4AFFA

High resolution structure of a pii mutant (i86n) protein in complex with atp, mg and flc
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
110
Chain Sequence
MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKRGSEYTVEFLQKLKLEIVVEDAQVDTVIDKIVAAARTGENGDGKIFVSPVDQTIRIRTGEKNADAISAWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords NITROGEN REGULATORY PROTEIN P-II
publication title An Engineered Pii Protein Variant that Senses a Novel Ligand: Atomic Resolution Structure of the Complex with Citrate.
pubmed doi rcsb
source organism Synechococcus elongatus
total genus 24
structure length 110
sequence length 116
ec nomenclature
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4affA00
2E66A 1UFLA 2O66A 4C3MA 3HLUA 1V3SA 1V9OA 4CO0A 2EG2A 2NUHA 1NH8A 2GW8A 4USJC 5D4NA 1UMJA 1KR4A 2XULA 3NCRA 2XBPA 2XG8A 4CO4A 2GNKA 4E98A 4WK3A 3GSDA 3DFEA 2Z0GA 3BZQA 2NS1B 4Y65A 4OZLA 1UKUA 2JJ4D 3AA9A 2ZFHA 1VHFA 4CNYA 4OZNA 1GNKA 4NYOA 3MHYA 2GX8A 3TA1A 4C3LA 4USHA 5D4OA 3AH6A 3O5TB 2J9DA 4Y6IA 4USIA 3TA0A 3AHPA 2RD5C 5L9NA 4RLEA 5D4PA 1J2VA 1O5JA 3TA2A 1NAQA 1XK8A 1H3DA 1OSCA 4D3HA 2CZ4A 5DS7A 2PIIA 3N5BA 2J9EA 4OZJA 4RX6A 4C3KA 2NUUG 4IYQA 4RWXA 2V5HG 2J9DE 2EG1A 3X3UA 4R25A 3OPKA 3LF0A 1QY7A 4YB7A 5D4LA 3CE8A 4D3GA 1NH7A 2XZWA 3AA8A 1V6HA 1PILA 1O51A 4RWWA 4NYPA 2O67A 3L7PA 1NZAA 1Q1KA 4YB6A 2DCLA 1V3RA 4CO1A 1VFJA 3NCQA 2VD3A 3NCPA 1UL3A 4AFFA 4CO3A 2J9CA 4WK1A 4YB5A 1P1LA 2ZOMA 4CNZA 5DRKA 4ZK7M 1HWUA 3T9ZA 3O8WA 4CO5A 4CO2A 3M05A
chains in the Genus database with same CATH superfamily
2RKIA 4DV6F 2W01A 3IBWA 5I42B 2BYCA 2D9PA 3MPDA 4ZVHA 3BBCA 2QX0A 2V8HA 4ANEA 1AFIA 2DNMA 4N8OA 3GIJA 2IMWP 2FB0A 3RRGA 1FE0A 2I38A 2UUCJ 2J6UA 5E0OA 4NLYA 2R2TA 4EZ9A 4DR2J 4B3TJ 2YBVA 2UP1A 1OSCA 3MUMP 2AEFA 4MFBA 4OFZA 1VDHA 4RW9A 2QMUB 1JLBA 5FLXY 5D0EA 1U1LA 3AQPA 5I3UA 3OL7A 4OX6A 4I2PA 5KFAA 3G8SA 4M5LA 4X84A 4DR5F 4RBUA 4ED8A 5CD4A 2Y9HA 4U7UD 3A8IA 1TKZB 3H40A 3MOJB 3V6DA 2UXBJ 3PJ9A 2VPXB 3ULHA 2D3OR 1FX4A 3ADAC 3W2VB 2HRTA 2BQRA 4ICLB 2GNKA 3UD3P 3MXHP 1A9NB 2HFVA 4A8WA 4QYRA 1AUSL 3KLEB 2UUBJ 2K06A 3BKFA 3K57A 2ZKUA 2C3MA 3MTJA 4ZITA 2P9CA 4ID5B 2IPOB 1KBRA 3HXMA 2XSJB 3EYZA 2BOAA 2AMCB 2HQDA 2PD1A 1N5YA 2YNHA 1BUXA 4KHPJ 2WVEA 1DLOB 2Q1LA 2OFGX 1ZETA 3MPWA 3QSIA 1HPZA 3MMAA 1OY9A 3E3XA 4PYDA 4NLXA 4HHUA 3BSOA 4CLLA 1FI4A 3VV2B 1S9EA 4F4XA 2O67A 4LSLA 2AWZA 3MFIA 1YJWS 1Y0HA 5GMDA 2R2SA 3QAEA 1C0UB 1HNXF 2CPIA 2EPIA 2JHEA 4K7QA 1B70B 4P2MA 3NGUA 5HVHA 3MM9B 3OHAA 2EG2A 4R0EA 4QU7A 4DXLA 5KT5A 4OMFG 2D69A 3BZQA 3R7NB 1CS4B 3K5PA 2HEKA 4G1PA 2BJ3A 1KSPA 3VALA 3M8QA 2DO0A 1MMDA 3PACA 5AJ3J 3OVBA 9RUBA 3RB4A 1E6VB 1SIWB 1VQSA 4RLEA 1O8BA 2RNEA 2CWKA 4M5KA 4G1QB 1IM6A 1D3WA 2PMWA 3SQOP 2DGUA 3QWPA 1RLDA 1LW0A 5J2NA 1KLMB 2V68A 2AX1A 2N4CA 3KJNB 2BJ8A 2R8GA 2VKZG 2QZ8A 4F2RA 2PT0A 4KBIA 2GQ2A 1UVNA 4PG8A 1IUJA 5BR8F 1FK9A 1PIEA 2OMLA 4Q44A 4OLPA 4YB1P 3DLGB 5K14A 1RQ0A 3VQSA 2OTJS 4F3QA 3IR6B 5F3TA 3C6TB 1Q8LA 3IBCB 1FRJA 2DH7A 4MH8A 4F4ZA 4FF2A 1EQ0A 5J2MA 1YJ7A 1CJUA 3HSGA 3ZZYA 3SXLA 5HN0A 5FLXU 1X4CA 2XNQA 3O1LA 4DPWA 4FXDA 1REGX 1AW0A 2RU3A 3WX4A 2V6AA 3TYTA 3M2UA 2BV3A 3V4IA 4K0KF 2UVVA 1IM4A 3H20A 2J9DA 4IOBA 2XO6A 3BPSP 3ILLA 4KB7A 3I0SB 4DSFA 2CQDA 1NZ8A 3DLBA 2N3OA 2VQEF 4J9MA 4DSJA 3R5AA 3JSBA 4M1KA 4M5DA 2V4JB 1V6HA 3PR5B 4NLTA 1TQLA 3CCVS 1Q8BA 1UW9A 4CYUA 4B3SF 1EAYC 3SV3A 4KH1B 4DX8H 3FCWA 3QBCA 3HZGA 3HHLC 2YWGA 3M05A 1TVRB 4Y3CA 1U25A 4LR7A 2V34A 2M5YA 4J90A 1S1VB 3R8YA 1JLFB 3CB4A 3MMBA 1A0OB 3EZOA 3KJQB 3TX0A 4E98A 4ED5A 1TAQA 5J2PB 1B7FA 1NB2A 1EKRA 3C6UB 2QYGA 3CPWR 1MW7A 1WC6A 2HBQB 3MHYA 1Y3JA 1BD6A 3Q22A 1TL1B 4CLPA 2QL7B 1SJRA 4ZLNA 1LW2A 3HPOA 1NJIT 3NGRA 3TA2A 3KDNA 1R8HA 4UTGA 1M5HA 4ILRA 4JYAJ 4TY9A 2GJIA 1L5UA 4JOUA 4DSEA 5IM0A 2D1CA 3X3UA 3CJSA 2CVIA 3VGUA 1T9YA 1SC3B 1RAEB 3DRSA 3FCVA 3H2LA 3LANA 1T0TV 1VRUA 1RTJB 3OFFA 3TVZA 1NSPA 3C2PA 2G1HA 1N52B 4WK1A 3HHLB 1LK5A 1Q5YA 3ZTQA 2LVWA 1YRTA 4MKVA 1BXNA 1H2VZ 4RUAA 3UD4P 3MUVP 2OPSA 1WORA 2DR8A 4Q45A 2XG8A 2KM8B 3FBCA 3VAMA 3UCZP 2Y8WA 2FVCA 5ETSA 3CDWA 4JBCA 3CT9A 3PYGA 4CLFA 3G6VA 2WOMB 1O0PA 2W7OA 1HMVB 3PJXA 2YPYA 4NLWA 1F9HA 2BW2A 1KOOA 4DU8A 1YQHA 3NOGA 4YMEA 1F5CA 1TP7A 4UOCA 1NLKL 2XZDB 4DLEA 1HBUB 2YQ1A 4KR0B 2XHCA 4C8ZA 3KUEA 2ZOGA 2GIRA 1VYAA 3R5JB 1QTNB 1X4HA 1U6FA 2BABA 3IM9A 3TEGA 2PA8D 2GZOA 5T7LA 4WYLA 3HULA 1HQUB 3BYPA 2LQ8A 3CEDA 4DX7A 4PQUA 3BGLA 3IBFB 1RZMA 4TXSA 1FTCA 5AT1B 4CTAB 3H0PA 3GIRA 4EEYA 3G6ES 1FVQA 1WKJA 1RKIA 1VHIA 2RVJA 4ED7A 4F0HA 3OL8A 3M32B 3IS9B 3R5GA 2FVQA 2VQFJ 4S0MA 1YHQS 1FRXA 2MB0B 1R8AA 1LWEB 1GX5A 1KQKA 4ZPBA 4YP3A 3I5AA 2K3KA 4RW8B 3PW5A 3HSJA 2Q6CA 4Q8FA 2DHSA 4RU9A 3UNYA 2RRBA 4Z37A 3WC0A 1X9MA 3EGWB 5A8WA 5KFDA 2F9DA 2OO4A 3NEKA 3RW7A 3JTNA 2DNQA 2HAIA 1FFWB 1M1GA 2XZWA 2GS8A 4X4UA 4E0DA 2MKHA 3OBIA 1SV5B 2C2OB 1NNDA 2OPRB 3W2WA 3JSYA 4DV5F 4AD6A 2AGOA 1IKVA 3PV8A 4RL1A 2KJVA 2LMIA 3TEHB 1GMWD 5KFSA 1CBKA 4X62J 2CJQA 4ZP9A 1I1GA 3CJ5A 2MSSA 3ELHA 3WC2A 2RQKA 3ENWA 2XS2A 1BLUA 1D8ZA 1U4BA 3RUBL 3PO5A 2QO3A 1VQ4S 4ILLA 3DLLQ 1FESA 2H54B 2RAQA 2V94A 4PQAA 4P2SA 1RTHB 3NLCA 1UWBA 1HNVA 2B51A 3P8BB 2KG1A 3W9JA 1DTQA 2F4VJ 4K4SA 2F1FA 1C4AA 1CPZA 2RSQA 1UZHA 2IVFB 2J9DE 4JI5J 1SQGA 2WSCC 3NMAA 4EBCA 1J5OB 4KH0B 2LEPA 2DR9A 2DHXA 3D0GE 3PFEA 2BQ3A 4Y00A 2VOPA 1JNRB 3KTQA 3CJ2A 5IQQA 2LA6A 4JI0J 2GHPA 5B0DA 1JJ4A 1FRMA 4NA3A 3TZZA 5CXTA 3QQCD 4DSKA 1NU4A 3BH7B 3KDOA 4HACA 3KK3A 2E7VA 2B5JB 1IBMJ 5DDQC 1OS5A 3J7Z5 2G0CA 5K9FA 2H4YB 3JSMB 2FVSA 1OO0B 2YH1A 3LGNA 3W65A 3W9HA 3HK2A 4FPIA 2Z0GA 3EDQB 4LF4F 4Z7CA 2BJDA 3DDIA 4IRKA 2XMWA 1HQEB 3IGNA 1HBMA 4F3OA 1RWMB 2F8HA 3GJRB 5B09A 4RUHA 1HYSA 5D3GB 4LFAF 1X5SA 2UZAA 4NLUA 3QAUA 3MTKA 4X4TA 2WTFA 3FBEA 4ALZA 4PPDA 1KQSR 5A8KA 4RNOA 1M0SA 1OSDA 2GMHA 2R9LA 4B9LA 1VC0A 5IV3A 2BW7A 3DCAA 2RMLA 2VG6A 1WKLA 5CH7B 1FO1A 1G3OA 4JI3J 4ZCKA 4M5GA 2Y8YA 1P1LA 4H4OB 1WC0A 2FJEB 3MR5A 1FRLA 2D41A 1Z2ZA 3I5BA 2H4WB 3T19A 3IGVA 3TUZC 4DLGA 4PR6A 3MCOA 5BXIA 2QLFB 3OVSA 3E01A 1TZ0A 3C8YA 4IRDA 1DQ8A 4X65J 2AJ2A 2AD9A 1WC3A 3V81A 4DV0F 4DF8A 3OLBA 2V8GA 1C1CB 1Q8IA 1SQFA 4CNYA 1FKAF 2QJ3A 3GLJA 1T9XA 2XHWA 4HT5A 5KFPA 3DOKB 2PO4A 2A18A 2HHHF 1LOUA 2DNNA 2P8IA 1O5JA 2W9CA 1QAXA 1M90T 4ERDA 4QOTA 3R7SB 1DAXA 2AKWB 1JLQB 1S10A 3GCXP 3JQJA 4B9NA 2LCWA 1OIAA 3MM8A 3Q8UA 4H4KA 3R5BA 4ZP6A 1YLXA 4UQTA 1C2PA 4C8OA 1CJKA 4LF5J 1TMMA 1GMVA 2J0QD 1ICEB 1VK3A 1APSA 4XDCA 3UPFA 2AEJA 2DR6A 4XPEA 3CC2S 2CQIA 3B78A 5B08A 3DOLA 2Z8QA 2R7QA 1ELOA 2E5IA 4GVLA 2YVSA 1QLNA 1RTZA 3H59A 2OPPA 3ENVA 3NOCA 4FKYA 3GTYX 3L9ZA 1GT8A 1WELA 4IH5A 1BC6A 1ZAWA 1RT6A 2BANA 3D1QA 3MD3A 2MZJA 2AU0A 4GC6A 1N5VA 2ZOFA 2XB2D 1YJUA 5L9NA 1UP1A 5K5MA 1QAIA 3LP2B 4FYDA 2BEFA 1YJTA 1LKZA 3K5LA 4K4TA 2CG4A 4X4RA 3TJ9A 1FE4A 4DS5A 1MWQA 4U8YA 3WIUA 1HFEL 2ROEA 5F8MA 1MU2B 2HNYB 4WE1B 1VJWA 1YDLA 3RBEA 2QEXS 3AJ2A 1S97A 3LQVA 1T9WA 3UFCX 2XMUA 5MLCV 1OYDA 3RYLA 1SIZA 2KKHA 3GIKA 4M95A 2AF6A 4AL7A 3BGRB 2CQPA 3JSRA 2VHGA 3DC2A 3DFEA 4QIWD 4JUZA 3D28A 3IMQJ 4DL2A 2WVFA 3KHRA 4MK7A 3KHHA 4O4RA 1EIYB 3MM7B 2EBGA 1KQFB 3KLGA 3R7BB 4Q0BA 2E5LF 1M5VC 1VMBA 4TYAA 4MT1A 1J27A 2I5JA 3NWRA 1B4SA 4CQ1A 5KFTA 2X3DA 2ZC3A 4USVA 4DUZJ 1P9QC 5BJRA 4R25A 2KTQA 1JLGA 3KYLA 3CJ8A 3PO4A 2VD3A 2JDJA 3ET6A 1FVSA 2NXCA 3CD7A 2OFHX 2CDQA 1TAUA 3FFIA 4NASA 2CPZA 4P6QA 3K8WA 2HFUA 1S57A 1XNRF 3GIIA 3UN3A 4MYTA 4CO0A 3J7ZT 2CQ1A 2EFVA 3VTIA 4ZHRB 3TUIC 3WIVA 2C22A 1VQNS 3LH2S 4OV6A 4WWSA 2E1MC 1UWAA 3RRHA 3D2WA 3C3LA 2JLEA 3CUNA 4IFYA 4HL9A 2CJYB 3F0NA 1LWFB 4OZNA 4EK2A 4F4AA 4DV4F 3ZZ0A 3RGIA 4OZ5A 3TI0A 4DPOA 4FN5A 5KG3A 4ZMMA 4ANDA 1NK5A 3LP1B 5IS2A 2OTLS 2BXJA 2DGWA 2MGZA 3THTA 4BHQA 2BBEA 1I5OB 5HL7Q 2H51B 1MROB 4IYQA 3NKYA 2AYBA 1MSWD 4DMZA 3BM7A 5KG7A 1E6YA 2VJUA 2O3DA 2VDIA 1GAOA 4DV7F 4ED2A 2MKKA 1Q82T 4CCHA 4N7TA 1F5AA 4IO9Q 2UV8A 3HZEA 1WF0A 1Q5VA 4QCLA 4RZRA 1SI9A 2XTJP 3KHGA 4YB6A 2XSFA 3W9IA 3MEDA 5GADU 2W2OP 4DR5J 1S49A 1PAUB 4DR4J 1CJVB 4UUWA 3AOAA 2A1BA 3W7BA 3OVAA 3QRRA 1O6XA 3EZ5A 1ZA2B 3HT3A 1G4CA 4MAKA 4RUCA 4O0NA 5D4NA 1CULB 2ZBPA 4LR9A 1NEEA 5IT0A 3BO3A 2HMIB 2ZHAA 1YJNS 2DY1A 4PEOA 4C8KA 2EEYA 2KU7A 4AXIA 2RQMA 4ECYA 1PBAA 5JMNA 2BDPA 5AE1A 3UDEA 2OP5A 5DLFA 4TY8A 1EB0A 3M9NB 3KK2A 3UW1A 2XCAA 3CJRA 4LRAA 5HP1A 1KFSA 1CG2A 1SVDA 2VH7A 5C24B 4F02A 3AJDA 4RW6A 5G4DA 4ECUA 1PG5B 2WAQD 1JJHA 1KTQA 1S1UB 3PHEA 2ALYB 3GR1A 3ENQA 1HNXJ 1S77D 5F3ZA 2NYIA 2MQPA 3T9ZA 1F0XA 2DCUB 2VV5A 1HQ2A 3EX7B 1XMOJ 2GJ2A 4NCBA 2C2MB 2A10A 2UUAF 1FJGF 5ETKA 4JI7F 3MCNA 3QLHB 1KKHA 4KGMA 4P75A 2CNOB 4HR2A 2BRKA 4NI2B 1HHTP 2GVDA 1NSKL 2QV6A 3SI8A 2RB7A 1C1BA 1TK8A 2Q66A 3TZWA 2IVYA 3QJLA 5L1JA 3VF0B 4N47A 4PG6A 4I68A 2MZRA 3Q86A 2DJWA 3HVTA 4NXNJ 3B4DA 4LR8A 3VQTA 8RUCA 1RWVB 3ICLA 2GVZB 1GQEA 2KJWA 2R7UA 4D3GA 3O6QA 4M5JA 5IWAJ 5H1SV 1UVLA 2IAJB 2FGCA 4HI1A 1FD8A 1KC8T 2KYZA 5D77A 4I67A 1YITS 4CLZA 5KT6A 1F1BB 2OEMA 3CCZA 4IFVB 2ASLA 2ILYA 1N36F 1HNZJ 4U95A 3PX4A 1BWEA 3CCTA 1EETA 1S12A 3IR5B 2O66A 1XNQJ 4J91A 1SJ3P 4C97A 4YHHF 1MWYA 2RIJA 2BE2B 4LIRA 4DCPB 1CLFA 4QYZJ 5HMXA 2YWHA 3RW6A 1Y10A 2Z4PA 1WWHA 2J8SA 1P27B 4Y6IA 3D66A 3PRBA 2CAJA 4KV8B 4LRFA 3I55S 1NK0A 2G0JA 3DU5A 3HKZD 1RACB 2BACA 1EHWA 4X64F 3R1LA 3CO9A 3VAIA 3AB4B 2U2FA 3QZ7A 3DKDA 2HQ3A 5DO2A 3LGHA 1Y5IB 3P3DA 4DV2F 2HNDB 4AQYF 1JLAA 3H4BA 4DL7A 2P2CB 4DUYF 2LKZA 3NXZA 4B3SJ 2ZJRQ 4N77A 4K4UA 2NPFA 2C1EB 2QL5B 2WBMA 3FEZA 4N41A 1V3SA 2ZH9A 1PCAA 5KT7A 2VBWA 4CH7A 1EP4B 2VDHA 2YWKA 2XYHB 4O3OA 4WXWA 4K4ZA 1GXUA 1RA7A 4KGZB 1YBTA 1SKUB 2V2QA 4DZDA 1NJWA 1WC5A 3M8ZA 2CJXB 4GC7A 1CJTB 4Y2IA 1RT1B 2B56A 5KG4A 5DGBA 4JI1F 2HHQA 3KLVA 3QGHA 4A46A 4KO0B 3H7HB 3GJQB 3RG6A 2MQNA 2J0SD 1QAYA 3BV8A 5IC6B 3T3FA 2PEHA 4DZ6A 4A48A 3QMQA 1ZPVA 1JJ2R 4WP3A 2HQFA 1ZTWA 3ZTOA 4KGXB 2LP4A 4UOHA 3K17A 4CO5A 7FDRA 4JV2A 2Z2MA 2XMJA 4DX5A 3QT8A 2VU5A 4UT4A 3EMTA 4B17A 4NYZA 1M5SA 2XULA 4NZ7A 3EDRB 1AFJA 2V0NA 1IWGA 4Y65A 3KHLA 2R7TA 4XK8C 2LU1A 4F26A 5D0HA 4ECZA 3PRDA 4ZN3A 3GIMA 3M30A 1D8YA 3HJFA 3EM1A 2DNKA 1RWNB 3NS5A 3C46A 2W7PA 5KFOA 3OXLA 4KQZA 4RWXA 1P9YA 3FSXA 1U0SA 1T02A 1S1WA 4CM2A 2R4FA 3M1VB 2YKNB 2CQ4A 4DN9A 5DLGA 4PPZA 4PUOA 1FNXH 4JI2F 4LF9F 3P6YC 2OPQB 2NXJA 4UZCA 4FNIA 3NNHA 3OUYB 3QSYB 2B9YA 4R8UB 3VR1A 2VOOA 2ZH8A 3GFYA 2QSWA 2WVCA 3BBBA 4O44B 3NWGA 4OZ1A 1UEKA 3AJ1A 4KE5A 2CYYA 3IFEA 2DNRA 2GO8A 4LREA 1C0TA 3IM8A 3IN5A 1KOHA 3GFXA 2H5JB 4OLOA 3TA1A 2MQQA 1RHRB 5H9EJ 3E8OA 4C9DA 3QRPA 4BDPA 4X66F 2HZVA 4FZVA 3IAS9 2W4PA 3PZPA 2KT3A 4GKKF 3DN9A 3GZ7A 1T03B 2COLA 2DRAA 2RF2A 2HURA 3N6MA 1TUWA 3J7YI 1VBKA 4DDFA 1OQ3A 2QA2A 2QIFA 3Q8SB 2J76E 1WJ9A 3W2VA 2GC8A 3VAFA 1DHMA 3R5DA 4C4WA 2HFOA 4KKOA 4WTYA 2VICA 3R3TA 1JNZB 1DQ9A 4WU2A 3KLFB 4DV5J 1WEXA 1SXLA 2B6AB 4ID5A 3Q0AA 4ES3A 2P5VA 4OYPA 4LF8F 5HBMA 5L8RC 5K8NA 1BQMB 1NPKA 3W5XA 2ZDPA 2EFPA 1PJ6A 1DQAA 1VRTB 3EZUA 2ATCB 5KOXA 4DG1B 4NA2A 2CKWA 5KFYA 2NLWA 5A6PA 4NCAA 5SUHA 3VAHA 4WFZA 1C0UA 1X4AA 3GCWP 1AROP 1REVB 5ETNA 1Q4RA 4OL8A 3NL0A 2ZH4A 4OZ2A 4P10A 5KAKA 2RKIB 3ONQA 4A8SA 5KG2A 9ATCB 5KFLA 5KT4A 3HD1A 4FF4A 4LVNP 3PG9A 3R5CA 1JQGA 3I5CA 3QRQA 3D3BJ 2IM1A 4ITSA 3DLJA 2AGQA 1RT3A 3POTB 1U1MA 5DGAA 4OI3A 5GAEI 1S0MA 4FBTA 4YN3B 3A12A 2E66A 1E6VA 3VAGA 2EKYA 2NSCA 3OTBA 1XERA 3C16B 1R8CA 2QMWA 2ASJA 4G1QA 3KUHA 2X7IA 3G6YA 4RW9B 3WQPA 2DNGA 1KLMA 2Q3PA 1JLBB 5C42B 1WNEA 4LF4J 1OYEA 1UCNA 2GJFA 5I3UB 4I2PB 1B7YB 2XLIA 5AE3A 2KO1A 2A2CA 1I94F 1S1XA 3HF5A 2V2KA 2J6SA 2J7KA 3E2EA 3V6DB 2FGOA 2ZBQA 3ETOA 2OUGA 3DLGA 1BWVA 3B8HA 2MSTA 3HJVA 1M5PC 3M8SA 4ETXA 1Q81T 4ZCMA 2C3OA 3K5MA 3R1HA 1PKUA 1S6QA 4OHXA 2DGTA 2FHMA 4QZVB 4CNZA 2MHNA 2DNPA 1VQOS 2LU2A 2BJEA 5CYQA 3G86A 2XMMA 3M2RB 2ASYA 1V9OA 1YTYA 3DGPA 3N4WA 1UFKA 2R8HA 1B0PA 1F2GA 2GFFA 1N5YB 2YNHB 4X4NA 5GAHU 4FBUA 1MN9A 3HVRA 4OZ0A 3OFHA 1HPZB 4CLSA 1HNIB 3PXGa 5IXUA 2DH8A 4L76A 1WHYA 3A3NB 1S9EB 4MTPA 4LSLB 2ERRA 3GFZA 2CQ0A 1XMQJ 2DGOA 3DHWC 3QFHA 5IZHA 3TOQA 1ZM4A 1KWMA 2H48B 4B3MJ 5D15A 1GX6A 3H2UB 5KT3A 3QT6A 2FUG9 3W5YA 3OPKA 3CE8A 1HHQA 4H4MA 3VWSA 2XMVA 1KDNA 4OYXA 3ETMA 2WW4A 4YEAA 1KTVA 2E5GA 1S1VA 4Y28C 4LF6F 3M4XA 1RK8A 5KFCA 2GIFA 1XBWA 1J5EJ 3U27A 1MN7A 4MJKA 2VODA 1UL3A 2KI2A 2MQ8A 2V2ZA 2DEJA 4WTOB 3D7SB 3SYZA 4K5SA 4PWWA 3C6UA 4PABA 3TWZA 3PX6A 1TL1A 2NR0A 1UFLA 1NSQA 3BBFA 2DKOB 1LW0B 1SBRA 5J2NB 4QWDA 2ZJQQ 2UXDF 4EMDA 4W90B 3GONA 2R2RA 2GCFA 3MMCA 2Y1IA 1D1UA 3P4UB 2W4CA 1G7CB 2ALZA 2AT1B 1VI7A 4KHMA 4NLSA 4WIQA 2PIIA 2MTLA 1K8AT 5K14B 4JV5F 2YPZA 4PRFA 3LAKA 3ILIA 3FSYA 1IBLJ 1PYOB 3RTVA 4DL5A 2HLTA 4K2XA 3A3PB 2X1AA 4ECWA 1TUGB 1CJUB 5F8LA 2VA3A 2K7JA 3GYGA 2ZD1A 3ZTSA 5KFKA 3R9LA 3M2UB 3T9NA 3V4IB 4ZP8A 5H9FJ 4LF7J 3KLHA 1Y5LB 2R7RA 2FVRA 1UMJA 2V9KA 1KS2A 4FKXA 1RISA 3FJ2A 2XS5A 4OI4A 2WOMA 3K58A 2N7YA 1HMVA 1I3OB 2CUYA 1S0NA 4M5DB 3N9UC 5DM7Q 2YKPA 4J9SA 3NY0A 1HLWA 5DM6Q 4NPOA 2IRXA 1HBUA 2YKMB 1V3ZA 2JL9A 2FIUA 4GKJF 1NO8A 2GQCA 4I6WA 2E5LJ 3RRKA 4J9NA 1NKEA 1BQNB 5DS7A 4F8RA 4F2SA 3SMZA 2CQ3A 1RP5A 2ZH3A 4RX6A 5GVQA 2Y3YA 4C8NA 3MMBB 3RBDA 2KRBA 3QGGA 2JVOA 3H5XA 3L7PA 1KHWA 4W92B 3CDBA 2AYGA 4ZVSB 1CVJA 1C4CA 3AD9C 3DLKB 2MQOA 4J37A 3NS7B 3CDUA 2J7UA 3HHEA 3MPVA 4LT6A 3CIZA 3EXYA 3RU0A 5HAOA 1LW2B 1LWEA 3VCDA 5A6WA 3BN7A 1RWXB 4K50A 3S7RA 4EFAC 1BY9A 2LFVA 1XNRJ 1QSYA 4FYVB 3NGSA 3PCOB 4MKAA 3G2XA 3W63A 5IM0B 1IBKF 1WG4A 1X5TA 2K1RB 3RB3A 5DDOC 2R42A 1VHFA 2QYCA 2FY8A 1GTHA 3DRSB 1RU2A 4JI4J 1VRUB 1YG0A 4F4KA 4FVMA 4K4WA 4OJ3A 2R7VA 2B9XA 4ECRA 1H98A 2JEFA 3BH6B 4GMKA 1NK9A 1HW8A 1SV5A 3AXKA 3R27A 2O5DA 5F9LA 3RJMB 2OPRA 3GJTB 5D0GA 4LSNA 3D67A 3QJJA 2YXLA 1ZH5A 3VGVA 2OPSB 3WBZA 2XY5A 1OWXA 1B3TA 1VBZA 3NBPB 4YQWA 2VFSA 2XLJA 5E3QA 5KFMA 4NLQA 2ZBCA 4KY3A 2WVBA 5GAGI 3OLAA 3PIOQ 1SUQA 3TJ8A 4ZVEA 2EWHA 2H9ZA 3WZ0A 2RT3A 5DDRC 1RTHA 2B4UA 4DV3F 1ZYQA 2J0WA 1H0HB 4NXMF 3D6TB 3VVTA 3T5LA 2VONA 1NDPA 3LAMA 2B9WA 2RUSA 4R5PA 5EGYA 2BR0A 5CA5A 4J9UE 4UF4A 3M8YA 1J5OA 3OXFA 3FSIA 4L73A 2WB1D 2PFFB 4O3SA 2QTWA 4BC7A 1NHKL 2LQ9A 1Z2LA 4DR2F 3BSAA 1H38A 4B3TF 2WB4A 4PQUB 5DZ7A 2PEBA 5C7PA 2B5JA 1VJQA 1GTEA 4LQ9A 3ZNUA 1TMJA 2KDOA 1CC7A 3BKTA 3CD6S 2D7SA 2U1AA 4OHWA 2DNHA 4J5OA 2YNFB 2F3JA 4DR7J 5CHCB 4CO3A 1YI2S 4PXEA 4FNHA 4B3OA 4WIIA 4RKUC 3TX8A 1HD1A 4TLRA 2IIHA 1VIXA 2HHXA 2AJ0A 3IG1A 1S76D 4DQPA 4ED0A 5LOQA 2CA9A 3WHIA 5D3GA 2UXBF 2ZEJA 1GMUA 3CW2C 4KAIA 3UE2A 2F5GA 3F44A 4EYHB 4IG3A 2C2ZB 3EVWA 1LFWA 1HWIA 2KVQE 4EWTA 4ED3A 4YY3F 4WZMA 2HS3A 2VG7B 1GH8A 4X2BA 5D4PA 5J1PA 1Y4ZB 4ZPVR 3DXBA 2UUBF 3I31A 2QLWA 1FWLA 1YJVA 3CCLS 4X4OA 1IKVB 4GRSA 3RZAA 2IA0A 1RWOB 2HPUA 2IDEA 2G2YA 5F9NA 3Q8YA 3FC9A 6AT1B 1W26A 1AB8A 1NJZA 1TKDA 4DV1J 1HR0J 4IUFA 3FZ2A 1Q78A 1EQMA 3SDEB 4A8XA 1FDNA 1YK9A 2UVUA 3US5A 1HI0P 3MUTP 4BC9A 1C1CA 4DR1F 3W61A 2NXUA 4P73A 4EI2A 2JLGA 5LMNJ 2GGPA 1UWBB 1Y5NB 1TK5A 1RDRA 4A8FA 3DOKA 5CYJA 1SKSA 4URGA 1U8SA 3M7VA 3BDPA 3CIMA 2NZ4A 2KFZA 4BS2A 4ZDNA 2IA6A 2LEAA 3HT0A 1G2EA 1U2CA 4PKDB 3MECA 4Y2CA 2BQUA 5HVGA 4ZVUB 8ATCB 3T1YJ 3SV4A 2IBOA 1VGYA 5AJ3F 1VC5A 2DB1A 3WDOA 2B4VA 4B08A 4HACB 3KK3B 5BYRA 1U1KA 1RLCL 4ZVRB 5FD1A 1RWWB 3FBFA 1FXDA 3HHDA 1HL6A 3P5TL 4OX9F 4B9TA 2O1PA 2H1YA 4DV2J 1ZAVA 1LNQA 4DPUA 3CDEA 2NSBA 1N34F 2C2DA 3BSCA 3DLHA 3H2VE 4LSZB 4UUXA 4DN0A 2EC0A 4C3MA 4ZPWR 3EVOA 1RABB 3OSPA 4X4VA 2DPJA 1UPPA 2CJBA 1IXKA 3MCSA 4CLWA 1QSLA 4G1IA 4I7FB 5KFWA 1WTBA 4NWBA 2KZZA 4ECVA 3NMRA 2HQCA 2XI3A 1Y11A 5ETMA 5LT5A 4H4KC 1T11A 2Z2ZA 1WDDA 2HWTA 2Q43A 4ELVA 2RRNA 5U47A 1KRPA 5JUMA 3AH6A 2QE5A 3ZZTA 4ES2A 3CVKA 2J0XA 2DO4A 1NAQA 2FY1A 1MU2A 2HNYA 1JXEA 1IQZA 1S6UA 4PG5A 4DSLA 4WE1A 4Z7YA 3KLIA 3V4MA 2LA4A 2RU9A 4HDHA 3E01B 3MEGA 1RTDA 3M9MB 1NH7A 4LF1A 2JC1A 2ACMA 3FK4A 1JJCB 4JB8B 3V81B 4N76A 4IO1A 2MZQA 2KXNB 4DR3F 3OR1A 2EK6A 4OI0A 1X9SA 5T14A 1FNOA 3EGVA 4OHZA 1D9AA 3MM7A 3D0HE 5AE2A 2W9CB 2LQBA 2E1AA 5KG1A 1ZM3A 3M6XA 4B3RJ 1IKWA 4NX9A 5IV4A 2RS8A 4ZPTR 2CXEA 1GXTA 1JXVA 1ZAXA 4CO4A 2MQLA 1RE1B 4OJ1A 5D8HB 3MM8B 3AT1B 3LWMA 2VKRA 1QE1B 3O44A 1CJKB 1GNKA 1IJEB 4WU3A 2LXFA 3H98A 1EZZB 3QFWA 2FJAB 2C42A 3B4MA 1W2IA 1R89A 2YNGB 4IDKA 3HCXA 1N33F 3MAQA 3J80Y 1FHTA 2DY9A 1ACMB 1L3SA 4ELTA 1Q86T 1RWUA 1PGZA 5J2QA 1N32J 3SCJE 2AEMA 4QIFA 5L38A 3NAHA 3DGVA 2SXLA 1VQ8S 4YR3A 4RU2A 3M6VA 2G2OA 4JYAF 1FKOA 5HVFA 1R27B 2OPPB 5AXNA 1TV6A 3UCUP 2L9NA 3D4JA 1EX8A 4O3NA 1FX2A 2M8DB 2XNRA 3K5OA 4O4GA 1RT6B 2BANB 2XMKA 4A8YA 4P72A 4NZ0A 2ABYA 4J9OA 3CC4S 4JI2J 1LWFA 3H42A 4LF9J 4HI2A 1U26A 2YNIA 4JP8A 1FTRA 3HO1A 2L08A 1YBUA 1RYSA 1G6BA 3LW5C 4LFCF 5KFEA 5IT9Y 1NJXA 1KVKA 2RQ4A 1MROA 5F8GA 4CT8A 3D0IE 5EX3A 4NCGB 1GMWA 3OTOJ 3PEJA 2BM0A 2HSEB 4LIWA 3DLEB 3UN2A 2DVIA 2FJBB 1K44A 2MY8A 2OKQA 4RW7B 2HLUA 2LQJA 2PFDA 2Z56B 1TL3B 4X66J 4CWBA 4FS1A 5A8RA 4NEZA 1CJVA 3IWNC 2E1CA 1A7GE 1VISA 1RHJB 5F8HA 2QFIA 1D9FA 3MEEA 4EO8A 2HMIA 5L39A 4J9VA 2CPHA 2XY6A 2BJ7A 4QIVA 5C25B 3MD1A 3I56S 1LV5A 3TO8A 4QR1A 3MR2A 4CZCA 3KLGB 3UVJB 1Y7PA 3GE9A 2QA1A 4C8LA 2FLNA 3ITHA 2E9TA 2C3YA 2EFGA 3DHXA 3PR4A 4C0BA 3N79A 3MM6B 2ZITA 2PMZD 1Q8KA 3HHKA 3QZ8A 1SQEA 4B9MA 1JLGB 2B43A 5L46A 5LL6d 1TL7A 2VUGA 1Q53A 1OMSA 3RAXA 2CNKB 2AHOB 2VQFF 6FD1A 4DR6J 1PO6A 3UNGC 1BGXT 1S1UA 2QG9B 1U45A 3FFIB 3I87A 2G2ZA 1ZBTA 2AP6A 1DURA 4P71A 2CG8A 2JZ5A 2HBRB 3QLHA 1HI1A 1QSSA 5HLFA 4NI2A 1TKXB 1F2HA 2HHTA 1QD1A 4J9KA 5DRKA 4LJMA 4OZ3A 5LXRA 4JI6J 4IOCQ 3J80U 2JEIA 3U1MA 2W9AA 4PCQA 4FYWB 2W2NP 4RW4B 3BQ0A 2KRRA 3W8PA 1W25A 2IM2A 1UA0A 5HROA 1R6VA 1YJ9S 2DPIA 2KT2A 4IR9A 3KMSA 3UCGA 4WFXA 2FYXA 3GILA 4LFBJ 4KIAA 2DISA 1D9DA 1WACA 3C19A 2V4RA 1RTIB 1HNWJ 2H5EA 3NNAA 3A4TA 4IFVA 1H73A 2C2KB 2W9BB 2VG5A 5IT9U 3OL6A 2DIVA 2V8VA 2G9OA 1S1TB 1LXJA 5ADZA 2QA4S 4JI5F 4QJVA 2R8KA 2DD8S 2M88A 1WC4A 1F60B 1UJ4A 2QSFA 1BE4A 5B0BA 2E5HA 3LWLA 3QNWB 3DOMA 3QIPA 2XZTB 3DDNA 2UUWA 4IQMA 4USWA 4OI2A 4TY8B 4OIXA 3PX0A 5EX0A 2NQPA 4JI0F 2W1BA 5B0GA 1WF2A 2HRYA 4FDFA 1NHVA 5HP1B 2NZCA 1YBAA 2E9ZA 1WHVA 1IBMF 2OMOA 2IM3A 2IC3B 3FQLA 1MNEA 3T6BA 2ZC4A 4RW6B 1L3TA 4P2XA 3OXGA 2CPYA 3U02A 3FQKA 2NXEA 5CAAA 4RBTA 3B82A 4FYYB 5KFUA 1XK8A 1XEZA 1MMLA 2H65B 4HHJA 1RT5B 2JEGA 4USMA 4RNFA 4CI0B 3DU6A 4WPAA 3P5BP 4U96A 4QWEA 1FDAA 3TW0A 3LPYA 2HYIB 4EO6A 3TQEA 2V69A 3PYDA 2GVDB 2VJVA 1NJYA 1C1BB 3IC1A 4LBIA 3FMWA 4DQSA 2I6WA 4KFBA 1WUUA 1QVFR 2IRUA 4YDDB 2HS0A 2F8EX 4AXJA 5FDLB 2YQ0A 2MJUA 4JI3F 3A8EA 3HVTB 2DT9A 4OV1A 3HKWA 5KFNA 1CJTA 3A1YG 2ZNYA 4HKQA 4HTJA 4OYMA 2APOA 5HQLA 1RT4A 3ENAA 4PWDA 3AD8C 2IY5B 3MR7A 1FKPA 2IYGA 4X65F 4QWAA 4P7TA 2FLOA 1PBUA 4C3LA 3UDCA 1UVMA 2Y1LB 2KH9A 2VFVA 4PXBA 1ZZNA 4HYKA 4ZVGA 1P8GA 3L09A 1S9GA 3MDFA 5GMKa 4WCEQ 1T95A 2HVZA 2IFXA 2AX0A 2JWNA 1SJQA 1XC9A 2HHPA 3F56A 4W98A 3BR8A 1B0TA 2HK2A 1PILA 3CJTA 4NYPA 5DG7A 4ZJOA 4NEYA 1Y9OA 4ZPCA 3IWLA 4TYBA 4ZIWA 1LWXA 4WZQA 4LF5F 2PI4A 3T1AA 1NCLA 2RUGA 1WEZA 4NE9C 2RHSB 1G1XA 3CWJA 1NMEB 1RHUB 5EWFA 4MKBA 4ZOSA 3PW0A 4L3KA 1S6PB 1B0VA 2MZSA 5G0RA 2Y1RI 3DMJA 2KG0A 5KFBA 1IR1A 4AT1B 4JI8J 1IN0A 4ZVOB 3AHPA 2RD5C 1K1QA 3RBXA 5C2CA 2PMHA 3SSQA 1IWAA 1SC4B 3H5YA 1JX4A 3CJKA 4C48A 1IKYA 2B7CB 5K8OA 1P6TA 1AZSA 3VVUA 3DRRB 2Z58B 4B02A 1KNZA 2IJRA 3CJ4A 2MLYA 4PG4A 2NREA 1S7IA 4O44A 1N48A 4DJBA 2DHAA 2YKOA 4PG7A 1UJ5A 3D6MB 4TQSA 1WHXA 2DGVA 3G9CA 4A8KA 2VBYA 3KNGA 3D6FB 2KZMA 3G4SS 5DQGA 3B54A 3NG8A 3EPGA 2KXHA 1H2UX 3SIPB 2DNYA 4J9QA 2BKPA 3QWUA 4F25A 1VQ7S 3A8KA 2AYEA 3I32A 3EJMA 1N4LA 1EARA 3QGPA 3SCIE 1T03A 1UAWA 3PTWA 1JMTA 1UKUA 2A2DA 3HX9A 2HWIA 1IBKJ 3J7A1 1NSAA 2PSZA 2KL8A 1RAOA 4DU7A 4KGVB 3NNCA 2N4DA 3W3SA 3UO0A 3DRPB 1TL4A 5CYMA 4A4JA 1UVJA 1SC6A 3G96A 2C2EA 3KLFA 1QY7A 1U6ZA 3MZIA 2M9KA 1D09B 2B6AA 3NP5A 2LEBA 4DUZF 4ZLLA 1RKJA 3FMBA 1IR0A 4X4QA 3LP0A 1BQMA 5KFHA 2ZOMA 2W2QP 4ED4A 2G0IA 2JNJA 1SH3A 1YX2A 3ZZOA 4CDIA 4F04B 4DF4A 1VQYA 1FEHA 5DJBA 1JLEA 2E9RX 5L1LA 1JLCA 4WK3A 4MKYA 1AYEA 3K89A 3BREA 4QU6A 3PY8A 1S1WB 5DETA 3W5ZA 4DS4A 4GVBA 1HIYA 2QLXA 2Q6BA 3HHNB 2ZZTA 4HDGA 1RA6A 3JYTB 1YVFA 4PUOB 4DBQA 4DI6A 1U1QA 1R6YA 2ZWPA 3POTA 3M2VB 2K7KA 4B9UA 4O3PA 4CRJA 1WSVA 2FHOB 1FJ7A 1X4BA 4N8NA 2MHEA 2A6OA 3IO1A 4TKTA 1I51B 1U6BA 2GA7A 1C0TB 3C16A 4DQIA 5HJXA 1S79A 5KT2A 4AFFA 3MGJA 1T3OA 3JTPA 2HZAA 5C42A 1RT7B 4X4PA 2HK3A 2UXCJ 2R7XA 1AT1B 4FYXB 3CJ0A 3KNAA 1FWPA 2I1RA 4F4WA 2BA9A 4DR4F 2GMLA 4QWCA 3GSDA 4XO0A 2RF2B 2HFSA 1IKXB 3OV7A 3T6JA 3SZ2A 1TR0A 2AJFE 1ZM9A 2GHVC 4LBPA 1U2FA 2F9JA 1HKAA 1YWXA 4KPYA 1MG7A 2DEIA 2Z2LA 4BWJA 2IJFA 3AODA 2G13A 2UU9F 4YY3J 2L9WA 4KKOB 2WBRA 2RDJA 2XMTA 3PJWA 5CABA 4U8VA 2N82B 1TU0B 1NK4A 4C3KA 3C14A 5T41A 4IRCA 1EJ7L 3BO4A 2QC3A 3N28A 1UA1A 1VIOA 3QO9A 1XR7A 3S6EA 3M2RA 4ZJLA 4JV0A 2XQCA 4Z2XA 2ZKTA 3H8YA 5HBMB 4LRBA 3I96A 3AOBA 1SJFA 4DV6J 2MKIA 1FFSB 5BYSA 1HNIA 1DARA 1NXIA 2EVZA 5IT4A 2FJDB 2OHDA 4OYZA 1FT8A 4L6V3 3CD5A 2OLWA 2ZH5A 4DR1J 5F0UA 3ZZUA 4DQRA 1VQPS 2VL1A 1T3NA 1HWLA 1XMOF 3EGZA 1TKTB 1RAGB 1IJFB 2XO7A 3NGDA 3OHBA 3FEXB 2DR7A 4LBHA 4KTQA 3R6GB 1LFPA 3WX8A 1RT3B 4NLVA 5C5JA 3DI6A 4OJHA 2OJ3A 3TANA 1QUVA 3G82A 4ZN1A 4NXNF 2ZVIA 4DL0C 4O3QA 3ZZRA 3PYFA 1UVKA 2CZ9A 2DITA 1H6KX 1Q16B 2LXUA 4OX9J 3GG0A 4XAKA 5IWAF 2R7OA 4XIUA 3MI7X 3NGTA 4U67Q 4I2QA 5CZVA 4YUDA 2EW9A 5KG5A 2ZE2B 1HBOA 1FJCA 2DNOA 3TAMB 1N34J 1S1XB 2BUNA 1NK8A 2GW8A 1N5SA 1HNZF 3GV7B 2EFNA 4C8YA 3CF5Q 4ZVQB 2DGQA 1XNQF 1IBCB 1R31A 4DCJB 2PN6A 4B9SA 1URNA 3PEHA 4IG0B 2CPEA 3QGIA 3BGUA 1S4FA 4AYBD 5EHHA 1S6QB 1TL5A 2E7WA 4D3HA 1XWLA 2K2PA 1JB0C 1T05B 5CYQB 3N6NA 1OY6A 2LDIA 3GG1A 3DGPB 1QUPA 4Q2LA 2F40A 4QIGA 1LWCB 1X0FA 1O51A 4PAAA 4M63A 2AJ1A 5F8NA 1JWWA 2CADA 3SQGA 1NK7A 3I4PA 2RH3A 4DR3J 5HSPA 3DYAB 2ADCA 1UJ6A 3MEKA 1ZZFA 2FTRA 4OX8A 1U49A 2L3MA 4F3MA 2YKMA 1R8PA 1BQNA 2AQ4A 2D74B 2PE8A 2WSEC 1F6TA 4OI1A 4H4MB 3OJUA 5B0FA 4P9SA 4NYOA 4DCOB 5KG6A 2FZCB 3O5TB 5E5NA 4I4BA 3JS9A 4ED1A 4RUBA 1NKCA 3M8PB 2BM1A 2KM8C 4DL4A 1H3DA 2FJXA 2ZWOA 4JV1A 4WFNQ 1N33J 3DLKA 3J7AN 2X3GA 2WCXA 2FQQB 2FHJA 1A6LA 2EK1A 2HAFA 5BR8J 1U0HA 4ENOA 2WW8A 3CULA 3LPEA 2AJQA 1M1HA 3CCQS 1RBOB 2VBXA 1TTHB 2XGPA 2B7BB 2XYGB 3ZZZA 2K1RA 2HNZB 3MMCB 4ZK7M 2HBYB 1FDDA 1YRUA 2UVRA 2R7WA 2WONA 3GB0A 3L4BC 1U48A 1YZ7A 3D9BA 1NH8A 3I9V9 3NRBA 1K73T 4DL3A 4USUA 4NMLA 1RT2A 3ZNJ1 5HO4A 4K0KJ 2CFXA 2KFYA 4LFCJ 4F0KA 5JJBA 2AIRB 1WHWA 5KFVA 4TU9A 3ZFVA 3IA0A 1RGVA 4ZS6A 2V2VA 1QTMA 2E29A 4IOAQ 2VQEJ 5CCLA 1KVJA 4E2FB 3D1OA 1X60A 3NBPA 2AGPA 3O2IA 5HMZA 3CC7S 2ZD1B 4FP9A 3IRXB 5A0YB 2ZM6F 4HTIA 1CSJA 2LQ5A 2NCKL 5ETLA 2CQBA 2IVMA 3KLHB 1D0EA 4I69A 4KSEB 4YOEA 2GQQA 2ZVSA 3EGNA 2FDNA 5HQMA 2KB2A 1X9WA 5LM7E 4IH6A 3V2UC 3Q8PB 4EBEA 4DFPA 4C11B 2GV1A 3LALA 5KFZA 2QA4G 2CNLB 4QW8A 2CQHA 3I0RB 1HBNA 1LQ9A 5KFJA 3PDNA 4EU0A 2AYMA 4ECSA 1WF1A 1HWKA 1KR4A 2LLZA 1OY8A 1VBXA 4OYAA 3OR2B 3L7UA 4QWBA 2LXIA 1R0CB 1V5IB 3KJVA 1JKHB 3V5RA 1L3VA 2DGXA 4DEZA 5J1EB 2QLBB 2EFOA 3SSSA 4OYWA 1P1TA 1VQ6S 4RBVA 3HD2A 5ETRA 3CMQA 2LYVA 1T94A 4USIA 1Q0NA 2EC2A 3GQCA 2YNFA 3TNVA 2ZH7A 2D3O1 3R97A 1NUEA 2HVEA 1U24A 2POKA 5HJYA 3DM2A 3C15A 4G3IA 3P96A 2B8QA 1DFDA 4CLYA 4F36A 1EKSA 4RR5A 3CCMS 1U1OA 2MYFA 3CJQA 2RQCA 1FFGB 3KK1A 4KT0C 5F41A 3N5FA 4QR2A 4QQBA 4ECTA 2Y0SD 1TUVA 1SJ1A 2YKAA 3NCQA 1ZOTA 2ATLA 3KXDA 1NKBA 4BLGA 3X1LB 1KD1T 2PA3A 2ZH1A 3MAAA 2EI5A 1RWKB 3EUNA 1FXLA 3H25A 4HEA9 2VG7A 2AZ1A 4PZVA 1DTTB 2P9EA 4LSNB 2M7SA 4AL6A 2XS7A 1NK6A 3AA9A 1UPMB 2YY3A 3MM5B 4EUVA 4FXVA 4QW9A 2F8MA 3CNQP 4KHRA 1R0AA 2IBKA 2YQ3A 2GHWA 4A47A 1N6QB 4ILMA 1RU1A 1U09A 4EZ6A 4CLKA 5I42A 2OEJA 3SDEA 3GWCA 4ES1A 4TNOA 1SUQB 3N5BA 1HWJA 2J9EA 1B64A 4ID8A 1XR5A 3UDLA 2PGCA 3OL9A 4EGLA 3S01A 3MF5A 2JFDA 3KG1A 3MURP 2M8HA 3PFOA 4C98A 1N5TA 1R7IA 1DY3A 4R5PB 2MDAA 5ETTA 3D1HA 1WEYA 3DRXA 4YDXA 3CCES 2YX7A 1U8WA 1UEVA 3TZYA 3L3CA 5KFXA 1CQMA 3I82A 1BMQB 3OTEA 3GYXB 1VQMS 4R0JA 2NUHA 2OD4A 3SBMA 2E7XA 4DWIA 3J81j 3U7JA 2ROGA 2AZ3A 1TKZA 3OJSA 3HVWA 1NRKA 1I6JA 5I4MA 3UI3A 3H4DA 1CEZA 1UETA 5CCMA 3G87A 2VPYB 2RDDA 2DGSA 2Z2YB 1BHNA 5IQ6A 4ICLA 2EXUA 1S6OA 4B3OB 2W2PP 3ISND 1Q7LB 3BB5A 3LUYA 2HQGA 4A8QA 3IG1B 1GFWB 3J7YU 5HATA 5LJ3Y 3KLEA 5A2QY 3L95X 2PI5A 4G6VB 1RAIB 4I7FA 1SL2A 4IG3B 4LUBA 3FZBA 2XSJA 2W8LA 4IR1A 3HVAA 1HWUA 2ZDOA 2G4BA 1S72S 2HW3A 1DLOA 5KFRA 3UDVA 4WFYA 4QPXA 2HGMA 3FGVA 4DX6A 2OSRA 1X8DA 3W1YC 4ETZA 3CCJS 4HH0A 2L9DA 3TJAA 4NLDA 2ZFHA 5LSOA 1GXLA 3DXSX 5E3CA 2FZKB 3QJPA 4USHA 2YWWA 4K8RA 3MM9A 1IR2A 1URRA 1K9MT 5DG9A 3BGFA 2L48A 1XMQF 4DL6A 1ZPWX 2V5HG 2GGPB 1S9FA 1CS4A 2H5IB 4C8MA 4ZLPA 4Q7AA 4N5SA 2MJNA 3L7OA 4FS2A 4CIOA 1SB6A 4B3MF 4WKRA 1SL1A 3G8TA 3AY0A 3GPAA 4MFBB 5GAEU 3MECB 4TU7A 1QE1A 2BKNA 1J5EF 4CH0S 2HKEA 1X4FA 3PYEA 1WSRA 4MK8A 5SZTA 2J5AA 2YNGA 3TVYA 3G8QA 3CO0P 2R8IA 5KOWA 3N01A 1YJRA 2B8PA 3SFGA 2IRYA 2CNNB 2X1BA 5DDPC 3MPYA 4LFAJ 2BOPA 3Q23A 2GIQA 5E7OB 2DTJA 2FVPA 2W24A 4ZVTB 3PW4A 1UFWA 2KVIA 1HW9A 3C6TA 1Y3KA 3AOCA 1YZ6A 2IDLA 2BMBA 2QLJB 2MPUA 1VLOA 3OW2R 4Y2MA 1SC1B 3K7RA 3JXOA 2QN6B 3ZTRA 1K0VA 2V50A 2OAUA 2RS2A 2R8JA 1IBLF 2HHVA 3CCRS 3I0SA 1YIJS 5M2UA 2OIHA 4C0OC 2ZBRA 3MMAB 3PW2A 1VQKS 4FXWA 4FF1A 4NCGA 4DV0J 2J6TA 5HMWA 3DLEA 2MKJA 5B0CA 4TU8A 2V4JA 3VHQA 2JRSA 4RW7A 3KLIB 3OFGA 1WTFA 1TL3A 2XWXA 1F5BA 3MEGB 4LF7F 1RTDB 2HHHJ 2JX2A 3BPDA 5A2QU 5HI7A 4CLUA 1U7LA 2OSQA 1YSJA 1X0PA 3MOZA 2YKQA 5LJ5Y 4USKA 3CMAS 4NLPA 5EDWA 4WF9Q 1TVRA 1RAJA 2FPHX 3W62A 2G1DA 1J2VA 2HVHA 3NS6A 3OR1B 1JLFA 4J7CA 4XDDA 3GFHA 2CZ4A 2EBEA 3P45B 2RDIA 3IAM9 5C25A 3FRYA 3G71S 1M5KC 4Q43A 5J2PA 2V8PA 3LF0A 3M8QB 3G6XA 1M5OC 1PSDA 3AA8A 3UVJA 1IKWB 2KN4A 4C7QA 5ITHA 3T1HF 1WD6A 3FCHA 3BS9A 1X31C 4CM0A 2XC9A 3FNNA 4H54A 5K20B 2K3IA 2ACYA 3BF4A 3MM6A 3IR7B 2KHDA 3Q83A 1UVIA 3ZO7A 2V67A 3OQ2A 4IDKB 3HLUA 3MAHA 5A76A 3RBZA 5J2QB 2CIMA 3LOUA 1RTJA 1S0OA 1FK9B 5LMUF 3JAMY 1X5OA 4EBDA 1FKOB 3HHLA 5KFGA 2I9SA 1VLYA 5EWGA 1TV6B 3SSRA 2RE1A 4ECQA 3J81Y 3PIPQ 4I1TA 2BE9B 4DHVA 5LXYA 5J1NA 3QATA 2UVWA 1RAHB 4O4GB 2FJVA 1SKWA 5J2MB 1TKXA 2X51A 4JI4F 2MZTA 2YNIB 4TN2A 1FD2A 2MQMA 1H74A 5ETPA 1H7XA 3W66A 2EFQA 4HT7A 3IRWP 3KMQA 4RW4A 4CO1A 4DFKA 2WVDA 5GADI 3VGTA 5E2QA 4PYAA 4DPXA 2UUTA 4U7CA 1NHUA 3SCKE 2FLLA 1NB7A 4CYUB 4USJC 4WJBA 3THPA 3UD5A 1RTIA 2XM3A 2C2RA 4OI6A 5A8RB 1FCAA 2NS1B 1ITPA 1DJ0A 2F7VA 4ANCA 3EVMA 5D78A 3ISNC 4BBYA 2W9BA 3FVYA 1R43A 3MEEB 4P52A 1U47A 2VC1A 4OX7A 5AXLA 1HQUA 2JEJA 1FWKA 1S1TA 4YS2A 2RJZA 2UU9J 2ZUGA 4CTAA 3T41A 2VFRA 2NUUG 2AV5A 2MKCA 3D3CJ 2FZGB 1FERA 2DIUA 8AT1B 4M5MA 3M32A 3IS9A 4PXCA 2HQIA 4L74A 3FKBA 3ITHB 2CPXA 1ZM2A 4RW8A 1ROFA 3UQSA 5EN1A 3CD0A 1RHKB 1R0BG 2FHKA 1KEKA 2IC3A 1KLNA 1L3UA 1PAEX 1TL7B 4C6AA 4DR7F 1VOMA 1WC1A 4OYIA 4L72B 1DBDA 1Q7YT 3M8RA 4CT9A 2VPWB 4I64A 2LDYA 1HI8A 4DV4J 4CLTA 4RJVA 2CPDA 5DQHA 1R3NA 3ZXWA 1RT5A 2HBZB 3ZTPA 4ELUA 3B6BA 4NRTA 2CPJA 3HP6A 5M2PA 3AFGA 1N8RT 5HLFB 3KG0A 2XLKA 4LF2A 5IOLA 3TP2A 4DV7J 2H3EB 3GJSB 4ZCIA 4L3NA 3QPIA 2QGFB 2D3ZA 4MIWA 2ZZMA 1M1KT 2XGQA 2QFJA 2KHCA 2JLFA 3GV8B 5FDLA 5KFQA 5ETVA 3EWGA 3DDKA 1FRIA 4WP8A 1UZDA 3JAMU 2VA2A 5HROB 3HDSA 2Z57B 4OYOA 3C66A 5B0AA 4YR2A 2OELA 5GAGU 3J81U 1HR0F 4DV1F 2I2YA 3F73A 1XN9A 3SFUA 4C0HA 2ZJPQ 4ZKAA 5HK4A 2OI2A 5K8PA 3AQOA 2FC8A 3EXCX 1RAAB 2CJKA 1U02A 5JVGQ 2ZH2A 1WOPA 5LMNF 2VC0A 1F9FA 7FD1A 1WOSA 2HG4A 3OSNA 2VG5B 4KYZA 5F8JA 2UUCF 3DNCA 2J8AA 5T7LB 4GO5X 1KP6A 5HQ8A 2GX8A 2V63A 2E5JA 2CJAA 5D4OA 1W7WA 2CZVC 3KKFA 5BYQA 4F0MA 4OHVA 4ZVPB 3JSMA 3K0JA 3W60A 3KFWX 1SKRA 4OZJA 4LVOP 3Q8RB 3DOMB 3QIPB 2WZ1A 2HVIA 3KOAA 3T1YF 3TAPA 3P49B 3TRGA 3RR7A 1S7HA 2BZ2A 3I4HX 2P9GA 4URSA 1HQEA 4Q2MA 2KFNA 3U1NA 1RUSA 1MLAA 3A3OB 2BVZA 4XPCA 2FLPA 1T8EA 3Q8QB 1Q1KA 2DCLA 4U7UK 5DQIA 3GYNA 1RAFB 2UUAJ 1FJGJ 5A8WB 1MMNA 4JI7J 1RWPB 1S6PA 3BQ1A 4OYBA 4QYZK 1AUDA 2FJWA 2HS4A 4ZCLA 1Q95G 2DK2A 3ZC4A 4CO2A 2R3VA 2N7CA 2JOQA 5F8IA 1JIHA 3A8JA 2BRLA 4U9RA 3MPUB 3NCRA 3D54A 1LK7A 3FDSA 3W2WB 4BWMA 5K8MA 3GV5B 4H4OA 3DRRA 2DHGA 1H7WA 4ZJQA 1U1PA 1XIQA 3HSDA 3UR3C 4WKYA 4WFBQ 4KFBB 4KHPF 1IVZA 2NPIA 4ZP7A 4NMXA 3QYYA 2JVRA 2DR5A 2VPZB 1KN6A 2E1RA 2D9OA 2C3UA 3Q2SC 1WG1A 1OPZA 5IC4B 2CRLA 3W64A 4RWWA 3R6LB 1N36J 1HNVB 2M4MA 1FF2A 1PJ5A 1RT4B 2XWYA 1DTQB 3GMGA 2JC0A 1SCJB 4MMOA 4PWDB 2HIYA 5KFFA 1S48A 1FKPB 1SH0A 3GU0A 1WKKA 1JLQA 4YHHJ 2ZNZA 5FIIA 1FJEB 2FC9A 3V6KA 3BR9A 1WDTA 3PKMA 3KG4A 2DRDA 5HANA 1QDUB 5F0WA 1S9GB 1GK8A 4ED6A 3TUJC 3CJ3A 3DRPA 2DNLA 2YTCA 2WK4A 1W2BR 1K1SA 2V9WA 4B3RF 1Z4UA 2ZHBA 1S99A 2L41A 2W7AA 1N88A 2MY7A 1NDKA 4F7VA 2OD6A 4DUTA 1NDCA 4X64J 4AUKA 4ZPDA 5L1KA 4UZBA 2RHQB 2CJ9A 2M70A 2ADBA 2ZM6J 4KRWA 2E44A 4AQYJ 4DUYJ 1HBMB 1S59A 3FUYA 4CH1A 4I6YA 1N32F 2B0GA 3ILJA 1HYSB 1HD0A 4HVZA 1PYTA 5ETOA 5HMYA 4TLQA 1H72C 2PC6A 1S4EA 5G0RB 4RPFA 2O01C 3DMJB 1FRKA 3LP2A 5A8KB 4G65A 2UV8G 3LO3A 1FNMA 1RCOB 1FRHA 1ZTTA 1KONA 4KJIA 1T9UA 1RADB 3AD7C 3JYTA 5IFMA 2VG6B 4TQRA 3MFHA 5E33A 3CJKB 3T5HA 3EE3A 1IKYB 4KPCA 4ZA1A 4AE5A 3M2VA 1AZSB 5CD4H 4M8LA 4WP9A 5EWEA 4DOZA 3CCSS 3N6LA 1RB0A 2ZBIA 4P2FA 3CSKA 3MR6A 3TR5A 1VS3A 4UOGA 4A8OA 4JI1J 3BGRA 1XMBA 3OTOF 1RBAA 3FRZA 2FHJD 1RT7A 2DYAA 4FF3A 5KTQA 3M9OB 3D68A 5L1IA 3QT7A 1IKXA 3DRYA 2FD2A 4HH1A 5KFIA 1WI8A 3TQ1A 5H9EK 3O8WA 1BQXA 4GO7X 1TK0A 3MMJA 4V19X 2GAHC 1OQ6A 2AW0A 4O3RA 1T7PA 2Z30B 2KT5A 1V5VA 4KC5A 5CYMB 1RSCA 2YX1A 1N0UA 4F67A 3BSNA 1QM9A 3M8WA 3FEYB 1TELA 2JJ4D 2W2MP 3U1LA 4J9RA 3TAQA 1R8BA 2AJ4A 1T9TA 3DOLB 2M52A 4F50A 3CTRA 3I9ZA 4IQXA 3R2DJ 2A0FB 4LRCA 3ILOA 3LP0B 1TFYA 4QR0A 2DXEA 3TARA 4K4YA 4ZHRA 1YRXA 3RB0A 2XEXA 2LECA 4NOHA 4K4VA 4NL5A 2MLXA 3NAIA 5DZ6A 2ASDA 4J9PA 2B4PA 1U1RA 3BGOP 4DR6F 5E41A 1JLEB 3HFKA 2XYPB 1JLCB 4HLBA 4MIBA 2OEKA 5CZXA 2VASA 2HGNA 3MR3A 4GVBB 3LP1A 1TKTA 5ETQA 3F41A 3PRVA 3BO2A 3AAWB 2B4OA 3EICA 1X5PA 3HMJG 3Q2TC 1RJJA 2PDAA 1JXLA 1RYRA 2GO9A 2IJNA 4JI6F 1X4EA 1FEEA 2YWEA 4L75A 5I3QA 4TVAB 4RNHA 3PHTA 1YGYA 1UW4A 4RO0A 5CQGA 4ZPAA 2J7WA 4GKKJ 1GEHA 3OT9A 1VQLS 1T9VA 2IMOA 1CULA 2RILA 4X4SA 1HHSA 2M2BA 4LFBF 3TVKA 1UEUA 4Y0FA 3SCLE 4I0WA 1S5ZA 4YB7A 2I0XA 3H5UA 5DG8A 2XMAA 1HNWF 4MK9A 2WHOA 2ZE2A 4Q0BB 4Q8EA 4W4MA 3TAMA 1VBYA 3S1TA 3LTOA 2E1PA 3Q8VA 4ER8A 2I5JB 1NZAA 4M5NA 2YWFA 3LGMA 4V1Ak 1ZS6A 2ROPA 2BJ9A 3CGIA 3PNIA 1KFDA 4NLOA 1X4GA 4LF8J 3UWTA 2MZ1A 1XR6A 3ZZPA 4V19J 2I8EA 5L9XA 4ATNA 4OHYA 4IG0A 2C3PA 5D6GA 3LA0A 2B3TB 2DXDA 2YH0A 2MMYA 2XY7A 5C24A 4FPRA 2MXYA 3CCUS 5GAHI 4N56A 3C14B 2XI2A 4J9LA 3ET6B 4XTTA 1T05A 2MEWA 5JVHQ 2QL9B 3QO9B 5B7WA 2P6TA 3MCMA 5LSRA 3VZIA 3D5MA 1XTZA 1LWCA 3RAMA 4UQGA 2Q79A 3TUPA 4KGKA 1KVIA 4U6PA 4C2MA 2KXFA 1OPIA 3HFZB 3PKYA 1U1NA 3MWBA 4IFYB 4O0IA 3UN5A 3DYAA 5AXMA 2VBZA 1L3KA 3AB2B 4DFMA 1VQ5S 2HHWA 2HZCA 1VFJA 2EKNA 2MGZB 2QMXA 2J9CA 3O3LA 4YB5A 1PC5A 2IYIA 3H5SA 3HFVA 3OFEA 4UY85 1E6YB 3NGKA 4X62F 2GVZA 3K59A 2XCPA 3DI6B 1LEOA 1N56A 3OTDA 1NPRA 3M8PA 1XJWB 4YR0A 2C2NA 2WSFC 1RI7A 1PJ7A 2IAJA 4M5IA 3G82B 1N5QA 3MEDB 1QAJA 3JQMA 4DPTA 1RHQB 4YFUA 4QIEA 2ILZA 4Y34A 1F9EB 3QIDA 3BQ2A 3BDEA 1CC8A 1I94J 2A3JA 2Y1JA 1FDBA 2F4VF 2HHSA 2DNZA 1WOOA 3H90A 2W8KA 1PYSB 4ZVFA 3JQKA 3M6UA 4E8UA 4I2QB 3RB6A 2HNZA 3HSZA 2HWHA 2VFTA 1HARA 1HBOB 2BE2A 5D4LA 4O23A 5AXKA 2RRAA 5D0RA 3CCWA 4RNMA 1FXRA 1F3VA 4NLGA 1N54B 3RAQA 3R2CJ 3VAKA 4OJGA 3A13A 3KK2B 2CWXA 4NZ6A 1U2RA 4KV8A 5M2RA 3GSIA 4P7VA 3EPIA 1AA1B 1SPBP 4UOFA 4EYIB 3GR0A 1MWZA 3M6WA 1LXNA 3HI9A 5RUBA 1AXQA 3T5KA 3BEGB 3IRXA 2VB6A 5A0YA 3N0VA 1WI6A 2BKOA 2HNDA 4QBUA 4OZLA 1DRZA 2ZHOA 2VF3A 5THWA 4I6AA 2CPFA 3K5NA 1QJHA 4FVCA 4IH7A 2X1FA 1RBLA 4LMZA 2OH2A 2Y0BB 3SQGB 3TA0A 3QT5A 3V6HA 4Y2KA 5E3AA 1ZA1B 4K4XA 2R7SA 4K2JA 4JI8F 1EP4A 1X4DA 2ZZNA 4LF6J 4DPYA 4C11A 2QT7A 5H9FK 1VR6A 2BX6A 5B0EA 1F3FA 2F4FA 1VQ9S 4M94A 2GAGC 4DQQA 1Z1ZA 3I0RA 4Y2AA 2DXFA 1K0TA 2DRBA 1NBEB 1H2TZ 1QVGR 3T5JA 1FA0A 3VZHA 3HM9A 1RXOB 3AXMA 1IQTA 1XQIA 3T1HJ 1NDLA 3OR2A 2N3LA 1SH2A 5I3PA 3I6PA 4UW2A 1JKHA 5E3RA 2DH9A 5GMEA 1N0VC 1RHMB 2DBBA 1RT1A 5J1EA 4ZLJA 1SJ4P 2UXDJ 3CMES 3KJFB 2VZ9A 1Y00A 3E51A 1PC4A 5E3PA 4KO0A 4PWUA 4P74A 4BCAA 1S0VA 3FBBA 3D6HB 1B99A 4WYWA 2VIHA 1KHVA 2OGUA 3VGSA 1U0HB 3BKUA 5LMUJ 1VC6A 1EETB 2JH3A 2MLZA 4WFAQ 4F4YA 4JV5J 3K8VA 2ZUAA 2V4QA 3VAJA 3CDAA 2HGLA 1HA1A 2HRUA 1SL0A 4A8MP 1TFWA 4MIAA 5LSLA 6FDRA 2K8GA 2EG1A 2B9EA 1KQGB 2WONB 1VRQC 5EUHA 3KUGA 2W4DA 5KG0A 4ZIVA 2MKSA 4Q5VA 1RT2B 1DTTA 3Q24A 3IXQA 3GP9A 3NCPA 1YKWA 3MM5A 2F65A 1ULRA 1VK8A 3IP0A 2VFUA 1K47A 3OTCA 4OQJA 1N6QA 3CXCR 3S8SA 5JXSA 3M1VA 2YKNA 1JLAB 4ECXA 2WRMA 1WG5A 1CQNA 3ISZA 2QRRA 2F63A 4IKAA 4DFJA 4HHHA 4GKJJ 1JK9B 2OPQA 3THVA 4NA1A 3PM9A 3JB9k 3K2YA 3OUYA 3BJYA 2HIQA 4K59A 4LRDA 4R8UA 5C2GA 4NRUA 2X1GA 1DZ5A 3PW7A 3KWMA 2IHR1 4URQU 1UTAA 3Q89A 1HBNB 3W8GA 4AL5A 3BN4A 2C28A 1NM2A 2BJ1A 4QPTA 4K5RA 1VCTA 4WBFA 2HFZA 1V3RA 1Q79A 3KJVB 2M3DA 2YX4A 2CQ2A 3JTOA 2KYXA 4UY8T 4DSIA 3PVXA 2M0GB 4MYUA 3UR0A 3IWXA 1RCXB 2XBPA 2D3UA 2UXCF 3DM2B 2CDRB 1OJ4A 3C15B 7AT1B 2P6SA 4I56A 4PXDA 3HHLD 3KK1B 2JFKA 2NYHA 2MKYA 5MAOA 4CP5A 4RNNA 2JSXA 4USTA 2CQCA 4LQ3A 1NPPA 3V6JA 2A6MA 4NLRA 3OD2A 3MAAB 4WXOA 2R2UA 3SEOA 3BYRA 5FJ4A 1X7VA 4M5HA 2HVDA 1VRTA 3RR8A 2BE7D 3M30B 2GMJA 2CQGA 2CVEA 4DG1A 2DHHA 2IM0A 2W25A 2NXNA 1REVA 2V8DA 4DV3J 2HHUA 2ZH6A 4NXMJ 4B9VA 2HFNA 1R0AB 3TZXA
chains in the Genus database with same CATH topology
2JEIA 2RKIA 4NCGA 3U1MA 4DV6F 2J6TA 5HMWA 2WBMA 3FEZA 2W9AA 1V3SA 3DLEA 2MKJA 3IBWA 4N41A 5I42B 5B0CA 2ZH9A 2BYCA 4TU8A 2D9PA 2V4JA 5KT7A 4PCQA 4ZVHA 2VBWA 4CH7A 1EP4B 2JRSA 4RW4B 4RW7A 3BQ0A 3KLIB 2YWKA 2KRRA 2V8HA 3OFGA 4O3OA 1W25A 2IM2A 1UA0A 4WXWA 1WTFA 1TL3A 2XWXA 5HROA 1YJ9S 1AFIA 2DNMA 4N8OA 2DPIA 1F5BA 3GIJA 2IMWP 3MEGB 2FB0A 2KT2A 4LF7F 1RTDB 2JX2A 5HI7A 4IR9A 1U7LA 2OSQA 3KMSA 3RRGA 3UCGA 1YSJA 1FE0A 4WFXA 4K4ZA 1GXUA 1X0PA 2I38A 3MOZA 1RA7A 2YKQA 5LJ5Y 3CMAS 2J6UA 5E0OA 3GILA 4NLPA 5EDWA 4WF9Q 4NLYA 2R2TA 1TVRA 4KIAA 4EZ9A 2DISA 1NJWA 1RAJA 2FPHX 1D9DA 2G1DA 1J2VA 4GC7A 2HVHA 3NS6A 1WACA 3OR1B 2V4RA 1RTIB 1JLFA 4XDDA 2UP1A 1OSCA 3MUMP 3GFHA 2CZ4A 2EBEA 2H5EA 2RDIA 4Y2IA 3IAM9 5C25A 3FRYA 3G71S 1RT1B 2B56A 4MFBA 4OFZA 5KG4A 1M5KC 3NNAA 4IFVA 5DGBA 4Q43A 4RW9A 5J2PA 4JI1F 2HHQA 3KLVA 3LF0A 2W9BB 2VG5A 3M8QB 3G6XA 1M5OC 3QGHA 4A46A 1JLBA 1PSDA 5FLXY 3AA8A 4KO0B 1IKWB 2KN4A 4C7QA 3OL6A 1U1LA 5ITHA 3T1HF 1WD6A 2DIVA 2V8VA 3AQPA 3FCHA 3BS9A 3OL7A 4OX6A 5I3UA 2XC9A 4I2PA 2G9OA 5KFAA 2MQNA 1S1TB 3G8SA 1LXJA 2J0SD 4X84A 5ADZA 1QAYA 2QA4S 4JI5F 4DR5F 3T3FA 3FNNA 2PEHA 4H54A 4RBUA 4ED8A 2K3IA 4QJVA 2R8KA 2ACYA 2DD8S 2M88A 3QMQA 4A48A 1ZPVA 1JJ2R 1TKZB 2OTLS 1F60B 1ZTWA 1UJ4A 3H40A 2QSFA 3BF4A 3MM6A 3IR7B 5B0BA 2E5HA 2KHDA 3MOJB 3LWLA 3V6DA 4CO5A 7FDRA 4JV2A 1UVIA 3DOMA 2VPXB 3QIPA 2Z2MA 3ULHA 2XMJA 3DDNA 2D3OR 2UUWA 4IQMA 3OQ2A 4IDKB 4OI2A 4TY8B 4OIXA 3PX0A 5EX0A 3W2VB 2NQPA 3HLUA 4B17A 4NYZA 3MAHA 4JI0F 2BQRA 1M5SA 4ICLB 5B0GA 1WF2A 2HRYA 2XULA 4NZ7A 1NHVA 5J2QB 5HP1B 2CIMA 2GNKA 3LOUA 1YBAA 3UD3P 2E9ZA 1AFJA 2V0NA 1WHVA 1RTJA 1S0OA 1IBMF 2OMOA 4Y65A 2IM3A 3MXHP 1FK9B 5LMUF 3JAMY 3KHLA 1X5OA 2IC3B 3FQLA 4EBDA 1A9NB 2R7TA 1MNEA 3T6BA 4A8WA 4XK8C 4QYRA 1FKOB 3HHLA 2ZC4A 4RW6B 3KLEB 2LU1A 1L3TA 5KFGA 4F26A 2I9SA 3K57A 2ZKUA 4QU6A 3OXGA 1VLYA 5EWGA 2CPYA 1TV6B 3SSRA 2RE1A 4ECZA 3PRDA 2C3MA 3MTJA 4ECQA 3J81Y 3GIMA 2P9CA 3M30A 3U02A 3FQKA 3PIPQ 4I1TA 4DHVA 4ID5B 1D8YA 3HJFA 4RBTA 5LXYA 5J1NA 3HXMA 2XSJB 3B82A 2UVWA 2DNKA 5KFUA 1XK8A 3EYZA 1XEZA 1MMLA 3NS5A 3C46A 4O4GB 2FJVA 1SKWA 5J2MB 2W7PA 1TKXA 4HHJA 2X51A 4JI4F 2PD1A 2MZTA 1RT5B 5KFOA 3OXLA 4KQZA 2JEGA 1N5YA 2YNHA 4RWXA 2YNIB 1DLOB 2Q1LA 2OFGX 1ZETA 4RNFA 3MPWA 1HPZA 3FSXA 4TN2A 3MMAA 4CI0B 3DU6A 1T02A 1FD2A 1S1WA 2MQMA 3E3XA 4NLXA 4B9LA 4QWEA 1FDAA 3TW0A 3LPYA 2HYIB 2R4FA 1H7XA 3M1VB 3BSOA 2YKNB 4EO6A 1S9EA 4F4XA 2O67A 4LSLA 2AWZA 2CQ4A 4DN9A 5DLGA 2EFQA 3MFIA 1YJWS 1Y0HA 2R2SA 4PPZA 4HT7A 3IRWP 1NJYA 3QAEA 1C1BB 1C0UB 3KMQA 4RW4A 3IC1A 4CO1A 1HNXF 4DFKA 4PUOA 3FMWA 4DQSA 1FNXH 5GADI 4JI2F 2CPIA 2EPIA 4KFBA 2OPQB 4LF9F 3P6YC 1QVFR 2JHEA 5E2QA 4FNIA 3NNHA 2IRUA 3OUYB 2UUTA 2B9YA 4YDDB 4R8UB 3VR1A 2VOOA 2HS0A 2F8EX 4AXJA 5FDLB 2ZH8A 4U7CA 3GFYA 2MJUA 4JI3F 1NHUA 2QSWA 3A8EA 3HVTB 3SCKE 3MM9B 2DT9A 2FLLA 3OHAA 1NB7A 4O44B 2EG2A 3NWGA 4OV1A 4R0EA 4QU7A 4OZ1A 3AJ1A 3HKWA 4USJC 4KE5A 4WJBA 2CYYA 5KFNA 3IFEA 3THPA 2DNRA 2GO8A 3A1YG 5KT5A 2ZNYA 4HKQA 4OMFG 1RTIA 4HTJA 2C2RA 1C0TA 4OI6A 2APOA 5A8RB 1RT4A 3BZQA 3IN5A 1FCAA 2NS1B 1DJ0A 1KOHA 2F7VA 3K5PA 4PWDA 5D78A 3GFXA 1FKPA 4G1PA 3ISNC 2IYGA 4X65F 1KSPA 4QWAA 4P7TA 4BBYA 3VALA 4OLOA 2W9BA 2FLOA 3M8QA 2DO0A 3TA1A 1MMDA 2MQQA 3FVYA 3PACA 4C3LA 3E8OA 1R43A 3UDCA 5H9EJ 1UVMA 3OVBA 4C9DA 3RB4A 1E6VB 3MEEB 1U47A 2VC1A 2KH9A 4OX7A 5AXLA 4BDPA 1SIWB 2VFVA 1VQSA 4PXBA 1ZZNA 1HQUA 2JEJA 4HYKA 4RLEA 4ZVGA 1S1TA 1P8GA 4X66F 1O8BA 3L09A 2RNEA 1S9GA 4FZVA 2RJZA 3IAS9 2W4PA 3MDFA 4G1QB 5GMKa 4WCEQ 1D3WA 1T95A 2ZUGA 2HVZA 2DGUA 2KT3A 3QWPA 2IFXA 4CTAA 3DN9A 3GZ7A 3PZPA 2COLA 1T03B 4GKKF 2VFRA 2NUUG 1LW0A 5J2NA 2AV5A 2AX0A 1KLMB 2MKCA 2AX1A 1FERA 2RF2A 2DRAA 2JWNA 2N4CA 1SJQA 1XC9A 2HHPA 3N6MA 3F56A 2DIUA 3J7YI 3BR8A 1B0TA 3M32A 3IS9A 4PXCA 2HQIA 4DDFA 3ITHB 1OQ3A 2QA2A 2QIFA 3Q8SB 2J76E 1PILA 3W2VA 2GC8A 4NYPA 2R8GA 5DG7A 2VKZG 2QZ8A 2CPXA 4F2RA 3VAFA 2PT0A 1ZM2A 1Y9OA 4KBIA 2GQ2A 4RW8A 1DHMA 3IWLA 3R5DA 4ZPCA 1ROFA 4TYBA 4PG8A 1UVNA 3UQSA 5EN1A 1IUJA 4WZQA 3CD0A 2HFOA 4KKOA 4WTYA 5BR8F 4LF5F 4C4WA 1FK9A 2OMLA 2FHKA 3R3TA 1KEKA 2IC3A 4Q44A 1KLNA 2PI4A 1JNZB 1DQ9A 4OLPA 4WU2A 3T1AA 1L3UA 3KLFB 4YB1P 3DLGB 5K14A 1RQ0A 3VQSA 1WEXA 4DR7F 1SXLA 1VOMA 4F3QA 2OTJS 3IR6B 2RUGA 4L72B 1DBDA 2B6AB 1WEZA 5F3TA 3C6TB 1Q7YT 1Q8LA 4ID5A 1G1XA 3CWJA 4CT9A 3M8RA 2VPWB 1FRJA 4I64A 2DH7A 4MH8A 3Q0AA 2LDYA 1HI8A 4ES3A 5EWFA 2P5VA 4F4ZA 4FF2A 4MKBA 2CPDA 5DQHA 4ZOSA 4LF8F 1R3NA 5J2MA 5HBMA 5L8RC 3PW0A 3ZZYA 5K8NA 1BQMB 3SXLA 1RT5A 5HN0A 1S6PB 1X4CA 2XNQA 3O1LA 1B0VA 4ELUA 4FXDA 2ZDPA 2EFPA 2MZSA 5G0RA 2RU3A 3WX4A 2Y1RI 1AW0A 3DMJA 4NRTA 3TYTA 2KG0A 1DQAA 5KFBA 1VRTB 3EZUA 3M2UA 2BV3A 5KOXA 2CPJA 4NA2A 4DG1B 3HP6A 5M2PA 3V4IA 1IN0A 4K0KF 1N8RT 1IM4A 2UVVA 3H20A 2CKWA 2J9DA 2NLWA 5KFYA 3KG0A 5A6PA 5HLFB 4NCAA 2XLKA 3AHPA 5SUHA 3VAHA 2RD5C 1K1QA 4WFZA 4IOBA 3TP2A 1C0UA 1X4AA 1AROP 2PMHA 3I0SB 4KB7A 1REVB 3SSQA 4DSFA 4ZCIA 2CQDA 3DLBA 4L3NA 1Q4RA 3H5YA 3QPIA 4OL8A 1JX4A 3NL0A 2N3OA 2D3ZA 3CJKA 4MIWA 2ZH4A 2VQEF 1IKYA 4J9MA 2B7CB 2ZZMA 1M1KT 5K8OA 2RKIB 1P6TA 5KAKA 4DSJA 2XGQA 3R5AA 2QFJA 2KHCA 3ONQA 3DRRB 4B02A 2JLFA 5KG2A 4A8SA 1KNZA 3GV8B 3JSBA 4M1KA 5FDLA 3CJ4A 5KFQA 4M5DA 5KFLA 2V4JB 5KT4A 1V6HA 3PR5B 4NLTA 1TQLA 3CCVS 4PG4A 1Q8BA 3DDKA 3R5CA 4LVNP 2NREA 1FRIA 4O44A 1N48A 4FF4A 4DJBA 2DHAA 3I5CA 2YKOA 4B3SF 3SV3A 4PG7A 2VA2A 1UJ5A 4TQSA 1WHXA 2DGVA 3HDSA 5HROB 3G9CA 4DX8H 4A8KA 2IM1A 4ITSA 2VBYA 3DLJA 2AGQA 1RT3A 3POTB 1U1MA 3KNGA 5DGAA 3C66A 4OI3A 5B0AA 5GAEI 2KZMA 3G4SS 4YR2A 5GAGU 5DQGA 1S0MA 4FBTA 3HZGA 1HR0F 3HHLC 4DV1F 3F73A 2I2YA 1XN9A 3SFUA 2YWGA 4C0HA 2ZJPQ 3NG8A 4ZKAA 3M05A 1TVRB 3EPGA 2KXHA 1H2UX 2E66A 4Y3CA 5K8PA 1E6VA 3VAGA 2EKYA 1U25A 2DNYA 3AQOA 2M5YA 2FC8A 1S1VB 3EXCX 2NSCA 4J9QA 3OTBA 1JLFB 1XERA 3CB4A 3QWUA 2CJKA 3MMBA 4F25A 1R8CA 2QMWA 1VQ7S 2ASJA 2AYEA 3I32A 2ZH2A 5JVGQ 4E98A 4G1QA 5LMNF 2VC0A 1F9FA 3SCIE 3QGPA 1N4LA 7FD1A 3G6YA 1TAQA 4ED5A 4RW9B 5J2PB 1T03A 2HG4A 1UAWA 1B7FA 1JMTA 1UKUA 2A2DA 2DNGA 2VG5B 3HX9A 1KLMA 3OSNA 5F8JA 2Q3PA 2UUCF 3DNCA 1JLBB 2HWIA 5C42B 3C6UB 1WNEA 3CPWR 2J8AA 5T7LB 1MW7A 4GO5X 3MHYA 2GX8A 5HQ8A 3J7A1 1Y3JA 5I3UB 1BD6A 3Q22A 2E5JA 2CJAA 1TL1B 2PSZA 1SJRA 4I2PB 5D4OA 2CZVC 1LW2A 2XLIA 3KKFA 5AE3A 2KO1A 3HPOA 1NJIT 5BYQA 3NNCA 2A2CA 2N4DA 1I94F 3TA2A 3W3SA 1S1XA 1R8HA 4OHVA 3DRPB 1TL4A 5CYMA 1M5HA 3JSMA 4ILRA 3K0JA 3KFWX 3HF5A 1SKRA 4TY9A 2GJIA 2V2KA 2J6SA 2J7KA 4OZJA 3V6DB 3E2EA 1L5UA 4LVOP 4JOUA 4A4JA 3Q8RB 4DSEA 1UVJA 3QIPB 2FGOA 5IM0A 1SC6A 2HVIA 2D1CA 3G96A 3KOAA 3ETOA 3X3UA 2C2EA 3T1YF 3TAPA 3P49B 3TRGA 3KLFA 3RR7A 1QY7A 1U6ZA 3DLGA 1S7HA 2BZ2A 3I4HX 2CVIA 3B8HA 2P9GA 4URSA 3MZIA 1HQEA 4Q2MA 2KFNA 2MSTA 3U1NA 1M5PC 3DRSA 3M8SA 2M9KA 3H2LA 2B6AA 3LANA 3NP5A 4ETXA 2LEBA 4DUZF 1VRUA 2BVZA 4XPCA 2FLPA 1T8EA 1Q81T 1RKJA 3FMBA 3Q8QB 1Q1KA 1RTJB 3OFFA 3TVZA 2DCLA 3C2PA 4ZCMA 2C3OA 4U7UK 5DQIA 1N52B 3GYNA 3K5MA 3R1HA 1IR0A 4X4QA 3LP0A 1S6QA 1BQMA 4OHXA 5A8WB 1MMNA 5KFHA 1S6PA 2DGTA 4WK1A 3BQ1A 3HHLB 2ZOMA 2FHMA 4QZVB 4CNZA 2MHNA 2DNPA 1VQOS 1AUDA 1LK5A 2FJWA 2HS4A 1SH3A 3ZZOA 4ZCLA 2LU2A 2BJEA 2DK2A 3ZC4A 5CYQA 3G86A 4CO2A 4DF4A 2N7CA 2JOQA 2LVWA 2XMMA 1YRTA 1VQYA 3M2RB 5F8IA 1H2VZ 1JIHA 4RUAA 2BRLA 1FEHA 2ASYA 3UD4P 1V9OA 3MUVP 1YTYA 3DGPA 2OPSA 4U9RA 5DJBA 1JLEA 2E9RX 2DR8A 3N4WA 4Q45A 5L1LA 1JLCA 2R8HA 1B0PA 3NCRA 3D54A 2XG8A 1F2GA 2GFFA 2KM8B 1N5YB 2YNHB 4WK3A 4MKYA 4X4NA 5GAHU 4FBUA 3HVRA 1LK7A 4OZ0A 3OFHA 3VAMA 1HPZB 3BREA 3FDSA 3W2WB 1HNIB 1S1WB 3UCZP 2FVCA 5DETA 3PXGa 5IXUA 3PY8A 2DH8A 4BWMA 5K8MA 4DS4A 3GV5B 3CDWA 1WHYA 2QLXA 4H4OA 3DRRA 2DHGA 1H7WA 2Q6BA 3CT9A 4JBCA 1S9EB 4MTPA 1U1PA 4LSLB 2ERRA 3GFZA 3HHNB 2CQ0A 4HDGA 1RA6A 3JYTB 1YVFA 4PUOB 2DGOA 3DHWC 3UR3C 5IZHA 4DBQA 4WKYA 4WFBQ 1U1QA 4KFBB 4KHPF 1R6YA 3TOQA 1ZM4A 3G6VA 3POTA 2WOMB 3M2VB 1GX6A 1O0PA 3H2UB 2NPIA 1HMVB 2W7OA 4ZP7A 2K7KA 3PJXA 5KT3A 4B9UA 4O3PA 4NLWA 2BW2A 1KOOA 3QYYA 2FHOB 2JVRA 1YQHA