1XNRF

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xnrF00
4DV6F 4K0KF 4DV7F 5BR8F 4DR3F 2BVZA 3T1HF 4B3MF 1I94F 4YY3F 2VQFF 4DR6F 2RJZA 4YHHF 2UUCF 5LMNF 4JI1F 3R3TA 2UUBF 1XNQF 4LF4F 1GH8A 4JI5F 2J5AA 1N33F 2B7CB 4LF6F 4DUZF 4LF7F 1IJEB 4OX9F 1N32F 2UUAF 2E5LF 4B3RF 5IWAF 1IBKF 1B64A 4X62F 2KJWA 1XMOF 4JI7F 1G1XA 3OTOF 1XNRF 3T1YF 1CQMA 4LFBF 5AJ3F 4DV1F 2UU9F 4JV5F 4DV3F 4LFAF 4JI8F 4GKJF 2ZM6F 4DUYF 4X65F 4DR1F 4JI2F 4NXNF 4X66F 4AQYF 4LF8F 4JI4F 2YY3A 2UXCF 4B3SF 1F60B 4DR5F 4DR2F 1HR0F 1G7CB 4NXMF 1HNZF 1FKAF 4B3TF 2VQEF 4DR4F 4DV0F 2F4VF 4X64F 1HNXF 1IBLF 4DV5F 4DR7F 1CQNA 2UXBF 1IBMF 2HHHF 4DV2F 1IJFB 2B7BB 2BXJA 1HNWF 4KHPF 1FJGF 4JI0F 4DV4F 5LMUF 4GKKF 2KJVA 1N34F 4LF9F 4LFCF 4LF5F 3ZZPA 4JI6F 1J5EF 1N36F 4JYAF 1LOUA 4JI3F 1QJHA 1RISA 1VMBA 2UXDF 1XMQF
chains in the Genus database with same CATH superfamily
5M2RA 3PJWA 4YEAA 1JLGB 2VONA 3RZAA 3FSYA 1PIEA 1PYOB 4PPDA 4L6V3 4XPEA 1S1UB 1KD1T 3DHXA 1X4DA 3GZ7A 1EX8A 2DXDA 3EGZA 2J8AA 3MZIA 3IG1A 4JV5J 3W2WA 4JI8J 2OSQA 5EX3A 4DPUA 5D3GA 2G2YA 9ATCB 2FY1A 4BWMA 3M6WA 2PI5A 1UJ5A 1RBAA 4RLEA 4WU2A 4UY8T 4ZCIA 4DV5J 4NLDA 3OUYA 2AD9A 4OYWA 3IS9B 3MUMP 3D0GE 5L1JA 1HNWJ 3NGUA 1LWFB 4I6YA 4YQWA 3BN4A 3D3BJ 3TZXA 1YGYA 1XN9A 3QAEA 1HBOB 2G4BA 2KN4A 4BLGA 1CULB 2XYGB 4DSJA 2W9CA 1IQZA 4CWBA 1VBKA 4JI5J 3PRDA 2Y8WA 3DDNA 2MHNA 1DHMA 3B4DA 3N0VA 3FSXA 3UQSA 4TU8A 1GH8A 2Q6CA 2RDDA 1NKCA 4OL8A 1ICEB 1WOOA 4KHRA 2ALZA 3GIMA 5KFGA 3FFIB 4OJGA 3KHLA 5E0OA 4JP8A 4KH0B 4CP5A 2NR0A 2XZTB 2Z8QA 4G1IA 3E3XA 1S7IA 1BQNB 4OV6A 2OO4A 2HHHJ 3TAQA 2Z2ZA 1U0HA 3M2RA 1FKAF 3KNAA 3CEDA 5K8MA 1TL3B 2K7JA 2V2VA 1TUGB 2B0GA 3CO9A 3JAMU 4HDHA 4FS2A 4ID5B 4KR0B 2M4MA 5FLXU 2Y9HA 2CJYB 2DT9A 4C3LA 4QWAA 2AJQA 2M9KA 2LEAA 2XGPA 4URGA 1WKLA 1GXUA 5A0YB 3TNVA 3KHRA 2FHKA 4ZVFA 2HHXA 2G0CA 1TKTA 5G0RA 3UN5A 4W98A 1T94A 4YY3F 2YX4A 3C14A 1M1KT 2JWNA 2CQ4A 2ALYB 5KG2A 1HL6A 3H0PA 4CO1A 4URQU 2ZBPA 4FVCA 4C98A 3I5AA 3T5HA 3FRZA 4WIIA 1CQMA 5IV3A 4DQRA 4KTQA 2J7UA 2RU3A 3JSYA 2HG4A 4F50A 1WACA 3DMJA 3QZ8A 4M5IA 3DOMB 2FJAB 5HSPA 5A76A 4LRAA 3CC4S 1M5HA 1V3RA 4YR0A 4B9LA 4DWIA 4EFAC 3R5JB 3Q83A 3MAAA 4PG4A 1ZA2B 1DBDA 3EZ5A 1U48A 1NCLA 3EPGA 2ZJRQ 3DLBA 2QZ8A 1NSAA 5C2GA 2OPQA 4DV4J 2HFNA 3H90A 3MDFA 2DGQA 4M1KA 3C16B 1BXNA 2XZDB 4M5MA 4ALZA 3UDVA 2G2ZA 2DR6A 2E1MC 3GG1A 2J76E 1F3FA 3N4WA 1AXQA 2RHSB 2AJ4A 3M9MB 4PRFA 2YPYA 5JVHQ 4ANCA 4IFVA 3L7PA 2OELA 1RAJA 5IC6B 4A8OA 3NBPA 4FDFA 4AXJA 2E5IA 2IRUA 4K2XA 1JX4A 4CLWA 2KG0A 2XMKA 4ZIWA 4EO8A 1VFJA 2IVMA 3EWGA 4KGMA 3Q8QB 1LK7A 2BE2B 2RVJA 2VG6A 3M8YA 3VCDA 3H5SA 4XO0A 2PMWA 5CYQB 3T9NA 3I0SA 3GTYX 2VD3A 2KH9A 5DZ6A 2M7SA 3UDCA 5I42A 4IQXA 2W8LA 3DRPB 2Y1IA 3OVAA 5CYMB 3SMZA 2E9TA 2VL1A 3GLJA 5J2NA 2E1CA 3GPAA 1X4EA 3BS9A 4U9RA 4HYKA 3TR5A 1REVB 1U1OA 1WD6A 3R5GA 4OYAA 1R0CB 3I5CA 3PV8A 2C3MA 1R89A 4PQUB 3KUHA 2HFSA 5E3AA 1S9GB 4N41A 4NCGB 1RAIB 2BJEA 3IR6B 2F7VA 1VQNS 4ETXA 4CO5A 1OPIA 1S5ZA 4DR5J 1WORA 4JV5F 2IA6A 4JI8F 8ATCB 2DR5A 2GO9A 4P73A 1J27A 4AT1B 4WCEQ 1X4AA 2WSFC 3BGFA 2KFNA 1RT1B 3SQGA 2GVDA 1B7FA 2LLZA 4M95A 3LO3A 1MU2A 2HHTA 3GONA 2OMOA 4W92B 3T6BA 1K73T 4DV5F 4LF1A 1KQKA 4DV0J 2XNRA 1HNWF 2LFVA 2HQGA 2V4RA 4CLFA 1QD1A 1RGVA 2YTCA 4ZVPB 1GX6A 1VISA 4ZCLA 1HI1A 2E5GA 2ZDPA 4MTPA 1IKVB 4ECUA 3GCXP 1BWEA 1DLOA 1TKDA 3OTBA 2M3DA 3Q8PB 2HWHA 4ES3A 4RW9B 4JI5F 2QL9B 1WTFA 3ONQA 1HWJA 5D77A 1MW7A 4LFAJ 1U25A 3FBEA 2M70A 1HA1A 1UW9A 3QSIA 1FERA 4PUOB 1M5OC 3TQEA 2NXNA 2HNDB 3VTIA 1SUQB 2HQ3A 2KXHA 4NLYA 4O44B 4ED1A 2YY3A 3GR1A 1FJ7A 4KBIA 1RTDB 4CLPA 2RRNA 4G6VB 2R7XA 3M6VA 1IR0A 5KOWA 2NLWA 4WJBA 1PO6A 4DSEA 3Q23A 1XR7A 2HMIA 1RBOB 1CJVB 1OY6A 2V2QA 2O1PA 2HHHF 4ZVQB 2XMWA 1Q5VA 1N36J 3H5YA 2BOPA 1I3OB 2CQGA 2AGOA 4NCBA 1UEUA 5KOXA 4DU8A 4RU2A 2L9DA 2GVZA 4OZ5A 1UAWA 3MMJA 1C1BB 2CQ2A 2HNZB 5HANA 2R8JA 4R8UA 4RBVA 1S0NA 3GIJA 5HROA 1EIYB 4B3RJ 2OD4A 3QGIA 3QFHA 1ZBTA 4NYZA 4FYVB 2B7CB 1GX5A 4AFFA 3QNWB 1FFWB 2GMLA 2B8PA 4NPOA 3CIMA 4WTOB 1N88A 3JB9k 2DXEA 3GFZA 3HSGA 5IXUA 4F4WA 2OTLS 3HDSA 4B17A 5KFMA 3HMJG 1N52B 3MGJA 3EDQB 1RWOB 3L7UA 3WX8A 2BR0A 4RUCA 4H4MB 1VOMA 2PEHA 3VGSA 4GKKJ 4CH0S 2AEJA 1LW2A 4J9VA 2PFDA 4P52A 4F3QA 5K14B 1Q8LA 4RL1A 2FHOB 4IFYA 4QWDA 5T7LA 2YQ0A 2ATLA 2DR9A 4IDKA 2V0NA 3ENAA 2HZCA 1U1RA 5AT1B 2MLYA 4IOAQ 3GFYA 1JXEA 1OQ3A 2VQFF 4BBYA 2R7WA 5CZXA 4LRFA 1GTEA 2XM3A 5IV4A 4I56A 5HVFA 1ZPWX 2PA3A 2EK6A 4EO6A 1RT5B 4CRJA 4R5PB 4F8RA 3DOKB 3LP1B 2KFYA 2C3PA 1X4BA 4DQQA 1S1TA 1UWBA 2VJVA 1S48A 2IVYA 5HJYA 4ZVUB 1IKYA 3N6LA 1UVNA 4B3TJ 3D1HA 2AWZA 4J9MA 4RNFA 2BW2A 5HJXA 4WYLA 3CD6S 2RRAA 3CD0A 3MECB 2ASYA 2ZH3A 1NMEB 3IRWP 1CVJA 2VA3A 1VLYA 4FF2A 1ZETA 3CMES 1OO0B 4HEA9 4LSNB 4Y28C 4DLEA 3L9ZA 4M5NA 3W60A 1RHUB 5A8KB 2XB2D 1ZM4A 2VC1A 4PG7A 2HIYA 2XMAA 4YHHJ 5B08A 2KM8B 1B4SA 3FBFA 3K5PA 3LWLA 4ZPDA 2DEJA 2CPJA 5I3PA 1JLAB 3TI0A 3BJYA 4RW4B 1IXKA 4WP8A 2C2RA 1B7YB 4DHVA 1OIAA 2RS8A 4KH1B 4LFBJ 4DV1J 4LQ3A 1OY9A 1FDNA 1LWCA 1R8BA 3K57A 3GMGA 5L9NA 2QLJB 1EB0A 5SZTA 4PABA 4WYWA 1RTHB 2A2CA 1TAUA 2R7OA 4CH1A 3MEDA 1K1QA 4DR5F 4ZVTB 3LP0A 2BJ7A 3GV5B 1WC6A 3DLEA 3MM9B 3BGRA 4QZVB 3EPIA 3KXDA 2FDNA 2P2CB 3GCWP 4OYOA 4K8RA 2XCAA 3BQ2A 3VGUA 2G9OA 4DFMA 2HHSA 1WWHA 1TKXB 3AOBA 2IDLA 2X1AA 3FEXB 1YLXA 2BE9B 3DGVA 4RWWA 5C25B 2EFPA 3CCSS 1T3OA 1YJRA 2MY7A 4DR3J 2BJ8A 1T05B 2B56A 3T5KA 3MUTP 3CULA 4DUZJ 2BBEA 3KJNB 3ZNUA 5HMZA 5KFUA 3D9BA 1UPMB 6FD1A 4BDPA 5LSRA 3P5BP 3CCRS 2XWXA 3LANA 4DL2A 5KT2A 1JLGA 2E9RX 3O8WA 4EUVA 2Q66A 3R7NB 4ED4A 4LFAF 1R3NA 3B78A 2QRRA 2V8HA 2C2DA 2H65B 2RQKA 3QT6A 1WF1A 2CG4A 2JJ4D 1ROFA 3N28A 3HO1A 2XY6A 3MTKA 1FJGJ 3Q2SC 2OAUA 1MG7A 1T9YA 3VGVA 4MK7A 4M5GA 2DNYA 4HI1A 3GB0A 2YNFB 3M32A 2ZJPQ 3JSBA 3MPUB 3IS9A 2W24A 3BGOP 1N36F 5M2UA 1SBRA 3LTOA 4X4QA 4KPCA 3CC2S 2CJKA 4ZPAA 5ETVA 3T1AA 1HBOA 1VQ9S 4TKTA 2PN6A 3WIUA 4BS2A 1UEVA 2E5HA 1ZA1B 4B3RF 5D4OA 4CLLA 3SV3A 1LFPA 3N9UC 3N6MA 4F3OA 2VQEJ 4OHZA 4QIEA 3OVBA 2H48B 3U1LA 2EBEA 3QT7A 2JEJA 4JV0A 3CDEA 5J1PA 1S99A 2RRBA 1X5PA 2VODA 5FIIA 2E7XA 3P3DA 1WG4A 2HFZA 3VVUA 2GFFA 3FFIA 4UF4A 4ECSA 1O0PA 5E3PA 4A8QA 1BQNA 1YK9A 2PMZD 2KDOA 2DTJA 4GKKF 3TAPA 3CJ8A 3I4PA 2RHQB 4WK1A 3KG0A 4OI4A 3BZQA 1HBNB 4PWDB 1TL3A 3UD5A 3M05A 1Y7PA 1VQ8S 4DN0A 2FY8A 2M8DB 2LA4A 3MMCA 1Q0NA 3IAM9 3TYTA 2IC3B 2IM2A 3HVTA 3E8OA 5HMWA 3OHBA 2HAFA 3LALA 3DCAA 1KLMB 3M1VB 3I9V9 4LSLB 4B3SJ 1QAIA 3CCES 3PEHA 1EKSA 1J5OB 1RBLA 2IFXA 1IWAA 4NLPA 4USMA 1R31A 4DR7J 1FEEA 4B3TF 3P49B 4ED7A 2BJDA 2ZKUA 4A8KA 3KMQA 3KJVB 3QMQA 1N6QB 4UZBA 1K47A 2P6TA 3EVMA 4CYUA 4LRBA 3DOMA 1SL2A 3W5YA 1H72C 2JFKA 4CZCA 2XSFA 2WB4A 2AMCB 2CQDA 2DNGA 2L41A 3MCMA 4K2JA 4XDDA 1Q1KA 1YDLA 4O3RA 3NGRA 4WU3A 1TL5A 2CVEA 4DXLA 4YHHF 2LVWA 1EHWA 2WVEA 3E01B 3JTPA 2DRAA 2ZBIA 4K50A 3BYPA 2B4PA 2EPIA 1RACB 2DGTA 2W2PP 5DDOC 3CCTA 4ZLPA 2LA6A 3HD1A 4UUWA 2DO4A 4LFBF 4DV1F 5KFOA 2ZZNA 2YKOA 3NCRA 1WDDA 2FGOA 2HNYB 3ENWA 3QJPA 4OI2A 3K8VA 1VI7A 3R5CA 4JUZA 2KVIA 4USHA 1RT4B 1NJIT 2IJFA 4C8ZA 5GVQA 1K1SA 1AZSB 2QJ3A 1R7IA 2KTQA 2FVSA 4ECXA 3NP5A 2E66A 2BE2A 4O4GB 4Y00A 2UZAA 3IN5A 4DLGA 4ES1A 2WZ1A 1NJYA 1FESA 2A2DA 3CUNA 4HH0A 3ILJA 3PIOQ 1SH0A 4Y0FA 1QVGR 3DRPA 2HIQA 4U67Q 2HS3A 4DR3F 3IFEA 1G2EA 2PC6A 8AT1B 2C2MB 5H9EJ 5IWAJ 4RKUC 4TU7A 3SCLE 4DUZF 5KFYA 5HLFB 2ZC3A 1REVA 3HKZD 5I3QA 5DQGA 1RT7A 2B4OA 4F0MA 2LQ8A 2RT3A 3PTWA 1HQUB 2HLTA 4JB8B 1FKPB 1OSCA 4FPIA 2IBKA 5HO4A 3CT9A 4P2XA 1S9GA 3HFKA 2CQ1A 3BQ1A 1VQ5S 3A8KA 4NI2B 2Q1LA 2LXIA 3H2VE 3AD9C 1Q82T 3PR5B 2COLA 3H4BA 3OTEA 2D7SA 3NLCA 4GRSA 4DX5A 2ZUGA 2LU1A 1GXTA 4U7CA 1FJGF 1S0VA 6AT1B 2O01C 1RA7A 2BYCA 2ZOMA 4DL0C 1ZH5A 2BQUA 5SUHA 1XERA 1U1LA 4DSFA 2BZ2A 3KUGA 4OYXA 3D6MB 2XYPB 2WW8A 5F8GA 1D9FA 2DGSA 3DLHA 1FI4A 1M1GA 2ASJA 2R8IA 2I5JB 3ZTSA 2W2MP 4ED6A 3MCOA 4JV1A 4OHWA 1TAQA 3MR5A 3G6XA 1GMWD 1IKVA 2BKPA 3T6JA 3PJXA 2LEBA 3KLEA 2IYIA 4ICLA 4J9PA 4UT4A 2Y1LB 4DOZA 4XPCA 1RLCL 4QR1A 1YJNS 1HD1A 4RW9A 1QM9A 2WTFA 2JLGA 4F25A 1BWVA 1QDUB 3EGWB 4I1TA 1FRXA 2VQEF 2BM1A 4M8LA 1MLAA 3Q8SB 3AFGA 2RKIB 1S6PB 4F4ZA 3QRQA 1SUQA 1SIZA 4O44A 4JI3J 4RX6A 2M2BA 2MDAA 2DJWA 1RTDA 2XS5A 2RQ4A 1KEKA 1P8GA 5DDRC 2X51A 1JQGA 2DISA 3FC9A 1ZM9A 3GIKA 3HI9A 1VMBA 1MMNA 2AT1B 2ACMA 3M2UB 3RB6A 4GVBB 3CJ5A 1PC5A 2CNLB 5E41A 1B3TA 4OZ0A 1RWNB 2O66A 4ZLNA 3GWCA 2Y1RI 1OMSA 1L3SA 3IO1A 3QIPB 1C2PA 1NSQA 4K4ZA 1C1BA 2K8GA 1RZMA 2DGUA 4NCAA 2JSXA 1SKRA 1BY9A 4DR2J 1VRUA 4Q8EA 3KK1B 2QTWA 3DLKA 3M4XA 4CNZA 3UNYA 4B3SF 3LPEA 3LOUA 4M5DA 2NREA 4NLVA 4FYYB 2EXUA 4HTIA 4PXCA 1WHYA 2D41A 4DR7F 2NZCA 3M9OB 1RYRA 3Q22A 3PHEA 4Q2LA 2MHEA 2MGZB 2RD5C 1EZZB 5HL7Q 4AUKA 4L72B 1NBEB 2DH8A 2RMLA 2WHOA 5HN0A 4H4MA 1ACMB 2DNKA 4OHVA 4C8LA 4QIGA 4YB5A 5L9XA 5K14A 5CD4A 1NJZA 1P9QC 4DUTA 2PD1A 1TL1A 1NU4A 4HACB 3BF4A 4NLWA 1AYEA 3T9ZA 2XMVA 1VJQA 4ELTA 5KG3A 4QOTA 3W63A 3M2VB 2VU5A 4FXDA 2OFGX 1LK5A 4I64A 4NA3A 3P5TL 1B0PA 1RT5A 3M8ZA 4RR5A 3LP1A 2HVZA 4Q0BB 2KT3A 2IM0A 4ZPCA 4IRKA 3NMAA 4KRWA 3QLHB 2A10A 1FRLA 1LXNA 4HTJA 2V6AA 2QL5B 3BSOA 4DSLA 3KNGA 3D68A 1WC1A 5D6GA 4USVA 3MECA 2HVHA 5L1LA 5HP1A 4PCQA 4JI1J 1RISA 2UUBJ 5IM0B 1W7WA 3S01A 3CJTA 3FQKA 4FYDA 1XJWB 4OLPA 4TXSA 4ZMMA 1Q7LB 2UUCF 4J91A 3SEOA 4LR7A 3RAMA 3CCQS 1HI8A 3AQPA 4QPXA 3E2EA 5A8KA 1HHTP 3BBBA 1IKXB 5F3TA 4GKJJ 3GV8B 3K17A 5IWAF 4MK9A 4X66J 3SYZA 1H74A 4KE5A 1JLAA 1FD2A 2JVRA 5F8IA 1RAGB 2L9WA 1Y3KA 4M5JA 2FIUA 4DR4J 2VPYB 1KKHA 1M5PC 1U6FA 2K1RA 1RT3B 3CD7A 1F2GA 3H4DA 3WIVA 5GMDA 3LW5C 1NHUA 1IKWA 4V19J 3I31A 1R27B 1RLDA 4FF4A 3W2WB 4EEYA 4KB7A 2ZH8A 4H4OA 4ZP6A 4P2SA 4RW8B 3CJSA 5A8WA 4MJKA 5KFHA 3Q8RB 3MM9A 2MZRA 1WUUA 4ECQA 2R8HA 1HQEB 4CLYA 3R5AA 3WHIA 3C15A 1M90T 4I6AA 1TKXA 3RBDA 1PKUA 4NLUA 5C25A 3ZZZA 1NK7A 2DRBA 3M8WA 5DJBA 3I4HX 2VDHA 4PAAA 2ZOGA 4NYOA 1D9AA 4ZS6A 2Z2MA 4K4YA 3GJRB 4H4KA 4DFJA 2CRLA 1V3SA 1UTAA 1Z1ZA 1RQ0A 2PGCA 4FZVA 1AB8A 3O2IA 1E6VB 4FXVA 3U02A 5T41A 2MKJA 3HX9A 4YS2A 1WEXA 5GAHI 3WX4A 3VZIA 3HFVA 5A8RA 4GVLA 1H38A 2YWGA 3CMAS 3IA0A 1WSVA 2F9DA 1Q16B 3GV7B 1X8DA 4B9VA 3H2LA 3N5BA 3W8PA 1FRJA 3M6XA 2Y0BB 4N56A 1BQMA 4JI3F 4CO2A 4DS4A 2IYGA 3G2XA 2R3VA 3F73A 3D0IE 1N33J 2GNKA 3QWUA 3BR8A 4ZIVA 2YNFA 3H20A 2GHVC 3MM6A 5CZVA 3PYGA 2EKNA 4O3QA 4U8VA 2JLEA 1V6HA 1JJCB 2MQQA 3ZTOA 1WI6A 2KRBA 1MN7A 1WKJA 1A9NB 3Q8UA 4ZA1A 4DN9A 4DPOA 4F4KA 4O3OA 2POKA 1OPZA 1KDNA 2CPYA 5J2QB 1TKTB 3HP6A 2HEKA 3OFHA 4N8NA 3D7SB 4WBFA 3UI3A 3C14B 4DR2F 3AH6A 4L74A 4DV2J 3GIIA 2PMHA 1YVFA 4OZ1A 1X4GA 1R8HA 3RUBL 2LDIA 2I1RA 3Q89A 2DNOA 2FC8A 2FPHX 4N76A 1RWUA 1K44A 2XG8A 4ZVEA 3IWXA 2DR7A 1SV5B 4EMDA 1S12A 2FJWA 2ZHAA 4RO0A 1ZTWA 2P9EA 2HQFA 2VPWB 2HGLA 1N32J 4I68A 5KFTA 3P45B 4ED0A 4HKQA 4PWDA 3OL9A 3B6BA 2YNGB 1SQEA 1Q7YT 3PYFA 2JOQA 3BV8A 1U2CA 2W4CA 4HT7A 1FXDA 4MIWA 3FCHA 2W2NP 2HHVA 4ZKAA 4DMZA 2V8GA 2KRRA 2E1PA 4LMZA 3LF0A 4XIUA 3KK2A 2L3MA 4ZP7A 4C0BA 3AQOA 1S1XA 5ETNA 1OQ6A 4LSLA 2EI5A 3BYRA 1ZTTA 3CJ4A 3NBPB 5IQQA 3DU6A 4USKA 5F8HA 1YRXA 2DD8S 4UTGA 2GGPA 4XDCA 5CA5A 2VOOA 3V6JA 3R5BA 3KJVA 1DJ0A 2MKSA 2CAJA 1Q8IA 3WZ0A 5I42B 2FQQB 5D4PA 4JI1F 2UUBF 1VCTA 4J9LA 2Y0SD 1TK8A 2E5JA 3NY0A 2EK1A 1XMOJ 3TEHB 2PSZA 4ED3A 3VAJA 1N56A 2WCXA 2MZ1A 1RT6A 3B8HA 4WE1B 2F9JA 3VZHA 3R6LB 5J2NB 3I82A 2B5JB 1S6QB 4GKJF 4XK8C 4CO3A 2YWEA 2XNQA 2PO4A 4OX7A 3I32A 3X1LB 3E01A 3C19A 5BXIA 4X66F 1UMJA 1M5VC 2GA7A 3EDRB 5CD4H 1L3UA 3FBCA 2QSFA 4IG3B 1NDCA 1UFWA 8RUCA 2PIIA 2MSSA 4DR4F 1DY3A 3D1OA 4RJVA 4TVAB 4D3GA 1JLQB 3LPYA 1S7HA 3SFUA 2HNYA 5L38A 3PIPQ 1XQIA 2CG8A 2AEMA 4C3MA 2BEFA 4C2MA 2D3ZA 2IBOA 2WOMB 1FDBA 3W1YC 5KG7A 3N6NA 1VQ4S 2C2EA 4PEOA 2MTLA 4EI2A 4PYDA 3J81Y 3NOCA 2ZVSA 2XY5A 3V81A 3MI7X 3SXLA 4O4GA 3HHNB 2KXFA 2OPSB 2J7KA 2YX7A 5A6PA 4O0IA 2BJ1A 2F40A 3UN2A 4LRDA 2KZZA 4WFBQ 2FTRA 1WC4A 2L08A 3HHEA 1MROB 1V9OA 3RYLA 1FDDA 1FDAA 2HVIA 2IM1A 3W66A 2MKYA 4ATNA 2GJIA 5ETMA 4A8FA 2BOAA 5JVGQ 2IVFB 1UP1A 3ZFVA 5HLFA 1ULRA 2CQ0A 2MJUA 4EGLA 2E29A 1MWYA 4LVNP 2OHDA 3IM8A 3CWJA 4KKOA 3UN3A 3D6HB 1HQUA 2B9WA 3HZGA 2E1RA 4JBCA 1FKPA 1VRQC 4ECZA 2PT0A 2JDJA 3PW4A 2F1FA 1GMUA 4NI2A 2YKAA 1FD8A 2ERRA 1NKEA 2QN6B 1VC5A 1FX2A 3QO9B 3VVTA 5KFPA 2RH3A 5HATA 2HMIB 3VALA 2HFOA 2NS1B 2FJXA 1SL1A 3ELHA 1N33F 2ATCB 1TR0A 3U1MA 2ASDA 4DV3J 3VQSA 1VS3A 4KHMA 2IMOA 4GC7A 5EWFA 1FE0A 1C1CB 1W2BR 4ZOSA 2QV6A 4EBDA 2GVZB 4ED5A 2H5JB 2RE1A 2DNRA 1HNZJ 4KSEB 2I5JA 3RG6A 3LQVA 1HARA 2XS2A 3RU0A 4LR8A 2KM8C 2J9DA 4DPTA 1LWXA 2NPFA 5E7OB 1HQ2A 4A8WA 3KOAA 3MR7A 4ECWA 5T14A 3W5XA 2A6MA 1YSJA 1T7PA 4ES2A 2B43A 1Q4RA 3P8BB 1RUSA 4DV2F 3VWSA 1MMDA 2CQ3A 3LWMA 5ETRA 3ENQA 2CZVC 4ZN3A 4OI0A 3J80Y 2FUG9 2XSJA 4NOHA 1DRZA 2W8KA 1DTQB 2ZH2A 2W4DA 5M2PA 2RKIA 1S6PA 1Q8BA 3A12A 2LXUA 3FKBA 9RUBA 2WVDA 2VPZB 3DLJA 1JLEA 2VKZG 4FXWA 4KO0B 5E3RA 2G2OA 1V3ZA 2R7VA 3AY0A 1X4FA 3KFWX 1N32F 1A7GE 1LW2B 4YMEA 5KFBA 1P1TA 1HBUB 3M2UA 2EFVA 4JI2J 1HNIB 3SFGA 4GVBA 4IDKB 1ZYQA 3NAIA 1IM6A 3FMBA 5KFXA 3NAHA 2FZCB 5DDPC 1LW0B 2MJNA 1FHTA 4ZPTR 3V2UC 3QIPA 3HXMA 5KFKA 2C3OA 3BREA 3ADAC 3DRSA 4CM0A 3EVOA 4RU9A 4L76A 1FE4A 3PX6A 3KK1A 3MWBA 3OL8A 2ZNYA 3CDWA 3OR2B 4DSIA 2Y3YA 3O6QA 5F3ZA 2LQJA 2KKHA 5A2QY 2OP5A 1ZOTA 4ZITA 4M63A 3CF5Q 1MWQA 1ZZNA 1SC6A 2BMBA 4O3NA 2CQCA 5K8PA 2UVRA 2MGZA 2ZHOA 4KV8B 2VB6A 5GAHU 1C0TB 4AD6A 2HK3A 4DQIA 3NEKA 4UOCA 2ZM6J 1VHIA 1D9DA 3K5NA 4FVMA 3J7ZT 1XMOF 3LGMA 3IRXB 1VGYA 1KRPA 3HHLD 3RAQA 4E0DA 4JV2A 5KT4A 3MFHA 2EG2A 4TNOA 4HACA 3HHDA 4E8UA 3CD5A 3UPFA 3UDLA 3ENVA 4B02A 2ZH1A 3FGVA 3FZBA 2BE7D 4B9TA 4K4SA 1KVIA 3LAMA 3LGNA 3Q2TC 2RUGA 4TY8B 3Q0AA 3D66A 4O23A 2HQDA 4L73A 4LJMA 3RR7A 4Q0BA 2RQCA 2LU2A 1BHNA 3HLUA 3NGKA 2VBZA 4OJ1A 3QLHA 1UKUA 2IRXA 3RRHA 2MQOA 1F9EB 4BWJA 2DR8A 1KTVA 2J6UA 5GADU 2KT2A 1NK9A 2JZ5A 2VDIA 2VFUA 1WC3A 5IM0A 1VQSA 4OI6A 2KJWA 1WHXA 2YKNA 2YQ3A 1GAOA 5ETSA 4FS1A 2J0WA 4DCJB 1NDKA 1S76D 2VUGA 1KBRA 4HHJA 5D4LA 3K0JA 4QYZJ 1IKXA 1P6TA 1F9HA 3TARA 3MAQA 1DZ5A 2AEFA 2CQPA 2QIFA 3D28A 3ILLA 1QLNA 3AJ2A 2FJDB 5KT6A 4I69A 1UW4A 1SC1B 1YIJS 5FJ4A 4A8XA 1RT3A 1X9MA 2CDRB 4YR2A 2OIHA 4DL3A 2JHEA 3MM7B 2DNPA 1AUSL 1KQFB 2QLWA 2KI2A 1QAYA 3AOAA 2PA8D 4UOHA 5KG4A 5ETOA 2LQBA 3FEZA 3SV4A 3M8RA 4F0HA 4RW8A 2DRDA 3TWZA 1CPZA 3UCUP 3MPVA 2V2KA 2WAQD 3M32B 2L48A 1HQEA 4G65A 4C8NA 1QSSA 4DR1J 3T19A 2CJ9A 1JKHA 3ZC4A 4DV3F 3SDEB 1S57A 1F5BA 2PE8A 2E44A 4DG1A 2FVRA 2V68A 4FN5A 1F6TA 2E1AA 4C0HA 4MYUA 1FT8A 1HNZF 3RB3A 2VASA 1WF2A 3VGTA 1LV5A 1VQOS 3DU5A 3MM8A 2ZZMA 3GFXA 4YN3B 4Y2IA 5IT9U 7FDRA 1FFSB 1O5JA 4YB7A 4NLRA 3HVRA 1RTIB 2BACA 2V8DA 2CJQA 1E6VA 2EC2A 3VAFA 2DH9A 3AHPA 1JLBB 1SPBP 2F8HA 2C22A 2DIVA 4LREA 2WW4A 2CPIA 4QU7A 1RSCA 2DGXA 1T95A 4OX9J 5HQLA 1FRHA 4U95A 2R7TA 3D0HE 4NLGA 4Y2CA 2HQCA 2HFUA 4YDDB 5U47A 4USIA 1EKRA 1GXLA 3UE2A 1HNVB 1H0HB 4JI2F 5KFQA 5J2MB 3MPWA 4ZN1A 1RWVB 3MMCB 3C46A 2KYXA 3DNCA 3BSAA 2HZAA 3HVTB 2XBPA 1UPPA 1BUXA 2B6AB 4X4RA 1P27B 1RTZA 3H98A 2G13A 3MEEB 1NHKL 5J2QA 3POTB 3QRRA 2LCWA 3PEJA 2BW7A 2JX2A 2MZSA 1X0PA 3BSNA 5HK4A 2OUGA 4YUDA 2MLXA 2R7RA 3UVJA 1U1PA 3TANA 2R9LA 1PILA 5KFSA 2HWIA 2RQMA 1HW8A 1XNQJ 3O44A 2BABA 3IMQJ 2GO8A 3SZ2A 5AE2A 3TA2A 3A8JA 3G8SA 3BO4A 1PJ5A 2YX1A 3MOJB 3US5A 4FYXB 4WF9Q 1Q8KA 1WC0A 4CYUB 1XIQA 3CIZA 1SV5A 3PRBA 3EYZA 2WVFA 2VFTA 2LKZA 4X65J 3ZTRA 2CJXB 2J8SA 1MWZA 1X5TA 2ROGA 2IMWP 3HFZB 2ZM6F 3W5ZA 1RHRB 2FHMA 2QYCA 2D3OR 4WFAQ 3BSCA 5L46A 4OZ2A 3GR0A 3OVSA 4WIQA 4AL5A 3PXGa 5F9NA 3QATA 3EGNA 3HVAA 2YNGA 3AXKA 3R1LA 3UR0A 1TU0B 3GYXB 4TLRA 3OLAA 3OXGA 2AU0A 4ZK7M 4S0MA 4DX8H 3LP2A 1X5SA 2K3KA 5HQ8A 4ITSA 5E33A 3H25A 4QBUA 2QLXA 1QAJA 1SJ3P 1LFWA 1KOOA 3CJ0A 2UVVA 4LBIA 5K20B 4C4WA 3H5UA 3H59A 4QJVA 2IJRA 2ZE2B 2RS2A 2RAQA 2H9ZA 3NRBA 2OMLA 2NXUA 4QIVA 2AV5A 5B0DA 1FA0A 1KFSA 3B4MA 4NLQA 3BGLA 2G1DA 2BKNA 4F04B 2XTJP 3TJAA 2MSTA 2Z58B 1HMVA 3BN7A 2WRMA 1TZ0A 5KFAA 3KLVA 4AE5A 4C48A 3QQCD 1SQFA 2FHJD 4WZMA 5K8NA 2CPEA 4Y65A 2NUHA 2M88A 4X64J 2GS8A 2W7OA 4WE1A 2YPZA 2K3IA 4NZ7A 2P9GA 2FC9A 4KJIA 3CCWA 1SIWB 3DLGA 2M5YA 2WBRA 2B5JA 1S6QA 1U4BA 1E6YA 2PDAA 1RT7B 2M52A 4P10A 3O1LA 5IS2A 1N5YB 2KJVA 4IG3A 5KAKA 5HQMA 4P74A 2I9SA 2ZJQQ 1UFLA 4ZPBA 3J7A1 4ECRA 4O4RA 3ZTQA 2DK2A 2X1BA 1SJ4P 3OPKA 3QBCA 1JLQA 4L75A 1SKUB 3FVYA 1JLCB 3AXMA 2R2UA 1RTJB 2QSWA 2WOMA 3NXZA 4KIAA 1FVSA 3KUEA 3FEYB 2D69A 3QAUA 2EFGA 3ILOA 4C8KA 1S10A 1C4CA 2MMYA 3TVYA 2Z2YB 4DQSA 4ZJOA 4DR1F 2OPSA 1CJUB 1BE4A 5B0AA 4CH7A 3HPOA 2OEMA 2QO3A 1MROA 1PC4A 4RNHA 5LM7E 3RAXA 3QIDA 3CDUA 3G6VA 4WFNQ 1KQSR 1TL7A 1OS5A 1FO1A 4A48A 3KLEB 2MYFA 4ICLB 2KFZA 2XMTA 4F36A 1H73A 1SC3B 1H2TZ 2ZH6A 4PG6A 4OIXA 1Q81T 4F4AA 2VFSA 3IGNA 5AXLA 3CJKB 4LF6J 1CJTA 2YH1A 1JJ2R 4DS5A 3ULHA 3EZUA 5KG6A 3JQMA 4P71A 3AD7C 3KLGB 1RT2B 1RYSA 1SJQA 1RHMB 3GE9A 4OX9F 3T5LA 2W2QP 2LQ5A 4N5SA 4PR6A 3MXHP 4B9NA 3VV2B 1D1UA 1FRIA 3QO9A 3P6YC 2LXFA 3B54A 3K58A 1YX2A 1T9TA 2ADBA 4C0OC 2QMUB 1F2HA 2R4FA 4A4JA 5H1SV 1X9SA 1HI0P 1C1CA 4NEYA 2KVQE 2AJFE 3P96A 3RB0A 1FVQA 4LF5J 2YVSA 5DM7Q 3QJJA 4OI3A 2WONB 1ELOA 4RWXA 3L95X 1WNEA 1WEYA 1VRUB 1BD6A 3H2UB 1UZHA 3DLKB 3PJ9A 2OEKA 4ZP9A 2MB0B 2FYXA 4M5DB 2NSBA 3A8IA 5LSOA 1NKBA 3A3NB 4KGZB 3G6ES 4YB1P 5DGBA 5H9EK 2Z30B 1S9EB 5F41A 1XNQF 1X31C 4RUBA 4DDFA 1DTQA 2UU9J 2RF2A 4CM2A 5A6WA 1A6LA 2AKWB 1HYSB 1VR6A 4QU6A 2BUNA 1TK5A 2MZJA 3OFFA 2V34A 3W62A 4KO0A 4X65F 1S1WB 5DRKA 3HSDA 3TW0A 1FNMA 1UVLA 2XZWA 2QLFB 1SVDA 3ZZTA 2P6SA 3PFEA 2QMXA 1HBUA 3AA9A 3NGSA 1HNIA 1TL1B 1K8AT 3OD2A 2OPPB 2LYVA 1URRA 2OEJA 2X3GA 1LW0A 3ICLA 4OYZA 4OYBA 5J1EB 4IYQA 4A8MP 4DV4F 4PYAA 1GMWA 2DHXA 4OJ3A 5G4DA 2EWHA 3KJQB 2KXNB 3IGVA 3TUIC 1M5KC 4DR6J 3MD3A 2A0FB 2VG5B 1KWMA 2MKCA 5H9FJ 1U1NA 1NRKA 4NYPA 2QT7A 4X4UA 3OR2A 1FK9B 2Y1JA 3PW5A 4DCPB 4OLOA 2A1BA 1IBKJ 4X62J 5AE3A 2RIJA 2I0XA 2Z56B 3EJMA 1UA1A 3A1YG 2VKRA 4V19X 5HP1B 2IM3A 3GIRA 2H5IB 1AUDA 1TVRA 5DM6Q 1XR5A 3G87A 1ZAVA 1HWUA 4KV8A 1Q95G 1DQAA 1RKJA 2I8EA 2BDPA 1C0TA 1IBLJ 2OLWA 2WB1D 1T03A 5BYRA 3IBFB 1SJRA 1CSJA 3F44A 1WDTA 1YTYA 3V6HA 3FCVA 4X64F 4ZPVR 4DX6A 2N3LA 3IRXA 2HBRB 3I87A 2BRLA 3KLFB 3PCOB 4B9UA 4WK3A 1WHWA 3M6UA 3TP2A 2GHPA 1UVJA 1TK0A 2N82B 4OI1A 1I94J 2K1RB 3QGGA 1FJCA 2APOA 1Q5YA 2ZWPA 2VFRA 2C2KB 4G1PA 4LF7J 2Q79A 2DHGA 1IKWB 3R7SB 3BB5A 4TY8A 2GCFA 3HK2A 3FZ2A 4DZ6A 4P6QA 1NSKL 4H4OB 4I7FB 2BJ3A 3PW7A 4RNOA 1VRTB 4ANEA 3GP9A 5A8WB 2O67A 4ILMA 4I0WA 1SH2A 4Y2KA 3KJFB 4X84A 4M5LA 1QSLA 3HVWA 4C8MA 3CJRA 1JNZB 5JUMA 5D0HA 4J9QA 3C15B 1SI9A 2DGOA 2PFFB 2W25A 3QWPA 5EUHA 4F4YA 4RNMA 2CNNB 4HDGA 1ZZFA 2WK4A 2C3UA 5F8NA 1NO8A 4IO9Q 4DV0F 2PEBA 3HHLB 3X3UA 5K9FA 1DQ8A 2HSEB 2VBYA 3NKYA 4PKDB 4RW7B 4ZJQA 3TA0A 3LUYA 1UWAA 5EX0A 2QC3A 1VK8A 3UNGC 3ITHB 5L1IA 4ANDA 2EFNA 4PXBA 2CADA 2FVCA 4ZPWR 1LOUA 5THWA 3W7BA 1N5QA 1UVIA 4N77A 4ZLJA 1SJ1A 4Y3CA 2MZTA 3H40A 1B70B 4J37A 2L9NA 3I55S 3GILA 5A8RB 4A8YA 3OTDA 4CO4A 4NLOA 2XI3A 3ISND 4LF6F 3MM7A 1SQGA 2JH3A 5K5MA 1YRUA 3MM5B 4IQMA 3NOGA 1YJWS 3HULA 1RAAB 1RAEB 4ELVA 1BQMB 2BKOA 3JXOA 2HPUA 4TLQA 1QY7A 4Y2AA 1S72S 4NRTA 2AGPA 2MEWA 1Z4UA 4WKRA 3MM6B 4X4NA 3V4IB 3D2WA 1NK6A 2CPFA 3PO4A 5F0WA 5KFRA 2XMMA 2EVZA 3SDEA 1XWLA 3OJSA 3TQ1A 4TQSA 1NK4A 3OTCA 2CPHA 4J9OA 2FB0A 2ZKTA 3MMBB 4DV6J 3DRRB 4LF5F 1EQ0A 3ZTPA 3OQ2A 1FXRA 3BKUA 3DFEA 3Q8VA 2N4CA 2Z0GA 5IT9Y 1RTIA 3TOQA 3TVKA 4X4VA 1NJXA 4TN2A 1SJFA 3TZYA 4EYIB 1X5OA 4JI7J 4LVOP 1JLBA 1V5IB 1YJ7A 1N0UA 3D6TB 1TMJA 2OFHX 1RAFB 1FX4A 1S49A 4J9NA 5ETTA 3L4BC 2UU9F 5HBMB 2ZZTA 3JS9A 4U7UK 3TRGA 1OWXA 4K7QA 1T9UA 1HBMB 4OZNA 4V1Ak 3AD8C 4ERDA 2VC0A 3MR3A 1OYEA 3A3PB 5C24B 3D5MA 2N7YA 1F0XA 1CQNA 2C42A 2MKIA 1FFGB 3N5FA 1HNVA 1QUVA 2UVWA 2P8IA 3FQLA 4CCHA 2CQBA 2YXLA 4CTAB 3JAMY 1EP4B 5CYJA 5J2MA 5KG0A 5EDWA 5FLXY 2ZFHA 1U0SA 1TQLA 2B6AA 1R8AA 4Y2MA 3DN9A 1UVMA 3KK2B 4IOBA 4OZJA 2AF6A 3MEEA 4RUHA 1S1XB 3POTA 4DR6F 2DB1A 2DNLA 2C28A 1PYSB 1QTNB 3CVKA 4D3HA 3CGIA 4WP9A 2GGPB 2DNHA 1IBKF 2V69A 1AFJA 4X62F 5CHCB 4C7QA 2HS4A 4LF2A 2VOPA 1S9FA 2EC0A 3IAS9 4KGVB 2YH0A 2ZEJA 3FSIA 2CQHA 4OYMA 4I2QA 3K5OA 1YBUA 1YQHA 3PW0A 2FJBB 7FD1A 2K2PA 1RHKB 2V8PA 5DQHA 2F65A 1RT6B 1IBLF 2FZKB 4LF9J 4JI6J 2BXJA 2M0GB 4KQZA 1RADB 1HKAA 1FRKA 4C97A 3KKFA 1SL0A 3G71S 3KG4A 3PR4A 4NZ6A 2R8GA 3IWNC 3DRXA 1NSPA 2DY9A 1NDLA 1V5VA 2YWHA 4ZLLA 1VQ6S 2LMIA 4J90A 1KFDA 4P2MA 2G0IA 1I94F 4CIOA 2DHHA 5J2PB 4HR2A 4PZVA 2AZ3A 2MQLA 3THVA 4LF7F 1VQMS 3RW6A 3QRPA 2NYIA 4OV1A 5GMKa 1TUVA 4R0JA 3UCGA 3I0RB 2UXCJ 2ZE2A 1Y4ZB 1VBYA 1TV6A 3VR1A 3V81B 2OPRB 5B0BA 2D74B 1UFKA 3OSPA 2MZQA 3UFCX 3OV7A 1VBZA 1UEKA 4USJC 1L3TA 1NUEA 1YRTA 2B51A 2LECA 5F8JA 4Y6IA 3C8YA 3FJ2A 3QFWA 2AYEA 3F0NA 1S6OA 1XMQJ 4NLXA 4Q44A 1FEHA 3G8TA 5D78A 2W01A 3FBBA 2IIHA 1LWEB 3NGTA 4YFUA 4USUA 4EYHB 4KKOB 1QTMA 5FDLB 1N5YA 3NNHA 4NASA 5DZ7A 1J2VA 3K8WA 4RPFA 2VQFJ 1AT1B 3IWLA 4DCOB 4HHHA 5KFZA 4EBCA 1YKWA 1PGZA 4N7TA 3HCXA 2CUYA 1AFIA 3RBXA 1PJ6A 2QA2A 3DOLB 4X4TA 2MLZA 2VFVA 3NCPA 4A8SA 1JLCA 1RTJA 5CXTA 3QSYB 2ZITA 5E5NA 4DZDA 4F2RA 1KHWA 3NWGA 2ZBQA 3WQPA 1TKZB 1I1GA 3SSRA 1WSRA 4QQBA 4FKYA 2XQCA 1U6BA 2VH7A 1CJUA 1VHFA 1KSPA 4I2PB 5C42A 2VBWA 3EE3A 3OJUA 1HIYA 4F4XA 4K0KJ 3T1HJ 2ADCA 1MMLA 3IR7B 3W2VB 4AYBD 1XK8A 5IZHA 4LF4J 4DV6F 4G1QB 4UZCA 3RB4A 1DQ9A 1DARA 3IM9A 4CNYA 3DC2A 1HWKA 3OXFA 3SSSA 1VYAA 3OSNA 4K5RA 2XSJB 4PG5A 1B64A 4LT6A 4JI7F 3CJKA 5L1KA 4ECTA 4F26A 2FLLA 1W2IA 3MEGA 4OX6A 3G9CA 3NNAA 2J9EA 2NUUG 5I4MA 4FP9A 3KLGA 1RT2A 1HNXJ 1VC6A 1JLEB 2HVDA 3VQTA 1B99A 1NB2A 2HBYB 2GHWA 4CLZA 4CO0A 2AYGA 5MLCV 3W64A 2UV8G 3UW1A 2AQ4A 2R2SA 1S1VB 2XLKA 2KZMA 1MNEA 2ZH9A 4NE9C 5FD1A 5DQIA 5KFDA 1B0VA 4EK2A 1QJHA 4OQJA 1U1MA 4MMOA 3I5BA 3DRSB 4LRCA 2V67A 1JLFB 4LUBA 2WONA 2AIRB 3DYAB 1EETA 2UV8A 5JXSA 2J5AA 2DBBA 2KT5A 5DG8A 3MOZA 4ETZA 3T3FA 3HT0A 4C8YA 2XLJA 3BKFA 1KVKA 4I6WA 2R8KA 1T0TV 3HT3A 4NXNJ 2D9PA 2YBVA 3JSMB 4O3SA 2NCKL 3OL7A 1ZS6A 5ADZA 1HR0J 3W65A 3OXLA 1YJTA 1IVZA 2CPXA 3M9NB 1S9EA 2DIUA 5I3UB 3FK4A 1JK9B 2K7KA 4I67A 2VG7B 3QJLA 1YZ6A 2XO7A 1TFWA 1HYSA 2YWKA 2H4YB 3L7OA 1YITS 1LNQA 4WXWA 2P5VA 4HT5A 1S1WA 1S59A 5HMYA 4L3NA 4LF9F 4KGKA 1W26A 4JI6F 1REGX 1FRMA 3QT8A 2OPPA 3TAMB 4K4UA 4HVZA 4U7UD 3PW2A 3T5JA 5CAAA 5J1EA 2QE5A 3AJDA 1PAEX 5ETLA 1RU1A 1GFWB 3CSKA 1BMQB 3KHHA 4RZRA 4QCLA 3OHAA 3PNIA 2VG5A 3THPA 3V4MA 4ZHRA 4DL6A 1W25A 3F56A 1Y9OA 3CCZA 1FK9A 1NK0A 2WVCA 5B7WA 3SCIE 4UQTA 3M30A 1WOSA 4LBHA 2UXCF 2DNQA 3QT5A 5K8OA 3MURP 1U49A 1SB6A 2IHR1 2CWKA 2A3JA 1M5SA 3M8PB 1C0UB 2F8EX 1Q53A 3IC1A 2VPXB 4U96A 3IXQA 2YKNB 5KT3A 2OSRA 2ZOFA 5D15A 4F7VA 2XMUA 2KHDA 1YWXA 1XC9A 1H2UX 3J81j 4BHQA 1QE1A 2CFXA 1XMQF 4QR2A 2DPJA 5JMNA 3KLFA 3TUPA 2R2RA 1H7WA 4DSKA 4M5KA 3EICA 1YJ9S 2RDJA 1JIHA 4CLSA 4GO7X 4J9RA 1CJKB 3I6PA 1OY8A 3AODA 2AGQA 1U47A 3RR8A 2W7AA 3BPDA 4RW6B 2DNZA 4F3MA 4DEZA 2F63A 1S6UA 3ZNJ1 3C2PA 3CJ3A 3DGPA 3HKWA 4UOGA 1X9WA 4I7FA 1FWPA 3PACA 2JEIA 1VRTA 3R5DA 4B3OB 1ZM2A 4DPWA 4C11B 2M8HA 2YKQA 1HWIA 1NM2A 2VF3A 3U1NA 2YNIB 3GJTB 1JKHB 2EW9A 4X2BA 1PJ7A 3KLHA 3D3CJ 3K59A 3LGHA 1NDPA 2OD6A 4ZVHA 4DG1B 2FLPA 3HHLA 1U09A 3H5XA 2V50A 4K0KF 3KDNA 4RW7A 3T1HF 1WJ9A 1YI2S 1ZAWA 1Y3JA 4AXIA 2FZGB 5IOLA 1KC8T 3RJMB 3MM8B 1CS4A 1NPKA 3UDEA 4IRCA 3ITHA 4LF4F 2B9YA 2UVUA 3CXCR 5AJ3J 4DFPA 5JJBA 1RI7A 3DM2B 2AJ2A 1RA6A 2P9CA 2HKEA 3ZZ0A 3UO0A 4W90B 4ZVRB 2U2FA 2CNKB 4EU0A 3BQ0A 4X4OA 3MCNA 5EGYA 4QR0A 2BM0A 4A47A 2UXBJ 3FUYA 1U8SA 1WELA 3MM5A 4P75A 2GMHA 3AB2B 1L3VA 2FJVA 2DO0A 4UW2A 1F1BB 1HNXF 4NLSA 2FVQA 3UCZP 1I5OB 3VHQA 2KB2A 1UA0A 2J0SD 5KFWA 3V4IA 3BEGB 3LH2S 3J7Z5 5DGAA 3S8SA 4WPAA 1T9VA 1HW9A 2VBXA 2DNNA 4KFBB 4DPYA 4F02A 4C3KA 2OH2A 3THTA 1VQLS 2HHWA 3MMBA 4MIBA 3DRRA 1XNRJ 1KP6A 2B8QA 2HK2A 5KFEA 3UVJB 4TY9A 2JL9A 3NMRA 2GZOA 2W9BA 4NXNF 4QYZK 2X1FA 1NPPA 3KK3B 3TUZC 1HR0F 3S6EA 5KT5A 2QA1A 1FKOB 1XEZA 4J5OA 1S1UA 1WG1A 2QMWA 2NZ4A 5HBMA 4E2FB 2CXEA 5MAOA 2B3TB 1HBMA 2AP6A 2IY5B 4N8OA 5IT4A 5EN1A 3BO2A 5C24A 4OHYA 1SH3A 1BQXA 4MFBB 1FXLA 3J7YI 1VDHA 1G6BA 1NZ8A 1CLFA 3GJSB 4CTAA 4CLUA 4DU7A 1EP4A 2IAJB 4LBPA 4IKAA 2EEYA 1LWFA 3LP2B 1YZ7A 5E2QA 5B0FA 2RILA 1DTTB 1ZPVA 3G82B 2V8VA 1TTHB 2MQNA 3A3OB 1ZAXA 1CULA 4W4MA 4NXMJ 1RP5A 1GNKA 3S1TA 1FTCA 4JOUA 4DQPA 1TUWA 3CNQP 1OSDA 4DPXA 3OR1B 1FWKA 1M1HA 1IBMJ 3W3SA 3DKDA 3FNNA 3EUNA 3GG0A 1NZAA 2V4QA 1HMVB 2F3JA 2GIFA 3PKMA 3PDNA 1WTBA 7AT1B 2XLIA 2QFJA 5CQGA 4ECYA 3S7RA 4Q5VA 3IBCB 2CPDA 4P9SA 2YNHB 1UVKA 1WF0A 2C2OB 3FMWA 3GSDA 5CABA 2QEXS 2V4JB 1FJEB 4BC7A 1U7LA 3DLGB 4OYIA 3M7VA 2DVIA 1OJ4A 1E6YB 3RGIA 5EHHA 3D67A 3G6YA 3RBZA 3K2YA 3PVXA 2CZ9A 1X7VA 4J9KA 1Y5LB 4ID5A 1RXOB 3U27A 1G1XA 2HURA 4JI4J 4PPZA 4OHXA 3MAHA 3NS5A 4FF3A 5DETA 5J2PA 1Z2LA 5ITHA 3K7RA 2QA4G 1U26A 4WXOA 2BV3A 5A0YA 1EJ7L 4TQRA 3OLBA 5IT0A 4YB6A 4J7CA 3TO8A 2XHCA 3I0RA 4DBQA 1LKZA 2ROPA 3WBZA 1VK3A 4BCAA 2X3DA 4I4BA 3BBFA 2B7BB 2ZBCA 5DO2A 2OPRA 1RE1B 3SI8A 2LEPA 3HJVA 3KDOA 2XI2A 3ET6B 1HHSA 4ED8A 4Q43A 4DV7J 3SSQA 2OKQA 2CA9A 3O5TB 3D6FB 2KU7A 1UJ4A 1RAHB 1L5UA 2HYIB 1RAOA 2AX1A 2J7WA 3BH6B 1L3KA 4IUFA 2W9AA 3W9HA 2E5LJ 4QYRA 1TL7B 1HWLA 4MK8A 1LXJA 3CCVS 3QPIA 2HRTA 1H7XA 3BPSP 1LWEA 1U45A 5C7PA 5KFNA 3KLIB 1QUPA 4U8YA 2D3O1 3AAWB 5AJ3F 2BANB 1RKIA 2IRYA 5FDLA 5D0GA 1IUJA 4DF8A 1TMMA 5B0GA 2ZHBA 2DXFA 1CJTB 4J9SA 2H3EB 1PCAA 3C16A 1QAXA 2CNOB 3DI6B 2N4DA 3K89A 3RTVA 2AW0A 2F4FA 2UXBF 1GK8A 3PFOA 2GX8A 3DOLA 4B9SA 1U6ZA 3TZWA 4QW8A 3KYLA 3J81U 4OZ3A 1K9MT 3TX0A 3G8QA 3NS7B 1TKZA 3V6DB 1JJ4A 2FHJA 1XBWA 3OBIA 1X4CA 4WFZA 1GEHA 1TL4A 1R6YA 2E7WA 2R2TA 1WG5A 5CYQA 4I2PA 1RU2A 2CZ4A 2B9EA 2UUCJ 4IH5A 3W2VA 1SC4B 2DCLA 5CYMA 5D8HB 4LF8J 1P1LA 4G1QA 1XNRF 4C9DA 5E3QA 1IR1A 4EBEA 2AHOB 4USTA 3I9ZA 1IBCB 2ZUAA 1F60B 4FNIA 4LQ9A 4OZLA 2Q43A 1RWKB 4CDIA 5D0RA 4B08A 2HRUA 4NA2A 2RF2B 1EARA 1UCNA 1BC6A 4PQUA 1T02A 2EFQA 2XEXA 4ZP8A 2CJBA 3PRVA 3A13A 3GSIA 1NXIA 1R8PA 1WI8A 4NCGA 3IP0A 3BH7B 1XTZA 3ZZPA 4NRUA 4ID8A 1N5TA 3GYNA 1S4EA 3KWMA 2XHWA 3HF5A 4IO1A 2UUWA 3EX7B 3ETMA 3CMQA 3KMSA 4ZVGA 5HI7A 1S77D 3VAGA 4XAKA 1RT1A 4CLTA 1S1VA 3ZZYA 2VJUA 2DNMA 1F5AA 3HHLC 1D09B 4WTYA 2QA4S 4ELUA 1AROP 3MF5A 4PQAA 4ZVSB 5GMEA 5KFJA 6FDRA 2O5DA 2GJ2A 2YKMB 1JLFA 3MMAB 1KN6A 2BX6A 2AYMA 3DYAA 4G3IA 5GAEI 2R7UA 3K5MA 1JXLA 2VHGA 2NXEA 4MYTA 4NXMF 4TYBA 4MKBA 3BR9A 3IBWA 4KHPJ 1Y0HA 3JSMA 2NXJA 2W1BA 1IBMF 4AL7A 4LFCJ 3J80U 3C6UB 2C1EB 2D1CA 5I3UA 1TVRB 1NH8A 2HFVA 2VG7A 3H42A 3MPYA 4PUOA 2GV1A 2Z4PA 2HNDA 3TEGA 2J9CA 1R43A 1RWPB 3CJ2A 2HAIA 1T03B 1NJWA 2ZD1B 1KONA 3C66A 2IDEA 3CCUS 2BQ3A 3TA1A 4DL7A 2CWXA 1CJVA 4NMLA 2EFOA 2RU9A 2C2ZB 3TAMA 4PXEA 5LXRA 1FNXH 2E9ZA 4AQYJ 4RBUA 3EGVA 2GQQA 4PWUA 3D4JA 3CDAA 1MSWD 5L8RC 4KYZA 4JI4F 1UZDA 1KS2A 1XMBA 4ER8A 1HLWA 3G86A 2HNZA 3NG8A 4KT0C 3JSRA 1JJHA 5B0CA 5LJ5Y 1P9YA 1WEZA 3MCSA 2C2NA 2JRSA 2HZVA 1IJFB 5A2QU 1F3VA 4Q45A 3DLLQ 3JQJA 1VQYA 4ECVA 4FNHA 1VLOA 2HHPA 4Z2XA 1YHQS 2C3YA 3M8PA 1AW0A 1C0UA 1RWMB 4DV7F 1CG2A 2RB7A 2BRKA 1CC8A 3KHGA 5C2CA 2F8MA 1NH7A 4XTTA 1Z2ZA 2VZ9A 1S97A 4YP3A 4FBTA 3DDKA 4X4SA 2E5LF 4CI0B 3SCJE 4IRDA 4IH7A 2JNJA 3R9LA 1DURA 4KAIA 4NL5A 1VC0A 3VAMA 3JQKA 1BGXT 1TP7A 3PG9A 3C6TB 1JXVA 3ZO7A 1CJKA 5HAOA 3W9JA 1NNDA 2GC8A 2GJFA 5BYQA 3J7YU 3RRGA 4RW6A 3BKTA 4IG0B 4ZCKA 4DFKA 4NA1A 5BYSA 1N34J 2HGNA 1U1QA 4WP3A 3OT9A 2YWWA 1KLNA 3JYTB 5LL6d 3V6KA 4R5PA 2V5HG 3DOKA 1FNOA 3NWRA 4OYPA 2GMJA 3MPDA 1I6JA 4YOEA 5GAGI 2CPZA 4B3OA 5H9FK 4TU9A 4CLKA 1HPZB 1H2VZ 3SCKE 4C11A 1R0AB 4FPRA 5AXNA 2HQIA 5KT7A 5KFLA 2ILYA 2YNIA 3GU0A 2I2YA 1GQEA 1GT8A 2DYAA 2K06A 3RBEA 4PWWA 1D8ZA 3BM7A 2GW8A 3FCWA 4DF4A 3AB4B 4NWBA 1N5SA 1IJEB 2R7SA 2AZ1A 4DUYJ 3M8QB 1JB0C 5KFCA 2Z57B 4LSNA 1R0BG 5LOQA 3ZXWA 2XC9A 1M0SA 3KG1A 3SQOP 5EWEA 4LF8F 2F4VJ 1DFDA 2GAHC 3WC0A 2G1HA 4HI2A 2JFDA 2HLUA 3DM2A 3EM1A 2B4UA 3K5LA 5EWGA 3L3CA 3Q8YA 1T11A 1RDRA 4JI0J 4RW4A 4R25A 5AXMA 2J6SA 3ZZOA 3CTRA 2ZH4A 1GTHA 4P7TA 3G96A 1N54B 2XY7A 2DEIA 3R2CJ 2UXDJ 2RNEA 3AT1B 4B3MJ 1CC7A 3IG1B 4HH1A 3SIPB 2ZH5A 4N47A 5LMNJ 2KG1A 1K0VA 3WDOA 2CKWA 5C5JA 1RHQB 2YWFA 5D3GB 3CO0P 1RTHA 4ZCMA 5LJ3Y 4WFXA 1BLUA 2RJZA 3TJ8A 2ZH7A 4E98A 3VAKA 4PXDA 3DXSX 3TZZA 2MKHA 1TELA 2X7IA 1X60A 3R2DJ 1U24A 1KOHA 2H1YA 4DI6A 4ZDNA 3OUYB 1MN9A 1YG0A 3PZPA 3VAHA 4QIWD 2B4VA 2ILZA 2JLFA 3ILIA 4KFBA 1EAYC 3AOCA 3FDSA 3NS6A 4DL4A 2DPIA 1D0EA 4P72A 2ASLA 1KNZA 1KQGB 1PBUA 1SCJB 4LIWA 2ZVIA 1T05A 3PKYA 2QG9B 3BDPA 2OTJS 2BQRA 2NYHA 2W2OP 4Z7CA 2W9CB 2AYBA 2V94A 4NEZA 3ZZRA 2XS7A 5BJRA 4HLBA 4Q2MA 3QGHA 3NNCA 3PX4A 4YR3A 4KHPF 1VQKS 2CDQA 3MD1A 3QGPA 4B9MA 3KK3A 5D0EA 3EXCX 3DHWC 4LFCF 2BA9A 2YQ1A 3P4UB 1DAXA 4UOFA 1FKOA 1HFEL 4I2QB 5IQ6A 1R8CA 1PYTA 3I96A 2ROEA 1APSA 1IQTA 2BVZA 2QFIA 4YDXA 4NLTA 4CQ1A 3R1HA 2CJAA 2DHAA 3DXBA 3T41A 1XR6A 4PG8A 3Q86A 2MY8A 2WSCC 1Y11A 1NK5A 4WKYA 1PAUB 4Z37A 1U0HB 3M2RB 5CCMA 2N7CA 4MFBA 2KO1A 1Y00A 4MH8A 1S0OA 2NPIA 2AX0A 3PHTA 2IAJA 1PBAA 3ZZUA 2QGFB 2V63A 4AQYF 1IN0A 2MXYA 2DKOB 1U02A 3VF0B 4C6AA 1DTTA 4HL9A 1RB0A 2AJ0A 2LQ9A 4M5HA 2HHUA 4X4PA 2GIRA 3G82A 4Q7AA 4MT1A 2KYZA 2B9XA 1OYDA 4KPYA 4CT8A 2HBZB 2R7QA 3MR6A 5G0RB 1N4LA 4ILRA 3R27A 4F0KA 3OR1A 5GADI 1R6VA 1SKSA 1TV6B 1X0FA 3B82A 1KR4A 3N01A 5KFVA 1X4HA 4MAKA 2I6WA 1T3NA 2LDYA 3VAIA 1YBAA 3G4SS 2NQPA 2XGQA 2UUAJ 2JVOA 3PM9A 4H54A 1QSYA 2XWYA 3DMJB 3OTOJ 1VBXA 2YNHA 5DLFA 1FCAA 2QL7B 2FLNA 2AJ1A 3D54A 1Y5IB 1SKWA 2FGCA 1O51A 3BGUA 4IOCQ 4K5SA 1CBKA 2V4JA 3W8GA 3MAAB 2WVBA 4IH6A 4ED2A 1HBNA 2HW3A 4QWEA 1H6KX 3JTNA 2OPQB 3HM9A 5HVHA 2FJEB 2WSEC 1PG5B 1AA1B 5J1NA 2GIQA 5LMUJ 3O3LA 1HHQA 2IC3A 1NAQA 2ZNZA 1VQPS 3N79A 4OJHA 5F8LA 4Q8FA 1N34F 4K4VA 1KLMA 3M1VA 4QWBA 4GO5X 1C4AA 4IFVB 2DITA 3TJ9A 3A4TA 2ZBRA 2HRYA 1J5OA 5GAEU 1JWWA 4WWSA 2FLOA 1LQ9A 1KHVA 3A8EA 3R3TA 3OW2R 3ET6A 3HSJA 1O8BA 4MKVA 3J7AN 2VG6B 2W4PA 1VJWA 4K4TA 2Y8YA 5C42B 3I0SB 2J0QD 1RWWB 1N6QA 5IC4B 3OFEA 1N0VC 4UY85 3E51A 4UQGA 3EZOA 1NB7A 2DH7A 4DUYF 2RDIA 5B09A 2W7PA 3BDEA 4MKYA 3MTJA 3CDBA 2DGWA 3RW7A 3MUVP 4FF1A 5LT5A 4BC9A 4GMKA 5KG5A 3KLIA 5E3CA 3U7JA 2F4VF 2A18A 3GYGA 2IJNA 3PX0A 2BANA 1YJVA 1G4CA 4IR1A 1WKKA 4JI0F 2CIMA 2JC1A 1KVJA 3MEGB 5CCLA 2HGMA 1ITPA 5BR8J 4LIRA 3C3LA 3DI6A 1RWXB 4WFYA 2J9DE 4ILLA 2UXDF 4P2FA 1UETA 1F5CA 4B3MF 3UD4P 3PO5A 5LMNF 4RUAA 1GMVA 4QWCA 1RT4A 2FVPA 4IR9A 5HVGA 4WZQA 3V5RA 1SXLA 3FRYA 2D9OA 1WOPA 3D1QA 3T1YJ 3HHKA 1AZSA 3V6DA 4KC5A 2SXLA 3SQGB 2GVDB 5F8MA 3M8SA 3CC7S 2YKPA 2FD2A 4K4WA 2J0XA 3CCLS 1MU2B 2LP4A 5F9LA 1KTQA 3HD2A 2VA2A 4F2SA 1NHVA 4NMXA 1HD0A 4Z7YA 1EETB 2DGVA 5DG9A 1D3WA 4KGXB 1Q79A 4RBTA 2DY1A 2HHQA 2MPUA 1N48A 1J5EJ 2UUTA 5ETPA 4JYAJ 1DLOB 4DL5A 2XULA 1S0MA 3EMTA 4K59A 2MQ8A 2PI4A 1A0OB 3ISZA 3MEKA 3PYEA 2U1AA 4O3PA 2JEFA 1Y10A 4MKAA 2H4WB 3DRYA 4EWTA 3MFIA 4TYAA 4L3KA 1F9FA 2Z2LA 5D4NA 1QVFR 4A46A 2G0JA 5KTQA 2R42A 4FKXA 4Y34A 3R97A 1G3OA 4DX7A 3UD3P 2CYYA 1U2FA 2DHSA 2IPOB 2DCUB 2QYGA 1YJUA 1CEZA 2A6OA 4F67A 5GAGU 2O3DA 3BO3A 3LAKA 2RUSA 2H51B 4AL6A 2YKMA 3MMAA 5F0UA 1FTRA 4ZHRB 1S4FA 3MHYA 3GJQB 4EZ6A 4KY3A 4R8UB 2ACYA 3UWTA 2HBQB 5HROB 2QX0A 3BBCA 5ETKA 3W61A 3M30B 4QPTA 1FF2A 4CT9A 1K0TA 1T8EA 3C6UA 4OFZA 3EXYA 2Q3PA 2EBGA 3R7BB 3WC2A 1URNA 1ZM3A 3TX8A 1Q86T 3HSZA 1I51B 2VICA 5RUBA 3DDIA 2UUAF 4DJBA 2Q6BA 5AXKA 3OTOF 1TFYA 3R8YA 2ZD1A 2CVIA 2KHCA 1N8RT 3L09A 3SBMA 1O6XA 1QE1B 3GQCA 4OMFG 1VQ7S 1LEOA 3RRKA 1G7CB 1B0TA 2EKYA 3ETOA 4NX9A 4IFYB 3R6GB 1H98A 5T7LB 1JNRB 4R0EA 4USWA 2CQIA 4RNNA 2VIHA 3CCMS 1NK8A 3TVZA 1IWGA 3AJ1A 2F5GA 5LMUF 4C8OA 4LSZB 2JC0A 2ZWOA 3DGPB 4H4KC 2JEGA 1NEEA 2WBMA 1NLKL 4YY3J 2V9WA 3ISNC 1EQMA 1YBTA 2GQ2A 2ZDOA 1S1TB 2BJ9A 1UWBB 2NXCA 3I56S 2D3UA 1WC5A 4K4XA 5DS7A 4LR9A 1IKYB 2H5EA 1U1KA 2ABYA 2RSQA 3EVWA 3PY8A 1U2RA 3KLHB 1RCXB 2J6TA 3CJQA 4ZJLA 5LSLA 3JTOA 5ETQA 4OX8A 4FBUA 4P7VA 3QYYA 5LXYA 2OGUA 3GFHA 4HHUA 1CS4B 1JMTA 1Y5NB 4GC6A 1T9XA 4MIAA 3H7HB 4EZ9A 1UL3A 3AA8A 2NSCA 5DLGA 2MQMA 1N5VA 5B0EA 2XYHB 4ZVOB 3HZEA 3TUJC 2XCPA 3C6TA 1RJJA 5KFFA 3CB4A 5KG1A 2XO6A 5HMXA 2GQCA 5KFIA 3IR5B 2X1GA 1D8YA 1PSDA 4UUXA 3UR3C 3NGDA 4URSA 4IG0A 1LWCB 2V2ZA 3M2VA 2HS0A 4ENOA 3CE8A 2HVEA 5DDQC 3CCJS 1RHJB 3HJFA 5L39A 1NPRA 4M94A 5BR8F 3OFGA 1VIXA 3JYTA 4QIFA 3W9IA 3MR2A 4NZ0A 1UJ6A 2OJ3A 3MEDB 5DG7A 1FWLA 3CW2C 5IFMA 3LP0B 2MQPA 1Q78A 1T9WA 1HPZA 3DLEB 3BGRB 1R0AA 3CPWR 3T1YF 2KL8A 2OI2A 1H3DA 2H54B 2XMJA 3OL6A 5CH7B 2E7VA 1RK8A 2N3OA 1RABB 3NCQA 1VIOA 2VV5A 1RCOB 1U8WA 3LA0A 3KTQA 2IA0A 4FYWB 3M8QA 2EG1A 4QW9A 3H8YA 3Q24A 2QLBB 4J9UE 4U6PA 3PYDA 2MKKA 2ZC4A 3NL0A 1IM4A 3F41A 5AE1A 4O0NA 3QZ7A 2W9BB 1J5EF 2GAGC 4JYAF 1WHVA 2I38A 1IR2A 2V9KA 2HWTA 1S79A 2UP1A
chains in the Genus database with same CATH topology
4OHVA 5M2RA 2VFSA 3IGNA 3PJWA 4YEAA 5AXLA 3CJKB 2QEXS 4C8LA 1JLGB 2V4JB 2VONA 1FJEB 4QIGA 4BC7A 1U7LA 3RZAA 3FSYA 3DLGB 2YH1A 4PPDA 4YB5A 4L6V3 4XPEA 5L9XA 1JJ2R 4DS5A 1S1UB 3ULHA 3DHXA 1KD1T 1X4DA 2DVIA 5K14A 3GZ7A 3EZUA 1E6YB 5KG6A 5EHHA 1NJZA 3EGZA 1P9QC 3KLGB 2J8AA 1RT2B 3G6YA 3MZIA 1RYSA 2PD1A 1SJQA 3GE9A 3IG1A 4OX9F 1TL1A 1NU4A 4N5SA 2LQ5A 3K2YA 4PR6A 3T5LA 3PVXA 3MXHP 3BF4A 3W2WA 4B9NA 4NLWA 3T9ZA 1X7VA 4J9KA 2OSQA 1D1UA 1Y5LB 4ID5A 5EX3A 2XMVA 5D3GA 1FRIA 3U27A 3QO9A 1G1XA 3P6YC 4PPZA 4OHXA 4ELTA 2LXFA 3K58A 5KG3A 3MAHA 4QOTA 3NS5A 2FY1A 4BWMA 4FF3A 3M2VB 4FXDA 5DETA 2OFGX 5J2PA 1Z2LA 3M6WA 2PI5A 5ITHA 3K7RA 1UJ5A 1LK5A 2ADBA 4I64A 4RLEA 1U26A 4NA3A 4WU2A 4C0OC 4WXOA 2QA4G 4UY8T 3P5TL 2BV3A 1B0PA 2R4FA 5A0YA 4A4JA 4ZCIA 1RT5A 4TQRA 3OLBA 4NLDA 5IT0A 5H1SV 1X9SA 3OUYA 2AD9A 4YB6A 3LP1A 3TO8A 3IS9B 1HI0P 2HVZA 1C1CA 4Q0BB 3MUMP 2KT3A 3D0GE 2IM0A 4ZPCA 5L1JA 2AJFE 1LWFB 3I0RA 4I6YA 4YQWA 3BN4A 4IRKA 4DBQA 3P96A 1LKZA 2ROPA 3WBZA 3NMAA 1VK3A 4KRWA 4BCAA 3QLHB 3RB0A 2A10A 4I4BA 1FVQA 1YGYA 1FRLA 1LXNA 1XN9A 2B7BB 2YVSA 5DM7Q 2ZBCA 3QAEA 5DO2A 4HTJA 1HBOB 2OPRA 2G4BA 3QJJA 4OI3A 2WONB 1ELOA 4RWXA 3SI8A 2KN4A 2LEPA 3L95X 3BSOA 2XI2A 1WNEA 1WEYA 4DSLA 3KNGA 1VRUB 1HHSA 1BD6A 3H2UB 4DSJA 5D6GA 4ED8A 3DLKB 4Q43A 3SSQA 2OKQA 3MECA 2HVHA 4ZP9A 5L1LA 5HP1A 2MB0B 3O5TB 2W9CA 4PCQA 1IQZA 1RISA 4M5DB 2KU7A 5IM0B 2NSBA 3S01A 5LSOA 1UJ4A 3FQKA 1NKBA 4FYDA 1L5UA 2HYIB 3PRDA 4OLPA 4TXSA 3DDNA 2AX1A 2MHNA 2J7WA 3G6ES 4YB1P 1L3KA 4IUFA 5DGBA 1DHMA 4ZMMA 2W9AA 1Q7LB 3B4DA 2UUCF 3SEOA 3N0VA 3RAMA 3CCQS 3FSXA 1S9EB 5F41A 1HI8A 3UQSA 1XNQF 3AQPA 4TU8A 1GH8A 4QYRA 4QPXA 2Q6CA 4DDFA 3E2EA 5A8KA 1HWLA 1DTQA 1HHTP 4MK8A 1NKCA 2RF2A 1LXJA 4OL8A 1IKXB 5A6WA 3CCVS 5F3TA 1A6LA 3GV8B 3QPIA 5IWAF 4KHRA 2ALZA 1H7XA 1HYSB 1LWEA 1U45A 5KFNA 4MK9A 3KLIB 3GIMA 4QU6A 1QUPA 5KFGA 2BUNA 3FFIB 3SYZA 1TK5A 2MZJA 3AAWB 3OFFA 4OJGA 3KHLA 5E0OA 5AJ3F 4KE5A 1JLAA 1FD2A 1RKIA 2BANB 2IRYA 2JVRA 5F8IA 5FDLA 2L9WA 1Y3KA 1IUJA 4KO0A 4X65F 2NR0A 4DF8A 2Z8QA 5B0GA 4G1IA 1S1WB 2ZHBA 2FIUA 3E3XA 5DRKA 2VPYB 3TW0A 4J9SA 1FNMA 1BQNB 1UVLA 1M5PC 1U6FA 2XZWA 2K1RA 1RT3B 3CD7A 2OO4A 1F2GA 3ZZTA 3TAQA 3H4DA 2P6SA 1QAXA 3M2RA 1FKAF 3PFEA 3KNAA 3DI6B 2QMXA 1HBUA 3CEDA 5K8MA 3AA9A 1HNIA 2N4DA 1TL3B 3LW5C 1NHUA 1IKWA 4V19J 2K7JA 3RTVA 3I31A 1TL1B 2AW0A 1R27B 1K8AT 4FF4A 3W2WB 2UXBF 2B0GA 2OPPB 4KB7A 4EEYA 3PFOA 3CO9A 2GX8A 2LYVA 1URRA 4HDHA 2ZH8A 3DOLA 4FS2A 4B9SA 4H4OA 1U6ZA 4ID5B 4QW8A 4ZP6A 2X3GA 1LW0A 4KR0B 3ICLA 5J1EB 2M4MA 4IYQA 4A8MP 4DV4F 3KYLA 4P2SA 2DT9A 4RW8B 4C3LA 2DHXA 5A8WA 4QWAA 4OJ3A 5G4DA 2M9KA 2LEAA 4MJKA 2EWHA 2AJQA 2XGPA 1K9MT 5KFHA 3Q8RB 4URGA 2KXNB 3G8QA 3MM9A 1GXUA 3IGVA 3TUIC 5A0YB 2MZRA 1TKZA 3V6DB 1M5KC 4ECQA 3TNVA 3KHRA 1JJ4A 2R8HA 2FHJA 1HQEB 3MD3A 1XBWA 2VG5B 2MKCA 3OBIA 5H9FJ 1U1NA 2FHKA 1X4CA 3R5AA 4WFZA 4ZVFA 1NRKA 2HHXA 2G0CA 1TKTA 4NYPA 5G0RA 1M90T 2QT7A 1T94A 1TL4A 1R6YA 4I6AA 1TKXA 4X4UA 3RBDA 2E7WA 3OR2A 4YY3F 1FK9B 2YX4A 4NLUA 2Y1JA 2R2TA 1M1KT 1WG5A 5CYQA 3PW5A 2JWNA 4I2PA 4OLOA 2A1BA 2CQ4A 5C25A 3ZZZA 2CZ4A 5KG2A 5AE3A 1HL6A 4CO1A 1NK7A 4URQU 4IH5A 2DRBA 2RIJA 3W2VA 4FVCA 2I0XA 5DJBA 3I4HX 4C98A 2ZOGA 4NYOA 3I5AA 1D9AA 2DCLA 3T5HA 3A1YG 1UA1A 2VKRA 3FRZA 4ZS6A 5CYMA 4V19X 5D8HB 5HP1B 1P1LA 4G1QA 4WIIA 1XNRF 2IM3A 4C9DA 2Z2MA 1CQMA 4K4YA 5E3QA 4DQRA 1AUDA 4H4KA 1TVRA 2CRLA 4DFJA 1V3SA 5DM6Q 4EBEA 4KTQA 1Z1ZA 2J7UA 1XR5A 2RU3A 1ZAVA 1RQ0A 3I9ZA 3JSYA 1HWUA 2HG4A 2PGCA 4F50A 4KV8A 1WACA 3DMJA 1DQAA 3QZ8A 1RKJA 2I8EA 2BDPA 1C0TA 1F60B 4FNIA 4FZVA 4LQ9A 4OZLA 3O2IA 2Q43A 2FJAB 1E6VB 2OLWA 2WB1D 3CC4S 1M5HA 4FXVA 3U02A 1V3RA 4YR0A 5T41A 2MKJA 1T03A 3HX9A 4B08A 5BYRA 2HRUA 1WEXA 4B9LA 1SJRA 5GAHI 1CSJA 3F44A 4NA2A 3VZIA 3WX4A 4EFAC 4DWIA 1YTYA 2RF2B 3V6HA 5A8RA 4ZPVR 4X64F 2N3LA 1H38A 4PG4A 3IRXA 2YWGA 3CMAS 3IA0A 4PQUA 1BC6A 2F9DA 1T02A 1Q16B 2EFQA 2XEXA 3GV7B 4ZP8A 1DBDA 1X8DA 2CJBA 3I87A 3EZ5A 1U48A 3H2LA 4B9VA 2BRLA 3N5BA 3KLFB 1R8PA 3EPGA 4B9UA 1WI8A 2ZJRQ 4NCGA 4WK3A 1FRJA 3DLBA 3M6XA 1WHWA 3M6UA 2QZ8A 3TP2A 4N56A 2GHPA 1XTZA 1UVJA 3ZZPA 4NRUA 1TK0A 4ID8A 1N5TA 3GYNA 2N82B 3KWMA 1BQMA 2OPQA 4OI1A 2HFNA 2XHWA 3HF5A 4JI3F 4CO2A 4IO1A 2UUWA 3MDFA 2K1RB 3EX7B 2DGQA 3KMSA 4DS4A 4M1KA 2IYGA 3QGGA 4ZVGA 1FJCA 2APOA 5HI7A 3F73A 3D0IE 2VFRA 4G1PA 4ALZA 2GNKA 3QWUA 1S77D 2Q79A 2DHGA 3VAGA 1IKWB 3BR8A 2E1MC 3BB5A 2J76E 3GG1A 4TY8A 2YNFA 3H20A 2GCFA 2GHVC 3MM6A 4XAKA 5CZVA 3HK2A 3N4WA 3FZ2A 1AXQA 1RT1A 1S1VA 4O3QA 4P6QA 3ZZYA 2AJ4A 4H4OB 3M9MB 4PRFA 4I7FB 2JLEA 5JVHQ 2DNMA 1V6HA 1F5AA 3HHLC 3PW7A 4IFVA 3L7PA 4WTYA 4RNOA 2QA4S 4ELUA 1AROP 3MF5A 1VRTB 1RAJA 4PQAA 2MQQA 5KFJA 4A8OA 6FDRA 5A8WB 1WI6A 2O67A 3NBPA 2KRBA 4ILMA 1A9NB 2O5DA 1SH2A 4I0WA 4Y2KA 4ZA1A 4AXJA 2GJ2A 2E5IA 4X84A 2IRUA 2YKMB 4K2XA 4DN9A 1JX4A 1JLFA 3MMAB 4DPOA 1KN6A 2KG0A 2XMKA 4F4KA 4O3OA 4EO8A 1QSLA 2POKA 1VFJA 1OPZA 3HVWA 4C8MA 2AYMA 3DYAA 4G3IA 2IVMA 5GAEI 1JNZB 2R7UA 3K5MA 5JUMA 2CPYA 5J2QB 1TKTB 4J9QA 1JXLA 3HP6A 4KGMA 3OFHA 4N8NA 1SI9A 3Q8QB 1LK7A 2BE2B 2DGOA 2RVJA 2VG6A 2PFFB 2W25A 4MYTA 3UI3A 4DR2F 3QWPA 5EUHA 4F4YA 3VCDA 3H5SA 3AH6A 4XO0A 4RNMA 4NXMF 4TYBA 5CYQB 4HDGA 3T9NA 1ZZFA 3GIIA 2WK4A 3I0SA 4MKBA 3BR9A 3IBWA 2PMHA 2C3UA 1YVFA 5F8NA 1NO8A 4OZ1A 1X4GA 4IO9Q 2VD3A 2KH9A 1R8HA 1Y0HA 3JSMA 2M7SA 4DV0F 3UDCA 3HHLB 5I42A 4IQXA 3X3UA 5K9FA 1DQ8A 2W8LA 2VBYA 1IBMF 3NKYA 4AL7A 4PKDB 4RW7B 3DRPB 2Y1IA 2LDIA 3C6UB 3TA0A 3OVAA 2I1RA 3LUYA 5CYMB 3SMZA 2DNOA 2FC8A 2FPHX 2D1CA 5I3UA 2E9TA 2VL1A 5EX0A 4N76A 1VK8A 1TVRB 1RWUA 3UNGC 3ITHB 1NH8A 5J2NA 5L1IA 2VG7A 2XG8A 4ZVEA 3MPYA 2E1CA 3IWXA 4PUOA 2GV1A 2EFNA 4PXBA 1X4EA 2Z4PA 2FVCA 4ZPWR 2HNDA 1LOUA 3BS9A 4U9RA 5THWA 3W7BA 4HYKA 1N5QA 3TR5A 2DR7A 1SV5B 1UVIA 1REVB 4N77A 2J9CA 1R43A 1SJ1A 1U1OA 4Y3CA 2FJWA 2ZHAA 1WD6A 2HAIA 3CJ2A 1T03B 1NJWA 2MZTA 3H40A 3PZPA 1ZTWA 2P9EA 4J37A 3I5CA 2ZD1B 1KONA 2HGLA 2VPWB 2L9NA 3I55S 3C66A 3GILA 3PV8A 2C3MA 5A8RB 4A8YA 3OTDA 3CCUS 4CO4A 4I68A 1R89A 5KFTA 4NLOA 4PQUB 4ED0A 2BQ3A 2XI3A 5E3AA 3TA1A 3ISND 4DL7A 4LF6F 3MM7A 1S9GB 4N41A 4HKQA 4NCGB 4PWDA 2JH3A 2BJEA 4NMLA 2EFOA 5K5MA 1YRUA 2RU9A 3MM5B 3OL9A 3IR6B 4IQMA 2F7VA 1YJWS 4ETXA 1VQNS 3TAMA 4PXEA 5LXRA 1FNXH 2E9ZA 4CO5A 4ELVA 1OPIA 4RBUA 1BQMB 2YNGB 2GQQA 1SQEA 4PWUA 4JV5F 2IA6A 3CDAA 4JI8F 2HPUA 4TLQA 1QY7A 4Y2AA 1Q7YT 2JOQA 1MSWD 2W4CA 5L8RC 4HT7A 2DR5A 2GO9A 1FXDA 1S72S 4MIWA 3FCHA 4WCEQ 1X4AA 2HHVA 4JI4F 4NRTA 2WSFC 4ZKAA 2AGPA 4DMZA 2V8GA 3BGFA 1KS2A 1Z4UA 2KRRA 4WKRA 3MM6B 1XMBA 2KFNA 4LMZA 3LF0A 4XIUA 1RT1B 3SQGA 3KK2A 2L3MA 3G86A 4X4NA 2HNZA 4ZP7A 1B7FA 4C0BA 3AQOA 3V4IB 2LLZA 1S1XA 3D2WA 3NG8A 4M95A 1OQ6A 4KT0C 1NK6A 3LO3A 4LSLA 3JSRA 2CPFA 1MU2A 2HHTA 1JJHA 5B0CA 2EI5A 2OMOA 5LJ5Y 4W92B 3PO4A 1ZTTA 3T6BA 1K73T 5F0WA 4DV5F 5KFRA 1WEZA 2XMMA 3MCSA 1KQKA 2JRSA 2EVZA 3SDEA 3CJ4A 1XWLA 3NBPB 3OJSA 3TQ1A 1IJFB 4TQSA 5IQQA 1NK4A 3OTCA 2XNRA 2CPHA 3DU6A 1HNWF 4J9OA 5F8HA 2FB0A 2ZKTA 1YRXA 2DD8S 2V4RA 3MMBB 2GGPA 4XDCA 4Q45A 3DLLQ 1VQYA 1RGVA 3DRRB 4FNHA 5CA5A 4ECVA 4LF5F 2YTCA 2VOOA 1GX6A 3OQ2A 4ZCLA 1HI1A 2E5GA 1FXRA 2HHPA 4Z2XA 3DFEA 1YHQS 2C3YA 3V6JA 3M8PA 3R5BA 1C0UA 2N4CA 1AW0A 3KJVA 1DJ0A 2MKSA 2ZDPA 4MTPA 1Q8IA 4DV7F 1CG2A 1IKVB 4ECUA 2RB7A 2Z0GA 3WZ0A 2BRKA 1BWEA 1DLOA 5I42B 1CC8A 1TKDA 1RTIA 3KHGA 5D4PA 5IT9Y 3OTBA 3TOQA 2M3DA 3TVKA 4JI1F 4X4VA 2UUBF 1NJXA 4TN2A 3Q8PB 2HWHA 1SJFA 4J9LA 2Y0SD 2F8MA 1NH7A 4ES3A 1TK8A 2E5JA 4RW9B 4EYIB 4JI5F 2EK1A 1Z2ZA 1X5OA 2VZ9A 1S97A 4LVOP 1JLBA 1WTFA 2PSZA 3ONQA 1HWJA 3VAJA 4ED3A 5D77A 1N56A 4YP3A 2WCXA 2MZ1A 1MW7A 4FBTA 1RT6A 1U25A 3DDKA 3B8HA 4WE1B 2F9JA 1N0UA 2M70A 3VZHA 5J2NB 4X4SA 2E5LF 1HA1A 2OFHX 4CI0B 3SCJE 4IRDA 1S49A 4IH7A 1FERA 4PUOB 3I82A 1M5OC 4J9NA 2B5JB 2HNDB 3VTIA 1DURA 1S6QB 2UU9F 5HBMB 1SUQB 4KAIA 4U7UK 3TRGA 4NL5A 1VC0A 4GKJF 4XK8C 3VAMA 4CO3A 2HQ3A 2KXHA 2YWEA 4NLYA 2XNQA 2PO4A 4OX7A 3I32A 3X1LB 3E01A 1BGXT 1OWXA 4O44B 4X66F 4ED1A 2YY3A 1UMJA 1TP7A 1HBMB 3GR1A 2GA7A 4OZNA 5CD4H 3C6TB