2C2NA

Structure of human mitochondrial malonyltransferase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
317
structure length
317
Chain Sequence
MGQCSVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAEGLYAVKIRAEAMQEASEAVPSGMLSVLGQPQSKFNFACLEAREHCKSLGIENPVCEVSNYLFPDCRVISGHQEALRFLQKNSSKFHFRRTRMLPVSGAFHTRLMEPAVEPLTQALKAVDIKKPLVSVYSNVHGHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKSCNMQAWKSYSAVDVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MALONYL COA-ACYL CARRIER PROTEIN TRANSACYLASE
publication title Structural Basis for Different Specificities of Acyltransferases Associated with the Human Cytosolic and Mitochondrial Fatty Acid Synthases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 115
structure length 317
sequence length 317
chains with identical sequence B
ec nomenclature ec 2.3.1.39: [Acyl-carrier-protein] S-malonyltransferase.
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 2c2nA02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 2c2nA01
2VZ9A 3TZWA 3IM9A 3K89A 2JFKA 5DZ6A 3TQEA 2UV8G 2JFDA 3G87A 3SBMA 2G2OA 4RR5A 2QJ3A 3R97A 3IM8A 2QC3A 1MLAA 3PTWA 3TZZA 4RL1A 2PFFB 3R8YA 2G2YA 3TZYA 2C2NA 5CZCA 3CJ8A 5CZDA 2VKZG 2G1HA 3HHDA 5DZ7A 3RGIA 2CUYA 2QO3A 3HMJG 2HG4A 2VZ8A 3EZOA 3HJVA 2G2ZA 2H1YA 3H0PA 3BV8A 4QBUA 3QATA 1NM2A 3TZXA
chains in the Genus database with same CATH superfamily
2FHJD 1RAOA 2B4UA 2PC6A 1AFJA 2DXFA 3L09A 2RRBA 1WD6A 1BD6A 4RPFA 4EYIB 4ENOA 4F3QA 2AEMA 2J7WA 4QWDA 3MUMP 2ACMA 3DDNA 2AT1B 1WDTA 1HL6A 2D3OR 1W26A 5F8JA 2KM8C 1RT2A 4CM2A 3IR7B 3CVKA 1RTDB 2QV6A 3PNIA 2LEAA 1SL0A 4BC9A 4QYZK 4CLTA 3VAIA 3GR1A 1VR6A 2KKHA 4R8UB 4I2QB 3L95X 1H2TZ 5B0CA 3E01A 1GX5A 1T8EA 3ZZOA 3AD7C 3RBZA 1S9GB 4DDFA 1EETA 2V68A 2N3LA 5FDLB 2EBGA 5KG4A 4USHA 4LFCJ 1PC5A 3MPWA 5MAOA 3KJQB 2QGFB 2FHJA 4ZCLA 4NYPA 2GNKA 1ZM3A 2Z56B 1ZM9A 3UDLA 3FK4A 2GVZA 2FHMA 3MECB 2BVZA 4QIWD 2CRLA 3M8SA 1VIXA 2KXNB 3HMJG 3OVBA 2YVSA 1S7IA 4P2XA 3CCLS 4ZITA 2Z30B 2GA7A 4NLOA 1LW2B 4C8ZA 1FVSA 4Y28C 4WFBQ 2HVIA 1IQZA 1KTVA 5KFKA 4FN5A 1LWFB 4FYXB 4ZPWR 1BXNA 1Q82T 4F2SA 4WFYA 2GIRA 2NXUA 2E5LF 2J8SA 5CABA 1QAJA 1RHJB 5HK4A 3PCOB 1HNZF 4AMNA 4H4OB 1GXLA 2J0QD 3MZIA 3PJWA 4UY85 2LQ9A 2WONA 3M6WA 1Z2ZA 2XULA 2RIJA 1CJKB 3BKFA 2Z2MA 2DGUA 3JTNA 1RCXB 2GIQA 3CMAS 4KYZA 3RBDA 2KI2A 1S97A 1S0VA 2VG7B 1VK8A 2CYYA 2KT3A 1FO1A 2ZVIA 2QMUB 1MWZA 3ADAC 1OY6A 1YJUA 1HHTP 2X3DA 3ZO7A 2FJEB 2ROPA 3MAAB 1PAUB 2KVQE 1IBCB 2VH7A 3Q0AA 2OD4A 3LANA 3QWUA 4USMA 2P9GA 4ZCIA 1OWXA 1JLAA 4DMZA 1UEVA 2DY1A 5E5NA 4MKVA 4I6YA 4ID5B 3LALA 3JQMA 3M2UB 3VAKA 1CS4A 2J6UA 1V3ZA 2W8KA 1SH2A 2JEFA 3GFXA 1L3TA 1U1NA 2L9WA 5RUBA 2RU9A 4DXLA 3MMAA 1SBRA 1QVFR 2HRYA 1YHQS 4ILRA 2E5LJ 3BSAA 4QYZJ 5E3AA 4DL4A 2NYIA 4R0EA 1HNZJ 4OI2A 4CYUB 3JSYA 4CTAB 5J1PA 1TFWA 4ZN1A 4IFYA 4A8YA 2CPFA 4ZA1A 2HFUA 1RAAB 4HTIA 4L73A 1TVRB 1X4EA 4UOGA 2WZ1A 3CTRA 3CCMS 1C2PA 3M8WA 2BJ3A 2YY3A 1S1XA 3JTPA 5D4PA 3D6HB 1QD1A 1RA6A 3V4IA 5HMXA 1FERA 1C4AA 2WOMA 3PXGa 2IM0A 4WP9A 3SXLA 4HYKA 3QQCD 4OJ3A 3OW2R 2RQKA 2RHSB 4LSNB 3P4UB 5AXLA 1XR6A 4GO5X 4OZNA 2XY7A 2V9WA 1RT6B 2G0CA 2K06A 5ETOA 2A3JA 3AOCA 5KG1A 4IR9A 1MG7A 3HVAA 1UFLA 3PYFA 1VBKA 2OPPB 3W5XA 5CZCA 2NUHA 2GX8A 2WCXA 2HFSA 2BQ3A 2AJ0A 1Y3KA 2NQPA 2K1RA 1WHWA 1A9NB 2F1FA 2KHCA 1A6LA 1RXOB 1NKCA 4ECWA 1UPPA 1CJUB 1OSDA 1M90T 3LWLA 3OL7A 3W7BA 3O5TB 2MDAA 2EFOA 2OO4A 1U8SA 4FDFA 4LF1A 3CJ4A 1G4CA 2FLLA 4I7FB 3ZZZA 2FVCA 3G71S 1N6QA 3IFEA 3ZZTA 1RYRA 1SL1A 1KFSA 2ZEJA 4LMZA 2YQ3A 2W9AA 3ENAA 5LJ5Y 5A8KA 5D78A 2XMKA 2LU2A 4N47A 1RLDA 2UXDF 4P10A 4JYAF 2VONA 1LV5A 2M7SA 2VG6A 2LKZA 3MM7A 1G7CB 1FF2A 5KAKA 5DGAA 3HHNB 4X4PA 2KG0A 3N01A 4F25A 1AUDA 2HHXA 2HIYA 5DG8A 4WU2A 2M52A 2OTLS 4WKYA 4ED8A 4KFBA 1WNEA 3OLBA 1NMEB 3EZOA 2Q6BA 1TMJA 5GAHU 2CJXB 5KFVA 3NGTA 2F7VA 1VJQA 4B9LA 3RB4A 3SDEA 3QNWB 5AE1A 5J1EA 3DLKB 3AHPA 3V6JA 1F60B 2VC1A 1AROP 2W2OP 4CLLA 3UD4P 5C24A 2PA3A 2OELA 2F40A 2I5JB 2E29A 2K2PA 3QWPA 5CXTA 1RTJB 4HDHA 4Q5VA 3M8PB 4IH6A 4OX9F 1YLXA 1TFYA 3AA8A 3DRRA 4JYAJ 4NA2A 4ZPCA 3AB4B 2XNRA 1RBLA 3BKTA 4G1QB 1XMQF 2EFQA 4O3QA 4LF9F 5KFPA 4OHZA 4M5DA 1VQ6S 1XEZA 5DQGA 1NJIT 3IRXA 1WG4A 2H4WB 3EXCX 5IM0A 1LXNA 3KLGA 2NXJA 3KHGA 2Y1JA 4GVLA 4F0HA 3R7SB 1UPMB 1Q4RA 3K5MA 4B9VA 2C42A 2UP1A 2UV8A 3H20A 2NS1B 2R4FA 1IBLF 5IT0A 4B3MF 3NKYA 4TU8A 4YB5A 2QRRA 3OTBA 2QYCA 4DV1F 4PXCA 3N6MA 4MFBA 1EETB 3BH6B 4HI2A 3E2EA 3NG8A 1UVJA 1RAFB 4C0OC 4CRJA 1M5PC 3DNCA 3RBXA 4K2JA 4OX9J 3F73A 5EX0A 4X4VA 5KFBA 1Y10A 1YG0A 5HLFA 1YJNS 1LWEA 1WTFA 2IVFB 3TA2A 4OI0A 1RDRA 1SXLA 1XMQJ 1HNWF 4LF9J 1Y7PA 1XMBA 5I4MA 1YTYA 1FRLA 3TUJC 1N8RT 3U1LA 5CH7B 1U49A 4ZIVA 4J37A 2FLOA 1OS5A 4JV5J 1ROFA 2YWHA 3C19A 4Y2KA 3BV8A 4PZVA 1IBLJ 4B3MJ 3BYRA 2XCPA 3P6YC 4ZVQB 2MZ1A 2RKIA 4P71A 3IWXA 5J1NA 1HNVA 2VFUA 1HYSA 3BJYA 1RT7A 2PD1A 5EHHA 3OHBA 4JI2F 3W9JA 1M5SA 4J5OA 4DV1J 4DR3F 3CD6S 2Y3YA 2WONB 4IYQA 4OYMA 1YJWS 2C3UA 1X0PA 3W2WA 3QZ7A 2QA4S 4JBCA 3HZEA 1VQ8S 1K9MT 3NOCA 2V9KA 1R7IA 4FF2A 2ROEA 3NS6A 1HIYA 2EI5A 2XS2A 3VQSA 3A8KA 3ZNUA 4JV2A 1HNWJ 5J2PA 1J27A 2F4VF 4A8MP 3CD0A 3ISND 4HL9A 2AGQA 3H2UB 3KLEA 2DT9A 1NJZA 3FMWA 3BR9A 5B09A 2ZBCA 1CS4B 3DCAA 1K1SA 2HWIA 4LR7A 1D1UA 4ECYA 5E3PA 1FDDA 2YNIA 3NGRA 2R3VA 4HDGA 2ZJPQ 2JX2A 2VZ8A 3MMAB 5J2NA 4YMEA 3CJSA 4CDIA 4I64A 2YX4A 1SPBP 2MY7A 1S6PA 3FSIA 3K5LA 4JI2J 4M5NA 3MTKA 4CO3A 5F8GA 2J6SA 3MCMA 3BN7A 3TZZA 3DFEA 4TQSA 4KV8A 4KHMA 3PRVA 2M0GB 4NZ6A 3JSRA 3MEDA 3BDPA 2YKOA 4CH0S 4RO0A 3MPVA 3PTWA 5FJ4A 2VJUA 2BJ7A 5B7WA 4ZVOB 3THVA 2MMYA 3RW6A 2A2CA 2WOMB 2F4VJ 1UWAA 3PW2A 3R1LA 4OZ1A 1ULRA 3E3XA 2GV1A 4QCLA 4K4XA 1SC3B 4PWUA 4BWJA 2W2MP 5HMZA 4AXIA 1U26A 4NLWA 2HSEB 4TNOA 4NZ0A 2KRBA 2AX0A 2ROGA 1VMBA 3IO1A 2HQIA 4Y2IA 5I3QA 1IKVB 3ETOA 4OYIA 1SJ1A 1RT4A 1N5YA 5DGBA 2IFXA 1GXUA 2OPRA 1T9VA 4RW9A 2JFKA 2E1CA 5CYMA 2K1RB 1ZTWA 3GV5B 2UUAF 1URNA 4U9RA 4A48A 2X1GA 3TAMB 3ZZPA 1DRZA 4HH0A 1UVMA 2Y8WA 2BJ8A 3L7PA 5F8LA 3KHRA 2ZE2A 1M1KT 2M5YA 3IA0A 1R0AA 1VS3A 2MQPA 4ES3A 3GFYA 4ZVTB 4TN2A 2DR9A 1N6QB 3IGNA 3ITHA 4UZBA 2U2FA 2ZBQA 2JRSA 4AMPA 4I6AA 3LH2S 2AYMA 1I94F 4DPYA 5KFEA 3D4JA 4DR1F 2IA6A 3HDSA 7AT1B 3KJVB 3J81U 3TOQA 2BUNA 3KK3A 4C8NA 2VG6B 4NI2B 3MM7B 4R0JA 2I6WA 4HHJA 1X5SA 4K5RA 2GFFA 1SB6A 3BGUA 1ZTTA 2MQQA 4DL6A 1BQXA 2J9EA 3US5A 4O4RA 4WXOA 3SCLE 3FQLA 3M30A 2FY1A 2IAJA 2CDRB 2ZC3A 3LP1B 4HR2A 2GO9A 1VK3A 4ILLA 1IKYA 1R8BA 3MMCB 3K5OA 3WX4A 4P52A 1AXQA 1NEEA 3ETMA 4DZ6A 1RISA 2AEFA 5HAOA 3LGMA 3GR0A 1NUEA 3K5PA 2KG1A 2Y0SD 1AYEA 1TUGB 4EK2A 5J1EB 3X3UA 4TQRA 1JB0C 3W63A 2ZNYA 2VPWB 3TVZA 3DLBA 1DQAA 1I94J 4QIFA 2AU0A 3VAMA 5LXYA 3MOZA 1UTAA 4MKBA 3PX0A 4HHHA 2DNNA 3DRRB 1UAWA 3MWBA 2KDOA 2VIHA 3PW0A 2N82B 4KKOA 1F1BB 4WYWA 5DRKA 1EKRA 2A6OA 3HSDA 1OY9A 2KYZA 2DNZA 2HWTA 2Q3PA 1FRHA 4DS4A 2JZ5A 4KR0B 4U95A 4M5DB 1VQOS 3DDIA 3N5BA 1T9UA 1GK8A 3B8HA 4K7QA 3HLUA 3IRXB 3VAHA 1NK8A 4HI1A 3I5AA 4O3RA 1FWPA 2R8HA 1NSAA 5DO2A 1EJ7L 5M2PA 1KVKA 4ZVFA 3Q8RB 2NXCA 1WC6A 3OFFA 5T41A 3IM9A 4RUBA 2ATLA 1FJ7A 2IPOB 3AAWB 5F9LA 2YQ1A 3LAKA 2XHWA 3AOAA 1OYEA 2LCWA 2HZCA 5G0RB 4W90B 2WSCC 3FGVA 2H5EA 4IH5A 4MFBB 4OZJA 3FEXB 4QR2A 2CG8A 2BW7A 1XJWB 2ZD1A 2AV5A 3HKWA 1XN9A 2XY5A 4C98A 4C2MA 3GYXB 3PX6A 5HLFB 1E6VB 3GG0A 4OLOA 4AE5A 5K8OA 4USVA 1MN9A 3CSKA 1F2GA 2QYGA 3LWMA 2CPZA 4DV5F 4FXVA 2GCFA 7FD1A 2XCAA 2Z2YB 1X5OA 3F56A 5LMNF 2RMLA 1X4GA 2R8JA 2M8DB 3L3CA 1QTNB 2LMIA 1RLCL 3TJ8A 1HBMB 3CC7S 3UWTA 1N56A 2L9DA 3CO0P 3QAUA 2E5IA 2LXUA 3D0HE 2ZVSA 4A8OA 2ADCA 1HWUA 1H2VZ 4ED0A 1W7WA 3S7RA 4E98A 1Y4ZB 2RKIB 1FKOA 1HNVB 1CC7A 1RT7B 3AT1B 4URSA 1NZAA 3C14A 4OYBA 3VGTA 1FHTA 2FHOB 3I96A 5B0BA 3KDOA 5K14B 1N33J 2CQPA 2R2SA 3ZZYA 1F5AA 5ETKA 3KTQA 4KTQA 3MGJA 1JLFA 3SSQA 1WJ9A 2QZ8A 2FVSA 4A8XA 3DU5A 2F4FA 3NL0A 5K8MA 1WSVA 5L8RC 3EUNA 2G2OA 4PPDA 5J2PB 4DQIA 4OJHA 3BO3A 4KPCA 4ZVEA 2DIUA 4DV5J 3C6UA 3T6JA 3FRYA 2GO8A 4NX9A 2RDDA 3KLEB 2WSEC 3EVOA 1VQ5S 4PKDB 5LMNJ 3H5UA 4I4BA 5JXSA 2A0FB 2L41A 3M8QA 3DKDA 3OT9A 3NOGA 3LPYA 2V4QA 2PDAA 2MLZA 2YNIB 2NLWA 1P6TA 4JI0F 2NUUG 1KSPA 4OZ3A 4DN9A 1OO0B 5J2NB 4IOCQ 3G87A 3J80U 4K50A 2HS3A 3TX8A 3RB3A 2BKNA 3IS9B 1S6PB 2ALZA 1SV5A 4WYLA 1FX2A 5A6WA 4CLYA 1IR2A 3D6TB 4HT7A 1QAIA 3EDQB 4MYUA 1PGZA 4NXMF 2GMJA 1JNZB 3FQKA 3H5SA 2QL9B 2FJBB 1NSPA 3R2CJ 3T5JA 1Y5LB 3MEDB 1TKXA 2W7PA 2W8LA 4LUBA 3PVXA 1OY8A 1RAHB 4WCEQ 1EP4A 1IWAA 1HI0P 2GS8A 3CJRA 4QBUA 2CQDA 4B3SF 3MEGA 4IRKA 4XIUA 4BWMA 2QLFB 2PMWA 3SCJE 1RABB 1WHYA 3PW5A 1HQEA 3TRGA 4MYTA 4Y34A 1CJTB 2PN6A 3BREA 3FSYA 3DRSB 2O67A 2XWXA 4Y2MA 2HW3A 4JI0J 1L3KA 2B43A 1ZZNA 1FVQA 3VVUA 2BX6A 2AX1A 1GNKA 4H4KC 3EE3A 4IH7A 3W66A 1JLBB 2M8HA 3CF5Q 1N5YB 4FYYB 2Y1LB 3PRBA 4NA3A 4K59A 2OPRB 1OYDA 2XNQA 2EKYA 3ILJA 4JI8F 4RW9B 3UCGA 1TL5A 2ZOGA 2FJVA 4ECUA 1S4FA 4IDKA 4DX6A 1NKEA 4NXMJ 1FD2A 2I38A 2ZE2B 4L3KA 1R0AB 2DIVA 2AJ4A 4OHXA 5IT9Y 3AD9C 5DDPC 5L38A 3O2IA 3ITHB 4QWEA 4X65F 4PG6A 1U02A 3OL6A 2LXIA 2YWWA 1FJCA 4RUHA 4NCGA 2A1BA 1WEZA 4FNIA 4ELUA 1RACB 1KP6A 4DX7A 3RB6A 3KK3B 4B3SJ 4QW9A 2FQQB 2RAQA 2V2ZA 1YRUA 3VZIA 3TAQA 1WC3A 5DQIA 1Y9OA 3RBEA 3LW5C 2DXEA 1WG5A 3M05A 2YX7A 4C7QA 2R7RA 4B17A 4NLDA 3JSMA 2NREA 4E2FB 2XMUA 1E6YA 1PYTA 3M30B 3TA1A 4PUOB 2IAJB 2UVWA 4XDCA 2AIRB 4JI8J 1DLOA 1YRXA 1Q8LA 3WIVA 1FFWB 2RU3A 3CULA 2GHPA 4CIOA 4YP3A 3NLCA 1TAQA 5T7LA 2IY5B 2DHHA 3KK2A 2HHTA 1K8AT 2QG9B 4AMOA 3R6LB 5M2RA 1U6FA 1NDCA 4QW8A 2MZRA 1N34F 4X65J 4DX5A 3E51A 1NHKL 3MCSA 4WF9Q 3HFKA 4DV6F 2VASA 3V81B 4OYPA 4DSJA 2RS2A 2A18A 5L9XA 1SI9A 2YH0A 4NOHA 2MZTA 2L08A 4KKOB 2H54B 2HVZA 2PA8D 4QPXA 4WE1A 5LXRA 2ZOFA 3KDNA 1RK8A 1RA7A 3L9ZA 3CCZA 3QFHA 1L3SA 4ZHRB 2B56A 2MZQA 4RKUC 2E7WA 2KN4A 2X51A 3MM6A 2PFDA 3IR5B 1NK7A 3I55S 5KT5A 3I82A 2OAUA 4C9DA 3AH6A 2ZH1A 1WHVA 3HKZD 3VR1A 4P72A 1NZ8A 1X5PA 2XWYA 1NK4A 3CXCR 4M94A 3Q23A 1S49A 1RWOB 1AA1B 4DQSA 2JFDA 3MPUB 5I3UA 4F0MA 1QE1A 4RNHA 5I3PA 1Q5YA 4J9MA 4ED1A 1U47A 1N34J 3SEOA 5D3GA 1J2VA 2D74B 3EGWB 1IM4A 2ZH6A 3PKYA 4DV6J 4HEA9 4USJC 3NCRA 2I1RA 5L1KA 2FVPA 1MWQA 2ZH9A 3ZXWA 2CPEA 1NH7A 3OR1B 3W65A 2ASYA 1LWCA 3T6BA 3BBFA 3BSCA 2DNRA 2H5JB 4K4WA 5B0FA 2XO7A 2FZKB 1KKHA 1DTTA 2IRXA 1SL2A 3HULA 2C28A 4ZKAA 4QU6A 1MNEA 4CNYA 2HNDA 4TYBA 2D9PA 1LFPA 2FY8A 2XSFA 2KHDA 2OSQA 3UVJB 1SH0A 5E7OB 3IC1A 2ALYB 1YBUA 4ITSA 3KWMA 5THWA 1QSYA 4FYVB 1L3UA 4W92B 3DM2A 1WDDA 3MM9B 2MKCA 3HHLD 2E9RX 2ZH7A 1WOSA 4WJBA 4XAKA 4BDPA 3OXFA 1J5OA 1FKOB 3I4PA 5EWEA 1HQ2A 4O0IA 2F9JA 1QSLA 2XEXA 2DD8S 3IGVA 3R7NB 3C14B 1WF1A 2Q79A 3CNQP 1VBZA 2YKMB 2YQ0A 3IP0A 4K4TA 2CQ0A 5A2QY 2HFZA 4MIAA 2IVYA 2EBEA 2HIQA 2W2NP 3MHYA 4ECQA 1FKPB 3PRDA 2VBYA 1T9TA 1EAYC 2M70A 1JLFB 3CDAA 1XERA 3IWNC 3EDRB 2EPIA 4QR0A 2B9WA 4I68A 5J2QA 1K73T 4RNNA 1XIQA 3FDSA 1PYOB 2ASJA 3C6TB 2QO3A 1LOUA 1HWKA 3CCQS 3A8JA 1CSJA 5K9FA 2K3KA 3H4DA 1VRUA 1WOPA 3M8QB 3HHLA 1TL1A 1UJ6A 1JLQB 1GMWD 2G0JA 3NGDA 1X5TA 2U1AA 2XZTB 2DJWA 5C25A 4N41A 1N5VA 2HK2A 3GP9A 4TXSA 4NLQA 1S0OA 1YSJA 5GMDA 5LOQA 4DQQA 4LBIA 1UETA 1BLUA 3O6QA 1DHMA 1KQSR 4MAKA 3ZZRA 3CCWA 2F63A 2IDLA 2QC3A 5GAEI 3D66A 4EZ6A 3UN2A 1TKXB 2LEBA 5EWGA 1VQ7S 3PO4A 2F65A 4PWWA 1YWXA 5KFLA 1FXLA 2CZVC 3MMJA 4NLGA 4PAAA 4L72B 1U1QA 3CD7A 1S1VA 4QOTA 3K0JA 3WC0A 2MQ8A 2RILA 2J9DE 5H9FK 1EP4B 3MEGB 1RU1A 2FYXA 2G9OA 2VBWA 5DQHA 3PG9A 2KT2A 2ZJRQ 1GMWA 3GYNA 4W4MA 4Q45A 4ZVUB 1HQEB 4F4XA 3MD1A 3WX8A 3SSRA 1ZS6A 3P8BB 1X9SA 2BV3A 2EW9A 5B0AA 1TK0A 2KFZA 5HO4A 4Z37A 4J9UE 4ECSA 3QZ8A 1DARA 2XTJP 1YK9A 3IRWP 1YJ9S 3CDEA 1RAGB 1Q1KA 4K4SA 1Q16B 1JKHA 4RW4A 3N0VA 5D6GA 1X7VA 4Q2LA 5KG0A 3CCSS 4F3MA 2XYPB 1X4FA 2UVVA 2FLNA 4IDKB 3D9BA 3GTYX 3GJSB 1B7YB 2ZUAA 1HNIB 4JI6F 1OPZA 3UPFA 3IG1B 2EXUA 2CNKB 3MAQA 4LFBF 2E5HA 5F8MA 3BR8A 2Z2LA 2PFFB 1T03B 1TQLA 3FSXA 3UNGC 2Y9HA 3P49B 3DRPA 3D28A 2DNQA 2VODA 1DTQB 2K7JA 3K17A 3LOUA 2CVIA 1K47A 4CO0A 3KOAA 1HHQA 2BACA 3TEHB 2L9NA 3VV2B 1JNRB 1Q53A 2OPQA 2WHOA 3JSMB 2BJDA 2XMAA 3NMAA 1E6YB 2MSTA 1VBYA 3HVTA 1ZM2A 1HI1A 2V5HG 1PIEA 3ET6B 2VDHA 3VZHA 5LSLA 2EK6A 3QGIA 4U8YA 5D77A 4Q43A 1EZZB 3C66A 2FTRA 1HW9A 2JC1A 1DLOB 3IBWA 3V2UC 3AJ1A 1BY9A 1JLCB 3MCOA 3D68A 5IFMA 2C1EB 5T7LB 4YS2A 1UFWA 4I0WA 3KK2B 1P27B 2VFSA 5KOWA 4JI6J 5KT4A 3PJ9A 4C97A 1FDBA 1LQ9A 5CA5A 3BPDA 2XMVA 4EGLA 1QSSA 5D0HA 3THTA 1KQGB 2VFTA 4G1IA 2DO4A 1HBNA 1C0UA 5H9FJ 5B0EA 1Q8BA 4HKQA 3UE2A 3BF4A 3VF0B 3GIJA 3NBPA 4NLTA 3U27A 4WZMA 1ZZFA 4KO0A 3MM6B 3D67A 2HQGA 2GW8A 1RADB 3N6LA 3SV3A 4AYBD 1Q8IA 1RKIA 2DITA 3CD5A 1FJEB 2D9OA 5EX3A 3OR2B 4USUA 2CNNB 4C0HA 3QGGA 3G82A 3TI0A 3WDOA 3U7JA 4J9QA 3ZTSA 5I3UB 1QE1B 3EMTA 2O5DA 4H54A 2YNGA 2B9XA 1W25A 5D3GB 5E0OA 2DH9A 1IKWB 4JUZA 2BQRA 4IR1A 5KFNA 1RT5A 4CZCA 5DG7A 2WK4A 2QA2A 2KT5A 4B3RF 4U7UD 3JYTB 1REVB 2JOQA 2ZHOA 2B4PA 3W3SA 2AP6A 1SKSA 1GTHA 4JP8A 4P7VA 1FNOA 2BBEA 2XLIA 3IWLA 1DTTB 4M63A 3HJFA 1NK6A 3DOKA 1TV6A 3R7BB 2HNDB 1SVDA 3OSPA 3ISZA 1WUUA 2B5JA 2XM3A 3CJQA 1KHVA 2V50A 2MZSA 1U0SA 2CJYB 1JJ4A 2VFVA 3QMQA 1QVGR 1TMMA 5BXIA 2CJQA 4YEAA 1HKAA 3DM2B 3SMZA 1IR1A 1KVIA 3RRGA 5HJXA 2VQEF 1J5OB 2YXLA 1Q78A 3ILOA 2DPIA 2MLXA 2O3DA 3K7RA 3GONA 4N7TA 2HBRB 4MH8A 2I8EA 3BH7B 2LQBA 3Q8PB 5FD1A 4NLVA 3OTDA 2QLWA 3Q89A 2M3DA 4QZVB 2E44A 4KBIA 4B3RJ 3AXMA 4LF7F 4PG5A 1FX4A 3KUEA 2GAHC 3PYEA 5HQMA 1RI7A 4MK9A 2KFYA 3OJUA 1U0HA 3EJMA 4FF4A 2DHAA 4J9OA 2BJEA 4AXJA 2HQFA 4FKYA 3BGLA 4RU2A 2HK3A 8ATCB 2LFVA 1RWWB 1HW8A 3E8OA 2V8VA 3QO9A 4ANDA 2XGPA 4ZPAA 5D0GA 3M6VA 2DRDA 4RW7B 1OQ6A 1VRUB 3HHLB 5GAEU 4RZRA 2AGOA 4FNHA 5C25B 3GFZA 4ED2A 3DYAA 2DGOA 4EMDA 3DU6A 1Y5IB 2J6TA 3K8WA 3QRRA 3BQ1A 2DGQA 3SBMA 4IQMA 3EGVA 4GO7X 1T02A 2F9DA 1AZSA 1MMNA 3H90A 2N4CA 2H48B 2YNHA 4NLPA 2WVFA 4ELVA 2GJFA 2WRMA 2DHXA 3PYDA 3T1AA 2B7CB 4LF7J 4CNZA 3HHKA 3CC2S 5BJRA 1CBKA 1KHWA 1FXDA 3UCZP 5AE3A 2BRLA 2VF3A 2YH1A 1T9XA 2X7IA 4GC6A 2E7XA 2LP4A 4RL1A 3ZTRA 1S1VB 2C2RA 1S57A 4F4YA 1WC4A 2ZOMA 4OQJA 1F5CA 5ETQA 2J0XA 4BBYA 3M1VA 1OJ4A 3EX7B 1S6QA 1YX2A 4ZJQA 2OFHX 1S6UA 2CPXA 4IOBA 1VQ9S 2HNZB 1QAYA 4TY9A 3HO1A 2YKPA 4RLEA 3D7SB 4CM0A 4LVNP 3PY8A 2R7SA 4EYHB 1H6KX 4DLGA 2DXDA 2MKKA 1U2CA 1BMQB 3JS9A 3SYZA 3GYGA 2AGPA 4RW4B 3KLVA 1X4DA 2E1PA 3FFIA 2IMOA 4LFAJ 3K5NA 1S79A 4EWTA 1H2UX 1VI7A 3R5AA 2F8MA 1Q86T 1FRXA 3MR5A 4J9PA 4FPRA 2IHR1 2XHCA 2COLA 4UW2A 4LR8A 3MEKA 1S7HA 3AJDA 4OHWA 1SIWB 1RHKB 3GJRB 5AXNA 1EHWA 1KLMA 3DRPB 5DLFA 2Z0GA 5KFCA 4MIWA 3D3BJ 1VQMS 4OYWA 1SJ4P 2LDIA 2ZH2A 4WP8A 2CPDA 5JMNA 1RJJA 3DI6A 4PRFA 3OSNA 1RHQB 3DLGB 1FE4A 3VGVA 1IR0A 1CPZA 3RR7A 3R3TA 1X9MA 4UF4A 1GX6A 3PEHA 4KSEB 2IYIA 1JJCB 5KOXA 1ZAVA 3RUBL 3HVTB 3SI8A 3AODA 4WFAQ 2B6AB 2RQ4A 3QT7A 1FWLA 3HP6A 4RX6A 1NPKA 2C2OB 2XMJA 3DLEA 1FESA 1X60A 1S1WB 2YWEA 3K8VA 4WBFA 2JVRA 1CQMA 1MROB 2PI4A 2RJZA 3FNNA 2HMIB 1RAEB 3CDUA 2MKYA 2AKWB 1A0OB 4XDDA 4CWBA 1PO6A 4B08A 3GU0A 1DBDA 4DSEA 3GIIA 2DGWA 2CPHA 2JNJA 4ID8A 4HACA 4NLRA 1HD1A 4FS1A 2ZZNA 2FJXA 2JVOA 3V5RA 2GC8A 1FT8A 2M4MA 3GV8B 2EG1A 4A4JA 5B0GA 1QJHA 4Y2CA 2HS4A 3HZGA 1YZ6A 2ADBA 4ZP7A 1LNQA 4ICLA 3NBPB 3OXLA 2IJNA 4DPWA 2MKJA 4X66F 4NMLA 1TR0A 3UFCX 3G8SA 4BCAA 3QSYB 4KO0B 1WSRA 3TYTA 5ETNA 4DSLA 4J9SA 1RP5A 1BE4A 5C2CA 3MM5A 1U09A 2Z8QA 3OHAA 5F9NA 2RE1A 2P6SA 1XNRF 2ZBRA 4AL7A 5C2GA 1T95A 1UWBA 2APOA 3G82B 1ZA1B 2MHNA 3I5BA 1JLGA 2V8PA 2XS7A 3H2VE 2P9CA 4KT0C 3HVRA 4LBPA 1R27B 4I2PA 1Q8KA 1R6YA 2VFRA 1T11A 4IO9Q 2PI5A 1QDUB 5M2UA 1R31A 3BZQA 3K58A 5A0YB 4PR6A 4XTTA 2DNGA 3OFHA 1MW7A 2QEXS 3GE9A 5KFJA 1K44A 1WOOA 1A7GE 4M5HA 1RWXB 3TQEA 3RTVA 1SQGA 1HWLA 2GJIA 3I4HX 1TELA 1L3VA 3QIPA 4X66J 4NE9C 5JUMA 1VRTA 3P5TL 2IBOA 1B0PA 3RGIA 3CJ5A 1RKJA 3BSNA 4RBUA 4G6VB 4NLXA 1CULA 1UJ4A 3NNAA 1TKZA 3T1YF 4FVCA 2W9BB 1AFIA 1HWJA 2DNOA 4D3GA 4D3HA 2R8KA 1IJFB 1ZETA 3CIZA 1XNRJ 2IM3A 2CVEA 3ENWA 3TX0A 2C2KB 2HWHA 4CH7A 4P2FA 4LF2A 2RRAA 2D1CA 1WF0A 5F41A 3MF5A 3KG1A 4ERDA 4M95A 3HHDA 3N79A 3QT8A 2GHWA 5KFOA 4KH1B 3KLFB 3NEKA 1LW0A 2CKWA 3AQOA 3KKFA 3A3OB 5KFTA 1K0TA 5KG6A 3BO4A 4ED3A 2BANA 3W9HA 3CUNA 4ZCMA 2RUSA 4DZDA 3EZUA 2AD9A 4USTA 5DETA 3MDFA 5F0UA 5EWFA 1TL3A 2FPHX 3G2XA 3F44A 1DFDA 2YKAA 3QO9B 4A8FA 3SSSA 2MSSA 2GQCA 5KFRA 2XO6A 2H4YB 3MCNA 4WTOB 4LSLB 2N7YA 5HMYA 1RB0A 3T1YJ 3QSIA 4GVBB 3GCWP 3R2DJ 2WVDA 1F3VA 2HHPA 4PG8A 2R7QA 4ED4A 3M8YA 1HPZA 3ZZUA 3U1MA 3T9ZA 3MTJA 2N7CA 7FDRA 2N4DA 1O5JA 3BO2A 1RCOB 4RUAA 2CXEA 1JJHA 3SV4A 1C0TA 5JVGQ 2VICA 1UA0A 3TVYA 3H98A 2ASLA 2OEJA 3D1OA 2YNHB 2H1YA 3N28A 3WHIA 3C15A 3QLHA 1VJWA 4ZP8A 4M5MA 2V69A 4Y3CA 3OVSA 1O8BA 1U4BA 2M88A 2W4DA 4QQBA 1BWEA 4UOFA 1VQSA 1AB8A 5B0DA 5BR8F 3KJFB 4TU7A 3B4MA 3D6MB 2MKSA 3JSBA 1RWNB 5GADI 4MIBA 2W25A 2XYHB 1NDKA 2R7UA 3ZNJ1 3CCUS 1UEUA 1HQUA 3AQPA 2LDYA 3OTCA 3M1VB 2RRNA 3A4TA 1S9FA 2P5VA 3R1HA 1TUVA 4IG0B 5CYJA 5DZ6A 1D8YA 1FTRA 4ZVPB 4PEOA 2JSXA 1UMJA 3M9OB 5D15A 1RWPB 3W8PA 1U1LA 5DDQC 1U6ZA 1U45A 3M2RA 3GG1A 2R9LA 2FZCB 5CYQA 2IC3A 1V3RA 1K1QA 2H51B 1FRMA 4W98A 5E33A 2MKHA 1ITPA 1N0UA 2WW8A 3CCRS 2X1FA 2W2PP 1U2FA 2NR0A 3VQTA 1S1UB 1U2RA 3UI3A 4U67Q 3RU0A 3ZTQA 5ETRA 3C2PA 2LA4A 4B3TF 5ETPA 3IR6B 1RGVA 1FFSB 1C1CA 5KG5A 5BYSA 2HNYA 2E9TA 1LK7A 3IBFB 4OYZA 2J7UA 5BR8J 1NDLA 3C16B 4OX6A 9ATCB 1PG5B 1B70B 1HMVA 1WWHA 2XSJB 2K7KA 2HZVA 3GILA 2DB1A 1RTHB 4RWWA 4DU7A 3JAMY 1VCTA 3P96A 3W62A 1N36F 5KFWA 3GB0A 3FUYA 5IV3A 1IM6A 1CQNA 1GFWB 4KJIA 3AXKA 1W2BR 4H4MB 4UT4A 2BJ9A 4O3NA 5HROB 2ZM6F 1H7XA 5JJBA 2W1BA 4OYXA 1DY3A 5K5MA 1MLAA 1HBUA 4NL5A 3GWCA 1GXTA 4K8RA 3OUYA 2UVRA 1MWYA 2B4VA 2CQ1A 1I1GA 2FVRA 1ACMB 5IWAF 2CQGA 1JQGA 4LQ9A 4B3TJ 3UDEA 2MEWA 4CLZA 4CT9A 4KGVB 2J9DA 4I2QA 2Y1RI 3S1TA 3UDVA 1JXEA 4O3PA 2HURA 2C3PA 2NZ4A 2FIUA 2RB7A 1VIOA 1RT2B 4Z7YA 2KM8B 2DISA 5SZTA 4OI1A 3I0SA 4YDDB 4JV5F 2AEJA 4X64F 4OLPA 2ZH4A 4GC7A 1N36J 2J5AA 2BYCA 2R7WA 2G2YA 2BJ1A 2CQ3A 3DXSX 3CJ8A 4TYAA 1GAOA 3MECA 3J7YI 3E01B 2B3TB 3O44A 4ICLB 2CIMA 3NWGA 1CJVA 2JDJA 1OPIA 2QFIA 1FTCA 3K89A 2Z58B 2V94A 2ZM6J 1L5UA 4L6V3 2AW0A 4HH1A 1NH8A 1VC6A 2CADA 2LECA 2OMLA 1R43A 5EN1A 3MM5B 1LEOA 2V8DA 2GVZB 3MM8A 3THPA 5IWAJ 3NRBA 2WTFA 1M1GA 2W4CA 2MTLA 4DFKA 4AD6A 4AT1B 3CCTA 3PFEA 2ZFHA 3ICLA 2XG8A 2EFNA 4FP9A 3CT9A 4DV0F 3OBIA 1TP7A 4OHYA 3MURP 2R8GA 1CJKA 3MMBA 4I2PB 1U1PA 3DHXA 3V6DA 3HFVA 2CNLB 2VG7A 2H9ZA 2C2MB 3HHEA 4DG1A 4Z2XA 1UP1A 4ECZA 4X64J 2R7VA 3NAIA 2PEBA 1GQEA 3MR3A 4FF1A 2HHVA 1SQEA 1F3FA 5CHCB 3MAAA 3M32A 3I9V9 1S72S 2YTCA 2MGZA 1T3OA 1EIYB 3LP2A 1T9WA 1WORA 3RW7A 5IV4A 3A13A 3PX4A 3H25A 4C8LA 4N76A 1TKZB 4DSIA 1LXJA 3BPSP 4CO5A 2ZITA 2QMXA 3DOLA 3CJ2A 4DV2F 4OZLA 2HGNA 2ZDPA 1WKJA 3WQPA 2XB2D 1JLAB 2IRUA 4DV7F 4DV0J 5D8HB 1TTHB 2QT7A 5EDWA 1T94A 2HZAA 3ZTOA 3BS9A 4UQTA 1NHUA 1VC5A 5KT6A 3BGRA 1LW0B 3MPYA 2LA6A 4C8YA 1KDNA 4WWSA 1JJ2R 1CEZA 3MFHA 4IG3A 2BANB 1U1MA 1VHIA 2K3IA 2C2DA 3HFZB 4QJVA 2PSZA 1R8PA 2CJAA 3Q2TC 1RHRB 4IFYB 1KLNA 4QPTA 1CLFA 4EU0A 2HBZB 1YJ7A 4OIXA 4RBVA 2RUGA 2E1MC 2DHGA 4FBTA 3TNVA 2IM1A 3T3FA 1UKUA 1HHSA 1S1XB 1FRJA 5I42A 2HAFA 4NEYA 2XS5A 2Q6CA 3M2VA 4EO6A 2VL1A 6FD1A 4DV2J 3V4IB 3LA0A 3FEYB 2OPPA 2WAQD 1HPZB 4PXEA 1SC1B 2OP5A 4Q0BA 1NJWA 1S10A 4YDXA 4DV7J 4YQWA 4PYDA 1Q7YT 2BE2A 2CQ4A 1M1HA 4ZLNA 5GADU 1PCAA 4MJKA 2VKRA 1YGYA 3GLJA 3DXBA 4KHRA 1WF2A 1HR0F 3QPIA 1G6BA 4DQRA 2BDPA 1NK9A 3C15B 3I0RA 3QLHB 2HPUA 3CCJS 5LMUF 2LLZA 1TL4A 2ZDOA 1NCLA 4KY3A 3NS7B 3AD8C 1UVKA 3Q8SB 4DEZA 1UZDA 3DHWC 4YOEA 4I7FA 2HHQA 3LGNA 1UJ5A 3NCPA 2VQFJ 3FZBA 2W7OA 3GJTB 2V8GA 4F0KA 2X3GA 5F3TA 3OPKA 1KOHA 5IZHA 2LU1A 2BA9A 2WB4A 4J91A 4OFZA 4IO1A 1HQUB 1Y0HA 5BYRA 2MKIA 1UEKA 4HTJA 2JEJA 5KFXA 3BB5A 1NRKA 4FF3A 3W1YC 4P73A 5ETLA 4B9TA 4OL8A 4DCOB 3DMJA 2BXJA 3HF5A 3M2RB 5A8KB 1O6XA 1KOOA 2BEFA 5GMKa 5CYQB 2YKQA 2CJ9A 1TU0B 2XQCA 2NCKL 3IM8A 1B64A 1VBXA 1YIJS 2AZ1A 1K0VA 2QA1A 3W61A 2KTQA 2R2TA 1HR0J 2I9SA 1YJTA 3EGNA 5LMUJ 4CP5A 3DLKA 4HVZA 1ZM4A 2MQNA 3JQJA 1C1CB 4KFBB 4ZPTR 5ADZA 2IBKA 2GZOA 4IFVA 2EFPA 2FJDB 1KC8T 3HT3A 1FXRA 1RWMB 1HMVB 1YQHA 2Q66A 2V2QA 4JV0A 3G8TA 3POTA 1JIHA 5KG7A 3SDEB 1JK9B 4V19X 1H73A 1U48A 3B4DA 1BGXT 2OKQA 4G1QA 3PW7A 2CG4A 4JOUA 4C3KA 3UN3A 2EWHA 1FEHA 2HFVA 4P75A 5C24B 3ILIA 1NK5A 5AT1B 4GRSA 4YR2A 4Q2MA 2WB1D 1HBUB 1Q95G 1IKXA 2HLTA 3OUYB 4A8SA 2HGLA 3FBBA 5IQQA 4DL5A 4WFXA 3M8ZA 1TK8A 1KD1T 2AQ4A 2PEHA 2ZHBA 4JI5F 2VD3A 2FGCA 4UY8T 1SUQA 3HT0A 2DKOB 1H98A 4X4TA 5GVQA 4LF6F 3J7YU 2YPYA 2IA0A 4EBDA 2R7TA 2Z57B 2DNPA 5IM0B 3KLGB 3AJ2A 3KJNB 3OL9A 1FCAA 2DTJA 5F8IA 3T5KA 3A8EA 1RU2A 3I0SB 3MR6A 2CPIA 3PV8A 2OJ3A 4OYAA 1EQMA 1D09B 4PPZA 3CEDA 3HCXA 5CZVA 3P5BP 4B3OA 4PABA 2DNLA 3UQSA 3CCES 1PSDA 4RJVA 1S9EA 2DVIA 3MR2A 2HVEA 3QT6A 4U96A 1CJVB 4ZN3A 3EVMA 4ZJLA 4QIEA 1MSWD 1N33F 3KLIA 2BMBA 3CJKA 4X62F 3LP0A 3CCVS 3RJMB 4KRWA 4RW6A 2UVUA 1LWEB 2FZGB 4NZ7A 4RW8A 3MM8B 1T3NA 4JI5J 3DDKA 2B8QA 4DL2A 4ZP6A 3O3LA 3D1QA 5IT9U 5A8RA 3ENVA 2LEPA 5F0WA 4LF6J 1SJFA 2ZH8A 2E1AA 3MMBB 4EBEA 2PGCA 3V6DB 1B3TA 2DNMA 4S0MA 2OMOA 1X9WA 1PKUA 1S4EA 4DG1B 4UQGA 3R5DA 3Q22A 2CFXA 2QJ3A 3MUVP 2ZZMA 1HYSB 4USWA 1M5VC 1H7WA 3QT5A 5HP1A 3M32B 5HVGA 4O3OA 2UXCF 2ACYA 4IQXA 2UXBF 1PAEX 2A2DA 4FKXA 2DNHA 3W2WB 1H3DA 2MGZB 1SKUB 3LP2B 2AJFE 4Y65A 3K2YA 3RYLA 2MY8A 3MUTP 2AJQA 4X62J 3SQOP 5FLXY 4KGZB 2IRYA 1Z4UA 3M4XA 4DF8A 4NMXA 1KRPA 1OSCA 1N48A 3DOLB 2D3O1 4WPAA 2OHDA 4X4SA 4DCJB 4KGKA 1IBMF 1O51A 3FCVA 4RU9A 2ZZTA 3QGHA 3BQ0A 5KFSA 4K4YA 2CDQA 3FKBA 3EGZA 2OPSA 5EGYA 1FD8A 4GMKA 1N5TA 2EK1A 2AHOB 3EICA 4CLPA 2CQCA 4R5PA 2BOPA 3BGRB 2EC2A 1HI8A 2VBXA 3OJSA 3NAHA 1VLYA 2O1PA 2EC0A 4TKTA 4IG3B 4X4UA 2AMCB 4C8OA 5HVFA 2MYFA 4ZCKA 2UXCJ 2VA2A 1UVLA 1KN6A 2UXBJ 2NYHA 3QRQA 2UV8G 2G1DA 2E66A 2GMHA 2IMWP 4KV8B 3GSIA 4NEZA 4FYDA 2RD5C 3PR5B 4CLWA 3HM9A 3D3CJ 5I42B 2YBVA 3M2VB 1N32F 4JV1A 2DR6A 2MJUA 4O3SA 2KRRA 1IBMJ 2LVWA 4ATNA 4J9RA 4USIA 3AY0A 3JXOA 4JB8B 1NPPA 1IKVA 1MN7A 4Q0BB 2MZJA 1IVZA 4ILMA 3TA0A 2GQ2A 4C4WA 2BE2B 5C5JA 3NWRA 2C3YA 2VU5A 2RF2A 4ZP9A 4IOAQ 1VQ4S 2J0WA 4EO8A 5AXKA 1RHMB 4V1Ak 2AYGA 1JMTA 3TAMA 2UU9F 2HVHA 3I56S 4CQ1A 3I0RB 3JQKA 2V0NA 2NPIA 4PXBA 3HPOA 4MK8A 3TWZA 5HATA 2CA9A 5DLGA 1VQPS 1VQLS 1TZ0A 5HBMA 4H4KA 1RT4B 1VYAA 2FD2A 5CYMB 4X4QA 1RZMA 2HLUA 4L75A 2W01A 1LWXA 1EB0A 2OH2A 3RAQA 3O1LA 3KJVA 2MQOA 4NI2A 4A47A 2AF6A 2D69A 4N56A 1RWVB 2OSRA 1FRKA 1N32J 2ZWOA 3DMJB 1SC6A 2AYEA 4ECTA 4DPUA 1Y3JA 2ZUGA 3ENQA 4NYZA 1XMOF 2KYXA 1HD0A 3LP1A 2GGPA 5L1IA 2DRAA 1HLWA 3MMCA 4LQ3A 5A2QU 3B82A 5HI7A 2UU9J 1VHFA 2LYVA 4FPIA 4ZPDA 1KQFB 3L7UA 4BS2A 2DGSA 4OJGA 1NXIA 4L74A 4ZDNA 3TO8A 4DSFA 3TUZC 2BE7D 1XC9A 1NK0A 4RNOA 5AE2A 4IFVB 3NNCA 1PJ6A 3CMQA 2UUCF 2OTJS 3D6FB 1IKYB 4L76A 3KG4A 4KIAA 3POTB 2BE9B 2UXDJ 4NRUA 1XNQF 3D54A 2DR5A 4KGXB 2GJ2A 3H7HB 4TU9A 2XGQA 4CO1A 3VCDA 1N4LA 4DL0C 3FCWA 2LQJA 2JL9A 1EQ0A 2FC8A 5IOLA 4X4NA 2P2CB 2CQBA 3TVKA 1XMOJ 1QTMA 1HARA 1IKXB 3Q24A 5F8HA 2ZHAA 4ECVA 1AUSL 5KFUA 4YN3B 3RRKA 2R42A 4Q44A 3Q8QB 2QN6B 2Y1IA 1EKSA 1SUQB 2DH8A 3R5GA 3GV7B 3IAS9 3GPAA 5G0RA 1S48A 4LF8F 3L4BC 3KUGA 3EXYA 2ZJQQ 4YR3A 2UUCJ 2V4JA 3BKUA 3W9IA 4EBCA 1JWWA 2MJNA 2KFNA 1VQKS 1F0XA 5HMWA 1WEXA 2ZC4A 5E3CA 4QWAA 5DM7Q 2HEKA 3CWJA 1FJGF 1AT1B 4ER8A 2ZBPA 1EARA 1XNQJ 1NB7A 1E6VA 3SZ2A 4B3OB 4AFFA 1YJVA 4QU7A 3R8YA 3D2WA 1S9EB 1M5HA 3TP2A 2IJRA 2DCLA 1VGYA 4URGA 3EZ5A 3T5LA 4O4GA 5KFQA 2ZD1B 2AYBA 1RQ0A 1UA1A 3WZ0A 5IC4B 2NSCA 3TW0A 3KLIB 1U1RA 3CJKB 5D4LA 1D0EA 3LP0B 4G65A 1LKZA 1HBMA 4RW6B 3KMQA 5ETSA 4ANEA 3VHQA 4X4RA 2YKNA 2A10A 2O66A 3HJVA 4ZLLA 4RW8B 3EPGA 4AL5A 3TEGA 3TARA 4FS2A 5CCMA 1SKWA 1YZ7A 3D5MA 3QGPA 3HVWA 5A8RB 3CW2C 2KO1A 3GIMA 2B0GA 3ZFVA 4LF8J 2X1AA 3SQGA 4J90A 1IWGA 4ZVSB 1R0CB 4U8VA 4XPCA 1IUJA 3VAGA 5K14A 1FJGJ 1FI4A 3A1YG 1Z1ZA 5HP1B 4DV3F 5JVHQ 2YWGA 2XI2A 4J9VA 1PC4A 3CMES 2YPZA 2DR7A 2W7AA 2KB2A 4Y00A 1UVNA 2VPYB 4J9LA 5LSOA 3FC9A 2YNFA 4ZS6A 2ZH5A 2GVDA 1F9FA 2PO4A 3M8RA 4NCBA 1SKRA 1BQNA 2FB0A 4FXDA 3C6UB 4WIQA 1Z2LA 4M5LA 1FE0A 3BBBA 3IS9A 3W8GA 5IQ6A 1BUXA 1WEYA 3MPDA 3N9UC 2OGUA 4ELTA 4I6WA 2C22A 4DR3J 2OPSB 1VQYA 2CPJA 2CNOB 1OQ3A 3GFHA 4EFAC 5DG9A 3PEJA 3I5CA 2DGVA 2FJAB 3N4WA 1V5VA 1VOMA 4LT6A 4R5PB 2RHQB 5LL6d 2K8GA 3BDEA 1U8WA 4ANCA 1Q81T 4UUXA 5LM7E 4DUTA 2HAIA 2XZDB 4C8MA 3ISNC 3LUYA 3PHTA 2KZMA 1SV5B 5C7PA 2QL5B 3FJ2A 1Y11A 4M8LA 4DV3J 2ZBIA 3F41A 1R6VA 3GZ7A 2E5JA 5KFFA 1FKAF 2CWKA 3W5YA 3UW1A 3CDBA 3FVYA 1M5OC 5GMEA 3KFWX 4WU3A 4ED5A 3WBZA 5GAGI 6FDRA 1UVIA 1CJTA 3KK1A 4O44A 4DR5F 1PJ7A 3DRSA 1ZBTA 4OX7A 5AJ3F 4XK8C 1FFGB 3RG6A 3RR8A 5U47A 3VGSA 4KE5A 2B9YA 1SH3A 4LF4F 5DZ7A 4P7TA 3IN5A 3M9MB 1JLBA 1D9FA 3UCUP 2OIHA 1I6JA 3QATA 4WKRA 2RF2B 4O0NA 1XR7A 3DN9A 2QX0A 2QSFA 3NXZA 4C3MA 2J9CA 1ZOTA 3D0GE 4LVOP 1KVJA 1XK8A 2RQCA 1FNXH 5HBMB 2B8PA 2V34A 3H40A 3B54A 2VJVA 4IKAA 4RUCA 4NYOA 4ZJOA 4FYWB 5KG3A 3ILLA 2QMWA 3HK2A 4DLEA 4F4KA 1XBWA 3KUHA 2VA3A 4DU8A 4KB7A 4IRCA 2B7BB 4CLSA 4AQYF 5CZXA 4LSZB 4CO2A 1MMLA 3J7AN 5KT2A 4DFJA 4DR5J 5D0RA 5AJ3J 4NCGB 2HBYB 3LF0A 1SIZA 2JH3A 2OD6A 3A8IA 3C46A 3R27A 4LF4J 4PUOA 4JI4F 1IJEB 4F50A 2GGPB 1PBUA 5SUHA 1WG1A 3HSJA 3U1NA 3W5ZA 2YX1A 3CE8A 3T41A 2UUAJ 2DCUB 2NSBA 4P6QA 5L1JA 1CG2A 4OV6A 2XZWA 4DUYF 4NXNF 4EUVA 3MD3A 1N54B 1RE1B 1Q7LB 1Y00A 3CPWR 4LR9A 3QYYA 1ZH5A 3L7OA 2MQLA 1TK5A 4CH1A 5J2MA 3LTOA 4OI6A 3Q2SC 1FDAA 3V81A 1V9OA 4DR1J 3GCXP 2VC0A 4WIIA 4UOCA 2CUYA 3SIPB 4YB6A 3A12A 3ZTPA 4AQYJ 3TZXA 2RSQA 3UNYA 3CIMA 3F0NA 5HVHA 4F26A 2EG2A 8RUCA 1R0BG 3FBFA 1X0FA 1ICEB 4ZHRA 3RAMA 3T19A 4AL6A 9RUBA 4JI4J 2DEJA 1JXVA 1KTQA 1WTBA 4N8NA 4LRDA 4HHUA 1WHXA 3BSOA 2ZKTA 1WC1A 3TUPA 4WE1B 1UL3A 3OLAA 2V8HA 3CGIA 5F3ZA 4PQUA 2DNYA 3AA9A 4DUYJ 4NXNJ 4LREA 3G9CA 4PWDA 3LO3A 4LJMA 4P2SA 4KPYA 1V3SA 3RAXA 4CO4A 2FHKA 2V4JB 3W2VA 3DLJA 4M5IA 3T5HA 3HSZA 1IQTA 4YFUA 2HKEA 5DDOC 3VTIA 2UZAA 2KXHA 3KNAA 1D9DA 4EZ9A 4OV1A 3OR1A 1HA1A 1JLEA 2C2ZB 1G3OA 5LT5A 2XY6A 3LQVA 2HRTA 1GEHA 4O4GB 1KS2A 1P1TA 5KFHA 1CC8A 3VAFA 2DR8A 4A8QA 3HSGA 4ZOSA 2XC9A 4R25A 4YB7A 2CAJA 4HLBA 4ZVRB 4C6AA 2F3JA 1HFEL 3UVJA 1AW0A 3PM9A 2YKNB 1LWCB 2BRKA 3PDNA 1EX8A 4BHQA 3MM9A 4OZ2A 3KLHA 2UUWA 3M7VA 1TKTA 2BZ2A 1YJRA 1KFDA 2VPXB 3KXDA 4NASA 3J81Y 2BQUA 3SQGB 1F6TA 2GHVC 4CLKA 2YKMA 3TZWA 2OFGX 4PYAA 1QUPA 2V2KA 4MKYA 1PILA 2I0XA 1FKPA 2OLWA 3FBEA 4F4ZA 1BC6A 2ZH3A 2EVZA 1TKDA 1NSQA 3BQ2A 5DM6Q 2G4BA 4IRDA 2CZ9A 3CB4A 1B0VA 5D4NA 4DOZA 4UUWA 4ZLPA 2F8EX 2L48A 3C6TA 3NGUA 4NLUA 3UO0A 4G1PA 2FC9A 3B78A 2QE5A 2WVCA 1P1LA 2QFJA 3QAEA 5C42A 2HYIB 2IJFA 1BQMA 4OI3A 3UR3C 5MLCV 1N88A 2G0IA 4UOHA 3VAJA 1DJ0A 1NNDA 2YNFB 1JLQA 3G4SS 2HQ3A 2GVDB 5J2QB 4WZQA 4DPXA 2ZWPA 5DJBA 1RBOB 1BQNB 2W9CA 2EFGA 4ECRA 4QIGA 3AOBA 4N8OA 1V6HA 1TAUA 1GMUA 2FDNA 4KC5A 4DPOA 2B9EA 3NNHA 1NAQA 1RWKB 2IVMA 4CLUA 3NGSA 3FEZA 1TL1B 4F2RA 5GAGU 2CQIA 3J81j 4LF5F 2GAGC 2IDEA 3UN5A 1DAXA 3V6KA 5D4OA 4TLRA 3H2LA 3MI7X 1Y5NB 1X4CA 1KONA 5G4DA 4OHVA 1TUWA 4ZLJA 4F4AA 1FNMA 4LFAF 1XQIA 3IBCB 5E2QA 1RWUA 3Q83A 4LBHA 3OXGA 3G8QA 5T14A 1RT1A 3ZZ0A 3TJAA 4KH0B 3BN4A 2VUGA 2A6MA 4DR7F 1FDNA 3KK1B 4O44B 4K4ZA 1WKKA 4ZMMA 4K5SA 4ECXA 1HWIA 4GKKF 2DPJA 3G6VA 3J7A1 1Q79A 4GKJF 4ED7A 4PG4A 1NU4A 1C1BA 3OV7A 3T9NA 4A46A 1TL7A 1S59A 5ITHA 4ZVGA 4J9KA 2F8HA 1IN0A 3T1HF 2I2YA 2VOPA 3FBCA 3PHEA 4MMOA 1VRQC 4V19J 3LPEA 4ZPBA 4OZ5A 5E3RA 4DFPA 2GMLA 1HNIA 3N6NA 3IG1A 1O0PA 2WVEA 4LF5J 5L39A 3S6EA 1FWKA 3A3PB 1JKHB 1M5KC 1T03A 3KHHA 5A6PA 1B0TA 2ZNZA 5CD4H 2KJVA 1RT3A 1DTQA 2PE8A 4K4UA 1HBOA 2JJ4D 1DURA 1MU2A 4K0KF 1KQKA 5DDRC 1YI2S 2J0SD 4DR7J 4OZ0A 2RT3A 3OL8A 3J7Z5 5L9NA 5KTQA 3MR7A 2C2NA 1S76D 4GKKJ 3LGHA 5KFDA 4GKJJ 1SJRA 4A8KA 3ET6A 1NB2A 3D0IE 2E9ZA 4RBTA 4F7VA 1UCNA 2LQ5A 2JWNA 1NSKL 2P8IA 2E7VA 4E8UA 3T1HJ 1JLCA 1F5BA 2OPQB 3LAMA 4KHPF 1FA0A 3GIRA 4CCHA 2BR0A 4U7UK 3OQ2A 4F4WA 2RVJA 2OUGA 3H59A 1ELOA 4UZCA 3M6XA 3DOMA 2VOOA 2CPYA 2JLEA 3HXMA 3R5CA 1KEKA 3EYZA 2IM2A 3H42A 5J2MB 3G6XA 1QLNA 4RNMA 4B02A 2C3OA 1S1TA 4NRTA 3CO9A 3M6UA 4F36A 2C3MA 2W4PA 1YBAA 4K0KJ 2KVIA 4RWXA 3J80Y 3JTOA 5HN0A 2E5GA 4AUKA 2MHEA 5KFZA 2YWKA 3BM7A 4B9SA 5HSPA 1NKBA 1KBRA 3C3LA 3FMBA 1YITS 2UUBF 5HL7Q 2GQQA 1PBAA 4J9NA 2P6TA 1H74A 3PO5A 6AT1B 1U24A 4DR6F 5DS7A 1HBNB 4DX8H 4LRFA 1C0UB 3SCKE 2RS8A 1I51B 3R9LA 5HJYA 4C11A 3OFGA 1KNZA 1NBEB 1FEEA 4K2XA 3D1HA 4PQUB 3DLLQ 2PMHA 3W60A 3OR2A 3Q86A 2DH7A 4PWDB 1ZYQA 4J7CA 4KHPJ 4KQZA 3RZAA 2V4RA 1R89A 1P9QC 4DCPB 4DR2F 2DHSA 2MB0B 2CQHA 1S6OA 3VVTA 3I87A 2XLKA 4DS5A 1IKWA 2VG5A 3W2VB 5CCLA 1R8HA 2IIHA 2R7XA 3ZC4A 5LJ3Y 3MOJB 3M9NB 1YDLA 2KJWA 3JYTA 3PJXA 4LRBA 3PIPQ 3PKMA 1REVA 4I69A 1QAXA 2C2EA 5L46A 2DBBA 2Y8YA 2EFVA 3H4BA 1JLEB 2YNGB 2OEKA 4JI7F 4WXWA 1H0HB 2POKA 2NPFA 2UUBJ 4QYRA 1RT5B 1FK9A 5A76A 4RNFA 3FZ2A 3CJ0A 1NJYA 2CJBA 2HFNA 3AB2B 4DR6J 4BLGA 2CJKA 3TZYA 4JI1F 1DQ9A 4X4OA 3GMGA 2RDJA 3QJJA 3NMRA 2DK2A 3KLHB 3NS5A 1ZPWX 1TKTB 4XO0A 5D0EA 2NZCA 3DOKB 3TUIC 1TV6B 2MLYA 2D41A 2B5JB 1PJ5A 2CZ4A 1X4AA 4DR2J 4AMMA 1KWMA 2HG4A 1RUSA 2G2ZA 2ATCB 1Q5VA 3H0PA 3EPIA 1P9YA 3PZPA 1VLOA 3JAMU 2BM0A 2KL8A 2Q43A 2DNKA 2NXEA 1N52B 4ZPVR 1SC4B 1D8ZA 2DEIA 4MKAA 1RSCA 4KGMA 1VISA 4WFZA 4DL3A 2Z4PA 2QLBB 4EEYA 2KH9A 2IYGA 3JB9k 4PQAA 4DQPA 4JI7J 4ALZA 3NP5A 1C4CA 2H65B 5ETVA 1NM2A 4U6PA 2DO0A 4RW7A 2QIFA 1WI8A 2MXYA 2M2BA 2V6AA 2OEMA 1XR5A 3RRHA 5C42B 5CZDA 3HHLC 1BQMB 4JI1J 1U0HB 2JLFA 4QR1A 5H1SV 1JX4A 1YRTA 3QJLA 2R2RA 1ZPVA 2W9CB 1HNXF 5IC6B 3R5JB 4DL7A 3PIOQ 4OMFG 2MQMA 4M1KA 3CJ3A 3FRZA 1YVFA 2AZ3A 3MEEA 3BBCA 4DPTA 3TAPA 1NLKL 2QLJB 2MPUA 1NHVA 4ZK7M 3PW4A 2XI3A 4WK1A 2H3EB 2XBPA 1U1OA 4DBQA 3DYAB 3ONQA 3EVWA 5IT4A 5AXMA 3DGPA 4MT1A 1YKWA 2UUTA 3MFIA 2V67A 1AZSB 4USKA 4ZIWA 3QJPA 1U6BA 3EWGA 4N77A 4I67A 4F8RA 4TY8A 2DYAA 3AFGA 1VC0A 1F9HA 2E1RA 1U7LA 3Q8VA 2AJ2A 5IS2A 1D9AA 2L3MA 1RT1B 3DRXA 2JEIA 2HHWA 5KFAA 1R8AA 2HNZA 3UD5A 4DF4A 1GH8A 5HQ8A 2ILZA 4PCQA 4B9NA 3HX9A 4DWIA 3O8WA 3A3NB 3CJTA 4NCAA 1HNXJ 3NY0A 4M5JA 1REGX 4F3OA 1C1BB 4OJ1A 2XLJA 4ES2A 5IXUA 1RTIA 5EUHA 1TL7B 4K4VA 1S6QB 3PYGA 3QIDA 4M5GA 1S0NA 1J5EF 5A8WA 5KFGA 2B51A 2Z2ZA 2BABA 4X2BA 1N5SA 3I9ZA 3OTOF 2KZZA 1SJQA 2HS0A 2LQ8A 3QBCA 2FLPA 2OI2A 2J7KA 3RB0A 3WC2A 2VPZB 1T9YA 3ULHA 4JI3F 5B08A 3H5YA 2D3UA 1T05A 3FFIB 1WI6A 4PG7A 3G96A 5CQGA 3I32A 2JLGA 1RT3B 4WK3A 4I1TA 1NJXA 4QWBA 1HBOB 3BGFA 1MU2B 4CLFA 2RQMA 3Q8YA 5K20B 5HANA 3DLGA 3IAM9 3KHLA 1H72C 1R8CA 2YWFA 4LRAA 1CVJA 3BYPA 5HQLA 2WBMA 1KLMB 2JHEA 2B6AA 4LIWA 1RYSA 1OIAA 3BGOP 2QSWA 3DI6B 2QA4G 1J5EJ 2R2UA 1S1WA 3IMQJ 4NPOA 5L1LA 1IBKF 2VKZG 2VB6A 1ZAXA 4YY3F 1MROA 4MK7A 2HMIA 2HRUA 4OYOA 3QRPA 1BHNA 4YR0A 5ETMA 3OTOJ 4C0BA 3S8SA 1WKLA 4P2MA 4LFBJ 4NWBA 1SJ3P 4F67A 3DOMB 1H38A 1WC0A 1B7FA 2XMMA 4PXDA 3NGKA 4JI3J 1RTDA 3DLEB 3EM1A 1GTEA 1NDPA 3KG0A 2AJ1A 1U1KA 3CC4S 2JEGA 4DN0A 1I3OB 2VZ9A 1S1TB 2FVQA 1APSA 2LXFA 5KG2A 3GIKA 4FBUA 1F2HA 3VALA 3X1LB 1N5QA 1B99A 1LK5A 4R8UA 5F8NA 2B4OA 1DQ8A 3KYLA 1W2IA 2ABYA 2O01C 4FVMA 2G13A 1S9GA 4C3LA 4HACB 5FDLA 3C8YA 1U25A 4NA1A 4FZVA 2AWZA 2EKNA 3KNGA 2QTWA 3PACA 2HQDA 4YHHF 4URQU 4Q8EA 1ZAWA 1M0SA 2H5IB 1QY7A 2R8IA 4C11B 4DV4F 2ILYA 5KFMA 1S5ZA 3B6BA 3P3DA 1IBKJ 3CDWA 3S01A 4DUZF 1D3WA 4YY3J 1KR4A 3Q8UA 2M9KA 4TLQA 1P8GA 4ETXA 1VQNS 4I56A 1LW2A 2KXFA 3BEGB 2R7OA 1S0MA 1R3NA 2D7SA 1NO8A 4DSKA 1QUVA 2VG5B 4DI6A 2HBQB 4WFNQ 4L3NA 4X84A 1S77D 4DR4F 1LWFA 4HT5A 1T7PA 4O23A 1GMVA 2ASDA 3UR0A 5KT7A 3R6GB 3PR4A 2VHGA 4IUFA 2J8AA 1FRIA 1UWBB 5A0YA 4F02A 1X4BA 2ERRA 3DGVA 4F04B 4H4OA 1JLGB 2W24A 2Q1LA 3FCHA 2FUG9 1UW9A 2HFOA 3HD2A 4C8KA 4Q7AA 4UTGA 1SQFA 4Y2AA 3QFWA 2DGTA 1FK9B 1IXKA 4U7CA 1G1XA 2HQCA 1WACA 2W9BA 3MAHA 4YHHJ 1RBAA 4DV4J 1SCJB 1BWVA 4DUZJ 2WW4A 1ZA2B 1Q0NA 2HGMA 3QIPB 1OMSA 3R97A 3N5FA 1VRTB 4OX8A 3VWSA 3P45B 1UZHA 3U02A 4ID5A 5CAAA 1CULB 3OFEA 3M2UA 2X1BA 5K8NA 3TJ9A 1XTZA 1WELA 3KLFA 5KFYA 4DR4J 2Y0BB 4Y0FA 2PIIA 2DGXA 3H8YA 4CYUA 3ELHA 5CD4A 1RAIB 4P74A 2V2VA 2WSFC 4CTAA 4WTYA 4LRCA 4N5SA 2NXNA 4DFMA 2F5GA 4B9MA 1TVRA 4CT8A 4LSLA 3H5XA 3NCQA 2BOAA 8AT1B 1S12A 1B4SA 4MTPA 3V6HA 2XMTA 4GVBA 2XMWA 4LIRA 3G86A 2VQFF 3K59A 5KT3A 2QLXA 5H9EK 2VQEJ 2JC0A 2DY9A 1TL3B 4LSNA 1QM9A 3OD2A 1RTZA 4FXWA 4NLYA 3WIUA 2VV5A 3MEEB 4YB1P 1RT6A 5K8PA 2N3OA 3GJQB 1JXLA 3I31A 2D3ZA 1UFKA 2PT0A 4ZVHA 4BC7A 4E0DA 5LSRA 3SFGA 3UDCA 3TQ1A 3J7ZT 2RNEA 1RAJA 2EEYA 5FIIA 1PYSB 2HHUA 3GQCA 4WP3A 5ETTA 3DGPB 1X4HA 2V63A 4ES1A 1NPRA 4Y6IA 4RR5A 4OI4A 3VGUA 1C0TB 4YUDA 4QWCA 1V5IB 3SCIE 4TY8B 3HI9A 3TR5A 1CJUA 2BKPA 2BW2A 4A8WA 1DZ5A 4C48A 4ED6A 4IG0A 3MXHP 2HHHF 1XWLA 2WBRA 2HHSA 2BM1A 1RHUB 4Z7CA 3TANA 2W2QP 4G3IA 3G6ES 1T0TV 3IXQA 3PFOA 1X31C 3K57A 5E41A 4EI2A 4CI0B 1RTIB 3DC2A 1N0VC 3DLHA 5E3QA 4ETZA 5A8WB 1X8DA 1F9EB 1S1UA 1UW4A 2CQ2A 2GIFA 4P9SA 3R5BA 2G1HA 1VDHA 2FJWA 3W64A 2J76E 2IC3B 1WC5A 3I6PA 2VBZA 3V4MA 4DJBA 4NLSA 3C16A 2PMZD 2WVBA 3OTEA 4KAIA 1I5OB 3OVAA 1T05B 2ZKUA 2XSJA 1LFWA 1RTHA 3UD3P 5BYQA 3GSDA 2HVDA 2SXLA 1G2EA 4M5KA 2CWXA 5FLXU 2FGOA 3DRYA 1URRA 5KFIA 4DHVA 2BKOA 2KU7A 2P9EA 2XYGB 2HHHJ 1S99A 3HD1A 2HNYB 2VDIA 1VFJA 1MMDA 2RH3A 2RDIA 4H4MA 2I5JA 5GAHI 4B9UA 1GT8A 1RTJA 4QIVA 4XPEA 5HROA 4LFCF 2QL7B 3M8PA 1YBTA 4TVAB 2DRBA 3SFUA 3G6YA 5H9EJ 3KMSA 4Q8FA
chains in the Genus database with same CATH topology
2VZ9A 3TZWA 3IM9A 3K89A 2JFKA 5DZ6A 3TQEA 2UV8G 2JFDA 3G87A 3SBMA 2G2OA 4RR5A 2QJ3A 3R97A 3IM8A 2QC3A 1MLAA 3PTWA 3TZZA 4RL1A 2PFFB 3R8YA 2G2YA 3TZYA 2C2NA 5CZCA 3CJ8A 5CZDA 2VKZG 2G1HA 3HHDA 5DZ7A 3RGIA 2CUYA 2QO3A 3HMJG 2HG4A 2VZ8A 3EZOA 3HJVA 2G2ZA 2H1YA 3H0PA 3BV8A 4QBUA 3QATA 1NM2A 3TZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZ9 A;  3TZW A;  3IM9 A;  3K89 A;  2JFK A;  5DZ6 A;  3TQE A;  2UV8 G;  2JFD A;  3G87 A;  3SBM A;  2G2O A;  4RR5 A;  2QJ3 A;  3R97 A;  3IM8 A;  2QC3 A;  1MLA A;  3PTW A;  3TZZ A;  4RL1 A;  2PFF B;  3R8Y A;  2G2Y A;  3TZY A;  2C2N A;  5CZC A;  3CJ8 A;  5CZD A;  2VKZ G;  2G1H A;  3HHD A;  5DZ7 A;  3RGI A;  2CUY A;  2QO3 A;  3HMJ G;  2HG4 A;  2VZ8 A;  3EZO A;  3HJV A;  2G2Z A;  2H1Y A;  3H0P A;  3BV8 A;  4QBU A;  3QAT A;  1NM2 A;  3TZX A; 
#chains in the Genus database with same CATH topology
 2FHJ D;  1RAO A;  2B4U A;  2PC6 A;  1AFJ A;  2DXF A;  3L09 A;  2RRB A;  1WD6 A;  1BD6 A;  4RPF A;  4EYI B;  4ENO A;  4F3Q A;  2AEM A;  2J7W A;  4QWD A;  3MUM P;  2ACM A;  3DDN A;  2AT1 B;  1WDT A;  1HL6 A;  2D3O R;  1W26 A;  5F8J A;  2KM8 C;  1RT2 A;  4CM2 A;  3IR7 B;  3CVK A;  1RTD B;  2QV6 A;  3PNI A;  2LEA A;  1SL0 A;  4BC9 A;  4QYZ K;  4CLT A;  3VAI A;  3GR1 A;  1VR6 A;  2KKH A;  4R8U B;  4I2Q B;  3L95 X;  1H2T Z;  5B0C A;  3E01 A;  1GX5 A;  1T8E A;  3ZZO A;  3AD7 C;  3RBZ A;  1S9G B;  4DDF A;  1EET A;  2V68 A;  2N3L A;  5FDL B;  2EBG A;  5KG4 A;  4USH A;  4LFC J;  1PC5 A;  3MPW A;  5MAO A;  3KJQ B;  2QGF B;  2FHJ A;  4ZCL A;  4NYP A;  2GNK A;  1ZM3 A;  2Z56 B;  1ZM9 A;  3UDL A;  3FK4 A;  2GVZ A;  2FHM A;  3MEC B;  2BVZ A;  4QIW D;  2CRL A;  3M8S A;  1VIX A;  2KXN B;  3HMJ G;  3OVB A;  2YVS A;  1S7I A;  4P2X A;  3CCL S;  4ZIT A;  2Z30 B;  2GA7 A;  4NLO A;  1LW2 B;  4C8Z A;  1FVS A;  4Y28 C;  4WFB Q;  2HVI A;  1IQZ A;  1KTV A;  5KFK A;  4FN5 A;  1LWF B;  4FYX B;  4ZPW R;  1BXN A;  1Q82 T;  4F2S A;  4WFY A;  2GIR A;  2NXU A;  2E5L F;  2J8S A;  5CAB A;  1QAJ A;  1RHJ B;  5HK4 A;  3PCO B;  1HNZ F;  4AMN A;  4H4O B;  1GXL A;  2J0Q D;  3MZI A;  3PJW A;  4UY8 5;  2LQ9 A;  2WON A;  3M6W A;  1Z2Z A;  2XUL A;  2RIJ A;  1CJK B;  3BKF A;  2Z2M A;  2DGU A;  3JTN A;  1RCX B;  2GIQ A;  3CMA S;  4KYZ A;  3RBD A;  2KI2 A;  1S97 A;  1S0V A;  2VG7 B;  1VK8 A;  2CYY A;  2KT3 A;  1FO1 A;  2ZVI A;  2QMU B;  1MWZ A;  3ADA C;  1OY6 A;  1YJU A;  1HHT P;  2X3D A;  3ZO7 A;  2FJE B;  2ROP A;  3MAA B;  1PAU B;  2KVQ E;  1IBC B;  2VH7 A;  3Q0A A;  2OD4 A;  3LAN A;  3QWU A;  4USM A;  2P9G A;  4ZCI A;  1OWX A;  1JLA A;  4DMZ A;  1UEV A;  2DY1 A;  5E5N A;  4MKV A;  4I6Y A;  4ID5 B;  3LAL A;  3JQM A;  3M2U B;  3VAK A;  1CS4 A;  2J6U A;  1V3Z A;  2W8K A;  1SH2 A;  2JEF A;  3GFX A;  1L3T A;  1U1N A;  2L9W A;  5RUB A;  2RU9 A;  4DXL A;  3MMA A;  1SBR A;  1QVF R;  2HRY A;  1YHQ S;  4ILR A;  2E5L J;  3BSA A;  4QYZ J;  5E3A A;  4DL4 A;  2NYI A;  4R0E A;  1HNZ J;  4OI2 A;  4CYU B;  3JSY A;  4CTA B;  5J1P A;  1TFW A;  4ZN1 A;  4IFY A;  4A8Y A;  2CPF A;  4ZA1 A;  2HFU A;  1RAA B;  4HTI A;  4L73 A;  1TVR B;  1X4E A;  4UOG A;  2WZ1 A;  3CTR A;  3CCM S;  1C2P A;  3M8W A;  2BJ3 A;  2YY3 A;  1S1X A;  3JTP A;  5D4P A;  3D6H B;  1QD1 A;  1RA6 A;  3V4I A;  5HMX A;  1FER A;  1C4A A;  2WOM A;  3PXG a;  2IM0 A;  4WP9 A;  3SXL A;  4HYK A;  3QQC D;  4OJ3 A;  3OW2 R;  2RQK A;  2RHS B;  4LSN B;  3P4U B;  5AXL A;  1XR6 A;  4GO5 X;  4OZN A;  2XY7 A;  2V9W A;  1RT6 B;  2G0C A;  2K06 A;  5ETO A;  2A3J A;  3AOC A;  5KG1 A;  4IR9 A;  1MG7 A;  3HVA A;  1UFL A;  3PYF A;  1VBK A;  2OPP B;  3W5X A;  5CZC A;  2NUH A;  2GX8 A;  2WCX A;  2HFS A;  2BQ3 A;  2AJ0 A;  1Y3K A;  2NQP A;  2K1R A;  1WHW A;  1A9N B;  2F1F A;  2KHC A;  1A6L A;  1RXO B;  1NKC A;  4ECW A;  1UPP A;  1CJU B;  1OSD A;  1M90 T;  3LWL A;  3OL7 A;  3W7B A;  3O5T B;  2MDA A;  2EFO A;  2OO4 A;  1U8S A;  4FDF A;  4LF1 A;  3CJ4 A;  1G4C A;  2FLL A;  4I7F B;  3ZZZ A;  2FVC A;  3G71 S;  1N6Q A;  3IFE A;  3ZZT A;  1RYR A;  1SL1 A;  1KFS A;  2ZEJ A;  4LMZ A;  2YQ3 A;  2W9A A;  3ENA A;  5LJ5 Y;  5A8K A;  5D78 A;  2XMK A;  2LU2 A;  4N47 A;  1RLD A;  2UXD F;  4P10 A;  4JYA F;  2VON A;  1LV5 A;  2M7S A;  2VG6 A;  2LKZ A;  3MM7 A;  1G7C B;  1FF2 A;  5KAK A;  5DGA A;  3HHN B;  4X4P A;  2KG0 A;  3N01 A;  4F25 A;  1AUD A;  2HHX A;  2HIY A;  5DG8 A;  4WU2 A;  2M52 A;  2OTL S;  4WKY A;  4ED8 A;  4KFB A;  1WNE A;  3OLB A;  1NME B;  3EZO A;  2Q6B A;  1TMJ A;  5GAH U;  2CJX B;  5KFV A;  3NGT A;  2F7V A;  1VJQ A;  4B9L A;  3RB4 A;  3SDE A;  3QNW B;  5AE1 A;  5J1E A;  3DLK B;  3AHP A;  3V6J A;  1F60 B;  2VC1 A;  1ARO P;  2W2O P;  4CLL A;  3UD4 P;  5C24 A;  2PA3 A;  2OEL A;  2F40 A;  2I5J B;  2E29 A;  2K2P A;  3QWP A;  5CXT A;  1RTJ B;  4HDH A;  4Q5V A;  3M8P B;  4IH6 A;  4OX9 F;  1YLX A;  1TFY A;  3AA8 A;  3DRR A;  4JYA J;  4NA2 A;  4ZPC A;  3AB4 B;  2XNR A;  1RBL A;  3BKT A;  4G1Q B;  1XMQ F;  2EFQ A;  4O3Q A;  4LF9 F;  5KFP A;  4OHZ A;  4M5D A;  1VQ6 S;  1XEZ A;  5DQG A;  1NJI T;  3IRX A;  1WG4 A;  2H4W B;  3EXC X;  5IM0 A;  1LXN A;  3KLG A;  2NXJ A;  3KHG A;  2Y1J A;  4GVL A;  4F0H A;  3R7S B;  1UPM B;  1Q4R A;  3K5M A;  4B9V A;  2C42 A;  2UP1 A;  2UV8 A;  3H20 A;  2NS1 B;  2R4F A;  1IBL F;  5IT0 A;  4B3M F;  3NKY A;  4TU8 A;  4YB5 A;  2QRR A;  3OTB A;  2QYC A;  4DV1 F;  4PXC A;  3N6M A;  4MFB A;  1EET B;  3BH6 B;  4HI2 A;  3E2E A;  3NG8 A;  1UVJ A;  1RAF B;  4C0O C;  4CRJ A;  1M5P C;  3DNC A;  3RBX A;  4K2J A;  4OX9 J;  3F73 A;  5EX0 A;  4X4V A;  5KFB A;  1Y10 A;  1YG0 A;  5HLF A;  1YJN S;  1LWE A;  1WTF A;  2IVF B;  3TA2 A;  4OI0 A;  1RDR A;  1SXL A;  1XMQ J;  1HNW F;  4LF9 J;  1Y7P A;  1XMB A;  5I4M A;  1YTY A;  1FRL A;  3TUJ C;  1N8R T;  3U1L A;  5CH7 B;  1U49 A;  4ZIV A;  4J37 A;  2FLO A;  1OS5 A;  4JV5 J;  1ROF A;  2YWH A;  3C19 A;  4Y2K A;  3BV8 A;  4PZV A;  1IBL J;  4B3M J;  3BYR A;  2XCP A;  3P6Y C;  4ZVQ B;  2MZ1 A;  2RKI A;  4P71 A;  3IWX A;  5J1N A;  1HNV A;  2VFU A;  1HYS A;  3BJY A;  1RT7 A;  2PD1 A;  5EHH A;  3OHB A;  4JI2 F;  3W9J A;  1M5S A;  4J5O A;  4DV1 J;  4DR3 F;  3CD6 S;  2Y3Y A;  2WON B;  4IYQ A;  4OYM A;  1YJW S;  2C3U A;  1X0P A;  3W2W A;  3QZ7 A;  2QA4 S;  4JBC A;  3HZE A;  1VQ8 S;  1K9M T;  3NOC A;  2V9K A;  1R7I A;  4FF2 A;  2ROE A;  3NS6 A;  1HIY A;  2EI5 A;  2XS2 A;  3VQS A;  3A8K A;  3ZNU A;  4JV2 A;  1HNW J;  5J2P A;  1J27 A;  2F4V F;  4A8M P;  3CD0 A;  3ISN D;  4HL9 A;  2AGQ A;  3H2U B;  3KLE A;  2DT9 A;  1NJZ A;  3FMW A;  3BR9 A;  5B09 A;  2ZBC A;  1CS4 B;  3DCA A;  1K1S A;  2HWI A;  4LR7 A;  1D1U A;  4ECY A;  5E3P A;  1FDD A;  2YNI A;  3NGR A;  2R3V A;  4HDG A;  2ZJP Q;  2JX2 A;  2VZ8 A;  3MMA B;  5J2N A;  4YME A;  3CJS A;  4CDI A;  4I64 A;  2YX4 A;  1SPB P;  2MY7 A;  1S6P A;  3FSI A;  3K5L A;  4JI2 J;  4M5N A;  3MTK A;  4CO3 A;  5F8G A;  2J6S A;  3MCM A;  3BN7 A;  3TZZ A;  3DFE A;  4TQS A;  4KV8 A;  4KHM A;  3PRV A;  2M0G B;  4NZ6 A;  3JSR A;  3MED A;  3BDP A;  2YKO A;  4CH0 S;  4RO0 A;  3MPV A;  3PTW A;  5FJ4 A;  2VJU A;  2BJ7 A;  5B7W A;  4ZVO B;  3THV A;  2MMY A;  3RW6 A;  2A2C A;  2WOM B;  2F4V J;  1UWA A;  3PW2 A;  3R1L A;  4OZ1 A;  1ULR A;  3E3X A;  2GV1 A;  4QCL A;  4K4X A;  1SC3 B;  4PWU A;  4BWJ A;  2W2M P;  5HMZ A;  4AXI A;  1U26 A;  4NLW A;  2HSE B;  4TNO A;  4NZ0 A;  2KRB A;  2AX0 A;  2ROG A;  1VMB A;  3IO1 A;  2HQI A;  4Y2I A;  5I3Q A;  1IKV B;  3ETO A;  4OYI A;  1SJ1 A;  1RT4 A;  1N5Y A;  5DGB A;  2IFX A;  1GXU A;  2OPR A;  1T9V A;  4RW9 A;  2JFK A;  2E1C A;  5CYM A;  2K1R B;  1ZTW A;  3GV5 B;  2UUA F;  1URN A;  4U9R A;  4A48 A;  2X1G A;  3TAM B;  3ZZP A;  1DRZ A;  4HH0 A;  1UVM A;  2Y8W A;  2BJ8 A;  3L7P A;  5F8L A;  3KHR A;  2ZE2 A;  1M1K T;  2M5Y A;  3IA0 A;  1R0A A;  1VS3 A;  2MQP A;  4ES3 A;  3GFY A;  4ZVT B;  4TN2 A;  2DR9 A;  1N6Q B;  3IGN A;  3ITH A;  4UZB A;  2U2F A;  2ZBQ A;  2JRS A;  4AMP A;  4I6A A;  3LH2 S;  2AYM A;  1I94 F;  4DPY A;  5KFE A;  3D4J A;  4DR1 F;  2IA6 A;  3HDS A;  7AT1 B;  3KJV B;  3J81 U;  3TOQ A;  2BUN A;  3KK3 A;  4C8N A;  2VG6 B;  4NI2 B;  3MM7 B;  4R0J A;  2I6W A;  4HHJ A;  1X5S A;  4K5R A;  2GFF A;  1SB6 A;  3BGU A;  1ZTT A;  2MQQ A;  4DL6 A;  1BQX A;  2J9E A;  3US5 A;  4O4R A;  4WXO A;  3SCL E;  3FQL A;  3M30 A;  2FY1 A;  2IAJ A;  2CDR B;  2ZC3 A;  3LP1 B;  4HR2 A;  2GO9 A;  1VK3 A;  4ILL A;  1IKY A;  1R8B A;  3MMC B;  3K5O A;  3WX4 A;  4P52 A;  1AXQ A;  1NEE A;  3ETM A;  4DZ6 A;  1RIS A;  2AEF A;  5HAO A;  3LGM A;  3GR0 A;  1NUE A;  3K5P A;  2KG1 A;  2Y0S D;  1AYE A;  1TUG B;  4EK2 A;  5J1E B;  3X3U A;  4TQR A;  1JB0 C;  3W63 A;  2ZNY A;  2VPW B;  3TVZ A;  3DLB A;  1DQA A;  1I94 J;  4QIF A;  2AU0 A;  3VAM A;  5LXY A;  3MOZ A;  1UTA A;  4MKB A;  3PX0 A;  4HHH A;  2DNN A;  3DRR B;  1UAW A;  3MWB A;  2KDO A;  2VIH A;  3PW0 A;  2N82 B;  4KKO A;  1F1B B;  4WYW A;  5DRK A;  1EKR A;  2A6O A;  3HSD A;  1OY9 A;  2KYZ A;  2DNZ A;  2HWT A;  2Q3P A;  1FRH A;  4DS4 A;  2JZ5 A;  4KR0 B;  4U95 A;  4M5D B;  1VQO S;  3DDI A;  3N5B A;  1T9U A;  1GK8 A;  3B8H A;  4K7Q A;  3HLU A;  3IRX B;  3VAH A;  1NK8 A;  4HI1 A;  3I5A A;  4O3R A;  1FWP A;  2R8H A;  1NSA A;  5DO2 A;  1EJ7 L;  5M2P A;  1KVK A;  4ZVF A;  3Q8R B;  2NXC A;  1WC6 A;  3OFF A;  5T41 A;  3IM9 A;  4RUB A;  2ATL A;  1FJ7 A;  2IPO B;  3AAW B;  5F9L A;  2YQ1 A;  3LAK A;  2XHW A;  3AOA A;  1OYE A;  2LCW A;  2HZC A;  5G0R B;  4W90 B;  2WSC C;  3FGV A;  2H5E A;  4IH5 A;  4MFB B;  4OZJ A;  3FEX B;  4QR2 A;  2CG8 A;  2BW7 A;  1XJW B;  2ZD1 A;  2AV5 A;  3HKW A;  1XN9 A;  2XY5 A;  4C98 A;  4C2M A;  3GYX B;  3PX6 A;  5HLF B;  1E6V B;  3GG0 A;  4OLO A;  4AE5 A;  5K8O A;  4USV A;  1MN9 A;  3CSK A;  1F2G A;  2QYG A;  3LWM A;  2CPZ A;  4DV5 F;  4FXV A;  2GCF A;  7FD1 A;  2XCA A;  2Z2Y B;  1X5O A;  3F56 A;  5LMN F;  2RML A;  1X4G A;  2R8J A;  2M8D B;  3L3C A;  1QTN B;  2LMI A;  1RLC L;  3TJ8 A;  1HBM B;  3CC7 S;  3UWT A;  1N56 A;  2L9D A;  3CO0 P;  3QAU A;  2E5I A;  2LXU A;  3D0H E;  2ZVS A;  4A8O A;  2ADC A;  1HWU A;  1H2V Z;  4ED0 A;  1W7W A;  3S7R A;  4E98 A;  1Y4Z B;  2RKI B;  1FKO A;  1HNV B;  1CC7 A;  1RT7 B;  3AT1 B;  4URS A;  1NZA A;  3C14 A;  4OYB A;  3VGT A;  1FHT A;  2FHO B;  3I96 A;  5B0B A;  3KDO A;  5K14 B;  1N33 J;  2CQP A;  2R2S A;  3ZZY A;  1F5A A;  5ETK A;  3KTQ A;  4KTQ A;  3MGJ A;  1JLF A;  3SSQ A;  1WJ9 A;  2QZ8 A;  2FVS A;  4A8X A;  3DU5 A;  2F4F A;  3NL0 A;  5K8M A;  1WSV A;  5L8R C;  3EUN A;  2G2O A;  4PPD A;  5J2P B;  4DQI A;  4OJH A;  3BO3 A;  4KPC A;  4ZVE A;  2DIU A;  4DV5 J;  3C6U A;  3T6J A;  3FRY A;  2GO8 A;  4NX9 A;  2RDD A;  3KLE B;  2WSE C;  3EVO A;  1VQ5 S;  4PKD B;  5LMN J;  3H5U A;  4I4B A;  5JXS A;  2A0F B;  2L41 A;  3M8Q A;  3DKD A;  3OT9 A;  3NOG A;  3LPY A;  2V4Q A;  2PDA A;  2MLZ A;  2YNI B;  2NLW A;  1P6T A;  4JI0 F;  2NUU G;  1KSP A;  4OZ3 A;  4DN9 A;  1OO0 B;  5J2N B;  4IOC Q;  3G87 A;  3J80 U;  4K50 A;  2HS3 A;  3TX8 A;  3RB3 A;  2BKN A;  3IS9 B;  1S6P B;  2ALZ A;  1SV5 A;  4WYL A;  1FX2 A;  5A6W A;  4CLY A;  1IR2 A;  3D6T B;  4HT7 A;  1QAI A;  3EDQ B;  4MYU A;  1PGZ A;  4NXM F;  2GMJ A;  1JNZ B;  3FQK A;  3H5S A;  2QL9 B;  2FJB B;  1NSP A;  3R2C J;  3T5J A;  1Y5L B;  3MED B;  1TKX A;  2W7P A;  2W8L A;  4LUB A;  3PVX A;  1OY8 A;  1RAH B;  4WCE Q;  1EP4 A;  1IWA A;  1HI0 P;  2GS8 A;  3CJR A;  4QBU A;  2CQD A;  4B3S F;  3MEG A;  4IRK A;  4XIU A;  4BWM A;  2QLF B;  2PMW A;  3SCJ E;  1RAB B;  1WHY A;  3PW5 A;  1HQE A;  3TRG A;  4MYT A;  4Y34 A;  1CJT B;  2PN6 A;  3BRE A;  3FSY A;  3DRS B;  2O67 A;  2XWX A;  4Y2M A;  2HW3 A;  4JI0 J;  1L3K A;  2B43 A;  1ZZN A;  1FVQ A;  3VVU A;  2BX6 A;  2AX1 A;  1GNK A;  4H4K C;  3EE3 A;  4IH7 A;  3W66 A;  1JLB B;  2M8H A;  3CF5 Q;  1N5Y B;  4FYY B;  2Y1L B;  3PRB A;  4NA3 A;  4K59 A;  2OPR B;  1OYD A;  2XNQ A;  2EKY A;  3ILJ A;  4JI8 F;  4RW9 B;  3UCG A;  1TL5 A;  2ZOG A;  2FJV A;  4ECU A;  1S4F A;  4IDK A;  4DX6 A;  1NKE A;  4NXM J;  1FD2 A;  2I38 A;  2ZE2 B;  4L3K A;  1R0A B;  2DIV A;  2AJ4 A;  4OHX A;  5IT9 Y;  3AD9 C;  5DDP C;  5L38 A;  3O2I A;  3ITH B;  4QWE A;  4X65 F;  4PG6 A;  1U02 A;  3OL6 A;  2LXI A;  2YWW A;  1FJC A;  4RUH A;  4NCG A;  2A1B A;  1WEZ A;  4FNI A;  4ELU A;  1RAC B;  1KP6 A;  4DX7 A;  3RB6 A;  3KK3 B;  4B3S J;  4QW9 A;  2FQQ B;  2RAQ A;  2V2Z A;  1YRU A;  3VZI A;  3TAQ A;  1WC3 A;  5DQI A;  1Y9O A;  3RBE A;  3LW5 C;  2DXE A;  1WG5 A;  3M05 A;  2YX7 A;  4C7Q A;  2R7R A;  4B17 A;  4NLD A;  3JSM A;  2NRE A;  4E2F B;  2XMU A;  1E6Y A;  1PYT A;  3M30 B;  3TA1 A;  4PUO B;  2IAJ B;  2UVW A;  4XDC A;  2AIR B;  4JI8 J;  1DLO A;  1YRX A;  1Q8L A;  3WIV A;  1FFW B;  2RU3 A;  3CUL A;  2GHP A;  4CIO A;  4YP3 A;  3NLC A;  1TAQ A;  5T7L A;  2IY5 B;  2DHH A;  3KK2 A;  2HHT A;  1K8A T;  2QG9 B;  4AMO A;  3R6L B;  5M2R A;  1U6F A;  1NDC A;  4QW8 A;  2MZR A;  1N34 F;  4X65 J;  4DX5 A;  3E51 A;  1NHK L;  3MCS A;  4WF9 Q;  3HFK A;  4DV6 F;  2VAS A;  3V81 B;  4OYP A;  4DSJ A;  2RS2 A;  2A18 A;  5L9X A;  1SI9 A;  2YH0 A;  4NOH A;  2MZT A;  2L08 A;  4KKO B;  2H54 B;  2HVZ A;  2PA8 D;  4QPX A;  4WE1 A;  5LXR A;  2ZOF A;  3KDN A;  1RK8 A;  1RA7 A;  3L9Z A;  3CCZ A;  3QFH A;  1L3S A;  4ZHR B;  2B56 A;  2MZQ A;  4RKU C;  2E7W A;  2KN4 A;  2X51 A;  3MM6 A;  2PFD A;  3IR5 B;  1NK7 A;  3I55 S;  5KT5 A;  3I82 A;  2OAU A;  4C9D A;  3AH6 A;  2ZH1 A;  1WHV A;  3HKZ D;  3VR1 A;  4P72 A;  1NZ8 A;  1X5P A;  2XWY A;  1NK4 A;  3CXC R;  4M94 A;  3Q23 A;  1S49 A;  1RWO B;  1AA1 B;  4DQS A;  2JFD A;  3MPU B;  5I3U A;  4F0M A;  1QE1 A;  4RNH A;  5I3P A;  1Q5Y A;  4J9M A;  4ED1 A;  1U47 A;  1N34 J;  3SEO A;  5D3G A;  1J2V A;  2D74 B;  3EGW B;  1IM4 A;  2ZH6 A;  3PKY A;  4DV6 J;  4HEA 9;  4USJ C;  3NCR A;  2I1R A;  5L1K A;  2FVP A;  1MWQ A;  2ZH9 A;  3ZXW A;  2CPE A;  1NH7 A;  3OR1 B;  3W65 A;  2ASY A;  1LWC A;  3T6B A;  3BBF A;  3BSC A;  2DNR A;  2H5J B;  4K4W A;  5B0F A;  2XO7 A;  2FZK B;  1KKH A;  1DTT A;  2IRX A;  1SL2 A;  3HUL A;  2C28 A;  4ZKA A;  4QU6 A;  1MNE A;  4CNY A;  2HND A;  4TYB A;  2D9P A;  1LFP A;  2FY8 A;  2XSF A;  2KHD A;  2OSQ A;  3UVJ B;  1SH0 A;  5E7O B;  3IC1 A;  2ALY B;  1YBU A;  4ITS A;  3KWM A;  5THW A;  1QSY A;  4FYV B;  1L3U A;  4W92 B;  3DM2 A;  1WDD A;  3MM9 B;  2MKC A;  3HHL D;  2E9R X;  2ZH7 A;  1WOS A;  4WJB A;  4XAK A;  4BDP A;  3OXF A;  1J5O A;  1FKO B;  3I4P A;  5EWE A;  1HQ2 A;  4O0I A;  2F9J A;  1QSL A;  2XEX A;  2DD8 S;  3IGV A;  3R7N B;  3C14 B;  1WF1 A;  2Q79 A;  3CNQ P;  1VBZ A;  2YKM B;  2YQ0 A;  3IP0 A;  4K4T A;  2CQ0 A;  5A2Q Y;  2HFZ A;  4MIA A;  2IVY A;  2EBE A;  2HIQ A;  2W2N P;  3MHY A;  4ECQ A;  1FKP B;  3PRD A;  2VBY A;  1T9T A;  1EAY C;  2M70 A;  1JLF B;  3CDA A;  1XER A;  3IWN C;  3EDR B;  2EPI A;  4QR0 A;  2B9W A;  4I68 A;  5J2Q A;  1K73 T;  4RNN A;  1XIQ A;  3FDS A;  1PYO B;  2ASJ A;  3C6T B;  2QO3 A;  1LOU A;  1HWK A;  3CCQ S;  3A8J A;  1CSJ A;  5K9F A;  2K3K A;  3H4D A;  1VRU A;  1WOP A;  3M8Q B;  3HHL A;  1TL1 A;  1UJ6 A;  1JLQ B;  1GMW D;  2G0J A;  3NGD A;  1X5T A;  2U1A A;  2XZT B;  2DJW A;  5C25 A;  4N41 A;  1N5V A;  2HK2 A;  3GP9 A;  4TXS A;  4NLQ A;  1S0O A;  1YSJ A;  5GMD A;  5LOQ A;  4DQQ A;  4LBI A;  1UET A;  1BLU A;  3O6Q A;  1DHM A;  1KQS R;  4MAK A;  3ZZR A;  3CCW A;  2F63 A;  2IDL A;  2QC3 A;  5GAE I;  3D66 A;  4EZ6 A;  3UN2 A;  1TKX B;  2LEB A;  5EWG A;  1VQ7 S;  3PO4 A;  2F65 A;  4PWW A;  1YWX A;  5KFL A;  1FXL A;  2CZV C;  3MMJ A;  4NLG A;  4PAA A;  4L72 B;  1U1Q A;  3CD7 A;  1S1V A;  4QOT A;  3K0J A;  3WC0 A;  2MQ8 A;  2RIL A;  2J9D E;  5H9F K;  1EP4 B;  3MEG B;  1RU1 A;  2FYX A;  2G9O A;  2VBW A;  5DQH A;  3PG9 A;  2KT2 A;  2ZJR Q;  1GMW A;  3GYN A;  4W4M A;  4Q45 A;  4ZVU B;  1HQE B;  4F4X A;  3MD1 A;  3WX8 A;  3SSR A;  1ZS6 A;  3P8B B;  1X9S A;  2BV3 A;  2EW9 A;  5B0A A;  1TK0 A;  2KFZ A;  5HO4 A;  4Z37 A;  4J9U E;  4ECS A;  3QZ8 A;  1DAR A;  2XTJ P;  1YK9 A;  3IRW P;  1YJ9 S;  3CDE A;  1RAG B;  1Q1K A;  4K4S A;  1Q16 B;  1JKH A;  4RW4 A;  3N0V A;  5D6G A;  1X7V A;  4Q2L A;  5KG0 A;  3CCS S;  4F3M A;  2XYP B;  1X4F A;  2UVV A;  2FLN A;  4IDK B;  3D9B A;  3GTY X;  3GJS B;  1B7Y B;  2ZUA A;  1HNI B;  4JI6 F;  1OPZ A;  3UPF A;  3IG1 B;  2EXU A;  2CNK B;  3MAQ A;  4LFB F;  2E5H A;  5F8M A;  3BR8 A;  2Z2L A;  2PFF B;  1T03 B;  1TQL A;  3FSX A;  3UNG C;  2Y9H A;  3P49 B;  3DRP A;  3D28 A;  2DNQ A;  2VOD A;  1DTQ B;  2K7J A;  3K17 A;  3LOU A;  2CVI A;  1K47 A;  4CO0 A;  3KOA A;  1HHQ A;  2BAC A;  3TEH B;  2L9N A;  3VV2 B;  1JNR B;  1Q53 A;  2OPQ A;  2WHO A;  3JSM B;  2BJD A;  2XMA A;  3NMA A;  1E6Y B;  2MST A;  1VBY A;  3HVT A;  1ZM2 A;  1HI1 A;  2V5H G;  1PIE A;  3ET6 B;  2VDH A;  3VZH A;  5LSL A;  2EK6 A;  3QGI A;  4U8Y A;  5D77 A;  4Q43 A;  1EZZ B;  3C66 A;  2FTR A;  1HW9 A;  2JC1 A;  1DLO B;  3IBW A;  3V2U C;  3AJ1 A;  1BY9 A;  1JLC B;  3MCO A;  3D68 A;  5IFM A;  2C1E B;  5T7L B;  4YS2 A;  1UFW A;  4I0W A;  3KK2 B;  1P27 B;  2VFS A;  5KOW A;  4JI6 J;  5KT4 A;  3PJ9 A;  4C97 A;  1FDB A;  1LQ9 A;  5CA5 A;  3BPD A;  2XMV A;  4EGL A;  1QSS A;  5D0H A;  3THT A;  1KQG B;  2VFT A;  4G1I A;  2DO4 A;  1HBN A;  1C0U A;  5H9F J;  5B0E A;  1Q8B A;  4HKQ A;  3UE2 A;  3BF4 A;  3VF0 B;  3GIJ A;  3NBP A;  4NLT A;  3U27 A;  4WZM A;  1ZZF A;  4KO0 A;  3MM6 B;  3D67 A;  2HQG A;  2GW8 A;  1RAD B;  3N6L A;  3SV3 A;  4AYB D;  1Q8I A;  1RKI A;  2DIT A;  3CD5 A;  1FJE B;  2D9O A;  5EX3 A;  3OR2 B;  4USU A;  2CNN B;  4C0H A;  3QGG A;  3G82 A;  3TI0 A;  3WDO A;  3U7J A;  4J9Q A;  3ZTS A;  5I3U B;  1QE1 B;  3EMT A;  2O5D A;  4H54 A;  2YNG A;  2B9X A;  1W25 A;  5D3G B;  5E0O A;  2DH9 A;  1IKW B;  4JUZ A;  2BQR A;  4IR1 A;  5KFN A;  1RT5 A;  4CZC A;  5DG7 A;  2WK4 A;  2QA2 A;  2KT5 A;  4B3R F;  4U7U D;  3JYT B;  1REV B;  2JOQ A;  2ZHO A;  2B4P A;  3W3S A;  2AP6 A;  1SKS A;  1GTH A;  4JP8 A;  4P7V A;  1FNO A;  2BBE A;  2XLI A;  3IWL A;  1DTT B;  4M63 A;  3HJF A;  1NK6 A;  3DOK A;  1TV6 A;  3R7B B;  2HND B;  1SVD A;  3OSP A;  3ISZ A;  1WUU A;  2B5J A;  2XM3 A;  3CJQ A;  1KHV A;  2V50 A;  2MZS A;  1U0S A;  2CJY B;  1JJ4 A;  2VFV A;  3QMQ A;  1QVG R;  1TMM A;  5BXI A;  2CJQ A;  4YEA A;  1HKA A;  3DM2 B;  3SMZ A;  1IR1 A;  1KVI A;  3RRG A;  5HJX A;  2VQE F;  1J5O B;  2YXL A;  1Q78 A;  3ILO A;  2DPI A;  2MLX A;  2O3D A;  3K7R A;  3GON A;  4N7T A;  2HBR B;  4MH8 A;  2I8E A;  3BH7 B;  2LQB A;  3Q8P B;  5FD1 A;  4NLV A;  3OTD A;  2QLW A;  3Q89 A;  2M3D A;  4QZV B;  2E44 A;  4KBI A;  4B3R J;  3AXM A;  4LF7 F;  4PG5 A;  1FX4 A;  3KUE A;  2GAH C;  3PYE A;  5HQM A;  1RI7 A;  4MK9 A;  2KFY A;  3OJU A;  1U0H A;  3EJM A;  4FF4 A;  2DHA A;  4J9O A;  2BJE A;  4AXJ A;  2HQF A;  4FKY A;  3BGL A;  4RU2 A;  2HK3 A;  8ATC B;  2LFV A;  1RWW B;  1HW8 A;  3E8O A;  2V8V A;  3QO9 A;  4AND A;  2XGP A;  4ZPA A;  5D0G A;  3M6V A;  2DRD A;  4RW7 B;  1OQ6 A;  1VRU B;  3HHL B;  5GAE U;  4RZR A;  2AGO A;  4FNH A;  5C25 B;  3GFZ A;  4ED2 A;  3DYA A;  2DGO A;  4EMD A;  3DU6 A;  1Y5I B;  2J6T A;  3K8W A;  3QRR A;  3BQ1 A;  2DGQ A;  3SBM A;  4IQM A;  3EGV A;  4GO7 X;  1T02 A;  2F9D A;  1AZS A;  1MMN A;  3H90 A;  2N4C A;  2H48 B;  2YNH A;  4NLP A;  2WVF A;  4ELV A;  2GJF A;  2WRM A;  2DHX A;  3PYD A;  3T1A A;  2B7C B;  4LF7 J;  4CNZ A;  3HHK A;  3CC2 S;  5BJR A;  1CBK A;  1KHW A;  1FXD A;  3UCZ P;  5AE3 A;  2BRL A;  2VF3 A;  2YH1 A;  1T9X A;  2X7I A;  4GC6 A;  2E7X A;  2LP4 A;  4RL1 A;  3ZTR A;  1S1V B;  2C2R A;  1S57 A;  4F4Y A;  1WC4 A;  2ZOM A;  4OQJ A;  1F5C A;  5ETQ A;  2J0X A;  4BBY A;  3M1V A;  1OJ4 A;  3EX7 B;  1S6Q A;  1YX2 A;  4ZJQ A;  2OFH X;  1S6U A;  2CPX A;  4IOB A;  1VQ9 S;  2HNZ B;  1QAY A;  4TY9 A;  3HO1 A;  2YKP A;  4RLE A;  3D7S B;  4CM0 A;  4LVN P;  3PY8 A;  2R7S A;  4EYH B;  1H6K X;  4DLG A;  2DXD A;  2MKK A;  1U2C A;  1BMQ B;  3JS9 A;  3SYZ A;  3GYG A;  2AGP A;  4RW4 B;  3KLV A;  1X4D A;  2E1P A;  3FFI A;  2IMO A;  4LFA J;  3K5N A;  1S79 A;  4EWT A;  1H2U X;  1VI7 A;  3R5A A;  2F8M A;  1Q86 T;  1FRX A;  3MR5 A;  4J9P A;  4FPR A;  2IHR 1;  2XHC A;  2COL A;  4UW2 A;  4LR8 A;  3MEK A;  1S7H A;  3AJD A;  4OHW A;  1SIW B;  1RHK B;  3GJR B;  5AXN A;  1EHW A;  1KLM A;  3DRP B;  5DLF A;  2Z0G A;  5KFC A;  4MIW A;  3D3B J;  1VQM S;  4OYW A;  1SJ4 P;  2LDI A;  2ZH2 A;  4WP8 A;  2CPD A;  5JMN A;  1RJJ A;  3DI6 A;  4PRF A;  3OSN A;  1RHQ B;  3DLG B;  1FE4 A;  3VGV A;  1IR0 A;  1CPZ A;  3RR7 A;  3R3T A;  1X9M A;  4UF4 A;  1GX6 A;  3PEH A;  4KSE B;  2IYI A;  1JJC B;  5KOX A;  1ZAV A;  3RUB L;  3HVT B;  3SI8 A;  3AOD A;  4WFA Q;  2B6A B;  2RQ4 A;  3QT7 A;  1FWL A;  3HP6 A;  4RX6 A;  1NPK A;  2C2O B;  2XMJ A;  3DLE A;  1FES A;  1X60 A;  1S1W B;  2YWE A;  3K8V A;  4WBF A;  2JVR A;  1CQM A;  1MRO B;  2PI4 A;  2RJZ A;  3FNN A;  2HMI B;  1RAE B;  3CDU A;  2MKY A;  2AKW B;  1A0O B;  4XDD A;  4CWB A;  1PO6 A;  4B08 A;  3GU0 A;  1DBD A;  4DSE A;  3GII A;  2DGW A;  2CPH A;  2JNJ A;  4ID8 A;  4HAC A;  4NLR A;  1HD1 A;  4FS1 A;  2ZZN A;  2FJX A;  2JVO A;  3V5R A;  2GC8 A;  1FT8 A;  2M4M A;  3GV8 B;  2EG1 A;  4A4J A;  5B0G A;  1QJH A;  4Y2C A;  2HS4 A;  3HZG A;  1YZ6 A;  2ADB A;  4ZP7 A;  1LNQ A;  4ICL A;  3NBP B;  3OXL A;  2IJN A;  4DPW A;  2MKJ A;  4X66 F;  4NML A;  1TR0 A;  3UFC X;  3G8S A;  4BCA A;  3QSY B;  4KO0 B;  1WSR A;  3TYT A;  5ETN A;  4DSL A;  4J9S A;  1RP5 A;  1BE4 A;  5C2C A;  3MM5 A;  1U09 A;  2Z8Q A;  3OHA A;  5F9N A;  2RE1 A;  2P6S A;  1XNR F;  2ZBR A;  4AL7 A;  5C2G A;  1T95 A;  1UWB A;  2APO A;  3G82 B;  1ZA1 B;  2MHN A;  3I5B A;  1JLG A;  2V8P A;  2XS7 A;  3H2V E;  2P9C A;  4KT0 C;  3HVR A;  4LBP A;  1R27 B;  4I2P A;  1Q8K A;  1R6Y A;  2VFR A;  1T11 A;  4IO9 Q;  2PI5 A;  1QDU B;  5M2U A;  1R31 A;  3BZQ A;  3K58 A;  5A0Y B;  4PR6 A;  4XTT A;  2DNG A;  3OFH A;  1MW7 A;  2QEX S;  3GE9 A;  5KFJ A;  1K44 A;  1WOO A;  1A7G E;  4M5H A;  1RWX B;  3TQE A;  3RTV A;  1SQG A;  1HWL A;  2GJI A;  3I4H X;  1TEL A;  1L3V A;  3QIP A;  4X66 J;  4NE9 C;  5JUM A;  1VRT A;  3P5T L;  2IBO A;  1B0P A;  3RGI A;  3CJ5 A;  1RKJ A;  3BSN A;  4RBU A;  4G6V B;  4NLX A;  1CUL A;  1UJ4 A;  3NNA A;  1TKZ A;  3T1Y F;  4FVC A;  2W9B B;  1AFI A;  1HWJ A;  2DNO A;  4D3G A;  4D3H A;  2R8K A;  1IJF B;  1ZET A;  3CIZ A;  1XNR J;  2IM3 A;  2CVE A;  3ENW A;  3TX0 A;  2C2K B;  2HWH A;  4CH7 A;  4P2F A;  4LF2 A;  2RRA A;  2D1C A;  1WF0 A;  5F41 A;  3MF5 A;  3KG1 A;  4ERD A;  4M95 A;  3HHD A;  3N79 A;  3QT8 A;  2GHW A;  5KFO A;  4KH1 B;  3KLF B;  3NEK A;  1LW0 A;  2CKW A;  3AQO A;  3KKF A;  3A3O B;  5KFT A;  1K0T A;  5KG6 A;  3BO4 A;  4ED3 A;  2BAN A;  3W9H A;  3CUN A;  4ZCM A;  2RUS A;  4DZD A;  3EZU A;  2AD9 A;  4UST A;  5DET A;  3MDF A;  5F0U A;  5EWF A;  1TL3 A;  2FPH X;  3G2X A;  3F44 A;  1DFD A;  2YKA A;  3QO9 B;  4A8F A;  3SSS A;  2MSS A;  2GQC A;  5KFR A;  2XO6 A;  2H4Y B;  3MCN A;  4WTO B;  4LSL B;  2N7Y A;  5HMY A;  1RB0 A;  3T1Y J;  3QSI A;  4GVB B;  3GCW P;  3R2D J;  2WVD A;  1F3V A;  2HHP A;  4PG8 A;  2R7Q A;  4ED4 A;  3M8Y A;  1HPZ A;  3ZZU A;  3U1M A;  3T9Z A;  3MTJ A;  2N7C A;  7FDR A;  2N4D A;  1O5J A;  3BO2 A;  1RCO B;  4RUA A;  2CXE A;  1JJH A;  3SV4 A;  1C0T A;  5JVG Q;  2VIC A;  1UA0 A;  3TVY A;  3H98 A;  2ASL A;  2OEJ A;  3D1O A;  2YNH B;  2H1Y A;  3N28 A;  3WHI A;  3C15 A;  3QLH A;  1VJW A;  4ZP8 A;  4M5M A;  2V69 A;  4Y3C A;  3OVS A;  1O8B A;  1U4B A;  2M88 A;  2W4D A;  4QQB A;  1BWE A;  4UOF A;  1VQS A;  1AB8 A;  5B0D A;  5BR8 F;  3KJF B;  4TU7 A;  3B4M A;  3D6M B;  2MKS A;  3JSB A;  1RWN B;  5GAD I;  4MIB A;  2W25 A;  2XYH B;  1NDK A;  2R7U A;  3ZNJ 1;  3CCU S;  1UEU A;  1HQU A;  3AQP A;  2LDY A;  3OTC A;  3M1V B;  2RRN A;  3A4T A;  1S9F A;  2P5V A;  3R1H A;  1TUV A;  4IG0 B;  5CYJ A;  5DZ6 A;  1D8Y A;  1FTR A;  4ZVP B;  4PEO A;  2JSX A;  1UMJ A;  3M9O B;  5D15 A;  1RWP B;  3W8P A;  1U1L A;  5DDQ C;  1U6Z A;  1U45 A;  3M2R A;  3GG1 A;  2R9L A;  2FZC B;  5CYQ A;  2IC3 A;  1V3R A;  1K1Q A;  2H51 B;  1FRM A;  4W98 A;  5E33 A;  2MKH A;  1ITP A;  1N0U A;  2WW8 A;  3CCR S;  2X1F A;  2W2P P;  1U2F A;  2NR0 A;  3VQT A;  1S1U B;  1U2R A;  3UI3 A;  4U67 Q;  3RU0 A;  3ZTQ A;  5ETR A;  3C2P A;  2LA4 A;  4B3T F;  5ETP A;  3IR6 B;  1RGV A;  1FFS B;  1C1C A;  5KG5 A;  5BYS A;  2HNY A;  2E9T A;  1LK7 A;  3IBF B;  4OYZ A;  2J7U A;  5BR8 J;  1NDL A;  3C16 B;  4OX6 A;  9ATC B;  1PG5 B;  1B70 B;  1HMV A;  1WWH A;  2XSJ B;  2K7K A;  2HZV A;  3GIL A;  2DB1 A;  1RTH B;  4RWW A;  4DU7 A;  3JAM Y;  1VCT A;  3P96 A;  3W62 A;  1N36 F;  5KFW A;  3GB0 A;  3FUY A;  5IV3 A;  1IM6 A;  1CQN A;  1GFW B;  4KJI A;  3AXK A;  1W2B R;  4H4M B;  4UT4 A;  2BJ9 A;  4O3N A;  5HRO B;  2ZM6 F;  1H7X A;  5JJB A;  2W1B A;  4OYX A;  1DY3 A;  5K5M A;  1MLA A;  1HBU A;  4NL5 A;  3GWC A;  1GXT A;  4K8R A;  3OUY A;  2UVR A;  1MWY A;  2B4V A;  2CQ1 A;  1I1G A;  2FVR A;  1ACM B;  5IWA F;  2CQG A;  1JQG A;  4LQ9 A;  4B3T J;  3UDE A;  2MEW A;  4CLZ A;  4CT9 A;  4KGV B;  2J9D A;  4I2Q A;  2Y1R I;  3S1T A;  3UDV A;  1JXE A;  4O3P A;  2HUR A;  2C3P A;  2NZ4 A;  2FIU A;  2RB7 A;  1VIO A;  1RT2 B;  4Z7Y A;  2KM8 B;  2DIS A;  5SZT A;  4OI1 A;  3I0S A;  4YDD B;  4JV5 F;  2AEJ A;  4X64 F;  4OLP A;  2ZH4 A;  4GC7 A;  1N36 J;  2J5A A;  2BYC A;  2R7W A;  2G2Y A;  2BJ1 A;  2CQ3 A;  3DXS X;  3CJ8 A;  4TYA A;  1GAO A;  3MEC A;  3J7Y I;  3E01 B;  2B3T B;  3O44 A;  4ICL B;  2CIM A;  3NWG A;  1CJV A;  2JDJ A;  1OPI A;  2QFI A;  1FTC A;  3K89 A;  2Z58 B;  2V94 A;  2ZM6 J;  1L5U A;  4L6V 3;  2AW0 A;  4HH1 A;  1NH8 A;  1VC6 A;  2CAD A;  2LEC A;  2OML A;  1R43 A;  5EN1 A;  3MM5 B;  1LEO A;  2V8D A;  2GVZ B;  3MM8 A;  3THP A;  5IWA J;  3NRB A;  2WTF A;  1M1G A;  2W4C A;  2MTL A;  4DFK A;  4AD6 A;  4AT1 B;  3CCT A;  3PFE A;  2ZFH A;  3ICL A;  2XG8 A;  2EFN A;  4FP9 A;  3CT9 A;  4DV0 F;  3OBI A;  1TP7 A;  4OHY A;  3MUR P;  2R8G A;  1CJK A;  3MMB A;  4I2P B;  1U1P A;  3DHX A;  3V6D A;  3HFV A;  2CNL B;  2VG7 A;  2H9Z A;  2C2M B;  3HHE A;  4DG1 A;  4Z2X A;  1UP1 A;  4ECZ A;  4X64 J;  2R7V A;  3NAI A;  2PEB A;  1GQE A;  3MR3 A;  4FF1 A;  2HHV A;  1SQE A;  1F3F A;  5CHC B;  3MAA A;  3M32 A;  3I9V 9;  1S72 S;  2YTC A;  2MGZ A;  1T3O A;  1EIY B;  3LP2 A;  1T9W A;  1WOR A;  3RW7 A;  5IV4 A;  3A13 A;  3PX4 A;  3H25 A;  4C8L A;  4N76 A;  1TKZ B;  4DSI A;  1LXJ A;  3BPS P;  4CO5 A;  2ZIT A;  2QMX A;  3DOL A;  3CJ2 A;  4DV2 F;  4OZL A;  2HGN A;  2ZDP A;  1WKJ A;  3WQP A;  2XB2 D;  1JLA B;  2IRU A;  4DV7 F;  4DV0 J;  5D8H B;  1TTH B;  2QT7 A;  5EDW A;  1T94 A;  2HZA A;  3ZTO A;  3BS9 A;  4UQT A;  1NHU A;  1VC5 A;  5KT6 A;  3BGR A;  1LW0 B;  3MPY A;  2LA6 A;  4C8Y A;  1KDN A;  4WWS A;  1JJ2 R;  1CEZ A;  3MFH A;  4IG3 A;  2BAN B;  1U1M A;  1VHI A;  2K3I A;  2C2D A;  3HFZ B;  4QJV A;  2PSZ A;  1R8P A;  2CJA A;  3Q2T C;  1RHR B;  4IFY B;  1KLN A;  4QPT A;  1CLF A;  4EU0 A;  2HBZ B;  1YJ7 A;  4OIX A;  4RBV A;  2RUG A;  2E1M C;  2DHG A;  4FBT A;  3TNV A;  2IM1 A;  3T3F A;  1UKU A;  1HHS A;  1S1X B;  1FRJ A;  5I42 A;  2HAF A;  4NEY A;  2XS5 A;  2Q6C A;  3M2V A;  4EO6 A;  2VL1 A;  6FD1 A;  4DV2 J;  3V4I B;  3LA0 A;  3FEY B;  2OPP A;  2WAQ D;  1HPZ B;  4PXE A;  1SC1 B;  2OP5 A;  4Q0B A;  1NJW A;  1S10 A;  4YDX A;  4DV7 J;  4YQW A;  4PYD A;  1Q7Y T;  2BE2 A;  2CQ4 A;  1M1H A;  4ZLN A;  5GAD U;  1PCA A;  4MJK A;  2VKR A;  1YGY A;  3GLJ A;  3DXB A;  4KHR A;  1WF2 A;  1HR0 F;  3QPI A;  1G6B A;  4DQR A;  2BDP A;  1NK9 A;  3C15 B;  3I0R A;  3QLH B;  2HPU A;  3CCJ S;  5LMU F;  2LLZ A;  1TL4 A;  2ZDO A;  1NCL A;  4KY3 A;  3NS7 B;  3AD8 C;  1UVK A;  3Q8S B;  4DEZ A;  1UZD A;  3DHW C;  4YOE A;  4I7F A;  2HHQ A;  3LGN A;  1UJ5 A;  3NCP A;  2VQF J;  3FZB A;  2W7O A;  3GJT B;  2V8G A;  4F0K A;  2X3G A;  5F3T A;  3OPK A;  1KOH A;  5IZH A;  2LU1 A;  2BA9 A;  2WB4 A;  4J91 A;  4OFZ A;  4IO1 A;  1HQU B;  1Y0H A;  5BYR A;  2MKI A;  1UEK A;  4HTJ A;  2JEJ A;  5KFX A;  3BB5 A;  1NRK A;  4FF3 A;  3W1Y C;  4P73 A;  5ETL A;  4B9T A;  4OL8 A;  4DCO B;  3DMJ A;  2BXJ A;  3HF5 A;  3M2R B;  5A8K B;  1O6X A;  1KOO A;  2BEF A;  5GMK a;  5CYQ B;  2YKQ A;  2CJ9 A;  1TU0 B;  2XQC A;  2NCK L;  3IM8 A;  1B64 A;  1VBX A;  1YIJ S;  2AZ1 A;  1K0V A;  2QA1 A;  3W61 A;  2KTQ A;  2R2T A;  1HR0 J;  2I9S A;  1YJT A;  3EGN A;  5LMU J;  4CP5 A;  3DLK A;  4HVZ A;  1ZM4 A;  2MQN A;  3JQJ A;  1C1C B;  4KFB B;  4ZPT R;  5ADZ A;  2IBK A;  2GZO A;  4IFV A;  2EFP A;  2FJD B;  1KC8 T;  3HT3 A;  1FXR A;  1RWM B;  1HMV B;  1YQH A;  2Q66 A;  2V2Q A;  4JV0 A;  3G8T A;  3POT A;  1JIH A;  5KG7 A;  3SDE B;  1JK9 B;  4V19 X;  1H73 A;  1U48 A;  3B4D A;  1BGX T;  2OKQ A;  4G1Q A;  3PW7 A;  2CG4 A;  4JOU A;  4C3K A;  3UN3 A;  2EWH A;  1FEH A;  2HFV A;  4P75 A;  5C24 B;  3ILI A;  1NK5 A;  5AT1 B;  4GRS A;  4YR2 A;  4Q2M A;  2WB1 D;  1HBU B;  1Q95 G;  1IKX A;  2HLT A;  3OUY B;  4A8S A;  2HGL A;  3FBB A;  5IQQ A;  4DL5 A;  4WFX A;  3M8Z A;  1TK8 A;  1KD1 T;  2AQ4 A;  2PEH A;  2ZHB A;  4JI5 F;  2VD3 A;  2FGC A;  4UY8 T;  1SUQ A;  3HT0 A;  2DKO B;  1H98 A;  4X4T A;  5GVQ A;  4LF6 F;  3J7Y U;  2YPY A;  2IA0 A;  4EBD A;  2R7T A;  2Z57 B;  2DNP A;  5IM0 B;  3KLG B;  3AJ2 A;  3KJN B;  3OL9 A;  1FCA A;  2DTJ A;  5F8I A;  3T5K A;  3A8E A;  1RU2 A;  3I0S B;  3MR6 A;  2CPI A;  3PV8 A;  2OJ3 A;  4OYA A;  1EQM A;  1D09 B;  4PPZ A;  3CED A;  3HCX A;  5CZV A;  3P5B P;  4B3O A;  4PAB A;  2DNL A;  3UQS A;  3CCE S;  1PSD A;  4RJV A;  1S9E A;  2DVI A;  3MR2 A;  2HVE A;  3QT6 A;  4U96 A;  1CJV B;  4ZN3 A;  3EVM A;  4ZJL A;  4QIE A;  1MSW D;  1N33 F;  3KLI A;  2BMB A;  3CJK A;  4X62 F;  3LP0 A;  3CCV S;  3RJM B;  4KRW A;  4RW6 A;  2UVU A;  1LWE B;  2FZG B;  4NZ7 A;  4RW8 A;  3MM8 B;  1T3N A;  4JI5 J;  3DDK A;  2B8Q A;  4DL2 A;  4ZP6 A;  3O3L A;  3D1Q A;  5IT9 U;  5A8R A;  3ENV A;  2LEP A;  5F0W A;  4LF6 J;  1SJF A;  2ZH8 A;  2E1A A;  3MMB B;  4EBE A;  2PGC A;  3V6D B;  1B3T A;  2DNM A;  4S0M A;  2OMO A;  1X9W A;  1PKU A;  1S4E A;  4DG1 B;  4UQG A;  3R5D A;  3Q22 A;  2CFX A;  2QJ3 A;  3MUV P;  2ZZM A;  1HYS B;  4USW A;  1M5V C;  1H7W A;  3QT5 A;  5HP1 A;  3M32 B;  5HVG A;  4O3O A;  2UXC F;  2ACY A;  4IQX A;  2UXB F;  1PAE X;  2A2D A;  4FKX A;  2DNH A;  3W2W B;  1H3D A;  2MGZ B;  1SKU B;  3LP2 B;  2AJF E;  4Y65 A;  3K2Y A;  3RYL A;  2MY8 A;  3MUT P;  2AJQ A;  4X62 J;  3SQO P;  5FLX Y;  4KGZ B;  2IRY A;  1Z4U A;  3M4X A;  4DF8 A;  4NMX A;  1KRP A;  1OSC A;  1N48 A;  3DOL B;  2D3O 1;  4WPA A;  2OHD A;  4X4S A;  4DCJ B;  4KGK A;  1IBM F;  1O51 A;  3FCV A;  4RU9 A;  2ZZT A;  3QGH A;  3BQ0 A;  5KFS A;  4K4Y A;  2CDQ A;  3FKB A;  3EGZ A;  2OPS A;  5EGY A;  1FD8 A;  4GMK A;  1N5T A;  2EK1 A;  2AHO B;  3EIC A;  4CLP A;  2CQC A;  4R5P A;  2BOP A;  3BGR B;  2EC2 A;  1HI8 A;  2VBX A;  3OJS A;  3NAH A;  1VLY A;  2O1P A;  2EC0 A;  4TKT A;  4IG3 B;  4X4U A;  2AMC B;  4C8O A;  5HVF A;  2MYF A;  4ZCK A;  2UXC J;  2VA2 A;  1UVL A;  1KN6 A;  2UXB J;  2NYH A;  3QRQ A;  2UV8 G;  2G1D A;  2E66 A;  2GMH A;  2IMW P;  4KV8 B;  3GSI A;  4NEZ A;  4FYD A;  2RD5 C;  3PR5 B;  4CLW A;  3HM9 A;  3D3C J;  5I42 B;  2YBV A;  3M2V B;  1N32 F;  4JV1 A;  2DR6 A;  2MJU A;  4O3S A;  2KRR A;  1IBM J;  2LVW A;  4ATN A;  4J9R A;  4USI A;  3AY0 A;  3JXO A;  4JB8 B;  1NPP A;  1IKV A;  1MN7 A;  4Q0B B;  2MZJ A;  1IVZ A;  4ILM A;  3TA0 A;  2GQ2 A;  4C4W A;  2BE2 B;  5C5J A;  3NWR A;  2C3Y A;  2VU5 A;  2RF2 A;  4ZP9 A;  4IOA Q;  1VQ4 S;  2J0W A;  4EO8 A;  5AXK A;  1RHM B;  4V1A k;  2AYG A;  1JMT A;  3TAM A;  2UU9 F;  2HVH A;  3I56 S;  4CQ1 A;  3I0R B;  3JQK A;  2V0N A;  2NPI A;  4PXB A;  3HPO A;  4MK8 A;  3TWZ A;  5HAT A;  2CA9 A;  5DLG A;  1VQP S;  1VQL S;  1TZ0 A;  5HBM A;  4H4K A;  1RT4 B;  1VYA A;  2FD2 A;  5CYM B;  4X4Q A;  1RZM A;  2HLU A;  4L75 A;  2W01 A;  1LWX A;  1EB0 A;  2OH2 A;  3RAQ A;  3O1L A;  3KJV A;  2MQO A;  4NI2 A;  4A47 A;  2AF6 A;  2D69 A;  4N56 A;  1RWV B;  2OSR A;  1FRK A;  1N32 J;  2ZWO A;  3DMJ B;  1SC6 A;  2AYE A;  4ECT A;  4DPU A;  1Y3J A;  2ZUG A;  3ENQ A;  4NYZ A;  1XMO F;  2KYX A;  1HD0 A;  3LP1 A;  2GGP A;  5L1I A;  2DRA A;  1HLW A;  3MMC A;  4LQ3 A;  5A2Q U;  3B82 A;  5HI7 A;  2UU9 J;  1VHF A;  2LYV A;  4FPI A;  4ZPD A;  1KQF B;  3L7U A;  4BS2 A;  2DGS A;  4OJG A;  1NXI A;  4L74 A;  4ZDN A;  3TO8 A;  4DSF A;  3TUZ C;  2BE7 D;  1XC9 A;  1NK0 A;  4RNO A;  5AE2 A;  4IFV B;  3NNC A;  1PJ6 A;  3CMQ A;  2UUC F;  2OTJ S;  3D6F B;  1IKY B;  4L76 A;  3KG4 A;  4KIA A;  3POT B;  2BE9 B;  2UXD J;  4NRU A;  1XNQ F;  3D54 A;  2DR5 A;  4KGX B;  2GJ2 A;  3H7H B;  4TU9 A;  2XGQ A;  4CO1 A;  3VCD A;  1N4L A;  4DL0 C;  3FCW A;  2LQJ A;  2JL9 A;  1EQ0 A;  2FC8 A;  5IOL A;  4X4N A;  2P2C B;  2CQB A;  3TVK A;  1XMO J;  1QTM A;  1HAR A;  1IKX B;  3Q24 A;  5F8H A;  2ZHA A;  4ECV A;  1AUS L;  5KFU A;  4YN3 B;  3RRK A;  2R42 A;  4Q44 A;  3Q8Q B;  2QN6 B;  2Y1I A;  1EKS A;  1SUQ B;  2DH8 A;  3R5G A;  3GV7 B;  3IAS 9;  3GPA A;  5G0R A;  1S48 A;  4LF8 F;  3L4B C;  3KUG A;  3EXY A;  2ZJQ Q;  4YR3 A;  2UUC J;  2V4J A;  3BKU A;  3W9I A;  4EBC A;  1JWW A;  2MJN A;  2KFN A;  1VQK S;  1F0X A;  5HMW A;  1WEX A;  2ZC4 A;  5E3C A;  4QWA A;  5DM7 Q;  2HEK A;  3CWJ A;  1FJG F;  1AT1 B;  4ER8 A;  2ZBP A;  1EAR A;  1XNQ J;  1NB7 A;  1E6V A;  3SZ2 A;  4B3O B;  4AFF A;  1YJV A;  4QU7 A;  3R8Y A;  3D2W A;  1S9E B;  1M5H A;  3TP2 A;  2IJR A;  2DCL A;  1VGY A;  4URG A;  3EZ5 A;  3T5L A;  4O4G A;  5KFQ A;  2ZD1 B;  2AYB A;  1RQ0 A;  1UA1 A;  3WZ0 A;  5IC4 B;  2NSC A;  3TW0 A;  3KLI B;  1U1R A;  3CJK B;  5D4L A;  1D0E A;  3LP0 B;  4G65 A;  1LKZ A;  1HBM A;  4RW6 B;  3KMQ A;  5ETS A;  4ANE A;  3VHQ A;  4X4R A;  2YKN A;  2A10 A;  2O66 A;  3HJV A;  4ZLL A;  4RW8 B;  3EPG A;  4AL5 A;  3TEG A;  3TAR A;  4FS2 A;  5CCM A;  1SKW A;  1YZ7 A;  3D5M A;  3QGP A;  3HVW A;  5A8R B;  3CW2 C;  2KO1 A;  3GIM A;  2B0G A;  3ZFV A;  4LF8 J;  2X1A A;  3SQG A;  4J90 A;  1IWG A;  4ZVS B;  1R0C B;  4U8V A;  4XPC A;  1IUJ A;  3VAG A;  5K14 A;  1FJG J;  1FI4 A;  3A1Y G;  1Z1Z A;  5HP1 B;  4DV3 F;  5JVH Q;  2YWG A;  2XI2 A;  4J9V A;  1PC4 A;  3CME S;  2YPZ A;  2DR7 A;  2W7A A;  2KB2 A;  4Y00 A;  1UVN A;  2VPY B;  4J9L A;  5LSO A;  3FC9 A;  2YNF A;  4ZS6 A;  2ZH5 A;  2GVD A;  1F9F A;  2PO4 A;  3M8R A;  4NCB A;  1SKR A;  1BQN A;  2FB0 A;  4FXD A;  3C6U B;  4WIQ A;  1Z2L A;  4M5L A;  1FE0 A;  3BBB A;  3IS9 A;  3W8G A;  5IQ6 A;  1BUX A;  1WEY A;  3MPD A;  3N9U C;  2OGU A;  4ELT A;  4I6W A;  2C22 A;  4DR3 J;  2OPS B;  1VQY A;  2CPJ A;  2CNO B;  1OQ3 A;  3GFH A;  4EFA C;  5DG9 A;  3PEJ A;  3I5C A;  2DGV A;  2FJA B;  3N4W A;  1V5V A;  1VOM A;  4LT6 A;  4R5P B;  2RHQ B;  5LL6 d;  2K8G A;  3BDE A;  1U8W A;  4ANC A;  1Q81 T;  4UUX A;  5LM7 E;  4DUT A;  2HAI A;  2XZD B;  4C8M A;  3ISN C;  3LUY A;  3PHT A;  2KZM A;  1SV5 B;  5C7P A;  2QL5 B;  3FJ2 A;  1Y11 A;  4M8L A;  4DV3 J;  2ZBI A;  3F41 A;  1R6V A;  3GZ7 A;  2E5J A;  5KFF A;  1FKA F;  2CWK A;  3W5Y A;  3UW1 A;  3CDB A;  3FVY A;  1M5O C;  5GME A;  3KFW X;  4WU3 A;  4ED5 A;  3WBZ A;  5GAG I;  6FDR A;  1UVI A;  1CJT A;  3KK1 A;  4O44 A;  4DR5 F;  1PJ7 A;  3DRS A;  1ZBT A;  4OX7 A;  5AJ3 F;  4XK8 C;  1FFG B;  3RG6 A;  3RR8 A;  5U47 A;  3VGS A;  4KE5 A;  2B9Y A;  1SH3 A;  4LF4 F;  5DZ7 A;  4P7T A;  3IN5 A;  3M9M B;  1JLB A;  1D9F A;  3UCU P;  2OIH A;  1I6J A;  3QAT A;  4WKR A;  2RF2 B;  4O0N A;  1XR7 A;  3DN9 A;  2QX0 A;  2QSF A;  3NXZ A;  4C3M A;  2J9C A;  1ZOT A;  3D0G E;  4LVO P;  1KVJ A;  1XK8 A;  2RQC A;  1FNX H;  5HBM B;  2B8P A;  2V34 A;  3H40 A;  3B54 A;  2VJV A;  4IKA A;  4RUC A;  4NYO A;  4ZJO A;  4FYW B;  5KG3 A;  3ILL A;  2QMW A;  3HK2 A;  4DLE A;  4F4K A;  1XBW A;  3KUH A;  2VA3 A;  4DU8 A;  4KB7 A;  4IRC A;  2B7B B;  4CLS A;  4AQY F;  5CZX A;  4LSZ B;  4CO2 A;  1MML A;  3J7A N;  5KT2 A;  4DFJ A;  4DR5 J;  5D0R A;  5AJ3 J;  4NCG B;  2HBY B;  3LF0 A;  1SIZ A;  2JH3 A;  2OD6 A;  3A8I A;  3C46 A;  3R27 A;  4LF4 J;  4PUO A;  4JI4 F;  1IJE B;  4F50 A;  2GGP B;  1PBU A;  5SUH A;  1WG1 A;  3HSJ A;  3U1N A;  3W5Z A;  2YX1 A;  3CE8 A;  3T41 A;  2UUA J;  2DCU B;  2NSB A;  4P6Q A;  5L1J A;  1CG2 A;  4OV6 A;  2XZW A;  4DUY F;  4NXN F;  4EUV A;  3MD3 A;  1N54 B;  1RE1 B;  1Q7L B;  1Y00 A;  3CPW R;  4LR9 A;  3QYY A;  1ZH5 A;  3L7O A;  2MQL A;  1TK5 A;  4CH1 A;  5J2M A;  3LTO A;  4OI6 A;  3Q2S C;  1FDA A;  3V81 A;  1V9O A;  4DR1 J;  3GCX P;  2VC0 A;  4WII A;  4UOC A;  2CUY A;  3SIP B;  4YB6 A;  3A12 A;  3ZTP A;  4AQY J;  3TZX A;  2RSQ A;  3UNY A;  3CIM A;  3F0N A;  5HVH A;  4F26 A;  2EG2 A;  8RUC A;  1R0B G;  3FBF A;  1X0F A;  1ICE B;  4ZHR A;  3RAM A;  3T19 A;  4AL6 A;  9RUB A;  4JI4 J;  2DEJ A;  1JXV A;  1KTQ A;  1WTB A;  4N8N A;  4LRD A;  4HHU A;  1WHX A;  3BSO A;  2ZKT A;  1WC1 A;  3TUP A;  4WE1 B;  1UL3 A;  3OLA A;  2V8H A;  3CGI A;  5F3Z A;  4PQU A;  2DNY A;  3AA9 A;  4DUY J;  4NXN J;  4LRE A;  3G9C A;  4PWD A;  3LO3 A;  4LJM A;  4P2S A;  4KPY A;  1V3S A;  3RAX A;  4CO4 A;  2FHK A;  2V4J B;  3W2V A;  3DLJ A;  4M5I A;  3T5H A;  3HSZ A;  1IQT A;  4YFU A;  2HKE A;  5DDO C;  3VTI A;  2UZA A;  2KXH A;  3KNA A;  1D9D A;  4EZ9 A;  4OV1 A;  3OR1 A;  1HA1 A;  1JLE A;  2C2Z B;  1G3O A;  5LT5 A;  2XY6 A;  3LQV A;  2HRT A;  1GEH A;  4O4G B;  1KS2 A;  1P1T A;  5KFH A;  1CC8 A;  3VAF A;  2DR8 A;  4A8Q A;  3HSG A;  4ZOS A;  2XC9 A;  4R25 A;  4YB7 A;  2CAJ A;  4HLB A;  4ZVR B;  4C6A A;  2F3J A;  1HFE L;  3UVJ A;  1AW0 A;  3PM9 A;  2YKN B;  1LWC B;  2BRK A;  3PDN A;  1EX8 A;  4BHQ A;  3MM9 A;  4OZ2 A;  3KLH A;  2UUW A;  3M7V A;  1TKT A;  2BZ2 A;  1YJR A;  1KFD A;  2VPX B;  3KXD A;  4NAS A;  3J81 Y;  2BQU A;  3SQG B;  1F6T A;  2GHV C;  4CLK A;  2YKM A;  3TZW A;  2OFG X;  4PYA A;  1QUP A;  2V2K A;  4MKY A;  1PIL A;  2I0X A;  1FKP A;  2OLW A;  3FBE A;  4F4Z A;  1BC6 A;  2ZH3 A;  2EVZ A;  1TKD A;  1NSQ A;  3BQ2 A;  5DM6 Q;  2G4B A;  4IRD A;  2CZ9 A;  3CB4 A;  1B0V A;  5D4N A;  4DOZ A;  4UUW A;  4ZLP A;  2F8E X;  2L48 A;  3C6T A;  3NGU A;  4NLU A;  3UO0 A;  4G1P A;  2FC9 A;  3B78 A;  2QE5 A;  2WVC A;  1P1L A;  2QFJ A;  3QAE A;  5C42 A;  2HYI B;  2IJF A;  1BQM A;  4OI3 A;  3UR3 C;  5MLC V;  1N88 A;  2G0I A;  4UOH A;  3VAJ A;  1DJ0 A;  1NND A;  2YNF B;  1JLQ A;  3G4S S;  2HQ3 A;  2GVD B;  5J2Q B;  4WZQ A;  4DPX A;  2ZWP A;  5DJB A;  1RBO B;  1BQN B;  2W9C A;  2EFG A;  4ECR A;  4QIG A;  3AOB A;  4N8O A;  1V6H A;  1TAU A;  1GMU A;  2FDN A;  4KC5 A;  4DPO A;  2B9E A;  3NNH A;  1NAQ A;  1RWK B;  2IVM A;  4CLU A;  3NGS A;  3FEZ A;  1TL1 B;  4F2R A;  5GAG U;  2CQI A;  3J81 j;  4LF5 F;  2GAG C;  2IDE A;  3UN5 A;  1DAX A;  3V6K A;  5D4O A;  4TLR A;  3H2L A;  3MI7 X;  1Y5N B;  1X4C A;  1KON A;  5G4D A;  4OHV A;  1TUW A;  4ZLJ A;  4F4A A;  1FNM A;  4LFA F;  1XQI A;  3IBC B;  5E2Q A;  1RWU A;  3Q83 A;  4LBH A;  3OXG A;  3G8Q A;  5T14 A;  1RT1 A;  3ZZ0 A;  3TJA A;  4KH0 B;  3BN4 A;  2VUG A;  2A6M A;  4DR7 F;  1FDN A;  3KK1 B;  4O44 B;  4K4Z A;  1WKK A;  4ZMM A;  4K5S A;  4ECX A;  1HWI A;  4GKK F;  2DPJ A;  3G6V A;  3J7A 1;  1Q79 A;  4GKJ F;  4ED7 A;  4PG4 A;  1NU4 A;  1C1B A;  3OV7 A;  3T9N A;  4A46 A;  1TL7 A;  1S59 A;  5ITH A;  4ZVG A;  4J9K A;  2F8H A;  1IN0 A;  3T1H F;  2I2Y A;  2VOP A;  3FBC A;  3PHE A;  4MMO A;  1VRQ C;  4V19 J;  3LPE A;  4ZPB A;  4OZ5 A;  5E3R A;  4DFP A;  2GML A;  1HNI A;  3N6N A;  3IG1 A;  1O0P A;  2WVE A;  4LF5 J;  5L39 A;  3S6E A;  1FWK A;  3A3P B;  1JKH B;  1M5K C;  1T03 A;  3KHH A;  5A6P A;  1B0T A;  2ZNZ A;  5CD4 H;  2KJV A;  1RT3 A;  1DTQ A;  2PE8 A;  4K4U A;  1HBO A;  2JJ4 D;  1DUR A;  1MU2 A;  4K0K F;  1KQK A;  5DDR C;  1YI2 S;  2J0S D;  4DR7 J;  4OZ0 A;  2RT3 A;  3OL8 A;  3J7Z 5;  5L9N A;  5KTQ A;  3MR7 A;  2C2N A;  1S76 D;  4GKK J;  3LGH A;  5KFD A;  4GKJ J;  1SJR A;  4A8K A;  3ET6 A;  1NB2 A;  3D0I E;  2E9Z A;  4RBT A;  4F7V A;  1UCN A;  2LQ5 A;  2JWN A;  1NSK L;  2P8I A;  2E7V A;  4E8U A;  3T1H J;  1JLC A;  1F5B A;  2OPQ B;  3LAM A;  4KHP F;  1FA0 A;  3GIR A;  4CCH A;  2BR0 A;  4U7U K;  3OQ2 A;  4F4W A;  2RVJ A;  2OUG A;  3H59 A;  1ELO A;  4UZC A;  3M6X A;  3DOM A;  2VOO A;  2CPY A;  2JLE A;  3HXM A;  3R5C A;  1KEK A;  3EYZ A;  2IM2 A;  3H42 A;  5J2M B;  3G6X A;  1QLN A;  4RNM A;  4B02 A;  2C3O A;  1S1T A;  4NRT A;  3CO9 A;  3M6U A;  4F36 A;  2C3M A;  2W4P A;  1YBA A;  4K0K J;  2KVI A;  4RWX A;  3J80 Y;  3JTO A;  5HN0 A;  2E5G A;  4AUK A;  2MHE A;  5KFZ A;  2YWK A;  3BM7 A;  4B9S A;  5HSP A;  1NKB A;  1KBR A;  3C3L A;  3FMB A;  1YIT S;  2UUB F;  5HL7 Q;  2GQQ A;  1PBA A;  4J9N A;  2P6T A;  1H74 A;  3PO5 A;  6AT1 B;  1U24 A;  4DR6 F;  5DS7 A;  1HBN B;  4DX8 H;  4LRF A;  1C0U B;  3SCK E;  2RS8 A;  1I51 B;  3R9L A;  5HJY A;  4C11 A;  3OFG A;  1KNZ A;  1NBE B;  1FEE A;  4K2X A;  3D1H A;  4PQU B;  3DLL Q;  2PMH A;  3W60 A;  3OR2 A;  3Q86 A;  2DH7 A;  4PWD B;  1ZYQ A;  4J7C A;  4KHP J;  4KQZ A;  3RZA A;  2V4R A;  1R89 A;  1P9Q C;  4DCP B;  4DR2 F;  2DHS A;  2MB0 B;  2CQH A;  1S6O A;  3VVT A;  3I87 A;  2XLK A;  4DS5 A;  1IKW A;  2VG5 A;  3W2V B;  5CCL A;  1R8H A;  2IIH A;  2R7X A;  3ZC4 A;  5LJ3 Y;  3MOJ B;  3M9N B;  1YDL A;  2KJW A;  3JYT A;  3PJX A;  4LRB A;  3PIP Q;  3PKM A;  1REV A;  4I69 A;  1QAX A;  2C2E A;  5L46 A;  2DBB A;  2Y8Y A;  2EFV A;  3H4B A;  1JLE B;  2YNG B;  2OEK A;  4JI7 F;  4WXW A;  1H0H B;  2POK A;  2NPF A;  2UUB J;  4QYR A;  1RT5 B;  1FK9 A;  5A76 A;  4RNF A;  3FZ2 A;  3CJ0 A;  1NJY A;  2CJB A;  2HFN A;  3AB2 B;  4DR6 J;  4BLG A;  2CJK A;  3TZY A;  4JI1 F;  1DQ9 A;  4X4O A;  3GMG A;  2RDJ A;  3QJJ A;  3NMR A;  2DK2 A;  3KLH B;  3NS5 A;  1ZPW X;  1TKT B;  4XO0 A;  5D0E A;  2NZC A;  3DOK B;  3TUI C;  1TV6 B;  2MLY A;  2D41 A;  2B5J B;  1PJ5 A;  2CZ4 A;  1X4A A;  4DR2 J;  4AMM A;  1KWM A;  2HG4 A;  1RUS A;  2G2Z A;  2ATC B;  1Q5V A;  3H0P A;  3EPI A;  1P9Y A;  3PZP A;  1VLO A;  3JAM U;  2BM0 A;  2KL8 A;  2Q43 A;  2DNK A;  2NXE A;  1N52 B;  4ZPV R;  1SC4 B;  1D8Z A;  2DEI A;  4MKA A;  1RSC A;  4KGM A;  1VIS A;  4WFZ A;  4DL3 A;  2Z4P A;  2QLB B;  4EEY A;  2KH9 A;  2IYG A;  3JB9 k;  4PQA A;  4DQP A;  4JI7 J;  4ALZ A;  3NP5 A;  1C4C A;  2H65 B;  5ETV A;  1NM2 A;  4U6P A;  2DO0 A;  4RW7 A;  2QIF A;  1WI8 A;  2MXY A;  2M2B A;  2V6A A;  2OEM A;  1XR5 A;  3RRH A;  5C42 B;  5CZD A;  3HHL C;  1BQM B;  4JI1 J;  1U0H B;  2JLF A;  4QR1 A;  5H1S V;  1JX4 A;  1YRT A;  3QJL A;  2R2R A;  1ZPV A;  2W9C B;  1HNX F;  5IC6 B;  3R5J B;  4DL7 A;  3PIO Q;  4OMF G;  2MQM A;  4M1K A;  3CJ3 A;  3FRZ A;  1YVF A;  2AZ3 A;  3MEE A;  3BBC A;  4DPT A;  3TAP A;  1NLK L;  2QLJ B;  2MPU A;  1NHV A;  4ZK7 M;  3PW4 A;  2XI3 A;  4WK1 A;  2H3E B;  2XBP A;  1U1O A;  4DBQ A;  3DYA B;  3ONQ A;  3EVW A;  5IT4 A;  5AXM A;  3DGP A;  4MT1 A;  1YKW A;  2UUT A;  3MFI A;  2V67 A;  1AZS B;  4USK A;  4ZIW A;  3QJP A;  1U6B A;  3EWG A;  4N77 A;  4I67 A;  4F8R A;  4TY8 A;  2DYA A;  3AFG A;  1VC0 A;  1F9H A;  2E1R A;  1U7L A;  3Q8V A;  2AJ2 A;  5IS2 A;  1D9A A;  2L3M A;  1RT1 B;  3DRX A;  2JEI A;  2HHW A;  5KFA A;  1R8A A;  2HNZ A;  3UD5 A;  4DF4 A;  1GH8 A;  5HQ8 A;  2ILZ A;  4PCQ A;  4B9N A;  3HX9 A;  4DWI A;  3O8W A;  3A3N B;  3CJT A;  4NCA A;  1HNX J;  3NY0 A;  4M5J A;  1REG X;  4F3O A;  1C1B B;  4OJ1 A;  2XLJ A;  4ES2 A;  5IXU A;  1RTI A;  5EUH A;  1TL7 B;  4K4V A;  1S6Q B;  3PYG A;  3QID A;  4M5G A;  1S0N A;  1J5E F;  5A8W A;  5KFG A;  2B51 A;  2Z2Z A;  2BAB A;  4X2B A;  1N5S A;  3I9Z A;  3OTO F;  2KZZ A;  1SJQ A;  2HS0 A;  2LQ8 A;  3QBC A;  2FLP A;  2OI2 A;  2J7K A;  3RB0 A;  3WC2 A;  2VPZ B;  1T9Y A;  3ULH A;  4JI3 F;  5B08 A;  3H5Y A;  2D3U A;  1T05 A;  3FFI B;  1WI6 A;  4PG7 A;  3G96 A;  5CQG A;  3I32 A;  2JLG A;  1RT3 B;  4WK3 A;  4I1T A;  1NJX A;  4QWB A;  1HBO B;  3BGF A;  1MU2 B;  4CLF A;  2RQM A;  3Q8Y A;  5K20 B;  5HAN A;  3DLG A;  3IAM 9;  3KHL A;  1H72 C;  1R8C A;  2YWF A;  4LRA A;  1CVJ A;  3BYP A;  5HQL A;  2WBM A;  1KLM B;  2JHE A;  2B6A A;  4LIW A;  1RYS A;  1OIA A;  3BGO P;  2QSW A;  3DI6 B;  2QA4 G;  1J5E J;  2R2U A;  1S1W A;  3IMQ J;  4NPO A;  5L1L A;  1IBK F;  2VKZ G;  2VB6 A;  1ZAX A;  4YY3 F;  1MRO A;  4MK7 A;  2HMI A;  2HRU A;  4OYO A;  3QRP A;  1BHN A;  4YR0 A;  5ETM A;  3OTO J;  4C0B A;  3S8S A;  1WKL A;  4P2M A;  4LFB J;  4NWB A;  1SJ3 P;  4F67 A;  3DOM B;  1H38 A;  1WC0 A;  1B7F A;  2XMM A;  4PXD A;  3NGK A;  4JI3 J;  1RTD A;  3DLE B;  3EM1 A;  1GTE A;  1NDP A;  3KG0 A;  2AJ1 A;  1U1K A;  3CC4 S;  2JEG A;  4DN0 A;  1I3O B;  2VZ9 A;  1S1T B;  2FVQ A;  1APS A;  2LXF A;  5KG2 A;  3GIK A;  4FBU A;  1F2H A;  3VAL A;  3X1L B;  1N5Q A;  1B99 A;  1LK5 A;  4R8U A;  5F8N A;  2B4O A;  1DQ8 A;  3KYL A;  1W2I A;  2ABY A;  2O01 C;  4FVM A;  2G13 A;  1S9G A;  4C3L A;  4HAC B;  5FDL A;  3C8Y A;  1U25 A;  4NA1 A;  4FZV A;  2AWZ A;  2EKN A;  3KNG A;  2QTW A;  3PAC A;  2HQD A;  4YHH F;  4URQ U;  4Q8E A;  1ZAW A;  1M0S A;  2H5I B;  1QY7 A;  2R8I A;  4C11 B;  4DV4 F;  2ILY A;  5KFM A;  1S5Z A;  3B6B A;  3P3D A;  1IBK J;  3CDW A;  3S01 A;  4DUZ F;  1D3W A;  4YY3 J;  1KR4 A;  3Q8U A;  2M9K A;  4TLQ A;  1P8G A;  4ETX A;  1VQN S;  4I56 A;  1LW2 A;  2KXF A;  3BEG B;  2R7O A;  1S0M A;  1R3N A;  2D7S A;  1NO8 A;  4DSK A;  1QUV A;  2VG5 B;  4DI6 A;  2HBQ B;  4WFN Q;  4L3N A;  4X84 A;  1S77 D;  4DR4 F;  1LWF A;  4HT5 A;  1T7P A;  4O23 A;  1GMV A;  2ASD A;  3UR0 A;  5KT7 A;  3R6G B;  3PR4 A;  2VHG A;  4IUF A;  2J8A A;  1FRI A;  1UWB B;  5A0Y A;  4F02 A;  1X4B A;  2ERR A;  3DGV A;  4F04 B;  4H4O A;  1JLG B;  2W24 A;  2Q1L A;  3FCH A;  2FUG 9;  1UW9 A;  2HFO A;  3HD2 A;  4C8K A;  4Q7A A;  4UTG A;  1SQF A;  4Y2A A;  3QFW A;  2DGT A;  1FK9 B;  1IXK A;  4U7C A;  1G1X A;  2HQC A;  1WAC A;  2W9B A;  3MAH A;  4YHH J;  1RBA A;  4DV4 J;  1SCJ B;  1BWV A;  4DUZ J;  2WW4 A;  1ZA2 B;  1Q0N A;  2HGM A;  3QIP B;  1OMS A;  3R97 A;  3N5F A;  1VRT B;  4OX8 A;  3VWS A;  3P45 B;  1UZH A;  3U02 A;  4ID5 A;  5CAA A;  1CUL B;  3OFE A;  3M2U A;  2X1B A;  5K8N A;  3TJ9 A;  1XTZ A;  1WEL A;  3KLF A;  5KFY A;  4DR4 J;  2Y0B B;  4Y0F A;  2PII A;  2DGX A;  3H8Y A;  4CYU A;  3ELH A;  5CD4 A;  1RAI B;  4P74 A;  2V2V A;  2WSF C;  4CTA A;  4WTY A;  4LRC A;  4N5S A;  2NXN A;  4DFM A;  2F5G A;  4B9M A;  1TVR A;  4CT8 A;  4LSL A;  3H5X A;  3NCQ A;  2BOA A;  8AT1 B;  1S12 A;  1B4S A;  4MTP A;  3V6H A;  2XMT A;  4GVB A;  2XMW A;  4LIR A;  3G86 A;  2VQF F;  3K59 A;  5KT3 A;  2QLX A;  5H9E K;  2VQE J;  2JC0 A;  2DY9 A;  1TL3 B;  4LSN A;  1QM9 A;  3OD2 A;  1RTZ A;  4FXW A;  4NLY A;  3WIU A;  2VV5 A;  3MEE B;  4YB1 P;  1RT6 A;  5K8P A;  2N3O A;  3GJQ B;  1JXL A;  3I31 A;  2D3Z A;  1UFK A;  2PT0 A;  4ZVH A;  4BC7 A;  4E0D A;  5LSR A;  3SFG A;  3UDC A;  3TQ1 A;  3J7Z T;  2RNE A;  1RAJ A;  2EEY A;  5FII A;  1PYS B;  2HHU A;  3GQC A;  4WP3 A;  5ETT A;  3DGP B;  1X4H A;  2V63 A;  4ES1 A;  1NPR A;  4Y6I A;  4RR5 A;  4OI4 A;  3VGU A;  1C0T B;  4YUD A;  4QWC A;  1V5I B;  3SCI E;  4TY8 B;  3HI9 A;  3TR5 A;  1CJU A;  2BKP A;  2BW2 A;  4A8W A;  1DZ5 A;  4C48 A;  4ED6 A;  4IG0 A;  3MXH P;  2HHH F;  1XWL A;  2WBR A;  2HHS A;  2BM1 A;  1RHU B;  4Z7C A;  3TAN A;  2W2Q P;  4G3I A;  3G6E S;  1T0T V;  3IXQ A;  3PFO A;  1X31 C;  3K57 A;  5E41 A;  4EI2 A;  4CI0 B;  1RTI B;  3DC2 A;  1N0V C;  3DLH A;  5E3Q A;  4ETZ A;  5A8W B;  1X8D A;  1F9E B;  1S1U A;  1UW4 A;  2CQ2 A;  2GIF A;  4P9S A;  3R5B A;  2G1H A;  1VDH A;  2FJW A;  3W64 A;  2J76 E;  2IC3 B;  1WC5 A;  3I6P A;  2VBZ A;  3V4M A;  4DJB A;  4NLS A;  3C16 A;  2PMZ D;  2WVB A;  3OTE A;  4KAI A;  1I5O B;  3OVA A;  1T05 B;  2ZKU A;  2XSJ A;  1LFW A;  1RTH A;  3UD3 P;  5BYQ A;  3GSD A;  2HVD A;  2SXL A;  1G2E A;  4M5K A;  2CWX A;  5FLX U;  2FGO A;  3DRY A;  1URR A;  5KFI A;  4DHV A;  2BKO A;  2KU7 A;  2P9E A;  2XYG B;  2HHH J;  1S99 A;  3HD1 A;  2HNY B;  2VDI A;  1VFJ A;  1MMD A;  2RH3 A;  2RDI A;  4H4M A;  2I5J A;  5GAH I;  4B9U A;  1GT8 A;  1RTJ A;  4QIV A;  4XPE A;  5HRO A;  4LFC F;  2QL7 B;  3M8P A;  1YBT A;  4TVA B;  2DRB A;  3SFU A;  3G6Y A;  5H9E J;  3KMS A;  4Q8F A; 
#chains in the Genus database with same CATH homology
 2VZ9 A;  3TZW A;  3IM9 A;  3K89 A;  2JFK A;  5DZ6 A;  3TQE A;  2UV8 G;  2JFD A;  3G87 A;  3SBM A;  2G2O A;  4RR5 A;  2QJ3 A;  3R97 A;  3IM8 A;  2QC3 A;  1MLA A;  3PTW A;  3TZZ A;  4RL1 A;  2PFF B;  3R8Y A;  2G2Y A;  3TZY A;  2C2N A;  5CZC A;  3CJ8 A;  5CZD A;  2VKZ G;  2G1H A;  3HHD A;  5DZ7 A;  3RGI A;  2CUY A;  2QO3 A;  3HMJ G;  2HG4 A;  2VZ8 A;  3EZO A;  3HJV A;  2G2Z A;  2H1Y A;  3H0P A;  3BV8 A;  4QBU A;  3QAT A;  1NM2 A;  3TZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...