4IG3B

Hiv-1 reverse transcriptase with bound fragment near knuckles site
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
424
structure length
416
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 125
structure length 416
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ig3B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig3B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig3B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig3B03
3V81A 2J6UA 1S4FA 4Y34A 2W8LA 2HWHA 4EBDA 4TY8B 3TVKA 3HKWA 4MFBB 4ID5A 3FSIA 5DGBA 2YNHB 3KHGA 4WYWA 3N6NA 2I5JB 2ATLA 4NLRA 1S6PB 5KT7A 1S9GB 4I7FA 4I2PA 1N48A 1JXLA 1JLEB 1C0TB 1S1VB 4R8UA 2IMWP 5CYQB 2YKNB 1RTDA 2OPSA 1HNVA 3UR0A 1N4LA 3PW2A 4K4ZA 3CO9A 5D3GB 3GV5B 4F50A 3QIPA 4O44A 1KLMA 4IRKA 4ZPBA 1XR6A 5KFRA 3QIDA 1RT6B 4RW6B 2XI3A 3I0RB 2DPJA 2OPRA 2CJQA 3CWJA 4K4UA 1K1SA 1RT7B 1IKXB 2XWYA 3G86A 1S1TA 4JUZA 3KLGB 4MIAA 4ED3A 4QWBA 2ILZA 3KK3A 5KFWA 3LP2B 1TKXB 2YKMB 5KFJA 2W8KA 2O5DA 3UDLA 3PW5A 1C1BA 4F4WA 3M9OB 5EWFA 4WFZA 1HQUA 3OL8A 3PZPA 4WE1B 4IRCA 4TLRA 1MMLA 1JLFA 3BGRB 5C25A 3HVTA 4J9MA 4KHMA 5KFXA 3KLEA 4KO0A 2HNYA 4Q0BB 1S1WB 5KFEA 5DG8A 3V6JA 4IFYB 3DLGA 2EC0A 2IAJA 4ED1A 4KAIA 4DG1B 4ZP6A 2FLPA 2R8HA 2BRKA 4ECQA 3H59A 2HAIA 2VG5A 2D7SA 2XC9A 3T5KA 3QGIA 2UVUA 1EP4A 3LAKA 3KMQA 4NLGA 4Y2CA 3DM2B 3CVKA 3DOLA 1HQEB 5L1IA 1LW2A 2IC3A 4IG0B 4LSNB 1GX5A 3NAHA 4O3RA 4WXWA 2BQUA 4KSEB 5J2QA 5HP1A 1QUVA 3T5JA 3SFGA 1S0OA 3GIIA 3CDWA 1JX4A 3MR2A 5KFHA 5F8MA 1T05B 3JSMA 4DL7A 4ZPCA 4EBEA 5HLFA 1KHVA 2W9BB 5KFTA 3H5XA 3DLEA 1JLGA 4RZRA 1SUQA 4QWEA 1QE1A 2YNIA 3DI6B 2AGOA 1S6QB 5KFKA 5HBMA 4RW7B 4NCGA 1JLBA 3TQ1A 2JEGA 3KHLA 2FLNA 3G6XA 2BE2A 2ZE2A 2B5JB 3KK1A 5KG6A 1S0NA 2OH2A 2UUWA 1HNIB 3V4IB 3M8PA 5J2PA 1TL3B 4H4MB 4R5PA 3QZ8A 1EETB 4KHRA 3LP0A 3G6YA 2B6AB 3MEEB 2V4RA 4ID5B 1S0MA 1JLCB 4TY9A 3M8QA 3T1AA 3GYNA 4DEZA 4KKOA 4NLOA 4FS2A 3SI8A 5CYMA 2RDIA 4URQU 4R8UB 1C0UB 3DYAA 1J5OA 1S1UA 4ECYA 2OPSB 4J9QA 3LAMA 4O3PA 4J9NA 4JV0A 2BR0A 4K4XA 3FFIA 3QIPB 3DLKA 1KLMB 4O44B 1XR7A 1LWCB 5KFZA 1FK9A 3E01B 2R2TA 1WNEA 3I5CA 3GILA 3KJVA 5J1EB 2FVPA 2AWZA 1T3NA 2JEFA 1TQLA 2IM1A 2ALZA 1RT4B 3VQSA 1IKVA 3MR3A 4XPCA 3RAQA 1RYRA 4DL2A 3Q8RB 5C24B 3C6UA 1N5YB 3MF5A 2HNDB 1C1BB 4J9PA 1DLOA 1HQUB 4ZHRA 3GV8B 4I2QA 3I0SA 3H98A 4PUOA 4O3SA 4ZP7A 5F8JA 2UVRA 1JLFB 4LSLA 4YMEA 3RBDA 2XI2A 1IKYB 3PW4A 2E9RX 2JEIA 5KFPA 2R8IA 3GIKA 2I1RA 2AGPA 3KLEB 1JIHA 4Q43A 5KG5A 3MECA 4H4OA 1W25A 5KG0A 5KG2A 2VG5B 2BANA 4U6PA 5KFVA 3OL6A 4YR3A 5C5JA 1TKZA 3KK2A 1ZTTA 3DOLB 1LWFA 3DRPA 2VG6A 4KE5A 2FLLA 2J6TA 2V4QA 2RKIB 2IJNA 4LQ9A 3FDSA 4F4YA 5KFYA 3V6DA 5KT4A 2WB4A 4XO0A 3CIZA 3PHEA 3JSMB 2R2UA 3CJ2A 1VRUA 2IJFA 4DL6A 1IM4A 3MEGA 4WFYA 1TVRA 1JLQA 1SUQB 2HNZB 1RAJA 2YNIB 2XCAA 4ICLB 4OL8A 4Q45A 3ITHA 5HBMB 1TP7A 3SFUA 4ECVA 4RW4A 2W9CA 2C2RA 2AX0A 2DPIA 3C6TB 5FDLA 4YP3A 2V9WA 4RW9A 4IDKB 1TV6B 2ZE2B 4K4WA 3KK1B 3LP1A 3KNAA 4NLUA 5J2PB 1ZTWA 4R0EA 3E51A 3D5MA 4ECZA 2OPPB 5J2NA 3LP0B 3DRSA 4KV8B 5DQGA 1HMVA 3IRXA 2W9AA 4FBUA 1BQNA 2E9ZA 1LW0A 1SV5B 3QLHB 3OLBA 1DTQB 3UPFA 2AQ4A 1S1XA 4NLWA 5L1KA 4KKOB 3OHAA 4PWDA 4TYBA 3HVWA 1BQMA 2IM3A 2JC1A 5KFMA 1S9FA 4J9LA 4EYIB 3I5AA 5CYMB 4KBIA 2ASJA 4JV1A 4ED8A 1FKPB 1J5OB 3IS9A 5EDWA 4FS1A 3DMJB 5K14B 1DTTA 3N6MA 4WZQA 4EYHB 3BJYA 3T5HA 1SH3A 4QPXA 5C42A 2GC8A 5JXSA 1TKTB 5KFUA 1RT1B 1R0AA 3NBPB 4NZ0A 2YNFA 3TAMB 1JLAA 2OPQA 4YQWA 2IBKA 3KJVB 1RTHB 1YVFA 2WONA 3BREA 1HYSA 4F4XA 3KOAA 3DRRB 5DLGA 2RDJA 2QE5A 3JYTB 3PJXA 5KFFA 2RF2A 4KFBB 2D3UA 5DG9A 3C6UB 4U7CA 3KLIA 1DLOB 2HMIB 3EPIA 4RW8A 3I0SB 1KHWA 4NLVA 1RT2A 4X2BA 4LSLB 5DGAA 2XGQA 4HYKA 4NRUA 4NLPA 5HROA 3PR5B 3IG1A 2FVSA 4ZVGA 5KFIA 3PW7A 1LWEA 2CKWA 3ICLA 4IH5A 1D0EA 5KG4A 4IFVA 3FRZA 1NNDA 4MFBA 4XPEA 4ZP8A 1S9EB 2YNHA 4IG3A 2V0NA 2I5JA 1RDRA 1C2PA 4WFXA 4O4RA 3OSNA 2R8JA 1S9GA 3V81B 2D41A 3Q8SB 3KK2B 4ZVFA 5L9XA 1JLEA 1C0TA 1LWFB 1S1VA 2VG6B 4QWDA 5CYQA 4NRTA 4J9KA 2YNGA 4DL3A 5KG3A 1T03A 4I7FB 1IKWA 1SH0A 4NLXA 4TQRA 4MKAA 2WTFA 4I2PB 3RAXA 5I42A 2FJVA 3BQ2A 3NL0A 4M95A 3OSPA 3FQKA 1VRUB 1RTDB 1HNVB 1REVA 4H54A 3KHRA 4IR9A 4RW6A 3PVXA 1IKXA 2FJWA 3KLGA 3OHBA 4RW4B 4O4GA 2WOMA 1RYSA 1TKXA 2YKMA 3LP2A 5FDLB 3H2LA 3MFHA 5F8HA 2OPRB 5KFCA 4Y2AA 4RUCA 3DDKA 1RT5A 2UVWA 4ECTA 4IRDA 1S1TB 1N56A 4WE1A 4NLYA 3KLFA 4NLDA 3KK3B 5J2NB 4NLTA 3BGRA 1HMVB 1C1CA 2GIRA 1SH2A 2JEJA 4DL5A 5DQIA 5KG7A 1S1WA 3GV7B 5KFDA 4MK9A 3MFIA 2C22A 2ASLA 5KFBA 1RA6A 3N6LA 5KFQA 1BQMB 4NLSA 4DG1A 5C25B 3BSCA 4ECXA 3HVTB 4KO0B 2HNYB 3BR9A 4QW8A 4URGA 3OL7A 4K4VA 1GX6A 1DTTB 4NLQA 1QAJA 3IN5A 3DLGB 3CJ3A 4IH6A 3GQCA 3BSNA 2C28A 2IAJB 4MKBA 3GIJA 4LSNA 4IG0A 2QV6A 2ILYA 2BRLA 3QO9A 1FKOA 5DQHA 1EP4B 1JLAB 2J6SA 2UVVA 1LW2B 2IC3B 1UWBA 2W7PA 2GIQA 2W9BA 4K4TA 3NMAA 4HKQA 1JKHA 5HP1B 5J2QB 4URSA 2RF2B 2R8GA 5I3UA 2FVQA 4RUAA 2FJXA 3FQLA 3MTKA 4ZPAA 3MR6A 3EPGA 5HLFB 1RT2B 3DLEB 3CDEA 4RU9A 3LALA 3BQ0A 1JLGB 4GC7A 3MEDA 1QE1B 5F8LA 2B5JA 3HVAA 3V4IA 3IG1B 5KT2A 1TL3A 4NCGB 1JLBB 4IR1A 1LWEB 4TXSA 1EETA 5J2MA 2BE2B 3ISND 2UUTA 2B6AA 2BQRA 3MEEA 4IFVB 3RB3A 3CJ5A 2AGQA 1JLCA 3M8PB 4IG3B 3KLHA 4ECSA 2JC0A 4EEYA 3DOKA 4R5PB 3CJ0A 1MU2A 1S10A 3M9MB 1C0UA 1S49A 1CSJA 3BSOA 3M8QB 1QAIA 4ZMMA 2YNGB 4ED2A 1T03B 4PQUA 3IGVA 4ZP9A 1S97A 1IKWB 1HPZA 1TL1A 2JLEA 5F8GA 4IH7A 5I42B 4ED6A 4IQXA 3PJWA 2IM0A 1LWCA 1VRTA 3DYAB 1S1UB 5L1JA 3E01A 1REVB 2B43A 4O3QA 5J1EA 3FFIB 2WRMA 1RT4A 3DLKB 5KFGA 2W7OA 4MIBA 4O4GB 2WOMB 1FK9B 4G1QA 4O3NA 3QGHA 3G6VA 1RTJA 1N6QA 5C24A 1N5YA 3QYYA 4KB7A 2HNDA 4ZVHA 1RT5B 5KT3A 4ECRA 3V6KA 4Y3CA 2E9TA 4B3OA 3KLFB 1IKVB 1RTIA 1OS5A 3M9NB 1RT3A 3D28A 4LQ3A 2ZD1A 3GIMA 1IKYA 3IGNA 4RNMA 5L1LA 1C1CB 4JV2A 3H40A 4ZHRB 5EWGA 4I2QB 3UQSA 4J9OA 4PUOB 2R8KA 3I5BA 2VG7A 3CJ4A 3H5SA 5KFSA 5KFNA 4EO6A 4MH8A 4IKAA 3LANA 4ECWA 4ED0A 2AX1A 2D3ZA 5JUMA 4QW9A 3MECB 4GC6A 4H4OB 3ISNC 4TY8A 1K1QA 3NKYA 4TQSA 5T14A 2RKIA 2BANB 3QO9B 1FKOB 1S6PA 5KFAA 1D1UA 1TKZB 5KT6A 4ZVEA 3PR4A 3DRPB 4RNFA 1UWBB 3V6HA 3H4DA 2YKNA 4J9SA 2WHOA 5F8IA 1JKHB 4RNHA 4K4YA 2HNZA 4FBTA 5D3GA 4ICLA 5I3UB 3V6DB 4Q8EA 3KMSA 3KHHA 5DG7A 3C6TA 4G3IA 3MEGB 3KLVA 1RT6A 1TVRB 1JLQB 3I0RA 3MEDB 4IDKA 1TV6A 2HWIA 4QWAA 4ECUA 1RT7A 3ITHB 4TN2A 1T94A 3H5UA 2F8EX 5KT5A 4NYZA 3CDUA 2W9CB 5EUHA 4MK8A 4J9RA 2OPPA 5J2MB 4KV8A 1S48A 4RW9B 2IM2A 5KG1A 1SV5A 3QLHA 1DTQA 3Q8PB 3LP1B 3KLHB 1ZETA 3DOKB 3RBEA 2XGPA 3DRSB 1I6JA 3IRXB 1RA7A 1MU2B 1BQNB 3T19A 1LW0B 1Z4UA 2WCXA 4YR2A 3RB4A 1FKPA 5F8NA 4M94A 1S1XB 3BQ1A 4Q0BA 3OL9A 5F9NA 3DMJA 5K14A 1NHUA 3NAIA 1U09A 4Q44A 4IFYA 4PQUB 4PWDB 4TYAA 3H4BA 4K4SA 1HPZB 1TL1B 1TKTA 1RT1A 2BQ3A 5KFOA 3NBPA 4RNNA 1VRTB 3IS9B 3TAMA 5KFLA 3NGDA 3Q8QB 3DM2A 4WZMA 3BSAA 1RTHA 5C42B 1HQEA 1R0AB 2R2SA 2FVCA 4WXOA 3DRRA 2YNFB 3JYTA 4G1QB 4KFBA 2C2DA 1RTJB 2AU0A 2OPQB 1N6QB 3PW0A 4Q8FA 4EO8A 4ZPDA 1T05A 2WONB 1HYSB 2HMIA 4IOBA 3RB0A 3RB6A 4B3OB 3H5YA 3MR5A 1RTIB 2ZKUA 2FVRA 1RT3B 3T5LA 2XCPA 2ZD1B 5DLFA 2ASDA 3KLIB 3HHKA 3DI6A 4RNOA 1S6QA 4MK7A 2VA3A 4RW7A 4RW8B 4EBCA 5EWEA 4F4ZA 2C2EA 2R2RA 4WYLA 2IA6A 4ED7A 2VA2A 3QZ7A 2VG7B 4K50A 1HARA 3QGGA 2WK4A 1XR5A 4QWCA 3OLAA 1HNIA 1S9EA 5HROB 4O3OA 5F9LA 4YR0A 4DL4A 1NHVA 3EZUA 4H4MA
chains in the Genus database with same CATH superfamily
1KONA 3RGIA 2ZJQQ 4FF2A 2YNHB 3ZZUA 5KT7A 2B4UA 4I7FA 2CDQA 1KRPA 1N48A 4C8ZA 2IMWP 3RG6A 2OPSA 3LGNA 1Q7YT 1X8DA 2MMYA 4N41A 4ZA1A 1L3VA 1RLDA 2ZHAA 3EXYA 4UY85 4JUZA 4EZ6A 2O5DA 5F0UA 5GAHU 4DR5F 1EKRA 1FJEB 1ZZNA 1X9WA 1WOSA 4J9MA 1NKEA 3RBZA 4USHA 3HFVA 2P9EA 1ZAXA 2D7SA 2XC9A 4F67A 3G2XA 4PYDA 4LSNB 4R0JA 2YXLA 3TZWA 2NREA 2ACMA 3BR8A 4OYAA 3J7YI 2HLTA 3PKYA 4H4KA 5CCLA 2FZCB 4WU3A 2UUWA 1RHKB 2B4OA 1TL3B 4R5PA 1VJQA 4D3GA 3SSQA 2I0XA 3JSBA 3X3UA 2WSEC 2CQDA 3GTYX 3CPWR 1B4SA 3KJVA 1YDLA 2NXCA 5DDQC 2O01C 2X1AA 3N28A 4DL2A 3JS9A 1HHQA 4LSLA 3UWTA 3AH6A 3A8EA 4OJHA 2JEIA 5DO2A 1EX8A 2I1RA 4UZCA 3MTJA 4FPIA 2IFXA 5KG5A 5L46A 4LSZB 1K44A 5KFVA 3DRPA 2V4QA 2IJNA 1RWPB 1Y4ZB 2A6OA 3LF0A 1OMSA 3G8QA 2CJBA 2HNZB 1KOOA 3B4DA 3TR5A 2YX1A 2DPIA 3VAKA 1C4CA 3F44A 1X31C 3LP1A 1QSYA 1SJFA 3AXKA 2G0CA 1ITPA 2DGWA 1LW0A 1OQ6A 1VLOA 2IM3A 3I9V9 2FJEB 3LUYA 1R0AA 4OV1A 4L75A 2YNFA 3FKBA 4QYRA 5E33A 1TK8A 2WONA 3OBIA 3W5YA 2QE5A 1AFJA 3C6UB 2QSFA 3KLIA 2NPFA 3D3CJ 3L7PA 5G0RA 2KFZA 2FQQB 1L3TA 2CQPA 3GYXB 2YWEA 3TA1A 4B3MF 2YVSA 4LR7A 2VBXA 2CG8A 3HLUA 3EDQB 1HBNA 1N5VA 3US5A 2R7TA 2RB7A 3P49B 4WE1A 4QPTA 1KR4A 4OZ2A 1N88A 4N56A 3K17A 3LH2S 2QFJA 3IO1A 5D8HB 2VPYB 2ZH5A 2DR6A 4USTA 3VAGA 4B9LA 2CWKA 2QO3A 2HGMA 2VIHA 4ETZA 4K4TA 2N3LA 2XSJA 4PG7A 2FJXA 2E5LF 1QJHA 5HLFB 3PRVA 5GMEA 3DLHA 2BE2B 2B6AA 3RB3A 1NK0A 2YH0A 4DPYA 3D66A 2N3OA 1NK5A 2LECA 1EJ7L 4ZMMA 2BYCA 2KYZA 3DXBA 5C2CA 5I42B 1CJVA 5DM7Q 4DQIA 4CO0A 3MEKA 4WBFA 1RTJA 5C24A 1D9AA 2UUAJ 3AQOA 1FJCA 3M9NB 2LA4A 2AD9A 1PJ5A 3NNHA 1FWLA 3H40A 3TAPA 5EWGA 1HI0P 3UQSA 1EAYC 5KFNA 1U1PA 3H8YA 2ZJPQ 3LANA 3QJJA 2ATCB 4QW9A 5T14A 5KFAA 3W64A 4GRSA 2FGCA 2A3JA 1FO1A 5I3UB 3VAMA 3K5LA 2DEIA 1F5CA 1OPZA 4Q2MA 2QYGA 3MMBB 1IWAA 4X4RA 2YQ3A 3QQCD 2P9CA 3GJRB 3RBEA 1I6JA 3RB4A 2CVIA 1FKPA 2ADCA 3H4BA 3Q8QB 1RAIB 2XYPB 1SJ3P 1WD6A 1ZM3A 4G1QB 4KFBA 2VKZG 5DZ7A 4CYUA 1PG5B 3NCRA 3NY0A 3H5YA 3CCVS 2FVRA 5DLFA 3RW7A 4K8RA 1ZAVA 2OP5A 2DGUA 2VA2A 4LFBJ 2Q6BA 4OLPA 4QWCA 4O3OA 3EZ5A 4YB7A 1S4FA 3UR3C 4AL5A 2VFRA 4QQBA 3THTA 4A8YA 3CT9A 2ZBCA 4XAKA 2QFIA 1HNVA 3DGVA 4F4AA 4ZLLA 3CO0P 1XR6A 2MZ1A 1IKXB 3IMQJ 3PW5A 1XERA 2AF6A 3JQMA 4A8MP 3GONA 3ZZTA 3KLEA 4KO0A 1AB8A 5DZ6A 2EC0A 4ED1A 4K5RA 1XMOF 3M8SA 3KMQA 5L1IA 3R5BA 4JI4J 1V5VA 2LQBA 1YK9A 4EGLA 1OQ3A 2NZ4A 1GMWA 3GYGA 1QTMA 1TFWA 3OR1A 1B0TA 3TX8A 2JEGA 3DRXA 1S0NA 3EVOA 3M8PA 4KHPJ 3QZ8A 2V4RA 3GYNA 2XHWA 3MMAB 2XMVA 2FJBB 2EEYA 1C0UB 1J5OA 3LGMA 1WG5A 1SXLA 4O44B 1I3OB 3EGWB 1NJWA 5B08A 2JEFA 2IM1A 4LF4J 1G4CA 4OIXA 5HI7A 3FBCA 2EW9A 4DJBA 4LR8A 4J9PA 5CD4H 2R42A 2C42A 4DPUA 3H0PA 2AGPA 1KVKA 2DNRA 5KG0A 4CCHA 1N5SA 2VFTA 2VG6A 4LQ9A 1Q5VA 1UAWA 4A8KA 1WHXA 4ZOSA 4P52A 2F4VJ 1IM4A 3C2PA 2PMWA 1TVRA 3ISZA 1U6FA 2C2RA 1PILA 1GMUA 2KM8C 1IR0A 4U8YA 1ZH5A 1HHTP 5AE3A 4R0EA 1T3OA 4P9SA 3LP0B 1OO0B 4LRFA 1RTZA 3HVWA 2UUCF 4JV1A 4ED8A 2WAQD 3JSYA 4YQWA 3D6FB 4BWMA 7AT1B 3RRHA 3TRGA 5LSLA 4XK8C 1OY8A 2J0QD 2RU9A 3DCAA 2R7SA 1YWXA 4U7CA 4NX9A 3TUIC 1NK6A 3U02A 1NRKA 3J80Y 3PR5B 3I96A 1BLUA 2MQPA 4JB8B 4IG3A 1YG0A 1AW0A 3B4MA 2UXBJ 1FT8A 4HACB 2V50A 3RAXA 4OV6A 5A2QU 3CCZA 1HWIA 1HW8A 1UVNA 3IP0A 1X4EA 5FDLB 2ACYA 2GW8A 5J2NB 1NK9A 1C1CA 2DRBA 3LWLA 4B02A 2VBYA 1RA6A 1ACMB 2LQ8A 4RR5A 2QZ8A 3T6BA 4TVAB 2VOOA 4IH6A 2G2ZA 4LR9A 3RAMA 1F6TA 3WHIA 1X5OA 1IBMJ 3C16A 3L4BC 1Q53A 3MTKA 3A8JA 5ETKA 3QNWB 2QEXS 1D3WA 3POTB 3HT3A 3JB9k 3UCZP 4TXSA 4C11B 1RABB 1VRQC 2OSRA 2XS5A 1HQ2A 1HBOB 2CQ4A 1J5EJ 1T03B 3DLLQ 5E3AA 4OLOA 2DNZA 4M5DA 1REVB 1VQNS 4EWTA 3TUZC 5KFGA 1CBKA 2MHEA 2EBGA 2NZCA 1H2UX 3U27A 3GSIA 2MKYA 2AX1A 1CQNA 4E8UA 2PDAA 2X1FA 4YHHJ 1K9MT 3HSGA 5B0AA 1WG1A 2DCLA 5SUHA 4RNFA 3PY8A 1KVIA 1IQTA 5HQMA 2KG1A 2R7RA 1FDNA 1U45A 3ZFVA 3WC0A 3GFHA 3T1HF 1H98A 3Q8UA 3Q8PB 1KNZA 2BABA 3OTBA 3IRXB 4YR2A 1Z4UA 4Q0BA 2IVMA 1QD1A 4OI3A 2CZVC 2DY9A 2G1HA 2ZFHA 2VD3A 3IS9B 1IXKA 4Z2XA 2CNOB 2N82B 1P27B 4FXVA 4QYZJ 5LMUJ 2LFVA 3QSYB 2C2DA 3HF5A 2OPQB 1XNQJ 3K7RA 2HMIA 4IOBA 3RB0A 5F3TA 2JLFA 2HZAA 1X5PA 2XCPA 4LF4F 3Q23A 1S6QA 2LEAA 4MK7A 3BB5A 3OTOF 1NKCA 1GAOA 1XR5A 5CCMA 5DJBA 4DR1J 2E7XA 2MGZB 1PO6A 3HKWA 2Z58B 3MWBA 2EFGA 1NJZA 1XIQA 3CJKA 4OI4A 4DPOA 1C0TB 9ATCB 2EFPA 2PI5A 4K4ZA 1T8EA 3D0HE 1BQXA 3J81Y 2KZZA 2XWYA 4FVMA 4NMXA 2XHCA 1SQGA 3ZZRA 1VQYA 3N0VA 3P8BB 3BPDA 2V4JA 1X4CA 4TKTA 2VFVA 1GQEA 1QUVA 1V9OA 1RCXB 2W9BB 4OZ5A 2JX2A 4QWEA 3G8SA 1JLBA 3MM8A 4CTAA 1UW9A 3VTIA 2M5YA 1O6XA 3VGUA 2DR5A 3MM5B 3IXQA 3D68A 2YH1A 3DXSX 1NJXA 3HFKA 4CM2A 3BPSP 5F0WA 2XMKA 2VF3A 2LEBA 2W7AA 4YB6A 5THWA 3VQSA 4WF9Q 3J7Z5 1M5KC 4F2SA 1FKAF 4NA1A 1WWHA 4O3SA 4ZP7A 4YMEA 4PAAA 3PW4A 2EK1A 4TLQA 5RUBA 1XNRF 1DAXA 1TKZA 1U24A 2F8MA 1R0CB 3MPVA 1I94J 2ADBA 1VQSA 2ZNZA 3C46A 4ITSA 5D0RA 3R5DA 3M2RB 4ECVA 2KM8B 2HEKA 3DRYA 4PXCA 5LT5A 2W2NP 1UVMA 2FLOA 3MCOA 5LMNJ 2GAGC 1ZAWA 2RNEA 4KKOB 3IRWP 1MWYA 4FS1A 4ELVA 2BJDA 3J7YU 1HWLA 3B82A 3N5BA 3VAHA 2JDJA 1JLAA 2W2MP 5IWAJ 2CFXA 5K8OA 4HL9A 3JYTB 2HGNA 2BXJA 4TU8A 3QRQA 4LBHA 1RT2A 3H7HB 1P9YA 4LFCF 1LWEA 4IFVA 2FC8A 4O4RA 2NR0A 3HJFA 1GTHA 4ZVFA 4FKYA 4J9KA 2QGFB 3EX7B 5T7LA 4DR2F 1IVZA 3TJ8A 2WBMA 2W1BA 5SZTA 4FKXA 1AUDA 4ZLJA 5ETSA 2MZQA 4IOAQ 4X64J 1RB0A 2ASLA 5AJ3J 4DG1A 4ECXA 3KJFB 5EX0A 3MPYA 1Q5YA 8RUCA 3FEYB 2OO4A 2BDPA 2CXEA 1U26A 1S72S 4DV2J 5MAOA 2NUUG 3NMAA 4HKQA 3LPYA 2R8GA 4DR3J 4DF8A 1P1LA 3BQ0A 1JLGB 2E1RA 2FB0A 3OFEA 1K47A 3KWMA 4L3KA 7FDRA 1GNKA 5A6PA 2J8AA 1JLCA 3ENVA 2VPWB 1UW4A 1FNXH 2R7WA 4BLGA 4UZBA 5IC6B 4ED2A 3QT7A 1URRA 3E01A 1HWKA 3PV8A 1RACB 2FHJD 4KB7A 1IR2A 1IBKF 1ZOTA 2H5JB 3GFYA 2RSQA 4WP8A 4PUOB 1OSDA 2A2DA 3THVA 1U2FA 5BYQA 3MDFA 2AMCB 4P2XA 1Q16B 2ZOFA 1MWZA 2CUYA 1A0OB 2L9WA 4J9RA 2RQMA 2N7CA 2GHWA 5CAAA 4PG4A 3KLHB 3C3LA 3CCRS 2MQLA 5KOXA 1VC5A 5F8NA 3AJ2A 2MXYA 3OL9A 1MLAA 2XLIA 2P9GA 3L09A 3T9NA 1RT1A 1VIXA 3GWCA 2NXNA 1X4BA 5KFLA 2ZH2A 2OLWA 1HQEA 4M8LA 5HSPA 3M6WA 5EHHA 1LQ9A 2KVQE 3W9JA 3RB6A 3MR5A 2B9WA 3PRDA 2FDNA 1KQKA 4RW8B 4WYLA 1WORA 3A1YG 2WK4A 4WWSA 2B8QA 4WIIA 4ENOA 1S6PB 1JXVA 1RZMA 2HFSA 2BJ7A 1JLEB 2KT5A 2HFOA 1RTDA 3PW2A 3L95X 2HW3A 1P8GA 4P73A 5A8WB 3M1VB 4OX8A 4ED3A 3I4PA 1C1BA 3KG4A 2ZZMA 4DSIA 3CCUS 2KB2A 2IAJA 2Z0GA 3BBFA 2VG5A 3QGIA 1EKSA 2KFNA 4Y2CA 3QWUA 2PFDA 3DOMA 5D4NA 4PXEA 2M7SA 2CQ1A 3JSMA 1LK5A 4ZPCA 4DBQA 2B4PA 5LJ3Y 2XNRA 4WKRA 3W8GA 4C0HA 5JMNA 2KO1A 2XMTA 5KFKA 3U7JA 3PYEA 2N7YA 4RUBA 4QR2A 4PR6A 1EETB 1GH8A 4KHRA 2C3UA 2E1MC 3ILIA 5CYMA 2OPSB 3I6PA 2DHAA 3DLKA 3O2IA 1NSKL 1IR1A 2C3YA 4N7TA 2ZH1A 1OIAA 1RT4B 2FJAB 5CYJA 1T9VA 3MR3A 2XO7A 2G4BA 1APSA 2HNDB 3UVJB 3ULHA 2MZRA 2VQFJ 2ALYB 5F41A 3RBDA 1VC6A 4QU6A 2C2KB 4Q43A 2QA4S 5LSRA 3MOJB 2ZKTA 2XBPA 2Z8QA 5H9FJ 4DPWA 1U6ZA 3R5GA 3RUBL 3V6DA 1W2IA 1VRUA 3VVUA 2J9EA 1JLQA 3TZXA 4DX8H 3Q86A 4ZVPB 1XWLA 4YP3A 1TV6B 4K4WA 3TVYA 4IRKA 1VOMA 3W61A 3QLHB 3HMJG 3BN7A 3NMRA 1S9FA 4J9LA 5KTQA 3DMJB 4EYHB 2E66A 4QPXA 1TKTB 5LOQA 4XDCA 2VZ9A 2EXUA 1JJHA 3KJVB 4F4XA 5DG9A 3HPOA 2PI4A 4LSLB 1UJ6A 2W24A 2B4VA 1GEHA 3BKTA 5L9NA 2RRBA 3LWMA 5KFIA 3PW7A 3RW6A 3ELHA 4P74A 1Y5NB 2YNHA 5CHCB 3L7UA 3DHWC 5L9XA 5H1SV 2XZDB 4LF6J 4DL3A 5KG3A 1SH0A 1BD6A 2IPOB 2GZOA 1HI1A 2J0WA 1MW7A 4J7CA 5HATA 1UEKA 2E7VA 3ENAA 3KK3B 2CJXB 2RHSB 3KKFA 5KG7A 1FCAA 5KFBA 5EGYA 4NOHA 2HNYB 2OD4A 4AFFA 1Q81T 4E98A 3LO3A 2BA9A 1WF1A 1VMBA 4UQTA 4LSNA 2V2ZA 1CJKB 1CEZA 4UT4A 2GJIA 1LW2B 2CDRB 2D9PA 1UZHA 2M3DA 3MEDA 4G65A 2ZOMA 3HVAA 1TL3A 2V69A 1MU2A 1M5SA 2M8HA 2QL7B 1R0BG 3PJWA 4CO5A 3DYAB 1U7LA 3EVWA 4GMKA 4USIA 1FK9B 1PC4A 1R8BA 1TAQA 1SJRA 4MT1A 2R8KA 5ETQA 1LV5A 1VC0A 3D0IE 4E2FB 4C8KA 4ZIVA 4USVA 3A12A 3PACA 4DQQA 2EWHA 1KQSR 3ILLA 2MB0B 4Y0FA 2HNZA 3NOCA 4BCAA 1HBMB 1RT6A 2LYVA 1H3DA 3ITHB 2D1CA 5EUHA 3M05A 5KG1A 3VCDA 3V4MA 5AXNA 4HH1A 1U09A 3I31A 2BQ3A 4JI3J 2YKOA 2HAFA 1VQMS 3DM2A 2G1DA 4NXNF 1RTJB 2IHR1 3T41A 3T5LA 1TUVA 5K20B 4RNOA 2HRUA 2HIYA 4JI6F 3CSKA 2OEMA 1U2CA 2HWHA 3UDVA 4DMZA 2ATLA 3N6NA 5E3PA 2CPEA 2RE1A 1HI8A 4RWXA 2MY7A 4A8OA 4KTQA 1YBTA 3H42A 2ZH9A 3UNYA 1KLMA 1NJYA 1UFLA 1K1SA 1Z2ZA 1JXEA 1EIYB 5IZHA 1BC6A 1HQUA 4B17A 3QJPA 1GXLA 4TLRA 1MMLA 1ZZFA 2ZVIA 3MURP 2AYBA 1BE4A 2KHCA 3OR2B 3SCJE 3DNCA 1PSDA 2J9DA 2DIUA 4CLFA 5LXRA 1QLNA 1REGX 3VZIA 4O3RA 4CYUB 4DL7A 5HLFA 1BGXT 1L3KA 1JJ2R 2RIJA 2BE2A 3NP5A 3MPWA 5J2PA 3R5JB 3G6YA 5AE2A 1Y11A 2EI5A 2ZWOA 2Z2YB 1PBUA 3KTQA 5U47A 4LF6F 1XMQJ 3IWNC 2K1RA 1WACA 3L9ZA 2YWFA 2XSFA 3FCHA 2B9XA 1HD1A 1D9FA 5K5MA 3GV8B 2UVRA 1WF2A 3KLEB 1KLNA 4DX5A 1TUGB 1W25A 4LFAJ 1RWWB 2HVEA 6AT1B 2NSCA 1FNOA 3EYZA 2RKIB 4CLUA 3W9IA 3KG1A 2W4DA 4B9VA 2KRBA 1WKLA 2UUBF 4DL6A 4WFYA 1F60B 1R3NA 1RAJA 1G1XA 3WX4A 3C6TB 4F3OA 3MMBA 4F4KA 3WDOA 3E51A 4JI1J 2W9AA 2CQBA 2AQ4A 1B70B 5E41A 1J5OB 4CO1A 5K14B 4U8VA 4NASA 3T5HA 2X3DA 1CS4A 4ZS6A 2DH8A 2CQCA 2X7IA 2RF2A 1UJ5A 4JI7J 4UTGA 3CULA 4ZK7M 4V19J 4MYUA 3IG1A 2LDIA 4Y2MA 5KG4A 4A48A 5GAHI 4ZP8A 1S9EB 2CADA 4CNYA 1RDRA 1C2PA 2DIVA 3CCMS 3VV2B 2VG6B 4NRTA 2CPDA 4M95A 4AUKA 3S1TA 2MLZA 1IKXA 2MEWA 3VGTA 2UV8A 2XZTB 2ERRA 2H5IB 4NLDA 4ILMA 3PIPQ 3QT8A 3P5TL 4NLSA 6FD1A 4URGA 4C4WA 2VV5A 4KR0B 5D4LA 2QV6A 2ILYA 3CJSA 5CABA 1EP4B 2P2CB 4RUAA 1SC3B 4DFKA 1RISA 2QRRA 3DLEB 2GHVC 1QE1B 5LSOA 2HFNA 5LL6d 3VALA 3RZAA 1R7IA 4CH1A 4IG3B 3ADAC 4Q5VA 1K0VA 3DOKA 3CJ0A 4A46A 2XLJA 1ROFA 1C0UA 1S49A 1CSJA 1HPZA 3JXOA 1LXNA 2C3PA 3BGOP 2HHSA 4ECRA 2J76E 2BM1A 1RWVB 2ZD1A 3UI3A 1C1CB 2D74B 2MJNA 1NLKL 2WW8A 3CJ4A 1S76D 3VZHA 5C7PA 3LA0A 4OYZA 1WF0A 1SB6A 1PC5A 1SKRA 1HNZF 1WELA 3H4DA 1CG2A 1NKBA 1FWKA 3C16B 3QWPA 2BOPA 2ASYA 3MEGB 3KLVA 3PXGa 2MKKA 1T94A 5KT5A 2XTJP 4RW9B 2DR7A 1FFWB 3DRSB 2DJWA 2KT3A 3WC2A 4CP5A 3R1LA 3NGDA 1U1LA 5H9FK 5C42B 3AAWB 2R2SA 4M63A 4F36A 4F2RA 2BOAA 3K5NA 1T05A 1HD0A 5EWEA 4HHUA 3LOUA 4JV5J 5CQGA 2H5EA 4GO5X 4PKDB 4YY3J 4YB5A 2M9KA 1S9GB 2Z2LA 4ZVRB 5IT9U 4OYBA 1YX2A 3MD3A 1N4LA 1Y3KA 1DHMA 2RMLA 4Q2LA 3GV5B 4RW6B 3TARA 4YN3B 2H1YA 3LP2B 2C1EB 4WFZA 3ZZ0A 3LGHA 1N33J 4BBYA 4OYXA 4Q0BB 5DG8A 3AJDA 4DV5J 4ECQA 1IWGA 1HNWJ 1DARA 4DZ6A 5BR8J 3AHPA 4G1PA 1RI7A 1WC3A 1R8CA 4QZVB 4DSKA 1SUQA 1S6QB 3BYPA 3POTA 4C11A 3KK1A 2OH2A 2WVDA 2PE8A 5FJ4A 1HBOA 1FD2A 2AKWB 3KXDA 3R5AA 3MPDA 2LU1A 3MMCB 4AL7A 3O6QA 4P2FA 1U1KA 2CNNB 1SL0A 4ZLNA 1TQLA 4CNZA 2KU7A 2GQQA 5AXMA 3H98A 2A18A 2XI2A 2BUNA 1RHMB 5KFPA 2VQEF 1JIHA 2H9ZA 4J9UE 2Y1RI 1H2VZ 2PEBA 1U25A 4JI5J 3R6LB 2ZBIA 1I1GA 3MHYA 3VAJA 2FHKA 1NCLA 3MAAA 4GKKF 3CIZA 3I32A 3BGUA 3NXZA 4N77A 1VQ9S 4OL8A 4DV4J 2AX0A 3OTCA 3MM8B 2GQCA 2ZM6F 4DSLA 3IRXA 1SV5B 1DTQB 2MSSA 2M70A 3OHAA 1BQMA 1YTYA 2OTJS 3IS9A 2LXUA 4LF9F 1OWXA 5I3QA 1U48A 5CD4A 4NL5A 2ZBPA 4NZ0A 3TAMB 2H54B 4HR2A 2OPQA 4ZVSB 1TELA 1YKWA 1VQ7S 2FZKB 2MQQA 2MGZA 5DETA 2WSFC 5E3QA 4XPEA 5A0YA 3BH7B 3IBFB 2LXFA 1WTBA 1UFWA 1C0TA 5HQLA 4B3SF 2C2MB 2YNGA 3QAEA 3CMES 1GXTA 3PFEA 2Y1LB 2MTLA 1EQMA 4CT8A 4O4GA 2VPZB 3H2LA 1FNMA 2QT7A 2HPUA 5KFCA 4Y2AA 4AD6A 4RUCA 3R97A 4HI1A 4DUYF 1BY9A 2HQCA 3T9ZA 4MK9A 4NZ6A 4DU8A 5FLXY 3CCSS 1HNXF 2EK6A 1YSJA 2HVDA 2R3VA 4LF8J 3DLGB 3BSNA 2NPIA 1UJ4A 2JH3A 3JSRA 1TMJA 1JLAB 5DDPC 1RHJB 2GIQA 2FD2A 2W9BA 3TOQA 4OHVA 1H38A 3EPGA 4DSFA 2FHOB 2PFFB 1RT2B 4NZ7A 5F8LA 3QPIA 1LWEB 1M1HA 1FEEA 3UDCA 4IFVB 3SCKE 4EEYA 1N36F 3CDBA 3OVSA 3CJ8A 1PIEA 2AJ0A 1RWXB 1F9EB 3M8QB 1SC4B 3R2DJ 3M2VA 5T7LB 5IT4A 3C15A 2MY8A 1I51B 2DGQA 2Y0SD 3FFIB 4GVBB 4MIBA 2EFOA 2Y3YA 3QGHA 3QYYA 3UW1A 3M30B 4OX6A 1X0FA 4ZCMA 3VR1A 5KFSA 3T6JA 1NZAA 2CQ0A 2ZH8A 2COLA 2J5AA 4XIUA 5BJRA 4DV7J 3PR4A 2VODA 2XY6A 3K5OA 1SCJB 1N52B 1M1GA 2CPXA 4NYZA 4DQSA 4PZVA 4F0MA 2A10A 1S79A 1F9FA 1C4AA 4PG8A 3BQ1A 4IFYA 1U0SA 2I2YA 3TNVA 3JYTA 2IY5B 1WKJA 5J1PA 2ZITA 4X65J 2ZKUA 4HDHA 3HHKA 2M4MA 1FVSA 2ROEA 2C2EA 4ED7A 2XEXA 4A8FA 1HNIA 5HROB 1CVJA 3CC4S 1RU1A 4J90A 2PT0A 4I6YA 3HZEA 1UCNA 4R8UA 1RKIA 2HHQA 2QSWA 1PYTA 1WDDA 3QIPA 4DR5J 2HS0A 4FXWA 2XI3A 1ICEB 2AT1B 1Q95G 5HN0A 3CCLS 3TA0A 4DCOB 4ZPWR 2V2VA 2HHHF 3HHLC 2AJQA 2EC2A 4C8OA 1VISA 4JYAF 3NEKA 1HQEB 4U7UK 3SV4A 4AXJA 1TL7B 2FUG9 5JVGQ 4QR1A 4WXWA 1FFGB 1V6HA 3FC9A 3CDWA 1JX4A 4EBEA 3VGSA 1JLGA 2M2BA 2FLNA 3E8OA 3MI7X 2RJZA 3M2UA 4LIRA 3W2VB 4NLOA 2ZBRA 1RUSA 2LA6A 2C2NA 3IBWA 2R7VA 4K4XA 4PXDA 1FRMA 4DFPA 4HTIA 3ET6A 2H4YB 2XG8A 2Z2ZA 3RR7A 1OY9A 3MF5A 1C1BB 1H2TZ 2KN4A 4PUOA 2GMLA 3IC1A 1U1OA 1YHQS 5CH7B 1HA1A 2VG5B 2HQGA 1DBDA 3ZO7A 2NS1B 4C8MA 3DOMB 5KFYA 5C2GA 3JSMB 3W2WB 2R2UA 3CJ2A 2B0GA 2OFHX 2DNLA 3R7BB 2B51A 2IA0A 1AROP 4ZJLA 4FP9A 3UN5A 3EGVA 1ZTWA 2DH7A 4QJVA 2N4CA 3LTOA 3IFEA 2MKCA 2JC1A 3Q22A 5CYMB 4OJ1A 2CPJA 4W98A 4UY8T 3S01A 3NBPB 3MUTP 1IJFB 7FD1A 1NPKA 3MAHA 4CLTA 4RW8A 3UN2A 3RTVA 5DGAA 4BHQA 1F0XA 4HYKA 1CULB 4B3MJ 1AYEA 1NNDA 2AJ4A 3M7VA 2DRDA 1JLEA 3AJ1A 4F02A 2GCFA 3OJUA 2ZC4A 1RAOA 1VRUB 5A8WA 2CWXA 1TAUA 3M1VA 4M5LA 3MFHA 1FX4A 5GVQA 4DN9A 4OZ1A 3BYRA 2YPYA 3A4TA 2CAJA 2DNQA 5DQIA 3MFIA 2R9LA 4I6AA 3BSCA 3HVTB 4RBTA 3BR9A 1S7HA 1QAJA 1X4FA 3BO3A 2GJ2A 1K8AT 2O1PA 4DWIA 4MKBA 2QTWA 2BRLA 1FKOA 4U67Q 3K59A 1RJJA 2E5LJ 1D8YA 2DO0A 1D9DA 1UZDA 4PQAA 5J2QB 1YBUA 3FQLA 4K59A 2VBWA 5GMKa 4KJIA 4NCGB 4IR1A 1EETA 3BEGB 3CJ5A 1VQOS 5BYSA 1S10A 3N9UC 4XTTA 2VOPA 5KAKA 1S97A 3OTDA 2ZVSA 4IQXA 1YLXA 3IR7B 1WHYA 1RT4A 1KTQA 5BYRA 2HNDA 1NDPA 3UVJA 2Q1LA 1KP6A 4RJVA 5KT3A 4U96A 1VQ6S 3W8PA 1Q86T 1A7GE 1RWKB 3NS7B 4WU2A 1SJQA 3H5SA 1WHVA 4F3QA 4ECWA 2D3ZA 3O8WA 1HWJA 1WSVA 2V67A 3M8WA 2VHGA 3TUPA 2ZBQA 3ISNC 3OVBA 4TY8A 2GO9A 1S59A 1PYSB 2QMUB 4HVZA 1S6UA 4M5MA 3KMSA 2CPHA 5IFMA 2W25A 2VFUA 3KDNA 3MEDB 1TV6A 3FCWA 3ZC4A 3AB4B 2UP1A 3RJMB 1M1KT 1Q8LA 1FX2A 4X4TA 1RWUA 1WI6A 3QLHA 3IR6B 3CIMA 1ZYQA 1MU2B 5F9NA 3DMJA 4RX6A 1TKTA 5AXLA 5KFOA 4DR6F 5HJXA 3QFWA 4GO7X 1TMMA 1QVGR 3BS9A 2CJAA 1Y9OA 1HYSB 4B9TA 5GMDA 5HVHA 3EM1A 4O23A 1O0PA 2XO6A 3BV8A 1HARA 5D78A 4EBDA 3KHGA 4CO2A 4OI0A 3RU0A 2HFVA 4DR7F 1RT6B 3MCSA 4OQJA 3KK3A 4KY3A 5KFWA 2W8KA 1WTFA 3M8YA 1PGZA 2H48B 1XMOJ 2M88A 3DC2A 3IM9A 2HNYA 1MMDA 1S1WB 4KAIA 2FLPA 2BRKA 1CJKA 2UVUA 1ELOA 1KD1T 4WFNQ 3DM2B 3CVKA 1LW2A 2YPZA 4HT5A 4MJKA 4C8LA 4L76A 1KHVA 1SJ4P 4LF2A 2XMUA 1Q1KA 3VAIA 2CRLA 4HHJA 2ZE2A 1U8WA 4C48A 4B9MA 2QLXA 3M6XA 2KZMA 4DEZA 1SI9A 1QAYA 1VS3A 4IO9Q 5DRKA 3SI8A 2PIIA 3DYAA 1QUPA 2YKPA 3DDIA 2XNQA 2JSXA 3NCPA 1FJGF 1AUSL 2PO4A 1KLMB 1J27A 4Y2KA 2HKEA 1FK9A 3PEJA 2ALZA 4XPCA 3TEGA 2GX8A 1UVJA 1HQUB 4RU2A 5F8JA 3PRBA 3SQOP 2OEJA 1IKYB 3TJ9A 2IVFB 3BN4A 2J0SD 3OL6A 2I6WA 3ZTPA 1FWPA 2VBZA 2JHEA 2XYGB 4KRWA 2MKIA 5A8RB 1HBMA 3ITHA 2AHOB 5ITHA 3TANA 3WIVA 2UUCJ 5J2PB 2XY7A 3OUYB 2DNOA 5A2QY 3PX6A 5ETMA 3MUVP 5K8NA 3BDEA 2BX6A 1IBLF 4DL0C 1ZM9A 3EUNA 2K1RB 2BJEA 3DRRB 5IQ6A 3PJXA 3X1LB 5D4OA 3C19A 1ZM2A 4ELTA 3K5MA 1DRZA 1SC6A 3MUMP 4ZVGA 3BDPA 1D0EA 2VB6A 1EB0A 2HQ3A 3V81B 2D41A 1WC5A 3VF0B 4W4MA 4QWDA 2GNKA 4UOGA 2QLFB 2FJVA 3NG8A 3ZXWA 2H65B 3O5TB 2WOMA 5GAEI 4JI2F 3IBCB 4FYWB 2OJ3A 2ZZTA 3CDAA 3CJTA 2MZJA 3OR2A 5IM0B 4I64A 2HFZA 5IV3A 1RLCL 3JAMU 1WC6A 1RAFB 4NLQA 4YEAA 4JP8A 1FRHA 5LXYA 1CS4B 1CQMA 3FBEA 1AFIA 1HBUB 4WFAQ 3QO9A 3CMAS 4OZLA 1V5IB 4AQYF 2C3OA 2RF2B 2BJ3A 5B09A 2KVIA 4FDFA 1BMQB 1N34F 5DDRC 2RQCA 3IG1B 2VDIA 1UVKA 4B3TJ 3M9MB 2DHSA 2UXDJ 3EE3A 2FC9A 2OGUA 3CJRA 1VIOA 2IM0A 4P6QA 4C8YA 3FK4A 4DV6J 4L3NA 4MKYA 2RVJA 2Q66A 1RT3A 4I0WA 4JI8F 1R31A 4F04B 4IKAA 5ETLA 4GC6A 2C3MA 4OHYA 2RKIA 2BANB 5ADZA 2GFFA 3KDOA 5HK4A 3BZQA 3PYFA 1B64A 3T1HJ 5DG7A 3C6TA 4G3IA 1KEKA 3I0RA 1T9XA 1RT7A 3CD7A 4DS5A 3CDUA 4MK8A 3UCGA 1ZPWX 3SDEA 1PAUB 4DR4F 2IIHA 1ZETA 3DOKB 3T19A 1Y5LB 4TU7A 5K14A 1HPZB 3MAQA 3VQTA 4M5NA 3EXCX 1ZBTA 4WIQA 3OTOJ 3PHTA 4ZPDA 3TP2A 1QSLA 2HHVA 1Z1ZA 3PYGA 2ZD1B 1AXQA 3CC2S 3W3SA 1S12A 1S9EA 3EZUA 1MMNA 4MFBB 1NSQA 2ZWPA 1E6YB 2H51B 3SZ2A 1RADB 4ZPBA 5ETNA 1XEZA 4QU7A 2CJQA 2EFVA 3KLGB 1YQHA 2ZC3A 5KFJA 3C8YA 4DLEA 3M9OB 2LCWA 4OYIA 1VQ8S 3MM6B 4S0MA 3V6JA 4KPCA 3WZ0A 3VAFA 2E5JA 3T5KA 3D2WA 1EP4A 4EZ9A 3J7A1 4KSEB 9RUBA 2Y1IA 1T05B 2HHXA 3DLEA 4X84A 2MZSA 1QE1A 2DKOB 5HBMA 2JLGA 1XQIA 3W5ZA 3G6XA 2B5JB 3Q83A 5L8RC 5IQQA 1CLFA 1GXUA 3I55S 2J8SA 4DDFA 2RDIA 1UPPA 2HK3A 3G96A 2RQKA 4EUVA 4JV0A 2UXCF 4LF5F 1KQFB 4C3LA 3NOGA 3GMGA 2D9OA 3GILA 3PO5A 4EFAC 3CB4A 2QYCA 3J81j 3RAQA 3KUGA 4DU7A 3HHDA 3MD1A 1XNRJ 2HVIA 2F9DA 2R8IA 2OMOA 1QSSA 2KH9A 3UO0A 3TZZA 1T9WA 2VICA 5ETTA 2J6TA 4KE5A 4AYBD 3W1YC 2IYIA 5J1NA 2K3KA 3NGUA 3MEGA 2GVDA 1SUQB 4ICLB 3RBXA 4RW4A 4RW9A 3KK1B 3BKUA 2ZUGA 4ECZA 3DRSA 3UPFA 4GKJF 3L7OA 5HMWA 1VBXA 3BH6B 3ZZOA 3PEHA 1HL6A 5EDWA 3OFGA 1DTTA 4J5OA 4B3TF 3BJYA 5C42A 1DZ5A 2UXDF 5ETPA 2B7BB 3Q2SC 3V5RA 4X62F 4LFCJ 4DV6F 3MM9B 3EPIA 1YJTA 4X2BA 3W7BA 4J9VA 3F73A 3HJVA 2BW7A 1VJWA 3GJQB 4IH5A 1X4GA 3CUNA 4DR2J 4UUWA 3H2VE 1S9GA 2RH3A 3MAAB 3NL0A 1GTEA 1VBYA 3FQKA 3OTEA 3QMQA 4RW6A 3PVXA 4I1TA 3H25A 5I4MA 3R9LA 3LP2A 3HZGA 2GO8A 4ECTA 3WIUA 3GG1A 3SQGB 2VU5A 1LXJA 5CA5A 4DV3F 1BQMB 1RAHB 4K4VA 1U0HB 3IN5A 2GHPA 2MJUA 4MIWA 1N0UA 1MG7A 1B99A 4DV0J 3QRRA 5HP1B 1RKJA 2LMIA 1IJEB 3CDEA 2QN6B 4DQPA 3FNNA 2UUTA 2UU9F 4E0DA 5GAGI 2RUGA 5A0YB 4ECSA 2ZZNA 3MMCA 2EFNA 1QAIA 2YNGB 2JLEA 3FEXB 3CGIA 1X5SA 4YUDA 1IBKJ 2YKAA 3EDRB 4O4GB 2WW4A 4K0KF 1RTIA 4O0NA 4I2QB 1KWMA 4J9OA 3AXMA 3HD1A 3FCVA 3I5BA 1KFSA 2ZJRQ 1QY7A 3NNAA 2B9YA 2NYHA 3R5CA 1NBEB 3MECB 3G4SS 2BKPA 4OYOA 2AEMA 1KKHA 4B9UA 2D69A 2B8PA 1UFKA 4RBVA 2HGLA 5D3GA 2HVHA 4DPTA 4ZN1A 4FF1A 2F8EX 2IMOA 1SV5A 2QA4G 3FVYA 1DTQA 1UMJA 4FNIA 2CJ9A 2BVZA 2RT3A 1RHRB 3M6UA 4DV1F 5H9EJ 3NAIA 4QIFA 3M2VB 3FMWA 5HVFA 2C2ZB 3C15B 3TAMA 2HHUA 4WXOA 3FBBA 4OI1A 3ILOA 2KXHA 5ETVA 2ASDA 5CZVA 3VWSA 2POKA 3E3XA 2IA6A 1PJ6A 1JJCB 3OFHA 4ID5A 3GB0A 3DGPB 2LEPA 5CYQB 2YQ1A 3GIRA 4LBIA 2MLXA 3WX8A 1SPBP 4ES2A 4CM0A 8ATCB 2G2OA 3WQPA 3G86A 4MIAA 3CCJS 4LUBA 2YKMB 4KYZA 4CLSA 4C3MA 2DYAA 2RILA 4IFYB 3DLGA 4X4UA 3T1YF 1UVIA 2BV3A 5MLCV 1NPRA 1YIJS 4CLZA 3CF5Q 3DOLA 3HI9A 3CXCR 4ZPTR 4ZCIA 2GAHC 5A6WA 3FUYA 2XYHB 1S0OA 4USJC 2O3DA 5D0HA 3MR2A 3D67A 3TW0A 5KFHA 1XJWB 5B0BA 4RZRA 4QIGA 2YNIA 3SEOA 4X4PA 1HNIB 2Z57B 2PMZD 5M2RA 4P72A 3MEEB 2QMWA 3M8QA 3DN9A 4FS2A 4BS2A 1NB7A 4R8UB 3LAMA 4O3PA 4J9NA 3OPKA 1W26A 3FFIA 4GVBA 3QIPB 1JNZB 1YRTA 2FVPA 4DQRA 4RBUA 3M30A 4C7QA 1N5YB 4RLEA 3R7NB 3K58A 4CO3A 4KGMA 1AZSB 2OEKA 1H0HB 5DM6Q 3JQJA 2V8HA 1URNA 5F3ZA 1OY6A 4KT0C 3KK2A 1O5JA 2BBEA 4DFJA 2RRNA 1UEUA 2LU2A 1YJ9S 2R7OA 1D09B 1GMVA 2EKYA 4QOTA 1QM9A 4DV0F 4Z7YA 3SFUA 1FDDA 3GJSB 4OI2A 4WPAA 3ZTRA 1NU4A 1VHIA 4OMFG 1E6VA 2BR0A 4KV8B 3M2UB 4IO1A 3LW5C 4LIWA 4NLWA 1RBOB 4TYBA 5HO4A 5KFMA 2WVBA 3C14B 1FERA 2F8HA 3N6MA 1VBKA 5KFUA 4N8OA 1SIZA 3CCES 2W4CA 5D77A 1ZPVA 1F9HA 3ZNJ1 1VQLS 3P45B 3CD0A 3ET6B 2H3EB 5DLGA 2RDJA 4ZKAA 2KJVA 5KFFA 1W2BR 4LF7F 4NLVA 3S7RA 4L6V3 3R3TA 5HROA 1X7VA 3FJ2A 1XK8A 2QA2A 4KGZB 1K73T 3Q8SB 2B3TB 2V94A 1IKWA 1X4AA 1VR6A 4I2PB 3BQ2A 1QDUB 1HIYA 2FJWA 5B0GA 4C6AA 3DFEA 4ETXA 2PSZA 3AOBA 3SCLE 1ZA1B 2Q43A 3D54A 2KTQA 3KLFA 5GADI 4Z7CA 4X4SA 1P9QC 3TI0A 1RK8A 1SL1A 2CZ4A 3M6VA 1TL7A 4Q7AA 5DQHA 2F9JA 2MQ8A 1PAEX 1JKHA 4AE5A 4PCQA 1FXRA 4Y6IA 4DOZA 4ZPAA 1R8HA 2IVYA 4PG6A 1U2RA 2IDLA 4XDDA 4L73A 3W2VA 1G6BA 4KGKA 3KYLA 4B3RF 1B0VA 1N32F 4IH7A 1NUEA 2HRYA 2ZHBA 5L1JA 1NMEB 2BZ2A 2BJ9A 4I56A 5HVGA 1CJUB 1VFJA 2IJRA 2AJ1A 4I4BA 2HQFA 2NCKL 5L1LA 2DO4A 3DU5A 3J7AN 2VG7A 4CRJA 2E29A 2DR8A 4NEZA 3B54A 3TO8A 4X66F 3N5FA 1K1QA 4DF4A 3FEZA 3L3CA 1FKOB 5GAEU 2AYMA 3W2WA 3EWGA 4P7TA 3FZBA 2EVZA 3PG9A 4HH0A 3AA8A 4WTYA 4JI0F 2E5HA 2PMHA 1U4BA 1EHWA 1Z2LA 3QT6A 1UTAA 2OD6A 2FZGB 3GFXA 2WCXA 1BQNB 3B8HA 4PRFA 1I5OB 4NXNJ 2NLWA 3NBPA 2JVOA 2K8GA 5BXIA 3H90A 5HL7Q 3BM7A 2KL8A 2DY1A 2BM0A 4JI6J 5IT0A 3M4XA 4QIEA 1L3SA 3DI6A 1CULA 2GMHA 2V2QA 2K2PA 1HR0F 5F9LA 1NHVA 1RGVA 3K5PA 2PA3A 3NCQA 4TY8B 3NWRA 3TVKA 1Q79A 1SC1B 2P6SA 2JVRA 3UCUP 3UFCX 2F1FA 3QJLA 3AOAA 1VBZA 1FE0A 2DPJA 3G87A 1NK4A 1HW9A 4LBPA 1TKXB 1Y5IB 5EWFA 4IRCA 4J37A 1R6YA 3BGRB 3HVTA 4KHMA 5KFXA 1PCAA 5KFEA 4ER8A 4UW2A 2R7UA 1SQEA 3LAKA 4WP3A 3ZZPA 2RU3A 2B7CB 3B78A 4B9SA 4BC7A 5J2QA 2M8DB 1O51A 3A3NB 5KFTA 3QGPA 5CXTA 2HHPA 4NCGA 4C0BA 4USUA 2AYGA 1SJ1A 2KJWA 2OELA 2NXUA 1S0MA 1CPZA 2F40A 1PYOB 4N47A 5D15A 1H6KX 2V2KA 1LWCB 5KFZA 3QT5A 2R2TA 1F2HA 4QYZK 2B56A 3G9CA 1N5QA 5HMZA 1RYRA 1DLOA 3K2YA 1TTHB 2AIRB 1VCTA 4OYPA 4ANDA 1X0PA 3ZZYA 1BHNA 1RQ0A 3T3FA 2UUBJ 4F4YA 4ZVUB 4MTPA 3IWXA 2DT9A 2Q6CA 3GLJA 2ZE2B 1U1RA 4PG5A 3GJTB 5AT1B 1HMVA 2E9ZA 3OLBA 2ZH4A 5L1KA 2Q79A 3TZYA 4KBIA 1HHSA 2Z4PA 2GC8A 2KFYA 3IAM9 1TZ0A 1RTHB 1F1BB 1YVFA 3BREA 1HYSA 5JVHQ 4PWWA 2E7WA 3IR5B 2JZ5A 4IQMA 3KUHA 4OZ0A 1DFDA 3K0JA 1FDBA 3ICLA 5KOWA 4WJBA 2Y9HA 2XMJA 2VJVA 3KFWX 3JTNA 2X1GA 5H9EK 3HX9A 4MKAA 3GG0A 2F4FA 3A3PB 2YKQA 3SIPB 3NGRA 3W66A 5F8HA 4FF3A 3BO2A 3M8RA 3FSXA 1X60A 1M5PC 2GIRA 3HHLA 3HXMA 4ZIWA 1S1WA 5HANA 2QX0A 5C25B 1NK8A 4Y00A 4DUTA 3GQCA 4KH0B 3I82A 1TUWA 2BW2A 3RRKA 3Q8YA 4URSA 4CT9A 3NRBA 4X4OA 1SBRA 5G4DA 3KNGA 3MR6A 5B0DA 4RU9A 1LFWA 3KJQB 4K2JA 2IRXA 3DKDA 2BQRA 3EGZA 1KBRA 4LJMA 4CI0B 3BF4A 1PJ7A 1D8ZA 4F0HA 1K0TA 3I4HX 2DNGA 3W5XA 1S1UB 1S57A 2HFUA 3HSJA 4PYAA 2WOMB 3G6VA 1N6QA 4QCLA 4YDXA 3JQKA 4B3OA 2GMJA 2XMAA 1H74A 1IKYA 1FDAA 4RKUC 2XZWA 2DB1A 4BC9A 2UUAF 1F3FA 1HNZJ 4FXDA 1NXIA 4ED0A 3EICA 4NMLA 4H4OB 2Y0BB 1X4HA 3QO9B 2XY5A 2B9EA 4HLBA 1V3SA 5A8RA 1NJIT 4M5IA 4NI2B 5AE1A 2QL9B 2PC6A 1Q4RA 3SMZA 3ENWA 4QWAA 2W9CB 1ULRA 4FNHA 2L9DA 3OUYA 5IT9Y 1F3VA 4FZVA 4DZDA 4DHVA 4ZLPA 3VVTA 4K4SA 2OIHA 3R1HA 4NCBA 3MCMA 4ANEA 4A8SA 4OZ3A 1NDLA 4KIAA 3P4UB 3DRRA 4QIVA 2KT2A 3PW0A 3HULA 4Q8FA 4FYXB 3OXGA 1S0VA 5GAGU 4DX7A 3ZNUA 3R27A 1RT3B 3PCOB 2SXLA 1H73A 1HWUA 4EBCA 4OYMA 2M0GB 5KT6A 1FJ7A 4NCAA 4DFMA 3LQVA 3V81A 2IBOA 1XBWA 1WOPA 2LQ9A 4LFBF 2LP4A 2EG2A 2MQNA 2WB1D 2BACA 4W92B 1OPIA 3I0RB 4OZJA 4K4UA 1RT7B 3PM9A 3ETOA 1UP1A 3SDEB 1CC7A 5IM0A 1JLFA 2UZAA 2DNMA 3NS5A 1UETA 2R8HA 1HBUA 4F25A 2G0JA 1BXNA 1KS2A 5M2UA 4AT1B 3JTPA 2P5VA 2BQUA 5JJBA 3T5JA 2CA9A 4CLYA 3OVAA 2AW0A 2J0XA 3Q89A 2XMWA 4JI4F 2L41A 1AT1B 1FHTA 4PEOA 3O3LA 5KG6A 3V4IB 2MKJA 2YY3A 2VJUA 1Q8BA 2VUGA 2DXDA 1DQAA 1KFDA 2HK2A 1RBLA 4KHPF 1MNEA 4URQU 4DS4A 2L48A 4ERDA 2CPFA 2AEJA 5J1EB 3SXLA 4C3KA 3DDNA 5IOLA 2VQEJ 2JNJA 2X51A 3Q8RB 3I0SA 6FDRA 3W65A 2E9RX 4MMOA 1RWOB 3GIKA 3ZTOA 1GFWB 1R6VA 5KG2A 1FRLA 2BANA 1W7WA 4GKKJ 5C5JA 2BKOA 1ZTTA 1LWFA 1RHUB 2HBQB 2ZM6J 2WVFA 1U8SA 2YBVA 3Q0AA 2AZ1A 4LMZA 1SKUB 5HBMB 1RHQB 5ETOA 4IDKB 2F4VF 1U02A 4F3MA 5D6GA 2OPPB 4LF9J 3A13A 1XTZA 2KI2A 3A3OB 2ASJA 4DSJA 2VASA 2RS2A 1YJWS 3MCNA 1B7YB 5T41A 3JTOA 4OX9J 2VPXB 3K89A 1S5ZA 2JOQA 4HT7A 1FRKA 3CC7S 1SKWA 4NRUA 4B3SJ 2V6AA 1RAGB 3FRZA 4MFBA 1RBAA 1WG4A 1SKSA 1E6YA 3TUJC 5DDOC 2UXBF 3KHRA 2GVDB 4ZJQA 1YI2S 3KLGA 1B0PA 4RW4B 1T9TA 4DUYJ 2CJYB 4UUXA 2OPRB 2UVWA 4IRDA 1S1TB 4KC5A 4WTOB 1HNXJ 5HJYA 2DEJA 4NLTA 3BKFA 3MM6A 2XLKA 3GV7B 5KFDA 5KFQA 2RUSA 3G82B 3RRGA 1DTTB 4MYTA 2HHWA 3CJ3A 2C28A 3NLCA 3J80U 3GIJA 3MZIA 4LRBA 4FN5A 5E3CA 4NA3A 2IC3B 3NGKA 3O1LA 2F3JA 2JFDA 1KOHA 1IBMF 1N36J 2B5JA 3NGTA 1VQ4S 5KT2A 4I67A 4H4KC 4PWUA 4G1IA 5E2QA 3NS6A 2DHGA 3F0NA 1LOUA 1QTNB 1UA0A 4RUHA 4ZP9A 1TL1A 1Q0NA 2GGPB 3QSIA 1VRTA 2B43A 1S77D 4O3QA 1J5EF 1Y00A 2FY1A 4OHXA 3SSRA 3MM7B 2FY8A 4TNOA 1IKVB 2V8DA 1WEZA 3D9BA 2A1BA 4JV2A 5D4PA 4ZHRB 3R7SB 2I38A 4EO6A 4MH8A 4P2SA 3CJQA 2JRSA 2Z30B 4TQSA 3UNGC 4X4NA 3OFFA 4ZVEA 1WEYA 2YKNA 4YHHF 5GADU 4K4YA 4ICLA 2DK2A 1OJ4A 2DNHA 4ELUA 4TN2A 4IYQA 2GV1A 4C8NA 2IM2A 2DGTA 2F63A 2JFKA 4PABA 3HDSA 2CVEA 1S1XB 3BBCA 1NHUA 4PWDB 4RL1A 1EQ0A 2LXIA 3D3BJ 4A8XA 1CJTA 4WZMA 2EKNA 5E5NA 2HBYB 1F2GA 1TU0B 3P5BP 3MM9A 3U1LA 5HQ8A 4FYDA 1RTIB 1WJ9A 4OJ3A 1WDTA 5LMUF 4V1Ak 4RW7A 1XNQF 4K50A 2ZHOA 4H4MA 3D7SB 2J6UA 1MROB 2I5JB 5FIIA 1RU2A 2GVZB 4DR1F 1S1VB 4GVLA 1IM6A 2XWXA 5E7OB 3DLBA 5D3GB 4CIOA 4J91A 1HKAA 4DUZJ 2R7XA 2HHHJ 4QWBA 3SQGA 3K57A 3GCXP 3OL8A 1X9SA 3PZPA 4PPDA 3TVZA 4JYAJ 1DQ8A 3QRPA 1U0HA 2ROGA 4FVCA 4M5GA 2LDYA 5B0EA 1GT8A 1TL4A 4IG0B 2DNKA 5HP1A 2OTLS 3SFGA 3MPUB 2VFSA 2XS2A 1FA0A 2AGOA 1FXDA 4DCJB 4OX9F 3CMQA 4CO4A 1WUUA 1IUJA 3J81U 4BDPA 2G0IA 2GA7A 4ID5B 3MXHP 3IA0A 2L3MA 4F0KA 2RHQB 1NEEA 1N8RT 2V68A 3M32B 2DCUB 3F56A 4CLKA 2HVZA 2KXFA 3I5CA 4K7QA 3VGVA 4C97A 2DNPA 1T3NA 2EG1A 2PN6A 2AP6A 2Z2MA 4YS2A 2VKRA 2X1BA 4I2QA 1YZ7A 1BUXA 2H4WB 4UOFA 1TK0A 3MECA 2F7VA 2HBZB 2FIUA 3DOLB 2DD8S 5DS7A 1NAQA 5FD1A 1M5HA 1JMTA 2YNIB 3PYDA 4Q45A 1HFEL 1DY3A 1I94F 4LREA 1T7PA 2AYEA 4O0IA 4I68A 3KNAA 3ETMA 2ZEJA 2DGOA 3D5MA 4LF1A 2U1AA 2CQ3A 2BJ8A 3DU6A 4YOEA 3N79A 4ID8A 1FVQA 8AT1B 3FZ2A 3S6EA 1OYDA 5LMNF 4WFBQ 5JXSA 3CNQP 3HT0A 2V8VA 3KOAA 1V3ZA 2U2FA 4AXIA 5K8MA 5IWAF 3FMBA 1OSCA 3AD7C 3EGNA 2IDEA 1G3OA 2FVSA 2BE7D 3D1HA 1Q82T 3M8ZA 4WFXA 1YJNS 3DGPA 3KK2B 2ZUAA 1WC0A 5CYQA 4I7FB 4DN0A 2F5GA 2CQHA 4TQRA 1LK7A 2CQ2A 3OSPA 4Z37A 2BJ1A 5IS2A 1GK8A 2OI2A 2YKMA 1IBCB 1G2EA 3DDKA 1RT5A 5K8PA 1E6VB 2KKHA 1OYEA 4DL5A 1WHWA 2C22A 3GSDA 1U49A 4ALZA 4W90B 1V3RA 1TFYA 1T02A 4P10A 1GX6A 4X64F 3HKZD 2YWHA 5AJ3F 3H20A 3LPEA 1FEHA 3GFZA 2UVVA 1UWBA 2W7PA 1KN6A 2HLUA 2K7KA 2FVQA 4DV2F 4PPZA 4GC7A 3PDNA 2XM3A 3GZ7A 5IXUA 2ZDOA 4DR3F 4FYYB 5J2MA 3MEEA 4CH7A 2DVIA 1LNQA 2WVEA 4R5PB 2KG0A 3MR7A 2Y8WA 3D1QA 3BSOA 1Q78A 4PQUA 1IKWB 1A6LA 2K06A 4L74A 4K2XA 1N5YA 4DUZF 3Q8VA 3V6KA 1NB2A 4ZITA 3KLFB 1AZSA 4LQ3A 4ANCA 5A8KA 4QR0A 4JOUA 4MAKA 3PFOA 3ONQA 3D6MB 2NUHA 5JUMA 4IOCQ 1U1QA 4ZVOB 4RO0A 3HCXA 4USWA 3D1OA 3DRPB 4J9SA 2WHOA 1JKHB 3IAS9 3U1NA 4FBTA 4Q8EA 2OUGA 2WVCA 1NPPA 3NGSA 4ZCKA 2PA8D 3SBMA 5B7WA 2QC3A 4KV8A 5HMXA 3LP1B 2ZH7A 1NDCA 4DR6J 2QG9B 1FD8A 2XB2D 1LW0B 1CC8A 3C14A 5D0GA 2NSBA 3AFGA 1MN7A 3PX0A 2X3GA 4M5HA 3FBFA 3CCQS 4HHHA 3CTRA 1R0AB 3Q2TC 1X9MA 3KG0A 2YNFB 2R7QA 1FRJA 2WONB 1RSCA 3KLIB 5G0RB 2VG7B 3E2EA 4YR0A 4DL4A 3CEDA 2DR9A 3SCIE 1U47A 4Y34A 4OZNA 3VHQA 4HI2A 4NLRA 4DR7J 2DXEA 4I2PA 5LM7E 1JXLA 4LRAA 2E1PA 1SL2A 3UD3P 2VDHA 4HDGA 5LJ5Y 4F50A 1Y7PA 2V63A 1JNRB 3CD6S 2EBEA 1HBNB 3CWJA 1N54B 2DXFA 4QIWD 4USKA 4WE1B 3H2UB 5E3RA 1Y10A 2QL5B 1UA1A 1WKKA 3GR1A 3TEHB 4P71A 4QBUA 2IRYA 2A6MA 3HFZB 1GX5A 3NAHA 2KHDA 1FTRA 3H5XA 4OHWA 2XSJB 5HAOA 3DI6B 2V5HG 4KH1B 4DI6A 1TKDA 4CZCA 3C66A 2DITA 5I3PA 2NYIA 2B6AB 2JWNA 2CQGA 5CZXA 3I56S 4P2MA 2MSTA 4TY9A 1FJGJ 3SYZA 1P6TA 4J9QA 4OYWA 2WBRA 1CJVB 1CJUA 1VQ5S 2ZDPA 4M1KA 1VK3A 2E5IA 4C9DA 3R2CJ 3DHXA 2AWZA 2QMXA 3K8WA 5C24B 3C6UA 1FRIA 2VONA 4DCPB 4K5SA 4ZVTB 2E5GA 1KSPA 1RWMB 3TWZA 2VQFF 2WZ1A 2RAQA 4ES3A 4Y65A 3FDSA 1KQGB 3KJNB 2MDAA 5KT4A 2WB4A 2QLWA 4RPFA 2IJFA 1JWWA 2YWWA 3OQ2A 3R8YA 2YQ0A 3GP9A 5DQGA 4FBUA 2NXJA 1BQNA 3OXLA 2HYIB 1IBLJ 3I5AA 1FKPB 4CQ1A 4WZQA 3MOZA 2N4DA 1XN9A 1R43A 3D6HB 2CPYA 3N4WA 3CW2C 1FI4A 4KFBB 2AV5A 3I87A 4A8WA 1TL5A 1DLOB 3JAMY 2XGQA 2VL1A 1H72C 2ROPA 4WP9A 1NZ8A 2O67A 4OJGA 3OSNA 2FTRA 2R8JA 2QLJB 2P6TA 3D4JA 4ZDNA 5K9FA 4RWWA 4NPOA 4NLXA 2WTFA 5I42A 2Q3PA 1IQZA 1YJRA 4JI2J 1HNVB 4H54A 4IR9A 3TA2A 4B08A 3PX4A 1TKXA 3UD5A 1RAEB 2DISA 1MSWD 4HEA9 3RYLA 1N56A 4NLYA 2OFGX 3W62A 3BGRA 2DNYA 1HMVB 2ZH6A 3AODA 3N6LA 5AXKA 2D3O1 4ZCLA 4KO0B 1LWXA 4AQYJ 2PEHA 2GJFA 2WSCC 2CIMA 1M0SA 2DH9A 4NE9C 4BWJA 2J7WA 2J6SA 1N34J 4D3HA 1FTCA 5I3UA 1WC4A 1B7FA 3IWLA 3OR1B 1FRXA 2OHDA 2Y8YA 5IC4B 1T9UA 3GR0A 1XMBA 2AGQA 3M8PB 1JQGA 2LVWA 2CNLB 3AB2B 3TQEA 4DLGA 3AA9A 4ED6A 2MYFA 2RRAA 1LWCA 2QLBB 2HZVA 3ZZZA 1FFSB 2APOA 3UDEA 1R8AA 4G1QA 4JI8J 4ZVHA 2D3OR 3GIMA 3IGNA 3HHLB 4CLLA 2YWGA 4P7VA 3AOCA 3QAUA 2V34A 2RS8A 3OJSA 2G9OA 1WEXA 3QBCA 1YRUA 2DGSA 3AY0A 5F8IA 1U1NA 1GMWD 1RP5A 2G2YA 4DR4J 1TVRB 2HWIA 4UOHA 3H5UA 3UD4P 3IM8A 1S48A 1HLWA 2XS7A 2OAUA 4RNNA 2A2CA 1RTHA 2FVCA 1Y3JA 1VQKS 4DPXA 1N6QB 2E44A 4JI3F 1PKUA 3QATA 1UL3A 4CLPA 4JBCA 4B3OB 5ETRA 1QAXA 3HHLD 2ZH3A 3NWGA 1RCOB 2R2RA 1MWQA 1FF2A 4KQZA 4LRDA 1JB0C 4WYWA 3MMAA 2GS8A 1KC8T 3UR0A 1RXOB 2QA1A 3CO9A 2AJ2A 2GIFA 4O44A 1KTVA 2DTJA 4N76A 5KFRA 3NNCA 3QIDA 4I6WA 1JJ4A 4NXMJ 2ILZA 4NEYA 1YJVA 1YBAA 1TR0A 4TU9A 5C25A 2QIFA 4USMA 4ZPVR 4C98A 4YDDB 2HAIA 1Q8IA 3OD2A 3GU0A 5L38A 1SIWB 3GIIA 2W2PP 1L5UA 3I9ZA 4UOCA 4OX7A 1J2VA 3TQ1A 5EX3A 3KHLA 3PO4A 1NK7A 3GE9A 3LP0A 4WK3A 4OFZA 2UXCJ 1EARA 3T1AA 4LF5J 1EZZB 4KGXB 1FESA 1S7IA 1G7CB 3A8KA 3ENQA 1S1UA 4ECYA 4ZJOA 1LFPA 4WKYA 4ZN3A 2K3IA 2YX4A 4M5DB 3PJ9A 3OXFA 3U1MA 3ZTQA 1A9NB 3HVRA 1XMQF 5B0CA 2MKHA 3QFHA 1UPMB 3V2UC 2DGXA 3Q24A 1JLFB 1S6OA 1RAAB 4WK1A 4H4OA 1M90T 4U6PA 1DJ0A 2KDOA 4OI6A 4HACA 3OV7A 4LFAF 4ED5A 2FYXA 4NI2A 2C2OB 4XO0A 4MKVA 4X4QA 4X4VA 1TP7A 2W9CA 5FDLA 4GKJJ 2L9NA 4NLUA 2W01A 1QVFR 5J2NA 1X5TA 2JJ4D 2LQ5A 2LLZA 1T95A 2HWTA 5L39A 4JI1F 4FPRA 1WI8A 5E0OA 1T11A 4UF4A 4U9RA 4X62J 4EI2A 1FE4A 1T9YA 2IYGA 2FPHX 2HBRB 2A0FB 3HSZA 2PD1A 3K8VA 2HMIB 3I0SB 1KHWA 1LKZA 4NLPA 4EU0A 1DQ9A 3PKMA 1FXLA 2CKWA 4JI7F 3KUEA 1IN0A 2ZNYA 3SSSA 3THPA 4A47A 4FF4A 1LWFB 1T03A 2QJ3A 3CJKB 1N5TA 1VYAA 1REVA 2L08A 1NSAA 4CLWA 3UE2A 4F26A 2YX7A 1RYSA 2HS3A 3WBZA 4DV3J 3D6TB 3O44A 4QW8A 2W4PA 3MMJA 2M52A 2OSQA 4YFUA 2V9KA 2V4JB 1JK9B 1VHFA 4DXLA 1BWEA 4KPYA 2K7JA 2DGVA 2MPUA 2E1CA 2UU9J 3BGFA 4Y2IA 3V4IA 2VC0A 1JLBB 4LT6A 3ISND 2KXNB 4CTAB 2CPZA 3IGVA 3AQPA 1H7WA 4K0KJ 5J1EA 3EMTA 1LEOA 2MZTA 2LKZA 2R4FA 4Y3CA 1R89A 4CDIA 1OS5A 3D28A 3TYTA 4RNMA 4NXMF 2VC1A 1N0VC 4DX6A 2XULA 2FJDB 2DHXA 1YJUA 2RD5C 2ABYA 3AT1B 1BWVA 2DBBA 2EFQA 1TKZB 3W63A 2CYYA 3HHEA 3OW2R 3V6HA 4I69A 4RNHA 4B9NA 2J9CA 3RR8A 3KHHA 3OT9A 2HIQA 2J9DE 4KGVB 4ECUA 4IDKA 1NH8A 1Y0HA 3EZOA 3BBBA 2OPPA 2IRUA 4DV1J 4NA2A 1YZ6A 4M94A 2HQDA 4Q44A 1TL1B 4M5JA 1F5BA 1VRTB 1YITS 2BE9B 2CNKB 2MHNA 3D0GE 2MLYA 3PTWA 2AU0A 2I8EA 4F7VA 4EO8A 1SQFA 2BMBA 1S4EA 2JL9A 5IV4A 3PIOQ 3FRYA 2HS4A 2W2QP 1RWNB 4ZVQB 2F65A 3W60A 3QGGA 2DHHA 3OLAA 3CE8A 2W8LA 2V8PA 3FSIA 5DGBA 4UQGA 2MQMA 3MM5A 4U7UD 4C2MA 4JV5F 2YKNB 1Q7LB 4YY3F 1KVJA 1XC9A 5EN1A 4NWBA 4Y28C 2I9SA 2OPRA 1AA1B 1P1TA 2FHMA 1S1TA 3UDLA 4OHZA 2CPIA 4F4WA 3T1YJ 4FYVB 3PNIA 3EJMA 3G82A 2V8GA 1TK5A 1UVLA 2XQCA 4ZP6A 4DG1B 3HK2A 3H59A 1N33F 3AD8C 3HM9A 5A76A 1CJTB 4NLGA 4LVOP 2IC3A 2BEFA 1UWAA 4DV5F 4YB1P 5F8MA 1HNWF 3N01A 2CJKA 5BR8F 3M2RA 3HP6A 4RW7B 1VK8A 2DNNA 2KYXA 2NQPA 5B0FA 4H4MB 3HO1A 1JLCB 4ILRA 1PBAA 4KKOA 1WOOA 2GGPA 2RDDA 2AEFA 4CH0S 2FGOA 1NHKL 2CQIA 1VGYA 3FGVA 1XR7A 3E01B 1WNEA 3P6YC 3MM7A 4N5SA 2BKNA 3BGLA 1IKVA 4AL6A 4NYOA 1RE1B 4ZHRA 2UV8G 5HMYA 3HSDA 3J7ZT 4YR3A 2G13A 1M5VC 2FLLA 2CZ9A 2RQ4A 3TAQA 3W9HA 4NYPA 1KDNA 4JI5F 4DSEA 3PHEA 1O8BA 3AD9C 3CD5A 2XCAA 3S8SA 2FHJA 4WCEQ 2V9WA 2HSEB 1F5AA 2YWKA 2VH7A 4DV4F 4LVNP 2HG4A 1S1XA 1WC1A 4PWDA 1WSRA 4EYIB 2ZOGA 1DURA 4V19X 2CG4A 1SH3A 3B6BA 1M5OC 1RT1B 4C0OC 2HRTA 4ILLA 4LF7J 4U95A 2IBKA 2NXEA 2D3UA 2YTCA 1ZS6A 3GCWP 4ES1A 3G6ES 4EMDA 1MROA 2V0NA 2I5JA 4PXBA 2GVZA 1UKUA 1S1VA 2O66A 1X4DA 1VLYA 3ZTSA 1RTDB 4P75A 2XMMA 3OHBA 4G6VB 4F8RA 4A4JA 2Z56B 4L72B 2W2OP 2HURA 2AJFE 1NM2A 1SH2A 2JEJA 3HHNB 1YGYA 1NSPA 3SV3A 1B3TA 3R6GB 3OL7A 2E1AA 2IAJB 2HQIA 4IG0A 1YRXA 1MN9A 3G8TA 3CCTA 4LF8F 1NDKA 2HZCA 1ZM4A 3MGJA 3LALA 1UEVA 1VDHA 3FSYA 4B3RJ 4M5KA 1S99A 2P8IA 1N32J 3KLHA 2JC0A 2HHTA 3BO4A 1NO8A 2EPIA 2DRAA 2LQJA 5D0EA 4LRCA 4ED4A 3ILJA 3CCWA 3M32A 5F8GA 1U6BA 3EVMA 3UN3A 1VI7A 2KRRA 5FLXU 2WRMA 3GPAA 3DLKB 2W7OA 1T0TV 4A8QA 4O3NA 1RT5B 1U1MA 2E9TA 4X66J 1SVDA 2GQ2A 4HTJA 2MKSA 3TJAA 3HD2A 4R25A 3NKYA 4ATNA 1S6PA 2AZ3A 1D1UA 4EK2A 1Q8KA 4JI0J 1UWBB 1R27B 4DV7F 3V6DB 3P96A 1JLQB 3DLJA 3P3DA 2MQOA 1VQPS 5J2MB 2PGCA 3TX0A 1YJ7A 2OMLA 2XGPA 4IUFA 1RA7A 1R8PA 4PQUB 4TYAA 1ZA2B 3BSAA 2J7KA 3G71S 3A8IA 1NH7A 2Y1JA 1L3UA 3F41A 2J7UA 1HR0J 2OKQA 1H7XA 5A8KB 4N8NA 2VA3A 5M2PA 4F4ZA 4CWBA 4X65F 3QZ7A
chains in the Genus database with same CATH topology
2J6UA 1KONA 1MROB 1MMNA 2HWHA 4DMZA 2ZJQQ 4MFBB 2ATLA 4FF2A 2YNHB 3ZZUA 3N6NA 2I5JB 5E3PA 2CPEA 2RE1A 5KT7A 2B4UA 5FIIA 4I7FA 1HI8A 2CDQA 1KRPA 1N48A 4DR1F 1S1VB 4RWXA 4C8ZA 2IMWP 1E6YB 2MY7A 2OPSA 3LGNA 4A8OA 1Q7YT 4KTQA 1X8DA 2XWXA 5E7OB 2ZH9A 3SZ2A 2MMYA 5D3GB 3DLBA 1KLMA 4CIOA 4ZPBA 1NJYA 4N41A 4ZA1A 1XEZA 2R7XA 4QU7A 1UFLA 1L3VA 2CJQA 1K1SA 2ZHAA 1Z2ZA 3EXYA 4UY85 2EFVA 4JUZA 3KLGB 1JXEA 4EZ6A 1YQHA 4QWBA 2ZC3A 5KFJA 3SQGA 3C8YA 2O5DA 5F0UA 5IZHA 4DLEA 5GAHU 1BC6A 4DR5F 3M9OB 3K57A 1HQUA 2LCWA 4B17A 3OL8A 1X9SA 1ZZNA 1FJEB 3QJPA 3PZPA 4PPDA 1GXLA 4TLRA 1MMLA 1ZZFA 3TVZA 1X9WA 3MURP 1VQ8S 2AYBA 1DQ8A 3MM6B 4J9MA 1NKEA 2KHCA 3OR2B 3V6JA 2ROGA 3SCJE 3DNCA 4FVCA 4USHA 1PSDA 3WZ0A 3VAFA 2P9EA 2E5JA 2LDYA 1ZAXA 2D7SA 2DIUA 2J9DA 4F67A 5B0EA 2XC9A 1GT8A 3T5KA 5LXRA 1QLNA 3D2WA 1EP4A 4EZ9A 3VZIA 3J7A1 1TL4A 4LSNB 4IG0B 4O3RA 4R0JA 2DNKA 4KSEB 5HP1A 2OTLS 3SFGA 2NREA 2Y1IA 1T05B 4DL7A 5HLFA 3BR8A 2HHXA 3DLEA 2VFSA 4X84A 1BGXT 2MZSA 1QE1A 1FA0A 1L3KA 2XS2A 1JJ2R 3J7YI 1FXDA 2AGOA 5HBMA 2HLTA 2RIJA 4OX9F 2JLGA 3PKYA 4H4KA 5CCLA 3G6XA 2BE2A 4CO4A 2B5JB 3NP5A 4WU3A 2UUWA 3MPWA 5J2PA 2B4OA 1TL3B 1IUJA 4BDPA 4R5PA 2GA7A 3G6YA 4D3GA 4ID5B 5L8RC 5AE2A 3MXHP 3IA0A 3SSQA 2EI5A 5IQQA 2L3MA 1CLFA 2I0XA 1GXUA 3I55S 4DDFA 2RDIA 3JSBA 3X3UA 1NEEA 3G96A 2WSEC 3KTQA 5U47A 2CQDA 2RQKA 4EUVA 4JV0A 4LF6F 2UXCF 1N8RT 3M32B 2DCUB 4LF5F 3F56A 3CPWR 1KQFB 4C3LA 3GMGA 3IWNC 2HVZA 2D9OA 2KXFA 3I5CA 4C97A 3GILA 3KJVA 2DNPA 2K1RA 1WACA 2O01C 5DDQC 1T3NA 2EG1A 2YWFA 3PO5A 4EFAC 2X1AA 2PN6A 2AP6A 3CB4A 2QYCA 3N28A 3RAQA 4DL2A 2XSFA 2Z2MA 3FCHA 2B9XA 2VKRA 1HD1A 2X1BA 1D9FA 5K5MA 3GV8B 4I2QA 3HHDA 3MD1A 2UVRA 4LSLA 3UWTA 2HVIA 3AH6A 1WF2A 3A8EA 4OJHA 2F9DA 5DO2A 2JEIA 2R8IA 2I1RA 2OMOA 1QSSA 3KLEB 2KH9A 1KLNA 3MTJA 2IFXA 5KG5A 3MECA 1TK0A 2F7VA 1W25A 2NSCA 5KFVA 2FIUA 1FNOA 2J6TA