3AA8A

Crystal structure analysis of the mutant cuta1 (s11v/e61v) from e. coli
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
103
structure length
103
Chain Sequence
TAVVVVLCTAPDEATAQDLAAKVLAEKLAACATLIPGATSLYYWEGKLEQEYVVQMILKTTVSHQQALLECLKSHHPYQTPELLVLPVTHGDTDYLSWLNASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Divalent-cation tolerance protein cutA
publication title Remarkable improvement in the heat stability of CutA1 from Escherichia coli by rational protein design
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 21
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3aa8A00
2VD3A 5D4OA 1NH7A 1UL3A 1H3DA 4C3MA 2O66A 5DRKA 4CO0A 3MHYA 2EG2A 4Y6IA 4CO5A 4RX6A 1V3RA 4CO1A 2Z0GA 4C3LA 4OZLA 1NAQA 4D3GA 1NH8A 4CO2A 4D3HA 2GW8A 1UKUA 1V6HA 4C3KA 2PIIA 4RLEA 3X3UA 5D4NA 1VHFA 4YB5A 5DS7A 1V9OA 4OZJA 2EG1A 1QY7A 2E66A 3NCQA 2O67A 3OPKA 1V3SA 4RWXA 1O51A 5D4PA 2XZWA 3DFEA 3CE8A 4AFFA 2NUUG 2XG8A 3NCPA 4CO3A 5D4LA 1HWUA 4ZK7M 2NS1B 2NUHA 4NYOA 3TA1A 3NCRA 1Q1KA 1UMJA 3O5TB 2J9CA 1XK8A 2GNKA 4WK1A 4OZNA 4R25A 3HLUA 3AHPA 1NZAA 1VFJA 1O5JA 2RD5C 4YB6A 3N5BA 2DCLA 3AA9A 4YB7A 3O8WA 1GNKA 2V5HG 4USJC 3BZQA 1J2VA 2XULA 3L7PA 3T9ZA 1PILA 2ZFHA 2XBPA 1KR4A 2J9EA 2CZ4A 1P1LA 4IYQA 4USHA 3AA8A 4NYPA 3LF0A 3TA2A 3TA0A 4CO4A 3AH6A 4Y65A 4E98A 2J9DA 2JJ4D 3GSDA 1UFLA 2GX8A 4CNYA 5L9NA 1OSCA 4USIA 4WK3A 3M05A 4RWWA 2ZOMA 4CNZA 2J9DE
chains in the Genus database with same CATH superfamily
1FD8A 2HFZA 4HDHA 3QIPB 3GCXP 2DEJA 2OPPA 4LF1A 3E3XA 2JX2A 6FD1A 2EPIA 1W2BR 1HW9A 3SSSA 2Y0BB 4GMKA 1TL1B 3LGHA 2OH2A 3J81j 4F3QA 2DBBA 4KJIA 3M30B 1RYRA 1OYEA 2NXNA 2E5GA 1FCAA 1K47A 5KG2A 2XI2A 3QIDA 4WFYA 5I42A 4F8RA 3MAAA 4ES1A 1RWVB 4LFAF 5IT9U 1RHKB 1MG7A 1UWAA 3TQ1A 3ENAA 3KDNA 1VQ8S 3A1YG 4KGXB 4LBIA 3AXMA 2IDLA 1AYEA 3CJSA 2PEBA 3OLAA 2A2DA 2V8DA 4UQGA 3K17A 2WAQD 4UY85 3ZTPA 1NK4A 4HHUA 3OFGA 2ZDPA 2J9DA 1S79A 1SC4B 2PA3A 2XS5A 2HRTA 2HQFA 4Q45A 3N6MA 3OXGA 1N36F 2KT2A 4BCAA 2WK4A 3C16B 2N3LA 4ECXA 1QAIA 2JFKA 1Y5LB 2Z57B 3J7A1 3AD9C 1S48A 3M8WA 3QO9A 3GWCA 3TVZA 4ED4A 3CD0A 2W8KA 1TL3A 4CO2A 3TJ8A 1S1XA 2I2YA 2D9OA 3EGZA 4DR4F 4O23A 2WONA 2YY3A 4LFCF 3VQTA 3JSYA 2XMAA 2DGQA 4KBIA 3BR8A 8RUCA 1VQLS 2W7PA 3OT9A 4ZVFA 3BN4A 2OUGA 2KG0A 3QYYA 4WPAA 1HHSA 1NZAA 3N5BA 2LKZA 3O8WA 3D0IE 1U0HB 2YVSA 4TLQA 1DURA 1S0OA 2F7VA 4ATNA 1PBAA 5HK4A 5EGYA 1HNZJ 2L9NA 1TL7A 2VD3A 1S7HA 5DQIA 3TQEA 5KT3A 1RT2B 1GXUA 3SEOA 1SKRA 1BHNA 3BH6B 3IFEA 4LF5F 4ELVA 2DIUA 2RILA 4CRJA 4KIAA 1Y9OA 2IMWP 4DR6F 2AEFA 1HD1A 4AT1B 1VMBA 2QO3A 2KKHA 1NPKA 2W25A 2UU9F 1A0OB 1RK8A 1I51B 1R43A 2I8EA 5E3AA 4BC9A 2FLLA 1FTCA 1HBMB 4DSLA 3FSIA 3JAMY 1YJTA 1IBLJ 4R25A 3HLUA 4B3RJ 5L1LA 2DVIA 2XZDB 3ILJA 4QR1A 3W5XA 2KB2A 2FC8A 1CJKB 3K5NA 1SH0A 1MROB 3HXMA 4DQRA 2YWHA 2XEXA 2F9JA 4DFKA 2RQKA 4J9PA 1MMDA 4OYPA 3MTJA 4GKKF 4DI6A 3DLBA 4ZN3A 1Z2LA 2HBQB 1IM4A 2WVBA 3M6XA 3VAKA 1UP1A 4O3OA 3AAWB 2ILYA 2W9CA 3QRQA 3AT1B 3AY0A 5SZTA 1DLOA 1N48A 4H4MB 4ZCLA 1FDBA 4HTJA 4L3KA 3LANA 1JNRB 1GMVA 2QA1A 1FERA 1K8AT 3H98A 3DXBA 3POTA 2FJEB 1URNA 2NXCA 5EWFA 2RU9A 4NCGA 2MYFA 4DV2F 2GFFA 4WXWA 2GVZA 3P49B 1QAYA 1PSDA 2W7OA 1ZETA 4KT0C 3F44A 2RAQA 3GTYX 3MR2A 3IG1B 3M1VA 1UJ6A 2DHHA 2LQ5A 2V0NA 5CA5A 4FXVA 1KNZA 3UCZP 1TR0A 2VBYA 4IR1A 2IMOA 4IRCA 1SH2A 2MXYA 4PXCA 4DU7A 3Q0AA 2J9EA 2E1RA 2H1YA 1RTJB 1Q8KA 3BDPA 4KTQA 3Q8QB 3UDCA 5KG7A 1ZAWA 4DF4A 4HT5A 3V4IB 2P5VA 2CA9A 2ZOGA 2K06A 2B43A 1RT3B 4JI3F 1H2UX 1RTDB 3LP2B 5LSOA 5ETSA 4QWCA 4WE1B 3JSMB 5J2PA 1FI4A 2BE7D 3E01B 1VC0A 3MECA 3MPVA 1QY7A 3EVMA 1VC5A 2E66A 1T05A 3MGJA 3TYTA 3KLFB 1RT4A 3D0GE 2YNIA 1MN9A 1FWPA 2FC9A 1E6YA 5DJBA 2AF6A 1QSYA 1GK8A 2HZVA 4U9RA 1RACB 2ZOFA 4M5MA 5IFMA 1Q1KA 1NRKA 1L3TA 3NKYA 3J80Y 4CLSA 3NXZA 1KTVA 3CJKA 4IH5A 2R7RA 1FHTA 1ZZFA 1VRTB 1U24A 4DV7J 1KS2A 2V6AA 3I87A 4OI3A 2PMHA 1RZMA 3NP5A 3DLLQ 4PR6A 3OL6A 1WSVA 3P8BB 4DR5F 1B3TA 3PRDA 4NZ7A 3UW1A 4GO5X 1JLFB 1M90T 1FE4A 2P8IA 1F3VA 2ZKTA 4ER8A 3EZUA 2QLWA 2ZHAA 2BE2A 3FCVA 3KK3A 2BUNA 4C8YA 5GAEU 2GHWA 3DRPB 1G4CA 1NJXA 1R0AA 3M6VA 1Y0HA 2GQQA 2NPFA 5E3RA 1CULB 3AD8C 4USVA 4O4GB 4DR1J 2JLFA 3UVJA 3H4BA 5KT2A 2KRRA 3TJAA 3MURP 3G87A 2CQ1A 1JWWA 2F8HA 3DLEA 1S6QB 1T3NA 2DHAA 3DM2A 2LQ9A 5DG7A 1ZTTA 1JXVA 2CQIA 2V50A 5ETTA 4C48A 4JI4J 1FWKA 2MGZA 3M8RA 1CBKA 2AV5A 2XMJA 2JEJA 2YNFA 4DBQA 2XCPA 2G0IA 2C2MB 3CIMA 3SSRA 1URRA 1C1CA 2C3OA 1JLGB 2IBKA 3QT5A 5E5NA 1CS4B 3MM5A 2CPIA 4RW4A 3PDNA 3P4UB 5KT6A 3CF5Q 2FJWA 2XBPA 3D1QA 3TA0A 4ZLJA 3L7OA 1LWXA 5F9LA 2WW8A 3PFEA 4F0KA 2KHDA 2YXLA 3DRSB 4DPXA 1C4CA 3GIRA 3RBEA 2KDOA 1VS3A 2B9XA 2LP4A 3HF5A 4ITSA 2BACA 2Y9HA 3W66A 1G7CB 1HNIA 3GMGA 1SJ3P 4J37A 4OYOA 3DLKA 3N6NA 4DL7A 2V8HA 2GAHC 3M2VA 2RQMA 3BDEA 2MKYA 5F9NA 5HMYA 1WC1A 3QMQA 4J5OA 4MIBA 3W3SA 1U1RA 1I5OB 4NLTA 3IN5A 3QRRA 4M5KA 3DGVA 1TZ0A 3SMZA 2HIQA 5HQLA 2YX1A 5M2PA 2KXHA 2M0GB 2MQPA 2OPPB 2C1EB 1KQGB 4UOCA 5G0RA 4ECSA 1GXLA 1X5TA 2VQFJ 2DYAA 1BD6A 3MUMP 1NU4A 2UXBF 3RB3A 1GH8A 3A4TA 3K5LA 5E41A 4NASA 4J9LA 2X7IA 1WACA 2HHSA 3FMWA 3MAAB 4U6PA 4DX6A 2PEHA 1HBUA 3EM1A 3KLIA 3DDIA 1R8HA 4DU8A 2VL1A 1JJ4A 4OHVA 4J91A 2E5LJ 4GVBA 5IC4B 3G4SS 4PXBA 3PO4A 1PG5B 3NBPB 1S4EA 1RWUA 2GO8A 3MMBA 3ZZRA 1JJHA 1HWJA 4JP8A 1RSCA 2W24A 3PYEA 4ZHRB 3PW7A 3K8WA 1S0MA 4Y28C 4KH0B 4RLEA 4DOZA 4RJVA 3H8YA 5HMXA 2OI2A 3PV8A 1M5PC 1BWVA 3QO9B 3T6JA 1K0TA 2U2FA 2YNGB 5IWAF 1FO1A 3MD1A 1S1XB 2VKRA 1ZZNA 4QWDA 1YGYA 2UXDJ 1HI8A 4UF4A 3ZFVA 2XY7A 1ZA1B 5BR8J 2Z2YB 3OR2B 4I6YA 3PR5B 2VASA 3CCSS 3K58A 3CMAS 4HH1A 2FHMA 2DRDA 2J6UA 4DL5A 4AQYJ 3ULHA 3CJ3A 2HBRB 3GYXB 2OAUA 5HSPA 1VC6A 1U1NA 1R0BG 2L3MA 4K4ZA 1Q4RA 4YB5A 5B0GA 4FKYA 1H7XA 1N0VC 4IRDA 2XTJP 1TL5A 4RWXA 2OPSA 4TY9A 4LIWA 5I4MA 5CYQA 2NS1B 4JV0A 4KKOA 2UUWA 1IBMF 5A8WA 1NSQA 3TZYA 2FY1A 1HA1A 3CD6S 1IWGA 2YKQA 1RXOB 2DITA 5KFHA 1CJVA 2K8GA 3D54A 5A76A 2ZH5A 1TAUA 3TRGA 4A8YA 4OJGA 1HKAA 3DHXA 4WYLA 2E5HA 2FVQA 2WTFA 4Y65A 3KUEA 2GA7A 2LECA 4ICLA 1UA1A 1X8DA 3T1YJ 3X1LB 2D41A 1R6VA 2W4PA 1SKSA 4C2MA 1HNWJ 5CABA 4WF9Q 1CC8A 1X60A 1I3OB 2ATCB 3OXLA 2GJIA 4DL2A 2KJWA 4LF7J 4ANCA 2W2QP 2CUYA 3Q8YA 2UUTA 3KLVA 3X3UA 5KFOA 3N4WA 2F1FA 1VLYA 2V67A 3UN3A 4Z7YA 2NPIA 4NA1A 1M5VC 2RMLA 4ES2A 4ENOA 1Q95G 5ETPA 1YBTA 2KT3A 2W9CB 1NSAA 3WZ0A 2CPDA 2CJYB 1UWBA 2B9YA 4X4OA 4JI7F 1DLOB 2AX0A 1FRLA 2I5JA 2YWFA 1LOUA 1FFGB 1SJ1A 4I68A 4ZCMA 3FCHA 1JXLA 4Y3CA 1DAXA 3N6LA 3TAPA 4FS2A 1SKUB 4FNIA 5A0YA 3DLHA 3POTB 1UVLA 2YKAA 4NCGB 4A8QA 3SIPB 2GVZB 5D3GA 3N9UC 1F5AA 2E7VA 1FRJA 4DV6J 3SSQA 2OSRA 3M9MB 1FTRA 3GONA 1WDTA 4IFVA 3P45B 2G0CA 2WCXA 1RQ0A 4CO0A 2CNKB 1RBLA 2AT1B 4DEZA 1T7PA 1NPPA 1YLXA 4I64A 3MCSA 4LR8A 3EWGA 4J9UE 1FKAF 4B3OB 1SQGA 3GYNA 4XPCA 4JI1F 2EBGA 1FKOB 3D0HE 3ZZTA 3TO8A 2OTJS 3HPOA 4PWWA 3MEGA 1FT8A 2V4RA 1RLCL 3T5HA 3VWSA 3HSZA 4OZ0A 4NXMF 3OSPA 2F4FA 4OI0A 5K8PA 3TJ9A 4NZ0A 3CCLS 5KT5A 2HGNA 2L9WA 1HQEA 3QRPA 1JLAA 2VFRA 1PYOB 5J2PB 2B4OA 2FLOA 1UW4A 5E3CA 2Y0SD 5G4DA 3H25A 2LXUA 1KLNA 2GMLA 1LK5A 3DRXA 1RP5A 2VH7A 2CZVC 4NLUA 3R27A 5FLXY 5LMNF 2YNIB 3PRVA 1G2EA 3MOJB 1X0FA 1VQMS 3OFEA 1ZA2B 3M8PA 1YK9A 2KFNA 2FGOA 3T1HJ 1J5EF 1WC0A 1IR0A 1G6BA 5KFIA 4F26A 1WOSA 2V69A 4DUZF 1VR6A 3C14A 3VAMA 3A3OB 2DR7A 5ETNA 3CXCR 3BQ2A 3V81A 1KWMA 4JUZA 3DLGA 2OEMA 2P2CB 1AFJA 2BE2B 2ZH1A 1FNOA 3NS5A 3U7JA 1N5QA 2HKEA 3MR3A 3NGRA 2BEFA 1R0AB 2CVIA 2IRXA 3W8PA 2RH3A 3ZNJ1 2KTQA 4DL4A 3SV4A 4HKQA 2GNKA 3CPWR 4ZVOB 5CQGA 4K4WA 1TU0B 4RPFA 3R5AA 4J9KA 4KY3A 1NKBA 5D6GA 4YY3F 3ET6B 3KLEA 2XULA 3ISNC 4B3MF 3UQSA 3Q24A 4JI0F 4RU2A 1T9YA 2MGZB 3OV7A 3F0NA 2R2UA 1UFKA 2EXUA 2C2RA 4ZJQA 2OTLS 2BBEA 3GU0A 1QE1A 3G82A 5D4OA 1I94F 4IQXA 1HBNB 1C1CB 1X7VA 3RBZA 2V2QA 3MM5B 3OUYA 4DSKA 4LBPA 4OZLA 2EFGA 5AXLA 5C25A 3G86A 3BKTA 2XWYA 1D8ZA 3NMRA 1H74A 5JMNA 5F8LA 1EB0A 1NBEB 4CT9A 3G2XA 2RF2B 1FK9A 3W9HA 2EFNA 3HK2A 1S0VA 1HNIB 1XMOJ 3PX4A 4CO3A 2DD8S 3DLKB 2QSFA 3VGTA 2BDPA 3BSAA 3M2VB 2FVPA 2ASDA 3GLJA 4J9VA 4LMZA 3RAXA 2QGFB 3UDVA 3EGWB 4I2PB 2C3YA 4F4XA 1O5JA 3W2VA 2FGCA 3CCQS 4C0HA 5EN1A 1WKJA 1JIHA 4ZPAA 1QLNA 5C42A 2C3UA 3PVXA 5G0RB 4JV2A 3K5PA 4F0MA 5JVHQ 3FUYA 2MY8A 3A12A 3VAIA 4DN0A 3ILLA 2DIVA 2AGPA 2XCAA 1FRMA 2GIQA 1HYSB 2VFTA 1TAQA 2RRBA 4MT1A 1JKHA 4ZVSB 2XB2D 3EMTA 2ZHBA 1RHJB 3KLIB 1X4DA 1ZOTA 3QQCD 1BLUA 4PCQA 2BOAA 3J7ZT 3IC1A 5KT4A 3KG1A 4LREA 5FIIA 4EU0A 5FDLA 3MMBB 3GFHA 4TY8B 2N7YA 2EBEA 4LFBJ 3P5TL 1I1GA 4IFYA 4KSEB 5I3PA 1WJ9A 4DV5J 1FX4A 4J90A 1VFJA 5KG5A 4JI2F 3D2WA 4FBUA 1RWNB 2MKSA 3CSKA 3GG0A 5HAOA 4PABA 3VV2B 3F41A 3QNWB 2JL9A 1S7IA 2VV5A 4ALZA 3IBCB 4EYHB 1KQFB 4I69A 3M9NB 3NNAA 2XY5A 3QT6A 5AT1B 4EFAC 3ILOA 4OZ1A 3H59A 2IA6A 5LJ3Y 1HD0A 4M5GA 1MSWD 1UKUA 4KHMA 2R2SA 3PX0A 4IG3B 2W2NP 2F65A 2L08A 4RW6A 2JLEA 1X9WA 3HDSA 3TUIC 3RG6A 3DDNA 3MPWA 5E2QA 1NJZA 4RW9B 4NCAA 3CCUS 4IOAQ 2QEXS 2ZBCA 2JFDA 4OI2A 4W92B 3GP9A 2XY6A 3J7Z5 4M1KA 4QR2A 1OSDA 3H40A 1HBOB 4K2XA 4MKBA 5D0RA 2NXUA 1F9FA 1HHQA 2YQ0A 2K7KA 3RW6A 4N41A 4DDFA 5ETOA 4KKOB 4A48A 5A8WB 5C2CA 3OL9A 5J1EA 1WKKA 2AIRB 1IBKF 2LA4A 4NE9C 1FWLA 3LAKA 1W2IA 4DF8A 2V8VA 1Q7YT 4K4TA 5GMKa 3AB4B 1VQ7S 3V6JA 2CPHA 3J81Y 4G3IA 4ICLB 2HQDA 2JSXA 5F8HA 3QJPA 3K59A 1YJNS 3R8YA 7AT1B 2MTLA 4QIFA 4DCJB 2U1AA 1KONA 1DTTA 2E44A 4Q7AA 5CZXA 4DR7F 3OTOF 2PN6A 3QZ7A 4L72B 5KFRA 2ROGA 5KFMA 4ZP6A 2MMYA 3FRZA 3RU0A 2HHQA 1KN6A 1NB7A 4DV0F 3HCXA 4DSEA 1S9EA 5KFCA 4NMLA 5HLFA 5AXMA 1IBCB 1NSKL 4NYPA 1AT1B 1JLBB 3UI3A 1S99A 2DNGA 1UWBB 4UUXA 2I5JB 4ZP9A 4LF8F 4KHPF 2KYZA 5MAOA 5A0YB 1KTQA 2RDIA 1BQMB 4QQBA 1Q8LA 4CIOA 3V5RA 3IAM9 5K8OA 2ATLA 2N82B 2H5JB 1T0TV 2N4DA 1FJGJ 1PBUA 2KN4A 3WIUA 1WEZA 4G1QA 1S1TA 1CQNA 4IFVB 4RW7A 1WG4A 1X5PA 2HHVA 4XDCA 4ZCIA 1FVQA 1SUQA 2HRUA 3L7UA 5K8MA 3EJMA 4F4KA 3FEXB 3DHWC 3GIMA 2R9LA 1T9UA 3KYLA 5HANA 1LWFB 4OI1A 3MEGB 1FVSA 5C24A 3ISZA 3BR9A 4Y2KA 5K8NA 5F8JA 3I9V9 3BN7A 3FEYB 3HFZB 4MK8A 4FYDA 5KFVA 1KHWA 1HQEB 2CQPA 4DQQA 3MI7X 3V4MA 2CDQA 5F8GA 2MLXA 1RLDA 1JLAB 2JHEA 4HR2A 1IKYA 2MSTA 1JQGA 3DLJA 3OTBA 1XR6A 1RWXB 2VQEJ 1WC6A 3MF5A 1NUEA 1RAEB 5F8IA 1L3SA 2BANB 1S12A 4R8UA 2AJ4A 4DR2F 1S1WA 1TV6A 4ZMMA 2M2BA 2MKKA 4OHYA 1TVRA 2C3PA 2HQCA 3M8PB 1QSLA 1SV5B 4DV7F 4DLGA 3NCQA 4KH1B 1Y00A 4XK8C 2DT9A 3KXDA 9ATCB 3PYDA 1TUWA 3CE8A 3CJRA 1UEKA 3C3LA 3ETMA 1VK8A 3MTKA 1RT1A 1XK8A 2I6WA 3KOAA 3V81B 1UEUA 1U1PA 1NK0A 4CLTA 4W90B 3QAEA 4DLEA 1IR1A 2KHCA 1R0CB 3R5GA 2OPQB 1U09A 2YNHA 3SYZA 2G13A 1R27B 4NA3A 3H42A 1NK5A 4YEAA 3CCMS 5J2NA 2HPUA 3V2UC 3H7HB 3CCVS 1D0EA 4ZKAA 2MSSA 4JI4F 2MY7A 3KLEB 2G0JA 1M0SA 3HZEA 1LWCA 1BWEA 2Q6BA 1JMTA 2PE8A 3NGUA 3H4DA 1IKXA 5A8KA 3Q8VA 2BJ1A 3KLGA 5IQ6A 2Z4PA 3KNAA 1LQ9A 1N88A 2ZH3A 4ECYA 2MHEA 3HD1A 2VZ9A 4YHHF 3G82B 3TANA 3S7RA 2YKPA 3CNQP 5ETQA 1SVDA 2N3OA 4JI5J 2D69A 2HS4A 1FRIA 4O3NA 2RDDA 3OUYB 2ZM6F 4NLGA 4UZCA 4PQUA 5C25B 4FXWA 4FF2A 4BWMA 3NGSA 4ZPTR 3KJVA 5D0EA 1RT7B 3B8HA 3H2UB 2VC1A 4ERDA 3BO4A 2M7SA 4U7UK 1F9HA 2R42A 2B8PA 3TA2A 2ZC4A 1WHYA 4CYUA 3KMQA 2CPJA 3CTRA 5A8RB 1X4HA 3PRBA 1UW9A 4CH7A 2XS7A 2B6AA 1VJQA 3I82A 4OI6A 2XYHB 5J1PA 2R7VA 4MYUA 3WHIA 1HLWA 2RJZA 4M5NA 4EUVA 4P6QA 1VHFA 2VBZA 1RWWB 4ECVA 5IM0A 3FQKA 1VQPS 3HVWA 4L73A 2P9GA 4YN3B 2RSQA 2PGCA 3BREA 3M6UA 1T11A 4C8NA 4K8RA 8ATCB 4XO0A 3Q8UA 5E33A 3DDKA 1K44A 3O5TB 5HVHA 1YJRA 2IDEA 5GAHI 2NYIA 3DN9A 2J0QD 4EK2A 1BQNA 3MOZA 2MZJA 4ZPDA 4QW9A 2JEGA 1EARA 5A2QY 4B17A 2BM0A 4CLYA 2VG5A 4ZP7A 4K4XA 5B0AA 1WF2A 4DV4F 5L38A 2DNPA 3KKFA 4BBYA 1D3WA 4EEYA 4PG7A 4KPCA 5A6WA 5FDLB 3M4XA 3MM8B 4EI2A 3SXLA 2V4JA 1CC7A 3NNCA 4IFYB 1BMQB 2Y1IA 1CEZA 4PPDA 3KHHA 5H9EK 3I0RB 3PW4A 2P6TA 4U95A 3R7NB 2YQ1A 4DV1J 2D3ZA 2J0XA 2IRYA 4WP8A 2J8AA 2HWHA 2LMIA 2O67A 3QIPA 4DCOB 3BF4A 1Q78A 3T5JA 4PPZA 4AFFA 2Y1RI 1RWMB 3KHGA 1N6QB 5BR8F 2UXCF 4QIGA 1TL1A 2CVEA 4DUYJ 1GMWA 5F8MA 5HL7Q 4B3SF 4XTTA 2DO0A 2UVRA 4RW6B 3CJ4A 1VOMA 3HHLB 4JI8F 2V68A 3W63A 2G2ZA 1WOPA 2XSFA 3T41A 3TAQA 2BJ8A 3T5LA 3CB4A 3CDEA 2WVDA 4EBDA 2FJBB 3FSXA 4X4QA 1Y11A 2CIMA 1N34J 2ZH8A 3MR6A 1YRXA 3T19A 4WZMA 4X65J 4ZPBA 4LF9F 4C3KA 2XC9A 4NLOA 2BKOA 4LSLA 2YKMA 1QAXA 3W65A 3G6VA 3C16A 4DPYA 2HVEA 3D5MA 1B0TA 2V2KA 2E5IA 3FDSA 4H4KA 1OPZA 2X51A 3BGRA 4ZK7M 4HI2A 4F2SA 1APSA 2O3DA 4S0MA 4GRSA 4U8VA 1N33J 2B3TB 2GZOA 7FDRA 1DTTB 2AP6A 2JLGA 1WHWA 3CEDA 3QZ8A 1VHIA 5GAEI 2GVDA 2VFSA 5D0GA 2A6MA 1H3DA 4MAKA 3HI9A 3N01A 2V8PA 1N32J 1S9EB 5HLFB 4IO1A 2CKWA 2FJAB 1NDKA 2DGSA 4CLZA 3ZC4A 5HMZA 3TVKA 2F4VJ 2YWEA 2HAFA 2M52A 3TNVA 3JYTB 2IC3A 2HGMA 4FYXB 2AGOA 4RZRA 1RT2A 3KJFB 4LVNP 5L1JA 3QSYB 1U2CA 1WHXA 2QSWA 5C5JA 2JZ5A 1T94A 5CZVA 4QWBA 2FJDB 4DV6F 3RGIA 4E8UA 2QMXA 3AD7C 4J9OA 3PXGa 3D6HB 5M2RA 3IGVA 3DOKB 3WIVA 5IQQA 1OWXA 3KHRA 2V94A 3HSDA 2ZFHA 3LPEA 3OJUA 2FVRA 2J5AA 2OLWA 2CWKA 5KAKA 2LEPA 4X4PA 3D67A 1TP7A 4LSNA 3BSOA 2W2OP 1CJKA 3PO5A 2Z2LA 1Y5IB 2QL9B 4CLFA 1RKIA 4DXLA 5C24B 3N0VA 5B09A 3AODA 3LGMA 3KWMA 2GW8A 2DNLA 3L3CA 2JC1A 5B0DA 4MFBB 1KFSA 3RW7A 2M5YA 3GILA 3P6YC 3D1HA 3ZXWA 3Q8SB 5CD4A 3UDEA 5KG6A 2DJWA 2W2PP 1XJWB 2GMJA 2KFZA 1KEKA 2XZWA 2AZ1A 4ED6A 2LQ8A 2N4CA 2X1AA 4U67Q 2PA8D 4H4MA 4C6AA 1LKZA 4OV1A 2C2EA 4IO9Q 4R8UB 2XMWA 5SUHA 2DEIA 1S1WB 1D9FA 4R0JA 1TV6B 4N7TA 2PC6A 1NLKL 1TVRB 2GJFA 4PXEA 1IUJA 1GTEA 2WBMA 4DX8H 2C2DA 5KFEA 3LH2S 4X64F 3CD7A 3BM7A 4PKDB 2D74B 1FX2A 3H5YA 3PIOQ 1TMMA 5KFFA 1YJ7A 4YQWA 2HVZA 2QLXA 5D15A 2KM8C 4UUWA 1RT1B 1DQAA 2ZE2A 4FVMA 1S1VA 4NXNF 2DNHA 3HM9A 2DNOA 4LQ3A 5M2UA 3EGVA 1YDLA 2YNHB 1HNXF 1RTJA 2VONA 1SXLA 4RUAA 3N5FA 4C9DA 2FLPA 3N79A 2FVCA 3S6EA 3KLHB 2MQLA 3LGNA 5J2NB 5FJ4A 1IQTA 3V4IA 4A8FA 1U49A 1RT3A 2G1DA 1W7WA 3HULA 4O0NA 4RR5A 1RA6A 3QATA 4WK1A 4CQ1A 3R1LA 3PKMA 4WE1A 3JSMA 2GQ2A 3MMCA 4ZVTB 5A8KB 3BSCA 3KLGB 2XLJA 3G8TA 4HTIA 1HR0J 3HFKA 2HHWA 1RAAB 3KLFA 2RHSB 1MU2B 4IYQA 4OYWA 3C46A 1K0VA 3QLHA 4CZCA 4E98A 2B8QA 1JXEA 4YFUA 5HROA 4RUBA 3GZ7A 1ELOA 1ZPVA 4LFAJ 2ZWOA 5F41A 1JLCB 1CQMA 4DR3F 1FXRA 2ZJQQ 2B5JB 2UZAA 4IOBA 1IVZA 4DQPA 1V6HA 1NMEB 2ACMA 1WORA 1V9OA 4EBEA 5DQHA 1N5SA 3U1NA 5HN0A 2LDYA 4MJKA 2B6AB 1LW2A 3DRPA 4CLUA 3DOLA 4J9MA 2QYCA 4B9MA 4RUHA 4LIRA 1CULA 1P1TA 4O4GA 1N36J 3DRRA 4RNNA 1DTQA 4KO0A 2QA4S 3LP1B 1RT5B 1U1OA 4NLWA 5IM0B 1SC1B 2FHKA 4NLYA 1U8SA 4USJC 4WTOB 4DCPB 5KTQA 2RNEA 3K5MA 4NX9A 1DJ0A 4DR4J 2NXEA 4DPUA 3BBFA 4LFCJ 2Y8YA 3HVAA 2HK3A 2BV3A 1KRPA 2CPYA 4ZA1A 3JSRA 3MPUB 1BQNB 2EK1A 4FN5A 3IWXA 1CS4A 5KFNA 4Z2XA 2IVYA 4B9UA 4OYMA 2VFUA 3ZNUA 4C7QA 1JJCB 4CO1A 3IGNA 1K1SA 4BC7A 2B0GA 4TLRA 2CNLB 4URGA 1Y7PA 2E9ZA 2FQQB 2V4JB 4ID8A 4ZN1A 1UVNA 2FZKB 4OLOA 1KFDA 2KJVA 3CC4S 1VQ4S 3BQ1A 1WC4A 2RRAA 3E51A 1TKXB 3FQLA 4LQ9A 2EFVA 5DZ7A 4KFBA 4YB1P 3M2UA 4K7QA 1VRUA 4C11A 1N5YB 2ASJA 1VQKS 3IAS9 4LF5J 5DDOC 2XSJA 2BJDA 4MYTA 1XNQJ 2W2MP 3GJQB 1VGYA 1WG1A 2R3VA 3Q83A 3ITHA 2W7AA 3F56A 3EICA 4FPRA 4KC5A 2E1MC 2E7WA 5ITHA 2UU9J 4KB7A 3C19A 3TAMB 3CJ5A 1UA0A 4J9SA 5H9FK 3LWLA 1DHMA 4ZVPB 1CJUB 4RX6A 4KV8B 3VZIA 2GGPB 4Y00A 4A8MP 3I6PA 2CDRB 2RE1A 1N8RT 4NL5A 2HNYB 4CLWA 2ERRA 2HYIB 2DPJA 1IKWA 4WWSA 3D3CJ 2ALYB 2MKHA 3CO0P 1U7LA 4Q44A 2NZ4A 4GKKJ 3NBPA 3I96A 2HS3A 3MEDA 5KT7A 4LR9A 4RO0A 4ES3A 4ZHRA 3G9CA 3TUPA 3EZ5A 3HHDA 1U2FA 2UUCF 1XWLA 4LSLB 3B82A 3VGVA 1ZAXA 2YKMB 5T7LB 2DNKA 2WRMA 3GJRB 3GJTB 2NQPA 1S6OA 1EP4B 2VA2A 3HJFA 4ZVGA 3D7SB 3BGRB 1S77D 4X66F 1Q86T 1NDCA 2FPHX 4PYDA 4JV5F 2YNGA 5BYQA 2YX4A 4RBTA 4DV2J 5L9XA 4V19X 3HHLC 3QSIA 1EJ7L 1PKUA 4EZ6A 1RGVA 5BJRA 3OR2A 4YS2A 4TXSA 3JTNA 3P96A 4I67A 2GVDB 4MKAA 2ZHOA 4I1TA 3TW0A 1HQUA 2DR9A 1AUSL 5CCLA 3D6MB 2AJ1A 2RHQB 5E3PA 1QDUB 3PTWA 4F2RA 2L9DA 2KZZA 1CSJA 3OQ2A 1YBUA 4WZQA 3R5BA 1H2VZ 4LF6F 1T3OA 4QWEA 2WHOA 1VCTA 4K4SA 4JI3J 2FIUA 3SBMA 2IC3B 1XNRF 3H2LA 4JOUA 2CPXA 2IA0A 1VDHA 2YKOA 4LT6A 2OFGX 5KFSA 1B99A 3D6FB 4C8LA 3IBFB 2ZH4A 3QFHA 1YJVA 5BYRA 1M5SA 4OX9F 2OD4A 2UP1A 2BYCA 4ID5B 5K9FA 4P52A 2DXDA 1S76D 3GYGA 3VCDA 3HX9A 1T9WA 4ZPWR 3UD5A 4OYAA 3KG0A 4OZJA 3IO1A 1IQZA 1VQ6S 2QL7B 3ADAC 2ZBPA 4ED7A 2DO4A 5GAHU 4LSNB 1OYDA 4DR5J 4IRKA 4B08A 5T41A 2KXNB 4GKJF 4PQAA 2IM0A 4QYZK 3IS9A 2J9CA 1Y4ZB 3I31A 4TN2A 4QBUA 2CNNB 1RU2A 3D9BA 4G6VB 2R7UA 3PEJA 3OL8A 1U25A 2YKNA 3PR4A 2AEMA 5L1KA 3KJNB 4B3TJ 1U45A 3VVUA 4TQRA 2NLWA 3MDFA 5IXUA 2MEWA 2GAGC 1NKCA 4RWWA 1XQIA 4NA2A 1GMUA 2BJ3A 1NH7A 2KO1A 3OHBA 3SQGA 4CDIA 3S1TA 3KK1A 2H54B 1CLFA 4PWDA 1SL2A 3IWNC 2A6OA 3PNIA 1TMJA 2LLZA 1SB6A 4G1PA 1NH8A 1PJ7A 1X4CA 2DISA 2XMKA 4N8NA 2W9BB 4OYZA 4M95A 4PG8A 1VQ9S 2XO6A 1LK7A 2CNOB 5D8HB 1GX6A 2P9CA 2HHHJ 2QZ8A 4KYZA 2ZE2B 1TFWA 1S9GB 1S1VB 4G65A 3ZO7A 2B56A 1YJ9S 3RBXA 2CADA 3NG8A 4B3OA 3K0JA 3H5XA 1D8YA 2PMWA 3CW2C 1J5OB 1FKOA 3MM6A 1C0TA 2MZ1A 1GT8A 1KLMB 5CYMA 1ZM3A 3DU6A 2LXFA 5LT5A 2ZDOA 2CJKA 4MK9A 4X4RA 3GV7B 1FDNA 5LSLA 2E29A 3MUVP 3IR5B 2VA3A 4MIWA 5EHHA 1F0XA 2IAJA 2YWWA 2FDNA 1Q79A 5DGBA 3MMCB 4Y2AA 2PDAA 1NHVA 4LF4F 2KYXA 4Y2IA 3FRYA 1FKPB 2UXBJ 2HWTA 1Q8IA 4UW2A 4K4UA 3OFHA 3QLHB 2K3IA 5ADZA 5KFBA 4O3RA 5KFYA 5HROB 3C8YA 4USUA 5EWGA 2LQJA 4ZITA 4M5IA 1RWOB 3PHTA 1RHUB 4WBFA 2E7XA 3B78A 2DGVA 1Y5NB 5GADU 4ZCKA 4K0KF 1VBXA 1M1GA 1LW2B 3DOLB 1XMQJ 1D9DA 3GSDA 1SI9A 3US5A 4RNFA 4OX7A 3ZZPA 3DRRB 3T3FA 1DTQB 4KO0B 4GC6A 3FNNA 4U7UD 3MHYA 3ET6A 3FBEA 2AMCB 2HQ3A 3PG9A 3D28A 5IWAJ 3NY0A 4JI6F 3I5BA 3OR1B 3VR1A 3TOQA 2DGUA 2XQCA 4FNHA 3NMAA 1DQ9A 1AA1B 1LNQA 4FS1A 1RU1A 5C2GA 3TI0A 4DV3F 4KAIA 1HBNA 2F3JA 4TYAA 2XLIA 5IS2A 3FBFA 2ZNZA 4QU6A 1XEZA 1RABB 3TA1A 4MKYA 4WIQA 4OJ1A 3GFXA 4FF4A 4IQMA 3T1AA 4X4VA 3RRKA 4NLXA 1WHVA 1M1HA 1LWEA 1RYSA 1MWQA 2LDIA 1NKEA 3C66A 3KNGA 3BYRA 2RF2A 3BS9A 3KK2B 5DLGA 2KRBA 2MDAA 4TVAB 4F0HA 3TWZA 4DPWA 4UQTA 2MZSA 2EEYA 1WUUA 1ZH5A 2EWHA 4O3PA 4ZVQB 4I2PA 3GV8B 3WDOA 4KFBB 5DDRC 3EE3A 1E6VA 3M2UB 1VRUB 4C11B 2APOA 4O0IA 4ZP8A 4Y2CA 3RRGA 4NLDA 4MMOA 2XSJB 1IBMJ 3ZTQA 3EVWA 2F63A 1U1QA 2C3MA 4QYRA 2R8HA 1FNXH 1DZ5A 3FZ2A 3IM8A 5HATA 3GPAA 3ITHB 2DY9A 1Q7LB 4ED3A 4DQSA 3J7YU 2VU5A 2DH8A 4B02A 4F36A 1YHQS 3LO3A 1WG5A 3W8GA 3UCGA 3K7RA 2L48A 3TX8A 2Z30B 5E0OA 5DDQC 3BBBA 4UT4A 2IVFB 2KL8A 1HYSA 1HMVB 1HQ2A 4USKA 3I0SA 4EWTA 4A46A 2BA9A 1YKWA 1R6YA 2VBWA 2XNRA 2DCLA 4P73A 2DNNA 5DG8A 1IKWB 5JUMA 4USHA 2MQMA 2DTJA 1XN9A 2LQBA 5LMUF 2JH3A 1NJYA 3FBBA 3MEDB 3CDWA 4TY8A 1X31C 1FEHA 3M05A 4WYWA 4DPTA 2OPRB 4C98A 1UL3A 3E2EA 3NNHA 5F8NA 3OL7A 2ASYA 1VLOA 5KFAA 4JI7J 2RKIB 1MNEA 1WWHA 1RTHA 1M5HA 1X4BA 1C1BA 1FD2A 3J81U 2BQUA 1DQ8A 2I9SA 1OO0B 4TU7A 4PG5A 4J7CA 4U7CA 1XIQA 1H73A 3GCWP 2MLYA 2DNYA 5J2MA 1U26A 1OQ6A 2MJNA 1FESA 2GS8A 1WOOA 1VIOA 2FTRA 4NRTA 4E0DA 1R3NA 4K59A 5AE1A 4N76A 4IG3A 4BS2A 4RU9A 1UPPA 5KG3A 2QN6B 2DHXA 3HKWA 2ZBIA 3OHAA 3PX6A 5HQ8A 3MEKA 4IDKA 3RZAA 2XMTA 1RKJA 4UOGA 1HQUB 4RW9A 2DR5A 4JI1J 1BQXA 2QTWA 5J1NA 1F6TA 1U6ZA 2CQGA 5IC6B 4X4SA 1D1UA 4NXMJ 1F3FA 2CWXA 5B0CA 1HBOA 1L3VA 4NZ6A 3W64A 3VAJA 1XR5A 1U6FA 4YP3A 4H4OB 4M63A 4H4KC 2LA6A 2QC3A 4P9SA 3F73A 4QR0A 3D1OA 3UR3C 1JJ2R 3C6UB 1UETA 5ETKA 4F4YA 3JB9k 1J27A 5LMNJ 1V3SA 2OMOA 5K5MA 4QIVA 4B9TA 3R2CJ 1QD1A 1EQ0A 3LWMA 4WIIA 4WFNQ 3ZZYA 3TVYA 4I6AA 2WB1D 4KGMA 2B4VA 2AU0A 2XLKA 3DC2A 2PFDA 3LA0A 5HP1B 3DOMA 5KFLA 1X9MA 5KFDA 1EIYB 3GFZA 1S57A 1J5EJ 1M5OC 2VJUA 3MEEA 2NXJA 4IOCQ 1TUVA 5J2QB 1ZS6A 1KVJA 4DUZJ 2HW3A 2B7BB 2Z8QA 2UUAF 3CGIA 2JNJA 1FDAA 3THPA 2GHPA 4QIWD 1FJCA 2YX7A 1KHVA 3IS9B 2C2ZB 2D3O1 4QJVA 4Q8EA 1F1BB 2AEJA 3HT0A 2BQRA 4PAAA 1N5VA 2HRYA 2YKNB 4P7TA 4Y6IA 1AFIA 2IJFA 2EC2A 1JLBA 3MM9B 3FZBA 1CJTA 4D3GA 2MZTA 5BYSA 3MMAA 1EHWA 4DN9A 3IBWA 4YY3J 4B3MJ 2M8HA 1JLQA 3SQGB 3L4BC 5AJ3F 4PUOA 1SJFA 3KK1B 4PG6A 4F3OA 3NGTA 1AUDA 4PWDB 1Q5VA 1BQMA 2ZC3A 2GO9A 2RB7A 4JYAF 3OTEA 4P72A 1I94J 3IM9A 4CLKA 2ALZA 1HNVB 1HWKA 2COLA 2EC0A 4WFZA 2VPXB 3CDUA 2KVIA 3W9IA 3A8JA 3I4HX 2BW2A 1UVMA 1NDPA 4YR3A 5AE2A 4TU9A 3HSJA 1GTHA 4UOFA 4EYIB 4Y34A 1F9EB 4N56A 2ZJPQ 3M32A 3MM6B 1C0TB 1LWFA 5DRKA 4PG4A 5CYMB 3BO2A 2OJ3A 2DKOB 2HHXA 1H98A 4X62F 3GQCA 5I3QA 3FMBA 2BRLA 3BGLA 3DXSX 3GFYA 3JS9A 1RBOB 3I32A 4YMEA 3I56S 3CCRS 4C97A 2IAJB 2WSEC 4GO7X 4QPTA 1HR0F 3BQ0A 3HT3A 4NLSA 2VOPA 2LYVA 1FXDA 4OFZA 4DG1B 2G1HA 1R89A 1S10A 2YPYA 4ZOSA 1YIJS 2BANA 1IWAA 4PRFA 1VQNS 2G4BA 3I5AA 1S9FA 2DR8A 1CPZA 3O6QA 3OTDA 5DO2A 1VI7A 5JJBA 4ECUA 4Y0FA 1SV5A 2YWKA 2LXIA 1NK7A 2HHTA 1HW8A 2H9ZA 5C7PA 4DSFA 3LOUA 2OHDA 1UEVA 3OJSA 1XERA 1Q16B 3UCUP 3JTPA 3CCES 2XMMA 2OEJA 1JLEA 1RUSA 2CPEA 3OFFA 4FPIA 3KFWX 3Q2TC 2HWIA 4DFPA 1ZYQA 2C2OB 1GAOA 4XIUA 2O01C 3UFCX 4QPXA 2OPQA 2QFJA 1HPZA 4OZ2A 3K57A 4QU7A 4NEYA 1AXQA 4I6WA 1KOOA 5DS7A 4ZVEA 4JI2J 2YTCA 4AL7A 2WVFA 5JXSA 3CCTA 4PWUA 4ANDA 4OIXA 1GEHA 4X2BA 5D4LA 2B4UA 4RBVA 3RBDA 3TZZA 2WSCC 2PMZD 3HP6A 3MFIA 1SH3A 5A2QU 3CVKA 4HACA 3VGUA 4FZVA 3HVRA 1BGXT 2CJAA 2AGQA 3HKZD 3CDAA 4DUTA 3GJSB 2QL5B 3MD3A 5HVGA 3M8QA 3RAQA 4UOHA 4Q5VA 2GV1A 2EFQA 4ZVRB 3IRXB 2MQ8A 1SCJB 2GX8A 4I7FA 4V19J 4ZLNA 4TU8A 4TKTA 4Q43A 4NLRA 1TKZA 1LWEB 1ACMB 3MM7A 1RT7A 4USMA 2DB1A 5F0WA 1HWIA 1V3RA 1F2GA 5KFXA 4V1Ak 4PXDA 4M5LA 2V4QA 4Y2MA 3I9ZA 5IZHA 4AXJA 4KR0B 3CJ8A 1U4BA 5A8RA 2MHNA 5AXKA 3KJQB 2KH9A 3TEGA 3QWUA 2D3UA 3UN5A 1RAIB 1E6VB 2AJFE 1XNQF 2DK2A 3BV8A 2Q1LA 2NUHA 5T14A 3OSNA 1BUXA 1NEEA 1RJJA 3MPYA 3QFWA 4LRCA 4ETXA 2VDHA 1IBKJ 3L95X 3VTIA 2V2VA 1K73T 1H0HB 3AXKA 2NCKL 5KFZA 1OY8A 3DMJA 3PKYA 4B9SA 3KUHA 3R7BB 5H9EJ 1TKTB 3ZTRA 1U1KA 1X4GA 4ED2A 3AQOA 1HI0P 3I0SB 2ZOMA 2DGTA 1UJ4A 3BEGB 4M5DB 1KDNA 4P75A 2A18A 4CM2A 1T9TA 2KU7A 2FD2A 5KOWA 4CTAA 3CT9A 5AE3A 1N54B 1VBZA 4OMFG 4DR7J 3OTOJ 2V9WA 4ED1A 3U27A 2MQOA 1YG0A 4O44A 4YDXA 4OJHA 4MH8A 2HFOA 2ROPA 1IM6A 3UE2A 2LFVA 3BPDA 3MM8A 4DV0J 2EG1A 1RAJA 2J76E 1NXIA 1MWZA 4Q2MA 1G3OA 4ILRA 1LXNA 2AYGA 4FVCA 2HFSA 3I55S 1WC5A 3I0RA 1P9QC 1NK8A 2AJ0A 2VG6A 4BLGA 4OJ3A 3HZGA 4LF8J 1RTHB 4KHPJ 1C1BB 4B9LA 2YQ3A 4U96A 4GVLA 5F0UA 2RD5C 4HL9A 2B9EA 4O3SA 3AOCA 1LW0A 1VQOS 3FFIB 3BZQA 2H3EB 2HBZB 4P2XA 2H4YB 4C8KA 5J2MB 3T9NA 1N6QA 2CQDA 2ZZMA 5L9NA 4TNOA 1T03A 1PCAA 2JVOA 4DSJA 3HHLA 3MMJA 2ZH9A 1TL4A 2NSCA 4IDKB 2IPOB 2Z0GA 3RRHA 2AJQA 2HFVA 3QGIA 4YOEA 2K1RA 1RE1B 3QGHA 4P2FA 3CMES 4ECWA 3MAHA 1HNZF 3R9LA 2BJEA 1QJHA 5D77A 4K5SA 1YVFA 4F4ZA 1KQKA 2DPIA 4B9VA 3H5SA 3RB4A 2M8DB 1XTZA 1N4LA 2UUBJ 1S1UB 2V9KA 3JSBA 2HNZA 5CCMA 2BXJA 2KFYA 3U02A 1RI7A 1FJEB 1SIZA 4ED5A 4Z37A 3CC7S 2LU1A 1WD6A 2Q3PA 4DR2J 1B70B 2A3JA 2XNQA 4CO4A 1SBRA 1VBKA 2Y1LB 2JJ4D 1C0UA 1W25A 1ZPWX 3DOMB 2RT3A 1S0NA 4XAKA 3THTA 1IBLF 2MKIA 4URQU 4B3RF 2ZJRQ 3W5ZA 1RT6B 3GR0A 3MEEB 3NWRA 2B51A 4BWJA 3R97A 2EI5A 2IRUA 1NAQA 2HLUA 4HDGA 3CD5A 3TARA 2FY8A 2C42A 3HHLD 1QVFR 4C4WA 3SFGA 1NJIT 2ZH2A 2C22A 4B3TF 2X3GA 3OBIA 5HMWA 3IR6B 2UVWA 5IV3A 3MCNA 3LW5C 2R7TA 5DM6Q 2G9OA 2BKPA 4IUFA 5CHCB 1CJTB 3R2DJ 3WC2A 3KTQA 4AD6A 3PJWA 3W5YA 4K2JA 3MMAB 4I56A 1TK0A 3JYTA 4OI4A 1CVJA 1NHUA 4LVOP 1PILA 4DX5A 2DXEA 1JLQB 4TYBA 4PUOB 2BOPA 2VG7B 4DFJA 3BYPA 1S49A 3DYAB 4ILMA 3J7AN 3A3PB 4HLBA 1U1LA 4YHHJ 1RAHB 1NHKL 3B54A 1X4EA 4UZBA 3M8YA 2HHHF 2WBRA 4USWA 3M8ZA 3DOKA 2ZM6J 3Q22A 1OMSA 2D9PA 3JXOA 3O1LA 1NNDA 1IN0A 3UNGC 1O8BA 3C15A 3D3BJ 3HVTB 3ZZZA 5CAAA 1B0PA 3LAMA 1C2PA 3M32B 2VICA 3KG4A 4BDPA 1R31A 3W9JA 1FFSB 5ETMA 4C0OC 4QIEA 2XI3A 3CJQA 3HJVA 4NYOA 3QT8A 1Y10A 2XO7A 4MFBA 1UTAA 4FP9A 2UV8A 3HHEA 3CULA 3SCIE 4L76A 4DPOA 2M4MA 5LM7E 5IT4A 5EUHA 3S8SA 2V5HG 1RBAA 3ENWA 4G1IA 4NI2A 2R8JA 2WOMA 1VBYA 1AB8A 1R8PA 1GQEA 5B7WA 3RTVA 2HVDA 4HT7A 3EGNA 5K20B 2EKNA 3EXYA 2DNQA 2DY1A 5I42B 1Q53A 5GAGI 3ETOA 1ICEB 1WDDA 2ZEJA 2VBXA 2DH7A 3SCJE 1EZZB 4CWBA 3AB2B 4WFAQ 4DMZA 1VYAA 1JLEB 3IWLA 5D4NA 1OS5A 4ECQA 4PYAA 4DV4J 4J9QA 1OY9A 4GC7A 3C6TA 4DZDA 2DRAA 1EQMA 2O5DA 1XMQF 1HPZB 2SXLA 6AT1B 3WX8A 9RUBA 2VIHA 4Q8FA 4DR1F 2HGLA 3KLHA 1ZBTA 3PEHA 2HQIA 4ECTA 3PZPA 4KHRA 5LL6d 3A13A 3QWPA 1TL3B 2HLTA 2QJ3A 3TZWA 1TFYA 3GSIA 3CJTA 2IM2A 2MPUA 2QLJB 4CCHA 2W4CA 2XHCA 3NL0A 2WONB 3H20A 2C2NA 1VQSA 1WELA 4HACB 2HMIA 1SPBP 4K4YA 2UXCJ 1PO6A 1MU2A 1X4FA 4ILLA 4A47A 2IJNA 3K8VA 5L8RC 4HEA9 3M8QB 2H5EA 1VQ5S 4B3SJ 5THWA 3TUZC 4LRBA 4JI8J 2X1BA 1IR2A 4I7FB 4QWAA 4LF2A 3M9OB 2HEKA 4N8OA 1TKZB 2IY5B 4ZIWA 1JLCA 2QIFA 3UO0A 3DNCA 3MM7B 1Q82T 2FJXA 1PC5A 2B5JA 3NOCA 1EETA 3OD2A 4HHJA 5KG0A 5IT9Y 2RQ4A 7FD1A 1ZM2A 2BE9B 3VAHA 3EZOA 1TL7B 2HFUA 3HO1A 2DGOA 4HI1A 1D9AA 3L7PA 3T9ZA 2HHUA 4B9NA 4LF9J 2DNZA 3BB5A 3PHEA 3DI6A 3GE9A 1X5OA 1N52B 2Q79A 3UN2A 1KSPA 2A2CA 2CAJA 3LP1A 1IJFB 1RT5A 2VQFF 3MCMA 4HH0A 1H2TZ 3UNYA 4C3MA 3BBCA 5B0BA 3OLBA 1Y3KA 2JDJA 3DMJB 3SV3A 3DGPA 3M2RA 4OZ3A 3TR5A 2X1GA 4OX8A 3NAIA 3THVA 2ZUAA 1JB0C 3Q89A 4R5PA 1WI8A 4ETZA 1TK8A 4RKUC 2GCFA 1SQFA 2R7WA 5D78A 1GFWB 2PSZA 4ZVHA 4CTAB 2XM3A 2E5LF 4EZ9A 2Y8WA 2IJRA 2Q66A 3AFGA 5F3TA 4O44B 1S6UA 1B7FA 2QLBB 1B7YB 2AKWB 3JQMA 4CH1A 4LR7A 4ZIVA 4DQIA 2VUGA 5KFWA 1J2VA 1LEOA 1UVJA 3W1YC 5H9FJ 1REGX 2GJ2A 3TUJC 1OJ4A 2VOOA 1S97A 5KG4A 4P74A 1NM2A 1RHRB 2VG6B 5D0HA 1TKXA 1GXTA 2MZQA 1AZSA 2QX0A 5CYJA 1R8CA 3MUTP 1RTZA 2Z58B 2X1FA 3CIZA 1RHMB 2MQNA 1N5YA 1LW0B 1D09B 2H48B 2DCUB 2UXDF 1WF0A 3M1VB 2E5JA 4D3HA 3K89A 5L39A 2OP5A 2CG8A 1XR7A 1MMNA 4Q2LA 1S4FA 2OIHA 1T03B 3TAMA 3AQPA 3CCWA 4R0EA 3GIJA 1YBAA 1CJUA 2R2TA 3GIKA 4KV8A 4AQYF 2GGPA 1YTYA 2HBYB 2BRKA 1V5VA 4WFBQ 4DHVA 2XZTB 2HNYA 3GB0A 2K1RB 1DBDA 1QTNB 2C2KB 4L74A 4F25A 1KR4A 1SJ4P 3W60A 2XHWA 1MWYA 3P3DA 1Z2ZA 4FYYB 2ADCA 3PYGA 4ZS6A 2FUG9 2YWGA 3CO9A 3MECB 4EO6A 3EVOA 1YJWS 3RB0A 3EPGA 2HNZB 1T05B 5T7LA 1RT4B 1E6YB 2V63A 2LCWA 1BC6A 4LUBA 1EP4A 4AE5A 1QTMA 4P2SA 2GC8A 3JAMU 2OGUA 2PIIA 1IXKA 1FEEA 1VIXA 1C0UB 2NYHA 3LQVA 1U2RA 3CJKB 4A8KA 3T1YF 4C0BA 4F3MA 2J0SD 1DY3A 5D4PA 4X64J 1HNWF 1YJUA 3DKDA 3WX4A 5LOQA 2BM1A 1SKWA 4PZVA 1GMWD 3NS7B 4LF7F 5GADI 4NXNJ 1A7GE 3KK3B 3G6ES 2IBOA 2A10A 2PO4A 4Q0BA 2BQ3A 4IH6A 2C28A 4N77A 1HNXJ 4WKRA 3ZTOA 3IP0A 3AH6A 3UVJB 3PJXA 2E1AA 2VPZB 5U47A 1PIEA 1B0VA 3DLEB 2NUUG 2ZUGA 2HIYA 2VF3A 3DM2B 2DNRA 2E1CA 4A4JA 3QT7A 3NGDA 3QJJA 2YNFB 2G2YA 4FYWB 1BE4A 3BGUA 1Q81T 1G1XA 2IYGA 2D1CA 4QYZJ 2F8EX 1KVIA 2MZRA 1YRTA 3BSNA 1PJ6A 4RW4B 1DARA 1HL6A 2CQCA 4CT8A 4ID5A 4I2QA 3NCPA 4KGKA 4P10A 4X84A 2CYYA 2R7XA 3V6KA 1ZAVA 2QMUB 4WTYA 2ZKUA 4M5HA 5DETA 3C15B 1U6BA 3G6YA 3UR0A 4DR3J 5L1IA 4UTGA 4HYKA 3GV5B 4W4MA 3TEHB 1VJWA 2F40A 4NMXA 1AW0A 2NR0A 2ZWPA 1SC3B 3G8QA 4H54A 1R7IA 2FZGB 5RUBA 5IT0A 2RIJA 2CPZA 3PM9A 1NK6A 1NO8A 3G96A 2JWNA 2QMWA 4LRFA 4HHHA 2K3KA 3VHQA 2J6TA 2RS8A 4M8LA 2WOMB 4NI2B 4ZPVR 4RNHA 2VPYB 4CI0B 4FBTA 2XWXA 3TP2A 3J80U 3J7YI 3ENVA 2HZCA 2IM1A 2FVSA 3FJ2A 1NCLA 2VJVA 4F4AA 3Q86A 3FGVA 3NAHA 2DGXA 1SQEA 3AJ2A 3VAGA 2JEFA 3D6TB 5L46A 3T1HF 1WF1A 1VRQC 1F5BA 1F5CA 3TZXA 4I4BA 2V8GA 1HBUB 4NWBA 2RVJA 2RDJA 1F60B 2W9BA 3RUBL 3FKBA 3GIIA 2P6SA 4YB6A 2XGPA 4X4UA 4GVBB 1S9GA 4LSZB 2AD9A 1EKSA 3C6TB 3E8OA 1V3ZA 1WC3A 5EX3A 3MAQA 5MLCV 2AYBA 5B0EA 1J5OA 1RA7A 3RR7A 2J9DE 1PJ5A 1KLMA 3MR7A 3HMJG 2AYEA 3OXFA 4USTA 3I5CA 2AQ4A 1RADB 2H65B 1WSRA 3W2WA 2L41A 1KBRA 1L3UA 4P7VA 3DCAA 3W61A 4F4WA 4RW8A 4DL3A 3OPKA 3IA0A 4DJBA 4RBUA 2HMIB 1P9YA 3MPDA 1FKPA 3CUNA 3GR1A 1KP6A 2RRNA 5A6PA 3QBCA 1VQYA 2B4PA 3ZZ0A 2F9DA 2JVRA 3TX0A 4J9NA 1Z1ZA 4WXOA 2LEBA 1H72C 3EDQB 2YH0A 3JQKA 3T6BA 4WKYA 2QFIA 2Y1JA 4LRDA 5HVFA 1LFPA 1FFWB 1LXJA 1N56A 1EETB 1XMOF 2XMVA 4DSIA 2F8MA 4N5SA 3FC9A 3BH7B 2RQCA 1YITS 2KI2A 4DFMA 2OPSB 4L75A 1JK9B 4K4VA 1T9XA 4N47A 5CYQB 1XBWA 2W1BA 3DI6B 3WBZA 2UUCJ 2POKA 5KFQA 2NZCA 5LJ5Y 1CJVB 2W9AA 4ZLPA 1FDDA 3AJ1A 1EKRA 2YBVA 2E9RX 4JV1A 4X66J 3IR7B 2OELA 2QG9B 4JV5J 4IR9A 2VHGA 3OR1A 3DGPB 2OD6A 1RAFB 2QE5A 3M2RB 5HO4A 4O4RA 4ANEA 2W8LA 5KFKA 4EBCA 1SL1A 4R5PB 4WFXA 1WTFA 3B4DA 5HBMA 1V5IB 2CZ4A 3Q8RB 2I1RA 2CZ9A 1TUGB 2UVUA 2O1PA 3R5DA 1KVKA 4CH0S 4CNZA 2DGWA 4LFBF 2R8IA 3BGFA 2VDIA 5LSRA 4DV5F 1RHQB 2QV6A 3LUYA 2K2PA 3I4PA 3KK2A 4CO5A 4CLLA 4AXIA 1YSJA 1U1MA 3EUNA 3RB6A 5GVQA 1FF2A 3V6DA 5HJYA 1W26A 4LF6J 1XMBA 2JRSA 3H0PA 2M70A 3HHNB 4F7VA 2CQBA 1AZSB 4FF3A 1XNRJ 5B08A 4LRAA 3DU5A 2QA2A 2VC0A 2KXFA 5K14A 2IFXA 1P8GA 2XG8A 2J7WA 5D3GB 1UMJA 2WSFC 2DHSA 4DR6J 2D7SA 3G8SA 4OX9J 2IM3A 2ZZNA 1NB2A 2ZD1A 4ZDNA 2QT7A 2DXFA 2HNDA 3EDRB 1GNKA 4DWIA 5HI7A 1P1LA 4ELTA 3HSGA 2PD1A 4OYXA 2KM8B 4EGLA 2HAIA 2X3DA 1REVA 1HMVA 5GAGU 5LXYA 1UFLA 4CNYA 3ZZUA 4DZ6A 1RCOB 2AZ3A 3K5OA 3ELHA 4MIAA 4DX7A 4YR0A 2ZITA 1LFWA 5DDPC 2BW7A 4WU2A 4GKJJ 3OW2R 4RL1A 2ROEA 2HQGA 4NPOA 4JB8B 4RUCA 2DRBA 3H2VE 2Q6CA 2XS2A 1ZTWA 2CQ4A 1UJ5A 1T02A 2MJUA 2CXEA 2AJ2A 2UUBF 3NGKA 3H5UA 1UCNA 1IKVA 2YPZA 2OPRA 5EDWA 3BPSP 1K9MT 1WI6A 2RKIA 3CC2S 1Q5YA 2WVEA 3BJYA 2MKCA 3SCLE 3AJDA 1FRXA 4NLVA 1BXNA 3SZ2A 3AHPA 3QGGA 3A8IA 3BKUA 2PI5A 3ENQA 4I0WA 4NLQA 1QM9A 2JC0A 4DS4A 3AOAA 3OTCA 1KC8T 3NLCA 3C14B 1P27B 2AW0A 3NOGA 2DHGA 3DLGB 3R5CA 1TK5A 1PAEX 1K1QA 3SFUA 2HS0A 1FE0A 2HSEB 1PC4A 5CD4H 4Q0BB 1U47A 3IRWP 1OQ3A 2QLFB 4W98A 3OVSA 4OYIA 3SDEA 2VPWB 2CG4A 2EKYA 1MMLA 2BZ2A 3MXHP 2EW9A 3D4JA 4NEZA 5DZ6A 2WW4A 3VVTA 4QOTA 5IV4A 3HD2A 2Y3YA 4E2FB 4H4OA 2WZ1A 4LJMA 2Z2ZA 4L3NA 3LP0A 1Z4UA 1UZHA 4EO8A 4LF4J 1WTBA 1HHTP 3UWTA 1QE1B 5CXTA 5I3UA 2V34A 1MW7A 5KFJA 4ED8A 3R1HA 2QRRA 1FJGF 1U8WA 3FK4A 1T9VA 1RDRA 2W01A 3C6UA 2VB6A 3W7BA 1RTIA 3Q8PB 1YWXA 2FYXA 3VQSA 4CM0A 2Z2MA 8AT1B 1TELA 1HWLA 2VODA 4I2QB 3BO3A 4ELUA 2GIFA 3MFHA 4IG0A 2MKJA 2HVIA 5HP1A 4WP3A 2AYMA 4WK3A 2AHOB 3O2IA 1X4AA 2V2ZA 4FKXA 1VK3A 2O66A 1FK9B 3HHKA 3KMSA 2EG2A 1YX2A 5J2QA 2CJXB 3VGSA 2W4DA 3PJ9A 1S6PA 4KQZA 2D3OR 1ROFA 2BX6A 2JEIA 3PYFA 4NOHA 3MZIA 4CP5A 2ABYA 4K0KJ 1QAJA 1H6KX 3W2VB 4F67A 2R8KA 1O51A 2CJBA 1KOHA 2RS2A 1NJWA 2HG4A 2BR0A 3FSYA 1XC9A 3M7VA 2VQEF 5FLXU 4A8OA 5C42B 3ZTSA 2K7JA 1U48A 3NCRA 3MM9A 1UAWA 3SCKE 4K50A 5ETVA 1HFEL 1S5ZA 5KFGA 1KD1T 2Z56B 3O44A 3PW0A 2PFFB 2R7SA 4JI6J 2OSQA 4RNOA 5LXRA 2NREA 2H4WB 4K5RA 1BY9A 1JKHB 4IH7A 1A9NB 4P2MA 1RB0A 4DV3J 2CJ9A 2J0WA 3EXCX 4OHXA 2F5GA 3M8SA 1HNVA 3PY8A 4A8XA 5AXNA 2AX1A 3K2YA 2OMLA 2LEAA 2OEKA 3NS6A 1Q0NA 2J6SA 2JOQA 1WNEA 1L3KA 3BGOP 3LPYA 1X5SA 4URSA 4ZJLA 3WQPA 3G6XA 1N0UA 4KE5A 4NRUA 1B4SA 1SJRA 3IXQA 4FDFA 3FVYA 3CDBA 1HI1A 2CQHA 1O6XA 4X4TA 2GHVC 1T8EA 4F50A 1QUVA 1FA0A 3W2WB 3G71S 3A3NB 5CH7B 2EVZA 1NZ8A 1JNZB 3D66A 2EFOA 2ZH6A 4QW8A 3AA9A 4YB7A 4RW8B 2R2RA 4DG1A 4EMDA 4WCEQ 1OY6A 4C8OA 4JI5F 3C2PA 3M30A 5KFUA 1H7WA 1IJEB 5EWEA 1GX5A 3L9ZA 3N28A 1PYTA 4IKAA 1PYSB 2BABA 4QCLA 2PT0A 2CPFA 3R3TA 4AL6A 4YDDB 4ZLLA 3PIPQ 1RAOA 5BXIA 1M1KT 4CLPA 3V6HA 2VKZG 3DRYA 3A8EA 3R5JB 5KFPA 5H1SV 1YQHA 1QVGR 4O3QA 5LMUJ 3KDOA 2OO4A 2BVZA 2RUSA 1HWUA 2ZVIA 3CCJS 3BKFA 2FLNA 1CG2A 4Z7CA 1R8BA 1FNMA 4ZJOA 1QSSA 2GMHA 2I0XA 3RYLA 5J1EB 5GMEA 3R6GB 1UVKA 1TQLA 2J7UA 3R7SB 2BMBA 3PW5A 2GIRA 3LF0A 4AL5A 3PACA 3QJLA 3KUGA 2KZMA 5KG1A 2OFHX 2UV8G 1OSCA 2XYGB 4USIA 1FJ7A 3UD4P 5E3QA 5DM7Q 3CMQA 4ECZA 4OHZA 4KRWA 2B7CB 1RAGB 2IIHA 4L6V3 2QA4G 1X9SA 5HBMB 4OQJA 4F02A 4A8WA 3MR5A 3EYZA 3PCOB 3IRXA 1ULRA 4KGZB 3SI8A 1U0HA 3R6LB 3CJ0A 3KHLA 3JTOA 2HZAA 2IVMA 4X4NA 2A1BA 1ZM4A 1Y3JA 2KT5A 1YZ6A 1R8AA 3V6DB 2LU2A 1JX4A 2HVHA 2I38A 1I6JA 4DV1F 4FF1A 2LVWA 1LV5A 2EK6A 1YI2S 2CFXA 1SC6A 2HURA 3CWJA 5GMDA 3Q2SC 3UD3P 1MLAA 5K14B 2FHJA 1S72S 4J9RA 4AYBD 1VISA 4ECRA 4OL8A 2FHOB 1PAUB 3S01A 4DUYF 4G1QB 1S1TB 4C8MA 2ZD1B 4RW7B 2R8GA 1P6TA 2ZBQA 4WJBA 1SUQB 2HNDB 2ZH7A 1EAYC 2ASLA 3FCWA 4PEOA 1HBMA 3MWBA 1HARA 1TKTA 1YZ7A 3NEKA 1REVB 4MKVA 4OYBA 3WC0A 4OZ5A 3ONQA 4DL0C 2B9WA 4M5DA 1MROA 2AWZA 1PGZA 1N34F 3D68A 4WU3A 2UUAJ 3RAMA 3VAFA 4RNMA 4MK7A 2HFNA 3U1MA 2N7CA 2P9EA 4NLPA 1SIWB 5HJXA 4X65F 2CQ2A 1U02A 1IKYB 3Q23A 4WP9A 1IKVB 2XMUA 3QPIA 2J7KA 1NDLA 5EX0A 2MQQA 2CQ0A 3B6BA 4BHQA 4ZVUB 3QAUA 2BJ7A 1RCXB 5AJ3J 5DGAA 5B0FA 4MTPA 3GG1A 2DR6A 2FHJD 3ILIA 2BJ9A 3FFIA 1N33F 3OVBA 1L5UA 2FB0A 4JYAJ 2EFPA 4XPEA 3IG1A 4C3LA 2ZVSA 2OKQA 2RU3A 3CJ2A 3HFVA 3IMQJ 3UDLA 1OPIA 2ZZTA 2RUGA 1HIYA 3PFOA 3CCZA 4FYVB 5IOLA 5F3ZA 2R7OA 2CQ3A 3B4MA 3DFEA 3RR8A 2MLZA 2H5IB 2M3DA 2XGQA 2VFVA 2HHPA 2IHR1 1T95A 1N32F 4C8ZA 4LBHA 5KOXA 2ACYA 1B64A 2HK2A 3SDEB 3MCOA 2ADBA 1SL0A 3T5KA 1RISA 3SQOP 5DG9A 2FJVA 2F4VF 6FDRA 5ETLA 5ETRA 4JBCA 5HQMA 1RTDA 4P71A 4X62J 1N5TA 3AA8A 1LWCB 3LP2A 1RWKB 3W62A 2MB0B 1YRUA 4YR2A 1IKXB 4ED0A 3QGPA 3E01A 3UPFA 1S1UA 3FEZA 3LP0B 2QYGA 4XDDA 2BKNA 3EX7B 2ILZA 5I3UB 3O3LA 2R7QA 5FD1A 1ZM9A 3ZZOA 4ZPCA 5KFTA 1RTIB 1AROP 3VZHA 1KQSR 4YUDA 4M94A 4PQUB 1F2HA 1UFWA 1Q8BA 4NYZA 1VRTA 4IG0B 2E9TA 3LTOA 1TKDA 4HVZA 3KJVB 1NSPA 2M9KA 3P5BP 3FBCA 2G2OA 3EPIA 1RT6A 5DQGA 1FRKA 4M5JA 3PW2A 2A0FB 5DLFA 1WKLA 1JLFA 3M6WA 4CYUB 1TTHB 1RWPB 4DS5A 4OZNA 2CRLA 3OVAA 1S6PB 2DH9A 2FZCB 3JQJA 1NK9A 2KG1A 1DFDA 1NPRA 1SJQA 2UVVA 4AUKA 4U8YA 3VF0B 1S59A 5E7OB 1S6QA 1UPMB 5JVGQ 1MN7A 1U0SA 2WB4A 2YH1A 1UVIA 1WEYA 2KVQE 3L09A 1O0PA 1QUPA 1ITPA 3NRBA 1A6LA 2ZNYA 1FRHA 4JI0J 2WVCA 2R4FA 2VG7A 1KKHA 1WEXA 2IYIA 1X0PA 4NCBA 3DYAA 3ISND 4OX6A 1JLGA 2Q43A 4FXDA 3H90A 2CJQA 1FXLA 4TQSA 2M88A 4OHWA 2H51B 4QZVB 2VG5B 4KPYA 2DNMA 2GQCA 4F04B 1OIAA 3RJMB 4UY8T 3U1LA 4A8SA 3HVTA 3NWGA 3DRSA 2PI4A 2ZBRA 3AOBA 1DRZA 1M5KC 4DL6A 1H38A 3ICLA 3A8KA 2XYPB 2NSBA 1C4AA 4OV6A 3LALA 1EX8A 3VALA 4OLPA 2E1PA 2J8SA 1UZDA 4KGVB
chains in the Genus database with same CATH topology
4KO0B 4GC6A 2KYZA 1YJWS 1FD8A 3RB0A 2HFZA 4HDHA 2HNZB 3EPGA 3FNNA 1T05B 3QIPB 5MAOA 5T7LA 1RT4B 3MHYA 2OPPA 1E6YB 5A0YB 3E3XA 1KTQA 2JX2A 6FD1A 2EPIA 2LCWA 2RDIA 1W2BR 1BQMB 4QQBA 1BC6A 4LUBA 1EP4A 2HQ3A 1Q8LA 4CIOA 4AE5A 1HW9A 3SSSA 3D28A 3V5RA 3IAM9 1TL1B 4GMKA 5K8OA 4JI6F 3I5BA 1QTMA 2ATLA 2OH2A 4P2SA 3OR1B 2N82B 2GC8A 3VR1A 2N4DA 4F3QA 2DBBA 2PIIA 2DGUA 3TOQA 1IXKA 4KJIA 2KN4A 3M30B 4FNHA 1RYRA 1FEEA 1VIXA 1C0UB 3CJKB 3LQVA 1U2RA 1DQ9A 2E5GA 4A8KA 3T1YF 1FCAA 3NMAA 1WEZA 4FS1A 5KG2A 4G1QA 4C0BA 2XI2A 4F3MA 1S1TA 1CQNA 4IFVB 3TI0A 4DV3F 2J0SD 3QIDA 4WFYA 4KAIA 5I42A 1HBNA 2F3JA 4F8RA 5D4PA 4RW7A 1WG4A 4ES1A 1X5PA 2HHVA 4TYAA 2XLIA 4XDCA 4ZCIA 1FVQA 1SUQA 4LFAF 1HNWF 1YJUA 2HRUA 5IS2A 2ZNZA 4QU6A 1XEZA 3WX4A 3TQ1A 3TA1A 5K8MA 4MKYA 1VQ8S 4OJ1A 3A1YG 2BM1A 1SKWA 3GFXA 4FF4A 4F4KA 4LF7F 5GADI 4IQMA 3FEXB 3T1AA 3DHWC 3GIMA 4X4VA 2R9LA 3RRKA 3KYLA 4NLXA 1A7GE 1WHVA 1LWEA 1RYSA 2LDIA 1NKEA 1LWFB 3KK3B 3G6ES 2IBOA 2A10A 4OI1A 2PO4A 3OLAA 4Q0BA 3C66A 2BQ3A 3KNGA 2A2DA 3MEGB 4IH6A 2RF2A 2C28A 3BS9A 2V8DA 4UQGA 1FVSA 3KK2B 2WAQD 4N77A 4UY85 5C24A 5DLGA 2KRBA 4WKRA 2MDAA 3ISZA 3BR9A 1NK4A 4Y2KA 5K8NA 3OFGA 5F8JA 4UQTA 2MZSA 3I9V9 3AH6A 3BN7A 2ZDPA 2J9DA 3PJXA 3FEYB 4MK8A 1ZH5A 4FYDA 2E1AA 1S79A 5KFVA 2VPZB 1KHWA 2PA3A 1HQEB 2CQPA 5U47A 4DQQA 2EWHA 3MI7X 3V4MA 1B0VA 4Q45A 2XS5A 2CDQA 4O3PA 3N6MA 5F8GA 3DLEB 2NUUG 1D9FA 3OXGA 1N36F 1JLAB 2ZUGA 4I2PA 2KT2A 2JHEA 3GV8B 1IKYA 2WK4A 3WDOA 2N3LA 4BCAA 2MSTA 3DM2B 4KFBB 4ECXA 2DNRA 1QAIA 5DDRC 2E1CA 3DLJA 3OTBA 1XR6A 1E6VA 2JFKA 1Y5LB 4A4JA 3M2UB 1VRUB 4C11B 3MF5A 3J7A1 2APOA 4O0IA 1S48A 4ZP8A 4Y2CA 3QO9A 5F8IA 3RRGA 3GWCA 4NLDA 3TVZA 3NGDA 4MMOA 3QJJA 2XSJB 1L3SA 1U1QA 3CD0A 2YNFB 2W8KA 2BANB 2C3MA 4QYRA 4R8UA 2R8HA 1TL3A 4CO2A 2AJ4A 1FNXH 1DZ5A 3BGUA 4DR2F 3FZ2A 1S1WA 1S1XA 1Q81T 1G1XA 2I2YA 1TV6A 2D9OA 2IYGA 4ZMMA 2M2BA 2D1CA 2MKKA 4OHYA 1TVRA 4QYZJ 2F8EX 3ITHB 3EGZA 4DR4F 1KVIA 2MZRA 2C3PA 4O23A 2WONA 3M8PB 1Q7LB 4ED3A 4DQSA 1QSLA 2YY3A 1SV5B 4LFCF 3J7YU 3VQTA 4DV7F 1YRTA 2DH8A 4B02A 4DLGA 3JSYA 3NCQA 3BSNA 1YHQS 3LO3A 4RW4B 1WG5A 1DARA 1HL6A 1Y00A 2CQCA 2DT9A 4XK8C 3K7RA 3UCGA 4CT8A 4ID5A 2L48A 2DGQA 4KBIA 3CE8A 3TX8A 5E0OA 3BR8A 5DDQC 4I2QA 1VQLS 3NCPA 4KGKA 3C3LA 2W7PA 4X84A 2IVFB 1VK8A 1HYSA 2CYYA 1HMVB 2R7XA 3MTKA 3I0SA 3V6KA 1RT1A 1XK8A 3BN4A 4ZVFA 4EWTA 1ZAVA 4A46A 3KOAA 2BA9A 4WTYA 2ZKUA 5DETA 2KG0A 1U6BA 3V81B 1UEUA 1U1PA 1NK0A 3G6YA 3QYYA 3UR0A 4W90B 1HHSA 1NZAA 1R6YA 5L1IA 2VBWA 4HYKA 3GV5B 3N5BA 2XNRA 2DCLA 3QAEA 4DLEA 2DNNA 2LKZA 1VJWA 5DG8A 2F40A 2KHCA 3D0IE 3O8WA 1IKWB 2OPQB 2YVSA 1U09A 2YNHA 4TLQA 3SYZA 2G13A 5JUMA 4USHA 1AW0A 1T8EA 2MQMA 1R27B 2DTJA 1XN9A 1DURA 4NA3A 2LQBA 1S0OA 5LMUF 2JH3A 1NJYA 1NK5A 4YEAA 3MEDB 2NR0A 2F7VA 3CDWA 4ATNA 4TY8A 3CCMS 3G8QA 5EGYA 5J2NA 2HPUA 1FEHA 3M05A 2L9NA 4WYWA 4H54A 3V2UC 2VD3A 1R7IA 1S7HA 5DQIA 2OPRB 4C98A 1UL3A 3E2EA 3NNHA 5IT0A 5F8NA 2RIJA 5KT3A 1RT2B 3OL7A 2ASYA 2CPZA 3CCVS 3PM9A 1NK6A 1D0EA 1GXUA 1NO8A 5KFAA 4ZKAA 3G96A 2MSSA 3SEOA 4JI4F 2JWNA 2QMWA 2RKIB 1SKRA 2MY7A 1MNEA 3KLEB 2K3KA 1M0SA 1WWHA 1RTHA 3IFEA 3HZEA 1LWCA 2J6TA 4ELVA 2Q6BA 2RS8A 1M5HA 1JMTA 2DIUA 1X4BA 2PE8A 1C1BA 1FD2A 2WOMB 4M8LA 4ZPVR 4RNHA 2RILA 2VPYB 2BQUA 3H4DA 1IKXA 4CI0B 5A8KA 1DQ8A 4FBTA 2XWXA 3TP2A 3J7YI 3ENVA 4KIAA 2HZCA 3KLGA 1Y9OA 2I9SA 2IM1A 2IMWP 4DR6F 1OO0B 5IQ6A 2FVSA 4TU7A 2Z4PA 4PG5A 3KNAA 3FJ2A 1LQ9A 1N88A 2ZH3A 4ECYA 1HD1A 1VMBA 2QO3A 2KKHA 2MHEA 2VZ9A 2W25A 3FGVA 4U7CA 4YHHF 3NAHA 2UU9F 2DGXA 1SQEA 3AJ2A 3S7RA 3VAGA 3TANA 2YKPA 2JEFA 1RK8A 2N3OA 1R43A 3T1HF 2I8EA 2HS4A 1FRIA 2DNYA 5J2MA 1WF1A 1U26A 4O3NA 1OQ6A 3OUYB 2MJNA 5E3AA 2ZM6F 1FESA 4BC9A 1F5BA 1F5CA 2FLLA 1VIOA 4I4BA 1FTCA 1HBMB 2FTRA 2V8GA 4NRTA 4DSLA 4E0DA 1HBUB 1R3NA 4NWBA 3FSIA 4NLGA 4K59A 3JAMY 5AE1A 2RVJA 2RDJA 1YJTA 4PQUA 4N76A 1F60B 2W9BA 4R25A 4FXWA 5C25B 3HLUA 4IG3A 4BS2A 4FF2A 4RU9A 5L1LA 4BWMA 2DVIA 5KG3A 3GIIA 2P6SA 4QR1A 2DHXA 3HKWA 2KB2A 2ZBIA 4YB6A 4ZPTR 3OHAA 3KJVA 3PX6A 2FC8A 3K5NA 2XGPA 4X4UA 5HQ8A 1RT7B 3B8HA 3H2UB 2VC1A 1SH0A 3MEKA 1MROB 4IDKA 3HXMA 3RZAA 4ERDA 1S9GA 2XMTA 1RKJA 3BO4A 4DQRA 2M7SA 1HQUB 2YWHA 4U7UK 2XEXA 4RW9A 2DR5A 2AD9A 1BQXA 2F9JA 4DFKA 3TA2A 3C6TB 2RQKA 2ZC4A 4J9PA 5J1NA 1MMDA 3E8OA 1WHYA 3MTJA 4GKKF 3DLBA 1U6ZA 3KMQA 2CPJA 2CQGA 3CTRA 1V3ZA 5EX3A 3MAQA 5MLCV 5A8RB 1Z2LA 4X4SA 2AYBA 1IM4A 5B0EA 1J5OA 3M6XA 1RA7A 1X4HA 3PRBA 1D1UA 3RR7A 3VAKA 2J9DE 1KLMA 4CH7A 5B0CA 1UP1A 2XS7A 4O3OA 3AAWB 1HBOA 1L3VA 4NZ6A 2B6AA 2ILYA 2W9CA 3VAJA 1XR5A 3HMJG 3I82A 3AY0A 4OI6A 5SZTA 1DLOA 2AYEA 5J1PA 1N48A 1U6FA 4YP3A 2R7VA 4MYUA 3OXFA 4H4OB 4H4MB 3I5CA 4M63A 4ZCLA 2AQ4A 1FDBA 4H4KC 2RJZA 4HTJA 2LA6A 3W2WA 4EUVA 3LANA 2L41A 1JNRB 4P6QA 3F73A 2QA1A 1VHFA 2VBZA 1FERA 1L3UA 4P7VA 3DCAA 4ECVA 5IM0A 1K8AT 4QR0A 3D1OA 3H98A 3UR3C 3DXBA 1JJ2R 3C6UB 3FQKA 1UETA 2FJEB 3POTA 3HVWA 4F4WA 1VQPS 1URNA 2P9GA 4F4YA 3JB9k 5EWFA 4RW8A 2RU9A 4DL3A 4NCGA 3OPKA 1V3SA 2MYFA 2OMOA 5K5MA 2GFFA 4QIVA 4WXWA 4DV2F 4B9TA 2RSQA 2PGCA 3BREA 3IA0A 3M6UA 4RBUA 4DJBA 4C8NA 3P49B 2HMIB 3LWMA 4WIIA 1QAYA 1PSDA 3ZZYA 4WFNQ 2W7OA 3TVYA 1ZETA 4I6AA 2WB1D 4KT0C 1FKPA 3CUNA 3F44A 3GR1A 4KGMA 4XO0A 2B4VA 2RRNA 3MR2A 2AU0A 5E33A 3DDKA 3IG1B 5A6PA 3M1VA 2XLKA 3DC2A 1UJ6A 1VQYA 2B4PA 3O5TB 3ZZ0A 2F9DA 2LQ5A 2V0NA 1YJRA 5GAHI 5CA5A 4FXVA 1KNZA 2JVRA 2NYIA 3DN9A 5HP1B 2J0QD 3UCZP 3DOMA 5KFLA 1X9MA 4J9NA 1TR0A 1Z1ZA 1BQNA 3MOZA 5KFDA 2VBYA 4IR1A 3GFZA 4WXOA 2IMOA 2LEBA 2MZJA 4IRCA 4ZPDA 4QW9A 2JEGA 5A2QY 4B17A 1M5OC 1SH2A 2MXYA 2BM0A 2YH0A 4PXCA 3Q0AA 3MEEA 3T6BA 4WKYA 1TUVA 4IOCQ 2Y1JA 5J2QB 2VG5A 4ZP7A 4K4XA 5B0AA 1WF2A 1KVJA 4DV4F 5L38A 2DNPA 1LFPA 2J9EA 2E1RA 3KKFA 1LXJA 2HW3A 1RTJB 1D3WA 2B7BB 4BBYA 4EEYA 2Z8QA 1N56A 2UUAF 3CGIA 1EETB 1FDAA 1XMOF 3BDPA 4PG7A 3THPA 4KTQA 2GHPA 5A6WA 3UDCA 3Q8QB 2XMVA 5FDLB 5KG7A 1ZAWA 4QIWD 3M4XA 4DSIA 3MM8B 1FJCA 2YX7A 1KHVA 3IS9B 3SXLA 2V4JA 4QJVA 4DF4A 2F8MA 1CC7A 4Q8EA 3NNCA 4N5SA 4IFYB 4HT5A 5CXTA 3V4IB 2P5VA 2BQRA 2RQCA 2ZOGA 1YITS 2KI2A 2B43A 1N5VA 4DFMA 2Y1IA 2OPSB 2HRYA 1CEZA 4PPDA 1RT3B 4JI3F 2YKNB 3KHHA 1JK9B 4P7TA 1H2UX 4Y6IA 4K4VA 1AFIA 3I0RB 2IJFA 4N47A 5CYQB 1RTDB 1JLBA 1XBWA 3MM9B 3PW4A 2P6TA 3FZBA 3DI6B 4D3GA 3LP2B 5LSOA 3WBZA 4QWCA 2MZTA 4WE1B 3JSMB 5J2PA 5BYSA 3MMAA 2D3ZA 3E01B 2POKA 2J0XA 5KFQA 1VC0A 4DN9A 3MECA 3IBWA 5LJ5Y 2IRYA 3MPVA 1QY7A 1VC5A 2E66A 2W9AA 2J8AA 2HWHA 4ZLPA 2LMIA 1T05A 2O67A 2M8HA 3MGJA 3QIPA 1FDDA 3TYTA 3BF4A 3KLFB 1Q78A 1JLQA 1RT4A 3AJ1A 2YNIA 3D0GE 3SQGB 5AJ3F 1SJFA 3KK1B 4PUOA 4PG6A 2FC9A 5DJBA 1E6YA 4PPZA 3T5JA 4F3OA 2AF6A 1QSYA 4AFFA 1AUDA 4PWDB 2E9RX 4JV1A 4U9RA 2ZOFA 1BQMA 2Y1RI 2ZC3A 3KHGA 2GO9A 3IR7B 5IFMA 1N6QB 5BR8F 2RB7A 2UXCF 4JYAF 4QIGA 1Q1KA 3OTEA 4IR9A 1NRKA 1L3TA 1TL1A 2CVEA 3NKYA 3J80Y 5F8MA 3OR1A 2OD6A 2QE5A 5HL7Q 3M2RB 1KTVA 5HO4A 4O4RA 4B3SF 2DO0A 3CJKA 4IH5A 2UVRA 2R7RA 1FHTA 1ZZFA 5KFKA 2W8LA 1VRTB 1U24A 4RW6B 4EBCA 1SL1A 1KS2A 3CJ4A 1VOMA 3HHLB 3I87A 4JI8F 4R5PB 2ALZA 1HNVB 4OI3A 2PMHA 1HWKA 4WFXA 2COLA 1WTFA 3NP5A 2EC0A 3DLLQ 3B4DA 5HBMA 4PR6A 4WFZA 2VPXB 2XSFA 3CDUA 2CZ4A 2KVIA 3OL6A 3I4HX 4DR5F 2BW2A 1UVMA 3Q8RB 3PRDA 2I1RA 4YR3A 3TAQA 4NZ7A 3UW1A 4GO5X 5AE2A 1JLFB 1M90T 2O1PA 3T5LA 2UVUA 3CB4A 3R5DA 4TU9A 1GTHA 1FE4A 4EYIB 3CDEA 2ZKTA 4EBDA 4Y34A 2FJBB 3EZUA 2QLWA 3FSXA 4X4QA 4N56A 2ZJPQ 4CH0S 4CNZA 2DGWA 2ZHAA 2BE2A 3M32A 4LFBF 2R8IA 3MM6B 1C0TB 3BGFA 2CIMA 1LWFA 3KK3A 2ZH8A 3MR6A 2BUNA 5LSRA 5DRKA 4DV5F 2QV6A 3LUYA 5GAEU 4C8YA 4PG4A 5CYMB 1YRXA 2K2PA 3I4PA 3BO2A 3T19A 2GHWA 3DRPB 2OJ3A 3KK2A 4CO5A 1NJXA 1R0AA 3M6VA 2HHXA 1Y0HA 2GQQA 2NPFA 4WZMA 1H98A 4AXIA 1YSJA 1U1MA 3EUNA 5E3RA 3RB6A 5GVQA 4X62F 1FF2A 3V6DA 3GQCA 5I3QA 3FMBA 4ZPBA 2BRLA 3BGLA 4LF9F 3DXSX 4O4GB 4C3KA 2JLFA 3GFYA 2XC9A 3I32A 4YMEA 1XMBA 2JRSA 3H4BA 5KT2A 2KRRA 4NLOA 3MURP 2M70A 4LSLA 2CQ1A 3HHNB 3I56S 3CCRS 1JWWA 4C97A 2IAJB 2YKMA 1QAXA 2CQBA 2WSEC 4GO7X