3AA8A

Crystal structure analysis of the mutant cuta1 (s11v/e61v) from e. coli
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
103
structure length
103
Chain Sequence
TAVVVVLCTAPDEATAQDLAAKVLAEKLAACATLIPGATSLYYWEGKLEQEYVVQMILKTTVSHQQALLECLKSHHPYQTPELLVLPVTHGDTDYLSWLNASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Remarkable improvement in the heat stability of CutA1 from Escherichia coli by rational protein design
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
molecule keywords Divalent-cation tolerance protein cutA
total genus 21
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3aa8A00
4CNZA 2VD3A 4WK1A 1VFJA 1UFLA 3LF0A 2NUUG 4RLEA 1H3DA 4NYPA 4YB7A 1OSCA 4AFFA 4CNYA 2ZFHA 2E66A 3O8WA 3AA9A 4IYQA 3T9ZA 4USHA 5D4PA 2Z0GA 3N5BA 2XZWA 4E98A 1V3SA 1KR4A 3TA1A 1O51A 4USIA 3OPKA 2GNKA 4YB6A 4C3LA 4C3MA 2ZOMA 3NCPA 1V3RA 1PILA 1Q1KA 2J9CA 2RD5C 3AHPA 2JJ4D 4OZJA 2GW8A 5DRKA 4OZLA 3NCQA 3TA0A 1QY7A 1P1LA 4CO2A 1NH8A 4CO0A 3HLUA 2J9EA 2XBPA 2GX8A 4RWXA 5DS7A 4CO1A 1UKUA 2J9DE 2J9DA 1UL3A 1V6HA 2O66A 3GSDA 2PIIA 5D4OA 2NS1B 2EG2A 3L7PA 4ZK7M 5L9NA 3AA8A 2CZ4A 3CE8A 4YB5A 5D4LA 4D3GA 3X3UA 1NAQA 3DFEA 4C3KA 1V9OA 5D4NA 2EG1A 2O67A 2NUHA 1O5JA 3BZQA 1NH7A 1J2VA 1UMJA 4CO3A 3TA2A 4CO4A 4WK3A 2XG8A 3M05A 2DCLA 2V5HG 3NCRA 4Y65A 3O5TB 1NZAA 3AH6A 4Y6IA 4R25A 4CO5A 4USJC 1XK8A 4OZNA 4RX6A 1GNKA 2XULA 4NYOA 1VHFA 4D3HA 3MHYA 1HWUA 4RWWA
chains in the Genus database with same CATH superfamily
1SPBP 2HSEB 4A8OA 2J5AA 3O3LA 2ZJQQ 9ATCB 1N36F 2A2CA 3MAAB 4E2FB 1RJJA 5GAGI 1N52B 1ZS6A 2EKYA 2VD3A 3VVTA 5GADI 1VC5A 1VQ4S 3DMJA 1VQ9S 4TYBA 5ETTA 3MEGB 2K1RB 1HQUB 5KFFA 2V4QA 2PO4A 5B0GA 4NYPA 5AJ3J 2YWEA 3H4DA 4JV2A 2J0QD 1VS3A 3R7NB 3U27A 1JB0C 3E01B 2AGPA 3TWZA 4OZ5A 3O8WA 2WW8A 4WF9Q 5FLXU 4QIVA 3PIOQ 3NNCA 1QAYA 4J9KA 1M5HA 3CCWA 4C11A 3PW0A 2CA9A 3PYDA 1S9GA 3UI3A 4EO6A 1Y9OA 4RNFA 4URGA 3J7Z5 4DLEA 2X1FA 3QJJA 2CRLA 3CJQA 5G4DA 2W9AA 7AT1B 4ERDA 3R5JB 2BDPA 2ZE2B 1NK9A 2LDYA 4HTIA 3LUYA 4N8OA 4X65J 2HBZB 1FKOA 3KFWX 3TAPA 1WWHA 2BE7D 2Z58B 5LM7E 3C14B 3GB0A 3C16A 3SXLA 1V5VA 2CPXA 4C8LA 3ZZRA 2BW7A 5D0RA 3GU0A 3HD1A 2OH2A 3VAGA 4JI0F 3BN4A 4K4SA 3FMWA 3VCDA 4MH8A 1ZOTA 5HK4A 5K8PA 1S99A 2E9TA 4OYOA 4CH7A 2JJ4D 4MIAA 1NMEB 5KFSA 2RHSB 3J7YU 4G3IA 3RJMB 3S01A 1I6JA 4ECWA 3IWXA 2JDJA 4DV1F 3GE9A 1X9WA 1WEXA 4I7FA 3L9ZA 4JI3J 1NH8A 3KHHA 2DXFA 1NKEA 5C25A 4LSNB 5CCLA 3I6PA 4P71A 2W2MP 2HHHF 1N33F 1SXLA 2AWZA 3TEGA 3N01A 4ZLJA 2XBPA 3SDEB 2J8AA 1HBNB 4X4OA 4PAAA 3I56S 3MR5A 4IR9A 2POKA 2DIUA 3Q86A 2MJUA 3W2VA 5IWAF 4W90B 3MURP 3G82A 3GV5B 2HAFA 2ZBCA 2OLWA 4RBUA 5A8WA 1FEEA 4F02A 2YWFA 3SSSA 5KFYA 3R7SB 3M9NB 4I7FB 2C3MA 3PW4A 1T11A 4DR7F 5AE2A 5DG9A 2MZ1A 3CE8A 3MM5A 4LT6A 4YB5A 3ZZ0A 2VONA 1SI9A 1N33J 2KFZA 3X3UA 1KNZA 4WWSA 1L5UA 3OL6A 3TUZC 2M0GB 3QT5A 3US5A 4UUWA 1FE4A 3HT0A 2R2TA 4CYUA 2NUHA 2RJZA 1KOHA 3OTBA 5F8IA 4DX7A 4GKKJ 2ZZMA 2LP4A 4WP8A 1QM9A 1B99A 3IR7B 1Q8LA 1SIWB 3SBMA 2OPSA 3HFVA 1O5JA 4WTOB 2I38A 1WKJA 3MCOA 3PFEA 1TKDA 1HNZJ 4YR3A 3D67A 3OLAA 2IHR1 2G0JA 1NH7A 2F4VJ 1Y5IB 1UEVA 4C0BA 2ROGA 3ZZOA 2E5IA 2KRBA 4H4KA 1SL0A 1XQIA 5L9XA 2CAJA 3CCMS 1R6YA 2FGCA 3NGRA 1QE1B 3UDCA 3RB6A 1Q7YT 2VOPA 3QGGA 2HLTA 2V50A 2Z56B 3H7HB 3M05A 4MT1A 3ZZTA 4LSNA 3OBIA 1TK5A 2UUBF 4ECQA 2EC0A 1VRTB 2HS0A 1Y5NB 1RBAA 1H6KX 1RWVB 1WSRA 3C15A 3HZEA 1ACMB 3JTNA 1WC0A 4OHZA 3GJSB 4KR0B 1S97A 4WP3A 2FJXA 1P27B 1XK8A 3GMGA 3PDNA 4RX6A 2VG5B 2ZZTA 3DN9A 5DZ6A 2F7VA 3JSMA 4JI5F 4K8RA 4ZVQB 1ZM2A 1BQMB 1R8HA 1WHWA 2DH7A 4NPOA 5K5MA 1SKSA 1HNXF 2JEFA 1VQOS 4DR5J 2IYIA 2VDHA 4YS2A 3R1LA 2GCFA 4HACB 4OZ2A 1GXLA 3LP0A 2APOA 2CJBA 2WONA 4F0MA 4KPCA 3VQTA 2ZNYA 4QPTA 1NRKA 1H2TZ 4NX9A 4K50A 1YVFA 3MM7A 3IAM9 2H48B 3ZTPA 1UA1A 1Z4UA 5E3AA 3ZO7A 1MN9A 2CWXA 2ZD1A 3A8IA 4MK8A 5J1PA 4XDDA 3BSOA 4B3TF 1WOOA 3PRDA 2OPPA 1JIHA 3G8QA 5J1NA 4AL6A 1C1CA 1ZZNA 2R9LA 2XY7A 2WRMA 5HJXA 5DDOC 2LQBA 4M5LA 1UJ5A 2DNHA 4BLGA 5ITHA 2IVYA 5CH7B 3OSNA 3M8PB 2WCXA 3M7VA 4FBUA 3BGUA 5ADZA 5HI7A 2RKIB 1UJ6A 1K8AT 1RLDA 2M9KA 2E5JA 8AT1B 2BMBA 5D4PA 1P9QC 1RHMB 2Z0GA 1DTQB 3IGNA 3W7BA 4YHHF 4DR2J 1HBUB 4NXNF 2DK2A 4JI7J 2XMVA 2VBXA 4LF5F 1OY8A 4LBHA 2CZ9A 4LF9F 1JK9B 4HLBA 4CT9A 2HQ3A 4RUCA 5IT9U 3L7OA 4M5KA 3D54A 5J2NB 3MPVA 4LF8J 5HBMA 1RBOB 1CJUB 1JKHA 1KONA 2AJQA 3KLGB 4CIOA 2CNKB 2LYVA 2G2ZA 3DYAB 4FDFA 2JH3A 3AD7C 4DV5F 1VQ5S 2FLLA 3POTA 1TP7A 3R97A 4ZITA 3SV4A 2DNMA 2GC8A 2GW8A 2OPQB 4OJ3A 2Y8YA 2A3JA 4B9VA 3CD7A 4DSLA 4Z2XA 5IC6B 5HBMB 1JLFB 1GTEA 4Y2IA 4DDFA 3W1YC 3Q83A 2VG6A 3AXKA 3C6UB 5KT3A 2PFFB 3KLFA 4Y2CA 2CQBA 1TL1A 2D69A 2PGCA 3JS9A 4FYDA 4UQGA 1YBUA 5LJ5Y 2RF2B 3MAQA 4F2RA 3CD6S 1JLCA 2QN6B 2V8HA 1WC4A 1WKKA 3HHLD 4CLUA 2HWTA 4PYDA 3WC0A 1NHVA 4KAIA 1S77D 2DGQA 2OAUA 4QU6A 3JSYA 4C97A 3NS5A 3W8GA 2CJAA 2QSWA 2KB2A 1TL3A 3M8ZA 3GIKA 1LWFA 1NU4A 3QRPA 5HMZA 2UXDJ 1RWOB 3A3PB 4WPAA 4CM0A 2UUWA 5J2PB 1WACA 4U7UK 2RDJA 4O44A 1UETA 2WVDA 2XZDB 1U09A 3DI6B 2AP6A 4RW4A 4JYAJ 3FZ2A 4B9TA 4USKA 2A18A 4WFAQ 4DFJA 3GYXB 3AQPA 4TYAA 4EUVA 4CTAA 2Y0BB 4IQMA 1RT1B 2PD1A 4N7TA 4DF8A 4DR4J 3HHLB 3PHTA 3T5JA 1A7GE 4DPYA 2PSZA 1ZAWA 4W98A 1RT7A 2M70A 5EUHA 5JVGQ 2ACMA 4F4KA 2DGSA 4YY3J 3JSBA 2ADCA 2N4CA 4WYWA 2P2CB 4AXIA 3W5ZA 1IBMF 1GX5A 3RRGA 3DLEA 3FQKA 3ZTQA 1OQ3A 1YK9A 2Y0SD 5RUBA 5GAEI 1N4LA 3PNIA 2PEBA 1ULRA 1S1WB 2CG4A 2ZVSA 3ISND 1AW0A 4RU9A 4JI1F 2BE2A 3NWRA 5HLFA 2C2EA 4KGMA 3CJKA 3MHYA 1RT6B 3OUYA 4P9SA 1HHTP 1JNRB 1GFWB 1PKUA 1QE1A 3QRQA 3FQLA 2PA8D 2XY5A 2DISA 1GMUA 1DLOA 3WDOA 3NOCA 3PXGa 3I5AA 1HYSB 1S9EA 1FA0A 3OTOJ 1JQGA 3EZ5A 5MAOA 3K5OA 2BACA 3B6BA 4DV2F 4WE1A 4DV7F 1HNWF 4GC7A 2P6SA 1JLGB 4EBEA 3RAQA 2HMIA 1H7XA 4HYKA 1WOSA 4JI8F 3PVXA 1S1VB 2CQ1A 5GVQA 2XM3A 3ZTSA 3DGPB 3MOJB 1VLYA 2OPRA 2SXLA 2DNZA 1NKCA 1J5OB 3BGRA 2COLA 4ZIWA 3QFWA 4B3OB 4N76A 4QR2A 5B09A 1VJQA 2CIMA 3OR1B 2UUCF 2W8KA 1T8EA 2R7OA 5KFIA 1F1BB 1LW2A 4QWCA 4IFYA 5I4MA 1T7PA 2DIVA 2MKSA 3DLEB 4OHYA 1M90T 1VIOA 2MSSA 4JOUA 1FJCA 1WG5A 5A6PA 2AYMA 5GAEU 1L3TA 3EVOA 2IM3A 1R31A 2F9JA 2C2OB 2ILZA 2MKJA 2OMLA 2IIHA 1IKYB 4EBCA 3OTOF 1OMSA 1KLMA 1RXOB 1VRQC 1DQ9A 2ZC3A 3CJ2A 3MM9A 2OTLS 1WD6A 1Y3JA 2E44A 3FVYA 3HVAA 4B02A 1T9TA 2JFKA 4MYTA 1S4EA 3MR2A 1YZ6A 1PO6A 2E7WA 1FESA 2HURA 1PILA 2OSQA 4H4KC 2ZWPA 4DCJB 3IO1A 4ZVFA 1FXRA 4B9MA 3UW1A 5L39A 4J91A 1D8YA 2IY5B 1LWEB 3C6TA 2H9ZA 4GMKA 2DD8S 2YNFA 2R4FA 2UVVA 1UZHA 2QMWA 2HBRB 1F9HA 4MKAA 4U95A 5C42A 2I0XA 3V6JA 1GMWD 4XK8C 2V9KA 4WFZA 3T19A 1VQMS 2FC9A 3H2UB 4I68A 3ENVA 2DNYA 1T9YA 3BGRB 3W62A 2GX8A 4QWBA 3G8TA 3BO4A 1AUDA 1IR1A 3Q2SC 2V9WA 1NDLA 1T02A 2XEXA 5L1JA 2CPHA 4MKYA 2N3OA 5LMUJ 4DR4F 1N5YB 2VFRA 2DNRA 2DNGA 3FJ2A 3PFOA 3PJWA 4OQJA 5LXRA 5KFDA 4PQUB 1SCJB 1TKXB 2LQ5A 4NLTA 1LFWA 4C8NA 4DR5F 1X8DA 1M1HA 3AA8A 2VHGA 1U48A 4M94A 4CTAB 1FRLA 3EICA 5A0YA 1WTFA 2GO9A 1JWWA 4ZVSB 1N6QA 1IKYA 3TUPA 1SVDA 2LQ8A 4OV1A 1Z1ZA 4WXOA 5HL7Q 4USUA 3DMJB 4X4PA 4DU7A 4LR7A 2IMOA 2RQKA 3AJDA 4ZN1A 2ATCB 2C2ZB 2LMIA 2D3OR 2W2NP 3B8HA 3PYGA 3KJQB 1C1BA 1SUQA 2B5JA 2OSRA 3OR1A 3KJNB 4NEYA 2D9OA 4RJVA 2LA6A 4JI2F 1U1MA 2WSFC 4ICLA 2L9NA 4RBVA 5FLXY 2IJFA 1T9XA 2EFGA 2W01A 3MR6A 1J5OA 1XWLA 2UXBF 4KC5A 5KG0A 3K17A 2MSTA 4DX6A 1CJKB 1RAFB 1G4CA 2BANB 2QIFA 1CJTA 1R8PA 1SUQB 3LTOA 3TZYA 3D6MB 1F3VA 3G4SS 1SV5B 4CO5A 2K7JA 3QATA 2HFOA 2QO3A 1NSAA 1VQNS 1HBMA 4E8UA 4WKRA 1E6VB 4DS5A 2M5YA 3JQMA 3WX4A 2AEJA 2OPPB 4NE9C 2ZBPA 4QIGA 4X62F 2B7CB 2AJ4A 5IFMA 2GMLA 2C3PA 4Q5VA 4J9RA 1OY9A 1FWPA 2BJ8A 4ZA1A 4C2MA 3KLGA 2C1EB 1XMQF 4BWJA 4G1IA 2MHEA 3LPYA 1H0HB 2FHOB 3AAWB 3DHWC 3EJMA 3HPOA 1OQ6A 1YRUA 1GMVA 3IA0A 2H5IB 3LP2B 2WB4A 3C46A 3HP6A 4DR2F 3PR5B 4DUYJ 1EIYB 3HO1A 3DLHA 2H1YA 1YZ7A 4ZVUB 3R7BB 1GEHA 2Q43A 4CNYA 1NSQA 2YXLA 3M9OB 4FVCA 3M1VB 1Q8BA 3S6EA 5FD1A 3CD0A 3RW7A 1RDRA 1C1BB 3KTQA 2JRSA 4OX7A 4X64J 3JAMY 1U24A 4FF3A 4MIWA 3NAIA 2AJ2A 1PIEA 5HN0A 3A3NB 3DGPA 5KFQA 4DUZF 4EFAC 4FXVA 2ERRA 1KFDA 1B0TA 4FYXB 4YY3F 2YWGA 5KFJA 2I5JA 4K4UA 2P6TA 3BGFA 2DT9A 3VQSA 4M5JA 2M3DA 2JZ5A 3JQJA 4LRFA 2CNOB 5KFTA 3PKMA 2OFHX 3ZNJ1 4C8MA 3RTVA 3UVJA 5E3PA 2OPSB 2ZDOA 2ZOMA 3KDOA 3NCPA 3IBWA 3M6VA 4L6V3 4PG6A 4ZVEA 3LA0A 5ETKA 5F3ZA 1XJWB 2ZZNA 3P5TL 3E3XA 2RS8A 3BYPA 3TP2A 6FD1A 1BE4A 2H51B 2RD5C 4IOBA 1QAJA 3SYZA 3HFZB 1S6QA 5HMYA 1T05B 5D78A 4QWEA 2VA2A 3BF4A 2CQPA 1HI1A 2CPDA 5F8GA 2NCKL 4PWUA 2FJDB 1X4EA 2WVBA 1SJ1A 2B56A 2XMTA 3D5MA 3QT7A 4ALZA 4WZMA 2KT5A 4ZP6A 1KSPA 1CS4A 2DXEA 2LXIA 4NCAA 4CCHA 3PYFA 3IRWP 1G3OA 4OYAA 2B4PA 1JNZB 1TL7B 3FBEA 1AT1B 5E0OA 2J9DE 1S6PA 3POTB 1KS2A 1UVKA 1MN7A 2F4VF 3QWUA 2IJRA 1ZTWA 1S1XA 3EXCX 2OO4A 4RUBA 4B9NA 1RWXB 1RT1A 1CG2A 4ZK7M 5IV4A 5L9NA 2YWHA 2V34A 3HKZD 3KK3A 3W65A 3NMAA 1K1QA 1DLOB 2B4OA 1ROFA 4KGVB 1PJ6A 2WOMB 4H4MA 5D4NA 3MMCA 4IG0B 5B0EA 3CUNA 5DETA 4P2XA 1TL7A 4OYIA 5D0GA 1Q8KA 4OHXA 2KFNA 2FLOA 3M2RA 3VAJA 2O01C 5LL6d 3CXCR 1EKSA 1RISA 5ETOA 2I9SA 1TL3B 1HLWA 1RT4B 2JHEA 2DNLA 3M30A 2DGVA 2HGMA 2Z2YB 4LRBA 5GAHI 1FE0A 4NA1A 4OL8A 1VRUB 1HR0J 2DEIA 3DOMB 4I56A 5IWAJ 2JWNA 1V5IB 2RILA 4LRAA 4LF9J 3W2WB 4LF5J 1EHWA 1LWEA 3C6TB 3D7SB 2B8QA 2GVZB 3HDSA 2NPFA 5BR8F 4RNOA 2ZH7A 3Q24A 3H90A 4ELUA 3CCQS 1A9NB 1U1QA 4KFBA 2FHJA 1S9GB 1X4AA 1NZAA 1TUGB 3TO8A 1VOMA 2DHAA 1MROA 4ZPTR 4CH1A 2E7XA 1R3NA 2GV1A 3BKFA 2HVEA 3S1TA 4I2PA 2QFJA 3OSPA 1L3SA 1IVZA 2HFNA 3W5XA 5CCMA 4PWWA 2V4RA 1XC9A 4J9PA 1B4SA 3D1QA 5T7LA 4QW8A 3PEJA 2IMWP 3EUNA 2QLWA 3R9LA 1FHTA 2JFDA 1WI6A 2KXFA 1HQUA 1OYDA 1X9SA 3GG0A 4J7CA 4I2QA 4BBYA 1FTRA 5F9NA 1JLQB 1YWXA 3NP5A 4DUYF 2XY6A 3TJAA 4ED0A 4QYZJ 3DRXA 2J0SD 4F7VA 1NPRA 2XNQA 3IS9B 2F63A 4ZCKA 3GILA 1YKWA 1FRHA 4M1KA 4DSKA 5DQIA 3QPIA 2M8DB 4WK1A 1WG1A 2X51A 4RZRA 3LF0A 1DZ5A 1KBRA 3KLVA 4AL5A 2HVHA 2RQCA 1U1OA 3M8QB 1EB0A 4DL0C 1X4HA 1RT2B 5CYJA 4X62J 3MFIA 2ZH2A 3O2IA 1RBLA 1YQHA 2HWIA 2KM8B 4M5MA 1RU1A 4DV3F 1ZTTA 3TAQA 3R3TA 4ITSA 1HBNA 4TQRA 4J9OA 3UDVA 5KFRA 5E5NA 2AQ4A 1QJHA 1YRXA 3GFXA 3GJRB 4IYQA 2VQEJ 2ASLA 2K3KA 3DRYA 4XAKA 3TVZA 3LPEA 2W9BA 1M1KT 3RAMA 3QQCD 1R0BG 5AJ3F 2UUBJ 3I0RB 5D3GA 2FB0A 1XBWA 1CQNA 5ETLA 4A8MP 3Q22A 2CJKA 3SEOA 1G1XA 2KTQA 3W64A 3AJ1A 2F5GA 4M5IA 3LP1B 2GIFA 5I3PA 5I3UB 3AQOA 3G87A 4L74A 1R8AA 4K4ZA 2KYXA 2RSQA 4ECSA 1R8BA 4CLZA 2AV5A 3OFFA 4C3LA 4ZHRA 3FBFA 5CA5A 3GTYX 1TK8A 5G0RB 2YY3A 4IH5A 1TUVA 1NK4A 3TVKA 1UPMB 2CZVC 1Q1KA 2HNZB 2KN4A 3AHPA 3Q8VA 1D1UA 2FVSA 1X5SA 2MMYA 1DY3A 4HHUA 2ZE2A 3A12A 3CDWA 4P10A 1S6OA 2BKPA 3EYZA 1YIJS 4H4OB 3ISNC 1JXVA 3T5KA 2BW2A 1UCNA 4K2XA 1X4FA 3IR5B 1RTHB 3VWSA 1URRA 1EETA 4J9VA 2L08A 4KT0C 1ZM4A 3VZIA 2DR9A 3QO9B 2OPQA 2W8LA 2NXJA 5LXYA 4WYLA 2GAGC 3KK1B 4DV6J 2FVRA 5J2PA 4PPZA 2KHDA 1FDBA 1OPIA 1E6YB 4K4XA 4HDGA 3R8YA 1SB6A 3WC2A 4K0KF 1VQKS 2JVRA 3ZTRA 4RW6A 1BWVA 2V8GA 3BDPA 1T94A 4DPUA 3H25A 2AMCB 4LF6J 3QZ7A 1Y3KA 3OFHA 3DFEA 2EK1A 3FRZA 3MGJA 1KQFB 5KFCA 3G6VA 2AGQA 3H5XA 5SUHA 2V8DA 3BBFA 5M2UA 4OYZA 3PM9A 4HT5A 3KNAA 3QSIA 5CZXA 3RZAA 4Q44A 1WUUA 4G6VB 1QDUB 2MZRA 1IBLJ 1MMNA 3W60A 4K5RA 3EZOA 1UEUA 2BEFA 3D0GE 2Z2LA 4UF4A 2J6TA 2XMAA 3QMQA 3CC4S 1T3OA 1X5TA 3NGUA 4HEA9 2LKZA 1JMTA 3BSCA 4UOFA 5KG7A 5KT7A 4YFUA 1XMOJ 5HMWA 4RW9B 4PKDB 3ICLA 3KDNA 4CO4A 1PBUA 2YH0A 4H4OA 4X4NA 2HFUA 3SDEA 2ZOFA 2XWXA 2ZOGA 2WHOA 4QIEA 4Y65A 5C5JA 2QA4G 3QYYA 1QSLA 3Q89A 4LF4J 3L09A 3FCHA 3L7UA 2DR6A 2ACYA 1MMLA 4KE5A 2WSEC 1KEKA 4Q0BA 2HW3A 4JI6J 4GO5X 2IC3A 3KG0A 4FF1A 2UVUA 4L72B 5ETRA 2V69A 3T3FA 3G6YA 3PJ9A 5IOLA 4ZHRB 4DL5A 1RAHB 5F8NA 2H4WB 2W2PP 1UVLA 3CEDA 4NL5A 2MKKA 5IV3A 3TYTA 4PEOA 2HVIA 4F4YA 3MEDA 4DHVA 3DRPB 4DV7J 1HNWJ 4OJGA 3QLHA 4F4ZA 1QVFR 2X1GA 3T9NA 1VBZA 1UJ4A 2N82B 1P8GA 2Z8QA 1R89A 2MZSA 4Q43A 2B9YA 1TTHB 3G86A 3TX0A 4DV0F 3HFKA 2W9BB 1RAEB 4DPWA 1I3OB 1HNIB 1H3DA 1F6TA 5EGYA 2LLZA 3WBZA 3FFIB 1RTDB 2PMWA 1RGVA 3DLJA 2YKOA 3R1HA 4CLYA 1NJWA 4U7UD 2LXUA 3BR8A 3JXOA 4MKBA 3IWLA 3V6DA 2AIRB 2KO1A 2MJNA 1OSDA 1VQ7S 1C0TB 2WW4A 3AT1B 3D66A 5ETNA 1RK8A 3W2WA 2MQ8A 3CJRA 2VQFJ 1U1PA 3CULA 3OVSA 1B7YB 1JXEA 3M2UB 2CQDA 2YX1A 3E01A 3N5BA 3SQOP 2EBEA 4N56A 2FVQA 1R43A 2Q1LA 4UZCA 4B9SA 1M1GA 1IBKF 4WIQA 1LWCA 1O51A 1HWJA 4Y2MA 2W9CA 2YQ0A 2C3UA 5IXUA 4Q45A 1H2VZ 2C3YA 4YR2A 3EDQB 4JI4F 4H4MB 4C8OA 4NRUA 5I42A 1BLUA 1GAOA 2VJUA 3T41A 4MFBB 3HHNB 1WHXA 2YNGA 1A0OB 5KG5A 2IFXA 2XSJA 3BM7A 3J81Y 4J9UE 4QWAA 5C2GA 2JNJA 3LQVA 4IO9Q 4OX6A 1NK5A 3K89A 3ZTOA 1K9MT 3NEKA 1KLNA 4LF7J 5AXKA 2UXDF 2XGQA 4CO2A 1QY7A 1P1LA 3JTOA 4WIIA 2L3MA 3DXBA 4LFAJ 4DL2A 4G65A 4FP9A 1FJEB 1Y0HA 2VJVA 2UUAJ 1K47A 3CW2C 2J9EA 5CHCB 1RA6A 4HVZA 2YNGB 3RBEA 2DNPA 2LFVA 3OL8A 3J7A1 2KRRA 1TL4A 3FRYA 3DU6A 2XCPA 3KLIA 2V2QA 1IR2A 2HEKA 3PR4A 5DGBA 2LVWA 3BPDA 3H59A 3M2VA 4QPXA 1N5QA 2UUAF 5KFPA 3M2UA 4FS1A 2P9CA 3DOKB 4LR8A 4RNNA 3BJYA 1PC5A 4KV8B 5L1IA 3DDNA 2XB2D 1NAQA 2WTFA 2PT0A 1IUJA 1V9OA 4OHVA 1ZETA 2UVRA 2FJBB 3PEHA 4FPRA 4O4RA 4V1Ak 2HFSA 5JXSA 4B3RF 5J2QB 1TUWA 1VR6A 2H5EA 1IN0A 2NXUA 4HI1A 4HKQA 1DQAA 1GTHA 4KKOB 4M5DB 3B4MA 1HNIA 4CRJA 3OL7A 4DV6F 2YNIB 3RGIA 5ETVA 3UD4P 2ZKUA 3MMBB 4JV0A 1DBDA 2VA3A 1FERA 4QCLA 3JAMU 4PWDB 2WZ1A 1Q82T 1S0MA 1S1UA 1WC1A 3DRSB 4JB8B 3VGVA 2JVOA 3DRPA 4M5HA 4YHHJ 2H5JB 1FXLA 1UPPA 4G1QB 1WG4A 4K7QA 4LIRA 3N79A 1TK0A 1RHQB 5B0CA 3BQ2A 1VQSA 4U8VA 4ELTA 3BSAA 2QL9B 2DY1A 1SBRA 4URQU 2FLNA 1VBKA 2W24A 3FSXA 3HSZA 2IPOB 4ZVOB 3VGTA 2P9GA 2V94A 1DARA 2Z57B 4F3MA 4DOZA 4CLSA 1J5EF 2FHMA 3DXSX 2LECA 2R2UA 3D28A 4G1QA 2A0FB 3T1AA 1WOPA 1U1NA 2KT2A 4DQPA 2HHSA 1LKZA 1H2UX 4DV0J 4RWWA 5KOXA 1N56A 1CULB 4ED7A 3S7RA 3BSNA 2YBVA 2W2QP 1UFKA 2AEMA 1HBMB 1NUEA 4URSA 2X1AA 4LMZA 4N47A 4DLGA 3QRRA 3GYNA 2VODA 2EFOA 2GA7A 2VBYA 2YNHB 4FYYB 2X1BA 3B54A 2R8IA 4NASA 2R7SA 3FCWA 2YTCA 4NCBA 4GRSA 1NK8A 2CQIA 3FSYA 2LCWA 4V19X 2KG1A 2W4CA 4JI6F 1RTIA 3DOLA 3M32A 2MGZB 3QSYB 2MEWA 2B4VA 1FKAF 1EQ0A 3UVJB 1NZ8A 3K7RA 2MLYA 3NOGA 2KYZA 1FK9A 1KR4A 2WVFA 4NI2A 1VQ6S 2HNDA 1F60B 1JLEA 3OR2B 3PCOB 3JSMB 3UNGC 3GZ7A 4WJBA 1FKPB 3G6ES 2HS4A 1K0TA 4YB6A 2M2BA 1S7IA 4DSFA 1XMOF 2Q6BA 1LW0A 1AROP 2B9WA 1HNZF 3H42A 1S1TB 4NOHA 3QIPA 5JUMA 1TVRB 2J6UA 1U6ZA 2MY8A 1EETB 2YKQA 4LIWA 1KP6A 1LXJA 2XMUA 2XO6A 3Q2TC 2E7VA 3EVMA 3I5BA 3NCQA 4OZLA 1FX2A 4A8QA 3RW6A 1BQXA 1HWIA 2VPWB 2PDAA 4HL9A 4C4WA 4ER8A 4UOHA 3K59A 1TFYA 3MPDA 2G0IA 4OI3A 1U25A 2V8PA 4F36A 1Y10A 4CDIA 2GMJA 2ZJPQ 4M8LA 1QAXA 4DR6F 3THTA 5HANA 3MFHA 4KRWA 4A8WA 2XYHB 4ED8A 4LREA 2N7YA 1RKJA 2HRUA 3JTPA 1Z2LA 2VC0A 1RT5A 2Q6CA 5H9EK 2N7CA 2HHHJ 2WB1D 1KQGB 3A1YG 4LBIA 2QV6A 4PXEA 2V8VA 3B4DA 3MMBA 4Y2KA 3MPWA 4YMEA 1U1RA 2YKMB 2FZCB 2MZTA 2LXFA 4C3KA 2ZH6A 1HL6A 4DV1J 3Q8SB 1GK8A 1S7HA 3IG1B 3NBPB 4OI2A 1RWNB 1YJ7A 2N3LA 4QW9A 3MM9B 5DLFA 4DQIA 4PQUA 2HHUA 4KFBB 1Q86T 2BANA 1N5YA 3U1MA 4CQ1A 2CPJA 2FPHX 2QT7A 2FQQB 1RAGB 1RWMB 4UZBA 1Q16B 1RCOB 2RUSA 3ITHA 2JLFA 3K0JA 1P9YA 1X5PA 4C8YA 1Q5VA 3HF5A 1OWXA 4OYXA 2ZHAA 2R7TA 1KVJA 3IRXB 2DHHA 4MK9A 4OI0A 1UVJA 3MR3A 5CYQA 3M30B 4ZOSA 4CYUB 5C42B 2H65B 1ZAVA 4LSLB 2IAJA 2XGPA 3MCNA 1FJGF 3TVYA 3AH6A 3WIVA 2EPIA 2KG0A 3J80U 4R8UA 3I0SB 3I87A 2VFUA 4DEZA 2VQEF 2QLFB 1KTVA 2OP5A 1FKOB 2XULA 3PW7A 5A8WB 2H3EB 3MD3A 4FNHA 1T95A 1ZM3A 3DNCA 4J90A 4RR5A 2F8MA 2UUTA 5K8MA 1NJYA 5GMKa 2FVPA 3CJ5A 3GFYA 3FFIA 1BGXT 1RTDA 3AOBA 4OIXA 2X3GA 4OZ0A 4I67A 1NKBA 2C2RA 3TZWA 3ADAC 2MB0B 3H2LA 3ZNUA 2Q66A 2VV5A 1VFJA 3DGVA 4USWA 5KFGA 2QYGA 3ULHA 1FXDA 1Y7PA 2VC1A 3ONQA 4IFVA 4YEAA 4TKTA 5E2QA 3OD2A 4OYPA 2P9EA 2V63A 2QSFA 2XMMA 1B3TA 3DCAA 3W9IA 2QLBB 2CNNB 2XI3A 2UU9J 4I2QB 2DB1A 1KOOA 3HVTA 4O0NA 3K5NA 3CD5A 1WDDA 2YPYA 4ZP9A 4EYIB 3IM9A 5KFOA 3MAAA 3MUTP 3BEGB 2W7AA 2NXEA 3IR6B 2AYGA 4F8RA 3G96A 3GFZA 3KUHA 4TU9A 4CM2A 4RW6B 3NNAA 5HP1A 2JC1A 2NPIA 2NXCA 1UVNA 1MLAA 4ZCIA 4ED4A 3K8WA 2OIHA 1T0TV 5KT6A 3MPUB 3O6QA 4KHPJ 3MD1A 2HQIA 4AL7A 3OXGA 3DI6A 6FDRA 3JSRA 2BBEA 1TMJA 2VUGA 4XPCA 1M5SA 3W8PA 1YBTA 3KJVA 1FT8A 3CCZA 3J81U 1N0UA 1SKRA 1RTHA 5C24B 1U1LA 3RUBL 3D1OA 1TV6A 3SCLE 1F5BA 3KMQA 2RF2A 2ZBIA 5F8MA 5HVGA 1ZYQA 4FNIA 3O1LA 3VHQA 4TY9A 4FS2A 3BH7B 5DM7Q 3GQCA 5C7PA 4QYRA 2LQJA 3KKFA 3KHGA 3D0HE 1CLFA 2CADA 2Y1LB 3ENAA 2VPZB 2HK2A 2EFPA 3R5BA 5IZHA 3RAXA 2G1HA 4Q0BB 5DS7A 1R0AA 4LFCJ 2DKOB 2DNKA 2JEIA 3IMQJ 5M2PA 3HCXA 3GG1A 3PO4A 2GVDA 1WI8A 5ETMA 1W26A 4OX8A 1PCAA 4USVA 5F0WA 5B0AA 1V6HA 2IRYA 3T1YJ 1ITPA 4TU8A 2JOQA 4WCEQ 4MMOA 3I0RA 4NI2B 3CJ4A 1PJ7A 5GAHU 3I4PA 5B08A 3NWGA 1TAUA 1DTTB 3WHIA 5MLCV 4CLKA 1NB7A 2XTJP 3HD2A 1RTJB 3P45B 4HH1A 4A48A 4ZLPA 3UQSA 4LF2A 2PMHA 3D9BA 4USTA 4DPXA 1ZA1B 2FJVA 2MTLA 2OD6A 1HQEA 3BZQA 5HO4A 1R7IA 2C2MB 2EFVA 3HM9A 4P72A 2GHPA 4F25A 2RU3A 3CMAS 1Y11A 2R7RA 1MU2B 1PAEX 1RTJA 3AOCA 3BYRA 2B43A 4UOGA 4K4TA 2MLXA 4J9NA 2AT1B 3WQPA 3A13A 4K0KJ 1WELA 3SSQA 2KFYA 1SL2A 1CSJA 2OD4A 5L38A 3T5HA 1RI7A 4PXCA 3PYEA 1WC6A 1A6LA 2NXNA 3FEYB 3W63A 3MECB 3R27A 3CVKA 4AUKA 4PG8A 2I5JB 3O44A 3RYLA 5H1SV 3PG9A 4YB1P 1JLEB 3OR2A 4R25A 4IH7A 5HATA 1RKIA 1YX2A 2GVDB 3QO9A 4OI1A 2UV8A 3V4MA 5F8JA 4IH6A 5CZVA 2DYAA 1RLCL 4D3HA 2R7VA 2VFVA 1AXQA 3KUGA 4R5PA 1ZM9A 3PRVA 2Y3YA 3CCVS 3BS9A 4O3PA 3BQ0A 3FEXB 2AU0A 1Q0NA 2MXYA 1WKLA 1X0FA 4NLWA 3THVA 3JQKA 3CJ8A 1FWKA 4PXBA 3G6XA 1YLXA 3PX0A 4IFYB 2UXCJ 4OFZA 4RU2A 3H8YA 2AZ3A 7FDRA 2RKIA 3FMBA 4KH1B 2B6AA 4I69A 3OLBA 4DQSA 4DFPA 3BR9A 4ECYA 8RUCA 4QWDA 5D0EA 1TKZB 4ZPVR 4ED5A 4EEYA 4AFFA 3RR8A 1XR7A 1FCAA 3VAKA 4M5DA 4F26A 5I3QA 4EO8A 2E66A 3MF5A 2YWWA 3LP1A 2CPIA 5LSLA 3EVWA 1S57A 4Q8FA 4X84A 2HQFA 5K8OA 5KTQA 3LWMA 2ZD1B 3J81j 2HYIB 4BS2A 4V19J 1EZZB 4WE1B 2HFZA 3HKWA 3MM7B 2HHPA 3KLEA 1BQNB 2MY7A 3CWJA 4KGKA 4O23A 5DJBA 5J2NA 1Q79A 3EXYA 3P8BB 1PG5B 3Q8YA 1LOUA 1X5OA 1V3SA 4DR7J 1XEZA 3PX6A 1CJTB 4P7TA 3RRHA 2RNEA 3VAMA 1K44A 3EM1A 1B64A 4JI2J 4F3QA 1BQMA 4AQYF 2UZAA 2W1BA 1OPZA 4P75A 1S12A 2KH9A 1DTQA 5HLFB 4I6AA 5IS2A 3KWMA 4P2SA 1U8WA 4DXLA 4DFMA 3IBFB 2A1BA 1VQLS 4DG1A 2GFFA 4DX8H 3QNWB 2Q79A 1IKXB 1N54B 3GCXP 3MTJA 5DDPC 1F2HA 1SQGA 1VLOA 4DBQA 1M5VC 4LFBJ 3RBZA 2GQ2A 4OX9J 3IXQA 3MEKA 4H54A 1TKTB 4KGXB 3W2VB 4CH0S 4I4BA 3SI8A 1RT7B 2BR0A 1UZDA 1R0CB 1U49A 3ILJA 4OJHA 5CQGA 3MUVP 3HLUA 1CJVB 5KT4A 4DV5J 2CJYB 3D3CJ 3A3OB 1MG7A 3DRRA 5HQMA 2FY1A 4I2PB 3EPGA 1NHUA 2ZH9A 2YKPA 5BYSA 1BD6A 3UFCX 1HWKA 4KV8A 1HBOB 1EP4B 5K14A 2MPUA 1IXKA 3I0SA 2V4JB 2J9DA 4GVBB 2A2DA 1URNA 3T5LA 2AEFA 3GSDA 3V5RA 2PIIA 2R8KA 1G6BA 1TKTA 2OFGX 4IOCQ 1WDTA 1RT6A 5E3RA 3OUYB 1KWMA 2IVMA 5JVHQ 5A8KA 2XQCA 2OMOA 1RHUB 1RADB 3LGMA 1ZAXA 3HK2A 1CS4B 1SC4B 2QC3A 1FVSA 2HPUA 4ZS6A 1S6UA 4LRDA 2GS8A 4Q2LA 3JB9k 2JEJA 1AZSA 4LBPA 4RPFA 2R8GA 3BB5A 1XNQJ 4LFBF 4X2BA 4NEZA 4X4RA 5FJ4A 2OELA 3R5GA 2ALYB 5EN1A 3MCSA 5A8KB 1Q5YA 3K57A 4DI6A 1N34J 2K8GA 2HMIB 2NZ4A 1WJ9A 4RNMA 1HHQA 2FJWA 3P49B 4C9DA 1K1SA 4O4GB 5KFXA 2P5VA 3FNNA 3AXMA 4DL6A 3J7ZT 1RYSA 1SC3B 4NLXA 2QL5B 6AT1B 4LFCF 4HI2A 2XHWA 4WKYA 1B0PA 1RSCA 1RABB 1Y5LB 2R42A 3KLEB 2Y8WA 3OVBA 3HHDA 5A8RB 1Q4RA 2CJQA 2U2FA 1S48A 3ET6B 3P3DA 3N4WA 5H9FJ 2ZBQA 4DU8A 1H7WA 2QE5A 3MMAB 1Q81T 1IJFB 4RKUC 2W9CB 3MEDB 3CPWR 3D4JA 1WNEA 1UFWA 3GSIA 3VALA 3L95X 2UUCJ 1R0AB 2EW9A 2B6AB 2J0WA 3KOAA 4ATNA 1RAJA 4I0WA 1OO0B 1JJHA 3KNGA 3NLCA 2C3OA 3NKYA 2GJ2A 3GFHA 2CPYA 2CQHA 4Q7AA 4DFKA 4IRCA 4JI4J 3OW2R 5HROB 3TRGA 3N28A 3DLGA 4KB7A 2YKNA 5KFEA 4ED2A 2CWKA 5B0DA 1IBKJ 3ISZA 4C0HA 3GV8B 3DM2A 2ZNZA 2AYBA 3K8VA 1XERA 1FDDA 1W7WA 5F0UA 4FYWB 4B3MJ 3NGDA 2R7XA 1F3FA 4RLEA 3GLJA 4PYAA 1C4CA 1WEZA 5C25B 1VHIA 1SH0A 3DLKA 3I9V9 4A8XA 1S9EB 1YJVA 4ES3A 5EDWA 1NPPA 4JV1A 1BY9A 4P6QA 1NK0A 5KFUA 1KN6A 1HNVB 2ZBRA 1HQ2A 2W7PA 1YJRA 1MW7A 1X4BA 3QLHB 5KOWA 3Q0AA 1AFIA 1SJRA 3AA9A 1W25A 2K1RA 3U7JA 5D0HA 1MSWD 3FEZA 3D2WA 1TKZA 2JL9A 1DHMA 3BGOP 4KY3A 4PABA 4LSZB 1IBMJ 4NZ6A 4KJIA 4ZVHA 2HQGA 2W2OP 4ZLNA 4B9UA 4MTPA 2XMKA 1FFWB 3D6HB 1TQLA 2BKNA 2OGUA 4R0JA 2MGZA 2ASJA 3HVTB 3M8YA 5CYMA 2GNKA 2DNOA 3NGSA 2D1CA 1HFEL 2VKRA 2DHGA 4ECZA 3CCRS 1U0HB 2X7IA 2ZWOA 1FFSB 1FFGB 1YJ9S 1NJIT 3P6YC 1UWAA 4KGZB 3UR0A 2MDAA 3LALA 1BWEA 1MMDA 4ZPWR 1HD1A 1NNDA 4ZKAA 4RW9A 3CMQA 2YNIA 2KT3A 2VPYB 4ZLLA 2FTRA 3QIDA 5DDRC 2EKNA 1YITS 3N0VA 3QAUA 4ED6A 4B9LA 2K3IA 4C48A 1FD8A 1FKPA 2BOAA 3D6TB 3UDLA 5CD4H 2BJ3A 4NLQA 5GMEA 4B17A 4CO0A 1YDLA 1RACB 4NLVA 3AY0A 3MEGA 4NLUA 3W61A 3LANA 3GR0A 1NDKA 1D8ZA 1CJUA 1JKHB 1LWFB 2QMXA 3I32A 3IM8A 3C19A 4HTJA 4RWXA 3V81B 3J80Y 2QLXA 4A8SA 3BBCA 1FNMA 5L1KA 1JLAB 2B9XA 2K2PA 1RT3A 4N77A 3TZZA 4ILRA 4QIWD 1SJ3P 2D74B 2O3DA 2ZJRQ 3M32B 3HSGA 3OXLA 4EBDA 4ZJQA 1HQEB 5D15A 2DNQA 2KDOA 4GKKF 2ZH8A 2M52A 3S8SA 1WF0A 4F0HA 3MEEB 2UV8G 4FZVA 4ZDNA 4ZIVA 3IRXA 4PWDA 1MWZA 2CDQA 2AGOA 4OI6A 4WFNQ 4LF6F 4DJBA 4IUFA 1G2EA 4IG3B 4IQXA 2B3TB 3A8KA 4DSEA 4OYBA 4NLGA 3N5FA 5EWFA 1Q78A 1S1VA 4M95A 1C1CB 1R27B 3MMAA 3W66A 1ZA2B 1YBAA 3ET6A 4ZP8A 4UOCA 1XR6A 2ROPA 5C2CA 5SZTA 1AYEA 4Z7YA 3IG1A 3G9CA 2C2NA 1KKHA 2P8IA 2XYPB 4DR6J 4WFBQ 1T3NA 4BC7A 2KXNB 1JJ2R 1UMJA 2EI5A 4OHWA 3EMTA 3IC1A 1O6XA 5ETPA 2BZ2A 3KK2B 3CT9A 2ZH4A 1KVIA 2LEBA 2XLKA 3QGHA 4UTGA 2ZM6J 2DO0A 3BPSP 3CDUA 4O0IA 2HK3A 2DR5A 1UWBB 2HHQA 2H4YB 4X66J 1GXTA 1PYOB 4MYUA 2XC9A 2XLIA 3N6MA 4ZMMA 2QYCA 2NYHA 2R8JA 1RUSA 5I3UA 3T1HF 2GHVC 1FDAA 1M5OC 2B7BB 3PACA 3RB3A 4NYOA 4HHJA 2DRAA 1VHFA 5A8RA 2X3DA 2QA2A 3B78A 2DGXA 3GIMA 2MKCA 2W4DA 3VAHA 1QSSA 2CYYA 5M2RA 2CXEA 5KG4A 3NL0A 1BMQB 1L3KA 2FZKB 4B3TJ 5FDLB 4QQBA 1EQMA 2PC6A 3A8EA 1LFPA 1TELA 3SCKE 3TX8A 3UDEA 4X65F 1W2BR 1XTZA 3RR7A 1LQ9A 2GGPA 2J7KA 2Z4PA 2XCAA 3I4HX 2MQPA 2D9PA 1L3VA 3NS6A 1UFLA 2B8PA 3CJTA 1N8RT 2MKIA 1GX6A 3OVAA 2BM1A 1HNXJ 3DOMA 1OSCA 5KFKA 3V4IA 3ETOA 3CO0P 4OI4A 1KLMB 2OI2A 1X31C 2E1CA 2PFDA 4ZCLA 2XHCA 2VU5A 1TR0A 4KHRA 2HNDB 5L8RC 3UD5A 5J1EB 2J7UA 2DTJA 2OEMA 1KQKA 3D1HA 3KLIB 3EGNA 3JYTA 5CYQB 2CQ2A 2FJEB 4UT4A 3VAIA 3C16B 4KTQA 4B3SF 3C2PA 1U6FA 1G7CB 2QG9B 3HVWA 3NAHA 3C66A 3R6LB 2Y9HA 3M6UA 4B3OA 1VK8A 4ECXA 1LXNA 2UP1A 5E7OB 2AJ1A 4K59A 1HMVA 1RHJB 3IP0A 4EWTA 4YDDB 1MROB 3R5DA 1FX4A 1J27A 2RT3A 2M7SA 4P7VA 5J2MB 2WSCC 1PSDA 4C98A 2NSCA 1N5TA 5BYRA 1NBEB 2VG6B 3C6UA 4U96A 3ZZYA 4C11B 2QEXS 4A4JA 2QTWA 3AB2B 3HULA 2MLZA 3WIUA 2VDIA 1CC8A 3V2UC 3R2CJ 3G2XA 3BREA 3H98A 4X4TA 3B82A 1OIAA 5DRKA 1IKWA 5GADU 2NQPA 5IC4B 2BE9B 2FY8A 3GR1A 3W9HA 4KH0B 4OYMA 4UUXA 2RDIA 3D0IE 3PKYA 1U45A 5DZ7A 4C0OC 2DY9A 1DURA 1R8CA 1XR5A 3I5CA 3J7YI 1PGZA 4P2MA 2WOMA 3QT6A 3ZC4A 4AYBD 1FVQA 1GMWA 2CVEA 2WBRA 3QT8A 4F4XA 3NXZA 2FZGB 2AX0A 2E9RX 3UD3P 3LGHA 2EVZA 1BQNA 3OT9A 1C0TA 2E9ZA 4NCGA 5LMNJ 1QUVA 3HMJG 1EARA 2V6AA 1QUPA 4KBIA 1T9UA 4IDKB 3P4UB 2G9OA 5DO2A 4ZJLA 4F4AA 5IT0A 4DR3J 2HS3A 5D4LA 3TNVA 5L46A 2D3O1 2BOPA 1CVJA 3ZZUA 1HHSA 5FDLA 3QJPA 2K06A 2FDNA 3SIPB 4Q2MA 1HMVB 3UCGA 2EFNA 5DLGA 2QMUB 4DS4A 4DCOB 1RHRB 3GYGA 2HNYA 3HSDA 3CJ3A 5E3QA 5I42B 3KLHB 2MQMA 3MEEA 2DITA 2RU9A 3M1VA 1D9FA 3E2EA 1O8BA 1RB0A 3FUYA 4DZ6A 2JX2A 5AXMA 2JSXA 1Q8IA 3W5YA 1Q95G 1IKVA 2CPEA 5BXIA 2ZH1A 2XNRA 3SV3A 4NMXA 4DQQA 3TA2A 2RB7A 5IM0B 4CWBA 1IBLF 2YKAA 2V0NA 4IRDA 4FVMA 4WK3A 3ZFVA 1ICEB 2KU7A 3M8RA 1QAIA 1IWGA 3CDAA 3O5TB 4LFAF 1D09B 3GJQB 1U2FA 2EBGA 3WZ0A 2XSFA 5HQLA 2MQOA 4LF7F 2QX0A 4FXWA 2RUGA 5DG8A 3KK1A 5KFHA 1SC6A 4ED3A 3EGWB 1QVGR 3R5CA 3OHBA 2AYEA 4KO0B 4F4WA 3MI7X 4PR6A 1TAQA 1JX4A 2ZH3A 3UWTA 2LDIA 3DLKB 1TVRA 3UO0A 3AODA 5DQGA 4B3SJ 2L48A 4I64A 4RO0A 4GVLA 1SV5A 2EWHA 4USMA 3DHXA 4EGLA 5KFMA 4Z37A 3V6HA 5U47A 4RNHA 4U67Q 1NB2A 2FYXA 2ZDPA 3OTDA 2B9EA 1JXLA 2A10A 4EZ9A 2MKHA 1WEYA 3DDIA 4CNZA 4EZ6A 3QWPA 2NYIA 1KHVA 2V68A 4WXWA 2NREA 3TJ8A 3BO3A 1U47A 2RVJA 5HVHA 2J76E 3RBXA 1N32J 2BM0A 2PMZD 4MIBA 1FO1A 4BC9A 1J5EJ 2ZUAA 5F41A 2ZFHA 2YX7A 2HBQB 3HJVA 3T1HJ 3EGVA 2Y1JA 3C3LA 2H54B 4X66F 4YR0A 5DQHA 3Q8QB 3P96A 1HWLA 1OS5A 2O1PA 3TUJC 2BJ7A 3V4IB 2XMJA 3N6LA 5C24A 2F65A 4WBFA 5A0YB 4DV4J 2FHKA 3U1NA 4EYHB 4ZCMA 1OJ4A 3QGIA 2KHCA 1EAYC 2RQ4A 4UY85 3TA1A 3K2YA 2ALZA 1QLNA 1PC4A 2YQ1A 1DAXA 3PHEA 3FKBA 1D9AA 1LK7A 3H20A 5GAGU 2MQQA 3NNHA 4WFYA 2EK6A 1V3RA 2BJEA 3KG4A 1M0SA 2E5LJ 2HVDA 4NLOA 1GT8A 2EXUA 5HP1B 3A8JA 2FVCA 5HVFA 2HRYA 3HX9A 1XNRF 5GMDA 2R7UA 5H9FK 1VRUA 4HACA 4RW7B 1VISA 3QBCA 1SJFA 3IS9A 3NY0A 2R2RA 3KJVB 4OZ1A 3KHLA 4UQTA 3D68A 4W4MA 1RWPB 2HHXA 1NPKA 2CPZA 2HG4A 2J0XA 5AXLA 2UXBJ 2OJ3A 2I6WA 3MM5B 4Y34A 2ZC4A 4CLTA 4CO1A 5DGAA 3H5YA 3C15B 5D8HB 1U2RA 3ENQA 1YJTA 4DPOA 4DUTA 2V2VA 4L3NA 1DFDA 2QZ8A 3KHRA 2VOOA 2AJFE 2I8EA 4PCQA 1QTNB 4X4SA 1CJVA 2ZUGA 1HW9A 2KKHA 1IQZA 2DXDA 2DRBA 3OHAA 5J2QA 3C8YA 1VI7A 3SQGA 5B0BA 3HHKA 2EEYA 2C2KB 4IR1A 4P73A 4NXMF 1D3WA 1X60A 3CJ0A 3BH6B 2QJ3A 1DRZA 3LO3A 4ES1A 5LJ3Y 3PY8A 4IFVB 3HXMA 2QFIA 2ABYA 5IT9Y 4PZVA 4NZ0A 3Q8RB 2G13A 1FNOA 1KDNA 3Q8UA 3CJSA 2E5LF 4KSEB 4ECRA 3FCVA 1IR0A 3J7AN 4LSLA 3WX8A 1T05A 2PN6A 5LMUF 5J1EA 1UWBA 2HHTA 1MWYA 1AFJA 3BKUA 4HR2A 3BO2A 4PPDA 1J2VA 4MJKA 4RW7A 2IC3B 1QD1A 3CMES 2C28A 4DV4F 1SQEA 3SCJE 3V81A 2ATLA 3ZXWA 2W25A 4NA2A 3F0NA 4OX9F 1FRXA 2HFVA 2VQFF 1N5VA 1NM2A 3K5PA 5KFNA 2VBWA 2PI4A 1HARA 1NHKL 2OKQA 1WF1A 4FPIA 3GIRA 1C0UA 1FRKA 3W9JA 2HIYA 2YH1A 4FXDA 4WZQA 2JC0A 2J8SA 4AD6A 2V67A 4MFBA 2RS2A 1LNQA 3FK4A 4AQYJ 1RT5B 2FJAB 4Y6IA 4DQRA 1ZH5A 3D3BJ 1T03B 3DLLQ 4LF4F 1JJCB 5A2QU 1S6QB 2E1PA 4YN3B 2XI2A 2IBOA 2PEHA 3FDSA 4ID5B 1RYRA 4ZVPB 3E8OA 3Q23A 4LUBA 1APSA 2RRNA 4A8FA 5DDQC 2RRAA 4R5PB 5KFLA 1ELOA 1SC1B 2VASA 3BN7A 3MAHA 2BKOA 3DRRB 4KQZA 3W3SA 1HYSA 4CLLA 4U7CA 4DV3J 3KYLA 1KQSR 2NR0A 1Y00A 3MECA 4QBUA 2FIUA 1REVB 1S4FA 4WFXA 2N4DA 4ZPAA 3TI0A 1EJ7L 1S9FA 4IO1A 3MM6B 4RW8A 1S1TA 4E98A 3P5BP 3CCUS 4DV2J 4F50A 1WC3A 2ASDA 3SMZA 2UXCF 4DG1B 5E41A 1S1WA 1Z2ZA 1BXNA 4USIA 5A76A 1XN9A 1NSPA 2VFTA 1YJWS 1RWWB 4GKJF 2E1MC 1PJ5A 5E33A 1PYTA 1XIQA 3I31A 3UPFA 2CQ4A 3M2RB 3CCES 1SJ4P 4LQ3A 1FK9B 3I82A 1Q53A 4HH0A 1PAUB 2NSBA 4QU7A 2B51A 2E5HA 3M6XA 3CCJS 1RT3B 1JJ4A 2DGUA 4OZ3A 2KZZA 5D6GA 1C2PA 1YRTA 3HHLA 4CLFA 2QLJB 2BQ3A 3EE3A 4C7QA 3GP9A 1XNQF 4NLPA 3PW5A 1LW0B 2AZ1A 1U26A 1JLBA 1N0VC 2QRRA 1I1GA 2VPXB 3GONA 1RWUA 2QGFB 2G2OA 1VDHA 4DR3F 3VTIA 5BR8J 1HNVA 4ECTA 3KUEA 2W4PA 1U4BA 1VQPS 4QIFA 2CUYA 1M5KC 3THPA 1F9EB 4IG3A 4L3KA 3HVRA 2HGNA 3LH2S 1HR0F 3F44A 3VVUA 3EWGA 3R2DJ 2O66A 4ZJOA 5EX3A 3AFGA 5EHHA 2NS1B 1K73T 1HPZA 4RUAA 3L7PA 4J9SA 2BQUA 2CZ4A 2IBKA 4UW2A 3CIMA 4XDCA 2R7WA 5HROA 1U0SA 1TL5A 4D3GA 1HBUA 5IQ6A 2F40A 2Z2ZA 5IT4A 2EG1A 2K7KA 5KAKA 2QA4S 3HSJA 5KG6A 3DKDA 1IWAA 4CZCA 2R2SA 5DM6Q 3M8SA 2DHXA 2LU1A 4ILLA 4BWMA 2CQGA 1CC7A 1N5SA 1RP5A 1RA7A 4R0EA 3TAMA 4ENOA 3TANA 1KFSA 4YP3A 1ZPVA 2LA4A 4NRTA 2ZITA 2G2YA 1P1TA 3AD8C 4TVAB 1FJ7A 1IKWB 2QA1A 1RHKB 3KXDA 5THWA 2WVCA 1D0EA 3BQ1A 4RL1A 5EX0A 2PE8A 4WTYA 3H5UA 3M4XA 4EK2A 4Z7CA 1KRPA 4CLPA 2DH9A 1U8SA 3R5AA 4DR1J 1S49A 4Y28C 2BQRA 3MTKA 3LP0B 4XO0A 2RHQB 4O4GA 2HBYB 1I94J 1MU2A 1S79A 1CPZA 4U6PA 4ANEA 4K4WA 2A6MA 3PZPA 1AB8A 2AW0A 3ZZPA 3CDEA 1F5CA 4ID5A 4AE5A 5KFBA 1U2CA 3BKTA 4OZNA 1NK7A 3BDEA 4JBCA 3FSIA 1T03A 7FD1A 1X0PA 3CCTA 3DU5A 4N8NA 3U02A 3ELHA 1S1UB 3DRSA 3UE2A 4BCAA 5HQ8A 3QAEA 1N34F 2RAQA 5H9EJ 4FBTA 4LF8F 1HWUA 2CVIA 3F56A 3SSRA 1HKAA 2B4UA 2CFXA 1DTTA 2D41A 2R7QA 2WK4A 4MAKA 4PG5A 3UCZP 2HZVA 2UVWA 2OTJS 4FYVB 2YNFB 2OPRB 2IDLA 3BBBA 3UN2A 4ZVTB 5AXNA 4ETZA 1HI0P 3OQ2A 4BHQA 2GJFA 3MMCB 1UW4A 4IG0A 3KMSA 2YQ3A 4Y0FA 1U6BA 2XYGB 4ZPCA 5K8NA 1FTCA 2HVZA 5T7LB 3DC2A 1FF2A 3TUIC 5KFWA 3A4TA 1VBYA 1S0VA 1TU0B 5D3GB 4P52A 4ANCA 2VKZG 3CCSS 5AE3A 1H38A 1AA1B 3SCIE 4X64F 2KJVA 2RE1A 2F8EX 1IM4A 4NLYA 4Y00A 4ECVA 2RIJA 2ILYA 4U8YA 4LVOP 1LWXA 2DH8A 4J9MA 4NLDA 1S6PB 3T9ZA 3NS7B 4USHA 1RT2A 1YGYA 4YUDA 3QJLA 2AF6A 4ES2A 2ZM6F 2DO4A 3MMJA 3MUMP 3CO9A 3IGVA 2VG7A 5ETSA 3DLBA 4A8YA 5HAOA 2IM2A 2DPJA 3DDKA 1NDPA 2D3ZA 2HRTA 2RDDA 3NGTA 4RBTA 1AUSL 1SKUB 2I2YA 4NA3A 4LRCA 4DX5A 2FHJD 2AJ0A 1HW8A 3OJUA 4TNOA 2DGTA 2GMHA 2KJWA 4JV5F 3FZBA 2R8HA 3X1LB 2AKWB 2BJ9A 2BABA 4JYAF 2E5GA 3CGIA 3KG1A 1EX8A 3IWNC 1F5AA 3H4BA 3PTWA 3F41A 3TJ9A 1EP4A 1FRMA 1GQEA 5K14B 1R6VA 1VJWA 4ANDA 4F67A 1LK5A 1UP1A 5KFZA 2BJDA 4NLRA 1T9VA 1SH2A 3TARA 1RTZA 1NJZA 3TA0A 1I94F 3RBDA 4TXSA 1QSYA 1TKXA 3TQEA 2GGPB 3OV7A 1FI4A 3UN5A 3IN5A 5KT5A 4DR1F 3HJFA 3AB4B 3LOUA 4I6WA 4OLPA 2FC8A 4JP8A 4OMFG 4P2FA 5T41A 3G8SA 4ECUA 2IAJB 1B7FA 1YG0A 1YSJA 1E6VA 2C42A 1IKXA 1LW2B 3GWCA 2W7OA 5HMXA 1UL3A 4DWIA 1HD0A 5D4OA 1VK3A 2EG2A 2GIQA 2XS5A 1F2GA 2PA3A 1MWQA 2HKEA 3ITHB 5F9LA 2DBBA 3LWLA 3H0PA 2LEAA 4JI0J 4J37A 1L3UA 4O3OA 5KFAA 4L76A 1FNXH 4P74A 3E51A 1VYAA 2CDRB 5K9FA 3KLFB 1ZBTA 2B5JB 2KI2A 2XLJA 3KK2A 1JLAA 3IAS9 1GXUA 1HBOA 3LGNA 4CI0B 2EC2A 2BUNA 2L41A 4NMLA 3VGSA 1S0OA 2HAIA 1U1KA 1S1XB 2BXJA 3HZGA 4F0KA 3V6KA 3MXHP 3OTEA 4Y2AA 1SQFA 3CSKA 2C2DA 1N6QB 2VH7A 3DYAA 4ZPBA 4JV5J 4CT8A 3L3CA 1JLBB 2L9DA 3KK3B 3FGVA 1CBKA 4PXDA 2PI5A 1X9MA 1S0NA 5B0FA 1IJEB 4LJMA 2DCLA 3NRBA 4DUZJ 1D9DA 1OY6A 2OEKA 2AX1A 2F1FA 1LV5A 1IQTA 3H5SA 3MR7A 5T14A 2Z30B 1UA0A 2GQQA 2VG7B 4YDXA 1K0VA 1X4GA 1FWLA 1P6TA 2CG8A 3PO5A 3PIPQ 4WP9A 1RAAB 1UEKA 4JUZA 2F4FA 1FEHA 4ICLB 4LQ9A 5F8LA 1HPZB 2F8HA 1NO8A 1YJNS 1HIYA 2ZEJA 4I1TA 4FN5A 2XZTB 1NCLA 3VAFA 4W92B 2Y1RI 1RZMA 3CB4A 2VL1A 4ID8A 1F0XA 2BRKA 3AJ2A 2ZKTA 3QIPB 4K4YA 4N5SA 2J6SA 4B3MF 4FF2A 2BV3A 4PUOB 4J5OA 4KO0A 2BJ1A 1UVMA 1V3ZA 4R8UB 4F3OA 3MZIA 3CIZA 1SL1A 3T6JA 1BUXA 4O44B 1XMQJ 4ZN3A 2VIHA 1VCTA 5LT5A 2L9WA 3EPIA 1S5ZA 1KVKA 2VB6A 3L4BC 1KHWA 2YVSA 3UCUP 4GO7X 5FIIA 5JMNA 3I55S 1RAOA 1Y4ZB 2DPIA 5HJYA 5EWEA 4M5NA 4DL3A 4DL7A 3AD9C 3DLGB 1IKVB 4FKYA 4NZ7A 4OYWA 1E6YA 4TQSA 1IM6A 3MCMA 4GC6A 5CYMB 2IA6A 4JI8J 3VGUA 4L75A 4EMDA 1VC0A 2RRBA 4X4QA 2F9DA 1TV6B 1H73A 2XZWA 3ILLA 2YNHA 4J9QA 3RB0A 1B70B 3KJFB 3MPYA 3TOQA 3IFEA 4ELVA 3NBPA 1VRTA 1N36J 4TY8A 1ZZFA 2XS7A 2GZOA 3M8PA 1RWKB 2EFQA 2HGLA 5D77A 4O3QA 4QOTA 3PRBA 5IQQA 2I1RA 2RH3A 4C3MA 4OLOA 2IRUA 4KKOA 2Q3PA 3LAKA 4DN9A 3M9MB 3MDFA 2KZMA 4QJVA 4L73A 2IYGA 2WVEA 4KIAA 3K5LA 2J9CA 1SJQA 3LAMA 2JLEA 5ETQA 1UAWA 3TAMB 4DF4A 4E0DA 4PUOA 2G1DA 4OZJA 2HQCA 4F04B 4OV6A 1KC8T 3SZ2A 4TU7A 1F9FA 2E29A 3MWBA 5G0RA 2U1AA 5LOQA 1OYEA 5CAAA 3DM2B 4WU2A 4K2JA 4I6YA 5IM0A 1YHQS 4X4UA 1JLCB 2MZJA 3FBBA 3VZHA 4DN0A 2BYCA 1NDCA 4PG4A 3M8QA 5DG7A 1X4CA 2J7WA 3ILIA 2ROEA 1N88A 2BE2B 4MK7A 3SFGA 2VG5A 3PV8A 3F73A 3VR1A 4C8KA 1H72C 4IKAA 4BDPA 4X4VA 2JLGA 4IOAQ 1AZSB 2HNYB 2GHWA 4PRFA 4O3NA 2OEJA 1JLFA 3MM6A 1C0UB 2VZ9A 1JLQA 1NSKL 3R6GB 4RW8B 4EI2A 3AOAA 4B3RJ 3GJTB 2OUGA 3GIIA 4S0MA 3CCLS 4OJ1A 4F2SA 5KFVA 2BVZA 4ZVGA 1S72S 5E3CA 4DSIA 2HHVA 3I96A 4GVBA 5BJRA 2LQ9A 5A2QY 4YOEA 2VICA 5LSRA 2XWYA 3RB4A 4HT7A 1REGX 4C6AA 2HHWA 2HZCA 1BC6A 2MQNA 3RRKA 3TEHB 1RQ0A 2Y1IA 2JEGA 1HI8A 1UTAA 2NZCA 4XTTA 2M88A 3HHLC 3ETMA 3M2VB 4M63A 3TR5A 2YWKA 4PQAA 2M4MA 4U9RA 1I51B 4CLWA 1RTIB 2DRDA 2IM1A 3CNQP 3DOLB 1Q7LB 3EX7B 4GKJJ 1T9WA 2DNNA 4K5SA 4LVNP 3BV8A 3GCWP 2LEPA 3QGPA 1YI2S 4EU0A 2XG8A 2V5HG 4A47A 2F3JA 3NCRA 3NG8A 4LF1A 5KG1A 4HHHA 2RMLA 1RT4A 1YJUA 3FC9A 4MKVA 2R3VA 2YX4A 3QZ8A 4CP5A 4TLQA 2DGOA 1B0VA 2G0CA 3MM8A 1NJXA 1TL1B 3N9UC 1GNKA 1ZPWX 2QL7B 4C8ZA 1JLGA 2V4JA 4IDKA 5J2MA 1WTBA 4N41A 2GVZA 2WBMA 2KVQE 1PBAA 2E1RA 1HA1A 2GJIA 3ENWA 4XPEA 1XMBA 2XSJB 1VBXA 3DOKA 2IJNA 2IM0A 2OHDA 2LU2A 1WHVA 1IBCB 2HZAA 4RW4B 1NXIA 4QR0A 3RG6A 3RU0A 2FGOA 1NK6A 1KD1T 3JYTB 4JI7F 4NXNJ 3U1LA 2XMWA 1RE1B 4RUHA 3G71S 3H2VE 1EKRA 1U02A 2DJWA 2NUUG 3CJKB 4YQWA 5KT2A 3T6BA 1FRIA 2MKYA 4YB7A 2KL8A 3Q8PB 1O0PA 4KHMA 1LEOA 2KM8C 2BA9A 5CD4A 2DCUB 1W2IA 2CJXB 2CQ3A 1UW9A 4JI1J 1YTYA 2G4BA 1TMMA 1X7VA 3G82B 4UY8T 2ZHOA 1I5OB 8ATCB 3K58A 3ILOA 1N32F 2B0GA 2DEJA 3TZXA 4LR9A 3ZZZA 4A46A 5CABA 1TFWA 3OFGA 4PG7A 3UNYA 2MYFA 2V2ZA 3MM8B 3PX4A 3CC2S 4Q8EA 3OJSA 4DCPB 2D7SA 2DVIA 2CPFA 4DPTA 2YKMA 3HHEA 3M8WA 3OPKA 2AD9A 3BGLA 4DL4A 1VGYA 1VQYA 3CF5Q 1N48A 1QTMA 1KTQA 2V2KA 4ZVRB 5A6WA 5KG2A 2DR7A 1BHNA 2DGWA 2D3UA 2IDEA 3LW5C 4ZPDA 2IA0A 4O3SA 4JI5J 3HT3A 1FJGJ 1PYSB 4QYZK 2KXHA 2MQLA 5KG3A 2ZVIA 3D6FB 2HLUA 4B08A 2FLPA 2BX6A 2WONB 4DSJA 1S76D 3EGZA 2BRLA 4NXMJ 2IVFB 1WHYA 1S59A 2XO7A 3K5MA 2C22A 1U7LA 2O5DA 3NGKA 2CQCA 3OTCA 4J9LA 4FKXA 3OL9A 1GH8A 5EWGA 2M8HA 2GO8A 2GQCA 3GV7B 3T1YF 3V6DB 5L1LA 1RCXB 3OFEA 1MNEA 1SIZA 3N6NA 4NWBA 3SQGB 4Y3CA 1UKUA 2ZHBA 3CTRA 1UVIA 3UN3A 1FD2A 1X4DA 2MHNA 2IRXA 1H98A 4ZP7A 2A6OA 1RAIB 2Z2MA 4IRKA 4G1PA 2GIRA 5BYQA 4NLSA 3PW2A 3QFHA 2GAHC 4A8KA 4XIUA 2HQDA 1TZ0A 1WORA 1FDNA 2VBZA 3EDRB 1REVA 3MOZA 3VV2B 3TQ1A 1CULA 1WSVA 2RQMA 2CQ0A 3CDBA 3VF0B 2CNLB 3OXFA 4AT1B 1C4AA 3SFUA 5B7WA 3NMRA 3I9ZA 2O67A 3GPAA 1LWCB 4NCGB 1DJ0A 1NLKL 4ETXA 1XNRJ 2CKWA 4AXJA 1RU2A 3FBCA 2YPZA 3GIJA 3M6WA 3LP2A 3C14A 3H40A 5K20B 1CEZA 2FUG9 3TW0A 2VFSA 5LMNF 2AHOB 4O3RA 4HDHA 3IBCB 1M5PC 1WC5A 1NEEA 2NLWA 2CJ9A 1VQ8S 9RUBA 1DQ8A 1WF2A 2HIQA 2ADBA 1VC6A 4CO3A 2DR8A 2E1AA 1SKWA 3KLHA 1CQMA 2VF3A 3EZUA 4WU3A 2KVIA 2DHSA 2HWHA 4TN2A 5LSOA 5F8HA 4NYZA 4KYZA 4JI3F 5F3TA 4DMZA 2ASYA 4QR1A 4TY8B 1H74A 4ILMA 2XS2A 3CC7S 4USJC 4QZVB 1VMBA 4ED1A 4KHPF 1SH3A 2FD2A 2ZH5A 3PJXA 4KPYA 4M5GA 5CXTA 1U0HA 2YKNB 1CJKA 1FRJA 2WAQD 1S10A 2UU9F 4K4VA 5HSPA 2HNZA 2MZQA 4TLRA 3UR3C 4FF4A 5JJBA 1VIXA 4DZDA 5AE1A 3HI9A 5AT1B
chains in the Genus database with same CATH topology
4A8OA 2J5AA 3O3LA 2ZJQQ 1N36F 2A2CA 1RJJA 5GAGI 1N52B 1VQ4S 2EKYA 2VD3A 5GADI 1VC5A 1VQ9S 3DMJA 4TYBA 3MEGB 2K1RB 1HQUB 5KFFA 2V4QA 2PO4A 5B0GA 4NYPA 4JV2A 2YWEA 3H4DA 2J0QD 1VS3A 3U27A 1JB0C 3E01B 2AGPA 4OZ5A 3O8WA 2WW8A 4WF9Q 4QIVA 3PIOQ 3NNCA 1QAYA 4J9KA 1M5HA 3CCWA 4C11A 3PW0A 4RNFA 1S9GA 3UI3A 4EO6A 1Y9OA 4URGA 3J7Z5 4DLEA 2X1FA 3QJJA 2CRLA 2W9AA 5G4DA 4ERDA 2BDPA 2ZE2B 1NK9A 2LDYA 4HTIA 3LUYA 4N8OA 1FKOA 3KFWX 3TAPA 1WWHA 3GB0A 3SXLA 2CPXA 4C8LA 3ZZRA 2OH2A 3VAGA 4JI0F 3BN4A 4K4SA 3FMWA 3VCDA 4MH8A 1ZOTA 5K8PA 1S99A 2E9TA 4CH7A 2JJ4D 4MIAA 5KFSA 3J7YU 4G3IA 3S01A 1I6JA 4ECWA 3IWXA 2JDJA 4DV1F 3GE9A 1X9WA 1WEXA 4I7FA 1NH8A 3KHHA 1NKEA 5C25A 4LSNB 5CCLA 3I6PA 1N33F 2HHHF 1SXLA 2AWZA 3N01A 2XBPA 3SDEB 2J8AA 1HBNB 4X4OA 3I56S 3MR5A 4IR9A 2POKA 2DIUA 2MJUA 3W2VA 5IWAF 4W90B 3MURP 3GV5B 2ZBCA 2OLWA 4RBUA 5A8WA 1FEEA 2YWFA 3SSSA 5KFYA 3M9NB 4I7FB 2C3MA 3PW4A 5AE2A 5DG9A 2MZ1A 3CE8A 3MM5A 4LT6A 4YB5A 3ZZ0A 2VONA 1SI9A 2KFZA 3X3UA 1KNZA 1L5UA 3OL6A 3TUZC 2M0GB 3US5A 4UUWA 1FE4A 2R2TA 2NUHA 2RJZA 1KOHA 3OTBA 5F8IA 2ZZMA 1QM9A 3IR7B 1Q8LA 1SIWB 1TKDA 2OPSA 1O5JA 2I38A 3PFEA 4YR3A 3OLAA 2IHR1 1NH7A 1Y5IB 1UEVA 4C0BA 2ROGA 3ZZOA 2E5IA 2KRBA 4H4KA 1SL0A 5L9XA 3RB6A 3CCMS 1R6YA 2FGCA 3UDCA 1QE1B 1Q7YT 2VOPA 3QGGA 2HLTA 3M05A 3ZZTA 4LSNA 3OBIA 1TK5A 2UUBF 4ECQA 2EC0A 1VRTB 2HS0A 1Y5NB 3HZEA 1H6KX 4OHZA 3JTNA 1S97A 4KR0B 2FJXA 1P27B 1XK8A 3GMGA 3PDNA 4RX6A 2VG5B 3DN9A 3JSMA 2F7VA 4JI5F 1ZM2A 1BQMB 1R8HA 1WHWA 2DH7A 4NPOA 5K5MA 1SKSA 1HNXF 2JEFA 1VQOS 2IYIA 3R1LA 2GCFA 1GXLA 3LP0A 2APOA 2CJBA 2WONA 3VQTA 2ZNYA 4QPTA 1NRKA 1H2TZ 4NX9A 4K50A 1YVFA 3MM7A 3IAM9 1UA1A 1Z4UA 5E3AA 4MK8A 2ZD1A 5J1PA 4B3TF 4XDDA 3BSOA 3PRDA 2OPPA 1JIHA 3G8QA 5J1NA 4AL6A 1C1CA 1ZZNA 2R9LA 2XY7A 2WRMA 5DDOC 2LQBA 3OSNA 1UJ5A 2DNHA 5ITHA 2IVYA 5CH7B 3M8PB 2WCXA 4FBUA 3BGUA 5ADZA 5HI7A 2RKIB 1UJ6A 1K8AT 2M9KA 2E5JA 5D4PA 1P9QC 3W7BA 2Z0GA 1DTQB 3IGNA 4YHHF 1HBUB 4NXNF 2DK2A 2XMVA 2VBXA 4LF5F 4LF9F 1JK9B 4HLBA 4CT9A 2HQ3A 4RUCA 3L7OA 3D54A 5J2NB 3MPVA 5HBMA 2AJQA 1JKHA 1KONA 3KLGB 4CIOA 2LYVA 3DYAB 2JH3A 1VQ5S 2FLLA 3POTA 1TP7A 3SV4A 2DNMA 2GC8A 2GW8A 2OPQB 4OJ3A 2A3JA 4B9VA 3CD7A 4DSLA 4Z2XA 5HBMB 1JLFB 1GTEA 4Y2IA 4DDFA 2VG6A 3C6UB 5KT3A 2PFFB 3KLFA 4Y2CA 2CQBA 1TL1A 2PGCA 4FYDA 4UQGA 5LJ5Y 2RF2B 3MAQA 4F2RA 3CD6S 1JLCA 2V8HA 3HHLD 2HWTA 3WC0A 1S77D 1NHVA 4KAIA 4QU6A 2DGQA 2OAUA 3JSYA 4C97A 3NS5A 2CJAA 2QSWA 2KB2A 1TL3A 1LWFA 1NU4A 5HMZA 2UUWA 5J2PB 1WACA 4U7UK 2RDJA 4O44A 1UETA 3DI6B 1U09A 2AP6A 4RW4A 3FZ2A 4B9TA 2A18A 4WFAQ 4DFJA 3GYXB 3AQPA 4TYAA 4EUVA 4CTAA 4IQMA 1RT1B 2PD1A 4DF8A 3HHLB 3T5JA 1A7GE 2PSZA 1ZAWA 1RT7A 2M70A 5EUHA 5JVGQ 4F4KA 2DGSA 3JSBA 2ADCA 2N4CA 4WYWA 4AXIA 1IBMF 3RRGA 1GX5A 3DLEA 3FQKA 1OQ3A 2Y0SD 5GAEI 1N4LA 3PNIA 1ULRA 1S1WB 2CG4A 2ZVSA 3ISND 1AW0A 4RU9A 4JI1F 2BE2A 5HLFA 2C2EA 4KGMA 3CJKA 3MHYA 1RT6B 3OUYA 1HHTP 1JNRB 1QE1A 3FQLA 2PA8D 2XY5A 2DISA 1DLOA 3WDOA 3PXGa 3I5AA 1HYSB 1S9EA 1FA0A 3EZ5A 5MAOA 3K5OA 2BACA 4DV2F 4WE1A 4DV7F 1HNWF 4GC7A 2P6SA 1JLGB 4EBEA 3RAQA 2HMIA 1H7XA 4HYKA 3PVXA 4JI8F 1S1VB 2CQ1A 5GVQA 3MOJB 1VLYA 2OPRA 2SXLA 2DNZA 1NKCA 1J5OB 3BGRA 2COLA 4B3OB 4N76A 4QR2A 5B09A 2UUCF 2CIMA 3OR1B 2W8KA 1T8EA 2R7OA 5KFIA 1LW2A 4QWCA 4IFYA 5I4MA 1T7PA 2DIVA 2MKSA 3DLEB 4OHYA 1M90T 1VIOA 2MSSA 4JOUA 1FJCA 1WG5A 5A6PA 2AYMA 5GAEU 1L3TA 2IM3A 1R31A 2F9JA 2OMLA 2ILZA 2MKJA 4EBCA 1IKYB 3OTOF 1KLMA 1DQ9A 2ZC3A 3CJ2A 3MM9A 2OTLS 1WD6A 1Y3JA 2E44A 3FVYA 3HVAA 4B02A 2JFKA 4MYTA 3MR2A 1PO6A 2E7WA 1FESA 2OSQA 1PILA 4H4KC 3IO1A 4ZVFA 1FXRA 4B9MA 3UW1A 5L39A 1D8YA 1LWEB 3C6TA 2H9ZA 4GMKA 2DD8S 2YNFA 2R4FA 2UVVA 5C42A 2QMWA 4MKAA 3V6JA 2I0XA 4XK8C 2V9KA 4WFZA 3T19A 1VQMS 2FC9A 3H2UB 4I68A 3ENVA 2DNYA 3BGRB 2GX8A 4QWBA 3G8TA 3BO4A 1AUDA 3Q2SC 2V9WA 4K0KF 1T02A 2XEXA 5L1JA 2CPHA 4MKYA 2N3OA 4DR4F 1N5YB 2VFRA 2DNRA 2DNGA 3FJ2A 3PFOA 3PJWA 4OQJA 5LXRA 5KFDA 4PQUB 2LQ5A 1TKXB 4NLTA 4C8NA 1LFWA 1U48A 1X8DA 4M94A 3AA8A 4CTAB 1FRLA 5A0YA 1WTFA 2GO9A 1JWWA 1N6QA 1IKYA 4OV1A 1Z1ZA 4WXOA 5HL7Q 3DMJB 4X4PA 2IMOA 2RQKA 2LMIA 2D3OR 3B8HA 5JUMA 1C1BA 1SUQA 2B5JA 2OSRA 3OR1A 2D9OA 4JI2F 2LA6A 4WZQA 1U1MA 2WSFC 4ICLA 2L9NA 4RBVA 5FLXY 2IJFA 2EFGA 3MR6A 1J5OA 2UXBF 1XWLA 4KC5A 5KG0A 2MSTA 2BANB 2QIFA 1R8PA 1SUQB 3G4SS 1SV5B 4CO5A 2K7JA 2HFOA 2QO3A 1VQNS 1HBMA 4E8UA 4WKRA 1E6VB 4DS5A 2M5YA 3WX4A 2OPPB 4QIGA 4X62F 2B7CB 2AJ4A 5IFMA 2GMLA 2C3PA 4Q5VA 4J9RA 4ZA1A 4C2MA 3KLGA 1XMQF 4BWJA 4G1IA 2MHEA 3LPYA 1H0HB 2FHOB 3AAWB 3DHWC 3HPOA 1OQ6A 1YRUA 3IA0A 3LP2B 2WB4A 3C46A 3HP6A 4DR2F 3PR5B 3DLHA 3M9OB 2Q43A 4CNYA 4FVCA 3M1VB 1Q8BA 3S6EA 5FD1A 3CD0A 3RW7A 1RDRA 1C1BB 3KTQA 2JRSA 4OX7A 3JAMY 1U24A 4FF3A 4MIWA 3NAIA 5HN0A 3DGPA 5KFQA 4DUZF 4EFAC 4FXVA 2ERRA 1KFDA 1B0TA 4YY3F 2YWGA 5KFJA 2I5JA 4K4UA 2P6TA 3BGFA 2DT9A 3VQSA 2M3DA 2JZ5A 5KFTA 3PKMA 2OFHX 4C8MA 3RTVA 5E3PA 2OPSB 2ZDOA 2ZOMA 3NCPA 4L6V3 3IBWA 3M6VA 4PG6A 4ZVEA 2ZZNA 5F3ZA 3P5TL 3E3XA 2RS8A 3TP2A 6FD1A 4IOBA 2RD5C 1QAJA 3SYZA 5HMYA 1S6QA 1T05B 5D78A 4QWEA 2VA2A 3BF4A 2CQPA 1HI1A 2CPDA 5F8GA 4PWUA 2FJDB 1X4EA 3D5MA 1SJ1A 2B56A 2XMTA 4WZMA 4ALZA 2KT5A 4ZP6A 1KSPA 2LXIA 4NCAA 4CCHA 3IRWP 1G3OA 2B4PA 1JNZB 5E0OA 1S6PA 2J9DE 3POTB 1KS2A 1UVKA 2F4VF 3QWUA 1ZTWA 1S1XA 3EXCX 2OO4A 4B9NA 1RT1A 1CG2A 4ZK7M 5L9NA 2YWHA 3HKZD 3NMAA 1K1QA 1DLOB 2B4OA 1ROFA 2WOMB 4H4MA 5D4NA 3MMCA 4IG0B 5B0EA 3CUNA 5DETA 2KFNA 2FLOA 3M2RA 3VAJA 2O01C 5LL6d 3CXCR 1RISA 3QJPA 2I9SA 1TL3B 1RT4B 3M30A 2JHEA 2DNLA 2DGVA 2HGMA 5GAHI 4OL8A 1FE0A 4NA1A 1VRUB 4I56A 2JWNA 2RILA 3W2WB 3GIKA 1LWEA 3C6TB 3HDSA 5BR8F 4RNOA 2NPFA 3Q24A 4ELUA 2ZH7A 3CCQS 1A9NB 1U1QA 4KFBA 2FHJA 1S9GB 1X4AA 1NZAA 3TO8A 1VOMA 2DHAA 1MROA 4ZPTR 4CH1A 2E7XA 1R3NA 2GV1A 3S1TA 3OSPA 4I2PA 2QFJA 1L3SA 2HFNA 2V4RA 5CCMA 1XC9A 4J9PA 3D1QA 5T7LA 4QW8A 3PEJA 2IMWP 3EUNA 2QLWA 1FHTA 2JFDA 1WI6A 2KXFA 1HQUA 1X9SA 3GG0A 5F9NA 4I2QA 4BBYA 1FTRA 4DUYF 1JLQB 1YWXA 3NP5A 2XY6A 4QYZJ 4ED0A 3DRXA 2J0SD 3GILA 2XNQA 3IS9B 4ZCKA 1FRHA 4M1KA 4DSKA 5DQIA 3QPIA 2M8DB 4WK1A 1WG1A 2X51A 4RZRA 3LF0A 1DZ5A 3KLVA 4AL5A 2HVHA 2RQCA 1U1OA 3M8QB 4DL0C 4DR5F 1X4HA 1RT2B 5CYJA 3MFIA 2ZH2A 2BQUA 3O2IA 1YQHA 2HWIA 2KM8B 1ZTTA 4DV3F 3TAQA 3R3TA 4ITSA 1HBNA 4TQRA 4J9OA 2AQ4A 5KFRA 5E5NA 1QJHA 1YRXA 3GFXA 2ASLA 4IYQA 1M1KT 2K3KA 3DRYA 4XAKA 3TVZA 2W9BA 3RAMA 5AJ3F 5D3GA 3I0RB 2FB0A 1XBWA 1CQNA 4A8MP 3Q22A 2CJKA 3SEOA 1G1XA 2KTQA 3AJ1A 3LP1B 5I3PA 5I3UB 3AQOA 1R8AA 4K4ZA 2KYXA 2RSQA 4ECSA 1R8BA 2AV5A 3OFFA 4C3LA 4ZHRA 5CA5A 1TK8A 5G0RB 2YY3A 4IH5A 1TUVA 1NK4A 3TVKA 2CZVC 1D1UA 1Q1KA 2HNZB 2KN4A 3AHPA 2FVSA 4C8KA 1X5SA 2MMYA 2ZE2A 3CDWA 1S6OA 3EYZA 1YIJS 4H4OB 3ISNC 3T5KA 2BW2A 4K2XA 1X4FA 3IR5B 1RTHB 3VWSA 1URRA 1EETA 2L08A 4KT0C 1ZM4A 3VZIA 2DR9A 3QO9B 2OPQA 2W8LA 5LXYA 4WYLA 3KK1B 2FVRA 5J2PA 4PPZA 2KHDA 1FDBA 1OPIA 1E6YB 4K4XA 4HDGA 1SB6A 3WC2A 1VQKS 2JVRA 4RW6A 2V8GA 3BDPA 1T94A 3H25A 3QZ7A 1Y3KA 3OFHA 3DFEA 2EK1A 3FRZA 3MGJA 1KQFB 5KFCA 3G6VA 2AGQA 3H5XA 5SUHA 2V8DA 5M2UA 3KNAA 3PM9A 4HT5A 5CZXA 3RZAA 4Q44A 4G6VB 2MZRA 1MMNA 4K5RA 1UEUA 3D0GE 2Z2LA 2J6TA 3QMQA 3CC4S 1T3OA 1X5TA 4HEA9 2LKZA 1JMTA 3BSCA 5KG7A 4YFUA 5HMWA 4RW9B 4PKDB 3ICLA 4CO4A 2YH0A 4H4OA 4X4NA 3SDEA 5C5JA 2ZOFA 2XWXA 2ZOGA 2WHOA 4QIEA 4Y65A 2QA4G 3QYYA 1QSLA 3L09A 3FCHA 4KE5A 2ACYA 1MMLA 2WSEC 1KEKA 4Q0BA 2HW3A 4GO5X 2IC3A 3KG0A 4FF1A 2UVUA 4L72B 3T3FA 4DL5A 3G6YA 5F8NA 4ZHRB 1UVLA 3CEDA 4NL5A 2MKKA 3TYTA 2HVIA 4F4YA 3MEDA 4DHVA 3DRPB 4OJGA 3QLHA 4F4ZA 1QVFR 2X1GA 3T9NA 1VBZA 1UJ4A 2N82B 1P8GA 2Z8QA 1R89A 2MZSA 4Q43A 2B9YA 3G86A 4DV0F 3HFKA 2W9BB 1HNIB 1H3DA 5EGYA 2LLZA 3WBZA 3FFIB 1RTDB 1RGVA 3DLJA 2YKOA 3R1HA 1NJWA 2LXUA 3BR8A 4MKBA 3V6DA 3IWLA 2KO1A 2MJNA 1OSDA 1VQ7S 1C0TB 1RK8A 3W2WA 1U1PA 3CULA 3OVSA 1JXEA 3M2UB 4N56A 2CQDA 2YX1A 3E01A 3N5BA 2FVQA 2EBEA 1R43A 2Q1LA 4B9SA 1IBKF 1LWCA 1O51A 1HWJA 4Y2MA 2W9CA 2C3UA 5IXUA 4Q45A 1H2VZ 2C3YA 4YR2A 4JI4F 4H4MB 4C8OA 4NRUA