1ICEB

Structure and mechanism of interleukin-1beta converting enzyme
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and mechanism of interleukin-1 beta converting enzyme.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords INTERLEUKIN-1 BETA CONVERTING ENZYME
total genus 16
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 1994-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1iceB00
2H51B 2H4WB 2Y1LB 1RHJB 4DCPB 1BMQB 3GJTB 2HBQB 2P2CB 2H65B 3R7SB 2C2ZB 2H48B 4ZVRB 2XZTB 3KJQB 1RWVB 4DCOB 4ZVPB 2CNKB 1RWWB 1QDUB 2XYHB 3R6LB 5K20B 2C2MB 1RHUB 3GJRB 3P4UB 2HBYB 3D6HB 2CDRB 1RWKB 1RWMB 2QL9B 1RWPB 3R6GB 3GJQB 4ZVTB 3R7NB 2QLJB 1SC3B 4ZVOB 1RE1B 1RWNB 1PYOB 3R7BB 1RHRB 4ZVUB 2CJYB 3IBCB 3D6MB 2H54B 1F9EB 2FQQB 1QTNB 2XZDB 3IBFB 3EDRB 3GJSB 4ZVQB 3SIPB 3EDQB 1RHKB 2H5IB 1I3OB 2C2OB 3R5JB 2QLFB 1GFWB 2H5JB 1IBCB 2DKOB 1SC4B 2HBZB 2QL7B 3KJFB 2CNNB 1ICEB 4DCJB 1SC1B 4LSZB 2QLBB 3QNWB 5IC6B 3NS7B 1I51B 1RWXB 2XYPB 3P45B 2Y0BB 2QL5B 5IC4B 1RHMB 2C1EB 2CNLB 2CNOB 1PAUB 2HBRB 4ZVSB 4JB8B 2H4YB 2XYGB 3D6FB 1RWOB 2CJXB 1NMEB 2C2KB 3KJNB 1RHQB 3RJMB
chains in the Genus database with same CATH superfamily
5HK4A 4USKA 4EWTA 3KHLA 2J0XA 5IM0A 4DWIA 2MGZA 2DGVA 4MFBB 2QC3A 2K1RB 1BMQB 1UJ4A 2ACMA 2K8GA 2V67A 4Y2KA 4GO5X 1NSQA 1SKUB 2AV5A 1TAQA 3DCAA 1U8WA 3O8WA 4M5DA 3ZTPA 3FEYB 1JLGB 1VFJA 2C2ZB 4ZP8A 5EWFA 4F4KA 1VCTA 3OSPA 1SQFA 2MQQA 4WXWA 2DNZA 4EYIB 2E9TA 4ES1A 4DV2F 2KO1A 5J1NA 2M9KA 1VQKS 2O66A 3I96A 3N6LA 5KT6A 4FBTA 3H90A 1QDUB 2DHAA 1JKHA 3JSMA 2HMIA 1VRUB 5L1KA 1FESA 2IDLA 3C14A 4J9VA 1J5EJ 3IR6B 2PFDA 1T94A 4F3MA 3B8HA 1M5VC 4NCAA 4B3TJ 1N32F 2Q1LA 3MCSA 3W62A 4CLWA 1AUSL 5KT2A 4NLOA 1HHQA 4DX6A 3D6TB 2M0GB 4NCBA 4XDDA 1RTJA 1RDRA 1VOMA 4UOGA 5HQ8A 3I82A 4CLKA 1ZTTA 1T9VA 4ED1A 1F3VA 2ZUAA 3E8OA 4WYLA 5KOXA 1BWEA 2VDIA 1QAYA 2OO4A 3AAWB 2C28A 2LYVA 4DPYA 2RQMA 2A0FB 3EVWA 3R7NB 1X4HA 3DOMA 4FZVA 3K8WA 5U47A 2WSCC 5J2QA 2BXJA 4C8OA 1Y5IB 3FSYA 2VKZG 3PCOB 4ZHRB 4IG3A 5L9NA 1EETA 1TK0A 1FKOB 2HFNA 2KL8A 2DEIA 2KHCA 5LSLA 1YRXA 4DPWA 3CD5A 3CCLS 4DV3J 2ZD1B 3ZZOA 2VUGA 5KOWA 3G4SS 3TWZA 4CTAA 1MWQA 5D4LA 1EQ0A 1RT2B 4IFYA 2B4UA 4YR0A 1KQSR 3OFEA 3A3OB 1APSA 1OPIA 4BC9A 1RKJA 1ZAXA 2MB0B 2DISA 4EBCA 1ZS6A 5L1JA 2NREA 3TX8A 1HNZF 2KG0A 4YB5A 2CJYB 3F0NA 2FZGB 5L9XA 1KP6A 2WBMA 3QFWA 5IQQA 5DGAA 3WHIA 3G6ES 1XR5A 1S5ZA 2DT9A 3VQSA 2XBPA 2MQ8A 4ENOA 3VAGA 3KOAA 2KFZA 3W2VA 3D1QA 2MLZA 4HR2A 4USTA 2UXBF 1S57A 3J81Y 2HZAA 3R5GA 2E5IA 2VFSA 4OZ0A 4OX9F 3CULA 1VDHA 1CS4B 3ZTSA 2IY5B 2J9DE 4B9TA 2X1GA 2QLFB 2E7XA 4DDFA 2H5JB 3OLAA 1N8RT 1TMJA 2IAJB 2RS8A 4WWSA 1U25A 2VC1A 4QWAA 3H20A 3GYNA 2KTQA 2HNZA 2ZH5A 4RUBA 2GQ2A 1CC8A 2Z30B 2BJ7A 4G1QA 4IFVB 2Y9HA 1DZ5A 1GX6A 1IKXB 2VG6A 3EWGA 4KR0B 3PW4A 2ASJA 1Y0HA 2Z2ZA 3DLEB 3LPYA 1U48A 2RRAA 1TKZA 4D3GA 3HF5A 2CRLA 3EZUA 3PRBA 1EKSA 3MTKA 1WKKA 2G2OA 3M6UA 3PJWA 5G0RA 5BYQA 4PEOA 1WI6A 3KTQA 1E6VB 3EICA 1ZAWA 4HLBA 4LRCA 2R9LA 1ZZNA 3M1VA 4HH1A 2FY1A 3KK3A 2KVQE 5T7LA 3NGKA 4OHXA 4JI8J 4X4VA 2BKPA 4FYYB 4UT4A 2MQNA 1HI0P 1B7FA 1KLNA 4Z7CA 4TKTA 3MR5A 2HHXA 2CNLB 4WP3A 2HBRB 4G1PA 5D4PA 3BQ2A 1HBOB 5H9EJ 2HZCA 3DNCA 5F3ZA 2RNEA 1UTAA 1OIAA 1SIWB 3OTBA 5HLFA 1EZZB 4DSIA 3EGWB 3LTOA 2W2OP 3OJUA 2OFHX 2H9ZA 4ZPBA 3IWNC 2W9BA 2CA9A 2AYGA 2NCKL 2E5JA 3DYAA 2DNHA 4LFAJ 3ENWA 1N88A 2YQ0A 1R3NA 4HHHA 1YHQS 2QIFA 2RT3A 1RABB 2GJFA 2FHJD 2JC1A 1QUVA 1S9EA 3TJ9A 7FD1A 4KPYA 3K17A 2V8VA 5F8GA 2MLYA 3X1LB 2H51B 3PRDA 2EC0A 3QRRA 2HHHF 4W98A 1XWLA 1YRTA 5KFZA 3LP0A 4YHHJ 3M2UB 5AJ3F 4WKRA 1JNRB 1AZSB 4HT7A 3W66A 3FMBA 2AD9A 2HBQB 4USIA 1HNIB 1RT2A 2HHTA 3NXZA 1YJNS 1JLQA 2EEYA 2HFOA 3AOBA 4DR4J 3PYDA 2ZD1A 2XZTB 3NGRA 2FVCA 4F0KA 3MR7A 3GZ7A 4LQ3A 1RT6B 4ZVPB 1EETB 2ZBRA 3M8PB 1BQMA 3ETOA 4PQAA 1Q81T 1FA0A 3G87A 3PR4A 2I38A 2RQKA 3H98A 1TAUA 2MLXA 3A3NB 4NLXA 8AT1B 1IXKA 4QU7A 4IQMA 4X66F 4W92B 2KT2A 4P74A 4CLYA 4Q44A 3D6HB 4I6WA 3I0RB 4U67Q 2BA9A 1FT8A 2DJWA 1VIXA 2GIRA 5JJBA 2GIFA 3GYGA 4B3RF 2VFRA 5BJRA 3J81U 1I94F 3IG1B 3W1YC 4IO9Q 3D66A 3DI6B 1IJEB 5A2QY 4X65F 1TP7A 1G6BA 4NI2A 4RW8B 3LH2S 3QBCA 1HARA 2BRLA 2GFFA 2UVVA 3SXLA 1SC3B 2VU5A 2Q3PA 4WFXA 2W9CB 3I55S 4NLVA 2AWZA 2W8LA 1FRXA 2J5AA 3ONQA 1HKAA 1S79A 2DH9A 4OX7A 2R7QA 2W9BB 4J9LA 3V6KA 4UY85 4TY8A 5E0OA 4A8FA 2IM1A 1RAOA 5KFIA 3BBFA 1X9WA 2RMLA 1T3OA 5DDOC 1FRLA 1CJVA 3NAIA 5ETNA 5KFTA 5HSPA 1HD0A 1S1UB 4KIAA 1DAXA 1T9WA 2FLOA 2KXHA 4C97A 4LF1A 3EYZA 1S49A 4KYZA 1MROB 1M0SA 1BWVA 1QTNB 3MPYA 1ZM4A 5I42A 1RI7A 2GVZA 4URGA 4Q0BB 1Q78A 3UFCX 2IM3A 1RTIB 1WDTA 2CPDA 1HNVB 1PG5B 1U02A 3DLBA 3KK2B 1RACB 2IA0A 1H7XA 1I3OB 2G0JA 4CNYA 4JYAJ 1FXLA 3C2PA 3EPGA 1IBLF 2BE9B 2P6SA 3KK1B 1VR6A 1HQUB 2K7KA 1KHWA 1SC4B 3MECA 3NNHA 1WUUA 1BXNA 1V6HA 2RDJA 1LWXA 4MIAA 3TQEA 1AW0A 3PFOA 1IWGA 1R6YA 2I5JB 4NCGB 2K06A 3OQ2A 1LW0A 3M4XA 3Q89A 1PYSB 3R97A 3TAQA 1IQTA 2WK4A 1MMDA 2I6WA 1FWLA 4YDDB 2BE2B 2XEXA 1F3FA 3MUMP 1KTQA 1XTZA 2Z58B 1EHWA 7FDRA 1NK7A 1MLAA 1CQMA 4I2PA 2AKWB 3QWUA 2V4RA 1J5OB 2UV8G 2HHPA 4NLRA 5ETSA 1RP5A 2NZCA 3VALA 1NB7A 4WYWA 4M5NA 4DSLA 3ILIA 2CQHA 5HVHA 2RF2B 5FLXY 1WHYA 4ZS6A 3SMZA 4CO5A 5KFWA 4AQYF 2XY5A 1REVB 3TI0A 3W64A 4DG1A 1U1RA 3TAMA 3EGZA 1U47A 3QIPB 1VK3A 3QIPA 1RWUA 2M5YA 2F9JA 1WG4A 5K8MA 2RU9A 3UN2A 3BSOA 1OMSA 2CJXB 1RTDA 1HYSA 4NMXA 1S1WB 2BM1A 3JSRA 1U0SA 5GADI 1S6QB 1FTCA 2EKYA 3NGSA 4UTGA 3K2YA 3D54A 5KG7A 2O3DA 1SKSA 1RHQB 1NJWA 3IRXB 2IA6A 4HVZA 2RHQB 1RJJA 3QJLA 3Q23A 1QAJA 3NRBA 4QJVA 2IVMA 3J7ZT 1VQMS 2OMLA 1F5BA 3S7RA 4DV3F 4TU9A 2E9ZA 5B0GA 4ZP6A 2V2VA 4H4KC 3W8GA 2MXYA 4ECVA 2DRAA 1H6KX 3DYAB 3R7SB 3Q2TC 3DRSA 5D0RA 1FHTA 2DNGA 4ICLB 2E1RA 3ZZTA 1AB8A 4ZVRB 1CJUA 2IM2A 3D9BA 4MTPA 4AXJA 4F2SA 4JP8A 1DTTB 1NBEB 2B7BB 2W8KA 2WSEC 4MYTA 2MMYA 4LF6F 4OZNA 1JKHB 3HJFA 2R7VA 4U7UD 4ED7A 3MM9A 1XQIA 1HA1A 4U6PA 2EK6A 1R8AA 2R8JA 2PEHA 2HFUA 3FMWA 4YB7A 3FSIA 2OTJS 2IJFA 1FWPA 2QFIA 2RJZA 3HVWA 4QYRA 3GJRB 2CIMA 1S1TB 1Q16B 2BQ3A 1SC6A 2DNLA 1HNVA 1S72S 1UW4A 5DO2A 2RS2A 1Y10A 1NSAA 3DOKB 4OX9J 2QL9B 4Q0BA 2IJNA 2YH0A 2W4CA 4GKJF 2HK2A 4ZMMA 3VTIA 2E66A 2AZ3A 2DK2A 2BJ3A 1QE1A 3EXCX 1G7CB 3K5PA 3MCNA 4IH6A 3WIUA 4DN0A 1I6JA 1S1UA 3RRHA 3VGSA 5F8LA 1SH0A 2HNZB 1N52B 4G65A 4USVA 1NXIA 4LMZA 3HSGA 4QIWD 5KAKA 2VOPA 3D68A 1RBOB 5EUHA 4K4YA 2QMWA 2ZBQA 2ZVIA 4LF2A 4B17A 4TY8B 2XO6A 1HNWJ 2EXUA 3VWSA 4YR3A 2BANA 8RUCA 4X4QA 3CPWR 2Z57B 2J6TA 4DR6J 3G8SA 1NK0A 1G2EA 4WE1A 4K59A 2DEJA 4WKYA 3B4MA 3HX9A 4Y34A 3MMAA 2MYFA 3NMAA 3U1NA 3SCJE 5D8HB 1HHSA 3MMJA 1TKTA 4N8NA 2QE5A 4USHA 4ZVUB 4EGLA 3HFVA 4ZLLA 2ZH8A 2UUCF 1UFKA 2DRDA 4LF9J 4LRDA 3MM8B 1RT7A 1E6YA 4MJKA 5M2PA 4Q45A 3ADAC 1KN6A 5K14B 3HDSA 1OQ3A 5DETA 1NKBA 1VC0A 1RADB 4OLPA 2ZOMA 2RUSA 3LANA 2ATCB 3TP2A 3TA0A 4ZLNA 3ENAA 2ZDPA 4FKYA 3UVJB 1WKLA 1K9MT 1FKOA 4E98A 1WC6A 2QO3A 2ADCA 4PWWA 3EZOA 3I9V9 3MAAA 3T6BA 4EMDA 2JL9A 3MHYA 4K5RA 4RNNA 4YHHF 1WG5A 5AJ3J 4NLPA 8ATCB 1N36J 3MTJA 1NNDA 3RB3A 4HDHA 3M2VB 5KFGA 1RAFB 1ACMB 3TUPA 1F2HA 3BSNA 2DPIA 2CPJA 2OELA 2GGPB 3C16A 4NWBA 2YKOA 1CVJA 2GMJA 3KUEA 5H9FK 3BO2A 4LF8F 1P1TA 1FDAA 4J9NA 2XWYA 1T03B 2AGOA 4QW8A 4HACB 2OSRA 4P6QA 3KWMA 4KHPJ 4J9OA 1IKVA 3PY8A 5KG5A 2FVPA 2EBGA 3VGVA 2C2EA 2BZ2A 1JWWA 1X4BA 2YPZA 5CYQA 3MEDB 3OV7A 1T7PA 5I4MA 1LWEB 1FD8A 1F1BB 2BOAA 3WC2A 3S01A 3HLUA 3CMAS 2DR6A 2OPRB 2N82B 2P5VA 2DXEA 1RT3A 4O4RA 4J9QA 4GC7A 1FI4A 1EIYB 1U2CA 3IWLA 4FF2A 4WZQA 4NA3A 1IVZA 3UDEA 5HLFB 1IN0A 2YX4A 3F44A 4HL9A 4ZVHA 9ATCB 1VLOA 2E1CA 1LFWA 3H0PA 3PDNA 4DV0J 4NYZA 2XY6A 5A6WA 2HVEA 4J91A 2F8MA 3MD3A 5HMXA 4ID8A 3EX7B 5H9EK 1GAOA 3M6WA 3M9OB 2A2DA 3M8YA 4ITSA 4LJMA 4C8NA 3UR0A 3M1VB 5IXUA 1XC9A 5J2MA 2GHWA 4YS2A 3BGLA 1IKYB 1URRA 5J2NA 2HGMA 2XLIA 4QOTA 2YNFA 3DLEA 2JFDA 4DL4A 2Y0SD 2MKIA 1B0TA 4N56A 3RUBL 4HTJA 5BXIA 4RW6B 5KFVA 4DL5A 2F4VJ 2XYHB 1GMWD 2AW0A 2B0GA 3BB5A 3OFGA 2ZNYA 4NMLA 2IAJA 3VAMA 2GA7A 4K8RA 3HHDA 3KDOA 2VQEF 1SJFA 2W7OA 1DFDA 2EFNA 1W2IA 2WOMA 3P4UB 5E3PA 5D3GA 2B4PA 2E5HA 1JLEB 3AT1B 4FF1A 4EU0A 1UFWA 2NUUG 2HFVA 4OJ1A 1IBLJ 2B3TB 2OP5A 3MM6B 3QT7A 1UEKA 4LRBA 3VAHA 5DZ7A 3PVXA 3I5AA 4J9PA 3SEOA 4YN3B 2BQRA 1TKDA 2VL1A 3C6UB 3IFEA 3K89A 1GXLA 2ZHOA 1W2BR 2R8KA 3NBPB 1H2VZ 3CCTA 3DU6A 4V19X 4CT9A 2XMKA 3M32B 5J1PA 1SBRA 2QJ3A 4O3RA 1U2RA 5E3QA 2OI2A 4DPTA 4FS2A 3UNYA 5M2UA 3OLBA 1Q8LA 2WB4A 1C0UB 5E5NA 5EX0A 5GVQA 3DDKA 5AXMA 4ZPVR 4RUCA 3KLEB 2ZOGA 5J1EB 4BLGA 4M5GA 2DGWA 4LR9A 2DR7A 3AOAA 1S9GA 3TVKA 2AX0A 1U1OA 1L3KA 4DLGA 4C8MA 2BJ9A 2QT7A 4TVAB 3CDBA 1X4FA 2ZHAA 3DRPB 3CC2S 5JUMA 3SZ2A 3SV3A 4UY8T 5EWGA 2OD6A 1XJWB 1NHVA 5D78A 1RT5B 4B9SA 3P49B 3BKUA 3DM2B 3FZ2A 3HZEA 1S1VA 4C11B 4QBUA 2BKNA 3E2EA 5DDQC 3EDQB 2R2RA 1F2GA 2D1CA 3PW5A 1LQ9A 4OYXA 1D9AA 5D3GB 1RT7B 4RBVA 3ZXWA 4CLSA 3I32A 1LWFA 3UCZP 4PQUB 1N33F 3ZZRA 1EB0A 1ZA2B 2DNRA 1IBCB 1WHWA 2LDYA 2FZKB 2V8PA 3OD2A 3RW7A 2J7UA 1HBUB 3R5AA 1YZ6A 3M6XA 4PUOB 1BC6A 4UQTA 4NOHA 2VQFJ 3A3PB 2OJ3A 4CLZA 3W5XA 2F8HA 4Y3CA 2VPYB 5FLXU 2V68A 3P8BB 3J7YU 4ETXA 2VPXB 3IR5B 3QSIA 3PX4A 3D67A 1S97A 2EWHA 3PFEA 3KYLA 2PC6A 3CCRS 2ZJPQ 3IAM9 2K3IA 1X7VA 1KOHA 1HWJA 2NYHA 3Q8UA 5RUBA 2KH9A 5IM0B 3VAJA 4C8YA 3MOJB 1N5VA 1BE4A 3HVTA 2OTLS 3MM5B 3QGIA 4X4NA 5A76A 1DQ8A 1HWUA 2LFVA 3LP1A 3OR2B 2J8AA 3G96A 3W2WB 3RAQA 1OY8A 4TYBA 4DV7J 2NXEA 1A0OB 2QA2A 3O1LA 5IT0A 5E41A 3FBFA 5LXYA 3FBEA 4F36A 3L9ZA 5CYMB 4JI7F 4QWEA 4IOCQ 4A46A 2ADBA 2YBVA 2BW7A 1UWBA 5B0BA 3NL0A 3W5YA 4ECUA 3C3LA 1R7IA 3D3CJ 4PUOA 2V50A 2H5EA 3TVZA 3FFIB 3LP2B 1SH2A 3DHWC 4RW7A 5HJXA 3ISZA 4P2XA 1RAJA 1S1VB 2N7CA 1K8AT 1B70B 4NZ0A 1Y00A 2B4OA 1RLCL 3P5BP 4JI6J 2MKSA 4DR5J 4DR7F 1GK8A 1YLXA 1BQNA 2FHKA 3K8VA 3OR1B 3RYLA 2BX6A 2DIUA 3EGVA 2XLJA 2C2DA 3ET6B 1SIZA 2CNKB 1S6OA 3FK4A 4Y2MA 1OWXA 3GYXB 1CULA 4J5OA 4IKAA 1AFJA 5K20B 1H2UX 1Q82T 5GAEI 3KLEA 1HL6A 1PILA 2ZNZA 1X4DA 3DRPA 2FHMA 4LF5F 6FD1A 3HKWA 1U09A 1NSKL 2FVRA 1HNXJ 1REVA 3GONA 3GCXP 3MAQA 1VC5A 1NLKL 9RUBA 1B0VA 3QT5A 5C24B 4A8OA 1WHVA 4WTOB 1S7HA 1TTHB 1K0TA 3OTDA 2C3YA 2V69A 1I5OB 1DTQB 1TQLA 2WW4A 4RNMA 3GIKA 4EO6A 2RDIA 3GV5B 3T3FA 1JMTA 2WW8A 3GIJA 2UUWA 2R42A 4CLTA 4ZP9A 1CJTB 2DGQA 2YTCA 5B0DA 4ZJQA 2KFNA 3HSZA 4JI5J 2O01C 3ZZPA 2DNKA 2XMJA 2HNYB 5A8WA 4WU3A 3MD1A 4NEYA 4KKOB 5HJYA 5IV3A 3QO9A 2AHOB 2O5DA 4OYAA 5HROB 2XCAA 4K5SA 3BGOP 4DSFA 2PA3A 2OUGA 3C66A 4OZ3A 4USJC 4FYDA 4KT0C 2ASYA 3HD2A 5KFRA 3PYFA 3KK1A 4NYOA 2WCXA 5B09A 1QD1A 3M7VA 4JUZA 2D7SA 2ACYA 4YDXA 5E3RA 1KFSA 4PYDA 2X51A 4ZKAA 3ZTQA 3SIPB 4Y0FA 1FE0A 5KFJA 2PN6A 3GMGA 3N9UC 5CD4H 2CJQA 5ETKA 3ZC4A 1K0VA 1WOOA 4PXDA 2FHJA 1NM2A 1MROA 2EKNA 2CQ4A 1Q5YA 2HIQA 3FQKA 3ITHB 3LA0A 2X3DA 3IGNA 3T41A 2DNMA 2DXDA 5DS7A 1ZM2A 2VG7B 3R5CA 4IH5A 4XPCA 1JJ2R 1CSJA 3RB6A 3POTB 3VF0B 4RW9A 3IRWP 1F5CA 2HVZA 4PWDB 2CNNB 4Y65A 2FTRA 1YQHA 4LR7A 1SUQB 3V6HA 1IKVB 1SJQA 4WFNQ 3LWMA 1SJ4P 1YG0A 2KU7A 4LUBA 3AD7C 3J7Z5 4X4PA 2HEKA 1FEEA 2OPRA 3HM9A 2DXFA 3QO9B 5HROA 5F8IA 1QVGR 1FFGB 5KFKA 2KT3A 3EM1A 3SSSA 5A8WB 4ECTA 5IV4A 1CBKA 1SXLA 3FRZA 4GVBB 2XYPB 3PR5B 4A8SA 4FPRA 1FX4A 4X2BA 2XGPA 4OZLA 5ETQA 1JLFB 5IC4B 2YY3A 2LP4A 3H2VE 3NGDA 2BABA 3MEDA 2XLKA 1ZPVA 1VQ4S 4DJBA 4H4KA 4TY9A 3BSCA 2GVDA 4DR3F 2P9GA 1Z1ZA 3ISND 4I69A 4FF3A 4HT5A 4LR8A 4F02A 3VAIA 4ZVFA 2DH8A 3R1LA 2UXDJ 2HGLA 4DQIA 4J7CA 2HS0A 2U1AA 3DMJA 3VAKA 1BUXA 4ED4A 5JMNA 1BQMB 3TANA 4WK1A 1OYEA 4ZPCA 4YQWA 1J5EF 4F26A 4L74A 4DQRA 3B54A 1NJXA 4QIGA 5CYMA 2HSEB 3MAAB 1VIOA 1N5YA 4D3HA 4U8YA 2DNOA 5F0UA 4X4SA 2HHSA 4WE1B 1D0EA 3DLLQ 1XMQF 5A8RA 1T9YA 1KDNA 3KNAA 2IMOA 2Q79A 1TL1B 3CMQA 5KFSA 1AFIA 1NKCA 1FKPB 2W7AA 4I2QA 4RU2A 3H40A 4G1IA 2NZ4A 4I64A 1V5VA 1N48A 3CSKA 3AQPA 1N5SA 4NLQA 1N56A 1MU2B 3A13A 2Q43A 3RTVA 2PMZD 2W9AA 4NXMF 2OIHA 4FNIA 4KRWA 4P73A 4ED0A 1N33J 1WD6A 2O67A 2C3UA 1NRKA 1VYAA 2LEAA 2RILA 2XSJB 4HTIA 3CDAA 1X60A 4NA2A 2R7OA 3IR7B 3LW5C 1WSRA 4CT8A 3W2WA 5LT5A 1AUDA 1UP1A 1RKIA 1CJKB 5LMNF 4CI0B 3GFXA 4CO3A 1YGYA 2PDAA 5KFOA 2E5LJ 5CYJA 2JEIA 2JJ4D 4ZCKA 4Z2XA 2F7VA 1R8PA 2ZC3A 4UOHA 1L3TA 1M5HA 1M5SA 5KTQA 1VK8A 3IC1A 3RR7A 2AEJA 5D15A 1RCXB 3DC2A 2QLXA 1REGX 1WC1A 1X8DA 3A1YG 1IKXA 3DRSB 2FJBB 4RPFA 4QPXA 4F4YA 4AQYJ 1T3NA 2BJEA 4NEZA 3MM9B 4FYXB 1YVFA 4QR2A 5D4OA 3R9LA 2QSWA 3ENQA 3PM9A 3DU5A 4DQQA 1O6XA 3I4PA 3MPUB 4U7CA 1R0CB 2UXCF 2QGFB 2L9NA 3PZPA 2U2FA 3MGJA 5ETOA 4F4XA 1F9EB 5DLFA 2J6UA 2XZDB 5HATA 2VA2A 1F0XA 3EDRB 3AOCA 4RZRA 5FDLB 2NQPA 2R7RA 5DGBA 4W90B 3QGGA 2CQPA 1KBRA 2YKNA 2VBZA 4KGMA 4OZJA 4Q2LA 3TJ8A 1LWFB 4M5HA 3O44A 3SCLE 3D1OA 5ADZA 4F50A 1B64A 1O5JA 1GFWB 4OQJA 1A9NB 4ELUA 3IGVA 2B9WA 4I7FB 1IM4A 2MSSA 1LW2A 3QFHA 4IRDA 2LEBA 1PJ5A 3G82A 2MZQA 4IDKA 1PCAA 1NPRA 2VF3A 2W25A 1PYTA 4QIVA 4QWDA 1VQOS 4F3OA 4M94A 2YNGA 3J7AN 4C0BA 5JVGQ 2CQ1A 2OPQB 1WI8A 2YNHA 4CDIA 3BDPA 1S6QA 2HURA 4OYBA 3NWRA 4N5SA 2JVRA 4DL3A 2BE2A 2MTLA 2RF2A 1WOPA 2WZ1A 3OFFA 1KQGB 4MK9A 4IO1A 4OYMA 4R0EA 1RWXB 5KG1A 3KG4A 3JS9A 5IT4A 3CUNA 4DS4A 1C1CB 1R0AA 2ZKTA 3CNQP 4L75A 5MAOA 4J9KA 1XNQJ 3SYZA 2B56A 1J5OA 2HIYA 4GMKA 4BCAA 5GMKa 3AY0A 4GKJJ 4RX6A 4UF4A 2HHHJ 2VD3A 2QSFA 5G4DA 1U0HA 4NASA 1U1KA 2YKPA 2HZVA 1MWZA 2ZBCA 4TN2A 4TQSA 3O3LA 4N47A 3N79A 3NCQA 3J7A1 2ZC4A 5HO4A 3VZIA 2XYGB 1QUPA 1BY9A 4BWMA 2RQ4A 1UFLA 3C14B 4DV1J 5F8JA 1CC7A 3OXFA 2IPOB 4R5PB 4U9RA 1UA0A 3OXGA 1VQ9S 3KLFB 2LDIA 5E7OB 3QIDA 1R89A 2D3UA 3TYTA 2HW3A 3UDLA 2UU9J 3QPIA 4DFMA 4G6VB 1RISA 4JI1J 5L39A 4M5DB 2KHDA 1T0TV 2L9WA 2YPYA 3C19A 3L7PA 4K4XA 4BS2A 5D0EA 2NS1B 1XK8A 3BGRA 3FKBA 2G0IA 1MG7A 2HQGA 3L3CA 2GO9A 1X9SA 2FJVA 3T1AA 4RLEA 2ZKUA 3RBZA 5GAGU 1RYRA 5IT9U 1OY6A 4MIWA 4HYKA 1VQ7S 1Y3JA 2V2QA 4J37A 5KFHA 3E01B 3DRYA 2UUAJ 1GX5A 2OFGX 4R5PA 5LXRA 3UD4P 1F6TA 3L09A 1FK9B 1XMOF 4FXDA 2JLEA 4L6V3 2OEKA 4M5LA 2PEBA 3IG1A 5EGYA 1Y9OA 4JI3F 1NH7A 3ZTOA 4C0OC 4CO0A 2XS7A 3I87A 3HI9A 3N5FA 2R8HA 2OSQA 1UVLA 3THTA 3VCDA 5L46A 3GB0A 4ALZA 4QPTA 5CABA 1NJYA 3JTNA 1S10A 3BN4A 5F3TA 1Q8IA 2KRRA 3R6GB 1XNRF 1B4SA 2HVIA 2F1FA 2IRUA 2NPIA 4OZ2A 4FP9A 2JEGA 4ZVTB 4YOEA 1RTHB 3DI6A 2ZE2A 4U7UK 2GCFA 4ZVOB 1NK4A 1RE1B 2D69A 2W9CA 2CPXA 4DV4J 4B3MJ 4ECYA 2CYYA 2GJ2A 4Q5VA 4IQXA 2PO4A 1OSDA 3M2RA 3BH6B 2BJ1A 4QYZJ 1XMBA 2OPPB 4WXOA 2DIVA 2W01A 3R2DJ 3JTPA 2VKRA 4DN9A 1A7GE 3R7BB 4PCQA 1VJQA 1IBKJ 1C1BB 1FWKA 3BPDA 3NS5A 3R2CJ 3KG0A 4EFAC 5F9LA 2AJQA 3HT3A 3M2UA 2RB7A 3L7UA 3CB4A 2XTJP 3EPIA 3W9HA 1NHUA 4U96A 4P7VA 1FVSA 4Y2AA 4RW4B 3CW2C 4TU7A 1VHIA 1GEHA 2NSCA 2V4JA 1Y3KA 5FDLA 2F63A 1RT6A 2JLFA 2R3VA 5CZVA 4C6AA 3Q8VA 5GADU 1SI9A 1KLMA 4UW2A 2MZTA 2W4PA 4KB7A 1BD6A 1XR6A 3MUTP 1LXJA 4LFCJ 4N76A 4PG8A 2R7XA 4IG0A 3CMES 2UVUA 2E44A 2LKZA 4C4WA 2FZCB 2DHXA 3VZHA 3LP0B 3ZFVA 3MM8A 3Q2SC 1KSPA 2EG2A 1SQEA 3RB4A 4UUWA 5LL6d 3THVA 5K8NA 3NNAA 4RUAA 2BJDA 3T1YF 1HWLA 2CJAA 1QY7A 2QLBB 4B02A 5AE1A 1PAEX 1VBXA 1K47A 1HNZJ 5DG8A 4LF7J 3OVBA 5AXKA 1H98A 4KH1B 4LIRA 2V63A 2EK1A 2VBXA 4ATNA 4DUYJ 3EE3A 3MEGB 2CQIA 3KHHA 4DSKA 4URSA 2C2RA 4JI2J 2C3MA 1WTFA 2F3JA 2W4DA 2IFXA 3JXOA 3VHQA 4CM2A 3OJSA 2IYIA 5CD4A 3T5JA 2QN6B 4YB6A 4EBDA 3G9CA 4DEZA 1VHFA 3MWBA 1R31A 2WVCA 3DRXA 5ETRA 4LFBJ 4AD6A 1PO6A 2VBYA 1PGZA 2G1DA 1U6ZA 1UZDA 2GHVC 3R5DA 4KE5A 4DBQA 4DX7A 3BO3A 3J81j 4GC6A 3K0JA 2JVOA 2V9KA 3FBBA 3UN5A 2R2SA 4IRKA 3CJRA 3KUGA 2FJAB 4CH1A 3W2VB 4JI0F 1UA1A 4JV2A 1HLWA 5DJBA 2I0XA 1FX2A 4JV5F 3GIRA 2D41A 3HD1A 2L9DA 1KKHA 3MOZA 4I2QB 4IG0B 2ZH3A 3BZQA 3HFZB 4PKDB 1TL5A 1S4EA 1X5TA 3UO0A 4CH7A 3K5NA 1UVKA 2XMWA 2XSJA 3NCRA 1K73T 4LF4F 1ZM9A 1Y4ZB 2CADA 1W25A 5DDRC 5KFUA 1TUWA 4FYVB 3CXCR 1RU1A 3PEJA 4UOFA 3EGNA 1RAHB 4I56A 2J76E 3V2UC 2MKKA 2FGOA 4PXCA 2F65A 3AJ2A 5I3QA 4WCEQ 4ICLA 3WC0A 2VFTA 3OHBA 4DG1B 2VV5A 3KNGA 3LAKA 5KFNA 3H4BA 1YX2A 1VQ6S 3H5UA 1U7LA 4RBUA 4ZHRA 2DHHA 5D0GA 1XNQF 2VPZB 3UQSA 1LKZA 3PXGa 3MFIA 4ZOSA 3AXKA 4YFUA 1R8HA 3PHTA 3CCQS 1FKPA 3V6JA 4CTAB 4DXLA 4ZK7M 4P52A 4ES3A 3IRXA 2J0QD 3MMCA 3AODA 4OHVA 2LQ9A 3ISNC 3MR2A 2XULA 3ELHA 3QATA 3SV4A 3M2RB 4OI2A 2D3OR 1RYSA 2NR0A 2CDQA 4YEAA 5M2RA 4E8UA 1XIQA 3H42A 4K4UA 4F4WA 2AJ0A 2D9OA 1P9YA 3I5CA 4K4ZA 3B4DA 1U8SA 3DGVA 3CJKB 2DNPA 2RIJA 2WVBA 3V4IB 4WF9Q 3VV2B 3CCWA 1RTHA 4MK7A 4DR1J 1N6QB 2I5JA 2QMXA 4P72A 4R25A 4LT6A 3EZ5A 2W2NP 2XO7A 2ALZA 3TJAA 5AE2A 3D7SB 3QJPA 4NPOA 3CD6S 2CJBA 3EXYA 3ETMA 4IR1A 2N3LA 5F8NA 2BVZA 4I2PB 4WFYA 4KQZA 4QIEA 2MZRA 1Q4RA 1ZTWA 1TR0A 1WEZA 3DGPA 2GQCA 4PG5A 5FIIA 2CQ0A 1RTIA 2I9SA 3CJSA 5CCLA 5HMWA 3HVRA 3NGTA 1HYSB 4PWDA 3VR1A 2MQLA 2HQ3A 2LLZA 2ZJQQ 2ZEJA 4ZJOA 3GWCA 1URNA 1HNXF 2X7IA 2VICA 1Y5LB 3GR0A 3IWXA 4ERDA 3MUVP 3P5TL 3JSMB 2HMIB 3J80Y 3BGRB 5BR8J 3IBFB 3G8QA 3ENVA 5BYSA 1HQUA 1UW9A 4FDFA 5GAHU 1DQAA 1T9UA 1WF1A 3OTOJ 3FGVA 2EVZA 3WZ0A 1SB6A 4KFBA 4KAIA 2MHEA 5HMZA 5KFLA 2RSQA 2ROPA 3ZZ0A 4JI5F 2K7JA 3POTA 1YJVA 2B7CB 2CWKA 3GSDA 3PJ9A 4MFBA 1RA6A 4OL8A 5L1LA 1SJRA 3S8SA 2LXUA 4JI1F 2DY1A 3BBBA 3ITHA 4J9UE 2DNQA 1ULRA 5F41A 4TYAA 3G71S 1O51A 3MAHA 3TQ1A 1D9FA 3VVUA 5A6PA 2DPJA 2ZJRQ 2CQBA 3QLHB 4KGXB 4K4SA 3CIMA 2CXEA 1D1UA 2AU0A 4KHRA 2FYXA 5T14A 4B3OB 2RQCA 1DJ0A 3VAFA 4QR0A 3DN9A 5DQIA 5DG9A 2QL5B 1NK5A 4OI6A 1I94J 3D3BJ 5F0WA 4PPZA 5GAHI 1GMWA 2KG1A 2AYBA 1C4CA 1Y5NB 4NI2B 1NDCA 3R8YA 1U45A 1GQEA 4ZVSB 2L41A 5LM7E 2M8HA 3W65A 5EHHA 1SL0A 2HVHA 3AQOA 3MM7A 4MIBA 2IMWP 3D6FB 1RWOB 2Y1RI 3C15A 4DZDA 1TL7A 2ILYA 2JX2A 5HL7Q 1X0FA 3Q83A 3W5ZA 2UUBJ 3PG9A 3E51A 3GIIA 1TU0B 1I1GA 3TZYA 4ZJLA 3M05A 2W7PA 2ZM6F 3SSRA 1BQNB 4J9RA 1R0AB 3TUJC 3A8JA 2QTWA 4IDKB 3ZNUA 1X4CA 5FD1A 1RHJB 2HVDA 1LW2B 5C24A 1M5KC 2OPSB 4V19J 4RW7B 3M8PA 1LXNA 3D4JA 3KFWX 3LP2A 4R8UA 4OV1A 2LCWA 3UDVA 3UCGA 4Q8FA 1RA7A 2YNHB 3FJ2A 3B6BA 3DOLB 3GFYA 4A8MP 1AXQA 1S7IA 1ZETA 1ZM3A 1FFSB 1R8CA 2YKNB 4RNOA 3NEKA 4ER8A 2B9EA 1RWWB 3DHXA 2M7SA 4JI2F 1CULB 4USMA 4H4OB 2HHVA 2M4MA 2AEMA 3CC7S 3WIVA 3BYRA 3HK2A 2ZH6A 3N6MA 4AL5A 5GAEU 1VS3A 2P8IA 4LFCF 4CRJA 5ETVA 2R7WA 3R27A 2AGQA 3P6YC 2N4CA 1RWPB 3LQVA 3TRGA 2A18A 4OJ3A 4C9DA 2MY8A 5GAGI 1FERA 2MZJA 2C42A 4ZIVA 4QR1A 2PI5A 3LAMA 2DR8A 2CUYA 4C98A 3CO0P 4LREA 2R7UA 2AF6A 2SXLA 5LJ3Y 3D5MA 2M52A 2EFQA 3U27A 3J7YI 3KLGA 4IFVA 1Q79A 3TAPA 1QLNA 1QAXA 3T5HA 4NXNJ 1MWYA 2WVFA 1SV5B 2QLWA 1HBMB 3ZZYA 4NLUA 4LF7F 4K4TA 3BEGB 1MU2A 4ZDNA 4N7TA 3CTRA 2BE7D 3NOCA 4NRUA 3NAHA 3JAMU 3KLHB 3T5LA 4KO0B 4ETZA 3DRRA 5DQGA 5GMDA 3HVTB 2NXUA 1PSDA 3I9ZA 4NL5A 2B51A 4KBIA 5MLCV 1SKWA 3B82A 4YR2A 2KM8C 4YMEA 3GP9A 4AXIA 2VQFF 2FLNA 2KT5A 1SJ3P 2VFUA 3HHLC 1FNMA 2EPIA 1HPZA 3H2LA 3NG8A 5I3UB 2KFYA 3V81A 5CXTA 1RAGB 2RVJA 2RKIA 4QIFA 4DMZA 2AX1A 1MN7A 1YRUA 1GMUA 3PTWA 1UPMB 4P10A 4CWBA 4JI4J 3CJTA 1CS4A 2JLGA 2QG9B 2C2OB 1KLMB 3K5OA 4YP3A 3O5TB 2E7VA 2M8DB 1NK6A 1NB2A 3DMJB 4C8ZA 1N5YB 5CZXA 3CCSS 3L95X 3QGHA 3N28A 4MAKA 2M2BA 4LF4J 1MMLA 3MDFA 1BLUA 1IQZA 2CKWA 4DX5A 2AYMA 3AD9C 5ETPA 4LSZB 1SJ1A 4IUFA 3MPWA 2HFSA 3QGPA 2UXBJ 4LVOP 2W1BA 3AH6A 3CO9A 4ZP7A 3IM8A 2XZWA 2G2ZA 3GLJA 2D3ZA 4C11A 3PX0A 2AJFE 3SQOP 2V4QA 3CCJS 2OPPA 5I3UA 4DUZF 2CPEA 1UKUA 4LFAF 2L48A 3Q86A 3P45B 1GTEA 4FKXA 4KH0B 4PG6A 4WPAA 4NLTA 1HQ2A 4GKKJ 2B8QA 1JQGA 3WDOA 5F9NA 4E0DA 1RK8A 2IYGA 2V6AA 2MHNA 4UZBA 4E2FB 1WHXA 5F8MA 4NZ7A 1KQFB 1JXLA 1HQEB 2O1PA 5BR8F 3OFHA 2GVDB 3QRQA 2WOMB 2H4YB 1JNZB 4BWJA 2HHUA 1S1XA 1TL3B 3G2XA 5HVFA 4EI2A 2E7WA 2AMCB 4EO8A 4RNFA 4OYIA 5KT5A 1UVNA 1YBAA 1IR1A 1YJRA 2UV8A 5KFYA 2Z2MA 2RHSB 1GTHA 3KJNB 1D09B 1YDLA 3CGIA 3N4WA 3W7BA 3TOQA 4X4UA 3M8QB 1LOUA 1VRUA 3BH7B 3GTYX 1GNKA 3E01A 3OL8A 1FJ7A 1OJ4A 3BKFA 5DLGA 2P2CB 1P6TA 5IFMA 1KC8T 5KT7A 2COLA 2HRTA 3BGFA 1FNXH 1S0OA 5J2PA 3ZO7A 3K57A 3CJ3A 2HWHA 5HVGA 4B3RJ 3T6JA 3MI7X 4F0MA 2AP6A 1AT1B 2YH1A 4RW9B 3I0SB 3KLVA 4AL6A 1JLAA 1D3WA 4QW9A 4A48A 3KLGB 2RRBA 1NHKL 1PJ7A 2K3KA 1FRHA 2C2MB 2MJNA 3V4MA 3BQ1A 4DV1F 4ECZA 3T1HF 4O3OA 4ZCMA 3T9NA 4TQRA 4LSLB 2Z2LA 2HBYB 3AJ1A 4X64F 2ZH4A 3PKMA 1FFWB 4EEYA 1CQNA 3Q8PB 2Z0GA 4FYWB 2C3PA 3CDWA 5L8RC 2DBBA 1MNEA 3GIMA 2LQ8A 3EVMA 3G6YA 1FVQA 2C2NA 2J9CA 4L72B 2OMOA 5CYQB 3MR3A 2A6OA 4B08A 4RWWA 1KVIA 4NLSA 4ZPDA 1DTQA 4LBPA 2XNRA 2ZBPA 1U0HB 5HN0A 4MKYA 2QLJB 3W61A 3K58A 2HG4A 2HYIB 1WC4A 4HI2A 4A47A 2W2MP 1T8EA 4YUDA 3PO5A 4ED6A 4USUA 3FNNA 4A4JA 3QRPA 1OY9A 2R2UA 3OW2R 1TVRB 2V9WA 3HCXA 4QWBA 2XMAA 1PKUA 3FCHA 2MPUA 4ECQA 3DKDA 5HAOA 1XMOJ 4I68A 3RR8A 2G1HA 4H4MB 3LUYA 1RAIB 2VBWA 4WIQA 1RAAB 1UPPA 4Y2CA 2XY7A 3OL7A 4A8XA 4DV6F 2Q6BA 1C0TA 1WF0A 2OPQA 3LALA 5SUHA 5B08A 4O3QA 2FD2A 2JSXA 4Z37A 4C3KA 3OR1A 4Z7YA 2GX8A 1S4FA 2DNYA 1WOSA 3TW0A 1T03A 3A4TA 2VPWB 2IIHA 1WF2A 4HDGA 3AB2B 5KFBA 3PX6A 2UU9F 3LGNA 2GGPA 1EAYC 3BO4A 1TVRA 3CJ0A 3UPFA 4LSNB 3FEZA 5IOLA 4PZVA 1DRZA 3X3UA 1XN9A 1NH8A 2QL7B 3BS9A 3HULA 1Q86T 3ET6A 1M5OC 5KT4A 4DCJB 3DXBA 1NK8A 4F2RA 3CJQA 3HZGA 1GMVA 1TKXB 3AFGA 3RB0A 1M5PC 4NXNF 1NDLA 1FJCA 4CO4A 4ECWA 1VQLS 2XNQA 3FFIA 1JLBA 4PXBA 2LQBA 2QYGA 3V81B 3AHPA 3GCWP 1VQ8S 1X5OA 3ILLA 2HWIA 3N5BA 3R1HA 2VONA 1EARA 3DLHA 1SPBP 1TKTB 3CCUS 2X1BA 2D9PA 2BJ8A 2CNOB 1JLAB 2YWHA 3A8IA 4P7TA 5A8KA 2Y8YA 1R27B 1PJ6A 2RDDA 3M9NB 2CG8A 5J2QB 1LNQA 1IJFB 3RAMA 3SDEB 1U1PA 1H3DA 3FCVA 1GXUA 3N0VA 4OMFG 2HFZA 2DHSA 2XI3A 2F5GA 3FDSA 2VFVA 2LA6A 4DSEA 5A8KB 2FC9A 2D3O1 1U4BA 4B3TF 4TLQA 1N32J 3MM5A 5AXNA 4ECXA 4LF6J 2BRKA 5L1IA 4CNZA 2DY9A 3RJMB 2MDAA 2PE8A 2YWFA 4MT1A 3T19A 5JXSA 1IBKF 2BDPA 1RZMA 1CEZA 1AA1B 2H4WB 1RBLA 3GPAA 1UEVA 2DTJA 2GW8A 3LO3A 4YB1P 1N5TA 2CJ9A 5HI7A 3D0HE 3BJYA 3M30A 4NXMJ 2HQIA 1B0PA 3CEDA 2BYCA 5KFXA 2AQ4A 2BV3A 2PMHA 3ULHA 4PWUA 1WKJA 3ZZZA 3MEKA 3TEHB 4Y00A 4UOCA 4KV8B 4LBIA 2DGXA 2C3OA 3S1TA 1H72C 3CJ8A 2R7SA 4H4OA 2FDNA 2CAJA 4Y2IA 3DM2A 2J8SA 2RE1A 4AT1B 2PT0A 3PRVA 2PFFB 2MQPA 1H38A 3PJXA 1U26A 2HRYA 3HHKA 5HP1B 3CJKA 1LK5A 2CPZA 1Q53A 2L08A 3PIOQ 3HT0A 3DFEA 5HQMA 1U2FA 3I31A 2XMTA 4OI4A 3W9JA 4DF8A 2G13A 1RU2A 4O44A 1JX4A 1IKWA 2BACA 1C0UA 1Q5VA 1UAWA 4GRSA 3GJQB 2LXFA 4O23A 4RBTA 3TUIC 4P2SA 4QQBA 4Q2MA 1PBAA 1B7YB 1S9FA 4WP8A 1VRTA 2XWXA 1WJ9A 3H5SA 1S9GB 2MQOA 4NLGA 1T95A 2MY7A 4DR7J 3RG6A 5HANA 3UI3A 3SQGA 2IDEA 1YSJA 5J1EA 4DR5F 1NPKA 3C15B 4IH7A 2H3EB 1RT4A 3P96A 2V8HA 5EX3A 3G8TA 5L38A 3C6UA 5KG3A 1PYOB 3H25A 3CCVS 2F4FA 3AA9A 2M3DA 3PEHA 3R5BA 4OJGA 2DHGA 1X5SA 2DITA 2ZZTA 3UNGC 3M8RA 3CDEA 4ELVA 2E1MC 4L76A 4LIWA 3IXQA 4DL0C 3C6TB 3DLGB 1ZYQA 1RHRB 1NJIT 2J6SA 4ZN3A 2FJWA 2F40A 3NBPA 1SUQA 3FZBA 3MECB 4I67A 2Q66A 2UUTA 1S76D 4JI7J 1YJ7A 2DGSA 1P1LA 5C42A 5IQ6A 2MKCA 4DR4F 1IBMJ 2B8PA 2CPYA 1NEEA 1N34J 2HAIA 3RAXA 2GVZB 3FRYA 2F9DA 4QZVB 4BDPA 5THWA 5T41A 1FXDA 1ROFA 4ZCIA 1QSYA 5J2NB 4O4GB 4EBEA 1DHMA 1FDDA 1HBMA 1ELOA 3GR1A 3P3DA 1FJGF 1T11A 3K5LA 2UUCJ 3AXMA 3D28A 4OJHA 4EYHB 1DURA 4KJIA 2BQUA 1ICEB 2B5JB 4FXVA 4C3LA 1FDNA 1SC1B 5C5JA 2IBKA 2I2YA 5KFMA 4X4TA 1O0PA 3KK2A 3BDEA 1HWKA 3M6VA 1MW7A 2DO4A 2G0CA 1RT3B 2V0NA 1WC3A 3KLIA 1TMMA 3KUHA 5IC6B 3Q8SB 1YJ9S 1LK7A 2GV1A 4X65J 4OX6A 4K4VA 4PG4A 4I0WA 2ZHBA 4TLRA 4C2MA 4TU8A 6FDRA 3CVKA 5DG7A 1IR2A 2V8DA 3CE8A 2AJ4A 3GG1A 3HHLD 3WX8A 4CO2A 4ZLJA 5LOQA 1RHMB 1CJVB 3EVOA 2C1EB 3MPDA 2AZ1A 2LEPA 2XHCA 2ZWOA 3DDIA 3QAUA 4RWXA 5JVHQ 1HD1A 2E1PA 4PRFA 3GFHA 3QMQA 4PPDA 4DQPA 2ROEA 2M88A 1HQEA 3M2VA 1SH3A 1P27B 2EC2A 1NMEB 2QMUB 1KRPA 2V4JB 5E2QA 1WC0A 2DRBA 4KHPF 1LWEA 3KDNA 3JQMA 3CCMS 4A8QA 2VODA 2DO0A 2YWEA 4M63A 1PC4A 2CQCA 2PSZA 3UW1A 2XG8A 3N01A 4F7VA 3H4DA 1HBNA 4X62F 3AA8A 2R8IA 3CCES 1L3VA 1S77D 1WORA 6AT1B 4DUTA 4OHZA 2XS2A 2JFKA 2IC3A 4I1TA 3HP6A 1HNIA 1X5PA 2YQ1A 2Z56B 1TFWA 4LRFA 1MSWD 3HSJA 2H48B 3UVJA 4DFPA 4Q7AA 3C16B 3FUYA 3RRGA 4NA1A 2HRUA 3H5YA 2ZH2A 1RWVB 4DCOB 3RRKA 1UVMA 4PG7A 4LQ9A 2NPFA 3RBDA 2BM0A 2EFOA 2HLTA 3CJ4A 4OV6A 2XMMA 3H7HB 3PO4A 4BHQA 1FEHA 1E6YB 3F73A 4DR3J 1YTYA 1M90T 1D8YA 5KG2A 1FF2A 3IAS9 4CZCA 2YNIB 1EJ7L 3Q24A 4DI6A 1HW8A 4F25A 1VC6A 3OHAA 4CP5A 1X0PA 2OAUA 3KHGA 2XSFA 2IVYA 4NRTA 1VQSA 2HNDB 4N77A 2X1AA 1YI2S 3U1MA 2MKYA 3PACA 4HHJA 4DPXA 1U1NA 1HBOA 2LQJA 1AZSA 2BANB 3GQCA 1U49A 4PAAA 3JQJA 3J80U 5DQHA 2Z4PA 1ZH5A 2GS8A 2FHOB 4P9SA 1KS2A 1TV6B 2ABYA 1VJWA 5GMEA 2F4VF 2NLWA 1HMVB 2CZ4A 3DRRB 2XB2D 1VI7A 1CPZA 1SL2A 2DGUA 2HHWA 2BKOA 3LF0A 1QE1B 4M5KA 2BEFA 4NLDA 3THPA 2WTFA 3DXSX 1TKZB 5LMUJ 2AGPA 2W24A 4IR9A 1YBUA 3M8WA 4MYUA 1YWXA 5EN1A 3KHRA 4LRAA 2VASA 3CJ5A 1Q95G 4P2MA 5DZ6A 2KN4A 3T5KA 4B9NA 1WC5A 5KFPA 2DR9A 2OD4A 5IWAF 1NZAA 3QJJA 3BSAA 2GJIA 1JJCB 4DFKA 3RGIA 3WBZA 4OHWA 2CQDA 3Q8QB 3C8YA 2VA3A 4IRCA 1S6PB 1E6VA 1C4AA 1HBUA 5SZTA 3GJSB 4ZLPA 3DOKA 2YVSA 1DTTA 1UL3A 2MSTA 1SCJB 3DGPB 2VHGA 1FJEB 2C22A 2KKHA 2Y1JA 1KNZA 2QFJA 1PIEA 1Q7LB 4PR6A 5DM6Q 1YBTA 2DKOB 5D0HA 3RW6A 1KVKA 1RLDA 3DLKB 5A0YA 2Y3YA 4LBHA 1V5IB 5C25A 5KFEA 2HS4A 2V2KA 2FGCA 3KMQA 1WNEA 1QM9A 1HIYA 2FPHX 3VVTA 5A2QU 5H1SV 1CG2A 2J7KA 4ES2A 1TELA 1CJUB 1UZHA 2UP1A 4Q8EA 3GE9A 1K1SA 2LMIA 5ETTA 4B3SF 3HMJG 4K2XA 2ZH9A 4DV7F 2V94A 2KJWA 4JBCA 5CCMA 4R8UB 3Q8RB 1FD2A 2PGCA 1VQPS 3A8EA 3SQGB 2KVIA 3FSXA 1JXVA 3V5RA 1WACA 5C7PA 4EUVA 2HAFA 3TVYA 4XK8C 1VQ5S 2V5HG 1KQKA 3KXDA 2WBRA 5CQGA 2BW2A 3U02A 1IR0A 3WX4A 3OSNA 1KONA 3FBCA 4I7FA 2JNJA 3QT6A 4OI0A 5EWEA 1R43A 2CPFA 2A3JA 3IS9B 2QEXS 3JYTB 5LMNJ 1IBMF 3KG1A 5BYRA 2JZ5A 2E5LF 3QT8A 5HP1A 3TAMB 1S12A 1N34F 2MZ1A 2P9CA 4MKAA 1YIJS 3GILA 4J9SA 2HQCA 3DOMB 5AE3A 3DLKA 2ZE2B 1AROP 2B9YA 4KC5A 2KRBA 1HWIA 2NXCA 4KGVB 4KV8A 4CH0S 1DQ9A 3D2WA 2RU3A 2CWXA 4ZIWA 3K59A 4KSEB 4B3OA 2HGNA 1EX8A 4DOZA 1BGXT 5D4NA 4ZITA 1H74A 4Y6IA 4FBUA 2IHR1 1XBWA 1ZOTA 1IM6A 3M30B 4RL1A 5K9FA 3IN5A 2NXNA 4LVNP 2IJRA 4GKKF 2YNFB 3VGTA 4CLPA 1RBAA 1QTMA 2PA8D 5I3PA 4CIOA 3Q0AA 1RUSA 3D0GE 3BYPA 5I42B 4NE9C 1TL4A 4UUXA 5C2GA 1VGYA 4J90A 1B99A 3HJVA 1HMVA 1FTRA 3DLJA 2FLPA 4C8LA 3JTOA 1O8BA 4MKVA 1RHUB 1UJ5A 1Y7PA 2VOOA 3CIZA 1NDKA 4EZ6A 2JWNA 3MEGA 4ZVEA 2FLLA 3QSYB 4OI1A 1Q8KA 3HHNB 4TNOA 4LF9F 4S0MA 5B7WA 4JI6F 4L73A 2ALYB 2HS3A 2ZH1A 4O3PA 2NSBA 2DD8S 4RW8A 1NJZA 4XPEA 2J0WA 1TV6A 2V34A 4ANEA 1OSCA 3M8SA 5HQLA 3QZ8A 1NAQA 2PMWA 3KLFA 1WG1A 1R8BA 4K2JA 5CH7B 3AB4B 5C2CA 1OYDA 2FC8A 1JLBB 1VBKA 2EFGA 3EUNA 3RBXA 4AFFA 4LF5J 1DLOA 2YWKA 3I0RA 1SQGA 1NKEA 2RAQA 4F4ZA 1TL1A 1OPZA 4ZPWR 1Z2ZA 4Q43A 3OTOF 4DR2F 4O0NA 2RH3A 4CYUB 2MKJA 2ROGA 2YKAA 1P9QC 2PI4A 4B9VA 2I8EA 2WSFC 2KXNB 4M95A 2Q6CA 2HNDA 3E3XA 3H5XA 2CPHA 4X64J 4YY3J 1IWAA 2JEJA 1LWCA 1T05B 4LF8J 3IM9A 1FXRA 3SCIE 2JC0A 4OYOA 5D6GA 3Q22A 1XNRJ 1N5QA 1H7WA 4RKUC 1U1LA 1FNOA 5F8HA 4KTQA 4N41A 1YJWS 2IC3B 3OTCA 3IA0A 3MMCB 3NGUA 1JLQB 2YXLA 4FNHA 3UR3C 2OKQA 4OIXA 5KFDA 1S9EB 1OO0B 2QYCA 4DU8A 2OEJA 4NYPA 4L3KA 1HR0J 3W3SA 1JLFA 1N0UA 4F3QA 2ASDA 4DV0F 1HBNB 1V3SA 2FY8A 2IBOA 2ZDOA 4GVBA 4P75A 4C48A 5K8OA 1U6FA 2KYZA 2B43A 4P2FA 5E3AA 1S48A 4FN5A 3OBIA 4ZPTR 2QV6A 2CPIA 2HLUA 2HWTA 4CYUA 2ATLA 4JYAF 4BC7A 4OI3A 4DL6A 1JJ4A 3C46A 4ED5A 2AJ1A 4K0KJ 4HEA9 3H2UB 4CLFA 4HHUA 4I6YA 4DS5A 2BMBA 3OPKA 4DQSA 4A8YA 4KHMA 3NMRA 4RR5A 4ED3A 3V6DB 3FCWA 1FCAA 4DZ6A 3PYEA 2YQ3A 3ICLA 5B0CA 5IT9Y 1F9HA 4EK2A 5E33A 1RGVA 1N54B 2I1RA 3SSQA 5T7LB 3VGUA 4AUKA 4RUHA 2WAQD 1L3SA 2JEFA 2ZWPA 4DL2A 1K44A 3I5BA 4WFZA 3RBEA 2KXFA 4DV5F 2B6AA 5G0RB 5C42B 5EDWA 1S1TA 3OT9A 3TZXA 1FRIA 1S0NA 1A6LA 1WELA 2CVIA 2VG6B 3NCPA 4O4GA 2Y1LB 1X9MA 2JRSA 4DV6J 3OUYB 5LMUF 1S0MA 3CD0A 4DCPB 1RT1B 1UEUA 2GAGC 3C6TA 3DLGA 1P8GA 3IBWA 1KOOA 2E1AA 2DNNA 1EP4A 2H65B 2MEWA 1TZ0A 2LECA 4B3SJ 1C2PA 4CQ1A 3CJ2A 2GNKA 4HH0A 4DF4A 4ZVGA 1XEZA 3JYTA 3IS9A 4C3MA 1WTBA 4CO1A 4DL7A 4G1QB 2J9EA 1DBDA 3BREA 3HKZD 4ED8A 1L3UA 4GO7X 1UCNA 3CD7A 2IRXA 4FF4A 2BBEA 4MK8A 3CF5Q 3W8PA 2MJUA 4IFYB 1FRKA 3G86A 1JXEA 3TX0A 4X4OA 2QX0A 4XDCA 3TEGA 4W4MA 4K4WA 3L4BC 1S1WA 1JIHA 4G3IA 2P6TA 3ZTRA 2XQCA 2J0SD 2VB6A 4K50A 1VRTB 4HI1A 1JJHA 1RT4B 2YNGB 4DPOA 1QSLA 3NOGA 2VH7A 4ZA1A 5IS2A 1H73A 4L3NA 2HPUA 5KFQA 4WFAQ 4UZCA 5ETMA 3TZWA 4PYAA 2OHDA 4RNHA 5A0YB 4H54A 4O44B 4U95A 4FPIA 5C25B 5DDPC 5B0EA 2KM8B 2EW9A 3HXMA 2A2CA 1N0VC 3M9MB 1OQ6A 2KZZA 2LU1A 4JI4F 4U8VA 3T9ZA 4QCLA 1IKWB 3F41A 1TFYA 2KI2A 3TR5A 2AYEA 4MKBA 4RJVA 2R2TA 2AT1B 5HBMA 4WU2A 3KJVA 1S6PA 2UZAA 3TUZC 1T02A 3B78A 1LV5A 2MZSA 4TXSA 4J9MA 3TA1A 3UWTA 4ZN1A 2UVWA 3GG0A 5LSRA 4JI0J 3RZAA 2ZITA 3JB9k 4QU6A 1Q8BA 4JI8F 2YKMB 3CT9A 3OL9A 4HKQA 1RB0A 5KG6A 4X84A 2CZVC 3MURP 1HNWF 4WP9A 1UJ6A 3UD5A 2GMLA 2FJDB 3IO1A 1RHKB 2CVEA 2H5IB 2RUGA 3ILJA 5ETLA 3R5JB 3MCOA 3ZNJ1 1T9TA 5CA5A 4MH8A 2OGUA 4NLWA 4X4RA 4DUZJ 1QSSA 3PV8A 2K1RA 4X66J 2F8EX 4ZCLA 2VG7A 4KPCA 2WVEA 1W26A 1DARA 2XCPA 4F4AA 5KFFA 4KY3A 3OVAA 3IP0A 2R4FA 4WK3A 1JLGA 2HQDA 3FVYA 3MPVA 3QNWB 4ID5B 4C0HA 3NS7B 4DX8H 1PBUA 4NLYA 3ILOA 1I51B 2XHWA 2IM0A 2POKA 1Q0NA 4O3SA 3BM7A 2WONA 2VG5A 1RAEB 2Z2YB 5KT3A 2IRYA 2OLWA 2FJXA 2YNIA 2P9EA 4AL7A 3HHLB 3MEEB 2Y0BB 2XS5A 1VMBA 3BQ0A 2EFVA 5FJ4A 1JK9B 2HK3A 2G4BA 4KKOA 5KFAA 2Y1IA 1TUVA 1VQYA 3LGHA 4MMOA 4FVCA 1QAIA 5B0AA 1EQMA 5E3CA 4OZ5A 3JAMY 1XERA 2ZFHA 3TNVA 3CDUA 2NXJA 3NKYA 4XIUA 2FIUA 4A8WA 2NUHA 3CCZA 4AE5A 1CJTA 3HVAA 3TARA 4QWCA 1KEKA 5H9FJ 4KGKA 2KJVA 1R6VA 4O3NA 2ZUGA 2Z8QA 3FQLA 4M5MA 1C1CA 1WEXA 2E29A 3FC9A 3DOLA 3T1HJ 3OTEA 4CCHA 3NNCA 3OL6A 2J9DA 2R8GA 5LSOA 1TUGB 3GJTB 4ILRA 2ILZA 3KMSA 4A8KA 4IOAQ 3OXLA 1ZZFA 2OPSA 2VJUA 3UE2A 3PHEA 4OYWA 3BR9A 2YX1A 3PNIA 1JLCA 1NPPA 3KJQB 2LVWA 4FVMA 1QVFR 3PW7A 1KVJA 1FRMA 3G82B 2E5GA 2XMVA 3MZIA 3HSDA 4R0JA 2B9XA 3K5MA 3JSYA 4Y28C 3M8ZA 3NLCA 1TL7B 4EZ9A 1IUJA 4F67A 4DV4F 4B3MF 1RCOB 4QYZK 1ITPA 3MMBB 2EFPA 1V3ZA 2LQ5A 1F5AA 2D74B 1RWKB 5LJ5Y 1RWMB 3QZ7A 3UCUP 1MN9A 2QZ8A 3AD8C 4N8OA 2E9RX 2YX7A 3KLIB 2DGTA 2APOA 1NDPA 4CLLA 4DHVA 1YJUA 5ITHA 1G3OA 1MMNA 1JB0C 3HHLA 3MEEA 4XO0A 3ZZUA 1W7WA 2X3GA 4DV5J 1VBZA 2B5JA 1HR0F 4DR6F 3R3TA 2WONB 2BUNA 3PIPQ 4DSJA 1H0HB 2WRMA 1V9OA 1HI8A 1UETA 1S6UA 3I0SA 3QLHA 2GZOA 4RO0A 2FVQA 1D8ZA 2BOPA 4ID5A 3UN3A 1U1MA 1T9XA 4IOBA 1FDBA 1EKRA 2UXDF 1YZ7A 3QWPA 4OLOA 1K1QA 2KYXA 3NWGA 3KK3B 3TO8A 5J2PB 3F56A 1AYEA 1KWMA 1ZAVA 3FEXB 1NU4A 5AT1B 1RTDB 3VQTA 4OX8A 1QJHA 4K0KF 4ILLA 3BPSP 1CJKA 2X1FA 4WIIA 3SFUA 4WFBQ 2A1BA 1TK5A 3WQPA 5DRKA 2UUBF 2ZVSA 2W2QP 3IMQJ 3W9IA 2CQ2A 1ZBTA 4KFBB 3V6DA 1XMQJ 1NCLA 2DCLA 2FQQB 2GAHC 2XGQA 2BR0A 3T1YJ 2ZM6J 1FE4A 1GXTA 4O0IA 1YKWA 3SI8A 2YKMA 2ZBIA 3UD3P 4F04B 1R0BG 2AEFA 4DU7A 4WTYA 2PIIA 1VBYA 3PKYA 2EI5A 3RU0A 2QA1A 4F8RA 1X31C 4B9MA 1KHVA 2XI2A 4OFZA 1V3RA 4OYZA 4XAKA 2KB2A 1U6BA 3KJFB 3BKTA 4B9LA 4FS1A 3PW2A 1S1XB 1TL3A 3BV8A 1UVJA 3M8QA 5D77A 4IYQA 1HHTP 1Z4UA 4PQUA 2MQMA 2ASLA 1YJTA 5CHCB 1RSCA 4LFBF 3A8KA 4XTTA 5A8RB 2QA4S 4NX9A 3BR8A 3LPEA 1D9DA 2N3OA 4I6AA 4DV2J 1NK9A 1Z2LA 1RT5A 2RD5C 4JV0A 4ANDA 4V1Ak 1NUEA 2WHOA 4M5JA 2A10A 4M1KA 2IVFB 3MFHA 1UMJA 3A12A 1N6QA 4C8KA 2ZZMA 1G1XA 4IG3B 3V4IA 3OVSA 2GHPA 3Q8YA 4WZMA 2ZZNA 5HBMB 3KJVB 1LFPA 5DM7Q 3H8YA 5KFCA 3GV8B 2CJKA 2CQGA 2GO8A 4URQU 2FVSA 3PYGA 4FXWA 3U7JA 1M1HA 3G6XA 1F9FA 1PC5A 3D1HA 1RXOB 1WEYA 2W2PP 1Q1KA 2LU2A 2DB1A 2DYAA 4DUYF 4RU9A 1RTJB 3MR6A 4ANCA 2L3MA 2LA4A 1Y11A 2RKIB 2C2KB 2JOQA 4PXEA 4YY3F 3M32A 2DVIA 4WJBA 2UXCJ 2RRNA 1FRJA 1VRQC 3D0IE 1UWBB 1KTVA 1RQ0A 1WSVA 1X4GA 3HHEA 4UQGA 3NS6A 5IWAJ 2MKHA 3SFGA 5HMYA 1U1QA 2DCUB 4DPUA 2VJVA 1VQNS 1EP4B 3I56S 2QRRA 3QAEA 4F0HA 3KLHA 3LGMA 2OH2A 1RT1A 4CM0A 1N4LA 1JLEA 3EJMA 1HPZB 2AJ2A 2JHEA 4NZ6A 2XM3A 4OHYA 1WWHA 1GT8A 2GMHA 2YKQA 2HHQA 1YITS 3SDEA 2KDOA 3PW0A 1NSPA 2ZH7A 3BF4A 3W63A 2N7YA 4JOUA 2G9OA 1BHNA 2G2YA 4USWA 4ECSA 2CZ9A 3LP1B 3OR2A 2GQQA 2DH7A 1F60B 4RW6A 1G4CA 2DGOA 1ZA1B 3I4HX 1HW9A 2PD1A 3AJDA 2B4VA 3R6LB 4C7QA 3TZZA 1VISA 2MGZB 1GH8A 3DDNA 5KG4A 3O2IA 3GU0A 3O6QA 2GC8A 1TK8A 4JV5J 1KFDA 1NZ8A 3SBMA 2EBEA 2LXIA 4BBYA 3G6VA 1IKYA 4ZPAA 2CDRB 2VC0A 1NO8A 3HFKA 4KO0A 1HFEL 1SV5A 3HPOA 3LWLA 1SKRA 4ILMA 3GV7B 1SL1A 2FJEB 1X4AA 3OUYA 2VIHA 3CC4S 2HQFA 3BGUA 4CLUA 2HKEA 1L5UA 1B3TA 3MXHP 3S6EA 7AT1B 1KR4A 2KZMA 1S59A 1YK9A 3GSIA 4OZ1A 2ERRA 3K7RA 2VZ9A 4M5IA 3MCMA 2JH3A 2AIRB 2B6AB 3TA2A 1J27A 1RWNB 3HO1A 1BQXA 1VLYA 1S0VA 4PABA 4LSNA 2YWGA 2XC9A 2Y8WA 3BBCA 3I6PA 3L7OA 1N36F 2HNYA 4I4BA 4GVLA 3QYYA 2ZOFA 4JI3J 1M1GA 3JQKA 2DR5A 3SCKE 1FJGJ 2CG4A 1TKXA 5B0FA 2WVDA 4DR1F 3IBCB 3D6MB 2OEMA 2H54B 4WBFA 3U1LA 3W60A 4HACA 5K8PA 1HI1A 1ZPWX 1KD1T 4DLEA 1RTZA 2GIQA 4ZVQB 1H2TZ 4H4MA 1UVIA 2JDJA 3JSBA 3NP5A 2QA4G 2V2ZA 3MM7B 3MMBA 4RW4A 1UWAA 2K2PA 4P71A 4ELTA 3BN7A 4ECRA 1LWCB 4ED2A 1S99A 2VQEJ 1T05A 2HBZB 4B9UA 2FB0A 2R7TA 3NY0A 1XR7A 2NYIA 1C1BA 2VDHA 4DR2J 2J7WA 1X4EA 5KG0A 4OYPA 4AYBD 4KGZB 3LOUA 1JLCB 1C0TB 2YWWA 2UVRA 2XMUA 4K7QA 1DLOB 3MM6A 1M1KT 1Q7YT 1U24A 5K14A 3CWJA 1LW0B 2V8GA 2CQ3A 4NCGA 2VG5B 3MF5A 2WB1D 1J2VA 3EMTA 5AXLA 3UDCA 4X62J 4JV1A 2FUG9 2CFXA 3MMAB 1PAUB 1WDDA 3QQCD 1LEOA 1SVDA 5CAAA 2H1YA 1DY3A 3H59A 2UUAF 4M8LA 3N6NA 4JB8B 5K5MA 1FKAF 2EG1A 1FO1A 2M70A 1FK9A 3US5A 5IZHA 4DFJA 5J2MB 3GFZA 1CLFA 3KKFA 2A6MA 1OS5A 4LSLA 2N4DA
chains in the Genus database with same CATH topology
2H51B 2H4WB 2Y1LB 1RHJB 4DCPB 1BMQB 3GJTB 2HBQB 2P2CB 2H65B 3R7SB 2C2ZB 2H48B 4ZVRB 2XZTB 3KJQB 1RWVB 4DCOB 4ZVPB 2CNKB 1RWWB 1QDUB 2XYHB 3R6LB 5K20B 2C2MB 1RHUB 3GJRB 3P4UB 2HBYB 3D6HB 2CDRB 1RWKB 1RWMB 2QL9B 1RWPB 3R6GB 3GJQB 4ZVTB 3R7NB 2QLJB 1SC3B 4ZVOB 1RE1B 1RWNB 1PYOB 3R7BB 1RHRB 4ZVUB 2CJYB 3IBCB 3D6MB 2H54B 1F9EB 2FQQB 1QTNB 2XZDB 3IBFB 3EDRB 3GJSB 4ZVQB 3SIPB 3EDQB 1RHKB 2H5IB 1I3OB 2C2OB 3R5JB 2QLFB 1GFWB 2H5JB 1IBCB 2DKOB 1SC4B 2HBZB 2QL7B 3KJFB 2CNNB 1ICEB 4DCJB 1SC1B 4LSZB 2QLBB 3QNWB 5IC6B 3NS7B 1I51B 1RWXB 2XYPB 3P45B 2Y0BB 2QL5B 5IC4B 1RHMB 2C1EB 2CNLB 2CNOB 1PAUB 2HBRB 4ZVSB 4JB8B 2H4YB 2XYGB 3D6FB 1RWOB 2CJXB 1NMEB 2C2KB 3KJNB 1RHQB 3RJMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H51 B;  2H4W B;  2Y1L B;  1RHJ B;  4DCP B;  1BMQ B;  3GJT B;  2HBQ B;  2P2C B;  2H65 B;  3R7S B;  2C2Z B;  2H48 B;  4ZVR B;  2XZT B;  3KJQ B;  1RWV B;  4DCO B;  4ZVP B;  2CNK B;  1RWW B;  1QDU B;  2XYH B;  3R6L B;  5K20 B;  2C2M B;  1RHU B;  3GJR B;  3P4U B;  2HBY B;  3D6H B;  2CDR B;  1RWK B;  1RWM B;  2QL9 B;  1RWP B;  3R6G B;  3GJQ B;  4ZVT B;  3R7N B;  2QLJ B;  1SC3 B;  4ZVO B;  1RE1 B;  1RWN B;  1PYO B;  3R7B B;  1RHR B;  4ZVU B;  2CJY B;  3IBC B;  3D6M B;  2H54 B;  1F9E B;  2FQQ B;  1QTN B;  2XZD B;  3IBF B;  3EDR B;  3GJS B;  4ZVQ B;  3SIP B;  3EDQ B;  1RHK B;  2H5I B;  1I3O B;  2C2O B;  3R5J B;  2QLF B;  1GFW B;  2H5J B;  1IBC B;  2DKO B;  1SC4 B;  2HBZ B;  2QL7 B;  3KJF B;  2CNN B;  1ICE B;  4DCJ B;  1SC1 B;  4LSZ B;  2QLB B;  3QNW B;  5IC6 B;  3NS7 B;  1I51 B;  1RWX B;  2XYP B;  3P45 B;  2Y0B B;  2QL5 B;  5IC4 B;  1RHM B;  2C1E B;  2CNL B;  2CNO B;  1PAU B;  2HBR B;  4ZVS B;  4JB8 B;  2H4Y B;  2XYG B;  3D6F B;  1RWO B;  2CJX B;  1NME B;  2C2K B;  3KJN B;  1RHQ B;  3RJM B; 
#chains in the Genus database with same CATH topology
 5HK4 A;  4USK A;  4EWT A;  3KHL A;  2J0X A;  5IM0 A;  4DWI A;  2MGZ A;  2DGV A;  4MFB B;  2QC3 A;  2K1R B;  1BMQ B;  1UJ4 A;  2ACM A;  2K8G A;  2V67 A;  4Y2K A;  4GO5 X;  1NSQ A;  1SKU B;  2AV5 A;  1TAQ A;  3DCA A;  1U8W A;  3O8W A;  4M5D A;  3ZTP A;  3FEY B;  1JLG B;  1VFJ A;  2C2Z B;  4ZP8 A;  5EWF A;  4F4K A;  1VCT A;  3OSP A;  1SQF A;  2MQQ A;  4WXW A;  2DNZ A;  4EYI B;  2E9T A;  4ES1 A;  4DV2 F;  2KO1 A;  5J1N A;  2M9K A;  1VQK S;  2O66 A;  3I96 A;  3N6L A;  5KT6 A;  4FBT A;  3H90 A;  1QDU B;  2DHA A;  1JKH A;  3JSM A;  2HMI A;  1VRU B;  5L1K A;  1FES A;  2IDL A;  3C14 A;  4J9V A;  1J5E J;  3IR6 B;  2PFD A;  1T94 A;  4F3M A;  3B8H A;  1M5V C;  4NCA A;  4B3T J;  1N32 F;  2Q1L A;  3MCS A;  3W62 A;  4CLW A;  1AUS L;  5KT2 A;  4NLO A;  1HHQ A;  4DX6 A;  3D6T B;  2M0G B;  4NCB A;  4XDD A;  1RTJ A;  1RDR A;  1VOM A;  4UOG A;  5HQ8 A;  3I82 A;  4CLK A;  1ZTT A;  1T9V A;  4ED1 A;  1F3V A;  2ZUA A;  3E8O A;  4WYL A;  5KOX A;  1BWE A;  2VDI A;  1QAY A;  2OO4 A;  3AAW B;  2C28 A;  2LYV A;  4DPY A;  2RQM A;  2A0F B;  3EVW A;  3R7N B;  1X4H A;  3DOM A;  4FZV A;  3K8W A;  5U47 A;  2WSC C;  5J2Q A;  2BXJ A;  4C8O A;  1Y5I B;  3FSY A;  2VKZ G;  3PCO B;  4ZHR B;  4IG3 A;  5L9N A;  1EET A;  1TK0 A;  1FKO B;  2HFN A;  2KL8 A;  2DEI A;  2KHC A;  5LSL A;  1YRX A;  4DPW A;  3CD5 A;  3CCL S;  4DV3 J;  2ZD1 B;  3ZZO A;  2VUG A;  5KOW A;  3G4S S;  3TWZ A;  4CTA A;  1MWQ A;  5D4L A;  1EQ0 A;  1RT2 B;  4IFY A;  2B4U A;  4YR0 A;  1KQS R;  3OFE A;  3A3O B;  1APS A;  1OPI A;  4BC9 A;  1RKJ A;  1ZAX A;  2MB0 B;  2DIS A;  4EBC A;  1ZS6 A;  5L1J A;  2NRE A;  3TX8 A;  1HNZ F;  2KG0 A;  4YB5 A;  2CJY B;  3F0N A;  2FZG B;  5L9X A;  1KP6 A;  2WBM A;  3QFW A;  5IQQ A;  5DGA A;  3WHI A;  3G6E S;  1XR5 A;  1S5Z A;  2DT9 A;  3VQS A;  2XBP A;  2MQ8 A;  4ENO A;  3VAG A;  3KOA A;  2KFZ A;  3W2V A;  3D1Q A;  2MLZ A;  4HR2 A;  4UST A;  2UXB F;  1S57 A;  3J81 Y;  2HZA A;  3R5G A;  2E5I A;  2VFS A;  4OZ0 A;  4OX9 F;  3CUL A;  1VDH A;  1CS4 B;  3ZTS A;  2IY5 B;  2J9D E;  4B9T A;  2X1G A;  2QLF B;  2E7X A;  4DDF A;  2H5J B;  3OLA A;  1N8R T;  1TMJ A;  2IAJ B;  2RS8 A;  4WWS A;  1U25 A;  2VC1 A;  4QWA A;  3H20 A;  3GYN A;  2KTQ A;  2HNZ A;  2ZH5 A;  4RUB A;  2GQ2 A;  1CC8 A;  2Z30 B;  2BJ7 A;  4G1Q A;  4IFV B;  2Y9H A;  1DZ5 A;  1GX6 A;  1IKX B;  2VG6 A;  3EWG A;  4KR0 B;  3PW4 A;  2ASJ A;  1Y0H A;  2Z2Z A;  3DLE B;  3LPY A;  1U48 A;  2RRA A;  1TKZ A;  4D3G A;  3HF5 A;  2CRL A;  3EZU A;  3PRB A;  1EKS A;  3MTK A;  1WKK A;  2G2O A;  3M6U A;  3PJW A;  5G0R A;  5BYQ A;  4PEO A;  1WI6 A;  3KTQ A;  1E6V B;  3EIC A;  1ZAW A;  4HLB A;  4LRC A;  2R9L A;  1ZZN A;  3M1V A;  4HH1 A;  2FY1 A;  3KK3 A;  2KVQ E;  5T7L A;  3NGK A;  4OHX A;  4JI8 J;  4X4V A;  2BKP A;  4FYY B;  4UT4 A;  2MQN A;  1HI0 P;  1B7F A;  1KLN A;  4Z7C A;  4TKT A;  3MR5 A;  2HHX A;  2CNL B;  4WP3 A;  2HBR B;  4G1P A;  5D4P A;  3BQ2 A;  1HBO B;  5H9E J;  2HZC A;  3DNC A;  5F3Z A;  2RNE A;  1UTA A;  1OIA A;  1SIW B;  3OTB A;  5HLF A;  1EZZ B;  4DSI A;  3EGW B;  3LTO A;  2W2O P;  3OJU A;  2OFH X;  2H9Z A;  4ZPB A;  3IWN C;  2W9B A;  2CA9 A;  2AYG A;  2NCK L;  2E5J A;  3DYA A;  2DNH A;  4LFA J;  3ENW A;  1N88 A;  2YQ0 A;  1R3N A;  4HHH A;  1YHQ S;  2QIF A;  2RT3 A;  1RAB B;  2GJF A;  2FHJ D;  2JC1 A;  1QUV A;  1S9E A;  3TJ9 A;  7FD1 A;  4KPY A;  3K17 A;  2V8V A;  5F8G A;  2MLY A;  3X1L B;  2H51 B;  3PRD A;  2EC0 A;  3QRR A;  2HHH F;  4W98 A;  1XWL A;  1YRT A;  5KFZ A;  3LP0 A;  4YHH J;  3M2U B;  5AJ3 F;  4WKR A;  1JNR B;  1AZS B;  4HT7 A;  3W66 A;  3FMB A;  2AD9 A;  2HBQ B;  4USI A;  1HNI B;  1RT2 A;  2HHT A;  3NXZ A;  1YJN S;  1JLQ A;  2EEY A;  2HFO A;  3AOB A;  4DR4 J;  3PYD A;  2ZD1 A;  2XZT B;  3NGR A;  2FVC A;  4F0K A;  3MR7 A;  3GZ7 A;  4LQ3 A;  1RT6 B;  4ZVP B;  1EET B;  2ZBR A;  3M8P B;  1BQM A;  3ETO A;  4PQA A;  1Q81 T;  1FA0 A;  3G87 A;  3PR4 A;  2I38 A;  2RQK A;  3H98 A;  1TAU A;  2MLX A;  3A3N B;  4NLX A;  8AT1 B;  1IXK A;  4QU7 A;  4IQM A;  4X66 F;  4W92 B;  2KT2 A;  4P74 A;  4CLY A;  4Q44 A;  3D6H B;  4I6W A;  3I0R B;  4U67 Q;  2BA9 A;  1FT8 A;  2DJW A;  1VIX A;  2GIR A;  5JJB A;  2GIF A;  3GYG A;  4B3R F;  2VFR A;  5BJR A;  3J81 U;  1I94 F;  3IG1 B;  3W1Y C;  4IO9 Q;  3D66 A;  3DI6 B;  1IJE B;  5A2Q Y;  4X65 F;  1TP7 A;  1G6B A;  4NI2 A;  4RW8 B;  3LH2 S;  3QBC A;  1HAR A;  2BRL A;  2GFF A;  2UVV A;  3SXL A;  1SC3 B;  2VU5 A;  2Q3P A;  4WFX A;  2W9C B;  3I55 S;  4NLV A;  2AWZ A;  2W8L A;  1FRX A;  2J5A A;  3ONQ A;  1HKA A;  1S79 A;  2DH9 A;  4OX7 A;  2R7Q A;  2W9B B;  4J9L A;  3V6K A;  4UY8 5;  4TY8 A;  5E0O A;  4A8F A;  2IM1 A;  1RAO A;  5KFI A;  3BBF A;  1X9W A;  2RML A;  1T3O A;  5DDO C;  1FRL A;  1CJV A;  3NAI A;  5ETN A;  5KFT A;  5HSP A;  1HD0 A;  1S1U B;  4KIA A;  1DAX A;  1T9W A;  2FLO A;  2KXH A;  4C97 A;  4LF1 A;  3EYZ A;  1S49 A;  4KYZ A;  1MRO B;  1M0S A;  1BWV A;  1QTN B;  3MPY A;  1ZM4 A;  5I42 A;  1RI7 A;  2GVZ A;  4URG A;  4Q0B B;  1Q78 A;  3UFC X;  2IM3 A;  1RTI B;  1WDT A;  2CPD A;  1HNV B;  1PG5 B;  1U02 A;  3DLB A;  3KK2 B;  1RAC B;  2IA0 A;  1H7X A;  1I3O B;  2G0J A;  4CNY A;  4JYA J;  1FXL A;  3C2P A;  3EPG A;  1IBL F;  2BE9 B;  2P6S A;  3KK1 B;  1VR6 A;  1HQU B;  2K7K A;  1KHW A;  1SC4 B;  3MEC A;  3NNH A;  1WUU A;  1BXN A;  1V6H A;  2RDJ A;  1LWX A;  4MIA A;  3TQE A;  1AW0 A;  3PFO A;  1IWG A;  1R6Y A;  2I5J B;  4NCG B;  2K06 A;  3OQ2 A;  1LW0 A;  3M4X A;  3Q89 A;  1PYS B;  3R97 A;  3TAQ A;  1IQT A;  2WK4 A;  1MMD A;  2I6W A;  1FWL A;  4YDD B;  2BE2 B;  2XEX A;  1F3F A;  3MUM P;  1KTQ A;  1XTZ A;  2Z58 B;  1EHW A;  7FDR A;  1NK7 A;  1MLA A;  1CQM A;  4I2P A;  2AKW B;  3QWU A;  2V4R A;  1J5O B;  2UV8 G;  2HHP A;  4NLR A;  5ETS A;  1RP5 A;  2NZC A;  3VAL A;  1NB7 A;  4WYW A;  4M5N A;  4DSL A;  3ILI A;  2CQH A;  5HVH A;  2RF2 B;  5FLX Y;  1WHY A;  4ZS6 A;  3SMZ A;  4CO5 A;  5KFW A;  4AQY F;  2XY5 A;  1REV B;  3TI0 A;  3W64 A;  4DG1 A;  1U1R A;  3TAM A;  3EGZ A;  1U47 A;  3QIP B;  1VK3 A;  3QIP A;  1RWU A;  2M5Y A;  2F9J A;  1WG4 A;  5K8M A;  2RU9 A;  3UN2 A;  3BSO A;  1OMS A;  2CJX B;  1RTD A;  1HYS A;  4NMX A;  1S1W B;  2BM1 A;  3JSR A;  1U0S A;  5GAD I;  1S6Q B;  1FTC A;  2EKY A;  3NGS A;  4UTG A;  3K2Y A;  3D54 A;  5KG7 A;  2O3D A;  1SKS A;  1RHQ B;  1NJW A;  3IRX B;  2IA6 A;  4HVZ A;  2RHQ B;  1RJJ A;  3QJL A;  3Q23 A;  1QAJ A;  3NRB A;  4QJV A;  2IVM A;  3J7Z T;  1VQM S;  2OML A;  1F5B A;  3S7R A;  4DV3 F;  4TU9 A;  2E9Z A;  5B0G A;  4ZP6 A;  2V2V A;  4H4K C;  3W8G A;  2MXY A;  4ECV A;  2DRA A;  1H6K X;  3DYA B;  3R7S B;  3Q2T C;  3DRS A;  5D0R A;  1FHT A;  2DNG A;  4ICL B;  2E1R A;  3ZZT A;  1AB8 A;  4ZVR B;  1CJU A;  2IM2 A;  3D9B A;  4MTP A;  4AXJ A;  4F2S A;  4JP8 A;  1DTT B;  1NBE B;  2B7B B;  2W8K A;  2WSE C;  4MYT A;  2MMY A;  4LF6 F;  4OZN A;  1JKH B;  3HJF A;  2R7V A;  4U7U D;  4ED7 A;  3MM9 A;  1XQI A;  1HA1 A;  4U6P A;  2EK6 A;  1R8A A;  2R8J A;  2PEH A;  2HFU A;  3FMW A;  4YB7 A;  3FSI A;  2OTJ S;  2IJF A;  1FWP A;  2QFI A;  2RJZ A;  3HVW A;  4QYR A;  3GJR B;  2CIM A;  1S1T B;  1Q16 B;  2BQ3 A;  1SC6 A;  2DNL A;  1HNV A;  1S72 S;  1UW4 A;  5DO2 A;  2RS2 A;  1Y10 A;  1NSA A;  3DOK B;  4OX9 J;  2QL9 B;  4Q0B A;  2IJN A;  2YH0 A;  2W4C A;  4GKJ F;  2HK2 A;  4ZMM A;  3VTI A;  2E66 A;  2AZ3 A;  2DK2 A;  2BJ3 A;  1QE1 A;  3EXC X;  1G7C B;  3K5P A;  3MCN A;  4IH6 A;  3WIU A;  4DN0 A;  1I6J A;  1S1U A;  3RRH A;  3VGS A;  5F8L A;  1SH0 A;  2HNZ B;  1N52 B;  4G65 A;  4USV A;  1NXI A;  4LMZ A;  3HSG A;  4QIW D;  5KAK A;  2VOP A;  3D68 A;  1RBO B;  5EUH A;  4K4Y A;  2QMW A;  2ZBQ A;  2ZVI A;  4LF2 A;  4B17 A;  4TY8 B;  2XO6 A;  1HNW J;  2EXU A;  3VWS A;  4YR3 A;  2BAN A;  8RUC A;  4X4Q A;  3CPW R;  2Z57 B;  2J6T A;  4DR6 J;  3G8S A;  1NK0 A;  1G2E A;  4WE1 A;  4K59 A;  2DEJ A;  4WKY A;  3B4M A;  3HX9 A;  4Y34 A;  3MMA A;  2MYF A;  3NMA A;  3U1N A;  3SCJ E;  5D8H B;  1HHS A;  3MMJ A;  1TKT A;  4N8N A;  2QE5 A;  4USH A;  4ZVU B;  4EGL A;  3HFV A;  4ZLL A;  2ZH8 A;  2UUC F;  1UFK A;  2DRD A;  4LF9 J;  4LRD A;  3MM8 B;  1RT7 A;  1E6Y A;  4MJK A;  5M2P A;  4Q45 A;  3ADA C;  1KN6 A;  5K14 B;  3HDS A;  1OQ3 A;  5DET A;  1NKB A;  1VC0 A;  1RAD B;  4OLP A;  2ZOM A;  2RUS A;  3LAN A;  2ATC B;  3TP2 A;  3TA0 A;  4ZLN A;  3ENA A;  2ZDP A;  4FKY A;  3UVJ B;  1WKL A;  1K9M T;  1FKO A;  4E98 A;  1WC6 A;  2QO3 A;  2ADC A;  4PWW A;  3EZO A;  3I9V 9;  3MAA A;  3T6B A;  4EMD A;  2JL9 A;  3MHY A;  4K5R A;  4RNN A;  4YHH F;  1WG5 A;  5AJ3 J;  4NLP A;  8ATC B;  1N36 J;  3MTJ A;  1NND A;  3RB3 A;  4HDH A;  3M2V B;  5KFG A;  1RAF B;  1ACM B;  3TUP A;  1F2H A;  3BSN A;  2DPI A;  2CPJ A;  2OEL A;  2GGP B;  3C16 A;  4NWB A;  2YKO A;  1CVJ A;  2GMJ A;  3KUE A;  5H9F K;  3BO2 A;  4LF8 F;  1P1T A;  1FDA A;  4J9N A;  2XWY A;  1T03 B;  2AGO A;  4QW8 A;  4HAC B;  2OSR A;  4P6Q A;  3KWM A;  4KHP J;  4J9O A;  1IKV A;  3PY8 A;  5KG5 A;  2FVP A;  2EBG A;  3VGV A;  2C2E A;  2BZ2 A;  1JWW A;  1X4B A;  2YPZ A;  5CYQ A;  3MED B;  3OV7 A;  1T7P A;  5I4M A;  1LWE B;  1FD8 A;  1F1B B;  2BOA A;  3WC2 A;  3S01 A;  3HLU A;  3CMA S;  2DR6 A;  2OPR B;  2N82 B;  2P5V A;  2DXE A;  1RT3 A;  4O4R A;  4J9Q A;  4GC7 A;  1FI4 A;  1EIY B;  1U2C A;  3IWL A;  4FF2 A;  4WZQ A;  4NA3 A;  1IVZ A;  3UDE A;  5HLF B;  1IN0 A;  2YX4 A;  3F44 A;  4HL9 A;  4ZVH A;  9ATC B;  1VLO A;  2E1C A;  1LFW A;  3H0P A;  3PDN A;  4DV0 J;  4NYZ A;  2XY6 A;  5A6W A;  2HVE A;  4J91 A;  2F8M A;  3MD3 A;  5HMX A;  4ID8 A;  3EX7 B;  5H9E K;  1GAO A;  3M6W A;  3M9O B;  2A2D A;  3M8Y A;  4ITS A;  4LJM A;  4C8N A;  3UR0 A;  3M1V B;  5IXU A;  1XC9 A;  5J2M A;  2GHW A;  4YS2 A;  3BGL A;  1IKY B;  1URR A;  5J2N A;  2HGM A;  2XLI A;  4QOT A;  2YNF A;  3DLE A;  2JFD A;  4DL4 A;  2Y0S D;  2MKI A;  1B0T A;  4N56 A;  3RUB L;  4HTJ A;  5BXI A;  4RW6 B;  5KFV A;  4DL5 A;  2F4V J;  2XYH B;  1GMW D;  2AW0 A;  2B0G A;  3BB5 A;  3OFG A;  2ZNY A;  4NML A;  2IAJ A;  3VAM A;  2GA7 A;  4K8R A;  3HHD A;  3KDO A;  2VQE F;  1SJF A;  2W7O A;  1DFD A;  2EFN A;  1W2I A;  2WOM A;  3P4U B;  5E3P A;  5D3G A;  2B4P A;  2E5H A;  1JLE B;  3AT1 B;  4FF1 A;  4EU0 A;  1UFW A;  2NUU G;  2HFV A;  4OJ1 A;  1IBL J;  2B3T B;  2OP5 A;  3MM6 B;  3QT7 A;  1UEK A;  4LRB A;  3VAH A;  5DZ7 A;  3PVX A;  3I5A A;  4J9P A;  3SEO A;  4YN3 B;  2BQR A;  1TKD A;  2VL1 A;  3C6U B;  3IFE A;  3K89 A;  1GXL A;  2ZHO A;  1W2B R;  2R8K A;  3NBP B;  1H2V Z;  3CCT A;  3DU6 A;  4V19 X;  4CT9 A;  2XMK A;  3M32 B;  5J1P A;  1SBR A;  2QJ3 A;  4O3R A;  1U2R A;  5E3Q A;  2OI2 A;  4DPT A;  4FS2 A;  3UNY A;  5M2U A;  3OLB A;  1Q8L A;  2WB4 A;  1C0U B;  5E5N A;  5EX0 A;  5GVQ A;  3DDK A;  5AXM A;  4ZPV R;  4RUC A;  3KLE B;  2ZOG A;  5J1E B;  4BLG A;  4M5G A;  2DGW A;  4LR9 A;  2DR7 A;  3AOA A;  1S9G A;  3TVK A;  2AX0 A;  1U1O A;  1L3K A;  4DLG A;  4C8M A;  2BJ9 A;  2QT7 A;  4TVA B;  3CDB A;  1X4F A;  2ZHA A;  3DRP B;  3CC2 S;  5JUM A;  3SZ2 A;  3SV3 A;  4UY8 T;  5EWG A;  2OD6 A;  1XJW B;  1NHV A;  5D78 A;  1RT5 B;  4B9S A;  3P49 B;  3BKU A;  3DM2 B;  3FZ2 A;  3HZE A;  1S1V A;  4C11 B;  4QBU A;  2BKN A;  3E2E A;  5DDQ C;  3EDQ B;  2R2R A;  1F2G A;  2D1C A;  3PW5 A;  1LQ9 A;  4OYX A;  1D9A A;  5D3G B;  1RT7 B;  4RBV A;  3ZXW A;  4CLS A;  3I32 A;  1LWF A;  3UCZ P;  4PQU B;  1N33 F;  3ZZR A;  1EB0 A;  1ZA2 B;  2DNR A;  1IBC B;  1WHW A;  2LDY A;  2FZK B;  2V8P A;  3OD2 A;  3RW7 A;  2J7U A;  1HBU B;  3R5A A;  1YZ6 A;  3M6X A;  4PUO B;  1BC6 A;  4UQT A;  4NOH A;  2VQF J;  3A3P B;  2OJ3 A;  4CLZ A;  3W5X A;  2F8H A;  4Y3C A;  2VPY B;  5FLX U;  2V68 A;  3P8B B;  3J7Y U;  4ETX A;  2VPX B;  3IR5 B;  3QSI A;  3PX4 A;  3D67 A;  1S97 A;  2EWH A;  3PFE A;  3KYL A;  2PC6 A;  3CCR S;  2ZJP Q;  3IAM 9;  2K3I A;  1X7V A;  1KOH A;  1HWJ A;  2NYH A;  3Q8U A;  5RUB A;  2KH9 A;  5IM0 B;  3VAJ A;  4C8Y A;  3MOJ B;  1N5V A;  1BE4 A;  3HVT A;  2OTL S;  3MM5 B;  3QGI A;  4X4N A;  5A76 A;  1DQ8 A;  1HWU A;  2LFV A;  3LP1 A;  3OR2 B;  2J8A A;  3G96 A;  3W2W B;  3RAQ A;  1OY8 A;  4TYB A;  4DV7 J;  2NXE A;  1A0O B;  2QA2 A;  3O1L A;  5IT0 A;  5E41 A;  3FBF A;  5LXY A;  3FBE A;  4F36 A;  3L9Z A;  5CYM B;  4JI7 F;  4QWE A;  4IOC Q;  4A46 A;  2ADB A;  2YBV A;  2BW7 A;  1UWB A;  5B0B A;  3NL0 A;  3W5Y A;  4ECU A;  3C3L A;  1R7I A;  3D3C J;  4PUO A;  2V50 A;  2H5E A;  3TVZ A;  3FFI B;  3LP2 B;  1SH2 A;  3DHW C;  4RW7 A;  5HJX A;  3ISZ A;  4P2X A;  1RAJ A;  1S1V B;  2N7C A;  1K8A T;  1B70 B;  4NZ0 A;  1Y00 A;  2B4O A;  1RLC L;  3P5B P;  4JI6 J;  2MKS A;  4DR5 J;  4DR7 F;  1GK8 A;  1YLX A;  1BQN A;  2FHK A;  3K8V A;  3OR1 B;  3RYL A;  2BX6 A;  2DIU A;  3EGV A;  2XLJ A;  2C2D A;  3ET6 B;  1SIZ A;  2CNK B;  1S6O A;  3FK4 A;  4Y2M A;  1OWX A;  3GYX B;  1CUL A;  4J5O A;  4IKA A;  1AFJ A;  5K20 B;  1H2U X;  1Q82 T;  5GAE I;  3KLE A;  1HL6 A;  1PIL A;  2ZNZ A;  1X4D A;  3DRP A;  2FHM A;  4LF5 F;  6FD1 A;  3HKW A;  1U09 A;  1NSK L;  2FVR A;  1HNX J;  1REV A;  3GON A;  3GCX P;  3MAQ A;  1VC5 A;  1NLK L;  9RUB A;  1B0V A;  3QT5 A;  5C24 B;  4A8O A;  1WHV A;  4WTO B;  1S7H A;  1TTH B;  1K0T A;  3OTD A;  2C3Y A;  2V69 A;  1I5O B;  1DTQ B;  1TQL A;  2WW4 A;  4RNM A;  3GIK A;  4EO6 A;  2RDI A;  3GV5 B;  3T3F A;  1JMT A;  2WW8 A;  3GIJ A;  2UUW A;  2R42 A;  4CLT A;  4ZP9 A;  1CJT B;  2DGQ A;  2YTC A;  5B0D A;  4ZJQ A;  2KFN A;  3HSZ A;  4JI5 J;  2O01 C;  3ZZP A;  2DNK A;  2XMJ A;  2HNY B;  5A8W A;  4WU3 A;  3MD1 A;  4NEY A;  4KKO B;  5HJY A;  5IV3 A;  3QO9 A;  2AHO B;  2O5D A;  4OYA A;  5HRO B;  2XCA A;  4K5S A;  3BGO P;  4DSF A;  2PA3 A;  2OUG A;  3C66 A;  4OZ3 A;  4USJ C;  4FYD A;  4KT0 C;  2ASY A;  3HD2 A;  5KFR A;  3PYF A;  3KK1 A;  4NYO A;  2WCX A;  5B09 A;  1QD1 A;  3M7V A;  4JUZ A;  2D7S A;  2ACY A;  4YDX A;  5E3R A;  1KFS A;  4PYD A;  2X51 A;  4ZKA A;  3ZTQ A;  3SIP B;  4Y0F A;  1FE0 A;  5KFJ A;  2PN6 A;  3GMG A;  3N9U C;  5CD4 H;  2CJQ A;  5ETK A;  3ZC4 A;  1K0V A;  1WOO A;  4PXD A;  2FHJ A;  1NM2 A;  1MRO A;  2EKN A;  2CQ4 A;  1Q5Y A;  2HIQ A;  3FQK A;  3ITH B;  3LA0 A;  2X3D A;  3IGN A;  3T41 A;  2DNM A;  2DXD A;  5DS7 A;  1ZM2 A;  2VG7 B;  3R5C A;  4IH5 A;  4XPC A;  1JJ2 R;  1CSJ A;  3RB6 A;  3POT B;  3VF0 B;  4RW9 A;  3IRW P;  1F5C A;  2HVZ A;  4PWD B;  2CNN B;  4Y65 A;  2FTR A;  1YQH A;  4LR7 A;  1SUQ B;  3V6H A;  1IKV B;  1SJQ A;  4WFN Q;  3LWM A;  1SJ4 P;  1YG0 A;  2KU7 A;  4LUB A;  3AD7 C;  3J7Z 5;  4X4P A;  2HEK A;  1FEE A;  2OPR A;  3HM9 A;  2DXF A;  3QO9 B;  5HRO A;  5F8I A;  1QVG R;  1FFG B;  5KFK A;  2KT3 A;  3EM1 A;  3SSS A;  5A8W B;  4ECT A;  5IV4 A;  1CBK A;  1SXL A;  3FRZ A;  4GVB B;  2XYP B;  3PR5 B;  4A8S A;  4FPR A;  1FX4 A;  4X2B A;  2XGP A;  4OZL A;  5ETQ A;  1JLF B;  5IC4 B;  2YY3 A;  2LP4 A;  3H2V E;  3NGD A;  2BAB A;  3MED A;  2XLK A;  1ZPV A;  1VQ4 S;  4DJB A;  4H4K A;  4TY9 A;  3BSC A;  2GVD A;  4DR3 F;  2P9G A;  1Z1Z A;  3ISN D;  4I69 A;  4FF3 A;  4HT5 A;  4LR8 A;  4F02 A;  3VAI A;  4ZVF A;  2DH8 A;  3R1L A;  2UXD J;  2HGL A;  4DQI A;  4J7C A;  2HS0 A;  2U1A A;  3DMJ A;  3VAK A;  1BUX A;  4ED4 A;  5JMN A;  1BQM B;  3TAN A;  4WK1 A;  1OYE A;  4ZPC A;  4YQW A;  1J5E F;  4F26 A;  4L74 A;  4DQR A;  3B54 A;  1NJX A;  4QIG A;  5CYM A;  2HSE B;  3MAA B;  1VIO A;  1N5Y A;  4D3H A;  4U8Y A;  2DNO A;  5F0U A;  4X4S A;  2HHS A;  4WE1 B;  1D0E A;  3DLL Q;  1XMQ F;  5A8R A;  1T9Y A;  1KDN A;  3KNA A;  2IMO A;  2Q79 A;  1TL1 B;  3CMQ A;  5KFS A;  1AFI A;  1NKC A;  1FKP B;  2W7A A;  4I2Q A;  4RU2 A;  3H40 A;  4G1I A;  2NZ4 A;  4I64 A;  1V5V A;  1N48 A;  3CSK A;  3AQP A;  1N5S A;  4NLQ A;  1N56 A;  1MU2 B;  3A13 A;  2Q43 A;  3RTV A;  2PMZ D;  2W9A A;  4NXM F;  2OIH A;  4FNI A;  4KRW A;  4P73 A;  4ED0 A;  1N33 J;  1WD6 A;  2O67 A;  2C3U A;  1NRK A;  1VYA A;  2LEA A;  2RIL A;  2XSJ B;  4HTI A;  3CDA A;  1X60 A;  4NA2 A;  2R7O A;  3IR7 B;  3LW5 C;  1WSR A;  4CT8 A;  3W2W A;  5LT5 A;  1AUD A;  1UP1 A;  1RKI A;  1CJK B;  5LMN F;  4CI0 B;  3GFX A;  4CO3 A;  1YGY A;  2PDA A;  5KFO A;  2E5L J;  5CYJ A;  2JEI A;  2JJ4 D;  4ZCK A;  4Z2X A;  2F7V A;  1R8P A;  2ZC3 A;  4UOH A;  1L3T A;  1M5H A;  1M5S A;  5KTQ A;  1VK8 A;  3IC1 A;  3RR7 A;  2AEJ A;  5D15 A;  1RCX B;  3DC2 A;  2QLX A;  1REG X;  1WC1 A;  1X8D A;  3A1Y G;  1IKX A;  3DRS B;  2FJB B;  4RPF A;  4QPX A;  4F4Y A;  4AQY J;  1T3N A;  2BJE A;  4NEZ A;  3MM9 B;  4FYX B;  1YVF A;  4QR2 A;  5D4O A;  3R9L A;  2QSW A;  3ENQ A;  3PM9 A;  3DU5 A;  4DQQ A;  1O6X A;  3I4P A;  3MPU B;  4U7C A;  1R0C B;  2UXC F;  2QGF B;  2L9N A;  3PZP A;  2U2F A;  3MGJ A;  5ETO A;  4F4X A;  1F9E B;  5DLF A;  2J6U A;  2XZD B;  5HAT A;  2VA2 A;  1F0X A;  3EDR B;  3AOC A;  4RZR A;  5FDL B;  2NQP A;  2R7R A;  5DGB A;  4W90 B;  3QGG A;  2CQP A;  1KBR A;  2YKN A;  2VBZ A;  4KGM A;  4OZJ A;  4Q2L A;  3TJ8 A;  1LWF B;  4M5H A;  3O44 A;  3SCL E;  3D1O A;  5ADZ A;  4F50 A;  1B64 A;  1O5J A;  1GFW B;  4OQJ A;  1A9N B;  4ELU A;  3IGV A;  2B9W A;  4I7F B;  1IM4 A;  2MSS A;  1LW2 A;  3QFH A;  4IRD A;  2LEB A;  1PJ5 A;  3G82 A;  2MZQ A;  4IDK A;  1PCA A;  1NPR A;  2VF3 A;  2W25 A;  1PYT A;  4QIV A;  4QWD A;  1VQO S;  4F3O A;  4M94 A;  2YNG A;  3J7A N;  4C0B A;  5JVG Q;  2CQ1 A;  2OPQ B;  1WI8 A;  2YNH A;  4CDI A;  3BDP A;  1S6Q A;  2HUR A;  4OYB A;  3NWR A;  4N5S A;  2JVR A;  4DL3 A;  2BE2 A;  2MTL A;  2RF2 A;  1WOP A;  2WZ1 A;  3OFF A;  1KQG B;  4MK9 A;  4IO1 A;  4OYM A;  4R0E A;  1RWX B;  5KG1 A;  3KG4 A;  3JS9 A;  5IT4 A;  3CUN A;  4DS4 A;  1C1C B;  1R0A A;  2ZKT A;  3CNQ P;  4L75 A;  5MAO A;  4J9K A;  1XNQ J;  3SYZ A;  2B56 A;  1J5O A;  2HIY A;  4GMK A;  4BCA A;  5GMK a;  3AY0 A;  4GKJ J;  4RX6 A;  4UF4 A;  2HHH J;  2VD3 A;  2QSF A;  5G4D A;  1U0H A;  4NAS A;  1U1K A;  2YKP A;  2HZV A;  1MWZ A;  2ZBC A;  4TN2 A;  4TQS A;  3O3L A;  4N47 A;  3N79 A;  3NCQ A;  3J7A 1;  2ZC4 A;  5HO4 A;  3VZI A;  2XYG B;  1QUP A;  1BY9 A;  4BWM A;  2RQ4 A;  1UFL A;  3C14 B;  4DV1 J;  5F8J A;  1CC7 A;  3OXF A;  2IPO B;  4R5P B;  4U9R A;  1UA0 A;  3OXG A;  1VQ9 S;  3KLF B;  2LDI A;  5E7O B;  3QID A;  1R89 A;  2D3U A;  3TYT A;  2HW3 A;  3UDL A;  2UU9 J;  3QPI A;  4DFM A;  4G6V B;  1RIS A;  4JI1 J;  5L39 A;  4M5D B;  2KHD A;  1T0T V;  2L9W A;  2YPY A;  3C19 A;  3L7P A;  4K4X A;  4BS2 A;  5D0E A;  2NS1 B;  1XK8 A;  3BGR A;  3FKB A;  2G0I A;  1MG7 A;  2HQG A;  3L3C A;  2GO9 A;  1X9S A;  2FJV A;  3T1A A;  4RLE A;  2ZKU A;  3RBZ A;  5GAG U;  1RYR A;  5IT9 U;  1OY6 A;  4MIW A;  4HYK A;  1VQ7 S;  1Y3J A;  2V2Q A;  4J37 A;  5KFH A;  3E01 B;  3DRY A;  2UUA J;  1GX5 A;  2OFG X;  4R5P A;  5LXR A;  3UD4 P;  1F6T A;  3L09 A;  1FK9 B;  1XMO F;  4FXD A;  2JLE A;  4L6V 3;  2OEK A;  4M5L A;  2PEB A;  3IG1 A;  5EGY A;  1Y9O A;  4JI3 F;  1NH7 A;  3ZTO A;  4C0O C;  4CO0 A;  2XS7 A;  3I87 A;  3HI9 A;  3N5F A;  2R8H A;  2OSQ A;  1UVL A;  3THT A;  3VCD A;  5L46 A;  3GB0 A;  4ALZ A;  4QPT A;  5CAB A;  1NJY A;  3JTN A;  1S10 A;  3BN4 A;  5F3T A;  1Q8I A;  2KRR A;  3R6G B;  1XNR F;  1B4S A;  2HVI A;  2F1F A;  2IRU A;  2NPI A;  4OZ2 A;  4FP9 A;  2JEG A;  4ZVT B;  4YOE A;  1RTH B;  3DI6 A;  2ZE2 A;  4U7U K;  2GCF A;  4ZVO B;  1NK4 A;  1RE1 B;  2D69 A;  2W9C A;  2CPX A;  4DV4 J;  4B3M J;  4ECY A;  2CYY A;  2GJ2 A;  4Q5V A;  4IQX A;  2PO4 A;  1OSD A;  3M2R A;  3BH6 B;  2BJ1 A;  4QYZ J;  1XMB A;  2OPP B;  4WXO A;  2DIV A;  2W01 A;  3R2D J;  3JTP A;  2VKR A;  4DN9 A;  1A7G E;  3R7B B;  4PCQ A;  1VJQ A;  1IBK J;  1C1B B;  1FWK A;  3BPD A;  3NS5 A;  3R2C J;  3KG0 A;  4EFA C;  5F9L A;  2AJQ A;  3HT3 A;  3M2U A;  2RB7 A;  3L7U A;  3CB4 A;  2XTJ P;  3EPI A;  3W9H A;  1NHU A;  4U96 A;  4P7V A;  1FVS A;  4Y2A A;  4RW4 B;  3CW2 C;  4TU7 A;  1VHI A;  1GEH A;  2NSC A;  2V4J A;  1Y3K A;  5FDL A;  2F63 A;  1RT6 A;  2JLF A;  2R3V A;  5CZV A;  4C6A A;  3Q8V A;  5GAD U;  1SI9 A;  1KLM A;  4UW2 A;  2MZT A;  2W4P A;  4KB7 A;  1BD6 A;  1XR6 A;  3MUT P;  1LXJ A;  4LFC J;  4N76 A;  4PG8 A;  2R7X A;  4IG0 A;  3CME S;  2UVU A;  2E44 A;  2LKZ A;  4C4W A;  2FZC B;  2DHX A;  3VZH A;  3LP0 B;  3ZFV A;  3MM8 A;  3Q2S C;  1KSP A;  2EG2 A;  1SQE A;  3RB4 A;  4UUW A;  5LL6 d;  3THV A;  5K8N A;  3NNA A;  4RUA A;  2BJD A;  3T1Y F;  1HWL A;  2CJA A;  1QY7 A;  2QLB B;  4B02 A;  5AE1 A;  1PAE X;  1VBX A;  1K47 A;  1HNZ J;  5DG8 A;  4LF7 J;  3OVB A;  5AXK A;  1H98 A;  4KH1 B;  4LIR A;  2V63 A;  2EK1 A;  2VBX A;  4ATN A;  4DUY J;  3EE3 A;  3MEG B;  2CQI A;  3KHH A;  4DSK A;  4URS A;  2C2R A;  4JI2 J;  2C3M A;  1WTF A;  2F3J A;  2W4D A;  2IFX A;  3JXO A;  3VHQ A;  4CM2 A;  3OJS A;  2IYI A;  5CD4 A;  3T5J A;  2QN6 B;  4YB6 A;  4EBD A;  3G9C A;  4DEZ A;  1VHF A;  3MWB A;  1R31 A;  2WVC A;  3DRX A;  5ETR A;  4LFB J;  4AD6 A;  1PO6 A;  2VBY A;  1PGZ A;  2G1D A;  1U6Z A;  1UZD A;  2GHV C;  3R5D A;  4KE5 A;  4DBQ A;  4DX7 A;  3BO3 A;  3J81 j;  4GC6 A;  3K0J A;  2JVO A;  2V9K A;  3FBB A;  3UN5 A;  2R2S A;  4IRK A;  3CJR A;  3KUG A;  2FJA B;  4CH1 A;  3W2V B;  4JI0 F;  1UA1 A;  4JV2 A;  1HLW A;  5DJB A;  2I0X A;  1FX2 A;  4JV5 F;  3GIR A;  2D41 A;  3HD1 A;  2L9D A;  1KKH A;  3MOZ A;  4I2Q B;  4IG0 B;  2ZH3 A;  3BZQ A;  3HFZ B;  4PKD B;  1TL5 A;  1S4E A;  1X5T A;  3UO0 A;  4CH7 A;  3K5N A;  1UVK A;  2XMW A;  2XSJ A;  3NCR A;  1K73 T;  4LF4 F;  1ZM9 A;  1Y4Z B;  2CAD A;  1W25 A;  5DDR C;  5KFU A;  1TUW A;  4FYV B;  3CXC R;  1RU1 A;  3PEJ A;  4UOF A;  3EGN A;  1RAH B;  4I56 A;  2J76 E;  3V2U C;  2MKK A;  2FGO A;  4PXC A;  2F65 A;  3AJ2 A;  5I3Q A;  4WCE Q;  4ICL A;  3WC0 A;  2VFT A;  3OHB A;  4DG1 B;  2VV5 A;  3KNG A;  3LAK A;  5KFN A;  3H4B A;  1YX2 A;  1VQ6 S;  3H5U A;  1U7L A;  4RBU A;  4ZHR A;  2DHH A;  5D0G A;  1XNQ F;  2VPZ B;  3UQS A;  1LKZ A;  3PXG a;  3MFI A;  4ZOS A;  3AXK A;  4YFU A;  1R8H A;  3PHT A;  3CCQ S;  1FKP A;  3V6J A;  4CTA B;  4DXL A;  4ZK7 M;  4P52 A;  4ES3 A;  3IRX A;  2J0Q D;  3MMC A;  3AOD A;  4OHV A;  2LQ9 A;  3ISN C;  3MR2 A;  2XUL A;  3ELH A;  3QAT A;  3SV4 A;  3M2R B;  4OI2 A;  2D3O R;  1RYS A;  2NR0 A;  2CDQ A;  4YEA A;  5M2R A;  4E8U A;  1XIQ A;  3H42 A;  4K4U A;  4F4W A;  2AJ0 A;  2D9O A;  1P9Y A;  3I5C A;  4K4Z A;  3B4D A;  1U8S A;  3DGV A;  3CJK B;  2DNP A;  2RIJ A;  2WVB A;  3V4I B;  4WF9 Q;  3VV2 B;  3CCW A;  1RTH A;  4MK7 A;  4DR1 J;  1N6Q B;  2I5J A;  2QMX A;  4P72 A;  4R25 A;  4LT6 A;  3EZ5 A;  2W2N P;  2XO7 A;  2ALZ A;  3TJA A;  5AE2 A;  3D7S B;  3QJP A;  4NPO A;  3CD6 S;  2CJB A;  3EXY A;  3ETM A;  4IR1 A;  2N3L A;  5F8N A;  2BVZ A;  4I2P B;  4WFY A;  4KQZ A;  4QIE A;  2MZR A;  1Q4R A;  1ZTW A;  1TR0 A;  1WEZ A;  3DGP A;  2GQC A;  4PG5 A;  5FII A;  2CQ0 A;  1RTI A;  2I9S A;  3CJS A;  5CCL A;  5HMW A;  3HVR A;  3NGT A;  1HYS B;  4PWD A;  3VR1 A;  2MQL A;  2HQ3 A;  2LLZ A;  2ZJQ Q;  2ZEJ A;  4ZJO A;  3GWC A;  1URN A;  1HNX F;  2X7I A;  2VIC A;  1Y5L B;  3GR0 A;  3IWX A;  4ERD A;  3MUV P;  3P5T L;  3JSM B;  2HMI B;  3J80 Y;  3BGR B;  5BR8 J;  3IBF B;  3G8Q A;  3ENV A;  5BYS A;  1HQU A;  1UW9 A;  4FDF A;  5GAH U;  1DQA A;  1T9U A;  1WF1 A;  3OTO J;  3FGV A;  2EVZ A;  3WZ0 A;  1SB6 A;  4KFB A;  4KAI A;  2MHE A;  5HMZ A;  5KFL A;  2RSQ A;  2ROP A;  3ZZ0 A;  4JI5 F;  2K7J A;  3POT A;  1YJV A;  2B7C B;  2CWK A;  3GSD A;  3PJ9 A;  4MFB A;  1RA6 A;  4OL8 A;  5L1L A;  1SJR A;  3S8S A;  2LXU A;  4JI1 F;  2DY1 A;  3BBB A;  3ITH A;  4J9U E;  2DNQ A;  1ULR A;  5F41 A;  4TYA A;  3G71 S;  1O51 A;  3MAH A;  3TQ1 A;  1D9F A;  3VVU A;  5A6P A;  2DPJ A;  2ZJR Q;  2CQB A;  3QLH B;  4KGX B;  4K4S A;  3CIM A;  2CXE A;  1D1U A;  2AU0 A;  4KHR A;  2FYX A;  5T14 A;  4B3O B;  2RQC A;  1DJ0 A;  3VAF A;  4QR0 A;  3DN9 A;  5DQI A;  5DG9 A;  2QL5 B;  1NK5 A;  4OI6 A;  1I94 J;  3D3B J;  5F0W A;  4PPZ A;  5GAH I;  1GMW A;  2KG1 A;  2AYB A;  1C4C A;  1Y5N B;  4NI2 B;  1NDC A;  3R8Y A;  1U45 A;  1GQE A;  4ZVS B;  2L41 A;  5LM7 E;  2M8H A;  3W65 A;  5EHH A;  1SL0 A;  2HVH A;  3AQO A;  3MM7 A;  4MIB A;  2IMW P;  3D6F B;  1RWO B;  2Y1R I;  3C15 A;  4DZD A;  1TL7 A;  2ILY A;  2JX2 A;  5HL7 Q;  1X0F A;  3Q83 A;  3W5Z A;  2UUB J;  3PG9 A;  3E51 A;  3GII A;  1TU0 B;  1I1G A;  3TZY A;  4ZJL A;  3M05 A;  2W7P A;  2ZM6 F;  3SSR A;  1BQN B;  4J9R A;  1R0A B;  3TUJ C;  3A8J A;  2QTW A;  4IDK B;  3ZNU A;  1X4C A;  5FD1 A;  1RHJ B;  2HVD A;  1LW2 B;  5C24 A;  1M5K C;  2OPS B;  4V19 J;  4RW7 B;  3M8P A;  1LXN A;  3D4J A;  3KFW X;  3LP2 A;  4R8U A;  4OV1 A;  2LCW A;  3UDV A;  3UCG A;  4Q8F A;  1RA7 A;  2YNH B;  3FJ2 A;  3B6B A;  3DOL B;  3GFY A;  4A8M P;  1AXQ A;  1S7I A;  1ZET A;  1ZM3 A;  1FFS B;  1R8C A;  2YKN B;  4RNO A;  3NEK A;  4ER8 A;  2B9E A;  1RWW B;  3DHX A;  2M7S A;  4JI2 F;  1CUL B;  4USM A;  4H4O B;  2HHV A;  2M4M A;  2AEM A;  3CC7 S;  3WIV A;  3BYR A;  3HK2 A;  2ZH6 A;  3N6M A;  4AL5 A;  5GAE U;  1VS3 A;  2P8I A;  4LFC F;  4CRJ A;  5ETV A;  2R7W A;  3R27 A;  2AGQ A;  3P6Y C;  2N4C A;  1RWP B;  3LQV A;  3TRG A;  2A18 A;  4OJ3 A;  4C9D A;  2MY8 A;  5GAG I;  1FER A;  2MZJ A;  2C42 A;  4ZIV A;  4QR1 A;  2PI5 A;  3LAM A;  2DR8 A;  2CUY A;  4C98 A;  3CO0 P;  4LRE A;  2R7U A;  2AF6 A;  2SXL A;  5LJ3 Y;  3D5M A;  2M52 A;  2EFQ A;  3U27 A;  3J7Y I;  3KLG A;  4IFV A;  1Q79 A;  3TAP A;  1QLN A;  1QAX A;  3T5H A;  4NXN J;  1MWY A;  2WVF A;  1SV5 B;  2QLW A;  1HBM B;  3ZZY A;  4NLU A;  4LF7 F;  4K4T A;  3BEG B;  1MU2 A;  4ZDN A;  4N7T A;  3CTR A;  2BE7 D;  3NOC A;  4NRU A;  3NAH A;  3JAM U;  3KLH B;  3T5L A;  4KO0 B;  4ETZ A;  3DRR A;  5DQG A;  5GMD A;  3HVT B;  2NXU A;  1PSD A;  3I9Z A;  4NL5 A;  2B51 A;  4KBI A;  5MLC V;  1SKW A;  3B82 A;  4YR2 A;  2KM8 C;  4YME A;  3GP9 A;  4AXI A;  2VQF F;  2FLN A;  2KT5 A;  1SJ3 P;  2VFU A;  3HHL C;  1FNM A;  2EPI A;  1HPZ A;  3H2L A;  3NG8 A;  5I3U B;  2KFY A;  3V81 A;  5CXT A;  1RAG B;  2RVJ A;  2RKI A;  4QIF A;  4DMZ A;  2AX1 A;  1MN7 A;  1YRU A;  1GMU A;  3PTW A;  1UPM B;  4P10 A;  4CWB A;  4JI4 J;  3CJT A;  1CS4 A;  2JLG A;  2QG9 B;  2C2O B;  1KLM B;  3K5O A;  4YP3 A;  3O5T B;  2E7V A;  2M8D B;  1NK6 A;  1NB2 A;  3DMJ B;  4C8Z A;  1N5Y B;  5CZX A;  3CCS S;  3L95 X;  3QGH A;  3N28 A;  4MAK A;  2M2B A;  4LF4 J;  1MML A;  3MDF A;  1BLU A;  1IQZ A;  2CKW A;  4DX5 A;  2AYM A;  3AD9 C;  5ETP A;  4LSZ B;  1SJ1 A;  4IUF A;  3MPW A;  2HFS A;  3QGP A;  2UXB J;  4LVO P;  2W1B A;  3AH6 A;  3CO9 A;  4ZP7 A;  3IM8 A;  2XZW A;  2G2Z A;  3GLJ A;  2D3Z A;  4C11 A;  3PX0 A;  2AJF E;  3SQO P;  2V4Q A;  3CCJ S;  2OPP A;  5I3U A;  4DUZ F;  2CPE A;  1UKU A;  4LFA F;  2L48 A;  3Q86 A;  3P45 B;  1GTE A;  4FKX A;  4KH0 B;  4PG6 A;  4WPA A;  4NLT A;  1HQ2 A;  4GKK J;  2B8Q A;  1JQG A;  3WDO A;  5F9N A;  4E0D A;  1RK8 A;  2IYG A;  2V6A A;  2MHN A;  4UZB A;  4E2F B;  1WHX A;  5F8M A;  4NZ7 A;  1KQF B;  1JXL A;  1HQE B;  2O1P A;  5BR8 F;  3OFH A;  2GVD B;  3QRQ A;  2WOM B;  2H4Y B;  1JNZ B;  4BWJ A;  2HHU A;  1S1X A;  1TL3 B;  3G2X A;  5HVF A;  4EI2 A;  2E7W A;  2AMC B;  4EO8 A;  4RNF A;  4OYI A;  5KT5 A;  1UVN A;  1YBA A;  1IR1 A;  1YJR A;  2UV8 A;  5KFY A;  2Z2M A;  2RHS B;  1GTH A;  3KJN B;  1D09 B;  1YDL A;  3CGI A;  3N4W A;  3W7B A;  3TOQ A;  4X4U A;  3M8Q B;  1LOU A;  1VRU A;  3BH7 B;  3GTY X;  1GNK A;  3E01 A;  3OL8 A;  1FJ7 A;  1OJ4 A;  3BKF A;  5DLG A;  2P2C B;  1P6T A;  5IFM A;  1KC8 T;  5KT7 A;  2COL A;  2HRT A;  3BGF A;  1FNX H;  1S0O A;  5J2P A;  3ZO7 A;  3K57 A;  3CJ3 A;  2HWH A;  5HVG A;  4B3R J;  3T6J A;  3MI7 X;  4F0M A;  2AP6 A;  1AT1 B;  2YH1 A;  4RW9 B;  3I0S B;  3KLV A;  4AL6 A;  1JLA A;  1D3W A;  4QW9 A;  4A48 A;  3KLG B;  2RRB A;  1NHK L;  1PJ7 A;  2K3K A;  1FRH A;  2C2M B;  2MJN A;  3V4M A;  3BQ1 A;  4DV1 F;  4ECZ A;  3T1H F;  4O3O A;  4ZCM A;  3T9N A;  4TQR A;  4LSL B;  2Z2L A;  2HBY B;  3AJ1 A;  4X64 F;  2ZH4 A;  3PKM A;  1FFW B;  4EEY A;  1CQN A;  3Q8P B;  2Z0G A;  4FYW B;  2C3P A;  3CDW A;  5L8R C;  2DBB A;  1MNE A;  3GIM A;  2LQ8 A;  3EVM A;  3G6Y A;  1FVQ A;  2C2N A;  2J9C A;  4L72 B;  2OMO A;  5CYQ B;  3MR3 A;  2A6O A;  4B08 A;  4RWW A;  1KVI A;  4NLS A;  4ZPD A;  1DTQ A;  4LBP A;  2XNR A;  2ZBP A;  1U0H B;  5HN0 A;  4MKY A;  2QLJ B;  3W61 A;  3K58 A;  2HG4 A;  2HYI B;  1WC4 A;  4HI2 A;  4A47 A;  2W2M P;  1T8E A;  4YUD A;  3PO5 A;  4ED6 A;  4USU A;  3FNN A;  4A4J A;  3QRP A;  1OY9 A;  2R2U A;  3OW2 R;  1TVR B;  2V9W A;  3HCX A;  4QWB A;  2XMA A;  1PKU A;  3FCH A;  2MPU A;  4ECQ A;  3DKD A;  5HAO A;  1XMO J;  4I68 A;  3RR8 A;  2G1H A;  4H4M B;  3LUY A;  1RAI B;  2VBW A;  4WIQ A;  1RAA B;  1UPP A;  4Y2C A;  2XY7 A;  3OL7 A;  4A8X A;  4DV6 F;  2Q6B A;  1C0T A;  1WF0 A;  2OPQ A;  3LAL A;  5SUH A;  5B08 A;  4O3Q A;  2FD2 A;  2JSX A;  4Z37 A;  4C3K A;  3OR1 A;  4Z7Y A;  2GX8 A;  1S4F A;  2DNY A;  1WOS A;  3TW0 A;  1T03 A;  3A4T A;  2VPW B;  2IIH A;  1WF2 A;  4HDG A;  3AB2 B;  5KFB A;  3PX6 A;  2UU9 F;  3LGN A;  2GGP A;  1EAY C;  3BO4 A;  1TVR A;  3CJ0 A;  3UPF A;  4LSN B;  3FEZ A;  5IOL A;  4PZV A;  1DRZ A;  3X3U A;  1XN9 A;  1NH8 A;  2QL7 B;  3BS9 A;  3HUL A;  1Q86 T;  3ET6 A;  1M5O C;  5KT4 A;  4DCJ B;  3DXB A;  1NK8 A;  4F2R A;  3CJQ A;  3HZG A;  1GMV A;  1TKX B;  3AFG A;  3RB0 A;  1M5P C;  4NXN F;  1NDL A;  1FJC A;  4CO4 A;  4ECW A;  1VQL S;  2XNQ A;  3FFI A;  1JLB A;  4PXB A;  2LQB A;  2QYG A;  3V81 B;  3AHP A;  3GCW P;  1VQ8 S;  1X5O A;  3ILL A;  2HWI A;  3N5B A;  3R1H A;  2VON A;  1EAR A;  3DLH A;  1SPB P;  1TKT B;  3CCU S;  2X1B A;  2D9P A;  2BJ8 A;  2CNO B;  1JLA B;  2YWH A;  3A8I A;  4P7T A;  5A8K A;  2Y8Y A;  1R27 B;  1PJ6 A;  2RDD A;  3M9N B;  2CG8 A;  5J2Q B;  1LNQ A;  1IJF B;  3RAM A;  3SDE B;  1U1P A;  1H3D A;  3FCV A;  1GXU A;  3N0V A;  4OMF G;  2HFZ A;  2DHS A;  2XI3 A;  2F5G A;  3FDS A;  2VFV A;  2LA6 A;  4DSE A;  5A8K B;  2FC9 A;  2D3O 1;  1U4B A;  4B3T F;  4TLQ A;  1N32 J;  3MM5 A;  5AXN A;  4ECX A;  4LF6 J;  2BRK A;  5L1I A;  4CNZ A;  2DY9 A;  3RJM B;  2MDA A;  2PE8 A;  2YWF A;  4MT1 A;  3T19 A;  5JXS A;  1IBK F;  2BDP A;  1RZM A;  1CEZ A;  1AA1 B;  2H4W B;  1RBL A;  3GPA A;  1UEV A;  2DTJ A;  2GW8 A;  3LO3 A;  4YB1 P;  1N5T A;  2CJ9 A;  5HI7 A;  3D0H E;  3BJY A;  3M30 A;  4NXM J;  2HQI A;  1B0P A;  3CED A;  2BYC A;  5KFX A;  2AQ4 A;  2BV3 A;  2PMH A;  3ULH A;  4PWU A;  1WKJ A;  3ZZZ A;  3MEK A;  3TEH B;  4Y00 A;  4UOC A;  4KV8 B;  4LBI A;  2DGX A;  2C3O A;  3S1T A;  1H72 C;  3CJ8 A;  2R7S A;  4H4O A;  2FDN A;  2CAJ A;  4Y2I A;  3DM2 A;  2J8S A;  2RE1 A;  4AT1 B;  2PT0 A;  3PRV A;  2PFF B;  2MQP A;  1H38 A;  3PJX A;  1U26 A;  2HRY A;  3HHK A;  5HP1 B;  3CJK A;  1LK5 A;  2CPZ A;  1Q53 A;  2L08 A;  3PIO Q;  3HT0 A;  3DFE A;  5HQM A;  1U2F A;  3I31 A;  2XMT A;  4OI4 A;  3W9J A;  4DF8 A;  2G13 A;  1RU2 A;  4O44 A;  1JX4 A;  1IKW A;  2BAC A;  1C0U A;  1Q5V A;  1UAW A;  4GRS A;  3GJQ B;  2LXF A;  4O23 A;  4RBT A;  3TUI C;  4P2S A;  4QQB A;  4Q2M A;  1PBA A;  1B7Y B;  1S9F A;  4WP8 A;  1VRT A;  2XWX A;  1WJ9 A;  3H5S A;  1S9G B;  2MQO A;  4NLG A;  1T95 A;  2MY7 A;  4DR7 J;  3RG6 A;  5HAN A;  3UI3 A;  3SQG A;  2IDE A;  1YSJ A;  5J1E A;  4DR5 F;  1NPK A;  3C15 B;  4IH7 A;  2H3E B;  1RT4 A;  3P96 A;  2V8H A;  5EX3 A;  3G8T A;  5L38 A;  3C6U A;  5KG3 A;  1PYO B;  3H25 A;  3CCV S;  2F4F A;  3AA9 A;  2M3D A;  3PEH A;  3R5B A;  4OJG A;  2DHG A;  1X5S A;  2DIT A;  2ZZT A;  3UNG C;  3M8R A;  3CDE A;  4ELV A;  2E1M C;  4L76 A;  4LIW A;  3IXQ A;  4DL0 C;  3C6T B;  3DLG B;  1ZYQ A;  1RHR B;  1NJI T;  2J6S A;  4ZN3 A;  2FJW A;  2F40 A;  3NBP A;  1SUQ A;  3FZB A;  3MEC B;  4I67 A;  2Q66 A;  2UUT A;  1S76 D;  4JI7 J;  1YJ7 A;  2DGS A;  1P1L A;  5C42 A;  5IQ6 A;  2MKC A;  4DR4 F;  1IBM J;  2B8P A;  2CPY A;  1NEE A;  1N34 J;  2HAI A;  3RAX A;  2GVZ B;  3FRY A;  2F9D A;  4QZV B;  4BDP A;  5THW A;  5T41 A;  1FXD A;  1ROF A;  4ZCI A;  1QSY A;  5J2N B;  4O4G B;  4EBE A;  1DHM A;  1FDD A;  1HBM A;  1ELO A;  3GR1 A;  3P3D A;  1FJG F;  1T11 A;  3K5L A;  2UUC J;  3AXM A;  3D28 A;  4OJH A;  4EYH B;  1DUR A;  4KJI A;  2BQU A;  1ICE B;  2B5J B;  4FXV A;  4C3L A;  1FDN A;  1SC1 B;  5C5J A;  2IBK A;  2I2Y A;  5KFM A;  4X4T A;  1O0P A;  3KK2 A;  3BDE A;  1HWK A;  3M6V A;  1MW7 A;  2DO4 A;  2G0C A;  1RT3 B;  2V0N A;  1WC3 A;  3KLI A;  1TMM A;  3KUH A;  5IC6 B;  3Q8S B;  1YJ9 S;  1LK7 A;  2GV1 A;  4X65 J;  4OX6 A;  4K4V A;  4PG4 A;  4I0W A;  2ZHB A;  4TLR A;  4C2M A;  4TU8 A;  6FDR A;  3CVK A;  5DG7 A;  1IR2 A;  2V8D A;  3CE8 A;  2AJ4 A;  3GG1 A;  3HHL D;  3WX8 A;  4CO2 A;  4ZLJ A;  5LOQ A;  1RHM B;  1CJV B;  3EVO A;  2C1E B;  3MPD A;  2AZ1 A;  2LEP A;  2XHC A;  2ZWO A;  3DDI A;  3QAU A;  4RWX A;  5JVH Q;  1HD1 A;  2E1P A;  4PRF A;  3GFH A;  3QMQ A;  4PPD A;  4DQP A;  2ROE A;  2M88 A;  1HQE A;  3M2V A;  1SH3 A;  1P27 B;  2EC2 A;  1NME B;  2QMU B;  1KRP A;  2V4J B;  5E2Q A;  1WC0 A;  2DRB A;  4KHP F;  1LWE A;  3KDN A;  3JQM A;  3CCM S;  4A8Q A;  2VOD A;  2DO0 A;  2YWE A;  4M63 A;  1PC4 A;  2CQC A;  2PSZ A;  3UW1 A;  2XG8 A;  3N01 A;  4F7V A;  3H4D A;  1HBN A;  4X62 F;  3AA8 A;  2R8I A;  3CCE S;  1L3V A;  1S77 D;  1WOR A;  6AT1 B;  4DUT A;  4OHZ A;  2XS2 A;  2JFK A;  2IC3 A;  4I1T A;  3HP6 A;  1HNI A;  1X5P A;  2YQ1 A;  2Z56 B;  1TFW A;  4LRF A;  1MSW D;  3HSJ A;  2H48 B;  3UVJ A;  4DFP A;  4Q7A A;  3C16 B;  3FUY A;  3RRG A;  4NA1 A;  2HRU A;  3H5Y A;  2ZH2 A;  1RWV B;  4DCO B;  3RRK A;  1UVM A;  4PG7 A;  4LQ9 A;  2NPF A;  3RBD A;  2BM0 A;  2EFO A;  2HLT A;  3CJ4 A;  4OV6 A;  2XMM A;  3H7H B;  3PO4 A;  4BHQ A;  1FEH A;  1E6Y B;  3F73 A;  4DR3 J;  1YTY A;  1M90 T;  1D8Y A;  5KG2 A;  1FF2 A;  3IAS 9;  4CZC A;  2YNI B;  1EJ7 L;  3Q24 A;  4DI6 A;  1HW8 A;  4F25 A;  1VC6 A;  3OHA A;  4CP5 A;  1X0P A;  2OAU A;  3KHG A;  2XSF A;  2IVY A;  4NRT A;  1VQS A;  2HND B;  4N77 A;  2X1A A;  1YI2 S;  3U1M A;  2MKY A;  3PAC A;  4HHJ A;  4DPX A;  1U1N A;  1HBO A;  2LQJ A;  1AZS A;  2BAN B;  3GQC A;  1U49 A;  4PAA A;  3JQJ A;  3J80 U;  5DQH A;  2Z4P A;  1ZH5 A;  2GS8 A;  2FHO B;  4P9S A;  1KS2 A;  1TV6 B;  2ABY A;  1VJW A;  5GME A;  2F4V F;  2NLW A;  1HMV B;  2CZ4 A;  3DRR B;  2XB2 D;  1VI7 A;  1CPZ A;  1SL2 A;  2DGU A;  2HHW A;  2BKO A;  3LF0 A;  1QE1 B;  4M5K A;  2BEF A;  4NLD A;  3THP A;  2WTF A;  3DXS X;  1TKZ B;  5LMU J;  2AGP A;  2W24 A;  4IR9 A;  1YBU A;  3M8W A;  4MYU A;  1YWX A;  5EN1 A;  3KHR A;  4LRA A;  2VAS A;  3CJ5 A;  1Q95 G;  4P2M A;  5DZ6 A;  2KN4 A;  3T5K A;  4B9N A;  1WC5 A;  5KFP A;  2DR9 A;  2OD4 A;  5IWA F;  1NZA A;  3QJJ A;  3BSA A;  2GJI A;  1JJC B;  4DFK A;  3RGI A;  3WBZ A;  4OHW A;  2CQD A;  3Q8Q B;  3C8Y A;  2VA3 A;  4IRC A;  1S6P B;  1E6V A;  1C4A A;  1HBU A;  5SZT A;  3GJS B;  4ZLP A;  3DOK A;  2YVS A;  1DTT A;  1UL3 A;  2MST A;  1SCJ B;  3DGP B;  2VHG A;  1FJE B;  2C22 A;  2KKH A;  2Y1J A;  1KNZ A;  2QFJ A;  1PIE A;  1Q7L B;  4PR6 A;  5DM6 Q;  1YBT A;  2DKO B;  5D0H A;  3RW6 A;  1KVK A;  1RLD A;  3DLK B;  5A0Y A;  2Y3Y A;  4LBH A;  1V5I B;  5C25 A;  5KFE A;  2HS4 A;  2V2K A;  2FGC A;  3KMQ A;  1WNE A;  1QM9 A;  1HIY A;  2FPH X;  3VVT A;  5A2Q U;  5H1S V;  1CG2 A;  2J7K A;  4ES2 A;  1TEL A;  1CJU B;  1UZH A;  2UP1 A;  4Q8E A;  3GE9 A;  1K1S A;  2LMI A;  5ETT A;  4B3S F;  3HMJ G;  4K2X A;  2ZH9 A;  4DV7 F;  2V94 A;  2KJW A;  4JBC A;  5CCM A;  4R8U B;  3Q8R B;  1FD2 A;  2PGC A;  1VQP S;  3A8E A;  3SQG B;  2KVI A;  3FSX A;  1JXV A;  3V5R A;  1WAC A;  5C7P A;  4EUV A;  2HAF A;  3TVY A;  4XK8 C;  1VQ5 S;  2V5H G;  1KQK A;  3KXD A;  2WBR A;  5CQG A;  2BW2 A;  3U02 A;  1IR0 A;  3WX4 A;  3OSN A;  1KON A;  3FBC A;  4I7F A;  2JNJ A;  3QT6 A;  4OI0 A;  5EWE A;  1R43 A;  2CPF A;  2A3J A;  3IS9 B;  2QEX S;  3JYT B;  5LMN J;  1IBM F;  3KG1 A;  5BYR A;  2JZ5 A;  2E5L F;  3QT8 A;  5HP1 A;  3TAM B;  1S12 A;  1N34 F;  2MZ1 A;  2P9C A;  4MKA A;  1YIJ S;  3GIL A;  4J9S A;  2HQC A;  3DOM B;  5AE3 A;  3DLK A;  2ZE2 B;  1ARO P;  2B9Y A;  4KC5 A;  2KRB A;  1HWI A;  2NXC A;  4KGV B;  4KV8 A;  4CH0 S;  1DQ9 A;  3D2W A;  2RU3 A;  2CWX A;  4ZIW A;  3K59 A;  4KSE B;  4B3O A;  2HGN A;  1EX8 A;  4DOZ A;  1BGX T;  5D4N A;  4ZIT A;  1H74 A;  4Y6I A;  4FBU A;  2IHR 1;  1XBW A;  1ZOT A;  1IM6 A;  3M30 B;  4RL1 A;  5K9F A;  3IN5 A;  2NXN A;  4LVN P;  2IJR A;  4GKK F;  2YNF B;  3VGT A;  4CLP A;  1RBA A;  1QTM A;  2PA8 D;  5I3P A;  4CIO A;  3Q0A A;  1RUS A;  3D0G E;  3BYP A;  5I42 B;  4NE9 C;  1TL4 A;  4UUX A;  5C2G A;  1VGY A;  4J90 A;  1B99 A;  3HJV A;  1HMV A;  1FTR A;  3DLJ A;  2FLP A;  4C8L A;  3JTO A;  1O8B A;  4MKV A;  1RHU B;  1UJ5 A;  1Y7P A;  2VOO A;  3CIZ A;  1NDK A;  4EZ6 A;  2JWN A;  3MEG A;  4ZVE A;  2FLL A;  3QSY B;  4OI1 A;  1Q8K A;  3HHN B;  4TNO A;  4LF9 F;  4S0M A;  5B7W A;  4JI6 F;  4L73 A;  2ALY B;  2HS3 A;  2ZH1 A;  4O3P A;  2NSB A;  2DD8 S;  4RW8 A;  1NJZ A;  4XPE A;  2J0W A;  1TV6 A;  2V34 A;  4ANE A;  1OSC A;  3M8S A;  5HQL A;  3QZ8 A;  1NAQ A;  2PMW A;  3KLF A;  1WG1 A;  1R8B A;  4K2J A;  5CH7 B;  3AB4 B;  5C2C A;  1OYD A;  2FC8 A;  1JLB B;  1VBK A;  2EFG A;  3EUN A;  3RBX A;  4AFF A;  4LF5 J;  1DLO A;  2YWK A;  3I0R A;  1SQG A;  1NKE A;  2RAQ A;  4F4Z A;  1TL1 A;  1OPZ A;  4ZPW R;  1Z2Z A;  4Q43 A;  3OTO F;  4DR2 F;  4O0N A;  2RH3 A;  4CYU B;  2MKJ A;  2ROG A;  2YKA A;  1P9Q C;  2PI4 A;  4B9V A;  2I8E A;  2WSF C;  2KXN B;  4M95 A;  2Q6C A;  2HND A;  3E3X A;  3H5X A;  2CPH A;  4X64 J;  4YY3 J;  1IWA A;  2JEJ A;  1LWC A;  1T05 B;  4LF8 J;  3IM9 A;  1FXR A;  3SCI E;  2JC0 A;  4OYO A;  5D6G A;  3Q22 A;  1XNR J;  1N5Q A;  1H7W A;  4RKU C;  1U1L A;  1FNO A;  5F8H A;  4KTQ A;  4N41 A;  1YJW S;  2IC3 B;  3OTC A;  3IA0 A;  3MMC B;  3NGU A;  1JLQ B;  2YXL A;  4FNH A;  3UR3 C;  2OKQ A;  4OIX A;  5KFD A;  1S9E B;  1OO0 B;  2QYC A;  4DU8 A;  2OEJ A;  4NYP A;  4L3K A;  1HR0 J;  3W3S A;  1JLF A;  1N0U A;  4F3Q A;  2ASD A;  4DV0 F;  1HBN B;  1V3S A;  2FY8 A;  2IBO A;  2ZDO A;  4GVB A;  4P75 A;  4C48 A;  5K8O A;  1U6F A;  2KYZ A;  2B43 A;  4P2F A;  5E3A A;  1S48 A;  4FN5 A;  3OBI A;  4ZPT R;  2QV6 A;  2CPI A;  2HLU A;  2HWT A;  4CYU A;  2ATL A;  4JYA F;  4BC7 A;  4OI3 A;  4DL6 A;  1JJ4 A;  3C46 A;  4ED5 A;  2AJ1 A;  4K0K J;  4HEA 9;  3H2U B;  4CLF A;  4HHU A;  4I6Y A;  4DS5 A;  2BMB A;  3OPK A;  4DQS A;  4A8Y A;  4KHM A;  3NMR A;  4RR5 A;  4ED3 A;  3V6D B;  3FCW A;  1FCA A;  4DZ6 A;  3PYE A;  2YQ3 A;  3ICL A;  5B0C A;  5IT9 Y;  1F9H A;  4EK2 A;  5E33 A;  1RGV A;  1N54 B;  2I1R A;  3SSQ A;  5T7L B;  3VGU A;  4AUK A;  4RUH A;  2WAQ D;  1L3S A;  2JEF A;  2ZWP A;  4DL2 A;  1K44 A;  3I5B A;  4WFZ A;  3RBE A;  2KXF A;  4DV5 F;  2B6A A;  5G0R B;  5C42 B;  5EDW A;  1S1T A;  3OT9 A;  3TZX A;  1FRI A;  1S0N A;  1A6L A;  1WEL A;  2CVI A;  2VG6 B;  3NCP A;  4O4G A;  2Y1L B;  1X9M A;  2JRS A;  4DV6 J;  3OUY B;  5LMU F;  1S0M A;  3CD0 A;  4DCP B;  1RT1 B;  1UEU A;  2GAG C;  3C6T A;  3DLG A;  1P8G A;  3IBW A;  1KOO A;  2E1A A;  2DNN A;  1EP4 A;  2H65 B;  2MEW A;  1TZ0 A;  2LEC A;  4B3S J;  1C2P A;  4CQ1 A;  3CJ2 A;  2GNK A;  4HH0 A;  4DF4 A;  4ZVG A;  1XEZ A;  3JYT A;  3IS9 A;  4C3M A;  1WTB A;  4CO1 A;  4DL7 A;  4G1Q B;  2J9E A;  1DBD A;  3BRE A;  3HKZ D;  4ED8 A;  1L3U A;  4GO7 X;  1UCN A;  3CD7 A;  2IRX A;  4FF4 A;  2BBE A;  4MK8 A;  3CF5 Q;  3W8P A;  2MJU A;  4IFY B;  1FRK A;  3G86 A;  1JXE A;  3TX0 A;  4X4O A;  2QX0 A;  4XDC A;  3TEG A;  4W4M A;  4K4W A;  3L4B C;  1S1W A;  1JIH A;  4G3I A;  2P6T A;  3ZTR A;  2XQC A;  2J0S D;  2VB6 A;  4K50 A;  1VRT B;  4HI1 A;  1JJH A;  1RT4 B;  2YNG B;  4DPO A;  1QSL A;  3NOG A;  2VH7 A;  4ZA1 A;  5IS2 A;  1H73 A;  4L3N A;  2HPU A;  5KFQ A;  4WFA Q;  4UZC A;  5ETM A;  3TZW A;  4PYA A;  2OHD A;  4RNH A;  5A0Y B;  4H54 A;  4O44 B;  4U95 A;  4FPI A;  5C25 B;  5DDP C;  5B0E A;  2KM8 B;  2EW9 A;  3HXM A;  2A2C A;  1N0V C;  3M9M B;  1OQ6 A;  2KZZ A;  2LU1 A;  4JI4 F;  4U8V A;  3T9Z A;  4QCL A;  1IKW B;  3F41 A;  1TFY A;  2KI2 A;  3TR5 A;  2AYE A;  4MKB A;  4RJV A;  2R2T A;  2AT1 B;  5HBM A;  4WU2 A;  3KJV A;  1S6P A;  2UZA A;  3TUZ C;  1T02 A;  3B78 A;  1LV5 A;  2MZS A;  4TXS A;  4J9M A;  3TA1 A;  3UWT A;  4ZN1 A;  2UVW A;  3GG0 A;  5LSR A;  4JI0 J;  3RZA A;  2ZIT A;  3JB9 k;  4QU6 A;  1Q8B A;  4JI8 F;  2YKM B;  3CT9 A;  3OL9 A;  4HKQ A;  1RB0 A;  5KG6 A;  4X84 A;  2CZV C;  3MUR P;  1HNW F;  4WP9 A;  1UJ6 A;  3UD5 A;  2GML A;  2FJD B;  3IO1 A;  1RHK B;  2CVE A;  2H5I B;  2RUG A;  3ILJ A;  5ETL A;  3R5J B;  3MCO A;  3ZNJ 1;  1T9T A;  5CA5 A;  4MH8 A;  2OGU A;  4NLW A;  4X4R A;  4DUZ J;  1QSS A;  3PV8 A;  2K1R A;  4X66 J;  2F8E X;  4ZCL A;  2VG7 A;  4KPC A;  2WVE A;  1W26 A;  1DAR A;  2XCP A;  4F4A A;  5KFF A;  4KY3 A;  3OVA A;  3IP0 A;  2R4F A;  4WK3 A;  1JLG A;  2HQD A;  3FVY A;  3MPV A;  3QNW B;  4ID5 B;  4C0H A;  3NS7 B;  4DX8 H;  1PBU A;  4NLY A;  3ILO A;  1I51 B;  2XHW A;  2IM0 A;  2POK A;  1Q0N A;  4O3S A;  3BM7 A;  2WON A;  2VG5 A;  1RAE B;  2Z2Y B;  5KT3 A;  2IRY A;  2OLW A;  2FJX A;  2YNI A;  2P9E A;  4AL7 A;  3HHL B;  3MEE B;  2Y0B B;  2XS5 A;  1VMB A;  3BQ0 A;  2EFV A;  5FJ4 A;  1JK9 B;  2HK3 A;  2G4B A;  4KKO A;  5KFA A;  2Y1I A;  1TUV A;  1VQY A;  3LGH A;  4MMO A;  4FVC A;  1QAI A;  5B0A A;  1EQM A;  5E3C A;  4OZ5 A;  3JAM Y;  1XER A;  2ZFH A;  3TNV A;  3CDU A;  2NXJ A;  3NKY A;  4XIU A;  2FIU A;  4A8W A;  2NUH A;  3CCZ A;  4AE5 A;  1CJT A;  3HVA A;  3TAR A;  4QWC A;  1KEK A;  5H9F J;  4KGK A;  2KJV A;  1R6V A;  4O3N A;  2ZUG A;  2Z8Q A;  3FQL A;  4M5M A;  1C1C A;  1WEX A;  2E29 A;  3FC9 A;  3DOL A;  3T1H J;  3OTE A;  4CCH A;  3NNC A;  3OL6 A;  2J9D A;  2R8G A;  5LSO A;  1TUG B;  3GJT B;  4ILR A;  2ILZ A;  3KMS A;  4A8K A;  4IOA Q;  3OXL A;  1ZZF A;  2OPS A;  2VJU A;  3UE2 A;  3PHE A;  4OYW A;  3BR9 A;  2YX1 A;  3PNI A;  1JLC A;  1NPP A;  3KJQ B;  2LVW A;  4FVM A;  1QVF R;  3PW7 A;  1KVJ A;  1FRM A;  3G82 B;  2E5G A;  2XMV A;  3MZI A;  3HSD A;  4R0J A;  2B9X A;  3K5M A;  3JSY A;  4Y28 C;  3M8Z A;  3NLC A;  1TL7 B;  4EZ9 A;  1IUJ A;  4F67 A;  4DV4 F;  4B3M F;  1RCO B;  4QYZ K;  1ITP A;  3MMB B;  2EFP A;  1V3Z A;  2LQ5 A;  1F5A A;  2D74 B;  1RWK B;  5LJ5 Y;  1RWM B;  3QZ7 A;  3UCU P;  1MN9 A;  2QZ8 A;  3AD8 C;  4N8O A;  2E9R X;  2YX7 A;  3KLI B;  2DGT A;  2APO A;  1NDP A;  4CLL A;  4DHV A;  1YJU A;  5ITH A;  1G3O A;  1MMN A;  1JB0 C;  3HHL A;  3MEE A;  4XO0 A;  3ZZU A;  1W7W A;  2X3G A;  4DV5 J;  1VBZ A;  2B5J A;  1HR0 F;  4DR6 F;  3R3T A;  2WON B;  2BUN A;  3PIP Q;  4DSJ A;  1H0H B;  2WRM A;  1V9O A;  1HI8 A;  1UET A;  1S6U A;  3I0S A;  3QLH A;  2GZO A;  4RO0 A;  2FVQ A;  1D8Z A;  2BOP A;  4ID5 A;  3UN3 A;  1U1M A;  1T9X A;  4IOB A;  1FDB A;  1EKR A;  2UXD F;  1YZ7 A;  3QWP A;  4OLO A;  1K1Q A;  2KYX A;  3NWG A;  3KK3 B;  3TO8 A;  5J2P B;  3F56 A;  1AYE A;  1KWM A;  1ZAV A;  3FEX B;  1NU4 A;  5AT1 B;  1RTD B;  3VQT A;  4OX8 A;  1QJH A;  4K0K F;  4ILL A;  3BPS P;  1CJK A;  2X1F A;  4WII A;  3SFU A;  4WFB Q;  2A1B A;  1TK5 A;  3WQP A;  5DRK A;  2UUB F;  2ZVS A;  2W2Q P;  3IMQ J;  3W9I A;  2CQ2 A;  1ZBT A;  4KFB B;  3V6D A;  1XMQ J;  1NCL A;  2DCL A;  2FQQ B;  2GAH C;  2XGQ A;  2BR0 A;  3T1Y J;  2ZM6 J;  1FE4 A;  1GXT A;  4O0I A;  1YKW A;  3SI8 A;  2YKM A;  2ZBI A;  3UD3 P;  4F04 B;  1R0B G;  2AEF A;  4DU7 A;  4WTY A;  2PII A;  1VBY A;  3PKY A;  2EI5 A;  3RU0 A;  2QA1 A;  4F8R A;  1X31 C;  4B9M A;  1KHV A;  2XI2 A;  4OFZ A;  1V3R A;  4OYZ A;  4XAK A;  2KB2 A;  1U6B A;  3KJF B;  3BKT A;  4B9L A;  4FS1 A;  3PW2 A;  1S1X B;  1TL3 A;  3BV8 A;  1UVJ A;  3M8Q A;  5D77 A;  4IYQ A;  1HHT P;  1Z4U A;  4PQU A;  2MQM A;  2ASL A;  1YJT A;  5CHC B;  1RSC A;  4LFB F;  3A8K A;  4XTT A;  5A8R B;  2QA4 S;  4NX9 A;  3BR8 A;  3LPE A;  1D9D A;  2N3O A;  4I6A A;  4DV2 J;  1NK9 A;  1Z2L A;  1RT5 A;  2RD5 C;  4JV0 A;  4AND A;  4V1A k;  1NUE A;  2WHO A;  4M5J A;  2A10 A;  4M1K A;  2IVF B;  3MFH A;  1UMJ A;  3A12 A;  1N6Q A;  4C8K A;  2ZZM A;  1G1X A;  4IG3 B;  3V4I A;  3OVS A;  2GHP A;  3Q8Y A;  4WZM A;  2ZZN A;  5HBM B;  3KJV B;  1LFP A;  5DM7 Q;  3H8Y A;  5KFC A;  3GV8 B;  2CJK A;  2CQG A;  2GO8 A;  4URQ U;  2FVS A;  3PYG A;  4FXW A;  3U7J A;  1M1H A;  3G6X A;  1F9F A;  1PC5 A;  3D1H A;  1RXO B;  1WEY A;  2W2P P;  1Q1K A;  2LU2 A;  2DB1 A;  2DYA A;  4DUY F;  4RU9 A;  1RTJ B;  3MR6 A;  4ANC A;  2L3M A;  2LA4 A;  1Y11 A;  2RKI B;  2C2K B;  2JOQ A;  4PXE A;  4YY3 F;  3M32 A;  2DVI A;  4WJB A;  2UXC J;  2RRN A;  1FRJ A;  1VRQ C;  3D0I E;  1UWB B;  1KTV A;  1RQ0 A;  1WSV A;  1X4G A;  3HHE A;  4UQG A;  3NS6 A;  5IWA J;  2MKH A;  3SFG A;  5HMY A;  1U1Q A;  2DCU B;  4DPU A;  2VJV A;  1VQN S;  1EP4 B;  3I56 S;  2QRR A;  3QAE A;  4F0H A;  3KLH A;  3LGM A;  2OH2 A;  1RT1 A;  4CM0 A;  1N4L A;  1JLE A;  3EJM A;  1HPZ B;  2AJ2 A;  2JHE A;  4NZ6 A;  2XM3 A;  4OHY A;  1WWH A;  1GT8 A;  2GMH A;  2YKQ A;  2HHQ A;  1YIT S;  3SDE A;  2KDO A;  3PW0 A;  1NSP A;  2ZH7 A;  3BF4 A;  3W63 A;  2N7Y A;  4JOU A;  2G9O A;  1BHN A;  2G2Y A;  4USW A;  4ECS A;  2CZ9 A;  3LP1 B;  3OR2 A;  2GQQ A;  2DH7 A;  1F60 B;  4RW6 A;  1G4C A;  2DGO A;  1ZA1 B;  3I4H X;  1HW9 A;  2PD1 A;  3AJD A;  2B4V A;  3R6L B;  4C7Q A;  3TZZ A;  1VIS A;  2MGZ B;  1GH8 A;  3DDN A;  5KG4 A;  3O2I A;  3GU0 A;  3O6Q A;  2GC8 A;  1TK8 A;  4JV5 J;  1KFD A;  1NZ8 A;  3SBM A;  2EBE A;  2LXI A;  4BBY A;  3G6V A;  1IKY A;  4ZPA A;  2CDR B;  2VC0 A;  1NO8 A;  3HFK A;  4KO0 A;  1HFE L;  1SV5 A;  3HPO A;  3LWL A;  1SKR A;  4ILM A;  3GV7 B;  1SL1 A;  2FJE B;  1X4A A;  3OUY A;  2VIH A;  3CC4 S;  2HQF A;  3BGU A;  4CLU A;  2HKE A;  1L5U A;  1B3T A;  3MXH P;  3S6E A;  7AT1 B;  1KR4 A;  2KZM A;  1S59 A;  1YK9 A;  3GSI A;  4OZ1 A;  2ERR A;  3K7R A;  2VZ9 A;  4M5I A;  3MCM A;  2JH3 A;  2AIR B;  2B6A B;  3TA2 A;  1J27 A;  1RWN B;  3HO1 A;  1BQX A;  1VLY A;  1S0V A;  4PAB A;  4LSN A;  2YWG A;  2XC9 A;  2Y8W A;  3BBC A;  3I6P A;  3L7O A;  1N36 F;  2HNY A;  4I4B A;  4GVL A;  3QYY A;  2ZOF A;  4JI3 J;  1M1G A;  3JQK A;  2DR5 A;  3SCK E;  1FJG J;  2CG4 A;  1TKX A;  5B0F A;  2WVD A;  4DR1 F;  3IBC B;  3D6M B;  2OEM A;  2H54 B;  4WBF A;  3U1L A;  3W60 A;  4HAC A;  5K8P A;  1HI1 A;  1ZPW X;  1KD1 T;  4DLE A;  1RTZ A;  2GIQ A;  4ZVQ B;  1H2T Z;  4H4M A;  1UVI A;  2JDJ A;  3JSB A;  3NP5 A;  2QA4 G;  2V2Z A;  3MM7 B;  3MMB A;  4RW4 A;  1UWA A;  2K2P A;  4P71 A;  4ELT A;  3BN7 A;  4ECR A;  1LWC B;  4ED2 A;  1S99 A;  2VQE J;  1T05 A;  2HBZ B;  4B9U A;  2FB0 A;  2R7T A;  3NY0 A;  1XR7 A;  2NYI A;  1C1B A;  2VDH A;  4DR2 J;  2J7W A;  1X4E A;  5KG0 A;  4OYP A;  4AYB D;  4KGZ B;  3LOU A;  1JLC B;  1C0T B;  2YWW A;  2UVR A;  2XMU A;  4K7Q A;  1DLO B;  3MM6 A;  1M1K T;  1Q7Y T;  1U24 A;  5K14 A;  3CWJ A;  1LW0 B;  2V8G A;  2CQ3 A;  4NCG A;  2VG5 B;  3MF5 A;  2WB1 D;  1J2V A;  3EMT A;  5AXL A;  3UDC A;  4X62 J;  4JV1 A;  2FUG 9;  2CFX A;  3MMA B;  1PAU B;  1WDD A;  3QQC D;  1LEO A;  1SVD A;  5CAA A;  2H1Y A;  1DY3 A;  3H59 A;  2UUA F;  4M8L A;  3N6N A;  4JB8 B;  5K5M A;  1FKA F;  2EG1 A;  1FO1 A;  2M70 A;  1FK9 A;  3US5 A;  5IZH A;  4DFJ A;  5J2M B;  3GFZ A;  1CLF A;  3KKF A;  2A6M A;  1OS5 A;  4LSL A;  2N4D A; 
#chains in the Genus database with same CATH homology
 2H51 B;  2H4W B;  2Y1L B;  1RHJ B;  4DCP B;  1BMQ B;  3GJT B;  2HBQ B;  2P2C B;  2H65 B;  3R7S B;  2C2Z B;  2H48 B;  4ZVR B;  2XZT B;  3KJQ B;  1RWV B;  4DCO B;  4ZVP B;  2CNK B;  1RWW B;  1QDU B;  2XYH B;  3R6L B;  5K20 B;  2C2M B;  1RHU B;  3GJR B;  3P4U B;  2HBY B;  3D6H B;  2CDR B;  1RWK B;  1RWM B;  2QL9 B;  1RWP B;  3R6G B;  3GJQ B;  4ZVT B;  3R7N B;  2QLJ B;  1SC3 B;  4ZVO B;  1RE1 B;  1RWN B;  1PYO B;  3R7B B;  1RHR B;  4ZVU B;  2CJY B;  3IBC B;  3D6M B;  2H54 B;  1F9E B;  2FQQ B;  1QTN B;  2XZD B;  3IBF B;  3EDR B;  3GJS B;  4ZVQ B;  3SIP B;  3EDQ B;  1RHK B;  2H5I B;  1I3O B;  2C2O B;  3R5J B;  2QLF B;  1GFW B;  2H5J B;  1IBC B;  2DKO B;  1SC4 B;  2HBZ B;  2QL7 B;  3KJF B;  2CNN B;  1ICE B;  4DCJ B;  1SC1 B;  4LSZ B;  2QLB B;  3QNW B;  5IC6 B;  3NS7 B;  1I51 B;  1RWX B;  2XYP B;  3P45 B;  2Y0B B;  2QL5 B;  5IC4 B;  1RHM B;  2C1E B;  2CNL B;  2CNO B;  1PAU B;  2HBR B;  4ZVS B;  4JB8 B;  2H4Y B;  2XYG B;  3D6F B;  1RWO B;  2CJX B;  1NME B;  2C2K B;  3KJN B;  1RHQ B;  3RJM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...