2C2NA

Structure of human mitochondrial malonyltransferase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
317
structure length
317
Chain Sequence
MGQCSVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAEGLYAVKIRAEAMQEASEAVPSGMLSVLGQPQSKFNFACLEAREHCKSLGIENPVCEVSNYLFPDCRVISGHQEALRFLQKNSSKFHFRRTRMLPVSGAFHTRLMEPAVEPLTQALKAVDIKKPLVSVYSNVHGHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKSCNMQAWKSYSAVDVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MALONYL COA-ACYL CARRIER PROTEIN TRANSACYLASE
publication title Structural Basis for Different Specificities of Acyltransferases Associated with the Human Cytosolic and Mitochondrial Fatty Acid Synthases.
pubmed doi rcsb
source organism Homo sapiens
total genus 115
structure length 317
sequence length 317
chains with identical sequence B
ec nomenclature ec 2.3.1.39: [Acyl-carrier-protein] S-malonyltransferase.
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 2c2nA02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 2c2nA01
2QC3A 4RR5A 3CJ8A 5DZ6A 3R97A 3SBMA 3R8YA 3EZOA 5CZCA 3TQEA 4RL1A 3HMJG 3PTWA 2JFKA 3K89A 3HJVA 3BV8A 2VZ8A 3TZYA 2C2NA 1NM2A 2QO3A 3QATA 2VKZG 2CUYA 2G2YA 2G1HA 3TZXA 2VZ9A 3IM9A 2H1YA 3HHDA 1MLAA 2HG4A 3IM8A 3TZZA 3RGIA 5DZ7A 2G2OA 3TZWA 4QBUA 2JFDA 2G2ZA 2PFFB 3G87A 2UV8G 3H0PA 5CZDA 2QJ3A
chains in the Genus database with same CATH superfamily
4NMXA 2F40A 2OFHX 2UU9J 2IBOA 3WIVA 3WHIA 1YGYA 1U26A 2XZDB 2CZ4A 5F8MA 1VQ6S 1S99A 2N7CA 2Q66A 1WC3A 4PRFA 2E7WA 1B70B 3M1VA 1H7XA 1B4SA 1YG0A 1N56A 1SCJB 3TEGA 3NGDA 3W65A 1TKZB 3OTOJ 3DLHA 2N3OA 3AD7C 3P3DA 1NLKL 4DX5A 4G3IA 3DKDA 2IM3A 3PACA 3RAQA 2F8MA 5GMKa 3QT8A 3CCRS 3GB0A 3QNWB 1S6OA 4RW6B 1P6TA 2B9XA 1S6QA 1IN0A 2DGSA 2WONA 1MWZA 4UY8T 3KG1A 4CH1A 4WIQA 3DLKB 3QAUA 1SUQB 4MTPA 3OFGA 4KYZA 1F2HA 5JVGQ 3G6XA 3SYZA 3KWMA 3SSSA 2Y0SD 1JQGA 1WTBA 1EP4B 4DR5F 1N8RT 3PFEA 4PWDA 1VC6A 4B9MA 3ISZA 1NB7A 2G0JA 2GMHA 3P45B 3GFXA 3FUYA 3PJXA 3QT7A 3TA0A 1HIYA 5I42A 1CVJA 4NCAA 4DV5J 4LR9A 4F4ZA 2VZ8A 3MTJA 2EBGA 4J9VA 3PRVA 2YKMB 4OX8A 2ERRA 4OV1A 5CYMA 1LWEB 3DM2B 2QE5A 1SIWB 5KG6A 3SCJE 2UUTA 2XMTA 4CYUA 1K47A 4EMDA 1KLNA 3S1TA 2C2EA 2ADBA 3MMCB 2YKNB 2GW8A 4ZP9A 4TU9A 1N52B 4M5MA 3BEGB 1EJ7L 4A8QA 4I56A 1Y11A 3BYRA 4TN2A 2KI2A 3CVKA 1FCAA 1QUVA 2IJFA 5A76A 5HMYA 1NDKA 4DSKA 2KT5A 1X4BA 3PRBA 5T41A 1HI1A 1M5HA 1DURA 2PI5A 3ZTSA 4CLYA 4YS2A 1PYOB 3GV5B 2J5AA 2IC3A 2NXCA 4KH1B 1GEHA 1QSYA 2ZITA 5DJBA 1CC8A 2ZUGA 3FGVA 2YNGA 1IQZA 1YHQS 3MM6A 4E8UA 5A2QU 1YBAA 1HWIA 4PCQA 1ITPA 4AL5A 2ALYB 3GZ7A 4WK1A 3I96A 3DLEB 2PA3A 1LWCA 2W2OP 4I69A 2ILYA 3HFVA 5F0UA 2GHVC 1Z4UA 3UCGA 1X31C 4ES2A 2MSTA 1HWLA 3D1HA 1GXUA 1BQMA 2V0NA 2WBRA 2FYXA 3ZZYA 3HHKA 2QA1A 3DRXA 2WRMA 2ZWPA 2EVZA 4LF8F 1DLOB 1KQGB 2MKJA 4WXWA 4DG1A 4QW9A 4FNHA 4F3QA 4NXMJ 3ULHA 3KHHA 3T1HJ 4KSEB 2CDRB 3IWLA 2QL5B 4Y00A 1YJ7A 2EFPA 1R8PA 1SIZA 1S5ZA 1X8DA 4TLQA 5A8RB 4DPTA 2RRBA 1VQMS 4KKOB 4YB5A 3C16B 1HBNB 4O3QA 2AWZA 2RDDA 1JK9B 2DGOA 4X62F 3V4IA 1R31A 4LSLA 4Q8EA 2DGQA 4O44B 2DR7A 2BM1A 3MR2A 3J81Y 1G6BA 2FUG9 2LEPA 1RTJB 2YNFB 1TU0B 5ETRA 1Y4ZB 3H59A 1OJ4A 3Q8VA 2GA7A 4CWBA 5KFXA 3POTA 2RQMA 2XM3A 2HFZA 3PY8A 3MR5A 3S6EA 3N5FA 1UJ5A 2WK4A 5JJBA 2W8KA 1TVRA 1S9GB 3FZ2A 2OEKA 3F41A 5DDQC 1HMVA 1VOMA 3UDCA 3UNGC 2HHVA 3KLGB 3MFHA 2RD5C 3KLVA 3KUEA 2BW2A 1TFWA 3MURP 3MMAA 2O1PA 1S7HA 2IRXA 1FRIA 4WYLA 4F0HA 2RUGA 3H2VE 2AIRB 2GJ2A 2VC0A 3HO1A 5CYJA 1UJ6A 4Q43A 5IQQA 2VKZG 3SV4A 3R3TA 3M1VB 3BBCA 1CJUA 1EARA 4NLDA 3HVWA 2OH2A 2V94A 3R1HA 5LMUF 5E3CA 3SCIE 1GXTA 1X5TA 1Y3KA 3H7HB 3FVYA 2QFIA 1VLYA 2DHHA 4K4XA 4NLVA 1VBXA 2DBBA 3ZZ0A 2VQEJ 1NNDA 4C98A 4CLSA 4BC9A 3OFHA 4OYIA 1S6QB 1SI9A 2QT7A 2WONB 3G96A 2MTLA 2DRDA 1B3TA 3MM8A 2VG5A 1GQEA 2O01C 4M5DA 3RR7A 1U4BA 2VHGA 4A8OA 3D5MA 2FIUA 1SC4B 2HK3A 3MUVP 1EHWA 1T9TA 2I5JA 3VGSA 2L3MA 2PE8A 2HIQA 2Q79A 4ED2A 1RKIA 4ED3A 4ZVFA 3TJAA 4HR2A 4YY3J 4F4WA 1RJJA 2M8HA 2E5LJ 1DTTA 2CPZA 5KTQA 4DV0F 2ZHBA 4FS2A 1BXNA 4GO7X 3QO9A 3NRBA 3CJ8A 2YKOA 1UAWA 3IO1A 4FF2A 4ELVA 2V4JA 4PWDB 1IKVA 2H5EA 2P9CA 2G2YA 3A8KA 3CJ0A 5I42B 2ZUAA 3IS9A 5ETTA 2QMXA 1FXRA 3NGKA 2ZEJA 1FWPA 2FVSA 4RR5A 1SV5A 4ZN1A 2KT3A 1C0TA 1APSA 4LRDA 5CYMB 5EX0A 1D9DA 1RLCL 3OJSA 2AX0A 2GFFA 3TAQA 1PBUA 1IWAA 1RI7A 1PKUA 4JI7J 1MLAA 4DSEA 2XZTB 1T9XA 4WWSA 3CO0P 3UE2A 2RUSA 1P9QC 1S0VA 4KGXB 2HQ3A 4EYHB 1LW2A 2VBXA 4WTOB 5K20B 4UZBA 5C25B 4IOBA 1RWKB 1HNVA 4RUCA 3HVRA 4A8MP 2KFZA 1MWQA 5ETMA 3CCUS 5CAAA 2GCFA 4A48A 1RWWB 1RAJA 1XR5A 2BJ1A 4KO0A 4DV7F 4O3NA 2FTRA 2UXCJ 3HD1A 2I2YA 3BQ0A 2YQ3A 1NDCA 4UUWA 5AJ3J 1NK5A 3DC2A 2M4MA 2IC3B 2IRYA 3PZPA 3BR8A 4Q7AA 3K58A 3MOJB 3AD9C 4LBIA 3D9BA 1S1XA 2YNGB 4YP3A 4OI4A 4MFBA 3MM6B 3SQOP 3AHPA 2ZH8A 1SJ3P 2CKWA 5HVFA 4LSZB 4ZP6A 3VZIA 2VODA 3SBMA 1HHSA 1JWWA 2W24A 3PW0A 1MW7A 5EHHA 1LWCB 3CJ4A 3HZGA 4EFAC 1WDDA 3VAIA 5E3QA 2X3DA 5F3TA 2B9EA 1RQ0A 3H42A 1LQ9A 1N36J 3VQTA 1H2TZ 2DCUB 1BQMB 2ZH7A 5HI7A 2RQCA 1IXKA 2HHQA 2Z2ZA 1Q81T 3DXBA 3JTOA 2OSQA 1YWXA 3B8HA 3Q2SC 3R5DA 2OGUA 2NPIA 4P73A 5L9XA 2R2TA 4AL6A 1HW8A 3V6DA 1FK9A 1N48A 3W63A 5L38A 4DG1B 1VC5A 2LLZA 4OI2A 2FVPA 4FYVB 4ZIWA 4BS2A 1IWGA 3MECA 4KPYA 3NXZA 2YWKA 4DR6J 3AOBA 3L7OA 3PKYA 4J91A 2BBEA 3Q0AA 3OBIA 2IM0A 1OQ6A 1TL1A 4PG5A 2MHEA 3FDSA 1SQGA 1RHQB 4NYPA 3V4IB 2N3LA 1SVDA 4PXBA 1KD1T 4ANDA 4LSLB 5G4DA 1TMJA 3F56A 2Y8YA 4OX6A 1XNRJ 4ANCA 3DDIA 4J37A 4LF7J 4LRCA 1WHWA 3POTB 4DR1J 1VHIA 4WFXA 4HLBA 2DHXA 2L08A 2DGTA 4IR9A 1TVRB 4A8XA 3OSPA 2FQQB 3Q8YA 1HMVB 5H1SV 5IM0A 1J27A 2K7JA 1UFLA 4X66J 4HDGA 3MPWA 2OEJA 2MQOA 2NCKL 5I3QA 4NLRA 2HZCA 2R8GA 4ED4A 1WELA 2BANA 3EE3A 1CJUB 1HQ2A 3IR6B 5EX3A 2VZ9A 2CG4A 4ZHRA 1HI8A 2BM0A 4QJVA 2J6TA 2RU3A 5C2CA 4DL6A 2HNYA 4XPCA 3Q8QB 4DR7J 3K0JA 4PG8A 4ECSA 4M5IA 5KFMA 3CXCR 1MG7A 4OYZA 1V6HA 3NGUA 1VYAA 1X5OA 4K5RA 5D77A 2LU1A 5HQLA 4ECTA 2DNQA 1N5VA 2OP5A 2EXUA 4DL0C 1FX4A 1B7YB 3MM8B 2VG5B 1QAYA 1U25A 4M5DB 3ZFVA 2ZDPA 5CABA 3TZXA 3KG4A 4NLQA 4YQWA 3EMTA 3G71S 3LP2A 1RWMB 4AE5A 2AW0A 1U2RA 5J1NA 4AT1B 2MQ8A 3HJFA 3OFFA 2ZZNA 1NJXA 4LQ3A 1DTTB 5ETLA 3T1YF 2HHHF 3QO9B 3C6UA 5AE3A 2V4JB 3CD6S 1RU1A 1HBUA 2QA4G 5DLGA 2YWGA 1NHUA 3IS9B 4JB8B 2D41A 2Y1RI 4I4BA 2O5DA 1SV5B 4E98A 4WXOA 2GZOA 2R8KA 1C0TB 2F4FA 4OJ1A 3AA8A 4WIIA 5KFUA 3C19A 3K57A 5BJRA 1FRLA 2HRYA 3GFHA 3FMBA 4YOEA 2VFSA 2GHWA 3CMAS 3UO0A 2G1HA 1YLXA 4QYZK 3M2VA 1LW2B 1Q5VA 3PKMA 1D9AA 4R25A 5DG8A 4WZQA 3VAKA 2Y1IA 3L09A 4BWMA 5L39A 2FJWA 1HNVB 4CH0S 1KVKA 2M3DA 2ZC4A 3HHNB 4ZKAA 1KC8T 4KO0B 2AKWB 4RLEA 5D15A 1N5QA 3QIDA 3V6HA 4TYAA 4QR2A 4CM0A 2P9GA 3M8QA 2B3TB 4XK8C 1RT2A 1GMUA 3D68A 4PQUA 4KTQA 4Q5VA 1S4EA 4URQU 1S1XB 4OHVA 4MFBB 1JLCA 2AGQA 5HATA 2RQKA 2DHSA 1DTQA 4DDFA 1G7CB 1KOHA 3V81A 4B3MJ 4OZNA 1PBAA 2UUAF 1K9MT 4I6WA 3GONA 2HWIA 4NYZA 4DV4F 4U7UD 3MUTP 4AQYF 1RAGB 2IBKA 3TRGA 4HTIA 3FBCA 2EG1A 1MU2A 4PKDB 2YQ1A 5EWEA 1WF2A 2G0CA 5L9NA 4F0MA 2GHPA 3RAXA 4O3SA 3PW2A 1P27B 2IJNA 3C2PA 3QSYB 2EFGA 1WTFA 4TY8A 2Z0GA 1YI2S 3TNVA 3JQJA 2LEBA 2X3GA 1WNEA 3V6DB 3CJ5A 5AXNA 1FK9B 3TEHB 3J81j 5ETKA 1TUWA 2VJUA 1DY3A 4LF6J 5A0YA 3CT9A 4TQRA 3CGIA 1RHUB 2NS1B 3CDUA 4TXSA 3MECB 1N6QA 3VR1A 4ZPCA 3E01A 1VRTA 3LP1A 3DDKA 2B9WA 2D9PA 3C46A 5I3PA 4MK7A 1LWFA 1YITS 2QLJB 1D8YA 1TL1B 1XN9A 3ZZPA 2ZBRA 2FPHX 3W8GA 1JLEA 4B17A 5B0AA 2BA9A 3M8YA 3UQSA 2RHQB 4B02A 2XWXA 5E3RA 2MJNA 3OQ2A 4BCAA 4X4NA 3UDVA 4KBIA 2AJ4A 1R7IA 4DFPA 4O23A 3IBFB 3K17A 1HNZF 2Y9HA 4Q44A 2DRBA 2AQ4A 5CA5A 4XIUA 2Q6BA 4HVZA 4X4PA 2KVIA 1W26A 4MMOA 4J9UE 5IM0B 2JOQA 1UW4A 1WC6A 3H0PA 4ZPVR 1UFKA 3DMJA 4LFCF 3O3LA 5IZHA 1RUSA 3HHDA 3NLCA 3OW2R 4ZDNA 2R2UA 2UUCF 5IXUA 1FJEB 5DQHA 2V8PA 4K4ZA 1OWXA 2BANB 3BKUA 5KFCA 4JI4F 4QWCA 1RYRA 4ZHRB 1D1UA 4LFAJ 3GJTB 4F3MA 3M6UA 1NJYA 3MR6A 2XMMA 1JLBB 5IC4B 2EFNA 2HNYB 3TP2A 3W1YC 5D0EA 1HD0A 1Y3JA 4Y65A 2OIHA 3GV7B 3N28A 2W9BA 2R4FA 5KG7A 3I82A 1RBAA 2XYHB 2DGUA 2HGLA 2VASA 4HKQA 1DBDA 4B3TJ 2BE7D 1R8AA 3RBXA 2WOMA 1V5IB 1HPZA 3B54A 2XGPA 1WEXA 3LP2B 3BN4A 1N4LA 1Q0NA 2GJFA 3EZ5A 2HFOA 1YSJA 2FZGB 3KJNB 2HS4A 5D6GA 3GILA 4ILMA 3C6UB 4BWJA 5KG2A 5F3ZA 5KFJA 5KFAA 4RW8A 1HBUB 1XTZA 1NU4A 1FJGJ 2J0XA 3OL7A 2D69A 1ZOTA 5KAKA 1H72C 4ED5A 2DITA 5FIIA 4ZK7M 5A6WA 2N82B 3QGPA 4QR1A 4TQSA 3D0IE 5RUBA 4JI2F 2HS3A 3H2LA 1VQ9S 3PW5A 1BY9A 4WKRA 1JLAA 3I32A 3J7Z5 2YPYA 1RB0A 2FC8A 1SB6A 4JI8J 2OAUA 3ONQA 1J5EF 2HS0A 3CC7S 1VHFA 5LMNF 3T5HA 2OPRA 1FHTA 3M2VB 1KS2A 2B8QA 2BE2A 3LP0A 1PCAA 3UPFA 3HHLD 3GFZA 1NKCA 2M5YA 3NP5A 3IP0A 2EBEA 1UVIA 1QAXA 1Q5YA 4YDDB 1RXOB 2R7OA 4DLGA 3CEDA 1HNXF 5KFKA 3QJLA 3W5YA 1GMWD 2RAQA 2AYMA 2DNZA 1LWXA 2VQFJ 1T9VA 4OV6A 1E6YA 2KZMA 3EPGA 3TO8A 3M8QB 1NCLA 1RT2B 3U7JA 1E6VA 4PQUB 4OX9F 4C11A 4JI6J 2LVWA 5J2PA 1UFWA 3EUNA 2CNKB 4DQRA 2FDNA 4M1KA 1T9WA 2VA3A 4MK8A 1I1GA 1JLCB 4F4KA 4A8SA 1QLNA 4QR0A 5KG3A 1YKWA 3Q23A 1WKLA 1YJ9S 1DTQB 1FFSB 2W4PA 5AXLA 5LL6d 2I9SA 2MZRA 3MDFA 3KG0A 4CIOA 3V81B 2C3OA 2XMAA 3J7ZT 3LPEA 3DFEA 4RBVA 2J76E 2QZ8A 5K5MA 3QBCA 1SC6A 3FQKA 2HMIA 1MU2B 3GCXP 2PN6A 2LA6A 1FEHA 4U96A 4FDFA 3K5MA 3MPDA 1H98A 5CH7B 4K4UA 1O5JA 2VV5A 1KKHA 1VI7A 3D6MB 5G0RA 2E5JA 4ECWA 4TY8B 3KJFB 2RSQA 3BDEA 1WC0A 2RDIA 2CPYA 4X4VA 2XQCA 1F5BA 2BJDA 3CUNA 4I64A 5FJ4A 2EG2A 1N54B 3M6XA 4C2MA 5E3AA 1WSVA 1KDNA 5GAGI 1C0UA 5A0YB 3HDSA 1LXJA 2IHR1 2JEJA 5L1KA 2XS5A 1YBUA 3KLEA 3G8SA 1N6QB 3CF5Q 4LREA 3E01B 2LXUA 3BREA 1VRTB 2Y0BB 3LP1B 1NHKL 4FVCA 3HD2A 1LWFB 2HBQB 1RGVA 2MYFA 3NS6A 2QA2A 1XJWB 1EKSA 4JI5F 3RB0A 5BYRA 1JLEB 1U2CA 5EUHA 5L8RC 5KFBA 3LANA 4XPEA 3AD8C 4FPIA 1Q8BA 1UVMA 2JZ5A 1FDBA 2J6SA 2DR5A 3ZNUA 5CCLA 2A1BA 2QO3A 1NRKA 4P2FA 3W3SA 1YQHA 5J2QA 1CSJA 5H9EK 5KFTA 2VF3A 2Z56B 1RBLA 2DPJA 2UU9F 4CTAA 5GAHI 1V3SA 2KG1A 5DG7A 1VCTA 4X2BA 2BKPA 2FVRA 3UI3A 1I6JA 4X4RA 1OSCA 1TAUA 3DMJB 3OTOF 1IKXA 2A6MA 2KB2A 1RA7A 1FRXA 4HL9A 2D3ZA 4JV5F 3FC9A 3ILIA 2H4YB 2LXFA 3TA2A 1LFWA 3HSJA 1KQSR 2D3OR 2ASLA 2PT0A 1Y9OA 2XMWA 5SUHA 1YJWS 4F26A 5BYSA 4WK3A 1Q8KA 2AD9A 1NDPA 4WZMA 4DPUA 4YEAA 3Q86A 3R2DJ 2JFDA 2XMJA 4YR3A 2VICA 2DR6A 2YWEA 4FYWB 5KT7A 5DDRC 4JYAJ 4QWEA 3IRXA 2W9BB 3LGHA 3A3PB 3K8VA 2M2BA 3ZZZA 3TZWA 1X60A 3PX6A 2FZCB 4JV2A 1QVFR 2WOMB 1NPPA 1HPZB 1YRXA 5A8KA 1RT3A 1PIEA 5EWGA 1Y5LB 1NEEA 2IIHA 2BABA 4H4OA 2MGZA 4O0NA 5KOXA 4DF4A 4C8ZA 4OZ0A 2AEJA 5GADI 1SC3B 4IO1A 7FDRA 1ZAXA 5F8JA 5CQGA 1N32J 2BW7A 1IJEB 5D0HA 2P5VA 3LTOA 1RKJA 2CIMA 3TQ1A 4ZMMA 4C3MA 4HT7A 4A8FA 2J9DE 2DNPA 2B7BB 2K2PA 4DU8A 1AA1B 2WBMA 4MT1A 4GMKA 1H3DA 3UN3A 1JLAB 4EZ6A 1X4GA 1T9UA 3FSYA 1S4FA 4WFAQ 4A46A 4DR3F 2HRTA 1HA1A 4L75A 1T95A 1U1MA 3NS7B 2OO4A 3DRPA 2HFNA 2YBVA 1RADB 4FBTA 5KG4A 4KHPF 4HHUA 2XMKA 3DGVA 2OPRB 3A12A 3QFHA 4LF5J 2BE2B 3LP0B 2GO8A 5KFLA 1HNIA 1CQMA 2P2CB 5HJXA 1U6FA 2E29A 2CQHA 2CVEA 2MZJA 7FD1A 1KSPA 5GAHU 2MZTA 1N5TA 5LSOA 9ATCB 2MY7A 2J7WA 4CO4A 2BUNA 1IBCB 4D3GA 2BRKA 1RWOB 2AU0A 1S6PA 1E6YB 4K7QA 1X0FA 1N5SA 2PEBA 4C6AA 3PM9A 4RNMA 2LU2A 4Q8FA 5K8NA 1E6VB 1IBLF 4DFKA 1JJCB 4C11B 2Y1JA 5J2PB 2B4PA 2NSCA 2BQRA 2DO0A 4CT8A 4DR2J 2CNLB 2KU7A 3D4JA 2ZVSA 4RU9A 4LF4J 4B08A 2UV8A 2ZHAA 2W2PP 5CD4H 4ECYA 2F63A 4S0MA 3F44A 2G2ZA 1Q7YT 4EUVA 1N34F 3I5AA 2BOPA 3R5JB 3NAIA 3R7NB 3CW2C 3S7RA 4P2SA 4WU3A 2HMIB 4KIAA 2DEIA 4ZLPA 3HI9A 4P6QA 1YZ7A 1J5OA 2J7KA 3TI0A 4NXMF 1WKJA 4M94A 4QZVB 2RT3A 3IN5A 3MM9A 3RUBL 1RT4A 5G0RB 2QN6B 3M32A 4OYXA 2DNRA 4KGKA 1ZYQA 3OLAA 2R2RA 2KL8A 2V8HA 4UZCA 1U1NA 4DLEA 1SBRA 4DSFA 1C0UB 4YHHJ 3QRRA 1ZA1B 2YH1A 3D3CJ 2HZAA 3KLEB 3GJQB 1LFPA 1WG4A 1WHYA 3GQCA 1RBOB 2V9WA 2QX0A 4ED8A 3OJUA 3AJ2A 2FGOA 1Y5IB 5IV3A 2IFXA 4K4TA 3PNIA 5K14A 1FJCA 3RGIA 5LJ5Y 4DMZA 4DOZA 3EX7B 1ZZNA 1FNMA 5KFWA 4I2PA 2CQBA 3B78A 5J2QB 3AODA 2NZ4A 5DO2A 3RU0A 4CTAB 4FBUA 4B3SF 4HHJA 1CEZA 1BQNA 3OR1A 4USJC 2CFXA 1RWNB 1FDAA 4JI1J 1L3UA 1NK4A 1IKYA 5ITHA 3KTQA 1N33F 5KFFA 1TMMA 4QOTA 1OMSA 5C2GA 1IVZA 1IKXB 1WOSA 3P6YC 2DIVA 2N4CA 1IKWA 1AB8A 2CUYA 3PJWA 3CJRA 1PJ5A 1JXVA 1CS4A 5DS7A 2KKHA 1RHJB 2XMUA 2GQ2A 2RS2A 2HURA 4N8NA 4GO5X 4CLTA 2FGCA 4N76A 4KAIA 1BWVA 4ATNA 3QYYA 2MKCA 2BOAA 3DN9A 2Z4PA 1F3VA 2AGOA 3IRXB 2CQIA 2XB2D 3EGZA 1U09A 3G4SS 4EBCA 2CZVC 1Y7PA 1FF2A 4EO8A 3KLHA 4HI2A 2FJDB 2E5LF 2V9KA 2EFQA 1RWUA 3W60A 3BO4A 3W64A 1L3VA 4B3RF 4TU8A 4TY9A 3OHBA 3MPVA 5A8KB 1RT3B 3H5XA 2BEFA 2CPFA 5L1JA 3ICLA 4H4OB 2MGZB 4DR5J 2B0GA 2Z2YB 2ZNZA 5J2NA 1U1OA 2DD8S 3HPOA 4EU0A 1ZM9A 4UT4A 1I94F 5BR8F 1ZTWA 1S7IA 3JSBA 5GMDA 4ANEA 2YKPA 2ZM6F 3QZ8A 4JI7F 4NRUA 3L7UA 4USKA 4UOHA 2ZH6A 1S1UA 4X65F 3DRSA 5LJ3Y 2QYCA 3P8BB 5KFQA 2F4VJ 4YB6A 5MAOA 1FD8A 2WHOA 2WVCA 1DQ9A 2LQ9A 4FKYA 1DQ8A 3WQPA 2EK6A 2F9JA 2IM1A 4KT0C 2LA4A 2YX7A 3UDLA 1FVSA 3LALA 2BR0A 3ZC4A 4QWAA 1T03A 1ROFA 5B0BA 4AMPA 1UMJA 3W2WA 3DRPB 4R8UA 2VFUA 2CA9A 1RK8A 2OD6A 1FKOA 3JSRA 3Q8RB 4V19X 3D66A 1HNIB 2RVJA 4P7TA 2BMBA 3G8QA 1XEZA 3M6VA 3QWUA 2PDAA 1LNQA 2XI3A 4ZPWR 5F8LA 2DTJA 4MKYA 3VQSA 2JSXA 3SSQA 4J9NA 1T3NA 4DHVA 1S6PB 4TLRA 3OPKA 4U67Q 1AROP 3CE8A 3CCJS 2BRLA 4DL4A 3QGHA 1KQKA 1EZZB 1FE0A 4PPZA 3B82A 2JC1A 2JLFA 3BSNA 1LK5A 2CJAA 3TZYA 1WI6A 1CG2A 3ZZUA 4Y2MA 4PWUA 4Q45A 5D8HB 2E1MC 2ALZA 1K0VA 4Y28C 2WW8A 4BHQA 1KLMA 2U2FA 1PG5B 4B9SA 2XBPA 2A0FB 1KWMA 4CLLA 4ERDA 3UD4P 3FKBA 4HI1A 1GMVA 3QSIA 4RJVA 2EC2A 2NSBA 2WVBA 3LPYA 2M70A 2DY1A 3PYFA 1WEYA 3R6GB 2QSFA 2J9CA 2DNLA 2J9EA 2EEYA 3T9ZA 2OTLS 2WVEA 1J5OB 1KEKA 3MM9B 2APOA 1RT4B 1U0HA 2E1PA 3M32B 3P5TL 1LWEA 4LF8J 1M0SA 2ATCB 4DR6F 3PO5A 1W2BR 3HCXA 3OXGA 3RG6A 5C42A 4NOHA 4JI3J 2XLIA 4KPCA 1R43A 3IA0A 2E9TA 2HHTA 3VAHA 2UVRA 2GNKA 2J0SD 1VC0A 1HQUA 1PYSB 2EC0A 1Y00A 3FMWA 4ILRA 1GTHA 2CVIA 2HHUA 3TA1A 2BDPA 1NSKL 4C48A 4DR1F 1H38A 4BDPA 1IBMF 3JTPA 5THWA 1KTVA 2R8HA 5K14B 2YPZA 4C7QA 2P8IA 4ZOSA 1IR0A 3AXKA 4I2PB 2CJKA 2DXEA 3MM7A 4FYXB 3RBEA 3JSMA 2W9CA 3CJQA 1C1CB 1BE4A 3PYEA 3KHLA 2R7QA 3EICA 2QLXA 4UQTA 1BQNB 3EJMA 1OY6A 3KJVA 3OR1B 3BBFA 2XSFA 4N77A 3V5RA 3N0VA 1XERA 1IKYB 2R2SA 3M2RA 3FBEA 3AB2B 2VKRA 1GAOA 2VB6A 4MYTA 2A2CA 3ZZRA 1N0VC 2DPIA 2CXEA 4OHXA 4KRWA 5B08A 4DR7F 2R8JA 1W7WA 3CD5A 2C2MB 2BJ7A 3BJYA 1CS4B 5LMUJ 4IG0A 3T41A 4OI3A 5ETVA 3O6QA 1JLQA 5U47A 4K59A 2BJEA 5AXKA 3QJJA 2R7SA 3R97A 5HK4A 3I9ZA 3SIPB 3W5XA 3KHRA 1PILA 3V2UC 5IWAJ 3NMAA 2ABYA 3M8PA 2RKIA 2VDIA 2BJ8A 1KP6A 2C1EB 1KONA 1FT8A 2GX8A 1RAEB 1FDDA 3KLHB 1Y5NB 1JJHA 1V5VA 2AGPA 1B64A 4IRKA 3ADAC 3P5BP 3CPWR 4C0BA 4XAKA 4CCHA 2ILZA 4IH7A 4I2QA 6FDRA 2IJRA 4K0KF 4U6PA 3QT6A 2CPJA 1KHWA 1U6ZA 3LO3A 4YN3B 4DV0J 2RQ4A 3PXGa 5J2NB 1UEKA 2M7SA 3RB3A 1RHRB 2YKQA 2DY9A 1X4EA 1XNQJ 3GYGA 4P72A 2BQUA 4BC7A 1RT7A 1RDRA 3UR3C 3ZTRA 2COLA 1FTRA 1S1UB 1RU2A 3DRSB 3T9NA 5EN1A 1YBTA 2EFOA 3MFIA 4OLOA 1S1TA 3ZTOA 5KFRA 1D9FA 4I0WA 2D1CA 1PSDA 3DU6A 2HNZA 3KLGA 1RP5A 4NCGA 1T03B 2C2ZB 1NO8A 4WPAA 5IOLA 3MEGA 2XMVA 3ILJA 3W2WB 4R8UB 2V2VA 2VG7A 2AP6A 2V8GA 2JNJA 2AX1A 3IM9A 4K2JA 1FKOB 4JV1A 4X4QA 2OI2A 3AFGA 2C28A 4NEZA 5ETOA 1TR0A 1REGX 4ZVUB 2QV6A 3RB4A 2HQCA 5B0FA 2V5HG 1XMQJ 4DSJA 2LQBA 4GVBA 2ROGA 4WFYA 1UA1A 1JMTA 1ZBTA 3DLLQ 2YXLA 4RW7A 4ELTA 4LF9F 2AMCB 2NLWA 5F8NA 2CPHA 1TTHB 1VR6A 3ZTPA 5IT0A 2MKYA 3R1LA 4AFFA 5KFGA 1R0AA 2MMYA 1M90T 5IT9U 3OTEA 3GMGA 2W25A 4Y2KA 4YB7A 4CO1A 5LM7E 1F5CA 4I1TA 1MN7A 5E41A 4KFBA 3VGVA 2NXNA 1YRUA 2E44A 4B9UA 2GS8A 5KG0A 5LSRA 2O67A 4RNOA 3R2CJ 1KLMB 1VQSA 4MIBA 1WWHA 2C2NA 1UP1A 1TL5A 4FKXA 2GC8A 4DPOA 4Z37A 1LV5A 1GT8A 2DYAA 4RU2A 4PYDA 1UVNA 4GVLA 1W25A 4LR8A 4M8LA 3LAKA 4CLPA 1TAQA 1QE1B 2W2NP 1U0HB 4OYMA 5AE1A 2IDEA 2V68A 2B4VA 4Y6IA 2MDAA 1S1VA 5H9FK 2WB4A 3NY0A 5T7LA 2AZ3A 5F8GA 5HROA 1K1QA 4MAKA 5C42B 5HQ8A 2PI4A 3LGMA 1YJTA 4F04B 2YWHA 4DF8A 2XNQA 4CLKA 3KFWX 4OI0A 3NCRA 1QJHA 2CPIA 2XLJA 1HQUB 2X51A 2OLWA 2AF6A 2ROEA 1NAQA 2BKOA 1OY9A 2KHCA 1EAYC 4ES1A 1URRA 5C25A 3CDEA 4DFJA 5L1IA 2E5GA 1JIHA 4PXDA 5HN0A 3IC1A 4EZ9A 4FXVA 2CQGA 4V1Ak 3MM7B 1FRMA 1P8GA 3JSMB 2W9CB 1QM9A 3B4DA 2CAJA 3FCHA 4PG4A 3G6YA 3N9UC 1U7LA 2WTFA 2DR9A 1TUGB 2E5IA 2E66A 1N5YA 3IGNA 3KJVB 2HQGA 2AJ0A 4LFAF 5CZDA 4NZ0A 4URGA 3M2RB 4WCEQ 2JWNA 4OZ2A 3BQ2A 1RLDA 2OPSA 4P2MA 1NZ8A 1RISA 1M5PC 4UF4A 1D09B 2JEGA 2E7XA 3IRWP 1F2GA 3VWSA 2CG8A 4IG0B 5CZXA 1JLQB 2GQQA 2XO6A 3X3UA 3O44A 2FHKA 4IH6A 4CLFA 1MNEA 4UUXA 4OJHA 5F0WA 1YJRA 1MMDA 2CQ0A 3M8PB 2RKIB 2X1FA 4I6YA 1SJ4P 4DCJB 1NK7A 1X9WA 4U95A 4GRSA 4NRTA 3G6VA 4F7VA 4ZJOA 2XCPA 3AA9A 2H5JB 1UPMB 4PG7A 4NA1A 3A13A 1LK7A 2K3KA 4I2QB 5KFEA 3BGRA 2MQLA 3K5NA 4FPRA 2CPXA 2DNHA 3OXFA 1FJGF 2M52A 3IR7B 4ILLA 2DHGA 1X9SA 3T1YJ 2HHHJ 4QYZJ 5FLXU 4K5SA 3V6KA 2GMJA 3NOCA 2MZSA 1WEZA 1X0PA 4Z7YA 1VS3A 1NPKA 1S77D 3OTDA 5CCMA 2VPZB 1RT7B 2A6OA 3TVZA 1FKPA 3RBZA 1HWKA 3BZQA 1U24A 2EI5A 3OD2A 5E33A 3R5GA 3T5LA 1S1TB 4DPWA 2PFFB 3BKFA 4DL2A 1NSAA 1WDTA 2HBYB 3M2UA 3RAMA 3BB5A 3AH6A 3D0GE 1U1KA 4DQIA 3EVWA 4Q0BA 2HNZB 4L76A 4Z2XA 4NCGB 1YTYA 1TQLA 4D3HA 4XTTA 4YDXA 3JTNA 2E9ZA 3MEGB 4LVOP 4ZVQB 2CRLA 4WJBA 1HNWF 2MSSA 2VG7B 2R9LA 2VQFF 3MCNA 2IMWP 4EBEA 3H98A 4DV6F 4M63A 1FA0A 4DX6A 2OEMA 3LH2S 4GVBB 1IM4A 1W2IA 2DH9A 2XULA 2WSEC 2OSRA 4RW7B 3CDWA 1ICEB 4L73A 4CO5A 1NK6A 2IVMA 1VQ4S 3R7SB 2DRAA 2VBYA 3T5JA 1R0AB 2KXHA 3KK1B 2KM8C 1A7GE 3LW5C 2Y3YA 2IY5B 3TAPA 3W5ZA 3IGVA 4RUHA 3PRDA 1QD1A 1SJ1A 1FFWB 5C24A 4ZLJA 4KFBB 1F60B 3CD7A 3D28A 4F25A 3NEKA 2EW9A 1RT1A 2UUAJ 4N56A 5HP1A 1FNOA 2X1GA 4DV4J 3EGWB 4AQYJ 4WP8A 1D8ZA 1GTEA 3BR9A 5DZ6A 1N0UA 4Y2AA 1AZSA 4WKYA 3EGNA 2QLBB 4P74A 2VIHA 3H4BA 2FHJA 1V3ZA 3VVUA 2RS8A 3M05A 2NYHA 4Y2IA 4WTYA 3R6LB 3MAHA 5HBMA 1HR0F 1X5SA 1RHKB 3HJVA 4ZLLA 1S1VB 1R89A 3D7SB 5IT4A 5T7LB 2UUBF 5HROB 3KLFA 3IG1A 4ZPTR 1JXEA 2MKHA 4G1IA 4IDKA 4XDCA 4OL8A 1IR2A 1T3OA 4QYRA 4F4YA 2VU5A 3BN7A 4DZDA 4F3OA 4KH0B 1F9FA 5AXMA 4FVMA 4YMEA 2FHJD 4Y3CA 1ZTTA 1MMLA 2PIIA 1O6XA 4OZ5A 1CQNA 5CXTA 1S72S 4DCOB 1U49A 1SL1A 1S12A 1VQOS 2R3VA 2HLUA 3OL8A 4I67A 1XMOF 1CBKA 1ACMB 4ZVSB 2ZBIA 2GJIA 1N5YB 2YNHA 2FJVA 1AXQA 4NLSA 3GFYA 3I5BA 3OT9A 1WG1A 2BJ9A 4J5OA 8ATCB 3PFOA 1RCXB 4FP9A 3H4DA 2B6AA 3I55S 2OPSB 2UUCJ 4USIA 4LJMA 5HLFA 3NKYA 4JI4J 4NXNJ 5LOQA 2V2KA 3OUYA 2ACYA 1UCNA 2R42A 2MKIA 2BV3A 4XDDA 3Q2TC 3H25A 1M5OC 4LRFA 2RJZA 1RWPB 2QMWA 3PYGA 5B0GA 3D3BJ 3L9ZA 4IUFA 1URNA 4RUAA 3D67A 2ACMA 1B7FA 2F1FA 2N4DA 4FYDA 3S8SA 3WC0A 4DUZF 1NKEA 1UETA 5LT5A 2YX4A 2JX2A 2QTWA 7AT1B 3BGRB 4DJBA 4W90B 3IAM9 3I0SA 5IT9Y 1AW0A 3KHGA 2P6SA 2XY6A 3FZBA 3R7BB 2IM2A 3KNAA 4CH7A 3HX9A 4C3KA 2W2QP 4EK2A 5HO4A 4KJIA 2V8VA 2DEJA 2KRRA 2FHMA 1ZPVA 2HFVA 4DXLA 1FKPB 3KUHA 2H4WB 2RF2A 3A1YG 3DCAA 3SXLA 3GSIA 4CLUA 2CQDA 1VGYA 1A0OB 1HWUA 4QIEA 4HEA9 1PO6A 1ZETA 2VG6A 4JI2J 3QGGA 4FF4A 1KVJA 5B0EA 4KQZA 4NASA 3THTA 3M2UB 2AEMA 4Q0BB 4NEYA 4AD6A 1UWBA 4DI6A 3TUPA 1S0MA 5M2UA 3M9NB 2KXNB 1IUJA 3BYPA 5LMNJ 1D0EA 1F5AA 3V6JA 4JV0A 3TX8A 4LRBA 1J2VA 3GTYX 5CD4A 3K5OA 3MAQA 1ELOA 1XK8A 1QSSA 4OYBA 3A3OB 2XGQA 3TZZA 1MMNA 1VFJA 1UVJA 3TR5A 1X4HA 4OI1A 1JLBA 4C8MA 2CQ1A 3U27A 4A8WA 3I5CA 1ZS6A 2QL9B 4QIVA 1T7PA 2WCXA 4C97A 4P71A 2PEHA 4CI0B 4OX9J 2ZOFA 4M5NA 2VL1A 3T1AA 1TKTA 3BH7B 2V2QA 3M7VA 2I0XA 2EFVA 3PIOQ 3L95X 2B51A 5HANA 1FX2A 1H2VZ 3ILLA 2IDLA 3VAFA 1V9OA 2ZH4A 3R5BA 3CD0A 3ELHA 4WE1A 2UXBF 3D6FB 3QAEA 3DNCA 4TNOA 5KT4A 2UV8G 4A4JA 5A2QY 3F73A 5C24B 3NCQA 2QEXS 1WJ9A 4J90A 2PD1A 4LSNA 4KC5A 1RT1B 5HP1B 5ADZA 1AZSB 3KNGA 5D4LA 2J6UA 3TOQA 1B99A 3UR0A 4LT6A 3OTBA 3VAGA 3O1LA 4LFBJ 1HLWA 5HBMB 4DV1F 3QRPA 1BHNA 1U1LA 3E2EA 1X4FA 2QIFA 1F3FA 6AT1B 5H9EJ 3RR8A 2IAJA 4ZVPB 2J8SA 1IQTA 1O0PA 3GLJA 4CO2A 3KLFB 2YKAA 1F1BB 1PJ6A 3IG1B 4JBCA 1UVKA 2Q6CA 3ET6A 2POKA 1XQIA 4IDKB 2B43A 3HF5A 4G6VB 3MEDA 1JXLA 1TFYA 2JVOA 3MEEA 2BQ3A 4ZS6A 5M2RA 4KHMA 2HNDA 3BDPA 1JX4A 4JI5J 3G86A 1NB2A 1NDLA 2GMLA 3N6MA 2F5GA 3MR3A 4MIAA 4WFBQ 1AT1B 5F9NA 2DGWA 3GYXB 1DJ0A 2H48B 2Z2MA 5KOWA 2JDJA 3U1NA 4OMFG 2Z30B 3GR0A 1UTAA 3BV8A 4ECZA 2CPEA 1Q7LB 3T3FA 1T05A 4W92B 2L9NA 3EDQB 2JHEA 3RZAA 2PSZA 4ECVA 2YNHB 2P6TA 4ALZA 1HFEL 4ED0A 4LQ9A 3L4BC 4NMLA 1U1RA 2ZBQA 1I5OB 2NYIA 1VBYA 2EWHA 2KYXA 2B6AB 1S1WA 4JV5J 4KR0B 4OYOA 2GAGC 5HLFB 1R6YA 5J2MA 1NJIT 1RTZA 2EPIA 2HHWA 1VQKS 3AQOA 2V8DA 3OUYB 2KXFA 5F8IA 3KK2A 4MIWA 5CZVA 4UW2A 4PPDA 3ETMA 3KKFA 3NOGA 1WOOA 2J7UA 3SZ2A 3MGJA 4QQBA 1UZDA 3SFGA 2YQ0A 1S59A 4IRCA 5HL7Q 2G13A 4RBUA 4A47A 4NZ6A 2KJVA 2KDOA 4MH8A 2OPQA 3CC4S 5HVHA 3CTRA 3Q8SB 2B7CB 3H2UB 5DDPC 3T6JA 2Q1LA 3JB9k 1OS5A 2JEIA 2F3JA 5KFVA 3FSIA 4ENOA 5IQ6A 1NH8A 3NGSA 1SH0A 3I0SB 3AB4B 1TZ0A 2FJAB 3W8PA 4QIFA 3FFIA 1VQYA 3QLHA 1DHMA 4J7CA 1S97A 2WSFC 1YVFA 3KDNA 3DLGA 3JQKA 2F4VF 1VQ8S 3CC2S 5F8HA 1HBMA 4X4TA 4QPTA 3TUIC 5DM6Q 4U9RA 3THPA 3H40A 1M5KC 3PYDA 2RF2B 3DHXA 1FRJA 2LP4A 3EGVA 3H5YA 5KFYA 3WX8A 2VG6B 1FDNA 2KO1A 4USVA 2QA4S 2KJWA 3TAMA 2HWHA 1RTIA 1PGZA 1XC9A 4OFZA 3IFEA 3AY0A 1FI4A 5F9LA 1FESA 4QWDA 1FERA 3W61A 5SZTA 4DR3J 1FXDA 3T5KA 1AFJA 4ZCKA 4Y34A 1RA6A 1UWBB 1VBKA 4IO9Q 3GIMA 2XSJA 3G9CA 1ZZFA 5D4NA 2XTJP 4KHPJ 2V4QA 1TKXA 1ZAVA 4NLXA 4LIRA 1U1PA 1RTDA 3GYNA 2W9AA 1QDUB 2PMHA 3D0HE 1XWLA 2ZH3A 2KRBA 1L3TA 1RAHB 5K8OA 1HQEA 4H4KC 4X64F 1BMQB 4ECXA 1IBKF 2XHWA 5CHCB 3HK2A 3DRYA 2ATLA 4USUA 5DZ7A 2XHCA 1U8WA 4FYYB 4DL3A 3OL6A 1L3KA 4PR6A 5KT3A 2BX6A 1R27B 3NGRA 1RZMA 1IBLJ 2CJYB 3DLJA 2JC0A 2GVZA 2LDYA 1TK8A 1ZA2B 2RIJA 1TKTB 2JJ4D 1VRUA 3DRRA 1WACA 5DLFA 4ZP7A 2HEKA 5D0RA 1R6VA 3CCSS 4WE1B 4KGMA 1QTMA 5L46A 3U02A 2L9WA 4C8LA 4LSNB 2JH3A 2QL7B 2GAHC 2A18A 3Q24A 3TQEA 5J1EA 2IVFB 2GV1A 1N34J 5JVHQ 1Z2ZA 4FNIA 1QSLA 4HHHA 2WVFA 4P75A 4A8YA 3HHLA 4NYOA 5E2QA 3UN5A 4X4SA 3L3CA 1S10A 3CIZA 2QJ3A 2E9RX 3GG0A 1FRKA 4JI3F 3UD5A 3C14A 4P9SA 2SXLA 1GMWA 2HVDA 3FK4A 2DT9A 3TJ8A 3C8YA 2KM8B 1PAEX 2IAJB 3AQPA 4CRJA 3NNCA 1DZ5A 2YY3A 2Z8QA 3Q89A 2HG4A 1CJVA 2MPUA 3ET6B 4OI6A 1XR6A 4NLYA 5E5NA 2XZWA 3MEDB 2K1RA 3PW4A 1M1HA 3MEEB 2JEFA 5LXYA 2OJ3A 3H5SA 2UUWA 2UZAA 1BQXA 4J9MA 2HHXA 2HNDB 3RJMB 1NSQA 1B0TA 3AJ1A 4W98A 3G2XA 3W9JA 4CLZA 3CCQS 5DGAA 4C0OC 4DFMA 4G1PA 4DBQA 4DV3J 3DI6A 1GX5A 1OO0B 2BKNA 4MKVA 2ZE2A 2H51B 1XMBA 1SKRA 2LCWA 3MEKA 2FY1A 4USWA 4I7FA 4F2SA 3CCVS 1U6BA 4V19J 3OTCA 4OLPA 3K7RA 2BE9B 1S9EA 2ASDA 3UDEA 4Q2LA 4QWBA 4AMMA 4B3SJ 3GP9A 1RWVB 1T05B 2M88A 3EM1A 2MB0B 1WC1A 1NH7A 4ED1A 1P1TA 2D3UA 1N33J 4UQGA 2B4OA 3GJSB 5MLCV 2NR0A 2V69A 2OD4A 1S1WB 3RW7A 2RMLA 3I0RA 3M9OB 1PYTA 1Q95G 5J2MB 5IWAF 2V34A 1R0BG 3NNHA 1R8CA 3J7YI 1QUPA 3A8IA 3CCMS 3KK2B 3GR1A 4R5PA 4IG3A 2M9KA 5ETNA 5D78A 3O2IA 5IFMA 3A4TA 4I68A 4B3OA 3UVJA 4JI0F 4RO0A 3VF0B 4GKKF 4J9PA 2ZHOA 3CCLS 5FDLA 3CMQA 4YUDA 2ZC3A 4PXEA 3OSNA 1Q1KA 1D3WA 1FEEA 2HQDA 4EYIB 1T11A 3QIPA 2ZVIA 2OPQB 2XLKA 3WZ0A 1TKDA 4DL7A 4KGZB 4B3RJ 1CULA 3DDNA 1KR4A 4FN5A 1XNQF 2HPUA 4GKJF 2IYGA 2ZH1A 2R7TA 1R0CB 3FFIB 4G65A 2JL9A 1I3OB 4YB1P 3QLHB 3JQMA 3R8YA 2XY7A 1UJ4A 3DLGB 4EWTA 4AXIA 5AT1B 1I94J 3HVAA 2RHSB 5BR8J 3B6BA 1VQ5S 2G1DA 4QCLA 2CWXA 1HBMB 2MLZA 3ENVA 3A8EA 2ZM6J 4CYUB 2V50A 3GV8B 2RDJA 4X65J 5ETQA 3QMQA 1AYEA 2XG8A 2HVIA 2CDQA 4UOGA 4N7TA 3NS5A 2UXDJ 5KFHA 4UTGA 3CO9A 4CDIA 3TAMB 4ER8A 1RTIB 1RT5A 3ENQA 4J9SA 2PA8D 1IJFB 2WW4A 1UWAA 2IPOB 1VJWA 4CO0A 3W66A 3CJKA 2FLNA 4PG6A 3TWZA 2ZJRQ 3BH6B 2AHOB 1MROA 2LQJA 2XSJB 2W7PA 4B9NA 1XMQF 2Q43A 1S48A 2C2KB 2OMOA 4DPYA 1U0SA 1TKXB 1RTDB 9RUBA 4NLOA 4F2RA 2NUUG 1KN6A 3BBBA 2W7AA 1YDLA 2FLOA 2GQCA 1HQEB 4PWWA 2HKEA 4DR4J 2AT1B 1OPZA 5A8WA 2JLEA 4DUTA 4X4OA 3KOAA 4YFUA 2P9EA 4WFZA 2BZ2A 2C22A 4OZJA 5D0GA 2ZOGA 2AJ1A 1Q4RA 1EX8A 2QSWA 1KQFB 1VDHA 3PR4A 1NHVA 1ZM4A 3J7A1 2GVZB 1VBZA 3KK3A 4ECRA 1VRUB 3DRRB 2DJWA 1LW0A 3CIMA 4ETXA 4MYUA 5A6PA 3MWBA 2EKNA 3GSDA 5KG5A 1X4CA 4CQ1A 1VK8A 4H4KA 2CWKA 2FC9A 3J7YU 4EEYA 4O3OA 4DV5F 3MAAA 5J1EB 1FJ7A 4Y2CA 2YH0A 1IM6A 1CJKA 4NLGA 1P1LA 5EDWA 3HHLB 1B0VA 2C2OB 4G1QA 3MMBA 3C14B 5E0OA 1YX2A 3MF5A 1VIXA 4ZIVA 2ROPA 2CJBA 2FD2A 3HSDA 3HHEA 3DGPA 3BSOA 5GAGU 4MK9A 2HFUA 5D3GA 1WHVA 4NL5A 2HLTA 2LFVA 1JLFA 3RRGA 4RNHA 3QRQA 2CPDA 2ZZMA 1CJVB 3L7PA 4J9QA 2LMIA 1GFWB 1RCOB 3ISNC 2K1RB 4AMNA 3LAMA 1RAFB 4PUOA 3ZNJ1 1KOOA 2LXIA 1IBMJ 4O3RA 4IFVA 4USHA 3DI6B 2HVHA 1U48A 2ZE2B 5D4OA 4I7FB 4TYBA 1HBOA 1S9EB 3BO3A 4C8YA 2G4BA 3MMAB 1HWJA 4ED7A 3WDOA 4I6AA 2VOOA 4NI2A 1HI0P 1X5PA 4HH0A 4WYWA 2JFKA 4DX7A 4R0EA 4GC7A 4OQJA 2GO9A 1R3NA 3IM8A 1M5VC 1HKAA 2A10A 1RE1B 4K4WA 2UP1A 4LF1A 1KVIA 4ICLA 3TVYA 2H54B 3PEHA 3I0RB 2FVCA 5E3PA 2AYGA 4IQMA 1U02A 3TVKA 1C1BA 3M8ZA 1U8SA 4NX9A 4ZJQA 3K89A 4R5PB 2B4UA 4IG3B 3FNNA 1NM2A 1FXLA 4B3OB 3QQCD 1SJQA 3UVJB 2HGMA 2QMUB 4O4GA 2I5JB 3T1HF 5FDLB 2W1BA 4IFYA 3SQGA 5C5JA 4DUYJ 2KH9A 3QIPB 5CYQA 2OKQA 1R8HA 1CULB 4OHZA 3PO4A 4K4SA 4K0KJ 1IKVB 2ZH2A 1EETA 2ZNYA 1QAIA 5GADU 2J0QD 4RPFA 1JJ4A 1RYSA 1BUXA 3X1LB 4PABA 3MHYA 4ZVGA 1ZH5A 3G87A 3GU0A 2VJVA 4J9LA 3RRKA 1SL0A 5HMZA 4AUKA 4CO3A 3DXSX 5C7PA 3FRZA 2FHOB 1TUVA 4ZP8A 4NPOA 1SKSA 5HMXA 1ZAWA 4C8NA 4RW4A 4CNYA 4RNFA 1NK9A 1C1CA 3QWPA 2CQ4A 3EZUA 1DQAA 3MCSA 2HBRB 4OYPA 3UNYA 1XBWA 3VGTA 1GK8A 1RT5B 4DV2J 2V67A 3CJKB 5KFSA 4A8KA 1GX6A 3U1LA 1MROB 3D6TB 3PIPQ 4MKBA 3VCDA 5KT6A 1FE4A 4RX6A 1K73T 3MI7X 2ZH5A 3SSRA 5IS2A 3FBFA 2VQEF 3IR5B 3CULA 1TL4A 4OYAA 2LQ5A 3P96A 1RWXB 3KXDA 3SI8A 1SKWA 3U1MA 4J9OA 2GIRA 3EXCX 5A8WB 3MUMP 2W4DA 4ETZA 2DXDA 3AT1B 4LF9J 5GVQA 2DNNA 1S0NA 2OUGA 3HKWA 1S76D 5KFDA 1FRHA 1UZHA 2HGNA 1WF0A 3NWGA 4YY3F 4YR0A 5H9FJ 3KK3B 2QRRA 1Q82T 2YWFA 1NBEB 3MMJA 3EPIA 1GH8A 3US5A 1LW0B 4U7UK 4MKAA 2D3O1 1BC6A 3OL9A 2EKYA 3N6NA 4U8VA 3E8OA 3MAAB 1VJQA 3MXHP 1RAAB 3B4MA 4KGVB 1YIJS 3PHEA 4TU7A 1CJKB 3M4XA 1Q53A 1H7WA 4P52A 4DN0A 3BO2A 3GWCA 3KUGA 2HWTA 3WC2A 4DN9A 3MOZA 3C15A 2HVZA 4G1QB 3MMBB 4ED6A 1M1KT 1P9YA 4DL5A 1BWEA 2CJ9A 2B9YA 1TV6A 3I87A 3THVA 3DGPB 4W4MA 1H0HB 3GIJA 3TANA 4OJGA 5D3GB 3BGUA 2H9ZA 5J1PA 2KT2A 3CJTA 3BS9A 2HZVA 1JLFB 3R9LA 3HKZD 2MQQA 3NNAA 1OIAA 4RNNA 2D74B 2DXFA 1KFDA 8RUCA 2G2OA 2YTCA 4PUOB 1U47A 2UXCF 4B9LA 1N88A 3UFCX 1REVA 2HFSA 2MY8A 2CNNB 3J80U 4EBDA 4IFVB 5AJ3F 3RB6A 4DS5A 2DISA 4PXCA 2MHNA 4DU7A 2F9DA 3PVXA 3NBPA 1HBOB 1CC7A 4QIWD 2LEAA 2C3PA 4ZPDA 2VC1A 2MZ1A 3FRYA 4NI2B 4ZN3A 2VONA 3BSAA 3ZZOA 3UCUP 4C4WA 1NJZA 1BD6A 4RKUC 4P10A 3DU5A 3AAWB 3IBWA 1KHVA 4NXNF 4NWBA 2DH8A 2OPPA 1CPZA 1N36F 2GGPA 2E1RA 2XS7A 3C6TA 3W7BA 1KBRA 4DQSA 3M8RA 3FQLA 4ICLB 1RAOA 1WHXA 1G1XA 2CJQA 3HLUA 3CJ3A 2DVIA 1ZPWX 1JKHA 3RRHA 1C1BB 1NMEB 2CZ9A 4RBTA 5FD1A 3GE9A 3RTVA 1U1QA 2QC3A 3G8TA 4M5LA 1SH2A 5T14A 1JB0C 2H5IB 2FJEB 2DNGA 3AJDA 2RU9A 1DAXA 4O4GB 2DK2A 1QE1A 5K8PA 5KFIA 1CJTA 4IFYB 3SQGB 4LR7A 4NLUA 2L48A 3AXMA 5D4PA 3ENAA 2NXUA 5CYQB 2ASYA 5JMNA 3SV3A 1WKKA 3MPUB 5HVGA 2ZWOA 3SCLE 3BPSP 2G0IA 1EETB 1UPPA 3MR7A 4ID8A 2AYBA 4K50A 1XNRF 2FB0A 2K06A 2F7VA 4OZ1A 2WZ1A 4LF7F 2W8LA 1S57A 3C66A 4WP9A 3K59A 4X62J 3V4MA 4IRDA 3Q8PB 2KG0A 2VFTA 2IMOA 1M5SA 2I38A 3HXMA 1NPRA 4Q2MA 1QVGR 1WSRA 2XCAA 4RW4B 1AUSL 3W2VA 3HT3A 3HT0A 4AXJA 4FZVA 4ZPAA 3EZOA 4X66F 3EDRB 5EGYA 4OZ3A 3CSKA 4ZVHA 1KTQA 3K8WA 3HP6A 3HM9A 1XIQA 1GNKA 2AYEA 2HHSA 3HSGA 2CADA 3KDOA 1U45A 3IWNC 4OHYA 3NAHA 3IBCB 1FWLA 4ZCMA 1HNWJ 2FLLA 4PZVA 4OZLA 4ZCLA 1YJNS 5ETPA 2FVQA 5B09A 3HFKA 3PX4A 4DV6J 2RH3A 3VALA 3RBDA 3P4UB 3D2WA 3BM7A 3FBBA 5E7OB 2MKKA 4ZITA 3ETOA 2IVYA 2OELA 3JXOA 4E2FB 3N79A 2FLPA 4AYBD 3OVAA 1HD1A 3ITHA 4QU6A 1FKAF 1RABB 2CQ3A 2VDHA 4U8YA 1SQEA 3FEXB 3C3LA 3NWRA 3LUYA 1S79A 2VA2A 4M5JA 1KRPA 3CCTA 2KFYA 1O8BA 3R27A 3P49B 3S01A 2RRNA 3GPAA 3EVOA 1EIYB 1WF1A 4PQAA 4ZVOB 2E5HA 3BQ1A 2U1AA 3VAJA 2RRAA 4USMA 5IC6B 4LFBF 2MQNA 2V6AA 3EXYA 3PW7A 3T19A 4XO0A 3BGFA 5KFOA 5HJYA 2AZ1A 3H90A 4M95A 4O4RA 1A9NB 2O3DA 4URSA 3HZEA 2CNOB 3UN2A 2PC6A 5B0CA 1NK0A 3C15B 2MXYA 3N4WA 1SC1B 1HR0J 3A3NB 1TV6B 3TUZC 1QY7A 4F02A 3JAMU 2GVDA 1VQ7S 3OVBA 1RACB 1XR7A 3F0NA 1ZM3A 2V63A 5AE2A 2UUBJ 3BGOP 2MEWA 3CNQP 2PGCA 5KFNA 1HW9A 1F9EB 2DKOB 5B7WA 3RW6A 4NA3A 1L5UA 2I8EA 1VQPS 1CLFA 4C9DA 1SJFA 1F6TA 5KT2A 1WORA 1Q86T 4HDHA 4HT5A 2RNEA 3VTIA 2QG9B 4JP8A 2KFNA 4O3PA 1Q8IA 3PJ9A 4GC6A 2BVZA 2CQPA 1REVB 4LMZA 4WF9Q 2MLYA 2VFRA 4H4MA 2DB1A 4F0KA 1K1SA 4Z7CA 3DOMA 5F41A 3PDNA 3CMES 3FCWA 3UWTA 1WC4A 1Q16B 5JUMA 4DV7J 4DQPA 1RAIB 3QT5A 2K3IA 3NBPB 1WD6A 4LVNP 3R5CA 2ZD1A 3OV7A 3Q22A 1LKZA 3W9HA 1XMOJ 4DX8H 1BGXT 3BGLA 2RE1A 4O0IA 2XWYA 1LEOA 1S49A 1X4AA 3LA0A 4L72B 2MLXA 3WBZA 1VK3A 3I31A 4B3MF 4N41A 1IR1A 2VPYB 4P7VA 3KK1A 2AJ2A 3A8JA 3DHWC 2OPPB 2VBWA 2GGPB 2MKSA 4ECQA 4IYQA 3C6TB 1FD2A 2R7XA 2KVQE 2WAQD 4C8OA 1RTHA 4DSLA 4DCPB 4ZVEA 5DQIA 4ZVTB 4B9TA 1JKHB 3DOLA 2H1YA 1FWKA 1OQ3A 2XC9A 1EB0A 4J9KA 2PFDA 1KNZA 1VLOA 1AUDA 3DLBA 1O51A 2JVRA 4LF6F 2A3JA 3PEJA 3GG1A 3LGNA 4NE9C 2DNKA 3MTKA 3QJPA 1CJTB 4RWXA 3TARA 2BACA 1TL3A 4DUZJ 5DGBA 2IYIA 3FEZA 3PG9A 2H65B 1VQNS 1C4CA 3N01A 5KT5A 4F36A 1FFGB 1G2EA 5L1LA 4RW8B 2C2RA 2NUHA 2KYZA 1KFSA 2UVUA 2MQMA 2IRUA 1RHMB 1TL7A 2X7IA 4KV8A 2FJXA 3Q8UA 4NZ7A 2OTJS 2XYPB 2YVSA 5GMEA 3I4PA 3PV8A 5JXSA 4B9VA 4HTJA 2KZZA 2NZCA 2BYCA 3W2VB 1OSDA 5HMWA 5DQGA 2WVDA 2HYIB 4L6V3 4DZ6A 1GXLA 4LIWA 2W4CA 3SEOA 3O5TB 3VGUA 5KFPA 3NG8A 4UOCA 1T02A 4CLWA 3D1OA 1Z1ZA 2N7YA 1WOPA 4IH5A 2B8PA 5DG9A 4F4XA 2VPWB 2GIFA 4WBFA 4LRAA 1RT6A 1L3SA 2MZQA 1A6LA 4RWWA 4NLPA 3K2YA 1VISA 4L3NA 3JS9A 5KFZA 3CCWA 3G6ES 3TUJC 2C3MA 4CP5A 3SFUA 4WFNQ 4K4VA 4M5GA 3HVTA 3CWJA 1Y10A 3WIUA 4ECUA 1HYSA 4N8OA 1UEUA 1EQMA 2FZKB 4CM2A 3J80Y 3M8WA 4IKAA 1OPIA 1LXNA 3M30A 5DETA 3ITHB 3FCVA 4TKTA 2NQPA 3PR5B 4B3TF 2IA0A 3H20A 3KMSA 2M0GB 1K0TA 2Z57B 3I56S 4E0DA 3MZIA 1Q78A 2GIQA 1VRQC 3E51A 4EGLA 3OR2A 3OXLA 3DOKA 2UXBJ 1NSPA 2OFGX 4U7CA 1MWYA 4KHRA 4AL7A 3KLIA 1Q79A 4FXWA 2VUGA 4PAAA 8AT1B 4TVAB 3VHQA 4ID5A 2LKZA 1NZAA 1YK9A 1PC4A 1K44A 1UA0A 3LF0A 3JYTA 3AOAA 5HSPA 3ENWA 4L74A 5B0DA 4NLWA 2KHDA 3PCOB 4CT9A 1TP7A 2CQCA 4DV1J 5I3UA 4JI8F 1SKUB 2QGFB 2GVDB 3CDAA 1S9FA 1OY8A 6FD1A 1PAUB 2DO4A 3SCKE 3WX4A 2KTQA 3OVSA 2RILA 4DV3F 2I1RA 3VAMA 2L9DA 4QIGA 4NLTA 2V4RA 5LXRA 3GIRA 1QAJA 4DS4A 4EI2A 5HQMA 3RYLA 4WP3A 2QLWA 4RZRA 2ZOMA 3MM5A 1TELA 1WI8A 4H4MB 4FS1A 4LF2A 4R0JA 1H2UX 3DYAA 5GAEI 3DOMB 4MJKA 1MN9A 3M6WA 4WU2A 1YZ6A 3D54A 5K8MA 4JI6F 3H8YA 1QTNB 1TK5A 2QFJA 3PX0A 1SL2A 1UEVA 3IMQJ 2R7VA 2ZFHA 1T9YA 3SDEA 2ZD1B 1VQLS 4QU7A 2XI2A 3QZ7A 2HQFA 1AFIA 4HACA 5M2PA 4OJ3A 1F0XA 3J7AN 2XNRA 2ZH9A 4BBYA 4DQQA 1TK0A 1JLGA 3D6HB 1LOUA 2B56A 2W01A 5CZCA 2NXJA 2LDIA 3MCMA 2VPXB 2XO7A 4KB7A 1H74A 1JNZB 4USTA 3K5PA 4FF3A 1EQ0A 2R7UA 4OIXA 3OFEA 3GIIA 4RW9A 3G82A 2ZBCA 1RTHB 1OYDA 1S6UA 1FTCA 1T94A 2Z2LA 4ZVRB 2ZKUA 2JLGA 2CYYA 3CJSA 4IQXA 3TX0A 4OHWA 2B5JA 3DOLB 2K7KA 4ITSA 2MJUA 4F4AA 2HAFA 2ZBPA 2D9OA 3PHTA 2E1AA 2W7OA 2Y1LB 3HSZA 2Y8WA 2AEFA 2C3UA 4LBHA 4HH1A 4ZA1A 4KE5A 1DARA 4JOUA 1WC5A 2PO4A 1EKRA 2R7WA 2O66A 1HHTP 1FO1A 3HMJG 3LWMA 3LWLA 4IR1A 5ETSA 1TL3B 2E7VA 2YNIA 4M5HA 4UOFA 3BSCA 2ASJA 2AJQA 3E3XA 2DCLA 3NGTA 2YX1A 1NUEA 4CNZA 2FJBB 1UVLA 2C42A 2DGXA 2AV5A 2X1AA 1YJVA 3LOUA 3CDBA 3VV2B 1NK8A 4NA2A 1HL6A 3MPYA 5HAOA 1PJ7A 2HHPA 1DRZA 2ZZTA 3UD3P 4PEOA 1TL7B 3BKTA 2R8IA 2ZDOA 1SXLA 4KV8B 2CQ2A 2UXDF 2Q3PA 1T8EA 2NREA 1K8AT 4Y0FA 4PYAA 2WB1D 3M8SA 3EWGA 3CCZA 3IXQA 3LQVA 3I6PA 2ZKTA 3MD3A 1YRTA 4M5KA 1NJWA 2KN4A 1HNZJ 3TYTA 4QPXA 3FJ2A 2WSCC 3JAMY 4C3LA 1DFDA 2BXJA 4FXDA 1TKZA 4ZPBA 2A2DA 4LFCJ 4QBUA 1ULRA 4DR4F 1NKBA 3NL0A 1RT6B 4C8KA 2DHAA 5GAEU 1M1GA 1VIOA 4HYKA 3PTWA 2E1CA 1C4AA 3ZXWA 2C2DA 3HVTB 3O8WA 4RW6A 4JYAF 2VH7A 4X64J 1HYSB 1IBKJ 2OMLA 1SPBP 1SJRA 2NPFA 4ES3A 3QFWA 2PMWA 3D1QA 3DLKA 3Q83A 1SUQA 3M30B 5EWFA 3GCWP 5DRKA 1S0OA 4X4UA 1F9HA 2HBZB 3ZTQA 2ADCA 3CCES 4DWIA 3H5UA 2XY5A 1RSCA 1UW9A 3UCZP 2F65A 1EP4A 2HVEA 3GIKA 2ZJPQ 3ILOA 3QGIA 2F8HA 4ZJLA 2HIYA 3OR2B 2EK1A 4BLGA 4K4YA 2J9DA 4FF1A 5DDOC 2J0WA 3J81U 3KYLA 2XEXA 3DOKB 3N6LA 1N32F 2LYVA 3N5BA 2X1BA 2L41A 1G4CA 2VOPA 4EO6A 4DPXA 3KLIB 2DH7A 2JRSA 4RUBA 1HHQA 2HSEB 3I4HX 3UW1A 2YKMA 1FNXH 3JSYA 3OLBA 1WUUA 3BF4A 3BPDA 3DM2A 3MD1A 4DEZA 4OX7A 4ID5B 2V2ZA 3ISND 1G3OA 3IWXA 2LQ8A 3MCOA 1T0TV 4NCBA 3JYTB 2F8EX 4LBPA 4P2XA 2HAIA 5I3UB 2R7RA 3MMCA 2YKNA 2C3YA 2AJFE 1V3RA 4OYWA 2Z58B 2VFVA 1SH3A 3I9V9 1C2PA 1R8BA 4LF5F 1X7VA 4H54A 4KY3A 1I51B 3CJ2A 1J5EJ 5I4MA 1X9MA 3HFZB 4F67A 4DSIA 1B0PA 5KG1A 3AOCA 1H6KX 4F50A 1MSWD 4JUZA 1UL3A 1U2FA 3MM5B 2DR8A 1FVQA 1Q8LA 4ZLNA 3HULA 1SQFA 1HARA 3DYAB 3TJ9A 3T6BA 1HNXJ 3EVMA 1YJUA 1UKUA 1JNRB 4J9RA 4K2XA 2FY8A 5BXIA 3SDEB 4DR2F 2I6WA 2PMZD 1NXIA 1ZM2A 3HHLC 3W62A 5DM7Q 4LF4F 3ZO7A 2UVVA 4N47A 4N5SA 2VD3A 3DLEA 2QYGA 4HACB 1VMBA 4IOCQ 3SMZA 2XYGB 2D7SA 3CB4A 4RL1A 1IKWB 3FEYB 4IOAQ 4LUBA 3NMRA 1JLGB 4K8RA 1H73A 3R5AA 1BLUA 3GJRB 2OHDA 3QPIA 2QLFB 4RW9B 3G82B 3VZHA 1OYEA 3OHAA 1PC5A 3EYZA 2H3EB 3K5LA 3TW0A 4C0HA 3KMQA 4AMOA 1DLOA 2DGVA 2B5JB 5BYQA 2XS2A 4DUYF 2BJ3A 2HQIA 2DIUA 3VVTA 3ZZTA 3IAS9 2CJXB 4JI0J 3M9MB 4GKKJ 1WG5A 4QW8A 2ZJQQ 4YHHF 2M8DB 1X4DA 5LSLA 2VBZA 5A8RA 4KKOA 3C16A 1HBNA 3W9IA 3FSXA 2YNIB 5K9FA 4X84A 2RB7A 2LECA 2IA6A 1Z2LA 2MQPA 4CZCA 4GKJJ 4UY85 2HW3A 2UVWA 4O44A 4YR2A 1RTJA 2YNFA 3QATA 4ELUA 4L3KA 2HRUA 2W2MP 3KJQB 3NCPA 4ZCIA 1JJ2R 2J8AA 2K8GA 2DNYA 1S9GA 2DNOA 4F8RA 5FLXY 2DNMA 2YWWA 2HK2A 1Y0HA 4DV2F 5IV4A 2G9OA 2NXEA 4JI1F
chains in the Genus database with same CATH topology
2QC3A 4RR5A 3CJ8A 5DZ6A 3R97A 3SBMA 3R8YA 3EZOA 5CZCA 3TQEA 4RL1A 3HMJG 3PTWA 2JFKA 3K89A 3HJVA 3BV8A 2VZ8A 3TZYA 2C2NA 1NM2A 2QO3A 3QATA 2VKZG 2CUYA 2G2YA 2G1HA 3TZXA 2VZ9A 3IM9A 2H1YA 3HHDA 1MLAA 2HG4A 3IM8A 3TZZA 3RGIA 5DZ7A 2G2OA 3TZWA 4QBUA 2JFDA 2G2ZA 2PFFB 3G87A 2UV8G 3H0PA 5CZDA 2QJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QC3 A;  4RR5 A;  3CJ8 A;  5DZ6 A;  3R97 A;  3SBM A;  3R8Y A;  3EZO A;  5CZC A;  3TQE A;  4RL1 A;  3HMJ G;  3PTW A;  2JFK A;  3K89 A;  3HJV A;  3BV8 A;  2VZ8 A;  3TZY A;  2C2N A;  1NM2 A;  2QO3 A;  3QAT A;  2VKZ G;  2CUY A;  2G2Y A;  2G1H A;  3TZX A;  2VZ9 A;  3IM9 A;  2H1Y A;  3HHD A;  1MLA A;  2HG4 A;  3IM8 A;  3TZZ A;  3RGI A;  5DZ7 A;  2G2O A;  3TZW A;  4QBU A;  2JFD A;  2G2Z A;  2PFF B;  3G87 A;  2UV8 G;  3H0P A;  5CZD A;  2QJ3 A; 
#chains in the Genus database with same CATH topology
 4NMX A;  2F40 A;  2OFH X;  2UU9 J;  2IBO A;  3WIV A;  3WHI A;  1YGY A;  1U26 A;  2XZD B;  2CZ4 A;  5F8M A;  1VQ6 S;  1S99 A;  2N7C A;  2Q66 A;  1WC3 A;  4PRF A;  2E7W A;  1B70 B;  3M1V A;  1H7X A;  1B4S A;  1YG0 A;  1N56 A;  1SCJ B;  3TEG A;  3NGD A;  3W65 A;  1TKZ B;  3OTO J;  3DLH A;  2N3O A;  3AD7 C;  3P3D A;  1NLK L;  4DX5 A;  4G3I A;  3DKD A;  2IM3 A;  3PAC A;  3RAQ A;  2F8M A;  5GMK a;  3QT8 A;  3CCR S;  3GB0 A;  3QNW B;  1S6O A;  4RW6 B;  1P6T A;  2B9X A;  1S6Q A;  1IN0 A;  2DGS A;  2WON A;  1MWZ A;  4UY8 T;  3KG1 A;  4CH1 A;  4WIQ A;  3DLK B;  3QAU A;  1SUQ B;  4MTP A;  3OFG A;  4KYZ A;  1F2H A;  5JVG Q;  3G6X A;  3SYZ A;  3KWM A;  3SSS A;  2Y0S D;  1JQG A;  1WTB A;  1EP4 B;  4DR5 F;  1N8R T;  3PFE A;  4PWD A;  1VC6 A;  4B9M A;  3ISZ A;  1NB7 A;  2G0J A;  2GMH A;  3P45 B;  3GFX A;  3FUY A;  3PJX A;  3QT7 A;  3TA0 A;  1HIY A;  5I42 A;  1CVJ A;  4NCA A;  4DV5 J;  4LR9 A;  4F4Z A;  2VZ8 A;  3MTJ A;  2EBG A;  4J9V A;  3PRV A;  2YKM B;  4OX8 A;  2ERR A;  4OV1 A;  5CYM A;  1LWE B;  3DM2 B;  2QE5 A;  1SIW B;  5KG6 A;  3SCJ E;  2UUT A;  2XMT A;  4CYU A;  1K47 A;  4EMD A;  1KLN A;  3S1T A;  2C2E A;  2ADB A;  3MMC B;  2YKN B;  2GW8 A;  4ZP9 A;  4TU9 A;  1N52 B;  4M5M A;  3BEG B;  1EJ7 L;  4A8Q A;  4I56 A;  1Y11 A;  3BYR A;  4TN2 A;  2KI2 A;  3CVK A;  1FCA A;  1QUV A;  2IJF A;  5A76 A;  5HMY A;  1NDK A;  4DSK A;  2KT5 A;  1X4B A;  3PRB A;  5T41 A;  1HI1 A;  1M5H A;  1DUR A;  2PI5 A;  3ZTS A;  4CLY A;  4YS2 A;  1PYO B;  3GV5 B;  2J5A A;  2IC3 A;  2NXC A;  4KH1 B;  1GEH A;  1QSY A;  2ZIT A;  5DJB A;  1CC8 A;  2ZUG A;  3FGV A;  2YNG A;  1IQZ A;  1YHQ S;  3MM6 A;  4E8U A;  5A2Q U;  1YBA A;  1HWI A;  4PCQ A;  1ITP A;  4AL5 A;  2ALY B;  3GZ7 A;  4WK1 A;  3I96 A;  3DLE B;  2PA3 A;  1LWC A;  2W2O P;  4I69 A;  2ILY A;  3HFV A;  5F0U A;  2GHV C;  1Z4U A;  3UCG A;  1X31 C;  4ES2 A;  2MST A;  1HWL A;  3D1H A;  1GXU A;  1BQM A;  2V0N A;  2WBR A;  2FYX A;  3ZZY A;  3HHK A;  2QA1 A;  3DRX A;  2WRM A;  2ZWP A;  2EVZ A;  4LF8 F;  1DLO B;  1KQG B;  2MKJ A;  4WXW A;  4DG1 A;  4QW9 A;  4FNH A;  4F3Q A;  4NXM J;  3ULH A;  3KHH A;  3T1H J;  4KSE B;  2CDR B;  3IWL A;  2QL5 B;  4Y00 A;  1YJ7 A;  2EFP A;  1R8P A;  1SIZ A;  1S5Z A;  1X8D A;  4TLQ A;  5A8R B;  4DPT A;  2RRB A;  1VQM S;  4KKO B;  4YB5 A;  3C16 B;  1HBN B;  4O3Q A;  2AWZ A;  2RDD A;  1JK9 B;  2DGO A;  4X62 F;  3V4I A;  1R31 A;  4LSL A;  4Q8E A;  2DGQ A;  4O44 B;  2DR7 A;  2BM1 A;  3MR2 A;  3J81 Y;  1G6B A;  2FUG 9;  2LEP A;  1RTJ B;  2YNF B;  1TU0 B;  5ETR A;  1Y4Z B;  3H59 A;  1OJ4 A;  3Q8V A;  2GA7 A;  4CWB A;  5KFX A;  3POT A;  2RQM A;  2XM3 A;  2HFZ A;  3PY8 A;  3MR5 A;  3S6E A;  3N5F A;  1UJ5 A;  2WK4 A;  5JJB A;  2W8K A;  1TVR A;  1S9G B;  3FZ2 A;  2OEK A;  3F41 A;  5DDQ C;  1HMV A;  1VOM A;  3UDC A;  3UNG C;  2HHV A;  3KLG B;  3MFH A;  2RD5 C;  3KLV A;  3KUE A;  2BW2 A;  1TFW A;  3MUR P;  3MMA A;  2O1P A;  1S7H A;  2IRX A;  1FRI A;  4WYL A;  4F0H A;  2RUG A;  3H2V E;  2AIR B;  2GJ2 A;  2VC0 A;  3HO1 A;  5CYJ A;  1UJ6 A;  4Q43 A;  5IQQ A;  2VKZ G;  3SV4 A;  3R3T A;  3M1V B;  3BBC A;  1CJU A;  1EAR A;  4NLD A;  3HVW A;  2OH2 A;  2V94 A;  3R1H A;  5LMU F;  5E3C A;  3SCI E;  1GXT A;  1X5T A;  1Y3K A;  3H7H B;  3FVY A;  2QFI A;  1VLY A;  2DHH A;  4K4X A;  4NLV A;  1VBX A;  2DBB A;  3ZZ0 A;  2VQE J;  1NND A;  4C98 A;  4CLS A;  4BC9 A;  3OFH A;  4OYI A;  1S6Q B;  1SI9 A;  2QT7 A;  2WON B;  3G96 A;  2MTL A;  2DRD A;  1B3T A;  3MM8 A;  2VG5 A;  1GQE A;  2O01 C;  4M5D A;  3RR7 A;  1U4B A;  2VHG A;  4A8O A;  3D5M A;  2FIU A;  1SC4 B;  2HK3 A;  3MUV P;  1EHW A;  1T9T A;  2I5J A;  3VGS A;  2L3M A;  2PE8 A;  2HIQ A;  2Q79 A;  4ED2 A;  1RKI A;  4ED3 A;  4ZVF A;  3TJA A;  4HR2 A;  4YY3 J;  4F4W A;  1RJJ A;  2M8H A;  2E5L J;  1DTT A;  2CPZ A;  5KTQ A;  4DV0 F;  2ZHB A;  4FS2 A;  1BXN A;  4GO7 X;  3QO9 A;  3NRB A;  3CJ8 A;  2YKO A;  1UAW A;  3IO1 A;  4FF2 A;  4ELV A;  2V4J A;  4PWD B;  1IKV A;  2H5E A;  2P9C A;  2G2Y A;  3A8K A;  3CJ0 A;  5I42 B;  2ZUA A;  3IS9 A;  5ETT A;  2QMX A;  1FXR A;  3NGK A;  2ZEJ A;  1FWP A;  2FVS A;  4RR5 A;  1SV5 A;  4ZN1 A;  2KT3 A;  1C0T A;  1APS A;  4LRD A;  5CYM B;  5EX0 A;  1D9D A;  1RLC L;  3OJS A;  2AX0 A;  2GFF A;  3TAQ A;  1PBU A;  1IWA A;  1RI7 A;  1PKU A;  4JI7 J;  1MLA A;  4DSE A;  2XZT B;  1T9X A;  4WWS A;  3CO0 P;  3UE2 A;  2RUS A;  1P9Q C;  1S0V A;  4KGX B;  2HQ3 A;  4EYH B;  1LW2 A;  2VBX A;  4WTO B;  5K20 B;  4UZB A;  5C25 B;  4IOB A;  1RWK B;  1HNV A;  4RUC A;  3HVR A;  4A8M P;  2KFZ A;  1MWQ A;  5ETM A;  3CCU S;  5CAA A;  2GCF A;  4A48 A;  1RWW B;  1RAJ A;  1XR5 A;  2BJ1 A;  4KO0 A;  4DV7 F;  4O3N A;  2FTR A;  2UXC J;  3HD1 A;  2I2Y A;  3BQ0 A;  2YQ3 A;  1NDC A;  4UUW A;  5AJ3 J;  1NK5 A;  3DC2 A;  2M4M A;  2IC3 B;  2IRY A;  3PZP A;  3BR8 A;  4Q7A A;  3K58 A;  3MOJ B;  3AD9 C;  4LBI A;  3D9B A;  1S1X A;  2YNG B;  4YP3 A;  4OI4 A;  4MFB A;  3MM6 B;  3SQO P;  3AHP A;  2ZH8 A;  1SJ3 P;  2CKW A;  5HVF A;  4LSZ B;  4ZP6 A;  3VZI A;  2VOD A;  3SBM A;  1HHS A;  1JWW A;  2W24 A;  3PW0 A;  1MW7 A;  5EHH A;  1LWC B;  3CJ4 A;  3HZG A;  4EFA C;  1WDD A;  3VAI A;  5E3Q A;  2X3D A;  5F3T A;  2B9E A;  1RQ0 A;  3H42 A;  1LQ9 A;  1N36 J;  3VQT A;  1H2T Z;  2DCU B;  1BQM B;  2ZH7 A;  5HI7 A;  2RQC A;  1IXK A;  2HHQ A;  2Z2Z A;  1Q81 T;  3DXB A;  3JTO A;  2OSQ A;  1YWX A;  3B8H A;  3Q2S C;  3R5D A;  2OGU A;  2NPI A;  4P73 A;  5L9X A;  2R2T A;  4AL6 A;  1HW8 A;  3V6D A;  1FK9 A;  1N48 A;  3W63 A;  5L38 A;  4DG1 B;  1VC5 A;  2LLZ A;  4OI2 A;  2FVP A;  4FYV B;  4ZIW A;  4BS2 A;  1IWG A;  3MEC A;  4KPY A;  3NXZ A;  2YWK A;  4DR6 J;  3AOB A;  3L7O A;  3PKY A;  4J91 A;  2BBE A;  3Q0A A;  3OBI A;  2IM0 A;  1OQ6 A;  1TL1 A;  4PG5 A;  2MHE A;  3FDS A;  1SQG A;  1RHQ B;  4NYP A;  3V4I B;  2N3L A;  1SVD A;  4PXB A;  1KD1 T;  4AND A;  4LSL B;  5G4D A;  1TMJ A;  3F56 A;  2Y8Y A;  4OX6 A;  1XNR J;  4ANC A;  3DDI A;  4J37 A;  4LF7 J;  4LRC A;  1WHW A;  3POT B;  4DR1 J;  1VHI A;  4WFX A;  4HLB A;  2DHX A;  2L08 A;  2DGT A;  4IR9 A;  1TVR B;  4A8X A;  3OSP A;  2FQQ B;  3Q8Y A;  1HMV B;  5H1S V;  5IM0 A;  1J27 A;  2K7J A;  1UFL A;  4X66 J;  4HDG A;  3MPW A;  2OEJ A;  2MQO A;  2NCK L;  5I3Q A;  4NLR A;  2HZC A;  2R8G A;  4ED4 A;  1WEL A;  2BAN A;  3EE3 A;  1CJU B;  1HQ2 A;  3IR6 B;  5EX3 A;  2VZ9 A;  2CG4 A;  4ZHR A;  1HI8 A;  2BM0 A;  4QJV A;  2J6T A;  2RU3 A;  5C2C A;  4DL6 A;  2HNY A;  4XPC A;  3Q8Q B;  4DR7 J;  3K0J A;  4PG8 A;  4ECS A;  4M5I A;  5KFM A;  3CXC R;  1MG7 A;  4OYZ A;  1V6H A;  3NGU A;  1VYA A;  1X5O A;  4K5R A;  5D77 A;  2LU1 A;  5HQL A;  4ECT A;  2DNQ A;  1N5V A;  2OP5 A;  2EXU A;  4DL0 C;  1FX4 A;  1B7Y B;  3MM8 B;  2VG5 B;  1QAY A;  1U25 A;  4M5D B;  3ZFV A;  2ZDP A;  5CAB A;  3TZX A;  3KG4 A;  4NLQ A;  4YQW A;  3EMT A;  3G71 S;  3LP2 A;  1RWM B;  4AE5 A;  2AW0 A;  1U2R A;  5J1N A;  4AT1 B;  2MQ8 A;  3HJF A;  3OFF A;  2ZZN A;  1NJX A;  4LQ3 A;  1DTT B;  5ETL A;  3T1Y F;  2HHH F;  3QO9 B;  3C6U A;  5AE3 A;  2V4J B;  3CD6 S;  1RU1 A;  1HBU A;  2QA4 G;  5DLG A;  2YWG A;  1NHU A;  3IS9 B;  4JB8 B;  2D41 A;  2Y1R I;  4I4B A;  2O5D A;  1SV5 B;  4E98 A;  4WXO A;  2GZO A;  2R8K A;  1C0T B;  2F4F A;  4OJ1 A;  3AA8 A;  4WII A;  5KFU A;  3C19 A;  3K57 A;  5BJR A;  1FRL A;  2HRY A;  3GFH A;  3FMB A;  4YOE A;  2VFS A;  2GHW A;  3CMA S;  3UO0 A;  2G1H A;  1YLX A;  4QYZ K;  3M2V A;  1LW2 B;  1Q5V A;  3PKM A;  1D9A A;  4R25 A;  5DG8 A;  4WZQ A;  3VAK A;  2Y1I A;  3L09 A;  4BWM A;  5L39 A;  2FJW A;  1HNV B;  4CH0 S;  1KVK A;  2M3D A;  2ZC4 A;  3HHN B;  4ZKA A;  1KC8 T;  4KO0 B;  2AKW B;  4RLE A;  5D15 A;  1N5Q A;  3QID A;  3V6H A;  4TYA A;  4QR2 A;  4CM0 A;  2P9G A;  3M8Q A;  2B3T B;  4XK8 C;  1RT2 A;  1GMU A;  3D68 A;  4PQU A;  4KTQ A;  4Q5V A;  1S4E A;  4URQ U;  1S1X B;  4OHV A;  4MFB B;  1JLC A;  2AGQ A;  5HAT A;  2RQK A;  2DHS A;  1DTQ A;  4DDF A;  1G7C B;  1KOH A;  3V81 A;  4B3M J;  4OZN A;  1PBA A;  2UUA F;  1K9M T;  4I6W A;  3GON A;  2HWI A;  4NYZ A;  4DV4 F;  4U7U D;  3MUT P;  4AQY F;  1RAG B;  2IBK A;  3TRG A;  4HTI A;  3FBC A;  2EG1 A;  1MU2 A;  4PKD B;  2YQ1 A;  5EWE A;  1WF2 A;  2G0C A;  5L9N A;  4F0M A;  2GHP A;  3RAX A;  4O3S A;  3PW2 A;  1P27 B;  2IJN A;  3C2P A;  3QSY B;  2EFG A;  1WTF A;  4TY8 A;  2Z0G A;  1YI2 S;  3TNV A;  3JQJ A;  2LEB A;  2X3G A;  1WNE A;  3V6D B;  3CJ5 A;  5AXN A;  1FK9 B;  3TEH B;  3J81 j;  5ETK A;  1TUW A;  2VJU A;  1DY3 A;  4LF6 J;  5A0Y A;  3CT9 A;  4TQR A;  3CGI A;  1RHU B;  2NS1 B;  3CDU A;  4TXS A;  3MEC B;  1N6Q A;  3VR1 A;  4ZPC A;  3E01 A;  1VRT A;  3LP1 A;  3DDK A;  2B9W A;  2D9P A;  3C46 A;  5I3P A;  4MK7 A;  1LWF A;  1YIT S;  2QLJ B;  1D8Y A;  1TL1 B;  1XN9 A;  3ZZP A;  2ZBR A;  2FPH X;  3W8G A;  1JLE A;  4B17 A;  5B0A A;  2BA9 A;  3M8Y A;  3UQS A;  2RHQ B;  4B02 A;  2XWX A;  5E3R A;  2MJN A;  3OQ2 A;  4BCA A;  4X4N A;  3UDV A;  4KBI A;  2AJ4 A;  1R7I A;  4DFP A;  4O23 A;  3IBF B;  3K17 A;  1HNZ F;  2Y9H A;  4Q44 A;  2DRB A;  2AQ4 A;  5CA5 A;  4XIU A;  2Q6B A;  4HVZ A;  4X4P A;  2KVI A;  1W26 A;  4MMO A;  4J9U E;  5IM0 B;  2JOQ A;  1UW4 A;  1WC6 A;  3H0P A;  4ZPV R;  1UFK A;  3DMJ A;  4LFC F;  3O3L A;  5IZH A;  1RUS A;  3HHD A;  3NLC A;  3OW2 R;  4ZDN A;  2R2U A;  2UUC F;  5IXU A;  1FJE B;  5DQH A;  2V8P A;  4K4Z A;  1OWX A;  2BAN B;  3BKU A;  5KFC A;  4JI4 F;  4QWC A;  1RYR A;  4ZHR B;  1D1U A;  4LFA J;  3GJT B;  4F3M A;  3M6U A;  1NJY A;  3MR6 A;  2XMM A;  1JLB B;  5IC4 B;  2EFN A;  2HNY B;  3TP2 A;  3W1Y C;  5D0E A;  1HD0 A;  1Y3J A;  4Y65 A;  2OIH A;  3GV7 B;  3N28 A;  2W9B A;  2R4F A;  5KG7 A;  3I82 A;  1RBA A;  2XYH B;  2DGU A;  2HGL A;  2VAS A;  4HKQ A;  1DBD A;  4B3T J;  2BE7 D;  1R8A A;  3RBX A;  2WOM A;  1V5I B;  1HPZ A;  3B54 A;  2XGP A;  1WEX A;  3LP2 B;  3BN4 A;  1N4L A;  1Q0N A;  2GJF A;  3EZ5 A;  2HFO A;  1YSJ A;  2FZG B;  3KJN B;  2HS4 A;  5D6G A;  3GIL A;  4ILM A;  3C6U B;  4BWJ A;  5KG2 A;  5F3Z A;  5KFJ A;  5KFA A;  4RW8 A;  1HBU B;  1XTZ A;  1NU4 A;  1FJG J;  2J0X A;  3OL7 A;  2D69 A;  1ZOT A;  5KAK A;  1H72 C;  4ED5 A;  2DIT A;  5FII A;  4ZK7 M;  5A6W A;  2N82 B;  3QGP A;  4QR1 A;  4TQS A;  3D0I E;  5RUB A;  4JI2 F;  2HS3 A;  3H2L A;  1VQ9 S;  3PW5 A;  1BY9 A;  4WKR A;  1JLA A;  3I32 A;  3J7Z 5;  2YPY A;  1RB0 A;  2FC8 A;  1SB6 A;  4JI8 J;  2OAU A;  3ONQ A;  1J5E F;  2HS0 A;  3CC7 S;  1VHF A;  5LMN F;  3T5H A;  2OPR A;  1FHT A;  3M2V B;  1KS2 A;  2B8Q A;  2BE2 A;  3LP0 A;  1PCA A;  3UPF A;  3HHL D;  3GFZ A;  1NKC A;  2M5Y A;  3NP5 A;  3IP0 A;  2EBE A;  1UVI A;  1QAX A;  1Q5Y A;  4YDD B;  1RXO B;  2R7O A;  4DLG A;  3CED A;  1HNX F;  5KFK A;  3QJL A;  3W5Y A;  1GMW D;  2RAQ A;  2AYM A;  2DNZ A;  1LWX A;  2VQF J;  1T9V A;  4OV6 A;  1E6Y A;  2KZM A;  3EPG A;  3TO8 A;  3M8Q B;  1NCL A;  1RT2 B;  3U7J A;  1E6V A;  4PQU B;  4OX9 F;  4C11 A;  4JI6 J;  2LVW A;  5J2P A;  1UFW A;  3EUN A;  2CNK B;  4DQR A;  2FDN A;  4M1K A;  1T9W A;  2VA3 A;  4MK8 A;  1I1G A;  1JLC B;  4F4K A;  4A8S A;  1QLN A;  4QR0 A;  5KG3 A;  1YKW A;  3Q23 A;  1WKL A;  1YJ9 S;  1DTQ B;  1FFS B;  2W4P A;  5AXL A;  5LL6 d;  2I9S A;  2MZR A;  3MDF A;  3KG0 A;  4CIO A;  3V81 B;  2C3O A;  2XMA A;  3J7Z T;  3LPE A;  3DFE A;  4RBV A;  2J76 E;  2QZ8 A;  5K5M A;  3QBC A;  1SC6 A;  3FQK A;  2HMI A;  1MU2 B;  3GCX P;  2PN6 A;  2LA6 A;  1FEH A;  4U96 A;  4FDF A;  3K5M A;  3MPD A;  1H98 A;  5CH7 B;  4K4U A;  1O5J A;  2VV5 A;  1KKH A;  1VI7 A;  3D6M B;  5G0R A;  2E5J A;  4ECW A;  4TY8 B;  3KJF B;  2RSQ A;  3BDE A;  1WC0 A;  2RDI A;  2CPY A;  4X4V A;  2XQC A;  1F5B A;  2BJD A;  3CUN A;  4I64 A;  5FJ4 A;  2EG2 A;  1N54 B;  3M6X A;  4C2M A;  5E3A A;  1WSV A;  1KDN A;  5GAG I;  1C0U A;  5A0Y B;  3HDS A;  1LXJ A;  2IHR 1;  2JEJ A;  5L1K A;  2XS5 A;  1YBU A;  3KLE A;  3G8S A;  1N6Q B;  3CF5 Q;  4LRE A;  3E01 B;  2LXU A;  3BRE A;  1VRT B;  2Y0B B;  3LP1 B;  1NHK L;  4FVC A;  3HD2 A;  1LWF B;  2HBQ B;  1RGV A;  2MYF A;  3NS6 A;  2QA2 A;  1XJW B;  1EKS A;  4JI5 F;  3RB0 A;  5BYR A;  1JLE B;  1U2C A;  5EUH A;  5L8R C;  5KFB A;  3LAN A;  4XPE A;  3AD8 C;  4FPI A;  1Q8B A;  1UVM A;  2JZ5 A;  1FDB A;  2J6S A;  2DR5 A;  3ZNU A;  5CCL A;  2A1B A;  2QO3 A;  1NRK A;  4P2F A;  3W3S A;  1YQH A;  5J2Q A;  1CSJ A;  5H9E K;  5KFT A;  2VF3 A;  2Z56 B;  1RBL A;  2DPJ A;  2UU9 F;  4CTA A;  5GAH I;  1V3S A;  2KG1 A;  5DG7 A;  1VCT A;  4X2B A;  2BKP A;  2FVR A;  3UI3 A;  1I6J A;  4X4R A;  1OSC A;  1TAU A;  3DMJ B;  3OTO F;  1IKX A;  2A6M A;  2KB2 A;  1RA7 A;  1FRX A;  4HL9 A;  2D3Z A;  4JV5 F;  3FC9 A;  3ILI A;  2H4Y B;  2LXF A;  3TA2 A;  1LFW A;  3HSJ A;  1KQS R;  2D3O R;  2ASL A;  2PT0 A;  1Y9O A;  2XMW A;  5SUH A;  1YJW S;  4F26 A;  5BYS A;  4WK3 A;  1Q8K A;  2AD9 A;  1NDP A;  4WZM A;  4DPU A;  4YEA A;  3Q86 A;  3R2D J;  2JFD A;  2XMJ A;  4YR3 A;  2VIC A;  2DR6 A;  2YWE A;  4FYW B;  5KT7 A;  5DDR C;  4JYA J;  4QWE A;  3IRX A;  2W9B B;  3LGH A;  3A3P B;  3K8V A;  2M2B A;  3ZZZ A;  3TZW A;  1X60 A;  3PX6 A;  2FZC B;  4JV2 A;  1QVF R;  2WOM B;  1NPP A;  1HPZ B;  1YRX A;  5A8K A;  1RT3 A;  1PIE A;  5EWG A;  1Y5L B;  1NEE A;  2IIH A;  2BAB A;  4H4O A;  2MGZ A;  4O0N A;  5KOX A;  4DF4 A;  4C8Z A;  4OZ0 A;  2AEJ A;  5GAD I;  1SC3 B;  4IO1 A;  7FDR A;  1ZAX A;  5F8J A;  5CQG A;  1N32 J;  2BW7 A;  1IJE B;  5D0H A;  2P5V A;  3LTO A;  1RKJ A;  2CIM A;  3TQ1 A;  4ZMM A;  4C3M A;  4HT7 A;  4A8F A;  2J9D E;  2DNP A;  2B7B B;  2K2P A;  4DU8 A;  1AA1 B;  2WBM A;  4MT1 A;  4GMK A;  1H3D A;  3UN3 A;  1JLA B;  4EZ6 A;  1X4G A;  1T9U A;  3FSY A;  1S4F A;  4WFA Q;  4A46 A;  4DR3 F;  2HRT A;  1HA1 A;  4L75 A;  1T95 A;  1U1M A;  3NS7 B;  2OO4 A;  3DRP A;  2HFN A;  2YBV A;  1RAD B;  4FBT A;  5KG4 A;  4KHP F;  4HHU A;  2XMK A;  3DGV A;  2OPR B;  3A12 A;  3QFH A;  4LF5 J;  2BE2 B;  3LP0 B;  2GO8 A;  5KFL A;  1HNI A;  1CQM A;  2P2C B;  5HJX A;  1U6F A;  2E29 A;  2CQH A;  2CVE A;  2MZJ A;  7FD1 A;  1KSP A;  5GAH U;  2MZT A;  1N5T A;  5LSO A;  9ATC B;  2MY7 A;  2J7W A;  4CO4 A;  2BUN A;  1IBC B;  4D3G A;  2BRK A;  1RWO B;  2AU0 A;  1S6P A;  1E6Y B;  4K7Q A;  1X0F A;  1N5S A;  2PEB A;  4C6A A;  3PM9 A;  4RNM A;  2LU2 A;  4Q8F A;  5K8N A;  1E6V B;  1IBL F;  4DFK A;  1JJC B;  4C11 B;  2Y1J A;  5J2P B;  2B4P A;  2NSC A;  2BQR A;  2DO0 A;  4CT8 A;  4DR2 J;  2CNL B;  2KU7 A;  3D4J A;  2ZVS A;  4RU9 A;  4LF4 J;  4B08 A;  2UV8 A;  2ZHA A;  2W2P P;  5CD4 H;  4ECY A;  2F63 A;  4S0M A;  3F44 A;  2G2Z A;  1Q7Y T;  4EUV A;  1N34 F;  3I5A A;  2BOP A;  3R5J B;  3NAI A;  3R7N B;  3CW2 C;  3S7R A;  4P2S A;  4WU3 A;  2HMI B;  4KIA A;  2DEI A;  4ZLP A;  3HI9 A;  4P6Q A;  1YZ7 A;  1J5O A;  2J7K A;  3TI0 A;  4NXM F;  1WKJ A;  4M94 A;  4QZV B;  2RT3 A;  3IN5 A;  3MM9 A;  3RUB L;  1RT4 A;  5G0R B;  2QN6 B;  3M32 A;  4OYX A;  2DNR A;  4KGK A;  1ZYQ A;  3OLA A;  2R2R A;  2KL8 A;  2V8H A;  4UZC A;  1U1N A;  4DLE A;  1SBR A;  4DSF A;  1C0U B;  4YHH J;  3QRR A;  1ZA1 B;  2YH1 A;  3D3C J;  2HZA A;  3KLE B;  3GJQ B;  1LFP A;  1WG4 A;  1WHY A;  3GQC A;  1RBO B;  2V9W A;  2QX0 A;  4ED8 A;  3OJU A;  3AJ2 A;  2FGO A;  1Y5I B;  5IV3 A;  2IFX A;  4K4T A;  3PNI A;  5K14 A;  1FJC A;  3RGI A;  5LJ5 Y;  4DMZ A;  4DOZ A;  3EX7 B;  1ZZN A;  1FNM A;  5KFW A;  4I2P A;  2CQB A;  3B78 A;  5J2Q B;  3AOD A;  2NZ4 A;  5DO2 A;  3RU0 A;  4CTA B;  4FBU A;  4B3S F;  4HHJ A;  1CEZ A;  1BQN A;  3OR1 A;  4USJ C;  2CFX A;  1RWN B;  1FDA A;  4JI1 J;  1L3U A;  1NK4 A;  1IKY A;  5ITH A;  3KTQ A;  1N33 F;  5KFF A;  1TMM A;  4QOT A;  1OMS A;  5C2G A;  1IVZ A;  1IKX B;  1WOS A;  3P6Y C;  2DIV A;  2N4C A;  1IKW A;  1AB8 A;  2CUY A;  3PJW A;  3CJR A;  1PJ5 A;  1JXV A;  1CS4 A;  5DS7 A;  2KKH A;  1RHJ B;  2XMU A;  2GQ2 A;  2RS2 A;  2HUR A;  4N8N A;  4GO5 X;  4CLT A;  2FGC A;  4N76 A;  4KAI A;  1BWV A;  4ATN A;  3QYY A;  2MKC A;  2BOA A;  3DN9 A;  2Z4P A;  1F3V A;  2AGO A;  3IRX B;  2CQI A;  2XB2 D;  3EGZ A;  1U09 A;  3G4S S;  4EBC A;  2CZV C;  1Y7P A;  1FF2 A;  4EO8 A;  3KLH A;  4HI2 A;  2FJD B;  2E5L F;  2V9K A;  2EFQ A;  1RWU A;  3W60 A;  3BO4 A;  3W64 A;  1L3V A;  4B3R F;  4TU8 A;  4TY9 A;  3OHB A;  3MPV A;  5A8K B;  1RT3 B;  3H5X A;  2BEF A;  2CPF A;  5L1J A;  3ICL A;  4H4O B;  2MGZ B;  4DR5 J;  2B0G A;  2Z2Y B;  2ZNZ A;  5J2N A;  1U1O A;  2DD8 S;  3HPO A;  4EU0 A;  1ZM9 A;  4UT4 A;  1I94 F;  5BR8 F;  1ZTW A;  1S7I A;  3JSB A;  5GMD A;  4ANE A;  2YKP A;  2ZM6 F;  3QZ8 A;  4JI7 F;  4NRU A;  3L7U A;  4USK A;  4UOH A;  2ZH6 A;  1S1U A;  4X65 F;  3DRS A;  5LJ3 Y;  2QYC A;  3P8B B;  5KFQ A;  2F4V J;  4YB6 A;  5MAO A;  1FD8 A;  2WHO A;  2WVC A;  1DQ9 A;  2LQ9 A;  4FKY A;  1DQ8 A;  3WQP A;  2EK6 A;  2F9J A;  2IM1 A;  4KT0 C;  2LA4 A;  2YX7 A;  3UDL A;  1FVS A;  3LAL A;  2BR0 A;  3ZC4 A;  4QWA A;  1T03 A;  1ROF A;  5B0B A;  4AMP A;  1UMJ A;  3W2W A;  3DRP B;  4R8U A;  2VFU A;  2CA9 A;  1RK8 A;  2OD6 A;  1FKO A;  3JSR A;  3Q8R B;  4V19 X;  3D66 A;  1HNI B;  2RVJ A;  4P7T A;  2BMB A;  3G8Q A;  1XEZ A;  3M6V A;  3QWU A;  2PDA A;  1LNQ A;  2XI3 A;  4ZPW R;  5F8L A;  2DTJ A;  4MKY A;  3VQS A;  2JSX A;  3SSQ A;  4J9N A;  1T3N A;  4DHV A;  1S6P B;  4TLR A;  3OPK A;  4U67 Q;  1ARO P;  3CE8 A;  3CCJ S;  2BRL A;  4DL4 A;  3QGH A;  1KQK A;  1EZZ B;  1FE0 A;  4PPZ A;  3B82 A;  2JC1 A;  2JLF A;  3BSN A;  1LK5 A;  2CJA A;  3TZY A;  1WI6 A;  1CG2 A;  3ZZU A;  4Y2M A;  4PWU A;  4Q45 A;  5D8H B;  2E1M C;  2ALZ A;  1K0V A;  4Y28 C;  2WW8 A;  4BHQ A;  1KLM A;  2U2F A;  1PG5 B;  4B9S A;  2XBP A;  2A0F B;  1KWM A;  4CLL A;  4ERD A;  3UD4 P;  3FKB A;  4HI1 A;  1GMV A;  3QSI A;  4RJV A;  2EC2 A;  2NSB A;  2WVB A;  3LPY A;  2M70 A;  2DY1 A;  3PYF A;  1WEY A;  3R6G B;  2QSF A;  2J9C A;  2DNL A;  2J9E A;  2EEY A;  3T9Z A;  2OTL S;  2WVE A;  1J5O B;  1KEK A;  3MM9 B;  2APO A;  1RT4 B;  1U0H A;  2E1P A;  3M32 B;  3P5T L;  1LWE A;  4LF8 J;  1M0S A;  2ATC B;  4DR6 F;  3PO5 A;  1W2B R;  3HCX A;  3OXG A;  3RG6 A;  5C42 A;  4NOH A;  4JI3 J;  2XLI A;  4KPC A;  1R43 A;  3IA0 A;  2E9T A;  2HHT A;  3VAH A;  2UVR A;  2GNK A;  2J0S D;  1VC0 A;  1HQU A;  1PYS B;  2EC0 A;  1Y00 A;  3FMW A;  4ILR A;  1GTH A;  2CVI A;  2HHU A;  3TA1 A;  2BDP A;  1NSK L;  4C48 A;  4DR1 F;  1H38 A;  4BDP A;  1IBM F;  3JTP A;  5THW A;  1KTV A;  2R8H A;  5K14 B;  2YPZ A;  4C7Q A;  2P8I A;  4ZOS A;  1IR0 A;  3AXK A;  4I2P B;  2CJK A;  2DXE A;  3MM7 A;  4FYX B;  3RBE A;  3JSM A;  2W9C A;  3CJQ A;  1C1C B;  1BE4 A;  3PYE A;  3KHL A;  2R7Q A;  3EIC A;  2QLX A;  4UQT A;  1BQN B;  3EJM A;  1OY6 A;  3KJV A;  3OR1 B;  3BBF A;  2XSF A;  4N77 A;  3V5R A;  3N0V A;  1XER A;  1IKY B;  2R2S A;  3M2R A;  3FBE A;  3AB2 B;  2VKR A;  1GAO A;  2VB6 A;  4MYT A;  2A2C A;  3ZZR A;  1N0V C;  2DPI A;  2CXE A;  4OHX A;  4KRW A;  5B08 A;  4DR7 F;  2R8J A;  1W7W A;  3CD5 A;  2C2M B;  2BJ7 A;  3BJY A;  1CS4 B;  5LMU J;  4IG0 A;  3T41 A;  4OI3 A;  5ETV A;  3O6Q A;  1JLQ A;  5U47 A;  4K59 A;  2BJE A;  5AXK A;  3QJJ A;  2R7S A;  3R97 A;  5HK4 A;  3I9Z A;  3SIP B;  3W5X A;  3KHR A;  1PIL A;  3V2U C;  5IWA J;  3NMA A;  2ABY A;  3M8P A;  2RKI A;  2VDI A;  2BJ8 A;  1KP6 A;  2C1E B;  1KON A;  1FT8 A;  2GX8 A;  1RAE B;  1FDD A;  3KLH B;  1Y5N B;  1JJH A;  1V5V A;  2AGP A;  1B64 A;  4IRK A;  3ADA C;  3P5B P;  3CPW R;  4C0B A;  4XAK A;  4CCH A;  2ILZ A;  4IH7 A;  4I2Q A;  6FDR A;  2IJR A;  4K0K F;  4U6P A;  3QT6 A;  2CPJ A;  1KHW A;  1U6Z A;  3LO3 A;  4YN3 B;  4DV0 J;  2RQ4 A;  3PXG a;  5J2N B;  1UEK A;  2M7S A;  3RB3 A;  1RHR B;  2YKQ A;  2DY9 A;  1X4E A;  1XNQ J;  3GYG A;  4P72 A;  2BQU A;  4BC7 A;  1RT7 A;  1RDR A;  3UR3 C;  3ZTR A;  2COL A;  1FTR A;  1S1U B;  1RU2 A;  3DRS B;  3T9N A;  5EN1 A;  1YBT A;  2EFO A;  3MFI A;  4OLO A;  1S1T A;  3ZTO A;  5KFR A;  1D9F A;  4I0W A;  2D1C A;  1PSD A;  3DU6 A;  2HNZ A;  3KLG A;  1RP5 A;  4NCG A;  1T03 B;  2C2Z B;  1NO8 A;  4WPA A;  5IOL A;  3MEG A;  2XMV A;  3ILJ A;  3W2W B;  4R8U B;  2V2V A;  2VG7 A;  2AP6 A;  2V8G A;  2JNJ A;  2AX1 A;  3IM9 A;  4K2J A;  1FKO B;  4JV1 A;  4X4Q A;  2OI2 A;  3AFG A;  2C28 A;  4NEZ A;  5ETO A;  1TR0 A;  1REG X;  4ZVU B;  2QV6 A;  3RB4 A;  2HQC A;  5B0F A;  2V5H G;  1XMQ J;  4DSJ A;  2LQB A;  4GVB A;  2ROG A;  4WFY A;  1UA1 A;  1JMT A;  1ZBT A;  3DLL Q;  2YXL A;  4RW7 A;  4ELT A;  4LF9 F;  2AMC B;  2NLW A;  5F8N A;  2CPH A;  1TTH B;  1VR6 A;  3ZTP A;  5IT0 A;  2MKY A;  3R1L A;  4AFF A;  5KFG A;  1R0A A;  2MMY A;  1M90 T;  5IT9 U;  3OTE A;  3GMG A;  2W25 A;  4Y2K A;  4YB7 A;  4CO1 A;  5LM7 E;  1F5C A;  4I1T A;  1MN7 A;  5E41 A;  4KFB A;  3VGV A;  2NXN A;  1YRU A;  2E44 A;  4B9U A;  2GS8 A;  5KG0 A;  5LSR A;  2O67 A;  4RNO A;  3R2C J;  1KLM B;  1VQS A;  4MIB A;  1WWH A;  2C2N A;  1UP1 A;  1TL5 A;  4FKX A;  2GC8 A;  4DPO A;  4Z37 A;  1LV5 A;  1GT8 A;  2DYA A;  4RU2 A;  4PYD A;  1UVN A;  4GVL A;  1W25 A;  4LR8 A;  4M8L A;  3LAK A;  4CLP A;  1TAQ A;  1QE1 B;  2W2N P;  1U0H B;  4OYM A;  5AE1 A;  2IDE A;  2V68 A;  2B4V A;  4Y6I A;  2MDA A;  1S1V A;  5H9F K;  2WB4 A;  3NY0 A;  5T7L A;  2AZ3 A;  5F8G A;  5HRO A;  1K1Q A;  4MAK A;  5C42 B;  5HQ8 A;  2PI4 A;  3LGM A;  1YJT A;  4F04 B;  2YWH A;  4DF8 A;  2XNQ A;  4CLK A;  3KFW X;  4OI0 A;  3NCR A;  1QJH A;  2CPI A;  2XLJ A;  1HQU B;  2X51 A;  2OLW A;  2AF6 A;  2ROE A;  1NAQ A;  2BKO A;  1OY9 A;  2KHC A;  1EAY C;  4ES1 A;  1URR A;  5C25 A;  3CDE A;  4DFJ A;  5L1I A;  2E5G A;  1JIH A;  4PXD A;  5HN0 A;  3IC1 A;  4EZ9 A;  4FXV A;  2CQG A;  4V1A k;  3MM7 B;  1FRM A;  1P8G A;  3JSM B;  2W9C B;  1QM9 A;  3B4D A;  2CAJ A;  3FCH A;  4PG4 A;  3G6Y A;  3N9U C;  1U7L A;  2WTF A;  2DR9 A;  1TUG B;  2E5I A;  2E66 A;  1N5Y A;  3IGN A;  3KJV B;  2HQG A;  2AJ0 A;  4LFA F;  5CZD A;  4NZ0 A;  4URG A;  3M2R B;  4WCE Q;  2JWN A;  4OZ2 A;  3BQ2 A;  1RLD A;  2OPS A;  4P2M A;  1NZ8 A;  1RIS A;  1M5P C;  4UF4 A;  1D09 B;  2JEG A;  2E7X A;  3IRW P;  1F2G A;  3VWS A;  2CG8 A;  4IG0 B;  5CZX A;  1JLQ B;  2GQQ A;  2XO6 A;  3X3U A;  3O44 A;  2FHK A;  4IH6 A;  4CLF A;  1MNE A;  4UUX A;  4OJH A;  5F0W A;  1YJR A;  1MMD A;  2CQ0 A;  3M8P B;  2RKI B;  2X1F A;  4I6Y A;  1SJ4 P;  4DCJ B;  1NK7 A;  1X9W A;  4U95 A;  4GRS A;  4NRT A;  3G6V A;  4F7V A;  4ZJO A;  2XCP A;  3AA9 A;  2H5J B;  1UPM B;  4PG7 A;  4NA1 A;  3A13 A;  1LK7 A;  2K3K A;  4I2Q B;  5KFE A;  3BGR A;  2MQL A;  3K5N A;  4FPR A;  2CPX A;  2DNH A;  3OXF A;  1FJG F;  2M52 A;  3IR7 B;  4ILL A;  2DHG A;  1X9S A;  3T1Y J;  2HHH J;  4QYZ J;  5FLX U;  4K5S A;  3V6K A;  2GMJ A;  3NOC A;  2MZS A;  1WEZ A;  1X0P A;  4Z7Y A;  1VS3 A;  1NPK A;  1S77 D;  3OTD A;  5CCM A;  2VPZ B;  1RT7 B;  2A6O A;  3TVZ A;  1FKP A;  3RBZ A;  1HWK A;  3BZQ A;  1U24 A;  2EI5 A;  3OD2 A;  5E33 A;  3R5G A;  3T5L A;  1S1T B;  4DPW A;  2PFF B;  3BKF A;  4DL2 A;  1NSA A;  1WDT A;  2HBY B;  3M2U A;  3RAM A;  3BB5 A;  3AH6 A;  3D0G E;  1U1K A;  4DQI A;  3EVW A;  4Q0B A;  2HNZ B;  4L76 A;  4Z2X A;  4NCG B;  1YTY A;  1TQL A;  4D3H A;  4XTT A;  4YDX A;  3JTN A;  2E9Z A;  3MEG B;  4LVO P;  4ZVQ B;  2CRL A;  4WJB A;  1HNW F;  2MSS A;  2VG7 B;  2R9L A;  2VQF F;  3MCN A;  2IMW P;  4EBE A;  3H98 A;  4DV6 F;  4M63 A;  1FA0 A;  4DX6 A;  2OEM A;  3LH2 S;  4GVB B;  1IM4 A;  1W2I A;  2DH9 A;  2XUL A;  2WSE C;  2OSR A;  4RW7 B;  3CDW A;  1ICE B;  4L73 A;  4CO5 A;  1NK6 A;  2IVM A;  1VQ4 S;  3R7S B;  2DRA A;  2VBY A;  3T5J A;  1R0A B;  2KXH A;  3KK1 B;  2KM8 C;  1A7G E;  3LW5 C;  2Y3Y A;  2IY5 B;  3TAP A;  3W5Z A;  3IGV A;  4RUH A;  3PRD A;  1QD1 A;  1SJ1 A;  1FFW B;  5C24 A;  4ZLJ A;  4KFB B;  1F60 B;  3CD7 A;  3D28 A;  4F25 A;  3NEK A;  2EW9 A;  1RT1 A;  2UUA J;  4N56 A;  5HP1 A;  1FNO A;  2X1G A;  4DV4 J;  3EGW B;  4AQY J;  4WP8 A;  1D8Z A;  1GTE A;  3BR9 A;  5DZ6 A;  1N0U A;  4Y2A A;  1AZS A;  4WKY A;  3EGN A;  2QLB B;  4P74 A;  2VIH A;  3H4B A;  2FHJ A;  1V3Z A;  3VVU A;  2RS8 A;  3M05 A;  2NYH A;  4Y2I A;  4WTY A;  3R6L B;  3MAH A;  5HBM A;  1HR0 F;  1X5S A;  1RHK B;  3HJV A;  4ZLL A;  1S1V B;  1R89 A;  3D7S B;  5IT4 A;  5T7L B;  2UUB F;  5HRO B;  3KLF A;  3IG1 A;  4ZPT R;  1JXE A;  2MKH A;  4G1I A;  4IDK A;  4XDC A;  4OL8 A;  1IR2 A;  1T3O A;  4QYR A;  4F4Y A;  2VU5 A;  3BN7 A;  4DZD A;  4F3O A;  4KH0 B;  1F9F A;  5AXM A;  4FVM A;  4YME A;  2FHJ D;  4Y3C A;  1ZTT A;  1MML A;  2PII A;  1O6X A;  4OZ5 A;  1CQN A;  5CXT A;  1S72 S;  4DCO B;  1U49 A;  1SL1 A;  1S12 A;  1VQO S;  2R3V A;  2HLU A;  3OL8 A;  4I67 A;  1XMO F;  1CBK A;  1ACM B;  4ZVS B;  2ZBI A;  2GJI A;  1N5Y B;  2YNH A;  2FJV A;  1AXQ A;  4NLS A;  3GFY A;  3I5B A;  3OT9 A;  1WG1 A;  2BJ9 A;  4J5O A;  8ATC B;  3PFO A;  1RCX B;  4FP9 A;  3H4D A;  2B6A A;  3I55 S;  2OPS B;  2UUC J;  4USI A;  4LJM A;  5HLF A;  3NKY A;  4JI4 J;  4NXN J;  5LOQ A;  2V2K A;  3OUY A;  2ACY A;  1UCN A;  2R42 A;  2MKI A;  2BV3 A;  4XDD A;  3Q2T C;  3H25 A;  1M5O C;  4LRF A;  2RJZ A;  1RWP B;  2QMW A;  3PYG A;  5B0G A;  3D3B J;  3L9Z A;  4IUF A;  1URN A;  4RUA A;  3D67 A;  2ACM A;  1B7F A;  2F1F A;  2N4D A;  4FYD A;  3S8S A;  3WC0 A;  4DUZ F;  1NKE A;  1UET A;  5LT5 A;  2YX4 A;  2JX2 A;  2QTW A;  7AT1 B;  3BGR B;  4DJB A;  4W90 B;  3IAM 9;  3I0S A;  5IT9 Y;  1AW0 A;  3KHG A;  2P6S A;  2XY6 A;  3FZB A;  3R7B B;  2IM2 A;  3KNA A;  4CH7 A;  3HX9 A;  4C3K A;  2W2Q P;  4EK2 A;  5HO4 A;  4KJI A;  2V8V A;  2DEJ A;  2KRR A;  2FHM A;  1ZPV A;  2HFV A;  4DXL A;  1FKP B;  3KUH A;  2H4W B;  2RF2 A;  3A1Y G;  3DCA A;  3SXL A;  3GSI A;  4CLU A;  2CQD A;  1VGY A;  1A0O B;  1HWU A;  4QIE A;  4HEA 9;  1PO6 A;  1ZET A;  2VG6 A;  4JI2 J;  3QGG A;  4FF4 A;  1KVJ A;  5B0E A;  4KQZ A;  4NAS A;  3THT A;  3M2U B;  2AEM A;  4Q0B B;  4NEY A;  4AD6 A;  1UWB A;  4DI6 A;  3TUP A;  1S0M A;  5M2U A;  3M9N B;  2KXN B;  1IUJ A;  3BYP A;  5LMN J;  1D0E A;  1F5A A;  3V6J A;  4JV0 A;  3TX8 A;  4LRB A;  1J2V A;  3GTY X;  5CD4 A;  3K5O A;  3MAQ A;  1ELO A;  1XK8 A;  1QSS A;  4OYB A;  3A3O B;  2XGQ A;  3TZZ A;  1MMN A;  1VFJ A;  1UVJ A;  3TR5 A;  1X4H A;  4OI1 A;  1JLB A;  4C8M A;  2CQ1 A;  3U27 A;  4A8W A;  3I5C A;  1ZS6 A;  2QL9 B;  4QIV A;  1T7P A;  2WCX A;  4C97 A;  4P71 A;  2PEH A;  4CI0 B;  4OX9 J;  2ZOF A;  4M5N A;  2VL1 A;  3T1A A;  1TKT A;  3BH7 B;  2V2Q A;  3M7V A;  2I0X A;  2EFV A;  3PIO Q;  3L95 X;  2B51 A;  5HAN A;  1FX2 A;  1H2V Z;  3ILL A;  2IDL A;  3VAF A;  1V9O A;  2ZH4 A;  3R5B A;  3CD0 A;  3ELH A;  4WE1 A;  2UXB F;  3D6F B;  3QAE A;  3DNC A;  4TNO A;  5KT4 A;  2UV8 G;  4A4J A;  5A2Q Y;  3F73 A;  5C24 B;  3NCQ A;  2QEX S;  1WJ9 A;  4J90 A;  2PD1 A;  4LSN A;  4KC5 A;  1RT1 B;  5HP1 B;  5ADZ A;  1AZS B;  3KNG A;  5D4L A;  2J6U A;  3TOQ A;  1B99 A;  3UR0 A;  4LT6 A;  3OTB A;  3VAG A;  3O1L A;  4LFB J;  1HLW A;  5HBM B;  4DV1 F;  3QRP A;  1BHN A;  1U1L A;  3E2E A;  1X4F A;  2QIF A;  1F3F A;  6AT1 B;  5H9E J;  3RR8 A;  2IAJ A;  4ZVP B;  2J8S A;  1IQT A;  1O0P A;  3GLJ A;  4CO2 A;  3KLF B;  2YKA A;  1F1B B;  1PJ6 A;  3IG1 B;  4JBC A;  1UVK A;  2Q6C A;  3ET6 A;  2POK A;  1XQI A;  4IDK B;  2B43 A;  3HF5 A;  4G6V B;  3MED A;  1JXL A;  1TFY A;  2JVO A;  3MEE A;  2BQ3 A;  4ZS6 A;  5M2R A;  4KHM A;  2HND A;  3BDP A;  1JX4 A;  4JI5 J;  3G86 A;  1NB2 A;  1NDL A;  2GML A;  3N6M A;  2F5G A;  3MR3 A;  4MIA A;  4WFB Q;  1AT1 B;  5F9N A;  2DGW A;  3GYX B;  1DJ0 A;  2H48 B;  2Z2M A;  5KOW A;  2JDJ A;  3U1N A;  4OMF G;  2Z30 B;  3GR0 A;  1UTA A;  3BV8 A;  4ECZ A;  2CPE A;  1Q7L B;  3T3F A;  1T05 A;  4W92 B;  2L9N A;  3EDQ B;  2JHE A;  3RZA A;  2PSZ A;  4ECV A;  2YNH B;  2P6T A;  4ALZ A;  1HFE L;  4ED0 A;  4LQ9 A;  3L4B C;  4NML A;  1U1R A;  2ZBQ A;  1I5O B;  2NYI A;  1VBY A;  2EWH A;  2KYX A;  2B6A B;  1S1W A;  4JV5 J;  4KR0 B;  4OYO A;  2GAG C;  5HLF B;  1R6Y A;  5J2M A;  1NJI T;  1RTZ A;  2EPI A;  2HHW A;  1VQK S;  3AQO A;  2V8D A;  3OUY B;  2KXF A;  5F8I A;  3KK2 A;  4MIW A;  5CZV A;  4UW2 A;  4PPD A;  3ETM A;  3KKF A;  3NOG A;  1WOO A;  2J7U A;  3SZ2 A;  3MGJ A;  4QQB A;  1UZD A;  3SFG A;  2YQ0 A;  1S59 A;  4IRC A;  5HL7 Q;  2G13 A;  4RBU A;  4A47 A;  4NZ6 A;  2KJV A;  2KDO A;  4MH8 A;  2OPQ A;  3CC4 S;  5HVH A;  3CTR A;  3Q8S B;  2B7C B;  3H2U B;  5DDP C;  3T6J A;  2Q1L A;  3JB9 k;  1OS5 A;  2JEI A;  2F3J A;  5KFV A;  3FSI A;  4ENO A;  5IQ6 A;  1NH8 A;  3NGS A;  1SH0 A;  3I0S B;  3AB4 B;  1TZ0 A;  2FJA B;  3W8P A;  4QIF A;  3FFI A;  1VQY A;  3QLH A;  1DHM A;  4J7C A;  1S97 A;  2WSF C;  1YVF A;  3KDN A;  3DLG A;  3JQK A;  2F4V F;  1VQ8 S;  3CC2 S;  5F8H A;  1HBM A;  4X4T A;  4QPT A;  3TUI C;  5DM6 Q;  4U9R A;  3THP A;  3H40 A;  1M5K C;  3PYD A;  2RF2 B;  3DHX A;  1FRJ A;  2LP4 A;  3EGV A;  3H5Y A;  5KFY A;  3WX8 A;  2VG6 B;  1FDN A;  2KO1 A;  4USV A;  2QA4 S;  2KJW A;  3TAM A;  2HWH A;  1RTI A;  1PGZ A;  1XC9 A;  4OFZ A;  3IFE A;  3AY0 A;  1FI4 A;  5F9L A;  1FES A;  4QWD A;  1FER A;  3W61 A;  5SZT A;  4DR3 J;  1FXD A;  3T5K A;  1AFJ A;  4ZCK A;  4Y34 A;  1RA6 A;  1UWB B;  1VBK A;  4IO9 Q;  3GIM A;  2XSJ A;  3G9C A;  1ZZF A;  5D4N A;  2XTJ P;  4KHP J;  2V4Q A;  1TKX A;  1ZAV A;  4NLX A;  4LIR A;  1U1P A;  1RTD A;  3GYN A;  2W9A A;  1QDU B;  2PMH A;  3D0H E;  1XWL A;  2ZH3 A;  2KRB A;  1L3T A;  1RAH B;  5K8O A;  1HQE A;  4H4K C;  4X64 F;  1BMQ B;  4ECX A;  1IBK F;  2XHW A;  5CHC B;  3HK2 A;  3DRY A;  2ATL A;  4USU A;  5DZ7 A;  2XHC A;  1U8W A;  4FYY B;  4DL3 A;  3OL6 A;  1L3K A;  4PR6 A;  5KT3 A;  2BX6 A;  1R27 B;  3NGR A;  1RZM A;  1IBL J;  2CJY B;  3DLJ A;  2JC0 A;  2GVZ A;  2LDY A;  1TK8 A;  1ZA2 B;  2RIJ A;  1TKT B;  2JJ4 D;  1VRU A;  3DRR A;  1WAC A;  5DLF A;  4ZP7 A;  2HEK A;  5D0R A;  1R6V A;  3CCS S;  4WE1 B;  4KGM A;  1QTM A;  5L46 A;  3U02 A;  2L9W A;  4C8L A;  4LSN B;  2JH3 A;  2QL7 B;  2GAH C;  2A18 A;  3Q24 A;  3TQE A;  5J1E A;  2IVF B;  2GV1 A;  1N34 J;  5JVH Q;  1Z2Z A;  4FNI A;  1QSL A;  4HHH A;  2WVF A;  4P75 A;  4A8Y A;  3HHL A;  4NYO A;  5E2Q A;  3UN5 A;  4X4S A;  3L3C A;  1S10 A;  3CIZ A;  2QJ3 A;  2E9R X;  3GG0 A;  1FRK A;  4JI3 F;  3UD5 A;  3C14 A;  4P9S A;  2SXL A;  1GMW A;  2HVD A;  3FK4 A;  2DT9 A;  3TJ8 A;  3C8Y A;  2KM8 B;  1PAE X;  2IAJ B;  3AQP A;  4CRJ A;  3NNC A;  1DZ5 A;  2YY3 A;  2Z8Q A;  3Q89 A;  2HG4 A;  1CJV A;  2MPU A;  3ET6 B;  4OI6 A;  1XR6 A;  4NLY A;  5E5N A;  2XZW A;  3MED B;  2K1R A;  3PW4 A;  1M1H A;  3MEE B;  2JEF A;  5LXY A;  2OJ3 A;  3H5S A;  2UUW A;  2UZA A;  1BQX A;  4J9M A;  2HHX A;  2HND B;  3RJM B;  1NSQ A;  1B0T A;  3AJ1 A;  4W98 A;  3G2X A;  3W9J A;  4CLZ A;  3CCQ S;  5DGA A;  4C0O C;  4DFM A;  4G1P A;  4DBQ A;  4DV3 J;  3DI6 A;  1GX5 A;  1OO0 B;  2BKN A;  4MKV A;  2ZE2 A;  2H51 B;  1XMB A;  1SKR A;  2LCW A;  3MEK A;  2FY1 A;  4USW A;  4I7F A;  4F2S A;  3CCV S;  1U6B A;  4V19 J;  3OTC A;  4OLP A;  3K7R A;  2BE9 B;  1S9E A;  2ASD A;  3UDE A;  4Q2L A;  4QWB A;  4AMM A;  4B3S J;  3GP9 A;  1RWV B;  1T05 B;  2M88 A;  3EM1 A;  2MB0 B;  1WC1 A;  1NH7 A;  4ED1 A;  1P1T A;  2D3U A;  1N33 J;  4UQG A;  2B4O A;  3GJS B;  5MLC V;  2NR0 A;  2V69 A;  2OD4 A;  1S1W B;  3RW7 A;  2RML A;  3I0R A;  3M9O B;  1PYT A;  1Q95 G;  5J2M B;  5IWA F;  2V34 A;  1R0B G;  3NNH A;  1R8C A;  3J7Y I;  1QUP A;  3A8I A;  3CCM S;  3KK2 B;  3GR1 A;  4R5P A;  4IG3 A;  2M9K A;  5ETN A;  5D78 A;  3O2I A;  5IFM A;  3A4T A;  4I68 A;  4B3O A;  3UVJ A;  4JI0 F;  4RO0 A;  3VF0 B;  4GKK F;  4J9P A;  2ZHO A;  3CCL S;  5FDL A;  3CMQ A;  4YUD A;  2ZC3 A;  4PXE A;  3OSN A;  1Q1K A;  1D3W A;  1FEE A;  2HQD A;  4EYI B;  1T11 A;  3QIP A;  2ZVI A;  2OPQ B;  2XLK A;  3WZ0 A;  1TKD A;  4DL7 A;  4KGZ B;  4B3R J;  1CUL A;  3DDN A;  1KR4 A;  4FN5 A;  1XNQ F;  2HPU A;  4GKJ F;  2IYG A;  2ZH1 A;  2R7T A;  1R0C B;  3FFI B;  4G65 A;  2JL9 A;  1I3O B;  4YB1 P;  3QLH B;  3JQM A;  3R8Y A;  2XY7 A;  1UJ4 A;  3DLG B;  4EWT A;  4AXI A;  5AT1 B;  1I94 J;  3HVA A;  2RHS B;  5BR8 J;  3B6B A;  1VQ5 S;  2G1D A;  4QCL A;  2CWX A;  1HBM B;  2MLZ A;  3ENV A;  3A8E A;  2ZM6 J;  4CYU B;  2V50 A;  3GV8 B;  2RDJ A;  4X65 J;  5ETQ A;  3QMQ A;  1AYE A;  2XG8 A;  2HVI A;  2CDQ A;  4UOG A;  4N7T A;  3NS5 A;  2UXD J;  5KFH A;  4UTG A;  3CO9 A;  4CDI A;  3TAM B;  4ER8 A;  1RTI B;  1RT5 A;  3ENQ A;  4J9S A;  2PA8 D;  1IJF B;  2WW4 A;  1UWA A;  2IPO B;  1VJW A;  4CO0 A;  3W66 A;  3CJK A;  2FLN A;  4PG6 A;  3TWZ A;  2ZJR Q;  3BH6 B;  2AHO B;  1MRO A;  2LQJ A;  2XSJ B;  2W7P A;  4B9N A;  1XMQ F;  2Q43 A;  1S48 A;  2C2K B;  2OMO A;  4DPY A;  1U0S A;  1TKX B;  1RTD B;  9RUB A;  4NLO A;  4F2R A;  2NUU G;  1KN6 A;  3BBB A;  2W7A A;  1YDL A;  2FLO A;  2GQC A;  1HQE B;  4PWW A;  2HKE A;  4DR4 J;  2AT1 B;  1OPZ A;  5A8W A;  2JLE A;  4DUT A;  4X4O A;  3KOA A;  4YFU A;  2P9E A;  4WFZ A;  2BZ2 A;  2C22 A;  4OZJ A;  5D0G A;  2ZOG A;  2AJ1 A;  1Q4R A;  1EX8 A;  2QSW A;  1KQF B;  1VDH A;  3PR4 A;  1NHV A;  1ZM4 A;  3J7A 1;  2GVZ B;  1VBZ A;  3KK3 A;  4ECR A;  1VRU B;  3DRR B;  2DJW A;  1LW0 A;  3CIM A;  4ETX A;  4MYU A;  5A6P A;  3MWB A;  2EKN A;  3GSD A;  5KG5 A;  1X4C A;  4CQ1 A;  1VK8 A;  4H4K A;  2CWK A;  2FC9 A;  3J7Y U;  4EEY A;  4O3O A;  4DV5 F;  3MAA A;  5J1E B;  1FJ7 A;  4Y2C A;  2YH0 A;  1IM6 A;  1CJK A;  4NLG A;  1P1L A;  5EDW A;  3HHL B;  1B0V A;  2C2O B;  4G1Q A;  3MMB A;  3C14 B;  5E0O A;  1YX2 A;  3MF5 A;  1VIX A;  4ZIV A;  2ROP A;  2CJB A;  2FD2 A;  3HSD A;  3HHE A;  3DGP A;  3BSO A;  5GAG U;  4MK9 A;  2HFU A;  5D3G A;  1WHV A;  4NL5 A;  2HLT A;  2LFV A;  1JLF A;  3RRG A;  4RNH A;  3QRQ A;  2CPD A;  2ZZM A;  1CJV B;  3L7P A;  4J9Q A;  2LMI A;  1GFW B;  1RCO B;  3ISN C;  2K1R B;  4AMN A;  3LAM A;  1RAF B;  4PUO A;  3ZNJ 1;  1KOO A;  2LXI A;  1IBM J;  4O3R A;  4IFV A;  4USH A;  3DI6 B;  2HVH A;  1U48 A;  2ZE2 B;  5D4O A;  4I7F B;  4TYB A;  1HBO A;  1S9E B;  3BO3 A;  4C8Y A;  2G4B A;  3MMA B;  1HWJ A;  4ED7 A;  3WDO A;  4I6A A;  2VOO A;  4NI2 A;  1HI0 P;  1X5P A;  4HH0 A;  4WYW A;  2JFK A;  4DX7 A;  4R0E A;  4GC7 A;  4OQJ A;  2GO9 A;  1R3N A;  3IM8 A;  1M5V C;  1HKA A;  2A10 A;  1RE1 B;  4K4W A;  2UP1 A;  4LF1 A;  1KVI A;  4ICL A;  3TVY A;  2H54 B;  3PEH A;  3I0R B;  2FVC A;  5E3P A;  2AYG A;  4IQM A;  1U02 A;  3TVK A;  1C1B A;  3M8Z A;  1U8S A;  4NX9 A;  4ZJQ A;  3K89 A;  4R5P B;  2B4U A;  4IG3 B;  3FNN A;  1NM2 A;  1FXL A;  4B3O B;  3QQC D;  1SJQ A;  3UVJ B;  2HGM A;  2QMU B;  4O4G A;  2I5J B;  3T1H F;  5FDL B;  2W1B A;  4IFY A;  3SQG A;  5C5J A;  4DUY J;  2KH9 A;  3QIP B;  5CYQ A;  2OKQ A;  1R8H A;  1CUL B;  4OHZ A;  3PO4 A;  4K4S A;  4K0K J;  1IKV B;  2ZH2 A;  1EET A;  2ZNY A;  1QAI A;  5GAD U;  2J0Q D;  4RPF A;  1JJ4 A;  1RYS A;  1BUX A;  3X1L B;  4PAB A;  3MHY A;  4ZVG A;  1ZH5 A;  3G87 A;  3GU0 A;  2VJV A;  4J9L A;  3RRK A;  1SL0 A;  5HMZ A;  4AUK A;  4CO3 A;  3DXS X;  5C7P A;  3FRZ A;  2FHO B;  1TUV A;  4ZP8 A;  4NPO A;  1SKS A;  5HMX A;  1ZAW A;  4C8N A;  4RW4 A;  4CNY A;  4RNF A;  1NK9 A;  1C1C A;  3QWP A;  2CQ4 A;  3EZU A;  1DQA A;  3MCS A;  2HBR B;  4OYP A;  3UNY A;  1XBW A;  3VGT A;  1GK8 A;  1RT5 B;  4DV2 J;  2V67 A;  3CJK B;  5KFS A;  4A8K A;  1GX6 A;  3U1L A;  1MRO B;  3D6T B;  3PIP Q;  4MKB A;  3VCD A;  5KT6 A;  1FE4 A;  4RX6 A;  1K73 T;  3MI7 X;  2ZH5 A;  3SSR A;  5IS2 A;  3FBF A;  2VQE F;  3IR5 B;  3CUL A;  1TL4 A;  4OYA A;  2LQ5 A;  3P96 A;  1RWX B;  3KXD A;  3SI8 A;  1SKW A;  3U1M A;  4J9O A;  2GIR A;  3EXC X;  5A8W B;  3MUM P;  2W4D A;  4ETZ A;  2DXD A;  3AT1 B;  4LF9 J;  5GVQ A;  2DNN A;  1S0N A;  2OUG A;  3HKW A;  1S76 D;  5KFD A;  1FRH A;  1UZH A;  2HGN A;  1WF0 A;  3NWG A;  4YY3 F;  4YR0 A;  5H9F J;  3KK3 B;  2QRR A;  1Q82 T;  2YWF A;  1NBE B;  3MMJ A;  3EPI A;  1GH8 A;  3US5 A;  1LW0 B;  4U7U K;  4MKA A;  2D3O 1;  1BC6 A;  3OL9 A;  2EKY A;  3N6N A;  4U8V A;  3E8O A;  3MAA B;  1VJQ A;  3MXH P;  1RAA B;  3B4M A;  4KGV B;  1YIJ S;  3PHE A;  4TU7 A;  1CJK B;  3M4X A;  1Q53 A;  1H7W A;  4P52 A;  4DN0 A;  3BO2 A;  3GWC A;  3KUG A;  2HWT A;  3WC2 A;  4DN9 A;  3MOZ A;  3C15 A;  2HVZ A;  4G1Q B;  3MMB B;  4ED6 A;  1M1K T;  1P9Y A;  4DL5 A;  1BWE A;  2CJ9 A;  2B9Y A;  1TV6 A;  3I87 A;  3THV A;  3DGP B;  4W4M A;  1H0H B;  3GIJ A;  3TAN A;  4OJG A;  5D3G B;  3BGU A;  2H9Z A;  5J1P A;  2KT2 A;  3CJT A;  3BS9 A;  2HZV A;  1JLF B;  3R9L A;  3HKZ D;  2MQQ A;  3NNA A;  1OIA A;  4RNN A;  2D74 B;  2DXF A;  1KFD A;  8RUC A;  2G2O A;  2YTC A;  4PUO B;  1U47 A;  2UXC F;  4B9L A;  1N88 A;  3UFC X;  1REV A;  2HFS A;  2MY8 A;  2CNN B;  3J80 U;  4EBD A;  4IFV B;  5AJ3 F;  3RB6 A;  4DS5 A;  2DIS A;  4PXC A;  2MHN A;  4DU7 A;  2F9D A;  3PVX A;  3NBP A;  1HBO B;  1CC7 A;  4QIW D;  2LEA A;  2C3P A;  4ZPD A;  2VC1 A;  2MZ1 A;  3FRY A;  4NI2 B;  4ZN3 A;  2VON A;  3BSA A;  3ZZO A;  3UCU P;  4C4W A;  1NJZ A;  1BD6 A;  4RKU C;  4P10 A;  3DU5 A;  3AAW B;  3IBW A;  1KHV A;  4NXN F;  4NWB A;  2DH8 A;  2OPP A;  1CPZ A;  1N36 F;  2GGP A;  2E1R A;  2XS7 A;  3C6T A;  3W7B A;  1KBR A;  4DQS A;  3M8R A;  3FQL A;  4ICL B;  1RAO A;  1WHX A;  1G1X A;  2CJQ A;  3HLU A;  3CJ3 A;  2DVI A;  1ZPW X;  1JKH A;  3RRH A;  1C1B B;  1NME B;  2CZ9 A;  4RBT A;  5FD1 A;  3GE9 A;  3RTV A;  1U1Q A;  2QC3 A;  3G8T A;  4M5L A;  1SH2 A;  5T14 A;  1JB0 C;  2H5I B;  2FJE B;  2DNG A;  3AJD A;  2RU9 A;  1DAX A;  4O4G B;  2DK2 A;  1QE1 A;  5K8P A;  5KFI A;  1CJT A;  4IFY B;  3SQG B;  4LR7 A;  4NLU A;  2L48 A;  3AXM A;  5D4P A;  3ENA A;  2NXU A;  5CYQ B;  2ASY A;  5JMN A;  3SV3 A;  1WKK A;  3MPU B;  5HVG A;  2ZWO A;  3SCL E;  3BPS P;  2G0I A;  1EET B;  1UPP A;  3MR7 A;  4ID8 A;  2AYB A;  4K50 A;  1XNR F;  2FB0 A;  2K06 A;  2F7V A;  4OZ1 A;  2WZ1 A;  4LF7 F;  2W8L A;  1S57 A;  3C66 A;  4WP9 A;  3K59 A;  4X62 J;  3V4M A;  4IRD A;  3Q8P B;  2KG0 A;  2VFT A;  2IMO A;  1M5S A;  2I38 A;  3HXM A;  1NPR A;  4Q2M A;  1QVG R;  1WSR A;  2XCA A;  4RW4 B;  1AUS L;  3W2V A;  3HT3 A;  3HT0 A;  4AXJ A;  4FZV A;  4ZPA A;  3EZO A;  4X66 F;  3EDR B;  5EGY A;  4OZ3 A;  3CSK A;  4ZVH A;  1KTQ A;  3K8W A;  3HP6 A;  3HM9 A;  1XIQ A;  1GNK A;  2AYE A;  2HHS A;  3HSG A;  2CAD A;  3KDO A;  1U45 A;  3IWN C;  4OHY A;  3NAH A;  3IBC B;  1FWL A;  4ZCM A;  1HNW J;  2FLL A;  4PZV A;  4OZL A;  4ZCL A;  1YJN S;  5ETP A;  2FVQ A;  5B09 A;  3HFK A;  3PX4 A;  4DV6 J;  2RH3 A;  3VAL A;  3RBD A;  3P4U B;  3D2W A;  3BM7 A;  3FBB A;  5E7O B;  2MKK A;  4ZIT A;  3ETO A;  2IVY A;  2OEL A;  3JXO A;  4E2F B;  3N79 A;  2FLP A;  4AYB D;  3OVA A;  1HD1 A;  3ITH A;  4QU6 A;  1FKA F;  1RAB B;  2CQ3 A;  2VDH A;  4U8Y A;  1SQE A;  3FEX B;  3C3L A;  3NWR A;  3LUY A;  1S79 A;  2VA2 A;  4M5J A;  1KRP A;  3CCT A;  2KFY A;  1O8B A;  3R27 A;  3P49 B;  3S01 A;  2RRN A;  3GPA A;  3EVO A;  1EIY B;  1WF1 A;  4PQA A;  4ZVO B;  2E5H A;  3BQ1 A;  2U1A A;  3VAJ A;  2RRA A;  4USM A;  5IC6 B;  4LFB F;  2MQN A;  2V6A A;  3EXY A;  3PW7 A;  3T19 A;  4XO0 A;  3BGF A;  5KFO A;  5HJY A;  2AZ1 A;  3H90 A;  4M95 A;  4O4R A;  1A9N B;  2O3D A;  4URS A;  3HZE A;  2CNO B;  3UN2 A;  2PC6 A;  5B0C A;  1NK0 A;  3C15 B;  2MXY A;  3N4W A;  1SC1 B;  1HR0 J;  3A3N B;  1TV6 B;  3TUZ C;  1QY7 A;  4F02 A;  3JAM U;  2GVD A;  1VQ7 S;  3OVB A;  1RAC B;  1XR7 A;  3F0N A;  1ZM3 A;  2V63 A;  5AE2 A;  2UUB J;  3BGO P;  2MEW A;  3CNQ P;  2PGC A;  5KFN A;  1HW9 A;  1F9E B;  2DKO B;  5B7W A;  3RW6 A;  4NA3 A;  1L5U A;  2I8E A;  1VQP S;  1CLF A;  4C9D A;  1SJF A;  1F6T A;  5KT2 A;  1WOR A;  1Q86 T;  4HDH A;  4HT5 A;  2RNE A;  3VTI A;  2QG9 B;  4JP8 A;  2KFN A;  4O3P A;  1Q8I A;  3PJ9 A;  4GC6 A;  2BVZ A;  2CQP A;  1REV B;  4LMZ A;  4WF9 Q;  2MLY A;  2VFR A;  4H4M A;  2DB1 A;  4F0K A;  1K1S A;  4Z7C A;  3DOM A;  5F41 A;  3PDN A;  3CME S;  3FCW A;  3UWT A;  1WC4 A;  1Q16 B;  5JUM A;  4DV7 J;  4DQP A;  1RAI B;  3QT5 A;  2K3I A;  3NBP B;  1WD6 A;  4LVN P;  3R5C A;  2ZD1 A;  3OV7 A;  3Q22 A;  1LKZ A;  3W9H A;  1XMO J;  4DX8 H;  1BGX T;  3BGL A;  2RE1 A;  4O0I A;  2XWY A;  1LEO A;  1S49 A;  1X4A A;  3LA0 A;  4L72 B;  2MLX A;  3WBZ A;  1VK3 A;  3I31 A;  4B3M F;  4N41 A;  1IR1 A;  2VPY B;  4P7V A;  3KK1 A;  2AJ2 A;  3A8J A;  3DHW C;  2OPP B;  2VBW A;  2GGP B;  2MKS A;  4ECQ A;  4IYQ A;  3C6T B;  1FD2 A;  2R7X A;  2KVQ E;  2WAQ D;  4C8O A;  1RTH A;  4DSL A;  4DCP B;  4ZVE A;  5DQI A;  4ZVT B;  4B9T A;  1JKH B;  3DOL A;  2H1Y A;  1FWK A;  1OQ3 A;  2XC9 A;  1EB0 A;  4J9K A;  2PFD A;  1KNZ A;  1VLO A;  1AUD A;  3DLB A;  1O51 A;  2JVR A;  4LF6 F;  2A3J A;  3PEJ A;  3GG1 A;  3LGN A;  4NE9 C;  2DNK A;  3MTK A;  3QJP A;  1CJT B;  4RWX A;  3TAR A;  2BAC A;  1TL3 A;  4DUZ J;  5DGB A;  2IYI A;  3FEZ A;  3PG9 A;  2H65 B;  1VQN S;  1C4C A;  3N01 A;  5KT5 A;  4F36 A;  1FFG B;  1G2E A;  5L1L A;  4RW8 B;  2C2R A;  2NUH A;  2KYZ A;  1KFS A;  2UVU A;  2MQM A;  2IRU A;  1RHM B;  1TL7 A;  2X7I A;  4KV8 A;  2FJX A;  3Q8U A;  4NZ7 A;  2OTJ S;  2XYP B;  2YVS A;  5GME A;  3I4P A;  3PV8 A;  5JXS A;  4B9V A;  4HTJ A;  2KZZ A;  2NZC A;  2BYC A;  3W2V B;  1OSD A;  5HMW A;  5DQG A;  2WVD A;  2HYI B;  4L6V 3;  4DZ6 A;  1GXL A;  4LIW A;  2W4C A;  3SEO A;  3O5T B;  3VGU A;  5KFP A;  3NG8 A;  4UOC A;  1T02 A;  4CLW A;  3D1O A;  1Z1Z A;  2N7Y A;  1WOP A;  4IH5 A;  2B8P A;  5DG9 A;  4F4X A;  2VPW B;  2GIF A;  4WBF A;  4LRA A;  1RT6 A;  1L3S A;  2MZQ A;  1A6L A;  4RWW A;  4NLP A;  3K2Y A;  1VIS A;  4L3N A;  3JS9 A;  5KFZ A;  3CCW A;  3G6E S;  3TUJ C;  2C3M A;  4CP5 A;  3SFU A;  4WFN Q;  4K4V A;  4M5G A;  3HVT A;  3CWJ A;  1Y10 A;  3WIU A;  4ECU A;  1HYS A;  4N8O A;  1UEU A;  1EQM A;  2FZK B;  4CM2 A;  3J80 Y;  3M8W A;  4IKA A;  1OPI A;  1LXN A;  3M30 A;  5DET A;  3ITH B;  3FCV A;  4TKT A;  2NQP A;  3PR5 B;  4B3T F;  2IA0 A;  3H20 A;  3KMS A;  2M0G B;  1K0T A;  2Z57 B;  3I56 S;  4E0D A;  3MZI A;  1Q78 A;  2GIQ A;  1VRQ C;  3E51 A;  4EGL A;  3OR2 A;  3OXL A;  3DOK A;  2UXB J;  1NSP A;  2OFG X;  4U7C A;  1MWY A;  4KHR A;  4AL7 A;  3KLI A;  1Q79 A;  4FXW A;  2VUG A;  4PAA A;  8AT1 B;  4TVA B;  3VHQ A;  4ID5 A;  2LKZ A;  1NZA A;  1YK9 A;  1PC4 A;  1K44 A;  1UA0 A;  3LF0 A;  3JYT A;  3AOA A;  5HSP A;  3ENW A;  4L74 A;  5B0D A;  4NLW A;  2KHD A;  3PCO B;  4CT9 A;  1TP7 A;  2CQC A;  4DV1 J;  5I3U A;  4JI8 F;  1SKU B;  2QGF B;  2GVD B;  3CDA A;  1S9F A;  1OY8 A;  6FD1 A;  1PAU B;  2DO4 A;  3SCK E;  3WX4 A;  2KTQ A;  3OVS A;  2RIL A;  4DV3 F;  2I1R A;  3VAM A;  2L9D A;  4QIG A;  4NLT A;  2V4R A;  5LXR A;  3GIR A;  1QAJ A;  4DS4 A;  4EI2 A;  5HQM A;  3RYL A;  4WP3 A;  2QLW A;  4RZR A;  2ZOM A;  3MM5 A;  1TEL A;  1WI8 A;  4H4M B;  4FS1 A;  4LF2 A;  4R0J A;  1H2U X;  3DYA A;  5GAE I;  3DOM B;  4MJK A;  1MN9 A;  3M6W A;  4WU2 A;  1YZ6 A;  3D54 A;  5K8M A;  4JI6 F;  3H8Y A;  1QTN B;  1TK5 A;  2QFJ A;  3PX0 A;  1SL2 A;  1UEV A;  3IMQ J;  2R7V A;  2ZFH A;  1T9Y A;  3SDE A;  2ZD1 B;  1VQL S;  4QU7 A;  2XI2 A;  3QZ7 A;  2HQF A;  1AFI A;  4HAC A;  5M2P A;  4OJ3 A;  1F0X A;  3J7A N;  2XNR A;  2ZH9 A;  4BBY A;  4DQQ A;  1TK0 A;  1JLG A;  3D6H B;  1LOU A;  2B56 A;  2W01 A;  5CZC A;  2NXJ A;  2LDI A;  3MCM A;  2VPX B;  2XO7 A;  4KB7 A;  1H74 A;  1JNZ B;  4UST A;  3K5P A;  4FF3 A;  1EQ0 A;  2R7U A;  4OIX A;  3OFE A;  3GII A;  4RW9 A;  3G82 A;  2ZBC A;  1RTH B;  1OYD A;  1S6U A;  1FTC A;  1T94 A;  2Z2L A;  4ZVR B;  2ZKU A;  2JLG A;  2CYY A;  3CJS A;  4IQX A;  3TX0 A;  4OHW A;  2B5J A;  3DOL B;  2K7K A;  4ITS A;  2MJU A;  4F4A A;  2HAF A;  2ZBP A;  2D9O A;  3PHT A;  2E1A A;  2W7O A;  2Y1L B;  3HSZ A;  2Y8W A;  2AEF A;  2C3U A;  4LBH A;  4HH1 A;  4ZA1 A;  4KE5 A;  1DAR A;  4JOU A;  1WC5 A;  2PO4 A;  1EKR A;  2R7W A;  2O66 A;  1HHT P;  1FO1 A;  3HMJ G;  3LWM A;  3LWL A;  4IR1 A;  5ETS A;  1TL3 B;  2E7V A;  2YNI A;  4M5H A;  4UOF A;  3BSC A;  2ASJ A;  2AJQ A;  3E3X A;  2DCL A;  3NGT A;  2YX1 A;  1NUE A;  4CNZ A;  2FJB B;  1UVL A;  2C42 A;  2DGX A;  2AV5 A;  2X1A A;  1YJV A;  3LOU A;  3CDB A;  3VV2 B;  1NK8 A;  4NA2 A;  1HL6 A;  3MPY A;  5HAO A;  1PJ7 A;  2HHP A;  1DRZ A;  2ZZT A;  3UD3 P;  4PEO A;  1TL7 B;  3BKT A;  2R8I A;  2ZDO A;  1SXL A;  4KV8 B;  2CQ2 A;  2UXD F;  2Q3P A;  1T8E A;  2NRE A;  1K8A T;  4Y0F A;  4PYA A;  2WB1 D;  3M8S A;  3EWG A;  3CCZ A;  3IXQ A;  3LQV A;  3I6P A;  2ZKT A;  3MD3 A;  1YRT A;  4M5K A;  1NJW A;  2KN4 A;  1HNZ J;  3TYT A;  4QPX A;  3FJ2 A;  2WSC C;  3JAM Y;  4C3L A;  1DFD A;  2BXJ A;  4FXD A;  1TKZ A;  4ZPB A;  2A2D A;  4LFC J;  4QBU A;  1ULR A;  4DR4 F;  1NKB A;  3NL0 A;  1RT6 B;  4C8K A;  2DHA A;  5GAE U;  1M1G A;  1VIO A;  4HYK A;  3PTW A;  2E1C A;  1C4A A;  3ZXW A;  2C2D A;  3HVT B;  3O8W A;  4RW6 A;  4JYA F;  2VH7 A;  4X64 J;  1HYS B;  1IBK J;  2OML A;  1SPB P;  1SJR A;  2NPF A;  4ES3 A;  3QFW A;  2PMW A;  3D1Q A;  3DLK A;  3Q83 A;  1SUQ A;  3M30 B;  5EWF A;  3GCW P;  5DRK A;  1S0O A;  4X4U A;  1F9H A;  2HBZ B;  3ZTQ A;  2ADC A;  3CCE S;  4DWI A;  3H5U A;  2XY5 A;  1RSC A;  1UW9 A;  3UCZ P;  2F65 A;  1EP4 A;  2HVE A;  3GIK A;  2ZJP Q;  3ILO A;  3QGI A;  2F8H A;  4ZJL A;  2HIY A;  3OR2 B;  2EK1 A;  4BLG A;  4K4Y A;  2J9D A;  4FF1 A;  5DDO C;  2J0W A;  3J81 U;  3KYL A;  2XEX A;  3DOK B;  3N6L A;  1N32 F;  2LYV A;  3N5B A;  2X1B A;  2L41 A;  1G4C A;  2VOP A;  4EO6 A;  4DPX A;  3KLI B;  2DH7 A;  2JRS A;  4RUB A;  1HHQ A;  2HSE B;  3I4H X;  3UW1 A;  2YKM A;  1FNX H;  3JSY A;  3OLB A;  1WUU A;  3BF4 A;  3BPD A;  3DM2 A;  3MD1 A;  4DEZ A;  4OX7 A;  4ID5 B;  2V2Z A;  3ISN D;  1G3O A;  3IWX A;  2LQ8 A;  3MCO A;  1T0T V;  4NCB A;  3JYT B;  2F8E X;  4LBP A;  4P2X A;  2HAI A;  5I3U B;  2R7R A;  3MMC A;  2YKN A;  2C3Y A;  2AJF E;  1V3R A;  4OYW A;  2Z58 B;  2VFV A;  1SH3 A;  3I9V 9;  1C2P A;  1R8B A;  4LF5 F;  1X7V A;  4H54 A;  4KY3 A;  1I51 B;  3CJ2 A;  1J5E J;  5I4M A;  1X9M A;  3HFZ B;  4F67 A;  4DSI A;  1B0P A;  5KG1 A;  3AOC A;  1H6K X;  4F50 A;  1MSW D;  4JUZ A;  1UL3 A;  1U2F A;  3MM5 B;  2DR8 A;  1FVQ A;  1Q8L A;  4ZLN A;  3HUL A;  1SQF A;  1HAR A;  3DYA B;  3TJ9 A;  3T6B A;  1HNX J;  3EVM A;  1YJU A;  1UKU A;  1JNR B;  4J9R A;  4K2X A;  2FY8 A;  5BXI A;  3SDE B;  4DR2 F;  2I6W A;  2PMZ D;  1NXI A;  1ZM2 A;  3HHL C;  3W62 A;  5DM7 Q;  4LF4 F;  3ZO7 A;  2UVV A;  4N47 A;  4N5S A;  2VD3 A;  3DLE A;  2QYG A;  4HAC B;  1VMB A;  4IOC Q;  3SMZ A;  2XYG B;  2D7S A;  3CB4 A;  4RL1 A;  1IKW B;  3FEY B;  4IOA Q;  4LUB A;  3NMR A;  1JLG B;  4K8R A;  1H73 A;  3R5A A;  1BLU A;  3GJR B;  2OHD A;  3QPI A;  2QLF B;  4RW9 B;  3G82 B;  3VZH A;  1OYE A;  3OHA A;  1PC5 A;  3EYZ A;  2H3E B;  3K5L A;  3TW0 A;  4C0H A;  3KMQ A;  4AMO A;  1DLO A;  2DGV A;  2B5J B;  5BYQ A;  2XS2 A;  4DUY F;  2BJ3 A;  2HQI A;  2DIU A;  3VVT A;  3ZZT A;  3IAS 9;  2CJX B;  4JI0 J;  3M9M B;  4GKK J;  1WG5 A;  4QW8 A;  2ZJQ Q;  4YHH F;  2M8D B;  1X4D A;  5LSL A;  2VBZ A;  5A8R A;  4KKO A;  3C16 A;  1HBN A;  3W9I A;  3FSX A;  2YNI B;  5K9F A;  4X84 A;  2RB7 A;  2LEC A;  2IA6 A;  1Z2L A;  2MQP A;  4CZC A;  4GKJ J;  4UY8 5;  2HW3 A;  2UVW A;  4O44 A;  4YR2 A;  1RTJ A;  2YNF A;  3QAT A;  4ELU A;  4L3K A;  2HRU A;  2W2M P;  3KJQ B;  3NCP A;  4ZCI A;  1JJ2 R;  2J8A A;  2K8G A;  2DNY A;  1S9G A;  2DNO A;  4F8R A;  5FLX Y;  2DNM A;  2YWW A;  2HK2 A;  1Y0H A;  4DV2 F;  5IV4 A;  2G9O A;  2NXE A;  4JI1 F; 
#chains in the Genus database with same CATH homology
 2QC3 A;  4RR5 A;  3CJ8 A;  5DZ6 A;  3R97 A;  3SBM A;  3R8Y A;  3EZO A;  5CZC A;  3TQE A;  4RL1 A;  3HMJ G;  3PTW A;  2JFK A;  3K89 A;  3HJV A;  3BV8 A;  2VZ8 A;  3TZY A;  2C2N A;  1NM2 A;  2QO3 A;  3QAT A;  2VKZ G;  2CUY A;  2G2Y A;  2G1H A;  3TZX A;  2VZ9 A;  3IM9 A;  2H1Y A;  3HHD A;  1MLA A;  2HG4 A;  3IM8 A;  3TZZ A;  3RGI A;  5DZ7 A;  2G2O A;  3TZW A;  4QBU A;  2JFD A;  2G2Z A;  2PFF B;  3G87 A;  2UV8 G;  3H0P A;  5CZD A;  2QJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...