3AA8A

Crystal structure analysis of the mutant cuta1 (s11v/e61v) from e. coli
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
103
structure length
103
Chain Sequence
TAVVVVLCTAPDEATAQDLAAKVLAEKLAACATLIPGATSLYYWEGKLEQEYVVQMILKTTVSHQQALLECLKSHHPYQTPELLVLPVTHGDTDYLSWLNASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Divalent-cation tolerance protein cutA
publication title Remarkable improvement in the heat stability of CutA1 from Escherichia coli by rational protein design
pubmed doi rcsb
source organism Escherichia coli
total genus 21
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3aa8A00
1V3RA 2EG1A 1NH8A 4R25A 4C3MA 1UFLA 1UMJA 1QY7A 2GNKA 4Y65A 4D3HA 3CE8A 5D4OA 2JJ4D 3TA1A 4YB7A 1NAQA 2O67A 4RWXA 1H3DA 4USIA 2NUHA 2J9DE 5DS7A 1PILA 2Z0GA 4USJC 1V6HA 4CNYA 1P1LA 5D4NA 1NH7A 1V3SA 2NS1B 3AH6A 2GX8A 3AA8A 4IYQA 4NYPA 4RLEA 1VFJA 2XZWA 4YB5A 5L9NA 2DCLA 2RD5C 3NCRA 4CNZA 2J9EA 1VHFA 4AFFA 3AA9A 4OZJA 2ZOMA 3AHPA 2XULA 3DFEA 3L7PA 5D4PA 1OSCA 3M05A 3T9ZA 4RWWA 3NCQA 4WK3A 3TA2A 1NZAA 4C3KA 3N5BA 1O51A 3TA0A 3X3UA 2J9CA 2V5HG 2J9DA 2O66A 4ZK7M 2E66A 2PIIA 4WK1A 4CO0A 1UL3A 5DRKA 4CO5A 1KR4A 1XK8A 4OZNA 4RX6A 1O5JA 3BZQA 2GW8A 2XG8A 4CO2A 3GSDA 4OZLA 1GNKA 4CO1A 3MHYA 3O8WA 4Y6IA 4YB6A 2VD3A 4CO4A 1J2VA 4C3LA 3O5TB 4CO3A 2EG2A 4E98A 2NUUG 2CZ4A 2ZFHA 4NYOA 1V9OA 4D3GA 3OPKA 3HLUA 3LF0A 1Q1KA 5D4LA 4USHA 2XBPA 3NCPA 1UKUA 1HWUA
chains in the Genus database with same CATH superfamily
1NLKL 4LBPA 3HHDA 1WOPA 3GPAA 2F4FA 3SCJE 3QWPA 3JQKA 1YBTA 4JI5F 3CT9A 2KVQE 4P71A 1XERA 2IAJB 1NK9A 1V3SA 1CJTB 1SH3A 5FDLA 3TWZA 2CQ3A 3DLGB 4TU7A 3CMAS 1S76D 2V8VA 4DR4J 1T05B 2HFSA 1XTZA 3T9ZA 4JV2A 5KFGA 1M5HA 3K2YA 3CCRS 1VMBA 2QFIA 1UVMA 2GIQA 3NMAA 4NLDA 2HS3A 3MR3A 1G7CB 1HNWJ 2YKNB 2AGOA 4C0HA 2WSFC 2KKHA 4NEYA 2WBMA 4P74A 2FHKA 3MEDB 4P2XA 5B0BA 5KOWA 1WOOA 4R8UA 4RW7B 3U27A 1JLCB 2DXDA 5J2NA 1MMNA 1WG4A 2M9KA 1QY7A 1S7HA 2OSRA 2CVIA 5CABA 2ZVSA 3DC2A 4Y2AA 4KHRA 4UOCA 3QJLA 4HLBA 2LU1A 1B0PA 2VUGA 1FKPA 2XY6A 2HVEA 4CZCA 1NK5A 1RT5A 3CO0P 1WDDA 4A8WA 5DQIA 1UWAA 2ADCA 3PJWA 3EX7B 1HLWA 1WD6A 4PG8A 3PXGa 2AF6A 1RSCA 2NYIA 3MR7A 1B70B 5GMEA 1WSRA 4C8NA 4X64J 1XNRF 4NEZA 4ILLA 5ITHA 2KZZA 2J76E 1NPRA 3MM6A 4ECSA 3OSPA 4OI0A 4F3MA 3P45B 1T0TV 4PG6A 4E0DA 4CCHA 2V94A 4ZCIA 4M5DB 3IRWP 1S10A 2LXFA 2EG2A 3HZEA 4EWTA 2GMJA 1AA1B 1T7PA 3L3CA 3NOGA 1BQXA 2CRLA 3AQOA 2ZE2A 3EMTA 4WZQA 1YJVA 5EWGA 4M8LA 3DLHA 2PFFB 2XNQA 4PCQA 1MG7A 1RT6B 4LFCF 2OSQA 2AD9A 4CDIA 5J2MA 4KKOA 4MK7A 3R2CJ 3QJJA 3I5CA 3CJ3A 1RABB 3MMCB 1SUQB 2HWHA 5J2PA 3PYEA 5IT4A 2HQDA 3P5BP 5HVHA 3RBZA 4LF9J 4RUCA 4RR5A 2W7PA 3BV8A 3CCJS 4ED5A 1HNZJ 1HMVB 2R8HA 1FNMA 2FPHX 1NPKA 1BQNA 3VQTA 2DH7A 2OAUA 2OEMA 4Z7YA 3DNCA 4W4MA 3U7JA 1PAUB 5GAGI 5KT5A 1TK0A 3PY8A 2U2FA 1XR6A 5G0RA 1UA0A 3Q0AA 2AU0A 2P5VA 2UXBJ 4FF2A 2LCWA 3GWCA 1HHTP 2RU3A 3LP2A 2IRYA 2BJ1A 2WONB 1REGX 2MKKA 3QPIA 1RWNB 2XYGB 2JVRA 3IGNA 2DPIA 4IQXA 3HHLB 4DR7F 4FF3A 4HHUA 4DV3J 2JRSA 3R1HA 5KFZA 2AEFA 5LXRA 2FZKB 3AD7C 3KDOA 2RKIA 4ZPTR 1U48A 3HKZD 2BJDA 2OEJA 3HD2A 1S99A 1KNZA 3K5PA 1RHJB 4J5OA 1C1CA 2J8AA 4RNMA 4RBTA 5CZXA 2BA9A 4J9UE 1C4AA 3CCES 4CLTA 4MAKA 4CH7A 2DNKA 4RW8A 1F2HA 3HZGA 1RWUA 3MM9B 3TP2A 2DYAA 1F3FA 3D6FB 5KFAA 3PYDA 4OLOA 3BYRA 1Q5VA 4Y00A 2DIUA 4I56A 1IN0A 1TL7A 1RWMB 1IKWA 2H4YB 3H4BA 1JXLA 3UNGC 1D9FA 1L3UA 4IO1A 4Y28C 2W4PA 3GG0A 3WIUA 4LFBF 1U8WA 4U95A 4B9UA 2WBRA 2R8KA 4K4UA 3LANA 2GJFA 1ZETA 2VDIA 2ZH5A 2ZHBA 2W9BB 2VBZA 4OIXA 3VVTA 2HYIB 5F8NA 4DUYJ 3RTVA 4IFVB 4I68A 3ILJA 1JKHB 2GIFA 4O0IA 2PO4A 2R8IA 3PFEA 3ZNJ1 2EPIA 4ETXA 1AUSL 2DNPA 1M0SA 3TAMA 1N6QA 3J7A1 1Y00A 4LSNB 5HP1A 3AODA 4X4OA 2WCXA 1NK4A 1L3TA 3I96A 5J2QB 4LR7A 3MR5A 2JFKA 2XI3A 3DDNA 1Q16B 4PWDA 1NK7A 2Y0BB 4GKKF 4DCJB 2Q6CA 2BRLA 1N48A 3T6JA 1OQ6A 5GAHU 2E7WA 1T8EA 4J7CA 2AX1A 5B7WA 3I6PA 5IM0B 1H73A 4FYWB 3UVJB 1LWCB 3OL8A 1P27B 2HHPA 2DXFA 2VC1A 2L9NA 4W90B 4MK8A 3C3LA 1U1QA 1TUGB 1NAQA 3T5LA 4BWMA 1RAJA 3R3TA 5D0EA 2PE8A 4TVAB 2GHPA 4RL1A 5HBMA 5LMUF 3DLLQ 3MCSA 5JJBA 4KR0B 1Y3KA 1S1UA 4CNZA 2OPPB 2WVCA 4CM0A 1Q8KA 4EEYA 3I31A 4ELTA 2HS0A 3DRSB 4XK8C 2MLZA 2BJEA 2XZDB 3AJ2A 3QLHB 4GC7A 3DHXA 5KFDA 3US5A 2JEGA 1EQ0A 4BC7A 1JLGA 1HNIB 3WBZA 3G4SS 2CJKA 4OHZA 1DLOA 5IXUA 4IDKA 4NRTA 3O8WA 2RVJA 3BO2A 3O5TB 2QLFB 1R6YA 3UQSA 1RHQB 1Y9OA 3FEZA 1YLXA 1UJ4A 2FY8A 3QQCD 3MOZA 3W5ZA 5DG8A 4F4KA 2ROPA 2I0XA 1U0SA 2HHHJ 2M4MA 3DRXA 4JI0F 1Y5IB 3AOCA 5KG0A 2IYGA 1S4EA 5KTQA 1S0MA 3FFIA 1FXRA 4WZMA 2Z30B 1ZAWA 2QC3A 2DNNA 3TX8A 1NUEA 2NS1B 2LVWA 2R7QA 2VFVA 3UCGA 3EVWA 2FB0A 2ZOMA 1B4SA 4UY8T 4KJIA 3OUYB 3RBXA 1K47A 1KHWA 2CWKA 4DR1F 3M2RA 2HQ3A 4B9LA 1MN9A 4C8YA 3CJRA 3V6DA 1WC5A 3Q8VA 3FSIA 4RX6A 1AXQA 1TKXA 1JJCB 4O4GB 2X1AA 1OPIA 2QA2A 1RI7A 1OQ3A 4DXLA 1T9WA 2HAIA 2HSEB 3W2WA 2YWEA 4DL3A 4OYOA 4LJMA 1RLDA 1PG5B 5BYQA 4DUZF 3N0VA 5A0YB 2ZHOA 2DNOA 2YWHA 1UPPA 4Y2MA 4DWIA 2HRYA 3MD3A 3G82B 5IWAJ 2P9CA 3M8WA 3AXKA 2C2DA 3UCZP 2QLBB 1S59A 2GO9A 4TU8A 4DG1A 2J9EA 3AXMA 4P2FA 2XULA 2KN4A 4JI2J 2QYGA 4O0NA 5CD4H 3HO1A 3MI7X 1QM9A 1KOOA 2ZDOA 4MIBA 1P6TA 3GIMA 3NRBA 1MW7A 3GJRB 4YR3A 1N34J 3HFKA 1WC0A 1QAYA 5D0GA 3EVOA 4RU2A 2E1AA 2G1HA 1RJJA 3G87A 4KHPF 3H4DA 4B3RJ 4FF1A 2CPDA 3B54A 4DQPA 4JB8B 3AB4B 3K8WA 4YY3F 2UU9J 1C0TB 1JB0C 2R8GA 3ONQA 1D8ZA 1R43A 4ITSA 1O6XA 2MZQA 3K57A 1MLAA 4F36A 3VQSA 4F3QA 3DLKA 4QWAA 2QLWA 3R6LB 3A3NB 2I9SA 3K58A 5F0UA 2FZGB 1VLYA 4HDHA 3PRBA 3JTOA 2BJ8A 1EP4B 1IM6A 2Y1RI 3VAIA 4NZ0A 4OZJA 4LIRA 3PM9A 2BANB 3IMQJ 3KK2A 3BBBA 1S9EA 1NZAA 2LLZA 2ASJA 3CCUS 1O51A 1TKZA 1HNXJ 1M1HA 2XMAA 1RWWB 4ED8A 1RE1B 3MCOA 2E1MC 4R0JA 3RJMB 5HROB 4DOZA 4ATNA 2OHDA 5FLXU 1Y10A 5A76A 5DDQC 1VQ8S 4DCOB 1SQFA 4DV4J 1DURA 1OIAA 2LDYA 3N6MA 2UUAJ 4DV6F 2QA4S 1ITPA 1NB7A 1WG1A 2AYBA 1IKVA 2ASYA 2HBZB 3HVRA 4MJKA 2GGPB 2GQCA 2CAJA 2EKNA 2D9PA 2VDHA 1TL3B 4LREA 3W3SA 3JQJA 4GRSA 5A2QU 3NAHA 2FIUA 2PGCA 3MM7B 3R8YA 5B0GA 2GQQA 2CXEA 2IVMA 1S72S 1UFKA 2ZOGA 2XS2A 2VOPA 2J0XA 3IXQA 4YB5A 1RU1A 3MMBB 3BJYA 2J0WA 2UV8G 3J80Y 4FNIA 4OI2A 2QG9B 1ACMB 8ATCB 2F3JA 5KT2A 4I2QA 2CNKB 3R7BB 4KKOB 2W24A 3KK3B 1M90T 1F5AA 3ETMA 4W98A 3N4WA 4G65A 4NLUA 1FT8A 2CPYA 1ZS6A 5DG9A 2NXUA 1T9VA 5EX3A 4DQQA 5J2PB 1FI4A 4N56A 4I4BA 1VRTA 2XGQA 2E9TA 4L3NA 3LF0A 3CCLS 1DQAA 1DBDA 5DETA 3DMJB 2Z2YB 1RTZA 2EW9A 4ER8A 5D4OA 3D3BJ 4DV5F 4R5PB 4DR6F 4DPWA 2Z0GA 1SQGA 4DLGA 3A3PB 1CPZA 1RT3A 1HNVA 4MMOA 3QIPA 3OSNA 3IA0A 4ID5B 1TP7A 3OD2A 2HGMA 2EBEA 2HZAA 2ZVIA 2DGQA 3MEKA 3VZHA 5HMZA 3TW0A 1TR0A 3UD3P 2K2PA 5IV3A 3HPOA 3BN4A 1L3VA 3CGIA 2PI4A 1PGZA 3EGZA 2DR5A 1TKDA 1SBRA 4NLSA 4URGA 4CLLA 3SCLE 4NCGA 4QR1A 4ZP6A 4DV2J 1G6BA 5LSLA 2HHXA 2VU5A 5D8HB 3BYPA 1T9YA 2V6AA 3M6UA 1F1BB 1U8SA 2DGXA 1NDLA 1QJHA 1UWBA 2ZFHA 3W9HA 2NXJA 4O3SA 3OPKA 1KP6A 4MFBB 3R7NB 3W2VA 2VG5B 3NS7B 2D3O1 1ZAVA 4USKA 2CPFA 1D09B 2IJNA 3TUJC 1RACB 3GFHA 1WI6A 3OBIA 4U8YA 1M5KC 1IKWB 1KTVA 1K44A 2EVZA 2VODA 4TLQA 2G13A 4NCAA 3EPGA 1QSLA 2CQ1A 4DN0A 2VASA 5GMKa 1FDDA 3J81j 5LL6d 2RILA 3QRQA 4DR3F 1NDPA 1H2VZ 1NZ8A 2XLKA 4B3TF 1Y3JA 4WFYA 2O66A 3TAQA 1GK8A 3MEEA 4HTIA 3MTKA 1TFYA 5D3GA 1O5JA 4U67Q 2NPFA 3D0HE 1F6TA 3JAMU 2CPHA 4P7VA 2XCPA 1Z4UA 3LWLA 3ETOA 1LOUA 3G96A 4PQAA 4G6VB 3P3DA 4UQTA 3OTOF 4C11A 4HI1A 2BE9B 4ZPVR 2DHGA 1J5EJ 1YJUA 3W64A 3ILLA 1X5OA 1AW0A 2M8HA 2FHJA 3MXHP 1EZZB 2ZJPQ 2M3DA 1CS4A 1RCOB 2N7YA 3CIZA 2AJQA 2ROGA 2RF2B 4YB1P 2R7RA 5AE3A 4PQUA 1HI1A 1VBXA 4IOCQ 2MSSA 2HBRB 3M32A 2HK3A 2LA4A 5L1KA 1NSPA 4OI4A 4K5SA 3DOKB 2QMUB 4BBYA 3EPIA 3QT5A 1FFSB 2J0SD 2IJRA 5KFMA 5CCLA 1AROP 1WC4A 1HIYA 1RU2A 4ICLA 4AE5A 4XO0A 2B4PA 3UR0A 3ENQA 4K2JA 4ZVSB 3DM2A 1JLFA 1SB6A 4NA3A 5F3ZA 4OZ2A 3Q2SC 4XTTA 2BKPA 3UW1A 4X4SA 3B78A 2E5JA 4NMXA 3ILOA 3UO0A 2R8JA 3S6EA 2KT5A 4CT9A 2MSTA 3RR7A 3UN3A 2W9CB 3PKYA 1FKOA 1SKRA 1S6PA 4FBTA 1OJ4A 1Q53A 1YQHA 2V9KA 2UXCF 5F8JA 2HMIA 3CUNA 1DRZA 3T1YF 3KMSA 1ZH5A 2Z2LA 1JLGB 4Q8EA 2DRBA 4QIWD 4RW9B 4IDKB 1K8AT 1H7WA 3NKYA 4WP3A 3WZ0A 2KTQA 2BDPA 3M30A 3HFZB 3MPVA 3SFUA 1RAFB 3ITHB 1I94J 1RTDA 3D2WA 1LW2A 4HVZA 4DQIA 2WOMB 4A4JA 3KLEB 2LEAA 3KLIB 4J9LA 1GXTA 2CJ9A 2NCKL 2XC9A 3NGSA 4J9PA 2E5GA 2P9EA 1RKJA 3NWGA 1G2EA 5K8NA 3SZ2A 4K4WA 4ZCLA 2ILYA 3LH2S 3BGRA 1F5CA 2VBXA 3M2RB 4CTAA 1H72C 1F5BA 2J8SA 4GVBB 2J7KA 5H9EJ 4ZVFA 4DBQA 3Q89A 4H4MA 5F8HA 4GMKA 4WIQA 4QYRA 4IYQA 4WYLA 3UDLA 4LT6A 2JH3A 1TKTA 4DLEA 2OTJS 1LXNA 3W2WB 1DQ9A 2LQJA 2XWXA 2VQFF 4P75A 5A6WA 3PW2A 2Q6BA 3TA2A 3V2UC 4HACB 3AT1B 4ZLJA 2G2ZA 1X0PA 4UUXA 2XWYA 2CWXA 5L1JA 2XO7A 2V4RA 3KNAA 4L75A 4ALZA 3D66A 5ETOA 2MQPA 1AUDA 3IR5B 4ED4A 4ILRA 2ZZNA 3JSMA 3H59A 1HHSA 1JXEA 2XMMA 3FC9A 3HXMA 3OLAA 3KG1A 1RCXB 3B4MA 5C42B 2N82B 3HFVA 2B7CB 1U09A 1F2GA 3LPEA 4FXVA 1CC8A 4F4YA 1F0XA 4LF1A 3SEOA 2QE5A 2HS4A 2JJ4D 2ZOFA 2VPWB 1U7LA 1CJVA 3PTWA 5E3QA 1VQOS 1C4CA 3IO1A 3R9LA 2ATCB 4A48A 1VBZA 3MAHA 1N5VA 4K8RA 1FX4A 3R27A 4JP8A 4G3IA 5D4NA 3GV7B 3JSYA 4J9OA 4YR0A 3V4IB 2DB1A 4DSIA 4OYMA 1W25A 2HNZB 2MZRA 2R7UA 4UOGA 2KFYA 5L9XA 1NSAA 5LMUJ 1VGYA 1WSVA 4U6PA 4USVA 4ZPWR 1KS2A 2PMWA 1C2PA 3L9ZA 2NZCA 3IAS9 1JLAB 1X4AA 3PACA 1GNKA 2GCFA 4YB6A 2XQCA 1U1KA 3TZYA 4O3OA 2ZITA 1EQMA 4DR5F 3TNVA 3VR1A 5C5JA 4C2MA 4OJ3A 2O01C 3TYTA 2JFDA 2ZWOA 2XMUA 3MFHA 4WFXA 4X4TA 3Q8YA 3VAFA 4M63A 3NGKA 1MROB 1TKZB 3NOCA 4O4RA 1KONA 2GFFA 1RBOB 1GAOA 2DXEA 2W1BA 5LSOA 4C0OC 3DLEA 2NSBA 2R7SA 4X66F 2DBBA 2B5JA 3HVTA 4U9RA 3I56S 4ZVGA 2R7TA 3V6JA 3A4TA 2A6MA 1RQ0A 2E44A 5L8RC 2K1RB 4OYIA 4N41A 1BUXA 1IR2A 1HQ2A 2AP6A 4DV0F 1HD1A 3G71S 4ZHRA 1DHMA 4J9MA 2MLYA 3CDBA 2V63A 1TMJA 2XY5A 1WKJA 3LP0B 2MQOA 1VOMA 1FRXA 3NMRA 4IG3B 3BSOA 4DEZA 3DOMA 3M9MB 4Q2LA 4OX9F 5GAGU 4DR1J 5KFEA 4USWA 1FD2A 2LU2A 2QL9B 3V81B 1U1MA 2OIHA 2CJYB 3GIRA 2K3KA 1ZM3A 4PABA 4ZIWA 4YQWA 3LW5C 3JTNA 1YRXA 2EFOA 2JLEA 2FVQA 3FEYB 4DFJA 1HWUA 1SC1B 3IS9B 2VHGA 4JI1J 3BH6B 1U45A 1SVDA 3LGHA 5IQ6A 4TY8A 3ELHA 1JLEA 3T6BA 1FE4A 4M5JA 2VA2A 1JXVA 3M2VA 4PAAA 2GHWA 1KBRA 2BM1A 4DUZJ 1T03B 2YKOA 3VGTA 1NCLA 1FCAA 1OY8A 4F7VA 2GVZA 4Q2MA 1Q8IA 4PR6A 1UAWA 1LXJA 2E5LF 1SL2A 3SV4A 4B08A 4PXEA 2BM0A 2Z8QA 1YJWS 1YKWA 4PXBA 3E8OA 1VLOA 1YJRA 1EIYB 2Z58B 1SL1A 2WSEC 1GEHA 3GFXA 2RDIA 4OV1A 4DV1J 3QATA 2QLXA 2F4VF 5K9FA 2IVYA 4OYXA 4PXDA 3QIPB 2B0GA 1DQ8A 4PG4A 3C14B 3DDKA 4JI4F 1FRIA 4NMLA 1RADB 3FMBA 3I55S 1UVLA 5KOXA 3DGPA 1TV6A 3OVSA 1UMJA 3BN7A 1XMBA 1FERA 2W2QP 1RT2A 2GIRA 5CAAA 4NCGB 2V4JB 5C24A 4DPXA 2LP4A 4YY3J 2NLWA 2R7WA 1DTQA 1RBLA 2HAFA 2XCAA 1V6HA 2ZM6J 2BE7D 2QFJA 5LT5A 1IBLF 3KK1A 3OFFA 1ZTWA 5KFYA 2COLA 2A6OA 3ZTQA 1XR5A 2IC3B 4UQGA 4AD6A 1ZM9A 3LQVA 3GR0A 1YRUA 2IBOA 3HSGA 3THTA 1U6FA 1TL1B 4JV5F 1B7YB 2FYXA 2OPSB 3TA0A 3X3UA 4RW6B 3OHAA 4GKJF 4NRUA 2MDAA 4KC5A 4UY85 3EICA 4PYDA 5ETKA 3D68A 3N9UC 5F8IA 1SJRA 1EHWA 1RT7A 3T1HF 1UEVA 4X65J 3CJ5A 1PYOB 1BWEA 3WQPA 2LKZA 2A2DA 2XI2A 3J81U 3MD1A 1MSWD 3MMAA 1V3RA 4HYKA 2KFZA 3SDEB 1T95A 2HVHA 3AJDA 1FWKA 2MTLA 2JEJA 3KUHA 2YKAA 3DRRB 3NEKA 4DV6J 2WAQD 3FKBA 5AE2A 1LW0A 4K50A 4CP5A 3M1VA 2FVSA 3TOQA 4OX7A 4A8FA 4Y2KA 3CDUA 5IQQA 1ZM2A 4IG0B 1ZA1B 3BQ2A 4YR2A 1WEYA 1S1TB 4ANDA 2WTFA 3H90A 2IAJA 2WW4A 4DL7A 2UZAA 3IAM9 3DLGA 1GTHA 4LMZA 1T05A 2HGNA 2V67A 2VH7A 2H3EB 4OZ1A 3F56A 5HL7Q 1W2BR 1G4CA 5L1LA 5KT7A 5KG6A 3T9NA 5DQHA 2R7VA 1FESA 3L4BC 2ACYA 2KDOA 2WVBA 1LWFB 2XYHB 1ULRA 3OFHA 2W2NP 3AJ1A 2MY7A 4KH1B 3VV2B 2YKNA 4TN2A 4ANEA 3MAAB 1BC6A 1F9FA 3IWLA 4ICLB 3ZZTA 5CH7B 3IR6B 2MQNA 4I67A 1N5YB 4RW7A 3O1LA 1JLCA 3FBEA 4IUFA 2NXCA 3QRPA 4WYWA 5GAEI 4DV5J 2B8PA 3QBCA 1YX2A 5BYSA 4WKYA 3QRRA 5B0AA 4HH0A 2ZBPA 1HQEB 3EM1A 3ZZRA 2OKQA 4OLPA 3QGHA 4RO0A 3GIIA 1PYSB 2YNFB 2HMIB 3R5AA 3GZ7A 4FVCA 3PDNA 3RW6A 4ZS6A 3W7BA 2L9WA 3LALA 4YFUA 1RHRB 2QO3A 2OMLA 3E01B 5ETQA 4B3OA 4WXOA 5KFFA 5I42A 1GXUA 1B64A 3AY0A 4QYZK 5MLCV 2ZEJA 3GJTB 1S1WB 2B4VA 4V19J 2DGUA 1Q4RA 2RB7A 4A8YA 2FJEB 3M8QA 4M5DA 4HDGA 4DS4A 5GADI 3DKDA 3M9NB 2AJFE 3KLVA 1TMMA 1K0VA 2CDQA 3HDSA 4IRDA 2HURA 1NBEB 3HJVA 4N7TA 1PILA 4K4XA 4CLFA 1RWOB 3RRGA 4TYAA 2AJ0A 2RQ4A 3FBCA 3TEHB 1RT6A 3PO4A 2ZDPA 4C8ZA 3JSBA 4YOEA 4CIOA 2I2YA 4LF6F 3MOJB 1P9YA 3MR6A 3DDIA 4MKBA 4MTPA 2YXLA 2AWZA 1YIJS 3M6VA 3KDNA 3MMCA 1SUQA 4CTAB 3O3LA 4LF5F 5MAOA 4NXMF 2GS8A 5I3PA 1IKYB 4ZOSA 2J5AA 1UL3A 2C2RA 3UDVA 4OI1A 4B3TJ 2GW8A 3BSNA 4QQBA 3K5OA 2NYHA 2RQMA 1HMVA 1TKTB 1LK5A 2I8EA 3GIKA 4YUDA 3PIOQ 2C2EA 4K7QA 3DXBA 4N76A 2AW0A 4X4NA 2PA8D 4ED1A 2BKOA 1R0CB 3M8YA 4BWJA 1KQKA 4WF9Q 4R25A 3D7SB 4KRWA 4ECTA 2CQBA 2EK6A 3PRDA 1KLMB 4JI3J 2YX7A 1QD1A 4OZ0A 2WONA 3NBPB 1SC4B 1PO6A 3HHLA 1VQPS 2CZVC 1VK3A 4Y34A 3KHGA 4PEOA 2L9DA 1UJ5A 4QCLA 3TVKA 1RT1B 4NE9C 1IUJA 3W1YC 2DHAA 1O0PA 1IKXB 3MM9A 4ZVUB 2OPQB 1FVQA 3MGJA 3QZ8A 4DL5A 4DZDA 1X5TA 4Q45A 4D3GA 1U47A 2CJQA 1FHTA 2ALYB 1IJFB 2YNIB 1VR6A 3ZTOA 2DNRA 1RAIB 3G6YA 1NDCA 3K8VA 3OHBA 1URNA 3R7SB 4OX6A 4PXCA 2E29A 2AKWB 1N33J 3R5BA 4DF8A 1C1BB 2P9GA 3T1YJ 2W9BA 1BY9A 2VC0A 3BKTA 3SFGA 4LF7F 4H4OB 2JL9A 1E6YA 4IFVA 3KHLA 3BO4A 2GZOA 1S6UA 1JKHA 1OSCA 1LWXA 2P2CB 4LRCA 4ED2A 3QZ7A 4DQRA 4LSNA 5G4DA 4ZCKA 3ZTRA 5AXNA 2VJUA 3WC0A 3AOAA 3A8EA 5J2QA 3KJNB 2B5JB 3RW7A 2C3UA 3RAMA 1VRQC 3AFGA 2JEFA 1PBUA 1X60A 2DNGA 4DUTA 1WI8A 3NGDA 2R2TA 3MECB 2FLLA 1CJKB 4USHA 3PR4A 2FDNA 3F73A 3EDQB 2ROEA 1XMQF 2XLJA 5T14A 3WIVA 3UPFA 2N3OA 5F8GA 3EZ5A 4EYHB 5L39A 5IM0A 1HWKA 2HBYB 3UVJA 1LWCA 3GYNA 5HVGA 3DOMB 4ZMMA 3FGVA 3D5MA 1PCAA 2RHQB 1VK8A 2KO1A 3OJSA 4DL0C 3CC7S 1WHVA 2DPJA 1FDAA 5KFNA 3IG1A 3JSRA 3N28A 3VGSA 3KG4A 3IBFB 2V2QA 4MK9A 3M05A 3OR1B 1KEKA 4DJBA 4WK3A 3I32A 3CWJA 2OPPA 4HEA9 4KAIA 4X62J 1FK9B 3CCMS 1XK8A 4PRFA 5ETMA 1TFWA 3ZTPA 2HZVA 4NLOA 3VTIA 3TQ1A 2WVFA 5BR8F 2YX1A 3QLHA 2VD3A 3GJSB 2VQEF 3S01A 1RTHB 3N6NA 4B3SF 4OHWA 5EN1A 1HNIA 3KLFA 1RAAB 4EGLA 3PZPA 5D0HA 5D4LA 5SUHA 4OI3A 2DY1A 2HWTA 2R42A 3GJQB 4IFYB 4U96A 4ZIVA 2JC1A 2XSFA 2BEFA 4F4AA 3JXOA 1NJXA 1UZHA 1I51B 1IBKF 4ZPBA 4ZJLA 2KG1A 3PW5A 3ZXWA 1SJQA 2O3DA 2DKOB 4DI6A 4J91A 1VCTA 4A47A 2F8EX 3KTQA 5LJ5Y 2G4BA 2UVWA 4HT7A 2ZNZA 1FJGF 4TLRA 2QN6B 4DL2A 2CPEA 5HMYA 3U1LA 1NRKA 2VFUA 4M1KA 3OUYA 2ERRA 3JS9A 2KG0A 3R6GB 5DQGA 3NNHA 9ATCB 4QW8A 3R5JB 2ZH7A 2KM8C 2LQ9A 2CG8A 4DFPA 1OS5A 4O4GA 5FIIA 2YY3A 3FBFA 4DR5J 2OFGX 3CULA 1XNQJ 3BGLA 4MKYA 2QX0A 2CADA 4DR2J 4ECWA 1X0FA 4KO0B 1BHNA 1T9TA 2H5EA 2J6TA 1IBMJ 1VYAA 2PA3A 1NH7A 5A0YA 3D67A 4AQYJ 4F0KA 2GJIA 1KC8T 3PG9A 4A8KA 1Q78A 4M5MA 3NCRA 3CD0A 5A8KB 2YKPA 1OYEA 3ILIA 3QFHA 2V8GA 5B08A 4X66J 1U1RA 1XMOJ 4UZBA 3G82A 2MEWA 4CM2A 4DFKA 3IWNC 2EK1A 2GQ2A 4KE5A 4HH1A 2B6AB 1Y5NB 4KGVB 2HFUA 5C7PA 1S6OA 2ZKUA 1LW0B 3T19A 2LDIA 5IV4A 1A9NB 3SV3A 4DV7J 3CF5Q 4JYAJ 2Z57B 3CJ4A 4DL4A 5AJ3F 1R31A 4NLPA 2VPZB 3CJ0A 2MY8A 2Y1LB 1NJZA 3CCVS 1HA1A 3BF4A 3LAMA 3I82A 3PW7A 1HW8A 4OHVA 2YNHB 1WC3A 4DF4A 1N5TA 3LUYA 1WF1A 4XAKA 5LSRA 5KG4A 4O3QA 4GVLA 4YB7A 5U47A 3W5YA 4W92B 1H2TZ 3D1OA 2WZ1A 3HP6A 1C0TA 5T41A 2C2ZB 2VL1A 1QDUB 3VZIA 1Q82T 2VFSA 2LQ5A 3HHNB 4AL7A 2M2BA 2Q3PA 2GAHC 1S9GB 5B0CA 4DR4F 2DEIA 3DN9A 3BPSP 1HHQA 3PYFA 1U2RA 1EP4A 4KGKA 5KFQA 2OUGA 4ZA1A 1Q0NA 1WEZA 3UDEA 1KR4A 2BANA 5L38A 2WVDA 1H6KX 3S8SA 2WB4A 4ED3A 4NZ7A 3NS6A 3MMJA 4ZVQB 3K5LA 3CCWA 3OTEA 2MKJA 4F50A 3Q24A 4OZ5A 2K7KA 1ZPVA 1RTIB 3CEDA 2GA7A 3EGWB 3NNAA 5HROA 4WFZA 1YJ9S 2UV8A 2F4VJ 3HHEA 1IR1A 1D9DA 3D0GE 1GXLA 1YITS 2IDLA 2NR0A 2AZ1A 1U26A 1T3NA 3ZZOA 4B3OB 2CVEA 4CI0B 5I42B 2GGPA 1SKWA 2J6SA 1TL3A 4U7UD 4PUOB 2HZCA 1SXLA 3EXCX 1F9EB 1KVKA 3MM7A 5D15A 5HSPA 4MT1A 4X4RA 3M8QB 1IBLJ 1S6QB 2KRRA 5KFWA 1EKRA 3BSCA 2FC8A 4ZITA 3I9ZA 4M5GA 2YWWA 3MMBA 3HM9A 5HQ8A 2W2MP 3GE9A 1VQ5S 2IRUA 1SL0A 5DO2A 3VAMA 2V2KA 1KSPA 3T41A 3KK3A 4YS2A 4U8VA 2XNRA 2ILZA 3Q8QB 3MF5A 3KJFB 2KXHA 2DHXA 1WELA 2BYCA 3NNCA 4ELVA 2FHMA 8RUCA 3MWBA 2RRNA 2OP5A 1JNZB 2DGWA 4FS2A 5KG7A 3DMJA 3ET6B 2C22A 3GFYA 1HBOB 2LYVA 4IQMA 4R5PA 2KHCA 3TARA 2Y8WA 2AGPA 3LO3A 4Q0BB 2OD6A 1KN6A 4K0KJ 2EC2A 3PYGA 4WE1B 4ID5A 1SC3B 3PX6A 1XBWA 5M2RA 4ECUA 4HI2A 4AL6A 1PSDA 2DR8A 4OZNA 3IR7B 2KZMA 2CNLB 2RRBA 2DGTA 3DXSX 1X5SA 1ZZFA 3EUNA 4L76A 1RAOA 3JQMA 1MWZA 2WSCC 2UXBF 2IBKA 3RB3A 1P1TA 2C28A 2FLNA 3OQ2A 2CQ0A 3OT9A 4JI8F 1RP5A 4NI2B 1QSSA 4QU7A 5EX0A 4DV3F 2IM3A 2M5YA 4MFBA 2W4DA 3I0SB 4IKAA 2LA6A 2VG5A 3W8PA 1F9HA 4USJC 2XMJA 2ATLA 3R2DJ 1R89A 2QA4G 1XEZA 2V8PA 2HQIA 3M6XA 3MAQA 2AQ4A 3C2PA 3GB0A 2DEJA 4LRDA 3TANA 1YG0A 1SJ1A 1XN9A 1ZBTA 4NLXA 2YQ0A 3SYZA 2D7SA 1WORA 2HNDB 1D9AA 2LMIA 2KI2A 3F41A 4PKDB 4FXWA 3RUBL 2ZZTA 1FTRA 4HHJA 4F02A 2EFNA 3A8KA 5KAKA 4J9KA 3IN5A 4UUWA 1VQ6S 2X3DA 5KFKA 4WTOB 4WFBQ 1E6YB 3VWSA 5I3QA 4QWCA 2GV1A 3GLJA 4CLUA 3QJPA 3UI3A 1WJ9A 2PD1A 2FJVA 2ZD1B 3ENVA 2W9AA 4Y2CA 3A1YG 5LJ3Y 1PIEA 5B09A 4IOBA 1SIZA 2D3UA 5F3TA 4DUYF 1HKAA 2E1CA 3KHRA 3FDSA 3LAKA 4ZVRB 1K9MT 1QTMA 3CD7A 4RLEA 1UVJA 3R5DA 4Z2XA 5DLFA 4EO6A 4Z7CA 1BGXT 2RF2A 4M5KA 5A6PA 1WG5A 2LECA 3RRHA 2BJ3A 2DNZA 1R0AB 5ETSA 1UZDA 4FYVB 3PFOA 1Q79A 2BW7A 5ETLA 1X4HA 3DOKA 3CB4A 4LSLA 5EDWA 1Y11A 2NPIA 4RBVA 3J7ZT 2D3OR 2ACMA 2QJ3A 4BCAA 4FS1A 4F2RA 2HGLA 4CO4A 3W9JA 3IG1B 2UP1A 1BD6A 1FO1A 1D3WA 2WW8A 1R8CA 3K5NA 5F9LA 3MUTP 4EBCA 2IYIA 2QL7B 1VC5A 1HYSB 2ZH3A 3UR3C 2P6TA 1S1VB 4L73A 2W9CA 3H20A 2VBYA 1SPBP 2MYFA 3QNWB 3TVYA 4ZN1A 2YTCA 4DX6A 1FKAF 1B0TA 2D1CA 3FJ2A 3H5SA 1L3KA 2WHOA 5E3RA 5A8RA 1JX4A 7FDRA 4B9NA 5C2CA 3DRPB 2DRAA 3KLFB 1J27A 5E2QA 1U6ZA 4P9SA 1X4CA 4RW9A 5KG3A 2P8IA 2CQPA 4JOUA 2H54B 2BZ2A 3BR9A 3C6UB 3KUEA 3BKUA 3ITHA 1SI9A 1CBKA 4QIEA 1FRHA 2XYPB 4B3MF 1VQMS 2WOMA 3X1LB 3KLEA 3KLIA 4YMEA 2JZ5A 1RDRA 2R9LA 2BQUA 1MMDA 3TJAA 1C0UB 3RR8A 2A3JA 1MWYA 2KM8B 3CCTA 1UFWA 4N77A 2B43A 4I69A 2HHHF 3CE8A 1OY6A 3IP0A 1JLBB 3G8QA 2FJWA 1YJNS 2CNNB 4RUBA 2NSCA 2MLXA 4ZJOA 1ZA2B 2V50A 1NKBA 3TUIC 2QGFB 2HQGA 4GVBA 1RUSA 3CC2S 4WP8A 2RD5C 3HI9A 2W7OA 2IMWP 5LOQA 3HULA 2RNEA 4J37A 5L46A 1VJWA 2V5HG 3VGUA 2FD2A 2M8DB 2KYZA 3PNIA 2B8QA 4CH1A 2AYMA 2GVDB 3Q23A 4HACA 4OX8A 3IM8A 5KFTA 3KJVB 2CZ4A 4K4TA 2VKZG 2ZZMA 1LFPA 5KFVA 1UW4A 5ETNA 2V34A 4ED7A 5D6GA 1UKUA 3E3XA 1MMLA 4U7CA 5EHHA 3KWMA 2XS7A 5C42A 2J9DE 4Z37A 5K8PA 1RKIA 1GQEA 1M1GA 5GAEU 3SXLA 2BV3A 1HL6A 2E5HA 3C66A 3AA8A 1LKZA 5F41A 4A8SA 5IWAF 4V1Ak 5HLFA 2DCUB 2RSQA 1FNXH 2F1FA 4PYAA 2IM0A 1OPZA 2FGCA 2YH0A 1APSA 2B56A 4I7FA 2VOOA 3JYTB 3QIDA 3NGTA 4QBUA 3P5TL 2DNMA 4U7UK 3V4IA 4X4QA 1FWPA 3C6TB 2C3PA 4N47A 4G1QB 2HNZA 2VG7B 4RUHA 3MDFA 3GV8B 3M8RA 3DI6B 4PWWA 5HJYA 1RT4B 2CQ2A 1YJTA 4ZVHA 4Y6IA 1S0NA 2XB2D 4DHVA 2HW3A 5J1PA 2D3ZA 4B3RF 5HJXA 2HEKA 2FY1A 3OV7A 1WNEA 4LF2A 2G0JA 3KXDA 1CQNA 2CYYA 4J9SA 1JLAA 2E9RX 1EETB 5BR8J 5B0FA 3FCWA 2YQ3A 5GADU 2VQEJ 4CLPA 2AJ1A 2GMLA 3SCKE 2LXIA 2X7IA 4RWXA 3H5UA 2XHWA 1MWQA 4DU8A 4CYUB 3A8IA 2Y1JA 1HI0P 4OL8A 4LR9A 4CNYA 4FKXA 4F2SA 1MROA 3TUZC 3PIPQ 3PW0A 4WIIA 4JI6J 5CYMB 1T9XA 4KPYA 1FRKA 4CLYA 3LOUA 2JEIA 1N36F 2DISA 4AFFA 3LGNA 4HKQA 3OL7A 3ZNUA 2A10A 1FDBA 1QUPA 2A1BA 1OMSA 1FVSA 1FWLA 2HHSA 1DARA 2Q1LA 1IBKJ 1HNXF 2Y8YA 5KT3A 2K1RA 4F4XA 4QPTA 3W65A 3QFWA 4CO2A 3EVMA 3NY0A 1RWKB 2DR9A 4EZ9A 1N8RT 3CD5A 6FDRA 1TL4A 1PAEX 4K4SA 3LP0A 4IG3A 2DNLA 3ZO7A 4DV4F 4WBFA 4EO8A 3PVXA 2I38A 2GNKA 3V81A 4F26A 2CPXA 3UE2A 1HW9A 2OEKA 3TJ9A 1VHIA 3B6BA 5KG2A 4JI7J 3EDRB 5H9EK 4O3NA 2HRTA 2XMTA 3IS9A 2J0QD 2YWGA 3OTDA 1CLFA 8AT1B 2C3MA 1N5QA 2V68A 3W66A 1Q95G 1VBKA 3G9CA 2RIJA 3T5KA 4CLZA 4OYZA 3C46A 2X1BA 1L5UA 1T03A 2J6UA 5E41A 2PEBA 4EFAC 2YNGB 2AJ2A 3NXZA 1CVJA 4RNOA 1EB0A 3DGVA 3S1TA 4WK1A 3TRGA 5BJRA 1J5OB 5HANA 4EBDA 1NU4A 4LQ3A 1KWMA 1BQMB 4N8NA 4OZLA 3MHYA 4DMZA 4B9TA 4C8KA 2DITA 2NXEA 1R6VA 5H1SV 2AV5A 1NSQA 4FYXB 2BJ7A 4KGMA 4WU3A 1NMEB 2KT3A 4EBEA 1OYDA 4ENOA 2C42A 1LWEA 2EXUA 1DAXA 2IVFB 4KFBB 2I5JB 3PX0A 3C14A 5EWFA 4JI5J 2OLWA 1NJIT 7AT1B 4DSJA 1GMVA 2CFXA 1WHWA 1IWAA 3LP1B 3PEHA 1H2UX 2YPYA 4USUA 3BKFA 2CQ4A 2V4JA 1TUWA 5BYRA 2XGPA 1YSJA 4MIAA 1MU2B 1SJ4P 2BXJA 1U6BA 3L7OA 1FXLA 2UXDF 2AIRB 3MEGA 2OJ3A 1X9MA 1NXIA 4HHHA 2IC3A 4JUZA 1TL1A 1PYTA 4DV2F 3Q83A 1YK9A 2OPSA 3FUYA 3GSDA 4TY9A 2BE2B 1ICEB 4RW6A 3FCVA 1S4FA 3G8TA 5KG1A 1YRTA 2G2OA 2B7BB 2QSFA 4F04B 2KL8A 4TU9A 3OW2R 3IGVA 3UN5A 1Q81T 4QWBA 2Y1IA 3QWUA 4ECXA 2EFQA 1GT8A 4KY3A 4YHHF 4LR8A 3HCXA 4P10A 1QAIA 2OTLS 5HQMA 3KKFA 1DTTB 2K06A 3MM8B 1RA7A 3SDEA 1W2IA 4LUBA 4I6YA 4ZPDA 2WRMA 3MURP 3DRRA 5C25B 3Q8UA 1FA0A 5JUMA 1M5OC 3AHPA 3NGUA 1XNRJ 1ZAXA 2ZJQQ 2LEBA 3MPWA 3D6MB 1I1GA 2MZSA 4IG0A 4ZK7M 2ABYA 3F0NA 3J80U 5HMXA 3D6TB 3D9BA 5HVFA 3IFEA 1S1TA 1R0BG 4FN5A 3TAPA 1NPPA 2ZH4A 4OYPA 4GO5X 3FZ2A 1DZ5A 4CO3A 3B4DA 4JV0A 2IRXA 2W4CA 1S1XB 3H5YA 2KB2A 1Q8BA 4B9MA 2F8HA 3RG6A 4X4PA 2GHVC 2OH2A 4QOTA 1JIHA 2CQCA 4LFCJ 5CA5A 3BQ1A 1N52B 3E2EA 2JHEA 1J5EF 4F25A 3BQ0A 1A0OB 2BMBA 4UF4A 1LWFA 4LSLB 5KFCA 2MKCA 1AZSA 1FEHA 1V5VA 3QT6A 2AEMA 3R5CA 3JB9k 2SXLA 1KFDA 4JV1A 3MAAA 3PHEA 2HLTA 4E8UA 4ZVTB 4DX5A 1G3OA 1VHFA 1QE1B 1N5YA 2EKYA 3UCUP 3IWXA 1SJFA 3NL0A 4ERDA 3HKWA 3THVA 5HQLA 4UZCA 1HR0F 4PG7A 3I0RB 5DGAA 4LBIA 1VQSA 1FJEB 3FBBA 2VG6B 1HQEA 3K0JA 1FE0A 5H9FK 4ECVA 3EWGA 5KFUA 1SQEA 5J1NA 4LFAF 2YNFA 2DR6A 1J2VA 3OR2A 5A8RB 3U02A 4ANCA 4KV8B 1VDHA 3KG0A 3E01A 2YX4A 3UFCX 1E6VB 3MFIA 4DR7J 4DN9A 4ZKAA 2R7XA 2FVRA 2MKIA 1NK0A 2QT7A 3WX4A 1S1WA 1N32F 1SV5A 5DS7A 1SKUB 4BS2A 4JI8J 4EYIB 4NASA 1TTHB 5LXYA 4LF8F 1HBUB 4KGXB 4IRKA 4FP9A 3DRYA 1BLUA 5I3UB 3J7YI 2ZC3A 1RBAA 3OL6A 5IOLA 3SQGB 2AJ4A 4Q44A 4HT5A 4ZDNA 1I94F 1REVA 3C15B 2J9CA 1VI7A 3T3FA 5A8WB 5AT1B 3PJXA 5GVQA 1HBNB 2EBGA 2E7VA 1PJ7A 3M4XA 4I2PB 4Q5VA 3CNQP 4X4VA 4LFBJ 5T7LA 4UW2A 5DGBA 1WF0A 2VBWA 3CDWA 1IKYA 5CYQB 4F3OA 1Z2LA 4OMFG 3RAXA 2EFVA 1DY3A 1HBMA 9RUBA 3CCZA 3FEXB 4Y3CA 2C3OA 1WUUA 3DLBA 3Q8PB 2R2SA 5KFOA 1KVIA 4C8OA 4Y65A 4JBCA 1WC6A 3CMQA 3R97A 1K73T 4QU6A 2OD4A 1RB0A 3U1NA 2UVVA 5KFXA 1QLNA 2Z56B 2YPZA 1VBYA 2VIHA 3CIMA 1I5OB 2E5IA 2QRRA 4ECQA 1KLMA 1VFJA 1U0HB 3KMQA 4ECRA 3C16B 2E1RA 1VIOA 3ZZYA 3W63A 3BBFA 3NBPA 3OFGA 2RUGA 5JVGQ 1SH2A 4I6WA 1JLQB 4C48A 1NK8A 2XM3A 2EI5A 4GKKJ 4WFAQ 1NSKL 3CJKB 3V6KA 2M70A 2G2YA 4IOAQ 2HHWA 2OPRB 4F0HA 4MH8A 4NX9A 1X8DA 4GC6A 5CXTA 3PR5B 4CRJA 5DZ6A 1RT1A 3KOAA 3DOLB 5HLFB 2POKA 2Z4PA 2YKMB 1KFSA 1IKXA 4I7FB 1CULB 2CQGA 2OPQA 1WKKA 1NNDA 5L1IA 3P8BB 3LA0A 1HPZB 2ZNYA 2DVIA 2YNIA 5F8LA 3DLJA 1UJ6A 4J9VA 3BGUA 2HNYB 2KFNA 1PJ5A 3CMES 2FC9A 1XJWB 1VIXA 2QV6A 1LV5A 1R8BA 2HPUA 3L09A 1EX8A 3CSKA 3QGPA 3QAUA 3Q22A 5DDRC 1C1BA 1VRUA 3E51A 3FMWA 2DGOA 3NCQA 3N01A 1TZ0A 4LSZB 3SI8A 2IM2A 4H4OA 4ZLPA 1QAXA 2RU9A 2FHJD 3NG8A 2XS5A 5JXSA 4IO9Q 4CO5A 1D8YA 1P9QC 1WKLA 4FBUA 4PPZA 2XG8A 4N5SA 2JSXA 2RDDA 1KQFB 2YVSA 2OO4A 3LTOA 3OTBA 3KYLA 4ZVEA 3CDEA 2FJDB 2IMOA 3P49B 4L3KA 4RW4B 3NCPA 3MCMA 4B3MJ 3B8HA 4ZP7A 1ROFA 1RHKB 4JI0J 2KRBA 5AXMA 2LXUA 4C3MA 4K4YA 3S7RA 4DU7A 3KLGB 2XSJB 3BO3A 2U1AA 2N4DA 3K7RA 1S77D 3MECA 1ZTTA 1ZZNA 3M8PB 1CJKA 3HT3A 4PWUA 3M2UB 3H2VE 5FJ4A 3ZFVA 2OFHX 1K1QA 3VAKA 1TVRB 1R8HA 4AYBD 4M5HA 1UW9A 4A8OA 4KH0B 5DLGA 2D74B 3H2UB 3NLCA 5FLXY 2KJWA 2YH1A 4NLVA 1JJ4A 4XPCA 4ZP9A 3CXCR 3OR1A 3UNYA 5DJBA 2M0GB 4IRCA 1ZPWX 1X9SA 2ZHAA 3GIJA 3EGNA 1TK5A 4OYWA 2MJNA 5IT0A 1FTCA 1NEEA 1FK9A 4ECYA 3J7Z5 3POTB 2EWHA 3CJ8A 5LM7E 5A2QY 4XDDA 1H0HB 1CG2A 4DSFA 3D28A 4JI1F 1RTHA 3H25A 4P2MA 3MPDA 2CG4A 1HFEL 2B9EA 2CQIA 1WWHA 2IFXA 3QAEA 4GO7X 3VCDA 3RU0A 2DY9A 2ZKTA 3IRXA 2GMHA 2XMWA 3LGMA 2D9OA 3GR1A 4A8XA 5H9FJ 2DO4A 4IFYA 5K14B 2CPZA 1S0OA 1DJ0A 1VJQA 4KYZA 2MPUA 1UVNA 1H7XA 3KLHB 4NXNF 1IM4A 2AYEA 2MGZB 4QIFA 1LWEB 4KTQA 4XDCA 3BS9A 2RS2A 3GQCA 5CQGA 3BB5A 2DNHA 3CCQS 4P2SA 4KHMA 4DV1F 1VISA 3QT8A 5E3AA 4RJVA 4KHPJ 5IC6B 2HLUA 3GMGA 1H38A 3HLUA 3TZWA 5CYJA 4XIUA 4G1IA 3UD4P 2L48A 2IIHA 4LIWA 2JVOA 3L7UA 2JX2A 2QMWA 2IA6A 2CNOB 5K20B 2CJBA 1UPMB 3MEGB 5FDLB 1TQLA 1IWGA 5C2GA 5THWA 4ZP8A 1BWVA 4DSLA 3A8JA 1SC6A 2AEJA 1JJHA 3BDPA 2W25A 3FSYA 4DPUA 4FVMA 2ZM6F 1YTYA 4M94A 2KVIA 2BX6A 3Q86A 5K8OA 4KO0A 3SMZA 4PZVA 1Q86T 4NOHA 1LK7A 2XEXA 3HF5A 4J9NA 4X2BA 4DPOA 1N36J 3VHQA 4URQU 5A8KA 3H8YA 4R8UB 5J2NB 3SQOP 2DH8A 4OJHA 3D3CJ 2B6AA 4E98A 2EFPA 4X65F 2HHVA 4WJBA 2DGVA 3DCAA 3TO8A 1X5PA 2VONA 1Q1KA 2N7CA 1Q5YA 3VVUA 2Z2ZA 4A46A 6AT1B 3LPYA 2MZJA 2IM1A 1FKPB 4A8QA 2H1YA 4QW9A 1RT5B 5IT9Y 4ED0A 1V5IB 3FZBA 3RB0A 4ES1A 2W8LA 4ETZA 3CD6S 2N4CA 4LF4F 2BOPA 1TUVA 2YNHA 5AXKA 3AH6A 1ZM4A 4IR1A 3K5MA 4CLWA 3FCHA 3MM6B 4AXJA 3GYGA 5E0OA 1M5SA 2F40A 3RGIA 4ES3A 4J9QA 3I87A 2GO8A 3ZZPA 1S5ZA 5HATA 3OL9A 2FVPA 1N54B 4P6QA 2UUTA 2RQCA 3JAMY 1AZSB 1S9GA 4PG5A 3QYYA 2X1GA 2ZE2B 4RKUC 1OO0B 3O6QA 2HHTA 1W7WA 4NLRA 1NJWA 2UUBF 3P4UB 2EC0A 4WCEQ 1S97A 2NUUG 1KHVA 3TUPA 3OLBA 5J2MB 4UOFA 4NZ6A 3W9IA 3QGIA 3MR2A 2YKQA 2HIYA 5CCMA 2QEXS 1RTIA 4DR6J 2DJWA 2KT2A 4RPFA 3NAIA 2X1FA 3D54A 1X4FA 2NUHA 4EK2A 3NWRA 2B51A 2NZ4A 2KHDA 3WDOA 3D1HA 3D1QA 1KTQA 3THPA 3OR2B 1VQ9S 1BQNB 3ISND 1PC5A 2VZ9A 1UCNA 3N79A 1U1NA 2DR7A 3DHWC 5G0RB 3AAWB 4EU0A 4YDXA 3GYXB 1H74A 4PUOA 2F5GA 2F63A 2PIIA 2CKWA 1SV5B 3LP2B 3DU5A 1U02A 3BPDA 2UXDJ 1RAHB 2L41A 1HARA 1S6QA 4RNHA 1RAEB 3C19A 3VAHA 3ZZZA 1P8GA 4QIGA 4ZPAA 4NYOA 3CDAA 2RKIB 4XPEA 2QL5B 2LQ8A 1NM2A 2GJ2A 5BXIA 2UUCF 2IA0A 4ZJQA 3VAJA 1AYEA 2XTJP 1Y5LB 2DNYA 1RWXB 5CHCB 1REVB 5HK4A 1C1CB 3RBDA 1N0UA 2WVEA 2ZUGA 1R27B 4RW8B 5CD4A 1U1PA 2FJAB 3QSIA 4C0BA 2CIMA 2B9YA 2DIVA 3D4JA 4QWDA 1KOHA 2B4OA 4BLGA 5T7LB 5LMNF 4YHHJ 2HFZA 2YBVA 4ECZA 4HL9A 5DDPC 3M8SA 2ZBQA 2F9DA 2DCLA 1U25A 1TL7B 4DR3J 1RZMA 1HBMB 3DFEA 5RUBA 2BQ3A 3ET6A 1HWJA 5IT9U 2XZTB 1HBOA 4NLGA 1XC9A 2J9DA 4P73A 3KNGA 1XR7A 4AL5A 2RE1A 3M6WA 1HI8A 2VPYB 3L95X 4YDDB 2C1EB 4ZLNA 4Q0BA 1IVZA 3C8YA 4FKYA 3BZQA 4DPTA 5FD1A 3I4PA 2CQDA 4WE1A 3OJUA 3V5RA 3FRZA 4K2XA 1GX5A 2MJUA 3OTOJ 3EJMA 1URRA 2MZ1A 3BGFA 3TAMB 2X3GA 1N6QB 2APOA 2RT3A 1FRLA 5HP1B 3I5AA 3BM7A 3EZOA 1B7FA 5AE1A 4JI3F 2KXFA 2C2MB 3BEGB 1IQZA 4F4ZA 3BGOP 4F67A 4NI2A 3PJ9A 2E7XA 1UTAA 1V3ZA 1SIWB 4PWDB 2RAQA 2W8KA 5L9NA 1Y7PA 2FUG9 3I0SA 2HVDA 3QSYB 2DRDA 1X4DA 4P7TA 1G1XA 3PHTA 1WC1A 5E33A 5KFHA 3QGGA 1RISA 3H7HB 5ETPA 3UWTA 4QWEA 2K8GA 1EKSA 3OXGA 3GSIA 3CTRA 3MTJA 1HR0J 3AOBA 2HK2A 3Q8RB 1YGYA 1Y0HA 4NA2A 1VC0A 1EARA 2HQFA 2HNDA 4LFAJ 2UXCJ 2DTJA 3SBMA 1VC6A 4C9DA 2XBPA 1VRUB 2KU7A 2MQQA 3TJ8A 4YP3A 5HBMB 3AD8C 2HRUA 2C2OB 4LVOP 1S1UB 1ELOA 3NS5A 1RYRA 1FX2A 2V2ZA 2ZD1A 1N33F 2OMOA 3W8GA 1RWPB 2A0FB 2JDJA 3V6HA 1U49A 1VS3A 3G8SA 1A7GE 1N32J 1YI2S 4O23A 3RAQA 2ZH1A 1S48A 3ENAA 2QTWA 2RMLA 1DLOB 3SSRA 3PCOB 1YZ6A 4OV6A 4LF8J 2Y0SD 3H98A 4C3KA 5D78A 4EUVA 1KD1T 5KFSA 4Y2IA 4RU9A 3CJ2A 4J90A 4O3PA 1R0AA 3U1MA 4OI6A 4ZN3A 3G6VA 2MMYA 3GU0A 2BJ9A 3AQPA 4FPIA 1M5PC 3HX9A 1DFDA 2G0IA 4CWBA 2ZH2A 4FYYB 1YZ7A 2G1DA 3FFIB 2MQ8A 3MM5A 1NH8A 4KQZA 2XMKA 4M5NA 4KBIA 4KPCA 4HR2A 3IBWA 2ALZA 4RNNA 2QA1A 2G9OA 4Q8FA 3RRKA 4DS5A 1N56A 5HI7A 2FJBB 4ES2A 4KT0C 5GMDA 2E1PA 3RZAA 1HYSA 3BBCA 1S1VA 1B0VA 2VQFJ 2LEPA 3V6DB 3IC1A 4WU2A 2DT9A 5DG7A 5IS2A 1IR0A 1FFWB 1TKXB 1D1UA 3AD9C 1O8BA 2KJVA 4S0MA 4C8MA 2CA9A 2E66A 3TI0A 3DRPA 1NO8A 2XY7A 1HQUA 4X62F 1MNEA 3ICLA 4ED6A 1CJUA 1IJEB 3IRXB 3T5JA 4UT4A 3C6UA 5B0DA 2V8DA 3GV5B 1MN7A 4C4WA 4IH5A 1T11A 3DU6A 1W26A 2MXYA 4L74A 2VFRA 2AYGA 2VF3A 4N8OA 1SCJB 3FNNA 2XLIA 2W2PP 4DG1B 4O44A 1C0UA 5DM7Q 3TR5A 2RUSA 3K59A 4DSKA 3I5BA 2QZ8A 1GX6A 2DHHA 2PSZA 1NB2A 2P6SA 1I3OB 2KXNB 2WK4A 1VQNS 1JLBA 4KIAA 1U24A 2R7OA 3ADAC 3AA9A 2F9JA 3L7PA 1T02A 2RQKA 4TQRA 1GFWB 1ZOTA 3WC2A 1M1KT 1CC7A 1U2FA 2QIFA 3SSQA 3Q2TC 1RTJA 2L3MA 3DYAA 5KFIA 3D6HB 3K89A 1F60B 4NLWA 3VF0B 5HN0A 3OXLA 4DSEA 3RB4A 5ETRA 4C3LA 3QO9A 2HQCA 3HHLD 1WTFA 4NA1A 2DGSA 2UVRA 2C3YA 3WX8A 3DLKB 1JWWA 4DL6A 2GVDA 2JLFA 2YWKA 3KJVA 3PW4A 3EZUA 4OZ3A 2C2NA 2V2VA 2O67A 1H3DA 1XNQF 4DR2F 4OYAA 4E2FB 3ZZUA 3KK2B 3LWMA 1P1LA 4URSA 1S9EB 2LQBA 1IBMF 5HMWA 3HHKA 3P6YC 2QSWA 4AQYF 1EJ7L 4NCBA 2BABA 2V69A 4DV0J 3CPWR 4QZVB 1N4LA 1U2CA 1NDKA 1D0EA 1XMOF 5IC4B 3TEGA 2OELA 4OX9J 4NL5A 3CVKA 2DD8S 4HTJA 1GMWD 2V0NA 2HFOA 3JYTA 2ASDA 1IKVB 1VQ7S 3OFEA 4WXWA 3J81Y 4H54A 3C6TA 3NP5A 4DV7F 4G1QA 4JYAF 2VG7A 3CCSS 1S57A 1NKEA 2ZC4A 3DI6A 1S9FA 1RT4A 2CZ9A 4OQJA 4WFNQ 3GTYX 2VB6A 4I6AA 2A2CA 2EFGA 2MHEA 2FTRA 2QMXA 3BREA 3UN2A 4EMDA 2JNJA 2Q66A 1EETA 1R8AA 1JJ2R 3VAGA 4L72B 5KT6A 3G6XA 3UD5A 3WHIA 4TNOA 4UTGA 1PJ6A 2CJXB 4OYBA 3CJTA 3OXFA 1IQTA 2LFVA 1JMTA 4IH7A 3A12A 2E5LJ 3CJSA 2DH9A 3HSDA 3J7YU 4I2QB 3T5HA 4CYUA 1WHXA 4X84A 1IXKA 2H9ZA 2IJFA 3Q8SB 3ISNC 2Z2MA 2MZTA 2IHR1 5CYMA 1HNWF 5M2UA 2NQPA 4KSEB 3RB6A 1VRTB 4NXNJ 1KQSR 2O1PA 4LRAA 1FDNA 4P52A 1AB8A 1RAGB 4OJ1A 1T9UA 4CO1A 5GAHI 3ZZ0A 3VALA 3BH7B 3G2XA 1QUVA 4JI4J 4FXDA 2CQHA 2B9XA 1YVFA 4LRFA 2XMVA 4B9SA 1S79A 3N6LA 1OWXA 3HJFA 3TQEA 4R0EA 2FJXA 4AUKA 1RT3B 1BXNA 1HNVB 2J7UA 1KKHA 4KGZB 2H5JB 3D0IE 2M88A 4K4VA 3HK2A 1TELA 3O44A 4ZPCA 1Z1ZA 2YQ1A 5J1EA 4X64F 3BR8A 2K7JA 4WP9A 1R3NA 2XZWA 5E3CA 2HKEA 1NHUA 1NK6A 5SZTA 1S49A 4WWSA 4CT8A 2ZUAA 5D4PA 4JV5J 4YEAA 3FSXA 1UETA 4MKAA 1F3VA 2GC8A 4H4KA 1YBUA 3ZC4A 4GKJJ 4F8RA 1UWBB 4FPRA 3GP9A 2HG4A 3CW2C 3W2VB 1HD0A 3T1HJ 2AGQA 1WF2A 2YNGA 2H48B 2D69A 1V9OA 4WPAA 4LBHA 4H4KC 1J5OA 1WDTA 2F8MA 2BQRA 2M52A 1I6JA 1BQMA 2ADBA 2O5DA 2UUWA 2Q79A 5EUHA 3QT7A 1YWXA 1VQLS 2OI2A 2R4FA 1TAUA 3SIPB 4ELUA 4CH0S 3MPYA 4LF9F 5DZ7A 1LNQA 4KFBA 5HO4A 1OSDA 2I5JA 2R2UA 1HNZF 3MEEB 2PC6A 4LF4J 4P72A 5D3GB 4FZVA 3LP1A 2ZBRA 2V8HA 2HFNA 2HHQA 2BOAA 4K0KF 1WHYA 1FD8A 1RWVB 1FRJA 2MHNA 3K17A 3H2LA 3EE3A 3UDCA 4C11B 1MU2A 1XIQA 5D77A 2HVIA 1HWIA 4F0MA 1CJTA 4PPDA 2W2OP 4DDFA 5ETTA 2K3IA 4X4UA 3CJQA 2X51A 3PKMA 4C97A 1YBAA 2MKHA 1CS4B 1U1OA 2ZWPA 2FLPA 4V19X 1FNOA 3QMQA 3ULHA 5D0RA 4PQUB 5E3PA 2UUBJ 2RHSB 2BE2A 4DX8H 4USMA 2VKRA 3M32B 1Y4ZB 2PT0A 1WTBA 1HWLA 4AT1B 4C98A 1RXOB 1QVFR 5F8MA 4QJVA 1X31C 3PRVA 2H5IB 4CQ1A 1TK8A 2FZCB 1RHUB 2GX8A 5JVHQ 2AMCB 1DTTA 3MEDA 3MM8A 1AFIA 3P96A 3MUVP 1XWLA 3DM2B 1JLFB 4OJGA 1X9WA 1S12A 4RZRA 1K1SA 1UEKA 3MCNA 4IH6A 5C25A 4NPOA 1FKOB 4CO0A 1LQ9A 2CPJA 2B4UA 1S6PB 2V9WA 2RS8A 1LEOA 1R8PA 4Q43A 2QYCA 1N5SA 5DM6Q 1VQKS 4F4WA 2PDAA 1OY9A 4RNFA 1SKSA 3RYLA 3GCXP 1YDLA 2ZBCA 5M2PA 3IM9A 1KDNA 3EGVA 3I4HX 2V4QA 2ASLA 3M7VA 1UA1A 3VGVA 3EYZA 3TA1A 1S1XA 1BMQB 3M30B 2UUCJ 2F7VA 4C7QA 3J7AN 1QAJA 2XO6A 1TL5A 1U1LA 2MKSA 4OHXA 1SJ3P 2DHSA 2VJVA 3H0PA 3H40A 1RTDB 3FVYA 1M5VC 1LW2B 1UVIA 4LF6J 2B3TB 5CZVA 3V4MA 4DQSA 3MM5B 5LMNJ 4QIVA 4LF5J 4NXMJ 2HWIA 3W60A 1L3SA 3HT0A 2E9ZA 1QE1A 2ZJRQ 1FJ7A 1FJCA 3AB2B 4OHYA 3BGRB 2BW2A 2F65A 3KJQB 4EZ6A 2D41A 2BRKA 3I0RA 4MYUA 2BBEA 4DFMA 3CC4S 4RUAA 3G86A 4TXSA 2MQLA 3BDEA 1YHQS 4Y0FA 2R3VA 4MIWA 2VG6A 5KFRA 1GTEA 1QVGR 3GFZA 1RA6A 2EG1A 2EEYA 4H4MB 1UFLA 4J9RA 4BC9A 4D3HA 3MPUB 4KV8A 4M5IA 4IR9A 1AT1B 4TYBA 5KFJA 2HHUA 1HQUB 1E6VA 3JTPA 2HFVA 2XHCA 1CJUB 4BDPA 3SSSA 3GONA 4DX7A 1RHMB 3OVAA 3N5FA 3HSJA 4ID8A 4LVNP 1VQYA 5EGYA 3NGRA 3TX0A 2JC0A 4RWWA 1XQIA 5KG5A 1QTNB 1HBUA 2DO0A 3JSMB 2UVUA 5I3UA 4O44B 1KQGB 3KUGA 4M95A 1X4BA 1UEUA 3SQGA 4ZVOB 5IFMA 1AFJA 3RBEA 2GAGC 1QSYA 4LQ9A 3C15A 1CSJA 2N3LA 1S0VA 2WB1D 5A8WA 1CJVB 1NKCA 3CO9A 1WACA 2B9WA 3BSAA 1HBNA 4MYTA 3HHLC 4I2PA 2ZH8A 4ZLLA 1X7VA 3OTCA 3SCIE 3B82A 2R2RA 2W7AA 5CYQA 4CLKA 2L08A 1RTJB 3DYAB 5K5MA 2I1RA 3H42A 1NJYA 4ZCMA 4TQSA 4LF7J 5DDOC 5K8MA 4RBUA 3QO9B 3OVBA 2PEHA 4OFZA 4FF4A 1GMWA 5B0EA 2ZH6A 2NXNA 2RJZA 4FDFA 2HIQA 4USTA 3W62A 3FRYA 4AXIA 1T3OA 4NLQA 4CLSA 1CQMA 3ISZA 5E5NA 3A3OB 1U0HA 4ZVPB 3C16A 2H4WB 2A18A 2AT1B 2BVZA 5F0WA 2HVZA 2IDEA 1JLQA 3GILA 1RLCL 1TU0B 1S7IA 1KVJA 5KFPA 2DNQA 3IBCB 2FQQB 1EAYC 3CJKA 3ZTSA 1WEXA 1UVKA 1GH8A 2JLGA 2BKNA 2OPRA 1IBCB 1NHVA 2C2KB 3DLEB 3W5XA 1XMQJ 1N0VC 1LFWA 3HVTB 2RRAA 4G1PA 3TZZA 1K0TA 3DOLA 4EI2A 2YKMA 1TAQA 3F44A 1PKUA 5AXLA 3ENWA 1FXDA 2JOQA 1WOSA 5KFLA 4I64A 1CULA 1T94A 1H98A 5KFBA 1JQGA 4JI2F 4A8MP 1ZYQA 4ZHRB 3H5XA 2FGOA 2CDRB 1HPZA 3FQLA 2CPIA 4L6V3 3FK4A 4YN3B 3W61A 1SH0A 5EWEA 3R5GA 4NLYA 2DK2A 2HNYA 1Z2ZA 1N34F 2KH9A 4I0WA 2MKYA 3HSZA 1PC4A 2M7SA 4B17A 2PFDA 3TVZA 2VICA 3GCWP 3G6ES 3PX4A 2G0CA 5DRKA 3MZIA 4LRBA 2H65B 1U4BA 1KLNA 3O2IA 2AX0A 2PMZD 2UU9F 5HAOA 2VPXB 4B3SJ 2YWFA 4QR2A 4TY8B 2CUYA 1JLEB 4DZ6A 2FVCA 3M2VB 1VQ4S 4NLTA 5KT4A 2AHOB 2FHOB 4K5RA 3DRSA 2H51B 2KYXA 1Q8LA 3HVWA 2GVZB 1Q7YT 1X4GA 2Y9HA 1RGVA 4USIA 2MQMA 4RW4A 4FNHA 4O3RA 3TZXA 2W01A 5E7OB 3KLGA 2XSJA 2MB0B 3MUMP 4NYPA 2RDJA 4JI6F 5JMNA 3EXYA 3M8PA 3FQKA 2Y3YA 4B02A 4NWBA 2QLJB 4WKRA 3M2UA 1FJGJ 3M8ZA 2ZH9A 1KRPA 3PV8A 4UOHA 1CEZA 2VA3A 2IY5B 3KFWX 2IPOB 1A6LA 1TVRA 3HVAA 2UUAF 4M5LA 2AZ3A 2CJAA 2FLOA 2PN6A 5I4MA 4I1TA 1FEEA 5J1EB 4QYZJ 3DGPB 4WTYA 1TV6B 2VV5A 1Q7LB 1FFGB 1RT2B 3T1AA 4MKVA 2NREA 1X4EA 5C24B 2I6WA 4KB7A 1DTQB 1UP1A 3A13A 1RYSA 2Q43A 3PEJA 3KK1B 6FD1A 2RH3A 2PMHA 1N88A 3POTA 2BUNA 3PO5A 4BHQA 4QPXA 2BR0A 5ADZA 4K4ZA 4JI7F 2OGUA 1R7IA 1YJ7A 1RK8A 5F9NA 4FYDA 2HBQB 4DCPB 1FF2A 2PI5A 2BACA 3KHHA 2JWNA 3M9OB 3HMJG 1NHKL 1PBAA 4Q7AA 1RT7B 3I9V9 4QR0A 3N5BA 1B99A 1BE4A 2ZBIA 4ILMA 2VFTA 5K14A 4C6AA 2J7WA 3KLHA 4K59A 4TKTA 5AJ3J 3MMAB 1B3TA 2MGZA 5ETVA 3HD1A 4NYZA 4B9VA 3R1LA 5IZHA 1FRMA 7FD1A 4DPYA 1GMUA 1JK9B 3GG1A 4C8LA 3M1VB 1JNRB
chains in the Genus database with same CATH topology
4M63A 3VAJA 2IYIA 3NGKA 1Y5LB 2DNYA 1VC5A 1HYSB 1MROB 2ZH3A 3HHDA 5CHCB 1REVB 1TKZB 4O4RA 1KONA 2GFFA 1C1CB 3UR3C 2P6TA 1S1VB 2W9CA 1GAOA 3SCJE 3H20A 3QWPA 3RBDA 2VBYA 5LSOA 4C0OC 1N0UA 2ZUGA 1R27B 4RW8B 2MYFA 1U1PA 2FJAB 4C0BA 2CIMA 3TVYA 3DLEA 2B9YA 2NSBA 2YTCA 1FKAF 2DIVA 1B0TA 2R7SA 4QWDA 4JI5F 1KOHA 3CT9A 2D1CA 4X66F 3FJ2A 2B4OA 1XERA 2DBBA 2B5JA 2IAJB 3HVTA 1V3SA 3H5SA 1NK9A 1L3KA 2WHOA 5E3RA 4U9RA 5T7LB 5LMNF 2HFZA 3I56S 4ECZA 4ZVGA 5A8RA 1SH3A 1JX4A 4HL9A 2R7TA 5FDLA 7FDRA 3V6JA 2CQ3A 5DDPC 4B9NA 3DLGB 3M8SA 1RQ0A 2F9DA 4TU7A 2DCLA 3DRPB 3CMAS 2DRAA 1S76D 2V8VA 2E44A 1U25A 3KLFB 5L8RC 2K1RB 1HBMB 1T05B 3DFEA 4N41A 5E2QA 1XTZA 2AP6A 4DV0F 1U6ZA 1HD1A 2BQ3A 3T9ZA 4JV2A 5KFGA 3G71S 1HWJA 1X4CA 4RW9A 5KG3A 1M5HA 4ZHRA 1DHMA 3K2YA 3CCRS 1VMBA 4J9MA 1HBOA 4NLGA 1XC9A 3CDBA 2CQPA 4JOUA 2J9DA 2XY5A 2BZ2A 3BR9A 3C6UB 3KNGA 3LP0B 1VOMA 1FRXA 2MQOA 3NMRA 1XR7A 4AL5A 4IG3B 2RE1A 3BSOA 4DEZA 1UVMA 2GIQA 3NMAA 3DOMA 3M9MB 3M6WA 4NLDA 1HI8A 2VPYB 4Q2LA 2HS3A 3L95X 4OX9F 5GAGU 3ITHA 5KFEA 3MR3A 1SI9A 4YDDB 4Q0BA 3C8YA 1FD2A 3BZQA 2LU2A 5FD1A 1U1MA 3V81B 2OIHA 4QIEA 3I4PA 1FRHA 1G7CB 2CQDA 2YKNB 4WE1A 2K3KA 2AGOA 4B3MF 3OJUA 1ZM3A 4C0HA 1VQMS 3V5RA 2WOMA 3X1LB 3KLEA 3FRZA 4K2XA 2WSFC 2KKHA 3KLIA 4YQWA 1GX5A 2WBMA 3LW5C 2MJUA 4YMEA 2FHKA 2JZ5A 3MEDB 1RDRA 2R9LA 3JTNA 1YRXA 2BQUA 2EFOA 1MMDA 2JLEA 1C0UB 5B0BA 5KOWA 2FVQA 3FEYB 3RR8A 4R8UA 4RW7B 3U27A 2A3JA 1MWYA 4DFJA 1HWUA 1JLCB 3IS9B 5J2NA 2KM8B 1MMNA 1URRA 2MZ1A 1U45A 1WG4A 2M9KA 3BGFA 2X3GA 3TAMB 5IQ6A 3CCTA 1UFWA 4N77A 1QY7A 4TY8A 1S7HA 2B43A 2OSRA 4I69A 1JLEA 1N6QB 2APOA 2RT3A 3T6BA 2HHHF 3CE8A 1FRLA 1JLBB 1FE4A 2CVIA 5HP1B 3I5AA 2ZVSA 3DC2A 3BM7A 4Y2AA 3G8QA 4KHRA 4UOCA 5HMYA 1YJNS 2FJWA 2VA2A 1B7FA 5AE1A 4JI3F 3M2VA 2KXFA 3BEGB 2GHWA 1IQZA 3QJLA 2BM1A 4HLBA 4F4ZA 2LU1A 1T03B 2NSCA 2YKOA 4F67A 1B0PA 2VUGA 1FCAA 2E7XA 1NKBA 3TUIC 1FKPA 2XY6A 4Q2MA 4CZCA 1NK5A 1V3ZA 1RT5A 1Q8IA 1SIWB 4PWDB 4PR6A 4A8WA 3CC2S 1UAWA 2W8KA 5L9NA 5DQIA 1Y7PA 2FUG9 2RD5C 1LXJA 3I0SA 3HI9A 3PJWA 2ADCA 2W7OA 3EX7B 2E5LF 1SL2A 1X4DA 4P7TA 3SV4A 1WD6A 4PG8A 2IMWP 1G1XA 3PXGa 4B08A 2AF6A 4PXEA 2NYIA 2BM0A 2RNEA 4J37A 4C8NA 5E33A 2Z8QA 5KFHA 1XNRF 3QGGA 4PXBA 1YJWS 1RISA 3E8OA 4ILLA 1VJWA 5ITHA 1YJRA 2V5HG 2KZZA 2J76E 2FD2A 2WSEC 3UWTA 1SL1A 3GFXA 2M8DB 2RDIA 4OV1A 3MM6A 2KYZA 3PNIA 4QWEA 4ECSA 4CH1A 3OSPA 4OI0A 2K8GA 2AYMA 4F3MA 3OXGA 3CTRA 2QLXA 3MTJA 4PG6A 3Q23A 4E0DA 4CCHA 2F4VF 5K9FA 2V94A 3Q8RB 1YGYA 4ZCIA 4OX8A 2IVYA 4M5DB 3IRWP 4PXDA 1Y0HA 1S10A 3QIPB 4NA2A 1VC0A 2LXFA 2EG2A 3HZEA 4EWTA 5KFTA 2B0GA 3KJVB 2CZ4A 2GMJA 4K4TA 1T7PA 2VKZG 1DQ8A 2HNDA 3L3CA 4PG4A 3DDKA 4JI4F 2ZZMA 1LFPA 1BQXA 1FRIA 2CRLA 1UW4A 4NMLA 3FMBA 5KFVA 3AQOA 2ZE2A 2DTJA 4WZQA 1VC6A 3I55S 1YJVA 4C9DA 2XBPA 4ED7A 5D6GA 1VRUB 1UKUA 3E3XA 5EWGA 2KU7A 1MMLA 2MQQA 4M8LA 3DLHA 4YP3A 2PFFB 1UVLA 5HBMB 3DGPA 5KOXA 1TV6A 3OVSA 1UMJA 4U7CA 5EHHA 3BN7A 1XMBA 1FERA 2XNQA 2HRUA 4PCQA 1RT6B 4LFCF 1RT2A 2OSQA 2AD9A 4LVOP 5J2MA 2GIRA 4NCGB 2V4JB 3KWMA 5C24A 2XS7A 1S1UB 4KKOA 1ELOA 4MK7A 5C42A 2J9DE 2NLWA 4Z37A 3NS5A 5K8PA 2R7WA 1DTQA 1RYRA 1RKIA 3QJJA 2XCAA 2ZD1A 1V6HA 1N33F 2OMOA 3I5CA 1GQEA 3CJ3A 5GAEU 3SXLA 3V6HA 2JDJA 1U49A 1VS3A 3G8SA 2QFJA 2BV3A 1HL6A 2E5HA 3C66A 5LT5A 3AA8A 1IBLF 1LKZA 5F41A 3KK1A 1A7GE 4A8SA 3OFFA 5KFYA 2COLA 3MMCB 1SUQB 5IWAF 5HLFA 2RSQA 2DCUB 2HWHA 1ZTWA 1FNXH 2F1FA 5J2PA 2IM0A 1YI2S 1OPZA 1XR5A 4O23A 2FGCA 5IT4A 2IC3B 2YH0A 1APSA 4UQGA 2B56A 3RAQA 2ZH1A 4I7FA 1S48A 4RUCA 1ZM9A 3LQVA 2W7PA 3GR0A 1YRUA 2IBOA 2RMLA 3THTA 1U6FA 1TL1B 1DLOB 3SSRA 3JYTB 2VOOA 3CCJS 4JV5F 2OPSB 2Y0SD 3H98A 3QIDA 4C3KA 3TA0A 4QBUA 3P5TL 3X3UA 2DNMA 4ED5A 4U7UK 3V4IA 4RW6B 1HMVB 2R8HA 5D78A 3C6TB 4X4QA 2C3PA 4N47A 4EUVA 4NRUA 4G1QB 3OHAA 1FNMA 1KD1T 4GKJF 2HNZA 2FPHX 4Y2IA 5KFSA 2VG7B 2MDAA 1BQNA 4KC5A 4UY85 3VQTA 4RUHA 3MDFA 4RU9A 3CJ2A 2DH7A 3GV8B 3N9UC 2OAUA 4O3PA 3M8RA 5F8IA 1SJRA 3DNCA 3DI6B 1R0AA 1RT4B 3U1MA 4OI6A 1RT7A 3U7JA 5GAGI 1TK0A 3PY8A 5KT5A 1UEVA 3T1HF 2CQ2A 1YJTA 1XR6A 2U2FA 3G6VA 5G0RA 4ZVHA 1UA0A 3CJ5A 4Y6IA 3Q0AA 2AU0A 2MMYA 2P5VA 1S0NA 2XB2D 1BWEA 4DHVA 2LKZA 2HW3A 5J1PA 4FF2A 3AQPA 1M5PC 2LCWA 3GWCA 2D3ZA 1HHTP 4B3RF 2FY1A 3HX9A 2A2DA 2RU3A 1DFDA 3LP2A 2IRYA 2ZH2A 3OV7A 2XI2A 3MD1A 1MSWD 1WNEA 2G1DA 2WONB 1CQNA 3FFIB 2CYYA 4J9SA 1JLAA 2E9RX 3MMAA 1EETB 3QPIA 2MKKA 3MM5A 2JVRA 5B0FA 2YQ3A 1V3RA 3IGNA 4HYKA 2KFZA 2DPIA 5GADU 1NH8A 3SDEB 4IQXA 1T95A 4KQZA 2XMKA 2HVHA 3HHLB 4DR7F 4FF3A 2JEJA 2AJ1A 4KBIA 2JRSA 3R1HA 5KFZA 2YKAA 3DRRB 3IBWA 5LXRA 2WAQD 2GMLA 2ALZA 4RNNA 3SCKE 2RKIA 2LXIA 4RWXA 4ZPTR 1U48A 3HKZD 2QA1A 3H5UA 2BJDA 2G9OA 4Q8FA 3RRKA 2XHWA 1S99A 1KNZA 4DS5A 5AE2A 1LW0A 4K50A 3M1VA 2FVSA 1N56A 3TOQA 5HI7A 2Y1JA 1HI0P 4OL8A 2FJBB 4ES2A 4KT0C 4CNYA 4OX7A 4A8FA 4F2SA 3RZAA 1MROA 3TUZC 4Y2KA 3CDUA 3K5PA 5IQQA 3PIPQ 3PW0A 1HYSA 4J5OA 4WIIA 5CYMB 1C1CA 2J8AA 4RNMA 4RBTA 5CZXA 1S1VA 2BA9A 1ZM2A 4KPYA 1C4AA 4IG0B 3BQ2A 1FRKA 3CCES 1B0VA 3LOUA 1N36F 2JEIA 2DISA 3EGZA 4YR2A 2LEPA 4AFFA 4MAKA 4CH7A 2DNKA 3IC1A 3LGNA 4RW8A 3V6DB 3HZGA 4HKQA 4WU2A 2DT9A 1WEYA 5DG7A 3OL7A 2A10A 1RWUA 1S1TB 3MM9B 1FDBA 5IS2A 1IR0A 3TP2A 2WTFA 2IAJA 1QUPA 1TKXB 2A1BA 1D1UA 1O8BA 1FVSA 2KJVA 5KFAA 4DL7A 2UZAA 3IAM9 4OLOA 4C8MA 2HHSA 1DARA 2E66A 2Q1LA 3DLGA 4Y00A 3TI0A 3DRPA 1HNXF 1NO8A 2DIUA 1GTHA 4I56A 1IN0A 4LMZA 5KT3A 2K1RA 2XY7A 1IKWA 1T05A 2HGNA 3H4BA 2VH7A 4F4XA 4OZ1A 4QPTA 1JXLA 3UNGC 1HQUA 1D9FA 1L3UA 4X62F 3F56A 5HL7Q 1MNEA 1W2BR 4IO1A 3ICLA 5L1LA 5KT7A 4ED6A 5KG6A 1IJEB 3T9NA 4CO2A 4Y28C 5DQHA 2R7VA 2W4PA 3IRXB 3T5JA 3GG0A 2DR9A 4EZ9A 1N8RT 1FESA 3CD5A 3C6UA 6FDRA 1TL4A 4K4SA 2ACYA 3LP0A 4LFBF 5B0DA 4B9UA 2KDOA 2V8DA 3GV5B 4IG3A 2WBRA 2R8KA 2DNLA 4DV4F 4C4WA 1LWFB 4K4UA 3LANA 4EO8A 1ULRA 3OFHA 3PVXA 4IH5A 2I38A 2GNKA 3AJ1A 3V81A 1ZETA 2MY7A 3DU6A 2MXYA 4F26A 2ZH5A 2YKNA 2CPXA 4TN2A 2VFRA 2AYGA 2ZHBA 1BC6A 1F9FA 2W9BB 3IWLA 2VBZA 4ICLB 4OIXA 4N8OA 3ZZTA 3UE2A 1HW9A 2HYIB 5F8NA 3FNNA 5CH7B 3RTVA 2XLIA 3IR6B 4IFVB 4I68A 4DG1B 4O44A 1C0UA 5DM7Q 2MQNA 3TR5A 1JKHB 4I67A 5KG2A 3K59A 1N5YB 3I5BA 4RW7A 3O1LA 4DSKA 4O0IA 2PO4A 4O3NA 2QZ8A 2R8IA 1JLCA 2XMTA 3IS9A 2J0QD 1GX6A 3PFEA 2YWGA 3OTDA 2EPIA 2PSZA 4ETXA 4IUFA 1CLFA 2DNPA 1M0SA 3TAMA 2C3MA 2P6SA 4WYWA 1N5QA 5GAEI 1N6QA 2KXNB 2WK4A 1VQNS 1Y00A 3J7A1 1JLBA 4KIAA 4LSNB 4WKYA 5BYSA 5HP1A 1U24A 5B0AA 2R7OA 2RIJA 4HH0A 4X4OA 3G9CA 3T5KA 2WCXA 3AA9A 1HQEB 2F9JA 3C46A 2X1BA 1NK4A 1L3TA 3L7PA 1L5UA 1T02A 3ZZRA 1T03A 2OKQA 2J6UA 4OLPA 2RQKA 3I96A 5E41A 4TQRA 1ZOTA 3WC2A 4EFAC 3QGHA 3GIIA 1M1KT 1CC7A 2YNGB 5J2QB 2YNFB 2HMIB 3R5AA 3GZ7A 4FVCA 1U2FA 2JFKA 3PDNA 3MR5A 2XI3A 3RW6A 4ZS6A 3W7BA 3DDNA 1Q16B 1CVJA 2L9WA 3LALA 2QIFA 4YFUA 4PWDA 4RNOA 1NK7A 3SSQA 2QO3A 2OMLA 3Q2TC 1RTJA 4GKKF 3S1TA 4WK1A 2L3MA 3DYAA 5KFIA 3E01B 2Q6CA 3TRGA 5BJRA 1J5OB 2BRLA 1F60B 1N48A 4NLWA 3VF0B 3T6JA 4B3OA 4EBDA 1NU4A 4LQ3A 1OQ6A 5HN0A 4WXOA 5KFFA 5GAHU 2E7WA 5I42A 3OXLA 1T8EA 1BQMB 4N8NA 4OZLA 1GXUA 4DSEA 3MHYA 3RB4A 4DMZA 1B64A 4C3LA 2AX1A 3AY0A 3QO9A 4B9TA 4C8KA 3HHLD 5B7WA 1WTFA 2DITA 4NA1A 3I6PA 5MLCV 5H1SV 2AV5A 2DGSA 2UVRA 1S1WB 2C3YA 2B4VA 5IM0B 3DLKB 2DGUA 4V19J 1Q4RA 4KGMA 4DL6A 2RB7A 1JWWA 1LWCB 3OL8A 4A8YA 1P27B 4WU3A 2HHPA 2FJEB 2JLFA 2KT3A 2VC1A 4EBEA 3M8QA 4M5DA 4HDGA 2YWKA 2L9NA 2C42A 1LWEA 4W90B 4DS4A 5GADI 4MK8A 3M9NB 2AJFE 3KLVA 1DAXA 3C3LA 1U1QA 3KJVA 3PW4A 2IVFB 4KFBB 3EZUA 1K0VA 2CDQA 2I5JB 3HDSA 3PX0A 1NAQA 2O67A 4IRDA 3T5LA 5EWFA 1H3DA 4BWMA 1XNQF 1RAJA 3R3TA 4DR2F 1PILA 4K4XA 2OLWA 1NJIT 4DSJA 3ZZUA 3RRGA 2PE8A 3KK2B 4TYAA 3LWMA 2AJ0A 2CFXA 1P1LA 1WHWA 2GHPA 2RQ4A 1S9EB 4URSA 2LQBA 5HBMA 3LP1B 3PEHA 1IBMF 1H2UX 5LMUF 3DLLQ 5HMWA 3MCSA 1RT6A 3HHKA 3PO4A 3P6YC 2ZDPA 4C8ZA 5JJBA 2QSWA 3JSBA 4YOEA 2CQ4A 4KR0B 1Y3KA 2V4JA 4AQYF 4CIOA 4NCBA 1S1UA 2BABA 4CNZA 2I2YA 2OPPB 4LF6F 5BYRA 4EEYA 2XGPA 3MOJB 3CPWR 4QZVB 1N4LA 3I31A 3MR6A 1YSJA