3AA8A

Crystal structure analysis of the mutant cuta1 (s11v/e61v) from e. coli
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
103
structure length
103
Chain Sequence
TAVVVVLCTAPDEATAQDLAAKVLAEKLAACATLIPGATSLYYWEGKLEQEYVVQMILKTTVSHQQALLECLKSHHPYQTPELLVLPVTHGDTDYLSWLNASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Remarkable improvement in the heat stability of CutA1 from Escherichia coli by rational protein design
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
molecule keywords Divalent-cation tolerance protein cutA
total genus 21
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3aa8A00
1NH7A 2JJ4D 1V6HA 3GSDA 3NCPA 3M05A 1O51A 2PIIA 2GNKA 1V3SA 4CO3A 4ZK7M 4CO0A 2EG1A 4CO5A 3MHYA 1H3DA 2XULA 3AH6A 3AHPA 1HWUA 5D4PA 1Q1KA 1XK8A 2O66A 4RX6A 1VHFA 4Y6IA 4CNZA 3CE8A 4YB5A 3TA2A 2E66A 1UMJA 1J2VA 3X3UA 3O8WA 4D3GA 4C3LA 4CO2A 4YB6A 3AA9A 4AFFA 2RD5C 1V3RA 3LF0A 2DCLA 1NH8A 1O5JA 3O5TB 2CZ4A 1UFLA 4Y65A 1NZAA 5DS7A 4YB7A 1PILA 4CO4A 2J9CA 3N5BA 3NCQA 2NS1B 3L7PA 3OPKA 2V5HG 2EG2A 3AA8A 4OZLA 2O67A 1UKUA 1P1LA 4CNYA 2ZFHA 4C3MA 2NUHA 1GNKA 4CO1A 2J9DA 4E98A 4RWWA 1NAQA 3BZQA 4D3HA 2J9DE 1QY7A 5D4LA 5D4NA 2GW8A 3TA0A 4RWXA 2GX8A 2Z0GA 3HLUA 1UL3A 5L9NA 4USHA 3T9ZA 3NCRA 4RLEA 4WK3A 3TA1A 1OSCA 4R25A 2J9EA 1KR4A 4USIA 4OZJA 2NUUG 2XG8A 1VFJA 2ZOMA 3DFEA 4USJC 5DRKA 4C3KA 2VD3A 4NYPA 5D4OA 2XBPA 2XZWA 4IYQA 4NYOA 1V9OA 4WK1A 4OZNA
chains in the Genus database with same CATH superfamily
5HJXA 5KFDA 2CVEA 5DGBA 1Y9OA 2VFVA 4NCGB 1AA1B 1E6VA 2KXFA 2MZJA 3UW1A 2UUTA 2Y8YA 1PAEX 2CDRB 2XYHB 3GFZA 3HP6A 1S57A 2WZ1A 4AUKA 1C0TB 4MYTA 4WE1A 4R5PA 1S72S 1NKCA 4B3OA 2C2RA 4V19J 2R7SA 3NMRA 3CD6S 2OPRA 1KDNA 1SUQA 2HNDA 2A2DA 3CF5Q 3NNAA 5LT5A 3BEGB 1H73A 2GNKA 4BLGA 3JYTA 2IA6A 3DCAA 2HQGA 2YNGB 4F02A 1IWAA 4N8NA 2R8HA 2ZD1B 2VG5B 1VRUA 1K1SA 2DH9A 3HHLD 3LO3A 5HVHA 1XNQF 1PYTA 1W26A 5ETMA 5CYQA 2ZH5A 3AJ2A 4HHHA 3LW5C 3VAFA 2AHOB 3UDVA 3KLEB 1K0TA 2R7RA 1HNVB 1OWXA 2G1DA 2N4CA 3CE8A 2BANB 2ZOFA 2QA1A 2A2CA 4OFZA 1ROFA 1S6QB 2CPZA 2YVSA 3KUHA 2DNYA 2CNNB 4MTPA 3DXSX 1MROA 1S79A 3A3NB 2BEFA 4DBQA 1VBZA 4YB6A 2HIQA 2MKHA 3R5BA 1WHWA 2HK3A 4J9SA 1BWEA 2IRXA 1NKEA 3UDLA 3FGVA 2W9CB 1TFWA 1CEZA 1H2TZ 5ETQA 1FXDA 3DRYA 3FBCA 1F9FA 2XYPB 4DN0A 4WP9A 3M1VB 1A7GE 2V63A 3N6MA 1RTIA 3R6GB 4O4GB 2DNOA 1F3VA 2FHJA 4BWJA 3SFGA 1K1QA 2ZZTA 3GR0A 2WVCA 5FD1A 1IBCB 3JTOA 3CJSA 3EYZA 1J27A 2X51A 3WIUA 1CJTA 2OLWA 2WK4A 1RYSA 2E44A 1FKOB 2ZDPA 3BKUA 4ENOA 4PQAA 2KH9A 2RRBA 2WVDA 1JWWA 2UUCF 2J0WA 2VDHA 8AT1B 3NS7B 1Q8LA 1RK8A 1VHIA 3MM7B 3NEKA 5KFZA 6AT1B 1Y3JA 2PT0A 1E6VB 3PW4A 4DSEA 3KLVA 1HYSB 2XZTB 1KLMA 2NQPA 1SI9A 2Q6BA 1B64A 4ZMMA 4CLPA 5RUBA 2W7PA 1UKUA 1RT2A 2B4PA 4PYAA 4QJVA 1Y0HA 2OPRB 2WVEA 3KNGA 4M63A 4TLQA 4LF8F 1FT8A 3UD4P 1RU2A 1M5KC 1AFIA 3DGPA 4IRKA 4NWBA 1HNIB 4WPAA 4WZMA 2KB2A 1F60B 1TVRB 1XMOF 3MR7A 1U6BA 3PV8A 1N0UA 3JQJA 1EARA 1NJWA 1RSCA 3MUMP 3AXKA 3LWMA 2G13A 2AJ1A 4UOGA 4LF4J 5E33A 3OW2R 1JB0C 2NXUA 2A6MA 5KG2A 3JXOA 3Q8PB 1WC1A 3G6YA 2DNMA 2ZVIA 5KG4A 3UNGC 1NXIA 1S7IA 1S9GB 2B8PA 4ID5A 4UQTA 3DLBA 1EQ0A 4A4JA 3MCSA 1WG4A 1HBOB 3M6UA 3V6DA 2ZH2A 5BR8F 2KM8C 1E6YB 5C2GA 4CYUA 5J1EA 4N47A 3QPIA 4YDXA 4EBCA 4NL5A 2B6AB 5F9NA 2RDJA 5LXYA 3DOKB 2AU0A 3QRPA 2P9GA 2V8VA 4K0KJ 1VDHA 1S4EA 2C42A 3W61A 1N33F 1S99A 4LF9F 4WZQA 3G6VA 1PO6A 3BPSP 2ZH1A 3RAXA 2YNFA 3E51A 3K7RA 4DV1F 3GILA 1HQ2A 4DPTA 2QTWA 1TK5A 3K0JA 1PCAA 3MTJA 4DR7F 2HQIA 3G87A 4ZVQB 3T1AA 4TU9A 1X4AA 2C2ZB 2NYIA 2G1HA 3KJVA 3PJ9A 2LA6A 4Y2AA 4FF4A 1UJ4A 4X66J 3DOLB 3H5UA 3RZAA 5KFIA 2N4DA 3ISNC 4DWIA 5A8WA 3ENVA 2A0FB 4CT8A 4RZRA 3P4UB 4X4OA 1IWGA 3IRXA 3J80Y 1PAUB 2NSBA 4DV0F 1N48A 3T19A 4JV5J 2HBYB 4I68A 5L1IA 4IO9Q 4PEOA 2FLPA 5E7OB 2R42A 2QFJA 4RKUC 1FRXA 3HVWA 3KLGB 2RIJA 3OBIA 1NLKL 2UXDF 1Q53A 7FDRA 3CJRA 4FZVA 3C14B 2VG6A 1BQNA 3UDEA 4DZDA 4USMA 1HLWA 2W9BA 3CSKA 1HARA 3I6PA 4X4SA 3DC2A 2OEMA 1QTNB 3MEGA 2IVYA 1FJGJ 4QWEA 1VRUB 2XMAA 2MQPA 1NK5A 9ATCB 1CJVB 3MWBA 4RW6B 1VBXA 4NMLA 3SQGA 2UXCJ 4DS4A 1EJ7L 2F65A 1CG2A 3LF0A 5EGYA 2CPHA 2QSFA 4F4YA 1I3OB 3L9ZA 1U25A 4RJVA 3VAIA 2HFSA 4ID5B 4KB7A 1N6QB 2CZ4A 1UFLA 4LBIA 1MNEA 2DY9A 1JJHA 1DQAA 2Y0BB 1LWEB 4LSLA 3RRGA 2PI5A 1EKSA 2WOMB 1JLCB 4ILRA 1WEZA 3MM6B 3HT0A 2Y1RI 4Q0BB 1ULRA 4RUHA 2HNZB 2HHQA 2PSZA 1IBMJ 1FKPA 4I2QB 2PD1A 2MZTA 1LEOA 4KFBB 4CLLA 4QIWD 2GVZB 2ATCB 2HBRB 2XMKA 1N5YB 3OXLA 3E01A 1RB0A 4OZLA 3RU0A 2DO0A 1U7LA 2MLXA 4NZ0A 1IN0A 2HAFA 1EETA 2QIFA 2XY5A 2P6TA 2QLWA 3BGOP 5A6WA 1H6KX 3CCVS 2XS7A 5IQ6A 5HN0A 4LF8J 3ILIA 3T1YJ 1SKRA 3CEDA 2DEJA 3QYYA 4P2XA 2HIYA 3K8WA 3ZTOA 5HMWA 2KKHA 4L6V3 1SQGA 2P5VA 4EUVA 2HBQB 1D1UA 1QJHA 4X4UA 2MHEA 5KFSA 5M2UA 1FA0A 4ZVPB 3PIOQ 1HHSA 2IMWP 1NJXA 1S10A 2GIQA 5I3PA 3D3BJ 4WFBQ 1V3ZA 3M30B 4ZVHA 3BQ2A 1FHTA 2V6AA 2ZEJA 1O8BA 1NBEB 4FYDA 2HVZA 3DU5A 4NASA 4NRTA 4QPTA 4JV1A 1RT7A 3Q8VA 4DV6J 3QSYB 2AD9A 2LYVA 1NDLA 3NCRA 3PFEA 3D6FB 3H98A 1TL1A 2D3ZA 3VGTA 1C4CA 2W2QP 3Q0AA 1U6ZA 3C15A 3OFHA 3K58A 1FK9B 1HA1A 2ZE2A 1IKYB 3QQCD 1UPPA 1CPZA 3MEKA 1C1BB 3U1MA 1WD6A 1NJIT 1FRJA 1SJRA 1VFJA 3NWRA 3PG9A 3CWJA 4FPRA 4GRSA 4R0EA 3WZ0A 4DZ6A 2E5GA 5C42B 2B9XA 1LFWA 1UFWA 3BN7A 3HVTA 4O0IA 3I55S 1SL2A 4CCHA 1RP5A 1RWVB 4P73A 2FJEB 4ILMA 3MCMA 2YWWA 1R0CB 1TKZA 1RHKB 2XLIA 1RZMA 2QLXA 5HJYA 4DX7A 5C5JA 5HROA 2HS0A 3R5JB 3R2CJ 3HDSA 3EXYA 2V4JA 4CI0B 4UQGA 1U49A 1G4CA 5IQQA 3G8TA 1WELA 2VBZA 2A3JA 2LEAA 2LDIA 2VQEJ 2J7UA 4NRUA 2MQOA 5KFQA 4B9NA 5EDWA 1LXJA 4OX9J 2HSEB 1RWWB 2JVOA 3AD7C 1HPZA 1R43A 1VC5A 2HWIA 5A76A 1R3NA 1XC9A 3DOMA 1URRA 3DM2A 4K4VA 1GTHA 2B56A 3KWMA 2ZNYA 4QIGA 2FVRA 3THVA 2FJAB 3AH6A 4JI5J 2C1EB 3AHPA 3CD0A 4DX8H 5KFCA 5AE1A 3GJTB 5EWEA 2DR9A 2MPUA 2BJ9A 3OVSA 1J5OB 1NDKA 3L3CA 4RU9A 4K4WA 4ELTA 4ZITA 2CIMA 3NLCA 4ZPDA 4X4QA 3W60A 4DU8A 2KJWA 5KG6A 2VJVA 2WVFA 2OGUA 2F63A 3CC2S 5KG0A 5EWFA 2QEXS 1RT1B 4NLDA 3MAHA 1KFDA 3GP9A 1ZH5A 3NMAA 5BXIA 1MMLA 3GJRB 2JC0A 3DMJA 2L41A 2O1PA 4DEZA 4JI6J 2RMLA 2M5YA 5KFTA 1UJ5A 5F0WA 3GIMA 3D1HA 2YWFA 3UDCA 4AFFA 4I56A 1ZM2A 3HHKA 5DG9A 2CNLB 4LFAJ 3HX9A 1X9MA 2EFOA 1BLUA 1Q8BA 1TKTB 3QJLA 5IT9U 3FBFA 2W8LA 3KHRA 4U9RA 4Y2CA 1JLBA 1DLOA 1SVDA 1LW0A 4RW8B 4DOZA 1BY9A 2IAJB 4WTYA 5G0RA 5HSPA 5A8KA 1T05A 4OV1A 2BJ7A 2DXDA 2R2RA 1LK7A 2DGOA 1WHXA 2H9ZA 2WCXA 3C19A 2K1RA 3D9BA 4LF6F 3UE2A 2ZC3A 2HZCA 5LSLA 1S0NA 2JVRA 4G65A 3NCQA 1X0FA 1QDUB 2DTJA 2NS1B 2PN6A 3UN5A 1D8YA 2R8KA 2DR8A 3DRSB 1M5SA 3I56S 2XMJA 2ZH4A 1MU2A 3HCXA 1S1UB 2Z8QA 2Z58B 1MMNA 3NNHA 3ULHA 3SXLA 4OJHA 1JKHA 4X62J 5CYJA 2CJQA 4KC5A 2V2ZA 2ZFHA 3OR2B 2JWNA 1QAIA 3TRGA 2VHGA 2PDAA 5KFBA 4F4WA 4E98A 1HNVA 3ET6A 4L72B 3MZIA 2B3TB 4GO5X 2G0JA 3GE9A 3C16A 5KG7A 3KDNA 1UZDA 5KT5A 1FJ7A 4LQ3A 2V9WA 4ZLPA 1U2FA 1XTZA 2IJNA 1FRKA 2QO3A 4OLOA 3AOCA 5IT9Y 2LQ9A 4W4MA 3M8SA 4I6AA 3MM9A 3HLUA 1NHKL 2P2CB 1UVKA 2GIRA 5C2CA 2DISA 3KNAA 2W9CA 4USHA 1KSPA 3G96A 2C3MA 2P8IA 4OIXA 3H7HB 4LF5F 4HR2A 4L75A 4W90B 3QIPA 1GMWA 1VIXA 4ZJOA 1KVIA 2EBGA 4JI7J 3DU6A 2X3GA 2BACA 4HDGA 4XK8C 2N7YA 5A8RB 3I5BA 3G6ES 2C2EA 1RABB 1U24A 4ZJQA 5CCMA 4AT1B 1OY9A 1ZA2B 3CJ5A 2X3DA 3EICA 4P74A 1U45A 4J5OA 2XY7A 4M5DB 4MIAA 4P10A 3W9HA 1NRKA 2IY5B 1N32J 3VR1A 3W65A 1DTQA 3ZNJ1 3A8JA 3M2RA 1U1PA 4W98A 4C3LA 4RL1A 2RVJA 2HMIA 1X5OA 4J91A 1H74A 3ILLA 5I3UB 3H2UB 3SDEB 3R1LA 4DQIA 2EFGA 4Y0FA 1NK6A 1Z2ZA 2WHOA 5BYSA 5KOWA 2HRUA 4TN2A 5IM0B 4K4UA 4NXNJ 1WEYA 1X7VA 2D7SA 3UN2A 2W9AA 1VQNS 1UEVA 1FWPA 2XMUA 1JLFB 3Q86A 4DQPA 3H2VE 3TANA 3OSPA 1HNIA 3M8WA 5F3ZA 2ZBQA 3KYLA 3SSSA 3MPDA 5CABA 3NL0A 3K17A 2LQBA 3FDSA 3BGRA 3QBCA 1ZA1B 3DI6B 3A8EA 1U4BA 1PJ7A 1CULA 5GAHI 4ER8A 4WFAQ 4KV8A 3MOZA 1OPIA 4X65F 4NA1A 2E66A 1FE0A 4DV1J 1X5SA 1HPZB 3NAIA 3S6EA 6FD1A 3V6KA 3S1TA 2UZAA 3V81A 1GX5A 1U1LA 5FLXU 2I38A 1WEXA 4LF4F 2BE9B 5FLXY 4DR1F 4ED3A 2CWKA 2XO6A 1VR6A 2YWGA 2B8QA 3N6NA 4RUAA 2HHXA 1FDAA 2IHR1 4IFYA 3BO2A 4V19X 2ILYA 1VGYA 3CULA 3O6QA 3TAPA 1BD6A 1JNZB 2BXJA 2E1RA 1I1GA 1PSDA 1U26A 4BC9A 1CJVA 4RW6A 1HBMA 2CG4A 1HBNB 4JBCA 2R2SA 4B3SJ 2J0SD 3O5TB 3RW6A 1NM2A 2AP6A 2OKQA 5AE3A 1TR0A 4NLUA 1OY8A 4HACA 3M8RA 1QE1B 1D0EA 3A4TA 4M1KA 4YUDA 2VFTA 4KO0B 5KFAA 2VV5A 2WBMA 4OJ3A 2DT9A 3KLHB 2R2TA 2WB1D 4FPIA 1LWCA 4DCJB 2FDNA 2M3DA 4OI2A 4NLPA 2FYXA 4CLUA 2DGUA 4DL7A 3I0RA 4P7TA 3MEDB 1U09A 5CH7B 4O3RA 2BRKA 3F73A 1KQFB 3FFIB 2Q3PA 2CQGA 1EP4B 4ZJLA 1N34F 4PYDA 3IR5B 5IWAJ 1C0TA 4WE1B 5H9EK 5HP1B 1REVB 2R7QA 3MPVA 5DQGA 1JLGA 3V6JA 1Q81T 4A47A 1VQ5S 4CLSA 2D69A 2NCKL 4LVNP 4TY8A 4EWTA 3GFHA 2J9DA 4RW7B 5CD4A 5A0YB 3POTA 3DYAA 5DDQC 2K8GA 4B9MA 4EBEA 1RTJB 1S9EA 3CDBA 4DUYJ 1NNDA 4RNOA 4GVLA 3UQSA 1HHQA 5D4LA 2GW8A 4HVZA 3PACA 4NI2A 2UU9J 3HKZD 4CT9A 1N52B 3KJVB 3W63A 1X4DA 1P8GA 3CIZA 3VHQA 1TUGB 2LKZA 3CXCR 3BBFA 2CZVC 3O44A 4ECSA 3JSMA 1TV6B 1TZ0A 3CD7A 3T9ZA 3JQMA 2MKIA 4KHPF 2HURA 3MTKA 4JP8A 3RRKA 2RKIB 3OFGA 3BO3A 1NK0A 3SI8A 2YKOA 3C8YA 4MK8A 2BM0A 4R25A 3BPDA 4Z7YA 4JV2A 1KR4A 4KKOA 3QZ8A 2M52A 4GKKJ 5I3QA 1R8CA 1KD1T 3SEOA 2BE2A 4OX6A 3PZPA 3RB4A 3W8PA 4F4AA 1NHVA 5LMUF 2CAJA 3E8OA 3MECA 1B99A 5E41A 4OYAA 2VFSA 2CXEA 1N0VC 1ZTWA 4G3IA 3G86A 3CC4S 2F4VJ 2ZVSA 4DV5F 4GC7A 1UEKA 1RTDB 2DHGA 3M05A 3SCKE 2MKKA 1KS2A 1XWLA 3M2UB 3ZTPA 2P6SA 3ITHA 4I0WA 4EZ9A 3E2EA 4UOHA 2RAQA 1AROP 5EHHA 5LMNJ 5B7WA 1OMSA 3KMSA 3MCNA 2LVWA 4OZ1A 4TYBA 1JLAB 5T7LB 3H40A 4ECUA 4Z2XA 2VFRA 1PGZA 1HI8A 4IR9A 4YR2A 1HNXF 4NXNF 3UCZP 1JJ4A 4X4TA 1HYSA 2R7VA 2IPOB 3KK1B 3C2PA 2OPSB 2EG1A 2GQ2A 1ZZNA 2ZUGA 3B54A 3SCLE 4OHZA 1D8ZA 1VQPS 5MAOA 5D4PA 4DMZA 2FTRA 4GO7X 2OH2A 2Q79A 1GXUA 5ETSA 4ZVSB 4EEYA 2IM0A 2OPPA 3GIRA 2OUGA 3WDOA 2JEJA 1N32F 3Q8YA 2HHHF 3NNCA 3MD1A 1NO8A 4I7FB 1KP6A 3OL7A 1RWMB 1W7WA 1EIYB 2YQ3A 1LWFB 3DGVA 3HPOA 2XMVA 5HATA 4Q43A 5CHCB 5MLCV 3J81Y 3C6UA 4LT6A 1UZHA 1RWNB 1YHQS 2OHDA 4Y2KA 1G6BA 4IDKB 2OELA 4DR5J 2UVVA 2H5IB 3M9OB 3H4BA 2IA0A 1ZPWX 2XSJB 2VBXA 4OJ1A 4KR0B 3SCJE 1T9UA 4C98A 4CH7A 2GHPA 4DFKA 2DCLA 2YKAA 2ZH9A 3GYNA 2ZWPA 1S1XA 3ENWA 4ZS6A 1EAYC 1HQEA 3S01A 3CO9A 1M5HA 2DHHA 3THTA 4DUZJ 4KAIA 2W8KA 2H5EA 2B5JB 2FHMA 1IQTA 2DGQA 3Q8SB 3P5TL 3OTEA 2VFUA 4ECZA 2WW4A 1WC6A 2OPQA 4F25A 1RT7B 2H5JB 4LF1A 2PO4A 1FXRA 1HW9A 5H9EJ 3H20A 1JIHA 3LAMA 1GQEA 3S7RA 1SKUB 1WDDA 1UVLA 2BJ8A 2HVEA 7FD1A 2BABA 2IM2A 4ZCIA 2GQCA 2K1RB 1U1MA 1LNQA 1WKKA 3QWUA 2EBEA 2XMMA 3UCGA 3BGUA 1VC0A 1TL3B 2QZ8A 4P75A 3UPFA 1ZZFA 3IRWP 4USWA 4NXMF 1RACB 1HI0P 2HRYA 1TL4A 2KRRA 4YR3A 2YNIB 3ADAC 2PEHA 4J9OA 1MU2B 4LFCJ 2MQ8A 1JLAA 2KTQA 2NUHA 4GC6A 1UWBB 2BV3A 3SZ2A 2FHKA 1FKAF 1TL5A 4QR1A 3H5YA 1P9QC 2BQRA 3PYDA 1T9WA 4PUOA 1Q8IA 1VJQA 3DN9A 3C3LA 2BKNA 1PIEA 4KH1B 3VGSA 5E5NA 2CQPA 2ZJQQ 2IC3B 1P9YA 4X4RA 3M6VA 3U7JA 3O3LA 4DQRA 3G82B 3MCOA 4UUXA 4JV0A 4ZCMA 4OHXA 3BSNA 4IQMA 1X5TA 2VL1A 1Q82T 1HI1A 2YPZA 3R97A 3TJAA 1WC5A 4BBYA 1NB7A 1T7PA 3ZFVA 1BQNB 2KXHA 1T94A 3ETOA 3VV2B 5A2QY 3MM7A 2IDLA 4NLWA 5EUHA 2QC3A 2HFOA 3DYAB 2F9DA 3HHLB 4IDKA 3AB2B 3QAEA 2H1YA 4IO1A 5ETVA 5A2QU 2WTFA 3CCQS 2L08A 4FNIA 2LFVA 1XERA 2GGPB 3GONA 3EE3A 4A8XA 4C97A 2VPYB 3GQCA 1VQ8S 4ERDA 1O6XA 2AEJA 4YN3B 2CQHA 1BHNA 2VD3A 4HHJA 5D4OA 5DETA 2MZ1A 5JVGQ 1X4FA 2ILZA 4K2JA 2HHHJ 2RJZA 4JYAJ 3BGFA 2XGQA 4LSNA 4LSLB 4ES1A 1OY6A 3DGPB 3CO0P 2DB1A 2CQ3A 4F0KA 2CPYA 4P52A 4X4PA 4JI5F 1HW8A 3OTCA 2E1MC 2ZZMA 1T9YA 3IS9B 4NLYA 1DHMA 2YKNB 3GR1A 3G9CA 2CWXA 2OSRA 5D0RA 2CQ2A 1GXTA 2RDDA 2VUGA 4CYUB 4P71A 4ANCA 5IXUA 5KFPA 3CCSS 3MOJB 2X7IA 2J8SA 1SC3B 1IBLJ 4PKDB 2LEPA 3ET6B 1RE1B 2V34A 3EX7B 1YJTA 2LU2A 2C3UA 3CDWA 4ED8A 4DL6A 1N36F 4F2SA 3K5NA 1R27B 1S1TA 2KHDA 4F3QA 3BREA 1XK8A 1OJ4A 3A3PB 3EGNA 4NE9C 3VZHA 1Y11A 3K5LA 1FNOA 1HMVA 3IGNA 4IOBA 1E6YA 2XLKA 5B0DA 1R0AA 2POKA 3R5GA 3DI6A 3U1NA 2EWHA 3D66A 4EYHB 4M5KA 1GX6A 4LR9A 3OTBA 4AYBD 5AE2A 4KE5A 2BM1A 2HZVA 1XR6A 5KG1A 2ADCA 1NJYA 4ZA1A 5F9LA 2VB6A 2CJXB 2CPDA 2FD2A 1RAAB 2EPIA 3D6MB 3QO9B 3ZZ0A 4A8SA 3RR8A 3KJQB 4Q7AA 1PC4A 1LKZA 4R5PB 2JC1A 3HSGA 2QRRA 5GMDA 2MEWA 1L3UA 4KGXB 4Q2LA 5KFLA 2AT1B 5LM7E 3Q22A 2C2DA 1RT4A 1NK9A 3WC2A 2KN4A 5FJ4A 3CB4A 3H5SA 4DX5A 1Y00A 4CLTA 1NMEB 1AW0A 1IKYA 2HWTA 4YHHF 4O3NA 3EZUA 2RU3A 5IZHA 2NXCA 1SC6A 1WORA 1UEUA 1HBMB 4LJMA 4TLRA 4Y65A 2WB4A 3W2VA 2I8EA 4RO0A 3B78A 4ITSA 5IV3A 2EI5A 3D6TB 1U48A 4X4NA 4UW2A 4FBTA 3LP2A 2OEJA 1OQ6A 4U96A 4M5LA 5B0FA 3T3FA 2FVSA 2N7CA 3L7PA 3OPKA 2AX0A 1FI4A 1WC4A 3SBMA 5KFXA 1NPPA 4ZPCA 1YGYA 2KHCA 1FX2A 3MUTP 2DGXA 4FKYA 2JDJA 1H38A 2Y9HA 5F8NA 3BSOA 2NXEA 5B08A 1NJZA 1YDLA 2HFZA 3BKFA 3H90A 1G7CB 1X4BA 1FD2A 1RT2B 2CJYB 3DOMB 3SQGB 4DSKA 3UVJB 1YRUA 3Q2SC 1WTFA 2HS4A 4TU7A 2R7WA 1CS4B 2YY3A 1NK7A 4DU7A 4FVCA 3E01B 4DI6A 3GSIA 4U95A 1W2BR 5KFOA 2IRUA 4NEYA 2W4PA 1DAXA 4H4MB 3N6LA 3QLHB 4LVOP 4RBVA 1Y7PA 2QA4G 4ECWA 1KQGB 3V4IB 5B09A 2JZ5A 2DRAA 2DNRA 3ONQA 1RT1A 2FZKB 1C2PA 4H4KC 1ZPVA 2UXCF 4F3OA 2C2OB 4WIQA 3JSMB 2BZ2A 2EFQA 3I82A 2JL9A 3MDFA 4KT0C 2DH7A 3FCWA 5K14B 1N36J 3QWPA 2K7KA 3M8PB 3K5PA 2MQMA 4OI0A 3TWZA 4WCEQ 5DG8A 1IKVA 1U2CA 2IM1A 5DRKA 3RUBL 1RU1A 2BDPA 3SFUA 4PXDA 4G1IA 1URNA 5M2PA 2D41A 2XHCA 1U47A 4NLTA 2ZD1A 2NZCA 5L1JA 1XMQJ 4P72A 4ZVEA 2HQDA 2JJ4D 3QATA 5L1KA 1ZM9A 1RAEB 1MG7A 3HFVA 5D6GA 1RAOA 1NZ8A 3FSIA 4JV5F 4XAKA 5F41A 3BJYA 1HNWJ 1MSWD 1FK9A 2ZE2B 2HHPA 2SXLA 1RT3A 1UW4A 4JI8F 2VJUA 1R7IA 3GTYX 3KK2B 3P96A 3MAAA 2MMYA 3ITHB 2PIIA 5K8PA 1Q5YA 3LH2S 4X66F 2ZKTA 1FEHA 1CJTB 1XQIA 3UWTA 3HF5A 3NXZA 4NPOA 4NMXA 3TQ1A 1S4FA 1YVFA 1KTQA 3HSZA 1OYEA 1XR5A 2CDQA 1FRMA 2ALYB 2CQ0A 3B6BA 4FYVB 4TQSA 3DDNA 3TQEA 4FXVA 2FUG9 3OVAA 5D3GB 2C22A 2Q6CA 2RDIA 1D9FA 2ZBIA 4CNZA 2E29A 4PABA 1T05B 3UNYA 4G1PA 2CUYA 4DFPA 2DNQA 3A1YG 1HIYA 4IG3B 2L9WA 1NDCA 5HLFA 4LIWA 3JAMY 2APOA 3BR8A 2XS5A 1FWKA 2KL8A 1RHMB 5BR8J 4I7FA 3NGTA 2B7CB 4ES2A 1BC6A 2XNRA 2OAUA 1T9VA 1HWKA 2J8AA 3MPWA 2HVHA 3FCVA 1X31C 1WOPA 2JFDA 1H2VZ 2OFGX 3KUGA 4MK7A 1V3RA 3K5OA 4YEAA 2YKQA 1VQKS 4LF5J 5CZVA 1VIOA 2DCUB 4XDCA 3PXGa 1RTJA 1S9EB 3RW7A 1NH8A 2BJ3A 2RNEA 1O5JA 2W2OP 5K8OA 1RT6B 1RWOB 5F0UA 4B08A 1R0AB 1KLMB 3QGGA 4ED5A 2RILA 4UZBA 2P9CA 3WX8A 2ZZNA 2CNKB 4NLQA 5KFGA 1HL6A 4URGA 1ZAWA 2K06A 3NS5A 4OYBA 3T1HJ 2XMWA 3ZZOA 4WTOB 1AYEA 2JX2A 4HT5A 2R2UA 1KONA 4Y28C 3I31A 3J81U 4UY8T 1U1OA 2KZZA 2XI3A 2W2PP 4RW4A 1FESA 1RHUB 3TJ8A 1QVFR 6FDRA 2DITA 2X1BA 2UXBF 1VJWA 3DLEA 3I0SB 4TU8A 4AXIA 2ZJPQ 4DUYF 4IKAA 1Q86T 1S77D 3CDEA 4IOCQ 2M9KA 1IQZA 2V2QA 3CJKB 4DN9A 2UUAF 4ZPTR 5DZ6A 2ZHBA 2VH7A 3TUPA 2W4CA 3T5KA 3G2XA 5T14A 3FNNA 4CNYA 4I64A 3GLJA 3VVUA 2MKSA 4OJGA 1GMVA 3AT1B 4GVBA 4USUA 4IH5A 3GV5B 2C3YA 2HHVA 2FZCB 2W7AA 4UOFA 1N4LA 1WC0A 4RW9B 3KFWX 3F56A 2CFXA 5DO2A 4JOUA 5K9FA 5GADI 2UVRA 1NAQA 2BJ1A 2WSCC 3NGRA 3M2UA 5HQ8A 3H4DA 4P2SA 4IUFA 2J9DE 3MM5A 2NPFA 2MHNA 2YKMB 3IWXA 4L74A 2HQ3A 1BXNA 1M1HA 2B9WA 1RAJA 1UJ6A 2Y0SD 3GJSB 1LW0B 2RRNA 1N5SA 2R3VA 1R6VA 3V4MA 1CULB 2Z0GA 4IG0A 2WRMA 3HZGA 3SCIE 5DQIA 8ATCB 2N3OA 3PX6A 2ERRA 5DQHA 3OJUA 3HMJG 1ZETA 1RQ0A 2XSJA 4MKAA 2OTLS 4IQXA 1SIWB 3A13A 3OTOF 4OHYA 3PYEA 4NEZA 1YBAA 1C0UA 3TA1A 2QV6A 4P6QA 4J9VA 3IG1B 1M5PC 3UVJA 2Z2LA 5KT3A 1HNZJ 3DLLQ 2DNPA 5F8LA 3O2IA 5KFFA 1HR0F 1S1UA 3GG0A 3O1LA 3GG1A 4C4WA 2BUNA 3BBCA 3CTRA 5LXRA 2VIHA 5GAHU 1WOSA 3DNCA 1RISA 3FSYA 3VWSA 2FZGB 1RYRA 5I42B 1IUJA 2YWEA 3D2WA 2GCFA 3RB0A 4OYPA 4YY3J 3P3DA 2LP4A 3FUYA 2YWKA 2LXIA 2XS2A 2AZ1A 3J7ZT 3LANA 2ZH8A 4UZCA 4K4TA 3A12A 2V0NA 5F8HA 4J9KA 4HH1A 1LWCB 2DXEA 2V8PA 3CCRS 2J0QD 2QL7B 4JI3J 3ICLA 3CCJS 1MWQA 1VLYA 1S97A 3PR5B 3OV7A 3I0SA 4NLOA 2ZH6A 2RH3A 4CO3A 4YY3F 1FDNA 1I5OB 1UETA 2BKOA 4ZVGA 2FB0A 4QR0A 3TO8A 2ZOGA 3NOCA 2FC9A 4NCBA 4UUWA 2XGPA 2E7XA 1YRTA 3KLFA 3JB9k 4O3SA 4NCGA 1IKWB 4XO0A 2IC3A 2HNYB 4DSIA 1YX2A 3CCUS 2ASDA 4CLZA 1TKDA 1H2UX 4NCAA 4LFBF 1N54B 1RBOB 2HEKA 2V4RA 4B3RJ 3CD5A 4B3OB 3QJPA 2R4FA 2YKPA 1UMJA 1RDRA 4YMEA 4QPXA 4A8QA 2NZ4A 3MURP 1RA6A 1JLCA 3TZWA 2VG7B 2AEFA 2H4YB 2IJFA 4NI2B 4IFVB 5EX0A 3M2RB 1T3NA 2R8IA 1GEHA 3LGNA 4J9RA 2PC6A 4JYAF 2HG4A 5KFYA 1YZ7A 2V4QA 3EJMA 4JUZA 3VGUA 4ZCLA 2R9LA 4ED2A 1CJKA 2EK1A 1WSRA 1VRTB 2WAQD 2R7OA 5KFRA 3T5JA 5K8MA 2GAGC 5GMKa 2FQQB 2MLZA 2GFFA 3QFWA 4ZPBA 1GXLA 4YR0A 4DS5A 3EDQB 3FC9A 4J37A 4S0MA 4JI4J 1PKUA 2BANA 2DY1A 2V94A 1NK8A 1N34J 5ETLA 1RT4B 5IOLA 1EQMA 4Q8EA 4C8LA 3ZO7A 4KBIA 1VBKA 2JLFA 5E0OA 3MM8B 4LFCF 4C9DA 2AW0A 1NDPA 1KN6A 3TX8A 3BH6B 2JNJA 4WFNQ 4NXMJ 1IBMF 1WKJA 1FCAA 3EXCX 1TTHB 5AJ3F 1BQMA 1WI6A 3T1YF 2YPYA 4HTJA 1ZAXA 2L9DA 3AA8A 4AQYF 2IBKA 3M2VB 4RNHA 2L9NA 3N79A 1KOOA 1M0SA 1RCOB 4RR5A 5BYRA 4JI2F 3VZIA 5DLFA 1JX4A 3TEHB 2PMZD 3G4SS 2DKOB 5HK4A 3V81B 2R8GA 1QLNA 1S6QA 4PG8A 3W7BA 4H4OA 2QMWA 1M5OC 2YH1A 4CQ1A 3FBBA 5GADU 1X4CA 4C3MA 2MQQA 3D67A 3FEXB 2E7VA 4X62F 4CM0A 2H54B 2Z2YB 3K89A 2WONB 3D6HB 3H2LA 3MM5B 1ZYQA 2DRBA 5D8HB 3PEHA 2OPSA 3FRYA 4RWWA 4FYWB 2OIHA 3M1VA 5DM6Q 2GC8A 3DLEB 4D3HA 9RUBA 3QMQA 3IAM9 2ZHAA 3R5DA 1KVJA 3TA0A 4X65J 3MXHP 4JI4F 5KG3A 3RBDA 2CPXA 2MQLA 2W24A 2A1BA 2HQCA 3ZTSA 5L9NA 4DF4A 2E9ZA 2AKWB 4CTAA 1ZTTA 4EI2A 1YZ6A 3I9V9 4MJKA 1R8AA 3PHEA 3U1LA 1NSKL 1FERA 2H48B 4AE5A 2EC2A 4ANEA 5HMZA 3MEGB 1FJGF 2LXUA 4HHUA 3D0HE 3QIPB 2DHAA 3W2VB 2XG8A 3QT5A 3M8ZA 4F4KA 4LFAF 2E9TA 1K0VA 2V8GA 4I6YA 1YJ7A 2KM8B 4J9PA 1VS3A 3SIPB 2VKZG 4CLFA 4MYUA 3OJSA 4LF7J 4B3RF 4QU6A 2V69A 4KGZB 5D78A 3QSIA 4TYAA 4DDFA 4FS2A 1HNXJ 4TY8B 2F3JA 1NH7A 4OHVA 4DUTA 1B3TA 4K0KF 3I9ZA 2WOMA 3B4DA 3BN4A 4USVA 4FYYB 3AJDA 1OPZA 1AT1B 1HWLA 2EVZA 2OSQA 2ROGA 3J80U 3IG1A 4EZ6A 4ES3A 2CQBA 1DQ9A 3SSQA 2E9RX 2MYFA 4TKTA 2FVCA 5IV4A 3GV8B 3HK2A 3VAJA 2HGMA 2FJBB 1T11A 1YG0A 2Q1LA 1V3SA 2FVPA 3W9IA 3W5XA 3KLFB 1TV6A 2GJFA 4JI3F 3J7AN 1F0XA 2F40A 3BDPA 3DLGB 2DGVA 5C25B 1T03A 1XBWA 5DZ7A 2ZKUA 4OV6A 3W64A 2DK2A 2KU7A 3JQKA 1R0BG 4ZN1A 3OHBA 4YOEA 1SV5A 1L3SA 1BWVA 1JJCB 1WF2A 4WU3A 5D0HA 2VQEF 3PRDA 3OR1B 2HLUA 3MR5A 5GMEA 2G2ZA 1U1KA 2RB7A 2MJNA 1M1KT 2FVQA 4PQUA 3WX4A 3D0GE 4QBUA 2DEIA 4M5MA 4D3GA 2GMHA 3W8GA 3WIVA 5A8KB 3VALA 2UV8G 3I87A 4IG3A 3PW2A 2OTJS 2M8DB 3KK1A 3H25A 1YQHA 2E1AA 3EVMA 1S0MA 4DPOA 1DFDA 3PNIA 2VC0A 3ZTRA 2MXYA 2YNFB 1RTIB 2J7WA 2K3KA 3HI9A 3WC0A 2GO9A 3AQPA 1JNRB 2B9EA 4EU0A 4YB1P 3GV7B 3M7VA 3PKYA 4GKKF 1S6UA 1UW9A 5JVHQ 3C15B 2DPJA 2V67A 1IKXB 1WDTA 3MPYA 4AXJA 1IJEB 2COLA 1Y5IB 2UVUA 3I96A 4QOTA 2GGPA 4XTTA 5DS7A 3LQVA 4PG5A 3FMBA 4WFZA 4ZLNA 3W2WA 4ZP8A 3CCES 3PY8A 4E0DA 4MKYA 3P6YC 1BE4A 3HJFA 2ZNZA 5ETNA 3CGIA 2PA8D 1FO1A 1HQUB 1Q8KA 2VICA 4ZVTB 1VQSA 2GS8A 1WOOA 5E3CA 1B0VA 4KRWA 2L3MA 3IMQJ 3IWLA 2ZWOA 2ACMA 1U8SA 2MDAA 4TVAB 4Y2MA 3BQ1A 4DFMA 1XIQA 5CAAA 3ZZUA 3OUYA 3GZ7A 3IS9A 2RE1A 3EGVA 4DV2J 4DR4J 4MFBB 1Y10A 1SJFA 1J5EF 1B7YB 3NGKA 1NPKA 4MIWA 4OYMA 4EBDA 1CJUA 2HRTA 2XNQA 3T5LA 3EUNA 4YHHJ 2DHXA 4M5GA 4OX7A 2M2BA 3MAQA 3IR6B 3PJXA 2AQ4A 2ROPA 3W5ZA 1FEEA 2F8EX 4FXWA 5C7PA 3Q8UA 4C8ZA 2LQ5A 3MMJA 2GV1A 3K8VA 2MKCA 2QX0A 2I2YA 1JLEB 3T1HF 2VBWA 3KK3B 4RWXA 1TVRA 4HTIA 4TY9A 4C7QA 2ZBRA 1CBKA 2RT3A 4KQZA 1U0HB 3AFGA 3DLJA 2F7VA 1FVSA 1FDBA 2XB2D 3U27A 2DGTA 2HGNA 2KYXA 2HMIB 2A18A 4WK3A 2NREA 2IM3A 1M5VC 3HSDA 3KG0A 3C6TA 3C66A 3SYZA 1YWXA 2J7KA 1L3KA 2JSXA 2DBBA 3AXMA 3GB0A 3T6BA 1YBTA 4B3SF 3D68A 4B9TA 3RAMA 3RB3A 4WP8A 2A6OA 2BW2A 2CVIA 4DFJA 3OD2A 3NOGA 2NPIA 1NSQA 4CZCA 1FVQA 3NS6A 1OIAA 5CCLA 4NLVA 1V9OA 4MK9A 1IKXA 4F26A 4MH8A 2B4VA 1OQ3A 3FKBA 4FF1A 5HI7A 4F4XA 1RAHB 2N82B 1DY3A 1YBUA 3NCPA 4RUBA 2NR0A 3BSCA 3W2WB 3OLAA 2F1FA 3CCTA 3NAHA 4KHRA 1WG5A 4BCAA 1AUDA 2QJ3A 4U8VA 4BDPA 4N77A 1AUSL 4L3NA 4LRAA 1DTTA 2IDEA 4UF4A 4WP3A 1NSPA 5KFKA 4QWCA 2BW7A 4ETZA 1F6TA 4Q2MA 2IVMA 3DRSA 5C42A 2HGLA 3MMBA 1QE1A 3AOAA 2FY1A 1FFWB 4QWAA 3LWLA 2E5HA 4ZIVA 4OQJA 4QWBA 1SB6A 4K5SA 4FBUA 3DOLA 2XULA 4OMFG 1JKHB 2YKMA 5B0EA 4A8YA 2A10A 4C8NA 3UN3A 4MMOA 2ADBA 2FJDB 3FMWA 1RTHA 2B51A 3DRPA 4C0OC 4A8WA 1NEEA 3RBEA 2JOQA 2CYYA 3HJVA 1S49A 4ATNA 2HNYA 4YQWA 4C48A 2YBVA 2AGPA 1KNZA 1A6LA 1N5TA 3KMQA 4DR3F 4U67Q 3KHLA 1YJ9S 2VU5A 1SC1B 4KO0A 3TW0A 2VPWB 4JI1F 1NHUA 3DHWC 3EVOA 3VGVA 5KFUA 2M8HA 2BJDA 4B17A 1H7XA 2LXFA 3DLGA 4V1Ak 5D0EA 3PO4A 3HO1A 1N8RT 2ZC4A 5D77A 3W9JA 5C24A 4A8OA 1Z4UA 4LQ9A 1LW2A 4O4RA 4DR6J 1Q7LB 4K50A 1FRIA 4PPDA 2YX1A 2RUGA 3UR0A 2ZITA 3MM6A 4ZHRB 3PO5A 5FDLA 2J6SA 4JI2J 2KXNB 5J2PA 1WKLA 3DLHA 1SPBP 3HHLC 2B9YA 1HQUA 2DIUA 2I1RA 4YB7A 4PR6A 3AY0A 5LJ3Y 2HHUA 1X9SA 1F5AA 1PILA 2C2NA 2HVDA 1YLXA 2W2NP 2VF3A 1WTBA 3GIIA 1G2EA 2OPQB 2GIFA 1FJCA 1B4SA 2FLLA 4Q0BA 3THPA 2WSFC 4U7UK 2M4MA 1Y4ZB 4FNHA 4K7QA 1RCXB 5L38A 1N33J 2HPUA 1U8WA 1YI2S 2HBZB 5ETPA 4KGMA 3D1QA 2BR0A 1BQXA 2G2OA 2QLFB 5L46A 4DR6F 1TMJA 4A46A 1K9MT 5E3RA 3FK4A 5DM7Q 3EGZA 2BBEA 3GPAA 1PBUA 4M5IA 4ED6A 4U7UD 4NZ7A 1NB2A 3BKTA 2KT5A 4P9SA 3VQTA 2AV5A 4NLGA 2V9KA 4ECVA 3IC1A 3LA0A 1LQ9A 3NRBA 2QE5A 4L76A 5CZXA 1UWBA 3BYPA 5D4NA 5H9FJ 2GX8A 2YWHA 3PRVA 2UXDJ 1IXKA 2GVDA 1FTRA 2ASYA 4DCOB 2ZH3A 2PMWA 3L4BC 3GYXB 2LU1A 3Q89A 5L9XA 4EK2A 3T41A 3H5XA 3LP0A 4KJIA 4NX9A 4F04B 2E5LJ 4RUCA 3SQOP 2XQCA 2HHSA 3R9LA 3RBXA 2VONA 1IBLF 1TFYA 2GO8A 2DIVA 1HBUB 1Z1ZA 1PC5A 1SXLA 2OD6A 1RJJA 2I6WA 3L95X 2NUUG 1RWUA 5SZTA 4F4ZA 4ED1A 2Y1IA 2HYIB 3ENQA 1FJEB 3CW2C 2B4UA 3TZYA 4QYRA 2CQ4A 2YQ0A 2XWXA 3CJQA 2MTLA 3Q83A 5KTQA 3UD3P 2G9OA 4NYOA 1U0HA 3ZZRA 2LA4A 4J9MA 1DZ5A 2RQMA 3PCOB 2V2VA 3M8QA 4CM2A 3M9NB 3C6UB 2LECA 3DRRA 2HFNA 4OI3A 3D3CJ 2DPIA 4QYZJ 2DGWA 4K8RA 1HWIA 2F5GA 1YRXA 4WU2A 4LF9J 2AIRB 1S76D 3MI7X 3C6TB 4Y34A 5LMNF 1F5CA 2AJ0A 2RHQB 1A9NB 3QGHA 2E5JA 1VK3A 3PEJA 3KLGA 1JMTA 2DR5A 2UV8A 4FDFA 4ECRA 1JJ2R 2XEXA 2E1CA 1VBYA 2B5JA 4KPCA 3PHTA 1XNQJ 4KPYA 1OYDA 1S7HA 1AZSB 1R89A 5LMUJ 1WUUA 4B3TJ 4XPCA 2HNZA 3Q8QB 3BH7B 1LFPA 4WFXA 3OTOJ 3EVWA 5KAKA 3OLBA 2QL5B 4OX9F 4ZIWA 4O44A 3KG4A 1P6TA 1VHFA 4Y6IA 1HFEL 3ZZPA 4L3KA 4HYKA 1S0VA 4QWDA 1N6QA 4DXLA 1PJ6A 1J5OA 3NP5A 1J2VA 2EKYA 3QFHA 3DMJB 4ED0A 4DL2A 3CDAA 2ZHOA 3NY0A 2QGFB 3HHNB 3JYTB 2EXUA 2KRBA 1T95A 2LQJA 2YNIA 5KFHA 4DV6F 4DLEA 2B7BB 5KT7A 3P8BB 3ILOA 1GMWD 4OYXA 1X9WA 4WKRA 2PE8A 3MR6A 2GVDB 4H4KA 2QYCA 5K8NA 3AOBA 2CJKA 4DG1B 3SDEA 2GA7A 5CYQB 2DRDA 5D3GA 3R3TA 2KFZA 2FLOA 5JUMA 4ZHRA 1UAWA 4LRDA 1N5YA 2HW3A 2VKRA 1VQMS 5IM0A 2IAJA 5G0RB 1KEKA 1KTVA 3JSBA 3QIDA 3QT8A 1RWPB 4LRFA 2H51B 2DJWA 1UWAA 3R8YA 5HQLA 2VQFJ 4ELVA 2Y1LB 4IR1A 1VK8A 3ZZYA 1B0TA 1KBRA 3J81j 3BF4A 2AYEA 4HEA9 1Q78A 4PXCA 3FQLA 4OYIA 3D28A 2L48A 3P5BP 4UT4A 1GTEA 5J1NA 3V5RA 2ATLA 4FP9A 4M8LA 3KHHA 2Q66A 4DQQA 3H59A 2OMLA 3N5BA 5I42A 2ALZA 5THWA 1TL7B 3OT9A 2HZAA 2BQUA 1KKHA 3ISND 3CJ8A 2E7WA 4F8RA 3D7SB 3DKDA 4RBTA 5ETOA 2BKPA 3CVKA 2AGOA 2O67A 1REGX 2ACYA 3HVTB 3IXQA 2Z56B 5E2QA 2DR7A 2UUAJ 1XMBA 2V2KA 3W3SA 1WF1A 2V68A 3CNQP 5T7LA 1FF2A 3SSRA 2VC1A 2CQ1A 3KLIB 3KLHA 3OL9A 1EKRA 2XY6A 1EHWA 1C1CB 2AF6A 3DRXA 5LSOA 4CLYA 1NU4A 5HMXA 1FXLA 2PA3A 2YQ1A 2V4JB 4ZDNA 1EZZB 1W25A 3BZQA 3I4PA 2Y1JA 3IAS9 4OYOA 1HBNA 3ISZA 4OHWA 4PAAA 4URQU 5B0AA 2UVWA 1UVNA 2MZRA 3PYFA 2WVBA 1BGXT 3C16B 3CMQA 3IBWA 3BV8A 3ZTQA 2UUWA 2BA9A 1MN7A 2HFVA 2WBRA 3PM9A 5BYQA 4M5HA 5DDOC 1VMBA 4NLSA 4RLEA 5HROB 3IGVA 2VG7A 4RW4B 3W1YC 3OSNA 1VQ7S 2AWZA 2XM3A 3VAHA 1WC3A 3POTB 4DV4J 4DR5F 2D3OR 1RT5B 4NA3A 2OD4A 2KYZA 2YKNA 1HMVB 3MMCB 4HLBA 1ELOA 2OFHX 2YX4A 3G8QA 1I94F 1VQYA 1DRZA 3CJKA 1S6OA 4FKXA 2MZQA 3MF5A 5U47A 1ICEB 1ZOTA 5HVFA 3CMES 4IYQA 2XZWA 1FKPB 4I2QA 4C2MA 2BRLA 2MB0B 1FFSB 3IP0A 2ZH7A 4GKJJ 5I3UA 2HKEA 3IA0A 1F2GA 2ZM6F 5IS2A 1T3OA 2G2YA 3OXGA 4UOCA 2KJVA 1B70B 4HI1A 5F3TA 3ZC4A 4AL7A 1DTQB 1NSAA 1T02A 3AB4B 1H0HB 2U2FA 2Y3YA 3LALA 1D09B 4J9LA 1XMQF 3RR7A 2RSQA 1RAGB 1HBOA 3BSAA 3HSJA 3N4WA 3V6DB 1TKTA 3L09A 4OI6A 2FC8A 3HT3A 1Q4RA 3SV3A 1JXVA 3I32A 2EEYA 2EC0A 2B0GA 5JXSA 3BGRB 4F67A 4ZPVR 2BOPA 4KIAA 4RPFA 2C2MB 4CO0A 3OTDA 3HD1A 4U7CA 3VTIA 4DL4A 2JRSA 4O44B 5F8MA 3KG1A 5DG7A 3PVXA 2RKIA 4I67A 2BX6A 3GIKA 3D5MA 3PKMA 3L7OA 4Z7CA 2FPHX 3KK3A 2NYHA 2EFNA 3PTWA 1QAYA 3AJ1A 3BB5A 2GHWA 5CA5A 3D54A 5HVGA 2AZ3A 3TA2A 3OL6A 3DLKB 1U2RA 2BMBA 5E3PA 1LXNA 4ZVFA 4F7VA 1FNMA 3UO0A 3C46A 3G71S 4J90A 5JMNA 2K2PA 1RWXB 2VASA 4R8UB 2J0XA 1QSLA 3BM7A 2VPZB 3E3XA 4ANDA 4DG1A 3PW5A 4ICLB 2R8JA 3EGWB 5A8WB 1CQMA 1AZSA 1Q0NA 3FRZA 1DARA 4KGKA 4MAKA 4OLPA 4H54A 2C2KB 2PI4A 2LDYA 3IO1A 3MEEB 4ZP6A 3HFKA 1QTMA 1HNWF 1IKWA 3GCXP 3CCLS 1WACA 2HHTA 1WG1A 2RUSA 4JI0J 3ZZZA 1HR0J 1CSJA 4G1QA 4B9LA 4RNMA 2HS3A 4EMDA 4O3PA 4KHMA 2I9SA 2XI2A 2NLWA 4AQYJ 1NZAA 1PBAA 4ZCKA 3TI0A 4B3MJ 4NA2A 2IBOA 3GU0A 3OR2A 3CC7S 1UVIA 1KWMA 3PRBA 4DR4F 3W62A 4DV2F 2Z30B 4ZVRB 5DGAA 4MKVA 2NXJA 5E3QA 3M4XA 1Q5VA 4LBPA 1VRTA 1T8EA 4QW8A 3AD8C 2XO7A 5HP1A 2V8HA 3UR3C 2CPFA 5A6PA 3KTQA 3PIPQ 3JTNA 4LF6J 2NXNA 3ETMA 4LRCA 1VQ9S 1UVJA 1QUVA 1S12A 1X4GA 2EK6A 4CRJA 1H72C 2KDOA 1UCNA 3AODA 3HHEA 3QZ7A 1REVA 1CJKB 1SIZA 1PG5B 2VQFF 2X1FA 2E5IA 3CJ4A 1WHYA 1SKSA 2GMLA 2RF2A 5HMYA 1P1TA 2AYGA 4IH7A 1JXLA 2CJBA 3LPYA 5J2QB 1MW7A 4B3MF 3M2VA 2XCPA 4F3MA 1R8PA 1K44A 1RAFB 4UTGA 1LWEA 4LR7A 2J5AA 2UUBJ 4OZ3A 4FS1A 1JLFA 3DLKA 1RLDA 2CPJA 5HBMA 3NG8A 2AYMA 2MKJA 1LK5A 1H7WA 3B4MA 1OO0B 3EZ5A 5KT4A 4DQSA 3V6HA 4MIBA 3RBZA 4ICLA 1HHTP 1C1CA 4L73A 2D3O1 1YJRA 3MUVP 2BE2B 4ELUA 3NBPA 1ZS6A 5HL7Q 1NUEA 1RGVA 3OQ2A 3KLEA 1QD1A 2KG0A 4OZJA 3RRHA 4Q8FA 4DX6A 1JQGA 2F8HA 2XSFA 2ZOMA 1G3OA 4C3KA 2W7OA 3UCUP 4WF9Q 1S5ZA 3M32A 3QNWB 3CCWA 3G82A 1ZM3A 2CJ9A 4C6AA 1BMQB 3EMTA 1MWZA 3N28A 4OZNA 2J76E 1SJ1A 5DDPC 2LCWA 1V6HA 4J9NA 2C3PA 3K57A 3I5CA 3TEGA 4DF8A 1CC7A 4DL3A 1X5PA 1B7FA 1GFWB 2FHJD 2HK2A 2AMCB 2K3IA 3N9UC 1AXQA 3HVRA 4J9QA 3CJTA 4E8UA 5IT4A 1SL1A 2DNZA 4QW9A 4LR8A 5LSRA 3RTVA 2IYIA 3R5CA 1KQSR 4CLWA 2QT7A 4ZKAA 2DNLA 1MROB 1N88A 1BUXA 1UTAA 2I5JA 2QFIA 4K4SA 1YITS 4WWSA 1TL1B 3VF0B 5KT6A 1L3VA 4DPWA 3GYGA 4A48A 1IBKJ 1Y3KA 4TNOA 3F44A 2QMXA 1FX4A 1C1BA 1WSVA 4M5JA 3C14A 4WKYA 4X64F 2ZM6J 4JI8J 1I51B 3AAWB 4NZ6A 2YNHA 4GKJF 1SQEA 1KHWA 3JSRA 2VA3A 5AXKA 4EO8A 3SV4A 2V50A 2D9OA 1YSJA 3O8WA 4O0NA 5F8JA 2FY8A 5GAEI 1TQLA 4M5NA 4X2BA 4N76A 4IH6A 4CO2A 3LP1B 4HT7A 4LF7F 1YIJS 4CH1A 4K4ZA 3QLHA 4RW9A 5EX3A 3WBZA 2KZMA 1S6PB 3LGMA 3TYTA 3PFOA 3MEDA 3K2YA 3TVKA 3P49B 1SV5B 5ETTA 3FFIA 3Q8RB 3A3OB 1Q7YT 3HM9A 4IRDA 4FF3A 2J6UA 3TR5A 5F8IA 2OI2A 2OMOA 2XWYA 1XEZA 3FQKA 3M8QB 2ZJRQ 2W4DA 2NSCA 3SMZA 3CMAS 1JLGB 3QRRA 3OL8A 4ECTA 2G0IA 2MY8A 2XC9A 5JJBA 4FYXB 4XIUA 3KJFB 4ECYA 1S9GA 2I0XA 3BS9A 3IR7B 2EFPA 4A8KA 2FJXA 4DSLA 1WHVA 1ZBTA 2CZ9A 2RHSB 4QIVA 4C8MA 2ASJA 3B8HA 4OYZA 3CCMS 4W92B 4FXDA 2YNGA 3FSXA 4DV7F 4PQUB 4FN5A 5AXNA 2DVIA 3T9NA 1DLOB 1JLBB 3R1HA 2VA2A 3EM1A 3BGLA 4J9UE 3RJMB 1CVJA 3MECB 1TKXB 5KFNA 1TMMA 2O3DA 4M94A 4F50A 2BJEA 4KV8B 4USTA 4WBFA 2VDIA 4DJBA 1JLQA 2D9PA 2C28A 1RTDA 2H65B 1XNRJ 5T41A 2RU9A 3QAUA 3PJWA 4OX8A 2J6TA 5J1EB 4MT1A 4J7CA 2E1PA 3R7BB 4WIIA 4DPYA 1ACMB 5KT2A 2AJFE 4PUOB 1RXOB 4BHQA 4DUZF 1O0PA 4LSZB 1L5UA 2DGSA 1S48A 4U6PA 4CH0S 4OYWA 4JI1J 3BR9A 5D15A 5GAGU 2AEMA 4USKA 3K5MA 2MY7A 3NBPB 1CJUB 3IRXB 1PJ5A 5CD4H 1OSCA 2ZUAA 2D74B 2XYGB 2AJQA 3US5A 4JB8B 3LP1A 1X0PA 4LFBJ 4CTAB 1C4AA 2M88A 1U1RA 3M32B 1FKOA 1R8BA 1A0OB 2QA4S 3LUYA 4USJC 4FF2A 1RT5A 4NLXA 1RBAA 3S8SA 5ITHA 4DSJA 4AD6A 1S1WB 4KSEB 3EWGA 4DPUA 4DCPB 4H4MA 2CNOB 4YFUA 4NLRA 4WK1A 3X1LB 1LOUA 2BOAA 4X64J 5L1LA 4OZ0A 4LBHA 3LPEA 3EDRB 3OXFA 4DV5J 2HVIA 4B02A 1IR1A 1FDDA 2D1CA 3TUJC 4LSNB 2DXFA 3F0NA 3GWCA 5K14A 4B3TF 4IRCA 1U0SA 2CPIA 3FVYA 3ILJA 4DR2F 2YTCA 1RUSA 1IKVB 2VPXB 5E3AA 3BQ0A 4M95A 4PWWA 3RG6A 2W9BB 4DV3J 3V4IA 2ZDOA 2Z2MA 4ID8A 2R7XA 2HLTA 2QLBB 4FVMA 4I6WA 4QU7A 4CIOA 4CO5A 2MSTA 2W1BA 1QM9A 2M70A 2OEKA 2V8DA 3I5AA 5HANA 4Q5VA 4Y00A 3IWNC 3BO4A 1F9HA 1F5BA 2MZSA 4CDIA 1EX8A 4ECXA 2YH0A 4ZVOB 4YP3A 2GVZA 4WYLA 5A8RA 4ZVUB 4DR2J 1T03B 1SL0A 1S1TB 4KYZA 3OVBA 1T9TA 1IM6A 2BVZA 1S1XB 3IBFB 1RT3B 1F9EB 1VC6A 2U1AA 2JEGA 3HULA 3DXBA 2UU9F 3QJJA 2ASLA 2R7UA 1ZAVA 3DDIA 4ZOSA 3MMBB 3FZ2A 1HWJA 3JAMU 2JEFA 2R7TA 4G6VB 1RWKB 1D9DA 3QRQA 1K47A 4IG0B 1IR0A 4CP5A 1ITPA 1P27B 5F8GA 1VRQC 3TAMB 2KFNA 3CT9A 1CLFA 3KUEA 4KHPJ 3TNVA 4RW8A 1NKBA 4EFAC 4O3OA 2YNHB 2IVFB 4P2FA 1EETB 1SC4B 1N5VA 1TK8A 5I4MA 2MLYA 1FE4A 4ECQA 1EB0A 1M90T 2EKNA 3TX0A 3RGIA 4PWDB 1GH8A 8RUCA 2DNNA 4ED4A 1VISA 4I4BA 4DLGA 4BWMA 1NPRA 1J5EJ 1GT8A 5SUHA 2M7SA 4I2PB 1QSSA 1UP1A 4CO4A 4GMKA 3J7A1 2BYCA 2RQCA 4RNNA 1RTHB 3FEZA 5B0CA 2QYGA 1K73T 2EG2A 3BDEA 3LTOA 1PYSB 4XDDA 1IVZA 1FRLA 1DURA 1T9XA 3I4HX 3R5AA 1S1VA 4N41A 3H8YA 1WNEA 1G1XA 1YKWA 2KT3A 4F2RA 3RYLA 1NCLA 2YXLA 2QN6B 2UUCJ 2X1GA 3BBBA 4JI0F 4DPXA 1LWXA 1VCTA 2CKWA 3LOUA 3MFIA 1NK4A 1TKZB 1PYOB 2JEIA 1S9FA 4ZN3A 4DHVA 3PW0A 1KLNA 3ENAA 3MD3A 4C8OA 1JXEA 3CJ0A 5M2RA 2RQ4A 1AB8A 5HO4A 2VOPA 4PG4A 1KQKA 1RAIB 2JHEA 5IC6B 2FGCA 1FRHA 2HWHA 3EZOA 1S0OA 4UY85 4Z37A 2DD8S 1FWLA 2RF2B 3DHXA 4HACB 4WJBA 4AL6A 4PXBA 1UL3A 4XPEA 1VQ6S 1TAQA 1YJUA 2XZDB 4GVBB 4O23A 3WQPA 5KFJA 2RQKA 3JTPA 2VBYA 5ETRA 3WHIA 4BS2A 1ZM4A 2CQDA 2MSSA 3FEYB 5HBMB 1V5IB 2JLGA 1Y5NB 3PR4A 4DR1J 1IR2A 1R31A 3HZEA 3M8YA 2XCAA 5J2MA 1EP4A 2PEBA 4USIA 4M5DA 2DHSA 2F8MA 2PFDA 2H4WB 1KOHA 3BYRA 3IFEA 5DDRC 1B0PA 2CA9A 3M8PA 3GCWP 1HKAA 4QR2A 1IM4A 3U02A 4K59A 3HKWA 2G0CA 5KFEA 3MFHA 3VAGA 2F4FA 3TZZA 1RHRB 4DL5A 2Z4PA 3QO9A 1D9AA 1HD1A 2P9EA 1FTCA 1UA1A 3KKFA 5CYMB 4B9SA 1TAUA 2CG8A 3ELHA 3MEEA 3KK2A 5D0GA 3W5YA 1OS5A 2M0GB 3CJ2A 2HNDB 1R6YA 1SUQB 1VI7A 4PCQA 4URSA 2H3EB 1O51A 2QLJB 3J7YI 3TUZC 1SJ4P 5H9FK 1N5QA 3CJ3A 4G1QB 2Y8WA 3VAKA 1WJ9A 4EYIB 2DNHA 2MJUA 1IBKF 2VG5A 5HAOA 1YTYA 3PDNA 1TU0B 1DTTB 3MMAB 3T5HA 2HFUA 1F1BB 3ZXWA 1RLCL 1K8AT 4ALZA 3EPGA 4DR7J 4DV4F 1SJ3P 1HD0A 4JI7F 4OZ5A 2Q43A 4Y3CA 5B0GA 4CLKA 3JSYA 4B9VA 2EW9A 5G4DA 5FIIA 3VCDA 3TOQA 3KXDA 1RBLA 3D1OA 1M1GA 5KFVA 4TQRA 2O66A 3OHAA 1HBUA 1S59A 2KI2A 3LAKA 4KKOB 4OZ2A 2GHVC 3ZNUA 4P2MA 4CWBA 5K20B 4LRBA 1TK0A 2GAHC 3T6JA 3A8KA 1D3WA 2XMTA 4DL0C 1YJWS 4KTQA 1W2IA 2QG9B 2XHWA 1I6JA 2QL9B 2KG1A 3FBEA 1SBRA 4MFBA 1I94J 3UFCX 1Q95G 5CXTA 5HLFB 3HHLA 4C11A 3JS9A 3LP2B 1WWHA 4HDHA 4K5RA 2O01C 4KGVB 4I69A 1F2HA 4PG7A 3VVTA 2OP5A 3P45B 1N56A 4HKQA 2VZ9A 3TZXA 1Y5LB 2CQIA 2DO4A 2PFFB 1CS4A 2KVQE 3R6LB 4MKBA 4K2XA 1UFKA 3HFZB 4RBUA 5J2QA 1U1NA 4EGLA 4F36A 2K7JA 2QSWA 3OUYB 3HXMA 5J2NA 4DV7J 2AX1A 4A8FA 1CQNA 1RKJA 4QCLA 4I2PA 3TUIC 1VYAA 2LQ8A 4ZP9A 3QGPA 2DH8A 1RHQB 2JLEA 2HAIA 5FDLB 3TVYA 5CQGA 3IN5A 1XMOJ 5J2PB 4RU2A 2HHWA 4PWUA 5IFMA 2FJVA 1S1VB 2IRYA 1FD8A 3TJ9A 1GAOA 3HVAA 1MWYA 2UUBF 2MGZB 1X8DA 2MQNA 4NYZA 5CYMA 2C3OA 1JLEA 1R8HA 2IFXA 4QIFA 3TP2A 3UI3A 2XTJP 3DM2B 4U8YA 2CPEA 3GFXA 1HQEB 2IYGA 3QT7A 5H1SV 4PZVA 1TP7A 1WF0A 4K4YA 1LWFA 4AL5A 1P1LA 4F0HA 1TUWA 4OI4A 4YS2A 3GFYA 1KC8T 5DLGA 5DJBA 1APSA 1GNKA 4CO1A 4ZPWR 1KVKA 2IMOA 3AQOA 4R0JA 2YX7A 1FNXH 2FGOA 5LOQA 5IWAF 1XR7A 2B4OA 3RAQA 3M6XA 2GZOA 5GAEU 1VLOA 3CIMA 2FJWA 2CJAA 3MAAB 2QA2A 1UPMB 3UD5A 3V2UC 5LJ5Y 1C0UB 3NGUA 1S6PA 4Y2IA 4N56A 1Q79A 2VG6B 2W25A 3PYGA 2DNKA 3KLIA 4LUBA 3M6WA 4C0BA 1YJVA 2W01A 5ADZA 5J2MB 2XLJA 1BQMB 1GK8A 2F9JA 4C11B 2B6AA 3TAQA 1TUVA 4B9UA 3DRPB 3DOKA 1QVGR 2OO4A 3F41A 2FIUA 2MKYA 3DFEA 4F0MA 2VOOA 4NYPA 1RI7A 2LLZA 3NGDA 5LL6d 1X4EA 3GMGA 3GIJA 5J2NB 4E2FB 3PX4A 3CDUA 3QT6A 1MLAA 3CCZA 4OI1A 3Q24A 4ETXA 5K5MA 4DV3F 1S1WA 3J7YU 3GSDA 1MN9A 1F3FA 3FJ2A 3H42A 4ZLJA 2Z57B 2F4VF 4X4VA 2BQ3A 3NWGA 3B82A 2Z2ZA 4IFYB 3OFEA 4ED7A 1VQLS 2N3LA 3KOAA 3K59A 5AXMA 4KFBA 2W2MP 3MMAA 1U02A 1RT6A 3QGIA 1UA0A 1JK9B 3KDOA 4ILLA 2ABYA 4ZK7M 3Q23A 2RRAA 4IOAQ 1JLQB 2OJ3A 3MHYA 2FLNA 3R7SB 3PW7A 1H3DA 2HQFA 1KFSA 1UVMA 5BJRA 3ZZTA 1HWUA 4ZP7A 4BC7A 1AFJA 2GMJA 2CRLA 3MR2A 1Q1KA 5C24B 3W66A 1LW2B 2AGQA 1WI8A 3MMCA 1QAJA 4RX6A 3MM9B 5IT0A 4K4XA 4N5SA 4LMZA 4LREA 3G8SA 1HNZF 4YB5A 4WXOA 1SKWA 4IFVA 2LMIA 4PRFA 3X3UA 4HL9A 5GAGI 3FZBA 2UP1A 3HD2A 2JH3A 4PPZA 2DNGA 2GJIA 2G4BA 1TKXA 1YK9A 1RTZA 1XJWB 2WSEC 5L8RC 3AA9A 4N8OA 3MR3A 3R27A 4N7TA 2RD5C 5A0YA 1X60A 3I0RB 5KFMA 4HI2A 1QAXA 1RA7A 3A8IA 4P7VA 3CUNA 2E5LF 1RKIA 2RS8A 4HH0A 3M9MB 1OSDA 4LF2A 2B43A 1DJ0A 4PXEA 2CADA 2PGCA 4ZPAA 3TAMA 4QIEA 5EN1A 1SH3A 2IJRA 2BE7D 2GJ2A 3L7UA 4O4GA 4O3QA 4Q45A 1KRPA 3IM8A 4LIRA 1QUPA 2CQCA 3VAMA 2IIHA 4ZLLA 5C25A 4RW7A 4RNFA 4QZVB 2J9CA 3R7NB 2DR6A 1FFGB 1KHVA 1TL3A 1X4HA 4PG6A 3MM8A 2EFVA 1TELA 3HHDA 3EPIA 1U1QA 1QSYA 2V5HG 4C8KA 3CPWR 1Z2LA 5AT1B 2KT2A 1CC8A 3IM9A 1MMDA 3OR1A 3IBCB 2UXBJ 4QYZK 3NKYA 3DDKA 3KHGA 1TL7A 3GJQB 1XNRF 5KFWA 3D4JA 3N01A 4WFYA 4R8UA 4C0HA 1L3TA 2WONA 4WXWA 4Q44A 2VODA 4C8YA 3LP0B 4EO6A 4KY3A 3DRRB 4QQBA 2KVIA 5IC4B 5AJ3J 3G6XA 3D0IE 4OL8A 4H4OB 2JFKA 3VQSA 2I5JB 3OFFA 4WYWA 1IJFB 2GQQA 7AT1B 5HQMA 3M30A 5EWGA 3RB6A 1DBDA 2KO1A 2MGZA 5L39A 4DR3J 1DQ8A 1QY7A 1U6FA 2ZBPA 5KG5A 1SCJB 2ZBCA 4NOHA 3PX0A 3R2DJ 5ETKA 3H0PA 3J7Z5 4A8MP 1XN9A 3MPUB 3MGJA 4TXSA 4X84A 5KOXA 1H98A 5GVQA 1VOMA 5B0BA 1SQFA 2X1AA 3TVZA 1YJNS 1SJQA 3FCHA 2FHOB 4DV0J 2WW8A 4YDDB 3AD9C 5AXLA 3LGHA 1LV5A 2DYAA 3TARA 1RHJB 2PMHA 3NGSA 2O5DA 1GMUA 2J9EA 2OPPB 3KJNB 2RS2A 1T0TV 1VQ4S 4KH0B 1RADB 2AYBA 2QMUB 3Q2TC 4PWDA 2LEBA 1Q16B 1SH2A 2D3UA 2XBPA 1V5VA 3N0VA 5J1PA 3N5FA 2KFYA 4DSFA 4JI6F 1SH0A 2AJ4A 2ROEA 4I1TA 2AJ2A 1VQOS
chains in the Genus database with same CATH topology
5KFDA 2CVEA 5DGBA 1Y9OA 2VFVA 4NCGB 3UW1A 1E6VA 2KXFA 2MZJA 2UUTA 3GFZA 3HP6A 4AUKA 1C0TB 4MYTA 4WE1A 1S72S 1NKCA 4B3OA 2C2RA 4V19J 2R7SA 3NMRA 3CD6S 2OPRA 1SUQA 2HNDA 2A2DA 3CF5Q 3NNAA 5LT5A 3BEGB 2GNKA 3JYTA 2IA6A 3DCAA 2YNGB 4F02A 4N8NA 2R8HA 2ZD1B 2VG5B 1VRUA 1K1SA 2DH9A 3HHLD 3LO3A 1XNQF 1BC6A 2ZH5A 5CYQA 3AJ2A 3LW5C 3VAFA 3KLEB 1K0TA 2R7RA 1HNVB 1OWXA 2G1DA 2N4CA 3CE8A 2BANB 2ZOFA 2QA1A 2A2CA 4OFZA 1ROFA 1S6QB 2CPZA 2YVSA 4MTPA 2DNYA 3THPA 4R5PA 3DXSX 1MROA 1S79A 4DBQA 1VBZA 2VA2A 3KTQA 4YB6A 2HIQA 2MKHA 3R5BA 1WHWA 1BWEA 4J9SA 2IRXA 1NKEA 3UDLA 3FGVA 2W9CB 1CEZA 1H2TZ 1FXDA 3DRYA 1F9FA 4DN0A 3M1VB 1A7GE 3N6MA 4O4GB 1RTIA 4BWJA 3SFGA 2DNOA 2FHJA 4RNFA 5K8PA 4O3RA 1K1QA 3GR0A 5FD1A 3JTOA 3EYZA 2X51A 1RYSA 2WK4A 2OLWA 2E44A 1FKOB 2ZDPA 2KH9A 4PQAA 2RRBA 1JWWA 2UUCF 2J0WA 1Q8LA 1RK8A 3MM7B 5KFZA 1Y3JA 2PT0A 1E6VB 3PW4A 4DSEA 3KLVA 1HYSB 1KLMA 2NQPA 1SI9A 2Q6BA 1B64A 4ZMMA 2W7PA 1UKUA 1RT2A 2B4PA 4QJVA 1Y0HA 2OPRB 3KNGA 1M5KC 4M63A 4TLQA 1AFIA 1FT8A 3DGPA 4IRKA 4NWBA 1HNIB 4WZMA 2KB2A 1F60B 1TVRB 1XMOF 1U6BA 3PV8A 1N0UA 1NJWA 3MUMP 3LWMA 2G13A 2AJ1A 5E33A 3OW2R 1JB0C 2NXUA 3Q8PB 5KG2A 3G6YA 2DNMA 5KG4A 3UNGC 1S9GB 4ID5A 4UQTA 3DLBA 4A4JA 3MCSA 1WG4A 1HBOB 3M6UA 3V6DA 2ZH2A 5BR8F 2KM8C 1E6YB 5J1EA 4N47A 3QPIA 4YDXA 4EBCA 4NL5A 2B6AB 5F9NA 2RDJA 5LXYA 3DOKB 2AU0A 2P9GA 2V8VA 2C42A 1N33F 1S99A 4LF9F 4WZQA 3G6VA 2ZH1A 3RAXA 2YNFA 3E51A 3K7RA 4DV1F 3GILA 1TK5A 3K0JA 4DR7F 3MTJA 2HQIA 3T1AA 4TU9A 1X4AA 2NYIA 3KJVA 4FF4A 2LA6A 4Y2AA 1UJ4A 3DOLB 3H5UA 3RZAA 5KFIA 2N4DA 3ISNC 4DWIA 5A8WA 3ENVA 4CT8A 4RZRA 4X4OA 3IRXA 2NSBA 4DV0F 1N48A 3T19A 4I68A 5L1IA 4IO9Q 2FLPA 5E7OB 2QFJA 4RKUC 1FRXA 3HVWA 3KLGB 2RIJA 3OBIA 2UXDF 1Q53A 7FDRA 4FZVA 2VG6A 1BQNA 2W9BA 3CSKA 1HARA 3I6PA 4X4SA 3DC2A 3MEGA 2IVYA 4QWEA 1VRUB 1NK5A 2MQPA 1VBXA 3MWBA 4RW6B 4NMLA 3SQGA 4DS4A 3LF0A 1CG2A 5EGYA 2CPHA 2QSFA 4F4YA 1U25A 3VAIA 4ID5B 4KB7A 1N6QB 2CZ4A 1UFLA 4LSLA 1MNEA 1JJHA 1DQAA 3RRGA 1LWEB 2PI5A 2WOMB 1JLCB 4ILRA 1WEZA 3MM6B 2Y1RI 4Q0BB 1ULRA 4RUHA 2HNZB 2HHQA 2PSZA 1FKPA 4I2QB 2PD1A 2MZTA 4KFBB 4QIWD 2XMKA 1N5YB 3OXLA 3E01A 4OZLA 3RU0A 2DO0A 1U7LA 4NZ0A 1IN0A 2QIFA 1EETA 2XY5A 2P6TA 2QLWA 5A6WA 3CCVS 1H6KX 2XS7A 5IQ6A 5HN0A 1SKRA 3CEDA 3QYYA 3K8WA 5HMWA 2KKHA 4L6V3 2P5VA 4EUVA 1D1UA 4X4UA 1QJHA 2MHEA 5KFSA 5M2UA 1FA0A 3PIOQ 1HHSA 2IMWP 1NJXA 1S10A 2GIQA 5I3PA 4WFBQ 1V3ZA 3M30B 4ZVHA 3BQ2A 1FHTA 4FYDA 1O8BA 2HVZA 3DU5A 4NRTA 4QPTA 4JV1A 1RT7A 2AD9A 2LYVA 3NCRA 3PFEA 3H98A 1TL1A 2D3ZA 1C4CA 3Q0AA 1U6ZA 3OFHA 3K58A 1FK9B 1HA1A 2ZE2A 1IKYB 1CPZA 3MEKA 1C1BB 3U1MA 1WD6A 1NJIT 1FRJA 1SJRA 1VFJA 4FPRA 4R0EA 3CWJA 3WZ0A 5C42B 1KC8T 2E5GA 2B9XA 1LFWA 1UFWA 3BN7A 3HVTA 4O0IA 3I55S 1SL2A 4CCHA 1RP5A 4ILMA 2FJEB 1TKZA 2XLIA 2QLXA 5C5JA 5HROA 2HS0A 3HDSA 3EXYA 2V4JA 4CI0B 4UQGA 1U49A 5IQQA 3G8TA 1WELA 2VBZA 2A3JA 2LEAA 2LDIA 2J7UA 4NRUA 2MQOA 5KFQA 4B9NA 5EDWA 1LXJA 2JVOA 1VC5A 1HPZA 1R43A 2HWIA 1R3NA 1XC9A 3DOMA 1URRA 3DM2A 4K4VA 1GTHA 2B56A 3KWMA 2ZNYA 4QIGA 2FVRA 3THVA 2FJAB 3AH6A 3CD0A 3AHPA 4DX8H 5KFCA 5AE1A 5EWEA 2DR9A 2MPUA 3OVSA 1J5OB 4K4WA 3L3CA 4RU9A 4ELTA 2CIMA 3NLCA 4ZPDA 4X4QA 2KJWA 5KG6A 3CC2S 5KG0A 5EWFA 2QEXS 1RT1B 4NLDA 3MAHA 1KFDA 1ZH5A 3NMAA 1MMLA 2JC0A 3DMJA 2L41A 2O1PA 4DEZA 2RMLA 2M5YA 5KFTA 1UJ5A 5F0WA 3GIMA 3D1HA 2YWFA 3UDCA 4AFFA 4I56A 1ZM2A 3HHKA 5DG9A 1X9MA 3HX9A 2EFOA 1BLUA 1Q8BA 1TKTB 3QJLA 2W8LA 3KHRA 4U9RA 4Y2CA 1DLOA 1JLBA 1LW0A 4RW8B 4DOZA 1BY9A 2IAJB 4WTYA 5G0RA 5A8KA 1T05A 4OV1A 2R2RA 1LK7A 2DGOA 1WHXA 2H9ZA 2WCXA 2K1RA 4LF6F 3UE2A 2ZC3A 2HZCA 5LSLA 1S0NA 2JVRA 3NCQA 1X0FA 2NS1B 2DTJA 1D8YA 2PN6A 2R8KA 2DR8A 3DRSB 1M5SA 3I56S 2XMJA 2ZH4A 1MU2A 1S1UB 2Z8QA 1MMNA 3NNHA 3ULHA 3SXLA 4OJHA 1JKHA 5CYJA 2CJQA 4KC5A 2ZFHA 3OR2B 2JWNA 1QAIA 3TRGA 2PDAA 5KFBA 4F4WA 4E98A 1HNVA 4L72B 3MZIA 2B3TB 4GO5X 3GE9A 5KG7A 5KT5A 1FJ7A 4LQ3A 4ZLPA 1U2FA 1XTZA 2IJNA 1FRKA 2QO3A 4OLOA 5IT9Y 2LQ9A 3M8SA 4I6AA 3MM9A 3HLUA 1UVKA 2GIRA 2DISA 3KNAA 2W9CA 4USHA 1KSPA 3G96A 2C3MA 4OIXA 4LF5F 4W90B 3QIPA 1VIXA 1KVIA 2EBGA 3DU6A 2X3GA 2BACA 4HDGA 4XK8C 2N7YA 5A8RB 3I5BA 3G6ES 2C2EA 1U24A 5CCMA 3CJ5A 1U45A 4J5OA 2XY7A 4M5DB 4MIAA 1NRKA 3VR1A 1DTQA 3M2RA 1U1PA 2RVJA 2HMIA 1X5OA 5I3UB 3H2UB 3SDEB 3R1LA 4DQIA 2EFGA 4Y0FA 1NK6A 1Z2ZA 2WHOA 5BYSA 5KOWA 2HRUA 4TN2A 5IM0B 1WEYA 1X7VA 2D7SA 2W9AA 1VQNS 1UEVA 2XMUA 4DQPA 1JLFB 3H2VE 3TANA 3OSPA 1HNIA 5F3ZA 3KYLA 3SSSA 3NL0A 2LQBA 3FDSA 3BGRA 3DI6B 3A8EA 1U4BA 5GAHI 4WFAQ 4KV8A 3MOZA 1OPIA 4X65F 4NA1A 2E66A 1FE0A 1X5SA 1HPZB 3NAIA 3S6EA 6FD1A 3V6KA 3S1TA 2UZAA 3V81A 1GX5A 1U1LA 2I38A 1WEXA 4LF4F 5FLXY 4DR1F 2YWGA 3N6NA 4RUAA 2HHXA 1FDAA 2IHR1 4IFYA 3BO2A 4V19X 2ILYA 1VGYA 3CULA 3O6QA 3TAPA 1BD6A 1JNZB 2BXJA 2E1RA 1I1GA 1PSDA 1U26A 4BC9A 4RW6A 2R2SA 1HBMA 2CG4A 1HBNB 4JBCA 2AGOA 2J0SD 3RW6A 3O5TB 2AP6A 2OKQA 5AE3A 1TR0A 4NLUA 3M8RA 1D0EA 1QE1B 4M1KA 4YUDA 2VFTA 4KO0B 5KFAA 2VV5A 2WBMA 4OJ3A 2DT9A 3KLHB 2R2TA 2WB1D 1LWCA 2FDNA 2M3DA 4OI2A 4NLPA 4DL7A 2DGUA 3I0RA 4P7TA 3MEDB 1U09A 5CH7B 2BRKA 3F73A 1KQFB 3FFIB 2Q3PA 2CQGA 1EP4B 1N34F 3IR5B 1C0TA 4WE1B 5HP1B 1REVB 2R7QA 3MPVA 5DQGA 1JLGA 3V6JA 1Q81T 4A47A 1VQ5S 4LVNP 4TY8A 4EWTA 3GFHA 2J9DA 4RW7B 5A0YB 3POTA 3DYAA 5DDQC 2K8GA 4B9MA 4EBEA 1RTJB 1S9EA 3CDBA 1NNDA 4RNOA 3UQSA 5D4LA 2GW8A 4HVZA 3PACA 3HKZD 4CT9A 1N52B 3KJVB 1X4DA 1P8GA 3CIZA 2LKZA 3CXCR 2CZVC 3O44A 4ECSA 3JSMA 1TV6B 1TZ0A 3CD7A 3T9ZA 2MKIA 4KHPF 3MTKA 3RRKA 2RKIB 3OFGA 3BO3A 1NK0A 3SI8A 2YKOA 3C8YA 4MK8A 2BM0A 4R25A 4JV2A 1KR4A 4KKOA 3QZ8A 2M52A 5I3QA 1R8CA 1KD1T 3SEOA 2BE2A 4OX6A 3PZPA 3RB4A 1NHVA 5LMUF 3E8OA 3MECA 5E41A 2VFSA 1N0VC 1ZTWA 4G3IA 3G86A 3CC4S 2ZVSA 4DV5F 4GC7A 1RTDB 2DHGA 3M05A 3SCKE 2MKKA 1KS2A 1XWLA 3M2UB 4EZ9A 2P6SA 3ITHA 4I0WA 3E2EA 5EHHA 1AROP 5B7WA 3KMSA 4OZ1A 2LVWA 4TYBA 1JLAB 5T7LB 3H40A 4ECUA 4Z2XA 2VFRA 1PGZA 1HI8A 4IR9A 4YR2A 1HNXF 4NXNF 3UCZP 1JJ4A 4X4TA 1HYSA 2R7VA 3KK1B 3C2PA 2OPSB 2EG1A 2GQ2A 1ZZNA 2ZUGA 3SCLE 4OHZA 1D8ZA 1VQPS 5MAOA 5D4PA 4DMZA 2FTRA 4GO7X 2OH2A 2Q79A 1GXUA 4EEYA 2IM0A 2OPPA 3WDOA 2JEJA 1N32F 2HHHF 3NNCA 3MD1A 1NO8A 4I7FB 3OL7A 2YQ3A 1LWFB 3HPOA 4DL4A 2XMVA 4Q43A 3J81Y 5CHCB 5MLCV 3UD4P 3C6UA 4LT6A 1YHQS 4Y2KA 1G6BA 4IDKB 2UVVA 3M9OB 3H4BA 2IA0A 1ZPWX 2XSJB 2VBXA 4OJ1A 4KR0B 3SCJE 4C98A 4CH7A 4DFKA 2GHPA 2DCLA 2YKAA 2ZH9A 3GYNA 4ZS6A 1S1XA 3ENWA 3THTA 1HQEA 3S01A 4DL0C 3CO9A 1M5HA 1VQ6S 4KAIA 2W8KA 2H5EA 2B5JB 2FHMA 1IQTA 2DGQA 3Q8SB 3P5TL 3OTEA 2VFUA 4ECZA 2OPQA 4F25A 1RT7B 2PO4A 1FXRA 1HW9A 5H9EJ 3H20A 1JIHA 3LAMA 1GQEA 3S7RA 1UVLA 7FD1A 2BABA 2IM2A 4ZCIA 2GQCA 2K1RB 1U1MA 3QWUA 2EBEA 2XMMA 3UCGA 3BGUA 1VC0A 1TL3B 2QZ8A 3UPFA 1ZZFA 3IRWP 4NXMF 2HRYA 1TL4A 2KRRA 4YR3A 2YNIB 2PEHA 4J9OA 1MU2B 1JLAA 2KTQA 2NUHA 4GC6A 1UWBB 2BV3A 3SZ2A 2FHKA 1FKAF 1TL5A 4QR1A 3H5YA 1P9QC 2BQRA 4PUOA 1Q8IA 3DN9A 3C3LA 5E5NA 2CQPA 2ZJQQ 2IC3B 4X4RA 3M6VA 3U7JA 3O3LA 4DQRA 4UUXA 4JV0A 4ZCMA 3BSNA 4OHXA 1Q82T 4IQMA 1X5TA 2VL1A 1HI1A 1NB7A 4BBYA 1T7PA 3ZFVA 1BQNB 2KXHA 1T94A 3ETOA 5A2QY 3MM7A 4NLWA 5EUHA 2HFOA 3DYAB 2F9DA 3HHLB 4IDKA 3AB2B 3QAEA 4IO1A 2WTFA 3VAJA 3CCQS 2L08A 4FNIA 1XERA 2GGPB 4A8XA 4C97A 3GQCA 1VQ8S 2VPYB 4ERDA 2CQHA 4HHJA 2VD3A 5DETA 5D4OA 2MZ1A 5JVGQ 1X4FA 2ILZA 2RJZA 3BGFA 2XGQA 4LSNA 4LSLB 4ES1A 2DB1A 2CQ3A 2CPYA 4X4PA 4JI5F 1HW8A 3OTCA 2E1MC 2ZZMA 3IS9B 4NLYA 1DHMA 2YKNB 3GR1A 2OSRA 2CQ2A 1GXTA 2VUGA 5IXUA 3CCSS 3MOJB 5KFPA 4PKDB 2LEPA 3EX7B 1YJTA 2LU2A 2C3UA 3CDWA 4ED8A 4DL6A 1N36F 4F2SA 3K5NA 1R27B 1S1TA 2KHDA 4F3QA 3BREA 1XK8A 3EGNA 3K5LA 3VZHA 1FNOA 1HMVA 3IGNA 4IOBA 1E6YA 2XLKA 5B0DA 1R0AA 2POKA 3DI6A 3U1NA 2EWHA 4EYHB 1GX6A 3OTBA 4AYBD 5AE2A 4KE5A 2BM1A 1XR6A 5KG1A 2ADCA 1NJYA 4ZA1A 5F9LA 2VB6A 2CPDA 2FD2A 3QO9B 2EPIA 3ZZ0A 4A8SA 3RR8A 4Q7AA 1PC4A 1LKZA 4R5PB 2JC1A 2QRRA 1L3UA 4Q2LA 2C2DA 5KFLA 1NK9A 3Q22A 1RT4A 3WC2A 2KN4A 5FJ4A 3CB4A 3H5SA 1Y00A 1AW0A 1IKYA 2HWTA 4YHHF 4O3NA 3EZUA 2RU3A 5IZHA