2ZVIA

Crystal structure of 2,3-diketo-5-methylthiopentyl-1-phosphate enolase from bacillus subtilis
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
400
structure length
395
Chain Sequence
SELLATYLLTEPDTEKKAEQIATGLTVGSWTDLPLVKQEQMQKHKGRVIKVEERAASEKQAVITIAYPEINFSQDIPALLTTVFGKLSLDGKIKLIDLHFSEAFKRALPGPKFGVYGIRKLLGEFERPLLMSIFKGVIGRDLSDIKEQLRQQALGGVDLIKDDEIFFETGLAPFETRIAEGKQILKETYEQTGHKTLYAVNLTGRTADLKDKARRAAELGADALLFNVFAYGLDVMQGLAEDPEIPVPIMAHPAVSGAFTSSPFYGFSHALLLGKLNRYCGADFSLFPSPYGSVALPRADALAIHEECVREDAFNQTFAVPSAGIHPGMVPLLMRDFGIDHIINAGGGVHGHPNGAQGGGRAFRAIIDAVLEAQPIDEKAEQCKDLKLALDKWGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords 2,3-diketo-5-methylthiopentyl-1-phosphate enolase
publication title Structure of the apo decarbamylated form of 2,3-diketo-5-methylthiopentyl-1-phosphate enolase from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
total genus 139
structure length 395
sequence length 400
chains with identical sequence B, C, D
ec nomenclature ec 5.3.2.5: 2,3-diketo-5-methylthiopentyl-1-phosphate enolase.
pdb deposition date 2008-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 2zviA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 2zviA01
3WQPA 2V68A 1AA1B 2OEJA 3NWRA 1AUSL 5HATA 3KDNA 8RUCA 2V63A 2RUSA 3FK4A 2OELA 3QFWA 4LF1A 1RSCA 1GEHA 3AXMA 1YKWA 1IR1A 1SVDA 4F0MA 2OEKA 2CXEA 1IWAA 1RBLA 1UWAA 4MKVA 1EJ7L 3A12A 5RUBA 5C2GA 2QYGA 3KDOA 2CWXA 5C2CA 1GK8A 4F0KA 3RG6A 5HQMA 2V69A 4RUBA 1UPPA 1IR2A 5HANA 5HJXA 1BXNA 1RLDA 1RBOB 1UZDA 3AXKA 4HHHA 2VDHA 2VDIA 4F0HA 3ZXWA 1RXOB 1RBAA 3RUBL 1RLCL 3A13A 2V67A 1WDDA 2D69A 2ZVIA 5HAOA 1UW9A 4NASA 9RUBA 2V6AA 1RCOB 1BWVA 2OEMA 1UPMB 1TELA 5HJYA 4LF2A 5HK4A 1RCXB 1UZHA 5HQLA 1RUSA 2YBVA
chains in the Genus database with same CATH superfamily
2WXDM 4AEEA 4XO7A 1AW1A 4ZPTR 1IT8A 4JGDA 2UUAJ 5HVHA 1VB9A 3MM6A 4IO1A 1AZSA 2LEPA 4RX0A 1AUSL 1H2TZ 2XJ7A 3OU8A 2KJWA 3MR5A 5E3CA 3R89A 4FBUA 4AD4A 3V0SA 5CHCB 3OJUA 3S9YA 1UZ4A 4NX9A 1VEPA 3VD9A 2E8YA 4QAIA 3GVRA 1JIBA 3IK2A 3GU0A 3V2UC 4NA1A 1U1MA 2VZTA 2V3GA 2XSAA 5LNUA 1LCOA 1W9PA 4HIBA 1HJXA 3PKMA 3CDUA 3ARPA 3JUGA 1B70B 1DWGM 1I5OB 4DU7A 4JQAA 3CAVA 2YNIB 4MFBB 1S97A 5J2NA 4LGXA 1BKHA 8XIMA 3ZTRA 4GYKA 5JQ9A 4A47A 3WK2A 2BM0A 2Y0BB 4NJHA 2ZIDA 4IPPA 5KT7A 1ZBKA 5A1AA 1HI0P 4I7VA 1M1KT 1A5NC 2GIQA 3DKLA 1LXJA 3UPWA 2IXUA 1KGUA 3ZT6A 1YZ6A 1L5UA 3CTRA 2DSUA 4B16A 2INEA 1RAFB 4L6HA 3SCKE 1FOBA 5BXTA 4ZLLA 3IP0A 5D8HB 4KCUA 3VIJA 2ZH6A 1RWUA 2CJ9A 4USKA 3GBEA 2P53A 4KGJA 3FRZA 4Q8NA 4N7QA 2ROEA 2ZH4A 4NZJA 1E0VA 2ZQ0A 2W2QP 3W9IA 1RWXB 1FXLA 1LYXA 1U8WA 4Q8UA 4HK6A 2DHGA 2RJZA 3AUOA 1LWCB 2RQKA 2CCRA 3NXZA 1XW8A 5HAOA 1JRCA 2YL5A 3NYZA 4HNOA 3CAQA 4MUPA 3ERPA 2FZNA 3PIOQ 1QUVA 4H2CA 3EDDA 1JUBA 3BZJA 4REQA 5AC7A 1PUDA 1EHWA 1SL2A 1MUMA 2JKEA 3UWQA 2WM1A 4ADSA 5A6JA 4LUIA 3WBYA 3G6LA 2B4VA 4B9MA 2EG7A 3GQYA 2Y5SA 3LF0A 2PU1A 4M5IA 2RQ4A 1WKYA 2V2VA 3NCPA 5KFDA 2KN4A 1LWEA 5T91A 1BHGA 2PTWA 3DOLB 4FVMA 4IL2A 1WSRA 1EP4A 6CGTA 3EDEA 5DS7A 1CENA 2XWXA 2GMJA 2R6OA 4YEAA 3BAXA 4BDPA 1NOWA 5KFWA 5T14A 3BCDA 2Z00A 2OP5A 3FIGA 4YHEA 1P6TA 4QPXA 1S1WA 3MYPA 1FKPB 2BV9A 4XAZA 3CJSA 2AAAA 3M5XA 3WH5A 3IJIA 1FF2A 3TSMA 4I6WA 5DELA 4XAPA 3QYSA 3MUZ1 1IBKF 1X39A 1T02A 1TQXA 3LQGA 3GHTA 1OCBA 3AQOA 1RHMB 1XYFA 4CQAA 5HWNA 3PO4A 2HHHJ 2XISA 4O17A 4NLVA 3VQSA 4WY0F 2XY7A 4I69A 5F41A 2J7KA 3QATA 5KFXA 1OFPA 5K9CA 3SFUA 2RD5C 2OFHX 2J75A 3R0KA 3WDRA 2BDQA 2GJIA 1CJTB 3LO3A 3L0GA 1QU4A 2PWUA 4C8NA 4DFJA 2Z1BA 4GABA 5FKYA 4JIHA 2PRLA 2QCMA 4D3GA 2B7QA 5FOOA 5ETVA 1B99A 3HHEA 1B30A 3WNNA 2D1CA 2BGQA 1OB0A 1K7XA 1VFUA 2ZX6A 4U28A 3R5DA 3TA2A 3BO4A 3NPVA 4IQEA 3BOLA 3L2MA 4YCPA 2WO5A 4WXWA 1UJ4A 4LJMA 4G1QA 3CQJA 4UQAA 2I14A 2YZRA 3TW9A 1WKDA 3MMDA 4GC4A 2TSYA 4Q4MA 4NG3A 1ZAHA 2JC1A 1T9VA 2ISFA 3ALGA 2ZZ7A 4YS2A 1XD0A 1RV8A 1NJYA 1EA9C 3QKZA 2DGSA 1IIGA 4ZTXA 4KEMA 4GVBA 2PC8A 5EMKA 4DPXA 3ABZA 3R2DJ 2BKOA 2OR2A 1TELA 5AC6A 4OGZA 4X4OA 3UG3A 1N5VA 5LZLA 4PWDB 3E0LA 5JMUA 1HQUB 3CCUS 4HOWA 2B9EA 1W9BM 2PDWA 5B7YA 3K8MA 3CCQS 3MKCA 1X7IA 1EXBA 3K13A 1Y10A 4I9TA 2VQEJ 2PMZD 3CC4S 3QGAC 1ODZA 3DMJA 1RA6A 2WC3A 5HNNA 5JVGQ 2X1FA 2EKNA 3MR3A 2R7UA 2XUCA 5HVFA 1CW2A 4IG2A 2Y8UA 4UTFA 2MKHA 4GKJF 4Q3MA 3W2UA 1R9XA 3W02A 3LQVA 3UD3P 3G6YA 3CCWA 3DYAA 4LEFA 4DJDA 1NDZA 1G7CB 4UBPC 2BACA 3DOMB 1NTHA 3MM6B 1ZALA 1FH7A 5DY3A 2ACYA 1G7UA 1ENUA 1FTXA 3FZ2A 3KG1A 1SJDA 3AO0A 2G41A 3K2YA 3GVWA 1OX4A 2DGXA 1FRMA 1XFBA 1LWIA 3ITVA 1SQGA 2ZUMA 4UNKA 4P2VA 1UW4A 2IJNA 2K7KA 4IZGA 5E0CA 4AHOA 2EFVA 1MLAA 2QKFA 4ZVUB 1MN7A 4P7OA 1ZLPA 4JNMA 1UZ1A 2XS5A 3GVVA 1PZ0A 3K5NA 5FEZA 2E7XA 2XFRA 2PURA 5J2NB 1UD6A 3MI2A 4BLGA 4DQIA 3I5CA 3K8VA 2OKOA 1FCQA 2N3LA 3W2LA 4NEZA 2YYTA 3R8YA 1TPDA 3P67A 2ZNZA 3EBVA 1AFIA 4P8XA 3A13A 3VDGA 3TJIA 1E6PA 3ETMA 4PEKA 4PYAA 1IBKJ 1QAPA 3OLBA 2N82B 1Z8AA 4QWEA 3N6JA 3NQEA 3G9CA 3B9NA 3IBFB 4JI4F 1WZKA 5DCEA 1MQPA 4KV8A 3R6IA 1BF2A 4IMAA 1UZHA 2XGBA 3OT9A 1M03A 3P4UB 3Q8YA 4GIRA 3UZXA 3AS1A 3BN7A 4JL1A 4EYHB 2BS9A 1PO9A 5DG9A 3GWQA 1U1KA 1W2PA 5DCBA 3FXGA 3KK2B 3IV8A 4DX6A 4REQB 3EX7B 3R27A 4PEEA 5LL6d 3QGIA 3MWBA 1HL9A 2EBGA 4IG3A 1M5PC 3S3GA 4LCQA 2ACMA 2R1LA 3FFSA 4YVVA 1FTRA 1V6VA 3BH7B 4Q8QA 3KVLA 1YRTA 4ZR8A 1LWEB 2PAJA 3FAWA 2OO0A 1EP4B 2KYZA 5CH7B 4LFCJ 3AXIA 2XYLA 3FGCB 3P5TL 2F3JA 4DZHA 4HP5A 5I6SA 4L4LA 2F8HA 3M0MA 2L08A 4WGXA 4Z2XA 5LNWA 1TWWA 2VZVA 4I9AA 1YGYA 4DR1F 3S2CA 3CZLA 3MV01 2E5LF 2HHTA 3HDSA 4Y9PA 1O66A 1XERA 4PPDA 4UTJA 5D4LA 1X4FA 4URGA 2M5YA 4TQSA 1NWRA 3E6EA 1HWLA 3GJTB 4D6CA 1CG2A 2IBOA 3LUYA 5A6BD 3FCWA 2I9EA 3WK0A 1QJWA 2CPXA 2NLWA 5IZHA 1W25A 1CXKA 4F0RA 2J9DA 1RLDA 1U5HA 5A2QU 1TAQA 4OLOA 4W89A 3MYOA 2PS2A 4C1LA 4CD5A 3NJ3A 1XBXA 2OD4A 2BANA 3BICA 3PBMA 3ZQ9A 2YWHA 3F2BA 5DN1A 3M7WA 3GVQA 1YTEA 5A6TC 1HYSB 4PODA 2NQ5A 3H4WA 4OZ1A 4N5SA 3AB2B 2R1NA 2X05A 2BVTA 2EW9A 4J28A 1NAL1 3HHKA 3KCLA 2HMIA 3MSDA 3KS6A 3PR2A 3KXQA 7CGTA 5B7WA 3DRSA 3MM5A 2OEMA 4F3QA 3DFTA 2XDFA 3I9ZA 1I6NA 3K59A 2R7TA 2PTZA 2WCAA 2HHPA 4RLEA 3ONBA 1G6BA 4JTCA 3BV8A 3IXQA 2VG6A 4W8AA 5DZ7A 3FCVA 1VBHA 3CQ0A 4MG4A 1S0NA 2F4FA 3KWMA 3UWVA 1E6ZA 2Y1HA 3M1VB 4KAIA 5JU6A 4M5JA 3THPA 3WJXA 3TX8A 1N5TA 5K2ZA 5FDLB 2LKZA 4ZVFA 2PF0A 4FKYA 1B3WA 3LCLA 2L9WA 1O1HA 2W9MA 1NDPA 3SGGA 2QDEA 3C3UA 5BRBA 2XIQA 1UWRA 3OVSA 2ON3A 3FY1A 1KR1A 3N2TA 3D6FB 2QA4S 2WC7A 4MDPA 4QP0A 1R8HA 4YR2A 5AT1B 1SV5A 4IOAQ 3DLGB 2PBOA 4HHLA 4IG2B 4BWLC 2CIMA 4HSNA 2OWCA 4BHQA 3N29A 3NS6A 1HI8A 2QCCA 1V02E 4CNYA 4JI4J 4ZIWA 1MU2A 5AECA 5KFZA 3DYAB 4ZVOB 2XEXA 4CD8A 1RD5A 2UVRA 4Q4SA 3CD5A 2A7NA 3LM3A 4NNAA 3P74A 1JLQB 5EWFA 4UR8A 1HQEB 2BE2B 1H7XA 1OX4B 4ALDA 3NNAA 3QIPA 1UD5A 2BVDA 1T0OA 4S2BA 1U26A 2I1RA 3NSXA 1DXFA 4PPZA 3FSIA 4P5UA 2Z2MA 5GVJA 1QT1A 1IGSA 3TXVA 3TJAA 1Z3NA 5FJIA 5CAHA 2DNNA 5EMJA 4R85A 3O5TB 3Q45A 2O3DA 4K38A 3UDLA 3UFCX 4ECQA 4J40A 4K3ZA 2EAWA 3CDBA 2W4CA 2FH6A 1A49A 5HMEA 3WH7A 4DJFA 3ZC4A 4GKLA 3FKBA 2B4PA 4PBFA 4ELVA 4S23A 4M6PA 3LGEA 3PVXA 3MFHA 3IIOA 3UXLA 2DXFA 4DR1J 1E72M 2E5LJ 4E3TA 3OVBA 3AIBA 4AZBA 3W1TA 1GYLA 5FF0A 3MWAA 1W2BR 4AAJA 1AD1A 2OSXA 3A3HA 3FRYA 4Y9NA 4YQWA 3ZLGA 4AWUA 5DZ6A 1U2RA 2V8HA 3A3PB 2YL8A 3PS7A 2DIUA 1HKIA 1PX3A 3FN9A 4ECZA 4A8KA 3CTLA 5F8GA 1P0NA 4C7DA 3TR2A 1GMUA 3KBMA 2XINA 4D6IA 5GJPA 1Q6RA 3RMEA 2PD9A 1ICQA 1N33F 3GWCA 2VEFA 4JIEA 3PHTA 1UWIA 1ITPA 1RK6A 3JSMB 1VCTA 3MD1A 2NW0A 3DAQA 1FFWB 1RAKA 2WBGA 2RH9A 4Q0BA 1C7TA 2FHKA 2YSWA 1ZTWA 3WL0A 4D1JA 3N6MA 2QSFA 3HM9A 4Y2AA 4M95A 4XZMX 4N4PA 2ZWPA 4AD3A 2XSJA 1DXEA 1CX9A 4Y9AA 4RBUA 3VX1A 4F4XA 1C1CA 2G3JA 1V79A 2D2GA 2X2YA 5G1MA 4XISA 1ONWA 4H6KA 3WD4A 4A2SA 3MAAA 2GFTA 3TCEA 3AHPA 2XH0A 4JTFA 3FQKA 3VAMA 1FHLA 5DMMA 5EWGA 3CXCR 3IUHA 1RT5A 4FO4A 3BN4A 5K7JA 1Z69A 2BXZA 2QF7A 2NCKL 3S5ZA 3VM5A 4CM2A 1JLEB 2V50A 4JV5F 5GMEA 2XVLA 3SECA 2OPQA 2QJIA 4AW7A 1DJZA 2QULA 4YTRA 2JVRA 4I2QA 4H4MB 3HM7A 3EUNA 2PE8A 2E6DA 3H2FA 5AN7A 1E40A 5AC8A 3FSUA 2MQPA 2E77A 4X60A 2YW3A 4Z2IA 2CERA 4XVEA 2AD9A 2NUHA 4KPCA 5I3HA 1D2KA 1T8XA 2C15A 2CLPA 5IXUA 3C2OA 2FZBA 1PILA 3M7VA 3AJDA 2QIIA 4KFBA 4P10A 5L9XA 1OADA 3EGJA 2BANB 1YEYA 5CYQA 3D68A 3QEZA 4GXWA 4EANA 3RU0A 1EO5A 3GE9A 1VQSA 5E41A 4V1Ak 1EBHA 4NZ6A 4D6EA 1SO6A 2NXIA 5BXRA 2GJLA 3LCIA 1L3KA 4K7VA 3PZPA 4J9VA 2A85A 4CU8A 5D9NA 2M8DB 4DF0A 4E4UA 1TV2A 3UJSA 2HMIB 4ZN3A 3EWUA 3N28A 3SUSA 3MM5B 3OVGA 2PBGA 4FLOA 3MM8A 2QCNA 2WW5A 2EPNA 1K9EA 4Q8MA 2ZJRQ 2X51A 4JHOA 1OFOA 3HFYA 3G82A 5FACA 3KTQA 2QTWA 1VFLA 3CO0P 2SXLA 2MGZB 3LXAA 2R8JA 3VOCA 1FWWA 4D71A 3NWGA 1G94A 1XIBA 2XHCA 3JQKA 2PLCA 4AF0A 1QSSA 4NX5A 5CZJA 3ICJA 3TTOA 2P9GA 4H8HA 5TQLA 5HBFA 3GAKA 4A22A 1GZJA 2DFAA 3T40A 1NELA 3EWDA 3WSUA 1KQKA 1XJWB 2HVZA 3ZWSA 4LAUA 3PR5B 3TQEA 1QK2A 5DT7A 4LFAJ 1SQ7A 1JCTA 3DFOA 1RQHA 2FFIA 4ZO9A 1WZMA 1V5VA 4P71A 4GGHA 3PEHA 4K4XA 4DF4A 3WMLA 1SV5B 4IPLA 3AU2A 1GFWB 4AH7A 3DU5A 1AZ2A 1T95A 2C14A 4F79A 1SL0A 3RMJA 2A79A 4S39A 1U2FA 5KSWA 1MU2B 1EB3A 2ABBA 4DV6J 4EBDA 1APSA 2XMJA 5F4SA 4C8LA 1JCMP 2BV3A 5T7LA 2WK2A 2XIIA 4W4QA 1N33J 5K4XA 1RT4A 4IQLA 3WDIA 2QJJA 3KM8A 1OCQA 4X2PA 2V9WA 3VD5A 3QIPB 1P0KA 4I68A 3W9ZA 4MAVA 4CN6A 1XXXA 2E4TA 2QO3A 4WD0A 2UZAA 2EGZA 1QOQA 1PKUA 2PGCA 1FHTA 4LVFA 4LUSB 4KEUA 4UR9A 5D4PA 4ZA1A 3KG4A 5B0DA 2FVRA 2P8BA 4O1EA 4L9ZA 4PTXA 1VEOA 3RO8A 3CEDA 3AOBA 5A2QY 2MZJA 3BG5A 3ISNC 3GZ7A 1BG9A 4URQU 4ATWA 1FUYA 1RWVB 4TTGA 4DB7A 2WVTA 2VF3A 3M6WA 3UNGC 3QV9A 1IEWA 4ATDA 3L4XA 1L9WA 1YNPA 3WG6A 4FS2A 1EBGA 4LAOA 2E5IA 3NXFA 5F2GA 3QPYA 2C6QA 4LYPA 1XGDA 5XIAA 4DRSA 2E5JA 3OVRA 2HZGA 4JV5J 3A6OA 3TTEA 3IVTA 1JF5A 3CW2C 3LP1B 4WWSA 4S3EA 4BEUA 2OQHA 4NLUA 4ZL1A 2MSSA 1TV5A 1NK5A 5BNKA 4P52A 4L6V3 5T9BG 1DPMA 4ZGYA 4DUTA 1WDQA 2WMHA 3OL6A 1BKSA 1HP4A 3A64A 4N41A 3MMWA 1JUKA 4EWTA 1A0CA 4ERIA 4C3LA 2CZ5A 3N2XA 3ALFA 2O4MA 3JS3A 1XLAA 4MTVA 2BQ3A 2D9PA 3S83A 1WKJA 4AVNA 1O60A 4K4ZA 3LXBA 3NLCA 3ZS4A 3ZO9A 2I5JA 4ZHRB 2Z24A 1EETA 3W72A 1DBDA 3MT1A 5AE3A 3KHLA 3HO8A 5HMYA 5F4XA 4DPOA 3BSCA 4QGCA 4MYTA 1SJFA 4E4FA 4ZCLA 4B2DA 4IPIA 3G8SA 4ZEPA 2QF8A 4TO8A 3MA8A 4FF7A 5J5DA 1CT5A 4NZ5A 1OD8A 5AE1A 4LRAA 3I56S 3E5BA 4PCNA 3QT6A 1HW8A 2VO5A 2J5AA 2J7UA 5HMFA 3LCHA 4C6EA 1C1CB 3GHSA 3MAAB 1MO0A 4R8UB 3HGSA 3PUGA 2HFVA 2PDKA 4DFKA 2ZE0A 3CC2S 1FDJA 1RT5B 1WDWA 1O6IA 3G71S 4B5UA 2MZ1A 2J66A 1KLZA 2AL2B 5CG7A 2NPIA 1WP6A 1ZM4A 1HF6A 3M0KA 1ZPTA 4P7RA 4LF5F 2N4DA 3EX1A 5EKYA 2HBZB 3GW0A 2QAFA 2R2RA 3GYXB 4H4KA 4EBCA 3M7SA 3W24A 3GB6A 5U7SA 4EF8A 2DNZA 1V6WA 1KXTA 3CNYA 3R2CJ 1ZBVA 1TJ0A 3S01A 3W64A 3TU9A 2FD2A 4O54A 3II1A 4KRZA 2Q6BA 3LMZA 2DIVA 2BY1A 3V6JA 4PQUB 4W92B 5CYQB 2RRAA 1A5KC 2CDQA 1AW2A 1LZOA 4NRUA 4Y8FA 4M5LA 3ITCA 2CJKA 2CFXA 3S1GA 3HJZA 4NMLA 3TVYA 1NQKA 1ISVA 2BNJA 2JF6A 1LQ9A 5L9NA 1PCKA 1BC6A 1IKYB 4ALZA 3OB8A 2WVBA 3I6EA 2CLKA 3OZMA 2VRJA 1CB2A 3ZR4A 3FYOA 1UB3A 4IO9Q 3RTVA 2YQ1A 3G82B 2JWNA 4CP5A 4MK8A 4NSBA 3CJTA 1H3DA 3CE8A 3R25A 1UEUA 5K14A 3AHYA 3BYPA 4EMDA 3NO5A 1MFVA 5GJNA 4AF0B 3D28A 1PZ1A 4X4RA 3KOAA 2DORA 1Q82T 4ICLB 1CXHA 3OHBA 1QATA 2JSXA 4EXAA 2QZRA 4HN8A 3N14A 1D8YA 4ORMA 2PSZA 4UIOA 2E1DA 1YTDA 3PJUA 1KQGB 5EDWA 2ZKMX 3EWZA 1E6YA 2QFIA 1O6XA 3M4HA 1B31A 3W1AA 3RM4A 3EGWB 1E71M 1J4EA 1E6RA 4GYJA 1IIHA 1UJQA 1J12A 2ZZ6A 1EUNA 4DIAA 1EC7A 1M01A 1Q8BA 2CQDA 5D30A 3EKZA 2MQMA 4TTUA 2YX0A 4O1FA 2MMYA 4GUIA 4WOZA 3RXZA 1ZAIA 4KMQA 2MKYA 1TV8A 1X1NA 3UQSA 4DPTA 2GSJA 1A0OB 4RXGA 5T7LB 5HLFB 2BJ1A 4HEA9 4DZIA 1RT4B 5D0EA 3N4AA 3SRKA 2IC3A 1SO4A 1U0HA 4ORIA 1U7LA 3KP0A 4XKYB 1TV3A 4URIA 3V5RA 1WC3A 5C9ZA 1A53A 2AQOA 1UKPA 5BU9A 2PB1A 3O0KA 3SUWA 3DXIA 2ZE3A 3LBMA 1EO7A 1IT0A 3WQPA 3TA9A 3VXGA 1YX2A 2HRWA 4B5SA 4ZLJA 3KBNA 3MMAB 1E0XA 4W90B 4ZPVR 2P0OA 1HW9A 1V7YA 4ZCKA 3ENWA 4R33A 5G2WA 3URAA 1F3TA 3PJWA 2ABYA 4Q7NA 1GX6A 3EGNA 3MPUB 2VPYB 4KHMA 3KTXA 1NDWA 4U6PA 2C0AA 3W7QA 2LEBA 2DIJA 4YWIA 3IM8A 5CYMA 3KBSA 1EJUC 3GYGA 1X31C 4ZENA 3K89A 4ICCX 4S3CA 1J0IA 3WEOA 1VQOS 1CEZA 2R9LA 4K37A 1DJQA 4NEYA 1JFHA 3B8TA 3PZVA 1EX5A 1RAAB 4KYZA 2XG9A 1WXZA 2DNPA 1XPYA 3T2OA 3TMLA 4K7QA 2CKRA 4JTGA 1E4LA 4V27A 5CSUA 1SC1B 4RKAA 1PIFA 2BY0A 2OT1A 4DXXA 3O1NA 2AGQA 1FJEB 5D4NA 4JS3A 5AVHA 2JFDA 2JLEA 2VJXA 4PMQA 1UQZA 4OZOA 1BD0A 1UIPA 5AHNA 2C1IA 1HQ2A 2I5JB 1NK9A 4GO5X 2BXVA 2PGRA 3QR0A 1EETB 4DN9A 1KV8A 4NRRA 3H42A 2PDJA 2LDIA 1U83A 4KH2A 4X63A 2ZE2B 1PZ2A 3S5NA 4ID5A 3PFEA 3Q8RB 4E2OA 4A4JA 4UOFA 1UVMA 1D3CA 3VV2B 3WNLA 1PG5B 5L39A 4V1YA 4LT6A 1IZKA 4WRHA 4NYZA 4JI3F 4JTLA 3UXAA 1OINA 4U10A 4HR2A 3VTIA 2M0GB 1OCNA 2DITA 2GGPA 2VX4A 3GJSB 4RO0A 4UW2A 5I3DA 3NPXA 1YJ9S 1HD0A 2RGLA 1SO5A 4USVA 3O0FA 1NLKL 1QM9A 4IDKA 4AYGA 5AY7A 1LUCA 2GQ9A 4IT1A 2GIFA 4CLYA 3MVTA 3HSJA 2Y8YA 2F2HA 4W4MA 1FWAC 1QRQA 4IFKA 2CIPA 3DFPA 1FI4A 1RUSA 1CJKA 5A0YA 3GTIA 5EGRA 1HWUA 1P1LA 2D73A 3NQFA 4HA0A 1SFTA 2NQLA 1S6QB 4U95A 1HVQA 4OI4A 1AXQA 3HG2A 3MUAA 3ZZOA 2E1WA 1VC5A 1XK8A 5A3HA 4EKJA 3WD0A 2Q8ZA 2J6TA 2DT0A 3BSGA 3T0DA 2LECA 1MUWA 1FP9A 3EWYA 4D2JA 3L9CA 4H7ZA 2W8KA 3J7Z5 4QWAA 2NS1B 2EPHA 2W24A 2NV9A 2NREA 2NXCA 4ECWA 3IBCB 4UTLA 3PRBA 4A8QA 2Y7GA 3I0RA 2I5IA 4WFNQ 1JI2A 3DKJA 1U6ZA 3AALA 2OI2A 5RUBA 4J4KA 4HU4A 1NRKA 2E3ZA 1Q78A 3BPWA 4MT1A 4AXNA 3BAYA 1BYAA 2J7FA 4M5NA 3GFHA 3KDOA 1W1VA 1AZ1A 1EP3A 4K1WA 1ELSA 4QX4A 3VCCA 2ZADA 4E38A 4TYAA 4ED0A 1FHDA 2ASHA 4KQZA 1ZENA 3LHVA 3H8YA 4UUXA 1BPLB 1HT6A 3C6CA 4KEZA 4DV4F 2VFSA 1XKJA 2Y63A 1PV8A 2YFOA 3IR6B 3BW3A 3UNDA 2BE9B 3CMJA 2GMLA 3LHUA 3OL7A 4KPLA 3WYZA 1YMYA 3PBGA 4TN2A 4FIRA 3CASA 5DGAA 2YB4A 3WD1A 4IR9A 3EYPA 1PDYA 1C4AA 2BW2A 2XVGA 3R97A 3PB0A 4JY8A 4DAIA 1ZBTA 2IVYA 2N7CA 3U5UA 1S72S 2WK4A 1SUQA 1FWEC 2ANUA 3VUPA 3M64A 3GDMA 3TK7A 5EX0A 3C66A 1EKOA 3B4DA 4DELA 5K8NA 2ZRUA 1SQEA 2ZWYA 1SW7A 3SCTA 1Q7ZA 4HYRA 1LWJA 1SQFA 3PW4A 1ISYA 1SU5A 3UA4A 1VQLS 1OYBA 2XS7A 3U1NA 4DNMA 1D9FA 2V3EA 4UNLA 4MLJA 3F0NA 4O0ZA 1E6SM 5MLCV 3PUOA 1R6VA 3TOQA 2KVQE 2JZ5A 1LW0B 2YYUA 4I7UA 2DSZA 4MDOA 1CQNA 5C9XA 1FO1A 1SJQA 4RW4A 2A3JA 3DXSX 4WTYA 3N79A 3OTOJ 2GW8A 1A5LC 2HG4A 1WEXA 5LOQA 4CN1A 1W5MA 2IC3B 1R3SA 4F9JA 5HWJA 4R53A 5DO8A 3L2LA 2CG8A 4G9PA 4NX0A 4Q6JA 1UC5A 1VS3A 1LF1A 2FTWA 2CESA 1Y9OA 3ZLHA 5I42B 3WJZA 2OX1A 2CBVA 4D6FA 4A8WA 2OPJA 2XVPA 4ENOA 1UEVA 5KFUA 1LFPA 2X2GA 2M8HA 1P5BA 5GQBA 3WFAA 3D54A 5GAHU 4PBEA 2J79A 1LRTA 4JI3J 2FTPA 4KGLA 2UUCJ 2QPSA 1YG0A 1LQAA 5LIWX 3LWLA 1BTCA 4QIWD 4XD5A 2K2PA 4K2JA 1JZ3A 3I96A 3OLIA 4QAWA 1OD0A 3FOKA 2DPEA 3BK0A 5D3GB 4C4WA 3SN0A 4Z1YA 2X0YA 3K2GA 4FB7A 4B3RF 3EWBX 2JALA 1RT7B 1OF6A 1VBXA 4K7YA 4IQJA 2ZYFA 4IUGA 1F61A 4KTQA 3C14A 4DUXA 3WD2A 1KOHA 1PWMA 4IJRA 3AIUA 3V3WA 2HWIA 1FWRA 1X9WA 3ARTA 3TAPA 3WEZA 3TUZC 4CQCA 3UWZA 1WDRA 1C93A 1SFSA 1XBVA 5D04C 3MKKA 4NQ1A 3NDYA 3ZZRA 2Q8XA 1A0DA 1IGWA 2PGFA 2WSYA 5FF4A 3R58A 2W4XA 1I2QA 4C8YA 3S6TA 1C0UA 3KAOA 1TUGB 3N6HA 1F1BB 1TZ0A 4BKNA 2YQ3A 3NO3A 3CCJS 1T6MA 4NAFB 1JD7A 4C6JA 3NPUA 1RLCL 5C0QA 5A94A 3GV8B 3SY5A 2DXEA 3J80U 4GY7A 1XIMA 2GVLA 5K8OA 5DQHA 1X5TA 1U8SA 3AYRA 4QITA 1EDGA 3VOFA 3CPUA 4ID5B 2IVMA 2JRSA 3C86A 2HVDA 3DCPA 1WDPA 3RU6A 5JXQA 4ES2A 4NAEA 1U48A 3U7JA 5CKSA 3P60A 1FHVA 4RZ5A 1S6PA 1S49A 3DECA 2FHJA 5HSPA 2AU0A 4GXPA 4MNJA 4KGXB 3BV7A 4DV4J 1R46A 1VC4A 4FALA 2IMRA 3EM1A 5IBXC 3UN2A 1S46A 4NLDA 1S6OA 5CZTA 3R94A 3MDWA 3VWSA 4HPGA 1JZ4A 1NMEB 5AOUA 2H5IB 1CPZA 5KFLA 2AHOB 2KZHA 2V4JA 3EB3A 3T44A 2Y4SA 3CJ2A 2RDXA 3R13A 4N9BA 4PTVA 4IFKB 1N8RT 2E28A 4Q7IA 4JICA 4Z2HA 1TV6A 3GJRB 3SQGB 1LQ2A 2X40A 1HMVA 1IR1A 5HDRA 3N3MA 1XIQA 5F8LA 3BLEA 2BA9A 5GNYA 3CB3A 1ZUAX 3V36A 1SJBA 3KRZA 3JQMA 2V2CA 4PEOA 1LV5A 3R9LA 2VURA 2MTLA 2Y9HA 3WX7A 4JN6A 4WCJA 2YW4A 3BGGA 4WF7A 5BW6A 3ONQA 3OA3A 2PT0A 1E15A 3LI0A 4ZVGA 1EXPA 3J81U 1X5SA 3VNKA 1J0YA 1KP6A 1WZAA 1PL9A 2PRMA 3FJ6A 4LC8A 4HCHA 5E1QA 1GXLA 2UUWA 5CZXA 4WUIA 1IJFB 3MURP 3TYBA 4J9UE 1Y7PA 4FXFA 4A8IA 2BDPA 2DT2A 3H2AA 3GCXP 3U9IA 4P72A 4J3WA 1J11A 4U9RA 1M41A 1FD2A 2HQFA 2J9DE 3W71A 1VQ4S 3RR7A 4ROQA 1KFWA 2W92A 2MANA 1GPWA 1PXGA 1BG4A 4G7EB 5TD4A 4GUJA 3WLHA 3OL8A 1V0LA 7XIMA 4XVDA 1Q4NX 4ZS6A 3MP5A 3BWWA 3FKRA 3CIMA 4WBFA 4QIUA 2DUAA 3CL8A 4GGBA 4XPCA 5EN1A 3A5FA 1S1XA 2XHWA 3C2VA 2QCHA 4RNIA 4Z7CA 3C19A 3F1QA 3QO9A 4FS1A 3W29A 1WTFA 4C7QA 1REQB 3E49A 4PN2A 3LGDA 1HKVA 4C6PA 5EYWA 2H4YB 5M5DA 2ZD1A 2RQCA 3UQNA 4ZVJA 5G4WA 4PCQA 4B3RJ 3VINA 1Q2RA 2YKAA 1S4EA 3V16A 4WOQA 3GQCA 3EOEA 3TN6A 2G97A 4KEVA 1GAOA 5A6BA 2WMGA 4UOCA 2KT2A 1NK7A 3NQGA 3VD4A 4CRJA 4OQVA 1OT1A 2DR5A 4EYIB 4NCGA 4IH6A 1HWKA 4O4RA 4MIBA 3OIHA 5KZDA 3HVTB 2R7VA 4C3MA 4HCLA 1TAUA 3A9IA 1N6QB 2G3IA 1O5QA 2ASDA 4K50A 1MUCA 4EAMA 1FH9A 3SR7A 1BAGA 1RK8A 1Z4UA 1U0SA 1NK0A 1YQ2A 4AL5A 4H8VA 2WNZA 5A8RA 4RBTA 4YR0A 2DNYA 4JP8A 2VG5A 2OYKA 3HULA 3CZKA 3DBNA 4E2BA 2WSCC 4WYWA 1RTZA 2B5JA 1S2VA 2YDAA 1DVJA 2BE7D 1F4AA 4C6AA 3T9PA 2ZX5A 4WZMA 3FYPA 1EGMA 3P82A 1F8IA 3WLTA 2PODA 2WWDA 4PCTA 3TC3A 2J4GA 1FRJA 1WF2A 3AY0A 5I09A 2HS0A 4A2RA 1AFSA 3G1XA 3GE7A 4CVWA 3B9EA 2C3PA 5XINA 1AYEA 4ED2A 2FIQA 1UPPA 1LP6A 4EZ6A 2HHVA 5L6UA 3KL3A 3U7VA 3VKJA 2F4VF 1YBUA 2ZOXA 2ZRZA 3MI6A 1KTCA 2DGAA 4HNCA 4W85A 2B6AA 1T03B 1ZOTA 1K02A 1Q7YT 2K3IA 1AL7A 2BVZA 3L7RA 1WAUA 1JLCB 4AIUA 4MZ1A 3BKTA 3MVIA 4G7FA 2FJVA 1H0IA 3OOQA 1BYCA 4PKDB 4QYZK 8CGTA 2A2DA 3M2VA 4CNTA 5E0OA 2D69A 4PBGA 2HE8A 5G1TA 1N32F 1REVA 4NT0A 4JKLA 3N4FA 4EU0A 4GQBA 3R8RA 3PZQA 7PTDA 2W63A 1XYCA 1EEPA 1L3SA 4CNPA 3LN3A 3QGGA 2K06A 3BBFA 1TR0A 3HJVA 3DEQA 3T05A 2Z1KA 2OSYA 4F4RA 6XIAA 2PMHA 3Q89A 1T40A 4W7WA 3W3OA 4U5IA 3H4XA 4Q4PA 3VCNA 3VIMA 4KHRA 2C91A 3R5JB 2ZOGA 4LPCA 1V77A 5L46A 1C8VA 3JTPA 1HKWA 3WJWA 2G4BA 1JG9A 1J01A 1OWQA 1XH0A 1JI1A 1GOXA 5H8PA 4H9YA 4B3SJ 1S6PB 2FUG9 3BZGA 1RY8A 3EXSA 1KBBA 1O94A 4EXQA 1P4CA 5G1YA 5U4NA 5KT3A 2M70A 4JYAJ 2HCVA 3KHGA 4I0WA 3TFXA 4WP8A 1NZ8A 3GCWP 2ZZTA 1VI7A 4Q43A 4KWOA 3CHEA 4U7CA 1IE7C 1RA5A 3HG5A 1R27B 3APGA 5TIMA 1UUOA 3CB8A 1TFYA 3T6JA 2XWEA 4IISA 1VBGA 3IRDA 2J0XA 2AGTA 4NXMF 5I24A 1RYRA 4XTTA 2DRAA 2XSXA 1NDYA 3A12A 3PHAA 4MFDA 3CIWA 1TCMA 1HMVB 1KBJA 2E9LA 3M0LA 4L80A 3MOJB 3FDGA 1U47A 3BAJA 5LSMA 1ZZMA 3WQ8A 2DZTA 3UGRA 2PEVA 3CZJA 4DL6A 2MYFA 4HNVA 3ANVA 1W1TA 4DBSA 1JDCA 3C5QA 3WLOA 4DUVA 4KH1B 1XRTA 3ABOA 1KO0A 2BR0A 4US5D 1ONRA 3RM9A 5HNUA 2J0QD 1SFJA 4HOZA 4IWWA 3ILOA 4RR5A 1CLFA 3M2UB 1EX8A 3EXRA 1XCXA 4KJIA 1D9AA 4DUZF 1SKRA 1TTHB 2VOOA 3I31A 3PJTA 1V4YA 4RPFA 4NCAA 4NASA 5HWMA 3RRGA 2VUNA 1UQYA 3RAOA 3CMAS 4BI6A 4JEQA 1CI1A 4NILA 2ZBPA 2HBQB 2O66A 1F5BA 5E3RA 3WNPA 5M2FX 3DHUA 1FY6A 5ENLA 2RFGA 2BY3A 3W01A 1IN0A 4ASTA 2D74B 4BA0A 3QO9B 1S7IA 1XG3A 1YRRA 2W6RA 3SEPA 2XN2A 3B9AA 4AZCA 3PYDA 3PG9A 2CZVA 3DIPA 4DV2J 3CIVA 2XIOA 5FJJA 5C2XA 5A6PA 1SB6A 2REQA 2ZD1B 3FSXA 4Y6IA 4YTTA 2F4VJ 1XP3A 1KW1A 1VS1A 3G8QA 4XIUA 5EMYA 3SCJE 1VHNA 2WZMA 4NF7A 2FVLA 3W83A 5IHRA 3TAQA 2WSKA 3U1LA 1I1WA 1OFRA 2J13A 3JW7A 4XB3A 3T1YJ 1Q6OA 3IJDA 3RLVA 3GU9A 2EFQA 1X0FA 3HVWA 1H2VZ 1HBOA 3RW6A 2DO4A 4GJJA 3E3HA 5M2RA 4GQRA 5DLGA 1N32J 4GRSA 4ZB0A 4C8KA 1TWDA 3GIIA 4F8XA 1BYBA 4DWSD 2DNLA 3G1AA 3TEVA 2HE5A 2AJ4A 3WZ0A 3TAKA 1LKZA 1LLOA 4KGKA 3ARSA 2X1IA 3B06A 3S0CA 1E9LA 1Q5MA 1EZWA 2NXEA 3WBEA 3RPDA 1AODA 4KO0A 4WJ8A 4NWBA 2VG5B 1VD6A 5AHLA 4NLRA 5DG7A 4HZ6A 4IXXA 2FLOA 4EE9A 1GVRA 1E56A 3V81A 5G4DA 4IIFA 2D1ZA 2LQBA 4K8RA 3SDEB 2DP3A 3M8PA 1RT1B 1N5SA 2IPWA 2OMOA 3C8FA 5C54A 4PMDA 1GWJA 4XAYA 2HS8A 1QK0A 3GUGA 1FWFC 4TUFA 4UCFA 4YUDA 1C1BA 1RTHB 4WKAA 2ZA2A 2LYVA 2EJAA 1VRXA 2RQMA 3NG3A 4NI2B 3OV7A 2F6XA 2X16A 2EHHA 3DFNA 2B6AB 2F1FA 4OZLA 3K58A 5JXSA 3LD5A 4GQGA 2NLIA 1TL4A 3M0XA 1J96A 1KCZA 1MN9A 4NXMJ 1XYMA 5LM7E 3N2CA 1BE4A 4GCXA 1GPFA 4TU9A 3PP7A 3ET6A 1JNEA 1EJTC 3CHCA 3VUSA 2RDUA 3LV6A 3WLQA 3ABRA 2PMWA 2I9SA 1S3HA 5HQLA 3POCA 1REVB 3MPVA 1Z44A 1BQMA 1TK0A 3QH2A 3VDAA 3ES7A 3GDBA 4XAGA 3ZOAA 4Y3CA 4D6HA 5D4OA 2UXDJ 2F61A 2NXHA 2AEFA 1JXEA 3N4EA 2YCKX 1YK9A 4CYUA 1MNSA 2L5HA 3S46A 5GNXA 1V93A 3VVTA 3BDKA 3SGUA 4C6QA 1PJ5A 1WG1A 2GYIA 3MBFA 4ILMA 2J8AA 1DTTB 5DM6Q 4QE1A 2V4RA 3VAIA 2NQPA 3M0ZA 4V19X 2GUYA 2VWTA 4CDIA 3X1LB 3AXMA 1SZNA 4QWDA 1OY6A 1HNZF 4DUZJ 2O01C 3LMYA 4OT7A 3P5ZA 1VJIA 2EC2A 3LLFA 3DN9A 2ZHBA 1BGAA 4U31A 5A69A 2VA3A 1DIDA 1E6XM 1RKIA 2XMAA 2UVUA 4HMDA 3EX6A 3QMRA 2QA4G 1M5VC 1QUMA 1CGXA 3POTB 2O56A 2KRRA 2JF7A 4GVHA 3CNQP 1MWYA 3VQTA 4O18A 3L12A 5BMWA 3D5MA 5ETOA 4LALA 5FIIA 2VRQA 3OR2A 4KBIA 4TY8A 3G3MA 3PULA 1JQXA 4KWWA 4BCEA 3VYLA 3PNUA 5HO4A 1X4DA 2C2ZB 1M68A 2G0IA 5GADI 1UROA 2D20A 3ELHA 3W81A 1FHUA 3L0NA 1DHKA 2ISVA 2B56A 2C2RA 2XSBA 2CVEA 1RDRA 3PRDA 1UKSA 1CGUA 4YCOA 1RTDA 3BF4A 2WANA 4YVXA 1DJIA 1EPXA 1TRIA 2G4JA 1HARA 3MSRA 2ZZ4A 3KWXA 3M0JA 3RW7A 3T41A 4GFSA 2BJEA 1X6NA 5FCZA 1JXLA 3QZ6A 1KBKA 4M51A 3BSMA 3LALA 5L9FA 1QW7A 1RAIB 4ATNA 3C4UA 3THAA 1O7AA 2QLXA 3NZRA 2DJWA 6TIMA 3TR9A 5DO2A 3RB0A 5D32A 2GJPA 2NYIA 4EPKA 5HP1A 4TQRA 4K68A 1KM4A 3MUTP 1W0MA 2OMLA 1VFMA 2ISWA 4KIRA 2APOA 3O06A 3N9KA 1NIUA 1PPIA 1G6CA 3WCZA 4IUFA 2E9BA 2J88A 4XZWA 1FX6A 1TIMA 1XLJA 1K8YA 1PHWA 3CUJA 2PEBA 4EWJA 2ZJQQ 4H3DA 2XIBA 1NHUA 5FIPA 2RNEA 2EVZA 4ENLA 1V3JA 2JNJA 5D0HA 1FKWA 4HZ7A 5HROA 4Q5VA 2V63A 4FXWA 3KLEB 1JULA 1JZ8A 1VQ6S 3MSGA 3W7RA 1GMVA 2N3OA 4NRTA 3KHJA 2REQB 3H2EA 3SCNA 4YHGA 1JPHA 5I3PA 3LYEA 2C1GA 4XIAA 5MKGB 1JJ2R 5LHFA 3UVJA 2IM0A 2VFDA 1TG7A 2MHNA 1XF0A 3R3TA 2EPOA 5D33A 3UYIA 1LWXA 3SW6A 3UCDA 1Y3KA 1WNOA 1B3ZA 4H54A 2HNEA 2Z57B 4QR6A 4TYBA 2ADCA 3UESA 1RWWB 5C2GA 1FCBA 3R2GA 1RHCA 2EC0A 3LENA 1HBOB 1JYWA 5E6ZA 1OF8A 2ZH9A 1I94F 2Z4GA 3VGVA 1TPH1 3B8IA 3PPCA 1IEXA 4UB9A 4D1IA 5EGYA 3PANA 1TTPA 5KFCA 1LT8A 2I38A 3AXHA 3PTWA 2X30A 1O5KA 4K4YA 1S99A 3LHWA 3G1FA 5IC6B 5EMMA 2I6WA 4JBRA 1W3IA 3S9IA 3T5KA 4M24A 3JSRA 1UA1A 3PFOA 4JTIA 4EK2A 3C16A 1K47A 4P2SA 1KV5A 3UJEA 1U25A 1X8CA 3UO0A 3T0TA 1LG2A 3GFXA 4M82A 5TNVA 3U2EA 1KBRA 1OK6A 2ZDOA 1GVOA 1ZZNA 2WPGA 3VOHA 1YJWS 1P6CA 1NWUA 4KCTA 1EARA 1YJ7A 3M8PB 4L6OA 3VAJA 2XI3A 3BPSP 5IS2A 4JCLA 5ETSA 1K9MT 1MYRA 4ETXA 4FIQA 1F3EA 1UD4A 4NRSA 1DLOA 1UR4A 2H48B 4HK7A 2QJHA 1AH0A 2C7FA 3HKWA 1XKYA 4GO7X 3IK4A 3R7NB 1UP2A 1Q8AA 3AICA 4WXZA 1XFCA 3S1XA 1W1B1 1LL6A 2EG8A 1W8SA 3MMUA 3T3FA 3LCWA 4J3ZA 3QMTA 4ZCWA 4DL5A 4G6CA 2O5DA 3P8JA 4CO1A 1VAHA 3C8YA 2BY2A 2W61A 3PTDA 1I0DA 2HKEA 1RI7A 3BSNA 3EGVA 2FQQB 1UBPC 4EX4A 4CLUA 4DUWA 4GWEA 2GCFA 2UXBJ 5CJNA 6FDRA 2WRMA 2V2QA 3KTSA 4JQ4A 4AEFA 1BQMB 3KG0A 4KGMA 3WDOA 4RNJA 4UMCA 2BJ3A 2WB4A 2NZ4A 2HSEB 3ITOA 3WBXA 4Z2LA 3STPA 1OM0A 3RYLA 1QE1B 4KT0C 4DY1A 4FNTA 2V9KA 3H4GA 4MY8A 4DHVA 1XDMA 3PBWA 4FXDA 4QJ1A 1PYMA 3NDOA 1SZGA 4QIGA 4DYEA 2QMJA 3DGBA 4RNOA 2XLJA 5I3KA 1RU2A 2QCGA 3HOJA 4H9VA 2PU0A 1PAEX 1D3WA 1KM1A 3W60A 2V0NA 5D09A 2HV5A 1J93A 3AXXA 1LK7A 1YDNA 1YHQS 5E33A 4L7ZA 2VFEA 2VBZA 2QXWA 2FYMA 3PNIA 1R8PA 1FJ7A 4N6EA 1XLHA 3MI7X 3VVGA 2W2NP 3TQ1A 2C19A 5HPCA 1JDDA 4GMEA 2B9WA 3UVAA 4JTHA 4IGNA 1RABB 4OX8A 1VRTA 1FWJC 4HK5A 2P5NA 1R86A 4NLWA 4DAFA 1RJRA 4ZTYA 1YWXA 4UQEA 1GXUA 4JTSA 4MJ2A 2HQ3A 1SR9A 1HHSA 1RTDB 1S2AA 1MXDA 3RR1A 4LBHA 3TI0A 5D0GA 2C1HA 4JFWA 3UZZA 1IKWB 4LF7J 1QO5A 3TJ4A 4ZSTA 2FPYA 1DZ5A 2AGKA 1TKXB 4P73A 3EA3A 4Y00A 5REQA 1H7RA 1UH2A 4M5PA 2E68A 1I94J 1ZSXA 5I23A 3O3RA 2AL1A 7A3HA 2SFPA 1M0SA 4A8FA 1WD6A 2E44A 4Q7AA 3BL3A 4HI1A 1GT8A 3KS5A 2IKHA 3SQLA 4QSFA 3H4BA 3GPAA 4CNZA 3QTPA 3NOEA 5FEPA 2YCIX 4WU2A 2BOEX 3AQPA 1E4IA 4LSZB 3N6NA 3UY7A 4TXEA 4HI2A 3F4WA 4BCAA 1MMNA 1XLDA 2YKMA 2POZA 1NOFA 5HQ8A 3GC2A 2CWNA 3KXDA 2FB2A 2PEHA 1VBJA 2IM3A 2KJVA 1FT8A 1NPPA 4O52A 1Q4WA 2PDLA 4RZ4A 2R8KA 5AHMA 1VKFA 5HROB 4XO0A 3SCVA 1B9BA 3MO4A 2EI5A 5D2VA 2WBRA 4OX6A 5BYQA 5HN0A 4CLMA 3G3DA 4OV6A 5E6YA 3CHDA 4O19A 3R5BA 1P0EA 4HMEA 1GYNA 3KL5A 2X7WA 3T7VA 2WHMA 2L9NA 4PG7A 4RW9B 3VZHA 5AXNA 3KLFA 1SKUB 2HJPA 2DB1A 4OV4A 2HHWA 5FJTA 2I56A 1NJIT 1Q65A 3UVJB 2B81A 3BW2A 3EMCA 3IJ9A 1R85A 1UR1A 2XMUA 2G0CA 2PDYA 3PB2A 3AIQA 3CWNA 5GAGI 5ETKA 2B7OA 1Q6QA 1QI3A 1XINA 1TVNA 4LUTA 3PZGA 1G0CA 3W87A 2MKIA 4AXKA 2WMFA 4UQDA 4YN5A 3TVKA 3WQGA 2BJDA 3PUEA 3MMBA 4CLKA 2PDPA 4IG0B 1K9DA 2QUTA 1TKTA 4MJMA 2OX4A 3LY0A 3H5YA 3TZWA 3T6BA 4O3QA 3WIJA 2CQBA 2QYCA 1XC4A 1HWJA 1TL5A 5I3FA 3TQVA 3H2NA 1SH3A 1O0PA 1CPUA 4HHUA 2V8PA 3KLKA 1WOAA 3O15A 5AYZA 2YIHA 1L6GA 3GG8A 2XN1A 1KD1T 1VFFA 3N12A 5A6KA 3PN8A 1P7TA 1FK9A 3VK5A 3PYFA 1UJPA 2E5DA 5KT5A 1RAOA 1SJAA 4E3VA 3AS2A 3HPZA 2O1PA 3PC0A 5JUMA 1UVNA 5ETMA 1L3UA 2P10A 2A6OA 2NXGA 4WE1A 3QN3A 4INFA 4CCHA 1C8QA 5EFDA 1TP7A 4MY1A 4I7WA 2Q02A 2ZOFA 2WTFA 1DXIA 5H1SV 3LHZA 4M7TA 4E8CA 2HIYA 4ZO7A 3CUGA 1VK3A 1NF7A 1DLOB 2I0XA 3SRHA 2JLGA 4GKKF 3UPBA 3Q2DA 2HQDA 1PIIA 3LRLA 1ZCOA 4ZVEA 3B4YA 3EAUA 1RWKB 2UY2A 1Y0EA 2G2OA 1SI9A 2QCLA 4QIVA 4HA4A 1OT2A 2GDQA 4R34A 1DRZA 3UDCA 1QPKA 3O6CA 2NT1A 3NL6A 3OZYA 1L2QA 5J1NA 3F4CA 5CAAA 3F4NA 6TAAA 4WZQA 3VGGA 1FDDA 2CLOA 3WHIA 1J5TA 1LOSA 3PZTA 1U09A 2EPKX 2BX7A 1KS2A 4R5PA 5KT4A 2DPJA 3IJ7A 2FY8A 1NSKL 3LA0A 3MWCA 5FL1A 2PE4A 1VC0A 3MQTA 3DKDA 5EX3A 3IVSA 3KRUA 3PY8A 3CMES 4EUVA 1K6WA 1SYTA 3AOAA 2ZZ5A 4EO8A 4YR3A 4P2FA 6FD1A 1BSLA 1J27A 5CGMA 1ZA2B 4GJIA 4I2PB 1QLNA 2PDCA 2DIKA 9XIMA 4DXLA 2GC8A 3WUBA 1HL6A 4PUDA 3DUGA 3G1SA 3MPDA 3QLHA 1XMOJ 3FSTA 3W7LA 1YW1A 2IQTA 4DHGA 3CV1A 4JV2A 3AS0A 4PYSA 5DRIA 4DZ6A 1KLNA 4IM4A 5A8NA 5BWAA 4X9SA 1UZDA 1UFWA 5GMDA 4CEUC 3KHHA 1H63A 2V2HA 4FNSA 5H8MA 1W91A 4DBQA 1N36J 3T1GA 4GNJA 3MXHP 3BV4A 2ZC8A 1SC4B 1US0A 4K4VA 3C3NA 1OFEA 1VZWA 3RBZA 4WZHA 4DPPA 1MZHA 3W7PA 2WMIA 3L4UA 1E3XA 3QHOA 1ECQA 1VRTB 3K57A 4IMEA 1C0TB 3HJFA 2EBEA 2LLZA 4AYSA 4LF9F 3AQUA 2FDNA 1UD8A 1S4FA 4DI6A 3AJ2A 4DMZA 2X8RA 1UC4A 3TQ0A 1JR1A 4YYFA 2NR0A 1S2WA 2YKKA 1EH9A 4C8OA 5EMUA 3QZ8A 5B09A 4L73A 3PX4A 3EMQA 3FDKA 3N5BA 1L3TA 3VKKA 1ZS2A 5H9FK 3M6UA 1S5MA 3T6CA 4DX8H 3HHLD 2M7SA 3RITA 2OPPA 1IKVA 3P96A 2DKOB 5F0WA 3K1DA 4Y90A 5CXTA 2GV1A 3VGTA 2VCBA 3EMZA 1FESA 5H9EK 4QS6A 2PF8A 3M32A 2PDNA 3PSWA 5FJPA 5E7OB 5KG3A 4OWGA 2KL8A 5CC5A 2XFFA 4WK1A 3S7RA 1DWHM 3MUMP 1JGIA 4HU8A 2VODA 1DJ0A 4OX9J 4OJYA 1TL3A 2YCJA 1WF0A 3GC5A 2I1OA 2RF2A 2OO6A 2XM2A 5LGZA 2YKMB 2KHDA 4R7OA 1C8YA 1UMYA 2GQAA 4NU7A 3KEHA 2B4OA 4OU1A 2AMGA 1C7SA 4QSHA 4ZO6A 3IEBA 3BGJA 1XJBA 2J8GA 4O23A 1GNKA 1VQYA 1KSPA 4DCJB 3J7YI 1CXLA 2IPGA 2O7SA 4HT3A 2D2JA 2YXLA 5CH9A 2B8PA 3OXFA 2FZCB 2OPRB 3AWNA 1TJ2A 4M1KA 1QI2A 5D38A 4RWWA 2BABA 1Y00A 4XPEA 4USIA 4CLLA 3D7SB 5F8MA 4CTAA 1EZ2A 4RUBA 2KH9A 3MC5A 1MDRA 4GKKJ 3FS2A 4QQ3A 2YA1A 2MY7A 2ZZNA 3SN4A 3S1WA 2W9AA 3EA1A 1A3HA 1Y0HA 4G56A 3PM6A 3M5YA 4Q8EA 2B4GA 1AJZA 3VABA 2GVYA 1R3TA 4X61A 2UY4A 1YXCA 2J8TA 2E5CA 4MKSA 4PSPA 3CJKA 4O57A 2VGFA 3P80A 1WXJA 3P49B 4LUTB 4UTTC 3LW5C 1RTJB 1GKRA 2R14A 2KXFA 2GGIA 2V8DA 4XO6A 1B2YA 1H6KX 1B9ZA 1HNXJ 2NUWA 3BTNA 4F4ZA 1TKTB 2A6NA 4AUKA 4TX6A 5AXMA 2WHJA 5LT5A 1FJCA 1VRUB 1LRQA 3A9BA 4H1ZA 4LBPA 3TSDA 3EPGA 4ECYA 2V5LA 2RUGA 4X65F 1GVYA 3ITLA 2FY1A 1D3GA 2X1SA 3O9NA 2HAIA 3G6VA 3K5LA 2VFTA 4PTWA 3WDQA 4NLOA 1P7TB 4BQ3A 2HIQA 2L9DA 1FK9B 5HMZA 4GI4A 1TWZA 1NXIA 2GZOA 1V9OA 3B82A 1KFSA 1W9DM 3HXMA 4KRUA 2WHOA 1PYFA 3T8LA 5LGXA 1W1PA 3NFUA 4O1CA 2R42A 2HNYA 2W3ZA 4ZQRA 4F2RA 4GVLA 2CVIA 4CLSA 3GDLA 4G1NA 3DYPA 4GZJA 1U6FA 2G4FA 4HH0A 4UZUA 1J10A 1J0ZA 1DORA 3AJXA 3TZNA 2QE5A 3LB0A 1TKDA 4Q45A 1S39A 1SGJA 1UUQA 1R3QA 4IYQA 4GX8A 1NAQA 3GNDA 2A3BA 1EKRA 1RACB 5E70A 1F6YA 4BI7A 4LF9J 4O11A 2XM1A 3VGUA 2ZFHA 1E55A 1VIOA 4MWAD 5CGQA 3G4SS 2DZPA 4AB4A 4GPNA 3W53A 3RYSA 2FGBA 3LP0A 5D77A 2WV8A 2QJ3A 4E0CA 3PBUA 2HZCA 1X4BA 3C15B 2UY3A 1A50A 4WK9A 1BUXA 1X38A 1XRFA 5E5CA 1S5VA 3OG3A 2A2IA 4PWUA 4R5PB 4UFKA 1DE5A 4PUKA 3KLIB 2HK3A 4YMZA 3CHFA 1ADDA 4KETA 3R1HA 4D8ZA 3BDEA 4N9EA 1N0VC 1VP5A 4NI3A 2WBMA 4HKQA 2W0UA 4NZ0A 5LXXA 1IWBA 1ZAWA 1H51A 4M0XA 2AZ1A 4AHQA 4A8XA 1YE6A 4LJ3A 2WQPA 2CHRA 4PMXA 4ICMA 1NSPA 1YVFA 2HBVA 4JKKA 3GU1A 4PMVA 4F2SA 3QLHB 3H7VA 4CLPA 3FJ4A 2R82A 3UT0A 2WQDA 5DM7Q 3TYDA 4CIOA 4XBJA 3DRPA 2B31A 5KETA 1IWGA 3PTKA 1JVNA 1S5NA 3WD3A 1WHVA 1N34F 3I6PA 4U5KA 1G5AA 2D9OA 4FX7A 4ZOBA 5I03A 1PAUB 2VX7A 3LOTA 3P0WA 2XLKA 3G0UA 2VUYA 2L48A 5J2MA 2CLFA 4OJGA 4X0VA 3V7PA 2WSFC 4N47A 3NM3A 5D37A 2DCLA 1SMDA 3CWOX 3VIOA 1PGZA 3ARVA 3RLGA 4ZPAA 1O8BA 3IRXA 1IKXB 4C98A 4DSEA 4DL2A 3IIXA 4KHPF 2P6SA 2VJUA 2ZUTA 2OLWA 1IXOA 4GY0A 2QL7B 3PJ9A 2H9AA 4IIBA 1VLWA 2C0HA 5KAKA 4JYFA 1OPIA 2VGBA 4F67A 1MRQA 5DQGA 1B4SA 4XD4A 3U57A 2QIFA 2A21A 1A4LA 2O9RA 5I3UA 3I55S 3NGUA 3LM7A 2PDUA 2PUZA 1OC7A 3M32B 2QLYA 4YLWA 3MZNA 2POKA 1I75A 4DJEC 4HMNA 3ZVHA 3DRYA 3W1XA 1IVZA 1KFDA 4MIWA 1KB3A 4UY85 3W25A 1GW1A 1UJ6A 2AX1A 2RF2B 1HL8A 1VRDA 4YB7A 2NLYA 4DR2J 4MYXA 4PMNA 4F25A 2ZX8A 4AISA 5LXRA 4GZEA 5KFHA 4L4OA 3VOJA 1FJGF 4AD2A 2F8QA 4OI6A 5PTDA 4PMJA 2JH3A 4DBWA 4JV0A 1S76D 1EHAA 4WIIA 3D46A 1Q7LB 3CDAA 3W7DA 4ICNA 2QMUB 2DXDA 3KJVA 2HQGA 5CEWA 2VASA 4DF8A 1M5HA 1U1QA 4G6VB 3H54A 3OEXA 4IFVB 5EB8A 5KZEA 2DZWA 3M0IA 1JMTA 1QW9A 3NY0A 3HFZB 2L41A 4LFYA 3S2JA 2G13A 4L61A 2W8LA 1RGVA 4WKRA 3OYZA 1YDYA 3SCIE 3CJKB 2H3DA 3NM1A 5HMDA 4LIWA 3CZ8A 3EKLA 3D3FA 2DGQA 4LRCA 3GYCA 1T41A 4LSNA 1S1VA 2E6AA 3CLWA 4LV4A 2OYMA 4DJBA 4PSRA 2YWEA 4UTGA 5LSOA 3AYVA 4WFBQ 2WLYA 4KC5A 3DHWC 4GUHA 5KG6A 2NX1A 1RKJA 4OIFA 1FTCA 3Q8UA 4AIEA 3RRXA 6ALDA 3VIKA 1U24A 2OJPA 1BQGA 1HBNB 4QPTA 3RNDA 2C79A 4ZPCA 1OJXA 2KRBA 1PBAA 1DURA 1GCYA 2DH7A 3AHXA 4S3KA 4N8NA 4RW8A 4LEQA 4LT9A 2W9BB 3GSDA 3BC9A 5BXSA 3XIMA 3G87A 4Y0FA 3FJNA 1X4EA 3ITHB 4DG1A 2FDSA 1JCXA 1IEVA 2HK1A 2HNYB 5JIWA 4RW6B 4ZJQA 4CQ9A 3ISIX 1U1PA 1N34J 3OHAA 4HYVA 3FHQA 4J7CA 5IHSA 5H9FJ 3N2MA 4TVAB 1JLBA 2WJFA 1DV7A 2GS8A 4Z1CA 3C6UA 5I78A 1U1RA 2BASA 2HEJA 1JLGA 1TKZA 4OJ1A 2G96A 2DEIA 4H7VA 3TE9A 2GNKA 3PPFA 1F3WA 2HXUA 1HHQA 4U2YA 4LRTA 1DTQA 4WDWA 1YX1A 2J7BA 3PZMA 4W5ZA 2HAFA 4NA2A 4KHPJ 1OIMA 1BXNA 1E6NA 5G2IA 1FVQA 3LP0B 4H6QA 1JPDX 1RHQB 3AISA 5KINA 4KKXA 3C2PA 3VNJA 2DCUB 1VDHA 1K3UA 3AHVA 3EVMA 2V3FA 4QWCA 5AC4A 1QSLA 1N82A 3QPEA 1E9IA 5A8WA 4OYAA 2I5QA 3D2WA 4F4WA 1MW0A 2HNZB 2QW5A 2AYGA 2OWWA 1XMBA 3T08A 1M5WA 1MG7A 4HN4A 1RAJA 4HACA 5DBUA 1XR7A 3U2CA 2BKPA 1TTJA 2VHLA 4DWSA 3NGDA 4IMCA 1UVKA 3RGTA 1V3IA 3SI9A 1NFGA 4OYOA 4BS0A 1JCJA 4ZCIA 5KG1A 1QTWA 2XZWA 5G4HC 4CCCA 3G6ES 1Y7VA 3RRAA 2CAJA 2Z2ZA 3DRPB 3K5PA 2WKLA 1ESWA 1F2HA 4WTOB 4WR3A 4J7RA 5D8WA 3TEGA 1JLFB 1DFDA 1ZM2A 2ZDPA 3JB9k 4V28A 1SO3A 4FF2A 4QR1A 3N9RA 5J2MB 1MSWD 1H60A 4J9KA 3IS9A 4GQ0A 4DXVA 4ITSA 1EIYB 1FKOA 1WUEA 3KRSA 1F6TA 3IN5A 2U2FA 4ES3A 3WDPP 5K3VA 2DZUA 3HD2A 3VC6A 1JJKA 3H7RA 3HG3A 5B0CA 4DV7F 1A3WA 2NX9A 1VPYA 3NAVA 1H1NA 4B3LA 1Z48A 3BLPX 1H1YA 2IAJA 2HQIA 4P7NA 3SCPA 3TUJC 2HK0A 1S1UB 1HPZA 1N56A 2GSEA 4M8LA 2WCXA 2H9AB 2CPEA 1RBLA 1CULB 2DEJA 1SW3A 1IEQA 3I9V9 1ZJBA 1KNWA 2BX6A 4MKAA 1F6PA 3U5YA 2C13A 2W2OP 2PP0A 2CWXA 4WIQA 3TSBA 1WOSA 5I3UB 4WY0A 1TVLA 3MAQA 3VA8A 3RHGA 1OYDA 4FEZA 5HQMA 2LQJA 1U02A 1NCLA 2RS2A 3BG3A 2JEQA 3WLSA 3CAKA 2HFUA 3HZGA 3ZVHB 1VQ7S 1CSJA 1E1EA 2FJUB 2N4CA 1DWIM 4LCRA 3WF2A 2UUTA 4ZQNA 4YTQA 2XIMA 1BY9A 3ZZUA 3IGSA 4KKOA 3W26A 1RQBA 2WPBA 1FA2A 1VK8A 1T11A 2IW0A 2DW7A 1DTNA 1XICA 5AKQA 3MB9A 2V5KA 4KBXA 3A8IA 1M65A 2XFWA 3D0HE 4BHYA 1HKAA 2WW4A 3QQ0A 4NVTA 3CM4A 3VC5A 3OQEA 1W3KA 3BLOA 3H53A 4UTWA 2Q6ZA 1KFCA 2QJMA 1H62A 2G3MA 3DOKA 1LWHA 3MR6A 2OO4A 3KJQB 3GIMA 1ZAXA 3AYTA 1U1NA 1E1FA 4TMCA 1URNA 3ARZA 5BCAA 3AIVA 3VAVA 5CZ0A 1VPQA 3KTCA 4XKMA 2EF9A 1IYXA 1U5JA 2OH2A 4LSLA 3T5JA 3N11A 1WX0A 1JKHB 2OB3A 1UOKA 1IBCB 3MR7A 2FJWA 2VT0A 3O07A 2BYCA 4PQAA 2OSRA 4UUIA 1M5SA 2YDSA 3QSTA 3RN6A 3DGVA 4FYYB 1TX2A 3FX4A 1FXRA 3NQ2A 2V68A 1GVQA 3I7RA 4IFOA 1O5JA 3ES8A 4IFYB 4FF3A 3ZTQA 5LXEA 2UU9F 3NEVA 1XWLA 3N6QA 1RP5A 5BXPA 1XD1A 1XBYA 1FVPA 2VDGA 3GR8A 4FX6M 5DMNA 1VC6A 4WDXA 4P6QA 3EDKA 2HGMA 4ID8A 3VGBA 4K4SA 3LP2A 1FXQA 5AZ0A 3KUHA 2HVNA 3NGKA 4OHYA 3M05A 1YBQA 2QHAA 3DGPB 2VCAA 3LPPA 3USBA 1QHZA 1OG6A 2QGYA 1ME8A 3FEQA 4ML4A 3FEYB 3VNIA 4W86A 3VD3A 4KERA 2KG1A 3KX6A 3L2IA 1S1TB 4H9TA 2Z8QA 5DDRC 3DU6A 1S10A 1GKPA 2YNGB 1VQNS 1GVSA 4IOCQ 1ZPVA 3B54A 4WXYA 4LAMA 4ADTA 4U2ZA 3AH6A 3L7OA 3WDHA 4B5NA 3QYQA 1KR4A 1GQIA 3BBBA 2UUBF 1GK8A 3TLLA 1FNOA 4DG1B 5JVHQ 3GH4A 1JPKA 2IXVA 3TW7A 4FAMA 2V69A 1TKKA 3SRFA 3P45B 4LQ9A 1VQMS 4YN3B 2UZ9A 3EWXA 5AVNA 2HS4A 1TA3B 1KWKA 4LFBF 3C0LA 3C56A 1JZ5A 3W75A 3KFWX 2HHHF 3OQ8A 1UWTA 3QAUA 5KFAA 1JLGB 1TKZB 5CD4H 2HISA 1ZYQA 1MW1A 3KBJA 1Q8IA 1OY8A 4F0HA 3NCOA 4DV7J 1XC6A 3SY1A 4WFZA 1DTQB 2GO8A 2YCLB 2Q8LA 1MNEA 2XHYA 1DIOA 1FX2A 2X0SA 4JX4A 1JCLA 2KZZA 3K30A 3NQ6A 5G5IA 5ABFB 4L76A 1T9TA 4AVOA 1N8FA 2A3LA 3GBDA 5AZ1A 3R1ZA 3C2RA 4MM1A 3W74A 3QJPA 2H3BA 3DLJA 1YI2S 3SAZA 3QMSA 2YH1A 4HNTA 5A8WB 4OFCA 3P5YA 4RW3A 4Z1AA 5EMLA 5U47A 1E70M 1KEKA 3MPGA 1TX0A 2QQ6A 2R4FA 2NX3A 2RDIA 3TW6A 3THUA 4DWSB 2HNDA 4DQRA 1FWNA 3AIEA 1V3RA 3QY6A 1H98A 1L6YA 4KWVA 3LANA 5ETLA 3BSOA 5MF5A 1GOMA 1QJHA 1CGTA 1CTNA 4M6QA 4MZ8A 1XUUA 1EYWA 1L8NA 4E8GA 1R0BG 4DO6A 1OBAA 2KU7A 4O50A 2ATCB 5E9XA 1VQ9S 4MUZA 4H4OB 2DHHA 5LMUF 3JTNA 1PTAA 3EPMA 2VJVA 3QKEA 4LSBA 3ITYA 2QSWA 2EG2A 3LK6A 1XIDA 3N25A 1KRCC 3DNCA 2LQ5A 2CXEA 5A2CA 2VQEF 4ZOSA 5DXYA 1VYRA 5D2WA 1F73A 3IS9B 2KT5A 4O4GA 3CH0A 1KN6A 1FKOB 3RAMA 3BAKA 3ZWTA 3TA0A 2PDFA 3S5OA 3WLJA 4M5GA 1L3VA 4KCVA 1EJWC 5A8GA 1JXVA 1Q5VA 3V4IA 2DY3A 4OE7A 4ZPWR 3AOFA 4KB7A 1G67A 4LCSA 3WMSA 4AL6A 1UUMA 1GVIA 3T9ZA 2DH3A 1J2WA 2D0FA 3AMGA 1XIHA 4YDDB 1TJ1A 1ZJAA 2W7OA 4JOMA 2BGSA 1GQEA 1OZQA 2IPFA 2UU9J 1U1UA 2FJKA 2ROPA 3WX4A 4PCSA 2VX6A 1WKKA 2PI4A 1WQ5A 4MNMA 3GONA 3GB0A 4B5VA 2CETA 4WY0B 2Z4PA 1V5XA 4OZJA 3BLKA 3GH7A 1YTKA 3PJXA 1VR6A 4O44A 3KJFB 1HTIA 2ZTJA 2VZ9A 3ARXA 3ZT5A 2MUCA 5JJBA 1K4HA 2R8GA 3I82A 2FC9A 5I07A 2HWTA 4XSMA 1UR3M 3D6HB 4XK8C 4KKOB 1IUJA 1RCQA 3WLIA 3U0HA 3GD6A 5A8KA 1RH9A 3FDSA 1NP2A 1G7VA 1VCFA 1XIGA 1WCGA 4YOEA 1IXKA 1S9GA 4J3TA 5E0KA 3NL0A 3QRPA 3NPWA 1JF6A 3QVQA 1NHKL 2R7SA 3TAMB 1ZQ5A 2UUBJ 5C25B 4LF8J 4ED8A 1MEHA 2J0SD 2Q3PA 2ZUNA 1U1OA 4TVCA 4TLRA 3PR4A 5GAEI 2Z1XA 1QNSA 5CC3A 5JBFA 1XR2A 3W28A 1OABA 2Y0SD 3VE7A 4LFBJ 4HPXA 2FHFA 4P7LA 4AWEA 4OIXA 2XIJA 1TR1A 2EKYA 1PWLA 3THVA 2BOAA 1GONA 3FK4A 5B0FA 1Q95G 4WK3A 2DHSA 4JI2J 2X3DA 4Y96A 3C8NA 3WLNA 4F3MA 3V5CA 2DGWA 3RX3A 3SQSA 3G1HA 2C8NA 1H5YA 4EACA 1XBWA 4ERGA 3APYA 2VVSA 1OX5A 5A8OA 1SZRA 1HGWA 1E5NA 3O6AA 2J76E 1XYLA 4LWWA 1ICEB 2U1AA 3EPNA 1CBKA 1WUUA 1JGMA 3PBYA 1Y3JA 4BWJA 3BVJA 2FHBA 5C70A 3UPMA 4M5DA 2FMOA 5CZSA 3TNOA 1HBUA 3BYRA 3R5AA 2WJZA 5B08A 1VBYA 2QJGA 4DR7J 2P76A 4JKMA 3ICLA 5T9CE 4B9ZA 4B4HA 4AUBA 4MVAA 3VNDA 1B4KA 5D78A 1WV2A 3UWWA 3T19A 3KKFA 1YNQA 3D6NA 4JDBA 3TTYA 4LFCF 4GX9A 3GNXA 3S6OA 4QISA 3S2MA 3F7JA 2GGEA 3VGFA 3NZQA 5KMYA 4OYXA 1LBMA 4EVZA 5C8BB 4UZBA 2DNMA 1OS5A 4LF4F 1P43A 1VIZA 3PWGA 3QZEA 1JZ2A 4WYLA 3TZXA 1R3WA 3UWYA 1US2A 5LMUJ 1Q63A 3TROA 4GLEA 1FEEA 2FGOA 3MR2A 1O95A 3T42A 1B3OA 1S59A 1PIEA 3JS9A 3KVKA 3CD6S 2PFFB 3WENA 4J5OA 4F2TA 3O8WA 3QC3A 3KBWA 2V8VA 1IXPA 2QDHA 4ED6A 5IM0B 4F66A 2HQCA 4IH3A 2HRTA 4J5NA 3OHIA 1ZP3A 5FJ4A 1W3NA 1Z89A 4EO6A 2ZBQA 1E6VB 3Q2SC 3QPZA 1L8PA 2RILA 2E5GA 2FVQA 2H54B 3RAQA 3RX4A 2KX9A 3NSNA 3O44A 1CC8A 3HB9A 2OPSA 5CAKA 1RU1A 4LBRA 1AZSB 5C7PA 3EE3A 2JEJA 1UWSA 3PG8A 4DOZA 4ZN1A 2PDQA 5IT0A 4F02A 2E7VA 2P6TA 2GK1A 3VZXA 1TK5A 3TR5A 4HCDA 1W9XA 1TPEA 5IV4A 3PYGA 3LPFA 2OELA 3DG6A 3LGMA 4UMBA 3RBDA 2HGNA 3I0SA 2FHJD 3CU2A 1QNPA 1NY1A 2WVFA 3TN5A 4AY1A 4YXGA 4PABA 4U4MA 2AEMA 3PY2A 3KLGA 2UY5A 4C9DA 1UMLA 3EOLA 3MEGA 3SJNA 2VI0A 1WEZA 2ZC4A 3W1PA 3L7UA 3BQ5A 1FCAA 2Z58B 2QNEA 3OD2A 1K8XA 4NLYA 2R8IA 2B4UA 2GZXA 4OI0A 3W1MA 3URNA 3M8QA 3O1LA 3P0XA 1DE6A 4O4GB 1ZTVA 1KLMA 1XLCA 4QQBA 3VZIA 1D8ZA 5KFVA 3QV8A 2J62A 3V4BA 4FXJA 2HSAA 4PFMA 4O8RA 3V4IB 3RR8A 1IBMF 1HIZA 1OPZA 3M6XA 5LIUX 4S3GA 4ZO8A 1UL3A 3W63A 3FMBA 4EBEA 5KFNA 2BHYA 1GXTA 3W1QA 1R8BA 2BOFX 3W7GA 4C7FA 3DDKA 3B8SA 2WBKA 4F2UA 3LV5A 3IIPA 4OQJA 1XLBA 4DV3F 5J1EA 1E43A 3DLEA 3MM7A 4UQ9A 3OFEA 5GADU 3PWAA 3CCLS 1TUVA 4HH1A 1SXLA 3VKCA 4PUEA 3D1QA 2IDEA 4DFMA 2PDMA 4MB1A 4QDPA 4ZVTB 1M7XA 2ZH5A 2FZKB 3VGSA 4I6AA 4NZ7A 1RVGA 3MGJA 3P2VA 5BRQA 1PYOB 2L3MA 4O44B 2D3LA 1OSEA 3LGNA 4MJKA 1NWSA 4JV1A 1TPC1 2EXUA 4USUA 1HJWA 1KQYA 3EVWA 4CI0B 2ZVRA 2DV0A 2HBRB 1BFNA 2AQVA 3CV7A 4BQ4A 5A6MA 2M88A 4JI7F 3F2DA 4NJJA 2W01A 2NWRA 4Y2WA 3SURA 2VD3A 1ZFJA 3BLFA 2HEKA 4DEZA 4I6KA 1NBEB 4LF4J 1H7OA 1HKJA 3UXDA 3S6DA 1S1WB 1JD9A 2XYHB 2W62A 3CBWA 1RPKA 3ETOA 2EPIA 2OOFA 4H9UA 1H3GA 3VMOA 1HHTP 2RKIA 5DT5A 3CK5A 5LIKX 4S3FA 3M8SA 1I2NA 4LVGA 3HHDA 3AMCA 4DN0A 3FC9A 3N2BA 2PN6A 3B40A 5D4YA 2PGEA 2BHZA 1W7WA 2ZITA 5CQ1A 4D6GA 3BLIA 4DBUA 3GHRA 2DGUA 4F50A 1G69A 1VFJA 2Y88A 3CO9A 4WCEQ 4I67A 3WQEA 5GJMA 2A2CA 4PWWA 3JYTA 2Y8WA 1PB0A 5CQGA 3FFIA 2DIEA 4HBKA 3TTQA 2OYLA 4NMXA 3EWGA 2AQ4A 3EOUA 2LA4A 3QSIA 4GIYA 3OL9A 1QHPA 1ITQA 3R43A 2FH8A 2Y7DA 3HHLA 1Z6KA 3R7MA 3SSRA 3NUKA 3TOPA 5JBDA 1G4TA 3DN5A 1HBUB 2INFA 3ITXA 3W8PA 4G1QB 4QIFA 2X09A 1ZA1B 4DF1A 2OUGA 4EPEC 4ANDA 1TPVA 3QXBA 3OTBA 2HFOA 4MAKA 5L8RC 5ETPA 3SZ8A 3CCES 1VHFA 1WKFA 4ANEA 4GVBB 2VEGA 4PG5A 1YIJS 3ZFHA 5C42A 4LAKA 3H2VE 4LIRA 1FKXA 2CKWA 3ISZA 2NZLA 1J6OA 3VIIA 1WDTA 4GMKA 4WQ6A 3AOCA 1UJ5A 1DWAM 4RV3A 5E9AA 1FERA 3WUEA 4GJ1A 1BLUA 5F9NA 1SPQA 3JVAA 1HW6A 5BOFA 1KOOA 3MF5A 1Q8KA 2WYSA 4B3OA 2WW8A 4C0BA 3DMJB 2CPUA 3F5JA 2YBVA 3EX4A 1UP1A 2BW7A 2VV5A 4C11A 3E2QA 2PI6A 1QNRA 2C28A 5EA9A 1EP2A 3EX3A 2Q3OA 1IBMJ 3IS4A 4RE0A 1NZAA 2P1FA 4XSLA 4UZSA 1YPXA 1B1YA 1RT2A 4GYPC 2OPSB 4O15A 1W5QA 6REQA 3U48A 3W2WA 3LRMA 2X7IA 3UCGA 3C46A 4XK2A 2HGLA 3SGZA 1YXDA 3UWTA 4DV3J 3MUCA 2VFVA 4W9TA 4TX9A 3LEPA 2GK1B 5F2LA 2QAPA 3CMFA 1R6WA 4OLPA 5FF3A 4OV9A 3L0KA 1HWIA 5KTQA 3UDVA 3UPFA 4QDWA 4NZ3A 3NOYA 2MKJA 4ZFCA 2Y1JA 1K73T 3GO2A 3P62A 1VOMA 1DQUA 3I0SB 5CJ5A 1SJ1A 3M41A 4MLRA 4GH3A 1HR0F 4LMZA 4WJBA 3THTA 3BE7A 3CMQA 3KLGB 2F6UA 2D0HA 1DYSA 4Y8EA 4YP3A 4YNGA 4XBKA 3MEGB 4JI7J 3DHDA 2DD8S 1F5CA 4HU0A 5B0BA 4JDYA 3D67A 3GH5A 1B64A 2JIWA 4X62F 3PYEA 1BGGA 4C6NA 4XIMA 3JR2A 2HS3A 1RT3A 4LFAF 4GBDA 4FYWB 5BR8F 3UETA 4QQUA 5E5NA 1R9YA 2Y62A 3GTXA 4K1GA 3CCSS 1U30A 3WQCA 1I60A 4J9SA 1VQ5S 1KLMB 3UZJA 4L5ZA 5HL7Q 2I5GA 1TV4A 2RIJA 4KCWA 4C6IA 4YJ5A 3MBDA 1OY9A 4N02A 2WCGA 1QTMA 1CC7A 3LOUA 2ZX9A 1E51A 3D1HA 4AXJA 4LYKA 4HU3A 2QT7A 3M0HA 2J27A 1B3TA 4GZ7A 4B5XA 5JMNA 4DV6F 4KV8B 1OGSA 4NYUA 4OYBA 4GIAA 4TIMA 1Q86T 3RBEA 1QR7A 4WFYA 4MWAA 1LL7A 1SKWA 4Y2KA 3GTNA 3R6GB 2ZBTA 1MWOA 1XQKA 3PZOA 3THQA 1EL3A 3KUMA 4EPDC 2FZMA 3Q0AA 1W3TA 3DH7A 4OZ5A 4MNKA 1OGBA 4AYBD 1OVDA 4PULA 5L1IA 4PMZA 1VLYA 3O8AA 4IP5A 3GILA 3CGTA 2QVNA 2Y1RI 2KO1A 4S1FA 4IG3B 4A8NA 4J3XA 1YRXA 2OLHA 4YU1A 2FVKA 2FGLA 2QV4A 3P3BA 1PBGA 2OEJA 4X4TA 4TU1A 2Z28A 3T09A 1KONA 3T9NA 1R47A 4K8HA 2GQ2A 3A3OB 2AV5A 4FR1A 3C3LA 4IH7A 1RP8A 2UV8G 3TZYA 3FNDA 2Q6CA 1EF3A 1PC5A 3BXWA 3CJ0A 5HVGA 1CBGA 2XCPA 3R5GA 4UUWA 4JIQA 2OTJS 4HJFA 1FQ0A 1Q6FA 1HO4A 4DBDA 1LOLA 1VQPS 3CZEA 1I6JA 1VJQA 4CQBA 3OTEA 3H21A 4A21A 3KOFA 4X4PA 4B9YA 3Q22A 3BKFA 1JPIA 4GKTA 4WP3A 2JJ4D 1Y5IB 3NYDA 1Q1KA 4BWMA 2KM8B 2HVOA 4PRTA 4FPRA 3M8RA 1WELA 1XRSA 2W5FA 5I79A 4AC1X 1X4CA 1VFTA 4NP7A 1EJSC 1WF1A 3RZAA 2FLNA 4AX6A 2UVWA 2RB7A 2ZUWA 1OC6A 5G0RA 1QPNA 2ZRXA 1YLXA 3S5YA 3O63A 3H25A 2NQZA 3JYTB 4CD6A 1TPFA 3I5AA 3L95X 1HUVA 4OYIA 1V02A 4JI8J 1OK4A 1HN1A 3HHLB 2Q43A 1Q6LA 3CCZA 1PHQA 1TUFA 3RJYA 4LBIA 1UVLA 1YZ7A 2QUVA 1C9DA 2IPJA 2BEFA 2CNLB 4FKXA 2PDIA 3DRSB 2NSBA 1FCVA 1DWJM 2F63A 3R12A 3CJQA 4F36A 5FJOA 2P0IA 2E9MA 2ERRA 1U5VA 1DIKA 1UTAA 4IMGA 2Y5EA 3GX9A 2VG6B 2WJEA 4BI5A 1GOWA 2I17A 2PDBA 4RDZA 4CQ8A 1HR0J 4C97A 4J37A 1CQMA 2ALDA 2J7DA 5C42B 5FSDC 3LGGA 3ILJA 1I1GA 3BANA 3UG4A 2AYBA 7ODCA 1YLVA 1OMSA 2E8ZA 4HPJA 3KK3A 3L4VA 1W2IA 3P5BP 4X4SA 1PX8A 2YL6A 3HFKA 4H4IA 4CD7A 3A8KA 4X62J 5K5MA 2XTKA 4M1RA 5ETRA 1UR9A 3THCA 5BR8J 4B9TA 2B7CB 2DZVA 1F8MA 3R1LA 2G95A 1ALDA 2VCCA 3KLLA 2GVDA 2KAUC 1J6PA 1GOQA 4HOXA 3GXMA 2CDRB 4YTUA 3QFWA 5HR7A 2G3NA 3UG8A 4AWTA 3DLHA 5I7GA 3LTSA 1LBFA 3RCMA 1QI4A 3F44A 2G9OA 3WIVA 1SUXA 2WVEA 2PFHA 3Q4DA 3R0UA 1PKYA 4AIBA 2HPIA 1XDJA 2OAUA 2WB1D 2DR9A 3I3DA 4Q8PA 1J5SA 4AEOA 1KKRA 1I2PA 3UW6A 2NXNA 4G1PA 2DNKA 3W2WB 1SFLA 3PAOA 1A3XA 2WJDA 3ARRA 3BUVA 2ILYA 3GZ3A 4L4PA 2CQGA 5KG0A 2G8ZA 2OG9A 4CH7A 1Q45A 4PTMA 1YADA 3ANUA 2GGHA 2Z6IA 4JR5A 4B15A 2HQAA 3FV9A 1MEWA 3PZIA 4CH0S 3FJLA 4ERAA 2ODOA 1O68A 5I02A 3UD4P 4JHMA 3SO7A 4QOTA 3L4WA 1AROP 4FK9A 1KXQA 3G8RA 1VQTA 1RK5A 4M56A 3W1LA 2K7JA 8ATCB 2QCFA 4CEXC 2V5CA 3M9NB 3GIYA 4AU0A 4DL3A 2OODA 3TYEA 1FRLA 1RHKB 3KCOA 4O1BA 2XH4A 4DJDC 3CYJA 1LBLA 3DG3A 1C29A 1B0TA 3BOFA 3W6YA 5CPTA 1THFD 1B0VA 3H59A 3BOXA 3CVKA 2MLXA 5H1WA 1KTQA 1RWOB 4CCEA 4L9XA 4ZK7M 1Q8JA 1RT3B 4J27A 1VBZA 3UWUA 3L67A 2IM2A 2O9OA 3MEDA 1DP0A 5TAOA 1YJUA 3VAHA 2J7HA 2X3GA 3QGHA 3N13A 2RDDA 5AC5A 3H2MA 4RV8A 3U1MA 4C5YA 4A8SA 1UR2A 1M1GA 2VOMA 1H41A 3QJLA 4Q8FA 3UG5A 4FNIA 1NK8A 4ZOAA 2JGQA 3F41A 4A8MP 2X42A 3SQMA 3NL2A 4DU8A 2XNRA 4ECSA 3CB4A 4V33A 3I3BA 1FNXH 1CNVA 1Y5WA 2NV2A 3AMKA 2F65A 1BQNA 4F4AA 1F60B 4C0OC 2WCSA 2MQNA 4J9OA 2VEIA 1BVNP 2JEPA 4TQTA 3TRGA 4H8NA 3DRRA 3K1GA 1U2YA 2ZFAA 1B3VA 2QMKA 1G4SA 1XQIA 4Q0BB 2GJFA 1JXJA 3TUUA 4FLSA 2YBTA 2OGYA 2PWHA 1Q6CA 3AU6A 1SIZA 3WUGA 3BGRA 4J2MA 3DLKA 2YB1A 1ICPA 2QCEA 4DSLA 5KT2A 5DMLA 2VFHA 3SCOA 2XSJB 1EUAA 3VAFA 5DF0A 3U02A 1JJ4A 2YTCA 1HNIA 3C6TA 3CDWA 1S79A 1SJ4P 4KFPA 4AZ6A 4G3IA 2CYGA 2Y0FA 3K4AA 3TFCA 4O3NA 2Y8VA 4N42A 7ENLA 1YITS 4ACZA 2IHR1 3IA0A 3EB2A 1GJWA 2P3EA 4DL7A 2LDYA 2CFFA 1V6HA 5GMKa 3BCJA 4J9JA 2JL9A 1IXNA 4PUNA 3T0BA 3O7UA