4IG3B

Hiv-1 reverse transcriptase with bound fragment near knuckles site
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
424
structure length
416
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 125
structure length 416
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ig3B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig3B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig3B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig3B03
1YVFA 2W8KA 3GV8B 2OPPB 2XI3A 4IH5A 4O4RA 1JX4A 1BQMB 4M94A 3V6KA 1N48A 4TYBA 3TAMB 1KLMA 4ED0A 1LW0B 4ECXA 5DLFA 1LWFA 4O4GB 1EETB 2RDIA 2B6AA 5KFRA 3DI6B 3C6UA 3H59A 3DLKA 2JEJA 5HROA 1IKXB 4NLTA 2QV6A 1SH3A 3CJ0A 3GV5B 1JKHA 4ECRA 3H5SA 1LWCA 3T5KA 2XI2A 4X2BA 3DLGB 2V4QA 3TQ1A 2V9WA 4XO0A 1S0NA 4K4SA 1HNIB 3DYAA 4K4XA 5KFKA 3M8PB 4J9LA 1RYRA 3NBPB 2BQUA 3E01B 1RTDA 2WB4A 4PWDA 2XGQA 2BR0A 4O3RA 3DRSB 4I2QB 1IKWA 2WOMB 3FFIA 4U7CA 2JEGA 2WRMA 5KFTA 4R5PA 2W7PA 2W9CB 4RW8B 1S1TA 4O44A 1XR7A 4ID5B 3V6DA 4Q43A 1TKXB 2R2TA 4RUAA 2HWHA 4H4OA 3QLHA 3D5MA 5F8GA 4ED7A 3DOLB 1EP4A 2FVQA 2UVUA 4KE5A 4IRCA 2AGPA 4WXWA 4B3OA 1C0UA 5KFFA 2FJVA 2UUTA 1S0MA 2CJQA 4URSA 4GC6A 1KLMB 1LWFB 1S1XA 2B6AB 1HNVA 2BE2A 1C1CA 2YKNA 5HROB 4Y3CA 2ZE2A 5I3UA 1JKHB 4RNMA 1LWCB 3DMJA 4ECYA 4ZP7A 5F8JA 2IAJA 2IJFA 3MEEB 1RT1A 4LSLA 5KFWA 3DYAB 3KLGB 4KO0A 2C28A 4TN2A 5FDLA 2ASLA 3CVKA 5KT7A 3I0RA 2VG5A 4MFBB 3I5AA 5DLGA 1J5OA 1RT4A 1RTDB 5DQHA 1T94A 4Y2AA 3MR6A 1IKWB 3CDWA 5KFVA 5KG7A 4IKAA 5D3GB 4R5PB 1HARA 1RT7A 4RUCA 4O44B 2AQ4A 3V6DB 3QGGA 4ZMMA 3DM2A 2OPQB 2YKMA 4I2PA 3OHBA 3MEDB 3QLHB 4H4OB 2IM2A 4NLWA 4WYLA 3LAMA 4ZVFA 3H5UA 3QZ7A 3GYNA 3PHEA 3H5YA 1EP4B 1RTHA 4LQ9A 4PUOA 5L1KA 4NLYA 3CDUA 4B3OB 5KFOA 3N6NA 3Q8RB 1C0TB 1S6PA 2XGPA 2E9RX 1FKOB 1JLAB 1S1XB 1HYSA 1HNVB 5KFGA 2BE2B 4WZMA 1C1CB 4JV2A 2YKNB 4NLVA 4ECZA 3BGRA 3FDSA 3RAQA 2IBKA 3KLHA 3DMJB 4NZ0A 3T1AA 1IKYA 3NAHA 2IAJB 1NHVA 2EC0A 4ZPCA 3MF5A 4LSLB 4PQUA 1XR6A 3M9OB 4KO0B 4NYZA 3UPFA 5KFYA 5FDLB 4RW4B 1N5YB 3BSOA 4G1QB 2IC3A 2VG5B 2FVPA 1J5OB 1RT4B 3PJWA 3UQSA 5KFQA 5DGBA 5HLFA 3V4IA 4J9OA 5K14A 2IM3A 3KLEA 1TL3A 3IRXA 4TYAA 4Y34A 3SFGA 3RAXA 4GC7A 1T05B 5KFUA 2V4RA 3BQ2A 2C2EA 1RT7B 3M9MB 3IG1A 3C6TB 5J2NA 1DTTA 3OHAA 4NLDA 1HPZA 1SV5A 2YNGA 2YKMB 3KLIB 3QIPA 4RW6A 2BANA 4ZHRB 2ILZA 4I2PB 4RU9A 2HNYA 3QIDA 4RNNA 5C25A 4XPCA 2FJWA 1DLOA 1LW2A 1W25A 4IFYA 5KG0A 1RTHB 4ZPDA 4PUOB 4KAIA 4RNFA 5DQGA 5KG1A 4ZVHA 1TL1A 4MK9A 4NLSA 4KHMA 5JUMA 1S97A 5F8LA 3HVAA 4J9RA 1QAIA 1S9GA 1NNDA 5KFPA 5L9XA 3KLFA 5KFJA 1QE1A 2W7OA 3RB0A 2JLEA 4NLGA 3V81A 3KK1B 2D3UA 2W9BA 2ASJA 1RT3A 3T5HA 4RW7B 5EWEA 1HQUA 3PW4A 4PQUB 3Q8QB 5F8IA 3DDKA 5KT6A 4J9QA 1JLQA 3PR5B 3CIZA 2BQRA 4EBCA 3CJ2A 3MR3A 2IC3B 1S4FA 3PVXA 2J6SA 3M8QA 4ECQA 3KHRA 4JV1A 5J2PA 5KFZA 5K14B 3KLEB 1JLEA 1TL3B 4FBTA 2AX1A 4ZPAA 2HMIA 2YNIA 2E9TA 5J2NB 3Q8SB 1ZTTA 1HPZB 4RW6B 3NL0A 1JLBA 3QIPB 4IFVB 1TKZA 1RA7A 2HNYB 1K1SA 3HVWA 3IN5A 1UWBA 4TQRA 2E9ZA 1JLCA 1LW2B 2ZKUA 1S1WA 4IFYB 4ECTA 3H40A 4K4WA 4RW9A 5HBMA 4J9PA 4TLRA 1RT6B 2XCPA 1XR5A 1TKTA 4YP3A 2XC9A 4ZP6A 1S9GB 4IR9A 4J9KA 1JIHA 5KFAA 5KG6A 5EWFA 4EO6A 4YQWA 4K4TA 2JC1A 3DRPA 3MEGA 3CO9A 2W9BB 4K4YA 3BSNA 3GV7B 4Q0BB 3KHLA 3LANA 5CYMA 3LAKA 1HQUB 2I5JA 5C5JA 2OPSA 3FQLA 3ICLA 4IG3A 1R0AA 4WZQA 3DLEA 4IRDA 1RA6A 1JLQB 3RB3A 5DG7A 5C24A 4EO8A 3M8QB 3C6UB 3DRRA 3DLKB 4LQ3A 1IKVA 1U09A 2O5DA 4NLOA 1MMLA 1OS5A 2HMIB 3E51A 2AGOA 5EWGA 1TV6A 4KB7A 1TKZB 2C2RA 2VG7A 1RT5A 5KFBA 1UWBB 1D1UA 5DG9A 1JLCB 1S1WB 4K4ZA 5KFEA 3CJ4A 4PWDB 1RAJA 2HNZA 5HBMB 1BQNA 1S0OA 3FFIB 1S9FA 3BR9A 5F8HA 1TKTB 4KFBA 2UUWA 3KOAA 4YMEA 1S1TB 3QZ8A 3OL6A 3G86A 1HMVA 3PW2A 2ALZA 4KV8A 3DRPB 3MEGB 1JXLA 1RTJA 3PZPA 3DOKA 5CYMB 3N6MA 4WXOA 4ED6A 4NLXA 3GIMA 4IDKA 5HP1A 3BSCA 4EBDA 2I5JB 2HNDA 4URGA 2OPSB 2IA6A 2GIRA 4J9NA 4IG3B 1C0UB 4WYWA 4IH7A 3VQSA 2R8KA 3HKWA 4QW8A 4DG1A 3T5LA 3N6LA 4O3SA 3FSIA 4NCGA 4KBIA 3H2LA 2ZE2B 5KG5A 4IG0A 4Q44A 2HWIA 1VRUA 5I3UB 3OL8A 1DTQA 5KG4A 4F4WA 4ECVA 1T03A 4J9MA 3I5CA 1TV6B 1RT1B 1IM4A 4QWEA 3T5JA 4O3PA 4M95A 4MH8A 3PR4A 4J9SA 1TVRA 4ECUA 3I0RB 1RYSA 2OPRA 4H4MA 1N6QA 3BREA 5L1LA 1ZTWA 5CYQA 4ECSA 4F4XA 3KK2A 2HNZB 4KHRA 1BQNB 1VRTA 2VG6A 3LP2A 2R8HA 2FVRA 4OL8A 4NRTA 5J2QA 1KHVA 5KFSA 4MIAA 4NLRA 1HMVB 3DM2B 4TQSA 4KV8B 4F4ZA 5F9NA 1RTIA 2RDJA 3IS9A 2WTFA 3DOKB 4Y2CA 4F4YA 4ED3A 1T3NA 2J6UA 2HNDB 3KMSA 3RB4A 3H4BA 2IMWP 2GC8A 3QYYA 5KG2A 2JEFA 3TAMA 2JEIA 1S6PB 3QO9A 5KT4A 3G6XA 1RDRA 4MKBA 1EETA 3BJYA 2DPIA 1HYSB 4ED8A 2FVCA 1REVA 2XCAA 4NCGB 2BRKA 3MTKA 3BQ1A 3BGRB 4IG0B 3LP1A 2JC0A 1VRUB 3FRZA 3KLHB 3I5BA 3DLGA 5J2MA 1IKYB 1QAJA 5T14A 3SFUA 3PW0A 1JLGA 2V0NA 3PJXA 1FKPA 1D0EA 4TY8A 1HNIA 2YNFA 3NBPA 5EDWA 2OPRB 2RKIA 4H4MB 3NAIA 2CKWA 4R8UA 5KFLA 5CYQB 5HLFB 3V4IB 3DRSA 4I2QA 3KK2B 2D41A 3IGNA 4DL4A 4Q8EA 1C1BA 1VRTB 4YR2A 2I1RA 3LP2B 3IRXB 2C2DA 5DQIA 4JV0A 5KFCA 4EEYA 1ZETA 4ZP8A 3IG1B 4O3NA 3OSPA 3GIIA 5J2QB 1DTTB 1SH0A 3NGDA 2AGQA 1SV5B 2YNGB 2OH2A 4FBUA 4XPEA 3KHGA 1RTIB 2BANB 4I7FA 4DL6A 1LWEA 4HKQA 5C25B 2VA2A 1DLOB 4WFYA 1TP7A 2YNHA 4KSEB 3GIKA 3H4DA 4FS2A 2FLLA 2WHOA 1TL1B 4QW9A 3G6VA 2FLPA 3QO9B 3OL7A 1S48A 1S1UA 5KG3A 3SI8A 3KLFB 3JSMA 1N4LA 1QE1B 1REVB 2GIQA 2W8LA 1FK9A 3LP0A 3OL9A 4DL7A 4WE1A 3V81B 3LP1B 4H54A 5DG8A 1RT3B 3ITHA 5KFMA 1JLFA 5J2MB 4K4UA 3PW5A 3IGVA 4U6PA 1JLGB 3MEEA 2F8EX 4IR1A 1FKPB 4MKAA 4TY8B 3KLGA 4QPXA 3Q8PB 5C42A 2YNFB 3H98A 2B43A 4TXSA 4QWCA 4MFBA 5I42A 5KFNA 3MR2A 2RKIB 3MFIA 4R8UB 4IQXA 4IRKA 1I6JA 1S10A 2R8IA 3KMQA 2J6TA 5J2PB 1C1BB 3GQCA 5D3GA 1JLEB 3OSNA 5EUHA 3HHKA 2YNIB 3EPIA 2ASDA 1S49A 3OLBA 4HYKA 2OPQA 1JLBB 4I7FB 4ICLA 1LWEB 3MEDA 2WONA 3CJ5A 3KK3A 4DL2A 3KNAA 1N56A 2BRLA 1S6QA 2YNHB 4RW9B 3KHHA 4EBEA 1C0TA 4ZPBA 4ZP9A 1FKOA 4QWAA 1JLAA 1MU2A 4NLPA 2QE5A 3MFHA 1S1UB 3JYTA 3QGIA 3JSMB 3RBDA 2C22A 3HVTA 4G3IA 1FK9B 3LP0B 4WE1B 3ITHB 2HAIA 5L1IA 1JLFB 3KJVA 4EYHB 3CDEA 5KFXA 1S9EA 4MK8A 4RZRA 4EYIB 5C42B 4KKOA 1R0AB 3DLEB 1K1QA 3MR5A 1HQEA 4RW4A 1N5YA 4R0EA 3QGHA 4G1QA 5I42B 1CSJA 5C24B 4YR0A 2D7SA 4ECWA 1GX5A 3NMAA 2R2UA 4ED2A 3DRRB 2ZD1A 3V6HA 2FLNA 1IKVB 4LSNA 1T05A 4FS1A 3KLVA 3M9NB 3C6TA 5KT2A 4ZVEA 4Q8FA 3KLIA 4ZHRA 3D28A 2IJNA 4DL3A 2AX0A 4ICLB 5KT5A 1RT2A 2WK4A 1SUQA 2VG7B 1RT5B 2WONB 1SH2A 3CJ3A 3KK3B 3BSAA 2XWYA 1S1VA 1S6QB 3I0SA 2B5JA 4WFZA 3EPGA 4K50A 2RF2A 4KFBB 1MU2B 5KFIA 3UDLA 3JYTB 5J1EA 5L1JA 3HVTB 3BQ0A 2AU0A 5JXSA 3KK1A 2WCXA 5F8NA 4YR3A 3MECA 2UVRA 1RTJB 3KJVB 3CWJA 4NLQA 4RW7A 4RNHA 3G6YA 4K4VA 3EZUA 5F9LA 4WFXA 4RNOA 2R8GA 4IDKB 5HP1B 1QUVA 4JUZA 2FVSA 1S9EB 3NKYA 2OPPA 4Q45A 4ZVGA 1BQMA 4KKOB 4TY9A 3PW7A 3RBEA 3ISNC 1HQEB 4NLUA 4O3OA 1LW0A 1NHUA 5KFDA 2VA3A 4O4GA 2UVWA 3H5XA 4DG1B 3DI6A 3ISND 2ZD1B 2D3ZA 1IKXA 4ED1A 4DL5A 1WNEA 1KHWA 4LSNB 2R2SA 1DTQB 5F8MA 1T03B 2R8JA 3GIJA 5KT3A 4QWDA 4QWBA 4MK7A 4DEZA 3RB6A 4IFVA 2W9AA 3TVKA 1RT2B 5DGAA 1SUQB 3M8PA 2ILYA 1GX6A 1TVRB 1S1VB 4O3QA 3E01A 1N6QB 3I0SB 1C2PA 2B5JB 2R2RA 4F50A 2WOMA 2FJXA 1RT6A 2IM1A 2VG6B 3V6JA 2UVVA 4MIBA 2RF2B 4URQU 2W9CA 2DPJA 4RW8A 5J1EB 4NRUA 4ID5A 1Z4UA 1TKXA 3FQKA 2AWZA 3MECB 3GILA 3LALA 3IS9B 3UR0A 4Q0BA 3T19A 4IOBA 4IH6A 3DOLA 2IM0A 2ATLA 1TQLA 3OLAA 5KFHA 2BQ3A
chains in the Genus database with same CATH superfamily
2HRYA 4F7VA 1VQ7S 2B6AA 4HLBA 1T95A 3H5SA 2HG4A 1VLOA 2DITA 3ZFVA 1YRTA 4J9UE 2XGQA 4I2QB 2QL9B 5U47A 2V68A 4RUAA 2CA9A 3DGVA 2LKZA 2KM8C 3K17A 2BOAA 4ZIWA 2MZJA 4DS5A 1PCAA 4ZP7A 2DNHA 3KLGB 4USMA 2RE1A 3I5AA 4ZOSA 5FLXY 2V9KA 5KG7A 3LGHA 1NUEA 3HFKA 4J90A 3LAMA 4LQ9A 3MI7X 5L1KA 3N6NA 1S1XB 2BE2B 1MW7A 1WELA 4KGKA 4FPRA 2DISA 4A8WA 3U1MA 5HL7Q 4WTYA 4DFMA 5ETVA 1TL3A 1WWHA 7FD1A 1IJFB 1ZH5A 1IQTA 2EG1A 3M7VA 4FVCA 4KHPJ 4WP9A 4LF5F 4PUOB 4WIQA 4P7TA 2ZWPA 1QE1A 3D7SB 3CCTA 4F0MA 1RQ0A 2L41A 1S7HA 2RNEA 3Q8QB 2DH8A 2ZZMA 3AH6A 2OSQA 2AYBA 2GFFA 4JP8A 5E33A 1WOPA 4DLGA 2N82B 4U96A 3IN5A 5HVGA 1SC6A 3M6WA 2MMYA 3I31A 1NMEB 2P5VA 1S9GB 2C2ZB 4YQWA 4K4TA 4Y2MA 2DGSA 2CYYA 3KHLA 3AOCA 4M5MA 5CCMA 3RGIA 3MMAB 3KDOA 1OY8A 2HHXA 5T7LA 2X3GA 4TKTA 4LQ3A 2HMIB 4DSEA 3DNCA 5EWGA 4KB7A 1BD6A 4CRJA 3D68A 3RG6A 3CD0A 1L3VA 2GVZA 3QZ8A 4FP9A 1HHQA 1RZMA 4JI2F 2CFXA 3HHDA 1E6VB 3FSYA 1OJ4A 1AUSL 2XSJB 2R8KA 4JB8B 5EX0A 3DC2A 1IM6A 4LR9A 3U02A 4IG0A 1DTQA 4USWA 3LWLA 2R7VA 3I5CA 1GMWA 2WB1D 2MY8A 4EU0A 1ZTWA 1WI8A 1NJXA 5MAOA 4Z2XA 1YBUA 3K57A 2VG6A 3R1LA 4RL1A 3PIOQ 4OL8A 3PRBA 5J2QA 5KFSA 1HA1A 5J1NA 2P9CA 3MDFA 2Q6CA 1KOHA 2XMTA 5A2QU 2WBMA 3TAMA 3GLJA 1XNRJ 4DV4J 2VD3A 1YIJS 2YWWA 1LWXA 4P2FA 3PW0A 1FRMA 1VC0A 2CQ1A 3S01A 2RKIA 3Q89A 3IGNA 2RH3A 4KJIA 4PABA 2U1AA 2ADBA 4WCEQ 4DR3F 1CJVA 3WDOA 1F3VA 3K8VA 3Q22A 1S1UA 3T1HJ 1N4LA 2XO6A 4X4NA 4K4UA 4UQGA 4TY8B 2MGZA 2J0QD 5IWAJ 3VGVA 2PDAA 3G6ES 3FMWA 2B4PA 1U1KA 2F4FA 3W8PA 2ASDA 4HYKA 3OLBA 4ICLA 4WBFA 2KXNB 1JMTA 2HFUA 2AIRB 4DV0J 1JLAA 3JSMB 3LP0B 2RSQA 2QJ3A 4DFJA 1PSDA 4G1PA 4G65A 4RZRA 1AB8A 4Q8EA 1BWEA 5I42B 1CSJA 3HHEA 2JRSA 2B9WA 2R2UA 3GMGA 4W92B 2WVDA 1KP6A 4NA1A 5D0RA 4X65J 2GAHC 1VOMA 2YKQA 3C8YA 2RF2A 4M5DB 5L1JA 3KK1A 5F8NA 2H3EB 4DR2J 3G6YA 2VPYB 1B0TA 4KH1B 2EPIA 2FHJD 5KTQA 4ID8A 4O0NA 1N32J 2CG8A 1A9NB 3H5XA 1ROFA 4B08A 2GO9A 4JI6F 1VQLS 1AUDA 3M8PA 1GX6A 2IIHA 3JSRA 4NMLA 1KKHA 4JI4J 3FQKA 2VH7A 5F3TA 2ATLA 4IH6A 1MN9A 1X60A 3M2UA 5B0BA 2AF6A 2PA8D 4M94A 5CD4H 4L75A 3MAAA 1LW0B 4AFFA 2E7XA 2Z8QA 2WVEA 4LF8F 1IBMF 4X2BA 2AEJA 1M5SA 2HQIA 3SQGA 2BACA 4CM0A 1FJ7A 2MDAA 2JEGA 2BJ8A 1RCOB 3CCRS 3RRKA 4DSJA 3CMQA 1WG1A 2YX7A 4X66J 4DCPB 2FJVA 2DO4A 2QFJA 1AT1B 2YH0A 2MHNA 2W25A 2XHWA 2ZH8A 3DMJA 3O8WA 2NPFA 4C48A 3DYAB 1WHYA 3CVKA 3I0RA 5HJXA 1NPKA 4DX6A 3D2WA 4RUCA 2M52A 3V6DB 3EWGA 2OPQB 1Q4RA 2IM2A 3AB4B 1Q78A 3KUHA 2DR7A 2GNKA 1NJYA 4B3OB 4WZMA 2GJ2A 5L38A 2CPXA 3OR2B 3G71S 4CO2A 1RWWB 1N5YB 3B82A 1HNWJ 3PM9A 2KKHA 4KGMA 4ECWA 3N5BA 3VGUA 5A0YA 3MPUB 4FF4A 1N33J 4S0MA 1XK8A 1N88A 3O3LA 2MSSA 1YSJA 4DV7J 5KFJA 1WOSA 2K3IA 4QIVA 1WJ9A 3WQPA 2ZKTA 2KYZA 1XMOJ 2V2KA 3ADAC 2OELA 1Y0HA 3K8WA 4EBCA 5J2NB 5G0RA 1UTAA 3HVWA 1PKUA 2OEKA 3AHPA 3OBIA 1JLCA 2ZKUA 3EMTA 1UZDA 4P10A 3GE9A 2E1PA 1RT6B 1XR5A 4ZP6A 5KFAA 2B51A 1F1BB 3MMBB 2V8PA 2BJ7A 3M30B 2G2OA 4DDFA 3UO0A 3VGSA 3W2WB 4LMZA 4FDFA 3POTB 4LBIA 2E1CA 5CABA 2M8HA 4ELTA 3K89A 1UW9A 4YY3J 2ALYB 3ET6B 3PW2A 4EUVA 2L9NA 2OKQA 2PI4A 4OV6A 2FLOA 4ED6A 4IDKA 4HVZA 4IH7A 3P96A 3LPYA 3H2LA 1C4CA 1U0HB 3CJRA 5KG4A 2HHVA 2P9EA 4H4KC 4MH8A 1N6QA 2Y0BB 4KHRA 1BQNB 3OFFA 1RGVA 2PT0A 3PDNA 4ATNA 4HI1A 2EWHA 4LFAJ 3MPWA 4RWWA 4A8YA 2JEIA 1L3TA 2RS2A 4ED8A 3VAKA 4CLKA 3CJKB 1RWXB 4F0HA 1ZAXA 5DZ7A 3FEXB 3AOAA 5KFLA 2KJWA 3NAIA 2CKWA 5CYQB 2N4DA 3V4IB 3KK2B 3AJ1A 3OT9A 5GMEA 1Q0NA 1U8SA 3DRYA 1DTTB 4K50A 1YHQS 1RU2A 1FJEB 4HKQA 3JTNA 2VA2A 1EARA 4JOUA 4A8QA 5GAGI 4J91A 3BBBA 3HCXA 1G6BA 4H54A 3EJMA 1PYOB 1IBLF 5C42A 2KTQA 2LQJA 2GA7A 1I6JA 2M9KA 3TAPA 4B3RJ 1JLEB 5IV4A 1TELA 2J0WA 4DL2A 4DFKA 4BLGA 1MU2A 2W4CA 5K20B 3JYTA 3NOCA 5L1IA 2HAIA 3TNVA 2D9PA 2J7UA 4M1KA 1KBRA 4G1QA 2ZH1A 3J80Y 2UUAJ 1RAHB 1F5BA 2EFVA 1VK8A 2E5GA 3FJ2A 2LCWA 4AQYF 2M70A 5EX3A 1S6QB 4DR5J 4XK8C 3F44A 3BH7B 2AJ0A 5J1EA 1VMBA 1SC3B 4Y6IA 3L3CA 3S1TA 1NHUA 5DDPC 4JI1J 4JI0J 3BF4A 1H7XA 2FZCB 4JI5F 4USIA 3W65A 3W7BA 1QY7A 3VAFA 1PAUB 3LALA 2DXFA 2IM0A 1ULRA 2IYGA 5A8WB 2DH7A 2E5JA 2H5IB 3CCVS 2DGTA 1MSWD 2PFDA 3ZC4A 3QJLA 1OMSA 4ZA1A 1SQEA 2BVZA 3BYRA 4U7UD 2W7PA 1NH7A 4HACB 3MM8A 3QLHA 3JQKA 1X4BA 1C0UA 5M2RA 1FT8A 2QC3A 1X8DA 4URSA 1KLMB 2ZITA 3BPDA 1ZM2A 3SCKE 4MKVA 1LWCB 3Q8VA 4UY85 4CT9A 1P9QC 2DNQA 4B3SJ 5DQHA 1T94A 3U7JA 3QQCD 4HR2A 2ZOFA 1TL7A 2CPYA 2IRYA 3DM2A 2YKMA 2OO4A 3MD3A 3L7OA 3GYNA 3TA0A 3C16A 1H72C 2PN6A 1HQ2A 1KC8T 1C1CB 4JV2A 4IYQA 2G0IA 4MT1A 4ZPCA 4DR7F 1XWLA 3BSOA 3MM7B 2BKNA 2C2EA 4KRWA 1EQMA 3TARA 4I2PB 1X4DA 3US5A 3TX8A 3EDRB 2E7WA 4OX7A 5G4DA 2DYAA 2PC6A 1RKIA 2J9DE 3GJSB 5KT6A 3P49B 1N34F 4ZJLA 4JV1A 5J2PA 2HHTA 4DSIA 2E9TA 1YBAA 5MLCV 1U24A 4JBCA 4LF7F 4Y2IA 2PMWA 2XULA 2XO7A 3TA2A 1F0XA 3GZ7A 2JC1A 2XQCA 4LF4F 3MEGA 1S57A 4Q0BB 1UJ4A 3EE3A 3FZ2A 1JLQB 5CXTA 2UXDF 2GHPA 2ZBIA 2EK1A 2ZHOA 3TZZA 3MXHP 4GKJJ 1QJHA 2W4DA 2WSEC 4X4TA 3T9NA 1PGZA 4XDDA 2XLIA 3QT8A 1EB0A 3HKWA 3A3OB 4O3SA 2G0CA 4MJKA 1VHIA 4Q5VA 4JYAJ 2GGPB 4F4KA 2FD2A 3BREA 3EXYA 5BXIA 4F4XA 3AFGA 4ED5A 2Q1LA 4MIAA 4KV8B 2OGUA 2MJNA 2DNKA 1S72S 1RTZA 2FIUA 5C7PA 3IM9A 2P2CB 5HN0A 3DRXA 2YX1A 1RDRA 1R0BG 4NCGB 4WP3A 3MTKA 1Y5NB 3DDIA 2DVIA 4W90B 3J7ZT 1D0EA 4WTOB 2E5LF 2GVDB 3G2XA 1RWNB 1U6FA 2VPWB 4YR2A 3NWGA 3LP2B 5KFCA 1R43A 3OSPA 5M2PA 3NGDA 2OH2A 3KHGA 1RTIB 1LWEA 2E66A 5HO4A 1XQIA 5LSRA 1PBUA 4RUHA 1JNRB 5EGYA 4NZ7A 3AY0A 4DR4F 1W26A 5RUBA 3LP1B 3PW5A 1FKPB 4MKAA 2F8MA 1Y3KA 1XNQF 4CQ1A 3P6YC 3GQCA 1CJTA 1I94J 1FO1A 4PG7A 1CJKA 5CZVA 4EBEA 1C0TA 2Y1RI 3QPIA 4ZPBA 4NCBA 5B08A 3E3XA 1RXOB 3PHTA 3FMBA 2CJKA 3CC4S 2OEJA 2ZD1A 5ETNA 1T05A 1VJWA 5GADU 5LL6d 5HMXA 2HHPA 2CXEA 2IDEA 4CO5A 1S1VA 3AD8C 1PJ6A 1QAYA 2I6WA 3HVTB 1RJJA 2WW8A 2YWFA 1DHMA 3M8SA 2ZDPA 2CQ2A 2J9CA 1VQ8S 4Q45A 4PKDB 1HQEB 2DEIA 1M1KT 3WBZA 1Y3JA 1SC4B 5F8MA 3NGRA 2W9AA 4A48A 4M5GA 3SXLA 5LMUF 4DV3F 2ZM6F 2DHGA 7FDRA 4M5NA 2PMZD 3MD1A 5A6WA 3UNGC 2AWZA 3MECB 2DK2A 1SJ1A 1HBNB 2CJAA 2EK6A 3KKFA 1R27B 4CIOA 1FNOA 2XI2A 2V4QA 1Q95G 3D54A 4H4KA 2AJ2A 4WU2A 2M7SA 1HBOA 4JI3F 4O44A 1XR7A 2R2TA 2V2ZA 4DPUA 2ZUAA 4B3TF 2A10A 3CW2C 3QFHA 3F41A 4DUZJ 5KFWA 3KG1A 3VGTA 3BKUA 3FCVA 1J5OA 2NZCA 2KU7A 4IKAA 1U1MA 1FRKA 2BJDA 1KTQA 1NM2A 1GFWB 1SJQA 1MROB 1RP5A 4ZKAA 5E3AA 1S99A 2D1CA 1S6PA 2KB2A 3DKDA 1HNVB 3D1OA 5J1PA 3HFZB 1TL4A 1Q16B 1UEUA 2IAJB 2EC0A 3MF5A 5IQ6A 4FXDA 4GVBA 3QRRA 2XZTB 3RAXA 4DR1F 3DHWC 3BSNA 1WEXA 4LRAA 4RU9A 4PXBA 4XPCA 2ZUGA 2XY6A 1RTHB 3JSYA 1NU4A 1BE4A 3AOBA 3K59A 5L9XA 1O5JA 4FZVA 1PJ5A 3R1HA 4MAKA 4DR6J 5HVFA 3VVUA 2J6SA 4AT1B 2Z2ZA 2YWEA 3C46A 2YNIA 3Q8SB 4WKYA 1TKZA 1G7CB 3OXGA 4CH1A 4CLWA 2POKA 4P52A 2AT1B 3ZTQA 1R8CA 1VQ6S 5EWFA 1RHKB 4FKXA 2CRLA 1Z2LA 4DF8A 3RB3A 1LK5A 1WKLA 2VV5A 1UVLA 2FHKA 3ETMA 2HZCA 1HNZF 1TV6A 1U2CA 2B0GA 4QBUA 1OWXA 2VJUA 3CJ4A 3QSIA 2M4MA 4WF9Q 4HH1A 2QLJB 4DPXA 3BO2A 1Q81T 4B3MJ 3QRPA 3I6PA 3W61A 3DRPB 2IYIA 1NH8A 5DZ6A 2XMUA 2I5JB 4AL6A 1FDBA 3NNAA 3T5LA 1RB0A 2ZE2B 1H2TZ 3JTOA 2HK2A 3IM8A 4ECSA 3CCUS 5HATA 1NSKL 4I68A 2J8SA 4NRTA 2RIJA 1WORA 2X1AA 2WTFA 4ED3A 2AZ3A 1RSCA 4NA2A 2EC2A 3QO9A 1IQZA 3ZZUA 1QSLA 3L95X 1I1GA 2B56A 1JLGA 4C2MA 5CAAA 4OYWA 3OPKA 2CQHA 3CXCR 2OFGX 1UA1A 3D1HA 1RAAB 2V8GA 3GJTB 4JV0A 1HI8A 4FBUA 1P6TA 5D15A 3Q8UA 3W63A 3HP6A 4QW9A 2HBZB 3OTDA 4QPTA 1PJ7A 2Z2MA 5DG8A 3UCGA 3EVOA 4IR1A 3MEEA 2QIFA 4U67Q 1U1RA 2OHDA 4TXSA 4K5SA 5KFNA 4DHVA 5A8KB 4FNHA 3KMQA 3CCSS 1HWLA 5F3ZA 2UU9J 1FEHA 1S49A 4I7FB 4WFAQ 3MEDA 3KNAA 4F3MA 2MY7A 1K73T 2YNHB 2B8PA 2J0XA 5BYRA 4C7QA 2A0FB 3N4WA 1FKOA 4C8LA 3P45B 1FK9B 4GKKF 1B7YB 3D3BJ 2XNRA 1VQ5S 3R6GB 2CQ4A 2AYMA 5F41A 3UW1A 4EYIB 4P2XA 1S79A 3V5RA 4NXNF 5IM0A 5KT2A 4ZVEA 1R31A 4ZHRA 2HK3A 3KK3B 2WAQD 2DIUA 4OMFG 3R5DA 2IVMA 4HDGA 4WFZA 2XS2A 3TJ9A 4CT8A 3MR7A 2WCXA 4N56A 3M05A 4RNHA 2R8GA 3VQTA 4PRFA 4F3OA 1T9XA 2PEHA 2RQCA 4I1TA 3NNCA 4ENOA 4F67A 3ISND 2CQGA 4LFCJ 2G9OA 2BJ1A 1VBZA 1UP1A 3EGNA 1H74A 9RUBA 2CQ0A 2V69A 4O3QA 4F50A 2R2RA 3FK4A 2IM1A 2HW3A 2B9YA 4NRUA 2GCFA 4DWIA 1SQGA 5B0GA 5A2QY 5KFHA 4RX6A 1LV5A 3DI6B 3C6UA 3H59A 4DV5F 2MZRA 4OX6A 2UXBJ 4F26A 3M6XA 1QAXA 2HVEA 1YDLA 4OHWA 3CJSA 2I0XA 2XS7A 4O3RA 2WOMB 1IR1A 1X7VA 3OXLA 2EEYA 2CZVC 1U47A 4Q43A 5D6GA 1U0SA 3BH6B 1FKAF 1KLNA 3PO4A 3D5MA 2HSEB 5IZHA 1FRJA 2JSXA 1C4AA 2AGPA 3M4XA 1SPBP 1S7IA 2KT2A 5I3PA 3UDEA 1S1XA 2BE2A 3HDSA 1N5SA 1JKHB 2B8QA 1CJUA 2ASLA 5ETRA 5DLGA 2XMKA 4Y2AA 1B64A 3OW2R 2O67A 3U1NA 1B4SA 2OLWA 3LWMA 4WKRA 3PKYA 4PUOA 2DY1A 5I3QA 2H4YB 3GFXA 3NCRA 4Y65A 1J5EJ 1RCXB 1T0TV 1ZAWA 1F2HA 2QZ8A 2VG5B 5KFQA 3PJWA 2MEWA 4WP8A 4DPYA 1OPZA 2V4RA 3BGLA 4RBUA 3OHAA 3MMCB 3KYLA 4ZPDA 4C8NA 1Q8LA 2AP6A 1RHRB 4DQSA 1S9GA 1Y4ZB 4KH0B 3RB0A 2QLBB 3MMAA 5JVGQ 4QJVA 2VBYA 3D0GE 2NQPA 2HMIA 3TQEA 1ZTTA 2ZWOA 4KPYA 4C8OA 2RDDA 2C3MA 4IFYB 1GEHA 4U95A 2YBVA 4ES3A 4J9VA 3CD6S 2MSTA 1E6VA 4M8LA 2BDPA 1HQUB 3FQLA 2HPUA 2XSJA 1TR0A 1FDNA 2PGCA 4L73A 4V19X 1HBMB 1P1TA 4A8XA 3HKZD 1K0TA 1RE1B 2JJ4D 2Y1LB 3RRGA 3CCJS 4RUBA 5AE3A 1NDPA 3KOAA 4F25A 1S1TB 1HWJA 3R9LA 1JXLA 3PZPA 5IV3A 4NLXA 2QA4G 2ZOGA 4B02A 1LOUA 2WSFC 3KNGA 4F04B 4OYXA 4QYZK 4I6YA 3W1YC 1BGXT 2Q79A 4QWEA 1CQMA 1X5PA 1G2EA 3SCJE 1EIYB 1WF1A 2R4FA 1T9WA 3TEHB 2A18A 5KT4A 2F8HA 1EETA 2FVCA 2E1RA 4CLUA 2VUGA 2OI2A 4TY8A 2NCKL 4HH0A 2MB0B 1SIZA 3QGPA 2JWNA 1UFKA 1RBOB 2BKPA 1SH0A 1SV5B 2BANB 4WK1A 5IT9U 3CJ8A 3NWRA 1YJNS 1VBXA 1FCAA 1LNQA 3G9CA 3R5GA 3JSMA 3AODA 2XEXA 3LP0A 2FHJA 1N36F 4OYAA 1WHVA 4MFBA 5I42A 2BE9B 3MR2A 4IQXA 4YUDA 2F4VF 2OP5A 2FZGB 5D3GA 4AL5A 4K0KF 3CJ5A 3GCWP 1AFJA 3SEOA 4ZIVA 4RW9B 2HLUA 4M5DA 4QWAA 3MFHA 4LBPA 3NS6A 3W5ZA 3CCWA 1NHKL 3EUNA 2OD4A 4RW4A 3OTBA 1IVZA 2YWKA 4EI2A 2LDYA 3GSIA 4MMOA 3TA1A 2FDNA 3KG0A 3DGPA 5KFIA 4DV1J 1VCTA 3BQ0A 5JXSA 2RHQB 3GONA 5HP1B 4JUZA 1Q8IA 3M2VB 4GMKA 4OYMA 4TY9A 5E0OA 2L48A 4NLUA 1LW0A 5D4LA 4DG1B 1WNEA 2GX8A 4C0HA 1ZM3A 1T03B 5D4NA 5KT3A 4KY3A 1KRPA 2UUBF 2HBQB 2B5JB 5AE1A 3V6JA 2UVVA 2WW4A 4CO0A 1HW9A 3I4HX 1CG2A 1O8BA 2FJAB 4F2SA 3MR6A 3Q24A 1JX4A 4B9NA 4NEYA 5KFRA 1GNKA 3GV5B 1OYEA 2J0SD 1N8RT 2F5GA 3DYAA 1NK8A 2CWXA 2YQ0A 4DUYJ 4PWDA 2DR6A 4ZS6A 4ZLPA 1DQ8A 1IWGA 4OLOA 2X1GA 3V6DA 3HO1A 2PD1A 3OFHA 2UVUA 4DL0C 4OI2A 4B3OA 5KFFA 3M2RA 3OVSA 1WDDA 1NK7A 1WI6A 4P71A 1QSSA 1RBLA 2JX2A 3CC7S 1RTDB 2CWKA 1CLFA 2AQ4A 1FNXH 2W7AA 2ZZTA 1HR0J 3Q8YA 2VBZA 4KTQA 2RRBA 1YG0A 2Z30B 5DS7A 1RADB 4OYPA 1NHVA 3CPWR 3H2UB 2HFNA 3UPFA 1RT4B 2CJXB 1O0PA 3IG1A 3C6TB 5J2NA 1JJ2R 2FJWA 1DLOA 2W1BA 1FJCA 1UVMA 4MK9A 4J9RA 5A8RB 2BJ9A 1MG7A 3NNHA 1Y5IB 1URRA 3M30A 1NJIT 4N5SA 4AYBD 3W2WA 3PR5B 3MR3A 2O1PA 4ECQA 3KLEB 3POTA 4ZPAA 2JLGA 2F3JA 3TI0A 1PBAA 4DMZA 2HNYB 2W2OP 2P6TA 4CLSA 3GFHA 2LECA 4YP3A 4IR9A 1JIHA 4LVNP 2H1YA 1H7WA 2W9BB 3GV7B 2Q43A 3U27A 1FFSB 3NGTA 1FFGB 4MYTA 2DCLA 1U0HA 1PC4A 1IKVA 2QLFB 3K2YA 1FA0A 5DG9A 2V8HA 4DV6F 4ANDA 4EZ6A 1BQNA 1MLAA 2YH1A 2PI5A 4NL5A 2VB6A 3AQPA 1M5OC 4LF5J 1N5VA 2AW0A 3GR1A 2Y3YA 1P9YA 5CYQA 3KK2A 1RUSA 3BKTA 3ZZZA 3CO0P 4DOZA 4WWSA 4ITSA 4PCQA 3GYXB 1BXNA 2CPJA 1KNZA 3RBXA 4AXJA 3D6MB 2GMHA 1XIQA 4MKBA 3L4BC 3BQ1A 1XMQJ 1HW8A 4Q7AA 3F0NA 3AJ2A 3IR5B 1VQSA 1FDDA 2HHHF 2DHAA 6FD1A 1DQAA 4F02A 3TZXA 1D3WA 2LQ9A 1S48A 4CWBA 2H54B 1QE1B 3CGIA 4PPDA 2Z4PA 5IT4A 2UUCF 3H0PA 1Y10A 3H98A 4X62F 2R8IA 1XJWB 1FXDA 8RUCA 4JI2J 1VQOS 3WZ0A 5AJ3F 3HHLB 3H7HB 2QL5B 2I9SA 1KDNA 2YY3A 1S6QA 2J9EA 1NXIA 4A8SA 2AKWB 4ZK7M 1WKKA 1IWAA 4CP5A 2HQFA 3CDEA 2G1DA 2FUG9 1U2RA 2M2BA 3QGHA 6AT1B 3P4UB 2DRBA 1MWQA 4C0BA 4UOFA 1V3ZA 4Q8FA 2OMOA 3HHLD 4AUKA 4ZPVR 1EX8A 3PKMA 4YHHF 1ITPA 2BBEA 1MWZA 2V8VA 2LFVA 3D67A 4TLQA 5F0WA 4NLQA 2BABA 3TVZA 4RNOA 2FVSA 5A8WA 1UMJA 2UVWA 3I87A 4DR3J 4ED1A 1DTQB 3HFVA 2F1FA 1HD1A 2K06A 4IFVA 3A4TA 1Q5VA 2LLZA 1D8YA 3I0SB 2DGUA 2DR9A 2CNKB 2VL1A 2VG6B 4MIBA 2AMCB 2LQ5A 4HACA 1T9VA 3TX0A 2A6OA 2W8KA 3TAMB 1KLMA 4O4GB 2XLJA 1LWCA 2KRBA 4XO0A 3THTA 1PIEA 3CCQS 2Z0GA 2BR0A 4UY8T 1FTRA 3MTJA 4DLEA 1YZ6A 4RW8B 5D8HB 3J7AN 1ZBTA 4KGXB 1LEOA 3SV4A 1ZYQA 2IVYA 2GMLA 1CJVB 2HFOA 4KE5A 1UFWA 4IRCA 4WXWA 2JHEA 3VAMA 2YXLA 2VOPA 1C1CA 1X4FA 5I3UA 3JS9A 1P27B 1FJGF 4TN2A 1X4HA 2MGZB 2K1RB 3MM7A 5LMNF 3G87A 3R8YA 4IO1A 3QBCA 4NI2B 2G0JA 4E8UA 2M0GB 4CLYA 4I2PA 2V2QA 5E2QA 5H9EK 1WC1A 3H5YA 1JNZB 4JI6J 3TEGA 4L3NA 1JLAB 1HYSA 2NUHA 4B3SF 4OZ3A 2B7BB 1U7LA 2FZKB 2IBKA 4DPOA 4LSLB 4WFBQ 3M9OB 1WF0A 1PO6A 4OZ1A 5HLFA 2YTCA 3BQ2A 4M5LA 2ILZA 4RNNA 5C25A 1NPPA 4LF8J 2JVRA 4ZVTB 1IBMJ 2KT3A 4DF4A 1TL1A 1WC4A 3VAJA 1GT8A 3MEKA 5KFPA 3KLFA 3CT9A 5ETQA 2G2YA 2V2VA 4PEOA 3KK1B 4JV5F 2IFXA 5HK4A 2IA0A 5ETMA 1JLQA 5DRKA 3CJ2A 2BE7D 2E7VA 3Q23A 2DTJA 2XHCA 5BR8F 2D3O1 3S7RA 3NL0A 3QIPB 4CZCA 1LW2B 2XZWA 3H40A 2UXCF 1Y7PA 2QG9B 1R8AA 1LFPA 1B0PA 4LF9F 2MQ8A 3DLEA 3RYLA 2HVDA 5DG7A 3MAAB 5D0HA 4EO8A 3M8QB 5M2UA 1MMLA 2K2PA 3LOUA 1I3OB 1FXRA 2LEAA 4ANEA 1RT5A 1T8EA 2Y1IA 2GGPA 3SQGB 4K4ZA 1TUGB 4W98A 2M5YA 3PCOB 3M1VB 5GAEU 2DJWA 4KV8A 2ALZA 1WG4A 4G6VB 4C4WA 3VQSA 4GKJF 1IR0A 2DXEA 4PG8A 2ZNYA 4NCGA 3PEJA 1S12A 4DXLA 4YEAA 4ZCIA 2NREA 3HT3A 2GVDA 2C2NA 4J9SA 3I0RB 4DI6A 3LP2A 2FVRA 1RTIA 3VHQA 4EWTA 3KFWX 4C11A 3BJYA 2DPIA 2HS0A 3LP1A 3I5BA 3CTRA 2MHEA 1KVKA 1KD1T 1FKPA 1LFWA 5BJRA 1H73A 1FWKA 4H4MB 1LKZA 1RI7A 2KO1A 3VAIA 2CPDA 4X84A 3DRSA 4EEYA 3ILLA 4QR1A 2Y1JA 3CCLS 5A0YB 2LQ8A 3TWZA 2FTRA 4A8MP 3W64A 3OL9A 4CTAB 1REGX 2GQCA 3IGVA 1M5VC 4LIWA 2MKKA 2MLZA 3GTYX 2ZVIA 1C1BB 1VQMS 3OSNA 4OHVA 4YFUA 1FHTA 1RISA 5CCLA 3ZZYA 2XNQA 2BRLA 3RBZA 3VWSA 3BV8A 2KRRA 2RD5C 3HVTA 4P2SA 3R2CJ 3ITHB 2WBRA 2BJEA 3B6BA 4X4QA 1HQEA 2PEBA 2C3PA 2C3OA 5GADI 3O1LA 5HVHA 2VF3A 2AD9A 3I4PA 4UZBA 4QYZJ 2BA9A 3SDEB 4Y00A 3MECA 3KJVB 4RW7A 1R3NA 3EZUA 5F9LA 2Z2YB 4IDKB 1HBNA 3TUJC 3CD5A 3FUYA 2VA3A 3HM9A 2D3ZA 1B7FA 3L09A 4ZLJA 1UEKA 2HGLA 1N6QB 1C2PA 1FRLA 1TUWA 1IBLJ 1WC6A 2HQGA 2FGOA 1AZSB 3D1QA 6FDRA 3HJVA 2NPIA 3GV8B 1GTHA 2J76E 2DCUB 4IH5A 3JSBA 2DGQA 3VCDA 1UETA 2RDIA 1D9FA 2W01A 8ATCB 3GU0A 2CNNB 1WD6A 1OPIA 2KHCA 5AXMA 4ZPTR 1TL5A 1FWLA 3MUMP 2WRMA 2VHGA 3BN7A 3QJJA 2QYGA 4ED7A 3DOLB 2FVQA 4PZVA 4CDIA 2XMVA 2HKEA 5LJ3Y 2C3YA 2KDOA 1LWFB 2D69A 1HNVA 1WKJA 4AQYJ 4FF3A 4BDPA 2IAJA 5E3CA 4J7CA 1Q82T 5DJBA 2HAFA 3I55S 2LEBA 3MZIA 4N77A 5FD1A 5AXLA 1HARA 3C2PA 1FTCA 3QZ7A 4WYLA 1RTHA 2L9DA 4JI5J 1KOOA 4MYUA 1TAQA 2E9RX 4DN0A 1G4CA 2ASYA 3RAQA 1UJ6A 5A76A 2LDIA 4KO0B 4G1QB 5ADZA 3GIRA 2IM3A 2BW7A 4O0IA 1U45A 2JEJA 2YNGA 1FEEA 1EHWA 5KG0A 3PACA 2UP1A 4NLSA 2GQ2A 2MLXA 1JJHA 4KC5A 4X4SA 4Q2MA 1SI9A 2KFYA 1BLUA 3V81A 4OI6A 1F9FA 3ELHA 2KXFA 2F65A 3PW4A 1G1XA 5F8IA 4NWBA 3W9JA 4PR6A 2BQRA 3FBCA 1HNXF 3I96A 3KUGA 4YB7A 4ECTA 3MAHA 3I9ZA 2DHXA 4K7QA 4NCAA 3I32A 4P9SA 2CJYB 1Q1KA 4DQIA 3QSYB 2YX4A 3HD1A 1JB0C 3DRPA 3D9BA 3J81j 2BXJA 5HMWA 1VC6A 4D3GA 2I5JA 1RHJB 2KL8A 2OD6A 3CD7A 3QMQA 1DURA 2PFFB 4RO0A 1Q7YT 4NLOA 3FBEA 1KEKA 2VG7A 3CCZA 4OX9F 2ACMA 3I56S 4CO4A 3BN4A 3FRYA 4DR7J 2GMJA 3MM8B 1RTJA 1ZPVA 3GIMA 3BSCA 4YB1P 1QTMA 4IG3B 1C0UB 2KI2A 2VFTA 1HLWA 4JI7F 4USUA 1M1HA 4F2RA 4NA3A 2HRTA 8AT1B 1N54B 4B3MF 1IM4A 2XM3A 1WTBA 4QIWD 4M95A 1SJRA 4F3QA 1N0VC 2IHR1 4TNOA 4LBHA 3DU6A 1Y5LB 1HMVB 3DM2B 1N34J 1NK6A 4ZLNA 3C16B 2IMWP 3HSJA 4LF7J 1FE0A 4N8OA 3O5TB 3DLGA 3AT1B 2DHHA 4LT6A 3WC2A 3ENWA 1HNIA 1SJFA 2AHOB 2HYIB 3R7SB 2KFNA 1NK0A 1VRTB 3L9ZA 1WF2A 1A7GE 3N5FA 1ZETA 2AGQA 1TUVA 2UXDJ 1YWXA 4I7FA 1ZZNA 3QAEA 3BBFA 3HVRA 4F0KA 2YNHA 3E2EA 4KSEB 4FYVB 2WHOA 3R5JB 2V4JB 3GCXP 3OL7A 1DFDA 2N3LA 3PIPQ 1FK9A 3AD9C 2HBYB 1AA1B 4QPXA 1U1QA 4NX9A 2B43A 3TUPA 2V63A 5J2PB 3OD2A 3CULA 3KK3A 4RLEA 2CQIA 3ZTRA 2ZDOA 1JJ4A 4NLPA 3QGIA 2AEMA 4WE1B 3AA9A 4HDHA 4EYHB 4FPIA 5IXUA 2L08A 3MR5A 3ISZA 4C3KA 4DSKA 4CI0B 3MM5B 1V9OA 2C3UA 2IJNA 4DL3A 3CJ3A 5T41A 1SH2A 2HIYA 2DNYA 3KJFB 2AV5A 2K7JA 2E5LJ 3PFEA 1ELOA 4ZCLA 2GAGC 4M63A 4CO1A 3CB4A 1LXNA 4XIUA 4L72B 4WFXA 3ZO7A 4OYBA 4NYPA 3VVTA 3PW7A 1U8WA 1CULA 3RBEA 5F0UA 3GFZA 3DI6A 2RT3A 4UOHA 2YVSA 1NAQA 4QWBA 2CZ9A 1SKRA 3HSDA 2XY5A 1RWUA 5IC6B 2WOMA 3T6JA 1WSVA 1XNQJ 1PC5A 1RHUB 1BQMB 5K8MA 1NB2A 1VHFA 2BM1A 2C42A 1IKXB 2B9EA 1JKHA 3RW7A 3UE2A 4LFBF 1B0VA 4K4XA 4YN3B 5AXKA 4M5KA 5ITHA 2I2YA 1VGYA 4U7CA 2PO4A 4ID5B 2XYHB 1TKXB 4A46A 2E44A 3BBCA 4NZ6A 5IT9Y 1CC7A 1TTHB 3IO1A 3HZGA 1FD2A 1RLDA 5EHHA 1TFWA 3IWXA 2P9GA 1RT1A 3W9HA 2QSFA 2VG5A 1IKWB 3CDWA 3UDVA 1TFYA 4R5PB 3ILOA 1T9TA 2E1AA 3CCES 3QGGA 1CJTB 4P7VA 2ZBCA 3T1YF 3OHBA 3MMCA 3WIVA 1IBCB 2HS4A 1CEZA 2YKPA 3PHEA 1EP4B 2L9WA 2DNGA 5ETKA 3G8TA 1C0TB 2ZC4A 2O01C 3W2VA 3X1LB 5LMUJ 4DV3J 3T1AA 2ZM6J 3OTEA 1V3SA 1NKEA 2WSCC 4MTPA 2UZAA 3IAM9 2VFSA 1SJ3P 1T05B 4ZVQB 3PY8A 4IFYA 5DQGA 1S97A 2DNLA 1J5EF 3D3CJ 2VQEJ 3UCZP 3QT5A 1CS4B 3BKFA 2ZNZA 3UDCA 1WTFA 1RT3A 1VLYA 4JI3J 3SSRA 3BEGB 1HQUA 4E2FB 4J9QA 1NDCA 1T3OA 3KJQB 3CEDA 3HZEA 3GB0A 2V34A 4L76A 1HBMA 2JVOA 4UUWA 4RBVA 4B3TJ 4TQRA 3AD7C 4BHQA 1WEZA 4J9PA 2OTLS 1VQNS 3M8WA 4KPCA 5CYJA 1ZPWX 2HFVA 3CO9A 2HQDA 4K4YA 3HJFA 3J7A1 1VR6A 4U8VA 1R0AA 3CCMS 3HX9A 4P74A 3DRRA 1KS2A 2APOA 3G8QA 2NXEA 2D3OR 1V5IB 1RAJA 1HBOB 1UCNA 4L74A 4USHA 2VJVA 1FRIA 5E3QA 2BMBA 5D4PA 3T9ZA 2ZBRA 4DR1J 3EGWB 4J9NA 4ILRA 4BC7A 3D6FB 3DFEA 3OUYB 2RQKA 2WVBA 4Q44A 3VALA 3BO4A 1KN6A 2HQCA 4K5RA 5H9EJ 2HHUA 1TK8A 1YJ7A 1TVRA 1RYSA 1Q79A 3E8OA 1KR4A 4ANCA 3SCLE 4F4YA 2OAUA 2RVJA 3C15B 3EVMA 2FHMA 3A8KA 1S6PB 1U1PA 3FRZA 1VRUB 3IP0A 2Q66A 5ETSA 3CMAS 4ZVSB 4HHJA 4DSFA 1U1OA 4GVBB 3NBPA 1SL1A 2R3VA 1YLXA 3VZIA 2CQBA 2LU2A 4OI0A 1FESA 2GJIA 2RMLA 1X5OA 2IRXA 1HNZJ 5E3PA 4GRSA 1MN7A 2IRUA 1GXUA 4NASA 4DL7A 2MTLA 4OYZA 3QT6A 2B4OA 1ZOTA 2PE8A 1DY3A 1XMBA 1UVJA 4QWCA 4OJ1A 1H0HB 4L3KA 3J7YU 5SZTA 2YNIB 5AXNA 3LTOA 1HBUA 2R9LA 5LOQA 2C22A 5H9FK 1NPRA 4DQQA 3JQMA 3M2VA 4E98A 2JL9A 1RWVB 2J7WA 2W2PP 2ZFHA 3V6HA 2VBXA 1M5KC 2AX0A 2Q3PA 2B5JA 2H9ZA 2Z56B 1SL2A 4WFNQ 1NO8A 5IQQA 3Q0AA 4K4VA 2D74B 3IC1A 3G4SS 3OJUA 4GO5X 3R2DJ 1OIAA 1NJWA 2VIHA 5BYQA 4LSZB 2C2KB 4LSNB 2FJEB 3SIPB 2SXLA 3D0IE 1K9MT 3TVKA 4PXDA 1YJVA 5B0EA 4URQU 4Y0FA 2XLKA 2VQFF 1X4CA 2OPPB 4V19J 2X1FA 4ED0A 4ZVOB 4LUBA 2QV6A 3CJ0A 4OHYA 5D0EA 2XWXA 2FJBB 4K4SA 1UL3A 1RYRA 4GKKJ 1RTDA 2WB4A 1VIOA 1X4GA 1O51A 4OI3A 2OEMA 4NXNJ 1EKRA 3DN9A 3Q83A 5HROB 2KVQE 1SCJB 2LA4A 1XBWA 4D3HA 2IJFA 3MEEB 1RT4A 4X64F 4OZ2A 2ERRA 5E41A 3PYFA 3BGFA 3MEDB 1FXLA 3OR1B 1G3OA 1FKOB 3QWPA 2YKNB 2QMUB 4NLVA 2YPYA 3KLHA 1UJ5A 2HGNA 2BJ3A 2QX0A 4WK3A 5LSOA 2VOOA 3HLUA 3DCAA 1D9DA 5KFYA 1WACA 5FDLB 3R5BA 4MIWA 2ZVSA 3KLEA 3IRXA 4J37A 1I51B 3THPA 5SUHA 4ZHRB 2JEFA 2HNYA 3QIDA 3K0JA 3B4MA 2DBBA 4DV5J 5DM7Q 4RNFA 3LQVA 1NNDA 1CBKA 2D3UA 2W9BA 3QT7A 4LR8A 4LF1A 2AYEA 4USKA 3R97A 4OV1A 1M5HA 2IC3B 3QJPA 4FBTA 3KTQA 2XYPB 5GMDA 4DV2F 4DQRA 1JLBA 2L3MA 4KIAA 3P8BB 5KG6A 3VZHA 3KUEA 3LF0A 3LAKA 2W2MP 3P5TL 3ICLA 4WPAA 1RA6A 3TO8A 2U2FA 1HKAA 3C6UB 3ENQA 2MZTA 2N7YA 1MMDA 3PXGa 1FWPA 3IWLA 2XTJP 1S9FA 2DGWA 3BR9A 4KFBA 2XBPA 1U6BA 1UWAA 2ROEA 1NSQA 5CYMB 2CPEA 2GIRA 2LA6A 1VK3A 1K47A 1RU1A 2KVIA 1E6YB 4DBQA 1WHWA 1K8AT 3IBWA 4USJC 1CJUB 5HQ8A 1IR2A 1FD8A 3IAS9 4CCHA 3JAMU 4TQSA 1N5TA 3IS9A 1VJQA 2Y8WA 2RU3A 4CLLA 3DLBA 5B7WA 2BRKA 4K59A 2DR8A 1FI4A 4HTIA 1B3TA 4LF6F 2C1EB 4OJHA 4OZ0A 3CJQA 2VU5A 4U9RA 2OPRB 4ILMA 2XG8A 2HLTA 3HHLA 1NSPA 3NEKA 3X3UA 2VPZB 3HD2A 4DL6A 3M8ZA 1XMQF 3D0HE 1YJUA 1SIWB 4DSLA 1AROP 4IQMA 1YGYA 2KJVA 5J2MB 1JQGA 3DLJA 1RWOB 1FVQA 2YNFB 4R8UB 1TMJA 5C2GA 3KWMA 5EUHA 2VKZG 2EKNA 5EN1A 3A8JA 1YRXA 1T9UA 3IBCB 2VDHA 3BR8A 2LXUA 2QE5A 3ZTSA 3B78A 1UAWA 1Y9OA 3QAUA 1JLFB 4YDXA 2W2QP 3A8IA 1YK9A 4YR0A 3K5OA 2VKRA 3W8GA 1OYDA 2EVZA 3QNWB 2JLFA 4FNIA 4NXMF 3FBFA 3KLIA 2DD8S 5JMNA 1IBKJ 3MM6A 5LXRA 2R7XA 3I0SA 2RUGA 1RBAA 2G1HA 2M3DA 3AAWB 2RRAA 3UDLA 1K44A 2MYFA 4Q2LA 3DHXA 3J81U 4C3MA 2UVRA 1T02A 3DXSX 1PYSB 2P8IA 2VDIA 2GV1A 4ZVGA 1H2VZ 3TAQA 1YJRA 2A2DA 5KFDA 4O4GA 3AXMA 3VV2B 2MQNA 3GIJA 3RB6A 2DO0A 5DGAA 1RT2B 1SUQB 4CLPA 4KGVB 5GAHU 3JTPA 1N36J 4RW8A 2CQ3A 3FVYA 4ZVPB 2F4VJ 2I38A 4JI8F 3M8RA 2QRRA 4F4AA 5L39A 4K0KJ 1EETB 2J9DA 2PSZA 3DLKA 4NLTA 4AE5A 1SH3A 4HHUA 4CM2A 3T5KA 3RR7A 3NXZA 2BV3A 2QGFB 2BQUA 3E01B 2K1RA 2KG0A 2NS1B 2DRAA 5KOXA 3FFIA 3MPYA 3OV7A 4WJBA 4NI2A 4ALZA 3PX0A 2R7SA 3HXMA 3TZWA 4Y3CA 3TRGA 5DDQC 4LSLA 2B7CB 4QCLA 3TUZC 4MFBB 1JXEA 2XMAA 2W24A 1X5TA 5D3GB 1VYAA 3DOMA 3UD4P 2RHSB 1UPMB 1SL0A 2V50A 3ULHA 4OZLA 3GJRB 3H5UA 3CDUA 1BMQB 4LJMA 2NXUA 2UUBJ 5KFGA 1R0CB 1P8GA 3BGRA 4XAKA 4NZ0A 1IKYA 3NAHA 3G82A 3HSZA 2FGCA 4RW4B 3W3SA 1UPPA 2Y0SD 4GC7A 3CMES 3D66A 2XMWA 3QIPA 1NK5A 4WIIA 1LW2A 2ROGA 2CQDA 3IFEA 3MCMA 3DGPB 1NRKA 3DLHA 4QU7A 1HD0A 4IO9Q 4ZJQA 4OHXA 2KZMA 1SVDA 3RUBL 4PQUB 1FFWB 2N7CA 3PYDA 1S4FA 3PVXA 1Q8BA 3M8QA 3MURP 3IMQJ 1Q7LB 1LXJA 1HPZB 4RW6B 1H2UX 2RQMA 1FNMA 1GXTA 4K4WA 3R6LB 1JK9B 1WEYA 3M1VA 4QQBA 3QFWA 1CQNA 4ILLA 4ER8A 1M5PC 2HIQA 2JFDA 5C24A 2MQOA 4YB5A 1FX4A 2OIHA 3LO3A 1DJ0A 3JB9k 1KFSA 1UWBB 4KT0C 3UN5A 4PWDB 2ZH3A 5HBMB 1S0OA 2J7KA 1TKTB 3BS9A 5GAEI 2J8AA 3W66A 1RK8A 2PIIA 5B0DA 4EBDA 1U49A 1L3SA 4HHHA 3M2RB 1S4EA 4WYWA 5LSLA 5HMZA 4QW8A 1X9SA 4EMDA 3N6LA 1TZ0A 5B09A 4B9SA 3EZ5A 2LXIA 4O3PA 1YITS 3VAGA 4H4MA 3FGVA 2HNZB 3GR0A 1RAFB 4DX8H 4Z37A 4CYUB 3N0VA 2BOPA 4F4ZA 2V5HG 5LT5A 4M5HA 3DOKB 4LRBA 1T3NA 3UN2A 3QYYA 1FERA 2XCAA 1DQ9A 4CTAA 2QTWA 3SFUA 3LH2S 4PWWA 4PAAA 2CQPA 4I2QA 2D41A 1C1BA 2EI5A 5DQIA 4QIFA 3IG1B 2BW2A 1DBDA 4I64A 1A0OB 4XPEA 3V4MA 1DLOB 3F56A 4N47A 2RRNA 5KG3A 4BS2A 4DV6J 2J5AA 3ITHA 2MJUA 4EGLA 2F8EX 4AL7A 3KLGA 4IRKA 2CDRB 3GJQB 1S10A 3LGNA 3ZXWA 3PTWA 3OJSA 1EQ0A 4DUTA 3CDBA 1VFJA 2OUGA 4PG6A 3PJ9A 4HTJA 3SDEA 4ZN1A 3KJVA 4ZDNA 3OTOJ 2GO8A 3EXCX 3UVJB 1IKVB 5C2CA 3C66A 4PWUA 3DDNA 2QO3A 4HEA9 2VPXB 2WZ1A 1FE4A 3NOGA 2H5EA 1AZSA 2F9JA 1KSPA 2HWTA 2HHHJ 1S9EB 3CSKA 3T6BA 1X0FA 4C3LA 1SQFA 4O3OA 1HIYA 4ZVUB 5I4MA 4ERDA 1KVJA 2R8JA 3FNNA 2DGXA 1X4AA 1S6OA 3TW0A 2UUCJ 1NLKL 3UNYA 2C2OB 3UR0A 4X62J 3DOLA 2LVWA 2YQ3A 5AJ3J 4TYBA 5DLFA 1LWFA 2R42A 1ICEB 4KHPF 2MKYA 5LJ5Y 4F8RA 1KONA 5KFKA 2CJ9A 2R7OA 2LMIA 4W4MA 1ZZFA 4CLTA 3SMZA 1I5OB 2QMWA 1RWKB 4YHHJ 3TVYA 4RNMA 2R7TA 4ECYA 2AJQA 2ZJPQ 4KO0A 3QWUA 1YZ7A 2AJ4A 3OFEA 3BDPA 5H9FJ 2DNRA 4H4OB 3A1YG 3D4JA 3R5CA 2XB2D 2XGPA 1UVNA 2ZH5A 1D8ZA 1NKCA 3LW5C 2RU9A 3SCIE 2QA4S 3HMJG 1TK5A 2HZVA 1SB6A 5DGBA 2NZ4A 3KDNA 3L7UA 3SFGA 3V2UC 1RHQB 1RT7B 1CVJA 3ENAA 2DH9A 2DRDA 1KQFB 5F8LA 3HVAA 3NGKA 2F63A 2JLEA 4NLGA 2W4PA 4AD6A 3DDKA 2KN4A 2VFVA 3MAQA 5IC4B 2CNOB 3HK2A 1LQ9A 5K14B 1F9EB 3EGVA 1SKWA 1GK8A 4IFVB 2G4BA 3W9IA 1XNRF 4DV4F 1P1LA 4TLRA 3MCSA 1FJGJ 2AEFA 1TKDA 5LMNJ 2AZ1A 3LANA 1VRQC 3W5XA 4IG3A 3M32B 3RAMA 2A2CA 3JXOA 3EYZA 3PNIA 1U09A 4A8KA 3SBMA 2EW9A 5KFBA 3T1HF 1S1WB 1X4EA 2ZH6A 4C8ZA 2Y8YA 3OL6A 1HMVA 3SV3A 5IWAF 3EX7B 2HURA 3BGUA 2X3DA 2OPSB 3N9UC 3A3PB 1NKBA 5I3UB 3MM9B 3OL8A 4F4WA 4ECVA 1OSDA 5L46A 1KTVA 4DV0F 1DRZA 4ECUA 4JV5J 5L1LA 4RKUC 1B70B 1VRTA 2VFRA 2IBOA 2FC9A 5F9NA 2F7VA 5BR8J 2HNDB 3RB4A 2V4JA 2ATCB 5IS2A 1HYSB 4X65F 4RBTA 2MPUA 3R7BB 2UXCJ 4ELUA 1DZ5A 2QMXA 2FJDB 5HLFB 4LF9J 4DR2F 2I1RA 2VC0A 2K7KA 1GMUA 1N32F 1KQGB 5C25B 1DAXA 3GIKA 2N4CA 3H4DA 1TL1B 3G6VA 1OQ3A 3KLFB 2ACYA 3EZOA 1REVB 2GIQA 1PAEX 1IXKA 4NOHA 7AT1B 4WE1A 4KQZA 1ZA1B 3C14B 1S6UA 1VQPS 2HFSA 2IJRA 2FC8A 2JZ5A 4JI4F 4A47A 3MM5A 5D77A 4BCAA 3HHKA 3GPAA 2OPQA 2M8DB 3MHYA 3ZZRA 3H25A 2PA3A 4OZJA 3LA0A 3RBDA 4TU9A 3OR2A 1L3KA 1M90T 1RHMB 1TK0A 3DLEB 1K1QA 1N5YA 3ZZOA 3NMAA 4N7TA 2FLNA 4OJ3A 4X66F 1M1GA 3R5AA 1UW4A 4C6AA 3D28A 1S0VA 5KT5A 1FX2A 1RT5B 2WONB 2JDJA 4X4RA 1IUJA 2GHVC 3CE8A 3THVA 4K2XA 5D0GA 3RR8A 2OSRA 1BQMA 4KKOB 3PG9A 2R7WA 5B0CA 1IKXA 4B9TA 1YBTA 2YQ1A 3DXBA 3TJ8A 4DEZA 3AQOA 3R3TA 2VFUA 2QSWA 1HI1A 3O6QA 2QN6B 1RT6A 1S5ZA 2DPJA 4ID5A 5E7OB 1Z4UA 1TKXA 4DCOB 3MMBA 3KJNB 1RAGB 1HNWF 1RKJA 1QD1A 3OLAA 3SSQA 2BQ3A 4O4RA 3V6KA 1N48A 4C11B 4LF2A 2EKYA 1N33F 3TYTA 4QIEA 2AJ1A 1S0NA 4DV7F 2GJFA 3HSGA 3BYPA 2QA1A 3DRSB 3VF0B 1X31C 1IKWA 1XMOF 1NSAA 1X9MA 4R5PA 2W9CB 3ET6A 4U7UK 4Z7YA 3UFCX 1EP4A 2RB7A 5ETPA 3MUVP 2CG4A 2DKOB 1Q5YA 1S0MA 2CJQA 4GC6A 4ED4A 1U6ZA 2LP4A 3ZNJ1 2B6AB 5CQGA 3UWTA 1BUXA 2MZQA 1ZAVA 5KOWA 1UFLA 1UEVA 5BYSA 1KVIA 2MKIA 1WSRA 1RWMB 4QR2A 2WVCA 1BY9A 1VBKA 1XEZA 4USTA 4ZVFA 4P6QA 1HWKA 4NLYA 4HT5A 2JH3A 5K8PA 2JNJA 3VTIA 1CS4A 4ECZA 3CJKA 2DR5A 2DNPA 3L7PA 4MKYA 4YY3F 3MGJA 1ACMB 3RW6A 4NYZA 2ZH9A 4M5JA 4FYXB 2XSFA 3V4IA 1T7PA 2P6SA 4TYAA 4Y34A 4I67A 4PG5A 5HQMA 1DTTA 4NLDA 2LQBA 5FIIA 2FB0A 4KAIA 4OYOA 3IRWP 4HL9A 2NYHA 3Q86A 2ZJRQ 1A6LA 4EFAC 2NXCA 2QLWA 5HI7A 2W7OA 1EAYC 2H51B 4BBYA 4RW7B 4OI4A 4ZN3A 3TP2A 3H42A 4I6AA 2OJ3A 3SQOP 5K9FA 5KFZA 4YB6A 1JLEA 1TL3B 4FXWA 3C3LA 4LFAF 2CIMA 1RA7A 2VQEF 3EICA 5HQLA 2DGVA 5HJYA 5B0FA 1NDLA 4NYOA 3IWNC 4EO6A 4LR7A 2XY7A 4I0WA 3WHIA 3SYZA 2ZH4A 4FF1A 4I69A 1RWPB 1F2GA 2VONA 3HT0A 4UOCA 3OUYA 1OS5A 2AGOA 3K5NA 3TR5A 3K7RA 1EZZB 4CLFA 2EBGA 5LM7E 1U2FA 3GSDA 1R8HA 3B4DA 3C15A 2O3DA 2IA6A 4B3RF 4URGA 4FXVA 5DM6Q 5T7LB 2A3JA 5CHCB 2O66A 2EG2A 4FYDA 1VRUA 3ZTPA 5CA5A 2AJFE 4CLZA 2DNOA 3PX6A 1NK9A 2GVZB 2V67A 4OQJA 3EDQB 2KFZA 1HNXJ 2UUAF 4Y2CA 1GMVA 1TU0B 2DB1A 4CNYA 3T41A 5GMKa 4IG0B 4DR5F 4KGZB 2V0NA 3EM1A 1X9WA 2HFZA 3NGSA 9ATCB 5J2QB 3GIIA 2YNGB 2LYVA 1BC6A 4JI1F 1IN0A 4JI0F 3ENVA 2W8LA 4OX9J 4QYRA 3V81B 3S6EA 2ZHBA 3TJAA 2A6MA 1QSYA 1GMWD 4KYZA 2RKIB 3MFIA 3H8YA 3OVAA 4B9LA 5FLXU 3OVBA 3J7YI 1KFDA 2H48B 2OMLA 2COLA 4JI7J 3OFGA 3GYGA 4B9UA 2FY1A 2VZ9A 4DX5A 1S1UB 4ZPWR 1F9HA 3RZAA 1N52B 3WX4A 1T9YA 3H20A 4N41A 4MK8A 1FF2A 2B4UA 3UCUP 3AA8A 3BDEA 4LSNA 2CAJA 1U02A 3MUTP 4ICLB 2MZ1A 2WK4A 2VG7B 3BZQA 5IOLA 3BGOP 3BO3A 3MOJB 2BEFA 4EZ9A 2NUUG 4DU8A 3NY0A 3TOQA 1RTJB 1NCLA 2CPZA 3CWJA 4I56A 3O44A 1YI2S 1W2BR 1QUVA 4K8RA 2OPPA 3ISNC 1D09B 4CNZA 1R8PA 3WC0A 2ILYA 4UZCA 2R7UA 2FJXA 3JAMY 2RF2B 3FC9A 3TUIC 1NZ8A 5CH7B 5CD4A 1J27A 4Q0BA 2KT5A 5LXYA 4IOBA 1URNA 1YVFA 2X51A 2B4VA 3FSXA 2CADA 5HROA 4BWJA 2FYXA 3DLGB 2JFKA 5ETTA 4OZ5A 1HNIB 5HMYA 3M8PB 1CC8A 3TANA 2EFQA 3NMRA 3CIMA 2DIVA 3B54A 5KFTA 3VAHA 3QATA 2HWHA 3M2UB 3CF5Q 2H5JB 4X4OA 3OR1A 1VQKS 2YKNA 2F40A 1R8BA 3UR3C 3ZZPA 2MLYA 2W2NP 5F8JA 3NP5A 5FDLA 5KT7A 4ZLLA 1V3RA 2ZJQQ 5KFVA 3RJMB 4A8FA 5GVQA 2CVIA 4ZMMA 2MKJA 2EXUA 4NLWA 4OLPA 3H90A 5KFOA 3Q8RB 1FRXA 3A3NB 4CH0S 4EK2A 2A1BA 3FDSA 3DMJB 3KXDA 1XR6A 3PFOA 2IC3A 1TMMA 2IVFB 2AYGA 1WG5A 5KFUA 2V8DA 2DNMA 3FCHA 2DY9A 3ZZTA 1T11A 1TAUA 1ZA2B 2R7RA 2B9XA 4M5IA 4LRCA 4LFBJ 2FPHX 4JYAF 3J81Y 1VI7A 2ASJA 4PG4A 2C2MB 4E0DA 4U8YA 1U25A 1CULB 3CIZA 1RAOA 3ILJA 4WU3A 2AX1A 2V94A 1QTNB 3EGZA 4C8KA 1K1SA 1B99A 1APSA 2Q6BA 1KQSR 1HL6A 1WHXA 2QLXA 4FVMA 3G8SA 3A13A 5CYMA 1Q8KA 3FZBA 4WZQA 3T1YJ 1E6YA 2YPZA 2Z2LA 1J2VA 2O5DA 3E51A 5G0RB 4UW2A 2C2RA 1BHNA 3LPEA 1JLCB 5KFEA 5F8HA 1W2IA 2DNNA 2MQLA 4YMEA 4DZ6A 3EVWA 4WXOA 1O6XA 2KHDA 3IA0A 1I94F 3FSIA 1VS3A 3W60A 1W7WA 1WOOA 1KWMA 1RT1B 4B9MA 3T5JA 2UV8A 2OPRA 3A8EA 1QDUB 5AE2A 1LK7A 1PYTA 2CPFA 3CUNA 4DFPA 3GG1A 1F5CA 3W2VB 3G6XA 1GXLA 4TU7A 4LRDA 5J2MA 1VC5A 3OTCA 3PYEA 2YNFA 2DNZA 4R8UA 1F60B 2VC1A 4CO3A 1X5SA 3AB2B 2BKOA 1BQXA 3M8YA 1TP7A 2KM8B 4C8YA 1K0VA 4F36A 2FLPA 5GAGU 2HGMA 5ETOA 2QYCA 3ZTOA 1RT3B 1JLFA 2KZZA 3D6TB 2DXDA 4TU8A 3RRHA 1Z2ZA 3SSSA 2NXJA 1D9AA 1MROA 3NG8A 3KHHA 4O23A 5DO2A 3HF5A 3NRBA 4IUFA 4OFZA 4FKYA 4ZCKA 2G13A 1CPZA 3ONQA 3PX4A 5JJBA 5C42B 1R0AB 4R0EA 2D7SA 1GX5A 4ED2A 3DRRB 4X4UA 4I6WA 1VQYA 1YRUA 3KLVA 3M9NB 1XN9A 4BWMA 1RT2A 2GHWA 1SUQA 4PYAA 3BSAA 2XWYA 1U4BA 2CPIA 4BC9A 4DJBA 2IDLA 4DUZF 5CZXA 4GVLA 3EPGA 5L9NA 3TZYA 1MU2B 3JYTB 2AU0A 4YR3A 1GTEA 2ZZNA 4R0JA 3S8SA 1IJEB 3Q2SC 2RJZA 3NLCA 1IBKF 1KHWA 4QWDA 2CJBA 3MOZA 1TVRB 2OTJS 3E01A 2CNLB 4LREA 5GAHI 5J1EB 1PG5B 2ROPA 3T19A 2NLWA 2XI3A 4V1Ak 2E5IA 3D6HB 3H2VE 1MWYA 2HVIA 2V9WA 5E5NA 2BX6A 3IR7B 3NBPB 3U1LA 4UQTA 2RS8A 4OJGA 4DR6F 3WIUA 3FKBA 3KG4A 2N3OA 3MPDA 4R25A 2VODA 2GZOA 3HPOA 2ZE2A 1GQEA 3PRVA 5DETA 3A12A 4ZCMA 5A6PA 2NSBA 3HULA 3MPVA 1VQ9S 3W5YA 2FQQB 2DHSA 4DN9A 3QLHB 3PV8A 2V6AA 1HBUB 4QIGA 3P5BP 1RACB 1WC3A 2RILA 4RPFA 3N01A 4Y28C 1X0PA 4PQUA 3UQSA 2VQFJ 1ZM9A 1TL7B 1N0UA 3M9MB 1HPZA 4RW6A 2YKMB 4J9OA 1H6KX 4LIRA 2HRUA 2EFOA 1WUUA 1W25A 3FBBA 4ZVHA 2ZHAA 1YJ9S 2XYGB 4KHMA 5JUMA 2IMOA 3BM7A 4ZVRB 2VBWA 3T5HA 2EBEA 4YOEA 2XZDB 5EWEA 1KQKA 1MMNA 4IOAQ 4FYYB 2Y9HA 2NR0A 1UA0A 2OFHX 4LF4J 4C98A 5A8KA 2YWGA 3KHRA 2ABYA 2BUNA 2R7QA 4UT4A 1UWBA 1VIXA 5HBMA 2XCPA 1TKTA 2XC9A 1MNEA 4J9KA 5THWA 2EFPA 2HHQA 4UTGA 4X64J 3MWBA 2KG1A 4NPOA 3NCPA 4GO7X 1OQ6A 1YX2A 1HFEL 3J80U 4A8OA 1NBEB 4DS4A 4B17A 2HNZA 3OXFA 4CYUA 2UUWA 1VBYA 3G86A 3MEGB 4ES2A 1H3DA 3DOKA 3N6MA 1HWUA 3QRQA 2QEXS 2UU9F 1XC9A 3Q2TC 4KBIA 2BYCA 5KG5A 2HWIA 1SC1B 1RABB 4HT7A 1VISA 4J9MA 1RAEB 4USVA 2ZBQA 2KXHA 4OX8A 5HANA 2XMJA 1YJTA 2B3TB 1R89A 1GAOA 4ETZA 3N28A 5ETLA 2HBRB 4UUXA 2RDJA 4TVAB 2ZEJA 2CUYA 2J6UA 3KMSA 2X1BA 4DV2J 5K8OA 1HI0P 1F6TA 4PPZA 4P2MA 2JC0A 4IOCQ 3KLHB 4C0OC 3PYGA 1S77D 4DR4J 3NCQA 4OHZA 2XS5A 3IRXB 2C2DA 2GIFA 2JOQA 4B9VA 4RR5A 5HSPA 4J5OA 1QM9A 4LFCF 3J7Z5 2ZH7A 2M88A 2HEKA 1OSCA 5KFMA 4PQAA 3Q8PB 4DPTA 2QL7B 1WC5A 5FJ4A 3UVJA 3I9V9 2E5HA 3NS5A 1L3UA 3UD5A 2LXFA 1JLBB 1LWEB 4RJVA 2BM0A 2UXBF 3IBFB 2H65B 3G96A 2D9OA 4ZP9A 1AW0A 3CJTA 2NXNA 4G3IA 5K8NA 1U1NA 3RU0A 2CZ4A 5KFXA 1S9EA 1QLNA 1SBRA 1AFIA 3HHLC 3LUYA 4FS1A 2HHSA 4ETXA 4G1IA 5E3RA 4C97A 2RAQA 5D4OA 2CQCA 4Y2KA 1CJKB 4LF6J 1BWVA 3T3FA 1SJ4P 1NK4A 4LRFA 4KFBB 3K5LA 2E29A 3OTOF 3C19A 4ZITA 2CVEA 5H1SV 3ZZ0A 2DEJA 3AJDA 3FEZA 3NKYA 1HHSA 3R27A 2HVZA 1UVKA 4QU6A 2BZ2A 2ZD1B 2ZC3A 2NSCA 2R2SA 1QVGR 1S76D 1JJCB 3GG0A 1R7IA 2HZAA 1S1VB 4I4BA 4DZDA 3K58A 5K5MA 3GILA 4PXEA 3IS9B 1UVIA 1TQLA 1NDKA 3FEYB 4ECXA 2YKOA 1FRHA 4NE9C 3I82A 1V5VA 4ECRA 3N79A 2ZOMA 3TQ1A 3OQ2A 2XMMA 1U26A 4J9LA 1Y00A 1EJ7L 4DCJB 2EFNA 4AXIA 1YTYA 1S1TA 2RQ4A 1H98A 4H4OA 4PYDA 5IFMA 2EFGA 5F8GA 3M6UA 4ELVA 5DDOC 4NXMJ 2UUTA 3K5MA 1VQ4S 2GQQA 2LEPA 5AT1B 1AXQA 3K5PA 4OI1A 3DLLQ 2DT9A 1JWWA 1QVFR 3PRDA 2C28A 3NS7B 1EKSA 3IR6B 3MMJA 2I8EA 1RT7A 4O44B 3UD3P 4YDDB 3B8HA 2VICA 1S59A 4N8NA 3O2IA 1RLCL 2WVFA 1OY6A 1ZS6A 2MKCA 2MKSA 1GH8A 2MKHA 4Z7CA 2FVPA 1J5OB 2G2ZA 5K14A 4JI8J 3JQJA 4C8MA 2UV8G 1HWIA 1SV5A 3KLIB 1YKWA 2BANA 1RAIB 1Z1ZA 4N76A 3MM6B 4DPWA 1SXLA 2VASA 5KG1A 5HAOA 2ZH2A 1N5QA 1QAIA 3VR1A 5KAKA 4NEZA 3RTVA 4CH7A 3M32A 5DDRC 3HHNB 4PXCA 4QZVB 2QFIA 2YKAA 2CDQA 3R7NB 2MXYA 2E9ZA 1S1WA 4DQPA 2QA2A 4RW9A 1FVSA 4YS2A 3GP9A 2IY5B 1NB7A 4A4JA 2HS3A 3DU5A 1L5UA 3BPSP 3PO5A 5C5JA 2OPSA 4IRDA 2ZBPA 2CPHA 2MZSA 4OYIA 3DLKB 1YJWS 3MM9A 3UI3A 2F9DA 1U1LA 1TKZB 1D1UA 1OY9A 2MQPA 5L8RC 4DU7A 3FFIB 2FHOB 3LGMA 2IPOB 1H38A 5HP1A 2KYXA 2HNDA 3P3DA 4DG1A 1T03A 1TV6B 4X4VA 3PR4A 2MQQA 1NJZA 1DARA 2R8HA 3DOMB 4FN5A 1KHVA 4QR0A 4NLRA 4FF2A 1FDAA 1XTZA 3H4BA 3BB5A 2GC8A 5KG2A 2MQMA 1REVA 3BGRB 1Y11A 2HVHA 3C14A 1IKYB 3CC2S 5T14A 1QAJA 4P72A 3PJXA 1OO0B 2NYIA 3G82B 2K3KA 3GFYA 4DV1F 4UOGA 5EDWA 2H4WB 1SKUB 1XERA 4X4PA 1ZM4A 4ZJOA 3SZ2A 3MCOA 4DL4A 1R6YA 1F5AA 3ZNUA 4XDCA 4ZP8A 4O3NA 1WDTA 1F3FA 4WFYA 2YWHA 2GW8A 4FS2A 2FLLA 3QO9B 4FYWB 2K8GA 1VDHA 3SI8A 2HHWA 3W62A 4HI2A 1V6HA 3HI9A 3ILIA 4RU2A 4U6PA 1JLGB 4L6V3 3MCNA 4DX7A 1NEEA 2J6TA 4UF4A 2X7IA 3PEHA 4XTTA 3EPIA 2RUSA 1WC0A 2WONA 1N56A 1UZHA 2LU1A 3WX8A 1Q53A 4DUYF 2FY8A 3GWCA 1YQHA 2KH9A 1QUPA 1PILA 2E1MC 4KKOA 3F73A 1NZAA 5C24B 4P73A 2ADCA 4QOTA 3C6TA 4OZNA 5D78A 1UKUA 1M0SA 2HQ3A 4OIXA 2Z58B 5A8RA 1HHTP 3NGUA 4RWXA 2Z57B 3CDAA 1JXVA 4P75A 5JVHQ 2DGOA 1AYEA 1SKSA 5IT0A 4K2JA 2QT7A 4DL5A 3IXQA 3UN3A 3M6VA 1HR0F 5IM0B 4MK7A 4ES1A 1Q86T 4KR0B 4NMXA 5B0AA 4C9DA 4LVOP 2W9CA 1U48A 2PMHA 3FCWA 2GS8A 3CNQP 1R6VA 3AXKA 3ETOA
chains in the Genus database with same CATH topology
4O4RA 1BQMB 3V6KA 2HRYA 1N48A 5K8MA 4C11B 1VQ7S 2B6AA 4HLBA 1LV5A 3DI6B 3C6UA 1VHFA 2BM1A 2EKYA 2C42A 2MZRA 3H59A 1IKXB 4OX6A 4DV5F 1N33F 1T95A 4F26A 1JKHA 3M6XA 3H5SA 3RW7A 2HG4A 3UE2A 1QAXA 4QIEA 2DITA 2AJ1A 3TYTA 4LFBF 3ZFVA 1B0VA 1S0NA 1YRTA 4DV7F 4K4XA 5AXKA 5ITHA 4OHWA 2I2YA 1VGYA 2I0XA 2XGQA 2XS7A 2QA1A 3DRSB 4I2QB 4O3RA 3VF0B 1IKWA 2WOMB 1X7VA 4U7CA 5U47A 1XMOF 3OXLA 1X9MA 2PO4A 4R5PA 2W9CB 2CZVC 1U47A 4ID5B 4Q43A 5D6GA 4U7UK 1TKXB 4A46A 4RUAA 2E44A 1FKAF 1KLNA 3PO4A 3D5MA 4NZ6A 5IT9Y 2LKZA 3UFCX 1EP4A 5IZHA 2KM8C 1FRJA 2RB7A 2JSXA 1CC7A 1C4AA 3MUVP 2AGPA 2CG4A 3IO1A 3M4XA 1S0MA 2CJQA 3HZGA 2KT2A 5I3PA 1FD2A 1U6ZA 4GC6A 1S1XA 2B6AB 2BE2A 3HDSA 2MZJA 1N5SA 4DS5A 1JKHB 5EHHA 1TFWA 5CQGA 3UWTA 4ZP7A 2MZQA 2DNHA 3IWXA 1ZAVA 2P9GA 1RT1A 3KLGB 5KOWA 1UFLA 2RE1A 1UEVA 2ASLA 2QSFA 2VG5A 3I5AA 2XMKA 5DLGA 4ZOSA 5FLXY 5BYSA 1KVIA 4Y2AA 2V9KA 1B64A 2MKIA 3OW2R 2O67A 1IKWB 3CDWA 5KG7A 3U1NA 2OLWA 4QR2A 3LWMA 1BY9A 1TFYA 4R5PB 2E1AA 3CCES 4WKRA 3QGGA 4P7VA 2ZBCA 3T1YF 1XEZA 3OHBA 3MMCA 3HFKA 2HS4A 3LAMA 4ZVFA 3PKYA 1CEZA 2YKPA 4P6QA 3PHEA 1EP4B 2L9WA 1HWKA 4LQ9A 4PUOA 2DNGA 3MI7X 4NLYA 5L1KA 4HT5A 3N6NA 2JH3A 3G8TA 5K8PA 1C0TB 2ZC4A 2O01C 3W2VA 3VTIA 1S1XB 3X1LB 2BE2B 1MW7A 1WELA 5I3QA 4ECZA 3CJKA 2DR5A 3GFXA 2DNPA 3T1AA 3NCRA 3OTEA 4KGKA 4Y65A 3L7PA 4MKYA 4YY3F 3MGJA 1V3SA 3RW6A 4FPRA 2DISA 1NKEA 1ZAWA 4NYZA 4A8WA 2QZ8A 2VG5B 5KFQA 3PJWA 2ZH9A 2WSCC 2XSFA 3U1MA 3V4IA 4MTPA 4WTYA 5HL7Q 2UZAA 3IAM9 4DFMA 1T7PA 2VFSA 2P6SA 4TYAA 1SJ3P 1TL3A 1WWHA 4Y34A 1OPZA 1T05B 7FD1A 4PG5A 2V4RA 4I67A 3BGLA 4RBUA 1DTTA 3OHAA 1IJFB 4NLDA 1ZH5A 1IQTA 2LQBA 3MMCB 3PY8A 2EG1A 4FVCA 4LF5F 5FIIA 4IFYA 3KYLA 4ZPDA 4PUOB 2FB0A 4KAIA 4C8NA 5DQGA 3IRWP 4HL9A 1Q8LA 2AP6A 1S97A 2DNLA 4DQSA 1J5EF 4P7TA 1S9GA 2ZJRQ 1A6LA 1Y4ZB 3UCZP 1QE1A 4EFAC 2QLWA 2ZNZA 5HI7A 2W7OA 3UDCA 3RB0A