1ICEB

Structure and mechanism of interleukin-1beta converting enzyme
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
88
structure length
88
Chain Sequence
b'AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTERLEUKIN-1 BETA CONVERTING ENZYME
publication title Structure and mechanism of interleukin-1 beta converting enzyme.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 16
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 1994-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1iceB00
2HBRB 3D6HB 1BMQB 4DCJB 2H4WB 3IBFB 2XYHB 3P45B 1RWKB 2HBQB 2XZDB 5IC6B 4ZVUB 1F9EB 1PYOB 1GFWB 1NMEB 3QNWB 2CJYB 2C2OB 1RHMB 2C2MB 3EDRB 3R7BB 4ZVSB 4DCOB 5K20B 1RHQB 2DKOB 1RWWB 2QL5B 1QDUB 1RWXB 1RHUB 2H4YB 1I3OB 4ZVQB 2H5JB 3R7NB 2HBYB 2C2KB 2QL7B 2QLJB 4JB8B 2XYPB 2C1EB 2QLFB 4DCPB 3D6MB 2XZTB 2H65B 3GJQB 3SIPB 2CDRB 1RHJB 2CNOB 3GJTB 2Y1LB 2FQQB 2P2CB 1SC3B 3R7SB 2HBZB 1RWPB 3R6GB 2CJXB 2CNLB 1ICEB 3EDQB 1SC1B 3GJRB 2QLBB 5IC4B 3KJQB 1RHRB 2H54B 2CNNB 1SC4B 4ZVTB 2H5IB 3R5JB 3KJNB 3IBCB 4LSZB 2CNKB 1PAUB 2H48B 2QL9B 1RE1B 2C2ZB 3D6FB 4ZVOB 1RWMB 1RHKB 1IBCB 3GJSB 2H51B 2XYGB 1I51B 3KJFB 2Y0BB 4ZVRB 1RWOB 3P4UB 3RJMB 1RWNB 3R6LB 1QTNB 4ZVPB 3NS7B 1RWVB
chains in the Genus database with same CATH superfamily
1APSA 3H8YA 3DHWC 4IR1A 1WF1A 1QE1B 4EI2A 4KAIA 3TUPA 1RTIB 1KQSR 4DL7A 1AXQA 5E33A 4DLEA 1FK9A 3BGRB 4XK8C 3PZPA 1W26A 2W25A 3BEGB 1JWWA 3KLIA 1FWLA 1X60A 3I0SA 3FQKA 1FVSA 4P71A 3CCMS 1CVJA 4AFFA 3MMBB 3QJPA 3TA1A 3T1YJ 4ZVFA 3ZTPA 1E6VA 1R27B 2EFVA 2FQQB 4GO5X 1XNRF 1N88A 3AJDA 2IA6A 1KEKA 1HNWJ 1O51A 3BZQA 2V50A 1HLWA 7FDRA 4B3SJ 1C0TA 3U1NA 1HWKA 2FLNA 3UVJA 4J9NA 3Q22A 4NLTA 5IV4A 1XMOF 2B9YA 1IKXB 2BKOA 4YDXA 3PV8A 1RHKB 4BC9A 4CNZA 2YKPA 4HDGA 3F41A 3G8TA 3A4TA 3WX8A 4OI1A 2YNGA 1RCOB 5H9EJ 1FTRA 1DRZA 3OVAA 2D74B 3EWGA 2C2DA 3NS7B 2UUBJ 4JI1J 3JQJA 1H7XA 5E2QA 2E66A 3AOAA 4DV1J 3QAUA 4XTTA 4DSJA 2HPUA 6AT1B 4JI4J 2MDAA 2V5HG 4WFZA 5B0CA 3QZ7A 3QATA 4DR2F 4CQ1A 1FK9B 2AT1B 1RHQB 2ZD1A 3GG0A 2ALZA 1SH3A 3KLIB 2R8IA 4CO3A 3I0SB 2M4MA 4TYAA 2GQQA 5D6GA 4YS2A 1K73T 1MMLA 1S49A 3H25A 5GAEI 1E6VB 3U1LA 4A8OA 4RO0A 1V3RA 1MWQA 2V9KA 4J90A 3CCUS 4OQJA 4KPCA 4CI0B 1S1WA 1IR2A 1C0TB 4LSZB 5D0EA 5ETMA 3UVJB 2HFVA 1M90T 1UW9A 2UVWA 2OI2A 3CCLS 2CQHA 4EWTA 2ZNZA 1UFKA 3DRRA 1PYSB 2NXJA 2YNGB 3HK2A 2J5AA 3ZNUA 3M8SA 2CG8A 1TUWA 4H4OA 4HVZA 4IFYA 1SJ4P 2EKNA 2ZZMA 2J9DE 1VC5A 2DNMA 2UUCF 2XTJP 5B0FA 2DRAA 2E1PA 1M5KC 3K8VA 2QA4S 1DQAA 3TANA 3FK4A 3QT6A 1UA0A 3VAIA 4JV5F 3B4DA 4C8OA 1RBLA 2ZFHA 3TI0A 2FLPA 1L3UA 1R8CA 2ZD1B 5AJ3F 3GYXB 4NI2A 1LW0A 1FE0A 1KFDA 2JNJA 1H2UX 3ENWA 4KB7A 2AYGA 2V8HA 2IJFA 4FBUA 3SFUA 1KD1T 2PMZD 1BHNA 2CNLB 5C42B 1TKTA 3MR5A 2CPHA 3NOGA 4JI3F 4X66F 2D9PA 1S1WB 4RJVA 1FCAA 4OYWA 2XLJA 2VASA 2WBRA 4BWJA 4RNMA 2W7PA 1Q7YT 1UTAA 1XN9A 3A8EA 3DRRB 4OLOA 4Y3CA 1C4CA 2QRRA 2XQCA 2HBRB 1HR0J 1KTQA 2RQKA 4K4UA 4H4OB 1NKEA 3W9JA 4IFYB 3T41A 2EPIA 4A4JA 2DR5A 1NK5A 1YJUA 3PHTA 3PR4A 3H20A 5L39A 1Q7LB 2KHCA 3DFEA 3BSNA 2AD9A 4OX7A 1VRQC 4YY3J 3NNCA 4OZ1A 3W61A 4ZN3A 1FRXA 3HJVA 4NI2B 1WOOA 1VQ9S 3BGFA 2V68A 3R9LA 1P1LA 4F36A 1RWUA 3PRDA 1EQ0A 4IOBA 5DDQC 1F9HA 3CCQS 3NLCA 2DRDA 4F4AA 3ZTSA 1BXNA 1N0VC 1F60B 1TKTB 5A2QY 5B0BA 3OTEA 4UUWA 2BM1A 2KZZA 1YQHA 3DDIA 4X4QA 3SFGA 4NXMF 1Z2LA 1HBNA 1H72C 2H51B 2WSEC 5IZHA 2VBZA 2CG4A 2CJBA 3GCXP 5JMNA 2EK1A 2AWZA 2D1CA 4UQGA 1YBUA 4TQRA 2PSZA 4QWDA 1W7WA 4AUKA 5F0WA 2DNLA 3DRXA 3CWJA 3HMJG 4YR3A 4RNHA 4ECWA 3R5GA 1RKJA 3BQ1A 3BKFA 5DQHA 1PJ7A 1MLAA 2ZWPA 2YWKA 3DLLQ 3PTWA 5ETTA 4KHRA 2FD2A 2XI2A 4MYTA 3M6VA 5U47A 1YIJS 3Q86A 4A8YA 1RT3A 3LPEA 5I3UA 2ZE2A 2GMLA 3MXHP 3J80U 4BDPA 1U24A 1UWBA 2GA7A 1HI8A 1HWJA 3EJMA 3J7A1 1T9WA 3MOJB 4ECUA 2KVIA 3UN5A 4D3HA 1RWMB 3RBXA 2VF3A 2QC3A 2UXCJ 1T9XA 4I0WA 2Q79A 1HBNB 2F8MA 4LT6A 4FZVA 3BBCA 4DZDA 2CA9A 3OXFA 1OY8A 3IRWP 3J7YI 3MWBA 3HKZD 1FNOA 3VCDA 3VV2B 3A3PB 1DJ0A 4CNYA 5HROA 4OZ3A 1FI4A 3CPWR 1K44A 1Q16B 1JJ2R 1LWEB 1Z2ZA 3NKYA 2VQEF 5CYJA 2DNOA 1XTZA 1K8AT 2K2PA 3IM9A 4RW9A 2FDNA 1B99A 2Q1LA 2CQIA 1RQ0A 4KGKA 4S0MA 4DQRA 2CQDA 1TV6A 1NK8A 4OYIA 1SC3B 4K50A 1RT3B 2ZM6F 4NLQA 3A3NB 5I3UB 2ZE2B 1AFJA 3N5BA 3Q8VA 3ZZUA 1UWBB 2WRMA 4NA2A 4WK1A 3BSOA 3R5JB 2CNKB 4KSEB 4JV0A 1VQYA 5ITHA 2DGWA 1NBEB 4NX9A 3TO8A 3BN4A 2OFHX 2DH8A 1JB0C 2PT0A 2FZGB 3N0VA 3P49B 1QAIA 3EGZA 1C1CA 1FJGF 2QIFA 4C11A 4UZCA 3M9MB 3VGTA 5HROB 4ZVSB 5HVGA 3NGSA 4Q2MA 2DTJA 5KOWA 3UN2A 4TXSA 1SKWA 3MMCA 4BLGA 2X3DA 1TK8A 4RW9B 2CJKA 1J5EF 1X9MA 2F9JA 4QCLA 3MM6B 3P5TL 3SIPB 5KFQA 4A48A 1TELA 1GX6A 3HDSA 3FCWA 2Y1LB 1TV6B 2HBZB 2JWNA 5B0AA 2JHEA 3UR3C 4O3PA 3D1OA 1XNRJ 4W90B 2HKEA 1Y3JA 3LP0A 2HWTA 1WEZA 2W4CA 1JX4A 2NUHA 4YB6A 4NZ7A 2FVPA 3TEHB 3W65A 1CG2A 1XMOJ 4DX6A 1HKAA 1HA1A 1T7PA 3M6UA 1Y4ZB 3GPAA 1C1CB 3MR2A 4ZVUB 2MGZA 4RX6A 4C11B 2AYEA 5KFNA 2FJEB 3FDSA 2K7JA 4ANEA 3MR7A 4F26A 3VALA 1N33F 1IXKA 2VC1A 5KFCA 2VV5A 3O3LA 4M5GA 3C16A 3MMCB 4K4XA 2MQLA 1NDKA 5CYQA 4PG8A 4FS2A 3H4BA 1FWPA 5KFJA 1EQMA 2DEIA 3IWLA 4QIWD 4QWAA 5KT4A 2F40A 2K7KA 4PQUA 2HLTA 1FDAA 1SKRA 2RSQA 4IOAQ 1JLEA 1QSLA 3LP0B 2RUGA 2YX1A 2MXYA 1S72S 2YH0A 3LGMA 4CLYA 9RUBA 4LJMA 3PYEA 1S77D 3H5YA 2RAQA 1RP5A 2E1AA 4J37A 1X0FA 3PO5A 4IFVA 4OI0A 2XMWA 3D2WA 1N5YA 2VOOA 1FRHA 3NY0A 4N5SA 2N3OA 1JLCA 2MGZB 2R8GA 4DXLA 3GLJA 4RU9A 2VODA 3GIMA 2UUCJ 4B3MF 1Y11A 2Y0SD 3M32A 2GFFA 3B82A 3T6BA 8ATCB 2RT3A 4PG7A 4USKA 1YX2A 1I3OB 4QYZJ 4AYBD 3C16B 4B3TF 4CT9A 5AJ3J 2C3MA 3AXMA 5CYQB 1HHTP 2KI2A 2CNOB 3K7RA 2AMCB 4HH1A 3T9ZA 2PO4A 3EX7B 2CIMA 5ETVA 2W2QP 1SXLA 2VOPA 3MCNA 3HSGA 1KR4A 1LWCA 4PQUB 4KO0A 1HIYA 1W25A 1JLEB 2P5VA 3KXDA 1VK3A 4NPOA 3KJVA 1HNZF 3HZEA 1NU4A 2GMHA 2YY3A 1DTQA 1KS2A 2MQ8A 1U09A 4NLGA 4WKYA 4A8QA 4ZJLA 4DCJB 1NZAA 1GNKA 3RB0A 4IFVB 1T03A 2IIHA 3GILA 4DJBA 1N5YB 5L1KA 1Q8KA 1NMEB 1JLCB 4IO9Q 4P75A 2EFQA 2ERRA 4USUA 1YLXA 4WJBA 4MMOA 3M32B 3NMRA 2OJ3A 4NLDA 2QT7A 4FVCA 2MKCA 4Y2AA 1Q81T 3N4WA 3ZFVA 3KHRA 2M0GB 2C1EB 3LO3A 4NL5A 3SBMA 4PYDA 5HQMA 1FD2A 1RYSA 4MIAA 1N56A 4RUBA 2FYXA 2ZH3A 5EUHA 5L38A 1BC6A 1FERA 1WHWA 5KFTA 4ETXA 1SC4B 4K4WA 1FDBA 4PZVA 1S97A 3HM9A 1LWCB 1FO1A 4KO0B 2D3UA 3GJSB 3TVYA 4G65A 4L3KA 1UA1A 5CH7B 3KJVB 4ICLA 1S1UA 2VDIA 5DLFA 1QTNB 4NXMJ 1Y5LB 1OIAA 3D68A 1DTQB 5LJ5Y 4AXJA 4L6V3 1T05A 5AE2A 4C8KA 1OSDA 3CW2C 4WIQA 1NH8A 1PSDA 2FHMA 1T03B 3K57A 3IG1A 1WHVA 1WUUA 1SH0A 5JXSA 1JJHA 1YRTA 5J1PA 3QRPA 3RW7A 3D28A 3G8QA 4CZCA 4OZNA 3SQGA 2RDDA 4MK9A 3CC7S 2QEXS 1TK5A 5IWAF 1X5OA 2J8AA 2BJ3A 1PAEX 1VYAA 1R6YA 3ETOA 3HCXA 4OYPA 2KHDA 2MKSA 3KMQA 5KG0A 2V6AA 2U1AA 1U6BA 3GFZA 5IV3A 1EAYC 1HYSA 3DOKA 1PO6A 1P27B 1VBXA 4OLPA 3PY8A 1S7HA 1YZ6A 4P52A 5HLFA 2ZOMA 4IDKA 3MUVP 2CPIA 1ZM3A 2V94A 2MQMA 3I4PA 4NXNJ 4ICLB 1S1UB 3RTVA 3H90A 2BUNA 1T05B 5HSPA 2B3TB 2C2MB 4WU2A 3IG1B 1SJFA 3ENQA 3BGUA 1S79A 9ATCB 4DV7F 4ES2A 2B8PA 4ZPDA 3DLKA 4X64F 1HNXF 4X65J 4FXVA 3SQGB 1BLUA 4OYBA 1GEHA 1VGYA 2HS0A 2ZJQQ 2DIVA 5JVHQ 1R0CB 4OHZA 3US5A 4KHPF 3UDEA 2VFTA 2UZAA 2G13A 1H73A 2UP1A 5DJBA 4P72A 3R6GB 3PKYA 4M5IA 4B17A 1REGX 2ZH2A 1EHWA 3ISND 1HYSB 1R8BA 2IBOA 3KUEA 4A47A 5DGBA 4TYBA 3DOKB 2DPJA 1CJTA 2R7XA 3T5LA 2E9TA 4B3RF 5E41A 3W9IA 2HHXA 4DFKA 1S7IA 5HLFB 3KK2A 1NDLA 4IDKB 1RI7A 3BN7A 4U96A 4UQTA 1XC9A 2ASDA 4UZBA 1G4CA 3T1HF 2CQCA 5IC6B 3G6ES 1KBRA 1I94F 4P6QA 3PVXA 3JAMU 3KLFA 5DG7A 4X4TA 2RDJA 2E1MC 5BYSA 4PR6A 4F3QA 1R8PA 1JJ4A 1A9NB 3DLKB 1M5VC 3EVOA 2EI5A 4NYZA 4CLPA 1T3NA 2UXBF 2EXUA 3D0IE 5HMXA 1S48A 1HMVA 1MG7A 3H40A 2RIJA 4RUCA 3IBWA 4IRCA 2HHVA 3NS5A 4ECYA 1RGVA 2BJDA 4LF9J 4GO7X 3ZXWA 2H5EA 5CQGA 1YJRA 2OFGX 5L8RC 2C2ZB 1CJTB 3D1HA 3O44A 2EFNA 3AJ1A 4PRFA 3EPIA 1RT5A 1BWVA 2Y0BB 2KXHA 2VPZB 5KFYA 4ZPAA 1UL3A 3KK2B 3N6NA 3TWZA 4ECTA 3MPWA 2V2KA 4ZP9A 1S9FA 2X7IA 4P9SA 1UVJA 3G6XA 3VVTA 1Q8LA 2DNKA 4DN0A 2OKQA 2XHCA 3HSDA 4OX9J 3BREA 2XMJA 3WIUA 3RZAA 2B51A 2F63A 1N33J 1ELOA 2M2BA 1PIEA 4ZLPA 4FYDA 4PXBA 2EVZA 4B3OA 5KG4A 2W4PA 3ETMA 3A8JA 5DQGA 2F3JA 3VZIA 2LQ8A 2PFDA 3F0NA 1CS4A 1B4SA 4DFPA 2KT5A 1HMVB 1U26A 3ICLA 1IR1A 5D3GA 5IT4A 2AW0A 3JB9k 3NBPA 2IJRA 4B08A 3AFGA 5FDLA 4A8SA 3DMJA 3NEKA 3BS9A 1V9OA 4PAAA 1TMMA 2IM0A 4DSEA 1KONA 2IFXA 3MPYA 3OW2R 1PG5B 2KH9A 1S9GA 4MFBA 1UJ6A 2HGNA 3O5TB 2MZJA 1RT5B 3QAEA 4EEYA 3J7ZT 2W24A 4LF4J 1Q82T 4NA1A 3X1LB 4NASA 4F4YA 3K0JA 4X84A 4RLEA 4LF8J 3UI3A 3T5JA 1SV5A 1J27A 2CQ2A 2A6OA 2YPYA 1WI8A 1T9UA 3HHLC 4ZMMA 4IH6A 2PI5A 2GC8A 2ZHOA 5HATA 4USIA 2N4DA 3W5YA 1PBAA 4DPUA 2YNIA 3OHAA 4KQZA 4O0IA 3IFEA 2DHGA 1Q95G 4DUTA 5KFEA 1XR7A 5D15A 1UPPA 4B3OB 3SV4A 3SV3A 5M2UA 1VQKS 3NL0A 4O44A 1CS4B 2B6AA 1ICEB 4YN3B 5D3GB 3EZUA 3NBPB 2IM1A 1MMNA 2DH7A 5F3TA 2C3PA 5FDLB 4ECQA 2G1HA 3DMJB 5E3AA 1D8YA 1DFDA 4ZLJA 2ABYA 3IXQA 1M5PC 3PW7A 3U02A 4MFBB 2BMBA 4TU9A 2FGOA 1C0UA 2ZUGA 1HNZJ 2L9DA 2DD8S 2E5IA 1RTDA 4DV5F 4C2MA 5IT0A 1SV5B 1SL0A 4ZIVA 3CIMA 2UV8A 3AXKA 3OTDA 2DKOB 1YJNS 4I56A 2VFRA 3JTNA 3I87A 2YNIB 3V5RA 1UEVA 2QX0A 3PKMA 2YKMA 2MY7A 3CJSA 1RBAA 2B0GA 3PO4A 5LMNF 4NCAA 3UR0A 1FE4A 3HHEA 4W92B 3FVYA 3MM8A 2GAHC 1SH2A 4CIOA 2JX2A 3HX9A 3NWGA 4DG1A 4TY8A 4O44B 1XIQA 3KLVA 2V0NA 2B6AB 3ILIA 1IM6A 4RNNA 3AB4B 4MH8A 1KN6A 3G86A 3CTRA 3QZ8A 4F4XA 2HQIA 1HD0A 1C0UB 2J9DA 3A8IA 2O1PA 2CPFA 2V2ZA 1VJQA 1RTDB 2V8DA 4ER8A 3KNAA 1BQNA 1TFYA 3LA0A 4TLQA 3LAKA 2CPEA 3PEJA 1XQIA 2V8VA 3SDEA 2BJEA 4MIBA 1ZETA 2HHHF 2YKMB 3OJSA 3HXMA 2UVVA 1VBKA 4CLWA 4CCHA 3M9NB 1GXTA 3CCZA 4X62F 1ZM9A 2DHHA 4H4KA 2OSRA 2NPIA 3MM8B 3T19A 2ZBPA 1NJYA 3IAS9 1L3SA 3EDQB 4DG1B 4TY8B 3ILJA 3DU6A 3JS9A 2VC0A 1EP4A 4J9KA 2M8HA 2AGOA 4DQIA 3CJ0A 2E7WA 4C4WA 2CWXA 3AD8C 2Z56B 2HHWA 2QN6B 3NGUA 1X8DA 1FHTA 3BF4A 4Z2XA 1RAHB 2LQ9A 3Q8UA 4F02A 3OJUA 4E0DA 1RBOB 3NGTA 4X4PA 2VQFF 1BQNB 4Y2IA 4KC5A 3RG6A 4M5DA 3UD5A 4J9RA 3OTCA 3SDEB 4QYRA 2X51A 5KT5A 4DQQA 1SL1A 3KDOA 3WIVA 4WXWA 2DNHA 3TUZC 3FKBA 1F5CA 4DSKA 5KTQA 3OTOF 4KV8A 1NCLA 4KFBA 4MTPA 1RB0A 2WAQD 3FJ2A 4USVA 3JTOA 2R7RA 3QT5A 4DS5A 1LQ9A 5GMEA 2DR8A 2Z30B 5ETKA 2UXDF 3E2EA 1EP4B 4QWBA 3ZTOA 1ITPA 2GVZA 1QSSA 4B3RJ 2BZ2A 1B70B 2N82B 3TVZA 4HL9A 3C15A 3D6HB 4UY8T 3HVRA 4ZKAA 2IMWP 1TKZA 2HVZA 1FWKA 3LW5C 4N76A 3M6WA 1UW4A 3O8WA 3R5AA 3TJ8A 2PGCA 3PW5A 1V5VA 4Q8FA 1GMWD 5DGAA 4DX8H 4M5DB 3RGIA 1P9YA 2WBMA 1URNA 1PBUA 3MPDA 2WVEA 2I1RA 4DCPB 3KKFA 2ZBCA 3MM5A 4NYPA 1OMSA 2QMXA 2UXBJ 2F4FA 5BR8J 4LFAF 3HVTA 3OL7A 2LFVA 1KHWA 2LCWA 4KV8B 4KFBB 2BJ7A 2MHNA 4C97A 2BQRA 5LJ3Y 4N56A 5GAEU 3AAWB 3HPOA 1HHSA 1WWHA 2H3EB 1SKSA 1CSJA 4J9VA 2XGQA 2GVZB 5AE3A 2W9BA 3P5BP 5IFMA 1GX5A 5KFRA 3GMGA 3Q2SC 3P3DA 5E3RA 3I82A 1UJ5A 4NCGA 1IKVA 4KGMA 2B5JA 2NREA 2DISA 1TKZB 2BOPA 3DRPA 3DU5A 1Q0NA 2ROEA 4DPYA 4DV3F 4NLRA 1GMWA 4OJGA 2G1DA 3HT0A 2V4RA 1IM4A 2ZOGA 3KHLA 1GXUA 3SQOP 4USMA 4B9NA 1B64A 2AHOB 3NAIA 4ELUA 2JFKA 3TA2A 3MM5B 2VFUA 2W8KA 4WK3A 5EHHA 3HVTB 2BR0A 3ZZRA 3NCQA 1CJUA 2ZZNA 4CM2A 1UWAA 2QFIA 1P9QC 2FY8A 3KJNB 4OZ0A 2I8EA 1B7FA 1AT1B 5F8HA 2OP5A 1LK7A 4U6PA 4YDDB 2L48A 3VTIA 5D0HA 4C3KA 2W9BB 1CULA 3D5MA 3OXGA 2QE5A 1LXJA 4KH1B 4QWCA 3FRYA 4BC7A 1X5TA 4NCGB 1IKVB 2B5JB 2BE9B 1H6KX 3CMES 2P6TA 3TP2A 2MKYA 1C2PA 4WBFA 2AGQA 1PJ5A 3MPUB 3EMTA 4F3MA 4DI6A 3PX0A 3V6JA 2DHAA 2KXFA 5IOLA 5H9EK 4WFYA 3CJ4A 4P74A 4WTOB 1XBWA 2OIHA 5A6WA 1HNVA 3EZOA 5KFBA 2V2QA 3LGNA 1CJUB 3J81U 3TAQA 1UZDA 3CDAA 1H2VZ 2QLXA 4DV2J 3GV5B 5ETNA 4Y2KA 2AJ1A 1GTEA 3N79A 1FXLA 1PJ6A 4ALZA 4CH1A 5ETLA 3OFGA 1M1GA 1ZM2A 2DNNA 4QIVA 3NWRA 5KG2A 2J0XA 1CULB 1U2FA 2Q6BA 3O1LA 1QD1A 2DNPA 3T1YF 3HP6A 3ZTQA 3ADAC 1M5OC 1CLFA 2XMMA 5HVFA 4HI1A 5D0GA 4X4VA 4C98A 4DV5J 4G1PA 1HNWF 3LWLA 2D9OA 3M6XA 4B3SF 3OQ2A 2ADBA 3W62A 3D3BJ 2GJFA 4K5RA 2IVMA 2BX6A 1OPZA 2LYVA 4Y28C 5JVGQ 5I3PA 2PC6A 4MKBA 5T7LA 2CYYA 2UUBF 4JI1F 4OZ5A 1MMDA 3K17A 2HZAA 4W4MA 1P6TA 1HNVB 1FXRA 2QYGA 4DV1F 1CEZA 4JI4F 3M8ZA 1J5OB 1YJWS 1A7GE 1CBKA 1S4EA 1X5SA 2MLYA 2BRKA 2DY9A 3ZNJ1 3QGPA 2KFNA 3QGHA 1U1NA 4KGXB 3PFEA 4XDCA 1QUVA 2A1BA 2DNGA 3QJJA 3CVKA 4R0JA 4RR5A 2CQ3A 4C0BA 2J6UA 2R7TA 4F8RA 2C2OB 3QLHA 4WFBQ 4PG5A 3J7YU 2NZCA 4KR0B 2D41A 5CHCB 4B9UA 3W2VA 5M2PA 4BWMA 3E51A 2BM0A 1S5ZA 3VAMA 5GAGU 2DJWA 1AROP 1FRKA 3Q89A 2XY5A 2J9CA 3R5CA 1CQMA 1UCNA 1U45A 5HMWA 1RT2A 2FJWA 5T7LB 4OJ1A 3I96A 1NSAA 3GU0A 1RCXB 1YJTA 3D66A 1VRUA 5LOQA 2KVQE 2HIQA 4DOZA 4RBTA 2ZNYA 3BDPA 4U9RA 5D8HB 2MTLA 4EFAC 3KJFB 4YB1P 3JQKA 2FJAB 4MKVA 5I3QA 3W64A 1GT8A 4URQU 2V9WA 4I69A 2O5DA 3R8YA 2YXLA 3LQVA 1M1HA 1WHYA 3UW1A 2UVRA 2LP4A 2HQDA 1U6FA 2ASLA 2MY8A 2HRUA 5D4PA 5MAOA 3J7AN 5FIIA 1URRA 2XO7A 1G6BA 5GADI 2HFSA 3SCLE 1OQ6A 1WEYA 3UDCA 3QLHB 3FBBA 2VQFJ 1FNMA 4OFZA 1NO8A 5I42A 2YH1A 1NDCA 2I38A 3W2VB 3NGRA 3FFIA 2HRTA 3VAJA 1LV5A 2OMOA 1KQGB 2MJUA 3AD7C 4JB8B 2UV8G 3F44A 1ZTTA 4KRWA 2OMLA 1WKJA 1FRIA 5C5JA 3PNIA 2JL9A 3I32A 1RT2B 2DGQA 3SSQA 1RAOA 1Q79A 4ZCKA 3NG8A 1VRUB 2A3JA 3BV8A 1VC6A 5KT6A 4KHMA 1SQEA 2ZEJA 3FSXA 1Y00A 3J81j 1D9FA 5F41A 2QTWA 4EBCA 1UVIA 3C14A 2UXDJ 2K06A 4ZVRB 4DZ6A 3T5KA 4CO5A 3RJMB 4YY3F 1X31C 2OD4A 3TZWA 1TAUA 1DAXA 3G8SA 1HD1A 3PIOQ 1QTMA 5L1JA 1RA7A 1NPRA 3MF5A 4H4MA 1W2BR 3QNWB 2KFZA 1X0PA 3B54A 2LMIA 4OHVA 2IRYA 2JZ5A 1FJEB 3CMAS 3QSYB 1TP7A 2HFUA 4HDHA 4YP3A 3KUGA 5I42B 6FD1A 2RH3A 4AL5A 3FFIB 3ULHA 2BEFA 4X2BA 2QMWA 4QPXA 1SJQA 4E8UA 4R5PA 5H9FK 5RUBA 1H2TZ 2OEKA 5JJBA 1NSKL 2XY7A 5MLCV 5KFGA 4LREA 1FNXH 4LFAJ 4FNIA 3KUHA 1SC6A 4I7FA 3ENVA 1WOSA 5KFFA 3FRZA 4PG4A 4ZA1A 2OEMA 1CJVA 3TA0A 4LFCF 3C14B 3S01A 1PILA 3EGNA 3BJYA 4ECXA 4K4VA 1RABB 2LA6A 5SZTA 2ZBQA 2AEJA 1FJ7A 1YWXA 2MZ1A 4H4MB 1OY6A 2M88A 1ZBTA 3W1YC 5C2CA 3P6YC 5J2PA 2HVIA 5HP1A 4ED4A 3AD9C 4PWWA 5KFWA 3C19A 5EWGA 1KNZA 2E1CA 4C8ZA 3EGVA 2UXCF 1WKKA 4H4KC 4QW8A 4N47A 2H65B 3G71S 2RDIA 4WP8A 1ZS6A 2IPOB 1RA6A 4R5PB 4IOCQ 4ZLNA 3UNYA 1N4LA 4RL1A 3PW4A 1OWXA 3RU0A 2KG0A 4I7FB 3HZGA 3AH6A 5D4LA 1RE1B 5M2RA 3PDNA 3KOAA 4IH5A 3MCOA 4EU0A 3Q8RB 3OL6A 1NK0A 1N36J 2VHGA 1T9YA 2YWWA 2CPYA 2W8LA 3LPYA 2I0XA 1WKLA 3S1TA 3SEOA 3BBBA 3Q0AA 3FQLA 2L08A 3KDNA 2CJYB 3LANA 1T3OA 2E5LJ 4DUYJ 3A13A 3O2IA 4PPDA 5J2PB 5HP1B 3QQCD 3SCKE 2LECA 2AIRB 2EC2A 2X3GA 2FHOB 3DN9A 2MKIA 3JQMA 1YGYA 3BR9A 1TUGB 2YWHA 1S9EA 2C3YA 3POTA 1MSWD 2QSWA 2R9LA 2LA4A 2DRBA 2CVIA 2IYIA 3CJKA 3NXZA 1KDNA 3K5MA 1GK8A 5KOXA 3JSYA 2B8QA 3NMAA 4PCQA 2NXNA 1SJRA 3SSSA 4HHHA 2FHJD 1VQ5S 1HI1A 4XO0A 1Q53A 2RRBA 5E5NA 4C3MA 2R7VA 4TU7A 4O3QA 1S1XA 4BHQA 4DV6J 3Q23A 1WG4A 3CJQA 5LXYA 1WF2A 1ZOTA 1LFWA 2COLA 2GO8A 4EUVA 3KK3A 1VQ7S 4CYUA 4LF5J 1S76D 1NKCA 2DVIA 3HO1A 4O3NA 4M5KA 4B9VA 2B9XA 2FPHX 2MSTA 3G6VA 3BO3A 3WBZA 3PM9A 3QFHA 5LSOA 1S9EB 3UCGA 1E6YA 4P2FA 3AT1B 3POTB 4UOGA 3JYTA 3HFVA 3VZHA 3CJKB 1RACB 2IYGA 2V8PA 2V69A 2HSEB 2B9EA 4DR7J 2GNKA 2OLWA 4QYZK 2IMOA 4TKTA 3HD2A 3A8KA 4U7UD 2FHJA 4JI2F 2E29A 1FKAF 1ZAWA 3H5SA 3QWUA 1SVDA 4ECSA 2OUGA 3B8HA 4DR6J 2H4WB 3K5PA 3BPDA 5F8IA 1WACA 3HKWA 3AA9A 3IM8A 4EMDA 4J9MA 4WKRA 1U1KA 3MMAA 2ZJRQ 1S1XB 4DUZJ 3NS6A 3EDRB 1MNEA 3GTYX 4HTIA 1UVLA 1B7YB 3D54A 1O8BA 2DNZA 3QBCA 1TTHB 1YDLA 1RK8A 2Q6CA 1HW8A 4CYUB 4ZDNA 2FVSA 2XS2A 1FXDA 4NLWA 1KTVA 1IBMJ 1JJCB 2HFOA 3ET6A 2DXFA 3UE2A 1E6YB 2IDLA 1F6TA 2J6TA 3H42A 2WONA 1I6JA 1JLFA 2B56A 1KWMA 3W63A 3IBCB 2AJ2A 1IQZA 3RRHA 3N6MA 2ZH7A 4DFJA 3RUBL 1LWFA 4J9QA 2AJ0A 4N77A 3KLGA 2DCUB 1Y5NB 2W4DA 1XWLA 2B43A 2JJ4D 1VJWA 3MMAB 1NAQA 3ZTRA 1UFLA 1IWGA 1TU0B 2K1RA 1FTCA 3HD1A 4RW4A 1RWXB 5A8RA 2G9OA 1REVA 1ACMB 4Y65A 5F0UA 1UMJA 2PEBA 3J80Y 2Z2MA 3MM7A 1U4BA 1NB7A 4OZLA 2XLIA 2P6SA 5D0RA 3ET6B 1HL6A 1TK0A 4N7TA 4EYHB 3HHDA 5B0EA 5EX0A 1TL3A 3CCJS 4DV4J 5DG8A 5D77A 4J5OA 2WONB 1WEXA 3MTJA 1JLFB 1FJCA 4MIWA 4G6VB 3QRRA 4Z7YA 3CDWA 4FVMA 2E7XA 1RWOB 5GVQA 2L9WA 1XMBA 2XG8A 1EZZB 1LWFB 4PKDB 2CDQA 1FEEA 3RBEA 2EG2A 3KLGB 2I2YA 1M5SA 4K4TA 4JI8J 2BABA 4KJIA 2KDOA 3TUJC 1LW0B 2R3VA 3KFWX 3NOCA 4PYAA 5E3CA 1UP1A 1YI2S 4X4RA 2AX0A 4C0HA 5HJXA 4DL6A 2HG4A 4FYYB 2K1RB 2QGFB 4RW4B 2MMYA 5GAHI 5A8RB 1NK6A 1YRXA 4ZHRA 1REVB 5C24A 3AOCA 1UAWA 3MM7B 3LP2A 2GHVC 3WDOA 1OYEA 3K59A 4F0KA 2MJNA 3NNHA 2FGCA 2JFDA 2GX8A 2YBVA 1HPZA 3LAMA 4DF8A 1TL3B 2DPIA 1U0SA 2VDHA 2QL9B 4Q44A 2BXJA 5A8WA 1U6ZA 4DL3A 2Y1JA 4CP5A 4IRDA 3UD4P 4ECZA 2A10A 1RT7A 2RS2A 1HWLA 2GIRA 1NK9A 3R6LB 1TKXA 1RXOB 3QFWA 2XMAA 3E8OA 2NQPA 4LFCJ 2PE8A 1F0XA 1F9EB 2OPQA 1OS5A 2WSCC 3IAM9 4JP8A 3NGKA 5G0RA 1OQ3A 2GVDA 4RWXA 4DR3J 2RB7A 3DKDA 2E1RA 2YTCA 5A76A 4GVBA 1U1MA 4F2RA 5HMYA 2HHPA 3DDKA 3CGIA 2YKOA 1Q78A 2H4YB 3DGPA 1RLCL 2AZ1A 2DCLA 2XLKA 3DNCA 2XYPB 4ZHRB 5C2GA 2UUAF 1HBOA 5C24B 4JI0J 4NXNF 5EN1A 2GAGC 3FBFA 3IA0A 3CIZA 3LP2B 1Q8IA 2AJFE 2CPZA 2HQ3A 4F0HA 4MKYA 3OLBA 4U7CA 2IVYA 1AW0A 1SJ1A 1HPZB 3DM2A 2OAUA 1V3ZA 5A8WB 2I9SA 4ID8A 3THTA 5HO4A 1RT7B 3I55S 1NUEA 5GAGI 4QWEA 1SQFA 2JSXA 1G3OA 1U02A 4M5JA 2X1BA 1ZM4A 1TKXB 4X65F 3FSIA 2VB6A 5T14A 5KG7A 4WWSA 4I2QA 1Y10A 2V8GA 1H7WA 3QJLA 5DS7A 2OPQB 2XMUA 3OTBA 2BKPA 4C3LA 5G0RB 2BYCA 2GVDB 2IY5B 1HNIA 1QVGR 5D4OA 4GVBB 4ZPTR 2ZHBA 2VPYB 2GHWA 5LMUF 4A8MP 4ED6A 3DGPB 3UCZP 3V6DA 1BGXT 1LEOA 4M5MA 1T94A 1CC8A 2VKZG 1JLGA 3RBZA 2W7AA 1HBOB 5ETRA 3C46A 3BDEA 2PDAA 1KLMA 2BE2A 2CJXB 4LR7A 1JXVA 2J0QD 1ZH5A 1RT1A 4OI2A 2AGPA 2DO4A 3U27A 3DM2B 2RHSB 5KFKA 1EETA 3GV7B 2F65A 2KT3A 3ELHA 1KC8T 5HQ8A 3CCRS 3VHQA 4CO1A 5K8OA 2JEIA 4UW2A 3LALA 4I2QB 2CPDA 3EPGA 1TZ0A 3N9UC 2MSSA 4Y2CA 4K4SA 3I5AA 5ETPA 4JYAJ 3M8WA 1HNIB 4LF9F 3MMJA 1GH8A 2GIQA 1H74A 1R3NA 3M8QA 2L41A 4WPAA 5AXKA 2ZC3A 3V6DB 1R7IA 4DL5A 1B0PA 4M94A 3H7HB 1JLGB 4BS2A 1KVKA 3TEGA 1FFSB 2OEJA 2BW7A 1U2CA 4NLSA 2KTQA 4KYZA 1N5SA 1KLMB 2H1YA 2BE2B 3QMQA 4OHXA 4Y6IA 3I6PA 1RT1B 4NA3A 1XMQJ 2G0JA 1JNRB 3WC2A 3E3XA 4B9LA 4NLVA 1DLOA 4OX9F 1EETB 2ZH5A 1A6LA 3EXCX 3P4UB 1X4EA 3NNAA 4ZVPB 5DZ7A 4ETZA 3V6KA 4X4UA 5E0OA 3BGOP 2QG9B 3K5NA 1BQMA 4RW7A 4JI2J 1RUSA 4RBUA 1LWXA 2XO6A 2P9EA 2V4QA 5AXNA 4YHHF 1MN9A 3GSIA 2FUG9 1ZAVA 3Q8YA 2DH9A 1WC0A 2ZOFA 1ZA2B 4ATNA 2ZH4A 1IWAA 4P10A 1IBLF 3N5FA 1FRMA 4K0KJ 1YITS 1UVNA 2ASJA 4DL2A 1Q5VA 3M8QB 1O5JA 4B02A 1S4FA 2X1AA 2KN4A 1RHJB 1Y7PA 4URGA 1MU2A 5FD1A 1U1LA 1BUXA 2BQUA 3EGWB 4LF4F 4JV2A 2W1BA 1UFWA 1RZMA 3FMWA 2HGLA 1U7LA 4LF8F 4IO1A 3EZ5A 5J2NA 1MN7A 1RYRA 3CUNA 2WHOA 3B78A 3DLBA 2CPXA 1XEZA 4LRBA 3OV7A 3ISZA 4OL8A 3RAMA 2LU2A 4OHWA 2ZZTA 3RYLA 4DR5F 1BMQB 2R8KA 2R2RA 5K8NA 4X4SA 2VICA 1BQMB 4RW7B 2AYBA 5K14A 2RKIA 1U48A 4Y34A 2WTFA 3IO1A 1Q86T 2BJ1A 3OL8A 4R25A 2FC8A 3TZYA 3SCJE 1FRLA 4J9OA 4WFAQ 2W9CA 5DDOC 2HEKA 2RQCA 1IKYA 1VBZA 5SUHA 1VDHA 4LFBJ 4EBDA 1FKPA 3HFKA 2E44A 1S10A 2RQ4A 2GCFA 2MZQA 3I0RA 1S0OA 2BACA 1MU2B 1LXNA 4DV0J 4UF4A 2XWYA 2EFOA 4QQBA 1R43A 3QT7A 4JV1A 1FA0A 3GYNA 3CC2S 2ZITA 1FT8A 1PCAA 5J2NB 3NCPA 1VHFA 4F50A 1RSCA 4XDDA 1U47A 2DITA 2OO4A 4DQPA 4CLZA 4NZ6A 3M2VA 3HSJA 3UNGC 3NGDA 4JI5F 1EKRA 1WJ9A 1KP6A 3KWMA 1ULRA 3CNQP 1UVMA 1O6XA 2K3IA 2M70A 2E5GA 4H54A 5HBMA 5K14B 2RKIB 5ETQA 2BDPA 4ED8A 3Q8SB 2GS8A 1HWIA 3C3LA 4WYWA 3V4IA 1RTIA 4AL7A 4I68A 2W9CB 2A2CA 1RHUB 1IKYB 2XSFA 5B0GA 2MZSA 1NB2A 1M1KT 1X9WA 1FKPB 1RAEB 4E98A 3GG1A 2CDRB 2F7VA 2DEJA 3I0RB 2RD5C 4MKAA 3CCTA 2PD1A 4AQYJ 4LBIA 1M5HA 4N8OA 5HI7A 1NKBA 2VFVA 5KT2A 4ZOSA 2BKNA 3N01A 5ADZA 2N4CA 1BWEA 3KNGA 5KFPA 1JLBA 5BXIA 4FDFA 3T1AA 4WFXA 3PYFA 2PA3A 2VG6A 4ZPVR 2CJAA 2KYXA 3M2VB 2YPZA 2BW2A 2XWXA 3IGNA 4HI2A 4L73A 3RBDA 4ZPWR 4ZCMA 2Y8WA 3IBFB 5KT7A 1XNQF 3JAMY 4F25A 1RWKB 1R6VA 1WTBA 4CO4A 4LSLA 4ED3A 5HBMB 4M5NA 5HL7Q 3K2YA 2DGOA 3IR5B 4RBVA 4O4GA 5E3PA 2PI4A 3AOBA 3V4IB 3RRGA 1RTZA 2HW3A 3F56A 4L74A 4LRFA 5GMKa 4I4BA 2JDJA 2LQBA 3OFHA 1YHQS 1QAXA 3PG9A 2HWIA 4E2FB 3W2WA 4QR2A 4TQSA 2UUAJ 2WVFA 1SB6A 3C66A 5CD4A 1GXLA 4ZVHA 3QGIA 1EARA 4RUHA 3MURP 4OX8A 3EM1A 3GFYA 1JLBB 4OV1A 4WU3A 1VS3A 1HFEL 2R7SA 4HH0A 4I2PA 1VMBA 1QY7A 3RAQA 4OYOA 2VG6B 2DXEA 1D8ZA 3MEKA 1D0EA 2PFFB 1WC6A 4DLGA 3RW6A 1NXIA 2R7QA 4F2SA 4QU7A 3BYPA 1D9DA 3QSIA 3WC0A 3K5OA 3KLEA 2MEWA 7AT1B 4LSLB 4JI7J 2ZVSA 3BKTA 1NLKL 2FVCA 4O4GB 2ZKUA 2AP6A 1NJZA 3IR7B 4KGVB 2B4PA 1Z1ZA 4LUBA 2KG1A 2ACYA 2QLFB 5LMUJ 1TVRA 2P2CB 5K8MA 1SKUB 3W2WB 1S0NA 1RT6A 1G7CB 1X4CA 4A8XA 3WX4A 4QPTA 4K5SA 2LQ5A 3R3TA 2BVZA 2PMHA 2E7VA 2D3O1 4X4OA 2H5IB 2VJVA 1AB8A 1YJVA 3ZZPA 2CRLA 4YFUA 2DIUA 5LSLA 4YMEA 2BE7D 1U0HA 4HT7A 4QBUA 3CCSS 5C42A 4XPEA 2J0WA 4DS4A 5DZ6A 2HS3A 2E5JA 5FLXU 1NJIT 2EWHA 4I2PB 4ZCLA 4Z37A 1KHVA 3EE3A 5T41A 2EFPA 4DPXA 5BR8F 3KLEB 1JKHA 1RHMB 2VD3A 1YTYA 3I9ZA 2EBEA 2F8EX 2J9EA 4EK2A 4M95A 3FUYA 4EO8A 5KG3A 1K0VA 4ZLLA 3GIJA 1JK9B 3VAGA 4L75A 4J9PA 4FF1A 1TVRB 2KJVA 2B7CB 2KXNB 1OY9A 3P8BB 1RT6B 3G9CA 4F4KA 1NSPA 1IBKJ 1F9FA 3GZ7A 1RHRB 3IN5A 4QR1A 2K3KA 2CQGA 3OVSA 2R8HA 1C4AA 4YB5A 4DU8A 2WW8A 3K58A 4ED7A 3M4XA 1U0HB 3GE9A 4FYXB 1LFPA 1X4GA 2ZH9A 3KLFB 3CD0A 2KT2A 5L46A 2BJ8A 4DX7A 2DGSA 5EGYA 4WZMA 4GKKJ 2XMTA 2E5HA 1LNQA 2AKWB 1JKHB 3DC2A 4HHUA 2CQ4A 1EX8A 3AY0A 4ZCIA 3MCSA 4YHHJ 2AU0A 2V67A 5C25A 1G2EA 4USTA 2DHSA 2BBEA 3CDUA 3RB3A 4K59A 1RAAB 2FLOA 5GADU 3DYAA 5LXRA 1N5VA 5L1IA 1IBLJ 2HHTA 1F5BA 2HQGA 2Y1RI 3UCUP 2LEBA 2NXCA 3RAXA 1NPKA 2LLZA 4FBTA 3S6EA 3GJRB 3PR5B 1VBYA 1EB0A 3QRQA 1O0PA 3TNVA 3OR2A 1PAUB 1JQGA 4WZQA 1U1PA 3M05A 4C48A 2XI3A 5CXTA 4DSIA 2PEHA 2XYGB 2HVHA 3TW0A 4ZPCA 1K9MT 2HK2A 4FYWB 1WDDA 4CT8A 1DQ8A 4CO2A 2R4FA 2EBGA 2MQPA 2GGPA 3DCAA 3KMSA 4PWDA 3NP5A 2HHSA 5EX3A 4DR5J 5B09A 3GB0A 3T6JA 3KHGA 4LF2A 1IQTA 3PCOB 2XSJA 4ELVA 2B4UA 4O4RA 3CSKA 1JXEA 4FXWA 1NHKL 4KE5A 4ZJQA 1I5OB 5C25B 4DV2F 1LWEA 2VA3A 1DBDA 1VLYA 4DR1J 5LT5A 3W8PA 2LEAA 4LBHA 2XY6A 3HHLD 4OJ3A 3DYAB 1X5PA 3MFHA 3K8WA 1BY9A 1OYDA 1S6OA 1S9GB 4IR9A 2DNRA 2CZVC 3C6UA 1VI7A 3O6QA 3OR2B 4K4YA 2SXLA 3L7OA 1V5IB 4DMZA 3S8SA 4DSFA 2Z8QA 3OSNA 3PJXA 5G4DA 4LF6F 2NR0A 3TZXA 2AX1A 3MPVA 4K4ZA 4TLRA 4P2SA 5F9NA 1CPZA 3S7RA 2GGPB 3CULA 5D4NA 4JI5J 3B6BA 3M7VA 3P45B 4PWDB 2RJZA 5DETA 2BRLA 4QOTA 1NJXA 2MQQA 4YQWA 5F9LA 3GCWP 2KM8B 2XSJB 3U7JA 3ZC4A 4LR9A 2V63A 5H9FJ 1TQLA 2QL7B 2LQJA 5IQ6A 2VKRA 4KGZB 3MAAA 2OD6A 2VBWA 2ILYA 2NYIA 3L3CA 4O3OA 2CJ9A 3HHLA 1HHQA 4F4ZA 2ACMA 1KOOA 3EYZA 2DXDA 3VF0B 4IRKA 1YVFA 4ED2A 3RR7A 3MM6A 1NH7A 5J2MA 4FXDA 3KYLA 3C6UB 1WC5A 4U8VA 2UU9J 3CEDA 1NJWA 4Q5VA 2U2FA 1EKSA 5A2QU 4OZ2A 2GQ2A 2ATLA 3PYDA 3Q2TC 3C8YA 5DLGA 2VG5A 2VIHA 1VQ6S 3OSPA 3FMBA 4IKAA 2LU1A 5L1LA 2XZDB 4JI6J 1F1BB 1PYOB 2HQFA 3HHNB 1VQLS 1XNQJ 3G87A 2QSFA 3I4HX 3W3SA 1U8WA 2YKNA 4XPCA 1U1QA 4NYOA 3OHBA 1FVQA 1N5QA 4N41A 2ZWOA 4G3IA 2H5JB 4FP9A 1L3VA 4LIWA 1ROFA 1S6QA 1NK7A 2QV6A 2AJQA 3MAAB 3QO9A 3HHLB 1RADB 4B9MA 1RISA 1GTHA 4P2XA 5D78A 4ZN1A 1TUVA 3VAFA 3A12A 2ZJPQ 2YKQA 3I5BA 3RB4A 2CNNB 3TX0A 5J2MB 3KHHA 5DO2A 5L9XA 3VQSA 2VUGA 3D6TB 4LMZA 1VQMS 4DU7A 4J91A 4OMFG 4ED0A 3MAHA 4ZITA 3X3UA 3HF5A 3V2UC 2VG5B 3FCVA 1HWUA 2A0FB 4GVLA 4GC6A 4ZP8A 2JEFA 4PXCA 4HLBA 4DBQA 5BJRA 2X1FA 2KRBA 4RNFA 1K0TA 2Y8YA 5EWEA 4ERDA 3M8PA 4IH7A 2YKNB 1Y3KA 3TAMA 4KT0C 4F67A 4ZVQB 1U2RA 2XULA 3HFZB 2VJUA 2YWEA 1N5TA 4Z7CA 1S0VA 1S6QB 3CT9A 3MUMP 3PJ9A 7FD1A 3ZZZA 4ENOA 2OHDA 2CQ1A 4Y00A 1AYEA 3QO9B 3M9OB 2Y9HA 4X4NA 4DR2J 3D3CJ 4MJKA 2RUSA 2MKKA 1N34F 3JXOA 2F5GA 1UPMB 1UKUA 4FPIA 2DGXA 3LGHA 4NOHA 4UOHA 2EG1A 3D6FB 1FDNA 5AXMA 5F3ZA 2VBYA 1IBCB 3CD5A 2VH7A 2RHQB 3HJFA 1IKWA 4LIRA 4I6WA 1HW9A 1VQNS 2NSBA 1KKHA 4KKOA 3Q83A 1K1QA 2WK4A 2AQ4A 2QZ8A 5KFZA 3LUYA 3H5UA 2BOAA 2BQ3A 4O3RA 2D3ZA 2AEMA 2HIYA 2ZKTA 4C0OC 1FF2A 4NLYA 4A8KA 5ETSA 2VONA 2F1FA 3M8PB 3GP9A 1XJWB 4W98A 2HNZA 3MEEA 3TAMB 1S12A 1X4BA 1IVZA 3C6TA 2OPSA 1TAQA 1R0BG 2CUYA 1XR5A 3LP1A 3J81Y 2JLFA 2GIFA 4JV5J 3TJ9A 3VGUA 5IS2A 4FKXA 1YSJA 4P73A 2VFSA 5THWA 3IWNC 1QM9A 3DOMA 2AJ4A 3C15B 3FEZA 4ZVOB 1WORA 4FF4A 3UDVA 5KFAA 3R27A 1PC4A 2JEGA 2Z57B 1D9AA 1IKWB 3G4SS 2KFYA 3TX8A 2IJNA 3MECA 2G2OA 2KZMA 2KO1A 1H3DA 1Q5YA 4B9TA 2CQPA 1S0MA 5CCMA 1NHUA 4KKOB 2HS4A 4JI3J 2PN6A 4X66J 2WOMA 4TY9A 1KLNA 1VCTA 4N8NA 4F7VA 1U49A 2W01A 2Z0GA 4L3NA 2YWFA 3T3FA 2LKZA 3PRBA 3MI7X 3UPFA 1IUJA 2HK3A 2XNRA 3R7NB 1VLOA 3TJAA 3VWSA 2HNZB 2C2KB 3MEEB 1JIHA 4NRUA 3C6TB 3SYZA 2XZTB 4D3GA 2OPSB 1UETA 3GJQB 1N36F 1FDDA 2OPRA 2IAJA 3KTQA 3LP1B 4IG3A 3DDNA 2W2OP 1U8SA 1X4AA 2C2RA 2O67A 3ILLA 2G0IA 1OJ4A 2FJDB 4C8NA 1QAJA 3PRVA 5HVHA 3DOMB 3M30A 1DTTA 3DRSA 4HTJA 1I51B 2E5LF 5F8NA 4DUYF 3CJ3A 4NLOA 4OX6A 1Q4RA 2C2NA 3DRPB 5KG5A 3HHKA 3MECB 1NK4A 4G1IA 3BQ0A 3CMQA 1YG0A 2MB0B 1XK8A 2DR7A 5A0YA 4ZVEA 5F8GA 3KG4A 3PJWA 3AJ2A 1ZYQA 2HVDA 1R0AA 4YR0A 2WOMB 1B3TA 3GIKA 3VR1A 3BPSP 4DCOB 3CD6S 4CDIA 1RKIA 4ZIWA 3MGJA 3MTKA 5KFHA 4DHVA 2WW4A 2N7CA 4PXEA 2YQ1A 3GR0A 2EW9A 2XC9A 2W2PP 4M1KA 3FEXB 4M5LA 3SCIE 3G2XA 2RMLA 1FFGB 3MOZA 2B9WA 3PFOA 3KLHA 1X4FA 2RILA 1N48A 2ZUAA 2WSFC 2OPRB 2IAJB 4LQ9A 2HZCA 4QIEA 4IG3B 1YJ7A 4A46A 3MDFA 5GAHU 2IHR1 3G96A 4CLLA 4YEAA 3DRYA 5CAAA 2HQCA 2NXEA 5L9NA 4QZVB 3ITHA 4FS1A 5KAKA 4DV6F 4HYKA 5BYQA 5C7PA 3M30B 5LL6d 1DTTB 1QVFR 3DRSB 3WZ0A 3FEYB 3CE8A 4LF5F 4FN5A 1VQSA 2OSQA 2EC0A 4CO0A 4WP9A 2C22A 4LF6J 2A2DA 5CZVA 4GKJF 1FX2A 4A8FA 1RU1A 4DDFA 1VQ4S 4LR8A 5A0YB 2WZ1A 1D1UA 2UUTA 3MAQA 5KFDA 1DURA 2X1GA 2Y3YA 3TUIC 1R0AB 2IDEA 3HVAA 4DPOA 3ILOA 2Z2YB 1MWYA 3NCRA 4CWBA 3ISNC 2J76E 4O23A 4DR7F 3OFFA 2M52A 3GJTB 3QT8A 4NE9C 3KLHB 1VRTA 2HAFA 2VQEJ 2L3MA 2LVWA 2IA0A 3T9NA 1JLQA 4DR6F 3IC1A 3GYGA 2OH2A 1H38A 5AE1A 4DL0C 3ITHB 4DUZF 2D69A 3ENAA 4ES3A 3MEGA 1WTFA 2HAIA 2ZM6J 1FESA 1AUDA 1NEEA 2F8HA 4F4WA 3BYRA 3D1QA 3TARA 1IBMF 3ZZYA 2LEPA 2Q3PA 2H9ZA 3QYYA 4K7QA 2CFXA 3K89A 2BANA 2RF2A 2C3UA 1OPIA 2HNYA 2UVUA 5DM6Q 3LOUA 4ANDA 1PC5A 2P9CA 3AB2B 3CC4S 2RRAA 3DXSX 1EIYB 1QAYA 4QJVA 1FJGJ 4V1Ak 1J2VA 4TNOA 1Q1KA 2N7YA 3DGVA 3PW0A 4Y2MA 1F2HA 1RWPB 1VRTB 3TRGA 3R5DA 2XZWA 4MAKA 1JLQB 3RR8A 3JSRA 1J5EJ 3A3OB 3MD1A 4MK7A 1AA1B 3HULA 1FX4A 4IUFA 4OIXA 3IGVA 2KU7A 4ECVA 4LQ3A 5HANA 2CWKA 2CQBA 3M1VA 1G1XA 3MEGB 3MD3A 1RWVB 1YKWA 1YZ7A 2XS7A 1YJ9S 4JBCA 2HWHA 4P7TA 2NZ4A 2JC1A 4F0MA 2M9KA 3OLAA 4RU2A 2R42A 2KM8C 1GFWB 3EVWA 3L4BC 2POKA 1S1VA 2BANB 2RF2B 4HHJA 3R7BB 4DPTA 4WTYA 2HNYB 3IRXA 2IBKA 2W7OA 5CABA 3DLHA 3TR5A 4DV4F 4YR2A 4K8RA 2ROPA 1OSCA 1PKUA 2QJ3A 5FJ4A 3OL9A 3DHXA 4WFNQ 4I6AA 2MQOA 3G6YA 2I6WA 2G2YA 5B0DA 4J9SA 1L3TA 1HQUA 2CKWA 4JI8F 2WB4A 2O3DA 2H48B 1SIWB 1N34J 2GW8A 2QO3A 1QUPA 1CQNA 3HLUA 2HYIB 2YX4A 4OI6A 3M1VB 1R31A 3AQPA 4CRJA 1DZ5A 2KYZA 4LF7F 3VQTA 2AZ3A 1TL4A 2HBQB 3OT9A 3R2DJ 3KG0A 2MKJA 4KY3A 4WIIA 2KRRA 3MUTP 1TMJA 4RW8A 2AV5A 5J1NA 4LRAA 4RUAA 1S1VB 4V19J 3BKUA 3OVBA 4RWWA 3IRXB 2GQCA 2J6SA 1UZHA 2XCPA 3QWPA 3V81A 2V34A 1AUSL 4K2XA 2DYAA 2P8IA 3CJRA 4F3OA 4ZS6A 2A6MA 4LVOP 2V2VA 1SBRA 1VQ8S 4NMXA 3B4MA 3BSAA 1MROA 4B3MJ 3KG1A 2M3DA 4DEZA 5DM7Q 4R0EA 4DF4A 1WNEA 5K9FA 1Y5IB 2P9GA 3JTPA 1HQUB 1VR6A 4ID5A 2XNQA 4DFMA 4B3TJ 1VK8A 4DR3F 2A18A 4EYIB 4ZP6A 3R5BA 1QSYA 2Z58B 4LVNP 1YBTA 4TU8A 1KQKA 4U67Q 5B08A 3VAHA 3BM7A 1WG1A 2ATCB 1QLNA 4KIAA 1KFSA 2DHXA 3H98A 1UEUA 3D0GE 3D4JA 3IMQJ 1VIXA 4JI0F 4DN9A 3LTOA 3PXGa 5KT3A 3RB6A 4FF2A 2KB2A 4RW8B 4M8LA 3TAPA 1JXLA 1P1TA 5IXUA 1Y9OA 4CLFA 5F8MA 3GSDA 3V81B 5LSRA 3BGLA 4AE5A 3AA8A 3GV8B 4ZP7A 1IN0A 2W9AA 2FTRA 3MZIA 5GMDA 2DBBA 1RJJA 2OTLS 2JC0A 4Y0FA 3CO0P 2FY1A 2YVSA 2IM3A 2BJ9A 3MR6A 1MROB 1CJVB 1NPPA 1P8GA 4F04B 3QGGA 2HHQA 2Z2ZA 3HT3A 5HN0A 3BH6B 1NRKA 4ID5B 3MEDA 8RUCA 1F2GA 3DLGA 4EZ9A 1HQEA 5KG1A 3D67A 1SL2A 1R89A 5IT9Y 4ILMA 3I31A 1SQGA 2MZTA 3E01A 4OYMA 4BCAA 2V4JA 5EWFA 3CO9A 1TL5A 2ZDOA 2XM3A 5KFLA 2JLEA 4FNHA 3L09A 5E3QA 3PEHA 2VG7A 1TFWA 2CZ9A 4OI3A 4URSA 4Q2LA 4NEZA 3PIPQ 2M8DB 4ECRA 2DK2A 2N3LA 2LDYA 1ZZNA 3THPA 3GIIA 2W2NP 4CLSA 4ED1A 3H2UB 4KH0B 2NSCA 2FIUA 1WSVA 2XEXA 5KG6A 2D7SA 3J7Z5 1MW7A 3CDEA 2VU5A 3BB5A 1T11A 4FKYA 1S6PA 1IR0A 2VPWB 2J7WA 1KVJA 5IWAJ 2R7UA 5DQIA 3ONQA 3MEDB 4YB7A 3DLGB 1UEKA 2APOA 1HQEB 1WG5A 4JYAF 4QW9A 4P2MA 3GFXA 4XIUA 1HBUA 4LF1A 4NLUA 4ELTA 4AXIA 3JSMA 2ZDPA 1FRJA 4KTQA 3CCES 3E01B 2ZBRA 2V4JB 4GKJJ 1KOHA 4NWBA 3ZZTA 1BE4A 3UQSA 4Q45A 1OO0B 4C7QA 3W7BA 1NHVA 3W8GA 3VGVA 2VG7B 2DO0A 4MK8A 1F3FA 2L9NA 3BSCA 8AT1B 2RNEA 4OI4A 2J7UA 3DXBA 1XMQF 2M5YA 2R7OA 5HQLA 1S1TA 1WI6A 2XBPA 3CJ8A 2R2TA 3KK1A 2MHEA 4IQXA 2MLZA 3AHPA 2C28A 2KJWA 4LRDA 4ITSA 3GWCA 2AEFA 3TQEA 2NLWA 2MPUA 4DV7J 1WC3A 3R2CJ 2VBXA 3DOLA 2AF6A 4X64J 1HNXJ 1S6PB 4U95A 2VA2A 2OELA 2RU9A 4QIGA 3M2UA 1S6UA 2FHKA 5IT9U 2CXEA 3OD2A 3UN3A 4KHPJ 5KFSA 4FYVB 1HBUB 2QMUB 4K0KF 4I64A 2FVQA 3KK3B 2LDIA 3LWMA 3JSMB 3FBCA 4PUOA 2MKHA 2J7KA 1VHIA 3OBIA 5K5MA 1VISA 3CF5Q 3TVKA 2XS5A 2ZVIA 3PHEA 2WCXA 2FLLA 2R8JA 1XERA 2NXUA 3PW2A 4M63A 2YX7A 2PA8D 3JSBA 3H59A 3QIDA 3T1HJ 5CD4H 2Z4PA 1S1TB 4RPFA 2Y1IA 1I94J 3BQ2A 3JYTB 2JEJA 3P96A 1N52B 4V19X 3KK1B 1CJKA 2CZ4A 2DGUA 1SCJB 3R7SB 2W2MP 2YQ3A 2ILZA 1N32F 4PEOA 4HKQA 2GMJA 4L76A 6FDRA 1D3WA 3DOLB 5A6PA 1R8AA 2LXUA 3I56S 1A0OB 4MYUA 2B7BB 4C6AA 3M2UB 3FNNA 3PX4A 4HEA9 1N6QA 3EUNA 1LOUA 2IRXA 2JVOA 5HMZA 4HACA 3AODA 1YRUA 3DLEA 5DG9A 3CCWA 4YOEA 1H98A 2PMWA 1PGZA 1RAIB 4WE1A 4LFBF 2R2SA 2FB0A 2EKYA 4NCBA 2LXFA 1YK9A 4PUOB 2F4VF 5EDWA 2FZKB 2WVCA 4DV0F 3OPKA 3VGSA 4WF9Q 3D0HE 4DPWA 1RAJA 2XCAA 3MM9A 4ANCA 2E9RX 3WHIA 3UO0A 2D3OR 1M0SA 3W5XA 1GMVA 1PYTA 1DARA 3DI6A 2GHPA 2GJ2A 4USHA 3H5XA 2GJIA 1U25A 2VZ9A 3GFHA 2OTJS 3L95X 3I9V9 3CD7A 1CJKB 1S99A 1U1OA 3LF0A 1ZZFA 2QA4G 2RE1A 2J0SD 4UOCA 3CCVS 4J9LA 4XAKA 3IS9A 2ROGA 2Q66A 1ZPWX 4M5HA 4USWA 3A1YG 4O0NA 2G0CA 4EO6A 1ZA1B 1HQ2A 2NYHA 4RKUC 1LKZA 1RWNB 1N6QB 3CJ2A 5HJYA 1SJ3P 4HACB 1VFJA 2GV1A 3DLEB 3N28A 2KL8A 4WE1B 4BBYA 1RTHA 4NEYA 2J8SA 4DQSA 5DDRC 3AQOA 4OYAA 1FKOA 3Q24A 1BD6A 1L3KA 4LF7J 2RRNA 4NRTA 1C1BA 1DY3A 4AQYF 3SI8A 4JUZA 4DR4F 3MM9B 2JH3A 4KPYA 1DQ9A 4DWIA 2FJVA 5ETOA 1KRPA 4LBPA 5CYMA 4PG6A 4ZJOA 1ZAXA 2VPXB 3FZ2A 3DI6B 3BO2A 4Q7AA 3MHYA 5HK4A 3CB4A 2QFJA 2BV3A 2DR9A 4IQMA 2YNHA 4Q0BA 3D7SB 3TZZA 4U8YA 2HLUA 4WYLA 4CTAA 4ES1A 4UY85 4KBIA 5A8KA 4G1QA 2ZH6A 1V6HA 4C9DA 3IS9B 3UWTA 5AXLA 2DNQA 3IR6B 3Q8QB 2ZH8A 2ADCA 4FPRA 5E7OB 2RVJA 4WP3A 1D09B 1RDRA 2C3OA 5K8PA 2NS1B 5LM7E 4GC7A 2MZRA 1EJ7L 1J5OA 3MCMA 3QPIA 2IVFB 3M8RA 1RTHB 1RU2A 1FKOB 2CQ0A 3UDLA 4IYQA 4OYXA 2KKHA 4DL4A 1C1BB 2OGUA 3W60A 1RAGB 4R8UA 4C8YA 2QL5B 1BQXA 4GMKA 2HBYB 2IM2A 2BA9A 1FD8A 5CZXA 3FGVA 1IJFB 5CYMB 3V4MA 5J1EA 1QJHA 4K2JA 4C8MA 2DGTA 2RQMA 1TL7A 2YNHB 3PACA 4Q0BB 1FEHA 4QIFA 2HFZA 5IM0A 2B4VA 4MT1A 5IC4B 4ILLA 4LSNA 4CTAB 3TQ1A 2QYCA 4ZVTB 2WB1D 4CM0A 5F8JA 3L9ZA 5A8KB 4G1QB 3SMZA 4JI7F 5LMNJ 4I6YA 1IJEB 1WSRA 1WHXA 3VAKA 3H2LA 2YKAA 2WVDA 2O66A 1T9TA 2YNFA 5I4MA 1X4DA 3M2RA 3BO4A 1SUQA 2CJQA 3H4DA 4FF3A 3ZZOA 2HMIA 1SPBP 2EEYA 3FC9A 5KFXA 5IQQA 1DHMA 3HI9A 5HAOA 2QA1A 2YWGA 3SZ2A 4R8UB 3FSYA 1U1RA 4CLTA 2EFGA 3R97A 1NZ8A 3W5ZA 4PABA 5CA5A 1I1GA 5J1EB 3MFIA 5KFUA 3LH2S 2JVRA 1FFWB 1TL7B 1F3VA 1KQFB 2DT9A 2DB1A 5IM0B 2CPJA 3FCHA 1GAOA 4LSNB 4ZVGA 4AT1B 2HHHJ 3G82A 1JLAA 4DSLA 2FVRA 3SXLA 1K1SA 2UUWA 4CH7A 3CDBA 1K47A 2QLWA 1AFIA 4X62J 4EGLA 3M8YA 2GO9A 4DX5A 2YNFB 2DGVA 3M2RB 4HR2A 1SUQB 4USJC 2ZHAA 3SSRA 2HMIB 4NZ0A 3ZO7A 2PIIA 1L5UA 2AYMA 4J9UE 1VOMA 2CVEA 1IBKF 5F8LA 1MWZA 1RT4A 2I5JA 4Q8EA 5BYRA 4CLUA 1Q8BA 1R8HA 1GMUA 2JOQA 2NUUG 5H1SV 4LRCA 2Z2LA 4IG0A 3UFCX 3CJ5A 3C2PA 2WVBA 1TKDA 4I67A 3W9HA 3BR8A 2Q43A 4YUDA 1VC0A 1VIOA 4PXDA 4GKKF 1X7VA 2ZC4A 2CADA 1LW2A 3Q8PB 3G82B 1JLAB 4P7VA 1B0TA 5AT1B 3RRKA 1SI9A 1HR0F 3HSZA 1VQPS 5KFOA 3OTOJ 2DR6A 3TOQA 1NM2A 4UUXA 4ED5A 4EZ6A 2RU3A 4HT5A 4A8WA 1VQOS 2FZCB 2XMVA 2XYHB 4ZK7M 3IWXA 4QU6A 4WCEQ 3I5CA 3FZBA 2VL1A 4NLXA 3R1LA 3U1MA 1UJ4A 2NCKL 5K20B 3OFEA 1HBMA 3BBFA 1WELA 1CC7A 3MR3A 2C42A 1V3SA 2EK6A 1QDUB 1YBAA 1RT4B 2I5JB 4AL6A 3K5LA 4C8LA 2QA2A 4ILRA 2ALYB 2G4BA 4CLKA 2GZOA 4UOFA 3ZZ0A 3D6MB 2HNDA 2HGMA 1UVKA 3QIPA 2M7SA 4IG0B 2HURA 1B0VA 1DLOB 2O01C 2H54B 3OUYA 3N6LA 1LK5A 4ZPBA 1N32J 2XMKA 1N8RT 1RAFB 1KVIA 1LW2B 1N0UA 2DY1A 1ZTWA 1NNDA 3CJTA 3T5HA 2C2EA 1TL1A 2ASYA 3R1HA 2FJXA 4CH0S 2IRUA 3F73A 2XGPA 3H2VE 2HRYA 4DR1F 1KSPA 1Z4UA 2F9DA 1X9SA 2IC3A 4PWUA 1WOPA 2MYFA 4PQAA 5DRKA 4Q43A 2R7WA 1RTJA 2OPPA 4OZJA 5B7WA 3L7PA 3D9BA 4UTGA 2F4VJ 1RWWB 4NLPA 1HBMB 1SIZA 1N54B 4PPZA 1W2IA 4TN2A 1T02A 5CCLA 4O3SA 1AZSA 4RW6A 5J2QA 3PYGA 3GIRA 3VVUA 3GR1A 2ZBIA 3NAHA 2B4OA 2HNDB 2ZH1A 3IP0A 3QIPB 1NDPA 2LXIA 1HI0P 3H0PA 4DV3J 3FBEA 5KFMA 4L72B 1JMTA 1S59A 4J7CA 3OR1A 3OXLA 3OUYB 3CXCR 1GQEA 2DNYA 3UD3P 3THVA 3EXYA 2MQNA 1F5AA 4AD6A 4JOUA 4WXOA 1QE1A 1TL1B 4QR0A 4EBEA 3BH7B 4OJHA 1NSQA 2XB2D 1T95A 3WQPA 2RS8A 1S57A 4NMLA 1WD6A 2NPFA 2R2UA 1RLDA 1T8EA 3BGRA 1WC4A 1Y0HA 4B9SA 2IC3B 4I1TA 2MLXA 2CAJA 2XHWA 3L7UA 1RTJB 4U7UK 5DDPC 1XR6A 2OPPB 4TVAB 4GRSA 3V6HA 3GONA 3MMBA 1T9VA 2G2ZA 2UU9F 4RZRA 1AZSB 2QLJB 4RW6B 5J2QB 4OYZA 4DR4J 2JLGA 2HVEA 1X4HA 2HZVA 2JRSA 5KFIA 5JUMA 3EICA 2FJBB 3TYTA 3NRBA 3W66A 2YQ0A 1WF0A 3EVMA 2K8GA 4OHYA 1SC1B 1JNZB 2HFNA 2QLBB 1HARA 4OV6A 4UT4A 2E9ZA 3KJQB 4JI6F 1T0TV 1H0HB 1IKXA 3OR1B 3HVWA 4RNOA 1TR0A 1ZPVA 5FLXY 3PX6A 5KFVA 2FC9A 3DLJA 1WC1A 1WDTA 3GQCA 2HHUA
chains in the Genus database with same CATH topology
2HBRB 3D6HB 1BMQB 4DCJB 2H4WB 3IBFB 2XYHB 3P45B 1RWKB 2HBQB 2XZDB 5IC6B 4ZVUB 1F9EB 1PYOB 1GFWB 1NMEB 3QNWB 2CJYB 2C2OB 1RHMB 2C2MB 3EDRB 3R7BB 4ZVSB 4DCOB 5K20B 1RHQB 2DKOB 1RWWB 2QL5B 1QDUB 1RWXB 1RHUB 2H4YB 1I3OB 4ZVQB 2H5JB 3R7NB 2HBYB 2C2KB 2QL7B 2QLJB 4JB8B 2XYPB 2C1EB 2QLFB 4DCPB 3D6MB 2XZTB 2H65B 3GJQB 3SIPB 2CDRB 1RHJB 2CNOB 3GJTB 2Y1LB 2FQQB 2P2CB 1SC3B 3R7SB 2HBZB 1RWPB 3R6GB 2CJXB 2CNLB 1ICEB 3EDQB 1SC1B 3GJRB 2QLBB 5IC4B 3KJQB 1RHRB 2H54B 2CNNB 1SC4B 4ZVTB 2H5IB 3R5JB 3KJNB 3IBCB 4LSZB 2CNKB 1PAUB 2H48B 2QL9B 1RE1B 2C2ZB 3D6FB 4ZVOB 1RWMB 1RHKB 1IBCB 3GJSB 2H51B 2XYGB 1I51B 3KJFB 2Y0BB 4ZVRB 1RWOB 3P4UB 3RJMB 1RWNB 3R6LB 1QTNB 4ZVPB 3NS7B 1RWVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HBR B;  3D6H B;  1BMQ B;  4DCJ B;  2H4W B;  3IBF B;  2XYH B;  3P45 B;  1RWK B;  2HBQ B;  2XZD B;  5IC6 B;  4ZVU B;  1F9E B;  1PYO B;  1GFW B;  1NME B;  3QNW B;  2CJY B;  2C2O B;  1RHM B;  2C2M B;  3EDR B;  3R7B B;  4ZVS B;  4DCO B;  5K20 B;  1RHQ B;  2DKO B;  1RWW B;  2QL5 B;  1QDU B;  1RWX B;  1RHU B;  2H4Y B;  1I3O B;  4ZVQ B;  2H5J B;  3R7N B;  2HBY B;  2C2K B;  2QL7 B;  2QLJ B;  4JB8 B;  2XYP B;  2C1E B;  2QLF B;  4DCP B;  3D6M B;  2XZT B;  2H65 B;  3GJQ B;  3SIP B;  2CDR B;  1RHJ B;  2CNO B;  3GJT B;  2Y1L B;  2FQQ B;  2P2C B;  1SC3 B;  3R7S B;  2HBZ B;  1RWP B;  3R6G B;  2CJX B;  2CNL B;  1ICE B;  3EDQ B;  1SC1 B;  3GJR B;  2QLB B;  5IC4 B;  3KJQ B;  1RHR B;  2H54 B;  2CNN B;  1SC4 B;  4ZVT B;  2H5I B;  3R5J B;  3KJN B;  3IBC B;  4LSZ B;  2CNK B;  1PAU B;  2H48 B;  2QL9 B;  1RE1 B;  2C2Z B;  3D6F B;  4ZVO B;  1RWM B;  1RHK B;  1IBC B;  3GJS B;  2H51 B;  2XYG B;  1I51 B;  3KJF B;  2Y0B B;  4ZVR B;  1RWO B;  3P4U B;  3RJM B;  1RWN B;  3R6L B;  1QTN B;  4ZVP B;  3NS7 B;  1RWV B; 
#chains in the Genus database with same CATH topology
 1APS A;  3H8Y A;  3DHW C;  4IR1 A;  1WF1 A;  1QE1 B;  4EI2 A;  4KAI A;  3TUP A;  1RTI B;  1KQS R;  4DL7 A;  1AXQ A;  5E33 A;  4DLE A;  1FK9 A;  3BGR B;  4XK8 C;  3PZP A;  1W26 A;  2W25 A;  3BEG B;  1JWW A;  3KLI A;  1FWL A;  1X60 A;  3I0S A;  3FQK A;  1FVS A;  4P71 A;  3CCM S;  1CVJ A;  4AFF A;  3MMB B;  3QJP A;  3TA1 A;  3T1Y J;  4ZVF A;  3ZTP A;  1E6V A;  1R27 B;  2EFV A;  2FQQ B;  4GO5 X;  1XNR F;  1N88 A;  3AJD A;  2IA6 A;  1KEK A;  1HNW J;  1O51 A;  3BZQ A;  2V50 A;  1HLW A;  7FDR A;  4B3S J;  1C0T A;  3U1N A;  1HWK A;  2FLN A;  3UVJ A;  4J9N A;  3Q22 A;  4NLT A;  5IV4 A;  1XMO F;  2B9Y A;  1IKX B;  2BKO A;  4YDX A;  3PV8 A;  1RHK B;  4BC9 A;  4CNZ A;  2YKP A;  4HDG A;  3F41 A;  3G8T A;  3A4T A;  3WX8 A;  4OI1 A;  2YNG A;  1RCO B;  5H9E J;  1FTR A;  1DRZ A;  3OVA A;  2D74 B;  3EWG A;  2C2D A;  3NS7 B;  2UUB J;  4JI1 J;  3JQJ A;  1H7X A;  5E2Q A;  2E66 A;  3AOA A;  4DV1 J;  3QAU A;  4XTT A;  4DSJ A;  2HPU A;  6AT1 B;  4JI4 J;  2MDA A;  2V5H G;  4WFZ A;  5B0C A;  3QZ7 A;  3QAT A;  4DR2 F;  4CQ1 A;  1FK9 B;  2AT1 B;  1RHQ B;  2ZD1 A;  3GG0 A;  2ALZ A;  1SH3 A;  3KLI B;  2R8I A;  4CO3 A;  3I0S B;  2M4M A;  4TYA A;  2GQQ A;  5D6G A;  4YS2 A;  1K73 T;  1MML A;  1S49 A;  3H25 A;  5GAE I;  1E6V B;  3U1L A;  4A8O A;  4RO0 A;  1V3R A;  1MWQ A;  2V9K A;  4J90 A;  3CCU S;  4OQJ A;  4KPC A;  4CI0 B;  1S1W A;  1IR2 A;  1C0T B;  4LSZ B;  5D0E A;  5ETM A;  3UVJ B;  2HFV A;  1M90 T;  1UW9 A;  2UVW A;  2OI2 A;  3CCL S;  2CQH A;  4EWT A;  2ZNZ A;  1UFK A;  3DRR A;  1PYS B;  2NXJ A;  2YNG B;  3HK2 A;  2J5A A;  3ZNU A;  3M8S A;  2CG8 A;  1TUW A;  4H4O A;  4HVZ A;  4IFY A;  1SJ4 P;  2EKN A;  2ZZM A;  2J9D E;  1VC5 A;  2DNM A;  2UUC F;  2XTJ P;  5B0F A;  2DRA A;  2E1P A;  1M5K C;  3K8V A;  2QA4 S;  1DQA A;  3TAN A;  3FK4 A;  3QT6 A;  1UA0 A;  3VAI A;  4JV5 F;  3B4D A;  4C8O A;  1RBL A;  2ZFH A;  3TI0 A;  2FLP A;  1L3U A;  1R8C A;  2ZD1 B;  5AJ3 F;  3GYX B;  4NI2 A;  1LW0 A;  1FE0 A;  1KFD A;  2JNJ A;  1H2U X;  3ENW A;  4KB7 A;  2AYG A;  2V8H A;  2IJF A;  4FBU A;  3SFU A;  1KD1 T;  2PMZ D;  1BHN A;  2CNL B;  5C42 B;  1TKT A;  3MR5 A;  2CPH A;  3NOG A;  4JI3 F;  4X66 F;  2D9P A;  1S1W B;  4RJV A;  1FCA A;  4OYW A;  2XLJ A;  2VAS A;  2WBR A;  4BWJ A;  4RNM A;  2W7P A;  1Q7Y T;  1UTA A;  1XN9 A;  3A8E A;  3DRR B;  4OLO A;  4Y3C A;  1C4C A;  2QRR A;  2XQC A;  2HBR B;  1HR0 J;  1KTQ A;  2RQK A;  4K4U A;  4H4O B;  1NKE A;  3W9J A;  4IFY B;  3T41 A;  2EPI A;  4A4J A;  2DR5 A;  1NK5 A;  1YJU A;  3PHT A;  3PR4 A;  3H20 A;  5L39 A;  1Q7L B;  2KHC A;  3DFE A;  3BSN A;  2AD9 A;  4OX7 A;  1VRQ C;  4YY3 J;  3NNC A;  4OZ1 A;  3W61 A;  4ZN3 A;  1FRX A;  3HJV A;  4NI2 B;  1WOO A;  1VQ9 S;  3BGF A;  2V68 A;  3R9L A;  1P1L A;  4F36 A;  1RWU A;  3PRD A;  1EQ0 A;  4IOB A;  5DDQ C;  1F9H A;  3CCQ S;  3NLC A;  2DRD A;  4F4A A;  3ZTS A;  1BXN A;  1N0V C;  1F60 B;  1TKT B;  5A2Q Y;  5B0B A;  3OTE A;  4UUW A;  2BM1 A;  2KZZ A;  1YQH A;  3DDI A;  4X4Q A;  3SFG A;  4NXM F;  1Z2L A;  1HBN A;  1H72 C;  2H51 B;  2WSE C;  5IZH A;  2VBZ A;  2CG4 A;  2CJB A;  3GCX P;  5JMN A;  2EK1 A;  2AWZ A;  2D1C A;  4UQG A;  1YBU A;  4TQR A;  2PSZ A;  4QWD A;  1W7W A;  4AUK A;  5F0W A;  2DNL A;  3DRX A;  3CWJ A;  3HMJ G;  4YR3 A;  4RNH A;  4ECW A;  3R5G A;  1RKJ A;  3BQ1 A;  3BKF A;  5DQH A;  1PJ7 A;  1MLA A;  2ZWP A;  2YWK A;  3DLL Q;  3PTW A;  5ETT A;  4KHR A;  2FD2 A;  2XI2 A;  4MYT A;  3M6V A;  5U47 A;  1YIJ S;  3Q86 A;  4A8Y A;  1RT3 A;  3LPE A;  5I3U A;  2ZE2 A;  2GML A;  3MXH P;  3J80 U;  4BDP A;  1U24 A;  1UWB A;  2GA7 A;  1HI8 A;  1HWJ A;  3EJM A;  3J7A 1;  1T9W A;  3MOJ B;  4ECU A;  2KVI A;  3UN5 A;  4D3H A;  1RWM B;  3RBX A;  2VF3 A;  2QC3 A;  2UXC J;  1T9X A;  4I0W A;  2Q79 A;  1HBN B;  2F8M A;  4LT6 A;  4FZV A;  3BBC A;  4DZD A;  2CA9 A;  3OXF A;  1OY8 A;  3IRW P;  3J7Y I;  3MWB A;  3HKZ D;  1FNO A;  3VCD A;  3VV2 B;  3A3P B;  1DJ0 A;  4CNY A;  5HRO A;  4OZ3 A;  1FI4 A;  3CPW R;  1K44 A;  1Q16 B;  1JJ2 R;  1LWE B;  1Z2Z A;  3NKY A;  2VQE F;  5CYJ A;  2DNO A;  1XTZ A;  1K8A T;  2K2P A;  3IM9 A;  4RW9 A;  2FDN A;  1B99 A;  2Q1L A;  2CQI A;  1RQ0 A;  4KGK A;  4S0M A;  4DQR A;  2CQD A;  1TV6 A;  1NK8 A;  4OYI A;  1SC3 B;  4K50 A;  1RT3 B;  2ZM6 F;  4NLQ A;  3A3N B;  5I3U B;  2ZE2 B;  1AFJ A;  3N5B A;  3Q8V A;  3ZZU A;  1UWB B;  2WRM A;  4NA2 A;  4WK1 A;  3BSO A;  3R5J B;  2CNK B;  4KSE B;  4JV0 A;  1VQY A;  5ITH A;  2DGW A;  1NBE B;  4NX9 A;  3TO8 A;  3BN4 A;  2OFH X;  2DH8 A;  1JB0 C;  2PT0 A;  2FZG B;  3N0V A;  3P49 B;  1QAI A;  3EGZ A;  1C1C A;  1FJG F;  2QIF A;  4C11 A;  4UZC A;  3M9M B;  3VGT A;  5HRO B;  4ZVS B;  5HVG A;  3NGS A;  4Q2M A;  2DTJ A;  5KOW A;  3UN2 A;  4TXS A;  1SKW A;  3MMC A;  4BLG A;  2X3D A;  1TK8 A;  4RW9 B;  2CJK A;  1J5E F;  1X9M A;  2F9J A;  4QCL A;  3MM6 B;  3P5T L;  3SIP B;  5KFQ A;  4A48 A;  1TEL A;  1GX6 A;  3HDS A;  3FCW A;  2Y1L B;  1TV6 B;  2HBZ B;  2JWN A;  5B0A A;  2JHE A;  3UR3 C;  4O3P A;  3D1O A;  1XNR J;  4W90 B;  2HKE A;  1Y3J A;  3LP0 A;  2HWT A;  1WEZ A;  2W4C A;  1JX4 A;  2NUH A;  4YB6 A;  4NZ7 A;  2FVP A;  3TEH B;  3W65 A;  1CG2 A;  1XMO J;  4DX6 A;  1HKA A;  1HA1 A;  1T7P A;  3M6U A;  1Y4Z B;  3GPA A;  1C1C B;  3MR2 A;  4ZVU B;  2MGZ A;  4RX6 A;  4C11 B;  2AYE A;  5KFN A;  2FJE B;  3FDS A;  2K7J A;  4ANE A;  3MR7 A;  4F26 A;  3VAL A;  1N33 F;  1IXK A;  2VC1 A;  5KFC A;  2VV5 A;  3O3L A;  4M5G A;  3C16 A;  3MMC B;  4K4X A;  2MQL A;  1NDK A;  5CYQ A;  4PG8 A;  4FS2 A;  3H4B A;  1FWP A;  5KFJ A;  1EQM A;  2DEI A;  3IWL A;  4QIW D;  4QWA A;  5KT4 A;  2F40 A;  2K7K A;  4PQU A;  2HLT A;  1FDA A;  1SKR A;  2RSQ A;  4IOA Q;  1JLE A;  1QSL A;  3LP0 B;  2RUG A;  2YX1 A;  2MXY A;  1S72 S;  2YH0 A;  3LGM A;  4CLY A;  9RUB A;  4LJM A;  3PYE A;  1S77 D;  3H5Y A;  2RAQ A;  1RP5 A;  2E1A A;  4J37 A;  1X0F A;  3PO5 A;  4IFV A;  4OI0 A;  2XMW A;  3D2W A;  1N5Y A;  2VOO A;  1FRH A;  3NY0 A;  4N5S A;  2N3O A;  1JLC A;  2MGZ B;  2R8G A;  4DXL A;  3GLJ A;  4RU9 A;  2VOD A;  3GIM A;  2UUC J;  4B3M F;  1Y11 A;  2Y0S D;  3M32 A;  2GFF A;  3B82 A;  3T6B A;  8ATC B;  2RT3 A;  4PG7 A;  4USK A;  1YX2 A;  1I3O B;  4QYZ J;  4AYB D;  3C16 B;  4B3T F;  4CT9 A;  5AJ3 J;  2C3M A;  3AXM A;  5CYQ B;  1HHT P;  2KI2 A;  2CNO B;  3K7R A;  2AMC B;  4HH1 A;  3T9Z A;  2PO4 A;  3EX7 B;  2CIM A;  5ETV A;  2W2Q P;  1SXL A;  2VOP A;  3MCN A;  3HSG A;  1KR4 A;  1LWC A;  4PQU B;  4KO0 A;  1HIY A;  1W25 A;  1JLE B;  2P5V A;  3KXD A;  1VK3 A;  4NPO A;  3KJV A;  1HNZ F;  3HZE A;  1NU4 A;  2GMH A;  2YY3 A;  1DTQ A;  1KS2 A;  2MQ8 A;  1U09 A;  4NLG A;  4WKY A;  4A8Q A;  4ZJL A;  4DCJ B;  1NZA A;  1GNK A;  3RB0 A;  4IFV B;  1T03 A;  2IIH A;  3GIL A;  4DJB A;  1N5Y B;  5L1K A;  1Q8K A;  1NME B;  1JLC B;  4IO9 Q;  4P75 A;  2EFQ A;  2ERR A;  4USU A;  1YLX A;  4WJB A;  4MMO A;  3M32 B;  3NMR A;  2OJ3 A;  4NLD A;  2QT7 A;  4FVC A;  2MKC A;  4Y2A A;  1Q81 T;  3N4W A;  3ZFV A;  3KHR A;  2M0G B;  2C1E B;  3LO3 A;  4NL5 A;  3SBM A;  4PYD A;  5HQM A;  1FD2 A;  1RYS A;  4MIA A;  1N56 A;  4RUB A;  2FYX A;  2ZH3 A;  5EUH A;  5L38 A;  1BC6 A;  1FER A;  1WHW A;  5KFT A;  4ETX A;  1SC4 B;  4K4W A;  1FDB A;  4PZV A;  1S97 A;  3HM9 A;  1LWC B;  1FO1 A;  4KO0 B;  2D3U A;  3GJS B;  3TVY A;  4G65 A;  4L3K A;  1UA1 A;  5CH7 B;  3KJV B;  4ICL A;  1S1U A;  2VDI A;  5DLF A;  1QTN B;  4NXM J;  1Y5L B;  1OIA A;  3D68 A;  1DTQ B;  5LJ5 Y;  4AXJ A;  4L6V 3;  1T05 A;  5AE2 A;  4C8K A;  1OSD A;  3CW2 C;  4WIQ A;  1NH8 A;  1PSD A;  2FHM A;  1T03 B;  3K57 A;  3IG1 A;  1WHV A;  1WUU A;  1SH0 A;  5JXS A;  1JJH A;  1YRT A;  5J1P A;  3QRP A;  3RW7 A;  3D28 A;  3G8Q A;  4CZC A;  4OZN A;  3SQG A;  2RDD A;  4MK9 A;  3CC7 S;  2QEX S;  1TK5 A;  5IWA F;  1X5O A;  2J8A A;  2BJ3 A;  1PAE X;  1VYA A;  1R6Y A;  3ETO A;  3HCX A;  4OYP A;  2KHD A;  2MKS A;  3KMQ A;  5KG0 A;  2V6A A;  2U1A A;  1U6B A;  3GFZ A;  5IV3 A;  1EAY C;  1HYS A;  3DOK A;  1PO6 A;  1P27 B;  1VBX A;  4OLP A;  3PY8 A;  1S7H A;  1YZ6 A;  4P52 A;  5HLF A;  2ZOM A;  4IDK A;  3MUV P;  2CPI A;  1ZM3 A;  2V94 A;  2MQM A;  3I4P A;  4NXN J;  4ICL B;  1S1U B;  3RTV A;  3H90 A;  2BUN A;  1T05 B;  5HSP A;  2B3T B;  2C2M B;  4WU2 A;  3IG1 B;  1SJF A;  3ENQ A;  3BGU A;  1S79 A;  9ATC B;  4DV7 F;  4ES2 A;  2B8P A;  4ZPD A;  3DLK A;  4X64 F;  1HNX F;  4X65 J;  4FXV A;  3SQG B;  1BLU A;  4OYB A;  1GEH A;  1VGY A;  2HS0 A;  2ZJQ Q;  2DIV A;  5JVH Q;  1R0C B;  4OHZ A;  3US5 A;  4KHP F;  3UDE A;  2VFT A;  2UZA A;  2G13 A;  1H73 A;  2UP1 A;  5DJB A;  4P72 A;  3R6G B;  3PKY A;  4M5I A;  4B17 A;  1REG X;  2ZH2 A;  1EHW A;  3ISN D;  1HYS B;  1R8B A;  2IBO A;  3KUE A;  4A47 A;  5DGB A;  4TYB A;  3DOK B;  2DPJ A;  1CJT A;  2R7X A;  3T5L A;  2E9T A;  4B3R F;  5E41 A;  3W9I A;  2HHX A;  4DFK A;  1S7I A;  5HLF B;  3KK2 A;  1NDL A;  4IDK B;  1RI7 A;  3BN7 A;  4U96 A;  4UQT A;  1XC9 A;  2ASD A;  4UZB A;  1G4C A;  3T1H F;  2CQC A;  5IC6 B;  3G6E S;  1KBR A;  1I94 F;  4P6Q A;  3PVX A;  3JAM U;  3KLF A;  5DG7 A;  4X4T A;  2RDJ A;  2E1M C;  5BYS A;  4PR6 A;  4F3Q A;  1R8P A;  1JJ4 A;  1A9N B;  3DLK B;  1M5V C;  3EVO A;  2EI5 A;  4NYZ A;  4CLP A;  1T3N A;  2UXB F;  2EXU A;  3D0I E;  5HMX A;  1S48 A;  1HMV A;  1MG7 A;  3H40 A;  2RIJ A;  4RUC A;  3IBW A;  4IRC A;  2HHV A;  3NS5 A;  4ECY A;  1RGV A;  2BJD A;  4LF9 J;  4GO7 X;  3ZXW A;  2H5E A;  5CQG A;  1YJR A;  2OFG X;  5L8R C;  2C2Z B;  1CJT B;  3D1H A;  3O44 A;  2EFN A;  3AJ1 A;  4PRF A;  3EPI A;  1RT5 A;  1BWV A;  2Y0B B;  2KXH A;  2VPZ B;  5KFY A;  4ZPA A;  1UL3 A;  3KK2 B;  3N6N A;  3TWZ A;  4ECT A;  3MPW A;  2V2K A;  4ZP9 A;  1S9F A;  2X7I A;  4P9S A;  1UVJ A;  3G6X A;  3VVT A;  1Q8L A;  2DNK A;  4DN0 A;  2OKQ A;  2XHC A;  3HSD A;  4OX9 J;  3BRE A;  2XMJ A;  3WIU A;  3RZA A;  2B51 A;  2F63 A;  1N33 J;  1ELO A;  2M2B A;  1PIE A;  4ZLP A;  4FYD A;  4PXB A;  2EVZ A;  4B3O A;  5KG4 A;  2W4P A;  3ETM A;  3A8J A;  5DQG A;  2F3J A;  3VZI A;  2LQ8 A;  2PFD A;  3F0N A;  1CS4 A;  1B4S A;  4DFP A;  2KT5 A;  1HMV B;  1U26 A;  3ICL A;  1IR1 A;  5D3G A;  5IT4 A;  2AW0 A;  3JB9 k;  3NBP A;  2IJR A;  4B08 A;  3AFG A;  5FDL A;  4A8S A;  3DMJ A;  3NEK A;  3BS9 A;  1V9O A;  4PAA A;  1TMM A;  2IM0 A;  4DSE A;  1KON A;  2IFX A;  3MPY A;  3OW2 R;  1PG5 B;  2KH9 A;  1S9G A;  4MFB A;  1UJ6 A;  2HGN A;  3O5T B;  2MZJ A;  1RT5 B;  3QAE A;  4EEY A;  3J7Z T;  2W24 A;  4LF4 J;  1Q82 T;  4NA1 A;  3X1L B;  4NAS A;  4F4Y A;  3K0J A;  4X84 A;  4RLE A;  4LF8 J;  3UI3 A;  3T5J A;  1SV5 A;  1J27 A;  2CQ2 A;  2A6O A;  2YPY A;  1WI8 A;  1T9U A;  3HHL C;  4ZMM A;  4IH6 A;  2PI5 A;  2GC8 A;  2ZHO A;  5HAT A;  4USI A;  2N4D A;  3W5Y A;  1PBA A;  4DPU A;  2YNI A;  3OHA A;  4KQZ A;  4O0I A;  3IFE A;  2DHG A;  1Q95 G;  4DUT A;  5KFE A;  1XR7 A;  5D15 A;  1UPP A;  4B3O B;  3SV4 A;  3SV3 A;  5M2U A;  1VQK S;  3NL0 A;  4O44 A;  1CS4 B;  2B6A A;  1ICE B;  4YN3 B;  5D3G B;  3EZU A;  3NBP B;  2IM1 A;  1MMN A;  2DH7 A;  5F3T A;  2C3P A;  5FDL B;  4ECQ A;  2G1H A;  3DMJ B;  5E3A A;  1D8Y A;  1DFD A;  4ZLJ A;  2ABY A;  3IXQ A;  1M5P C;  3PW7 A;  3U02 A;  4MFB B;  2BMB A;  4TU9 A;  2FGO A;  1C0U A;  2ZUG A;  1HNZ J;  2L9D A;  2DD8 S;  2E5I A;  1RTD A;  4DV5 F;  4C2M A;  5IT0 A;  1SV5 B;  1SL0 A;  4ZIV A;  3CIM A;  2UV8 A;  3AXK A;  3OTD A;  2DKO B;  1YJN S;  4I56 A;  2VFR A;  3JTN A;  3I87 A;  2YNI B;  3V5R A;  1UEV A;  2QX0 A;  3PKM A;  2YKM A;  2MY7 A;  3CJS A;  1RBA A;  2B0G A;  3PO4 A;  5LMN F;  4NCA A;  3UR0 A;  1FE4 A;  3HHE A;  4W92 B;  3FVY A;  3MM8 A;  2GAH C;  1SH2 A;  4CIO A;  2JX2 A;  3HX9 A;  3NWG A;  4DG1 A;  4TY8 A;  4O44 B;  1XIQ A;  3KLV A;  2V0N A;  2B6A B;  3ILI A;  1IM6 A;  4RNN A;  3AB4 B;  4MH8 A;  1KN6 A;  3G86 A;  3CTR A;  3QZ8 A;  4F4X A;  2HQI A;  1HD0 A;  1C0U B;  2J9D A;  3A8I A;  2O1P A;  2CPF A;  2V2Z A;  1VJQ A;  1RTD B;  2V8D A;  4ER8 A;  3KNA A;  1BQN A;  1TFY A;  3LA0 A;  4TLQ A;  3LAK A;  2CPE A;  3PEJ A;  1XQI A;  2V8V A;  3SDE A;  2BJE A;  4MIB A;  1ZET A;  2HHH F;  2YKM B;  3OJS A;  3HXM A;  2UVV A;  1VBK A;  4CLW A;  4CCH A;  3M9N B;  1GXT A;  3CCZ A;  4X62 F;  1ZM9 A;  2DHH A;  4H4K A;  2OSR A;  2NPI A;  3MM8 B;  3T19 A;  2ZBP A;  1NJY A;  3IAS 9;  1L3S A;  3EDQ B;  4DG1 B;  4TY8 B;  3ILJ A;  3DU6 A;  3JS9 A;  2VC0 A;  1EP4 A;  4J9K A;  2M8H A;  2AGO A;  4DQI A;  3CJ0 A;  2E7W A;  4C4W A;  2CWX A;  3AD8 C;  2Z56 B;  2HHW A;  2QN6 B;  3NGU A;  1X8D A;  1FHT A;  3BF4 A;  4Z2X A;  1RAH B;  2LQ9 A;  3Q8U A;  4F02 A;  3OJU A;  4E0D A;  1RBO B;  3NGT A;  4X4P A;  2VQF F;  1BQN B;  4Y2I A;  4KC5 A;  3RG6 A;  4M5D A;  3UD5 A;  4J9R A;  3OTC A;  3SDE B;  4QYR A;  2X51 A;  5KT5 A;  4DQQ A;  1SL1 A;  3KDO A;  3WIV A;  4WXW A;  2DNH A;  3TUZ C;  3FKB A;  1F5C A;  4DSK A;  5KTQ A;  3OTO F;  4KV8 A;  1NCL A;  4KFB A;  4MTP A;  1RB0 A;  2WAQ D;  3FJ2 A;  4USV A;  3JTO A;  2R7R A;  3QT5 A;  4DS5 A;  1LQ9 A;  5GME A;  2DR8 A;  2Z30 B;  5ETK A;  2UXD F;  3E2E A;  1EP4 B;  4QWB A;  3ZTO A;  1ITP A;  2GVZ A;  1QSS A;  4B3R J;  2BZ2 A;  1B70 B;  2N82 B;  3TVZ A;  4HL9 A;  3C15 A;  3D6H B;  4UY8 T;  3HVR A;  4ZKA A;  2IMW P;  1TKZ A;  2HVZ A;  1FWK A;  3LW5 C;  4N76 A;  3M6W A;  1UW4 A;  3O8W A;  3R5A A;  3TJ8 A;  2PGC A;  3PW5 A;  1V5V A;  4Q8F A;  1GMW D;  5DGA A;  4DX8 H;  4M5D B;  3RGI A;  1P9Y A;  2WBM A;  1URN A;  1PBU A;  3MPD A;  2WVE A;  2I1R A;  4DCP B;  3KKF A;  2ZBC A;  3MM5 A;  4NYP A;  1OMS A;  2QMX A;  2UXB J;  2F4F A;  5BR8 J;  4LFA F;  3HVT A;  3OL7 A;  2LFV A;  1KHW A;  2LCW A;  4KV8 B;  4KFB B;  2BJ7 A;  2MHN A;  4C97 A;  2BQR A;  5LJ3 Y;  4N56 A;  5GAE U;  3AAW B;  3HPO A;  1HHS A;  1WWH A;  2H3E B;  1SKS A;  1CSJ A;  4J9V A;  2XGQ A;  2GVZ B;  5AE3 A;  2W9B A;  3P5B P;  5IFM A;  1GX5 A;  5KFR A;  3GMG A;  3Q2S C;  3P3D A;  5E3R A;  3I82 A;  1UJ5 A;  4NCG A;  1IKV A;  4KGM A;  2B5J A;  2NRE A;  2DIS A;  1TKZ B;  2BOP A;  3DRP A;  3DU5 A;  1Q0N A;  2ROE A;  4DPY A;  4DV3 F;  4NLR A;  1GMW A;  4OJG A;  2G1D A;  3HT0 A;  2V4R A;  1IM4 A;  2ZOG A;  3KHL A;  1GXU A;  3SQO P;  4USM A;  4B9N A;  1B64 A;  2AHO B;  3NAI A;  4ELU A;  2JFK A;  3TA2 A;  3MM5 B;  2VFU A;  2W8K A;  4WK3 A;  5EHH A;  3HVT B;  2BR0 A;  3ZZR A;  3NCQ A;  1CJU A;  2ZZN A;  4CM2 A;  1UWA A;  2QFI A;  1P9Q C;  2FY8 A;  3KJN B;  4OZ0 A;  2I8E A;  1B7F A;  1AT1 B;  5F8H A;  2OP5 A;  1LK7 A;  4U6P A;  4YDD B;  2L48 A;  3VTI A;  5D0H A;  4C3K A;  2W9B B;  1CUL A;  3D5M A;  3OXG A;  2QE5 A;  1LXJ A;  4KH1 B;  4QWC A;  3FRY A;  4BC7 A;  1X5T A;  4NCG B;  1IKV B;  2B5J B;  2BE9 B;  1H6K X;  3CME S;  2P6T A;  3TP2 A;  2MKY A;  1C2P A;  4WBF A;  2AGQ A;  1PJ5 A;  3MPU B;  3EMT A;  4F3M A;  4DI6 A;  3PX0 A;  3V6J A;  2DHA A;  2KXF A;  5IOL A;  5H9E K;  4WFY A;  3CJ4 A;  4P74 A;  4WTO B;  1XBW A;  2OIH A;  5A6W A;  1HNV A;  3EZO A;  5KFB A;  2V2Q A;  3LGN A;  1CJU B;  3J81 U;  3TAQ A;  1UZD A;  3CDA A;  1H2V Z;  2QLX A;  4DV2 J;  3GV5 B;  5ETN A;  4Y2K A;  2AJ1 A;  1GTE A;  3N79 A;  1FXL A;  1PJ6 A;  4ALZ A;  4CH1 A;  5ETL A;  3OFG A;  1M1G A;  1ZM2 A;  2DNN A;  4QIV A;  3NWR A;  5KG2 A;  2J0X A;  1CUL B;  1U2F A;  2Q6B A;  3O1L A;  1QD1 A;  2DNP A;  3T1Y F;  3HP6 A;  3ZTQ A;  3ADA C;  1M5O C;  1CLF A;  2XMM A;  5HVF A;  4HI1 A;  5D0G A;  4X4V A;  4C98 A;  4DV5 J;  4G1P A;  1HNW F;  3LWL A;  2D9O A;  3M6X A;  4B3S F;  3OQ2 A;  2ADB A;  3W62 A;  3D3B J;  2GJF A;  4K5R A;  2IVM A;  2BX6 A;  1OPZ A;  2LYV A;  4Y28 C;  5JVG Q;  5I3P A;  2PC6 A;  4MKB A;  5T7L A;  2CYY A;  2UUB F;  4JI1 F;  4OZ5 A;  1MMD A;  3K17 A;  2HZA A;  4W4M A;  1P6T A;  1HNV B;  1FXR A;  2QYG A;  4DV1 F;  1CEZ A;  4JI4 F;  3M8Z A;  1J5O B;  1YJW S;  1A7G E;  1CBK A;  1S4E A;  1X5S A;  2MLY A;  2BRK A;  2DY9 A;  3ZNJ 1;  3QGP A;  2KFN A;  3QGH A;  1U1N A;  4KGX B;  3PFE A;  4XDC A;  1QUV A;  2A1B A;  2DNG A;  3QJJ A;  3CVK A;  4R0J A;  4RR5 A;  2CQ3 A;  4C0B A;  2J6U A;  2R7T A;  4F8R A;  2C2O B;  3QLH A;  4WFB Q;  4PG5 A;  3J7Y U;  2NZC A;  4KR0 B;  2D41 A;  5CHC B;  4B9U A;  3W2V A;  5M2P A;  4BWM A;  3E51 A;  2BM0 A;  1S5Z A;  3VAM A;  5GAG U;  2DJW A;  1ARO P;  1FRK A;  3Q89 A;  2XY5 A;  2J9C A;  3R5C A;  1CQM A;  1UCN A;  1U45 A;  5HMW A;  1RT2 A;  2FJW A;  5T7L B;  4OJ1 A;  3I96 A;  1NSA A;  3GU0 A;  1RCX B;  1YJT A;  3D66 A;  1VRU A;  5LOQ A;  2KVQ E;  2HIQ A;  4DOZ A;  4RBT A;  2ZNY A;  3BDP A;  4U9R A;  5D8H B;  2MTL A;  4EFA C;  3KJF B;  4YB1 P;  3JQK A;  2FJA B;  4MKV A;  5I3Q A;  3W64 A;  1GT8 A;  4URQ U;  2V9W A;  4I69 A;  2O5D A;  3R8Y A;  2YXL A;  3LQV A;  1M1H A;  1WHY A;  3UW1 A;  2UVR A;  2LP4 A;  2HQD A;  1U6F A;  2ASL A;  2MY8 A;  2HRU A;  5D4P A;  5MAO A;  3J7A N;  5FII A;  1URR A;  2XO7 A;  1G6B A;  5GAD I;  2HFS A;  3SCL E;  1OQ6 A;  1WEY A;  3UDC A;  3QLH B;  3FBB A;  2VQF J;  1FNM A;  4OFZ A;  1NO8 A;  5I42 A;  2YH1 A;  1NDC A;  2I38 A;  3W2V B;  3NGR A;  3FFI A;  2HRT A;  3VAJ A;  1LV5 A;  2OMO A;  1KQG B;  2MJU A;  3AD7 C;  4JB8 B;  2UV8 G;  3F44 A;  1ZTT A;  4KRW A;  2OML A;  1WKJ A;  1FRI A;  5C5J A;  3PNI A;  2JL9 A;  3I32 A;  1RT2 B;  2DGQ A;  3SSQ A;  1RAO A;  1Q79 A;  4ZCK A;  3NG8 A;  1VRU B;  2A3J A;  3BV8 A;  1VC6 A;  5KT6 A;  4KHM A;  1SQE A;  2ZEJ A;  3FSX A;  1Y00 A;  3J81 j;  1D9F A;  5F41 A;  2QTW A;  4EBC A;  1UVI A;  3C14 A;  2UXD J;  2K06 A;  4ZVR B;  4DZ6 A;  3T5K A;  4CO5 A;  3RJM B;  4YY3 F;  1X31 C;  2OD4 A;  3TZW A;  1TAU A;  1DAX A;  3G8S A;  1HD1 A;  3PIO Q;  1QTM A;  5L1J A;  1RA7 A;  1NPR A;  3MF5 A;  4H4M A;  1W2B R;  3QNW B;  2KFZ A;  1X0P A;  3B54 A;  2LMI A;  4OHV A;  2IRY A;  2JZ5 A;  1FJE B;  3CMA S;  3QSY B;  1TP7 A;  2HFU A;  4HDH A;  4YP3 A;  3KUG A;  5I42 B;  6FD1 A;  2RH3 A;  4AL5 A;  3FFI B;  3ULH A;  2BEF A;  4X2B A;  2QMW A;  4QPX A;  1SJQ A;  4E8U A;  4R5P A;  5H9F K;  5RUB A;  1H2T Z;  2OEK A;  5JJB A;  1NSK L;  2XY7 A;  5MLC V;  5KFG A;  4LRE A;  1FNX H;  4LFA J;  4FNI A;  3KUH A;  1SC6 A;  4I7F A;  3ENV A;  1WOS A;  5KFF A;  3FRZ A;  4PG4 A;  4ZA1 A;  2OEM A;  1CJV A;  3TA0 A;  4LFC F;  3C14 B;  3S01 A;  1PIL A;  3EGN A;  3BJY A;  4ECX A;  4K4V A;  1RAB B;  2LA6 A;  5SZT A;  2ZBQ A;  2AEJ A;  1FJ7 A;  1YWX A;  2MZ1 A;  4H4M B;  1OY6 A;  2M88 A;  1ZBT A;  3W1Y C;  5C2C A;  3P6Y C;  5J2P A;  2HVI A;  5HP1 A;  4ED4 A;  3AD9 C;  4PWW A;  5KFW A;  3C19 A;  5EWG A;  1KNZ A;  2E1C A;  4C8Z A;  3EGV A;  2UXC F;  1WKK A;  4H4K C;  4QW8 A;  4N47 A;  2H65 B;  3G71 S;  2RDI A;  4WP8 A;  1ZS6 A;  2IPO B;  1RA6 A;  4R5P B;  4IOC Q;  4ZLN A;  3UNY A;  1N4L A;  4RL1 A;  3PW4 A;  1OWX A;  3RU0 A;  2KG0 A;  4I7F B;  3HZG A;  3AH6 A;  5D4L A;  1RE1 B;  5M2R A;  3PDN A;  3KOA A;  4IH5 A;  3MCO A;  4EU0 A;  3Q8R B;  3OL6 A;  1NK0 A;  1N36 J;  2VHG A;  1T9Y A;  2YWW A;  2CPY A;  2W8L A;  3LPY A;  2I0X A;  1WKL A;  3S1T A;  3SEO A;  3BBB A;  3Q0A A;  3FQL A;  2L08 A;  3KDN A;  2CJY B;  3LAN A;  1T3O A;  2E5L J;  4DUY J;  3A13 A;  3O2I A;  4PPD A;  5J2P B;  5HP1 B;  3QQC D;  3SCK E;  2LEC A;  2AIR B;  2EC2 A;  2X3G A;  2FHO B;  3DN9 A;  2MKI A;  3JQM A;  1YGY A;  3BR9 A;  1TUG B;  2YWH A;  1S9E A;  2C3Y A;  3POT A;  1MSW D;  2QSW A;  2R9L A;  2LA4 A;  2DRB A;  2CVI A;  2IYI A;  3CJK A;  3NXZ A;  1KDN A;  3K5M A;  1GK8 A;  5KOX A;  3JSY A;  2B8Q A;  3NMA A;  4PCQ A;  2NXN A;  1SJR A;  3SSS A;  4HHH A;  2FHJ D;  1VQ5 S;  1HI1 A;  4XO0 A;  1Q53 A;  2RRB A;  5E5N A;  4C3M A;  2R7V A;  4TU7 A;  4O3Q A;  1S1X A;  4BHQ A;  4DV6 J;  3Q23 A;  1WG4 A;  3CJQ A;  5LXY A;  1WF2 A;  1ZOT A;  1LFW A;  2COL A;  2GO8 A;  4EUV A;  3KK3 A;  1VQ7 S;  4CYU A;  4LF5 J;  1S76 D;  1NKC A;  2DVI A;  3HO1 A;  4O3N A;  4M5K A;  4B9V A;  2B9X A;  2FPH X;  2MST A;  3G6V A;  3BO3 A;  3WBZ A;  3PM9 A;  3QFH A;  5LSO A;  1S9E B;  3UCG A;  1E6Y A;  4P2F A;  3AT1 B;  3POT B;  4UOG A;  3JYT A;  3HFV A;  3VZH A;  3CJK B;  1RAC B;  2IYG A;  2V8P A;  2V69 A;  2HSE B;  2B9E A;  4DR7 J;  2GNK A;  2OLW A;  4QYZ K;  2IMO A;  4TKT A;  3HD2 A;  3A8K A;  4U7U D;  2FHJ A;  4JI2 F;  2E29 A;  1FKA F;  1ZAW A;  3H5S A;  3QWU A;  1SVD A;  4ECS A;  2OUG A;  3B8H A;  4DR6 J;  2H4W B;  3K5P A;  3BPD A;  5F8I A;  1WAC A;  3HKW A;  3AA9 A;  3IM8 A;  4EMD A;  4J9M A;  4WKR A;  1U1K A;  3MMA A;  2ZJR Q;  1S1X B;  4DUZ J;  3NS6 A;  3EDR B;  1MNE A;  3GTY X;  4HTI A;  1UVL A;  1B7Y B;  3D54 A;  1O8B A;  2DNZ A;  3QBC A;  1TTH B;  1YDL A;  1RK8 A;  2Q6C A;  1HW8 A;  4CYU B;  4ZDN A;  2FVS A;  2XS2 A;  1FXD A;  4NLW A;  1KTV A;  1IBM J;  1JJC B;  2HFO A;  3ET6 A;  2DXF A;  3UE2 A;  1E6Y B;  2IDL A;  1F6T A;  2J6T A;  3H42 A;  2WON A;  1I6J A;  1JLF A;  2B56 A;  1KWM A;  3W63 A;  3IBC B;  2AJ2 A;  1IQZ A;  3RRH A;  3N6M A;  2ZH7 A;  4DFJ A;  3RUB L;  1LWF A;  4J9Q A;  2AJ0 A;  4N77 A;  3KLG A;  2DCU B;  1Y5N B;  2W4D A;  1XWL A;  2B43 A;  2JJ4 D;  1VJW A;  3MMA B;  1NAQ A;  3ZTR A;  1UFL A;  1IWG A;  1TU0 B;  2K1R A;  1FTC A;  3HD1 A;  4RW4 A;  1RWX B;  5A8R A;  2G9O A;  1REV A;  1ACM B;  4Y65 A;  5F0U A;  1UMJ A;  2PEB A;  3J80 Y;  2Z2M A;  3MM7 A;  1U4B A;  1NB7 A;  4OZL A;  2XLI A;  2P6S A;  5D0R A;  3ET6 B;  1HL6 A;  1TK0 A;  4N7T A;  4EYH B;  3HHD A;  5B0E A;  5EX0 A;  1TL3 A;  3CCJ S;  4DV4 J;  5DG8 A;  5D77 A;  4J5O A;  2WON B;  1WEX A;  3MTJ A;  1JLF B;  1FJC A;  4MIW A;  4G6V B;  3QRR A;  4Z7Y A;  3CDW A;  4FVM A;  2E7X A;  1RWO B;  5GVQ A;  2L9W A;  1XMB A;  2XG8 A;  1EZZ B;  1LWF B;  4PKD B;  2CDQ A;  1FEE A;  3RBE A;  2EG2 A;  3KLG B;  2I2Y A;  1M5S A;  4K4T A;  4JI8 J;  2BAB A;  4KJI A;  2KDO A;  3TUJ C;  1LW0 B;  2R3V A;  3KFW X;  3NOC A;  4PYA A;  5E3C A;  1UP1 A;  1YI2 S;  4X4R A;  2AX0 A;  4C0H A;  5HJX A;  4DL6 A;  2HG4 A;  4FYY B;  2K1R B;  2QGF B;  4RW4 B;  2MMY A;  5GAH I;  5A8R B;  1NK6 A;  1YRX A;  4ZHR A;  1REV B;  5C24 A;  3AOC A;  1UAW A;  3MM7 B;  3LP2 A;  2GHV C;  3WDO A;  1OYE A;  3K59 A;  4F0K A;  2MJN A;  3NNH A;  2FGC A;  2JFD A;  2GX8 A;  2YBV A;  1HPZ A;  3LAM A;  4DF8 A;  1TL3 B;  2DPI A;  1U0S A;  2VDH A;  2QL9 B;  4Q44 A;  2BXJ A;  5A8W A;  1U6Z A;  4DL3 A;  2Y1J A;  4CP5 A;  4IRD A;  3UD4 P;  4ECZ A;  2A10 A;  1RT7 A;  2RS2 A;  1HWL A;  2GIR A;  1NK9 A;  3R6L B;  1TKX A;  1RXO B;  3QFW A;  2XMA A;  3E8O A;  2NQP A;  4LFC J;  2PE8 A;  1F0X A;  1F9E B;  2OPQ A;  1OS5 A;  2WSC C;  3IAM 9;  4JP8 A;  3NGK A;  5G0R A;  1OQ3 A;  2GVD A;  4RWX A;  4DR3 J;  2RB7 A;  3DKD A;  2E1R A;  2YTC A;  5A76 A;  4GVB A;  1U1M A;  4F2R A;  5HMY A;  2HHP A;  3DDK A;  3CGI A;  2YKO A;  1Q78 A;  2H4Y B;  3DGP A;  1RLC L;  2AZ1 A;  2DCL A;  2XLK A;  3DNC A;  2XYP B;  4ZHR B;  5C2G A;  2UUA F;  1HBO A;  5C24 B;  4JI0 J;  4NXN F;  5EN1 A;  2GAG C;  3FBF A;  3IA0 A;  3CIZ A;  3LP2 B;  1Q8I A;  2AJF E;  2CPZ A;  2HQ3 A;  4F0H A;  4MKY A;  3OLB A;  4U7C A;  2IVY A;  1AW0 A;  1SJ1 A;  1HPZ B;  3DM2 A;  2OAU A;  1V3Z A;  5A8W B;  2I9S A;  4ID8 A;  3THT A;  5HO4 A;  1RT7 B;  3I55 S;  1NUE A;  5GAG I;  4QWE A;  1SQF A;  2JSX A;  1G3O A;  1U02 A;  4M5J A;  2X1B A;  1ZM4 A;  1TKX B;  4X65 F;  3FSI A;  2VB6 A;  5T14 A;  5KG7 A;  4WWS A;  4I2Q A;  1Y10 A;  2V8G A;  1H7W A;  3QJL A;  5DS7 A;  2OPQ B;  2XMU A;  3OTB A;  2BKP A;  4C3L A;  5G0R B;  2BYC A;  2GVD B;  2IY5 B;  1HNI A;  1QVG R;  5D4O A;  4GVB B;  4ZPT R;  2ZHB A;  2VPY B;  2GHW A;  5LMU F;  4A8M P;  4ED6 A;  3DGP B;  3UCZ P;  3V6D A;  1BGX T;  1LEO A;  4M5M A;  1T94 A;  1CC8 A;  2VKZ G;  1JLG A;  3RBZ A;  2W7A A;  1HBO B;  5ETR A;  3C46 A;  3BDE A;  2PDA A;  1KLM A;  2BE2 A;  2CJX B;  4LR7 A;  1JXV A;  2J0Q D;  1ZH5 A;  1RT1 A;  4OI2 A;  2AGP A;  2DO4 A;  3U27 A;  3DM2 B;  2RHS B;  5KFK A;  1EET A;  3GV7 B;  2F65 A;  2KT3 A;  3ELH A;  1KC8 T;  5HQ8 A;  3CCR S;  3VHQ A;  4CO1 A;  5K8O A;  2JEI A;  4UW2 A;  3LAL A;  4I2Q B;  2CPD A;  3EPG A;  1TZ0 A;  3N9U C;  2MSS A;  4Y2C A;  4K4S A;  3I5A A;  5ETP A;  4JYA J;  3M8W A;  1HNI B;  4LF9 F;  3MMJ A;  1GH8 A;  2GIQ A;  1H74 A;  1R3N A;  3M8Q A;  2L41 A;  4WPA A;  5AXK A;  2ZC3 A;  3V6D B;  1R7I A;  4DL5 A;  1B0P A;  4M94 A;  3H7H B;  1JLG B;  4BS2 A;  1KVK A;  3TEG A;  1FFS B;  2OEJ A;  2BW7 A;  1U2C A;  4NLS A;  2KTQ A;  4KYZ A;  1N5S A;  1KLM B;  2H1Y A;  2BE2 B;  3QMQ A;  4OHX A;  4Y6I A;  3I6P A;  1RT1 B;  4NA3 A;  1XMQ J;  2G0J A;  1JNR B;  3WC2 A;  3E3X A;  4B9L A;  4NLV A;  1DLO A;  4OX9 F;  1EET B;  2ZH5 A;  1A6L A;  3EXC X;  3P4U B;  1X4E A;  3NNA A;  4ZVP B;  5DZ7 A;  4ETZ A;  3V6K A;  4X4U A;  5E0O A;  3BGO P;  2QG9 B;  3K5N A;  1BQM A;  4RW7 A;  4JI2 J;  1RUS A;  4RBU A;  1LWX A;  2XO6 A;  2P9E A;  2V4Q A;  5AXN A;  4YHH F;  1MN9 A;  3GSI A;  2FUG 9;  1ZAV A;  3Q8Y A;  2DH9 A;  1WC0 A;  2ZOF A;  1ZA2 B;  4ATN A;  2ZH4 A;  1IWA A;  4P10 A;  1IBL F;  3N5F A;  1FRM A;  4K0K J;  1YIT S;  1UVN A;  2ASJ A;  4DL2 A;  1Q5V A;  3M8Q B;  1O5J A;  4B02 A;  1S4F A;  2X1A A;  2KN4 A;  1RHJ B;  1Y7P A;  4URG A;  1MU2 A;  5FD1 A;  1U1L A;  1BUX A;  2BQU A;  3EGW B;  4LF4 F;  4JV2 A;  2W1B A;  1UFW A;  1RZM A;  3FMW A;  2HGL A;  1U7L A;  4LF8 F;  4IO1 A;  3EZ5 A;  5J2N A;  1MN7 A;  1RYR A;  3CUN A;  2WHO A;  3B78 A;  3DLB A;  2CPX A;  1XEZ A;  4LRB A;  3OV7 A;  3ISZ A;  4OL8 A;  3RAM A;  2LU2 A;  4OHW A;  2ZZT A;  3RYL A;  4DR5 F;  1BMQ B;  2R8K A;  2R2R A;  5K8N A;  4X4S A;  2VIC A;  1BQM B;  4RW7 B;  2AYB A;  5K14 A;  2RKI A;  1U48 A;  4Y34 A;  2WTF A;  3IO1 A;  1Q86 T;  2BJ1 A;  3OL8 A;  4R25 A;  2FC8 A;  3TZY A;  3SCJ E;  1FRL A;  4J9O A;  4WFA Q;  2W9C A;  5DDO C;  2HEK A;  2RQC A;  1IKY A;  1VBZ A;  5SUH A;  1VDH A;  4LFB J;  4EBD A;  1FKP A;  3HFK A;  2E44 A;  1S10 A;  2RQ4 A;  2GCF A;  2MZQ A;  3I0R A;  1S0O A;  2BAC A;  1MU2 B;  1LXN A;  4DV0 J;  4UF4 A;  2XWY A;  2EFO A;  4QQB A;  1R43 A;  3QT7 A;  4JV1 A;  1FA0 A;  3GYN A;  3CC2 S;  2ZIT A;  1FT8 A;  1PCA A;  5J2N B;  3NCP A;  1VHF A;  4F50 A;  1RSC A;  4XDD A;  1U47 A;  2DIT A;  2OO4 A;  4DQP A;  4CLZ A;  4NZ6 A;  3M2V A;  3HSJ A;  3UNG C;  3NGD A;  4JI5 F;  1EKR A;  1WJ9 A;  1KP6 A;  3KWM A;  1ULR A;  3CNQ P;  1UVM A;  1O6X A;  2K3I A;  2M70 A;  2E5G A;  4H54 A;  5HBM A;  5K14 B;  2RKI B;  5ETQ A;  2BDP A;  4ED8 A;  3Q8S B;  2GS8 A;  1HWI A;  3C3L A;  4WYW A;  3V4I A;  1RTI A;  4AL7 A;  4I68 A;  2W9C B;  2A2C A;  1RHU B;  1IKY B;  2XSF A;  5B0G A;  2MZS A;  1NB2 A;  1M1K T;  1X9W A;  1FKP B;  1RAE B;  4E98 A;  3GG1 A;  2CDR B;  2F7V A;  2DEJ A;  3I0R B;  2RD5 C;  4MKA A;  3CCT A;  2PD1 A;  4AQY J;  4LBI A;  1M5H A;  4N8O A;  5HI7 A;  1NKB A;  2VFV A;  5KT2 A;  4ZOS A;  2BKN A;  3N01 A;  5ADZ A;  2N4C A;  1BWE A;  3KNG A;  5KFP A;  1JLB A;  5BXI A;  4FDF A;  3T1A A;  4WFX A;  3PYF A;  2PA3 A;  2VG6 A;  4ZPV R;  2CJA A;  2KYX A;  3M2V B;  2YPZ A;  2BW2 A;  2XWX A;  3IGN A;  4HI2 A;  4L73 A;  3RBD A;  4ZPW R;  4ZCM A;  2Y8W A;  3IBF B;  5KT7 A;  1XNQ F;  3JAM Y;  4F25 A;  1RWK B;  1R6V A;  1WTB A;  4CO4 A;  4LSL A;  4ED3 A;  5HBM B;  4M5N A;  5HL7 Q;  3K2Y A;  2DGO A;  3IR5 B;  4RBV A;  4O4G A;  5E3P A;  2PI4 A;  3AOB A;  3V4I B;  3RRG A;  1RTZ A;  2HW3 A;  3F56 A;  4L74 A;  4LRF A;  5GMK a;  4I4B A;  2JDJ A;  2LQB A;  3OFH A;  1YHQ S;  1QAX A;  3PG9 A;  2HWI A;  4E2F B;  3W2W A;  4QR2 A;  4TQS A;  2UUA J;  2WVF A;  1SB6 A;  3C66 A;  5CD4 A;  1GXL A;  4ZVH A;  3QGI A;  1EAR A;  4RUH A;  3MUR P;  4OX8 A;  3EM1 A;  3GFY A;  1JLB B;  4OV1 A;  4WU3 A;  1VS3 A;  1HFE L;  2R7S A;  4HH0 A;  4I2P A;  1VMB A;  1QY7 A;  3RAQ A;  4OYO A;  2VG6 B;  2DXE A;  1D8Z A;  3MEK A;  1D0E A;  2PFF B;  1WC6 A;  4DLG A;  3RW6 A;  1NXI A;  2R7Q A;  4F2S A;  4QU7 A;  3BYP A;  1D9D A;  3QSI A;  3WC0 A;  3K5O A;  3KLE A;  2MEW A;  7AT1 B;  4LSL B;  4JI7 J;  2ZVS A;  3BKT A;  1NLK L;  2FVC A;  4O4G B;  2ZKU A;  2AP6 A;  1NJZ A;  3IR7 B;  4KGV B;  2B4P A;  1Z1Z A;  4LUB A;  2KG1 A;  2ACY A;  2QLF B;  5LMU J;  1TVR A;  2P2C B;  5K8M A;  1SKU B;  3W2W B;  1S0N A;  1RT6 A;  1G7C B;  1X4C A;  4A8X A;  3WX4 A;  4QPT A;  4K5S A;  2LQ5 A;  3R3T A;  2BVZ A;  2PMH A;  2E7V A;  2D3O 1;  4X4O A;  2H5I B;  2VJV A;  1AB8 A;  1YJV A;  3ZZP A;  2CRL A;  4YFU A;  2DIU A;  5LSL A;  4YME A;  2BE7 D;  1U0H A;  4HT7 A;  4QBU A;  3CCS S;  5C42 A;  4XPE A;  2J0W A;  4DS4 A;  5DZ6 A;  2HS3 A;  2E5J A;  5FLX U;  1NJI T;  2EWH A;  4I2P B;  4ZCL A;  4Z37 A;  1KHV A;  3EE3 A;  5T41 A;  2EFP A;  4DPX A;  5BR8 F;  3KLE B;  1JKH A;  1RHM B;  2VD3 A;  1YTY A;  3I9Z A;  2EBE A;  2F8E X;  2J9E A;  4EK2 A;  4M95 A;  3FUY A;  4EO8 A;  5KG3 A;  1K0V A;  4ZLL A;  3GIJ A;  1JK9 B;  3VAG A;  4L75 A;  4J9P A;  4FF1 A;  1TVR B;  2KJV A;  2B7C B;  2KXN B;  1OY9 A;  3P8B B;  1RT6 B;  3G9C A;  4F4K A;  1NSP A;  1IBK J;  1F9F A;  3GZ7 A;  1RHR B;  3IN5 A;  4QR1 A;  2K3K A;  2CQG A;  3OVS A;  2R8H A;  1C4A A;  4YB5 A;  4DU8 A;  2WW8 A;  3K58 A;  4ED7 A;  3M4X A;  1U0H B;  3GE9 A;  4FYX B;  1LFP A;  1X4G A;  2ZH9 A;  3KLF B;  3CD0 A;  2KT2 A;  5L46 A;  2BJ8 A;  4DX7 A;  2DGS A;  5EGY A;  4WZM A;  4GKK J;  2XMT A;  2E5H A;  1LNQ A;  2AKW B;  1JKH B;  3DC2 A;  4HHU A;  2CQ4 A;  1EX8 A;  3AY0 A;  4ZCI A;  3MCS A;  4YHH J;  2AU0 A;  2V67 A;  5C25 A;  1G2E A;  4UST A;  2DHS A;  2BBE A;  3CDU A;  3RB3 A;  4K59 A;  1RAA B;  2FLO A;  5GAD U;  3DYA A;  5LXR A;  1N5V A;  5L1I A;  1IBL J;  2HHT A;  1F5B A;  2HQG A;  2Y1R I;  3UCU P;  2LEB A;  2NXC A;  3RAX A;  1NPK A;  2LLZ A;  4FBT A;  3S6E A;  3GJR B;  3PR5 B;  1VBY A;  1EB0 A;  3QRQ A;  1O0P A;  3TNV A;  3OR2 A;  1PAU B;  1JQG A;  4WZQ A;  1U1P A;  3M05 A;  4C48 A;  2XI3 A;  5CXT A;  4DSI A;  2PEH A;  2XYG B;  2HVH A;  3TW0 A;  4ZPC A;  1K9M T;  2HK2 A;  4FYW B;  1WDD A;  4CT8 A;  1DQ8 A;  4CO2 A;  2R4F A;  2EBG A;  2MQP A;  2GGP A;  3DCA A;  3KMS A;  4PWD A;  3NP5 A;  2HHS A;  5EX3 A;  4DR5 J;  5B09 A;  3GB0 A;  3T6J A;  3KHG A;  4LF2 A;  1IQT A;  3PCO B;  2XSJ A;  4ELV A;  2B4U A;  4O4R A;  3CSK A;  1JXE A;  4FXW A;  1NHK L;  4KE5 A;  4ZJQ A;  1I5O B;  5C25 B;  4DV2 F;  1LWE A;  2VA3 A;  1DBD A;  1VLY A;  4DR1 J;  5LT5 A;  3W8P A;  2LEA A;  4LBH A;  2XY6 A;  3HHL D;  4OJ3 A;  3DYA B;  1X5P A;  3MFH A;  3K8W A;  1BY9 A;  1OYD A;  1S6O A;  1S9G B;  4IR9 A;  2DNR A;  2CZV C;  3C6U A;  1VI7 A;  3O6Q A;  3OR2 B;  4K4Y A;  2SXL A;  3L7O A;  1V5I B;  4DMZ A;  3S8S A;  4DSF A;  2Z8Q A;  3OSN A;  3PJX A;  5G4D A;  4LF6 F;  2NR0 A;  3TZX A;  2AX1 A;  3MPV A;  4K4Z A;  4TLR A;  4P2S A;  5F9N A;  1CPZ A;  3S7R A;  2GGP B;  3CUL A;  5D4N A;  4JI5 J;  3B6B A;  3M7V A;  3P45 B;  4PWD B;  2RJZ A;  5DET A;  2BRL A;  4QOT A;  1NJX A;  2MQQ A;  4YQW A;  5F9L A;  3GCW P;  2KM8 B;  2XSJ B;  3U7J A;  3ZC4 A;  4LR9 A;  2V63 A;  5H9F J;  1TQL A;  2QL7 B;  2LQJ A;  5IQ6 A;  2VKR A;  4KGZ B;  3MAA A;  2OD6 A;  2VBW A;  2ILY A;  2NYI A;  3L3C A;  4O3O A;  2CJ9 A;  3HHL A;  1HHQ A;  4F4Z A;  2ACM A;  1KOO A;  3EYZ A;  2DXD A;  3VF0 B;  4IRK A;  1YVF A;  4ED2 A;  3RR7 A;  3MM6 A;  1NH7 A;  5J2M A;  4FXD A;  3KYL A;  3C6U B;  1WC5 A;  4U8V A;  2UU9 J;  3CED A;  1NJW A;  4Q5V A;  2U2F A;  1EKS A;  5A2Q U;  4OZ2 A;  2GQ2 A;  2ATL A;  3PYD A;  3Q2T C;  3C8Y A;  5DLG A;  2VG5 A;  2VIH A;  1VQ6 S;  3OSP A;  3FMB A;  4IKA A;  2LU1 A;  5L1L A;  2XZD B;  4JI6 J;  1F1B B;  1PYO B;  2HQF A;  3HHN B;  1VQL S;  1XNQ J;  3G87 A;  2QSF A;  3I4H X;  3W3S A;  1U8W A;  2YKN A;  4XPC A;  1U1Q A;  4NYO A;  3OHB A;  1FVQ A;  1N5Q A;  4N41 A;  2ZWO A;  4G3I A;  2H5J B;  4FP9 A;  1L3V A;  4LIW A;  1ROF A;  1S6Q A;  1NK7 A;  2QV6 A;  2AJQ A;  3MAA B;  3QO9 A;  3HHL B;  1RAD B;  4B9M A;  1RIS A;  1GTH A;  4P2X A;  5D78 A;  4ZN1 A;  1TUV A;  3VAF A;  3A12 A;  2ZJP Q;  2YKQ A;  3I5B A;  3RB4 A;  2CNN B;  3TX0 A;  5J2M B;  3KHH A;  5DO2 A;  5L9X A;  3VQS A;  2VUG A;  3D6T B;  4LMZ A;  1VQM S;  4DU7 A;  4J91 A;  4OMF G;  4ED0 A;  3MAH A;  4ZIT A;  3X3U A;  3HF5 A;  3V2U C;  2VG5 B;  3FCV A;  1HWU A;  2A0F B;  4GVL A;  4GC6 A;  4ZP8 A;  2JEF A;  4PXC A;  4HLB A;  4DBQ A;  5BJR A;  2X1F A;  2KRB A;  4RNF A;  1K0T A;  2Y8Y A;  5EWE A;  4ERD A;  3M8P A;  4IH7 A;  2YKN B;  1Y3K A;  3TAM A;  4KT0 C;  4F67 A;  4ZVQ B;  1U2R A;  2XUL A;  3HFZ B;  2VJU A;  2YWE A;  1N5T A;  4Z7C A;  1S0V A;  1S6Q B;  3CT9 A;  3MUM P;  3PJ9 A;  7FD1 A;  3ZZZ A;  4ENO A;  2OHD A;  2CQ1 A;  4Y00 A;  1AYE A;  3QO9 B;  3M9O B;  2Y9H A;  4X4N A;  4DR2 J;  3D3C J;  4MJK A;  2RUS A;  2MKK A;  1N34 F;  3JXO A;  2F5G A;  1UPM B;  1UKU A;  4FPI A;  2DGX A;  3LGH A;  4NOH A;  4UOH A;  2EG1 A;  3D6F B;  1FDN A;  5AXM A;  5F3Z A;  2VBY A;  1IBC B;  3CD5 A;  2VH7 A;  2RHQ B;  3HJF A;  1IKW A;  4LIR A;  4I6W A;  1HW9 A;  1VQN S;  2NSB A;  1KKH A;  4KKO A;  3Q83 A;  1K1Q A;  2WK4 A;  2AQ4 A;  2QZ8 A;  5KFZ A;  3LUY A;  3H5U A;  2BOA A;  2BQ3 A;  4O3R A;  2D3Z A;  2AEM A;  2HIY A;  2ZKT A;  4C0O C;  1FF2 A;  4NLY A;  4A8K A;  5ETS A;  2VON A;  2F1F A;  3M8P B;  3GP9 A;  1XJW B;  4W98 A;  2HNZ A;  3MEE A;  3TAM B;  1S12 A;  1X4B A;  1IVZ A;  3C6T A;  2OPS A;  1TAQ A;  1R0B G;  2CUY A;  1XR5 A;  3LP1 A;  3J81 Y;  2JLF A;  2GIF A;  4JV5 J;  3TJ9 A;  3VGU A;  5IS2 A;  4FKX A;  1YSJ A;  4P73 A;  2VFS A;  5THW A;  3IWN C;  1QM9 A;  3DOM A;  2AJ4 A;  3C15 B;  3FEZ A;  4ZVO B;  1WOR A;  4FF4 A;  3UDV A;  5KFA A;  3R27 A;  1PC4 A;  2JEG A;  2Z57 B;  1D9A A;  1IKW B;  3G4S S;  2KFY A;  3TX8 A;  2IJN A;  3MEC A;  2G2O A;  2KZM A;  2KO1 A;  1H3D A;  1Q5Y A;  4B9T A;  2CQP A;  1S0M A;  5CCM A;  1NHU A;  4KKO B;  2HS4 A;  4JI3 J;  2PN6 A;  4X66 J;  2WOM A;  4TY9 A;  1KLN A;  1VCT A;  4N8N A;  4F7V A;  1U49 A;  2W01 A;  2Z0G A;  4L3N A;  2YWF A;  3T3F A;  2LKZ A;  3PRB A;  3MI7 X;  3UPF A;  1IUJ A;  2HK3 A;  2XNR A;  3R7N B;  1VLO A;  3TJA A;  3VWS A;  2HNZ B;  2C2K B;  3MEE B;  1JIH A;  4NRU A;  3C6T B;  3SYZ A;  2XZT B;  4D3G A;  2OPS B;  1UET A;  3GJQ B;  1N36 F;  1FDD A;  2OPR A;  2IAJ A;  3KTQ A;  3LP1 B;  4IG3 A;  3DDN A;  2W2O P;  1U8S A;  1X4A A;  2C2R A;  2O67 A;  3ILL A;  2G0I A;  1OJ4 A;  2FJD B;  4C8N A;  1QAJ A;  3PRV A;  5HVH A;  3DOM B;  3M30 A;  1DTT A;  3DRS A;  4HTJ A;  1I51 B;  2E5L F;  5F8N A;  4DUY F;  3CJ3 A;  4NLO A;  4OX6 A;  1Q4R A;  2C2N A;  3DRP B;  5KG5 A;  3HHK A;  3MEC B;  1NK4 A;  4G1I A;  3BQ0 A;  3CMQ A;  1YG0 A;  2MB0 B;  1XK8 A;  2DR7 A;  5A0Y A;  4ZVE A;  5F8G A;  3KG4 A;  3PJW A;  3AJ2 A;  1ZYQ A;  2HVD A;  1R0A A;  4YR0 A;  2WOM B;  1B3T A;  3GIK A;  3VR1 A;  3BPS P;  4DCO B;  3CD6 S;  4CDI A;  1RKI A;  4ZIW A;  3MGJ A;  3MTK A;  5KFH A;  4DHV A;  2WW4 A;  2N7C A;  4PXE A;  2YQ1 A;  3GR0 A;  2EW9 A;  2XC9 A;  2W2P P;  4M1K A;  3FEX B;  4M5L A;  3SCI E;  3G2X A;  2RML A;  1FFG B;  3MOZ A;  2B9W A;  3PFO A;  3KLH A;  1X4F A;  2RIL A;  1N48 A;  2ZUA A;  2WSF C;  2OPR B;  2IAJ B;  4LQ9 A;  2HZC A;  4QIE A;  4IG3 B;  1YJ7 A;  4A46 A;  3MDF A;  5GAH U;  2IHR 1;  3G96 A;  4CLL A;  4YEA A;  3DRY A;  5CAA A;  2HQC A;  2NXE A;  5L9N A;  4QZV B;  3ITH A;  4FS1 A;  5KAK A;  4DV6 F;  4HYK A;  5BYQ A;  5C7P A;  3M30 B;  5LL6 d;  1DTT B;  1QVF R;  3DRS B;  3WZ0 A;  3FEY B;  3CE8 A;  4LF5 F;  4FN5 A;  1VQS A;  2OSQ A;  2EC0 A;  4CO0 A;  4WP9 A;  2C22 A;  4LF6 J;  2A2D A;  5CZV A;  4GKJ F;  1FX2 A;  4A8F A;  1RU1 A;  4DDF A;  1VQ4 S;  4LR8 A;  5A0Y B;  2WZ1 A;  1D1U A;  2UUT A;  3MAQ A;  5KFD A;  1DUR A;  2X1G A;  2Y3Y A;  3TUI C;  1R0A B;  2IDE A;  3HVA A;  4DPO A;  3ILO A;  2Z2Y B;  1MWY A;  3NCR A;  4CWB A;  3ISN C;  2J76 E;  4O23 A;  4DR7 F;  3OFF A;  2M52 A;  3GJT B;  3QT8 A;  4NE9 C;  3KLH B;  1VRT A;  2HAF A;  2VQE J;  2L3M A;  2LVW A;  2IA0 A;  3T9N A;  1JLQ A;  4DR6 F;  3IC1 A;  3GYG A;  2OH2 A;  1H38 A;  5AE1 A;  4DL0 C;  3ITH B;  4DUZ F;  2D69 A;  3ENA A;  4ES3 A;  3MEG A;  1WTF A;  2HAI A;  2ZM6 J;  1FES A;  1AUD A;  1NEE A;  2F8H A;  4F4W A;  3BYR A;  3D1Q A;  3TAR A;  1IBM F;  3ZZY A;  2LEP A;  2Q3P A;  2H9Z A;  3QYY A;  4K7Q A;  2CFX A;  3K89 A;  2BAN A;  2RF2 A;  2C3U A;  1OPI A;  2HNY A;  2UVU A;  5DM6 Q;  3LOU A;  4AND A;  1PC5 A;  2P9C A;  3AB2 B;  3CC4 S;  2RRA A;  3DXS X;  1EIY B;  1QAY A;  4QJV A;  1FJG J;  4V1A k;  1J2V A;  4TNO A;  1Q1K A;  2N7Y A;  3DGV A;  3PW0 A;  4Y2M A;  1F2H A;  1RWP B;  1VRT B;  3TRG A;  3R5D A;  2XZW A;  4MAK A;  1JLQ B;  3RR8 A;  3JSR A;  1J5E J;  3A3O B;  3MD1 A;  4MK7 A;  1AA1 B;  3HUL A;  1FX4 A;  4IUF A;  4OIX A;  3IGV A;  2KU7 A;  4ECV A;  4LQ3 A;  5HAN A;  2CWK A;  2CQB A;  3M1V A;  1G1X A;  3MEG B;  3MD3 A;  1RWV B;  1YKW A;  1YZ7 A;  2XS7 A;  1YJ9 S;  4JBC A;  2HWH A;  4P7T A;  2NZ4 A;  2JC1 A;  4F0M A;  2M9K A;  3OLA A;  4RU2 A;  2R42 A;  2KM8 C;  1GFW B;  3EVW A;  3L4B C;  2POK A;  1S1V A;  2BAN B;  2RF2 B;  4HHJ A;  3R7B B;  4DPT A;  4WTY A;  2HNY B;  3IRX A;  2IBK A;  2W7O A;  5CAB A;  3DLH A;  3TR5 A;  4DV4 F;  4YR2 A;  4K8R A;  2ROP A;  1OSC A;  1PKU A;  2QJ3 A;  5FJ4 A;  3OL9 A;  3DHX A;  4WFN Q;  4I6A A;  2MQO A;  3G6Y A;  2I6W A;  2G2Y A;  5B0D A;  4J9S A;  1L3T A;  1HQU A;  2CKW A;  4JI8 F;  2WB4 A;  2O3D A;  2H48 B;  1SIW B;  1N34 J;  2GW8 A;  2QO3 A;  1QUP A;  1CQN A;  3HLU A;  2HYI B;  2YX4 A;  4OI6 A;  3M1V B;  1R31 A;  3AQP A;  4CRJ A;  1DZ5 A;  2KYZ A;  4LF7 F;  3VQT A;  2AZ3 A;  1TL4 A;  2HBQ B;  3OT9 A;  3R2D J;  3KG0 A;  2MKJ A;  4KY3 A;  4WII A;  2KRR A;  3MUT P;  1TMJ A;  4RW8 A;  2AV5 A;  5J1N A;  4LRA A;  4RUA A;  1S1V B;  4V19 J;  3BKU A;  3OVB A;  4RWW A;  3IRX B;  2GQC A;  2J6S A;  1UZH A;  2XCP A;  3QWP A;  3V81 A;  2V34 A;  1AUS L;  4K2X A;  2DYA A;  2P8I A;  3CJR A;  4F3O A;  4ZS6 A;  2A6M A;  4LVO P;  2V2V A;  1SBR A;  1VQ8 S;  4NMX A;  3B4M A;  3BSA A;  1MRO A;  4B3M J;  3KG1 A;  2M3D A;  4DEZ A;  5DM7 Q;  4R0E A;  4DF4 A;  1WNE A;  5K9F A;  1Y5I B;  2P9G A;  3JTP A;  1HQU B;  1VR6 A;  4ID5 A;  2XNQ A;  4DFM A;  4B3T J;  1VK8 A;  4DR3 F;  2A18 A;  4EYI B;  4ZP6 A;  3R5B A;  1QSY A;  2Z58 B;  4LVN P;  1YBT A;  4TU8 A;  1KQK A;  4U67 Q;  5B08 A;  3VAH A;  3BM7 A;  1WG1 A;  2ATC B;  1QLN A;  4KIA A;  1KFS A;  2DHX A;  3H98 A;  1UEU A;  3D0G E;  3D4J A;  3IMQ J;  1VIX A;  4JI0 F;  4DN9 A;  3LTO A;  3PXG a;  5KT3 A;  3RB6 A;  4FF2 A;  2KB2 A;  4RW8 B;  4M8L A;  3TAP A;  1JXL A;  1P1T A;  5IXU A;  1Y9O A;  4CLF A;  5F8M A;  3GSD A;  3V81 B;  5LSR A;  3BGL A;  4AE5 A;  3AA8 A;  3GV8 B;  4ZP7 A;  1IN0 A;  2W9A A;  2FTR A;  3MZI A;  5GMD A;  2DBB A;  1RJJ A;  2OTL S;  2JC0 A;  4Y0F A;  3CO0 P;  2FY1 A;  2YVS A;  2IM3 A;  2BJ9 A;  3MR6 A;  1MRO B;  1CJV B;  1NPP A;  1P8G A;  4F04 B;  3QGG A;  2HHQ A;  2Z2Z A;  3HT3 A;  5HN0 A;  3BH6 B;  1NRK A;  4ID5 B;  3MED A;  8RUC A;  1F2G A;  3DLG A;  4EZ9 A;  1HQE A;  5KG1 A;  3D67 A;  1SL2 A;  1R89 A;  5IT9 Y;  4ILM A;  3I31 A;  1SQG A;  2MZT A;  3E01 A;  4OYM A;  4BCA A;  2V4J A;  5EWF A;  3CO9 A;  1TL5 A;  2ZDO A;  2XM3 A;  5KFL A;  2JLE A;  4FNH A;  3L09 A;  5E3Q A;  3PEH A;  2VG7 A;  1TFW A;  2CZ9 A;  4OI3 A;  4URS A;  4Q2L A;  4NEZ A;  3PIP Q;  2M8D B;  4ECR A;  2DK2 A;  2N3L A;  2LDY A;  1ZZN A;  3THP A;  3GII A;  2W2N P;  4CLS A;  4ED1 A;  3H2U B;  4KH0 B;  2NSC A;  2FIU A;  1WSV A;  2XEX A;  5KG6 A;  2D7S A;  3J7Z 5;  1MW7 A;  3CDE A;  2VU5 A;  3BB5 A;  1T11 A;  4FKY A;  1S6P A;  1IR0 A;  2VPW B;  2J7W A;  1KVJ A;  5IWA J;  2R7U A;  5DQI A;  3ONQ A;  3MED B;  4YB7 A;  3DLG B;  1UEK A;  2APO A;  1HQE B;  1WG5 A;  4JYA F;  4QW9 A;  4P2M A;  3GFX A;  4XIU A;  1HBU A;  4LF1 A;  4NLU A;  4ELT A;  4AXI A;  3JSM A;  2ZDP A;  1FRJ A;  4KTQ A;  3CCE S;  3E01 B;  2ZBR A;  2V4J B;  4GKJ J;  1KOH A;  4NWB A;  3ZZT A;  1BE4 A;  3UQS A;  4Q45 A;  1OO0 B;  4C7Q A;  3W7B A;  1NHV A;  3W8G A;  3VGV A;  2VG7 B;  2DO0 A;  4MK8 A;  1F3F A;  2L9N A;  3BSC A;  8AT1 B;  2RNE A;  4OI4 A;  2J7U A;  3DXB A;  1XMQ F;  2M5Y A;  2R7O A;  5HQL A;  1S1T A;  1WI6 A;  2XBP A;  3CJ8 A;  2R2T A;  3KK1 A;  2MHE A;  4IQX A;  2MLZ A;  3AHP A;  2C28 A;  2KJW A;  4LRD A;  4ITS A;  3GWC A;  2AEF A;  3TQE A;  2NLW A;  2MPU A;  4DV7 J;  1WC3 A;  3R2C J;  2VBX A;  3DOL A;  2AF6 A;  4X64 J;  1HNX J;  1S6P B;  4U95 A;  2VA2 A;  2OEL A;  2RU9 A;  4QIG A;  3M2U A;  1S6U A;  2FHK A;  5IT9 U;  2CXE A;  3OD2 A;  3UN3 A;  4KHP J;  5KFS A;  4FYV B;  1HBU B;  2QMU B;  4K0K F;  4I64 A;  2FVQ A;  3KK3 B;  2LDI A;  3LWM A;  3JSM B;  3FBC A;  4PUO A;  2MKH A;  2J7K A;  1VHI A;  3OBI A;  5K5M A;  1VIS A;  3CF5 Q;  3TVK A;  2XS5 A;  2ZVI A;  3PHE A;  2WCX A;  2FLL A;  2R8J A;  1XER A;  2NXU A;  3PW2 A;  4M63 A;  2YX7 A;  2PA8 D;  3JSB A;  3H59 A;  3QID A;  3T1H J;  5CD4 H;  2Z4P A;  1S1T B;  4RPF A;  2Y1I A;  1I94 J;  3BQ2 A;  3JYT B;  2JEJ A;  3P96 A;  1N52 B;  4V19 X;  3KK1 B;  1CJK A;  2CZ4 A;  2DGU A;  1SCJ B;  3R7S B;  2W2M P;  2YQ3 A;  2ILZ A;  1N32 F;  4PEO A;  4HKQ A;  2GMJ A;  4L76 A;  6FDR A;  1D3W A;  3DOL B;  5A6P A;  1R8A A;  2LXU A;  3I56 S;  1A0O B;  4MYU A;  2B7B B;  4C6A A;  3M2U B;  3FNN A;  3PX4 A;  4HEA 9;  1N6Q A;  3EUN A;  1LOU A;  2IRX A;  2JVO A;  5HMZ A;  4HAC A;  3AOD A;  1YRU A;  3DLE A;  5DG9 A;  3CCW A;  4YOE A;  1H98 A;  2PMW A;  1PGZ A;  1RAI B;  4WE1 A;  4LFB F;  2R2S A;  2FB0 A;  2EKY A;  4NCB A;  2LXF A;  1YK9 A;  4PUO B;  2F4V F;  5EDW A;  2FZK B;  2WVC A;  4DV0 F;  3OPK A;  3VGS A;  4WF9 Q;  3D0H E;  4DPW A;  1RAJ A;  2XCA A;  3MM9 A;  4ANC A;  2E9R X;  3WHI A;  3UO0 A;  2D3O R;  1M0S A;  3W5X A;  1GMV A;  1PYT A;  1DAR A;  3DI6 A;  2GHP A;  2GJ2 A;  4USH A;  3H5X A;  2GJI A;  1U25 A;  2VZ9 A;  3GFH A;  2OTJ S;  3L95 X;  3I9V 9;  3CD7 A;  1CJK B;  1S99 A;  1U1O A;  3LF0 A;  1ZZF A;  2QA4 G;  2RE1 A;  2J0S D;  4UOC A;  3CCV S;  4J9L A;  4XAK A;  3IS9 A;  2ROG A;  2Q66 A;  1ZPW X;  4M5H A;  4USW A;  3A1Y G;  4O0N A;  2G0C A;  4EO6 A;  1ZA1 B;  1HQ2 A;  2NYH A;  4RKU C;  1LKZ A;  1RWN B;  1N6Q B;  3CJ2 A;  5HJY A;  1SJ3 P;  4HAC B;  1VFJ A;  2GV1 A;  3DLE B;  3N28 A;  2KL8 A;  4WE1 B;  4BBY A;  1RTH A;  4NEY A;  2J8S A;  4DQS A;  5DDR C;  3AQO A;  4OYA A;  1FKO A;  3Q24 A;  1BD6 A;  1L3K A;  4LF7 J;  2RRN A;  4NRT A;  1C1B A;  1DY3 A;  4AQY F;  3SI8 A;  4JUZ A;  4DR4 F;  3MM9 B;  2JH3 A;  4KPY A;  1DQ9 A;  4DWI A;  2FJV A;  5ETO A;  1KRP A;  4LBP A;  5CYM A;  4PG6 A;  4ZJO A;  1ZAX A;  2VPX B;  3FZ2 A;  3DI6 B;  3BO2 A;  4Q7A A;  3MHY A;  5HK4 A;  3CB4 A;  2QFJ A;  2BV3 A;  2DR9 A;  4IQM A;  2YNH A;  4Q0B A;  3D7S B;  3TZZ A;  4U8Y A;  2HLU A;  4WYL A;  4CTA A;  4ES1 A;  4UY8 5;  4KBI A;  5A8K A;  4G1Q A;  2ZH6 A;  1V6H A;  4C9D A;  3IS9 B;  3UWT A;  5AXL A;  2DNQ A;  3IR6 B;  3Q8Q B;  2ZH8 A;  2ADC A;  4FPR A;  5E7O B;  2RVJ A;  4WP3 A;  1D09 B;  1RDR A;  2C3O A;  5K8P A;  2NS1 B;  5LM7 E;  4GC7 A;  2MZR A;  1EJ7 L;  1J5O A;  3MCM A;  3QPI A;  2IVF B;  3M8R A;  1RTH B;  1RU2 A;  1FKO B;  2CQ0 A;  3UDL A;  4IYQ A;  4OYX A;  2KKH A;  4DL4 A;  1C1B B;  2OGU A;  3W60 A;  1RAG B;  4R8U A;  4C8Y A;  2QL5 B;  1BQX A;  4GMK A;  2HBY B;  2IM2 A;  2BA9 A;  1FD8 A;  5CZX A;  3FGV A;  1IJF B;  5CYM B;  3V4M A;  5J1E A;  1QJH A;  4K2J A;  4C8M A;  2DGT A;  2RQM A;  1TL7 A;  2YNH B;  3PAC A;  4Q0B B;  1FEH A;  4QIF A;  2HFZ A;  5IM0 A;  2B4V A;  4MT1 A;  5IC4 B;  4ILL A;  4LSN A;  4CTA B;  3TQ1 A;  2QYC A;  4ZVT B;  2WB1 D;  4CM0 A;  5F8J A;  3L9Z A;  5A8K B;  4G1Q B;  3SMZ A;  4JI7 F;  5LMN J;  4I6Y A;  1IJE B;  1WSR A;  1WHX A;  3VAK A;  3H2L A;  2YKA A;  2WVD A;  2O66 A;  1T9T A;  2YNF A;  5I4M A;  1X4D A;  3M2R A;  3BO4 A;  1SUQ A;  2CJQ A;  3H4D A;  4FF3 A;  3ZZO A;  2HMI A;  1SPB P;  2EEY A;  3FC9 A;  5KFX A;  5IQQ A;  1DHM A;  3HI9 A;  5HAO A;  2QA1 A;  2YWG A;  3SZ2 A;  4R8U B;  3FSY A;  1U1R A;  4CLT A;  2EFG A;  3R97 A;  1NZ8 A;  3W5Z A;  4PAB A;  5CA5 A;  1I1G A;  5J1E B;  3MFI A;  5KFU A;  3LH2 S;  2JVR A;  1FFW B;  1TL7 B;  1F3V A;  1KQF B;  2DT9 A;  2DB1 A;  5IM0 B;  2CPJ A;  3FCH A;  1GAO A;  4LSN B;  4ZVG A;  4AT1 B;  2HHH J;  3G82 A;  1JLA A;  4DSL A;  2FVR A;  3SXL A;  1K1S A;  2UUW A;  4CH7 A;  3CDB A;  1K47 A;  2QLW A;  1AFI A;  4X62 J;  4EGL A;  3M8Y A;  2GO9 A;  4DX5 A;  2YNF B;  2DGV A;  3M2R B;  4HR2 A;  1SUQ B;  4USJ C;  2ZHA A;  3SSR A;  2HMI B;  4NZ0 A;  3ZO7 A;  2PII A;  1L5U A;  2AYM A;  4J9U E;  1VOM A;  2CVE A;  1IBK F;  5F8L A;  1MWZ A;  1RT4 A;  2I5J A;  4Q8E A;  5BYR A;  4CLU A;  1Q8B A;  1R8H A;  1GMU A;  2JOQ A;  2NUU G;  5H1S V;  4LRC A;  2Z2L A;  4IG0 A;  3UFC X;  3CJ5 A;  3C2P A;  2WVB A;  1TKD A;  4I67 A;  3W9H A;  3BR8 A;  2Q43 A;  4YUD A;  1VC0 A;  1VIO A;  4PXD A;  4GKK F;  1X7V A;  2ZC4 A;  2CAD A;  1LW2 A;  3Q8P B;  3G82 B;  1JLA B;  4P7V A;  1B0T A;  5AT1 B;  3RRK A;  1SI9 A;  1HR0 F;  3HSZ A;  1VQP S;  5KFO A;  3OTO J;  2DR6 A;  3TOQ A;  1NM2 A;  4UUX A;  4ED5 A;  4EZ6 A;  2RU3 A;  4HT5 A;  4A8W A;  1VQO S;  2FZC B;  2XMV A;  2XYH B;  4ZK7 M;  3IWX A;  4QU6 A;  4WCE Q;  3I5C A;  3FZB A;  2VL1 A;  4NLX A;  3R1L A;  3U1M A;  1UJ4 A;  2NCK L;  5K20 B;  3OFE A;  1HBM A;  3BBF A;  1WEL A;  1CC7 A;  3MR3 A;  2C42 A;  1V3S A;  2EK6 A;  1QDU B;  1YBA A;  1RT4 B;  2I5J B;  4AL6 A;  3K5L A;  4C8L A;  2QA2 A;  4ILR A;  2ALY B;  2G4B A;  4CLK A;  2GZO A;  4UOF A;  3ZZ0 A;  3D6M B;  2HND A;  2HGM A;  1UVK A;  3QIP A;  2M7S A;  4IG0 B;  2HUR A;  1B0V A;  1DLO B;  2O01 C;  2H54 B;  3OUY A;  3N6L A;  1LK5 A;  4ZPB A;  1N32 J;  2XMK A;  1N8R T;  1RAF B;  1KVI A;  1LW2 B;  1N0U A;  2DY1 A;  1ZTW A;  1NND A;  3CJT A;  3T5H A;  2C2E A;  1TL1 A;  2ASY A;  3R1H A;  2FJX A;  4CH0 S;  2IRU A;  3F73 A;  2XGP A;  3H2V E;  2HRY A;  4DR1 F;  1KSP A;  1Z4U A;  2F9D A;  1X9S A;  2IC3 A;  4PWU A;  1WOP A;  2MYF A;  4PQA A;  5DRK A;  4Q43 A;  2R7W A;  1RTJ A;  2OPP A;  4OZJ A;  5B7W A;  3L7P A;  3D9B A;  4UTG A;  2F4V J;  1RWW B;  4NLP A;  1HBM B;  1SIZ A;  1N54 B;  4PPZ A;  1W2I A;  4TN2 A;  1T02 A;  5CCL A;  4O3S A;  1AZS A;  4RW6 A;  5J2Q A;  3PYG A;  3GIR A;  3VVU A;  3GR1 A;  2ZBI A;  3NAH A;  2B4O A;  2HND B;  2ZH1 A;  3IP0 A;  3QIP B;  1NDP A;  2LXI A;  1HI0 P;  3H0P A;  4DV3 J;  3FBE A;  5KFM A;  4L72 B;  1JMT A;  1S59 A;  4J7C A;  3OR1 A;  3OXL A;  3OUY B;  3CXC R;  1GQE A;  2DNY A;  3UD3 P;  3THV A;  3EXY A;  2MQN A;  1F5A A;  4AD6 A;  4JOU A;  4WXO A;  1QE1 A;  1TL1 B;  4QR0 A;  4EBE A;  3BH7 B;  4OJH A;  1NSQ A;  2XB2 D;  1T95 A;  3WQP A;  2RS8 A;  1S57 A;  4NML A;  1WD6 A;  2NPF A;  2R2U A;  1RLD A;  1T8E A;  3BGR A;  1WC4 A;  1Y0H A;  4B9S A;  2IC3 B;  4I1T A;  2MLX A;  2CAJ A;  2XHW A;  3L7U A;  1RTJ B;  4U7U K;  5DDP C;  1XR6 A;  2OPP B;  4TVA B;  4GRS A;  3V6H A;  3GON A;  3MMB A;  1T9V A;  2G2Z A;  2UU9 F;  4RZR A;  1AZS B;  2QLJ B;  4RW6 B;  5J2Q B;  4OYZ A;  4DR4 J;  2JLG A;  2HVE A;  1X4H A;  2HZV A;  2JRS A;  5KFI A;  5JUM A;  3EIC A;  2FJB B;  3TYT A;  3NRB A;  3W66 A;  2YQ0 A;  1WF0 A;  3EVM A;  2K8G A;  4OHY A;  1SC1 B;  1JNZ B;  2HFN A;  2QLB B;  1HAR A;  4OV6 A;  4UT4 A;  2E9Z A;  3KJQ B;  4JI6 F;  1T0T V;  1H0H B;  1IKX A;  3OR1 B;  3HVW A;  4RNO A;  1TR0 A;  1ZPV A;  5FLX Y;  3PX6 A;  5KFV A;  2FC9 A;  3DLJ A;  1WC1 A;  1WDT A;  3GQC A;  2HHU A; 
#chains in the Genus database with same CATH homology
 2HBR B;  3D6H B;  1BMQ B;  4DCJ B;  2H4W B;  3IBF B;  2XYH B;  3P45 B;  1RWK B;  2HBQ B;  2XZD B;  5IC6 B;  4ZVU B;  1F9E B;  1PYO B;  1GFW B;  1NME B;  3QNW B;  2CJY B;  2C2O B;  1RHM B;  2C2M B;  3EDR B;  3R7B B;  4ZVS B;  4DCO B;  5K20 B;  1RHQ B;  2DKO B;  1RWW B;  2QL5 B;  1QDU B;  1RWX B;  1RHU B;  2H4Y B;  1I3O B;  4ZVQ B;  2H5J B;  3R7N B;  2HBY B;  2C2K B;  2QL7 B;  2QLJ B;  4JB8 B;  2XYP B;  2C1E B;  2QLF B;  4DCP B;  3D6M B;  2XZT B;  2H65 B;  3GJQ B;  3SIP B;  2CDR B;  1RHJ B;  2CNO B;  3GJT B;  2Y1L B;  2FQQ B;  2P2C B;  1SC3 B;  3R7S B;  2HBZ B;  1RWP B;  3R6G B;  2CJX B;  2CNL B;  1ICE B;  3EDQ B;  1SC1 B;  3GJR B;  2QLB B;  5IC4 B;  3KJQ B;  1RHR B;  2H54 B;  2CNN B;  1SC4 B;  4ZVT B;  2H5I B;  3R5J B;  3KJN B;  3IBC B;  4LSZ B;  2CNK B;  1PAU B;  2H48 B;  2QL9 B;  1RE1 B;  2C2Z B;  3D6F B;  4ZVO B;  1RWM B;  1RHK B;  1IBC B;  3GJS B;  2H51 B;  2XYG B;  1I51 B;  3KJF B;  2Y0B B;  4ZVR B;  1RWO B;  3P4U B;  3RJM B;  1RWN B;  3R6L B;  1QTN B;  4ZVP B;  3NS7 B;  1RWV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...