2FC8A

Solution structure of the rrm_1 domain of ncl protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
102
structure length
102
Chain Sequence
GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords NCL protein
publication title Solution structure of the RRM_1 domain of NCL protein
rcsb
source organism Homo sapiens
total genus 10
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2005-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fc8A00
2D3OR 2KG1A 5DDQC 1DHMA 1FNXH 2RRBA 2CQGA 2DGSA 1K8AT 2PE8A 2MQQA 4TU9A 2XNQA 1M5VC 3P3DA 1VQ9S 1ZZNA 3CCLS 1CVJA 2DNQA 3UE2A 2RRAA 3DLLQ 5EN1A 1FT8A 3TP2A 3G71S 1WEYA 4TU7A 2XS5A 2X1AA 2N7CA 2LA4A 4LJMA 1WI6A 2M9KA 3U1MA 2V94A 3SDEA 1SJFA 1XN9A 5FJ4A 2DHXA 5LJ5Y 2HYIB 5LXYA 3MI7X 2DB1A 1W2BR 2E5IA 3FEYB 5LSOA 5JVHQ 1H2VZ 3NNCA 2KN4A 1VBYA 2DNRA 2F3JA 4TLQA 2KT5A 2ERRA 1FO1A 2DHGA 2MKJA 1IQTA 2DH7A 4IOCQ 2MYFA 2DNMA 3SMZA 1Q81T 2UP1A 1VQ4S 1WI8A 2FC9A 2EVZA 1Q7YT 3P49B 2KRRA 5GAHU 3MUTP 4C0OC 3SXLA 3CCMS 2DNOA 5HO4A 2VONA 1X4HA 1FJ7A 1UW4A 2YH1A 1U6BA 2AYBA 2E5GA 1OWXA 1D9AA 1U1OA 2CPXA 3RW7A 3R27A 5LSLA 2ADBA 3FEXB 3CULA 1P27B 3DXBA 2ZJRQ 1VC6A 3ULHA 2DNLA 1VC5A 2J0SD 3P5TL 2MQOA 1M5KC 5IFMA 2EK1A 5DDPC 1YJ9S 1WF0A 5MLCV 3CCES 2CPHA 4WF9Q 3U1LA 2MZTA 2QA4S 2AYEA 2DGTA 3MD1A 2HGNA 1D8ZA 1R8HA 1HD0A 1OIAA 4TU8A 2DGWA 3S01A 2L9WA 1NO8A 2XB2D 2CQPA 1YITS 1VQ7S 2VOOA 3RW6A 1WWHA 2CPIA 2EK6A 3B4MA 2LECA 2K3KA 2MHNA 5CA5A 3HHNB 3R1LA 3MUVP 3VALA 1KOHA 1A7GE 2MKIA 1N54B 4WCEQ 1URNA 4CQ1A 2KVIA 2MKSA 3H2VE 1WEZA 2DH8A 2M2BA 2U2FA 3L3CA 1OO0B 2DGVA 2SXLA 4WIIA 4QU7A 2FPHX 4QQBA 2MSTA 3VAKA 2CPDA 3CPWR 2N82B 1DRZA 1WHWA 3CMAS 5JVGQ 1K73T 3IWNC 2FY1A 2MKCA 1R8PA 4A8XA 2N3LA 3BS9A 1M5PC 1SJ4P 1VQPS 1VQ8S 2NZ4A 3UD4P 2PEHA 1UAWA 1WHVA 5IM0A 2CQ2A 4UQTA 3CCRS 2OSQA 1YHQS 4IOAQ 1YJWS 2G0CA 2JVRA 2DHAA 3I56S 1VC0A 2LKZA 3NNAA 5D77A 1VQOS 2DH9A 2DNKA 3VF0B 2CQBA 2MZJA 4EGLA 1FJCA 1WELA 4W92B 2LEAA 4Y0FA 2FHOB 1VQNS 1VQ5S 1WG5A 2CQ1A 1OPIA 2MGZB 1B7FA 2AYGA 1PO6A 2J0QD 2M4MA 3EGZA 2CPEA 1U1NA 2CJKA 2I38A 3MOJB 2VODA 1SJRA 2RVJA 4FXVA 2LYVA 4U67Q 2BOPA 3G9CA 5DM6Q 2M7SA 3R1HA 4YUDA 2KXNB 1YJNS 3CC7S 1VBZA 3CMES 2MKHA 3IRWP 3CC4S 2M8DB 2YWKA 2J76E 2HGMA 1Q82T 4CH0S 5GMKa 3CC2S 1L3KA 2MQLA 3I55S 2DNZA 2HGLA 5DDOC 2LXIA 2DNYA 1FHTA 5BJRA 3SDEB 3V4MA 3CCVS 2CQ3A 4FXWA 5IQQA 4ERDA 2G4BA 3LQVA 2AD9A 3CF5Q 1HD1A 5CYJA 2GO9A 2MQMA 2RS8A 2CQHA 2F9JA 2LEBA 4F25A 3UWTA 1UFWA 4C4WA 2GHPA 1SJ3P 2DO4A 3VAHA 4J5OA 2L41A 3K0JA 3TYTA 4QPTA 3THTA 3OW2R 1VQKS 2MKKA 1QVFR 4F02A 2MJUA 3VAIA 1VQMS 3J7ZT 3VAJA 1YWXA 3G8SA 2MJNA 1HL6A 2CQ4A 5LXRA 2M88A 2JX2A 1YI2S 2M8HA 1DZ5A 2XS7A 3US5A 2OTJS 3MXHP 1M90T 3JB9k 1U1LA 3UCZP 3S7RA 2KYXA 2DIUA 2XS2A 1U1QA 2MY7A 2DISA 2FC8A 2MZQA 4IO9Q 1X4AA 4PR6A 1KOOA 3CXCR 5DM7Q 2MSSA 1K9MT 2KXFA 3UCGA 1KQSR 2G1DA 2KH9A 1AUDA 1DBDA 3EX7B 1JJHA 2JRSA 2O3DA 3J7YU 2DGXA 4F26A 2QFJA 1A9NB 4C7QA 1M1KT 1X0FA 3CD6S 1WEXA 3NNHA 3CCUS 2DNHA 1YIJS 1N8RT 3BO2A 5HL7Q 2OTLS 1KD1T 3MURP 1X4CA 1FJEB 1U1RA 2MGZA 1X5SA 1JJ4A 1ZZFA 4LMZA 2NLWA 3G4SS 2BZ2A 2X1GA 3PIOQ 3CCQS 1ZH5A 2CPZA 2KM8B 2RS2A 1U6FA 4UY8T 1X4EA 1WF1A 3THPA 4M5DB 2MB0B 2B0GA 2U1AA 1P1TA 2I2YA 2WBRA 2LXUA 1WG1A 1KC8T 3HI9A 1BY9A 2JVOA 5GAEU 1VBXA 3MD3A 1JMTA 1G2EA 2CPJA 2J8AA 5DDRC 1WHXA 2AYMA 4Z2XA 4RU2A 2MZ1A 4P6QA 2M70A 2VOPA 3S6EA 1SXLA 1U1PA 1HA1A 3Q2TC 1UP1A 1S72S 2CQIA 3LPYA 5GADU 3CUNA 3BO4A 4OZ1A 1S79A 5DETA 2E44A 1X4BA 2QEXS 1YTYA 3BO3A 4CH1A 2E5JA 2RQCA 2LMIA 4YOEA 2E5HA 2ZJPQ 2JWNA 2HVZA 2LCWA 1PGZA 2MZRA 3CCSS 4WKRA 1M5OC 2DO0A 1U2FA 3Q2SC 3VAFA 1U1MA 3H2UB 3G8TA 2X1BA 2YTCA 1VQLS 2MPUA 2KFYA 4IUFA 1QM9A 1Q86T 1SJQA 5H1SV 1RKJA 1N52B 5IM0B 3CTRA 1NU4A 1X4GA 3B4DA 2DNNA 3MUMP 1NJIT 3N9UC 2K8GA 2CQDA 4CIOA 2YH0A 1X4DA 1QVGR 1X4FA 4PKDB 1WHYA 2CPFA 2KXHA 1X5OA 1H2UX 1H6KX 5CXTA 2XNRA 4ZKAA 1O0PA 5GAGU 3D2WA 2MQPA 2DGQA 2KRBA 2L08A 1X5PA 2RT3A 3S8SA 2ADCA 2OIHA 2F9DA 3CCJS 4Y00A 2LA6A 3G96A 2M52A 3ZZZA 3UD3P 5ITHA 5LJ3Y 1H2TZ 4BS2A 3EGNA 1RK8A 2CQ0A 4WFNQ 2OJ3A 2DNPA 2MZSA 3PIPQ 2RQ4A 4WFBQ 3UCUP 3NS5A 2DGOA 2DITA 2DNGA 5GVQA 4YB1P 2Q79A 1N88A 5D78A 3VAGA 2ZJQQ 2RU3A 4ED5A 2D9PA 2YKAA 3MDFA 2DK2A 2KM8C 3VAMA 2XSFA 1U1KA 2KU7A 1WG4A 2D9OA 2DIVA 2MY8A 3NS6A 2A3JA 1WTBA 1VQ6S 3P6YC 1F9FA 2KG0A 1WF2A 2OSRA 1X5TA 3ZZYA 4LIRA 4V19X 2LQ5A 1JJ2R 2CPYA 4QU6A 3TO8A 1FXLA 2DGUA 2RNEA 2HZCA 2MMYA 3BEGB 2MXYA 2N3OA 3NMRA 2MQNA 4WFAQ 2CQCA 3G6ES 4W90B 2KHCA 2KI2A 2DHSA 2M0GB 4OZ0A 2X1FA 2RUGA 4PRFA
chains in the Genus database with same CATH superfamily
3M2UA 2VBZA 4LF9J 4ZVUB 3G86A 1CG2A 2WHOA 2EW9A 1Y5LB 2VFRA 1RT1A 3DLLQ 5E5NA 3U1MA 2OPPA 2V94A 2QA1A 4JOUA 3TVYA 1AZSB 1P8GA 3DHWC 2W8LA 2DHXA 4N8OA 3MWBA 3KJNB 5LSOA 3HKZD 4NLXA 4PG6A 5B0DA 3FEZA 5EWFA 5HSPA 4OYPA 3CO9A 3CJ8A 2COLA 3JTOA 3OR2A 5GADI 1Q7YT 2FYXA 4YS2A 1IKXB 4U6PA 2KRRA 1U25A 5KG1A 4M95A 3K89A 3HSZA 5CYQB 4C8YA 3I32A 4CLUA 2YY3A 1U6BA 2E5GA 3MHYA 1RBAA 1Z2ZA 4CT8A 3RBZA 3DXBA 4ECZA 1C4AA 1GFWB 2QL5B 1QUVA 2A2DA 1PYSB 4B02A 2UUBJ 2GAHC 3BJYA 4MMOA 2KJWA 3MEEB 1RTZA 1VRUA 4TU8A 2ROGA 3S01A 2DTJA 2AGOA 1RISA 2POKA 1RAAB 4EYHB 3AAWB 1CQMA 2VOOA 4DQRA 1TKXA 1PAEX 3M6XA 3I0SB 1LWXA 4NA1A 3X1LB 2DH8A 5DG8A 1XIQA 4XPCA 3PRVA 2KVQE 3A4TA 1FDBA 2IA0A 4A8XA 4O4GA 2NZ4A 4ZP8A 2AKWB 1RADB 5HANA 4FF2A 1YJWS 1JLEB 4YHHJ 1XMBA 2Z8QA 1T05B 1QDUB 3GR1A 4ZVEA 3KMSA 4KO0A 1VLOA 4PG4A 1J27A 5E33A 2CVIA 3FDSA 2DYAA 4NYZA 3GR0A 3DU6A 4F4AA 2V9WA 5KT7A 2XZDB 4P9SA 1ZM9A 2NSCA 2QA4G 4U8VA 5CQGA 3HM9A 1S5ZA 5A8KB 3CDAA 3AB4B 2W9AA 2HHHJ 1QY7A 3P96A 2WOMB 4LF7F 5I42A 2GIRA 2Q6CA 2NXNA 1EB0A 2IVMA 2GHPA 3VQSA 3GV8B 4J5OA 2L41A 4QJVA 3N0VA 5H9FJ 2XHCA 3DGPA 3O44A 4WIQA 5KFPA 2MY7A 1SBRA 1NSKL 5DM7Q 1HPZA 4S0MA 4URGA 3QO9B 3UO0A 2EFVA 4P7TA 1JLQB 2W1BA 4ECSA 4TY8B 3FZ2A 4F8RA 4P2MA 1TKDA 2EC2A 1XNRJ 1TL1A 2ZZTA 3CCQS 4USUA 2BJ3A 4MKBA 3A8KA 4Q8FA 2BVZA 3KKFA 1S1XB 2YNIA 2R9LA 3KJFB 3CDUA 2JEJA 1T02A 1NJWA 2B43A 2E5LF 1X31C 2XG8A 1FJGF 1TUWA 2FUG9 4K4YA 5DGBA 1SH3A 2E7WA 2CDRB 4P73A 3RB6A 2VG6B 1TTHB 4X4SA 3CTRA 1S97A 4U7UK 4A8KA 4M5MA 2EFGA 3Q23A 5KFTA 2DXDA 4NXMF 2JSXA 2KXHA 2O01C 4RJVA 2IBOA 5H9EJ 1SVDA 3MZIA 3D2WA 1D1UA 4HTJA 2JEFA 1NK9A 4URQU 2HLTA 2RT3A 3FSXA 3LA0A 2DR5A 3CCJS 2F63A 4EBCA 4NEYA 4MK9A 2R7SA 2BOAA 3DXSX 3NGSA 3MAHA 2RU3A 2W9CB 2FJAB 3MDFA 1U0HB 1PYOB 4KPCA 3CDWA 3VAMA 3T1HJ 1WNEA 5K8MA 2JL9A 1JJCB 5KFEA 4FBTA 2MY8A 3N6LA 2A3JA 1QUPA 1C4CA 1A6LA 3LP2B 3MMCA 2X7IA 4BWMA 3MEGA 3NMAA 3TO8A 2GHVC 3O3LA 3IR6B 4DZDA 2V4JA 1IBLF 5J2NB 2DHSA 1VK3A 2M0GB 2VG7B 1RJJA 1R7IA 3LAKA 4WKYA 3TA2A 2VBXA 3QT7A 4CLYA 2CQGA 4TYBA 1MSWD 3OVSA 1SQEA 1LWEA 3DRPB 4GVLA 1MN9A 2VQFF 3Q8PB 2RRAA 2H5JB 5L39A 5FIIA 4YY3J 2X1AA 2ZUAA 1HBUA 2C2DA 3FC9A 2XGPA 2KT5A 3PW4A 1SKSA 4ZPWR 4N7TA 2HVHA 3ET6A 4WK3A 5AE1A 4BHQA 4WK1A 5IT0A 1J2VA 2V8VA 3MUTP 4C0OC 1AT1B 3NRBA 3HHEA 4B3TF 3BSCA 3DLJA 3T9ZA 4FYXB 3HXMA 3WZ0A 4R5PA 5KG6A 2MKYA 1XR5A 3A13A 3K8VA 3NBPA 1YJUA 4OZNA 3P5TL 5DDPC 3DRYA 1YJ9S 1S48A 5MLCV 3IM9A 2ZWOA 4GVBB 4DMZA 4MKVA 2Q1LA 3I31A 2DGTA 3UD5A 1HD0A 1LK7A 4UOGA 3QZ8A 2NQPA 1Q5YA 2HNZB 2VPXB 4C2MA 3NLCA 4DL0C 4B9NA 2OPSB 4Z7YA 4LVNP 1X60A 4OHXA 4B3OA 2J9CA 1VFJA 3I82A 2ZM6F 4CLTA 5A0YB 4DPOA 4RWXA 3N6NA 2OELA 2Y0BB 3NGKA 1FRXA 5DG7A 4Y2KA 2ACYA 4ZVFA 1TMJA 1JLCB 1HWUA 2V8GA 1SJ4P 1VQPS 1VQ8S 3UD4P 2ZZMA 1EJ7L 3EZUA 5DO2A 3TRGA 1NSPA 2BQRA 2OHDA 4V1Ak 4EGLA 1U24A 2OD4A 1N5SA 1IR0A 1RAEB 2MDAA 4XDCA 3AODA 1H38A 2I38A 2PI4A 2OMLA 3GIRA 3R1HA 2XSJA 4OHZA 4RW9A 4ZJQA 2KXNB 4MYUA 5K5MA 4CLSA 2HGMA 3AB2B 4M5LA 1U0SA 2HIQA 2QLBB 1T94A 1K1SA 1FWLA 3JSBA 1V3SA 1YDLA 9RUBA 3LQVA 3CF5Q 5D0EA 3PYEA 3WBZA 1UFWA 2NXCA 4C4WA 4CLFA 5J1EB 4ZMMA 1CS4A 3OW2R 1QVFR 2KT2A 3VAIA 3EXYA 3J7ZT 1HQUB 1F2HA 4DUZJ 4P71A 3QATA 2DHHA 2BDPA 1U1LA 1HBNB 3S7RA 5J2QA 4ZVGA 4PYDA 2DISA 1X4AA 1YKWA 2VJVA 3OFGA 3ENWA 1F3VA 3KWMA 1Q16B 3PJXA 1RLCL 5KFSA 2DKOB 3PW7A 4USHA 3BR8A 1YIJS 3FKBA 1RDRA 2W4CA 3ZFVA 1NDCA 2V50A 4RW6A 4BWJA 2A18A 5KFCA 1SCJB 4IG3A 4ATNA 2HSEB 1H74A 3AJDA 3PVXA 2H54B 3BR9A 5GAEU 3H40A 3MD3A 5JMNA 3V81B 4W4MA 3GG0A 2ROPA 1FKOB 2XMMA 3DM2A 1K47A 3AXKA 4ANEA 4M5GA 3GCXP 1YRTA 2E5JA 5KFGA 4YOEA 4F3MA 2KDOA 3DLGB 3CCSS 3EDQB 4K4ZA 3GPAA 1UL3A 3LP1B 2XCAA 5HMZA 1FKPA 2VASA 1X4GA 2BKNA 1RGVA 1N5YA 4F7VA 2PFFB 1NK8A 3MR6A 1V6HA 1NHUA 4OLOA 1SIWB 2KRBA 2YQ1A 4HKQA 4HYKA 1MWQA 1NLKL 3SQOP 2BA9A 5KT4A 4DR4F 3HPOA 2MZSA 2HS4A 4DG1B 2FB0A 1N88A 1SV5A 3MAAA 2OH2A 4ZN1A 1L3UA 2DK2A 4KH0B 4WXOA 3ZTQA 4IH5A 1R0AA 3FQLA 1A0OB 3MFIA 3P6YC 2ZNZA 1HR0J 3ENQA 1DLOB 4UQGA 4NLOA 1WC5A 3NS7B 1S57A 3RJMB 1M1HA 2PI5A 4I69A 2RUGA 4L73A 2D3OR 1W2IA 3UDCA 4USJC 1ZZNA 4H54A 2R8IA 1CVJA 3UE2A 5HBMA 4KC5A 3CJ4A 3LAMA 4B3SF 2X3GA 1RACB 1IKWB 2GJ2A 4L75A 2GQQA 4Q5VA 1TP7A 1B3TA 3SDEA 1J5OA 2LQJA 4OV1A 3WIVA 3TAMB 2V2KA 4UOCA 4WE1B 2MKJA 4GRSA 3FRZA 2UP1A 2JJ4D 4IFVA 3CCMS 5SUHA 3EVWA 2UXCJ 1XMQJ 3I5CA 1LV5A 1JLFB 2FDNA 2ZOGA 1CJVB 2HQIA 1RWNB 3OVAA 1MG7A 3WX8A 4X4OA 4N47A 2B4OA 2KYZA 4ED0A 1V5IB 2DNLA 4RKUC 4DWIA 3UNYA 4PZVA 4N41A 2FZCB 2HWIA 2W01A 2VPYB 1L3SA 5CCMA 4HLBA 5I4MA 4DV7F 1QE1A 4LF5F 3HFZB 2YNFB 3OL9A 1KHWA 4M5DA 4NLUA 1VQ7S 3OHAA 2ZH4A 4R25A 2EPIA 1JNRB 1JLGB 2X3DA 4N77A 3OUYB 3KK3A 1N34F 2ACMA 2IDLA 4HVZA 4F4WA 1VK8A 1FWPA 5ETMA 4QU7A 3D1OA 2LFVA 3SIPB 3KLGB 3VWSA 3CMAS 3IWNC 3MM5B 3QLHA 5KFRA 1YRXA 5KTQA 3SFGA 4G6VB 1UFLA 2W25A 1WDDA 1JLBA 2G1HA 4GMKA 2L9NA 3I56S 6FD1A 3IFEA 1Q78A 1SB6A 2F8HA 1VHFA 1P1LA 1OPIA 2HNYA 4EWTA 2LXFA 2ZBPA 1U1NA 2AX1A 1R6VA 4GO5X 2CJAA 5DLFA 1ZM2A 2QLFB 1YJNS 1LW2B 2MKHA 4ALZA 2FHJA 1JLAB 2MQLA 3A3NB 3PX4A 3F0NA 1FHTA 4DR6J 3RAMA 1C2PA 2ATLA 4CNZA 2Y1IA 3U1NA 2IRYA 3DHXA 2LEBA 2UXBJ 3UWTA 3DI6A 3HHKA 4LSZB 3C6TA 3VAJA 1YWXA 2JX2A 3JQKA 3MXHP 5F0WA 4K0KJ 4M5KA 4RUAA 4PR6A 3Q8SB 5ETTA 2NPIA 1FE0A 4IH7A 1AZSA 1S6PA 4X66F 1X0FA 3CD6S 4KGXB 1X4CA 1U1RA 2XMVA 3MGJA 5K14A 1R8BA 5C42A 1FDDA 2YX7A 4UY8T 2XWYA 4LF9F 1IKXA 3GIKA 1WG1A 1SQGA 3FZBA 4NMLA 4AXJA 1S79A 5DGAA 5HATA 4CYUB 4JI1J 2QT7A 2ZH9A 3GE9A 2UUWA 2XGQA 4B9TA 3HT3A 3Q2SC 1EP4B 2EEYA 4JV1A 2BANB 1MU2B 1DJ0A 3KTQA 2FVCA 3MEEA 1RHMB 2E1MC 3SSSA 5KAKA 4X4PA 2V8DA 3NY0A 2ZEJA 2WVEA 4MK8A 1FRIA 1T9VA 2EG1A 4EUVA 3A3OB 4LIWA 1IWGA 1O0PA 1U4BA 2AWZA 4PEOA 5HMWA 2LA6A 1ZAVA 3DKDA 3ITHB 2JDJA 3QFHA 2DCUB 1S9EA 2DNGA 4N76A 4P72A 2R8HA 3MEDB 1B0PA 3H5YA 1T05A 4HT5A 4AUKA 4ID5B 4XIUA 2XM3A 1PSDA 3V6JA 1U09A 2RNEA 4C3MA 3KLIB 4CLZA 4KKOA 5A2QU 1PAUB 2KHCA 4ZCLA 2J5AA 3BV8A 2LQ9A 4PWWA 2W8KA 3K59A 5U47A 3C3LA 3OL6A 4DR3J 2XY7A 2BABA 3QWPA 4OX7A 4O44A 2PO4A 2QLXA 1FT8A 3D28A 4ECXA 3KK2B 2NXEA 1LFPA 4DCPB 1W2BR 4JI3J 2C3PA 5D4NA 2XLIA 3GJRB 2R2SA 2F3JA 2UUCJ 2X51A 3H4DA 3GIMA 2K7JA 3BB5A 2DH7A 4IOCQ 1QAIA 2MYFA 4O0NA 2QGFB 4F0HA 4OL8A 3TX8A 2F1FA 5BR8F 2KB2A 4Y28C 3BSAA 1EQMA 2XO7A 4DFMA 2R3VA 1JB0C 1U49A 2ADBA 3FEXB 2HHHF 1AW0A 1P27B 1VC6A 1FCAA 1O8BA 4DV4J 1NAQA 2WVFA 1C0UB 4F67A 1VRQC 3GYNA 1S1VB 5DLGA 4B9VA 3NOGA 4X4UA 4ECUA 4OHYA 3IR5B 3IS9B 3RAXA 3DU5A 1YITS 1FFWB 3CJTA 3SZ2A 4JV0A 4KIAA 1N6QB 2HHVA 1GT8A 3D1QA 3T1AA 3TUZC 3F44A 2K1RA 1PJ6A 2EKNA 1WHWA 4CO3A 2FY1A 3LGMA 3UDLA 4O0IA 2NCKL 2CQ2A 3D4JA 2F40A 3BZQA 4U7CA 3H98A 3SCLE 2JVRA 4C97A 1S6QB 2QX0A 2BX6A 1VQ5S 4M8LA 4DOZA 2WVDA 2FJBB 2VL1A 1DTQA 1T7PA 4N8NA 4QPXA 1ZM4A 3MOJB 2P6SA 5ETVA 1TKTB 5IWAF 4HHHA 4M5NA 2OUGA 3CMES 3MM6B 2UZAA 5KG4A 5D0RA 3IRXB 4PG8A 2DNZA 3GFHA 5LOQA 3JQJA 3QSYB 1KDNA 4I0WA 3M7VA 3HJFA 3PEJA 3EVMA 2CQHA 2DEJA 2ATCB 2WVBA 4F25A 2O1PA 1FA0A 2DO4A 1FE4A 4LBHA 4F02A 3D0GE 3JAMY 2OTJS 4IQMA 3R7SB 4UW2A 2BBEA 2HNDB 3BSNA 1NM2A 3DRPA 2DIUA 1K44A 2MZQA 4FYYB 4K4XA 2JLEA 3T1HF 5E3QA 2I6WA 3Q86A 1M1KT 3Q24A 4KE5A 1HYSA 5HL7Q 1UJ4A 2E1CA 2UU9F 3BBCA 2HFSA 1WF1A 3THPA 3J7Z5 5IT9Y 5HROA 2JH3A 3C14A 1G2EA 2J8AA 4ECRA 3SQGA 4CM0A 2PA8D 3UVJA 4YY3F 1UP1A 2R2UA 2E44A 3TQEA 4CH1A 1HNIB 3RR7A 5D0GA 1S59A 2C3OA 4HDGA 4WJBA 4XAKA 1PGZA 2MZRA 1FERA 2QJ3A 4QOTA 2DO0A 2IJRA 1LWCB 3I4PA 4FNIA 1Q86T 2JFDA 1AUSL 3E01A 1FRLA 1X7VA 3JTNA 2C1EB 1RT5A 3NWRA 1K0TA 2OPSA 3UN3A 2MLYA 1S0OA 5T7LA 3Q8UA 1IBMJ 4I2QB 2OIHA 2FVQA 5AE3A 2VUGA 2B9YA 2VU5A 1H2TZ 4BS2A 1BWEA 1RK8A 2DNPA 3UI3A 3GQCA 2QTWA 1JLCA 3NS5A 3HFVA 1NHVA 2Q3PA 2IBKA 3M32A 2D9OA 4PPZA 1VQ6S 1TUGB 3RYLA 3KUGA 1XEZA 2NYHA 2IAJB 2LQ5A 2Y1RI 3W2WA 3D6MB 2FTRA 4OYBA 5CYMA 3BEGB 2UXDJ 3T5JA 5MAOA 3G6ES 1R43A 4DR2J 2XYHB 3P8BB 1RTJA 4Q2MA 1KQFB 3IAM9 1PBUA 4WXWA 3G6VA 1IKYB 3K5OA 1LW0B 5A8WB 1U2RA 2F4VJ 2OGUA 3BF4A 1WI6A 5FDLA 4OZ2A 4CCHA 5C25B 1QSYA 2I5JA 1MROB 1RTIB 2XY5A 3G2XA 1H3DA 2GIQA 8ATCB 3D6FB 3HHLC 4TLQA 2AJQA 2DHGA 2BUNA 4L72B 1LKZA 3W3SA 3C16B 5HN0A 1HQUA 1BUXA 3PX0A 1S1TB 4FPIA 5KOXA 2VFUA 2KZZA 1HBNA 3JSMA 1UW4A 4NLQA 1OWXA 3R9LA 5IC4B 2QE5A 2J6UA 4DV2J 4J9KA 5B09A 2XZWA 2P5VA 3M05A 4DDFA 2J0SD 3I9V9 1N33J 1ELOA 3FVYA 2YKNB 3MM9B 1OIAA 1MWZA 5GAGI 2OP5A 4K5SA 4ZVHA 2GZOA 3RR8A 2XWXA 1HQEB 1TELA 2ZVIA 4CDIA 1JKHB 3WC2A 3FJ2A 4DS5A 3R1LA 4OYMA 4CQ1A 2UVVA 2HHTA 1NJZA 4ZHRB 1JXLA 5A76A 1XTZA 1NK4A 2JEIA 1KEKA 5HI7A 2J8SA 3IMQJ 4KB7A 1FNOA 3LP0B 1VRTA 3DRSA 1UAWA 2CG4A 2OSQA 3H2LA 4DF8A 3Q8YA 4RPFA 7FDRA 3EPGA 2DH9A 2DNKA 2W2NP 1DTTB 2PFDA 3AQOA 1Y5NB 3Q0AA 4ZP6A 1S9FA 4ANCA 1H7XA 3AOAA 3MM7A 1LWFA 2V67A 2BOPA 3LH2S 2ASJA 2M7SA 3DLEA 3QPIA 1D9DA 4OHWA 4PCQA 2MQ8A 1S10A 1F5AA 4X4NA 1RTHA 5DQGA 2IM0A 1WOSA 1JXVA 3HP6A 1DLOA 1Y11A 4MFBA 3PZPA 1DURA 1FI4A 3OHBA 4C3LA 1NZAA 4KQZA 2V9KA 3FBFA 1VQKS 5H9EK 4IKAA 3G6XA 3M8ZA 2MJNA 4DQQA 1RAIB 5L46A 1Y4ZB 2M8HA 1YZ7A 2EG2A 2Y1JA 2KYXA 4DS4A 3PFEA 1FK9A 1FWKA 1XMOF 4OJ3A 3RG6A 1P6TA 1K9MT 1OJ4A 3K2YA 1RBLA 3CEDA 4ZA1A 4NLRA 5F8MA 4ED2A 2V68A 2AQ4A 1KFSA 2AGQA 1JJ4A 3UW1A 5EDWA 2X1GA 3PIOQ 1WJ9A 2B0GA 4I4BA 4OX8A 5L9XA 4JI2J 3AHPA 1VBXA 4AFFA 2J9EA 4M5IA 1WHXA 1U48A 1R0BG 3KK1A 5KFWA 5KT6A 1GMVA 1RWOB 3V6DB 1NPPA 4OZ1A 1WSVA 4U9RA 2IC3B 3UPFA 2HS3A 2ILYA 4WZMA 2EI5A 2ZBRA 4ECWA 4BDPA 4L74A 2HFVA 3OJSA 3G6YA 5HQLA 3M8WA 3FGVA 3DOLB 4UY85 4LF2A 2UXCF 3BGFA 4F0KA 4XK8C 1XMQF 4Y2MA 3HHLB 4DL2A 4DQIA 1ICEB 2YBVA 2DPIA 1UTAA 4HTIA 1KVJA 4Y00A 1ITPA 1S9GA 3EZ5A 1AA1B 5C5JA 1RT2B 3W61A 1UVJA 2RQ4A 2I9SA 4JI8J 1SL2A 3T9NA 4DHVA 3LWMA 3CD0A 1RWPB 3F73A 2WONA 3K17A 1UWBA 3AT1B 2NSBA 4KTQA 3DCAA 3MM8B 3WHIA 2GCFA 4NLWA 4AYBD 1WTBA 3PG9A 1QSLA 4LUBA 1RU1A 4IR1A 3FFIB 4RW8B 3BQ1A 3JS9A 2NXJA 1S1WB 4NEZA 4P2SA 4DF4A 3NGRA 2QMUB 3PFOA 2DGUA 3K58A 3BQ0A 4NYPA 3N6MA 1E6YB 4C8ZA 2BJEA 4ZCMA 1MNEA 3P3DA 1LW2A 2BMBA 3M8SA 1TAUA 4I7FA 2ALYB 1RABB 1WEYA 3EDRB 2N7CA 3CDEA 2I1RA 1HW8A 4ZK7M 1SJFA 2MHEA 3W9IA 1OMSA 2R8JA 2HHPA 4XDDA 5DQHA 3IN5A 5KFJA 1VHIA 2KN4A 4IRKA 2DNRA 1CQNA 2CNOB 3UQSA 2NUHA 2E9TA 2GO8A 2EKYA 1K0VA 2G2OA 1KLMB 2NXUA 1X4HA 4LFCJ 2J7UA 1ZYQA 2Q66A 2H48B 4LR8A 2HQCA 1E6VA 4KFBA 4OYOA 4DR6F 2LQ8A 3R5GA 2UXBF 1IJFB 3FK4A 3M30B 5IZHA 4KY3A 4OYWA 2HGNA 5K8NA 4NA3A 4D3GA 3PW5A 1O6XA 2HFZA 1G3OA 2K3KA 3IP0A 3MEKA 4K0KF 2ZH3A 4B9MA 4KHRA 2JHEA 3PKMA 4J9SA 1HNXJ 5F0UA 1F6TA 1GXUA 1T9TA 5JJBA 3OFFA 4DFPA 4J9NA 4PPDA 5ETQA 1RBOB 2BRKA 2VFTA 3KLFA 3IG1A 4TKTA 3EE3A 3O1LA 5CH7B 3W5YA 4FYVB 4M94A 1IM4A 5I3UA 2CADA 1RLDA 2ZVSA 3RBDA 1SC3B 4ZCIA 1LNQA 1F60B 4GC7A 1I5OB 4JI1F 3D6TB 2C2MB 3NGTA 5KG3A 1SJRA 5DM6Q 3TJ8A 2W2PP 2VBYA 4F4XA 1FTCA 2FLLA 5DS7A 4CLWA 2B51A 4ZPDA 3MEDA 2YNHB 2HGLA 5DDOC 3EXCX 2XLJA 2IHR1 4JI0J 5A2QY 2UUAJ 4ID5A 2E66A 2QSWA 1R31A 3HD2A 3BH7B 2YKMA 1VQMS 4RX6A 3M2VA 3IBCB 3BYPA 3SI8A 1NZ8A 3W7BA 5CABA 3OVBA 2YWFA 1YI2S 3ZZRA 1HBMB 4P2XA 2B7CB 4OI3A 4V19J 3AA8A 5LSRA 2W24A 4IYQA 3KK2A 3UCGA 2JRSA 5M2RA 3IBWA 3MPYA 3NNHA 4DPYA 1WC6A 1OS5A 3SCIE 2QMWA 5A8RB 1P1TA 3LWLA 4JI6J 4DR3F 1CEZA 4EU0A 2G9OA 2AYMA 1HWIA 3CE8A 1ZS6A 1HA1A 4LF6J 1L3TA 5CD4A 3W9HA 4FVCA 4USTA 2E5HA 2RF2A 4I2PA 1RKIA 4QIGA 4JI3F 2WAQD 3SYZA 3NCQA 2UUCF 3AJ1A 1S1VA 3KUEA 1RYRA 4IUFA 3DRRA 2ZHAA 3RU0A 3GFXA 3BN4A 2Z56B 2V4QA 4K4UA 1F9HA 4PWDA 3N9UC 1D8YA 4DI6A 2V8HA 1HHQA 3TZZA 4J9MA 1ROFA 4WP3A 4ZS6A 3CD5A 4KGZB 4IFYB 1GMWD 5D15A 4IG0B 2GV1A 1VDHA 3CJ5A 4WTOB 1UZHA 3TANA 2YNGA 4X84A 3BKTA 3ZZZA 2Y9HA 4DV4F 4F4ZA 2FVPA 4OLPA 5HQMA 3MMJA 2HRTA 3ZTRA 2LU2A 3K57A 3TZWA 3K5LA 3T19A 4DUYJ 4KV8B 4F04B 1RT4B 2DIVA 3IAS9 1F9FA 5M2UA 2G0JA 4I67A 2CPYA 4DPUA 3RB3A 4A46A 5LMNJ 1ZAWA 3QAEA 4YB7A 1PCAA 5E7OB 3BGLA 4NOHA 2OPRB 2MQQA 2B9WA 4EBEA 4RW7A 3D3CJ 4QYZJ 3IRXA 5EN1A 2GS8A 2VH7A 2J0WA 1RCXB 2BJDA 3TP2A 5J2MA 5HK4A 2PT0A 2PEBA 3EPIA 2CXEA 3TAPA 1SC4B 1QAXA 1F5BA 2RD5C 4K7QA 3D0IE 4YDXA 2HFOA 3WIUA 2RKIA 3SMZA 3GYGA 2QYCA 2FC9A 3RRHA 3E2EA 2DNOA 4EEYA 1RAJA 3TAQA 1Y7PA 3LOUA 2VA2A 2PD1A 3MTJA 1VCTA 3GSDA 2IVFB 1EETA 3K5NA 2JOQA 4OZ3A 5HVHA 5DRKA 2GVZA 2AF6A 1SUQB 6FDRA 3EYZA 2PMWA 2JFKA 1HNZJ 1S76D 4ZPCA 2AYEA 2O5DA 4DV6F 1BQMA 3KLEB 5B0EA 1FF2A 4MJKA 1J5EJ 2Z4PA 3G87A 4TNOA 2RDDA 3T5LA 5L8RC 1BGXT 3C19A 3FSIA 2Z2MA 2XC9A 1S7HA 4LFBJ 1D09B 1RHUB 2YX4A 2ZBQA 1K73T 3D9BA 1N5VA 4USKA 2IMOA 4CI0B 3BPDA 2AX0A 4ECVA 1YHQS 2H4WB 1ZAXA 1C0TB 1RWKB 2BKOA 1NDKA 3S1TA 1I6JA 1FJCA 3TNVA 1WELA 3ZZTA 4KJIA 2Y8YA 3R6GB 3THVA 4DL5A 3CCTA 4DQPA 3I5AA 3DDIA 2DR8A 1YRUA 2BYCA 4QCLA 4H4KA 4DV1J 3OBIA 4DXLA 3WC0A 2E29A 2A0FB 1NSQA 2LXIA 2MEWA 1S1UB 4CTAB 5M2PA 2KKHA 3ADAC 4RBVA 1LOUA 4J9LA 3QIPA 3M2RB 1XJWB 3QGIA 3BQ2A 1IBMF 3GFYA 1GXTA 3MMAA 4QPTA 3KJVA 3KDOA 3KG0A 1Y00A 3FUYA 3JB9k 1IKYA 3VVUA 2WVCA 4NI2B 1S49A 3PY8A 2HBQB 4PUOB 1KQSR 2G1DA 1TK0A 1SPBP 5C25A 1N36J 1A9NB 1MROA 1PC4A 1OY8A 3TVZA 2N4CA 3KHHA 3FMBA 1Q53A 2HVEA 3ETOA 2MGZA 2UXDF 3DOKB 2RJZA 2GMJA 1IR1A 2YKPA 4DR2F 1IBKJ 1K1QA 3C16A 3IBFB 2ZH2A 3IR7B 3N01A 1KFDA 2H5IB 3P5BP 5JUMA 5ETLA 2PA3A 3SSQA 3C8YA 4I6WA 3JSYA 1JNZB 1Z1ZA 3Q8QB 2F4VF 4ZLLA 2ROEA 3DFEA 2CQIA 1FVSA 1X4BA 1YTYA 3C66A 3NEKA 4KH1B 2M3DA 4LBPA 1VI7A 4DCJB 4Y2IA 1RT1B 2ZC4A 1SJQA 4I1TA 1RP5A 4C98A 4I6YA 2IRXA 3G82A 2R7WA 3QJPA 4CLLA 1HLWA 4HH0A 2K8GA 2OPPB 1WKLA 5DZ6A 1TL7A 1QVGR 4Y2AA 4K2JA 1TL3A 4EO8A 4DSKA 3TJAA 1H6KX 2CZ9A 4J37A 2XNRA 2C2OB 2VFVA 4CNYA 4EBDA 1FDAA 4DV2F 1HBOA 1NBEB 3GB0A 4FN5A 2DBBA 2HHQA 4PG7A 2CQ0A 1CJTA 1N33F 4NE9C 4YB5A 2NZCA 4RW4B 3PV8A 2HW3A 3C2PA 2Y0SD 5D78A 4DLGA 3J7AN 2C22A 3VGUA 2Z2LA 2E9RX 5BYSA 2D9PA 1RT7B 4OFZA 3ZZYA 3CT9A 2GW8A 1KQKA 4FKXA 3LALA 4PYAA 4ENOA 2N3OA 1VRUB 2MQNA 3M1VA 4W90B 2KI2A 4ED6A 5C2GA 1GTHA 4OX9J 1DHMA 3B82A 2HMIA 3NWGA 3GWCA 5IC6B 2BEFA 2PE8A 3J7YI 2OLWA 2DXFA 4DR7F 4YDDB 3QGHA 1F3FA 1JWWA 5L9NA 1FEEA 1XQIA 3G71S 1PKUA 3ZC4A 4J9UE 3OPKA 2ALZA 1XN9A 1U02A 1M5HA 1B4SA 2E5IA 3NNCA 5C24A 1VBYA 4O4GB 2FZKB 3K5MA 1Q8LA 2GGPA 3CDBA 3ZZPA 2IVYA 2OEJA 4RUCA 1M0SA 3QBCA 4B3MJ 3BM7A 2QRRA 1D9AA 1RQ0A 4O3NA 2Q43A 3D3BJ 2OEKA 4K59A 2QL7B 3ULHA 4KR0B 4LRAA 2Y8WA 4PQUA 1BXNA 2EK1A 2DD8S 3FBCA 3TUPA 1TKZA 4NWBA 1YJVA 2ZH1A 3OLBA 4DR1J 4E98A 3I5BA 3L7PA 2L9WA 2NYIA 1HNVB 2AJ0A 3M9NB 2CQPA 3DRXA 3RW6A 5I42B 1CJUA 1CLFA 1Y3KA 1RHJB 3DLKA 2MKIA 4Q43A 4TQSA 2QC3A 4JBCA 3EZOA 2B4UA 3R6LB 4FZVA 2IC3A 1G1XA 4K4SA 1REGX 3DGPB 5EUHA 2DRBA 1N0VC 1B0TA 4DFJA 1OQ6A 2A6MA 2UV8G 1HPZB 1Q8KA 4UOHA 3M8QA 3KNGA 3KHRA 1FFSB 2B7BB 4OYXA 2LEAA 1VQNS 4OYZA 2HBZB 3MPUB 2CPEA 1TL1B 1APSA 1FKAF 2B3TB 1VBZA 3IRWP 1V3ZA 3N79A 2M8DB 5KFNA 3QT5A 4CH0S 2FJDB 3C15B 1VGYA 1RAHB 4X4TA 2DNYA 1TUVA 3A12A 2OEMA 3MM8A 3ZZOA 4QZVB 1REVA 2QA2A 1HD1A 2MQMA 4RW8A 1B99A 4ILMA 3TOQA 1SJ3P 3V5RA 1HHSA 1NXIA 3K0JA 2GVDA 2MJUA 1TFWA 3QAUA 3CJQA 2CDQA 4NRUA 2Z30B 2CQ4A 2PDAA 4JI8F 3CGIA 1M90T 2AZ3A 3ZNUA 2BJ1A 3EMTA 1Z2LA 1NKEA 4DPWA 2F4FA 2MSSA 1L3VA 2P8IA 4DPXA 4YN3B 4J9VA 5F8LA 4C3KA 3QJJA 8AT1B 1FJEB 3GILA 4C0HA 2C3YA 4G65A 2XY6A 2BZ2A 2RS2A 2IA6A 3E8OA 2CG8A 4C8KA 1R6YA 2I2YA 2WBRA 3PCOB 4M63A 1JMTA 4Y6IA 3MMCB 2XI2A 3H5XA 3MEGB 2RILA 2KHDA 4WBFA 5KT2A 1GTEA 4R0JA 2V4JB 3BO3A 1NSAA 2RQCA 3PX6A 4ZVPB 3QJLA 4OJGA 4M5JA 1BHNA 3DLBA 2YTCA 5FLXU 3M30A 5L1KA 2IYIA 4ZJOA 1LWEB 4CP5A 3AQPA 4I56A 4B3TJ 3DMJA 1NH7A 3ETMA 5BXIA 4WYLA 3GLJA 4NL5A 2P2CB 4NMXA 4DU7A 4LFCF 1FRMA 3J81U 4AL7A 1PYTA 2HQDA 2DGQA 5ETKA 5KFBA 5G0RA 1X5PA 3N4WA 2F9DA 2H65B 3ET6B 1QTMA 1VR6A 3EGNA 4IDKA 3H20A 3K5PA 1HWKA 5I3PA 1FXDA 2RUSA 4ZPAA 4WWSA 2Q79A 4QWAA 3W1YC 3BGUA 4JV5J 4UOFA 1UZDA 2XSFA 4R5PB 2P6TA 4C6AA 3NBPB 1KWMA 2CAJA 2LU1A 1WF2A 3QGGA 4P74A 1ZPVA 3RZAA 4QU6A 5E3CA 2HZCA 4ES2A 1RWVB 1HNXF 4F3QA 4H4OB 3H7HB 1UVMA 1GXLA 4QYRA 4Q2LA 3PW2A 4TU9A 2ZHBA 2CWXA 3RBEA 4HH1A 4WTYA 4B3OB 4X4QA 4BLGA 4Y3CA 4HHUA 1IBCB 2E7VA 3Q83A 1CULA 3H42A 3HVAA 3R5CA 2AW0A 1SL0A 3CJSA 1W7WA 4ZITA 1GK8A 2ERRA 5KG5A 1IQTA 2YWEA 2ZKTA 1VMBA 4RNHA 4HI1A 4I64A 3AOCA 4Q7AA 5B0GA 1ZOTA 5GAHU 3MECA 5K8OA 2UVRA 1RWUA 5HLFA 2R7UA 1WDTA 1NJXA 3M8RA 1LXJA 2ZJRQ 2C2KB 4JI0F 3U02A 4DEZA 1RAOA 2UUAF 3PTWA 2J7KA 3CWJA 3M6VA 2OMOA 2XSJB 4MIWA 4RW9B 1I51B 2WCXA 4X4RA 2WRMA 3HT0A 2VA3A 1KRPA 2VFSA 2PIIA 4Z37A 1A7GE 1N54B 1LXNA 2M2BA 1OO0B 2DGVA 2G0IA 1CS4B 3GP9A 3C6UA 5F8GA 1YX2A 2GHWA 3LUYA 3DYAA 1FXRA 3JYTA 1R8PA 3I0RB 4OX6A 5J2QB 5K8PA 1GH8A 2FD2A 4WFYA 3T3FA 1UVIA 5THWA 4WPAA 4O3PA 5F8IA 2AMCB 4JI6F 3D7SB 2AT1B 4O3SA 4LF6F 1FTRA 3DOMA 1PO6A 3O8WA 2J0QD 2HVDA 4RW6B 1NEEA 4IG3B 1EKSA 3R8YA 3T6JA 5HVGA 1HI1A 1TVRA 2C2ZB 1T03A 2DVIA 4B9UA 2DCLA 3DM2B 3I55S 2ZD1A 2VICA 4A8QA 2CZVC 2HK2A 3SCJE 4DR4J 5F3ZA 3GJSB 2AJ2A 3OV7A 4F4KA 2G4BA 3DDNA 1CJKB 1I1GA 1G6BA 2QZ8A 5A6WA 2RSQA 1SL1A 1UCNA 4MYTA 3AOBA 3HVTA 3GIIA 1N5YB 1B64A 2H5EA 3US5A 5EX3A 2UVUA 2HURA 1D0EA 3B6BA 3UCZP 2VG5A 1U1QA 2C2RA 2WB1D 1BE4A 2FC8A 3RBXA 4ZIVA 3BDPA 4DUYF 3F56A 1WD6A 2FJEB 2KXFA 1DBDA 1QJHA 3EX7B 4F26A 2VKRA 3D66A 4J91A 1WEXA 3OTOJ 3A1YG 3M8PA 5A6PA 5T41A 4XO0A 3MAAB 4PQAA 8RUCA 1YZ6A 4RNOA 1GMWA 2B6AB 4YR3A 1R0AB 2U1AA 1U2CA 4OI2A 4O3OA 5DDRC 4Z2XA 2MZ1A 3AH6A 3RRGA 3VQTA 5GADU 4CO5A 4NCGA 2QLJB 4BC7A 4RL1A 5CHCB 4ZLPA 5KG7A 4FPRA 3RB0A 2XMAA 1RWXB 5ETNA 3WX4A 5HBMB 1NUEA 4Q8EA 1VYAA 3KLEA 3I87A 3MUMP 1S6UA 2CQDA 4DN0A 2W2OP 4A48A 1X4DA 4ETXA 9ATCB 3Q8RB 1AYEA 3HF5A 1RZMA 1NHKL 2FHKA 5HVFA 4KGKA 1T9XA 4ZKAA 5J2PA 1FX2A 2MQPA 2L08A 5IT4A 4DV7J 4XPEA 4DV3J 4HHJA 4LF5J 4G1QB 3HSDA 3TZXA 2R2TA 1FVQA 1HNZF 5GVQA 4YP3A 3VAGA 1NDPA 1NRKA 2WSEC 2HQGA 1J5EF 1ZM3A 4RZRA 3EVOA 1WACA 4DSIA 4WP8A 5CCLA 2OSRA 1YBTA 1RHKB 4F2SA 3V4IB 4DUTA 2GMHA 2MMYA 2IPOB 3NMRA 3SFUA 1QE1B 3F41A 5HMXA 2RRNA 1L5UA 4PRFA 4LSNA 2QSFA 4NX9A 1RAGB 2DGSA 2HQ3A 2PN6A 5KFMA 3KK3B 4E8UA 3T1YJ 4IOBA 2HHXA 2XS5A 2F8EX 1GQEA 4LJMA 1S1UA 4CTAA 2XYPB 3R2CJ 3T5HA 3MI7X 5GAEI 3RAQA 1FO1A 3H5SA 4F0MA 3B54A 2ZE2A 4ZPTR 5KFYA 4K2XA 2FHMA 3SXLA 2FLNA 1JIHA 4OYIA 2NUUG 4DX6A 4PABA 3FRYA 1U1OA 4NI2A 4AQYJ 4DV1F 2HNYB 4FYDA 3D1HA 3CJKA 3SV3A 3KNAA 1QD1A 3MPDA 4A8MP 3TA1A 3OFHA 1N4LA 2A1BA 2Q6BA 2DR9A 3POTB 1NK5A 2CPHA 1SKRA 1VQYA 1IM6A 3UDEA 3MMBB 1R8HA 1JQGA 4O23A 1BMQB 5HJXA 4MKAA 2AZ1A 3ICLA 2BJ8A 4RNMA 1RA6A 2LECA 2MHNA 1FX4A 5CA5A 3VTIA 3MUVP 4PG5A 5LM7E 2R2RA 2KVIA 3DI6B 3C46A 1ZA2B 2MSTA 1N36F 5E3RA 3C6TB 2XMJA 1XR6A 3CJRA 4B9SA 2VPWB 2MKCA 3OXFA 4QBUA 4DSFA 3DNCA 3U27A 4K4VA 2OPQB 1IBKF 2HAIA 1AFIA 1UVLA 1XERA 2ZDPA 1VC0A 3NNAA 1V5VA 1S6PB 3VF0B 2CQBA 2MZJA 3AFGA 2CYYA 2DXEA 5CYQA 1R89A 4DL6A 5DG9A 2AYGA 2BV3A 2M4MA 5K14B 5C42B 1S99A 2VC1A 4K50A 1NPKA 3PJ9A 4J9PA 2D1CA 3BSOA 4LFAJ 4G1IA 5EHHA 2ASDA 1IUJA 2RDIA 3CC7S 4RW4A 2YWKA 1Q82T 3AD8C 2VIHA 2VV5A 3V4MA 2OI2A 2CQ3A 4C11B 1RT7A 4FF1A 2W7OA 5K9FA 4LF8J 3I0SA 3MPVA 3T5KA 2D3ZA 2LP4A 2HWHA 2LDYA 5AXNA 3THTA 1ACMB 2B56A 2MKKA 1SQFA 3H59A 1NK0A 3CCZA 2Z57B 4DU8A 2UUBF 1Y10A 2M88A 4X62J 2ABYA 3PW0A 2BR0A 5KFAA 2LQBA 3MPWA 4IO9Q 3B78A 4JV2A 1JLEA 3RGIA 2C42A 3CCWA 2WBMA 1SKWA 1S9EB 1KD1T 2GA7A 3G4SS 2CPZA 4OI4A 1TR0A 1HMVB 3D0HE 4OX9F 4ZLNA 1UEKA 3ENVA 2HZVA 5E2QA 5A8KA 4RU2A 5KT3A 3S6EA 5KFXA 1Q0NA 1SXLA 4CH7A 4YHHF 4ELTA 5DETA 4KKOB 2N7YA 4QYZK 2WOMA 4LQ9A 5BR8J 3HULA 2JEGA 2KFYA 3K8WA 4NA2A 1MMDA 3BKUA 4O44B 4LRFA 2HHUA 1HNVA 4NCAA 1ULRA 1X4FA 4PKDB 2QIFA 4B3MF 5F9NA 2CA9A 5HP1B 1G7CB 4ELUA 5KFLA 4A47A 2HPUA 2LLZA 4C9DA 5HMYA 3VHQA 1MW7A 4E2FB 4X64J 3QO9A 2VB6A 5B08A 4RNFA 1JLQA 4TY8A 4EK2A 1KQGB 3PIPQ 2H51B 4DR1F 5AXKA 1S4EA 3NCPA 1WC0A 1F0XA 3MFHA 4WFXA 1U1KA 3LGNA 2XTJP 4CLKA 3SV4A 1S1XA 4LIRA 2QFIA 4ZVTB 1Q8IA 3OQ2A 1FXLA 1Z4UA 2RQMA 3BBBA 3OTDA 4IH6A 3HZEA 2OD6A 3B8HA 4IRDA 4RBTA 2RRBA 2BM0A 2YQ3A 1S0VA 1GAOA 2HRUA 1XNRF 2VG6A 2BRLA 5J1NA 2H9ZA 3QRRA 1F2GA 1TAQA 2UUTA 3C15A 4GC6A 2K1RB 3HLUA 3A8EA 2ZDOA 1KN6A 5KFOA 2CJ9A 4GO7X 2DB1A 4OQJA 5KT5A 5IWAJ 2HFNA 5T14A 3VGSA 1HHTP 2CZ4A 1WOOA 2ZH5A 5L1IA 3TEHB 2VDHA 1C1BB 1T9YA 1VS3A 4DFKA 1WTFA 1GMUA 1FJ7A 4NLGA 1MN7A 3Q22A 2YH1A 2AYBA 1H0HB 1U6ZA 3IXQA 3RW7A 3R27A 1VOMA 2W9CA 4USVA 1U0HA 2XYGB 4F50A 2XQCA 1DTQB 2GQCA 3D68A 2KO1A 3MTKA 1FRJA 2MQOA 3LP2A 3MCMA 1GNKA 3UN5A 4DSEA 1UJ5A 2DGWA 2V8PA 5J2NA 2VG7A 2AEJA 1OSDA 1N56A 4C8NA 3ENAA 1RCOB 2EK6A 4C48A 3TQ1A 2D74B 2XO6A 1URNA 2UU9J 1WEZA 5FLXY 4X4VA 2G2YA 5F3TA 4K4WA 3W8GA 2VD3A 3OLAA 3BN7A 3HVRA 5G4DA 3D54A 4LR7A 3KHGA 2Z2ZA 5KFVA 2BQ3A 1WHVA 4DZ6A 2VF3A 5LMUJ 1QAJA 3JAMU 4Q44A 3J81Y 4IOAQ 2RB7A 1V3RA 2G0CA 3W5XA 1YVFA 4H4MB 1VQOS 3N5FA 2VQEJ 4CZCA 4DV5J 4NXNJ 1T11A 1VIXA 4PXCA 2LDIA 1HYSB 4EI2A 2FHOB 1IN0A 4CRJA 1R0CB 1B7FA 4FS1A 1T95A 3HK2A 2V2VA 1KHVA 4LF4J 2RVJA 4FXVA 4OJHA 1TK5A 3QGPA 3N28A 2O67A 5HROB 4GVBA 3C14B 3KOAA 4N5SA 3CC4S 5DJBA 3SQGB 5GMKa 5IT9U 3UVJB 1RYSA 2HNZA 4CO4A 4QWEA 4F2RA 1XWLA 1IR2A 2JZ5A 2R7VA 4D3HA 2BKPA 1ZETA 3OTEA 1IKVB 2DRDA 4NLTA 2QN6B 3J80U 3J7A1 2RH3A 4L6V3 5A0YA 3PJWA 4H4OA 3GV7B 3E01B 3JSRA 2AP6A 1RT5B 1DQAA 4FS2A 3GG1A 2D41A 3J81j 2OAUA 4ZJLA 2Z58B 4JV5F 2IMWP 5T7LB 3A3PB 2YXLA 1H7WA 3I4HX 2O3DA 3JQMA 1T8EA 5LT5A 3CCUS 2DNHA 3CVKA 3FBEA 2CNNB 2NLWA 2FGCA 1OY9A 3M32B 5ADZA 1T9WA 3IA0A 5EGYA 4DL7A 2LXUA 4RBUA 1BY9A 2JVOA 2CPJA 2C3UA 2B5JB 3M9MB 3W2WB 3R3TA 1GX6A 3HMJG 5CYMB 4CLPA 3BO4A 1KVKA 2QEXS 2MTLA 4OIXA 2YQ0A 2AEMA 1HW9A 5AJ3J 1RTJB 3W2VB 2KL8A 4U8YA 3FCWA 4LF1A 3M9OB 2D3UA 2MPUA 2ZBIA 5GMEA 1QM9A 2DT9A 3I6PA 5J1EA 4DL3A 5F9LA 3ZTOA 4QR0A 1NJIT 1N0UA 2YH0A 5FDLB 3OSNA 4CO1A 2I5JB 2FVSA 2RIJA 3CNQP 2C28A 5CXTA 4HI2A 4PWUA 3R7NB 1JX4A 2IIHA 2G13A 2B4PA 4A8YA 3FCVA 2AHOB 4RUHA 2M52A 5ITHA 4URSA 4ED4A 1RT3B 3ILOA 1GX5A 4WFBQ 3I0RA 2FGOA 4ED1A 1Q79A 3JSMB 3PXGa 1NCLA 5D0HA 3ELHA 2L48A 4ED5A 2AJ1A 1FD2A 4WU2A 4DUZF 2V34A 1WG4A 3RB4A 4A8OA 1X5TA 3V81A 4NYOA 4RWWA 3UDVA 1FKOA 2W9BB 3NOCA 4TQRA 2MXYA 1QTNB 1WC4A 4MK7A 3CB4A 3DLGA 4CO0A 1BQNB 2YKQA 3BGRB 3LP1A 4L76A 1RWWB 4R8UB 2XLKA 1M5VC 4C8LA 1HKAA 1FDNA 3CCLS 3CJ3A 1XNQJ 1MLAA 1S77D 1S4FA 4DX7A 2FLPA 4TU7A 3GV5B 4DV0J 2LA4A 4F4YA 2V0NA 4KHPJ 2AIRB 5IOLA 2FJXA 2OFGX 2RHSB 3FEYB 1H2VZ 1CJKA 1VRTB 3DRSB 3V6KA 4B08A 4LREA 1UJ6A 4ZIWA 2HWTA 1S0MA 4KT0C 3CJ0A 4DX8H 1X9SA 4DG1A 2XI3A 2GJFA 2ZKUA 4DR5J 5KFIA 4I6AA 3QNWB 4ECQA 4XTTA 4DPTA 2W4PA 1U45A 4OZJA 3MM7B 1LWFB 2EFOA 1VC5A 1M5KC 4BC9A 1N5QA 3DLEB 1AROP 5EWEA 2MZTA 4NLPA 1NMEB 3LTOA 1RTHB 1XMOJ 5IXUA 3AD9C 2B6AA 3TUIC 3HHLD 4LR9A 4NLSA 2DJWA 4KAIA 4MFBB 3KLVA 2MKSA 4X65J 3L3CA 4OI0A 2V63A 1IKWA 2HS0A 3MR3A 3VAKA 2N82B 1HR0F 3KJQB 2V69A 3TAMA 3OTOF 1YLXA 2PEHA 4WE1A 1FK9B 4YQWA 4WZQA 1Q1KA 3CCRS 1RWMB 3NAHA 4EO6A 1DARA 3VGVA 5D77A 3EGVA 1OQ3A 5F8HA 2H4YB 1JLFA 4RR5A 1CJVA 3N5BA 3EGZA 2YPYA 5KFFA 4G1QA 2JLFA 2CNKB 3QIDA 3IM8A 5RUBA 3HSJA 4YMEA 3KK1B 3CC2S 2AV5A 1O51A 2YNFA 3GZ7A 5BJRA 2ASYA 4WU3A 3PR5B 1JLGA 3OUYA 4KRWA 1DFDA 2CKWA 3HCXA 3V4IA 1HI0P 2R4FA 1UPMB 4DV3F 1YBAA 3TYTA 5IQ6A 3KLGA 3CJ2A 2F8MA 4OHVA 4ILLA 2IRUA 2QV6A 3HX9A 5CZXA 3MM5A 3QSIA 1BWVA 5C7PA 3NAIA 3QFWA 4JP8A 3QQCD 1WOPA 1YBUA 1T9UA 1KOOA 5HAOA 2IYGA 5L1JA 2CJBA 3UFCX 2XMTA 1S9GB 2KH9A 1JJHA 1TFYA 2DGXA 2QFJA 3W60A 4RLEA 3HDSA 3K7RA 4WYWA 4TY9A 2QG9B 1N8RT 1SH0A 2HRYA 1U7LA 2B8QA 4LMZA 3GFZA 2WONB 1UWBB 1ZH5A 4J90A 2Y3YA 2MB0B 1Y5IB 4ZDNA 1F5CA 1N32J 3T1YF 1JLAA 2M70A 4PXDA 5E41A 3MCOA 4ILRA 2HVZA 3POTA 5C2CA 2RMLA 1TU0B 1T3NA 1BLUA 2K2PA 2FJVA 5H1SV 1RKJA 3MMBA 1N5TA 5IM0B 1HFEL 4I7FB 4OZ5A 1NU4A 1F1BB 4ES1A 2CPFA 1X5OA 3OR1B 2HZAA 4AQYF 3OXGA 3VZHA 2ADCA 4YR0A 2BM1A 3PYFA 2ILZA 5KFQA 5D4PA 1E6VB 2OPQA 4KFBB 5B0CA 1RSCA 4UZCA 4JYAJ 4L3NA 4W98A 2HAFA 4P10A 2W7PA 3NS6A 1KSPA 1U47A 4JI4J 2BE9B 3VVTA 3OSPA 3W66A 3MR7A 1ZTWA 4TLRA 1CSJA 2AGPA 5CD4H 2GQ2A 4NZ6A 4CYUA 1TV6B 1FNXH 1ZPWX 1EP4A 4C8MA 1K8AT 3HSGA 2BANA 4KYZA 4B9LA 1MU2A 1HNWJ 4P75A 1YGYA 1KVIA 2CJYB 4QW8A 1UEVA 4YB6A 3GCWP 1MWYA 5F8NA 4ICLB 1NJYA 3GJQB 4C11A 2HYIB 5LJ5Y 2DEIA 2HKEA 5JVHQ 4ES3A 3GIJA 4A8FA 1W25A 4UUWA 2GMLA 3KLFB 3ZTPA 3IG1B 3QMQA 1VLYA 3MAQA 4G3IA 1Q81T 5F41A 3ITHA 4LFAF 1CPZA 5I3UB 1ZBTA 3UN2A 3BKFA 1RTDB 1TK8A 1VBKA 3GU0A 2XBPA 4JI7J 5LSLA 3CULA 3OTBA 5DZ7A 2HK3A 1HWLA 2QMXA 1SC6A 1XBWA 3OL8A 2K7KA 2JC0A 4LF8F 2ZOFA 3U1LA 2B8PA 2O66A 3PEHA 5ETRA 2CUYA 3KLIA 5B0AA 1HMVA 2BJ7A 3W64A 4O4RA 4X62F 2QLWA 1LK5A 3VALA 1KOHA 1VJWA 3LPEA 1JK9B 2R8GA 3UR3C 2EFPA 1HWJA 2YKMB 1KKHA 2BW7A 3M2VB 3SSRA 1QSSA 4I68A 4NRTA 3KHLA 1RA7A 4KPYA 3M6UA 3QT6A 2LKZA 4ZOSA 3TVKA 1Q4RA 5KFKA 2XMUA 1S6OA 4JB8B 4Y0FA 5HP1A 3P4UB 1WG5A 2IM3A 2RHQB 4Q0BB 3PM9A 3AA9A 3O5TB 4ZVSB 4A4JA 1EARA 5B7WA 3CD7A 1NH8A 2VODA 3NL0A 3HVWA 1NKBA 4U67Q 4EZ6A 1C0UA 4GKKJ 4JI5J 5BYRA 1KTVA 2LEPA 3KLHB 2ZWPA 3T41A 1DY3A 2J6TA 3W62A 5HJYA 4H4KC 3IS9A 4Y2CA 1EZZB 2ZITA 2NS1B 4DL4A 1MMNA 2RF2B 4I2PB 1N6QA 2IJNA 4KSEB 5CYJA 2GO9A 3R5AA 4ED8A 2F9JA 2IFXA 2WZ1A 3BBFA 1Q95G 3DRRB 4RU9A 3PO4A 1Y0HA 4X64F 4PWDB 3L4BC 4NZ0A 1LQ9A 3OD2A 5LXRA 1V9OA 3EICA 2XS2A 1YK9A 2YNGB 1AUDA 2JLGA 1S6QA 3KMQA 2IM2A 2QO3A 2EXUA 4U96A 4K5RA 1Y3JA 1NNDA 3QZ7A 4FYWB 4LT6A 1HARA 1X4EA 1Q5VA 2FZGB 2KJVA 1C1BA 2E1AA 2RAQA 1TKTA 2VJUA 1CC7A 4ER8A 3MM6A 1EQ0A 1DQ8A 4P6QA 1I94J 2VOPA 3BGOP 4EYIB 1H98A 4OJ1A 4F36A 2ZJPQ 2E1PA 2LCWA 4WKRA 4NPOA 1PIEA 4BBYA 4RW7B 1RT6B 3GSIA 4E0DA 1FRHA 2WTFA 1KONA 2DNNA 5FD1A 2MLZA 3FQKA 5J2MB 4YFUA 4FF4A 2IDEA 3HJVA 4AD6A 2HNDA 3QRQA 2J7WA 5KG0A 3AJ2A 5GAGU 2FQQB 1X0PA 3MR2A 2RKIB 4DV6J 3UD3P 1C1CB 1WUUA 5LJ3Y 1PILA 2OJ3A 3IWXA 3VGTA 3UCUP 3UR0A 2DGOA 2DITA 2IY5B 3H25A 1EETB 1UFKA 3CSKA 2YKAA 5D4LA 4LRBA 2GVZB 4H4MA 1CBKA 4OV6A 3VZIA 2KG0A 4AT1B 1ZTTA 4LSLB 4KGVB 1RI7A 4RUBA 1VISA 4WFAQ 1BQMB 4TN2A 2FLOA 2X1FA 1HNIA 4OZ0A 1XC9A 2HHSA 2FJWA 2ZOMA 5DDQC 1M1GA 1R3NA 1LWCA 1VQ9S 3KG1A 4RO0A 2DNQA 5LMUF 1FFGB 1I3OB 2J9DA 2ZH6A 3A8IA 3J80Y 1U8SA 1NKCA 2VQEF 2HLUA 2OFHX 5SZTA 4DV5F 4GKJJ 4NXNF 3ZXWA 3AD7C 2F7VA 5LXYA 1IKVA 2W2QP 4J9OA 3AY0A 1KR4A 4I2QA 1HIYA 3CIZA 4LF4F 4O3RA 2EVZA 3P49B 4OYAA 2NREA 1R27B 2AJFE 3DN9A 3LGHA 2YWGA 3EGWB 4CM2A 5F8JA 1M5SA 2GNKA 2KFNA 4HACB 2BE2B 1YG0A 2IAJA 2I0XA 4UTGA 2RU9A 4PAAA 2WSFC 4M1KA 1FEHA 1T0TV 1NO8A 3EJMA 4TVAB 1WWHA 1TL4A 2HQFA 4B3RJ 4JUZA 4YR2A 4QWBA 3QIPB 2HFUA 2V6AA 3DDKA 2B5JA 3ILLA 6AT1B 1LW0A 3H2VE 5A8WA 4USMA 2V5HG 3I96A 2PMZD 4QQBA 1B7YB 3MMAB 3KJVB 2CPDA 3CPWR 1BQXA 4QW9A 2E7XA 1RTIA 5IV3A 1YJTA 3W2VA 4DN9A 1T3OA 3CO0P 2N3LA 2BW2A 3BS9A 5CAAA 3L09A 3SEOA 2WB4A 2XEXA 3MOZA 4FXDA 4DJBA 4ZP9A 3O2IA 1S1TA 5D3GB 4BCAA 2ASLA 2QL9B 3NGUA 2IM1A 4FBUA 2CQ1A 2MGZB 1OSCA 5AJ3F 2KT3A 3VR1A 3M2UB 1WC1A 1RT3A 1QLNA 3V6HA 4DX5A 2YKNA 3MM9A 3IC1A 1L3KA 1SC1B 1RE1B 3LF0A 1HQ2A 3NGDA 3FNNA 1HQEA 4EFAC 1NB7A 2Z2YB 1JKHA 3HHDA 3PHTA 2GC8A 2AD9A 1D3WA 5I3QA 2CWKA 3OJUA 1U8WA 2W9BA 4OI1A 2HG4A 3VAHA 4ZHRA 3G82B 2AJ4A 3OR2B 3G8SA 1BC6A 1TL7B 1BQNA 3E51A 1IQZA 1DZ5A 2QYGA 3BGRA 1XK8A 3LP0A 4R8UA 1TL3B 5DQIA 5H9FK 2WSCC 5IS2A 2HEKA 1HBOB 4NASA 4USWA 5K20B 4P2FA 1DAXA 4QIEA 1PG5B 5D4OA 1CJTB 1R8AA 3ILIA 1DTTA 1AFJA 5AT1B 2W2MP 4C8OA 3BPSP 2JNJA 4CT9A 4DR7J 2JC1A 3NKYA 3I9ZA 3T6BA 4QIVA 1KC8T 3HI9A 3W65A 3R5BA 1TKXB 3TA0A 2H1YA 2A6OA 2CNLB 1XNQF 1TL5A 4Q45A 2YX1A 3DGVA 1EAYC 2E9ZA 4DV0F 4KHPF 3M1VB 4EZ9A 4YEAA 4HDHA 2YWHA 1PC5A 2HVIA 3TW0A 4USIA 3SBMA 1U2FA 2HMIB 4KBIA 1H72C 4HT7A 3H2UB 2XMWA 2X1BA 2KFZA 5LL6d 4UUXA 2AEFA 1N52B 2EFNA 2GJIA 2FY8A 3ZZ0A 5CZVA 1RAFB 3TEGA 1IVZA 4CIOA 3QRPA 3X3UA 4LF7J 2CFXA 1F9EB 3UNGC 4KO0B 4DR5F 3TX0A 5C24B 1S7IA 2AU0A 2P9GA 3R7BB 2GGPB 3G96A 1UKUA 3G8QA 3MF5A 3H8YA 4Y65A 5KG2A 4RNNA 2B9XA 1VJQA 5B0BA 1S12A 1OPZA 2PC6A 2C3MA 1LFWA 2B9EA 4X2BA 4A8WA 4PQUB 1S0NA 4N56A 3PDNA 4B17A 1TKZB 3L95X 4V19X 4ETZA 4X65F 1N48A 3V6DA 4NLYA 2FIUA 2APOA 3PYGA 1B0VA 1JXEA 2DY1A 3SCKE 1PJ5A 2ZFHA 2W4DA 1CJUB 2XNQA 2GIFA 3TJ9A 3DLKB 2NPFA 3EWGA 3DLHA 2YWWA 3VV2B 4AE5A 3H90A 3DOLA 4QR1A 3R5JB 4JI2F 2E5LJ 4FP9A 4OI6A 5FJ4A 2I8EA 1NPRA 1FJGJ 3LANA 2CRLA 4OZLA 3HHLA 2V2ZA 1OYDA 3D67A 1IWAA 2EC0A 1RT2A 2A2CA 1TQLA 2WW4A 1FNMA 4NXMJ 3M8QB 1GEHA 5EWGA 1B70B 2HIYA 4KGMA 3QWUA 5KFDA 2VONA 3PRBA 4LBIA 2YNIB 2CPXA 2A10A 4DCOB 4OMFG 4K4TA 4MIBA 3FCHA 4LRDA 2V2QA 1URRA 1RXOB 5IFMA 1WF0A 3ZZUA 3FFIA 3CCES 4WF9Q 1H73A 1S1WA 1UPPA 2QA4S 3MD1A 1EKRA 1PBAA 3PR4A 1D9FA 4WFZA 1ZA1B 1E6YA 2D69A 4ZVOB 3U7JA 2XB2D 2NR0A 3B4MA 3PYDA 2J0XA 5AXMA 1REVB 3HHNB 2RE1A 5J1PA 3OL7A 4WCEQ 1QAYA 1WSRA 2U2FA 1UA1A 5E0OA 2XCPA 3IO1A 2BJ9A 2P9CA 2EBEA 2GVDB 5KFZA 3A8JA 2G2ZA 1IBLJ 4FVMA 4ED7A 4U7UD 5ETPA 4PXBA 1M5PC 2R7TA 5IM0A 2VQFJ 5JXSA 4UQTA 2L3MA 1IXKA 2D7SA 2DHAA 3OT9A 1KLMA 3L7OA 1RHQB 1N32F 2C2NA 2W7AA 4W92B 3OR1A 1FD8A 4ZN3A 2L9DA 2OO4A 5ETOA 4UF4A 4FNHA 1YJRA 3G9CA 3Q8VA 4YUDA 4O3QA 1TZ0A 2MLXA 4PXEA 2J76E 2F65A 2PGCA 4UZBA 3EM1A 2EWHA 3KDNA 1HBUB 3Q89A 7AT1B 5IQQA 4ZPVR 2J9DE 2ZC3A 2RS8A 1CC8A 2EBGA 4A8SA 3WDOA 3V2UC 2N4DA 3DMJB 3P45B 2Y1LB 1TV6A 3HKWA 4NZ7A 3W63A 1NDLA 2XS7A 2P9EA 3DC2A 1WKKA 3L7UA 3NCRA 4HR2A 1VQSA 5L1LA 4JYAF 3CXCR 2YKOA 5G0RB 1UEUA 2ZM6J 1WC3A 4U95A 4ICLA 2VBWA 3OFEA 4JI4F 4IDKB 2XHWA 2FVRA 3HZGA 2OTLS 3MURP 4ZP7A 4QR2A 1X5SA 4QWDA 1ZZFA 1UVNA 2OKQA 3KFWX 1MMLA 5KFUA 1X9MA 4IR9A 4M5HA 1HNWF 2BQUA 2DR6A 2R7QA 5BYQA 1RTDA 1U1PA 2YNHA 3IGNA 3VCDA 4Z7CA 2KZMA 3BDEA 2DRAA 2JWNA 4ZVRB 4LQ3A 3VAFA 3FSYA 1RHRB 3KXDA 1U1MA 4MTPA 1YJ7A 1UETA 3RTVA 4AXIA 1CULB 3W5ZA 1WHYA 3GMGA 4MKYA 3H0PA 1HBMA 4JI7F 4ZCKA 3TUJC 3QYYA 2PSZA 2VPZB 5D6GA 4IQXA 2ZBCA 3GONA 1PJ7A 4ZLJA 3MECB 1UW9A 1BD6A 5HLFB 3CMQA 4CWBA 4NCBA 1KTQA 1RB0A 3GYXB 5L38A 2ZJQQ 3TARA 2KM8C 1NK6A 2KU7A 5A8RA 3ZNJ1 3JTPA 2E1RA 4DBQA 3CIMA 4AL5A 3FMWA 4Q0BA 3RUBL 2CQCA 1EX8A 4ZPBA 3M4XA 4IO1A 3M6WA 1R8CA 3MR5A 4FF3A 2D3O1 2KG1A 4FKYA 2DR7A 1AB8A 3KLHA 4ECYA 4WP9A 1SI9A 3BYRA 1DQ9A 3NG8A 2M9KA 4J7CA 4NLDA 4ED3A 1G4CA 2XMKA 4QIWD 4Y34A 2ZH7A 3C6UB 3ISNC 3M8YA 3DYAB 2CVEA 4IFYA 3JYTB 2R42A 3MCSA 2DPJA 4IG0A 3TI0A 4P7VA 2R7XA 4MH8A 4MIAA 2DNMA 1X8DA 5AE2A 1VQ4S 1WI8A 4NLVA 4AL6A 2BXJA 4MT1A 4GKKF 4JI5F 5HO4A 1UWAA 4HEA9 2RQKA 3BREA 1X9WA 1EHWA 1P9QC 2VKZG 3DOMB 1Q8BA 5ETSA 3NXZA 4KV8A 1RT4A 2VHGA 4KHMA 2RDJA 1TVRB 2XZTB 3WQPA 1T03B 4P52A 1D8ZA 2HHWA 1NB2A 1FKPB 4DLEA 2ZD1B 4F3OA 2WW8A 5HQ8A 5KOWA 4TXSA 4G1PA 5AXLA 4EMDA 2ZZNA 1KS2A 2CPIA 2OPRA 2BACA 2ZHOA 3JXOA 4K8RA 1NK7A 4FDFA 2SXLA 4WIIA 2FPHX 3W8PA 2ZUGA 1DRZA 2UVWA 5JVGQ 3HVTB 2BE7D 3ONQA 3PACA 4LRCA 1OY6A 3D5MA 3HD1A 1RT6A 7FD1A 2VG5B 2DY9A 5LMNF 1SV5B 2CJQA 2GFFA 1HI8A 2VZ9A 5GMDA 2WK4A 4B3SJ 1XR7A 5KFHA 2IJFA 2GAGC 3TZYA 3PHEA 3ILJA 1FESA 2R7RA 1I94F 3M8PB 2ZNYA 3OXLA 3H4BA 4DSJA 2K06A 2CJKA 2ZH8A 1C1CA 1KNZA 4ZVQB 1KBRA 1SUQA 4TYAA 2LYVA 4HL9A 1IJEB 3RRKA 2Z0GA 3E3XA 2F5GA 3R2DJ 2H3EB 2LVWA 2GX8A 4NCGB 1KLNA 3SDEB 3CCVS 1J5OB 1EIYB 4FXWA 3CW2C 1AXQA 2HBYB 4ERDA 4LSLA 3EUNA 5GAHI 3PKYA 4J9RA 3PNIA 4L3KA 4CO2A 1VIOA 3ZTSA 4ECTA 3ISND 3R5DA 3LO3A 3IGVA 4IFVB 1HL6A 2EFQA 1LEOA 2K3IA 1U26A 1Q7LB 1N34J 4UT4A 5J2PB 3OTCA 3QT8A 4QIFA 1C0TA 2YPZA 3PO5A 2FHJD 3J7YU 4MAKA 4C7QA 1SKUB 1UVKA 4QWCA 1WKJA 1SJ1A 3BO2A 4LFBF 1SH2A 1FRKA 3ISZA 3O6QA 1YSJA 2HBRB 3KG4A 2KM8B 1U6FA 1KP6A 4M5DB 3D6HB 3MCNA 3PRDA 1Y9OA 2J6SA 2R7OA 1OYEA 3GTYX 5B0FA 3Q2TC 5E3PA 2M5YA 1S72S 3LPYA 3CUNA 3NP5A 2KTQA 4GKJF 2LMIA 5IV4A 3HO1A 4R0EA 2UV8A 4HACA 4LSNB 2BE2A 1M5OC 3QLHB 1P9YA 3GJTB 3IWLA 3KUHA 3G8TA 1SIZA 3M2RA 3TWZA 1VQLS 1WORA 3R97A 3HFKA 3KYLA 2CIMA 1W26A 5EX0A 1O5JA 3TR5A 4LVOP 3B4DA 2XULA 1RUSA 1JLBB 1UA0A 4J9QA 1YQHA 2VDIA 3H5UA 4ELVA 1H2UX 4DQSA 3LW5C 3W9JA 4PUOA 3S8SA 4C0BA 4IRCA 2ZE2B 1TMMA 1RU2A 3FBBA 4WFNQ 2CJXB 2YVSA 2B4VA 3L9ZA 1UMJA 4ITSA 2PMHA 4YB1P 3DOKA 2C2EA 2V4RA 2VC0A 3AXMA 3CJKB 4ANDA 3BH6B 5D3GA 4B3RF 5D8HB 4X66J 4ID8A 3ZO7A 1JJ2R 4DSLA 2R8KA 5E3AA
chains in the Genus database with same CATH topology
3M2UA 2VBZA 1FNXH 1GXLA 4QYRA 1KQFB 1ZPWX 1EP4A 4Q2LA 4C8MA 3IAM9 1K8AT 4WXWA 3G86A 1CG2A 3PW2A 2BANA 4TU9A 2WHOA 3G6VA 1MU2A 4B9LA 2ZHBA 2EW9A 1IKYB 1Y5LB 2VFRA 1RT1A 3K5OA 3RBEA 4HH1A 4WTYA 1YGYA 1KVIA 3DLLQ 5E5NA 4B3OB 1LW0B 5A8WB 1U2RA 4QW8A 4X4QA 1UEVA 4YB6A 4Y3CA 3BF4A 1MWYA 1WI6A 3U1MA 2OPPA 5FDLA 2V94A 5F8NA 2QA1A 4ICLB 4JOUA 3TVYA 5C25B 1NJYA 1QSYA 4CCHA 2I5JA 1MROB 4C11A 1RTIB 1P8GA 3DHWC 2W8LA 2DHXA 3HVAA 5LJ5Y 2HYIB 4N8OA 2XY5A 3MWBA 2AW0A 3R5CA 1SL0A 5LSOA 1H3DA 2GIQA 4ES3A 5JVHQ 3GIJA 3HKZD 4A8FA 3HHLC 4TLQA 2AJQA 1W25A 4UUWA 2GMLA 4NLXA 2ERRA 4PG6A 5B0DA 5KG5A 3KLFB 3FEZA 2DHGA 1IQTA 2YWEA 3IG1B 2ZKTA 3QMQA 1VLYA 1VMBA 2BUNA 4RNHA 3MAQA 4G3IA 5EWFA 4HI1A 4I64A 4L72B 1LKZA 1Q81T 3CO9A 5F41A 3W3SA 4Q7AA 2COLA 3JTOA 5HN0A 5B0GA 3OR2A 5GADI 1Q7YT 1HQUA 3ITHA 4LFAF 3PX0A 1IKXB 1S1TB 2KRRA 1ZOTA 4U6PA 1U25A 5KG1A 5GAHU 1CPZA 5KOXA 4M95A 3MECA 5I3UB 1ZBTA 5K8OA 2VFUA 2UVRA 2KZZA 1HBNA 5CYQB 3JSMA 1RWUA 3I32A 5HLFA 4C8YA 2R7UA 1UW4A 2YY3A 1RTDB 1TK8A 1U6BA 2E5GA 1OWXA 4NLQA 1NJXA 2XBPA 3MHYA 2QE5A 1Z2ZA 5LSLA 4CT8A 3M8RA 3CULA 2J6UA 3OTBA 1LXJA 4J9KA 3DXBA 5B09A 2ZJRQ 2XZWA 4ECZA 1C4AA 1HWLA 2P5VA 4JI0F 3U02A 4DEZA 3M05A 2UUAF 2QMXA 1QUVA 4DDFA 1SC6A 2J0SD 1XBWA 2J7KA 3CWJA 3M6VA 3OL8A 2OMOA 2A2DA 2K7KA 2XSJB 4MIWA 2JC0A 4B02A 4LF8F 3I9V9 4RW9B 2ZOFA 1ELOA 3BJYA 4MMOA 3U1LA 3FVYA 3PEHA 2O66A 2YKNB 2KJWA 2WCXA 3MM9B 3MEEB 1OIAA 1VRUA 4TU8A 2ROGA 3KLIA 3S01A 4X4RA 2DTJA 1MWZA 2AGOA 1RISA 5GAGI 2POKA 2OP5A 2WRMA 4K5SA 4ZVHA 5B0AA 4EYHB 3RR8A 1HMVA 3AAWB 1CQMA 2XWXA 1HQEB 4O4RA 2VOOA 2VA3A 1KRPA 2VFSA 4X62F 4DQRA 1JKHB 3WC2A 1TKXA 2PIIA 2QLWA 3FJ2A 3M6XA 1LK5A 4DS5A 3R1LA 4Z37A 3VALA 1KOHA 1A7GE 3I0SB 1N54B 1VJWA 1JK9B 2R8GA 1LXNA 4NA1A 4CQ1A 3UR3C 3X1LB 2UVVA 2M2BA 2DH8A 1OO0B 2HHTA 2DGVA 5DG8A 1NJZA 4ZHRB 1JXLA 4XPCA 2EFPA 1XTZA 1NK4A 1HWJA 2YKMB 3C6UA 2JEIA 3M2VB 1FDBA 5HI7A 1KEKA 5F8GA 3SSRA 2GHWA 3LUYA 2IA0A 4KB7A 3DYAA 1FNOA 1FXRA 1QSSA 3LP0B 1R8PA 3I0RB 4A8XA 3JYTA 4I68A 1VRTA 4O4GA 4OX6A 4NRTA 3DRSA 5J2QB 2NZ4A 4ZP8A 1UAWA 5K8PA 2CG4A 3KHLA 1GH8A 2FD2A 2X1FA 4WFYA 3T3FA 2OSQA 3H2LA 1UVIA 1RA7A 4DF8A 4FF2A 1YJWS 3M6UA 7FDRA 4KPYA 1JLEB 1XMBA 5THWA 2Z8QA 4O3PA 5F8IA 2LKZA 4ZOSA 4JI6F 1Q4RA 3TVKA 5KFKA 1T05B 3EPGA 2DH9A 2XMUA 2DNKA 3GR1A 4ZVEA 1S6OA 3KMSA 4KO0A 4PG4A 1DTTB 4Y0FA 5HP1A 4O3SA 5E33A 3AQOA 2CVIA 1FTRA 1WG5A 2IM3A 3FDSA 4LF6F 1Y5NB 3Q0AA 3DOMA 3PM9A 1PO6A 4Q0BB 3O8WA 3AA9A 3O5TB 4ZP6A 1S9FA 2J0QD 4RW6B 2DPJA 1NEEA 4NYZA 3GR0A 4IG3B 4A4JA 3DU6A 2V9WA 1H7XA 5B7WA 3CD7A 3MM7A 5KT7A 1NH8A 2VODA 3NL0A 1LWFA 3HVWA 1NKBA 4U67Q 2BOPA 3LH2S 3T6JA 4EZ6A 2ASJA 1HI1A 1ZM9A 1TVRA 1C0UA 2M7SA 2NSCA 2QA4G 3DLEA 5CQGA 3QPIA 1D9DA 3HM9A 5BYRA 1KTVA 2LEPA 3KLHB 4OHWA 4PCQA 5A8KB 1T03A 2J6TA 2DVIA 4B9UA 2DCLA 1S10A 1F5AA 3CDAA 4X4NA 3DM2B 3AB4B 2W9AA 4H4KC 3I55S 2ZD1A 1RTHA 3IS9A 5DQGA 4A8QA 4Y2CA 1QY7A 2IM0A 3P96A 2ZITA 2CZVC 2NS1B 2WOMB 4DL4A 1MMNA 4LF7F 5I42A 3SCJE 2RF2B 4I2PB 1N6QA 3HP6A 2IJNA 5F3ZA 4F4KA 3OV7A 2G4BA 1DLOA 4KSEB 3DDNA 4MFBA 5CYJA 2GO9A 3PZPA 3R5AA 2GIRA 4ED8A 2F9JA 2IFXA 2Q6CA 1DURA 3OHBA 2IVMA 2GHPA 1NZAA 1I1GA 3DRRB 4C3LA 4KQZA 3VQSA 3GV8B 4RU9A 3PO4A 1Y0HA 2V9KA 4J5OA 4X64F 2L41A 1G6BA 2QZ8A 5A6WA 1VQKS 2RSQA 4IKAA 1SL1A 4PWDB 3G6XA 4NZ0A 4QJVA 3N0VA 1LQ9A 4MYTA 5H9FJ 3HVTA 3GIIA 1N5YB 2MJNA 4DQQA 1Y4ZB 3DGPA 5LXRA 1B64A 2M8HA 2H5EA 3O44A 3US5A 5EX3A 2UVUA 1D0EA 3UCZP 5KFPA 1V9OA 2EG2A 2Y1JA 2KYXA 2VG5A 4DS4A 3PFEA 2XS2A 1U1QA 1FK9A 2C2RA 2WB1D 2MY7A 2FC8A 1SBRA 1XMOF 3BDPA 4DUYF 3F56A 1WD6A 2FJEB 4OJ3A 5DM7Q 1P6TA 2YNGB 1HPZA 4URGA 1K9MT 2KXFA 1AUDA 1DBDA 1QJHA 3QO9B 3K2YA 3EX7B 2JLGA 4F26A 2VKRA 3CEDA 2EFVA 4P7TA 4ZA1A 1JLQB 1WEXA 1S6QA 4ECSA 4NLRA 4TY8B 5F8MA 3FZ2A 3KMQA 2IM2A 2QO3A 3A1YG 4ED2A 3M8PA 4F8RA 1TKDA 2AQ4A 1KFSA 2AGQA 4K5RA 5A6PA 1Y3JA 1NNDA 5T41A 3QZ7A 4XO0A 1JJ4A 4PQAA 4LT6A 3UW1A 1HARA 1TL1A 5EDWA 2X1GA 3PIOQ 3CCQS 4RNOA 2B6AB 1X4EA 4YR3A 2KJVA 2B0GA 1R0AB 2U1AA 4I4BA 1C1BA 2E1AA 4MKBA 4OX8A 5L9XA 1TKTA 3AHPA 1CC7A 1VBXA 4OI2A 4AFFA 4O3OA 2J9EA 5DDRC 4Q8FA 2BVZA 1WHXA 3MM6A 4Z2XA 3KKFA 1DQ8A 1S1XB 2MZ1A 4P6QA 1U48A 3AH6A 3RRGA 2VOPA 2YNIA 2R9LA 3KK1A 5KFWA 5KT6A 3VQTA 4EYIB 3CDUA 3V6DB 2JEJA 5GADU 1T02A 1H98A 1NJWA 4OZ1A 2B43A 4OJ1A 4CO5A 2E5LF 4NCGA 4U9RA 2IC3B 4BC7A 2XG8A 2ZJPQ 1FJGF 3UPFA 2LCWA 5CHCB 4ZLPA 2HS3A 2FUG9 4WKRA 2ILYA 4NPOA 4WZMA 5KG7A 2EI5A 4K4YA 4FPRA 4ECWA 5DGBA 3RB0A 4BDPA 4BBYA 1SH3A 4RW7B 1RT6B 2E7WA 3RB6A 2VG6B 4E0DA 3WX4A 3OJSA 1FRHA 5HBMB 3G6YA 4X4SA 2WTFA 4Q8EA 3KLEA 3CTRA 1KONA 1S97A 4U7UK 4A8KA 2DNNA 3I87A 5FD1A 3MUMP 3FGVA 3FQKA 3DOLB 2EFGA 3Q23A 5KFTA 5J2MB 1S6UA 2CQDA 4UY85 4YFUA 4DN0A 4NXMF 4FF4A 4A48A 1X4DA 4ETXA