A10A 4JI2F 2JNJA 2VG5B 1CJKB 1D0EA 4JV5J 4DV3J 2EFNA 2BXJA 4LF5F 2NLWA 1AYEA 1FD2A 3RUBL 2DPIA 2PFFB 1PSDA 1VIXA 1UL3A 4ZJQA 3VALA 1ZM2A 2E5IA 1MNEA 4EYHB 1PAUB 1RT5A 2FZGB 1YWXA 2CJKA 1PJ7A 1NK9A 2E9TA 1JLBB 1G6BA 4MK7A 1QVGR 2I5JB 4KV8B 1V5IB 3KLEA 2BJDA 3CCVS 4FF3A 4ED0A 3QGIA 2OO4A 1UP1A 3OT9A 3A3OB 1KWMA 5KG0A 2HHHF 3GILA 2ZH9A 5KFBA 4N76A 1UCNA 3CCES 5HJYA 2K1RA 3KLHA 4RW7A 4WPAA 2AW0A 4JI0F 4A8OA 2DO0A 4C2MA 1N36F 2N4CA 3KHRA 1I94J 1VRQC 4PXCA 2ROGA 5HATA 2HQGA 4NLPA 4ZPWR 2M4MA 1SIZA 2LA6A 3W5YA 4NYZA 1N6QA 2W1BA 2ZBIA 2LEPA 3TAMB 2JFDA 2DJWA 2IM1A 2U1AA 3KG4A 1PAEX 2YWHA 3DLEB 2XMVA 4ECYA 1IM6A 5I42B 3HVTA 3H5UA 5M2RA 2QG9B 5GADI 4DV2J 4W98A 3ENQA 3OVBA 2UVRA 5DO2A 2C3YA 3LTOA 4FF4A 2HZVA 3PIOQ 2NQPA 1D3WA 2DH8A 2UVUA 3N5FA 3KLIA 2NREA 4M5JA 1T05A 1VHIA 1RAOA 1WHXA 1FDAA 1UW9A 2PEHA 3DYAA 1RCOB 2KM8C 3HSDA 5C24A 2DXDA 2I8EA 1KVIA 4LRCA 3RAMA 1HHTP 4PZVA 3JSBA 4FNHA 2R2SA 4DN0A 1TKXB 1RU1A 3BDEA 1WOSA 3MEGA 5D0HA 4TXSA 5F8LA 5HMWA 1LWFB 4ANEA 2ZITA 3M2UA 4K0KJ 5CA5A 3EZUA 1SH3A 1U2RA 1L5UA 3ZXWA 2HNZB 3OD2A 2C3OA 2HFVA 5DDPC 5LMNJ 4JI1F 1WKLA 4F3MA 4DQPA 2QYCA 1NZAA 5C42A 3ENWA 4J9KA 3R1HA 4ILLA 3VQTA 3UPFA 4ZLPA 1H7WA 2ZOGA 3R8YA 3CF5Q 3G8SA 3DNCA 1QD1A 1U6BA 4EO8A 4ETXA 2DR5A 5DQHA 3DXSX 3H2UB 1SI9A 3Q23A 1SL0A 3AA8A 4FZVA 1HW9A 4DX5A 3GJRB 2X7IA 4BHQA 1AFIA 3IRXA 2RF2A 2Q66A 3BH7B 3CIZA 5KFMA 1UWAA 5JVGQ 3BKUA 3GJSB 1SKUB 1NXIA 2Z58B 4NMLA 3FDSA 2FD2A 2PD1A 2CYYA 3RR7A 4NL5A 1I6JA 4DBQA 2MY8A 3MR2A 1R0AB 1W2IA 4U7UK 2QMWA 4F0KA 3DLBA 3OTEA 4H4OB 3E3XA 1XBWA 3VQSA 4WK3A 2CQGA 3W64A 1TL1A 1T9VA 1NDLA 2YVSA 2JVOA 1H2TZ 4QJVA 4CIOA 2J6UA 1RADB 1W2BR 1JXLA 4OYOA 2B9XA 2PDAA 3AOCA 4DPYA 3C15B 1X4GA 2OPPA 1B0VA 4DR6J 2CFXA 1JLAA 2J0QD 2PMWA 1V3RA 3PYEA 1AZSB 1K0VA 2NXCA 2MQPA 1RTHA 5BR8J 1N5VA 1A6LA 3RAXA 1P6TA 4FS1A 3O3LA 5F0WA 5AT1B 3Q89A 4C11A 2CJBA 3C14A 4ECZA 4UY85 3MMBB 3OJSA 4CWBA 4DQSA 4DR3F 1TK8A 1ELOA 2HQCA 3DFEA 3CJRA 3Q83A 1EJ7L 1CULB 2HVEA 4HTIA 4HKQA 4X2BA 1G2EA 2Z56B 3EMTA 1FE0A 3MGJA 2G2OA 3FQLA 3L95X 3MAAB 3ITHB 5HSPA 3QATA 1N0UA 2QIFA 5IT9U 2E1PA 4OI3A 3PEJA 3S1TA 1VDHA 1HR0J 2P9GA 2CPFA 1HWJA 5A8WA 1FT8A 3RGIA 3MTJA 2OD4A 3IGVA 4OHVA 3BB5A 1S1TB 3PTWA 4QYRA 3DKDA 3CXCR 2Y1JA 4YMEA 4RBUA 1VC6A 3GB0A 4ZCLA 1S9FA 2CVEA 3CCMS 2PFDA 3M8PB 3J7YU 2VQFF 5KAKA 1S1VB 1YJ7A 2VDIA 3VGSA 5KFPA 1VYAA 2V2QA 2YY3A 3LP2A 3HHDA 1S6QB 2CRLA 1HQEA 4BWJA 2H54B 2K3IA 3FJ2A 4YUDA 4M63A 2DHHA 1X5SA 1Q5VA 2XI3A 3W60A 4CT8A 2X1AA 4RZRA 2H9ZA 4F3OA 2F7VA 3X3UA 3TAPA 4ILMA 2FZCB 3JYTB 2D74B 5HO4A 4JOUA 3TZZA 1T9WA 2VH7A 2GIQA 1Q8LA 2W7AA 2QA1A 3MMCA 3ZZUA 1W7WA 2F9DA 2YKNA 4U7CA 5KFVA 2JC1A 1FD8A 3GIKA 1DLOB 2IAJB 5J2PB 1F5CA 4TQSA 2RQCA 2WVFA 1Q4RA 2AHOB 1KD1T 5I3QA 3WDOA 4OLOA 3GIRA 2H4WB 4A8MP 4DJBA 5HLFA 1NB7A 2MQQA 2HHQA 4Y6IA 5KFWA 1Z1ZA 3WIVA 4DR4F 4OYPA 4DN9A 3CDAA 2E5JA 5HQ8A 1RWUA 2NPFA 4J9OA 1M1HA 2IM3A 2OEJA 3N6MA 1YG0A 2CG8A 4URSA 2ZH8A 1RT4B 2H5EA 2VQEJ 1URRA 3HHLD 3SI8A 3NAIA 2QLXA 3UNGC 2MDAA 4ECTA 2R9LA 3SZ2A 1ZS6A 3J80Y 4C48A 3TUPA 2BE2B 4TN2A 4ENOA 5G4DA 3KUHA 3EDQB 2DH7A 1AXQA 2R7TA 2XEXA 5IV4A 3C19A 2VONA 1EIYB 4NLQA 4L76A 1X9MA 4CH0S 3I4HX 2AF6A 2YX7A 1YDLA 1I3OB 4QZVB 2YWKA 4J37A 4NRUA 3PKYA 2DHAA 2ZFHA 3DOLB 1CPZA 1URNA 4WU3A 2ZZMA 3DGPA 1RTZA 3H98A 3ZZ0A 1NKBA 1K0TA 4O3OA 3FNNA 2XBPA 3HFZB 1GK8A 3T1HJ 3VZIA 5H9FJ 1SQFA 3L9ZA 1TAQA 2IBOA 2LXUA 4J9SA 2GCFA 1WHWA 3HP6A 4ZPVR 4JV0A 4RU9A 1IKVA 1D9AA 3T5HA 4ICLA 1BLUA 2E5LF 1HNZJ 3IN5A 4AXJA 3A4TA 3U1LA 2DEJA 4KKOA 4MMOA 4EZ9A 1JLGB 2RSQA 2CPYA 1U1PA 2HSEB 2G0JA 1Q7LB 2COLA 4DSLA 4ZHRA 3SQOP 5A6PA 1NK8A 2ZBRA 3RB6A 5HK4A 4NEYA 3DU6A 3KNAA 2CVIA 2JEGA 2PEBA 3I0RA 4CLLA 2K7KA 2C2ZB 1IBLF 3V6DA 1HI8A 3UO0A 3SQGA 2HAFA 4ZPBA 3MM8A 3CVKA 3FK4A 1K44A 4AL5A 4LF6F 2E7XA 1PYOB 5ETTA 3DM2B 1L3KA 1QAIA 2NYHA 2BJ3A 1KLMA 3LPEA 3AXMA 2BEFA 5KG6A 4JUZA 1GAOA 4YFUA 2VPYB 2B51A 1H74A 1J5EF 5E0OA 1SB6A 2J7WA 1YJWS 1B99A 1O6XA 2AQ4A 1JWWA 4B9MA 2DITA 2KXFA 5CQGA 2MQOA 1HQUA 4B9NA 4M5LA 2CNKB 4J7CA 4K5SA 3AHPA 3UVJA 1CJUB 3Q8RB 1TP7A 4F36A 3KTQA 1C4CA 5GAHI 2FGCA 1AA1B 1RZMA 1S1UB 5KFSA 1QSYA 2HFUA 1UKUA 2WONB 5IV3A 4LIRA 3R7BB 5E3CA 2XMTA 1FTRA 4UF4A 3CT9A 4LIWA 3NS6A 3VCDA 4IQXA 5DDOC 1S6OA 4QU7A 3V81B 4B3SJ 2KI2A 2LQ5A 4WP3A 3CJ5A 1HNWJ 1DQAA 1N5YA 1DQ9A 1J5OB 4O0NA 2XM3A 3KLFA 2XZTB 4ZVQB 4M5IA 4X4TA 1T3OA 3NL0A 4DX7A 4C8NA 2H51B 2RHQB 2YKPA 2DK2A 2E1RA 4JI6F 3OL8A 2OGUA 3DOMA 4PWDA 2D3ZA 3GV7B 3TAQA 1XNQJ 5GAGU 3OPKA 4P2FA 4OV6A 3LH2S 1LKZA 2P2CB 2YH1A 4Y28C 1OO0B 3DI6A 1T9YA 3SDEA 1YJTA 2G1DA 2E66A 1L3SA 4K8RA 5DG9A 1RUSA 2Z2MA 4FVCA 2CIMA 2KT2A 4OYXA 1X0FA 2HRYA 1RTIA 4RNMA 3H4DA 1WG5A 1KQKA 4KJIA 3G87A 3A3NB 3QT5A 2HG4A 3A13A 4BWMA 3DOKA 3H2LA 4IH5A 5DETA 4XIUA 3KXDA 3BO2A 3DCAA 1F0XA 4TNOA 3EYZA 1KONA 3CPWR 4KHMA 4O23A 5CXTA 1HWIA 1T95A 1RT3B 3L7PA 3LP0A 4I6YA 2NZCA 3KLVA 2IJFA 3ISND 4PXBA 3CD5A 1QJHA 2GX8A 4WKYA 1NJYA 4DZDA 4NLGA 3SFUA 4KE5A 5A76A 4DV4J 4JI8J 2E9RX 3UCUP 1OYDA 1YJRA 3G6VA 3JB9k 3GFZA 2IRXA 4V1Ak 1NDPA 1YSJA 1RHUB 3KLGB 4LSLB 2RDIA 3R7SB 3HSJA 1DJ0A 1RWVB 3AB4B 2AYEA 1H38A 1M5PC 3HVRA 2Z30B 3SEOA 2PC6A 3WX4A 5ETLA 3BJYA 4MIAA 4ZCMA 3OL7A 4G1QA 4CNZA 4IG3A 4ZVFA 2HBYB 4W92B 2OPQB 4LUBA 2XI2A 2AYMA 2R4FA 3B4DA 4YY3F 3Q86A 3M9NB 2B7BB 3D68A 2VIHA 1WNEA 1JLQA 2IVMA 4HEA9 3BEGB 1FERA 3PEHA 3ELHA 5CD4A 5KFQA 5IM0B 1WC4A 2HVZA 5J2QB 3Q8VA 3I32A 3KMSA 2NXEA 1XERA 2F5GA 1WORA 1FJGJ 1XN9A 3Q8QB 3K5LA 3B6BA 2NYIA 1VQ6S 2AEMA 1GT8A 3LALA 3L3CA 5GAEI 3GV5B 3CO0P 3W2VA 2B5JB 4NLRA 2CKWA 2WOMA 4O3PA 2RB7A 4DL2A 3NMRA 2KM8B 1X4BA 3O8WA 3JXOA 4K4UA 3QBCA 2WK4A 1FFWB 3SV4A 2KTQA 1PBUA 4KPYA 3TUJC 4Q0BB 2EFOA 3BBCA 1HYSB 4HL9A 5KFHA 1E6YA 2OPSB 2L9WA 1RAAB 1NM2A 5K8NA 4A4JA 3W61A 3CUNA 1JJCB 2HHUA 3D1QA 3RRHA 5DGBA 4PAAA 1VHFA 2XWYA 4FKYA 1UZHA 1I51B 4DF8A 3RAQA 2JEIA 5A8RA 3AJ1A 3OXFA 1XNRJ 1N56A 1R31A 2XY7A 1K1QA 1RT2B 2R8GA 4USWA 2R8KA 3ZTSA 2CJXB 4ECUA 1FX4A 2G0IA 1KFSA 2VASA 2L08A 3L7OA 4TYBA 2EFQA 3D5MA 1U45A 3OFEA 4N47A 2CQ4A 5MLCV 1MSWD 2DNKA 2QE5A 4X84A 3SYZA 2UV8A 4K4ZA 1F5BA 2VFRA 1YZ6A 3HZEA 5KTQA 1DY3A 1NK7A 1TV6B 1LK5A 1HHQA 2LQBA 3G8QA 4RW8A 1RI7A 3GP9A 2M52A 3CJQA 1XMBA 3CWJA 5D3GB 2UVWA 3MM6B 1CJKA 1C4AA 4WK1A 3DLLQ 3KJQB 1Q7YT 1C1BB 4F04B 3JTNA 5ETRA 4DI6A 1E6VB 1WC3A 1KVKA 1FXLA 4EWTA 1BWEA 3HFVA 2Q1LA 3SSRA 4RX6A 3FSIA 4JV5F 2RUGA 3MR5A 3TOQA 2E1MC 2FHJA 5BYSA 1JLBA 3VAKA 2KB2A 1FRXA 3TZYA 2I5JA 3E51A 3NKYA 4QIVA 4H4MB 4IG0B 4KV8A 2XY6A 2XZWA 4WZMA 3CEDA 3HLUA 1ZA2B 1H3DA 2DD8S 2DGQA 4ELUA 3ILOA 4KSEB 4U95A 1RWMB 1NPPA 5ETQA 2Z8QA 1Y11A 1KDNA 4F3QA 2WVBA 2D9PA 2V50A 1HNXJ 2YNHB 3LWLA 2V69A 3TWZA 4MK8A 1CC7A 2GJIA 3AJDA 4B3TJ 4DU8A 1PILA 3J81U 4KH1B 1I5OB 4LVOP 3K5NA 5K20B 2BRKA 1U1OA 2CQDA 2G1HA 1NH7A 1BXNA 4OX9F 2CADA 3I5AA 3AFGA 3F56A 2ZH7A 1RKJA 4ZVOB 2Z4PA 1S9EA 1JB0C 3GPAA 1LXJA 1IR2A 3DXBA 1VQ5S 3TYTA 4CLPA 1TL3A 3BQ1A 2AKWB 3DLEA 3NBPB 3HFKA 4FXDA 5I42A 3QSYB 2DO4A 1TL7A 1U1MA 4QBUA 1RWWB 3FUYA 1QVFR 4ZCKA 2UUBF 4ATNA 5EN1A 1U4BA 1IBKJ 2N7CA 3VAFA 4TYAA 1KC8T 2HQIA 3GV8B 1WOOA 4CRJA 5ETVA 1EAYC 2I2YA 4YP3A 3DRXA 2KFZA 3FSXA 4ZPTR 1KQFB 5GMEA 4NEZA 2V8HA 1RT5B 4XDDA 5KFJA 4RNFA 2UXBF 1P8GA 3OTOJ 3FGVA 4O3NA 2JLEA 4EUVA 3L09A 4ZITA 2E5HA 2MLYA 1MN7A 1TKXA 1ZTWA 2LVWA 1NJXA 2WBRA 2P8IA 3KJNB 4Y3CA 1S0VA 3PRBA 3QT6A 1LWFA 3MHYA 3AQPA 2CAJA 2GGPB 5KFYA 2HK3A 2MKSA 3UE2A 1GQEA 2NXNA 4E98A 4RW7B 2UUCF 4DDFA 1OQ6A 2HNZA 1HNIB 3UN3A 1ZTTA 1SJRA 5CCMA 1JMTA 4UZBA 3BBBA 1J27A 1RBLA 1RWNB 3ZZZA 3FBEA 4X4QA 4IR1A 4EZ6A 2HHTA 1N6QB 3B4MA 2W4DA 4NE9C 1YBAA 4AL6A 2N82B 2VBWA 1S6PB 2MQ8A 4OZLA 2R7RA 1FJEB 5LMNF 2WCXA 4GKKF 3HSZA 1RABB 1N54B 3UW1A 2AZ1A 2AMCB 5DZ6A 3SCLE 2ZBCA 4LF4F 2CQ0A 3CMQA 3UFCX 1G1XA 5LJ3Y 1NNDA 2VBZA 5U47A 5DJBA 3I0SB 3UQSA 2OPRB 3MM7B 3KLIB 1RAEB 3CCLS 2GMLA 3OFGA 4X64J 6FD1A 4E2FB 4GC6A 1DHMA 2ZH3A 1RP5A 5K9FA 1XWLA 2L48A 3RW7A 4NA1A 2RRAA 2YNIB 1HBMB 1CVJA 4YDXA 1EETB 3MEGB 5LXYA 1XMQF 5CZVA 5T41A 4H4OA 1N5QA 4ZP7A 1JIHA 4ILRA 3M2UB 5L1JA 3KJFB 1KKHA 4UT4A 2VDHA 2V34A 4DSKA 3GYGA 3BM7A 3C15A 4NMXA 3D0GE 1AZSA 1RT7B 4DR5F 4J9NA 2CDQA 3N6LA 4KO0B 3PRDA 2B4UA 5D4NA 4JI5F 5D6GA 4P10A 3D67A 5C42B 5H9EK 2ZZNA 2C28A 4X62F 3MMBA 2P9CA 1FK9B 3LOUA 4LBIA 3P5TL 1U0SA 3QT8A 3DU5A 1NK4A 1CULA 1F9HA 2QV6A 2X51A 2X3DA 3QAEA 1M0SA 2IDLA 2R8HA 1RAFB 2GHPA 2GMJA 2IRYA 4WFNQ 5LMUF 3PO4A 2M8HA 3ITHA 3MAAA 1U26A 1RTJB 3HKZD 2DISA 3D6HB 5B0GA 2BJEA 3CD0A 1YBUA 3FEXB 2C42A 3W66A 4IOAQ 2OUGA 2ZKTA 1P9YA 4USUA 4GMKA 3M8ZA 2LYVA 2VG7A 3V6KA 3M8YA 2KH9A 4USTA 3M8PA 2UP1A 4LRDA 1RU2A 1S1VA 5EWFA 2FUG9 2M2BA 2DBBA 2H5JB 3AD9C 4Z7YA 5C2CA 4KFBA 4B9TA 3HZGA 1JLCB 3Q8PB 4ECVA 3R6LB 4C8LA 1WKKA 1S0MA 1IVZA 3PCOB 2HBZB 4KQZA 2EW9A 4M5GA 4LFBF 1VLOA 3JYTA 1RTHB 2WB1D 1IM4A 4AYBD 4WIIA 2BQUA 1IR0A 3QO9B 1S49A 4F4WA 2KFYA 2XMMA 1NH8A 3C14B 1DLOA 2IAJA 5J2PA 3GU0A 4DF4A 2W9AA 2ZM6F 4WCEQ 4CO3A 3PFOA 4JYAJ 1QY7A 2MKJA 4B9LA 2EKYA 2ZVIA 4K7QA 2B56A 3TEHB 2Z2ZA 2DT9A 3AY0A 1FRJA 3IAM9 4WE1B 1U47A 3FQKA 3JQMA 5CYJA 1UAWA 4YR3A 2VB6A 5ETOA 4KT0C 1WC6A 2Z2LA 5H1SV 3BZQA 1BQMB 1Y5LB 2PA8D 1RT4A 3PV8A 4C8YA 2B3TB 5K5MA 2Y1LB 3TP2A 2MSSA 3H40A 2HURA 1X8DA 1T03B 2W9BB 4RR5A 2BE2A 4CI0B 4H4KC 1RHRB 3OW2R 4R5PA 5HVFA 3W3SA 4W90B 3CGIA 1OSDA 2HHVA 5AXKA 3R97A 3NNCA 1CQNA 2RDJA 2BOAA 2Z2YB 4LSNB 1VQKS 5ETSA 5A8KA 3ONQA 2MLXA 2FLLA 2JEJA 3PYFA 3DRRB 3JSRA 4LQ3A 3QIPB 1UEKA 3FFIB 1KHWA 4WFXA 4PG8A 1M5KC 2LU1A 2XLIA 2E29A 4DL5A 1CJTB 4NI2B 3F73A 3GMGA 2FB0A 1ZPVA 2MZRA 4K50A 2YWEA 2J5AA 3R2DJ 5KG2A 4N8NA 4UZCA 2N3OA 4DL6A 2XNQA 2F4VJ 1R27B 4P2SA 2APOA 2R7VA 3CCRS 2FVSA 4DV7F 4I6WA 3K5MA 4CM0A 4NCAA 2VPXB 5KFLA 4F8RA 4HI2A 3OJUA 3QRRA 1RA7A 4AUKA 4I2QB 2VD3A 5HLFB 2DTJA 3SMZA 1NHVA 2DGXA 4DX8H 1KTQA 1P1TA 4Z7CA 2RJZA 1JLGA 3DMJB 1QAYA 5G0RB 3G9CA 1HMVB 1EP4B 2H3EB 1HNZF 3IFEA 1BMQB 2CPDA 3GSIA 2FHJD 3K8WA 2MKYA 4RW9B 2DGUA 4TVAB 1R8PA 3DLJA 3FCHA 4DLGA 4XK8C 1T0TV 3DLHA 5BYRA 1U8SA 2VL1A 1SXLA 4Z37A 1LOUA 4A8WA 4OYZA 1U6FA 2DNOA 3IWLA 1F60B 3DM2A 4RW4B 1PO6A 1U0HB 1N32J 4DS5A 1UVIA 3GQCA 4AFFA 1C2PA 2ZJQQ 1GMWA 4CNYA 1FRLA 4RWWA 4JI7F 4DV0F 4WBFA 2QLJB 2CJ9A 3DGPB 1JK9B 4RUBA 4AQYJ 3MFHA 3BGUA 2PMZD 2MGZA 4AE5A 1S9GA 3AJ2A 4ZPDA 4ZVTB 3W8GA 4A8YA 5LL6d 4ZVRB 3K8VA 1WSRA 4ZLNA 4JV2A 4KH0B 5IFMA 4CQ1A 2RS2A 4DV1F 1WEYA 1BGXT 1HQ2A 2DNMA 1CJUA 3K7RA 2GIRA 4ID5B 4DQRA 4ICLB 3GTYX 3X1LB 2E7WA 1S1UA 4CLZA 2WONA 4N8OA 3TVKA 3N6NA 3P8BB 1S7IA 1FVQA 3LGHA 3NRBA 4M5NA 5BJRA 2BJ9A 1M5HA 3IAS9 1FHTA 2GO8A 3V81A 2JJ4D 3CO9A 3DLGA 1MROA 3BREA 4B9SA 2ASLA 4NXMJ 2OFHX 2CQPA 1J5OA 2W01A 3J81j 2MKHA 4CLSA 4U67Q 4B3SF 1UPPA 1UFKA 1RDRA 3MPYA 2G2YA 2FGOA 4DCJB 4ZMMA 3FSYA 2DNYA 2BW2A 3K5PA 4PG5A 1R0CB 4RNOA 4DR1J 4EO6A 1U1QA 4DQQA 4UY8T 4PXDA 3BN7A 2LP4A 3PYGA 4HH0A 3GZ7A 3TUIC 4NLYA 3IBWA 3H0PA 5J2MB 3PW4A 5KFNA 4DX6A 1FXRA 3C8YA 3S01A 4I69A 1FEHA 1OY6A 2G9OA 4QWBA 5KOWA 4RW6B 3GIMA 2RQMA 2CQ1A 4ZLJA 4LFAF 2DB1A 2DVIA 4NZ0A 2IPOB 2Q43A 2ASDA 3Q8SB 1FTCA 4QYZK 4ZVPB 4LT6A 1OPIA 5CABA 3CD6S 1A7GE 1NB2A 2M3DA 3UVJB 5IS2A 3GG0A 5D15A 3A8IA 1N52B 1GXTA 2L9NA 2RNEA 5D78A 2GFFA 3KOAA 3R5JB 4KR0B 1U2CA 4LR7A 4L74A 1EKSA 1RT3A 1IWAA 1K9MT 4OYMA 2A6OA 3B78A 2MEWA 2CDRB 2ATCB 5ETPA 2BA9A 2BDPA 4GC7A 2VV5A 1TMJA 1NHKL 3I9V9 2XC9A 4P74A 4CLUA 1M5VC 4PUOB 5D0RA 4MTPA 5F8IA 5D8HB 1F3FA 3P6YC 3M05A 1DURA 4OI2A 4KGKA 4J9RA 3KLGA 4LSLA 3B8HA 2R7UA 1EX8A 1UWBB 2J0WA 4DUYF 3OHBA 1SPBP 3N5BA 2W2NP 2Y0SD 3QWPA 1YKWA 4YR0A 1WHYA 4J9UE 2NSBA 2XCAA 1SVDA 2OPQA 2A2CA 3IP0A 5IT4A 1HI1A 3CB4A 2XYHB 3PW0A 2FJDB 3O2IA 2ADBA 3K58A 2FPHX 3M9MB 4KGMA 2AEJA 2VKRA 3CC4S 2O67A 3PJWA 3DI6B 3MECB 4QOTA 2FJWA 4B3MF 3GG1A 2WVDA 4NLSA 1P9QC 1S7HA 3C6TA 3RBZA 1R8BA 3UR0A 4RUCA 1HFEL 3T6BA 3KHGA 1RTIB 2HBRB 3VVUA 1S48A 1FKAF 2OEMA 4PEOA 2AWZA 3DDIA 2QGFB 2MQLA 4ER8A 4DSIA 1VQMS 4BCAA 3G4SS 1YQHA 4ELTA 4ANCA 1X7VA 5CCLA 3SXLA 2HIQA 1RHQB 4DCPB 4FS2A 3T1AA 2B5JA 2GQ2A 5EWGA 5K8MA 3BQ0A 1S5ZA 5L46A 5C25B 4MYTA 1DTQA 3PZPA 5KFXA 2VOOA 1REGX 4PPZA 4DV6J 4NLUA 2YWWA 2QTWA 4XDCA 4PG7A 2CQCA 1JKHB 5HJXA 1RT1B 2GVDB 1EARA 3ZZOA 4JI2J 4Q0BA 2ZH6A 1HYSA 2O66A 2KT5A 3TX0A 4JI4F 4X4OA 2OPSA 5ETKA 1N88A 2B4VA 1VBXA 3TX8A 4LF5J 1K1SA 2R42A 2RUSA 2MLZA 1HD1A 4DSEA 5CZXA 1BE4A 3BN4A 4IG3B 4HHJA 3K89A 1U25A 2GIFA 1RACB 3D6TB 5FLXY 1RT2A 1BQNB 4LF8J 2J9DA 1SJ1A 3CJTA 4OZNA 4GKJF 2UXCF 3ZZRA 5L38A 2QSFA 1ACMB 1XNRF 2YH0A 4FN5A 2F65A 4MT1A 1R7IA 3V5RA 2HHHJ 4N56A 1OSCA 1H72C 2JH3A 2IM0A 2LCWA 2EFVA 3D28A 3R27A 1Q5YA 4K4YA 4JI0J 2QO3A 1N36J 4URQU 2WTFA 3MR7A 3FKBA 1QLNA 1TV6A 1JNRB 1WEZA 2MQMA 2I6WA 2GV1A 2EI5A 3I31A 3ZFVA 5D3GA 3MM6A 1KN6A 1S10A 3AD7C 2DPJA 3B54A 2BACA 2BR0A 4Y0FA 1X4CA 1RT6B 1RE1B 1E6VA 2DNZA 3MCNA 3PRVA 2HNYB 4WFBQ 4ZOSA 3VHQA 1T9UA 3DRSB 3UI3A 2LA4A 1YTYA 4NCGB 1CSJA 4HLBA 3T41A 3EVOA 4MK9A 1TK0A 3OR1A 3ZZYA 1WDTA 3T1YF 4H4MA 4IG0A 3JAMU 4NYOA 2GO9A 2D7SA 1VQLS 4DR2F 1BQXA 2YNHA 2UU9J 3EDRB 1LK7A 2NZ4A 5GADU 4ITSA 2QEXS 4PPDA 6AT1B 1RGVA 1KQSR 3US5A 1YVFA 2MYFA 1VFJA 2W4CA 2ALZA 2EBGA 1FKOB 4Y2CA 1D9FA 3U1MA 1V3ZA 2KZZA 3CDWA 2YKOA 1X60A 5B0FA 3P5BP 3H5SA 1YJUA 3JSMA 5B0AA 3BH6B 3HKWA 5HQMA 1AFJA 4F7VA 4WJBA 4IKAA 1KRPA 1F5AA 4C3MA 1LW0A 2NPIA 3PW7A 4ZKAA 1Q78A 3MEEB 4MKBA 3I56S 4JI1J 1F1BB 2XO7A 4QPXA 2J9CA 3MPUB 2BM0A 1IKXB 1FO1A 4X4SA 3H20A 1T11A 4LRAA 4OZ2A 4DL7A 1YGYA 5KT2A 3IWXA 2IBKA 1G7CB 1IBMF 4G3IA 2FTRA 4ZPCA 5B7WA 5LSOA 3DDKA 4JP8A 2W25A 2R7XA 3EGVA 4Y2MA 5HI7A 3MR6A 4I64A 5HANA 3OTOF 2I0XA 3P4UB 1C0TB 4DMZA 2GGPA 3QGHA 1JNZB 2ZJPQ 3BS9A 2HBQB 3H4BA 2CQBA 1U8WA 4W4MA 1ZBTA 1GX5A 1TUVA 1EQ0A 2FHOB 2ZD1B 2KL8A 4WYLA 1HNIA 2J8AA 2LEBA 2UXDF 3QT7A 1R8AA 5T7LA 4U8YA 1BC6A 3K2YA 5E3RA 1S9EB 4ETZA 3HT0A 4PWUA 3R2CJ 4QWEA 3F41A 4FXVA 1JJ2R 3CJ2A 4OX7A 4QR2A 1S6PA 1MWZA 3QIDA 1VQSA 3AOAA 2OJ3A 1TL3B 1FNMA 2ROEA 5F0UA 1Q86T 2YX1A 5KG1A 5KFDA 1SC4B 2IM2A 1TL7B 3D0HE 3FZBA 4FPIA 2B7CB 1VI7A 3ILLA 3QFWA 3Q2TC 1I1GA 3M8RA 4ZP9A 2GQQA 3ZZTA 5B0BA 4DR3J 2SXLA 3HJVA 4L6V3 4CO1A 1CLFA 3I0SA 2OPRA 3H42A 2ZUAA 2DGOA 3MM7A 3AT1B 2MPUA 2AJ1A 1N0VC 3OV7A 2V9KA 1T8EA 2F40A 2YNIA 3THPA 2RMLA 1HBMA 1FF2A 1EETA 2V4JB 3MEKA 5KG4A 4OX6A 2W24A 4A8XA 4B3RF 4EYIB 1H98A 2OFGX 3HT3A 4ZIWA 2XS2A 5E33A 3MUTP 1BY9A 3TA1A 3W5XA 4AL7A 3GE9A 2VQFJ 2EG1A 1RT7A 1X4DA 2LDIA 4KO0A 1LV5A 1S1XB 4EBCA 2ZH2A 2WSEC 3L4BC 1AT1B 3DN9A 1V6HA 5HQLA 3JTPA 1L3VA 1FK9A 5IT9Y 2ZOMA 3MEDA 2Y8YA 4R8UB 4GVBB 5DDQC 2RQ4A 3MCMA 3A8KA 3IO1A 1S6UA 1RTJA 3GCWP 4NLXA 3CJSA 5IWAF 3LWMA 2YNFB 2AX0A 3UDVA 1RKIA 3M6VA 1OY8A 3CCJS 2GS8A 1VBYA 1H6KX 2CZ4A 1W26A 3NS7B 2XNRA 1VQ8S 3NXZA 1TKDA 1IBCB 1FKPB 5L9XA 2DGWA 2K7JA 3VAHA 1F2HA 3G71S 5HP1B 4OYWA 3BKFA 3IR5B 4NLTA 1N34J 1JLEB 2W8KA 2DR9A 2EC0A 2VPWB 5HN0A 3CCWA 4F2RA 2IY5B 2D9OA 1VOMA 2B9EA 1JLCA 3DRPB 1D8ZA 1X4FA 4MKAA 3CNQP 5IQ6A 2VKZG 4RL1A 1QSSA 1OS5A 2KVIA 4JB8B 1BHNA 1R3NA 3KKFA 1OMSA 4DG1B 4DL3A 3GR1A 1YBTA 2BJ7A 3QO9A 1KFDA 2GJ2A 3K17A 4MKVA 1RWOB 2CG4A 4ED4A 1IKWB 3CCZA 2NXUA 5KFIA 3W65A 2CNNB 5HMYA 2JOQA 3BPSP 4PG6A 1R0BG 4HDHA 3TW0A 1RAGB 2KHDA 3VTIA 2DXFA 3K59A 2IYIA 1TR0A 1UZDA 2YKAA 1HHSA 3OTDA 2AGQA 2MZJA 4X65F 2KJWA 4WE1A 4WFYA 2GJFA 2RILA 2OTJS 2W9CB 3TZWA 2HRUA 2XSJB 2MJUA 5DLFA 4JYAF 3A1YG 4KGVB 4U9RA 1C0UB 4NASA 1BQMA 3TRGA 2HFNA 3RBEA 1DZ5A 2A3JA 1WC5A 2KVQE 4HVZA 2BKOA 1ICEB 3FEZA 3D1HA 2ZBQA 2VG7B 4O4GB 4J90A 2E5LJ 3CULA 1JXEA 3Q8UA 2BOPA 2XGQA 1T03A 1UVMA 2W9BA 1XJWB 3W9JA 1PYSB 1YJ9S 4DR7J 1U24A 5AJ3J 5IQQA 5D0EA 2JFKA 4DS4A 3ZTPA 2ZVSA 3A3PB 4KHPF 2MB0B 2IIHA 3NGTA 1FRKA 3ETOA 3G6XA 4KFBB 3UN2A 4NLDA 1Q53A 4LSNA 3GWCA 4C9DA 4HACB 2XYGB 5BXIA 2XLJA 1WOPA 3DRRA 2HFSA 3QIPA 2VG6B 3FFIA 4YHHF 1SBRA 4NLOA 1IBLJ 1WHVA 3KHHA 3IA0A 1YRTA 4ZJLA 3BGLA 2PI5A 1CJTA 3M7VA 4NI2A 3DLKA 4ZP6A 3LGNA 4LF6J 1R8CA 4TLRA 1RYSA 2N4DA 2FJEB 3HULA 4B08A 4G65A 2DNHA 1S0NA 2EK6A 5JXSA 2XYPB 2V4QA 2A2DA 5KOXA 1QDUB 1NPRA 2DIUA 3V4IB 2VA3A 2NUUG 4YB5A 3O6QA 2FJBB 1J5EJ 3H7HB 4DV5F 3ZC4A 3S6EA 2KDOA 3T5JA 3GFHA 2YQ3A 4I2QA 3NOCA 2HGMA 1FDBA 2HNDB 4P71A 2HMIA 2AJQA 2V8VA 4PKDB 3SV3A 4NZ7A 4KC5A 3DMJA 2VHGA 5G0RA 1RLDA 1ZPWX 1HMVA 2UZAA 1ZH5A 1EP4A 8RUCA 3BYRA 1VQPS 3FMWA 4USIA 2O1PA 3KK1B 4RW9A 1K8AT 4BS2A 4I7FB 1XQIA 3MWBA 4U96A 2IDEA 3D66A 1HI0P 2R7QA 4KAIA 1M1KT 2J0XA 1TAUA 3OR2B 3LO3A 4R5PB 3PX4A 1MLAA 4RWXA 2AJ2A 2OIHA 1SQGA 1TKZB 3B82A 1RK8A 3UNYA 5LSLA 1Q8BA 2YQ1A 4RW4A 3UN5A 1U0HA 2M5YA 5F41A 1NEEA 3RZAA 5ITHA 2KZMA 1LWEB 5A8KB 3QYYA 4F50A 3QSIA 4IR9A 2XMWA 1N8RT 1CS4B 3CIMA 2HLUA 3BBFA 4C8MA 3EZ5A 3NEKA 1RB0A 2QN6B 4ERDA 1SH0A 5HROB 2CA9A 2HHPA 4YB6A 1DRZA 1YZ7A 4X4RA 1TMMA 4JI6J 2CNLB 3IG1B 4HHHA 2HFZA 4OI4A 5AE1A 2E9ZA 4L73A 3MPVA 2I1RA 4ZS6A 4AQYF 2YKQA 4XAKA 1SJ3P 1T3NA 2EBEA 4ID5A 3QRQA 1UMJA 4KGZB 2AV5A 3OFHA 3M9OB 3RR8A 1S1WB 2XY5A 2YKMB 5L1LA 3RRGA 2ZC3A 5CYQB 2EKNA 1Y7PA 1V3SA 3M30B 3VAJA 1PYTA 2BX6A 4EU0A 2HVDA 2IVFB 3ICLA 1FXDA 5AXLA 3MF5A 3BR9A 4RBTA 3OXGA 1QSLA 1RTDB 3UCZP 4X4NA 1TQLA 1LNQA 4CCHA 2CQ2A 5K8OA 3IMQJ 3CCTA 3R9LA 1WG4A 4OZ3A 2VJVA 3R1LA 4IDKA 4JI3J 5KFCA 1UJ4A 2YNGB 4FPRA 4YB1P 1LFPA 3W9IA 3MURP 4ECWA 3T5KA 2BRLA 1NSKL 5J2MA 1IJEB 5L1KA 2Q3PA 1S77D 5KFEA 5LM7E 5SUHA 1SV5B 1HBUB 2AGOA 3HSGA 1S4EA 4RW6A 2MGZB 4Q8EA 2RH3A 4Y65A 5CYMB 1S9GB 2XHWA 4CH7A 4LRBA 1VGYA 4J91A 4YY3J 3LF0A 1NCLA 3ZNJ1 4N5SA 1O51A 1GXUA 3BSNA 1WF0A 4XTTA 1QTMA 2HAIA 3W5ZA 4Q44A 3HCXA 2HQDA 2H65B 4LF9F 2V8GA 2DCLA 3LAMA 4OIXA 1MN9A 2CJQA 2ADCA 3NGUA 3MCSA 3KJVA 3AXKA 1KR4A 5DDRC 3ILJA 3WIUA 3DLGB 5A2QU 1EZZB 1MROB 4DCOB 2DGTA 1X5TA 4PUOA 4LQ9A 4OHWA 1KNZA 5KFKA 3PXGa 4F2SA 3FMBA 4PRFA 1EKRA 3CE8A 2AYGA 3QRPA 1UWBA 4D3GA 2DXEA 3ENAA 1Y5IB 1VLYA 2IC3B 5GAEU 2FVRA 1FI4A 5IXUA 3NNAA 3FVYA 3D3CJ 7FD1A 4ZA1A 1R89A 4A8KA 1HWLA 2IJNA 3CDEA 4QWDA 3R5DA 3MECA 4RU2A 2WVCA 5KT5A 3BYPA 3SCJE 3NP5A 1RWPB 1RISA 5E41A 2M88A 3CJKB 4J9LA 5KFAA 1FWPA 4DUZJ 2KXHA 4I67A 4ID8A 6FDRA 4QCLA 2FVQA 1WSVA 3IWNC 3GJQB 2OAUA 2LXIA 4DFKA 4P52A 4ZVSB 2X1BA 2H5IB 2LQ9A 3RB3A 3LANA 1JLFA 4UOHA 4TKTA 2R2TA 3DHWC 2BQ3A 2PI4A 1XEZA 4FVMA 3HMJG 2V68A 2MHNA 1GXLA 5C25A 4B17A 3EJMA 3KDOA 4IOCQ 1U09A 3CJ3A 4PWWA 2UUAJ 1JKHA 2AJ4A 4C3KA 1V5VA 1LW2A 1RT1A 2GVDA 2QMXA 1RBAA 2DR8A 4NYPA 1V9OA 4I68A 1PBAA 1DQ8A 5F9NA 2HS0A 4CT9A 2V2KA 1X9SA 2QLWA 2VC1A 2O3DA 4OL8A 3NGSA 1MG7A 2MSTA 3OVAA 4ZDNA 4KTQA 2R7OA 2DY1A 5GVQA 5J1NA 5KT4A 2DRDA 4LF7F 1IKYB 3MTKA 1VRTB 1O0PA 4FYYB 2ZE2A 2WHOA 1BQNA 1TL5A 3HM9A 3NOGA 4NPOA 4M8LA 3BO4A 5M2PA 4OZ0A 5LSRA 5FDLB 2P6TA 4DPXA 3H5YA 1FRHA 2R3VA 2KHCA 3C6TB 3MMAB 4USJC 3G82B 4WXOA 4LF8F 3OL6A 1Y9OA 4P7VA 3BGOP 2D3OR 4MIBA 3BSOA 4QIGA 1HKAA 1VC0A 5LT5A 1WDDA 4BDPA 3J7ZT 3QZ7A 4OX9J 2F1FA 3PX0A 2GAGC 4BC7A 3IBCB 4ZVUB 2OHDA 3DRYA 4ZN3A 1GEHA 5K8PA 4FYWB 3K0JA 3W2WB 1RT6A 1DTQB 2BE9B 1ROFA 1NHUA 4NLWA 1X31C 3R5BA 1LWCB 2DRAA 3TR5A 2O5DA 2HNYA 3MD1A 3DRSA 2XMJA 1S97A 4NCGA 3H90A 2LQJA 2I38A 3E01B 2UUBJ 2DR7A 4E0DA 5EWEA 3J81Y 3VR1A 2E44A 3KFWX 5EX3A 1VRUB 4G1IA 5KFOA 2VF3A 2QFJA 2F3JA 1UETA 4KIAA 4ZVGA 1WI8A 1XTZA 4EMDA 3I4PA 2UXBJ 3SSSA 3EUNA 4P72A 4HTJA 3IC1A 4C97A 3M1VB 4MFBB 2ZZTA 4ES3A 1NZ8A 2EFPA 5J1PA 2JC0A 3ENVA 3D1OA 4LFCJ 2UU9F 1FKOA 2W2MP 4C98A 2JRSA 4F4KA 2KRBA 3R5CA 4OJ3A 4B3OB 2JHEA 5DG7A 1KS2A 3PM9A 4HYKA 4I0WA 2BZ2A 3EXCX 2WB4A 2UUCJ 2DYAA 4O44B 2CJYB 4P9SA 3DC2A 1WF1A 2XSFA 2BE7D 3PW2A 3EGZA 4OZ5A 5KFUA 3MEEA 3J7A1 5IOLA 4Z2XA 1HBOB 2B6AB 2HWHA 2HIYA 3RTVA 3VAIA 4K2XA 4BC9A 2VJUA 1A9NB 4R0JA 1FFSB 1NSQA 4OI6A 4U8VA 1IKXA 4P6QA 5HBMB 3OHAA 3I55S 3K5OA 2KU7A 2RS8A 4GRSA 4GKKJ 4X66J 1X9WA 4DV3F 2MQNA 3CW2C 1H2UX 1UVLA 1S99A 3NY0A 2FC9A 4LF4J 1CQMA 2M9KA 2RU9A 3OLAA 3GONA 2WW4A 3OR1B 1NK0A 3PJXA 4NA2A 1S0OA 1ZETA 2KN4A 2DHSA 1UTAA 3MM5A 3QJPA 1QTNB 1K73T 3NGKA 3O5TB 2FQQB 2JZ5A 1C0TA 2DNRA 1ZA1B 5LJ5Y 2B8QA 4FYXB 4FYDA 2ZD1A 3FBCA 4KPCA 2CXEA 2FLNA 3KG1A 3BR8A 1R6VA 4UQGA 1SC6A 3OBIA 5I4MA 2VA2A 3SIPB 3BSAA 1Y3KA 4HT7A 2C22A 1XMQJ 5HVGA 3N0VA 4Q45A 2KXNB 4FKXA 3GFYA 3TANA 1TTHB 5K14B 4WU2A 1I94F 1GNKA 4RLEA 5A0YB 4DFPA 4H54A 3JSMB 2J6TA 4C0BA 4V19J 1VS3A 2X1GA 4I56A 1EQMA 2MJNA 2CPZA 4QWCA 1LW0B 5DLGA 2V5HG 4MH8A 3M4XA 4JBCA 4DR5J 4QW9A 1H0HB 4RUHA 5T14A 3TO8A 3HHLC 4KYZA 4JI5J 4NXNJ 2QA4G 3M2VB 3WZ0A 2W2OP 2ZBPA 3MCOA 1QAXA 4H4KA 4X62J 2QLBB 4NZ6A 4R0EA 3M32B 1RWKB 2W7OA 3SSQA 4DV2F 2XWXA 2LFVA 3S7RA 4MYUA 2EWHA 1SL1A 5LMUJ 1TKTB 3M8QB 1U02A 2QMUB 2V4JA 3LGMA 3T9NA 3N79A 3Q22A 4ZVHA 4TY8B 5C2GA 1PJ6A 2R8IA 4PABA 3IS9B 5HVHA 2MZSA 3CSKA 2QT7A 1WJ9A 5E2QA 3KNGA 1YX2A 2KT3A 4DLEA 1TUWA 2HGLA 3D54A 4K5RA 2AZ3A 2HFOA 1L3UA 4YN3B 2ROPA 2OTLS 2RHSB 1B0TA 2HZAA 1BWVA 3HHNB 1S79A 4L3KA 4UOFA 3C3LA 4K0KF 1XR7A 1IQTA 1S1XA 5T7LB 1U48A 1U1RA 1D8YA 1HWKA 3NCRA 2BV3A 4CYUB 4F26A 3LPYA 1SCJB 3CJ0A 3GJTB 4R8UA 4GVBA 4YB7A 1N5SA 1XMOJ 2A1BA 2EPIA 3GLJA 4LFBJ 2V6AA 3MAQA 3L7UA 4MJKA 2PMHA 4DL4A 4IQMA 1G4CA 2BKPA 2YNFA 3ULHA 4J9QA 2FHKA 3AA9A 3RB0A 3RG6A 3MOZA 2V94A 3G2XA 2C2KB 4YDDB 1ZZFA 1RHKB 2LKZA 1NKCA 1Z4UA 1QE1B 4UW2A 2ZM6J 2ZNYA 3PO5A 1FKPA 1TK5A 2UUTA 2DGVA 3UDEA 2R7SA 3H5XA 1NDKA 3OQ2A 5HP1A 5B0CA 3O44A 3NS5A 1JLEA 3TEGA 2K06A 2V0NA 2QZ8A 4CDIA 2FYXA 2FVPA 2VFUA 3DRPA 4UQTA 2V2ZA 1MU2B 2GZOA 1J2VA 1N34F 4P2MA 1Q8IA 2MXYA 3OTCA 4CTAB 4FNIA 2B9YA 1NJIT 5E5NA 4DG1A 4OHXA 3ISZA 4FP9A 1HNVB 2ZH4A 2FZKB 3W63A 4LR9A 2JVRA 3ADAC 4QR0A 3E8OA 1T9TA 4DR6F 4PQUB 2C2EA 1H7XA 4ES2A 4LF2A 1IKWA 1IN0A 1CC8A 3AAWB 3MEDB 2H1YA 1WACA 5D4PA 5BR8F 2K8GA 4KB7A 4XPEA 3THTA 2GAHC 4RBVA 3I96A 4IUFA 3OXLA 3GFXA 3W62A 3P96A 4M94A
chains in the Genus database with same CATH topology
2J7KA 1VBZA 4ECXA 4WYLA 1HNIA 2J8AA 3TUJC 5THWA 4CO5A 4Q0BB 2CJAA 1M5OC 3N01A 2EFOA 1HYSB 2LEBA 4PCQA 4K4SA 2UXDF 4HL9A 4OJGA 5KFHA 3RBDA 1E6YA 4DHVA 3UWTA 3RW6A 2OPSB 2W9CA 2L9WA 2XB2D 5GAHU 1R8AA 3M6XA 4UUWA 5T7LA 4Y2KA 2XSJA 2RU3A 1BC6A 2RIJA 3K2YA 5E3RA 1S9EB 4ETZA 2B43A 5K8NA 4PWUA 3OL9A 4WF9Q 4A4JA 4QWEA 3F41A 4FXVA 3TVZA 3CUNA 5KFTA 2ASJA 1JJ2R 3CJ2A 4IRCA 2HHUA 3D1QA 4OX7A 2ZHOA 3RRHA 4DFJA 4QR2A 3C6UA 1YRUA 5J2NA 5DGBA 1S6PA 1MWZA 1VHFA 2PSZA 1C0UA 3QIDA 1VQSA 3Q2SC 2XWYA 2OJ3A 1TL3B 1FNMA 2ROEA 5F0UA 1KEKA 1OPZA 4DF8A 1Q86T 3RAQA 1HR0F 2JEIA 5A8RA 3AJ1A 3C2PA 3OXFA 1IUJA 1N56A 3J7YI 2GHWA 4O4GA 2YX1A 5L39A 2L41A 3E2EA 1N32F 5KG1A 1R31A 4HDGA 2XY7A 1K1QA 5KFDA 1RT2B 3G96A 2HPUA 2IM2A 3K57A 4OZJA 2R8GA 1NRKA 2R8KA 4K4VA 3D0HE 3FZBA 3H59A 1U1LA 4WYWA 3I6PA 2B7CB 4ECUA 1VI7A 4YR2A 1N5YB 1VQ7S 2MZTA 1REVB 1G3OA 4O3SA 1SJFA 2DH9A 1KFSA 1OQ3A 2BQRA 3Q2TC 1I1GA 2VASA 3KLFB 3R5AA 2L08A 3M8RA 3L7OA 2IVYA 4TYBA 4ZP9A 5EHHA 1UA1A 2EFQA 2GQQA 4QR1A 3D5MA 3ZZTA 3G86A 1U45A 1KTVA 3OFEA 4N47A 5B0BA 5KFGA 4O3RA 2CQ4A 5AE2A 5MLCV 2ZDOA 2VZ9A 4F67A 1O8BA 4G6VB 2DHXA 2SXLA 2DNKA 2QE5A 4IOBA 4N77A 4X84A 1VK8A 4DR7F 5AJ3F 4EBEA 4L6V3 4CO1A 1U2FA 2FJAB 2QRRA 3SYZA 1CLFA 3I0SA 5J1EB 2OPRA 2UV8A 4K4ZA 2VBYA 5MAOA 3RYLA 3TI0A 1F5BA 2DGOA 2VFRA 3MM7A 5DS7A 3NGDA 4PWDB 2MPUA 2VBXA 2VG6A 2AJ1A 5A2QY 1N0VC 5F8HA 3HZEA 3OV7A 2V9KA 5KTQA 3I9ZA 4I2PB 5AE3A 5EX0A 1NK7A 1TV6B 1UVKA 3CCUS 3RRKA 2LECA 1LK5A 3FRZA 1T8EA 2LQBA 3G8QA 4RW8A 3PACA 3BO3A 5FD1A 2F40A 1RI7A 3MZIA 1YIJS 2YNIA 2M52A 3THPA 2RMLA 1HBMA 1FF2A 4QPTA 1IJFB 2D41A 1AUDA 1XMBA 3CWJA 5KT6A 5D3GB 1YJNS 2DRBA 3RU0A 2UVWA 2DIVA 1EETA 3MM6B 5KT7A 2V4JB 1TFYA 1C4AA 4WK1A 2J7UA 3DLLQ 2JX2A 2RE1A 3MEKA 2P6SA 3QLHA 3HO1A 5KG4A 4OX6A 3SDEB 1Q7YT 2W24A 1C1BB 4A8XA 1RA6A 4CO4A 3JTNA 2DNQA 5B08A 3MMJA 1E6VB 4B3RF 4UUXA 2BYCA 4XO0A 3M2RA 5IM0A 4QWAA 1H98A 2IHR1 5E3QA 4EYIB 5J2QA 1FXLA 3ISNC 2OFGX 3SCIE 4EWTA 3HT3A 3QPIA 3THVA 4URGA 1BWEA 4O0IA 3V4IA 2XS2A 5E33A 4QW8A 2Q1LA 3MUTP 1BY9A 3SSRA 5DM7Q 4RX6A 2P9EA 3TA1A 3FSIA 1C1CB 4JV5F 5E3PA 2RUGA 4AL7A 1S72S 2FLOA 3MR5A 3HXMA 3TOQA 3DOKB 3PY8A 3V6JA 2E1MC 3GE9A 4ES1A 3NNHA 3HHEA 2EG1A 2CPEA 2FHJA 5BYSA 4FF1A 4ZK7M 3CCQS 1NJWA 4IFVB 1RT7A 1NK5A 3SFGA 1JLBA 1X4DA 2ZC4A 2HNDA 3VAKA 2MKKA 2LDIA 2KKHA 2KB2A 4NXMF 4KO0A 1FRXA 3LP1A 1WD6A 1LV5A 1S1XB 2D3UA 4EBCA 2I5JA 3E51A 3NKYA 2ZH2A 4M5DB 4QIVA 4H4MB 4IG0B 1U7LA 4KV8A 2XZWA 2XY6A 4WZMA 3NAHA 3CEDA 3UD3P 3HLUA 3KYLA 2IRUA 5JUMA 5I3UB 1H3DA 2DD8S 1N48A 2WSEC 2DGQA 3MDFA 4ELUA 1FRMA 4KSEB 1FNXH 3LP0B 3DN9A 2V9WA 1V6HA 3OUYA 2Z8QA 3JTPA 4F3QA 1HBNB 1L3VA 1TVRB 1FK9A 5IT9Y 2D9PA 2ZOMA 3MEDA 3KK1A 2YNHB 3POTB 3LWLA 1D1UA 4DR1F 1SJ4P 4MK8A 4DEZA 4R8UB 2GC8A 1CC7A 2GJIA 4Q2MA 4I7FA 5DDQC 4DSJA 2RQ4A 2C3PA 1PILA 2PGCA 4LVOP 3PKMA 3K5NA 1NU4A 3DHXA 3IO1A 2BRKA 1T7PA 1S6UA 4K59A 7FDRA 3H25A 1ZM4A 1U1OA 3OR2A 2CQDA 3NG8A 4M95A 1NH7A 5DQIA 3NMAA 5HL7Q 4OX9F 1RTJA 2XG8A 2VQEF 1SKRA 3I5AA 4PXEA 3QJLA 3F56A 1FNOA 1PC5A 1TKZA 4IFYB 4YEAA 2JLGA 4NLXA 2ZH7A 1RYRA 1LXNA 2OKQA 4HT5A 2C2DA 1RKJA 5IWAF 4KBIA 2ABYA 3LWMA 2YNFB 2AX0A 1RKIA 2Z4PA 1S9EA 3M6VA 1JB0C 4MKYA 2KYZA 1T02A 1LQ9A 3LW5C 3TARA 2HHXA 1DTTB 1LWEA 1LXJA 2YWGA 1JJHA 3CCJS 2QA4S 2Q6CA 3DXBA 1VQ5S 5D77A 3TYTA 2ERRA 4ZP8A 1TZ0A 4G1QB 1SUQB 4ECQA 1TL3A 3BQ1A 1VBYA 1H6KX 2CZ4A 3BDPA 3P3DA 5AXNA 5LXRA 3DLEA 3NBPB 2XNRA 1VQ8S 4XPCA 1TKDA 3P49B 1FKPB 3HFKA 5L9XA 1NKEA 2DGWA 3NWGA 2K7JA 5F8GA 4FXDA 5I42A 3MI7X 3VAHA 2DO4A 3G71S 1U1MA 3AH6A 4QBUA 5HP1B 5HROA 1QVFR 1JLQB 3IR5B 4NLTA 4B02A 3DLKB 2V4RA 4ZCKA 4G1PA 2VFTA 2UUBF 1HARA 1MWYA 4ATNA 1JLEB 2W8KA 1REVA 5EN1A 1U4BA 3IG1A 2DR9A 3KK3A 1QUPA 2EC0A 3EGWB 2N7CA 2VPWB 5HN0A 3VAFA 3BSCA 3CCWA 4Q43A 3HDSA 5JVHQ 4F2RA 4TYAA 1Q1KA 4Y2AA 1Q79A 3KK2A 3MM9A 2OSRA 3PR5B 1KC8T 3CTRA 1JJ4A 2D9OA 1FRIA 4A8FA 2HQIA 1VOMA 1R6YA 2PIIA 1JLCA 3DRPB 3V6HA 3GV8B 1D8ZA 1X4FA 2I2YA 4YP3A 3DRXA 2KFZA 4OJ1A 3FSXA 4ZPTR 1FVSA 3KWMA 2ASYA 4MKAA 1KQFB 4IO9Q 4IRKA 5IQ6A 2VKZG 3HI9A 2RKIA 3LAKA 1F9FA 4EGLA 2V8HA 2J76E 2LEAA 1RT5B 3T1HF 4XDDA 5KFJA 4RNFA 2UXBF 1Y5NB 2R2RA 1LFWA 5F3ZA 1P8GA 4K4WA 2HGNA 5KFFA 5D4LA 1QSSA 3M8SA 1OS5A 2KVIA 3FGVA 4O3NA 1YRXA 3OLBA 2ZUGA 1GH8A 2JLEA 1R3NA 3KKFA 3JSYA 2K2PA 1S1WA 4EUVA 3TA0A 4DG1B 3L09A 4FBUA 2E5HA 3GR1A 3U7JA 2YKMA 4DL0C 3GIIA 4DL3A 2HMIB 3VWSA 1HPZB 5I3PA 5CYQA 3W2VB 4AXIA 3QO9A 2XS7A 1KFDA 5F9LA 3M30A 2GJ2A 3PR4A 2HHWA 1TKXA 4B9UA 2EFGA 2KFNA 3VAMA 2LVWA 1ZTWA 1MMDA 1NJXA 1NK6A 3D2WA 4TY9A 2WBRA 2GW8A 2WOMB 4LVNP 1QAJA 1C1BA 1JX4A 4Y3CA 2CG4A 1KOOA 1WWHA 1S0VA 1IKWB 3CCZA 1ZAVA 3PRBA 2NXUA 1FDDA 5KFIA 2ZHBA 1LWFA 3MHYA 3AQPA 1NAQA 2Q79A 2GGPB 5KFYA 2MKSA 3UE2A 2MKIA 5HMYA 1RTDA 4KRWA 1GQEA 3WBZA 2JOQA 2NUHA 5KG5A 3QZ8A 2RVJA 3N28A 4I4BA 3A8EA 3H2VE 4PG6A 2J6SA 1WEXA 4E98A 3GSDA 4E8UA 4FBTA 4HDHA 2BANB 4Y2IA 1KHVA 1WTFA 4RW7B 1KSPA 3TW0A 2UUCF 2IMWP 2KHDA 3VTIA 1X4AA 3K59A 2IYIA 1TR0A 4DDFA 2YKAA 1HHSA 3NLCA 3OTDA 1OQ6A 2HNZA 4IYQA 2HLTA 2MHEA 2AGQA 4C4WA 1HNIB 2IYGA 2MZJA 4X65F 1ZTTA 1SJRA 2CPJA 4IFVA 2LDYA 4F4ZA 3HHLA 5CCMA 1JMTA 2KJWA 4WE1A 5GMKa 1Q81T 4DQIA 4OI0A 4OLPA 1E6YB 4WFYA 4ZVEA 2RILA 4C3LA 2OTJS 2W9CB 3ZZZA 4BBYA 2HRUA 4WXWA 4ED1A 1N5TA 2XSJB 2MJUA 4X4QA 4IR1A 4DFMA 4EZ6A 1HD0A 3BGRA 2HHTA 1N6QB 5DLFA 2YNGA 3B4MA 4C0OC 2AYBA 2W4DA 4JYAF 3A1YG 2ZHAA 4A8SA 1GTHA 1YBAA 4PR6A 1AROP 4OHZA 2N82B 4AL6A 3C6UB 2VBWA 5J2NB 1S6PB 4U9RA 1C0UB 4OZLA 2R7RA 1BQMA 3TRGA 4MIWA 3H8YA 2HFNA 3RBEA 2LXFA 1DZ5A 2A3JA 3CMAS 1FJEB 1FJ7A 5LMNF 2WCXA 5A8RB 4HVZA 5KG7A 1Z2LA 3FEZA 4GKKF 5L9NA 3D1HA 2VG7B 4O4GB 2RRNA 1N54B 2GMHA 4JI3F 3CULA 1JXEA 4IO1A 2BOPA 2XGQA 1SV5A 1T03A 2W9BA 2JSXA 3UW1A 2FJVA 1UVMA 3MXHP 2GQCA 1HBUA 1KOHA 1YJ9S 1U24A 2AP6A 2DGSA 3SCLE 2ZBCA 3RB4A 2KYXA 1ZZNA 4LF4F 5IQQA 2K3KA 4TU7A 5CYMA 4NOHA 2JFKA 4DS4A 4Q5VA 2ZVSA 2KJVA 4KHPF 2OD6A 2MB0B 2CPIA 3CMES 4CO0A 1DAXA 1YITS 2CQ0A 1FRKA 1UVNA 1R43A 3ETOA 3G6XA 3UFCX 4KFBB 1WG1A 1ZAXA 4CO2A 5CH7B 3R3TA 4NLDA 1G1XA 1X5OA 1Q53A 5LJ3Y 4LSNA 5B0EA 3GWCA 1NNDA 2VBZA 4QIEA 5U47A 1P27B 4C9DA 1Q16B 5F8MA 4DV6F 1SUQA 3BQ2A 5DJBA 1Y00A 3D0IE 1O5JA 3I0SB 4DOZA 3UQSA 2OPRB 2XLJA 4ALZA 3DRRA 2VFVA 1QM9A 3MM7B 4QQBA 2B4PA 3KLIB 3NBPA 2GMLA 3QIPA 2B9WA 2VG6B 2WRMA 3OFGA 3CCLS 2Y1IA 3FFIA 4YHHF 5B0DA 6FD1A 1SBRA 4NLOA 4GC6A 1DHMA 3QAUA 5CD4H 1WHVA 2CQHA 3IR6B 3KHHA 2ZH3A 1RP5A 5K9FA 1XWLA 3IA0A 1YRTA 4RW8B 2L48A 2A10A 2GHVC 3RW7A 4NA1A 4JI2F 3KHLA 2PI5A 3BGLA 1SKWA 2RRAA 2YNIB 1S4FA 3DLKA 4ZP6A 1HBMB 3LGNA 1CVJA 2HHSA 2VG5B 4YDXA 1EETB 1R8CA 4TLRA 1D0EA 2VOPA 5KG3A 3T3FA 1RYSA 2N4DA 3QLHB 2EFNA 3MEGB 5LXYA 1XMQF 5CZVA 5T41A 2BXJA 2HW3A 2FJEB 1SJQA 4H4OA 4WFAQ 4B08A 4LF5F 3PX6A 2NLWA 2DNGA 2DNHA 1S0NA 2EK6A 5JXSA 1N5QA 4ZP7A 1FD2A 2HVIA 2V4QA 2A2DA 1UJ6A 3M2RB 1JIHA 2HQ3A 2DPIA 5KOXA 4ILRA 3M2UB 2DIUA 5L1JA 3V4IB 2PFFB 2VA3A 1PSDA 1VIXA 1UL3A 2NUUG 3VALA 4YB5A 2M7SA 1ZM2A 2E5IA 2ZDPA 1MNEA 4EYHB 4DSKA 3O6QA 2FJBB 1RT5A 2CQ3A 3BM7A 5DQGA 1YWXA 4YQWA 3D0GE 4DV5F 2CJKA 3ZC4A 3S6EA 2KDOA 4L72B 3T5JA 3MPWA 3GFHA 2YQ3A 1NK9A 2E9TA 4I2QA 2HGMA 1WI6A 1FDBA 1FE4A 1RT7B 4DR5F 2IC3A 1JLBB 1HNWF 1G6BA 2HNDB 4J9NA 4MK7A 2CDQA 3N6LA 1DARA 2HMIA 4KO0B 1TL4A 3PRDA 2B4UA 3LQVA 1QVGR 2I5JB 2V8VA 1UJ5A 2AJQA 1VJWA 4IDKB 4KV8B 4PKDB 5D4NA 4NZ7A 3SV3A 3KLEA 2AJFE 3WC0A 4JI5F 5D6GA 2GNKA 4KC5A 2BJDA 3DMJA 5C42B 3CCVS 4FF3A 4ED0A 5G0RA 5GAGI 2AX1A 1ZPWX 3QGIA 1HMVA 2OO4A 2UZAA 1ZH5A 1EP4A 2ZZNA 2C28A 4X62F 1UP1A 3OUYB 3MMBA 2P9CA 5KG0A 1VQPS 2GA7A 4PQAA 1FK9B 3FMWA 3LOUA 4USIA 2HHHF 2O1PA 3KK1B 1HA1A 3P5TL 4RW9A 3GILA 1WF2A 3DU5A 2ZH9A 1NK4A 5KFBA 2ZJRQ 1K8AT 4N76A 1X0PA 3CCES 4BS2A 4I7FB 2K1RA 3KLHA 1PC4A 2QV6A 4RW7A 3MWBA 4DSFA 2X51A 3QAEA 1HI0P 1M0SA 2R7QA 4CH1A 4KAIA 2R8HA 2AW0A 4JI0F 3CJKA 2DO0A 4A8OA 4C2MA 1N36F 2N4CA 1M1KT 2GHPA 3KHRA 1YHQS 2GMJA 2J0XA 1XNQF 1TAUA 3OR2B 2IRYA 3LO3A 4R5PB 4WFNQ 5LMUF 3PX4A 2ZNZA 2M8HA 3C66A