2C2NA

Structure of human mitochondrial malonyltransferase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
317
structure length
317
Chain Sequence
MGQCSVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAEGLYAVKIRAEAMQEASEAVPSGMLSVLGQPQSKFNFACLEAREHCKSLGIENPVCEVSNYLFPDCRVISGHQEALRFLQKNSSKFHFRRTRMLPVSGAFHTRLMEPAVEPLTQALKAVDIKKPLVSVYSNVHGHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKSCNMQAWKSYSAVDVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MALONYL COA-ACYL CARRIER PROTEIN TRANSACYLASE
publication title Structural Basis for Different Specificities of Acyltransferases Associated with the Human Cytosolic and Mitochondrial Fatty Acid Synthases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 115
structure length 317
sequence length 317
chains with identical sequence B
ec nomenclature ec 2.3.1.39: [Acyl-carrier-protein] S-malonyltransferase.
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 2c2nA02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 2c2nA01
2G2OA 2VZ9A 3CJ8A 5CZCA 4RL1A 2HG4A 3PTWA 3R8YA 2JFDA 3SBMA 2QO3A 2QC3A 2VKZG 2QJ3A 2C2NA 3HMJG 3K89A 2H1YA 3TZZA 3EZOA 5DZ6A 3G87A 3RGIA 3TZXA 2VZ8A 3BV8A 3HHDA 4QBUA 3TQEA 4RR5A 1MLAA 2PFFB 2G2YA 1NM2A 5DZ7A 3H0PA 2UV8G 3HJVA 2G2ZA 2JFKA 3QATA 3IM9A 3TZYA 5CZDA 3IM8A 3TZWA 3R97A 2CUYA 2G1HA
chains in the Genus database with same CATH superfamily
5C24A 1WC1A 1IVZA 4MTPA 3I9V9 2OKQA 3BKFA 1KQSR 3ISZA 4X84A 4X66F 1GNKA 2MYFA 5FLXY 2NXUA 2B9EA 3SV4A 2XY7A 2I0XA 1U7LA 4WBFA 2MZJA 2G0IA 2EFVA 3DGVA 2A10A 3KNGA 2AJ0A 3G9CA 2WONA 4AUKA 1WF1A 2QEXS 4Y28C 4CTAA 3TUZC 5HK4A 3PRBA 3L7UA 2CZ4A 4XDCA 4ZVOB 2ADCA 2AW0A 2WOMB 3C8YA 4DPXA 3U02A 2PMZD 4PXBA 3BYPA 5CQGA 1QAIA 2PE8A 1YSJA 1M5SA 3THPA 4Q7AA 2E9TA 4WFYA 2HFZA 3RAQA 5IT9Y 4CH1A 1FI4A 4P73A 1R3NA 2W9CA 2BOPA 1NJYA 2F9DA 2EK6A 2EC0A 2IM2A 3OL7A 3KLGA 4YFUA 1Q81T 1EP4B 3LALA 4RUCA 2XMAA 1R8PA 4DUYF 1H6KX 1QE1B 3A8KA 2J0XA 2JVOA 3H59A 3TZZA 1IBKF 2KVQE 2EC2A 2HEKA 1U0SA 3KLFA 2G2ZA 5HVGA 5A0YA 3L4BC 1XR7A 2J9CA 3KK1A 1HYSA 3D66A 4M95A 2CPEA 4DL0C 1HBUA 3WC0A 2N4DA 5T7LA 4KKOB 4CO0A 4J9LA 3KHHA 3CO0P 4P7TA 4OJHA 7AT1B 3JB9k 1FJ7A 2F8MA 3GTYX 4LSNB 3GV7B 1T94A 1TUWA 1Q16B 4CIOA 3HHLB 2H5JB 4TU8A 1VQ4S 4C8OA 4LF6J 4V19X 4UQGA 2AX0A 3T5JA 3FRZA 1IJFB 2YH0A 3OVSA 4DPOA 1N6QA 2FJVA 4C48A 1PKUA 3KHRA 4RU9A 1QJHA 2XS7A 1W2IA 2HQDA 1VISA 3PRDA 2OD4A 3I96A 2RKIB 4RW4B 2A2CA 2AYMA 4KRWA 1UWBB 2QC3A 1NU4A 3HM9A 3CJQA 2L48A 1HMVB 3J81Y 1JJ2R 3ET6A 4M5IA 1SKUB 3O8WA 3W62A 1B7YB 5E3AA 2YNHB 1LWEB 2AKWB 3UN2A 2M70A 2CPHA 3BV8A 4Z37A 3R7NB 2BA9A 3EE3A 1N5TA 4HVZA 3RR7A 1C0TB 4FXWA 3M8PA 3DLKA 1S7IA 1HNZF 3RW6A 3S01A 3GCWP 5CYQA 5J1PA 1T9VA 4DR2F 3MCNA 4NLDA 1KLMA 5IQ6A 1PJ5A 3IRXA 4DR4F 1CJKA 4TU7A 2YNIA 3K5PA 2JFDA 2OPPA 3R5AA 1PJ7A 1S7HA 2OPQB 4QQBA 5IOLA 4KAIA 1NK9A 1FX4A 2GJFA 4TQRA 3SQGB 1MWYA 3TA2A 3M2UB 2D69A 2OPRA 3OUYA 1HD0A 3FRYA 1HNIA 4U96A 4RW7A 1G6BA 4LR9A 4LUBA 2UVVA 2GMJA 3HJFA 2ZDPA 3BSOA 2HIQA 4M8LA 1N34J 4NWBA 4NPOA 2Y1LB 3CE8A 3G82B 2HAFA 5F8IA 4FS1A 2NREA 3R97A 2E5HA 3S1TA 1HBOA 3RBXA 2ZH9A 4LF7J 2P8IA 2HNYB 3HMJG 3RW7A 1FX2A 2KU7A 4QCLA 2MGZB 2HHPA 2XULA 2C2OB 5L1JA 1YX2A 3OL9A 2HRUA 3OHBA 2R8JA 4RPFA 4FNIA 1RAIB 4QIVA 4LSLA 3GLJA 4OQJA 3KG1A 3CC7S 3CJRA 4BBYA 2YNFA 4NMLA 4CLUA 4KFBA 3QSYB 1FNXH 2KYXA 1Z4UA 3T5KA 1RAFB 1SV5A 4K4YA 1BQMA 3D6FB 5GAEI 1S72S 3MCSA 5KFHA 4Q44A 5H9EK 3I5AA 1S4FA 3MUVP 1KTQA 1JKHB 2DEJA 1V3ZA 1NBEB 3US5A 4WJBA 1FRJA 3MZIA 4J5OA 2ZBQA 1N52B 2HFVA 1LOUA 2RT3A 3SXLA 4P52A 4BS2A 2OEKA 1QVGR 1A7GE 1GTEA 1KVIA 3NBPB 1T9YA 4IFYA 1QY7A 2G0JA 4EBDA 2R7TA 1NCLA 4C0BA 1D9FA 3CDBA 1Q82T 1L3UA 4AL5A 1R8BA 4LFBJ 1VQYA 1TL7B 2VA2A 3TRGA 5KFZA 1YZ7A 4WFBQ 2R7RA 4CO1A 3ZTPA 3G8QA 4QIWD 1RE1B 3K5NA 4WP3A 2UUWA 3C19A 4IRKA 1FT8A 3ZTRA 4NLYA 3M6WA 3MOZA 1F9HA 3DC2A 2HNZB 2VJUA 4P72A 1RHRB 2B9XA 1TAUA 4RLEA 5HBMB 1VRTA 1XNRJ 1TZ0A 2VFSA 2HZAA 5J1EB 1UFWA 2GCFA 1AYEA 1JWWA 3CD5A 5JVGQ 3V81B 4RJVA 3EXYA 1WDTA 5MLCV 3NGDA 3D6TB 2HK3A 2DNHA 2XEXA 3NAIA 3V4IB 3TOQA 5A8KB 3HPOA 1ROFA 1Q0NA 1NKEA 4K5RA 1IWGA 4ECRA 3EPIA 1Q5VA 2DRDA 1R6YA 2C3OA 1X0PA 2A1BA 3T5LA 1H7XA 4RX6A 2A6OA 4AD6A 3JXOA 3M30B 3SSRA 2POKA 3DKDA 1TFWA 2YKAA 1NDLA 3CDEA 2RVJA 4EBCA 2NXJA 4F26A 2Y8YA 4FYXB 2IAJA 3MEGA 1F1BB 3QWPA 4RUBA 4I2QB 5M2RA 5C25B 1YJNS 1JLGA 4LRDA 3MXHP 1M1HA 2MTLA 3GILA 4KV8B 2ZDOA 1LV5A 1XMOJ 4GVLA 3KK2A 4FBUA 3K8VA 1T9XA 5E3CA 2MQPA 3FSXA 4NI2B 4ZP8A 1Q7YT 3FMWA 3VV2B 2JNJA 2R2SA 2C3PA 3OXGA 4LFAJ 2LU2A 3WX8A 3EICA 2M8DB 4EYHB 2ZOMA 2J0QD 4I6WA 4ED4A 4DR1F 2J8AA 5F8LA 3TQ1A 3G6XA 1C1CB 1RKJA 2BYCA 3BB5A 5E41A 1ZAWA 1KHWA 4DV5J 2AEFA 3E8OA 3B6BA 3DDKA 2DEIA 3UCGA 1LWFA 2C2RA 3UDEA 2ZC3A 1FFSB 5ETRA 1BHNA 5KFVA 2QMWA 2GVDB 2ASJA 3AD9C 1GFWB 5K20B 3NNCA 3MM9B 3D54A 2JH3A 2F7VA 3IG1B 1VLYA 2ZJQQ 3KDOA 2GNKA 1CVJA 5HROB 1D9DA 5J2NA 1UPMB 4DV3F 2XY5A 4ZDNA 1JQGA 2XY6A 1FKAF 4FDFA 1NK5A 3T1HJ 3GYXB 3GFZA 2LYVA 1HPZA 4OZ5A 4TY8B 3MR2A 2F8HA 4G3IA 1HA1A 2K2PA 4LVNP 3CCSS 1RABB 3VAJA 4ANEA 4ICLA 2WK4A 5K8MA 2I8EA 4KHPJ 1XMQJ 3R5CA 1LKZA 1S9FA 2IA6A 3HHLC 3M8QA 1R8CA 2ILZA 2ATLA 1RADB 3QLHB 4Q8FA 4NRUA 2DR9A 1UZHA 3HFKA 3S7RA 3L3CA 2H4YB 3CMES 1A6LA 5ETQA 1NUEA 2E1PA 4EYIB 3SSSA 1XIQA 4CH0S 4G1IA 1HW9A 3H2LA 2MJNA 1VK8A 3OTOJ 3HKZD 1V6HA 2W7OA 2HVEA 4FP9A 4BC9A 3EDQB 4JP8A 4I2PA 4CM0A 4R5PB 2P2CB 3LP0B 3GE9A 4NLOA 5LOQA 3UQSA 1BWEA 4DG1A 1RTDA 2DITA 4HTIA 4UOCA 3NGUA 1UW4A 5HO4A 2HRYA 2MKKA 1CC7A 2WVFA 3MMCB 4O3RA 4Q0BB 1RT7A 5A6WA 3E3XA 4MYTA 5KT6A 2ROGA 5F9LA 4URQU 1F6TA 4H4OB 1GX5A 4LBHA 2XYGB 4LBPA 4PKDB 3GV8B 1HWUA 2GZOA 4I69A 1CPZA 3IAS9 4YR3A 4KTQA 4USWA 1VIOA 1NJWA 1RAGB 3MM7B 5K8OA 4NA1A 5D8HB 2NUUG 3RG6A 1S12A 3FFIA 4IKAA 1IUJA 4ZVPB 2UXBF 3C6UA 2YX1A 3FMBA 2AQ4A 2KXNB 3QQCD 1EQ0A 2G2YA 2ZNZA 5T14A 2QA4G 1RXOB 4NASA 3Q2SC 2CJXB 2AJQA 3DLHA 3LANA 3H5SA 2CQDA 4I6AA 3MEEB 3LH2S 1PO6A 2Z2MA 4H4KA 4IG3B 4JI3J 5F8GA 3LQVA 3K57A 5DGBA 2RSQA 3FBEA 1NZAA 2BE2A 1NXIA 2ZH4A 5LSRA 2NZCA 1ZAXA 1ZTTA 4A48A 3MM6B 4CLPA 2RAQA 2I38A 3C16A 3VVTA 2FJWA 4I1TA 4AE5A 1MROA 4WIIA 3EPGA 3V6JA 5KG5A 3R6LB 4GKJF 1M5OC 1FRKA 5J2PA 3KJNB 2R8GA 5IWAF 1REVB 1RT3B 3T19A 3HHNB 1TK5A 1FDAA 1ZS6A 3E01B 3OR1A 1RA7A 5LMUF 1S9EB 1EX8A 5G0RB 3T6BA 3DOLB 1Z2ZA 1YBTA 2CQ0A 4OYWA 1XNQJ 3DYAB 4IG0B 3D6HB 4KGMA 2I5JB 4QYZK 2DNNA 3KJQB 1S57A 2ZHAA 3BO3A 4KC5A 3IS9A 2AJ1A 1T03A 2NSCA 1TKXB 3DGPA 2GHVC 3GIMA 2MLZA 1S0VA 2XMWA 4DUZF 2RS8A 4OZJA 5AXKA 2V63A 4X4RA 1UL3A 5EWEA 3EYZA 2HHXA 3CCVS 1WF2A 1TMMA 3SFGA 4UZBA 4DV7F 4NZ6A 4C11B 2LXFA 4FS2A 3LW5C 4NA2A 3MI7X 3HHLD 1NPPA 2MZSA 1I5OB 2RS2A 3AJ2A 5CZVA 2FVPA 4A8WA 3TUPA 2OFHX 1UJ6A 1J2VA 4JV1A 2YPYA 5C7PA 4NZ0A 5M2UA 4A8SA 3K59A 3WIUA 4QW8A 3LAKA 4YDDB 1OPIA 3BS9A 1KFSA 2MQNA 1FWKA 3VQSA 4GVBB 1S6PA 1WNEA 4IO9Q 2CQBA 1FO1A 3MMAB 4DN0A 5U47A 3Q8UA 2XZDB 3V5RA 2D3ZA 4DR4J 5RUBA 2EK1A 2ZWOA 3A8JA 2DR7A 3P45B 2YY3A 3DLGA 1Q79A 2XB2D 5K8NA 3MEKA 2QTWA 2VDIA 3HF5A 2FJEB 3KLHB 4I0WA 4DF8A 4UW2A 5D3GA 1DHMA 4BCAA 3PX4A 2VG6A 1TL3A 4O3PA 2CQIA 2LMIA 5KFXA 1JLFA 4M5DB 4USMA 3UD4P 1ZOTA 4DSLA 4B9LA 2K1RB 4LRCA 1X9WA 2YKQA 4WIQA 2B5JA 3JSMB 3C66A 2FIUA 7FDRA 3FUYA 3PHEA 5H9FK 4CLYA 4PCQA 5C24B 2VF3A 4DPUA 2NQPA 4JI1J 4CT8A 4YR0A 2QL5B 4RNFA 2ZVSA 3HX9A 4OZ2A 1X0FA 5KFKA 3CJ4A 2AIRB 5DDOC 4X4NA 3KJFB 4WE1A 5DM7Q 3R5GA 5H1SV 3C46A 2ADBA 2WONB 5E3RA 2MXYA 4CTAB 4DR3J 1K9MT 4Y2KA 1SH0A 1CQNA 2NPFA 1H72C 3RU0A 4ED2A 5HMZA 1VQ9S 3MR6A 3LPYA 5CZCA 1HBMA 1NK0A 4K2JA 3BR9A 3DDIA 2H1YA 1NDPA 1O51A 2UXCF 3RB3A 4ECQA 5KFSA 2E29A 3H0PA 3KFWX 2VBYA 5A8WA 4NCGA 1RAEB 1I6JA 1U6ZA 1CSJA 4X4TA 3KG4A 2IRUA 4CLFA 1D1UA 1TL5A 3FEYB 2MZTA 2GMHA 1TU0B 1VQ7S 3CD6S 3CJKA 1MU2A 2W9CB 3ZNUA 3K8WA 1WF0A 1IM4A 2W2NP 3KLGB 2KG1A 4D3HA 2JEFA 3RR8A 3HHKA 3ILLA 3HP6A 4DFMA 1FRXA 2B9YA 4OV6A 1HHTP 3KLFB 4OJGA 4URSA 4ILMA 5A0YB 3GP9A 2YWWA 3KK1B 1QSSA 1HYSB 3W1YC 2GJIA 1PC4A 2KJWA 1FE0A 1HBUB 1BD6A 5DDPC 5DM6Q 3C14B 2V68A 5T7LB 3CJSA 1BQNB 4K4VA 3EMTA 4JI8F 2R8HA 5GAGU 2B4VA 4ZJQA 4C9DA 3VGVA 1PSDA 4D3GA 5FD1A 2GO9A 4AFFA 1KFDA 5KT3A 3UDLA 1PJ6A 4F50A 3MDFA 2CRLA 1I51B 2XCAA 4ZN1A 1N6QB 2OPSA 4IFVA 2HQFA 3DXBA 4IRCA 1RISA 5D4OA 5I3PA 2I9SA 5KFOA 3EVWA 1EB0A 2VIHA 2OFGX 3TJAA 4P71A 4JYAJ 2WBRA 4IDKB 3QGIA 1T9TA 1N36F 1ZA2B 3EGZA 4C3KA 1SC6A 2O5DA 1Y9OA 3ZC4A 2RILA 3HDSA 3ET6B 3JSYA 2KO1A 4DDFA 3I9ZA 4U9RA 4W4MA 3SMZA 2D9PA 5HMYA 3BGOP 1OJ4A 2BM0A 2C3UA 1PC5A 3SYZA 1X8DA 3FGVA 2KT2A 3HXMA 3M8PB 4IQMA 5E2QA 3KHGA 3GONA 3DLKB 4NOHA 1LW0A 2NYIA 2BMBA 3CDAA 3EXCX 5CYQB 2VOOA 3JQJA 2BANA 3P96A 1XR6A 3UD5A 3CULA 1U2FA 4HYKA 3TEGA 1KLMB 2BW2A 3NP5A 3IRXB 2VFRA 1LNQA 1CJKB 2MLXA 2YNIB 3NY0A 1S77D 1V5IB 2OPPB 4DXLA 2LDIA 3TQEA 2CPYA 1V9OA 1JJHA 4ZIVA 4LF9F 4KPCA 1TELA 2DK2A 1FHTA 3W2WA 1RTJA 2KB2A 2IVYA 4OZLA 3RRHA 3BDPA 4WU3A 4OFZA 2OPRB 1VQPS 3OUYB 3SCLE 3O1LA 2HVHA 3ZZPA 4RW7B 2CJ9A 5FIIA 2E9ZA 2R7QA 2MHEA 3A13A 1TK8A 1IKVB 5E33A 3GG0A 2KN4A 2OUGA 1AXQA 3PACA 3CUNA 2PC6A 4KH0B 1OY8A 4QZVB 4CLLA 2QA1A 2GV1A 2CDQA 4MYUA 1S49A 3O3LA 3FK4A 1Y00A 1HBOB 5A6PA 2C2DA 1GQEA 2VZ8A 1E6VA 1NSKL 2DNPA 1OQ3A 2ZD1A 1MWZA 2L9NA 1CEZA 5ETOA 2XGPA 1SQFA 5G4DA 1ULRA 4KGKA 4LSLB 3D5MA 4MK8A 4Y2CA 2VV5A 5KFNA 4DV3J 2UVRA 1JMTA 2YNFB 1H74A 3D6MB 1I3OB 2RQ4A 1SV5B 3DCAA 4QWCA 3GIJA 3NAHA 1LEOA 4J9OA 3AH6A 3BSAA 1F2HA 3PO5A 4O3SA 3PJXA 2GIFA 4AYBD 4JV5J 1RKIA 2A2DA 4MKVA 2V69A 4C0HA 4F4KA 3VGUA 3T9NA 1HW8A 4N47A 2JEIA 5IFMA 1YJTA 2FHKA 2Z0GA 4YB7A 4O3OA 4CLSA 1WC6A 2PO4A 4OI4A 3QJLA 4XDDA 3AAWB 3BQ0A 3HKWA 3CEDA 1U24A 3NNAA 2H3EB 3CTRA 4CH7A 3GG1A 3GJSB 1F3VA 2XNQA 2HLTA 1T8EA 3WIVA 1RHUB 4IFYB 4CO5A 4EEYA 1KP6A 5B0EA 5DQIA 5GAHI 2RH3A 2DB1A 3HI9A 1JIHA 4WP8A 2YKNB 3FNNA 2NR0A 2AEJA 1CG2A 1NKCA 3ZZTA 3CO9A 2F3JA 4KHRA 2EKYA 2BKPA 1PYSB 4CO2A 2W01A 4FF3A 4B3MJ 3FBCA 3BBCA 2KT3A 2LDYA 4J91A 2VQEJ 3G96A 1URNA 2X3DA 3AJDA 2QA2A 4USHA 3H90A 3AXMA 3IAM9 1Y5LB 2MSTA 1JLQB 4WKRA 3TVZA 3C6TA 1VRTB 2R3VA 4CDIA 2H9ZA 4FYVB 1CS4A 3MPYA 3SCJE 4YY3F 1F2GA 5E0OA 4YS2A 1NHUA 2IMWP 4F67A 4LR7A 3H25A 1AW0A 4YDXA 1IQZA 4B9UA 4RW8A 2LQ9A 1XJWB 4B9VA 4FKYA 2AV5A 3LA0A 4AMOA 3HVTA 3TP2A 5DQHA 2V5HG 4EBEA 2QO3A 1UFLA 4FPIA 1KVJA 1R7IA 3OTBA 1K1QA 4PG7A 3VHQA 1VQ5S 4PQUA 1EIYB 1VJQA 1XN9A 3RTVA 5CYJA 4K0KJ 1OY6A 5F9NA 2O3DA 4XTTA 4R8UA 2IYIA 3OT9A 3LGHA 3PNIA 2ZH5A 1JXEA 5HATA 2VPWB 5CCMA 2BZ2A 2IAJB 3IM8A 2IBKA 2DGXA 3MEGB 4A8OA 2YX7A 3TVKA 1VQ6S 2Q43A 2DY1A 1JLGB 3W5YA 1Q78A 1SJ3P 5KFWA 2C2MB 4UOHA 1TVRA 3LP1A 4MIBA 3IGVA 1DURA 5DG8A 3KK2B 2EW9A 1U1OA 4ITSA 4HT5A 3MGJA 3E2EA 4DCPB 1L3TA 4YP3A 1U26A 3BH7B 1X4AA 3OR2A 4WTYA 1SQEA 5KFMA 3RB0A 2KG0A 2E44A 1HHSA 3GIKA 3MCMA 5GAEU 3DI6A 2VKRA 4XK8C 2XSFA 1RWPB 2HS0A 5IWAJ 2ZBPA 3CD7A 4FN5A 4ZCLA 4UTGA 2GIRA 1U8WA 5D4NA 2W8KA 2FUG9 3VVUA 5DQGA 3L9ZA 4U67Q 5CZXA 2EWHA 5KAKA 3QO9A 5DGAA 1LWFB 4JB8B 3V6DA 1RDRA 2WAQD 3OL6A 2C2KB 4OYPA 1HLWA 4ES3A 2AT1B 1N4LA 4OV1A 3R5DA 3BKTA 3PX0A 1TV6A 2C2EA 2GVZA 4ELUA 2W4PA 3A3NB 3NGKA 5J2NB 5DLGA 4P9SA 2G9OA 4DV7J 3M6UA 1FVQA 2AGPA 3MM5A 1X9MA 1BUXA 1X4EA 2O66A 2UU9F 2B8PA 2E7XA 1HPZB 1M1KT 3VF0B 2DJWA 4NLRA 3ZZRA 2RB7A 1BLUA 4LF1A 2KTQA 2YPZA 4ED7A 1OPZA 1YQHA 3Q8RB 2ZZTA 4ZLLA 3BREA 4DV6J 4N77A 1N5QA 3VTIA 2OO4A 4ZVTB 1NB2A 4NCAA 2BEFA 3W9IA 3M8QB 4O4GA 2ZFHA 2RUSA 3K58A 5BR8J 4C4WA 4PXCA 5CD4H 4LF6F 3TEHB 3EJMA 3QT6A 1KQFB 3BPSP 2XZWA 3FSYA 5K8PA 4ZVSB 2V4JA 2DNKA 1VJWA 1X5TA 3ZZUA 1S6OA 3AD8C 1N8RT 4IH7A 2ACYA 4F4WA 4I2PB 1KRPA 2YNGA 4ECUA 3GJQB 4ER8A 1YJUA 2QLFB 4FF4A 2W2QP 4DG1B 4BC7A 3OQ2A 2MZQA 1RTDB 4DQSA 4ZPAA 3ELHA 3LOUA 1T7PA 3RRGA 1WC3A 1HIYA 4DR5F 2R8KA 3DRPA 1M5HA 1RT7B 4J9PA 5KT2A 1QVFR 3B82A 4FVMA 1H38A 3W8GA 1IBLJ 3BZQA 4B3OA 1ZH5A 4ZP7A 1M5VC 2CPXA 4RZRA 4ECTA 4C8MA 4KJIA 1Y10A 1XBWA 1ZM4A 1RT2A 3FCWA 3K5MA 1RWWB 5GVQA 1H0HB 4A8QA 3CJ8A 3AA8A 4DQPA 1GMWA 1NO8A 3IA0A 2KDOA 4YB5A 3C6UB 2EFQA 2XHCA 1U1KA 4ZVRB 4JV2A 5F3TA 4LQ9A 2WVCA 1S5ZA 2M7SA 3NXZA 2NSBA 2IJRA 3F56A 3I0RA 2MKYA 4K7QA 1S0MA 1WTBA 1XTZA 2ATCB 5B0CA 2E5IA 4MK9A 1N54B 3UO0A 2R8IA 2HK2A 3N0VA 2DNYA 3R2DJ 1K1SA 3DDNA 3PW0A 4K4UA 2Z30B 3DLJA 2BE2B 3CMQA 1N34F 1X4HA 4CCHA 2ACMA 3ISNC 4RR5A 4WPAA 3H5UA 1O0PA 1GH8A 1TTHB 5F41A 1O5JA 1YK9A 3C16B 2PIIA 4NXMF 3PDNA 3HVAA 2LU1A 3DMJA 4HHUA 3OLAA 2BJ1A 2XBPA 3A8EA 1SB6A 2Z57B 5J2PB 5J2QA 1KR4A 2M2BA 4RNHA 3UR0A 1YBUA 2E7VA 5KFIA 4JI8J 2NXNA 3ILOA 3OR1B 2CQGA 1QDUB 3MTJA 5I3UA 2ZM6J 4FNHA 3ITHA 3R7BB 1NZ8A 5KFRA 4ED5A 3TW0A 2HVIA 4E8UA 4I68A 1RCOB 4LF5J 1C1BA 2PEBA 3EZ5A 5AXNA 4WFNQ 1RHMB 3J7A1 3KK3A 5EWGA 5EX0A 3IS9B 3K5LA 2M8HA 2XLIA 1T03B 2MEWA 3U27A 3DGPB 4ZKAA 1NJIT 4LQ3A 4WZQA 3DM2A 1RYRA 1CJUA 1N36J 3LO3A 4J9QA 2DNMA 2FVCA 1IKWA 4CO4A 3CIZA 3IM9A 1V3RA 2C3YA 2AYBA 4NRTA 1YG0A 4ZVUB 4OLPA 4PG4A 5AXLA 2MMYA 2K3KA 3D9BA 4LFBF 3PKYA 2F65A 1F5CA 2ZE2A 2IM0A 4BDPA 1RWOB 4OMFG 2ASYA 1HR0F 4P2MA 4DPWA 2BE9B 2LQBA 4LF2A 4KR0B 1N56A 2J7KA 4F0MA 2VUGA 1PBUA 4UZCA 4A8XA 1G3OA 4O3QA 3DLGB 2LLZA 3GPAA 1QTNB 1MMDA 4CQ1A 4LF9J 4W98A 1XNRF 1U8SA 3SDEA 4MKYA 3FCHA 2VG6B 2KHCA 1JLFB 1RUSA 5ETLA 1U49A 3H20A 2OJ3A 3Q8QB 3J80Y 1RWXB 3KMSA 2ZUGA 1CBKA 2JLGA 2B5JB 3ZTSA 3ONQA 4MJKA 4DQIA 4ZVEA 1BGXT 3P8BB 4C7QA 3MAQA 2VFTA 1WD6A 3CJ2A 3ZZOA 4KT0C 1FDBA 4C6AA 3KLIB 3W61A 5HQLA 2KFYA 2Y1IA 1X31C 2V9WA 1VC5A 2QG9B 4X4SA 1YRUA 1SIZA 2MPUA 1C4AA 4F4ZA 3GYNA 3QGHA 2RIJA 4ILLA 1B3TA 2FGOA 1LWCA 3PEJA 3NKYA 2Y0SD 2MKJA 3WBZA 1S48A 2K06A 4ZK7M 1HQUA 2HFUA 1P6TA 3QT5A 4OYZA 3V4MA 1HBMB 5JXSA 4QWDA 2CQPA 1W2BR 3IWXA 2F4FA 3NS5A 2QLJB 3ENWA 1RJJA 1SC3B 2FB0A 2XO6A 4B9TA 5A8WB 4NCGB 4EZ9A 5MAOA 4P7VA 3M32A 1OYEA 3TZXA 4LT6A 4PPDA 1RI7A 1G2EA 2OLWA 3D28A 1SL1A 4I7FA 3BN4A 3CJKB 1MU2B 1BY9A 3ISND 3D1HA 2PSZA 3W9HA 3G4SS 3G86A 1CQMA 5HL7Q 3TANA 5CHCB 1UMJA 4YR2A 5GMEA 2OIHA 2XS2A 5IC4B 2DNQA 4K8RA 1UAWA 4QPXA 2CUYA 4J9KA 1UJ5A 5JJBA 3F41A 3JQMA 1UVNA 1FDNA 2GGPA 3J7ZT 1NDCA 3Q23A 3UPFA 4HACA 3T5HA 2GHWA 3BH6B 4P2FA 4NZ7A 1HI1A 4DX5A 2BJ3A 4IR1A 3RAXA 4WP9A 4QBUA 4RNNA 3IXQA 2PGCA 4G1QA 4IOBA 1LW2A 4B9SA 3DXSX 2A3JA 4KSEB 3K89A 1VBXA 1UCNA 1MSWD 1H2VZ 2EVZA 3SEOA 1S0OA 1P9YA 4O23A 5CABA 1B64A 3TZWA 3J7Z5 4KHPF 4IFVB 1UA1A 2AMCB 1PYOB 4TYBA 4HI1A 4IH5A 2QLWA 5SUHA 4OI0A 4YY3J 4OYAA 2FPHX 4U7UD 3J81j 3D0GE 2LA4A 1TFYA 5EWFA 1U6BA 1AA1B 5AXMA 5L46A 1NNDA 4TN2A 4U8VA 4ED1A 1SPBP 4PG6A 3ZTOA 3LGMA 2J0WA 1NJZA 1S9GA 3GWCA 1NMEB 1P27B 2DH7A 3SIPB 4CZCA 2D41A 2J7WA 4X4PA 2E9RX 2RQKA 4Q2LA 1WEYA 3GU0A 4CWBA 3Q8PB 1S6UA 2B0GA 1Q8LA 1LXNA 5AE3A 1LW0B 2VODA 4OX9J 2MKCA 1G4CA 2LECA 2BANB 2ABYA 2YX4A 1U1RA 4ZN3A 3BR8A 1IBCB 6AT1B 1HBNA 1S4EA 1NKBA 2V8DA 1Q4RA 1YITS 1K73T 1HI0P 1D0EA 4JUZA 5DDQC 1YDLA 4AQYF 4GO5X 4H54A 1HNWF 3CCJS 4I4BA 5L1KA 1NH8A 2Q66A 1UPPA 4LSNA 3FSIA 1EAYC 2COLA 3W2WB 1RBLA 3N28A 3PKMA 2EBGA 4A46A 5T41A 1TL4A 5ETVA 1LFPA 1GEHA 1AUDA 2F63A 1FJEB 3ILJA 2HQCA 2KXFA 2D1CA 2FVRA 1RTIA 2XMVA 2RU3A 1N5YA 3X3UA 1VRUA 2BXJA 3NRBA 1WI8A 1FTCA 4OX6A 5EUHA 2VBWA 2M5YA 1FESA 1KEKA 4NEYA 2CZVC 2AJ4A 1E6VB 4CI0B 4E2FB 4JI3F 3G87A 5E7OB 2M9KA 2ZD1B 2JJ4D 1KSPA 5ITHA 1IBMF 4N76A 4LRBA 2HVDA 3PXGa 3UVJA 3T1AA 1UVKA 1T05A 4OHVA 2CIMA 2R42A 2LKZA 2BJ8A 2HNDA 2R7SA 2UU9J 4RUAA 1T3NA 1MW7A 4HL9A 5HSPA 2B56A 4OYIA 3K2YA 1PCAA 1JJ4A 1L3SA 4LRFA 2V8VA 1DLOA 3SV3A 2ZBRA 2FQQB 1TKZA 4DV2J 5KG6A 1GMVA 1SH2A 3UFCX 4QR1A 1XNQF 1UKUA 2DGVA 1NK7A 1D8YA 2J7UA 3L95X 9RUBA 1TKTA 4PRFA 1LFWA 1SH3A 4B3RJ 1N33J 3QNWB 1UP1A 2XTJP 3W63A 3HSGA 3CF5Q 4DMZA 4L3KA 1FXLA 2ZH3A 4PG8A 2BOAA 1T9UA 4IO1A 2OP5A 4USKA 3LTOA 2YH1A 2E1AA 4NLUA 2EKNA 3H2VE 5KFDA 1KNZA 1N5VA 2L08A 4IH6A 2AEMA 3CC4S 4ZLNA 2HS3A 3MPDA 4KO0A 2RDIA 3CDWA 2MQLA 4DR5J 1R8AA 2LA6A 1Z2LA 5M2PA 2FZGB 3UWTA 3Q8VA 2PMHA 1VQ8S 4DV4J 4J9NA 1Y5NB 3C6TB 2PA3A 2Q79A 3IMQJ 4GKKF 1NAQA 2LQ8A 4HHJA 2E1MC 2JLEA 4DBQA 1GXUA 4L3NA 1XC9A 1AT1B 1YIJS 5A2QU 2ILYA 1M0SA 2FVSA 3VAIA 2HIYA 4RW8B 3KNAA 2CYYA 2X1BA 3IBFB 1QUVA 3HVTB 4OHZA 2CQCA 4Q2MA 2ZBCA 4PQUB 4TLRA 2WB4A 3FC9A 4ECVA 3MPVA 3FBFA 4R8UB 3HO1A 3I6PA 3NMAA 2E7WA 1VQMS 5KFUA 3M8SA 4M94A 3ZNJ1 2D3UA 3QRRA 1X4GA 3DRXA 3T1YF 1ZM2A 3PIPQ 4QWBA 1CLFA 4JI1F 1TVRB 3LP1B 4HTJA 2EG1A 2DCLA 5B0GA 5B0FA 4CLTA 1Q8BA 1UETA 5EHHA 2UUAJ 3A12A 3KLVA 3OR2B 2ZHBA 5GADU 1N48A 4NXMJ 1FK9A 4DR3F 2F1FA 4NLWA 5FLXU 1S1WA 2OTLS 1Z1ZA 3DI6B 3P4UB 3T9ZA 3EWGA 5BYSA 5HN0A 2IYGA 2J8SA 4O44A 2J6UA 1SCJB 5HBMA 3AA9A 2N3OA 3I5BA 2RHQB 1HQ2A 4RBUA 1I1GA 2EXUA 3QO9B 4YB6A 2FLNA 4Z2XA 2E5JA 2NUHA 1WHVA 3Q8YA 1ZPWX 4PABA 4NXNJ 2DXDA 1WWHA 5GAHU 2V9KA 1VBZA 1U45A 2ERRA 1TV6B 1KQGB 4LBIA 3FBBA 1IR2A 2GVZB 1TAQA 4B3TJ 3MM5B 2CXEA 2KFZA 2GFFA 3KOAA 1OQ6A 1KDNA 2M0GB 3BGRB 3RRKA 4NLGA 1U0HA 1WJ9A 2XNRA 4UOFA 2UUCF 3N5FA 5B0AA 2E5GA 1NM2A 1UVLA 2GJ2A 1FRIA 1UVIA 9ATCB 4ZHRA 5CZDA 2ZJRQ 2B4UA 3PYEA 1B0PA 4FBTA 3A8IA 4ZVGA 1HR0J 3MFHA 3PX6A 1Q1KA 2V2VA 2WB1D 4OI6A 2WVDA 1SI9A 4O4GB 1NK8A 2W8LA 2KZMA 4L73A 5DETA 3RUBL 4DSJA 5EN1A 3UD3P 3PW2A 3DRSB 1VRQC 3G2XA 2QL9B 4GRSA 4IOAQ 1Q53A 2P9EA 4IOCQ 1J27A 4GO7X 4BWJA 1ZAVA 2V4JB 3O5TB 1UVMA 2NLWA 3HVRA 3TR5A 1RU2A 3ZZ0A 2CPFA 4JYAF 3Q24A 2HWIA 4C2MA 2D3O1 2YNGB 4TVAB 2UUBJ 2GVDA 1WSRA 3FZ2A 1RBAA 4P6QA 2DO4A 4K59A 1WORA 2BQRA 3SSQA 3L09A 1U47A 1SC1B 2AGQA 3QZ7A 4NMXA 4HDGA 2PN6A 2XYHB 3J81U 3H40A 3DRPB 1VQLS 1S1VA 2YVSA 4OX8A 4KB7A 3KUEA 5J2MA 4B3OB 5B0BA 1APSA 3MR3A 1QSLA 1U2CA 3G8TA 2H5IB 1FVSA 3R1LA 3Q89A 4DX8H 3H5YA 1HQEA 3OXFA 3LP2A 1RT2B 4LIWA 4ZJLA 1RAOA 5LL6d 1SL0A 3CCMS 3OLBA 3BGFA 3C2PA 5HLFA 4DFPA 4RW6A 3W2VA 4A8YA 4WKYA 2Z2ZA 8ATCB 3MUMP 3OFEA 1WKKA 4FYDA 3I0RB 2VPYB 3QRQA 4QW9A 3PR5B 4QR2A 3LPEA 1BXNA 1J5EJ 1WACA 2Y8WA 1RT5A 3JTOA 4TXSA 4Q45A 4QOTA 1W7WA 4ZLPA 2LVWA 3GFXA 4F8RA 5ETMA 1C2PA 1NPKA 3H2UB 3NOGA 3E51A 1OIAA 5ETTA 4QWEA 3LP0A 2EG2A 3HT3A 3U7JA 2BM1A 3HT0A 3M8ZA 3ENAA 1P8GA 3CC2S 1QUPA 1ZYQA 1S1XA 1R0AA 3DMJB 5C2GA 5DO2A 1U4BA 1FNOA 3HHDA 5J2QB 2RDDA 4Q0BA 4EO6A 1XERA 1MN7A 2MQMA 2G1HA 2YTCA 5IT4A 1QAYA 5I3UB 3DHWC 4AXJA 5F0UA 3ITHB 1KC8T 2DNGA 2YKMA 5DG9A 4DSIA 5D4LA 4TQSA 1PAEX 2LEBA 4E0DA 1M1GA 4G6VB 4NLSA 1C1BB 3N6NA 3CJ3A 1CJTA 4JV5F 3D0HE 4ZS6A 4NLTA 3TARA 4C8LA 2VBZA 2IC3A 1CULA 3KK3B 1WHWA 2JFKA 1GMUA 3M2VA 3TZYA 2QRRA 3MAAA 3DM2B 2R4FA 3QRPA 1CJUB 3DRYA 2RE1A 2CDRB 4MFBA 3DHXA 2RD5C 3RBEA 1B0TA 5KFBA 2JLFA 3MMBA 1IKWB 4USIA 3LUYA 3IO1A 4N41A 3ADAC 2RJZA 1RYSA 3POTA 5EGYA 2IDLA 2QV6A 4QIGA 2OEJA 2FYXA 5CXTA 1YBAA 3GFYA 3NS6A 2V8HA 2C2ZB 2HHHF 2ZE2B 2B4PA 4MKBA 4OYMA 5DJBA 2DNRA 5SZTA 1M5KC 1TL1A 3NCQA 1WKLA 1SJ4P 4B3MF 1K44A 3SZ2A 5AT1B 4F36A 2VQEF 2GAHC 1FJGJ 3QBCA 2P6TA 2CADA 3N5BA 1XEZA 1IR0A 3HULA 2Y0BB 4AQYJ 4I56A 2AHOB 3EGNA 1HNWJ 2OGUA 1AZSA 2Q6CA 2ASDA 3KTQA 3GJTB 4PUOA 3SDEB 1PG5B 3RBDA 3K0JA 2HHWA 4QWAA 3B8HA 2CWKA 1ZA1B 4NE9C 1DTQA 2IMOA 3DN9A 2VOPA 1UEKA 1QAXA 2DISA 2VDHA 3M9OB 3NGTA 3NMRA 2Z2YB 2XLKA 1L3VA 4DUTA 1J5OA 1KTVA 5KTQA 5ETSA 3WHIA 3Q0AA 4K0KF 3FDSA 2EBEA 2HMIA 3GQCA 2F4VJ 4PAAA 3Q2TC 5IV4A 4Y0FA 4RW9A 1LWCB 3MM8A 2ZC4A 2Y1RI 4P2XA 3MPUB 2RRBA 4WYWA 2MDAA 1XR5A 4DPYA 2P9GA 3GR1A 1HQUB 2AZ3A 4EUVA 4X62F 2M3DA 1EETA 3T41A 1P1LA 1IBMJ 2CQ1A 4DFJA 3TO8A 1UZDA 1FEHA 2GIQA 3R2CJ 2V50A 4GVBA 4ZA1A 4ETZA 2RMLA 4WFXA 4ZPDA 3M32B 3KKFA 2EFNA 2C3MA 2RUGA 2ZOGA 2NYHA 3AOCA 5HP1A 2HW3A 2MKHA 4I7FB 4CP5A 1YTYA 2ZKTA 2KH9A 1F9EB 2LP4A 4F02A 3F0NA 2X1AA 1ITPA 1RWUA 3THTA 2B7BB 2WVEA 5HJXA 4DOZA 4J37A 1RHJB 4ELVA 3QAEA 4DV0J 2VPZB 4WWSA 2DPIA 1R27B 1RZMA 3EX7B 3ZFVA 2FJAB 3OTCA 4DQQA 1HWKA 2AU0A 1Y4ZB 2RU9A 1B4SA 4ED8A 3M2RA 4TYAA 5I42A 2GGPB 5FDLA 1Y5IB 2UXDJ 4ILRA 5KFTA 1WHXA 4HACB 1I94J 3AQOA 3OV7A 2J6SA 2CQ3A 2HHUA 1RT6A 1F3FA 3RAMA 3DU5A 2KL8A 4R25A 2HHTA 2E5LF 4DZ6A 5D4PA 1JJCB 4G1QB 3JTNA 1LW2B 6FDRA 2HGLA 1D09B 2GS8A 4MIWA 3PHTA 3CVKA 2Z2LA 1K47A 4EO8A 3B4DA 4L6V3 4DV6F 4YB1P 1W26A 4L74A 3BKUA 1X5OA 4NYOA 2UZAA 1R0BG 2QE5A 4GKKJ 4ED3A 3CJ0A 4X64J 3ZO7A 3TAQA 2GQCA 4CT9A 1GAOA 3IBWA 3AB2B 5BR8F 2SXLA 2O01C 3MWBA 2PT0A 4A47A 4WFAQ 4QJVA 3MF5A 1C0UA 2DIUA 1JNRB 2WRMA 1QAJA 4RWXA 4ERDA 4ZIWA 4B9MA 2YWGA 4CLWA 1PAUB 1S9GB 2A0FB 1FA0A 2IJNA 1FXDA 2IM3A 2ZNYA 5D6GA 1N32F 2X51A 3ZXWA 4WF9Q 4ZP6A 4FF1A 4X4UA 1N88A 4K4ZA 3SFUA 3T1YJ 3D2WA 2V2QA 3VAHA 1HBNB 3C14A 3H5XA 3C15A 1BQNA 4ZLJA 2KJVA 2F40A 2RQCA 2WZ1A 4LF4J 2OMOA 2N4CA 3D1QA 3DOKA 1LXJA 2W7PA 4B9NA 1V3SA 1IBLF 1LWXA 1GK8A 2MSSA 4PWUA 2FY8A 1FXRA 4AL6A 5L1LA 3CWJA 3NEKA 2QIFA 1RTIB 3H8YA 3DNCA 2A6MA 5A76A 1N5YB 2GAGC 4IDKA 1VRUB 3IN5A 4EFAC 2HLUA 2V8PA 4I6YA 3B4MA 1TUGB 1JLCA 4OZNA 4NEZA 3N9UC 2JC1A 3WZ0A 3UR3C 1JX4A 3M05A 1HD1A 4K4TA 1GTHA 1AFIA 3BM7A 1EKSA 2FGCA 2XMMA 5IXUA 2PA8D 3HK2A 1KHVA 4MK7A 1NSPA 3UVJB 1YJ9S 1FERA 1T05B 4KQZA 4K4SA 2WSEC 3W64A 3QGPA 4LFCF 2HNDB 2DVIA 1REGX 2UUCJ 4B02A 2EI5A 4ECZA 3K5OA 3W65A 4F3QA 1UEVA 2CG4A 5LM7E 4NYPA 4RUHA 1HNXJ 1KD1T 4MAKA 4K4XA 3N79A 2CNKB 1OMSA 2I2YA 4OYOA 3FCVA 4MKAA 4PYDA 4Y00A 4UY8T 4TLQA 5LSOA 4L75A 2V34A 1FFWB 1DLOB 4JI5J 2CJAA 2ZM6F 1Q7LB 2NPIA 2G2OA 3NWRA 1TKZB 2CPJA 4J9VA 4DWIA 1DQ8A 1O8BA 2GO8A 5HMXA 3Q83A 3DLEA 4LF5F 2XLJA 4B3SF 4ZVFA 4J90A 1RT4A 2WW4A 1IKVA 1TKTB 5KFFA 5D77A 1NLKL 2QFIA 1X4DA 3M9MB 1YGYA 1EKRA 2KT5A 1VCTA 2I1RA 3TA0A 2W2PP 5LXYA 1SKWA 3UN5A 2B7CB 2MJUA 4OZ3A 3MMJA 1M90T 2Y1JA 2WW8A 1T11A 1IR1A 1U02A 4UY85 2BE7D 2XM3A 3V2UC 3BF4A 4AMPA 4CRJA 4ATNA 3IBCB 1H7WA 2CVIA 2H54B 4ZCMA 3VAKA 4J9SA 4URGA 2IPOB 4GC7A 4C98A 5F8NA 1LQ9A 1VGYA 4KO0B 2R7UA 1X60A 2QGFB 1VDHA 2C28A 2P5VA 1MNEA 2LCWA 4K2XA 2GW8A 2ZKUA 2OMLA 2B51A 3GMGA 5F3ZA 4WFZA 5KT7A 2VFUA 2C1EB 1OWXA 2E66A 4C3LA 2OAUA 3I5CA 3TUIC 3EVOA 2DTJA 2B9WA 2X7IA 2DIVA 5I4MA 4OHXA 4F4YA 5D78A 4KYZA 1FNMA 3N01A 3MUTP 1VC0A 1NK4A 4OYXA 2BQ3A 3PV8A 5E5NA 1D3WA 5KFLA 3GIRA 4HH0A 1HNIB 1VQNS 3RGIA 5F0WA 1T9WA 2BDPA 3KWMA 1NDKA 4AMNA 1HARA 3IWNC 5C5JA 2YKNA 1N5SA 2AJFE 4DL6A 3KLEA 4J9MA 1KQKA 3OSPA 1WELA 2FHJA 4JI2J 1IKYA 3H7HB 1MMNA 3W8PA 5JVHQ 2UV8G 2AYGA 4DLGA 1S59A 1GMWD 4FPRA 4F2RA 2RNEA 1S1TA 4TKTA 1FK9B 1U1NA 4PR6A 1S1WB 4M5JA 2BUNA 1XMBA 2VQFF 2ZWPA 5AE1A 4O44B 2PDAA 1RHKB 1JLQA 3QGGA 4B08A 2IA0A 5LXRA 4R0JA 2JX2A 2CPZA 2XCPA 1ZBTA 4LJMA 3X1LB 5GADI 5A8RA 4KFBB 2H65B 4U7UK 3NOCA 4EK2A 3OD2A 1BQMB 1MN9A 4ZPBA 4OX7A 4DF4A 1WTFA 4O4RA 2O67A 4ID8A 2VASA 3I4PA 3GCXP 1VHFA 2FDNA 1YRTA 2MZ1A 4X4OA 2WTFA 2CNNB 3UCUP 4DR7J 1QTMA 4J9RA 1Q8KA 2QJ3A 1HFEL 2B6AA 2JOQA 1NPRA 2M4MA 3EM1A 2BW7A 4KIAA 2W24A 1HNVA 4C8YA 3OTDA 1FD2A 2DNLA 1U0HB 4JI0J 3SI8A 2ZOFA 2DO0A 5HJYA 1FKOA 3SCIE 3MECA 2H4WB 4MIAA 2LQJA 2HWTA 5J1NA 3ETOA 4N8OA 2QL7B 1N0UA 4ZHRB 2HHHJ 2H48B 3UI3A 1ZM9A 5K5MA 3A3OB 4M5GA 4O0IA 1U1PA 5KT5A 3QT7A 2IBOA 3TX8A 3OVBA 2M88A 1SBRA 3MPWA 4YQWA 2LEAA 2APOA 4IQXA 1YI2S 1TMJA 3LAMA 5DS7A 3HSDA 5KG0A 1HI8A 2IFXA 2BJEA 1HWJA 5CH7B 1F9FA 1Q5YA 5DG7A 2G4BA 5E3QA 4S0MA 4AL7A 2OH2A 2QN6B 4PQAA 2UUTA 1WOSA 3RJMB 3CCZA 3AT1B 3O2IA 3FKBA 2BKNA 1WG5A 3HSJA 4FYWB 3EUNA 3PR4A 4YHHF 1WOPA 3QSIA 2HHQA 2L41A 1T0TV 3AOAA 4KHMA 3VAMA 2Q3PA 2RF2A 1YJVA 2XMJA 3FQLA 2NXCA 3CXCR 4Y3CA 4UUWA 2MKIA 5DZ6A 1G1XA 4BLGA 3P3DA 2VG5A 2VG7A 4DSFA 3TAMA 3PZPA 4WXWA 8RUCA 1S1VB 2C2NA 3BBFA 2CZ9A 3G6VA 4NLQA 4ZVQB 3VQTA 1WUUA 4OX9F 3MTKA 2YQ1A 1C4CA 3PEHA 4QIEA 1RK8A 2DH9A 5J2MB 4M5KA 4F0HA 1NH7A 3QT8A 3PJWA 4X62J 4J7CA 1AB8A 3PJ9A 3NGSA 5AJ3F 1HQEB 5KG1A 2HPUA 3LP2B 5JMNA 1FRLA 3HJVA 2AP6A 4U7CA 1DZ5A 1FWPA 3CCQS 3D0IE 3R6GB 5HLFB 4PXEA 1JB0C 3RZAA 4RW6B 3W2VB 2FZKB 2ZUAA 5EDWA 2QX0A 1E6YA 2AZ1A 2N7YA 2L9WA 4PWDA 4ELTA 3BQ2A 2JRSA 4K5SA 1RT5B 2B43A 1AUSL 4LVOP 3OFHA 3ZZYA 3TX0A 3M1VA 1RTHA 2VC0A 2D74B 2FLPA 3QJJA 2VJVA 4ID5A 4FXDA 1X4CA 2F5GA 4WK3A 1JXLA 2Z8QA 5LMNJ 2DT9A 3MD3A 1EJ7L 6FD1A 3AFGA 2E1RA 5D0HA 2RDJA 4F2SA 1SKSA 4X66J 1O6XA 3AY0A 2LXIA 1S1XB 1R0AB 5H9EJ 2HBQB 1EQMA 4DR6F 3LWLA 3PYDA 1S1UA 4FF2A 3H98A 5LT5A 2V6AA 1IJEB 3D1OA 1YWXA 2E5LJ 2CWXA 3DLLQ 1JLAA 1KBRA 4HDHA 3P6YC 4DV1F 1YRXA 2YKMB 4QU6A 1U2RA 1TQLA 3IFEA 3R3TA 1XWLA 3OPKA 2PFDA 1AFJA 3EGVA 3OBIA 1FEEA 2DHSA 1CJTB 1JLEA 2NS1B 4ICLB 1BMQB 4KE5A 2JZ5A 4X65F 2DNOA 1Q95G 3PYFA 1HWIA 1RACB 5IM0A 2NCKL 2IC3B 1CULB 1RT1A 2GC8A 1GXTA 4OJ3A 2B3TB 3M2VB 1U09A 4ANDA 4DV2F 3MAAB 2V0NA 1VQSA 2J9EA 3HLUA 4M5HA 2OTJS 1VBKA 4MFBB 1PBAA 2N7CA 4DL5A 2N82B 3CCLS 3MMBB 2VICA 4L72B 3WC2A 1L3KA 3ENQA 3POTB 4B3RF 2J76E 1FCAA 4DUYJ 1N33F 4EGLA 2KM8B 4X2BA 3PFOA 1G7CB 2LXUA 1IBKJ 2KFNA 4ZP9A 2DGTA 2QZ8A 1YJWS 3R27A 1WG4A 4RNOA 4HLBA 1N32J 2BABA 3I55S 2ROPA 1TL1B 2ZHOA 3UDCA 2QYCA 2HRTA 5KFYA 4F4AA 1VC6A 2XMKA 2BRKA 2CNLB 4PYAA 1F60B 3QFHA 4FYYB 1SUQA 3JYTA 3UN3A 4N56A 3J7YI 4DL2A 3I87A 3VR1A 3UNGC 5KG2A 1TKDA 1DY3A 4DV4F 3MHYA 1OSDA 2K7KA 3S6EA 1AZSB 2DR5A 4PUOB 1YVFA 3M8YA 3JSRA 1FFGB 2ZH8A 2XMUA 4TNOA 2ZBIA 1RAAB 3NNHA 2ZZNA 1NEEA 1S6QA 3Q8SB 1DTQB 1GT8A 2FHMA 1WOOA 4AXIA 1S99A 4XPCA 2YBVA 1U48A 1DARA 3QZ8A 4LF8F 1UEUA 1EARA 2EFPA 3KUGA 3QPIA 1JXVA 3FFIB 2V4QA 1IKXA 1J5OB 2JVRA 3H4DA 1DJ0A 4H4MA 2JEGA 4Q5VA 3MURP 5CCLA 2HMIB 4EU0A 5KFCA 4JI7F 3BEGB 3ENVA 1RQ0A 4RW9B 4K4WA 3MM8B 2HSEB 3BQ1A 3W9JA 2J5AA 4HR2A 1DTTA 1WC5A 4HT7A 3I0SA 4CYUA 2OELA 2G1DA 1EETB 1SJQA 4N5SA 3NWGA 2DRAA 3FEZA 2YXLA 2QMXA 5CAAA 1HNZJ 1QLNA 2V8GA 3RBZA 2R2RA 1DAXA 3M8WA 2UUAF 4KY3A 4ZPWR 2KVIA 3UNYA 4LFCJ 3R5JB 5ADZA 4PXDA 3AB4B 4DR2J 5AE2A 3CCUS 1RWMB 2Z58B 2H5EA 1FDDA 1DQ9A 4JBCA 2UVWA 1MROB 3HZGA 4YN3B 1NHKL 5HP1B 1IXKA 1JLBA 5L1IA 3VZHA 1QSYA 2DNZA 2FLLA 1F5BA 3QIPA 2HQIA 2KKHA 1H98A 4QYRA 4DQRA 5F8HA 2Y9HA 3FEXB 5KG7A 1RAHB 3SCKE 2DXEA 4R0EA 1HKAA 2ZH7A 1EZZB 3CCTA 5C42A 3KG0A 4B3SJ 5HVFA 4ZMMA 2HG4A 3BYRA 1YZ6A 1KKHA 3M2RB 5K14A 3ULHA 5I42B 2HFSA 5FDLB 2IY5B 1SXLA 2W9BA 5EX3A 3KHLA 2VBXA 1MWQA 4BHQA 4OI2A 4YOEA 1UVJA 3KMQA 4NXNF 2WVBA 2JHEA 3I4HX 1RT6B 3KLIA 2HWHA 3T6JA 2G13A 3HFZB 4NLPA 5FJ4A 2FJBB 2GA7A 1RSCA 2J9DA 4GC6A 4B3TF 4OLOA 3TWZA 2XMTA 4EZ6A 1ZZNA 5F8MA 5KFQA 2F8EX 4C0OC 2K8GA 1CC8A 5KOXA 3DOMA 3KJVA 4Y2IA 3WQPA 3GYGA 2HURA 2HQ3A 4AMMA 4LRAA 3HFVA 4JV0A 2IVFB 4DL3A 3DRRA 1FKPA 1KOHA 3FZBA 1S6PB 4N7TA 3CIMA 7FD1A 2CVEA 3PRVA 1SJFA 2HHSA 2HGNA 2V2ZA 1LK7A 1C0UB 5L9NA 1URRA 1VBYA 3GIIA 2XI2A 2XWXA 5D0RA 1VS3A 1Q86T 5D3GB 2YWHA 1TL3B 3BSNA 4NCBA 1UFKA 3OSNA 1W25A 2WCXA 2I6WA 3VGTA 1CJVA 1VK3A 3NGRA 5HMWA 1EHWA 1ICEB 4XIUA 2UUBF 1LK5A 3PCOB 2XSJA 3A1YG 4Z7CA 2KRBA 2Z56B 3GSIA 1P1TA 3OJSA 3AXKA 1WDDA 3GR0A 2UP1A 3C15B 2OHDA 2MB0B 1K0VA 2FC8A 3OFFA 3G6YA 2BR0A 2MY7A 3NL0A 3G6ES 4WE1B 3LGNA 4UF4A 2IHR1 4JI4F 3DOKB 4M63A 1R8HA 3OXLA 2IRYA 2DHAA 3B78A 4USUA 2DD8S 3MEDA 1UA0A 1OO0B 2ZJPQ 1SKRA 3OJUA 3M4XA 2VQFJ 2FC9A 5IQQA 2CNOB 4DS5A 3VWSA 4WCEQ 2V94A 4ECSA 1S97A 2B4OA 1K0TA 2XG8A 4UUXA 2GQQA 2OI2A 4YEAA 2JWNA 2PFFB 2JEJA 1YJ7A 4ES1A 2HKEA 5CYMA 4ZVHA 2MQ8A 1TR0A 2XS5A 3OW2R 5D0GA 4OIXA 1ACMB 2AYEA 3BBBA 5KT4A 4DL7A 3N6MA 1JLCB 2BV3A 3NCPA 1J5EF 2VONA 2CJBA 3V6HA 4JOUA 3NLCA 3CDUA 2QYGA 1WI6A 4DU7A 1OS5A 2W7AA 4LMZA 4OZ0A 4Z7YA 2CA9A 2GX8A 1WKJA 3W60A 2D9OA 3W3SA 2CQ2A 3PY8A 2R9LA 3NS7B 4JI6F 3QFWA 4K50A 1VQKS 1X5SA 4C8KA 4YMEA 2DGOA 5GMKa 1FD8A 4QYZJ 1OSCA 3PW5A 4ANCA 3A3PB 3ZZZA 1GX6A 3Q86A 2H51B 3D67A 1RWKB 2FHOB 4OI3A 2DGWA 4DCOB 3BJYA 3HD2A 3L7OA 3CCRS 4DR1J 2XHWA 4P75A 3DLEB 1SC4B 2QMUB 4DEZA 4NLXA 2MZRA 2WSFC 2WOMA 1RT4B 1L5UA 5L8RC 3JQKA 4ZOSA 4F3MA 3C3LA 1HWLA 1A9NB 1ZM3A 2OPSB 2BJDA 3DU6A 2LQ5A 3F44A 2RQMA 2QSFA 4YHHJ 4WU2A 3DLBA 2VPXB 2FJDB 5KFPA 4DX6A 4OHWA 3CCWA 5IZHA 5K9FA 3G8SA 4U6PA 1P9QC 3R9LA 1F5AA 3FQKA 4WXOA 4P10A 4UT4A 4ED6A 2QLBB 2PI5A 2KM8C 3PFEA 1EP4A 2KYZA 3QATA 2QSWA 1QE1A 5KFAA 3IR6B 2YQ0A 3JSBA 2WHOA 2KXHA 5CA5A 3TVYA 4ECWA 3I56S 2XO7A 4BWMA 2ALZA 3W66A 4Y6IA 3RB4A 2CJYB 4M5NA 4PPZA 3J7AN 2MY8A 1YLXA 1D9AA 4M5LA 3GFHA 5JUMA 2MQQA 2AJ2A 2X1GA 3CB4A 3CCES 5AJ3J 4RKUC 3D7SB 1FJGF 2U1AA 5H9FJ 4J9UE 3EGWB 4KKOA 2JDJA 1WHYA 3TNVA 2HS4A 1FTRA 1VOMA 1RA6A 1UJ4A 2HGMA 3HHLA 3U1NA 1RTJB 2DY9A 1WEZA 2DYAA 2XYPB 1HL6A 1Q8IA 4DHVA 4G65A 2X1FA 3JAMU 2HFNA 1KWMA 2PMWA 3H4BA 1KLNA 4OHYA 4ZPVR 2ZZMA 4UQTA 3O6QA 2JL9A 3KLEB 4FVCA 2CQ4A 3BO2A 2RKIA 4RW4A 3J80U 1UWBA 4DFKA 1HMVA 1ELOA 1YJRA 1IKYB 4ZPTR 3IRWP 1K8AT 2F4VF 2V2KA 4H4KC 5KFJA 2FTRA 4CM2A 3QYYA 2BJ9A 3DFEA 3ICLA 3O44A 1S1TB 2YNHA 4PEOA 3PW4A 1R43A 1LWEA 4ENOA 1IWAA 1GXLA 2IDEA 4DR6J 2W4CA 2BKOA 3D3CJ 3A4TA 3WX4A 1U1LA 1FJCA 1C0TA 5HVHA 1VQOS 3HD1A 4ETXA 2UV8A 5A8RB 2P6SA 2PD1A 4IRDA 4DS4A 5BYRA 4DV1J 2HBYB 4KBIA 3D68A 4HKQA 4ALZA 1RGVA 1IM6A 3L7PA 3FJ2A 1R31A 1Y3KA 1FF2A 2AF6A 4FZVA 1WSVA 3N4WA 2DHHA 2CKWA 2VHGA 2OD6A 4X65J 4Y34A 2OPQA 1OYDA 2W2MP 1X5PA 5HQ8A 2UXBJ 4AT1B 2AX1A 1ZPVA 1UTAA 4V19J 2K3IA 4DV0F 4ZJOA 3SQGA 4NX9A 5HAOA 1Y3JA 3OTEA 3M2UA 3FVYA 2B6AB 4PZVA 5HI7A 1Y0HA 1HNVB 3VAFA 2GMLA 4DLEA 3CSKA 2IJFA 2J9DE 4ED0A 1Y7PA 3M8RA 1FKOB 3MECB 5L39A 4ZITA 2UXDF 4QPTA 3GSDA 3MOJB 2PEHA 1X7VA 1I94F 2ZVIA 5I3QA 3G82A 4ECXA 1ZTWA 1S76D 5F8JA 1NK6A 3WDOA 3D4JA 2HNYA 1T3OA 1XQIA 4EI2A 2MGZA 4TU9A 1VLOA 3KUHA 2D3OR 5IT0A 3PYGA 2KZZA 4GKJJ 2AD9A 3PW7A 2IVMA 1TK0A 1T02A 2BRLA 3ETMA 1BQXA 1SJRA 4EWTA 2R7VA 1RCXB 1R0CB 5LMUJ 5DZ7A 2ROEA 2JC0A 2MQOA 4B17A 3KDNA 2VU5A 1QM9A 3HSZA 3CNQP 3MFIA 5D0EA 3R7SB 4X64F 2AGOA 1JK9B 1CS4B 3QIDA 3SBMA 1PIEA 3R1HA 4W90B 1B70B 1QD1A 5ETNA 4OI1A 2RF2B 1VYAA 4RNMA 4F0KA 2DRBA 1JKHA 1OY9A 2FY1A 4LF8J 2DCUB 4N8NA 4DJBA 1VFJA 4XAKA 4A8KA 3B54A 5B09A 4ES2A 1MMLA 1RAJA 4DUZJ 2VG5B 1VR6A 4FXVA 3CJ5A 2VG7B 3U1MA 3TAMB 2L9DA 2HYIB 4JI7J 3NBPA 3GB0A 2BX6A 3BGRA 3W5XA 4DSKA 2K7JA 3UW1A 1RB0A 1KVKA 2YWEA 2XGQA 3F73A 4OYBA 4Q43A 3UDVA 4DX7A 3T3FA 3R8YA 2GQ2A 3JTPA 3M9NB 2J6TA 1RBOB 4NLVA 1TL7A 1KN6A 2E1CA 2ZH2A 4OZ1A 2KRRA 4LR8A 4O0NA 5LJ5Y 4LF4F 2ZH1A 4RL1A 4M1KA 4RWWA 4DSEA 4HHHA 1E6YB 4F7VA 4PWDB 3IWLA 3OL8A 4Y2MA 3DRSA 4F25A 3THVA 5HANA 2HNZA 1YHQS 3ZTQA 4DN9A 3R5BA 1WEXA 3TJ9A 4KPYA 2L3MA 1VHIA 5L38A 5GMDA 1AROP 3AODA 5J1EA 3M1VB 1RTHB 4ID5B 2YKPA 1XK8A 3V81A 2RHSB 1S0NA 1U25A 3V4IA 3OFGA 2J0SD 1H73A 3TAPA 1MG7A 3V6DB 5A8KA 5KFEA 4IUFA 2GHPA 2XWYA 1BWVA 4TY9A 3AJ1A 3U1LA 3NG8A 3I32A 4ZCKA 2O1PA 1PILA 2WSCC 1S1UB 2YWFA 2DGSA 1Y11A 5IT9U 4WK1A 1X4BA 4V1Ak 4KGXB 3M30A 2BQUA 1U6FA 4NYZA 3JS9A 1N0VC 4P74A 3CMAS 2CJQA 1JLAB 4DL4A 4A8FA 5BJRA 1HHQA 4I2QA 2R7WA 5C25A 5B7WA 2BBEA 3TA1A 1RLDA 4KV8A 1HNXF 3UCZP 2DBBA 2UXCJ 1JLEB 1RWNB 3IR7B 1RTZA 2AWZA 5DDRC 2W4DA 3I82A 1KS2A 4NI2A 2WBMA 5IM0B 3VCDA 4M5MA 3GV5B 3D3BJ 1RT1B 1B7FA 4JI5F 2Z4PA 3TI0A 3AD7C 3BDEA 4HI2A 2V67A 2RRNA 2OSQA 4MT1A 3MR7A 5KG3A 4QU7A 3W7BA 4U95A 3P5BP 4P2SA 4NL5A 1UWAA 1RHQB 4ZCIA 1C1CA 4HH1A 4UOGA 3LF0A 4IYQA 4PWWA 3QJPA 2HZCA 2MHNA 2FVQA 2HFOA 3I31A 4XPEA 5LSLA 4L76A 3HHEA 1V5VA 5LJ3Y 4PG5A 3BN7A 4WTOB 4LF7F 1SJ1A 3PM9A 2VKZG 4NA3A 4USJC 3VALA 2M52A 1NB7A 2C22A 3MM9A 4CNZA 1ZZFA 4LSZB 1PYTA 3IG1A 2CAJA 3VZIA 4QIFA 2PI4A 1SUQB 3ILIA 3JYTB 1NHVA 5HROA 4U8YA 4DI6A 3CGIA 1VI7A 4JI4J 4TY8A 2DH8A 2DR6A 5CD4A 2EEYA 1R6VA 3K7RA 2ASLA 4DU8A 1S6QB 1FRMA 1U1MA 5BXIA 2W9AA 1BE4A 2VFVA 4F4XA 1IQTA 4C3MA 1VIXA 1H2TZ 2CPDA 4C8NA 1BC6A 1IKXB 3QLHA 2P9CA 3MR5A 2C42A 4H4MB 4E98A 3QMQA 4FKXA 2V4RA 1NSAA 1KONA 4CNYA 1WC0A 3PVXA 2EPIA 3BGLA 3TUJC 3GZ7A 2HVZA 5IS2A 1DTTB 5THWA 1FE4A 4CLZA 1D8ZA 4USTA 2CFXA 2IIHA 2BVZA 3I0SB 1X4FA 4CYUB 2HAIA 1IN0A 4KGZB 4X4VA 1TP7A 4I64A 4R5PA 4JI2F 3OVAA 3EZOA 2YWKA 3IGNA 3KXDA 2EFGA 3M7VA 1PGZA 2YQ3A 3QWUA 5L9XA 1RWVB 4ZPCA 3W5ZA 4ECYA 8AT1B 4JI6J 2ZEJA 1X9SA 3UE2A 5DRKA 2N3LA 3MMCA 1JLBB 1B0VA 3OHAA 3JAMY 4XO0A 3H42A 2W2OP 2Y3YA 3QIPB 5IC6B 4H4OA 4G1PA 1T95A 2FZCB 2Q1LA 1H3DA 3CJTA 1ZETA 2FJXA 3IP0A 4OJ1A 3PIOQ 2DHGA 2R7XA 5C42B 2XI3A 2XQCA 3MM7A 1DBDA 5B08A 5K14B 3S8SA 1VMBA 2W9BB 2DPJA 5ETKA 2ZITA 5IV3A 4DR7F 2DGUA 4A8MP 2CG8A 2ZH6A 1H2UX 3CD0A 1DQAA 3CW2C 1YKWA 2QT7A 2EFOA 2QFJA 3V6KA 3TYTA 1FRHA 5KG4A 2HQGA 2DHXA 5C2CA 3MEEA 1DFDA 2VH7A 2VC1A 3AQPA 4IG3A 2XZTB 4JI0F 1KOOA 2FD2A 2HBRB 4LIRA 3PG9A 1R89A 4RO0A 2R2UA 3HZEA 1SL2A 5KFGA 2F9JA 3K17A 2VD3A 1XMOF 3DOMB 3KJVB 1S79A 2Q6BA 3MM6A 3J7YU 3EZUA 2W1BA 3M6VA 2HBZB 2FLOA 2DR8A 2IM1A 3PTWA 4QR0A 4IR9A 3MCOA 2DGQA 2NZ4A 1WC4A 3DRRB 4LFAF 1FKPB 4W92B 2CJKA 4CO3A 2LEPA 1DRZA 1REVA 4MMOA 1RT3A 2G0CA 4KH1B 2KHDA 3E01A 2JSXA 2KI2A 4I67A 1S9EA 4HEA9 5G0RA 3DOLA 1MLAA 2BACA 1TUVA 4GMKA 3P5TL 3TJ8A 3AOBA 5HQMA 3VAGA 4DV5F 4DZDA 3RYLA 3DYAA 5DLFA 3BSCA 4C97A 3IR5B 4F04B 4IG0A 2VA3A 2MKSA 2QA4S 4RU2A 1CJVB 1M5PC 5E3PA 2RRAA 2I5JA 2U2FA 5ETPA 2HZVA 2UVUA 2D7SA 2XSJB 1SIWB 2HHVA 2OSRA 1S10A 1TKXA 4OL8A 5B0DA 2VB6A 3IC1A 4DPTA 2ALYB 3BO4A 3RB6A 2CPIA 1NRKA 2XC9A 3MAHA 1U1QA 1UW9A 3GJRB 3N6LA 1NJXA 1B99A 4C11A 4Y2AA 1WG1A 3EVMA 1SVDA 2VL1A 4KGVB 3T1HF 3HVWA 4DCJB 2R7OA 3MEDB 3CPWR 4O3NA 3AHPA 1F0XA 5A2QY 2NXEA 2DKOB 4MH8A 3P49B 3Q22A 5GAGI 1XMQF 1JNZB 3NCRA 3PO4A 2QLXA 4CLKA 1FWLA 4USVA 4Y65A 4F3OA 3BGUA 4X4QA 3VGSA 5CYMB 1RLCL 2A18A 3CT9A 3EDRB 3HCXA 1NSQA 3MMAA 1A0OB 4WYLA 2B8QA 2DXFA 2VZ9A 5KOWA 4RBTA 5BYQA 3G71S 2FHJD 4YUDA 1SQGA 2R2TA 5D15A 2YKOA 3M6XA 2MLYA 3KLHA 1RP5A 2IRXA 4EMDA 3KYLA 3LWMA 3SQOP 2LFVA 3BPDA 4LREA 4C8ZA 4M5DA 4RBVA 4Q8EA 2X3GA 3OTOF 2W25A 2CQHA 3QAUA 2BJ7A 4A4JA 2K1RA 2OEMA 3MD1A 1RU1A 5LMNF 4WZMA 3JSMA
chains in the Genus database with same CATH topology
2G2OA 2VZ9A 3CJ8A 5CZCA 4RL1A 2HG4A 3PTWA 3R8YA 2JFDA 3SBMA 2QO3A 2QC3A 2VKZG 2QJ3A 2C2NA 3HMJG 3K89A 2H1YA 3TZZA 3EZOA 5DZ6A 3G87A 3RGIA 3TZXA 2VZ8A 3BV8A 3HHDA 4QBUA 3TQEA 4RR5A 1MLAA 2PFFB 2G2YA 1NM2A 5DZ7A 3H0PA 2UV8G 3HJVA 2G2ZA 2JFKA 3QATA 3IM9A 3TZYA 5CZDA 3IM8A 3TZWA 3R97A 2CUYA 2G1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G2O A;  2VZ9 A;  3CJ8 A;  5CZC A;  4RL1 A;  2HG4 A;  3PTW A;  3R8Y A;  2JFD A;  3SBM A;  2QO3 A;  2QC3 A;  2VKZ G;  2QJ3 A;  2C2N A;  3HMJ G;  3K89 A;  2H1Y A;  3TZZ A;  3EZO A;  5DZ6 A;  3G87 A;  3RGI A;  3TZX A;  2VZ8 A;  3BV8 A;  3HHD A;  4QBU A;  3TQE A;  4RR5 A;  1MLA A;  2PFF B;  2G2Y A;  1NM2 A;  5DZ7 A;  3H0P A;  2UV8 G;  3HJV A;  2G2Z A;  2JFK A;  3QAT A;  3IM9 A;  3TZY A;  5CZD A;  3IM8 A;  3TZW A;  3R97 A;  2CUY A;  2G1H A; 
#chains in the Genus database with same CATH topology
 5C24 A;  1WC1 A;  1IVZ A;  4MTP A;  3I9V 9;  2OKQ A;  3BKF A;  1KQS R;  3ISZ A;  4X84 A;  4X66 F;  1GNK A;  2MYF A;  5FLX Y;  2NXU A;  2B9E A;  3SV4 A;  2XY7 A;  2I0X A;  1U7L A;  4WBF A;  2MZJ A;  2G0I A;  2EFV A;  3DGV A;  2A10 A;  3KNG A;  2AJ0 A;  3G9C A;  2WON A;  4AUK A;  1WF1 A;  2QEX S;  4Y28 C;  4CTA A;  3TUZ C;  5HK4 A;  3PRB A;  3L7U A;  2CZ4 A;  4XDC A;  4ZVO B;  2ADC A;  2AW0 A;  2WOM B;  3C8Y A;  4DPX A;  3U02 A;  2PMZ D;  4PXB A;  3BYP A;  5CQG A;  1QAI A;  2PE8 A;  1YSJ A;  1M5S A;  3THP A;  4Q7A A;  2E9T A;  4WFY A;  2HFZ A;  3RAQ A;  5IT9 Y;  4CH1 A;  1FI4 A;  4P73 A;  1R3N A;  2W9C A;  2BOP A;  1NJY A;  2F9D A;  2EK6 A;  2EC0 A;  2IM2 A;  3OL7 A;  3KLG A;  4YFU A;  1Q81 T;  1EP4 B;  3LAL A;  4RUC A;  2XMA A;  1R8P A;  4DUY F;  1H6K X;  1QE1 B;  3A8K A;  2J0X A;  2JVO A;  3H59 A;  3TZZ A;  1IBK F;  2KVQ E;  2EC2 A;  2HEK A;  1U0S A;  3KLF A;  2G2Z A;  5HVG A;  5A0Y A;  3L4B C;  1XR7 A;  2J9C A;  3KK1 A;  1HYS A;  3D66 A;  4M95 A;  2CPE A;  4DL0 C;  1HBU A;  3WC0 A;  2N4D A;  5T7L A;  4KKO B;  4CO0 A;  4J9L A;  3KHH A;  3CO0 P;  4P7T A;  4OJH A;  7AT1 B;  3JB9 k;  1FJ7 A;  2F8M A;  3GTY X;  4LSN B;  3GV7 B;  1T94 A;  1TUW A;  1Q16 B;  4CIO A;  3HHL B;  2H5J B;  4TU8 A;  1VQ4 S;  4C8O A;  4LF6 J;  4V19 X;  4UQG A;  2AX0 A;  3T5J A;  3FRZ A;  1IJF B;  2YH0 A;  3OVS A;  4DPO A;  1N6Q A;  2FJV A;  4C48 A;  1PKU A;  3KHR A;  4RU9 A;  1QJH A;  2XS7 A;  1W2I A;  2HQD A;  1VIS A;  3PRD A;  2OD4 A;  3I96 A;  2RKI B;  4RW4 B;  2A2C A;  2AYM A;  4KRW A;  1UWB B;  2QC3 A;  1NU4 A;  3HM9 A;  3CJQ A;  2L48 A;  1HMV B;  3J81 Y;  1JJ2 R;  3ET6 A;  4M5I A;  1SKU B;  3O8W A;  3W62 A;  1B7Y B;  5E3A A;  2YNH B;  1LWE B;  2AKW B;  3UN2 A;  2M70 A;  2CPH A;  3BV8 A;  4Z37 A;  3R7N B;  2BA9 A;  3EE3 A;  1N5T A;  4HVZ A;  3RR7 A;  1C0T B;  4FXW A;  3M8P A;  3DLK A;  1S7I A;  1HNZ F;  3RW6 A;  3S01 A;  3GCW P;  5CYQ A;  5J1P A;  1T9V A;  4DR2 F;  3MCN A;  4NLD A;  1KLM A;  5IQ6 A;  1PJ5 A;  3IRX A;  4DR4 F;  1CJK A;  4TU7 A;  2YNI A;  3K5P A;  2JFD A;  2OPP A;  3R5A A;  1PJ7 A;  1S7H A;  2OPQ B;  4QQB A;  5IOL A;  4KAI A;  1NK9 A;  1FX4 A;  2GJF A;  4TQR A;  3SQG B;  1MWY A;  3TA2 A;  3M2U B;  2D69 A;  2OPR A;  3OUY A;  1HD0 A;  3FRY A;  1HNI A;  4U96 A;  4RW7 A;  1G6B A;  4LR9 A;  4LUB A;  2UVV A;  2GMJ A;  3HJF A;  2ZDP A;  3BSO A;  2HIQ A;  4M8L A;  1N34 J;  4NWB A;  4NPO A;  2Y1L B;  3CE8 A;  3G82 B;  2HAF A;  5F8I A;  4FS1 A;  2NRE A;  3R97 A;  2E5H A;  3S1T A;  1HBO A;  3RBX A;  2ZH9 A;  4LF7 J;  2P8I A;  2HNY B;  3HMJ G;  3RW7 A;  1FX2 A;  2KU7 A;  4QCL A;  2MGZ B;  2HHP A;  2XUL A;  2C2O B;  5L1J A;  1YX2 A;  3OL9 A;  2HRU A;  3OHB A;  2R8J A;  4RPF A;  4FNI A;  1RAI B;  4QIV A;  4LSL A;  3GLJ A;  4OQJ A;  3KG1 A;  3CC7 S;  3CJR A;  4BBY A;  2YNF A;  4NML A;  4CLU A;  4KFB A;  3QSY B;  1FNX H;  2KYX A;  1Z4U A;  3T5K A;  1RAF B;  1SV5 A;  4K4Y A;  1BQM A;  3D6F B;  5GAE I;  1S72 S;  3MCS A;  5KFH A;  4Q44 A;  5H9E K;  3I5A A;  1S4F A;  3MUV P;  1KTQ A;  1JKH B;  2DEJ A;  1V3Z A;  1NBE B;  3US5 A;  4WJB A;  1FRJ A;  3MZI A;  4J5O A;  2ZBQ A;  1N52 B;  2HFV A;  1LOU A;  2RT3 A;  3SXL A;  4P52 A;  4BS2 A;  2OEK A;  1QVG R;  1A7G E;  1GTE A;  1KVI A;  3NBP B;  1T9Y A;  4IFY A;  1QY7 A;  2G0J A;  4EBD A;  2R7T A;  1NCL A;  4C0B A;  1D9F A;  3CDB A;  1Q82 T;  1L3U A;  4AL5 A;  1R8B A;  4LFB J;  1VQY A;  1TL7 B;  2VA2 A;  3TRG A;  5KFZ A;  1YZ7 A;  4WFB Q;  2R7R A;  4CO1 A;  3ZTP A;  3G8Q A;  4QIW D;  1RE1 B;  3K5N A;  4WP3 A;  2UUW A;  3C19 A;  4IRK A;  1FT8 A;  3ZTR A;  4NLY A;  3M6W A;  3MOZ A;  1F9H A;  3DC2 A;  2HNZ B;  2VJU A;  4P72 A;  1RHR B;  2B9X A;  1TAU A;  4RLE A;  5HBM B;  1VRT A;  1XNR J;  1TZ0 A;  2VFS A;  2HZA A;  5J1E B;  1UFW A;  2GCF A;  1AYE A;  1JWW A;  3CD5 A;  5JVG Q;  3V81 B;  4RJV A;  3EXY A;  1WDT A;  5MLC V;  3NGD A;  3D6T B;  2HK3 A;  2DNH A;  2XEX A;  3NAI A;  3V4I B;  3TOQ A;  5A8K B;  3HPO A;  1ROF A;  1Q0N A;  1NKE A;  4K5R A;  1IWG A;  4ECR A;  3EPI A;  1Q5V A;  2DRD A;  1R6Y A;  2C3O A;  1X0P A;  2A1B A;  3T5L A;  1H7X A;  4RX6 A;  2A6O A;  4AD6 A;  3JXO A;  3M30 B;  3SSR A;  2POK A;  3DKD A;  1TFW A;  2YKA A;  1NDL A;  3CDE A;  2RVJ A;  4EBC A;  2NXJ A;  4F26 A;  2Y8Y A;  4FYX B;  2IAJ A;  3MEG A;  1F1B B;  3QWP A;  4RUB A;  4I2Q B;  5M2R A;  5C25 B;  1YJN S;  1JLG A;  4LRD A;  3MXH P;  1M1H A;  2MTL A;  3GIL A;  4KV8 B;  2ZDO A;  1LV5 A;  1XMO J;  4GVL A;  3KK2 A;  4FBU A;  3K8V A;  1T9X A;  5E3C A;  2MQP A;  3FSX A;  4NI2 B;  4ZP8 A;  1Q7Y T;  3FMW A;  3VV2 B;  2JNJ A;  2R2S A;  2C3P A;  3OXG A;  4LFA J;  2LU2 A;  3WX8 A;  3EIC A;  2M8D B;  4EYH B;  2ZOM A;  2J0Q D;  4I6W A;  4ED4 A;  4DR1 F;  2J8A A;  5F8L A;  3TQ1 A;  3G6X A;  1C1C B;  1RKJ A;  2BYC A;  3BB5 A;  5E41 A;  1ZAW A;  1KHW A;  4DV5 J;  2AEF A;  3E8O A;  3B6B A;  3DDK A;  2DEI A;  3UCG A;  1LWF A;  2C2R A;  3UDE A;  2ZC3 A;  1FFS B;  5ETR A;  1BHN A;  5KFV A;  2QMW A;  2GVD B;  2ASJ A;  3AD9 C;  1GFW B;  5K20 B;  3NNC A;  3MM9 B;  3D54 A;  2JH3 A;  2F7V A;  3IG1 B;  1VLY A;  2ZJQ Q;  3KDO A;  2GNK A;  1CVJ A;  5HRO B;  1D9D A;  5J2N A;  1UPM B;  4DV3 F;  2XY5 A;  4ZDN A;  1JQG A;  2XY6 A;  1FKA F;  4FDF A;  1NK5 A;  3T1H J;  3GYX B;  3GFZ A;  2LYV A;  1HPZ A;  4OZ5 A;  4TY8 B;  3MR2 A;  2F8H A;  4G3I A;  1HA1 A;  2K2P A;  4LVN P;  3CCS S;  1RAB B;  3VAJ A;  4ANE A;  4ICL A;  2WK4 A;  5K8M A;  2I8E A;  4KHP J;  1XMQ J;  3R5C A;  1LKZ A;  1S9F A;  2IA6 A;  3HHL C;  3M8Q A;  1R8C A;  2ILZ A;  2ATL A;  1RAD B;  3QLH B;  4Q8F A;  4NRU A;  2DR9 A;  1UZH A;  3HFK A;  3S7R A;  3L3C A;  2H4Y B;  3CME S;  1A6L A;  5ETQ A;  1NUE A;  2E1P A;  4EYI B;  3SSS A;  1XIQ A;  4CH0 S;  4G1I A;  1HW9 A;  3H2L A;  2MJN A;  1VK8 A;  3OTO J;  3HKZ D;  1V6H A;  2W7O A;  2HVE A;  4FP9 A;  4BC9 A;  3EDQ B;  4JP8 A;  4I2P A;  4CM0 A;  4R5P B;  2P2C B;  3LP0 B;  3GE9 A;  4NLO A;  5LOQ A;  3UQS A;  1BWE A;  4DG1 A;  1RTD A;  2DIT A;  4HTI A;  4UOC A;  3NGU A;  1UW4 A;  5HO4 A;  2HRY A;  2MKK A;  1CC7 A;  2WVF A;  3MMC B;  4O3R A;  4Q0B B;  1RT7 A;  5A6W A;  3E3X A;  4MYT A;  5KT6 A;  2ROG A;  5F9L A;  4URQ U;  1F6T A;  4H4O B;  1GX5 A;  4LBH A;  2XYG B;  4LBP A;  4PKD B;  3GV8 B;  1HWU A;  2GZO A;  4I69 A;  1CPZ A;  3IAS 9;  4YR3 A;  4KTQ A;  4USW A;  1VIO A;  1NJW A;  1RAG B;  3MM7 B;  5K8O A;  4NA1 A;  5D8H B;  2NUU G;  3RG6 A;  1S12 A;  3FFI A;  4IKA A;  1IUJ A;  4ZVP B;  2UXB F;  3C6U A;  2YX1 A;  3FMB A;  2AQ4 A;  2KXN B;  3QQC D;  1EQ0 A;  2G2Y A;  2ZNZ A;  5T14 A;  2QA4 G;  1RXO B;  4NAS A;  3Q2S C;  2CJX B;  2AJQ A;  3DLH A;  3LAN A;  3H5S A;  2CQD A;  4I6A A;  3MEE B;  3LH2 S;  1PO6 A;  2Z2M A;  4H4K A;  4IG3 B;  4JI3 J;  5F8G A;  3LQV A;  3K57 A;  5DGB A;  2RSQ A;  3FBE A;  1NZA A;  2BE2 A;  1NXI A;  2ZH4 A;  5LSR A;  2NZC A;  1ZAX A;  1ZTT A;  4A48 A;  3MM6 B;  4CLP A;  2RAQ A;  2I38 A;  3C16 A;  3VVT A;  2FJW A;  4I1T A;  4AE5 A;  1MRO A;  4WII A;  3EPG A;  3V6J A;  5KG5 A;  3R6L B;  4GKJ F;  1M5O C;  1FRK A;  5J2P A;  3KJN B;  2R8G A;  5IWA F;  1REV B;  1RT3 B;  3T19 A;  3HHN B;  1TK5 A;  1FDA A;  1ZS6 A;  3E01 B;  3OR1 A;  1RA7 A;  5LMU F;  1S9E B;  1EX8 A;  5G0R B;  3T6B A;  3DOL B;  1Z2Z A;  1YBT A;  2CQ0 A;  4OYW A;  1XNQ J;  3DYA B;  4IG0 B;  3D6H B;  4KGM A;  2I5J B;  4QYZ K;  2DNN A;  3KJQ B;  1S57 A;  2ZHA A;  3BO3 A;  4KC5 A;  3IS9 A;  2AJ1 A;  1T03 A;  2NSC A;  1TKX B;  3DGP A;  2GHV C;  3GIM A;  2MLZ A;  1S0V A;  2XMW A;  4DUZ F;  2RS8 A;  4OZJ A;  5AXK A;  2V63 A;  4X4R A;  1UL3 A;  5EWE A;  3EYZ A;  2HHX A;  3CCV S;  1WF2 A;  1TMM A;  3SFG A;  4UZB A;  4DV7 F;  4NZ6 A;  4C11 B;  2LXF A;  4FS2 A;  3LW5 C;  4NA2 A;  3MI7 X;  3HHL D;  1NPP A;  2MZS A;  1I5O B;  2RS2 A;  3AJ2 A;  5CZV A;  2FVP A;  4A8W A;  3TUP A;  2OFH X;  1UJ6 A;  1J2V A;  4JV1 A;  2YPY A;  5C7P A;  4NZ0 A;  5M2U A;  4A8S A;  3K59 A;  3WIU A;  4QW8 A;  3LAK A;  4YDD B;  1OPI A;  3BS9 A;  1KFS A;  2MQN A;  1FWK A;  3VQS A;  4GVB B;  1S6P A;  1WNE A;  4IO9 Q;  2CQB A;  1FO1 A;  3MMA B;  4DN0 A;  5U47 A;  3Q8U A;  2XZD B;  3V5R A;  2D3Z A;  4DR4 J;  5RUB A;  2EK1 A;  2ZWO A;  3A8J A;  2DR7 A;  3P45 B;  2YY3 A;  3DLG A;  1Q79 A;  2XB2 D;  5K8N A;  3MEK A;  2QTW A;  2VDI A;  3HF5 A;  2FJE B;  3KLH B;  4I0W A;  4DF8 A;  4UW2 A;  5D3G A;  1DHM A;  4BCA A;  3PX4 A;  2VG6 A;  1TL3 A;  4O3P A;  2CQI A;  2LMI A;  5KFX A;  1JLF A;  4M5D B;  4USM A;  3UD4 P;  1ZOT A;  4DSL A;  4B9L A;  2K1R B;  4LRC A;  1X9W A;  2YKQ A;  4WIQ A;  2B5J A;  3JSM B;  3C66 A;  2FIU A;  7FDR A;  3FUY A;  3PHE A;  5H9F K;  4CLY A;  4PCQ A;  5C24 B;  2VF3 A;  4DPU A;  2NQP A;  4JI1 J;  4CT8 A;  4YR0 A;  2QL5 B;  4RNF A;  2ZVS A;  3HX9 A;  4OZ2 A;  1X0F A;  5KFK A;  3CJ4 A;  2AIR B;  5DDO C;  4X4N A;  3KJF B;  4WE1 A;  5DM7 Q;  3R5G A;  5H1S V;  3C46 A;  2ADB A;  2WON B;  5E3R A;  2MXY A;  4CTA B;  4DR3 J;  1K9M T;  4Y2K A;  1SH0 A;  1CQN A;  2NPF A;  1H72 C;  3RU0 A;  4ED2 A;  5HMZ A;  1VQ9 S;  3MR6 A;  3LPY A;  5CZC A;  1HBM A;  1NK0 A;  4K2J A;  3BR9 A;  3DDI A;  2H1Y A;  1NDP A;  1O51 A;  2UXC F;  3RB3 A;  4ECQ A;  5KFS A;  2E29 A;  3H0P A;  3KFW X;  2VBY A;  5A8W A;  4NCG A;  1RAE B;  1I6J A;  1U6Z A;  1CSJ A;  4X4T A;  3KG4 A;  2IRU A;  4CLF A;  1D1U A;  1TL5 A;  3FEY B;  2MZT A;  2GMH A;  1TU0 B;  1VQ7 S;  3CD6 S;  3CJK A;  1MU2 A;  2W9C B;  3ZNU A;  3K8W A;  1WF0 A;  1IM4 A;  2W2N P;  3KLG B;  2KG1 A;  4D3H A;  2JEF A;  3RR8 A;  3HHK A;  3ILL A;  3HP6 A;  4DFM A;  1FRX A;  2B9Y A;  4OV6 A;  1HHT P;  3KLF B;  4OJG A;  4URS A;  4ILM A;  5A0Y B;  3GP9 A;  2YWW A;  3KK1 B;  1QSS A;  1HYS B;  3W1Y C;  2GJI A;  1PC4 A;  2KJW A;  1FE0 A;  1HBU B;  1BD6 A;  5DDP C;  5DM6 Q;  3C14 B;  2V68 A;  5T7L B;  3CJS A;  1BQN B;  4K4V A;  3EMT A;  4JI8 F;  2R8H A;  5GAG U;  2B4V A;  4ZJQ A;  4C9D A;  3VGV A;  1PSD A;  4D3G A;  5FD1 A;  2GO9 A;  4AFF A;  1KFD A;  5KT3 A;  3UDL A;  1PJ6 A;  4F50 A;  3MDF A;  2CRL A;  1I51 B;  2XCA A;  4ZN1 A;  1N6Q B;  2OPS A;  4IFV A;  2HQF A;  3DXB A;  4IRC A;  1RIS A;  5D4O A;  5I3P A;  2I9S A;  5KFO A;  3EVW A;  1EB0 A;  2VIH A;  2OFG X;  3TJA A;  4P71 A;  4JYA J;  2WBR A;  4IDK B;  3QGI A;  1T9T A;  1N36 F;  1ZA2 B;  3EGZ A;  4C3K A;  1SC6 A;  2O5D A;  1Y9O A;  3ZC4 A;  2RIL A;  3HDS A;  3ET6 B;  3JSY A;  2KO1 A;  4DDF A;  3I9Z A;  4U9R A;  4W4M A;  3SMZ A;  2D9P A;  5HMY A;  3BGO P;  1OJ4 A;  2BM0 A;  2C3U A;  1PC5 A;  3SYZ A;  1X8D A;  3FGV A;  2KT2 A;  3HXM A;  3M8P B;  4IQM A;  5E2Q A;  3KHG A;  3GON A;  3DLK B;  4NOH A;  1LW0 A;  2NYI A;  2BMB A;  3CDA A;  3EXC X;  5CYQ B;  2VOO A;  3JQJ A;  2BAN A;  3P96 A;  1XR6 A;  3UD5 A;  3CUL A;  1U2F A;  4HYK A;  3TEG A;  1KLM B;  2BW2 A;  3NP5 A;  3IRX B;  2VFR A;  1LNQ A;  1CJK B;  2MLX A;  2YNI B;  3NY0 A;  1S77 D;  1V5I B;  2OPP B;  4DXL A;  2LDI A;  3TQE A;  2CPY A;  1V9O A;  1JJH A;  4ZIV A;  4LF9 F;  4KPC A;  1TEL A;  2DK2 A;  1FHT A;  3W2W A;  1RTJ A;  2KB2 A;  2IVY A;  4OZL A;  3RRH A;  3BDP A;  4WU3 A;  4OFZ A;  2OPR B;  1VQP S;  3OUY B;  3SCL E;  3O1L A;  2HVH A;  3ZZP A;  4RW7 B;  2CJ9 A;  5FII A;  2E9Z A;  2R7Q A;  2MHE A;  3A13 A;  1TK8 A;  1IKV B;  5E33 A;  3GG0 A;  2KN4 A;  2OUG A;  1AXQ A;  3PAC A;  3CUN A;  2PC6 A;  4KH0 B;  1OY8 A;  4QZV B;  4CLL A;  2QA1 A;  2GV1 A;  2CDQ A;  4MYU A;  1S49 A;  3O3L A;  3FK4 A;  1Y00 A;  1HBO B;  5A6P A;  2C2D A;  1GQE A;  2VZ8 A;  1E6V A;  1NSK L;  2DNP A;  1OQ3 A;  2ZD1 A;  1MWZ A;  2L9N A;  1CEZ A;  5ETO A;  2XGP A;  1SQF A;  5G4D A;  1ULR A;  4KGK A;  4LSL B;  3D5M A;  4MK8 A;  4Y2C A;  2VV5 A;  5KFN A;  4DV3 J;  2UVR A;  1JMT A;  2YNF B;  1H74 A;  3D6M B;  1I3O B;  2RQ4 A;  1SV5 B;  3DCA A;  4QWC A;  3GIJ A;  3NAH A;  1LEO A;  4J9O A;  3AH6 A;  3BSA A;  1F2H A;  3PO5 A;  4O3S A;  3PJX A;  2GIF A;  4AYB D;  4JV5 J;  1RKI A;  2A2D A;  4MKV A;  2V69 A;  4C0H A;  4F4K A;  3VGU A;  3T9N A;  1HW8 A;  4N47 A;  2JEI A;  5IFM A;  1YJT A;  2FHK A;  2Z0G A;  4YB7 A;  4O3O A;  4CLS A;  1WC6 A;  2PO4 A;  4OI4 A;  3QJL A;  4XDD A;  3AAW B;  3BQ0 A;  3HKW A;  3CED A;  1U24 A;  3NNA A;  2H3E B;  3CTR A;  4CH7 A;  3GG1 A;  3GJS B;  1F3V A;  2XNQ A;  2HLT A;  1T8E A;  3WIV A;  1RHU B;  4IFY B;  4CO5 A;  4EEY A;  1KP6 A;  5B0E A;  5DQI A;  5GAH I;  2RH3 A;  2DB1 A;  3HI9 A;  1JIH A;  4WP8 A;  2YKN B;  3FNN A;  2NR0 A;  2AEJ A;  1CG2 A;  1NKC A;  3ZZT A;  3CO9 A;  2F3J A;  4KHR A;  2EKY A;  2BKP A;  1PYS B;  4CO2 A;  2W01 A;  4FF3 A;  4B3M J;  3FBC A;  3BBC A;  2KT3 A;  2LDY A;  4J91 A;  2VQE J;  3G96 A;  1URN A;  2X3D A;  3AJD A;  2QA2 A;  4USH A;  3H90 A;  3AXM A;  3IAM 9;  1Y5L B;  2MST A;  1JLQ B;  4WKR A;  3TVZ A;  3C6T A;  1VRT B;  2R3V A;  4CDI A;  2H9Z A;  4FYV B;  1CS4 A;  3MPY A;  3SCJ E;  4YY3 F;  1F2G A;  5E0O A;  4YS2 A;  1NHU A;  2IMW P;  4F67 A;  4LR7 A;  3H25 A;  1AW0 A;  4YDX A;  1IQZ A;  4B9U A;  4RW8 A;  2LQ9 A;  1XJW B;  4B9V A;  4FKY A;  2AV5 A;  3LA0 A;  4AMO A;  3HVT A;  3TP2 A;  5DQH A;  2V5H G;  4EBE A;  2QO3 A;  1UFL A;  4FPI A;  1KVJ A;  1R7I A;  3OTB A;  1K1Q A;  4PG7 A;  3VHQ A;  1VQ5 S;  4PQU A;  1EIY B;  1VJQ A;  1XN9 A;  3RTV A;  5CYJ A;  4K0K J;  1OY6 A;  5F9N A;  2O3D A;  4XTT A;  4R8U A;  2IYI A;  3OT9 A;  3LGH A;  3PNI A;  2ZH5 A;  1JXE A;  5HAT A;  2VPW B;  5CCM A;  2BZ2 A;  2IAJ B;  3IM8 A;  2IBK A;  2DGX A;  3MEG B;  4A8O A;  2YX7 A;  3TVK A;  1VQ6 S;  2Q43 A;  2DY1 A;  1JLG B;  3W5Y A;  1Q78 A;  1SJ3 P;  5KFW A;  2C2M B;  4UOH A;  1TVR A;  3LP1 A;  4MIB A;  3IGV A;  1DUR A;  5DG8 A;  3KK2 B;  2EW9 A;  1U1O A;  4ITS A;  4HT5 A;  3MGJ A;  3E2E A;  4DCP B;  1L3T A;  4YP3 A;  1U26 A;  3BH7 B;  1X4A A;  3OR2 A;  4WTY A;  1SQE A;  5KFM A;  3RB0 A;  2KG0 A;  2E44 A;  1HHS A;  3GIK A;  3MCM A;  5GAE U;  3DI6 A;  2VKR A;  4XK8 C;  2XSF A;  1RWP B;  2HS0 A;  5IWA J;  2ZBP A;  3CD7 A;  4FN5 A;  4ZCL A;  4UTG A;  2GIR A;  1U8W A;  5D4N A;  2W8K A;  2FUG 9;  3VVU A;  5DQG A;  3L9Z A;  4U67 Q;  5CZX A;  2EWH A;  5KAK A;  3QO9 A;  5DGA A;  1LWF B;  4JB8 B;  3V6D A;  1RDR A;  2WAQ D;  3OL6 A;  2C2K B;  4OYP A;  1HLW A;  4ES3 A;  2AT1 B;  1N4L A;  4OV1 A;  3R5D A;  3BKT A;  3PX0 A;  1TV6 A;  2C2E A;  2GVZ A;  4ELU A;  2W4P A;  3A3N B;  3NGK A;  5J2N B;  5DLG A;  4P9S A;  2G9O A;  4DV7 J;  3M6U A;  1FVQ A;  2AGP A;  3MM5 A;  1X9M A;  1BUX A;  1X4E A;  2O66 A;  2UU9 F;  2B8P A;  2E7X A;  1HPZ B;  1M1K T;  3VF0 B;  2DJW A;  4NLR A;  3ZZR A;  2RB7 A;  1BLU A;  4LF1 A;  2KTQ A;  2YPZ A;  4ED7 A;  1OPZ A;  1YQH A;  3Q8R B;  2ZZT A;  4ZLL A;  3BRE A;  4DV6 J;  4N77 A;  1N5Q A;  3VTI A;  2OO4 A;  4ZVT B;  1NB2 A;  4NCA A;  2BEF A;  3W9I A;  3M8Q B;  4O4G A;  2ZFH A;  2RUS A;  3K58 A;  5BR8 J;  4C4W A;  4PXC A;  5CD4 H;  4LF6 F;  3TEH B;  3EJM A;  3QT6 A;  1KQF B;  3BPS P;  2XZW A;  3FSY A;  5K8P A;  4ZVS B;  2V4J A;  2DNK A;  1VJW A;  1X5T A;  3ZZU A;  1S6O A;  3AD8 C;  1N8R T;  4IH7 A;  2ACY A;  4F4W A;  4I2P B;  1KRP A;  2YNG A;  4ECU A;  3GJQ B;  4ER8 A;  1YJU A;  2QLF B;  4FF4 A;  2W2Q P;  4DG1 B;  4BC7 A;  3OQ2 A;  2MZQ A;  1RTD B;  4DQS A;  4ZPA A;  3ELH A;  3LOU A;  1T7P A;  3RRG A;  1WC3 A;  1HIY A;  4DR5 F;  2R8K A;  3DRP A;  1M5H A;  1RT7 B;  4J9P A;  5KT2 A;  1QVF R;  3B82 A;  4FVM A;  1H38 A;  3W8G A;  1IBL J;  3BZQ A;  4B3O A;  1ZH5 A;  4ZP7 A;  1M5V C;  2CPX A;  4RZR A;  4ECT A;  4C8M A;  4KJI A;  1Y10 A;  1XBW A;  1ZM4 A;  1RT2 A;  3FCW A;  3K5M A;  1RWW B;  5GVQ A;  1H0H B;  4A8Q A;  3CJ8 A;  3AA8 A;  4DQP A;  1GMW A;  1NO8 A;  3IA0 A;  2KDO A;  4YB5 A;  3C6U B;  2EFQ A;  2XHC A;  1U1K A;  4ZVR B;  4JV2 A;  5F3T A;  4LQ9 A;  2WVC A;  1S5Z A;  2M7S A;  3NXZ A;  2NSB A;  2IJR A;  3F56 A;  3I0R A;  2MKY A;  4K7Q A;  1S0M A;  1WTB A;  1XTZ A;  2ATC B;  5B0C A;  2E5I A;  4MK9 A;  1N54 B;  3UO0 A;  2R8I A;  2HK2 A;  3N0V A;  2DNY A;  3R2D J;  1K1S A;  3DDN A;  3PW0 A;  4K4U A;  2Z30 B;  3DLJ A;  2BE2 B;  3CMQ A;  1N34 F;  1X4H A;  4CCH A;  2ACM A;  3ISN C;  4RR5 A;  4WPA A;  3H5U A;  1O0P A;  1GH8 A;  1TTH B;  5F41 A;  1O5J A;  1YK9 A;  3C16 B;  2PII A;  4NXM F;  3PDN A;  3HVA A;  2LU1 A;  3DMJ A;  4HHU A;  3OLA A;  2BJ1 A;  2XBP A;  3A8E A;  1SB6 A;  2Z57 B;  5J2P B;  5J2Q A;  1KR4 A;  2M2B A;  4RNH A;  3UR0 A;  1YBU A;  2E7V A;  5KFI A;  4JI8 J;  2NXN A;  3ILO A;  3OR1 B;  2CQG A;  1QDU B;  3MTJ A;  5I3U A;  2ZM6 J;  4FNH A;  3ITH A;  3R7B B;  1NZ8 A;  5KFR A;  4ED5 A;  3TW0 A;  2HVI A;  4E8U A;  4I68 A;  1RCO B;  4LF5 J;  1C1B A;  2PEB A;  3EZ5 A;  5AXN A;  4WFN Q;  1RHM B;  3J7A 1;  3KK3 A;  5EWG A;  5EX0 A;  3IS9 B;  3K5L A;  2M8H A;  2XLI A;  1T03 B;  2MEW A;  3U27 A;  3DGP B;  4ZKA A;  1NJI T;  4LQ3 A;  4WZQ A;  3DM2 A;  1RYR A;  1CJU A;  1N36 J;  3LO3 A;  4J9Q A;  2DNM A;  2FVC A;  1IKW A;  4CO4 A;  3CIZ A;  3IM9 A;  1V3R A;  2C3Y A;  2AYB A;  4NRT A;  1YG0 A;  4ZVU B;  4OLP A;  4PG4 A;  5AXL A;  2MMY A;  2K3K A;  3D9B A;  4LFB F;  3PKY A;  2F65 A;  1F5C A;  2ZE2 A;  2IM0 A;  4BDP A;  1RWO B;  4OMF G;  2ASY A;  1HR0 F;  4P2M A;  4DPW A;  2BE9 B;  2LQB A;  4LF2 A;  4KR0 B;  1N56 A;  2J7K A;  4F0M A;  2VUG A;  1PBU A;  4UZC A;  4A8X A;  1G3O A;  4O3Q A;  3DLG B;  2LLZ A;  3GPA A;  1QTN B;  1MMD A;  4CQ1 A;  4LF9 J;  4W98 A;  1XNR F;  1U8S A;  3SDE A;  4MKY A;  3FCH A;  2VG6 B;  2KHC A;  1JLF B;  1RUS A;  5ETL A;  1U49 A;  3H20 A;  2OJ3 A;  3Q8Q B;  3J80 Y;  1RWX B;  3KMS A;  2ZUG A;  1CBK A;  2JLG A;  2B5J B;  3ZTS A;  3ONQ A;  4MJK A;  4DQI A;  4ZVE A;  1BGX T;  3P8B B;  4C7Q A;  3MAQ A;  2VFT A;  1WD6 A;  3CJ2 A;  3ZZO A;  4KT0 C;  1FDB A;  4C6A A;  3KLI B;  3W61 A;  5HQL A;  2KFY A;  2Y1I A;  1X31 C;  2V9W A;  1VC5 A;  2QG9 B;  4X4S A;  1YRU A;  1SIZ A;  2MPU A;  1C4A A;  4F4Z A;  3GYN A;  3QGH A;  2RIJ A;  4ILL A;  1B3T A;  2FGO A;  1LWC A;  3PEJ A;  3NKY A;  2Y0S D;  2MKJ A;  3WBZ A;  1S48 A;  2K06 A;  4ZK7 M;  1HQU A;  2HFU A;  1P6T A;  3QT5 A;  4OYZ A;  3V4M A;  1HBM B;  5JXS A;  4QWD A;  2CQP A;  1W2B R;  3IWX A;  2F4F A;  3NS5 A;  2QLJ B;  3ENW A;  1RJJ A;  1SC3 B;  2FB0 A;  2XO6 A;  4B9T A;  5A8W B;  4NCG B;  4EZ9 A;  5MAO A;  4P7V A;  3M32 A;  1OYE A;  3TZX A;  4LT6 A;  4PPD A;  1RI7 A;  1G2E A;  2OLW A;  3D28 A;  1SL1 A;  4I7F A;  3BN4 A;  3CJK B;  1MU2 B;  1BY9 A;  3ISN D;  3D1H A;  2PSZ A;  3W9H A;  3G4S S;  3G86 A;  1CQM A;  5HL7 Q;  3TAN A;  5CHC B;  1UMJ A;  4YR2 A;  5GME A;  2OIH A;  2XS2 A;  5IC4 B;  2DNQ A;  4K8R A;  1UAW A;  4QPX A;  2CUY A;  4J9K A;  1UJ5 A;  5JJB A;  3F41 A;  3JQM A;  1UVN A;  1FDN A;  2GGP A;  3J7Z T;  1NDC A;  3Q23 A;  3UPF A;  4HAC A;  3T5H A;  2GHW A;  3BH6 B;  4P2F A;  4NZ7 A;  1HI1 A;  4DX5 A;  2BJ3 A;  4IR1 A;  3RAX A;  4WP9 A;  4QBU A;  4RNN A;  3IXQ A;  2PGC A;  4G1Q A;  4IOB A;  1LW2 A;  4B9S A;  3DXS X;  2A3J A;  4KSE B;  3K89 A;  1VBX A;  1UCN A;  1MSW D;  1H2V Z;  2EVZ A;  3SEO A;  1S0O A;  1P9Y A;  4O23 A;  5CAB A;  1B64 A;  3TZW A;  3J7Z 5;  4KHP F;  4IFV B;  1UA1 A;  2AMC B;  1PYO B;  4TYB A;  4HI1 A;  4IH5 A;  2QLW A;  5SUH A;  4OI0 A;  4YY3 J;  4OYA A;  2FPH X;  4U7U D;  3J81 j;  3D0G E;  2LA4 A;  1TFY A;  5EWF A;  1U6B A;  1AA1 B;  5AXM A;  5L46 A;  1NND A;  4TN2 A;  4U8V A;  4ED1 A;  1SPB P;  4PG6 A;  3ZTO A;  3LGM A;  2J0W A;  1NJZ A;  1S9G A;  3GWC A;  1NME B;  1P27 B;  2DH7 A;  3SIP B;  4CZC A;  2D41 A;  2J7W A;  4X4P A;  2E9R X;  2RQK A;  4Q2L A;  1WEY A;  3GU0 A;  4CWB A;  3Q8P B;  1S6U A;  2B0G A;  1Q8L A;  1LXN A;  5AE3 A;  1LW0 B;  2VOD A;  4OX9 J;  2MKC A;  1G4C A;  2LEC A;  2BAN B;  2ABY A;  2YX4 A;  1U1R A;  4ZN3 A;  3BR8 A;  1IBC B;  6AT1 B;  1HBN A;  1S4E A;  1NKB A;  2V8D A;  1Q4R A;  1YIT S;  1K73 T;  1HI0 P;  1D0E A;  4JUZ A;  5DDQ C;  1YDL A;  4AQY F;  4GO5 X;  4H54 A;  1HNW F;  3CCJ S;  4I4B A;  5L1K A;  1NH8 A;  2Q66 A;  1UPP A;  4LSN A;  3FSI A;  1EAY C;  2COL A;  3W2W B;  1RBL A;  3N28 A;  3PKM A;  2EBG A;  4A46 A;  5T41 A;  1TL4 A;  5ETV A;  1LFP A;  1GEH A;  1AUD A;  2F63 A;  1FJE B;  3ILJ A;  2HQC A;  2KXF A;  2D1C A;  2FVR A;  1RTI A;  2XMV A;  2RU3 A;  1N5Y A;  3X3U A;  1VRU A;  2BXJ A;  3NRB A;  1WI8 A;  1FTC A;  4OX6 A;  5EUH A;  2VBW A;  2M5Y A;  1FES A;  1KEK A;  4NEY A;  2CZV C;  2AJ4 A;  1E6V B;  4CI0 B;  4E2F B;  4JI3 F;  3G87 A;  5E7O B;  2M9K A;  2ZD1 B;  2JJ4 D;  1KSP A;  5ITH A;  1IBM F;  4N76 A;  4LRB A;  2HVD A;  3PXG a;  3UVJ A;  3T1A A;  1UVK A;  1T05 A;  4OHV A;  2CIM A;  2R42 A;  2LKZ A;  2BJ8 A;  2HND A;  2R7S A;  2UU9 J;  4RUA A;  1T3N A;  1MW7 A;  4HL9 A;  5HSP A;  2B56 A;  4OYI A;  3K2Y A;  1PCA A;  1JJ4 A;  1L3S A;  4LRF A;  2V8V A;  1DLO A;  3SV3 A;  2ZBR A;  2FQQ B;  1TKZ A;  4DV2 J;  5KG6 A;  1GMV A;  1SH2 A;  3UFC X;  4QR1 A;  1XNQ F;  1UKU A;  2DGV A;  1NK7 A;  1D8Y A;  2J7U A;  3L95 X;  9RUB A;  1TKT A;  4PRF A;  1LFW A;  1SH3 A;  4B3R J;  1N33 J;  3QNW B;  1UP1 A;  2XTJ P;  3W63 A;  3HSG A;  3CF5 Q;  4DMZ A;  4L3K A;  1FXL A;  2ZH3 A;  4PG8 A;  2BOA A;  1T9U A;  4IO1 A;  2OP5 A;  4USK A;  3LTO A;  2YH1 A;  2E1A A;  4NLU A;  2EKN A;  3H2V E;  5KFD A;  1KNZ A;  1N5V A;  2L08 A;  4IH6 A;  2AEM A;  3CC4 S;  4ZLN A;  2HS3 A;  3MPD A;  4KO0 A;  2RDI A;  3CDW A;  2MQL A;  4DR5 J;  1R8A A;  2LA6 A;  1Z2L A;  5M2P A;  2FZG B;  3UWT A;  3Q8V A;  2PMH A;  1VQ8 S;  4DV4 J;  4J9N A;  1Y5N B;  3C6T B;  2PA3 A;  2Q79 A;  3IMQ J;  4GKK F;  1NAQ A;  2LQ8 A;  4HHJ A;  2E1M C;  2JLE A;  4DBQ A;  1GXU A;  4L3N A;  1XC9 A;  1AT1 B;  1YIJ S;  5A2Q U;  2ILY A;  1M0S A;  2FVS A;  3VAI A;  2HIY A;  4RW8 B;  3KNA A;  2CYY A;  2X1B A;  3IBF B;  1QUV A;  3HVT B;  4OHZ A;  2CQC A;  4Q2M A;  2ZBC A;  4PQU B;  4TLR A;  2WB4 A;  3FC9 A;  4ECV A;  3MPV A;  3FBF A;  4R8U B;  3HO1 A;  3I6P A;  3NMA A;  2E7W A;  1VQM S;  5KFU A;  3M8S A;  4M94 A;  3ZNJ 1;  2D3U A;  3QRR A;  1X4G A;  3DRX A;  3T1Y F;  1ZM2 A;  3PIP Q;  4QWB A;  1CLF A;  4JI1 F;  1TVR B;  3LP1 B;  4HTJ A;  2EG1 A;  2DCL A;  5B0G A;  5B0F A;  4CLT A;  1Q8B A;  1UET A;  5EHH A;  2UUA J;  3A12 A;  3KLV A;  3OR2 B;  2ZHB A;  5GAD U;  1N48 A;  4NXM J;  1FK9 A;  4DR3 F;  2F1F A;  4NLW A;  5FLX U;  1S1W A;  2OTL S;  1Z1Z A;  3DI6 B;  3P4U B;  3T9Z A;  3EWG A;  5BYS A;  5HN0 A;  2IYG A;  2J8S A;  4O44 A;  2J6U A;  1SCJ B;  5HBM A;  3AA9 A;  2N3O A;  3I5B A;  2RHQ B;  1HQ2 A;  4RBU A;  1I1G A;  2EXU A;  3QO9 B;  4YB6 A;  2FLN A;  4Z2X A;  2E5J A;  2NUH A;  1WHV A;  3Q8Y A;  1ZPW X;  4PAB A;  4NXN J;  2DXD A;  1WWH A;  5GAH U;  2V9K A;  1VBZ A;  1U45 A;  2ERR A;  1TV6 B;  1KQG B;  4LBI A;  3FBB A;  1IR2 A;  2GVZ B;  1TAQ A;  4B3T J;  3MM5 B;  2CXE A;  2KFZ A;  2GFF A;  3KOA A;  1OQ6 A;  1KDN A;  2M0G B;  3BGR B;  3RRK A;  4NLG A;  1U0H A;  1WJ9 A;  2XNR A;  4UOF A;  2UUC F;  3N5F A;  5B0A A;  2E5G A;  1NM2 A;  1UVL A;  2GJ2 A;  1FRI A;  1UVI A;  9ATC B;  4ZHR A;  5CZD A;  2ZJR Q;  2B4U A;  3PYE A;  1B0P A;  4FBT A;  3A8I A;  4ZVG A;  1HR0 J;  3MFH A;  3PX6 A;  1Q1K A;  2V2V A;  2WB1 D;  4OI6 A;  2WVD A;  1SI9 A;  4O4G B;  1NK8 A;  2W8L A;  2KZM A;  4L73 A;  5DET A;  3RUB L;  4DSJ A;  5EN1 A;  3UD3 P;  3PW2 A;  3DRS B;  1VRQ C;  3G2X A;  2QL9 B;  4GRS A;  4IOA Q;  1Q53 A;  2P9E A;  4IOC Q;  1J27 A;  4GO7 X;  4BWJ A;  1ZAV A;  2V4J B;  3O5T B;  1UVM A;  2NLW A;  3HVR A;  3TR5 A;  1RU2 A;  3ZZ0 A;  2CPF A;  4JYA F;  3Q24 A;  2HWI A;  4C2M A;  2D3O 1;  2YNG B;  4TVA B;  2UUB J;  2GVD A;  1WSR A;  3FZ2 A;  1RBA A;  4P6Q A;  2DO4 A;  4K59 A;  1WOR A;  2BQR A;  3SSQ A;  3L09 A;  1U47 A;  1SC1 B;  2AGQ A;  3QZ7 A;  4NMX A;  4HDG A;  2PN6 A;  2XYH B;  3J81 U;  3H40 A;  3DRP B;  1VQL S;  1S1V A;  2YVS A;  4OX8 A;  4KB7 A;  3KUE A;  5J2M A;  4B3O B;  5B0B A;  1APS A;  3MR3 A;  1QSL A;  1U2C A;  3G8T A;  2H5I B;  1FVS A;  3R1L A;  3Q89 A;  4DX8 H;  3H5Y A;  1HQE A;  3OXF A;  3LP2 A;  1RT2 B;  4LIW A;  4ZJL A;  1RAO A;  5LL6 d;  1SL0 A;  3CCM S;  3OLB A;  3BGF A;  3C2P A;  5HLF A;  4DFP A;  4RW6 A;  3W2V A;  4A8Y A;  4WKY A;  2Z2Z A;  8ATC B;  3MUM P;  3OFE A;  1WKK A;  4FYD A;  3I0R B;  2VPY B;  3QRQ A;  4QW9 A;  3PR5 B;  4QR2 A;  3LPE A;  1BXN A;  1J5E J;  1WAC A;  2Y8W A;  1RT5 A;  3JTO A;  4TXS A;  4Q45 A;  4QOT A;  1W7W A;  4ZLP A;  2LVW A;  3GFX A;  4F8R A;  5ETM A;  1C2P A;  1NPK A;  3H2U B;  3NOG A;  3E51 A;  1OIA A;  5ETT A;  4QWE A;  3LP0 A;  2EG2 A;  3HT3 A;  3U7J A;  2BM1 A;  3HT0 A;  3M8Z A;  3ENA A;  1P8G A;  3CC2 S;  1QUP A;  1ZYQ A;  1S1X A;  1R0A A;  3DMJ B;  5C2G A;  5DO2 A;  1U4B A;  1FNO A;  3HHD A;  5J2Q B;  2RDD A;  4Q0B A;  4EO6 A;  1XER A;  1MN7 A;  2MQM A;  2G1H A;  2YTC A;  5IT4 A;  1QAY A;  5I3U B;  3DHW C;  4AXJ A;  5F0U A;  3ITH B;  1KC8 T;  2DNG A;  2YKM A;  5DG9 A;  4DSI A;  5D4L A;  4TQS A;  1PAE X;  2LEB A;  4E0D A;  1M1G A;  4G6V B;  4NLS A;  1C1B B;  3N6N A;  3CJ3 A;  1CJT A;  4JV5 F;  3D0H E;  4ZS6 A;  4NLT A;  3TAR A;  4C8L A;  2VBZ A;  2IC3 A;  1CUL A;  3KK3 B;  1WHW A;  2JFK A;  1GMU A;  3M2V A;  3TZY A;  2QRR A;  3MAA A;  3DM2 B;  2R4F A;  3QRP A;  1CJU B;  3DRY A;  2RE1 A;  2CDR B;  4MFB A;  3DHX A;  2RD5 C;  3RBE A;  1B0T A;  5KFB A;  2JLF A;  3MMB A;  1IKW B;  4USI A;  3LUY A;  3IO1 A;  4N41 A;  3ADA C;  2RJZ A;  1RYS A;  3POT A;  5EGY A;  2IDL A;  2QV6 A;  4QIG A;  2OEJ A;  2FYX A;  5CXT A;  1YBA A;  3GFY A;  3NS6 A;  2V8H A;  2C2Z B;  2HHH F;  2ZE2 B;  2B4P A;  4MKB A;  4OYM A;  5DJB A;  2DNR A;  5SZT A;  1M5K C;  1TL1 A;  3NCQ A;  1WKL A;  1SJ4 P;  4B3M F;  1K44 A;  3SZ2 A;  5AT1 B;  4F36 A;  2VQE F;  2GAH C;  1FJG J;  3QBC A;  2P6T A;  2CAD A;  3N5B A;  1XEZ A;  1IR0 A;  3HUL A;  2Y0B B;  4AQY J;  4I56 A;  2AHO B;  3EGN A;  1HNW J;  2OGU A;  1AZS A;  2Q6C A;  2ASD A;  3KTQ A;  3GJT B;  4PUO A;  3SDE B;  1PG5 B;  3RBD A;  3K0J A;  2HHW A;  4QWA A;  3B8H A;  2CWK A;  1ZA1 B;  4NE9 C;  1DTQ A;  2IMO A;  3DN9 A;  2VOP A;  1UEK A;  1QAX A;  2DIS A;  2VDH A;  3M9O B;  3NGT A;  3NMR A;  2Z2Y B;  2XLK A;  1L3V A;  4DUT A;  1J5O A;  1KTV A;  5KTQ A;  5ETS A;  3WHI A;  3Q0A A;  4K0K F;  3FDS A;  2EBE A;  2HMI A;  3GQC A;  2F4V J;  4PAA A;  3Q2T C;  5IV4 A;  4Y0F A;  4RW9 A;  1LWC B;  3MM8 A;  2ZC4 A;  2Y1R I;  4P2X A;  3MPU B;  2RRB A;  4WYW A;  2MDA A;  1XR5 A;  4DPY A;  2P9G A;  3GR1 A;  1HQU B;  2AZ3 A;  4EUV A;  4X62 F;  2M3D A;  1EET A;  3T41 A;  1P1L A;  1IBM J;  2CQ1 A;  4DFJ A;  3TO8 A;  1UZD A;  1FEH A;  2GIQ A;  3R2C J;  2V50 A;  4GVB A;  4ZA1 A;  4ETZ A;  2RML A;  4WFX A;  4ZPD A;  3M32 B;  3KKF A;  2EFN A;  2C3M A;  2RUG A;  2ZOG A;  2NYH A;  3AOC A;  5HP1 A;  2HW3 A;  2MKH A;  4I7F B;  4CP5 A;  1YTY A;  2ZKT A;  2KH9 A;  1F9E B;  2LP4 A;  4F02 A;  3F0N A;  2X1A A;  1ITP A;  1RWU A;  3THT A;  2B7B B;  2WVE A;  5HJX A;  4DOZ A;  4J37 A;  1RHJ B;  4ELV A;  3QAE A;  4DV0 J;  2VPZ B;  4WWS A;  2DPI A;  1R27 B;  1RZM A;  3EX7 B;  3ZFV A;  2FJA B;  3OTC A;  4DQQ A;  1HWK A;  2AU0 A;  1Y4Z B;  2RU9 A;  1B4S A;  4ED8 A;  3M2R A;  4TYA A;  5I42 A;  2GGP B;  5FDL A;  1Y5I B;  2UXD J;  4ILR A;  5KFT A;  1WHX A;  4HAC B;  1I94 J;  3AQO A;  3OV7 A;  2J6S A;  2CQ3 A;  2HHU A;  1RT6 A;  1F3F A;  3RAM A;  3DU5 A;  2KL8 A;  4R25 A;  2HHT A;  2E5L F;  4DZ6 A;  5D4P A;  1JJC B;  4G1Q B;  3JTN A;  1LW2 B;  6FDR A;  2HGL A;  1D09 B;  2GS8 A;  4MIW A;  3PHT A;  3CVK A;  2Z2L A;  1K47 A;  4EO8 A;  3B4D A;  4L6V 3;  4DV6 F;  4YB1 P;  1W26 A;  4L74 A;  3BKU A;  1X5O A;  4NYO A;  2UZA A;  1R0B G;  2QE5 A;  4GKK J;  4ED3 A;  3CJ0 A;  4X64 J;  3ZO7 A;  3TAQ A;  2GQC A;  4CT9 A;  1GAO A;  3IBW A;  3AB2 B;  5BR8 F;  2SXL A;  2O01 C;  3MWB A;  2PT0 A;  4A47 A;  4WFA Q;  4QJV A;  3MF5 A;  1C0U A;  2DIU A;  1JNR B;  2WRM A;  1QAJ A;  4RWX A;  4ERD A;  4ZIW A;  4B9M A;  2YWG A;  4CLW A;  1PAU B;  1S9G B;  2A0F B;  1FA0 A;  2IJN A;  1FXD A;  2IM3 A;  2ZNY A;  5D6G A;  1N32 F;  2X51 A;  3ZXW A;  4WF9 Q;  4ZP6 A;  4FF1 A;  4X4U A;  1N88 A;  4K4Z A;  3SFU A;  3T1Y J;  3D2W A;  2V2Q A;  3VAH A;  1HBN B;  3C14 A;  3H5X A;  3C15 A;  1BQN A;  4ZLJ A;  2KJV A;  2F40 A;  2RQC A;  2WZ1 A;  4LF4 J;  2OMO A;  2N4C A;  3D1Q A;  3DOK A;  1LXJ A;  2W7P A;  4B9N A;  1V3S A;  1IBL F;  1LWX A;  1GK8 A;  2MSS A;  4PWU A;  2FY8 A;  1FXR A;  4AL6 A;  5L1L A;  3CWJ A;  3NEK A;  2QIF A;  1RTI B;  3H8Y A;  3DNC A;  2A6M A;  5A76 A;  1N5Y B;  2GAG C;  4IDK A;  1VRU B;  3IN5 A;  4EFA C;  2HLU A;  2V8P A;  4I6Y A;  3B4M A;  1TUG B;  1JLC A;  4OZN A;  4NEZ A;  3N9U C;  2JC1 A;  3WZ0 A;  3UR3 C;  1JX4 A;  3M05 A;  1HD1 A;  4K4T A;  1GTH A;  1AFI A;  3BM7 A;  1EKS A;  2FGC A;  2XMM A;  5IXU A;  2PA8 D;  3HK2 A;  1KHV A;  4MK7 A;  1NSP A;  3UVJ B;  1YJ9 S;  1FER A;  1T05 B;  4KQZ A;  4K4S A;  2WSE C;  3W64 A;  3QGP A;  4LFC F;  2HND B;  2DVI A;  1REG X;  2UUC J;  4B02 A;  2EI5 A;  4ECZ A;  3K5O A;  3W65 A;  4F3Q A;  1UEV A;  2CG4 A;  5LM7 E;  4NYP A;  4RUH A;  1HNX J;  1KD1 T;  4MAK A;  4K4X A;  3N79 A;  2CNK B;  1OMS A;  2I2Y A;  4OYO A;  3FCV A;  4MKA A;  4PYD A;  4Y00 A;  4UY8 T;  4TLQ A;  5LSO A;  4L75 A;  2V34 A;  1FFW B;  1DLO B;  4JI5 J;  2CJA A;  2ZM6 F;  1Q7L B;  2NPI A;  2G2O A;  3NWR A;  1TKZ B;  2CPJ A;  4J9V A;  4DWI A;  1DQ8 A;  1O8B A;  2GO8 A;  5HMX A;  3Q83 A;  3DLE A;  4LF5 F;  2XLJ A;  4B3S F;  4ZVF A;  4J90 A;  1RT4 A;  2WW4 A;  1IKV A;  1TKT B;  5KFF A;  5D77 A;  1NLK L;  2QFI A;  1X4D A;  3M9M B;  1YGY A;  1EKR A;  2KT5 A;  1VCT A;  2I1R A;  3TA0 A;  2W2P P;  5LXY A;  1SKW A;  3UN5 A;  2B7C B;  2MJU A;  4OZ3 A;  3MMJ A;  1M90 T;  2Y1J A;  2WW8 A;  1T11 A;  1IR1 A;  1U02 A;  4UY8 5;  2BE7 D;  2XM3 A;  3V2U C;  3BF4 A;  4AMP A;  4CRJ A;  4ATN A;  3IBC B;  1H7W A;  2CVI A;  2H54 B;  4ZCM A;  3VAK A;  4J9S A;  4URG A;  2IPO B;  4GC7 A;  4C98 A;  5F8N A;  1LQ9 A;  1VGY A;  4KO0 B;  2R7U A;  1X60 A;  2QGF B;  1VDH A;  2C28 A;  2P5V A;  1MNE A;  2LCW A;  4K2X A;  2GW8 A;  2ZKU A;  2OML A;  2B51 A;  3GMG A;  5F3Z A;  4WFZ A;  5KT7 A;  2VFU A;  2C1E B;  1OWX A;  2E66 A;  4C3L A;  2OAU A;  3I5C A;  3TUI C;  3EVO A;  2DTJ A;  2B9W A;  2X7I A;  2DIV A;  5I4M A;  4OHX A;  4F4Y A;  5D78 A;  4KYZ A;  1FNM A;  3N01 A;  3MUT P;  1VC0 A;  1NK4 A;  4OYX A;  2BQ3 A;  3PV8 A;  5E5N A;  1D3W A;  5KFL A;  3GIR A;  4HH0 A;  1HNI B;  1VQN S;  3RGI A;  5F0W A;  1T9W A;  2BDP A;  3KWM A;  1NDK A;  4AMN A;  1HAR A;  3IWN C;  5C5J A;  2YKN A;  1N5S A;  2AJF E;  4DL6 A;  3KLE A;  4J9M A;  1KQK A;  3OSP A;  1WEL A;  2FHJ A;  4JI2 J;  1IKY A;  3H7H B;  1MMN A;  3W8P A;  5JVH Q;  2UV8 G;  2AYG A;  4DLG A;  1S59 A;  1GMW D;  4FPR A;  4F2R A;  2RNE A;  1S1T A;  4TKT A;  1FK9 B;  1U1N A;  4PR6 A;  1S1W B;  4M5J A;  2BUN A;  1XMB A;  2VQF F;  2ZWP A;  5AE1 A;  4O44 B;  2PDA A;  1RHK B;  1JLQ A;  3QGG A;  4B08 A;  2IA0 A;  5LXR A;  4R0J A;  2JX2 A;  2CPZ A;  2XCP A;  1ZBT A;  4LJM A;  3X1L B;  5GAD I;  5A8R A;  4KFB B;  2H65 B;  4U7U K;  3NOC A;  4EK2 A;  3OD2 A;  1BQM B;  1MN9 A;  4ZPB A;  4OX7 A;  4DF4 A;  1WTF A;  4O4R A;  2O67 A;  4ID8 A;  2VAS A;  3I4P A;  3GCX P;  1VHF A;  2FDN A;  1YRT A;  2MZ1 A;  4X4O A;  2WTF A;  2CNN B;  3UCU P;  4DR7 J;  1QTM A;  4J9R A;  1Q8K A;  2QJ3 A;  1HFE L;  2B6A A;  2JOQ A;  1NPR A;  2M4M A;  3EM1 A;  2BW7 A;  4KIA A;  2W24 A;  1HNV A;  4C8Y A;  3OTD A;  1FD2 A;  2DNL A;  1U0H B;  4JI0 J;  3SI8 A;  2ZOF A;  2DO0 A;  5HJY A;  1FKO A;  3SCI E;  3MEC A;  2H4W B;  4MIA A;  2LQJ A;  2HWT A;  5J1N A;  3ETO A;  4N8O A;  2QL7 B;  1N0U A;  4ZHR B;  2HHH J;  2H48 B;  3UI3 A;  1ZM9 A;  5K5M A;  3A3O B;  4M5G A;  4O0I A;  1U1P A;  5KT5 A;  3QT7 A;  2IBO A;  3TX8 A;  3OVB A;  2M88 A;  1SBR A;  3MPW A;  4YQW A;  2LEA A;  2APO A;  4IQX A;  1YI2 S;  1TMJ A;  3LAM A;  5DS7 A;  3HSD A;  5KG0 A;  1HI8 A;  2IFX A;  2BJE A;  1HWJ A;  5CH7 B;  1F9F A;  1Q5Y A;  5DG7 A;  2G4B A;  5E3Q A;  4S0M A;  4AL7 A;  2OH2 A;  2QN6 B;  4PQA A;  2UUT A;  1WOS A;  3RJM B;  3CCZ A;  3AT1 B;  3O2I A;  3FKB A;  2BKN A;  1WG5 A;  3HSJ A;  4FYW B;  3EUN A;  3PR4 A;  4YHH F;  1WOP A;  3QSI A;  2HHQ A;  2L41 A;  1T0T V;  3AOA A;  4KHM A;  3VAM A;  2Q3P A;  2RF2 A;  1YJV A;  2XMJ A;  3FQL A;  2NXC A;  3CXC R;  4Y3C A;  4UUW A;  2MKI A;  5DZ6 A;  1G1X A;  4BLG A;  3P3D A;  2VG5 A;  2VG7 A;  4DSF A;  3TAM A;  3PZP A;  4WXW A;  8RUC A;  1S1V B;  2C2N A;  3BBF A;  2CZ9 A;  3G6V A;  4NLQ A;  4ZVQ B;  3VQT A;  1WUU A;  4OX9 F;  3MTK A;  2YQ1 A;  1C4C A;  3PEH A;  4QIE A;  1RK8 A;  2DH9 A;  5J2M B;  4M5K A;  4F0H A;  1NH7 A;  3QT8 A;  3PJW A;  4X62 J;  4J7C A;  1AB8 A;  3PJ9 A;  3NGS A;  5AJ3 F;  1HQE B;  5KG1 A;  2HPU A;  3LP2 B;  5JMN A;  1FRL A;  3HJV A;  2AP6 A;  4U7C A;  1DZ5 A;  1FWP A;  3CCQ S;  3D0I E;  3R6G B;  5HLF B;  4PXE A;  1JB0 C;  3RZA A;  4RW6 B;  3W2V B;  2FZK B;  2ZUA A;  5EDW A;  2QX0 A;  1E6Y A;  2AZ1 A;  2N7Y A;  2L9W A;  4PWD A;  4ELT A;  3BQ2 A;  2JRS A;  4K5S A;  1RT5 B;  2B43 A;  1AUS L;  4LVO P;  3OFH A;  3ZZY A;  3TX0 A;  3M1V A;  1RTH A;  2VC0 A;  2D74 B;  2FLP A;  3QJJ A;  2VJV A;  4ID5 A;  4FXD A;  1X4C A;  2F5G A;  4WK3 A;  1JXL A;  2Z8Q A;  5LMN J;  2DT9 A;  3MD3 A;  1EJ7 L;  6FD1 A;  3AFG A;  2E1R A;  5D0H A;  2RDJ A;  4F2S A;  1SKS A;  4X66 J;  1O6X A;  3AY0 A;  2LXI A;  1S1X B;  1R0A B;  5H9E J;  2HBQ B;  1EQM A;  4DR6 F;  3LWL A;  3PYD A;  1S1U A;  4FF2 A;  3H98 A;  5LT5 A;  2V6A A;  1IJE B;  3D1O A;  1YWX A;  2E5L J;  2CWX A;  3DLL Q;  1JLA A;  1KBR A;  4HDH A;  3P6Y C;  4DV1 F;  1YRX A;  2YKM B;  4QU6 A;  1U2R A;  1TQL A;  3IFE A;  3R3T A;  1XWL A;  3OPK A;  2PFD A;  1AFJ A;  3EGV A;  3OBI A;  1FEE A;  2DHS A;  1CJT B;  1JLE A;  2NS1 B;  4ICL B;  1BMQ B;  4KE5 A;  2JZ5 A;  4X65 F;  2DNO A;  1Q95 G;  3PYF A;  1HWI A;  1RAC B;  5IM0 A;  2NCK L;  2IC3 B;  1CUL B;  1RT1 A;  2GC8 A;  1GXT A;  4OJ3 A;  2B3T B;  3M2V B;  1U09 A;  4AND A;  4DV2 F;  3MAA B;  2V0N A;  1VQS A;  2J9E A;  3HLU A;  4M5H A;  2OTJ S;  1VBK A;  4MFB B;  1PBA A;  2N7C A;  4DL5 A;  2N82 B;  3CCL S;  3MMB B;  2VIC A;  4L72 B;  3WC2 A;  1L3K A;  3ENQ A;  3POT B;  4B3R F;  2J76 E;  1FCA A;  4DUY J;  1N33 F;  4EGL A;  2KM8 B;  4X2B A;  3PFO A;  1G7C B;  2LXU A;  1IBK J;  2KFN A;  4ZP9 A;  2DGT A;  2QZ8 A;  1YJW S;  3R27 A;  1WG4 A;  4RNO A;  4HLB A;  1N32 J;  2BAB A;  3I55 S;  2ROP A;  1TL1 B;  2ZHO A;  3UDC A;  2QYC A;  2HRT A;  5KFY A;  4F4A A;  1VC6 A;  2XMK A;  2BRK A;  2CNL B;  4PYA A;  1F60 B;  3QFH A;  4FYY B;  1SUQ A;  3JYT A;  3UN3 A;  4N56 A;  3J7Y I;  4DL2 A;  3I87 A;  3VR1 A;  3UNG C;  5KG2 A;  1TKD A;  1DY3 A;  4DV4 F;  3MHY A;  1OSD A;  2K7K A;  3S6E A;  1AZS B;  2DR5 A;  4PUO B;  1YVF A;  3M8Y A;  3JSR A;  1FFG B;  2ZH8 A;  2XMU A;  4TNO A;  2ZBI A;  1RAA B;  3NNH A;  2ZZN A;  1NEE A;  1S6Q A;  3Q8S B;  1DTQ B;  1GT8 A;  2FHM A;  1WOO A;  4AXI A;  1S99 A;  4XPC A;  2YBV A;  1U48 A;  1DAR A;  3QZ8 A;  4LF8 F;  1UEU A;  1EAR A;  2EFP A;  3KUG A;  3QPI A;  1JXV A;  3FFI B;  2V4Q A;  1IKX A;  1J5O B;  2JVR A;  3H4D A;  1DJ0 A;  4H4M A;  2JEG A;  4Q5V A;  3MUR P;  5CCL A;  2HMI B;  4EU0 A;  5KFC A;  4JI7 F;  3BEG B;  3ENV A;  1RQ0 A;  4RW9 B;  4K4W A;  3MM8 B;  2HSE B;  3BQ1 A;  3W9J A;  2J5A A;  4HR2 A;  1DTT A;  1WC5 A;  4HT7 A;  3I0S A;  4CYU A;  2OEL A;  2G1D A;  1EET B;  1SJQ A;  4N5S A;  3NWG A;  2DRA A;  3FEZ A;  2YXL A;  2QMX A;  5CAA A;  1HNZ J;  1QLN A;  2V8G A;  3RBZ A;  2R2R A;  1DAX A;  3M8W A;  2UUA F;  4KY3 A;  4ZPW R;  2KVI A;  3UNY A;  4LFC J;  3R5J B;  5ADZ A;  4PXD A;  3AB4 B;  4DR2 J;  5AE2 A;  3CCU S;  1RWM B;  2Z58 B;  2H5E A;  1FDD A;  1DQ9 A;  4JBC A;  2UVW A;  1MRO B;  3HZG A;  4YN3 B;  1NHK L;  5HP1 B;  1IXK A;  1JLB A;  5L1I A;  3VZH A;  1QSY A;  2DNZ A;  2FLL A;  1F5B A;  3QIP A;  2HQI A;  2KKH A;  1H98 A;  4QYR A;  4DQR A;  5F8H A;  2Y9H A;  3FEX B;  5KG7 A;  1RAH B;  3SCK E;  2DXE A;  4R0E A;  1HKA A;  2ZH7 A;  1EZZ B;  3CCT A;  5C42 A;  3KG0 A;  4B3S J;  5HVF A;  4ZMM A;  2HG4 A;  3BYR A;  1YZ6 A;  1KKH A;  3M2R B;  5K14 A;  3ULH A;  5I42 B;  2HFS A;  5FDL B;  2IY5 B;  1SXL A;  2W9B A;  5EX3 A;  3KHL A;  2VBX A;  1MWQ A;  4BHQ A;  4OI2 A;  4YOE A;  1UVJ A;  3KMQ A;  4NXN F;  2WVB A;  2JHE A;  3I4H X;  1RT6 B;  3KLI A;  2HWH A;  3T6J A;  2G13 A;  3HFZ B;  4NLP A;  5FJ4 A;  2FJB B;  2GA7 A;  1RSC A;  2J9D A;  4GC6 A;  4B3T F;  4OLO A;  3TWZ A;  2XMT A;  4EZ6 A;  1ZZN A;  5F8M A;  5KFQ A;  2F8E X;  4C0O C;  2K8G A;  1CC8 A;  5KOX A;  3DOM A;  3KJV A;  4Y2I A;  3WQP A;  3GYG A;  2HUR A;  2HQ3 A;  4AMM A;  4LRA A;  3HFV A;  4JV0 A;  2IVF B;  4DL3 A;  3DRR A;  1FKP A;  1KOH A;  3FZB A;  1S6P B;  4N7T A;  3CIM A;  7FD1 A;  2CVE A;  3PRV A;  1SJF A;  2HHS A;  2HGN A;  2V2Z A;  1LK7 A;  1C0U B;  5L9N A;  1URR A;  1VBY A;  3GII A;  2XI2 A;  2XWX A;  5D0R A;  1VS3 A;  1Q86 T;  5D3G B;  2YWH A;  1TL3 B;  3BSN A;  4NCB A;  1UFK A;  3OSN A;  1W25 A;  2WCX A;  2I6W A;  3VGT A;  1CJV A;  1VK3 A;  3NGR A;  5HMW A;  1EHW A;  1ICE B;  4XIU A;  2UUB F;  1LK5 A;  3PCO B;  2XSJ A;  3A1Y G;  4Z7C A;  2KRB A;  2Z56 B;  3GSI A;  1P1T A;  3OJS A;  3AXK A;  1WDD A;  3GR0 A;  2UP1 A;  3C15 B;  2OHD A;  2MB0 B;  1K0V A;  2FC8 A;  3OFF A;  3G6Y A;  2BR0 A;  2MY7 A;  3NL0 A;  3G6E S;  4WE1 B;  3LGN A;  4UF4 A;  2IHR 1;  4JI4 F;  3DOK B;  4M63 A;  1R8H A;  3OXL A;  2IRY A;  2DHA A;  3B78 A;  4USU A;  2DD8 S;  3MED A;  1UA0 A;  1OO0 B;  2ZJP Q;  1SKR A;  3OJU A;  3M4X A;  2VQF J;  2FC9 A;  5IQQ A;  2CNO B;  4DS5 A;  3VWS A;  4WCE Q;  2V94 A;  4ECS A;  1S97 A;  2B4O A;  1K0T A;  2XG8 A;  4UUX A;  2GQQ A;  2OI2 A;  4YEA A;  2JWN A;  2PFF B;  2JEJ A;  1YJ7 A;  4ES1 A;  2HKE A;  5CYM A;  4ZVH A;  2MQ8 A;  1TR0 A;  2XS5 A;  3OW2 R;  5D0G A;  4OIX A;  1ACM B;  2AYE A;  3BBB A;  5KT4 A;  4DL7 A;  3N6M A;  1JLC B;  2BV3 A;  3NCP A;  1J5E F;  2VON A;  2CJB A;  3V6H A;  4JOU A;  3NLC A;  3CDU A;  2QYG A;  1WI6 A;  4DU7 A;  1OS5 A;  2W7A A;  4LMZ A;  4OZ0 A;  4Z7Y A;  2CA9 A;  2GX8 A;  1WKJ A;  3W60 A;  2D9O A;  3W3S A;  2CQ2 A;  3PY8 A;  2R9L A;  3NS7 B;  4JI6 F;  3QFW A;  4K50 A;  1VQK S;  1X5S A;  4C8K A;  4YME A;  2DGO A;  5GMK a;  1FD8 A;  4QYZ J;  1OSC A;  3PW5 A;  4ANC A;  3A3P B;  3ZZZ A;  1GX6 A;  3Q86 A;  2H51 B;  3D67 A;  1RWK B;  2FHO B;  4OI3 A;  2DGW A;  4DCO B;  3BJY A;  3HD2 A;  3L7O A;  3CCR S;  4DR1 J;  2XHW A;  4P75 A;  3DLE B;  1SC4 B;  2QMU B;  4DEZ A;  4NLX A;  2MZR A;  2WSF C;  2WOM A;  1RT4 B;  1L5U A;  5L8R C;  3JQK A;  4ZOS A;  4F3M A;  3C3L A;  1HWL A;  1A9N B;  1ZM3 A;  2OPS B;  2BJD A;  3DU6 A;  2LQ5 A;  3F44 A;  2RQM A;  2QSF A;  4YHH J;  4WU2 A;  3DLB A;  2VPX B;  2FJD B;  5KFP A;  4DX6 A;  4OHW A;  3CCW A;  5IZH A;  5K9F A;  3G8S A;  4U6P A;  1P9Q C;  3R9L A;  1F5A A;  3FQK A;  4WXO A;  4P10 A;  4UT4 A;  4ED6 A;  2QLB B;  2PI5 A;  2KM8 C;  3PFE A;  1EP4 A;  2KYZ A;  3QAT A;  2QSW A;  1QE1 A;  5KFA A;  3IR6 B;  2YQ0 A;  3JSB A;  2WHO A;  2KXH A;  5CA5 A;  3TVY A;  4ECW A;  3I56 S;  2XO7 A;  4BWM A;  2ALZ A;  3W66 A;  4Y6I A;  3RB4 A;  2CJY B;  4M5N A;  4PPZ A;  3J7A N;  2MY8 A;  1YLX A;  1D9A A;  4M5L A;  3GFH A;  5JUM A;  2MQQ A;  2AJ2 A;  2X1G A;  3CB4 A;  3CCE S;  5AJ3 J;  4RKU C;  3D7S B;  1FJG F;  2U1A A;  5H9F J;  4J9U E;  3EGW B;  4KKO A;  2JDJ A;  1WHY A;  3TNV A;  2HS4 A;  1FTR A;  1VOM A;  1RA6 A;  1UJ4 A;  2HGM A;  3HHL A;  3U1N A;  1RTJ B;  2DY9 A;  1WEZ A;  2DYA A;  2XYP B;  1HL6 A;  1Q8I A;  4DHV A;  4G65 A;  2X1F A;  3JAM U;  2HFN A;  1KWM A;  2PMW A;  3H4B A;  1KLN A;  4OHY A;  4ZPV R;  2ZZM A;  4UQT A;  3O6Q A;  2JL9 A;  3KLE B;  4FVC A;  2CQ4 A;  3BO2 A;  2RKI A;  4RW4 A;  3J80 U;  1UWB A;  4DFK A;  1HMV A;  1ELO A;  1YJR A;  1IKY B;  4ZPT R;  3IRW P;  1K8A T;  2F4V F;  2V2K A;  4H4K C;  5KFJ A;  2FTR A;  4CM2 A;  3QYY A;  2BJ9 A;  3DFE A;  3ICL A;  3O44 A;  1S1T B;  2YNH A;  4PEO A;  3PW4 A;  1R43 A;  1LWE A;  4ENO A;  1IWA A;  1GXL A;  2IDE A;  4DR6 J;  2W4C A;  2BKO A;  3D3C J;  3A4T A;  3WX4 A;  1U1L A;  1FJC A;  1C0T A;  5HVH A;  1VQO S;  3HD1 A;  4ETX A;  2UV8 A;  5A8R B;  2P6S A;  2PD1 A;  4IRD A;  4DS4 A;  5BYR A;  4DV1 J;  2HBY B;  4KBI A;  3D68 A;  4HKQ A;  4ALZ A;  1RGV A;  1IM6 A;  3L7P A;  3FJ2 A;  1R31 A;  1Y3K A;  1FF2 A;  2AF6 A;  4FZV A;  1WSV A;  3N4W A;  2DHH A;  2CKW A;  2VHG A;  2OD6 A;  4X65 J;  4Y34 A;  2OPQ A;  1OYD A;  2W2M P;  1X5P A;  5HQ8 A;  2UXB J;  4AT1 B;  2AX1 A;  1ZPV A;  1UTA A;  4V19 J;  2K3I A;  4DV0 F;  4ZJO A;  3SQG A;  4NX9 A;  5HAO A;  1Y3J A;  3OTE A;  3M2U A;  3FVY A;  2B6A B;  4PZV A;  5HI7 A;  1Y0H A;  1HNV B;  3VAF A;  2GML A;  4DLE A;  3CSK A;  2IJF A;  2J9D E;  4ED0 A;  1Y7P A;  3M8R A;  1FKO B;  3MEC B;  5L39 A;  4ZIT A;  2UXD F;  4QPT A;  3GSD A;  3MOJ B;  2PEH A;  1X7V A;  1I94 F;  2ZVI A;  5I3Q A;  3G82 A;  4ECX A;  1ZTW A;  1S76 D;  5F8J A;  1NK6 A;  3WDO A;  3D4J A;  2HNY A;  1T3O A;  1XQI A;  4EI2 A;  2MGZ A;  4TU9 A;  1VLO A;  3KUH A;  2D3O R;  5IT0 A;  3PYG A;  2KZZ A;  4GKJ J;  2AD9 A;  3PW7 A;  2IVM A;  1TK0 A;  1T02 A;  2BRL A;  3ETM A;  1BQX A;  1SJR A;  4EWT A;  2R7V A;  1RCX B;  1R0C B;  5LMU J;  5DZ7 A;  2ROE A;  2JC0 A;  2MQO A;  4B17 A;  3KDN A;  2VU5 A;  1QM9 A;  3HSZ A;  3CNQ P;  3MFI A;  5D0E A;  3R7S B;  4X64 F;  2AGO A;  1JK9 B;  1CS4 B;  3QID A;  3SBM A;  1PIE A;  3R1H A;  4W90 B;  1B70 B;  1QD1 A;  5ETN A;  4OI1 A;  2RF2 B;  1VYA A;  4RNM A;  4F0K A;  2DRB A;  1JKH A;  1OY9 A;  2FY1 A;  4LF8 J;  2DCU B;  4N8N A;  4DJB A;  1VFJ A;  4XAK A;  4A8K A;  3B54 A;  5B09 A;  4ES2 A;  1MML A;  1RAJ A;  4DUZ J;  2VG5 B;  1VR6 A;  4FXV A;  3CJ5 A;  2VG7 B;  3U1M A;  3TAM B;  2L9D A;  2HYI B;  4JI7 J;  3NBP A;  3GB0 A;  2BX6 A;  3BGR A;  3W5X A;  4DSK A;  2K7J A;  3UW1 A;  1RB0 A;  1KVK A;  2YWE A;  2XGQ A;  3F73 A;  4OYB A;  4Q43 A;  3UDV A;  4DX7 A;  3T3F A;  3R8Y A;  2GQ2 A;  3JTP A;  3M9N B;  2J6T A;  1RBO B;  4NLV A;  1TL7 A;  1KN6 A;  2E1C A;  2ZH2 A;  4OZ1 A;  2KRR A;  4LR8 A;  4O0N A;  5LJ5 Y;  4LF4 F;  2ZH1 A;  4RL1 A;  4M1K A;  4RWW A;  4DSE A;  4HHH A;  1E6Y B;  4F7V A;  4PWD B;  3IWL A;  3OL8 A;  4Y2M A;  3DRS A;  4F25 A;  3THV A;  5HAN A;  2HNZ A;  1YHQ S;  3ZTQ A;  4DN9 A;  3R5B A;  1WEX A;  3TJ9 A;  4KPY A;  2L3M A;  1VHI A;  5L38 A;  5GMD A;  1ARO P;  3AOD A;  5J1E A;  3M1V B;  1RTH B;  4ID5 B;  2YKP A;  1XK8 A;  3V81 A;  2RHS B;  1S0N A;  1U25 A;  3V4I A;  3OFG A;  2J0S D;  1H73 A;  3TAP A;  1MG7 A;  3V6D B;  5A8K A;  5KFE A;  4IUF A;  2GHP A;  2XWY A;  1BWV A;  4TY9 A;  3AJ1 A;  3U1L A;  3NG8 A;  3I32 A;  4ZCK A;  2O1P A;  1PIL A;  2WSC C;  1S1U B;  2YWF A;  2DGS A;  1Y11 A;  5IT9 U;  4WK1 A;  1X4B A;  4V1A k;  4KGX B;  3M30 A;  2BQU A;  1U6F A;  4NYZ A;  3JS9 A;  1N0V C;  4P74 A;  3CMA S;  2CJQ A;  1JLA B;  4DL4 A;  4A8F A;  5BJR A;  1HHQ A;  4I2Q A;  2R7W A;  5C25 A;  5B7W A;  2BBE A;  3TA1 A;  1RLD A;  4KV8 A;  1HNX F;  3UCZ P;  2DBB A;  2UXC J;  1JLE B;  1RWN B;  3IR7 B;  1RTZ A;  2AWZ A;  5DDR C;  2W4D A;  3I82 A;  1KS2 A;  4NI2 A;  2WBM A;  5IM0 B;  3VCD A;  4M5M A;  3GV5 B;  3D3B J;  1RT1 B;  1B7F A;  4JI5 F;  2Z4P A;  3TI0 A;  3AD7 C;  3BDE A;  4HI2 A;  2V67 A;  2RRN A;  2OSQ A;  4MT1 A;  3MR7 A;  5KG3 A;  4QU7 A;  3W7B A;  4U95 A;  3P5B P;  4P2S A;  4NL5 A;  1UWA A;  1RHQ B;  4ZCI A;  1C1C A;  4HH1 A;  4UOG A;  3LF0 A;  4IYQ A;  4PWW A;  3QJP A;  2HZC A;  2MHN A;  2FVQ A;  2HFO A;  3I31 A;  4XPE A;  5LSL A;  4L76 A;  3HHE A;  1V5V A;  5LJ3 Y;  4PG5 A;  3BN7 A;  4WTO B;  4LF7 F;  1SJ1 A;  3PM9 A;  2VKZ G;  4NA3 A;  4USJ C;  3VAL A;  2M52 A;  1NB7 A;  2C22 A;  3MM9 A;  4CNZ A;  1ZZF A;  4LSZ B;  1PYT A;  3IG1 A;  2CAJ A;  3VZI A;  4QIF A;  2PI4 A;  1SUQ B;  3ILI A;  3JYT B;  1NHV A;  5HRO A;  4U8Y A;  4DI6 A;  3CGI A;  1VI7 A;  4JI4 J;  4TY8 A;  2DH8 A;  2DR6 A;  5CD4 A;  2EEY A;  1R6V A;  3K7R A;  2ASL A;  4DU8 A;  1S6Q B;  1FRM A;  1U1M A;  5BXI A;  2W9A A;  1BE4 A;  2VFV A;  4F4X A;  1IQT A;  4C3M A;  1VIX A;  1H2T Z;  2CPD A;  4C8N A;  1BC6 A;  1IKX B;  3QLH A;  2P9C A;  3MR5 A;  2C42 A;  4H4M B;  4E98 A;  3QMQ A;  4FKX A;  2V4R A;  1NSA A;  1KON A;  4CNY A;  1WC0 A;  3PVX A;  2EPI A;  3BGL A;  3TUJ C;  3GZ7 A;  2HVZ A;  5IS2 A;  1DTT B;  5THW A;  1FE4 A;  4CLZ A;  1D8Z A;  4UST A;  2CFX A;  2IIH A;  2BVZ A;  3I0S B;  1X4F A;  4CYU B;  2HAI A;  1IN0 A;  4KGZ B;  4X4V A;  1TP7 A;  4I64 A;  4R5P A;  4JI2 F;  3OVA A;  3EZO A;  2YWK A;  3IGN A;  3KXD A;  2EFG A;  3M7V A;  1PGZ A;  2YQ3 A;  3QWU A;  5L9X A;  1RWV B;  4ZPC A;  3W5Z A;  4ECY A;  8AT1 B;  4JI6 J;  2ZEJ A;  1X9S A;  3UE2 A;  5DRK A;  2N3L A;  3MMC A;  1JLB B;  1B0V A;  3OHA A;  3JAM Y;  4XO0 A;  3H42 A;  2W2O P;  2Y3Y A;  3QIP B;  5IC6 B;  4H4O A;  4G1P A;  1T95 A;  2FZC B;  2Q1L A;  1H3D A;  3CJT A;  1ZET A;  2FJX A;  3IP0 A;  4OJ1 A;  3PIO Q;  2DHG A;  2R7X A;  5C42 B;  2XI3 A;  2XQC A;  3MM7 A;  1DBD A;  5B08 A;  5K14 B;  3S8S A;  1VMB A;  2W9B B;  2DPJ A;  5ETK A;  2ZIT A;  5IV3 A;  4DR7 F;  2DGU A;  4A8M P;  2CG8 A;  2ZH6 A;  1H2U X;  3CD0 A;  1DQA A;  3CW2 C;  1YKW A;  2QT7 A;  2EFO A;  2QFJ A;  3V6K A;  3TYT A;  1FRH A;  5KG4 A;  2HQG A;  2DHX A;  5C2C A;  3MEE A;  1DFD A;  2VH7 A;  2VC1 A;  3AQP A;  4IG3 A;  2XZT B;  4JI0 F;  1KOO A;  2FD2 A;  2HBR B;  4LIR A;  3PG9 A;  1R89 A;  4RO0 A;  2R2U A;  3HZE A;  1SL2 A;  5KFG A;  2F9J A;  3K17 A;  2VD3 A;  1XMO F;  3DOM B;  3KJV B;  1S79 A;  2Q6B A;  3MM6 A;  3J7Y U;  3EZU A;  2W1B A;  3M6V A;  2HBZ B;  2FLO A;  2DR8 A;  2IM1 A;  3PTW A;  4QR0 A;  4IR9 A;  3MCO A;  2DGQ A;  2NZ4 A;  1WC4 A;  3DRR B;  4LFA F;  1FKP B;  4W92 B;  2CJK A;  4CO3 A;  2LEP A;  1DRZ A;  1REV A;  4MMO A;  1RT3 A;  2G0C A;  4KH1 B;  2KHD A;  3E01 A;  2JSX A;  2KI2 A;  4I67 A;  1S9E A;  4HEA 9;  5G0R A;  3DOL A;  1MLA A;  2BAC A;  1TUV A;  4GMK A;  3P5T L;  3TJ8 A;  3AOB A;  5HQM A;  3VAG A;  4DV5 F;  4DZD A;  3RYL A;  3DYA A;  5DLF A;  3BSC A;  4C97 A;  3IR5 B;  4F04 B;  4IG0 A;  2VA3 A;  2MKS A;  2QA4 S;  4RU2 A;  1CJV B;  1M5P C;  5E3P A;  2RRA A;  2I5J A;  2U2F A;  5ETP A;  2HZV A;  2UVU A;  2D7S A;  2XSJ B;  1SIW B;  2HHV A;  2OSR A;  1S10 A;  1TKX A;  4OL8 A;  5B0D A;  2VB6 A;  3IC1 A;  4DPT A;  2ALY B;  3BO4 A;  3RB6 A;  2CPI A;  1NRK A;  2XC9 A;  3MAH A;  1U1Q A;  1UW9 A;  3GJR B;  3N6L A;  1NJX A;  1B99 A;  4C11 A;  4Y2A A;  1WG1 A;  3EVM A;  1SVD A;  2VL1 A;  4KGV B;  3T1H F;  3HVW A;  4DCJ B;  2R7O A;  3MED B;  3CPW R;  4O3N A;  3AHP A;  1F0X A;  5A2Q Y;  2NXE A;  2DKO B;  4MH8 A;  3P49 B;  3Q22 A;  5GAG I;  1XMQ F;  1JNZ B;  3NCR A;  3PO4 A;  2QLX A;  4CLK A;  1FWL A;  4USV A;  4Y65 A;  4F3O A;  3BGU A;  4X4Q A;  3VGS A;  5CYM B;  1RLC L;  2A18 A;  3CT9 A;  3EDR B;  3HCX A;  1NSQ A;  3MMA A;  1A0O B;  4WYL A;  2B8Q A;  2DXF A;  2VZ9 A;  5KOW A;  4RBT A;  5BYQ A;  3G71 S;  2FHJ D;  4YUD A;  1SQG A;  2R2T A;  5D15 A;  2YKO A;  3M6X A;  2MLY A;  3KLH A;  1RP5 A;  2IRX A;  4EMD A;  3KYL A;  3LWM A;  3SQO P;  2LFV A;  3BPD A;  4LRE A;  4C8Z A;  4M5D A;  4RBV A;  4Q8E A;  2X3G A;  3OTO F;  2W25 A;  2CQH A;  3QAU A;  2BJ7 A;  4A4J A;  2K1R A;  2OEM A;  3MD1 A;  1RU1 A;  5LMN F;  4WZM A;  3JSM A; 
#chains in the Genus database with same CATH homology
 2G2O A;  2VZ9 A;  3CJ8 A;  5CZC A;  4RL1 A;  2HG4 A;  3PTW A;  3R8Y A;  2JFD A;  3SBM A;  2QO3 A;  2QC3 A;  2VKZ G;  2QJ3 A;  2C2N A;  3HMJ G;  3K89 A;  2H1Y A;  3TZZ A;  3EZO A;  5DZ6 A;  3G87 A;  3RGI A;  3TZX A;  2VZ8 A;  3BV8 A;  3HHD A;  4QBU A;  3TQE A;  4RR5 A;  1MLA A;  2PFF B;  2G2Y A;  1NM2 A;  5DZ7 A;  3H0P A;  2UV8 G;  3HJV A;  2G2Z A;  2JFK A;  3QAT A;  3IM9 A;  3TZY A;  5CZD A;  3IM8 A;  3TZW A;  3R97 A;  2CUY A;  2G1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...