2ZVIA

Crystal structure of 2,3-diketo-5-methylthiopentyl-1-phosphate enolase from bacillus subtilis
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
400
structure length
395
Chain Sequence
SELLATYLLTEPDTEKKAEQIATGLTVGSWTDLPLVKQEQMQKHKGRVIKVEERAASEKQAVITIAYPEINFSQDIPALLTTVFGKLSLDGKIKLIDLHFSEAFKRALPGPKFGVYGIRKLLGEFERPLLMSIFKGVIGRDLSDIKEQLRQQALGGVDLIKDDEIFFETGLAPFETRIAEGKQILKETYEQTGHKTLYAVNLTGRTADLKDKARRAAELGADALLFNVFAYGLDVMQGLAEDPEIPVPIMAHPAVSGAFTSSPFYGFSHALLLGKLNRYCGADFSLFPSPYGSVALPRADALAIHEECVREDAFNQTFAVPSAGIHPGMVPLLMRDFGIDHIINAGGGVHGHPNGAQGGGRAFRAIIDAVLEAQPIDEKAEQCKDLKLALDKWGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the apo decarbamylated form of 2,3-diketo-5-methylthiopentyl-1-phosphate enolase from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
molecule keywords 2,3-diketo-5-methylthiopentyl-1-phosphate enolase
total genus 139
structure length 395
sequence length 400
chains with identical sequence B, C, D
ec nomenclature ec 5.3.2.5: 2,3-diketo-5-methylthiopentyl-1-phosphate enolase.
pdb deposition date 2008-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 2zviA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 2zviA01
3FK4A 4MKVA 5HJYA 3NWRA 1RLCL 1RBLA 2CXEA 3RG6A 1UPPA 4RUBA 5HATA 1SVDA 4NASA 2OEMA 1RSCA 5HAOA 1RCXB 3ZXWA 1AUSL 1UZDA 1IR2A 3AXKA 1RXOB 2V63A 1RCOB 3QFWA 4LF2A 5HK4A 3A13A 5HJXA 2OELA 2QYGA 3AXMA 1RBOB 1UPMB 1UWAA 4LF1A 1BWVA 3RUBL 1WDDA 2OEJA 2YBVA 4F0KA 5RUBA 5C2CA 2RUSA 1UW9A 2VDHA 2V69A 8RUCA 5C2GA 3A12A 1GEHA 2V67A 5HQMA 1UZHA 5HANA 1IWAA 1IR1A 4F0HA 2ZVIA 9RUBA 5HQLA 2CWXA 2VDIA 2D69A 2OEKA 1EJ7L 2V6AA 1AA1B 1YKWA 1RUSA 4HHHA 1TELA 1BXNA 3WQPA 4F0MA 1RBAA 3KDOA 1GK8A 3KDNA 2V68A 1RLDA
chains in the Genus database with same CATH superfamily
2W4PA 2IPJA 5C25A 2XDFA 3PHTA 4UUWA 2PFDA 4H1ZA 3NS5A 4NJJA 2OYLA 3CLMA 4INFA 3M8SA 3O1NA 2WSRA 1RT7A 4KGKA 3UNDA 2VURA 1Z4UA 3SFGA 2CG4A 1YQHA 1MNSA 1FCUA 3BZJA 1UTAA 2J7KA 1JJ2R 1UD5A 3GNDA 3PPHA 3VZIA 3Q8RB 2CPUA 2WB5A 5DCBA 2BGNE 4IYQA 3C16B 4DV5J 3V4IB 1WHXA 5KFQA 4PQUB 2PEHA 3WDRA 1ZS6A 1JJ4A 1U0SA 2V2ZA 1DZ5A 1R8HA 2BVZA 3ABXA 3V3WA 1ZPTA 3V75A 4AX7A 3CUNA 4NCAA 4L3KA 2FGLA 4GY1A 2QUMA 5KFZA 5LXRA 1FWJC 3ELHA 1OMSA 4H8UA 4JQAA 2L9DA 3CTRA 1CLVA 2O4MA 3C2PA 4YEAA 2V69A 3V5CA 2AD9A 1US2A 4PMDA 3W7PA 4JV2A 3VCNA 4R8UA 4RWWA 3TVYA 4EUVA 3PZNA 1FRLA 3NDOA 1Y00A 2ICSA 3P5BP 3P82A 4WE1B 4MDPA 4XVEA 4DI6A 4JNMA 2V3FA 2Y0BB 3KLFB 3LBOA 2ZRVA 2OFGX 1TFYA 2AAMA 1LQ0A 4NZ3A 2G96A 5CPQA 3BBFA 6ENLA 3BV8A 4QW9A 1NK4A 3K2GA 1XRFA 2BB0A 2QCGA 1QJWA 5I09A 5C5YA 2PA8D 2Q8XA 4NAEB 5LIKX 1D8YA 4QIWD 3VO0A 3NQBA 2CPYA 1UD8A 3W7BA 3HQ1A 4QLKA 2WWCA 2CLEA 4PCTA 3QMTA 2X1GA 5D0RA 3X3UA 1YADA 3PF3A 3A22A 3VINA 1UOZA 4YS2A 4WP8A 1SO6A 3EXRA 2E68A 2HNYB 4IUOA 4J3ZA 3WFAA 1WWHA 4ITSA 3V5FA 1BPLB 3MZ2A 4GO5X 3SQGA 3KOFA 4C5YA 2V4JA 1AVAA 3ISZA 4U2YA 2WKLA 2MQ8A 1K8AT 3T4CA 3D1HA 1YBQB 4FBTA 1U6BA 2EPIA 5GADU 4X0NA 1DQUA 3RR7A 5C9XA 3E01B 1EP2A 3C8YA 3H5UA 4DI9A 4H4OB 3AS2A 1AQ0A 1F73A 1FEHA 4MK7A 3W01A 3TJ4A 4DPTA 3LERA 3ZJKA 3W74A 3ZYZA 4GZIA 5RUBA 1UW9A 2HBXA 5L9XA 3OA5A 1CGWA 3W73A 2OX4A 4UQEA 4FYWB 4IGNA 2TAAA 1CGTA 4M6PA 3P62A 5BOOA 3SFKA 2OTLS 4HLBA 3W37A 2P5VA 4XSLA 4H4IA 1SUQB 2U1AA 1WNEA 3RG6A 4P2VA 3O3RA 1H62A 1G2EA 1EDGA 3GWCA 4WK9A 2RDIA 1RWUA 5LIWX 4U6PA 2FLIA 4R85A 2E66A 3GXIA 1TA3B 3E2RA 1XPGA 2AJ2A 4KC5A 3DKDA 4LUJA 3DOLB 3MDFA 4RDYA 2V30A 4QDPA 5KFYA 5C42B 5IV4A 2MKKA 1P0EA 2NX3A 1WXZA 1R8LA 1S79A 3CDEA 3QSRA 5BR8J 4KW2A 4A2RA 5BR8F 4NLVA 4E98A 1R3QA 3G0SA 3UEQA 4MY1A 5HATA 4OZ1A 1V5XA 3W7QA 2IUZA 4GQRA 3NGUA 3WDIA 1PKNA 4ACZB 3RLHA 2Q43A 3LSCA 4QPTA 2Q66A 2R8HA 2AYBA 4ZVTB 3I7QA 2VOOA 2WHJA 5I4MA 3SJNA 2CQ1A 4IIHA 1C8VA 5FCZA 3WBWA 3BG9A 4C1KA 3QLLA 4N9DA 4KH0B 1HJVA 4J3WA 2BQ3A 4PRTA 3S01A 1XYAA 1KQKA 3H25A 3CL6A 2XFFA 7PTDA 2Y0SD 1LWCA 3NQ6A 1LLOA 4BI6A 5JBDA 2YTCA 4ECLA 1CWYA 3VZYA 1Q1KA 3HSZA 3U7VA 3HLUA 2VOMA 4XTDA 5HMSA 2CFFA 1OSCA 3JXOA 2MSSA 3W9ZA 4ES2A 3TMLA 4Q32A 4CO5A 1NJIT 2J8TA 3AUOA 1QY7A 5PTDA 3BBCA 4JTTA 3H0PA 2L3MA 4NQ1A 4B4FA 4R8UB 3H54A 4I9MA 1LK7A 2HNZB 4U10A 3VXGA 4P7VA 5JBEA 2WW4A 3M2VB 2VODA 4JI4F 3RGIA 2G97A 3MUTP 3MMCA 2RRBA 3NGFA 1KXQA 3OYXA 1KFWA 4I6KA 5C24A 2E8YA 5KFMA 2V82A 1HFBA 4E8DA 4QS5A 1KCLA 3VUPA 2MEWA 2P6SA 3HVTB 1Q8JA 1HGWA 3BSMA 2J9DA 3FCWA 4H41A 3TNOA 4XV0A 4Y2AA 2ZOXA 5DDRC 3N29A 1I94J 1PO9A 2F3JA 3VZHA 2Z2LA 2MKSA 4WFBQ 5IOBA 4R5PA 4HHPA 1TWDA 1KCKA 1JYVA 5H2ZA 4H9TA 1O6IA 3LYEA 1WDWA 2LDIA 2YNFA 4B91A 5AE2A 2V8ZA 4Y96A 4W85A 2FVPA 2XHWA 3WBZA 1TJRA 3C0LA 5A2AA 1GVYA 2INFA 4AFYA 2JKEA 2QV5A 3AXHA 4C6JA 3GYCA 1G7UA 1YJWS 2DTJA 1ICQA 1PX4A 3IJIA 1S9EB 4UY8T 4OJ3A 4AVOA 2FHOB 3S5ZA 5J2MB 4W88A 3EWCA 4F25A 1HBUB 3TOYA 2XVNA 4LRCA 1YRUA 2JNJA 3EE3A 1X9WA 5I3UB 3I0RB 3WQVA 1V4YA 5KT7A 3CE8A 4DR7J 5KFGA 2WNNA 3WMBA 4MY9A 3K5XA 1F6PA 1IHIA 3TU9A 4E2OA 1O6XA 2YL5A 2VGGA 2REQB 3MDWA 3M5XA 2YX7A 4DPXA 2IQTA 1QATA 4ADTA 3NZGA 5HK4A 2X0HA 2AEMA 1K9DA 2WBGA 3P6LA 4WD0A 4QR1A 5I3GA 2FZKB 5E70A 3ARUA 4O53A 4Y7EA 2B81A 3T1GA 1JXJA 3NCRA 1NK5A 4JYEA 3VGGA 5L46A 3CS2A 4QE4A 3KWSA 1UP3A 3ZTQA 2EQDA 2ESCA 2YY3A 3C6UA 4WJBA 1WAUA 3T44A 3GG0A 3KX6A 4O57A 3OZPA 2W5FA 4K4ZA 3GE9A 4EVZA 2ZJPQ 1BRLA 2PAJA 4IICA 1L6FA 1VHNA 3ELFA 3QJLA 2R1LA 4GGBA 2GQ9A 4UNLA 3GIJA 3WNPA 4A8SA 3PPCA 4QNEA 1QUPA 4V1Ak 4PG7A 4NEZA 5HLFA 3HTWA 2CPXA 4DR5F 4Y9PA 3V6DA 4IX2A 2C7FA 1GVRA 2EPMX 3LB0A 3MFHA 3AWOA 3S1XA 4F50A 4S3GA 4JTIA 4FF2A 5G0RB 4FIRA 1ZGDA 2CLLA 4ZVSB 2E5IA 3RU0A 3II1A 4IPIA 3K0JA 1E56A 1ULRA 3LGDA 4G1IA 3W64A 2CERA 1T7PA 4ADSA 3EOLA 1M7XA 4ZQPA 1WF0A 2G2OA 3MTJA 4JI8F 4NKCA 2ZOFA 5M2PA 2K06A 3QSIA 4A8KA 3S8SA 3IXQA 4O44A 2ZZ5A 3A21A 1ZENA 5DANA 4DOZA 4KGLA 3PZMA 2QTWA 1G4SA 3CCJS 1LF1A 4ORIA 4NX9A 3E3XA 4QAIA 1XUUA 2MUCA 2IFXA 3LBCA 3MKCA 3S1GA 1WTBA 4GVHA 4J28A 3FC9A 4JB8B 3QNWB 3FOKA 5HR6A 1S3HA 3TP4A 4FALA 2RDWA 2VRQA 4W84A 3SDOA 3HVAA 4FZIA 2JWNA 3BAXA 2HHQA 2O9RA 1LW0B 1OX4A 3QQ1A 2MQNA 2JGQA 1E5JA 3A8EA 3UZJA 1NUEA 4P52A 2H54B 1LUCB 1J8VA 3B97A 4P6QA 3ZTPA 2CJBA 2J9CA 4N9EA 1Y10A 4LS1A 1W1ZA 1RTHB 4DBEA 1U2FA 4YTUA 1JXEA 1RT3A 4DV5F 2W2QP 4NT0A 1Z1ZA 4ZOEA 3ETOA 3DLGB 3EWGA 3PACA 3M1VB 1Q16B 2NQHA 4DM1A 4OYIA 1RAAB 1RYSA 4FX8A 3ZLGA 2CETA 3BXWA 1JNZB 1UCNA 3R6GB 4DR6F 1BQMB 1VYAA 1U4BA 1VQ6S 4GCXA 4H54A 4ERGA 3W61A 2IY5B 3THVA 1Y3JA 1W8SA 1B4EA 2W25A 2MKHA 3FEYB 2XLJA 1FFRA 2VPXB 1HN1A 3A3PB 4C9DA 3VNZA 3LN3A 1NSKL 3UNTA 2WZ1A 2VGIA 1RAJA 3HU7A 2ASJA 3QOMA 2ZUUA 4K4VA 3TC6A 3ARQA 4S3AA 3V0TA 3OTDA 3WQFA 3HHKA 5FI8A 1KV5A 4JTAA 2F4VJ 4D72A 4HHUA 4OX6A 1PXGA 1VCVA 4F3OA 3U57A 4GKTA 2K3KA 3LRLA 3GW0A 3DFEA 4G7FA 4O0NA 2WJEA 3W1XA 4YTRA 3A1YG 1KWMA 1NY1A 2FHBA 5BU6A 1DP0A 7AT1B 1KGUA 4DV7J 3DGPA 1EQ0A 3BCJA 3NEHA 2VFUA 3AOAA 1OG0A 3LLFA 2DIJA 2QYCA 3DAQA 1HKAA 4E3TA 3GK0A 2DIUA 1NF7A 2NQLA 2V8DA 1N6QA 3V5RA 2DXDA 4DBDA 3FSYA 1PTDA 3KZPA 3BSAA 2PBGA 3GO2A 2VQFJ 4LFCF 3CJKB 4M5KA 3HPSA 3MSDA 4P72A 4PRWA 4I7FA 3GU0A 2DNLA 4NYUA 4O13A 3OXLA 5BXIA 1KVJA 3O16A 4DNMA 3U5UA 4JXCA 4YHGA 2BTMA 5A6TC 2ZDSA 4O14A 2GFFA 3S1UA 4MLRA 4LRTA 3ZC4A 1AROP 2JFEX 3LP2A 4C6OA 1OHLA 3L9ZA 4TMCA 5I42A 2PI4A 1E6SM 4WTYA 1E1EA 3VGFA 1Q6DA 5D2TA 2H6RA 2VD3A 1OX4B 1PIEA 4JOMA 2B9EA 4Y6GA 1NH7A 3PB0A 1G9HA 1VPYA 3FKBA 4IH5A 3IJDA 1F6YA 5C42A 3LALA 1RK5A 1SCJB 2ZRYA 1C4AA 1JPDX 1VRTA 2WB1D 1MFVA 2JF7A 1UKPA 2WBKA 4O10A 2W62A 3DG3A 2RS2A 3JB9k 5FOOA 2OCZA 3EZ4A 3MD3A 3THPA 5D3GB 3THCA 4JFVA 4N56A 4PXCA 1I1XA 4ZJQA 2J0SD 4RW7B 2NYIA 1CYGA 4MKNA 4JCLA 1F8IA 2YX4A 3UJRA 3KVMA 4AZIA 1LBFA 3MUZ1 3VOCA 1XSJA 3WC2A 3GIQA 1H2JA 4HD5A 3MM5B 1HKMA 3E0LA 3M2UA 3L68A 3BO2A 4P7TA 3NQFA 3W7MA 3BANA 2EGZA 4JIRA 1P27B 4FOUA 1OY9A 2QX0A 4AC7C 1CEOA 4GLEA 4HZ6A 5J1EB 3V18A 1GONA 3UYIA 1SFTA 3NVDA 2BBEA 3C5QA 4B3KA 5ABFA 3P3DA 3WF4A 3PKMA 7FD1A 4DAIA 2Y7GA 3V0SA 1XRVA 1TZ0A 3TX9A 2XSJA 5E09A 4USKA 4P2FA 1FHVA 4DL4A 1F07A 2BBFA 2BX6A 4XO0A 4K4WA 4PTNA 1N8RT 1E0WA 2UU9F 1LXJA 4Y28C 3NVTA 3A8IA 5E6ZA 1QK2A 2M52A 3GRIA 3UFCX 3MXHP 3TA6A 2Z7KA 4W7WA 4GKKJ 4HZ8A 1I8JA 1XRTA 3DDIA 3NG8A 1W9DM 3IJLA 5KZDA 3FZBA 1FD8A 3K89A 1JEZA 1QVFR 4DSKA 3OVQA 1F4HA 4M5PA 3GLJA 3FJ6A 4HPXA 5CD4A 4DV1J 5KFLA 1BFNA 2WO5A 1R89A 2RQMA 1ITUA 2HBQB 5H8MA 2QDHA 3MF5A 2E6FA 4Q4MA 2X1FA 4C6QA 4C8ZA 3MYOA 3PX0A 1B9BA 2GJNA 2GGGA 2ZZ1A 4DAFA 1N8IA 4DX5A 1Q6OA 4FOKA 3H24A 2DHSA 4OI2A 2BANB 2IRUA 4KWUA 4XDCA 4A8OA 1O60A 4HSOA 1VBJA 5ABEA 1GPFA 1S5TA 4F3MA 2V81A 2QUVA 3TZYA 1Q8IA 3M6XA 2JQXA 3S5NA 1KR4A 4U4MA 2K1RB 1GAOA 2V5JA 1L3TA 1X7FA 1AT1B 4DR4F 4EACA 1HQ2A 1X4EA 1IF2A 4UY85 3VALA 2XINA 3TZNA 3L4UA 4R88A 4UNIA 2M0GB 1FQ0A 5HQMA 4XZBA 3HFTA 4G9PA 3DU0A 4N2YA 3ZSSA 3GXMA 2Q8LA 1X4CA 3EWDA 2MKYA 4DL6A 1POKA 2AOSA 4CQ1A 4BWJA 3OQ2A 5KFFA 3KE0A 4DEFA 2F2KA 1SIZA 2GIFA 4B3RJ 3WZ0E 3KBSA 2DFAA 2WM1A 3GHUA 4NXNJ 3F44A 5G5IA 3TANA 1P0KA 2UXDF 3TSBA 5CGQA 1XLHA 4ES1A 4LRDA 4GXWA 4P2XA 1WG1A 1FWHC 4ZLNA 2YNGA 2XYLA 1ECEA 4UFJA 3KTQA 1EP1A 5KT4A 4X3ZA 2V50A 2CXGA 4ZXLA 2X3DA 4XSMA 3GX9A 4IP7A 2NXJA 4KGMA 5DRIA 3G22A 4XTTA 1GKQA 2RIJA 3VOIA 1KRCC 1S46A 4K39A 3NXFA 2KN4A 5AXMA 1L3SA 1IBLJ 4U33A 4NI3A 3CDAA 4OV4A 3QGAC 2GQ2A 3WF3A 4QWBA 2Q01A 4GINA 4ECVA 1ZB5A 2Z25A 4V1YA 2CLKA 3B04A 1OSDA 7REQB 3RW6A 5D2XA 3WIUA 3Q8VA 3MC5A 4UCGA 3PEJA 3PNIA 3PZ9A 3DYPA 4JS3A 3UWEA 1UWBA 2I16A 1HW9A 5F3ZA 1CXHA 2DEIA 3SCKE 4GH1A 2HPMA 1W5MA 4JIPA 2IBKA 3EOUA 1N34F 3FDKA 3T5HA 1RDRA 1KQGB 4NCBA 1V0LA 1ZLPA 3NQCA 3ZWSA 5GAEI 2APOA 4LRBA 4IL0A 1FWDC 1VPQA 3ITTA 2CWNA 2UUAF 1QRQA 2HGMA 1UQZA 1CXLA 1JQGA 3IIOA 5A8PA 4U7CA 4JTFA 3TMQA 4FS1A 3E0VA 3L0NA 2FMOA 3MJMA 1O7AA 3B82A 3CD5A 4DQIA 4PAAA 3PIOQ 1W0MA 3PJ9A 3Q22A 2QLJB 3SFUA 4J2PA 1Q66A 5I00A 1E72M 2DIVA 2DT9A 3UFYA 3GNRA 5BROA 4JKKA 4F4YA 4PUOB 3WBEA 4UOHA 3OHAA 1HP4A 2DHXA 5KOWA 1R47A 2ZX9A 5FJTA 2CWKA 4HSNA 2IMRA 3S5YA 4HH0A 3HJZA 1XMQF 2CLPA 2IVMA 5BW6A 5JBFA 1T02A 3I9V9 3HKWA 2BJ8A 1HIZA 4JI0J 2BANA 5BMWA 3W1NA 3SADA 2KG1A 4L6V3 5D05A 1PDYA 2C2OB 3BAIA 1LG1A 1F9EB 4DUXA 2BLEA 3BGLA 1NXIA 1R2SA 4GPNA 5GNZA 4O54A 2RJGA 1TUVA 4DN0A 3AMGA 2EJ1A 2P6TA 3EMCA 1G4CA 2QV6A 2Y1LB 1Q7QA 1QSLA 1UPPA 4F40A 4DUTA 5ETMA 2YNGB 1E55A 3VV2B 4C6EA 1CPZA 4QCLA 5D2YA 4JDBA 1UMJA 3CC4S 1MVYA 1EO7A 5FEPA 4DPWA 4XUGA 2W4CA 4CEUC 3CZGA 3PXGa 1XYCA 2FLPA 4E2BA 3URAA 1QNOA 4UFMA 5CSYA 1J2WA 4C6CA 1RAOA 1FWIC 2FJBB 4G8TA 4CO1A 5A0YB 1ACMB 2DSWA 4CCEA 1CBKA 4DQSA 4NLRA 3UCUP 5F2IA 1X6NA 4U8VA 3KBJA 4EK2A 5F8NA 1AG1O 2PRLA 1GTEA 1GVQA 5K20B 2DY1A 3R5AA 1U0HA 3HDSA 3TW7A 1WCGA 4H6KA 2XQCA 2MHNA 3TJLA 3G3MA 5M5DA 4BK9A 2DKOB 3WIVA 5FSEC 2MQLA 2Z58B 1LOSA 3MDUA 4AIEA 1KOOA 2E9RX 2RDJA 3UA3A 3SQLA 4QR2A 3MANA 3SGUA 5ITHA 2DGWA 3QV6A 2KU7A 4P7QA 1EJWC 3L0KA 2FGCA 2YZ5A 4M19A 1FHLA 2BKNA 1UAWA 4TOQA 4PUUA 4MKAA 1WDSA 3A8KA 4QBUA 1VS1A 3OUYA 3NQVA 2DGTA 3C14B 4JY9A 4JOUA 1GVFA 5IC4B 4JTCA 3UW1A 5IT0A 3F56A 1PYOB 2VMFA 2ZYFA 3VU2A 2HFVA 3KL5A 2G37A 2R6OA 3G1HA 4IPNB 2GMLA 3PVFA 1ALDA 1RE1B 4MIWA 2VGBA 4GI6A 1ZETA 4OHVA 3VX0A 1WO2A 4DX6A 2PMWA 2GMJA 3H21A 5L1KA 1EF3A 1EETA 2V5LA 4C0OC 2PT0A 3QC0A 3GCXP 2C79A 3W28A 5ETOA 2XO7A 2QSFA 2GHWA 3NCOA 5L39A 1EARA 3EDDA 4K4SA 3O0FA 2DHAA 1OY6A 4GUGA 2NPIA 2OXNA 1P9YA 1CQNA 4DV4F 2UUCF 3I55S 3N79A 3E12A 2ZRUA 1A3WA 2FJEB 4O18A 1WOPA 5G4EA 3N6QA 2VZTA 2E9MA 3TAMB 4XAZA 4CQ9A 2WBRA 5BYRA 1XF0A 4RNOA 4RW7A 1ODZA 2VG7B 4RXGA 4OLPA 4ZPBA 3AHXA 5A5WA 2V3GA 3TRGA 3UWWA 4ZOSA 3J80Y 2BZNA 1EX1A 2WJFA 4WIQA 4X4NA 2YDRA 4FB7A 2YPZA 4P2SA 1ZJBA 5HQEA 2FJKA 3NRBA 2AQOA 1SQFA 3DI6B 4IDKB 5HI7A 2J7GA 2PA6A 2VFDA 1HQEA 2P3EA 4GO8A 3W85A 4PCPA 1A6LA 1G4EA 2G95A 2XCAA 3G0XA 1JVNA 3S6DA 4ZIVA 5EWEA 1S5WA 1SL1A 1XEZA 3G82A 3PW0A 4U3CA 4CI0B 4DJFD 4JIEA 1H3DA 4GQQA 5DCDA 1G1XA 4J4KA 4GFIA 3MP4A 1XYLA 3KCJA 4J9PA 4RNMA 1L5UA 3PCOB 1REGX 3O9NA 5EA9A 1R31A 4O15A 2D23A 3KRSA 3ISIX 1HJWA 1N33F 2CLOA 1O51A 1F60B 1HWIA 3T05A 4XZIA 3T78A 3TR2A 5D4PA 1EKOA 5CPTA 4KBXA 2BHZA 3G1AA 4I2QB 3G4SS 5F8MA 4BBYA 4WEVX 2LU2A 3R10A 3W65A 1NAL1 3BURA 1QMLA 4ZN3A 2HROA 1ZPWX 4B9VA 3DFOA 4DF8A 2FTPA 3JTOA 1O12A 1T05A 3FA4A 5THWA 4IF2A 3AHYA 2VF3A 1QASA 2EBNA 2J24A 1SKUB 1FXLA 1A4LA 4YMZA 3GFHA 3PHAA 1TVNA 1YZ7A 4WCEQ 3C52A 4Q4SA 4A2SA 2RKIB 2W92A 4KCWA 2HQCA 1NELA 4IFVB 1I51B 1GTHA 4R27A 3OIHA 3WNOA 6CGTA 2HS0A 2F65A 3APGA 3BH6B 2MTLA 3EB2A 5FF4A 3CV2A 1CZ1A 2M7SA 1QOXA 4LUTB 1OADA 4Q4OA 5D4YA 3FJNA 1IEVA 4D6HA 5B80A 3DKLA 3SSSA 3TYTA 1HBUA 1RBLA 2HNEA 2GHPA 2O3DA 4OV6A 5D15A 2R24A 2LXFA 2QDGA 4YL2A 4POCA 2NSBA 3JAMY 4NASA 3QIPA 5T7LA 1U83A 1ME9A 3SN4A 2JRSA 1M5KC 1V3LA 2UU9J 1URRA 2O7SA 3FZ2A 5ECUA 4YR2A 1ZM9A 2EXOA 1T96A 2VQUA 4OHQA 2F4VF 4QYZJ 4EWJA 3KLHB 1AFJA 1JD7A 3R8RA 1SJBA 1WOSA 1R8PA 5FA5A 4X64F 1N54B 4KE5A 4Z2LA 4DELA 2HMCA 4LNYA 4NSBA 3M0ZA 1GX5A 4QWCA 1MWZA 5LA2A 1KD0A 1H61A 2VI0A 2D2JA 7REQA 4CYUA 1JCJA 4M8UA 3JTNA 2ZOMA 4OZLA 4O12A 2IHR1 1J6PA 4C0BA 4NLYA 4F2SA 3N2OA 1H2TZ 3VFLA 3UA4A 5C2XA 2DNPA 5F9NA 5IWAJ 2Q8ZA 3ZJ6A 4AWTA 1XJWB 3P8IA 1WKLA 4E3VA 4JV5J 2E5CA 1MDRA 1LFWA 3HHDA 2PGWA 3VABA 4US5A 1H51A 5I02A 1QWGA 2DH8A 1S5NA 2VR5A 5IQ6A 1RP9A 4DR6J 4UTJA 1YI2S 4OI6A 1E9LA 1AW0A 1PIIA 3OLGA 3HX9A 2CKWA 4LFBJ 3FEZA 3LEPA 2KM8B 4WF9Q 2PWHA 4JY8A 5KG6A 3QPYA 3N6JA 4LOCA 2E9BA 3LGHA 5E3PA 4ZVOB 3PM9A 4FEZA 5J8LA 2E1RA 2BNJA 1B54A 3W7RA 1VS3A 3FV9A 2D3NA 4C3MA 3R97A 3CPUA 4IIFA 4AB4A 2G9OA 3IAPA 2XSXA 5HJLA 1RT4A 3OODA 2EI5A 2PU1A 4QOTA 2EFOA 2NW0A 2Z6JA 2LU1A 1FA2A 2G2YA 5KFNA 4CN6A 9RUBA 1UR3M 4GKKF 1YPIA 3WLPA 2H5JB 3E74A 4LANA 4QIVA 1RWKB 2ZFHA 2HVOA 2YCEA 1JQVA 2CQ3A 1V6YA 2DIEA 2V5DA 1RPXA 2WOMA 3FFIB 3NWGA 2VC0A 5HBMB 4UTWA 1PPIA 3ZFHA 1VCFA 5K7JA 1RWVB 1NVMA 1D9DA 4KWSA 1UKQA 4OBTA 4O0ZA 3I0SA 3TJ8A 3RO8A 4DS4A 2ASDA 2X1BA 1A0OB 3K7RA 4P74A 4A46A 1WC3A 3C3LA 3TLQA 1C29A 3OR1B 2P50A 4LUBA 4ED4A 4XAYA 5FDLA 4LSZB 5A8KA 3HVWA 2VCBA 4F66A 1YK9A 5LYRA 3ENQA 4QEEA 2WANA 4IIGA 2ZUGA 3W7DA 4WKYA 4X60A 5EMLA 2MJUA 2N4DA 3I0RA 3BWWA 1JL8A 3VAFA 4ANEA 3HPZA 5E0CA 1JYWA 1MQQA 3VAJA 5AZ0A 2ZDOA 2CPEA 1XLBA 4BF9A 4ECWA 3GIMA 3MY9A 5FIIA 4A8FA 4KHPF 2C2EA 2BVWA 3KK2B 3NL6A 4CU8A 4DWIA 2UVWA 3VDBA 3LP0A 2O01C 2QG9B 4MAZA 3WNLA 2CJ9A 1S1TB 3VIPA 3NOGA 3O6YX 4QYZK 3MMDA 2CKSA 4CNYA 3VIHA 3KLGA 3G9CA 3AZRA 1RACB 2JIWA 2P53A 3MMBA 3HCXA 4DL7A 2M88A 4IQXA 1R30A 1PJ5A 3M2UB 1JLCA 4CU7A 2OQLA 3L2IA 3AJ7A 2WVTA 3H2NA 3EWZA 3NM3A 1ZAXA 5MAOA 1O5KA 3T2OA 4PMXA 1JF5A 1VGYA 4KHMA 2ZICA 4USVA 2GPTA 1VB9A 3QFWA 3LPEA 3G1SA 3RB4A 3AJ1A 4HYVA 3FHQA 2NXGA 3AZSA 1Q5YA 3MEGB 1BC6A 3KP0A 4NXMJ 2VPYB 2OJPA 2V0TA 3GB0A 7FDRA 4CVUA 2NXEA 3UCZP 3FEQA 5FF2A 4USIA 2OLAA 1DIKA 1ZU8A 4E8UA 3D6HB 2DRDA 4QG8A 1F2GA 2R14A 3IGHX 1WBHA 3DRRA 3CCES 3IIZA 2BASA 2XNRA 1V0MA 1W2PA 4DJFA 1ITCA 3BJSA 2JZ5A 3IFEA 3INPA 3EDFA 4NNCA 3TC7A 2E9ZA 5LIYX 4R7JA 1Z6KA 3TNVA 2FLNA 3IWLA 2IKHA 4FP1A 1JLFA 1V3SA 1DFDA 1E6RA 3V7PA 2PI6A 2XTJP 3REQA 4K5SA 4XZNX 1EB0A 3OVSA 4F02A 4NP7A 1X5TA 4WKRA 1BF2A 3KK2A 3MA8A 4N6FA 2GUYA 8XIAA 3EDRB 4JCMA 3HPXA 4US6A 1BE4A 1J0YA 4MZ1A 1VP5A 3EXTA 2FVCA 3CC1A 2WZMA 4J3TA 1J5OA 3NYZA 4O11A 4PMUA 2IVYA 3TQ1A 3BJYA 1TTJA 1MROA 1T9WA 2YQ1A 4J91A 2KT2A 3FRZA 4PWWA 1DQAA 4ELUA 4EI2A 4TU9A 5BYQA 4EK7A 5I79A 2Y7DA 1OYAA 1FCVA 3GKFA 2J9DE 1PWLA 2ZH1A 2DNQA 3Q2DA 1WACA 4DPQA 1H98A 4ML4A 5EL1A 2ACMA 3GWQA 4W7VA 4UFKA 3LZ3A 3O15A 1M5OC 3NUKA 2J62A 3N14A 2E40A 3GIPA 2GK1A 2DZWA 4M5DA 3EKGA 1ZJAA 4D6IA 3V81A 3LHZA 2CZDA 1UWBB 4LTSA 1EP4B 2JLGA 4XD5A 3WD4A 4NXSA 1RLDA 3PC0A 4Y90A 3SI9A 2ODOA 1WDTA 3WDQA 3WF2A 2BABA 2M2BA 2XWYA 3A24A 2E7VA 2AMCB 3H2MA 2PF0A 1J12A 4AQYF 2BW2A 1NQKA 3WUFA 1W3LA 3M6VA 3CZ8A 3R25A 4NZ5A 2QMUB 1XBWA 3DBNA 3DRRB 2IC3B 2CQPA 2H3DA 1DTTB 1IEXA 4XWUA 4BF7A 4L65A 4V2XA 1VEPA 1ZTVA 3QGVA 1S1TA 1RHUB 1S1XA 1T9TA 4LAZA 1X8DA 3LM7A 2LYVA 3UNYA 4JX6A 2DGOA 3VNJA 2ZE2B 1TPB1 4Z2JA 1JD9A 1JGMA 2PTDA 3THUA 5G1YA 1K4HA 3DOMA 3L23A 4GNKB 2HRTA 3TAMA 4JI5F 2EG2A 3IBCB 2HHWA 1H1NA 2NX1A 1KBRA 2HHSA 1YHQS 4S1FA 2WJZA 2BV9A 3P67A 2D2OA 3BLPX 2QR6A 4CD5A 1LQ2A 1OO0B 2BY3A 3OTBA 4KIRA 4Z0JA 1VRUB 3PX6A 2FZBA 4K2XA 1I4NA 3ID7A 4FK9A 3PBYA 1QI4A 4C7FA 4KCTA 1EA0A 2A18A 3H8AA 4XIAA 1RA7A 1O8BA 2ZDPA 3E9AA 4J9JA 3NGSA 3GSDA 1PJ7A 4ZQRA 4Z37A 3IP0A 4NX5A 3OLEA 3W6LA 1AZ2A 2A3BA 1JG9A 3K46A 1NPKA 2LXUA 4BCAA 3M9MB 4JV0A 3OEXA 1UH3A 2C3OA 2ROPA 2CAJA 4DXXA 2GVZA 1D3WA 2VOPA 1AXQA 2IPWA 2I9EA 5DO8A 5FJUA 3O8WA 4CQ8A 3B0XA 3RCNA 5CZKA 4XAFA 3TX8A 2WV8A 2ZZ3A 3OR2A 1Y5LB 4HNNA 5KETA 1HNYA 5AHFA 1BLUA 1PCWA 1NH8A 1JRBA 3M1ZA 3UVIA 4WGHA 3M0YA 3ZLHA 2CJXB 5HMDA 2QDEA 1DJ0A 2O5DA 3MU7A 1TUGB 4NLOA 1UC5A 4DSLA 4LIWA 2C18A 2VU5A 3O1LA 1W7WA 5AYIA 4B9TA 4CT9A 5HN0A 4Y2IA 3P2VA 4F8RA 4LB3A 5JXQA 4XVDA 9CGTA 1RHMB 1Z44A 5A6WA 5LIUX 2EK6A 4OIFA 3QGHA 3QLDA 4YY3F 4AZCB 1XIEA 3LXCA 1UJ5A 1TZ9A 1ZZNA 4XD4A 1WC4A 4ZEPA 5KZEA 3OBAA 3PZGA 3T0DA 3DM2B 1SW7A 2B6AB 4YP3A 1UZDA 5BOFA 2XWDA 1W2BR 5CYMB 3RJXA 5KZ6A 2BRLA 2GC8A 3ITVA 4LT6A 4M5LA 3AA8A 3ATZA 1FX2A 3FAWA 2FHJD 2RQCA 3CCQS 1JZ6A 4KCVA 3BB5A 1CG2A 2C2NA 3BQ2A 3L4YA 1SU5A 2QS8A 1RK6A 4YUDA 1V6HA 2DH9A 3GTXA 1CXFA 4OZ3A 1Q4RA 3JVAA 1JLBB 1U47A 1ONXA 3S0CA 4K8RA 2QPUA 3H7RA 1N36F 1X97A 1GYMA 4B5NA 4B9SA 1E43A 4IO1A 3OGVA 2F38A 1C7TA 3QBCA 3GIKA 4FF5A 4ATWA 3FEXB 4GIEA 2C3YA 3QMQA 3RLUA 2FPVA 2PWGA 2J6VA 4JI1F 3BMVA 2WSYA 4F67A 3VD5A 1PTGA 3I3BA 1DJNA 2BDQA 3RPMA 3CEUA 1PC5A 1FHUA 1GVIA 3W5ZA 1KQFB 1VFFA 3PM6A 3ABSA 2PP3A 3NCQA 3G6YA 3AIVA 2KTQA 1QUVA 1QO2A 3QT6A 2D9OA 3GR4A 4HNLA 3W76A 5KG4A 3IS9A 3OSNA 4GYKA 1NP0A 4ZCWA 3R27A 3SY8A 4GVBB 4Y2CA 1VBZA 4EAMA 2HHPA 2V68A 4OI3A 1R3WA 4OYAA 1QAIA 3C8FA 1ZTWA 5HNRA 3LCXA 1TL7A 1YMYA 3RITA 3W07A 3GSIA 4X84A 1TMLA 2OPRB 2X1SA 4GI4A 4YCOA 3QFEA 2BVYA 1P6TA 3WC0A 3L2MA 2YWFA 3J80U 1F3VA 4R7WA 1VBXA 3NP5A 3DC0A 4AXJA 2PDQA 1M04A 1W32A 1LL4A 1V3KA 3FDSA 3UDCA 3OB8A 4Z1CA 1TPEA 2YCKX 2DR6A 5BRQA 3KLFA 1YGYA 2H3BA 1U33A 1OM0A 1U5HA 2AAAA 3VNMA 3DI0A 5FL0A 4LYQA 4A8WA 1IXOA 3BMXA 3TA2A 4EWND 1KQSR 4J9UE 1Y5VA 3LOUA 1IWBA 5M3WA 5JUMA 3QY6A 4JICA 1RJJA 2R8JA 1XC4A 1YRRA 3T5LA 2C6QA 2CBJA 1TELA 2DSUA 4ZODA 1FKPB 3WLIA 2HQAA 3QMRA 2PWEA 2YJQA 4YTQA 4HOWA 3N01A 4FKYA 5AJ3F 2J78A 2GUBA 3J7Z5 1XIQA 5ETSA 3OVBA 3PTWA 2HHUA 3R5DA 2Z2ZA 2NV2A 4JX4A 1RA5A 3CZLA 5CPNA 4CLKA 3ZFVA 1AUDA 2R94A 3OTOF 2VFHA 3APTA 3N3TA 2XSJB 1B30A 3TCEA 4LF8F 5IBXA 4KY3A 3W00A 2VYOA 3MKVA 4IDKA 3CEDA 4Q7BA 2BKOA 2GV1A 2YOCA 4QR0A 1K03A 2GFTA 3L4VA 3ZOAA 1ONRA 1TVPA 2LCWA 4GVBA 1T05B 3DRPA 2Z0IA 3QZEA 3E02A 5KFAA 1M1HA 5J5DA 3C0JA 1IT7A 1EOMA 4ZB5A 4X65J 1QI0A 2DVUA 2YDAA 2W8KA 1QOQA 2E8ZA 3S9ZA 2J7BA 3CZEA 2BJEA 4N8OA 4F8XA 2N7CA 3POHA 4MZ8A 4OZJA 2Z2UA 4J35A 1H1ZA 4NXKA 2H3EB 1A9NB 1DTQB 2WJDA 4ID8A 1TL5A 2NUYA 4O1FA 4IMDA 1KFBA 1PZ3A 2E44A 2RDDA 1UMLA 1QVGR 2DJWA 3AIQA 3CH0A 1PYSB 3CJRA 3VGHA 3WZ0A 3DUGA 2QFIA 1IT0A 1FBAA 2OPSB 4C5ZA 4XTIA 4HHJA 4QCEA 2NUXA 3CJ8A 3EYZA 4EPBC 4WY0B 3ZZ1A 3MI3A 1DJHA 4E2VA 4B5VA 1SC6A 4O23A 4GUFA 1CJKB 1AJ2A 4I5UA 1QBAA 3WH6A 1DV7A 2JDJA 4RWXA 3N34A 1A5NC 4ROQA 1EGVA 1QVBA 3GJQB 3M8PB 3SCVA 3VMPA 4MDOA 5J2QA 1E9IA 4B16A 1BMQB 1RKJA 1VYRA 1G4TA 3AD9C 2BVDA 2R7OA 4ID5A 4OI1A 1VLYA 1JZ5A 1UEUA 2YKMA 1M5HA 1ISYA 2OD4A 2QCEA 3M6DA 4ZPTR 2EK1A 4Q7NA 3A4AA 1W37A 2BOAA 2V6AA 3BGAA 2WLYA 2NT1A 3N11A 3ZVHA 3CO9A 3SGZA 4AQLA 2FIQA 3MECB 2GZOA 3NGJA 1ZZFA 2VEMA 3UGRA 4PBFA 4JN6A 2Y62A 3NMRA 2VG5A 1BHNA 4YWIA 1MSWD 2QVHA 5B0EA 3D3BJ 1V3JA 5F9LA 2XSBA 2ZQ0A 3RCYA 2EW9A 1W9BM 3UE2A 2F7FA 5F4XA 5J2PB 1IJEB 1R8AA 4PSRA 2VEIA 1BKHA 4OQJA 1OWXA 3OW2R 2F6XA 2XMMA 1CLXA 4TY8A 3FXYA 1PYMA 1UD3A 3AYSA 4MAVA 4DV0F 2LEPA 1JZ8A 2ZZ2A 1S7IA 5A8KB 3G8EA 1UFWA 2W3ZA 3WL0A 2HNDA 5EFDA 1BG9A 3KBVA 3M4XA 4B3SF 1SQ7A 3UZYA 1IXNA 2VENA 1DHMA 3ITLA 1KR1A 2OZ3A 2NV9A 1HMVA 4DPUA 2DRBA 4FX7A 4H9XA 4EBEA 4RW4B 3B9NA 3AH6A 3KKFA 2ONEA 4JI2J 3PN8A 1ICEB 3K5PA 4NZ1A 4H4MB 3EWBX 2WVBA 3B8TA 2FC9A 3QR0A 2EPNA 4Q8OA 3S42A 5FJOA 4K5RA 3LPFA 1KNZA 1XIHA 1FWRA 1N2VA 1PGZA 1XXXA 4ZVFA 4GA8A 2YBTA 2CJAA 1R8BA 4OHZA 1GX6A 4JN8A 4GCAA 3G96A 2GJXB 1N56A 1BQXA 2N4CA 1WZAA 1ZA1B 4XO7A 3DYMA 3AXIA 3L4BC 4PA8A 2A3HA 3W2VA 4PCFA 2E3ZA 3PUGA 3W83A 1S6PB 3E8OA 3JQMA 3AFGA 3W38A 2DD8S 2C3PA 1IQTA 2DGVA 4GC7A 1E4LA 1JMTA 4AL7A 1RA6A 3I4HX 1TPUA 3IJ9A 3R0DA 4G1QB 4ZE4A 2TRSA 3BKUA 2DXFA 1A49A 4UBPC 3FCHA 3QWUA 5CCLA 4B02A 1IKVA 4IG3A 1EIBA 1HVQA 3W2KA 3LA4A 2CG8A 3VZXA 4CD6A 3NNHA 4GH3A 1NKCA 1FCBA 1OQFA 4HT7A 3B9AA 3SEOA 4HVXA 4RKUC 1VKFA 1K0VA 4AY8A 5D4LA 1N0VC 1KTNA 3F4DA 1NJYA 4WPAA 4A8RA 2GHVC 3RMJA 4O4GB 5MHBA 1Q8BA 1HQUA 4ZVPB 2ZBTA 2FPTA 4LH8A 3VD7A 3KJNB 5AHMA 4Y3CA 2B9WA 3P93A 1HR0J 2E29A 4ANCA 1YDYA 3NZ1A 1Q4WA 2DBBA 3KDOA 3GTNA 3PWGA 1XGZA 3FS2A 2KVQE 3AB4B 2KZHA 5EWFA 3PYGA 5KFRA 2VFGA 4DL3A 5CQGA 2OMAA 2FTYA 1PUDA 3SUSA 1KB3A 3DERA 3LY0A 1VJQA 1HKIA 4WE1A 5SUHA 3HSGA 3I10A 4NA1A 2R2SA 4K0KF 2R7XA 3B4UA 3KZSA 4L4OA 2HJPA 2UUCJ 2IYGA 1B4SA 1I60A 3VKKA 3RTVA 4IFKA 2D3O1 4NNBA 2OSQA 2YIHA 4ATDA 1FWKA 3W3OA 1VBHA 4M29A 1KC7A 2CPIA 4NXNF 1B3VA 3WD0A 1HJSA 5HBFA 1TB3A 3N04A 3H4XA 3LP0B 1S6PA 1QCWA 5CC6A 4FMVA 1WDDA 3W2NA 3D68A 1Q45A 2HEKA 2OEKA 4C6LA 1HBOA 1KFCA 3HULA 1KTQA 2AGTA 3PJXA 4XPEA 2NS1B 1VIWA 4M1KA 2AEJA 1MN7A 2ZH2A 2VX5A 2MY8A 4Z7YA 3VUSA 4LFAF 3KFWX 3R0UA 1PE1A 4W9TA 3WNMA 1DJXA 4NZ7A 1D8ZA 3EVWA 1DORA 3NSNA 1VYSX 2Z30B 4DSJA 3BSHA 3WDPP 2CYYA 4DM2A 2HNZA 1EDTA 1A5MC 3BQ1A 1XNQJ 3QQWA 3PB2A 3UWZA 3KLEA 3DCPA 2EFNA 1XLJA 1K9FA 5E1QA 3N9UC 5D6GA 1X1OA 3DRSA 2BM1A 5K9FA 1MSSA 3V1HA 3CD0A 3MM7B 4KRWA 1FWCC 1MWOA 3DN9A 3BO3A 3HO1A 1DQ8A 2W9BB 4ALZA 3GR1A 2XMUA 3U1MA 1T7LA 2W2NP 3OL7A 3D6NA 3PAJA 3PY2A 1FDBA 4B17A 4GGHA 1Q2SA 4DO7A 1SKRA 1LZOA 2RKIA 4BHQA 4CD7A 4DX8H 3BLLA 4A3YA 1X8FA 5M1TA 4H4OA 2IDEA 2J7CA 4DPYA 2CHNA 4GMKA 2FMNA 3AC0A 5A6JA 2IM2A 3SMZA 3RAOA 3BREA 3MO7A 5F8JA 2Z26A 1JYXA 4KS0A 3MMCB 1WPCA 3UETA 4QWEA 3FAXA 4AL5A 4NAEA 1J4EA 4HA0A 3I5BA 5T14A 4K7VA 4EZ9A 5LMNF 4UMAA 2YR1A 3M2RA 3LTYA 4RU9A 1U5JA 2VC9A 1UA0A 4QE5A 2AKZA 1M5VC 3TX0A 2DH7A 3G3DA 3ET6A 3CCSS 4NL5A 4FO4A 2GAGC 4AD0A 5DBTA 3ZZZA 4NA2A 2EJAA 4A8LA 2ZX6A 3DU5A 2XPKA 2DUAA 3TVKA 3ITHB 1H1YA 2OSYA 3U7BA 5K8MA 3IV8A 5GADI 3AHTA 4Q4RA 2DSZA 4DR1F 4UR7A 5AKQA 1KBKA 3LV6A 4LGXA 3UI3A 4J9LA 4QSHA 3VFCA 4Y8EA 1J96A 2Y8VA 5LL6d 2UY4A 4F0KA 4F3QA 1WHYA 2YW3A 4PEKA 1FHTA 4AF0A 3L95X 3URNA 4Q8TA 1U1JA 1GW9A 2P3ZA 4O4GA 5E3AA 1KC8T 4KQNA 3TZWA 2E77A 3UESA 1DWJM 1HUVA 3NFUA 3FA5A 1KVIA 5G4HC 4CYUB 3SQMA 4DNHA 1HD0A 1QTMA 2V8HA 2ACUA 1BLIA 3AIBA 3LHYA 1JKHB 1U0HB 1JLEB 1IBCB 3DRSB 3ZM8A 1E9YB 3CJTA 5DY2A 2ZX8A 6PTDA 1F3WA 2FDSA 4QWAA 2CNKB 2OZ0A 2WC7A 2WW8A 5L9FA 3V2UC 5KSWA 2DZXA 1ZBCA 4B08A 6AT1B 2ASYA 2J7FA 3PUEA 4B3OB 3K4WA 2GDVA 2XFYA 3MKKA 1VJIA 1K73T 4B9NA 3W7KA 1DQ9A 2XFRA 5HPOA 2H65B 3WLOA 3IIPA 4J40A 3W71A 4FR6A 4IMEA 3CJ5A 1QT1A 5LMUF 1VC5A 2FZ8A 1ODUA 3I82A 3SI8A 2A6NA 4CH0S 5CZVA 3L3CA 2PD1A 4WDWA 5IHRA 2QCMA 2WRMA 1Q6GA 4N7QA 1EJ7L 3QPZA 4D8ZA 3PZTA 4ZP6A 4S2BA 4W4MA 3ULHA 5JJBA 4QDMA 2GVGA 3ZJ8A 1YTKA 1GYLA 2C1GA 4UMCA 1VQOS 1PHQA 4OE7A 2QW5A 2W8LA 3SURA 3V6KA 3QRRA 1J93A 2DNRA 3D2WA 1LW2B 3AJXA 4P7OA 4BQ4A 3V36A 2E5LJ 3BGFA 4DCOB 2VJXA 5T41A 2L9WA 1WD6A 2E1CA 1MW1A 3S9YA 4UQDA 4BEUA 4RCXA 4WSKA 3GTYX 2VO5A 5T7LB 1U1HA 4NLGA 4AZGA 1R9YA 3WJYA 2Z1VA 4FNTA 3GQYA 1ADSA 1S5VA 2HBZB 5A8GA 1S3TC 1RSCA 1V3MA 2W66A 5LSRA 4C1NB 1WG4A 4FNQA 4TY8B 2AEFA 2DT0A 3QF0A 3KK1A 1XLAA 4PB3A 2QUNA 1U7LA 1Y9OA 3FY1A 1EIYB 1DURA 4S38A 3S6TA 2PDAA 2C2RA 4BC7A 2FZCB 2A0NA 3CMJA 2UVVA 1HWJA 2OKQA 1DJWA 1K7XA 1W1IE 2B31A 1OJXA 2DVXA 4WK3A 2ZA1A 1QHPA 1ZOTA 3J81U 2VZUA 3NQDA 2J7UA 3I3DA 2FYMA 1R0CB 4JDYA 3GZ7A 3HJVA 5L6UA 3J7HA 4LV4A 2PDKA 3NL3A 1FP9A 1UROA 3Q4DA 3U3HA 3P0XA 3D6MB 3ZXWA 1DTNA 3Q37A 4ILMA 2ACYA 1X6UA 3TA9A 2VCAA 3KHJA 3A64A 2BACA 3IK2A 1TIMA 1V3IA 4LEFA 3C15A 3FCPA 2B7PA 4CLUA 2I14A 1NPRA 1O95A 2MNRA 3EGJA 2ZITA 2RJZA 3B05A 2HZVA 1NDKA 4X2RA 3VGVA 4E5TA 3RR1A 2W9CB 4M95A 2MGZB 4OX8A 4N47A 1TZZA 1VJZA 5D04C 3PUDA 3DRYA 3M1VA 3PKYA 3W26A 2EEYA 4HP5A 2W7AA 3PW2A 1RVGA 2Q1LA 3MQTA 5I3DA 2ATLA 1R3SA 3F5JA 2FZGB 1T5AA 4DUYJ 1YDOA 2H8ZA 5ETLA 5C8BB 5E41A 3VVGA 4RXFA 4P9SA 1UA1A 1ME7A 1LUCA 4TX9A 2QQ6A 2QRRA 5IOLA 2ZXQA 3W7HA 1S49A 3TA1A 1XL9A 2VX6A 1FK9B 1WUUA 2Z8QA 3MM7A 3PSVA 3ZT5A 3EA1A 4XQ6A 3CUFA 4MM1A 2VX7A 1TTQA 5F0UA 2ISWA 1Q79A 4CRJA 4IGMA 3MEGA 2IW0A 3OZMA 4XDDA 1RQEA 4FXJA 2OO4A 4TX8A 1EGMA 1UZ1A 5EFFA 4CLWA 1ZH5A 4H6RA 3E6EA 4Q8UA 4RNHA 4OX7A 1SW3A 3K30A 2G3JA 3RBXA 1Y5NB 1J27A 2B8QA 3HI9A 1G7VA 1S1WA 2E5DA 3MMAB 3R13A 1JF6A 2HK1A 4OMFG 2AZ1A 3UJ2A 2QGYA 3CULA 4LBSA 2DITA 1RD5A 2XIOA 3AB2B 2WVUA 2E9LA 2HGNA 4MF4A 2C22A 2QAPA 4AVFA 4AD3A 5G4DA 1RTHA 2EAWA 1Q13A 2XY7A 2E5GA 1FNOA 3O05A 3LENA 4DG1A 5FJPA 3THQA 2MQPA 3O06A 1NBEB 1QTNB 1U1OA 1LRTA 3HFKA 3VM7A 2ABAA 3H2UB 1RY8A 1TIWA 3FW6A 3THDA 4HPJA 3VE7A 5ETQA 2AGPA 3M8ZA 1UASA 5AN7A 2XWXA 1JX4A 4JI2F 2HKEA 2G3FA 2XSAA 2K3IA 4HA4A 2DT1A 3WX7A 4C7QA 2RMLA 1FDYA 1HI0P 3H23A 4W8AA 3J7A1 1WHVA 1DHPA 1HNVB 2QCDB 3I4EA 2XM2A 3O5TB 4HSHA 3SCTA 1ZAVA 3GILA 1VQYA 3HD2A 4DBWA 1Y5WA 1RWOB 2WHMA 4HHMA 1AL7A 4DU7A 1K4GA 2CRLA 5BMXA 5KFJA 4P8UA 4C6PA 2YA0A 1GXLA 3H2EA 5DMLA 2X30A 4NHVA 4LAKA 2WMKA 3BH7B 1NSAA 4J37A 4NRSA 2AWZA 2NREA 1IIHA 1MUMA 1KBJA 3ARVA 2PCQA 4PUKA 3K8VA 4FVCA 2TODA 2XZTB 3UQSA 3B4MA 5C2CA 1D3GA 3O6CA 5HOSA 1LJYA 3M9OB 4REQA 1BQNA 3DKJA 1SFSA 3KJFB 4J9VA 1GT8A 1X38A 2OX1A 4JQ2A 2ZWZA 3B4YA 1YLVA 4NILA 2J13A 2FFIA 4W8LA 4L75A 2PD9A 2WVEA 2DNOA 4LSLB 3BPWA 4B9UA 2WB4A 1SJRA 1IE7C 5F7UA 2VT0A 3GDBA 3UR0A 2ZE2A 1TRIA 3I5CA 4LVDA 2AW0A 3WJZA 4YVPA 2Y6ZA 3LTOA 5E0FA 1KLZA 3WK1A 1FKOB 4USJC 6REQB 5FEWA 4JIHA 1N5TA 3LQVA 2MDAA 1RWPB 1OZQA 5F3TA 3HM7A 3A47A 1BYBA 3KOAA 1MYRA 4WQ6A 1BYAA 5D9PA 4MK8A 1Q6QA 1YWXA 4XBSA 2MGZA 2UXBJ 2B8PA 1QI5A 2GVYA 4QR6A 3GU9A 3CIZA 3DXSX 4KF1A 2KYXA 2KRRA 4P8VA 4GKLA 3HVTA 1C0UB 4CDIA 1NK6A 3T6JA 2IKIA 3M32B 1XYBA 3Q2SC 1P6WA 3GDRA 2Y7FA 2PCEA 1S77D 3DMJB 1I3OB 4HGXA 4UTTC 1F7BA 2ROEA 4UZBA 2VKRA 4NI2A 1FDAA 1ADDA 2WVCA 2YCJA 1UH4A 3QQ0A 3RLVA 4DJED 3SIZA 3LBMA 1FWLA 4NMXA 2MZSA 3PUOA 5J5RA 2H8XA 3G87A 1ZP4A 2I5JA 3LCFA 5TIMA 3S1WA 1WNOA 4KJIA 4P5UA 3BAYA 2X7WA 2OLSA 3M4HA 1C8QA 3L9CA 3SIMA 3NDZA 3E51A 3FEMA 3BE7A 3FNDA 2AZ3A 4D2JA 2VKZG 2P8IA 5XINA 4Y2KA 2FGBA 4LVAA 1E0UA 3WD3A 3P74A 2C0AA 3NPVA 2OPQB 3MPWA 2IKJA 3W7GA 2WPGA 4WFAQ 2V94A 3C6UB 1JDCA 3GXFA 1E15A 3NQMA 3OA3A 3WEMA 3UYCA 4KH1B 1EP4A 1FERA 1PKMA 5FF0A 1MMNA 1M7PA 4LVFA 2ZJRQ 1LWHA 5GNXA 2CJYB 1RABB 1M53A 3R12A 2M3DA 4ZVHA 4W5ZA 2EPOA 4HJFA 1NO8A 4JX5A 1XIFA 4LR7A 4WKFA 2XM3A 1ZM2A 1KFEA 3T8QA 5D77A 3C0QA 3G82B 3LMZA 2A2DA 1OB0A 3PW7A 1I2OA 2GVLA 3ILOA 3TE9A 2B4UA 2HQGA 2EKNA 3W88A 4QJ1A 2XB2D 1Q65A 2HS3A 4YN5A 4CD4A 1E51A 3WN6A 3HA1A 1LORA 2GWNA 1XQIA 1TA3A 3JUGA 4K68A 3UVAA 1R6VA 1U25A 6XIAA 2XZ7A 4R9OA 4DV6J 4LS0A 3GCWP 1NMEB 4MH8A 1U48A 4LF6F 2J6SA 3DG6A 3N2XA 4WRHA 2PC6A 1J2VA 1NWUA 3GTIA 2DRAA 5KFXA 4B5SA 3I6EA 1XERA 1AA1B 3SUVA 4DUWA 4D3GA 2R7RA 4Z08A 5FJRA 2A6MA 5K14B 5F2LA 2W24A 3UERA 1UZ4A 3VA8A 3CNQP 1TMJA 4DJEA 3BGRA 4IQDA 3GG1A 3R7MA 2OT0A 4LF7F 1TCDA 3UPMA 2BJ9A 3DHWC 2QEZA 3VCDA 4TXSA 3IJ6A 3B8DA 3PO5A 4XZHA 1WBJA 4HMDA 4MNLA 1H6KX 3TTOA 1HNZF 3VIOA 2AMGA 2QLYA 3S5OA 1MQPA 3L4WA 3OL6A 1N0UA 3OLAA 1RHRB 1TRDA 2CCRA 2C15A 4WF7A 2OZ8A 3T7VA 1ESWA 3GV7B 4CQDA 1U6ZA 3UVJB 2CBVA 2PBOA 3CLWA 3CMGA 4EO6A 1NPPA 2MQQA 2J8SA 1HPZB 5B0DA 1UIPA 3BQ0A 2FJAB 1UJ4A 3R7BB 3E3HA 3IJ8A 2E1PA 2QMWA 3HV9A 2BG5A 3OLBA 4A05A 4B9MA 4PTDA 3JU2A 5A6SA 4A48A 5IM51 2MHEA 3DFPA 3AA9A 3DGVA 1B3TA 1WDQA 1H7RA 1F5BA 3BC9A 3OBKA 2ZZ4A 4Y2WA 3EOSA 4PCSA 2W7PA 3W23A 1PKUA 1VHCA 3BN4A 1Q6FA 2GAHC 3H55A 3O44A 2WNQA 3PULA 3RR8A 1K9TA 3EB4A 1XDMA 4H7VA 2VB6A 4AQYJ 3M8QB 4D3HA 2A3LA 3EEGA 1WUFA 4ZO9A 3VYLA 1YPFA 3RMEA 1O5JA 2OPRA 5JH1A 4GVGA 3ENLA 3PG9A 1E4NA 2ZVRA 3QZAA 5GPRA 2WC4A 2GQ8A 4HTJA 3OHIA 4DR3F 4RJVA 3BARA 1OEPA 1AW1A 1QNRA 3MM5A 4PUOA 3BOFA 1NDPA 1SJAA 4TMBA 4Y34A 1RQHA 3VMNA 4DF0A 3MPYA 2KHDA 2WKJA 3AWNA 1JR1A 3SCQA 4L5ZA 4CLPA 1AYEA 1B0IA 4B5WA 3VKCA 2RDUA 5DLGA 1VYPX 3CUXA 4CCZA 1N32F 1VZWA 1R0BG 1TL7B 2D3OR 1Q6LA 1LRNA 1NOFA 5AC4A 3JYTB 1B3YA 2FH6A 2B0MA 2QJGA 4DB7A 3RBEA 3R89A 4LQ1A 1R86A 2BHYA 3T41A 5J1PA 4HPHA 2VM8A 3NGRA 5DS7A 2P76A 1MEWA 4WXOA 7TIMA 4DZAA 2N82B 1M1BA 5HNUA 3SRKA 1CI1A 1XMBA 2YWKA 4OI0A 4LIRA 2AX0A 1GZ1A 1XGDA 1C0UA 3T0CA 4KWWA 1U24A 2GIRA 4DUZF 1NKBA 1JPMA 3NQ7A 4YVVA 2HFZA 4OT7A 4DYJA 5DXYA 2M8DB 3A3WA 2ATMA 3CW2C 2HRYA 2JVOA 3N19B 5BCAA 1C93A 3UZWA 4NZ0A 1KKHA 4ZS6A 1UUQA 5KFCA 1HO4A 3T6BA 4I6VA 3RN6A 2JSXA 3MD1A 3QATA 1UBPC 3M05A 2DR7A 4UOQA 2G4FA 2BOPA 3QHMA 2OTDA 1XLGA 4BEQA 1KHWA 4EBDA 1SB6A 1E9ZB 3OTRA 2XMTA 3TWBA 2MY7A 5JVHQ 3TYAA 3S1VA 1N82A 1YX2A 2YSWA 3PFOA 2IA6A 1J18A 5JUVA 3CIMA 4FA3A 2EPKX 2NXIA 1QAJA 4DJDD 1HBMA 5J2PA 1UKSA 4DRSA 2B3TB 5BXPA 2BY0A 4LFYA 1BEUA 2VG6A 3AXXA 4O1DA 4OYWA 2V34A 1F8MA 2EO7A 3KUGA 4ED2A 3QZ6A 3DRXA 3D0IE 3PYEA 4FP9A 4A29A 3G86A 3EDQB 4DFKA 3SSRA 4KFBA 3QC3A 3WQ6A 1X5PA 4PL1A 3WQGA 5CC3A 1QNQA 2IPOB 2JOQA 5A8QA 2EFGA 4L4PA 3PTQA 4LCQA 2QFJA 2DNKA 3CYJA 5CG0A 3HP6A 3PZVA 5MKGB 1DWGM 3BPSP 1LLZA 4NA3A 4S2CA 4C8YA 4KV8B 1TV6B 2FGOA 4K38A 4M56A 3AIEA 1RA0A 3E96A 3NGTA 1QJHA 2V2KA 3CZKA 4DLGA 2IJFA 4QFUA 4G56A 1MXDA 3UO0A 1NZ8A 2AJ0A 1VFUA 4O1CA 1T8EA 4LF9F 3NL2A 3QHNA 2YCLB 5CYQB 3C2YA 1X0FA 4LT9A 1UCWA 1KFDA 4PODA 3TQEA 4FNHA 1MW2A 1QPKA 1E6VB 3C19A 2FD2A 1UP2A 1DEDA 1WG5A 3W7JA 4E2DA 4CLSA 2P88A 2ZTJA 1H41A 1IR2A 1W1B1 1FO1A 2DNHA 2XFWA 3WUBA 4ZPAA 4DV0J 2ASHA 1MNZA 2B51A 2Z1KA 1CULB 4C98A 2Y9HA 4QJVA 2XIBA 2W9BA 1QPRA 3QHOA 1HJQA 4H9ZA 2ZVIA 4WZHA 1P48A 2RRNA 5DRKA 1XLFA 2QSWA 3T42A 1MEIA 1IZJA 4MK9A 5HUOA 3DENA 1S0VA 1XDJA 1Z41A 2X0SA 5A6LA 3MHYA 4IUGA 4B9ZA 4BWMA 4ED0A 2UUBJ 4PQUA 1M7JA 2AIRB 3BKFA 1Z8AA 5DT7A 3ZZTA 2OELA 4RPFA 5JU6A 4H4MA 1SMAA 4ZKAA 4GKJF 4ECSA 1DJZA 2EBGA 1M3UA 1NWSA 4QTGA 1P4CA 2DT3A 1NJWA 2PC8A 1HVXA 3ITOA 3TSDA 3TTEA 1TV4A 1BSLA 1K7EA 2CQ4A 2OSXA 4HYRA 2DEJA 1K1SA 4GOAA 4Z2KA 3VGSA 3CL8A 3DECA 1ZTTA 1QFEA 1VLWA 3LDVA 1FDNA 1UR9A 3RYLA 1LWJA 1NOUA 3V0UA 1HL6A 1Q5VA 2VFTA 3H7HB 5XIMA 3POTB 1NTHA 3V6JA 1V6VA 2DGQA 1HO1A 3CHVA 4IQJA 3A3NB 1EJRC 3V6HA 4D6DA 2YW4A 3STGA 3I3EA 4US5D 3VI2A 2R7TA 1FXQA 4LV9A 5FD1A 1SKSA 2GWGA 4UNKA 4AWUA 3KEHA 3EAUA 3ZT7A 3QBUA 4Q6XA 2XS2A 2AF6A 4FF1A 3E2SA 4OKDA 3BLKA 3H5YA 1VLIA 1WXYA 2DW6A 3UG5A 2KRBA 4KRZA 1XFCA 3C15B 3J81j 3WJSA 1BQGA 1QD1A 3QM3A 2Z6IA 1OT1A 6FDRA 4DO6A 4UFHA 1NLKL 1RWMB 4NYPA 4BJHA 5IXEA 1XC6A 3MVIA 1RT5A 1PC4A 2MZRA 3M6UA 3Q89A 3U7JA 1EX8A 3WHIA 2C28A 5CH9A 4WLCA 3OTOJ 4LBIA 3S3GA 4MWAD 3R9LA 1TZ7A 3AYVA 3U4FA 2G3MA 4GXMA 2YKQA 5KOXA 1RZMA 1TSIA 4C60A 4UTMA 5T9CE 1ISWA 2ZWYA 1YIJS 3NOEA 3QPIA 1Z3NA 3BOXA 3GW3A 4RUAA 4EGLA 4D1IA 4X9YA 1I5OB 3IGVA 1TE1A 3IVUA 3K8WA 2LVWA 4B3TJ 4B3TF 3V4MA 1O0PA 1P0NA 5MKGA 4ORMA 3M0JA 3NL0A 4U8YA 2Y0FA 3CASA 4C1LA 4NL1A 1XC9A 3M8RA 3FYOA 5KFPA 5K8PA 3WQCA 2DO4A 3KTSA 3ARRA 4D1JA 1JCMP 2VEPA 4L61A 3H2CA 1JAKA 4IPLA 1XLEA 4PYAA 4MJMA 2PGRA 5DM7Q 4QHRA 3GZAA 2YCLA 4JTRA 2HBYB 2OLWA 5IM0B 3IN5A 4L73A 2O0TA 2MLZA 2CU0A 2I8EA 4HVZA 1EQCA 2OWXA 2C2KB 3GUGA 4ZMGA 2GGPA 1YW1A 1L6YA 3PS7A 1LKZA 5IRPA 3BICA 1QSSA 4YPJA 4ZPVR 5LNWA 1W26A 3W1TA 1SUXA 1D8CA 4PMOA 2ZX5A 2ZUWA 3T1HJ 3W7LA 2ZRXA 5HDRA 2Y5EA 3K4AA 3UCQA 1CIUA 2P9EA 4EOUA 4DU8A 1RHKB 2CLHA 5L1LA 1T3OA 1X4BA 1U2CA 1RU2A 4ML9A 1CJVA 2P8CA 2J6UA 5U4NA 4DDFA 4JI5J 2DGXA 4NLPA 3WLQA 3M2VA 2FVLA 1QW8A 2XZ9A 3KCOA 4UTTA 4UTGA 3TKFA 1CGVA 1IWGA 6ALDA 4YNGA 3C66A 2FHFA 4HEA9 1B3XA 3G24A 1E73M 1FWAC 4IJRA 4MKYA 5DZ7A 3RXZA 3M0MA 2QCDA 1HHQA 3KHHA 3D0CA 4O8AA 3J7YU 7A3HA 1KLNA 4YVXA 2E5HA 5I3PA 2YA1A 1B3OA 3AUJA 1G1YA 3WLSA 1UR2A 3H2AA 1NJZA 2FJXA 2G50A 1SO5A 1ZAWA 3IGNA 5EMKA 1OFAA 2O56A 1ENUA 1KM5A 4PMVA 4F26A 1CJVB 2AYGA 2UXCF 1WP6A 2HTMA 3JSRA 2C8NA 1C9DA 2GX8A 4KTQA 1NARA 3T0TA 5HMFA 4MWAA 3DESA 1EZ2A 3QJPA 1CXKA 1U26A 3UXIA 1SGJA 3I68A 1U1RA 2E0PA 2C71A 1JDFA 5CPOA 3QRPA 4MKBA 1AQFA 2JX2A 2XHYA 4E0CA 5GAGU 1VGAA 4M8LA 4QG6A 1YXYA 2VUNA 3LCHA 4IFOA 2QUUA 3MM6A 5KITA 4M5JA 1RTDA 1A5AA 4K50A 3W9HA 4CNSA 1EA9C 3KHLA 4JZ5A 3GFXA 1C1CB 2XGZA 4OIXA 4HN4A 2CITA 3GDKA 5AT1B 1Q86T 1J0JA 3QW4B 1RT3B 2QDDA 4IQEA 3KK1B 3DYAA 2Y1JA 4AEEA 3CJSA 1T03A 3STFA 1UC4A 4HI2A 2D2HA 4CWBA 3EZ5A 1T3NA 2YL6A 4NLXA 1HNWJ 1J0IA 4HU0A 4U31A 3CHEA 2I9UA 4YLWA 5AXKA 4J9QA 3NDYA 3W1AA 3FKKA 3H2OA 4EXBA 4I4BA 3MECA 2A85A 3OJSA 4WVXA 4F2TA 4PH6A 2WAGA 2PGFA 3IUIA 3VAHA 2HYIB 5C25B 1BRLB 3TDFA 2HAFA 4IPPA 4Q8VA 2QLFB 4Q0BA 3G1FA 2HSEB 2C1IA 1VQKS 1B7FA 4B3MF 3L5AA 4YR0A 1NDCA 5JQ9A 2EC2A 3HOJA 1B90A 1EIXA 3I7SA 3ZQ9A 2QLBB 4KGXB 3VE9A 4JI7F 3ARXA 4EYHB 1EDQA 1X9MA 2PDUA 1DXEA 5LIXX 2KXFA 2LQ5A 4NI2B 3GVWA 5K9XA 1D09B 1LK5A 1ZP3A 1FXDA 3W4RA 3L65A 1AH3A 3N9KA 1XUZA 3GFYA 5F8HA 1Y11A 3GB6A 1B0PA 4HI1A 3FSXA 1YDNA 3M0LA 1SI9A 1LV5A 3H53A 3LHVA 4MIAA 4ZITA 4RNNA 4UZUA 4GC3A 3PX4A 1SH3A 3ARSA 3THAA 3L7UA 3ZSTA 2QLWA 4XZMX 2KKHA 2RKXA 1AUSL 1M0SA 1OF8A 2PURA 1FK9A 1E3ZA 4G7EB 3GD6A 4DR3J 4FF7A 1VC6A 4R9XA 3UW6A 4O17A 1N33J 4MHBA 2OOFA 2JK2A 2GO8A 2ZCGA 3COTA 3FXGA 4N4PA 3L2LA 4CLLA 2HS4A 1QTWA 1VHIA 1NFGA 3E0IA 4LAOA 1S6UA 1VBGA 2OB3A 1JIHA 1E6YA 3AROA 3VIFA 4FYDA 1C2PA 3AMKA 2UXCJ 4MB3A 4TYAA 4TR9A 3NA8A 4HHLA 3RCMA 3NGKA 4QJ5B 1WXJA 4CT8A 4JGDA 4H7ZA 4I2PB 1Q7YT 2QMXA 2WSFC 3CDUA 4WY0F 4UR9A 4J9SA 2J6XA 2UBPC 1ZFJA 1GMUA 1HKJA 5LMNJ 3HF3A 1E6ZA 4TTGA 1Z69A 3IRDA 3P81A 4NZJA 3C56A 1E0XA 4XZLX 1G69A 1SZGA 2ZC8A 1L3UA 1J0ZA 4LY4A 3H2VE 4LMZA 2VR2A 4RE2A 3PANA 2MZ1A 2PUZA 2FLOA 5HAOA 4DMZA 3GYNA 3KOXA 4KWVA 1RT2A 3WK0A 4GQGA 5LKYA 4XZ9A 2LMIA 4ED7A 3QT8A 3VNLA 2K7KA 5D78A 4FI4A 3IBWA 4K0KJ 3CUGA 1NU5A 3IIXA 4BCEA 3F1QA 4LCRA 3DBPA 3EX2A 1RAGB 1YKWA 1E6NA 3PP7A 4I1TA 4PMYA 2XYGB 2CESA 5DN1A 3OXFA 3SV4A 3WLJA 2XN2A 2PA3A 2OGYA 3E0WA 2H9ZA 1J2BA 5B0BA 4N7TA 4HK7A 3OYZA 5TNVA 1RAEB 4PG4A 5CYQA 3EPGA 3PZQA 4UOCA 3UJFA 3QT7A 3SUWA 2XG9A 3DHDA 2HFNA 4AFFA 2EG6A 3T2QA 1JWWA 5G2HA 4ATNA 1SO3A 2YQ3A 4PULA 2W1BA 3JS3A 3BW3A 1CLFA 4DLEA 4JKLA 5A2QU 1BYCA 1ZHAA 1EBHA 2DH2A 3DXIA 3VCCA 1XWYA 2OPJA 4MKSA 3OR2B 4ZO6A 5EMMA 5E5NA 3B0VC 3D5HA 2QIFA 3PYDA 1KQZA 4YB7A 2A1YA 4GY0A 5U7SA 1YZ6A 2KYZA 4FNIA 3SCUA 1LROA 4DI8A 2XVPA 1VFMA 1YPXA 3BL3A 4QITA 2XN1A 2VDIA 2COLA 1QSYA 5BYWA 2D22A 4KEVA 4N4QA 1NDYA 3P61A 4NE9C 3S1TA 4DQRA 2XH0A 4UOFA 2H48B 2DDXA 1JCLA 1NDWA 4PABA 1R2TA 2WZEA 1Y5IB 5C0QA 1UKUA 3NO3A 1BUXA 4GE8A 3KOWA 3IBFB 2YNFB 3AOCA 3KRZA 2D20A 4FXFA 2ZUTA 5E3QA 4LFBF 2D41A 1CENA 3Q8UA 3IGXA 3VGBA 3WKZA 1BG4A 3ES8A 4A3HA 1PBGA 3MEKA 2NQ5A 3W82A 2CQHA 2VNCA 3F73A 3UN2A 3MGJA 4H9MA 4RBVA 1EC7A 1IV8A 1VHFA 3HM9A 2FVKA 1LDCA 2ZM6F 2YL9A 1RH9A 3KLVA 3TA0A 1P6BA 3MR6A 2BQUA 1HHSA 3U0HA 3HGOA 4MNMA 3TWZA 5LNVA 4NRTA 4O4WA 3KNGA 3HQOA 3W1UA 3IMQJ 3VOHA 1K1QA 2C2ZB 4KYZA 3O07A 3VM5A 3KJQB 1LWEA 3LCLA 4MJ2A 4ZLLA 3QT5A 3HSDA 5AOUA 3T9NA 1Q6RA 2XZWA 3OVGA 4GC4A 4DSIA 4OYZA 4LS2A 1KTVA 4B4HA 3VOGA 2DNGA 3LU2A 5BWAA 3UQNA 1B0VA 3WLNA 3EB3A 2FY8A 4TLQA 2DYAA 2PTXA 4HNVA 1HFEL 2CQIA 3S6EA 4ICMA 3G1DA 2OFHX 5LA0A 3HG2A 3GLCA 3WCZA 2V63A 3OJUA 2ZFAA 2F40A 4AD6A 3MSRA 1W56A 3EA2A 1KRPA 4IG0B 3N9SA 3AFBA 1K70A 4I6AA 2UVUA 1KXVA 5ABHA 2X3GA 3RRHA 1F5AA 1EKRA 4KV8A 3QZ8A 3ISNC 4KGVB 2XMKA 2I9SA 3BGJA 3VGUA 4TVUA 2XVKA 3PBWA 2VPZB 2ZC3A 2QGHA 2FQIA 3TYCA 1F4AA 4RPQA 3W9IA 2PDJA 3E1F1 1I1GA 3PZOA 2ZWOA 1PWMA 4FPRA 4GX8A 4DG1B 3SBFA 3DEQA 1GJPA 1FFWB 2OGUA 2KX9A 2RE1A 2XWEA 2QVNA 1TCMA 3H59A 3WUEA 4MNJA 5B7YA 2QMJA 2KB2A 1QNVA 2QN6B 3M47A 2Z0GA 3MI6A 4F2BA 3GTHA 2XUCA 1F9HA 1KHVA 5E9XA 1LLWA 3WFZA 1QBBA 5LHFA 2AKWB 1XMOF 3NAIA 3GMGA 3SCLE 3W87A 2UUAJ 1FHDA 3UJSA 1YXCA 3ADAC 4OZ2A 4Q8PA 2A10A 2GVZB 4IOTA 1PSCA 1JLCB 1XNRJ 4JHMA 2V2DA 5C9RA 1MUCA 5ETVA 1K6WA 1G94A 2HQFA 3NQAA 2PFFB 3K5OA 2QCNA 3W7NA 2CPJA 8RUCA 2DCUB 4PC8A 2AX1A 1ZSXA 1KFLA 5E2QA 1EL3A 4KERA 4JTSA 2WMIB 5IT9Y 3MM8A 1KCXA 2OTJS 2BE9B 1XLMA 1VFOA 4UTWC 1KP6A 3G8SA 4IMFA 1M5SA 3WG6A 4AAJA 2EF9A 1XIBA 1WORA 5BXSA 2RUGA 2EG1A 4O50A 4CLZA 4FHAA 1ZS2A 2NLYA 1ZY9A 3OD2A 3R6IA 4LC6A 2OQYA 2ZXBA 1GVOA 4IMGA 1IIGA 4DJDC 2OD6A 3EGVA 1IR1A 1IXQA 1TKDA 3AMCA 5CZ0A 4A21A 3N18A 3AJ2A 3MYPA 2GSJA 4C11A 4DJBA 4USHA 4ZXOA 4A8MP 2ZIDA 5J04A 4TN2A 3AD7C 2UY5A 1IKXA 3R5EA 3KUEA 4RLEA 4C6AA 1ZAJA 3SSQA 3N4AA 2XC9A 5GJPA 5FF3A 3BSNA 3MM9A 1SZNA 1SJFA 1D0EA 5HR7A 4YXGA 1W31A 3TP2A 1IWAA 4WOZA 4XD6A 3SFWA 1H2UX 1TK8A 3RRXA 3HHNB 2DPIA 3T55A 3G18A 4UQAA 3E2EA 1RQBA 8XIMA 2DEPA 2IQDA 2BA9A 5F8GA 2QULA 2RRAA 1Q3NA 3QTPA 2N3OA 4Q43A 1GH8A 1E40A 2YWWA 1XYZA 2O66A 3P80A 1V5IB 1Z32X 3VAMA 2B4OA 1MMFA 2J5AA 5A6MA 2XMVA 2RUSA 1IGWA 4I64A 3QLHB 3G6ES 5AC6A 4OLOA 5HROA 5T8GA 5KG3A 4BWLC 4JI6J 3KWMA 4JI6F 4CVWA 3MMWA 2JLFA 2YH0A 3MCOA 2ZKTA 5HSPA 1OCJA 3WQ5A 2WMFA 2Y61A 4L76A 4FF3A 1IKWB 3ZR5A 1LL6A 4LAMA 1HI1A 5KG5A 3OUYB 2RF2B 3ITGA 4LYPA 3K8KA 2KHCA 3S8HA 2XULA 1KEKA 4KPLA 4LUSA 1VPXA 4WZMA 5ETRA 4DZDA 4QJ4B 4S0MA 4GNJA 4YYFA 3ARYA 3HFVA 5EX0A 2P2CB 3RF9A 4F9DA 3TWAA 3SCNA 3ENAA 1YEYA 4LF8J 3QYQA 4ZGYA 4ICCX 1WTFA 2I0XA 1OYCA 5HXMA 1BSIA 2D0HA 1IKYB 3CMQA 1WQ5A 3ZZYA 3MEDA 2Q09A 4A8NA 4OOZA 2WAQD 1MUWA 3PNUA 4DJFC 4C11B 3BLDA 1TR0A 2Z56B 2ZBCA 4FDFA 4NZCA 1G4PA 5D3GA 3IVTA 3DOPA 3HHLA 2J7HA 1RP8A 1ZL1A 1NU4A 2IM0A 1YQ2A 1WC1A 3LAKA 2A3JA 1THFD 3SZ8A 2W4DA 3WEZA 2JEIA 2WVSA 4Z2XA 2CZ5A 5K5MA 1J10A 4WP9A 3W1LA 2J7DA 2Y8KA 3M0KA 1KD1T 4JQ1A 4EU0A 1CT5A 3MZNA 2Z1WA 3RB3A 3IGUA 2ISDA 5AHEA 4JI0F 3GVVA 3A13A 1OPIA 2DSVA 4IGHA 2CBIA 5C71A 4MB1A 4IHCA 3DLLQ 1VJSA 2NSCA 5JIWA 1APSA 1TUXA 2QPXA 2JJ4D 2JEJA 4J2MA 4O44B 1XD0A 1XWLA 3DI6A 3OL9A 4OUIA 3EGWB 2VVSA 2Y85A 3UPWA 1A0DA 1QNSA 2FQQB 3T1YF 4ZO8A 1S2CA 2PDMA 1HXJA 4RO0A 3MBDA 2QJIA 1XTZA 2I1OA 1IZCA 1LBMA 5H1SV 4E4UA 4E4FA 4F3HA 3CPRA 4W8BA 4X4QA 5EHHA 2N7YA 1VFSA 5DBUA 1SC3B 3UCDA 2VBYA 3S47A 5I77A 3H4DA 4M7TA 1YDVA 2UUTA 1H2VZ 3TIMA 4V15A 3NCPA 3M6WA 4C8OA 2YXOA 1OX6A 1OGBA 2HPIA 5AY7A 1HR0F 3MEEA 4KPYA 1GQEA 3M8QA 4RX0A 3KMQA 1P6CA 2NV1A 1FEEA 3U5YA 3IWNC 1XYFA 3NPUA 4UQCA 1OFBA 4ELVA 3EMQA 4FN5A 2IPGA 3VOJA 3GIIA 1DTQA 1X39A 2LXIA 4N8NA 4IG2B 5E93A 1IT8A 2D3UA 2UWFA 3K5MA 1GVEA 3MW7A 3Q94A 1R3NA 2YKOA 3GFZA 3MO4A 3POTA 5D0EA 1QHZA 4H4KC 3SV3A 5HLFB 3VAIA 2QO3A 5T9BG 2VD8A 3MAQA 2PFHA 5CYJA 3NNCA 3VNYA 2I5QA 5BZAA 2P0OA 5FF7A 1DRZA 2V0NA 2RGLA 3W29A 2GZXA 1KLYA 1JLBA 1YITS 1JCNA 2VUGA 2L48A 5AC5A 3DC8A 2BE7D 5LSOA 1R3RA 4LVNP 4FXDA 2NX9A 3BSGA 3EXYA 2KO1A 3W2MA 4B5XA 3T81A 4DL5A 5I78A 4RW4A 1I45A 4R33A 2JC0A 2RS8A 4Y9MA 1FNXH 4H19A 1JXVA 2W67A 1KBIA 4WUIA 1V6UA 4WK1A 5A2QY 5CBIA 4K36A 1UL3A 2ZUVA 2W4XA 1SUQA 1SJDA 4NG3A 1JXKA 4DCPB 2WQDA 1F3EA 4EX4A 3VCRA 3NNTA 5F8IA 1W3TA 3OTEA 5A6KA 1OFQA 1HNZJ 2FC8A 2MLXA 4BDPA 1BGGA 3CTTA 4XPCA 3S5SA 1SL0A 2Y8WA 3TN3A 2LQ8A 4DXLA 4MYUA 3FSIA 1GJUA 3O6DA 2ISFA 2RD5C 4MYXA 3VC5A 2F8QA 5HJXA 5CLWA 4PPZA 2J88A 2XH2A 1KTBA 4B9YA 2BXJA 3MPUB 3EDKA 4JTDA 1TJ0A 7CGTA 4L4MA 2DNYA 3S83A 3MS8A 4AEFA 2R8GA 1M1GA 5I3HA 1KN6A 2Y89A 1SFLA 2WW5A 1SSDA 2Q3PA 2ZZNA 1SBRA 5AYBA 3FSUA 2MZJA 1J5OB 2ZH5A 1C1CA 3BLFA 3LI1A 4HT3A 3M8WA 2ZBRA 4RV8A 1HQEB 4URSA 1S1RA 4WHBA 3LWMA 2GGJA 3IR5B 3KHRA 1VDHA 5DRCA 1S10A 3N6MA 1T8XA 5FIPA 1RHCA 3MV01 1FVQA 4GQBA 3STEA 3BPDA 2YB1A 5AHNA 2K1RA 4C2MA 4Z1BA 4YWSA 4U95A 5BNKA 1OZMA 3F0NA 3K1GA 5D30A 1TV8A 1WSVA 7TAAA 1XNQF 1P0BA 1WV2A 1ISVA 2YYTA 1N5VA 2AKMA 2RDTA 1V3ZA 1X4GA 4O0KA 3RR4A 5CAKA 2FHJA 2W9CA 4G6VB 4XIUA 2ZWPA 3R94A 4M6QA 5KTQA 1TTPA 4GJIA 3QYYA 4MWAE 3BLIA 4QBXA 2YKNA 2V2CA 3QJJA 2J76E 1S57A 4L6OA 1NZAA 3P8BB 4AVNA 2EKCA 4B92A 3QGIA 3NAHA 4NJGA 1FOBA 4NXMF 3FNNA 4YTTA 1VR6A 1YG0A 1U1NA 1JPKA 4LUYA 1IQZA 3OQEA 2OKTA 4ILSA 3S2MA 4DUOA 5H1WA 2ZJQQ 2DZUA 1JLQB 5FD0A 2WSQA 3UD5A 1M5PC 2F63A 2UY3A 4MFEA 3D46A 3PZPA 3HN3A 2AGOA 2X2GA 4IP4A 1K8XA 3WBAA 1CGYA 4QQBA 2EKYA 4ZQCA 3LS9A 4AW7A 1I75A 2W63A 4MGGA 2DQXA 3C61A 4MLJA 4CO0A 1KXHA 4YTSA 2ZDRA 3A3OB 3HMCA 4N5SA 1UA3A 3KLLA 1SIWB 3DLJA 4R25A 1K1DA 1C0TB 5HMYA 3RW7A 5KT6A 2B4GA 5C54A 1UVKA 1GWJA 1E6YB 3CMFA 1N8FA 4LREA 4LRAA 1R3TA 1FFGB 3KJVA 4LRSA 5I7GA 1UZHA 3MZIA 3QQCD 2O67A 1GVSA 3PBMA 3PR2A 5CH7B 3H90A 5CZSA 4RBUA 2DGUA 4DQWA 2CDRB 3GHRA 1K8ZA 4G1NA 2XI2A 1ICPA 4AHQA 2HXUA 4D8LA 1I9CB 1WE5A 2DNNA 2DISA 1EYEA 2BY1A 5BRBA 3MCMA 2FTRA 2P9CA 1CC7A 2LECA 4U5IA 1QW9A 2HAIA 3MBFA 1JFXA 1PTAA 2QHAA 2HNYA 5A0YA 2TSYA 4CNPA 1Q81T 3WQEA 4EEYA 3D3FA 2ZBIA 5L38A 3HG4A 3M7WA 1D9EA 3T0BA 1YBQA 4LJ3A 3AMDA 1O5QA 4Y2MA 2XLIA 1FRIA 1U2YA 1F74A 4S3KA 3MB9A 1HG3A 4F2UA 1PCAA 2GYIA 1XIIA 4YYCA 3IM8A 3GKAA 5I07A 4KRTA 5AVHA 2VFRA 2WONA 3P3BA 1L3VA 2EFVA 2CZEA 2V3EA 3BSCA 4PUJA 3W5YA 5IBXC 4OBSA 3MM9B 2VA2A 5AHIA 3KDNA 2GUUA 2CJKA 3WLLA 3F4VA 2B7CB 1R6WA 2CIPA 1TK0A 1V3HA 3W62A 1V7YA 4FS9A 1TG7A 3Q8YA 1QAXA 2HNDB 4LF1A 1NFBA 3MP5A 4HK6A 2YFOA 4W89A 3ICJA 3O6QA 5FJ4A 1F2JA 1REQA 3M30A 4K4XA 3H4GA 4I7UA 3IAS9 4PR6A 3BK0A 3SN1A 3MMJA 4X61A 1E6XM 2IXVA 4HU4A 4DX7A 4OU1A 4HKQA 2ADCA 2VZVA 3FJ4A 1RTDB 3GNPA 1TYGA 3ABZA 2CHRA 1FVSA 1FTCA 3BGOP 3LGMA 4O3OA 1RT5B 2P10A 4ZQNA 2GJFA 3DHXA 2OPPB 4PCQA 1EC8A 1HP5A 4HR2A 1OY8A 5DG9A 4DS5A 4PXEA 5K9CA 3L09A 4OYBA 4R0JA 1TWSA 2HFOA 1HBMB 1E6QM 3OO2A 4XK2A 2IVFB 3GG7A 5K4XA 4X64J 3C6TA 4ATLA 3TVZA 1PS9A 2A79A 2V5KA 3SCWA 3U9IA 3NY0A 2A2IA 3FX4A 4RDVA 4M1BA 1TQLA 3TN5A 3WJXA 1E71M 1RT6B 1YJUA 2EG7A 4DR5J 4LR9A 3TYZA 5LNUA 1DTUA 4ZMMA 1YRXA 3EZUA 3IWXA 4PB4A 1S0MA 5HVGA 2I7GA 2AV5A 2HK0A 2JFKA 1SKWA 3T3FA 4URIA 4XB3A 4HNUA