2ZVIA

Crystal structure of 2,3-diketo-5-methylthiopentyl-1-phosphate enolase from bacillus subtilis
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
400
structure length
395
Chain Sequence
SELLATYLLTEPDTEKKAEQIATGLTVGSWTDLPLVKQEQMQKHKGRVIKVEERAASEKQAVITIAYPEINFSQDIPALLTTVFGKLSLDGKIKLIDLHFSEAFKRALPGPKFGVYGIRKLLGEFERPLLMSIFKGVIGRDLSDIKEQLRQQALGGVDLIKDDEIFFETGLAPFETRIAEGKQILKETYEQTGHKTLYAVNLTGRTADLKDKARRAAELGADALLFNVFAYGLDVMQGLAEDPEIPVPIMAHPAVSGAFTSSPFYGFSHALLLGKLNRYCGADFSLFPSPYGSVALPRADALAIHEECVREDAFNQTFAVPSAGIHPGMVPLLMRDFGIDHIINAGGGVHGHPNGAQGGGRAFRAIIDAVLEAQPIDEKAEQCKDLKLALDKWGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,3-diketo-5-methylthiopentyl-1-phosphate enolase
publication title Structure of the apo decarbamylated form of 2,3-diketo-5-methylthiopentyl-1-phosphate enolase from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 139
structure length 395
sequence length 400
chains with identical sequence B, C, D
ec nomenclature ec 5.3.2.5: 2,3-diketo-5-methylthiopentyl-1-phosphate enolase.
pdb deposition date 2008-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 2zviA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 2zviA01
1UZHA 2ZVIA 2OEKA 1AUSL 1GK8A 8RUCA 5RUBA 2V63A 1EJ7L 1RXOB 1UWAA 3A12A 2V67A 1RUSA 1RBLA 4F0KA 2V68A 2RUSA 3AXMA 3KDOA 4NASA 1IWAA 1RCOB 1GEHA 1RBAA 5C2GA 4F0HA 2CWXA 1SVDA 5C2CA 3WQPA 1IR1A 5HJYA 3AXKA 5HQLA 1UW9A 2CXEA 3RG6A 1RCXB 1BXNA 5HANA 1RLCL 5HAOA 1BWVA 3A13A 5HATA 2YBVA 3QFWA 3KDNA 3RUBL 5HK4A 2D69A 3FK4A 4HHHA 2V6AA 5HJXA 4RUBA 1UPMB 1TELA 2OEMA 2VDIA 2OEJA 1UZDA 1RSCA 1YKWA 3NWRA 1AA1B 3ZXWA 2OELA 2QYGA 1IR2A 4F0MA 1RLDA 1RBOB 1UPPA 1WDDA 2VDHA 9RUBA 5HQMA 4MKVA 4LF1A 4LF2A 2V69A
chains in the Genus database with same CATH superfamily
1FTRA 3P2VA 1FOBA 4K4ZA 5F4XA 4OJ1A 3KRZA 3FZBA 4FVCA 1G3OA 3P67A 5GNYA 1UG6A 3RR8A 4E4PA 4ECQA 3I87A 4DJEC 1VRDA 4D6HA 2FYXA 3EDEA 4ZQOA 4X3ZA 2VR2A 2PSNA 1EJ7L 2PDIA 2VJXA 2WVBA 1G2EA 2FZMA 1M5HA 1MWOA 1M5PC 2F6UA 2GQ2A 2HROA 4USWA 4DI6A 4YPJA 3W7EA 3NYDA 2VUGA 1BPLB 5KFLA 3T4CA 2QKFA 3LXCA 4JQ3A 1UMLA 3T1GA 2PIIA 3VMPA 1IGSA 1U1RA 2J0QD 3MDUA 2E9ZA 1W31A 1EF2A 5JMUA 3GS6A 2CPJA 4Q4PA 2G0CA 4XSLA 2VFUA 3V6JA 2OCZA 1OVDA 4NKCA 3A3NB 4KGLA 4FK9A 4ZDNA 1J6PA 4GYFA 1DXEA 2WB5A 5DBUA 4IFKA 4BFAA 5HQLA 4UQBA 1EZZB 2P0OA 1IM6A 1KV8A 3PG8A 1RTDA 1KR0A 1MEHA 5D4LA 3PK7A 3A13A 1B7YB 4MIBA 2BMBA 3DGPA 1O6IA 2DHGA 2R7TA 2H6RA 5DO8A 4QG8A 1FWPA 3MMBB 3R89A 2ZFHA 3N73A 3NY0A 1TU0B 3B0PA 8AT1B 5PTDA 1FFWB 3ZTSA 3W7DA 1OC6A 3ET6B 3KE0A 4HSHA 2XVLA 1L6GA 2AJ4A 3M6UA 1R30A 1RALA 5F8IA 1E6YB 4QLKA 2BW2A 2C7FA 2XZWA 2V38A 4I7FB 4OFZA 5EHHA 1OFDA 5H6HA 3H2CA 1JAEA 2Q1LA 2O4MA 4CCHA 1ZB5A 2YQ1A 2DVIA 4O18A 1HBNB 3S1WA 1SJBA 5E41A 1DORA 4RNHA 1RJRA 3BDEA 1IVZA 3DRYA 4FZIA 4W93A 3KG0A 2N82B 2FLLA 3WDRA 3NQBA 4LPCA 4A22A 1C0TB 2ESCA 1POJA 4NJKA 3I65A 2VOTA 3DERA 2RU3A 1ITUA 3PB0A 3K5LA 4DHVA 4JDBA 3CQIA 3FSIA 2I5GA 2AZ3A 2MQ8A 5L8RC 3TQ1A 4CQ8A 3SUWA 3BLIA 2GVLA 3AYTA 3KKFA 3BUVA 2XIQA 4AQLA 1HG3A 4IMCA 1TL7A 1F5AA 3W83A 2F40A 1RA0A 1MROB 3VGHA 3JRKA 5A1AA 3DRSA 4H9MA 1M7OA 3ZZRA 4CQ1A 5CD4A 3N2BA 1QJWA 4CO0A 1QPKA 5CA5A 1GZ1A 1V8EA 2BW7A 3KLHB 2CPUA 4LVOP 4XB3A 1WTBA 2L48A 2XFWA 1D8WA 5FF2A 1XPGA 2XVKA 4UF4A 3QGIA 4E4FA 2HRTA 4W85A 2EFOA 2YNHB 1DEDA 2HQIA 3P5YA 4H4IA 3FJLA 1XG4A 1HHQA 5KFNA 4CNYA 2HE8A 3QTGA 2KFNA 3W2UA 3W1TA 4LRFA 3TARA 2XC9A 2PTZA 2GV1A 2GVZA 3X3UA 3TA0A 2GJNA 4H19A 4MJZA 3V5OA 5AHIA 4U33A 4C8MA 3JUGA 4US5A 4DU8A 4TX8A 4QW9A 1UR4A 2YBVA 2GSJA 1GMWD 2VG7A 2VEGA 3VIPA 2EI5A 4BHYA 4M95A 1NVMA 1HBOA 3GJSB 2UBPC 2WPGA 3KBMA 4UFHA 3DC0A 2ZRVA 1ICPA 2C3ZA 1F9HA 2ZJQQ 2OEMA 2E5GA 1Q8AA 2CHOA 1B0VA 2NT1A 3M7SA 1YWXA 4WIWA 1MDLA 4L6OA 3F4NA 1XICA 2I5IA 1JLCB 5I3QA 4V15A 3V4MA 2LVWA 2AEFA 2DR7A 3BV8A 4RW9B 3B03A 1H1ZA 4O54A 3DOKB 1GMVA 4GKKF 1RVGA 1Q79A 2MZ1A 3IS4A 4I7VA 1TR0A 1MMDA 5KG1A 4EK2A 2VQFJ 1S0NA 4MPKA 1DWGM 4H9UA 2BY3A 4HCLA 4TN2A 5I3FA 2WQPA 1MEWA 2HNHA 4J3ZA 4QHRA 2XBPA 3APGA 3DXBA 3TZFA 5KG5A 2BV9A 4OQJA 1DWFM 5L38A 1S57A 1EGZA 1MDRA 1ADSA 4PCNA 1JLGB 3GR1A 4TKTA 1E4LA 2B9YA 2YGYA 4NG3A 5CHCB 4RU2A 2QDEA 4NRTA 1EIXA 3GP9A 2Q6BA 1TZ0A 1D0EA 2QF8A 4I6VA 3VCDA 1X39A 1E6NA 4GGHA 2FIUA 4LJMA 1GPFA 4ZIVA 4UB9A 2IPJA 4DUZF 2ZM6J 4DQPA 3KK2B 1J8VA 2VGFA 3WELA 2CJ9A 3R11A 3OJGA 3QMQA 1A6LA 2A85A 5D2YA 2ZE3A 2A3HA 3W1XA 2HWIA 3H7HB 1DQXA 2CWXA 3QO9B 3K8LA 3G1HA 1GVYA 1VPYA 2DZBA 3V1HA 4MKBA 5KZDA 3QJPA 2EEXA 3GAYA 3WJYA 1TB3A 4YXGA 3O2IA 4XD3A 4TMBA 4URIA 4O14A 5BU6A 4TY9A 4HVZA 1QI3A 3PZQA 3WMCA 1OGGA 2Q79A 3B97A 4CKQA 4EKJA 3SQSA 2TYSA 1UJ4A 1B9BA 3W53A 4F40A 3A9BA 2OIHA 2HNYB 2WMGA 4LR7A 4UQAA 4JI2J 1LG1A 3SSJA 3NQGA 2QCEA 1VP5A 4IPNB 4EXBA 1SR9A 2M8HA 3CAVA 4KCVA 4F3QA 4DLEA 4O3SA 2R8KA 4ZE4A 2W2OP 1XM3A 3G6VA 2EW9A 1VYAA 2QHAA 3EE3A 3K4DA 4W8AA 2XGPA 4LYQA 3MPDA 1HNXJ 2OFJA 2CLIA 2VRJA 3A5FA 4GMKA 3WLHA 3WQGA 1AA1B 3OR2B 3G6YA 3LGGA 3CDWA 3SRHA 3OTOJ 4NOHA 4GKJF 5GQBA 4F0MA 1FNXH 2B4OA 3LW5C 2GOKA 2IMOA 4CDIA 1R3VA 3JSRA 3ISND 3PZTA 1JLEA 3T5JA 3UDEA 2C2EA 2QJMA 4NCBA 2G9OA 3OUYA 1TL4A 4GC4A 1T40A 1GH8A 4JBRA 3VM7A 2Z0GA 3GONA 5F7UA 2CPEA 5M03A 1X5OA 1XLGA 5DQPA 2F63A 1WC1A 1JZ4A 3EMCA 1DJWA 3NCOA 1LJYA 2VCCA 3KRUA 1JJHA 4G6CA 4WGHA 4DV5F 1FP8A 4LXFA 5GADU 2XIBA 3RR7A 3V6HA 3EPNA 5D0RA 1UFKA 1JR1A 1EWEA 3FBCA 1JJ2R 4HIBA 4C8YA 1V93A 3B4UA 2BSLA 2VODA 4JQAA 3TKFA 3AB4B 4YL2A 4RUHA 3EWDA 2QL9B 4P10A 5DELA 3UG4A 5K2ZA 3PYFA 4PCSA 5HNRA 4J37A 2DIEA 1H0HB 2E66A 3AXXA 3T41A 1N8FA 3TJ8A 3PVXA 1TAUA 3ITYA 4J3TA 1EC8A 1EHNA 4QCFA 4V28A 4QIWD 4FYDA 4PMXA 1P1LA 4GIAA 2HHSA 1X5PA 4MT1A 2VL1A 2VD9A 4JTQA 4IH5A 3VDAA 4KPYA 2NX3A 1TWSA 1A3WA 4JBCA 1S49A 2Y24A 4AMCA 2LCWA 4Z2XA 4HA3A 4ES2A 1TPH1 4E8UA 1FDDA 3VIGA 1KWMA 2ACYA 3B05A 2RJGA 4EIVA 2ROGA 3DFHA 3QYSA 3VAIA 1V5VA 3QMTA 3K17A 2WJZA 1FDBA 4JTCA 3SCVA 4NMXA 1WORA 3UG5A 1OEPA 1O12A 2RS2A 1WWHA 2YWGA 4L3KA 4QWDA 1RT2B 2Y2WA 2OYMA 1LYXA 4RNJA 5K9FA 2VJUA 3I3BA 3DU0A 3WQFA 4AVOA 1H62A 1B99A 3MURP 4QISA 4TVUA 1OD0A 3W7JA 4U8VA 3GNPA 5KT2A 1M5OC 1XUZA 3AIQA 3I7QA 3PR2A 1Q0NA 5KT4A 5AYYA 4ATWA 3B78A 4NZ3A 4WKYA 1HIYA 3M47A 3SGGA 2E6FA 4X62F 5I23A 3DG6A 4YY3J 5C54A 1UEVA 4EYIB 2UVUA 3C15A 4CNOA 2XH4A 2BVTA 5LXEA 2LDYA 5IV4A 1GGOA 1OG0A 1B4EA 3GU2A 2IY5B 2O0TA 1SJDA 4S0MA 1QAIA 3O6CA 3S1VA 4B3RF 1NWUA 1DIEA 1F6YA 1LTDA 1QW7A 2QIFA 3OL9A 1EARA 1QTNB 1ROFA 2W0UA 3SSZA 3GB6A 1ODZA 3NQCA 1EOKA 2J7DA 5B0EA 3RB0A 4J9NA 4OECA 1RT3B 1C92A 2YCLA 3GZ7A 4DU7A 1CTNA 1KLYA 4DXKA 4TO8A 1I2PA 2MKKA 1C1BA 1WKYA 3CTLA 4IDKB 1SW0A 1IIHA 4LVAA 3W1MA 4LAOA 1EP4B 4DR4F 2Y8UA 4WSKA 4OZ0A 3DCAA 4UBPC 1E9ZB 4USIA 2LYVA 3P5ZA 1BWKA 4J40A 2WZMA 3JZEA 5HROB 1HIZA 4LOCA 1E6RA 4DXLA 3T8LA 3DC2A 4GFIA 2FVCA 4MUPA 3TC7A 3HZ3A 4U2YA 3BV7A 3BBCA 4MB5A 4WFNQ 4XBKA 1HNZJ 2CXEA 1R2SA 1AH3A 1UUQA 4Z0SA 1HQUA 1GW1A 2ZE0A 4ZHRA 4BF5A 1XHGA 2BS9A 3ILIA 3GYEA 2BDPA 2VVSA 2EPOA 4OHQA 3QRRA 1VS1A 5B7ZA 2BDQA 3GTYX 4J2PA 2F6XA 1L8PA 2GJ2A 3IN5A 3LWMA 4HCDA 4X66F 1CGXA 1FWAC 1EHWA 1JLFB 2CQGA 2Z27A 3NDOA 5CCLA 1WB0A 4LR9A 1GQNA 5EMMA 3MSGA 2ZKUA 4H4OB 3GHRA 4JOUA 2QLYA 4CO2A 3CQHA 1XLLA 3D6NA 4W84A 3JQMA 4HVXA 4N9CA 4LBPA 4E8DA 1RKJA 1Q63A 3AWNA 5HULA 1C9WA 3MEGB 1CQMA 4RBTA 3H7VA 4KBIA 2AEMA 2TPSA 3LNMA 1HWLA 4NL5A 1ZCOA 1C7TA 3FXGA 1GHRA 4GMEA 2CKWA 3MO4A 4DR3J 5AFDA 1Z48A 2QCDB 5FKYA 2MY7A 2ZEJA 2FTRA 4WRHA 3VOGA 4M24A 4O15A 2XDFA 2H5EA 2WWCA 2CQ2A 1PC5A 1WOSA 4LFYA 1J0HA 4P6QA 4ZITA 2PC4A 1LBMA 1JXJA 1FCBA 1H6KX 1PG5B 1N5YB 3CSKA 3MMCA 2BOFX 4Q4MA 3W1AA 1HT6A 3L0NA 3KL0A 3RX2A 1LK7A 4QU6A 3B9OA 5LT5A 5C25A 5IFPA 4AMAA 2VL4A 4Y9MA 5KG4A 1TPWA 1HVXA 1TVRA 2PLJA 5E9XA 4EZ6A 2HV5A 4WYWA 1U7LA 5BOFA 3L0KA 5L39A 4MF4A 1R85A 3OQ8A 2ZOMA 2XIMA 1OY6A 1BG4A 3CDAA 2K7KA 5DGBA 3IAS9 1YITS 1XYZA 3ARYA 3RGIA 3M7WA 4OBSA 1IQ8A 1XN9A 4LUIA 3QLHB 1O94A 4ELUA 2QCHA 2J8GA 3TN4A 1E4MM 3ARRA 4Y3CA 2FVKA 3QOMA 2XS2A 4ZZ9A 5C2CA 1QO2A 2VR4A 1MNEA 4K8EA 5BYWA 4C48A 3NNHA 3AALA 4ID5B 1PYFA 5HOSA 3OJSA 1XQIA 1VPXA 1NDLA 3TJ4A 4OI6A 4FX8A 4B9MA 1H3GA 1CJTB 3VKKA 3WEMA 1KRMA 2CBVA 3B8DA 2OYLA 3ETMA 2IC3B 3WLKX 1KXVA 3GXMA 4GQRA 1I1WA 4PAAA 4C1NB 3EPGA 2YB1A 2YDRA 3QFWA 3H23A 3QR0A 2JC1A 3PW4A 4GE8A 1SZRA 1US3A 5LNSA 1S2WA 3LRKA 1F2GA 1OBAA 1W9XA 5ETKA 5B0CA 4EPEC 5AVHA 2HBRB 3SCKE 1TPB1 2FHBA 1AL8A 3NYZA 2OWXA 2MY8A 3D3BJ 3WLOA 1UWSA 3VALA 3U0HA 1LW2A 4ANDA 4R5EA 3Q8PB 1RWXB 3V6DB 4MAVA 2PFFB 4CEXC 1DBTA 1WF2A 3I7RA 3VAGA 4R33A 3GO2A 1SZFA 2F9RA 2Z2ZA 1LFWA 1GYLA 3E0FA 3GQYA 1Z1ZA 2CNLB 2WVCA 4IP4A 1GOKA 3WLIA 1W1VA 5JUMA 3M05A 1KA9F 3KTQA 3TW6A 3GDTA 4HI2A 3T09A 4JFWA 3AS0A 4CD8A 4A05A 4JI5F 3WDQA 1AQFA 4F4ZA 2OUGA 4GVBB 4DVOA 3WF0A 3C6UA 4IRKA 3UR2A 1ULRA 1J5EF 3F56A 2YKMA 2DNPA 3KMSA 4ER8A 1HYSB 2IA6A 4GBDA 2C0HA 3WK0A 1X31C 2ZX6A 1RHRB 3IV3A 2H1YA 2KKHA 1EXBA 4UNIA 2PCQA 1TL1A 3ZFVA 1FDYA 5IT9Y 2LXUA 1TZZA 3C52A 1DQUA 1M65A 2RSQA 4GZIA 3CXCR 4D1JA 5M5DA 4GABA 4OHWA 4A2SA 1XLBA 1L3SA 1UA3A 2QUMA 4HYWA 2VICA 2WNNA 1TYGA 1Z3NA 1WHXA 3BCFA 1QASA 5E33A 4X64J 2EQDA 1S6QA 2V9WA 5EDWA 1XXXA 2N4CA 2ACRA 6REQB 5F8HA 3M6YA 3LP2A 1WDRA 5SWUA 1Y65A 3UN5A 3J81Y 2XIOA 2FB3A 2VO5A 1P0BA 2PDNA 3DXIA 2B0MA 3MT1A 2E7VA 3IGVA 2NXEA 4XIMA 3D0GE 4YQWA 3P93A 2KN4A 1DTQA 3FJ6A 1ICEB 1QVBA 3FSXA 4UZCA 1S9EB 3WNOA 4Q8QA 1YLVA 1E0WA 4PB5A 2D23A 1CSJA 1I3OB 4RJEA 4PXDA 2COLA 4DCJB 4B9VA 4MMWA 3A3WA 4GI8A 3KG4A 3BLLA 1I2OA 2QA2A 3CO9A 3H5UA 3VUSA 2B0GA 3VKAA 1T05A 4I3GA 2C2MB 1UKSA 3G6LA 3R58A 2OQLA 4MSSA 2TMDA 4UC5A 4QZVB 3B8SA 3UDCA 4NAEA 2LU2A 4PC8A 4W5UA 4KGJA 1DE5A 2ZA1A 2BKOA 4DZHA 1RT4B 4G1IA 3ARVA 3IAPA 1SIZA 3KBWA 3ORWA 2Y1HA 3K8MA 3ZO9A 3R43A 1DTTB 1QAYA 2WVDA 5I3JA 1OD8A 3FSUA 5AN7A 4ANCA 1GOOA 3CS2A 3L2IA 2QO3A 2OEKA 3NGUA 4TU8A 5HP1B 5CC5A 2R2RA 1GK8A 1UD8A 3Q8YA 3TYUA 4PPDA 4LC6A 2RHSB 2HYIB 3K2GA 3M0IA 5BRPA 2PDXA 1RAJA 2J6SA 3BLKA 3LTOA 2INZA 1TKTB 1ZH5A 4IJCA 1T9UA 1ITCA 4LT6A 1C2PA 1IEXA 3G4SS 4NZ5A 4A6GA 3GHSA 3Q86A 1RU2A 1XNQF 3SR7A 2WQDA 1IWGA 2WXDM 3LS9A 2BY0A 2R14A 2O67A 1FHVA 4RNFA 2Z58B 1R3TA 3MEEB 1IEVA 4PUJA 2RDUA 4JYAF 4OOUA 1FKAF 1BSLA 1EWDA 2PMQA 1EKOA 1G4PA 4WKHA 3NFUA 2HRUA 4Q8UA 4N0RA 3DYAB 1ISXA 3U4AA 2C22A 2E9MA 5CPTA 5FJIA 5AYBA 1I5OB 2XYHB 3WIJA 5FLXU 4JV1A 3GDBA 1PZ0A 3BH4A 3VMNA 2QAFA 2XVNA 2HZVA 2NXUA 1J5OA 1CXEA 5DT5A 1Q2SA 4AWSA 1PL9A 4FXJA 5AZ1A 2J8FA 3GG7A 3PANA 4GQ0A 3CNYA 9ATCB 1HARA 3D67A 5EMUA 3DHFA 2OGJA 3LUYA 4JI1J 1A49A 3V18A 1PKLA 2R7UA 4H6KA 2P6TA 3H4WA 5AJ3F 3W87A 3NPVA 1RWPB 4WKAA 2CNKB 2M9KA 5LXRA 4IIDA 3W2NA 1IKYA 4EU0A 5GAGU 2UUBF 1B1YA 3CO4A 1AH4A 1JCNA 5CYMB 3NQ2A 3LCXA 3HULA 2W7AA 3NLCA 4B3LA 4GK8A 4DV7F 2GGGA 1B0TA 4WCEQ 4OFCA 2QYGA 2OJ3A 1SIWB 1S5ZA 3MB9A 1PDYA 2ZH4A 1CNVA 2GPTA 3MR7A 3S8SA 4D8AA 2E9RX 3TYAA 1J5TA 2WTFA 1NARA 1IZKA 3CDBA 1HN1A 2PD5A 4MYTA 5E1QA 4QFUA 4F50A 3K4AA 3CJSA 1PTGA 5LZLA 3OJUA 4FR6A 3LB0A 2W9BA 4RW4A 5D8HB 3SCPA 1HKJA 4RV3A 1MSWD 5A6AA 1RK6A 4RDWA 1PYMA 1HNVB 3BSHA 1XEZA 3FEZA 2QCFA 3IJLA 2QE5A 2QJIA 3K0JA 3FQLA 4PCFA 4HDGA 4TQTA 1VD6A 4B15A 4F4RA 3PJUA 3RAQA 2MLXA 3D6TB 1FRIA 3I9ZA 5G0RA 3D0HE 4E8GA 3MM8A 2WRMA 3BZGA 2O9TA 3T55A 2YWHA 2GDQA 3HG4A 5LGXA 4D72A 3U27A 3TJAA 3EGNA 4DF0A 2VGBA 4OYOA 4TYBA 1TKKA 5EMLA 1WX0A 3LHWA 4WX2A 3QRHA 3QY7A 5FAJA 2EXOA 1FRKA 4FKXA 3U2ZA 1OO0B 4OX9J 5EY5A 5K5MA 3UQNA 2DNRA 4GO5X 4HZ8A 4WZQA 5U7SA 4JYDA 3TA6A 1PCWA 4BKNA 3UFCX 3TR2A 1WXJA 2DT2A 3MYPA 1FP9A 3LD5A 3TSDA 4RX0A 1FCVA 2XWDA 4R34A 1LWEB 4YOEA 4JN6A 4B3TJ 2O4QA 4POCA 3CJ0A 5K9DA 2MQMA 3OIHA 4I4BA 2WVVB 2F84A 3AIWA 2ZUUA 5AVNA 2CLMA 2V8ZA 3F2BA 2X1AA 4AQYF 2D22A 2AYBA 3PN8A 2N3OA 1OYDA 1NHKL 2DH3A 4A47A 2QULA 2B5JB 5A8KB 3QKZA 1HBMB 4LF4F 3FNNA 2GAHC 3BQ1A 3U1NA 4B9LA 2CQ0A 1JWWA 4FN5A 4LVGA 1HL6A 4DUXA 4K7QA 3TC6A 2E40A 3GQCA 1ZA1B 3OB8A 2VEIA 4OZ3A 4L9XA 4RK8A 1DE6A 4C6MA 1FT8A 2V5BA 4YFUA 1EJWC 1TV2A 3LGEA 3CGIA 4UOFA 5LIYX 3DI0A 4NLGA 1XBVA 2BM1A 5HMSA 5BXTA 1JXVA 4JL1A 4IXXA 3NKYA 4HTIA 2A3AA 1TV5A 4CLPA 5LMUF 2PE4A 3BKTA 1Q81T 4OZOA 3QY6A 1IQTA 2ZBRA 3RF9A 3KZSA 2W8LA 3CPWR 3LGHA 5KFFA 2BRKA 1U1MA 3M8QB 3JS9A 2QXWA 1SO6A 2QLFB 2YFOA 3OVAA 3S2MA 4QITA 3P6LA 4PR6A 1RAHB 1UKQA 2KZMA 3HVTA 1WNOA 4RZ5A 5IWAF 4M5HA 2IAJA 4BC7A 2IQ0A 3WC0A 4PTNA 3CYVA 4PQUB 2NR0A 4K4XA 3URQA 3DI6A 2RD5C 3WJSA 2VV5A 3CMFA 1S76D 1OYEA 1QRQA 3GDLA 4HTBA 3PHAA 1MW0A 4OYPA 4A8KA 4KKOA 1KR4A 2ZZ3A 3VNYA 4C6EA 3AXKA 4FNSA 3CULA 4M5KA 4AHQA 1J0ZA 2ZFAA 4DPOA 2ZXBA 1KRCC 2OKTA 3WUGA 3HQPA 3HSZA 1LLZA 4C7GA 4HCHA 2MUCA 3RBEA 3PEJA 1MQPA 3UXDA 5IQ6A 4HA1A 2YCKX 3NURA 2BE2B 3JSMA 1L2QA 1EO5A 3K7RA 5LMNF 4JTIA 4CLLA 2ZOGA 1MLAA 1X5TA 1WXYA 4LGXA 5KSWA 3ISZA 2BX7A 3TTYA 3K2YA 1DJNA 3FKRA 3O7UA 4ZK7M 1J2VA 4IUGA 3VGTA 1KCLA 1QNPA 3DU6A 1PBAA 4NXKA 1ELOA 2JX2A 1W1A1 3ARPA 4B5SA 2Z7KA 1RLDA 2BXVA 3C2PA 5CCMA 1HBUA 3BYPA 3RW7A 1QHOA 4K38A 1OIMA 3RX4A 3UJRA 4GBUA 3WNMA 4ERAA 4C8LA 1PV8A 1SC1B 2H3DA 1JPKA 1O68A 2RB7A 4DJFD 5J04A 1Z6KA 3SI9A 5HQ8A 3T81A 3QAUA 4J9OA 1N36F 2FB2A 4WLCA 1OFOA 3B9DA 3QGPA 2VRKA 1DJYA 1M3UA 2VU5A 2WAGA 5ADZA 1B90A 5B7YA 1OFRA 1YTEA 2JKPA 3FS2A 1Q5MA 4HJFA 1G4CA 5JU6A 4IFKB 1LK5A 3ECQA 3GNDA 2HIYA 4PB3A 4Y0FA 3RM4A 1DIKA 1UETA 4UY8T 4ATDA 1XF0A 3AIUA 2REQA 3S6TA 1EB3A 1RTDB 1JYWA 3UW6A 2I2YA 1IJEB 3DFYA 4I64A 2CQIA 3WH8A 3DGPB 1E6ZA 4ANEA 2C2ZB 1A5AA 2RRAA 2QTWA 2RU9A 4C4WA 2MLYA 2G95A 4AZCB 5C55A 3LA0A 2Y62A 3GYCA 4DYJA 4YS2A 1KKRA 2AX1A 1PBUA 2D3ZA 1YI2S 4OI3A 4FO4A 1HD1A 3TRGA 5B7WA 2HDJA 1X1ZA 1NRKA 3BMXA 1A5MC 5J2QA 5FF0A 2GUBA 2D74B 2HFZA 3LTPA 4U9RA 1VBXA 3NGKA 4K37A 3DHPA 3PRDA 2QL7B 2UV8G 5HWNA 2DNOA 4Q2LA 3UD5A 3Q89A 5FJJA 3PBMA 1C29A 3VYLA 4P7OA 1U33A 4HN8A 2WHLA 4Y28C 3GR4A 4C6NA 1N55A 3CASA 4BJHA 4GNKB 4IGHA 2MDAA 4X4SA 4XD6A 4UMBA 3CZJA 5J1PA 4NCAA 2IDEA 4WEVX 3HQOA 1B57A 4NLQA 2R7XA 3N6HA 2DISA 4DL2A 2EO7A 3I5AA 2HHHJ 2CDQA 2J78A 1S46A 3W6MA 5AC5A 2VKRA 1RABB 5F0WA 4KRZA 1Q6EA 1RWOB 2VZUA 3DFSA 2J47A 5LA1A 1TL7B 3D6FB 3T9PA 4BWLC 1HMVA 2FD2A 2MSTA 2YNFB 1AFJA 4WBFA 2W7PA 2CPIA 2E3ZA 3RJYA 3M6XA 4GLEA 3BSCA 1SUQB 3EDDA 3QPIA 5A5WA 3B8UA 4IR1A 1ZS2A 3VKCA 2JK2A 3HSDA 2GYIA 3BOLA 1FXRA 1W1IE 2VELA 1EAYC 1W26A 4UCFA 3TUJC 1W37A 1X9SA 3WK1A 2VZ9A 3G1YA 4XWUA 1CQNA 3ISNC 3W2KA 3WQ5A 4LR8A 5J2PA 2D2OA 3BGJA 3S1TA 3U1MA 3CXOA 3C46A 2XNQA 3DFNA 3SEOA 2KM8C 4L4LA 3H7UA 4NXNF 1V3ZA 5IFMA 3B06A 1OCQA 2GVZB 3WG6A 1WO2A 2HZGA 3NO5A 4KCUA 3FMWA 4L73A 4M94A 3DDNA 2PRLA 1H41A 4B9NA 4XZIA 3ZT6A 4CLTA 3IBCB 4P71A 1VH7A 1DQWA 1GVRA 1ZALA 4XTIA 5A6BD 2VB6A 2VG7B 1I45A 3LLXA 3IARA 1KD1T 4PTWA 2CHRA 3KK3A 2XMWA 1KRAC 1PYTA 2XMVA 2ISWA 3W7NA 4GISA 4Z2IA 1L8NA 4F8XA 1OWXA 4ZVHA 1KQZA 2PWDA 4GKLA 2DNZA 1LQAA 3TZWA 2KB2A 1AL7A 3HVAA 3HXMA 3M4HA 2V2CA 4HPJA 3W84A 4NYOA 3C8NA 1ZP3A 1RISA 1GXUA 3IGNA 4ZVJA 4AWUA 5I5RA 3TTOA 3KAOA 5C71A 4CQCA 1XLAA 2PP1A 1XH1A 1SFSA 3N17A 2PTXA 2J24A 3W38A 5DFAA 2KH9A 3R3TA 4GUFA 3BH6B 2PDLA 1NZ8A 1TQLA 5DZ6A 4JL2A 2HPIA 5CBBA 4GY7A 4LNYA 2GQ8A 4GPNA 2UUTA 4DPWA 3Q4DA 1B64A 1WEXA 4HKPA 5D04C 5AYIA 3IBWA 4C60A 1P6TA 3TROA 2YL8A 1P0EA 4GX9A 2ISSA 3AXHA 3O16A 4PUKA 4GC3A 1KXHA 1X7FA 4Z1AA 1LZOA 1JGMA 2PS2A 1QVGR 3A47A 4HZMA 2O55A 3MI2A 2O92A 4CLKA 1TRDA 3CIMA 4JI6J 1N33F 1ZP4A 2P3EA 3SCUA 4DZ6A 2Q01A 2I7GA 2RGLA 2PEBA 1CJKB 1VFHA 2JEIA 4Q8PA 4EXQA 4ECRA 2KJWA 1GOMA 1CC7A 2K2PA 2GGHA 5A8RB 1Y5IB 3NS7B 1FF2A 3GB0A 1JJCB 3G8EA 1Q7MA 2Z6IA 1NK8A 3AHVA 1YBAA 1Z2LA 3TR5A 4FSAA 2VH7A 4Y34A 1WAWA 2MKIA 4WOZA 4LIRA 3BJFA 4HA0A 1RAEB 3CAWA 1FKOA 1PUDA 5I3HA 2OT0A 3IIXA 2Z2UA 4ZB0A 2DNHA 3NG8A 5MLCV 3PY2A 5K14B 4W4QA 2F6KA 2DEJA 1ODUA 3MKKA 4LS2A 1KRBC 4XAFA 1CPZA 2BRLA 2VR5A 1DWJM 3MM9A 5AE3A 1OCNA 4X4PA 4J90A 2HBXA 1VLWA 3AU2A 3FFIA 3TVZA 3VF0B 3RG6A 1OADA 3ID7A 5J1NA 3A8KA 3TZNA 2AWZA 4A8OA 4K8GA 4PMJA 4QJ1A 2QUVA 3QT6A 1XQKA 3J81j 3E12A 3C0SA 2VG6A 4KFBA 2E5BA 3H26A 3MVTA 2ZKMX 3RU0A 4DUTA 1OB0A 1X4AA 3IM8A 2ON3A 1APSA 3SB0A 5B08A 1F07A 3H4GA 5KMYA 1X8CA 1YPIA 3SCWA 4C6QA 3M1VA 5CJMA 3TTEA 3RUBL 5HK4A 1LXJA 4FI4A 1JLEB 1TUXA 3FRZA 1X8FA 4HHHA 3R5CA 4MFBB 4F7VA 3MQTA 2HMCA 3UGRA 2Z56B 4LF8J 3HF3A 4S3AA 2RHGA 1H1NA 2YXXA 2DR5A 3C4UA 1FWJC 2PWEA 2FJEB 5TQLA 3U9IA 4M8LA 3N5FA 4O1FA 1J2BA 4PTXA 4X4RA 2Y8VA 5AOUA 1TUWA 3KUGA 4MB3A 4HOWA 3CJ8A 3CZLA 4L75A 3DEQA 5BYRA 1Q78A 4ZIWA 4YTUA 2CJYB 4LVDA 4AEEA 1XLFA 4F48A 4PH6A 2DEPA 4CM2A 3UVAA 1ZBCA 3QZEA 1OFBA 1ESWA 3BR9A 3VOFA 5EUHA 2HVMA 2P50A 1C8YA 4W7VA 4NWBA 5G1MA 2FVQA 4JICA 3M2UB 3HQ1A 3D1HA 3PBYA 1C90A 3DLGA 5FD1A 2VOPA 1E70M 3W2MA 4L74A 5LOQA 4D6FA 4RW6B 3I10A 3UY7A 3ZTRA 2XH0A 4O17A 2J7EA 1TWWA 2C1HA 3WQOA 4B08A 2B4UA 1S3HA 2FJBB 1TJ1A 4FLSA 5HUOA 3WNPA 2FVMA 5KT6A 4C98A 2GK1B 5D37A 2ZD1A 5L1JA 5KFSA 1TKXA 2N3LA 1KGUA 5FSEC 2OLWA 3U02A 4YYFA 1TX2A 2GDVA 2GX8A 3Q94A 5DF0A 1Q8JA 2CZDA 2XN1A 3W88A 4DUOA 5BZAA 4OMFG 4USKA 1WC5A 3AHZA 4ZOSA 3N18A 4H4KC 2ZUAA 3FCPA 1P1XA 3B4DA 3EA2A 2NPIA 1VBZA 2UXDF 3OG3A 2OTJS 2YKNA 3C8FA 5E5NA 1HVQA 4WOQA 4LEFA 3GC2A 1QDUB 2BLEA 2WYSA 1Z69A 4OYIA 3H2VE 2Y4SA 2HS6A 1RY8A 1A3HA 1U83A 4IL2A 4P7QA 5KG7A 1R46A 4PUEA 2NSBA 3PO4A 3G18A 4NP7A 4A3HA 5T14A 3BAKA 2V4RA 1FWDC 1R0MA 1NK6A 4IICA 3C15B 4OI4A 1XDMA 1XLMA 3W2VA 1QK0A 3HGRA 4KMQA 4TY8A 1WQ5A 1U1JA 1EQMA 3MPUB 1IKXA 1G4SA 2M2BA 3QGHA 5ECUA 2RDWA 5K9CA 1KFKA 3QN3A 1WV2A 1W3IA 4QYZJ 4Y9PA 3VCCA 4UFMA 3QR3A 2C3UA 2IMWP 1EJRC 4CNZA 1NJWA 3HFYA 1HFBA 1XKJA 2J7GA 3GVWA 5AXLA 5EGRA 1ISZA 4W5ZA 1EP2A 1R0AA 3HN3A 2ZZ4A 4GVFA 3TYDA 3HVWA 1KEKA 4PTMA 1C1BB 4FYYB 3QXBA 2Z28A 4S3EA 3GDRA 2PDUA 3IS9A 3JYTA 1UWTA 4H9VA 2FPVA 3T07A 3B54A 2HCVA 4A3YA 2P8CA 3ITHA 3LAKA 2GA7A 3O06A 1IXQA 4O4GA 1GMUA 4GVGA 4YJ5A 4RXFA 2K7JA 2KVIA 4DEZA 1TFYA 4L76A 4CD4A 4LSLB 4WWSA 1KTVA 4QYZK 3MZIA 2R42A 1DJHA 1LF1A 2NX1A 1X4HA 1DY3A 2W27A 4I2PB 4IPLA 2J7UA 2RRNA 2BFGA 4MH8A 4PFMA 1WKFA 2VONA 2VBWA 1IEIA 2XFRA 1TPEA 3M32B 2YDSA 1UR9A 4C6OA 3K5NA 1RT6A 2FHJA 1TTHB 4J27A 2OJPA 2V5CA 2NQHA 2UV8A 2UUBJ 2C2RA 3AHPA 2R2UA 1EA9C 2CIPA 5CPMA 1WKKA 4DX6A 3GBEA 4DV7J 2ZX5A 3G0XA 2XLJA 2KDOA 5HMZA 4KR0B 2HVIA 3DLHA 4F4KA 1DJZA 4IOCQ 4FNPA 3P6YC 3Q65A 4UOJA 1NSKL 3DUGA 5BYQA 2AYEA 1Q8LA 3GYXB 3MOJB 1BEUA 3W85A 1GAOA 1Q95G 1TRIA 3M0JA 3TX8A 2B7OA 1I2NA 3LANA 1QT1A 2HSAA 1Q4RA 4MG4A 2EPNA 3OV7A 3AROA 3VIIA 4JHMA 2LQ5A 1M90T 2XTKA 1KO0A 3OBEA 4H4MA 3G0SA 3S46A 3MMCB 1LL6A 2MKJA 2OZ3A 3CPRA 4JKLA 2QUUA 2EG6A 3KOXA 3U3HA 3BH7B 4BDPA 5C25B 4B2DD 1CJUA 1A5UA 5G1TA 5EX3A 1UZHA 2PDQA 4MGGA 3NPUA 3GXDA 4DV4F 2WK2A 2X2YA 2GVEA 4OBTA 4Q7AA 2Z1KA 4AZ5A 1T9TA 4WTOB 3IRXA 4DDFA 4GJJA 1U25A 2QC3A 2E09A 4KGZB 2OYKA 3AJ1A 1TV6A 4CNNA 3P45B 1QE1B 1XPYA 1ITXA 4O19A 4X4TA 4KWUA 4QG9A 4YHGA 5JBDA 4UTUA 5CZVA 3GLJA 3WD1A 4I2QA 1IZJA 3MMWA 4CIOA 1FBAA 1B3WA 2ZBCA 4MJKA 3PZOA 3CH9A 4ZP8A 3P81A 4O3QA 2PRMA 3ENAA 1RJJA 3BSGA 4C7QA 2GAGC 1YE6A 2IA0A 3W7RA 4H3DA 3V81A 4GGBA 4LF4J 4LRSA 1S4FA 4QIFA 1SI9A 2CQPA 1D9DA 1NSJA 3UO0A 2DSKA 3ICJA 2QGFB 1EXPA 3KOYA 2BGNE 1V4YA 2V3FA 1HD0A 2P6SA 3BS9A 3WQCA 5KFIA 2BR0A 2XJ7A 4RE4A 3PSWA 1FFGB 4DBSA 3LGNA 1S7IA 3PTMA 3L7UA 2DSVA 2WV8A 1ZM9A 1HI1A 2A3JA 3P96A 1F9FA 2EPKX 3IVUA 3W2WB 3U57A 5F2LA 1FK9A 3G3MA 4B5XA 3KUHA 1D3CA 5CPOA 1LW2B 3RYSA 1EC7A 2QMUB 1UHVA 5D0EA 2YFNA 3DLBA 3S9YA 3W1UA 3GIRA 3OW1A 3QQ1A 3EOLA 2J9DE 4LNCA 2VC1A 2NUXA 3WZ0E 1JLBA 1ZAWA 4XSMA 2J9YA 1NP2A 5IDIA 3FSTA 3RIKA 2Z2YB 4UTWC 4DBWA 3TXZA 3QAEA 2CPZA 3PVFA 3GU0A 3M2VA 4P2MA 1A0EA 3VGUA 3ANUA 3F2DA 4GVIA 4CLYA 2NXNA 4V33A 2WZEA 3NUKA 5AYXA 3DLKA 1XIQA 4FKYA 5FL1A 1FE0A 4V19X 3KP1A 2HVNA 1BC6A 3BLDA 3DOPA 1NO8A 5HWJA 5IWAJ 2WMIA 1VCTA 4RUCA 2YKMB 2BJEA 4GZEA 1O5QA 3L2LA 4HT3A 2FGOA 5A6WA 4LF7F 4RPFA 4MOZA 3GTFA 4B3MJ 5C9RA 4RXGA 1TL1B 4IQLA 3S42A 4ZOCA 4DR7F 3T44A 4C6IA 3D5HA 4JI8F 4LJ3A 5KFKA 1XLIA 1HXJA 1H0GA 2RDXA 5AHNA 1RT5B 1R8CA 6AT1B 2IJRA 4DN1A 1JDFA 1H4PA 4TUFA 1Z32X 4ILMA 2WSCC 2EKCA 1DFDA 3RDKA 3CCLS 1Q6FA 3PNUA 4ZVEA 1FVSA 4NLYA 2HVDA 4NY2A 1VDHA 4DPUA 3H90A 5C9ZA 4HHLA 1ZL1A 1KLZA 3CUFA 1J93A 2AEJA 2YKKA 2FVPA 4I56A 5IHRA 4MWAD 3ANYA 3OLAA 2RAGA 1CDGA 1NHVA 2A2CA 3HFKA 1S2CA 3QATA 4Q4SA 4GOAA 2J62A 3JAMU 2C0AA 1BKHA 3N4FA 4JQ2A 1T05B 3LBOA 3QWUA 3LU2A 3TW0A 1YSJA 1JF5A 1FJ7A 3AMDA 1K8ZA 5H9EJ 1S72S 4UUXA 2UWFA 3Q0AA 3MHUA 4AFFA 3EXTA 1OMSA 1UA7A 4LALA 3ZLFA 2AYMA 3W24A 3EGVA 4IG0A 3GIYA 3LNPA 1OT1A 1AZ2A 3WLRA 3M0YA 2EVZA 4QOTA 3NQDA 2ZC3A 1PX8A 1YTKA 3QHNA 4U28A 1JB0C 4Y2WA 1L6FA 3FCWA 1FD2A 2E1AA 1V02E 1UD6A 2B9XA 5KFCA 4PG6A 3R5JB 3LH2S 1VBUA 3J80Y 3IUHA 3QSIA 4KW2A 2W4DA 2VENA 5KFTA 4P7NA 3T8QA 1BUXA 3SI8A 4C0OC 5H9EK 3LEPA 1SW3A 1WG1A 1RCQA 3EX7B 4C8KA 2XS5A 2YJQA 2HHVA 1IR1A 1J5SA 3VAMA 4JTGA 3KCLA 3HP6A 1QSLA 1UJPA 1X38A 3U1LA 1Q7YT 3MMTA 4M1BA 1P9QC 3URNA 4ATLA 2NQ5A 2ZVRA 3HT0A 2H8XA 2PTYA 1WDTA 3CCQS 2PTDA 5D15A 2NSXA 2WONA 2W01A 3HI9A 4EBDA 3FJ4A 1IBKJ 1DJQA 1R9YA 1G7CB 2P2CB 3WNLA 3H2EA 3G24A 4JV0A 3UEQA 1WZAA 4ECUA 2ASHA 3D3CJ 4WU2A 4FLQA 2X7WA 3SCRA 1RAOA 2A6OA 3CH0A 2FJXA 3NRBA 1E51A 3UN2A 4HTYA 5C0QA 4GH3A 3V36A 3TAPA 3AMCA 3W37A 1I0BA 4F0KA 1EOMA 2XMJA 2BV3A 1V6XA 1KC7A 5FEXA 4HT7A 1UB3A 3EXYA 2VX6A 1F8IA 3WL1A 1J5OB 1XW8A 4QP0A 2J88A 4I6KA 1LNQA 4YVPA 1OYAA 4CWBA 3IC1A 1YGYA 4MIMA 1JJKA 3W07A 2OKOA 2PZNA 3PFRA 4RE3A 4HPNA 2ZUWA 4TIMA 2UUAF 4ICCX 2QPSA 3CWHA 3LHTA 1O7AA 2NX9A 5HI7A 2NQ9A 1XC4A 2IM2A 4CP5A 2RUGA 4IOTA 1P8GA 3HHLC 1IKYB 4CO1A 1TV3A 3ABQA 1PYOB 3LG3A 4XZBA 2IRYA 4O3NA 2Y5JA 1XIIA 2P3ZA 4HBKA 3T08A 2JHEA 4C3KA 1RR2A 1XC9A 4P7VA 2E1MC 2E6AA 4LUSB 2QF7A 3MSDA 5E3AA 4Q7NA 4V1XA 2OLHA 5H9FJ 1FH9A 3STEA 4KWWA 4WK1A 1T8EA 3PTDA 4P7TA 2E4TA 4QPXA 1C7SA 3O9NA 4JY9A 4ZB5A 2XG8A 2BJ3A 1PO9A 2NS1B 3RTVA 1U5JA 1US2A 4JN7A 2W9BB 1M9HA 3QFHA 2PWUA 1F6TA 3ITTA 4A8XA 1KC8T 4LUTB 3VD4A 2D2JA 3QPEA 1XWYA 3G2GA 4DV0F 1HKWA 1XV8A 5J2NA 4DUVA 3DOMB 1QFEA 2B9EA 1DHKA 1PO6A 2OG9A 1KGXA 1C0TA 4DAFA 5DDRC 1NFPA 3E1F1 1FEEA 3MM8B 1FWRA 5H9FK 4E2DA 4OWGA 2XPKA 2C71A 1N8WA 3U7BA 2IJNA 3AB2B 2CZEA 4GVLA 3EX2A 4UTKA 1OFPA 3CPGA 1QSYA 1V3KA 1ITPA 1KQGB 2W3ZA 1Y5WA 4RNIA 4G1KA 5KFBA 1T96A 2VC7A 4C3LA 4ECYA 2LQ9A 2XMAA 4I0WA 1WDQA 1L0PA 2EBNA 4FIQA 2GHWA 2NUYA 3TQ0A 4XD4A 3I4KA 2EPLX 4WJ8A 2A6LA 4XK8C 1YZ6A 4DJFC 2WHKA 4XAKA 4WKRA 5DQGA 2PF8A 4EZ9A 2XHWA 2VEFA 3ZT5A 2Y9HA 1G1XA 1ECQA 2OQHA 3OLDA 1ZAVA 2X0SA 4RZRA 3AXIA 2HTMA 2J8TA 4XIUA 5D4NA 4AZHA 3V5RA 3AQUA 3FEQA 1O8BA 3VD9A 3W7IA 1F3TA 2HURA 4KTQA 3R13A 3WC2A 2C16A 3UCZP 3OVQA 1Q53A 1DRZA 3G1XA 2B4VA 3C2EA 2P0IA 2XZTB 1WUUA 1KLMA 2Y1IA 1XLDA 1F73A 1H5YA 2A2IA 4XAYA 3D1QA 3EVWA 3NNCA 3U5YA 1RQHA 3SUUA 3BMVA 3S2LA 2QA4G 1EC9A 2VJVA 3FXYA 4H8UA 4X0NA 2ACSA 4MPQA 4N56A 4GQGA 1WOOA 3S2CA 4DJDC 3QT5A 1I94F 3QM3A 2W79A 3L66A 3KDNA 1PGZA 3PULA 3ONBA 2M8DB 1DWAM 2FQQB 4Q7BA 4DR5F 3RCYA 2L9WA 3FEXB 2D9PA 1Q6LA 1SL1A 4EP8C 4H7VA 4Q32A 2BTMA 4P73A 1YDLA 4PFHA 4ZJOA 1JXLA 2BYCA 2RDIA 4NRSA 4QQBA 1S3TC 1NF7A 3VQSA 5BR8J 3EX4A 4A8YA 4FS1A 3UG3A 4R27A 1NK9A 5A8WB 1TWDA 1NJYA 4BY3A 4RW9A 3PX6A 3H53A 3TN3A 4WFAQ 4LF2A 4FNHA 2Q43A 2ATMA 3R0KA 1KNWA 5D02A 2PZ0A 3C6TA 1S5NA 3GC5A 3WD4A 5DCEA 4ZEPA 3TUIC 3V4BA 3N2OA 4HMEA 1PDZA 2IAJB 2W4CA 5B0DA 3M8PA 1HHSA 4JIIX 1FJGF 4K2JA 4X4VA 3R94A 3L9CA 1JLGA 3B8TA 3SZ8A 3QHOA 4CH1A 3HGJA 4HMDA 3G1DA 3T6CA 2GWNA 2W2NP 1W25A 3VIKA 3IJQA 2F8MA 2NXCA 4ZBCA 2PTWA 3VKDA 2C91A 1TTJA 2BX6A 1RP9A 2WBGA 4E3TA 4PG7A 5TBOA 3W6YA 1Q82T 5T41A 2V8DA 4FP1A 3NMRA 3KP0A 1C4CA 2V8HA 2IKIA 4UQDA 3IJ6A 1E71M 3CCUS 1VEMA 3BANA 4MNKA 2EWHA 1F6KA 3WL0A 5DBTA 4L7ZA 3AA8A 4LF5J 2QJHA 2VASA 1R3QA 3QO9A 2PI4A 2I9EA 3N6MA 1PX3A 3QSRA 5CPNA 5JIWA 5M2FX 3R0DA 1RHQB 1KFWA 4Q0BB 1MXSA 4DZAA 1SSGA 3W7PA 2VWSA 3QF0A 5LHFA 3RM8A 2R6OA 2H48B 4G65A 1VLOA 1F05A 5CJ5A 2HFOA 5LNVA 2HNYA 4J9LA 1XIGA 5K9XA 4UWMA 2WCSA 1S38A 4GYPC 5DRIA 3RNDA 2V2HA 4HK7A 4DV2J 1JD9A 3CWJA 2VT0A 2E5HA 5L46A 1KFBA 1HBUB 2WAQD 1WC6A 2GO8A 2RHQB 4HKQA 2QPXA 4YU1A 1G6CA 2O1PA 6A3HA 1EBHA 2ZZ1A 5DXXA 3RR1A 3VNLA 1UKUA 1QVFR 2ZZ2A 8TIMA 3RLGA 1V6HA 4AVNA 2Q02A 2B8PA 4M5JA 3MSYA 3CHDA 4OZLA 2ZUGA 5M2UA 1TR1A 3AD8C 3H54A 3SRKA 3QIDA 5IBXC 2WSPA 2CG4A 3MM5A 1GQIA 4GG9A 4OYWA 3W86A 2ZXAA 4I6YA 4H54A 1RHMB 4CM0A 1FH8A 4P75A 3TW9A 4OT7A 4ILSA 5ABTA 3AIEA 4ZVPB 4KPCA 2QFJA 2REQB 1ML1A 2W9MA 3FVYA 3EXSA 1D1UA 4QX4A 4B5WA 1T95A 3UD3P 4Z1YA 5T26A 5A8NA 3MM7A 2Q6CA 2NWRA 4H6RA 4Q6JA 2ALRA 3R8GA 1X4GA 3WUEA 3T4WA 1B54A 4O1AA 4JI4J 3JQKA 4DNMA 3WUBA 2MJUA 1WAUA 3UWWA 3GR0A 1YG0A 1XFBA 2VC6A 2LQBA 2VX5A 3CUHA 3GXFA 3WLSA 4A8QA 4JTDA 2VFVA 3A64A 1K7EA 3NOYA 4OKDA 2RDDA 2WVTA 3ZC4A 5K8PA 3J80U 2DQWA 1UWBA 4NASA 1QNQA 1XR7A 3VIFA 5C2GA 2HS3A 4C1LA 4Z2GA 3VZZA 3VTIA 3F4WA 4E0DA 1ZUAX 1RTHA 3OQEA 3EX3A 1AW1A 2CA9A 4L4OA 3EOEA 5HJYA 1SC6A 3IO1A 3LHVA 3RB6A 1KFSA 4QR6A 4DXVA 3MM6B 3NMAA 1BXNA 4LT9A 3T6BA 4ACZA 4NZ4A 3E9AA 4ED6A 4X2BA 2PU0A 2OFHX 1JPHA 3THCA 3MMUA 3C6CA 2EK6A 3OHMB 3CT2A 5HUPA 4N6FA 4KH2A 4LYKA 1J27A 2CQ3A 1VKFA 4OLPA 3C86A 2POKA 1UUMA 4US5D 4C5YA 2M5YA 4WDWA 2AYGA 1K4HA 5HVFA 2ATLA 2DYAA 3G77A 5AYZA 3AJXA 2DRBA 4JEJA 1IKWA 4ETXA 4QDMA 3KCOA 2IYGA 1HMVB 3FRYA 1QPRA 1LQ9A 3PX0A 1YRXA 5C7VA 1PJ6A 2YR1A 1QAJA 4C6JA 1EPXA 4WXYA 3T5KA 1DURA 2BASA 1ZAJA 1IXOA 2AAMA 3E2QA 3KWXA 5EMJA 3VKBA 2OX4A 3KS5A 4UOHA 4O3RA 3ZZOA 1SBRA 2KRRA 1UPPA 2PGRA 4Y6GA 4AD6A 4DCPB 2ZH5A 3DZ1A 1K1QA 4ZENA 3CMQA 4B5NA 4USJC 1P27B 2YBUA 1U45A 4EO8A 5LJ5Y 3PBWA 2IVYA 3FAWA 3UFYA 4N2YA 2AKZA 2HG4A 3CB8A 4FVMA 4V1YA 2ASYA 3TAOA 2DQXA 3NO1A 3KEHA 4ZQRA 1LQ2A 2YX1A 4ZGYA 5A2AA 4JEQA 3NAHA 5HR7A 1AZ1A 4ZR8A 1GUVA 1BVWA 1UCNA 1XKYA 3LLFA 4DV1J 3G6MA 3MUAA 4O0IA 2RJZA 2IQTA 3IIVA 3TWZA 1N4LA 1FWEC 3ZFHA 3RMJA 5LSLA 1N5TA 1PJ7A 3BF4A 1NJJA 3AZTA 2CW6A 3GD6A 4GQBA 3M0LA 2Z30B 3EGWB 1GVEA 4DFJA 2KXHA 2DPEA 1H7OA 3C2RA 4WSJA 4Y2AA 3WJXA 2RE1A 4EPBC 1I6JA 2GQ3A 4ICLB 3BGGA 5GAEU 4E5TA 2GHVC 3CAKA 2HNEA 5KFVA 1T0OA 3COTA 5HNTA 3KXQA 4ECWA 4DQWA 5JBEA 3LN3A 1ZPTA 2DVXA 1H7XA 2IIHA 4ZPBA 3NSNA 2WW8A 3NGDA 3NZRA 4XV0A 1HW8A 1OABA 1OYCA 2PBOA 3KOFA 4LRBA 4E3VA 2MMYA 5KFJA 2VGIA 4FXDA 2XYPB 5HWMA 4LFBF 1LOQA 1R87A 2KT5A 1XLEA 5DY2A 3FK4A 4C7FA 3K8VA 4A2RA 1NBEB 3VCRA 4H4OA 3CIWA 2DNYA 3GVVA 2D3OR 4UY85 4FP9A 1SQFA 4KHMA 3CLWA 3UWVA 2JC0A 3O6AA 5BYSA 2BHZA 3VAKA 3W66A 3L7RA 2PO4A 4H6QA 3BO9A 4XUGA 3QZ7A 2CJAA 4KIEA 5H8MA 1L9WA 1AJ0A 3H5YA 4AIEA 3QV6A 4JTFA 2AL2B 2CFXA 2JIWA 2PDGA 5A2BA 9CGTA 3MAAB 1NK7A 2R1PA 3WIVA 5BXPA 2QCDA 4CGTA 3ALGA 5LNWA 4I9AA 1QPQA 1E43A 2X16A 2F8HA 2NVCA 4KSEB 5CGMA 1YDNA 2M88A 4FIRA 4F3MA 2Y7GA 1F1BB 3IEBA 1JLAA 1S5VA 2VQFF 3LA4A 4NSBA 1N5YA 3ENLA 1LORA 4JTUA 4DUYJ 2DNQA 3PUDA 4N4PA 2NXIA 2D2HA 2RFGA 2YW3A 4AY1A 2AJFE 3U6WA 2HRWA 4QWBA 4LSBA 1OFEA 3WZ0A 1A5KC 3T9ZA 1OY9A 2DVUA 4RW3A 2FVRA 3T0DA 4AW7A 5FL0A 1DJXA 1AZSA 2JVOA 2OPRA 3J7Z5 4S3KA 4QEHA 3FFIB 3SFGA 2VEPA 4IZGA 4KFPA 4O52A 5KT5A 4W7WA 3D3FA 3I6TA 4ZLPA 1Z41A 1GJWA 2VG6B 4KFBB 1UC5A 2VFRA 4NLXA 1Q6CA 1AQ0A 2ZM6F 2PT0A 5DETA 1QO5A 4DR1J 3PZUA 1YRTA 5HVGA 2HK3A 3SECA 4YMZA 3M1VB 4XQ6A 3VOIA 5FESA 2P53A 5K8MA 3H25A 2G0WA 2NV1A 1GX5A 5FEWA 3FLUA 4KEUA 2X7IA 4HGXA 4YWIA 2D7SA 2ALDA 3NEKA 1GQEA 4ROPA 3NGSA 3D2WA 2WC3A 4HU3A 4Z42C 2V0NA 3INPA 2I14A 3S3GA 3EX1A 3G1VA 3LDVA 3W72A 4C1NA 4ITSA 3QJLA 1KM6A 4J7CA 1EGVA 1RYSA 4NT0A 1XBYA 2D2GA 1VCGA 4X60A 2J77A 2IPGA 2DXEA 4JI2F 4BS2A 2C28A 1HL2A 3LPYA 3RJXA 3M5ZA 4XAGA 2IKHA 3GNXA 4YVVA 1PYSB 2KJVA 2NSCA 2XWYA 3ZJKA 1O5KA 1HP4A 1G4TA 3HZEA 3I3DA 3OG2A 2WC7A 1KR1A 3DLGB 1CVJA 1HNXF 2X40A 1F3FA 2FZCB 1A47A 3W28A 4LUBA 2HXUA 1QUMA 4FOJA 1Z9AA 3W7GA 4XX6A 1H73A 3V6DA 3CNQP 2KG1A 3LHYA 3A3PB 1LQ0A 1TPFA 2YZRA 4C6AA 2IJFA 1JMTA 1KNZA 5KFGA 8XIMA 3VGSA 3VAJA 4CT8A 4AXJA 1HLWA 3MEKA 3LXAA 3WLJA 3K8WA 2ZD1B 3ENVA 1OF6A 1Y0EA 2ABYA 5ENLA 4YN3B 3N2XA 3QT7A 1EX1A 1H0IA 2JOQA 2XHYA 4ADSA 2X51A 4PXBA 4BC9A 2HE5A 3B0UX 1TA3A 1CIUA 2EBEA 1KFLA 3LX9A 2EAWA 3F0NA 3LZ3A 4H9YA 4HNCA 2Z1XA 1LWHA 1N54B 3PRBA 5EN1A 3R5GA 1UFLA 1W0MA 4M3PA 2HSEB 4TVAB 4RW8A 5TD4A 4U3AA 2FFCA 3NJ3A 2HS4A 3FYOA 5I77A 4QQ3A 1JFXA 4YTRA 1NEYA 2FLPA 1YIXA 1QOXA 2LEAA 1H2VZ 4CQ9A 4K5SA 2X3GA 4BR1A 2RNEA 1RK5A 2WZHA 2GGPB 3STPA 4B02A 3BGRA 4A8WA 1QHZA 4KWSA 1S5MA 2ADBA 1SJQA 2D20A 3I6EA 2ICSA 4UOGA 3DLJA 2YLAA 3DGBA 2LLZA 3W2VB 3MO7A 3CW2C 1BF6A 2A6MA 2GGIA 3EKGA 1PKUA 3NXLA 5LJ3Y 4B3SJ 3UYIA 1IKXB 5A6MA 4HHUA 1CEZA 5E2QA 1FXLA 4C6LA 3L4TA 2ZDSA 2OXNA 3OR1A 3BM7A 3W7BA 4EX4A 2PWVA 2KYXA 1I9CB 4RUBA 3PJ9A 1UPMB 1R0AB 2RDJA 2GJIA 4RCXA 3LP1A 4QS6A 5G2WA 3VNIA 3IS9B 3KOWA 2J0SD 3JYTB 3R2DJ 1MMLA 2ZBQA 4WY0F 1K8YA 4I5UA 3VD5A 2EF9A 1D09B 4HHJA 3SUSA 2ADAA 3GG0A 4KJIA 2P88A 2F38A 3MANA 3AZSA 1FA2A 2NV2A 4JOMA 2JH3A 2VBYA 3SCJE 3Q2DA 5LXXA 1MWZA 4U10A 1Q16B 4DSFA 4GY0A 5HP1A 3WK2A 1NPPA 4W9TA 4WP9A 3PTQA 4K3ZA 3O63A 3V2UC 4YY3F 1FDAA 4WK3A 1VEOA 4MUZA 2AJ2A 4DWIA 3U48A 2QV6A 3UVJA 2BXZA 3GXTA 1TK8A 4JY8A 5L9NA 1NLKL 2B4PA 4FF7A 1RT6B 4HHPA 3CJQA 1YDVA 3M43A 1C8XA 4K1WA 3G6XA 1TKTA 4HK5A 3BGUA 3PZNA 2X1IA 4G56A 3M64A 1PAMA 1JXEA 1S59A 2D24A 3CCMS 3DBPA 3PFEA 2R7RA 4R7WA 2TRSA 3TLLA 4QWAA 4KF1A 1VEPA 5ETMA 2IW0A 1ZBWA 2N4DA 3P5TL 3W9ZA 1XIHA 1TE6A 3SRFA 1H49A 1VYRA 5GNXA 3CVKA 3ERPA 1WZMA 3MEEA 3AXMA 1WPCA 4NILA 1FKPA 2V8PA 3SN4A 2FMOA 1FRXA 4EVZA 4FZVA 1E56A 3AUOA 1Y3JA 3C0LA 4J35A 2DV0A 3MP5A 3RU8X 3DYAA 4LRAA 1NDVA 3BKFA 3L95X 2E5LJ 3POTB 1FX6A 1NU5A 3EDJA 4TX9A 1HNZF 1UD2A 3H2FA 1QBAA 3BGFA 2J7HA 4H4MB 2GUYA 1KD0A 1BRLB 1H2UX 3AICA 5HATA 1RA7A 4FNQA 4NIRA 1YRUA 2J9ZA 4C6BA 3OFFA 4MWAC 1UWUA 4DL6A 1XMBA 1A9NB 1Q3NA 1VIXA 3RAMA 3NP5A 4HU0A 1E6XM 1CJUB 3HMCA 1YNYA 1ZM4A 3BCJA 3O0FA 4ZO7A 5LSMA 2K3IA 1ONXA 3P8JA 2AOSA 1WBJA 3U5UA 1NDZA 3CUIA 3GIQA 4UUIA 3CMES 2OPQA 3BMWA 4FNIA 1S1WA 3IFEA 3AI0A 2PGFA 1OC7A 3PUGA 1IR2A 3L21A 3QW3A 2WZTA 4Y9NA 3S1XA 4ALDA 1XGZA 5GVQA 5HNUA 4OZJA 3A24A 2KT2A 2YKOA 3W25A 4LBHA 2XY6A 1XYBA 3R5BA 1OX6A 1M68A 4AX7A 1TV6B 2EG7A 3RCMA 4LMZA 3DDMA 2RDTA 4ECLA 3H59A 4DR3F 2J6VA 1P0DA 3W5YA 4Q8MA 4AWTA 4DZDA 3DGRA 4AD3A 5REQA 3V81B 1MRAA 4ML9A 2JEJA 3TAQA 2ODOA 2NZCA 1RAKA 1SH0A 2L3MA 3WH6A 3TI0A 3Q58A 5I07A 3CV2A 3RFAA 2DVTA 2XYLA 4ZCIA 1PBGA 2BGQA 4CTAA 2CJKA 4DWSC 1BQXA 4RLIA 3PZ9A 2W2PP 5BRQA 1VLIA 2J9EA 2DNNA 1QU4A 2VPXB 2YX4A 4K4WA 2FZ9A 4X4NA 1WHWA 2Z4GA 4GH1A 1GNKA 1VYSX 4XK2A 1FA0A 2MKSA 1IBLJ 4O1CA 4F4XA 3AOAA 4JFUA 1FWWA 3H40A 1T9XA 2V4JA 1FK9B 1A3XA 3CMAS 2EG1A 4LH8A 3R7MA 2G3NA 4J9QA 1SKSA 2D0HA 3B4MA 3KTCA 4O1EA 3SCQA 5ABFB 3L5LA 3V3WA 3EXCX 1U4BA 3BVJA 1JKHA 3RYLA 3LV6A 1NPKA 2YWFA 1JLBB 1LWEA 4KO0B 1ZTWA 1RLCL 3ARUA 4HLBA 1ZM2A 3PKMA 3M2VB 1UKTA 2VURA 1TJ0A 4B3OA 4ZOBA 4BF7A 1N32J 2V8VA 4N76A 2DSWA 4DY1A 3RX3A 3IGUA 3DLKB 4KGXB 3WQ4A 3VGBA 1MVYA 1QY7A 1A4MA 4A8MP 1S39A 2G5WA 2B5JA 3AA9A 1HBMA 2WMIB 4UTWA 2LDIA 4YS1A 4Q7IA 1H74A 2P1FA 4Z1DA 1JZ2A 4NRUA 3GYGA 3I4PA 3CAQA 2W2MP 5JVGQ 2VDIA 1N34J 2LEPA 3OBAA 1C8VA 1QWGA 3WD3A 1R8HA 3LENA 2VD8A 3GHUA 3M46A 2XSJA 1A5SA 2C14A 4MIWA 3T6JA 2P8BA 3D68A 4PPZA 3K1GA 1NK0A 3OPSA 4UW2A 1MWYA 5G4DA 5GNZA 4IYQA 1YNPA 1W32A 1S1TA 3MTKA 1Q1KA 4AXIA 1K9EA 4KRWA 3AIBA 1D9AA 5K8OA 4F2SA 4HZ7A 5FIPA 1YJ7A 2R9LA 4WYLA 3VGDA 1KKHA 3CTRA 2D0FA 2AD9A 2J4GA 2OSRA 2X1SA 3S5OA 1XMQF 3DXSX 5LSOA 2WJDA 4O12A 4J1OA 5KFMA 4S23A 1ZENA 3D0CA 1J79A 3DHUA 2YCJA 3QJJA 2C3PA 3WCZA 3TA1A 6XIAA 1HW9A 4J3SA 1NFBA 3OBKA 4F3HA 4M5MA 3BC9A 1THFD 1DTUA 1FVQA 3STFA 4PQUA 2Y88A 4GJIA 4AY8A 4M5LA 3RGTA 1I4NA 4X4QA 2R9RA 1XI3A 3WLTA 3WFZA 2BNJA 4M5GA 4Y7EA 5LIKX 4DLMA 4JFTA 4L6HA 4R0JA 3E3HA 2DNKA 4IG0B 2QN6B 2X1TA 3B82A 3TAKA 4RW5A 4BQ3A 1JZ3A 1XK8A 2HMIA 1WKEA 1WXZA 2OOGA 2HVHA 2PDHA 1REVB 3GXIA 4L1WA 2DZUA 4IH6A 3S5SA 4WKFA 4X64F 2VG5A 4HYVA 2E9BA 4C8ZA 3V6KA 1VQ5S 2HNDA 1QTWA 3CK5A 4V19J 3HDSA 5KG3A 4U6PA 1SU5A 1IM4A 2FZBA 2V2VA 2DTJA 3LXBA 3PW0A 4R53A 2J0WA 5FACA 3EMQA 3M0MA 5D4PA 3MMJA 1KCZA 3A22A 3KFTA 3UZWA 3KWMA 1Y0HA 1R86A 1XH2A 3QR1A 3FVMA 3H24A 2XI3A 4UMCA 2DHSA 2WONB 3THTA 4HA4A 1QI0A 4NZFA 3IGHX 4PTVA 5BOEA 1CB7B 2Y8YA 1FO1A 2AJ0A 4LRCA 2FDMA 2DUZA 1T0TV 1SJFA 3SZ2A 1T03A 1J11A 3TWAA 3TYCA 4Q22A 4PUUA 1HNYA 1LLOA 4R0EA 1CB2A 5HDRA 1Q85A 1SJ1A 3W1NA 5KZ6A 3WYZA 5C9UA 4OJHA 3E49A 2V3EA 3JR2A 2FGZA 2XVPA 1OM0A 3MMAA 1KONA 3GVQA 3BAWA 2ASLA 1AD1A 1UR0A 3HJZA 3KLLA 1X0PA 2G0JA 4LF6F 2A7PA 2U1AA 4DV3J 2EC0A 1RTJA 1HR0F 2EJ1A 1V5XA 3IVTA 2G0IA 3QGGA 3VIJA 2PE8A 4IPJA 1TFWA 3GFHA 3EWYA 1NDCA 1QXLA 2CKSA 1H50A 1ELSA 1VJQA 5T7LB 1UMYA 3IUIA 3K58A 1X98A 2RQMA 3HPAA 1W3TA 1S5TA 5DGAA 4FS2A 1FNMA 1HJSA 2V2QA 1EQPA 3I0SA 2GDUA 1ZZMA 3VHQA 5ITHA 5CZTA 3Q23A 4LSNA 3TV8A 2FDSA 1AH0A 2EFNA 1PJ5A 3BSMA 4AZCA 2JFDA 3C14A 3UW1A 3TZYA 4YR3A 2UU9J 1VQOS 3S9IA 1FTXA 2NQLA 2NV9A 3OFEA 3HHLA 4HOXA 3QV9A 4AD4A 1BFNA 1JUEA 1SC4B 3CZKA 5AE1A 1K77A 1U30A 3STCA 4TQSA 4O4VA 4F0RA 1P6WA 1CXIA 4LUJA 4QXIA 3V5CA 1AUDA 4NI2B 2B31A 3N6LA 3R0UA 2IPOB 2X1UA 2J27A 1JG9A 5CC3A 4OIXA 3DBNA 3W27A 1YADA 3R97A 2GFTA 3E51A 3PWGA 4PMOA 5HPOA 1GFWB 4OHZA 3ZZZA 1IT8A 2IQDA 5J2NB 3KHRA 4JZ5A 3ITGA 5D3GB 3L68A 2Z1BA 1TVPA 4HNVA 1KM5A 4KC5A 4JI1F 1Y3KA 1LV5A 2R7SA 3RAOA 4M8UA 3NPXA 2XSXA 2CQCA 3W81A 1AQHA 3IK2A 1LROA 1P9YA 2IPWA 4QLJA 1GWJA 4GINA 3A8JA 3ZZPA 4U5IA 3MCNA 3N9SA 5AT1B 3RBDA 4AWEA 5DX7A 3SIZA 3TCSA 2BOPA 1NNDA 1NH8A 1XIMA 2HK0A 2YOCA 2CCRA 3G1AA 4WDUA 3UERA 1KOHA 2YNFA 5DEZA 1EDQA 3CCWA 3Q2TC 3LCGA 4TV5A 3GKAA 3AHXA 1VHIA 4ZVRB 1SMDA 1EUAA 2FQIA 3VDBA 4LAKA 1SUQA 1R6YA 2H9ZA 2NVDA 3TFCA 2O01C 4AXNA 2DR6A 1S5WA 4K7YA 1M5SA 4CCCA 3DYMA 1U1OA 4PMNA 2RQ4A 4U67Q 3W9JA 4KCTA 2OSQA 2C19A 3VNJA 3VVUA 3ITXA 1JLQA 4Q4OA 1D7KA 4IM4A 2J79A 3J7YI 3RW6A 4MWAE 1H98A 3HHNB 1X5SA 3R7NB 2Z29A 2C6QA 4DX5A 4DJFA 1KLMB 3OXFA 2HHUA 2XM3A 4RDZA 2OD4A 1UWQA 2M52A 4ED1A 2W25A 1U1UA 2ZKTA 4LFBJ 2QLJB 4IR9A 2EGZA 2E7FA 2I8EA 2RUSA 3BYRA 2L08A 2NQPA 3DFEA 1XMOJ 2YW4A 1LOLA 3WSUA 4P7RA 4K39A 1M7PA 2JLGA 1I0DA 3CCSS 1K8CA 3GE9A 4K7VA 3JTPA 1HL8A 3S6OA 4N47A 2DJLA 2PA6A 1S2UA 3BO4A 1BGGA 2QDDA 1Y10A 3IXQA 1E9LA 3PHTA 4JTEA 4OX9F 1YEYA 4D6JA 3ZLGA 5I0DA 1NJIT 2A21A 4C6DA 4U3CA 2E29A 4FNRA 3NL0A 1ZBKA 1RT1A 1BWVA 4DJDA 3LCHA 2FVSA 1BYDA 2V2DA 3M0HA 1CXHA 3MCMA 2VHLA 4DV6J 3CC1A 4B3TF 1DP0A 3DHDA 3MBFA 3HD1A 1MU2A 3NR0A 4QWCA 3GK0A 3IVSA 4XTDA 2WNWA 2PDJA 1K02A 5CZ0A 3PEHA 4WVXA 2DT9A 3FMBA 1ZPVA 2PN6A 3ONQA 3HG5A 3C6TB 2BANA 4EBCA 3ICLA 1U6FA 2WVSA 3H55A 3RRAA 5F4WA 2QA1A 4DWDA 8CGTA 1AW5A 4JFVA 4DR6J 2GIFA 2G2ZA 4JHOA 3I5BA 3M8PB 2A5HA 4W8LA 3EOOA 5IDZA 1D8ZA 1JQGA 1O51A 4S2CA 3UJEA 3FUYA 4EFAC 2GZOA 4CNSA 3AJDA 3H21A 3THQA 4AB4A 3UPWA 4HN4A 3SRDA 4WIQA 1S12A 4K4SA 5BWAA 3S83A 2MKCA 2AX0A 3VOCA 4IT1A 4KKXA 4UTLA 3SBFA 2RILA 3EB3A 4YP3A 4LUYA 3OZMA 4C0HA 1VCVA 4AYSA 3H20A 5GAHI 5CD4H 2DHXA 3VPLA 1FXDA 4GUGA 1CJKA 5BU9A 4DIAA 1HPZB 4AL6A 4M7SA 3E0LA 3FA3A 3VGEA 3ZT7A 1R7AA 5A8RA 2F3JA 3P62A 3EICA 4QIVA 3GH5A 4ZLLA 1H7WA 3PM6A 4ASTA 3BSAA 3GR8A 4HACA 1UEUA 3ZVHA 2PDWA 3KLGA 1KTNA 4L4MA 4C7DA 2Q6ZA 4HJWA 5FDLB 4Q3MA 3LBCA 3USZA 4DR2J 2QLWA 2QL5B 3C2YA 3FVDA 4AC1X 3SY1A 4RX6A 1NDYA 1U5VA 1WSVA 5D09A 1U47A 1UFWA 1KFJA 4IOBA 5KTQA 3EOSA 2XFFA 1ZCCA 1RTIB 3QKEA 1Q7QA 3KZPA 4NYYA 3TYZA 4DX3A 4HNLA 1T3OA 3O1LA 1NMEB 2CLPA 4NZ6A 4Z2JA 2LLEA 3OW2R 4WHBA 5K14A 1CXFA 1N82A 5L9FA 3D0IE 3UG8A 1R3RA 1M03A 4DPPA 2C13A 2E5DA 1N5QA 4C1KA 3U7JA 3CUGA 1OSEA 1RZMA 2FFIA 3MPWA 1PTAA 2FZDA 4WU3A 2ZWPA 2DGAA 1H7NA 1R0CB 4ES3A 4DPXA 5HANA 4H1ZA 1R8LA 2ZDOA 4OZNA 4MNJA 2XU2A 2BA9A 3E8OA 2YWEA 4GYPA 1WYIA 1O5JA 4I6AA 1VQ7S 4A8FA 4YCPA 1J2WA 3DECA 3GE7A 1OSCA 2QFIA 2FC8A 2Z2BA 2UXBJ 2PP3A 2BVWA 3G1RA 2D1CA 3MM5B 4MFBA 4BQ5A 1BY9A 3WO8A 1J0YA 3WNKA 3PIPQ 1H09A 2DGWA 4P7LA 2IVFB 4KQZA 3HM9A 3M8ZA 4QYRA 2HFNA 3E5PA 1WF1A 3UWQA 2BBEA 5D77A 4M82A 5BWFA 3TX9A 1S1UA 3RLUA 3DRXA 1URRA 4JX6A 5D05A 5IBXA 2NYHA 1K7XA 2A0NA 3OLGA 2DH8A 4KHPF 1FDZA 3MM7B 1BQCA 3N2MA 5HR6A 3WQ8A 2CZ9A 1H63A 2ZWYA 3MTWA 4O4RA 3FBEA 2KT3A 4M5PA 3UI3A 3ZS4A 3TK7A 1VQLS 3KL5A 1K70A 1NF0A 4IPPA 4A4AA 3CC7S 3C0QA 4CEUC 3VVTA 4ADUA 1YBUA 3AD9C 2VFFA 3H70A 1ZJHA 1RGVA 1F6PA 4ZODA 2J25A 2XI2A 2OOFA 2M0GB 3VIOA 1FFRA 3X1LB 1JZ6A 2FTYA 1KVIA 2GJRA 1X4FA 3UJ2A 1OPZA 3UXKA 2KXNB 3ZR4A 2JLFA 2HFSA 3M2UA 3HOJA 3KJFB 1DZ5A 3C2FA 2LQ8A 4K4UA 1UWBB 1NH7A 1Y5LB 4A3QA 2OPSA 1BQNA 4MHBA 2CLHA 4K4YA 3DFTA 3KHJA 3L4ZA 4RW6A 4C65A 1RTHB 4F2TA 2A3EA 4NXSA 1XCXA 3M8SA 4U31A 4GNJA 4ECVA 2FHKA 2RIJA 3PS7A 3P82A 1ZJAA 3AMGA 3HA1A 4WPAA 3E96A 5F3ZA 2OTDA 2GK1A 2FHFA 4ACZB 2DNLA 5D03A 4X84A 2BJDA 2UVWA 3EKLA 2I17A 1B70B 4IFRA 4TXEA 1MN9A 2PLCA 2FHCA 2Y7EA 4QR0A 4PMRA 4FXRA 3MI3A 3URBA 3IRSA 2OZ8A 3W2LA 2QR6A 1R8BA 3R12A 2CWNA 1MNSA 1X9MA 2C42A 4AZGA 1Z7AA 4L56A 4LU0A 2PPGA 1IKWB 3M6VA 4ZPCA 1EETA 2YH0A 3FJ2A 1XJBA 3GXNA 3DLEA 1FI4A 4PCQA 3F2CA 3G8TA 2V3GA 2W2QP 5H91A 2XG9A 4N42A 4NRRA 2HKEA 4DMZA 2QV5A 4GFSA 5LL6d 1OGBA 3GW0A 4L4PA 1IGWA 2PCEA 3URAA 3VXGA 3H7RA 3UQSA 2V6AA 4Y8EA 2G2OA 2R2TA 1WF0A 1XIEA 4ICMA 3P8BB 1V3MA 1YPXA 1WOBA 3J7A1 4CVWA 4G9PA 1U22A 3L7OA 1X7VA 2FPYA 3KS6A 2J66A 5A8PA 5FLXY 4R85A 2QCGA 1TAQA 4DFKA 4F2RA 5A6TC 3NQMA 4PA8A 4KV8A 1UD3A 2PFDA 3R5EA 3KOZA 5F8MA 2HHHF 3CDEA 3HSJA 4JAWA 2KM8B 2PDMA 3LRMA 3NQVA 3MSRA 3FC9A 3AFGA 3L9ZA 2YX0A 1IQZA 2NUUG 3DMJA 1TSIA 2Y1LB 1OX5A 5D2VA 1ALDA 4PGLA 4XZWA 2XGZA 2EHHA 2HXTA 4WFBQ 2B7PA 4MVAA 1UYQA 5CSYA 5E6YA 5MKGA 5CYQB 2WVEA 1WZKA 3LOTA 3CWOX 5E09A 4HH1A 1TL3A 2BP1A 1W2VA 5I06A 1JZ5A 4LSLA 1HA1A 4UTGA 3W1YC 4IG2A 2FC9A 4DM2A 1EJXC 4GO8A 2KYZA 5BJRA 4I2PA 5DZ7A 1ZNNA 4UOQA 1W9BM 2CESA 3TVAA 4O1DA 5U4NA 2ZBIA 3M32A 1DPMA 4PR4A 3UA4A 5JVLA 3CF5Q 2ISFA 4O10A 1H5VA 4BF9A 1RADB 3OD2A 2YA2A 2ROPA 5F1UA 4DN9A 2VXNA 4DO7A 1B4SA 4PCTA 2Z2MA 3EPMA 2MEWA 1YBTA 1BGAA 2DT0A 2QVHA 4GUHA 1U1HA 2QZRA 1VB9A 4HYKA 3N1AA 1LKZA 7ENLA 3CE8A 2P5VA 1CLKA 1LDCA 4YB7A 1Q6QA 2WMJA 4Y65A 3TN5A 1JI1A 3AYVA 5G4EA 5KT7A 3ZO7A 2JWNA 1M1BA 2HQGA 4WE1A 1NHUA 1X4CA 1SR0A 3QY8A 2OPPA 4LYRA 4PRWA 5D33A 4FF2A 2WKLA 3GFYA 2XZ9A 1JJ4A 4IQEA 4ZB2A 5F41A 4W88A 5DANA 1NU4A 1FCUA 4DL3A 2ZZNA 3G5EA 2X0YA 3QGVA 3B9AA 1W1B1 1WCGA 2XSAA 4GRSA 4DO4A 4S39A 1YKWA 4IWWA 1JLAB 3UDVA 2IVMA 1UH2A 4HPXA 2WSRA 4PL1A 2CVIA 4EACA 4NLVA 2FB0A 5BXIA 1EH9A 3UZZA 4Q2MA 2YQ0A 5KOWA 3E0IA 4I7WA 1O6XA 3IG1A 3NPWA 4AX6A 4G2DA 1KVKA 3NBPA 1KKOA 2HWTA 3NAVA 3NDYA 3IJDA 1AZSB 1K9FA 4X2PA 2OPRB 3FZ2A 4WTYA 3LTYA 1SPBP 1T9WA 1UKOA 4WZHA 1BTCA 2DH7A 2ZZ5A 4PEKA 1S0OA 3H4XA 4LWWA 4EOUA 2OP5A 4CO3A 2HIQA 5DCBA 1D8CA 3VNZA 2V81A 4S3GA 2Z00A 3GU1A 4JI6F 3K5MA 3T1YJ 1UIOA 1DVJA 1YXYA 1EZWA 4WZMA 3WMBA 1CJVA 1VHFA 2V5LA 3PM9A 5MHBA 2TSYA 1K8XA 4QIEA 4IIEA 4LF9J 2E1CA 1NM2A 5DT7A 3VCNA 1OG6A 2Q3RA 1QE1A 2RT3A 3MZ2A 3W8GA 5F8NA 4DYEA 1VBGA 4XDDA 5AXMA 3IPWA 4EMDA 4AU0A 1TV7A 3REQB 1FWTA 4AXKA 1H61A 4MYXA 1AW0A 1VBKA 3BOFA 1VQYA 1FX2A 4RBVA 3LSBA 1B9ZA 2PMWA 3FIGA 4PB4A 4OE7A 1ME8A 2EKYA 1GCYA 3ELFA 3H42A 1POKA 5EFFA 2C79A 1YJUA 1HGWA 4FBUA 3WQPA 3Q83A 4MZ8A 2O7QA 5J2MA 5CLTA 2B81A 3M16A 6PTDA 4J4KA 4JXCA 4B5UA 4AUBA 1IKVB 2ZADA 3E01B 3WDHA 4IUOA 4WIIA 4PXCA 1QNVA 1W5NA 5GPRA 1F3EA 1XYFA 3W2WA 3W74A 5D0HA 3GIJA 1RYRA 3GRIA 5D9OA 3SCOA 1JCLA 2ATCB 5GMEA 1W8SA 3KCJA 3TP2A 3ZJ6A 1TG7A 1GVSA 1ZETA 4MDOA 1ZQ5A 2X1RA 2HRYA 3HJEA 2YDAA 2MNRA 4QS5A 4JV5J 2DNGA 1PB0A 4NLWA 4RNMA 1TE1A 1LUCA 3NVDA 1JDAA 3ME3A 4TTUA 4Y90A 1SQEA 5D8ZA 1YYAA 1XMQJ 2JEPA 4KS0A 3HT3A 1DHMA 4LF8F 4PULA 4FBTA 2QCCA 1UIPA 4RKAA 4YYCA 2FJKA 3CEPA 3M1ZA 1TTIA 1CC8A 2XB2D 4M51A 3V0SA 2FJAB 4UT4A 2A2DA 3MHFA 3ITVA 3BEGB 3KHGA 1HKMA 4Q4RA 3GIMA 2ZH9A 4QPTA 2YTCA 3NCRA 1TA3B 3UWTA 1YJRA 3C3LA 1CECA 1JFHA 3UZJA 1BKSA 3O44A 4D3GA 3RZAA 3MPGA 1UASA 1V03A 3A8EA 4ATNA 3NIYA 3HK2A 3QFEA 2RRBA 4ZVTB 1K44A 3AS1A 4RW7A 4RW8B 3PJTA 4RWWA 4RL3A 5JJBA 3G96A 4D6CA 1GW9A 1XIBA 1RT5A 1WHYA 5L1KA 4IQXA 1I2RA 4UNKA 3TC3A 3BGRB 3R7BB 1E9YB 3P0WA 1VC0A 1UBSA 1RD5A 4M6PA 2IMRA 1QAXA 3KG1A 4HOZA 1UVLA 1TUGB 1RUSA 1AW2A 4NNBA 2FLOA 1D3HA 1NWRA 1H7PA 4P9SA 4AZ6A 2KFZA 3M2RA 2HJPA 3W7QA 4FB7A 4QWEA 2PRHA 3OR1B 5XIAA 2ZUVA 2FHJD 3HHKA 1OJ4A 5F8GA 2V3DA 4ILLA 1ONWA 4ORIA 4JFSA 3U2OA 5M1TA 1FWCC 2C1EB 1J0IA 1ZJIA 3ONCA 4DUWA 3LP1B 4U96A 1UVJA 5LKYA 1NFGA 2AKWB 1VI7A 3QBCA 2DO0A 3M0KA 3NSXA 5M17A 1LWJA 1BMQB 1MSSA 4PZVA 4P52A 3A4AA 3AZRA 3OZPA 2C1GA 4XUYA 3HIJA 2MANA 4OZ2A 3AY0A 3EKZA 2C3MA 4B3ZA 3TXVA 1TJ2A 4JD4A 5ECVA 2ZHBA 2G3JA 2BOGX 4J5OA 3IJ7A 1XWLA 3ZVIA 3AHYA 3CD7A 2O66A 3NS5A 2F65A 5I2UA 1HJQA 1WZLA 5AHLA 4DF8A 4LF6J 3SYZA 5MAOA 3P8IA 2QNEA 1V0MA 3TDFA 1F5BA 1HR0J 1G1YA 3EWBX 1AB8A 3OSPA 4X63A 4CCDA 1V6WA 4NI8A 5FJ4A 4DYKA 1QSSA 3WLLA 3UVJB 5AC6A 2BBFA 2UY4A 1DARA 1DBDA 4F2BA 3GILA 7XIMA 3ABOA 3VA8A 2HPUA 3A23A 4TYAA 3A5VA 1UAWA 2Z8QA 1U24A 3H8AA 4IISA 3PX4A 1FWHC 3PZMA 1WUFA 3S7RA 1I1XA 1VQ9S 3GUGA 2O9OA 5HBMA 1G94A 3BKUA 3WH9A 5CBJA 1REGX 3KLFA 4ZO8A 2WCGA 2RJHA 2CBJA 4Z7CA 2PC6A 1PZ3A 1FKPB 3L4XA 4YTQA 2W9CA 3I56S 1CBKA 1ECEA 2OLAA 1F60B 3F73A 1SYTA 2VZSA 3SDEB 3C3NA 3OVRA 1KOOA 3G8RA 3L67A 3JXOA 1WDSA 2F2KA 2N7CA 2CERA 3R1HA 3TMLA 3W02A 5ABHA 1QOPA 1RWNB 3HO8A 4AZ7A 1WEYA 1N8IA 4CO4A 1YXCA 1U0SA 1NELA 1GJUA 1RWKB 4K0KJ 2D73A 3S9ZA 3MUY1 5CXTA 5D32A 1FVPA 2M70A 1VQKS 4P8XA 3UP8A 1VIWA 1XRFA 5E0KA 4F0HA 4JTJA 5FJRA 4ED0A 1H7RA 4FALA 4GXWA 2KO1A 3DDIA 4ECTA 2HK1A 3NGFA 3MA8A 1RK8A 1NOFA 4ZN3A 1GYNA 4ZMMA 4L9ZA 2KTQA 5I02A 2UVVA 1TPC1 1EJTC 4I1TA 2OPQB 4PG4A 3H8YA 1S1WB 2QMJA 4KETA 5M2RA 4UTTC 5KOXA 3L23A 4MWAA 4JI7J 2FIQA 4P8VA 3W75A 3GJRB 1QI5A 2CBIA 4LUSA 4A21A 2PDYA 4C11A 1NCLA 2NLWA 1M5VC 1OF8A 3L2MA 1GHSA 1KCKA 4J2MA 4IP5A 4YDDB 1JF6A 4GZJA 1UH3A 2WVFA 3MR3A 1X7IA 3MWCA 1DKWA 4CN4A 1FKWA 2PA8D 2AJQA 3EB2A 5ABGA 3VNDA 2XWEA 1KHVA 2CWKA 4PWDA