1ICEB

Structure and mechanism of interleukin-1beta converting enzyme
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTERLEUKIN-1 BETA CONVERTING ENZYME
publication title Structure and mechanism of interleukin-1 beta converting enzyme.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 16
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 1994-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1iceB00
1I3OB 4ZVPB 1QTNB 2QL7B 1RWOB 2H4YB 3GJRB 4LSZB 1NMEB 3D6FB 2XYHB 3R6LB 3QNWB 3KJNB 1RHMB 2FQQB 3R5JB 1BMQB 1ICEB 2DKOB 2XYPB 3NS7B 3GJSB 3D6HB 1GFWB 3GJQB 1QDUB 2H51B 4ZVQB 1IBCB 1RWPB 4DCOB 1RHQB 1RWWB 1I51B 1RHUB 2CNOB 2CNLB 2XYGB 2Y0BB 2Y1LB 1PYOB 2C2MB 3SIPB 4ZVOB 4ZVUB 2CDRB 5IC6B 2QL9B 1SC3B 1SC1B 2HBYB 2HBRB 4ZVTB 1F9EB 2QL5B 2H54B 2CNNB 2H5JB 2P2CB 4DCJB 3P45B 3EDQB 1RHRB 4ZVRB 1RHKB 3KJQB 3R7NB 2C2ZB 5IC4B 1RWMB 2C2OB 1RWXB 2CJXB 1SC4B 2HBZB 2H65B 1RWNB 3KJFB 1PAUB 2XZDB 3R6GB 4JB8B 5K20B 2CJYB 2QLBB 4ZVSB 3IBFB 1RE1B 3R7BB 1RWKB 3R7SB 2H48B 2CNKB 2C1EB 3EDRB 1RWVB 2C2KB 2HBQB 3P4UB 2XZTB 3D6MB 2QLJB 3GJTB 3IBCB 2H5IB 1RHJB 2H4WB 2QLFB 3RJMB 4DCPB
chains in the Genus database with same CATH superfamily
1F1BB 1RI7A 2MQNA 4USVA 1RA7A 4LF9J 4ZHRB 2XMVA 5DQGA 3RR7A 3MFHA 2RMLA 3V4MA 1C0UB 4LF5F 3BDPA 4FS2A 2DR8A 2OMOA 4K5SA 4HI2A 2AYBA 2ZOGA 3LGMA 4H4MA 1VIOA 3FBEA 2VKRA 3QJLA 4DL2A 3SQOP 2L9NA 4M5DB 2J76E 1SQGA 3SXLA 1HFEL 1NHUA 1TTHB 2V63A 4WCEQ 2WBRA 1QAIA 4DR6J 1A6LA 3JSBA 4YEAA 3KJVA 3UO0A 4B9SA 1Y11A 4FS1A 4OIXA 1OO0B 2L9DA 1TV6A 3TX0A 2J0QD 2FHJD 3UCZP 4R25A 1WTFA 3G6VA 4WXWA 2P9CA 1I3OB 1ZOTA 3G4SS 2HHPA 4X62F 4U7UK 2V8DA 1T11A 1S0VA 2WVBA 4F2RA 2XMAA 1X7VA 3CIMA 4RU9A 1EKRA 3R5CA 3A8KA 3FCVA 3DOKB 3IN5A 5KFJA 4I6WA 1TL5A 1VQ7S 4FVMA 2DNNA 3OSNA 4OZJA 4RJVA 3OD2A 3FK4A 4NCBA 4X65F 2FDNA 3EZOA 2UUAJ 2RJZA 3M6UA 2D69A 5U47A 2EKNA 2YWKA 4MYTA 2DB1A 2UUBJ 5HP1A 2NREA 3SCIE 2V4JA 4XPEA 4A47A 5IC6B 1MLAA 2Z2YB 4LR8A 3DM2A 2W9CB 3RRHA 3BDEA 1LWXA 4QIWD 1VLOA 4DV4J 3HO1A 3AY0A 1IWGA 1P1LA 1YJTA 3DOMA 4CO2A 1PSDA 4ZP8A 1P8GA 2CQGA 3QIPB 2PE8A 2DO0A 4QJVA 3V4IB 3HHKA 2AX1A 5F8LA 2H3EB 4CLZA 2H4WB 4HACB 3PY8A 4PXEA 1UJ4A 4W98A 3OQ2A 2VFTA 3BSAA 2ILYA 3DXBA 3TJ9A 4A8FA 4A8SA 2VB6A 3G8SA 2IM3A 4G1QA 1QAYA 3GSIA 1HA1A 1VLYA 2LA6A 4PUOA 4BC7A 2LEPA 1IBCB 3W7BA 1NZAA 4GC7A 3DRSB 2XMJA 3IO1A 1LK7A 2CNLB 4ECYA 2GHPA 3A8JA 1UTAA 3RAQA 2MZRA 2BQUA 2CJ9A 2LDIA 3UD3P 1HQ2A 2OSRA 1HHTP 4B3RF 2QL5B 4ED4A 2C2NA 2HZCA 2VPZB 3W8PA 2KFNA 2VPYB 4DR6F 1XN9A 3TUZC 2DIUA 2R7WA 3BO3A 4ED5A 5C24A 1D9AA 4NWBA 3GPAA 2KN4A 4USWA 3CJ8A 3KK2A 4YR3A 1OSCA 2HK3A 4M1KA 3KLHB 2KM8C 3ZZOA 2IJFA 2HFSA 5ETVA 2XLIA 2WSFC 4WP3A 3SFGA 1JLAA 1VBKA 4Z7YA 4UZBA 2XHWA 3I0RA 1R0AA 2OUGA 2YWHA 2DH9A 3A13A 4YQWA 1HNVA 3UW1A 3MXHP 1OWXA 3CEDA 4N5SA 4NLPA 4Q0BA 1UFKA 4HHHA 5B0AA 1KTVA 1C4CA 3I31A 3AD8C 5HLFB 2E1CA 2ZOMA 3JAMY 4OFZA 3CCQS 2DNLA 3CJTA 1APSA 4ZPVR 2DHHA 4N76A 5HK4A 1PO6A 1FRXA 2G1DA 5AJ3J 1EP4A 4J7CA 1S7HA 1I94F 1R0BG 2MHNA 3NGSA 3TOQA 1TQLA 5AXLA 1RABB 3SDEB 3LWLA 4JI4J 3D1QA 3GCXP 4M5NA 3TJ8A 3ILOA 2OO4A 2RHSB 3KXDA 1FVSA 5A8RA 2V4QA 1NJIT 1YBTA 2P8IA 1EAYC 5HBMB 1B0TA 2V8GA 3HJVA 4EYHB 2L3MA 1H2TZ 3I5AA 4J5OA 3J7AN 3UN5A 2YNGB 5KFHA 1QDUB 2YTCA 3QGGA 1RWWB 1NDPA 1UPPA 2W7AA 2LA4A 2XYGB 2Y0BB 2MKJA 3QYYA 5B0DA 5GAHU 3OFEA 2KL8A 4BLGA 5CABA 4DL3A 3P5TL 3CJ2A 4KAIA 4G65A 4ZVEA 5DGAA 2W8KA 1IBKJ 1VQMS 3M8RA 1RYRA 3CCWA 1S5ZA 4K4VA 4DS5A 4CIOA 4OV1A 3ZFVA 2FJAB 4LFCJ 2OKQA 3D4JA 4JB8B 1GXUA 2CJYB 2G2YA 1FVQA 4PKDB 5B0FA 2HWTA 5D3GA 5AE2A 2W2OP 1N33J 2RRAA 4NZ0A 5KOXA 2NLWA 4CLYA 1XNQF 3HK2A 5EWFA 1VGYA 1RWOB 2BACA 3N0VA 3QLHA 1R6YA 4PRFA 4DSFA 4ANCA 1YBAA 2KRRA 3MR3A 4KGMA 4J9MA 4OHZA 4HHUA 5HROB 2HHUA 3ZZYA 2MQPA 5J1NA 2WCXA 2J9CA 2HMIA 2DYAA 2XSJB 3BPDA 2QE5A 3TUIC 3KMQA 2AT1B 3C6UA 3MDFA 3O3LA 1IBMJ 1VQ9S 3SCJE 4LSLA 1FHTA 2FGCA 4TY8A 3RW6A 2KXNB 1O51A 5F8GA 5DGBA 1GMVA 5KAKA 4BWJA 4MYUA 5AE1A 5AJ3F 3CCUS 3WIVA 1RCOB 2RDDA 3MM7B 3ZO7A 2ZKUA 3TAMB 1N4LA 3PYDA 3MEEB 3Q89A 4JUZA 4LF4F 2HNYA 1JLFB 3M8QA 2KFZA 4I2PA 5GAEI 2RAQA 4TQRA 3T5LA 1U6FA 1VCTA 4WKYA 2B3TB 5LMUJ 3D6FB 1J5EJ 1RK8A 1M5PC 2F1FA 4IH5A 4IFYA 2XMKA 1S6PA 4ED0A 4O3RA 1FNOA 4IH7A 2IRXA 2V9KA 1DLOA 2I5JB 5IZHA 1YJ7A 2AHOB 2FLPA 1CJKB 4NMXA 4B9TA 3D0IE 1ULRA 3OR1A 4C0BA 2E5JA 1H72C 1TL7A 2NPIA 1MNEA 1FXRA 2OPPB 2HRUA 2R2TA 5F3ZA 5EWGA 2DY9A 2Q66A 2H54B 3S01A 3BR9A 1TKXA 5LJ3Y 2ROEA 1WHVA 1K9MT 1HNIB 4B9LA 1MU2A 1S77D 3KLIB 3AXMA 4IOBA 2K3KA 2RQKA 4QWAA 3M32A 5ETOA 3IM9A 1TZ0A 4H4OB 1W2BR 3IC1A 1YJUA 3D54A 3BB5A 2BE2B 1S12A 1TFWA 1VK8A 1KQKA 1X9SA 2WONA 3NEKA 1FXLA 2G0CA 4DR1F 1H2UX 1U1PA 4F0KA 1LWCA 4PXBA 4XDDA 1FRHA 3T1YJ 4WZQA 2RE1A 2HQFA 1AW0A 2Q79A 2IA6A 1X8DA 3NWGA 3MURP 4M8LA 1BQNB 4YB6A 3MD3A 1Q1KA 2E5GA 2FB0A 4ZJLA 3R27A 5IM0A 3KLFB 4JV5F 3PW2A 3W61A 3FSXA 3MM6A 3DRPA 3DGPB 2VBZA 3NGKA 1ZA1B 4FF4A 5EN1A 2CPIA 3CSKA 2AJ1A 3HX9A 1KONA 4DCJB 3GIRA 4BS2A 4P73A 1WORA 2ATLA 5DDOC 3OSPA 4KPYA 2CJQA 1U47A 1Y10A 3CD0A 2OEJA 1ZAXA 3BQ2A 1SL1A 2VFRA 4GRSA 4NLRA 3M30B 1SIWB 1CULA 3GG0A 3CJKB 1KLMA 3H25A 1X31C 3M2UB 5C2GA 2K7KA 4Y3CA 3M2RB 3RG6A 2NXCA 2B5JB 2OPQA 3H8YA 5A8KB 2H5EA 1X4CA 1B70B 2YNFB 2H51B 3E8OA 2AEMA 3UN2A 5CQGA 1T05A 3DOLA 3AJDA 1IR2A 3OR2B 2FHKA 4Q8EA 4ZVUB 4RNOA 4MFBB 1U09A 2ZJQQ 4ER8A 5KFCA 1T9XA 1CEZA 3IS9B 2PI5A 1FDBA 1WD6A 1T3NA 1CLFA 4CZCA 3G8QA 3T5HA 1RE1B 3EX7B 3G96A 1ZZNA 2A10A 4MIWA 3D0GE 3BN7A 2DNQA 4M63A 4PPZA 3C15B 1FDAA 4MJKA 5E3AA 1TMMA 4C0HA 2J5AA 2ZH7A 2VKZG 2MJNA 3R2DJ 3IFEA 4OHWA 4RW9B 5CYQA 3F0NA 2WB1D 1T9UA 1NNDA 3MTKA 3DMJB 2ZDOA 3T1YF 1D8ZA 4C3LA 5KT3A 3CJ5A 4LFBF 4WP9A 1L3KA 5GAGI 2ABYA 3SSQA 4GKJJ 1BUXA 1NK4A 1N52B 4RBUA 3U02A 2L08A 2EFQA 3TR5A 5A6WA 4ZJOA 2MDAA 4B3OA 3VV2B 1RWUA 2P2CB 4CH1A 1G6BA 3DLKB 4PG7A 3KHRA 2B6AA 1UFWA 1X9WA 1HLWA 1YJRA 1YZ6A 3R97A 2D3O1 5E33A 1H38A 1VHIA 1WI8A 1Q5YA 4OI0A 4Q45A 2K3IA 3UR3C 5CA5A 2XZTB 3ZNUA 1JLEA 5RUBA 2MB0B 1TMJA 1RT3A 5A2QU 2PA3A 4F02A 4PWUA 2QC3A 4U7CA 3L09A 4J9SA 2CZ9A 5HATA 4K8RA 1WDDA 3K58A 2IYGA 4E8UA 3BO4A 4GO5X 2M3DA 1MROA 3IGNA 3D6HB 1N0VC 1YJNS 4DL4A 3ZTPA 2HWHA 3R3TA 3HP6A 5IT9Y 1IKXA 4LMZA 4O4RA 3VGUA 4PQAA 4WIQA 4I4BA 4DL6A 1VK3A 2VFSA 3W2VA 2CDRB 4K4XA 4DR2J 3WX8A 2X1BA 1A9NB 1LW0A 3GIIA 4WWSA 3UWTA 1SV5A 2FJXA 4YP3A 1X5SA 2LKZA 3NGUA 5KFNA 2HBZB 3GFXA 4O3SA 3TZYA 4B3MF 4KGKA 3WIUA 9RUBA 4FYWB 4D3GA 2ERRA 2GVDB 1R0CB 5K14B 3QMQA 2F3JA 4Y0FA 3DXSX 4NA1A 4ED7A 4OJGA 2HAIA 3PNIA 3T41A 2FQQB 2NCKL 3BBFA 1U49A 4DU7A 4LFAF 3MM5A 4CT9A 2AIRB 1NK0A 4ZP9A 3KLEB 2YQ3A 2J6SA 2DH7A 5A76A 4ZVOB 4C9DA 4WK1A 4HYKA 1NPRA 1FKPA 5CXTA 1NDKA 2ZDPA 1RGVA 1K1QA 4RX6A 5DDRC 2IMWP 1JLCA 3NBPA 2XHCA 1HBNA 3QT8A 4IRCA 4ZVRB 2V2QA 4K2JA 3LGNA 2EK1A 3DLGA 5DM6Q 3QIDA 1VRTA 2AV5A 2DCLA 2AEJA 4LIRA 1HBMA 4FYYB 2KZMA 3HULA 1GNKA 3PM9A 4L73A 1RWVB 2KJWA 1FDDA 2ZITA 3QRPA 1DRZA 1LW2A 3CNQP 4Y34A 2VL1A 2X3GA 3RJMB 2BXJA 3J81Y 1SCJB 4DG1A 4DZ6A 3DKDA 2B9WA 4B3SJ 5I42B 2M70A 5GADU 4I64A 2MQLA 1RT1A 2RS2A 3VF0B 2XQCA 1Q53A 1RQ0A 4QOTA 1KOHA 2GIRA 1CJVA 1JB0C 4ZLLA 2DNKA 2VFUA 3ZXWA 2LEAA 3EGWB 4WTOB 1RHUB 2DT9A 1JLGB 1AXQA 2Y1LB 3K8VA 2XLJA 2BV3A 4J9OA 1WF2A 3BF4A 4JI5F 4EUVA 3EDQB 3TWZA 3W5ZA 3TQEA 1MMDA 1V6HA 1GMWD 2EG2A 5EGYA 3THVA 5C25B 4RW8B 1RT5A 4MKAA 3BEGB 2Z57B 1VR6A 5F8HA 4KC5A 5FIIA 1R89A 4M95A 1YJWS 4W90B 6AT1B 2AW0A 5H1SV 1X5TA 4J9UE 4RW7A 1R6VA 2K06A 4NASA 5BYRA 1JXEA 1F9HA 3ETMA 2RU9A 2LVWA 3W8GA 3OJUA 3PO4A 3MUMP 3PYGA 3RAXA 2JNJA 2Z56B 3QRRA 2GVZB 1N5YB 4HL9A 4IG3A 4LRFA 3TUPA 2DR6A 2CPHA 2BANA 1X4FA 4C7QA 4DLGA 1URNA 5J2MB 5F9NA 4C8MA 2E66A 2BJ1A 1FESA 1J5OA 3EVMA 3JYTA 4S0MA 1UPMB 4X84A 1P9QC 3A3OB 2R7SA 2DBBA 3QGHA 4A8YA 4LF2A 2DNHA 1UMJA 4ED6A 1FTCA 1R8CA 2FIUA 4ZA1A 4YHHJ 5GMDA 3GMGA 3EZ5A 2DNRA 1T9TA 3B4DA 2HZVA 1PJ6A 3P96A 2F63A 1EETA 2IAJA 1AROP 1N54B 4KKOA 3K5NA 3HI9A 3DRYA 3PYFA 2UVVA 2W7OA 1S48A 1R8BA 3IGVA 1UETA 3U27A 1VQ5S 5FD1A 3CCVS 1PJ5A 2HNDA 3MOJB 2FY1A 4PG6A 3MEGB 2ALZA 4E2FB 3OL6A 2LQJA 2X7IA 1QLNA 5HO4A 3VVUA 4B3SF 2NXNA 3I4PA 3LP1B 3TZXA 1SPBP 1S10A 4ELVA 2Y8WA 3CC2S 2Q3PA 1MWQA 2BE7D 2ZWOA 3VAKA 1HWIA 3AHPA 1EIYB 2RNEA 4RW4A 4ZDNA 1HWKA 1T03B 2FGOA 3R8YA 4ZN3A 2GC8A 3LP2B 2BW2A 4YB5A 5GAEU 3JS9A 1IR1A 2CQHA 3TA0A 2EXUA 3PVXA 2VPWB 1XBWA 3BGRB 5F8JA 4OI6A 1HWUA 3O1LA 5G4DA 1P1TA 2MGZA 1VOMA 1QM9A 1L3SA 1FRIA 3DRRB 4P71A 2BJEA 2DHGA 2KTQA 4QW8A 3L7OA 3Q8QB 5LSLA 5CZVA 1BQMB 3JSMA 2V50A 3GFZA 3P49B 4JI3F 2NXUA 4WK3A 5KFWA 3K7RA 1Y9OA 3IRXB 4TU9A 1E6VB 1Q81T 3IA0A 2HQGA 4KV8A 3PRVA 2OEMA 4CT8A 2VQEJ 2R7UA 3C6TB 1SJFA 2IM1A 2HAFA 1TKZA 3V6DA 1XMQJ 2I6WA 4DJBA 3BSNA 3GG1A 1NK7A 4DX8H 2LQBA 2E9RX 5DZ7A 5L1IA 2PSZA 2YKMB 2B4OA 4DV7F 2VG6A 3QQCD 3ICLA 2AP6A 1HBOA 1KVJA 4G6VB 1FK9A 4C8LA 4YR2A 4O3NA 3MWBA 1RT7B 2HHXA 1SJ4P 1KQGB 4TLRA 3E01B 4B9MA 2W9BB 1N34J 3MM9B 3BBCA 4ZVQB 4JI2J 2B8PA 1YBUA 1GXLA 4I7FB 2E7XA 2GO9A 1ZM4A 1WEYA 4IDKB 1X5OA 4M5DA 2XSFA 1LWFB 5G0RB 1N36F 2DGXA 4ECUA 5LT5A 4C0OC 1RAFB 3THTA 4NL5A 4F3QA 5T7LB 3M8PB 4OYOA 2EWHA 3MMAA 2C2ZB 1JJ4A 2H9ZA 4IO9Q 4R0JA 3TVYA 2K1RB 1JLBA 1LQ9A 1WKJA 4FF1A 4DV5J 4TXSA 4ZPBA 2HFNA 2F9JA 1VC6A 1SL2A 1VQ8S 4DUYF 2AJ2A 4OYBA 1QJHA 3GONA 4C3KA 1ROFA 2HG4A 4IG0B 4EEYA 4OX9J 1AYEA 4PQUB 5L9NA 4BWMA 3DDIA 1IXKA 3NL0A 3SI8A 2XY7A 2CG4A 1RBOB 4QR2A 2YNIA 3Q8VA 4KTQA 4GKKJ 1PAEX 2MKSA 1OQ3A 1SJ3P 1UZDA 4Y2CA 2PIIA 4CYUB 2W9CA 3QSYB 2HBYB 3TAQA 4R8UB 3Q24A 2YKAA 1R8PA 1PCAA 1IKVB 4QR0A 2VQEF 2NYIA 4RU2A 3MUTP 3MMCB 1NBEB 5KT5A 3PXGa 1XMQF 2HW3A 4P10A 3A4TA 2XZDB 3QIPA 3QGPA 2B4PA 4OQJA 1TL4A 2N82B 2UXDF 4FPIA 1MMLA 4CRJA 4CO5A 4HACA 4FP9A 1RHJB 3M9NB 5HMXA 3A12A 3AODA 1RB0A 1UEKA 2P9EA 3IAM9 2FJVA 1WC3A 1QSYA 3LPEA 3GJSB 2BQRA 1N34F 3FFIA 1XQIA 5J2QB 4U6PA 1RADB 2CWXA 1H2VZ 3SMZA 1PKUA 3AD7C 4JI2F 3DYAA 4ECSA 2YKNA 2XGPA 3OJSA 3LOUA 2AKWB 3U7JA 1RTJB 2I1RA 3A8IA 2Z4PA 3TRGA 2E9TA 4ZVTB 4QU7A 1PJ7A 3FBBA 5FJ4A 2NZCA 2Z8QA 4X4PA 5KTQA 2IC3B 5ETTA 2AF6A 4EYIB 4ZCIA 1YRTA 2ZFHA 3KTQA 2I2YA 5D77A 5F3TA 2J7KA 1XIQA 2V67A 4Y65A 4IKAA 3FMBA 2QA4G 2DIVA 4KFBB 3OFHA 2XEXA 2XO6A 3KLHA 4ZITA 4NXNJ 2XNQA 2CA9A 2MMYA 2OJ3A 4ID8A 3N79A 5J2NA 2VA2A 6FD1A 5ETMA 5DJBA 4QWEA 4NLOA 3IG1B 4O0NA 3VALA 4J91A 2JLFA 2V94A 2F5GA 1S1TB 5ITHA 3ZZTA 4DR7J 4L3NA 3PW5A 4NX9A 3FJ2A 4DFJA 4OX9F 2RDIA 5F0UA 5GMKa 5HLFA 2ZZTA 1RTHA 4RW6A 3OTOF 3I55S 2RRNA 4TLQA 2ASJA 2O67A 1VQ6S 4ILLA 5FDLB 2ZHOA 2J8SA 4XDCA 4ZS6A 1YVFA 1FNMA 4DPYA 1XK8A 3H98A 1RT2B 3D6TB 1ZM9A 3J7YU 3H5YA 5IQQA 3IBFB 1K47A 2ZVSA 1TUVA 4LSNA 3FDSA 2K8GA 3WHIA 4JYAJ 2Q6BA 2IHR1 2EFPA 1FEEA 1U6ZA 5HBMA 1RBLA 1FJ7A 2CWKA 5M2PA 5D0HA 1N32F 4B08A 2YNGA 4KT0C 3IRWP 4FF3A 3M4XA 2GS8A 4X4NA 2UU9J 3DDKA 4NLDA 1I6JA 1F5CA 3GFYA 2O1PA 1S9EA 3SQGA 3EWGA 1IWAA 5IV3A 1YTYA 5HVHA 5HQ8A 1M5OC 3JQJA 2BA9A 1U1KA 4DFKA 3NAIA 5HQMA 4TN2A 3N5FA 5K8PA 1YZ7A 4WPAA 3D66A 4UF4A 2HQDA 4LF1A 3HSZA 4A8OA 4LRCA 2ZH4A 2QJ3A 2PEBA 2UXCF 4B3TF 4KQZA 4DV6J 1U1NA 4PABA 2LP4A 1U24A 3T5JA 4K50A 2WTFA 3P3DA 5B08A 3HSDA 2H4YB 2JWNA 1HI8A 5A8WB 4Y28C 4K4UA 2N3OA 5KFMA 2XS2A 4JI6J 1CJTB 2ZH2A 5HROA 2A2CA 2Q1LA 3CJ4A 4EO8A 2FTRA 2MQMA 3UVJB 1OMSA 1AA1B 2UUWA 4PCQA 3TANA 3BBBA 1N5QA 1RAGB 1C1BA 1FERA 1BY9A 1FXDA 2M5YA 3S1TA 4DDFA 1Q0NA 1U8SA 4K4ZA 3J7ZT 3QJJA 4WZMA 1P27B 2FHOB 3MCNA 2DGVA 3KUHA 4H4MB 5D4PA 2ZBCA 1Q16B 3EM1A 2BUNA 4URQU 2HIQA 4K4TA 1H0HB 5H9FK 3BPSP 1JWWA 3TAMA 3W64A 2ASLA 2HYIB 2C2EA 3UNGC 1GK8A 4KJIA 2HVIA 1XR5A 4IUFA 4FYXB 4WXOA 2BJ8A 2HS0A 1N6QA 4HT5A 1TL3A 3QT6A 3Q86A 4ZVGA 2RT3A 3HJFA 3AJ2A 4JYAF 1PGZA 3G6XA 1JIHA 1Y7PA 1BC6A 4ID5B 4LF7J 3HXMA 1N88A 1TV6B 4FBUA 2IMOA 4Z7CA 2V9WA 2MKKA 5BXIA 3CD7A 4WE1B 1RWPB 3H2LA 1R7IA 2RB7A 1LOUA 4ETZA 4DF4A 1Q4RA 2BOAA 4Z37A 3GZ7A 2ZE2A 2OPPA 3TO8A 1S1WA 2BX6A 1YI2S 3SFUA 2OPRB 1WWHA 3GU0A 3H0PA 4DSKA 2VIHA 1DQAA 1F2HA 2BABA 5KFEA 4O0IA 5E3PA 2V4JB 2ZC4A 1PYTA 3KMSA 1UA1A 4H4OA 1NSAA 1SJRA 3DM2B 2VDIA 2HIYA 2ZHAA 4EI2A 2BE2A 5LMNF 2WSCC 1GX6A 1UAWA 1D3WA 2FVSA 1W26A 3GCWP 3R5GA 3DHXA 4RNMA 1NPKA 4DHVA 1NKCA 4KO0A 3J80U 1XWLA 5M2RA 3W62A 7AT1B 2MEWA 3D68A 3KLFA 4JI1J 4JI6F 2CPDA 3CDEA 2W4DA 3DGPA 4ELUA 3HVWA 2FVQA 2IY5B 2W7PA 1FE4A 1PYOB 2B8QA 4F4ZA 3IWNC 4A46A 4YB7A 4X64F 1TL1B 4G1QB 1VRUA 5E5NA 2ZH5A 4YDDB 4PUOB 2H5JB 3WC2A 2DITA 3M2VA 3RR8A 1WF1A 3C14B 4LR7A 5LXRA 3K8WA 5ETKA 2R8IA 5HANA 2DGTA 4F0MA 3FGVA 5SUHA 3HKZD 3QFWA 5BR8F 4G3IA 3H59A 3ZZZA 4HLBA 2VOPA 2FLOA 3M30A 2VOOA 5F8MA 3CJKA 3B54A 4DN0A 4P9SA 2PO4A 3EICA 1FI4A 4WFBQ 4HT7A 2VC0A 3MPWA 1UW9A 4YDXA 4LQ9A 4RZRA 2B5JA 2RILA 2KYZA 2XMTA 4DR3J 1PC4A 1KFDA 5A8KA 3D1HA 3ET6B 3OTDA 4QQBA 4WYLA 1V5IB 2IJRA 2V8PA 2E5IA 5C24B 3T19A 5BJRA 1NK9A 1FX2A 3PYEA 3SV4A 3KK2B 2QX0A 2GV1A 3ADAC 3BV8A 1N48A 4MFBA 3K59A 2CADA 4ECWA 2JL9A 1IBLF 2EFOA 4N8OA 2MKIA 1AFIA 5ETSA 1MWZA 3IS9A 4AUKA 3I0RB 3VAIA 1R0AB 4XTTA 1QAXA 2RSQA 4K0KF 3VHQA 1HNVB 1MW7A 1RHRB 4Q0BB 4PWWA 2WK4A 2DNOA 2FYXA 2F8HA 2RU3A 1RACB 1UVNA 4LF5J 5D4OA 4DQQA 4I6AA 2RDJA 5KFLA 1B7YB 2AGOA 4P74A 3ZTSA 3FRZA 3C16B 1HQEB 1RU1A 1S4FA 1FWLA 1ZPVA 3QT5A 2KB2A 2OGUA 3TZWA 2KKHA 1SKSA 4MMOA 2R7XA 2XI2A 4N56A 2AYGA 4NLUA 1OPIA 2IVMA 5A8RB 4O44A 4PYDA 1ZM2A 3IR6B 1UP1A 4NYOA 3K2YA 3QO9B 2N3LA 2Z2LA 3IBWA 3LW5C 3DN9A 1F9EB 4F7VA 2OD4A 3LUYA 4DL7A 3P5BP 4H54A 1WEXA 2WB4A 5IV4A 4O3PA 3VGVA 4K5RA 4C3MA 3HFVA 1TKTA 4X62J 1LXNA 3O6QA 4USKA 4WJBA 5T41A 1KQFB 3H42A 2RKIA 4C8KA 4QW9A 4K2XA 5ETQA 3BR8A 2DPIA 3DDNA 4DSJA 4X65J 2JRSA 4XPCA 4QU6A 4GMKA 2W4PA 4A8KA 4KGVB 3RBXA 1HD0A 1S72S 1IKWA 3HD1A 3ENQA 4EMDA 1WOPA 3BYPA 4Y2AA 3JB9k 2OH2A 1V3ZA 2B51A 1U45A 4NXMF 1Y3JA 5D3GB 3VGTA 3ZTQA 1GXTA 1F0XA 3PR4A 2GIFA 4WFZA 2AEFA 5BYQA 5EDWA 1KHVA 4KSEB 1OY8A 4J9KA 5IFMA 1VQ4S 5ADZA 4OHXA 3QLHB 3W65A 1JNRB 4DV2F 2IYIA 5T14A 3B78A 8AT1B 1MN9A 4ILMA 1SC1B 1M5SA 4ICLB 1JK9B 3MECA 2MKYA 3QBCA 1UVJA 1FX4A 5IWAJ 1JJHA 1WHWA 1MMNA 4EGLA 1CBKA 3CJQA 1WG5A 2DGQA 2GVDA 5A0YA 1PAUB 1S7IA 3V5RA 4CQ1A 4PEOA 5K14A 4FKYA 4J9NA 2V6AA 1S1UB 1X4GA 4M5GA 4ATNA 1PC5A 2OEKA 2FJDB 2DISA 4TY8B 1R43A 3N01A 2VONA 2E7VA 2I8EA 4HHJA 3H20A 2J0XA 2J6UA 2QIFA 1KEKA 2B9XA 4ECZA 4F4YA 2JEFA 2Y1JA 4QR1A 4B3RJ 2DKOB 1H3DA 3GIJA 3UD5A 2HNYB 2IBKA 1NZ8A 4OI3A 3M8QB 4I2PB 1WG1A 2Y3YA 1VQOS 1FTRA 3VZIA 3KLEA 1IKYA 2D74B 1UJ5A 5AXMA 2DR7A 4G1PA 2J6TA 3I96A 4IFYB 3GTYX 2MKCA 1S6PB 3MD1A 3ZNJ1 4OZ0A 2GQQA 1Z2ZA 1Q8LA 4X4RA 2NXEA 1DLOB 4PR6A 1NKBA 1OSDA 1O0PA 3LF0A 1OY6A 3GQCA 3BKTA 3O8WA 4JI8F 2FJWA 3AFGA 3U1NA 2BJDA 1TL7B 4FNHA 4ERDA 3EUNA 1MWYA 3R7BB 5D0RA 5DDQC 3EDRB 3QGIA 2UXBF 2C2KB 2HBQB 1TKXB 5HVGA 1SL0A 1UEVA 3H4DA 2F4VJ 4RWXA 4DOZA 1N56A 1OJ4A 4X4SA 3H7HB 3FNNA 4P7VA 2VICA 3ZZ0A 1MN7A 1DURA 3RBDA 1YLXA 1XNRF 4QIEA 1YG0A 2LXUA 4KPCA 1PG5B 2ZH1A 1I94J 2G1HA 1JLGA 3EPGA 4NLWA 4WP8A 2WONB 1U2RA 2A6OA 2YH1A 2FHJA 1LWCB 2WVDA 1D9DA 2DNGA 1HR0F 1NB7A 3LA0A 2RQMA 5C42A 4HVZA 1REGX 1F9FA 5JMNA 9ATCB 5J2PA 1N8RT 2CXEA 1GEHA 5IM0B 3P6YC 3QWPA 5C25A 2LFVA 2IM0A 1S79A 5EUHA 4OZ5A 3MM6B 2IVYA 3DRPB 1YDLA 1RWXB 2CJKA 4V19J 2GGPA 2O66A 1RWNB 4OYAA 4EZ9A 1IR0A 1RXOB 5IWAF 1UVMA 1H7WA 3LP0A 4AD6A 2QA4S 3VGSA 1M1HA 1EX8A 3L3CA 1REVA 1FKOB 2C3MA 4PG8A 2OFHX 4EWTA 4OZ2A 1U1LA 2OTLS 1OIAA 2CPEA 1JLQA 1KBRA 2H1YA 3PJ9A 1AZSA 2CRLA 3CJ0A 2R7RA 5JJBA 1HIYA 4F2SA 3RYLA 4PYAA 1NK6A 4ILRA 4MKBA 1RT6B 5J2MA 2ZHBA 1AUSL 2CUYA 3D9BA 5DG7A 2FPHX 3HHLD 3O2IA 4MH8A 3UI3A 2YKQA 3WX4A 1RTDB 1RKIA 2GJIA 1S1VA 3W5YA 2KT3A 3BQ1A 3NKYA 1XNQJ 1V5VA 3E2EA 1T05B 3DOLB 3HHDA 3CC7S 2O01C 2GJ2A 1VRQC 3R7NB 5F41A 3JSYA 1WJ9A 3G71S 4MKVA 5J1EA 4QYZJ 4O4GA 1NSKL 1TR0A 5KFDA 3GR0A 4ES2A 2BOPA 5E0OA 2QLJB 3LH2S 1VJQA 3GE9A 4N77A 4YY3J 1P6TA 2DEJA 3Q8RB 3JQMA 1EKSA 4UY85 5H9EJ 1UVLA 5KFRA 1BMQB 1G2EA 2F4VF 4U7UD 4I2QB 1GQEA 5GADI 1D8YA 3PJWA 2DTJA 1HARA 3KK1A 3MAAA 3K5LA 1C2PA 4DCOB 4LIWA 2KXFA 2JVRA 4MT1A 3FMWA 1NJZA 4MK9A 1X9MA 4FVCA 1WSRA 1GTEA 4LF4J 4R5PA 3LP2A 4QWCA 1WEZA 5C7PA 1KD1T 4OZ1A 1YIJS 2WVFA 3L7UA 3PX6A 1RHKB 5KT6A 4WIIA 1KRPA 3ULHA 4GVBB 3M6WA 3DHWC 1Z4UA 3OW2R 3BGRA 1DTTB 5EX3A 3D0HE 4RLEA 3UDCA 3UDLA 2B6AB 1V3RA 1HPZB 4ZVPB 3KHGA 3HHNB 3R1LA 4I1TA 2XYHB 5JXSA 2HQ3A 2DHAA 4FN5A 2DXDA 2BKOA 3OLAA 4B9VA 3A1YG 4ZCMA 5L9XA 3W1YC 2VBWA 2UUCF 2L9WA 1HNWJ 4DV0F 1RT3B 1T3OA 3GYGA 1I51B 2ZBRA 1SH3A 3MAHA 1M5HA 3NS6A 3C6TA 4ZP6A 1BWVA 2CG8A 1R8AA 1MROB 2HBRB 4RR5A 2ROPA 1F2GA 1HWJA 2LECA 5M2UA 4E98A 4RUAA 2E44A 2ADBA 2B9YA 2Y0SD 2YKMA 1CSJA 2AX0A 4DR1J 2P5VA 3MHYA 4DF8A 1NKEA 2QMXA 1T7PA 3DFEA 3W2VB 1RLCL 2KG0A 4KRWA 3UN3A 1VQNS 1LW0B 2V34A 4JV5J 1SV5B 4FKXA 1YITS 4NOHA 2WSEC 3R6LB 4AQYF 1FRKA 4PG4A 4M5MA 4YY3F 2OD6A 5CHCB 1U0HB 4ANDA 2NSBA 5B0GA 2DPJA 3SYZA 2NXJA 3Q83A 3OVAA 3SSRA 5GMEA 4I7FA 5F0WA 3HF5A 4IDKA 3M6VA 5HQLA 2EW9A 3DI6B 4KB7A 3V81A 4GVLA 3Q22A 5KFPA 3CB4A 2V69A 1RBAA 4H4KA 4IR1A 3MM5B 4NLSA 4CP5A 5KFYA 1BWEA 1WELA 1K0VA 1RU2A 3M8PA 3GR1A 1VYAA 5CYMA 2ZBPA 3EXCX 1YSJA 4DPWA 2VG5B 2R9LA 1RWMB 4N8NA 2W24A 2WZ1A 2IFXA 4K7QA 1VBZA 2OHDA 1HYSA 1QUPA 3R5AA 2K1RA 1RA6A 5DRKA 1FKPB 2E5HA 3CD6S 4DEZA 4U96A 4NLVA 3H2UB 2QZ8A 3PKYA 1HBNB 2FJBB 3K5OA 5KFZA 2YX7A 2FVRA 3DLGB 4KE5A 4DR5F 2PC6A 3HHEA 3M8YA 2F4FA 5IT0A 1I1GA 4IG0A 1HBMB 4OI2A 2DRBA 4L74A 2CPJA 4OHVA 1H73A 4CDIA 4IQXA 4J9LA 1LW2B 2HQCA 4DQPA 3T1AA 3FBFA 4LVNP 1BHNA 3LANA 4DG1B 1HNWF 1FE0A 3AJ1A 1ZAWA 4NZ6A 2CKWA 4P7TA 3WC0A 3DGVA 4R8UA 2FUG9 1BQXA 1ZBTA 1UFLA 4U8YA 2HPUA 1TELA 2C42A 1CJVB 4ECVA 2EFNA 3ILJA 1FRMA 1IJEB 3FKBA 1IM6A 5D6GA 4Q43A 4UTGA 2VJUA 1PBAA 5IOLA 5KG5A 1C1CB 5KG2A 3PACA 4LFBJ 4PXDA 4DS4A 4RUBA 4KH1B 3GWCA 3CCRS 3CXCR 1Q7LB 3W5XA 1M5VC 1TUGB 5A6PA 4D3HA 4F0HA 2FC9A 2ACYA 2KT2A 2LLZA 1RT5B 3NRBA 2BYCA 2GZOA 3GJQB 2KRBA 2EEYA 2MLZA 1VQKS 2O5DA 3R9LA 1RTJA 1YQHA 4YB1P 2XMMA 4A8WA 3KG4A 3HCXA 2QLXA 4IG3B 4ZVHA 3FCWA 3M8WA 3QWUA 4BBYA 3MPVA 1Y5NB 3KOAA 2V5HG 2IC3A 2BANB 4TNOA 2K7JA 1W25A 1JKHA 3G6YA 5KG0A 4ZLNA 4NLQA 3D7SB 4DFMA 3QATA 4W4MA 4FZVA 2C28A 1J5OB 2Z2MA 1JNZB 3FSIA 4DR4F 3JYTB 4C4WA 3D28A 2PGCA 5FLXU 2JHEA 1HHQA 2FVCA 1KDNA 3POTA 4USUA 1KKHA 2F7VA 1LWEA 3IP0A 1KS2A 2JDJA 2NUUG 1QTNB 2QL7B 4WFXA 3NLCA 1D9FA 1TK8A 4DWIA 3GV5B 4P2XA 1RHMB 1EETB 1ZAVA 3R5DA 3V6KA 4GO7X 1VIXA 4KKOB 1M1GA 1WI6A 3MEDA 1TFYA 2D41A 1WHYA 3OL8A 4Q7AA 4Q44A 2JH3A 1FFGB 3WQPA 4ALZA 2PDAA 3AQPA 4UQTA 2HNDB 2CPFA 1T0TV 2MLXA 1XTZA 4X66F 4B3MJ 3ISND 4F8RA 1QD1A 1K8AT 3RTVA 3G82A 1VISA 3CCLS 1XMOF 4CLTA 3LALA 5FDLA 4X4OA 2MKHA 3PEJA 4X4VA 4ZPDA 4RW4B 1NUEA 5JVHQ 5KT7A 1SIZA 2PD1A 4G1IA 3TAPA 3JQKA 4LFAJ 4EK2A 2CPYA 1NH7A 1DTQA 4J9QA 2HHHJ 3A8EA 2E29A 3GYNA 4U8VA 3MAQA 4O23A 3MUVP 1ZH5A 4NI2B 5IS2A 2UZAA 3LWMA 2Y1IA 3VQTA 5KFAA 2WOMB 3ZZUA 3B6BA 5FLXY 1X4DA 1W7WA 4WYWA 1QVFR 3IWLA 3ENVA 3KDNA 2KXHA 5D8HB 4OZLA 2E7WA 2HFOA 3CDUA 4DFPA 1YHQS 3UDVA 2GX8A 3GIKA 1ZS6A 4DV3J 1FT8A 4OV6A 2WVCA 2VF3A 1FRLA 2YNHA 2GAHC 4LBHA 5DZ6A 5LXYA 1RISA 2KVIA 3S8SA 1NHKL 3JSMB 1R27B 3I0SA 3MI7X 2R8HA 4UOFA 4P2MA 1ITPA 2A3JA 1OY9A 1HNXF 4X2BA 2IBOA 4KV8B 1U6BA 4E0DA 5KFKA 2AWZA 3EGVA 2A6MA 2VBYA 1KHWA 2QT7A 2I38A 5LL6d 1KR4A 3Q8UA 3KYLA 3FSYA 3IR7B 4ANEA 4J90A 4M94A 3GJRB 5HVFA 4DQRA 4I6YA 2VG6B 5KFGA 4RBTA 5A8WA 2B4VA 3G6ES 2MSSA 2UV8G 4JI5J 1ICEB 2MQ8A 4DV1J 4FXDA 3AD9C 3AOCA 2AGPA 2ZNZA 4CLKA 1FK9B 1U1OA 4KHPJ 1S99A 3AH6A 1WTBA 3MTJA 3I5CA 2DR5A 2IVFB 2ZZNA 3FEZA 1C0TA 5L1KA 1CC7A 4IO1A 3C2PA 1QSLA 4DUZF 3HVTA 1VJWA 4K4SA 2YH0A 2QL9B 3UQSA 3K57A 1X4BA 3TNVA 2B4UA 4DX7A 2QN6B 1GT8A 1F3VA 2JVOA 3BYRA 3DNCA 3KJQB 1Y0HA 4FPRA 2MLYA 2VODA 4ES3A 3ZTOA 3DCAA 4CI0B 3CW2C 5K8NA 4RO0A 3J7YI 3VAJA 2FVPA 2ASDA 4NRTA 5I3UA 1FJGF 1S1XA 4RNFA 2CQCA 2BMBA 5A2QY 2ILZA 2HHHF 3FQKA 3MMAB 4ID5A 3M9OB 2MSTA 3GV8B 2HZAA 3D67A 4NYZA 4N47A 3OHBA 2HRTA 2V68A 3VAHA 5CCLA 1JLBB 1NCLA 4WE1A 4CO4A 2AZ1A 3PFOA 1ZA2B 1TU0B 1HKAA 1CC8A 4DV3F 4M5KA 2EPIA 2XCPA 2Q43A 3WDOA 2OPRA 4OX7A 4LUBA 2KT5A 1DBDA 1HW9A 3CUNA 2Y8YA 3GIMA 3PEHA 4C11A 1KC8T 4AXIA 2YNIB 2POKA 4Q2MA 1Q8IA 1VQLS 3NNAA 1Q95G 3HVAA 2M9KA 2BM0A 2FY8A 1TUWA 2GQ2A 2CVIA 3ILLA 1KQSR 1RUSA 2E1MC 1WACA 1RWKB 1Y00A 5ETPA 4LR9A 3PV8A 4NEZA 3FVYA 4I68A 4CLUA 3TEHB 3EVOA 1N5SA 2DD8S 2EFVA 4UOCA 4JI7F 1S9GB 4OYMA 4YN3B 4C8NA 3DLBA 5C2CA 2EK6A 1QE1A 4DV1F 2V4RA 4OYIA 2M8HA 1LEOA 4KHPF 4I69A 2GFFA 3JXOA 2ASYA 4HH0A 2D3UA 1TL1A 4LF9F 2XB2D 3JAMU 5ETRA 2QGFB 3CE8A 3C14A 1LFWA 2ZH8A 3TUJC 2HQIA 3TI0A 1S6UA 3FFIB 3CCSS 5DLGA 4DX6A 2DO4A 4FBTA 1SBRA 4MIAA 2ZC3A 1VQPS 3DYAB 3NGTA 2YKNB 2OFGX 4FDFA 4DU8A 2ZH9A 4YMEA 2DH8A 2W8LA 5D4LA 2V8HA 1EQMA 4JI3J 4QYZK 2W25A 2JLEA 2R7OA 2WHOA 4FYDA 3UVJA 4OJ1A 4BCAA 2QO3A 2DGUA 1SI9A 2J9DA 3MPDA 3S6EA 2NSCA 2BJ7A 3ET6A 3MR6A 4LSZB 5DETA 1C4AA 2RF2A 3R5BA 1VDHA 3CMAS 3DLEB 1HI0P 3N28A 2ZD1A 3VVTA 4ED1A 5H9EK 2FHMA 3SCLE 1GMWA 1UWBB 2HVDA 2ZM6J 2MY8A 5KFOA 1IQTA 2J7UA 4DQSA 4DV7J 2AJ0A 1SUQB 5DLFA 2W2NP 4ZVFA 3ITHA 4TY9A 2GW8A 3DC2A 1W2IA 4WFYA 4DSEA 5J2NB 3B8HA 4U95A 4OJHA 1SKUB 3OFGA 2B56A 2XMWA 2CNNB 3D1OA 1FD8A 1BXNA 3FC9A 1NO8A 1U1RA 3VZHA 4NCGA 5KFTA 1U0SA 4LRAA 2UUAF 4F25A 2C2OB 4CNZA 4ECTA 1RTHB 2XC9A 4RW6B 2UUBF 3N9UC 1VC5A 2CJBA 4UUXA 2UUTA 1Y3KA 2AZ3A 1DAXA 3C16A 3IBCB 1HQEA 2J7WA 2YWFA 1X4EA 2DVIA 5HJXA 2RVJA 2HNZA 3HHLB 2PMHA 1N36J 4DV4F 1S49A 2PFDA 4QPTA 5HAOA 4CH7A 1I5OB 3PFEA 4C6AA 2CZVC 2RRBA 3CIZA 4PZVA 3TA1A 5D15A 2LQ5A 3OXLA 2KI2A 4ES1A 3H5XA 1VI7A 4BC9A 4LSNB 1AT1B 3QFHA 3RRGA 2EG1A 2BBEA 3QO9A 3I56S 2HGMA 7FD1A 1HQUA 3K5MA 4WKRA 5E3RA 3D5MA 3Q0AA 3KK3B 3HM9A 2AMCB 1O5JA 2E1AA 1QTMA 4C8OA 3DU6A 2KJVA 4JI0J 1G4CA 2VDHA 3VCDA 3JSRA 2W2MP 1E6YA 3V2UC 1RT4A 1WC1A 2HVHA 2ADCA 2EKYA 2R7VA 4DUYJ 3F44A 3Q2TC 1K1SA 1S9EB 3SQGB 3N4WA 3CCZA 5DM7Q 2VD3A 3EJMA 3KLGB 2XULA 5IT4A 2RS8A 4DXLA 4KYZA 1WC5A 1WHXA 3RZAA 1Z1ZA 3TA2A 4BDPA 2QTWA 4CH0S 3GB0A 3OT9A 2UVUA 2J9DE 2AJQA 4AXJA 2C22A 4A8XA 4IFVA 1CJUA 2HHQA 1UEUA 4P52A 3MM8A 3IAS9 2HWIA 1ACMB 1IN0A 1CS4A 4M5HA 3OTCA 4NRUA 2JEJA 5D0GA 1YRUA 2D3OR 2QSWA 2C2RA 2VASA 2WW4A 3PG9A 1TVRA 2ZM6F 5DG9A 3NCPA 4NEYA 1Q78A 2OMLA 4ICLA 2UXDJ 5KFIA 3NG8A 4TYBA 2OPSA 1CVJA 4P2SA 5F8NA 1WG4A 3W2WA 3VR1A 5F9LA 1C1BB 2IDEA 2I9SA 3AXKA 3T1HJ 4B9UA 4ZHRA 2KDOA 3QPIA 3KJFB 2W4CA 4RNHA 3T6JA 4HKQA 1DJ0A 1S1UA 4Y2MA 1C0UA 2L41A 4XK8C 2VG7B 5DQIA 2LQ8A 5HMYA 1SC6A 1RTIB 2ZUGA 4IQMA 4KIAA 4LBIA 4ZPTR 4Y2KA 1RCXB 4NLXA 4JI4F 3C3LA 3C66A 4NMLA 3NP5A 2RHQB 1N6QB 1TL3B 2KFYA 4IOCQ 4ZCLA 3MZIA 1U8WA 4Y00A 2AQ4A 2JSXA 3HFZB 3PHEA 4TYAA 1DQ8A 4USTA 1T9YA 4HH1A 1UVKA 3TARA 1KTQA 3OVBA 2RIJA 5CYJA 4FF2A 1VBYA 2C2DA 4U67Q 4JI0F 2GHWA 3C46A 3GYXB 2ZBIA 1ZPWX 1B7FA 2ZE2B 1S1WB 2FZGB 3CGIA 2VV5A 5E41A 5MAOA 4P6QA 4DSLA 4F26A 3DOKA 1M5KC 2CDQA 2QA1A 3I9ZA 3G87A 5B0CA 1NXIA 4ECXA 3R1HA 1IBKF 2B7CB 2M8DB 1B4SA 4AE5A 3OTOJ 1FF2A 1FFWB 4KHRA 4LFCF 2QEXS 4C98A 3H2VE 4OL8A 5B0EA 1KN6A 4KHMA 1N33F 3PZPA 1CG2A 2C3OA 2BKNA 2N4DA 2CNOB 1SVDA 3RRKA 3PIOQ 3M1VB 2V2KA 4CM2A 3HHLC 5JVGQ 1T95A 1WKLA 4KO0B 3U1MA 2R4FA 4F4AA 2HSEB 1NJWA 1YKWA 2FLLA 2KHCA 3V4IA 2DNYA 4DMZA 3KDOA 3CT9A 4QPXA 4NA2A 2Y1RI 2X1FA 1WC4A 2QYCA 4DPOA 4NLYA 2VJVA 2QMUB 4L6V3 2E5LJ 1SC4B 4P75A 1N32J 3N5BA 2RQ4A 4EO6A 1S76D 3TVZA 1VRUB 3FRYA 4OYPA 3T1HF 2XY6A 3M2VB 1FKOA 3MMBB 1IBMF 3PX0A 1NRKA 3KUGA 1TAUA 3DRSA 1NJYA 2JLGA 2HS4A 3RAMA 3DLLQ 2XI3A 4RPFA 3OFFA 3F41A 1A0OB 3BQ0A 1SH0A 2RQCA 4CTAB 4JV0A 4AL5A 2EBGA 3A3NB 2JZ5A 1NU4A 1RT6A 4KR0B 3NNHA 3NY0A 3FCHA 1HBUB 3EPIA 2OELA 1T9VA 4ZP7A 4YOEA 2LCWA 2RUSA 1U4BA 3B4MA 1U2FA 4EU0A 2UXCJ 1RTDA 2LU2A 4B3TJ 5LMUF 1J5EF 2YX1A 3US5A 4DL0C 1YWXA 3THPA 4USHA 3ZTRA 2AJ4A 4ZLPA 2CQ1A 4F67A 2FD2A 2W2QP 2QG9B 3MCSA 1FKAF 1NPPA 2R42A 4K4YA 2YKOA 2CQ2A 2C3YA 2VBXA 1HMVB 3G8TA 2DGSA 3ZZRA 2V0NA 3NGRA 1N0UA 3UDEA 2CQPA 2KYXA 1RSCA 3DLHA 4GC6A 5EX0A 2CQ3A 2PMWA 2NUHA 1NJXA 2ZVIA 3CDWA 5ETLA 3BZQA 3NXZA 3KJNB 2VA3A 4I2QA 2LDYA 3AA8A 3L4BC 3AB2B 3KNGA 4YS2A 4ITSA 4USJC 5AXKA 4AYBD 5IT9U 3TZZA 2HHTA 2BVZA 3PHTA 4CLSA 4UQGA 1S6QB 5KFXA 7FDRA 3SDEA 4M5JA 3Q2SC 3EVWA 2MZQA 3TW0A 4CLWA 1U1QA 5L39A 4O44B 1LK5A 2YBVA 2E1RA 3RBEA 3BGLA 1QAJA 4ZIVA 4JOUA 1CQNA 1CPZA 3PTWA 2B7BB 4GVBA 1UKUA 3ZZPA 1KWMA 4A4JA 2ZNYA 4L76A 1DTTA 2LQ9A 2QLBB 2BW7A 2YWEA 3QAEA 4U9RA 2E5LF 5EHHA 2R7TA 3ENWA 2Y9HA 3F73A 2CQ4A 1HPZA 3BSCA 4X4QA 1TKTB 2YQ0A 4OMFG 3G9CA 2XLKA 2GMHA 2OIHA 4EBCA 1SH2A 5L1JA 3QNWB 4DPTA 2ALYB 2RKIB 1Q7YT 3WBZA 3NCRA 1TAQA 3H5SA 2QSFA 3NAHA 4DI6A 3HZEA 1ZYQA 4WFNQ 4MK7A 4B9NA 3T9NA 3FEYB 3JTOA 4WU2A 4LBPA 4PPDA 4CLPA 2OLWA 1IKWB 4XAKA 3AB4B 2AU0A 2DNZA 1YJ9S 2YPZA 4QIFA 3TX8A 3OPKA 2HGLA 5KFUA 5LMNJ 3VWSA 1HHSA 3W9HA 5CD4H 4TU7A 4ECRA 1O6XA 3H40A 1F5AA 2OAUA 4PAAA 2G0IA 4IYQA 3PRBA 4LRDA 1PIEA 2RH3A 1EQ0A 1DQ9A 5E3QA 2A18A 3UCUP 4ZPAA 3M7VA 1XJWB 1OS5A 1BE4A 1KOOA 4KH0B 2HS3A 3G86A 3MECB 2N7CA 4UUWA 1V9OA 5I3PA 5LSRA 3OUYB 3J81U 3OL7A 2IIHA 4A8QA 3CCMS 4PWDB 1KLNA 1EARA 2XSJA 5A0YB 1L3UA 1U0HA 4X64J 4QIGA 3CJSA 1T02A 1Y5LB 4X4TA 1HNZJ 2GQCA 2V2ZA 2W9AA 1X0PA 2XO7A 2JOQA 4EBDA 3DI6A 2A2DA 3L9ZA 4LF6J 2IPOB 4OHYA 5D78A 2GO8A 5JUMA 5BR8J 1FDNA 3UCGA 1QVGR 3V6HA 3KKFA 1NB2A 3MM7A 3FZ2A 3MEEA 3PJXA 3U1LA 1JLFA 2G9OA 4J37A 1XC9A 3P45B 5KG6A 1IKYB 2VG5A 2X1AA 3KJVB 1N5TA 1X4AA 1NSPA 4MK8A 1NLKL 3GFHA 3KWMA 4GKJF 4IRKA 3R2CJ 4HR2A 3L95X 5H9FJ 3W9JA 2H5IB 4WTYA 2DK2A 2I5JA 1ZETA 1S59A 2BZ2A 1RLDA 1CJKA 5HJYA 2HEKA 5DDPC 1VBXA 2BJ3A 2R8GA 1IBLJ 2KU7A 3PW4A 4K0KJ 3L7PA 3T5KA 3MGJA 1RDRA 5L46A 2BKPA 1HNIA 5E7OB 3UFCX 4DPXA 1H7XA 3SIPB 3KLIA 4DQIA 4FNIA 1S9FA 1X5PA 4R0EA 5HP1B 2LEBA 1SC3B 3CMES 3BGOP 2MZSA 2MY7A 1H74A 4YUDA 1U02A 2PFFB 2ZJRQ 4NLTA 4FXWA 2R7QA 3I4HX 4OI1A 1RTZA 1SKWA 2ROGA 1C1CA 3S7RA 2GMLA 5C42B 2HFZA 2C3UA 3DOMB 4ZN1A 2NZ4A 3PDNA 5J2PB 1JJ2R 4JP8A 1BQNA 4DR2F 2DNPA 2X51A 2ZBQA 5DS7A 2YQ1A 2R8JA 2E1PA 2FC8A 2GGPB 3BKUA 2G0JA 5DG8A 3LP0B 1OPZA 3PX4A 2CZ4A 4UOGA 2AJFE 3IXQA 3SEOA 3MMJA 3BM7A 1REVB 1HNZF 2IJNA 1NK5A 1WOOA 1M90T 2VQFJ 1R31A 3CVKA 3CMQA 5KG4A 1JLQB 4LF6F 1AZSB 3ISNC 4J9PA 3CWJA 2D9PA 2KVQE 3HT3A 4ZLJA 3LAKA 4ZOSA 1TP7A 1RAAB 3I87A 3M2UA 1YX2A 3M2RA 2DGWA 3HMJG 3ELHA 3Q8YA 5IC4B 2W1BA 3IWXA 1T94A 4NXMJ 2F40A 4W92B 1S1VB 1H98A 2H48B 2MXYA 2YNFA 3D6MB 4V19X 3BREA 1FEHA 3AT1B 2B9EA 1L5UA 4DCPB 4DV2J 3OR2A 2DJWA 2DRDA 3VAFA 5J1EB 3NCQA 4O4GB 3O44A 2GIQA 1UWAA 1B64A 3QSIA 3J80Y 2XS5A 2PT0A 2MHEA 2FZCB 1JLAB 1B3TA 2L48A 1FO1A 1RAIB 1WF0A 1SQFA 2PA8D 2D7SA 2GNKA 4FYVB 1Z2LA 2XS7A 4ED2A 1NM2A 1HL6A 4OYXA 4O3QA 1VQSA 3KK1B 2DCUB 3MAAB 3OTEA 3VAMA 2HLTA 1TK0A 3MPYA 3C15A 1MSWD 3I5BA 4EZ6A 1EP4B 2BJ9A 2HK2A 1SJQA 1T8EA 1JX4A 3EGNA 2XGQA 4RW9A 2EVZA 4R5PB 3P8BB 3RUBL 4MKYA 3R7SB 3M8SA 1SKRA 1DZ5A 3AOAA 3DMJA 1OYDA 4NI2A 3SBMA 4B17A 3B82A 2QRRA 1VHFA 4ENOA 3PW0A 2G13A 2CQIA 2XM3A 2WOMA 4O3OA 4DBQA 3TVKA 4YR0A 1WUUA 5F8IA 4ZKAA 1GAOA 1M1KT 1T9WA 2AD9A 1JXVA 3Q23A 3NMRA 4QCLA 4X4UA 2IM2A 4KGZB 5LSOA 4HTJA 2X1GA 3DLKA 1GX5A 2ZUAA 4QYRA 5CD4A 4F4XA 4JI8J 8RUCA 2GJFA 3LTOA 4I56A 2F65A 2BE9B 2VQFF 1NDCA 3RB3A 2YX4A 2HRYA 5GVQA 2M4MA 2UXBJ 2MTLA 3LPYA 1KP6A 3EGZA 3MCOA 2R2UA 1U26A 2GCFA 3M9MB 1YGYA 1DHMA 2FJEB 2XMUA 1VC0A 1WKKA 1FRJA 5KFFA 4AL6A 3MPUB 3FQLA 2ZZMA 1FWKA 2GHVC 1SB6A 3CD5A 4L72B 1P9YA 3OXGA 3D2WA 4CO3A 4NA3A 1XNRJ 3N6NA 3W60A 2CNKB 1QY7A 5HMZA 2YVSA 1HD1A 1KNZA 4RL1A 5KOWA 1SJ1A 3SSSA 3QRQA 1RJJA 4NPOA 3HSJA 3SZ2A 4YHHF 4DPUA 1HR0J 3QJPA 3LQVA 1RZMA 2OSQA 3TYTA 1WNEA 4Q2LA 1EHWA 2QFJA 1JQGA 1ZTTA 3CJ3A 3CPWR 3PIPQ 5KT2A 4F3OA 1VFJA 5CZXA 3BN4A 1UVIA 3CCTA 2XY5A 2NR0A 4L75A 2HMIB 2D3ZA 1Q86T 1HW8A 4LF8J 1F5BA 2OP5A 3C6UB 1RYSA 1SXLA 3X1LB 2G4BA 1JJCB 3MOZA 1AB8A 3W3SA 4P72A 4LSLB 1RAOA 2MYFA 2DNMA 1DARA 3V81B 3N6LA 4HDGA 2HHVA 1RAJA 2QV6A 2VFVA 2CJXB 5KFQA 5DQHA 3CCJS 4ECQA 4Y6IA 2FZKB 5CCMA 1X4HA 4ZVSB 4B02A 3HLUA 2ZH3A 2PI4A 3QT7A 4Y2IA 3VQSA 1B99A 5CYMB 3MR7A 2XNRA 2PEHA 4AFFA 1NSQA 1Q79A 3GSDA 4LJMA 5I3QA 1HYSB 4KBIA 3OL9A 3CO9A 3MCMA 3UNYA 4BHQA 2JC0A 4QBUA 1ZTWA 3NS5A 1NAQA 3NNCA 1WSVA 1N5VA 3HZGA 4L3KA 2K2PA 3EXYA 3I9V9 2HVEA 4TVAB 3HKWA 4F4WA 5K9FA 5LOQA 6FDRA 3T9ZA 3OV7A 3OR1B 3X3UA 2V2VA 4URSA 1DFDA 3HFKA 2ZJPQ 4CCHA 2OTJS 3UPFA 2WRMA 3V6JA 1FNXH 4UW2A 3T6BA 2BRLA 1R8HA 1MU2B 5I42A 4LVOP 4NCAA 5K20B 2VH7A 4P2FA 2P9GA 5SZTA 5HL7Q 4EBEA 4PG5A 2DXFA 4M5LA 4ZPWR 3M32B 4OI4A 4JV2A 3GJTB 1PILA 3LO3A 1FD2A 1MG7A 2HHSA 1FJEB 1NEEA 4ETXA 5HN0A 1D09B 3HD2A 4Z2XA 2R8KA 3H4BA 3BGUA 2P6TA 4FXVA 1S9GA 2EFGA 1K44A 2KH9A 1HWLA 5GAGU 5B09A 4IRDA 2CVEA 1J2VA 2RD5C 4TU8A 4ELTA 1GMUA 1WC0A 2N4CA 2KG1A 2QMWA 4Q5VA 2XZWA 4RW8A 4C8ZA 3J7A1 1QSSA 4IH6A 2HLUA 2BM1A 4RNNA 2ZKTA 3BGFA 2G2OA 1BGXT 3G2XA 4LF8F 2M7SA 4JBCA 3RW7A 3JTNA 2A0FB 5EWEA 4LRBA 2YY3A 3E3XA 2MPUA 3KHHA 2EC0A 4MAKA 2HURA 5E2QA 2ZH6A 2H65B 4DUTA 4LREA 2GVZA 4QIVA 1N5YA 3TP2A 2XBPA 2UUCJ 3E51A 5E3CA 1RP5A 4DV0J 1CQMA 3DU5A 1CULB 1NHVA 1JKHB 2JFDA 3K17A 1KLMB 2XCAA 2M88A 3ENAA 2R2RA 4RBVA 2MJUA 4N41A 3KG0A 2UVRA 1G3OA 4PXCA 3DLEA 1XMBA 4NZ7A 3R5JB 1TKDA 2VZ9A 2OPQB 2ACMA 3POTB 4J9VA 2XYPB 4ZIWA 1UWBA 4TKTA 4QWBA 1G1XA 1FJCA 3W63A 4UOHA 1KSPA 1LWEB 5CH7B 4A48A 3PRDA 2ZOFA 4K59A 1SUQA 4DV5F 4DSIA 4OZNA 1S0OA 2BR0A 4ZPCA 2A1BA 4C2MA 2CQBA 4UT4A 3MEDB 1URRA 4CO0A 1O8BA 4LT6A 1RAHB 3D3BJ 4QWDA 2JEGA 2BRKA 4USMA 5B0BA 1YRXA 2BDPA 4IOAQ 3I6PA 2OI2A 3ISZA 3PW7A 4UY8T 4AQYJ 4NLGA 4OX6A 3MEGA 4GKKF 3LAMA 3FZBA 1ZM3A 3G82B 2M2BA 3CULA 1S97A 4HI1A 3LP1A 1D0EA 4RUHA 4OJ3A 3BSOA 1B0VA 1VS3A 4ED8A 1GTHA 3HHLA 3MR2A 2QA2A 1NH8A 3KLVA 1PBUA 1U1MA 5KG3A 2LXFA 4CO1A 1T03A 3SV3A 5CYQB 1DTQB 4H4KC 1GFWB 2CQ0A 2XWYA 3H90A 2HVZA 3O5TB 2JEIA 3NOCA 3KK3A 2AGQA 3FUYA 3GLJA 2IRUA 5D0EA 1F6TA 1EB0A 4CLLA 2VUGA 5C5JA 1UA0A 2Z58B 2JC1A 3I82A 2MQQA 4B3OB 1Y5IB 2HFUA 3M05A 3RGIA 2IRYA 4OLPA 2UP1A 4ZJQA 1K73T 4DR5J 2YNHB 4IR9A 3DRRA 2NS1B 2J0SD 3UR0A 4F50A 3R6GB 4XIUA 3EE3A 5J1PA 3KLGA 4USIA 3I0SB 4ZK7M 1BQMA 1GH8A 3HVRA 4F04B 1KVKA 4NYPA 2W2PP 1JLEB 2HFVA 1B0PA 3IRXA 1UJ6A 1E6VA 1UCNA 2IDLA 2QYGA 1KFSA 3Q8SB 3BH7B 3LGHA 5KT4A 3KG1A 3RB4A 1WOSA 1RKJA 5THWA 3I32A 4F36A 3UD4P 1U7LA 4OYWA 1A7GE 5KG7A 1IKXB 3J81j 3N6MA 4M5IA 4EFAC 4NXNF 2LMIA 4OLOA 4F3MA 1S6OA 5AT1B 1NK8A 1V3SA 4DX5A 4N7TA 2Z0GA 4DR7F 1C0TB 1F3FA 1RT7A 4WF9Q 2ZWPA 2O3DA 3ETOA 3HVTB 3W66A 3GP9A 4RKUC 3E01A 2W9BA 8ATCB 3NOGA 2XG8A 3AAWB 2JJ4D 2R2SA 2VG7A 3MM9A 1K0TA 3IR5B 3H5UA 4DN9A 3J7Z5 1X0FA 3CJRA 3VTIA 3HPOA 1X60A 2QLFB 2UVWA 5IQ6A 5AE3A 1RTIA 4HDHA 2EI5A 2F8EX 2Z30B 4DZDA 1LWFA 5G0RA 3MFIA 1IM4A 3K0JA 3KHLA 2J8AA 1YK9A 1Q8BA 2D9OA 5I3UB 5KFBA 1S1XB 2PMZD 1JMTA 3FBCA 1RHQB 2CJAA 3OHAA 1FWPA 5DO2A 5T7LA 4ED3A 3IM8A 2DR9A 4DR4J 2B43A 3PR5B 2YWGA 3A3PB 2APOA 5KG1A 4CNYA 1PYSB 1R3NA 2UV8A 2YXLA 4CWBA 5ETNA 2EBEA 5B7WA 1VMBA 1YJVA 3Q8PB 1XR7A 4AT1B 5L1LA 4URGA 1JLCB 3CF5Q 3NBPB 2UU9F 1U25A 5K5MA 2MZTA 2JFKA 3TEGA 4J9RA 3DRXA 3OXFA 3D3CJ 5GAHI 1VRTB 1FFSB 3EMTA 2FLNA 5K8MA 1XEZA 1XERA 4C11B 4PQUA 1F60B 3K5PA 1IVZA 1G7CB 3BO2A 4OYZA 4MTPA 3BJYA 1LKZA 3MEKA 2P6SA 5K8OA 4X66J 1Q5VA 1NMEB 1AFJA 3TQ1A 3M6XA 1S0NA 3PCOB 2J0WA 1XMOJ 2HGNA 4CYUA 3MR5A 1RT1B 4DV6F 2W01A 3CCES 5CAAA 4TQSA 1IKVA 5BYSA 3T3FA 2R3VA 2EC2A 1EZZB 3DLJA 1OQ6A 3MMCA 4WFAQ 3M1VA 4KGXB 2GA7A 4RWWA 2U1AA 5HMWA 2KHDA 3RU0A 3BS9A 3AA9A 3KFWX 3PO5A 2HHWA 3NMAA 1KVIA 3TJAA 3HSGA 1SQEA 3M8ZA 5IXUA 2DXEA 3ILIA 1EJ7L 2G2ZA 1Q82T 4MIBA 1QE1B 4I67A 2WAQD 2YKPA 1ELOA 2HKEA 3OBIA 4I0WA 1H6KX 1IUJA 3ZC4A 3VAGA 2GAGC 3CTRA 4DL5A 2WVEA 4Q8FA 2NYHA 2JX2A 3MMBA 1UZHA 1JXLA 1LV5A 4ZMMA 2CIMA 2YWWA 3WZ0A 5J2QA 1NDLA 4RW7B 1FCAA 5L8RC 1S0MA 2NPFA 4CTAA 2Q6CA 4UZCA 3NS7B 2VPXB 3KNAA 1HBUA 2GMJA 3AOBA 2DHXA 1BLUA 2CPXA 2Z2ZA 1HNXJ 3NWRA 2M52A 2E9ZA 2BEFA 1WC6A 1Q8KA 3ONQA 2RF2B 3CC4S 2COLA 2X3DA 4LF7F 2ZD1B 2B0GA 4V1Ak 1XR6A 4C8YA 2CYYA 4WU3A 5I4MA 4KFBA 1HMVA 4DLEA 4AL7A 2PN6A 4CLFA 3ITHB 1UL3A 5AXNA 4HTIA 2CFXA 3W9IA 1S4EA 2VU5A 2MQOA 2IAJB 1OYEA 3IG1A 2NQPA 3GV7B 1S1TA 2V8VA 1HI1A 2ZEJA 5LM7E 4NCGB 2DEIA 2F8MA 2KO1A 3RB0A 1UW4A 4DUZJ 5MLCV 3NGDA 1S57A 5HI7A 2IA0A 2BQ3A 1J27A 2SXLA 1ZZFA 2U2FA 2HNZB 5HSPA 2CPZA 2VHGA 1S6QA 3GILA 2DGOA 3AQOA 1FA0A 2LU1A 2XWXA 3RBZA 1RT2A 1TK5A 3QAUA 5KFSA 1LNQA 1AUDA 3HT0A 3CDAA 3BKFA 3BH6B 2M0GB 1FJGJ 2CAJA 3OLBA 3F56A 5L38A 4C97A 4JV1A 5D4NA 4JI1F 1M0SA 1HQUB 3IMQJ 3QZ7A 3OTBA 3QZ8A 2MZ1A 1IQZA 4OX8A 2F9DA 2I0XA 3CDBA 2LYVA 5KFVA 3P4UB 4OZ3A 1E6YB 1L3VA 1RT4B 3EYZA 2C3PA 4NE9C 3HDSA 2MZJA 2MGZB 4RUCA 1DY3A 3FEXB 2RUGA 2XTJP 2N7YA 2DHSA 3PKMA 1VQYA 2AYMA 2WW8A 3SCKE 3CO0P 2VC1A 2CQDA 1D1UA 4QZVB 5LJ5Y 2LXIA 2YPYA 4WBFA 3K89A 1BD6A 2ATCB 3OVSA 2DRAA 4DR3F 2D1CA 2C2MB 4IFVB 4LQ3A 1CJUB 1RAEB 2KZZA 1U2CA 3MM8B 4ZCKA 4KY3A 1CS4B 2AYEA 1U48A 4CM0A 1TKZB 4A8MP 3V6DB 3JTPA 4K4WA 4YFUA 1L3TA 1LXJA 1Y4ZB 4F4KA 1TVRB 2KM8B 3RB6A 3KUEA 3C8YA 2QLWA 1WDTA 3MF5A 1IJFB 2J9EA 4JI7J 3UE2A 3EZUA 2OPSB 4HEA9 1LFPA 1QUVA 2C1EB 1CJTA 2WBMA 2QFIA 4C48A 4XO0A 2DY1A 3OUYA 3C19A 1HBOB 4PWDA 3W2WB
chains in the Genus database with same CATH topology
1I3OB 4ZVPB 1QTNB 2QL7B 1RWOB 2H4YB 3GJRB 4LSZB 1NMEB 3D6FB 2XYHB 3R6LB 3QNWB 3KJNB 1RHMB 2FQQB 3R5JB 1BMQB 1ICEB 2DKOB 2XYPB 3NS7B 3GJSB 3D6HB 1GFWB 3GJQB 1QDUB 2H51B 4ZVQB 1IBCB 1RWPB 4DCOB 1RHQB 1RWWB 1I51B 1RHUB 2CNOB 2CNLB 2XYGB 2Y0BB 2Y1LB 1PYOB 2C2MB 3SIPB 4ZVOB 4ZVUB 2CDRB 5IC6B 2QL9B 1SC3B 1SC1B 2HBYB 2HBRB 4ZVTB 1F9EB 2QL5B 2H54B 2CNNB 2H5JB 2P2CB 4DCJB 3P45B 3EDQB 1RHRB 4ZVRB 1RHKB 3KJQB 3R7NB 2C2ZB 5IC4B 1RWMB 2C2OB 1RWXB 2CJXB 1SC4B 2HBZB 2H65B 1RWNB 3KJFB 1PAUB 2XZDB 3R6GB 4JB8B 5K20B 2CJYB 2QLBB 4ZVSB 3IBFB 1RE1B 3R7BB 1RWKB 3R7SB 2H48B 2CNKB 2C1EB 3EDRB 1RWVB 2C2KB 2HBQB 3P4UB 2XZTB 3D6MB 2QLJB 3GJTB 3IBCB 2H5IB 1RHJB 2H4WB 2QLFB 3RJMB 4DCPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I3O B;  4ZVP B;  1QTN B;  2QL7 B;  1RWO B;  2H4Y B;  3GJR B;  4LSZ B;  1NME B;  3D6F B;  2XYH B;  3R6L B;  3QNW B;  3KJN B;  1RHM B;  2FQQ B;  3R5J B;  1BMQ B;  1ICE B;  2DKO B;  2XYP B;  3NS7 B;  3GJS B;  3D6H B;  1GFW B;  3GJQ B;  1QDU B;  2H51 B;  4ZVQ B;  1IBC B;  1RWP B;  4DCO B;  1RHQ B;  1RWW B;  1I51 B;  1RHU B;  2CNO B;  2CNL B;  2XYG B;  2Y0B B;  2Y1L B;  1PYO B;  2C2M B;  3SIP B;  4ZVO B;  4ZVU B;  2CDR B;  5IC6 B;  2QL9 B;  1SC3 B;  1SC1 B;  2HBY B;  2HBR B;  4ZVT B;  1F9E B;  2QL5 B;  2H54 B;  2CNN B;  2H5J B;  2P2C B;  4DCJ B;  3P45 B;  3EDQ B;  1RHR B;  4ZVR B;  1RHK B;  3KJQ B;  3R7N B;  2C2Z B;  5IC4 B;  1RWM B;  2C2O B;  1RWX B;  2CJX B;  1SC4 B;  2HBZ B;  2H65 B;  1RWN B;  3KJF B;  1PAU B;  2XZD B;  3R6G B;  4JB8 B;  5K20 B;  2CJY B;  2QLB B;  4ZVS B;  3IBF B;  1RE1 B;  3R7B B;  1RWK B;  3R7S B;  2H48 B;  2CNK B;  2C1E B;  3EDR B;  1RWV B;  2C2K B;  2HBQ B;  3P4U B;  2XZT B;  3D6M B;  2QLJ B;  3GJT B;  3IBC B;  2H5I B;  1RHJ B;  2H4W B;  2QLF B;  3RJM B;  4DCP B; 
#chains in the Genus database with same CATH topology
 1F1B B;  1RI7 A;  2MQN A;  4USV A;  1RA7 A;  4LF9 J;  4ZHR B;  2XMV A;  5DQG A;  3RR7 A;  3MFH A;  2RML A;  3V4M A;  1C0U B;  4LF5 F;  3BDP A;  4FS2 A;  2DR8 A;  2OMO A;  4K5S A;  4HI2 A;  2AYB A;  2ZOG A;  3LGM A;  4H4M A;  1VIO A;  3FBE A;  2VKR A;  3QJL A;  4DL2 A;  3SQO P;  2L9N A;  4M5D B;  2J76 E;  1SQG A;  3SXL A;  1HFE L;  1NHU A;  1TTH B;  2V63 A;  4WCE Q;  2WBR A;  1QAI A;  4DR6 J;  1A6L A;  3JSB A;  4YEA A;  3KJV A;  3UO0 A;  4B9S A;  1Y11 A;  4FS1 A;  4OIX A;  1OO0 B;  2L9D A;  1TV6 A;  3TX0 A;  2J0Q D;  2FHJ D;  3UCZ P;  4R25 A;  1WTF A;  3G6V A;  4WXW A;  2P9C A;  1I3O B;  1ZOT A;  3G4S S;  2HHP A;  4X62 F;  4U7U K;  2V8D A;  1T11 A;  1S0V A;  2WVB A;  4F2R A;  2XMA A;  1X7V A;  3CIM A;  4RU9 A;  1EKR A;  3R5C A;  3A8K A;  3FCV A;  3DOK B;  3IN5 A;  5KFJ A;  4I6W A;  1TL5 A;  1VQ7 S;  4FVM A;  2DNN A;  3OSN A;  4OZJ A;  4RJV A;  3OD2 A;  3FK4 A;  4NCB A;  4X65 F;  2FDN A;  3EZO A;  2UUA J;  2RJZ A;  3M6U A;  2D69 A;  5U47 A;  2EKN A;  2YWK A;  4MYT A;  2DB1 A;  2UUB J;  5HP1 A;  2NRE A;  3SCI E;  2V4J A;  4XPE A;  4A47 A;  5IC6 B;  1MLA A;  2Z2Y B;  4LR8 A;  3DM2 A;  2W9C B;  3RRH A;  3BDE A;  1LWX A;  4QIW D;  1VLO A;  4DV4 J;  3HO1 A;  3AY0 A;  1IWG A;  1P1L A;  1YJT A;  3DOM A;  4CO2 A;  1PSD A;  4ZP8 A;  1P8G A;  2CQG A;  3QIP B;  2PE8 A;  2DO0 A;  4QJV A;  3V4I B;  3HHK A;  2AX1 A;  5F8L A;  2H3E B;  4CLZ A;  2H4W B;  4HAC B;  3PY8 A;  4PXE A;  1UJ4 A;  4W98 A;  3OQ2 A;  2VFT A;  3BSA A;  2ILY A;  3DXB A;  3TJ9 A;  4A8F A;  4A8S A;  2VB6 A;  3G8S A;  2IM3 A;  4G1Q A;  1QAY A;  3GSI A;  1HA1 A;  1VLY A;  2LA6 A;  4PUO A;  4BC7 A;  2LEP A;  1IBC B;  3W7B A;  1NZA A;  4GC7 A;  3DRS B;  2XMJ A;  3IO1 A;  1LK7 A;  2CNL B;  4ECY A;  2GHP A;  3A8J A;  1UTA A;  3RAQ A;  2MZR A;  2BQU A;  2CJ9 A;  2LDI A;  3UD3 P;  1HQ2 A;  2OSR A;  1HHT P;  4B3R F;  2QL5 B;  4ED4 A;  2C2N A;  2HZC A;  2VPZ B;  3W8P A;  2KFN A;  2VPY B;  4DR6 F;  1XN9 A;  3TUZ C;  2DIU A;  2R7W A;  3BO3 A;  4ED5 A;  5C24 A;  1D9A A;  4NWB A;  3GPA A;  2KN4 A;  4USW A;  3CJ8 A;  3KK2 A;  4YR3 A;  1OSC A;  2HK3 A;  4M1K A;  3KLH B;  2KM8 C;  3ZZO A;  2IJF A;  2HFS A;  5ETV A;  2XLI A;  2WSF C;  4WP3 A;  3SFG A;  1JLA A;  1VBK A;  4Z7Y A;  4UZB A;  2XHW A;  3I0R A;  1R0A A;  2OUG A;  2YWH A;  2DH9 A;  3A13 A;  4YQW A;  1HNV A;  3UW1 A;  3MXH P;  1OWX A;  3CED A;  4N5S A;  4NLP A;  4Q0B A;  1UFK A;  4HHH A;  5B0A A;  1KTV A;  1C4C A;  3I31 A;  3AD8 C;  5HLF B;  2E1C A;  2ZOM A;  3JAM Y;  4OFZ A;  3CCQ S;  2DNL A;  3CJT A;  1APS A;  4ZPV R;  2DHH A;  4N76 A;  5HK4 A;  1PO6 A;  1FRX A;  2G1D A;  5AJ3 J;  1EP4 A;  4J7C A;  1S7H A;  1I94 F;  1R0B G;  2MHN A;  3NGS A;  3TOQ A;  1TQL A;  5AXL A;  1RAB B;  3SDE B;  3LWL A;  4JI4 J;  3D1Q A;  3GCX P;  4M5N A;  3TJ8 A;  3ILO A;  2OO4 A;  2RHS B;  3KXD A;  1FVS A;  5A8R A;  2V4Q A;  1NJI T;  1YBT A;  2P8I A;  1EAY C;  5HBM B;  1B0T A;  2V8G A;  3HJV A;  4EYH B;  2L3M A;  1H2T Z;  3I5A A;  4J5O A;  3J7A N;  3UN5 A;  2YNG B;  5KFH A;  1QDU B;  2YTC A;  3QGG A;  1RWW B;  1NDP A;  1UPP A;  2W7A A;  2LA4 A;  2XYG B;  2Y0B B;  2MKJ A;  3QYY A;  5B0D A;  5GAH U;  3OFE A;  2KL8 A;  4BLG A;  5CAB A;  4DL3 A;  3P5T L;  3CJ2 A;  4KAI A;  4G65 A;  4ZVE A;  5DGA A;  2W8K A;  1IBK J;  1VQM S;  3M8R A;  1RYR A;  3CCW A;  1S5Z A;  4K4V A;  4DS5 A;  4CIO A;  4OV1 A;  3ZFV A;  2FJA B;  4LFC J;  2OKQ A;  3D4J A;  4JB8 B;  1GXU A;  2CJY B;  2G2Y A;  1FVQ A;  4PKD B;  5B0F A;  2HWT A;  5D3G A;  5AE2 A;  2W2O P;  1N33 J;  2RRA A;  4NZ0 A;  5KOX A;  2NLW A;  4CLY A;  1XNQ F;  3HK2 A;  5EWF A;  1VGY A;  1RWO B;  2BAC A;  3N0V A;  3QLH A;  1R6Y A;  4PRF A;  4DSF A;  4ANC A;  1YBA A;  2KRR A;  3MR3 A;  4KGM A;  4J9M A;  4OHZ A;  4HHU A;  5HRO B;  2HHU A;  3ZZY A;  2MQP A;  5J1N A;  2WCX A;  2J9C A;  2HMI A;  2DYA A;  2XSJ B;  3BPD A;  2QE5 A;  3TUI C;  3KMQ A;  2AT1 B;  3C6U A;  3MDF A;  3O3L A;  1IBM J;  1VQ9 S;  3SCJ E;  4LSL A;  1FHT A;  2FGC A;  4TY8 A;  3RW6 A;  2KXN B;  1O51 A;  5F8G A;  5DGB A;  1GMV A;  5KAK A;  4BWJ A;  4MYU A;  5AE1 A;  5AJ3 F;  3CCU S;  3WIV A;  1RCO B;  2RDD A;  3MM7 B;  3ZO7 A;  2ZKU A;  3TAM B;  1N4L A;  3PYD A;  3MEE B;  3Q89 A;  4JUZ A;  4LF4 F;  2HNY A;  1JLF B;  3M8Q A;  2KFZ A;  4I2P A;  5GAE I;  2RAQ A;  4TQR A;  3T5L A;  1U6F A;  1VCT A;  4WKY A;  2B3T B;  5LMU J;  3D6F B;  1J5E J;  1RK8 A;  1M5P C;  2F1F A;  4IH5 A;  4IFY A;  2XMK A;  1S6P A;  4ED0 A;  4O3R A;  1FNO A;  4IH7 A;  2IRX A;  2V9K A;  1DLO A;  2I5J B;  5IZH A;  1YJ7 A;  2AHO B;  2FLP A;  1CJK B;  4NMX A;  4B9T A;  3D0I E;  1ULR A;  3OR1 A;  4C0B A;  2E5J A;  1H72 C;  1TL7 A;  2NPI A;  1MNE A;  1FXR A;  2OPP B;  2HRU A;  2R2T A;  5F3Z A;  5EWG A;  2DY9 A;  2Q66 A;  2H54 B;  3S01 A;  3BR9 A;  1TKX A;  5LJ3 Y;  2ROE A;  1WHV A;  1K9M T;  1HNI B;  4B9L A;  1MU2 A;  1S77 D;  3KLI B;  3AXM A;  4IOB A;  2K3K A;  2RQK A;  4QWA A;  3M32 A;  5ETO A;  3IM9 A;  1TZ0 A;  4H4O B;  1W2B R;  3IC1 A;  1YJU A;  3D54 A;  3BB5 A;  2BE2 B;  1S12 A;  1TFW A;  1VK8 A;  1KQK A;  1X9S A;  2WON A;  3NEK A;  1FXL A;  2G0C A;  4DR1 F;  1H2U X;  1U1P A;  4F0K A;  1LWC A;  4PXB A;  4XDD A;  1FRH A;  3T1Y J;  4WZQ A;  2RE1 A;  2HQF A;  1AW0 A;  2Q79 A;  2IA6 A;  1X8D A;  3NWG A;  3MUR P;  4M8L A;  1BQN B;  4YB6 A;  3MD3 A;  1Q1K A;  2E5G A;  2FB0 A;  4ZJL A;  3R27 A;  5IM0 A;  3KLF B;  4JV5 F;  3PW2 A;  3W61 A;  3FSX A;  3MM6 A;  3DRP A;  3DGP B;  2VBZ A;  3NGK A;  1ZA1 B;  4FF4 A;  5EN1 A;  2CPI A;  3CSK A;  2AJ1 A;  3HX9 A;  1KON A;  4DCJ B;  3GIR A;  4BS2 A;  4P73 A;  1WOR A;  2ATL A;  5DDO C;  3OSP A;  4KPY A;  2CJQ A;  1U47 A;  1Y10 A;  3CD0 A;  2OEJ A;  1ZAX A;  3BQ2 A;  1SL1 A;  2VFR A;  4GRS A;  4NLR A;  3M30 B;  1SIW B;  1CUL A;  3GG0 A;  3CJK B;  1KLM A;  3H25 A;  1X31 C;  3M2U B;  5C2G A;  2K7K A;  4Y3C A;  3M2R B;  3RG6 A;  2NXC A;  2B5J B;  2OPQ A;  3H8Y A;  5A8K B;  2H5E A;  1X4C A;  1B70 B;  2YNF B;  2H51 B;  3E8O A;  2AEM A;  3UN2 A;  5CQG A;  1T05 A;  3DOL A;  3AJD A;  1IR2 A;  3OR2 B;  2FHK A;  4Q8E A;  4ZVU B;  4RNO A;  4MFB B;  1U09 A;  2ZJQ Q;  4ER8 A;  5KFC A;  1T9X A;  1CEZ A;  3IS9 B;  2PI5 A;  1FDB A;  1WD6 A;  1T3N A;  1CLF A;  4CZC A;  3G8Q A;  3T5H A;  1RE1 B;  3EX7 B;  3G96 A;  1ZZN A;  2A10 A;  4MIW A;  3D0G E;  3BN7 A;  2DNQ A;  4M63 A;  4PPZ A;  3C15 B;  1FDA A;  4MJK A;  5E3A A;  1TMM A;  4C0H A;  2J5A A;  2ZH7 A;  2VKZ G;  2MJN A;  3R2D J;  3IFE A;  4OHW A;  4RW9 B;  5CYQ A;  3F0N A;  2WB1 D;  1T9U A;  1NND A;  3MTK A;  3DMJ B;  2ZDO A;  3T1Y F;  1D8Z A;  4C3L A;  5KT3 A;  3CJ5 A;  4LFB F;  4WP9 A;  1L3K A;  5GAG I;  2ABY A;  3SSQ A;  4GKJ J;  1BUX A;  1NK4 A;  1N52 B;  4RBU A;  3U02 A;  2L08 A;  2EFQ A;  3TR5 A;  5A6W A;  4ZJO A;  2MDA A;  4B3O A;  3VV2 B;  1RWU A;  2P2C B;  4CH1 A;  1G6B A;  3DLK B;  4PG7 A;  3KHR A;  2B6A A;  1UFW A;  1X9W A;  1HLW A;  1YJR A;  1YZ6 A;  3R97 A;  2D3O 1;  5E33 A;  1H38 A;  1VHI A;  1WI8 A;  1Q5Y A;  4OI0 A;  4Q45 A;  2K3I A;  3UR3 C;  5CA5 A;  2XZT B;  3ZNU A;  1JLE A;  5RUB A;  2MB0 B;  1TMJ A;  1RT3 A;  5A2Q U;  2PA3 A;  4F02 A;  4PWU A;  2QC3 A;  4U7C A;  3L09 A;  4J9S A;  2CZ9 A;  5HAT A;  4K8R A;  1WDD A;  3K58 A;  2IYG A;  4E8U A;  3BO4 A;  4GO5 X;  2M3D A;  1MRO A;  3IGN A;  3D6H B;  1N0V C;  1YJN S;  4DL4 A;  3ZTP A;  2HWH A;  3R3T A;  3HP6 A;  5IT9 Y;  1IKX A;  4LMZ A;  4O4R A;  3VGU A;  4PQA A;  4WIQ A;  4I4B A;  4DL6 A;  1VK3 A;  2VFS A;  3W2V A;  2CDR B;  4K4X A;  4DR2 J;  3WX8 A;  2X1B A;  1A9N B;  1LW0 A;  3GII A;  4WWS A;  3UWT A;  1SV5 A;  2FJX A;  4YP3 A;  1X5S A;  2LKZ A;  3NGU A;  5KFN A;  2HBZ B;  3GFX A;  4O3S A;  3TZY A;  4B3M F;  4KGK A;  3WIU A;  9RUB A;  4FYW B;  4D3G A;  2ERR A;  2GVD B;  1R0C B;  5K14 B;  3QMQ A;  2F3J A;  4Y0F A;  3DXS X;  4NA1 A;  4ED7 A;  4OJG A;  2HAI A;  3PNI A;  3T41 A;  2FQQ B;  2NCK L;  3BBF A;  1U49 A;  4DU7 A;  4LFA F;  3MM5 A;  4CT9 A;  2AIR B;  1NK0 A;  4ZP9 A;  3KLE B;  2YQ3 A;  2J6S A;  2DH7 A;  5A76 A;  4ZVO B;  4C9D A;  4WK1 A;  4HYK A;  1NPR A;  1FKP A;  5CXT A;  1NDK A;  2ZDP A;  1RGV A;  1K1Q A;  4RX6 A;  5DDR C;  2IMW P;  1JLC A;  3NBP A;  2XHC A;  1HBN A;  3QT8 A;  4IRC A;  4ZVR B;  2V2Q A;  4K2J A;  3LGN A;  2EK1 A;  3DLG A;  5DM6 Q;  3QID A;  1VRT A;  2AV5 A;  2DCL A;  2AEJ A;  4LIR A;  1HBM A;  4FYY B;  2KZM A;  3HUL A;  1GNK A;  3PM9 A;  4L73 A;  1RWV B;  2KJW A;  1FDD A;  2ZIT A;  3QRP A;  1DRZ A;  1LW2 A;  3CNQ P;  4Y34 A;  2VL1 A;  2X3G A;  3RJM B;  2BXJ A;  3J81 Y;  1SCJ B;  4DG1 A;  4DZ6 A;  3DKD A;  2B9W A;  4B3S J;  5I42 B;  2M70 A;  5GAD U;  4I64 A;  2MQL A;  1RT1 A;  2RS2 A;  3VF0 B;  2XQC A;  1Q53 A;  1RQ0 A;  4QOT A;  1KOH A;  2GIR A;  1CJV A;  1JB0 C;  4ZLL A;  2DNK A;  2VFU A;  3ZXW A;  2LEA A;  3EGW B;  4WTO B;  1RHU B;  2DT9 A;  1JLG B;  1AXQ A;  2Y1L B;  3K8V A;  2XLJ A;  2BV3 A;  4J9O A;  1WF2 A;  3BF4 A;  4JI5 F;  4EUV A;  3EDQ B;  3TWZ A;  3W5Z A;  3TQE A;  1MMD A;  1V6H A;  1GMW D;  2EG2 A;  5EGY A;  3THV A;  5C25 B;  4RW8 B;  1RT5 A;  4MKA A;  3BEG B;  2Z57 B;  1VR6 A;  5F8H A;  4KC5 A;  5FII A;  1R89 A;  4M95 A;  1YJW S;  4W90 B;  6AT1 B;  2AW0 A;  5H1S V;  1X5T A;  4J9U E;  4RW7 A;  1R6V A;  2K06 A;  4NAS A;  5BYR A;  1JXE A;  1F9H A;  3ETM A;  2RU9 A;  2LVW A;  3W8G A;  3OJU A;  3PO4 A;  3MUM P;  3PYG A;  3RAX A;  2JNJ A;  2Z56 B;  3QRR A;  2GVZ B;  1N5Y B;  4HL9 A;  4IG3 A;  4LRF A;  3TUP A;  2DR6 A;  2CPH A;  2BAN A;  1X4F A;  4C7Q A;  4DLG A;  1URN A;  5J2M B;  5F9N A;  4C8M A;  2E66 A;  2BJ1 A;  1FES A;  1J5O A;  3EVM A;  3JYT A;  4S0M A;  1UPM B;  4X84 A;  1P9Q C;  3A3O B;  2R7S A;  2DBB A;  3QGH A;  4A8Y A;  4LF2 A;  2DNH A;  1UMJ A;  4ED6 A;  1FTC A;  1R8C A;  2FIU A;  4ZA1 A;  4YHH J;  5GMD A;  3GMG A;  3EZ5 A;  2DNR A;  1T9T A;  3B4D A;  2HZV A;  1PJ6 A;  3P96 A;  2F63 A;  1EET A;  2IAJ A;  1ARO P;  1N54 B;  4KKO A;  3K5N A;  3HI9 A;  3DRY A;  3PYF A;  2UVV A;  2W7O A;  1S48 A;  1R8B A;  3IGV A;  1UET A;  3U27 A;  1VQ5 S;  5FD1 A;  3CCV S;  1PJ5 A;  2HND A;  3MOJ B;  2FY1 A;  4PG6 A;  3MEG B;  2ALZ A;  4E2F B;  3OL6 A;  2LQJ A;  2X7I A;  1QLN A;  5HO4 A;  3VVU A;  4B3S F;  2NXN A;  3I4P A;  3LP1 B;  3TZX A;  1SPB P;  1S10 A;  4ELV A;  2Y8W A;  3CC2 S;  2Q3P A;  1MWQ A;  2BE7 D;  2ZWO A;  3VAK A;  1HWI A;  3AHP A;  1EIY B;  2RNE A;  4RW4 A;  4ZDN A;  1HWK A;  1T03 B;  2FGO A;  3R8Y A;  4ZN3 A;  2GC8 A;  3LP2 B;  2BW2 A;  4YB5 A;  5GAE U;  3JS9 A;  1IR1 A;  2CQH A;  3TA0 A;  2EXU A;  3PVX A;  2VPW B;  1XBW A;  3BGR B;  5F8J A;  4OI6 A;  1HWU A;  3O1L A;  5G4D A;  1P1T A;  2MGZ A;  1VOM A;  1QM9 A;  1L3S A;  1FRI A;  3DRR B;  4P71 A;  2BJE A;  2DHG A;  2KTQ A;  4QW8 A;  3L7O A;  3Q8Q B;  5LSL A;  5CZV A;  1BQM B;  3JSM A;  2V50 A;  3GFZ A;  3P49 B;  4JI3 F;  2NXU A;  4WK3 A;  5KFW A;  3K7R A;  1Y9O A;  3IRX B;  4TU9 A;  1E6V B;  1Q81 T;  3IA0 A;  2HQG A;  4KV8 A;  3PRV A;  2OEM A;  4CT8 A;  2VQE J;  2R7U A;  3C6T B;  1SJF A;  2IM1 A;  2HAF A;  1TKZ A;  3V6D A;  1XMQ J;  2I6W A;  4DJB A;  3BSN A;  3GG1 A;  1NK7 A;  4DX8 H;  2LQB A;  2E9R X;  5DZ7 A;  5L1I A;  2PSZ A;  2YKM B;  2B4O A;  4DV7 F;  2VG6 A;  3QQC D;  3ICL A;  2AP6 A;  1HBO A;  1KVJ A;  4G6V B;  1FK9 A;  4C8L A;  4YR2 A;  4O3N A;  3MWB A;  1RT7 B;  2HHX A;  1SJ4 P;  1KQG B;  4TLR A;  3E01 B;  4B9M A;  2W9B B;  1N34 J;  3MM9 B;  3BBC A;  4ZVQ B;  4JI2 J;  2B8P A;  1YBU A;  1GXL A;  4I7F B;  2E7X A;  2GO9 A;  1ZM4 A;  1WEY A;  4IDK B;  1X5O A;  4M5D A;  2XSF A;  1LWF B;  5G0R B;  1N36 F;  2DGX A;  4ECU A;  5LT5 A;  4C0O C;  1RAF B;  3THT A;  4NL5 A;  4F3Q A;  5T7L B;  3M8P B;  4OYO A;  2EWH A;  3MMA A;  2C2Z B;  1JJ4 A;  2H9Z A;  4IO9 Q;  4R0J A;  3TVY A;  2K1R B;  1JLB A;  1LQ9 A;  1WKJ A;  4FF1 A;  4DV5 J;  4TXS A;  4ZPB A;  2HFN A;  2F9J A;  1VC6 A;  1SL2 A;  1VQ8 S;  4DUY F;  2AJ2 A;  4OYB A;  1QJH A;  3GON A;  4C3K A;  1ROF A;  2HG4 A;  4IG0 B;  4EEY A;  4OX9 J;  1AYE A;  4PQU B;  5L9N A;  4BWM A;  3DDI A;  1IXK A;  3NL0 A;  3SI8 A;  2XY7 A;  2CG4 A;  1RBO B;  4QR2 A;  2YNI A;  3Q8V A;  4KTQ A;  4GKK J;  1PAE X;  2MKS A;  1OQ3 A;  1SJ3 P;  1UZD A;  4Y2C A;  2PII A;  4CYU B;  2W9C A;  3QSY B;  2HBY B;  3TAQ A;  4R8U B;  3Q24 A;  2YKA A;  1R8P A;  1PCA A;  1IKV B;  4QR0 A;  2VQE F;  2NYI A;  4RU2 A;  3MUT P;  3MMC B;  1NBE B;  5KT5 A;  3PXG a;  1XMQ F;  2HW3 A;  4P10 A;  3A4T A;  2XZD B;  3QIP A;  3QGP A;  2B4P A;  4OQJ A;  1TL4 A;  2N82 B;  2UXD F;  4FPI A;  1MML A;  4CRJ A;  4CO5 A;  4HAC A;  4FP9 A;  1RHJ B;  3M9N B;  5HMX A;  3A12 A;  3AOD A;  1RB0 A;  1UEK A;  2P9E A;  3IAM 9;  2FJV A;  1WC3 A;  1QSY A;  3LPE A;  3GJS B;  2BQR A;  1N34 F;  3FFI A;  1XQI A;  5J2Q B;  4U6P A;  1RAD B;  2CWX A;  1H2V Z;  3SMZ A;  1PKU A;  3AD7 C;  4JI2 F;  3DYA A;  4ECS A;  2YKN A;  2XGP A;  3OJS A;  3LOU A;  2AKW B;  3U7J A;  1RTJ B;  2I1R A;  3A8I A;  2Z4P A;  3TRG A;  2E9T A;  4ZVT B;  4QU7 A;  1PJ7 A;  3FBB A;  5FJ4 A;  2NZC A;  2Z8Q A;  4X4P A;  5KTQ A;  2IC3 B;  5ETT A;  2AF6 A;  4EYI B;  4ZCI A;  1YRT A;  2ZFH A;  3KTQ A;  2I2Y A;  5D77 A;  5F3T A;  2J7K A;  1XIQ A;  2V67 A;  4Y65 A;  4IKA A;  3FMB A;  2QA4 G;  2DIV A;  4KFB B;  3OFH A;  2XEX A;  2XO6 A;  3KLH A;  4ZIT A;  4NXN J;  2XNQ A;  2CA9 A;  2MMY A;  2OJ3 A;  4ID8 A;  3N79 A;  5J2N A;  2VA2 A;  6FD1 A;  5ETM A;  5DJB A;  4QWE A;  4NLO A;  3IG1 B;  4O0N A;  3VAL A;  4J91 A;  2JLF A;  2V94 A;  2F5G A;  1S1T B;  5ITH A;  3ZZT A;  4DR7 J;  4L3N A;  3PW5 A;  4NX9 A;  3FJ2 A;  4DFJ A;  4OX9 F;  2RDI A;  5F0U A;  5GMK a;  5HLF A;  2ZZT A;  1RTH A;  4RW6 A;  3OTO F;  3I55 S;  2RRN A;  4TLQ A;  2ASJ A;  2O67 A;  1VQ6 S;  4ILL A;  5FDL B;  2ZHO A;  2J8S A;  4XDC A;  4ZS6 A;  1YVF A;  1FNM A;  4DPY A;  1XK8 A;  3H98 A;  1RT2 B;  3D6T B;  1ZM9 A;  3J7Y U;  3H5Y A;  5IQQ A;  3IBF B;  1K47 A;  2ZVS A;  1TUV A;  4LSN A;  3FDS A;  2K8G A;  3WHI A;  4JYA J;  2Q6B A;  2IHR 1;  2EFP A;  1FEE A;  1U6Z A;  5HBM A;  1RBL A;  1FJ7 A;  2CWK A;  5M2P A;  5D0H A;  1N32 F;  4B08 A;  2YNG A;  4KT0 C;  3IRW P;  4FF3 A;  3M4X A;  2GS8 A;  4X4N A;  2UU9 J;  3DDK A;  4NLD A;  1I6J A;  1F5C A;  3GFY A;  2O1P A;  1S9E A;  3SQG A;  3EWG A;  1IWA A;  5IV3 A;  1YTY A;  5HVH A;  5HQ8 A;  1M5O C;  3JQJ A;  2BA9 A;  1U1K A;  4DFK A;  3NAI A;  5HQM A;  4TN2 A;  3N5F A;  5K8P A;  1YZ7 A;  4WPA A;  3D66 A;  4UF4 A;  2HQD A;  4LF1 A;  3HSZ A;  4A8O A;  4LRC A;  2ZH4 A;  2QJ3 A;  2PEB A;  2UXC F;  4B3T F;  4KQZ A;  4DV6 J;  1U1N A;  4PAB A;  2LP4 A;  1U24 A;  3T5J A;  4K50 A;  2WTF A;  3P3D A;  5B08 A;  3HSD A;  2H4Y B;  2JWN A;  1HI8 A;  5A8W B;  4Y28 C;  4K4U A;  2N3O A;  5KFM A;  2XS2 A;  4JI6 J;  1CJT B;  2ZH2 A;  5HRO A;  2A2C A;  2Q1L A;  3CJ4 A;  4EO8 A;  2FTR A;  2MQM A;  3UVJ B;  1OMS A;  1AA1 B;  2UUW A;  4PCQ A;  3TAN A;  3BBB A;  1N5Q A;  1RAG B;  1C1B A;  1FER A;  1BY9 A;  1FXD A;  2M5Y A;  3S1T A;  4DDF A;  1Q0N A;  1U8S A;  4K4Z A;  3J7Z T;  3QJJ A;  4WZM A;  1P27 B;  2FHO B;  3MCN A;  2DGV A;  3KUH A;  4H4M B;  5D4P A;  2ZBC A;  1Q16 B;  3EM1 A;  2BUN A;  4URQ U;  2HIQ A;  4K4T A;  1H0H B;  5H9F K;  3BPS P;  1JWW A;  3TAM A;  3W64 A;  2ASL A;  2HYI B;  2C2E A;  3UNG C;  1GK8 A;  4KJI A;  2HVI A;  1XR5 A;  4IUF A;  4FYX B;  4WXO A;  2BJ8 A;  2HS0 A;  1N6Q A;  4HT5 A;  1TL3 A;  3QT6 A;  3Q86 A;  4ZVG A;  2RT3 A;  3HJF A;  3AJ2 A;  4JYA F;  1PGZ A;  3G6X A;  1JIH A;  1Y7P A;  1BC6 A;  4ID5 B;  4LF7 J;  3HXM A;  1N88 A;  1TV6 B;  4FBU A;  2IMO A;  4Z7C A;  2V9W A;  2MKK A;  5BXI A;  3CD7 A;  4WE1 B;  1RWP B;  3H2L A;  1R7I A;  2RB7 A;  1LOU A;  4ETZ A;  4DF4 A;  1Q4R A;  2BOA A;  4Z37 A;  3GZ7 A;  2ZE2 A;  2OPP A;  3TO8 A;  1S1W A;  2BX6 A;  1YI2 S;  3SFU A;  2OPR B;  1WWH A;  3GU0 A;  3H0P A;  4DSK A;  2VIH A;  1DQA A;  1F2H A;  2BAB A;  5KFE A;  4O0I A;  5E3P A;  2V4J B;  2ZC4 A;  1PYT A;  3KMS A;  1UA1 A;  4H4O A;  1NSA A;  1SJR A;  3DM2 B;  2VDI A;  2HIY A;  2ZHA A;  4EI2 A;  2BE2 A;  5LMN F;  2WSC C;  1GX6 A;  1UAW A;  1D3W A;  2FVS A;  1W26 A;  3GCW P;  3R5G A;  3DHX A;  4RNM A;  1NPK A;  4DHV A;  1NKC A;  4KO0 A;  3J80 U;  1XWL A;  5M2R A;  3W62 A;  7AT1 B;  2MEW A;  3D68 A;  3KLF A;  4JI1 J;  4JI6 F;  2CPD A;  3CDE A;  2W4D A;  3DGP A;  4ELU A;  3HVW A;  2FVQ A;  2IY5 B;  2W7P A;  1FE4 A;  1PYO B;  2B8Q A;  4F4Z A;  3IWN C;  4A46 A;  4YB7 A;  4X64 F;  1TL1 B;  4G1Q B;  1VRU A;  5E5N A;  2ZH5 A;  4YDD B;  4PUO B;  2H5J B;  3WC2 A;  2DIT A;  3M2V A;  3RR8 A;  1WF1 A;  3C14 B;  4LR7 A;  5LXR A;  3K8W A;  5ETK A;  2R8I A;  5HAN A;  2DGT A;  4F0M A;  3FGV A;  5SUH A;  3HKZ D;  3QFW A;  5BR8 F;  4G3I A;  3H59 A;  3ZZZ A;  4HLB A;  2VOP A;  2FLO A;  3M30 A;  2VOO A;  5F8M A;  3CJK A;  3B54 A;  4DN0 A;  4P9S A;  2PO4 A;  3EIC A;  1FI4 A;  4WFB Q;  4HT7 A;  2VC0 A;  3MPW A;  1UW9 A;  4YDX A;  4LQ9 A;  4RZR A;  2B5J A;  2RIL A;  2KYZ A;  2XMT A;  4DR3 J;  1PC4 A;  1KFD A;  5A8K A;  3D1H A;  3ET6 B;  3OTD A;  4QQB A;  4WYL A;  1V5I B;  2IJR A;  2V8P A;  2E5I A;  5C24 B;  3T19 A;  5BJR A;  1NK9 A;  1FX2 A;  3PYE A;  3SV4 A;  3KK2 B;  2QX0 A;  2GV1 A;  3ADA C;  3BV8 A;  1N48 A;  4MFB A;  3K59 A;  2CAD A;  4ECW A;  2JL9 A;  1IBL F;  2EFO A;  4N8O A;  2MKI A;  1AFI A;  5ETS A;  1MWZ A;  3IS9 A;  4AUK A;  3I0R B;  3VAI A;  1R0A B;  4XTT A;  1QAX A;  2RSQ A;  4K0K F;  3VHQ A;  1HNV B;  1MW7 A;  1RHR B;  4Q0B B;  4PWW A;  2WK4 A;  2DNO A;  2FYX A;  2F8H A;  2RU3 A;  1RAC B;  1UVN A;  4LF5 J;  5D4O A;  4DQQ A;  4I6A A;  2RDJ A;  5KFL A;  1B7Y B;  2AGO A;  4P74 A;  3ZTS A;  3FRZ A;  3C16 B;  1HQE B;  1RU1 A;  1S4F A;  1FWL A;  1ZPV A;  3QT5 A;  2KB2 A;  2OGU A;  3TZW A;  2KKH A;  1SKS A;  4MMO A;  2R7X A;  2XI2 A;  4N56 A;  2AYG A;  4NLU A;  1OPI A;  2IVM A;  5A8R B;  4O44 A;  4PYD A;  1ZM2 A;  3IR6 B;  1UP1 A;  4NYO A;  3K2Y A;  3QO9 B;  2N3L A;  2Z2L A;  3IBW A;  3LW5 C;  3DN9 A;  1F9E B;  4F7V A;  2OD4 A;  3LUY A;  4DL7 A;  3P5B P;  4H54 A;  1WEX A;  2WB4 A;  5IV4 A;  4O3P A;  3VGV A;  4K5R A;  4C3M A;  3HFV A;  1TKT A;  4X62 J;  1LXN A;  3O6Q A;  4USK A;  4WJB A;  5T41 A;  1KQF B;  3H42 A;  2RKI A;  4C8K A;  4QW9 A;  4K2X A;  5ETQ A;  3BR8 A;  2DPI A;  3DDN A;  4DSJ A;  4X65 J;  2JRS A;  4XPC A;  4QU6 A;  4GMK A;  2W4P A;  4A8K A;  4KGV B;  3RBX A;  1HD0 A;  1S72 S;  1IKW A;  3HD1 A;  3ENQ A;  4EMD A;  1WOP A;  3BYP A;  4Y2A A;  3JB9 k;  2OH2 A;  1V3Z A;  2B51 A;  1U45 A;  4NXM F;  1Y3J A;  5D3G B;  3VGT A;  3ZTQ A;  1GXT A;  1F0X A;  3PR4 A;  2GIF A;  4WFZ A;  2AEF A;  5BYQ A;  5EDW A;  1KHV A;  4KSE B;  1OY8 A;  4J9K A;  5IFM A;  1VQ4 S;  5ADZ A;  4OHX A;  3QLH B;  3W65 A;  1JNR B;  4DV2 F;  2IYI A;  5T14 A;  3B78 A;  8AT1 B;  1MN9 A;  4ILM A;  1SC1 B;  1M5S A;  4ICL B;  1JK9 B;  3MEC A;  2MKY A;  3QBC A;  1UVJ A;  1FX4 A;  5IWA J;  1JJH A;  1WHW A;  1MMN A;  4EGL A;  1CBK A;  3CJQ A;  1WG5 A;  2DGQ A;  2GVD A;  5A0Y A;  1PAU B;  1S7I A;  3V5R A;  4CQ1 A;  4PEO A;  5K14 A;  4FKY A;  4J9N A;  2V6A A;  1S1U B;  1X4G A;  4M5G A;  4ATN A;  1PC5 A;  2OEK A;  2FJD B;  2DIS A;  4TY8 B;  1R43 A;  3N01 A;  2VON A;  2E7V A;  2I8E A;  4HHJ A;  3H20 A;  2J0X A;  2J6U A;  2QIF A;  1KEK A;  2B9X A;  4ECZ A;  4F4Y A;  2JEF A;  2Y1J A;  4QR1 A;  4B3R J;  2DKO B;  1H3D A;  3GIJ A;  3UD5 A;  2HNY B;  2IBK A;  1NZ8 A;  4OI3 A;  3M8Q B;  4I2P B;  1WG1 A;  2Y3Y A;  1VQO S;  1FTR A;  3VZI A;  3KLE A;  1IKY A;  2D74 B;  1UJ5 A;  5AXM A;  2DR7 A;  4G1P A;  2J6T A;  3I96 A;  4IFY B;  3GTY X;  2MKC A;  1S6P B;  3MD1 A;  3ZNJ 1;  4OZ0 A;  2GQQ A;  1Z2Z A;  1Q8L A;  4X4R A;  2NXE A;  1DLO B;  4PR6 A;  1NKB A;  1OSD A;  1O0P A;  3LF0 A;  1OY6 A;  3GQC A;  3BKT A;  3O8W A;  4JI8 F;  2FJW A;  3AFG A;  3U1N A;  2BJD A;  1TL7 B;  4FNH A;  4ERD A;  3EUN A;  1MWY A;  3R7B B;  5D0R A;  5DDQ C;  3EDR B;  3QGI A;  2UXB F;  2C2K B;  2HBQ B;  1TKX B;  5HVG A;  1SL0 A;  1UEV A;  3H4D A;  2F4V J;  4RWX A;  4DOZ A;  1N56 A;  1OJ4 A;  4X4S A;  3H7H B;  3FNN A;  4P7V A;  2VIC A;  3ZZ0 A;  1MN7 A;  1DUR A;  3RBD A;  1YLX A;  1XNR F;  4QIE A;  1YG0 A;  2LXU A;  4KPC A;  1PG5 B;  2ZH1 A;  1I94 J;  2G1H A;  1JLG A;  3EPG A;  4NLW A;  4WP8 A;  2WON B;  1U2R A;  2A6O A;  2YH1 A;  2FHJ A;  1LWC B;  2WVD A;  1D9D A;  2DNG A;  1HR0 F;  1NB7 A;  3LA0 A;  2RQM A;  5C42 A;  4HVZ A;  1REG X;  1F9F A;  5JMN A;  9ATC B;  5J2P A;  1N8R T;  2CXE A;  1GEH A;  5IM0 B;  3P6Y C;  3QWP A;  5C25 A;  2LFV A;  2IM0 A;  1S79 A;  5EUH A;  4OZ5 A;  3MM6 B;  2IVY A;  3DRP B;  1YDL A;  1RWX B;  2CJK A;  4V19 J;  2GGP A;  2O66 A;  1RWN B;  4OYA A;  4EZ9 A;  1IR0 A;  1RXO B;  5IWA F;  1UVM A;  1H7W A;  3LP0 A;  4AD6 A;  2QA4 S;  3VGS A;  1M1H A;  1EX8 A;  3L3C A;  1REV A;  1FKO B;  2C3M A;  4PG8 A;  2OFH X;  4EWT A;  4OZ2 A;  1U1L A;  2OTL S;  1OIA A;  2CPE A;  1JLQ A;  1KBR A;  2H1Y A;  3PJ9 A;  1AZS A;  2CRL A;  3CJ0 A;  2R7R A;  5JJB A;  1HIY A;  4F2S A;  3RYL A;  4PYA A;  1NK6 A;  4ILR A;  4MKB A;  1RT6 B;  5J2M A;  2ZHB A;  1AUS L;  2CUY A;  3D9B A;  5DG7 A;  2FPH X;  3HHL D;  3O2I A;  4MH8 A;  3UI3 A;  2YKQ A;  3WX4 A;  1RTD B;  1RKI A;  2GJI A;  1S1V A;  3W5Y A;  2KT3 A;  3BQ1 A;  3NKY A;  1XNQ J;  1V5V A;  3E2E A;  1T05 B;  3DOL B;  3HHD A;  3CC7 S;  2O01 C;  2GJ2 A;  1VRQ C;  3R7N B;  5F41 A;  3JSY A;  1WJ9 A;  3G71 S;  4MKV A;  5J1E A;  4QYZ J;  4O4G A;  1NSK L;  1TR0 A;  5KFD A;  3GR0 A;  4ES2 A;  2BOP A;  5E0O A;  2QLJ B;  3LH2 S;  1VJQ A;  3GE9 A;  4N77 A;  4YY3 J;  1P6T A;  2DEJ A;  3Q8R B;  3JQM A;  1EKS A;  4UY8 5;  5H9E J;  1UVL A;  5KFR A;  1BMQ B;  1G2E A;  2F4V F;  4U7U D;  4I2Q B;  1GQE A;  5GAD I;  1D8Y A;  3PJW A;  2DTJ A;  1HAR A;  3KK1 A;  3MAA A;  3K5L A;  1C2P A;  4DCO B;  4LIW A;  2KXF A;  2JVR A;  4MT1 A;  3FMW A;  1NJZ A;  4MK9 A;  1X9M A;  4FVC A;  1WSR A;  1GTE A;  4LF4 J;  4R5P A;  3LP2 A;  4QWC A;  1WEZ A;  5C7P A;  1KD1 T;  4OZ1 A;  1YIJ S;  2WVF A;  3L7U A;  3PX6 A;  1RHK B;  5KT6 A;  4WII A;  1KRP A;  3ULH A;  4GVB B;  3M6W A;  3DHW C;  1Z4U A;  3OW2 R;  3BGR A;  1DTT B;  5EX3 A;  3D0H E;  4RLE A;  3UDC A;  3UDL A;  2B6A B;  1V3R A;  1HPZ B;  4ZVP B;  3KHG A;  3HHN B;  3R1L A;  4I1T A;  2XYH B;  5JXS A;  2HQ3 A;  2DHA A;  4FN5 A;  2DXD A;  2BKO A;  3OLA A;  4B9V A;  3A1Y G;  4ZCM A;  5L9X A;  3W1Y C;  2VBW A;  2UUC F;  2L9W A;  1HNW J;  4DV0 F;  1RT3 B;  1T3O A;  3GYG A;  1I51 B;  2ZBR A;  1SH3 A;  3MAH A;  1M5H A;  3NS6 A;  3C6T A;  4ZP6 A;  1BWV A;  2CG8 A;  1R8A A;  1MRO B;  2HBR B;  4RR5 A;  2ROP A;  1F2G A;  1HWJ A;  2LEC A;  5M2U A;  4E98 A;  4RUA A;  2E44 A;  2ADB A;  2B9Y A;  2Y0S D;  2YKM A;  1CSJ A;  2AX0 A;  4DR1 J;  2P5V A;  3MHY A;  4DF8 A;  1NKE A;  2QMX A;  1T7P A;  3DFE A;  3W2V B;  1RLC L;  2KG0 A;  4KRW A;  3UN3 A;  1VQN S;  1LW0 B;  2V34 A;  4JV5 J;  1SV5 B;  4FKX A;  1YIT S;  4NOH A;  2WSE C;  3R6L B;  4AQY F;  1FRK A;  4PG4 A;  4M5M A;  4YY3 F;  2OD6 A;  5CHC B;  1U0H B;  4AND A;  2NSB A;  5B0G A;  2DPJ A;  3SYZ A;  2NXJ A;  3Q83 A;  3OVA A;  3SSR A;  5GME A;  4I7F A;  5F0W A;  3HF5 A;  4IDK A;  3M6V A;  5HQL A;  2EW9 A;  3DI6 B;  4KB7 A;  3V81 A;  4GVL A;  3Q22 A;  5KFP A;  3CB4 A;  2V69 A;  1RBA A;  4H4K A;  4IR1 A;  3MM5 B;  4NLS A;  4CP5 A;  5KFY A;  1BWE A;  1WEL A;  1K0V A;  1RU2 A;  3M8P A;  3GR1 A;  1VYA A;  5CYM A;  2ZBP A;  3EXC X;  1YSJ A;  4DPW A;  2VG5 B;  2R9L A;  1RWM B;  4N8N A;  2W24 A;  2WZ1 A;  2IFX A;  4K7Q A;  1VBZ A;  2OHD A;  1HYS A;  1QUP A;  3R5A A;  2K1R A;  1RA6 A;  5DRK A;  1FKP B;  2E5H A;  3CD6 S;  4DEZ A;  4U96 A;  4NLV A;  3H2U B;  2QZ8 A;  3PKY A;  1HBN B;  2FJB B;  3K5O A;  5KFZ A;  2YX7 A;  2FVR A;  3DLG B;  4KE5 A;  4DR5 F;  2PC6 A;  3HHE A;  3M8Y A;  2F4F A;  5IT0 A;  1I1G A;  4IG0 A;  1HBM B;  4OI2 A;  2DRB A;  4L74 A;  2CPJ A;  4OHV A;  1H73 A;  4CDI A;  4IQX A;  4J9L A;  1LW2 B;  2HQC A;  4DQP A;  3T1A A;  3FBF A;  4LVN P;  1BHN A;  3LAN A;  4DG1 B;  1HNW F;  1FE0 A;  3AJ1 A;  1ZAW A;  4NZ6 A;  2CKW A;  4P7T A;  3WC0 A;  3DGV A;  4R8U A;  2FUG 9;  1BQX A;  1ZBT A;  1UFL A;  4U8Y A;  2HPU A;  1TEL A;  2C42 A;  1CJV B;  4ECV A;  2EFN A;  3ILJ A;  1FRM A;  1IJE B;  3FKB A;  1IM6 A;  5D6G A;  4Q43 A;  4UTG A;  2VJU A;  1PBA A;  5IOL A;  5KG5 A;  1C1C B;  5KG2 A;  3PAC A;  4LFB J;  4PXD A;  4DS4 A;  4RUB A;  4KH1 B;  3GWC A;  3CCR S;  3CXC R;  1Q7L B;  3W5X A;  1M5V C;  1TUG B;  5A6P A;  4D3H A;  4F0H A;  2FC9 A;  2ACY A;  2KT2 A;  2LLZ A;  1RT5 B;  3NRB A;  2BYC A;  2GZO A;  3GJQ B;  2KRB A;  2EEY A;  2MLZ A;  1VQK S;  2O5D A;  3R9L A;  1RTJ A;  1YQH A;  4YB1 P;  2XMM A;  4A8W A;  3KG4 A;  3HCX A;  2QLX A;  4IG3 B;  4ZVH A;  3FCW A;  3M8W A;  3QWU A;  4BBY A;  3MPV A;  1Y5N B;  3KOA A;  2V5H G;  2IC3 A;  2BAN B;  4TNO A;  2K7J A;  1W25 A;  1JKH A;  3G6Y A;  5KG0 A;  4ZLN A;  4NLQ A;  3D7S B;  4DFM A;  3QAT A;  4W4M A;  4FZV A;  2C28 A;  1J5O B;  2Z2M A;  1JNZ B;  3FSI A;  4DR4 F;  3JYT B;  4C4W A;  3D28 A;  2PGC A;  5FLX U;  2JHE A;  1HHQ A;  2FVC A;  1KDN A;  3POT A;  4USU A;  1KKH A;  2F7V A;  1LWE A;  3IP0 A;  1KS2 A;  2JDJ A;  2NUU G;  1QTN B;  2QL7 B;  4WFX A;  3NLC A;  1D9F A;  1TK8 A;  4DWI A;  3GV5 B;  4P2X A;  1RHM B;  1EET B;  1ZAV A;  3R5D A;  3V6K A;  4GO7 X;  1VIX A;  4KKO B;  1M1G A;  1WI6 A;  3MED A;  1TFY A;  2D41 A;  1WHY A;  3OL8 A;  4Q7A A;  4Q44 A;  2JH3 A;  1FFG B;  3WQP A;  4ALZ A;  2PDA A;  3AQP A;  4UQT A;  2HND B;  2CPF A;  1T0T V;  2MLX A;  1XTZ A;  4X66 F;  4B3M J;  3ISN D;  4F8R A;  1QD1 A;  1K8A T;  3RTV A;  3G82 A;  1VIS A;  3CCL S;  1XMO F;  4CLT A;  3LAL A;  5FDL A;  4X4O A;  2MKH A;  3PEJ A;  4X4V A;  4ZPD A;  4RW4 B;  1NUE A;  5JVH Q;  5KT7 A;  1SIZ A;  2PD1 A;  4G1I A;  3TAP A;  3JQK A;  4LFA J;  4EK2 A;  2CPY A;  1NH7 A;  1DTQ A;  4J9Q A;  2HHH J;  3A8E A;  2E29 A;  3GYN A;  4U8V A;  3MAQ A;  4O23 A;  3MUV P;  1ZH5 A;  4NI2 B;  5IS2 A;  2UZA A;  3LWM A;  2Y1I A;  3VQT A;  5KFA A;  2WOM B;  3ZZU A;  3B6B A;  5FLX Y;  1X4D A;  1W7W A;  4WYW A;  1QVF R;  3IWL A;  3ENV A;  3KDN A;  2KXH A;  5D8H B;  4OZL A;  2E7W A;  2HFO A;  3CDU A;  4DFP A;  1YHQ S;  3UDV A;  2GX8 A;  3GIK A;  1ZS6 A;  4DV3 J;  1FT8 A;  4OV6 A;  2WVC A;  2VF3 A;  1FRL A;  2YNH A;  2GAH C;  4LBH A;  5DZ6 A;  5LXY A;  1RIS A;  2KVI A;  3S8S A;  1NHK L;  3JSM B;  1R27 B;  3I0S A;  3MI7 X;  2R8H A;  4UOF A;  4P2M A;  1ITP A;  2A3J A;  1OY9 A;  1HNX F;  4X2B A;  2IBO A;  4KV8 B;  1U6B A;  4E0D A;  5KFK A;  2AWZ A;  3EGV A;  2A6M A;  2VBY A;  1KHW A;  2QT7 A;  2I38 A;  5LL6 d;  1KR4 A;  3Q8U A;  3KYL A;  3FSY A;  3IR7 B;  4ANE A;  4J90 A;  4M94 A;  3GJR B;  5HVF A;  4DQR A;  4I6Y A;  2VG6 B;  5KFG A;  4RBT A;  5A8W A;  2B4V A;  3G6E S;  2MSS A;  2UV8 G;  4JI5 J;  1ICE B;  2MQ8 A;  4DV1 J;  4FXD A;  3AD9 C;  3AOC A;  2AGP A;  2ZNZ A;  4CLK A;  1FK9 B;  1U1O A;  4KHP J;  1S99 A;  3AH6 A;  1WTB A;  3MTJ A;  3I5C A;  2DR5 A;  2IVF B;  2ZZN A;  3FEZ A;  1C0T A;  5L1K A;  1CC7 A;  4IO1 A;  3C2P A;  1QSL A;  4DUZ F;  3HVT A;  1VJW A;  4K4S A;  2YH0 A;  2QL9 B;  3UQS A;  3K57 A;  1X4B A;  3TNV A;  2B4U A;  4DX7 A;  2QN6 B;  1GT8 A;  1F3V A;  2JVO A;  3BYR A;  3DNC A;  3KJQ B;  1Y0H A;  4FPR A;  2MLY A;  2VOD A;  4ES3 A;  3ZTO A;  3DCA A;  4CI0 B;  3CW2 C;  5K8N A;  4RO0 A;  3J7Y I;  3VAJ A;  2FVP A;  2ASD A;  4NRT A;  5I3U A;  1FJG F;  1S1X A;  4RNF A;  2CQC A;  2BMB A;  5A2Q Y;  2ILZ A;  2HHH F;  3FQK A;  3MMA B;  4ID5 A;  3M9O B;  2MST A;  3GV8 B;  2HZA A;  3D67 A;  4NYZ A;  4N47 A;  3OHB A;  2HRT A;  2V68 A;  3VAH A;  5CCL A;  1JLB B;  1NCL A;  4WE1 A;  4CO4 A;  2AZ1 A;  3PFO A;  1ZA2 B;  1TU0 B;  1HKA A;  1CC8 A;  4DV3 F;  4M5K A;  2EPI A;  2XCP A;  2Q43 A;  3WDO A;  2OPR A;  4OX7 A;  4LUB A;  2KT5 A;  1DBD A;  1HW9 A;  3CUN A;  2Y8Y A;  3GIM A;  3PEH A;  4C11 A;  1KC8 T;  4AXI A;  2YNI B;  2POK A;  4Q2M A;  1Q8I A;  1VQL S;  3NNA A;  1Q95 G;  3HVA A;  2M9K A;  2BM0 A;  2FY8 A;  1TUW A;  2GQ2 A;  2CVI A;  3ILL A;  1KQS R;  1RUS A;  2E1M C;  1WAC A;  1RWK B;  1Y00 A;  5ETP A;  4LR9 A;  3PV8 A;  4NEZ A;  3FVY A;  4I68 A;  4CLU A;  3TEH B;  3EVO A;  1N5S A;  2DD8 S;  2EFV A;  4UOC A;  4JI7 F;  1S9G B;  4OYM A;  4YN3 B;  4C8N A;  3DLB A;  5C2C A;  2EK6 A;  1QE1 A;  4DV1 F;  2V4R A;  4OYI A;  2M8H A;  1LEO A;  4KHP F;  4I69 A;  2GFF A;  3JXO A;  2ASY A;  4HH0 A;  2D3U A;  1TL1 A;  4LF9 F;  2XB2 D;  3JAM U;  5ETR A;  2QGF B;  3CE8 A;  3C14 A;  1LFW A;  2ZH8 A;  3TUJ C;  2HQI A;  3TI0 A;  1S6U A;  3FFI B;  3CCS S;  5DLG A;  4DX6 A;  2DO4 A;  4FBT A;  1SBR A;  4MIA A;  2ZC3 A;  1VQP S;  3DYA B;  3NGT A;  2YKN B;  2OFG X;  4FDF A;  4DU8 A;  2ZH9 A;  4YME A;  2DH8 A;  2W8L A;  5D4L A;  2V8H A;  1EQM A;  4JI3 J;  4QYZ K;  2W25 A;  2JLE A;  2R7O A;  2WHO A;  4FYD A;  3UVJ A;  4OJ1 A;  4BCA A;  2QO3 A;  2DGU A;  1SI9 A;  2J9D A;  3MPD A;  3S6E A;  2NSC A;  2BJ7 A;  3ET6 A;  3MR6 A;  4LSZ B;  5DET A;  1C4A A;  2RF2 A;  3R5B A;  1VDH A;  3CMA S;  3DLE B;  1HI0 P;  3N28 A;  2ZD1 A;  3VVT A;  4ED1 A;  5H9E K;  2FHM A;  3SCL E;  1GMW A;  1UWB B;  2HVD A;  2ZM6 J;  2MY8 A;  5KFO A;  1IQT A;  2J7U A;  4DQS A;  4DV7 J;  2AJ0 A;  1SUQ B;  5DLF A;  2W2N P;  4ZVF A;  3ITH A;  4TY9 A;  2GW8 A;  3DC2 A;  1W2I A;  4WFY A;  4DSE A;  5J2N B;  3B8H A;  4U95 A;  4OJH A;  1SKU B;  3OFG A;  2B56 A;  2XMW A;  2CNN B;  3D1O A;  1FD8 A;  1BXN A;  3FC9 A;  1NO8 A;  1U1R A;  3VZH A;  4NCG A;  5KFT A;  1U0S A;  4LRA A;  2UUA F;  4F25 A;  2C2O B;  4CNZ A;  4ECT A;  1RTH B;  2XC9 A;  4RW6 B;  2UUB F;  3N9U C;  1VC5 A;  2CJB A;  4UUX A;  2UUT A;  1Y3K A;  2AZ3 A;  1DAX A;  3C16 A;  3IBC B;  1HQE A;  2J7W A;  2YWF A;  1X4E A;  2DVI A;  5HJX A;  2RVJ A;  2HNZ A;  3HHL B;  2PMH A;  1N36 J;  4DV4 F;  1S49 A;  2PFD A;  4QPT A;  5HAO A;  4CH7 A;  1I5O B;  3PFE A;  4C6A A;  2CZV C;  2RRB A;  3CIZ A;  4PZV A;  3TA1 A;  5D15 A;  2LQ5 A;  3OXL A;  2KI2 A;  4ES1 A;  3H5X A;  1VI7 A;  4BC9 A;  4LSN B;  1AT1 B;  3QFH A;  3RRG A;  2EG1 A;  2BBE A;  3QO9 A;  3I56 S;  2HGM A;  7FD1 A;  1HQU A;  3K5M A;  4WKR A;  5E3R A;  3D5M A;  3Q0A A;  3KK3 B;  3HM9 A;  2AMC B;  1O5J A;  2E1A A;  1QTM A;  4C8O A;  3DU6 A;  2KJV A;  4JI0 J;  1G4C A;  2VDH A;  3VCD A;  3JSR A;  2W2M P;  1E6Y A;  3V2U C;  1RT4 A;  1WC1 A;  2HVH A;  2ADC A;  2EKY A;  2R7V A;  4DUY J;  3F44 A;  3Q2T C;  1K1S A;  1S9E B;  3SQG B;  3N4W A;  3CCZ A;  5DM7 Q;  2VD3 A;  3EJM A;  3KLG B;  2XUL A;  5IT4 A;  2RS8 A;  4DXL A;  4KYZ A;  1WC5 A;  1WHX A;  3RZA A;  1Z1Z A;  3TA2 A;  4BDP A;  2QTW A;  4CH0 S;  3GB0 A;  3OT9 A;  2UVU A;  2J9D E;  2AJQ A;  4AXJ A;  2C22 A;  4A8X A;  4IFV A;  1CJU A;  2HHQ A;  1UEU A;  4P52 A;  3MM8 A;  3IAS 9;  2HWI A;  1ACM B;  1IN0 A;  1CS4 A;  4M5H A;  3OTC A;  4NRU A;  2JEJ A;  5D0G A;  1YRU A;  2D3O R;  2QSW A;  2C2R A;  2VAS A;  2WW4 A;  3PG9 A;  1TVR A;  2ZM6 F;  5DG9 A;  3NCP A;  4NEY A;  1Q78 A;  2OML A;  4ICL A;  2UXD J;  5KFI A;  3NG8 A;  4TYB A;  2OPS A;  1CVJ A;  4P2S A;  5F8N A;  1WG4 A;  3W2W A;  3VR1 A;  5F9L A;  1C1B B;  2IDE A;  2I9S A;  3AXK A;  3T1H J;  4B9U A;  4ZHR A;  2KDO A;  3QPI A;  3KJF B;  2W4C A;  4RNH A;  3T6J A;  4HKQ A;  1DJ0 A;  1S1U A;  4Y2M A;  1C0U A;  2L41 A;  4XK8 C;  2VG7 B;  5DQI A;  2LQ8 A;  5HMY A;  1SC6 A;  1RTI B;  2ZUG A;  4IQM A;  4KIA A;  4LBI A;  4ZPT R;  4Y2K A;  1RCX B;  4NLX A;  4JI4 F;  3C3L A;  3C66 A;  4NML A;  3NP5 A;  2RHQ B;  1N6Q B;  1TL3 B;  2KFY A;  4IOC Q;  4ZCL A;  3MZI A;  1U8W A;  4Y00 A;  2AQ4 A;  2JSX A;  3HFZ B;  3PHE A;  4TYA A;  1DQ8 A;  4UST A;  1T9Y A;  4HH1 A;  1UVK A;  3TAR A;  1KTQ A;  3OVB A;  2RIJ A;  5CYJ A;  4FF2 A;  1VBY A;  2C2D A;  4U67 Q;  4JI0 F;  2GHW A;  3C46 A;  3GYX B;  2ZBI A;  1ZPW X;  1B7F A;  2ZE2 B;  1S1W B;  2FZG B;  3CGI A;  2VV5 A;  5E41 A;  5MAO A;  4P6Q A;  4DSL A;  4F26 A;  3DOK A;  1M5K C;  2CDQ A;  2QA1 A;  3I9Z A;  3G87 A;  5B0C A;  1NXI A;  4ECX A;  3R1H A;  1IBK F;  2B7C B;  2M8D B;  1B4S A;  4AE5 A;  3OTO J;  1FF2 A;  1FFW B;  4KHR A;  4LFC F;  2QEX S;  4C98 A;  3H2V E;  4OL8 A;  5B0E A;  1KN6 A;  4KHM A;  1N33 F;  3PZP A;  1CG2 A;  2C3O A;  2BKN A;  2N4D A;  2CNO B;  1SVD A;  3RRK A;  3PIO Q;  3M1V B;  2V2K A;  4CM2 A;  3HHL C;  5JVG Q;  1T95 A;  1WKL A;  4KO0 B;  3U1M A;  2R4F A;  4F4A A;  2HSE B;  1NJW A;  1YKW A;  2FLL A;  2KHC A;  3V4I A;  2DNY A;  4DMZ A;  3KDO A;  3CT9 A;  4QPX A;  4NA2 A;  2Y1R I;  2X1F A;  1WC4 A;  2QYC A;  4DPO A;  4NLY A;  2VJV A;  2QMU B;  4L6V 3;  2E5L J;  1SC4 B;  4P75 A;  1N32 J;  3N5B A;  2RQ4 A;  4EO6 A;  1S76 D;  3TVZ A;  1VRU B;  3FRY A;  4OYP A;  3T1H F;  2XY6 A;  3M2V B;  1FKO A;  3MMB B;  1IBM F;  3PX0 A;  1NRK A;  3KUG A;  1TAU A;  3DRS A;  1NJY A;  2JLG A;  2HS4 A;  3RAM A;  3DLL Q;  2XI3 A;  4RPF A;  3OFF A;  3F41 A;  1A0O B;  3BQ0 A;  1SH0 A;  2RQC A;  4CTA B;  4JV0 A;  4AL5 A;  2EBG A;  3A3N B;  2JZ5 A;  1NU4 A;  1RT6 A;  4KR0 B;  3NNH A;  3NY0 A;  3FCH A;  1HBU B;  3EPI A;  2OEL A;  1T9V A;  4ZP7 A;  4YOE A;  2LCW A;  2RUS A;  1U4B A;  3B4M A;  1U2F A;  4EU0 A;  2UXC J;  1RTD A;  2LU2 A;  4B3T J;  5LMU F;  1J5E F;  2YX1 A;  3US5 A;  4DL0 C;  1YWX A;  3THP A;  4USH A;  3ZTR A;  2AJ4 A;  4ZLP A;  2CQ1 A;  4F67 A;  2FD2 A;  2W2Q P;  2QG9 B;  3MCS A;  1FKA F;  1NPP A;  2R42 A;  4K4Y A;  2YKO A;  2CQ2 A;  2C3Y A;  2VBX A;  1HMV B;  3G8T A;  2DGS A;  3ZZR A;  2V0N A;  3NGR A;  1N0U A;  3UDE A;  2CQP A;  2KYX A;  1RSC A;  3DLH A;  4GC6 A;  5EX0 A;  2CQ3 A;  2PMW A;  2NUH A;  1NJX A;  2ZVI A;  3CDW A;  5ETL A;  3BZQ A;  3NXZ A;  3KJN B;  2VA3 A;  4I2Q A;  2LDY A;  3AA8 A;  3L4B C;  3AB2 B;  3KNG A;  4YS2 A;  4ITS A;  4USJ C;  5AXK A;  4AYB D;  5IT9 U;  3TZZ A;  2HHT A;  2BVZ A;  3PHT A;  4CLS A;  4UQG A;  1S6Q B;  5KFX A;  7FDR A;  3SDE A;  4M5J A;  3Q2S C;  3EVW A;  2MZQ A;  3TW0 A;  4CLW A;  1U1Q A;  5L39 A;  4O44 B;  1LK5 A;  2YBV A;  2E1R A;  3RBE A;  3BGL A;  1QAJ A;  4ZIV A;  4JOU A;  1CQN A;  1CPZ A;  3PTW A;  2B7B B;  4GVB A;  1UKU A;  3ZZP A;  1KWM A;  4A4J A;  2ZNY A;  4L76 A;  1DTT A;  2LQ9 A;  2QLB B;  2BW7 A;  2YWE A;  3QAE A;  4U9R A;  2E5L F;  5EHH A;  2R7T A;  3ENW A;  2Y9H A;  3F73 A;  2CQ4 A;  1HPZ A;  3BSC A;  4X4Q A;  1TKT B;  2YQ0 A;  4OMF G;  3G9C A;  2XLK A;  2GMH A;  2OIH A;  4EBC A;  1SH2 A;  5L1J A;  3QNW B;  4DPT A;  2ALY B;  2RKI B;  1Q7Y T;  3WBZ A;  3NCR A;  1TAQ A;  3H5S A;  2QSF A;  3NAH A;  4DI6 A;  3HZE A;  1ZYQ A;  4WFN Q;  4MK7 A;  4B9N A;  3T9N A;  3FEY B;  3JTO A;  4WU2 A;  4LBP A;  4PPD A;  4CLP A;  2OLW A;  1IKW B;  4XAK A;  3AB4 B;  2AU0 A;  2DNZ A;  1YJ9 S;  2YPZ A;  4QIF A;  3TX8 A;  3OPK A;  2HGL A;  5KFU A;  5LMN J;  3VWS A;  1HHS A;  3W9H A;  5CD4 H;  4TU7 A;  4ECR A;  1O6X A;  3H40 A;  1F5A A;  2OAU A;  4PAA A;  2G0I A;  4IYQ A;  3PRB A;  4LRD A;  1PIE A;  2RH3 A;  1EQ0 A;  1DQ9 A;  5E3Q A;  2A18 A;  3UCU P;  4ZPA A;  3M7V A;  1XJW B;  1OS5 A;  1BE4 A;  1KOO A;  4KH0 B;  2HS3 A;  3G86 A;  3MEC B;  2N7C A;  4UUW A;  1V9O A;  5I3P A;  5LSR A;  3OUY B;  3J81 U;  3OL7 A;  2IIH A;  4A8Q A;  3CCM S;  4PWD B;  1KLN A;  1EAR A;  2XSJ A;  5A0Y B;  1L3U A;  1U0H A;  4X64 J;  4QIG A;  3CJS A;  1T02 A;  1Y5L B;  4X4T A;  1HNZ J;  2GQC A;  2V2Z A;  2W9A A;  1X0P A;  2XO7 A;  2JOQ A;  4EBD A;  3DI6 A;  2A2D A;  3L9Z A;  4LF6 J;  2IPO B;  4OHY A;  5D78 A;  2GO8 A;  5JUM A;  5BR8 J;  1FDN A;  3UCG A;  1QVG R;  3V6H A;  3KKF A;  1NB2 A;  3MM7 A;  3FZ2 A;  3MEE A;  3PJX A;  3U1L A;  1JLF A;  2G9O A;  4J37 A;  1XC9 A;  3P45 B;  5KG6 A;  1IKY B;  2VG5 A;  2X1A A;  3KJV B;  1N5T A;  1X4A A;  1NSP A;  4MK8 A;  1NLK L;  3GFH A;  3KWM A;  4GKJ F;  4IRK A;  3R2C J;  4HR2 A;  3L95 X;  5H9F J;  3W9J A;  2H5I B;  4WTY A;  2DK2 A;  2I5J A;  1ZET A;  1S59 A;  2BZ2 A;  1RLD A;  1CJK A;  5HJY A;  2HEK A;  5DDP C;  1VBX A;  2BJ3 A;  2R8G A;  1IBL J;  2KU7 A;  3PW4 A;  4K0K J;  3L7P A;  3T5K A;  3MGJ A;  1RDR A;  5L46 A;  2BKP A;  1HNI A;  5E7O B;  3UFC X;  4DPX A;  1H7X A;  3SIP B;  3KLI A;  4DQI A;  4FNI A;  1S9F A;  1X5P A;  4R0E A;  5HP1 B;  2LEB A;  1SC3 B;  3CME S;  3BGO P;  2MZS A;  2MY7 A;  1H74 A;  4YUD A;  1U02 A;  2PFF B;  2ZJR Q;  4NLT A;  4FXW A;  2R7Q A;  3I4H X;  4OI1 A;  1RTZ A;  1SKW A;  2ROG A;  1C1C A;  3S7R A;  2GML A;  5C42 B;  2HFZ A;  2C3U A;  3DOM B;  4ZN1 A;  2NZ4 A;  3PDN A;  5J2P B;  1JJ2 R;  4JP8 A;  1BQN A;  4DR2 F;  2DNP A;  2X51 A;  2ZBQ A;  5DS7 A;  2YQ1 A;  2R8J A;  2E1P A;  2FC8 A;  2GGP B;  3BKU A;  2G0J A;  5DG8 A;  3LP0 B;  1OPZ A;  3PX4 A;  2CZ4 A;  4UOG A;  2AJF E;  3IXQ A;  3SEO A;  3MMJ A;  3BM7 A;  1REV B;  1HNZ F;  2IJN A;  1NK5 A;  1WOO A;  1M90 T;  2VQF J;  1R31 A;  3CVK A;  3CMQ A;  5KG4 A;  1JLQ B;  4LF6 F;  1AZS B;  3ISN C;  4J9P A;  3CWJ A;  2D9P A;  2KVQ E;  3HT3 A;  4ZLJ A;  3LAK A;  4ZOS A;  1TP7 A;  1RAA B;  3I87 A;  3M2U A;  1YX2 A;  3M2R A;  2DGW A;  3HMJ G;  3ELH A;  3Q8Y A;  5IC4 B;  2W1B A;  3IWX A;  1T94 A;  4NXM J;  2F40 A;  4W92 B;  1S1V B;  1H98 A;  2H48 B;  2MXY A;  2YNF A;  3D6M B;  4V19 X;  3BRE A;  1FEH A;  3AT1 B;  2B9E A;  1L5U A;  4DCP B;  4DV2 J;  3OR2 A;  2DJW A;  2DRD A;  3VAF A;  5J1E B;  3NCQ A;  4O4G B;  3O44 A;  2GIQ A;  1UWA A;  1B64 A;  3QSI A;  3J80 Y;  2XS5 A;  2PT0 A;  2MHE A;  2FZC B;  1JLA B;  1B3T A;  2L48 A;  1FO1 A;  1RAI B;  1WF0 A;  1SQF A;  2PA8 D;  2D7S A;  2GNK A;  4FYV B;  1Z2L A;  2XS7 A;  4ED2 A;  1NM2 A;  1HL6 A;  4OYX A;  4O3Q A;  1VQS A;  3KK1 B;  2DCU B;  3MAA B;  3OTE A;  3VAM A;  2HLT A;  1TK0 A;  3MPY A;  3C15 A;  1MSW D;  3I5B A;  4EZ6 A;  1EP4 B;  2BJ9 A;  2HK2 A;  1SJQ A;  1T8E A;  1JX4 A;  3EGN A;  2XGQ A;  4RW9 A;  2EVZ A;  4R5P B;  3P8B B;  3RUB L;  4MKY A;  3R7S B;  3M8S A;  1SKR A;  1DZ5 A;  3AOA A;  3DMJ A;  1OYD A;  4NI2 A;  3SBM A;  4B17 A;  3B82 A;  2QRR A;  1VHF A;  4ENO A;  3PW0 A;  2G13 A;  2CQI A;  2XM3 A;  2WOM A;  4O3O A;  4DBQ A;  3TVK A;  4YR0 A;  1WUU A;  5F8I A;  4ZKA A;  1GAO A;  1M1K T;  1T9W A;  2AD9 A;  1JXV A;  3Q23 A;  3NMR A;  4QCL A;  4X4U A;  2IM2 A;  4KGZ B;  5LSO A;  4HTJ A;  2X1G A;  3DLK A;  1GX5 A;  2ZUA A;  4QYR A;  5CD4 A;  4F4X A;  4JI8 J;  8RUC A;  2GJF A;  3LTO A;  4I56 A;  2F65 A;  2BE9 B;  2VQF F;  1NDC A;  3RB3 A;  2YX4 A;  2HRY A;  5GVQ A;  2M4M A;  2UXB J;  2MTL A;  3LPY A;  1KP6 A;  3EGZ A;  3MCO A;  2R2U A;  1U26 A;  2GCF A;  3M9M B;  1YGY A;  1DHM A;  2FJE B;  2XMU A;  1VC0 A;  1WKK A;  1FRJ A;  5KFF A;  4AL6 A;  3MPU B;  3FQL A;  2ZZM A;  1FWK A;  2GHV C;  1SB6 A;  3CD5 A;  4L72 B;  1P9Y A;  3OXG A;  3D2W A;  4CO3 A;  4NA3 A;  1XNR J;  3N6N A;  3W60 A;  2CNK B;  1QY7 A;  5HMZ A;  2YVS A;  1HD1 A;  1KNZ A;  4RL1 A;  5KOW A;  1SJ1 A;  3SSS A;  3QRQ A;  1RJJ A;  4NPO A;  3HSJ A;  3SZ2 A;  4YHH F;  4DPU A;  1HR0 J;  3QJP A;  3LQV A;  1RZM A;  2OSQ A;  3TYT A;  1WNE A;  4Q2L A;  1EHW A;  2QFJ A;  1JQG A;  1ZTT A;  3CJ3 A;  3CPW R;  3PIP Q;  5KT2 A;  4F3O A;  1VFJ A;  5CZX A;  3BN4 A;  1UVI A;  3CCT A;  2XY5 A;  2NR0 A;  4L75 A;  2HMI B;  2D3Z A;  1Q86 T;  1HW8 A;  4LF8 J;  1F5B A;  2OP5 A;  3C6U B;  1RYS A;  1SXL A;  3X1L B;  2G4B A;  1JJC B;  3MOZ A;  1AB8 A;  3W3S A;  4P72 A;  4LSL B;  1RAO A;  2MYF A;  2DNM A;  1DAR A;  3V81 B;  3N6L A;  4HDG A;  2HHV A;  1RAJ A;  2QV6 A;  2VFV A;  2CJX B;  5KFQ A;  5DQH A;  3CCJ S;  4ECQ A;  4Y6I A;  2FZK B;  5CCM A;  1X4H A;  4ZVS B;  4B02 A;  3HLU A;  2ZH3 A;  2PI4 A;  3QT7 A;  4Y2I A;  3VQS A;  1B99 A;  5CYM B;  3MR7 A;  2XNR A;  2PEH A;  4AFF A;  1NSQ A;  1Q79 A;  3GSD A;  4LJM A;  5I3Q A;  1HYS B;  4KBI A;  3OL9 A;  3CO9 A;  3MCM A;  3UNY A;  4BHQ A;  2JC0 A;  4QBU A;  1ZTW A;  3NS5 A;  1NAQ A;  3NNC A;  1WSV A;  1N5V A;  3HZG A;  4L3K A;  2K2P A;  3EXY A;  3I9V 9;  2HVE A;  4TVA B;  3HKW A;  4F4W A;  5K9F A;  5LOQ A;  6FDR A;  3T9Z A;  3OV7 A;  3OR1 B;  3X3U A;  2V2V A;  4URS A;  1DFD A;  3HFK A;  2ZJP Q;  4CCH A;  2OTJ S;  3UPF A;  2WRM A;  3V6J A;  1FNX H;  4UW2 A;  3T6B A;  2BRL A;  1R8H A;  1MU2 B;  5I42 A;  4LVO P;  4NCA A;  5K20 B;  2VH7 A;  4P2F A;  2P9G A;  5SZT A;  5HL7 Q;  4EBE A;  4PG5 A;  2DXF A;  4M5L A;  4ZPW R;  3M32 B;  4OI4 A;  4JV2 A;  3GJT B;  1PIL A;  3LO3 A;  1FD2 A;  1MG7 A;  2HHS A;  1FJE B;  1NEE A;  4ETX A;  5HN0 A;  1D09 B;  3HD2 A;  4Z2X A;  2R8K A;  3H4B A;  3BGU A;  2P6T A;  4FXV A;  1S9G A;  2EFG A;  1K44 A;  2KH9 A;  1HWL A;  5GAG U;  5B09 A;  4IRD A;  2CVE A;  1J2V A;  2RD5 C;  4TU8 A;  4ELT A;  1GMU A;  1WC0 A;  2N4C A;  2KG1 A;  2QMW A;  4Q5V A;  2XZW A;  4RW8 A;  4C8Z A;  3J7A 1;  1QSS A;  4IH6 A;  2HLU A;  2BM1 A;  4RNN A;  2ZKT A;  3BGF A;  2G2O A;  1BGX T;  3G2X A;  4LF8 F;  2M7S A;  4JBC A;  3RW7 A;  3JTN A;  2A0F B;  5EWE A;  4LRB A;  2YY3 A;  3E3X A;  2MPU A;  3KHH A;  2EC0 A;  4MAK A;  2HUR A;  5E2Q A;  2ZH6 A;  2H65 B;  4DUT A;  4LRE A;  2GVZ A;  4QIV A;  1N5Y A;  3TP2 A;  2XBP A;  2UUC J;  3E51 A;  5E3C A;  1RP5 A;  4DV0 J;  1CQM A;  3DU5 A;  1CUL B;  1NHV A;  1JKH B;  2JFD A;  3K17 A;  1KLM B;  2XCA A;  2M88 A;  3ENA A;  2R2R A;  4RBV A;  2MJU A;  4N41 A;  3KG0 A;  2UVR A;  1G3O A;  4PXC A;  3DLE A;  1XMB A;  4NZ7 A;  3R5J B;  1TKD A;  2VZ9 A;  2OPQ B;  2ACM A;  3POT B;  4J9V A;  2XYP B;  4ZIW A;  1UWB A;  4TKT A;  4QWB A;  1G1X A;  1FJC A;  3W63 A;  4UOH A;  1KSP A;  1LWE B;  5CH7 B;  4A48 A;  3PRD A;  2ZOF A;  4K59 A;  1SUQ A;  4DV5 F;  4DSI A;  4OZN A;  1S0O A;  2BR0 A;  4ZPC A;  2A1B A;  4C2M A;  2CQB A;  4UT4 A;  3MED B;  1URR A;  4CO0 A;  1O8B A;  4LT6 A;  1RAH B;  3D3B J;  4QWD A;  2JEG A;  2BRK A;  4USM A;  5B0B A;  1YRX A;  2BDP A;  4IOA Q;  3I6P A;  2OI2 A;  3ISZ A;  3PW7 A;  4UY8 T;  4AQY J;  4NLG A;  4OX6 A;  3MEG A;  4GKK F;  3LAM A;  3FZB A;  1ZM3 A;  3G82 B;  2M2B A;  3CUL A;  1S97 A;  4HI1 A;  3LP1 A;  1D0E A;  4RUH A;  4OJ3 A;  3BSO A;  1B0V A;  1VS3 A;  4ED8 A;  1GTH A;  3HHL A;  3MR2 A;  2QA2 A;  1NH8 A;  3KLV A;  1PBU A;  1U1M A;  5KG3 A;  2LXF A;  4CO1 A;  1T03 A;  3SV3 A;  5CYQ B;  1DTQ B;  4H4K C;  1GFW B;  2CQ0 A;  2XWY A;  3H90 A;  2HVZ A;  3O5T B;  2JEI A;  3NOC A;  3KK3 A;  2AGQ A;  3FUY A;  3GLJ A;  2IRU A;  5D0E A;  1F6T A;  1EB0 A;  4CLL A;  2VUG A;  5C5J A;  1UA0 A;  2Z58 B;  2JC1 A;  3I82 A;  2MQQ A;  4B3O B;  1Y5I B;  2HFU A;  3M05 A;  3RGI A;  2IRY A;  4OLP A;  2UP1 A;  4ZJQ A;  1K73 T;  4DR5 J;  2YNH B;  4IR9 A;  3DRR A;  2NS1 B;  2J0S D;  3UR0 A;  4F50 A;  3R6G B;  4XIU A;  3EE3 A;  5J1P A;  3KLG A;  4USI A;  3I0S B;  4ZK7 M;  1BQM A;  1GH8 A;  3HVR A;  4F04 B;  1KVK A;  4NYP A;  2W2P P;  1JLE B;  2HFV A;  1B0P A;  3IRX A;  1UJ6 A;  1E6V A;  1UCN A;  2IDL A;  2QYG A;  1KFS A;  3Q8S B;  3BH7 B;  3LGH A;  5KT4 A;  3KG1 A;  3RB4 A;  1WOS A;  1RKJ A;  5THW A;  3I32 A;  4F36 A;  3UD4 P;  1U7L A;  4OYW A;  1A7G E;  5KG7 A;  1IKX B;  3J81 j;  3N6M A;  4M5I A;  4EFA C;  4NXN F;  2LMI A;  4OLO A;  4F3M A;  1S6O A;  5AT1 B;  1NK8 A;  1V3S A;  4DX5 A;  4N7T A;  2Z0G A;  4DR7 F;  1C0T B;  1F3F A;  1RT7 A;  4WF9 Q;  2ZWP A;  2O3D A;  3ETO A;  3HVT B;  3W66 A;  3GP9 A;  4RKU C;  3E01 A;  2W9B A;  8ATC B;  3NOG A;  2XG8 A;  3AAW B;  2JJ4 D;  2R2S A;  2VG7 A;  3MM9 A;  1K0T A;  3IR5 B;  3H5U A;  4DN9 A;  3J7Z 5;  1X0F A;  3CJR A;  3VTI A;  3HPO A;  1X60 A;  2QLF B;  2UVW A;  5IQ6 A;  5AE3 A;  1RTI A;  4HDH A;  2EI5 A;  2F8E X;  2Z30 B;  4DZD A;  1LWF A;  5G0R A;  3MFI A;  1IM4 A;  3K0J A;  3KHL A;  2J8A A;  1YK9 A;  1Q8B A;  2D9O A;  5I3U B;  5KFB A;  1S1X B;  2PMZ D;  1JMT A;  3FBC A;  1RHQ B;  2CJA A;  3OHA A;  1FWP A;  5DO2 A;  5T7L A;  4ED3 A;  3IM8 A;  2DR9 A;  4DR4 J;  2B43 A;  3PR5 B;  2YWG A;  3A3P B;  2APO A;  5KG1 A;  4CNY A;  1PYS B;  1R3N A;  2UV8 A;  2YXL A;  4CWB A;  5ETN A;  2EBE A;  5B7W A;  1VMB A;  1YJV A;  3Q8P B;  1XR7 A;  4AT1 B;  5L1L A;  4URG A;  1JLC B;  3CF5 Q;  3NBP B;  2UU9 F;  1U25 A;  5K5M A;  2MZT A;  2JFK A;  3TEG A;  4J9R A;  3DRX A;  3OXF A;  3D3C J;  5GAH I;  1VRT B;  1FFS B;  3EMT A;  2FLN A;  5K8M A;  1XEZ A;  1XER A;  4C11 B;  4PQU A;  1F60 B;  3K5P A;  1IVZ A;  1G7C B;  3BO2 A;  4OYZ A;  4MTP A;  3BJY A;  1LKZ A;  3MEK A;  2P6S A;  5K8O A;  4X66 J;  1Q5V A;  1NME B;  1AFJ A;  3TQ1 A;  3M6X A;  1S0N A;  3PCO B;  2J0W A;  1XMO J;  2HGN A;  4CYU A;  3MR5 A;  1RT1 B;  4DV6 F;  2W01 A;  3CCE S;  5CAA A;  4TQS A;  1IKV A;  5BYS A;  3T3F A;  2R3V A;  2EC2 A;  1EZZ B;  3DLJ A;  1OQ6 A;  3MMC A;  4WFA Q;  3M1V A;  4KGX B;  2GA7 A;  4RWW A;  2U1A A;  5HMW A;  2KHD A;  3RU0 A;  3BS9 A;  3AA9 A;  3KFW X;  3PO5 A;  2HHW A;  3NMA A;  1KVI A;  3TJA A;  3HSG A;  1SQE A;  3M8Z A;  5IXU A;  2DXE A;  3ILI A;  1EJ7 L;  2G2Z A;  1Q82 T;  4MIB A;  1QE1 B;  4I67 A;  2WAQ D;  2YKP A;  1ELO A;  2HKE A;  3OBI A;  4I0W A;  1H6K X;  1IUJ A;  3ZC4 A;  3VAG A;  2GAG C;  3CTR A;  4DL5 A;  2WVE A;  4Q8F A;  2NYH A;  2JX2 A;  3MMB A;  1UZH A;  1JXL A;  1LV5 A;  4ZMM A;  2CIM A;  2YWW A;  3WZ0 A;  5J2Q A;  1NDL A;  4RW7 B;  1FCA A;  5L8R C;  1S0M A;  2NPF A;  4CTA A;  2Q6C A;  4UZC A;  3NS7 B;  2VPX B;  3KNA A;  1HBU A;  2GMJ A;  3AOB A;  2DHX A;  1BLU A;  2CPX A;  2Z2Z A;  1HNX J;  3NWR A;  2M52 A;  2E9Z A;  2BEF A;  1WC6 A;  1Q8K A;  3ONQ A;  2RF2 B;  3CC4 S;  2COL A;  2X3D A;  4LF7 F;  2ZD1 B;  2B0G A;  4V1A k;  1XR6 A;  4C8Y A;  2CYY A;  4WU3 A;  5I4M A;  4KFB A;  1HMV A;  4DLE A;  4AL7 A;  2PN6 A;  4CLF A;  3ITH B;  1UL3 A;  5AXN A;  4HTI A;  2CFX A;  3W9I A;  1S4E A;  2VU5 A;  2MQO A;  2IAJ B;  1OYE A;  3IG1 A;  2NQP A;  3GV7 B;  1S1T A;  2V8V A;  1HI1 A;  2ZEJ A;  5LM7 E;  4NCG B;  2DEI A;  2F8M A;  2KO1 A;  3RB0 A;  1UW4 A;  4DUZ J;  5MLC V;  3NGD A;  1S57 A;  5HI7 A;  2IA0 A;  2BQ3 A;  1J27 A;  2SXL A;  1ZZF A;  2U2F A;  2HNZ B;  5HSP A;  2CPZ A;  2VHG A;  1S6Q A;  3GIL A;  2DGO A;  3AQO A;  1FA0 A;  2LU1 A;  2XWX A;  3RBZ A;  1RT2 A;  1TK5 A;  3QAU A;  5KFS A;  1LNQ A;  1AUD A;  3HT0 A;  3CDA A;  3BKF A;  3BH6 B;  2M0G B;  1FJG J;  2CAJ A;  3OLB A;  3F56 A;  5L38 A;  4C97 A;  4JV1 A;  5D4N A;  4JI1 F;  1M0S A;  1HQU B;  3IMQ J;  3QZ7 A;  3OTB A;  3QZ8 A;  2MZ1 A;  1IQZ A;  4OX8 A;  2F9D A;  2I0X A;  3CDB A;  2LYV A;  5KFV A;  3P4U B;  4OZ3 A;  1E6Y B;  1L3V A;  1RT4 B;  3EYZ A;  2C3P A;  4NE9 C;  3HDS A;  2MZJ A;  2MGZ B;  4RUC A;  1DY3 A;  3FEX B;  2RUG A;  2XTJ P;  2N7Y A;  2DHS A;  3PKM A;  1VQY A;  2AYM A;  2WW8 A;  3SCK E;  3CO0 P;  2VC1 A;  2CQD A;  1D1U A;  4QZV B;  5LJ5 Y;  2LXI A;  2YPY A;  4WBF A;  3K89 A;  1BD6 A;  2ATC B;  3OVS A;  2DRA A;  4DR3 F;  2D1C A;  2C2M B;  4IFV B;  4LQ3 A;  1CJU B;  1RAE B;  2KZZ A;  1U2C A;  3MM8 B;  4ZCK A;  4KY3 A;  1CS4 B;  2AYE A;  1U48 A;  4CM0 A;  1TKZ B;  4A8M P;  3V6D B;  3JTP A;  4K4W A;  4YFU A;  1L3T A;  1LXJ A;  1Y4Z B;  4F4K A;  1TVR B;  2KM8 B;  3RB6 A;  3KUE A;  3C8Y A;  2QLW A;  1WDT A;  3MF5 A;  1IJF B;  2J9E A;  4JI7 J;  3UE2 A;  3EZU A;  2OPS B;  4HEA 9;  1LFP A;  1QUV A;  2C1E B;  1CJT A;  2WBM A;  2QFI A;  4C48 A;  4XO0 A;  2DY1 A;  3OUY A;  3C19 A;  1HBO B;  4PWD A;  3W2W B; 
#chains in the Genus database with same CATH homology
 1I3O B;  4ZVP B;  1QTN B;  2QL7 B;  1RWO B;  2H4Y B;  3GJR B;  4LSZ B;  1NME B;  3D6F B;  2XYH B;  3R6L B;  3QNW B;  3KJN B;  1RHM B;  2FQQ B;  3R5J B;  1BMQ B;  1ICE B;  2DKO B;  2XYP B;  3NS7 B;  3GJS B;  3D6H B;  1GFW B;  3GJQ B;  1QDU B;  2H51 B;  4ZVQ B;  1IBC B;  1RWP B;  4DCO B;  1RHQ B;  1RWW B;  1I51 B;  1RHU B;  2CNO B;  2CNL B;  2XYG B;  2Y0B B;  2Y1L B;  1PYO B;  2C2M B;  3SIP B;  4ZVO B;  4ZVU B;  2CDR B;  5IC6 B;  2QL9 B;  1SC3 B;  1SC1 B;  2HBY B;  2HBR B;  4ZVT B;  1F9E B;  2QL5 B;  2H54 B;  2CNN B;  2H5J B;  2P2C B;  4DCJ B;  3P45 B;  3EDQ B;  1RHR B;  4ZVR B;  1RHK B;  3KJQ B;  3R7N B;  2C2Z B;  5IC4 B;  1RWM B;  2C2O B;  1RWX B;  2CJX B;  1SC4 B;  2HBZ B;  2H65 B;  1RWN B;  3KJF B;  1PAU B;  2XZD B;  3R6G B;  4JB8 B;  5K20 B;  2CJY B;  2QLB B;  4ZVS B;  3IBF B;  1RE1 B;  3R7B B;  1RWK B;  3R7S B;  2H48 B;  2CNK B;  2C1E B;  3EDR B;  1RWV B;  2C2K B;  2HBQ B;  3P4U B;  2XZT B;  3D6M B;  2QLJ B;  3GJT B;  3IBC B;  2H5I B;  1RHJ B;  2H4W B;  2QLF B;  3RJM B;  4DCP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...