2ZVIA

Crystal structure of 2,3-diketo-5-methylthiopentyl-1-phosphate enolase from bacillus subtilis
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
400
structure length
395
Chain Sequence
SELLATYLLTEPDTEKKAEQIATGLTVGSWTDLPLVKQEQMQKHKGRVIKVEERAASEKQAVITIAYPEINFSQDIPALLTTVFGKLSLDGKIKLIDLHFSEAFKRALPGPKFGVYGIRKLLGEFERPLLMSIFKGVIGRDLSDIKEQLRQQALGGVDLIKDDEIFFETGLAPFETRIAEGKQILKETYEQTGHKTLYAVNLTGRTADLKDKARRAAELGADALLFNVFAYGLDVMQGLAEDPEIPVPIMAHPAVSGAFTSSPFYGFSHALLLGKLNRYCGADFSLFPSPYGSVALPRADALAIHEECVREDAFNQTFAVPSAGIHPGMVPLLMRDFGIDHIINAGGGVHGHPNGAQGGGRAFRAIIDAVLEAQPIDEKAEQCKDLKLALDKWGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the apo decarbamylated form of 2,3-diketo-5-methylthiopentyl-1-phosphate enolase from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
molecule keywords 2,3-diketo-5-methylthiopentyl-1-phosphate enolase
total genus 139
structure length 395
sequence length 400
chains with identical sequence B, C, D
ec nomenclature ec 5.3.2.5: 2,3-diketo-5-methylthiopentyl-1-phosphate enolase.
pdb deposition date 2008-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 2zviA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 2zviA01
1RSCA 1SVDA 2V6AA 5HATA 4F0HA 1AA1B 1UWAA 4F0MA 3KDOA 1YKWA 2CWXA 5HJYA 1BXNA 2OEKA 1IWAA 4LF2A 3A13A 1IR2A 2V67A 1BWVA 2OEMA 1GK8A 3QFWA 4HHHA 3RUBL 1IR1A 1UW9A 1EJ7L 1TELA 1RLDA 2QYGA 2VDHA 4MKVA 4F0KA 1GEHA 1RUSA 2CXEA 1RCOB 2V69A 5C2CA 3AXMA 5HQLA 1AUSL 1UZDA 3AXKA 1UPMB 2D69A 5RUBA 3NWRA 9RUBA 1RCXB 3KDNA 3A12A 1RXOB 1RBLA 2ZVIA 4NASA 8RUCA 1WDDA 5HQMA 1UZHA 1RLCL 2OEJA 3FK4A 3WQPA 5HK4A 1RBOB 2V68A 5HAOA 2RUSA 3ZXWA 1UPPA 5HANA 5HJXA 4LF1A 2VDIA 3RG6A 2OELA 2YBVA 5C2GA 2V63A 4RUBA 1RBAA
chains in the Genus database with same CATH superfamily
2XIOA 2BBEA 4YYCA 1YKWA 3GTXA 4HACA 3J80U 4YVXA 3C3NA 5CBBA 1X60A 5KFZA 4UZBA 1Q5MA 3VNJA 2X7WA 1ELOA 4O3SA 2ZFHA 3BQ6A 4WYLA 1WACA 3PANA 1U4BA 1JPHA 3EPIA 1IQ8A 1RE1B 1R3YA 1HR0F 3GXDA 1AXQA 1TJ2A 3ARRA 1IWPA 3ZMRA 3KLKA 4LB3A 2WCAA 2QCDB 3PRDA 2CUYA 4E4PA 3G1XA 3CIXA 3QATA 1NDZA 4B5UA 2BXVA 3M0HA 2HRUA 3GLJA 3MECB 3UPFA 4DR6F 4PTWA 3CCQS 3HOJA 3FCWA 3CPRA 4WKRA 3EX3A 3O07A 5KG3A 3KLGA 2VFVA 2RFGA 1PIGA 1ZSXA 3L7UA 3GBEA 3MV11 4XTDA 3QO9B 1NB7A 1SH0A 4O11A 1DQWA 3TCSA 1ZAWA 5D15A 1VIXA 1FA0A 3VOGA 6REQA 4CLFA 3MUMP 2YOCA 2KH9A 3AT1B 3IRDA 4UTLA 4OLPA 3PZPA 2W24A 3P80A 3EOLA 4I6KA 4BQ3A 1H49A 3NZ1A 3VC6A 2PP3A 2BV9A 1J01A 1OT1A 1TKXA 2DXEA 5J2MA 4Z0SA 4JD4A 5HUOA 2Y24A 1IGWA 4D6FA 3VAMA 2BYCA 3ZT7A 1HJVA 3N2XA 2J47A 4NI8A 5ETTA 3PPGA 4ZOBA 3L21A 2O9TA 3T81A 3ZFHA 4IL2A 1FJEB 2QCLA 3KUEA 2PI5A 3E01A 3ABRA 1K8ZA 4V1Ak 2XLJA 3BS9A 1XQIA 3W73A 3JQKA 4ZTXA 5BZAA 2RD5C 1HL8A 2ANUA 3PVXA 2QUMA 4L1GA 4QX4A 3JQJA 3K5LA 1THFD 4LR9A 4URIA 2CETA 3T0BA 1L6GA 4AEFA 6ENLA 1AZSB 5C24A 3OGSA 5LJ3Y 4ROPA 1ZM2A 1JPKA 4GCAA 2FZBA 4O52A 1VQKS 1SJCA 3K2YA 1SR9A 4P74A 1HYSB 2Y1LB 5I3JA 3K4DA 1E55A 3FYPA 3IACA 2F4VJ 3ILIA 3VZHA 4TXEA 3AALA 4CQ8A 1X31C 4NZ6A 4ECLA 2OTJS 4D8LA 1U1RA 4XTIA 1B0TA 3AFBA 5E5CA 3WQOA 2WJZA 2HFVA 4L74A 3NP5A 4C97A 4DNMA 4GFIA 5AXLA 3P62A 2IC3A 3WDIA 3P5TL 3DKJA 3UZYA 3GDKA 3MMCA 1FWRA 2DH9A 4M80A 2B81A 2BVWA 3G77A 4O53A 2XTKA 4WP3A 2BM0A 3TVAA 1RAFB 1ONRA 4YYFA 1MQPA 3VAKA 3CQKA 1K4HA 3IIVA 3RIKA 4U8VA 3KAOA 4GQBA 4RR4A 1A5UA 3GXNA 3HHLA 1P6WA 3DDMA 1WKKA 4OYBA 5KFSA 1LZOA 3WIVA 2WJDA 1NK0A 2CPIA 1T3NA 1ITXA 1CXLA 3S9ZA 3O8WA 3WBWA 1HL6A 2IVMA 1LTDA 1XC9A 5D04C 1C4CA 4WK1A 1XICA 3ZIZA 4A3HA 5IT4A 5E0KA 1GGOA 4UTMA 4NJHA 1RTIB 2HIQA 3CB3A 2OD6A 3JVAA 3PBYA 3SY5A 4DJED 4NZ0A 3TP2A 1E6XM 3FX4A 2XSBA 4QQ3A 4MFBB 5KFBA 3HZEA 1KM5A 3G0UA 3CYJA 3VGDA 3L5AA 5T26A 4Q4KA 3GZ3A 1UBSA 5FI8A 2GJPA 5LIUX 4C6JA 4LXFA 2GSHA 4KV8B 2WC4A 4MTPA 2Y61A 4I4BA 4GY7A 1FKPA 2IPGA 1KVIA 3TYBA 2ZDPA 3RX3A 1W54A 4PXCA 3EICA 2G3IA 3CPWR 3WQ6A 2XI2A 1UC4A 1VENA 4ALDA 1QAIA 2BY2A 5DANA 3HG4A 2G4FA 4NZCA 3KLIA 2HDJA 2PDKA 3T55A 4OJGA 3TSBA 2TPSA 3GUWA 1WG5A 2MYFA 4F3HA 2Z2ZA 2MKIA 3R0UA 5IDIA 4PTXA 4KBXA 3M07A 3MMAA 2Z2BA 3THVA 1QO5A 3DESA 5FA5A 3LA0A 2X0HA 2AEMA 2HFOA 2A10A 3ARYA 3QBCA 1C92A 2JX2A 1WAUA 1CJKA 4US5A 3D1QA 4C8KA 4QNWA 1ADSA 2HGMA 3TJ4A 2J9CA 4DUYJ 2PEHA 3G8SA 3HA1A 4W5ZA 4UFKA 1ITUA 3V5OA 3QZAA 4DQWA 4X4NA 3N4FA 1HIYA 2FPTA 1W9BM 1RK8A 3C2RA 5KZMA 5IOLA 4OYAA 2QJJA 2CNLB 2HBQB 2HSEB 4GNKB 2WOQA 1JXLA 1NXIA 1M7JA 4Q3MA 2AZ3A 5D77A 1IBKJ 2VHGA 4XKMA 1FCUA 1TAUA 4F4YA 3PAOA 3IJLA 3OIXA 5A94A 1RISA 4LT6A 2HHQA 1DWFM 5K14B 2F6KA 1LLWA 4ECZA 3QHNA 1WCGA 2E5JA 3W7EA 3CU2A 4HJWA 3N9UC 4DIAA 5T14A 3L2MA 2YFOA 3PW7A 3NY0A 1FFSB 5DGAA 5LMNJ 1XM3A 1PL9A 3G18A 3VIFA 3MPUB 4ZN1A 3HXMA 3M8YA 4O3OA 4I8DA 4DWSA 4IRKA 2E6AA 1JR1A 3C2VA 3VD7A 4ZJOA 5CYJA 4NF7A 2PRMA 4Y2WA 4ZFMA 1YTYA 1JYVA 3O3RA 5KFNA 4I1TA 1AL8A 5JXSA 2XVKA 2KXHA 2D20A 4EIVA 4MZYA 2I1OA 1WKJA 4TYAA 1AFSA 3CO9A 4DX6A 5DQHA 1ZPVA 3A4WA 2KI2A 4B9SA 4O3NA 2AX1A 2IQ0A 4B4FA 2HHPA 3H5YA 1P0NA 3JSMA 3ET6A 4WKAA 1O5KA 2Y7EA 4PA8A 4IKAA 4XK8C 1HQUB 4YLWA 2BE2A 4TYBA 2VQFJ 5HMEA 4IT1A 3ABZA 4RZBA 4B92A 3IWPA 4Q22A 3ITTA 1KV8A 4HZ6A 1GVOA 1IUJA 4J37A 1FCQA 2R7WA 1QNPA 4D6GA 4B5WA 3EDFA 4B3ZA 2XHCA 4TQRA 3IJQA 3Q94A 5E3RA 1B7YB 2PWEA 4DN9A 4XAPA 2L9NA 1NIUA 4CIOA 1GG0A 1C0UA 2GJIA 2FLPA 1R7AA 2NWSA 4WY0F 4CKQA 4RXGA 2X1UA 1ZPWX 3E0FA 3GHRA 2XIQA 4GQRA 5FAJA 3EMTA 3EMZA 1Q2RA 2QA4S 1KR1A 2MQMA 5L39A 1VZWA 2EKNA 2PEVA 3GRIA 2YJQA 1RBLA 2ZA2A 3THQA 1I2NA 3GMGA 3LI0A 3K2GA 2RUSA 5TBOA 2NW0A 3T5LA 2NXEA 4GH3A 4CQDA 4DSIA 4AVNA 2RAQA 4ZK7M 4I5XA 1X6LA 1XGDA 1TX0A 3ARXA 3DLEA 4AEEA 2WZHA 3PO4A 3D6NA 3TK7A 4YTSA 4B9ZA 2GK1A 2FHFA 2IW0A 4LEQA 3FEZA 3ET6B 4O4GA 3H20A 3M0ZA 1VB9A 4JI5J 1IT7A 1UFWA 2YNGB 3ZZYA 4PUMA 3UNGC 3RG6A 1MNZA 3APYA 3GC4A 1F6YA 2O9PA 2YKKA 3CQJA 3HHLD 3N0VA 2HRWA 3IJ6A 3H21A 1AODA 1VRUA 4J91A 1AK5A 2EG2A 3ZJ7A 1U33A 3M8SA 2J7EA 2J7CA 2WSRA 1A49A 1U1JA 1HNIA 1XKJA 4JUZA 3KMQA 4OJHA 1S0VA 3ZSSA 9RUBA 1MMNA 2VC6A 1VQTA 2IHR1 3IARA 4W92B 3CYVA 1MMLA 1HW6A 2YB4A 2R6OA 3PTKA 3KBSA 3MBDA 1I6JA 2IMWP 1GW9A 4NX5A 1LWCA 1NPPA 2XN0A 3E02A 5B7WA 2XUCA 2DNLA 1J4EA 2QIWA 4OYIA 4WPAA 5F4SA 1KRAC 1JRBA 1OFPA 5DF0A 1S4EA 1FH7A 2QCCA 2FHOB 5IHSA 4KQZA 1CLKA 1X5PA 1US0A 3QIPB 5EWGA 3AUOA 4AQLA 1HBNB 3CIZA 1NK7A 1TZ0A 2IA6A 1U0HB 4NLSA 2M88A 2AGPA 5KZDA 2AMXA 4J9RA 1W5PA 3MVIA 3T09A 4B2DD 4WZQA 2QMUB 5D0HA 4GABA 2VENA 3PX4A 2EBGA 4B3KA 1JCJA 2OPQA 3FRYA 5CZVA 3P0XA 1KRBC 3QRHA 2C1HA 4LRBA 1N0UA 2HPMA 3MHGA 2WANA 1VBJA 3MTWA 1IKYA 1RT6A 4Z2IA 2CPJA 2QL7B 3QWPA 5G4WA 2MKHA 2GHPA 1OYEA 2H1YA 2VR5A 4DJDD 3G6XA 5KG4A 2W8LA 1EGZA 4I2QB 1HXJA 3SUUA 2GJ2A 2PDFA 5AT1B 2OUGA 4CNOA 5CD4H 4OIXA 3VMPA 4B3RF 3K8KA 1ZGDA 4WK3A 3O2LA 3SSRA 5J2QB 3GM8A 2DH2A 4J3UA 1XLFA 4QISA 4DV2J 3UWEA 2G5WA 1ZA2B 3RBZA 3V6KA 4IUFA 2Z27A 3HLUA 2DY3A 1NEYA 3NBPA 5C25A 3USBA 4HMEA 4GIAA 4LFCJ 4U3AA 3H53A 5AB3A 2VBYA 4JI1J 3WLMA 2RDIA 1K8CA 3H2EA 1UP2A 2POKA 2PI4A 1JLCA 2D7SA 2UUAF 5FF3A 3S83A 3MMDA 2HZAA 1RKIA 5ABFB 3R79A 2W9CB 4E2FB 4K59A 1HKJA 1JLEB 3RB3A 2EG7A 4DPUA 4B3MF 3OBEA 3HTWA 2VT0A 2W9CA 2V4JB 4MNKA 1KLZA 1YIXA 3FEQA 2QJGA 2D73A 5AVHA 4E4FA 2RH3A 4FF2A 4QR6A 2QL9B 4D9PA 3LH2S 3SGGA 2QR6A 2A5HA 2F9RA 3AHVA 2MY8A 1V3HA 2CBIA 4HMDA 4LSLB 5JMNA 1B3YA 4OQJA 3R2GA 5IFMA 3OLEA 3KLFA 4ED6A 1OC6A 2BG5A 2PMZD 2Y1IA 2OZ8A 2WNZA 1RAGB 2XWDA 4L7ZA 1AQMA 3WN6A 3ZT5A 1DOSA 5BXRA 4UUWA 3AICA 5T7LB 1PYOB 2CQCA 2HHWA 2CZEA 3D1HA 5E93A 2XEXA 1LCOA 5IM0A 2PU1A 1HBNA 1MROA 2ZWYA 1T05B 3VNDA 4HOXA 5H9FJ 1QPOA 3ZZ1A 2CLMA 4B9NA 1K7XA 4DYEA 4ZCWA 1KQZA 3CO4A 1S79A 3GO2A 2IBKA 4LVOP 1TG7A 2PCEA 4EPBC 1VBZA 4JI7F 1DORA 4AYBD 2XSJB 3LY0A 1KR4A 1NRKA 4JIQA 1NFBA 1RT2B 1X4DA 2EF9A 2ACMA 4YR3A 2VJVA 3L23A 3H2OA 5EDWA 3LCFA 1OABA 4HT3A 2CNCA 3W1QA 4Q44A 3HPFA 1VRTA 4IFYB 2EVZA 3AAWB 4HEA9 2G3JA 3QQWA 4RZ4A 3DOKB 4U2YA 2PODA 5D38A 4ZIVA 3W72A 4YU1A 3TC7A 1VJWA 2R2UA 1WEZA 4LS2A 2ZZ7A 2KX9A 1JVNA 4ZVOB 5KFDA 3C16B 3EOUA 4DQRA 1VP5A 2DGSA 4GI9A 3NL3A 5BYSA 1LWCB 1RWUA 4GQ0A 2KU7A 5AC8A 4B3LA 1VJQA 2CVIA 2JH3A 3EKZA 2FJAB 4WUIA 1D8CA 3H40A 4HHPA 2INEA 1VS3A 2PDAA 1LBFA 3QRQA 2HLUA 1AD1A 3VD3A 1S9EA 1EKRA 2M70A 2J7UA 2A79A 4ORMA 1KRMA 4ZN3A 2QDEA 2W66A 2XZDB 2V68A 2CQGA 3SCVA 4RZ6A 3SW6A 5HMSA 1ICQA 1Q66A 3U1LA 4M5DA 3K5MA 2MSTA 3WX4A 3ABQA 4JV0A 4GKJF 3KRZA 4I9JA 4J28A 4QDMA 1ZM3A 5FD1A 1IKXA 2HS8A 4LFYA 3M30A 7REQB 2Z1VA 1IJEB 3KWMA 4K2XA 4KHPJ 2RDUA 1OSCA 1C29A 5CQGA 3ISND 3C2OA 4ZO6A 4KH1B 2PU0A 2CADA 3LV6A 1RU2A 4IGSA 4B2DA 2ZX8A 3KCOA 4RKUC 3BM7A 3FCVA 3M5XA 1WPCA 1FRMA 2W8KA 4I7FA 5EWFA 1PZ0A 1SV5B 4FXWA 2ZUUA 3GHSA 2HQCA 2I17A 3LCWA 4QR1A 5ETNA 4QJ4B 9XIAA 4DQIA 2D0HA 4RW8A 2AV5A 3UJRA 3DM2B 1UD8A 5A2BA 4EBEA 3GAKA 1DY3A 3G1FA 2H4WB 1XLJA 3L9ZA 5C55A 4I90A 4FVCA 3E2SA 2FJVA 1O12A 2V0TA 3AYTA 1RPXA 3UZJA 2FZCB 4JTEA 1ZZMA 1RD5A 1KBLA 1RT3B 1JKHA 1RP5A 2P88A 1UD6A 2FVMA 2FPVA 5CPNA 1S6PA 4WJBA 4GJ1A 2NX9A 3M0XA 1SZNA 5DRIA 3MM7B 1DPMA 2DHHA 4GYKA 1N48A 1PYFA 5KFWA 4X4QA 1GMWD 3CW2C 2E1WA 4GA8A 1WC1A 4H8NA 2Y62A 3M32A 3FKRA 4UTJA 5FEZA 1XMQJ 3FXYA 3PUDA 2R3VA 3C16A 3NQ2A 3B0XA 4MIMA 4XX6A 1OYDA 2UVUA 4IIHA 1R6WA 3SN0A 4DWSB 1PX3A 4GUJA 4DJFA 2FLOA 4LFCF 1S5WA 1M03A 1MSWD 2FTYA 3R12A 1KHWA 4WDUA 3SUVA 1QI5A 3FVMA 4LMZA 2WONA 1BC6A 3CJRA 2QPSA 1NWUA 3ITOA 2YXGA 4IPLA 1NQKA 4RBTA 1HJUA 5A8KA 1EF3A 1F9HA 4EK2A 2UVVA 3PKYA 4J9UE 3W7IA 2QA1A 3LTOA 1N5YB 2YVSA 3H22A 5CSRA 1OD0A 3M5VA 4WTYA 2Z4GA 1JPDX 4C1LA 4FYVB 5LJ5Y 3DH7A 4I9AA 3QGIA 4XIAA 1D9EA 1Q0NA 1QUMA 2GQ3A 4H6QA 3VUPA 1NAQA 2FIQA 4M5NA 3CCRS 3QT6A 4RWXA 3CUXA 3IIOA 1R3NA 2W62A 3WD0A 3E5BA 4GIYA 2QV6A 4IL0A 5BXSA 4H8HA 1GONA 1Q6DA 5BR8F 2RE1A 4YL2A 1J5SA 1K73T 5G0RA 1LWJA 2XIIA 5LYRA 1K8YA 3MMAB 3Q4DA 1G01A 3H5SA 2E9LA 3V36A 3RRKA 2EO7A 3V6DA 5D37A 4YS1A 4QCFA 3FAXA 2YX0A 4DJFC 2PA8D 1V7AA 2AQ4A 3N4AA 2B43A 3ZVHA 1HNVA 2V2QA 3V0UA 4U5IA 4M6UA 3T6CA 4RL3A 1XV8A 3T8QA 1SFTA 1UJPA 1C90A 3BGAA 2ADAA 4IIFA 3M2VA 2K1RA 4LV4A 3UDLA 2VC9A 2XVPA 3HG3A 2ATLA 1TV5A 3CUFA 3I3EA 2WVBA 1HNZF 4YTQA 2OIHA 2B4PA 2VZTA 3MB9A 4CLMA 1TKZA 1EP2A 2HTMA 1FWDC 4E2BA 2GFTA 3W7NA 2KZMA 3V75A 3CEPA 4K38A 4HOZA 4JYAJ 2DT0A 1UETA 4Y2KA 3AS0A 2NV9A 5CGQA 2FHJD 1XSKA 4DUOA 2BQRA 1XG4A 1WKEA 2KJVA 1P0BA 3D3AA 2V8VA 4DV3F 1E6SM 4PEKA 4DF4A 3ARZA 3CUZA 4CGTA 1CGWA 4DX3A 1GORA 1TMMA 4X62J 3DFHA 4GI4A 3KS5A 2KZHA 3UR0A 3B8WA 4AL6A 4DL2A 1NSKL 3ZZPA 4JHZA 4DN1A 1YNQA 2YIHA 4RPPA 5I3HA 4A2SA 1W7WA 1T99A 1U0SA 4RX6A 2VCBA 2VCCA 4PWDB 3R8RA 5AC5A 1SW0A 4FNPA 4K7VA 2WWCA 2YDRA 5IV4A 1H3GA 4DYKA 1NDKA 3R5DA 4IOCQ 1TVRA 3D28A 1L3SA 1L0PA 2IKGA 3SBFA 2EXOA 5EBUA 3NGTA 3EGNA 2ZXQA 3J7A1 2YGYA 2OSXA 2QGYA 1Y3JA 4O1CA 2YDAA 3OTRA 2AQWA 3TFXA 3M7SA 3ZZRA 1E40A 3EB3A 3PJXA 3FBCA 2QLWA 1HNVB 4HTBA 1RHMB 3LEPA 1S1TB 1XJWB 4ADSA 4S3KA 3PZVA 3CJKA 2QF8A 2UUBJ 4CD6A 1N7KA 4Y00A 3SV4A 3QSIA 4FF1A 2WK4A 3R5JB 4FYWB 1D3HA 3RLVA 4ZVRB 3RAMA 2ADCA 1EETB 4S0MA 5U7SA 1S1RA 2Q09A 4PMZA 5DRCA 5EYWA 3SQOP 3GTHA 4TXSA 1OCJA 5LNUA 2QSWA 2VG7A 2F84A 2O55A 5KFJA 3KBVA 2YW3A 1TKZB 2IAJA 1F3EA 1UP0A 3BJTA 5IV3A 4P2VA 4Z2HA 2GK1B 1S9FA 2LQ9A 4HK6A 2JIWA 2XQCA 5C24B 1YBUA 1VPXA 3VYLA 4NYUA 3GU0A 5J1NA 4AHOA 1LP6A 4ZLNA 1V3SA 1X5SA 3CLWA 3PHTA 1UFKA 4H9UA 5E6YA 2DZUA 4BY3A 1SJAA 1VEMA 2FDSA 1BYDA 2YKMB 4W7UA 1X0FA 2F9DA 3KWXA 1VQSA 1KM1A 4DUTA 1J79A 3DC2A 2DH7A 1K1SA 1RT7A 2J8FA 4GE8A 4BWJA 9XIMA 2TAAA 1W0MA 1CI1A 1DIOA 1A5NC 3AIWA 5D09A 4NNBA 3LCHA 2QCHA 1TPB1 1DHKA 3OL7A 2BA9A 5HQMA 1EHAA 2Y6ZA 5A3HA 4GRSA 2CITA 3RF9A 1TVLA 1Q6RA 4LFAJ 3VCRA 5EUHA 3OVBA 3CDEA 6TAAA 1Y5VA 1WOOA 4YTUA 4CVUA 2QA4G 2C42A 1QWGA 1TVPA 1UWRA 1I2PA 1NDCA 3N17A 4HNNA 2YKAA 3UNDA 4UTGA 2M8DB 3TU9A 4H19A 3U7JA 1OC7A 2NYIA 1WZLA 4DR4F 3ISIX 2F2HA 2C7FA 4QJ1A 2FJBB 3QT8A 2CIMA 4ZPTR 3QBUA 3A8JA 5J8LA 3IO1A 4ED5A 2WW8A 4GZIA 4MGGA 1A7GE 1IKXB 2Y8YA 4LF1A 4Y8EA 1QVFR 5BRQA 2DCLA 1HZYA 3VIMA 4NLRA 4FIRA 1S6OA 4DUWA 4JI1F 5IRPA 4DFKA 2Z7KA 1VISA 4DLFA 4UTWC 3W2VA 1C93A 5D2XA 2V0NA 4L3NA 4D72A 4UR9A 3VU2A 3JAMY 5JVLA 3ANUA 1KLMA 5G2WA 4OYZA 1DIKA 4AMAA 2V34A 3GIKA 3HHNB 4LF4F 3HGJA 1PBUA 3BAKA 2DR9A 4LB4A 3NZQA 3NGRA 2MMYA 3J81Y 3T3FA 1JCLA 2DSZA 3RNDA 4P8XA 1M5VC 4IISA 1HBUA 1XYFA 5IDZA 2MZTA 3KG0A 5KFFA 4F9DA 1FTCA 3PO5A 1SZFA 4UFJA 4GQGA 5CABA 4EWND 3YPIA 4ICLB 2PWDA 4HN4A 4ZENA 1PZ2A 3UO0A 5K8OA 1NEEA 2KN4A 3W53A 2RRBA 2HHSA 4FK9A 2XVGA 3WLNA 2DK2A 3JTNA 4KFBB 4XV0A 1KBIA 1VEOA 4E8GA 4NZ7A 2C22A 1OX6A 3B82A 5F3ZA 5M2PA 2OODA 4JDBA 3TAOA 4NLVA 3DHWC 5KG1A 3CAKA 4Y2AA 2DGXA 2Y8VA 3AJ2A 2W91A 3LDVA 3FRZA 1WZAA 3W2WB 1GHSA 1RTJA 2VG7B 4QIGA 3TMLA 5C7HA 2HYIB 1TX2A 1KKHA 2VX6A 3PJ9A 3S0CA 2E5HA 3TAPA 2E6YA 5KFGA 5IC6B 1OINA 3LGMA 1LNQA 2PDCA 1DWGM 1AROP 2GQ8A 5THWA 2QLFB 1SIZA 4DPYA 1PSDA 2Y8KA 2JEGA 4LEFA 2CQ3A 4PQAA 4DUYF 2ZBPA 3C52A 5JVHQ 3EXTA 1X4CA 4I6WA 3R58A 2BY1A 2PZNA 5D03A 3GQCA 3L66A 4AY1A 4J2MA 2WSFC 4ZHRA 5AXNA 1T3OA 3C2PA 2W01A 5C6MA 3I5AA 3PRVA 3U3HA 1E6PA 2AL2B 3D54A 3SCPA 4B90A 4H3DA 1OG0A 4D6JA 2VNCA 3WF0A 4LVAA 4QE5A 1KLNA 3WBAA 3VABA 3U6WA 3IRSA 2J75A 3N01A 1F2JA 4NILA 4W8AA 5MLCV 1J0YA 3GVRA 1XD1A 2PSZA 2EG8A 4MAZA 4UB9A 5EMLA 3BH6B 2WVTA 4QIVA 5DO2A 1R2RA 1G69A 1V0MA 4LAUA 3HD2A 1CEOA 3UNYA 2LLEA 2N3OA 4PCSA 5DLGA 3WLRA 5AC7A 3QC0A 1K1QA 2MKJA 5H9EJ 3IS9A 1NH6A 1U22A 4I3GA 2OOFA 1MN9A 5E70A 1R43A 4QU6A 2A7NA 2M5YA 4QIFA 3R8YA 4YFUA 4LX4A 3KOYA 1Q2SA 4LBSA 2VYOA 4QWCA 1QPQA 3OP2A 4E8CA 4DZIA 3ATYA 3HHLC 3AIRA 4ACYA 2R2RA 2CRLA 2WYSA 5TIMA 4EPKA 2FZ9A 5A6AA 3M2UA 1RBOB 2JGYA 3CXOA 1M9HA 3PBUA 4NZ4A 1UWAA 3UPMA 2E1MC 4TY8A 5BRPA 3B9EA 1YJRA 3APGA 1RWWB 2PUZA 3PP7A 2TRSA 1XWLA 1CLVA 1Y5LB 3Q8VA 3VA8A 2REQB 5DG7A 4WZMA 2NLWA 4YTRA 1GCYA 4Y9AA 4PR6A 3K1DA 2ZA3A 3TOPA 2BEFA 4ZPVR 2J9XA 2YCJA 3MM6A 1YBAA 4EBDA 1NDWA 5HNNA 4HR2A 2J8GA 3J7HA 3L9CA 1P48A 1U09A 3FOKA 4HKQA 1NQ6A 3EZ4A 3LXAA 4GUHA 1CBKA 2EPIA 3ZZUA 4EBCA 4DL4A 3U2EA 3TYCA 3H70A 3URNA 4DU7A 2G2OA 1BRLB 3GZ7A 3NL2A 1SQGA 2H3EB 3IFEA 3VOFA 2EEXA 2ZX9A 2C2NA 5I5RA 3ES8A 3UWQA 3G1DA 1TIMA 4QE1A 5LL6d 2FHMA 3PW5A 1RT7B 4WP9A 1TK5A 1GVQA 2AGKA 4PC8A 4DVOA 2OPJA 3G5EA 1ODZA 3AWNA 1E3ZA 3PZGA 4IJRA 3HSJA 1Q6QA 3EWYA 2ZJQQ 1XDMA 1WBHA 4P7NA 1FHLA 1Y9OA 3K59A 3A9BA 4N9BA 4M6QA 1DRZA 2OO4A 3QW4B 4UQ9A 8CGTA 3DRRA 5IOBA 5CZ0A 3GSIA 3W22A 3IS9B 1U8SA 4JFVA 3HP6A 3QAEA 1MO0A 2QKFA 3KVJA 2Z2UA 3QPYA 3PX6A 1VAHA 3OZMA 4GGBA 8XIMA 4DR1J 4PB5A 1Q8LA 2HNYB 4HGXA 5H2ZA 3DLEB 1VK8A 5CBJA 1SKWA 5A8KB 1WC3A 5DMYA 4WOQA 4QXIA 1TJRA 5D4OA 3OVSA 5KFYA 1MQRA 1IT8A 5KFEA 3CDBA 3A13A 2Y85A 1WB0A 1XNRJ 1V02A 3ONQA 4GBDA 1FKXA 1VHIA 3CCWA 3Q23A 5J2QA 4FLOA 1VJSA 4WHBA 2FFCA 3FA3A 1ZETA 2NUXA 1F3WA 2YNGA 4G7FA 1HJSA 4ATLA 2L41A 1XCXA 1XK8A 5A8PA 3SRKA 5JXQA 1U1KA 3CTTA 1TUFA 2O92A 4HHJA 2PBGA 3BLEA 4CNSA 4JQAA 4IH7A 4DRSA 4UFLA 4PN2A 2I2YA 1QWKA 3W24A 2J8SA 1R27B 2M9KA 3DOLA 4KFBA 2FJDB 2MZRA 3E01B 2RQ4A 3B04A 5L8RC 3H4DA 1QW8A 3QM3A 1YLVA 4HTJA 3O9NA 2LXIA 3G9CA 3CJ4A 2HVIA 5I23A 5D0EA 4J9QA 1MWYA 1ISWA 4TVDA 3R1ZA 3PWGA 1VS1A 1D3WA 1OQ6A 5I3FA 3B40A 4H4KC 4S3FA 5LA1A 3DOPA 4V1YA 5D0RA 1XH1A 2E3ZA 1TWSA 4IXHA 4U67Q 4Y2IA 2VV5A 4QIUA 2FGBA 3UG5A 3A4XA 1B3ZA 7PTDA 4MIBA 2RQKA 1NKEA 1AZ1A 4HDGA 3G6YA 1DAXA 1QVBA 2DXFA 2Y0BB 3K57A 2C79A 3GVQA 3B4DA 1WKLA 3SN1A 2GGGA 4WJEA 1TMQA 2XN2A 4YR2A 5BMXA 2VPYB 1OY0A 1SL2A 3CL7A 1PKLA 1CTNA 1YQ2A 5I4MA 4R0EA 3P84A 2DNNA 1UWBA 1V0LA 3LK6A 4R3UA 4OTKA 2AYGA 4Q7NA 3OIHA 3D7SB 2V8DA 1X39A 4K3ZA 3TNBA 3I5BA 2XN1A 4MYAA 4KCVA 2QO3A 1XBXA 1BWLA 1E4NA 3A8EA 2EGZA 2DO0A 2GJXA 1H63A 4GG9A 4IM4A 4ES4A 5KG6A 3BBCA 2VGBA 1HVXA 3PY2A 3WBYA 3ZTOA 2IFXA 3RAXA 3VKCA 3DUGA 3POTB 1P9QC 2C16A 4GISA 4ZP8A 3SSSA 3IPWA 2ABYA 4DFPA 1PC5A 4M6PA 3HSGA 1KS2A 3ARWA 2CLOA 4H9TA 3HD1A 1GVYA 5I3QA 5F7UA 1I9CB 4QDPA 3WH8A 2ALYB 3S1TA 3NPXA 1N5VA 3SCRA 1H7NA 1V08A 3EX1A 2ZFAA 4O8AA 1IXKA 3BQ1A 2Q6BA 2QPUA 2WVSA 4TOQA 1K1DA 4LF6J 3L2LA 3GU2A 3CIVA 3URBA 2B5JB 1S5VA 2QCFA 3FCHA 2UXDF 3KK3A 3N3TA 4JPGA 1F8IA 1RA6A 4DJBA 4ZDNA 5F8JA 1PWLA 4F9JA 3W65A 5B08A 3QT5A 3Q58A 1I94J 3N4WA 3CSKA 1P0KA 4N7TA 1UD5A 1FP8A 3KVKA 5C0QA 3EDDA 1CDGA 3CS2A 3B9DA 3TUJC 3DYPA 4O1DA 3UEQA 1JEZA 3DXIA 3OW1A 3O0KA 2FH6A 1N8FA 2D3LA 1I1GA 2E7XA 2RF2B 3PACA 1BYBA 4KIAA 5E7OB 2CZ4A 2C1IA 1ROFA 3WDRA 1W1A1 1C2PA 3PB0A 2WMGA 3LGHA 1HARA 4FR6A 2LECA 2GNKA 4EANA 2Y88A 1XN9A 4OZJA 4F0MA 4F0HA 5T9CE 2GS8A 4N02A 2MDAA 1S49A 2XGZA 4JTFA 1VI7A 4EPEC 4DZ5A 2PF0A 1BHNA 1PBAA 1WOPA 4O1FA 1XBZA 3ABOA 3W61A 1XH2A 5C8BB 3CD7A 3ZLGA 4AIEA 5GADI 1XG3A 1RVGA 2EI5A 4J9OA 1UMLA 3BDEA 4ZVEA 1VCGA 3M6UA 3GK0A 3CJSA 4JYAF 2HISA 3IUDA 1S5NA 5IC4B 3QQ1A 4FSAA 4PG6A 2IKHA 2YX7A 3GB6A 2HGNA 3KK2B 4L80A 5KZEA 2E8ZA 3CHDA 5FSDC 4RNNA 2XY5A 3CMJA 2VZOA 1R3VA 4FMVA 2C3YA 4Q8FA 4HU4A 3A23A 3DFSA 4PKDB 4Z0JA 2I8EA 1VLWA 4KSEB 1QOPA 3W1NA 1BF6A 3GS6A 2Y1HA 3KP1A 3VNMA 2R4FA 1J18A 1OVDA 2DZTA 2XZ7A 4ZTYA 2YWWA 1F9EB 4H9ZA 1U1OA 1GYNA 2YSWA 4MLRA 4JTRA 3UP8A 4RZRA 5BYWA 1S3HA 1RK6A 3VIHA 3AMDA 5KTLA 1G7VA 3MUIA 1ICEB 2VB6A 1BSIA 4IYQA 1BG4A 2QDDA 2MHNA 3MWCA 3UXLA 3E2RA 2PWFA 4HB7A 3AA9A 4GYPC 3TR2A 3A8IA 3ZJ8A 1AUSL 4LW7A 1RTZA 5G1TA 1LK7A 2XFFA 2XNQA 2NQ9A 1XLMA 3VIKA 2CNNB 2VWSA 2PFFB 4LUIA 1M5WA 3STGA 1NK6A 4HU8A 1IT0A 2X1FA 1CGXA 1K0TA 1F73A 1UD4A 5GQBA 1PAUB 2V3DA 4LF2A 1P5BA 5E09A 2GO8A 2GQ2A 4NQ1A 1DJQA 4JQ3A 4EXQA 3DYMA 2KO1A 4H54A 4L4MA 3A64A 5LNSA 4O28A 3UWVA 3VGVA 1IR0A 4HBKA 2WLZA 2BS9A 5LIKX 3PEJA 2X1IA 2AMCB 3AODA 4IGNA 4PAAA 3LXCA 3V18A 3L4VA 1FT8A 4NLUA 2C91A 4HVXA 2W1BA 2Y70A 3S2LA 7FD1A 2HVHA 2CWXA 1ALDA 3RCYA 3WZ0E 5IBXC 3QNWB 2LDYA 1H11A 1UHVA 1NTHA 4ZLPA 3U5UA 1S6UA 2VTFA 4GJIA 1AJZA 2DZWA 1NM2A 2UUCF 1XDJA 3DFNA 4BC9A 4F67A 3BICA 3DYAA 3W3OA 2OJPA 5HVGA 3H12A 3ARTA 4C6BA 2QEXS 2AAAA 2YA2A 2YX1A 4LUSA 1VRDA 5IFPA 3MCSA 4JEJA 3QY6A 3R5CA 1LW2B 4FX8A 4A8WA 5ABEA 1H2UX 1G4EA 4G6VB 3W60A 6FD1A 2BJEA 3RN6A 3V6DB 2QQ6A 4C3LA 4NI2A 1DTTA 1BLIA 1E4MM 1MFVA 4DU8A 4ZVFA 4OYWA 3A3PB 3BSAA 4MKBA 3BSCA 1C91A 3N3MA 1HPZA 3TJ8A 1U02A 4HA1A 1KCKA 1E3XA 1PJ6A 3NXFA 1BQXA 4EWJA 4UY85 2OZ3A 2HS0A 3M8QA 5A6WA 1IN0A 3PPFA 4HHUA 2HHHF 4FS2A 3VIIA 3MVTA 4PULA 1GXUA 5K9CA 2W2PP 1NDPA 2ZM6F 2M3DA 1FKOB 2XBPA 3ELFA 3WMLA 2JNJA 3H98A 2YKPA 1X8FA 2XFRA 2Q02A 2HURA 1S2UA 3S2JA 3IANA 3PBMA 1VH7A 1JNRB 3C61A 3UD4P 6A3HA 4S3AA 1UH2A 2GV1A 1UVKA 5EGRA 1UH3A 4KHPF 4U2ZA 1KD0A 1NNDA 2PTDA 4ED8A 3L7RA 2G3MA 3UXDA 3ZJ6A 1KRCC 4TVUA 4C6DA 4Q8OA 4PMJA 1V8EA 4IH5A 4HI1A 1GYLA 3MGJA 4GYFA 4ICNA 3SV3A 3P45B 4NLTA 4AZ6A 3E0VA 1FCVA 3AYRA 1YI2S 2W6RA 3POCA 3UCZP 2E44A 1QW9A 2D2HA 3U8GA 2BGQA 4MB1A 1XS2A 2CW6A 2GC8A 2HQAA 2EQDA 3N4EA 3L4WA 2YCKX 4PBEA 2VD3A 3EZUA 3TNOA 2I14A 1W56A 3OA3A 1PCWA 2V5HG 4CD7A 1W3NA 3MMWA 4N42A 5F2MA 4HYKA 3L4XA 4WIWA 3VNYA 1EUNA 1D3GA 2YPZA 3KFWX 4R27A 3GFYA 2QLJB 3NIYA 4CO2A 3ZNJ1 1R9ZA 3BPWA 4INFA 2K1RB 3PRBA 1R3QA 1BWEA 1WYIA 3B8HA 2DR6A 2BRKA 1P7TA 4NZ5A 5TF0A 8TIMA 2IKJA 3RMJA 1NOFA 2FTRA 4GNJA 4LF8F 3NM1A 4P7RA 3TSMA 5CZSA 4AE5A 2MLYA 4GIRA 3BGFA 1GVEA 3TONA 2ISVA 2AYBA 4B15A 1S4FA 5E0CA 3M6XA 2IPWA 4P2FA 1RT4B 2XSAA 3TWZA 2Q01A 5AOUA 1PB0A 4LSBA 4ZVJA 1GW1A 1PAMA 2RDTA 5ENLA 3I96A 3KXDA 1LT8A 4FPIA 1Q6GA 4ELTA 4CWBA 2GJRA 2M8HA 4PMVA 3M4HA 1H7OA 5FEXA 1TUVA 3PSVA 4X4RA 1CGYA 2V94A 1BXNA 5G4HC 3DNCA 4LYQA 3WK2A 2OPSB 5FJIA 1J2WA 3B0PA 4Q8EA 3T0AA 3M9MB 3IWNC 1FJCA 4PQUB 1XQKA 2AGTA 4M82A 1CG2A 3NOYA 5ADZA 1TMHA 3TVYA 5ETVA 4KC5A 4PABA 5FAGA 2YL6A 1FRXA 2HHHJ 2KB2A 4UZUA 4DFJA 1UEKA 1XR5A 3LLXA 3E9AA 3EX6A 5D9NA 1W26A 5B0CA 3M5ZA 3S6OA 3FW6A 2ZJPQ 2F4VF 4UQEA 4O4WA 3EX4A 1EKSA 5U4NA 1TL3B 3R5GA 4IRDA 3QLDA 4ED4A 1R9YA 1S12A 4LVFA 4IFKB 5GAHU 1U49A 2RILA 4O14A 4JOUA 1OFOA 3P14A 5H9EK 4MIAA 1SO5A 4YR0A 1T40A 4ACZA 1F9CA 3O2IA 4UOHA 4C6IA 4HNCA 4F2UA 2HNEA 1PV8A 3FFIB 2H5JB 4CZCA 2I5IA 3F03K 4X4PA 5D4LA 4K4SA 1M7PA 3M0YA 2QULA 1JZ3A 3E51A 3UXKA 1C0TB 4PODA 3PG9A 1GNKA 5C71A 2KFNA 3WNNA 1B4SA 1EX8A 2Y5SA 3OR1B 1JJKA 4F7VA 2UU9F 3SSQA 3K4WA 3EVOA 2D24A 4ATWA 4DQSA 3W00A 2PLMA 3VD9A 4L6OA 3I7SA 2C14A 3W2KA 4K8GA 4ZOSA 3T2QA 4O1EA 5HL7Q 1RWVB 1YJ7A 2DNKA 1IR1A 1Q16B 2DIUA 4C6QA 1CYGA 4WDXA 1F3XA 3MWAA 3EDKA 4G8TA 2XMTA 3E0IA 3V2UC 2VQUA 5I79A 4NZ3A 3TAMB 4NE9C 1DARA 3EGJA 3PAJA 3CC2S 1UKQA 3OTDA 4J3VA 1J5OA 3EDRB 2RJGA 4IIGA 5DDRC 1K47A 3B8VA 2W2QP 1DTTB 3OXFA 1N36F 1WDPA 1HKIA 3GW0A 1N36J 3CEUA 4PYSA 5LIYX 1RU1A 2PDHA 4MJ4A 4KFNA 5LKYA 1OS5A 2LEBA 1HKKA 3CJQA 1DEDA 4LREA 1RHJB 3BYRA 2XS2A 4JI3F 4NXNJ 3C86A 3GW3A 2ZTJA 3DLJA 1D8YA 3UJSA 2PPGA 1DLOA 4LRAA 3KLFB 4ZSTA 2RDJA 4LF7F 4HT7A 1PJ5A 3H0PA 1JAKA 5C25B 4MJZA 2MQ8A 4BWMA 2OFHX 1B0IA 2WPGA 4YDXA 1HT6A 3GWCA 1GKPA 4JTKA 1EJSC 2YZRA 5D3GA 1SJBA 2ZZ4A 3M8PB 2M52A 2LYVA 1U5JA 3EPNA 2IXUA 2KFZA 3K8MA 2V9DA 3CB8A 4WSHA 2DGTA 4BQ4A 1ZA1B 3WBEA 2ZZ1A 3IJ9A 2Y5EA 1AG1O 4BKNA 4K4XA 3LM3A 4JKKA 3LN3A 1KBRA 1DBTA 2Q6ZA 5AZ1A 2OT1A 4Z17A 2CAJA 4YTTA 1X5OA 4C8OA 4J9JA 3M5YA 1VQ8S 2WXDM 4A46A 1Z41A 3B0VC 2AJFE 3CQIA 3MKCA 1YPXA 4BJHA 3EWGA 2H4YB 4DX8H 4UNKA 1N32F 2YY3A 3I31A 1NSPA 5K2ZA 4NXKA 1JWWA 4AXIA 1RAJA 3Q2DA 2KXFA 1WDRA 3DLHA 1UUQA 4MK7A 1A80A 1OD8A 5DEZA 4CNNA 1W9PA 1SO3A 1LV5A 2UBPC 3D4JA 2NLYA 1J12A 5CYMA 2PDYA 1ZP4A 3RRHA 4A8OA 4JIEA 3G4SS 3QOKA 3QTPA 1V93A 5T91A 5TNVA 5KZ6A 4QP0A 3U1NA 2ZH5A 1HWUA 3LXBA 3QY8A 3KEHA 5CYMB 3NL6A 3L95X 2FPYA 2Z6JA 4AWTA 1U2CA 3DLBA 2HHUA 3HG2A 4AX6A 4ECXA 3PZ9A 4ZPWR 1OCNA 4CLSA 3OV7A 3FN9A 5B0DA 1SJ1A 2GYIA 1BXCA 3TJAA 4BR1A 3L0NA 3HMCA 1MMDA 1FTRA 5CAKA 2QCDA 2A6MA 2DZPA 4PB4A 3VIJA 1ZTWA 1FHUA 1YADA 3OHIA 1ENUA 2NZCA 1JNZB 1C8QA 1J11A 2YH1A 2NQPA 2BJ3A 2C1GA 1QD1A 3KL0A 4REQB 1DTUA 3GV5B 5F41A 4FNTA 2DSKA 2DT9A 3H7HB 4RUCA 1VHFA 3WJWA 2FKPA 3SSJA 1PG5B 3LO3A 2CPEA 2D3O1 1EQPA 1P9YA 4DZ6A 2HK1A 2A2CA 1CB2A 3HHEA 2EW9A 4NA1A 4UTUA 4LQ3A 3TZFA 1CPZA 1BQMA 2PMHA 2FYXA 2PDUA 4J9MA 1LROA 2X3DA 1TKDA 3JS9A 4KGXB 1HW8A 2V8HA 1LYXA 2J0WA 2KDOA 1JJHA 4H6KA 4AF0B 5BWFA 3NGUA 3UWTA 3MZIA 3CO8A 4RX0A 1EDQA 4DBEA 4HMNA 4UCGA 4DXLA 4KRTA 1RTHA 2R2SA 1W1VA 1M5SA 2KM8B 1B70B 1W1YA 3QHOA 3AS3A 3W2UA 4HPXA 4LIRA 1J0JA 2DORA 5C9UA 2PMQA 1YZ6A 3W1XA 2ZQ0A 3URQA 5M17A 3CTRA 4DQPA 4PXBA 2CXEA 1FF2A 3CZEA 4IMAA 4XKYA 4RW3A 1Q4RA 4LJMA 4YJ5A 1WDDA 2F2KA 4I7VA 1T6MA 3ZVHB 2ZNYA 4UOGA 3NQEA 2C2RA 5J2NA 3BLPX 2QJNA 1BY9A 3PZMA 3HSDA 1TO3A 1WKYA 2OZTA 4V15A 3IBFB 3S9YA 2YDQA 1BYAA 2YX4A 1S1WB 2VC0A 2RS8A 2XU2A 1JDDA 3R25A 2HVMA 2EFGA 2HVEA 4KJIA 2HFNA 3UG4A 2ISDA 4G9PA 5BOEA 1MUWA 4P7OA 1Z1ZA 3W02A 1TUWA 4ZHRB 1FDBA 4NEYA 2PDMA 1DJHA 3FA4A 1OPIA 3WUBA 3DIPA 1V6HA 2E29A 4ZPCA 1EP4A 3VZIA 3KK1B 4RNOA 2LA6A 2PA3A 3CGTA 5LXEA 3FDSA 2PD5A 3U48A 3W7JA 5RUBA 3FJ6A 5B7YA 1YJTA 4LC8A 4MY8A 3AUJA 3TIMA 4A05A 4UNLA 2OEJA 2PWGA 3T5JA 1S1VA 2D2OA 1ISVA 1DP0A 2A3JA 1X1OA 3SDEA 3L67A 4M3PA 2VH7A 2GJLA 2BVYA 1UD2A 1JIHA 4NUWA 1NP0A 1CS4A 1W3LA 3DGPB 5KMYA 1FXRA 3CT9A 3DECA 1FUYA 4E98A 3CZKA 3Q45A 4NRUA 3K5NA 3F41A 3LHWA 3A5FA 1AFJA 1C0UB 3P3BA 3W5ZA 1E4IA 2V5CA 4JIRA 2J62A 2WW5A 3M32B 3WQPA 3TN4A 3CL6A 1RAOA 1RV8A 1FHDA 1OK6A 1AL7A 2A0FB 1XLLA 5FJTA 1YDOA 4Q4MA 2XYHB 4E8DA 1XBWA 1HWKA 1FWSA 3VM5A 1QPRA 3C6TB 2WCGA 3HPAA 4DX5A 4QAWA 4DBSA 4PUOA 4L6HA 3TYDA 4W5UA 2F8EX 3GTNA 1FBAA 3AI0A 3Q22A 3RTVA 3BJYA 3GNNA 1Z8AA 1W2BR 3TUPA 3SR7A 2R94A 3GDTA 4NYOA 3IK2A 4OBRA 2G0IA 1TV3A 3MMBB 1YRRA 1Z2LA 3QY7A 1RT1A 5EX0A 2HBYB 4HA3A 3GP9A 3JXOA 1A3WA 3SDOA 4C3MA 3BW3A 2WC7A 1GG1A 5BU9A 1C3FA 3U4FA 1RT5A 4OYOA 2LVWA 3SUWA 5GADU 3W7OA 5A2QY 3W37A 3PWIA 4NCBA 5A2QU 1VFFA 3PYGA 3N6MA 3QOMA 3S6EA 3QC3A 1NHUA 3IG1B 2GUBA 1B3VA 1VFHA 2AYEA 3NGJA 4Z1DA 3Q8YA 5HJYA 3OR2B 2A6NA 1E43A 2ZZMA 4LNCA 2PD1A 2J9ZA 1Y4ZB 4IFVA 3BDPA 5M2RA 1UW9A 1NF7A 3CCLS 3W2NA 3CJKB 1E71M 4C5YA 4N0RA 5CH7B 3SECA 4ZCMA 3FV9A 1RYRA 1UJ4A 3NWRA 4ETZA 4FXSA 3CWNA 1Q86T 5I3IA 4U7UK 4GVLA 3FZBA 3AJDA 4DWSC 2CU0A 3GYNA 4EYIB 3OW2R 3P2VA 5BOOA 1FKAF 1EB0A 2I6WA 3OVRA 4XG1A 3TQEA 2QAPA 1E6RA 4UMAA 1QLNA 2VOPA 5TD4A 3UJEA 3QVQA 1X4GA 2Y1JA 1PIIA 2VFHA 1QE1B 1YHQS 5DT5A 3NM3A 3KBJA 5FJUA 4OBTA 3IRXB 3PW4A 3SQMA 3F2DA 5HDRA 5SWUA 3ZJKA 4XAFA 3CB4A 1OT2A 1E5NA 3CC4S 4DUZJ 5KEZA 4Q6XA 1ZENA 3W0KA 3WK0A 1VCVA 2CWKA 2QL5B 3AHTA 4HA0A 3QZEA 3KTSA 1ZJBA 3GHTA 4BCEA 2WKGA 3M05A 2AKMA 2J27A 1SBRA 1EHWA 1K9MT 1R46A 1VBGA 2WNWA 2HS6A 3AMKA 5A6TC 1UOKA 1JLBB 2GVYA 1XD0A 3SCWA 2Y1RI 4C91A 2DNMA 3UPBA 1RACB 5FJRA 3LP2A 2P0OA 1LF1A 1SPQA 4W8LA 3K8LA 2KVIA 1EUAA 5BNKA 1TKKA 2V6AA 4HA4A 2AZ1A 5H9FK 2CBJA 3A9IA 3DRYA 2DGAA 3NFUA 2ZXAA 3GAYA 1ZU8A 2OG9A 4Z42C 2MZ1A 2DGVA 5BOFA 1JF5A 4DJEA 2DNOA 2QMJA 4C6KA 1BQNB 2CLKA 2AEFA 4MG4A 4P6QA 4GO7X 5J2PB 3BAWA 4PMUA 1TL5A 4NI2B 1B1YA 2BOAA 3WH9A 1XBYA 4FAMA 3CJ5A 3M7WA 3R27A 2CJXB 2Z1KA 4MJ2A 2JL9A 5KFQA 4M29A 3W7LA 4FI4A 2E1RA 4A8QA 2YKNA 1E9ZB 4UBPC 2P3ZA 5CXPA 4FF4A 1NF0A 2V8GA 2EBEA 3R6LB 3MMJA 4U9RA 4GQQA 1TE1A 4OLOA 2XYLA 2W7PA 4BEQA 1S0OA 1KBBA 3S6DA 1N52B 1NH8A 1PKMA 1TWDA 4G1NA 1REGX 2ISWA 1LT7A 2Z58B 3AS1A 1Z44A 1KHVA 2NXJA 4FVMA 3RR7A 4N4PA 3R7BB 3BOLA 4WSJA 1XIDA 1MXSA 3WF4A 4AVOA 1KFSA 1TPFA 4GH1A 1RT1B 1Z32X 4O0ZA 1LFWA 3WLQA 4RE2A 4JBRA 2R7VA 2EJAA 4DSEA 3LX9A 2ZVRA 3UN2A 4UFHA 3T2OA 1P4CA 1KLYA 2GGHA 3HGSA 4KGZB 2V2DA 2CLIA 3R0DA 4UC5A 1P1XA 3QMTA 3GIRA 5JBEA 1SC4B 4S3GA 2W2NP 1H5VA 3BGRB 4OHQA 4ZVQB 2EKGA 4GKJJ 1KFJA 4IFKA 4A8YA 1OF6A 2ZE2B 2BWGA 2E28A 2WMHA 4NXNF 3W8GA 5F9NA 1X8CA 3NSMA 1NJXA 1OHLA 3PM6A 3T78A 2IM3A 2XH7A 1GEQA 1TMLA 2VMFA 3QR0A 2RHSB 3T08A 3OSNA 1SYTA 3WQ5A 4B3MJ 1R3SA 1XJBA 3E38A 3SCNA 1JPIA 2HEJA 3LHUA 1JRCA 1RD6A 1AZSA 1KVJA 1M0SA 4H4OB 2E67A 1SSGA 1TMJA 2INFA 1R0AB 3VFCA 1A0OB 4YS2A 1JQGA 3AJ1A 3QGKC 2V63A 3D6TB 3QT7A 1FCBA 3OFFA 1YBQB 3BO2A 3DGVA 1PJ7A 1TTIA 4CI0B 2BOGX 2HVNA 3U5YA 3W5YA 5HBMB 5J2MB 1ZJAA 1HQEA 3GH4A 2FGZA 5A1AA 3NQAA 2ASDA 4JYFA 2IRYA 2TODA 3PZNA 2XYPB 3ZZOA 3BLIA 1IXNA 1JLQB 1RLCL 8ATCB 4B5TA 2VGFA 1SKSA 4DCPB 2XS5A 3NYZA 2LQBA 1LUCA 1JCMP 4Y9MA 1QI0A 4DV5F 3DI0A 4IGMA 2PGCA 1FH9A 1TWWA 4KEUA 3KK2A 3BE7A 4JDYA 4NRTA 3VCNA 3PSWA 4AY7A 3ZQ9A 4DS5A 1CEZA 1Q81T 4E4UA 4JKLA 3MI7X 3KHLA 4Z1BA 2PDBA 1ZM9A 1TZ9A 4L9YA 2FHJA 5J04A 3P49B 2JEFA 2JKEA 1AQ0A 5C7PA 1RI7A 1E15A 5A8OA 3E3HA 5CXTA 4USUA 4Q45A 4F8RA 2VEGA 2XPKA 1DJNA 1HWJA 3GG7A 4ZVHA 1EL3A 4YQWA 1AVAA 4RWWA 2GVLA 3DCAA 2DITA 1ZPTA 2YR1A 2F3JA 1LL4A 3TR9A 4A21A 3MDFA 1Q7QA 1XBVA 2EPKX 3JZEA 3W2MA 2QVNA 3CV7A 1HBMA 1YZ7A 2UXCJ 3GD6A 4Z2JA 3GXMA 3AXKA 4X22A 3GVWA 5AYBA 2DKOB 3ITHA 4IPPA 3I0SA 3CAQA 4MWAD 1EP3A 3VI2A 4Y34A 1FCAA 5IWAF 3NS6A 4DV0J 4ILMA 1TWZA 1HNWJ 4N2YA 1U25A 3CF5Q 1H3DA 3N9RA 2YCLA 4C7DA 7ENLA 3KLHB 4B91A 4BDPA 3MI6A 4WFNQ 4FOKA 1RTHB 2ACYA 2AHOB 1SJ3P 3TAKA 2UUAJ 4FN5A 4QM1A 1N5QA 2PTYA 1VRTB 4IFYA 1G4CA 3SQGA 2ERRA 3LM7A 1OYCA 3EJMA 4L6DA 1XR2A 7XIMA 1Q4NX 3JR2A 3NKYA 4N47A 3BSOA 2O66A 4LYPA 1TL4A 4QBUA 4S23A 5AHMA 1QTNB 3GR4A 1DURA 2FIUA 1J93A 1H7PA 1PAEX 3NNHA 1FDZA 2VEIA 2DNRA 3IV3A 3CDUA 3G6MA 3E96A 3N29A 2E77A 3VGEA 5KFOA 1GOIA 4NRRA 4E0CA 4IICA 2CXGA 2X8RA 4FLSA 4U7UD 1M04A 4ZJQA 1PUDA 3T44A 3BN7A 3FUYA 1YMYA 3RBEA 4MHBA 3POHA 3BDKA 4C60A 1MUCA 1AH3A 2B4VA 4CTAA 1L8NA 3BLKA 2P10A 2EPHA 4ZR8A 3XIMA 1V6WA 3FEXB 2Y7DA 2D1CA 2VVSA 3T4CA 3MS8A 2IDLA 2WHMA 1TVNA 3KDOA 3KTCA 2MKSA 1TPH1 4CO1A 3NS7B 3SCKE 3LLFA 1YJVA 2G4BA 3CL8A 1H1NA 4ECQA 3IGHX 3HFVA 3CUHA 3KOWA 2FLLA 5DN1A 2HMCA 4QLLA 4E5TA 3P61A 5HPOA 1LWFA 3VAHA 1UVJA 2R8GA 4Q8VA 4WCJA 1VFUA 4X2PA 2PLCA 2JC1A 3A21A 3BW4A 3WMSA 1Q78A 2ZC4A 2DEJA 4YPJA 3QKZA 4ZE5A 3TZNA 1KSPA 3UR2A 1GTHA 4C5ZA 1RJRA 4LS1A 4F8XA 3TTEA 4DPXA 1L3TA 4WCEQ 4LVGA 2ZZNA 4ZITA 4M63A 5XINA 4JTAA 3RRAA 1LOSA 2I56A 5K9DA 1VC5A 4RUHA 3KOFA 4WVXA 1TPC1 4UW2A 1KCLA 2RU9A 4B4HA 2GVJA 4J3TA 1G4PA 3D0IE 3V0SA 5KFXA 1POJA 1BWKA 2G3FA 4XPEA 4CEUC 1B9BA 2FGLA 3Q2SC 1ZCCA 3IMQJ 1UVIA 4K4ZA 1W2VA 3GV8B 4RPQA 1KD1T 3VIOA 4J9SA 4US5D 4UOQA 4KW2A 1PX8A 3R9LA 3KG4A 5A8NA 1HGYA 5E33A 1A9NB 3EYPA 3K13A 2OFJA 2QJ3A 5GNZA 1FFGB 1Q63A 2UXBJ 2ZUGA 1F76A 1YTKA 4JCLA 1XTZA 3AS2A 5HN0A 4M7SA 5H8MA 6XIAA 1QM9A 1AUDA 4DEFA 1QW7A 2Q1LA 3QPEA 1REVA 3G8TA 1EAYC 5JH1A 1QVGR 1AMYA 5D9OA 5LOQA 4B9YA 1JLGB 1A5MC 1T9WA 3S01A 4HSHA 2J6XA 3TKFA 5HVHA 2IYIA 3DG6A 3D3CJ 2I16A 1OYAA 2PTXA 2PFDA 3H2FA 3OHBA 4H4IA 4P7QA 3K5OA 1E6YB 3T0DA 3PPCA 1L3UA 1KFDA 4JX6A 2WSQA 2YNHB 3PR4A 2GW8A 2ROPA 5FIIA 3GLCA 4BQ2A 2C2MB 4RK8A 2GIRA 2WSEC 2PP1A 5CLWA 1XINA 1XWYA 5DMLA 3THAA 5CCLA 5DRKA 2AWZA 1HW9A 4DNHA 4OV4A 2XDFA 4LVDA 3SIZA 1CZ1A 4WF7A 3F44A 3VD4A 1DHMA 1CLXA 4W85A 2XY6A 1R87A 1JXEA 2PRHA 4K2JA 4RU9A 1DWJM 3OUYA 1TSIA 5G2IA 4DUXA 5IM51 1V3LA 5A0YB 3THPA 1SL0A 4DL0C 4AZ5A 4IPIA 1H60A 4WU2A 3QLLA 3RUBL 1I3OB 3VAGA 1B7FA 1WF2A 4CCHA 4K36A 1YJNS 1P43A 1FWTA 2V3GA 3EEZA 4JI7J 3QJPA 5DO8A 4QG6A 1SW7A 1A5OC 1F74A 1A5KC 4JTLA 5CG0A 2Z4PA 5KT2A 2HFSA 3OBIA 2X30A 1FNOA 3ABXA 4PH6A 2HS4A 1NJWA 4ZQRA 1W3TA 1B54A 1B31A 2QLBB 2LQ5A 2YDSA 4GBUA 4CQBA 1A0DA 4UQGA 3QIPA 3RRXA 3LWLA 1VRXA 4W87A 4HIBA 3BAYA 4GI6A 3M6WA 3UN3A 4A22A 1A50A 3O5TB 2CJ9A 1RJQA 3HO8A 2RF2A 2ZWOA 1UWUA 4AWUA 4TKTA 3N15A 4XKYB 1D2KA 3EE3A 1M5KC 4N7QA 3QZ6A 1KWMA 5GPRA 1S1UB 4IH6A 2PTWA 2FTPA 3ZZZA 2GVZB 4DBDA 2OMAA 5KG5A 3BVJA 1JI2A 4NT0A 4BF7A 2ZH2A 1XIBA 5JH2A 3CEDA 3B8UA 2HZVA 4JZ5A 5F3TA 2EG1A 3TJIA 1AQHA 1BUXA 1Y5IB 3NS5A 2DTJA 3NOCA 1UVLA 1X4HA 4EXBA 4E8UA 3KLEB 1Q5YA 3LTSA 2FJUB 1RJPA 5D2TA 4ZQMA 2Z26A 2WZ1A 3TX0A 3P8JA 3OZYA 3MV01 5CC6A 3BK0A 3G8RA 3ETOA 3SFUA 3B9OA 3EYZA 4B5SA 1UWBB 5HMXA 1D7KA 3LGNA 2DJWA 3DX5A 3I0RA 4KPLA 4V27A 2DNYA 3TAQA 3HZ3A 5DZ7A 4USWA 1FJGJ 3K4AA 4XPCA 1TZ7A 2DZXA 4GD0A 5FF7A 1F5BA 2HQFA 4KR0B 2BZNA 3MMBA 4H6EA 1Q65A 4DB7A 1EA9C 4J9LA 1Q7LB 1RY0A 1A47A 1K8AT 6CGTA 2Z2AA 1XERA 1EKOA 4K37A 3G82B 2KTQA 4ACZB 1UBPC 1E6ZA 3AFGA 3NAVA 4I0WA 3U2CA 2GZXA 1Z2ZA 2VQEF 3CJ2A 2CJQA 2WZIA 3GC2A 1J0KA 3EVWA 2HWIA 4HD5A 1O0PA 2JFEX 2GX8A 3OQ2A 4ENOA 1D9AA 3UQSA 4A4JA 4KWUA 4GGHA 1NOUA 1VQMS 2O9OA 2YCEA 3B8TA 4HPNA 1K8XA 4HU3A 3BBBA 4CLTA 1GQNA 4YN5A 5LGXA 1YBTA 4LYRA 2WQDA 3T1YJ 2U2FA 1NZAA 4CNZA 1LQ2A 3B8IA 5HMFA 4CNYA 4YHHJ 2YL5A 1SUQB 1PBGA 2Z7GA 4TTUA 4EZ9A 1EOMA 1GXTA 1DXIA 2J88A 2GIFA 4H4MA 1C1BB 4G1IA 5D4NA 4EAYA 2BVDA 4AZ7A 1OC5A 4A2RA 2LA4A 3N2MA 4LTSA 3JSMB 2RT3A 2NREA 1UJ6A 4IMCA 4ORIA 2B56A 2ZOFA 3CDWA 4NMXA 1X98A 2BDPA 3ZWSA 1OGSA 3BLLA 3TZXA 2OT0A 3NQ6A 1NK5A 5GJNA 3TEVA 1XLIA 3KRSA 5LT5A 3W29A 5CC5A 1ZLPA 3OSPA 5L1JA 4IP7A 1D0EA 4Q7AA 3D47A 4Q4RA 4S2BA 3SY8A 2HLTA 1KGUA 4RE0A 3FSYA 3FGCA 5EFFA 5F8HA 4JL2A 1VYPX 4Q5VA 3KW3A 5IWAJ 3FDKA 5BCAA 1K9FA 1E1EA 5C2GA 1G7CB 4U3CA 5AFDA 2RRNA 1ZBTA 5CPLA 2EG6A 3W1MA 1APSA 1UVMA 3CHFA 4QJ3B 4NNAA 3PUEA 4TTGA 4OL8A 2W79A 3R89A 5BROA 2A3HA 1Q82T 1JJ2R 1JD7A 2HNHA 3BR9A 1Q1KA 2O01C 2V4JA 4EU0A 5TQLA 4X4UA 3NQBA 3N12A 2F61A 2XMUA 1C4AA 1F9FA 5D9PA 3HVAA 1YXCA 1OX4B 2MLZA 4NY2A 5FIPA 3UETA 5I6SA 3LHZA 3WH7A 3PTQA 2PZ0A 1E6VB 3VDAA 4YY3J 3J7YU 1G67A 3U4AA 3R8HA 1B2YA 1DKWA 5E2QA 2CJAA 1S76D 2WBGA 3A3HA 3E5PA 4LF4J 4GMKA 5D6GA 2WMIA 4JTGA 3S8HA 2AIRB 1PCKA 1Q3NA 3STPA 2IC3B 2WB5A 2QUTA 4A3UA 2O0TA 3S2CA 1NCLA 3RW6A 2OEMA 4FKXA 3C0JA 2VQFF 4GC7A 2OTLS 1QNVA 4JTSA 4L73A 3HF3A 2BVZA 4DN0A 1G4SA 4LUBA 1KWGA 5DDQC 4B3SJ 1FXDA 3PHEA 1ZB5A 3M16A 4Z2GA 2AJ2A 4KT2A 3S47A 5D2VA 3MR5A 2E40A 3HG5A 4ZVTB 1BTCA 1M5HA 2I57A 4RW4A 1K7EA 4AIBA 5A8RB 3MUCA 2V67A 5B0FA 3TX8A 1VBRA 3VF0B 2WVVA 5B09A 4DSKA 4RW7A 1E4LA 4OV6A 2IDEA 1OZMA 2AGQA 5HQ8A 3GBDA 2J79A 3M44A 3HPOA 1HHTP 3KL3A 4JTCA 4A8RA 3VNZA 3UU0A 4EAMA 4F40A 5A6KA 4S38A 4DV6J 1TCMA 3RLUA 3G0XA 3WQGA 4OI6A 3GR1A 1CJTA 4BCAA 3KHHA 1XQLA 1VGYA 2YWGA 1H51A 4XAKA 2F38A 4NCAA 3MKKA 4MVAA 2GGJA 2FZ8A 5D4YA 2A3EA 2YYUA 4M5PA 1XFBA 4KRWA 4KIRA 3C14B 3JSYA 4H7CA 1IHIA 3EZOA 1M7OA 2IBOA 1WF1A 1YNPA 3IK4A 3W3SA 3TW7A 1S2AA 1CIUA 2RGLA 2VO5A 4F3OA 5K20B 1T11A 1H41A 4RO0A 1ZJIA 2FB2A 4JI8F 1SKRA 3VE7A 5AXMA 3H42A 3B78A 3DLGB 3NR0A 4XZMX 3PUGA 4LV9A 1JJCB 3GYGA 2DHAA 4DV1J 4U6PA 2BW2A 4FP1A 1FDAA 1V3JA 1GOKA 5G0RB 3NQVA 2JVOA 1X9MA 2VZSA 2K7JA 4OV1A 1NK9A 3SFWA 4TVCA 4XSLA 4F79A 1R8CA 2XS7A 4JI6F 2XHWA 2WMJA 2DUXA 3GKAA 1IGSA 3H4XA 5LA2A 1F60B 3QMRA 3A3OB 5C2XA 3AOAA 3CIWA 2QMKA 3HK2A 3MZNA 1H72C 3VGBA 4LUJA 1W5QA 5ETPA 4O3RA 3PZOA 3RM9A 4N77A 3TYTA 3S1GA 1W1ZA 4W84A 3T1HJ 4S2CA 1JPMA 4LPCA 3AXMA 3PTWA 3IG1A 4PTDA 2RU3A 5CBIA 3BG9A 1GMUA 3DI6B 1AFIA 1S7IA 1NZ8A 4JNZA 3PVFA 1LJYA 1EJWC 2AYMA 3RRGA 4PL2A 3P7YA 4M56A 4DWSD 2FZGB 3HX9A 1MW1A 4X84A 1EOKA 3OFEA 1JL8A 4A8FA 1K6AA 3UY8A 4Q4PA 3N6LA 1UR8A 1UCWA 2Z29A 2QEZA 4Q0BB 1E6VA 2HHVA 1MZHA 1B99A 3W63A 2WHJA 4Y28C 1OFQA 5JUMA 3CMGA 2AQOA 3O05A 4NAFA 4Q0BA 3CD5A 3R43A 1J10A 3QGAC 5CD4A 4N8OA 2J6SA 2DT2A 3HGRA 2PDJA 4OECA 2YKOA 3QTGA 1IIHA 2PE8A 1O66A 4AZCB 4JHOA 2DY1A 5HROB 3HPXA 1HQUA 3LUYA 2ZKMX 3B03A 4CD8A 1YG0A 2IM2A 1LWIA 1UKUA 4DEZA 3LCIA 4A35A 4NP7A 1UZHA 2QGFB 4TUFA 2FJWA 2UUTA 3GDLA 2ZUAA 2OQYA 4F4RA 4NYYA 2ZC3A 4NYZA 1QOXA 3AQOA 4IQMA 4KCWA 2C0HA 3W81A 3B4UA 5F0UA 3S8SA 1FHVA 1BHGA 1H38A 3QYYA 2J13A 3H4WA 1W5MA 2QW5A 1XRFA 3M0KA 1GFWB 1UAWA 2NT1A 1EQMA 5D33A 1L6FA 4OX7A 1ZAJA 2HHTA 1MFUA 4M24A 2E5CA 1BPLB 1QXLA 2VG5B 3OPKA 2WSPA 3AU2A 3LAKA 2E6FA 5C9WA 4ZPBA 4OGZA 4C8MA 3MM5B 1BKSA 5D2YA 1I8JA 1QJHA 4E3TA 1YEYA 4L5ZA 4R8UA 2YPIA 1TZZA 3KJNB 1MNSA 4ZQPA 4LAOA 2B5JA 1FEEA 4LC6A 1EJ7L 1LOLA 4G1PA 1DJIA 2RQCA 5CG7A 2OR2A 4C1NB 4Z2KA 5M1TA 1E0XA 2WVEA 3S1VA 3BPSP 4RZ5A 2RVJA 3UJFA 3WIJA 4KWVA 1S5TA 3VMOA 1YRUA 2C3PA 2XMJA 3C14A 5HNTA 3DI1A 1CECA 3AU6A 2VC5A 2CBVA 2ZBRA 5F1VA 4TMCA 2DGOA 1NKBA 2B9XA 1XIHA 1W2PA 4F25A 2MJNA 1DQAA 5A8WB 3AIUA 1HX0A 2E4TA 3DHFA 4HT5A 4JICA 4WXZA 1YE6A 1ZBVA 3BG3A 5C70A 2FUG9 3EUNA 4ZP6A 2XI3A 3V6HA 2G96A 1UKTA 2BHZA 4XUGA 4C8LA 3SBMA 5HQLA 2XWXA 1WOAA 4R7WA 1OF8A 1SFSA 2NUYA 3LB0A 3CCSS 4IPNB 3DFOA 4TLQA 3RCMA 1MROB 1YK9A 3COTA 2GLKA 3R7SB 3AROA 4LSZB 3TTQA 3XISA 5M2FX 3M1ZA 5DS7A 2FYMA 1SQFA 1DIDA 3BN4A 1XW8A 2A3LA 2LLZA 3CC1A 1T02A 1E1CA 4C90A 2Y7FA 3LNMA 4AG0A 4DHGA 2HVOA 2DP3A 3C3LA 4OKDA 4G1QB 1PDYA 2RKXA 4BI6A 3E8OA 4XDCA 4TV5A 1AJ0A 4DR3F 1TRIA 3DC8A 2ISFA 2W0UA 4DWIA 1WNOA 2XISA 3GDMA 4P8UA 4LFAF 1XX1A 1KFKA 3G8EA 3C15A 2ZX5A 2X1GA 1XI3A 2YBVA 3WL0A 1H0IA 5KG2A 2JEPA 5J1EB 2X3GA 4XD4A 2GFFA 3RGIA 3S42A 4IQDA 1NU5A 2MLXA 2UZ9A 4K4WA 2BP1A 1H2JA 4WIQA 4ES3A 3W84A 4HHMA 4LSLA 5GAGI 2VODA 3G1VA 3H4GA 1ME7A 2OTDA 3G6ES 1A5BA 3VOJA 3AHPA 5BYQA 3BCFA 3AIBA 4C11A 1VBHA 3W7DA 1YDNA 1S9GA 3OEXA 1UPPA 3SYZA 2ACSA 4NAEA 1TB3A 2A3AA 2V3FA 1VD6A 1G3OA 1S1UA 1JK9B 2CLLA 4G7EA 3NAHA 2CDQA 3I5CA 5BMWA 4OZ5A 1A4MA 1CJTB 1CGVA 1YXYA 3QGPA 4P7VA 1MVYA 4CVWA 5DLCA 4KHMA 3M64A 3RU8X 4WXOA 1RCXB 1L6YA 4DF0A 3JW7A 3HVWA 1BVNP 5K4ZA 1T96A 2QTWA 1YX1A 1JI1A 3MPGA 1RJJA 2P0IA 1VCTA 1Y0EA 3OO2A 2GDUA 1S57A 3FQLA 3BAXA 1NMEB 5J5RA 4O44A 4AD5A 2Z2MA 3V3WA 3MO7A 3R10A 4W89A 1SM9A 4G56A 2KG0A 1N82A 3QSRA 4MWAB 1I1WA 2H6RA 4ELUA 3GQYA 1VFTA 2PBOA 2XJ7A 2CFFA 2J6UA 3PC0A 2DGWA 1CB7B 1KFBA 3TA1A 2H3BA 1H7RA 3HJZA 4H01A 3IGVA 3QLHA 4I6AA 1A4LA 3T4WA 5AYYA 4IO1A 3G6LA 4NLDA 3QJJA 3NL0A 2JLEA 3RFAA 3HULA 3VAJA 1E73M 3KWSA 6TIMA 4GX8A 4MAVA 1EIBA 2IRXA 4JQ2A 5KFRA 3SEPA 1HMVA 4OQVA 2CQBA 1GNXA 2FZDA 2N4DA 4PCPA 3I6TA 4OJ3A 3GIIA 2RDWA 1LRNA 2YWKA 2QUVA 1WEXA 1NJJA 3SUSA 4V19X 1WUFA 2LEPA 2PDWA 2Z2LA 3GFHA 2UY3A 2P6SA 2DNQA 1R7OA 4G1KA 4LY8A 5F2LA 1CW2A 1MQQA 2J7GA 3W01A 1W1PA 2W25A 4KRUA 2G8ZA 4K68A 1XNQF 1S1XB 1R85A 3WH5A 3NGKA 1URNA 2JK2A 3NO5A 5ECUA 1N8RT 4AWEA 1I2OA 1TCDA 4O0QA 2E6DA 3GSMA 3EWCA 3I6RA 1JFXA 4GPNA 3W9ZA 2M7SA 3AXHA 4MNJA 1FE4A 1FE0A 1EDGA 4MKNA 2F8HA 1KXQA 4CO4A 3KOAA 2YBTA 1OFEA 5AHEA 2HBZB 2BW7A 5EMMA 1J27A 3WUEA 4QOTA 2R1NA 1N8WA 3IM9A 1E70M 1EZ2A 1GTEA 2J6VA 1L3KA 3DKDA 2EC0A 5HO4A 4C8ZA 2NX1A 3BO4A 4F50A 5DCEA 3VVGA 2IKIA 1JZ8A 2X51A 4JTQA 4IG3B 3E1F1 2K8GA 1KQFB 3U7BA 3M8WA 4PG7A 3WC0A 2LMIA 1V3MA 3UW6A 3W1LA 4Z08A 1S6QB 3ATZA 2J74A 4O4VA 2G1DA 4IP5A 4B3OB 2B6AA 4PFHA 3UCCA 3PBVA 3PFMA 4JB8B 2GWNA 4GZ7A 1RHRB 3FJ4A 3OJGA 2J8TA 4AZBA 4BK9A 3SGUA 3A3NB 5F8MA 4BWLA 4ED3A 4D3GA 1U0HA 4ANEA 1MW0A 3NXZA 4USMA 2HQDA 2WJFA 3WDOA 5DDPC 4UF4A 2L5HA 3NZRA 5FLXY 4GKLA 3WQCA 5LMUF 5GAHI 1ELSA 4QEHA 3TP4A 3WD3A 3R5BA 5A69A 2WM0A 5EY5A 1R9XA 1GZJA 1MXDA 2VX7A 1FNMA 1VQ4S 1CS4B 4GUGA 4J3WA 2HFZA 3M6DA 2OPRB 2XVNA 2HWGA 4G7EB 4UCFA 1N56A 3G71S 3FHQA 2NVCA 4JI0F 2C6QA 3EOSA 5CA5A 5EMKA 4LUTA 2PRLA 2IVFB 1QI2A 3D46A 4B3RJ 2HBVA 3HQ1A 4PUDA 1ONEA 4CYUB 3Q0AA 1FWPA 1DJXA 1KM3A 3QH2A 1KGXA 5BU6A 3VALA 3ZVIA 1JZ4A 3AC0A 4E2VA 1AW2A 5I03A 1FD2A 3T6JA 1NJIT 3AHZA 2BUNA 3MR3A 2HRTA 4G6CA 1DQUA 3S9IA 2BX6A 2WM1A 3QZ7A 4ZA0A 3INPA 3BMXA 2ZXDA 3EAUA 1CC7A 5K3VA 3BUVA 1NVMA 4DV4F 3G2XA 4NA2A 2QF7A 3AD8C 3P81A 2W2MP 3SMZA 4ZQCA 3FS2A 3LP1B 4KEZA 3RAQA 2F8QA 1KGWA 1EB3A 2XG9A 4HNUA 1UIOA 4JYEA 3TE9A 1K4GA 1ZUAX 1HBOB 4Z2XA 3D66A 2D0GA 1XUZA 4G65A 2GQQA 3FIGA 3LPGA 3C0LA 5F8NA 3MFIA 2QYGA 1FERA 1RHCA 2JE8A 2XLKA 3RLGA 3K89A 5T7LA 4ZIWA 1XUUA 5LIWX 5DY2A 3BXWA 4QFUA 3AH6A 1SO4A 3UNTA 2BGNE 4KERA 1MRQA 4CLUA 5KFAA 5K14A 4ML4A 2DIEA 2I9EA 4D2JA 4WY0A 3N34A 4Y96A 2J9DA 4RUBA 1VFLA 3V4BA 1XLBA 1W5NA 4DPTA 1MW3A 4ASTA 3GFZA 4PUKA 1NSJA 4R85A 4WR3A 4LUTB 2DFAA 5EKYA 3O7UA 3MHFA 3V81B 2DSVA 5DFAA 1HFEL 1C7TA 2WTFA 3SAZA 3E2EA 1RT2A 4EEYA 4UIOA 4RW6B 5BXIA 2XSJA 4EX4A 1BVWA 2XMWA 1S72S 2BFGA 2QCNA 4DR5J 3I32A 1H62A 3UCUP 3WQ4A 1RXOB 5A6LA 4LGXA 1ESWA 3GCXP 4ZLLA 3PF3A 3D3FA 2YXLA 1JXJA 1O8BA 1WQ5A 3LPPA 1P8GA 5K9XA 2Q3RA 5GJPA 4DXXA 1FQ0A 2ZHBA 4LVBA 3M41A 1TTPA 3LALA 3NMAA 2BY0A 1HJWA 2NXHA 1NK4A 3ZS4A 2YA0A 2YBUA 3QLHB 5A6MA 1WUEA 3IR7B 4C1KA 4DBUA 4QWBA 4F36A 4QE4A 1YGYA 3VDBA 4QZVB 5HROA 4GNVA 3FNDA 3L0KA 3WBXA 1PXGA 4FLRA 5A6BA 1FA2A 1H2VZ 2VBXA 1L2QA 4RNFA 3HFKA 3SURA 1HWLA 3DRPB 1GVRA 1UR3M 2OWCA 3QR3A 1RA7A 1YYAA 2YLLA 4ED2A 4JV2A 2YNHA 5J5DA 4ED1A 3MU7A 3HHLB 3N9SA 1H2TZ 2MQNA 2NWRA 5BR8J 4RNIA 1VRQC 1H5YA 2UV8G 1FRIA 2BSLA 3UA4A 3N6NA 2OLSA 3WUGA 3W62A 4MMWA 2CPUA 1ZTTA 3HDSA 2DRAA 3W1TA 2OYLA 3W83A 4I2PA 1JFHA 1TV6A 4L65A 2ATCB 1S2VA 3TN3A 1XR6A 3ZOAA 1ZAXA 4DELA 4JOMA 4XAGA 2ZWPA 1CJUA 2UZAA 2YNFA 2E9BA 1F3FA 3UN5A 6AT1B 1RQEA 1VLYA 3AB2B 4JXCA 4BF5A 2AU0A 4GJJA 5AC4A 3V4IA 2WLYA 4U4MA 4D1IA 4HMCA 1ITPA 2H9AA 1RK5A 3SADA 2XCAA 2VD9A 3QR1A 4GCXA 2VFIA 4JI8J 3BGRA 2BJ8A 4P9SA 4O23A 1JDEA 4H9VA 3SY1A 4S3EA 1S2CA 3PKMA 2Z00A 1Q8KA 1D8WA 1WC0A 5HMZA 3SCQA 3A12A 2D23A 4IO9Q 3D6FB 3L4UA 2B7CB 5CH9A 1LM1A 1MYRA 2CQIA 3SCTA 1JF6A 2OMOA 4PRRA 1T9UA 3UDEA 5HSPA 1GYMA 3EPOA 1NHKL 1OWXA 3RXZA 4FX7A 4JTJA 2NYHA 3M47A 4MPKA 4BLGA 2MJUA 4ES2A 3M0MA 3NNTA 3UDVA 5DT7A 3GG1A 5D02A 2DH8A 1HNXF 4FF5A 2B7QA 3B0YA 4C11B 1W9UA 1KOOA 4O10A 3AAMA 2RQMA 4PMXA 3U9IA 2X7IA 1VBXA 1U1UA 5I3PA 3M7VA 1H50A 5HJXA 2Y8UA 3LPEA 2OX1A 4JNYA 3T9NA 2HSAA 1W8GA 2POZA 4OYXA 2WHOA 1RABB 4LCRA 1F6KA 2D9PA 3M1VB 4F26A 4DR2F 1YTDA 2HK0A 3GY1A 4E38A 2QS8A 2AX0A 2K3KA 2VFFA 1GZ1A 2BHYA 3BV4A 4AX7A 2R91A 3EA1A 1MDLA 1OGBA 3M8RA 3WO8A 4D6CA 2IPOB 4ZO9A 4F0SA 2OWXA 4KPYA 3A4JA 3RPTA 3CH0A 4PMQA 3QJLA 4OWGA 4V1XA 3ITXA 2YB1A 1SJQA 3SJNA 2CNOB 1PJ9A 4MDPA 4W93A 3LP0B 2G0WA 4QRNA 4MT1A 4BEUA 3LPYA 1H6KX 1UA3A 4PWDA 1NJZA 3A3XA 4IP4A 3QGHA 1DJWA 3DU6A 2H54B 3CZGA 2WKLA 3NBPB 2W4CA 4KBIA 1BGAA 2B8PA 4Y8FA 3G6VA 1LW0A 4WEVX 1VCFA 4WBFA 4UMBA 4Y7EA 1UUOA 1MU2A 4QR0A 1B57A 3MXHP 3KCLA 1AA1B 2B7BB 3H59A 4M5KA 1YTEA 1BLUA 1NARA 3M2VB 1CULA 4K8HA 1HNZJ 3HV8A 3F5LA 1E0WA 1CSJA 1JCNA 1Z7AA 5D05A 1V0NA 3I0SB 1BAGA 1YPIA 4PUEA 1HF6A 3ARVA 2C1EB 1DXEA 3H7UA 1U7LA 3P6YC 4MB5A 2V5BA 3EKLA 2BOFX 1Y65A 3THTA 4LAZA 3B97A 4UTHA 2VZ9A 1P0EA 2O67A 4JIPA 3DN5A 4DUVA 5JIPA 2J7BA 1R3TA 4DV7J 4ZEPA 1W2IA 2Q8XA 1B0VA 3OA5A 2WONB 1WHXA 1LQ9A 2CLHA 2XIJA 1C1BA 4NXSA 3MM8A 1NDYA 5K7JA 3QZ8A 1OY6A 5ETOA 2GVDB 4QW9A 2PLKA 3TA0A 4PMNA 3CT7A 3CUIA 3U2OA 4AIOA 1CC8A 1YQHA 3KUHA 1WX0A 1ME9A 2V8PA 4IX2A 4Q6JA 3OJUA 1O95A 4IUGA 4O3PA 2IY5B 4NLGA 4O57A 4CT8A 3MJYA 3C66A 3HZGA 1XMOJ 5HMWA 4AD1A 4N76A 3T8LA 5DBTA 3T19A 5A6SA 5AZ0A 1G2EA 4HSOA 2FD2A 2P9GA 3CVKA 3MP3A 4OZ2A 3CD0A 3H7VA 3KK3B 4XISA 3QRRA 3LANA 5J1PA 4JN6A 2IMOA 1BYCA 4PEEA 4CNPA 2OGYA 3BAJA 3C3UA 2DNPA 3WLIA 4AFYA 2ISSA 3T2PA 1EC8A 1QPNA 1DFDA 3L68A 4U5KA 4EPDC 4IPJA 4V19J 3DM2A 3TARA 4CM2A 5EMYA 3WJXA 2NVDA 5EB8A 2ZEJA 1HTIA 3SCOA 4IGHA 4EGLA 4LAMA 3PYEA 3VOIA 3KOZA 5L9FA 1HBOA 3Q24A 1FWJC 1R0AA 3IRWP 2V2CA 2YQ1A 3W1RA 3CZLA 3H2MA 2R7UA 3N04A 5KFCA 4UTTA 2X7VA 2BANB 2OO6A 4PPZA 4NLPA 4DFMA 3RX4A 4K7YA 2X41A 2EK1A 3C2YA 2B4GA 2Z1XA 2OKQA 3OZPA 3OFGA 4X0NA 1KDNA 3B3DA 2FDNA 3HO1A 2JF6A 3URAA 4D3HA 5DLFA 4WY0B 3M1VA 3HIJA 2ADBA 4QU7A 2J78A 4PXDA 1GJWA 2I5GA 4MY1A 1VFSA 4WWSA 4W86A 3CAWA 1POKA 1IF2A 3DC0A 2JWNA 1HBUB 1WHWA 3GVGA 3SEOA 1HD0A 1QJWA 4EI2A 1XMOF 3IWLA 4CLZA 5HXMA 3MM9B 4LIWA 3Q67A 3TZZA 2BTMA 3AWOA 1SV5A 2Y7GA 1TR9A 1TFWA 4R53A 3UERA 2VFUA 1M1GA 2PTZA 3MQTA 2XG8A 3ADAC 5PTDA 1R8AA 2NXUA 1EGVA 1F07A 2X1AA 4JQ4A 2J7FA 3KHDA 4XB3A 3BBFA 1ONWA 1IM6A 2FGOA 5ABTA 3G82A 4USTA 4AZHA 2BE2B 4HH0A 4BI7A 3LENA 1K9TA 2H3DA 3HHKA 5ETMA 3W7KA 4J35A 3ZR6A 4KH0B 2F5GA 2CJBA 3WF1A 4KT0C 4QJVA 4C8YA 3EWWA 3MUVP 3N1AA 2CQ2A 4B3OA 5HULA 1H1YA 2R1KA 4IMGA 3DEQA 4A48A 1FWAC 3NLCA 2AJQA 4CN6A 3OOQA 1AT1B 3AD9C 2BV3A 4LF9F 4F0LA 4FP9A 4MOZA 4OE7A 1BG9A 5GVJA 3C5QA 1E9YB 2C28A 1I0DA 4MFBA 3OXLA 3LQLA 4NEZA 4N6EA 4LBIA 3O6QA 3OUYB 3CV2A 3D6HB 4WE1A 1XLGA 3US5A 2FGCA 2D3UA 4XZIA 3W75A 1UQYA 4HCHA 3OTOJ 2FVQA 1NK8A 2QG9B 4V28A 1E56A 2NPFA 2WO5A 1EC7A 1ECQA 1RR2A 2YYTA 4O0KA 2VG6B 3U7VA 2EHHA 2VKRA 4KCTA 4HTIA 4LSNA 3BKTA 2P3EA 3J81U 3GILA 2QT3A 1VYSX 4LH8A 1T9YA 2ZUSA 3TRGA 3AHYA 1UEUA 4RW7B 3LWMA 1UUMA