3AA8A

Crystal structure analysis of the mutant cuta1 (s11v/e61v) from e. coli
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
103
structure length
103
Chain Sequence
TAVVVVLCTAPDEATAQDLAAKVLAEKLAACATLIPGATSLYYWEGKLEQEYVVQMILKTTVSHQQALLECLKSHHPYQTPELLVLPVTHGDTDYLSWLNASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Divalent-cation tolerance protein cutA
publication title Remarkable improvement in the heat stability of CutA1 from Escherichia coli by rational protein design
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 21
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3aa8A00
2O66A 1H3DA 3N5BA 3DFEA 5L9NA 3HLUA 1O5JA 2O67A 1HWUA 5D4LA 2J9CA 4C3LA 3T9ZA 4C3KA 4RWWA 4WK3A 4CO0A 3NCRA 2J9DE 1Q1KA 4OZJA 4Y6IA 3TA2A 1V6HA 3NCQA 4AFFA 1XK8A 1VHFA 2GW8A 5DRKA 1P1LA 1OSCA 1QY7A 2V5HG 4IYQA 4WK1A 4E98A 2GNKA 4RX6A 1O51A 2XG8A 4CO4A 5D4OA 4USIA 2ZFHA 4CO5A 3M05A 4NYOA 4YB5A 2Z0GA 1NZAA 3O8WA 2GX8A 2EG2A 4CO3A 2NS1B 4NYPA 4Y65A 2E66A 4D3HA 3BZQA 4OZLA 2J9DA 1KR4A 1UFLA 4C3MA 4YB7A 3CE8A 4ZK7M 2DCLA 3O5TB 2VD3A 2XZWA 2J9EA 2RD5C 1NH7A 3MHYA 1V9OA 3AA9A 1GNKA 5DS7A 4CNZA 1VFJA 2ZOMA 3AA8A 3AHPA 5D4NA 1PILA 1UL3A 4OZNA 3TA0A 1UKUA 2XBPA 3GSDA 4USJC 4USHA 1J2VA 2EG1A 4CO2A 4YB6A 4D3GA 1V3SA 3OPKA 1NAQA 1UMJA 4CNYA 3TA1A 3L7PA 2XULA 2CZ4A 2NUUG 2PIIA 4RLEA 3NCPA 4RWXA 5D4PA 4CO1A 2JJ4D 1NH8A 3X3UA 2NUHA 4R25A 3LF0A 3AH6A 1V3RA
chains in the Genus database with same CATH superfamily
1Y5NB 2AMCB 2M8DB 1XMBA 4ZP9A 3BO2A 5C25B 1U1RA 2OTLS 3EZOA 3HPOA 2G0CA 4J9RA 1RHRB 4ZPBA 5HMXA 2KM8B 1X9MA 2P9EA 5B0FA 1RT7B 2MPUA 1FFWB 2ZBIA 3EGZA 1M5HA 3DOKA 2XG8A 5ITHA 5DDOC 3TAPA 4DWIA 4X4SA 1MLAA 4ILMA 2E44A 2L9WA 2MEWA 4ECXA 3DGPB 1RHUB 1QSLA 2J8SA 3TJAA 1ZM4A 4QWDA 2H5JB 3J7ZT 2YKPA 2DNRA 2XM3A 1T03A 1RJJA 2UUAJ 1RAIB 5C42B 3WDOA 2Z2MA 4DL6A 3G2XA 1T94A 4TY8A 2FHJA 1PC5A 4J9QA 4IG3A 5L1IA 4X62J 4DFJA 5DM7Q 2Y1IA 5AXKA 1NAQA 1RAEB 2F8MA 1VQSA 4J90A 5K8PA 1TL1A 2DRBA 5AT1B 3I9ZA 3L7UA 3EGWB 1JQGA 4TQSA 1FXRA 1NHKL 1IBLJ 2UUAF 1Z4UA 4K5RA 1RWXB 1IVZA 2QGFB 1EB0A 1JJ4A 3PM9A 1VBXA 2H1YA 3NWGA 3KJVA 4X62F 3CC2S 1GMVA 1NB7A 4NASA 3QGHA 3MAAA 3R27A 3IBWA 1X9WA 1FTRA 4OQJA 3KLVA 2ZE2A 2FJXA 2RKIB 2AGQA 4LF5J 3VAIA 1RTIA 2YWKA 2PMZD 5E3AA 1LKZA 3EDQB 2NXCA 3BGRB 4FF1A 3AJ2A 1IBLF 4X65J 2LECA 2MYFA 4DR7J 3J81U 2ZC3A 1K47A 1RKJA 1NRKA 4RW4A 2F8HA 4ZITA 1WACA 3KUHA 2YKOA 4KJIA 4M63A 2JFKA 1ZA2B 5DGAA 3D28A 3JB9k 4HKQA 5DG9A 4KY3A 4LF5F 1WG1A 3T1YJ 3RG6A 3X3UA 3IR6B 1NSKL 4X65F 4J9SA 1BXNA 2GIRA 2QMWA 3E3XA 4DR7F 3DNCA 2AKWB 3IR5B 2CJ9A 3M6WA 5ETPA 2FJEB 2NREA 3D1QA 2V68A 3FBFA 3R2CJ 4QW8A 1TUWA 3FKBA 3BDEA 1UAWA 2MTLA 4RU9A 4QIGA 2KFZA 1QAYA 1LK7A 1SXLA 2HBQB 5AXMA 2R2UA 5A6PA 4XDCA 2C2EA 2EVZA 2P6TA 2IRYA 3TEHB 4AXJA 3LP2B 1NK7A 4I7FA 1VQ7S 2DIVA 4DQRA 1CJTB 1YVFA 3T1YF 3FRZA 1TP7A 2AZ1A 3KMSA 3SCLE 2XHWA 4U95A 1N34J 1LWCB 4L3NA 5K8NA 4YR3A 3C15A 1TL7A 1S1TB 2FLNA 2R7VA 2O3DA 3IM9A 2MSTA 1M5OC 5IV3A 2XY7A 2ABYA 2C2KB 1TUGB 1S4FA 2GAGC 3RW6A 4OI4A 1UFKA 1YKWA 5HJYA 4P2MA 1KHWA 3UI3A 4P72A 3HMJG 3R6LB 5F41A 1VRTB 1B0PA 1YITS 1N34F 3HD1A 1HI0P 1UVNA 3G9CA 1DHMA 1UVKA 4KIAA 3CO0P 1T0TV 3GR1A 1XMOJ 3N5BA 3JAMU 3TX8A 1UJ4A 2IVFB 1RTJB 1F5BA 1GX5A 4ZIVA 1U45A 5E41A 2AEFA 1WHWA 2NLWA 3BN4A 1YZ6A 3AD9C 3NY0A 4KYZA 2VODA 1NSPA 3QRQA 1A7GE 4X4NA 2ZOFA 1WHYA 3KFWX 4FPIA 4ELTA 4EZ9A 3U1LA 3NS6A 3DDNA 2WONB 1GMWA 4X64J 1XMOF 5G0RA 2NR0A 2B7BB 2DCLA 2WVCA 3E51A 2LXFA 5LMNJ 3IAM9 1FD2A 3C6UA 4YR0A 1L3SA 2YWFA 1MG7A 1RHMB 2WSCC 1X5TA 1X31C 4QZVB 3M8ZA 2IM1A 1PCAA 4X64F 1LFPA 1REGX 2PA3A 3KLEA 2OIHA 3CXCR 3M32A 4JV5J 5HI7A 1QTNB 5LMNF 4XDDA 1JLFB 2KN4A 2HBRB 4QIFA 2G0JA 4X4VA 1SL2A 3D3BJ 2BA9A 3LUYA 4I69A 2NYHA 1YJWS 4TN2A 5KFJA 3TEGA 2APOA 4HDHA 3HHNB 4F7VA 1RKIA 1RTHB 2HIYA 1TAUA 3PRBA 5K14B 3UQSA 1SC4B 5LJ3Y 1TTHB 2E66A 3P8BB 4RW6B 4JV5F 1ZS6A 2LYVA 3GV5B 1SQGA 2YNIB 4NCGA 3QJJA 4Q5VA 3ET6B 3ZTSA 2LQ5A 4IFVA 3BBBA 1S1VA 3UN5A 4OYPA 3FCVA 3PRVA 4ES3A 3G86A 4KB7A 5E3QA 4WE1B 2AJ4A 2L9DA 5KFWA 4M8LA 3I32A 2ZC4A 1AZSA 3GILA 4HLBA 2XS5A 1JMTA 4DR2J 2ILYA 5J2PB 1WD6A 1VYAA 2KG0A 3G96A 2F65A 2CIMA 4LRFA 4IRKA 2CVIA 1JWWA 1KSPA 3E8OA 3I9V9 2AEMA 4K8RA 4RNNA 4P2SA 5A6WA 1QUPA 2DT9A 2M52A 2NXNA 2HMIA 1U0HA 1H72C 3J80U 5LOQA 3QWPA 3R7BB 4J9UE 4DR2F 4USWA 3SMZA 2ATCB 1CS4A 1T9VA 3IRXA 1OYEA 2VC0A 1UJ6A 2CQ3A 1RU2A 4DU7A 3OSNA 4EFAC 1S6PB 4RW7B 5HMWA 1FDAA 3NGSA 4RNOA 4H4OB 4I2PA 4X4QA 3POTB 2WW8A 3J7YU 3MAQA 1IBCB 1X0FA 1SPBP 1LW0A 2YQ1A 3HDSA 1CJUB 4G65A 5C7PA 2X3DA 2XSJB 2I2YA 2CQGA 4OHXA 3ZZYA 1X5SA 2YNGA 4YEAA 4ZIWA 2BQUA 3ZTOA 2AX0A 5A2QU 1HNWJ 3CMES 3W3SA 2L48A 2LXUA 1WSVA 3LA0A 1ZOTA 1M1HA 1Q8LA 2MQMA 3EE3A 3NGTA 2XYPB 3MZIA 1D09B 3D68A 3NGDA 2KB2A 2Z30B 2WB4A 1M1KT 1DLOA 1B7YB 2WTFA 3CCUS 4NZ7A 1UFLA 4C3MA 1WTFA 4ZK7M 3LTOA 1HNWF 1HW9A 2DNZA 5D3GB 4O0NA 1VDHA 3BGLA 3PIOQ 1VLOA 1J2VA 1M5VC 2C2NA 4U67Q 1Y0HA 2MHEA 1B64A 3SQGB 3IS9A 1NEEA 1M90T 1WC3A 3W8PA 3JSMB 3D0HE 3NG8A 2OGUA 1RGVA 3PYDA 3DLKA 4QIWD 4EO8A 4IG0A 3FCHA 5D77A 2VBZA 4QR0A 4Q45A 2RB7A 2KT2A 3QWUA 2QYCA 5F3TA 2K1RA 3DGVA 1FRLA 1VQPS 1FNOA 3MM6B 2H4WB 3DKDA 3KLHA 2VKZG 3M8QA 2KRBA 3DLGB 4IFYA 4K4XA 5CA5A 3LAKA 5HLFB 3DOMA 2DGXA 3OR2B 1VRUB 1R6YA 2XO7A 1C1CB 2W4PA 4A8WA 2H4YB 1HPZB 4B3TJ 4URSA 1HNIB 2VD3A 3NNHA 1RT6A 2VF3A 5F9LA 1LV5A 3M2UB 1CQMA 3GSDA 1C1BB 2KYZA 5CCLA 4P73A 3N4WA 1F5AA 2N4DA 4DUTA 2HBZB 2ACYA 4HT5A 3ZNJ1 4XPEA 3V81A 2E1PA 4NE9C 3BSCA 4KE5A 1HHQA 4DL0C 3PYFA 2ZM6J 2WW4A 3HZGA 4AXIA 2QFIA 5GAHI 1Y3KA 4ZLNA 2JEFA 3CD7A 4B3TF 2YKMA 3D67A 2IYIA 3KLFB 3IM8A 4L6V3 4A8OA 4WIIA 4ITSA 3MPWA 2LA6A 1RT4B 4Z7YA 4KTQA 1RTDB 3M8YA 1Q8KA 3KK3A 2Y1LB 4J5OA 4ENOA 5AE3A 4NLGA 4OZ1A 2IMOA 3NGUA 3JTOA 3BKUA 2LLZA 3Q86A 4NYOA 5M2PA 3K5NA 2ZM6F 3A8IA 3OXGA 3Q83A 3QJPA 1SJRA 1F5CA 1Y5LB 4WKYA 2CQBA 5M2UA 1TELA 4WF9Q 1IM4A 1QSYA 3D66A 2WB1D 2H54B 1GX6A 1JLCB 3D3CJ 5FD1A 4DSLA 4OZ5A 1SJ3P 4Y34A 3BH7B 1I1GA 3TA1A 2ZJQQ 2EFVA 2XMJA 4JI4F 1XN9A 2GVZA 3IA0A 4IDKB 2Y1RI 3D6MB 4DFMA 5HATA 1ZH5A 1RUSA 2QL7B 2RVJA 2UP1A 5T7LA 2N3OA 1MROB 1Q16B 4WXWA 2Q43A 4FP9A 1SKSA 4DV7J 3WBZA 1QAXA 2Z2YB 1Y10A 4MKBA 3EXCX 4NCBA 3UPFA 4J9VA 2ZH5A 2HVHA 1VOMA 2OD4A 2MY7A 2OPQB 3HKWA 3G8TA 1DQAA 3ZZZA 1N36J 4CTAA 3O6QA 4BDPA 4Q43A 2J0SD 2QLBB 1NLKL 4Y65A 1GAOA 2DR6A 2V8PA 1P9YA 4DV7F 2E29A 1SCJB 4QYRA 2C3PA 4LRCA 3TO8A 4U6PA 2FJAB 4XIUA 2V94A 2DNHA 3M8PA 4OZ2A 3T41A 3KLIB 1N36F 2XI3A 3I56S 4R5PB 3R7SB 3CW2C 4USVA 2BM1A 5KT4A 1YBAA 3FMWA 4DS4A 2KHDA 4F50A 2UXCJ 3Q24A 4HHUA 3TP2A 1DAXA 1N32J 2AYBA 5ETRA 4KHMA 1ZPWX 4ZDNA 1UPMB 2W4DA 5ETTA 3R5DA 5M2RA 2EFNA 2HAFA 2VBWA 4IR9A 2CQCA 2WOMB 2ZZNA 4B3SJ 1XERA 3MOZA 2GAHC 4KHPJ 4JI6F 2KI2A 2UXCF 3UD3P 4PUOB 2OPRA 3DHWC 1N32F 4EBEA 4K2XA 4LRAA 4N77A 4P2XA 3GCWP 5BYQA 2DGQA 5F8MA 3CUNA 5DS7A 4Q44A 3HHEA 3IN5A 3KLGA 2FC8A 4C2MA 4OYAA 3TZWA 5F9NA 5LL6d 5A8WB 2YX4A 4B3SF 2JZ5A 4DQIA 4J91A 1UVJA 1QDUB 4PYAA 3K7RA 4KHPF 5IT9U 2FVPA 4TLRA 1JKHB 2CPXA 3HO1A 4DF8A 5LSOA 4ECUA 1S6QA 4WJBA 3C19A 2F3JA 3VAGA 2HFSA 2A0FB 2K06A 4F4WA 1TV6A 2GCFA 2HFVA 3DM2A 3BDPA 2RF2B 3T9ZA 4HI1A 5ETMA 1HARA 1CC8A 4QWBA 4N56A 5C25A 4GO7X 2AGPA 1IJFB 5EGYA 4FN5A 4NLDA 1U2FA 2Y8WA 2WVFA 3ETMA 3J81j 3O44A 5AXNA 4O44A 2QLXA 2C22A 2CADA 4F3QA 2H48B 4JOUA 2J7KA 5IC6B 5LM7E 4IH7A 3HX9A 3CJ8A 3EX7B 1Y4ZB 3DDIA 2PDAA 4LFBJ 2P6SA 3EGVA 4YS2A 4UZCA 1YJVA 5J1EB 1VK8A 1BUXA 4NOHA 1DRZA 2QL5B 1T05A 3BYPA 3HVAA 1HMVB 5C42A 2AD9A 4ZVSB 4ZS6A 2ZD1A 1U1PA 1FJCA 1VIOA 2F9DA 4DOZA 3U27A 1JLEB 2ZVIA 1P1TA 2Q3PA 4QW9A 1VR6A 3MCSA 2C28A 4LFBF 1UWAA 1E6YB 2ZDOA 1HYSA 5KG5A 5GAGI 2ZH3A 2FZGB 2OHDA 4PWDB 2MHNA 3CIMA 3DLLQ 5MAOA 3CMQA 3DCAA 3T5JA 3KNAA 8AT1B 3AODA 4NEYA 2NCKL 4U8VA 2KG1A 3QJLA 3VGUA 4UZBA 1YRXA 1OJ4A 2XYHB 7AT1B 3T3FA 1KQSR 2KXNB 2OPPB 1OPIA 1TR0A 2XMAA 4ECZA 1T7PA 1PO6A 2J9DA 1WC0A 2Q6BA 2VB6A 4YR2A 2OPSA 1U4BA 1FKOA 1V9OA 2DTJA 1DQ8A 1RTZA 2CNLB 4CNZA 3SQOP 2RIJA 3VAJA 4PABA 3IG1B 4Y2AA 4EYHB 5T41A 3VCDA 1RAGB 1X4BA 4Q0BB 3TJ8A 2VFVA 2HGLA 1U26A 3AH6A 4K4ZA 2GO9A 1SL1A 2B3TB 1SKRA 5CYJA 1NUEA 3UD4P 4DSIA 4DI6A 1F9FA 1XK8A 2V4QA 3TNVA 3OFGA 2ZKUA 1VK3A 1S7HA 2Y3YA 3DLBA 1JLBB 4B9SA 3IGVA 5LXYA 4FNIA 4DN0A 2AHOB 2KT5A 1MMDA 5A0YA 3PFOA 4HH0A 4B9MA 3HJVA 1S0NA 2R42A 1CJTA 2EFOA 5D0HA 3BSOA 1JNZB 3MHYA 4JI0F 1JLGB 2ZITA 3MR2A 5I42A 4M5JA 2YNHA 4CCHA 1FEEA 2CVEA 4FZVA 4AT1B 1RHKB 2KZZA 3VZHA 4MKAA 5DG7A 1UMJA 2RDDA 2AZ3A 2ZH1A 3L9ZA 2XC9A 2JJ4D 5DM6Q 1HI8A 1OWXA 3CDAA 3D54A 4OX7A 3ZTRA 1LXNA 3BBCA 2WBRA 1HHTP 5CYQA 1HQEA 6AT1B 5KOWA 4E2FB 2FVQA 1K9MT 4X4OA 2C2ZB 3Q8VA 3KUEA 2VFSA 4ECWA 3EGNA 4DR3J 2UXDJ 1YJNS 2YXLA 5EHHA 4OYMA 4ETXA 1NJWA 3K8WA 2EBGA 4RL1A 1FFSB 3D5MA 1UWBB 4GC7A 2FHOB 3RAQA 4ED8A 4W4MA 4ZVPB 4M5HA 3I0RB 4IUFA 3PV8A 4AYBD 2WONA 1Q8IA 2DHHA 1WUUA 3VQTA 2OFGX 3GIMA 4JI5J 2HQIA 3I5AA 4DR3F 5SZTA 2UXDF 1NK9A 2I1RA 3IGNA 1PBUA 1Z1ZA 4RUCA 2QLWA 1P6TA 4ZPWR 2RU3A 4K7QA 1JLAA 1Q53A 2NXUA 1WKKA 2NUHA 2CYYA 2HS3A 3RAMA 4J9LA 2FHJD 1N5TA 2J6SA 4LF9J 2OLWA 4N76A 2F9JA 3VVUA 2LQ8A 3DFEA 4LIWA 4Y3CA 4DL5A 6FD1A 5DQIA 3PX0A 3MWBA 4JI5F 4DFPA 1VCTA 3KXDA 3M1VB 4USMA 1BHNA 3TX0A 3CJSA 3C3LA 3DRPB 1LEOA 4FVMA 1VJQA 4LF8J 2QA2A 2XNQA 3F73A 1R3NA 4OYZA 1RWPB 4MYTA 1J5EJ 2YKNB 4TY9A 3GG0A 2PEBA 3MI7X 4LF9F 4OHZA 3N0VA 3CD5A 2UV8A 4TYBA 1SUQA 2IY5B 3CJTA 3W62A 2W9BB 1RTHA 3BQ2A 4R0EA 5D0EA 2FQQB 1NHUA 2HK2A 3G82A 1TL5A 2A6MA 4ED0A 4OI6A 3A8JA 3M4XA 3SBMA 2YNIA 5EWFA 2I38A 3VF0B 4NLQA 4LF8F 4N5SA 2XYGB 3ET6A 1J5EF 3OL6A 3QSIA 4X4UA 1WKLA 3J7A1 2QZ8A 4TYAA 5D0RA 1QAIA 4JYAJ 4EK2A 3DRYA 2L08A 3TVKA 4DX5A 4H54A 3UR3C 4NYZA 3FC9A 3AJDA 3RRHA 3DRSA 4TY8B 1JJCB 3ITHA 4CLFA 4CLTA 2XWXA 2W1BA 5BXIA 1FVQA 2BW7A 1VBKA 3CJ2A 4CO4A 2CUYA 2ZUGA 1QTMA 4NMXA 3LQVA 2C1EB 2FJVA 3BH6B 1AUSL 2PO4A 4QJVA 2RRNA 4NA2A 4JYAF 1TL1B 2BX6A 4AQYJ 5JVHQ 1VQLS 2WBMA 2KJVA 2BJ9A 1BQXA 3D6HB 3QATA 4N47A 4F2RA 3DXSX 1G4CA 1S5ZA 2LQBA 4DX6A 1RK8A 5E3RA 4WP3A 3T5HA 4GMKA 2BZ2A 3KJVB 2LEAA 2BE7D 3EM1A 2ZH2A 4OX8A 1S6PA 4ZP7A 3MAAB 1G2EA 2ZE2B 2W2QP 3S6EA 3OW2R 4AQYF 2E9TA 1F1BB 3AQOA 4H4OA 1HNXJ 2L3MA 3SFUA 5SUHA 2QX0A 1U7LA 2RH3A 5F8IA 2ROGA 1I5OB 2GVDB 2LXIA 4UOGA 2BJ7A 3WZ0A 4OZJA 2DYAA 4RW4B 2OJ3A 2C3OA 1G3OA 3N6NA 3QGIA 2H51B 4O4RA 3H42A 3HJFA 3M6XA 1FRMA 2Z4PA 3PG9A 5JUMA 4CDIA 2ZBRA 1U6BA 3D0GE 3D2WA 1YQHA 4DLEA 3R1HA 3I5CA 2H3EB 5DZ6A 1HNXF 4WCEQ 3KKFA 1Y11A 1CEZA 3AOBA 1T9WA 5D0GA 3QGPA 3VAFA 2VASA 5IS2A 3PCOB 4QYZK 1Q5VA 4QR2A 2HYIB 4KGXB 1GMWD 4OI3A 1RT1B 1V3SA 2HQGA 3F44A 4Z7CA 3EYZA 1WI6A 2WVEA 1SIWB 1WOPA 4L76A 4OIXA 2YH1A 4DPXA 4ZLPA 3KK2B 4WP9A 1T02A 2W24A 2PA8D 3JSMA 4WFNQ 4AE5A 5K8MA 3C15B 2UUTA 2DNYA 2CA9A 2BMBA 2BV3A 4NA1A 3IWNC 3L95X 4ZP8A 3A3PB 3M8WA 2IYGA 1FDBA 1ZA1B 4KAIA 1N48A 2AIRB 4DFKA 1R31A 4MTPA 5CZVA 3AXKA 2KL8A 2Z2LA 2B9YA 3ISND 3H0PA 1T9TA 2N3LA 4NXMJ 5LMUJ 3PR4A 1NSAA 4F0HA 4QR1A 4ICLB 4OYOA 5KFZA 1R0AA 3SCKE 1KTVA 1P8GA 3OV7A 3OR2A 2KXHA 3GPAA 2Y9HA 4ZPDA 1NK8A 2FTRA 2CPDA 2OSRA 5DG8A 3PKYA 4DBQA 1FXDA 2ZHBA 1W2BR 3FK4A 3M2UA 2HIQA 1SV5A 9RUBA 2LEBA 2C2DA 1RYSA 4NXMF 5LMUF 3W65A 4EWTA 3GYXB 2L9NA 5G0RB 3NLCA 4CWBA 3H2UB 4ZVGA 1HHSA 2DK2A 5I3PA 2IA0A 4WTYA 1DBDA 3N01A 2C2RA 2HHQA 3GU0A 3H20A 1IBKJ 3I87A 1RT4A 1RTDA 3PZPA 1IR2A 2EPIA 2CQIA 2GNKA 3V6DB 3SSRA 1VRQC 2VA2A 3P45B 3HF5A 2VPWB 4KQZA 1ZYQA 2YX1A 4OZ0A 3QPIA 5FLXY 3IO1A 4USKA 4CLPA 3R5GA 4O4GA 4FBUA 1AROP 4YB7A 3KLEB 3WX4A 3M32B 2HWTA 3H7HB 3T5KA 1QVGR 1N5YA 1S72S 1WHVA 2D3OR 4BCAA 2V0NA 4KPCA 1LWEA 4DQPA 3ISNC 2VV5A 1IBKF 3G8QA 2Y0SD 3J7YI 2L41A 3WC2A 2UUWA 3V4IA 3LPYA 2D41A 2F8EX 3DMJB 2MDAA 1W26A 2BOAA 2DCUB 2YPZA 4WYLA 4C6AA 5HN0A 3M30B 1FE4A 1GXLA 3M6UA 2COLA 3UDVA 1W7WA 2JX2A 2J9CA 4NCGB 4IDKA 2CNKB 2XI2A 3QLHA 2UUCJ 1GMUA 2EEYA 3CCLS 2DH9A 1YI2S 4L74A 4KV8B 4IFVB 1WF0A 5B0EA 1S1VB 4P75A 4A8YA 1RLDA 3MXHP 2VG5B 5KG3A 3MM9A 1KN6A 1FX2A 4TU7A 3V6JA 3UE2A 4ZP6A 1UTAA 4LUBA 2CRLA 2FLPA 1TU0B 1E6VB 2EI5A 1WTBA 2F7VA 4OHVA 3SSQA 3MEDA 3GV8B 2QRRA 4ZCMA 1RADB 3SXLA 2UUCF 2R2TA 5KAKA 3R5AA 3B4MA 3W5XA 5J2MA 4Y00A 1WC6A 3W2VB 2M3DA 1SL0A 1R89A 2DNOA 3EVWA 2GFFA 1RISA 3I4PA 5IQ6A 2IRUA 2PSZA 4F25A 2RILA 2H9ZA 2OI2A 1XMQJ 2ASLA 3BF4A 1S1UB 1JXVA 3ISZA 2BM0A 1S1WA 3T6JA 2JWNA 3NCRA 4KHRA 4I6WA 1S77D 4WTOB 1KQFB 4QWCA 1PJ6A 1SBRA 2I5JA 1FNXH 1QVFR 1U8SA 5HQLA 1VQ4S 4X84A 3P5TL 1LW0B 3ILOA 4KT0C 3TUZC 1XMQF 4DCPB 2D9OA 4DR6J 2CPIA 2YNGB 2D1CA 1IBMJ 4PUOA 2RHQB 4ED7A 3AD7C 2DH8A 4L73A 3NL0A 2HS4A 3R5CA 1H74A 4OYIA 1K1QA 3CJ5A 3QZ7A 5KFRA 2CDQA 2R8JA 1FWPA 4TVAB 1H7WA 4ZCKA 1KP6A 1GEHA 4DR6F 2R7RA 1DLOB 5H1SV 2JEGA 1XQIA 1B3TA 5JMNA 3PW5A 1IBMF 1Q78A 2Z57B 2V8GA 2I9SA 4HR2A 2ASDA 2V2ZA 1AB8A 2RT3A 2J76E 1OSCA 5D15A 3THTA 4UQTA 4FYXB 4CLWA 3OBIA 3PIPQ 3U7JA 1KEKA 4LF2A 2P9CA 4BBYA 3RBEA 4JP8A 4ETZA 3M9NB 2LMIA 2CQDA 4NEZA 2NS1B 2LU1A 3DLKB 3HXMA 1H7XA 4RNMA 3H25A 5HVGA 5DLFA 1M5PC 2V2VA 4DQSA 1X4AA 5KFOA 2VONA 4UY85 4LVOP 2DJWA 4WXOA 2ZWPA 5KG4A 2K1RB 1N0VC 2V4JB 1N33J 4MK8A 1RB0A 4I1TA 3A3OB 2R2RA 3C46A 2OTJS 3KLHB 2Q66A 4PQAA 2W8KA 4EBCA 3IWLA 4IFYB 4GKKJ 1ZTTA 3DHXA 4HT7A 3DOMB 2HFZA 3R1LA 1NK4A 3K89A 3FBEA 2VOOA 4OL8A 1QD1A 1VQNS 2VJUA 4PG7A 3LGMA 3GG1A 4OLPA 3CSKA 1N33F 1E6YA 3A8KA 3ZZ0A 4R8UB 1GTEA 5BJRA 3KMQA 4PWDA 3D4JA 3BPSP 3CJ3A 4ES1A 2DB1A 2CWKA 1W2IA 1DY3A 4GKKF 3V81B 2MGZA 1Q5YA 1TAQA 2Y8YA 1I6JA 4NI2A 4A8KA 3MR7A 2KFYA 4RUAA 2XCAA 2YKMB 3CDBA 5GMKa 1WOOA 1WORA 4MAKA 3RRKA 4DV4J 2NXEA 1U02A 3CEDA 3SCJE 2QC3A 2R8KA 2OKQA 3MD1A 3CCRS 4CH7A 2W8LA 5HQ8A 2ZJPQ 2R2SA 2VJVA 4CH0S 3OFEA 1R7IA 4DPWA 3IG1A 3KG1A 4UUWA 4KGZB 1XR7A 2JEJA 1N52B 2HG4A 4QU6A 1SQFA 4ANEA 1DTQA 3BGUA 1ZZNA 5B0GA 2YBVA 5KFBA 2GHWA 1C0TA 3QRRA 2VPXB 4YOEA 2HSEB 4FYYB 3MURP 4CZCA 3W9JA 3M05A 5KOXA 3L4BC 3TANA 4WP8A 4F2SA 3N6MA 2B6AA 1IWGA 3JAMY 4CH1A 2GVZB 3NAHA 2DISA 1Q81T 2XZWA 2G1DA 5DQHA 5T7LB 1WKJA 2VDHA 4DR5J 3RBZA 3HM9A 1PILA 4ECVA 1FD8A 5HK4A 1IR1A 2DITA 3CMAS 2W9CA 1TKZB 2CQ1A 8RUCA 2YH0A 2XGPA 1J5OA 5I3QA 1IKVB 4XPCA 2Y0BB 2E5HA 3NOCA 1TL3B 1AW0A 2AQ4A 3FSYA 2W2NP 1U2RA 4PWUA 4DR5F 3BGOP 4YUDA 5ADZA 4L75A 2B9XA 4Y6IA 4G6VB 4HHHA 2KVQE 5BYRA 3NS5A 3ONQA 4YN3B 3VHQA 4FYWB 5DLGA 2FGCA 2JC0A 1VS3A 3EVOA 5GADI 3H5UA 4LRDA 4ECYA 2AU0A 3KG4A 4DN9A 2C3MA 3MR5A 4ZCIA 4WZQA 2QE5A 2DNKA 3PW7A 2P9GA 4TQRA 4OHWA 5HANA 1DQ9A 3AHPA 1R8AA 3CD6S 5IT0A 2JNJA 1HA1A 2MZJA 3I0RA 3LALA 2K8GA 2MY8A 1H0HB 2H5IB 4BWMA 3FCWA 3L7PA 3FGVA 1XC9A 2M8HA 3M2VB 3PJXA 4GVBA 5B0BA 2DR5A 4R25A 3MGJA 3DDKA 3R97A 3PACA 3T1HJ 2LQ9A 3GIKA 4EMDA 2XLIA 1QE1A 1HNVA 3KLGB 5HP1A 3TUIC 4IRDA 4OJ3A 4DU8A 4FF4A 3FQLA 1EZZB 2QLJB 3M1VA 2CJXB 5DGBA 5L9XA 3ENWA 1IR0A 2D3UA 7FD1A 3T1HF 3K5LA 2HHWA 1FT8A 1S6QB 3OTOJ 4J9OA 2F40A 4MH8A 3H59A 3P6YC 3HVRA 1TV6B 3GIIA 3DM2B 1QJHA 4WYWA 2PEHA 3R8YA 1SJ1A 3T5LA 2VIHA 3FSIA 2QT7A 1UW4A 5GMDA 4IQMA 2YY3A 3J80Y 3HP6A 1KOHA 3ENVA 1L3TA 3US5A 2P5VA 3SV3A 2ZEJA 5DZ7A 2KM8C 1MWZA 2R7TA 2HW3A 1CJKA 1H98A 5HVHA 3PEJA 4O44B 3LP0A 1VI7A 3OTOF 2B8QA 3CD0A 3HHLB 2RQMA 2AJ1A 1RT5A 1N5VA 1YDLA 2YQ0A 4ZKAA 1DARA 4TU8A 4LSLB 3S1TA 4WK3A 3TAQA 1BC6A 3MM8A 3OSPA 4ZLLA 3FRYA 2OUGA 3CCMS 3OTCA 1T05B 2DO0A 4B08A 2OAUA 3O8WA 3G4SS 4ED1A 4ZHRA 4ANCA 2ZD1B 3QT5A 4D3HA 3HVTA 3SZ2A 3HSDA 3G6ES 4GC6A 4ZVRB 3NAIA 3A4TA 3RYLA 1VGYA 4I2QB 2WAQD 2GHVC 1HYSB 1BQMB 2GHPA 2GJ2A 4FKYA 4JV2A 1UVLA 2HBYB 2R7QA 3CPWR 1OQ6A 3GZ7A 4B9VA 1TKTB 1UCNA 2DD8S 4NCAA 3IBFB 2ATLA 4JI8J 2AGOA 2FZCB 1ICEB 2CPEA 1O5JA 4PPZA 2E1CA 5EWGA 2OPSB 4O23A 2BJDA 2FLLA 1FKOB 4EZ6A 1X8DA 2GJIA 5KFQA 4LR9A 3PX4A 2GVDA 3OJSA 4C8LA 2HS0A 2ZFHA 2IA6A 4YB5A 1PSDA 2KJWA 4JI1J 3PR5B 4JI8F 1D8ZA 2DR9A 2VC1A 1FRXA 2HWIA 2W25A 2OP5A 3Q8RB 2V63A 1S6OA 2CWXA 3I31A 1URRA 1AYEA 1U2CA 4LIRA 4OX6A 2Z56B 2J5AA 2V8DA 5HQMA 2XZDB 1D9FA 2RAQA 1RA6A 2CDRB 2OH2A 2FC9A 4JI1F 1ZAWA 5KG7A 1C0UA 2VZ9A 2ZDPA 3NRBA 2RRAA 1RT1A 3PFEA 4X66J 4ER8A 5A0YB 2W01A 2B4VA 1N0UA 3KK2A 4ID5B 3EJMA 2AW0A 2XMMA 3F0NA 2GV1A 4AFFA 5I42B 2OELA 4P6QA 2YNHB 2IJNA 2XY6A 2MKHA 2VA3A 1YWXA 1VQ9S 1SJQA 2MB0B 3TRGA 1ZM9A 1N5QA 2EC0A 4MJKA 4X66F 2E5LJ 4RW9B 1FWKA 2CQ2A 1RYRA 3EWGA 1HD1A 3THPA 1QUVA 4M5IA 1PBAA 1JNRB 2XLJA 3B6BA 1TMMA 5CYQB 1HQEB 4K4UA 4USHA 1WC1A 4IO9Q 4ICLA 3H40A 3VV2B 1RDRA 2JH3A 3AD8C 4DPTA 5F0WA 3KK1B 4J9PA 3N28A 3UDLA 2E5LF 5H9EK 2I8EA 2D69A 1BMQB 1FDNA 4F3MA 1NDKA 3MFHA 2BE2B 4JV0A 3CF5Q 2W9AA 5LT5A 2VH7A 1YJRA 2ZHOA 1S97A 3FUYA 3KHHA 2V5HG 5ETNA 1DJ0A 1GXTA 2CKWA 2KFNA 2DGSA 5LXRA 7FDRA 1KDNA 3TW0A 5E7OB 3R2DJ 3ENAA 1JLAB 3V6DA 5KFTA 1T9YA 4JBCA 1G1XA 1FVSA 3IC1A 2DIUA 5KFDA 2CQPA 5D4NA 1YLXA 3W9HA 4KO0A 1VISA 4KBIA 2CG8A 3OQ2A 4FVCA 1WG4A 2MQLA 3V5RA 2NZCA 4DR4J 1SI9A 3DMJA 1BWVA 3RAXA 1SUQB 4QWAA 3NKYA 4B02A 4DPOA 5HVFA 2YNFA 4Y2KA 3G82B 3M30A 2F4FA 4OZ3A 3IXQA 2VFTA 4M5MA 1H2TZ 2V2QA 1RABB 2J6UA 2G2ZA 4KV8A 2HNDA 4DR4F 1WEZA 2NYIA 1Y7PA 1Q7YT 4NYPA 2WSEC 4U8YA 1REVA 1RWUA 2VG5A 3MAHA 1NCLA 2ZUAA 3L3CA 1NK0A 1D3WA 3A1YG 1E6VA 2G13A 4QPXA 4LFCJ 4JB8B 3DRSB 2DGVA 2UVWA 3KJQB 5KT5A 3G6YA 2UVVA 3ITHB 1GFWB 3MM5A 1XJWB 3UDCA 2BOPA 2M9KA 3W2VA 3I0SA 2V9WA 1NMEB 3TAMB 4N7TA 1RWNB 1KVKA 2DHXA 2VHGA 1QM9A 3N79A 1TVRA 3H4BA 3I4HX 1KONA 1EJ7L 1FESA 4P52A 2HWHA 4EO6A 4LFCF 1YJUA 3BV8A 1HL6A 1V6HA 3QAUA 2CQ4A 2H65B 2R7OA 2MQ8A 1S1UA 3WX8A 3LGHA 1N88A 1MN9A 1X0PA 1LW2A 2A18A 5FDLA 2YX7A 4LR7A 1UEVA 5EX3A 3RJMB 5LJ5Y 2FUG9 4I0WA 3K8VA 2ZWOA 1JXLA 4C4WA 1X5PA 4BS2A 2EXUA 1FF2A 2JLEA 1HBUA 1IUJA 2AYEA 3MECB 4CYUA 3DRXA 3AOAA 3GJSB 3OPKA 2ALYB 2GJFA 3H98A 2DNNA 2K7KA 4O0IA 1SJ4P 2F63A 4ED4A 3NXZA 4CLZA 2VU5A 4DG1A 2IJFA 3DLJA 2J6TA 2IIHA 3CIZA 2V8HA 5L9NA 2B7CB 3W2WA 2M88A 5AE2A 3GJTB 5F3ZA 2IM0A 3DYAB 2VG6B 1PGZA 2HRTA 4G3IA 4WK1A 5KFKA 5HL7Q 4ECQA 1RAJA 2JVRA 1O51A 1LWFA 3QYYA 4C98A 3PY8A 1KLNA 5KFXA 2GIFA 2D9PA 4YP3A 2DEIA 4USTA 1CG2A 3ZO7A 3QNWB 3QGGA 3FBBA 2KO1A 3HVWA 4A8MP 5J2QA 1UEKA 4C8ZA 5JJBA 3JQKA 4K4WA 4FF3A 1S1XB 1HKAA 2P2CB 2JC1A 1H6KX 1VFJA 3SDEA 5KT6A 3ZZRA 1HD0A 3RU0A 3VALA 4KSEB 1F9EB 3MOJB 5A8KA 1CULA 2CJYB 4DPYA 1N56A 1X4CA 2J7WA 4RJVA 2LFVA 2DXEA 2DGWA 4C0OC 3VGTA 2UVUA 2BKPA 2V4JA 2R8GA 2RDJA 1FHTA 1EP4A 2D3O1 2HNYB 2V2KA 5H9FJ 1K0TA 1RCXB 1R0AB 3C66A 1OO0B 5L1JA 3CJ4A 2KXFA 2GW8A 2E1MC 2Z8QA 4ED6A 4H4KA 2ASYA 5GMEA 2RRBA 1FRHA 3UN2A 2GQQA 5B08A 5F8JA 2MLXA 3TVZA 1O0PA 2Z0GA 3QT7A 3OLBA 2EG2A 1SV5B 3V6HA 4R8UA 3CCTA 3UVJA 3ZZUA 4DLGA 2ADCA 5C24A 5KG1A 1C4CA 1RI7A 4P74A 1FERA 4WFXA 4MYUA 3OFFA 4RPFA 1EARA 2MKIA 4LMZA 3LAMA 2XMWA 3AOCA 2E5GA 2YWWA 2C3YA 4MKYA 3BB5A 5KFMA 1FXLA 3PHTA 1SB6A 2XMKA 1JIHA 3CB4A 4K4VA 2G4BA 3BGFA 4O4GB 1Q7LB 3C8YA 3V4MA 2ZH6A 4OV6A 1NHVA 1U1NA 4FXDA 5L1LA 4MFBB 4JI4J 1N5YB 2CXEA 1ZETA 3CCWA 1X4EA 1LWEB 4FXVA 2ALZA 4RR5A 1NJYA 3V4IB 3RBXA 3T6BA 3UR0A 4Y0FA 2QIFA 2CJQA 2IHR1 4UOHA 5EUHA 3FBCA 3AQPA 3CDEA 3VGSA 2GO8A 5A8RA 3VAMA 2DKOB 2QMUB 4OI0A 5GAGU 1GQEA 1HW8A 3S7RA 3SIPB 4LF1A 3S01A 3QLHB 1OY9A 1W25A 3CT9A 3MMBA 1RWMB 2MZRA 1ZAVA 3MMAB 3CULA 5EX0A 2E9RX 1NDPA 3OTDA 1DTTA 2B5JA 1PAEX 4MIAA 3MM9B 2O01C 1LFWA 1VQ5S 1NK5A 2FY1A 4OJ1A 4F02A 3QIPB 2JSXA 2RHSB 1RACB 1TKZA 4YDXA 1Y00A 3O3LA 3OLAA 3MEDB 2CQ0A 1EETA 4HVZA 4I56A 1IKVA 3K58A 3W64A 1T3NA 3LO3A 1FO1A 1TL3A 4NLVA 2ZNYA 2XS2A 5J2MB 1S12A 1XR6A 2IJRA 1X4GA 1D8YA 5HMYA 4L3KA 1HWKA 5C5JA 3M9MB 2DVIA 2FVSA 2CZ9A 4DQQA 3Q22A 2XSFA 3CDWA 1K0VA 3R5JB 2BQRA 1D9DA 4KRWA 4OZLA 1FA0A 1U25A 3I5BA 5KFSA 4FYDA 3EPGA 3HHKA 2LEPA 2V9KA 1ROFA 1S1WB 4UTGA 2G2OA 3H2VE 4JI6J 1KFDA 3Q2TC 1RA7A 4DV0J 3O2IA 3KHRA 5DDPC 2YWGA 2HKEA 1VBYA 4DHVA 2PIIA 2I5JB 3MUVP 4UUXA 3KNGA 4EBDA 2VUGA 3JXOA 4QIVA 2V34A 2KH9A 3M2VA 4ZA1A 3F56A 3GWCA 2XCPA 1CJVA 1RWVB 2YKAA 4MK9A 3GTYX 4WU3A 4DV0F 4DZ6A 3PTWA 2RE1A 4PKDB 4RX6A 4PG8A 3UW1A 2IVMA 3G6XA 3FSXA 4WIQA 2UXBJ 3DI6A 4OI2A 1T9XA 1Y5IB 2E1RA 3GIRA 2WVDA 4I6AA 2BANB 1IKXA 3CC4S 3DLEB 4A46A 3LW5C 5J1PA 2R7UA 2ZJRQ 3QT6A 1AFJA 2G0IA 3MMCA 1PJ7A 4J9NA 5HAOA 4DXLA 2HHVA 4UT4A 4ZLJA 2BUNA 1HBMA 1UKUA 2XBPA 3BO3A 3HK2A 1SC3B 1CQNA 2A6OA 4CNYA 3TWZA 5ETSA 2JLGA 2NUUG 2UXBF 3HSZA 2B8PA 3K0JA 3LF0A 3PX6A 1TZ0A 4H4MB 4F4YA 2O66A 3VVTA 4A8QA 1L3UA 1R8BA 4ECTA 4EUVA 1MWQA 5K8OA 1EX8A 3HHLA 2ACMA 5HROB 2XHCA 4DCOB 4LSLA 4M5KA 4C11A 3CCSS 1NJXA 1KVIA 3TZZA 4N8NA 4BHQA 1U6ZA 1LXJA 4CLLA 2DRDA 1B0TA 1X7VA 4OJHA 3FEZA 1NKEA 1KR4A 4AL5A 2QYGA 4O3NA 1VBZA 2LA4A 1L3VA 2ZOMA 3LANA 3Q89A 3H5YA 4ZVFA 4QQBA 1Q86T 3QAEA 4YB6A 4I2QA 3JYTB 2VFRA 1BQMA 2HHTA 3FZBA 1KKHA 4YFUA 3CJRA 3TZXA 3OUYB 2MGZB 5IZHA 4NI2B 1TKTA 3D7SB 3OD2A 5DETA 1YRUA 1G6BA 3OL7A 4BLGA 4PQUB 2A10A 2OD6A 1EQMA 4YY3J 4QU7A 2BJ1A 1HBOB 1UP1A 1FNMA 3C14A 4DUYJ 4ZVQB 1YHQS 2PI5A 2JHEA 2LDYA 1HR0J 3M7VA 4DX7A 5JXSA 5LSRA 1FTCA 1XBWA 1DTQB 3RB6A 3C6TB 5HBMA 1H2UX 4F4KA 1C0TB 4YY3F 5D78A 4NZ0A 2JEIA 2W4CA 3FNNA 2CZ4A 4P10A 1HLWA 5F8LA 3GYNA 4DUYF 1EHWA 4JI0J 2IM3A 4N8OA 5CHCB 2EC2A 2B4UA 3D0IE 2B6AB 3W8GA 2MKYA 3FEXB 1HR0F 2D74B 2RDIA 3MEGA 3RW7A 4M5DA 4Y2IA 3MPVA 2O67A 4DV5J 1S4EA 5U47A 2DRAA 1JX4A 4F36A 2CAJA 4JI3J 2OMLA 1WI8A 3H5SA 4DL7A 3GIJA 3AB2B 4NLOA 3OVAA 4ID5A 1X5OA 2DGUA 1RWOB 4J7CA 3FQKA 1F3FA 2W9CB 2RU9A 3TUJC 2MSSA 2BYCA 5F8GA 2KT3A 1RP5A 1J5OB 3BZQA 3GMGA 2B4PA 4DV5F 3GSIA 1D9AA 1S9EA 4M5NA 3MTKA 1NKBA 1WELA 1FK9A 4RW9A 3HFKA 3Q0AA 2RJZA 2X1BA 4JI3F 4DSFA 1RHJB 4OZNA 1S0VA 3BN7A 3HSGA 2GA7A 1BLUA 4Q8FA 3MM7A 2VG7B 4RUBA 1YG0A 2MKCA 3CJQA 2OO4A 4P9SA 3IFEA 3A12A 5IOLA 1F9HA 5IQQA 1N5SA 4TKTA 4X4PA 3KK1A 4CLYA 4JI2J 8ATCB 3PW0A 1F2GA 5D4LA 2OEJA 1FDDA 2JOQA 4W98A 4K4SA 4HL9A 2J9DE 5ETLA 2GMLA 2P8IA 2BE2A 2J0QD 1KNZA 4I68A 2WSFC 2PE8A 1FWLA 2FB0A 2GX8A 4C8OA 2J8AA 4G1QA 3EPIA 5L39A 4GVBB 2AWZA 4PAAA 2KTQA 4JI2F 4F0MA 4WKRA 3LH2S 5ETOA 2RD5C 4NRUA 2K3IA 3DRRA 1T8EA 3QRPA 5MLCV 2J0XA 2X7IA 1QE1B 1HNVB 5HP1B 2E7WA 3GP9A 4PCQA 4PG5A 2DGTA 3P3DA 4WU2A 1NK6A 3GE9A 5KFEA 2DHAA 4LF6J 1S9GA 3UDEA 5D4PA 2MZSA 2WVBA 1WJ9A 2BQ3A 3MFIA 5FIIA 4F67A 3RGIA 4DX8H 3HULA 1DZ5A 4OMFG 4CP5A 1RE1B 1SH0A 3TARA 4DL2A 1RT3B 2E7VA 2YVSA 3P4UB 1Q0NA 3AJ1A 2OSQA 1EAYC 3ZXWA 2BW2A 1BQNB 3KHGA 4W92B 4ED2A 3N6LA 4LF6F 1X60A 3FDSA 1U0SA 2MZQA 2IFXA 1CJKB 2F1FA 4KKOB 2FJDB 4LF7J 3LP0B 3ILIA 1N6QA 2E5JA 3JSBA 1RT5B 1AA1B 1R8CA 3R6GB 4UOFA 2XMUA 4U7UD 5J2NA 1HBNB 1H73A 3C16A 2FHKA 4UF4A 1Z2LA 3MM8B 3Q8YA 3JTNA 4AUKA 2BJEA 2R7WA 3CJ0A 4IOCQ 2VL1A 1A0OB 4NL5A 3I6PA 1ULRA 3P96A 4LF7F 1LOUA 1B70B 4ZHRB 4DJBA 1V3RA 4K4TA 1C4AA 3H2LA 3HVTB 2BBEA 4MIBA 3TAMA 3E01A 1OY8A 4IRCA 4C3LA 1S9FA 4YQWA 3OL8A 4CI0B 3UFCX 2Z2ZA 2PC6A 3K2YA 4KFBA 3TOQA 4NLSA 4V1Ak 1FEHA 3KTQA 1MN7A 2HHHJ 2DHSA 4USIA 4PYDA 3MCOA 3D1HA 2CFXA 1NDCA 2UU9J 2V50A 1VMBA 1D0EA 1VQKS 1OPZA 1JLQA 4C97A 2AX1A 4MMOA 1ITPA 1NPKA 1NH7A 5KT2A 3EZUA 4MKVA 4X4RA 1IKYA 3TZYA 1WF1A 1NB2A 4ID8A 1UL3A 3LPEA 4C7QA 1PAUB 2HHHF 3QFHA 4M5LA 1KQGB 5IM0B 3Q8SB 3UN3A 3IAS9 4A8XA 2DBBA 2V67A 1B99A 2UU9F 5H9FK 2K3KA 3MECA 4MIWA 4FNHA 3BYRA 2E9ZA 2E5IA 2HVEA 1JK9B 2HHUA 4I4BA 4IKAA 3BQ1A 2GZOA 4FDFA 1XEZA 1EKSA 3OXFA 1S99A 4QCLA 3DOLA 2C3UA 2H5EA 1YBUA 3HD2A 1FRIA 3MCMA 3KHLA 4WFZA 3GB0A 2CNNB 4GRSA 1PG5B 2NSBA 1YRTA 1WDTA 4F4AA 3DYAA 1D1UA 2HK3A 2VG6A 1NSQA 1EIYB 1C0UB 3GFZA 3W63A 2LQJA 4HTJA 4WBFA 2IAJB 3FJ2A 1XR5A 2QA1A 5KFNA 5FJ4A 4Y28C 2MJNA 1GH8A 1WEYA 4RW8A 1NBEB 1WF2A 3EMTA 3GFHA 1S1XA 3QIDA 4IO1A 1GK8A 1EQ0A 3LP1B 4RBVA 3ICLA 1N8RT 1RSCA 1MMLA 2RMLA 4WZMA 3QMQA 4RLEA 4CO1A 4CIOA 2YPYA 2MQQA 2FLOA 1FJ7A 3HFVA 1HWIA 4OJGA 3NNAA 3W61A 2Q1LA 3M8SA 2HGMA 1UPPA 2HHPA 4GKJJ 5K20B 4XO0A 2ZNZA 2QSWA 3TYTA 4QYZJ 3KUGA 4NLYA 5DRKA 2HNYA 4HI2A 2M70A 4B9TA 1JXEA 4OI1A 2JFDA 1R6VA 3BKTA 2IVYA 3EXYA 2BRLA 4O3SA 4ZVOB 4EYIB 3Q2SC 3U02A 3CCQS 2CPZA 3O5TB 1RXOB 2RSQA 2MKSA 4P7VA 4GKJF 3WQPA 2ZOGA 3M2RA 3ZTQA 4USUA 3CJKA 5LSLA 4OHYA 3OR1A 1FRKA 4C8MA 3BREA 1V3ZA 5KFYA 2NZ4A 1XNRJ 2VFUA 2YWHA 2QEXS 2EG1A 2JL9A 3NNCA 4ERDA 1AFIA 2CNOB 4U7UK 1T3OA 4NRTA 2F5GA 3PO4A 1JB0C 3ADAC 1A6LA 2LDIA 2CJAA 4DV1J 4O3PA 1QLNA 4C8KA 1FJGJ 3W5YA 2DR7A 3OTEA 1H3DA 4LBIA 2BE9B 4LVNP 2CG4A 5L1KA 4YHHJ 2GQ2A 3G87A 1O8BA 2SXLA 3ENQA 1XNRF 1VHFA 4YMEA 1OS5A 2AYGA 3QT8A 4MFBA 2MZ1A 3H5XA 1S76D 4I6YA 2HNZA 4KO0B 1LQ9A 2GS8A 4ZJLA 5KFHA 4DV1F 4FPRA 2IRXA 4PXBA 2ZBPA 1FJGF 4WWSA 4URQU 4X4TA 2G9OA 2VICA 4HYKA 2MQNA 2CPJA 4ZN3A 3CE8A 1EKRA 1Y3JA 3WIUA 3GJQB 2FVCA 4YHHF 1WNEA 2M0GB 1R27B 4B3OA 1JJ2R 1SQEA 3NEKA 4NMLA 1LK5A 2LVWA 5CZXA 2YNFB 3PHEA 2GC8A 2NPIA 2QA4G 4OYBA 3K5MA 1P9QC 5GAEU 4ILRA 1NNDA 4N41A 1MW7A 3I82A 3QSYB 3B82A 5KFCA 2HNDB 2HGNA 4ZVTB 3CCJS 2FYXA 4U9RA 1U09A 3RZAA 3MMAA 1QAJA 1REVB 1H2VZ 2EFQA 4IR1A 3NWRA 4M5GA 4F8RA 5E0OA 4PG4A 3QIPA 1YIJS 2QFJA 3NP5A 5CYMA 1YGYA 3UNGC 4F4XA 2ROPA 2DPJA 1MU2B 2V8VA 2WHOA 1UZDA 3MM5B 2EFGA 1DFDA 1B0VA 4ZJOA 1TL4A 2XEXA 1UEUA 3I96A 3I0SB 3A3NB 4DSKA 2V6AA 4IOAQ 1KVJA 1UZHA 2ZH9A 5K9FA 3RR7A 4E0DA 4Q7AA 1ZPVA 4EU0A 2CJKA 3CC7S 1TVRB 4BC7A 5KFFA 1URNA 3AA9A 2WK4A 5C2CA 1S48A 4AL7A 3MEEA 3WHIA 4A8FA 4DPUA 3LGNA 1GTHA 2HQ3A 3TA0A 2G2YA 4KGVB 1M5SA 3F41A 4KH0B 1FKPA 3PVXA 5THWA 4NLRA 1BWEA 1LW2B 3U1MA 1FRJA 2HLTA 5FDLB 1CBKA 1O6XA 4ZVHA 2WCXA 2MKKA 1IKWB 3ZZTA 5K5MA 3BR9A 4ZMMA 3DU5A 1KBRA 1YSJA 1OMSA 2MQOA 2OMOA 4CO0A 1U1QA 3TA2A 2EK1A 3KWMA 4QPTA 1HBUB 4CM0A 3HT0A 2FZKB 6FDRA 4CYUB 3OVBA 1RBLA 1C2PA 5B09A 4DEZA 2MLZA 1RT2A 2KVIA 2IC3B 3N9UC 2MQPA 4DG1B 3JS9A 1I51B 2DGOA 2BEFA 5T14A 4PWWA 3LWLA 4BWJA 1GNKA 3VZIA 2HHSA 4P71A 3W2WB 3JQMA 2QMXA 1RT7A 1H38A 4CT8A 4FKXA 3K17A 2BANA 3SV4A 3CCVS 3DLEA 1YJ7A 1SKUB 3AAWB 2PMWA 2AJQA 1HFEL 5GADU 2Y1JA 2A2CA 4YB1P 3AXMA 2VBXA 3QZ8A 1LWFB 3FVYA 3DGPA 2ZZTA 5B0AA 3W66A 3BEGB 2D3ZA 2XWYA 3P5BP 4F3OA 4IH5A 3TQEA 5G4DA 1X9SA 4URGA 3BBFA 3TVYA 4C48A 5J2QB 1J27A 2LP4A 2HQDA 2C2OB 2ILZA 4BC9A 1N54B 4CRJA 2DR8A 4RWWA 4C8NA 4H4MA 3CVKA 2B51A 1PIEA 5AXLA 3SDEB 2DNQA 3D6FB 1SKWA 3GQCA 4IYQA 3PEHA 2M5YA 2VQEJ 5A8KB 1CULB 3CCZA 1F6TA 5L38A 3NMAA 1SVDA 5HROA 4RO0A 1K1SA 4Y2MA 3TUPA 1Q4RA 2W2MP 4PR6A 4P2FA 4Q2LA 1EP4B 5DQGA 5CABA 3K59A 3ETOA 1HI1A 1U8WA 2XTJP 2YWEA 3HHDA 3H90A 2X1GA 4DL4A 2V69A 3RRGA 3UCUP 3FEYB 4O3OA 1KLMB 3J81Y 1NJIT 4CLSA 2FGOA 2VQEF 4H4KC 2RUGA 1QSSA 4CO2A 4NXNJ 4WPAA 3OT9A 2RKIA 4UQGA 4K2JA 3GFXA 2DHGA 1WOSA 3MPYA 2AJ2A 3HT3A 3BGRA 1XWLA 3JYTA 4FS1A 1VQOS 4RZRA 2KHCA 2IMWP 4HTIA 3UVJB 5C24B 3OUYA 5IFMA 2W7OA 4NLXA 3RB0A 2I0XA 4NXNF 2GGPB 3FZ2A 4KPYA 4PQUA 4NA3A 1XTZA 2B43A 2JRSA 4ZN1A 5CD4A 3ZNUA 3RR8A 2AP6A 3QFWA 1X4FA 3B4DA 1T9UA 1KWMA 1X4HA 4IH6A 1HBOA 2MLYA 4PG6A 2AF6A 1IQTA 2M7SA 3ZZPA 1UETA 1FKAF 3NBPB 2AV5A 2QV6A 1WC4A 3L09A 3CGIA 3LP2A 3I55S 2BVZA 4ZPTR 3C6TA 2HHXA 2KU7A 2XULA 4PXCA 5I3UB 2R9LA 3WIVA 3AFGA 1LWCA 1ZBTA 4TU9A 4KH1B 1KHVA 2RQKA 4K0KJ 3W7BA 4RUHA 4OV1A 1Q8BA 5A8RB 2BDPA 1S1TA 2KRRA 1NJZA 5D8HB 1HQUB 1S59A 2RUSA 4WFAQ 4AL6A 4NLTA 5KFPA 2EK6A 3C2PA 4OX9J 3SEOA 2HQFA 3OXLA 4LBPA 1APSA 3ZFVA 2C42A 1TQLA 4KC5A 2ZBQA 4DR1J 3LOUA 1VRTA 3MMBB 3RBDA 2IPOB 1FI4A 5D4OA 3PW4A 4CO5A 3M9OB 3Q8UA 4K0KF 2VDIA 3S8SA 2R4FA 1DTTB 1UA0A 2B5JB 1JJHA 3ILJA 3A13A 2G1HA 2PD1A 1RTJA 1M5KC 3PO5A 1G7CB 2FD2A 1OSDA 4LREA 3FFIB 4RBUA 4OX9F 4LF4J 3HZEA 1EETB 1KD1T 2HQCA 3OHAA 4DS5A 3H8YA 1TKXB 3MMJA 4DR1F 3UCGA 3T1AA 1FE0A 1NXIA 1N4LA 2YTCA 1NPRA 3A8EA 2VPZB 2VG7A 4LT6A 4CLKA 4RNFA 1KTQA 1Y9OA 1S7IA 2YKQA 2BXJA 1MSWD 4B3MJ 1FFGB 4HDGA 4LF4F 1FX4A 3CTRA 2QSFA 3R3TA 4A8SA 1IWAA 4PZVA 3IWXA 4NX9A 3MR3A 4HH1A 4LSNB 1S49A 2ZH8A 3KG0A 2AEJA 4HACB 3SYZA 1UVMA 3B78A 1SC6A 3T9NA 4NZ6A 2IBOA 3HHLD 5KG0A 1JLFA 4B3MF 1TMJA 4JV1A 4XTTA 4C8YA 4O3RA 1HIYA 3MPDA 3AA8A 2LCWA 1R43A 2R8IA 1CJVB 4USJC 2ZHAA 2HFOA 3GFYA 3QO9B 5AJ3J 4C0BA 3MF5A 3MDFA 5K14A 5F8HA 4V19X 2AT1B 4DCJB 1RU1A 1T95A 4FXWA 4RW6A 3DI6B 2BACA 3PYEA 3AB4B 1IKXB 4A47A 2QLFB 2OEMA 4MK7A 2NQPA 1GT8A 3DOKB 2ADBA 1RHQB 1OQ3A 4UOCA 3MMCB 4LSZB 4B9NA 3ULHA 2U2FA 1QY7A 4EGLA 1HBMB 5AJ3F 4WE1A 4TLQA 2Q79A 2X51A 1MMNA 5CQGA 1NZAA 1T03B 2DPIA 1RT3A 1A9NB 2DNGA 1SH3A 4CO3A 1BQNA 5J2PA 5ETQA 3W9IA 4IG3B 3ILLA 3M6VA 3EVMA 1B7FA 1NKCA 4DMZA 2FHMA 4MT1A 4KKOA 5RUBA 2DY1A 3HHLC 2POKA 3CO9A 4LBHA 4R0JA 1HBNA 3EDRB 3T19A 1KOOA 2VQFJ 4C11B 4DF4A 3GONA 2KYXA 2DO4A 2CPHA 4Q2MA 2UV8G 4G1PA 2ROEA 4NLWA 3KJFB 1P27B 4RW7A 4DUZJ 3PJWA 1VQ8S 1VHIA 1RLCL 4Z37A 2M2BA 4CM2A 1RTIB 5A2QY 3POTA 1TFWA 2VQFF 3PNIA 1CJUA 2XSJA 4UY8T 4Y2CA 1RAFB 3R5BA 2HRUA 4ZVUB 2XZTB 5EN1A 1VC0A 1KC8T 4ECSA 3K5PA 3B8HA 3GYGA 5BR8J 1WDDA 2RQ4A 1PKUA 1AUDA 4DUZF 1R8HA 3G8SA 2HFUA 4PXDA 5HMZA 3Q23A 3RB4A 4HHJA 1NO8A 4S0MA 5HJXA 4DSJA 3PXGa 1BGXT 1WC5A 2Q6CA 3PYGA 5KFVA 3NMRA 1RCOB 3BQ0A 1CVJA 2CPFA 1OIAA 5JVGQ 3C14B 2GQCA 2EFPA 4ZOSA 1WWHA 2W2PP 1TUVA 3UWTA 1CLFA 5BR8F 4IOBA 4KR0B 1U48A 4CQ1A 4PEOA 3W5ZA 1CC7A 2NSCA 5IM0A 1IXKA 5D3GA 2XY5A 1WSRA 2R7SA 3CWJA 2CJBA 4NWBA 4U96A 5BYSA 2D7SA 2LKZA 4I7FB 4C3KA 4CLUA 4EI2A 3SCIE 2IBKA 4J9KA 2E1AA 1U6FA 5HBMB 3SQGA 4ZPAA 2W7PA 2ASJA 3VQSA 4DZDA 1TL7B 2B9WA 2CQHA 4ILLA 3JQJA 1XNQJ 4O3QA 1NDLA 4RU2A 3BSAA 2PFFB 1TK0A 3QBCA 3MEGB 2PGCA 1TKDA 1KS2A 4M5DB 2EKYA 3G71S 3AY0A 3VAHA 2IAJA 3B54A 3IR7B 4U7CA 3TI0A 2VOPA 2KKHA 3MM6A 1BY9A 1FCAA 4RNHA 2IDEA 4EEYA 4LFAJ 3DLGA 1YJTA 4F4ZA 3O1LA 3WC0A 3MEKA 5HLFA 2WRMA 1VRUA 2UZAA 3R7NB 1C1CA 2JVOA 1XNQF 4HEA9 4ALZA 1TK8A 3D6TB 3DC2A 1HPZA 2EKNA 2HFNA 1BE4A 1HNIA 3LP1A 3HKZD 1BD6A 2XMTA 4K59A 3GJRB 2HEKA 3ZC4A 3HLUA 4B9UA 5F0UA 2U1AA 4FBTA 3ZZOA 2MZTA 5CAAA 5GVQA 2HZAA 1S9EB 3HFZB 1C1BA 3MUMP 2PT0A 3NCQA 1RBOB 5DDRC 1FK9B 3KJNB 2NXJA 1CSJA 4LFAF 4E98A 2QO3A 2QTWA 2B9EA 3MM7B 2UVRA 2RS2A 3G6VA 3ELHA 3EZ5A 1I3OB 2XB2D 2CZVC 2VKRA 4RKUC 4P7TA 3C6UB 3KLFA 5ETVA 2IM2A 5KFUA 4YDDB 3BJYA 4Q8EA 5I4MA 1B4SA 2GMJA 1RQ0A 4FYVB 2QL9B 3MR6A 3Q8QB 1LWXA 5E33A 2ZZMA 1MNEA 2OFHX 2FDNA 2FJWA 3QQCD 2PMHA 1R0BG 2B56A 3UCZP 1V5VA 1S6UA 1ACMB 4G1QB 2NPFA 4E8UA 1K44A 4F04B 3HI9A 5EDWA 2EWHA 4FF2A 1YBTA 1JLCA 1YJ9S 2PN6A 2BJ3A 2GMHA 2QN6B 1U1MA 1IN0A 3DRRB 3CNQP 1LNQA 2PI4A 3VAKA 4L72B 2RS8A 4FS2A 3P49B 3PRDA 3V2UC 1AXQA 1F60B 2F4VJ 5H9EJ 3SFGA 2AJ0A 1S9GB 2C2MB 1VC5A 2K7JA 4QBUA 1MROA 5KG2A 1VLYA 2N7YA 4DDFA 1ZM3A 1NM2A 4LJMA 1VQ6S 5DDQC 1M0SA 5KFAA 4C0HA 2OPQA 3AT1B 1AZSB 1YK9A 4WFYA 1HQ2A 2F4VF 1UA1A 2FJBB 2HRYA 1VQMS 4RWXA 4IQXA 4ZVEA 3M8RA 2X1FA 2BRKA 3THVA 3VR1A 2B0GA 1U1LA 1F0XA 1R8PA 5GAHU 1S57A 1HWUA 1S10A 1N6QB 2DNLA 4NLPA 2A3JA 2HVZA 2FPHX 2HMIB 1U0HB 5J2NB 4ELUA 3KLIA 3C16B 3BKFA 2HAIA 2RQCA 3OFHA 4R5PA 3JSRA 1CS4B 1UFWA 2DH7A 2FVRA 3IRXB 5F8NA 2KZMA 1MU2A 3HCXA 3MD3A 2QA4S 5HSPA 2DNMA 3BS9A 2XLKA 3OL9A 4QIEA 2A2DA 3IRWP 4F26A 3J7AN 4DL3A 3VWSA 4I2PB 3E01B 1VJWA 1UVIA 3DLHA 1IM6A 4J37A 1PYTA 4OYWA 4M95A 2W7AA 4NLUA 2CPYA 4KFBB 1ZTWA 1L3KA 2WOMA 2BR0A 4KGKA 4TNOA 1YTYA 1OY6A 5DJBA 3NCPA 2DEJA 5E3CA 4LR8A 1ELOA 5CH7B 2HVDA 4DSEA 5HO4A 4GVLA 5IT9Y 2DXDA 2HVIA 1JLQB 1R0CB 3SSSA 4A4JA 1IKWA 2JLFA 1IKYB 3PKMA 5A8WA 3KOAA 5B0DA 1SC1B 1HNZJ 2J7UA 5KFLA 3PDNA 3DXBA 4WFBQ 1WG5A 3GCXP 2XMVA 1JKHA 3OVSA 1SIZA 5IXUA 4LRBA 2MXYA 2AYMA 1V5IB 2BJ8A 2LU2A 2RF2A 3J7Z5 5IWAJ 3IS9B 2IC3A 3RTVA 2MMYA 1Q82T 3K5OA 1HNZF 5IT4A 9ATCB 3DOLB 4ANDA 5B0CA 3D9BA 1F3VA 2BKNA 1VQYA 3JTPA 4IG0B 2IDLA 4GO5X 2I6WA 1IJEB 1U1KA 3FMBA 2DNPA 1S0OA 1NH8A 3Q8PB 1T11A 3GV7B 5CCMA 1HWLA 2XS7A 3PJ9A 4ELVA 3W60A 1RAOA 5IWAF 3BR8A 3RB3A 1TFYA 2XQCA 5J1EA 2V4RA 4Z2XA 4K4YA 5D6GA 3EICA 3M8QB 2FIUA 2N82B 1HMVA 4RW8B 2AJFE 2EW9A 2ZBCA 1PC4A 1I94J 2YQ3A 1GXUA 4ED3A 5J1NA 3VGVA 1JLEA 3D1OA 3BPDA 3N5FA 1RT6B 3TQ1A 4QWEA 3V6KA 2QG9B 5AE1A 5CD4H 1UJ5A 1K73T 4I67A 1UW9A 2FY8A 5GAEI 4ATNA 3SI8A 1I94F 4ECRA 1ZZFA 3LWMA 1Z2ZA 2OPPA 1KLMA 5KTQA 1Q95G 2R7XA 5L46A 4DV3J 2QJ3A 5EWEA 3IP0A 4PPDA 3KK3B 4QOTA 1RWWB 4W90B 4LQ9A 3ZTPA 3VTIA 3IBCB 1K8AT 3GLJA 3CCES 3DU6A 1Q1KA 3M2RB 3CJKB 3X1LB 3OR1B 5KG6A 2ZKTA 2O5DA 3H4DA 3GR0A 1L5UA 4M94A 2KDOA 2M4MA 4Q0BA 1S79A 2HZVA 4DV4F 4DV3F 3TJ9A 5KT7A 1XIQA 4OFZA 2MKJA 3KDOA 2GGPA 4TXSA 1PJ5A 2ZH4A 2VPYB 5ETKA 4DV2J 4G1IA 4UW2A 3RUBL 4JI7J 1M1GA 3HSJA 2XO6A 2HZCA 3MUTP 3KDNA 2ZH7A 5KT3A 3MPUB 2HURA 1JLBA 3NBPA 3OTBA 2DXFA 2HNZB 4ZPVR 1VC6A 5C2GA 4I64A 2X3GA 1RBAA 4B3RJ 2R8HA 4ED5A 1IQZA 3CDUA 3OHBA 2N7CA 5FLXU 4DV2F 5I3UA 1JLGA 5KFGA 1SJFA 2OEKA 4NPOA 2ZVSA 5CXTA 4KGMA 4JI7F 3NOGA 4B3OB 1RWKB 4C9DA 4CTAB 3IMQJ 1KQKA 3KYLA 1HQUA 5L8RC 4J9MA 3U1NA 1FJEB 2BKOA 4ZCLA 3UNYA 3EUNA 1VIXA 1U1OA 2HLUA 4OYXA 1TK5A 4B3RF 4M1KA 3W1YC 4LQ3A 5B7WA 1PYSB 5E2QA 5IV4A 3L7OA 1WHXA 3M8PB 2J9EA 3JSYA 1U49A 1PYOB 3NS7B 2R3VA 4XAKA 2N4CA 4RBTA 1RAAB 3BSNA 4A48A 4B17A 1Q79A 3PW2A 1ZM2A 3UD5A 4K5SA 5CYMB 1RAHB 5KFIA 3FFIA 3NGRA 1MWYA 2J0WA 3R9LA 2DY9A 1F2HA 4PXEA 4B9LA 3K57A 3BM7A 3BO4A 1UWBA 1TKXA 1HWJA 1X4DA 1CPZA 2HPUA 3UO0A 2JDJA 2E7XA 4DV6J 1U47A 2X1AA 2UUBJ 1WEXA 5E5NA 2A1BA 4ZJQA 3MEEB 4X2BA 1P1LA 1S0MA 1NZ8A 3E2EA 1SH2A 2OPRB 1NPPA 3DN9A 2RNEA 1FKPB 3NGKA 2K2PA 2EBEA 3MCNA 4ZPCA 1NU4A 4DV6F 4LSNA 5E3PA 1KRPA 3OJUA 1KFSA 3MTJA 4F0KA 2ERRA 2UUBF 4CT9A 4HACA 2MJUA 4V19J 3TR5A 4AD6A 2BABA 2W2OP 2Z58B 4ES2A 5IC4B 1U24A 5DO2A 5A76A 1ZAXA 1OYDA 1DURA 3DRPA 2GIQA 2XNRA 1RZMA 4D3GA 1YZ7A 4PRFA 2YKNA 2VBYA 1AT1B 2PFDA 4XK8C 2B4OA 2O1PA 2WZ1A 4OLOA 4K50A 3QO9A 1YX2A 4JUZA 2W9BA 2XGQA 1RT2B
chains in the Genus database with same CATH topology
1FESA 1IKWB 3DRYA 3ZZTA 1Y5NB 2M8DB 2L08A 3TVKA 1XMBA 5K5MA 2HWHA 4H54A 4ZP9A 3BR9A 3UR3C 4ZMMA 3BO2A 4EO6A 3DU5A 5C25B 1YSJA 2MQOA 1U1RA 4NYZA 2OTLS 4LFCF 3RRHA 2OMOA 3DRSA 1YJUA 3HPOA 2G0CA 4J9RA 4CO0A 1U1QA 4ZPBA 3TA2A 5HMXA 1HL6A 1V6HA 2EK1A 2KM8B 3KWMA 2P9EA 2CQ4A 3QAUA 4TY8B 5B0FA 1X9MA 1RT7B 2MPUA 3ITHA 4QPTA 2R7OA 1HBUB 2XWXA 1S1UA 2ZBIA 1N88A 3EGZA 1FVQA 1M5HA 6FDRA 1X0PA 3CJ2A 3DOKA 2XG8A 5ITHA 1LW2A 4CO4A 5DDOC 1C2PA 2ZUGA 3OVBA 1QTMA 2A18A 3TAPA 5FDLA 3LQVA 4DWIA 2YX7A 5B09A 4X4SA 2FJVA 4DEZA 2PO4A 1UEVA 4QJVA 2RRNA 4ILMA 5EX3A 4NA2A 1RT2A 5LJ5Y 2KVIA 4JYAF 2FUG9 1TL1B 2E44A 3K8VA 4I0WA 2IC3B 2L9WA 4ECXA 1JXLA 3N9UC 2MQPA 4DG1B 4C4WA 5JVHQ 1QSLA 1X5PA 1VQLS 2WBMA 1ZM4A 2KJVA 4QWDA 2DGOA 1BQXA 5T14A 4N47A 3J7ZT 2YKPA 2DNRA 1T03A 1RJJA 4F2RA 3DXSX 4BS2A 3LWLA 4BWJA 1GNKA 3VZIA 2HHSA 1FF2A 2LQBA 3W2WB 2JLEA 2Z2MA 3WDOA 5C42B 1RK8A 4DL6A 1T94A 5E3RA 2QMXA 4TY8A 1RT7A 2FHJA 1H38A 4CT8A 1PC5A 1HBUA 2BANA 3SV4A 3CCVS 1IUJA 3DLEA 4J9QA 3AAWB 4IG3A 2AYEA 2AJQA 3MECB 5L1IA 4GMKA 3T5HA 2BZ2A 3KJVB 1HFEL 5GADU 2LEAA 2A2CA 3DRXA 2Y1JA 4DFJA 5DM7Q 2Y1IA 4YB1P 2ZH2A 3OPKA 5AXKA 1NAQA 4OX8A 3H98A 2DNNA 1S6PA 2F8MA 4ZP7A 1VQSA 2K7KA 4O0IA 1SJ4P 2VBXA 1G2EA 5K8PA 1TL1A 3QZ8A 1LWFB 2ZE2B 3FVYA 2DRBA 3DGPA 4DG1A 3I4HX 3I9ZA 3S6EA 3OW2R 4AQYF 2IJFA 5B0AA 2E9TA 3AQOA 4H4OA 3DLJA 2J6TA 3BEGB 3CIZA 2D3ZA 2XWYA 3EGWB 4F3OA 2L3MA 2V8HA 4IH5A 5L9NA 2B7CB 4TQSA 5G4DA 5SUHA 3SFUA 1X9SA 1FXRA 4URGA 2UUAF 1Z4UA 2M88A 3TVYA 3W2WA 5AE2A 1U7LA 2RH3A 5J2QB 5F8IA 4K5RA 2ROGA 2ILZA 4BC9A 1N54B 2DR8A 5F3ZA 2LXIA 1JJ4A 4RWWA 4C8NA 3PM9A 4H4MA 3WZ0A 2IM0A 4OZJA 3DYAB 4RW4B 2C3OA 3CVKA 2B51A 1G3OA 3NWGA 1VBXA 3KJVA 3N6NA 3QGIA 5AXLA 2VG6B 3SDEB 4O4RA 4X62F 1PGZA 2DNQA 3CC2S 3HJFA 1SKWA 3GQCA 3M6XA 3PEHA 2M5YA 4IYQA 1FRMA 2Z4PA 4WK1A 5KFKA 5HL7Q 1NB7A 4ECQA 4G3IA 1RAJA 5JUMA 2JVRA 3QGHA 1O51A 5A8KB 1U6BA 3D0GE 3CCZA 3D2WA 3R27A 3IBWA 1X9WA 1FTRA 1YQHA 1LWFA 4OQJA 3KLVA 2ZE2A 2FJXA 2RKIB 4DLEA 3R1HA 3I5CA 5L38A 3QYYA 3NMAA 4C98A 2AGQA 3PY8A 1KLNA 5KFXA 3VAIA 5HROA 1RTIA 2D9PA 2YWKA 2PMZD 4YP3A 1HNXF 5E3AA 1LKZA 4WCEQ 1CG2A 3BGRB 3QGGA 3KKFA 4FF1A 1K1SA 3AJ2A 1IBLF 1CEZA 2LECA 2KO1A 4Y2MA 3HVWA 4A8MP 5J2QA 2MYFA 1Q4RA 4C8ZA 4PR6A 5JJBA 4Q2LA 4K4WA 1EP4B 5DQGA 4FF3A 2ZC3A 1S1XB 3K59A 3ETOA 1RKJA 1HI1A 1NRKA 2YWEA 3HHDA 4RW4A 3QGPA 3VAFA 2VASA 2JC1A 1H6KX 2F8HA 2X1GA 5IS2A 1VFJA 4DL4A 1WACA 3SDEA 3RRGA 5KT6A 3UCUP 2YKOA 3ZZRA 3FEYB 1HD0A 4O3OA 3RU0A 1KLMB 3J81Y 3VALA 1NJIT 2HYIB 4QR2A 4KJIA 4KSEB 2FGOA 4M63A 2JFKA 4H4KC 5A8KA 2VQEF 3MOJB 2RUGA 1QSSA 4CO2A 4OI3A 5DGAA 1RT1B 1V3SA 1N56A 2RKIA 3F44A 1X4CA 4UQGA 2J7WA 3D28A 3EYZA 1WI6A 3GFXA 2DHGA 3JB9k 5DG9A 4HKQA 2DGWA 4LF5F 4C0OC 1SIWB 1WG1A 4OIXA 2YH1A 3MPYA 2UVUA 3HT3A 4ZLPA 3X3UA 3BGRA 3KK2B 3IR6B 2V4JA 1XWLA 4X65F 4J9SA 2R8GA 2RDJA 3JYTA 2GIRA 2QMWA 3E3XA 1FHTA 4DR7F 3DNCA 4FS1A 1T02A 1EP4A 2CJ9A 2W24A 3IR5B 3M6WA 4RZRA 1VQOS 2PA8D 3JSMA 2FJEB 2HNYB 4WFNQ 2KHCA 4AE5A 4HTIA 5K8MA 2IMWP 2NREA 2V2KA 5H9FJ 2UUTA 3D1QA 1K0TA 5C24B 3OUYA 4QW8A 5IFMA 2W7OA 2DNYA 1R0AB 3BDEA 1UAWA 3C66A 4RU9A 4QIGA 1OO0B 5L1JA 2KFZA 1QAYA 1LK7A 1SXLA 2KXFA 3CJ4A 4NLXA 3RB0A 2GW8A 2BV3A 2E1MC 2Z8QA 5AXMA 4ED6A 4NA1A 3IWNC 2I0XA 3L95X 4H4KA 2R2UA 4NXNF 2ASYA 2RRBA 1FRHA 2GGPB 4ZP8A 2GQQA 5A6PA 4XDCA 2C2EA 2EVZA 2P6TA 2IRYA 3FZ2A 4AXJA 5B08A 3LP2B 4NA3A 4KPYA 4PQUA 1XTZA 2IYGA 1NK7A 1FDBA 4I7FA 3TVZA 1VQ7S 4KAIA 1O0PA 1N48A 2DIVA 2Z0GA 2B43A 4DFKA 2JRSA 4DQRA 1R31A 1YVFA 3T1YF 3FRZA 1TP7A 4MTPA 3OLBA 2EG2A 3RR8A 3KMSA 3SCLE 5CZVA 2XHWA 2AP6A 1SV5B 1LWCB 3V6HA 1X4FA 4R8UA 2Z2LA 3B4DA 4L3NA 2B9YA 5K8NA 3ISND 1X4HA 3CCTA 4IH6A 4YR3A 2N3LA 1HBOA 3ZZUA 4DLGA 3PR4A 4PG6A 2ADCA 5C24A 1S1TB 4QR1A 2AF6A 4ICLB 5KG1A 2FLNA 1C4CA 5KFZA 1R0AA 1IQTA 2M7SA 1KTVA 1P8GA 3SCKE 2R7VA 1RI7A 3ZZPA 3OV7A 3OR2A 1UETA 2KXHA 2O3DA 1FERA 4WFXA 1FKAF 4MYUA 2MSTA 3NBPB 3OFFA 2AV5A 1M5OC 2XY7A 2ABYA 2QV6A 2MKIA 4LMZA 4ZPDA 3LAMA 1NK8A 1S4FA 2FTRA 3L09A 3RW6A 2XMWA 3CGIA 4OI4A 3LP2A 2CPDA 2E5GA 2C3YA 2OSRA 5DG8A 3I55S 3PKYA 2BVZA 4MKYA 4DBQA 1KHWA 3BB5A 4ZPTR 3C6TA 3UI3A 5KFMA 2HHXA 1FXLA 3HMJG 1FXDA 2KU7A 2XULA 4PXCA 2ZHBA 1W2BR 5F41A 1VRTB 1SB6A 5I3UB 2R9LA 1B0PA 3M2UA 1YITS 2HIQA 1SV5A 1LWCA 2LEBA 1N34F 1ZBTA 4TU9A 2XMKA 1JIHA 3CB4A 1KHVA 1HI0P 2C2DA 1UVNA 2RQKA 3G9CA 1DHMA 1UVKA 3W7BA 4KIAA 4RUHA 1RYSA 4NXMF 5LMUF 4K4VA 4OV1A 4EWTA 3GR1A 2G4BA 1Q8BA 3GYXB 5A8RB 2BDPA 2L9NA 1S1TA 2KRRA 3N5BA 1NJZA 3TX8A 3BGFA 5G0RB 4O4GB 1Q7LB 1HQUB 3C8YA 3V4MA 2ZH6A 1UJ4A 5D8HB 1NHVA 3NLCA 4WFAQ 3H2UB 2IVFB 4AL6A 1RTJB 5L1LA 1U1NA 4FXDA 1F5BA 1GX5A 4MFBB 4ZVGA 1U45A 5E41A 4NLTA 1HHSA 1WHWA 2NLWA 2DK2A 5KFPA 3BN4A 5I3PA 2IA0A 2EK6A 4WTYA 1DBDA 1N5YB 3C2PA 3SEOA 2VODA 3N01A 2C2RA 1ZETA 3CCWA 1X4EA 3OXLA 1LWEB 3H20A 4FXVA 2HHQA 1APSA 3I87A 3ZFVA 2C42A 2ALZA 1RT4A 1TQLA 4KC5A 1RTDA 3PZPA 1A7GE 2EPIA 2CQIA 4X4NA 2GNKA 3LOUA 1VRTA 3MMBB 3SSRA 3V6DB 1NJYA 3RBDA 3V4IB 5D4OA 3PW4A 2VA2A 2ZOFA 4CO5A 1WHYA 3KFWX 3T6BA 3M9OB 3UR0A 4ELTA 4Y0FA 3HF5A 2VPWB 4KQZA 4EZ9A 3U1LA 3NS6A 3DDNA 2QIFA 4K0KF 2WONB 2CJQA 2IHR1 3S8SA 2R4FA 1DTTB 5EUHA 1UA0A 1ZYQA 2YX1A 4OZ0A 3QPIA 3AQPA 2B5JB 3CDEA 1JJHA 3IO1A 2GO8A 5A8RA 5FLXY 3VAMA 1XMOF 5G0RA 4O4GA 4OI0A 4FBUA 5GAGU 2NR0A 2PD1A 1RTJA 1AROP 2B7BB 4YB7A 3KLEB 3WX4A 1M5KC 3M32B 2DCLA 1GQEA 2HWTA 3PO5A 1HW8A 3T5KA 1G7CB 2FD2A 3E51A 3S7RA 1OSDA 2LXFA 1QVGR 3IAM9 3FFIB 4RBUA 1N5YA 3S01A 4OX9F 1S72S 1FD2A 3C6UA 3HZEA 1WHVA 4YR0A 2D3OR 4BCAA 1L3SA 1EETB 1KD1T 2V0NA 1LWEA 3QLHB 4DQPA 2YWFA 3OHAA 3ISNC 2VV5A 1W25A 2WSCC 1IBKF 4DS5A 3G8QA 3H8YA 2Y0SD 1TKXB 3CT9A 3MMBA 3MMJA 3J7YI 4DR1F 3UCGA 3T1AA 1X5TA 2L41A 3WC2A 2UUWA 3V4IA 2MZRA 3LPYA 2D41A 1FE0A 2F8EX 3DMJB 1ZAVA 3MMAB 4QZVB 3CULA 5EX0A 2E9RX 2MDAA 1N4LA 3OTDA 2YTCA 2IM1A 1DTTA 2B5JA 4MIAA 3A8EA 3MM9B 4X64F 1LFPA 2O01C 2DCUB 1LFWA 1VQ5S 1NK5A 2FY1A 4OJ1A 2VPZB 4WYLA 4F02A 2PA3A 5HN0A 3KLEA 2VG7A 2OIHA 4LT6A 3CXCR 3M32A 3M30B 3QIPB 1FE4A 1GXLA 2JSXA 3M6UA 1TKZA 4YDXA 4RNFA 2COLA 1Y00A 1KTQA 1Y9OA 5HI7A 3O3LA 3OLAA 5LMNF 4XDDA 3MEDB 2CQ0A 2YKQA 2BXJA 1MSWD 4HDGA 4LF4F 1JLFB 1EETA 2JX2A 4HVZA 2J9CA 4I56A 4NCGB 4IDKA 2KN4A 2XI2A 1IKVA 3QLHA 4QIFA 3K58A 1T3NA 3CCLS 2DH9A 3CTRA 3LO3A 1YI2S 1SL2A 4X4VA 1FO1A 1TL3A 2QSFA 4NLVA 2BA9A 3LUYA 2ZNYA 4I69A 4KV8B 2XS2A 5J2MB 3R3TA 4IFVB 4A8SA 1WF0A 1YJWS 4TN2A 5B0EA 1S1VB 3IWXA 5KFJA 1XR6A 4A8YA 4NX9A 3MR3A 1X4GA 2APOA 4HDHA 1D8YA 3HHNB 4HH1A 4LSNB 5HMYA 3MXHP 1HWKA 2VG5B 1S49A 5C5JA 2ZH8A 3M9MB 1RKIA 5KG3A 3MM9A 2DVIA 2FVSA 1KN6A 1RTHB 4TU7A 3V6JA 3KG0A 1TAUA 3SYZA 1UVMA 3PRBA 4DQQA 3Q22A 5K14B 3UQSA 3UE2A 4ZP6A 4LUBA 2CRLA 2XSFA 3CDWA 5LJ3Y 2FLPA 3B78A 2EI5A 1E6VB 1K0VA 1SC6A 3T9NA 2E66A 1WTBA 2BQRA 4NZ6A 2F7VA 1D9DA 4KRWA 4OHVA 4OZLA 4RW6B 4JV5F 1FA0A 2IBOA 2LYVA 3SSQA 3GV5B 3MEDA 1U25A 3HHLD 3I5BA 5KG0A 3GV8B 1JLFA 2QRRA 2YNIB 5KFSA 4B3MF 4NCGA 4ZCMA 4FYDA 4JV1A 3SXLA 4C8YA 3EPGA 3HHKA 4O3RA 2UUCF 2R2TA 5KAKA 3R5AA 3QJJA 3B4MA 4Q5VA 5J2MA 2LQ5A 4IFVA 2LEPA 4Y00A 3W2VB 3AA8A 2V9KA 2M3DA 1ROFA 1R43A 1S1WB 1S1VA 1R89A 2LCWA 1SL0A 2R8IA 3H2VE 4USJC 2ZHAA 1KFDA 2HFOA 3Q2TC 1RA7A 2DNOA 3GFYA 3O2IA 3QO9B 2GFFA 3KHRA 1RISA 3I4PA 5DDPC 4ES3A 3G86A 4KB7A 2YWGA 5IQ6A 4C0BA 5E3QA 4WE1B 3MF5A 2IRUA 3MDFA 5K14A 2AJ4A 2PSZA 4F25A 2L9DA 4DHVA 2PIIA 5F8HA 5KFWA 2I5JB 1VBYA 4M8LA 4V19X 3I32A 1T95A 4FXWA 2ZC4A 4RW6A 3MUVP 4UUXA 2RILA 2H9ZA 3KNGA 4EBDA 3GILA 2VUGA 4HLBA 4QIVA 3DI6B 2KH9A 2XS5A 1JMTA 2BACA 3AB4B 2ASLA 1IKXB 3BF4A 4A47A 2ILYA 5J2PB 1S1UB 1WD6A 3M2VA 2KG0A 4MK7A 3G96A 2NQPA 1GT8A 3ISZA 2BM0A 1S1WA 4ZA1A 2CIMA 3DOKB 3F56A 3T6JA 2ADBA 4IRKA 3GWCA 2XCPA 2CVIA 2JWNA 1OQ3A 4UOCA 3NCRA 2YKAA 4MK9A 3MMCB 4KHRA 4I6WA 4B9NA 1S77D 4WU3A 1JWWA 3ULHA 1KSPA 4DV0F 2U2FA 3E8OA 3I9V9 1QY7A 4EGLA 1KQFB 4QWCA 1HBMB 2RE1A 4RNNA 4WE1A 5AJ3F 4TLQA 4P2SA 5A6WA 4PKDB 4RX6A 1SBRA 4PG8A 1QUPA 2DT9A 2M52A 2I5JA 3UW1A