5D4PA

Structure of cpii bound to adp and bicarbonate, from thiomonas intermedia k12
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
102
Chain Sequence
AIKLYPLKKLEIILEGAHKEFATDLLDRAGVKGYTIVGNLSGKGSHGMYEGHLMDDALIMIIAAVPEELVGPLLEGFQPFFEAHSGVVFVHDIQVGRPIKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of CPII bound to ADP and Bicarbonate, from Thiomonas intermedia K12
rcsb
source organism Thiomonas arsenitoxydans (strain dsm 22701 / cip 110005 / 3as)
molecule tags Signaling protein
molecule keywords Putative Nitrogen regulatory protein P-II GlnB
total genus 18
structure length 102
sequence length 105
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d4pA00
4OZNA 2XG8A 3AA8A 1UKUA 1UMJA 2GW8A 3OPKA 1Q1KA 2ZFHA 3M05A 2XULA 3HLUA 1O5JA 2JJ4D 4CO0A 4C3MA 2V5HG 4CO2A 3NCRA 2J9DA 3DFEA 4AFFA 3NCQA 3NCPA 2Z0GA 4Y6IA 2J9EA 2RD5C 1PILA 3BZQA 4ZK7M 4CNYA 2O67A 1UL3A 4RLEA 4YB7A 2XZWA 4USJC 1KR4A 3O8WA 5D4LA 2E66A 3AA9A 4IYQA 2ZOMA 2J9CA 4C3KA 1QY7A 1UFLA 5DS7A 1GNKA 4R25A 4USHA 1V9OA 2NUUG 4YB6A 2NUHA 5D4NA 1V6HA 4Y65A 3CE8A 1OSCA 3TA0A 1HWUA 1NZAA 2EG2A 3O5TB 2J9DE 3X3UA 3AH6A 1NAQA 4RX6A 5L9NA 1P1LA 4CO5A 4D3HA 1V3RA 2DCLA 1VHFA 4YB5A 3TA1A 3TA2A 2CZ4A 4CO1A 4RWWA 4RWXA 4C3LA 3N5BA 3GSDA 2EG1A 4USIA 2VD3A 4WK1A 4D3GA 4NYOA 3T9ZA 1NH7A 4WK3A 2XBPA 4E98A 3LF0A 1H3DA 2PIIA 1VFJA 1NH8A 3MHYA 1V3SA 2GNKA 1XK8A 5D4OA 2GX8A 5DRKA 1O51A 3L7PA 4CO4A 3AHPA 4OZLA 4CO3A 2NS1B 4OZJA 1J2VA 2O66A 4NYPA 5D4PA 4CNZA
chains in the Genus database with same CATH superfamily
1KN6A 5ITHA 1NJYA 4MK7A 2IYIA 1NSKL 1RQ0A 4YDXA 3UCUP 3T1HJ 2MKSA 2BJ8A 5IC6B 4RUHA 3KWMA 2VFTA 2IVMA 1KWMA 1SC1B 5JXSA 3TX8A 2E1PA 3QO9B 4H4OA 3M32A 3S6EA 1TELA 2ASYA 3CD6S 4DV4F 4ZKAA 1HNVA 4I1TA 4F8RA 3POTA 2Y8WA 2ZZNA 3GTYX 1NDLA 1RHJB 4QQBA 3TI0A 2KXHA 3OBIA 4FP9A 4JI1F 2J9EA 2EK6A 2F8EX 3IBWA 2AT1B 3ZZYA 2ZE2A 3NXZA 2F9JA 4MMOA 1N33J 2HEKA 3R5DA 3W65A 1S10A 4JV1A 3BQ1A 1GX5A 3KLVA 5DG7A 4PEOA 1DTTA 2B0GA 1ZA1B 3I5BA 4YDDB 2I9SA 1Y11A 2MJUA 3W2VA 1S99A 2EBGA 3WX8A 3K2YA 3NS5A 5A8WA 4N47A 5HMYA 4DR2J 1NK7A 2B4VA 2FIUA 1RSCA 4P74A 1TKTB 4WU2A 2JSXA 2YNFA 1U1QA 1HBOB 1XR5A 3GP9A 4ED3A 4FDFA 1RT1B 3CJTA 3I9ZA 4DXLA 5GADI 5HSPA 4RUCA 4LJMA 2XO7A 3KHGA 4OLPA 5DS7A 3P96A 4WXOA 1KLNA 3MM9A 3KJNB 3FQKA 2M52A 1RCXB 4J9PA 1RT6A 2ADBA 4GMKA 5FLXU 2W4DA 4K4SA 2BABA 2MZSA 2F7VA 2W2NP 2A2CA 1NNDA 1FVQA 1M5SA 1AYEA 1NRKA 3CO0P 3E3XA 3Q8VA 3GIKA 4JI5J 1O6XA 1NCLA 1S9GA 4LF8F 3Q86A 4JP8A 3KNAA 5KT7A 4WZMA 3JTPA 3OTBA 2GGPA 1T3NA 2BEFA 2F4VJ 4ZJLA 1F5AA 1Q95G 2F5GA 3N9UC 2H5IB 1FKPA 1H7WA 1RT7A 3OV7A 3X3UA 2W8KA 4DSIA 4FYDA 5K20B 3SQGA 1NPPA 4O3OA 2ZE2B 4ID5A 1VHFA 3ET6B 4IDKB 1WELA 1XTZA 2FJEB 4QYRA 4YB5A 5FDLB 1RLCL 3TOQA 1H7XA 1XMBA 2JH3A 3KLFB 2NQPA 1HNVB 1CJTB 2HZCA 4DV2J 1HKAA 3D7SB 4F50A 3OW2R 1RHKB 4ID8A 3TZYA 4LMZA 4RW8B 2QFIA 4WFBQ 4RWXA 3KHLA 2F1FA 4CYUA 1UJ4A 1FJ7A 1S6PA 2YWGA 5KG6A 2XZTB 1M5OC 2E1RA 4DEZA 2KU7A 2BACA 1UJ5A 3CCRS 2FJVA 1CJKA 2I1RA 4IG3B 2X51A 4WFAQ 4XPEA 4B02A 2DO0A 4KGKA 3I0SB 5IOLA 1U25A 1VJQA 2AZ1A 4L6V3 1VC5A 2V8PA 1KVJA 5HQLA 1BD6A 4FN5A 2B9XA 2BW7A 9RUBA 1FRJA 3LPEA 2RAQA 3P5TL 4EUVA 5C42B 2LFVA 2I2YA 4QYZK 4OI0A 4ZITA 4B3TF 1TR0A 5F9LA 3D3CJ 1KFSA 1TKZB 1T3OA 4NLWA 2QMWA 4UUWA 3CC7S 3IP0A 3P49B 1A9NB 2AV5A 1O51A 2A6OA 2MLZA 3D54A 2E5LF 3NG8A 2E1CA 2D41A 1VLYA 1NMEB 2DXDA 3IFEA 3M8ZA 3PR4A 2CJXB 1SJRA 2Z4PA 1S1TA 3LGMA 3ZTSA 4ZIWA 3QZ8A 4A8WA 5ETRA 1J2VA 1UWBA 2XNQA 3AOBA 3EVOA 2HZVA 4O4GB 4OZ1A 1J5OA 3ONQA 5EWEA 4YB1P 2VF3A 2KJWA 3IG1B 1RTZA 3AOAA 5J1EB 5DM7Q 4KO0A 4G65A 2YXLA 1JLGB 3MMJA 4RZRA 4WKYA 1X5SA 1O8BA 1VI7A 2YKNB 2DITA 2HVIA 4HKQA 3IRXA 3PFEA 2EEYA 1NK5A 4PUOA 3OTOJ 4A8OA 1GK8A 2J0WA 2CZVC 2LLZA 3MM5B 5BXIA 3HSJA 1RT6B 4CO0A 2FLNA 2VBWA 1SH3A 5CXTA 2D9PA 2VB6A 3EVWA 2OLWA 5SZTA 1YBTA 4TYAA 3WBZA 3PJ9A 2IRYA 1MWYA 3WX4A 2IPOB 1U8SA 4Y6IA 4ZMMA 1Q79A 4C8LA 2KHCA 4IOCQ 3P5BP 1X0PA 1JKHA 4LF5F 3D0GE 5DZ7A 1UL3A 2FUG9 3D28A 4WFNQ 1ZYQA 1NJZA 1HR0F 2YWKA 3CJ8A 8AT1B 4U7UD 1RT3A 1JB0C 2P6SA 1WORA 2JC1A 3BO3A 3ICLA 4C8OA 1UVJA 1XQIA 3H40A 4J9KA 5BR8F 2D9OA 1Q0NA 3GLJA 1S97A 1PCAA 4JI7J 1IUJA 2C3MA 3AA9A 3UDCA 2OMLA 3PIOQ 4R8UA 3HHLB 2AP6A 5DG9A 2K3KA 2HQGA 3MR6A 3QJJA 3HDSA 1Z4UA 3KK2A 3V4IA 3T5LA 3KJFB 3G6YA 3G6VA 4HT7A 5L9XA 1XBWA 3J7YU 1IKYB 4NLYA 4LFBJ 2WK4A 3FBBA 1HWIA 3TWZA 3RB4A 1SIZA 3NRBA 4DR4J 1XIQA 3HJVA 2A3JA 4N77A 2K06A 3CUNA 3JSMB 2GIFA 1SKRA 4UF4A 3VAKA 1T9XA 3R6GB 4UW2A 2ZJPQ 4K50A 4PCQA 3CMES 5A8RA 4KAIA 3GV5B 3RU0A 1JMTA 2VPYB 1H72C 3DLGA 3TYTA 2KM8C 4PG6A 1HA1A 3MEEB 3A8IA 3BKUA 5L1JA 2F4FA 1FT8A 2M7SA 3CJQA 2V9KA 1IKXB 3PACA 1PAEX 3W2WB 2FVSA 3RR7A 2OTLS 2KXNB 3SCJE 1SJ4P 5AE3A 2E29A 1KOHA 1IKVA 1TVRA 2P9EA 3AOCA 1B70B 2G9OA 3I5CA 4NEYA 4C97A 1CQMA 3KNGA 4L75A 4NLDA 4CH7A 1B7YB 1RE1B 1ZTTA 3PW0A 2RF2A 4KKOA 5CQGA 1U6FA 3OR1A 3PX0A 1QDUB 3CJ3A 1KD1T 1Y5LB 4X4VA 5F8LA 1Q81T 4LF9J 2RUSA 5KFUA 1S7IA 4YP3A 2MGZA 5KFKA 3DOKB 5DO2A 3K7RA 3NKYA 4WK3A 1LK5A 2ZC4A 5L39A 4MYUA 2U2FA 4ZP6A 4FVCA 2WW4A 1K0TA 3UO0A 2ADCA 1Q78A 1S12A 4USMA 3MF5A 2GNKA 7FDRA 3T3FA 1KSPA 2VA3A 2DXFA 4CDIA 1SV5A 4K4YA 2QC3A 1YGYA 1HBNA 1HD1A 2HLTA 4NWBA 4YR3A 3H4DA 4Z2XA 1M1HA 1VK8A 3QGGA 4RNFA 5KFJA 4U67Q 2ILZA 5HBMA 3JB9k 4ZVQB 2R7WA 3T41A 4WJBA 2QLXA 2YWWA 3HT0A 2KVIA 3MMCA 2HQFA 2OGUA 1FE4A 1LWEB 2AHOB 2N4CA 3VGVA 4DL5A 1RKJA 1WC6A 1DBDA 4ZPAA 5KT4A 2B3TB 3KHRA 3RRGA 2ABYA 3TR5A 3NNCA 2ASJA 4Q8EA 1S6QA 1GAOA 3MM8B 1SIWB 2IJRA 2N3LA 2PEBA 4C0OC 1FF2A 2ZKTA 4CLZA 2VQEJ 3QJPA 1H6KX 1FNOA 2LQ9A 2CNOB 3KLGA 1S0OA 1L3VA 1WJ9A 4RNMA 3J81j 4DX8H 3K5MA 1Q1KA 5T7LB 5D3GB 1H38A 2KKHA 5KG1A 4TLRA 4C3MA 2FZGB 3FRZA 3NCRA 3AD9C 1X5PA 3T5KA 3VWSA 1VBXA 1RU2A 4Q5VA 2GVDA 4IRCA 4GKKF 1RWVB 2IC3B 3N01A 2Q6CA 4GRSA 2OPRA 3GONA 2COLA 3MPUB 2DNLA 3SI8A 3DLEA 3EGZA 4JI5F 5LJ5Y 2HGLA 1KR4A 1QD1A 2AF6A 3BN4A 3OFFA 3P3DA 4IOBA 2V4QA 2V2KA 3SSQA 3W5XA 5J2QA 4RBTA 4KTQA 4BHQA 1JJ4A 2CKWA 3ENAA 4K5RA 2WVFA 3OL8A 1EP4A 3ETOA 3TVZA 2ROEA 3OL6A 2RQCA 3M6VA 3Q8PB 1FK9B 1RXOB 1QY7A 3UR3C 2C28A 1Y7PA 2H48B 2IMOA 3ILJA 4Y2KA 5E0OA 5A8RB 1IKWA 1XR7A 2W2OP 2ZH5A 1T8EA 5B0DA 1ZTWA 1ZETA 3J7AN 1P1TA 1NLKL 2BJ9A 2WB1D 1SB6A 2FZKB 4OJHA 4WE1B 4X66J 3HVWA 2UU9F 3DLBA 1RAGB 2GIQA 3DXBA 3DLEB 5J2NA 3SBMA 1C0UA 2CPHA 4PG4A 1S7HA 4WFXA 4YR2A 5D0GA 1X5TA 1UZDA 1LWCA 4X65J 3RGIA 1W26A 3Q2SC 1B0VA 4DL7A 1SQEA 2ZHBA 1KVIA 2GMLA 3M9OB 1BWEA 3FDSA 4BBYA 5FJ4A 4Y2MA 2J9DE 1RT5B 2UV8G 5LMNF 2G1DA 4WFZA 3W64A 3OHAA 4CLWA 4F4KA 2CADA 5D3GA 3HHNB 1HHTP 1Q7LB 2QA1A 5K5MA 1R3NA 4X4SA 4NZ7A 2V2VA 5CCMA 4LIRA 3KLHB 3JYTA 1NJWA 3K89A 2XCAA 2E44A 2D1CA 4HHUA 2HS4A 2HRYA 1ZPVA 2AEJA 2FJXA 1PO6A 2ACMA 1VRTB 3GJRB 1S5ZA 1WWHA 1T95A 2UVVA 4I0WA 4USVA 4TU7A 2NXEA 1W25A 3G86A 1UA0A 1TL1A 3NL0A 1P9QC 4KIAA 3T6JA 4M1KA 2YBVA 2HKEA 3R7NB 3WQPA 1JLAA 4ETZA 3BSAA 5IV3A 4NCBA 1XMQF 4J7CA 3JYTB 1Q5VA 3OFHA 1DQ9A 2E7VA 3OL7A 2QYCA 3JAMU 2B8PA 2EFQA 1T9TA 4F4AA 1C2PA 2R7UA 4IQMA 2OO4A 5IC4B 2M4MA 2OKQA 1U6BA 2NXNA 3CDBA 4WU3A 1I3OB 2RHSB 5LOQA 1JLQB 5DRKA 1BHNA 3DOMB 3NS7B 5D77A 4QWBA 3TZXA 3ADAC 1PIEA 1QM9A 3BKTA 4X64F 4RW6B 3NBPA 3PVXA 1VQ8S 3GR1A 4CO3A 1Q8BA 3FKBA 4RNHA 4ELVA 4KKOB 3HKZD 3CT9A 2XM3A 3H20A 1FFWB 4RW4B 2V4RA 2BANA 5LXRA 3CCWA 4OX9J 3W63A 3Q8RB 1NM2A 4HYKA 1IKVB 1RBLA 1XEZA 3QSIA 1I1GA 3I32A 3WHIA 1O0PA 4GKJJ 2UXCJ 2OELA 2UUBJ 3RBXA 3UN3A 4N41A 5HVFA 2R8KA 5HAOA 1YDLA 3MAAA 1XMQJ 2J76E 2LVWA 1TQLA 4A4JA 1KKHA 1LFPA 1S57A 3MEEA 5B0EA 1OY8A 3BBCA 4URSA 2P9GA 4ELUA 3HI9A 5J2QB 2Z56B 4DL4A 1JXLA 3NNAA 2QSWA 3UE2A 2R7VA 4OZ3A 1ZOTA 2JNJA 5KFAA 1KQKA 4KJIA 4FXDA 5AE2A 1DQAA 1X5OA 4HTIA 4F0MA 3NCQA 2XWXA 3THVA 1AUDA 3H8YA 1HL6A 2FQQB 1NDKA 4PYDA 3W5ZA 2MZTA 2J5AA 3TUIC 1HLWA 3EPIA 2HQDA 4YB7A 2R3VA 5L1KA 2MJNA 2P9CA 4OV1A 4USJC 3OL9A 1D9FA 3BF4A 1NEEA 3F41A 3UW1A 1UTAA 4S0MA 4O23A 1RKIA 2Z8QA 4Q2MA 3KK2B 3V4IB 3VAGA 1FJEB 4OYPA 2EFGA 5ETQA 5D78A 1H2UX 4RPFA 4WYLA 2NXCA 3ZZPA 1UA1A 4ENOA 4JYAF 2FD2A 2ZOMA 1FCAA 1HYSA 1OYEA 2AJ1A 1HBMA 2C3PA 4HTJA 4P6QA 4TYBA 3HMJG 2LEBA 1U4BA 3FRYA 2CJKA 2VPWB 1T02A 4EBDA 2MQOA 2J0SD 1JK9B 2HFSA 1TKXA 5HROB 2ZBRA 2R8HA 1JNZB 5HVGA 2HVDA 2DVIA 4NXMJ 3V2UC 2Z57B 4I56A 4ZCKA 2M2BA 3CDWA 3FCWA 4M5GA 2XGQA 4FS2A 1QAJA 3D68A 5KFOA 3AB2B 3SSSA 4IFVA 5KT6A 2X3GA 3PFOA 2AU0A 2A6MA 3GYGA 4KGXB 2CFXA 1GX6A 2WB4A 3GFYA 3HULA 5B0BA 3PY8A 4WXWA 4HVZA 3IN5A 1QAYA 2FJAB 4NMLA 1YJTA 3IO1A 4ZP9A 2AKWB 3I55S 3MR3A 4JI6J 5IXUA 5ETVA 1M5PC 4ES2A 3DOKA 3BR9A 1N6QB 2GCFA 1RT5A 4IH6A 1B3TA 4LRAA 1X9MA 3M8RA 4KO0B 3PO4A 4OHXA 4Y0FA 2CIMA 4DL0C 5HLFB 1Q4RA 4DCOB 2EC2A 4R0JA 2RF2B 3UQSA 1EX8A 1WTFA 2HWHA 2M8HA 5C2GA 1FK9A 2WCXA 3GSDA 3I9V9 5CYQB 4ZCLA 4P72A 2QLJB 3NGSA 3CULA 1B0PA 1EIYB 3KG0A 5K14B 5ETPA 3RZAA 4FYXB 4BS2A 4BDPA 5C2CA 2F9DA 3QT8A 4JI2F 1LEOA 1VQOS 3HZEA 3NEKA 3QSYB 3HK2A 2CVIA 3MMBA 3L7OA 4RW7B 1MROB 5K8OA 4GC6A 3IGVA 5JJBA 4DR6F 2PO4A 4P9SA 2VDIA 1SC6A 1FRXA 1ULRA 1AXQA 3DLGB 2HQIA 4E8UA 2BBEA 1C0TA 3H5UA 2EFNA 3MWBA 4B9NA 5D6GA 4B3MJ 3M2VA 3P45B 3T19A 2OHDA 5AXKA 3Q8SB 2R2UA 5F9NA 3V6HA 2QO3A 3UDEA 1EETB 3AHPA 3U27A 1V5IB 3J7ZT 4IG3A 1TL3B 1TTHB 2W2PP 4KV8A 1FJGJ 5T7LA 2JX2A 1PC4A 2OPRB 2BA9A 3TW0A 4A48A 3BSOA 3U7JA 1MMDA 3IC1A 1S6PB 4ER8A 1FRMA 2EKNA 4U95A 3TVKA 1RABB 1S1WA 1CC8A 2CQCA 2CPFA 5RUBA 4EK2A 4AYBD 4UQGA 4X84A 4DZ6A 1N56A 1AROP 4G3IA 1SPBP 1RTJB 1VIOA 3J81U 2DEIA 3QIPA 2R8GA 3F56A 4ED4A 1LWEA 1HHQA 1RWNB 3VAIA 1FDNA 2ROPA 2CG8A 1SI9A 4NA3A 2SXLA 2ZFHA 5KFRA 5KFXA 3W61A 2KG0A 3GWCA 3G4SS 2YPYA 2J0XA 3HLUA 2XSJA 4Q0BB 1TKXB 4CTAB 4F7VA 2QYGA 1BE4A 3HVTB 3H98A 4EO6A 3OUYB 4F4ZA 4FBTA 3D4JA 1XNQF 3QMQA 4LSNA 2VASA 2MQLA 2PT0A 3T9NA 2YH0A 5A8KB 1S77D 2AJ2A 5ETMA 4PABA 2RD5C 4ITSA 1NHUA 4V1Ak 4ZN3A 1GXLA 1N5SA 2M70A 4X66F 2KI2A 2DNQA 2QFJA 4QIEA 3VZIA 2ILYA 3ZZOA 4OYAA 2VQFJ 3RAQA 2XZWA 5IV4A 1LW2B 1YKWA 4B9LA 3BH7B 1ZH5A 5D4LA 2KFNA 4OYXA 4KBIA 1N34F 2CJBA 2XWYA 1HBUA 1NJXA 3ITHA 2Y1RI 5CZVA 1QLNA 1VISA 5EHHA 2IBOA 2MKYA 1UFKA 2P2CB 2XMUA 2BE9B 4OJGA 4LFAJ 3S01A 1U0HA 4C3KA 5DQGA 4FNIA 4DUZF 3PZPA 3TUPA 3MXHP 1X60A 3PKMA 1SL0A 3GCWP 2LP4A 3JQJA 2QGFB 4RBVA 5CHCB 3DGVA 4F67A 1V9OA 7AT1B 2MGZB 2WSCC 1N88A 2EI5A 2ZNZA 3C6TA 1LWXA 3CMQA 2EW9A 3JSBA 3GU0A 1XERA 3M8PA 2FY8A 2IVYA 2VG5B 3MM6B 3OR1B 2X1FA 3KJVA 2MQNA 1S0MA 4B17A 2B56A 5CD4A 3CC4S 2DGWA 4L74A 3TO8A 3PX6A 2WOMA 4ZHRB 5KFSA 2DYAA 2FC8A 5F3ZA 2Y3YA 1T0TV 4HT5A 2MY7A 1UWAA 1F9EB 1HI8A 2KRBA 2QZ8A 1HWUA 2Z2ZA 4MT1A 4IFYA 1U45A 2A1BA 3MPYA 1NK0A 4B3TJ 1NBEB 2W4PA 2YKAA 2VOOA 2NZCA 1RWXB 1WF0A 2RS2A 1RTIB 2CPYA 3DDKA 5DQIA 2ZM6F 4ECRA 1KHWA 1PG5B 3H4BA 1N5QA 2UU9J 2L9NA 1YJ7A 5D15A 1NHKL 2C2RA 3I4PA 3CCQS 1VQLS 4LFAF 2MZ1A 2CZ4A 3X1LB 1GH8A 1CJKB 5I4MA 3F44A 4J90A 5CA5A 5KFVA 3HHKA 3W62A 2ZITA 3ZZUA 4B9MA 2R7XA 2B8QA 5KFPA 3DLKA 4UY8T 1X4CA 3ZO7A 2UP1A 2DR7A 2NR0A 4FPIA 4GC7A 2HRUA 4ZIVA 4WK1A 3AODA 5A6PA 3PKYA 4DV0J 4U8YA 4XIUA 4WTYA 4DV0F 3GYNA 1K0VA 2QV6A 2XNRA 2B6AA 3D0IE 3MTKA 1T03A 4LBHA 1H3DA 3TVYA 3HHLA 4Y34A 3IR7B 4MK9A 3PNIA 2PC6A 2IM3A 4PR6A 3RB0A 3GV8B 1WEXA 3CD5A 5KG0A 2E7WA 1TZ0A 5B08A 3OJSA 3M8SA 5J2MA 1U8WA 4FPRA 1MMNA 4DJBA 2DNGA 1GXTA 1S9GB 2FVCA 3TAMA 2FHOB 3MURP 3LP0A 2VH7A 2QL5B 2DXEA 3JSYA 1D0EA 1DLOA 3N0VA 2AIRB 4OHYA 2VONA 3NY0A 1UZHA 2P6TA 4RBUA 3A13A 2BZ2A 3DMJA 1YVFA 5F8JA 5LT5A 2DY1A 3MD3A 2Q3PA 5M2RA 4DPXA 4KGMA 2ACYA 3KG1A 4OL8A 1T94A 3R7BB 1N36F 2W1BA 3VGSA 4JV0A 4Q44A 1RHUB 2IRUA 1R8BA 2RE1A 3OT9A 1FD2A 4ANCA 1RUSA 5IM0A 1VIXA 1YRUA 4M5DA 3W7BA 3FBCA 4C8ZA 2KTQA 2J7UA 5SUHA 1JLBB 4DBQA 1A0OB 3V6KA 3QLHB 5I3UB 1GQEA 1YRXA 2PD1A 1IKWB 1XNRF 2POKA 2VBYA 2AGPA 2FVPA 2GS8A 2NLWA 2WVBA 2Z2MA 4ILRA 1PILA 5KFFA 2YWHA 2BQ3A 2OD6A 4GKJF 4OI4A 4QPTA 1AB8A 1WOSA 4MKBA 4Y28C 3DRPA 3T1YJ 1X4GA 4ZVPB 2H4YB 2ZJQQ 4PWDB 1HQEA 2MHNA 3DRRA 1HHSA 5G0RB 3GIIA 2E9RX 1YZ7A 4PZVA 3H59A 4ECSA 5AT1B 2YH1A 3HVAA 2FYXA 3JTOA 3H5SA 3LQVA 2R7SA 4E2FB 3MCOA 5E2QA 1T05A 3A12A 1DTQB 2HIYA 2QX0A 3DRSB 3TEHB 2E9ZA 2YWFA 4KHMA 3C6UB 2MXYA 3HP6A 4J9OA 1CS4A 3PYFA 1QSLA 4ED7A 3O3LA 4F4YA 2YX1A 3E51A 4KGVB 5EN1A 3RR8A 3MECA 4I6WA 1HYSB 2EXUA 3IWXA 3MPVA 3B4DA 4I7FA 4LRFA 1QSYA 2OFHX 1B64A 5I3PA 2CQHA 1TV6A 1RBAA 2ZD1B 4LRCA 5DG8A 2W9BB 4HDHA 2YKPA 3KLGB 2FLLA 4IUFA 1U1RA 2APOA 4UOCA 3NNHA 3A3PB 3N6LA 4IO9Q 4NI2B 3OLAA 4Y65A 2M0GB 3DNCA 3QLHA 3L7UA 2MKKA 2AYBA 2OEKA 4ED5A 2QSFA 5B0CA 2AGOA 3DRPB 2HMIB 3BGOP 4FXVA 2QTWA 4NOHA 3ZFVA 4O44B 3RW7A 1RWPB 2DNZA 3AD8C 4DR3F 1S0NA 3D3BJ 2BRLA 5IZHA 2A0FB 4R5PA 3M7VA 4X65F 1S49A 2DBBA 2ZKUA 5K8PA 3TZZA 2A18A 2UXDF 1TU0B 4LF5J 2EWHA 1RP5A 2QLWA 3RJMB 2IBKA 2AYEA 4C2MA 4KFBB 1LWFA 4F36A 3V6DA 1FEEA 1F60B 2GGPB 3AB4B 1EJ7L 3PYDA 4C3LA 4CM2A 1DLOB 1W2IA 3PG9A 1RT1A 3PRVA 3E01A 4JBCA 4DCPB 1D8YA 2FLPA 2HBRB 4TQSA 4TLQA 5B7WA 2Y8YA 2CJ9A 4OYMA 3MOZA 4QIFA 2JEIA 2CDQA 1NU4A 3T6BA 1YSJA 2DNHA 4I2PA 2KT5A 1HARA 4AE5A 1N48A 1GMWD 2FHJD 2DIUA 1U7LA 2XBPA 1RAJA 3GSIA 4DG1A 8ATCB 5LMUF 1R89A 4B3SJ 4LF7J 4FF3A 2MKIA 2VPXB 5EUHA 1VFJA 1Q8LA 1V3SA 5ETOA 2AW0A 3LOUA 5D0HA 4DZDA 2EBEA 2L48A 1DZ5A 2DGXA 2X1GA 3R8YA 5L8RC 1TUWA 3DGPB 4A8YA 1Y5IB 4OHWA 4PG7A 3L7PA 2N3OA 3PO5A 3PJXA 2ZUAA 3I82A 5KOXA 4ECUA 4LF4F 1NZ8A 1RGVA 2Y9HA 2F40A 3CJ5A 4OZJA 5DETA 1XN9A 2ZH9A 3BBFA 2DIVA 5CD4H 1H74A 2XS2A 2VFRA 5KT3A 1UVKA 4RNNA 2HNYB 2H65B 4O4RA 3OTCA 4U96A 2RJZA 4LQ9A 2H1YA 1N32J 1LK7A 2ZZMA 1PBUA 4DF8A 2MMYA 3SFGA 3EPGA 4O0IA 1S6OA 2ASLA 3T5JA 1K44A 4JI8J 2AJ0A 3VAJA 3P6YC 2C2DA 2RUGA 2IA0A 4PWUA 5E3PA 3R5BA 3JSMA 1RTIA 1IM6A 2CQ3A 3LO3A 3VAHA 3VALA 2IM0A 1RU1A 2IM2A 4RKUC 2J8SA 5E3CA 4XPCA 2OP5A 2VDHA 1N8RT 4OLOA 3CD7A 4PKDB 1F0XA 1AZSA 4B3OA 1RA6A 1X4DA 4USTA 3FUYA 4R8UB 1UPMB 2E5IA 3GB0A 2QA2A 2PEHA 2C2OB 1HPZA 1UAWA 3KJVB 5LSLA 4EBEA 2J0QD 1V5VA 4M5HA 2AD9A 1TFWA 2BE7D 4F3OA 2QMXA 4RW9A 2AWZA 3FEXB 4LR8A 3KYLA 5MLCV 2B4PA 4ZLPA 4Y2AA 4DV4J 3BDPA 3DC2A 4E0DA 3A8EA 4LF6J 5HMZA 4Q43A 2DR8A 2RKIA 4ED1A 2WONA 4IH7A 2ZBIA 4F02A 3M8PB 4DPWA 4M8LA 1FO1A 1PBAA 3EMTA 3A8KA 3M1VA 2KB2A 1S1VA 1Z1ZA 2XS5A 4ES1A 2MHEA 3BDEA 3NOGA 3KHHA 2Y1IA 2OSQA 2IM1A 3DM2A 5HL7Q 3KXDA 2DH8A 4WFYA 5IT4A 1UEVA 2ZH6A 1UCNA 2GJFA 1VS3A 2ZHAA 3RB3A 3R5GA 1F9FA 4PUOB 5DM6Q 2XHCA 2DRBA 1BQNA 1VQ5S 3O6QA 1VQYA 4PXDA 4B08A 3TEGA 4A8MP 4I67A 1KQFB 1KQGB 1OSCA 4P7TA 4ZJOA 5HO4A 3TA0A 3M9NB 4JI7F 2D3O1 4X62F 4FF1A 2WVCA 1FRHA 4PQUA 3KOAA 2DY9A 2B9EA 4DL3A 4B3MF 1X4FA 5IT9Y 1UP1A 4QWEA 1UWBB 2XLJA 3QIPB 1HQUA 1RA7A 4CH1A 1M90T 3HVTA 2JFKA 4HI1A 2HMIA 1L3TA 3R6LB 1WKJA 2LQ8A 3R1HA 3CVKA 3HPOA 2DPJA 1OWXA 1R6VA 1L3SA 4NLUA 2VFSA 2DGQA 3I5AA 1NDCA 3N5BA 3PM9A 5E3RA 1TV6B 2ZD1A 5D0RA 3CDAA 5CYMB 2FJWA 1Y5NB 2YTCA 3LP2A 3EZUA 3NAHA 4MIAA 4QR0A 4USIA 5F8HA 1D09B 1KDNA 4UT4A 3CJSA 1M5HA 2XQCA 1S1XB 2XC9A 1HNWJ 1PJ5A 2OEMA 4K2XA 1NH7A 2CJAA 1SH2A 4OZ0A 1PC5A 1HNXF 3IS9B 2GZOA 2NXUA 4HACA 3D67A 3DRSA 4PG8A 1VRUA 3PV8A 1T05B 1KC8T 2UXDJ 1YWXA 3QBCA 3P8BB 4I2QA 4X62J 5KTQA 1BWVA 1OMSA 2IAJA 3OXLA 2LXIA 4HEA9 2W9CB 4DUTA 2CQ0A 2C3YA 2C3OA 1Y4ZB 2C2MB 4WE1A 1KBRA 5B0GA 1P8GA 1HQEB 1VQSA 2YY3A 3IWNC 4WZQA 3EE3A 1M1GA 2R9LA 1PYOB 1OJ4A 2QT7A 4PYAA 3MPWA 3KFWX 1WHYA 1S9FA 2J6SA 4DSJA 3QRQA 5FDLA 4IDKA 5HANA 3CWJA 2VL1A 1OPZA 3JQKA 4CM0A 1WTBA 4F0KA 3BGLA 3LW5C 4AXJA 2NPIA 2O1PA 3DOLB 3GE9A 2DCUB 5CABA 1IBLJ 2W9CA 2RSQA 4DR1F 2CYYA 3FFIA 3M6UA 2I5JB 4FZVA 5E3AA 1SL1A 1FJGF 4M5NA 2BOAA 1UW9A 1YJRA 1WACA 4J91A 2MKHA 3D1QA 5HJXA 2HHXA 1E6VA 1X4HA 3KLIA 1EAYC 2KFZA 4DMZA 4X4RA 1SKWA 3FZBA 4JV5F 1S1XA 4QWDA 1LW0A 3QATA 3Q22A 3SSRA 2BKOA 2V5HG 5DGBA 4YUDA 3KDOA 2YQ0A 2E1AA 4GVBB 4PG5A 2KHDA 5KFCA 1VQ9S 3DFEA 1KS2A 2BX6A 3LP2B 2G4BA 4QCLA 3SYZA 2Z0GA 3GZ7A 2VG6B 2LMIA 2AX1A 2LXUA 5A0YA 3TANA 2G0JA 2UZAA 1NJIT 4ILLA 4LVOP 3W60A 1HNZF 1VOMA 2YNFB 3FZ2A 4K4XA 3MEDB 2QA4S 4AQYJ 3NLCA 4RU2A 2R7RA 1M5KC 3DU6A 4I6YA 4LSLB 1W7WA 3TJAA 4DPTA 1JLFA 2K8GA 4ZP8A 4DL6A 3OR2B 3LANA 3JXOA 3Q8UA 3MMCB 4EO8A 4OHVA 1WHVA 3D6TB 3MAQA 1U26A 4DL2A 1NK8A 1CLFA 3K17A 1UFLA 1Y9OA 3G87A 4ZVTB 2ERRA 2CJQA 2FGCA 1FRLA 2PN6A 4LFCJ 1UEUA 3WIUA 1LKZA 4QYZJ 2UXCF 1HBMB 2MLYA 3C14B 1NHVA 3H2LA 4OFZA 4ZVSB 5GAHI 2FC9A 3ZNJ1 3HX9A 1QTMA 1TL4A 4DLGA 4B9VA 1V6HA 2V8GA 2U1AA 3E8OA 3HHLD 4H54A 3SCIE 2VKRA 2DKOB 2AQ4A 5JVHQ 3VZHA 1FTRA 3W8GA 1GMWA 3MUTP 1K73T 2C2ZB 3OVBA 2DT9A 1YG0A 2EG2A 5AXLA 3GPAA 4C98A 3VCDA 4RX6A 4OYZA 5L9NA 1X0FA 1VBZA 1HW8A 1HIYA 4D3HA 2RKIB 4IH5A 2V4JA 1WNEA 3MCMA 4B3SF 3CD0A 4QU7A 3EGNA 3FJ2A 3KLEB 2OH2A 2CNNB 1RT2B 2RVJA 3WC0A 3GIMA 2VFVA 5H9EJ 4QJVA 4YHHJ 1Q82T 1FHTA 2CAJA 2ASDA 4Q7AA 2WBRA 3CJ0A 3DU5A 4RWWA 3TZWA 3IMQJ 3PYGA 3ZZZA 3A1YG 4ZP7A 1LV5A 3BO2A 5AXNA 1AW0A 1RZMA 3FQLA 3TARA 1YTYA 3UR0A 1TMMA 2ZH1A 1SC4B 1D9DA 2VOPA 3NGRA 1DHMA 2PMHA 3FMWA 3M30B 3CCZA 4H4KC 5EWGA 4DV5F 3O1LA 2W24A 3TP2A 4NLSA 2B4OA 4E98A 4ANEA 4NCGB 4LBIA 2BANB 2DRDA 3DDNA 1U0HB 2GQQA 1GFWB 1E6YB 1S1UA 2V8HA 3HKWA 3LUYA 4WP9A 3M9MB 2HYIB 3MM7A 4DFKA 1CSJA 4HDGA 1N33F 2OSRA 4O0NA 1HBUB 4BWJA 3M2RB 1NPRA 3FSYA 2K7KA 3I4HX 1N54B 2FVQA 2HNYA 1KONA 4Y2IA 5F0WA 4A46A 1LW2A 1P27B 2HK3A 2KDOA 2WBMA 1R43A 4I69A 5KFWA 4KHPF 3BS9A 2HHTA 3AQOA 1X8DA 3IA0A 1F9HA 2XMTA 3ZZTA 2HHHF 3T1YF 1I5OB 2WZ1A 4CH0S 3PW4A 4M95A 3ILIA 4YR0A 5L1LA 1X4BA 3LAKA 3IGNA 4NLPA 4LSLA 1YJ9S 4P2XA 4OJ3A 4DV7J 1K8AT 2B4UA 2UUAF 1RDRA 1FRKA 3BJYA 3J80U 1FDDA 2NSCA 3QFHA 4CLTA 2XSJB 4LSZB 2ALZA 1SJFA 1S0VA 5DGAA 2JLGA 1ZM4A 4F2RA 1HNWF 1UKUA 2W25A 5E7OB 5M2UA 2JZ5A 4CI0B 4LF6F 2F4VF 1JLFB 1KLMA 3H5XA 2HSEB 2RS8A 3BM7A 2BJ7A 4FNHA 4I6AA 1MLAA 4KHRA 4XK8C 4ZVRB 4CO2A 4ECQA 4ZVEA 1REVB 2UUWA 3GG0A 4KB7A 4LR7A 4I68A 2VQEF 3R1LA 2UXBJ 2LKZA 5B09A 1LFWA 1EKRA 2ZHOA 3QJLA 1AT1B 3AXKA 4FYWB 4P52A 3EICA 2HGMA 1SXLA 2Z30B 1JLEB 3UVJB 2KFYA 1XJWB 2YKNA 2R2TA 1C4AA 1VYAA 2I8EA 3ZZ0A 1B99A 2CRLA 3L3CA 3GQCA 3AXMA 2L41A 2EC0A 2DHSA 5I3UA 3KDNA 4NCGA 1CG2A 4JI4F 2JVRA 4ECZA 3G9CA 2J6TA 2YWEA 3IG1A 3Q2TC 1CJUA 2IJNA 3KLIB 3OLBA 2BQUA 1C0TB 5EGYA 1WI6A 3MCNA 2HZAA 3GJSB 1BQMA 2K7JA 2BRKA 4K4TA 4K0KF 2IHR1 3MAHA 1NXIA 1C0UB 4DQSA 3AFGA 1RK8A 2BJ1A 4N8NA 4CLSA 3GFZA 3PYEA 1TMJA 2CJYB 2V8DA 3DOLA 2I0XA 1GEHA 3DDIA 2HVEA 1XC9A 1HW9A 2DHAA 3PW7A 3EYZA 1TKZA 1VC0A 5KFLA 4QW9A 2IA6A 2NUUG 3K5OA 4AXIA 3IM8A 3HXMA 3H2UB 2NUHA 4I2QB 3GG1A 4F25A 1K1QA 4TQRA 2B43A 1FX2A 1T11A 3GJTB 4QIGA 4ICLB 4DSEA 3HZGA 1TFYA 3VVTA 2LU1A 4DUYJ 4LIWA 2C2EA 1NSPA 4DOZA 4NXNJ 3C6UA 3QPIA 3PCOB 4H4MB 3I87A 1OY9A 2WHOA 3MOJB 2HHSA 1TUGB 4ECTA 5IT9U 2FB0A 5IQQA 1LQ9A 1JLEA 3UVJA 1K47A 3BQ2A 2MSTA 2MZJA 2ZH4A 3B4MA 1JNRB 5ETNA 4ATNA 2YNGB 3DI6B 2VZ9A 2HHWA 4CYUB 1WC4A 3CPWR 5DQHA 4KH0B 2HFOA 5KFDA 1FDBA 3AQPA 4HH1A 2XO6A 4K4ZA 5BYSA 3OSPA 3EXCX 1RWWB 1KLMB 4LT6A 4UQTA 3N28A 4I64A 4F3MA 2OUGA 4WYWA 4EGLA 5HQMA 1FESA 3JSRA 2F63A 2GVZA 4G1QA 3K57A 2QIFA 3BO4A 4G6VB 2OPPB 2RRAA 2VD3A 1JXEA 3MI7X 4NYOA 1D1UA 3BPDA 4JI8F 3T9ZA 4C8YA 1QE1A 1HBNB 5KFQA 3P4UB 4PAAA 1NB2A 5KT2A 1JLCB 4RR5A 4AL7A 2BR0A 2ATCB 2JFDA 4WPAA 3Q24A 2PIIA 4LFBF 3M8YA 3L09A 1HD0A 4TXSA 1OQ6A 5HBMB 1SBRA 4J9MA 2RIJA 3GIRA 4XTTA 5F41A 1RI7A 2XHWA 4C8MA 2B9YA 2GX8A 5A2QY 2VODA 3BB5A 2CQ4A 2MB0B 2YPZA 4MIWA 2VPZB 6FDRA 1A6LA 3R2CJ 2Q79A 1S1VB 1WSVA 3FGVA 5BYQA 1EHWA 2M3DA 4OZLA 4DX5A 3MUMP 3ZTRA 1Q86T 4DQPA 4MKYA 3BSNA 3TX0A 3W9HA 4AT1B 4MKVA 2HK2A 5C25B 2KM8B 2VHGA 1YJWS 1YK9A 3B6BA 3JQMA 4TY9A 1ZZFA 3A3NB 4MFBB 2QL7B 4DV5J 4DWIA 2C1EB 1VGYA 2DD8S 3VAMA 1VC6A 4QR1A 4W92B 2XGPA 3MGJA 2DH9A 3DYAA 3AA8A 2RQ4A 4DV6J 1UMJA 3G6ES 2CPZA 3V5RA 5IQ6A 4NMXA 5C5JA 1VBKA 2DB1A 2Q43A 3R97A 1CBKA 1SUQA 4DV1J 4FXWA 2LA6A 3M32B 1T9VA 3O44A 2HHHJ 3V4MA 3A4TA 4FS1A 4DF4A 4JI3J 1Z2ZA 3BGUA 2UUBF 2FDNA 3NS6A 4AL5A 4EWTA 3PHTA 2V4JB 3M8QB 2DEJA 2J7WA 5E5NA 2MQQA 1YBUA 3U1LA 4U9RA 2UUCJ 5KFYA 4X4UA 2R8JA 2GQCA 2YNIB 3OTEA 4EYIB 2D3ZA 4ZVUB 2HNZA 2XSFA 2Z2YB 3RRKA 3SDEB 2PMWA 4QBUA 1IM4A 2K1RA 5CCLA 1REGX 2AYMA 3CJ2A 1NO8A 3IXQA 2XY5A 1R0AB 3LPYA 1KP6A 1TL7A 3KK1A 2XS7A 4CQ1A 4CLKA 3KMQA 1TUVA 2MKCA 4LRBA 1YRTA 3BKFA 4R5PB 3CDUA 2OIHA 3HSGA 5DLFA 4C6AA 3R7SB 2CXEA 3KK3A 1WKKA 3AT1B 3MPDA 2GHWA 3N79A 2BYCA 2XMAA 3OXGA 2VG5A 3MM6A 4UY85 3NMRA 2RQMA 1TL1B 2G2ZA 1VLOA 4NLOA 3N6MA 4IKAA 2G0IA 2LXFA 2M9KA 2MY8A 3OR2A 4OIXA 1F6TA 3FNNA 2HFVA 3VV2B 4QPXA 5LJ3Y 3OJUA 2ZH8A 3Q8YA 5AJ3F 2BOPA 1CVJA 2Y0BB 2V63A 2UUCF 4P2SA 4ZVOB 4ZDNA 1WDDA 4XDCA 3ZTQA 1YIJS 1TAQA 2V2ZA 3K0JA 3AH6A 1CULB 1C1BB 1RAFB 3LWLA 5A0YB 3E2EA 2Q6BA 2ZZTA 3I56S 2H5EA 4ZLLA 2A10A 2LQBA 3H42A 4DG1B 3CJRA 2LECA 4LFCF 2CQBA 4F26A 2BW2A 2OPSB 3CCVS 4GVBA 4K8RA 1RAIB 2BMBA 3S7RA 5EX0A 1LW0B 4U7UK 1PSDA 3MTJA 1GTEA 4PPZA 1JJ2R 3U1MA 1VQPS 2ZBCA 5EWFA 3M2RA 4RL1A 3IRXB 5A8KA 3DLLQ 4DPUA 4ED8A 1S9EB 3MM7B 5KFIA 4OYOA 2EFPA 1LWFB 1LXJA 2DJWA 1JLGA 4CTAA 3NMAA 3ZTOA 4D3GA 5HQ8A 3FEYB 2VV5A 3MR2A 4NI2A 2DTJA 1U1PA 2HHUA 2E5LJ 1NPKA 4DLEA 4GO5X 3QT7A 5JMNA 4RW9B 5F8MA 4O4GA 5DDPC 4DV7F 4ED2A 1J5OB 2QE5A 4WTOB 1R8CA 2UUAJ 2EK1A 4IRDA 4CLLA 2I6WA 4O44A 2PFFB 2N7CA 4K4WA 1I6JA 1WOPA 3CIZA 1XK8A 1YX2A 1ZM2A 3TUZC 1RTHB 5BYRA 4Z7CA 1DY3A 1Y10A 8RUCA 1N5YA 4IOAQ 5C24A 2HNDA 3G8QA 4OX6A 1WC3A 3ZTPA 4NZ0A 4C9DA 3QWPA 2JOQA 3D9BA 3LGNA 2UUTA 2CPIA 1YQHA 4MK8A 3L9ZA 4HACB 1U1LA 2EKYA 3IS9A 1TP7A 1Q16B 1VRQC 2CNKB 2DNMA 1RAEB 3W9JA 4RW8A 1FNMA 1ZA2B 2YQ1A 3QAEA 5DJBA 3K59A 4WBFA 1RADB 3ILOA 4TN2A 4KPYA 2XY6A 1SJ1A 3KLFA 1FVSA 4N76A 4Q8FA 3DRYA 2DR9A 3SCKE 4FVMA 2ZJRQ 3HD1A 1WG1A 1WKLA 3DRXA 2OI2A 3DRRB 4J5OA 3W5YA 1S6QB 1YITS 1O5JA 1S79A 1FKPB 2RRBA 3Q83A 1R31A 1HI1A 4KYZA 4RU9A 3KMSA 1Y3KA 2AEMA 4ECXA 1U48A 3MMAA 4N56A 2V34A 3DGPA 3VQTA 4X4PA 5BR8J 3NP5A 4AFFA 4NLVA 3UNGC 4C0HA 3ET6A 3M8WA 2IVFB 1I94J 3KKFA 4DR7J 1FWLA 5KFBA 3QZ7A 4CNYA 1F3VA 4A8XA 1RYRA 3W1YC 1KRPA 1CQNA 1MU2B 4EZ9A 4ZS6A 4DUZJ 3CB4A 1JLBA 1P9YA 4ZVFA 2PDAA 2BE2B 4PXCA 2ZVIA 5H1SV 3CMAS 2YKMA 4CWBA 2RDDA 1IR2A 2DHGA 2E66A 3BGRA 3JTNA 1RWOB 1KHVA 6FD1A 3Q8QB 3MEDA 1SV5B 4LF4J 2D3UA 1RT4A 2RRNA 3NOCA 1HBOA 3BBBA 2CQIA 2H5JB 2W9AA 4DV1F 5J1NA 2C22A 3BR8A 2VQFF 4LQ3A 2XCPA 2W2QP 2IMWP 2XB2D 4RNOA 3BGRB 2RU9A 2WVEA 4OX9F 5M2PA 3V6DB 2DGVA 2ZH7A 4B3RJ 3MM9B 3FVYA 4R25A 2GHVC 4F0HA 3OVAA 4H4KA 4JUZA 4USHA 1DTTB 2W7AA 1RHQB 2G1HA 1MU2A 2HBYB 1S4FA 3D6MB 4J9NA 2KJVA 3H2VE 4DX7A 2HLUA 5L46A 4YY3F 2RU3A 1IWAA 3K5LA 4EBCA 1ITPA 2V8VA 4HLBA 2FHKA 3BQ0A 1FI4A 3D6HB 1SH0A 4MYTA 2I5JA 4X64J 4M5LA 3TAPA 4A8KA 2FHMA 3CGIA 4DQIA 3I6PA 3O5TB 2HHQA 3Q23A 1JQGA 1NAQA 5GAGU 5A76A 1VQMS 2GV1A 1HPZB 1P1LA 1UEKA 1V3RA 1WOOA 2QMUB 2EFVA 5GAEI 1K9MT 2DPIA 1HNIB 4NL5A 1Q8IA 1NKCA 1H73A 1U2FA 4A47A 4KE5A 2KN4A 2VU5A 4O3RA 2L08A 2XYHB 3QO9A 4NLGA 1WC5A 2CA9A 2H3EB 2BKNA 4LBPA 4A8FA 2MZQA 2BV3A 2WRMA 4CLUA 5EX3A 4J9SA 2DRAA 4ERDA 1S59A 2NYHA 1G2EA 2XEXA 3RBDA 4JV2A 3LWMA 3F0NA 1GMVA 5KG4A 2KT2A 4DQRA 4C11A 2HFZA 3ISZA 3DXSX 4LF1A 5B0AA 3RBEA 4G1PA 2AYGA 3CCUS 1GT8A 1OQ3A 2G13A 3UFCX 2AGQA 2MKJA 1X4EA 4DHVA 1QAIA 4NCAA 4KH1B 4ZCIA 4TVAB 4ZLNA 4DI6A 1VBYA 1H2VZ 2CPEA 2QRRA 3RTVA 1OY6A 1T9YA 3G96A 2DGOA 2DNYA 4QU6A 2NZ4A 3UCZP 1DARA 3UDVA 4ZPDA 2DNPA 4YEAA 5E41A 3FC9A 4PXEA 4QW8A 3ULHA 3GMGA 4HI2A 1Z2LA 4K2JA 3C15A 4U6PA 2L9DA 3EZ5A 1F3FA 4B9SA 3M2UB 4JI0J 4NRTA 1B0TA 4UOGA 2E9TA 1HWJA 4HHJA 5IM0B 3FCVA 5GMKa 1IBKF 2E5HA 3OSNA 3C6TB 4AL6A 2O66A 1RISA 4JI4J 2L9WA 3LAMA 1N36J 2UVRA 3NBPB 3LTOA 4QIWD 3AD7C 4ZPVR 1MG7A 3DLJA 4JI6F 1H0HB 4KSEB 5F3TA 2LQ5A 3VQSA 3ZXWA 1JIHA 3W9IA 4K59A 1VR6A 1N34J 1UVLA 2KZZA 3PEJA 1SJQA 4OZNA 1IBMJ 1YJVA 1DJ0A 2FPHX 4JB8B 3ITHB 5JVGQ 3E01B 5GAHU 2AJFE 2O3DA 3DHWC 1PKUA 1ZPWX 3SCLE 3CCTA 5AE1A 4J9RA 1JX4A 3DLHA 3OTDA 4KFBA 4O3NA 1W2BR 5T14A 3CW2C 3KJQB 5J1EA 1ZM9A 2DNOA 3NWRA 2CPDA 3H90A 3M1VB 3FCHA 1SQGA 2VICA 1KFDA 4MKAA 4DR6J 2WSFC 3NGTA 1RYSA 3PW5A 1VRTA 1WHXA 2CDRB 1RTJA 3THTA 5GADU 3UD3P 3VF0B 5H9EK 1L5UA 1AFIA 4TNOA 4P71A 3TAQA 4DCJB 2B6AB 1T03B 4X2BA 1U1KA 3NGUA 4B9UA 1EQMA 4Q0BA 2AJ4A 1TL5A 4N5SA 1QUPA 2CVEA 2DHXA 2QLBB 4OI1A 4C11B 2NREA 1FD8A 2E1MC 4HR2A 2JC0A 2UVWA 1TL7B 3RG6A 3KK1B 3DLKB 4YHHF 2R7TA 5C42A 2ZEJA 3V81A 1DAXA 4DS5A 2Q1LA 2VA2A 2EVZA 1X7VA 4NYZA 4FF2A 3KG4A 5J2PB 1C1CA 2BJDA 4B3OB 2HNZB 1IQTA 2D69A 1FWPA 1IN0A 5KOWA 2DO4A 1I94F 2MTLA 4DR7F 1MNEA 4EFAC 2VBZA 1IBLF 2MSSA 2XMMA 4EEYA 1KEKA 1URRA 4P2FA 5ETSA 3S1TA 3M8QA 1TL3A 3D6FB 2ZH2A 1EQ0A 5D0EA 2MQ8A 3ZC4A 4ZPBA 4O3QA 4GKKJ 1BXNA 3MMBB 4RW7A 2VIHA 1FFSB 1K1SA 3J80Y 2YKQA 3LP1B 3QWUA 1NZAA 2IDEA 2ZWPA 3NGDA 4LR9A 3T5HA 3CDEA 4W4MA 3MEGB 1IR1A 2W4CA 4DFPA 3TNVA 1HNIA 2YNHA 5HLFA 4CT9A 1F5CA 3N4WA 3SQGB 4GVLA 3UWTA 2CQ2A 4CP5A 4LF9F 4F04B 3CXCR 2B51A 4M5DB 5K14A 4DR1J 1JWWA 2NCKL 4NXNF 2JDJA 2B7BB 2DR6A 2IC3A 4UOHA 4HL9A 1CC7A 1ZS6A 4X4OA 2BVZA 2MPUA 2JEFA 2HS0A 3Q89A 3FBFA 5J2MB 4LF2A 3CCJS 2GAGC 5G4DA 1SVDA 2AMCB 5DDQC 3EZOA 4KC5A 4PWDA 3I0RB 1WG4A 2MZRA 2BE2A 4NPOA 5ETKA 4JI1J 1S72S 2CQ1A 1EB0A 3PIPQ 2CG4A 1LNQA 3PEHA 2W2MP 4OHZA 4URQU 3B8HA 1C1BA 3MHYA 4RO0A 3LP0B 4UZBA 3HO1A 4IRKA 2G0CA 1TKTA 1QJHA 5ETTA 3ILLA 3SQOP 2QEXS 1IVZA 3G6XA 2CWXA 5FIIA 3RAMA 2YKMB 2L3MA 3R3TA 2VBXA 4CO4A 1TKDA 2KH9A 4UUXA 4NLTA 4CLPA 5IWAF 2NS1B 3OD2A 4ES3A 1MSWD 4P10A 4ED0A 2YNHB 3I31A 2H51B 1S48A 3WZ0A 4NYPA 5HROA 5F8GA 1PYTA 1U49A 1OIAA 3POTB 2NPFA 3SMZA 3FK4A 3MMAB 4HH0A 2KZMA 3N6NA 1WI8A 2F3JA 3G8TA 4EYHB 4IG0A 3QRPA 2CPJA 3RB6A 2PA3A 2PSZA 2IY5B 3VGTA 2X1BA 4WF9Q 1S1WB 2ZDOA 3UN2A 3J7A1 1U02A 2DHHA 4URGA 4DSLA 1N0VC 3CF5Q 1VQNS 2D74B 1T9WA 2W9BA 2ZBPA 3QYYA 3OPKA 4PPDA 3SDEA 2R2SA 2GJ2A 3M05A 4CLYA 3M6XA 3BN7A 2Q66A 3MEKA 3C66A 4KV8B 2JJ4D 3SIPB 3OHBA 1RTDB 5F8NA 3G82B 3AAWB 2J9DA 1N5YB 4W90B 3M2VB 4C0BA 4TU8A 4L3KA 2XYPB 5KFEA 3NCPA 4P75A 4AUKA 3EVMA 4DN0A 2H54B 4X4NA 4U7CA 1OYDA 1GTHA 3HHEA 3IR6B 4NRUA 5HI7A 5K9FA 1UVMA 3BREA 3EUNA 2UXBF 2G2OA 4DR4F 1TK5A 4A8QA 4IFYB 2RILA 1PGZA 2O5DA 2OPQA 3VR1A 2RDJA 5KFZA 2HHPA 3EDQB 2P5VA 5C24B 1WD6A 2XI2A 4UTGA 1IJFB 2WOMB 1NSQA 4ZHRA 2QJ3A 1R0BG 2NSBA 3ISNC 5F0UA 3R27A 5T41A 4DPOA 1KVKA 3MR5A 2W7OA 5CYQA 4JV5J 3DYAB 1SKUB 2JLEA 1WEYA 4OYWA 2FTRA 3R9LA 3T1HF 4RW6A 4M5MA 2ZC3A 1CJUB 3BV8A 1FFGB 2N4DA 3D66A 3B82A 4MH8A 5FLXY 4U8VA 4JYAJ 1OO0B 3OFGA 4FKXA 3LGHA 2BJ3A 2GMHA 2OPSA 3SFUA 5KT5A 1N6QA 4TKTA 2I38A 5JUMA 2P8IA 4IR9A 4NASA 3CCMS 1ZM3A 2LCWA 1QSSA 3ELHA 4DU8A 3VAFA 1MMLA 2HS3A 3HD2A 2VFUA 3L95X 1MN9A 4WIIA 4M5JA 3UN5A 2UVUA 3DOMA 2DGTA 2E5GA 1RCOB 1JLQA 1ZBTA 1QTNB 4ZPWR 4KHPJ 2RDIA 1UETA 5H9FJ 1G3OA 3GFHA 4Y2CA 2CPXA 1OPIA 3RW6A 3DHXA 2XMVA 4CO5A 4MIBA 4ELTA 3ENQA 4KT0C 5I3QA 2KYXA 2MLXA 1JLCA 1Y3JA 3D0HE 5KG5A 3WIVA 4F4WA 3OUYA 3QGIA 5EDWA 5FD1A 4DSFA 1R0CB 2CUYA 2LA4A 2R42A 3C15B 3KUEA 4C8KA 2OPPA 3U1NA 4EI2A 4CO1A 2C2KB 4AD6A 1R8AA 4DR3J 2B5JA 2HPUA 2GJIA 2KT3A 2DISA 2GIRA 2OMOA 1RACB 2V6AA 3A8JA 2UV8A 4LREA 5KG7A 5KFMA 4Z37A 2EG1A 5DDRC 2CQDA 3FBEA 4A8SA 2IFXA 2MDAA 2K1RB 3ZNUA 1R0AA 4LF8J 3KTQA 3HJFA 1CJVB 3GV7B 2KO1A 3IBCB 5I42A 1M5VC 3MD1A 3SEOA 1EARA 3D2WA 2WAQD 3LF0A 2YNIA 2V94A 3AJ2A 2JHEA 4QR2A 2KL8A 1CPZA 4C8NA 4BC7A 2HW3A 2ZBQA 1HR0J 1NSAA 2DH7A 4L3NA 3VHQA 4ECYA 1ELOA 1R8HA 4J9QA 5ADZA 3SV4A 4DUYF 4CCHA 3ENWA 5CAAA 5A2QU 5LMUJ 2IDLA 1QUVA 2R7OA 2WW8A 1WHWA 3IAM9 3O2IA 1X4AA 2ROGA 4MTPA 3H25A 1RAOA 5DLGA 1RB0A 1BMQB 1G4CA 2RHQB 1EP4B 4I4BA 3OXFA 5J2NB 1N52B 1HMVA 3C19A 3AJDA 1FKOA 1YZ6A 2XI3A 2ZUGA 1MROA 1N0UA 1RLDA 3M4XA 4K4UA 3HCXA 3QRRA 4F4XA 4J37A 5K8NA 2J8AA 4MAKA 4DN9A 3RRHA 3EGVA 5U47A 4OZ5A 1SUQB 2JWNA 2GFFA 1RAAB 2XG8A 4WP3A 2HVHA 1R7IA 3D1OA 4JI2J 4DQQA 1XNQJ 3CTRA 2BJEA 1RWMB 1AA1B 1VRUB 1IQZA 1WUUA 2DNNA 2H4WB 2ZNYA 3NAIA 4RW4A 1G6BA 4IO1A 4N7TA 5GMDA 4WCEQ 3BGFA 4O3SA 2XYGB 5B0FA 3A3OB 2HBQB 4NLRA 3MFIA 1G7CB 1Y00A 3QAUA 3AY0A 5IWAJ 1CEZA 4OYIA 4YY3J 4F2SA 3OVSA 4MFBA 1RWUA 2ZVSA 4L73A 4LF7F 2BM0A 4C4WA 1RHRB 1FXLA 2RT3A 3MM8A 4P2MA 1RT4B 1HQ2A 2O67A 3TQ1A 3BEGB 2LEAA 5KAKA 4ALZA 4IFVB 3HVRA 1EKSA 1BQXA 2E5JA 2PA8D 3G71S 1VQ7S 2GO9A 4V19X 2C2NA 4P73A 1F2HA 2DNRA 3L4BC 4G1IA 2Y1LB 4O3PA 4NZ6A 4J9VA 2F8MA 4Q2LA 4HHHA 3N5FA 4FYYB 2R2RA 3G8SA 3FSXA 5HMWA 2J9CA 4JOUA 1SJ3P 4OI2A 1RT7B 3HT3A 3PJWA 3HHLC 1JXVA 4KRWA 2X7IA 1VQ4S 2VKZG 2HFNA 1FXRA 1IBCB 2PI5A 2BXJA 1U1NA 3EGWB 2LU2A 1MWZA 1T9UA 4YB6A 1YBAA 3BPSP 1HFEL 4M5KA 2HFUA 1VK3A 2LDYA 5D4NA 2HAIA 1J5EF 5CYJA 4QOTA 3C3LA 1UVNA 2PMZD 1U09A 3I0RA 2JVOA 3UNYA 4DU7A 4DV2F 5IS2A 4H4MA 1YJNS 4PXBA 5A6WA 1XMOJ 1NKBA 1VDHA 4WP8A 3V6JA 1QAXA 4K7QA 1E6VB 1NB7A 1XNRJ 4ICLA 3US5A 1S76D 1YJUA 2KVQE 2AJQA 3R5JB 3ENVA 3KUGA 3TA1A 3TJ8A 3TA2A 5LSRA 1H2TZ 5J1PA 5HMXA 1LXNA 1X31C 4ZLJA 1U2CA 1U1OA 1DFDA 3W2VB 2W01A 4OQJA 2F8HA 5A8WB 1EETA 4XDDA 3OQ2A 4OX8A 5BJRA 4DR5J 3SZ2A 2K2PA 2J7KA 3HFVA 1FKOB 4ZN1A 5DDOC 4OMFG 1HMVB 1XWLA 2YVSA 3BYPA 3MAAB 3PHEA 3PRBA 4M5IA 1TK8A 2QG9B 2Y0SD 5L1IA 3MEGA 1AZSB 1EZZB 4OJ1A 1NK9A 1FNXH 3EWGA 4M94A 3RYLA 4DS4A 1D3WA 3GJQB 2JEJA 1D9AA 1VMBA 4OZ2A 3LP1A 2HIQA 1RAHB 2CNLB 3KLEA 1IKXA 1ACMB 2WTFA 3J7YI 1FTCA 1RHMB 3K58A 3K5NA 1UJ6A 5IT0A 2DR5A 2GQ2A 3UPFA 6AT1B 2IJFA 5MAOA 4NA2A 1RWKB 1BQMB 3THPA 4FKYA 4BLGA 3PX4A 3PR5B 2M8DB 4W98A 3J7Z5 3K8VA 1FRIA 4RJVA 3UCGA 2ZM6J 2FZCB 1U24A 1F2GA 3CIMA 2VUGA 1REVA 2YKOA 1C1CB 2DNKA 5F8IA 2BM1A 1KQSR 2W7PA 4NEZA 2NYIA 2ZWOA 2R8IA 4ZJQA 2QL9B 4DR5F 3VVUA 3C14A 1ZAXA 3UI3A 1IKYA 2HWIA 1IJEB 2HURA 2BQRA 1APSA 3IWLA 1M0SA 1BUXA 2FGOA 1CULA 3NWGA 4M63A 2M5YA 2V9WA 1KTQA 1CJVA 5CH7B 1OS5A 2HWTA 3CEDA 3I96A 4C7QA 4PRFA 3SXLA 1WF1A 4WKRA 3C8YA 1D8ZA 1IBKJ 1B7FA 2DK2A 4LUBA 4UOFA 2GW8A 4YFUA 2ALYB 4ZOSA 4DR2F 1N5VA 4PWWA 3Q0AA 4DSKA 5THWA 3QGHA 4CRJA 2EFOA 5AJ3J 2CZ9A 4BWMA 2XULA 4N8OA 4PQUB 4X4TA 4I2PB 3KK3B 3B54A 1U2RA 2MEWA 3LH2S 4ZPTR 3EX7B 4DFMA 3RAXA 1JKHB 2GMJA 1YLXA 1I51B 2NXJA 2RMLA 3IRWP 4Y3CA 5GAEU 3W66A 2FY1A 4ETXA 3BZQA 4ZK7M 2DGSA 2VC1A 4EU0A 2OJ3A 1PYSB 1YI2S 1DRZA 2D7SA 3HHDA 5L38A 3CO9A 4ZCMA 3O8WA 4XO0A 4X4QA 3R2DJ 1BC6A 1NUEA 1FWKA 4EMDA 1WC1A 1LWCB 1FE0A 2N82B 2QA4G 2R7QA 2AX0A 4DX6A 2KG1A 1KNZA 2PE8A 2IIHA 4IYQA 1RBOB 4ILMA 2QLFB 1H98A 1S1UB 3R5AA 2JL9A 4YS2A 3FSIA 4AQYF 3PDNA 2M88A 1C4CA 1GNKA 2XMWA 5HN0A 1JJHA 2E7XA 1LOUA 2N7YA 4WWSA 1NK4A 2CWKA 5CZXA 3M30A 4DPYA 5LM7E 1HNXJ 2EPIA 4ECVA 1N32F 3EJMA 2RH3A 1ZZNA 1ZAWA 1R27B 3ISND 4ZVGA 3W2WA 1HI0P 3R5CA 4ZA1A 4RUBA 3F73A 3LA0A 3PXGa 1Q7YT 2KYZA 2LEPA 2GA7A 1FX4A 1TK0A 1BGXT 1AFJA 3H7HB 4ZPCA 1NDPA 3CE8A 2XZDB 5LL6d 4CZCA 3M6WA 3G82A 2H9ZA 1RT2A 1UW4A 1DTQA 5HJYA 3S8SA 1KTVA 4OI6A 2JEGA 2CQGA 2C3UA 1L3UA 1UVIA 5KFHA 2DCLA 1SKSA 3FMBA 1F5BA 1U1MA 2AZ3A 4L76A 4KR0B 5C25A 1X9SA 2HVZA 1X9WA 2YX7A 2R4FA 2C42A 4K4VA 2F65A 3HSZA 1P6TA 3CCLS 5LXYA 5LSOA 3D5MA 3IBFB 4KGZB 1RTDA 4FF4A 1URNA 1Q8KA 2FLOA 2HRTA 3QIDA 4IQXA 1WC0A 4YN3B 2IYGA 1SQFA 2MQMA 4KY3A 2G2YA 4OYBA 2GC8A 3CJ4A 2OEJA 2Z58B 3DN9A 5KG3A 4TU9A 1R8PA 3W3SA 1WDTA 3B78A 4QWAA 4IG0B 1QE1B 1WSRA 1NKEA 1CJTA 5K8MA 1HQUB 3GILA 2ZDPA 4YQWA 4NE9C 2PI4A 1JLAB 3NGKA 2A2DA 4K5SA 2GVZB 4G1QB 1NH8A 5HK4A 3DCAA 3EM1A 2ZOGA 3CJKA 2VG6A 3SV3A 3AJ1A 1A7GE 3DMJB 5GVQA 1HWLA 1M1KT 1S6UA 1WF2A 3EXYA 3MCSA 4J9UE 1ROFA 3GIJA 1VJWA 3OTOF 2QN6B 1GXUA 5GMEA 4RUAA 5HP1A 1QVFR 5IFMA 2HQ3A 3MDFA 4USKA 4CLFA 3KLHA 3MR7A 4ED6A 2YQ3A 2YNGA 3DI6A 3FEZA 3DM2B 5HP1B 4NX9A 4J9LA 5KG2A 3D1HA 3JS9A 1FJCA 9ATCB 1FXDA 5HVHA 3DKDA 4NLXA 1PJ7A 2J6UA 4K0KJ 3CNQP 3KUHA 3VTIA 2FJDB 3CJKB 3PRDA 3QFWA 3TJ9A 1VCTA 3QT5A 2KRRA 4KPCA 3K8WA 1V3ZA 1J27A 4DFJA 1J5EJ 2O01C 3J81Y 1QVGR 3G2XA 2XLKA 2MQPA 4LRDA 3HFZB 1VHIA 4ECWA 4USWA 3FFIB 1TVRB 2XMKA 2CQPA 1BLUA 5H9FK 2Z2LA 2DGUA 1IR0A 1WG5A 2AEFA 2RNEA 4H4OB 3TRGA 3TQEA 2RQKA 5KFNA 3WC2A 4PQAA 4USUA 4BCAA 4KQZA 4DV6F 5ETLA 3WDOA 4BC9A 5AXMA 1OSDA 2IAJB 1FDAA 1IWGA 2HGNA 4FYVB 3T1AA 5D8HB 1R6YA 4C48A 1SCJB 1FA0A 1N5TA 4OV6A 1S4EA 4WIQA 4RLEA 3RUBL 3MECB 3GYXB 5KFTA 4V19J 4Y00A 3IM9A 4DV3F 3BYRA 3LALA 1FERA 2GHPA 2K3IA 5J2PA 3I0SA 3C46A 2X1AA 1JJCB 1KOOA 3GCXP 1N4LA 2PGCA 1F1BB 1XMOF 3MZIA 1FEHA 2V2QA 5CYMA 3JAMY 4Q45A 2HBZB 2FHJA 1VQ6S 2GVDB 3QGPA 2HNDB 1ICEB 3ETMA 2V69A 5G0RA 7FD1A 2FVRA 1IXKA 2GAHC 1L3KA 1RTHA 3EDRB 3IR5B 5I42B 1UPPA 3W8PA 1FKAF 2LDIA 1Q5YA 3VGUA 3H5YA 3V81B 5HATA 3HSDA 5LMNJ 3C2PA 2FJBB 2V68A 2XTJP 1MWQA 2YX4A 1U47A 2VJVA 4ID5B 2B5JB 1G1XA 3HF5A 4LVNP 1GMUA 3UDLA 2BDPA 2BKPA 1PJ6A 1RT3B 3MFHA 4FBUA 2B9WA 5C7PA 4JI0F 2RB7A 4OX7A 1AUSL 2V67A 1ZAVA 2VG7B 1S9EA 2HG4A 5DZ6A 3PTWA 4DV3J 4IR1A 1B4SA 3UD4P 1BQNB 3IAS9 1Q53A 1MN7A 4B3RF 2IRXA 1T7PA 4TY8A 1BY9A 3CSKA 4EZ6A 3HM9A 3BH6B 2W8LA 2KXFA 2HHVA 2LQJA 1YHQS 1SC3B 2OD4A 2ZOFA 3C16B 4OI3A 3MM5A 3CC2S 1IBMF 4B9TA 4YMEA 3GR0A 5GAGI 4TY8B 4F3QA 4GO7X 2B7CB 2WVDA 3MUVP 2D3OR 4LSNB 3RBZA 4QWCA 3CCSS 3PW2A 3TAMB 2VG7A 3C16A 1E6YA 1UFWA 3QNWB 3H0PA 4R0EA 4NXMF 3CCES 1WEZA 1RJJA 4DDFA 2OTJS 2BUNA 4NLQA 3U02A 3GFXA 1HWKA 2JLFA 2OAUA 4QZVB 2ATLA 3HFKA 2PFDA 2VC0A 4Z7YA 3TUJC 3ZZRA 4P7VA 2WONB 1S1TB 1HNZJ 4JI3F 1XR6A 3M2UA 3QT6A 1NK6A 1PAUB 5D4OA 4UZCA 4MJKA 4ZVHA 2ZH3A 5E33A 2HAFA 1DURA 5E3QA 2VJUA 1U6ZA 2OPQB 4CT8A 4QIVA 3OFEA 2GO8A 2XMJA 2XLIA 2V0NA 1U0SA 2XY7A 4ANDA 4XAKA 1MW7A 2LYVA 2WSEC 4CIOA 1SL2A 1TAUA 2HQCA 1DQ8A 2X3DA 4YOEA 2V50A 4I7FB 5D4PA 3K5PA 2MYFA 3UD5A 3QQCD 2Y1JA 1VQKS 4CNZA 5KFGA 4L72B 1Y0HA 3BSCA 4NA1A 2JRSA 2OFGX 1CS4B
chains in the Genus database with same CATH topology
1KN6A 5ITHA 1NJYA 4MK7A 2IYIA 1RQ0A 4YDXA 3UCUP 2MKSA 4RUHA 3KWMA 2VFTA 2IVMA 5JXSA 3TX8A 3QO9B 4H4OA 3M32A 3S6EA 3CD6S 2ASYA 4DV4F 4ZKAA 1HNVA 4I1TA 4F8RA 3POTA 2ZZNA 4QQBA 3TI0A 4JI1F 2KXHA 3OBIA 4FP9A 2J9EA 2EK6A 2F8EX 3IBWA 3ZZYA 2ZE2A 4MMOA 2F9JA 3R5DA 1S10A 4JV1A 3BQ1A 1GX5A 3KLVA 5DG7A 1DTTA 2B0GA 3I5BA 4YDDB 2I9SA 2MJUA 3W2VA 5A8WA 1S99A 2EBGA 5HMYA 3K2YA 3NS5A 4N47A 1NK7A 2B4VA 2FIUA 1TKTB 4WU2A 2JSXA 2YNFA 1U1QA 1HBOB 1XR5A 4ED3A 1RT1B 3I9ZA 5GADI 2XO7A 2R7XA 4RUCA 4LJMA 3KHGA 1KLNA 4OLPA 5DS7A 3P96A 4WXOA 3MM9A 3FQKA 2M52A 4J9PA 1RT6A 2ADBA 4GMKA 2W4DA 2BABA 2MZSA 2F7VA 2A2CA 1NNDA 1FVQA 1M5SA 1NRKA 3GIKA 4LF8F 3E3XA 1S9GA 3KNAA 4WZMA 5KT7A 3JTPA 3OTBA 2GGPA 1T3NA 1F5AA 3N9UC 1FKPA 1H7WA 1RT7A 3OV7A 3X3UA 2W8KA 4DSIA 4FYDA 3SQGA 4O3OA 2ZE2B 4ID5A 1VHFA 4IDKB 1WELA 1XTZA 2FJEB 4QYRA 4YB5A 5FDLB 3TOQA 4R5PB 1H7XA 1XMBA 2JH3A 3KLFB 2NQPA 1HNVB 2HZCA 4F50A 3OW2R 4ID8A 4LMZA 4RW8B 4WFBQ 4RWXA 3KHLA 2F1FA 1UJ4A 1FJ7A 1S6PA 2YWGA 5KG6A 1M5OC 2E1RA 4DEZA 2KU7A 2BACA 1UJ5A 3CCRS 2FJVA 2I1RA 4IG3B 2X51A 4WFAQ 4XPEA 4B02A 2DO0A 4KGKA 3I0SB 1U25A 4L6V3 1VC5A 1KVJA 1BD6A 4FN5A 2B9XA 1FRJA 3P5TL 4EUVA 5C42B 2I2YA 4OI0A 4B3TF 1TR0A 5F9LA 1KFSA 1TKZB 1T3OA 4NLWA 2QMWA 4UUWA 3CC7S 3P49B 1A9NB 2AV5A 1O51A 2E5LF 3D54A 3NG8A 2E1CA 2D41A 1VLYA 3IFEA 3PR4A 1SJRA 2Z4PA 1S1TA 3LGMA 3QZ8A 4A8WA 1J2VA 1UWBA 2XNQA 4O4GB 4OZ1A 1J5OA 3ONQA 5EWEA 4YB1P 2KJWA 3IG1B 5J1EB 5DM7Q 4KO0A 1JLGB 3MMJA 4RZRA 4WKYA 1X5SA 1O8BA 1VI7A 2YKNB 2DITA 2HVIA 4HKQA 3IRXA 3PFEA 1NK5A 4PUOA 4A8OA 2J0WA 2CZVC 2LLZA 3MM5B 1RT6B 4CO0A 2FLNA 2VBWA 1SH3A 5CXTA 2D9PA 2VB6A 2OLWA 5SZTA 4TYAA 3WBZA 2IRYA 1MWYA 3WX4A 4ZMMA 1U8SA 4Y6IA 4C8LA 1Q79A 1IQTA 2KHCA 4IOCQ 1X0PA 1JKHA 4LF5F 3D0GE 4WFNQ 1UL3A 2FUG9 3D28A 1ZYQA 1NJZA 1HR0F 2YWKA 1RT3A 1JB0C 2P6SA 2JC1A 3BO3A 4C8OA 3ICLA 1UVJA 3H40A 4J9KA 5BR8F 2D9OA 1S97A 1IUJA 2C3MA 3AA9A 3UDCA 2OMLA 3PIOQ 4R8UA 3HHLB 2AP6A 5DG9A 2K3KA 3MR6A 3QJJA 3HDSA 1Z4UA 3KK2A 3V4IA 3T5LA 3G6VA 3G6YA 4HT7A 5L9XA 1XBWA 3J7YU 1IKYB 4NLYA 2WK4A 3RB4A 1HWIA 1SIZA 3NRBA 2A3JA 4N77A 3CUNA 3JSMB 1SKRA 3VAKA 2ZJPQ 4UW2A 4PCQA 3CMES 5A8RA 4KAIA 3GV5B 3RU0A 1JMTA 2VPYB 3DLGA 3TYTA 2KM8C 4PG6A 1HA1A 3MEEB 5L1JA 1FT8A 2M7SA 2V9KA 1IKXB 3PACA 3W2WB 2FVSA 3RR7A 2OTLS 2KXNB 3SCJE 1SJ4P 5AE3A 2E29A 1KOHA 1IKVA 1TVRA 2P9EA 3I5CA 5KFQA 2G9OA 4K50A 2OTJS 4C97A 1CQMA 3KNGA 4NLDA 4CH7A 1ZTTA 3PW0A 2RF2A 4KKOA 5CQGA 1U6FA 3OR1A 3PX0A 3CJ3A 1KD1T 1Y5LB 4X4VA 5F8LA 1Q81T 5KFUA 4YP3A 2MGZA 5KFKA 3DOKB 5DO2A 3K7RA 3NKYA 4WK3A 1LK5A 2ZC4A 5L39A 4MYUA 2U2FA 4ZP6A 4FVCA 1K0TA 2ADCA 1Q78A 7FDRA 3T3FA 3MF5A 2GNKA 1KSPA 2VA3A 1SV5A 4K4YA 1YGYA 1HBNA 1HD1A 2HLTA 4NWBA 4YR3A 3H4DA 4Z2XA 1VK8A 3QGGA 4RNFA 5KFJA 4U67Q 2ILZA 5HBMA 3JB9k 2R7WA 4WJBA 2QLXA 3MMCA 2KVIA 4DL5A 1FE4A 2N4CA 1LWEB 1RKJA 1DBDA 4ZPAA 5KT4A 2B3TB 3KHRA 3RRGA 2ABYA 3TR5A 3NNCA 2ASJA 4Q8EA 1S6QA 1GAOA 3MM8B 1SIWB 4C0OC 2N3LA 2UXBF 1FF2A 2ZKTA 3QJPA 1H6KX 1FNOA 2LQ9A 3KLGA 1S0OA 1L3VA 4RNMA 3K5MA 1Q1KA 5T7LB 5D3GB 1H38A 2KKHA 5KG1A 4C3MA 3FRZA 3NCRA 1X5PA 3T5KA 3VWSA 1VBXA 4Q5VA 4IRCA 4GKKF 3N01A 2IC3B 2Q6CA 2OPRA 2COLA 2DNLA 3SI8A 3DLEA 3EGZA 4JI5F 5LJ5Y 2HGLA 1KR4A 2AF6A 3BN4A 3OFFA 3P3DA 4IOBA 2V4QA 2V2KA 3SSQA 5J2QA 4RBTA 4KTQA 4BHQA 1JJ4A 2CKWA 4K5RA 3OL8A 1EP4A 3ETOA 3TVZA 2ROEA 3OL6A 2RQCA 3M6VA 3Q8PB 1FK9B 1QY7A 3UR3C 2C28A 1Y7PA 4Y2KA 2IMOA 5A8RB 5E0OA 2ZH5A 1IKWA 1XR7A 1T8EA 5B0DA 1ZTWA 1ZETA 4K4SA 1P1TA 2WB1D 4OJHA 1SB6A 2UU9F 4WE1B 3DLBA 3HVWA 2GIQA 3DXBA 3DLEB 5J2NA 1C0UA 2CPHA 4PG4A 1S7HA 4WFXA 4YR2A 1X5TA 1LWCA 3Q2SC 1B0VA 4DL7A 1SQEA 2ZHBA 1KVIA 2GMLA 3M9OB 1BWEA 3FDSA 4BBYA 5FJ4A 4Y2MA 2J9DE 1RT5B 2UV8G 5LMNF 2G1DA 4WFZA 3OHAA 5D3GA 3HHNB 4F4KA 1HHTP 1Q7LB 2QA1A 5K5MA 1R3NA 4X4SA 4NZ7A 5CCMA 1NJWA 4LIRA 3KLHB 3JYTA 2XCAA 2E44A 2D1CA 2HS4A 2HRYA 1ZPVA 2FJXA 1PO6A 1VRTB 1WWHA 1T95A 2UVVA 4I0WA 1UA0A 1W25A 3G86A 3NL0A 1TL1A 1P9QC 4KIAA 3T6JA 4M1KA 1JLAA 4ETZA 3BSAA 4NCBA 1XMQF 3JYTB 3OFHA 1DQ9A 3OL7A 2QYCA 2EFQA 2R7UA 1C2PA 4IQMA 2OO4A 2M4MA 2OKQA 1U6BA 3CDBA 4WU3A 1JLQB 5DRKA 4QWBA 4X64F 5D77A 1QM9A 4RW6B 3NBPA 3PVXA 1VQ8S 3GR1A 4CO3A 1Q8BA 4ELVA 4RNHA 4KKOB 3HKZD 3CT9A 3H20A 4RW4B 2V4RA 2BANA 5LXRA 3CCWA 3Q8RB 4HYKA 1IKVB 1XEZA 1I1GA 3I32A 1O0PA 4N41A 2R8KA 2J76E 2LVWA 1TQLA 4A4JA 1LFPA 3MEEA 5B0EA 4URSA 2P9GA 4ELUA 3HI9A 5J2QB 1JXLA 4DL4A 3NNAA 2QSWA 3UE2A 2R7VA 1ZOTA 5KFAA 4FXDA 1KQKA 4KJIA 5AE2A 1DQAA 1X5OA 4HTIA 3NCQA 2XWXA 3THVA 1AUDA 3H8YA 1HL6A 2MZTA 2J5AA 3TUIC 3EPIA 5L1KA 4YB7A 2MJNA 2P9CA 4OV1A 4USJC 3OL9A 1D9FA 3BF4A 1NEEA 3F41A 3UW1A 1FJEB 4O23A 1RKIA 2Z8QA 4Q2MA 3KK2B 3V4IB 3VAGA 2EFGA 5D78A 1H2UX 4WYLA 3ZZPA 1UA1A 2FD2A 2ZOMA 1FCAA 4TYBA 2AJ1A 1HBMA 2C3PA 4HTJA 4P6QA 3HMJG 2LEBA 1U4BA 3FRYA 2CJKA 2VPWB 1T02A 4EBDA 2MQOA 2J0SD 1JK9B 5HROB 1TKXA 2R8HA 1JNZB 2DVIA 3V2UC 4I56A 1QAJA 4ZCKA 2M2BA 3CDWA 2XGQA 4FS2A 5KFOA 3AB2B 3SSSA 4IFVA 5KT6A 2X3GA 3PFOA 2AU0A 2CFXA 1GX6A 2WB4A 3GFYA 5B0BA 3PY8A 4WXWA 4HVZA 3IN5A 1QAYA 2FJAB 4NMLA 1YJTA 3IO1A 4ZP9A 3I55S 3MR3A 5IXUA 1M5PC 4ES2A 3DOKA 3BR9A 1N6QB 2GCFA 1RT5A 4IH6A 1X9MA 3M8RA 4KO0B 3PO4A 4OHXA 4Y0FA 2CIMA 4DL0C 5HLFB 1Q4RA 4R0JA 2RF2B 3UQSA 1WTFA 2HWHA 2M8HA 1FK9A 2WCXA 3GSDA 3I9V9 5CYQB 4ZCLA 3CULA 1B0PA 3KG0A 5K14B 4BS2A 3RZAA 4BDPA 2F9DA 4JI2F 1VQOS 3HZEA 3HK2A 2CVIA 3MMBA 3L7OA 4RW7B 1MROB 5K8OA 4GC6A 3IGVA 5JJBA 4DR6F 2PO4A 1SC6A 1FRXA 3DLGB 1AXQA 1ULRA 2HQIA 4E8UA 2BBEA 1C0TA 3H5UA 2EFNA 3MWBA 4B9NA 5D6GA 3M2VA 3Q8SB 3T19A 5AXKA 2R2UA 5F9NA 3V6HA 2QO3A 1EETB 3AHPA 3U27A 3J7ZT 4IG3A 1TL3B 4KV8A 5T7LA 2JX2A 1PC4A 2OPRB 2BA9A 3TW0A 4A48A 3BSOA 3U7JA 1MMDA 3IC1A 1S6PB 1FRMA 3TVKA 1S1WA 1CC8A 2CQCA 2CPFA 4AYBD 4UQGA 4X84A 1N56A 1AROP 4G3IA 1RTJB 1VIOA 3QIPA 2R8GA 3F56A 1LWEA 3VAIA 1FDNA 2ROPA 5KFRA 1SI9A 4NA3A 2SXLA 2ZFHA 5KFXA 2KG0A 1NB7A 4Q0BB 3GWCA 3G4SS 2J0XA 3HLUA 2XSJA 1TKXB 4CTAB 3HVTB 3H98A 4EO6A 3OUYB 4F4ZA 4FBTA 1XNQF 3QMQA 4LSNA 2VASA 2MQLA 2PT0A 3T9NA 2YH0A 5A8KB 1S77D 2RD5C 4ITSA 1NHUA 4X66F 1GXLA 1N5SA 2M70A 2KI2A 2DNQA 2QFJA 4QIEA 3VZIA 2ILYA 3ZZOA 3RAQA 2XZWA 1LW2B 4B9LA 1ZH5A 5D4LA 2KFNA 4KBIA 1N34F 2CJBA 2XWYA 1HBUA 1NJXA 3ITHA 2Y1RI 5CZVA 1QLNA 5EHHA 2EC0A 2IBOA 3S01A 4C3KA 2XMUA 4OJGA 5DQGA 4DUZF 3PZPA 4FNIA 3MXHP 3PKMA 1SL0A 4RBVA 5CHCB 4F67A 2MGZB 1V9OA 2WSCC 1N88A 2EI5A 2ZNZA 3C6TA 3JSBA 4JV2A 2EW9A 3M8PA 2X1FA 1XERA 2IVYA 2VG5B 3MM6B 3OR1B 3KJVA 2MQNA 1S0MA 4B17A 2B56A 3CC4S 2DGWA 3TO8A 3PX6A 2WOMA 4ZHRB 5KFSA 2FC8A 5F3ZA 4HT5A 2MY7A 4TLRA 2KRBA 1HI8A 2QZ8A 3MFIA 1HWUA 1U45A 1NK0A 4IFYA 2A1BA 3MPYA 2W4PA 2YKAA 2VOOA 1WF0A 2RS2A 1RTIB 2CPYA 3DDKA 5DQIA 2ZM6F 4ECRA 1KHWA 3H4BA 1N5QA 2L9NA 2C2RA 1GH8A 3I4PA 3CCQS 1VQLS 4LFAF 2MZ1A 2CZ4A 3X1LB 5I4MA 3F44A 5CA5A 5KFVA 3HHKA 3ZZUA 2ZITA 4B9MA 5KFPA 3DLKA 4UY8T 1X4CA 2UP1A 2DR7A 2NR0A 4GC7A 2HRUA 3PKYA 4WK1A 5A6PA 4XIUA 1K0VA 4WTYA 4DV0F 3GYNA 2QV6A 2XNRA 2B6AA 3D0IE 3MTKA 1T03A 1H3DA 3TVYA 3HHLA 4Y34A 3IR7B 4MK9A 3PNIA 2PC6A 2IM3A 4PR6A 3RB0A 3GV8B 1WEXA 3CD5A 5KG0A 2E7WA 1TZ0A 5B08A 3OJSA 3M8SA 4FPRA 1MMNA 4DJBA 2DNGA 1GXTA 1S9GB 2FVCA 3TAMA 2FHOB 3MURP 3LP0A 2VH7A 3JSYA 1D0EA 1DLOA 3N0VA 4OHYA 2VONA 2P6TA 4RBUA 2BZ2A 3DMJA 1YVFA 5F8JA 5LT5A 3MD3A 2Q3PA 5M2RA 4KGMA 2ACYA 3KG1A 4OL8A 1T94A 1N36F 4Q44A 4JV0A 2RE1A 2IRUA 1R8BA 5IM0A 1FD2A 1VIXA 1YRUA 4M5DA 3W7BA 4C8ZA 2KTQA 2J7UA 5SUHA 1JLBB 4DBQA 3V6KA 3QLHB 1GQEA 1YRXA 2PD1A 1IKWB 1XNRF 2POKA 2VBYA 2AGPA 2FVPA 2NLWA 2Z2MA 4ILRA 5KFFA 1PILA 2BQ3A 2YWHA 2OD6A 4GKJF 4OI4A 4QPTA 4MKBA 4Y28C 3DRPA 1X4GA 2ZJQQ 1HQEA 2MHNA 3DRRA 1HHSA 5G0RB 3GIIA 2E9RX 4ECSA 3H59A 2YH1A 3HVAA 3JTOA 3H5SA 3LQVA 2R7SA 5E2QA 1T05A 1DTQB 3DRSB 2E9ZA 1HYSA 2YWFA 4KHMA 3C6UB 2MXYA 3HP6A 4J9OA 1QSLA 4ED7A 3O3LA 4F4YA 2YX1A 3E51A 5EN1A 3RR8A 3MECA 4I6WA 1HYSB 3IWXA 3MPVA 4I7FA 3B4DA 1QSYA 2OFHX 1B64A 5I3PA 2CQHA 1TV6A 2ZD1B 5DG8A 2W9BB 2FLLA 4IUFA 4HDHA 2YKPA 3KLGB 1U1RA 2APOA 4UOCA 3NNHA