4JI1J

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4ji1J00
4B3RJ 4DR2J 2UXBJ 5IT9U 4X66J 5A2QU 5AJ3J 1XNQJ 2HHHJ 2UU9J 2KVQE 4LFBJ 4LFCJ 4DUZJ 4KYZA 3T1YJ 4X62J 4JI4J 5FLXU 4LF8J 2VQFJ 5IWAJ 2ZM6J 4DV2J 1IBLJ 4DR4J 4LF5J 2KL8A 4PWWA 3OTOJ 2F4VJ 4DV3J 4KHPJ 4DR3J 1N34J 2UUAJ 4LF7J 1XMOJ 4B3TJ 4DR7J 1N36J 1HNXJ 3W1YC 3D3BJ 3IMQJ 4JI8J 4JI7J 4DV0J 2E5LJ 4X65J 1IBMJ 4GKJJ 4NEZA 4DV1J 1HR0J 4LF4J 4OX9J 4JI3J 4DV6J 5LM7E 2VQEJ 4RJVA 1XMQJ 2UUBJ 4JI6J 4LF9J 4B3MJ 4DR5J 4DUYJ 4KY3A 1J5EJ 1FJGJ 4DV4J 4HHUA 4DR1J 5LMNJ 4JV5J 3J81U 1HNWJ 1HNZJ 4YHHJ 1I94J 2UXDJ 4AQYJ 4YY3J 4V1Ak 4NXMJ 3R2CJ 2UUCJ 4GKKJ 2MEWA 2MTLA 4JI1J 3T1HJ 3R2DJ 4JI0J 4JI5J 4DV7J 4JI2J 4NXNJ 4LFAJ 4DR6J 5LMUJ 4DV5J 1IBKJ 1XNRJ 4JYAJ 3J80U 5BR8J 4B3SJ 3D3CJ 4X64J 2MQ8A 4NEYA 1N33J 4LF6J 4K0KJ 3J7AN 3JAMU 2UXCJ 1N32J
chains in the Genus database with same CATH superfamily
4DF4A 4DLEA 2FGCA 4ENOA 3W5YA 5A2QY 4KQZA 4DBQA 3KMQA 2X1AA 3MFIA 2CQCA 1VJWA 2V2ZA 4DN0A 1VQYA 3VQSA 1RISA 3R5CA 2KL8A 4IUFA 4X4RA 2QT7A 2P5VA 2DPIA 2M2BA 1N34J 1NDCA 2QRRA 3QSIA 3BO4A 2ZZTA 3DLBA 4J9OA 3OUYA 4DV7F 1OQ6A 2NUHA 4WCEQ 1R31A 1NJWA 4P2SA 3SMZA 1W7WA 4OZ5A 2LLZA 3W66A 4QPXA 1IJFB 2W9BB 4XIUA 1HNWJ 1M1KT 1FEEA 3U1LA 2GVDA 3UNGC 2FJWA 4PXDA 4NXMJ 2RSQA 2BEFA 5FIIA 4O44A 2FGOA 1IXKA 1HBNA 3BH7B 3TJAA 2V2QA 2ZZNA 1IVZA 3X3UA 2D1CA 4DQRA 2HEKA 2Z57B 1QAJA 2IYIA 3GIRA 3PKYA 1RQ0A 4IO1A 4LF1A 4CNZA 1CJUA 2C22A 5HROB 4NLTA 2GO8A 4W4MA 5J2MA 1EHWA 4IH6A 3QAEA 2L9NA 1GAOA 5F0WA 2B6AB 5BR8F 4I56A 1V9OA 5C2CA 1D3WA 3D9BA 2DK2A 3GLJA 4HLBA 2ZHAA 4IKAA 1RT3B 2NXNA 4J9KA 3I0SA 1R8AA 2RILA 2LQBA 1H38A 2OI2A 3PRDA 1SC4B 3P3DA 5ETKA 4YR0A 4E2FB 4KV8B 1VRUA 1ZAVA 3ETMA 2HIYA 3NNAA 5GMKa 2DGUA 3WZ0A 4OI6A 2L3MA 3PKMA 2ATCB 1SI9A 1RYRA 3PFEA 2NREA 5EDWA 4TU9A 3IM9A 3ISNC 2R4FA 2ABYA 4PWDA 3DN9A 4C8ZA 3C14B 4C0OC 3FDSA 5FLXY 3TW0A 2GIQA 4OZNA 4CT9A 3VGUA 2AMCB 2DGSA 3IBFB 1LK7A 4KGXB 3KLFB 5M2RA 2OPPB 4DG1A 2YKAA 3PIPQ 1RJJA 3ENAA 3VAJA 1YX2A 3HK2A 1UVIA 1FXDA 1UZHA 1ZM2A 3QT6A 3GIMA 4KKOA 4B3SF 3MEGA 3LQVA 5C24B 2UVUA 5LT5A 4RNOA 4X66F 3TR5A 3UDCA 5EUHA 4IQXA 3IBCB 4LRBA 2ZUAA 2Z30B 5E0OA 4WBFA 3ZC4A 4LF5F 1NZAA 3HKWA 2Z58B 1X5OA 1QVGR 2WBRA 3JXOA 2ZH8A 5D4NA 1FX2A 2JL9A 5IM0B 1YG0A 1ELOA 2GA7A 3JYTB 3D7SB 1N6QB 2DGTA 4QIVA 3ET6B 1X60A 3BBFA 2QLJB 4JI6F 2QA4G 2H51B 3L3CA 2WVDA 4I2QA 2XB2D 3NS5A 2XQCA 3H5XA 1N0VC 1RYSA 1BQMA 1S7HA 3W9IA 4H4MA 4X62J 1S76D 4PG7A 1U1LA 1YIJS 3D6TB 4FS1A 3KK3B 3IO1A 3W64A 1XBWA 2AGQA 2RF2A 1KTVA 2GJFA 4K7QA 1S12A 4OYMA 2RDJA 3R6GB 4I69A 4LIWA 2QO3A 3L4BC 4O3OA 3VAMA 3O1LA 5EX3A 5GAGU 5ETRA 1HFEL 3OFFA 5J2PB 3UDEA 4FF3A 3HT3A 5I42B 2RDIA 2FVCA 3D5MA 1UMJA 2W4DA 2W4PA 4M95A 1U8SA 2NXEA 3BH6B 1GQEA 3MDFA 2UXDJ 2EFPA 5KFHA 1CBKA 4HHHA 3BKTA 3J7Z5 5F3TA 1WTBA 1VOMA 3ZZZA 3DGVA 3QRPA 4NEYA 2W9BA 2DNLA 2XMMA 3RGIA 1ZZNA 4BDPA 4DXLA 4OZLA 3M2RB 1NB2A 3GE9A 2BQUA 4KHPJ 3GR1A 4DLGA 4CZCA 2Z4PA 2GO9A 5AJ3F 2HYIB 4M5KA 4RUHA 2C3OA 3O5TB 1S1UB 2X1FA 1ZZFA 3MR2A 3FBFA 1LEOA 1WOPA 2JVOA 1S9FA 2A3JA 3PTWA 1YZ6A 4PUOB 2WOMA 2VA3A 2OKQA 2B6AA 4CM2A 2EI5A 4K5SA 3SCJE 1F2GA 1MMLA 3HI9A 4TYAA 1JJ2R 5I3UB 2G0IA 1S9EB 3QAUA 4KV8A 2Q3PA 2DGWA 3I9V9 3UDVA 4B02A 3TVKA 4EEYA 2KTQA 3VVUA 5KFPA 1VQLS 4NCBA 1S99A 1N5VA 2HQ3A 4F36A 4C6AA 3V6HA 2CQDA 4B3MF 1S6PB 4ZIWA 2OO4A 2J0WA 2ILYA 4EO8A 2VODA 2LVWA 4YHHF 5KOWA 1FVQA 1RWMB 1KVKA 4N76A 3T3FA 2UV8A 1SV5B 2CQ3A 2W2QP 3BBBA 3MM8B 3KLFA 3MXHP 2OPPA 2XMAA 5IZHA 4HACB 3FEXB 4PKDB 3AOAA 2VPWB 1UJ6A 2P9GA 1MWQA 4HHUA 1N34F 2WVEA 5CXTA 4U6PA 3M9MB 5C24A 1X5TA 4WYWA 1TK0A 3ADAC 4ICLB 4ID5B 1HWUA 2MZRA 1VC6A 2RUGA 3QJPA 3LP1B 3QNWB 4ZJOA 3TARA 4OLOA 4P2XA 2V8GA 4ZVHA 2N4CA 4CH1A 5IM0A 1HNWF 2ASDA 4DMZA 3JYTA 1B0VA 3QT7A 5ETLA 4ZLNA 4NXMF 1ZPWX 4QWEA 1N6QA 1N88A 3P49B 1FXLA 2VBZA 3ET6A 1RWVB 3FRYA 4ECYA 1RAIB 3IG1B 1FDDA 1FD8A 4ZVGA 5KFCA 3NS6A 5KG0A 3AQOA 4ANDA 4MIAA 4M5NA 2RRAA 2IC3B 4J9VA 2RQ4A 4J37A 3WQPA 4J9SA 3HHLD 2L41A 2FVSA 3OXGA 4OHVA 2UUBJ 3LUYA 4LF9J 2RT3A 3KK3A 3J81j 1Q8IA 1RHUB 1F2HA 2VFVA 2H5IB 2B3TB 3BZQA 2YQ1A 4ZN1A 3OXLA 3T5LA 4PG6A 4RUCA 2CPJA 1NKBA 4OI1A 3E01B 4YN3B 3MFHA 5J2PA 3UN3A 5JUMA 2AX0A 1S1XB 5GAGI 3D3CJ 2XHWA 4KE5A 4ECZA 1JNRB 4K4UA 4PXBA 2UXBJ 4R5PB 2XMVA 3DOLB 2IMOA 2MQLA 1HQ2A 1KNZA 3C6TB 1CULB 2IBKA 5LJ3Y 5A6PA 1WNEA 1AFJA 1VLYA 4OIXA 2N4DA 4A8YA 3IFEA 2XWXA 2HGMA 1FRKA 4ZMMA 2LEPA 4USKA 4F4YA 2CXEA 2FVPA 3KUEA 3KOAA 3PW7A 4ZVTB 2ROPA 1NKEA 4J9QA 4DPYA 3T9NA 2BKPA 3CC2S 4KH1B 4ZN3A 3KLEB 2G4BA 3R6LB 4OZJA 2XYPB 2AEJA 3M32B 2HHXA 3IA0A 1RCOB 2KJWA 4AL5A 2ZJRQ 4F4XA 2OPQB 3KLIB 4JI2J 1UJ4A 1WTFA 2F4VF 4RPFA 4ANEA 1D9AA 2C42A 2HVZA 3HJVA 4B3RJ 1R3NA 4IOBA 3SQOP 4KC5A 1FRJA 4ZVPB 1F60B 1UVLA 1JLBB 8ATCB 1DQAA 3D0GE 1FJEB 3QBCA 3QLHB 2DNNA 4OHXA 4WFZA 3VVTA 4RW9A 4PEOA 1HPZB 1S9EA 4RW6B 4KT0C 1QUPA 2DNRA 3EM1A 4LBPA 4C98A 3VZHA 2MKHA 1VGYA 3IRWP 3K0JA 1PJ5A 4X62F 3SFGA 2Y3YA 1V5IB 2MY7A 1RB0A 1S6PA 3OFHA 3CIMA 4ETZA 1S97A 3KK2A 1KLNA 2E7WA 5CZVA 2XNRA 3CGIA 3FEYB 4YY3J 2JZ5A 3MM8A 1SQFA 4YEAA 1S49A 5CYJA 4M5MA 4HACA 2MQOA 2IM0A 1IQZA 5DDQC 1HBUA 5IXUA 2KT2A 1FRLA 3KKFA 2JLFA 2UXDF 4DZDA 4FYWB 2P2CB 2W25A 4JI3F 2DNMA 4ICLA 4WKYA 2JLGA 4NLYA 2R2RA 1YSJA 4ZPWR 3FBEA 2MHNA 4E98A 5CD4H 2OPSB 4L6V3 1ZPVA 2Z2YB 1TR0A 2Y8WA 2XM3A 3NLCA 1FFWB 4P2MA 4JI1F 1NDKA 3FK4A 1TL7B 1SQEA 2N3OA 2HQDA 3UW1A 4F4ZA 2HURA 3BGUA 1MROA 2L9WA 4RU9A 4TQSA 2DIVA 3MAHA 2GAHC 2QA1A 3J81U 4PG5A 3Q2SC 1JMTA 2IC3A 3QYYA 2BACA 3FKBA 4F8RA 5D4OA 4NRTA 1TKXB 2AJFE 3J80U 3CCSS 1Q78A 3BSNA 3BM7A 1VRTB 3OQ2A 1G1XA 3Q0AA 5DDRC 2HHHJ 3M2UB 2ZVSA 2GVZB 4NLWA 2UU9J 2B8PA 1C4AA 1SJ4P 1B7FA 2H5EA 1MMNA 2OAUA 2HQFA 4UOCA 3E01A 1M5PC 2HVIA 4ZJLA 1S1XA 4UUWA 4DR3J 1KRPA 3MECA 3R27A 2YWKA 2Z2LA 1RA6A 5A6WA 3SCKE 1QDUB 5I3PA 3TEHB 3I55S 3DOLA 3DLHA 3RYLA 2YNHB 3C6TA 5HMZA 1CULA 1KC8T 2O66A 5F8NA 4NI2B 2VUGA 3K17A 1KKHA 2EKNA 4ZVQB 5KFXA 3JSMB 3D0IE 4LFAJ 3P6YC 3B4MA 1YK9A 4JYAJ 2ASLA 3R7NB 3MD1A 1GK8A 3MWBA 3BYPA 4GO5X 2W7PA 1TMMA 1I6JA 5EHHA 1NDLA 3T1YJ 4HH1A 4EWTA 4NRUA 1GEHA 3C15B 2OPQA 1D8YA 1VK8A 1GX6A 1WELA 2DR6A 2W24A 2W2PP 2UZAA 3ULHA 1AT1B 1WKJA 4JV0A 1WC6A 2WONB 3SXLA 4NA1A 1DY3A 3LGNA 1JLBA 3HD1A 1U1QA 4QWDA 3QLHA 2ROEA 1VISA 2VFRA 1VQ5S 2DJWA 4OJ1A 1RHQB 4OX8A 1HPZA 2LEAA 3FEZA 2PGCA 4RW6A 2HHTA 1EB0A 4IFYB 1UWBB 1X8DA 1YZ7A 2RB7A 2BDPA 3P4UB 1FNOA 1RT6A 2JEIA 4B3OB 2HK2A 2D3ZA 2V5HG 1FWLA 2UUBF 3G96A 3AD8C 1H2VZ 4LF9F 4PXCA 2GHVC 1IKVB 3HO1A 4NLSA 2VBXA 2W2OP 2WHOA 1LOUA 2ZOMA 3NCPA 4K0KJ 5J2QA 2ZD1A 3HD2A 5SUHA 2VA2A 1LFWA 1T9YA 2YTCA 2MLXA 3DYAB 5KOXA 4CLUA 2B4UA 1S0NA 2QIFA 3QATA 2QYCA 2XEXA 1TL3B 1EP4B 3BO2A 4R0JA 3NKYA 1IBLJ 1XC9A 2VZ9A 2XI3A 1UFLA 4C8OA 3LAKA 3IRXA 1N36J 5E3CA 1V5VA 4JI0F 3AA9A 3H5SA 2FDNA 3JTNA 3SI8A 1TAQA 2KN4A 4A8QA 1F9FA 4J7CA 4DV4J 4ILMA 2K3IA 2OPSA 1TUVA 1D8ZA 3OL9A 3M8WA 1G4CA 3HHDA 4ECUA 4JI4F 3OD2A 2FZKB 1Y10A 5AXLA 5CH7B 4CLLA 3MCNA 1TL7A 3NWGA 3AB2B 1CJTA 4DFJA 2X1GA 3WX4A 4EZ9A 4X64J 3CULA 1LW0B 2CUYA 4U67Q 1KR4A 4ZP9A 1FI4A 4RNNA 3CD6S 3CCES 1WC3A 1OYDA 2JEFA 2ZH7A 2B8QA 1LW2B 2I5JB 1YRXA 1Q8BA 3R5GA 4JI2F 1TK5A 2YWHA 1KVIA 4F0KA 2E5GA 2XYHB 2YKOA 1U1OA 2AZ3A 3M1VA 2UUAJ 3RUBL 1RI7A 4B9SA 4B3RF 4DR7J 3QZ7A 1AB8A 3OL6A 2CNOB 2DTJA 2FHJA 1FX4A 2KO1A 4ETXA 3EJMA 1X4GA 3B82A 1RK8A 3M2UA 4LREA 4GO7X 4YR3A 1TP7A 3CCRS 2LEBA 3TX8A 4ECVA 1RKIA 1S1WB 3N28A 1FE4A 4RL1A 2XY6A 1R0BG 2JSXA 3K5PA 1U8WA 2EFNA 4ZCKA 3PHTA 2MY8A 1C0UB 4DX7A 3RRKA 2KT5A 5BYRA 2YNHA 1EQMA 1U2FA 3RR7A 1IBKJ 1RU1A 1K8AT 1Q5VA 4FXDA 3A8KA 4IDKB 4LSZB 4CLPA 4NI2A 4ER8A 1NK6A 3HX9A 4ZHRB 3GFHA 4J9NA 3ZTPA 4QCLA 1XR5A 1TUGB 3DOKB 4OZ1A 4EUVA 2UUWA 2POKA 3H4DA 2VICA 2BX6A 3JSMA 2DH8A 4WZMA 2DGOA 4CTAB 2VHGA 3HF5A 1VQ7S 2RH3A 4BWJA 1ZTWA 1UPMB 2IHR1 3ZFVA 2EC2A 3ILOA 4ID8A 1U1KA 2B4OA 2HG4A 1FRHA 5AE3A 2KM8C 5E3AA 4F0HA 3W5XA 2J9EA 3GV8B 3DLJA 4LF4J 2OEJA 2B9YA 2KDOA 1RWKB 5ETSA 2IDLA 2OTJS 3NMAA 4FP9A 3Q8UA 5DQHA 5EWGA 2V4RA 4NCGB 3QT5A 4DS5A 4ZVSB 1IKWB 2DGXA 2H1YA 2E29A 2FLLA 1RBAA 2WB4A 2HFSA 1RT2B 1URRA 2WONA 2AJ1A 3PDNA 1S7IA 1RT4B 3IR6B 3W2VB 1X5SA 4TVAB 2AWZA 5ETTA 4CM0A 5DM6Q 1B0PA 4V19X 5GAHU 2CJAA 4WE1B 4IFYA 5K5MA 1JLQA 1UWBA 1HL6A 1C0TB 2JWNA 1RWWB 2HNYB 4A4JA 1A7GE 1DTQB 1PILA 3MPYA 2ZH6A 3SV3A 4B3OA 3C16A 3ENQA 4FXVA 2BJDA 2CNKB 1IKVA 2EK6A 2V68A 3ZZTA 2VG5B 1QTMA 2LXUA 2HHHF 3HZGA 1XR6A 2YWWA 2AYMA 1NZ8A 3AQPA 4DSJA 3DYAA 3UCUP 3I96A 1H6KX 1K1SA 4AL6A 3CC4S 4M5GA 4DV6J 1TL3A 1ZA1B 1EP4A 1IM4A 3J7ZT 1QE1B 4B9MA 2ZEJA 1T03B 5DJBA 4ZVRB 2LXFA 3E2EA 2FVRA 2C1EB 1RWXB 3W2WB 4H4KA 5F8JA 4L74A 1T94A 5KFKA 5D15A 2R7QA 3BR8A 3HZEA 4KRWA 3PEHA 3CUNA 1QAYA 4WFBQ 2DISA 4L3KA 4DQPA 3VGSA 4YDDB 3EYZA 2CPEA 4JBCA 4ZPDA 1HNVB 2C2ZB 1NK8A 3CJ8A 2FTRA 1FTCA 4IG3B 2BVZA 2JRSA 5KG1A 2R2UA 1U7LA 2Y0BB 1DAXA 1HA1A 4RBUA 4JYAF 4F4WA 4KIAA 3R3TA 3W60A 1LW0A 2CQHA 3OR2B 4KGMA 5CYQB 2IA0A 1VR6A 1F6TA 1RAFB 4OJ3A 3T1YF 2I5JA 5B0BA 3ZTQA 3C6UA 2M0GB 2HNDA 3QGIA 4I64A 3UD3P 1U0HB 2PEHA 2P6SA 4O3SA 2AYEA 2MQPA 5D78A 5AE2A 2BA9A 1T3OA 1UA0A 1MWZA 3FCVA 2PEBA 3G6ES 1SJFA 2GGPB 4M63A 3HFZB 2ZKUA 1U24A 1S1WA 3RBEA 5CYMB 1KOOA 5DDPC 4NYPA 5EWFA 1GNKA 2CWKA 4CP5A 1IM6A 2ZKTA 3PVXA 3IR5B 4LF8J 4Q2LA 4WFYA 1DURA 4FYVB 4MKBA 1OMSA 1J5EF 3KUHA 1QSYA 1RTIB 4TY9A 4B08A 1FA0A 3UN2A 3K2YA 3DMJB 4K59A 2H4YB 3CCMS 1H2UX 4UZCA 4K0KF 5KT6A 2DR8A 4X84A 2UUCF 3FMBA 2CZ9A 4CO0A 2P9CA 2AJ4A 5F9LA 3DOKA 2KRRA 4Q7AA 4LT6A 1T95A 1IBLF 4XTTA 1DHMA 1NPPA 4DFMA 1X31C 5DGAA 4DN9A 1MU2B 2OGUA 3KG4A 4C8NA 5DM7Q 3BGRB 3BV8A 1N36F 3TQEA 4IFVB 3FGVA 3TWZA 4UOFA 2AHOB 1SC1B 2RIJA 2OP5A 5LMUJ 4I68A 4PPDA 5HQLA 3SSQA 4DV4F 1N33J 3U27A 4NCGA 3J7AN 3V4MA 3MCMA 2AGOA 2NXCA 4LRAA 1H2TZ 2HBYB 4ZLLA 1XNQJ 2G2YA 1RT2A 3PRVA 2YWGA 1X0PA 3LA0A 4U96A 5IC6B 4N47A 3W2VA 5KFEA 2F5GA 3R97A 3IS9A 1FT8A 4DV3J 2FY1A 3FZBA 1FF2A 2DXDA 4WE1A 1SH2A 1HNXJ 1C0TA 4J9PA 2J6UA 5GAHI 2J9CA 2HNYA 3HHLC 1SC3B 4WPAA 1DTQA 3KJNB 4KR0B 3I0RB 2GMLA 3CXCR 4Y2MA 1TTHB 1RAAB 3DRPA 2J7WA 2UUAF 2IBOA 2IDEA 4PG4A 1U6FA 4LR9A 2VG5A 4DR7F 3J81Y 4ECSA 3NRBA 3R5BA 1B70B 2BUNA 3ILIA 3THTA 1FJCA 1YBTA 1KFSA 5HBMB 3UCZP 3CB4A 5M2PA 5J1EA 3IXQA 3V4IB 2DCUB 2VFUA 1N54B 1QE1A 3J80Y 6AT1B 3PIOQ 1EX8A 2ACYA 1G7CB 1NK4A 1T03A 3OT9A 1N32J 1MLAA 1UKUA 5IOLA 3I82A 3W2WA 1BQNB 3NGUA 3DLGB 4BLGA 1XEZA 1Q53A 1RT5B 4F2SA 3QRRA 1ZM3A 3BJYA 1IBKF 1D9FA 4Y28C 1U2RA 4F04B 4O3RA 3GJRB 1X4HA 1V3SA 2BKOA 3FBBA 1GMWA 2W4CA 3M6WA 2EG2A 4WU2A 1HNVA 3TUZC 4IG3A 5LM7E 4URSA 2AV5A 3SYZA 5E7OB 4HYKA 2VOPA 2AJQA 4BBYA 4OX6A 5F8MA 2QFJA 1WOOA 2CNNB 2HFVA 3OV7A 4DCJB 3OR2A 1MN9A 1RTDB 2B9WA 1KQFB 4LF4F 3GV5B 3JSBA 4EK2A 4IG0B 4LF2A 1U2CA 4CO4A 1U0HA 4CRJA 2KXHA 4ZPBA 2DNYA 4DL3A 1H72C 5GMEA 2AP6A 2WTFA 4PYAA 4CH7A 2VG6B 2LU2A 2DBBA 1J5OB 2FD2A 2R7WA 2GGPA 2CAJA 2VFSA 1HWKA 1YJVA 3DU6A 4MT1A 2ZBIA 3HT0A 4AQYF 2I8EA 3Q8VA 2OUGA 3M8YA 4B9TA 4ZVOB 4MJKA 3OPKA 4K4SA 3CDEA 2KM8B 1S4EA 1Z2ZA 4ZP7A 3EXYA 3KDNA 2HKEA 2X51A 1RTIA 4WYLA 2FJVA 1WG1A 3EZ5A 2CNLB 3DMJA 1SKWA 2BJ3A 5L9XA 2OHDA 2P9EA 4DUZF 2E1CA 4TLQA 1N4LA 4ED3A 1JLFB 4FN5A 4DV6F 4EYHB 1RLCL 4E8UA 5DS7A 1WORA 1OJ4A 1IJEB 4LUBA 1N5YB 1U45A 5D4LA 3BSAA 4FKXA 4RNFA 5HP1B 1BLUA 1RBOB 3EDQB 3BGRA 1P1TA 4IFVA 1YBAA 1LFPA 3IGVA 3GMGA 3L95X 2VQFJ 1Q4RA 4UOHA 4PAAA 1JJHA 4DR4J 1FEHA 3S7RA 2DY9A 5CAAA 4LF7J 3JQKA 2YNGA 4YQWA 4P2FA 2JFKA 3VALA 3BQ0A 3HJFA 1MNEA 4NEZA 1RDRA 4UQGA 2KXFA 3DLLQ 4AL7A 1IQTA 1VI7A 4DQSA 1HIYA 1U6ZA 1FHTA 3DRRB 3RAMA 1VQ9S 4FBTA 3AB4B 3R8YA 3QO9B 3IR7B 1UVKA 3ZXWA 5JVHQ 2GMHA 2W7OA 1UPPA 2DRAA 1N0UA 2OFHX 5KFAA 2HFZA 4TY8B 2FJBB 3FFIA 4DV7J 3I0RA 2HLTA 1GT8A 1UAWA 3GV7B 3K5MA 3H7HB 3R7BB 2ZBCA 1X4CA 1BUXA 4OZ2A 4MKVA 5HBMA 4K4ZA 1K0VA 2HBZB 4DQQA 4RZRA 1S48A 3V4IA 2O5DA 2JX2A 4J9LA 1GX5A 3NAHA 1AROP 5KFYA 2J0QD 4FS2A 4GKJJ 1YVFA 4LF8F 1BQNA 3DLGA 2QX0A 3UVJB 2HS3A 3EVWA 1RT5A 2NCKL 3W62A 4PQAA 2CRLA 3HLUA 2Z0GA 2CJXB 2BQRA 5HL7Q 2A18A 2N7CA 4TYBA 4HT5A 1VBYA 3M2VB 2MHEA 3MAAB 4ZCMA 3MF5A 4A8KA 2ZH2A 4USIA 4CIOA 1PAEX 5AXNA 2C3MA 1ZETA 3CO9A 4A8XA 3CE8A 3DU5A 1PSDA 2MJNA 1IN0A 2F8EX 5KT4A 2AU0A 1RTDA 3W8GA 5AXKA 3O3LA 2W9CB 3K59A 1HNIB 3GONA 3BYRA 3GYXB 5LMUF 1X4EA 2BJEA 3OL7A 1N33F 2DNQA 1UFWA 5HQMA 3ETOA 2LA4A 3F41A 1XNQF 3AFGA 5RUBA 1CS4B 2VG6A 2SXLA 1J5OA 2Y1JA 4QYZJ 2UXCF 3PW0A 2UP1A 4DV3F 4A8OA 4P74A 1HNXF 2ILZA 2VPXB 1XWLA 2FJEB 5T14A 4BHQA 3H98A 1VQKS 3PW4A 4XPEA 4S0MA 4GMKA 2A6OA 5BYQA 1KONA 5E3QA 3DDNA 3GCWP 4M5IA 2FPHX 2GVDB 1JXVA 1EIYB 4B9UA 1FERA 4O44B 4Y2KA 2OELA 1VS3A 1HBNB 2PA3A 1JLFA 1IWAA 3HSGA 2NQPA 1XQIA 4F2RA 2ZH1A 3OJUA 2OJ3A 1ZH5A 2G2ZA 4NLVA 1N5YA 2GJ2A 4OYXA 4KGVB 1N32F 1TKZB 5IS2A 2ZH3A 1G2EA 3EZOA 3ONQA 4C3LA 3TVYA 1CJKB 3TEGA 1VQPS 2HHVA 3PNIA 4DR6F 1AFIA 1NRKA 3UR3C 2BE2B 3HHLB 5J2MB 4DUYJ 1HQEB 3CEDA 2E7VA 3W63A 2Z56B 1S79A 1CLFA 4MAKA 4AD6A 3MCOA 1HHTP 3TUIC 2AEFA 1L3SA 1UJ5A 3I0SB 3BPDA 4YP3A 1QSLA 2D74B 5L1JA 1UEKA 2XZWA 3DRRA 5CCLA 2IVFB 2OLWA 2I2YA 2FHMA 2MMYA 3QO9A 3M8RA 2F3JA 3UI3A 2KFYA 2HRTA 3I4PA 4OI4A 4XO0A 1M5VC 2KFZA 1ZBTA 1R8PA 3CCTA 2QA4S 2ALYB 2EK1A 4FF4A 1RUSA 4TY8A 1QUVA 4QU6A 4LVNP 4KGZB 2GQCA 5D0EA 4ERDA 4ZJQA 2XO6A 2WW8A 3LAMA 1V3ZA 5HMXA 2OIHA 4NLXA 2GZOA 1WUUA 2V69A 2YWEA 1H73A 2QN6B 3C46A 2MKYA 2PI4A 4JB8B 1I3OB 2HQCA 3F73A 1GXTA 4I0WA 1F1BB 3IM8A 1FRIA 1DTTB 3CJ0A 2ZDPA 2K8GA 2B9EA 5F9NA 2FLPA 3CTRA 1SJQA 3I5AA 2XS2A 2MEWA 3RBDA 4OJHA 3FZ2A 2LCWA 3KK1A 3UVJA 3QWPA 2OEMA 5DLFA 1C1CB 4BWMA 4KJIA 1DLOB 1EZZB 3NY0A 4HEA9 3J7A1 1K1QA 1L3VA 3L7PA 2CJ9A 1TL1B 3CIZA 4OI3A 4DI6A 3CF5Q 1Q5YA 4RUAA 1M5SA 2I6WA 1Q7LB 4F3QA 3KDOA 3M2VA 3MAAA 2EPIA 3H25A 3D6MB 2HVHA 2E5LJ 4ED2A 3MGJA 1HR0J 1UL3A 4QIGA 4IH7A 1XNRF 3F0NA 4DR4F 2W9CA 4B3MJ 1HNIA 3CMES 3NNCA 1JLEB 3TUPA 4J5OA 2CQ0A 4LF7F 2W8LA 1NJYA 4YHHJ 1R27B 3FCWA 3VHQA 5A8WB 2LECA 5KT2A 2BOAA 8AT1B 1CG2A 1CQNA 2U2FA 4NLPA 3KNGA 3MM7B 1CS4A 5DG9A 1HYSB 1Q95G 4F3MA 3K89A 3RZAA 1FK9B 4QR1A 4DEZA 4Z7YA 2Y1RI 5D77A 2HLUA 2PI5A 2YQ3A 4EGLA 3TQ1A 1JB0C 2EG1A 1RBLA 2QSFA 4A8MP 3E3XA 4DX6A 4TU8A 3ISND 2J8SA 2GNKA 3PW2A 1VHIA 1Q16B 3HHEA 3D6HB 1TKTA 2NYHA 2CYYA 3TJ8A 2AQ4A 1WHVA 2DO0A 2R2SA 4RW4B 1RP5A 2EC0A 3CJKB 1D0EA 3T5KA 2HS0A 4C11A 4F3OA 4MIBA 3BGOP 3IC1A 1T9UA 3BN4A 3T1AA 4W92B 5ETNA 5DRKA 3PR5B 1REVB 1C2PA 3Q8SB 4C7QA 1TKZA 4PWUA 3RRGA 4MK7A 4GKJF 3MHYA 2MTLA 3UQSA 3MCSA 1CJKA 2FQQB 3KMSA 2V50A 2HFUA 3I31A 2NSCA 3RBZA 2BE2A 3HHLA 3A3PB 4URGA 1HQEA 2C3PA 1NSAA 3OR1A 4GVBA 2WOMB 1DRZA 3JAMU 2BQ3A 4MMOA 5CQGA 4X65F 2ZHBA 2GS8A 1FNMA 2HZVA 4EBEA 4UY85 2COLA 1RTJB 3UE2A 3QFWA 4HKQA 2MKKA 2HFOA 4PQUA 1KBRA 4V19J 4A8SA 4O3PA 3GG0A 3K58A 2AYBA 2VONA 1FDBA 4CWBA 2Y0SD 3X1LB 3ZTRA 2QC3A 3EZUA 2A0FB 5H9FJ 4M8LA 1ACMB 1SH0A 5G4DA 2W2MP 2I1RA 3HXMA 2XMWA 5HJXA 3BS9A 2W01A 4X4UA 4NMLA 3K57A 5KTQA 3O44A 3FUYA 4PPZA 2MZSA 1KQSR 5F3ZA 5HJYA 3OTCA 1YLXA 1XN9A 4OHZA 1MSWD 1OYEA 4ES2A 4Q43A 7FDRA 4DSIA 2CZVC 3GR0A 3AD9C 2NZCA 4C2MA 3CVKA 4X4VA 4N5SA 2OSQA 1UVMA 3QJJA 2XMJA 1YDLA 2HAIA 1DTTA 1XTZA 2HPUA 4NE9C 1X0FA 3LANA 1Q82T 3HHNB 2JHEA 3MM9B 2XLJA 2F4VJ 1C1CA 2CWXA 3GQCA 4RNMA 4YB5A 1DLOA 2QL7B 2HBRB 2U1AA 1KLMB 3BR9A 5EGYA 2VH7A 1VQ6S 1KQKA 3KJVA 4PYDA 1B3TA 5ADZA 3OSNA 1TL1A 3W7BA 3D1QA 4OX9J 2V2KA 2F7VA 3UDLA 1WC0A 1WHXA 4N8OA 3TUJC 2KRBA 3CDAA 3SSRA 3AOBA 1HHSA 3N4WA 1LWEA 4U7UK 5KFZA 3EPIA 1APSA 5KG7A 5KFDA 2HMIB 5DGBA 4PRFA 2CPIA 3OVSA 4DUYF 1JLEA 2GCFA 1RZMA 2R9LA 2IA6A 2BRKA 1VYAA 2D41A 3TAMB 4N77A 4FF2A 2HRUA 5A8WA 2R8HA 3GZ7A 1R0AB 2H9ZA 2QA2A 5FLXU 4ILRA 2UVWA 1S10A 4HH0A 1IKYA 5C42B 2IM2A 3MM7A 2ZH9A 2O67A 1HYSA 2DHAA 1FK9A 1EQ0A 1WC1A 4FVCA 5IV4A 2R7SA 2HAFA 1SXLA 3BKFA 2JOQA 5ETMA 1F5BA 2ALZA 4WTYA 2W2NP 4JI3J 1XMQJ 1F5AA 3N0VA 2ZNYA 4ZCIA 5FDLB 3Q89A 1WI8A 5ETPA 1TV6B 1NHKL 3A3OB 4USWA 3T9ZA 2J0SD 4RW4A 1HI0P 2WAQD 2EBGA 2BANA 2F1FA 4JI1J 3CJKA 3S1TA 3BKUA 2R8GA 1JXEA 2F9JA 2L08A 2MZTA 1X9MA 3R5DA 3D1OA 2HGNA 2MZ1A 3M30B 1RWPB 1XJWB 4A46A 1RT1B 4IR1A 2ZJQQ 1REVA 1FTRA 1CVJA 3S01A 1WC5A 4Q5VA 3A4TA 2JDJA 2Q66A 3JSYA 2KT3A 2BMBA 2B4VA 3AH6A 1JLAB 4QWAA 1S57A 3HPOA 4EO6A 3NL0A 2FUG9 3CJ2A 1T02A 4FF1A 3TZZA 2XY7A 1SJ3P 3K5OA 3MI7X 5A0YB 4GC6A 1RTJA 3RR8A 4DX8H 5DQGA 4ES3A 4NLUA 4RW9B 2VJVA 4DR1J 2GC8A 2FJAB 4LR7A 2P6TA 2B51A 2MKCA 4LFCF 2N3LA 3WIUA 2HRYA 3Q2TC 4C3MA 3G86A 3MMAB 2E5LF 2CQBA 3A1YG 3A3NB 1HR0F 4J91A 5GAEU 4BC7A 1NO8A 2IM3A 5F8IA 1R8CA 4ALZA 3VAGA 2BABA 2M88A 3KK2B 1QAIA 4A48A 5BJRA 1LKZA 4ZPVR 2ERRA 4TNOA 1SL1A 1KHWA 3G87A 4FYXB 4OYPA 1Z2LA 3V81B 2IRXA 3QMQA 4JUZA 1RHRB 3LP2A 5IWAJ 3RTVA 1RGVA 4FKYA 2DNZA 5DZ7A 4I7FB 3H90A 4LVOP 1HBUB 2NZ4A 1N5TA 5KT3A 3RBXA 3LWLA 1HBMB 3MTJA 1I1GA 2ZC4A 1KVJA 1UA1A 1K47A 1T9XA 3I32A 4NXNF 2BRLA 4HT7A 5D4PA 3N6NA 4Y2CA 4OJGA 1JKHA 1W25A 2E7XA 5JXSA 4K4XA 3AJ1A 3MM9A 1HBOB 3GSDA 3W3SA 1TMJA 3EUNA 4DFKA 1KLMA 4KBIA 3FJ2A 3KJFB 2DKOB 4M1KA 2ATLA 3AOCA 1NJZA 3EDRB 4TXSA 3RB4A 4G3IA 3OVAA 3FSIA 1NAQA 1H7WA 5G0RB 2BW2A 2RVJA 1UFKA 5LOQA 4ZS6A 3NGRA 1FKOB 1MROB 1DQ9A 5H1SV 4Q0BB 2J9DE 4RO0A 3W5ZA 4FYYB 4C4WA 5IT9U 3Q8YA 4H4KC 1P27B 4R25A 3DDIA 5D0RA 1ZA2B 3IP0A 2D7SA 4F26A 2H48B 2MB0B 3QT8A 2HMIA 4K2JA 5KFSA 4AFFA 2DRBA 1UTAA 1BQXA 2M7SA 2OPRB 3BQ2A 3M8ZA 3TAMA 3BSCA 3RU0A 1MN7A 1IBMJ 3UD5A 1RADB 1YBUA 4RBVA 1R0AA 2VB6A 4DV5F 1BE4A 1UP1A 5HQ8A 5C42A 2MQQA 2XULA 2D3UA 3QJLA 4HTIA 1N5SA 3MECB 1FCAA 4OI0A 1VRQC 3M9OB 4LRCA 4JI0J 2O3DA 3EICA 3CCLS 4RKUC 1O6XA 1O51A 2V9WA 4M5DB 4WFXA 1HMVB 5FDLA 5GADU 1J27A 1TV6A 4DV1F 5K9FA 4ANCA 5B0AA 1D09B 3JTOA 1SBRA 2RQKA 5E2QA 4JI4J 5KT5A 1NMEB 4B17A 6FDRA 5KG4A 4YS2A 3ZZOA 2IVYA 1PO6A 4N41A 3W9JA 3M30A 2JNJA 3PX6A 3H8YA 4HL9A 1RT1A 4U9RA 3KWMA 4U8VA 3TP2A 2EFOA 1P9YA 2EFVA 2E5IA 1SIZA 4A47A 2DB1A 3RW6A 2ASJA 4DR5J 2E9RX 1JLAA 1RAGB 4XDCA 3VAFA 3EX7B 2K06A 5KFQA 2E1PA 1PC4A 2N7YA 3KTQA 3C19A 3MR6A 5KFMA 4DSLA 2QE5A 4W98A 3TYTA 4DQIA 2L48A 2CKWA 2ZBQA 1F9HA 5A0YA 2NUUG 1R6YA 7AT1B 4DFPA 4OX9F 4DF8A 2YH1A 2C2MB 1RABB 3TA1A 3ZTSA 3I5CA 3VWSA 3D67A 1O0PA 2FC8A 4HHJA 3N6MA 1BHNA 3D6FB 3IAS9 1KOHA 1VIXA 2HSEB 2F9DA 3MMAA 3BSOA 1Q0NA 1KQGB 5B0EA 2R7VA 1RT6B 2ZWPA 2PFFB 1YJNS 1S6OA 1FD2A 2XHCA 4ZP8A 3OVBA 3UR0A 2X7IA 5GAEI 4ZVFA 2LYVA 5HO4A 2D3OR 4LRFA 2HQGA 2NPFA 4C0BA 1SB6A 2ZD1B 5J2QB 1T05B 1ITPA 2CVEA 3IAM9 4JI7J 2PFDA 5B08A 2R3VA 4IOCQ 3V81A 3ICLA 3CD5A 3DKDA 5K8OA 3ZZRA 2AYGA 3M6UA 3T5HA 2M52A 4HDHA 3RAQA 2LU1A 2ADCA 5I3QA 1LWCB 1S0VA 2MLZA 2PMZD 4CLYA 4I7FA 3O2IA 2LQ8A 1HNZJ 3IRXB 3D28A 3G8QA 1HBMA 2E1AA 2MQNA 2ZBPA 3B6BA 1NSKL 1T9TA 3ILLA 1F3VA 5HATA 1XMQF 4OHYA 4C8LA 3F44A 3CT9A 2NR0A 4P7TA 2YNFB 2EVZA 4RW7B 2QMUB 3BF4A 1HBOA 5D6GA 3ENVA 2IY5B 3KNAA 4CLWA 3Q24A 5B0GA 3HSDA 2RNEA 3U7JA 3ITHA 1EKRA 2DYAA 4X4TA 1KP6A 2RMLA 4DV2J 2E66A 5G0RA 1CJTB 2DXEA 3G8TA 1FKOA 4OV1A 2Q6BA 1YRTA 4DU7A 2A1BA 2RE1A 4Q0BA 2B5JB 2G13A 1LK5A 2MZQA 2MZJA 2BOPA 1KTQA 1VHFA 2EXUA 1EETA 1BWVA 3GIIA 3I56S 2ZITA 3D2WA 5C2GA 2JFDA 2OMOA 2KZMA 2OPRA 5CCMA 3M1VB 1LWXA 3KHLA 1UEVA 4OLPA 1WEXA 1VLOA 1VQOS 5L9NA 1OSDA 4N56A 3SEOA 2XS7A 2CQPA 3VV2B 3KFWX 4DR1F 1K73T 3ZTOA 2C3YA 3MOJB 2PIIA 3JAMY 2MLYA 1FESA 1KWMA 1JLGB 4I67A 4FPRA 2EBEA 3BDPA 2UVRA 1YKWA 3CO0P 2KXNB 2DEJA 1UVJA 2L9DA 2CJYB 3OTEA 2NS1B 5HVHA 4M5DA 1RLDA 4NMXA 1HMVA 3LALA 2LKZA 3MPVA 4DV0J 2F65A 2RD5C 1WF2A 1QSSA 2BYCA 1PG5B 5GADI 4F67A 3S8SA 5IWAF 4O0IA 1WKKA 4DR2F 3A8EA 5KFRA 1X4FA 2X3DA 1CPZA 1S1VB 2QMWA 1B4SA 3PXGa 3H2VE 3C2PA 4OHWA 4MFBB 2H4WB 5KG2A 1WSVA 1OIAA 1S1TA 4OMFG 2MQ8A 4N7TA 4MK8A 5K8PA 4ED5A 3DC2A 2CVIA 1RCXB 2MPUA 2B4PA 3T19A 5KFBA 1O8BA 1M0SA 4ED4A 3VF0B 4RW8B 1Y5NB 4G1QB 1PBUA 5SZTA 5HN0A 2C2OB 5A76A 3D0HE 1NKCA 2HIQA 4CCHA 3KHRA 1JLQB 1NJXA 3V6KA 1N56A 1Y5LB 2C2EA 4KO0B 2IJNA 3NCRA 1OQ3A 4NYOA 4USTA 2FJDB 2FIUA 2VQEJ 3VGVA 1KFDA 3POTB 3GYNA 4WK3A 2QZ8A 3QSYB 2ROGA 2YBVA 1J5EJ 1PYOB 3C16B 3CJSA 1CEZA 1IBCB 3FVYA 2AD9A 1AUSL 4YMEA 2YPZA 1TL5A 1TU0B 4U7UD 3U1MA 1CJVA 2CJBA 1T05A 1IBMF 2UUCJ 1P6TA 1PBAA 5D3GB 3SCIE 2ASYA 1NJIT 1EAYC 1YQHA 4LSNB 9RUBA 2VV5A 2DHSA 2DPJA 1LWCA 2IFXA 1TZ0A 3G6XA 3RB3A 4ECWA 3TANA 2PO4A 1JLCB 2AW0A 4U95A 3P45B 4NA2A 2J6SA 3C66A 2XI2A 1T3NA 3DGPB 2WVFA 2FVQA 2W1BA 4NX9A 3OTDA 2I9SA 5LSLA 3PYFA 2FY8A 2XGQA 1OPIA 4AXJA 5LMNF 5U47A 1VQNS 4YFUA 4CLTA 2ZUGA 2YNFA 4RW7A 2ZC3A 4EBDA 3HKZD 2ZHOA 1WOSA 4DUTA 1VMBA 3WC0A 3DI6B 2XSFA 4AUKA 4WXOA 3M8PB 2MKIA 3P5BP 2XG8A 2B5JA 3HVWA 2B7CB 1XR7A 5B0DA 2B7BB 3MR3A 3L09A 3R5JB 4UY8T 2VKRA 2G9OA 3NS7B 3RB0A 4MIWA 3DFEA 3AODA 4IYQA 4RWWA 3C6UB 4DR5F 3EXCX 2HNDB 1XMOF 1IWGA 4L3NA 4Z2XA 2I38A 5KFVA 2XGPA 2PA8D 2V8DA 4F25A 2GIRA 2KJVA 2CG4A 5EWEA 4WZQA 1NU4A 3EGWB 4FXWA 2XZDB 1KS2A 1GFWB 3LH2S 3MMBB 4C8KA 5AE1A 2YXLA 4IH5A 2G0JA 4KH0B 1I51B 2GQQA 4O4RA 5HAOA 1YJWS 4P71A 4ZVUB 3UWTA 2AJ0A 4FVMA 1M1HA 1S0MA 1YWXA 2CPDA 1JLGA 3DHXA 1WG4A 4OV6A 4OYBA 2RHQB 4EYIB 2JEJA 9ATCB 5B0FA 4OX7A 3AXMA 1FDAA 2Q43A 3T6JA 1UW9A 2RUSA 3KHHA 1A6LA 5H9EJ 1PAUB 4JI7F 3R2CJ 2IYGA 3MUVP 4GKKJ 2R42A 5MAOA 5DG8A 3AY0A 1U25A 1FE0A 3FRZA 4X4OA 2AZ1A 1NLKL 1N48A 4AE5A 4ZDNA 1YGYA 1NDPA 2FHKA 3A12A 1HWLA 3H59A 4ZVEA 4Q45A 1SKUB 1HNZF 3GP9A 2GIFA 3N9UC 1DFDA 4RNHA 1S1VA 5IT0A 4H4OB 2RU3A 4UW2A 1X4DA 3G6VA 4MFBA 3N79A 5KG3A 3BGLA 3HVTB 4CQ1A 1U02A 4WTOB 4HDGA 3PJ9A 2XMUA 4KB7A 4ZIVA 2X1BA 3UPFA 3OHBA 1FJ7A 2NLWA 1HI8A 4O3QA 4PABA 1YITS 2OFGX 4DV2F 3BO3A 1B7YB 4RW8A 3AJ2A 3CDWA 4G1QA 5LXRA 3IS9B 2FB0A 4AQYJ 4UT4A 5HROA 2BM0A 3KG1A 2KH9A 5B09A 4R8UB 3OLBA 3D66A 1KDNA 4KO0A 3R2DJ 2RKIB 3MOZA 3CDUA 4TU7A 3POTA 3K7RA 3QIPB 2HHWA 4UOGA 3H2LA 1C4CA 3DRPB 1PIEA 4BS2A 4ZPAA 1RT3A 1IUJA 2IPOB 2XMKA 2EWHA 5IT9Y 2V67A 2PT0A 1FVSA 2AT1B 4DUZJ 3N5BA 3EVOA 5HVFA 2WSCC 5D3GA 1W2IA 4MTPA 2XLIA 4U7CA 4P10A 2FJXA 1YTYA 3MEDB 3MM6B 1W26A 1Z1ZA 4HI2A 4LSNA 2E5HA 1SPBP 4EMDA 4PWWA 5J1EB 3EGNA 4I6YA 2Y1LB 4DSKA 2OH2A 2KG0A 2HHQA 1K0TA 4CLSA 5LL6d 1UW4A 2HHPA 4JI8J 1JLCA 4E0DA 3DRXA 1NPKA 3MEKA 4RR5A 3R5AA 4GVLA 3NWRA 3G9CA 3DGPA 3C14A 2DHGA 2YQ0A 5KG6A 3TX0A 4R0EA 3RG6A 2DR9A 3H20A 4JV5J 1VIOA 1YI2S 4HVZA 1VQMS 4DV0F 3PFOA 1WHYA 3KJQB 3L7UA 3UCGA 1RHJB 1ZAXA 3DI6A 3NNHA 3PJWA 2YKPA 1TFYA 4BC9A 5A8RB 1TL4A 4NA3A 3M8PA 4ZPCA 1Q81T 1S72S 2HWIA 1D1UA 1QTNB 2CQGA 2W9AA 3MR5A 2A2CA 4X2BA 3PR4A 2RRNA 5BXIA 4DCOB 4DL6A 2C2KB 2VASA 2ZH5A 5IFMA 3NOGA 3BDEA 5CD4A 3Q8QB 4LRDA 1WF0A 1CSJA 4JP8A 4I1TA 2D3O1 1WI6A 1BC6A 2PMHA 3SFUA 1M90T 3MMBA 3WC2A 2V0NA 4USJC 2O01C 4Q44A 2YX1A 2C2RA 4DL2A 2DHXA 3M7VA 3KG0A 1RU2A 1XK8A 4RBTA 4NLRA 3NBPB 2DNOA 3T1HJ 2V34A 5KFOA 4ED1A 2VQEF 4A8FA 4HI1A 2GAGC 4IO9Q 2ZVIA 1QD1A 2QLWA 1G3OA 1S0OA 4DL0C 2DHHA 3AAWB 1U47A 2J8AA 1VJQA 4USMA 2DGVA 3BBCA 5I42A 1WD6A 3PZPA 2EEYA 1BD6A 4HTJA 3AT1B 2FYXA 2QG9B 2OEKA 4KTQA 5L39A 4OI2A 3V6JA 4DJBA 4O3NA 3R1HA 2GQ2A 3V5RA 5T41A 1S6UA 1X9SA 4P7VA 2XYGB 3VGTA 2DNGA 4JV2A 4H4OA 2M70A 2QLXA 3OLAA 3V6DB 1ZS6A 2VJUA 4OYAA 3J7YU 2XBPA 1FNXH 3PRBA 3ELHA 3HVTA 1WKLA 2VD3A 2HZCA 1HW9A 2YNGB 1DZ5A 4YB7A 2XCAA 3M2RA 1WJ9A 3RJMB 1ZTTA 3CCZA 3G4SS 3NXZA 2ACMA 4NPOA 1HARA 5DETA 2WK4A 3H4BA 4I6AA 1UEUA 2J7KA 3KUGA 1T7PA 5J2NB 2B43A 2UXCJ 2CPHA 2CJKA 3IWNC 4YOEA 2YH0A 3MPUB 1T9VA 2MDAA 2DH7A 1S1UA 3ZNUA 2CQ4A 5LJ5Y 2LDYA 2YY3A 4R8UA 1WWHA 4LQ3A 2RKIA 3FFIB 3OW2R 3JQMA 4PUOA 8RUCA 3QIPA 4WP8A 2F4FA 4D3HA 1WEZA 2XSJB 4NLQA 4NZ6A 2JC0A 1M5KC 3VAHA 1HWIA 1WC4A 3GJSB 2V4QA 5I3UA 3M8SA 3AA8A 2F8MA 1X7VA 4M94A 5BYSA 2E5JA 3EWGA 3DRYA 3MEDA 3MM6A 4FPIA 4DDFA 4C0HA 2V4JB 2HK3A 1U4BA 1Y9OA 1D9DA 3OXFA 3QQCD 3HP6A 2HGLA 1SL0A 3RB6A 3LOUA 1NHUA 5ITHA 3OHAA 2LP4A 1RT7B 4JI5J 1R7IA 1ZAWA 4DR6J 1Y0HA 1TK8A 4O23A 4QYZK 2KFNA 2NYIA 3WHIA 4D3GA 1RTZA 2ZE2B 4DL4A 1F5CA 3B54A 5JVGQ 1SV5A 4L72B 3DDKA 4GKKF 2IRYA 3A8IA 5IQQA 3S6EA 4RWXA 4RX6A 2E1MC 4C97A 3QGGA 2HWTA 3MMCB 2H3EB 5A8RA 5C5JA 2XMTA 3ZZPA 4OFZA 4USUA 3R1LA 1TELA 3F56A 4NLGA 4ID5A 2BW7A 4EI2A 3CJ3A 2KKHA 2M9KA 1YJRA 2KHCA 3LP1A 4RJVA 5IT4A 1DJ0A 3U02A 5F8HA 3GG1A 1UWAA 1FJGJ 1N5QA 2ADBA 1S5ZA 1P9QC 2QLFB 4ECXA 2APOA 3M6XA 1U1PA 4NCAA 3BPSP 3GSIA 3LW5C 1YRUA 4WP9A 1NB7A 3IG1A 3WIVA 4KHPF 3CMQA 5ETQA 5B7WA 2C2NA 2VDIA 3KLGB 5THWA 2ZDOA 1OY8A 2QLBB 2ZBRA 1H98A 3D54A 2VF3A 5L8RC 2YKQA 4L75A 3NBPA 1J2VA 2AGPA 1TUWA 4IQMA 1P8GA 1YJ9S 1QJHA 2C3UA 2HVEA 2IJFA 5DZ6A 4UTGA 1ZOTA 2BE9B 1FFSB 3NGTA 4Z7CA 2B9XA 2R8IA 3LTOA 2HZAA 4ZLPA 5KAKA 4QZVB 2XWYA 3RAXA 1X4AA 2CDQA 2VPZB 1L3TA 1AUDA 3DNCA 3L7OA 1W2BR 3BN7A 4QIWD 2C2DA 5L38A 3PYEA 5B0CA 4R5PA 4JI8F 1LWFB 2V94A 2LQ5A 5KFLA 4UZBA 1OY6A 3GFZA 3V6DA 1XNRJ 4I2PB 4DPOA 1NK0A 2KYZA 1QVFR 4OZ3A 2RHSB 4QW8A 3KHGA 3EVMA 5KFUA 3J7YI 2DNKA 4JV5F 3HFKA 4JOUA 1N52B 2W8KA 4ZA1A 3D4JA 5DDOC 4NZ0A 2FLOA 3Q23A 3QIDA 2NSBA 1RWOB 1JK9B 5M2UA 3PACA 3TJ9A 3W8PA 1CC7A 1TQLA 3KLEA 2BE7D 4K4WA 4QWBA 4J9RA 5J2NA 4Y34A 2XLKA 3CCUS 3M32A 1WACA 5C25B 1K9MT 3JTPA 2DNHA 2GX8A 2LFVA 2VPYB 3OL8A 3KLIA 4YB6A 4EBCA 5HMYA 3K5LA 1S6QB 2QL9B 2B56A 4MH8A 3I9ZA 4X4NA 4MKYA 2MKSA 2VKZG 1B64A 2R8JA 3FQKA 4PXEA 3DHWC 2XSJA 5EN1A 4AXIA 3VAKA 1G6BA 4IR9A 1AZSB 2HQIA 1BGXT 3MM5B 3ZO7A 2VC1A 5HI7A 1Y3JA 5E5NA 4J9MA 4CI0B 3DXBA 2DY1A 1Z4UA 2AJ2A 4QR0A 4KGKA 2OSRA 2V4JA 2UVVA 1SJRA 5FJ4A 2FHOB 2NXJA 2BJ8A 3DXSX 5K8NA 3T1HF 4Y6IA 3SCLE 1FRXA 1AYEA 1T9WA 1RT7A 3KK1B 2WSFC 2GMJA 4IRCA 1U48A 2ZWOA 5LXYA 2ZE2A 4L76A 3E51A 4OZ0A 2EKYA 4X65J 2VG7B 2D9OA 1M5OC 3AXKA 5HANA 1GH8A 1H3DA 4CLZA 1WDDA 5IQ6A 4LMZA 1VQSA 3FSXA 4WP3A 4ITSA 1NH8A 2ZZMA 3LPYA 3MMCA 2UXBF 2YX4A 3DOMB 5KFTA 1QLNA 4DPUA 1M5HA 1VC0A 1F9EB 3TRGA 1HD1A 3MPDA 3GILA 2IVMA 1LXJA 3IWLA 1RTHB 2P8IA 3HCXA 3JSRA 4ED7A 4ED0A 3P96A 1EKSA 4WFNQ 4ZP6A 3GJQB 2R8KA 1WDTA 2K7JA 2DT9A 3Q8PB 3TI0A 2YVSA 3QWUA 4KHMA 4KYZA 2D69A 2HHSA 1RACB 1WSRA 2OMLA 2JLEA 2GJIA 2W7AA 5KFNA 5CA5A 4RUBA 2CQ2A 5DG7A 2Z2MA 1RHKB 4NL5A 3GYGA 2PN6A 3KLGA 1SH3A 4ELTA 2CFXA 5KFWA 2C28A 1TVRB 2KVIA 4AT1B 4YB1P 2N82B 2HBQB 2QGFB 3GWCA 3LWMA 1TKXA 1NCLA 2QSWA 3DCAA 2K1RB 1VRTA 4CO2A 1TKTB 2IM1A 1WHWA 3PO4A 4ZPTR 2KU7A 4CYUB 5H9FK 3MEEB 2GVZA 4QBUA 4QJVA 4M5JA 1KN6A 4WWSA 2QTWA 3GCXP 2G1DA 2CPFA 4KPCA 3M9NB 1VBZA 1SL2A 4C11B 4DZ6A 4USHA 2YWFA 4TLRA 5L1IA 4NLOA 3TZWA 3Q22A 4XDDA 1RA7A 1S9GB 4CO5A 3FSYA 1EJ7L 2VOOA 2FZGB 3HMJG 3NGSA 1LWFA 2HW3A 4QU7A 1H7XA 4JI5F 4WFAQ 4UQTA 2ZNZA 1JX4A 3NG8A 3SSSA 4GC7A 4H54A 4I2PA 1Y4ZB 4YY3F 2QYGA 3OR1B 3JS9A 4GVBB 3HFVA 1Y7PA 2PMWA 3CCQS 3W1YC 3W61A 2E44A 1NM2A 2KI2A 3CD7A 1HD0A 2CPXA 4W90B 2Z2ZA 1T11A 2MSTA 1KHVA 4DL5A 3HDSA 2NXUA 2R7XA 4EZ6A 2EFGA 1IKXB 2XZTB 1Q79A 1CQMA 3MPWA 4PQUB 4NOHA 2BBEA 2M8DB 3FMWA 2CG8A 1GMUA 5AT1B 4CDIA 4WXWA 2GW8A 1ROFA 2IMWP 5C25A 1E6YB 2VL1A 4QQBA 3C15A 3NMRA 5HK4A 3US5A 1S6QA 3MR7A 1FJGF 3KXDA 4G1IA 4QYRA 3NEKA 4MYTA 1UVNA 3D1HA 5DO2A 4LFBJ 3PW5A 3U1NA 1VDHA 1AZSA 3B78A 3CJTA 3MM5A 3GPAA 2R7TA 2IIHA 1FKPB 1P1LA 3CDBA 3V2UC 4ZKAA 3H40A 3HM9A 4B3TJ 1OPZA 3CJRA 1NPRA 2JC1A 4FZVA 1VQ8S 5ETOA 2A6MA 2LXIA 2V8PA 2VIHA 5KFJA 4OYOA 2LMIA 2HWHA 1NK7A 4QR2A 3OFGA 4ECQA 4QOTA 4LQ9A 1GTHA 1GTEA 3MTKA 1CC8A 3UN5A 2UU9F 1LXNA 3N6LA 4P9SA 3KJVB 7FD1A 3C3LA 3RW7A 3R7SB 1TFWA 4QW9A 4XAKA 5FD1A 2VG7A 4IOAQ 2J5AA 3FQLA 4F0MA 4DR3F 2BR0A 4K8RA 1AXQA 4YDXA 4LF6J 2H54B 3DOMA 4DHVA 2V8VA 1LWEB 2LQ9A 3PYDA 1FWPA 1JJ4A 4LFCJ 1R89A 2DXFA 3UO0A 1Q8KA 2DH9A 3CJQA 1B99A 2KG1A 1QAXA 3LP0B 1L3UA 2F63A 3VQTA 1RTHA 3ISZA 1F3FA 3TOQA 1ZM9A 4OL8A 2QEXS 2Y8YA 4QPTA 3TAQA 2DVIA 2XC9A 4Y0FA 4G6VB 2RU9A 3B4DA 5K14B 2H65B 4LFAF 3SV4A 4KPYA 4CO3A 2A2DA 1HHQA 2YX7A 3PX4A 1Q7YT 1IKYB 1BMQB 2CQIA 3TAPA 1QY7A 4ZOSA 4C8YA 4UUXA 1RWNB 4MK9A 5D8HB 2WVCA 3GFYA 3ENWA 1LW2A 3TZXA 4QIEA 1Q1KA 1TVRA 3UFCX 1MWYA 2RQMA 3OBIA 4G1PA 1WG5A 4EFAC 5KG5A 3ZZ0A 3QRQA 4NXNJ 3PJXA 2K1RA 3NP5A 2FZCB 2RS8A 3HVRA 3D68A 3PY8A 5E33A 3EMTA 1A9NB 4QIFA 5A8KB 2BJ1A 1PCAA 4CYUA 3CCWA 3MEEA 4LJMA 3QGHA 3QZ8A 2ZOGA 3LGMA 4DCPB 1U1RA 1XMBA 2BANB 1SIWB 4X4SA 2I0XA 5LSRA 1X9WA 1X5PA 4KAIA 2JH3A 1U1MA 1YJUA 1PJ6A 3SZ2A 1NSPA 4P72A 3IMQJ 3K8WA 4MKAA 1S9GA 2EFQA 3VR1A 3OJSA 4O4GB 1C0UA 2DRDA 3FCHA 2J7UA 2XTJP 3M8QB 3PV8A 1SJ1A 4IDKA 5HLFB 4ZHRA 1F0XA 3NGDA 2VU5A 4G65A 1I94J 1S59A 2VDHA 4CT8A 5L1LA 3SQGB 3PEJA 4HR2A 3JQJA 4CLFA 2J0XA 1V6HA 1E6VB 4K5RA 3EGZA 1I5OB 4CTAA 1IKXA 4DV5J 1VBXA 3Q86A 3BQ1A 4F50A 4P6QA 1N8RT 1HI1A 3GIKA 5A2QU 1GMVA 4M5HA 1E6YA 3L9ZA 4LSLB 2QFIA 1ZM4A 2HFNA 2KHDA 4ECTA 3MURP 4K50A 2HHUA 3BEGB 3G71S 1IKWA 3VZIA 1R8HA 4CNYA 1VCTA 5J1PA 4XPCA 3LF0A 4DX5A 1RT4A 3M4XA 4DV1J 1TKDA 2OD4A 3LP2B 3G82B 1RAEB 3G6YA 4X64F 2RAQA 1TAUA 2OD6A 5K20B 1FKPA 2RDDA 4DS4A 1Y3KA 3Q8RB 1LQ9A 1T0TV 4DPWA 2WCXA 3SBMA 1NH7A 2Q79A 4I6WA 4Y3CA 3CNQP 3BB5A 3MD3A 4MYUA 1AW0A 1C1BB 1JKHB 5F41A 3THPA 3MAQA 1NXIA 2DO4A 3CCVS 2FHJD 3JB9k 2CPYA 4QWCA 2FC9A 1HW8A 4Y00A 3P5TL 4ZLJA 1T8EA 4FNHA 4ED6A 4J90A 1SKSA 3MUMP 4K4VA 2XY5A 2UV8G 1XERA 1NHVA 2GHPA 3OFEA 1DBDA 2WW4A 4FDFA 2ZM6J 2QL5B 3PO5A 2BM1A 2HS4A 2CIMA 1PYSB 2QJ3A 4PZVA 2VFTA 3I6PA 4Q8EA 2KYXA 4AYBD 3G2XA 4DPTA 1X4BA 3CJ4A 2HNZB 1NUEA 5F8GA 1OO0B 3CWJA 3LP0A 2BV3A 3B8HA 1HQUB 3M05A 4ELUA 4P52A 4Y2AA 1RKJA 3K5NA 1FWKA 1SUQB 1MW7A 1NEEA 2GHWA 5K14A 1U49A 5DLGA 4KFBB 4FBUA 2BJ7A 1BXNA 3EPGA 4NYZA 3H0PA 4M5LA 4O0NA 4JV1A 5DQIA 4PCQA 1R0CB 2BKNA 3DLEB 5T7LB 2HVDA 4B9LA 5CYQA 2CPZA 4P75A 5KFGA 5K8MA 2CADA 2WB1D 5GMDA 2G2OA 3ZZYA 2MGZB 2IAJB 4NZ7A 2MYFA 1BY9A 3FC9A 3BREA 3MUTP 1SC6A 2X3GA 2K3KA 2LQJA 2R7OA 5E3PA 1FXRA 2DGQA 3Q83A 4LIRA 5A8KA 2G0CA 1JJCB 4C3KA 4LFBF 2M3DA 1HLWA 1L3KA 3NOCA 4K4YA 2VBWA 4LR8A 2A10A 4TKTA 3O6QA 3PG9A 1JIHA 5CYMA 2D9PA 3DRSB 1WEYA 4OYZA 4Z37A 4B3TF 2PD1A 3ZZUA 2MXYA 4V1Ak 4XK8C 1YHQS 1S77D 2GV1A 3W65A 4O4GA 2Z8QA 3CCJS 4IRDA 4B9NA 3LGHA 1SVDA 4F02A 1QM9A 3M8QA 4GRSA 3TO8A 3CW2C 3O8WA 4TQRA 3NCQA 4L73A 1NNDA 1OSCA 5HLFA 3CMAS 1U1NA 1U09A 2KVQE 3I87A 3SQGA 1U26A 3EGVA 4P73A 3E8OA 1JQGA 1RE1B 4C9DA 1VFJA 2XO7A 1E6VA 1MU2A 3GIJA 4TN2A 1OS5A 2F8HA 4ECRA 3OTOJ 4WF9Q 2DNPA 4LF6F 4ELVA 4WJBA 3CPWR 3OTBA 3D3BJ 2CJQA 3I5BA 1H74A 4ES1A 3G8SA 2V2VA 3PM9A 4LSLA 2IRUA 4DOZA 2AEMA 3MZIA 3M6VA 1S4FA 3GJTB 3I4HX 2IJRA 2CQ1A 5IC4B 3WX8A 1M1GA 4DSFA 1FKAF 2M5YA 2WSEC 1L5UA 3K8VA 6FD1A 4C8MA 3UNYA 3TNVA 4J9UE 3PCOB 3G82A 5HMWA 4PG8A 3HSZA 1PYTA 4ED8A 2YKMB 5EX0A 5D0GA 4DR2J 3KLHB 3IGNA 1R43A 4FYDA 4F4AA 1LNQA 1IR0A 3KYLA 4UF4A 3R9LA 3SIPB 4WIQA 1C1BA 2DR5A 5GVQA 1MG7A 3SDEB 3H5UA 1O5JA 4URQU 1U0SA 2VC0A 3CJ5A 4WU3A 4DL7A 1MMDA 3AD7C 2KB2A 2E9TA 3AHPA 3DM2B 3ITHB 3IBWA 2RRBA 5KT7A 1GXLA 1V3RA 4BCAA 1DQ8A 1JXLA 2YNIB 2V6AA 2PE8A 3T41A 1SCJB 2DCLA 2CZ4A 3PYGA 4ILLA 3FNNA 4K2XA 1UZDA 5LSOA 1EETB 2HNZA 2PSZA 5CZXA 1URNA 2LDIA 5BR8J 1HQUA 2BZ2A 1SQGA 1Q8LA 1RAOA 1I94F 1JNZB 2YKNB 1SUQA 1PC5A 3TVZA 3QGPA 1VBKA 2VBYA 2BJ9A 4KFBA 5L1KA 1RHMB 3PHEA 4FNIA 4CO1A 4F7VA 3DLKB 4Q8FA 2J9DA 4U8YA 1IR1A 2OTLS 3DLEA 5T7LA 1B0TA 4C48A 1NK9A 1RSCA 2M8HA 3A13A 3HVAA 4IG0A 5JMNA 2MGZA 2IAJA 3T6BA 2PC6A 2XCPA 1ULRA 4X4QA 5LMNJ 4NWBA 4N8NA 2V9KA 3HULA 1OY9A 1KD1T 3AJDA 5L46A 2R2TA 4YR2A 2XNQA 1YJTA 1SKRA 3CD0A 4NASA 1FFGB 3NAIA 1KEKA 3HHKA 1HWJA 3MMJA 5CHCB 5C7PA 1RAHB 4B3SJ 5ETVA 1U6BA 2K7KA 3DRSA 5I4MA 4X66J 2UUTA 3EE3A 3OUYB 4ZITA 1R6VA 2Y9HA 4IRKA 1PKUA 3H2UB 4USVA 5IV3A 1REGX 4LF5J 1UETA 1GXUA 1S1TB 3IWXA 2KZZA 4PR6A 4WKRA 1XMOJ 1YJ7A 2H5JB 2WRMA 1VK3A 2V8HA 4LBHA 1Y5IB 4B9VA 1JWWA 1WF1A 1FDNA 2F40A 3WDOA 1Y00A 1A0OB 2BXJA 1FRMA 4A8WA 2ZM6F 4JI6J 2O1PA 2B0GA 4DPXA 4NLDA 4OYIA 3ILJA 5HVGA 2WBMA 4CLKA 2ZJPQ 3ZNJ1 5HP1A 5JJBA 4DU8A 2R7UA 4DWIA 1NBEB 3THVA 3C8YA 2R7RA 2YPYA 3H42A 2WZ1A 2QV6A 1CJUB 2XS5A 2DEIA 1K44A 4WK1A 1PGZA 1LV5A 3CC7S 4EU0A 2ZFHA 3GU0A 1HKAA 4Y2IA 1GMWD 3KLVA 1OWXA 2E1RA 3VTIA 3OSPA 1BWEA 2MSSA 1CJVB 2DITA 2RQCA 2M4MA 4RLEA 4ZCLA 4Y65A 1VRUB 4KSEB 5F8LA 1ICEB 2PDAA 1IR2A 1RAJA 3GB0A 4ATNA 3VAIA 4K4TA 2YKMA 2FLNA 3KLHA 1VQ4S 3TA0A 3T5JA 1PJ7A 2EW9A 4PWDB 2RS2A 3UD4P 2CA9A 3N01A 4RU2A 3VCDA 1FO1A 2JJ4D 4X4PA 5CABA 1RWUA 1XIQA 2J76E 2Q1LA 3SDEA 2LA6A 3HSJA 4YUDA 2AF6A 2CDRB 2DIUA 2DR7A 2ZH4A 1H0HB 5J1NA 3TZYA 4DG1B 3CSKA 4Q2MA 4ZK7M 3WBZA 3DM2A 2NPIA 1RXOB 2WVBA 5AXMA 2DD8S 5F0UA 4KKOB 3MEGB 2K2PA 1KSPA 1VC5A 5KFFA 5E3RA 1AA1B 3IN5A 3H5YA 2AX1A 5AJ3J 5H9EK 2YNIA 2ZOFA 3QFHA 3FBCA 3LPEA 2J6TA 2MQMA 4WIIA 1NSQA 3GFXA 3NGKA 5MLCV 5HSPA 3N5FA 5KFIA 4KHRA 3PX0A 2MKJA 5E41A 1R8BA 3BGFA 4LBIA 2AIRB 3LO3A 3RRHA 2GFFA 3GTYX 2MJUA 5D0HA 2YKNA 1Q86T 3W9HA 1Y11A 4OYWA 2QMXA 4KY3A 4F4KA 4I2QB 2Q6CA 2V63A 3OTOF 4DSEA 3QPIA 2JVRA 3DLKA 1ZYQA 1DARA 1BQMB 2G1HA 2E9ZA 2VQFF 4H4MB 3P8BB 1UCNA 4OQJA 2Y1IA 1NK5A 3A8JA 2AKWB 1EARA 2RJZA 2RF2B 4I4BA 3TA2A 4CH0S 2JEGA
chains in the Genus database with same CATH topology
4B3RJ 4DR2J 2UXBJ 5IT9U 4X66J 5A2QU 5AJ3J 1XNQJ 2HHHJ 2UU9J 2KVQE 4LFBJ 4LFCJ 4DUZJ 4KYZA 3T1YJ 4X62J 4JI4J 5FLXU 4LF8J 2VQFJ 5IWAJ 2ZM6J 4DV2J 1IBLJ 4DR4J 4LF5J 2KL8A 4PWWA 3OTOJ 2F4VJ 4DV3J 4KHPJ 4DR3J 1N34J 2UUAJ 4LF7J 1XMOJ 4B3TJ 4DR7J 1N36J 1HNXJ 3W1YC 3D3BJ 3IMQJ 4JI8J 4JI7J 4DV0J 2E5LJ 4X65J 1IBMJ 4GKJJ 4NEZA 4DV1J 1HR0J 4LF4J 4OX9J 4JI3J 4DV6J 5LM7E 2VQEJ 4RJVA 1XMQJ 2UUBJ 4JI6J 4LF9J 4B3MJ 4DR5J 4DUYJ 4KY3A 1J5EJ 1FJGJ 4DV4J 4HHUA 4DR1J 5LMNJ 4JV5J 3J81U 1HNWJ 1HNZJ 4YHHJ 1I94J 2UXDJ 4AQYJ 4YY3J 4V1Ak 4NXMJ 3R2CJ 2UUCJ 4GKKJ 2MEWA 2MTLA 4JI1J 3T1HJ 3R2DJ 4JI0J 4JI5J 4DV7J 4JI2J 4NXNJ 4LFAJ 4DR6J 5LMUJ 4DV5J 1IBKJ 1XNRJ 4JYAJ 3J80U 5BR8J 4B3SJ 3D3CJ 4X64J 2MQ8A 4NEYA 1N33J 4LF6J 4K0KJ 3J7AN 3JAMU 2UXCJ 1N32J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R J;  4DR2 J;  2UXB J;  5IT9 U;  4X66 J;  5A2Q U;  5AJ3 J;  1XNQ J;  2HHH J;  2UU9 J;  2KVQ E;  4LFB J;  4LFC J;  4DUZ J;  4KYZ A;  3T1Y J;  4X62 J;  4JI4 J;  5FLX U;  4LF8 J;  2VQF J;  5IWA J;  2ZM6 J;  4DV2 J;  1IBL J;  4DR4 J;  4LF5 J;  2KL8 A;  4PWW A;  3OTO J;  2F4V J;  4DV3 J;  4KHP J;  4DR3 J;  1N34 J;  2UUA J;  4LF7 J;  1XMO J;  4B3T J;  4DR7 J;  1N36 J;  1HNX J;  3W1Y C;  3D3B J;  3IMQ J;  4JI8 J;  4JI7 J;  4DV0 J;  2E5L J;  4X65 J;  1IBM J;  4GKJ J;  4NEZ A;  4DV1 J;  1HR0 J;  4LF4 J;  4OX9 J;  4JI3 J;  4DV6 J;  5LM7 E;  2VQE J;  4RJV A;  1XMQ J;  2UUB J;  4JI6 J;  4LF9 J;  4B3M J;  4DR5 J;  4DUY J;  4KY3 A;  1J5E J;  1FJG J;  4DV4 J;  4HHU A;  4DR1 J;  5LMN J;  4JV5 J;  3J81 U;  1HNW J;  1HNZ J;  4YHH J;  1I94 J;  2UXD J;  4AQY J;  4YY3 J;  4V1A k;  4NXM J;  3R2C J;  2UUC J;  4GKK J;  2MEW A;  2MTL A;  4JI1 J;  3T1H J;  3R2D J;  4JI0 J;  4JI5 J;  4DV7 J;  4JI2 J;  4NXN J;  4LFA J;  4DR6 J;  5LMU J;  4DV5 J;  1IBK J;  1XNR J;  4JYA J;  3J80 U;  5BR8 J;  4B3S J;  3D3C J;  4X64 J;  2MQ8 A;  4NEY A;  1N33 J;  4LF6 J;  4K0K J;  3J7A N;  3JAM U;  2UXC J;  1N32 J; 
#chains in the Genus database with same CATH topology
 4DF4 A;  4DLE A;  2FGC A;  4ENO A;  3W5Y A;  5A2Q Y;  4KQZ A;  4DBQ A;  3KMQ A;  2X1A A;  3MFI A;  2CQC A;  1VJW A;  2V2Z A;  4DN0 A;  1VQY A;  3VQS A;  1RIS A;  3R5C A;  2KL8 A;  4IUF A;  4X4R A;  2QT7 A;  2P5V A;  2DPI A;  2M2B A;  1N34 J;  1NDC A;  2QRR A;  3QSI A;  3BO4 A;  2ZZT A;  3DLB A;  4J9O A;  3OUY A;  4DV7 F;  1OQ6 A;  2NUH A;  4WCE Q;  1R31 A;  1NJW A;  4P2S A;  3SMZ A;  1W7W A;  4OZ5 A;  2LLZ A;  3W66 A;  4QPX A;  1IJF B;  2W9B B;  4XIU A;  1HNW J;  1M1K T;  1FEE A;  3U1L A;  2GVD A;  3UNG C;  2FJW A;  4PXD A;  4NXM J;  2RSQ A;  2BEF A;  5FII A;  4O44 A;  2FGO A;  1IXK A;  1HBN A;  3BH7 B;  3TJA A;  2V2Q A;  2ZZN A;  1IVZ A;  3X3U A;  2D1C A;  4DQR A;  2HEK A;  2Z57 B;  1QAJ A;  2IYI A;  3GIR A;  3PKY A;  1RQ0 A;  4IO1 A;  4LF1 A;  4CNZ A;  1CJU A;  2C22 A;  5HRO B;  4NLT A;  2GO8 A;  4W4M A;  5J2M A;  1EHW A;  4IH6 A;  3QAE A;  2L9N A;  1GAO A;  5F0W A;  2B6A B;  5BR8 F;  4I56 A;  1V9O A;  5C2C A;  1D3W A;  3D9B A;  2DK2 A;  3GLJ A;  4HLB A;  2ZHA A;  4IKA A;  1RT3 B;  2NXN A;  4J9K A;  3I0S A;  1R8A A;  2RIL A;  2LQB A;  1H38 A;  2OI2 A;  3PRD A;  1SC4 B;  3P3D A;  5ETK A;  4YR0 A;  4E2F B;  4KV8 B;  1VRU A;  1ZAV A;  3ETM A;  2HIY A;  3NNA A;  5GMK a;  2DGU A;  3WZ0 A;  4OI6 A;  2L3M A;  3PKM A;  2ATC B;  1SI9 A;  1RYR A;  3PFE A;  2NRE A;  5EDW A;  4TU9 A;  3IM9 A;  3ISN C;  2R4F A;  2ABY A;  4PWD A;  3DN9 A;  4C8Z A;  3C14 B;  4C0O C;  3FDS A;  5FLX Y;  3TW0 A;  2GIQ A;  4OZN A;  4CT9 A;  3VGU A;  2AMC B;  2DGS A;  3IBF B;  1LK7 A;  4KGX B;  3KLF B;  5M2R A;  2OPP B;  4DG1 A;  2YKA A;  3PIP Q;  1RJJ A;  3ENA A;  3VAJ A;  1YX2 A;  3HK2 A;  1UVI A;  1FXD A;  1UZH A;  1ZM2 A;  3QT6 A;  3GIM A;  4KKO A;  4B3S F;  3MEG A;  3LQV A;  5C24 B;  2UVU A;  5LT5 A;  4RNO A;  4X66 F;  3TR5 A;  3UDC A;  5EUH A;  4IQX A;  3IBC B;  4LRB A;  2ZUA A;  2Z30 B;  5E0O A;  4WBF A;  3ZC4 A;  4LF5 F;  1NZA A;  3HKW A;  2Z58 B;  1X5O A;  1QVG R;  2WBR A;  3JXO A;  2ZH8 A;  5D4N A;  1FX2 A;  2JL9 A;  5IM0 B;  1YG0 A;  1ELO A;  2GA7 A;  3JYT B;  3D7S B;  1N6Q B;  2DGT A;  4QIV A;  3ET6 B;  1X60 A;  3BBF A;  2QLJ B;  4JI6 F;  2QA4 G;  2H51 B;  3L3C A;  2WVD A;  4I2Q A;  2XB2 D;  3NS5 A;  2XQC A;  3H5X A;  1N0V C;  1RYS A;  1BQM A;  1S7H A;  3W9I A;  4H4M A;  4X62 J;  1S76 D;  4PG7 A;  1U1L A;  1YIJ S;  3D6T B;  4FS1 A;  3KK3 B;  3IO1 A;  3W64 A;  1XBW A;  2AGQ A;  2RF2 A;  1KTV A;  2GJF A;  4K7Q A;  1S12 A;  4OYM A;  2RDJ A;  3R6G B;  4I69 A;  4LIW A;  2QO3 A;  3L4B C;  4O3O A;  3VAM A;  3O1L A;  5EX3 A;  5GAG U;  5ETR A;  1HFE L;  3OFF A;  5J2P B;  3UDE A;  4FF3 A;  3HT3 A;  5I42 B;  2RDI A;  2FVC A;  3D5M A;  1UMJ A;  2W4D A;  2W4P A;  4M95 A;  1U8S A;  2NXE A;  3BH6 B;  1GQE A;  3MDF A;  2UXD J;  2EFP A;  5KFH A;  1CBK A;  4HHH A;  3BKT A;  3J7Z 5;  5F3T A;  1WTB A;  1VOM A;  3ZZZ A;  3DGV A;  3QRP A;  4NEY A;  2W9B A;  2DNL A;  2XMM A;  3RGI A;  1ZZN A;  4BDP A;  4DXL A;  4OZL A;  3M2R B;  1NB2 A;  3GE9 A;  2BQU A;  4KHP J;  3GR1 A;  4DLG A;  4CZC A;  2Z4P A;  2GO9 A;  5AJ3 F;  2HYI B;  4M5K A;  4RUH A;  2C3O A;  3O5T B;  1S1U B;  2X1F A;  1ZZF A;  3MR2 A;  3FBF A;  1LEO A;  1WOP A;  2JVO A;  1S9F A;  2A3J A;  3PTW A;  1YZ6 A;  4PUO B;  2WOM A;  2VA3 A;  2OKQ A;  2B6A A;  4CM2 A;  2EI5 A;  4K5S A;  3SCJ E;  1F2G A;  1MML A;  3HI9 A;  4TYA A;  1JJ2 R;  5I3U B;  2G0I A;  1S9E B;  3QAU A;  4KV8 A;  2Q3P A;  2DGW A;  3I9V 9;  3UDV A;  4B02 A;  3TVK A;  4EEY A;  2KTQ A;  3VVU A;  5KFP A;  1VQL S;  4NCB A;  1S99 A;  1N5V A;  2HQ3 A;  4F36 A;  4C6A A;  3V6H A;  2CQD A;  4B3M F;  1S6P B;  4ZIW A;  2OO4 A;  2J0W A;  2ILY A;  4EO8 A;  2VOD A;  2LVW A;  4YHH F;  5KOW A;  1FVQ A;  1RWM B;  1KVK A;  4N76 A;  3T3F A;  2UV8 A;  1SV5 B;  2CQ3 A;  2W2Q P;  3BBB A;  3MM8 B;  3KLF A;  3MXH P;  2OPP A;  2XMA A;  5IZH A;  4HAC B;  3FEX B;  4PKD B;  3AOA A;  2VPW B;  1UJ6 A;  2P9G A;  1MWQ A;  4HHU A;  1N34 F;  2WVE A;  5CXT A;  4U6P A;  3M9M B;  5C24 A;  1X5T A;  4WYW A;  1TK0 A;  3ADA C;  4ICL B;  4ID5 B;  1HWU A;  2MZR A;  1VC6 A;  2RUG A;  3QJP A;  3LP1 B;  3QNW B;  4ZJO A;  3TAR A;  4OLO A;  4P2X A;  2V8G A;  4ZVH A;  2N4C A;  4CH1 A;  5IM0 A;  1HNW F;  2ASD A;  4DMZ A;  3JYT A;  1B0V A;  3QT7 A;  5ETL A;  4ZLN A;  4NXM F;  1ZPW X;  4QWE A;  1N6Q A;  1N88 A;  3P49 B;  1FXL A;  2VBZ A;  3ET6 A;  1RWV B;  3FRY A;  4ECY A;  1RAI B;  3IG1 B;  1FDD A;  1FD8 A;  4ZVG A;  5KFC A;  3NS6 A;  5KG0 A;  3AQO A;  4AND A;  4MIA A;  4M5N A;  2RRA A;  2IC3 B;  4J9V A;  2RQ4 A;  4J37 A;  3WQP A;  4J9S A;  3HHL D;  2L41 A;  2FVS A;  3OXG A;  4OHV A;  2UUB J;  3LUY A;  4LF9 J;  2RT3 A;  3KK3 A;  3J81 j;  1Q8I A;  1RHU B;  1F2H A;  2VFV A;  2H5I B;  2B3T B;  3BZQ A;  2YQ1 A;  4ZN1 A;  3OXL A;  3T5L A;  4PG6 A;  4RUC A;  2CPJ A;  1NKB A;  4OI1 A;  3E01 B;  4YN3 B;  3MFH A;  5J2P A;  3UN3 A;  5JUM A;  2AX0 A;  1S1X B;  5GAG I;  3D3C J;  2XHW A;  4KE5 A;  4ECZ A;  1JNR B;  4K4U A;  4PXB A;  2UXB J;  4R5P B;  2XMV A;  3DOL B;  2IMO A;  2MQL A;  1HQ2 A;  1KNZ A;  3C6T B;  1CUL B;  2IBK A;  5LJ3 Y;  5A6P A;  1WNE A;  1AFJ A;  1VLY A;  4OIX A;  2N4D A;  4A8Y A;  3IFE A;  2XWX A;  2HGM A;  1FRK A;  4ZMM A;  2LEP A;  4USK A;  4F4Y A;  2CXE A;  2FVP A;  3KUE A;  3KOA A;  3PW7 A;  4ZVT B;  2ROP A;  1NKE A;  4J9Q A;  4DPY A;  3T9N A;  2BKP A;  3CC2 S;  4KH1 B;  4ZN3 A;  3KLE B;  2G4B A;  3R6L B;  4OZJ A;  2XYP B;  2AEJ A;  3M32 B;  2HHX A;  3IA0 A;  1RCO B;  2KJW A;  4AL5 A;  2ZJR Q;  4F4X A;  2OPQ B;  3KLI B;  4JI2 J;  1UJ4 A;  1WTF A;  2F4V F;  4RPF A;  4ANE A;  1D9A A;  2C42 A;  2HVZ A;  3HJV A;  4B3R J;  1R3N A;  4IOB A;  3SQO P;  4KC5 A;  1FRJ A;  4ZVP B;  1F60 B;  1UVL A;  1JLB B;  8ATC B;  1DQA A;  3D0G E;  1FJE B;  3QBC A;  3QLH B;  2DNN A;  4OHX A;  4WFZ A;  3VVT A;  4RW9 A;  4PEO A;  1HPZ B;  1S9E A;  4RW6 B;  4KT0 C;  1QUP A;  2DNR A;  3EM1 A;  4LBP A;  4C98 A;  3VZH A;  2MKH A;  1VGY A;  3IRW P;  3K0J A;  1PJ5 A;  4X62 F;  3SFG A;  2Y3Y A;  1V5I B;  2MY7 A;  1RB0 A;  1S6P A;  3OFH A;  3CIM A;  4ETZ A;  1S97 A;  3KK2 A;  1KLN A;  2E7W A;  5CZV A;  2XNR A;  3CGI A;  3FEY B;  4YY3 J;  2JZ5 A;  3MM8 A;  1SQF A;  4YEA A;  1S49 A;  5CYJ A;  4M5M A;  4HAC A;  2MQO A;  2IM0 A;  1IQZ A;  5DDQ C;  1HBU A;  5IXU A;  2KT2 A;  1FRL A;  3KKF A;  2JLF A;  2UXD F;  4DZD A;  4FYW B;  2P2C B;  2W25 A;  4JI3 F;  2DNM A;  4ICL A;  4WKY A;  2JLG A;  4NLY A;  2R2R A;  1YSJ A;  4ZPW R;  3FBE A;  2MHN A;  4E98 A;  5CD4 H;  2OPS B;  4L6V 3;  1ZPV A;  2Z2Y B;  1TR0 A;  2Y8W A;  2XM3 A;  3NLC A;  1FFW B;  4P2M A;  4JI1 F;  1NDK A;  3FK4 A;  1TL7 B;  1SQE A;  2N3O A;  2HQD A;  3UW1 A;  4F4Z A;  2HUR A;  3BGU A;  1MRO A;  2L9W A;  4RU9 A;  4TQS A;  2DIV A;  3MAH A;  2GAH C;  2QA1 A;  3J81 U;  4PG5 A;  3Q2S C;  1JMT A;  2IC3 A;  3QYY A;  2BAC A;  3FKB A;  4F8R A;  5D4O A;  4NRT A;  1TKX B;  2AJF E;  3J80 U;  3CCS S;  1Q78 A;  3BSN A;  3BM7 A;  1VRT B;  3OQ2 A;  1G1X A;  3Q0A A;  5DDR C;  2HHH J;  3M2U B;  2ZVS A;  2GVZ B;  4NLW A;  2UU9 J;  2B8P A;  1C4A A;  1SJ4 P;  1B7F A;  2H5E A;  1MMN A;  2OAU A;  2HQF A;  4UOC A;  3E01 A;  1M5P C;  2HVI A;  4ZJL A;  1S1X A;  4UUW A;  4DR3 J;  1KRP A;  3MEC A;  3R27 A;  2YWK A;  2Z2L A;  1RA6 A;  5A6W A;  3SCK E;  1QDU B;  5I3P A;  3TEH B;  3I55 S;  3DOL A;  3DLH A;  3RYL A;  2YNH B;  3C6T A;  5HMZ A;  1CUL A;  1KC8 T;  2O66 A;  5F8N A;  4NI2 B;  2VUG A;  3K17 A;  1KKH A;  2EKN A;  4ZVQ B;  5KFX A;  3JSM B;  3D0I E;  4LFA J;  3P6Y C;  3B4M A;  1YK9 A;  4JYA J;  2ASL A;  3R7N B;  3MD1 A;  1GK8 A;  3MWB A;  3BYP A;  4GO5 X;  2W7P A;  1TMM A;  1I6J A;  5EHH A;  1NDL A;  3T1Y J;  4HH1 A;  4EWT A;  4NRU A;  1GEH A;  3C15 B;  2OPQ A;  1D8Y A;  1VK8 A;  1GX6 A;  1WEL A;  2DR6 A;  2W24 A;  2W2P P;  2UZA A;  3ULH A;  1AT1 B;  1WKJ A;  4JV0 A;  1WC6 A;  2WON B;  3SXL A;  4NA1 A;  1DY3 A;  3LGN A;  1JLB A;  3HD1 A;  1U1Q A;  4QWD A;  3QLH A;  2ROE A;  1VIS A;  2VFR A;  1VQ5 S;  2DJW A;  4OJ1 A;  1RHQ B;  4OX8 A;  1HPZ A;  2LEA A;  3FEZ A;  2PGC A;  4RW6 A;  2HHT A;  1EB0 A;  4IFY B;  1UWB B;  1X8D A;  1YZ7 A;  2RB7 A;  2BDP A;  3P4U B;  1FNO A;  1RT6 A;  2JEI A;  4B3O B;  2HK2 A;  2D3Z A;  2V5H G;  1FWL A;  2UUB F;  3G96 A;  3AD8 C;  1H2V Z;  4LF9 F;  4PXC A;  2GHV C;  1IKV B;  3HO1 A;  4NLS A;  2VBX A;  2W2O P;  2WHO A;  1LOU A;  2ZOM A;  3NCP A;  4K0K J;  5J2Q A;  2ZD1 A;  3HD2 A;  5SUH A;  2VA2 A;  1LFW A;  1T9Y A;  2YTC A;  2MLX A;  3DYA B;  5KOX A;  4CLU A;  2B4U A;  1S0N A;  2QIF A;  3QAT A;  2QYC A;  2XEX A;  1TL3 B;  1EP4 B;  3BO2 A;  4R0J A;  3NKY A;  1IBL J;  1XC9 A;  2VZ9 A;  2XI3 A;  1UFL A;  4C8O A;  3LAK A;  3IRX A;  1N36 J;  5E3C A;  1V5V A;  4JI0 F;  3AA9 A;  3H5S A;  2FDN A;  3JTN A;  3SI8 A;  1TAQ A;  2KN4 A;  4A8Q A;  1F9F A;  4J7C A;  4DV4 J;  4ILM A;  2K3I A;  2OPS A;  1TUV A;  1D8Z A;  3OL9 A;  3M8W A;  1G4C A;  3HHD A;  4ECU A;  4JI4 F;  3OD2 A;  2FZK B;  1Y10 A;  5AXL A;  5CH7 B;  4CLL A;  3MCN A;  1TL7 A;  3NWG A;  3AB2 B;  1CJT A;  4DFJ A;  2X1G A;  3WX4 A;  4EZ9 A;  4X64 J;  3CUL A;  1LW0 B;  2CUY A;  4U67 Q;  1KR4 A;  4ZP9 A;  1FI4 A;  4RNN A;  3CD6 S;  3CCE S;  1WC3 A;  1OYD A;  2JEF A;  2ZH7 A;  2B8Q A;  1LW2 B;  2I5J B;  1YRX A;  1Q8B A;  3R5G A;  4JI2 F;  1TK5 A;  2YWH A;  1KVI A;  4F0K A;  2E5G A;  2XYH B;  2YKO A;  1U1O A;  2AZ3 A;  3M1V A;  2UUA J;  3RUB L;  1RI7 A;  4B9S A;  4B3R F;  4DR7 J;  3QZ7 A;  1AB8 A;  3OL6 A;  2CNO B;  2DTJ A;  2FHJ A;  1FX4 A;  2KO1 A;  4ETX A;  3EJM A;  1X4G A;  3B82 A;  1RK8 A;  3M2U A;  4LRE A;  4GO7 X;  4YR3 A;  1TP7 A;  3CCR S;  2LEB A;  3TX8 A;  4ECV A;  1RKI A;  1S1W B;  3N28 A;  1FE4 A;  4RL1 A;  2XY6 A;  1R0B G;  2JSX A;  3K5P A;  1U8W A;  2EFN A;  4ZCK A;  3PHT A;  2MY8 A;  1C0U B;  4DX7 A;  3RRK A;  2KT5 A;  5BYR A;  2YNH A;  1EQM A;  1U2F A;  3RR7 A;  1IBK J;  1RU1 A;  1K8A T;  1Q5V A;  4FXD A;  3A8K A;  4IDK B;  4LSZ B;  4CLP A;  4NI2 A;  4ER8 A;  1NK6 A;  3HX9 A;  4ZHR B;  3GFH A;  4J9N A;  3ZTP A;  4QCL A;  1XR5 A;  1TUG B;  3DOK B;  4OZ1 A;  4EUV A;  2UUW A;  2POK A;  3H4D A;  2VIC A;  2BX6 A;  3JSM A;  2DH8 A;  4WZM A;  2DGO A;  4CTA B;  2VHG A;  3HF5 A;  1VQ7 S;  2RH3 A;  4BWJ A;  1ZTW A;  1UPM B;  2IHR 1;  3ZFV A;  2EC2 A;  3ILO A;  4ID8 A;  1U1K A;  2B4O A;  2HG4 A;  1FRH A;  5AE3 A;  2KM8 C;  5E3A A;  4F0H A;  3W5X A;  2J9E A;  3GV8 B;  3DLJ A;  4LF4 J;  2OEJ A;  2B9Y A;  2KDO A;  1RWK B;  5ETS A;  2IDL A;  2OTJ S;  3NMA A;  4FP9 A;  3Q8U A;  5DQH A;  5EWG A;  2V4R A;  4NCG B;  3QT5 A;  4DS5 A;  4ZVS B;  1IKW B;  2DGX A;  2H1Y A;  2E29 A;  2FLL A;  1RBA A;  2WB4 A;  2HFS A;  1RT2 B;  1URR A;  2WON A;  2AJ1 A;  3PDN A;  1S7I A;  1RT4 B;  3IR6 B;  3W2V B;  1X5S A;  4TVA B;  2AWZ A;  5ETT A;  4CM0 A;  5DM6 Q;  1B0P A;  4V19 X;  5GAH U;  2CJA A;  4WE1 B;  4IFY A;  5K5M A;  1JLQ A;  1UWB A;  1HL6 A;  1C0T B;  2JWN A;  1RWW B;  2HNY B;  4A4J A;  1A7G E;  1DTQ B;  1PIL A;  3MPY A;  2ZH6 A;  3SV3 A;  4B3O A;  3C16 A;  3ENQ A;  4FXV A;  2BJD A;  2CNK B;  1IKV A;  2EK6 A;  2V68 A;  3ZZT A;  2VG5 B;  1QTM A;  2LXU A;  2HHH F;  3HZG A;  1XR6 A;  2YWW A;  2AYM A;  1NZ8 A;  3AQP A;  4DSJ A;  3DYA A;  3UCU P;  3I96 A;  1H6K X;  1K1S A;  4AL6 A;  3CC4 S;  4M5G A;  4DV6 J;  1TL3 A;  1ZA1 B;  1EP4 A;  1IM4 A;  3J7Z T;  1QE1 B;  4B9M A;  2ZEJ A;  1T03 B;  5DJB A;  4ZVR B;  2LXF A;  3E2E A;  2FVR A;  2C1E B;  1RWX B;  3W2W B;  4H4K A;  5F8J A;  4L74 A;  1T94 A;  5KFK A;  5D15 A;  2R7Q A;  3BR8 A;  3HZE A;  4KRW A;  3PEH A;  3CUN A;  1QAY A;  4WFB Q;  2DIS A;  4L3K A;  4DQP A;  3VGS A;  4YDD B;  3EYZ A;  2CPE A;  4JBC A;  4ZPD A;  1HNV B;  2C2Z B;  1NK8 A;  3CJ8 A;  2FTR A;  1FTC A;  4IG3 B;  2BVZ A;  2JRS A;  5KG1 A;  2R2U A;  1U7L A;  2Y0B B;  1DAX A;  1HA1 A;  4RBU A;  4JYA F;  4F4W A;  4KIA A;  3R3T A;  3W60 A;  1LW0 A;  2CQH A;  3OR2 B;  4KGM A;  5CYQ B;  2IA0 A;  1VR6 A;  1F6T A;  1RAF B;  4OJ3 A;  3T1Y F;  2I5J A;  5B0B A;  3ZTQ A;  3C6U A;  2M0G B;  2HND A;  3QGI A;  4I64 A;  3UD3 P;  1U0H B;  2PEH A;  2P6S A;  4O3S A;  2AYE A;  2MQP A;  5D78 A;  5AE2 A;  2BA9 A;  1T3O A;  1UA0 A;  1MWZ A;  3FCV A;  2PEB A;  3G6E S;  1SJF A;  2GGP B;  4M63 A;  3HFZ B;  2ZKU A;  1U24 A;  1S1W A;  3RBE A;  5CYM B;  1KOO A;  5DDP C;  4NYP A;  5EWF A;  1GNK A;  2CWK A;  4CP5 A;  1IM6 A;  2ZKT A;  3PVX A;  3IR5 B;  4LF8 J;  4Q2L A;  4WFY A;  1DUR A;  4FYV B;  4MKB A;  1OMS A;  1J5E F;  3KUH A;  1QSY A;  1RTI B;  4TY9 A;  4B08 A;  1FA0 A;  3UN2 A;  3K2Y A;  3DMJ B;  4K59 A;  2H4Y B;  3CCM S;  1H2U X;  4UZC A;  4K0K F;  5KT6 A;  2DR8 A;  4X84 A;  2UUC F;  3FMB A;  2CZ9 A;  4CO0 A;  2P9C A;  2AJ4 A;  5F9L A;  3DOK A;  2KRR A;  4Q7A A;  4LT6 A;  1T95 A;  1IBL F;  4XTT A;  1DHM A;  1NPP A;  4DFM A;  1X31 C;  5DGA A;  4DN9 A;  1MU2 B;  2OGU A;  3KG4 A;  4C8N A;  5DM7 Q;  3BGR B;  3BV8 A;  1N36 F;  3TQE A;  4IFV B;  3FGV A;  3TWZ A;  4UOF A;  2AHO B;  1SC1 B;  2RIJ A;  2OP5 A;  5LMU J;  4I68 A;  4PPD A;  5HQL A;  3SSQ A;  4DV4 F;  1N33 J;  3U27 A;  4NCG A;  3J7A N;  3V4M A;  3MCM A;  2AGO A;  2NXC A;  4LRA A;  1H2T Z;  2HBY B;  4ZLL A;  1XNQ J;  2G2Y A;  1RT2 A;  3PRV A;  2YWG A;  1X0P A;  3LA0 A;  4U96 A;  5IC6 B;  4N47 A;  3W2V A;  5KFE A;  2F5G A;  3R97 A;  3IS9 A;  1FT8 A;  4DV3 J;  2FY1 A;  3FZB A;  1FF2 A;  2DXD A;  4WE1 A;  1SH2 A;  1HNX J;  1C0T A;  4J9P A;  2J6U A;  5GAH I;  2J9C A;  2HNY A;  3HHL C;  1SC3 B;  4WPA A;  1DTQ A;  3KJN B;  4KR0 B;  3I0R B;  2GML A;  3CXC R;  4Y2M A;  1TTH B;  1RAA B;  3DRP A;  2J7W A;  2UUA F;  2IBO A;  2IDE A;  4PG4 A;  1U6F A;  4LR9 A;  2VG5 A;  4DR7 F;  3J81 Y;  4ECS A;  3NRB A;  3R5B A;  1B70 B;  2BUN A;  3ILI A;  3THT A;  1FJC A;  1YBT A;  1KFS A;  5HBM B;  3UCZ P;  3CB4 A;  5M2P A;  5J1E A;  3IXQ A;  3V4I B;  2DCU B;  2VFU A;  1N54 B;  1QE1 A;  3J80 Y;  6AT1 B;  3PIO Q;  1EX8 A;  2ACY A;  1G7C B;  1NK4 A;  1T03 A;  3OT9 A;  1N32 J;  1MLA A;  1UKU A;  5IOL A;  3I82 A;  3W2W A;  1BQN B;  3NGU A;  3DLG B;  4BLG A;  1XEZ A;  1Q53 A;  1RT5 B;  4F2S A;  3QRR A;  1ZM3 A;  3BJY A;  1IBK F;  1D9F A;  4Y28 C;  1U2R A;  4F04 B;  4O3R A;  3GJR B;  1X4H A;  1V3S A;  2BKO A;  3FBB A;  1GMW A;  2W4C A;  3M6W A;  2EG2 A;  4WU2 A;  1HNV A;  3TUZ C;  4IG3 A;  5LM7 E;  4URS A;  2AV5 A;  3SYZ A;  5E7O B;  4HYK A;  2VOP A;  2AJQ A;  4BBY A;  4OX6 A;  5F8M A;  2QFJ A;  1WOO A;  2CNN B;  2HFV A;  3OV7 A;  4DCJ B;  3OR2 A;  1MN9 A;  1RTD B;  2B9W A;  1KQF B;  4LF4 F;  3GV5 B;  3JSB A;  4EK2 A;  4IG0 B;  4LF2 A;  1U2C A;  4CO4 A;  1U0H A;  4CRJ A;  2KXH A;  4ZPB A;  2DNY A;  4DL3 A;  1H72 C;  5GME A;  2AP6 A;  2WTF A;  4PYA A;  4CH7 A;  2VG6 B;  2LU2 A;  2DBB A;  1J5O B;  2FD2 A;  2R7W A;  2GGP A;  2CAJ A;  2VFS A;  1HWK A;  1YJV A;  3DU6 A;  4MT1 A;  2ZBI A;  3HT0 A;  4AQY F;  2I8E A;  3Q8V A;  2OUG A;  3M8Y A;  4B9T A;  4ZVO B;  4MJK A;  3OPK A;  4K4S A;  3CDE A;  2KM8 B;  1S4E A;  1Z2Z A;  4ZP7 A;  3EXY A;  3KDN A;  2HKE A;  2X51 A;  1RTI A;  4WYL A;  2FJV A;  1WG1 A;  3EZ5 A;  2CNL B;  3DMJ A;  1SKW A;  2BJ3 A;  5L9X A;  2OHD A;  2P9E A;  4DUZ F;  2E1C A;  4TLQ A;  1N4L A;  4ED3 A;  1JLF B;  4FN5 A;  4DV6 F;  4EYH B;  1RLC L;  4E8U A;  5DS7 A;  1WOR A;  1OJ4 A;  1IJE B;  4LUB A;  1N5Y B;  1U45 A;  5D4L A;  3BSA A;  4FKX A;  4RNF A;  5HP1 B;  1BLU A;  1RBO B;  3EDQ B;  3BGR A;  1P1T A;  4IFV A;  1YBA A;  1LFP A;  3IGV A;  3GMG A;  3L95 X;  2VQF J;  1Q4R A;  4UOH A;  4PAA A;  1JJH A;  4DR4 J;  1FEH A;  3S7R A;  2DY9 A;  5CAA A;  4LF7 J;  3JQK A;  2YNG A;  4YQW A;  4P2F A;  2JFK A;  3VAL A;  3BQ0 A;  3HJF A;  1MNE A;  4NEZ A;  1RDR A;  4UQG A;  2KXF A;  3DLL Q;  4AL7 A;  1IQT A;  1VI7 A;  4DQS A;  1HIY A;  1U6Z A;  1FHT A;  3DRR B;  3RAM A;  1VQ9 S;  4FBT A;  3AB4 B;  3R8Y A;  3QO9 B;  3IR7 B;  1UVK A;  3ZXW A;  5JVH Q;  2GMH A;  2W7O A;  1UPP A;  2DRA A;  1N0U A;  2OFH X;  5KFA A;  2HFZ A;  4TY8 B;  2FJB B;  3FFI A;  4DV7 J;  3I0R A;  2HLT A;  1GT8 A;  1UAW A;  3GV7 B;  3K5M A;  3H7H B;  3R7B B;  2ZBC A;  1X4C A;  1BUX A;  4OZ2 A;  4MKV A;  5HBM A;  4K4Z A;  1K0V A;  2HBZ B;  4DQQ A;  4RZR A;  1S48 A;  3V4I A;  2O5D A;  2JX2 A;  4J9L A;  1GX5 A;  3NAH A;  1ARO P;  5KFY A;  2J0Q D;  4FS2 A;  4GKJ J;  1YVF A;  4LF8 F;  1BQN A;  3DLG A;  2QX0 A;  3UVJ B;  2HS3 A;  3EVW A;  1RT5 A;  2NCK L;  3W62 A;  4PQA A;  2CRL A;  3HLU A;  2Z0G A;  2CJX B;  2BQR A;  5HL7 Q;  2A18 A;  2N7C A;  4TYB A;  4HT5 A;  1VBY A;  3M2V B;  2MHE A;  3MAA B;  4ZCM A;  3MF5 A;  4A8K A;  2ZH2 A;  4USI A;  4CIO A;  1PAE X;  5AXN A;  2C3M A;  1ZET A;  3CO9 A;  4A8X A;  3CE8 A;  3DU5 A;  1PSD A;  2MJN A;  1IN0 A;  2F8E X;  5KT4 A;  2AU0 A;  1RTD A;  3W8G A;  5AXK A;  3O3L A;  2W9C B;  3K59 A;  1HNI B;  3GON A;  3BYR A;  3GYX B;  5LMU F;  1X4E A;  2BJE A;  3OL7 A;  1N33 F;  2DNQ A;  1UFW A;  5HQM A;  3ETO A;  2LA4 A;  3F41 A;  1XNQ F;  3AFG A;  5RUB A;  1CS4 B;  2VG6 A;  2SXL A;  1J5O A;  2Y1J A;  4QYZ J;  2UXC F;  3PW0 A;  2UP1 A;  4DV3 F;  4A8O A;  4P74 A;  1HNX F;  2ILZ A;  2VPX B;  1XWL A;  2FJE B;  5T14 A;  4BHQ A;  3H98 A;  1VQK S;  3PW4 A;  4XPE A;  4S0M A;  4GMK A;  2A6O A;  5BYQ A;  1KON A;  5E3Q A;  3DDN A;  3GCW P;  4M5I A;  2FPH X;  2GVD B;  1JXV A;  1EIY B;  4B9U A;  1FER A;  4O44 B;  4Y2K A;  2OEL A;  1VS3 A;  1HBN B;  2PA3 A;  1JLF A;  1IWA A;  3HSG A;  2NQP A;  1XQI A;  4F2R A;  2ZH1 A;  3OJU A;  2OJ3 A;  1ZH5 A;  2G2Z A;  4NLV A;  1N5Y A;  2GJ2 A;  4OYX A;  4KGV B;  1N32 F;  1TKZ B;  5IS2 A;  2ZH3 A;  1G2E A;  3EZO A;  3ONQ A;  4C3L A;  3TVY A;  1CJK B;  3TEG A;  1VQP S;  2HHV A;  3PNI A;  4DR6 F;  1AFI A;  1NRK A;  3UR3 C;  2BE2 B;  3HHL B;  5J2M B;  4DUY J;  1HQE B;  3CED A;  2E7V A;  3W63 A;  2Z56 B;  1S79 A;  1CLF A;  4MAK A;  4AD6 A;  3MCO A;  1HHT P;  3TUI C;  2AEF A;  1L3S A;  1UJ5 A;  3I0S B;  3BPD A;  4YP3 A;  1QSL A;  2D74 B;  5L1J A;  1UEK A;  2XZW A;  3DRR A;  5CCL A;  2IVF B;  2OLW A;  2I2Y A;  2FHM A;  2MMY A;  3QO9 A;  3M8R A;  2F3J A;  3UI3 A;  2KFY A;  2HRT A;  3I4P A;  4OI4 A;  4XO0 A;  1M5V C;  2KFZ A;  1ZBT A;  1R8P A;  3CCT A;  2QA4 S;  2ALY B;  2EK1 A;  4FF4 A;  1RUS A;  4TY8 A;  1QUV A;  4QU6 A;  4LVN P;  4KGZ B;  2GQC A;  5D0E A;  4ERD A;  4ZJQ A;  2XO6 A;  2WW8 A;  3LAM A;  1V3Z A;  5HMX A;  2OIH A;  4NLX A;  2GZO A;  1WUU A;  2V69 A;  2YWE A;  1H73 A;  2QN6 B;  3C46 A;  2MKY A;  2PI4 A;  4JB8 B;  1I3O B;  2HQC A;  3F73 A;  1GXT A;  4I0W A;  1F1B B;  3IM8 A;  1FRI A;  1DTT B;  3CJ0 A;  2ZDP A;  2K8G A;  2B9E A;  5F9N A;  2FLP A;  3CTR A;  1SJQ A;  3I5A A;  2XS2 A;  2MEW A;  3RBD A;  4OJH A;  3FZ2 A;  2LCW A;  3KK1 A;  3UVJ A;  3QWP A;  2OEM A;  5DLF A;  1C1C B;  4BWM A;  4KJI A;  1DLO B;  1EZZ B;  3NY0 A;  4HEA 9;  3J7A 1;  1K1Q A;  1L3V A;  3L7P A;  2CJ9 A;  1TL1 B;  3CIZ A;  4OI3 A;  4DI6 A;  3CF5 Q;  1Q5Y A;  4RUA A;  1M5S A;  2I6W A;  1Q7L B;  4F3Q A;  3KDO A;  3M2V A;  3MAA A;  2EPI A;  3H25 A;  3D6M B;  2HVH A;  2E5L J;  4ED2 A;  3MGJ A;  1HR0 J;  1UL3 A;  4QIG A;  4IH7 A;  1XNR F;  3F0N A;  4DR4 F;  2W9C A;  4B3M J;  1HNI A;  3CME S;  3NNC A;  1JLE B;  3TUP A;  4J5O A;  2CQ0 A;  4LF7 F;  2W8L A;  1NJY A;  4YHH J;  1R27 B;  3FCW A;  3VHQ A;  5A8W B;  2LEC A;  5KT2 A;  2BOA A;  8AT1 B;  1CG2 A;  1CQN A;  2U2F A;  4NLP A;  3KNG A;  3MM7 B;  1CS4 A;  5DG9 A;  1HYS B;  1Q95 G;  4F3M A;  3K89 A;  3RZA A;  1FK9 B;  4QR1 A;  4DEZ A;  4Z7Y A;  2Y1R I;  5D77 A;  2HLU A;  2PI5 A;  2YQ3 A;  4EGL A;  3TQ1 A;  1JB0 C;  2EG1 A;  1RBL A;  2QSF A;  4A8M P;  3E3X A;  4DX6 A;  4TU8 A;  3ISN D;  2J8S A;  2GNK A;  3PW2 A;  1VHI A;  1Q16 B;  3HHE A;  3D6H B;  1TKT A;  2NYH A;  2CYY A;  3TJ8 A;  2AQ4 A;  1WHV A;  2DO0 A;  2R2S A;  4RW4 B;  1RP5 A;  2EC0 A;  3CJK B;  1D0E A;  3T5K A;  2HS0 A;  4C11 A;  4F3O A;  4MIB A;  3BGO P;  3IC1 A;  1T9U A;  3BN4 A;  3T1A A;  4W92 B;  5ETN A;  5DRK A;  3PR5 B;  1REV B;  1C2P A;  3Q8S B;  4C7Q A;  1TKZ A;  4PWU A;  3RRG A;  4MK7 A;  4GKJ F;  3MHY A;  2MTL A;  3UQS A;  3MCS A;  1CJK A;  2FQQ B;  3KMS A;  2V50 A;  2HFU A;  3I31 A;  2NSC A;  3RBZ A;  2BE2 A;  3HHL A;  3A3P B;  4URG A;  1HQE A;  2C3P A;  1NSA A;  3OR1 A;  4GVB A;  2WOM B;  1DRZ A;  3JAM U;  2BQ3 A;  4MMO A;  5CQG A;  4X65 F;  2ZHB A;  2GS8 A;  1FNM A;  2HZV A;  4EBE A;  4UY8 5;  2COL A;  1RTJ B;  3UE2 A;  3QFW A;  4HKQ A;  2MKK A;  2HFO A;  4PQU A;  1KBR A;  4V19 J;  4A8S A;  4O3P A;  3GG0 A;  3K58 A;  2AYB A;  2VON A;  1FDB A;  4CWB A;  2Y0S D;  3X1L B;  3ZTR A;  2QC3 A;  3EZU A;  2A0F B;  5H9F J;  4M8L A;  1ACM B;  1SH0 A;  5G4D A;  2W2M P;  2I1R A;  3HXM A;  2XMW A;  5HJX A;  3BS9 A;  2W01 A;  4X4U A;  4NML A;  3K57 A;  5KTQ A;  3O44 A;  3FUY A;  4PPZ A;  2MZS A;  1KQS R;  5F3Z A;  5HJY A;  3OTC A;  1YLX A;  1XN9 A;  4OHZ A;  1MSW D;  1OYE A;  4ES2 A;  4Q43 A;  7FDR A;  4DSI A;  2CZV C;  3GR0 A;  3AD9 C;  2NZC A;  4C2M A;  3CVK A;  4X4V A;  4N5S A;  2OSQ A;  1UVM A;  3QJJ A;  2XMJ A;  1YDL A;  2HAI A;  1DTT A;  1XTZ A;  2HPU A;  4NE9 C;  1X0F A;  3LAN A;  1Q82 T;  3HHN B;  2JHE A;  3MM9 B;  2XLJ A;  2F4V J;  1C1C A;  2CWX A;  3GQC A;  4RNM A;  4YB5 A;  1DLO A;  2QL7 B;  2HBR B;  2U1A A;  1KLM B;  3BR9 A;  5EGY A;  2VH7 A;  1VQ6 S;  1KQK A;  3KJV A;  4PYD A;  1B3T A;  5ADZ A;  3OSN A;  1TL1 A;  3W7B A;  3D1Q A;  4OX9 J;  2V2K A;  2F7V A;  3UDL A;  1WC0 A;  1WHX A;  4N8O A;  3TUJ C;  2KRB A;  3CDA A;  3SSR A;  3AOB A;  1HHS A;  3N4W A;  1LWE A;  4U7U K;  5KFZ A;  3EPI A;  1APS A;  5KG7 A;  5KFD A;  2HMI B;  5DGB A;  4PRF A;  2CPI A;  3OVS A;  4DUY F;  1JLE A;  2GCF A;  1RZM A;  2R9L A;  2IA6 A;  2BRK A;  1VYA A;  2D41 A;  3TAM B;  4N77 A;  4FF2 A;  2HRU A;  5A8W A;  2R8H A;  3GZ7 A;  1R0A B;  2H9Z A;  2QA2 A;  5FLX U;  4ILR A;  2UVW A;  1S10 A;  4HH0 A;  1IKY A;  5C42 B;  2IM2 A;  3MM7 A;  2ZH9 A;  2O67 A;  1HYS A;  2DHA A;  1FK9 A;  1EQ0 A;  1WC1 A;  4FVC A;  5IV4 A;  2R7S A;  2HAF A;  1SXL A;  3BKF A;  2JOQ A;  5ETM A;  1F5B A;  2ALZ A;  4WTY A;  2W2N P;  4JI3 J;  1XMQ J;  1F5A A;  3N0V A;  2ZNY A;  4ZCI A;  5FDL B;  3Q89 A;  1WI8 A;  5ETP A;  1TV6 B;  1NHK L;  3A3O B;  4USW A;  3T9Z A;  2J0S D;  4RW4 A;  1HI0 P;  2WAQ D;  2EBG A;  2BAN A;  2F1F A;  4JI1 J;  3CJK A;  3S1T A;  3BKU A;  2R8G A;  1JXE A;  2F9J A;  2L08 A;  2MZT A;  1X9M A;  3R5D A;  3D1O A;  2HGN A;  2MZ1 A;  3M30 B;  1RWP B;  1XJW B;  4A46 A;  1RT1 B;  4IR1 A;  2ZJQ Q;  1REV A;  1FTR A;  1CVJ A;  3S01 A;  1WC5 A;  4Q5V A;  3A4T A;  2JDJ A;  2Q66 A;  3JSY A;  2KT3 A;  2BMB A;  2B4V A;  3AH6 A;  1JLA B;  4QWA A;  1S57 A;  3HPO A;  4EO6 A;  3NL0 A;  2FUG 9;  3CJ2 A;  1T02 A;  4FF1 A;  3TZZ A;  2XY7 A;  1SJ3 P;  3K5O A;  3MI7 X;  5A0Y B;  4GC6 A;  1RTJ A;  3RR8 A;  4DX8 H;  5DQG A;  4ES3 A;  4NLU A;  4RW9 B;  2VJV A;  4DR1 J;  2GC8 A;  2FJA B;  4LR7 A;  2P6T A;  2B51 A;  2MKC A;  4LFC F;  2N3L A;  3WIU A;  2HRY A;  3Q2T C;  4C3M A;  3G86 A;  3MMA B;  2E5L F;  2CQB A;  3A1Y G;  3A3N B;  1HR0 F;  4J91 A;  5GAE U;  4BC7 A;  1NO8 A;  2IM3 A;  5F8I A;  1R8C A;  4ALZ A;  3VAG A;  2BAB A;  2M88 A;  3KK2 B;  1QAI A;  4A48 A;  5BJR A;  1LKZ A;  4ZPV R;  2ERR A;  4TNO A;  1SL1 A;  1KHW A;  3G87 A;  4FYX B;  4OYP A;  1Z2L A;  3V81 B;  2IRX A;  3QMQ A;  4JUZ A;  1RHR B;  3LP2 A;  5IWA J;  3RTV A;  1RGV A;  4FKY A;  2DNZ A;  5DZ7 A;  4I7F B;  3H90 A;  4LVO P;  1HBU B;  2NZ4 A;  1N5T A;  5KT3 A;  3RBX A;  3LWL A;  1HBM B;  3MTJ A;  1I1G A;  2ZC4 A;  1KVJ A;  1UA1 A;  1K47 A;  1T9X A;  3I32 A;  4NXN F;  2BRL A;  4HT7 A;  5D4P A;  3N6N A;  4Y2C A;  4OJG A;  1JKH A;  1W25 A;  2E7X A;  5JXS A;  4K4X A;  3AJ1 A;  3MM9 A;  1HBO B;  3GSD A;  3W3S A;  1TMJ A;  3EUN A;  4DFK A;  1KLM A;  4KBI A;  3FJ2 A;  3KJF B;  2DKO B;  4M1K A;  2ATL A;  3AOC A;  1NJZ A;  3EDR B;  4TXS A;  3RB4 A;  4G3I A;  3OVA A;  3FSI A;  1NAQ A;  1H7W A;  5G0R B;  2BW2 A;  2RVJ A;  1UFK A;  5LOQ A;  4ZS6 A;  3NGR A;  1FKO B;  1MRO B;  1DQ9 A;  5H1S V;  4Q0B B;  2J9D E;  4RO0 A;  3W5Z A;  4FYY B;  4C4W A;  5IT9 U;  3Q8Y A;  4H4K C;  1P27 B;  4R25 A;  3DDI A;  5D0R A;  1ZA2 B;  3IP0 A;  2D7S A;  4F26 A;  2H48 B;  2MB0 B;  3QT8 A;  2HMI A;  4K2J A;  5KFS A;  4AFF A;  2DRB A;  1UTA A;  1BQX A;  2M7S A;  2OPR B;  3BQ2 A;  3M8Z A;  3TAM A;  3BSC A;  3RU0 A;  1MN7 A;  1IBM J;  3UD5 A;  1RAD B;  1YBU A;  4RBV A;  1R0A A;  2VB6 A;  4DV5 F;  1BE4 A;  1UP1 A;  5HQ8 A;  5C42 A;  2MQQ A;  2XUL A;  2D3U A;  3QJL A;  4HTI A;  1N5S A;  3MEC B;  1FCA A;  4OI0 A;  1VRQ C;  3M9O B;  4LRC A;  4JI0 J;  2O3D A;  3EIC A;  3CCL S;  4RKU C;  1O6X A;  1O51 A;  2V9W A;  4M5D B;  4WFX A;  1HMV B;  5FDL A;  5GAD U;  1J27 A;  1TV6 A;  4DV1 F;  5K9F A;  4ANC A;  5B0A A;  1D09 B;  3JTO A;  1SBR A;  2RQK A;  5E2Q A;  4JI4 J;  5KT5 A;  1NME B;  4B17 A;  6FDR A;  5KG4 A;  4YS2 A;  3ZZO A;  2IVY A;  1PO6 A;  4N41 A;  3W9J A;  3M30 A;  2JNJ A;  3PX6 A;  3H8Y A;  4HL9 A;  1RT1 A;  4U9R A;  3KWM A;  4U8V A;  3TP2 A;  2EFO A;  1P9Y A;  2EFV A;  2E5I A;  1SIZ A;  4A47 A;  2DB1 A;  3RW6 A;  2ASJ A;  4DR5 J;  2E9R X;  1JLA A;  1RAG B;  4XDC A;  3VAF A;  3EX7 B;  2K06 A;  5KFQ A;  2E1P A;  1PC4 A;  2N7Y A;  3KTQ A;  3C19 A;  3MR6 A;  5KFM A;  4DSL A;  2QE5 A;  4W98 A;  3TYT A;  4DQI A;  2L48 A;  2CKW A;  2ZBQ A;  1F9H A;  5A0Y A;  2NUU G;  1R6Y A;  7AT1 B;  4DFP A;  4OX9 F;  4DF8 A;  2YH1 A;  2C2M B;  1RAB B;  3TA1 A;  3ZTS A;  3I5C A;  3VWS A;  3D67 A;  1O0P A;  2FC8 A;  4HHJ A;  3N6M A;  1BHN A;  3D6F B;  3IAS 9;  1KOH A;  1VIX A;  2HSE B;  2F9D A;  3MMA A;  3BSO A;  1Q0N A;  1KQG B;  5B0E A;  2R7V A;  1RT6 B;  2ZWP A;  2PFF B;  1YJN S;  1S6O A;  1FD2 A;  2XHC A;  4ZP8 A;  3OVB A;  3UR0 A;  2X7I A;  5GAE I;  4ZVF A;  2LYV A;  5HO4 A;  2D3O R;  4LRF A;  2HQG A;  2NPF A;  4C0B A;  1SB6 A;  2ZD1 B;  5J2Q B;  1T05 B;  1ITP A;  2CVE A;  3IAM 9;  4JI7 J;  2PFD A;  5B08 A;  2R3V A;  4IOC Q;  3V81 A;  3ICL A;  3CD5 A;  3DKD A;  5K8O A;  3ZZR A;  2AYG A;  3M6U A;  3T5H A;  2M52 A;  4HDH A;  3RAQ A;  2LU1 A;  2ADC A;  5I3Q A;  1LWC B;  1S0V A;  2MLZ A;  2PMZ D;  4CLY A;  4I7F A;  3O2I A;  2LQ8 A;  1HNZ J;  3IRX B;  3D28 A;  3G8Q A;  1HBM A;  2E1A A;  2MQN A;  2ZBP A;  3B6B A;  1NSK L;  1T9T A;  3ILL A;  1F3V A;  5HAT A;  1XMQ F;  4OHY A;  4C8L A;  3F44 A;  3CT9 A;  2NR0 A;  4P7T A;  2YNF B;  2EVZ A;  4RW7 B;  2QMU B;  3BF4 A;  1HBO A;  5D6G A;  3ENV A;  2IY5 B;  3KNA A;  4CLW A;  3Q24 A;  5B0G A;  3HSD A;  2RNE A;  3U7J A;  3ITH A;  1EKR A;  2DYA A;  4X4T A;  1KP6 A;  2RML A;  4DV2 J;  2E66 A;  5G0R A;  1CJT B;  2DXE A;  3G8T A;  1FKO A;  4OV1 A;  2Q6B A;  1YRT A;  4DU7 A;  2A1B A;  2RE1 A;  4Q0B A;  2B5J B;  2G13 A;  1LK5 A;  2MZQ A;  2MZJ A;  2BOP A;  1KTQ A;  1VHF A;  2EXU A;  1EET A;  1BWV A;  3GII A;  3I56 S;  2ZIT A;  3D2W A;  5C2G A;  2JFD A;  2OMO A;  2KZM A;  2OPR A;  5CCM A;  3M1V B;  1LWX A;  3KHL A;  1UEV A;  4OLP A;  1WEX A;  1VLO A;  1VQO S;  5L9N A;  1OSD A;  4N56 A;  3SEO A;  2XS7 A;  2CQP A;  3VV2 B;  3KFW X;  4DR1 F;  1K73 T;  3ZTO A;  2C3Y A;  3MOJ B;  2PII A;  3JAM Y;  2MLY A;  1FES A;  1KWM A;  1JLG B;  4I67 A;  4FPR A;  2EBE A;  3BDP A;  2UVR A;  1YKW A;  3CO0 P;  2KXN B;  2DEJ A;  1UVJ A;  2L9D A;  2CJY B;  3OTE A;  2NS1 B;  5HVH A;  4M5D A;  1RLD A;  4NMX A;  1HMV A;  3LAL A;  2LKZ A;  3MPV A;  4DV0 J;  2F65 A;  2RD5 C;  1WF2 A;  1QSS A;  2BYC A;  1PG5 B;  5GAD I;  4F67 A;  3S8S A;  5IWA F;  4O0I A;  1WKK A;  4DR2 F;  3A8E A;  5KFR A;  1X4F A;  2X3D A;  1CPZ A;  1S1V B;  2QMW A;  1B4S A;  3PXG a;  3H2V E;  3C2P A;  4OHW A;  4MFB B;  2H4W B;  5KG2 A;  1WSV A;  1OIA A;  1S1T A;  4OMF G;  2MQ8 A;  4N7T A;  4MK8 A;  5K8P A;  4ED5 A;  3DC2 A;  2CVI A;  1RCX B;  2MPU A;  2B4P A;  3T19 A;  5KFB A;  1O8B A;  1M0S A;  4ED4 A;  3VF0 B;  4RW8 B;  1Y5N B;  4G1Q B;  1PBU A;  5SZT A;  5HN0 A;  2C2O B;  5A76 A;  3D0H E;  1NKC A;  2HIQ A;  4CCH A;  3KHR A;  1JLQ B;  1NJX A;  3V6K A;  1N56 A;  1Y5L B;  2C2E A;  4KO0 B;  2IJN A;  3NCR A;  1OQ3 A;  4NYO A;  4UST A;  2FJD B;  2FIU A;  2VQE J;  3VGV A;  1KFD A;  3POT B;  3GYN A;  4WK3 A;  2QZ8 A;  3QSY B;  2ROG A;  2YBV A;  1J5E J;  1PYO B;  3C16 B;  3CJS A;  1CEZ A;  1IBC B;  3FVY A;  2AD9 A;  1AUS L;  4YME A;  2YPZ A;  1TL5 A;  1TU0 B;  4U7U D;  3U1M A;  1CJV A;  2CJB A;  1T05 A;  1IBM F;  2UUC J;  1P6T A;  1PBA A;  5D3G B;  3SCI E;  2ASY A;  1NJI T;  1EAY C;  1YQH A;  4LSN B;  9RUB A;  2VV5 A;  2DHS A;  2DPJ A;  1LWC A;  2IFX A;  1TZ0 A;  3G6X A;  3RB3 A;  4ECW A;  3TAN A;  2PO4 A;  1JLC B;  2AW0 A;  4U95 A;  3P45 B;  4NA2 A;  2J6S A;  3C66 A;  2XI2 A;  1T3N A;  3DGP B;  2WVF A;  2FVQ A;  2W1B A;  4NX9 A;  3OTD A;  2I9S A;  5LSL A;  3PYF A;  2FY8 A;  2XGQ A;  1OPI A;  4AXJ A;  5LMN F;  5U47 A;  1VQN S;  4YFU A;  4CLT A;  2ZUG A;  2YNF A;  4RW7 A;  2ZC3 A;  4EBD A;  3HKZ D;  2ZHO A;  1WOS A;  4DUT A;  1VMB A;  3WC0 A;  3DI6 B;  2XSF A;  4AUK A;  4WXO A;  3M8P B;  2MKI A;  3P5B P;  2XG8 A;  2B5J A;  3HVW A;  2B7C B;  1XR7 A;  5B0D A;  2B7B B;  3MR3 A;  3L09 A;  3R5J B;  4UY8 T;  2VKR A;  2G9O A;  3NS7 B;  3RB0 A;  4MIW A;  3DFE A;  3AOD A;  4IYQ A;  4RWW A;  3C6U B;  4DR5 F;  3EXC X;  2HND B;  1XMO F;  1IWG A;  4L3N A;  4Z2X A;  2I38 A;  5KFV A;  2XGP A;  2PA8 D;  2V8D A;  4F25 A;  2GIR A;  2KJV A;  2CG4 A;  5EWE A;  4WZQ A;  1NU4 A;  3EGW B;  4FXW A;  2XZD B;  1KS2 A;  1GFW B;  3LH2 S;  3MMB B;  4C8K A;  5AE1 A;  2YXL A;  4IH5 A;  2G0J A;  4KH0 B;  1I51 B;  2GQQ A;  4O4R A;  5HAO A;  1YJW S;  4P71 A;  4ZVU B;  3UWT A;  2AJ0 A;  4FVM A;  1M1H A;  1S0M A;  1YWX A;  2CPD A;  1JLG A;  3DHX A;  1WG4 A;  4OV6 A;  4OYB A;  2RHQ B;  4EYI B;  2JEJ A;  9ATC B;  5B0F A;  4OX7 A;  3AXM A;  1FDA A;  2Q43 A;  3T6J A;  1UW9 A;  2RUS A;  3KHH A;  1A6L A;  5H9E J;  1PAU B;  4JI7 F;  3R2C J;  2IYG A;  3MUV P;  4GKK J;  2R42 A;  5MAO A;  5DG8 A;  3AY0 A;  1U25 A;  1FE0 A;  3FRZ A;  4X4O A;  2AZ1 A;  1NLK L;  1N48 A;  4AE5 A;  4ZDN A;  1YGY A;  1NDP A;  2FHK A;  3A12 A;  1HWL A;  3H59 A;  4ZVE A;  4Q45 A;  1SKU B;  1HNZ F;  3GP9 A;  2GIF A;  3N9U C;  1DFD A;  4RNH A;  1S1V A;  5IT0 A;  4H4O B;  2RU3 A;  4UW2 A;  1X4D A;  3G6V A;  4MFB A;  3N79 A;  5KG3 A;  3BGL A;  3HVT B;  4CQ1 A;  1U02 A;  4WTO B;  4HDG A;  3PJ9 A;  2XMU A;  4KB7 A;  4ZIV A;  2X1B A;  3UPF A;  3OHB A;  1FJ7 A;  2NLW A;  1HI8 A;  4O3Q A;  4PAB A;  1YIT S;  2OFG X;  4DV2 F;  3BO3 A;  1B7Y B;  4RW8 A;  3AJ2 A;  3CDW A;  4G1Q A;  5LXR A;  3IS9 B;  2FB0 A;  4AQY J;  4UT4 A;  5HRO A;  2BM0 A;  3KG1 A;  2KH9 A;  5B09 A;  4R8U B;  3OLB A;  3D66 A;  1KDN A;  4KO0 A;  3R2D J;  2RKI B;  3MOZ A;  3CDU A;  4TU7 A;  3POT A;  3K7R A;  3QIP B;  2HHW A;  4UOG A;  3H2L A;  1C4C A;  3DRP B;  1PIE A;  4BS2 A;  4ZPA A;  1RT3 A;  1IUJ A;  2IPO B;  2XMK A;  2EWH A;  5IT9 Y;  2V67 A;  2PT0 A;  1FVS A;  2AT1 B;  4DUZ J;  3N5B A;  3EVO A;  5HVF A;  2WSC C;  5D3G A;  1W2I A;  4MTP A;  2XLI A;  4U7C A;  4P10 A;  2FJX A;  1YTY A;  3MED B;  3MM6 B;  1W26 A;  1Z1Z A;  4HI2 A;  4LSN A;  2E5H A;  1SPB P;  4EMD A;  4PWW A;  5J1E B;  3EGN A;  4I6Y A;  2Y1L B;  4DSK A;  2OH2 A;  2KG0 A;  2HHQ A;  1K0T A;  4CLS A;  5LL6 d;  1UW4 A;  2HHP A;  4JI8 J;  1JLC A;  4E0D A;  3DRX A;  1NPK A;  3MEK A;  4RR5 A;  3R5A A;  4GVL A;  3NWR A;  3G9C A;  3DGP A;  3C14 A;  2DHG A;  2YQ0 A;  5KG6 A;  3TX0 A;  4R0E A;  3RG6 A;  2DR9 A;  3H20 A;  4JV5 J;  1VIO A;  1YI2 S;  4HVZ A;  1VQM S;  4DV0 F;  3PFO A;  1WHY A;  3KJQ B;  3L7U A;  3UCG A;  1RHJ B;  1ZAX A;  3DI6 A;  3NNH A;  3PJW A;  2YKP A;  1TFY A;  4BC9 A;  5A8R B;  1TL4 A;  4NA3 A;  3M8P A;  4ZPC A;  1Q81 T;  1S72 S;  2HWI A;  1D1U A;  1QTN B;  2CQG A;  2W9A A;  3MR5 A;  2A2C A;  4X2B A;  3PR4 A;  2RRN A;  5BXI A;  4DCO B;  4DL6 A;  2C2K B;  2VAS A;  2ZH5 A;  5IFM A;  3NOG A;  3BDE A;  5CD4 A;  3Q8Q B;  4LRD A;  1WF0 A;  1CSJ A;  4JP8 A;  4I1T A;  2D3O 1;  1WI6 A;  1BC6 A;  2PMH A;  3SFU A;  1M90 T;  3MMB A;  3WC2 A;  2V0N A;  4USJ C;  2O01 C;  4Q44 A;  2YX1 A;  2C2R A;  4DL2 A;  2DHX A;  3M7V A;  3KG0 A;  1RU2 A;  1XK8 A;  4RBT A;  4NLR A;  3NBP B;  2DNO A;  3T1H J;  2V34 A;  5KFO A;  4ED1 A;  2VQE F;  4A8F A;  4HI1 A;  2GAG C;  4IO9 Q;  2ZVI A;  1QD1 A;  2QLW A;  1G3O A;  1S0O A;  4DL0 C;  2DHH A;  3AAW B;  1U47 A;  2J8A A;  1VJQ A;  4USM A;  2DGV A;  3BBC A;  5I42 A;  1WD6 A;  3PZP A;  2EEY A;  1BD6 A;  4HTJ A;  3AT1 B;  2FYX A;  2QG9 B;  2OEK A;  4KTQ A;  5L39 A;  4OI2 A;  3V6J A;  4DJB A;  4O3N A;  3R1H A;  2GQ2 A;  3V5R A;  5T41 A;  1S6U A;  1X9S A;  4P7V A;  2XYG B;  3VGT A;  2DNG A;  4JV2 A;  4H4O A;  2M70 A;  2QLX A;  3OLA A;  3V6D B;  1ZS6 A;  2VJU A;  4OYA A;  3J7Y U;  2XBP A;  1FNX H;  3PRB A;  3ELH A;  3HVT A;  1WKL A;  2VD3 A;  2HZC A;  1HW9 A;  2YNG B;  1DZ5 A;  4YB7 A;  2XCA A;  3M2R A;  1WJ9 A;  3RJM B;  1ZTT A;  3CCZ A;  3G4S S;  3NXZ A;  2ACM A;  4NPO A;  1HAR A;  5DET A;  2WK4 A;  3H4B A;  4I6A A;  1UEU A;  2J7K A;  3KUG A;  1T7P A;  5J2N B;  2B43 A;  2UXC J;  2CPH A;  2CJK A;  3IWN C;  4YOE A;  2YH0 A;  3MPU B;  1T9V A;  2MDA A;  2DH7 A;  1S1U A;  3ZNU A;  2CQ4 A;  5LJ5 Y;  2LDY A;  2YY3 A;  4R8U A;  1WWH A;  4LQ3 A;  2RKI A;  3FFI B;  3OW2 R;  3JQM A;  4PUO A;  8RUC A;  3QIP A;  4WP8 A;  2F4F A;  4D3H A;  1WEZ A;  2XSJ B;  4NLQ A;  4NZ6 A;  2JC0 A;  1M5K C;  3VAH A;  1HWI A;  1WC4 A;  3GJS B;  2V4Q A;  5I3U A;  3M8S A;  3AA8 A;  2F8M A;  1X7V A;  4M94 A;  5BYS A;  2E5J A;  3EWG A;  3DRY A;  3MED A;  3MM6 A;  4FPI A;  4DDF A;  4C0H A;  2V4J B;  2HK3 A;  1U4B A;  1Y9O A;  1D9D A;  3OXF A;  3QQC D;  3HP6 A;  2HGL A;  1SL0 A;  3RB6 A;  3LOU A;  1NHU A;  5ITH A;  3OHA A;  2LP4 A;  1RT7 B;  4JI5 J;  1R7I A;  1ZAW A;  4DR6 J;  1Y0H A;  1TK8 A;  4O23 A;  4QYZ K;  2KFN A;  2NYI A;  3WHI A;  4D3G A;  1RTZ A;  2ZE2 B;  4DL4 A;  1F5C A;  3B54 A;  5JVG Q;  1SV5 A;  4L72 B;  3DDK A;  4GKK F;  2IRY A;  3A8I A;  5IQQ A;  3S6E A;  4RWX A;  4RX6 A;  2E1M C;  4C97 A;  3QGG A;  2HWT A;  3MMC B;  2H3E B;  5A8R A;  5C5J A;  2XMT A;  3ZZP A;  4OFZ A;  4USU A;  3R1L A;  1TEL A;  3F56 A;  4NLG A;  4ID5 A;  2BW7 A;  4EI2 A;  3CJ3 A;  2KKH A;  2M9K A;  1YJR A;  2KHC A;  3LP1 A;  4RJV A;  5IT4 A;  1DJ0 A;  3U02 A;  5F8H A;  3GG1 A;  1UWA A;  1FJG J;  1N5Q A;  2ADB A;  1S5Z A;  1P9Q C;  2QLF B;  4ECX A;  2APO A;  3M6X A;  1U1P A;  4NCA A;  3BPS P;  3GSI A;  3LW5 C;  1YRU A;  4WP9 A;  1NB7 A;  3IG1 A;  3WIV A;  4KHP F;  3CMQ A;  5ETQ A;  5B7W A;  2C2N A;  2VDI A;  3KLG B;  5THW A;  2ZDO A;  1OY8 A;  2QLB B;  2ZBR A;  1H98 A;  3D54 A;  2VF3 A;  5L8R C;  2YKQ A;  4L75 A;  3NBP A;  1J2V A;  2AGP A;  1TUW A;  4IQM A;  1P8G A;  1YJ9 S;  1QJH A;  2C3U A;  2HVE A;  2IJF A;  5DZ6 A;  4UTG A;  1ZOT A;  2BE9 B;  1FFS B;  3NGT A;  4Z7C A;  2B9X A;  2R8I A;  3LTO A;  2HZA A;  4ZLP A;  5KAK A;  4QZV B;  2XWY A;  3RAX A;  1X4A A;  2CDQ A;  2VPZ B;  1L3T A;  1AUD A;  3DNC A;  3L7O A;  1W2B R;  3BN7 A;  4QIW D;  2C2D A;  5L38 A;  3PYE A;  5B0C A;  4R5P A;  4JI8 F;  1LWF B;  2V94 A;  2LQ5 A;  5KFL A;  4UZB A;  1OY6 A;  3GFZ A;  3V6D A;  1XNR J;  4I2P B;  4DPO A;  1NK0 A;  2KYZ A;  1QVF R;  4OZ3 A;  2RHS B;  4QW8 A;  3KHG A;  3EVM A;  5KFU A;  3J7Y I;  2DNK A;  4JV5 F;  3HFK A;  4JOU A;  1N52 B;  2W8K A;  4ZA1 A;  3D4J A;  5DDO C;  4NZ0 A;  2FLO A;  3Q23 A;  3QID A;  2NSB A;  1RWO B;  1JK9 B;  5M2U A;  3PAC A;  3TJ9 A;  3W8P A;  1CC7 A;  1TQL A;  3KLE A;  2BE7 D;  4K4W A;  4QWB A;  4J9R A;  5J2N A;  4Y34 A;  2XLK A;  3CCU S;  3M32 A;  1WAC A;  5C25 B;  1K9M T;  3JTP A;  2DNH A;  2GX8 A;  2LFV A;  2VPY B;  3OL8 A;  3KLI A;  4YB6 A;  4EBC A;  5HMY A;  3K5L A;  1S6Q B;  2QL9 B;  2B56 A;  4MH8 A;  3I9Z A;  4X4N A;  4MKY A;  2MKS A;  2VKZ G;  1B64 A;  2R8J A;  3FQK A;  4PXE A;  3DHW C;  2XSJ A;  5EN1 A;  4AXI A;  3VAK A;  1G6B A;  4IR9 A;  1AZS B;  2HQI A;  1BGX T;  3MM5 B;  3ZO7 A;  2VC1 A;  5HI7 A;  1Y3J A;  5E5N A;  4J9M A;  4CI0 B;  3DXB A;  2DY1 A;  1Z4U A;  2AJ2 A;  4QR0 A;  4KGK A;  2OSR A;  2V4J A;  2UVV A;  1SJR A;  5FJ4 A;  2FHO B;  2NXJ A;  2BJ8 A;  3DXS X;  5K8N A;  3T1H F;  4Y6I A;  3SCL E;  1FRX A;  1AYE A;  1T9W A;  1RT7 A;  3KK1 B;  2WSF C;  2GMJ A;  4IRC A;  1U48 A;  2ZWO A;  5LXY A;  2ZE2 A;  4L76 A;  3E51 A;  4OZ0 A;  2EKY A;  4X65 J;  2VG7 B;  2D9O A;  1M5O C;  3AXK A;  5HAN A;  1GH8 A;  1H3D A;  4CLZ A;  1WDD A;  5IQ6 A;  4LMZ A;  1VQS A;  3FSX A;  4WP3 A;  4ITS A;  1NH8 A;  2ZZM A;  3LPY A;  3MMC A;  2UXB F;  2YX4 A;  3DOM B;  5KFT A;  1QLN A;  4DPU A;  1M5H A;  1VC0 A;  1F9E B;  3TRG A;  1HD1 A;  3MPD A;  3GIL A;  2IVM A;  1LXJ A;  3IWL A;  1RTH B;  2P8I A;  3HCX A;  3JSR A;  4ED7 A;  4ED0 A;  3P96 A;  1EKS A;  4WFN Q;  4ZP6 A;  3GJQ B;  2R8K A;  1WDT A;  2K7J A;  2DT9 A;  3Q8P B;  3TI0 A;  2YVS A;  3QWU A;  4KHM A;  4KYZ A;  2D69 A;  2HHS A;  1RAC B;  1WSR A;  2OML A;  2JLE A;  2GJI A;  2W7A A;  5KFN A;  5CA5 A;  4RUB A;  2CQ2 A;  5DG7 A;  2Z2M A;  1RHK B;  4NL5 A;  3GYG A;  2PN6 A;  3KLG A;  1SH3 A;  4ELT A;  2CFX A;  5KFW A;  2C28 A;  1TVR B;  2KVI A;  4AT1 B;  4YB1 P;  2N82 B;  2HBQ B;  2QGF B;  3GWC A;  3LWM A;  1TKX A;  1NCL A;  2QSW A;  3DCA A;  2K1R B;  1VRT A;  4CO2 A;  1TKT B;  2IM1 A;  1WHW A;  3PO4 A;  4ZPT R;  2KU7 A;  4CYU B;  5H9F K;  3MEE B;  2GVZ A;  4QBU A;  4QJV A;  4M5J A;  1KN6 A;  4WWS A;  2QTW A;  3GCX P;  2G1D A;  2CPF A;  4KPC A;  3M9N B;  1VBZ A;  1SL2 A;  4C11 B;  4DZ6 A;  4USH A;  2YWF A;  4TLR A;  5L1I A;  4NLO A;  3TZW A;  3Q22 A;  4XDD A;  1RA7 A;  1S9G B;  4CO5 A;  3FSY A;  1EJ7 L;  2VOO A;  2FZG B;  3HMJ G;  3NGS A;  1LWF A;  2HW3 A;  4QU7 A;  1H7X A;  4JI5 F;  4WFA Q;  4UQT A;  2ZNZ A;  1JX4 A;  3NG8 A;  3SSS A;  4GC7 A;  4H54 A;  4I2P A;  1Y4Z B;  4YY3 F;  2QYG A;  3OR1 B;  3JS9 A;  4GVB B;  3HFV A;  1Y7P A;  2PMW A;  3CCQ S;  3W1Y C;  3W61 A;  2E44 A;  1NM2 A;  2KI2 A;  3CD7 A;  1HD0 A;  2CPX A;  4W90 B;  2Z2Z A;  1T11 A;  2MST A;  1KHV A;  4DL5 A;  3HDS A;  2NXU A;  2R7X A;  4EZ6 A;  2EFG A;  1IKX B;  2XZT B;  1Q79 A;  1CQM A;  3MPW A;  4PQU B;  4NOH A;  2BBE A;  2M8D B;  3FMW A;  2CG8 A;  1GMU A;  5AT1 B;  4CDI A;  4WXW A;  2GW8 A;  1ROF A;  2IMW P;  5C25 A;  1E6Y B;  2VL1 A;  4QQB A;  3C15 A;  3NMR A;  5HK4 A;  3US5 A;  1S6Q A;  3MR7 A;  1FJG F;  3KXD A;  4G1I A;  4QYR A;  3NEK A;  4MYT A;  1UVN A;  3D1H A;  5DO2 A;  4LFB J;  3PW5 A;  3U1N A;  1VDH A;  1AZS A;  3B78 A;  3CJT A;  3MM5 A;  3GPA A;  2R7T A;  2IIH A;  1FKP B;  1P1L A;  3CDB A;  3V2U C;  4ZKA A;  3H40 A;  3HM9 A;  4B3T J;  1OPZ A;  3CJR A;  1NPR A;  2JC1 A;  4FZV A;  1VQ8 S;  5ETO A;  2A6M A;  2LXI A;  2V8P A;  2VIH A;  5KFJ A;  4OYO A;  2LMI A;  2HWH A;  1NK7 A;  4QR2 A;  3OFG A;  4ECQ A;  4QOT A;  4LQ9 A;  1GTH A;  1GTE A;  3MTK A;  1CC8 A;  3UN5 A;  2UU9 F;  1LXN A;  3N6L A;  4P9S A;  3KJV B;  7FD1 A;  3C3L A;  3RW7 A;  3R7S B;  1TFW A;  4QW9 A;  4XAK A;  5FD1 A;  2VG7 A;  4IOA Q;  2J5A A;  3FQL A;  4F0M A;  4DR3 F;  2BR0 A;  4K8R A;  1AXQ A;  4YDX A;  4LF6 J;  2H54 B;  3DOM A;  4DHV A;  2V8V A;  1LWE B;  2LQ9 A;  3PYD A;  1FWP A;  1JJ4 A;  4LFC J;  1R89 A;  2DXF A;  3UO0 A;  1Q8K A;  2DH9 A;  3CJQ A;  1B99 A;  2KG1 A;  1QAX A;  3LP0 B;  1L3U A;  2F63 A;  3VQT A;  1RTH A;  3ISZ A;  1F3F A;  3TOQ A;  1ZM9 A;  4OL8 A;  2QEX S;  2Y8Y A;  4QPT A;  3TAQ A;  2DVI A;  2XC9 A;  4Y0F A;  4G6V B;  2RU9 A;  3B4D A;  5K14 B;  2H65 B;  4LFA F;  3SV4 A;  4KPY A;  4CO3 A;  2A2D A;  1HHQ A;  2YX7 A;  3PX4 A;  1Q7Y T;  1IKY B;  1BMQ B;  2CQI A;  3TAP A;  1QY7 A;  4ZOS A;  4C8Y A;  4UUX A;  1RWN B;  4MK9 A;  5D8H B;  2WVC A;  3GFY A;  3ENW A;  1LW2 A;  3TZX A;  4QIE A;  1Q1K A;  1TVR A;  3UFC X;  1MWY A;  2RQM A;  3OBI A;  4G1P A;  1WG5 A;  4EFA C;  5KG5 A;  3ZZ0 A;  3QRQ A;  4NXN J;  3PJX A;  2K1R A;  3NP5 A;  2FZC B;  2RS8 A;  3HVR A;  3D68 A;  3PY8 A;  5E33 A;  3EMT A;  1A9N B;  4QIF A;  5A8K B;  2BJ1 A;  1PCA A;  4CYU A;  3CCW A;  3MEE A;  4LJM A;  3QGH A;  3QZ8 A;  2ZOG A;  3LGM A;  4DCP B;  1U1R A;  1XMB A;  2BAN B;  1SIW B;  4X4S A;  2I0X A;  5LSR A;  1X9W A;  1X5P A;  4KAI A;  2JH3 A;  1U1M A;  1YJU A;  1PJ6 A;  3SZ2 A;  1NSP A;  4P72 A;  3IMQ J;  3K8W A;  4MKA A;  1S9G A;  2EFQ A;  3VR1 A;  3OJS A;  4O4G B;  1C0U A;  2DRD A;  3FCH A;  2J7U A;  2XTJ P;  3M8Q B;  3PV8 A;  1SJ1 A;  4IDK A;  5HLF B;  4ZHR A;  1F0X A;  3NGD A;  2VU5 A;  4G65 A;  1I94 J;  1S59 A;  2VDH A;  4CT8 A;  5L1L A;  3SQG B;  3PEJ A;  4HR2 A;  3JQJ A;  4CLF A;  2J0X A;  1V6H A;  1E6V B;  4K5R A;  3EGZ A;  1I5O B;  4CTA A;  1IKX A;  4DV5 J;  1VBX A;  3Q86 A;  3BQ1 A;  4F50 A;  4P6Q A;  1N8R T;  1HI1 A;  3GIK A;  5A2Q U;  1GMV A;  4M5H A;  1E6Y A;  3L9Z A;  4LSL B;  2QFI A;  1ZM4 A;  2HFN A;  2KHD A;  4ECT A;  3MUR P;  4K50 A;  2HHU A;  3BEG B;  3G71 S;  1IKW A;  3VZI A;  1R8H A;  4CNY A;  1VCT A;  5J1P A;  4XPC A;  3LF0 A;  4DX5 A;  1RT4 A;  3M4X A;  4DV1 J;  1TKD A;  2OD4 A;  3LP2 B;  3G82 B;  1RAE B;  3G6Y A;  4X64 F;  2RAQ A;  1TAU A;  2OD6 A;  5K20 B;  1FKP A;  2RDD A;  4DS4 A;  1Y3K A;  3Q8R B;  1LQ9 A;  1T0T V;  4DPW A;  2WCX A;  3SBM A;  1NH7 A;  2Q79 A;  4I6W A;  4Y3C A;  3CNQ P;  3BB5 A;  3MD3 A;  4MYU A;  1AW0 A;  1C1B B;  1JKH B;  5F41 A;  3THP A;  3MAQ A;  1NXI A;  2DO4 A;  3CCV S;  2FHJ D;  3JB9 k;  2CPY A;  4QWC A;  2FC9 A;  1HW8 A;  4Y00 A;  3P5T L;  4ZLJ A;  1T8E A;  4FNH A;  4ED6 A;  4J90 A;  1SKS A;  3MUM P;  4K4V A;  2XY5 A;  2UV8 G;  1XER A;  1NHV A;  2GHP A;  3OFE A;  1DBD A;  2WW4 A;  4FDF A;  2ZM6 J;  2QL5 B;  3PO5 A;  2BM1 A;  2HS4 A;  2CIM A;  1PYS B;  2QJ3 A;  4PZV A;  2VFT A;  3I6P A;  4Q8E A;  2KYX A;  4AYB D;  3G2X A;  4DPT A;  1X4B A;  3CJ4 A;  2HNZ B;  1NUE A;  5F8G A;  1OO0 B;  3CWJ A;  3LP0 A;  2BV3 A;  3B8H A;  1HQU B;  3M05 A;  4ELU A;  4P52 A;  4Y2A A;  1RKJ A;  3K5N A;  1FWK A;  1SUQ B;  1MW7 A;  1NEE A;  2GHW A;  5K14 A;  1U49 A;  5DLG A;  4KFB B;  4FBU A;  2BJ7 A;  1BXN A;  3EPG A;  4NYZ A;  3H0P A;  4M5L A;  4O0N A;  4JV1 A;  5DQI A;  4PCQ A;  1R0C B;  2BKN A;  3DLE B;  5T7L B;  2HVD A;  4B9L A;  5CYQ A;  2CPZ A;  4P75 A;  5KFG A;  5K8M A;  2CAD A;  2WB1 D;  5GMD A;  2G2O A;  3ZZY A;  2MGZ B;  2IAJ B;  4NZ7 A;  2MYF A;  1BY9 A;  3FC9 A;  3BRE A;  3MUT P;  1SC6 A;  2X3G A;  2K3K A;  2LQJ A;  2R7O A;  5E3P A;  1FXR A;  2DGQ A;  3Q83 A;  4LIR A;  5A8K A;  2G0C A;  1JJC B;  4C3K A;  4LFB F;  2M3D A;  1HLW A;  1L3K A;  3NOC A;  4K4Y A;  2VBW A;  4LR8 A;  2A10 A;  4TKT A;  3O6Q A;  3PG9 A;  1JIH A;  5CYM A;  2D9P A;  3DRS B;  1WEY A;  4OYZ A;  4Z37 A;  4B3T F;  2PD1 A;  3ZZU A;  2MXY A;  4V1A k;  4XK8 C;  1YHQ S;  1S77 D;  2GV1 A;  3W65 A;  4O4G A;  2Z8Q A;  3CCJ S;  4IRD A;  4B9N A;  3LGH A;  1SVD A;  4F02 A;  1QM9 A;  3M8Q A;  4GRS A;  3TO8 A;  3CW2 C;  3O8W A;  4TQR A;  3NCQ A;  4L73 A;  1NND A;  1OSC A;  5HLF A;  3CMA S;  1U1N A;  1U09 A;  2KVQ E;  3I87 A;  3SQG A;  1U26 A;  3EGV A;  4P73 A;  3E8O A;  1JQG A;  1RE1 B;  4C9D A;  1VFJ A;  2XO7 A;  1E6V A;  1MU2 A;  3GIJ A;  4TN2 A;  1OS5 A;  2F8H A;  4ECR A;  3OTO J;  4WF9 Q;  2DNP A;  4LF6 F;  4ELV A;  4WJB A;  3CPW R;  3OTB A;  3D3B J;  2CJQ A;  3I5B A;  1H74 A;  4ES1 A;  3G8S A;  2V2V A;  3PM9 A;  4LSL A;  2IRU A;  4DOZ A;  2AEM A;  3MZI A;  3M6V A;  1S4F A;  3GJT B;  3I4H X;  2IJR A;  2CQ1 A;  5IC4 B;  3WX8 A;  1M1G A;  4DSF A;  1FKA F;  2M5Y A;  2WSE C;  1L5U A;  3K8V A;  6FD1 A;  4C8M A;  3UNY A;  3TNV A;  4J9U E;  3PCO B;  3G82 A;  5HMW A;  4PG8 A;  3HSZ A;  1PYT A;  4ED8 A;  2YKM B;  5EX0 A;  5D0G A;  4DR2 J;  3KLH B;  3IGN A;  1R43 A;  4FYD A;  4F4A A;  1LNQ A;  1IR0 A;  3KYL A;  4UF4 A;  3R9L A;  3SIP B;  4WIQ A;  1C1B A;  2DR5 A;  5GVQ A;  1MG7 A;  3SDE B;  3H5U A;  1O5J A;  4URQ U;  1U0S A;  2VC0 A;  3CJ5 A;  4WU3 A;  4DL7 A;  1MMD A;  3AD7 C;  2KB2 A;  2E9T A;  3AHP A;  3DM2 B;  3ITH B;  3IBW A;  2RRB A;  5KT7 A;  1GXL A;  1V3R A;  4BCA A;  1DQ8 A;  1JXL A;  2YNI B;  2V6A A;  2PE8 A;  3T41 A;  1SCJ B;  2DCL A;  2CZ4 A;  3PYG A;  4ILL A;  3FNN A;  4K2X A;  1UZD A;  5LSO A;  1EET B;  2HNZ A;  2PSZ A;  5CZX A;  1URN A;  2LDI A;  5BR8 J;  1HQU A;  2BZ2 A;  1SQG A;  1Q8L A;  1RAO A;  1I94 F;  1JNZ B;  2YKN B;  1SUQ A;  1PC5 A;  3TVZ A;  3QGP A;  1VBK A;  2VBY A;  2BJ9 A;  4KFB A;  5L1K A;  1RHM B;  3PHE A;  4FNI A;  4CO1 A;  4F7V A;  3DLK B;  4Q8F A;  2J9D A;  4U8Y A;  1IR1 A;  2OTL S;  3DLE A;  5T7L A;  1B0T A;  4C48 A;  1NK9 A;  1RSC A;  2M8H A;  3A13 A;  3HVA A;  4IG0 A;  5JMN A;  2MGZ A;  2IAJ A;  3T6B A;  2PC6 A;  2XCP A;  1ULR A;  4X4Q A;  5LMN J;  4NWB A;  4N8N A;  2V9K A;  3HUL A;  1OY9 A;  1KD1 T;  3AJD A;  5L46 A;  2R2T A;  4YR2 A;  2XNQ A;  1YJT A;  1SKR A;  3CD0 A;  4NAS A;  1FFG B;  3NAI A;  1KEK A;  3HHK A;  1HWJ A;  3MMJ A;  5CHC B;  5C7P A;  1RAH B;  4B3S J;  5ETV A;  1U6B A;  2K7K A;  3DRS A;  5I4M A;  4X66 J;  2UUT A;  3EE3 A;  3OUY B;  4ZIT A;  1R6V A;  2Y9H A;  4IRK A;  1PKU A;  3H2U B;  4USV A;  5IV3 A;  1REG X;  4LF5 J;  1UET A;  1GXU A;  1S1T B;  3IWX A;  2KZZ A;  4PR6 A;  4WKR A;  1XMO J;  1YJ7 A;  2H5J B;  2WRM A;  1VK3 A;  2V8H A;  4LBH A;  1Y5I B;  4B9V A;  1JWW A;  1WF1 A;  1FDN A;  2F40 A;  3WDO A;  1Y00 A;  1A0O B;  2BXJ A;  1FRM A;  4A8W A;  2ZM6 F;  4JI6 J;  2O1P A;  2B0G A;  4DPX A;  4NLD A;  4OYI A;  3ILJ A;  5HVG A;  2WBM A;  4CLK A;  2ZJP Q;  3ZNJ 1;  5HP1 A;  5JJB A;  4DU8 A;  2R7U A;  4DWI A;  1NBE B;  3THV A;  3C8Y A;  2R7R A;  2YPY A;  3H42 A;  2WZ1 A;  2QV6 A;  1CJU B;  2XS5 A;  2DEI A;  1K44 A;  4WK1 A;  1PGZ A;  1LV5 A;  3CC7 S;  4EU0 A;  2ZFH A;  3GU0 A;  1HKA A;  4Y2I A;  1GMW D;  3KLV A;  1OWX A;  2E1R A;  3VTI A;  3OSP A;  1BWE A;  2MSS A;  1CJV B;  2DIT A;  2RQC A;  2M4M A;  4RLE A;  4ZCL A;  4Y65 A;  1VRU B;  4KSE B;  5F8L A;  1ICE B;  2PDA A;  1IR2 A;  1RAJ A;  3GB0 A;  4ATN A;  3VAI A;  4K4T A;  2YKM A;  2FLN A;  3KLH A;  1VQ4 S;  3TA0 A;  3T5J A;  1PJ7 A;  2EW9 A;  4PWD B;  2RS2 A;  3UD4 P;  2CA9 A;  3N01 A;  4RU2 A;  3VCD A;  1FO1 A;  2JJ4 D;  4X4P A;  5CAB A;  1RWU A;  1XIQ A;  2J76 E;  2Q1L A;  3SDE A;  2LA6 A;  3HSJ A;  4YUD A;  2AF6 A;  2CDR B;  2DIU A;  2DR7 A;  2ZH4 A;  1H0H B;  5J1N A;  3TZY A;  4DG1 B;  3CSK A;  4Q2M A;  4ZK7 M;  3WBZ A;  3DM2 A;  2NPI A;  1RXO B;  2WVB A;  5AXM A;  2DD8 S;  5F0U A;  4KKO B;  3MEG B;  2K2P A;  1KSP A;  1VC5 A;  5KFF A;  5E3R A;  1AA1 B;  3IN5 A;  3H5Y A;  2AX1 A;  5AJ3 J;  5H9E K;  2YNI A;  2ZOF A;  3QFH A;  3FBC A;  3LPE A;  2J6T A;  2MQM A;  4WII A;  1NSQ A;  3GFX A;  3NGK A;  5MLC V;  5HSP A;  3N5F A;  5KFI A;  4KHR A;  3PX0 A;  2MKJ A;  5E41 A;  1R8B A;  3BGF A;  4LBI A;  2AIR B;  3LO3 A;  3RRH A;  2GFF A;  3GTY X;  2MJU A;  5D0H A;  2YKN A;  1Q86 T;  3W9H A;  1Y11 A;  4OYW A;  2QMX A;  4KY3 A;  4F4K A;  4I2Q B;  2Q6C A;  2V63 A;  3OTO F;  4DSE A;  3QPI A;  2JVR A;  3DLK A;  1ZYQ A;  1DAR A;  1BQM B;  2G1H A;  2E9Z A;  2VQF F;  4H4M B;  3P8B B;  1UCN A;  4OQJ A;  2Y1I A;  1NK5 A;  3A8J A;  2AKW B;  1EAR A;  2RJZ A;  2RF2 B;  4I4B A;  3TA2 A;  4CH0 S;  2JEG A; 
#chains in the Genus database with same CATH homology
 4B3R J;  4DR2 J;  2UXB J;  5IT9 U;  4X66 J;  5A2Q U;  5AJ3 J;  1XNQ J;  2HHH J;  2UU9 J;  2KVQ E;  4LFB J;  4LFC J;  4DUZ J;  4KYZ A;  3T1Y J;  4X62 J;  4JI4 J;  5FLX U;  4LF8 J;  2VQF J;  5IWA J;  2ZM6 J;  4DV2 J;  1IBL J;  4DR4 J;  4LF5 J;  2KL8 A;  4PWW A;  3OTO J;  2F4V J;  4DV3 J;  4KHP J;  4DR3 J;  1N34 J;  2UUA J;  4LF7 J;  1XMO J;  4B3T J;  4DR7 J;  1N36 J;  1HNX J;  3W1Y C;  3D3B J;  3IMQ J;  4JI8 J;  4JI7 J;  4DV0 J;  2E5L J;  4X65 J;  1IBM J;  4GKJ J;  4NEZ A;  4DV1 J;  1HR0 J;  4LF4 J;  4OX9 J;  4JI3 J;  4DV6 J;  5LM7 E;  2VQE J;  4RJV A;  1XMQ J;  2UUB J;  4JI6 J;  4LF9 J;  4B3M J;  4DR5 J;  4DUY J;  4KY3 A;  1J5E J;  1FJG J;  4DV4 J;  4HHU A;  4DR1 J;  5LMN J;  4JV5 J;  3J81 U;  1HNW J;  1HNZ J;  4YHH J;  1I94 J;  2UXD J;  4AQY J;  4YY3 J;  4V1A k;  4NXM J;  3R2C J;  2UUC J;  4GKK J;  2MEW A;  2MTL A;  4JI1 J;  3T1H J;  3R2D J;  4JI0 J;  4JI5 J;  4DV7 J;  4JI2 J;  4NXN J;  4LFA J;  4DR6 J;  5LMU J;  4DV5 J;  1IBK J;  1XNR J;  4JYA J;  3J80 U;  5BR8 J;  4B3S J;  3D3C J;  4X64 J;  2MQ8 A;  4NEY A;  1N33 J;  4LF6 J;  4K0K J;  3J7A N;  3JAM U;  2UXC J;  1N32 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...