1ICEB

Structure and mechanism of interleukin-1beta converting enzyme
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and mechanism of interleukin-1 beta converting enzyme.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords INTERLEUKIN-1 BETA CONVERTING ENZYME
total genus 16
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 1994-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1iceB00
2XYPB 2C2ZB 3D6MB 1RHMB 2QLJB 3IBFB 3R7NB 2FQQB 3GJRB 3R6LB 4ZVPB 1SC3B 3EDRB 4ZVQB 3R7SB 2HBRB 1RHKB 1ICEB 1QTNB 2Y1LB 3SIPB 2XYHB 2QL5B 1GFWB 3QNWB 2H51B 3R5JB 3P45B 1NMEB 1I51B 3D6HB 2DKOB 3KJNB 3R7BB 2HBYB 2CNNB 2QL9B 3GJQB 3IBCB 3EDQB 1RHJB 2H54B 3GJTB 2C2MB 1PAUB 4DCJB 1RWXB 2HBQB 2XYGB 2H4YB 3GJSB 4ZVSB 1PYOB 2Y0BB 1RWOB 2H48B 1RWVB 1SC4B 2CJXB 1RWNB 2C2OB 2CNOB 4ZVUB 2H5IB 4DCPB 2XZTB 1RWPB 1F9EB 3P4UB 2QLFB 1SC1B 3R6GB 4DCOB 2H65B 3KJFB 1RHQB 1RHRB 2QL7B 1RE1B 5K20B 1RWMB 1RWWB 4ZVOB 2CDRB 2C1EB 2CNLB 1IBCB 4ZVRB 2P2CB 2H4WB 3RJMB 4ZVTB 5IC4B 2CJYB 2H5JB 5IC6B 1RWKB 2HBZB 2QLBB 4JB8B 3NS7B 3D6FB 1I3OB 1QDUB 1RHUB 2CNKB 1BMQB 2C2KB 2XZDB 3KJQB 4LSZB
chains in the Genus database with same CATH superfamily
1VISA 3CO0P 1Y11A 1HNZJ 4BWMA 4MK7A 1AW0A 2VODA 3FZ2A 1UJ5A 4TN2A 1HNXJ 4QW9A 4F67A 5T14A 1MG7A 3L7PA 4NEZA 4RUHA 5IZHA 3FSYA 5GAHU 4LSNB 3OQ2A 1N34F 3C6TB 2J6UA 3KK2B 1GT8A 2CG8A 1X4BA 2H1YA 3BREA 4KYZA 2I6WA 3MM7A 1C0TA 1NB7A 3AQOA 3CDEA 4HHJA 1RTDB 2HBRB 3UCUP 1RA7A 3CE8A 4ECZA 4GKJJ 3LGNA 2LFVA 2G2OA 2AJFE 2MSSA 4CLPA 4DPXA 2QGFB 3NCRA 1SKWA 4ECSA 2ZUGA 1LXNA 1E6YA 2Z2ZA 4OYPA 4G3IA 1FK9A 1D3WA 2WAQD 2DH9A 2IRYA 1FEEA 3ZZZA 4PG8A 3V4IB 4DR7F 5KFHA 4UTGA 2R7UA 1F5CA 1NH8A 2XWYA 3QO9B 5J1EB 2KYZA 3MAAA 4F8RA 4LF9J 4R0JA 1S76D 2BV3A 1LOUA 2V4JB 3W65A 5EGYA 1YZ6A 2CJBA 4DV1F 2YNGB 2DB1A 3K58A 3RB0A 4RW6B 2Z2LA 2HW3A 2WVDA 5K8NA 1C2PA 4OYAA 4Q5VA 3SYZA 3MCOA 1KQKA 3MMAB 1UPPA 3MFIA 3RTVA 2XY5A 2R7SA 3GG0A 3OR2B 1JLEA 3J7YI 2PFFB 5FDLB 1SC6A 3PYGA 5A6WA 3TR5A 2BKNA 2HBQB 2XY6A 4IOCQ 1NEEA 4MKYA 2K7KA 1RYSA 3THVA 2XULA 1U6BA 1TFWA 2OPPA 2QEXS 3W5XA 2RQCA 1JLCA 2QSFA 1S77D 1YBUA 4FKYA 2NXEA 2AF6A 3EZ5A 3D7SB 3IC1A 2V8DA 5ETNA 4LJMA 5GAEU 2Z56B 5K8OA 3PEJA 2CVIA 1YK9A 3HHLA 4LR8A 2MKIA 3CCWA 3EPIA 4FF2A 3ITHA 5B0GA 3AH6A 1MWYA 1S9GA 2NCKL 4N8NA 2FLLA 2NUHA 3D9BA 3SQGA 4KBIA 1TL4A 3IWLA 5BR8J 3MHYA 2H65B 2MYFA 2DR6A 3C6TA 3PR5B 4MTPA 4KPYA 3ZXWA 1S48A 5HAOA 5G0RA 3PFOA 1C1CB 2VFVA 3Q86A 3FBCA 3MEEA 4TNOA 4X4UA 2DNYA 1XBWA 4DQRA 2V68A 2XMWA 3D0IE 2WCXA 2HQDA 4L3NA 4L6V3 2GW8A 2U2FA 1S1UA 1GMVA 4DV5J 3MGJA 2W25A 4DPUA 4JV1A 1SH2A 2QN6B 2DNGA 2LLZA 1F5AA 2DHSA 4MIAA 2WK4A 3ZZRA 1WOOA 3AOCA 3GONA 1FK9B 5DLGA 2ZH8A 2W01A 1KD1T 3TOQA 1XNRJ 4B3RF 3R5GA 4WZMA 3B4MA 1N5VA 2DT9A 2VG7A 3HHKA 3TO8A 4X4PA 2DR8A 2OD4A 5LM7E 3EJMA 5JJBA 3OFGA 1VGYA 3LP2A 5D78A 4BWJA 5C7PA 2BA9A 4RX6A 5A8RA 4IOBA 4ECQA 4W98A 1IBCB 3DLHA 4JI4J 1K0VA 2HS0A 4ZP6A 4DR4F 2KVIA 2OKQA 2GJIA 4CO3A 1U8SA 3GE9A 3H7HB 3C16B 5C25A 2B9XA 2DNOA 3OR1A 3GQCA 4K4SA 4OIXA 3BN7A 2HKEA 3TAMA 4OI0A 2Z58B 3QRPA 3G8SA 3BSOA 2B9YA 1VQPS 2KXNB 3K5PA 1CJUA 3I0SA 2EG1A 3UDLA 4J9NA 4RNMA 4I56A 2P8IA 3G8QA 4OYMA 3K7RA 1PO6A 4ILMA 1UMJA 3MUTP 4CT8A 1LWFB 3M7VA 5J2QB 3G86A 1KVKA 3L09A 4NPOA 4P2XA 5HMXA 1MSWD 1VQ6S 3QZ8A 1NXIA 4FNHA 1BWEA 3DRRB 2EVZA 2GAGC 2GIQA 1YBTA 4KR0B 1R0AA 1V6HA 3H5UA 3PHTA 1K8AT 1D1UA 1UVIA 4ETXA 1SL1A 2VBXA 1HMVB 2DGSA 1U1NA 4OZNA 4ZLNA 2B6AA 1P1TA 3CD0A 2NXJA 3MF5A 3S1TA 3PDNA 2N82B 4TQRA 4DSJA 3PW2A 3MEGB 4Y2MA 1M5SA 1ROFA 4LFCF 3FC9A 1F3FA 1XEZA 2PGCA 3K57A 2FJBB 3QRRA 1VRQC 1GK8A 2GGPA 3POTA 3I4PA 3T5HA 2A6OA 2FLPA 1JLCB 2E5JA 1TKTA 1HWLA 4I0WA 4KGVB 4LRFA 4X4TA 3JSMB 3R9LA 1CC8A 4HI1A 4F26A 4YB5A 2DO0A 3MM5A 2NXCA 4RNOA 5J2PB 1VS3A 2YBVA 5M2RA 3NKYA 5ADZA 3BO3A 1H73A 1H2VZ 4M5NA 3ZTQA 2ZVSA 1TMMA 5CD4A 3IS9A 4LF7F 1YIJS 3CJSA 2DKOB 1AUSL 3DYAB 5L8RC 2GV1A 2BQ3A 2PMWA 2J6SA 4H4KA 4ICLA 4BBYA 3WX8A 4EO6A 2UXCF 2V8HA 3AFGA 4P71A 4C8NA 3T19A 4DQIA 1U1LA 2F1FA 4RW8B 2JLEA 2DK2A 2KXFA 3FKBA 4LQ9A 2RQ4A 1RT4B 3M32B 1MLAA 1RAFB 4YEAA 1IKWA 3NOCA 5LXYA 2PEHA 5EX0A 2R9LA 5HP1A 2NR0A 2RUSA 3NS5A 2IYGA 4DFPA 1VBZA 3H5YA 4O44B 5LT5A 2XQCA 2IM3A 2QG9B 2YWGA 3FBBA 2BRKA 3OJSA 4ECYA 3RYLA 2X1AA 4NLOA 1Q8IA 2AJ2A 5IT4A 5KFBA 1OY6A 4KGZB 5SZTA 1S72S 2DPJA 1FVQA 1UZDA 4JI0F 2HFOA 4LR9A 2FVRA 5KFUA 1TL1B 4JP8A 4DS5A 2UUBJ 3MOJB 4DSFA 1X4FA 2B5JB 3JSYA 3MUVP 2KJWA 3K5OA 4HLBA 2V9KA 2KFYA 2NQPA 4WTOB 1C0UB 2WW8A 3AJ2A 1TZ0A 2YKNB 3AOAA 2IM0A 1GTEA 2CJ9A 3LAMA 5ETQA 2UUCF 4A8SA 2VFRA 3T1YF 2VOPA 3G6VA 4DFJA 3N9UC 2QJ3A 4PXBA 1CULA 2EI5A 3ZNUA 4CLZA 2R2TA 4L76A 1T3NA 2BDPA 2ILZA 2BKPA 3POTB 4CNYA 2BJ3A 2C3YA 2I5JA 1IWGA 1ITPA 5IT0A 1KONA 5DJBA 5HVHA 4AT1B 4GRSA 3E01B 5THWA 3IRXB 4ZMMA 3CCES 2VPZB 4KH0B 2EFPA 4WK3A 3MM5B 2FTRA 3OVSA 3OUYA 5AXKA 2Q43A 3WQPA 4A8MP 1HMVA 4IDKB 2C1EB 2DD8S 4J90A 3OJUA 3MTKA 2ZBCA 4F0MA 4PWDB 1PSDA 3AODA 2LQJA 4FYYB 2G2ZA 1IUJA 1OY8A 1X0PA 2KB2A 2FHKA 4M5JA 3RJMB 3UD5A 1L3TA 4FNIA 3MECB 4F02A 4LMZA 1RA6A 5F0WA 2YH0A 5EX3A 9RUBA 1T9YA 1RBOB 2KG0A 4JB8B 3CB4A 1JNRB 5E7OB 2ZM6F 3EX7B 2Y1JA 4ANCA 1FJGF 2EFOA 3LA0A 4DR5J 4F4YA 1HBNB 5HP1B 2Z2MA 1IBLF 1LQ9A 2BX6A 3M8QA 1PGZA 1RAGB 5GVQA 2CIMA 2ZWOA 4MMOA 5CYJA 1EJ7L 3J81U 1U47A 1HNXF 5CYMB 3NNCA 3H4DA 4V1Ak 4L75A 1XERA 2YX1A 2M52A 3DKDA 4AUKA 2UU9F 1F2GA 2BJ7A 3FCWA 2JH3A 2DVIA 3DLLQ 1X8DA 4XDCA 5LMUJ 2B5JA 2K3IA 1SQEA 2DXFA 2HAFA 1F5BA 2G4BA 4HR2A 4PQUA 5FIIA 4EFAC 3T1AA 1FXDA 3DRRA 3EDRB 1N56A 3M8ZA 4ALZA 3ZTPA 1S4EA 4K2XA 3JTNA 3MMBB 1N88A 1U09A 2AU0A 1V3RA 1TL5A 2IM2A 3DDKA 3C2PA 3HP6A 1HHTP 3VGTA 4DUZJ 1T0TV 3L4BC 4O3SA 4W90B 5LMNF 5B0BA 2QL5B 4EO8A 4NYOA 2FUG9 3BBCA 1BGXT 5C42A 3R2CJ 3H25A 3QMQA 1NK7A 1UA1A 2BOPA 5GAHI 2WVBA 3VZIA 2X3DA 2MQOA 2F9JA 2E9ZA 1X5SA 1QJHA 1KTQA 2F40A 3Q22A 1T03B 1S1XA 2BABA 1PJ7A 3BV8A 3CWJA 2EFVA 3RAMA 1UPMB 3SCJE 4URGA 2QL9B 2XLJA 4PXCA 1KTVA 3CCJS 1VK3A 2AJ0A 4FN5A 1U1PA 1LWEA 1N8RT 1X7VA 4AYBD 2PC6A 4NASA 3CCQS 2IHR1 2QFIA 2VPYB 4Y6IA 5HATA 3D0GE 4NCAA 2WB4A 3UW1A 4DCJB 2HNZB 5IV3A 4MYUA 3OHBA 1RWXB 4DPTA 2RS2A 4C97A 1S0MA 1FRJA 2NPFA 5IWAJ 4C11B 4RU9A 1YLXA 3RBEA 3NBPA 2CAJA 2DNNA 2HFZA 2PFDA 4ED2A 3IA0A 4ETZA 1VR6A 4ZP9A 2RH3A 5D8HB 2CPZA 2JX2A 3CUNA 2CQ4A 2BOAA 3FBEA 4OJ1A 1PBAA 2JEIA 2Q6BA 3I9V9 5K8MA 5CYMA 2DNQA 5DDRC 2L41A 2CQHA 4O4RA 4IFVB 3FNNA 1UZHA 1FX4A 1NJZA 4NLVA 1VQSA 1WC4A 3K0JA 3PRDA 3O8WA 3CXCR 1N5SA 1HQ2A 2FYXA 2KM8C 4A8QA 3W9IA 3QJPA 4X4NA 1VK8A 1Y3KA 3QFWA 4LFBJ 2GNKA 2VG6A 4M5GA 3FVYA 4RUCA 4K0KF 1KVJA 1R0BG 3ZZYA 3UNYA 4MKBA 2JEFA 1BXNA 3N0VA 1XQIA 3GPAA 5LJ3Y 1WOPA 3SXLA 1K1QA 4EGLA 1UVMA 4AL5A 1V3SA 2HGLA 3CC4S 4I2QB 5FDLA 1XMBA 3WZ0A 5C5JA 1P1LA 2W9CA 3BBFA 4LF1A 5HN0A 3G2XA 1YG0A 3MCMA 3VTIA 5HL7Q 4DWIA 2ZDOA 2ZHAA 3ENWA 2P6TA 2F8MA 1OS5A 1VI7A 1YRXA 3GB0A 1Y7PA 2C2NA 4DOZA 1WHXA 3WDOA 5D6GA 4C2MA 5AE3A 4B3TF 1R43A 8RUCA 5FLXU 3LW5C 1M1KT 2KHDA 2F3JA 1S1XB 2F4VF 4FXDA 2VFSA 1Q79A 1KBRA 4ZVFA 2CJYB 2W4PA 2H3EB 2LQ9A 1BWVA 1T9VA 2OPSA 3Q83A 1VQMS 3OXFA 3VGUA 2I38A 3AD7C 2NXUA 5E41A 1WDTA 3OFEA 1YKWA 3Q23A 1ULRA 4WFBQ 3D6FB 3BSCA 4M5KA 1YJNS 4PABA 1NLKL 4L74A 5GADU 2CPEA 4ZVGA 2IFXA 5J1NA 4JI8F 1JNZB 4CO0A 3MPVA 2UV8A 4F7VA 2O3DA 4TKTA 2XSJB 1FRLA 1UL3A 3ISZA 3VVTA 4B3OA 3IRXA 3J7ZT 3GMGA 5C2CA 4J9RA 2AW0A 4NZ7A 3RB6A 3MEDB 1Y10A 3M8SA 1RTZA 2KRRA 2V6AA 2POKA 4KFBA 5E3QA 4Q0BA 3W7BA 3IAS9 3CDWA 4MK8A 3KJVB 4JYAF 3MMCB 2QO3A 1RU1A 2MZRA 2GJFA 3I4HX 4G1PA 1DBDA 5E3RA 3VCDA 5KFKA 5AJ3J 3OTOF 1Q7LB 3HVRA 4ECTA 1JWWA 4M8LA 2HRYA 4OJGA 2LECA 5B09A 3HHNB 1RTJA 8AT1B 4QWAA 4DR7J 4OZ0A 4QYRA 4F3QA 2AGPA 4F50A 2RQMA 3KFWX 4C6AA 3IR5B 3VAFA 2HQCA 2CPHA 3AB2B 5E0OA 2V8PA 2XYHB 1VC6A 2I9SA 4FF3A 4NMXA 2HHTA 3Q2TC 4XO0A 4JI1F 2RHQB 1XTZA 1NM2A 2MHNA 2X7IA 4NI2A 5HJXA 3OSPA 1U1RA 4IRCA 1SKSA 2ZH7A 2YH1A 5DM7Q 1NRKA 2B4OA 3IGVA 4FYVB 3KOAA 1FRMA 1ZPWX 2IAJB 5LL6d 1WTFA 2W2PP 5DG9A 4X66F 2UUTA 4RW9B 4FDFA 4ZKAA 4QR0A 2BW7A 3OTEA 3MI7X 1TVRA 2KYXA 4PXEA 4TYBA 2MDAA 3B78A 2J0WA 1RTHB 2WSCC 1PAUB 2KKHA 2B51A 4NLTA 3OD2A 3KLIB 4DV7F 4QU7A 2HPUA 2VASA 4RW6A 4FPIA 2LA4A 2VQEF 2BMBA 2J8AA 2Z57B 3GTYX 4DX5A 3CMAS 2UVWA 4JV5J 4U96A 4YFUA 2D3ZA 2EPIA 2QMXA 2BVZA 1WDDA 1Q0NA 1JJHA 3UNGC 1HL6A 2QA2A 3P6YC 4GO7X 4IH7A 5KOXA 4B9UA 4C3LA 4A8OA 3S01A 4WYLA 2VKRA 5AXNA 2C3OA 5L1IA 4ZCKA 3V81A 4OX6A 4LF8J 3QJJA 2VL1A 3JXOA 4HHUA 1IBMF 1SC1B 2ROGA 1H98A 2BJEA 2XMUA 2ZVIA 4FYWB 4QQBA 2YWWA 3SDEA 1HPZA 1WEXA 2FJAB 1E6VB 3CT9A 3HD2A 4C98A 1J5EF 2DHGA 1TAQA 2PEBA 2UUWA 3MEGA 5EWFA 3D2WA 1NSAA 4P6QA 5GADI 3L3CA 4UOCA 3SSSA 4OHZA 4UW2A 2HGNA 2F7VA 2KVQE 3M2RB 2DY9A 3M6UA 3OVBA 3P3DA 3G9CA 4EU0A 5G0RB 5KFAA 3W2WA 3OLAA 1QAYA 2EKYA 2VG6B 2R8GA 4WXOA 3BR9A 1T05A 4CIOA 3LP0B 4ZCIA 4F4XA 1FE4A 3DXSX 1RT1A 3MTJA 1VQ5S 3TA1A 2CNLB 1XMOJ 1RTDA 5IT9Y 1Q7YT 1M5VC 1CJKA 3CJTA 3B4DA 3A8EA 5KOWA 3HDSA 2CWKA 2Q1LA 2EXUA 3FUYA 3OPKA 3MPUB 3HO1A 3KNAA 3G87A 1HWKA 1ZM2A 2Q6CA 3VAHA 4DF4A 1B70B 2R2UA 3QRQA 1HWJA 2HMIA 3VZHA 4Q7AA 2VV5A 1R8HA 1SBRA 4KV8A 3CCLS 3C19A 1HBUA 3UDEA 2VQEJ 4YR0A 3U02A 2V2QA 4RPFA 3W61A 2XZDB 4TU7A 3H0PA 1EZZB 2VOOA 1NU4A 5B0AA 5F8GA 4HI2A 4CLKA 2XYPB 2UU9J 2XHCA 1H74A 1B99A 2L9NA 3IO1A 4L3KA 4UF4A 5DQGA 3Q8SB 1HR0F 2R8KA 2BXJA 2MQMA 1X5OA 1YDLA 3B82A 2VC1A 2DGWA 3MCNA 1RADB 2IMWP 3CD7A 2YWEA 3DLGA 4MH8A 2XS5A 4LUBA 1UFWA 4DS4A 1HNIA 4Y2IA 4NE9C 1XJWB 4ZJLA 1NPKA 5BXIA 1S9EA 2DR5A 2RQKA 2XSJA 4C0BA 3M9OB 3LPEA 3TJ9A 2J7KA 5JVGQ 3V6DA 3IBWA 4LRBA 3THTA 3TVKA 3UCGA 3H4BA 1R8AA 1REGX 1Q86T 3S8SA 3J7YU 5D4LA 1FRIA 4DV6F 4OI6A 3VGVA 2X1GA 2XMJA 2ZJRQ 4YB6A 5MAOA 3PY8A 3DOLA 4LSLA 4RU2A 3NNHA 2AJ1A 1WD6A 2WB1D 1CQMA 2MQQA 1H7XA 1VQLS 1VQNS 5IT9U 2IDEA 3MAHA 1WC1A 3DLKA 3P45B 5HLFA 1R0CB 3P49B 4KO0B 1MMLA 2ADBA 2W2MP 1N54B 2MQ8A 4FVMA 4WIQA 2QZ8A 5CHCB 4Q44A 2RU9A 5EWEA 2PN6A 1UVJA 1F60B 2YXLA 2FHJD 3CDAA 4YS2A 4ZVEA 5CZVA 1KLMB 2UVRA 4ZJQA 2HHHJ 3R5AA 4V19J 1C4CA 2RJZA 1FEHA 3V4MA 4J9QA 3IXQA 3TJAA 1QTMA 2H4YB 3K8VA 3CJ0A 5LSOA 2CQBA 2WVEA 5IFMA 1HFEL 3FMWA 4O3RA 2UXBF 2YWHA 1UFKA 2B56A 2Y1IA 4OX8A 1S9FA 1SC4B 4PG6A 2XC9A 2B0GA 5D3GB 2WW4A 1WI6A 2DR7A 3VAJA 2UUBF 2MKHA 2ZD1B 4CH7A 1RP5A 2WHOA 3DGPA 3PO5A 3EVWA 1VBXA 1OQ6A 4DFMA 2E1RA 2AX1A 2WOMB 4MIBA 2VQFJ 3MM6B 2M2BA 2QMWA 3CD5A 2VG5B 4DSKA 2BKOA 2E1MC 4FPRA 4CO4A 2N7CA 1CJUB 4PG4A 5F8IA 4NWBA 3VAIA 4DEZA 4ECUA 2OPQB 4MT1A 2P5VA 3KJFB 2AKWB 2LCWA 1RLDA 2LXUA 1YWXA 2IBOA 3R5CA 3VR1A 4FS1A 2J0QD 2DJWA 2M8HA 3Q89A 2FJXA 3FBFA 3K5LA 2CVEA 4XTTA 4B9MA 4F2SA 1HNWF 1NHVA 4OYZA 4DU8A 2QL7B 3ENQA 4DR5F 2XB2D 5K9FA 4CO5A 1D0EA 2DIUA 5KFSA 3TAPA 5CH7B 1FTCA 3PG9A 4NL5A 2WSFC 2QFJA 3PFEA 2CQ0A 1AZSB 2AQ4A 1HW8A 2ZZMA 3DRSB 3PIPQ 1FFGB 4PAAA 1UEUA 2K8GA 1S9EB 2GQCA 1KOOA 2XLKA 2FB0A 4J9UE 2GA7A 3I5BA 5L38A 1B7FA 3KNGA 4YP3A 4K50A 4WK1A 1G2EA 4PUOA 4CYUB 3HPOA 4YHHJ 3JSMA 2NZ4A 2FDNA 4NLSA 2G1DA 3BYPA 4K59A 5J2PA 3HHLC 4EK2A 1VFJA 3DOLB 3M6XA 4LSLB 4N56A 2ZH1A 3KLEA 1VDHA 2YKPA 1F9HA 3IS9B 1IQTA 1U0SA 3ZC4A 5IWAF 3BN4A 3DLKB 2ROPA 4R8UB 5D0GA 3QJLA 4PXDA 3NXZA 4B9VA 2NLWA 2OGUA 6FD1A 3KHGA 4RUAA 5IV4A 1O0PA 2CPIA 1NDPA 3FQLA 4FP9A 2DGOA 4I2QA 4AQYJ 1RT4A 3M32A 3NGRA 4O3NA 4NLQA 4G1IA 2W9CB 5D0EA 3C15A 3KUHA 1KLMA 3EGNA 5CA5A 1VQ4S 5J2NA 3M2UA 3CEDA 4BC7A 1RKJA 2FC9A 2X3GA 3MPDA 1RT2B 4EMDA 3C6UB 2YQ1A 4I64A 2CXEA 3ENAA 2FVQA 2DNPA 3PJ9A 4F36A 4IRKA 1XR7A 2BE9B 2CA9A 2E9TA 1MU2B 3C8YA 5C24B 5D0RA 4LRDA 4PWWA 1DTTB 2GIFA 2V4JA 3I0RB 3CCMS 4LF5J 3CPWR 3X3UA 1N33F 3F0NA 2KG1A 1CS4B 2RE1A 1G1XA 4CLUA 1GFWB 1EAYC 5IS2A 1IM4A 1S6OA 1JLGA 1IR1A 4LF4J 4QYZJ 5A8KB 3UO0A 4KHPF 2A2DA 5F3ZA 1WC3A 3ILJA 4WF9Q 2MKYA 1IKVB 3IFEA 4USKA 3BQ0A 2MLZA 1FCAA 1SQGA 4ILRA 2B43A 4I6WA 4PEOA 4Q2MA 4ZPWR 3PX6A 3H98A 2FHOB 3M9NB 3DI6B 4KSEB 3MEKA 5U47A 5IM0A 3GYXB 2FY1A 5KFWA 1HNIB 1R89A 3BSAA 4QWBA 3GJTB 1RT5B 2C2MB 2CWXA 4CTAA 2QA1A 3BBBA 5EHHA 4J9OA 4KO0A 4RO0A 2R4FA 1S12A 4IKAA 4PKDB 1EIYB 3I6PA 3U1LA 3TUIC 1WOSA 1IBLJ 2CPDA 4DLGA 1NPRA 3K5MA 1YTYA 2KT2A 1C4AA 5KT4A 1REVB 2CJXB 2K2PA 3NCPA 5ETPA 4P7VA 4USTA 2QLWA 2HSEB 2DYAA 1TV6B 4M95A 3MMJA 5DQHA 1IM6A 5ETVA 2OFGX 3JYTB 1KFSA 1XWLA 3HULA 3W63A 4RNFA 1JX4A 1S0VA 5DM6Q 1APSA 4H4KC 4B3OB 5ETRA 2O01C 3HVAA 3UFCX 1WF2A 3A8IA 2XO6A 3JSBA 1N5YB 3KLGB 1S1VA 2OI2A 2JHEA 5KFMA 2R7XA 3AJ1A 2L08A 3RAXA 1VOMA 3N5BA 3O1LA 1HKAA 1T02A 3LAKA 4YQWA 2PMHA 1S6QA 2AMCB 2YNHA 3IMQJ 3M1VA 3DCAA 3TX8A 5KFNA 3CW2C 5IQ6A 1HQUA 1G6BA 1S6PA 5KFVA 4UZCA 1WSVA 2JLFA 1FDNA 1AUDA 1DY3A 4ITSA 3RRGA 4LF5F 4C4WA 3MM8B 1J5OB 5HVFA 5J1PA 2UP1A 4FXWA 4GVLA 4USWA 3FRZA 1B4SA 3MPWA 4P2MA 5KG4A 1ELOA 4USVA 5DO2A 3FCVA 3GSDA 3QT5A 3TW0A 3SV3A 3CIMA 4OYIA 4UQTA 4E8UA 3HSGA 3THPA 3QT7A 3UCZP 1WNEA 1VBYA 3BF4A 2DH8A 4O44A 3TZXA 1OSDA 2W2QP 2DNRA 3VAGA 1EARA 3M2UB 4DR6J 5L46A 3R5BA 2N4CA 5EDWA 5HQMA 4BCAA 3EYZA 3HKZD 5KT6A 4KTQA 1K47A 3PEHA 2EG2A 3EZUA 2HVHA 4B17A 2H5EA 2HG4A 1DQAA 1JLQB 1LWFA 3PRBA 3QLHB 3BDPA 4LF2A 2OH2A 2JEJA 2VPXB 1DTQB 5H9EK 1S57A 4K4WA 2KT3A 4KKOB 3DRXA 1RK8A 5E5NA 1DARA 3T6JA 2MLXA 1RB0A 2PT0A 2MSTA 2A3JA 3BM7A 1YHQS 3NMAA 2HHSA 3MPYA 3T1HJ 1JLGB 3D1OA 5CD4H 4ZP7A 5L9XA 2OO4A 2OPSB 4DSEA 2AWZA 2YTCA 3PCOB 1WACA 2HNYA 1KR4A 2YWFA 3PW4A 3AD9C 4U9RA 3RR8A 3IBFB 4ZA1A 4ID5B 3TARA 4GVBB 4JI7F 3M30B 3G82A 4HEA9 4HH1A 4KIAA 4QZVB 4RUBA 1PILA 3J81j 2YNFA 4NA3A 3GILA 1SB6A 2V34A 1NKBA 4K7QA 1TMJA 1RT6B 4JUZA 4B9SA 1U25A 3K5NA 3GU0A 3KLFA 3OL9A 1I94F 3M1VB 2HHWA 5GAGU 3OXGA 3OTBA 1BE4A 2R2SA 2DPIA 1N32F 4ELTA 2IRUA 4NYPA 4GC7A 2M88A 2IBKA 2ZFHA 1TTHB 3MR7A 4A46A 2XMMA 3A1YG 4ED3A 1N6QB 2MZSA 3A3OB 1T9TA 4DSLA 3UD3P 1KHVA 2H51B 4DL5A 3KDNA 1Q5YA 1UCNA 5E3AA 1RTJB 1QLNA 2LYVA 2VDIA 1O5JA 1RT7B 1Y5LB 3ISNC 3C3LA 2U1AA 3BGRB 3ZZUA 2AP6A 3OL6A 4LF6J 2LQ5A 2VD3A 1B0TA 5FJ4A 2F8HA 4G1QB 5KT5A 1S1UB 3HHDA 4GKKJ 1N0VC 1HIYA 3DXBA 2ALYB 3GIKA 4USJC 2E5GA 2XTJP 1LW2A 5KFFA 3ZNJ1 3WC0A 3D67A 4JI3J 4NLWA 5J2QA 4ZVSB 1MU2A 4DV2F 4LRAA 1S7IA 4HTJA 2KFNA 3AXMA 3IR6B 1RWVB 3LALA 1SI9A 3WHIA 3ZZPA 1HI0P 2HZVA 2XO7A 4TVAB 4WBFA 2V69A 2RF2B 2UVUA 1KQSR 1FJGJ 2PE8A 2H5IB 4IG3B 4CH0S 3GV7B 3OL7A 1RLCL 1U6ZA 1M90T 3K59A 5AE2A 3SZ2A 3LWMA 5C42B 1HBOA 2AT1B 2WZ1A 4YR2A 4Y00A 2PA8D 2V2KA 2XHWA 3A3PB 4NLUA 1WELA 2HFVA 5HJYA 4DR4J 5KFXA 1IR0A 5A76A 2MLYA 1DTQA 3QATA 4PG5A 4RLEA 3AD8C 5FD1A 3VF0B 1X31C 7FD1A 4YB1P 2HQ3A 4WU2A 2XMAA 1NK0A 2DNLA 4B3RJ 3K2YA 3CVKA 2LVWA 4AL7A 2KZMA 1ZZFA 1GXTA 2RILA 3ZZOA 2MHEA 3MFHA 4X84A 4B02A 2MEWA 1EP4B 1ZAXA 2OSRA 1S1WB 3CDUA 2BM1A 4TY8B 4O3PA 1U8WA 2C3UA 3QPIA 4OYBA 4DV3F 1N5QA 1PBUA 2L9DA 1FDBA 3FCHA 1BQXA 4A8KA 2XY7A 4N76A 4DZDA 4FF4A 1UP1A 2QSWA 4MK9A 2DBBA 2MQPA 2RRAA 1ZZNA 2P9CA 1D9FA 1RYRA 4QU6A 5F0UA 2DR9A 3I9ZA 2CQ1A 3H2VE 4NXMF 2DIVA 2HQIA 1TL3A 4J9VA 4UQGA 4U95A 5KG6A 1WJ9A 4ZVTB 2CQGA 4DV0F 1LXJA 5HMZA 3VQSA 3M8RA 3FSIA 2HQFA 1RWKB 2HBZB 2ZOGA 3E51A 3GR1A 1PAEX 3EM1A 4FYXB 5KAKA 5KG7A 2B8PA 3SEOA 4ED8A 1P6TA 3G6YA 3QIPB 4J9KA 1JKHA 1UVLA 4DUYJ 3KMSA 1VLOA 2RD5C 4JV5F 1AB8A 1RAIB 2ASJA 1B64A 1SH0A 4IG0B 2GFFA 5JVHQ 1HBMB 4ZHRB 1X9SA 2EKNA 1FRXA 2DCUB 3BGOP 4OX7A 1DJ0A 1TUGB 2Z2YB 2JOQA 1SUQA 3MM8A 4UOGA 1RT7A 1J5OA 4NLXA 3QT8A 1SIZA 4ZLPA 2H9ZA 1TL1A 5HI7A 3BGRA 4L72B 5A2QU 3ZTSA 4H4MA 1V5IB 2DGXA 2JWNA 3GG1A 1I1GA 1HQEB 2RKIB 4ZCMA 4ZN3A 4ZIVA 4HH0A 4ANDA 4NA1A 2QA4G 1HBOB 2VJUA 3HI9A 2HEKA 2YPZA 5D4NA 2HYIB 2Z0GA 2O67A 1LW2B 3D1QA 4DG1B 1YJVA 4ZVQB 3BGUA 4CCHA 2VJVA 1H0HB 5F8JA 5AJ3F 1YSJA 3D1HA 2W9AA 2OJ3A 2QLXA 3S7RA 4A8FA 2XEXA 4IR9A 2UXBJ 3CCTA 3HSJA 1OMSA 1NK5A 3UD4P 3SIPB 2GX8A 4B3TJ 5HVGA 3UE2A 2G1HA 2K3KA 2M7SA 1Y00A 3H20A 3ITHB 3KLFB 1IXKA 3PV8A 2ILYA 1HNZF 1JLEB 2UZAA 4U8YA 1AZSA 2HWIA 2HNZA 3HFVA 4DQSA 2ZEJA 1D8ZA 3HZGA 3BPSP 2IJFA 1RBLA 4GMKA 4NZ6A 4ID5A 2HIYA 4XDDA 3UPFA 1VIXA 1N36J 3V2UC 4ES3A 3MM9A 1OO0B 2DH7A 3IWNC 2EK1A 3TNVA 5LJ5Y 1QVFR 1WSRA 2GJ2A 3PW7A 3HCXA 1S0OA 1JB0C 5D0HA 3HHLB 2JJ4D 4IRDA 2OUGA 5KT3A 1HBNA 3NEKA 2CQIA 2OHDA 3DLJA 3OBIA 5HMYA 1X4CA 3KLEB 2VDHA 3M8QB 3QAUA 3IM8A 5E3CA 4DV7J 2CQPA 4ZLJA 4I6AA 2CQDA 2OAUA 4DL4A 3I5CA 2W4DA 1KS2A 3DNCA 4YB7A 3OTOJ 1O8BA 3W5YA 3TRGA 2HRUA 2DGQA 1Q4RA 2XZTB 3QYYA 4IFYA 4MFBA 3T41A 3W9JA 6AT1B 1KSPA 1Q16B 1DQ9A 2CZ4A 1EX8A 1M5PC 2HLTA 1JLBA 1U6FA 3EGWB 4F0HA 3CSKA 3ILIA 3R6GB 4DCOB 1X5TA 1HNWJ 2Y8WA 1R7IA 3DDNA 4J5OA 4OLPA 1WHVA 5J2NB 5KFOA 3TA0A 5KFCA 1N0UA 3KK3A 1ZA1B 1WKLA 4RW4A 3UDVA 2MGZB 5KFGA 1FD8A 3KHRA 1FNXH 2OIHA 2MZQA 4R5PB 5BJRA 5B0FA 1FWLA 1MMDA 2CUYA 3DU5A 3EVOA 3KXDA 5JXSA 1T9UA 4A4JA 1ACMB 2DITA 1IKXB 1OIAA 1EHWA 1YGYA 3BPDA 4CO1A 3OHAA 1TK5A 1EETB 5I3UB 3AA9A 4DLEA 2AHOB 3QO9A 5J1EA 1I94J 3UR3C 1VCTA 2I0XA 3ZTOA 3CCSS 5EWGA 1VJQA 1PYSB 2DXDA 3JQMA 2RF2A 2XMVA 2RDIA 4EBCA 2OLWA 3LQVA 1HYSA 2ZZNA 4I2PA 4ZPTR 4RW7B 3SI8A 2FJEB 2GMHA 1NK9A 1L3UA 3W9HA 3CF5Q 2D3O1 3PYFA 4K4ZA 5IC6B 1TK0A 3AJDA 2XGPA 3M2VB 3MD1A 1U49A 3EXCX 1X0FA 1RT5A 2KL8A 4CLFA 4DN0A 1WHYA 2MKJA 2V8GA 2W4CA 4JI2J 1C1CA 3NS7B 3H5XA 4P72A 4ED4A 3US5A 3R8YA 1TKZB 3H59A 3MEDA 2RSQA 1KOHA 4ZCLA 3FGVA 4HVZA 4YN3B 5ETTA 4DX6A 4ECRA 1KVIA 1S6PB 3AA8A 3T5KA 4LF4F 1JJCB 2MKSA 3R1HA 4AL6A 1RHMB 2QLJB 3M2RA 2VZ9A 4C0OC 1FO1A 4IG0A 3RW6A 4ECVA 1ZPVA 2CPYA 2B3TB 3M05A 1T05B 1SC3B 4KB7A 3F44A 1FWKA 4OX9F 4E2FB 1FXRA 1NB2A 2VBYA 1RT1B 1Z2LA 3RZAA 2EC0A 3MR2A 1F6TA 1VHIA 3MDFA 1EKSA 3NGKA 5KTQA 4Z2XA 5A6PA 2W9BA 1NO8A 1BHNA 2K1RA 2VA3A 4IOAQ 5F8HA 2KZZA 1OYEA 3EUNA 3W3SA 2GHVC 4PCQA 3CJ8A 4Z7YA 4X4OA 3J7AN 1X9MA 4DHVA 1S99A 2ZBQA 3HZEA 4C8KA 5E33A 2UXDF 3IG1A 2IMOA 4OLOA 2DNMA 3D6TB 3HFKA 4RWWA 1U02A 4P2FA 3T5LA 2AEMA 2BACA 5I42A 4LF6F 1NHUA 3D6HB 1WUUA 3BEGB 4I69A 1OQ3A 4P74A 3EICA 4C3KA 4CT9A 3JAMY 1VBKA 2ATCB 1HNVA 1MROB 2CNNB 4HT5A 1D8YA 3GP9A 4RW4B 1YX2A 2XM3A 1S59A 3U1MA 3SSRA 3HJFA 2OD6A 3IP0A 3ILLA 2ATLA 2VFTA 1JLAA 1NSPA 1UEVA 2D69A 2R7QA 3EGVA 1RI7A 1AYEA 2HFSA 3F41A 2O5DA 5KG2A 3KK1A 4OFZA 5CAAA 2YKMB 5BYRA 2GHPA 3CO9A 3Q8UA 5B08A 1CJVB 1FJEB 4HL9A 4RL1A 2FZGB 2ZHOA 2BUNA 2EC2A 1T9WA 3N79A 2D74B 1RWNB 2DHAA 4KC5A 3LWLA 5T7LB 3PACA 1TKTB 3MD3A 4ZLLA 1VHFA 4BC9A 3FEZA 3H2UB 2CNOB 4URSA 3PO4A 3DGVA 4OHYA 1R0AB 3FRYA 1LWCA 2HK2A 3PTWA 2R42A 4RR5A 1RWPB 4FYDA 2GZOA 2IM1A 3RRHA 3NY0A 1G7CB 1ZA2B 1WTBA 1A0OB 2QLFB 3VHQA 2G9OA 3PKYA 4F4ZA 1REVA 1UJ4A 2EEYA 2VB6A 3EWGA 1ZM9A 4KHPJ 2HVZA 3NAHA 5L1LA 4CLTA 1KC8T 4IYQA 4X64J 1WG5A 1UWBB 2MZTA 2OMLA 5CQGA 5A8WA 1X9WA 4Q8FA 1FJ7A 2AGQA 3W1YC 4R8UA 3RBDA 1JK9B 4XPCA 3AY0A 3KLGA 4GKKF 2W7PA 2QE5A 3DOKA 1M1HA 2A18A 1YJRA 3BKTA 4P10A 4QW8A 4AXJA 5F9NA 4ZVOB 4K4XA 1N32J 1TAUA 1TQLA 3HSDA 1XC9A 2KFZA 3KK3B 2VONA 1CQNA 3RBXA 4TQSA 4NI2B 4ELUA 2MGZA 1CJTB 1W25A 2PA3A 1N52B 3CJKB 2FJDB 1RT2A 1WI8A 2P9GA 4TYAA 3GFZA 3HT0A 1X4EA 3K17A 5DS7A 3M4XA 5K8PA 4C8ZA 4A8XA 2VIHA 4ED1A 2YKQA 1URNA 1KQGB 2BJDA 4NXNF 1LK5A 3QFHA 4WTYA 4C3MA 2CDQA 3MMBA 3I0RA 3LP1A 1SPBP 3BGLA 2CPXA 1UAWA 3AHPA 3SCIE 1HI1A 5CZXA 1CBKA 1NUEA 3KHLA 3W2VA 5ITHA 1KFDA 1H7WA 2Y8YA 5DGBA 3V6KA 3BSNA 2EW9A 1J27A 4I2PB 5CABA 1PJ6A 2YVSA 3B54A 5LMUF 2XCPA 5KG5A 1YJ9S 3J7A1 5K14B 2HVEA 2JDJA 2OMOA 2YKAA 3KG0A 5F8LA 2AX0A 1JMTA 5DLFA 3M8WA 3D6MB 2R2RA 1ZTTA 1RAOA 4XAKA 3UDCA 4M5DA 5AT1B 2QTWA 2JFDA 3PW5A 2WONB 3MUMP 2NS1B 5IQQA 5DDQC 3VAMA 1HPZB 3KLIA 4ZVPB 2RAQA 1N4LA 3OFHA 1P9QC 1KRPA 2O1PA 3QWUA 4DUTA 2HIQA 2HNYB 1ZYQA 1U1MA 4P73A 2XMTA 1FXLA 3UVJA 4Z37A 2KHCA 1SL2A 2HWHA 4U7UD 2GMLA 2DY1A 1VC5A 4PUOB 2PI5A 1UW4A 1AFJA 1ZETA 3A4TA 3SSQA 4KT0C 3UN2A 3ILOA 3J81Y 3IN5A 2GVDA 3EE3A 3KUGA 2IRXA 2JL9A 3QIPA 3OUYB 2EK6A 3R5JB 1CPZA 2ZKTA 4TU9A 2KN4A 2ASDA 2CJKA 3HVWA 1UETA 4NYZA 1IWAA 1Q1KA 5KFIA 3UN5A 3QZ7A 1Q8BA 5KFTA 2JVRA 1D09B 5A8RB 1CSJA 2CZVC 2X51A 3KJNB 4OI2A 4WCEQ 4KRWA 4RNNA 4IR1A 3O5TB 2HNDB 1PYTA 2QMUB 3ETOA 4J37A 2ZNYA 4TY9A 4DQQA 3KTQA 1FKPA 4JI2F 4OI1A 1UTAA 4KGMA 1RHJB 3D68A 2R7WA 1U1QA 4J7CA 3TAMB 4M1KA 1SJFA 3SBMA 1NJYA 1TKXB 3U7JA 2ZD1A 1XNQF 3T1YJ 1WEYA 1DZ5A 2XYGB 2RB7A 4TLQA 3ULHA 3GJSB 1N33J 1F3VA 4KPCA 3R5DA 3J80U 2D1CA 2FLNA 5HK4A 1SJ1A 3O44A 3PRVA 2ZDPA 5KT2A 1XNQJ 1E6YB 1W2BR 4DL0C 2ZJQQ 3ZZ0A 4H54A 3H8YA 1UWAA 4JI6F 2RVJA 2KXHA 4X4QA 2Y0SD 1TUWA 2JNJA 1A9NB 2GQ2A 4FF1A 3HKWA 1FHTA 3OR1B 4OX9J 3QWPA 3CJRA 2LDYA 4Q45A 4Z7CA 1HQEA 2RKIA 3I32A 4Q43A 3D4JA 3L7UA 4BDPA 4ATNA 4CWBA 1YVFA 1VRTB 4I1TA 1GXUA 1KDNA 4YR3A 1L3VA 2NXNA 4G6VB 2ABYA 3KG1A 3GYNA 1DLOA 2RRNA 3A12A 1IBKJ 4LVNP 2GO8A 3QQCD 2V9WA 5IM0B 1XNRF 1MWZA 1YJWS 3CJ3A 3G71S 2HFNA 3D3CJ 2YNIB 3GCXP 1BQMA 2YKMA 1BD6A 5BYQA 1U48A 4GVBA 2PMZD 3OL8A 1CJVA 2V67A 2LEBA 1NPPA 2IY5B 1H38A 1QSSA 5B0DA 2YNFB 4EYHB 1UVNA 5DG7A 4KGXB 2AD9A 5T7LA 4QCLA 4ZPDA 2ZOFA 4Y0FA 2FLOA 2N3LA 5EN1A 1Q53A 2BANB 3DOKB 2B6AB 1N34J 2HHUA 2NSCA 2CJAA 1LV5A 1TELA 4B9LA 2ALZA 1SJ3P 1HD0A 1FRHA 1RU2A 3V6JA 4K8RA 2H5JB 2CQ3A 2KTQA 1QE1B 5HSPA 1GAOA 4LFCJ 5KFRA 3V6HA 4WFYA 2HLUA 2HAIA 2L3MA 1X4DA 2XI2A 3TVYA 4DN9A 1F2HA 7FDRA 2J8SA 3PX4A 1UFLA 1UA0A 1NKCA 1MWQA 2CNKB 4WP8A 4M5MA 4E98A 1VMBA 2OSQA 3C15B 1KN6A 4LT6A 4ZP8A 3KJQB 2AYEA 2ZOMA 2ZZTA 1IR2A 4LSZB 1AA1B 2QC3A 2ZNZA 4EBEA 4ED6A 2M4MA 2AGOA 4LF9F 2C2ZB 3MZIA 1M5KC 1Z2ZA 1H3DA 1CJTA 2HNDA 2KI2A 4RW9A 1RGVA 2COLA 2I1RA 3EZOA 5AXMA 2PD1A 2AEFA 3HHEA 3M9MB 1IBMJ 3PYDA 4NA2A 4DV6J 4CH1A 1R31A 2HFUA 4RZRA 3BH7B 4PQAA 1FKOA 4XPEA 2YPYA 1SIWB 4KHMA 4ED7A 4DX7A 2G13A 3H5SA 4OYOA 4USIA 3H42A 3QSYB 4OJ3A 3RG6A 4M5IA 2Z4PA 4CI0B 5B7WA 1HWUA 1ICEB 2J9EA 4C8MA 5HO4A 3QLHA 1FJCA 2XWXA 4ZPAA 1UKUA 2OP5A 2JVOA 3CIZA 2IAJA 4DR6F 2SXLA 2YWKA 1R8BA 5ETLA 1T3OA 4J9PA 2MY8A 4B3MJ 4B3SF 3RAQA 4WKRA 2OEJA 3Q0AA 1CC7A 2A10A 2L9WA 3W62A 1H2UX 1BLUA 1XIQA 2E44A 2L48A 2QV6A 2Y9HA 2ZH9A 4DV4J 2DO4A 4ES1A 3DM2A 2E7VA 2V8VA 2F4FA 4WFZA 2DCLA 4JV0A 3SFUA 1ZTWA 1U45A 2WVFA 4K4VA 4DV5F 2HHQA 4CQ1A 1M0SA 5KFLA 4K5SA 2OFHX 1OWXA 2ZUAA 1HHQA 2DNZA 3OT9A 3TWZA 4X65F 2WBMA 4RW7A 1CULB 2ASYA 3NNAA 3EDQB 1T8EA 1I5OB 4EYIB 2XNRA 3N6MA 1RACB 3CMQA 5DETA 5HQ8A 3DYAA 1IKYA 1QSLA 1X4HA 1K1SA 3W2WB 2HZCA 4HYKA 3FK4A 1RWOB 5KG0A 3TUPA 3F73A 4P75A 1YITS 2EFQA 4OI4A 5EUHA 4ECWA 3Q8YA 2GC8A 2DEJA 4C7QA 1TL3B 3L95X 4G65A 1TK8A 1R6VA 2GVDB 2M9KA 3M6VA 4DCPB 2GVZB 2JSXA 1VRUA 3GIMA 2CPJA 2V4QA 3RB4A 3P4UB 2J9CA 2A6MA 3DOMA 3LPYA 2XGQA 4PPZA 3NGUA 3MMCA 3FMBA 5H9FJ 3IG1B 3PR4A 4JOUA 4YDXA 1QY7A 4O4GA 3P8BB 2LMIA 3G6XA 4C48A 4JBCA 3CC7S 1M5OC 4OHVA 3TEHB 1SKRA 1TR0A 4NRTA 4IFYB 4MFBB 3NOGA 2HHHF 2C2EA 4RW8A 2J9DE 3CD6S 4WWSA 4PRFA 2EBEA 2AJ4A 2LQBA 1WHWA 1RE1B 3MMAA 1FTRA 4IH5A 4X62J 1RWWB 4E0DA 3OLBA 2AV5A 1TL7B 4QOTA 2CYYA 2YY3A 4TU8A 3FQKA 4M5LA 4P52A 3PVXA 1FFWB 2IPOB 3ET6A 1NNDA 5A8KA 2E9RX 2J7UA 2MTLA 4FVCA 3BZQA 5L39A 2OPPB 3MAAB 3VVUA 3NGDA 2UXDJ 4NXNJ 1DQ8A 2E7XA 4F3OA 4DR2F 5BR8F 2F9DA 1HD1A 3I31A 4LF8F 4JI3F 4ES2A 1GMUA 2VKZG 1XMOF 3I87A 3RGIA 3UQSA 1AROP 3SCKE 2FD2A 1NZ8A 4DR3F 3KLVA 4CM0A 2R7VA 2Y3YA 3PJXA 4B9TA 1ZH5A 4DJBA 4MKAA 5G4DA 4Y2CA 4HTIA 2OPRA 2BE2B 2ADCA 2NYIA 3DLGB 4P9SA 3GFYA 1U0HA 4UZBA 3NGSA 5I4MA 1T7PA 1RAAB 2Y1RI 1NJIT 2EFGA 3WX4A 2QT7A 1GMWA 3LOUA 3JYTA 1MN9A 1U2CA 1QM9A 5DRKA 1YQHA 2PDAA 1ZM4A 3E01A 3V6DB 2B7CB 2J5AA 2MB0B 4MJKA 1NH7A 3NWGA 3DN9A 3TA2A 2W7AA 4ID8A 4Y65A 2KT5A 2ZC4A 3BR8A 2MXYA 3E8OA 3HT3A 2CQCA 2ACMA 2E1CA 4ZDNA 4YY3F 2VG7B 3CULA 4QPXA 2IIHA 1VQ8S 1S6UA 3LP2B 1ZAWA 3TAQA 2HWTA 1IKYB 4DV3J 4LIWA 1RHKB 2VC0A 3A13A 1QD1A 3PJWA 5A0YB 3C16A 5C25B 5MLCV 2ASLA 2BYCA 5L1JA 3R2DJ 4LBPA 2XCAA 1N5TA 1O6XA 2R7OA 2KU7A 3GSIA 4MYTA 5I3QA 3R1LA 4D3GA 1VQ9S 1FT8A 2V0NA 3LP0A 4NEYA 4HACB 3TQEA 2LKZA 4B3SJ 3MM6A 4V19X 3OSNA 4ELVA 2HURA 1JXVA 1YRUA 1Y5NB 2G2YA 1BY9A 1WF1A 1ZBTA 2HGMA 3AT1B 3D28A 3PW0A 4OYWA 2V63A 3HVTA 4CNZA 1NJXA 3LGMA 2GO9A 4RNHA 5AXLA 5DDOC 3FDSA 1MN7A 1SUQB 3R7BB 1FWPA 4NLYA 3DHXA 4H4OA 4OJHA 2QX0A 4OV1A 3Q8PB 2RNEA 3JQKA 4OL8A 5D3GA 1WKJA 4WE1A 1IKXA 2A2CA 4Y3CA 5F3TA 4DR3J 1VQ7S 3FEXB 2ZJPQ 3ISND 1QAXA 2IDLA 2IC3A 2YNGA 3PNIA 4D3HA 1TUVA 1R3NA 1W26A 4DV2J 3DRPA 4MIWA 3QBCA 4J9MA 4U6PA 2R7RA 3OR2A 1U0HB 2Z30B 1S49A 3HD1A 3UVJB 1Y3JA 2C2OB 3T5JA 2DRAA 2AYMA 4UUXA 4ZVUB 1IQZA 4OYXA 1O51A 3KK1B 1TP7A 3CGIA 2ZH2A 3TI0A 2HZAA 1SXLA 2P9EA 1F9EB 4O23A 4N47A 4C0HA 4ILLA 4F4AA 2F4VJ 3K89A 3MR6A 1DURA 1SCJB 2WONA 3JS9A 2DXEA 4OZJA 3GIIA 5JUMA 4K0KJ 2FZCB 1YBAA 3MR3A 1QUPA 4J91A 4CM2A 1Q95G 3DHWC 1RHQB 3KG4A 1VQOS 5M2UA 4B3MF 2GMJA 3EMTA 1RHRB 3NCQA 4JI8J 1WG4A 3A3NB 3N4WA 1DHMA 4XIUA 4X62F 3TZWA 3BO4A 4LVOP 3A8JA 1NHKL 2IJNA 1DRZA 4RBTA 2FGOA 4NCGA 1K44A 4JI0J 3WC2A 5HLFB 3KK2A 2CDRB 1T95A 3ENVA 3M8PA 2N4DA 2AYGA 4LFBF 2YQ3A 3D54A 4K4UA 1RT6A 3P5TL 1VIOA 1Y5IB 3GR0A 3NAIA 3UI3A 3W8GA 3ZFVA 3BYRA 3RB3A 2E5LJ 2BJ1A 2K1RB 5D4PA 3HFZB 4G1QA 2ERRA 3T9ZA 1EQ0A 5IC4B 3DOMB 2MPUA 3KHHA 2V50A 2GHWA 3NWRA 2QLBB 2ZHBA 1RAJA 2DRDA 1T94A 3OW2R 1R27B 5KFYA 1TKXA 2XNQA 3DRYA 4F04B 1I3OB 1QDUB 2YKNA 4NX9A 4K4YA 4H4MB 4IQXA 1SJRA 2WSEC 2VBWA 1KQFB 4IO1A 2H4WB 2FGCA 2P2CB 5J2MB 4JV2A 4WU3A 4R5PA 4KJIA 3SFGA 3E3XA 3HLUA 3W2VB 4EZ9A 2WOMA 1Q8LA 4N5SA 1Z1ZA 2DISA 1OSCA 2XI3A 1NDLA 2RUGA 1XR5A 2F65A 5GMKa 1FA0A 2OPRB 3ET6B 1K73T 4F25A 2UUAF 2D3UA 2FQQB 2D9PA 2VUGA 2XS2A 1EETA 5I3UA 4CP5A 2ZWPA 2XSFA 4ECXA 3SMZA 2CKWA 2NYHA 3R6LB 4ANEA 1BQNB 4ZJOA 4DUYF 1V9OA 3I55S 4NLDA 4IDKA 4O0NA 5IOLA 2W8LA 5D77A 1GX5A 3TX0A 5KFPA 1VLYA 1RT3A 2Q3PA 4ZPCA 1HLWA 4KY3A 1U1KA 4Q8EA 1IN0A 1B7YB 2QA4S 4R25A 3EVMA 1B0VA 1Q81T 4PWUA 3N6NA 4CLWA 2KM8B 1Q78A 3V5RA 3DMJA 1B0PA 3T9NA 3NP5A 4W4MA 2IVMA 4PYDA 4KH1B 4M94A 2DTJA 2RU3A 4XK8C 2LU2A 4OHXA 1CEZA 4DL7A 2KRBA 2ZC3A 1RXOB 1U2RA 4HT7A 4M63A 2VU5A 3TYTA 2FJVA 3U1NA 1I51B 4FKXA 3U27A 5A8WB 2A1BA 5HQLA 2LU1A 2GQQA 5ETSA 2CRLA 3WIVA 1S5ZA 2MZ1A 2QYGA 2BBEA 1XMQJ 1UVKA 4HACA 1N5YA 2RS8A 1RAHB 1TU0B 1M5HA 2BZ2A 2O66A 4N7TA 2H54B 1FNMA 2DHHA 4RBUA 3LANA 3MECA 5CCLA 1NK6A 1QE1A 4RBVA 1PG5B 1TV6A 3BGFA 1L5UA 1JJ4A 1S1WA 3LGHA 3DFEA 1Y9OA 1HBMA 3GFXA 4LIRA 2BM0A 4R0EA 5I3PA 4ZHRA 1SJQA 3DC2A 2Y0BB 3QGGA 1HBUB 4OZ2A 2H48B 2F63A 4UOFA 1TVRB 1JJ2R 4UY8T 3QAEA 1KHWA 3BS9A 4BS2A 4I4BA 4IO9Q 2LP4A 3BB5A 2IC3B 3H90A 1BUXA 3NLCA 1HQUB 1KP6A 2G0CA 2E29A 1RBAA 2JRSA 2RRBA 4UOHA 4WP3A 2M8DB 5DGAA 5KG3A 2J0SD 3CCUS 4B9NA 4NXMJ 4DR2J 3GYGA 3QGPA 4O3QA 4DPOA 3ZTRA 1J2VA 4Y2KA 2JC0A 3J80Y 4Q2LA 2AEJA 4USUA 1WKKA 2HK3A 5JMNA 1QAIA 1URRA 2R7TA 1VJWA 1ZS6A 2DHXA 5HMWA 5LMNJ 2DGUA 3CJQA 4ZPBA 3LTOA 2MQLA 1RWMB 3RUBL 4C8OA 2FC8A 4A8YA 2V2ZA 1P8GA 4C8LA 4AFFA 3N6LA 3MAQA 2AZ1A 3Q8RB 3TVZA 5C2GA 2E7WA 1SVDA 4PZVA 1HI8A 2M5YA 2BQUA 2C42A 1NAQA 1QAJA 1LFPA 3ICLA 1FNOA 2BW2A 2I5JB 3D5MA 1BQNA 3HX9A 3VWSA 3KYLA 2IA6A 3HHLD 1RISA 1FESA 1F1BB 2NUUG 4RKUC 1T03A 1VQKS 1DFDA 2CPFA 1CLFA 2MQNA 4NCGB 3FSXA 5D15A 1CG2A 1S1VB 4CTAB 3HXMA 2C2DA 4CRJA 2ZE2A 2B7BB 3PKMA 4ZOSA 4ENOA 3D3BJ 5BYSA 5DDPC 3HK2A 3X1LB 1E6VA 1X4GA 2AZ3A 2ACYA 3PIOQ 5KT7A 3DMJB 4X2BA 2HQGA 4N77A 3ZZTA 1AT1B 4OZ3A 1S1TB 1MW7A 3C14A 3H2LA 4BLGA 2RIJA 2QIFA 1LW0B 1LNQA 1IBKF 3I96A 4BHQA 3R97A 3ADAC 1UEKA 2CFXA 3AXKA 3D0HE 4OHWA 2F5GA 3DGPB 1RTIA 3FFIA 2ZBIA 4NCBA 4N41A 2XS7A 2FHMA 2AIRB 2ZKUA 1VRUB 1FFSB 1JLBB 2DEIA 2E5HA 3MURP 3JSRA 5B0CA 2VG5A 1TKDA 4J9SA 5CXTA 4A8WA 5GMEA 1NBEB 1WWHA 2C3PA 3OFFA 3JAMU 4DDFA 1CJKB 3NL0A 4HDGA 2M70A 2Q79A 4IUFA 2XLIA 1JLQA 4DI6A 5F8MA 3GIRA 3LF0A 3I82A 1GX6A 4QPTA 5LOQA 4U67Q 1V5VA 4DL6A 1D9AA 1QTNB 4MKVA 5CYQA 8ATCB 5I42B 2JC1A 2XBPA 4FXVA 4DUZF 3T3FA 1NK8A 4HKQA 1G4CA 1RZMA 1FDAA 1TL7A 2EFNA 4UT4A 5DZ7A 1LEOA 3QNWB 2MJNA 1RT3B 4OZ1A 1C0UA 4OMFG 4UY85 2HRTA 2AJQA 1RAEB 4I67A 2GAHC 3CDBA 1NCLA 2OPQA 2UXCJ 5K14A 4WPAA 4A48A 1HHSA 2JLGA 4J9LA 1WEZA 1F0XA 2C22A 4ED5A 4RWXA 2J9DA 3VAKA 2EWHA 4B08A 3GJQB 1RCOB 1F9FA 1MMNA 4NLRA 1T9XA 4I7FA 4EEYA 1Q5VA 1IJEB 1KLNA 2QRRA 4IQMA 5KFZA 1FRKA 1RKIA 1KKHA 2CG4A 2C3MA 3NGTA 4Q0BB 1C1BB 4NLPA 2HHXA 3CNQP 3GV8B 3MOZA 4JI5F 4UUWA 4WJBA 3I56S 4LFAF 4YDDB 3SQOP 2FY8A 1HYSB 1WORA 2PSZA 2VQFF 3OXLA 1Q82T 1A6LA 2HVIA 1SV5B 2CADA 1R8PA 3NS6A 2W2NP 1VQYA 2B9WA 3NBPB 3OV7A 3M2VA 4LFAJ 4KE5A 2G0IA 4AXIA 5LSRA 4CYUA 3TANA 2D7SA 2RDJA 2WVCA 4DV1J 4QIWD 1RDRA 3AAWB 4L73A 2C2RA 1YI2S 1TKZA 1H2TZ 1LKZA 4ZVHA 2X1BA 2K7JA 3KWMA 4USHA 4AE5A 3DLBA 1GQEA 2M3DA 3B6BA 1SJ4P 4JI5J 4YOEA 1JLFB 3CJKA 4X65J 4FS2A 4N8OA 4CLSA 5GMDA 3KLHA 1FERA 1FKPB 1OYDA 5HANA 4YUDA 5K20B 2BR0A 3WBZA 1JXLA 5CYQB 1FE0A 4DBQA 5LXRA 3HM9A 1PCAA 2IJRA 2RDDA 4ZPVR 3HMJG 1U1OA 3CCVS 1SQFA 4DV4F 3BKFA 4F0KA 4JI6J 4DSIA 3BJYA 4MAKA 1U24A 2ZBRA 3VGSA 1S79A 2ZITA 1KEKA 4PQUB 3IR7B 4EBDA 1FKOB 3MM7B 1EQMA 3W64A 1KNZA 1XR6A 3VQTA 3M8YA 1S7HA 1HNVB 1MROA 1NDCA 1OJ4A 4ZVRB 4EWTA 3VALA 1AXQA 4QR1A 2W24A 2MMYA 3PZPA 4JI4F 3JQJA 3L9ZA 3W5ZA 3MR5A 4F4KA 2RT3A 3D66A 4W92B 4WXWA 2NSBA 4WFXA 5T41A 4WE1B 1Y4ZB 3P5BP 1YJTA 3C46A 1RTHA 3N5FA 1HW9A 4CZCA 2A0FB 3SDEB 1A7GE 1VYAA 3CJ4A 3BH6B 2KH9A 3CMES 1FI4A 2JFKA 3LUYA 1V3ZA 3QGIA 3PHEA 4KGKA 3H40A 2XG8A 3GZ7A 4AQYF 1NJWA 2FIUA 2BEFA 4ZS6A 2BJ9A 4YHHF 4DG1A 1ZOTA 1EP4A 4TY8A 3TJ8A 3RR7A 1WC0A 1GH8A 1YJ7A 1ZM3A 1BQMB 1Y0HA 2I8EA 2KDOA 4PR6A 1JLAB 3AB4B 3MM9B 2E1PA 2OELA 2FPHX 3V81B 3FJ2A 1UJ6A 3F56A 1PC4A 2J0XA 4C11A 5KFQA 3RU0A 2W1BA 1BC6A 3AQPA 3KKFA 1T11A 5SUHA 3R7SB 3JTOA 3CTRA 2NREA 1PIEA 3Q24A 1I6JA 2ZE2B 1NSKL 2B4PA 2NZCA 2QYCA 4GKJF 1JLFA 4PPDA 1RABB 2YX4A 2W7OA 4Y2AA 3KJVA 3KLHB 3MXHP 4IFVA 1M1GA 5KFJA 2IVYA 1SV5A 5KG1A 2HMIB 1S1TA 3C14B 2FZKB 2LXIA 3J7Z5 4KV8B 5D4OA 1LW0A 2HHPA 2D3OR 5A0YA 4O4GB 4DF8A 3MCSA 3K8WA 3HSZA 4LBHA 2BJ8A 3WIUA 3PX0A 5H1SV 5J2MA 4IH6A 3CCRS 1IKWB 1XMQF 4WKYA 3DLEB 2OEKA 1FX2A 3W8PA 2W2OP 3E2EA 2LA6A 1GMWD 4LF7J 3NRBA 1HARA 3IAM9 4TLRA 2PI4A 1SL0A 2KO1A 3GCWP 3TZYA 1R8CA 2ZH5A 2OTLS 1JKHB 2P6SA 3UWTA 3HVTB 1WG1A 3S6EA 4CLYA 4X64F 1DAXA 3BQ1A 4QR2A 1Q8KA 2AYBA 4NZ0A 3G6ES 5K5MA 1H72C 3UN3A 4KHRA 2MJUA 1IJFB 1PYOB 1X5PA 1QUVA 2J6TA 2OTJS 3TP2A 2VF3A 3KDOA 1OPIA 2FHJA 4USMA 1FVSA 4EZ6A 2LDIA 2EBGA 1YJUA 5HBMA 4F4WA 3LP1B 2WBRA 3O6QA 4CDIA 2B9EA 3ELHA 3W66A 1L3KA 2R8IA 4LBIA 1ZAVA 3B8HA 1RCXB 7AT1B 4QBUA 2ZH6A 4OZLA 4EUVA 5DZ6A 2BE2A 1YRTA 4TXSA 2IVFB 2RHSB 2WTFA 3RBZA 1J5EJ 5A2QY 1U26A 3DI6A 4QJVA 1NZAA 3ONQA 3LO3A 3N28A 4C9DA 2B4VA 3GWCA 3EPGA 3QIDA 4I7FB 1UW9A 2VBZA 2IYIA 4DL2A 2FJWA 1GTHA 2CZ9A 2BE7D 1RSCA 1EB0A 1WF0A 2JZ5A 5AE1A 4DFKA 4PWDA 1W2IA 5M2PA 3DDIA 1C1BA 1GXLA 5RUBA 4OI3A 1S6QB 2YNHB 3CJ5A 4K5RA 2D41A 2Q66A 2DRBA 1K0TA 3TEGA 3NG8A 4K2JA 4LSNA 2X1FA 4QIFA 4QWDA 4NLGA 4ICLB 1NK4A 1VC0A 3JB9k 2GGPB 2LXFA 2XMKA 2R3VA 1NDKA 2CJQA 4QWCA 3ETMA 3GV5B 4DL3A 5GAGI 2GVZA 1OPZA 6FDRA 4EI2A 4CO2A 2N3OA 3CCZA 4WP9A 1LWXA 3G96A 4DR1J 1RQ0A 1QSYA 4U7CA 1FKAF 3M6WA 5H9FK 3V4IA 2N7YA 1W7WA 3MWBA 2F8EX 2OEMA 1S0NA 4CLLA 5F8NA 1BMQB 2C2KB 2LEPA 3PYEA 4FZVA 1SH3A 4X4RA 3HF5A 2UUAJ 2LEAA 2HS4A 3LH2S 5LSLA 4LRCA 1NKEA 4O0IA 4PG7A 1HR0J 1C0TB 4KKOA 1OY9A 3DLEA 4NMLA 5HBMB 3KMQA 4C8YA 2ROEA 2R8HA 3TUJC 3GIJA 4OV6A 3AOBA 3R7NB 2DGTA 3BQ2A 5ETMA 1JXEA 2WRMA 5B0EA 3Q8VA 3GJRB 2FVPA 4A47A 2YQ0A 4DZ6A 3UR0A 5HROA 5DG8A 1IVZA 3C66A 1YZ7A 3JTPA 1HWIA 4DPWA 2J7WA 4NRUA 4DU7A 3G4SS 1HA1A 1DLOB 4F2RA 2VICA 4U8VA 2M0GB 3Q2SC 4P7TA 2ZH4A 3FZBA 3O2IA 2FVSA 4GO5X 2GCFA 3G82B 4O3OA 2YNIA 3EGZA 1EKRA 3R3TA 4QIGA 1JQGA 2Y1LB 2RMLA 4QIVA 4X4SA 4QWEA 4ER8A 1D9DA 3TUZC 4FBTA 4JI7J 2PIIA 3EXYA 3N01A 1GNKA 3T6BA 2VHGA 1LWCB 5DQIA 3RW7A 3NMRA 3W60A 4YMEA 2V94A 3RRKA 4ZIWA 1RUSA 1P27B 1U7LA 3SCLE 5F41A 2KJVA 2HS3A 2E1AA 1WC6A 2D9OA 3QT6A 3SQGB 1VRTA 1NMEB 2DGVA 2YKOA 3IGNA 3G8TA 1S10A 4FBUA 3QSIA 4X66J 2W8KA 1N48A 1QVGR 1FDDA 4RJVA 4YY3J 4URQU 4AD6A 2HBYB 2K06A 2XZWA 3PM9A 4HHHA 2DNKA 3ZO7A 1N6QA 2NPIA 3BKUA 4WFAQ 3IBCB 3MEEB 1P9YA 2IA0A 9ATCB 5L9NA 5H9EJ 1CVJA 3DU6A 1RTIB 3FFIB 3M30A 5E3PA 2ZM6J 1K9MT 3O3LA 2MY7A 2FVCA 4LR7A 5E2QA 1MNEA 5ETOA 1X4AA 3OVAA 4DV0J 4KFBB 3SV4A 4ED0A 4Y28C 1FF2A 2E5IA 3M8PB 4I68A 3FEYB 1KWMA 2VFUA 1RJJA 2APOA 2G0JA 3BDEA 4I6YA 2W9BB 2BANA 2V5HG 1PJ5A 1XN9A 4KAIA 3VV2B 5L1KA 4ZN1A 5C24A 4WFNQ 5ETKA 2B8QA 3PXGa 2CQ2A 4NOHA 2V4RA 2BQRA 4DX8H 1XK8A 1S97A 2MZJA 1JIHA 1LK7A 1CS4A 2DNHA 1PKUA 1U2FA 2GS8A 3GLJA 5KFEA 4QIEA 4P2SA 4ZK7M 2JEGA 3CC2S 1TFYA 2Z8QA 3I0SB 2LQ8A 4IG3A 3IM9A 2YX7A 5KFDA 3C6UA 2HHVA 4WZQA 5FLXY 4GC6A 3TQ1A 2UUCJ 4X4VA 3P96A 2C28A 4H4OB 3BO2A 1X60A 4OZ5A 1U4BA 3Q8QB 3T1HF 1NSQA 3GFHA 3CJ2A 1DTTA 2R8JA 4S0MA 2MKKA 3R27A 3OTDA 2VPWB 1SKUB 4WYWA 3L7OA 3IWXA 4M5DB 3OTCA 1G3OA 1B3TA 1L3SA 1GEHA 4DR1F 1R6YA 2GIRA 2ZBPA 4Y34A 3I5AA 4JI1J 3DRPB 1Z4UA 4JYAJ 2B4UA 4F3MA 5GAEI 2PO4A 4ZITA 5HROB 4DMZA 1FD2A 2MKCA 4DPYA 2V2VA 4K4TA 2VH7A 1IKVA 1LWEB 3TZZA 4OQJA 2E5LF 4DQPA 1S9GB 1S4FA 2BRLA 1LFWA 1PC5A 1WC5A 1RWUA 2J76E 4HDHA 4LREA 2VA2A 5IXUA 2HVDA 3DRSA 2UVVA 3IRWP 3A8KA 4WIIA 5CCMA 4LQ3A 4KQZA 2ZH3A 1N36F 3HJVA 4M5HA 4U7UK 4ERDA 1UWBA 5F9LA 2I2YA 1RHUB 4PYAA 2E66A 3QGHA 1AFIA 3DM2B 4DXLA 2UV8G 3KUEA 4QYZK 1H6KX
chains in the Genus database with same CATH topology
2XYPB 2C2ZB 3D6MB 1RHMB 2QLJB 3IBFB 3R7NB 2FQQB 3GJRB 3R6LB 4ZVPB 1SC3B 3EDRB 4ZVQB 3R7SB 2HBRB 1RHKB 1ICEB 1QTNB 2Y1LB 3SIPB 2XYHB 2QL5B 1GFWB 3QNWB 2H51B 3R5JB 3P45B 1NMEB 1I51B 3D6HB 2DKOB 3KJNB 3R7BB 2HBYB 2CNNB 2QL9B 3GJQB 3IBCB 3EDQB 1RHJB 2H54B 3GJTB 2C2MB 1PAUB 4DCJB 1RWXB 2HBQB 2XYGB 2H4YB 3GJSB 4ZVSB 1PYOB 2Y0BB 1RWOB 2H48B 1RWVB 1SC4B 2CJXB 1RWNB 2C2OB 2CNOB 4ZVUB 2H5IB 4DCPB 2XZTB 1RWPB 1F9EB 3P4UB 2QLFB 1SC1B 3R6GB 4DCOB 2H65B 3KJFB 1RHQB 1RHRB 2QL7B 1RE1B 5K20B 1RWMB 1RWWB 4ZVOB 2CDRB 2C1EB 2CNLB 1IBCB 4ZVRB 2P2CB 2H4WB 3RJMB 4ZVTB 5IC4B 2CJYB 2H5JB 5IC6B 1RWKB 2HBZB 2QLBB 4JB8B 3NS7B 3D6FB 1I3OB 1QDUB 1RHUB 2CNKB 1BMQB 2C2KB 2XZDB 3KJQB 4LSZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XYP B;  2C2Z B;  3D6M B;  1RHM B;  2QLJ B;  3IBF B;  3R7N B;  2FQQ B;  3GJR B;  3R6L B;  4ZVP B;  1SC3 B;  3EDR B;  4ZVQ B;  3R7S B;  2HBR B;  1RHK B;  1ICE B;  1QTN B;  2Y1L B;  3SIP B;  2XYH B;  2QL5 B;  1GFW B;  3QNW B;  2H51 B;  3R5J B;  3P45 B;  1NME B;  1I51 B;  3D6H B;  2DKO B;  3KJN B;  3R7B B;  2HBY B;  2CNN B;  2QL9 B;  3GJQ B;  3IBC B;  3EDQ B;  1RHJ B;  2H54 B;  3GJT B;  2C2M B;  1PAU B;  4DCJ B;  1RWX B;  2HBQ B;  2XYG B;  2H4Y B;  3GJS B;  4ZVS B;  1PYO B;  2Y0B B;  1RWO B;  2H48 B;  1RWV B;  1SC4 B;  2CJX B;  1RWN B;  2C2O B;  2CNO B;  4ZVU B;  2H5I B;  4DCP B;  2XZT B;  1RWP B;  1F9E B;  3P4U B;  2QLF B;  1SC1 B;  3R6G B;  4DCO B;  2H65 B;  3KJF B;  1RHQ B;  1RHR B;  2QL7 B;  1RE1 B;  5K20 B;  1RWM B;  1RWW B;  4ZVO B;  2CDR B;  2C1E B;  2CNL B;  1IBC B;  4ZVR B;  2P2C B;  2H4W B;  3RJM B;  4ZVT B;  5IC4 B;  2CJY B;  2H5J B;  5IC6 B;  1RWK B;  2HBZ B;  2QLB B;  4JB8 B;  3NS7 B;  3D6F B;  1I3O B;  1QDU B;  1RHU B;  2CNK B;  1BMQ B;  2C2K B;  2XZD B;  3KJQ B;  4LSZ B; 
#chains in the Genus database with same CATH topology
 1VIS A;  3CO0 P;  1Y11 A;  1HNZ J;  4BWM A;  4MK7 A;  1AW0 A;  2VOD A;  3FZ2 A;  1UJ5 A;  4TN2 A;  1HNX J;  4QW9 A;  4F67 A;  5T14 A;  1MG7 A;  3L7P A;  4NEZ A;  4RUH A;  5IZH A;  3FSY A;  5GAH U;  4LSN B;  3OQ2 A;  1N34 F;  3C6T B;  2J6U A;  3KK2 B;  1GT8 A;  2CG8 A;  1X4B A;  2H1Y A;  3BRE A;  4KYZ A;  2I6W A;  3MM7 A;  1C0T A;  1NB7 A;  3AQO A;  3CDE A;  4HHJ A;  1RTD B;  2HBR B;  3UCU P;  1RA7 A;  3CE8 A;  4ECZ A;  4GKJ J;  3LGN A;  2LFV A;  2G2O A;  2AJF E;  2MSS A;  4CLP A;  4DPX A;  2QGF B;  3NCR A;  1SKW A;  4ECS A;  2ZUG A;  1LXN A;  1E6Y A;  2Z2Z A;  4OYP A;  4G3I A;  1FK9 A;  1D3W A;  2WAQ D;  2DH9 A;  2IRY A;  1FEE A;  3ZZZ A;  4PG8 A;  3V4I B;  4DR7 F;  5KFH A;  4UTG A;  2R7U A;  1F5C A;  1NH8 A;  2XWY A;  3QO9 B;  5J1E B;  2KYZ A;  3MAA A;  4F8R A;  4LF9 J;  4R0J A;  1S76 D;  2BV3 A;  1LOU A;  2V4J B;  3W65 A;  5EGY A;  1YZ6 A;  2CJB A;  4DV1 F;  2YNG B;  2DB1 A;  3K58 A;  3RB0 A;  4RW6 B;  2Z2L A;  2HW3 A;  2WVD A;  5K8N A;  1C2P A;  4OYA A;  4Q5V A;  3SYZ A;  3MCO A;  1KQK A;  3MMA B;  1UPP A;  3MFI A;  3RTV A;  2XY5 A;  2R7S A;  3GG0 A;  3OR2 B;  1JLE A;  3J7Y I;  2PFF B;  5FDL B;  1SC6 A;  3PYG A;  5A6W A;  3TR5 A;  2BKN A;  2HBQ B;  2XY6 A;  4IOC Q;  1NEE A;  4MKY A;  2K7K A;  1RYS A;  3THV A;  2XUL A;  1U6B A;  1TFW A;  2OPP A;  2QEX S;  3W5X A;  2RQC A;  1JLC A;  2QSF A;  1S77 D;  1YBU A;  4FKY A;  2NXE A;  2AF6 A;  3EZ5 A;  3D7S B;  3IC1 A;  2V8D A;  5ETN A;  4LJM A;  5GAE U;  2Z56 B;  5K8O A;  3PEJ A;  2CVI A;  1YK9 A;  3HHL A;  4LR8 A;  2MKI A;  3CCW A;  3EPI A;  4FF2 A;  3ITH A;  5B0G A;  3AH6 A;  1MWY A;  1S9G A;  2NCK L;  4N8N A;  2FLL A;  2NUH A;  3D9B A;  3SQG A;  4KBI A;  1TL4 A;  3IWL A;  5BR8 J;  3MHY A;  2H65 B;  2MYF A;  2DR6 A;  3C6T A;  3PR5 B;  4MTP A;  4KPY A;  3ZXW A;  1S48 A;  5HAO A;  5G0R A;  3PFO A;  1C1C B;  2VFV A;  3Q86 A;  3FBC A;  3MEE A;  4TNO A;  4X4U A;  2DNY A;  1XBW A;  4DQR A;  2V68 A;  2XMW A;  3D0I E;  2WCX A;  2HQD A;  4L3N A;  4L6V 3;  2GW8 A;  2U2F A;  1S1U A;  1GMV A;  4DV5 J;  3MGJ A;  2W25 A;  4DPU A;  4JV1 A;  1SH2 A;  2QN6 B;  2DNG A;  2LLZ A;  1F5A A;  2DHS A;  4MIA A;  2WK4 A;  3ZZR A;  1WOO A;  3AOC A;  3GON A;  1FK9 B;  5DLG A;  2ZH8 A;  2W01 A;  1KD1 T;  3TOQ A;  1XNR J;  4B3R F;  3R5G A;  4WZM A;  3B4M A;  1N5V A;  2DT9 A;  2VG7 A;  3HHK A;  3TO8 A;  4X4P A;  2DR8 A;  2OD4 A;  5LM7 E;  3EJM A;  5JJB A;  3OFG A;  1VGY A;  3LP2 A;  5D78 A;  4BWJ A;  5C7P A;  2BA9 A;  4RX6 A;  5A8R A;  4IOB A;  4ECQ A;  4W98 A;  1IBC B;  3DLH A;  4JI4 J;  1K0V A;  2HS0 A;  4ZP6 A;  4DR4 F;  2KVI A;  2OKQ A;  2GJI A;  4CO3 A;  1U8S A;  3GE9 A;  3H7H B;  3C16 B;  5C25 A;  2B9X A;  2DNO A;  3OR1 A;  3GQC A;  4K4S A;  4OIX A;  3BN7 A;  2HKE A;  3TAM A;  4OI0 A;  2Z58 B;  3QRP A;  3G8S A;  3BSO A;  2B9Y A;  1VQP S;  2KXN B;  3K5P A;  1CJU A;  3I0S A;  2EG1 A;  3UDL A;  4J9N A;  4RNM A;  4I56 A;  2P8I A;  3G8Q A;  4OYM A;  3K7R A;  1PO6 A;  4ILM A;  1UMJ A;  3MUT P;  4CT8 A;  1LWF B;  3M7V A;  5J2Q B;  3G86 A;  1KVK A;  3L09 A;  4NPO A;  4P2X A;  5HMX A;  1MSW D;  1VQ6 S;  3QZ8 A;  1NXI A;  4FNH A;  1BWE A;  3DRR B;  2EVZ A;  2GAG C;  2GIQ A;  1YBT A;  4KR0 B;  1R0A A;  1V6H A;  3H5U A;  3PHT A;  1K8A T;  1D1U A;  1UVI A;  4ETX A;  1SL1 A;  2VBX A;  1HMV B;  2DGS A;  1U1N A;  4OZN A;  4ZLN A;  2B6A A;  1P1T A;  3CD0 A;  2NXJ A;  3MF5 A;  3S1T A;  3PDN A;  2N82 B;  4TQR A;  4DSJ A;  3PW2 A;  3MEG B;  4Y2M A;  1M5S A;  1ROF A;  4LFC F;  3FC9 A;  1F3F A;  1XEZ A;  2PGC A;  3K57 A;  2FJB B;  3QRR A;  1VRQ C;  1GK8 A;  2GGP A;  3POT A;  3I4P A;  3T5H A;  2A6O A;  2FLP A;  1JLC B;  2E5J A;  1TKT A;  1HWL A;  4I0W A;  4KGV B;  4LRF A;  4X4T A;  3JSM B;  3R9L A;  1CC8 A;  4HI1 A;  4F26 A;  4YB5 A;  2DO0 A;  3MM5 A;  2NXC A;  4RNO A;  5J2P B;  1VS3 A;  2YBV A;  5M2R A;  3NKY A;  5ADZ A;  3BO3 A;  1H73 A;  1H2V Z;  4M5N A;  3ZTQ A;  2ZVS A;  1TMM A;  5CD4 A;  3IS9 A;  4LF7 F;  1YIJ S;  3CJS A;  2DKO B;  1AUS L;  3DYA B;  5L8R C;  2GV1 A;  2BQ3 A;  2PMW A;  2J6S A;  4H4K A;  4ICL A;  4BBY A;  3WX8 A;  4EO6 A;  2UXC F;  2V8H A;  3AFG A;  4P71 A;  4C8N A;  3T19 A;  4DQI A;  1U1L A;  2F1F A;  4RW8 B;  2JLE A;  2DK2 A;  2KXF A;  3FKB A;  4LQ9 A;  2RQ4 A;  1RT4 B;  3M32 B;  1MLA A;  1RAF B;  4YEA A;  1IKW A;  3NOC A;  5LXY A;  2PEH A;  5EX0 A;  2R9L A;  5HP1 A;  2NR0 A;  2RUS A;  3NS5 A;  2IYG A;  4DFP A;  1VBZ A;  3H5Y A;  4O44 B;  5LT5 A;  2XQC A;  2IM3 A;  2QG9 B;  2YWG A;  3FBB A;  2BRK A;  3OJS A;  4ECY A;  3RYL A;  2X1A A;  4NLO A;  1Q8I A;  2AJ2 A;  5IT4 A;  5KFB A;  1OY6 A;  4KGZ B;  5SZT A;  1S72 S;  2DPJ A;  1FVQ A;  1UZD A;  4JI0 F;  2HFO A;  4LR9 A;  2FVR A;  5KFU A;  1TL1 B;  4JP8 A;  4DS5 A;  2UUB J;  3MOJ B;  4DSF A;  1X4F A;  2B5J B;  3JSY A;  3MUV P;  2KJW A;  3K5O A;  4HLB A;  2V9K A;  2KFY A;  2NQP A;  4WTO B;  1C0U B;  2WW8 A;  3AJ2 A;  1TZ0 A;  2YKN B;  3AOA A;  2IM0 A;  1GTE A;  2CJ9 A;  3LAM A;  5ETQ A;  2UUC F;  4A8S A;  2VFR A;  3T1Y F;  2VOP A;  3G6V A;  4DFJ A;  3N9U C;  2QJ3 A;  4PXB A;  1CUL A;  2EI5 A;  3ZNU A;  4CLZ A;  2R2T A;  4L76 A;  1T3N A;  2BDP A;  2ILZ A;  2BKP A;  3POT B;  4CNY A;  2BJ3 A;  2C3Y A;  2I5J A;  1IWG A;  1ITP A;  5IT0 A;  1KON A;  5DJB A;  5HVH A;  4AT1 B;  4GRS A;  3E01 B;  5THW A;  3IRX B;  4ZMM A;  3CCE S;  2VPZ B;  4KH0 B;  2EFP A;  4WK3 A;  3MM5 B;  2FTR A;  3OVS A;  3OUY A;  5AXK A;  2Q43 A;  3WQP A;  4A8M P;  1HMV A;  4IDK B;  2C1E B;  2DD8 S;  4J90 A;  3OJU A;  3MTK A;  2ZBC A;  4F0M A;  4PWD B;  1PSD A;  3AOD A;  2LQJ A;  4FYY B;  2G2Z A;  1IUJ A;  1OY8 A;  1X0P A;  2KB2 A;  2FHK A;  4M5J A;  3RJM B;  3UD5 A;  1L3T A;  4FNI A;  3MEC B;  4F02 A;  4LMZ A;  1RA6 A;  5F0W A;  2YH0 A;  5EX3 A;  9RUB A;  1T9Y A;  1RBO B;  2KG0 A;  4JB8 B;  3CB4 A;  1JNR B;  5E7O B;  2ZM6 F;  3EX7 B;  2Y1J A;  4ANC A;  1FJG F;  2EFO A;  3LA0 A;  4DR5 J;  4F4Y A;  1HBN B;  5HP1 B;  2Z2M A;  1IBL F;  1LQ9 A;  2BX6 A;  3M8Q A;  1PGZ A;  1RAG B;  5GVQ A;  2CIM A;  2ZWO A;  4MMO A;  5CYJ A;  1EJ7 L;  3J81 U;  1U47 A;  1HNX F;  5CYM B;  3NNC A;  3H4D A;  4V1A k;  4L75 A;  1XER A;  2YX1 A;  2M52 A;  3DKD A;  4AUK A;  2UU9 F;  1F2G A;  2BJ7 A;  3FCW A;  2JH3 A;  2DVI A;  3DLL Q;  1X8D A;  4XDC A;  5LMU J;  2B5J A;  2K3I A;  1SQE A;  2DXF A;  2HAF A;  1F5B A;  2G4B A;  4HR2 A;  4PQU A;  5FII A;  4EFA C;  3T1A A;  1FXD A;  3DRR A;  3EDR B;  1N56 A;  3M8Z A;  4ALZ A;  3ZTP A;  1S4E A;  4K2X A;  3JTN A;  3MMB B;  1N88 A;  1U09 A;  2AU0 A;  1V3R A;  1TL5 A;  2IM2 A;  3DDK A;  3C2P A;  3HP6 A;  1HHT P;  3VGT A;  4DUZ J;  1T0T V;  3L4B C;  4O3S A;  4W90 B;  5LMN F;  5B0B A;  2QL5 B;  4EO8 A;  4NYO A;  2FUG 9;  3BBC A;  1BGX T;  5C42 A;  3R2C J;  3H25 A;  3QMQ A;  1NK7 A;  1UA1 A;  2BOP A;  5GAH I;  2WVB A;  3VZI A;  2X3D A;  2MQO A;  2F9J A;  2E9Z A;  1X5S A;  1QJH A;  1KTQ A;  2F40 A;  3Q22 A;  1T03 B;  1S1X A;  2BAB A;  1PJ7 A;  3BV8 A;  3CWJ A;  2EFV A;  3RAM A;  1UPM B;  3SCJ E;  4URG A;  2QL9 B;  2XLJ A;  4PXC A;  1KTV A;  3CCJ S;  1VK3 A;  2AJ0 A;  4FN5 A;  1U1P A;  1LWE A;  1N8R T;  1X7V A;  4AYB D;  2PC6 A;  4NAS A;  3CCQ S;  2IHR 1;  2QFI A;  2VPY B;  4Y6I A;  5HAT A;  3D0G E;  4NCA A;  2WB4 A;  3UW1 A;  4DCJ B;  2HNZ B;  5IV3 A;  4MYU A;  3OHB A;  1RWX B;  4DPT A;  2RS2 A;  4C97 A;  1S0M A;  1FRJ A;  2NPF A;  5IWA J;  4C11 B;  4RU9 A;  1YLX A;  3RBE A;  3NBP A;  2CAJ A;  2DNN A;  2HFZ A;  2PFD A;  4ED2 A;  3IA0 A;  4ETZ A;  1VR6 A;  4ZP9 A;  2RH3 A;  5D8H B;  2CPZ A;  2JX2 A;  3CUN A;  2CQ4 A;  2BOA A;  3FBE A;  4OJ1 A;  1PBA A;  2JEI A;  2Q6B A;  3I9V 9;  5K8M A;  5CYM A;  2DNQ A;  5DDR C;  2L41 A;  2CQH A;  4O4R A;  4IFV B;  3FNN A;  1UZH A;  1FX4 A;  1NJZ A;  4NLV A;  1VQS A;  1WC4 A;  3K0J A;  3PRD A;  3O8W A;  3CXC R;  1N5S A;  1HQ2 A;  2FYX A;  2KM8 C;  4A8Q A;  3W9I A;  3QJP A;  4X4N A;  1VK8 A;  1Y3K A;  3QFW A;  4LFB J;  2GNK A;  2VG6 A;  4M5G A;  3FVY A;  4RUC A;  4K0K F;  1KVJ A;  1R0B G;  3ZZY A;  3UNY A;  4MKB A;  2JEF A;  1BXN A;  3N0V A;  1XQI A;  3GPA A;  5LJ3 Y;  1WOP A;  3SXL A;  1K1Q A;  4EGL A;  1UVM A;  4AL5 A;  1V3S A;  2HGL A;  3CC4 S;  4I2Q B;  5FDL A;  1XMB A;  3WZ0 A;  5C5J A;  1P1L A;  2W9C A;  3BBF A;  4LF1 A;  5HN0 A;  3G2X A;  1YG0 A;  3MCM A;  3VTI A;  5HL7 Q;  4DWI A;  2ZDO A;  2ZHA A;  3ENW A;  2P6T A;  2F8M A;  1OS5 A;  1VI7 A;  1YRX A;  3GB0 A;  1Y7P A;  2C2N A;  4DOZ A;  1WHX A;  3WDO A;  5D6G A;  4C2M A;  5AE3 A;  4B3T F;  1R43 A;  8RUC A;  5FLX U;  3LW5 C;  1M1K T;  2KHD A;  2F3J A;  1S1X B;  2F4V F;  4FXD A;  2VFS A;  1Q79 A;  1KBR A;  4ZVF A;  2CJY B;  2W4P A;  2H3E B;  2LQ9 A;  1BWV A;  1T9V A;  2OPS A;  3Q83 A;  1VQM S;  3OXF A;  3VGU A;  2I38 A;  3AD7 C;  2NXU A;  5E41 A;  1WDT A;  3OFE A;  1YKW A;  3Q23 A;  1ULR A;  4WFB Q;  3D6F B;  3BSC A;  4M5K A;  1YJN S;  4PAB A;  1NLK L;  4L74 A;  5GAD U;  2CPE A;  4ZVG A;  2IFX A;  5J1N A;  4JI8 F;  1JNZ B;  4CO0 A;  3MPV A;  2UV8 A;  4F7V A;  2O3D A;  4TKT A;  2XSJ B;  1FRL A;  1UL3 A;  3ISZ A;  3VVT A;  4B3O A;  3IRX A;  3J7Z T;  3GMG A;  5C2C A;  4J9R A;  2AW0 A;  4NZ7 A;  3RB6 A;  3MED B;  1Y10 A;  3M8S A;  1RTZ A;  2KRR A;  2V6A A;  2POK A;  4KFB A;  5E3Q A;  4Q0B A;  3W7B A;  3IAS 9;  3CDW A;  4MK8 A;  3KJV B;  4JYA F;  3MMC B;  2QO3 A;  1RU1 A;  2MZR A;  2GJF A;  3I4H X;  4G1P A;  1DBD A;  5E3R A;  3VCD A;  5KFK A;  5AJ3 J;  3OTO F;  1Q7L B;  3HVR A;  4ECT A;  1JWW A;  4M8L A;  2HRY A;  4OJG A;  2LEC A;  5B09 A;  3HHN B;  1RTJ A;  8AT1 B;  4QWA A;  4DR7 J;  4OZ0 A;  4QYR A;  4F3Q A;  2AGP A;  4F50 A;  2RQM A;  3KFW X;  4C6A A;  3IR5 B;  3VAF A;  2HQC A;  2CPH A;  3AB2 B;  5E0O A;  2V8P A;  2XYH B;  1VC6 A;  2I9S A;  4FF3 A;  4NMX A;  2HHT A;  3Q2T C;  4XO0 A;  4JI1 F;  2RHQ B;  1XTZ A;  1NM2 A;  2MHN A;  2X7I A;  4NI2 A;  5HJX A;  3OSP A;  1U1R A;  4IRC A;  1SKS A;  2ZH7 A;  2YH1 A;  5DM7 Q;  1NRK A;  2B4O A;  3IGV A;  4FYV B;  3KOA A;  1FRM A;  1ZPW X;  2IAJ B;  5LL6 d;  1WTF A;  2W2P P;  5DG9 A;  4X66 F;  2UUT A;  4RW9 B;  4FDF A;  4ZKA A;  4QR0 A;  2BW7 A;  3OTE A;  3MI7 X;  1TVR A;  2KYX A;  4PXE A;  4TYB A;  2MDA A;  3B78 A;  2J0W A;  1RTH B;  2WSC C;  1PAU B;  2KKH A;  2B51 A;  4NLT A;  3OD2 A;  3KLI B;  4DV7 F;  4QU7 A;  2HPU A;  2VAS A;  4RW6 A;  4FPI A;  2LA4 A;  2VQE F;  2BMB A;  2J8A A;  2Z57 B;  3GTY X;  4DX5 A;  3CMA S;  2UVW A;  4JV5 J;  4U96 A;  4YFU A;  2D3Z A;  2EPI A;  2QMX A;  2BVZ A;  1WDD A;  1Q0N A;  1JJH A;  3UNG C;  1HL6 A;  2QA2 A;  3P6Y C;  4GO7 X;  4IH7 A;  5KOX A;  4B9U A;  4C3L A;  4A8O A;  3S01 A;  4WYL A;  2VKR A;  5AXN A;  2C3O A;  5L1I A;  4ZCK A;  3V81 A;  4OX6 A;  4LF8 J;  3QJJ A;  2VL1 A;  3JXO A;  4HHU A;  1IBM F;  1SC1 B;  2ROG A;  1H98 A;  2BJE A;  2XMU A;  2ZVI A;  4FYW B;  4QQB A;  2YWW A;  3SDE A;  1HPZ A;  1WEX A;  2FJA B;  1E6V B;  3CT9 A;  3HD2 A;  4C98 A;  1J5E F;  2DHG A;  1TAQ A;  2PEB A;  2UUW A;  3MEG A;  5EWF A;  3D2W A;  1NSA A;  4P6Q A;  5GAD I;  3L3C A;  4UOC A;  3SSS A;  4OHZ A;  4UW2 A;  2HGN A;  2F7V A;  2KVQ E;  3M2R B;  2DY9 A;  3M6U A;  3OVB A;  3P3D A;  3G9C A;  4EU0 A;  5G0R B;  5KFA A;  3W2W A;  3OLA A;  1QAY A;  2EKY A;  2VG6 B;  2R8G A;  4WXO A;  3BR9 A;  1T05 A;  4CIO A;  3LP0 B;  4ZCI A;  4F4X A;  1FE4 A;  3DXS X;  1RT1 A;  3MTJ A;  1VQ5 S;  3TA1 A;  2CNL B;  1XMO J;  1RTD A;  5IT9 Y;  1Q7Y T;  1M5V C;  1CJK A;  3CJT A;  3B4D A;  3A8E A;  5KOW A;  3HDS A;  2CWK A;  2Q1L A;  2EXU A;  3FUY A;  3OPK A;  3MPU B;  3HO1 A;  3KNA A;  3G87 A;  1HWK A;  1ZM2 A;  2Q6C A;  3VAH A;  4DF4 A;  1B70 B;  2R2U A;  3QRQ A;  1HWJ A;  2HMI A;  3VZH A;  4Q7A A;  2VV5 A;  1R8H A;  1SBR A;  4KV8 A;  3CCL S;  3C19 A;  1HBU A;  3UDE A;  2VQE J;  4YR0 A;  3U02 A;  2V2Q A;  4RPF A;  3W61 A;  2XZD B;  4TU7 A;  3H0P A;  1EZZ B;  2VOO A;  1NU4 A;  5B0A A;  5F8G A;  4HI2 A;  4CLK A;  2XYP B;  2UU9 J;  2XHC A;  1H74 A;  1B99 A;  2L9N A;  3IO1 A;  4L3K A;  4UF4 A;  5DQG A;  3Q8S B;  1HR0 F;  2R8K A;  2BXJ A;  2MQM A;  1X5O A;  1YDL A;  3B82 A;  2VC1 A;  2DGW A;  3MCN A;  1RAD B;  2IMW P;  3CD7 A;  2YWE A;  3DLG A;  4MH8 A;  2XS5 A;  4LUB A;  1UFW A;  4DS4 A;  1HNI A;  4Y2I A;  4NE9 C;  1XJW B;  4ZJL A;  1NPK A;  5BXI A;  1S9E A;  2DR5 A;  2RQK A;  2XSJ A;  4C0B A;  3M9O B;  3LPE A;  3TJ9 A;  2J7K A;  5JVG Q;  3V6D A;  3IBW A;  4LRB A;  3THT A;  3TVK A;  3UCG A;  3H4B A;  1R8A A;  1REG X;  1Q86 T;  3S8S A;  3J7Y U;  5D4L A;  1FRI A;  4DV6 F;  4OI6 A;  3VGV A;  2X1G A;  2XMJ A;  2ZJR Q;  4YB6 A;  5MAO A;  3PY8 A;  3DOL A;  4LSL A;  4RU2 A;  3NNH A;  2AJ1 A;  1WD6 A;  2WB1 D;  1CQM A;  2MQQ A;  1H7X A;  1VQL S;  1VQN S;  5IT9 U;  2IDE A;  3MAH A;  1WC1 A;  3DLK A;  3P45 B;  5HLF A;  1R0C B;  3P49 B;  4KO0 B;  1MML A;  2ADB A;  2W2M P;  1N54 B;  2MQ8 A;  4FVM A;  4WIQ A;  2QZ8 A;  5CHC B;  4Q44 A;  2RU9 A;  5EWE A;  2PN6 A;  1UVJ A;  1F60 B;  2YXL A;  2FHJ D;  3CDA A;  4YS2 A;  4ZVE A;  5CZV A;  1KLM B;  2UVR A;  4ZJQ A;  2HHH J;  3R5A A;  4V19 J;  1C4C A;  2RJZ A;  1FEH A;  3V4M A;  4J9Q A;  3IXQ A;  3TJA A;  1QTM A;  2H4Y B;  3K8V A;  3CJ0 A;  5LSO A;  2CQB A;  2WVE A;  5IFM A;  1HFE L;  3FMW A;  4O3R A;  2UXB F;  2YWH A;  1UFK A;  2B56 A;  2Y1I A;  4OX8 A;  1S9F A;  1SC4 B;  4PG6 A;  2XC9 A;  2B0G A;  5D3G B;  2WW4 A;  1WI6 A;  2DR7 A;  3VAJ A;  2UUB F;  2MKH A;  2ZD1 B;  4CH7 A;  1RP5 A;  2WHO A;  3DGP A;  3PO5 A;  3EVW A;  1VBX A;  1OQ6 A;  4DFM A;  2E1R A;  2AX1 A;  2WOM B;  4MIB A;  2VQF J;  3MM6 B;  2M2B A;  2QMW A;  3CD5 A;  2VG5 B;  4DSK A;  2BKO A;  2E1M C;  4FPR A;  4CO4 A;  2N7C A;  1CJU B;  4PG4 A;  5F8I A;  4NWB A;  3VAI A;  4DEZ A;  4ECU A;  2OPQ B;  4MT1 A;  2P5V A;  3KJF B;  2AKW B;  2LCW A;  1RLD A;  2LXU A;  1YWX A;  2IBO A;  3R5C A;  3VR1 A;  4FS1 A;  2J0Q D;  2DJW A;  2M8H A;  3Q89 A;  2FJX A;  3FBF A;  3K5L A;  2CVE A;  4XTT A;  4B9M A;  4F2S A;  1HNW F;  1NHV A;  4OYZ A;  4DU8 A;  2QL7 B;  3ENQ A;  4DR5 F;  2XB2 D;  5K9F A;  4CO5 A;  1D0E A;  2DIU A;  5KFS A;  3TAP A;  5CH7 B;  1FTC A;  3PG9 A;  4NL5 A;  2WSF C;  2QFJ A;  3PFE A;  2CQ0 A;  1AZS B;  2AQ4 A;  1HW8 A;  2ZZM A;  3DRS B;  3PIP Q;  1FFG B;  4PAA A;  1UEU A;  2K8G A;  1S9E B;  2GQC A;  1KOO A;  2XLK A;  2FB0 A;  4J9U E;  2GA7 A;  3I5B A;  5L38 A;  1B7F A;  3KNG A;  4YP3 A;  4K50 A;  4WK1 A;  1G2E A;  4PUO A;  4CYU B;  3HPO A;  4YHH J;  3JSM A;  2NZ4 A;  2FDN A;  4NLS A;  2G1D A;  3BYP A;  4K59 A;  5J2P A;  3HHL C;  4EK2 A;  1VFJ A;  3DOL B;  3M6X A;  4LSL B;  4N56 A;  2ZH1 A;  3KLE A;  1VDH A;  2YKP A;  1F9H A;  3IS9 B;  1IQT A;  1U0S A;  3ZC4 A;  5IWA F;  3BN4 A;  3DLK B;  2ROP A;  4R8U B;  5D0G A;  3QJL A;  4PXD A;  3NXZ A;  4B9V A;  2NLW A;  2OGU A;  6FD1 A;  3KHG A;  4RUA A;  5IV4 A;  1O0P A;  2CPI A;  1NDP A;  3FQL A;  4FP9 A;  2DGO A;  4I2Q A;  4AQY J;  1RT4 A;  3M32 A;  3NGR A;  4O3N A;  4NLQ A;  4G1I A;  2W9C B;  5D0E A;  3C15 A;  3KUH A;  1KLM A;  3EGN A;  5CA5 A;  1VQ4 S;  5J2N A;  3M2U A;  3CED A;  4BC7 A;  1RKJ A;  2FC9 A;  2X3G A;  3MPD A;  1RT2 B;  4EMD A;  3C6U B;  2YQ1 A;  4I64 A;  2CXE A;  3ENA A;  2FVQ A;  2DNP A;  3PJ9 A;  4F36 A;  4IRK A;  1XR7 A;  2BE9 B;  2CA9 A;  2E9T A;  1MU2 B;  3C8Y A;  5C24 B;  5D0R A;  4LRD A;  4PWW A;  1DTT B;  2GIF A;  2V4J A;  3I0R B;  3CCM S;  4LF5 J;  3CPW R;  3X3U A;  1N33 F;  3F0N A;  2KG1 A;  1CS4 B;  2RE1 A;  1G1X A;  4CLU A;  1GFW B;  1EAY C;  5IS2 A;  1IM4 A;  1S6O A;  1JLG A;  1IR1 A;  4LF4 J;  4QYZ J;  5A8K B;  3UO0 A;  4KHP F;  2A2D A;  5F3Z A;  1WC3 A;  3ILJ A;  4WF9 Q;  2MKY A;  1IKV B;  3IFE A;  4USK A;  3BQ0 A;  2MLZ A;  1FCA A;  1SQG A;  4ILR A;  2B43 A;  4I6W A;  4PEO A;  4Q2M A;  4ZPW R;  3PX6 A;  3H98 A;  2FHO B;  3M9N B;  3DI6 B;  4KSE B;  3MEK A;  5U47 A;  5IM0 A;  3GYX B;  2FY1 A;  5KFW A;  1HNI B;  1R89 A;  3BSA A;  4QWB A;  3GJT B;  1RT5 B;  2C2M B;  2CWX A;  4CTA A;  2QA1 A;  3BBB A;  5EHH A;  4J9O A;  4KO0 A;  4RO0 A;  2R4F A;  1S12 A;  4IKA A;  4PKD B;  1EIY B;  3I6P A;  3U1L A;  3TUI C;  1WOS A;  1IBL J;  2CPD A;  4DLG A;  1NPR A;  3K5M A;  1YTY A;  2KT2 A;  1C4A A;  5KT4 A;  1REV B;  2CJX B;  2K2P A;  3NCP A;  5ETP A;  4P7V A;  4UST A;  2QLW A;  2HSE B;  2DYA A;  1TV6 B;  4M95 A;  3MMJ A;  5DQH A;  1IM6 A;  5ETV A;  2OFG X;  3JYT B;  1KFS A;  1XWL A;  3HUL A;  3W63 A;  4RNF A;  1JX4 A;  1S0V A;  5DM6 Q;  1APS A;  4H4K C;  4B3O B;  5ETR A;  2O01 C;  3HVA A;  3UFC X;  1WF2 A;  3A8I A;  2XO6 A;  3JSB A;  1N5Y B;  3KLG B;  1S1V A;  2OI2 A;  2JHE A;  5KFM A;  2R7X A;  3AJ1 A;  2L08 A;  3RAX A;  1VOM A;  3N5B A;  3O1L A;  1HKA A;  1T02 A;  3LAK A;  4YQW A;  2PMH A;  1S6Q A;  2AMC B;  2YNH A;  3IMQ J;  3M1V A;  3DCA A;  3TX8 A;  5KFN A;  3CW2 C;  5IQ6 A;  1HQU A;  1G6B A;  1S6P A;  5KFV A;  4UZC A;  1WSV A;  2JLF A;  1FDN A;  1AUD A;  1DY3 A;  4ITS A;  3RRG A;  4LF5 F;  4C4W A;  3MM8 B;  1J5O B;  5HVF A;  5J1P A;  2UP1 A;  4FXW A;  4GVL A;  4USW A;  3FRZ A;  1B4S A;  3MPW A;  4P2M A;  5KG4 A;  1ELO A;  4USV A;  5DO2 A;  3FCV A;  3GSD A;  3QT5 A;  3TW0 A;  3SV3 A;  3CIM A;  4OYI A;  4UQT A;  4E8U A;  3HSG A;  3THP A;  3QT7 A;  3UCZ P;  1WNE A;  1VBY A;  3BF4 A;  2DH8 A;  4O44 A;  3TZX A;  1OSD A;  2W2Q P;  2DNR A;  3VAG A;  1EAR A;  3M2U B;  4DR6 J;  5L46 A;  3R5B A;  2N4C A;  5EDW A;  5HQM A;  4BCA A;  3EYZ A;  3HKZ D;  5KT6 A;  4KTQ A;  1K47 A;  3PEH A;  2EG2 A;  3EZU A;  2HVH A;  4B17 A;  2H5E A;  2HG4 A;  1DQA A;  1JLQ B;  1LWF A;  3PRB A;  3QLH B;  3BDP A;  4LF2 A;  2OH2 A;  2JEJ A;  2VPX B;  1DTQ B;  5H9E K;  1S57 A;  4K4W A;  2KT3 A;  4KKO B;  3DRX A;  1RK8 A;  5E5N A;  1DAR A;  3T6J A;  2MLX A;  1RB0 A;  2PT0 A;  2MST A;  2A3J A;  3BM7 A;  1YHQ S;  3NMA A;  2HHS A;  3MPY A;  3T1H J;  1JLG B;  3D1O A;  5CD4 H;  4ZP7 A;  5L9X A;  2OO4 A;  2OPS B;  4DSE A;  2AWZ A;  2YTC A;  3PCO B;  1WAC A;  2HNY A;  1KR4 A;  2YWF A;  3PW4 A;  3AD9 C;  4U9R A;  3RR8 A;  3IBF B;  4ZA1 A;  4ID5 B;  3TAR A;  4GVB B;  4JI7 F;  3M30 B;  3G82 A;  4HEA 9;  4HH1 A;  4KIA A;  4QZV B;  4RUB A;  1PIL A;  3J81 j;  2YNF A;  4NA3 A;  3GIL A;  1SB6 A;  2V34 A;  1NKB A;  4K7Q A;  1TMJ A;  1RT6 B;  4JUZ A;  4B9S A;  1U25 A;  3K5N A;  3GU0 A;  3KLF A;  3OL9 A;  1I94 F;  3M1V B;  2HHW A;  5GAG U;  3OXG A;  3OTB A;  1BE4 A;  2R2S A;  2DPI A;  1N32 F;  4ELT A;  2IRU A;  4NYP A;  4GC7 A;  2M88 A;  2IBK A;  2ZFH A;  1TTH B;  3MR7 A;  4A46 A;  2XMM A;  3A1Y G;  4ED3 A;  1N6Q B;  2MZS A;  3A3O B;  1T9T A;  4DSL A;  3UD3 P;  1KHV A;  2H51 B;  4DL5 A;  3KDN A;  1Q5Y A;  1UCN A;  5E3A A;  1RTJ B;  1QLN A;  2LYV A;  2VDI A;  1O5J A;  1RT7 B;  1Y5L B;  3ISN C;  3C3L A;  2U1A A;  3BGR B;  3ZZU A;  2AP6 A;  3OL6 A;  4LF6 J;  2LQ5 A;  2VD3 A;  1B0T A;  5FJ4 A;  2F8H A;  4G1Q B;  5KT5 A;  1S1U B;  3HHD A;  4GKK J;  1N0V C;  1HIY A;  3DXB A;  2ALY B;  3GIK A;  4USJ C;  2E5G A;  2XTJ P;  1LW2 A;  5KFF A;  3ZNJ 1;  3WC0 A;  3D67 A;  4JI3 J;  4NLW A;  5J2Q A;  4ZVS B;  1MU2 A;  4DV2 F;  4LRA A;  1S7I A;  4HTJ A;  2KFN A;  3AXM A;  3IR6 B;  1RWV B;  3LAL A;  1SI9 A;  3WHI A;  3ZZP A;  1HI0 P;  2HZV A;  2XO7 A;  4TVA B;  4WBF A;  2V69 A;  2RF2 B;  2UVU A;  1KQS R;  1FJG J;  2PE8 A;  2H5I B;  4IG3 B;  4CH0 S;  3GV7 B;  3OL7 A;  1RLC L;  1U6Z A;  1M90 T;  3K59 A;  5AE2 A;  3SZ2 A;  3LWM A;  5C42 B;  1HBO A;  2AT1 B;  2WZ1 A;  4YR2 A;  4Y00 A;  2PA8 D;  2V2K A;  2XHW A;  3A3P B;  4NLU A;  1WEL A;  2HFV A;  5HJY A;  4DR4 J;  5KFX A;  1IR0 A;  5A76 A;  2MLY A;  1DTQ A;  3QAT A;  4PG5 A;  4RLE A;  3AD8 C;  5FD1 A;  3VF0 B;  1X31 C;  7FD1 A;  4YB1 P;  2HQ3 A;  4WU2 A;  2XMA A;  1NK0 A;  2DNL A;  4B3R J;  3K2Y A;  3CVK A;  2LVW A;  4AL7 A;  2KZM A;  1ZZF A;  1GXT A;  2RIL A;  3ZZO A;  2MHE A;  3MFH A;  4X84 A;  4B02 A;  2MEW A;  1EP4 B;  1ZAX A;  2OSR A;  1S1W B;  3CDU A;  2BM1 A;  4TY8 B;  4O3P A;  1U8W A;  2C3U A;  3QPI A;  4OYB A;  4DV3 F;  1N5Q A;  1PBU A;  2L9D A;  1FDB A;  3FCH A;  1BQX A;  4A8K A;  2XY7 A;  4N76 A;  4DZD A;  4FF4 A;  1UP1 A;  2QSW A;  4MK9 A;  2DBB A;  2MQP A;  2RRA A;  1ZZN A;  2P9C A;  1D9F A;  1RYR A;  4QU6 A;  5F0U A;  2DR9 A;  3I9Z A;  2CQ1 A;  3H2V E;  4NXM F;  2DIV A;  2HQI A;  1TL3 A;  4J9V A;  4UQG A;  4U95 A;  5KG6 A;  1WJ9 A;  4ZVT B;  2CQG A;  4DV0 F;  1LXJ A;  5HMZ A;  3VQS A;  3M8R A;  3FSI A;  2HQF A;  1RWK B;  2HBZ B;  2ZOG A;  3E51 A;  3GR1 A;  1PAE X;  3EM1 A;  4FYX B;  5KAK A;  5KG7 A;  2B8P A;  3SEO A;  4ED8 A;  1P6T A;  3G6Y A;  3QIP B;  4J9K A;  1JKH A;  1UVL A;  4DUY J;  3KMS A;  1VLO A;  2RD5 C;  4JV5 F;  1AB8 A;  1RAI B;  2ASJ A;  1B64 A;  1SH0 A;  4IG0 B;  2GFF A;  5JVH Q;  1HBM B;  4ZHR B;  1X9S A;  2EKN A;  1FRX A;  2DCU B;  3BGO P;  4OX7 A;  1DJ0 A;  1TUG B;  2Z2Y B;  2JOQ A;  1SUQ A;  3MM8 A;  4UOG A;  1RT7 A;  1J5O A;  4NLX A;  3QT8 A;  1SIZ A;  4ZLP A;  2H9Z A;  1TL1 A;  5HI7 A;  3BGR A;  4L72 B;  5A2Q U;  3ZTS A;  4H4M A;  1V5I B;  2DGX A;  2JWN A;  3GG1 A;  1I1G A;  1HQE B;  2RKI B;  4ZCM A;  4ZN3 A;  4ZIV A;  4HH0 A;  4AND A;  4NA1 A;  2QA4 G;  1HBO B;  2VJU A;  3HI9 A;  2HEK A;  2YPZ A;  5D4N A;  2HYI B;  2Z0G A;  2O67 A;  1LW2 B;  3D1Q A;  4DG1 B;  1YJV A;  4ZVQ B;  3BGU A;  4CCH A;  2VJV A;  1H0H B;  5F8J A;  5AJ3 F;  1YSJ A;  3D1H A;  2W9A A;  2OJ3 A;  2QLX A;  3S7R A;  4A8F A;  2XEX A;  4IR9 A;  2UXB J;  3CCT A;  3HSJ A;  1OMS A;  1NK5 A;  3UD4 P;  3SIP B;  2GX8 A;  4B3T J;  5HVG A;  3UE2 A;  2G1H A;  2K3K A;  2M7S A;  1Y00 A;  3H20 A;  3ITH B;  3KLF B;  1IXK A;  3PV8 A;  2ILY A;  1HNZ F;  1JLE B;  2UZA A;  4U8Y A;  1AZS A;  2HWI A;  2HNZ A;  3HFV A;  4DQS A;  2ZEJ A;  1D8Z A;  3HZG A;  3BPS P;  2IJF A;  1RBL A;  4GMK A;  4NZ6 A;  4ID5 A;  2HIY A;  4XDD A;  3UPF A;  1VIX A;  1N36 J;  3V2U C;  4ES3 A;  3MM9 A;  1OO0 B;  2DH7 A;  3IWN C;  2EK1 A;  3TNV A;  5LJ5 Y;  1QVF R;  1WSR A;  2GJ2 A;  3PW7 A;  3HCX A;  1S0O A;  1JB0 C;  5D0H A;  3HHL B;  2JJ4 D;  4IRD A;  2OUG A;  5KT3 A;  1HBN A;  3NEK A;  2CQI A;  2OHD A;  3DLJ A;  3OBI A;  5HMY A;  1X4C A;  3KLE B;  2VDH A;  3M8Q B;  3QAU A;  3IM8 A;  5E3C A;  4DV7 J;  2CQP A;  4ZLJ A;  4I6A A;  2CQD A;  2OAU A;  4DL4 A;  3I5C A;  2W4D A;  1KS2 A;  3DNC A;  4YB7 A;  3OTO J;  1O8B A;  3W5Y A;  3TRG A;  2HRU A;  2DGQ A;  1Q4R A;  2XZT B;  3QYY A;  4IFY A;  4MFB A;  3T41 A;  3W9J A;  6AT1 B;  1KSP A;  1Q16 B;  1DQ9 A;  2CZ4 A;  1EX8 A;  1M5P C;  2HLT A;  1JLB A;  1U6F A;  3EGW B;  4F0H A;  3CSK A;  3ILI A;  3R6G B;  4DCO B;  1X5T A;  1HNW J;  2Y8W A;  1R7I A;  3DDN A;  4J5O A;  4OLP A;  1WHV A;  5J2N B;  5KFO A;  3TA0 A;  5KFC A;  1N0U A;  3KK3 A;  1ZA1 B;  1WKL A;  4RW4 A;  3UDV A;  2MGZ B;  5KFG A;  1FD8 A;  3KHR A;  1FNX H;  2OIH A;  2MZQ A;  4R5P B;  5BJR A;  5B0F A;  1FWL A;  1MMD A;  2CUY A;  3DU5 A;  3EVO A;  3KXD A;  5JXS A;  1T9U A;  4A4J A;  1ACM B;  2DIT A;  1IKX B;  1OIA A;  1EHW A;  1YGY A;  3BPD A;  4CO1 A;  3OHA A;  1TK5 A;  1EET B;  5I3U B;  3AA9 A;  4DLE A;  2AHO B;  3QO9 A;  5J1E A;  1I94 J;  3UR3 C;  1VCT A;  2I0X A;  3ZTO A;  3CCS S;  5EWG A;  1VJQ A;  1PYS B;  2DXD A;  3JQM A;  2RF2 A;  2XMV A;  2RDI A;  4EBC A;  2OLW A;  3LQV A;  1HYS A;  2ZZN A;  4I2P A;  4ZPT R;  4RW7 B;  3SI8 A;  2FJE B;  2GMH A;  1NK9 A;  1L3U A;  3W9H A;  3CF5 Q;  2D3O 1;  3PYF A;  4K4Z A;  5IC6 B;  1TK0 A;  3AJD A;  2XGP A;  3M2V B;  3MD1 A;  1U49 A;  3EXC X;  1X0F A;  1RT5 A;  2KL8 A;  4CLF A;  4DN0 A;  1WHY A;  2MKJ A;  2V8G A;  2W4C A;  4JI2 J;  1C1C A;  3NS7 B;  3H5X A;  4P72 A;  4ED4 A;  3US5 A;  3R8Y A;  1TKZ B;  3H59 A;  3MED A;  2RSQ A;  1KOH A;  4ZCL A;  3FGV A;  4HVZ A;  4YN3 B;  5ETT A;  4DX6 A;  4ECR A;  1KVI A;  1S6P B;  3AA8 A;  3T5K A;  4LF4 F;  1JJC B;  2MKS A;  3R1H A;  4AL6 A;  1RHM B;  2QLJ B;  3M2R A;  2VZ9 A;  4C0O C;  1FO1 A;  4IG0 A;  3RW6 A;  4ECV A;  1ZPV A;  2CPY A;  2B3T B;  3M05 A;  1T05 B;  1SC3 B;  4KB7 A;  3F44 A;  1FWK A;  4OX9 F;  4E2F B;  1FXR A;  1NB2 A;  2VBY A;  1RT1 B;  1Z2L A;  3RZA A;  2EC0 A;  3MR2 A;  1F6T A;  1VHI A;  3MDF A;  1EKS A;  3NGK A;  5KTQ A;  4Z2X A;  5A6P A;  2W9B A;  1NO8 A;  1BHN A;  2K1R A;  2VA3 A;  4IOA Q;  5F8H A;  2KZZ A;  1OYE A;  3EUN A;  3W3S A;  2GHV C;  4PCQ A;  3CJ8 A;  4Z7Y A;  4X4O A;  3J7A N;  1X9M A;  4DHV A;  1S99 A;  2ZBQ A;  3HZE A;  4C8K A;  5E33 A;  2UXD F;  3IG1 A;  2IMO A;  4OLO A;  2DNM A;  3D6T B;  3HFK A;  4RWW A;  1U02 A;  4P2F A;  3T5L A;  2AEM A;  2BAC A;  5I42 A;  4LF6 F;  1NHU A;  3D6H B;  1WUU A;  3BEG B;  4I69 A;  1OQ3 A;  4P74 A;  3EIC A;  4C3K A;  4CT9 A;  3JAM Y;  1VBK A;  2ATC B;  1HNV A;  1MRO B;  2CNN B;  4HT5 A;  1D8Y A;  3GP9 A;  4RW4 B;  1YX2 A;  2XM3 A;  1S59 A;  3U1M A;  3SSR A;  3HJF A;  2OD6 A;  3IP0 A;  3ILL A;  2ATL A;  2VFT A;  1JLA A;  1NSP A;  1UEV A;  2D69 A;  2R7Q A;  3EGV A;  1RI7 A;  1AYE A;  2HFS A;  3F41 A;  2O5D A;  5KG2 A;  3KK1 A;  4OFZ A;  5CAA A;  2YKM B;  5BYR A;  2GHP A;  3CO9 A;  3Q8U A;  5B08 A;  1CJV B;  1FJE B;  4HL9 A;  4RL1 A;  2FZG B;  2ZHO A;  2BUN A;  2EC2 A;  1T9W A;  3N79 A;  2D74 B;  1RWN B;  2DHA A;  4KC5 A;  3LWL A;  5T7L B;  3PAC A;  1TKT B;  3MD3 A;  4ZLL A;  1VHF A;  4BC9 A;  3FEZ A;  3H2U B;  2CNO B;  4URS A;  3PO4 A;  3DGV A;  4OHY A;  1R0A B;  3FRY A;  1LWC A;  2HK2 A;  3PTW A;  2R42 A;  4RR5 A;  1RWP B;  4FYD A;  2GZO A;  2IM1 A;  3RRH A;  3NY0 A;  1G7C B;  1ZA2 B;  1WTB A;  1A0O B;  2QLF B;  3VHQ A;  2G9O A;  3PKY A;  4F4Z A;  1REV A;  1UJ4 A;  2EEY A;  2VB6 A;  3EWG A;  1ZM9 A;  4KHP J;  2HVZ A;  3NAH A;  5L1L A;  4CLT A;  1KC8 T;  4IYQ A;  4X64 J;  1WG5 A;  1UWB B;  2MZT A;  2OML A;  5CQG A;  5A8W A;  1X9W A;  4Q8F A;  1FJ7 A;  2AGQ A;  3W1Y C;  4R8U A;  3RBD A;  1JK9 B;  4XPC A;  3AY0 A;  3KLG A;  4GKK F;  2W7P A;  2QE5 A;  3DOK A;  1M1H A;  2A18 A;  1YJR A;  3BKT A;  4P10 A;  4QW8 A;  4AXJ A;  5F9N A;  4ZVO B;  4K4X A;  1N32 J;  1TAU A;  1TQL A;  3HSD A;  1XC9 A;  2KFZ A;  3KK3 B;  2VON A;  1CQN A;  3RBX A;  4TQS A;  4NI2 B;  4ELU A;  2MGZ A;  1CJT B;  1W25 A;  2PA3 A;  1N52 B;  3CJK B;  2FJD B;  1RT2 A;  1WI8 A;  2P9G A;  4TYA A;  3GFZ A;  3HT0 A;  1X4E A;  3K17 A;  5DS7 A;  3M4X A;  5K8P A;  4C8Z A;  4A8X A;  2VIH A;  4ED1 A;  2YKQ A;  1URN A;  1KQG B;  2BJD A;  4NXN F;  1LK5 A;  3QFH A;  4WTY A;  4C3M A;  2CDQ A;  3MMB A;  3I0R A;  3LP1 A;  1SPB P;  3BGL A;  2CPX A;  1UAW A;  3AHP A;  3SCI E;  1HI1 A;  5CZX A;  1CBK A;  1NUE A;  3KHL A;  3W2V A;  5ITH A;  1KFD A;  1H7W A;  2Y8Y A;  5DGB A;  3V6K A;  3BSN A;  2EW9 A;  1J27 A;  4I2P B;  5CAB A;  1PJ6 A;  2YVS A;  3B54 A;  5LMU F;  2XCP A;  5KG5 A;  1YJ9 S;  3J7A 1;  5K14 B;  2HVE A;  2JDJ A;  2OMO A;  2YKA A;  3KG0 A;  5F8L A;  2AX0 A;  1JMT A;  5DLF A;  3M8W A;  3D6M B;  2R2R A;  1ZTT A;  1RAO A;  4XAK A;  3UDC A;  4M5D A;  5AT1 B;  2QTW A;  2JFD A;  3PW5 A;  2WON B;  3MUM P;  2NS1 B;  5IQQ A;  5DDQ C;  3VAM A;  1HPZ B;  3KLI A;  4ZVP B;  2RAQ A;  1N4L A;  3OFH A;  1P9Q C;  1KRP A;  2O1P A;  3QWU A;  4DUT A;  2HIQ A;  2HNY B;  1ZYQ A;  1U1M A;  4P73 A;  2XMT A;  1FXL A;  3UVJ A;  4Z37 A;  2KHC A;  1SL2 A;  2HWH A;  4U7U D;  2GML A;  2DY1 A;  1VC5 A;  4PUO B;  2PI5 A;  1UW4 A;  1AFJ A;  1ZET A;  3A4T A;  3SSQ A;  4KT0 C;  3UN2 A;  3ILO A;  3J81 Y;  3IN5 A;  2GVD A;  3EE3 A;  3KUG A;  2IRX A;  2JL9 A;  3QIP A;  3OUY B;  2EK6 A;  3R5J B;  1CPZ A;  2ZKT A;  4TU9 A;  2KN4 A;  2ASD A;  2CJK A;  3HVW A;  1UET A;  4NYZ A;  1IWA A;  1Q1K A;  5KFI A;  3UN5 A;  3QZ7 A;  1Q8B A;  5KFT A;  2JVR A;  1D09 B;  5A8R B;  1CSJ A;  2CZV C;  2X51 A;  3KJN B;  4OI2 A;  4WCE Q;  4KRW A;  4RNN A;  4IR1 A;  3O5T B;  2HND B;  1PYT A;  2QMU B;  3ETO A;  4J37 A;  2ZNY A;  4TY9 A;  4DQQ A;  3KTQ A;  1FKP A;  4JI2 F;  4OI1 A;  1UTA A;  4KGM A;  1RHJ B;  3D68 A;  2R7W A;  1U1Q A;  4J7C A;  3TAM B;  4M1K A;  1SJF A;  3SBM A;  1NJY A;  1TKX B;  3U7J A;  2ZD1 A;  1XNQ F;  3T1Y J;  1WEY A;  1DZ5 A;  2XYG B;  2RB7 A;  4TLQ A;  3ULH A;  3GJS B;  1N33 J;  1F3V A;  4KPC A;  3R5D A;  3J80 U;  2D1C A;  2FLN A;  5HK4 A;  1SJ1 A;  3O44 A;  3PRV A;  2ZDP A;  5KT2 A;  1XNQ J;  1E6Y B;  1W2B R;  4DL0 C;  2ZJQ Q;  3ZZ0 A;  4H54 A;  3H8Y A;  1UWA A;  4JI6 F;  2RVJ A;  2KXH A;  4X4Q A;  2Y0S D;  1TUW A;  2JNJ A;  1A9N B;  2GQ2 A;  4FF1 A;  3HKW A;  1FHT A;  3OR1 B;  4OX9 J;  3QWP A;  3CJR A;  2LDY A;  4Q45 A;  4Z7C A;  1HQE A;  2RKI A;  3I32 A;  4Q43 A;  3D4J A;  3L7U A;  4BDP A;  4ATN A;  4CWB A;  1YVF A;  1VRT B;  4I1T A;  1GXU A;  1KDN A;  4YR3 A;  1L3V A;  2NXN A;  4G6V B;  2ABY A;  3KG1 A;  3GYN A;  1DLO A;  2RRN A;  3A12 A;  1IBK J;  4LVN P;  2GO8 A;  3QQC D;  2V9W A;  5IM0 B;  1XNR F;  1MWZ A;  1YJW S;  3CJ3 A;  3G71 S;  2HFN A;  3D3C J;  2YNI B;  3GCX P;  1BQM A;  2YKM A;  1BD6 A;  5BYQ A;  1U48 A;  4GVB A;  2PMZ D;  3OL8 A;  1CJV A;  2V67 A;  2LEB A;  1NPP A;  2IY5 B;  1H38 A;  1QSS A;  5B0D A;  2YNF B;  4EYH B;  1UVN A;  5DG7 A;  4KGX B;  2AD9 A;  5T7L A;  4QCL A;  4ZPD A;  2ZOF A;  4Y0F A;  2FLO A;  2N3L A;  5EN1 A;  1Q53 A;  2BAN B;  3DOK B;  2B6A B;  1N34 J;  2HHU A;  2NSC A;  2CJA A;  1LV5 A;  1TEL A;  4B9L A;  2ALZ A;  1SJ3 P;  1HD0 A;  1FRH A;  1RU2 A;  3V6J A;  4K8R A;  2H5J B;  2CQ3 A;  2KTQ A;  1QE1 B;  5HSP A;  1GAO A;  4LFC J;  5KFR A;  3V6H A;  4WFY A;  2HLU A;  2HAI A;  2L3M A;  1X4D A;  2XI2 A;  3TVY A;  4DN9 A;  1F2H A;  7FDR A;  2J8S A;  3PX4 A;  1UFL A;  1UA0 A;  1NKC A;  1MWQ A;  2CNK B;  4WP8 A;  4M5M A;  4E98 A;  1VMB A;  2OSQ A;  3C15 B;  1KN6 A;  4LT6 A;  4ZP8 A;  3KJQ B;  2AYE A;  2ZOM A;  2ZZT A;  1IR2 A;  4LSZ B;  1AA1 B;  2QC3 A;  2ZNZ A;  4EBE A;  4ED6 A;  2M4M A;  2AGO A;  4LF9 F;  2C2Z B;  3MZI A;  1M5K C;  1Z2Z A;  1H3D A;  1CJT A;  2HND A;  2KI2 A;  4RW9 A;  1RGV A;  2COL A;  2I1R A;  3EZO A;  5AXM A;  2PD1 A;  2AEF A;  3HHE A;  3M9M B;  1IBM J;  3PYD A;  4NA2 A;  4DV6 J;  4CH1 A;  1R31 A;  2HFU A;  4RZR A;  3BH7 B;  4PQA A;  1FKO A;  4XPE A;  2YPY A;  1SIW B;  4KHM A;  4ED7 A;  4DX7 A;  2G13 A;  3H5S A;  4OYO A;  4USI A;  3H42 A;  3QSY B;  4OJ3 A;  3RG6 A;  4M5I A;  2Z4P A;  4CI0 B;  5B7W A;  1HWU A;  1ICE B;  2J9E A;  4C8M A;  5HO4 A;  3QLH A;  1FJC A;  2XWX A;  4ZPA A;  1UKU A;  2OP5 A;  2JVO A;  3CIZ A;  2IAJ A;  4DR6 F;  2SXL A;  2YWK A;  1R8B A;  5ETL A;  1T3O A;  4J9P A;  2MY8 A;  4B3M J;  4B3S F;  3RAQ A;  4WKR A;  2OEJ A;  3Q0A A;  1CC7 A;  2A10 A;  2L9W A;  3W62 A;  1H2U X;  1BLU A;  1XIQ A;  2E44 A;  2L48 A;  2QV6 A;  2Y9H A;  2ZH9 A;  4DV4 J;  2DO4 A;  4ES1 A;  3DM2 A;  2E7V A;  2V8V A;  2F4F A;  4WFZ A;  2DCL A;  4JV0 A;  3SFU A;  1ZTW A;  1U45 A;  2WVF A;  4K4V A;  4DV5 F;  2HHQ A;  4CQ1 A;  1M0S A;  5KFL A;  4K5S A;  2OFH X;  1OWX A;  2ZUA A;  1HHQ A;  2DNZ A;  3OT9 A;  3TWZ A;  4X65 F;  2WBM A;  4RW7 A;  1CUL B;  2ASY A;  3NNA A;  3EDQ B;  1T8E A;  1I5O B;  4EYI B;  2XNR A;  3N6M A;  1RAC B;  3CMQ A;  5DET A;  5HQ8 A;  3DYA A;  1IKY A;  1QSL A;  1X4H A;  1K1S A;  3W2W B;  2HZC A;  4HYK A;  3FK4 A;  1RWO B;  5KG0 A;  3TUP A;  3F73 A;  4P75 A;  1YIT S;  2EFQ A;  4OI4 A;  5EUH A;  4ECW A;  3Q8Y A;  2GC8 A;  2DEJ A;  4C7Q A;  1TL3 B;  3L95 X;  4G65 A;  1TK8 A;  1R6V A;  2GVD B;  2M9K A;  3M6V A;  4DCP B;  2GVZ B;  2JSX A;  1VRU A;  3GIM A;  2CPJ A;  2V4Q A;  3RB4 A;  3P4U B;  2J9C A;  2A6M A;  3DOM A;  3LPY A;  2XGQ A;  4PPZ A;  3NGU A;  3MMC A;  3FMB A;  5H9F J;  3IG1 B;  3PR4 A;  4JOU A;  4YDX A;  1QY7 A;  4O4G A;  3P8B B;  2LMI A;  3G6X A;  4C48 A;  4JBC A;  3CC7 S;  1M5O C;  4OHV A;  3TEH B;  1SKR A;  1TR0 A;  4NRT A;  4IFY B;  4MFB B;  3NOG A;  2HHH F;  2C2E A;  4RW8 A;  2J9D E;  3CD6 S;  4WWS A;  4PRF A;  2EBE A;  2AJ4 A;  2LQB A;  1WHW A;  1RE1 B;  3MMA A;  1FTR A;  4IH5 A;  4X62 J;  1RWW B;  4E0D A;  3OLB A;  2AV5 A;  1TL7 B;  4QOT A;  2CYY A;  2YY3 A;  4TU8 A;  3FQK A;  4M5L A;  4P52 A;  3PVX A;  1FFW B;  2IPO B;  3ET6 A;  1NND A;  5A8K A;  2E9R X;  2J7U A;  2MTL A;  4FVC A;  3BZQ A;  5L39 A;  2OPP B;  3MAA B;  3VVU A;  3NGD A;  2UXD J;  4NXN J;  1DQ8 A;  2E7X A;  4F3O A;  4DR2 F;  5BR8 F;  2F9D A;  1HD1 A;  3I31 A;  4LF8 F;  4JI3 F;  4ES2 A;  1GMU A;  2VKZ G;  1XMO F;  3I87 A;  3RGI A;  3UQS A;  1ARO P;  3SCK E;  2FD2 A;  1NZ8 A;  4DR3 F;  3KLV A;  4CM0 A;  2R7V A;  2Y3Y A;  3PJX A;  4B9T A;  1ZH5 A;  4DJB A;  4MKA A;  5G4D A;  4Y2C A;  4HTI A;  2OPR A;  2BE2 B;  2ADC A;  2NYI A;  3DLG B;  4P9S A;  3GFY A;  1U0H A;  4UZB A;  3NGS A;  5I4M A;  1T7P A;  1RAA B;  2Y1R I;  1NJI T;  2EFG A;  3WX4 A;  2QT7 A;  1GMW A;  3LOU A;  3JYT A;  1MN9 A;  1U2C A;  1QM9 A;  5DRK A;  1YQH A;  2PDA A;  1ZM4 A;  3E01 A;  3V6D B;  2B7C B;  2J5A A;  2MB0 B;  4MJK A;  1NH7 A;  3NWG A;  3DN9 A;  3TA2 A;  2W7A A;  4ID8 A;  4Y65 A;  2KT5 A;  2ZC4 A;  3BR8 A;  2MXY A;  3E8O A;  3HT3 A;  2CQC A;  2ACM A;  2E1C A;  4ZDN A;  4YY3 F;  2VG7 B;  3CUL A;  4QPX A;  2IIH A;  1VQ8 S;  1S6U A;  3LP2 B;  1ZAW A;  3TAQ A;  2HWT A;  1IKY B;  4DV3 J;  4LIW A;  1RHK B;  2VC0 A;  3A13 A;  1QD1 A;  3PJW A;  5A0Y B;  3C16 A;  5C25 B;  5MLC V;  2ASL A;  2BYC A;  5L1J A;  3R2D J;  4LBP A;  2XCA A;  1N5T A;  1O6X A;  2R7O A;  2KU7 A;  3GSI A;  4MYT A;  5I3Q A;  3R1L A;  4D3G A;  1VQ9 S;  1FT8 A;  2V0N A;  3LP0 A;  4NEY A;  4HAC B;  3TQE A;  2LKZ A;  4B3S J;  3MM6 A;  4V19 X;  3OSN A;  4ELV A;  2HUR A;  1JXV A;  1YRU A;  1Y5N B;  2G2Y A;  1BY9 A;  1WF1 A;  1ZBT A;  2HGM A;  3AT1 B;  3D28 A;  3PW0 A;  4OYW A;  2V63 A;  3HVT A;  4CNZ A;  1NJX A;  3LGM A;  2GO9 A;  4RNH A;  5AXL A;  5DDO C;  3FDS A;  1MN7 A;  1SUQ B;  3R7B B;  1FWP A;  4NLY A;  3DHX A;  4H4O A;  4OJH A;  2QX0 A;  4OV1 A;  3Q8P B;  2RNE A;  3JQK A;  4OL8 A;  5D3G A;  1WKJ A;  4WE1 A;  1IKX A;  2A2C A;  4Y3C A;  5F3T A;  4DR3 J;  1VQ7 S;  3FEX B;  2ZJP Q;  3ISN D;  1QAX A;  2IDL A;  2IC3 A;  2YNG A;  3PNI A;  4D3H A;  1TUV A;  1R3N A;  1W26 A;  4DV2 J;  3DRP A;  4MIW A;  3QBC A;  4J9M A;  4U6P A;  2R7R A;  3OR2 A;  1U0H B;  2Z30 B;  1S49 A;  3HD1 A;  3UVJ B;  1Y3J A;  2C2O B;  3T5J A;  2DRA A;  2AYM A;  4UUX A;  4ZVU B;  1IQZ A;  4OYX A;  1O51 A;  3KK1 B;  1TP7 A;  3CGI A;  2ZH2 A;  3TI0 A;  2HZA A;  1SXL A;  2P9E A;  1F9E B;  4O23 A;  4N47 A;  4C0H A;  4ILL A;  4F4A A;  2F4V J;  3K89 A;  3MR6 A;  1DUR A;  1SCJ B;  2WON A;  3JS9 A;  2DXE A;  4OZJ A;  3GII A;  5JUM A;  4K0K J;  2FZC B;  1YBA A;  3MR3 A;  1QUP A;  4J91 A;  4CM2 A;  1Q95 G;  3DHW C;  1RHQ B;  3KG4 A;  1VQO S;  5M2U A;  4B3M F;  2GMJ A;  3EMT A;  1RHR B;  3NCQ A;  4JI8 J;  1WG4 A;  3A3N B;  3N4W A;  1DHM A;  4XIU A;  4X62 F;  3TZW A;  3BO4 A;  4LVO P;  3A8J A;  1NHK L;  2IJN A;  1DRZ A;  4RBT A;  2FGO A;  4NCG A;  1K44 A;  4JI0 J;  3WC2 A;  5HLF B;  3KK2 A;  2CDR B;  1T95 A;  3ENV A;  3M8P A;  2N4D A;  2AYG A;  4LFB F;  2YQ3 A;  3D54 A;  4K4U A;  1RT6 A;  3P5T L;  1VIO A;  1Y5I B;  3GR0 A;  3NAI A;  3UI3 A;  3W8G A;  3ZFV A;  3BYR A;  3RB3 A;  2E5L J;  2BJ1 A;  2K1R B;  5D4P A;  3HFZ B;  4G1Q A;  2ERR A;  3T9Z A;  1EQ0 A;  5IC4 B;  3DOM B;  2MPU A;  3KHH A;  2V50 A;  2GHW A;  3NWR A;  2QLB B;  2ZHB A;  1RAJ A;  2DRD A;  1T94 A;  3OW2 R;  1R27 B;  5KFY A;  1TKX A;  2XNQ A;  3DRY A;  4F04 B;  1I3O B;  1QDU B;  2YKN A;  4NX9 A;  4K4Y A;  4H4M B;  4IQX A;  1SJR A;  2WSE C;  2VBW A;  1KQF B;  4IO1 A;  2H4W B;  2FGC A;  2P2C B;  5J2M B;  4JV2 A;  4WU3 A;  4R5P A;  4KJI A;  3SFG A;  3E3X A;  3HLU A;  3W2V B;  4EZ9 A;  2WOM A;  1Q8L A;  4N5S A;  1Z1Z A;  2DIS A;  1OSC A;  2XI3 A;  1NDL A;  2RUG A;  1XR5 A;  2F65 A;  5GMK a;  1FA0 A;  2OPR B;  3ET6 B;  1K73 T;  4F25 A;  2UUA F;  2D3U A;  2FQQ B;  2D9P A;  2VUG A;  2XS2 A;  1EET A;  5I3U A;  4CP5 A;  2ZWP A;  2XSF A;  4ECX A;  3SMZ A;  2CKW A;  2NYH A;  3R6L B;  4ANE A;  1BQN B;  4ZJO A;  4DUY F;  1V9O A;  3I55 S;  4NLD A;  4IDK A;  4O0N A;  5IOL A;  2W8L A;  5D77 A;  1GX5 A;  3TX0 A;  5KFP A;  1VLY A;  1RT3 A;  2Q3P A;  4ZPC A;  1HLW A;  4KY3 A;  1U1K A;  4Q8E A;  1IN0 A;  1B7Y B;  2QA4 S;  4R25 A;  3EVM A;  1B0V A;  1Q81 T;  4PWU A;  3N6N A;  4CLW A;  2KM8 B;  1Q78 A;  3V5R A;  3DMJ A;  1B0P A;  3T9N A;  3NP5 A;  4W4M A;  2IVM A;  4PYD A;  4KH1 B;  4M94 A;  2DTJ A;  2RU3 A;  4XK8 C;  2LU2 A;  4OHX A;  1CEZ A;  4DL7 A;  2KRB A;  2ZC3 A;  1RXO B;  1U2R A;  4HT7 A;  4M63 A;  2VU5 A;  3TYT A;  2FJV A;  3U1N A;  1I51 B;  4FKX A;  3U27 A;  5A8W B;  2A1B A;  5HQL A;  2LU1 A;  2GQQ A;  5ETS A;  2CRL A;  3WIV A;  1S5Z A;  2MZ1 A;  2QYG A;  2BBE A;  1XMQ J;  1UVK A;  4HAC A;  1N5Y A;  2RS8 A;  1RAH B;  1TU0 B;  1M5H A;  2BZ2 A;  2O66 A;  4N7T A;  2H54 B;  1FNM A;  2DHH A;  4RBU A;  3LAN A;  3MEC A;  5CCL A;  1NK6 A;  1QE1 A;  4RBV A;  1PG5 B;  1TV6 A;  3BGF A;  1L5U A;  1JJ4 A;  1S1W A;  3LGH A;  3DFE A;  1Y9O A;  1HBM A;  3GFX A;  4LIR A;  2BM0 A;  4R0E A;  5I3P A;  4ZHR A;  1SJQ A;  3DC2 A;  2Y0B B;  3QGG A;  1HBU B;  4OZ2 A;  2H48 B;  2F63 A;  4UOF A;  1TVR B;  1JJ2 R;  4UY8 T;  3QAE A;  1KHW A;  3BS9 A;  4BS2 A;  4I4B A;  4IO9 Q;  2LP4 A;  3BB5 A;  2IC3 B;  3H90 A;  1BUX A;  3NLC A;  1HQU B;  1KP6 A;  2G0C A;  2E29 A;  1RBA A;  2JRS A;  2RRB A;  4UOH A;  4WP3 A;  2M8D B;  5DGA A;  5KG3 A;  2J0S D;  3CCU S;  4B9N A;  4NXM J;  4DR2 J;  3GYG A;  3QGP A;  4O3Q A;  4DPO A;  3ZTR A;  1J2V A;  4Y2K A;  2JC0 A;  3J80 Y;  4Q2L A;  2AEJ A;  4USU A;  1WKK A;  2HK3 A;  5JMN A;  1QAI A;  1URR A;  2R7T A;  1VJW A;  1ZS6 A;  2DHX A;  5HMW A;  5LMN J;  2DGU A;  3CJQ A;  4ZPB A;  3LTO A;  2MQL A;  1RWM B;  3RUB L;  4C8O A;  2FC8 A;  4A8Y A;  2V2Z A;  1P8G A;  4C8L A;  4AFF A;  3N6L A;  3MAQ A;  2AZ1 A;  3Q8R B;  3TVZ A;  5C2G A;  2E7W A;  1SVD A;  4PZV A;  1HI8 A;  2M5Y A;  2BQU A;  2C42 A;  1NAQ A;  1QAJ A;  1LFP A;  3ICL A;  1FNO A;  2BW2 A;  2I5J B;  3D5M A;  1BQN A;  3HX9 A;  3VWS A;  3KYL A;  2IA6 A;  3HHL D;  1RIS A;  1FES A;  1F1B B;  2NUU G;  4RKU C;  1T03 A;  1VQK S;  1DFD A;  2CPF A;  1CLF A;  2MQN A;  4NCG B;  3FSX A;  5D15 A;  1CG2 A;  1S1V B;  4CTA B;  3HXM A;  2C2D A;  4CRJ A;  2ZE2 A;  2B7B B;  3PKM A;  4ZOS A;  4ENO A;  3D3B J;  5BYS A;  5DDP C;  3HK2 A;  3X1L B;  1E6V A;  1X4G A;  2AZ3 A;  2ACY A;  3PIO Q;  5KT7 A;  3DMJ B;  4X2B A;  2HQG A;  4N77 A;  3ZZT A;  1AT1 B;  4OZ3 A;  1S1T B;  1MW7 A;  3C14 A;  3H2L A;  4BLG A;  2RIJ A;  2QIF A;  1LW0 B;  1LNQ A;  1IBK F;  3I96 A;  4BHQ A;  3R97 A;  3ADA C;  1UEK A;  2CFX A;  3AXK A;  3D0H E;  4OHW A;  2F5G A;  3DGP B;  1RTI A;  3FFI A;  2ZBI A;  4NCB A;  4N41 A;  2XS7 A;  2FHM A;  2AIR B;  2ZKU A;  1VRU B;  1FFS B;  1JLB B;  2DEI A;  2E5H A;  3MUR P;  3JSR A;  5B0C A;  2VG5 A;  1TKD A;  4J9S A;  5CXT A;  4A8W A;  5GME A;  1NBE B;  1WWH A;  2C3P A;  3OFF A;  3JAM U;  4DDF A;  1CJK B;  3NL0 A;  4HDG A;  2M70 A;  2Q79 A;  4IUF A;  2XLI A;  1JLQ A;  4DI6 A;  5F8M A;  3GIR A;  3LF0 A;  3I82 A;  1GX6 A;  4QPT A;  5LOQ A;  4U67 Q;  1V5V A;  4DL6 A;  1D9A A;  1QTN B;  4MKV A;  5CYQ A;  8ATC B;  5I42 B;  2JC1 A;  2XBP A;  4FXV A;  4DUZ F;  3T3F A;  1NK8 A;  4HKQ A;  1G4C A;  1RZM A;  1FDA A;  1TL7 A;  2EFN A;  4UT4 A;  5DZ7 A;  1LEO A;  3QNW B;  2MJN A;  1RT3 B;  4OZ1 A;  1C0U A;  4OMF G;  4UY8 5;  2HRT A;  2AJQ A;  1RAE B;  4I67 A;  2GAH C;  3CDB A;  1NCL A;  2OPQ A;  2UXC J;  5K14 A;  4WPA A;  4A48 A;  1HHS A;  2JLG A;  4J9L A;  1WEZ A;  1F0X A;  2C22 A;  4ED5 A;  4RWX A;  2J9D A;  3VAK A;  2EWH A;  4B08 A;  3GJQ B;  1RCO B;  1F9F A;  1MMN A;  4NLR A;  1T9X A;  4I7F A;  4EEY A;  1Q5V A;  1IJE B;  1KLN A;  2QRR A;  4IQM A;  5KFZ A;  1FRK A;  1RKI A;  1KKH A;  2CG4 A;  2C3M A;  3NGT A;  4Q0B B;  1C1B B;  4NLP A;  2HHX A;  3CNQ P;  3GV8 B;  3MOZ A;  4JI5 F;  4UUW A;  4WJB A;  3I56 S;  4LFA F;  4YDD B;  3SQO P;  2FY8 A;  1HYS B;  1WOR A;  2PSZ A;  2VQF F;  3OXL A;  1Q82 T;  1A6L A;  2HVI A;  1SV5 B;  2CAD A;  1R8P A;  3NS6 A;  2W2N P;  1VQY A;  2B9W A;  3NBP B;  3OV7 A;  3M2V A;  4LFA J;  4KE5 A;  2G0I A;  4AXI A;  5LSR A;  4CYU A;  3TAN A;  2D7S A;  2RDJ A;  2WVC A;  4DV1 J;  4QIW D;  1RDR A;  3AAW B;  4L73 A;  2C2R A;  1YI2 S;  1TKZ A;  1H2T Z;  1LKZ A;  4ZVH A;  2X1B A;  2K7J A;  3KWM A;  4USH A;  4AE5 A;  3DLB A;  1GQE A;  2M3D A;  3B6B A;  1SJ4 P;  4JI5 J;  4YOE A;  1JLF B;  3CJK A;  4X65 J;  4FS2 A;  4N8O A;  4CLS A;  5GMD A;  3KLH A;  1FER A;  1FKP B;  1OYD A;  5HAN A;  4YUD A;  5K20 B;  2BR0 A;  3WBZ A;  1JXL A;  5CYQ B;  1FE0 A;  4DBQ A;  5LXR A;  3HM9 A;  1PCA A;  2IJR A;  2RDD A;  4ZPV R;  3HMJ G;  1U1O A;  3CCV S;  1SQF A;  4DV4 F;  3BKF A;  4F0K A;  4JI6 J;  4DSI A;  3BJY A;  4MAK A;  1U24 A;  2ZBR A;  3VGS A;  1S79 A;  2ZIT A;  1KEK A;  4PQU B;  3IR7 B;  4EBD A;  1FKO B;  3MM7 B;  1EQM A;  3W64 A;  1KNZ A;  1XR6 A;  3VQT A;  3M8Y A;  1S7H A;  1HNV B;  1MRO A;  1NDC A;  1OJ4 A;  4ZVR B;  4EWT A;  3VAL A;  1AXQ A;  4QR1 A;  2W24 A;  2MMY A;  3PZP A;  4JI4 F;  3JQJ A;  3L9Z A;  3W5Z A;  3MR5 A;  4F4K A;  2RT3 A;  3D66 A;  4W92 B;  4WXW A;  2NSB A;  4WFX A;  5T41 A;  4WE1 B;  1Y4Z B;  3P5B P;  1YJT A;  3C46 A;  1RTH A;  3N5F A;  1HW9 A;  4CZC A;  2A0F B;  3SDE B;  1A7G E;  1VYA A;  3CJ4 A;  3BH6 B;  2KH9 A;  3CME S;  1FI4 A;  2JFK A;  3LUY A;  1V3Z A;  3QGI A;  3PHE A;  4KGK A;  3H40 A;  2XG8 A;  3GZ7 A;  4AQY F;  1NJW A;  2FIU A;  2BEF A;  4ZS6 A;  2BJ9 A;  4YHH F;  4DG1 A;  1ZOT A;  1EP4 A;  4TY8 A;  3TJ8 A;  3RR7 A;  1WC0 A;  1GH8 A;  1YJ7 A;  1ZM3 A;  1BQM B;  1Y0H A;  2I8E A;  2KDO A;  4PR6 A;  1JLA B;  3AB4 B;  3MM9 B;  2E1P A;  2OEL A;  2FPH X;  3V81 B;  3FJ2 A;  1UJ6 A;  3F56 A;  1PC4 A;  2J0X A;  4C11 A;  5KFQ A;  3RU0 A;  2W1B A;  1BC6 A;  3AQP A;  3KKF A;  1T11 A;  5SUH A;  3R7S B;  3JTO A;  3CTR A;  2NRE A;  1PIE A;  3Q24 A;  1I6J A;  2ZE2 B;  1NSK L;  2B4P A;  2NZC A;  2QYC A;  4GKJ F;  1JLF A;  4PPD A;  1RAB B;  2YX4 A;  2W7O A;  4Y2A A;  3KJV A;  3KLH B;  3MXH P;  4IFV A;  1M1G A;  5KFJ A;  2IVY A;  1SV5 A;  5KG1 A;  2HMI B;  1S1T A;  3C14 B;  2FZK B;  2LXI A;  3J7Z 5;  4KV8 B;  5D4O A;  1LW0 A;  2HHP A;  2D3O R;  5A0Y A;  4O4G B;  4DF8 A;  3MCS A;  3K8W A;  3HSZ A;  4LBH A;  2BJ8 A;  3WIU A;  3PX0 A;  5H1S V;  5J2M A;  4IH6 A;  3CCR S;  1IKW B;  1XMQ F;  4WKY A;  3DLE B;  2OEK A;  1FX2 A;  3W8P A;  2W2O P;  3E2E A;  2LA6 A;  1GMW D;  4LF7 J;  3NRB A;  1HAR A;  3IAM 9;  4TLR A;  2PI4 A;  1SL0 A;  2KO1 A;  3GCW P;  3TZY A;  1R8C A;  2ZH5 A;  2OTL S;  1JKH B;  2P6S A;  3UWT A;  3HVT B;  1WG1 A;  3S6E A;  4CLY A;  4X64 F;  1DAX A;  3BQ1 A;  4QR2 A;  1Q8K A;  2AYB A;  4NZ0 A;  3G6E S;  5K5M A;  1H72 C;  3UN3 A;  4KHR A;  2MJU A;  1IJF B;  1PYO B;  1X5P A;  1QUV A;  2J6T A;  2OTJ S;  3TP2 A;  2VF3 A;  3KDO A;  1OPI A;  2FHJ A;  4USM A;  1FVS A;  4EZ6 A;  2LDI A;  2EBG A;  1YJU A;  5HBM A;  4F4W A;  3LP1 B;  2WBR A;  3O6Q A;  4CDI A;  2B9E A;  3ELH A;  3W66 A;  1L3K A;  2R8I A;  4LBI A;  1ZAV A;  3B8H A;  1RCX B;  7AT1 B;  4QBU A;  2ZH6 A;  4OZL A;  4EUV A;  5DZ6 A;  2BE2 A;  1YRT A;  4TXS A;  2IVF B;  2RHS B;  2WTF A;  3RBZ A;  1J5E J;  5A2Q Y;  1U26 A;  3DI6 A;  4QJV A;  1NZA A;  3ONQ A;  3LO3 A;  3N28 A;  4C9D A;  2B4V A;  3GWC A;  3EPG A;  3QID A;  4I7F B;  1UW9 A;  2VBZ A;  2IYI A;  4DL2 A;  2FJW A;  1GTH A;  2CZ9 A;  2BE7 D;  1RSC A;  1EB0 A;  1WF0 A;  2JZ5 A;  5AE1 A;  4DFK A;  4PWD A;  1W2I A;  5M2P A;  3DDI A;  1C1B A;  1GXL A;  5RUB A;  4OI3 A;  1S6Q B;  2YNH B;  3CJ5 A;  4K5R A;  2D41 A;  2Q66 A;  2DRB A;  1K0T A;  3TEG A;  3NG8 A;  4K2J A;  4LSN A;  2X1F A;  4QIF A;  4QWD A;  4NLG A;  4ICL B;  1NK4 A;  1VC0 A;  3JB9 k;  2GGP B;  2LXF A;  2XMK A;  2R3V A;  1NDK A;  2CJQ A;  4QWC A;  3ETM A;  3GV5 B;  4DL3 A;  5GAG I;  2GVZ A;  1OPZ A;  6FDR A;  4EI2 A;  4CO2 A;  2N3O A;  3CCZ A;  4WP9 A;  1LWX A;  3G96 A;  4DR1 J;  1RQ0 A;  1QSY A;  4U7C A;  1FKA F;  3M6W A;  5H9F K;  3V4I A;  2N7Y A;  1W7W A;  3MWB A;  2F8E X;  2OEM A;  1S0N A;  4CLL A;  5F8N A;  1BMQ B;  2C2K B;  2LEP A;  3PYE A;  4FZV A;  1SH3 A;  4X4R A;  3HF5 A;  2UUA J;  2LEA A;  2HS4 A;  3LH2 S;  5LSL A;  4LRC A;  1NKE A;  4O0I A;  4PG7 A;  1HR0 J;  1C0T B;  4KKO A;  1OY9 A;  3DLE A;  4NML A;  5HBM B;  3KMQ A;  4C8Y A;  2ROE A;  2R8H A;  3TUJ C;  3GIJ A;  4OV6 A;  3AOB A;  3R7N B;  2DGT A;  3BQ2 A;  5ETM A;  1JXE A;  2WRM A;  5B0E A;  3Q8V A;  3GJR B;  2FVP A;  4A47 A;  2YQ0 A;  4DZ6 A;  3UR0 A;  5HRO A;  5DG8 A;  1IVZ A;  3C66 A;  1YZ7 A;  3JTP A;  1HWI A;  4DPW A;  2J7W A;  4NRU A;  4DU7 A;  3G4S S;  1HA1 A;  1DLO B;  4F2R A;  2VIC A;  4U8V A;  2M0G B;  3Q2S C;  4P7T A;  2ZH4 A;  3FZB A;  3O2I A;  2FVS A;  4GO5 X;  2GCF A;  3G82 B;  4O3O A;  2YNI A;  3EGZ A;  1EKR A;  3R3T A;  4QIG A;  1JQG A;  2Y1L B;  2RML A;  4QIV A;  4X4S A;  4QWE A;  4ER8 A;  1D9D A;  3TUZ C;  4FBT A;  4JI7 J;  2PII A;  3EXY A;  3N01 A;  1GNK A;  3T6B A;  2VHG A;  1LWC B;  5DQI A;  3RW7 A;  3NMR A;  3W60 A;  4YME A;  2V94 A;  3RRK A;  4ZIW A;  1RUS A;  1P27 B;  1U7L A;  3SCL E;  5F41 A;  2KJV A;  2HS3 A;  2E1A A;  1WC6 A;  2D9O A;  3QT6 A;  3SQG B;  1VRT A;  1NME B;  2DGV A;  2YKO A;  3IGN A;  3G8T A;  1S10 A;  4FBU A;  3QSI A;  4X66 J;  2W8K A;  1N48 A;  1QVG R;  1FDD A;  4RJV A;  4YY3 J;  4URQ U;  4AD6 A;  2HBY B;  2K06 A;  2XZW A;  3PM9 A;  4HHH A;  2DNK A;  3ZO7 A;  1N6Q A;  2NPI A;  3BKU A;  4WFA Q;  3IBC B;  3MEE B;  1P9Y A;  2IA0 A;  9ATC B;  5L9N A;  5H9E J;  1CVJ A;  3DU6 A;  1RTI B;  3FFI B;  3M30 A;  5E3P A;  2ZM6 J;  1K9M T;  3O3L A;  2MY7 A;  2FVC A;  4LR7 A;  5E2Q A;  1MNE A;  5ETO A;  1X4A A;  3OVA A;  4DV0 J;  4KFB B;  3SV4 A;  4ED0 A;  4Y28 C;  1FF2 A;  2E5I A;  3M8P B;  4I68 A;  3FEY B;  1KWM A;  2VFU A;  1RJJ A;  2APO A;  2G0J A;  3BDE A;  4I6Y A;  2W9B B;  2BAN A;  2V5H G;  1PJ5 A;  1XN9 A;  4KAI A;  3VV2 B;  5L1K A;  4ZN1 A;  5C24 A;  4WFN Q;  5ETK A;  2B8Q A;  3PXG a;  2CQ2 A;  4NOH A;  2V4R A;  2BQR A;  4DX8 H;  1XK8 A;  1S97 A;  2MZJ A;  1JIH A;  1LK7 A;  1CS4 A;  2DNH A;  1PKU A;  1U2F A;  2GS8 A;  3GLJ A;  5KFE A;  4QIE A;  4P2S A;  4ZK7 M;  2JEG A;  3CC2 S;  1TFY A;  2Z8Q A;  3I0S B;  2LQ8 A;  4IG3 A;  3IM9 A;  2YX7 A;  5KFD A;  3C6U A;  2HHV A;  4WZQ A;  5FLX Y;  4GC6 A;  3TQ1 A;  2UUC J;  4X4V A;  3P96 A;  2C28 A;  4H4O B;  3BO2 A;  1X60 A;  4OZ5 A;  1U4B A;  3Q8Q B;  3T1H F;  1NSQ A;  3GFH A;  3CJ2 A;  1DTT A;  2R8J A;  4S0M A;  2MKK A;  3R27 A;  3OTD A;  2VPW B;  1SKU B;  4WYW A;  3L7O A;  3IWX A;  4M5D B;  3OTC A;  1G3O A;  1B3T A;  1L3S A;  1GEH A;  4DR1 F;  1R6Y A;  2GIR A;  2ZBP A;  4Y34 A;  3I5A A;  4JI1 J;  3DRP B;  1Z4U A;  4JYA J;  2B4U A;  4F3M A;  5GAE I;  2PO4 A;  4ZIT A;  5HRO B;  4DMZ A;  1FD2 A;  2MKC A;  4DPY A;  2V2V A;  4K4T A;  2VH7 A;  1IKV A;  1LWE B;  3TZZ A;  4OQJ A;  2E5L F;  4DQP A;  1S9G B;  1S4F A;  2BRL A;  1LFW A;  1PC5 A;  1WC5 A;  1RWU A;  2J76 E;  4HDH A;  4LRE A;  2VA2 A;  5IXU A;  2HVD A;  3DRS A;  2UVV A;  3IRW P;  3A8K A;  4WII A;  5CCM A;  4LQ3 A;  4KQZ A;  2ZH3 A;  1N36 F;  3HJV A;  4M5H A;  4U7U K;  4ERD A;  1UWB A;  5F9L A;  2I2Y A;  1RHU B;  4PYA A;  2E66 A;  3QGH A;  1AFI A;  3DM2 B;  4DXL A;  2UV8 G;  3KUE A;  4QYZ K;  1H6K X; 
#chains in the Genus database with same CATH homology
 2XYP B;  2C2Z B;  3D6M B;  1RHM B;  2QLJ B;  3IBF B;  3R7N B;  2FQQ B;  3GJR B;  3R6L B;  4ZVP B;  1SC3 B;  3EDR B;  4ZVQ B;  3R7S B;  2HBR B;  1RHK B;  1ICE B;  1QTN B;  2Y1L B;  3SIP B;  2XYH B;  2QL5 B;  1GFW B;  3QNW B;  2H51 B;  3R5J B;  3P45 B;  1NME B;  1I51 B;  3D6H B;  2DKO B;  3KJN B;  3R7B B;  2HBY B;  2CNN B;  2QL9 B;  3GJQ B;  3IBC B;  3EDQ B;  1RHJ B;  2H54 B;  3GJT B;  2C2M B;  1PAU B;  4DCJ B;  1RWX B;  2HBQ B;  2XYG B;  2H4Y B;  3GJS B;  4ZVS B;  1PYO B;  2Y0B B;  1RWO B;  2H48 B;  1RWV B;  1SC4 B;  2CJX B;  1RWN B;  2C2O B;  2CNO B;  4ZVU B;  2H5I B;  4DCP B;  2XZT B;  1RWP B;  1F9E B;  3P4U B;  2QLF B;  1SC1 B;  3R6G B;  4DCO B;  2H65 B;  3KJF B;  1RHQ B;  1RHR B;  2QL7 B;  1RE1 B;  5K20 B;  1RWM B;  1RWW B;  4ZVO B;  2CDR B;  2C1E B;  2CNL B;  1IBC B;  4ZVR B;  2P2C B;  2H4W B;  3RJM B;  4ZVT B;  5IC4 B;  2CJY B;  2H5J B;  5IC6 B;  1RWK B;  2HBZ B;  2QLB B;  4JB8 B;  3NS7 B;  3D6F B;  1I3O B;  1QDU B;  1RHU B;  2CNK B;  1BMQ B;  2C2K B;  2XZD B;  3KJQ B;  4LSZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...