1ICEB

Structure and mechanism of interleukin-1beta converting enzyme
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords INTERLEUKIN-1 BETA CONVERTING ENZYME
publication title Structure and mechanism of interleukin-1 beta converting enzyme.
pubmed doi rcsb
total genus 16
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 1994-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1iceB00
3P45B 2QLJB 1I3OB 3SIPB 1RWWB 3D6MB 1RWPB 2H51B 2HBQB 3NS7B 4DCOB 2C2MB 1RHQB 3R7NB 2XZDB 3GJQB 2H5JB 3R6GB 1RHRB 1RWOB 2CNOB 3P4UB 3RJMB 1I51B 4ZVOB 2CDRB 2H4YB 3D6HB 1QTNB 4DCJB 2FQQB 4LSZB 4ZVSB 2C2KB 2HBZB 2Y1LB 2CJXB 3D6FB 1RE1B 1RWKB 1F9EB 2XYHB 1ICEB 1SC3B 4ZVTB 2H5IB 2XZTB 3GJRB 1RWNB 3IBFB 3KJNB 1RWXB 2H54B 1RHMB 3GJTB 4DCPB 1RHKB 2HBRB 2QLBB 1RWMB 2C1EB 3KJFB 2H48B 1RWVB 2XYPB 3EDRB 1SC1B 1PAUB 4ZVPB 3EDQB 5IC6B 4ZVQB 4ZVRB 2QL7B 2C2OB 2QLFB 5K20B 3KJQB 5IC4B 4JB8B 2CJYB 2Y0BB 1QDUB 4ZVUB 1SC4B 1IBCB 3IBCB 3R7SB 2CNKB 2DKOB 3R5JB 2XYGB 3R7BB 2C2ZB 1GFWB 1PYOB 2CNNB 3QNWB 2QL5B 2H65B 2P2CB 2QL9B 2HBYB 1BMQB 3GJSB 1RHJB 1RHUB 2CNLB 2H4WB 1NMEB 3R6LB
chains in the Genus database with same CATH superfamily
5HANA 4RUHA 1U1MA 1U02A 5CYQB 1XK8A 2ZJRQ 4DG1A 1MWZA 4FF4A 2UXBJ 4K59A 3DGVA 4I7FB 3CDWA 1Q78A 2CNOB 2WVFA 4O4RA 2NSBA 3BM7A 2W8KA 1SIZA 4DG1B 4F50A 2ZVSA 1OPZA 2MZTA 3MURP 5B7WA 2IM2A 4QU7A 3HZEA 2Y9HA 4DMZA 1UW4A 3EYZA 5F41A 2RHSB 4BLGA 3SQGA 2ZEJA 4ILLA 4JB8B 2LEPA 4ZVFA 1YWXA 1X5SA 2VDIA 4F3OA 1U6BA 4QIVA 1NK7A 5K8PA 5LMNJ 3IGNA 2P9GA 3SQGB 2C28A 2EG1A 1NHKL 4Q43A 1QE1A 4OYBA 3NY0A 4P74A 4UOFA 1LWEB 1ZZNA 3TR5A 3V6JA 2BR0A 1A7GE 1KOOA 3M8WA 1QE1B 1TKZA 5M2UA 3JSYA 4MK8A 3GG0A 2BKPA 4OYMA 4DX7A 2V4QA 5F8NA 4G1IA 5KOXA 3W1YC 1SH0A 4IR1A 3QWPA 4P75A 2M70A 3EXYA 1UPPA 1SQGA 1F9EB 4ERDA 3R97A 2BE9B 4TXSA 1NDCA 4URSA 4OI3A 2I2YA 4MKAA 4KHPJ 3GR1A 4GVBB 5HVGA 2C2OB 4ZCIA 1CJUA 4LF7J 2ZH3A 1HHQA 3HP6A 3MPVA 5F0WA 3W2WA 4KGMA 1BLUA 2DRDA 1EKRA 2OSQA 1KRPA 4NZ0A 5HN0A 2HHSA 4M5LA 1CJUB 1W2IA 3CCWA 4F67A 5A8KA 3Q24A 3W2WB 1X5TA 1KKHA 4NCBA 3B78A 5A8KB 1U47A 1X4EA 4CWBA 2VUGA 2MSTA 3CE8A 4Q2MA 1UEKA 4DFMA 3CCVS 2AD9A 2K06A 2Q79A 3NMAA 3BGFA 1PIEA 2IJRA 8RUCA 3F41A 4B9LA 2UVRA 2J7KA 4Y2IA 1R0BG 4OZNA 3RRHA 3QLHB 3CD0A 4Y0FA 2FVPA 2CQ2A 3CJ5A 2W2OP 4UTGA 3HJFA 1QVGR 3OTOF 4P10A 3RRGA 2UUBF 3J80Y 2LA4A 1UEUA 1YITS 4AXIA 1RT7A 1XIQA 5A6PA 1YJWS 3IR5B 1NK4A 2IRXA 1S0NA 2ILZA 1W26A 4NI2A 4F0MA 2GQQA 3HX9A 2MKJA 4DR6F 1KLMA 2E5LJ 1RT7B 3KK3A 1G6BA 4M95A 1M90T 1VBZA 5EGYA 2LECA 1UVJA 4NI2B 1SC6A 4IG3A 2HHXA 1BUXA 1KLMB 5FLXY 3W62A 1RLDA 2V8DA 1MMDA 5K9FA 2KXFA 4I0WA 4I1TA 3ZZYA 3AQOA 2W1BA 2MQOA 5IZHA 2X51A 5ETMA 3E3XA 1TKXA 4DV3F 4X66F 1S4FA 3CJ0A 1IR0A 2FC8A 1N88A 4X4PA 1YKWA 2ILYA 3GPAA 5KG2A 2Z2LA 1BY9A 3MZIA 4OV6A 2ASYA 3HFKA 1TKXB 4OJGA 2UU9F 2QIFA 3MMBA 2FGOA 2HGMA 3CD6S 2GHPA 3S7RA 3IXQA 2MLZA 1JJHA 2HVIA 3GONA 3V6HA 1FWPA 4NLGA 1N0UA 5D77A 1VISA 4DX8H 4Y2MA 4RWXA 1M1KT 1FD8A 4D3GA 4K4SA 4TU7A 1NMEB 2DNHA 1KEKA 3POTA 1NM2A 1EIYB 1PSDA 3NMRA 3U1MA 1U2RA 1VQOS 4KHRA 4OI2A 1S7HA 2JSXA 4Q5VA 3N6LA 2XEXA 3K59A 3MR3A 3R7NB 4ECZA 1FDAA 4PG6A 3HULA 3W3SA 3GSDA 4CLWA 1YG0A 4DFKA 1EX8A 3PKYA 1C0TB 4RBTA 4J91A 1WSRA 2LQJA 2JEGA 5HMZA 1Q8LA 1RBLA 4DN9A 5L38A 3RBEA 2KJVA 1WHYA 3BSCA 2MY8A 3FCVA 3K2YA 3JYTA 1X9WA 3M8YA 3KYLA 3MEGA 1CQNA 5KFXA 2V8VA 2QLFB 1TUGB 3QAEA 1C4AA 2DHGA 4J5OA 1W7WA 3MTJA 2KT3A 2ACYA 3MEEA 2RAQA 1ZM9A 3WC0A 3JYTB 5KFOA 3GU0A 3R5CA 3MEGB 1VIXA 3HD1A 5KG0A 5K8OA 1U8WA 2FVRA 4PCQA 3K0JA 1YJUA 3J81U 3T3FA 2AV5A 2CQCA 3ET6A 1UJ5A 4ID8A 3MEEB 5ETPA 3E01A 4FYWB 5KFYA 3FGVA 2HQIA 3KMQA 2AJ1A 2MPUA 1RYSA 2CJQA 4LF6J 3ET6B 5KFAA 4NX9A 3RR8A 2OPRA 1L5UA 5HATA 3CB4A 1BXNA 3AOCA 3M7VA 2HAFA 2QRRA 4DOZA 4CLFA 4CQ1A 3GIRA 1VRTA 5A0YA 2GJ2A 1YHQS 3BEGB 4DPWA 2ROGA 3IAM9 1FCAA 2P6TA 4XPCA 4WJBA 5KFPA 3R5AA 5IV4A 1S97A 2H1YA 1VRTB 3EZOA 1PILA 4OJ3A 5A0YB 3MTKA 4PQUA 2J9DE 3H20A 1KQFB 3QZ8A 4Q7AA 1QY7A 3BR9A 2MKYA 4DI6A 3VGUA 3RAXA 1WEXA 2QG9B 3TA1A 2BZ2A 4P2XA 1Y3JA 4PXCA 3A13A 3K5LA 1N32J 3TVZA 4PQUB 3BS9A 1VQ4S 2X3GA 4C7QA 3M8ZA 2FLNA 3E51A 2YBVA 5CXTA 4RW8A 4NRTA 2LEBA 1NB7A 4QPXA 4U7CA 3KTQA 3QT8A 3K5PA 4Z37A 4RW8B 1HFEL 1VRQC 3UCUP 1HYSB 3P4UB 1LK5A 2G0CA 3KLFA 3VAMA 1T3OA 3T5HA 1QAYA 3J81j 5M2RA 5KFTA 2FGCA 2DRAA 1NH8A 1K9MT 3ENWA 4ZVTB 2IM1A 2B4VA 1GT8A 3K5MA 1OMSA 4RUAA 5I3UA 3ZTSA 5BJRA 3BB5A 1X4DA 4NE9C 3KK1A 1P27B 2F8HA 4LFAJ 2XY7A 4WFNQ 3D1QA 1FNMA 4QW8A 5I3UB 1LW2A 2JNJA 1LWXA 3KK1B 2R8JA 2BQ3A 3BR8A 1NPPA 3MM8A 2J9DA 2F40A 4DV7F 3A12A 2DD8S 5HQMA 2YKPA 2IVMA 2KRBA 2DH9A 2YNFA 3TO8A 3PHEA 4OX8A 3MM8B 2NR0A 2XS2A 4J9QA 2YKNA 1HNWJ 2ZHAA 4DZDA 3ILIA 1BQMA 2Z8QA 2CQ1A 4DXLA 2FJEB 1H72C 3BGOP 4LF8F 5DG7A 4LBIA 5F8MA 2UUCF 2HEKA 5LT5A 3D0GE 4ZJQA 1VR6A 3UVJA 2YKNB 4PPZA 3DOLA 3D1HA 3LWLA 1BQMB 5AE2A 5KT4A 2DNQA 4OX7A 1NHUA 1F60B 3Q2SC 4HHHA 1Q8BA 1S6UA 3THTA 5CABA 5DM6Q 3LP0A 2CQ4A 3DOLB 4YP3A 3AOAA 1H2TZ 4CLYA 2W4PA 3EGVA 5IC4B 4C0BA 3TZZA 2DHHA 3AT1B 2VG7A 1TL3A 4PXBA 2MJNA 3ZTPA 4DU7A 2HS3A 2XZWA 4CLSA 2W2PP 4Q44A 4NXMJ 4YR2A 4DHVA 1UCNA 4UOHA 1TL3B 3W9JA 1R6VA 4K0KF 4ZCMA 1U24A 1ZA2B 2BRLA 4IR9A 3UWTA 3CPWR 2HQ3A 2DCUB 1S6QA 3TWZA 1YGYA 4F7VA 1Z4UA 1X0FA 4YOEA 4KFBA 3KK2A 1KONA 2XBPA 4RNHA 3OTDA 1N5SA 2QJ3A 3ISZA 1RWOB 4C8NA 2G1HA 2FJWA 1UJ6A 2W2QP 5B09A 4QWCA 1S6QB 4KFBB 4Z7YA 3KK2B 4NLQA 7AT1B 4XPEA 2QLXA 3HHLD 4DS4A 3D54A 4OJ1A 2EKYA 2V63A 4FF3A 5DRKA 4OV1A 4AFFA 5J2QA 1HA1A 2IY5B 2JDJA 3CJ4A 5EX3A 3KG4A 3MHYA 2G0JA 3VQTA 5D78A 2ASLA 2AYBA 4FF1A 4B3TF 4EO8A 3QIPA 4PXDA 4Q0BA 1U8SA 3H98A 3B4MA 5J2QB 1HD0A 1U1RA 4NYPA 4ANDA 2M3DA 2DXEA 5DETA 2V0NA 3N01A 3QGIA 3N5FA 2NXNA 3QIPB 2VG5B 1P1LA 1I94J 3M9NB 2IRYA 2QYGA 1WC5A 3AB2B 2E7XA 4JI2F 1TELA 2XLIA 3C14A 1VI7A 3W2VA 3IS9A 2MJUA 3PEJA 1KDNA 2IBOA 2BM0A 1ZM3A 2HHHJ 1VQYA 5T14A 2AEFA 2DNGA 3C14B 3W2VB 3IS9B 1VC0A 2D74B 1FKAF 3I4HX 2D3OR 1KSPA 4P73A 5ETQA 3JSRA 1M5OC 2FYXA 3HXMA 4ZMMA 3CCMS 3DNCA 2IM3A 3MECA 4H4KA 3NCPA 2GMLA 4IFVA 5AXMA 2KVQE 4NZ7A 3PFEA 4H4MA 4IH7A 1SV5A 2RRNA 1H6KX 2P9CA 3KOAA 2E5GA 4J9SA 3IRWP 5EN1A 1FX2A 3MECB 4ICLA 4ETZA 4IFVB 2RU9A 1YI2S 4H4MB 2FVQA 2R2RA 3B82A 1SV5B 1T3NA 2YX7A 3FSIA 4ICLB 1M1GA 4C4WA 2UUAJ 1HIYA 3PJXA 1ELOA 1RTJA 3TJAA 4DSIA 5DGBA 5HJYA 2PMHA 4P9SA 2VBXA 3FBCA 1VGYA 4ECYA 1UVKA 1NJYA 2DNPA 4QR2A 1B0PA 1RTJB 4LBPA 3KWMA 4FP9A 4PG8A 1KTQA 4F02A 1FDDA 1VJWA 2HPUA 3QMQA 3A4TA 5HI7A 5KG3A 4LJMA 1JLBA 5LXRA 4DR2J 5DDOC 3NBPA 3KG1A 2UV8A 5M2PA 2RDJA 2W01A 2O01C 1DBDA 3W65A 3W8GA 4QYZJ 1FERA 5KFUA 4I4BA 2E9RX 3PRVA 2AJ4A 1RP5A 3L7UA 4L73A 2XMJA 2XC9A 1JLBB 4X62J 2BJ7A 4V19J 3I9V9 3I4PA 3NBPB 4ZVUB 2QMXA 4XAKA 1TK5A 4DR1F 4K4VA 2ALYB 4KGXB 1T9TA 2C2ZB 2BVZA 3VAHA 4J9NA 4MIWA 3R1LA 4DL4A 1RBAA 3H90A 3GJSB 3K8WA 2DNMA 1XNRF 2D3ZA 1K1QA 3OXGA 3KUGA 1WSVA 1NU4A 4DPXA 5C2CA 2HQDA 4DQRA 3RAQA 4DR7F 2J0WA 1SKSA 3LO3A 2ZOGA 1FEHA 4K5RA 2Z0GA 4JUZA 3TYTA 1REVB 1IBLF 1RT4A 1FFWB 2COLA 2X1FA 3DOMA 3D1OA 2I8EA 4EGLA 4X4NA 2F4FA 1X8DA 3W64A 2BX6A 5AXLA 2CFXA 4NRUA 2YKMA 5GMDA 4ANCA 2XO7A 2IJFA 3C16B 5K8NA 1MROA 3CNQP 2WZ1A 3W8PA 2QZ8A 2D1CA 2OELA 1KWMA 4WPAA 2RUGA 4DV4F 2YKMB 1CJVA 1C4CA 2IIHA 3C15A 4LSLB 1YBAA 1JJ2R 1CJTB 3VZIA 2FLPA 1CJVB 5IS2A 4ILMA 3UDCA 1HARA 4JV5J 4C8YA 5KFGA 4I69A 3FMWA 3C15B 3CJ3A 3PO5A 4O3OA 3G87A 5KFHA 4ED5A 3MEKA 2CPXA 1P6TA 4DFPA 1R27B 4CIOA 3UDVA 1RE1B 3OLBA 2HNZA 2IHR1 3BPSP 1R43A 3V6DA 2H5IB 2V8PA 9RUBA 5DQIA 2YPZA 1WC1A 2Z4PA 2J0SD 2WBRA 4YDXA 1PAUB 5KFIA 1SL1A 3BGUA 2DT9A 2AYMA 3V6DB 2QFJA 2LP4A 5C7PA 5GAHI 3UCGA 2YQ3A 4RNOA 2HFUA 5KFJA 3AA8A 2P8IA 1WELA 4DQIA 4O3NA 1BWVA 4C2MA 4DBQA 2WHOA 2BQRA 3CJRA 1URRA 2A0FB 3DN9A 5D4LA 4OYZA 3SIPB 3PM9A 3DI6A 2PEHA 1W2BR 5ETTA 4FXVA 2HMIA 2DB1A 1MG7A 3ZTOA 2WAQD 3R6GB 3G86A 3ZZOA 5CH7B 2RD5C 2VFTA 2WW8A 1YLXA 2MMYA 4Y2AA 1SKRA 3DI6B 3G6XA 3A8KA 2HMIB 1HL6A 2UVUA 3VGSA 3W5ZA 3Q0AA 1U1PA 4EWTA 1IBMJ 3AHPA 2AJQA 4KR0B 4JI5F 4WFAQ 2KXHA 1PAEX 1IM4A 4DPYA 3VHQA 1V9OA 4ECUA 3LGMA 4I68A 3GV5B 4HLBA 5D4PA 4TQSA 2DNYA 3FRZA 3T1YJ 3C6TA 4PYAA 3Q8YA 3QT5A 3LA0A 1YJRA 3DLKA 1PKUA 4TU8A 3F44A 4C11A 3JS9A 4L76A 4GMKA 4B3RJ 3N9UC 3GYGA 3C6TB 4PR6A 3DLKB 4A8SA 4P71A 4USMA 2CPDA 2C3MA 4C11B 4FYXB 4Y65A 1I3OB 1NK9A 1Y3KA 4M63A 4C3KA 5HMXA 2R7QA 2C2MB 4WK3A 1KQKA 1Q95G 3HHLC 1IJFB 2AIRB 2RQKA 2XWYA 3S8SA 3MOZA 2XG8A 2L9NA 3K17A 2XB2D 4DR5J 4ZIVA 3LGNA 2EFVA 1SVDA 1OO0B 2CYYA 3EWGA 2Z57B 2HRUA 4LRDA 2MHEA 1G2EA 1TVRA 3BZQA 2OUGA 3N79A 1JWWA 1QAXA 2ZFHA 3PY8A 3GYNA 4PAAA 1T9UA 5MAOA 1APSA 1TVRB 3OQ2A 2DNNA 4BCAA 3CCLS 4U6PA 2XYGB 1NK8A 2XS5A 3ZNUA 4I2PB 3H59A 1PJ5A 3NWRA 3X1LB 1J5OA 3H5XA 3H4DA 4FYYB 3EXCX 1TV6A 2A6OA 2UP1A 1WWHA 1CPZA 2V50A 4MT1A 1RYRA 1J5OB 1TV6B 4NWBA 3TNVA 2E1RA 3OXFA 5HSPA 4RUCA 2HBZB 3UR0A 1JLGB 5L1IA 4CTAA 1KD1T 2AJFE 1CS4A 5E3CA 4NA3A 2ZH9A 2BE7D 4XTTA 3BDPA 1HNXF 1RT2A 2HNDA 1ZBTA 4CTAB 1S1UB 1RWVB 1CS4B 5B0AA 5ITHA 2C2RA 3QFWA 5F8GA 5A6WA 3HO1A 2HNDB 3F0NA 4ZOSA 2KO1A 3M2UA 2MY7A 4CT8A 3CIZA 2W24A 4NA2A 2AZ1A 2OJ3A 2R7XA 2W8LA 2KTQA 1RTIA 3G71S 2R8GA 1LXJA 3H25A 4C0OC 1XNQF 2NLWA 2KH9A 1MU2A 2YXLA 4CH1A 2YH1A 3TAPA 1HR0J 1RTIB 4BBYA 2BE2A 4ECTA 1WEYA 1SIWB 2HG4A 2W4DA 1S79A 5KT5A 1CC8A 2AU0A 2CZ4A 2IA6A 1PCAA 3TQ1A 3UW1A 1MU2B 3GV7B 1OYEA 2N4DA 3SDEA 1U1NA 3V4IA 3FNNA 2BE2B 3MPDA 2CQDA 4DEZA 2FDNA 1SC3B 1WC3A 3SDEB 4B9SA 5HLFA 3V4IB 4QJVA 4DUYF 2NPIA 4KQZA 3BSNA 1WDDA 2DIUA 1MN7A 4X4UA 1FKOA 4QW9A 5HLFB 1GEHA 5LM7E 2Z2ZA 1NSQA 3CW2C 3OLAA 3ZZRA 3VCDA 1OPIA 4CP5A 2XULA 3I32A 4N8NA 2ZNZA 4E8UA 2BW7A 4FXWA 2KL8A 4Q8FA 1FKOB 5LL6d 4URGA 3IM8A 1NPRA 2G1DA 3MCOA 3P6YC 2WVCA 1Q8KA 4J9KA 3LAMA 3R9LA 4FNHA 2X7IA 5A8RA 4LIWA 4K4ZA 4DV5F 5B0CA 2DGWA 1E6VA 5ETKA 2RMLA 3ISNC 2ZBRA 3M32B 3SZ2A 2NXUA 5GMKa 3K5NA 2F1FA 2FJXA 5A8RB 2FJBB 2VASA 4ZP7A 2XHCA 3WZ0A 3GLJA 1E6VB 3A8JA 5DO2A 2MKKA 1XERA 4NEZA 1IKYA 2FHJA 1HBMB 3CD5A 4F2SA 2VICA 4CO1A 2MZJA 3IBFB 2R7TA 1IVZA 2CZVC 2HKEA 4LR9A 1IKYB 3UD3P 2L48A 4AYBD 4Y2CA 2M5YA 1TU0B 4C9DA 1L3SA 2CJYB 3IFEA 2R7UA 2UUWA 4B9TA 1F2GA 2A2CA 2LU1A 1NRKA 3JQJA 3VVUA 5IWAJ 5HL7Q 2JL9A 1FESA 3HM9A 3HPOA 2JHEA 2NUUG 4Y2KA 3GIKA 1IWGA 1AFIA 3QO9A 3M6XA 2R7OA 1C1BB 3EVMA 4NASA 4DDFA 4ED0A 4F36A 2DEIA 2HSEB 3HKWA 3H4BA 3DU6A 1WC6A 3CJ2A 3K89A 1FJGJ 1WKJA 2KRRA 3QO9B 3LOUA 4M5MA 1X4HA 2QEXS 5DZ6A 1XTZA 2NZ4A 2QE5A 4A8XA 4WZMA 2HWHA 4O3PA 4MK9A 1RCOB 3MUTP 2ZWOA 2GHWA 1GXUA 3HSGA 1CVJA 3JSBA 1F3VA 3TQEA 1NJIT 1VQNS 3UDEA 2DYAA 1N6QA 4IH5A 3EDQB 3GP9A 5F8JA 1WORA 4A4JA 3PKMA 3VAKA 3OJUA 4C8ZA 3NL0A 2Y1RI 1LQ9A 3KG0A 2J9CA 2KFZA 1KVIA 3A3NB 1FRJA 3G6ES 2C3OA 4PUOA 2FLOA 2H4WB 4LF7F 2MGZA 2ZWPA 4JP8A 3US5A 3NG8A 6FDRA 4OYXA 2V34A 1R0CB 3IR7B 4NMXA 4PUOB 3NGTA 2MGZB 3Q2TC 2H4YB 1S5ZA 4OX6A 2RH3A 4ED4A 2KKHA 1D9AA 2AX1A 3I5CA 2U1AA 1HD1A 3KKFA 5HP1A 1FNXH 2Z56B 2ZKUA 4KPYA 4USHA 1FI4A 1S12A 3NRBA 3PX0A 4FPIA 3DDIA 5KFWA 1JLFA 4J9OA 4ZPWR 3JXOA 1UWAA 2RQMA 3RTVA 2OEKA 3DHXA 5HP1B 2P9EA 3CCUS 4NXNF 2M8HA 2OP5A 3S1TA 2PO4A 2FZCB 1ZM4A 2VD3A 3L9ZA 2FIUA 1JLFB 3AA9A 3I0RA 2WRMA 5K14A 3BBCA 5D0HA 4WFXA 3DDNA 2BOPA 1Q81T 3TEGA 3PW0A 3TUPA 1MSWD 2P6SA 1GK8A 4TY8A 2HVDA 1BMQB 3I0RB 4LIRA 5K14B 4M5IA 3W7BA 5D3GA 2YQ0A 1BHNA 3D3BJ 1KHWA 4ZS6A 2BW2A 3FCWA 2BJ1A 5KFMA 1GNKA 2RRAA 2AYGA 4TY8B 1Y00A 1H2UX 5D3GB 3RJMB 1FDNA 2MXYA 2MZQA 1RTZA 4OZLA 5JVGQ 1WF0A 3O3LA 1RZMA 2F7VA 4HT7A 1LWFA 1VQSA 5KG1A 3WIVA 4FYDA 1ICEB 4NL5A 1FJCA 2OTJS 1NHVA 4ZDNA 3B4DA 1CSJA 4PWUA 4P7VA 1LWFB 1SUQA 1JIHA 4YN3B 1K47A 4FYVB 3TAQA 4F4XA 3NS6A 4USUA 3DGPA 2AHOB 3IA0A 2GJFA 1WKKA 3KLHA 2YPYA 1SUQB 1TMMA 4MYTA 4RJVA 5KFEA 3DC2A 2Z2MA 5IV3A 1OQ6A 3IBCB 2LKZA 3M9MB 1S4EA 2BABA 2Q1LA 3G8SA 3FC9A 3EGZA 2MB0B 2WSEC 3KLHB 2B43A 2ZH5A 1M1HA 5THWA 3PW4A 3HHKA 1N8RT 3C3LA 4WK1A 1DAXA 2XI2A 2DR7A 2G2OA 3OPKA 4LF1A 4OZ5A 3MCSA 1WD6A 4LR8A 1WF2A 3G6VA 3MM7A 1XC9A 1TMJA 4Y3CA 4JI3F 2F4VF 1Q5YA 1UA0A 2FHOB 3M2VA 5JXSA 2L41A 3G4SS 1RWXB 3MM7B 2XTJP 1VS3A 4O3QA 3U27A 3CO9A 3M2VB 2VODA 1NJWA 2GO9A 2LXUA 2GFFA 1SH3A 4LRCA 1JQGA 1P1TA 4QR1A 2H5EA 2D3O1 3QRQA 3CO0P 3DLJA 2LEAA 1U2CA 2LVWA 2WB1D 3I96A 5B08A 3D67A 2P2CB 1NO8A 1RAIB 3R5DA 3SV4A 4IKAA 3OVAA 3O8WA 4GRSA 2HYIB 1DQAA 4ZLJA 1QUVA 2ZE2A 3PXGa 1RUSA 2VC0A 2HFNA 1I51B 4EZ6A 2J6SA 2DNOA 3PHTA 1S0OA 2RJZA 1BC6A 3NLCA 3BYPA 2ZE2B 2VKRA 3MD3A 2QSWA 4JBCA 5B0DA 5G4DA 2BJDA 2XYHB 5I3QA 4PPDA 2DCLA 2HIQA 3R1HA 3PW7A 2IRUA 4AL5A 3SBMA 4A48A 2RB7A 3DLBA 3EICA 1EAYC 3FBEA 2FJAB 1FD2A 4CO5A 2PSZA 1QSLA 2UUBJ 4N77A 1AROP 5LMUJ 1X5PA 2NZCA 4ER8A 2IBKA 1NSPA 3LP1A 1SQFA 2G2ZA 4JI0J 3D6TB 2OEJA 2DEJA 1SQEA 1U4BA 2UXDF 2CJ9A 4CO2A 3MMCA 2MTLA 2QN6B 4IRDA 4DR6J 5KG4A 3LP1B 1QLNA 1YX2A 2GNKA 5DQGA 2EG2A 4I67A 3D0IE 1N32F 3TP2A 3AD7C 1YRUA 1DLOA 2F9DA 3EGWB 5GVQA 4NYOA 2E7WA 2Y1LB 2A6MA 6FD1A 2VPWB 4QIEA 3TA0A 3NNAA 1DLOB 1L3KA 2E66A 3KLGA 1RKJA 1U6FA 4OZJA 3RBXA 1TQLA 2KB2A 1O6XA 2JOQA 3KLGB 2J6UA 4HH1A 4PZVA 5E33A 4P2MA 3DOKA 3G8TA 3L09A 2AZ3A 2M0GB 3PW5A 4RU9A 3FBBA 5K5MA 1GX5A 2XWXA 2E44A 5KFBA 1VFJA 4N41A 2XGPA 2VFVA 1WG4A 4OI6A 3DOKB 5CD4A 1PYTA 3J80U 8AT1B 4RX6A 2HBYB 3MDFA 2AMCB 2CDQA 4IRKA 4LFAF 2J6TA 1MLAA 4QQBA 1NSKL 3MR7A 4CYUA 4WZQA 3D68A 1NDKA 4WE1A 2IYIA 3NS7B 3ULHA 3BQ2A 2KFYA 1JLAA 1RAGB 2FB0A 5LXYA 4B3OA 4CYUB 4O3RA 1T05A 1JLAB 3PZPA 3PW2A 1VC6A 4ETXA 2VDHA 2ZBPA 4YDDB 1N5TA 5AJ3J 4B3OB 4S0MA 1RAOA 5JVHQ 5C5JA 4EEYA 4B08A 1X9MA 5EX0A 5HVFA 4FS2A 3U1LA 2DRBA 3T19A 1HWIA 2Q43A 3DDKA 1DQ8A 1NKCA 4ILRA 3OTBA 3FRYA 4WU2A 5K20B 1ZM2A 3DCAA 2Y0BB 4E98A 2EFNA 2CWXA 5D6GA 3R7SB 3H2VE 1GMWA 1DTTA 1NPKA 2ZC3A 5L1KA 2BM1A 2CPJA 1UKUA 4ZPCA 1GX6A 2POKA 1FX4A 2CIMA 1WOPA 3ZZ0A 5BR8J 1LV5A 2PD1A 4RO0A 1ZAXA 1DTTB 4HDGA 5CCLA 4F0KA 5J1EA 3OL7A 4U8VA 3OR1A 2HWIA 3SXLA 2FJDB 4WP9A 4HL9A 3DRSA 2M52A 2VFUA 2J7WA 3I55S 2NXCA 2IFXA 5J1EB 5KT7A 3OR1B 3O1LA 1MWQA 1DZ5A 1NH7A 3EMTA 3FFIA 1JJ4A 3TVYA 1FHTA 5E2QA 1GMUA 3DRSB 4X2BA 4EBCA 2W2MP 5F9NA 3K58A 2H9ZA 2VG6A 5DDQC 4YB1P 2AP6A 4DU8A 2XYPB 3FFIB 4NCGA 3HDSA 2XCAA 1RQ0A 1HW9A 3PJWA 5H9FK 4YEAA 1F3FA 4WFBQ 5KFCA 2QA2A 1X60A 1JLEA 3RG6A 2VG6B 2GAGC 1O8BA 3O6QA 4DR3F 4YB5A 3GMGA 3R5JB 4NCGB 4YY3J 1FK9A 4KT0C 4OX9J 3DMJA 3QPIA 3DRYA 3MGJA 1JMTA 5C42A 1WI6A 3DHWC 2MQMA 4UUWA 2ZH7A 4DSFA 1N4LA 3H40A 3BREA 2MQPA 3BBFA 1FK9B 1S1XB 4ZPTR 3AJ1A 5C42B 4ZLLA 1GAOA 4FS1A 3SYZA 3RB6A 5GADU 2V8HA 1I94F 1AT1B 4CO3A 2B8PA 4DPTA 2DVIA 3GB0A 5LJ3Y 1S48A 3DFEA 4ELUA 1VQ6S 4QBUA 1AZSA 3W66A 2DGXA 4CDIA 1TKTA 2KT5A 2Q6CA 3DLEA 2HHHF 2EK6A 1KQSR 3NKYA 3G9CA 3IP0A 1AZSB 1CBKA 2QV6A 1RTHB 1TKTB 4GKKF 3DLEB 2C3UA 2KG1A 4LT6A 2FPHX 3LAKA 4EBEA 2EK1A 3MR2A 1JB0C 3NAIA 5IXUA 2YWWA 4UW2A 3Q8VA 1SL0A 4QWDA 5D15A 4DZ6A 3QFHA 2OFHX 5E3PA 3PNIA 3UNYA 4ECQA 1N52B 1MMNA 3TX0A 2OD6A 4KTQA 1UFWA 1ZTWA 4LF5J 5HVHA 2W9BA 4DV1J 2B56A 2ACMA 4RW9A 5GAGI 2NREA 2DGTA 1EQ0A 1FE0A 4J7CA 3J7ZT 2FHJD 2IMOA 4RW9B 1IQTA 1KVJA 2MHNA 2PE8A 3TUJC 2CPIA 4K2XA 4TY9A 3CCES 2QLBB 3AY0A 2LU2A 4JI6J 4NZ6A 4JV2A 2QL7B 1HWJA 3ADAC 2DPIA 1Q7YT 3BBBA 5EWFA 3KDNA 3NOGA 4HI1A 2XNQA 1JLQA 4CH7A 3BSAA 2DTJA 4CT9A 4OHWA 4X64J 4K4WA 1T94A 3KHRA 1HNIA 4V1Ak 2QL5B 4RW6A 4X4TA 1WF1A 1YDLA 2J9EA 4KPCA 2J76E 4ZLPA 2AX0A 2B51A 5F3TA 2VBZA 4USJC 1JLQB 3KLVA 4K0KJ 3RW7A 4X62F 1HNVA 1S9FA 2DR6A 2BA9A 1HNIB 4P6QA 2OKQA 2H51B 1TKZB 4RW6B 2E29A 2LQ9A 1PJ7A 5AT1B 2XQCA 1YRXA 2ZM6F 4KH0B 1OQ3A 1RHRB 1HNVB 3IGVA 2W9CA 2CPYA 4O44A 5FIIA 3ENAA 4DR4F 1MNEA 4CLPA 4ZPVR 2J5AA 3CC7S 1TL1A 2CQHA 4ZPAA 1NJZA 3GJRB 1I1GA 2W9CB 4O44B 4YHHJ 1RWMB 1TZ0A 1TL1B 2ZHBA 5CHCB 4J9VA 3NGSA 2HHQA 4RNNA 1WUUA 1IR2A 4ES3A 1ZAWA 5IQ6A 2UUTA 4QYZK 5CQGA 5B0BA 2BRKA 3B8HA 1YJ7A 4WXOA 1HWUA 3EE3A 4QWEA 1VQMS 2G9OA 5I4MA 2OD4A 1L3VA 3Q8UA 5SZTA 2OGUA 3A3PB 2HHUA 1VHIA 4DWIA 3I31A 5EHHA 3T9ZA 2HNYA 2JLEA 2KT2A 3P3DA 3F56A 1Y5LB 3ENQA 3E2EA 4LFBJ 1F5CA 2VQEJ 3DLHA 1C0UA 2GAHC 3LP2A 4IQMA 2EFPA 1EARA 1IBKF 2HNYB 1N36J 1TTHB 4O23A 1IM6A 2IVYA 2FVCA 1KN6A 1C0UB 1NJXA 3GIIA 2VA2A 1GTEA 3GFXA 1GMVA 5G0RA 3LP2B 2KM8B 2JFDA 1U09A 2L3MA 3FK4A 1VCTA 4CLLA 3FJ2A 4TN2A 4L3NA 4GKJJ 3HMJG 1X4BA 3MAAA 4CZCA 5G0RB 3IC1A 1FWLA 3OR2A 2MYFA 4MH8A 3SFUA 1LKZA 4WF9Q 1ZOTA 1Q0NA 3PYDA 1BQXA 2Y1IA 3UDLA 1WTBA 4MAKA 1Y4ZB 1PBAA 3UN5A 3VR1A 1U0SA 3KK3B 4ZVHA 2XMUA 4HEA9 5HK4A 2DHXA 1XMQJ 4IG3B 2QTWA 1KTVA 5GAEI 3J7Z5 1Y5NB 3BKFA 5SUHA 1LFWA 2DPJA 3KXDA 4TNOA 2HVHA 4ZLNA 3UN3A 2Y0SD 2ZBCA 4BWMA 2NYIA 4UZCA 1F0XA 2F9JA 1L3UA 1VBXA 3EDRB 2VA3A 2GS8A 1JXLA 2CJAA 3MMBB 1IBMF 4DPOA 4O3SA 4OJHA 4NOHA 4DR1J 4C97A 2QMWA 2ZZTA 2V2VA 3C8YA 1XMBA 4OLOA 5ETNA 3NNHA 2CQIA 5HO4A 2K3KA 2VH7A 2FTRA 2OO4A 3POTB 4M1KA 1SJFA 1LXNA 3GYXB 3NGUA 2VOOA 3OL6A 2M7SA 4WFYA 4DR7J 1UEVA 4B3RF 4NYZA 1V5VA 5E3QA 2OSRA 3AD9C 3R8YA 2EBEA 2PA8D 1Y5IB 2EC0A 5RUBA 1IBLJ 3OHAA 3AQPA 2J0XA 2KN4A 4UY8T 3GILA 1KHVA 2V2ZA 1J5EF 4EBDA 2Y3YA 3D5MA 2GW8A 1VBYA 3L7OA 4B9UA 2PMZD 2E9ZA 2CQ3A 3RUBL 3SSSA 4LVNP 1F6TA 4YUDA 1X31C 3WQPA 2B9YA 1AA1B 1S59A 1ZH5A 4DLEA 3FMBA 2HS4A 5B0FA 2VFRA 3QYYA 4RW4A 3DLLQ 3EZ5A 3TARA 3ICLA 4URQU 3HCXA 2VBYA 2DO4A 4ECRA 2ZH6A 4OLPA 4PG5A 2ATLA 1CC7A 2GV1A 2DNKA 1FRXA 2DGSA 5EWEA 4MKBA 2W2NP 2YKAA 4LQ9A 3E01B 4RW4B 5CYMA 4ATNA 3R6LB 2QT7A 3D6MB 1T03A 1XR5A 1NNDA 3A8EA 3T1AA 2OPRB 3HJVA 3M8RA 1HQUA 2H5JB 3MFHA 3GZ7A 2DH8A 1T9XA 4NLPA 3MUMP 1K1SA 5KFLA 4R5PA 1T03B 2CRLA 1ZA1B 5CZVA 1X9SA 5AE3A 1KFDA 4FBTA 1UZDA 2BV3A 4AL6A 3T5LA 4YMEA 4ECVA 1HQUB 3AH6A 4WFZA 3QZ7A 1VHFA 2OH2A 3IWLA 4LF9F 1ZPWX 2OHDA 1HHTP 2VJVA 3G82A 3G8QA 2QLWA 1VQ7S 2I5JA 2FY8A 2B0GA 4K4TA 3DRRA 3M05A 2ZH2A 3VZHA 3NP5A 3A3OB 1WG5A 1LFPA 2ZOMA 2A1BA 2J0QD 2I5JB 2FC9A 4LRAA 3QSIA 5LJ5Y 2GVDA 1TKDA 2AWZA 3SCKE 3S6EA 5DM7Q 3VGTA 2RKIA 1UVLA 2EC2A 5A76A 2HZVA 2GVDB 4BC9A 4JV0A 2R8KA 3UPFA 3KLFB 2RKIB 5HQLA 2ASDA 1WG1A 4YR0A 4A8KA 1S77D 4XIUA 1QTNB 4FXDA 1RLCL 2QC3A 4F25A 3CULA 1F5AA 2DGQA 4PEOA 2ADBA 3TZYA 3KJNB 4RWWA 4DCPB 4USTA 2YVSA 2I1RA 4J9PA 2YWEA 3N0VA 1LW2B 1UP1A 3ZFVA 4KV8A 2YX4A 2DHAA 4KGKA 3PJ9A 3OTEA 4X65F 3PX4A 2HIYA 1G4CA 1Q7LB 2CPHA 3ZTQA 4KV8B 2OPQA 5D4NA 3SSRA 2YNFB 2IA0A 3J7YI 2HQFA 2OPQB 2KFNA 1H74A 3CC4S 3OD2A 4B9MA 4DQSA 3UVJB 3WIUA 3GR0A 4IFYA 5D0EA 1ROFA 4UY85 2R7VA 3QGGA 2KG0A 1UETA 4F4KA 1Y7PA 3AB4B 4M5KA 2ZDOA 4IFYB 4KKOA 3LP0B 2CQPA 5DS7A 3LANA 2BUNA 2GZOA 2PIIA 1DARA 3G6YA 2V94A 4CNYA 4JI7J 4J9MA 1NKEA 4XDDA 1K73T 2LMIA 2VG7B 2XMTA 4KKOB 4A8YA 2XY6A 4UF4A 3WX4A 3R2DJ 2X1AA 4W90B 2G2YA 2FVSA 4HHJA 4F3MA 2R2UA 2EFGA 1WJ9A 1S76D 2CKWA 1FNOA 4B3MF 2W7PA 3T9NA 3NEKA 5CZXA 4R25A 4A8WA 1NSAA 3RYLA 1Q79A 5F8IA 2VQFJ 3N5BA 3D28A 1HBNA 5IWAF 3ZZZA 1WOSA 1GTHA 2CDRB 5FD1A 4A8QA 1V3SA 1U2FA 3PIPQ 3A8IA 2DH7A 1HBNB 3GFYA 4FKXA 3CF5Q 4MIAA 1DQ9A 3FZBA 3Q8RB 2W9AA 4K2JA 5DG8A 2ZZMA 2LQ8A 1VQ9S 1V3RA 1WDTA 3M30A 2KU7A 1HBOA 3Q8QB 2HBRB 2C1EB 5HBMA 4Q0BB 2QGFB 1VQ8S 3KUEA 3HT0A 3SCLE 3HHLA 4E0DA 2V8GA 3J7A1 1YSJA 1HNZJ 1HBOB 1X4AA 1TL7A 3QT6A 2K7KA 4USIA 2V6AA 5HBMB 5KFZA 4BS2A 4WTYA 2VPYB 1FT8A 3QNWB 1W25A 3CCJS 3HHLB 1FFGB 3FEZA 3UN2A 2VONA 1SJ3P 2ZITA 1TL7B 2ZJPQ 1N33J 3EZUA 1SJRA 3H5UA 4C6AA 4MYUA 4JI1J 1N5QA 2DGOA 4LRFA 1VRUA 3CMQA 4ZP6A 4DN0A 4YFUA 4C0HA 4P72A 2XSJA 1BQNA 2PFDA 3TRGA 1BD6A 3M2RA 1RA7A 1RBOB 3WHIA 1VRUB 2Q6BA 3NXZA 3AFGA 4EZ9A 4W98A 2VF3A 3JAMU 2XSJB 1BQNB 3MPYA 1X7VA 1IN0A 3M2RB 2VHGA 1VQ5S 1S57A 1B70B 3RGIA 7FDRA 1B7FA 4OI1A 4DL5A 2E9TA 2AGQA 3Q89A 3RAMA 4P2SA 2YWHA 2V67A 2KHCA 2MLYA 4J9LA 3CCTA 2JLFA 3RB4A 4C98A 3PRBA 4OHVA 3H8YA 3ZTRA 4UQTA 3HHEA 2LFVA 2BJ3A 2W4CA 4DV0F 1YZ7A 2VZ9A 3G96A 1RA6A 5ETLA 1ZTTA 3IG1A 4ZVOB 1JNZB 4EMDA 5KFDA 2DR8A 3V4MA 3OVBA 4TLQA 2RUSA 2GJIA 3T5JA 3IG1B 1RAHB 3BJYA 3I5AA 3MCNA 2VIHA 1FF2A 2AJ0A 1NK6A 2YY3A 1CQMA 2XGQA 4N47A 5JUMA 2BKOA 1BWEA 3JTNA 3UI3A 1SC4B 4KGVB 2WTFA 5KFNA 1MW7A 3CXCR 2GGPA 3TX8A 1PJ6A 3MEDA 3B54A 2IAJA 5BYSA 5CYJA 3U1NA 3C2PA 1U7LA 3CCRS 4FDFA 4RBUA 2GGPB 3HT3A 2KZZA 2E1PA 3MEDB 1LWEA 2HFVA 3IR6B 3O44A 2IAJB 5HMWA 5LSLA 5KFKA 2V4JA 4KC5A 2OPPA 3K5OA 4LF2A 4NLVA 4GO5X 4YQWA 2KVIA 5HQ8A 4C8MA 5L8RC 1JXEA 4MK7A 2WVBA 1N56A 3DXSX 3KHHA 1B4SA 2V4JB 2OPPB 3OFHA 1RT4B 2A10A 2Q66A 1HI0P 2Z2YB 3DOMB 1RAJA 1TK0A 1C1CA 2EEYA 3HHDA 4C8KA 4ZK7M 1Q82T 1K8AT 2BANA 2HK2A 4ZP9A 1FE4A 1MROB 4OQJA 1C1CB 4GVBA 3DRXA 2XMMA 3KLEA 4LMZA 1IBCB 2BANB 1NK0A 1X4GA 1FKPA 1HQEA 4DUTA 2CG4A 3LTOA 4PWWA 1ZZFA 1UVNA 3TUIC 3JQMA 2DY1A 2MQLA 2J7UA 1XMOF 2B7CB 4WP8A 2MQNA 3ZC4A 3KLEB 2D9PA 1ZYQA 1Q86T 2FY1A 2ATCB 2QMUB 2LDYA 1JKHA 1FKPB 1HQEB 2OMLA 1HW8A 5C25A 1RWPB 4IDKA 2J8AA 3BGLA 4K5SA 2BXJA 4LFCF 4FVCA 5DJBA 1JKHB 5C25B 4IDKB 2GHVC 2IVFB 2HNZB 2XI3A 1FRKA 4ENOA 1KS2A 4FPRA 2IM0A 4I6YA 2N3OA 4KAIA 2HRYA 3QLHA 4HYKA 5IT0A 1S1TA 4NXNJ 1WOOA 4NLDA 1KNZA 3ZO7A 4DV6J 4Y34A 1UL3A 2B9EA 4JI8F 3Q86A 2HHWA 3KHLA 1S1TB 2O1PA 4RL1A 1FJEB 4M5NA 3OW2R 2ADCA 4ALZA 1KBRA 2O3DA 3NGKA 1M5KC 2M2BA 3HVTA 3BKTA 4F0HA 5LMUF 1I6JA 4X4QA 2JX2A 1YJVA 2IDLA 2PN6A 3CCSS 1S9GA 4JI0F 1RTDA 3HVTB 1AYEA 3GJQB 4IUFA 3AXMA 4ZCLA 4RPFA 2XM3A 4CLKA 3EX7B 2CVEA 3RZAA 1F1BB 1S9GB 1RTDB 4DL3A 3CJKA 3GWCA 2PT0A 1T95A 1RWKB 4NLTA 4ZIWA 4F4AA 3VQSA 1SL2A 4QIWD 4ZCKA 2OLWA 1D9FA 2GA7A 5C2GA 3NAHA 3CJKB 4FVMA 2HFZA 1AFJA 3FVYA 4WYLA 2B4OA 2NYHA 4O0IA 2FZKB 2UXCF 4OZ0A 5KT3A 1PG5B 1QDUB 3T1HF 4DJBA 2GVZA 2MZSA 3SEOA 3BN4A 2MKCA 2ZJQQ 4OYWA 3PYFA 1R89A 1DRZA 1NZAA 2JVOA 2QL9B 3SV3A 5IT9U 3T6JA 3AOBA 2GVZB 4GO7X 3OV7A 3VF0B 3VGVA 3MR6A 3CDAA 4NCAA 1X5OA 4N7TA 2G4BA 4KH1B 1WNEA 4M94A 5KG6A 2J8SA 3GQCA 5DGAA 4Y6IA 1HHSA 2LA6A 2CWKA 1S0MA 2E1MC 2UVWA 4JI3J 2F4VJ 5IQQA 1B0TA 2M8DB 2HZAA 3PYEA 2EPIA 4DQQA 3WDOA 4HVZA 4BWJA 4P7TA 4DL0C 2I9SA 1C0TA 1RDRA 3M8QA 4DUZF 5BXIA 3IN5A 1VQKS 4DX5A 2RS2A 2DR9A 1Q4RA 3P8BB 1AUSL 2PA3A 3FEYB 1U1OA 3P5TL 3ZZPA 2RS8A 3M8QB 4FF2A 5IC6B 2XMKA 2RU3A 2EI5A 2DNLA 3AODA 1FXDA 1RWUA 2HQCA 3MMJA 2NPFA 1TL5A 5AJ3F 3W5XA 4I64A 3M6WA 2GIQA 4ZPBA 3CSKA 4KYZA 2BKNA 2CNNB 5GAHU 1XQIA 1YVFA 1D8YA 3CDUA 3L3CA 4DV2J 3UD5A 3C46A 1N34F 2NUHA 3OJSA 4J9UE 3JAMY 1UAWA 4KE5A 1D9DA 3M4XA 1LOUA 1OS5A 1FVQA 4G6VB 3ZXWA 1RCXB 4WYWA 4RBVA 2XLKA 2YQ1A 1N0VC 3G2XA 1VK3A 8ATCB 4YB7A 1KOHA 3V5RA 2JRSA 5BR8F 2A3JA 2ROPA 2PDAA 4A8MP 3ETMA 7FD1A 3R3TA 3R27A 4IRCA 3HD2A 1G3OA 1T9VA 1RT2B 5AXKA 5LSOA 3NS5A 4JYAJ 2ZOFA 3MWBA 3BN7A 3QGPA 4NPOA 3FCHA 3ITHA 4WXWA 2OTLS 3MUVP 1EQMA 1UVMA 2WK4A 3M2UB 3L4BC 1N48A 3IWNC 4B9NA 3TJ9A 4QWAA 2YTCA 3ITHB 1EZZB 2HVZA 2UXDJ 1WC4A 1QJHA 1WC0A 1CLFA 1FRMA 5B0GA 4ZN3A 1NUEA 3C66A 5KFFA 3UR3C 3VAJA 3BH6B 4F3QA 1SCJB 3ETOA 4OYAA 4UUXA 4YY3F 1RHQB 4I6WA 4F4WA 4OX9F 4OFZA 4GC6A 4HI2A 3QBCA 4PXEA 1KC8T 1HYSA 3TZXA 4F4ZA 3EVOA 1V3ZA 4DLGA 4ZHRA 4WIIA 3H42A 2NCKL 4IQXA 2V9WA 2GX8A 4RZRA 1Q5VA 1NXIA 2MQQA 2O66A 3L7PA 1XBWA 1RK8A 3V6KA 3EJMA 4ZHRB 3TI0A 2KHDA 2B7BB 2AW0A 1SC1B 1HI8A 3BGRA 4OL8A 2HFSA 4AUKA 1L3TA 3OXLA 1U25A 2MQ8A 1M5HA 5KT2A 2EKNA 4KO0A 3JTPA 1JNRB 1MN9A 1LEOA 2DKOB 5CA5A 2F5GA 1VLYA 3BGRB 3P5BP 2NQPA 1HI1A 5L39A 4NLXA 4JI4J 3MM6A 4KO0B 4WBFA 2PC6A 2B6AA 3ILOA 5H9EJ 1D3WA 2MKHA 4BHQA 1YQHA 2GQCA 1LWCA 4CRJA 4TYAA 3MM6B 2UXBF 1VK8A 5D0RA 1O51A 2B6AB 4QCLA 4XK8C 4ZITA 1ACMB 3IRXA 5KOWA 2C3YA 4LF5F 3Q23A 1LWCB 3BH7B 1S10A 4WWSA 4OI0A 2B8QA 1KLNA 4DV1F 2RE1A 1UFLA 2XZTB 3IRXB 4ED7A 1NKBA 4NLRA 3M6VA 5H9FJ 4ELTA 2G13A 1RSCA 3TZWA 3N28A 1OY6A 1E6YA 2V9KA 4YR3A 3GG1A 4TU9A 5LMNF 2RRBA 4RNMA 2KYZA 4JI6F 2IDEA 2XCPA 3CMAS 2VKZG 1E6YB 2XNRA 2EW9A 4KIAA 2V69A 4C8LA 1RT6A 3MM9A 1F9FA 5J1NA 1FA0A 3CDBA 4GVLA 4DSEA 1NCLA 2KM8C 4X64F 1CULA 1FWKA 1N5YA 1RT6B 3MM9B 3MFIA 4OZ2A 4LSZB 1IR1A 1VYAA 4Q45A 2ZKTA 4RLEA 2DY9A 5DLFA 1CULB 2VOPA 1Q8IA 4FBUA 1REGX 2OEMA 4ANEA 3HSZA 2DITA 1J27A 1XEZA 3KFWX 3CEDA 1N5YB 3WX8A 2MKSA 4ZN1A 3IWXA 5KTQA 1HKAA 4AT1B 2R8HA 2FJVA 1N6QB 2V2QA 2ZDPA 5DQHA 3DYAA 4KHPF 2X3DA 4HACA 4OHYA 4AQYJ 4LF4J 2F8EX 3FEXB 4DR3J 1YBTA 5ETOA 1JK9B 3DYAB 1DFDA 3D7SB 4H54A 2LQBA 4YHHF 4HACB 1H98A 2WBMA 3U7JA 4M5HA 4ED6A 3MAHA 3Q8SB 3VV2B 3OUYA 4X4VA 2VG5A 4MTPA 3QWUA 2Y8WA 4EFAC 4ES1A 2JJ4D 5L46A 2LCWA 2EFQA 1RU1A 3DRPA 5CD4H 4ED8A 3TANA 3GV8B 3OUYB 1RT5A 2N7YA 4A8OA 2C42A 4OZ3A 4MIBA 2LXFA 3R5GA 1RU2A 1T9YA 3OFEA 2LYVA 4ED1A 4X4RA 2FUG9 3DRPB 1IJEB 2HW3A 1RT5B 5JMNA 4B3SJ 2RIJA 1OJ4A 1FXRA 2AYEA 1UWBA 4KJIA 4MKVA 3MM5A 3LUYA 1FRIA 5IT9Y 4HDHA 1OY9A 2IPOB 3BF4A 4FKYA 4GKKJ 2DR5A 1VJQA 3NGDA 1UWBB 4LFBF 2VQEF 4EI2A 2P5VA 2HS0A 3MM5B 3CMES 4DQPA 4K4XA 3ZZUA 2KDOA 1PO6A 2OAUA 1N36F 2CNKB 1DURA 5KT6A 4J90A 4LBHA 3O2IA 3CCQS 3FQLA 2BDPA 2XMAA 5E3AA 4GKJF 1FRLA 1PYSB 2E5LF 5F9LA 1UA1A 4L3KA 3AAWB 2O5DA 2F63A 1NZ8A 3EM1A 4U67Q 4Y00A 2V2KA 4KB7A 4CM0A 2B5JA 3CWJA 2VFSA 3WC2A 3P49B 3R5BA 2ABYA 3I6PA 3ZNJ1 1XMQF 1PC5A 1R31A 4ECSA 1KVKA 2B5JB 3LPYA 2Y8YA 3DGPB 4M5DA 3AJDA 1S72S 4LVOP 1SI9A 1YJ9S 2QA1A 2JZ5A 3GFHA 1TFYA 2VPXB 3J81Y 1XN9A 2GQ2A 1TFWA 2NXEA 2XMVA 4NEYA 4RKUC 1ZETA 4M5DB 2AF6A 5L1JA 4U9RA 4WTOB 2JEFA 2GO8A 1YJNS 4FZVA 1TUWA 1IUJA 3IMQJ 1FFSB 4PWDA 2ASJA 2LQ5A 1V6HA 1RHUB 1V5IB 1X4FA 1OSCA 4OYOA 3GE9A 5FDLA 3E8OA 2HZCA 4L6V3 2ZBIA 5ETVA 2ZM6J 4EYHB 4PWDB 1HWKA 1JXVA 2U2FA 1RAFB 4UZBA 1F2HA 1QM9A 5F8LA 1GQEA 5FDLB 4DR4J 3HLUA 3FZ2A 2AEMA 2ZHOA 4HTJA 1SPBP 2DK2A 4M8LA 2K2PA 1REVA 1QUPA 5T41A 2W25A 2VC1A 2R42A 4O4GA 1HMVA 5ETSA 4F4YA 1S1WA 1NAQA 2DXDA 3ISND 2R2TA 1S0VA 3EVWA 6AT1B 4UQGA 2YWGA 4O4GB 1JJCB 2ZC4A 1HMVB 3C16A 1UVIA 1S1WB 3BO4A 4QIGA 2CPFA 2HHTA 5BYQA 1GFWB 4LSNA 2AEJA 4G1PA 2AGOA 1M5SA 5AE1A 3HFZB 3BSOA 1RB0A 1VIOA 2NSCA 3A1YG 2H3EB 3ZZTA 1EETA 5DDRC 4LSLA 2JC1A 4N56A 5L1LA 3MI7X 4ECWA 4LSNB 1CJTA 1RAAB 4DCOB 4V19X 4U95A 3QATA 2XSFA 4LF6F 4L74A 5H1SV 2C2EA 1EETB 4LQ3A 5IT4A 2EBGA 3CTRA 4NLWA 2R7SA 4P2FA 4ED3A 4E2FB 1P8GA 1BGXT 2M4MA 4DSLA 2HRTA 1RKIA 3OTOJ 4N76A 2B4PA 1IBKJ 1UFKA 3W9IA 2MDAA 3HI9A 3CJ8A 5KFRA 1FEEA 4NMLA 5MLCV 4CH0S 4EK2A 4BC7A 1DTQA 1O0PA 2DXFA 1D1UA 2CG8A 1GXLA 2BEFA 4ZVQB 3PIOQ 3FDSA 1DTQB 5T7LA 4N5SA 4QR0A 3FBFA 3JTOA 2JWNA 4EU0A 2VPZB 2XMWA 3BDEA 1U1LA 2PGCA 4W92B 4CO4A 2RT3A 2EFOA 3DKDA 3MMCB 2ZVIA 1J2VA 1O5JA 3EPIA 5T7LB 3I56S 1S9EA 3SMZA 2D69A 5E0OA 1H7XA 1UPMB 4KSEB 4KBIA 1SKUB 2HBQB 1HWLA 4K8RA 5FJ4A 1D0EA 4USVA 3UCZP 1S9EB 4TQRA 1U6ZA 4DV3J 4X66J 3CGIA 1RADB 3MF5A 1NLKL 5E3RA 1FTCA 3QSYB 5D0GA 5DLGA 2CQBA 1FJ7A 4DFJA 2UU9J 3THPA 1IQZA 2WVEA 1AW0A 2BBEA 1SXLA 5KFVA 3Q8PB 4AE5A 2IJNA 4PKDB 1PBUA 2YNGA 3OFFA 2B3TB 2AGPA 3QQCD 3RBZA 4WP3A 4X4SA 4ECXA 2ROEA 2MKIA 4F8RA 3AXKA 1FRHA 2YNGB 2R7WA 3TOQA 4AL7A 3Q83A 1NBEB 3KMSA 2AT1B 2L08A 2V4RA 1CG2A 3OBIA 1S99A 1N54B 3HVAA 3KJVA 3SFGA 1RI7A 1T02A 2BJ8A 4C3LA 4WE1B 2WVDA 5EDWA 2VBWA 3VALA 3KJVB 2CJKA 3I87A 3HF5A 1T05B 1HNWF 3PFOA 1OYDA 1CJKA 1Z1ZA 4CCHA 3PO4A 3M8PA 1QD1A 1OIAA 1EKSA 2DISA 2OFGX 5ADZA 4ZA1A 5F3ZA 1U1KA 1NDPA 1J5EJ 3CJSA 1CJKB 1KFSA 2HGLA 3C19A 3MMAA 3M8PB 1UZHA 4I56A 1T11A 1Y9OA 2B9WA 4QPTA 3K57A 3KDOA 4X84A 2NXJA 5J2NA 3MMAB 4XO0A 2D7SA 4K7QA 4CNZA 3TJ8A 1SJQA 3IBWA 1EJ7L 4NLUA 1UJ4A 5F8HA 5J2NB 5LSRA 3QT7A 2MSSA 3TUZC 3D66A 4H4KC 4NXMF 4I2PA 1DJ0A 1YK9A 3CC2S 2XY5A 4JV1A 4JI7F 1P9QC 3LWMA 3BV8A 4ID5A 1HLWA 4HHUA 3KNGA 2OPSA 4UOGA 4K4YA 2DGVA 2WCXA 4G3IA 1OY8A 1LW0A 4ID5B 5D4OA 3Q22A 2OPSB 1B0VA 2I38A 1DY3A 2MZRA 2L9WA 2VQFF 1A9NB 1JLGA 1OSDA 1LW0B 1WTFA 2YNHA 1FDBA 3KLIA 3K8VA 4LF9J 4RU2A 1QSSA 2MEWA 4DSJA 1S7IA 2R3VA 3RU0A 2ZH8A 1QSYA 4TYBA 1KR4A 4RNFA 3NCQA 2A2DA 3GJTB 5U47A 2BACA 2ZBQA 2H48B 3IO1A 2YNHB 1S1UA 1JLCA 1JLEB 3KLIB 3M1VA 2I6WA 1H7WA 2RQCA 1KP6A 1S1VA 5E41A 4CLUA 3DMJB 4BDPA 2GC8A 2OI2A 3OSPA 2BJEA 3KNAA 3H5SA 3UD4P 1JLCB 4HR2A 4USKA 2EWHA 3PDNA 5K8MA 3M1VB 4KY3A 4U7UK 2PFFB 2VV5A 1IKXA 1S1VB 3VVTA 2CQGA 4ZVRB 1HNZF 4QOTA 4ZKAA 2R4FA 4LREA 1RJJA 3MXHP 1YRTA 2ZD1A 2LXIA 1IKXB 3N6NA 4IH6A 2IMWP 2HVEA 5IOLA 3NWGA 1U48A 1TK8A 3M8SA 4OHZA 4EO6A 2GMJA 1N33F 1JX4A 4D3HA 1U49A 3GTYX 4U7UD 2ZD1B 1X4CA 2ZNYA 4JI1F 1TP7A 4QWBA 3THVA 2N3LA 2HAIA 1RAEB 5DG9A 3VAIA 4K50A 1LNQA 3QJPA 2JFKA 3I9ZA 3I82A 3I0SA 4NLYA 2ERRA 4CO0A 3S01A 1Y10A 4DV7J 3D2WA 1IWAA 1H3DA 2PI5A 1ITPA 1WHXA 5HAOA 3I0SB 3HVRA 1RABB 3TA2A 3R7BB 1Q53A 3CVKA 1AB8A 4X65J 4B17A 1K0VA 2HGNA 2DHSA 4LF8J 3SQOP 2UUAF 2UUCJ 5BYRA 2W9BB 1H38A 1R8CA 2FD2A 2KYXA 2WW4A 4U8YA 4WCEQ 1VLOA 5L9NA 2YWFA 2N4CA 3N6MA 3M32A 2C3PA 2AJ2A 2CUYA 4ZJLA 3QJLA 4IO1A 3RB3A 3D6FB 4C8OA 4OMFG 4MFBA 1Y0HA 1HBMA 1QTMA 2EVZA 4MJKA 1YJTA 4F2RA 4DR2F 1OWXA 5J1PA 2YH0A 4MFBB 2QSFA 4DPUA 4PRFA 1NDLA 5HJXA 1TL4A 3M9OB 3HK2A 2QYCA 4YS2A 1WI8A 5A2QU 3UNGC 1NEEA 4B3MJ 3JQKA 4OI4A 4RW7A 4J9RA 4O0NA 4J37A 3P45B 2QLJB 1N5VA 5GMEA 3ENVA 2HWTA 1YZ6A 4L75A 1C1BA 4RW7B 2E5JA 4Y28C 2UV8G 2EXUA 3CD7A 1GXTA 3PVXA 2MLXA 3SCIE 1XR7A 4B3TJ 1T7PA 2HLUA 3V81A 1H73A 2BJ9A 3KUHA 1WKLA 1HBUA 3ELHA 2C22A 1PC4A 2D3UA 3FKBA 2D9OA 4EYIB 1F5BA 2XHWA 1RGVA 1M0SA 4GC7A 2R8IA 1Z2LA 3V81B 4JI2J 3UE2A 1HBUB 2Z58B 2X1BA 2R7RA 2E1AA 1CEZA 2K3IA 1R0AA 3MR5A 2Z30B 4TKTA 3H2LA 4PG4A 2SXLA 2QA4S 3PR4A 3LPEA 3JB9k 3OT9A 4YB6A 4FN5A 3VAFA 3MOJB 1R0AB 4MKYA 2F3JA 1FXLA 3F73A 3CDEA 2RILA 4AXJA 3PACA 3FSXA 3OFGA 3D9BA 5I42A 5LOQA 2GCFA 3UFCX 4JV5F 2K1RA 2W7OA 1A0OB 3O5TB 3PV8A 2KXNB 2C2NA 4WU3A 3TW0A 2CZ9A 3SSQA 3RR7A 2E1CA 4AD6A 2JVRA 5GAGU 5I42B 1G1XA 2K1RB 2N82B 3PYGA 3BQ0A 2CPEA 1QVFR 2CPZA 5IFMA 4WIQA 3B6BA 3W63A 5KG7A 2JEJA 2M9KA 3EPGA 2APOA 2WSCC 5EUHA 2FHKA 4DS5A 4KHMA 2DNZA 4W4MA 2OMOA 3MAAB 1VDHA 2Y1JA 3PEHA 3OR2B 4DSKA 4UT4A 4ITSA 2KI2A 1B3TA 3OTCA 3EGNA 4IOAQ 1PYOB 1B99A 3R2CJ 3JSMA 4ED2A 3MCMA 4DV6F 2RQ4A 3GSIA 4F04B 2CJBA 2ZUGA 4I6AA 2HHVA 4DV0J 1R7IA 3MPWA 1RWWB 3PR5B 3JSMB 4HT5A 4DX6A 3HKZD 1S6PA 2DJWA 2HURA 3BO2A 5I3PA 3PG9A 4ZVSB 1VQLS 4K4UA 2CJXB 1S6PB 5EWGA 2OIHA 1EB0A 4N8OA 2KZMA 2YKQA 4CI0B 4OHXA 1RWNB 3CJQA 1SKWA 2BQUA 3V2UC 1NB2A 3QAUA 3LH2S 3C6UA 4X4OA 5C24A 1MWYA 2VU5A 2YKOA 3T1YF 1XNRJ 1Q1KA 3TAMA 4B9VA 1YIJS 2LDIA 2CQ0A 4RR5A 1VC5A 3C6UB 1TAQA 4JOUA 5C24B 4DF4A 3OVSA 2RVJA 5DDPC 1R8AA 2H65B 4G65A 1HPZA 3TAMB 3GCXP 3PRDA 2HK3A 2Q3PA 1RHJB 1SB6A 2CNLB 1G7CB 1A6LA 4M5JA 5CCMA 1AXQA 5KAKA 1DHMA 1HPZB 4PYDA 1WHWA 2V5HG 3ONQA 3QIDA 3HSDA 3D0HE 2FQQB 4XDCA 3OL8A 4M5GA 3P96A 2R9LA 2VL1A 1XWLA 3K7RA 3BO3A 3BPDA 1Q16B 2CXEA 4DR5F 5E5NA 2ALZA 4IG0A 1UTAA 3GIMA 3LGHA 2ZZNA 4DV4J 2L9DA 3LW5C 2RDIA 2V68A 2PEBA 1T8EA 4DF8A 3D4JA 3RW6A 5E7OB 4IG0B 1T0TV 3T6BA 3MD1A 9ATCB 1S49A 3X3UA 3CUNA 3VAGA 2O67A 3U02A 3HVWA 4I2QA 1XMOJ 2CA9A 2UZAA 3RRKA 3FSYA 3L95X 5CYMB 2JEIA 4Z2XA 2UVVA 1FO1A 4A46A 4I2QB 2HQGA 4DL6A 3NNCA 4HKQA 3TEHB 1FVSA 1KQGB 1R3NA 2HHPA 3IM9A 3GIJA 4LFCJ 4ES2A 2W7AA 4R5PB 4DL2A 3FUYA 4WKYA 2MZ1A 2E7VA 3UO0A 4DV2F 2E5IA 1YTYA 2WSFC 3SCJE 1ZPVA 2X1GA 2WB4A 1MMLA 2JC0A 2LLZA 3NCRA 2C2DA 5GAEU 4NLOA 1B7YB 2QX0A 3G82B 4WKRA 4A47A 2ZUAA 2DNRA 3KJFB 3DRRB 3I5BA 4OIXA 4EUVA 4JI8J 2NS1B 4C3MA 4IO9Q 4LR7A 5DZ7A 1EP4A 1SJ4P 3M6UA 4JYAF 2FLLA 4TVAB 4LUBA 2VB6A 1K0TA 1VQPS 2CADA 3PTWA 5F0UA 1EP4B 4FNIA 1K44A 2WONA 5J2PA 1RACB 2DGUA 3GFZA 2B9XA 3NOCA 5JJBA 5KG5A 1BE4A 2I0XA 4C48A 3T5KA 3ILJA 4JI5J 3CJTA 1S6OA 1ULRA 4ZVGA 1HR0F 1NK5A 2WONB 1TR0A 3PCOB 5J2PB 1GH8A 4LRBA 3HZGA 4H4OA 1M5PC 1P9YA 1D09B 4ZJOA 1IKWA 5AXNA 4P52A 4R0EA 2C2KB 4R8UA 3AD8C 4RUBA 5A2QY 4H4OB 5HROA 1IKWB 2XLJA 2HFOA 1X0PA 4R8UB 4IYQA 2ZH4A 1D8ZA 4ZVPB 3IAS9 1H0HB 4NLSA 2GMHA 2UXCJ 1Y11A 3KJQB 5HROB 2F8MA 2A18A 4OYPA 3T1HJ 5HMYA 2AQ4A 5B0EA 5A8WA 2RHQB 3AJ2A 4B02A 4F26A 3OSNA 5KFSA 3DLGA 1B64A 3BYRA 2GIFA 3LQVA 5A8WB 2YNIA 4CLTA 1Z2ZA 5GADI 3RB0A 3LF0A 3DLGB 1URNA 3TVKA 4Q8EA 5KFQA 1VOMA 2YNIB 1U1QA 2DBBA 4JI4F 3RBDA 1VMBA 1VBKA 3H5YA 2JH3A 1FTRA 3N4WA 4DUZJ 3HSJA 3DU5A 1XJWB 1QAJA 4HTIA 3SI8A 3CCZA 1GMWD 1RHMB 1EHWA 3ILLA 5ETRA 1HQ2A 1RT3A 3CIMA 2CVIA 4QU6A 2HLTA 1TUVA 5FLXU 1U0HA 1RT3B 2G0IA 4QYRA 1LK7A 2F65A 4IOBA 3W5YA 3OHBA 1U26A 1U0HB 1N34J 1ZS6A 3EUNA 1SH2A 1M5VC 3LALA 5IM0A 4U96A 4CM2A 2B4UA 2RNEA 1PGZA 1WACA 3DM2A 4ZP8A 4IOCQ 2ZH1A 1HNXJ 3H2UB 5IM0B 3WBZA 4DL7A 1AUDA 2XZDB 3PX6A 5L9XA 4QIFA 3GCWP 4QZVB 2RSQA 3D6HB 2N7CA 3BKUA 3DM2B 1FJGF 4TLRA 5H9EK 4HH0A 1WEZA 1I5OB 1R8BA 5J2MA 3J7AN 2E5HA 3M30B 2XO6A 4OZ1A 4G1QA 4ZPDA 5CAAA 1RHKB 2IYGA 2PI4A 3MAQA 2WOMA 3W9HA 5J2MB 2VJUA 2D41A 1XNQJ 2GIRA 4G1QB 4KRWA 3DXBA 1IKVA 4MMOA 3FQKA 2RF2A 2WOMB 1UMJA 1IXKA 2YWKA 1XR6A 3VWSA 2BYCA 1RT1A 4PG7A 3QJJA 3T41A 1TAUA 1U45A 2QO3A 1IKVB 2FHMA 3D3CJ 1SBRA 4ZVEA 4AQYF 4LF4F 2RF2B 3BQ1A 3H7HB 4KGZB 2AKWB 1RISA 1R8HA 3UQSA 2JLGA 2BOAA 1RT1B 4Z7CA 3HHNB 3QRPA 2BMBA 1F9HA 3MPUB 1UW9A 1S1XA 3NGRA 2K8GA 4R0JA 4DUYJ 2IC3A 2QFIA 3HFVA 4DCJB 3J7YU 3QGHA 3H0PA 4UOCA 3W60A 2IC3B 4OYIA 2KJWA 4PQAA 1R8PA 1ZAVA 4ELVA 2H54B 2K7JA 4PABA 4L72B 2YX1A 1RXOB 3KHGA 3QRRA 1QAIA 2CAJA 3CT9A 2DIVA 1R6YA 1H2VZ 3VTIA 4USWA 2RDDA 4CLZA 1RTHA 2QA4G 4B3SF 2PMWA 2XS7A 3OL9A 1YBUA 4DV5J 4NA1A 1T9WA 2R2SA 4Q2LA 5CYQA 5D8HB 3W61A 2M88A 1WHVA 4A8FA 2DO0A 2FZGB 4I7FA 1C2PA 1SJ1A
chains in the Genus database with same CATH topology
3P45B 2QLJB 1I3OB 3SIPB 1RWWB 3D6MB 1RWPB 2H51B 2HBQB 3NS7B 4DCOB 2C2MB 1RHQB 3R7NB 2XZDB 3GJQB 2H5JB 3R6GB 1RHRB 1RWOB 2CNOB 3P4UB 3RJMB 1I51B 4ZVOB 2CDRB 2H4YB 3D6HB 1QTNB 4DCJB 2FQQB 4LSZB 4ZVSB 2C2KB 2HBZB 2Y1LB 2CJXB 3D6FB 1RE1B 1RWKB 1F9EB 2XYHB 1ICEB 1SC3B 4ZVTB 2H5IB 2XZTB 3GJRB 1RWNB 3IBFB 3KJNB 1RWXB 2H54B 1RHMB 3GJTB 4DCPB 1RHKB 2HBRB 2QLBB 1RWMB 2C1EB 3KJFB 2H48B 1RWVB 2XYPB 3EDRB 1SC1B 1PAUB 4ZVPB 3EDQB 5IC6B 4ZVQB 4ZVRB 2QL7B 2C2OB 2QLFB 5K20B 3KJQB 5IC4B 4JB8B 2CJYB 2Y0BB 1QDUB 4ZVUB 1SC4B 1IBCB 3IBCB 3R7SB 2CNKB 2DKOB 3R5JB 2XYGB 3R7BB 2C2ZB 1GFWB 1PYOB 2CNNB 3QNWB 2QL5B 2H65B 2P2CB 2QL9B 2HBYB 1BMQB 3GJSB 1RHJB 1RHUB 2CNLB 2H4WB 1NMEB 3R6LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P45 B;  2QLJ B;  1I3O B;  3SIP B;  1RWW B;  3D6M B;  1RWP B;  2H51 B;  2HBQ B;  3NS7 B;  4DCO B;  2C2M B;  1RHQ B;  3R7N B;  2XZD B;  3GJQ B;  2H5J B;  3R6G B;  1RHR B;  1RWO B;  2CNO B;  3P4U B;  3RJM B;  1I51 B;  4ZVO B;  2CDR B;  2H4Y B;  3D6H B;  1QTN B;  4DCJ B;  2FQQ B;  4LSZ B;  4ZVS B;  2C2K B;  2HBZ B;  2Y1L B;  2CJX B;  3D6F B;  1RE1 B;  1RWK B;  1F9E B;  2XYH B;  1ICE B;  1SC3 B;  4ZVT B;  2H5I B;  2XZT B;  3GJR B;  1RWN B;  3IBF B;  3KJN B;  1RWX B;  2H54 B;  1RHM B;  3GJT B;  4DCP B;  1RHK B;  2HBR B;  2QLB B;  1RWM B;  2C1E B;  3KJF B;  2H48 B;  1RWV B;  2XYP B;  3EDR B;  1SC1 B;  1PAU B;  4ZVP B;  3EDQ B;  5IC6 B;  4ZVQ B;  4ZVR B;  2QL7 B;  2C2O B;  2QLF B;  5K20 B;  3KJQ B;  5IC4 B;  4JB8 B;  2CJY B;  2Y0B B;  1QDU B;  4ZVU B;  1SC4 B;  1IBC B;  3IBC B;  3R7S B;  2CNK B;  2DKO B;  3R5J B;  2XYG B;  3R7B B;  2C2Z B;  1GFW B;  1PYO B;  2CNN B;  3QNW B;  2QL5 B;  2H65 B;  2P2C B;  2QL9 B;  2HBY B;  1BMQ B;  3GJS B;  1RHJ B;  1RHU B;  2CNL B;  2H4W B;  1NME B;  3R6L B; 
#chains in the Genus database with same CATH topology
 5HAN A;  4RUH A;  1U1M A;  1U02 A;  5CYQ B;  1XK8 A;  2ZJR Q;  4DG1 A;  1MWZ A;  4FF4 A;  2UXB J;  4K59 A;  3DGV A;  4I7F B;  3CDW A;  1Q78 A;  2CNO B;  2WVF A;  4O4R A;  2NSB A;  3BM7 A;  2W8K A;  1SIZ A;  4DG1 B;  4F50 A;  2ZVS A;  1OPZ A;  2MZT A;  3MUR P;  5B7W A;  2IM2 A;  4QU7 A;  3HZE A;  2Y9H A;  4DMZ A;  1UW4 A;  3EYZ A;  5F41 A;  2RHS B;  4BLG A;  3SQG A;  2ZEJ A;  4ILL A;  4JB8 B;  2LEP A;  4ZVF A;  1YWX A;  1X5S A;  2VDI A;  4F3O A;  1U6B A;  4QIV A;  1NK7 A;  5K8P A;  5LMN J;  3IGN A;  2P9G A;  3SQG B;  2C28 A;  2EG1 A;  1NHK L;  4Q43 A;  1QE1 A;  4OYB A;  3NY0 A;  4P74 A;  4UOF A;  1LWE B;  1ZZN A;  3TR5 A;  3V6J A;  2BR0 A;  1A7G E;  1KOO A;  3M8W A;  1QE1 B;  1TKZ A;  5M2U A;  3JSY A;  4MK8 A;  3GG0 A;  2BKP A;  4OYM A;  4DX7 A;  2V4Q A;  5F8N A;  4G1I A;  5KOX A;  3W1Y C;  1SH0 A;  4IR1 A;  3QWP A;  4P75 A;  2M70 A;  3EXY A;  1UPP A;  1SQG A;  1F9E B;  4ERD A;  3R97 A;  2BE9 B;  4TXS A;  1NDC A;  4URS A;  4OI3 A;  2I2Y A;  4MKA A;  4KHP J;  3GR1 A;  4GVB B;  5HVG A;  2C2O B;  4ZCI A;  1CJU A;  4LF7 J;  2ZH3 A;  1HHQ A;  3HP6 A;  3MPV A;  5F0W A;  3W2W A;  4KGM A;  1BLU A;  2DRD A;  1EKR A;  2OSQ A;  1KRP A;  4NZ0 A;  5HN0 A;  2HHS A;  4M5L A;  1CJU B;  1W2I A;  3CCW A;  4F67 A;  5A8K A;  3Q24 A;  3W2W B;  1X5T A;  1KKH A;  4NCB A;  3B78 A;  5A8K B;  1U47 A;  1X4E A;  4CWB A;  2VUG A;  2MST A;  3CE8 A;  4Q2M A;  1UEK A;  4DFM A;  3CCV S;  2AD9 A;  2K06 A;  2Q79 A;  3NMA A;  3BGF A;  1PIE A;  2IJR A;  8RUC A;  3F41 A;  4B9L A;  2UVR A;  2J7K A;  4Y2I A;  1R0B G;  4OZN A;  3RRH A;  3QLH B;  3CD0 A;  4Y0F A;  2FVP A;  2CQ2 A;  3CJ5 A;  2W2O P;  4UTG A;  3HJF A;  1QVG R;  3OTO F;  4P10 A;  3RRG A;  2UUB F;  3J80 Y;  2LA4 A;  1UEU A;  1YIT S;  4AXI A;  1RT7 A;  1XIQ A;  5A6P A;  1YJW S;  3IR5 B;  1NK4 A;  2IRX A;  1S0N A;  2ILZ A;  1W26 A;  4NI2 A;  4F0M A;  2GQQ A;  3HX9 A;  2MKJ A;  4DR6 F;  1KLM A;  2E5L J;  1RT7 B;  3KK3 A;  1G6B A;  4M95 A;  1M90 T;  1VBZ A;  5EGY A;  2LEC A;  1UVJ A;  4NI2 B;  1SC6 A;  4IG3 A;  2HHX A;  1BUX A;  1KLM B;  5FLX Y;  3W62 A;  1RLD A;  2V8D A;  1MMD A;  5K9F A;  2KXF A;  4I0W A;  4I1T A;  3ZZY A;  3AQO A;  2W1B A;  2MQO A;  5IZH A;  2X51 A;  5ETM A;  3E3X A;  1TKX A;  4DV3 F;  4X66 F;  1S4F A;  3CJ0 A;  1IR0 A;  2FC8 A;  1N88 A;  4X4P A;  1YKW A;  2ILY A;  3GPA A;  5KG2 A;  2Z2L A;  1BY9 A;  3MZI A;  4OV6 A;  2ASY A;  3HFK A;  1TKX B;  4OJG A;  2UU9 F;  2QIF A;  3MMB A;  2FGO A;  2HGM A;  3CD6 S;  2GHP A;  3S7R A;  3IXQ A;  2MLZ A;  1JJH A;  2HVI A;  3GON A;  3V6H A;  1FWP A;  4NLG A;  1N0U A;  5D77 A;  1VIS A;  4DX8 H;  4Y2M A;  4RWX A;  1M1K T;  1FD8 A;  4D3G A;  4K4S A;  4TU7 A;  1NME B;  2DNH A;  1KEK A;  3POT A;  1NM2 A;  1EIY B;  1PSD A;  3NMR A;  3U1M A;  1U2R A;  1VQO S;  4KHR A;  4OI2 A;  1S7H A;  2JSX A;  4Q5V A;  3N6L A;  2XEX A;  3K59 A;  3MR3 A;  3R7N B;  4ECZ A;  1FDA A;  4PG6 A;  3HUL A;  3W3S A;  3GSD A;  4CLW A;  1YG0 A;  4DFK A;  1EX8 A;  3PKY A;  1C0T B;  4RBT A;  4J91 A;  1WSR A;  2LQJ A;  2JEG A;  5HMZ A;  1Q8L A;  1RBL A;  4DN9 A;  5L38 A;  3RBE A;  2KJV A;  1WHY A;  3BSC A;  2MY8 A;  3FCV A;  3K2Y A;  3JYT A;  1X9W A;  3M8Y A;  3KYL A;  3MEG A;  1CQN A;  5KFX A;  2V8V A;  2QLF B;  1TUG B;  3QAE A;  1C4A A;  2DHG A;  4J5O A;  1W7W A;  3MTJ A;  2KT3 A;  2ACY A;  3MEE A;  2RAQ A;  1ZM9 A;  3WC0 A;  3JYT B;  5KFO A;  3GU0 A;  3R5C A;  3MEG B;  1VIX A;  3HD1 A;  5KG0 A;  5K8O A;  1U8W A;  2FVR A;  4PCQ A;  3K0J A;  1YJU A;  3J81 U;  3T3F A;  2AV5 A;  2CQC A;  3ET6 A;  1UJ5 A;  4ID8 A;  3MEE B;  5ETP A;  3E01 A;  4FYW B;  5KFY A;  3FGV A;  2HQI A;  3KMQ A;  2AJ1 A;  2MPU A;  1RYS A;  2CJQ A;  4LF6 J;  3ET6 B;  5KFA A;  4NX9 A;  3RR8 A;  2OPR A;  1L5U A;  5HAT A;  3CB4 A;  1BXN A;  3AOC A;  3M7V A;  2HAF A;  2QRR A;  4DOZ A;  4CLF A;  4CQ1 A;  3GIR A;  1VRT A;  5A0Y A;  2GJ2 A;  1YHQ S;  3BEG B;  4DPW A;  2ROG A;  3IAM 9;  1FCA A;  2P6T A;  4XPC A;  4WJB A;  5KFP A;  3R5A A;  5IV4 A;  1S97 A;  2H1Y A;  1VRT B;  3EZO A;  1PIL A;  4OJ3 A;  5A0Y B;  3MTK A;  4PQU A;  2J9D E;  3H20 A;  1KQF B;  3QZ8 A;  4Q7A A;  1QY7 A;  3BR9 A;  2MKY A;  4DI6 A;  3VGU A;  3RAX A;  1WEX A;  2QG9 B;  3TA1 A;  2BZ2 A;  4P2X A;  1Y3J A;  4PXC A;  3A13 A;  3K5L A;  1N32 J;  3TVZ A;  4PQU B;  3BS9 A;  1VQ4 S;  2X3G A;  4C7Q A;  3M8Z A;  2FLN A;  3E51 A;  2YBV A;  5CXT A;  4RW8 A;  4NRT A;  2LEB A;  1NB7 A;  4QPX A;  4U7C A;  3KTQ A;  3QT8 A;  3K5P A;  4Z37 A;  4RW8 B;  1HFE L;  1VRQ C;  3UCU P;  1HYS B;  3P4U B;  1LK5 A;  2G0C A;  3KLF A;  3VAM A;  1T3O A;  3T5H A;  1QAY A;  3J81 j;  5M2R A;  5KFT A;  2FGC A;  2DRA A;  1NH8 A;  1K9M T;  3ENW A;  4ZVT B;  2IM1 A;  2B4V A;  1GT8 A;  3K5M A;  1OMS A;  4RUA A;  5I3U A;  3ZTS A;  5BJR A;  3BB5 A;  1X4D A;  4NE9 C;  3KK1 A;  1P27 B;  2F8H A;  4LFA J;  2XY7 A;  4WFN Q;  3D1Q A;  1FNM A;  4QW8 A;  5I3U B;  1LW2 A;  2JNJ A;  1LWX A;  3KK1 B;  2R8J A;  2BQ3 A;  3BR8 A;  1NPP A;  3MM8 A;  2J9D A;  2F40 A;  4DV7 F;  3A12 A;  2DD8 S;  5HQM A;  2YKP A;  2IVM A;  2KRB A;  2DH9 A;  2YNF A;  3TO8 A;  3PHE A;  4OX8 A;  3MM8 B;  2NR0 A;  2XS2 A;  4J9Q A;  2YKN A;  1HNW J;  2ZHA A;  4DZD A;  3ILI A;  1BQM A;  2Z8Q A;  2CQ1 A;  4DXL A;  2FJE B;  1H72 C;  3BGO P;  4LF8 F;  5DG7 A;  4LBI A;  5F8M A;  2UUC F;  2HEK A;  5LT5 A;  3D0G E;  4ZJQ A;  1VR6 A;  3UVJ A;  2YKN B;  4PPZ A;  3DOL A;  3D1H A;  3LWL A;  1BQM B;  5AE2 A;  5KT4 A;  2DNQ A;  4OX7 A;  1NHU A;  1F60 B;  3Q2S C;  4HHH A;  1Q8B A;  1S6U A;  3THT A;  5CAB A;  5DM6 Q;  3LP0 A;  2CQ4 A;  3DOL B;  4YP3 A;  3AOA A;  1H2T Z;  4CLY A;  2W4P A;  3EGV A;  5IC4 B;  4C0B A;  3TZZ A;  2DHH A;  3AT1 B;  2VG7 A;  1TL3 A;  4PXB A;  2MJN A;  3ZTP A;  4DU7 A;  2HS3 A;  2XZW A;  4CLS A;  2W2P P;  4Q44 A;  4NXM J;  4YR2 A;  4DHV A;  1UCN A;  4UOH A;  1TL3 B;  3W9J A;  1R6V A;  4K0K F;  4ZCM A;  1U24 A;  1ZA2 B;  2BRL A;  4IR9 A;  3UWT A;  3CPW R;  2HQ3 A;  2DCU B;  1S6Q A;  3TWZ A;  1YGY A;  4F7V A;  1Z4U A;  1X0F A;  4YOE A;  4KFB A;  3KK2 A;  1KON A;  2XBP A;  4RNH A;  3OTD A;  1N5S A;  2QJ3 A;  3ISZ A;  1RWO B;  4C8N A;  2G1H A;  2FJW A;  1UJ6 A;  2W2Q P;  5B09 A;  4QWC A;  1S6Q B;  4KFB B;  4Z7Y A;  3KK2 B;  4NLQ A;  7AT1 B;  4XPE A;  2QLX A;  3HHL D;  4DS4 A;  3D54 A;  4OJ1 A;  2EKY A;  2V63 A;  4FF3 A;  5DRK A;  4OV1 A;  4AFF A;  5J2Q A;  1HA1 A;  2IY5 B;  2JDJ A;  3CJ4 A;  5EX3 A;  3KG4 A;  3MHY A;  2G0J A;  3VQT A;  5D78 A;  2ASL A;  2AYB A;  4FF1 A;  4B3T F;  4EO8 A;  3QIP A;  4PXD A;  4Q0B A;  1U8S A;  3H98 A;  3B4M A;  5J2Q B;  1HD0 A;  1U1R A;  4NYP A;  4AND A;  2M3D A;  2DXE A;  5DET A;  2V0N A;  3N01 A;  3QGI A;  3N5F A;  2NXN A;  3QIP B;  2VG5 B;  1P1L A;  1I94 J;  3M9N B;  2IRY A;  2QYG A;  1WC5 A;  3AB2 B;  2E7X A;  4JI2 F;  1TEL A;  2XLI A;  3C14 A;  1VI7 A;  3W2V A;  3IS9 A;  2MJU A;  3PEJ A;  1KDN A;  2IBO A;  2BM0 A;  1ZM3 A;  2HHH J;  1VQY A;  5T14 A;  2AEF A;  2DNG A;  3C14 B;  3W2V B;  3IS9 B;  1VC0 A;  2D74 B;  1FKA F;  3I4H X;  2D3O R;  1KSP A;  4P73 A;  5ETQ A;  3JSR A;  1M5O C;  2FYX A;  3HXM A;  4ZMM A;  3CCM S;  3DNC A;  2IM3 A;  3MEC A;  4H4K A;  3NCP A;  2GML A;  4IFV A;  5AXM A;  2KVQ E;  4NZ7 A;  3PFE A;  4H4M A;  4IH7 A;  1SV5 A;  2RRN A;  1H6K X;  2P9C A;  3KOA A;  2E5G A;  4J9S A;  3IRW P;  5EN1 A;  1FX2 A;  3MEC B;  4ICL A;  4ETZ A;  4IFV B;  2RU9 A;  1YI2 S;  4H4M B;  2FVQ A;  2R2R A;  3B82 A;  1SV5 B;  1T3N A;  2YX7 A;  3FSI A;  4ICL B;  1M1G A;  4C4W A;  2UUA J;  1HIY A;  3PJX A;  1ELO A;  1RTJ A;  3TJA A;  4DSI A;  5DGB A;  5HJY A;  2PMH A;  4P9S A;  2VBX A;  3FBC A;  1VGY A;  4ECY A;  1UVK A;  1NJY A;  2DNP A;  4QR2 A;  1B0P A;  1RTJ B;  4LBP A;  3KWM A;  4FP9 A;  4PG8 A;  1KTQ A;  4F02 A;  1FDD A;  1VJW A;  2HPU A;  3QMQ A;  3A4T A;  5HI7 A;  5KG3 A;  4LJM A;  1JLB A;  5LXR A;  4DR2 J;  5DDO C;  3NBP A;  3KG1 A;  2UV8 A;  5M2P A;  2RDJ A;  2W01 A;  2O01 C;  1DBD A;  3W65 A;  3W8G A;  4QYZ J;  1FER A;  5KFU A;  4I4B A;  2E9R X;  3PRV A;  2AJ4 A;  1RP5 A;  3L7U A;  4L73 A;  2XMJ A;  2XC9 A;  1JLB B;  4X62 J;  2BJ7 A;  4V19 J;  3I9V 9;  3I4P A;  3NBP B;  4ZVU B;  2QMX A;  4XAK A;  1TK5 A;  4DR1 F;  4K4V A;  2ALY B;  4KGX B;  1T9T A;  2C2Z B;  2BVZ A;  3VAH A;  4J9N A;  4MIW A;  3R1L A;  4DL4 A;  1RBA A;  3H90 A;  3GJS B;  3K8W A;  2DNM A;  1XNR F;  2D3Z A;  1K1Q A;  3OXG A;  3KUG A;  1WSV A;  1NU4 A;  4DPX A;  5C2C A;  2HQD A;  4DQR A;  3RAQ A;  4DR7 F;  2J0W A;  1SKS A;  3LO3 A;  2ZOG A;  1FEH A;  4K5R A;  2Z0G A;  4JUZ A;  3TYT A;  1REV B;  1IBL F;  1RT4 A;  1FFW B;  2COL A;  2X1F A;  3DOM A;  3D1O A;  2I8E A;  4EGL A;  4X4N A;  2F4F A;  1X8D A;  3W64 A;  2BX6 A;  5AXL A;  2CFX A;  4NRU A;  2YKM A;  5GMD A;  4ANC A;  2XO7 A;  2IJF A;  3C16 B;  5K8N A;  1MRO A;  3CNQ P;  2WZ1 A;  3W8P A;  2QZ8 A;  2D1C A;  2OEL A;  1KWM A;  4WPA A;  2RUG A;  4DV4 F;  2YKM B;  1CJV A;  1C4C A;  2IIH A;  3C15 A;  4LSL B;  1YBA A;  1JJ2 R;  1CJT B;  3VZI A;  2FLP A;  1CJV B;  5IS2 A;  4ILM A;  3UDC A;  1HAR A;  4JV5 J;  4C8Y A;  5KFG A;  4I69 A;  3FMW A;  3C15 B;  3CJ3 A;  3PO5 A;  4O3O A;  3G87 A;  5KFH A;  4ED5 A;  3MEK A;  2CPX A;  1P6T A;  4DFP A;  1R27 B;  4CIO A;  3UDV A;  1RE1 B;  3OLB A;  2HNZ A;  2IHR 1;  3BPS P;  1R43 A;  3V6D A;  2H5I B;  2V8P A;  9RUB A;  5DQI A;  2YPZ A;  1WC1 A;  2Z4P A;  2J0S D;  2WBR A;  4YDX A;  1PAU B;  5KFI A;  1SL1 A;  3BGU A;  2DT9 A;  2AYM A;  3V6D B;  2QFJ A;  2LP4 A;  5C7P A;  5GAH I;  3UCG A;  2YQ3 A;  4RNO A;  2HFU A;  5KFJ A;  3AA8 A;  2P8I A;  1WEL A;  4DQI A;  4O3N A;  1BWV A;  4C2M A;  4DBQ A;  2WHO A;  2BQR A;  3CJR A;  1URR A;  2A0F B;  3DN9 A;  5D4L A;  4OYZ A;  3SIP B;  3PM9 A;  3DI6 A;  2PEH A;  1W2B R;  5ETT A;  4FXV A;  2HMI A;  2DB1 A;  1MG7 A;  3ZTO A;  2WAQ D;  3R6G B;  3G86 A;  3ZZO A;  5CH7 B;  2RD5 C;  2VFT A;  2WW8 A;  1YLX A;  2MMY A;  4Y2A A;  1SKR A;  3DI6 B;  3G6X A;  3A8K A;  2HMI B;  1HL6 A;  2UVU A;  3VGS A;  3W5Z A;  3Q0A A;  1U1P A;  4EWT A;  1IBM J;  3AHP A;  2AJQ A;  4KR0 B;  4JI5 F;  4WFA Q;  2KXH A;  1PAE X;  1IM4 A;  4DPY A;  3VHQ A;  1V9O A;  4ECU A;  3LGM A;  4I68 A;  3GV5 B;  4HLB A;  5D4P A;  4TQS A;  2DNY A;  3FRZ A;  3T1Y J;  3C6T A;  4PYA A;  3Q8Y A;  3QT5 A;  3LA0 A;  1YJR A;  3DLK A;  1PKU A;  4TU8 A;  3F44 A;  4C11 A;  3JS9 A;  4L76 A;  4GMK A;  4B3R J;  3N9U C;  3GYG A;  3C6T B;  4PR6 A;  3DLK B;  4A8S A;  4P71 A;  4USM A;  2CPD A;  2C3M A;  4C11 B;  4FYX B;  4Y65 A;  1I3O B;  1NK9 A;  1Y3K A;  4M63 A;  4C3K A;  5HMX A;  2R7Q A;  2C2M B;  4WK3 A;  1KQK A;  1Q95 G;  3HHL C;  1IJF B;  2AIR B;  2RQK A;  2XWY A;  3S8S A;  3MOZ A;  2XG8 A;  2L9N A;  3K17 A;  2XB2 D;  4DR5 J;  4ZIV A;  3LGN A;  2EFV A;  1SVD A;  1OO0 B;  2CYY A;  3EWG A;  2Z57 B;  2HRU A;  4LRD A;  2MHE A;  1G2E A;  1TVR A;  3BZQ A;  2OUG A;  3N79 A;  1JWW A;  1QAX A;  2ZFH A;  3PY8 A;  3GYN A;  4PAA A;  1T9U A;  5MAO A;  1APS A;  1TVR B;  3OQ2 A;  2DNN A;  4BCA A;  3CCL S;  4U6P A;  2XYG B;  1NK8 A;  2XS5 A;  3ZNU A;  4I2P B;  3H59 A;  1PJ5 A;  3NWR A;  3X1L B;  1J5O A;  3H5X A;  3H4D A;  4FYY B;  3EXC X;  1TV6 A;  2A6O A;  2UP1 A;  1WWH A;  1CPZ A;  2V50 A;  4MT1 A;  1RYR A;  1J5O B;  1TV6 B;  4NWB A;  3TNV A;  2E1R A;  3OXF A;  5HSP A;  4RUC A;  2HBZ B;  3UR0 A;  1JLG B;  5L1I A;  4CTA A;  1KD1 T;  2AJF E;  1CS4 A;  5E3C A;  4NA3 A;  2ZH9 A;  2BE7 D;  4XTT A;  3BDP A;  1HNX F;  1RT2 A;  2HND A;  1ZBT A;  4CTA B;  1S1U B;  1RWV B;  1CS4 B;  5B0A A;  5ITH A;  2C2R A;  3QFW A;  5F8G A;  5A6W A;  3HO1 A;  2HND B;  3F0N A;  4ZOS A;  2KO1 A;  3M2U A;  2MY7 A;  4CT8 A;  3CIZ A;  2W24 A;  4NA2 A;  2AZ1 A;  2OJ3 A;  2R7X A;  2W8L A;  2KTQ A;  1RTI A;  3G71 S;  2R8G A;  1LXJ A;  3H25 A;  4C0O C;  1XNQ F;  2NLW A;  2KH9 A;  1MU2 A;  2YXL A;  4CH1 A;  2YH1 A;  3TAP A;  1HR0 J;  1RTI B;  4BBY A;  2BE2 A;  4ECT A;  1WEY A;  1SIW B;  2HG4 A;  2W4D A;  1S79 A;  5KT5 A;  1CC8 A;  2AU0 A;  2CZ4 A;  2IA6 A;  1PCA A;  3TQ1 A;  3UW1 A;  1MU2 B;  3GV7 B;  1OYE A;  2N4D A;  3SDE A;  1U1N A;  3V4I A;  3FNN A;  2BE2 B;  3MPD A;  2CQD A;  4DEZ A;  2FDN A;  1SC3 B;  1WC3 A;  3SDE B;  4B9S A;  5HLF A;  3V4I B;  4QJV A;  4DUY F;  2NPI A;  4KQZ A;  3BSN A;  1WDD A;  2DIU A;  1MN7 A;  4X4U A;  1FKO A;  4QW9 A;  5HLF B;  1GEH A;  5LM7 E;  2Z2Z A;  1NSQ A;  3CW2 C;  3OLA A;  3ZZR A;  3VCD A;  1OPI A;  4CP5 A;  2XUL A;  3I32 A;  4N8N A;  2ZNZ A;  4E8U A;  2BW7 A;  4FXW A;  2KL8 A;  4Q8F A;  1FKO B;  5LL6 d;  4URG A;  3IM8 A;  1NPR A;  2G1D A;  3MCO A;  3P6Y C;  2WVC A;  1Q8K A;  4J9K A;  3LAM A;  3R9L A;  4FNH A;  2X7I A;  5A8R A;  4LIW A;  4K4Z A;  4DV5 F;  5B0C A;  2DGW A;  1E6V A;  5ETK A;  2RML A;  3ISN C;  2ZBR A;  3M32 B;  3SZ2 A;  2NXU A;  5GMK a;  3K5N A;  2F1F A;  2FJX A;  5A8R B;  2FJB B;  2VAS A;  4ZP7 A;  2XHC A;  3WZ0 A;  3GLJ A;  1E6V B;  3A8J A;  5DO2 A;  2MKK A;  1XER A;  4NEZ A;  1IKY A;  2FHJ A;  1HBM B;  3CD5 A;  4F2S A;  2VIC A;  4CO1 A;  2MZJ A;  3IBF B;  2R7T A;  1IVZ A;  2CZV C;  2HKE A;  4LR9 A;  1IKY B;  3UD3 P;  2L48 A;  4AYB D;  4Y2C A;  2M5Y A;  1TU0 B;  4C9D A;  1L3S A;  2CJY B;  3IFE A;  2R7U A;  2UUW A;  4B9T A;  1F2G A;  2A2C A;  2LU1 A;  1NRK A;  3JQJ A;  3VVU A;  5IWA J;  5HL7 Q;  2JL9 A;  1FES A;  3HM9 A;  3HPO A;  2JHE A;  2NUU G;  4Y2K A;  3GIK A;  1IWG A;  1AFI A;  3QO9 A;  3M6X A;  2R7O A;  1C1B B;  3EVM A;  4NAS A;  4DDF A;  4ED0 A;  4F36 A;  2DEI A;  2HSE B;  3HKW A;  3H4B A;  3DU6 A;  1WC6 A;  3CJ2 A;  3K89 A;  1FJG J;  1WKJ A;  2KRR A;  3QO9 B;  3LOU A;  4M5M A;  1X4H A;  2QEX S;  5DZ6 A;  1XTZ A;  2NZ4 A;  2QE5 A;  4A8X A;  4WZM A;  2HWH A;  4O3P A;  4MK9 A;  1RCO B;  3MUT P;  2ZWO A;  2GHW A;  1GXU A;  3HSG A;  1CVJ A;  3JSB A;  1F3V A;  3TQE A;  1NJI T;  1VQN S;  3UDE A;  2DYA A;  1N6Q A;  4IH5 A;  3EDQ B;  3GP9 A;  5F8J A;  1WOR A;  4A4J A;  3PKM A;  3VAK A;  3OJU A;  4C8Z A;  3NL0 A;  2Y1R I;  1LQ9 A;  3KG0 A;  2J9C A;  2KFZ A;  1KVI A;  3A3N B;  1FRJ A;  3G6E S;  2C3O A;  4PUO A;  2FLO A;  2H4W B;  4LF7 F;  2MGZ A;  2ZWP A;  4JP8 A;  3US5 A;  3NG8 A;  6FDR A;  4OYX A;  2V34 A;  1R0C B;  3IR7 B;  4NMX A;  4PUO B;  3NGT A;  2MGZ B;  3Q2T C;  2H4Y B;  1S5Z A;  4OX6 A;  2RH3 A;  4ED4 A;  2KKH A;  1D9A A;  2AX1 A;  3I5C A;  2U1A A;  1HD1 A;  3KKF A;  5HP1 A;  1FNX H;  2Z56 B;  2ZKU A;  4KPY A;  4USH A;  1FI4 A;  1S12 A;  3NRB A;  3PX0 A;  4FPI A;  3DDI A;  5KFW A;  1JLF A;  4J9O A;  4ZPW R;  3JXO A;  1UWA A;  2RQM A;  3RTV A;  2OEK A;  3DHX A;  5HP1 B;  2P9E A;  3CCU S;  4NXN F;  2M8H A;  2OP5 A;  3S1T A;  2PO4 A;  2FZC B;  1ZM4 A;  2VD3 A;  3L9Z A;  2FIU A;  1JLF B;  3AA9 A;  3I0R A;  2WRM A;  5K14 A;  3BBC A;  5D0H A;  4WFX A;  3DDN A;  2BOP A;  1Q81 T;  3TEG A;  3PW0 A;  3TUP A;  1MSW D;  2P6S A;  1GK8 A;  4TY8 A;  2HVD A;  1BMQ B;  3I0R B;  4LIR A;  5K14 B;  4M5I A;  3W7B A;  5D3G A;  2YQ0 A;  1BHN A;  3D3B J;  1KHW A;  4ZS6 A;  2BW2 A;  3FCW A;  2BJ1 A;  5KFM A;  1GNK A;  2RRA A;  2AYG A;  4TY8 B;  1Y00 A;  1H2U X;  5D3G B;  3RJM B;  1FDN A;  2MXY A;  2MZQ A;  1RTZ A;  4OZL A;  5JVG Q;  1WF0 A;  3O3L A;  1RZM A;  2F7V A;  4HT7 A;  1LWF A;  1VQS A;  5KG1 A;  3WIV A;  4FYD A;  1ICE B;  4NL5 A;  1FJC A;  2OTJ S;  1NHV A;  4ZDN A;  3B4D A;  1CSJ A;  4PWU A;  4P7V A;  1LWF B;  1SUQ A;  1JIH A;  4YN3 B;  1K47 A;  4FYV B;  3TAQ A;  4F4X A;  3NS6 A;  4USU A;  3DGP A;  2AHO B;  3IA0 A;  2GJF A;  1WKK A;  3KLH A;  2YPY A;  1SUQ B;  1TMM A;  4MYT A;  4RJV A;  5KFE A;  3DC2 A;  2Z2M A;  5IV3 A;  1OQ6 A;  3IBC B;  2LKZ A;  3M9M B;  1S4E A;  2BAB A;  2Q1L A;  3G8S A;  3FC9 A;  3EGZ A;  2MB0 B;  2WSE C;  3KLH B;  2B43 A;  2ZH5 A;  1M1H A;  5THW A;  3PW4 A;  3HHK A;  1N8R T;  3C3L A;  4WK1 A;  1DAX A;  2XI2 A;  2DR7 A;  2G2O A;  3OPK A;  4LF1 A;  4OZ5 A;  3MCS A;  1WD6 A;  4LR8 A;  1WF2 A;  3G6V A;  3MM7 A;  1XC9 A;  1TMJ A;  4Y3C A;  4JI3 F;  2F4V F;  1Q5Y A;  1UA0 A;  2FHO B;  3M2V A;  5JXS A;  2L41 A;  3G4S S;  1RWX B;  3MM7 B;  2XTJ P;  1VS3 A;  4O3Q A;  3U27 A;  3CO9 A;  3M2V B;  2VOD A;  1NJW A;  2GO9 A;  2LXU A;  2GFF A;  1SH3 A;  4LRC A;  1JQG A;  1P1T A;  4QR1 A;  2H5E A;  2D3O 1;  3QRQ A;  3CO0 P;  3DLJ A;  2LEA A;  1U2C A;  2LVW A;  2WB1 D;  3I96 A;  5B08 A;  3D67 A;  2P2C B;  1NO8 A;  1RAI B;  3R5D A;  3SV4 A;  4IKA A;  3OVA A;  3O8W A;  4GRS A;  2HYI B;  1DQA A;  4ZLJ A;  1QUV A;  2ZE2 A;  3PXG a;  1RUS A;  2VC0 A;  2HFN A;  1I51 B;  4EZ6 A;  2J6S A;  2DNO A;  3PHT A;  1S0O A;  2RJZ A;  1BC6 A;  3NLC A;  3BYP A;  2ZE2 B;  2VKR A;  3MD3 A;  2QSW A;  4JBC A;  5B0D A;  5G4D A;  2BJD A;  2XYH B;  5I3Q A;  4PPD A;  2DCL A;  2HIQ A;  3R1H A;  3PW7 A;  2IRU A;  4AL5 A;  3SBM A;  4A48 A;  2RB7 A;  3DLB A;  3EIC A;  1EAY C;  3FBE A;  2FJA B;  1FD2 A;  4CO5 A;  2PSZ A;  1QSL A;  2UUB J;  4N77 A;  1ARO P;  5LMU J;  1X5P A;  2NZC A;  4ER8 A;  2IBK A;  1NSP A;  3LP1 A;  1SQF A;  2G2Z A;  4JI0 J;  3D6T B;  2OEJ A;  2DEJ A;  1SQE A;  1U4B A;  2UXD F;  2CJ9 A;  4CO2 A;  3MMC A;  2MTL A;  2QN6 B;  4IRD A;  4DR6 J;  5KG4 A;  3LP1 B;  1QLN A;  1YX2 A;  2GNK A;  5DQG A;  2EG2 A;  4I67 A;  3D0I E;  1N32 F;  3TP2 A;  3AD7 C;  1YRU A;  1DLO A;  2F9D A;  3EGW B;  5GVQ A;  4NYO A;  2E7W A;  2Y1L B;  2A6M A;  6FD1 A;  2VPW B;  4QIE A;  3TA0 A;  3NNA A;  1DLO B;  1L3K A;  2E66 A;  3KLG A;  1RKJ A;  1U6F A;  4OZJ A;  3RBX A;  1TQL A;  2KB2 A;  1O6X A;  2JOQ A;  3KLG B;  2J6U A;  4HH1 A;  4PZV A;  5E33 A;  4P2M A;  3DOK A;  3G8T A;  3L09 A;  2AZ3 A;  2M0G B;  3PW5 A;  4RU9 A;  3FBB A;  5K5M A;  1GX5 A;  2XWX A;  2E44 A;  5KFB A;  1VFJ A;  4N41 A;  2XGP A;  2VFV A;  1WG4 A;  4OI6 A;  3DOK B;  5CD4 A;  1PYT A;  3J80 U;  8AT1 B;  4RX6 A;  2HBY B;  3MDF A;  2AMC B;  2CDQ A;  4IRK A;  4LFA F;  2J6T A;  1MLA A;  4QQB A;  1NSK L;  3MR7 A;  4CYU A;  4WZQ A;  3D68 A;  1NDK A;  4WE1 A;  2IYI A;  3NS7 B;  3ULH A;  3BQ2 A;  2KFY A;  1JLA A;  1RAG B;  2FB0 A;  5LXY A;  4B3O A;  4CYU B;  4O3R A;  1T05 A;  1JLA B;  3PZP A;  3PW2 A;  1VC6 A;  4ETX A;  2VDH A;  2ZBP A;  4YDD B;  1N5T A;  5AJ3 J;  4B3O B;  4S0M A;  1RAO A;  5JVH Q;  5C5J A;  4EEY A;  4B08 A;  1X9M A;  5EX0 A;  5HVF A;  4FS2 A;  3U1L A;  2DRB A;  3T19 A;  1HWI A;  2Q43 A;  3DDK A;  1DQ8 A;  1NKC A;  4ILR A;  3OTB A;  3FRY A;  4WU2 A;  5K20 B;  1ZM2 A;  3DCA A;  2Y0B B;  4E98 A;  2EFN A;  2CWX A;  5D6G A;  3R7S B;  3H2V E;  1GMW A;  1DTT A;  1NPK A;  2ZC3 A;  5L1K A;  2BM1 A;  2CPJ A;  1UKU A;  4ZPC A;  1GX6 A;  2POK A;  1FX4 A;  2CIM A;  1WOP A;  3ZZ0 A;  5BR8 J;  1LV5 A;  2PD1 A;  4RO0 A;  1ZAX A;  1DTT B;  4HDG A;  5CCL A;  4F0K A;  5J1E A;  3OL7 A;  4U8V A;  3OR1 A;  2HWI A;  3SXL A;  2FJD B;  4WP9 A;  4HL9 A;  3DRS A;  2M52 A;  2VFU A;  2J7W A;  3I55 S;  2NXC A;  2IFX A;  5J1E B;  5KT7 A;  3OR1 B;  3O1L A;  1MWQ A;  1DZ5 A;  1NH7 A;  3EMT A;  3FFI A;  1JJ4 A;  3TVY A;  1FHT A;  5E2Q A;  1GMU A;  3DRS B;  4X2B A;  4EBC A;  2W2M P;  5F9N A;  3K58 A;  2H9Z A;  2VG6 A;  5DDQ C;  4YB1 P;  2AP6 A;  4DU8 A;  2XYP B;  3FFI B;  4NCG A;  3HDS A;  2XCA A;  1RQ0 A;  1HW9 A;  3PJW A;  5H9F K;  4YEA A;  1F3F A;  4WFB Q;  5KFC A;  2QA2 A;  1X60 A;  1JLE A;  3RG6 A;  2VG6 B;  2GAG C;  1O8B A;  3O6Q A;  4DR3 F;  4YB5 A;  3GMG A;  3R5J B;  4NCG B;  4YY3 J;  1FK9 A;  4KT0 C;  4OX9 J;  3DMJ A;  3QPI A;  3DRY A;  3MGJ A;  1JMT A;  5C42 A;  1WI6 A;  3DHW C;  2MQM A;  4UUW A;  2ZH7 A;  4DSF A;  1N4L A;  3H40 A;  3BRE A;  2MQP A;  3BBF A;  1FK9 B;  1S1X B;  4ZPT R;  3AJ1 A;  5C42 B;  4ZLL A;  1GAO A;  4FS1 A;  3SYZ A;  3RB6 A;  5GAD U;  2V8H A;  1I94 F;  1AT1 B;  4CO3 A;  2B8P A;  4DPT A;  2DVI A;  3GB0 A;  5LJ3 Y;  1S48 A;  3DFE A;  4ELU A;  1VQ6 S;  4QBU A;  1AZS A;  3W66 A;  2DGX A;  4CDI A;  1TKT A;  2KT5 A;  2Q6C A;  3DLE A;  2HHH F;  2EK6 A;  1KQS R;  3NKY A;  3G9C A;  3IP0 A;  1AZS B;  1CBK A;  2QV6 A;  1RTH B;  1TKT B;  4GKK F;  3DLE B;  2C3U A;  2KG1 A;  4LT6 A;  2FPH X;  3LAK A;  4EBE A;  2EK1 A;  3MR2 A;  1JB0 C;  3NAI A;  5IXU A;  2YWW A;  4UW2 A;  3Q8V A;  1SL0 A;  4QWD A;  5D15 A;  4DZ6 A;  3QFH A;  2OFH X;  5E3P A;  3PNI A;  3UNY A;  4ECQ A;  1N52 B;  1MMN A;  3TX0 A;  2OD6 A;  4KTQ A;  1UFW A;  1ZTW A;  4LF5 J;  5HVH A;  2W9B A;  4DV1 J;  2B56 A;  2ACM A;  4RW9 A;  5GAG I;  2NRE A;  2DGT A;  1EQ0 A;  1FE0 A;  4J7C A;  3J7Z T;  2FHJ D;  2IMO A;  4RW9 B;  1IQT A;  1KVJ A;  2MHN A;  2PE8 A;  3TUJ C;  2CPI A;  4K2X A;  4TY9 A;  3CCE S;  2QLB B;  3AY0 A;  2LU2 A;  4JI6 J;  4NZ6 A;  4JV2 A;  2QL7 B;  1HWJ A;  3ADA C;  2DPI A;  1Q7Y T;  3BBB A;  5EWF A;  3KDN A;  3NOG A;  4HI1 A;  2XNQ A;  1JLQ A;  4CH7 A;  3BSA A;  2DTJ A;  4CT9 A;  4OHW A;  4X64 J;  4K4W A;  1T94 A;  3KHR A;  1HNI A;  4V1A k;  2QL5 B;  4RW6 A;  4X4T A;  1WF1 A;  1YDL A;  2J9E A;  4KPC A;  2J76 E;  4ZLP A;  2AX0 A;  2B51 A;  5F3T A;  2VBZ A;  4USJ C;  1JLQ B;  3KLV A;  4K0K J;  3RW7 A;  4X62 F;  1HNV A;  1S9F A;  2DR6 A;  2BA9 A;  1HNI B;  4P6Q A;  2OKQ A;  2H51 B;  1TKZ B;  4RW6 B;  2E29 A;  2LQ9 A;  1PJ7 A;  5AT1 B;  2XQC A;  1YRX A;  2ZM6 F;  4KH0 B;  1OQ3 A;  1RHR B;  1HNV B;  3IGV A;  2W9C A;  2CPY A;  4O44 A;  5FII A;  3ENA A;  4DR4 F;  1MNE A;  4CLP A;  4ZPV R;  2J5A A;  3CC7 S;  1TL1 A;  2CQH A;  4ZPA A;  1NJZ A;  3GJR B;  1I1G A;  2W9C B;  4O44 B;  4YHH J;  1RWM B;  1TZ0 A;  1TL1 B;  2ZHB A;  5CHC B;  4J9V A;  3NGS A;  2HHQ A;  4RNN A;  1WUU A;  1IR2 A;  4ES3 A;  1ZAW A;  5IQ6 A;  2UUT A;  4QYZ K;  5CQG A;  5B0B A;  2BRK A;  3B8H A;  1YJ7 A;  4WXO A;  1HWU A;  3EE3 A;  4QWE A;  1VQM S;  2G9O A;  5I4M A;  2OD4 A;  1L3V A;  3Q8U A;  5SZT A;  2OGU A;  3A3P B;  2HHU A;  1VHI A;  4DWI A;  3I31 A;  5EHH A;  3T9Z A;  2HNY A;  2JLE A;  2KT2 A;  3P3D A;  3F56 A;  1Y5L B;  3ENQ A;  3E2E A;  4LFB J;  1F5C A;  2VQE J;  3DLH A;  1C0U A;  2GAH C;  3LP2 A;  4IQM A;  2EFP A;  1EAR A;  1IBK F;  2HNY B;  1N36 J;  1TTH B;  4O23 A;  1IM6 A;  2IVY A;  2FVC A;  1KN6 A;  1C0U B;  1NJX A;  3GII A;  2VA2 A;  1GTE A;  3GFX A;  1GMV A;  5G0R A;  3LP2 B;  2KM8 B;  2JFD A;  1U09 A;  2L3M A;  3FK4 A;  1VCT A;  4CLL A;  3FJ2 A;  4TN2 A;  4L3N A;  4GKJ J;  3HMJ G;  1X4B A;  3MAA A;  4CZC A;  5G0R B;  3IC1 A;  1FWL A;  3OR2 A;  2MYF A;  4MH8 A;  3SFU A;  1LKZ A;  4WF9 Q;  1ZOT A;  1Q0N A;  3PYD A;  1BQX A;  2Y1I A;  3UDL A;  1WTB A;  4MAK A;  1Y4Z B;  1PBA A;  3UN5 A;  3VR1 A;  1U0S A;  3KK3 B;  4ZVH A;  2XMU A;  4HEA 9;  5HK4 A;  2DHX A;  1XMQ J;  4IG3 B;  2QTW A;  1KTV A;  5GAE I;  3J7Z 5;  1Y5N B;  3BKF A;  5SUH A;  1LFW A;  2DPJ A;  3KXD A;  4TNO A;  2HVH A;  4ZLN A;  3UN3 A;  2Y0S D;  2ZBC A;  4BWM A;  2NYI A;  4UZC A;  1F0X A;  2F9J A;  1L3U A;  1VBX A;  3EDR B;  2VA3 A;  2GS8 A;  1JXL A;  2CJA A;  3MMB B;  1IBM F;  4DPO A;  4O3S A;  4OJH A;  4NOH A;  4DR1 J;  4C97 A;  2QMW A;  2ZZT A;  2V2V A;  3C8Y A;  1XMB A;  4OLO A;  5ETN A;  3NNH A;  2CQI A;  5HO4 A;  2K3K A;  2VH7 A;  2FTR A;  2OO4 A;  3POT B;  4M1K A;  1SJF A;  1LXN A;  3GYX B;  3NGU A;  2VOO A;  3OL6 A;  2M7S A;  4WFY A;  4DR7 J;  1UEV A;  4B3R F;  4NYZ A;  1V5V A;  5E3Q A;  2OSR A;  3AD9 C;  3R8Y A;  2EBE A;  2PA8 D;  1Y5I B;  2EC0 A;  5RUB A;  1IBL J;  3OHA A;  3AQP A;  2J0X A;  2KN4 A;  4UY8 T;  3GIL A;  1KHV A;  2V2Z A;  1J5E F;  4EBD A;  2Y3Y A;  3D5M A;  2GW8 A;  1VBY A;  3L7O A;  4B9U A;  2PMZ D;  2E9Z A;  2CQ3 A;  3RUB L;  3SSS A;  4LVN P;  1F6T A;  4YUD A;  1X31 C;  3WQP A;  2B9Y A;  1AA1 B;  1S59 A;  1ZH5 A;  4DLE A;  3FMB A;  2HS4 A;  5B0F A;  2VFR A;  3QYY A;  4RW4 A;  3DLL Q;  3EZ5 A;  3TAR A;  3ICL A;  4URQ U;  3HCX A;  2VBY A;  2DO4 A;  4ECR A;  2ZH6 A;  4OLP A;  4PG5 A;  2ATL A;  1CC7 A;  2GV1 A;  2DNK A;  1FRX A;  2DGS A;  5EWE A;  4MKB A;  2W2N P;  2YKA A;  4LQ9 A;  3E01 B;  4RW4 B;  5CYM A;  4ATN A;  3R6L B;  2QT7 A;  3D6M B;  1T03 A;  1XR5 A;  1NND A;  3A8E A;  3T1A A;  2OPR B;  3HJV A;  3M8R A;  1HQU A;  2H5J B;  3MFH A;  3GZ7 A;  2DH8 A;  1T9X A;  4NLP A;  3MUM P;  1K1S A;  5KFL A;  4R5P A;  1T03 B;  2CRL A;  1ZA1 B;  5CZV A;  1X9S A;  5AE3 A;  1KFD A;  4FBT A;  1UZD A;  2BV3 A;  4AL6 A;  3T5L A;  4YME A;  4ECV A;  1HQU B;  3AH6 A;  4WFZ A;  3QZ7 A;  1VHF A;  2OH2 A;  3IWL A;  4LF9 F;  1ZPW X;  2OHD A;  1HHT P;  2VJV A;  3G82 A;  3G8Q A;  2QLW A;  1VQ7 S;  2I5J A;  2FY8 A;  2B0G A;  4K4T A;  3DRR A;  3M05 A;  2ZH2 A;  3VZH A;  3NP5 A;  3A3O B;  1WG5 A;  1LFP A;  2ZOM A;  2A1B A;  2J0Q D;  2I5J B;  2FC9 A;  4LRA A;  3QSI A;  5LJ5 Y;  2GVD A;  1TKD A;  2AWZ A;  3SCK E;  3S6E A;  5DM7 Q;  3VGT A;  2RKI A;  1UVL A;  2EC2 A;  5A76 A;  2HZV A;  2GVD B;  4BC9 A;  4JV0 A;  2R8K A;  3UPF A;  3KLF B;  2RKI B;  5HQL A;  2ASD A;  1WG1 A;  4YR0 A;  4A8K A;  1S77 D;  4XIU A;  1QTN B;  4FXD A;  1RLC L;  2QC3 A;  4F25 A;  3CUL A;  1F5A A;  2DGQ A;  4PEO A;  2ADB A;  3TZY A;  3KJN B;  4RWW A;  4DCP B;  4UST A;  2YVS A;  2I1R A;  4J9P A;  2YWE A;  3N0V A;  1LW2 B;  1UP1 A;  3ZFV A;  4KV8 A;  2YX4 A;  2DHA A;  4KGK A;  3PJ9 A;  3OTE A;  4X65 F;  3PX4 A;  2HIY A;  1G4C A;  1Q7L B;  2CPH A;  3ZTQ A;  4KV8 B;  2OPQ A;  5D4N A;  3SSR A;  2YNF B;  2IA0 A;  3J7Y I;  2HQF A;  2OPQ B;  2KFN A;  1H74 A;  3CC4 S;  3OD2 A;  4B9M A;  4DQS A;  3UVJ B;  3WIU A;  3GR0 A;  4IFY A;  5D0E A;  1ROF A;  4UY8 5;  2R7V A;  3QGG A;  2KG0 A;  1UET A;  4F4K A;  1Y7P A;  3AB4 B;  4M5K A;  2ZDO A;  4IFY B;  4KKO A;  3LP0 B;  2CQP A;  5DS7 A;  3LAN A;  2BUN A;  2GZO A;  2PII A;  1DAR A;  3G6Y A;  2V94 A;  4CNY A;  4JI7 J;  4J9M A;  1NKE A;  4XDD A;  1K73 T;  2LMI A;  2VG7 B;  2XMT A;  4KKO B;  4A8Y A;  2XY6 A;  4UF4 A;  3WX4 A;  3R2D J;  2X1A A;  4W90 B;  2G2Y A;  2FVS A;  4HHJ A;  4F3M A;  2R2U A;  2EFG A;  1WJ9 A;  1S76 D;  2CKW A;  1FNO A;  4B3M F;  2W7P A;  3T9N A;  3NEK A;  5CZX A;  4R25 A;  4A8W A;  1NSA A;  3RYL A;  1Q79 A;  5F8I A;  2VQF J;  3N5B A;  3D28 A;  1HBN A;  5IWA F;  3ZZZ A;  1WOS A;  1GTH A;  2CDR B;  5FD1 A;  4A8Q A;  1V3S A;  1U2F A;  3PIP Q;  3A8I A;  2DH7 A;  1HBN B;  3GFY A;  4FKX A;  3CF5 Q;  4MIA A;  1DQ9 A;  3FZB A;  3Q8R B;  2W9A A;  4K2J A;  5DG8 A;  2ZZM A;  2LQ8 A;  1VQ9 S;  1V3R A;  1WDT A;  3M30 A;  2KU7 A;  1HBO A;  3Q8Q B;  2HBR B;  2C1E B;  5HBM A;  4Q0B B;  2QGF B;  1VQ8 S;  3KUE A;  3HT0 A;  3SCL E;  3HHL A;  4E0D A;  2V8G A;  3J7A 1;  1YSJ A;  1HNZ J;  1HBO B;  1X4A A;  1TL7 A;  3QT6 A;  2K7K A;  4USI A;  2V6A A;  5HBM B;  5KFZ A;  4BS2 A;  4WTY A;  2VPY B;  1FT8 A;  3QNW B;  1W25 A;  3CCJ S;  3HHL B;  1FFG B;  3FEZ A;  3UN2 A;  2VON A;  1SJ3 P;  2ZIT A;  1TL7 B;  2ZJP Q;  1N33 J;  3EZU A;  1SJR A;  3H5U A;  4C6A A;  4MYU A;  4JI1 J;  1N5Q A;  2DGO A;  4LRF A;  1VRU A;  3CMQ A;  4ZP6 A;  4DN0 A;  4YFU A;  4C0H A;  4P72 A;  2XSJ A;  1BQN A;  2PFD A;  3TRG A;  1BD6 A;  3M2R A;  1RA7 A;  1RBO B;  3WHI A;  1VRU B;  2Q6B A;  3NXZ A;  3AFG A;  4EZ9 A;  4W98 A;  2VF3 A;  3JAM U;  2XSJ B;  1BQN B;  3MPY A;  1X7V A;  1IN0 A;  3M2R B;  2VHG A;  1VQ5 S;  1S57 A;  1B70 B;  3RGI A;  7FDR A;  1B7F A;  4OI1 A;  4DL5 A;  2E9T A;  2AGQ A;  3Q89 A;  3RAM A;  4P2S A;  2YWH A;  2V67 A;  2KHC A;  2MLY A;  4J9L A;  3CCT A;  2JLF A;  3RB4 A;  4C98 A;  3PRB A;  4OHV A;  3H8Y A;  3ZTR A;  4UQT A;  3HHE A;  2LFV A;  2BJ3 A;  2W4C A;  4DV0 F;  1YZ7 A;  2VZ9 A;  3G96 A;  1RA6 A;  5ETL A;  1ZTT A;  3IG1 A;  4ZVO B;  1JNZ B;  4EMD A;  5KFD A;  2DR8 A;  3V4M A;  3OVB A;  4TLQ A;  2RUS A;  2GJI A;  3T5J A;  3IG1 B;  1RAH B;  3BJY A;  3I5A A;  3MCN A;  2VIH A;  1FF2 A;  2AJ0 A;  1NK6 A;  2YY3 A;  1CQM A;  2XGQ A;  4N47 A;  5JUM A;  2BKO A;  1BWE A;  3JTN A;  3UI3 A;  1SC4 B;  4KGV B;  2WTF A;  5KFN A;  1MW7 A;  3CXC R;  2GGP A;  3TX8 A;  1PJ6 A;  3MED A;  3B54 A;  2IAJ A;  5BYS A;  5CYJ A;  3U1N A;  3C2P A;  1U7L A;  3CCR S;  4FDF A;  4RBU A;  2GGP B;  3HT3 A;  2KZZ A;  2E1P A;  3MED B;  1LWE A;  2HFV A;  3IR6 B;  3O44 A;  2IAJ B;  5HMW A;  5LSL A;  5KFK A;  2V4J A;  4KC5 A;  2OPP A;  3K5O A;  4LF2 A;  4NLV A;  4GO5 X;  4YQW A;  2KVI A;  5HQ8 A;  4C8M A;  5L8R C;  1JXE A;  4MK7 A;  2WVB A;  1N56 A;  3DXS X;  3KHH A;  1B4S A;  2V4J B;  2OPP B;  3OFH A;  1RT4 B;  2A10 A;  2Q66 A;  1HI0 P;  2Z2Y B;  3DOM B;  1RAJ A;  1TK0 A;  1C1C A;  2EEY A;  3HHD A;  4C8K A;  4ZK7 M;  1Q82 T;  1K8A T;  2BAN A;  2HK2 A;  4ZP9 A;  1FE4 A;  1MRO B;  4OQJ A;  1C1C B;  4GVB A;  3DRX A;  2XMM A;  3KLE A;  4LMZ A;  1IBC B;  2BAN B;  1NK0 A;  1X4G A;  1FKP A;  1HQE A;  4DUT A;  2CG4 A;  3LTO A;  4PWW A;  1ZZF A;  1UVN A;  3TUI C;  3JQM A;  2DY1 A;  2MQL A;  2J7U A;  1XMO F;  2B7C B;  4WP8 A;  2MQN A;  3ZC4 A;  3KLE B;  2D9P A;  1ZYQ A;  1Q86 T;  2FY1 A;  2ATC B;  2QMU B;  2LDY A;  1JKH A;  1FKP B;  1HQE B;  2OML A;  1HW8 A;  5C25 A;  1RWP B;  4IDK A;  2J8A A;  3BGL A;  4K5S A;  2BXJ A;  4LFC F;  4FVC A;  5DJB A;  1JKH B;  5C25 B;  4IDK B;  2GHV C;  2IVF B;  2HNZ B;  2XI3 A;  1FRK A;  4ENO A;  1KS2 A;  4FPR A;  2IM0 A;  4I6Y A;  2N3O A;  4KAI A;  2HRY A;  3QLH A;  4HYK A;  5IT0 A;  1S1T A;  4NXN J;  1WOO A;  4NLD A;  1KNZ A;  3ZO7 A;  4DV6 J;  4Y34 A;  1UL3 A;  2B9E A;  4JI8 F;  3Q86 A;  2HHW A;  3KHL A;  1S1T B;  2O1P A;  4RL1 A;  1FJE B;  4M5N A;  3OW2 R;  2ADC A;  4ALZ A;  1KBR A;  2O3D A;  3NGK A;  1M5K C;  2M2B A;  3HVT A;  3BKT A;  4F0H A;  5LMU F;  1I6J A;  4X4Q A;  2JX2 A;  1YJV A;  2IDL A;  2PN6 A;  3CCS S;  1S9G A;  4JI0 F;  1RTD A;  3HVT B;  1AYE A;  3GJQ B;  4IUF A;  3AXM A;  4ZCL A;  4RPF A;  2XM3 A;  4CLK A;  3EX7 B;  2CVE A;  3RZA A;  1F1B B;  1S9G B;  1RTD B;  4DL3 A;  3CJK A;  3GWC A;  2PT0 A;  1T95 A;  1RWK B;  4NLT A;  4ZIW A;  4F4A A;  3VQS A;  1SL2 A;  4QIW D;  4ZCK A;  2OLW A;  1D9F A;  2GA7 A;  5C2G A;  3NAH A;  3CJK B;  4FVM A;  2HFZ A;  1AFJ A;  3FVY A;  4WYL A;  2B4O A;  2NYH A;  4O0I A;  2FZK B;  2UXC F;  4OZ0 A;  5KT3 A;  1PG5 B;  1QDU B;  3T1H F;  4DJB A;  2GVZ A;  2MZS A;  3SEO A;  3BN4 A;  2MKC A;  2ZJQ Q;  4OYW A;  3PYF A;  1R89 A;  1DRZ A;  1NZA A;  2JVO A;  2QL9 B;  3SV3 A;  5IT9 U;  3T6J A;  3AOB A;  2GVZ B;  4GO7 X;  3OV7 A;  3VF0 B;  3VGV A;  3MR6 A;  3CDA A;  4NCA A;  1X5O A;  4N7T A;  2G4B A;  4KH1 B;  1WNE A;  4M94 A;  5KG6 A;  2J8S A;  3GQC A;  5DGA A;  4Y6I A;  1HHS A;  2LA6 A;  2CWK A;  1S0M A;  2E1M C;  2UVW A;  4JI3 J;  2F4V J;  5IQQ A;  1B0T A;  2M8D B;  2HZA A;  3PYE A;  2EPI A;  4DQQ A;  3WDO A;  4HVZ A;  4BWJ A;  4P7T A;  4DL0 C;  2I9S A;  1C0T A;  1RDR A;  3M8Q A;  4DUZ F;  5BXI A;  3IN5 A;  1VQK S;  4DX5 A;  2RS2 A;  2DR9 A;  1Q4R A;  3P8B B;  1AUS L;  2PA3 A;  3FEY B;  1U1O A;  3P5T L;  3ZZP A;  2RS8 A;  3M8Q B;  4FF2 A;  5IC6 B;  2XMK A;  2RU3 A;  2EI5 A;  2DNL A;  3AOD A;  1FXD A;  1RWU A;  2HQC A;  3MMJ A;  2NPF A;  1TL5 A;  5AJ3 F;  3W5X A;  4I64 A;  3M6W A;  2GIQ A;  4ZPB A;  3CSK A;  4KYZ A;  2BKN A;  2CNN B;  5GAH U;  1XQI A;  1YVF A;  1D8Y A;  3CDU A;  3L3C A;  4DV2 J;  3UD5 A;  3C46 A;  1N34 F;  2NUH A;  3OJS A;  4J9U E;  3JAM Y;  1UAW A;  4KE5 A;  1D9D A;  3M4X A;  1LOU A;  1OS5 A;  1FVQ A;  4G6V B;  3ZXW A;  1RCX B;  4WYW A;  4RBV A;  2XLK A;  2YQ1 A;  1N0V C;  3G2X A;  1VK3 A;  8ATC B;  4YB7 A;  1KOH A;  3V5R A;  2JRS A;  5BR8 F;  2A3J A;  2ROP A;  2PDA A;  4A8M P;  3ETM A;  7FD1 A;  3R3T A;  3R27 A;  4IRC A;  3HD2 A;  1G3O A;  1T9V A;  1RT2 B;  5AXK A;  5LSO A;  3NS5 A;  4JYA J;  2ZOF A;  3MWB A;  3BN7 A;  3QGP A;  4NPO A;  3FCH A;  3ITH A;  4WXW A;  2OTL S;  3MUV P;  1EQM A;  1UVM A;  2WK4 A;  3M2U B;  3L4B C;  1N48 A;  3IWN C;  4B9N A;  3TJ9 A;  4QWA A;  2YTC A;  3ITH B;  1EZZ B;  2HVZ A;  2UXD J;  1WC4 A;  1QJH A;  1WC0 A;  1CLF A;  1FRM A;  5B0G A;  4ZN3 A;  1NUE A;  3C66 A;  5KFF A;  3UR3 C;  3VAJ A;  3BH6 B;  4F3Q A;  1SCJ B;  3ETO A;  4OYA A;  4UUX A;  4YY3 F;  1RHQ B;  4I6W A;  4F4W A;  4OX9 F;  4OFZ A;  4GC6 A;  4HI2 A;  3QBC A;  4PXE A;  1KC8 T;  1HYS A;  3TZX A;  4F4Z A;  3EVO A;  1V3Z A;  4DLG A;  4ZHR A;  4WII A;  3H42 A;  2NCK L;  4IQX A;  2V9W A;  2GX8 A;  4RZR A;  1Q5V A;  1NXI A;  2MQQ A;  2O66 A;  3L7P A;  1XBW A;  1RK8 A;  3V6K A;  3EJM A;  4ZHR B;  3TI0 A;  2KHD A;  2B7B B;  2AW0 A;  1SC1 B;  1HI8 A;  3BGR A;  4OL8 A;  2HFS A;  4AUK A;  1L3T A;  3OXL A;  1U25 A;  2MQ8 A;  1M5H A;  5KT2 A;  2EKN A;  4KO0 A;  3JTP A;  1JNR B;  1MN9 A;  1LEO A;  2DKO B;  5CA5 A;  2F5G A;  1VLY A;  3BGR B;  3P5B P;  2NQP A;  1HI1 A;  5L39 A;  4NLX A;  4JI4 J;  3MM6 A;  4KO0 B;  4WBF A;  2PC6 A;  2B6A A;  3ILO A;  5H9E J;  1D3W A;  2MKH A;  4BHQ A;  1YQH A;  2GQC A;  1LWC A;  4CRJ A;  4TYA A;  3MM6 B;  2UXB F;  1VK8 A;  5D0R A;  1O51 A;  2B6A B;  4QCL A;  4XK8 C;  4ZIT A;  1ACM B;  3IRX A;  5KOW A;  2C3Y A;  4LF5 F;  3Q23 A;  1LWC B;  3BH7 B;  1S10 A;  4WWS A;  4OI0 A;  2B8Q A;  1KLN A;  4DV1 F;  2RE1 A;  1UFL A;  2XZT B;  3IRX B;  4ED7 A;  1NKB A;  4NLR A;  3M6V A;  5H9F J;  4ELT A;  2G13 A;  1RSC A;  3TZW A;  3N28 A;  1OY6 A;  1E6Y A;  2V9K A;  4YR3 A;  3GG1 A;  4TU9 A;  5LMN F;  2RRB A;  4RNM A;  2KYZ A;  4JI6 F;  2IDE A;  2XCP A;  3CMA S;  2VKZ G;  1E6Y B;  2XNR A;  2EW9 A;  4KIA A;  2V69 A;  4C8L A;  1RT6 A;  3MM9 A;  1F9F A;  5J1N A;  1FA0 A;  3CDB A;  4GVL A;  4DSE A;  1NCL A;  2KM8 C;  4X64 F;  1CUL A;  1FWK A;  1N5Y A;  1RT6 B;  3MM9 B;  3MFI A;  4OZ2 A;  4LSZ B;  1IR1 A;  1VYA A;  4Q45 A;  2ZKT A;  4RLE A;  2DY9 A;  5DLF A;  1CUL B;  2VOP A;  1Q8I A;  4FBU A;  1REG X;  2OEM A;  4ANE A;  3HSZ A;  2DIT A;  1J27 A;  1XEZ A;  3KFW X;  3CED A;  1N5Y B;  3WX8 A;  2MKS A;  4ZN1 A;  3IWX A;  5KTQ A;  1HKA A;  4AT1 B;  2R8H A;  2FJV A;  1N6Q B;  2V2Q A;  2ZDP A;  5DQH A;  3DYA A;  4KHP F;  2X3D A;  4HAC A;  4OHY A;  4AQY J;  4LF4 J;  2F8E X;  3FEX B;  4DR3 J;  1YBT A;  5ETO A;  1JK9 B;  3DYA B;  1DFD A;  3D7S B;  4H54 A;  2LQB A;  4YHH F;  4HAC B;  1H98 A;  2WBM A;  3U7J A;  4M5H A;  4ED6 A;  3MAH A;  3Q8S B;  3VV2 B;  3OUY A;  4X4V A;  2VG5 A;  4MTP A;  3QWU A;  2Y8W A;  4EFA C;  4ES1 A;  2JJ4 D;  5L46 A;  2LCW A;  2EFQ A;  1RU1 A;  3DRP A;  5CD4 H;  4ED8 A;  3TAN A;  3GV8 B;  3OUY B;  1RT5 A;  2N7Y A;  4A8O A;  2C42 A;  4OZ3 A;  4MIB A;  2LXF A;  3R5G A;  1RU2 A;  1T9Y A;  3OFE A;  2LYV A;  4ED1 A;  4X4R A;  2FUG 9;  3DRP B;  1IJE B;  2HW3 A;  1RT5 B;  5JMN A;  4B3S J;  2RIJ A;  1OJ4 A;  1FXR A;  2AYE A;  1UWB A;  4KJI A;  4MKV A;  3MM5 A;  3LUY A;  1FRI A;  5IT9 Y;  4HDH A;  1OY9 A;  2IPO B;  3BF4 A;  4FKY A;  4GKK J;  2DR5 A;  1VJQ A;  3NGD A;  1UWB B;  4LFB F;  2VQE F;  4EI2 A;  2P5V A;  2HS0 A;  3MM5 B;  3CME S;  4DQP A;  4K4X A;  3ZZU A;  2KDO A;  1PO6 A;  2OAU A;  1N36 F;  2CNK B;  1DUR A;  5KT6 A;  4J90 A;  4LBH A;  3O2I A;  3CCQ S;  3FQL A;  2BDP A;  2XMA A;  5E3A A;  4GKJ F;  1FRL A;  1PYS B;  2E5L F;  5F9L A;  1UA1 A;  4L3K A;  3AAW B;  2O5D A;  2F63 A;  1NZ8 A;  3EM1 A;  4U67 Q;  4Y00 A;  2V2K A;  4KB7 A;  4CM0 A;  2B5J A;  3CWJ A;  2VFS A;  3WC2 A;  3P49 B;  3R5B A;  2ABY A;  3I6P A;  3ZNJ 1;  1XMQ F;  1PC5 A;  1R31 A;  4ECS A;  1KVK A;  2B5J B;  3LPY A;  2Y8Y A;  3DGP B;  4M5D A;  3AJD A;  1S72 S;  4LVO P;  1SI9 A;  1YJ9 S;  2QA1 A;  2JZ5 A;  3GFH A;  1TFY A;  2VPX B;  3J81 Y;  1XN9 A;  2GQ2 A;  1TFW A;  2NXE A;  2XMV A;  4NEY A;  4RKU C;  1ZET A;  4M5D B;  2AF6 A;  5L1J A;  4U9R A;  4WTO B;  2JEF A;  2GO8 A;  1YJN S;  4FZV A;  1TUW A;  1IUJ A;  3IMQ J;  1FFS B;  4PWD A;  2ASJ A;  2LQ5 A;  1V6H A;  1RHU B;  1V5I B;  1X4F A;  1OSC A;  4OYO A;  3GE9 A;  5FDL A;  3E8O A;  2HZC A;  4L6V 3;  2ZBI A;  5ETV A;  2ZM6 J;  4EYH B;  4PWD B;  1HWK A;  1JXV A;  2U2F A;  1RAF B;  4UZB A;  1F2H A;  1QM9 A;  5F8L A;  1GQE A;  5FDL B;  4DR4 J;  3HLU A;  3FZ2 A;  2AEM A;  2ZHO A;  4HTJ A;  1SPB P;  2DK2 A;  4M8L A;  2K2P A;  1REV A;  1QUP A;  5T41 A;  2W25 A;  2VC1 A;  2R42 A;  4O4G A;  1HMV A;  5ETS A;  4F4Y A;  1S1W A;  1NAQ A;  2DXD A;  3ISN D;  2R2T A;  1S0V A;  3EVW A;  6AT1 B;  4UQG A;  2YWG A;  4O4G B;  1JJC B;  2ZC4 A;  1HMV B;  3C16 A;  1UVI A;  1S1W B;  3BO4 A;  4QIG A;  2CPF A;  2HHT A;  5BYQ A;  1GFW B;  4LSN A;  2AEJ A;  4G1P A;  2AGO A;  1M5S A;  5AE1 A;  3HFZ B;  3BSO A;  1RB0 A;  1VIO A;  2NSC A;  3A1Y G;  2H3E B;  3ZZT A;  1EET A;  5DDR C;  4LSL A;  2JC1 A;  4N56 A;  5L1L A;  3MI7 X;  4ECW A;  4LSN B;  1CJT A;  1RAA B;  4DCO B;  4V19 X;  4U95 A;  3QAT A;  2XSF A;  4LF6 F;  4L74 A;  5H1S V;  2C2E A;  1EET B;  4LQ3 A;  5IT4 A;  2EBG A;  3CTR A;  4NLW A;  2R7S A;  4P2F A;  4ED3 A;  4E2F B;  1P8G A;  1BGX T;  2M4M A;  4DSL A;  2HRT A;  1RKI A;  3OTO J;  4N76 A;  2B4P A;  1IBK J;  1UFK A;  3W9I A;  2MDA A;  3HI9 A;  3CJ8 A;  5KFR A;  1FEE A;  4NML A;  5MLC V;  4CH0 S;  4EK2 A;  4BC7 A;  1DTQ A;  1O0P A;  2DXF A;  1D1U A;  2CG8 A;  1GXL A;  2BEF A;  4ZVQ B;  3PIO Q;  3FDS A;  1DTQ B;  5T7L A;  4N5S A;  4QR0 A;  3FBF A;  3JTO A;  2JWN A;  4EU0 A;  2VPZ B;  2XMW A;  3BDE A;  1U1L A;  2PGC A;  4W92 B;  4CO4 A;  2RT3 A;  2EFO A;  3DKD A;  3MMC B;  2ZVI A;  1J2V A;  1O5J A;  3EPI A;  5T7L B;  3I56 S;  1S9E A;  3SMZ A;  2D69 A;  5E0O A;  1H7X A;  1UPM B;  4KSE B;  4KBI A;  1SKU B;  2HBQ B;  1HWL A;  4K8R A;  5FJ4 A;  1D0E A;  4USV A;  3UCZ P;  1S9E B;  4TQR A;  1U6Z A;  4DV3 J;  4X66 J;  3CGI A;  1RAD B;  3MF5 A;  1NLK L;  5E3R A;  1FTC A;  3QSY B;  5D0G A;  5DLG A;  2CQB A;  1FJ7 A;  4DFJ A;  2UU9 J;  3THP A;  1IQZ A;  2WVE A;  1AW0 A;  2BBE A;  1SXL A;  5KFV A;  3Q8P B;  4AE5 A;  2IJN A;  4PKD B;  1PBU A;  2YNG A;  3OFF A;  2B3T B;  2AGP A;  3QQC D;  3RBZ A;  4WP3 A;  4X4S A;  4ECX A;  2ROE A;  2MKI A;  4F8R A;  3AXK A;  1FRH A;  2YNG B;  2R7W A;  3TOQ A;  4AL7 A;  3Q83 A;  1NBE B;  3KMS A;  2AT1 B;  2L08 A;  2V4R A;  1CG2 A;  3OBI A;  1S99 A;  1N54 B;  3HVA A;  3KJV A;  3SFG A;  1RI7 A;  1T02 A;  2BJ8 A;  4C3L A;  4WE1 B;  2WVD A;  5EDW A;  2VBW A;  3VAL A;  3KJV B;  2CJK A;  3I87 A;  3HF5 A;  1T05 B;  1HNW F;  3PFO A;  1OYD A;  1CJK A;  1Z1Z A;  4CCH A;  3PO4 A;  3M8P A;  1QD1 A;  1OIA A;  1EKS A;  2DIS A;  2OFG X;  5ADZ A;  4ZA1 A;  5F3Z A;  1U1K A;  1NDP A;  1J5E J;  3CJS A;  1CJK B;  1KFS A;  2HGL A;  3C19 A;  3MMA A;  3M8P B;  1UZH A;  4I56 A;  1T11 A;  1Y9O A;  2B9W A;  4QPT A;  3K57 A;  3KDO A;  4X84 A;  2NXJ A;  5J2N A;  3MMA B;  4XO0 A;  2D7S A;  4K7Q A;  4CNZ A;  3TJ8 A;  1SJQ A;  3IBW A;  1EJ7 L;  4NLU A;  1UJ4 A;  5F8H A;  5J2N B;  5LSR A;  3QT7 A;  2MSS A;  3TUZ C;  3D66 A;  4H4K C;  4NXM F;  4I2P A;  1DJ0 A;  1YK9 A;  3CC2 S;  2XY5 A;  4JV1 A;  4JI7 F;  1P9Q C;  3LWM A;  3BV8 A;  4ID5 A;  1HLW A;  4HHU A;  3KNG A;  2OPS A;  4UOG A;  4K4Y A;  2DGV A;  2WCX A;  4G3I A;  1OY8 A;  1LW0 A;  4ID5 B;  5D4O A;  3Q22 A;  2OPS B;  1B0V A;  2I38 A;  1DY3 A;  2MZR A;  2L9W A;  2VQF F;  1A9N B;  1JLG A;  1OSD A;  1LW0 B;  1WTF A;  2YNH A;  1FDB A;  3KLI A;  3K8V A;  4LF9 J;  4RU2 A;  1QSS A;  2MEW A;  4DSJ A;  1S7I A;  2R3V A;  3RU0 A;  2ZH8 A;  1QSY A;  4TYB A;  1KR4 A;  4RNF A;  3NCQ A;  2A2D A;  3GJT B;  5U47 A;  2BAC A;  2ZBQ A;  2H48 B;  3IO1 A;  2YNH B;  1S1U A;  1JLC A;  1JLE B;  3KLI B;  3M1V A;  2I6W A;  1H7W A;  2RQC A;  1KP6 A;  1S1V A;  5E41 A;  4CLU A;  3DMJ B;  4BDP A;  2GC8 A;  2OI2 A;  3OSP A;  2BJE A;  3KNA A;  3H5S A;  3UD4 P;  1JLC B;  4HR2 A;  4USK A;  2EWH A;  3PDN A;  5K8M A;  3M1V B;  4KY3 A;  4U7U K;  2PFF B;  2VV5 A;  1IKX A;  1S1V B;  3VVT A;  2CQG A;  4ZVR B;  1HNZ F;  4QOT A;  4ZKA A;  2R4F A;  4LRE A;  1RJJ A;  3MXH P;  1YRT A;  2ZD1 A;  2LXI A;  1IKX B;  3N6N A;  4IH6 A;  2IMW P;  2HVE A;  5IOL A;  3NWG A;  1U48 A;  1TK8 A;  3M8S A;  4OHZ A;  4EO6 A;  2GMJ A;  1N33 F;  1JX4 A;  4D3H A;  1U49 A;  3GTY X;  4U7U D;  2ZD1 B;  1X4C A;  2ZNY A;  4JI1 F;  1TP7 A;  4QWB A;  3THV A;  2N3L A;  2HAI A;  1RAE B;  5DG9 A;  3VAI A;  4K50 A;  1LNQ A;  3QJP A;  2JFK A;  3I9Z A;  3I82 A;  3I0S A;  4NLY A;  2ERR A;  4CO0 A;  3S01 A;  1Y10 A;  4DV7 J;  3D2W A;  1IWA A;  1H3D A;  2PI5 A;  1ITP A;  1WHX A;  5HAO A;  3I0S B;  3HVR A;  1RAB B;  3TA2 A;  3R7B B;  1Q53 A;  3CVK A;  1AB8 A;  4X65 J;  4B17 A;  1K0V A;  2HGN A;  2DHS A;  4LF8 J;  3SQO P;  2UUA F;  2UUC J;  5BYR A;  2W9B B;  1H38 A;  1R8C A;  2FD2 A;  2KYX A;  2WW4 A;  4U8Y A;  4WCE Q;  1VLO A;  5L9N A;  2YWF A;  2N4C A;  3N6M A;  3M32 A;  2C3P A;  2AJ2 A;  2CUY A;  4ZJL A;  3QJL A;  4IO1 A;  3RB3 A;  3D6F B;  4C8O A;  4OMF G;  4MFB A;  1Y0H A;  1HBM A;  1QTM A;  2EVZ A;  4MJK A;  1YJT A;  4F2R A;  4DR2 F;  1OWX A;  5J1P A;  2YH0 A;  4MFB B;  2QSF A;  4DPU A;  4PRF A;  1NDL A;  5HJX A;  1TL4 A;  3M9O B;  3HK2 A;  2QYC A;  4YS2 A;  1WI8 A;  5A2Q U;  3UNG C;  1NEE A;  4B3M J;  3JQK A;  4OI4 A;  4RW7 A;  4J9R A;  4O0N A;  4J37 A;  3P45 B;  2QLJ B;  1N5V A;  5GME A;  3ENV A;  2HWT A;  1YZ6 A;  4L75 A;  1C1B A;  4RW7 B;  2E5J A;  4Y28 C;  2UV8 G;  2EXU A;  3CD7 A;  1GXT A;  3PVX A;  2MLX A;  3SCI E;  1XR7 A;  4B3T J;  1T7P A;  2HLU A;  3V81 A;  1H73 A;  2BJ9 A;  3KUH A;  1WKL A;  1HBU A;  3ELH A;  2C22 A;  1PC4 A;  2D3U A;  3FKB A;  2D9O A;  4EYI B;  1F5B A;  2XHW A;  1RGV A;  1M0S A;  4GC7 A;  2R8I A;  1Z2L A;  3V81 B;  4JI2 J;  3UE2 A;  1HBU B;  2Z58 B;  2X1B A;  2R7R A;  2E1A A;  1CEZ A;  2K3I A;  1R0A A;  3MR5 A;  2Z30 B;  4TKT A;  3H2L A;  4PG4 A;  2SXL A;  2QA4 S;  3PR4 A;  3LPE A;  3JB9 k;  3OT9 A;  4YB6 A;  4FN5 A;  3VAF A;  3MOJ B;  1R0A B;  4MKY A;  2F3J A;  1FXL A;  3F73 A;  3CDE A;  2RIL A;  4AXJ A;  3PAC A;  3FSX A;  3OFG A;  3D9B A;  5I42 A;  5LOQ A;  2GCF A;  3UFC X;  4JV5 F;  2K1R A;  2W7O A;  1A0O B;  3O5T B;  3PV8 A;  2KXN B;  2C2N A;  4WU3 A;  3TW0 A;  2CZ9 A;  3SSQ A;  3RR7 A;  2E1C A;  4AD6 A;  2JVR A;  5GAG U;  5I42 B;  1G1X A;  2K1R B;  2N82 B;  3PYG A;  3BQ0 A;  2CPE A;  1QVF R;  2CPZ A;  5IFM A;  4WIQ A;  3B6B A;  3W63 A;  5KG7 A;  2JEJ A;  2M9K A;  3EPG A;  2APO A;  2WSC C;  5EUH A;  2FHK A;  4DS5 A;  4KHM A;  2DNZ A;  4W4M A;  2OMO A;  3MAA B;  1VDH A;  2Y1J A;  3PEH A;  3OR2 B;  4DSK A;  4UT4 A;  4ITS A;  2KI2 A;  1B3T A;  3OTC A;  3EGN A;  4IOA Q;  1PYO B;  1B99 A;  3R2C J;  3JSM A;  4ED2 A;  3MCM A;  4DV6 F;  2RQ4 A;  3GSI A;  4F04 B;  2CJB A;  2ZUG A;  4I6A A;  2HHV A;  4DV0 J;  1R7I A;  3MPW A;  1RWW B;  3PR5 B;  3JSM B;  4HT5 A;  4DX6 A;  3HKZ D;  1S6P A;  2DJW A;  2HUR A;  3BO2 A;  5I3P A;  3PG9 A;  4ZVS B;  1VQL S;  4K4U A;  2CJX B;  1S6P B;  5EWG A;  2OIH A;  1EB0 A;  4N8O A;  2KZM A;  2YKQ A;  4CI0 B;  4OHX A;  1RWN B;  3CJQ A;  1SKW A;  2BQU A;  3V2U C;  1NB2 A;  3QAU A;  3LH2 S;  3C6U A;  4X4O A;  5C24 A;  1MWY A;  2VU5 A;  2YKO A;  3T1Y F;  1XNR J;  1Q1K A;  3TAM A;  4B9V A;  1YIJ S;  2LDI A;  2CQ0 A;  4RR5 A;  1VC5 A;  3C6U B;  1TAQ A;  4JOU A;  5C24 B;  4DF4 A;  3OVS A;  2RVJ A;  5DDP C;  1R8A A;  2H65 B;  4G65 A;  1HPZ A;  3TAM B;  3GCX P;  3PRD A;  2HK3 A;  2Q3P A;  1RHJ B;  1SB6 A;  2CNL B;  1G7C B;  1A6L A;  4M5J A;  5CCM A;  1AXQ A;  5KAK A;  1DHM A;  1HPZ B;  4PYD A;  1WHW A;  2V5H G;  3ONQ A;  3QID A;  3HSD A;  3D0H E;  2FQQ B;  4XDC A;  3OL8 A;  4M5G A;  3P96 A;  2R9L A;  2VL1 A;  1XWL A;  3K7R A;  3BO3 A;  3BPD A;  1Q16 B;  2CXE A;  4DR5 F;  5E5N A;  2ALZ A;  4IG0 A;  1UTA A;  3GIM A;  3LGH A;  2ZZN A;  4DV4 J;  2L9D A;  3LW5 C;  2RDI A;  2V68 A;  2PEB A;  1T8E A;  4DF8 A;  3D4J A;  3RW6 A;  5E7O B;  4IG0 B;  1T0T V;  3T6B A;  3MD1 A;  9ATC B;  1S49 A;  3X3U A;  3CUN A;  3VAG A;  2O67 A;  3U02 A;  3HVW A;  4I2Q A;  1XMO J;  2CA9 A;  2UZA A;  3RRK A;  3FSY A;  3L95 X;  5CYM B;  2JEI A;  4Z2X A;  2UVV A;  1FO1 A;  4A46 A;  4I2Q B;  2HQG A;  4DL6 A;  3NNC A;  4HKQ A;  3TEH B;  1FVS A;  1KQG B;  1R3N A;  2HHP A;  3IM9 A;  3GIJ A;  4LFC J;  4ES2 A;  2W7A A;  4R5P B;  4DL2 A;  3FUY A;  4WKY A;  2MZ1 A;  2E7V A;  3UO0 A;  4DV2 F;  2E5I A;  1YTY A;  2WSF C;  3SCJ E;  1ZPV A;  2X1G A;  2WB4 A;  1MML A;  2JC0 A;  2LLZ A;  3NCR A;  2C2D A;  5GAE U;  4NLO A;  1B7Y B;  2QX0 A;  3G82 B;  4WKR A;  4A47 A;  2ZUA A;  2DNR A;  3KJF B;  3DRR B;  3I5B A;  4OIX A;  4EUV A;  4JI8 J;  2NS1 B;  4C3M A;  4IO9 Q;  4LR7 A;  5DZ7 A;  1EP4 A;  1SJ4 P;  3M6U A;  4JYA F;  2FLL A;  4TVA B;  4LUB A;  2VB6 A;  1K0T A;  1VQP S;  2CAD A;  3PTW A;  5F0U A;  1EP4 B;  4FNI A;  1K44 A;  2WON A;  5J2P A;  1RAC B;  2DGU A;  3GFZ A;  2B9X A;  3NOC A;  5JJB A;  5KG5 A;  1BE4 A;  2I0X A;  4C48 A;  3T5K A;  3ILJ A;  4JI5 J;  3CJT A;  1S6O A;  1ULR A;  4ZVG A;  1HR0 F;  1NK5 A;  2WON B;  1TR0 A;  3PCO B;  5J2P B;  1GH8 A;  4LRB A;  3HZG A;  4H4O A;  1M5P C;  1P9Y A;  1D09 B;  4ZJO A;  1IKW A;  5AXN A;  4P52 A;  4R0E A;  2C2K B;  4R8U A;  3AD8 C;  4RUB A;  5A2Q Y;  4H4O B;  5HRO A;  1IKW B;  2XLJ A;  2HFO A;  1X0P A;  4R8U B;  4IYQ A;  2ZH4 A;  1D8Z A;  4ZVP B;  3IAS 9;  1H0H B;  4NLS A;  2GMH A;  2UXC J;  1Y11 A;  3KJQ B;  5HRO B;  2F8M A;  2A18 A;  4OYP A;  3T1H J;  5HMY A;  2AQ4 A;  5B0E A;  5A8W A;  2RHQ B;  3AJ2 A;  4B02 A;  4F26 A;  3OSN A;  5KFS A;  3DLG A;  1B64 A;  3BYR A;  2GIF A;  3LQV A;  5A8W B;  2YNI A;  4CLT A;  1Z2Z A;  5GAD I;  3RB0 A;  3LF0 A;  3DLG B;  1URN A;  3TVK A;  4Q8E A;  5KFQ A;  1VOM A;  2YNI B;  1U1Q A;  2DBB A;  4JI4 F;  3RBD A;  1VMB A;  1VBK A;  3H5Y A;  2JH3 A;  1FTR A;  3N4W A;  4DUZ J;  3HSJ A;  3DU5 A;  1XJW B;  1QAJ A;  4HTI A;  3SI8 A;  3CCZ A;  1GMW D;  1RHM B;  1EHW A;  3ILL A;  5ETR A;  1HQ2 A;  1RT3 A;  3CIM A;  2CVI A;  4QU6 A;  2HLT A;  1TUV A;  5FLX U;  1U0H A;  1RT3 B;  2G0I A;  4QYR A;  1LK7 A;  2F65 A;  4IOB A;  3W5Y A;  3OHB A;  1U26 A;  1U0H B;  1N34 J;  1ZS6 A;  3EUN A;  1SH2 A;  1M5V C;  3LAL A;  5IM0 A;  4U96 A;  4CM2 A;  2B4U A;  2RNE A;  1PGZ A;  1WAC A;  3DM2 A;  4ZP8 A;  4IOC Q;  2ZH1 A;  1HNX J;  3H2U B;  5IM0 B;  3WBZ A;  4DL7 A;  1AUD A;  2XZD B;  3PX6 A;  5L9X A;  4QIF A;  3GCW P;  4QZV B;  2RSQ A;  3D6H B;  2N7C A;  3BKU A;  3DM2 B;  1FJG F;  4TLR A;  5H9E K;  4HH0 A;  1WEZ A;  1I5O B;  1R8B A;  5J2M A;  3J7A N;  2E5H A;  3M30 B;  2XO6 A;  4OZ1 A;  4G1Q A;  4ZPD A;  5CAA A;  1RHK B;  2IYG A;  2PI4 A;  3MAQ A;  2WOM A;  3W9H A;  5J2M B;  2VJU A;  2D41 A;  1XNQ J;  2GIR A;  4G1Q B;  4KRW A;  3DXB A;  1IKV A;  4MMO A;  3FQK A;  2RF2 A;  2WOM B;  1UMJ A;  1IXK A;  2YWK A;  1XR6 A;  3VWS A;  2BYC A;  1RT1 A;  4PG7 A;  3QJJ A;  3T41 A;  1TAU A;  1U45 A;  2QO3 A;  1IKV B;  2FHM A;  3D3C J;  1SBR A;  4ZVE A;  4AQY F;  4LF4 F;  2RF2 B;  3BQ1 A;  3H7H B;  4KGZ B;  2AKW B;  1RIS A;  1R8H A;  3UQS A;  2JLG A;  2BOA A;  1RT1 B;  4Z7C A;  3HHN B;  3QRP A;  2BMB A;  1F9H A;  3MPU B;  1UW9 A;  1S1X A;  3NGR A;  2K8G A;  4R0J A;  4DUY J;  2IC3 A;  2QFI A;  3HFV A;  4DCJ B;  3J7Y U;  3QGH A;  3H0P A;  4UOC A;  3W60 A;  2IC3 B;  4OYI A;  2KJW A;  4PQA A;  1R8P A;  1ZAV A;  4ELV A;  2H54 B;  2K7J A;  4PAB A;  4L72 B;  2YX1 A;  1RXO B;  3KHG A;  3QRR A;  1QAI A;  2CAJ A;  3CT9 A;  2DIV A;  1R6Y A;  1H2V Z;  3VTI A;  4USW A;  2RDD A;  4CLZ A;  1RTH A;  2QA4 G;  4B3S F;  2PMW A;  2XS7 A;  3OL9 A;  1YBU A;  4DV5 J;  4NA1 A;  1T9W A;  2R2S A;  4Q2L A;  5CYQ A;  5D8H B;  3W61 A;  2M88 A;  1WHV A;  4A8F A;  2DO0 A;  2FZG B;  4I7F A;  1C2P A;  1SJ1 A; 
#chains in the Genus database with same CATH homology
 3P45 B;  2QLJ B;  1I3O B;  3SIP B;  1RWW B;  3D6M B;  1RWP B;  2H51 B;  2HBQ B;  3NS7 B;  4DCO B;  2C2M B;  1RHQ B;  3R7N B;  2XZD B;  3GJQ B;  2H5J B;  3R6G B;  1RHR B;  1RWO B;  2CNO B;  3P4U B;  3RJM B;  1I51 B;  4ZVO B;  2CDR B;  2H4Y B;  3D6H B;  1QTN B;  4DCJ B;  2FQQ B;  4LSZ B;  4ZVS B;  2C2K B;  2HBZ B;  2Y1L B;  2CJX B;  3D6F B;  1RE1 B;  1RWK B;  1F9E B;  2XYH B;  1ICE B;  1SC3 B;  4ZVT B;  2H5I B;  2XZT B;  3GJR B;  1RWN B;  3IBF B;  3KJN B;  1RWX B;  2H54 B;  1RHM B;  3GJT B;  4DCP B;  1RHK B;  2HBR B;  2QLB B;  1RWM B;  2C1E B;  3KJF B;  2H48 B;  1RWV B;  2XYP B;  3EDR B;  1SC1 B;  1PAU B;  4ZVP B;  3EDQ B;  5IC6 B;  4ZVQ B;  4ZVR B;  2QL7 B;  2C2O B;  2QLF B;  5K20 B;  3KJQ B;  5IC4 B;  4JB8 B;  2CJY B;  2Y0B B;  1QDU B;  4ZVU B;  1SC4 B;  1IBC B;  3IBC B;  3R7S B;  2CNK B;  2DKO B;  3R5J B;  2XYG B;  3R7B B;  2C2Z B;  1GFW B;  1PYO B;  2CNN B;  3QNW B;  2QL5 B;  2H65 B;  2P2C B;  2QL9 B;  2HBY B;  1BMQ B;  3GJS B;  1RHJ B;  1RHU B;  2CNL B;  2H4W B;  1NME B;  3R6L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...