2ZVIA

Crystal structure of 2,3-diketo-5-methylthiopentyl-1-phosphate enolase from bacillus subtilis
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
400
structure length
395
Chain Sequence
SELLATYLLTEPDTEKKAEQIATGLTVGSWTDLPLVKQEQMQKHKGRVIKVEERAASEKQAVITIAYPEINFSQDIPALLTTVFGKLSLDGKIKLIDLHFSEAFKRALPGPKFGVYGIRKLLGEFERPLLMSIFKGVIGRDLSDIKEQLRQQALGGVDLIKDDEIFFETGLAPFETRIAEGKQILKETYEQTGHKTLYAVNLTGRTADLKDKARRAAELGADALLFNVFAYGLDVMQGLAEDPEIPVPIMAHPAVSGAFTSSPFYGFSHALLLGKLNRYCGADFSLFPSPYGSVALPRADALAIHEECVREDAFNQTFAVPSAGIHPGMVPLLMRDFGIDHIINAGGGVHGHPNGAQGGGRAFRAIIDAVLEAQPIDEKAEQCKDLKLALDKWGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the apo decarbamylated form of 2,3-diketo-5-methylthiopentyl-1-phosphate enolase from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
molecule keywords 2,3-diketo-5-methylthiopentyl-1-phosphate enolase
total genus 139
structure length 395
sequence length 400
chains with identical sequence B, C, D
ec nomenclature ec 5.3.2.5: 2,3-diketo-5-methylthiopentyl-1-phosphate enolase.
pdb deposition date 2008-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 2zviA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 2zviA01
4NASA 5RUBA 3FK4A 2V63A 1AUSL 1BWVA 1RCOB 1RXOB 2OEKA 4HHHA 5HJYA 3A13A 5HANA 5HK4A 5HQLA 1RCXB 2V6AA 1RSCA 1YKWA 3ZXWA 4F0KA 4LF2A 1RUSA 2CWXA 1UZHA 1RBAA 2VDIA 2V67A 1TELA 1RLDA 9RUBA 1IWAA 5HQMA 8RUCA 2OEMA 4RUBA 3KDOA 3NWRA 5HJXA 1WDDA 2D69A 3AXMA 3QFWA 2RUSA 5HATA 1EJ7L 1UPMB 3RUBL 2OELA 5C2CA 1GK8A 2QYGA 1RLCL 1AA1B 1IR1A 1SVDA 1UWAA 1UZDA 2OEJA 2V69A 2VDHA 2YBVA 2ZVIA 3A12A 5HAOA 3WQPA 3RG6A 1GEHA 1RBOB 1UPPA 1UW9A 2CXEA 4F0HA 4F0MA 3AXKA 2V68A 5C2GA 1IR2A 1RBLA 3KDNA 1BXNA 4LF1A 4MKVA
chains in the Genus database with same CATH superfamily
2V8ZA 4W98A 4JI5J 3MM5B 5AJ3F 1IHIA 1V0KA 4IRKA 3OGRA 5HOSA 1PJ5A 4HCDA 2EVZA 2EPNA 1EARA 4QWDA 3U2OA 3S9IA 2DR8A 2ZKUA 2EG8A 2JFKA 2CJAA 3HSGA 3ILJA 4FLSA 1EWEA 2PGRA 3HVAA 1RTHB 2BASA 4W7VA 3P8BB 3V6DB 3N4WA 4JIHA 3OYXA 4JTIA 1H7XA 2Y7FA 2L5HA 2PE4A 1HNYA 2HS8A 1LKZA 4XD3A 4HP5A 5HN0A 2CG4A 4XBSA 3QFWA 3EKLA 2VEIA 2DSVA 1LG1A 4LSLB 3RU8X 2H3BA 3WLNA 4K4VA 1UW4A 1P0NA 2XZTB 3KLFA 2FGLA 4TX9A 4Y8FA 5EMYA 1ZTTA 2GVZA 2ISDA 2RD5C 2QMJA 3CCZA 3VFCA 4O1DA 2HE5A 1VC4A 2CNLB 2ILYA 3AB4B 2YKQA 7AT1B 4ZSTA 2E5HA 4B5UA 2CLPA 1TKTA 3IUHA 4OHVA 2QSFA 1WOBA 2PDAA 3MANA 2ACQA 3OZYA 4JTCA 4CO1A 4TLQA 1NKBA 1IXPA 1XNQJ 2YX7A 3VNZA 5B7ZA 4QYZJ 3TWZA 3NQ6A 1REVA 4OZ2A 4KS0A 2QUMA 2IHR1 4QR0A 3WQPA 4D8LA 3R7BB 4FNPA 1UWQA 1OJ4A 3KK1B 4DUYF 3HJEA 2HHQA 2WVVA 1PHQA 2JIEA 4S23A 1K8YA 4Z1BA 4C8MA 1HNWJ 1EJVC 3W72A 3PEJA 3WLTA 4DF2A 3WMLA 1A5LC 4FXFA 3HBLA 3UPMA 1VISA 5JIPA 1XC6A 4OE7A 1TL3A 5HNNA 3W2JA 4JKMA 4J3XA 5D8WA 1PL9A 1S3HA 1FJGJ 1R2RA 2XY5A 1CXFA 3JS3A 4PMDA 3POCA 4L80A 3HD2A 4UUIA 5A8RB 1HHTP 3R11A 5E41A 4CWBA 3W25A 4CLMA 3UVJA 4OMFG 8ATCB 1C8QA 4YTQA 4ERAA 4PWDB 3CS2A 4B9UA 3OT9A 4AHOA 4FNUA 1VQ4S 5DRKA 4U67Q 1P1TA 4I7WA 3CL8A 4MUPA 4Q2LA 1XLJA 3S4TA 3W3SA 1CENA 3BCFA 5FA5A 3B54A 4UWMA 4RL3A 4FLQA 1OABA 4MM1A 3LCGA 4QRNA 3AXKA 4OYAA 4KWUA 3WH9A 1RHMB 4M5NA 4I67A 3W7CA 2OIHA 4PABA 2FTRA 1J5EJ 2ZH7A 3LP2B 3EXRA 2X09A 3SI8A 1X4EA 3CZLA 4LUTB 2XS2A 3IXQA 2JIWA 4A8IA 1Q45A 1KR0A 3I55S 3LX9A 5I24A 5E6YA 4FP9A 4S39A 1KQZA 1TPUA 1HTIA 1EJSC 5E6ZA 4LH8A 4QWBA 5E0FA 1GPFA 1JCTA 4F3OA 4KRTA 4YS1A 5IV3A 3R10A 1Y10A 2P1FA 3VNIA 2DVTA 1M1HA 1EKOA 3URAA 5A2CA 3NKYA 2Y9HA 2F5GA 1AZ1A 1OMSA 4NIRA 5ECUA 1O66A 1UOZA 1Z89A 5J2QA 4IIGA 5D0RA 4IDKB 3MMWA 1R8CA 4O16A 1TTJA 4M5DB 1NDCA 2OUGA 1UC5A 3CMJA 2OSXA 4F0HA 4GKKF 3ARPA 4KIEA 3PY8A 2AT1B 1E73M 1EP2A 1TCMA 4S3JA 2M4MA 1XSIA 4CT9A 3PO4A 4LF2A 4ZE5A 4XKMA 4RJVA 4L4OA 4NEYA 3CMFA 2EJ1A 2BEFA 1JCLA 2J75A 1S1TA 3K5PA 4PYDA 1NKCA 2AWZA 5L9XA 2PTWA 4L1WA 5D09A 2GYIA 2F38A 4CQ9A 2NXCA 3M0JA 3M6UA 4EBDA 3BLPX 4UTJA 1G2EA 5A2BA 3KLFB 1K9TA 5D04C 2VFHA 1PE1A 4E2OA 4URQU 5KG1A 2RDUA 1HJSA 1LOSA 1UH4A 3ZT6A 1JCJA 1ZY9A 1NK0A 4DYEA 4GCXA 1KNZA 1RAGB 2W9MA 3QRRA 4OI2A 2WJZA 2ZE2A 4M29A 4UMBA 5FJJA 4WP9A 3OLDA 2C28A 4O18A 2OU4A 1T11A 4Q22A 1GOOA 1ZNNA 2PRMA 4CNNA 3W0KA 1RTIA 2HBYB 4N5SA 2XZ9A 5J1EB 1HJUA 4RZ5A 4DBWA 1MMNA 1S39A 3BURA 2QCGA 5AC5A 3IR7B 2EFOA 3RAQA 4DG1A 2XVPA 5B08A 2XSFA 4L9YA 1VFJA 4F0SA 1R0BG 4MYUA 3UU0A 2KRBA 1J5OB 1HW6A 3C52A 3MD1A 7FD1A 2DPJA 4RU9A 2VUNA 3EDQB 1E4NA 1UJPA 4WU2A 3HQNA 3VPLA 2C3MA 4FZVA 4ZVGA 3LPOA 2ZX5A 1ZUAX 1QPOA 4IIFA 2FFIA 3G6LA 2CVEA 1UJ4A 3D6FB 1NDYA 1HKWA 3TAMB 2EC0A 3Q23A 4S3DA 4JV2A 3B8TA 3DHPA 3OLBA 4X63A 2OFHX 2AZ3A 2Y0BB 4UTFA 4N6EA 5T14A 4AG0A 2U1AA 1F9FA 3GW0A 3UFYA 1JLQB 1H7OA 4PUWA 1CQNA 4Y9PA 4OI4A 3CJTA 4ELVA 5LSRA 1QNPA 3G1AA 5HWMA 1Z48A 5E09A 3QTPA 1QOXA 1T40A 3HTWA 2W7PA 1RT7B 1RGVA 1Q7QA 1UTAA 3OB8A 3RTVA 1E40A 3N01A 2F61A 2ZZ2A 3KLHB 4R9OA 1OSDA 1Q86T 3BSAA 3DIPA 1V9OA 3UYIA 3NPVA 4R3UA 3VCDA 5G2WA 2G97A 2FIUA 4CNTA 5A2QY 3ADAC 4M5JA 1C1CB 1VBXA 2EO7A 3R1ZA 4C6MA 3GXIA 4MZ1A 4H4IA 3A13A 3AHXA 3GXTA 1Q8AA 2CETA 4P6QA 1Z44A 3V4BA 1MW7A 4HPJA 5J5DA 1WC0A 2AKMA 1CT5A 2WW4A 1P5BA 1W3LA 1Q6CA 2XFYA 3FKBA 5FEZA 3MA8A 2ZH3A 1TVPA 3M64A 2VRQA 4L5ZA 4CTAA 3WJWA 1KSPA 1GW9A 4G7FA 3M6YA 3AJXA 1BYBA 3H2UB 4USUA 1VLWA 4DR1F 3BAIA 4WE1A 5D2TA 3B0UX 4C1KA 3CLWA 2DB1A 3SY1A 4C9DA 1HI8A 1FWGC 1YITS 2ZRZA 3WDJA 1N0UA 4AXJA 5CA5A 1TMJA 3BM7A 4I64A 3R5JB 4OV6A 1GW1A 5CYQA 4R9XA 3ZZZA 2J0QD 4RUAA 4HNOA 5K4XA 1VDHA 5H9FK 2AGPA 4ED3A 1NFGA 3IRXA 3A21A 5D3GA 1T0OA 2JL9A 1MN9A 2D2HA 4HOWA 1TVRB 4ES1A 5GQBA 3KG4A 2VI0A 3QWUA 3CJPA 3H55A 3II1A 3M8ZA 1K8CA 4PMNA 1YHTA 1NXIA 2DH8A 4IXXA 1E5NA 3J7HA 3IRDA 3M4HA 3UW6A 1TYGA 2ZA3A 5GJPA 1QDUB 3THPA 4UUWA 2CQIA 1RWNB 2XGZA 2E8YA 2NSOA 3OFEA 1W2VA 3HK2A 3WUGA 2IKHA 4PA8A 3ITCA 1BG9A 2QT3A 1MRQA 4TVCA 4CEUC 1DXIA 1HGWA 1NZAA 3I32A 1V5VA 5A8RA 4AWEA 4EX4A 4J90A 4X64J 4K2SA 4NJIA 4CCEA 4LUJA 2OX4A 1OHLA 1HBMA 4OHWA 1WNOA 1WZKA 4DN9A 1W9XA 3P93A 2OZ8A 1U45A 4LU0A 4FF7A 1ZS2A 2IJRA 4DR3F 3PFMA 4HT5A 3MBDA 4MYXA 5DMLA 3AZRA 1VRUA 2EFGA 1NEYA 3WKZA 4I4BA 2DNQA 1T0TV 2GDUA 2BE2A 1DEDA 3SO7A 2BJEA 3QMQA 1PKLA 5AHLA 4Q4KA 1YKWA 3W86A 4LRDA 2XMWA 1L6YA 3BPSP 4K36A 2X0YA 2LKZA 1PZ1A 3CV6A 2MEWA 1SJCA 3HPZA 5CQ1A 4RKAA 4MPKA 3ZNUA 1QE1B 5LNUA 2YB1A 1CGXA 1UD8A 1KLZA 2IYIA 3TJ9A 2VQTA 1RPXA 2A85A 4JKKA 2QDGA 3OUYA 5H9EJ 1S1RA 1GKPA 1G1YA 4JV5J 4GH3A 2ZEJA 3P3BA 1NOWA 3GY1A 2YKPA 5FJOA 4C6DA 3UZZA 2XH7A 3BG3A 3CCVS 1ZOTA 5HNUA 2CPDA 3NM1A 1Q7MA 1RVGA 2VWSA 4WXYA 3FFIA 4DBQA 5HULA 3ZJ8A 2BANB 3LS9A 1G4PA 4MJ2A 2H48B 1HJQA 1HI1A 5GADI 2BJ3A 3QV6A 4H6KA 2X0SA 4WK9A 2V4JB 4JS3A 4KKXA 5F8GA 3FW6A 2E9RX 1TZ7A 3KOZA 2DBBA 3MEEA 2BVZA 3J81U 4QG9A 1K9FA 3T09A 3CPRA 2AV5A 1KM6A 3KDOA 5D0GA 2F8EX 2BHUA 3U6WA 1UFLA 4YLWA 1BYAA 3S8SA 3C2PA 3FJNA 2MTLA 4QCFA 4JZ5A 1OWQA 3H23A 2O4MA 3RCYA 1HT6A 4M5IA 2DIJA 4O23A 1S48A 2DGSA 4GXPA 2CPZA 1T9VA 4R8UA 3ZWSA 3MHUA 1C0UA 3GLJA 2VP8A 1RCXB 3P8IA 2DVUA 4NYYA 2GCFA 3UCCA 1JLQA 3MM7B 2QVHA 3V81B 2JEQA 3N28A 1JLAB 2KVQE 2DHGA 3QRQA 1GVSA 1FFGB 2FDSA 1IEVA 2ZH9A 4C3MA 4LIRA 4GZIA 1OYCA 3PZUA 5KFSA 2I57A 3VILA 4GO8A 2QFJA 2DZWA 1PCKA 4IIHA 4YTRA 1IM4A 1ZA2B 5DT7A 2XB2D 4C8LA 3JS9A 1ONXA 2FJAB 3R2GA 4MK9A 5G0RA 3TX0A 3PR5B 1L6WA 1O5QA 3W7GA 3MT1A 3WQCA 2ZZ3A 2ZH2A 4OJGA 4FK9A 4OV9A 3UWUA 1HNXJ 2E9TA 3CJ5A 2AHOB 3BOFA 3M6DA 1TWZA 1OG0A 1U0HA 1S5MA 2MB0B 1DP0A 1SJBA 2C1IA 2DR7A 2XTKA 3BSMA 3JZEA 1MUMA 3PYFA 3QLLA 3O05A 3NGSA 3OOQA 1Q4WA 4D71A 2PLCA 3VKAA 1FF2A 4PTXA 1GQLA 1UHVA 5AB3A 2VX6A 3SMZA 3W28A 3PR4A 1E56A 4OYPA 2UXBF 2PAJA 3DKJA 1Q16B 2AX1A 5HWJA 2O1PA 3N11A 2YNIB 2PF0A 3G1HA 3QKZA 4C6FA 3ZOAA 1H60A 1TFWA 3QSRA 4P72A 3SZ2A 1W3KA 1VQ5S 4C3KA 3TWBA 1OO0B 4J9UE 4ZB5A 1RKJA 1C93A 1MW1A 3FBCA 2MKCA 3C2RA 2BDPA 3K2YA 1LFPA 4QGCA 3UESA 1E6NA 1U2YA 2JH3A 5LJ3Y 3RR7A 1RT2B 4D8ZA 1ISVA 4DZIA 1LBFA 1OX4B 3KFWX 5HMWA 4EEYA 3D66A 4DXKA 9RUBA 2VC0A 1XSJA 2CAJA 2F7VA 4JI7J 8RUCA 2X42A 5LGZA 4IG0B 5A8GA 3VO0A 4ADUA 1URRA 1RHJB 2ZBQA 5ABFA 3KBVA 1KM5A 4PRFA 1KVJA 1KD0A 3FHQA 2CZDA 2XFRA 5AZ1A 3MR5A 3P81A 2Q71A 5M03A 3IWNC 2IKJA 3ES8A 4WJEA 5CGQA 3IJ7A 5BYSA 2GJPA 1IBCB 4W8LA 2DHAA 1GZ1A 3EEGA 1MLAA 3WX7A 4L6DA 3P3DA 1HMVB 4B4FA 3GG1A 1SSGA 3NQMA 1ZLPA 2CKSA 1N8FA 3WF2A 3THUA 3WQEA 2E44A 3WLOA 4UC5A 1F73A 4IMDA 1UVNA 4RE3A 5CPSA 1VIZA 1OIMA 1GOWA 5CSRA 1E43A 3T78A 4LRFA 4WLCA 1UWTA 1QU4A 1B3WA 4TTGA 2R42A 5FCZA 3SCSA 3SV4A 4X4RA 1JB0C 1FWJC 4DV0J 3MDFA 2XLJA 4ZKAA 2NW0A 3WD4A 1SUXA 4CCCA 4CU6A 1JLCB 4B2DA 2AL2B 3C6UB 1L0PA 4NZ0A 3SCLE 4X2PA 3WH8A 3LB0A 4UQGA 3E3XA 1MNEA 1LFWA 1RYRA 1W17A 3B0VC 2Y7EA 4NAEA 1CJTA 4YTSA 1KFDA 2DK2A 3G77A 2JNJA 3OFGA 1TRDA 3W2UA 4DQWA 4RV3A 2E8ZA 1TKZB 1AFIA 1HW9A 4DV3J 4GC4A 3DOLB 4L4MA 5D30A 3Q83A 1HQEA 2PURA 5KG7A 5CCMA 5KG0A 2A18A 3D46A 1F5CA 3H2AA 4UTGA 1T02A 3A4JA 1DQ8A 1Y3JA 2PWEA 4GUIA 4FNSA 3CCQS 4MNJA 3LERA 5J2NA 2BY0A 4DZ6A 1RBAA 4JXCA 3WNPA 3VTIA 5D9OA 2VKZG 2MZJA 1WDQA 1HXJA 4TUFA 3SUSA 5F8NA 4ECLA 1OFBA 1XN9A 5KETA 5E1QA 2D1ZA 4F26A 2RB7A 2WMIB 4JI8J 3PNIA 4M63A 2YNFB 1TUWA 4KH2A 2NVAA 4OL8A 1QXLA 1JD9A 4PWWA 1XJBA 1WHWA 4NQ1A 5DFAA 1XR7A 2IM3A 4JTRA 4K2XA 5K8PA 4ZZ9A 1GHSA 3BEGB 1TRIA 1S5VA 2AQVA 2X1SA 1OT2A 4K68A 4AISA 1HQUB 2VA3A 4QBXA 1OYAA 1FDAA 1O5XA 2TSYA 5H2ZA 1XH1A 1G6CA 1FDZA 2F8QA 3QGIA 2CLOA 1C8XA 1OQ6A 2B9XA 4X0NA 1GQJA 1QE1A 1YW1A 1KFCA 3VDBA 1AQ0A 3TA0A 1P27B 1B3ZA 4WP3A 3I5AA 1SSDA 1H7WA 3TYUA 3ARTA 1MG7A 3CDUA 3W76A 2KZHA 2OQHA 1CBKA 2BJ7A 9CGTA 1UP2A 2BM0A 1TB3A 3RX3A 3CD6S 3SUWA 4Q3MA 1D8CA 2OSYA 2R7RA 2G50A 5EMUA 1KQYA 4KT2A 4TU8A 2XIOA 3FHAA 1E1CA 1N32F 1ECQA 2IRYA 5K8OA 1KONA 3AXHA 1V02A 3UNDA 2OPPA 1IBKF 2XWDA 3M43A 3IGNA 6TIMA 3V6DA 5AJ3J 4FPSA 4HGXA 3EGWB 4DPXA 3LF0A 1U24A 3CB3A 5DQIA 5A6BD 1S5WA 1UWBB 1NQ6A 3S42A 1QVFR 3HFTA 2WMFA 1K8AT 1SKRA 1UD4A 2X30A 2OYKA 3UW1A 1FWTA 1R47A 2PCQA 2HRYA 1BQMA 2G9OA 4GZJA 1BQNA 2X51A 2JC1A 3GV5B 2J9DE 1OFAA 3CDBA 2QZ8A 4UQTA 5D15A 1TV7A 2IA6A 4IPPA 1MQQA 1VBRA 2XHYA 1Q6QA 3FSXA 1ZJIA 2GGIA 4C8OA 2GPTA 4LRSA 4KAIA 4WZQA 2AIRB 3L9ZA 2OYLA 1NOUA 3BAXA 1S1VA 2FB2A 2QRRA 2VPYB 1YLXA 2B5JB 3QRPA 4PUDA 2Z4GA 5IS2A 4TMBA 2E9BA 4LFCJ 4MIWA 1SW0A 5GVJA 2XM2A 3P8JA 2HRTA 2DR6A 2W61A 1W37A 5F4XA 4U96A 1T3NA 1VLOA 2RDXA 2IJFA 5F7UA 3W87A 4BLGA 2H4WB 2WXDM 4U33A 1SKWA 4WYLA 1ADSA 2QIFA 2QMWA 4OOZA 4E8DA 1I94F 3L23A 3AA9A 2PC8A 5KFIA 1E6VB 2WZIA 3BBCA 3T0BA 2WOMB 2BGSA 4MG4A 1U1OA 1IWGA 4MFBB 1JI2A 5DCDA 2W66A 5DO2A 4IMEA 5HA7A 1VFTA 1F8MA 4H6EA 3MM7A 4HMCA 2MUCA 3I6PA 2C7FA 2FPYA 3TW6A 1FCVA 3S9YA 5T8GA 2GUYA 3SCPA 3QMRA 3DLBA 1JUBA 4ZLNA 1RK6A 4AD4A 3G0XA 3SBMA 4ZHRA 3RGIA 4C4WA 4DBDA 1QATA 2WV8A 2E40A 4NJKA 4AWTA 3T1YJ 1ISYA 4K0KJ 4M80A 3WL1A 1PEZA 1UPPA 2B81A 4YYFA 1JQGA 5C2GA 4Q43A 1PIEA 3EVOA 3PRVA 2FUG9 2R1KA 3UR8A 3IGUA 4G7EB 1X7IA 1SV5A 2BM1A 3N4EA 5IDZA 4ZP8A 3CQ0A 3GFZA 2ZTKA 2YDSA 3SYZA 3F44A 3BO2A 2VG5A 3NCOA 1WC6A 4USMA 2PTXA 3IWPA 2J9ZA 1C0TB 3B04A 1XLDA 3A3HA 3B3DA 3NEHA 1NELA 1JGMA 3HG5A 2ASHA 1QTMA 2EC2A 5ABGA 1F2JA 5E70A 1H61A 3JTPA 5JJBA 1OYEA 1TPEA 3NSMA 1MNSA 1W8SA 1AW5A 5CJMA 2W63A 1JDCA 2UV8A 2F63A 2R7TA 2R14A 1R3YA 1TTQA 2IQTA 3WLSA 1RQBA 1RT4A 2AEMA 5DGAA 1PSCA 1ZBKA 4LFAF 2Y89A 1H98A 2NUXA 4NZ1A 4TO8A 5DZ7A 3AD8C 3M0LA 3WQOA 5XIMA 3QFEA 1QR7A 3R97A 1EXPA 2XSBA 1VC5A 2GGPB 1NJIT 4F0RA 5KFMA 3ZM8A 2B4OA 2PEHA 3A4XA 4WKHA 4WY0B 5GPRA 1PVNA 3AS0A 1SUQA 1C4AA 5AXLA 3RJYA 3A3OB 2MGZB 3LTOA 1KR1A 1KA9F 1TMLA 1TTPA 4GYPA 1XIBA 1V7YA 1HN1A 4Q4PA 1UA0A 1X6NA 2ZFHA 3W2VB 4XQ6A 3M41A 3Q8RB 1E1FA 3PC0A 1ZP3A 3QY7A 2W4PA 1EQ0A 1GQIA 4NYUA 3PB0A 5BU9A 3AUJA 3N04A 2UU9F 4AAJA 1TUFA 1FT8A 4HZMA 1LUCB 3ECQA 4DNHA 4DXLA 3W6MA 1QFEA 4MKAA 1WKKA 1VQPS 2IDLA 3H42A 1EOKA 3E74A 3TYBA 1HNZJ 4DYJA 7REQB 5GAEI 3ITHB 2ZUVA 1U49A 5JVHQ 3EDDA 4IIBA 3MUCA 3UCZP 4FPIA 1KD1T 2GK1B 4REQB 1D3HA 5F2MA 2HFVA 5J1PA 4LIWA 2Z1KA 4HA4A 3CJKA 4X60A 4B5VA 1A4MA 1LXNA 1W7WA 1JIBA 2ZUSA 2VFVA 2HRWA 1S49A 2VYOA 2VDHA 4OBRA 4J37A 4IUFA 3VGDA 2JFEX 3GZAA 3VCCA 1M1GA 5KZDA 4JTAA 1L6GA 1LNQA 4LQ3A 2ZH4A 3VDCA 2MQNA 1FP8A 4NZ3A 5F3TA 2HIYA 2GZXA 5DM7Q 2W67A 2Q6CA 3FVDA 1EHWA 3NO3A 2X1TA 5GMKa 2JOQA 3W7BA 3AQOA 2KM8B 2OFGX 3NS6A 4AD3A 1VD6A 5K14A 1XRTA 3G24A 4PFMA 4J5OA 3GJQB 4Z2LA 2GHPA 3PAJA 1TAUA 3MHGA 2WKLA 4AEEA 3VX0A 3ABSA 2Y85A 3GG7A 4USWA 3L4XA 2VCBA 1MU2B 3ZJKA 2E1PA 5FF0A 3E2QA 3MS8A 2PDHA 4LB4A 3T4WA 2DT9A 2W6RA 1XD1A 5FL0A 2PPGA 1B4EA 1PO9A 2DPEA 1PTGA 4FBUA 3LHYA 3FGCB 4PBGA 4ZR8A 4EAMA 3DOMA 3MMAB 3QMSA 5E3AA 1UAWA 3GR8A 3IGSA 2VRJA 4CP5A 1PCWA 1HYSA 4LS2A 1SZEA 2FYXA 4RDVA 2Z30B 3SRFA 1E0TA 2QR6A 3ZTOA 4O0NA 3DHDA 2ZHOA 4ZPVR 1SC6A 4ZVFA 3M07A 2VG5B 2X7VA 3T41A 3Q67A 1NK5A 1J5OA 3KUEA 2ZE0A 4AL5A 1ZU8A 2BKPA 2FC8A 2CLLA 1QSSA 3F7JA 1Z9AA 4L75A 1S0MA 1F2HA 3DFEA 4KH0B 4UQDA 1BQXA 1UFWA 2NREA 3BQ5A 4BWLC 3CJ2A 1CCWB 1L3SA 2EFVA 4LRBA 1EEPA 4H8HA 4PG5A 3TLLA 3T0DA 4Z08A 3DRXA 4ATWA 3EWCA 1JUEA 1MUCA 1RISA 3W8GA 1RTDB 4AWSA 2PC6A 4L4LA 1PKYA 2C8NA 1EUAA 3FNDA 3OW1A 1NSQA 4ZK7M 1ECEA 5DELA 2AJ1A 4J9SA 4C6JA 1GTEA 1HBOB 3L0GA 1POKA 3CCSS 3WO8A 1C4CA 1JKHA 5CLTA 3D47A 3L7OA 4NHVA 3EWDA 2D3LA 3B0PA 2NCKL 1QW8A 2OT1A 3LG3A 2VURA 1IJEB 1RAHB 1S99A 4K1GA 1E6XM 4BF5A 1QTNB 5CXPA 2WPGA 1QAJA 4P8WA 3SQMA 5ETVA 2FY1A 5D37A 3G1XA 1YBQB 4M5PA 3OVSA 2ZNZA 1E4LA 3NZQA 4IL2A 1J0HA 3S2NA 5JBEA 1CLXA 4V1YA 4HNVA 3G8EA 2G3MA 1WF1A 3NQFA 3W82A 2QX0A 2Y8KA 4XZBA 3AS3A 3ETMA 3M44A 5A94A 1V02E 7FDRA 4PXBA 1M68A 4N47A 2KTQA 3C2EA 2K8GA 2CDQA 4U2YA 2XVKA 4RW9B 2QAPA 3CYJA 2CZVC 1URNA 1EQMA 3QEZA 5B0AA 2QLXA 1S6PA 2UVWA 2ZXQA 3KE0A 3M30B 4ZITA 3GCXP 3V0TA 5HVGA 3CF5Q 5HQ8A 4GD0A 1CIUA 3LRMA 2IPJA 2CWKA 4CYUA 1L8PA 4V28A 4LR8A 2GSHA 9XIMA 2OGJA 1PCAA 4AZGA 4QU6A 2DRAA 2YW3A 3H2CA 3XIMA 1O60A 3VINA 4NZ7A 2CPEA 4KBXA 3GDRA 2FB3A 3JYTA 2B9WA 4P8XA 2X1GA 3OVAA 4UIOA 5KT6A 2MKYA 4RZ4A 1IWPA 2AGKA 3CM4A 1DTTB 3NCRA 3W60A 5EBAA 4GQ0A 1Z8AA 3CUNA 1OYBA 4JUZA 5FD0A 3NL2A 1WEZA 2RQMA 3L0NA 3CUXA 3T42A 3C15A 1TELA 4CQCA 4QS5A 1J0ZA 1XLFA 3GO2A 2JEGA 1J0YA 1U2CA 4MKYA 1FQ0A 4ZFCA 3DM2B 2CPXA 1D7KA 3N14A 3T05A 5T26A 3SGGA 3BR9A 1JZ6A 3LHZA 1PKUA 2O92A 5KITA 1B70B 4FR6A 3B9OA 1EC7A 3RF9A 5A5WA 3JSRA 2ACRA 4JAWA 4USHA 2QCLA 2VZVA 4IICA 1DTQB 3LTPA 1MU2A 1KWMA 4BHYA 2J77A 1K70A 3VWSA 2WB5A 2MDAA 4IG2B 3VIPA 4ZP6A 2WHOA 1G6BA 4R7JA 3GDBA 3VX1A 3MM8B 4UXDA 4DV1J 1VRDA 3KOFA 3IWLA 2EPOA 5F2IA 3IC1A 2HWHA 1UCNA 3PZOA 2AX0A 1HL9A 4LGXA 4B5SA 2HZCA 1EYWA 3BZGA 4YB7A 3E2RA 4LVBA 5FSEC 2HVOA 4RE0A 3GQYA 4YVXA 4NLVA 4BWJA 2N3LA 2V3DA 1EJXC 3WBEA 1VGYA 3HFKA 1FTCA 3CL7A 4OU1A 2VO5A 5EMJA 4I6KA 5HNRA 3B4DA 2E66A 5CPTA 5TF0A 2R8KA 1MRAA 2EWHA 3OTRA 3LPFA 2NUUG 2ACSA 5H8MA 1PX8A 4PR4A 3C5QA 3U57A 3VIGA 4ACZA 5AHFA 2X7IA 2DH3A 3KTCA 4ML4A 1XRVA 1JCMP 4LSLA 5C55A 3M5ZA 4CH7A 2I5QA 3PHAA 1KC8T 3ABOA 4L6HA 2VC5A 3PWAA 1YNYA 1DXFA 2J74A 4JFUA 5KG5A 3KVJA 2DORA 2GOUA 2B8QA 3DFHA 3K5LA 4C60A 4LVAA 4U7CA 2PI5A 2OLHA 1MROA 4IGHA 2ZRVA 3O16A 3N9KA 1NARA 4UQEA 4PKDB 4O3QA 1CS4B 1ULRA 4QDPA 4NZ4A 1TL5A 3PG8A 1F07A 1YLVA 1UOKA 3OHIA 2XHCA 4BJHA 5BXRA 2HEJA 4ZTYA 3ZZ1A 4CO0A 1Q6GA 3HXMA 2YYTA 2H5EA 4QE4A 4O1BA 5FD1A 1GX6A 4ECWA 1NDPA 3MDWA 1F9CA 5D78A 1SQFA 4MJZA 5F3ZA 3ILIA 2FLPA 2MKIA 2ALRA 3L7RA 4KRZA 5G2IA 3F2CA 2VFEA 1S6PB 5HMZA 3EZ4A 3FJ6A 4HPNA 3FZBA 4Z1DA 2VG7B 3W9ZA 3BSNA 5CYMA 3APTA 1MFUA 4TOQA 4ZVTB 3EWZA 4P52A 1MXGA 3S83A 4OZNA 3EVWA 4IX0A 4WIQA 3THVA 1D9DA 3DBNA 2HZAA 2CHRA 4AZCA 4ELUA 3H8YA 1DLOB 3NIYA 3CV2A 3M2RB 2UXDJ 5DLCA 1UA3A 4LSNA 3LWMA 3TA9A 2XG8A 1EYEA 2KL8A 1ZAHA 3N6QA 2AYGA 3QLDA 2IYGA 2P9CA 3W07A 4XB3A 3D1OA 4B9NA 3MPWA 2A7NA 7TIMA 2FQQB 3NAVA 3AAWB 4D6EA 1VHCA 4HVXA 4EACA 3MF5A 2MSTA 3R0DA 2WCXA 1P1MA 1TIWA 2Z1SA 3KBMA 1PO6A 2CQBA 2IM0A 4GC7A 4YTTA 4Z2HA 2XMMA 3ZNJ1 3G71S 4ICNA 3PANA 5AYXA 1H2JA 4AD2A 5ETQA 2WSQA 3CNYA 4WR3A 4Q8VA 3P6LA 1RT5A 5G0RB 4W8BA 2Y6ZA 4FNTA 3RITA 3FDSA 4O3SA 1EFZA 4U4MA 3C4UA 4HJWA 4NCGB 5I3GA 2WSCC 2PWGA 4FNQA 1Q7ZA 4IG2A 2KHCA 2NWRA 1VHIA 3BS9A 3BUVA 4DSJA 1AZ2A 4OYWA 3TARA 1Y0EA 4WDXA 5CC3A 5J2MA 1JGIA 4PPDA 3TEVA 1S5ZA 3M8SA 4MYTA 4A2RA 3CO8A 1TFVA 2FHKA 4IDKA 2Z27A 1KTCA 3OL7A 2V2DA 4YU1A 3M8WA 3TU9A 1EKSA 4DV5F 1YBUA 2AMGA 4MJKA 4CNZA 1ITXA 4IP4A 4QHRA 3J80Y 1RWKB 3RW7A 3H5YA 3PKMA 2ALZA 1UMYA 4DSIA 1CJKA 2XYHB 3VNYA 1JQXA 3Q8UA 1DJQA 1DBTA 1S1WA 2Y61A 4QJ3B 4DL0C 2YWEA 4DR4F 4WF9Q 2ASJA 1FX2A 4FYWB 3E01A 2HBVA 2Y0SD 1UIPA 3I5BA 4HKPA 4CD8A 4B92A 1EB3A 3R6LB 2DGTA 4ZP7A 1KXTA 2LP4A 4IISA 4NL1A 4ACYA 1JZ5A 2NS1B 1W1TA 3CPWR 3LNMA 3MV01 1XQIA 2IBKA 2BY3A 1ICPA 1M01A 2CPUA 3TXVA 1YQ2A 1GMWA 1LK7A 2PO4A 1XLEA 1BEUA 4DJFC 3N73A 4JN8A 4FF5A 2VVNA 2GFFA 4WK3A 1Y5XA 5KFTA 2VFDA 5GAHU 3H4DA 2FHMA 2R6OA 4D6IA 3GSDA 3NL5A 5K5MA 4GQQA 3AOCA 2EBGA 2J6SA 1HL2A 2E5DA 5EDWA 1XRFA 4GC3A 4QIWD 3L68A 2GJNA 1E0WA 4YWSA 3T81A 5IT9U 3MM8A 1SL0A 1PYOB 1J5TA 1VJSA 3FYOA 2X05A 3M30A 3M8PA 4K4UA 4ERDA 3WDPP 2F65A 3RO6A 1NM9A 4NAFA 4ZJLA 2PLJA 4F67A 2OLSA 4AXNA 5IFPA 2BG5A 5A6JA 4GO7X 4QWCA 3I65A 2ZXDA 5LHEA 1JNZB 1U02A 4OUIA 1SH3A 1T96A 2V2KA 4WF7A 1OX4A 4LNYA 1LQAA 4GFIA 2JWNA 3KBSA 1MDLA 3UN2A 5CJ5A 3PY2A 5C70A 4DX3A 1VQ6S 3GXFA 1S1UB 4LCQA 2W2PP 3W64A 2E6DA 3JAMU 2V5JA 4HSOA 3WEZA 3LCLA 4AUKA 5DGBA 3X3UA 4LF8J 3C3UA 2CJ9A 4P2FA 2WZMA 4KPLA 4Z2KA 1S57A 3F2BA 4WFAQ 2D20A 4QIVA 4HB7A 5KFRA 1QK2A 2HXUA 4E8CA 2UUTA 2WMJA 2OSQA 3VM5A 2DGOA 3VAFA 3H12A 2AQWA 2CZEA 2EPKX 1YDNA 4Q7AA 1EP3A 2NLYA 1ZJBA 4UOHA 4NXNF 2JGQA 4C6IA 3NMRA 3IV8A 3BDKA 1KLMB 3VIIA 3OVGA 1YX1A 2J78A 1TR9A 3UCGA 2FZ8A 1D3CA 2X1AA 2FVKA 4X61A 1P8GA 3K46A 2HNDA 3O6YX 1RAKA 4BI6A 5IFTA 3SIZA 1Y7VA 1KHWA 3PW0A 1D9EA 3H0PA 5GAGU 3IGVA 3K59A 1KQSR 2YWKA 3VA8A 1EX5A 4L3KA 4Q45A 4W84A 5F8MA 1F3EA 3MCMA 2D3O1 4X4UA 1FWPA 1Y65A 4L65A 1JYXA 4FR1A 2PF8A 4HNTA 3KMQA 3A8KA 2J8FA 2DXEA 1EC8A 1CPZA 4OBTA 3NY0A 3WC0A 5LJ5Y 3A3XA 1QBBA 1QNQA 3KRUA 1PYMA 1NWUA 7TAAA 1YPXA 4JYAF 3HF3A 3NSNA 1RT6A 1UR4A 2E9ZA 3BH6B 1HFBA 3A4WA 4IGSA 3R6IA 4MSSA 3BC9A 1UZ4A 5FI8A 3UY7A 1DLOA 4QIGA 3DGPB 1GJWA 5I2UA 3HGSA 3DLLQ 1BHGA 3CCES 2RRAA 2PBOA 3GHSA 3SZ8A 3EOOA 2HLUA 3UEQA 4X65J 1XICA 2OTDA 4O54A 1T9TA 2CIMA 2J7KA 2ZE2B 3HHKA 3BCDA 1Y5WA 3MUIA 4OX9J 4HNLA 4JEJA 3E3HA 1JF5A 1VHFA 4YHGA 1ICEB 1H72C 5E5NA 1RHCA 5BOFA 2V0NA 3KJNB 4OJ1A 2XMAA 5KZEA 1TJPA 1I1GA 4DV6J 3UXDA 1UYQA 3KBJA 2LA6A 3OA3A 1MXSA 4L7ZA 2DNOA 4KV8A 3W1QA 1YXCA 1ZL1A 2COLA 4OZ1A 4ECSA 4CT8A 1N33J 3HZEA 4O44A 3PSVA 1OPZA 3RB6A 5CPMA 2MZTA 4KESA 5AECA 3T07A 2Y62A 1SJRA 2Q09A 2YXOA 2FYMA 4ZJOA 1WTBA 1T6MA 3ZTPA 1PAMA 2Q3OA 1SQGA 2RUSA 5ETRA 1GYLA 1HD1A 1QO5A 2J9CA 3MUVP 1UZDA 3PDNA 1WDWA 3WF0A 3D67A 3SY8A 5C7PA 1R8PA 2PUZA 3OQ8A 3M6XA 4JI3J 3KLEA 4KWOA 3H54A 3SSQA 3AOAA 1ITQA 4WWSA 3INPA 1YJRA 5I3UB 2J6VA 1UASA 5KFXA 3S0CA 2WSYA 4TYBA 5FF2A 1SC3B 1W54A 4M1KA 8XIAA 1W0MA 3M8PB 4JTTA 3SUVA 1IKYB 2K06A 3B8VA 1OCNA 5E3QA 1IIHA 1BKHA 4DUZJ 1SR0A 1CSJA 1UA7A 2P10A 4XAYA 3SUUA 2RKIA 3M05A 1WELA 2ILZA 4TV5A 1IXKA 2BOAA 3UXAA 1DV7A 2ZDRA 4BC7A 5E0KA 1GXLA 2FDNA 2YGYA 3LOUA 5B7WA 3WC2A 4Z1AA 4OV4A 4O8AA 4B9LA 2YX0A 1ZBWA 3BGGA 1QM9A 1H7NA 3V35A 2L08A 4ZVQB 3VM7A 5FACA 1A0OB 2ATSA 3SUTA 3CU2A 4TQTA 1SMAA 1AUSL 4GUFA 2GQ2A 2EK6A 4UY8T 3KRSA 4A8QA 1L3VA 2VUYA 3NG3A 4DV5J 3TZZA 4Q8NA 3HU7A 4UFHA 4QR6A 1KWGA 2DP3A 4GBDA 3D28A 1CXLA 3RRAA 4ZQRA 5KZMA 2BW2A 4ED4A 4B3RF 1UEKA 2Q8LA 4I8YA 1DIOA 2FHJD 5FEWA 1V0LA 3C61A 2UUBF 4EZ9A 3S1TA 4ZQMA 3RR4A 3AICA 1HL6A 1XD0A 4NY2A 4EYHB 3KYLA 5L1JA 3DXBA 2Z1VA 1WEYA 2GL5A 1XF0A 3HPAA 4PMZA 4CNOA 1H0GA 5CBJA 1J9YA 1JLBA 2LQ5A 3T5LA 1LV5A 5IDIA 5DDQC 4LOCA 1TIMA 2CHNA 1DHKA 1L6SA 1XBZA 4P2XA 4DO6A 3NGFA 2VG6A 3ZT7A 4H9YA 3TYAA 5E3PA 1H50A 2AL2A 2PDXA 4NKCA 2VX7A 3VOGA 2OKOA 3TYZA 2W91A 5KT5A 1W2BR 5LMNF 3GVRA 3W26A 5A8WB 1RP8A 4DR1J 3JTNA 2I9EA 2HGLA 3RRKA 4CVUA 2HRUA 3PFOA 4JQ1A 2MZRA 2U2FA 4NMXA 4M5KA 4WOQA 4H8UA 1P0EA 2FH6A 2YCKX 4RNFA 3GIIA 3B4MA 1LLOA 2D2JA 1M65A 2E9LA 3MB9A 1VMBA 4ROQA 2QA1A 1FERA 3VGBA 1T99A 1BGXT 2QCMA 1NRKA 2RF2A 3JSYA 4JB8B 3TCEA 2X3DA 1U1UA 3ABZA 3PRDA 4H4OA 3GIQA 4KCVA 1HNXF 4FALA 4WE1B 3W23A 3QW3A 1G7UA 3UCDA 3N29A 3NNHA 3KAOA 3ITOA 1UCWA 3UD5A 3DAQA 4IP7A 3SN0A 2Z29A 2BLEA 3JW7A 4DX6A 3OLGA 4XV0A 1RV8A 2A0FB 1X4BA 3A4AA 3XINA 1HJWA 1FWHC 2ZVIA 2F3JA 2ERRA 1MEWA 4W7WA 1KM4A 4AWUA 3QLHA 3BXWA 4DQSA 3MEKA 3KL5A 1V6XA 4NASA 3S6DA 4BF7A 4FHAA 3NFUA 4GQRA 3TNOA 3KK2B 4MLRA 3FY1A 3LBMA 3OHBA 3L21A 1QNVA 4YR3A 3F73A 2RKXA 2LMIA 1H4PA 1N8WA 3HFVA 3TQPA 5HATA 2C2OB 1W25A 4GOAA 4DAFA 3C3NA 3CEPA 1FVQA 4OYMA 4GMKA 5GAEU 3KP1A 3N2TA 4PG8A 3BCJA 1YTKA 3MUY1 2BHYA 5BZAA 3C0QA 4DJDC 2O67A 3PX0A 4JPGA 3KG1A 1DURA 1UEUA 1A5NC 2HWGA 1HYSB 1QO2A 2F40A 2WAQD 4A48A 2VFTA 3UVJB 3AC0A 2PDUA 5J04A 1TX0A 4F40A 1PB0A 2FMNA 1FK9A 2KT5A 3NTYA 4FLRA 5C7HA 3A8JA 1CBGA 5A3HA 3IG1A 3B4UA 1KW1A 4U5IA 2QA4S 1S2VA 2LXUA 1E0XA 1H2VZ 3PVXA 4RW5A 1YMYA 4ZVRB 4LVOP 4NNBA 3VE9A 2QCDB 4XPCA 4MIBA 2XM1A 1BXCA 4LUSA 1U30A 5AYBA 1GG1A 2DW7A 4W5ZA 2BUNA 4LF5J 3WFAA 4MZYA 3CO0P 1KQFB 3AIUA 1XYMA 2X1UA 3ARYA 3W2NA 3KHDA 3VD7A 3PRBA 2PA8D 3V2UC 1W1A1 3DMJB 3PULA 2W92A 5C2CA 4OZLA 3GV8B 1ODUA 4NZCA 3L65A 1SPBP 2I5JB 4WSJA 1UW9A 3EMTA 3AJ1A 4HN4A 5LNWA 1BWKA 4N8OA 3QZ8A 2Q79A 4E5TA 1VQ7S 3LBOA 1ZENA 1E9IA 5CEWA 4QWEA 3CHEA 3NQDA 1SKUB 4MNKA 3S1VA 2IRUA 3REQA 5JUVA 2ZZTA 3IIOA 2LU2A 1IT0A 3DLKA 4HVZA 3U1MA 4LCSA 1FRMA 1P1LA 4A8RA 2VASA 3R7SB 3EA3A 2GX8A 3WNLA 4OZ5A 4P10A 1UUOA 5M3WA 1MSSA 2BOGX 3PBWA 1GVQA 3KCOA 2CHOA 4CD7A 4U2ZA 3GZ7A 1MWZA 3MAAB 4DMZA 1ICQA 4GI6A 4J4KA 3W71A 2GNKA 3FCHA 2FZCB 4XIUA 3K8LA 1E3ZA 2Y5EA 3WBWA 1CGTA 3HT3A 2O9PA 2OX1A 1CGVA 1LT7A 4QE1A 2V0TA 1XFBA 2D69A 2Z2YB 1DE6A 1W3JA 4AMAA 1GNKA 2NQZA 3VVUA 4JYAJ 3G8TA 3CDAA 1FWNA 1R6WA 1PIFA 2HPIA 1QAPA 2HZGA 4AEOA 4S38A 4B3LA 4WUIA 4ED5A 1J0IA 3W7HA 1FWKA 4UW2A 3VZZA 1PDZA 1TL1B 4CKQA 2E5BA 2C2RA 2MQPA 1FKWA 4K0KF 2Q43A 4B3KA 4M5DA 1PG5B 1Q8BA 4GKJF 2JKAA 4H9UA 1QVGR 2RHQB 2NYIA 1CC8A 1R27B 5EGRA 2V34A 3VC5A 5EGYA 2NUYA 2V5KA 4HYKA 3TAOA 3TJXA 3AMDA 4JTEA 1BD0A 4C2MA 1MQRA 5C2XA 5HINA 1TV4A 4UOQA 4RXFA 2W8KA 5CYQB 2VDIA 3PZQA 1PTDA 2PDIA 1ZTWA 3NAIA 1DWFM 3CZEA 4MOZA 1WBJA 8AT1B 1A5CA 3QIPB 4DV7J 3NPXA 2RKIB 2BXYA 2NVDA 1C0TA 3CH0A 4A22A 1LOQA 2ZC1A 3FCWA 5DLFA 3RR8A 4CQ8A 2DGAA 3SJNA 5TIMA 1FWCC 4UTUA 7ENLA 2G1DA 4JQ3A 3GVQA 3MTKA 2YWWA 4B3OB 1FCBA 3H26A 3B6BA 4DR6J 2YY3A 4RZRA 3BO3A 4UFJA 5LA1A 2ZX8A 4FXWA 1ME9A 4I7UA 4KCTA 4H7ZA 2EKNA 3HG4A 2ZJRQ 2OJ3A 3R8YA 1IVZA 4B4HA 1MQPA 5DG7A 4ZGYA 2FHBA 1ROFA 4Y28C 3TZXA 4H9TA 1HHQA 4FPRA 2OHDA 1LROA 4CQBA 2A3CA 1FXRA 2VEPA 3K0JA 2ZD1B 1XRSA 1BXNA 4E38A 4A3UA 2PDQA 3VKCA 4DJDA 4DX8H 1XM3A 2WCGA 2CYYA 1HNWF 5REQB 3CAVA 2MGZA 1JLCA 3M1ZA 1B4SA 1PKNA 1R0AA 1B31A 3M1VA 4U31A 2GA7A 3LTSA 3QYYA 4GE8A 2GOKA 3G0SA 1X4HA 3CIMA 5A6AA 4FNRA 4ZN3A 4AL6A 4MK7A 4EXAA 1I2PA 3B03A 3H59A 3EX7B 1UEVA 1B3XA 3QHMA 4GNKB 4PWUA 1DTTA 2J79A 1J4EA 4P2SA 2G3IA 5IC6B 3UVAA 4C1NA 3NZRA 4EWJA 3PK7A 4ILRA 2I2YA 4DM1A 4RDZA 3FYPA 3P74A 5E3CA 4NZJA 4R0EA 3EDJA 4RK8A 2CWXA 1OZMA 2V4RA 3GXMA 3C2YA 3UCUP 1CLFA 1REQA 4KRWA 1KFBA 1T7PA 1LBMA 2UUBJ 3AHZA 4S1FA 3PJUA 1KBKA 4GKLA 2VGBA 3BLFA 3O1LA 5LHFA 2W24A 2QE5A 4A05A 2PC4A 2X40A 1RBLA 4CTAB 2I8EA 2F2HA 2RQKA 3V6JA 2RS8A 3EYPA 3TNVA 2TODA 2OPSB 4ZA1A 2QGFB 4HCLA 4ZPTR 3DRSA 3OL8A 1NFPA 4NA3A 4PQUB 4UTIA 4Q4SA 4DL7A 2BR0A 3I7QA 3K2GA 4C6QA 4D6JA 1N55A 3MTWA 2OSWA 4EF8A 1S1TB 3MWBA 2Z7GA 4MADA 3LRKA 1LRTA 1FKPB 1FH7A 3L2IA 2JSXA 2DZAA 4FS9A 3H20A 2ZXBA 2V5CA 4O0QA 3CGIA 2OPQB 4X3ZA 2F6XA 1I75A 4USTA 1C90A 3MJYA 4F66A 4L73A 4PUKA 1Y9OA 2CLKA 3BSGA 2GMHA 3WBXA 5J1NA 1ZFJA 1J6OA 4ZCLA 3ZTSA 2RU3A 3HKZD 4HNUA 1WBHA 3I31A 1KRCC 1YTDA 5KFBA 4O3RA 2QUVA 1D2KA 4JI6J 2NT1A 1S4EA 1F4HA 2UXBJ 4DR5J 3HHNB 3W01A 5A8PA 3ARUA 2WK2A 3MM9A 5M2PA 2G2OA 3N9UC 1I51B 4MFEA 4PXDA 2C3UA 2RDDA 1NPRA 5ENLA 4QPTA 2A6NA 2UBPC 3VXGA 3K5OA 3UG5A 2E7WA 2EPHA 1H73A 1AQMA 1JL8A 3A3WA 2FVCA 2XC9A 3MWAA 2PTZA 3BQ2A 3EB4A 2EPLX 4K4WA 1YI2S 2P9GA 4OJYA 3UA3A 3L3CA 1NY1A 2R3VA 4RNMA 2AGOA 4RPPA 3VAJA 1FH9A 5C7VA 1HGYA 4RR5A 1IKVB 3ITGA 2IJNA 2R7QA 4QIEA 2NXEA 3AB2B 2O56A 1LL6A 5HMXA 1LJYA 1ZGDA 5A8OA 1GYNA 3AIBA 4RW7B 4OQJA 4DL6A 1VENA 5EUHA 1XNRJ 1JPDX 2GO9A 2L48A 3ALFA 3IUDA 2XMTA 4JIEA 3Q22A 4WEVX 1MNZA 3V0SA 4DJEA 4A8SA 1RVKA 3QV9A 5G4HC 1DPMA 3QPZA 1RALA 3VE7A 3DBPA 3TYEA 3BW4A 3DYOA 4JIIX 3B9DA 3LPEA 4WJBA 5ADZA 3FXYA 2HZVA 4PCNA 4IOBA 4P8UA 3CJSA 2FJEB 2QIIA 2NXJA 3N0VA 2F1FA 1IBKJ 5IWAJ 2Y7DA 1LBLA 4ZPWR 2PB1A 5AHNA 2JRSA 3EUNA 4CEXC 2DUXA 1TV6A 2OQYA 1PHWA 2ABYA 2QTWA 2POZA 1UUQA 1Q6OA 3IJ9A 3GTHA 3VABA 3MWCA 2P3EA 4A3HA 1OINA 2FJUB 3GSMA 1NEEA 5AYYA 3CC2S 3CH9A 4HHLA 3IAPA 2ZA2A 2QQ6A 3N13A 1P7TA 4XBJA 1O1ZA 4HU0A 1NHKL 2XIBA 1VBHA 1V3SA 2NYHA 1U5HA 5KFPA 3MAAA 1SQ7A 3EGNA 1F9EB 1W31A 6FD1A 3QQ0A 4GI4A 1Q5MA 4ROPA 3HQOA 3HCXA 4JY9A 3PS7A 1XH0A 3BLDA 2BY1A 1JPKA 5JU6A 3K1DA 4H3DA 1V7AA 4JOMA 4MK8A 4AD0A 2Y2WA 1S2CA 3FYYA 3LCWA 3MCOA 1SI9A 3SBFA 1YQHA 4KERA 4G1PA 2VPZB 3O9NA 2AOSA 4IPIA 4XK2A 3U7JA 3S2JA 3HHLB 1Z2ZA 3H40A 2WC7A 5I3QA 5I7GA 5I23A 1NF0A 3GFXA 1JLEB 1CULB 2KH9A 4D6CA 3W7NA 3JU2A 4Y90A 3G5EA 1B3YA 1KCZA 3UDVA 1VCFA 1OM0A 1E5JA 2WAGA 3ARQA 5K9DA 3WUBA 2YWHA 3P5TL 1NJWA 1RK8A 1IBLJ 3EGZA 3AH6A 4CD5A 1AZSB 3T1HF 4XPEA 5TQLA 4EK2A 2R7XA 2G4JA 4ZCMA 3AS2A 1SC1B 4AZ7A 3D54A 3CWHA 4KHMA 3O07A 1K7FA 5IRPA 4L76A 1U1KA 1QSYA 3LANA 3GKFA 2WWCA 3TUIC 4GZEA 4V2XA 5FF7A 4J3WA 1Q8IA 3NQ8A 3IIZA 4EFAC 2KZMA 4GNVA 2A5HA 3HB9A 5I3KA 4YB5A 5HL7Q 2VIHA 3LCHA 2YXGA 3BJFA 4M8UA 4BI7A 2VFGA 5GMDA 4W88A 4ELTA 2RGMA 4ED1A 2O7SA 1M6JA 4LBIA 1EHNA 4UTHA 4X22A 5DETA 5EX0A 1SZGA 3ZFHA 1JXEA 3HZGA 4AX6A 1MMDA 1A5UA 3TUPA 3ZT5A 4AH7A 3D1HA 1US0A 3FUYA 1VFHA 1UR9A 5EFDA 2A3EA 1Q13A 3GRIA 1TUGB 5J8LA 2MYFA 2VQEF 4ZP9A 3QMTA 4AD1A 4W4QA 5HPCA 1IR0A 3VAVA 4HEA9 4D6DA 1J12A 1XYLA 2F2KA 2PWFA 3WQ6A 4J9RA 2B56A 1HP4A 2CJYB 3IBFB 3BAWA 4XZHA 1PC4A 3AALA 2LU1A 2YBUA 1R0AB 4KHPF 5C9UA 3K8MA 3E0LA 1G67A 2YR1A 3DRPA 3WQDA 3CMAS 3IAS9 3QBUA 1A5BA 4KIRA 3FEMA 3A23A 4ADTA 1KTQA 4O4VA 4OKDA 4A8NA 4YHHJ 4IJBA 2M70A 2FVRA 3RPMA 3N1AA 1AW2A 3N9SA 2PMWA 5LT5A 3AHYA 2C3ZA 4Y9AA 4ECYA 2ZXAA 1QOQA 3G2XA 4AW7A 1W5NA 3R9LA 1PUDA 1I60A 3HSZA 4NRUA 4OJHA 1UZHA 1KOHA 4EZ6A 5DANA 4LQ9A 3VK5A 4P7RA 2BGQA 2C3OA 2C2KB 5FAJA 3VOJA 1K6WA 2YYUA 2ZQ0A 1Y5LB 2WSRA 3THQA 4I1TA 1YDYA 3CJ0A 3MI2A 4CN1A 2HHUA 4LUIA 2INZA 1TCDA 2XTJP 2Y1HA 5KFFA 1W5PA 3M0HA 3QZAA 5HR6A 1E15A 1UKOA 3FXGA 5CQGA 4C1LA 3T19A 4DPWA 5JIWA 5I3JA 1WKLA 2DQXA 5F4WA 1FJ7A 2K3KA 2Z1BA 5TNVA 1Y4ZB 2QV6A 3W7EA 4R33A 2R1MA 4S3CA 1KRPA 3VKDA 4NLSA 2PD9A 3WD0A 4GIYA 3ELHA 3U3HA 4US5A 1T9UA 4OYBA 3T1GA 2ON3A 1PYTA 2VG7A 3G8RA 1W1IE 2DVIA 3GQCA 4P7NA 3VVGA 1WXJA 4OI3A 3RW6A 5HQLA 3UR3C 3OBKA 5LMNJ 2WZTA 2C79A 1S5NA 4OUEA 1S6UA 3OJGA 5I77A 4NX5A 3I3EA 1ESWA 1EB0A 1FE0A 2B7PA 4I7FA 4QYRA 3CAWA 2HPMA 1RWOB 2J27A 5IT0A 5HP1A 3AHPA 3GAYA 2HNDB 2HGNA 4PYAA 3TJ8A 3LAKA 3SGZA 1TUVA 4LR9A 5C24A 2XI2A 3K4DA 3NOYA 1TPDA 4H4KA 4J9MA 1IKYA 2H8ZA 4MKSA 2XGQA 3TJAA 3KTSA 4GABA 2OR2A 1I3OB 1A53A 4JTGA 3DEQA 1CZ1A 1QNRA 1ZBTA 1UBPC 5IXEA 3GW3A 1SB6A 1DFDA 3QT5A 1WACA 5D8HB 4IFYA 4ZOSA 2CLMA 4WQ6A 5I3HA 2IVFB 2Y4SA 2WOQA 4QG8A 2MQLA 1PZ0A 2B7CB 3RM8A 1U83A 2R1NA 2YCEA 2FB0A 3BGOP 2GVJA 2AL1A 4BZYA 1WC3A 5SUHA 3HM7A 2V50A 4F4WA 4GX9A 1UC4A 4CGTA 3HM9A 1L6FA 3T5KA 1AZSA 3HULA 3LI1A 3SDEA 1GXUA 4GA8A 3T6JA 5ETLA 4O28A 1IV8A 1T03B 4KGVB 3ATZA 3ZR5A 1A6LA 4LC6A 1S0VA 2PDLA 3MSGA 2WWDA 1YSJA 3FKRA 3V4IB 3U27A 3I9ZA 1NFBA 2RF2B 2XMUA 2NQ9A 1NBEB 3TX8A 3MMAA 4AVNA 2PI6A 2VGGA 2QYGA 2A6LA 1JJ2R 4X62F 2HHPA 2UY5A 3DHUA 2J13A 4HOZA 1HLWA 3ZLHA 1RA5A 4NLXA 1SFJA 2YCJA 3GKAA 3UWYA 3QATA 2UY4A 4LBHA 5K4ZA 4DHGA 2HQFA 1RUSA 4CCDA 5HQMA 4LF9J 2VHGA 4QQUA 4RNOA 3ZTQA 5ETSA 1EJ7L 5FJRA 3CCMS 3Q2SC 2WLYA 4N4PA 3PTDA 2XINA 3KK1A 1IEXA 3I5CA 4AF0A 3WK0A 4B3ZA 1SC4B 1E6YB 2C15A 2V68A 4A4JA 2ZITA 3L9CA 1J18A 3H4XA 2KN4A 1K7EA 5A8NA 3U7BA 1LDCA 2PDFA 3H4BA 2G3FA 3L66A 4Z1CA 3B8IA 2GMJA 4WP8A 1A3XA 4QSHA 3M8QB 1YXYA 2C1GA 3DDMA 2P8IA 3GONA 3U5YA 5AC7A 4HKQA 3H53A 2ZOFA 4W87A 3CMES 4XZLX 2RAQA 3W27A 4PXCA 3VOFA 1P48A 1VIOA 1EZWA 1NB2A 1U5VA 4CQAA 2H51B 5L46A 5G4WA 1FCAA 1TWIA 2ZOGA 3CHDA 4HDHA 3CC4S 3PYEA 3E6EA 1TWWA 3TNBA 4Z42C 3MD3A 1LYXA 2WANA 4DB7A 1P0BA 3CPGA 2WB4A 1CX9A 2UY2A 1OY0A 1QHOA 2ISVA 2LQBA 3PUEA 1CXHA 1VEMA 2JDJA 4DI6A 3KLKA 4ID5B 1XJWB 2BE7D 2VFIA 3KLIA 1BFNA 4Z2JA 3GVWA 4M0XA 2XYLA 4WSHA 3K30A 1RT3A 1O68A 3UNTA 5EPDA 4OWGA 1HWUA 2UUAF 3MKCA 1S1VB 2BVTA 1Z42A 2JX2A 1ALDA 2MLZA 5CAAA 1MDRA 4F02A 2PBGA 4LUTA 3UXIA 1JJ4A 2WW8A 3E2SA 1HO1A 4I8DA 4ZE4A 5DCEA 1GOQA 3ENVA 1LQ9A 4I3GA 1VLYA 2ZZNA 3CWJA 4DO4A 4X4QA 3ET6B 3UWEA 4D8AA 4FYXB 4HHUA 5B0BA 4LF9F 3AMGA 3STPA 5H9EK 5EHHA 1R7OA 1Z1ZA 4HA3A 3SRDA 1S0OA 3L4YA 4D3GA 1KFKA 3TTSA 2PZNA 4FX7A 3CCWA 4HH0A 4R8UB 2PODA 4E4UA 3VNDA 3R3TA 3J81j 4F0LA 2G96A 3W88A 3E2EA 5K9XA 2KXHA 1M7PA 2RUGA 4W4MA 2HQGA 3HHLA 4USJC 2WBGA 1EZ2A 4MWAA 2M7SA 4OGZA 3HQPA 2CUYA 4NI3A 1FJCA 2HAFA 2Z2LA 3LCXA 2XN0A 4NLOA 2O9TA 4C0BA 1FKOA 3B4YA 1DORA 2B5JA 3M0VA 1HG3A 3WNMA 1F6PA 3FK4A 1DJWA 2C0AA 3K5XA 4DUZF 1F5BA 3U02A 4TYAA 3PYDA 2OOGA 3TN5A 1VJWA 2DR5A 1U33A 3MEEB 4KO0B 1U1LA 4KFNA 1NP0A 3L4UA 2ISSA 4NU7A 4WSKA 2Z7KA 4IH3A 1V4YA 2VBZA 4HOXA 1RHQB 2B43A 1K6AA 4XO7A 3DI1A 3MAHA 1XW8A 4YCPA 2PFDA 5DBTA 5DRCA 3SCTA 1VCTA 1QPRA 1VFMA 2X1BA 2G5WA 3RCNA 3EKGA 4ZHRB 4QFUA 3NO5A 1TMHA 4IJRA 3JSBA 3V16A 4J28A 1G4EA 3PAOA 1WPCA 4A8LA 4A8OA 3HGOA 4NF7A 3QM3A 3U2CA 2VPXB 1WX0A 1F7BA 3WEMA 3STEA 1JLAA 4FP1A 2FZGB 3BG9A 3SDOA 2KYXA 4C0HA 5T9BG 1HKAA 1VQSA 2QV4A 4HBKA 3NQEA 2WBKA 3I4PA 4LMZA 2XO7A 2POTA 4X66F 2VOPA 2E5CA 4K4ZA 1Q85A 3KUMA 5TAOA 4FEZA 3AD9C 2VBYA 4Y8EA 3IM8A 3ZO9A 2GV1A 3BBBA 5CPNA 3BGJA 2QCNA 4OHZA 2DRDA 2G0CA 3SCVA 2WSPA 4XAFA 2CPIA 3R5EA 4KHPJ 4AXKA 1JZ8A 1GJPA 1E9YB 5IM0A 1V3HA 4S2BA 2Q02A 3TJIA 4QYZK 4DS4A 1IJFB 2VQFF 3AISA 3BE7A 4F04B 1HKKA 3IJIA 3T2OA 3F56A 1O6IA 3VAKA 1JIHA 2M9KA 4DWSD 5LNRA 3LENA 4NT0A 1FY6A 1WO2A 4X84A 5DXXA 5F4SA 2W7AA 1TQXA 3EPNA 2J9XA 1I94J 2K3IA 1GK8A 4I9MA 4TY8B 1FUYA 4F4YA 3HN3A 3DU6A 3N2BA 3GYNA 5KFAA 4CI0B 4BS0A 1XUZA 1XNRF 3GR0A 4LT9A 3A5VA 2DFAA 3T44A 2GJLA 4C8ZA 4ERIA 1IKWB 5HUOA 3QGVA 4LV9A 4Z7YA 1GMUA 5JBFA 4R88A 2CIPA 4M8LA 3FS2A 1RI7A 2W2QP 2CKWA 2J4GA 2Z2BA 3NS7B 3IVUA 3LXCA 2IM2A 2VUGA 5D4YA 3EWGA 1WAWA 4PG6A 3US5A 4TU9A 5H8UA 3DN9A 3EXCX 3TN4A 2ZKTA 1C8YA 1MEHA 3QV8A 5AT1B 1KEKA 4TU1A 3N6HA 3PW5A 4C8KA 3LLXA 1SO5A 2CQCA 1O8BA 5HNTA 3RBXA 3T1HJ 4F4AA 2JVRA 4PXEA 4RW9A 4EU0A 2YZ5A 1DTUA 4QCEA 1XIEA 3N3TA 1TKZA 3RX4A 1XYAA 3MYOA 1AG1O 4IH7A 1T03A 4H4MB 3P5YA 4FIQA 5AVHA 3TR5A 3MUMP 1GT8A 1V3ZA 3LGMA 2MPUA 2N4DA 6A3HA 3CZKA 3EXSA 3NJ3A 4IKAA 2CW6A 3GYGA 1M0SA 4M56A 2OPSA 3KLVA 1L9WA 2XNRA 2WHKA 1A0CA 1FXDA 1J0KA 1RA0A 1T95A 2EBNA 3NBPA 3AMLA 1K47A 4GNJA 3CDEA 3H2MA 1VCVA 3OTOF 1RZMA 4DCPB 6XIMA 4NZFA 2YBTA 5FJIA 1FDBA 3L4BC 3RAXA 2BTMA 3A9IA 3KTXA 1HKIA 4F36A 4P5UA 3CAKA 4NLDA 2G4BA 1J2BA 2P2CB 1PV8A 1WDTA 2I7GA 4Q8TA 1KLYA 4RXGA 4DF4A 4IHCA 3GNPA 2GFTA 4W9TA 4YY3J 1F74A 4Q5VA 4A6GA 1CEZA 2F9RA 1QVBA 1N88A 1VQ9S 3H6OA 3WK3A 2AKWB 3PM9A 2KHDA 1GZJA 4N0RA 3IK4A 3ZQ9A 2GVLA 4NE9C 2PEBA 3T0AA 1TPH1 3TE9A 1Q81T 1VBZA 4B3MF 1R3NA 5A6KA 3S2LA 3VMOA 2HMCA 1HR0J 4UOCA 1P6BA 4H01A 1K4GA 1VF8A 1TVNA 3MJMA 2PGEA 1HWJA 2R8GA 1VPYA 2V5LA 5I5RA 4E0DA 4AYGA 4LYQA 4GYFA 4WIWA 2DTJA 1DWAM 3CZGA 3W7JA 4NXSA 3WZ0A 3OSNA 4B3OA 3LU2A 1PIIA 2XWYA 2BX7A 2F7FA 5LA2A 3R8HA 4A2SA 3JUGA 4M94A 2HHWA 2NXHA 2YX4A 2HQAA 1BQGA 5HBFA 3C66A 1N32J 4IMAA 2VWTA 4QDMA 1VRTA 1WC1A 2YWFA 4R27A 3IV3A 3TQEA 1I1WA 3UYCA 3D1QA 1W26A 3VNJA 1EF3A 3UQSA 4Q4OA 1Q6DA 5IM0B 3TONA 1ICSA 3WJSA 4KKOB 4QEEA 4R7WA 4UFIA 4MKVA 1MUWA 2HVZA 4AXIA 2J88A 2DZPA 3SSZA 3Q89A 4JX5A 1NM2A 1SGJA 2HDJA 4BQ5A 2O3DA 1XR2A 3MGJA 1NWSA 4NXMF 4PL1A 1HBOA 3M5VA 3KJVA 4YNGA 2XSXA 5FEXA 3H7VA 3V6HA 2DYAA 1KGUA 1IZCA 3NGTA 3O15A 1JYNA 3A6OA 3RAOA 4DSFA 3PUDA 4JDYA 3LZ5A 1P1XA 5KZ6A 1R8BA 3O8AA 5L1LA 2ZD1A 4DBUA 3DLJA 4CLTA 3TA2A 1C9WA 4C5YA 1N34F 1R7AA 3MMTA 2GJRA 2DZUA 3EZOA 4PCSA 3AHTA 1P7TB 3CBWA 4IP5A 2XM3A 1BQCA 4EMDA 2V3GA 2WBMA 4DWIA 1AH3A 3NGJA 5AXNA 1H5VA 5M2FX 3MKVA 4ZCKA 2E1WA 1TU0B 2H5IB 1Z3NA 4PULA 2LXFA 4CUCA 4M5GA 3SQOP 1JVNA 2TAAA 4QR2A 5J1EA 2ZJPQ 2BOEX 1RH9A 2EHHA 3NYZA 3WMBA 1JD7A 1FHUA 3EB2A 4RW3A 2ZZ7A 1ISZA 2OPQA 2P6TA 1FBAA 3WX4A 4B91A 4TNOA 3P84A 4PYSA 2J8GA 4XAPA 3W85A 1R9YA 2UXDF 4FIRA 2I16A 2XVLA 4ZO7A 2BX6A 3H24A 3HGJA 3T9PA 1PKMA 4LF5F 3OZMA 3MO4A 4MY8A 1FDDA 5K2ZA 4ZB0A 4ZS6A 3IO1A 1E0VA 3FEXB 1UVLA 2TYSA 4WXWA 4C6BA 3KOAA 1BRLA 2KVIA 4N42A 4O1CA 5B0FA 3QF0A 2N4CA 3QAUA 2QL9B 2OGUA 4DZ5A 1VEOA 3EPIA 2NQHA 1JXKA 2CZ4A 1BPLB 2V30A 4JI7F 1C7TA 4MIAA 4M7TA 3PKYA 1Q8KA 1A7GE 3ZZUA 1EX8A 2M8DB 3POTB 1GVRA 4IFKB 2I5GA 4LVDA 3QRHA 1FDNA 4NPOA 7PTDA 1YNQA 3L4ZA 3TXZA 2R1LA 2SXLA 3ARZA 2GVDB 4NNAA 1GUVA 4NYPA 4CZCA 4GACA 4GPNA 3FMWA 3JXOA 3KLEB 1N6QA 1FVPA 2YIHA 1K7XA 2J47A 3R0UA 4S3BA 2Q6ZA 3SM0A 3UETA 5BYQA 2MSSA 4ZPCA 4ZA0A 4OHYA 1K4HA 2YA1A 1RJPA 5EWGA 6PTDA 2ROEA 2XY7A 3M8YA 5BXSA 3NWGA 2DZSA 3WDRA 1BE4A 1WD6A 3I3DA 2DH9A 4C97A 2AMXA 2WHLA 1NNDA 2WVBA 1XYFA 4IUOA 2BB0A 4JQ2A 5FLXY 1JULA 5A0YB 4MJ4A 4CCZA 2O7QA 3ZZTA 1KM2A 5D9MA 4O3PA 4IFRA 2GHWA 2ZC8A 3OJUA 2W4XA 3PEHA 4I0WA 3NVTA 3LM3A 3W2KA 4W92B 1HP5A 1MW3A 1HBMB 3QR3A 2H9AB 4DR5F 1YXDA 3PW7A 1QMLA 2NV2A 1A47A 4B17A 1F0XA 3H22A 3GJTB 2XCPA 2IY5B 5GNXA 3AIQA 3R94A 3UG8A 1CPUA 1YBAA 4E2BA 4MUZA 1GXTA 3OLIA 1EO7A 2EEYA 2Z8QA 1AQHA 5I07A 3HG2A 3R1HA 4OTKA 3W7DA 5CSUA 3IAQA 1TR0A 2XBPA 4LSZB 1NQKA 3VDAA 3GNDA 2WVUA 3FJ4A 5D33A 1RACB 3QGHA 2OPJA 3KNGA 3O5TB 3ZSSA 1ME7A 2QZRA 3ORWA 2ZWPA 3PPHA 1W1PA 1EO5A 3N17A 3QOMA 2RDTA 4Q8UA 3CIXA 2D41A 2J7GA 2G3NA 3HQ1A 2UZAA 1KN6A 4B9YA 3UR2A 1Y0HA 1EKRA 2VCCA 5HO4A 3W7PA 1LEOA 3DI6A 1EJWC 1OCBA 3IARA 1WZLA 3PP7A 2E3ZA 2JGYA 3PZ9A 2RGLA 1JLEA 4RZBA 1H62A 1PYFA 3WNNA 2TRSA 3PZVA 1RK5A 2IA0A 5HLFA 4GJIA 1R6VA 4X64F 2YQ3A 3C0LA 4DR7F 4KKOA 2IPFA 1WKJA 1XG3A 3PZGA 4L3NA 4O1AA 2GGEA 5IM51 2XSJB 1NAQA 3GTNA 3RX2A 1VR6A 2WCSA 4RUHA 4ZCWA 4Y9OA 3CK5A 1QUMA 4FI4A 3AS1A 3O0KA 3VCRA 1EUNA 2I17A 1AJZA 2VCAA 4FX6M 3W22A 1NH8A 4HYWA 3T08A 3ANVA 3MHFA 1RADB 3KXQA 8TIMA 4A8XA 2I9UA 2E67A 3QY6A 1GCYA 4DJED 1NCLA 1X97A 3BSOA 1T05A 1PPIA 3NQCA 2IUZA 1Q53A 1V93A 5FIPA 1HBUA 4ICLA 2QCCA 4JGDA 3S5NA 3CSKA 2XIIA 2R91A 5B7YA 3IS9B 4NA2A 3CZJA 2BKOA 3UFCX 2QPUA 3E49A 3TEGA 2UY3A 1XGEA 1SXLA 3RBDA 1OADA 1V0NA 5AE2A 4DELA 5KG4A 1ITUA 5L38A 2QV5A 1EC9A 1VFOA 1F1BB 1R8AA 1XIDA 1R3RA 2VL1A 5LMUJ 2WPBA 4M3PA 1XMOF 1JAKA 3SGUA 1E3XA 2Z6IA 4KGMA 5EY5A 3U1NA 3BL3A 4KWWA 3PJ9A 3VR1A 1B9BA 4PMXA 4FYDA 1XLCA 3GV7B 1OF8A 3RU6A 1OBAA 1LCOA 3M5YA 2I0XA 3TLQA 2ZBCA 4ZPDA 4C48A 2ZUGA 4YDDB 1YK9A 5KFWA 4K38A 1CXEA 1QPNA 2BHZA 2OVLA 4KGLA 3F5JA 4DN1A 1X5SA 4GXWA 3CCTA 1Y7PA 1QW9A 3EB3A 1FWDC 1YE4A 3RM4A 4F3HA 2C91A 3KJFB 4P71A 3CDWA 2FJVA 1G69A 4OI6A 2PMZD 2OO0A 1S1XB 2VTFA 2BRLA 1KM0A 3M0IA 3VIOA 1JDFA 3VKKA 3LM7A 4ED6A 4PUOA 4YL2A 1UP0A 3DGVA 3UN3A 4LF7J 4US6A 2ZC4A 4HHMA 2D3NA 3VMNA 2E09A 1M41A 3VDHA 2WNNA 2ZH6A 2Z1XA 2LEBA 2MLYA 2V94A 2WMKA 3HSDA 1PWMA 1TSIA 2HHVA 1EIYB 1GKQA 4WRHA 2DNLA 4YFUA 4A29A 1P4CA 4BCEA 2GGHA 2YA2A 2PDBA 1U7LA 2BVDA 2CERA 3G3DA 4ORMA 4CO2A 1T7LA 4G1KA 5L8RC 1X4FA 2DY9A 3SFKA 1C9DA 1S38A 3ZLFA 4E2FB 2R94A 4Y0FA 3TEHB 1AH4A 4IFKA 3AWNA 5HR7A 3PNUA 3IAM9 2IIHA 2WSKA 3IS4A 1DL3A 1JPIA 2QDHA 2H9AA 2NXGA 2WLZA 2Q66A 5EYWA 1KFSA 2VBWA 3AJ7A 4CN4A 4HU8A 4BBYA 3U5UA 1FXPA 3X1LB 1SW7A 1I2RA 4C6AA 3LPGA 3IBCB 1GOIA 3NQBA 1H11A 1UD2A 2RU9A 4JQ4A 1O5KA 3B8WA 4GQBA 4KW2A 3BGAA 2A6MA 3IPWA 4PTVA 4URGA 3LHVA 5C24B 2R2SA 1OY6A 4NLYA 3MQTA 1EAYC 1BGAA 2PS2A 1WC4A 1QAXA 3QC0A 2P0IA 3LN3A 3AQUA 2RH9A 2PGCA 5EN1A 2JEJA 3DDIA 3NOCA 3GD6A 2V9DA 3A9BA 4K7YA 3HP6A 3DX5A 4IIDA 2V82A 1RSCA 4KF1A 2KXNB 3KLIB 4WJ8A 1JLFA 1I9CB 2HQDA 4IFYB 3DKDA 4R25A 1RT3B 2QF7A 3LK6A 1FA0A 3CZ8A 4S3EA 5DQGA 1N82A 2MXYA 3E1F1 3D3AA 3KRBA 4DFPA 5F8IA 2WNQA 5FF4A 4PB3A 4LALA 1I45A 5IBXC 3FQLA 1B64A 2XZWA 4QBUA 3DH7A 1RJQA 1TTHB 3OR2B 4ATLA 4KJIA 2UVUA 4TQRA 4EPKA 3NQ2A 2HHHJ 3HPXA 2PA6A 2DNPA 4MTVA 2XSJA 2JBMA 3NZ1A 3VGEA 1ZP4A 1HHSA 1HW8A 2QL5B 3TKFA 2FMOA 2OWCA 1REGX 4BY3A 1E6VA 1VJZA 3NPWA 2C3PA 2A79A 4M5MA 4FXVA 1B99A 1C8VA 3TDFA 3TK7A 5ETNA 1WV2A 3LZ3A 3RPDA 1XISA 3KEHA 1AK5A 1JDAA 1G3OA 2DEJA 3QJPA 5CYJA 3RBZA 1AXQA 1Q1KA 5I42B 2RILA 3N2OA 1XIGA 4US5D 1ZA1B 1C0UB 1DIDA 4QJVA 4OHQA 2HYIB 3P80A 3IIPA 1E55A 2A2IA 4XIMA 4DDFA 3TYTA 2YH1A 1KRAC 2AQOA 4R53A 4C0OC 1R7IA 1IZKA 1JYVA 1NSAA 4GY1A 2ZKMX 3MEGA 4AEFA 4S3FA 4UTWA 3OG2A 4N6FA 2YLLA 3TZFA 2X8RA 2HNEA 2J6UA 3MEDA 2MJUA 4HPXA 1OY8A 1GEQA 3H4WA 4HYRA 2VEFA 2CNKB 3QPIA 4X62J 2VT0A 1XERA 1DJYA 3VUPA 3UERA 3MI7X 4JL2A 3GLCA 2PI4A 1P6WA 3I0RA 2JLEA 2XU2A 3EOLA 2C2NA 3V4IA 1B30A 4CNSA 2VENA 1LT8A 2WZ1A 1ELSA 3TANA 4QAIA 4L1GA 2VZSA 5A95A 3NVDA 1VQYA 1VYAA 3CW2C 4FKXA 3IEBA 2CA9A 4ZVEA 2W9CA 1VRXA 1VQTA 2FZ9A 2EEXA 1S59A 1DIKA 2O01C 3H2EA 9XIAA 3W2WB 4EWTA 3KJQB 4XISA 1W2IA 1U5JA 4IG3B 5LXYA 4C8NA 1TWSA 2ZE3A 4NSBA 4YWIA 4UNLA 3LXBA 2PLKA 1BY9A 2BOFX 3G82A 3UDCA 3BPDA 1Z7AA 3QR1A 2ZM6F 4DLGA 5C9WA 3RB3A 2Q3PA 2HHXA 5IZHA 3K13A 4XBKA 1ZZMA 2NX3A 4UOJA 4C6CA 1DAXA 4JNYA 3AXXA 4KO0A 3PZTA 2J7DA 1Y5NB 3QJLA 4FAMA 4B3SJ 1OT1A 1B9ZA 2XFFA 2B0MA 5IOBA 3M9MB 2FVLA 5ABFB 3W1XA 2CADA 4LBRA 4UCGA 3DLGB 1G5AA 5L9FA 4KPCA 2WONA 2QEXS 3VDGA 3T5HA 1DQXA 3MZIA 4OX6A 4GX8A 3NXZA 1S77D 3LGDA 2E1RA 1T05B 1BQMB 5D2YA 2W2MP 1VBKA 3QSYB 4LYKA 1VHNA 4W7UA 4P74A 1NKEA 3EICA 2VJXA 3GUGA 3NXLA 2KJVA 1TV6B 1PILA 1IXOA 4CM0A 3QXBA 3HT0A 4ANEA 2BNJA 3Q2TC 4LRAA 2HROA 4AC7C 4ETXA 5J2NB 4L61A 2CNOB 2FHCA 3LP2A 3SSRA 3JYTB 1H6KX 3PZIA 1WTFA 1W1VA 5EMMA 4WX2A 1VBJA 3PXGa 3CUIA 4G6CA 5L1IA 4O1EA 4JV1A 2QLFB 2VG6B 4EUVA 2HURA 2OMOA 4ZJQA 3EE3A 1M7JA 1TJ1A 3R12A 2HVIA 5EL1A 2GQ3A 4KQNA 4DLMA 3MM6B 2PTYA 4ZBCA 3VVTA 2XQCA 1IT7A 5C5JA 2YCLA 4DJFD 1HO4A 2BV9A 2FVPA 1KM3A 1X9MA 4O19A 4UTMA 3DLEA 2XUCA 3OEXA 3KX6A 2FKPA 4MJMA 4RNJA 4DUVA 1J11A 5J2QB 4H7CA 5LIXX 3DDNA 4GHRA 5CZXA 1WE5A 2XZDB 3G1SA 3QWPA 1WWHA 2D74B 2OJPA 5BROA 5KFQA 1B7YB 4A8YA 1N34J 1O94A 4LAUA 3OXLA 4CH0S 2Y24A 1BKSA 1TG7A 3WEOA 1SU5A 1SCJB 5FF3A 2LLZA 3S47A 1X4DA 3VGGA 1Y3KA 1TK5A 2Z28A 2ZTJA 3I4EA 3HHLD 4TKTA 3SCIE 3BMXA 4RLIA 1MN7A 3EYZA 1UKPA 3NQAA 1KFEA 2RNEA 2DT1A 1K8ZA 2M88A 1VI7A 2A2CA 4DCJB 1Q6FA 2QULA 2X2GA 2E1CA 1AD1A 3H98A 2FJKA 3GDMA 1GG0A 1G4TA 3GHTA 1WI8A 2H90A 1GQEA 1G9HA 1X39A 3QHNA 4U7UK 2VHLA 2C2EA 3ONCA 1ADDA 4C91A 3O06A 4KB7A 2ASDA 3UZYA 3MEDB 1TA3A 2YL5A 2VR4A 4MNMA 1UJ6A 3OVPA 5BMXA 4BEUA 3LHTA 4M19A 4QDWA 1DHMA 5F2LA 3S2CA 4LY8A 1W9VA 1EIXA 1HKVA 4L9XA 3M8RA 2YLAA 1IR1A 4WZHA 3T8LA 4KSEB 4B9VA 1EX1A 4IOCQ 3TZNA 4G1IA 3WQ8A 1CB7B 4K4YA 2VZOA 3QPYA 1I2QA 2J7EA 2ZCGA 2KRRA 1PAUB 2GDVA 1YJ7A 1F3XA 3LSBA 4HSHA 3OIHA 2GGPA 3W9IA 4KFBA 2PDJA 3K8KA 3I4KA 3VIFA 3VGSA 3M6WA 3TUZC 1AJ2A 1EA0A 4YTUA 1IEQA 3L7UA 4HSNA 4R5PB 1WNEA 1WOAA 4AZ6A 4ZN1A 2Y7GA 4AZIA 4NYZA 2V5HG 2WVTA 4DJBA 5H9FJ 2HVNA 1LK5A 4DWSA 1UKQA 4JI1J 4LVNP 1DE5A 1JNDA 4JI2F 3A47A 3QFHA 1IXNA 1N2VA 3HJFA 3ZZYA 1P9YA 1G01A 4HK6A 2J0XA 5H1WA 2WONB 3VD3A 4WDUA 4JL1A 3AJDA 4RW7A 3UD4P 2LYVA 4K8HA 4U5KA 3ARWA 5HPOA 1HQTA 2QYCA 2YVSA 1LLWA 2PP3A 1TL4A 4RBVA 3W5XA 1OIFA 3NSXA 4HDGA 4MNLA 2GIRA 2ZNYA 3LY0A 4AY7A 3G18A 2M8HA 5KEZA 6FDRA 2ZM6J 2VV5A 1RAAB 1BQNB 1X9SA 4KQZA 3UPWA 3PBMA 5IQQA 5DT5A 4ATDA 5LGXA 1RT7A 4Z2XA 1MYRA 2DJLA 2J7UA 3T9NA 2VEMA 5KG6A 3PTMA 3AU6A 1KRBC 3QJAA 4ZVSB 3W81A 1W3TA 3MBFA 3DYAA 4ZPBA 2X3GA 4LS0A 3PYGA 2CPJA 1UVIA 2GUBA 2DNMA 2XS5A 3W75A 4PEOA 5HXMA 2WC3A 2DXDA 2R8JA 2VQFJ 4O15A 2HVHA 1R0MA 2X0HA 4PMYA 1LLZA 1QAYA 1W2PA 3TX9A 3DCPA 4O11A 1U6BA 3HD1A 5E33A 3MUXA 3FA4A 2E1MC 3C6CA 3BK0A 3R8GA 1PS9A 1A4LA 3WQVA 2B7NA 4ECZA 5LNVA 4IQJA 4O0KA 3UD6A 2V8DA 1J2VA 4PUMA 3VAIA 4P7OA 2DCUB 4DR2J 3KHGA 1RU1A 2FGBA 3TYCA 3FCVA 1E71M 1XX1A 1K1SA 4CQDA 3EKZA 3DG7A 3VIHA 4PCFA 3ITHA 4M51A 5AC4A 4LF8F 1BRLB 3OU8A 1J27A 3ZR6A 2VGFA 3GXDA 3TTYA 3R79A 2D0GA 3F4NA 2XG9A 2Y88A 1TE6A 1C7SA 4N41A 4FF1A 4K5RA 2K7JA 1W6TA 2PRHA 3GUWA 4BDPA 1AMKA 3TC3A 1CVJA 5I79A 4TVDA 4E3VA 3HMJG 2A3HA 4IFVB 2D23A 3W6YA 1ZTVA 3Q4DA 4GJJA 1RKIA 2PSZA 2WVEA 4I6YA 4LW7A 2IPGA 1OB0A 1G0CA 3PHEA 2HHTA 4P7TA 1SFSA 3ZVHB 4OZOA 3N12A 1OFEA 1JAEA 1WDPA 1WC5A 1X1ZA 4XZIA 3HHLC 1GQKA 1XR5A 3B97A 3ZFVA 3FSTA 6TAAA 4P7LA 1WF0A 3BMVA 3ATYA 2OP5A 1F3VA 1GVEA 3UXLA 1M5OC 3GIPA 3SQSA 2KG0A 3N34A 1ZAXA 3DC0A 1JX4A 3DGRA 2HWIA 2M2BA 3ICJA 1SIWB 4K8RA 2FLOA 5AC8A 1AROP 3YPIA 3F1QA 2QF8A 5CPQA 5AYZA 2VC7A 1A80A 3TP4A 3S9ZA 3BREA 3T55A 3S5SA 4F4XA 5LXEA 1VQLS 1T3OA 2FVQA 3IACA 4KGJA 4EAYA 2KYZA 3DFYA 2JKPA 4MPQA 5KFGA 4HMEA 2CJQA 1Z6KA 1WAUA 5CXTA 3GSIA 1RWUA 3NCPA 3NMAA 1XL9A 2ABBA 4DR3J 2WRMA 1DVJA 4QS6A 3D9BA 4QISA 2JEPA 3TAPA 2BVWA 2C16A 3CB4A 3JR2A 4Q6XA 4RJEA 3UWVA 3VGTA 4RBTA 4HHHA 2E1AA 3FBBA 1V6TA 1UD3A 4ECXA 4QJ4B 4XVDA 4LEQA 3LRLA 1XMQF 1IYXA 5AN7A 5LL6d 2FZNA 3Q45A 3H7RA 3NA8A 3LSCA 4KR0B 1U8SA 4ZOCA 4MH8A 3AA8A 5I6SA 3F4DA 4YPJA 2E0PA 3D3BJ 4FF4A 1P6CA 2EG1A 3PFEA 1IGWA 1L2UA 3GG8A 1HZYA 1JI1A 3WH7A 3G2GA 5THWA 4TU7A 4F8RA 1H2TZ 4F3MA 4H8VA 1TE1A 3ENAA 4YR0A 1SJFA 2OQLA 2H3DA 2UXCJ 2D22A 1HKMA 1RP5A 3GIRA 3H21A 3HSJA 2REQB 2ZUNA 3GK0A 4GYKA 1VS3A 5T7LA 4C11B 1J8VA 3LGEA 2BYCA 4GI8A 1AQFA 4JTDA 3FGCA 3DOMB 4ATNA 1HQ2A 1UPMB 5D0EA 3MMJA 3TN6A 4WXZA 1MW0A 3U4AA 1NSPA 2UZ9A 4FNIA 2XMJA 1OG6A 1K0VA 4JDBA 1FHDA 1RAJA 4QLLA