2ZVIA

Crystal structure of 2,3-diketo-5-methylthiopentyl-1-phosphate enolase from bacillus subtilis
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
400
structure length
395
Chain Sequence
SELLATYLLTEPDTEKKAEQIATGLTVGSWTDLPLVKQEQMQKHKGRVIKVEERAASEKQAVITIAYPEINFSQDIPALLTTVFGKLSLDGKIKLIDLHFSEAFKRALPGPKFGVYGIRKLLGEFERPLLMSIFKGVIGRDLSDIKEQLRQQALGGVDLIKDDEIFFETGLAPFETRIAEGKQILKETYEQTGHKTLYAVNLTGRTADLKDKARRAAELGADALLFNVFAYGLDVMQGLAEDPEIPVPIMAHPAVSGAFTSSPFYGFSHALLLGKLNRYCGADFSLFPSPYGSVALPRADALAIHEECVREDAFNQTFAVPSAGIHPGMVPLLMRDFGIDHIINAGGGVHGHPNGAQGGGRAFRAIIDAVLEAQPIDEKAEQCKDLKLALDKWGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,3-diketo-5-methylthiopentyl-1-phosphate enolase
publication title Structure of the apo decarbamylated form of 2,3-diketo-5-methylthiopentyl-1-phosphate enolase from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 139
structure length 395
sequence length 400
chains with identical sequence B, C, D
ec nomenclature ec 5.3.2.5: 2,3-diketo-5-methylthiopentyl-1-phosphate enolase.
pdb deposition date 2008-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 2zviA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 2zviA01
3ZXWA 4LF1A 1WDDA 1UWAA 3QFWA 4NASA 2V67A 4RUBA 1GK8A 5HK4A 1UZDA 1BXNA 1BWVA 1UPMB 5C2CA 1EJ7L 2OEJA 3AXKA 2YBVA 1RBLA 2V63A 1TELA 1RCOB 1RLCL 2CXEA 3RG6A 8RUCA 4MKVA 5HATA 2V68A 1RCXB 5C2GA 1RUSA 2D69A 1UPPA 1AUSL 1UZHA 4F0HA 3WQPA 1SVDA 1GEHA 3AXMA 2RUSA 5RUBA 2OEKA 2VDIA 2VDHA 2V6AA 2ZVIA 9RUBA 5HJXA 3KDNA 1RBAA 3A12A 3KDOA 1IR2A 4F0MA 2OEMA 1YKWA 2CWXA 1RLDA 1IWAA 1AA1B 1UW9A 2QYGA 5HAOA 1RBOB 5HANA 5HJYA 3NWRA 5HQMA 3A13A 1IR1A 5HQLA 4LF2A 2V69A 3RUBL 1RSCA 3FK4A 4F0KA 2OELA 4HHHA 1RXOB
chains in the Genus database with same CATH superfamily
1PHQA 3RBDA 3GG8A 2E7VA 1LWEB 2HK1A 4YMZA 1IR0A 3MF5A 2VQTA 3QVQA 2W92A 4AZBA 5F3ZA 1YNQA 2X1FA 1YJVA 2ZZMA 2W3ZA 3FDSA 1ZTVA 1QUMA 1KTQA 4DV0J 4HDGA 1DJGA 1IE7C 2V2CA 2AYMA 3H0PA 3EVMA 4KT0C 1FO1A 2HHQA 4I2QB 2JC1A 2DPJA 3WD4A 3E51A 3V36A 5GJPA 2VQEJ 1HIYA 2BE2A 4WDUA 3M30A 4EUVA 3GHRA 5K14B 4NILA 1F05A 4AWTA 2PWFA 3TOYA 5EGYA 1KRCC 5K5MA 1ZY9A 2CQBA 1VRXA 2NLYA 1BPLB 4F0RA 1S7HA 2VQEF 3R4IA 3T5JA 1U1QA 2O9OA 4LRTA 2G0IA 1U45A 3EDDA 2B7NA 4F0HA 2XVPA 4KFPA 2PPGA 5AC6A 3HDSA 4K3ZA 2C71A 1J10A 3V5CA 5EWEA 4REQB 5HP1B 3CGIA 2DNMA 2B5JB 1IBMJ 3O63A 2PWHA 2VDIA 1P1XA 2Z24A 3QR0A 3CQJA 3CCMS 1UCWA 1GVOA 1CXKA 4LAMA 3NL2A 3W2MA 1WKKA 5AE3A 4QU7A 5M17A 2OLSA 3QBCA 4NKCA 3TAQA 4DPOA 4C8ZA 3CO9A 5BXRA 3T42A 2P10A 3LQVA 2IAJA 4ZSUA 3IVTA 3P8BB 4J9KA 2PDIA 3SRHA 1X0FA 3CJRA 4B5TA 1JGMA 3RCYA 1KKRA 3AH6A 1IKWA 2Y89A 2F3JA 3KVKA 3DDNA 8A3HA 4FI4A 3OTDA 4RCXA 4LAOA 2QEXS 3AUJA 3C0JA 4N42A 1SXLA 2X3DA 3STFA 3R7NB 1NKCA 3D6NA 3RPMA 2BE2B 1RT2B 4NLTA 1HF6A 4ZOBA 3M30B 3K8LA 1NJZA 3EGZA 5J5RA 3OL6A 4RW7A 3D67A 7CGTA 3ITCA 2WMJA 1E6RA 1HIZA 2R8WA 2KN4A 2PA6A 2VO5A 3EKGA 4NI3A 5LNWA 1I1XA 3FSXA 1VD6A 2NXIA 4P2FA 3S9ZA 4YIWA 1A47A 2I16A 1BYAA 2RJZA 4RUBA 1B0PA 2O4MA 4F4XA 1VPYA 4M6VA 5BR8F 1NKBA 1XK8A 3G87A 3CZLA 1M6JA 1PS9A 4N56A 1UZ4A 3L9CA 1AW1A 4OTKA 1VBRA 2I56A 3PJ9A 2YOCA 3LQGA 1KOOA 4O3QA 3MAQA 4XAKA 2WHJA 4CUCA 5K8PA 3WO8A 4YB1P 4S3JA 2G4BA 4QCFA 3TO8A 2B56A 1GVRA 2ZRWA 1CEOA 1HTIA 2PUZA 3OXFA 3MR2A 3IM8A 2PDBA 1C91A 1VRQC 4B3TF 2ADAA 3ZMRA 2RDWA 4QWDA 3UR2A 5A0YA 3TJ9A 2PDXA 1RWWB 4C0HA 2I9EA 3B78A 3M6UA 4IT1A 3RJMB 3GV5B 4CLLA 4UY8T 2DY1A 2IAJB 2CZEA 3SADA 3W2WA 1F2JA 4WBFA 3BW2A 2I14A 5THWA 4NSBA 5L39A 3VOFA 5KG4A 1IKWB 1KVIA 3BGRA 1X38A 5GAHI 2DCLA 4ZP8A 1UR4A 4CLFA 4RU9A 1XERA 1N0UA 2R1KA 4KEUA 4ZA0A 1FKOB 1JCNA 2N82B 3THTA 3QTPA 1DJXA 4Z1AA 4W9TA 3SCOA 2GJ2A 2QTWA 2HNYA 2XM2A 1QVBA 4NEYA 4MJMA 2BRKA 4RW7B 4YB6A 2MSSA 1F6YA 4HNNA 1NARA 2VD8A 4WXZA 3KEHA 2HZCA 4FF1A 3GVWA 1V3JA 4XO7A 1JMTA 2H3DA 1Y5XA 2LLEA 2B7BB 2ZNZA 4DI8A 3MM6A 4WXOA 5GVQA 1GX5A 2NWSA 3KHHA 4ETXA 3G18A 1KFBA 1TPUA 1TPC1 3NJ3A 1HKJA 3QMRA 1OY6A 1X6LA 1OIMA 5DGAA 3PVXA 3MA8A 1YBQA 5BRBA 1S2WA 2CQDA 2WLZA 4Z42C 3BKTA 5E3RA 2GIQA 2Y7FA 3ZNUA 3QY6A 2ZUGA 4ZQPA 1E6NA 1KLMB 2Z1WA 4MJKA 5IFTA 4DOZA 4CYUA 4DI9A 2YFNA 1U6FA 5A0YB 3D3AA 1H49A 4JPGA 1Y4ZB 2JL9A 3FXYA 1EB0A 5AE2A 3QQWA 1CT5A 3VNKA 1WDRA 4BC9A 2FZKB 1FHUA 2PA3A 4XKYA 3W2WB 3AQUA 4TVUA 3ZSSA 3G1AA 4EANA 1EO5A 3GWCA 2PDKA 3O9NA 3BGRB 2ACMA 3U4FA 2DVXA 2ZHAA 4EI2A 4EEYA 4RXFA 3SJ3A 3I5BA 4RLIA 3CEUA 1TELA 3TR2A 2FLLA 1BWLA 4PMZA 3VVUA 3A6OA 5AC8A 2LXIA 5E0OA 5I23A 3TOPA 5I5RA 2W0UA 2QGHA 3P6LA 3DLEA 3WX4A 3ONQA 3CUJA 5LA1A 1NPRA 3MEDA 1QK2A 3G86A 2GS8A 3GR1A 4EVZA 2HNYB 3K17A 1TKKA 2A2CA 3CH0A 1U1PA 2DO4A 1JLEA 2G9OA 3OVBA 4UTHA 1U1HA 1P7TA 1BG9A 3FN9A 3MM8A 2QLJB 4ZPTR 3Q8VA 4TMCA 5HNTA 1YLXA 4DU7A 2EI5A 2CPXA 3BJSA 3MM6B 1XG3A 5E9AA 4CNOA 3TWBA 2R82A 1XYFA 5KT3A 2AW0A 3VX0A 1IVZA 1YBQB 1N32J 2ZTJA 2ZC3A 1Q6QA 4RKAA 4UTTA 5DRCA 2W7PA 4JNMA 5BRPA 2IS7A 4MNJA 5LHFA 3DZ1A 3QKEA 2EGZA 3MEGA 2OIHA 4N8OA 2R1NA 3KBVA 2MQQA 4B17A 3R1LA 4CYUB 2GOKA 2D3OR 2PSNA 1RWUA 4NA2A 4L7ZA 4E8DA 2HRWA 3VHQA 3EOSA 1IEWA 3UYIA 3SBFA 3WDIA 4OV6A 3VCDA 4XKYB 2YXGA 1LBLA 3N15A 3DDKA 1UWQA 2B7PA 4IMFA 4C6KA 4ZVSB 3H40A 1OYDA 1TMJA 1D3WA 1VFMA 3KUMA 2NUXA 1DAXA 1S79A 2WYSA 4GBDA 1R0AA 1V0KA 4DS4A 3TW6A 4F9JA 4HU8A 3TVKA 3CYJA 3SCQA 4GH1A 1T8EA 3PM9A 3LOTA 4E8UA 1A7GE 3DLEB 4I9AA 1R6VA 4OQJA 4NYZA 2ZVRA 3CXCR 3MEDB 2V34A 1LXJA 3TC3A 1L8NA 3E2QA 4XAGA 3MWBA 3TJAA 1JCJA 1ZAHA 3TE9A 1P7TB 1ZPTA 4QJVA 3MM8B 2O67A 2QT3A 2V3EA 4LVBA 1OFDA 1B64A 3CUZA 3B0PA 4UW2A 3TCEA 4L80A 2E6YA 3E5BA 1EPVA 4PWDA 5F8JA 1KA9F 2C15A 5IT9U 4WOQA 1V08A 2V8VA 5BOOA 4X22A 3A3NB 5LJ3Y 4LB4A 3VKKA 3GIJA 1U5VA 3HQNA 3HQOA 2J9DA 3TOQA 3FKBA 2JLEA 3WD3A 3CNQP 2WB4A 3UQSA 4DO5A 2YKMA 4PA8A 3SZ2A 1BYBA 4M8LA 3U3HA 5LXXA 1GVIA 4F7VA 1YK9A 1W1YA 3MEGB 3KL0A 1E9LA 4QU6A 3ITLA 1X7IA 1IJEB 5E9XA 3MAAA 2C8NA 1MNZA 5AYYA 1SB6A 1D8ZA 4KGMA 3P5YA 1J2WA 3K8KA 2ZKTA 2RKIA 1M03A 3SCSA 2AD9A 1O0PA 3TNBA 1VIZA 4A3QA 3VOJA 4LF7J 1C1BA 4JZ5A 1WKJA 3D2WA 1YKWA 1TE1A 3WUEA 1X1ZA 1R0AB 1TKDA 4O19A 3AYTA 4TYAA 4UF4A 2CESA 2ZM6F 3WLRA 2PDWA 4JI7J 1GQIA 4IO9Q 5ECVA 1TCDA 4W87A 1YJRA 1HVQA 1Z2LA 3U48A 5ETTA 2Z56B 1WXZA 3VNYA 2BY2A 4QHRA 1QBBA 4FR6A 1UBPC 4RNIA 2JHEA 3DFTA 1T7LA 3M0IA 4BF5A 3OLEA 1FRLA 4J2PA 2QJ3A 2J78A 2EJAA 4OE7A 3GXMA 3KTCA 1S5ZA 3GYGA 3LM3A 1UKUA 2RNEA 4RR4A 3GB0A 2A3CA 1I8JA 4PG7A 3V5OA 3DCAA 4O1FA 3DYAA 4B4HA 1RAKA 3BW3A 2BVYA 3UF9A 4PWDB 1QVFR 3MKCA 1YJNS 1H50A 2BZNA 2PWVA 4L76A 3TTOA 1LV5A 5LGXA 4ZIWA 3PZ9A 4DUTA 1WNEA 1EGMA 3D6TB 4WP3A 2YKMB 3LEPA 4OZJA 4YNGA 3KVLA 4NPOA 2NWRA 2GJFA 4H9TA 4OZ0A 1UR3M 3DLBA 1EDTA 1XFCA 3BPSP 2FB3A 1BVNP 5DM7Q 3MAAB 1V5IB 4R0JA 8TIMA 3HPFA 2Q6CA 4URQU 1S5NA 3EMQA 4DAIA 3C61A 2YW4A 4Z2XA 5BMXA 1Q79A 2RKIB 3GXNA 1LG1A 2NZLA 3W75A 2CG4A 5KFWA 1X4FA 4LYKA 5JIWA 1GMVA 2J6VA 2WVUA 5A6BA 4FX8A 2I1OA 1C1BB 2X1BA 5GADI 1E9IA 2MB0B 4DN1A 1OS5A 1GJWA 3UG8A 4ASTA 4B5SA 4POCA 3QGPA 3ABOA 3W7JA 3DFSA 3WLPA 3M43A 4TVAB 1THFD 3B0XA 1EJSC 1F5ZA 1F61A 3MPGA 3IC1A 4BR1A 2EEYA 4PEEA 3IS4A 2WTFA 3M6YA 1PO6A 3CT7A 1XR5A 2OFGX 2CWNA 2OFHX 5FACA 2J74A 1V3HA 2NVAA 3HHEA 2BACA 3MTJA 3A5FA 1QCWA 4B16A 1TTQA 4OX7A 2VGFA 4X0NA 3N11A 4PRRA 4RE2A 4KCUA 3DYAB 1F9EB 1XBVA 3M1ZA 3OJSA 1GPFA 1K73T 2BZ2A 3MANA 5C7PA 1JVNA 3DRYA 3N3MA 1LL6A 2AU0A 1KM6A 2Y8VA 1XIEA 3LTSA 2WCXA 4OI6A 3J7YI 4Y9MA 3UGVA 1VDHA 4OX8A 3R1HA 2QFJA 4CLYA 3NZ1A 2GVDA 1FWSA 4GQBA 5AE1A 1XD0A 1UR9A 4FIQA 4FXJA 3NL0A 3K8MA 4M29A 4A8XA 3L7RA 5D8WA 4ACZB 3SUTA 3ARUA 1SH0A 5J2MA 3MFHA 3F4VA 2VD3A 3OQ2A 1WOSA 2XMVA 2R7OA 4QYZK 1UUQA 3V4IA 3GDKA 1WI6A 2Y7GA 2MJNA 4HMEA 1JD9A 3AHPA 2RB7A 3GSIA 4ZMGA 3TU9A 4CCCA 2HLUA 1FWJC 3EPMA 1V3LA 3T1GA 4UTLA 4ZQNA 4ICCX 1S59A 1S1TA 2FVLA 1OT1A 2F6XA 3RRXA 4B15A 2AJQA 7FDRA 3EDRB 4YPJA 3DKLA 4JI5J 2FQQB 3OSNA 3DERA 1FTCA 4HT5A 1Q85A 2BVDA 4KHPJ 3LCIA 4HGXA 4I5RA 4UCFA 4ZOAA 4H1ZA 3VZXA 4OHZA 4PL2A 4P7RA 1PKUA 2DVTA 3QTGA 3SQLA 3H8AA 3USBA 3SSZA 3OBAA 3V4BA 1F07A 3W23A 3FNNA 3AIWA 4YDDB 4D6DA 1CJUA 1YHTA 3TZXA 3MI7X 2G96A 3WUGA 4EWJA 3QOMA 2VYOA 1UASA 4OYXA 4AVNA 3ETOA 1K0VA 3ZR6A 3KLGA 2ZUUA 4X65J 2XO7A 4L6DA 1HQTA 2V2HA 4QRNA 4B2DD 5CG0A 4PKDB 2R7TA 2AZ3A 2WHKA 5LIXX 3N29A 3C8NA 2YCJA 2WQPA 3W1RA 2TRSA 1FDZA 2DTJA 1U30A 4L3KA 2D2HA 1B7FA 4MZ8A 1TZ7A 2GSHA 2GVDB 1EYWA 4NJIA 2NVDA 4LUJA 2E1WA 1FY6A 3IRSA 5D04C 1GOWA 3GH4A 1XKJA 3M07A 1HBUA 2EG1A 5J2MB 4LY4A 2NZ4A 3Q86A 3TJLA 4KKXA 3BLDA 3V4IB 3BLOA 3EXTA 4N7QA 1SFJA 4RW3A 1I1GA 1JUBA 3GDMA 3ZTOA 1EHWA 1Y11A 5EYWA 2HGMA 3OHMB 2F7VA 1KFKA 1S1TB 4XISA 2NQZA 3GU1A 3PFMA 5CAHA 1DBDA 2GO9A 4OZ5A 5I78A 5FIIA 3L2MA 1S1VA 1WXJA 4WDXA 3PSWA 2CYYA 1VJZA 3U2CA 3CDBA 4XAPA 3TR9A 3DXIA 1RAJA 2AL2A 1VBGA 3G1RA 2WPBA 1BWKA 4W85A 4RE0A 3S0CA 4Y28C 2EBGA 1UVKA 3ADAC 2IRUA 1V4YA 3H4WA 1U02A 3MUZ1 3GTHA 1VKFA 1UROA 1CJUB 3AIVA 4NLQA 2D3NA 3O8AA 2H54B 3LLDA 1BVWA 3TONA 1ADSA 3GXPA 4NA3A 3UPFA 1XLKA 2BJ7A 1ODUA 1SW7A 1BSIA 2ZX8A 4OBTA 2Y2WA 5A6PA 3W01A 1VIOA 3IUHA 1H0IA 1G4CA 3LP2A 2WVTA 3I10A 2I9UA 4UZSA 1RKJA 3HBLA 1NOUA 4JFUA 4XK2A 3R0UA 4QDPA 3RX3A 2RDJA 3KBSA 1AQMA 3ZTPA 2ZD1A 2R14A 2FC8A 3POCA 2V2QA 2PDMA 5E2QA 3L2LA 1HBUB 3OHIA 4XBSA 2LXFA 1S9EA 3AZTA 1GGOA 5BXIA 4MF4A 1JWWA 2ZBTA 2IKJA 3W37A 1Q6OA 1GUVA 3RFAA 4EKJA 1EFZA 1HHQA 4CO5A 3WQPA 2R94A 4F79A 3WUBA 5CPQA 1YJUA 3DGPA 2MLXA 3ICLA 2Z2LA 1R7OA 3VIJA 4XD6A 1H5YA 1F3XA 4M5MA 1BMQB 1X5OA 4DBUA 5KFZA 4DN0A 4ZS6A 1T96A 1HI0P 4Q4PA 1SC4B 1HNVA 1OFEA 3WLIA 5D2YA 2AL2B 2BLEA 5I02A 3CAVA 1JLBA 2CPFA 2LEPA 1S77D 1LWHA 3EXSA 3A21A 2DZPA 3M0LA 3M0YA 1FJCA 5CYQA 3M16A 4Y8FA 3W3SA 1O66A 1XR7A 2U2FA 4NEZA 3PO4A 2CIPA 3FCPA 1L6FA 4DJBA 4M6UA 3OA5A 3ZJ7A 4KWVA 2XYHB 3KNAA 4USUA 4JTAA 2PAJA 4JYAJ 3MP5A 1V3RA 1P8GA 3ENLA 4H8HA 1JZ5A 4RE3A 4HZ6A 2OSYA 3VMOA 3B9DA 2A6OA 1A9NB 4X2PA 4M0XA 3N9UC 4IH7A 2WB1D 4J3ZA 2WONA 1B0VA 1QDSA 4PCFA 3LMYA 5HMWA 1WX0A 3NIYA 3D0CA 3LP2B 1R3VA 3CJ2A 4GC4A 4XZLX 5IRPA 1WP6A 2BVWA 1F73A 4NYOA 4J5OA 1SW3A 5K3VA 4OL8A 2P53A 4JQ3A 2Q43A 4O1DA 4RW6A 5C42A 1OQ6A 4KR0B 2UXCF 1YQ2A 3LA0A 3KL5A 2P9GA 3LRMA 2ZD1B 2QDDA 1NKEA 2W27A 4XPCA 4QQBA 1NDVA 2P8BA 2V30A 4GUIA 3MFIA 5D78A 5FEWA 2UY4A 1S9EB 3PIOQ 4M6PA 2YKKA 3FRZA 3T2OA 1SJBA 5KEZA 1HNWJ 1BG4A 2QZRA 3B05A 2HQGA 4NCAA 2RDUA 1VBHA 1E71M 1X5TA 1BXBA 1AROP 3A22A 1RISA 1LYXA 3C2PA 3D6FB 4D9PA 3I87A 4ICLA 2V2VA 3W2VA 4Z2LA 1OCNA 4LRDA 2UUBJ 2N3LA 1QTNB 4DNHA 3H7RA 4UTUA 2JJ4D 3CJSA 3D9BA 3OW2R 4ZK7M 4KIRA 3RLGA 4LRBA 4AD0A 2MQMA 1R7AA 2JFKA 1OC5A 2WHMA 1HNVB 3LPOA 4IRDA 4IIEA 1MWQA 3G3MA 2RDIA 1JLBB 2EBEA 2V8PA 1RK5A 5BRQA 2JALA 4TU1A 3VNJA 2J0WA 4LQ9A 4A48A 4JV0A 4L4OA 1MSSA 3QRQA 2J79A 1Z48A 4QIWD 1XV8A 5CC6A 2LA6A 4K4WA 1HFBA 4FZIA 2EKNA 3BOXA 4YR3A 3KHLA 4D1JA 4DJFC 5BU9A 1EKSA 3UE2A 4I90A 4JI0F 4A8SA 3DM2B 4ZQOA 5DMLA 5I42A 2HISA 1CBGA 1OHLA 4LEFA 3A3PB 4HOXA 3L7OA 3AIQA 1BD0A 3DEQA 3CT9A 6FDRA 2YDAA 3M47A 3UDEA 5DGBA 1W1B1 2XZ9A 3FMWA 3PG9A 2WONB 4XDCA 5E3PA 3CE8A 1K1DA 2M70A 2PTWA 1B3TA 1C92A 2W01A 5D02A 3GYCA 4E2VA 4YTQA 1W17A 2ASLA 4RW6B 3BO2A 1FRBA 3SRKA 2BQUA 3MCOA 4BEUA 2IM2A 5KFAA 2VM8A 4QXIA 1PJ9A 2WSFC 4HZ7A 1XR6A 4WP8A 4KGXB 3JAMU 1WD6A 4Y2IA 1NDKA 4LFBJ 1VIXA 3UNDA 3U5YA 4AIUA 2INFA 4WFZA 3MZNA 4YS2A 1NQ6A 4AHPA 5DS7A 3TK7A 4A22A 1OSCA 2CRLA 4FYYB 4ICLB 3ZXWA 5FA5A 1XQIA 2ABAA 4LIRA 1J6PA 1S1PA 3EX6A 2A7RA 3O05A 1N54B 2WW8A 4WSJA 4IG2A 4QE5A 1EPXA 3OUYA 4B3LA 1N5QA 3BGLA 2D0FA 3W7PA 1M7XA 3E3XA 5D15A 3VNZA 4W88A 4M5NA 1YXDA 4XIUA 3O06A 1BUXA 2ISVA 2NXUA 3UD4P 4BJHA 3OJUA 2PBOA 1QPQA 5A8NA 1QD1A 1YZ7A 3CL7A 2A3JA 3UWTA 4N5SA 5FF4A 4Q6XA 1JAEA 3T8QA 1WEZA 3H5UA 1UC5A 2PI6A 3MYOA 4U2YA 5I42B 4PFMA 3BN7A 1QE1A 4IPLA 2VI0A 4BCEA 1UBSA 2OUGA 3VCCA 1WA3A 1GEQA 3W4RA 3G6ES 3BLPX 3TYZA 4M8UA 1WC4A 2UXBJ 1OBAA 4S2CA 2DJLA 4NLDA 4CLUA 1CENA 1EB3A 4DLEA 2E5LJ 2Q8XA 4LS2A 2WBGA 1X4BA 1KTNA 5GAEI 1FCBA 2WZTA 1JLFB 1PBAA 3K4AA 4DV1J 4GYFA 1MMNA 4Y3CA 3W8GA 3KFTA 3OVRA 2F40A 3CMJA 1X5PA 4WLCA 1J0YA 1S9FA 1TTPA 2NT1A 3MT1A 4M1BA 3EOUA 4B3RJ 5HQ8A 1UG6A 2TODA 2JRSA 2BOFX 2F5GA 1CEZA 3KDOA 2MUCA 3KLIB 4UFIA 1CC8A 3CF5Q 3N4EA 5KG1A 4KWSA 2G4FA 3S1WA 3LHZA 5K7JA 3WQOA 1XIQA 3OR2A 1ML1A 3H4GA 4ZP9A 3OUYB 1YJWS 4IG2B 3IFEA 3ZZOA 3KVJA 1R0MA 3H20A 3CT2A 1FHTA 4O53A 1YNYA 3Q45A 1MEHA 3DOPA 4K8RA 1JQGA 2RKXA 1SQFA 3MB9A 1QI4A 3SCUA 2Q3OA 5KFUA 4O4GA 1XCXA 1HKWA 2MZ1A 2OT1A 2WM1A 2KAUC 2L5HA 2RD5C 5C70A 3M8PA 1H11A 3KZPA 3LHVA 4JQ1A 4KGVB 4CCHA 4I2PA 2VBWA 3FCHA 4YHEA 2W61A 2LQ5A 3RB3A 1CGYA 2OMOA 1QE1B 4H9XA 4PEOA 4Y2KA 5LNRA 4HQVA 4MADA 3GJRB 1WHXA 4M5IA 3LP1A 4Q7AA 5HXMA 4K2XA 1ZUAX 1N5VA 3E96A 1RAAB 2DRDA 2NLIA 5CCLA 4GKKJ 1XYBA 3LGGA 5KFPA 4X3ZA 3G8QA 2VFRA 1UQZA 1K3UA 3W0KA 1R3WA 4BF7A 4USTA 1LWCA 1EX5A 1UFLA 5A6LA 3E2SA 1D3GA 4LXFA 4OKDA 3IGVA 1Q0NA 3EWBX 4EGLA 1E6XM 1KWMA 2JLFA 4J9VA 4GKKF 3DHUA 1EQPA 3JZUA 2HWIA 2ZE0A 1FRXA 3D1HA 1P4CA 1XH0A 2D73A 2KB2A 4W8LA 2IA6A 4CLZA 4DUXA 2UUAF 2HS8A 2Y63A 2NX9A 2YPYA 4WU3A 4RL3A 2IHR1 2DO0A 3AU2A 3FYPA 1HKKA 4GHRA 3AHVA 1HO4A 5K9DA 3GZAA 3AWOA 4CNSA 4HMNA 2CKRA 3UXAA 4YHHJ 3AXMA 2J25A 2TYSA 3ES8A 4IH3A 4C8YA 1BHGA 1SBRA 5CPSA 2XSXA 7FD1A 3CQ0A 5AOUA 2DT3A 2JEIA 1FHVA 1KR0A 1RACB 3QJPA 4O4GB 2QVHA 1BQXA 4ZB2A 3MCSA 5ETRA 4EFAC 3LCGA 1HWLA 2HNEA 2HNZA 3CTTA 4TOQA 3M8PB 3UESA 2BRLA 1E4MM 3THUA 1LFPA 3SUSA 2ZIDA 2WHLA 3H2UB 1U49A 2QLBB 4CCDA 5HAOA 2CBIA 1AQHA 1IEVA 3DHWC 3SCRA 3IACA 3W1LA 4UTGA 3I6RA 3IEBA 3QJLA 1XKYA 3EGWB 2Q09A 1BSLA 1WG1A 5XIAA 3TZNA 2X3GA 3LP1B 2WK2A 2RH3A 4OX9J 3CWOX 3GU2A 1KFWA 4M5HA 5KG6A 5FF3A 3S5NA 2YH0A 2GK1A 2Y5JA 1VR6A 3R5AA 2YR1A 4WCJA 5E09A 3QZ7A 1LWCB 4LFCF 2R1LA 5MAOA 6FD1A 1NXIA 1G0CA 3KL3A 4ZPCA 1LM1A 3CH9A 3H8YA 4K7VA 2E5JA 3IIXA 1F2HA 1WNOA 3QR1A 3PAOA 2HLTA 3MU7A 3B40A 1RAGB 1EHAA 2YWGA 5EMJA 5B7YA 3O8WA 4OYOA 3N2MA 4Z7YA 2HHHJ 1PZ2A 2OYLA 4AIBA 1RK8A 4AW7A 4EXQA 3POHA 1SKUB 2GX8A 3S5ZA 3BQ5A 3KCOA 1FWKA 1LRNA 3VAHA 2G2OA 5B7WA 1ZA1B 2G2ZA 4ATNA 1GQEA 4XZHA 4U5IA 2FTYA 1JLGA 3K0JA 4QTGA 3LXCA 1K8CA 3AMLA 3HZ3A 1R3SA 3K1DA 3HFTA 1SFSA 3TTSA 4ZE4A 3ITGA 1SL0A 1XLLA 1FWIC 4MKVA 2B4GA 2WW5A 2KT2A 1R38A 3R10A 1GT8A 4S3KA 3RLVA 4IQDA 1C3FA 1X60A 5D0GA 4J1OA 2HNZB 7ODCA 5I0DA 3THDA 3PCOB 3ENAA 4LF4J 1X97A 3M44A 1GOOA 2MKIA 1Z32X 3SGUA 3SXLA 4ENOA 2H9AA 2WWDA 1QOXA 2P9EA 2DR8A 3KRSA 3C16A 2C16A 1IEQA 5EX0A 1QWGA 2HK3A 3IJ9A 4R7OA 4TXEA 4NXMF 3HT3A 4JIHA 2FZBA 1XINA 2GK1B 5L1JA 3P7YA 5IT9Y 4MWAC 1ICEB 3AALA 1FWGC 1G7UA 2CQ0A 3QC0A 4LUYA 4ANEA 2EC2A 4DV5F 3LNMA 1FKPA 3VIHA 1V02A 3WL1A 2DKOB 3S01A 4CNPA 3ZZ1A 1YRXA 1YADA 3ES7A 1KBBA 1W9DM 4Q33A 2YCIX 4B9ZA 1CPUA 1V5XA 2DGQA 1NZ8A 3ANYA 4UWMA 2VTFA 2FGZA 2DGSA 2TAAA 2PWUA 3EX3A 1J12A 2BHUA 4KTQA 3A13A 2ANUA 3N2BA 5AN7A 4CCEA 3J7Z5 3S1UA 1YJ9S 1JPKA 2VZ9A 3Q23A 3ALGA 1ZAIA 3OHBA 2YDQA 4JR5A 2GVYA 1I51B 4PC8A 2YZ5A 2XIIA 1EGVA 2PU1A 1VYPX 2XVGA 3KP1A 1JLGB 5KZ6A 2KXNB 4LYQA 3M5XA 2FVQA 2GUBA 3GXFA 3LGNA 3UJEA 3IGXA 3O2LA 3ZT6A 3SCIE 2FFCA 5FJIA 4YTTA 2B4VA 3QPEA 4IICA 2DNGA 5E33A 2JBMA 4AHQA 5DBUA 4HZMA 3Q8PB 3GU9A 1JR1A 4HK5A 2WSYA 3I96A 3MR6A 2R7XA 2VWTA 3M6DA 2J76E 1FWLA 1NF0A 2ZJQQ 3PUEA 1FD8A 4C11A 2HSEB 2H9AB 3LOUA 3TAMB 1QPKA 4ANCA 3C16B 5HLFB 1S3TC 3E0IA 1TTHB 2XVNA 5I79A 4U7UK 1QRQA 1X4CA 3E1F1 4NJHA 4UUIA 1X39A 2NCKL 3EOEA 1GQJA 3EX2A 4V1Ak 3RF9A 1FKPB 4MSSA 1JNEA 4P2XA 3GNXA 4HK7A 1ZJIA 3AC0A 2J6SA 2VX6A 3UDCA 3Q8YA 1R8LA 3TYEA 3AWNA 3HIJA 2RQMA 3AD7C 2Y1JA 3ALFA 4JKMA 4O0ZA 3TMQA 2VL1A 1D9DA 4TV6A 3R2DJ 1LRQA 1OCQA 3NQAA 2XTKA 4KY3A 1Q5VA 1N7KA 1YE6A 4E3VA 2IPFA 3LYEA 4EBDA 3TH6A 1ME9A 1KQFB 4ZMMA 1DKWA 5H6HA 1X8DA 1EL3A 2ZZ2A 2XY5A 1DXEA 1TA3B 3CK5A 4KO0A 2HGLA 3V7PA 4BK9A 4IXXA 1TK5A 3LRLA 3BGGA 2BJ9A 3CVKA 4UOHA 5E0KA 4YMEA 3E2VA 5F41A 1X9MA 3B8TA 3J7HA 5A76A 5MLCV 4DBQA 3DAQA 2F4VJ 4HNVA 2ZOXA 1TK0A 1G69A 4S0MA 4IMAA 2C1HA 4LF2A 3MPUB 1KFDA 2GCFA 4O0IA 1PGZA 4LS0A 3ITYA 2Z28A 4GCXA 4WJXA 3QATA 4MGGA 1YIXA 4C11B 3FLUA 2OELA 3W72A 2X1IA 1TV3A 1ADDA 2DH7A 3SEPA 4FYWB 4DV2J 4MKBA 3VF0B 5KZMA 4PTDA 4ZFCA 3BMXA 3IJLA 4C6BA 3SY8A 4ZA1A 3WJZA 3I4EA 3ANVA 4GJJA 3ILJA 1NDLA 5KG0A 3RJXA 1VHCA 3CEDA 2VRJA 1EA0A 4GNVA 3SRDA 1C0TB 1ZCCA 3GBDA 3PJWA 5CC5A 4ALZA 4WGXA 2F38A 5ABGA 1A5MC 2XWEA 3PUDA 1Y9OA 8XIAA 2VL4A 1Q1KA 2FVCA 1D2KA 4DWSC 2VBZA 2BM0A 2CYGA 3I4HX 1XJWB 1X6NA 5HN0A 1RK6A 1JPMA 2H51B 1T9WA 2QULA 3U0HA 5L9NA 4USIA 4QZVB 1X7FA 2YBUA 2JC0A 1MQPA 4ZO6A 2Z7KA 2XULA 5IQQA 4JCLA 3FBCA 2FGBA 3RB0A 2GDQA 3LUYA 4HYWA 4IFOA 1PWMA 4DR1J 3K4WA 3RIKA 1B5TA 5H8PA 4NRRA 2ZH2A 1BKHA 1ZJBA 3OLBA 3I56S 4C4WA 2BA9A 3JTNA 3TNOA 1E0UA 1TR1A 1M0SA 1U22A 3PY2A 2OWCA 2BUNA 4GI4A 1UA7A 4C98A 4YTRA 3IO1A 5BXSA 4KWWA 1V6HA 3ZZZA 1N2VA 4N4PA 3IR5B 4S2BA 5DRIA 1WHVA 2DNPA 4C48A 3RW7A 1SMDA 5LNSA 4WKRA 3PK7A 1ZZNA 1Q7ZA 1BTCA 2XFFA 4OHQA 2IXVA 2B7OA 1BY9A 3IMQJ 1KFEA 2Y61A 1YDLA 4Q8WA 4BQ5A 4YVXA 3SECA 3BSMA 1YBTA 4CU6A 1RYRA 1HNYA 1I1WA 5FDLA 4KCWA 3HD2A 4CQ1A 4DUZF 4NXSA 4NA1A 1I94J 2VA2A 2F8QA 4F8RA 1MW0A 1EARA 4C3LA 1GAOA 2PF0A 4NMXA 1MRQA 2A0NA 3FA3A 1JJHA 5KFJA 3UR3C 4RW9B 4RPQA 1XW8A 1SL1A 4Z2IA 2KXFA 3KHDA 4PMXA 1QI3A 4Z1BA 1N5SA 4FOKA 3QPZA 2XH2A 3GRIA 4B2DA 4M5DB 1S57A 1M5HA 3N34A 4YTSA 5CSRA 2B8PA 3WELA 4NLRA 3W5ZA 4DV3J 2OO0A 1B0IA 2I5QA 2ILYA 3CEPA 3RGTA 3D3BJ 3QWUA 2PMZD 4O28A 1J5OA 5D32A 1WUUA 3NWGA 1IF2A 5AZ1A 1NNDA 1O12A 4PUEA 2ZUTA 1MWOA 4DI6A 3FFSA 1J27A 1JJKA 1T9YA 1XMOJ 3A8JA 1IM4A 1GMWD 4ADTA 2ZX6A 2XCAA 3TZFA 1OB0A 3L95X 4E0CA 3KOAA 1Y00A 3CZGA 1UOZA 2BKOA 3OBIA 1OFAA 3C86A 1RWKB 4O52A 3EVWA 5KFVA 4B08A 3NSNA 5DJBA 3QZ8A 2PFFB 1XMOF 3M0ZA 4H04A 2VB6A 2QLXA 4BQ3A 2CQ4A 1NDPA 3W84A 1F3WA 1K9DA 1KN6A 2OX1A 5BYQA 1E3ZA 2YKAA 5IDZA 2J6UA 1QNSA 5FDLB 1CJTA 2I6WA 2PDCA 3HG5A 2GJLA 3N6HA 1CSJA 3A8KA 2WXDM 1YX2A 2Y4SA 4KS0A 2NSBA 4R9XA 4IMGA 2R7QA 3PKYA 3UEQA 3K5PA 1TV7A 3M4HA 1HYSA 1D8YA 1W1TA 1GKQA 2BGQA 3UFCX 3U2OA 5D2WA 4WDTA 4DCOB 3UU0A 3DXSX 1OCJA 4PG8A 2NX1A 3A47A 3SQOP 3WLMA 3JQKA 2V81A 3R5CA 5EWFA 3PPFA 4IDKA 3FGCA 1E43A 2P5VA 3UR8A 2Z2AA 3UA4A 2V5CA 4AQYF 4HSHA 4IZGA 3CV7A 4EZ6A 2M52A 1ONEA 3BUVA 1MQRA 1TU0B 3GVVA 3CV2A 4KRZA 4V19X 2Y62A 1J5OB 3M8SA 5I3JA 5DMNA 4RZ4A 3B4MA 2RU9A 1WF1A 2W4PA 3M2VA 2HVNA 1RH9A 2DZBA 1ZNNA 2DXDA 1JUEA 3WLOA 3UPWA 3K13A 4XD5A 1QNQA 1M65A 2G5WA 3B06A 3MHGA 1Q81T 2EJ1A 4CU7A 3TARA 1UFWA 3QM3A 1PSDA 3AB4B 3T05A 1JAKA 3PZNA 4AXJA 2WSEC 2EK6A 3N4WA 4ZFMA 4ZE5A 2H8XA 2H48B 3G1FA 2CBJA 4H9MA 1ELSA 3H12A 2F65A 4NCGA 5U47A 4DO6A 3PPGA 1TAQA 2X1AA 4QPTA 5B0AA 1DHPA 1CGTA 3WEMA 2QDHA 3OG3A 1CC7A 1KQGB 3OD2A 4F4RA 3NTYA 5C7VA 3QGKC 4ES1A 3BMWA 3RXZA 1CJTB 2N4DA 1XIJA 5LXEA 2CLIA 3OGVA 1XNRJ 4LUTA 3OTOF 2FKPA 1E6PA 4HP5A 4YCOA 4JTUA 4UFLA 2RE1A 5F2GA 4OYBA 4NI2A 1HYSB 5K8MA 3BQ1A 1IT0A 3EWWA 4WD0A 3MOZA 4C8OA 3BAKA 3A4JA 3EPOA 5A8MA 1EBHA 3LPFA 2A5HA 2J47A 2XFRA 1REGX 1XNRF 2YBTA 3SDOA 4LJ3A 2GGEA 4IDKB 1Y5WA 1DTNA 3FGCB 3DMJA 1JF5A 5H1WA 1TMMA 4FVMA 4RZRA 2CNKB 3FMBA 4D6IA 2J8SA 4OJ3A 4V33A 1FRMA 2QIIA 1EX8A 1HBMA 2EPIA 1ZBCA 3BSOA 4PMDA 2XG9A 7PTDA 3M2VB 3R89A 1DJYA 1O5RA 3D6HB 2WAGA 2KVIA 5TF0A 4MK9A 2WMGA 1XIMA 3HFZB 2IJNA 5KFTA 4B5XA 3F4CA 2AQ4A 3PXGa 2JZ5A 2OGJA 4DUWA 2JK2A 1ZRQA 3KM8A 3WFLA 1N56A 3IARA 1RT3A 1B4EA 5AHMA 3LF0A 4RX6A 2ZDPA 4MIAA 4ZPDA 4TTUA 1NEYA 3W1MA 1AFIA 1WC0A 1XRVA 2UBPC 1D0EA 3BCJA 4G5DA 4MJ4A 2DUXA 3L67A 1TKXA 1URNA 4GIRA 2NLWA 3XIMA 4BA0A 1YDYA 3VU2A 3M8YA 2VG7B 3W1QA 1RV8A 1SZGA 2G2YA 4LUTB 2ALRA 5D2VA 2BBFA 2GJRA 5JMUA 4RKUC 5DLCA 2WK4A 4YJ5A 4GD0A 3DRSA 4XG1A 3CL6A 3BSNA 3F0NA 4A8IA 4JV5F 3CLWA 4HYRA 2CJXB 1OFQA 4DSLA 1PCKA 3OYZA 4YY3J 4BWLC 3DOLA 3QJAA 3IR7B 3CPUA 3SFWA 4CLWA 4CQBA 4CT8A 3APGA 1X8FA 2PDFA 3OZMA 1QW9A 3ZT5A 3JAMY 2RDDA 3EA1A 1OYEA 5AXMA 3GY1A 2J6XA 5KFMA 4Y2MA 2VIHA 4ECVA 1Q4NX 3ISIX 6TIMA 2XO6A 4QQ3A 2ZC8A 1HBMB 2IMRA 1EUAA 1SGJA 4PZVA 1VK8A 4B5NA 1NO8A 1BVZA 3N01A 1X6UA 2VFDA 4C7DA 4GC6A 2J0XA 2BVZA 1S6PA 1M7OA 1FDBA 3SGZA 3T8LA 3QGHA 4AYBD 1K7FA 4DJED 4KH2A 2WHOA 1G67A 1RJJA 4PMRA 1XM3A 1Q66A 2VFTA 1MUWA 4M1KA 1KM1A 2PLJA 3OLIA 3UJ2A 5J1EA 4IFRA 2E7WA 3HZEA 2WQDA 5U7SA 2M5YA 2BV3A 2F61A 4QWEA 4QEEA 1V3ZA 3X3UA 2D41A 3EDEA 1BD6A 2ZZ7A 3KBJA 4CIOA 1A53A 2YKPA 4N77A 2QCCA 2YL8A 1VENA 4HVXA 1M5KC 5LOQA 1TKXB 4U95A 4KESA 2RIJA 2ZQ0A 3OTEA 4WYWA 3GUWA 3D7SB 2V0TA 2PS2A 4FIRA 1MRAA 4TQTA 1PB0A 3RBZA 2K3KA 1KLZA 5D33A 1S4EA 4H19A 4X62F 1EXBA 4H8NA 3DRSB 5C6MA 2DGAA 2QUVA 2RVJA 2PMHA 1DORA 2PP0A 5G2HA 1SFTA 2VENA 2J9XA 4PUJA 3W2KA 1FK9A 5CSSA 2BS9A 1YSJA 4KJIA 4ED2A 1E6ZA 4C1LA 2VZVA 3AOFA 4O14A 5CSUA 1R8PA 3DOLB 3GYNA 4JQ2A 4TR9A 2PFHA 4HCDA 4C3MA 1WKFA 1WI8A 4I1TA 4IPPA 3RO8A 2VC5A 1JFXA 1O7AA 2DUZA 3MZIA 2GAGC 4BS2A 3O0KA 4D2JA 4NZ3A 5DEZA 1FHDA 2VURA 3HKZD 2P0IA 5H1SV 3TAPA 1I2QA 1WZMA 3VMPA 1B9BA 3VTRA 3H4DA 1JZ3A 3G1HA 5CABA 4FS1A 1M5SA 3P82A 2HBRB 1S6PB 3HQPA 2PE4A 2CNCA 1BWVA 1QOQA 3MEKA 4GK8A 2O66A 1W5QA 4QG6A 2J77A 1LQAA 2WVVA 2HK0A 1U0SA 3UNYA 5J1EB 3THCA 2XMJA 4WKFA 4EF9A 4A8YA 2E1MC 2UUTA 1T6MA 4N9CA 4KB7A 3NQ7A 1BQCA 3PANA 1HQ2A 4RNNA 3AHYA 4MPQA 2R4FA 3HPZA 4HT3A 3OZPA 4JEJA 1FDNA 4ZL1A 1HHTP 1PYSB 1PTAA 2IDLA 5ABFA 2CWKA 3ZNJ1 2YWHA 4ZVPB 5KTQA 5H9FK 3PZPA 3YPIA 1K02A 4CQAA 2HHXA 4L6OA 1EZZB 5CJ5A 1F0XA 2ZX7A 5SUHA 2CNLB 2QG9B 4QDMA 2H3BA 1EJVC 3KE0A 4IRKA 2GWNA 4IPNB 5HMSA 5LMNF 3FW6A 4I9JA 1FK9B 4W8AA 3H5SA 3QBUA 1JJ4A 1XSIA 3GM8A 4LQ1A 5E7OB 3KDNA 2HROA 3H24A 4O23A 2O55A 1Q13A 1N5TA 4MYAA 2PC4A 3HSGA 4DL0C 3KJNB 5CCMA 2VRKA 1MUCA 3GTIA 1I2RA 4ANDA 1BGAA 3F73A 5GQBA 1QASA 5H9EK 4W7UA 2V5HG 4JTJA 3R3TA 1WKEA 1NFGA 4C6DA 1EJWC 5I06A 3MAHA 5G1MA 4MJZA 2WSKA 2CZDA 1I0BA 5D8ZA 2XSBA 3WK2A 4LSNA 3W6MA 2PCEA 2XGPA 4L56A 3SCKE 3IV8A 3CWJA 4YWSA 2CJYB 1RZMA 1G3OA 4QS6A 4Y96A 2G0CA 5EY5A 4B5UA 1WDSA 1UL3A 3EA2A 1IBKF 2WVVB 1TRDA 1HR0J 2EPKX 1QO2A 2Y85A 3CQHA 4PB3A 1B3WA 2DQWA 4LVGA 1E4LA 3W73A 5HR7A 3W61A 4PCQA 1TPB1 3L5MA 2HHSA 1MQQA 2DJXA 2VCBA 2OGUA 5K8OA 2BY0A 1WDWA 4FNUA 1K9EA 4I6AA 2B0GA 5ABFB 4A21A 4DF2A 3WUFA 1U2CA 4JTDA 2DGUA 1MNSA 3W9JA 3W81A 1TV5A 1RT4A 2CZ5A 4C6FA 5JUVA 1JGIA 3W7MA 5D4LA 2AKMA 3STEA 1Q53A 1C9DA 2BJ3A 2IRXA 2DVIA 5EKYA 4CQ9A 3TTYA 4WIWA 2PP1A 1RWOB 2OPPA 1PHWA 2FDSA 4H83A 3Q94A 4KWOA 4NMLA 4LFAF 1Q8BA 3UXLA 3O16A 4K0KF 2OZTA 4CN1A 3NDZA 2V9KA 4NAFB 2NSOA 1XJBA 1O94A 3VIGA 3KLVA 1N82A 1KR4A 2JWNA 3C52A 4F4KA 4DLMA 2OPSA 1QLNA 2AJ2A 2RU3A 4F0LA 5A3HA 3S2NA 3W7KA 3GIIA 1H2TZ 2Y88A 1UD2A 3JVAA 1GW9A 3BLIA 4LSNB 5LNUA 1LKZA 3QMQA 1MU2B 2XI3A 4D6EA 1WWHA 3CCZA 1N88A 3DLKA 5IS2A 2JVOA 3HG2A 3FSUA 4PMOA 4CU8A 3SAZA 3WBAA 4DUOA 1C4CA 4UFJA 2DIEA 4PCTA 1UVMA 4PRFA 1R86A 4ZN1A 3BC9A 3NPXA 3F41A 3UG4A 3Q89A 2HEJA 4ZBCA 1VOMA 3NPUA 1RP8A 4DZIA 3NWRA 4GIEA 5J2QA 2QV6A 4CDIA 2YKOA 4X0VA 3WH5A 4JI1J 2E44A 3VZHA 3ERPA 4DSFA 2YCLA 3CTRA 2D2JA 3GLCA 4G8TA 3T1YF 2FJKA 2WSCC 4A3UA 3DLGA 1RT4B 1OY9A 3A8EA 3CHFA 4FKXA 1P1TA 2E9LA 3I0SA 4LS1A 3URAA 3H4XA 2ROGA 2J8GA 2BEFA 5HINA 3UCGA 5BOEA 4RDZA 4HCLA 3PFEA 4C6IA 3T0DA 4PGLA 2OPPB 3M0JA 2VBYA 4DWSB 2A7NA 2ZXAA 4JY8A 1POKA 4DQRA 4K50A 2HKEA 1L6WA 5KFEA 3FJNA 2GQ9A 3GTXA 2J9YA 1TV8A 4CNUA 1RHMB 4ZITA 4H7ZA 5F9LA 3EX4A 3PZOA 4OZ1A 3R8GA 5LMUJ 2NW0A 2P8IA 1M53A 3FA5A 2XN1A 2AGTA 3GG1A 4OFZA 3US5A 1NH7A 2VQFJ 2NXGA 5BXPA 2YNIA 3MECA 4OX6A 1FE4A 1P6TA 4IWWA 2QW5A 2AEFA 2ZBIA 2JEGA 4PMYA 4A8QA 1ME7A 3KP0A 2WC3A 1CYGA 2XZTB 2UU9J 3MGJA 5I3KA 3DLKB 2UZAA 4US6A 1LT8A 4MB1A 1S1WA 3THQA 4M3PA 1SJFA 2J8TA 1QSYA 1EXPA 2EFQA 4E8GA 1W7WA 1TK8A 3WF0A 4PN2A 1LQ0A 4GI9A 4B3OA 3NAIA 1YXYA 2OKQA 2NPIA 3GIPA 2ISDA 3VVGA 5J2QB 4W89A 1SM9A 1NSQA 1VHIA 1Y7PA 1A0CA 4QNWA 3VDAA 2YCLB 1QTWA 3N5BA 4H41A 3DFOA 3DLGB 1AJZA 3O44A 4UFHA 3L0KA 5I3PA 1E0XA 4FXDA 4O3PA 1QDUB 1UEVA 3I0SB 2DRAA 2VASA 2MJUA 5CZ0A 4ZHRA 1JIBA 3EPGA 3GC4A 1LTDA 2C2KB 2FHJD 1C8XA 5KFGA 3VKJA 3WLKX 1EC9A 3LCWA 2Y1LB 4LF6F 4QYZJ 2I5GA 3IA0A 3II1A 2GSJA 4D72A 3UN3A 3IK4A 2O3DA 6REQA 4DQPA 2HPMA 2C2DA 3ILLA 3AB2B 3H42A 1LROA 1NB7A 3S1TA 1AD1A 3HVAA 3PR4A 4AZGA 2VT0A 2OZ3A 4ZVUB 2INEA 3P5TL 3FKRA 3HM9A 5KZDA 4C7GA 3LXAA 2MXYA 3CQIA 4M80A 4Q7IA 2LXUA 1LOLA 5FD0A 2HJPA 5AVHA 2FIUA 2DNLA 2GDVA 2YNIB 3ILIA 1EHNA 3MECB 3S5OA 3GTFA 4TY8A 3CW2C 4YDXA 3REQA 3R43A 4IJRA 4KMQA 3QHOA 4ZZ9A 4LCQA 4C97A 3TUPA 1UJPA 2KJWA 3IWLA 5IDIA 2CQHA 1S1WB 3EWUA 3GR0A 3NM3A 3HHLC 1VPXA 2FZGB 4AAJA 2AT1B 3CBWA 2FY1A 5EUHA 4B3OB 3V16A 3W38A 4Q7NA 4JTEA 4N0RA 4Y9OA 3RBXA 3ITTA 3DKDA 3IANA 3AMCA 3LLFA 4GXMA 3BM7A 1JX4A 1ZHAA 1MFUA 3S46A 3ZWTA 2G1HA 2I38A 2HMCA 1QNPA 3ISNC 3MUY1 4G1QA 3NS7B 1VQTA 5I03A 2MKKA 2PTZA 4XZBA 4JI8J 1GJUA 3OVAA 1UJ6A 3VGEA 2FH6A 1K1SA 1F9CA 2YKNB 3T09A 1OGSA 4GQGA 1S6QA 2POKA 5CYMA 2XLKA 4NF7A 3CXOA 4I56A 2DITA 2ZX9A 3R5DA 5BZAA 4F50A 2G8ZA 8AT1B 6REQB 1TUVA 1T94A 2XUCA 2P76A 5SWUA 4JI8F 3BXWA 4WQ6A 1HQUA 1NEEA 1KRMA 2JGYA 3BBBA 3UVIA 2NYIA 3QYQA 3HQ1A 1UKTA 4CVUA 4OECA 3ARQA 4UR7A 3IGHX 4KF1A 4B91A 1YJ7A 3ARXA 3GKAA 3WG6A 3CIWA 3MPVA 4OZ3A 3W64A 3AQPA 2JIEA 4MG4A 5FJTA 4UOZA 1F3EA 2V9DA 3MUMP 3W24A 1Q3NA 4TY8B 3REQB 1M1BA 4L5ZA 1YQHA 3PO5A 1R3QA 5D03A 1J5TA 3OFFA 2DP3A 3OP2A 2WO5A 1VB9A 5AZ0A 3R8RA 2CLEA 2HQ3A 1ZP3A 4FS2A 4AFYA 4F26A 5DG8A 4ZPBA 3TW9A 5D9MA 5JU6A 2BOAA 3E2RA 2AWZA 4V28A 5BNKA 1ZAVA 3T4CA 4NRUA 2MZTA 2B9WA 4E98A 2QCEA 1OD0A 1OQFA 2F84A 1WG4A 4K4SA 2BHZA 4G1QB 3HGSA 1GVFA 4QJ3B 1T95A 4IQMA 5CYJA 4M81A 3ZWSA 1XN9A 5CZVA 5EBAA 3G1SA 1F8MA 1FESA 4WIIA 1ZP4A 4EIVA 2G3MA 3GCXP 2G3FA 1S6QB 5CYMB 1XP3A 1YGYA 4D71A 4ITSA 3QGIA 3TYAA 1NSKL 4BWLA 2ZFHA 3T08A 4U3AA 3BL3A 1K9TA 2EFGA 4Y7EA 1GHSA 4DL3A 1T8XA 4MLJA 3RYSA 1ONRA 4N9BA 2GVZA 3MQTA 1QI0A 1DWHM 3R6IA 5KFNA 3PWIA 5HPCA 1HQUB 1RALA 4MOZA 4Z17A 1XH2A 3HO1A 4HT7A 1IZKA 4ZJQA 3QHNA 3BO3A 1TSIA 4GXPA 3Q83A 4URSA 3ELFA 3W2LA 2HMIA 5I3QA 2VFIA 1VHNA 1OG6A 2XH0A 5KINA 3APTA 3W29A 4X63A 4AUBA 2M7SA 4PXDA 4JIIX 3TEVA 4GO8A 2PN6A 2FTPA 2PT0A 2IYGA 3P80A 2R8HA 2XSFA 2ZTKA 1HL2A 1TTIA 5DRKA 3I3DA 3CJ4A 1WHWA 1PEZA 3HPXA 1H73A 1K8AT 5IBXC 1S2AA 4INFA 2NQLA 2CPJA 9XIMA 2X0SA 5DQPA 1GOIA 2XCPA 4S3GA 1TG7A 4F2SA 2WKGA 2QMXA 3MD3A 1KQSR 1N33F 2P2CB 4MIBA 1GMWA 4O4RA 3SCPA 2F4FA 3JS9A 4UTIA 4XTIA 2V4JB 2UY3A 2CCRA 1TUGB 1Z44A 3EVOA 2EXOA 3F03K 3NL5A 3WEZA 1PL9A 5I77A 1FDYA 1U2RA 2XGQA 1B90A 3QZEA 3C0SA 3TYCA 1DWAM 3OTRA 3IIPA 4JTKA 4C5YA 5CJMA 2G4JA 2YQ3A 1N55A 2DT9A 1T9VA 2RHSB 3D1OA 1KFSA 5I3UA 4AY7A 2B4PA 4C5ZA 1WUEA 2ALDA 2QVNA 1F1BB 3GC5A 3VOCA 2PZ0A 3T0CA 3J7A1 4ED5A 2GVZB 2Z57B 1R2SA 2YWKA 3BGJA 3WH6A 2XMTA 4CO4A 1E1EA 3WBYA 1Y3KA 3BLLA 4P8UA 3S8SA 2OYMA 4J91A 5CBBA 1GTHA 1WAUA 4A8WA 1U4BA 1UZDA 3NDOA 1OC6A 2HMIB 3WJYA 1XYMA 3HPAA 3OVQA 4ZCIA 5K9XA 1NRKA 5AYIA 4IGMA 3M46A 4HNOA 5CQ1A 4ED0A 5IWAJ 1SJ4P 1LFWA 2Z2UA 2DHXA 1W25A 1XGZA 4TTGA 5DLGA 4JTQA 2V8ZA 3URBA 1MVYA 4KV8A 3VFLA 1TJ0A 2C2EA 1TIWA 8RUCA 1KRBC 2I5IA 3DXBA 2OOFA 3NS5A 3N2TA 3K2GA 2WM0A 4U10A 5GJMA 2MYFA 1L9WA 3N25A 2D69A 4PRTA 2BX6A 1HBOA 3ABXA 3SSJA 3KTXA 2N4CA 4KSEB 4RDVA 2FGOA 3CDWA 5CGQA 4FLQA 3IV3A 2DGVA 2E29A 2KYXA 3UWYA 1NDCA 1FH8A 1ZJHA 4IMCA 4WPAA 1F76A 3H59A 2QPUA 1UP1A 2QMKA 4TU8A 3KLHA 4TMBA 5HJLA 2P6TA 3WBXA 4ZVHA 2GUYA 4HNTA 1RU1A 1DRZA 2GJPA 1RHJB 5KFYA 2VELA 1O1HA 3STGA 2AEMA 2F1FA 1Z3NA 3EUNA 1FRKA 5I3UB 3U4AA 4ZB5A 2G50A 2OU4A 4KT2A 1JZ6A 1B70B 2V8GA 2YYTA 3NXLA 3Q0AA 4OI2A 4CLKA 2OODA 3HG4A 1AQFA 2HG4A 2H9ZA 1AL7A 2F9JA 3PW2A 1VLYA 5CBJA 2ABYA 5DX7A 1FWHC 2W2OP 1FWBC 2VRQA 2QCNA 4ED4A 2MSTA 1EUNA 2RH9A 3LERA 1W9XA 1MWZA 2OSQA 3HVRA 3AJXA 1XLGA 2AHOB 2W8LA 4F0KA 3W74A 1UD5A 4LF9F 5AHNA 4JHOA 1NSJA 1K9MT 4LX4A 4C65A 2NUHA 4H9ZA 1DQ8A 1HO1A 4GOAA 4KV8B 2HV5A 4O1EA 2NVCA 2HRUA 3U5UA 1E9ZB 5E5NA 1AL8A 1TV6A 1FH7A 2FDNA 3W1UA 3D4JA 4P74A 3WYZA 3H5YA 3RITA 4ZXOA 5EWGA 3MKKA 1RJQA 1TFYA 1UPMB 1HBOB 3M6VA 5C5JA 3SW6A 3DDMA 2P5NA 2HURA 2MMYA 2GVLA 3PR5B 2VGBA 2V5DA 4N9EA 4C6EA 4N9DA 4HNUA 2OLAA 4NJJA 2ZA1A 2WOQA 1W5MA 2CLHA 1EDGA 1CW2A 3KLHB 3RB6A 2F8MA 4YN3B 2ERRA 4I8YA 3VABA 1VFUA 3BZJA 3AXIA 4WK9A 1AQ0A 2WVSA 5C9ZA 2QXWA 5T14A 2DQXA 4M24A 1Y65A 3WMBA 2E9BA 1PYOB 1AUSL 4TX8A 1VGYA 2E77A 5JBFA 3NOCA 5AC7A 1XRFA 2JLGA 4UR9A 1R31A 3EZOA 2AKWB 3M5VA 3VMNA 3VX1A 1JYXA 1VCTA 2RRBA 1Q8LA 1WG5A 4F4ZA 2V82A 1PJ6A 3LAMA 1JZ8A 1XYCA 3FV9A 3IAS9 1ZM9A 2Z0IA 1NP0A 1R85A 3A9BA 3DI1A 4JGDA 3R25A 5CPLA 1LK5A 2HS0A 4NLUA 2DSZA 3LHUA 4JTCA 1JCLA 5AYXA 2ACYA 2M8HA 5AC4A 2BANA 2F8HA 4XZWA 2KT3A 2VP8A 4OVXA 1B99A 1FD2A 3ZS4A 3ARPA 3BVJA 4FPIA 4IUOA 4PSPA 1UD4A 2PDAA 4ERDA 4GUJA 2XJ7A 2O7QA 1TV6B 2E9ZA 2VBXA 2ZBQA 4W5ZA 1HI1A 3FS2A 4CQ8A 3DH7A 1TTJA 4UQCA 4ELUA 4CKQA 3W7GA 1QAPA 2JX2A 4MZ1A 1GOXA 3B8VA 3NSMA 1R30A 4UOFA 1DTUA 5D77A 4ELTA 2FFIA 2MQLA 3RRHA 3G0SA 2P6SA 3H2AA 3VAFA 3BV7A 4KEZA 2CC0A 4JP8A 3DDIA 4HMCA 4DJEA 4DX8H 2WC4A 3OL9A 1AW5A 3W3OA 5BCAA 1R8AA 1TVNA 4DY1A 3SMZA 1MDRA 3TWAA 3ZTRA 1UA0A 1DTTA 3QF0A 3TX0A 1WOBA 3C6CA 3CSKA 2R7RA 1Q8AA 2CEQA 3GW3A 4WR3A 3GNNA 2D9PA 2DDXA 1VQSA 2FVMA 1BQGA 3PBYA 2LQ8A 2VX4A 3GAYA 4NL5A 4H9YA 2GPTA 3WH8A 4IF2A 3LWLA 2QV4A 4ECLA 1KKHA 6PTDA 3G9CA 3R2CJ 1W1ZA 1A5BA 4FNRA 4U3CA 3GYXB 1ME8A 2WCGA 4YVVA 4GPNA 1VI7A 3UCDA 4K6AA 2BANB 3PW7A 2L48A 1HW8A 1UUOA 3G71S 1HKVA 1XLJA 1B2YA 4A29A 3MR3A 1DHMA 4K59A 1SJCA 4JICA 3T5LA 1CNVA 3RR1A 2DB1A 4MNMA 1BFNA 3A3HA 4F3MA 1GXTA 3U1NA 4X64F 3IPWA 3CCRS 1H2VZ 3AFBA 3BH7B 3LHTA 1XIDA 3LTOA 1NK4A 2G0JA 3M9MB 2Y0FA 3AY0A 4W98A 4YVPA 5FJOA 3P49B 2K8GA 3KUGA 4DR5F 4S3FA 1VLIA 4K7QA 4QFUA 3C2OA 1E0VA 4MUPA 1ZL1A 3A8IA 1RY8A 3SYZA 1QSSA 5EU9A 1FRJA 1RBAA 2NQ5A 3BCDA 2H90A 3D66A 1VMBA 3QRRA 1WSRA 2OEMA 3S2JA 3T6CA 2CQGA 3MW7A 3TSDA 2VV5A 4NOHA 4JL2A 1JDDA 3E74A 1L6GA 1F5AA 4FLOA 1US3A 3MR7A 4NUWA 3TEGA 3XISA 4GY1A 2W24A 1PTGA 3OVGA 4RW8A 2CLFA 1POJA 5DY3A 1QPNA 2FIQA 1P1MA 2XHCA 4DR3F 3QT7A 1LWXA 2WAQD 1N36J 4EWTA 2SXLA 2NREA 3S83A 3EWCA 3ICJA 4HPHA 3AD9C 4E4FA 4UQTA 1XMQJ 4IQEA 1FXLA 4LREA 2XS5A 1WDTA 4KWUA 3Q8UA 4IIFA 2PMWA 1P48A 4W86A 3WDQA 1TMLA 3QEZA 1MUMA 1P6WA 4FYXB 1TZ0A 4MWAE 3UYCA 4D6FA 4PPZA 1QSLA 1BGXT 4DXKA 1RT1A 3DECA 5BYWA 4HACA 2X09A 5LKYA 1XMQF 4OJHA 3LRKA 2DZAA 4A2RA 1S3HA 4GKLA 2ZH1A 4WIQA 3AOBA 4ECWA 1VHFA 4R0EA 3OPKA 1SH3A 5KITA 2IXUA 2Z29A 5BJRA 3QFEA 5L9FA 3HHLA 2P8CA 2OVLA 4RNFA 1OFOA 2DJWA 4HHPA 2HHPA 1GFWB 1W31A 2N7YA 3CC2S 2CZVC 3TA9A 1AVAA 4ECZA 1GTEA 3UJFA 4IP7A 2LEAA 2DNNA 2G41A 1IYXA 3D1QA 3L2IA 2MANA 3B4YA 2BXVA 5CLWA 1RKIA 1A3WA 3TMLA 4MK7A 1T05A 2HE5A 1O5KA 4DWDA 2Y0BB 4AFFA 2JE8A 3FIGA 4RW8B 4I64A 2O9TA 5FJUA 1FFSB 1QVGR 1W2IA 1DEDA 1KFCA 1HNXJ 1D09B 3H7HB 2FVPA 4XUGA 2H65B 3VKBA 9RUBA 4O15A 3UCUP 2J9ZA 1F3FA 5LIWX 1BF6A 3JTPA 2FUG9 4Q32A 4ZCKA 2Y0SD 1GQNA 2Y8WA 1OADA 1QW7A 2OX4A 3SEOA 2ZOFA 2XMKA 2OPRA 1HNZJ 1TX0A 2W2PP 3FHAA 4BBYA 2IMWP 3VGFA 2FGLA 3FC9A 2V0NA 1LQ2A 2W2QP 1L2UA 4KEVA 3BG9A 1RBOB 1RT1B 1Q4RA 4HACB 3TJ8A 1I60A 4YR0A 3AS3A 4JI6J 1HGYA 4URGA 3VNDA 3GTYX 3VZIA 1VEOA 2XIJA 3CUXA 4ES3A 4OYWA 3TDFA 1FJGF 4LR8A 3AMDA 4QPXA 4V19J 3K5MA 3TXZA 1GQLA 2WLYA 2EFNA 2DZTA 4UFKA 1K8XA 3MWAA 4FNTA 2DNQA 3POTA 2QF8A 5KT4A 4PR4A 2DEPA 1EETA 3HHLB 2B51A 1WDQA 4WFYA 3NZGA 2VKZG 4Z1CA 3T4WA 3WNNA 5J2NA 5LA2A 1DIOA 4OWGA 3L9ZA 4K8EA 2XNQA 2ZVSA 2R6OA 3HG3A 4J9JA 1T99A 1J0HA 1U2FA 4BC7A 4O0NA 1O60A 1JCYA 2D22A 3W1YC 1J0KA 2VD9A 3OZYA 5ETPA 3BS9A 1T05B 2WNZA 3KCJA 4CQDA 4NG3A 2B9EA 1HVXA 5CZXA 2DSUA 4FF2A 1AXQA 1UCNA 3QRHA 5ETKA 3LANA 1JPHA 3O1NA 1T11A 1CJKA 2B9XA 3RM8A 3SIMA 4O3SA 4RK8A 2UXDF 4H8UA 4A8LA 1JXJA 2CQ2A 2K3IA 2WJFA 4CO1A 4U67Q 1WTFA 3NGSA 4XQ6A 4FALA 2G0WA 2C3OA 4R7WA 1RCXB 1X4GA 3C56A 3LPGA 4Z2JA 4X4RA 2Z2YB 1YHQS 3RMJA 2VNCA 4LNCA 1K8YA 4NCBA 5DM6Q 5BMWA 4MPKA 2XSJA 1J5EF 1ZPWX 4AXKA 2E1AA 1RHKB 1R3YA 2XZ7A 2CJKA 3PBVA 4HMDA 1JRBA 1MLAA 2ATSA 4JI3J 3CDEA 1JYVA 1DIDA 1IIHA 1MW2A 1K4GA 2VMFA 3GU0A 4DJDC 3I82A 1XX1A 1JEZA 1ZTTA 1S9GB 3AA8A 3NURA 4PB5A 4QR1A 5EL1A 3KNGA 3POTB 3WDOA 4XB3A 1M90T 3KS5A 2PEHA 1EETB 1UWRA 3WL0A 5IBXA 5DDQC 4KH1B 1VFTA 1LLOA 2Z26A 2WC7A 5J2NB 3OB8A 3W88A 3HSDA 4J9MA 3OU8A 4PUOA 2IKIA 2ZDSA 1AT1B 3G6MA 2HS6A 2ATMA 1CXHA 5M1TA 1ZGDA 4WUIA 5FOOA 5HQLA 1R8BA 1VFLA 1KLYA 1FWDC 5J04A 4OLOA 2C3MA 4GY7A 4Q2LA 3FGVA 2V5KA 2DSKA 3PB2A 4CD7A 3LLXA 3VGSA 1RB0A 4DB7A 3K1GA 1NTHA 2J24A 4ZVQB 3KS6A 2OTJS 3MSRA 3KOWA 2QJHA 1VCGA 1E0TA 1UWAA 3RMEA 2ZRUA 2WVEA 4L6V3 2DT1A 1CGVA 4U7UD 3NEVA 4ECRA 3IS9A 2W2NP 2OYKA 1U1UA 3P81A 4LSZB 1R46A 3KW3A 2CBUA 5FESA 1OF6A 1FBAA 5C2CA 1H62A 1A5SA 2FD2A 3RHGA 3PX0A 4DFKA 5KFXA 1MDLA 3F4DA 2XSJB 4UTJA 4N6FA 1GYMA 4JB8B 1HL8A 5FLXU 1U7LA 3KLEA 2YZRA 3TZWA 4DL2A 3ECQA 2F6KA 4QCLA 3NRBA 5HMXA 1NHKL 4CM0A 2Z1XA 4U96A 3CJ3A 1E5JA 2B8QA 2I2YA 2F2KA 1EJXC 3DENA 4FXWA 2Y1RI 4JN6A 3G1YA 4ADUA 2BDQA 2EEXA 3TVAA 2MZRA 4DZHA 2C13A 3GIMA 1AMKA 1MXGA 3VXGA 3ZM8A 1V5VA 3O5TB 4NYYA 1IKYA 4OJYA 2FHOB 2FHMA 4YHGA 2DGTA 4LTSA 1ZFJA 1VQOS 4NU7A 4C0BA 5HP1A 3DI6A 2DEIA 1X96A 2GQ3A 4LVDA 1N8RT 4PUOB 1O68A 3KTSA 3V1PA 2HGNA 4DVOA 4JHMA 5DELA 4MMWA 1W3HA 3UG3A 3PV8A 2VFHA 4O1AA 4M94A 2C1EB 3T5KA 2FB0A 1S0VA 4GYPC 1FI4A 3FZ2A 4ICMA 4UMAA 2X7WA 2E9TA 1KD1T 4HPGA 2AQWA 4U5KA 2H5IB 3TVYA 1QAJA 4PEKA 2ZC4A 2VG5A 3BR9A 1Q86T 3NPWA 2VPWB 4ECSA 1XNQJ 2I7GA 2B43A 3IS9B 2POZA 5A8OA 1SO4A 4RW4A 3PJUA 5HWJA 3BOFA 1OFPA 5HOSA 3G8TA 4F40A 2EO7A 2J7HA 4UTWC 1VPQA 4C6OA 2L9WA 2XS2A 4HHJA 2IQTA 1E6YA 3NEKA 3U02A 5LYRA 3N6QA 5M03A 3IIZA 4DG1A 4Q8NA 3P8IA 4ID8A 1XPGA 2ISWA 1RT2A 1RXOB 3R97A 2QA4G 4ED6A 2KZMA 3KLEB 1XNQF 2HVIA 4YQWA 3RPTA 4HTYA 1BWEA 4O50A 1E51A 1HXJA 3N3TA 2GGGA 2HVOA 2HXUA 3A24A 3S42A 2HRYA 2IVFB 1CX9A 3SO7A 4OUEA 1T3OA 2UUCJ 4B3MF 3KRZA 3ZVIA 4EU0A 4L4PA 3KJQB 2JEPA 3FEXB 1ZH5A 1H7PA 4ZOEA 3VKCA 2M3DA 4J9QA 2J88A 4NYPA 4M95A 1N8WA 1H2JA 1D8CA 4QLKA 4CN6A 4QWCA 1TR9A 4DZ6A 3KK2A 3G6LA 5GNXA 4RNJA 4MB3A 3EB2A 2BWGA 4JX4A 4LB3A 1IKYB 1W91A 2RDXA 2DXFA 2M9KA 4L73A 2H8ZA 2UUCF 5KT7A 1VH7A 3AISA 4W5UA 4XPEA 3IM9A 3DI6B 5KSWA 3FOKA 1U1LA 3U1MA 1KM2A 4D6HA 4EMDA 4WKYA 5D4NA 2ODOA 1LCOA 4ZQMA 2FJUB 3RM4A 3TSMA 2BG5A 5XIMA 1VGAA 1VLWA 3GNDA 1EBGA 3W1TA 3E02A 2GHWA 2J9EA 4IX2A 4LUBA 4DUYF 3S6DA 3CJ0A 2BB0A 2VEIA 4RV3A 2IQ0A 1KC7A 1XBXA 2RGLA 2W62A 4GUHA 5M3WA 4IR1A 3PYFA 3KK1A 3W65A 2YWWA 4DL4A 2VG5B 2GA7A 1PIEA 5EB8A 2O01C 1A5KC 4JIPA 4RW4B 1CIUA 5DG7A 2GJNA 1Q82T 3BJFA 3WMSA 1P1LA 3TX8A 2NXCA 1PJ7A 3GS6A 1FKOA 2XM3A 1E6YB 1NP2A 4CVWA 3MOJB 4DG1B 5KFIA 2V2ZA 1KGXA 2HZVA 5BR8J 5CCZA 3V2UC 4G2DA 1R27B 4J3VA 4F36A 3PF3A 2YA0A 3LY0A 3TROA 3NQDA 3UBPC 3LB0A 4QLJA 3VINA 1BKSA 3GNOA 4XIAA 3W02A 5JMNA 3E8OA 3IJ8A 1NK7A 5FAGA 5FSDC 4K4XA 3C3UA 3CUHA 3H2FA 1X98A 4U2ZA 3GLJA 3PBWA 5DDOC 1FWCC 1VCFA 1WOOA 3K4DA 4B3TJ 1RP5A 4H4KA 1KQKA 4WY0A 3KK2B 3UQNA 4MNKA 1EWDA 4K39A 1UR0A 3BQ2A 1WOPA 3M8WA 1JJCB 3UFYA 2W66A 5DCBA 1ODZA 5GNYA 3GP9A 1QAIA 4Q0BA 1GW1A 3VDHA 3W82A 5C0QA 4QBUA 1D9EA 4S3BA 1KLMA 4PR6A 1OPZA 4JFVA 4NZ1A 3D5MA 1DWGM 5KG2A 3EPIA 1X7VA 3ZZUA 4FF7A 2EG6A 1LOQA 3CTLA 4GCAA 1WKLA 1UKSA 4NZFA 3Q8SB 5I09A 2KKHA 1J79A 4JV1A 1FOBA 3KK1B 2GNKA 2Z1BA 4GVGA 3ZR4A 3ITVA 3NAVA 4N41A 1G1YA 3C2EA 1H1ZA 4P8VA 1VRTA 3DGBA 2GYIA 3OOQA 2R24A 2ZRYA 1B31A 2FLOA 1VQ5S 1W9PA 4AU0A 1RVKA 2KO1A 5DT7A 4IJCA 2PE8A 4DF4A 4MNLA 2A79A 1SSDA 4PMUA 3CC4S 1KKOA 4GFSA 4BFAA 4QE1A 5KFCA 3UD3P 1UWUA 1RAOA 4O1BA 3AJDA 3TV8A 1TJRA 3PSVA 5DMYA 4WRHA 1A49A 4LALA 3UXKA 4E2BA 2CKWA 3K5OA 2KT5A 3GD6A 3PKMA 1JRCA 1D9FA 4QAWA 4K2SA 3QW4B 3SN1A 1MEWA 3FEQA 4Y00A 1C8QA 3E0VA 2BM1A 2VEPA 1W1PA 3UN5A 4WY0B 1LDCA 5EPDA 2E25A 5BU6A 3CUNA 3V6JA 2IKHA 4W8BA 4I6KA 2J75A 3S6TA 4DU8A 3ZC4A 4ZENA 1KCXA 4GWEA 3JUGA 3NVTA 1IHIA 4Q0BB 4KRUA 1J01A 1UR1A 4S3DA 4N4QA 1RD6A 3WQ6A 4RLEA 4W4MA 2YJQA 3OLGA 2B0MA 3DLLQ 4JXCA 2WSQA 3TQ0A 4AZ6A 5HQMA 3OXLA 1Y0EA 1GOKA 1SZRA 5KFLA 4B92A 3VIPA 4DL7A 4LCRA 3HM7A 4OZ2A 3VWSA 3MR5A 4ZVFA 3G1XA 3VE9A 5ETMA 3GIQA 4LPCA 1UEKA 4NLVA 4AMAA 3FNDA 1WOAA 1VRTB 1DWIM 1S5TA 4GZIA 4RX0A 1R6YA 1DJZA 1PSCA 2L3MA 3R11A 3EZ4A 2RF2A 3AJ2A 3HU7A 1I2NA 2PGWA 2PEBA 3ARTA 1LOSA 3M6WA 3PZUA 4AZ5A 5CEWA 3TJIA 4H8VA 4I6WA 3PZIA 2CZFA 3VD7A 2DV0A 2MPUA 2GUUA 3OYXA 2XU2A 5KZEA 3QC3A 4YB5A 2IM3A 1Y5IB 2ACUA 2DISA 3UCZP 4DNMA 3ITOA 4ZB0A 3JSRA 4JX5A 1JLQA 5K20B 1VYSX 1QR7A 1T03A 1PYTA 4MY8A 3WEOA 2JKPA 5F0UA 1O4UA 4Q6JA 4LBIA 3P6YC 1C93A 3WQVA 3W25A 3HLUA 2Z8QA 4LMZA 1G4EA 4CTAA 2M2BA 1H1YA 3MDFA 4PABA 3CPGA 2KU7A 3PJTA 3EEGA 4DPTA 3GIYA 1GOMA 1PILA 1KTBA 3CULA 3MVTA 2BOEX 1MXDA 4B90A 3KLLA 4PWWA 1TZZA 2X16A 1MYRA 4GMKA 3J7AN 1UETA 3OBEA 3VAJA 4PQAA 1JZ4A 1HLWA 2QL5B 3TX9A 3OFEA 4U4MA 2GO8A 5I3GA 3P5ZA 1DQUA 4MJ2A 1OVDA 3KJVA 2AYBA 1FX6A 1JKHA 2VFFA 4B9NA 2HRTA 5AHIA 1RLDA 3M64A 2Z1VA 3EJMA 3GG0A 1AA1B 3HFYA 4IX0A 3M8RA 1LNQA 2MEWA 4PE8A 1TPEA 4I7WA 2AZ1A 2RF2B 1MN9A 4AZHA 2OO6A 1NOWA 4WKHA 3TA2A 3UZZA 5AXLA 3BJTA 1DZ5A 1EZWA 1W6TA 2E7XA 3TI0A 3CHVA 3WIUA 2PTDA 2B4OA 1LXNA 1F9FA 2D74B 1XLFA 3EB3A 2WVFA 2CPZA 1FX4A 2HHWA 2J7GA 5I7GA 1M1GA 3UI3A 2E7FA 4YWIA 2C0HA 1JLQB 4DR6J 1IEIA 4ZPVR 2VICA 1T03B 4XO0A 2DPIA 5T41A 1R3RA 4MB5A 2HHTA 3AYRA 4K8HA 1GYNA 5C71A 2FZ8A 3OBKA 4DM1A 4OJ1A 4CTAB 4HKQA 1PAEX 1ISVA 1DARA 4Y0FA 5HUPA 5DZ6A 3G3DA 3P14A 4CLTA 4GKJF 3PHAA 4WJ8A 3VO0A 4DR6F 4CT9A 3CCLS 2PRMA 4MIMA 2DNOA 3L4VA 5F4XA 4K4ZA 1SR9A 1E3XA 1H0HB 2YNGA 2ZM6J 1GYLA 4ALDA 5KFQA 3KG0A 1QU4A 1EZ2A 2XC9A 1ITQA 3PX6A 1KFJA 4O8AA 3EB4A 1XCFA 1CDGA 2FGCA 1M5OC 4F2BA 4B5VA 3DGRA 3PBMA 1RUSA 3OODA 2Y3YA 4J3UA 5E5CA 3KJVB 4ZTYA 1JKHB 3MV01 2HQDA 1CXLA 3BO9A 1FXPA 3M9OB 4AD1A 4GO9A 3TFXA 3CPWR 3C5QA 1XTZA 4X4SA 4GVLA 1CI1A 3V4MA 2KL8A 3MDWA 3ZZRA 5H9EJ 3AMGA 1JIHA 1FCQA 1W1IE 1IGWA 2MQ8A 2FPVA 3HB9A 1J8VA 1BE4A 1ZU8A 2HSAA 3TW0A 4DBEA 4J9PA 3T81A 3AO0A 3GR7A 1SO3A 1QAXA 3DFHA 2IJRA 3BSHA 4DX3A 4OI3A 4YYFA 2HS4A 5D4OA 1B57A 1IBCB 3R6LB 5BYSA 1TYGA 5HWNA 2HVHA 1KDNA 4UUWA 3R79A 1Y3JA 2FHBA 5J8LA 3UJRA 7REQA 3B9EA 3ONBA 3T2PA 1AFJA 4YYCA 3GV8B 1Z42A 1LK7A 2BE7D 4XO6A 3CMGA 1XIFA 3X1LB 2HZGA 4DELA 5C55A 2HFNA 4ACZA 3O6YX 4AEFA 5G4HC 2DR9A 4HJWA 4KPLA 2CFXA 3LGDA 5G5IA 1O8BA 2C22A 1XLMA 3RM9A 3MHFA 4O17A 3RR8A 4LAZA 3CJTA 1KHWA 2HK2A 2OPJA 3ZJ6A 1JLAA 4R27A 2YNGB 2J62A 5FF0A 1I0DA 3WF4A 4B9TA 2VQUA 1EQMA 4P61A 2IRYA 2QA4S 3JSYA 3O6AA 5C7HA 5BYRA 3ABRA 4MFEA 1FXQA 2ZWZA 3B8UA 2QEZA 2VDGA 3MY9A 5IFPA 3I5AA 3W2JA 3K8WA 4RBVA 1M5WA 4E3TA 4J9NA 1EJ7L 3TQVA 4G56A 2MZSA 1UIOA 4OIXA 4AG0A 4EOUA 1PYMA 2CHOA 4ZVEA 1AH4A 3BAXA 3N9RA 2BW7A 3FQLA 1RCOB 2VJUA 3T2QA 4JUZA 4DZAA 5I2UA 2BABA 2AYGA 2OO4A 1T8QA 2Z6JA 3GKFA 3ARZA 4ZQCA 3TXVA 5JQ9A 1BQNA 1FKAF 2W9BA 2RS2A 4H4IA 2MLZA 1FP8A 4G6CA 1XUZA 3BREA 4GACA 1SZEA 3UR0A 4XTTA 3DN5A 1RTZA 3ME3A 1F6KA 5BWFA 1L6YA 1Z6KA 2PODA 4TV5A 2KFZA 4US5A 3LCLA 4C6LA 1FEHA 4Y2AA 4YR2A 3L68A 3MUXA 4NZCA 1EQCA 5HNRA 3WQ5A 1KBKA 7REQB 4C6MA 2R7UA 3W62A 1EKOA 2C14A 3NNAA 5E93A 3JQMA 3P61A 2DW7A 3G82A 4LF8F 1W32A 5CPNA 4O0KA 4J4KA 4IMDA 4TY9A 1FA2A 5ECUA 2RSQA 2W6RA 1XG4A 8XIMA 3PZQA 2RILA 2IM0A 2VWSA 1P43A 1R7IA 1P9YA 1JLAB 1A0EA 3S2CA 3CCTA 3V5FA 3T44A 2DIJA 3FFIA 3OEXA 3N0VA 3URNA 2PGCA 2NPFA 2ASDA 4DSEA 3F7JA 2W67A 3L4XA 3NYZA 5GMDA 4ZO9A 4ZVRB 4ZODA 6CGTA 2KDOA 1WC3A 3GNPA 3H54A 3RAMA 4FN5A 1R47A 1WHYA 3GVRA 4LW7A 7ENLA 4LBHA 4RE4A 5JVHQ 3V18A 3W76A 3WZ0E 2VA3A 5B0FA 3GTNA 3TJXA 4BY3A 2EPMX 3DFNA 2MHNA 3BSCA 4P7OA 3SV4A 2NXNA 3FBEA 2CLPA 1EWEA 4PBEA 2BHYA 3VDGA 1UD3A 1TKTA 3H2CA 2YB1A 1BQNB 3IP0A 2B9YA 2W9BB 2DBBA 5A2CA 4NT0A 1VLOA 1DQAA 3I6EA 2D3ZA 1FJ7A 4MTVA 3S6OA 3B9NA 2X7VA 4OV9A 4ZOSA 1RA0A 2O5DA 3XINA 3DCPA 4H6RA 1SQ7A 2KM8B 5HSPA 3LPPA 4K37A 2ZUVA 4XWUA 4XIMA 2Z25A 1RHRB 4HD5A 4Z08A 4LV9A 5HNNA 2RMLA 2QUNA 3TANA 4WE1A 2Z7GA 3AOAA 2QCGA 3RJYA 1DL3A 5K4ZA 3G82B 2GLKA 3CYVA 3HA1A 1NDWA 1VJSA 1C7SA 1LF1A 1MMDA 4CEUC 2GIRA 2W5FA 1RA7A 2GAHC 4WTYA 4NZJA 4AWUA 2QJNA 5E0FA 3VI2A 3CB4A 2QV5A 3VNMA 1GMUA 3FFIB 1RD5A 3S1GA 3TYUA 2Y7DA 2V8DA 3LXBA 4EK7A 2ASJA 1TFVA 5HUOA 1PUDA 1SIZA 5DXXA 4YXGA 4E38A 4MAVA 2PRLA 3QQ1A 4I67A 2AJFE 2LKZA 1JDFA 5F8MA 4OHYA 2HVDA 4QR0A 2R8JA 3KLKA 3JTOA 2Y1HA 3CZEA 3NZQA 1PCWA 4PCNA 4S3CA 3G24A 4R34A 5HVHA 2CWXA 3NGJA 2GV1A 1UZ1A 2VZTA 4AIOA 3S5YA 1RCQA 3RU6A 3HMJG 2YX0A 1V7AA 5JBDA 1TKTB 5F1UA 3U2EA 2VR5A 2NSCA 4PMQA 3C0LA 3KOZA 5D37A 2JSXA 4ES2A 3CV6A 2CIMA 3NP5A 4S1FA 4UQGA 3BGFA 1F3TA 1JYWA 1G6BA 2FZNA 1S49A 1NJJA 3PTQA 2XMUA 2VC9A 1E56A 4ZO8A 3T9PA 2BJDA 2YGYA 1V3MA 1JCMP 2F7FA 4DPQA 2ZUWA 2HNHA 4DCPB 3PW5A 1ELOA 1E1CA 4MUZA 5I6SA 4WE1B 4Q4KA 4TU9A 2FQIA 4WKAA 1TAUA 2PD9A 2PTYA 1QW8A 4DR4F 2LYVA 1KQZA 2PLCA 3BLEA 3QN3A 3K57A 7TAAA 1BXNA 4DYKA 4OYZA 2ROEA 1I3OB 1JXLA 1PKMA 4QJ4B 3TQEA 1UC4A 4NX9A 3BJYA 1FKXA 1K77A 3DFQA 3AXKA 1TWDA 3THAA 2E5DA 4PUNA 1WO2A 2XM1A 2E67A 1XLAA 2FY8A 3CIMA 4C1KA 1SH2A 1TRIA 3VGBA 1J11A 3E38A 3DU5A 3R5GA 4RUHA 3W00A 2MQNA 3F2CA 1RE1B 4OI1A 1RY0A 2R2RA 3NG8A 2GC8A 1O51A 3OT9A 3W5YA 2L9DA 1XF0A 2WJEA 3TP2A 5LIYX 8CGTA 4CEXC 3SCNA 3HXMA 1XIBA 4PL1A 3M2UA 1DP0A 1W26A 1FVQA 4L6HA 3M8ZA 2QJJA 4WGHA 1XQKA 1QM9A 4L9ZA 4FLRA 4DXXA 4EAMA 2QCDA 3ABSA 2C2NA 1F3VA 3I6TA 1EJRC 3GB6A 4EF8A 3DM2A 3RRKA 4UQBA 2C3YA 2WPGA 5FLXY 3VM5A 4GGBA 5CPOA 2ZVIA 1TVPA 2M4MA 2UXCJ 1CVJA 5B0DA 2QGFB 4KH0B 3W9ZA 2X1RA 3V6HA 4F2TA 2DYAA 4DYEA 3CJKB 4TX6A 3W1AA 1NH6A 4HSOA 2Z30B 1LLWA 1W3KA 3I0RB 1E1CB 1YITS 3L5LA 2Q02A 4TQRA 2H4YB 4QJ5B 4OLPA 4FVCA 5IM0A 4A4JA 2GQCA 5CC3A 4J3XA 3UZWA 3TN5A 1VFFA 5M2FX 3N6MA 2QAFA 4X4PA 2FMNA 5CSYA 1FNXH 3VFCA 3AS0A 2NYHA 2Z4GA 1T40A 3QIPA 3MDUA 2KTQA 1B3YA 2DNHA 3BZGA 1TL1A 3GZ3A 2D7SA 2J5AA 4G9PA 5EX3A 4EPBC 2E5BA 3W1NA 5IT4A 1KXQA 3ATZA 2X1GA 3PTMA 3GC2A 3GWQA 4M63A 5F1VA 3T1AA 2GGJA 2BJEA 4O54A 1X9SA 1IJFB 1O5QA 3HMCA 2UUWA 3SCJE 2UVVA 3I9V9 3SI9A 2FYXA 2J7CA 1RABB 4JI0J