5D4PA

Structure of cpii bound to adp and bicarbonate, from thiomonas intermedia k12
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
102
Chain Sequence
AIKLYPLKKLEIILEGAHKEFATDLLDRAGVKGYTIVGNLSGKGSHGMYEGHLMDDALIMIIAAVPEELVGPLLEGFQPFFEAHSGVVFVHDIQVGRPIKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of CPII bound to ADP and Bicarbonate, from Thiomonas intermedia K12
rcsb
source organism Thiomonas arsenitoxydans (strain dsm 22701 / cip 110005 / 3as)
molecule tags Signaling protein
molecule keywords Putative Nitrogen regulatory protein P-II GlnB
total genus 18
structure length 102
sequence length 105
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d4pA00
3O8WA 2EG2A 1KR4A 2GNKA 2O66A 2J9CA 2XG8A 1V3SA 5L9NA 2Z0GA 2J9DE 1NH7A 2EG1A 2ZFHA 1O51A 3T9ZA 3AA9A 1PILA 2DCLA 1Q1KA 4WK1A 2VD3A 4NYOA 2NS1B 4R25A 1UL3A 2GX8A 3M05A 4E98A 5D4OA 4RWWA 4USJC 2PIIA 1VFJA 4CNZA 1J2VA 1VHFA 5D4NA 3GSDA 4CO0A 2CZ4A 4NYPA 3CE8A 3MHYA 3HLUA 1HWUA 4CO5A 4USIA 3AH6A 4D3GA 4IYQA 4D3HA 3L7PA 3N5BA 2GW8A 1H3DA 4C3LA 1UMJA 3NCQA 3NCPA 4CO3A 2XBPA 3OPKA 4OZNA 1GNKA 4CO2A 1P1LA 5D4LA 4RWXA 5DS7A 4CNYA 1NH8A 2J9EA 3AA8A 3BZQA 2NUUG 5D4PA 1OSCA 2ZOMA 5DRKA 4C3MA 4C3KA 4OZLA 3X3UA 4YB7A 4YB6A 2XULA 3O5TB 4ZK7M 2NUHA 3DFEA 1XK8A 4Y65A 1NAQA 2RD5C 3TA2A 2J9DA 4Y6IA 1UFLA 2O67A 3TA1A 4CO4A 4AFFA 1V6HA 1O5JA 4OZJA 3TA0A 4CO1A 1V3RA 1QY7A 1UKUA 2V5HG 4WK3A 4RLEA 3LF0A 2JJ4D 2XZWA 3NCRA 1NZAA 1V9OA 4USHA 3AHPA 4RX6A 2E66A 4YB5A
chains in the Genus database with same CATH superfamily
2CG4A 3MM6A 3BO4A 4WTOB 1MMNA 1X8DA 1NMEB 5KT3A 3JSBA 2Z57B 2ZH4A 4LF8J 2FTRA 4NPOA 1Y0HA 3L95X 1RWMB 4LSLB 5H9EK 1RTDA 4MKYA 1AA1B 1JLFA 2V2KA 2A2DA 1S12A 2IDEA 2GHVC 5DQIA 4J9PA 3KG1A 2LEBA 4GO7X 1GMUA 4KH1B 1JJ2R 2DGWA 1DQAA 3VF0B 3ZO7A 5B0AA 4I6AA 1I51B 2XMJA 2VD3A 2XZDB 3NGUA 3R3TA 1UL3A 5E33A 2VPXB 2CG8A 5KFRA 4YMEA 1FJ7A 3HHLC 3T41A 1N34F 4XDCA 3LANA 4DL3A 4QYZJ 4K8RA 3DU5A 1UAWA 3ZTRA 3UVJB 3IA0A 1J2VA 4KFBB 3GQCA 4F4KA 1CBKA 1PSDA 2QA4G 3GSDA 3NAIA 1MU2B 2EKNA 3M32A 4RW6A 5HVHA 2B9XA 4OYWA 2A6OA 4N56A 4CH1A 1OPIA 4CLPA 2QMXA 3MMAB 4JI8F 3EWGA 1H98A 2DNOA 3W66A 5KFTA 4C8NA 1D9DA 4YUDA 2IM3A 3E3XA 2QIFA 1KFDA 1UPPA 4ZOSA 3ETMA 2IDLA 1S6UA 2VQEJ 1C1BB 5HLFB 3NXZA 3QBCA 1BHNA 1JLAA 4OZ3A 1XMBA 2BRLA 1TKZA 2HHHJ 4KV8A 1Y5NB 2W7AA 2XTJP 2KM8C 3D68A 2QSWA 1AUDA 4UUWA 4AYBD 4CO3A 4DN9A 1JLGB 2V8GA 3TZYA 5K8NA 3CDWA 1T05A 3TZXA 3SCIE 2KFYA 2WCXA 3LP1A 4ZP9A 4ZMMA 5FLXY 2QL9B 2C28A 2WBRA 1YVFA 2XMKA 3CGIA 3MMCB 3SEOA 3U1MA 1FDAA 5LXRA 4RBVA 3U7JA 1KWMA 4FYYB 2E9RX 4CNYA 4P72A 3H5SA 2XO7A 3NNAA 3W8GA 4OZ0A 1H2VZ 1RKIA 2LDIA 2GQQA 2BE9B 3GZ7A 5KG3A 4G1QB 1JNZB 2OPPB 1WC0A 3WC0A 3M9MB 4OX9J 3IN5A 3BO2A 1HQEB 3TJ9A 4QIGA 4X4NA 4C3KA 2DVIA 3RB6A 4V19X 4USVA 3M30A 3K89A 4QWEA 1GMVA 2ZVIA 4H4KC 5GADI 4DHVA 2R7TA 3WDOA 4USTA 2ZJRQ 2DY1A 1RT6B 2XNQA 4KB7A 2ZITA 1KC8T 3OJUA 1N5YB 3DLHA 3WX8A 1SC3B 5CQGA 5IWAF 3KTQA 3BH6B 1UWAA 1JLCA 2CVIA 4LF6F 4AL7A 2KN4A 3I56S 3GJQB 3DLBA 5KFBA 4K4VA 1NDKA 2MGZB 4K50A 1WG4A 1AUSL 2ZBIA 2RRBA 3DRYA 2GGPA 2J9DA 3RBXA 1HYSB 4DR3F 2OFGX 1HQUA 1YRXA 1J5EF 4M5HA 4CO4A 4U8YA 1ZBTA 4WFBQ 4KTQA 1FRKA 1DLOA 2BRKA 3THVA 1MN7A 2JC1A 2FB0A 3CCLS 1LWCB 2RHSB 3ZZ0A 4L3KA 1EB0A 4N41A 2R7UA 5BR8J 5GAHI 1UETA 3LF0A 3AODA 3IFEA 4PRFA 4DR4J 1Z2ZA 3VQTA 4OV1A 2EPIA 1S77D 1SKSA 1DAXA 5DJBA 1TFWA 5CH7B 2Y1JA 4MFBB 1XWLA 2D9PA 4MTPA 3QAUA 1IN0A 2O3DA 3FFIA 3E2EA 2N3LA 2ZNYA 1NK4A 2DD8S 3ENQA 3SYZA 3IR7B 1U0SA 3I82A 1LWEB 3D6TB 1NB2A 2EG1A 2CQPA 1XMQJ 3L3CA 1O51A 2AJ4A 2QMUB 3ONQA 2AGOA 3MMBB 2HHVA 3VHQA 4R25A 4UZCA 3DHWC 4E98A 1NJXA 1D1UA 1XNQJ 2MZTA 2AEFA 2YNHA 2IM0A 5U47A 2N7YA 3JTOA 4NA3A 4USJC 2AMCB 2E7WA 3KK2A 1AYEA 1S5ZA 4OYAA 4P2SA 4CNZA 4EWTA 2X7IA 3W3SA 2OD4A 1R8BA 1RXOB 4NLQA 3CJRA 3JTNA 2H9ZA 3NRBA 1EQ0A 4DV2F 3C66A 4NYPA 1SQEA 2KT3A 3OTDA 4OI3A 4RW6B 2WK4A 1HNIB 3SSRA 3R6GB 1OS5A 2N4CA 3KK3B 2W8KA 2ZWPA 1E6VA 3R1HA 3GWCA 3VGSA 2FJVA 3EVWA 2BX6A 1HWUA 1YITS 1SKWA 3G6ES 1WSVA 3JQKA 1FTRA 1E6YB 2K3KA 1TUVA 2KKHA 4QQBA 5IT9U 4QYZK 2UV8A 1F60B 4XO0A 4A4JA 5KFWA 2QEXS 2DR8A 2N82B 2HMIB 1T11A 1RE1B 5E3RA 4R8UB 3FEXB 3MR6A 3IBCB 2M5YA 5FJ4A 2C2NA 1R0AA 3EVOA 5E3CA 1U24A 5D0RA 3D1QA 1HBMA 3ZTSA 1VGYA 3FKBA 2FY1A 2AYMA 1XMOJ 1FEEA 3MTKA 3TUJC 4NZ7A 5JVGQ 3QLHB 2GIQA 4ILRA 3OTCA 4NE9C 4ECWA 2RIJA 1TV6B 1T0TV 1VQLS 1VK3A 1MG7A 1YQHA 4ZPVR 3L7UA 1HLWA 2B56A 1YWXA 1OYDA 2WHOA 4YQWA 3Q8QB 3KLEB 2JH3A 3V81A 1IR1A 1LFWA 4IH6A 2V0NA 4MJKA 4DUTA 5C25B 4DF4A 1VBZA 4F2SA 3G2XA 2DB1A 2G2OA 3MR7A 2HAFA 1RTHA 3PM9A 3KJVB 1RHKB 4DV4J 2FC9A 2HMIA 4C3MA 3IO1A 3AY0A 2HHUA 4OZLA 1FE0A 2M88A 4IOBA 4YY3J 3VTIA 3J7Z5 2FLPA 3CB4A 4BWMA 2GO9A 3DRRA 2KVIA 5HAOA 2WVFA 4DU7A 2YKNB 2HHHF 4ZK7M 3WX4A 3W65A 2VG5A 3I6PA 2R8IA 4U7UD 2A2CA 3CMES 2QG9B 3MUTP 1TL1A 2FLOA 4DV6J 3PFEA 2DR7A 1K44A 4B3MJ 4JV2A 4JI6J 3M8PA 1WC6A 3KLGB 1VQPS 2DTJA 2MTLA 2NXNA 5IM0A 1X5PA 1NDPA 2D74B 2LU1A 2HIQA 4B3OA 1FCAA 4ZPBA 5L1KA 2J6TA 4W4MA 2NR0A 3DRSB 4WXOA 4DSEA 4M5DA 4F3OA 3RYLA 4JI7F 4RNOA 2XNRA 1A6LA 4QR2A 1FDDA 3ZZUA 1KQFB 1I3OB 2WZ1A 1ZAWA 2GO8A 2ILZA 2HNDB 2FIUA 1U7LA 2IVMA 3DXSX 4GKJJ 4DQIA 1URRA 2ALYB 3TAMA 5KFFA 1QY7A 2LQBA 1WF0A 4CLWA 3CCVS 3G6VA 3RB0A 4O23A 4PPDA 2R8GA 3GV5B 3C8YA 2Z58B 4P2MA 1GXLA 2ZJQQ 5K8MA 1ULRA 5HK4A 3PKMA 1S99A 4EBEA 2RT3A 2DO0A 3M8WA 4OZNA 2MLXA 4IQMA 2C2RA 5G0RB 3O8WA 1KSPA 4ED5A 3NEKA 4H4OB 3MFIA 1FX4A 1P9YA 2DY9A 2PE8A 3IBFB 1U02A 1WUUA 1RT7A 3M8PB 1PYSB 4MFBA 1OWXA 2OTLS 2IBKA 3OJSA 1N56A 2IY5B 2B4PA 1Q4RA 1RAFB 1U0HA 4I2QB 4N47A 1DTTA 2HZAA 1XQIA 3GFYA 3NG8A 1IKWB 3C6UA 4M5DB 1LWEA 1FESA 1LWFA 1SI9A 3NKYA 1TVRB 2ZE2A 3T9ZA 3N6NA 4DSIA 2OH2A 5EGYA 1FO1A 1BY9A 2ILYA 1VDHA 5KFKA 3OV7A 3THPA 2R7OA 4ELTA 1KFSA 1LEOA 3KHLA 4JI5J 1WHWA 1ZM3A 2I1RA 3KLHA 1FJEB 2WONB 4BC7A 4ED6A 2R2SA 2YBVA 3P8BB 1HL6A 1X4HA 2IIHA 4ZVFA 3ET6A 5LJ5Y 4HDGA 3VZHA 1ZYQA 3R7NB 2WRMA 4RW4B 1EJ7L 1XC9A 1T7PA 3KNAA 2A1BA 1IXKA 3BB5A 1X4GA 3TWZA 4P9SA 1B70B 1S1TB 2MQNA 3MPDA 5ETMA 4ED2A 1LW0B 3UD3P 2XM3A 4ED7A 3TQ1A 4B3TJ 2VQFJ 1W2IA 4PKDB 2ZH1A 3W5XA 2JLEA 2WAQD 1YZ7A 3C6UB 3C14B 3PY8A 1Q86T 2L9DA 3QAEA 1OMSA 1U8SA 2LDYA 2ZOFA 3RZAA 4A8KA 1TKDA 1R3NA 4CT9A 3OTOF 3EICA 4OJGA 2CJQA 5F3ZA 1XBWA 4LF1A 3VVUA 1CJKB 2YNIA 3BBCA 3TX8A 4ZS6A 3W63A 1HD0A 5KFCA 2GAGC 3CJ0A 5HVFA 1VQ7S 3CC2S 4CWBA 1ZOTA 3PW5A 2ZD1A 3FBFA 2GHPA 3ET6B 3GMGA 5CA5A 2YXLA 1TKXB 1XTZA 3CJKA 4ZCMA 4M1KA 3K5LA 2R2UA 4YDDB 5KG1A 3CMAS 1RAJA 2AHOB 2UXCF 1H7XA 3OXGA 3FSXA 3B4MA 4RWXA 3RRHA 2M2BA 1X31C 2W25A 1S9GA 4Z7CA 3QWPA 4M5MA 1T02A 3CCQS 4ECVA 2OP5A 4X62J 4JV5F 5IT9Y 1EKRA 3DOLA 2EKYA 4I0WA 4KO0A 3D54A 3W1YC 4DV0F 5CYQA 2J0QD 1U45A 1MSWD 1FKPB 2NZCA 3RW7A 1PJ5A 4OL8A 5KFEA 4MIWA 3W61A 1YJ7A 3G86A 1B7FA 2CKWA 3NBPB 1LV5A 1HHTP 3KOAA 3CO9A 3J80U 3DDNA 3ZZRA 4F04B 2I9SA 4P71A 1DQ8A 2OPQB 4NA1A 3KLIA 2VG5B 3VAHA 3MOJB 1Y3KA 3HD1A 5KFNA 3Q24A 1CJUA 1FEHA 4KT0C 3RB3A 1RK8A 2FVSA 2AJ2A 3TRGA 4KGMA 4DWIA 4ILMA 2AF6A 2RD5C 1NHKL 2ZBPA 4Y2KA 1OY8A 1KNZA 1UVKA 2DGOA 4WBFA 4BWJA 3PO5A 4RUHA 3DRSA 4EFAC 1N4LA 1X9WA 4DR2J 3MEEA 4C4WA 1G2EA 4OYBA 3WBZA 3DGPB 4LSLA 3B6BA 3SFGA 3IXQA 4F2RA 2LA6A 1N36J 4HR2A 3UDVA 4PWDA 4X4VA 2H3EB 4G6VB 4AQYJ 1XNQF 2CVEA 2RE1A 4UOHA 2XO6A 2BM0A 3NCRA 2OMLA 2UUBF 2C3UA 4USHA 1JXEA 2OMOA 2MJNA 3AAWB 4OX6A 4YB5A 5HMZA 4OZ5A 8RUCA 2YX4A 1KR4A 4A8MP 2RS2A 2XZTB 3H59A 4DI6A 2DNQA 1S49A 4ZVPB 2VBYA 3UVJA 3RW6A 1RT2B 1L3TA 4J90A 1KRPA 4NMXA 5L9NA 3HFKA 3CULA 1U0HB 2DH9A 3C19A 1SKRA 2MB0B 2Q1LA 3CSKA 4U7UK 2D3O1 1RBLA 2HQIA 2IVFB 1UA0A 4QPXA 3EE3A 3MECB 1NKBA 2CJYB 2Z2MA 1SQGA 5D4OA 4BCAA 4X65F 4PWDB 1CQMA 2DEIA 4OLPA 4A47A 2HGLA 2DXDA 2HQGA 2O1PA 5HLFA 3QSYB 2NXCA 3AQOA 1A7GE 1UW4A 3H2VE 1Q7LB 1EZZB 1HHSA 4TQSA 3BR9A 1TKZB 1RYSA 4B9MA 2V50A 4ZPDA 3AOBA 1I94J 1Z4UA 3IWXA 4AD6A 1UZDA 2ZH2A 2VA2A 4WTYA 4TYAA 3I9ZA 3VCDA 4A8WA 1TL3A 1U6FA 5A8KB 3UCUP 1T05B 3W8PA 4NYZA 2C3PA 4YDXA 2ZH5A 4J7CA 2NYHA 5L8RC 1HNIA 4DEZA 4TVAB 4IYQA 5JJBA 2F65A 3CCZA 1TL5A 3MGJA 4JP8A 2W2MP 4D3HA 4FBTA 3SFUA 2DGVA 3G82B 2QA2A 3ISNC 2M9KA 1K1SA 2R42A 5A6WA 1WI8A 1E6YA 1WD6A 4ZITA 1IBMF 1RWKB 1AFIA 2EWHA 1JXVA 3Q8VA 2HHPA 3QFHA 3FMBA 4EZ6A 1SJ1A 2YNFB 2NPFA 1QE1A 3D6HB 3GSIA 4MK9A 4DDFA 4JI2J 1TQLA 3OPKA 3B78A 2BANA 2IMWP 3QIDA 5SUHA 2H65B 4NCBA 2MQQA 1BGXT 2AWZA 4ECSA 3PJXA 1QD1A 1UVIA 4LT6A 3GFXA 4JI3F 2RVJA 3T1HJ 2CWXA 1RT5A 2KDOA 5H9FJ 4UOGA 5F9NA 1S10A 3T19A 4NLTA 3MXHP 1VJQA 3FCVA 1S9GB 3PACA 1U47A 5LMUJ 2QTWA 4DL4A 4L72B 1YZ6A 2ZOMA 3CDEA 5A2QU 2XLKA 1HYSA 1RWUA 3OHAA 2J0WA 5B0EA 5JMNA 1HQUB 4NLDA 4K0KJ 1HI1A 1RTIA 4IFYB 1X0PA 4RBTA 5IC6B 4YB7A 4WFXA 2F9JA 1FT8A 3SCLE 3S8SA 2R4FA 3KJVA 4S0MA 3UD5A 2WVEA 1S7HA 2N4DA 1LQ9A 5M2UA 1BC6A 3IRXB 4C8MA 1D9FA 1CJTA 3A3PB 3FBEA 2DNMA 3N28A 3V6KA 5E0OA 2ABYA 2LEAA 5HATA 4YOEA 4X62F 3KHGA 1YJWS 2UVWA 1SJ4P 1WORA 5B0FA 4ZJOA 4J9LA 2I5JA 4KC5A 2B9EA 1SJ3P 3I5BA 4ZN1A 2PC6A 1RAOA 4PABA 4IG3A 1ZS6A 3OD2A 2EFQA 1PAEX 3FEYB 3MOZA 3WQPA 1QAXA 1R0CB 2J76E 3DOMA 3AD9C 2BYCA 3C15B 5J2QB 5D78A 1KS2A 3CJ4A 3EGNA 4IDKB 3A1YG 4PG4A 4EO8A 3VAKA 1U49A 2CNLB 4NLGA 3MAHA 2ZC4A 1T03B 4NMLA 2O01C 4K4ZA 3O6QA 1V3ZA 2GCFA 2DGTA 3IWLA 1RTIB 4IFYA 4ZP6A 1X60A 3QZ7A 1HWKA 3LWLA 4Q8FA 2JOQA 3TARA 2PO4A 2XZWA 3PR4A 1Y9OA 1RLCL 2IA0A 1NM2A 2QYGA 1F5BA 3CMQA 2VPWB 3C6TA 1WC3A 3KMSA 1Q7YT 1RQ0A 1VYAA 7FD1A 2I0XA 3RAMA 2YH0A 1QSSA 5F8IA 3FRZA 2DK2A 3A3NB 4LF8F 5CZXA 1ZTWA 1EHWA 1K0TA 3LP2A 4UW2A 3KWMA 1S0VA 3POTB 3G96A 1W25A 3KK3A 2ZFHA 3UNGC 2MZSA 2KI2A 4ED8A 5L46A 3K5PA 1XR7A 3EZUA 3GP9A 1HD1A 4M5KA 2HEKA 2MSTA 5THWA 1NO8A 3BKFA 3PX6A 4RWWA 4BS2A 2R8KA 4DSKA 4IO9Q 1JB0C 1WC4A 2JEIA 1N52B 1OY6A 5D4NA 5C5JA 2UVVA 4CO0A 2KU7A 4JI7J 3UPFA 3FSYA 2B51A 2DHXA 5EWGA 1GFWB 3BGUA 1QTMA 4Y28C 1YI2S 2ATLA 2QLBB 3LGNA 2NLWA 5CAAA 4USIA 4TU8A 2MZRA 4I64A 3HM9A 1Q81T 3R27A 5B7WA 1UP1A 4FF2A 1JKHB 2AKWB 3R5GA 4TU9A 2KZMA 1KD1T 1O6XA 5K14B 2KJVA 3KLEA 5D6GA 3UW1A 2EC0A 1WEZA 1A9NB 1R89A 3CJ5A 3UN5A 4F36A 2UUAF 2E9ZA 2KXHA 3OLAA 1TL7B 2W4PA 3V4IA 1DZ5A 2XHWA 3C14A 4IRDA 1U1MA 2IYIA 5E2QA 3W7BA 2ZOGA 4JYAJ 3FGVA 4F0KA 3ILJA 2ROGA 1FJGF 2V4JB 1NK7A 4X4OA 3DRRB 1EETA 2FUG9 3OQ2A 1RWWB 1YJUA 4NA2A 4CO2A 1HBOB 2OPRB 5C24B 3GYXB 3CD0A 2XS2A 3L4BC 2IC3B 4KSEB 4O4RA 1IR0A 2R2RA 5K8PA 1TK8A 2BJDA 1HPZB 4KQZA 5KFQA 4PXCA 2R7QA 3DI6B 1NK5A 3QJLA 1RTJB 1QAJA 4EBCA 1JMTA 3BZQA 4DQSA 2QFJA 4HTIA 4OYXA 3KHRA 1NJIT 1EX8A 3D0HE 2WB4A 3EZOA 5JUMA 1N33F 2CIMA 2YNGA 3U1LA 2JX2A 3HCXA 1IKVB 2K3IA 1JLEA 2ZBCA 3GYNA 2X1GA 1F6TA 2YQ0A 3BBFA 3H2UB 3I0SA 3RAXA 3LO3A 3O44A 3X3UA 1VQSA 3JQMA 3A3OB 3OTBA 3CPWR 2KT2A 1PYOB 2RQMA 3AJDA 4UOCA 2RKIB 1FDBA 3TANA 2GZOA 2AV5A 4KAIA 3HSGA 2XMMA 1RTZA 3D6MB 4K4UA 1WEXA 2V4JA 1C4AA 4DOZA 3W64A 1ZM2A 4R0JA 3J80Y 1JNRB 2LEPA 2LFVA 4NI2A 3BN4A 3ULHA 3VAGA 1N5SA 2W1BA 3O2IA 4P2FA 2PD1A 2M4MA 4P10A 1HI8A 4IFVA 4P6QA 3DI6A 1O5JA 2L9NA 2DR6A 2HBZB 1RT7B 3QQCD 1ZA1B 3TA0A 3UR0A 3RAQA 1HNZF 4Z2XA 4O0IA 2D41A 4ER8A 4N76A 1TAQA 1U6BA 4YHHJ 4CZCA 1GQEA 2ADCA 1F9FA 4ZLJA 4LSNA 1HQ2A 1Q8KA 4HVZA 2E1RA 4RLEA 4DL6A 1BQNA 3P45B 5ETLA 2ZJPQ 4ZCKA 4I6WA 2UZAA 2UUTA 3LQVA 4WJBA 3UO0A 4HT5A 4WZQA 4KRWA 4ANEA 2GMHA 3RUBL 1X5TA 3J7ZT 1KQKA 5L1JA 1U1KA 2FZCB 2GMLA 4K2XA 4H4MB 2OEKA 3DXBA 4NEYA 1WI6A 2OI2A 3G8TA 2ZBQA 2V8VA 1H2UX 2MKHA 5LM7E 1FERA 5K5MA 2HVEA 3FSIA 1VMBA 5ETNA 2LLZA 4NZ0A 1NCLA 1N34J 1R0BG 4RW4A 3DYAB 3EX7B 1S1WA 1NH7A 4RUCA 1HFEL 3ZZPA 2EBGA 1BQMA 5F8HA 3AA9A 2MKIA 3W2WA 1EIYB 2AW0A 5B09A 4ZCIA 4PPZA 3HPOA 3H0PA 4C0OC 4CRJA 1VI7A 2HURA 4H54A 2BKOA 3CCRS 1FKAF 4K4YA 2YWHA 1RAIB 4FKXA 2XYPB 3S01A 2IRXA 1XN9A 3IGNA 4ECUA 2DITA 2GS8A 1C1CB 2RAQA 4B3SJ 1PC4A 3D9BA 3MECA 3PG9A 1JLFB 2YPZA 4B3RJ 2LKZA 5BYSA 2MEWA 1EARA 1CJKA 2YNIB 4PYAA 2GVZA 1B0TA 2VBXA 3CJ3A 3MR2A 4IOCQ 2DYAA 3MHYA 2GA7A 4Q0BB 2R9LA 2J5AA 1WELA 1TKTB 5GAEI 2BM1A 2XGQA 1REGX 4C98A 2BOPA 4B9VA 4TNOA 2LMIA 2OD6A 4OYPA 4BHQA 5KFJA 1YRTA 3PVXA 2DHGA 5B0DA 1TUGB 4JI4F 3VAMA 5K14A 1KHWA 4HH1A 4JV5J 1ZA2B 2JFKA 4OHXA 2J6UA 4DCPB 5J2NB 1N6QA 3CCES 4KGVB 4O44A 2WVCA 1T9YA 4HT7A 5DDQC 2HYIB 5ETKA 2IJNA 3I4HX 1K73T 3B8HA 2EI5A 1S1XA 2GJ2A 2VH7A 3IG1A 2LQ8A 3D3CJ 3NGKA 2ZH3A 1J5OB 1GH8A 2JDJA 4PXEA 1NK8A 5A2QY 2ZHAA 1G1XA 4KGZB 3Q8UA 4JI0J 1P1TA 4ITSA 2FQQB 4RKUC 4USUA 4DUYJ 2I6WA 2C2DA 3DMJA 2ASLA 3KLVA 2JEFA 1Y10A 2C2ZB 4PXDA 4NRUA 1U1RA 4ICLB 4Q0BA 2I38A 3MEDA 3J81U 1HNVB 2NUUG 3DDKA 2XQCA 2MHEA 2R7VA 3AXKA 5IWAJ 4KPCA 1LOUA 5J2PA 3OT9A 3N5FA 4CTAA 3NLCA 2UUCF 3SBMA 4C8YA 1CULB 4YY3F 2VQFF 4NWBA 4TKTA 4UY8T 5DGAA 3BKUA 4KR0B 2LP4A 3TAQA 3FQKA 4Y3CA 4J9UE 1B7YB 3GCWP 3HSJA 3I31A 1S1UA 4QPTA 5L1LA 2UXDF 2DISA 5HQ8A 3BS9A 2BKNA 1K0VA 3TNVA 2HGNA 2F8EX 3C16B 4XPCA 2M0GB 5KFVA 1HNWF 1SB6A 1HR0F 1Q8LA 2DNPA 3D28A 3CTRA 1RI7A 3BPSP 2EFGA 3DLEB 5ADZA 1N5QA 4AXIA 3CCSS 2W9BA 5DZ7A 4TXSA 2QLXA 4FS2A 2OAUA 2G13A 2R3VA 2YTCA 3GLJA 1RCXB 3K17A 4IFVB 4ICLA 2GAHC 4ED0A 3CVKA 2HW3A 1IKYA 3AJ1A 4ED3A 4IG3B 2QA4S 4RBUA 1U6ZA 2H5EA 1MWQA 2HQDA 2OGUA 2V4QA 4TU7A 1NK9A 3MM6B 4I6YA 1M1KT 1F9HA 4CT8A 3FDSA 2VOOA 2CPEA 4LSZB 4M5GA 1YBUA 1WOOA 4CDIA 2XCAA 1KVIA 1PBUA 1OPZA 2B8QA 2W2QP 2GGPB 5HMYA 3BKTA 3KUEA 4RO0A 5D4PA 1VIOA 1VRQC 4C2MA 4DLEA 3ZZYA 1ACMB 2NPIA 1HBUB 1BD6A 4WXWA 1U1QA 1AZSA 1ZZFA 2IM1A 4I56A 2CQIA 5DLGA 4OYMA 4Z37A 2AYGA 2Z2LA 1MLAA 2X1BA 5LT5A 3MFHA 2HRYA 2XMVA 1H73A 1JLQA 2BOAA 3N9UC 5IXUA 2NSCA 2HBRB 4IH7A 4K7QA 2ZH8A 2ALZA 3OR2A 1IWAA 3TZZA 3HVAA 1G3OA 4FVCA 3W5ZA 3N6MA 2C3YA 2HBQB 2MKJA 4OZ1A 2PMZD 3T5LA 4DX7A 4LF9J 2W7OA 2FHKA 3H40A 2DNGA 2J0SD 1R6VA 4YR2A 2KM8B 4UQTA 4WK1A 2FHJA 1FA0A 3KKFA 4NYOA 3W2WB 2BQ3A 2CA9A 2D1CA 4CLFA 1CS4A 1VRUB 3R8YA 3POTA 4J9OA 1M5PC 2JRSA 4ELVA 4LRBA 2BJ9A 4JI5F 3PJWA 4CH7A 2GMJA 3OXLA 3UI3A 5C42A 4F4YA 1EKSA 4EMDA 1Q82T 3T1YF 4NLXA 2E29A 2QE5A 2JVRA 5E7OB 3ITHA 4KKOA 1U1NA 4O4GA 2HHQA 1D9AA 5ITHA 1WSRA 3BR8A 1T9TA 1VQ6S 3D7SB 5I42B 4NL5A 4LQ9A 5HN0A 3EMTA 1NSAA 3MMBA 3SQOP 2UUBJ 1HW9A 3BGOP 3AOCA 3R5CA 4A8FA 4LF2A 1JLQB 2C2EA 5J1PA 2HHSA 5EHHA 3CIMA 1FXRA 4OHYA 3EZ5A 2G0JA 4DCOB 3KYLA 3JYTB 4ZIWA 2NYIA 2B43A 2DNLA 3Q2SC 3F41A 3W62A 4L74A 5HROA 3NNHA 4C3LA 2XLJA 1CS4B 2HS4A 2XMTA 3HJVA 5A8WB 2EVZA 2W9AA 1W26A 2B9YA 4KY3A 2Q66A 2BXJA 2FPHX 3NCPA 3QT7A 1GTEA 1E6VB 1XR6A 4I69A 3DN9A 3QPIA 3BGRA 3FMWA 5DETA 4F8RA 1OSDA 2HLUA 3MM8B 5DGBA 3UR3C 1FI4A 4MIBA 1PC5A 5KFIA 4OJ3A 1QDUB 4URSA 4DR5F 4FPIA 5ETOA 4PG8A 1S9EB 1REVA 1NK0A 3ILOA 1H38A 3BBBA 2J9EA 2JLFA 2K7KA 3AA8A 4ZN3A 2VFVA 3H5UA 2E44A 5A8RB 1Q53A 3T5HA 4B3MF 4LF6J 3O3LA 2UXBF 4OLOA 5DM7Q 2FLLA 1YRUA 2V2VA 5AXLA 3PW4A 3NWGA 1WG1A 3JTPA 5IC4B 3IS9B 3PRBA 4CTAB 1LXJA 1TR0A 1FVSA 4DV7J 2DNKA 4A48A 4DR1F 2MGZA 1QUVA 1KQSR 2H48B 2VU5A 3ETOA 3G87A 3Q83A 1NXIA 2MKYA 5KFAA 3TEHB 1IKVA 3HP6A 5EWEA 3R2DJ 1F2GA 3I0SB 2V4RA 3HHKA 4DMZA 5T14A 4PUOA 1QTNB 2XB2D 4JI8J 4ZLPA 1LFPA 2CNOB 5ETPA 1RTHB 2RDDA 3EGWB 4FKYA 1IBLJ 4V19J 4MK7A 3DLKA 2ZH7A 2E9TA 4TQRA 4DPOA 4N5SA 3H4DA 2FVQA 3SDEA 4AUKA 1FWKA 1V6HA 1Y7PA 2ZBRA 4PEOA 1IBMJ 1UVNA 2OPSB 1HMVA 3QT5A 2JEJA 4ECYA 4CO1A 4W92B 3U27A 1SH0A 2F3JA 2E5HA 2Y3YA 2PFFB 2GJFA 1UKUA 1FRHA 1BWVA 5FIIA 1U25A 2DNNA 1RDRA 3VGVA 3K2YA 4UQGA 3MUVP 4EYHB 2HHWA 1GAOA 4DZDA 4ZIVA 1DBDA 1RWVB 3PNIA 4OJHA 5B0CA 2AEJA 4DPUA 3JSMB 3K5NA 5M2PA 3M2RA 1DHMA 2VICA 2XSJA 2ZZTA 1XMQF 1QAYA 1WJ9A 3QMQA 4LSNB 5HQMA 3GJTB 3MM9B 3RGIA 1AXQA 4CYUA 1BQNB 1HBUA 4B3RF 3IGVA 2BQRA 3HF5A 4PUOB 1KOHA 4DXLA 1YKWA 2R7WA 5L1IA 1YTYA 3M9NB 3VAFA 3CC4S 2K06A 1WG5A 3DLKB 4TLQA 3CF5Q 1RADB 3K5MA 4K4TA 2HQCA 3HVTB 3TVKA 4YHHF 4LFBF 2JSXA 2IHR1 3BJYA 3RRGA 3WHIA 2GVDB 4LBHA 2HFNA 2GX8A 4J37A 2YY3A 2HVHA 2H4WB 4YR3A 3GV8B 1S1WB 1RCOB 3WZ0A 1G7CB 4GVBA 1BQMB 1I5OB 1JKHA 4WPAA 3CD6S 1R43A 5C2GA 1S72S 2IJFA 1PJ6A 1ZAXA 2VHGA 5B08A 2VV5A 1FRJA 4I2QA 4LJMA 3PX4A 1RWNB 1RU2A 4LIWA 5DM6Q 1RHRB 5A76A 4MKBA 2EFPA 1VHIA 3UCZP 1C0TB 2M3DA 3MURP 1LWFB 2VJVA 1FFSB 1J5EJ 1U48A 1UTAA 4U6PA 2XY7A 4CO5A 2XMAA 2ZKTA 3OL9A 4I67A 4OX7A 5KT5A 3QGHA 4I2PA 4CLYA 3X1LB 3FUYA 4D3GA 4U8VA 2C1EB 4FYDA 3SZ2A 4U67Q 1DRZA 1G6BA 4YP3A 4FXWA 3OSPA 4WKRA 2Z2ZA 1HPZA 1WTBA 3FBBA 4ID5A 7FDRA 2WSFC 3TW0A 4IOAQ 3Q86A 1NSQA 1H72C 2XI3A 5A0YA 1SJFA 2HBYB 4GVBB 4WFNQ 1GX5A 2M70A 3F73A 1NK6A 3TJ8A 4LRDA 3NS7B 1FTCA 3LW5C 5LSLA 3HZEA 1GK8A 1UFKA 1JJHA 2JLGA 2XMUA 3V81B 3OSNA 2VOPA 2CQ2A 3LP0A 3B82A 4ZKAA 3MDFA 4JV0A 2W2NP 2FDNA 2JL9A 2KO1A 3HHLA 1SUQB 1S57A 2OEJA 1NH8A 5EX3A 3G8SA 1CC7A 3J7AN 2YKNA 3D3BJ 2J0XA 3RBZA 2E5LJ 2APOA 3BQ2A 5ETVA 2G4BA 2FLNA 2FVPA 2IA6A 3EGZA 3PCOB 2PMHA 3Q8PB 1KEKA 3MEDB 6FDRA 1PGZA 3K57A 2JFDA 4RW8B 8AT1B 1HBNB 3HHNB 4WF9Q 2X1AA 3LOUA 3EYZA 5F8GA 3M6UA 5IS2A 2Z30B 3OR1B 4GRSA 4QYRA 5DO2A 1YBAA 3SV3A 2DNYA 4DPYA 1FD2A 1CULA 3AOAA 2HFUA 2CAJA 2YX1A 1U09A 4QW8A 3TO8A 3KHHA 3M8ZA 2ASJA 1TTHB 3HK2A 2F63A 3G8QA 4FYWB 2V6AA 3NWRA 1NDLA 3D5MA 2VG7B 1R8HA 2ZM6J 4WWSA 1GMWD 2DGUA 2Q43A 2RU3A 1T9WA 3MCMA 3G71S 3HI9A 2CFXA 4WFYA 1RT1A 1NJWA 2PN6A 4DR7J 3CCUS 2OPQA 2FZKB 4EBDA 2DIUA 4F02A 1ITPA 1U1LA 5KFGA 3UE2A 3PIPQ 3BDPA 1NKCA 5G0RA 4RW7B 5DDRC 2ACYA 4JOUA 2FC8A 1BLUA 1B0PA 1LKZA 3BSNA 2RRNA 1HWIA 4DQQA 2AD9A 1X4BA 2W8LA 3EGVA 1Y4ZB 2MPUA 3D0GE 1B99A 3VZIA 2IM2A 3IC1A 3ILIA 1RT3A 1WF2A 4C48A 2EG2A 3P5TL 3FFIB 4ZVGA 3DGVA 4ZP8A 1BXNA 1M5HA 5KG5A 3MM9A 3V6DA 1T95A 2ROEA 2XY6A 3MPVA 2VDHA 2HNZB 1RT4A 3GJSB 4J9QA 2BABA 4UTGA 5GADU 4WFAQ 2BJEA 4LVOP 5LXYA 3D66A 1JLBA 3KNGA 4Y00A 3TJAA 4DPXA 1PILA 2IRUA 4DUZJ 2CWKA 3I32A 1VS3A 1YHQS 2CDRB 2D69A 2F8HA 3WC2A 2EXUA 4AL6A 1D09B 3LUYA 3MPYA 4ETZA 2FHMA 1WTFA 1WC1A 2B4VA 3QFWA 4E0DA 4KIAA 1TFYA 2ZM6F 3QGGA 1TZ0A 1Q5VA 2IYGA 2MDAA 4NLVA 3EVMA 3MWBA 4R5PA 2ZUAA 3GILA 4P75A 2CZ4A 1RT3B 2OTJS 5J2NA 4PZVA 4DZ6A 5C42B 3BSAA 1IVZA 4M95A 3TUIC 1NEEA 3D1HA 1WHVA 1S6QA 2V8DA 1D8YA 2RQ4A 2VG6B 3G4SS 1FWLA 3J81Y 1T94A 3BDEA 3OXFA 2XWYA 2Z56B 5L39A 2Z4PA 2MZ1A 4M8LA 4Y2IA 3V5RA 3RB4A 4X4SA 3HO1A 3KJFB 2HIYA 4GKJF 3T9NA 3AFGA 3IR6B 1SQFA 4PAAA 3H8YA 4F4ZA 2GW8A 1HIYA 1J27A 2H54B 2ROPA 3M30B 2VC1A 1XR5A 1H3DA 4DV0J 3CJKB 4C8KA 1EP4B 4AQYF 2KT5A 4DPWA 1U4BA 1Y11A 4OIXA 1S0NA 2F7VA 2VC0A 3A8KA 1WACA 2PEHA 4ZVQB 2MKCA 2X3GA 3CCJS 1VC0A 3SIPB 4JI1F 2JEGA 2YWGA 2RUSA 2Y1LB 3GTYX 4OQJA 1P6TA 4X64F 2UU9F 3GIKA 3DM2B 1D8ZA 2FYXA 3LP0B 3T1HF 2FVRA 2MQLA 2YKMB 1JQGA 1YG0A 3N6LA 4Y2CA 1VC6A 3CC7S 4F0MA 2VG6A 5CD4A 5GMDA 3HHLB 1UJ6A 2D3ZA 1SUQA 4ZHRB 1VJWA 2HQ3A 3TOQA 3IMQJ 4LF7F 2EBEA 4LR7A 2HNYA 4XAKA 3G6XA 2DCUB 1S9EA 1XEZA 5KG2A 3LPEA 4WIQA 5KFHA 5BYQA 2BANB 3PDNA 3KMQA 1JLAB 1S48A 4C97A 1SJRA 1H74A 1MWZA 1WKJA 5DG7A 2XULA 4LR9A 5AXKA 3CJSA 2GQ2A 3FCWA 3KLFB 2F8MA 4IG0A 1VQ4S 2DHHA 1N0VC 1LW2B 3MCNA 1GXTA 1MMLA 4Q43A 3M1VA 1VQYA 4M5LA 3LP1B 2EC2A 5CABA 3MCOA 4B3OB 3MMCA 5LMNJ 5KFLA 1X4CA 2KRRA 3WIVA 3OFEA 4LRFA 4Y6IA 1H2TZ 4J9VA 4GC7A 2Y1IA 1CEZA 4Y0FA 4DV6F 2DHAA 2KRBA 4HH0A 2JHEA 4FPRA 1BWEA 2MHNA 4KYZA 2UVRA 1X5OA 2CJKA 4IRKA 1URNA 2BW2A 2WOMB 1NSKL 3TAMB 1TK0A 2NXEA 1FVQA 1S76D 2EK6A 4FDFA 2RRAA 2YNHB 3HD2A 1Q5YA 2V5HG 1FJCA 2XS7A 3OBIA 3R5AA 5HSPA 1WHYA 2VONA 2ZZNA 4IR1A 1RJJA 1NZAA 2CJBA 2NXJA 4TY8A 4YN3B 3GR1A 3US5A 3W9HA 4PQAA 1RT2A 4URGA 2E66A 2B5JB 1VRUA 2AGQA 1ZZNA 3C3LA 4LFBJ 4OZ2A 1Q78A 4MYUA 1FRIA 1H6KX 5IQQA 1JJCB 3JSMA 4ECTA 4UY85 3C15A 5KFUA 3B4DA 4DL5A 3QGPA 2G0CA 4LMZA 4NZ6A 2VDIA 2XSJB 4W98A 2DKOB 4BBYA 3PYFA 3QWUA 5CD4H 3Q23A 3PRDA 1OO0B 3PXGa 3BO3A 1UPMB 4C0HA 3G6YA 2VF3A 3SCJE 2DPJA 4QU6A 3AT1B 3LGHA 5I42A 2BMBA 3LA0A 1F5AA 4B08A 2UVUA 3AXMA 4ED1A 1LNQA 1NRKA 2OKQA 4RW9B 4R8UA 4WZMA 3M05A 1HNZJ 1RYRA 3EXCX 4USKA 4DX6A 2BDPA 3HVTA 3TYTA 3MEGB 3W5YA 3U02A 2R7RA 5HMXA 4ZJQA 2PIIA 2DXEA 3HFZB 2BE2A 3TR5A 2J7UA 3JYTA 5GVQA 8ATCB 4HACB 2QN6B 2K1RA 1WHXA 3M8QA 1KONA 3Q89A 1ZH5A 2EFOA 3QLHA 3W2VB 5KT7A 4YB1P 5A8WA 2AU0A 3PR5B 1U26A 3NY0A 2QYCA 2CPDA 4GC6A 5F8LA 3MTJA 4DFKA 3QYYA 5KT2A 2KXFA 3D4JA 4CLZA 4LIRA 4XTTA 4CLLA 4DG1A 2XSFA 5C25A 1A0OB 2LQ9A 1IJFB 2D3UA 2IJRA 2LXUA 2RNEA 2WW8A 4WFZA 2RSQA 3V2UC 4ECQA 4ZPCA 2OELA 2RMLA 5E3AA 1GEHA 3I5AA 4HI1A 2PMWA 4RUAA 2FGOA 4RZRA 2E5LF 2M8HA 3IAM9 3N79A 2OHDA 4N7TA 4PCQA 2A6MA 5E41A 1SJQA 2PA8D 2DNRA 4ERDA 4DR3J 1N5VA 2KJWA 3M8YA 2V2ZA 2VKRA 2ZD1B 4LF5J 2YX7A 1W7WA 1X4FA 1Q95G 3GR0A 4ID5B 2VFTA 4DV3F 3IS9A 4QIVA 1RBAA 5IM0B 1IUJA 1S9FA 3PYGA 4DSLA 1LK7A 5GMKa 3ZTOA 1VBYA 2GQCA 4QW9A 4XPEA 3AJ2A 4DSJA 2BV3A 3E8OA 2HSEB 2VFUA 5K8OA 5AXNA 1UJ5A 2YQ3A 2VIHA 2UXCJ 2GC8A 5D15A 3MAQA 2DR5A 1QSLA 1IBCB 1L3VA 1X9SA 4ZHRA 5FDLA 4DV4F 2AQ4A 2WBMA 4CI0B 3M8SA 4FNHA 1FKOA 3OFHA 1VQ8S 2A0FB 2HNYB 2I8EA 2Z8QA 2CPXA 2LVWA 3UN3A 3WIUA 1U8WA 1NUEA 4WU2A 4NLSA 4YEAA 4ECZA 2D9OA 1HWJA 4G1IA 1HMVB 3MR5A 2VB6A 3LALA 1WKKA 3M2UB 3BV8A 1NB7A 3I96A 3KLIB 1TELA 2V69A 1RT6A 1C2PA 4ZP7A 4HYKA 1FNOA 1N5YA 4C9DA 2QSFA 1ZAVA 4ZPWR 5BYRA 4B9NA 4NLOA 3M9OB 2I2YA 3H98A 1HBNA 5KG4A 4MMOA 4K4XA 4IDKA 4LFAF 1RA6A 3M2RB 2R2TA 3CEDA 1T03A 1RHJB 1IKWA 2H51B 3MEEB 1TVRA 2LQJA 2ZE2B 1KQGB 3H20A 3JXOA 4DV3J 2AJQA 2J8SA 2AEMA 1ELOA 2L9WA 2XYGB 1X9MA 5KOXA 2CPZA 4WP3A 2K7JA 2BE7D 1KOOA 3C6TB 3W9IA 2YH1A 3JAMU 4J9KA 2VA3A 3HJFA 3DCAA 2CADA 4J9NA 4A8SA 3I0RB 4FNIA 1FNMA 3P96A 1EAYC 4RJVA 3AHPA 4DUZF 1YJNS 3TAPA 2F1FA 3HSZA 4HTJA 3MAAA 4O3NA 2CXEA 1RAEB 3FJ2A 1MROA 3EM1A 4WIIA 2RQCA 4TLRA 2O66A 4F0HA 3EPGA 3PYDA 4X4QA 2XHCA 5D0HA 3L09A 1IBKF 4KPYA 4DJBA 1VQKS 4ZPTR 5LL6d 5KFXA 1FRLA 5K9FA 1K9MT 4A8YA 1R31A 3HVWA 4B9UA 2HFSA 2Q6CA 1NZ8A 3FBCA 5SZTA 1XIQA 1Q1KA 3OVBA 2HNZA 2LCWA 2QGFB 5GAHU 2V63A 5DG8A 2ZKUA 4RW9A 3TUPA 2ATCB 5BXIA 2G1HA 4NLUA 4I2PB 1HI0P 2X1FA 1JLBB 3H42A 4ZJLA 1GT8A 2W9CB 3RG6A 4LQ3A 4ATNA 4FVMA 3KK2B 4DS5A 3D2WA 1IM4A 1SIZA 3UNYA 1UZHA 1HARA 3NAHA 2AJ1A 1CQNA 5CZVA 3QT8A 2QX0A 4FF1A 2MYFA 2DBBA 2DGXA 3LPYA 2ERRA 4O3SA 4PG7A 3VALA 3PEHA 2BA9A 3ZXWA 4ZDNA 4CLSA 1DTTB 4GKKJ 4Q5VA 1FKPA 5F9LA 3GIMA 2GV1A 4ED4A 4F7VA 2XY5A 1SH3A 2C2MB 1WNEA 3H90A 5CCLA 1FD8A 3L7PA 2HWHA 2OUGA 2BBEA 3TX0A 4USMA 1NBEB 1NLKL 3OVSA 4DLGA 3O1LA 2IBOA 2FD2A 3EUNA 3KDNA 4X4TA 3KG0A 4AL5A 2DGQA 5M2RA 4LF7J 4OI6A 1EP4A 1RTJA 4L75A 3CW2C 1GMWA 2KVQE 3FEZA 1EQMA 2VFSA 4U9RA 2E7XA 2YWWA 2FGCA 1R6YA 4ZA1A 4JI2F 4DQRA 4DUYF 3Q2TC 4X2BA 1TV6A 2CNNB 4J5OA 2UV8G 2RS8A 1OY9A 5I3UB 5LMNF 4NCGA 4DFMA 3K0JA 1SIWB 3MEKA 2D7SA 3NOGA 3PEJA 2CQ0A 2P6SA 1H7WA 2BKPA 2XI2A 4Y2MA 3DM2A 3FC9A 2HLTA 3TEGA 2R7SA 2UXBJ 4WKYA 4KJIA 1S0OA 2CJAA 3P5BP 4OFZA 2RKIA 1J5OA 3PO4A 2WSCC 4OHVA 3CD5A 4ECXA 5F41A 4C8ZA 4DV7F 2L48A 3JSYA 4DFJA 3PX0A 4DL2A 2AYEA 4K0KF 1BUXA 1VC5A 4IH5A 4C8OA 5GAGU 3BQ0A 3M6VA 1CJTB 4WE1B 1JJ4A 3DC2A 1MW7A 1Q0NA 3SCKE 3JAMY 2C2KB 1C4CA 1B4SA 3PV8A 3OFGA 4QWBA 3RJMB 1KLMA 1HW8A 2PSZA 2CUYA 5LOQA 2VZ9A 2GHWA 1Y5LB 2QRRA 3T1AA 4DFPA 1GX6A 3TA1A 4P73A 1M5OC 3M1VB 5KFDA 1KKHA 2HRTA 1VBKA 2RILA 1S1VA 3HT0A 3J81j 4P7VA 3HKWA 5HP1B 3OTEA 2P8IA 4OJ1A 3NS5A 5KG6A 3OLBA 1YJTA 4DR6J 2VJUA 3RBEA 1YK9A 3LAKA 5D0EA 2OJ3A 2CQCA 3KJQB 3MPWA 1WWHA 5HVGA 5CYJA 5IV3A 3LAMA 2HKEA 3DKDA 3R9LA 2QT7A 3I9V9 1SL1A 2FJWA 2Q6BA 1NKEA 5E3PA 4CH0S 3GV7B 1N32F 1S79A 4FN5A 3VVTA 2HPUA 3DNCA 5J1NA 5G4DA 3ZFVA 2MLZA 4I7FB 5CYMA 3DYAA 5KFZA 4EK2A 2HS3A 4IQXA 4NXNF 2KXNB 3AD8C 4B3SF 2X51A 2GNKA 2AJFE 3HZGA 3ZNJ1 5H9EJ 4NXMF 2P9EA 2MQPA 1FXDA 1KP6A 1U2CA 1CC8A 1R8PA 1UCNA 1NHVA 3CDBA 2XCPA 1RWXB 2J9DE 1NJZA 3PFOA 5AJ3F 2EK1A 1F2HA 3EDQB 3I4PA 2Y1RI 4CQ1A 3QO9A 3OL8A 4FS1A 2AGPA 3NNCA 2CPYA 2H5JB 4P74A 4Q7AA 2FJEB 4USWA 4DR4F 4QWAA 4WYWA 1X4DA 2D3OR 2HK3A 2Y8YA 3BPDA 1T3OA 4RL1A 3UN2A 1AZSB 1UEKA 4JB8B 5DDOC 1VQOS 4LREA 2DHSA 2F4VJ 1F1BB 5LSRA 2PGCA 4K4WA 2CQHA 1SC4B 4F26A 3H25A 3ENAA 2O5DA 2ZC3A 4OYIA 4JI6F 4I7FA 4CLKA 3NGSA 5KFPA 3CE8A 4IKAA 4XIUA 4ZVEA 2K2PA 1JLGA 1YJVA 1S1TA 4URQU 5HANA 3SQGA 3UD4P 1HR0J 4K4SA 2BJ8A 3F0NA 4FXVA 1M5VC 3PW2A 1VBXA 2RQKA 5DQHA 3NMAA 3ADAC 1N6QB 6FD1A 1VQ9S 1M0SA 3N5BA 1S1XB 2UP1A 4X66J 2VFRA 3NMRA 4L3NA 1YLXA 2DRDA 2HGMA 2NXUA 2OEMA 1P8GA 4CIOA 3U1NA 4DR5J 4EEYA 1NNDA 3QJJA 1X7VA 1R27B 5KT4A 2ZWOA 1FDNA 3DU6A 3AB2B 3GONA 1IQTA 2OPRA 3PKYA 2I5JB 2FZGB 4JYAF 1P1LA 3I87A 2UXDJ 1RSCA 1RISA 3VQSA 2MQOA 5J2PB 1JLCB 1NDCA 4Q45A 1LW2A 1L3SA 2GIRA 5I3UA 1KVJA 1WDDA 4NCGB 1RKJA 4AT1B 2OSRA 1YIJS 1PKUA 3DOLB 4KO0B 3KUGA 4Y2AA 5DRKA 4OMFG 2AX0A 3MZIA 3QIPA 1FFWB 3E01B 3L9ZA 3BGRB 2HG4A 3NBPA 3NGTA 3G82A 5DZ6A 2AIRB 3JSRA 4NCAA 4M5IA 1WEYA 2P9GA 1O8BA 4TYBA 2IPOB 2NUHA 2WOMA 4DN0A 2AYBA 3MM5A 5JXSA 2YNFA 3DFEA 1XK8A 1QE1B 4Y65A 3BEGB 1AFJA 2CPJA 1DQ9A 2YWKA 4HHJA 1ICEB 1NAQA 4LUBA 1IQZA 4C11B 3M2UA 4J91A 4PR6A 4NI2B 1CVJA 2XEXA 3UQSA 1TUWA 2RUGA 4TY8B 4LBPA 1X4AA 1TL1B 2J8AA 2DT9A 1OQ6A 2B6AA 3LP2B 3P4UB 1RT5B 4IO1A 4MYTA 1CSJA 1F3VA 4F3MA 1R8AA 3HHEA 3KLGA 1RAAB 1FNXH 3TVZA 1NPRA 1VQ5S 5KAKA 5HP1A 4HLBA 1YDLA 4I68A 2CQ3A 2POKA 4QR1A 4U7CA 3BREA 2MXYA 1S6OA 1ZPWX 1U2RA 2C42A 4ES1A 1W2BR 1VRTA 4CM2A 4UOFA 4K2JA 1U1OA 4LF9F 3MUMP 3H5XA 5IOLA 3E01A 3IWNC 3T6BA 5GAGI 4B3TF 3RRKA 5I3PA 2QLFB 1M5SA 3I55S 3T5JA 4QZVB 2E5IA 3RBDA 3M2VB 1WOPA 2MY8A 4LRAA 5E5NA 2XLIA 4B9LA 1ROFA 3CT9A 2HVIA 3J7A1 3T1YJ 1ZETA 3ZZOA 3GFZA 1SBRA 5L38A 2K1RB 3UDCA 2RDIA 3UDLA 4EU0A 3MAAB 1C0UB 1Q8BA 2Z0GA 3E51A 2VKZG 4H4OA 3CJTA 2LXFA 1BMQB 4ECRA 2QMWA 1FRXA 2YWEA 2GJIA 2KTQA 3BSOA 3KG4A 5KOWA 1MN9A 1V5VA 2G2ZA 3HKZD 3F56A 2ZDPA 4PG6A 2DNZA 2YKOA 2XS5A 3GYGA 4DR6F 3D6FB 4KHMA 4G1PA 2W4DA 4NLYA 5C2CA 3GIJA 3M6WA 3MM7B 4NLPA 2DR9A 1C1CA 1RA7A 2PDAA 2QLWA 3QGIA 1V5IB 4L73A 4ANCA 4OI0A 4E2FB 1VHFA 3KDOA 3FNNA 3CDUA 3FVYA 5GMEA 4NLWA 1DARA 3RTVA 1SL0A 3R2CJ 2YQ1A 1B64A 2XYHB 4LFCF 2B3TB 2AX1A 2V9KA 3R6LB 5B0GA 1PCAA 1SVDA 1HBMB 4N8OA 4QWDA 2KFNA 4EYIB 3MD1A 3K8WA 1QSYA 2OLWA 3FQLA 1N0UA 2EFNA 4WU3A 4BLGA 5KFMA 1FX2A 5D3GB 1C0UA 9ATCB 2VPZB 2RDJA 1GXUA 2XMWA 2KHDA 2B7CB 1TP7A 2L3MA 3P3DA 2QV6A 1CLFA 2CQDA 4NEZA 4DR2F 1UEVA 3A12A 3HSDA 2FVCA 2MQMA 3CJ2A 1SCJB 2W2PP 4OHZA 5DDPC 4CM0A 3NP5A 3CNQP 2HFOA 4DSFA 4QOTA 2HFZA 1PAUB 3R97A 4JI1J 1IWGA 3BYPA 5EDWA 2LXIA 1FJGJ 4M63A 3K7RA 3S1TA 1ZPVA 3DOKB 5A8RA 1NHUA 5D4LA 5DS7A 1N48A 4QIFA 4DR1J 4HHHA 3T3FA 1NPPA 2HQFA 3DRPB 4DQPA 4M5NA 2R8HA 3V6JA 2HVZA 2EEYA 4KHPJ 1SPBP 3DLGA 4HEA9 4X66F 3OTOJ 3Q0AA 1TK5A 4QIEA 1OSCA 2ZVSA 1FRMA 1PJ7A 3BM7A 1S0MA 4ZVHA 3CO0P 4ILLA 2MJUA 2P6TA 3QIPB 3GU0A 1FK9B 2YKAA 2QO3A 5HI7A 3SSSA 4DBQA 1RAGB 3HT3A 3I5CA 4FF4A 3A13A 2BJ1A 5IV4A 1R8CA 4YB6A 5GAEU 4LR8A 3M4XA 3O5TB 5CCMA 1TL7A 2ACMA 4JBCA 4Z7YA 4OX9F 3LWMA 2KYZA 4J9SA 1RHMB 3V4IB 1PO6A 1FFGB 2HAIA 3OVAA 2UUWA 1RWPB 2HVDA 3T6JA 2MKSA 5EX0A 1X4EA 3K5OA 4C7QA 2VL1A 4AE5A 2VODA 4C11A 3TA2A 4F3QA 4KBIA 4DV1F 4ZLNA 5C24A 3AD7C 4Q8EA 4HKQA 4WE1A 1XJWB 1ZM4A 4LBIA 4W90B 1P9QC 3NGRA 1CJUB 2XC9A 1IKXA 2J7KA 2YPYA 3DRPA 4UF4A 3VWSA 5J2MA 4FZVA 5HO4A 3DOMB 4N8NA 1QM9A 1N88A 2G0IA 2Q79A 4LF5F 3IP0A 2HS0A 3P6YC 1L5UA 1DY3A 2AJ0A 1VRTB 1JLEB 1JIHA 1P27B 1S1VB 4WK3A 1UVMA 2QA1A 2JJ4D 2IAJB 2R7XA 2KYXA 2Y0SD 3MPUB 4HHUA 2ADBA 3CDAA 2CQBA 1MMDA 4MK8A 1OIAA 1RLDA 4OI4A 2MMYA 3M2VA 5HBMB 3HVRA 3V6HA 2IRYA 1YJRA 1T8EA 3KLHB 2SXLA 3CCWA 4CLTA 2MY7A 4U96A 4A46A 2J7WA 2YKPA 2B8PA 1LK5A 3D67A 3Q8SB 2M8DB 3HFVA 3ILLA 3R5BA 2F4VF 3T5KA 3G9CA 2GVDA 2MLYA 2LQ5A 1YBTA 2IMOA 1TKTA 3JS9A 4MIAA 1Z1ZA 2PT0A 1K8AT 5F8MA 1YGYA 4GO5X 4PWUA 4WP9A 5AXMA 4F67A 1N36F 3NL0A 4Y34A 1GTHA 1LW0A 2WSEC 2DCLA 3C2PA 5IZHA 1NSPA 4PQUA 4PWWA 3K8VA 2NS1B 1YJ9S 1FXLA 3IR5B 2CPIA 4QWCA 2LECA 1AROP 2P2CB 1QUPA 1FF2A 3H2LA 3HDSA 4A8XA 1C0TA 3ISND 1AT1B 3QO9B 4GKKF 2YVSA 5AT1B 3MM7A 3IG1B 4LFAJ 5KFYA 1TMMA 5KG0A 4BC9A 4O3RA 4NXMJ 1RT4B 4NRTA 3Q8YA 1T9XA 3FRYA 4B02A 3GCXP 3GG1A 5F3TA 2PI4A 4LF4F 1XNRF 1U1PA 1IBLF 4J9RA 3SV4A 1BE4A 1JK9B 2V8HA 4NASA 3NGDA 5J1EA 5F0UA 1HNVA 1S97A 4IUFA 2E5GA 1XERA 3QZ8A 2BUNA 2W7PA 4IR9A 5CHCB 5D3GA 2KHCA 3AH6A 5A0YB 1WC5A 3IM8A 3QRQA 2M52A 5E3QA 1TL3B 4AXJA 5A8KA 2BEFA 2RH3A 1S4EA 5HROB 2MZQA 1T3NA 1T9UA 1MU2A 2G9OA 3M32B 2YKQA 3FK4A 5CYQB 4CP5A 4ETXA 2ZH9A 1M5KC 3ICLA 2JWNA 2VUGA 1IM6A 3K58A 1S6QB 4EZ9A 3GJRB 4QIWD 5ETSA 1RAHB 3MMAA 5H9FK 4RUBA 4K5SA 1XMOF 3A8EA 3PHEA 2BZ2A 1TU0B 1B0VA 2Q3PA 5AE2A 1CG2A 3ZZTA 1EETB 1HHQA 2B4OA 3IM9A 1D0EA 3QRPA 3L7OA 1VCTA 3DOKA 1DFDA 1YSJA 4UZBA 2CZVC 4B9TA 3S7RA 4JI0F 2AZ1A 2EFVA 5L9XA 1UVJA 2FHOB 2NQPA 1ZTTA 3VAJA 3ZNUA 5MAOA 4RNNA 5ETTA 3R7SB 2UUCJ 2DRBA 3BF4A 5HL7Q 2QJ3A 2WW4A 3R5DA 3OUYA 2VQEF 5DQGA 3MMJA 4DV2J 1KN6A 5I4MA 2YNGB 2ZH6A 3ENWA 3OR1A 1VQNS 5D77A 1UW9A 1MWYA 4FF3A 1S6PB 3MI7X 4ZLLA 2QC3A 3IAS9 4KGKA 3DGPA 4O3PA 2W2OP 3S6EA 1VOMA 3PIOQ 2JC0A 1UVLA 2VG7A 2DJWA 2BACA 2GIFA 2CJXB 2K8GA 2RF2A 4ZVOB 2CPHA 1TAUA 3EJMA 1SC1B 2V9WA 1RT1B 1X5SA 2B7BB 2U2FA 4IRCA 3B54A 4G1QA 2OPPA 5LJ3Y 2AP6A 3HHDA 3IRXA 3MCSA 1HQEA 3SDEB 4O0NA 5CYMB 4H4KA 1OJ4A 4DCJB 2OPSA 2DNHA 5KTQA 3BYRA 4OZJA 1IKXB 5J2MB 3TVYA 4HI2A 3KLFA 1VK8A 1WOSA 3GIRA 2QFIA 3SXLA 2N7CA 4DV5J 4F50A 1RP5A 3H5YA 2E7VA 2UUAJ 1LXNA 3P49B 1NU4A 5H1SV 3CJ8A 2OO4A 2QL7B 4L6V3 2COLA 1LWXA 4OYZA 1YX2A 5T7LA 3QNWB 3VR1A 3KK1A 3V6DB 4JI4J 1XNRJ 1NPKA 4RU9A 5C7PA 1SL2A 1RABB 2PA3A 2BQUA 5ETQA 2RF2B 4L76A 4ENOA 4H4MA 3PYEA 3SSQA 4RR5A 4BDPA 4FBUA 3CWJA 3OFFA 2JZ5A 4PG5A 2VASA 2J9CA 5HJXA 5T41A 2NREA 4JV1A 2XG8A 1I1GA 2FJAB 3J7YU 3MD3A 4ELUA 2W9BB 3A8JA 3Q8RB 4P52A 3GG0A 3N0VA 3R1LA 1CJVB 2V34A 3N4WA 4FYXB 4I1TA 3FCHA 3SQGB 2OIHA 1QAIA 1QLNA 3DHXA 3ZTPA 4PQUB 1KVKA 2HWTA 5EUHA 4DL0C 3HMJG 1QVGR 1K47A 2E1MC 3ENVA 3TUZC 4RNMA 3TZWA 1K1QA 2CPFA 2G2YA 3D0IE 2IFXA 4DV5F 4X4RA 5T7LB 5KFOA 2ZHOA 1SV5A 4O3OA 4J9MA 1ZM9A 1M90T 3QRRA 5B0BA 3BH7B 2KH9A 3KXDA 2CJ9A 4LVNP 1U2FA 3NS6A 3R7BB 4F4XA 1SXLA 3KFWX 2V2QA 3OHBA 1C1BA 3PZPA 4X4PA 3M7VA 1KTVA 3HLUA 3M8RA 4GVLA 1HNWJ 4ES2A 3PRVA 5J1EB 1HNXJ 3FZBA 4EI2A 3H7HB 4KV8B 4QCLA 3OR2B 5IFMA 2JNJA 4I4BA 5F8NA 2BE2B 1UWBA 2DXFA 2DO4A 4DR7F 2CYYA 2RU9A 4JUZA 5HQLA 1N32J 2LYVA 2ZNZA 4ALZA 1F3FA 2CQGA 3HXMA 1CPZA 2B4UA 3M8QB 1APSA 2VBWA 3VV2B 3CCTA 2KG1A 3ZTQA 3NCQA 1FHTA 1VISA 5A6PA 2L41A 4O44B 3QJPA 1NJYA 5JVHQ 2Y9HA 1SV5B 4DG1B 3F44A 2KG0A 3J7YI 3ITHB 4KKOB 1I6JA 4O4GB 3GIIA 2FJDB 2ZZMA 1KHVA 2H1YA 2Z2YB 2CRLA 3MM5B 4MKVA 4A8OA 4JI3J 4A8QA 3OL6A 3GB0A 4YS2A 1X0FA 3BQ1A 2F5GA 2QZ8A 4U95A 1VR6A 2BJ3A 1R7IA 4EUVA 1JX4A 5DLFA 2DH7A 1JWWA 2B0GA 1T9VA 1VLOA 3OUYB 2B6AB 2HFVA 4ID8A 4OX8A 2B9WA 2V68A 1D3WA 3NOCA 4YFUA 5LMUF 4FXDA 3DLGB 1L3KA 5J2QA 1TMJA 2RHQB 3HULA 4HDHA 4NLRA 3A8IA 3BN7A 2WTFA 1KTQA 4KE5A 2QL5B 4N77A 2XWXA 4LFCJ 2U1AA 5MLCV 1S4FA 3ZC4A 1N33J 1RU1A 2KZZA 5IQ6A 3GE9A 4CYUB 1UEUA 3D1OA 1RZMA 2FY8A 2KFZA 4KHPF 1AB8A 3M6XA 5I3QA 2MZJA 4RNHA 3C16A 2BW7A 5FDLB 4E8UA 1KLNA 2C2OB 2A3JA 3JQJA 2P9CA 1KDNA 4XDDA 3ELHA 4G65A 1REVB 2DH8A 3LGMA 2DIVA 2LA4A 3DLEA 1S59A 2KL8A 2WVDA 1G4CA 2C3OA 2W01A 2ZDOA 3N01A 4NX9A 1Q8IA 4YR0A 4B9SA 2MQ8A 2H4YB 2MKKA 4RPFA 4ZPAA 1Y3JA 2KB2A 3H4BA 1MNEA 2AT1B 1IKYB 3CD7A 2HZVA 3SI8A 4OV6A 1RUSA 5KG7A 3MF5A 4TN2A 5KFSA 1RGVA 9RUBA 1B3TA 1UA1A 3VGTA 2E1PA 4ZVSB 4OYOA 3UDEA 4UT4A 1V9OA 4MT1A 3KK1B 4C6AA 3RR8A 1F0XA 4P7TA 4DPTA 2CZ9A 4QU7A 4ANDA 4NXNJ 3CUNA 1HNXF 2IAJA 2PI5A 4OHWA 4EO6A 1RTDB 4XK8C 4M94A 2HNDA 2JVOA 1DTQB 4LF4J 1V3SA 5BR8F 2N3OA 3PJ9A 3EXYA 1N8RT 5EN1A 1FWPA 4QBUA 3MEGA 1RHQB 2F40A 1DJ0A 4WP8A 1H0HB 3PW0A 1DURA 1PBAA 2E5JA 2HWIA 3I0RA 5CXTA 4F25A 2FJBB 5EWFA 1CJVA 4OI2A 2XGPA 2ZHBA 2DGSA 1N5TA 2NCKL 4HACA 3OW2R 4O3QA 2PFDA 4WCEQ 1HWLA 4Q2LA 3IRWP 3W2VA 4RNFA 2F4FA 1MROB 1WDTA 2DEJA 4DF8A 1VFJA 1SH2A 2FJXA 4ZVTB 2R8JA 4GMKA 4PXBA 5F0WA 4C0BA 2HK2A 2WVBA 5AE3A 4R5PB 4DV1J 3ISZA 2J6SA 4DX5A 4F4AA 2EW9A 4DX8H 1VIXA 4P2XA 5K20B 2A10A 3CCMS 3GFHA 4FYVB 2WB1D 2Y8WA 2CQ1A 3QATA 2A18A 2BVZA 4MKAA 1DTQA 3W9JA 1AW0A 2CNKB 2L08A 2YWFA 2V67A 3R5JB 3QSIA 3TI0A 1HBOA 2WONA 2GVZB 3TP2A 4X84A 1OYEA 1R0AB 3RR7A 2IC3A 2ASDA 1VLYA 2CQ4A 3ZZZA 2W9CA 4F4WA 4QR0A 5FLXU 2HHTA 1Q79A 1UWBB 4UUXA 2V8PA 3AB4B 5RUBA 1UMJA 4ZVRB 3IBWA 2P5VA 3PTWA 4NOHA 4Q44A 4G3IA 5HJYA 1WKLA 3CXCR 4DS4A 1JXLA 2C22A 5D8HB 3PHTA 3HX9A 1Q16B 4HL9A 2XBPA 2DRAA 1SC6A 2FHJD 1HA1A 1VQMS 1Y00A 2CDQA 1RB0A 1SKUB 1FK9A 2QLJB 3MR3A 3PW7A 2DPIA 1GNKA 2M7SA 3BGLA 1BQXA 5BJRA 3MM8A 4KH0B 2YKMA 1M1GA 3AQPA 4DU8A 5HMWA 3JB9k 2LU2A 1WF1A 1FKOB 1S7IA 2HRUA 2V94A 1L3UA 1F5CA 4MAKA 4X64J 2UU9J 4ES3A 2BR0A 2F9DA 5IT4A 1Y5IB 3TQEA 3W60A 2ASYA 3VAIA 3DRXA 2AZ3A 3UFCX 1O0PA 3QT6A 3Q22A 3CJQA 2BJ7A 4OI1A 6AT1B 2E1CA 4CCHA 3DMJB 2H5IB 3VGUA 2VBZA 2W4CA 4RW7A 1TKXA 4MH8A 2RB7A 3DLJA 4WYLA 2RJZA 4M5JA 1TL4A 3EDRB 1KBRA 4C8LA 4IG0B 3CIZA 3KUHA 2Y0BB 2C3MA 1QJHA 2E1AA 2GFFA 3LTOA 5ETRA 5IT0A 3A4TA 1UJ4A 7AT1B 2X3DA 3FZ2A 4PYDA 4V1Ak 1FE4A 1S6PA 4Q2MA 3DDIA 5LSOA 3HHLD 1IR2A 2ZUGA 5D0GA 4CLUA 4B17A 4RU2A 1PG5B 4R0EA 3THTA 1S1UB 1IJEB 1UFLA 2W24A 2NZ4A 4KGXB 2O67A 2ZEJA 5HBMA 3K59A 3V4MA 4QJVA 4X65J 4X4UA 1PYTA 3UWTA 4AFFA 4TY9A 1I94F 1DLOB 5FD1A 1OQ3A 1F9EB 2IVYA 3KJNB 1QVFR 5F8JA 1LWCA 1RHUB 3EPIA 5AE1A 2G1DA 1UFWA 1V3RA 1RBOB 2NSBA 4K5RA 2VPYB 4K59A 3GPAA 5KT6A 3DLLQ 2MSSA 3LH2S 5DG9A 4EGLA 2OSQA 3C46A 1RWOB 4FP9A 1M1HA 1IBKJ 2OFHX 4ZVUB 3SMZA 1PIEA 3OL7A 4RW8A 1N54B 4ZCLA 3RU0A 4KFBA 2PEBA 3BGFA 4KHRA 1KLMB 2HZCA 2B5JA 3UCGA 1Z2LA 4RX6A 1HKAA 1RACB 4LRCA 4DL7A 3BSCA 5AJ3J 2HHXA
chains in the Genus database with same CATH topology
2CG4A 3MM6A 3BO4A 1MMNA 1X8DA 5KT3A 3JSBA 2ZH4A 2FTRA 4NPOA 1Y0HA 3L95X 4LSLB 1RTDA 4MKYA 1JLFA 2V2KA 2A2DA 4J9PA 5DQIA 2GHVC 3KG1A 2LEBA 4GO7X 1JJ2R 2DGWA 1DQAA 3VF0B 5B0AA 4I6AA 2XMJA 2VD3A 3R3TA 1UL3A 5E33A 2VPXB 5KFRA 4YMEA 1FJ7A 3HHLC 1N34F 4XDCA 3LANA 4DL3A 4QYZJ 3DU5A 1UAWA 3IA0A 1J2VA 4KFBB 3GQCA 4F4KA 1PSDA 2QA4G 3GSDA 3NAIA 1MU2B 3M32A 4RW6A 2B9XA 4N56A 4CH1A 1OPIA 2QMXA 3MMAB 4JI8F 1H98A 2DNOA 5KFTA 4C8NA 1D9DA 4YUDA 2IM3A 3E3XA 2QIFA 1KFDA 4ZOSA 1S6UA 5HLFB 1C1BB 1JLAA 1XMBA 2BRLA 1TKZA 4KV8A 1Y5NB 2W7AA 2KM8C 1AUDA 2QSWA 4UUWA 4AYBD 4CO3A 4DN9A 1JLGB 2V8GA 5K8NA 3CDWA 1T05A 3SCIE 2KFYA 2WCXA 3LP1A 4ZP9A 4ZMMA 5FLXY 2C28A 2WBRA 1YVFA 2XMKA 3CGIA 3MMCB 3SEOA 3U1MA 1FDAA 5LXRA 4RBVA 3U7JA 2E9RX 4CNYA 3H5SA 2XO7A 3NNAA 4OZ0A 1H2VZ 1RKIA 2LDIA 2GQQA 3GZ7A 5KG3A 4G1QB 1JNZB 2OPPB 3WC0A 3M9MB 3IN5A 3BO2A 1HQEB 4QIGA 4C3KA 2DVIA 3RB6A 4V19X 3M30A 4QWEA 5GADI 2R7TA 4H4KC 4DHVA 3WDOA 2ZJRQ 2XNQA 1RT6B 1KC8T 4KB7A 2ZITA 1N5YB 3OJUA 3DLHA 3KTQA 5CQGA 5IWAF 4LF6F 1JLCA 2CVIA 4AL7A 2KN4A 3I56S 3DLBA 5KFBA 2MGZB 4K50A 1WG4A 2ZBIA 2RRBA 3DRYA 2GGPA 2J9DA 1HYSB 4DR3F 2OFGX 1HQUA 1YRXA 1J5EF 4CO4A 1ZBTA 4WFBQ 4KTQA 1FRKA 1DLOA 2BRKA 3THVA 2JC1A 2FB0A 3CCLS 1LWCB 3ZZ0A 4N41A 2R7UA 5GAHI 1UETA 3LF0A 3IFEA 4PRFA 1Z2ZA 3VQTA 4OV1A 2EPIA 1S77D 1SKSA 1DAXA 5DJBA 1TFWA 5CH7B 2Y1JA 4MFBB 1XWLA 2D9PA 4MTPA 3QAUA 1IN0A 2O3DA 3FFIA 3E2EA 2N3LA 2ZNYA 1NK4A 2DD8S 3ENQA 3SYZA 3IR7B 3I82A 1LWEB 2EG1A 2CQPA 3L3CA 1O51A 2AJ4A 3ONQA 2AGOA 3MMBB 2HHVA 4R25A 3DHWC 4E98A 1NJXA 1D1UA 2MZTA 2YNHA 2IM0A 5U47A 2N7YA 3JTOA 4NA3A 4USJC 2E7WA 3KK2A 4P2SA 4CNZA 4EWTA 3W3SA 2OD4A 1R8BA 4NLQA 3JTNA 2H9ZA 3NRBA 4DV2F 3C66A 4NYPA 1SQEA 2KT3A 3OTDA 4OI3A 4RW6B 2WK4A 1HNIB 3SSRA 3KK3B 1OS5A 2N4CA 2W8KA 3R1HA 1K73T 1E6VA 2FJVA 3GWCA 1HWUA 1YITS 1SKWA 1FTRA 1E6YB 1TUVA 2K3KA 2KKHA 4QQBA 2UV8A 1F60B 4XO0A 4A4JA 5KFWA 2QEXS 2DR8A 2N82B 2HMIB 5E3RA 4R8UB 3FEXB 3MR6A 2M5YA 5FJ4A 1R0AA 5E3CA 1U24A 3D1QA 1HBMA 1VGYA 2FY1A 2AYMA 1FEEA 3MTKA 3TUJC 4NZ7A 5JVGQ 3QLHB 2GIQA 4ILRA 3OTCA 4ECWA 2RIJA 1TV6B 1VQLS 1VK3A 1YQHA 4ZPVR 1QVFR 2B56A 1YWXA 2WHOA 3KLEB 4YQWA 3Q8QB 3V81A 2JH3A 1LFWA 4IH6A 4DF4A 2V0NA 4MJKA 5C25B 1VBZA 4F2SA 2DB1A 3KJVB 1RTHA 3PM9A 2FC9A 2HMIA 4C3MA 3IO1A 3AY0A 2HHUA 4OZLA 1FE0A 2M88A 4IOBA 3J7Z5 3VTIA 2FLPA 3CB4A 4BWMA 2GO9A 3DRRA 2KVIA 2HHHF 2YKNB 4ZK7M 3WX4A 2VG5A 3I6PA 2R8IA 2A2CA 3CMES 3MUTP 1TL1A 2FLOA 4JV2A 3PFEA 2DR7A 3M8PA 3KLGB 1VQPS 2DTJA 5IM0A 1X5PA 2D74B 2LU1A 2HIQA 4B3OA 1FCAA 4ZPBA 5L1KA 2J6TA 2NR0A 3DRSB 4WXOA 4DSEA 4M5DA 2XNRA 3RYLA 4JI7F 4RNOA 1A6LA 4QR2A 1FDDA 3ZZUA 1KQFB 1ZAWA 2GO8A 2ILZA 2HNDB 2FIUA 1U7LA 2IVMA 3DXSX 4DQIA 1URRA 3TAMA 5KFFA 1QY7A 2LQBA 1WF0A 3RB0A 3CCVS 4O23A 4PPDA 2R8GA 3GV5B 3C8YA 1GXLA 2ZJQQ 5K8MA 1ULRA 3PKMA 1S99A 4EBEA 2RT3A 2DO0A 4OZNA 4IQMA 2C2RA 5G0RB 3O8WA 1KSPA 4ED5A 4H4OB 3MFIA 3M8PB 2PE8A 5THWA 4MFBA 2OTLS 1RT7A 2IBKA 1OWXA 3OJSA 1N56A 2B4PA 1Q4RA 4I2QB 4N47A 1DTTA 4M5DB 3GFYA 3NG8A 1IKWB 3C6UA 1LWEA 1FESA 1LWFA 1SI9A 3NKYA 1TVRB 2ZE2A 3T9ZA 3N6NA 4DSIA 2OH2A 5EGYA 1FO1A 1BY9A 2ILYA 5KFKA 3OV7A 3THPA 2R7OA 4ELTA 1KFSA 3KHLA 1WHWA 1ZM3A 2I1RA 3KLHA 1FJEB 2WONB 4BC7A 4ED6A 2R2SA 1HL6A 1X4HA 4ZVFA 5LJ5Y 4HDGA 3VZHA 1ZYQA 2WRMA 4RW4B 1XC9A 1T7PA 3KNAA 2A1BA 1IXKA 3BB5A 1X4GA 1S1TB 2MQNA 4ED2A 1LW0B 3UD3P 4ED7A 3TQ1A 1W2IA 4PKDB 2ZH1A 2JLEA 2WAQD 3C6UB 3PY8A 1Q86T 2L9DA 3QAEA 1U8SA 2LDYA 2ZOFA 3RZAA 4A8KA 1TKDA 1R3NA 4CT9A 3OTOF 4OJGA 2CJQA 5F3ZA 1XBWA 2YNIA 3TX8A 5KFCA 5EWEA 4ZS6A 1HD0A 3CJ0A 1VQ7S 3CC2S 1ZOTA 3PW5A 2ZD1A 2GHPA 5CA5A 3GMGA 1TKXB 1XTZA 3CJKA 4ZCMA 4M1KA 3K5LA 2R2UA 4YDDB 5KG1A 3CMAS 1RAJA 2UXCF 1H7XA 3OXGA 3FSXA 3B4MA 4RWXA 3RRHA 2M2BA 2W25A 1S9GA 3QWPA 3CCQS 1T02A 4ECVA 5IT9Y 2OP5A 4JV5F 3DOLA 2EKYA 4I0WA 4KO0A 3D54A 4DV0F 2J0QD 5CYQA 1MSWD 1U45A 1FKPB 3RW7A 4OL8A 5KFEA 4MIWA 3G86A 1B7FA 2CKWA 3NBPB 1LV5A 1HHTP 3KOAA 3CO9A 3DDNA 3ZZRA 2I9SA 1DQ8A 2OPQB 4NA1A 3KLIA 2VG5B 3VAHA 3MOJB 1Y3KA 5KFNA 3Q24A 3RB3A 1FEHA 4KT0C 2FVSA 1RK8A 4DWIA 3TRGA 4KGMA 4ILMA 2AF6A 2RD5C 4Y2KA 1KNZA 1UVKA 2DGOA 4BWJA 3PO5A 4RUHA 3DRSA 4EFAC 1N4LA 1X9WA 3MEEA 4C4WA 1G2EA 3WBZA 4LSLA 3SFGA 3IXQA 4F2RA 2LA6A 4X4VA 4PWDA 4G6VB 1XNQF 2CVEA 2RE1A 2BM0A 3NCRA 2OMLA 2UUBF 2C3UA 4USHA 1JXEA 2OMOA 2MJNA 3AAWB 4OX6A 4YB5A 5HMZA 4OZ5A 2YX4A 1KR4A 4A8MP 2RS2A 3H59A 3RW6A 2DNQA 1S49A 2VBYA 1RT2B 1L3TA 1KRPA 5L9NA 3HFKA 3CULA 2DH9A 1SKRA 2MB0B 2Q1LA 3CSKA 4U7UK 2HQIA 2IVFB 1UA0A 4QPXA 3MECB 1NKBA 2Z2MA 5D4OA 4BCAA 4PWDB 4X65F 1CQMA 4OLPA 4A47A 2HGLA 2O1PA 5HLFA 3AQOA 1A7GE 1UW4A 3H2VE 1Q7LB 1HHSA 4TQSA 4B9MA 3BR9A 1TKZB 1RYSA 4ZPDA 1Z4UA 3IWXA 2ZH2A 2VA2A 4WTYA 4TYAA 3I9ZA 3VCDA 4A8WA 1TL3A 1U6FA 5A8KB 3UCUP 1T05B 4NYZA 2C3PA 4YDXA 2ZH5A 5L8RC 4DEZA 1HNIA 4IYQA 5JJBA 3CCZA 1TL5A 3MGJA 4D3HA 4FBTA 3SFUA 2DGVA 2FLLA 2QA2A 3ISNC 2M9KA 1K1SA 1IBMF 5A6WA 1WI8A 1E6YA 1WD6A 1AFIA 2EWHA 4EZ6A 2HHPA 3FMBA 1SJ1A 2YNFB 2NPFA 1QE1A 4MK9A 4DDFA 1TQLA 3OPKA 3B78A 2BANA 2IMWP 3QIDA 5SUHA 4NCBA 2MQQA 1BGXT 2AWZA 4ECSA 3PJXA 1UVIA 4LT6A 3GFXA 4JI3F 2RVJA 1RT5A 2KDOA 5H9FJ 5F9NA 1S10A 3MXHP 3T19A 4NLTA 1S9GB 3PACA 1U47A 4DL4A 4L72B 2ZOMA 3CDEA 2XLKA 1HYSA 1RWUA 3OHAA 2J0WA 5B0EA 1HQUB 4NLDA 1HI1A 1RTIA 4IFYB 1X0PA 4RBTA 4YB7A 4WFXA 2F9JA 1FT8A 3SCLE 3S8SA 2R4FA 3KJVA 1S7HA 2N4DA 1LQ9A 5M2UA 1BC6A 3IRXB 4C8MA 1D9FA 2DNMA 3N28A 3V6KA 5E0OA 2ABYA 2LEAA 4YOEA 4X62F 3KHGA 1YJWS 2UVWA 1SJ4P 5B0FA 4J9LA 2I5JA 4KC5A 1SJ3P 3I5BA 2PC6A 4IG3A 2EFQA 3FEYB 3MOZA 1QAXA 2J76E 3DOMA 5J2QB 2BYCA 5D78A 1KS2A 3CJ4A 3EGNA 4IDKB 3A1YG 4PG4A 4EO8A 3VAKA 1U49A 1NKEA 4NLGA 3MAHA 2ZC4A 1T03B 4NMLA 2O01C 4K4ZA 3O6QA 1V3ZA 2GCFA 2DGTA 3IWLA 1RTIB 4IFYA 4ZP6A 3QZ7A 3LWLA 1HWKA 4Q8FA 2JOQA 3TARA 2XZWA 2PO4A 3PR4A 1Y9OA 2IA0A 1F5BA 2VPWB 3C6TA 3KMSA 1Q7YT 1RQ0A 7FD1A 2I0XA 3RAMA 2YH0A 1QSSA 5F8IA 3FRZA 2DK2A 4LF8F 5CZXA 1ZTWA 1K0TA 3LP2A 4UW2A 3KWMA 1S0VA 3POTB 3G96A 1W25A 3KK3A 2ZFHA 3UNGC 2MZSA 2KI2A 4ED8A 3K5PA 1XR7A 3EZUA 1HD1A 2MSTA 1NO8A 3PX6A 4RWWA 4BS2A 2R8KA 4DSKA 4IO9Q 1JB0C 2JEIA 1N52B 5D4NA 5C5JA 2UVVA 4CO0A 2KU7A 3UPFA 3FSYA 2B51A 2DHXA 5EWGA 1QTMA 3BGUA 4Y28C 1YI2S 2ATLA 3LGNA 2NLWA 4USIA 4TU8A 2MZRA 4I64A 3HM9A 1Q81T 3R27A 5B7WA 1UP1A 4FF2A 1JKHB 4TU9A 2KZMA 1KD1T 5K14B 2KJVA 3KLEA 5D6GA 3UW1A 2EC0A 1WEZA 1A9NB 1R89A 3CJ5A 2E9ZA 2UUAF 2KXHA 3OLAA 3V4IA 2W4PA 1DZ5A 4IRDA 2XHWA 1U1MA 2IYIA 5E2QA 3W7BA 2ZOGA 3FGVA 1FJGF 2ROGA 2V4JB 1NK7A 4X4OA 3DRRB 1EETA 2FUG9 3OQ2A 1YJUA 4CO2A 4NA2A 5C24B 1HBOB 2OPRB 3GYXB 3CD0A 2XS2A 2IC3B 4KSEB 4O4RA 1IR0A 2R2RA 5K8PA 1TK8A 2BJDA 1HPZB 4KQZA 5KFQA 4PXCA 2R7QA 3DI6B 1NK5A 3QJLA 1RTJB 1QAJA 4EBCA 1JMTA 3BZQA 4DQSA 2QFJA 4HTIA 3KHRA 1NJIT 1N33F 3D0HE 5JUMA 2WB4A 2CIMA 2YNGA 3U1LA 2JX2A 1IKVB 2K3IA 1JLEA 2ZBCA 3GYNA 2X1GA 3H2UB 3RAXA 3I0SA 3LO3A 3O44A 3X3UA 1VQSA 3CPWR 3OTBA 2KT2A 2RQMA 4UOCA 2RKIB 1FDBA 3TANA 2AV5A 4KAIA 2XMMA 4K4UA 1WEXA 2V4JA 1C4AA 4DOZA 1ZM2A 4R0JA 3J80Y 1JNRB 2LEPA 3BN4A 3ULHA 3VAGA 1N5SA 3O2IA 2PD1A 2M4MA 1HI8A 4IFVA 4P6QA 3DI6A 1O5JA 2L9NA 3UR0A 1HNZF 1RT7B 3TA0A 3RAQA 4Z2XA 4O0IA 2D41A 4N76A 1TAQA 1U6BA 4CZCA 1GQEA 2ADCA 1F9FA 4LSNA 4HVZA 4DL6A 2E1RA 4RLEA 1BQNA 2ZJPQ 4ZCKA 4I6WA 2UZAA 2UUTA 3LQVA 4WJBA 4WZQA 4HT5A 4KRWA 2GMHA 3J7ZT 1X5TA 5L1JA 1KQKA 1U1KA 2GMLA 4K2XA 4H4MB 3DXBA 1WI6A 3G8TA 2V8VA 1H2UX 2MKHA 1FERA 5K5MA 3FSIA 1VMBA 2LLZA 4NZ0A 4RW4A 3DYAB 3EX7B 1S1WA 1NH7A 4RUCA 1HFEL 3ZZPA 2EBGA 1BQMA 5F8HA 3AA9A 2MKIA 3W2WA 2AW0A 5B09A 4ZCIA 4PPZA 3HPOA 4C0OC 1VI7A 4H54A 3CCRS 1FKAF 4K4YA 2YWHA 3S01A 2IRXA 1XN9A 3IGNA 4ECUA 2DITA 1C1CB 1PC4A 3MECA 1JLFB 2LKZA 5BYSA 2YNIB 1B0TA 2VBXA 3CJ3A 3MR2A 4IOCQ 3MHYA 2GA7A 4Q0BB 2R9LA 2J5AA 1WELA 1TKTB 5GAEI 2BM1A 2XGQA 4C98A 2BOPA 4B9VA 4TNOA 2LMIA 2OD6A 4BHQA 5KFJA 3PVXA 1YRTA 2DHGA 5B0DA 4JI4F 3VAMA 5K14A 1KHWA 4HH1A 2JFKA 4OHXA 2J6UA 5J2NB 1N6QA 3CCES 4O44A 4HT7A 5DDQC 2HYIB 2IJNA 3I4HX 3B8HA 2EI5A 1S1XA