3AA8A

Crystal structure analysis of the mutant cuta1 (s11v/e61v) from e. coli
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
103
structure length
103
Chain Sequence
TAVVVVLCTAPDEATAQDLAAKVLAEKLAACATLIPGATSLYYWEGKLEQEYVVQMILKTTVSHQQALLECLKSHHPYQTPELLVLPVTHGDTDYLSWLNASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Remarkable improvement in the heat stability of CutA1 from Escherichia coli by rational protein design
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
molecule keywords Divalent-cation tolerance protein cutA
total genus 21
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3aa8A00
1XK8A 4YB6A 2PIIA 4OZNA 1V9OA 3OPKA 3AA8A 5D4PA 3X3UA 3NCQA 4YB5A 3DFEA 1Q1KA 4C3MA 4R25A 5L9NA 1P1LA 4C3KA 1NAQA 4Y65A 3CE8A 1H3DA 3TA1A 2NUUG 2E66A 4CO2A 3AH6A 1NH8A 2XBPA 4D3HA 2V5HG 2NUHA 1VFJA 2J9CA 2GW8A 4IYQA 2JJ4D 3NCPA 2NS1B 1VHFA 2ZOMA 4WK3A 2ZFHA 2Z0GA 4RWXA 2EG1A 2DCLA 4CO3A 1GNKA 2J9DA 4NYOA 1UL3A 1PILA 3TA0A 4CNZA 4CO1A 2XG8A 4YB7A 2RD5C 4D3GA 4OZJA 3O8WA 3N5BA 5D4OA 3HLUA 4USJC 1UKUA 1KR4A 1O5JA 1OSCA 4RWWA 4CO0A 2O67A 2XULA 3AA9A 1V6HA 4CO4A 3M05A 3NCRA 4ZK7M 1UMJA 5DS7A 4USHA 4C3LA 1V3SA 1UFLA 1QY7A 3AHPA 4Y6IA 4AFFA 3GSDA 3T9ZA 2O66A 2J9DE 1NZAA 5D4LA 4RLEA 4OZLA 3L7PA 1O51A 1HWUA 3MHYA 4NYPA 3TA2A 3LF0A 1J2VA 1NH7A 1V3RA 2GX8A 2CZ4A 4E98A 2GNKA 4CO5A 4RX6A 4WK1A 2EG2A 3BZQA 4USIA 2J9EA 2XZWA 2VD3A 4CNYA 5D4NA 5DRKA 3O5TB
chains in the Genus database with same CATH superfamily
2QX0A 3G86A 4DQPA 1KS2A 2DNOA 2V2VA 2V6AA 4AQYJ 2UVVA 4RW6A 3V4IB 2DY1A 1NDKA 3KLFB 1R89A 3CULA 3L9ZA 3OFFA 5KFUA 4I64A 3ILOA 5GAEU 4WFYA 3E2EA 2ACYA 2RAQA 3SEOA 5L46A 4U6PA 2AQ4A 1TL3B 2H54B 3P6YC 3Q8SB 4NLQA 4JV2A 3OFEA 8RUCA 3PFOA 5EX3A 2RS8A 3AH6A 1D9AA 2XBPA 4C7QA 1OSDA 2BBEA 3A8JA 2X3DA 4G1PA 5LSRA 1UVJA 5JVGQ 4DZ6A 1TKXB 2V2ZA 3DM2A 4V1Ak 2DNZA 3NS5A 4BDPA 4J9MA 2B4PA 3NMRA 2HHXA 2EFVA 1YJVA 1MLAA 1YRUA 3D68A 1RI7A 4TLQA 2CPDA 1JK9B 2ILZA 3AFGA 3D5MA 3QFWA 4M63A 2OI2A 5CCLA 1NEEA 2Y0BB 3CCSS 5JVHQ 4F3OA 1R8PA 4N76A 4ZPDA 2U1AA 1UL3A 1X0PA 4RKUC 1RTHB 1TVRB 1TV6B 1TU0B 5DQHA 4ATNA 1FX4A 2M5YA 2YNIA 1LOUA 4LSLA 4MFBA 5GMKa 1L3UA 2J6UA 2IBOA 5KFLA 4DX7A 1HNXJ 2HQFA 2XCPA 3B4MA 4GKKJ 3CMES 1HKAA 5LOQA 3W3SA 1N33J 2XMMA 3C14B 1HHQA 1QDUB 3F44A 5CHCB 5D0EA 4KHMA 3KLEB 2G0CA 3TO8A 1RWKB 4Y2CA 4V19J 3OSPA 3J80Y 1HBNB 3MEEB 2J8SA 3EZOA 3PJ9A 1X4DA 4DSJA 1FJ7A 4U8YA 3QO9B 1WHVA 5J1EA 3MUMP 3TUPA 1S7IA 2IDEA 2MQNA 2PE8A 3M8PB 2N3LA 4O23A 4X62J 2MSTA 3MPYA 3VAIA 1VBYA 2JFDA 1NNDA 2XSJA 1N48A 3DDKA 3WX4A 3FSXA 4DPXA 4CLUA 2HZAA 1X9MA 3OTBA 2C2OB 3MCMA 4M8LA 5K8OA 1YSJA 2BYCA 1RGVA 3SCLE 1TKTA 4QIFA 5F41A 3NWGA 2J7WA 5KOWA 2COLA 3HI9A 5FIIA 3FBCA 4HH0A 3TOQA 2VQFJ 4HDGA 1RLDA 2WOMA 1YDLA 2V0NA 1AFJA 4F50A 4HACA 2G0JA 2CKWA 3UVJA 2GIQA 1MROB 2ALYB 3AHPA 1G2EA 4Q7AA 2E1PA 3DGPA 4TVAB 4X66F 1HBNA 4MIWA 1UETA 5DLGA 2GJFA 4QYRA 5F8IA 2Y1RI 2DT9A 4JOUA 4A46A 1JLEB 3A3PB 5IV4A 1FCAA 2J6TA 1DZ5A 3QT6A 1LK5A 2Y8WA 3M30A 1NCLA 1CLFA 4Z37A 4QW8A 4YB1P 4J9SA 4DR2F 4M5NA 4ZKAA 1KN6A 4AD6A 3HKZD 1RTIA 1YJTA 3MR2A 2FVQA 3WIUA 1PYOB 2MPUA 3PW5A 3IGNA 1G6BA 2HVZA 1U6FA 1AA1B 4PWUA 1IJEB 2HHWA 3TA2A 1MMNA 2VBYA 2CVEA 5LXRA 1UJ5A 3I9V9 4Z7CA 2CQ2A 3UVJB 2B0GA 5M2PA 4BS2A 1XNRF 4PWDB 1C0UB 2PFDA 2IHR1 2G2OA 3ELHA 2DB1A 3PR4A 4W4MA 3DDIA 5CD4H 2XWYA 2RRAA 1KFSA 4M5DB 3DLEB 4NXMJ 5L9XA 2J0SD 2DEJA 3GCWP 4QR1A 4KGMA 3ZZPA 2J9EA 1HNWJ 3MCOA 3AT1B 4J9PA 4A8YA 4LF1A 3RBEA 1VQYA 1WWHA 2HBQB 2AT1B 1WSVA 2J7UA 2JFKA 3IGVA 3KKFA 3KNGA 3QBCA 3TAMB 4B3RJ 2KFYA 1EETB 2HFOA 2LKZA 3F73A 2GHPA 3CCVS 1X4AA 4P73A 3KMQA 5F3ZA 1UWAA 5E3QA 1N52B 1REGX 2LQ9A 3BEGB 2NSCA 3JS9A 4C3MA 4DUTA 4DL7A 3FK4A 4C3KA 1TMJA 1HQEB 3KLFA 2ZH6A 4IRCA 3L7OA 3PFEA 4USKA 3R8YA 4DV1J 4M5KA 3I31A 3VAGA 2GS8A 2V8DA 3KG4A 4RJVA 1NH8A 2HLUA 1NK8A 1C0TB 3PRVA 3ETOA 2IJRA 1T11A 1RYRA 2ASYA 1Q7LB 3EGNA 2CJ9A 4OQJA 3HHLB 4RNFA 3DOMA 2VFVA 1K1SA 4M5MA 4P2XA 4MH8A 3TQEA 2XMVA 2VASA 4NI2B 3W9HA 2VJUA 3EGWB 5KFPA 4F2RA 4WFBQ 1N54B 2M8DB 3SCKE 2HVDA 3RB6A 1UA0A 4C8YA 2EFGA 2OD6A 3Q0AA 1UVNA 2DIUA 4NCAA 1MG7A 4FYXB 3U27A 4GC7A 3N79A 4ETZA 1RT4B 3J7Z5 3HSDA 2MKYA 1TAQA 4DU7A 3TYTA 4WF9Q 1OY6A 2DPJA 4RO0A 5IC4B 2OPQB 2MZQA 1CULB 2P6TA 3OT9A 4KH0B 5HBMA 3RBZA 5IWAF 2FZKB 4KV8B 4OYBA 1QE1A 3EVMA 1AB8A 1E6YA 5B7WA 5DG9A 1OJ4A 1VS3A 1NJIT 2FC8A 3EVOA 4W92B 1BQXA 2RD5C 4USMA 4LIRA 4PQUB 2PMWA 3AQPA 3HHKA 4ITSA 3MM7A 2OH2A 2A0FB 4YN3B 4X4VA 2UV8A 2F4VF 2B8PA 4TLRA 4JP8A 1YKWA 1S99A 1T02A 2BMBA 3ZZUA 1R0AB 2F4VJ 2HG4A 4EUVA 8AT1B 5IM0A 3HXMA 5H9EJ 3VAKA 1RTDB 4V19X 4WCEQ 3QLHA 2HGMA 3TWZA 1DARA 1RWWB 2H5IB 1N5SA 1QUPA 2RNEA 2WSCC 3B6BA 3IFEA 4DOZA 4EWTA 4QCLA 2P9GA 3SBMA 5B08A 4Y0FA 1NHVA 2CQ1A 1Q82T 2YKPA 3GJTB 1AUDA 4HT7A 2ADBA 1ZA1B 3SV4A 2RSQA 3GJQB 2DR6A 2DNQA 4IFVB 2MHEA 1SKSA 3KHHA 1WC5A 5A8WB 5EUHA 4NLVA 1ZPWX 4H4MA 4MKVA 4E8UA 1JMTA 4WKYA 4Y6IA 4U67Q 4DR2J 1R0AA 2I8EA 4MYUA 3LALA 2BQ3A 1FRXA 2O66A 4NMXA 4FXDA 1SCJB 4K8RA 1KQFB 2YX7A 1MSWD 2JVOA 3P5TL 5I4MA 4WU3A 3GV8B 1KD1T 3QGIA 2ALZA 2ASJA 5LSLA 3R7SB 5B0BA 1SIWB 3FCVA 3K7RA 1VQ6S 4PAAA 4GO7X 4PR6A 1RLCL 1RDRA 4QIWD 5GADI 3NWRA 2MHNA 4TY9A 1S77D 2C3OA 2XTJP 1SL1A 1RTIB 3BYPA 5DQIA 4OX6A 2N4DA 2L9DA 3QMQA 1V5VA 2BXJA 4ILRA 1NH7A 4NLRA 5THWA 1MN9A 5KG3A 1ICEB 3MMJA 1NXIA 3DRRB 5HANA 5CAAA 4X65F 3CCMS 1ZETA 1DAXA 1HI0P 4B3RF 2WVCA 4KC5A 4O3OA 5KFYA 1UVIA 1SXLA 3KDNA 3SFUA 4FS2A 4KAIA 2Q79A 4IG0B 3R5AA 3HFVA 3DC2A 3R27A 2GQCA 3J7YI 2LDYA 3EGZA 3ZTOA 3LANA 3O5TB 4ECWA 1BQNB 4H4KC 4ENOA 2J76E 4XPEA 1H72C 3O44A 3OPKA 1RJJA 2QA4G 1N33F 2CDQA 5D4PA 3UO0A 4IDKA 1OIAA 2QLWA 2E1AA 4R25A 2VQEF 4U96A 1JIHA 3ADAC 3GIIA 3BR8A 4DL6A 2ZVIA 3PHEA 5KG1A 4ZPWR 1JLGA 4P6QA 2V9WA 2RKIA 1G3OA 3QRQA 4K5RA 5GAGI 3VQSA 3CC7S 2BJ1A 1AXQA 1FDAA 1IBKJ 1HIYA 3HJFA 5T7LB 3CDWA 1VIOA 1RA7A 2QLXA 1JLBB 1GMWD 4JI0F 1S1XA 4ZP6A 4Q43A 3PIPQ 2ADCA 4URGA 2NZ4A 3BQ2A 1JLFB 4HEA9 1RT1A 4X66J 1T3OA 5BYQA 2LECA 4EBCA 2P5VA 2PFFB 1Y11A 2HNYA 2ZOMA 3HD2A 4ECTA 3FBFA 2YNIB 4LSLB 1ITPA 3SCJE 3CCLS 2GQ2A 1VLYA 2OTJS 2WVEA 2MZ1A 3KJFB 4I6AA 5EDWA 4Y2AA 2YQ3A 3GIRA 3UDCA 1TK5A 1I94J 1U6BA 2V2QA 2IBKA 2HBYB 1SKWA 1HPZB 3TAMA 3OD2A 4Y34A 3HJVA 4H4OB 3ZXWA 4ED0A 4NXNJ 2ASDA 2DNNA 2V2KA 2VBZA 4B9LA 1LWCA 3IWXA 4X62F 4WFXA 2FVPA 3TZXA 2YWFA 3IBWA 2DXDA 4AUKA 4F0MA 2AEJA 2PEHA 1Q81T 2BVZA 4N8NA 4WFNQ 1L3TA 1TFWA 3J7AN 2GHWA 1KBRA 2ZBQA 4DPWA 4G1QA 4O0IA 3HVTB 5ETNA 1X5TA 2C22A 5IOLA 1NDLA 3DRPB 1F9HA 4DMZA 2XCAA 1U1RA 1FE0A 3AA9A 2BANB 3DOKB 1RAOA 4OHVA 3THTA 4BCAA 4IO1A 4FYVB 1HNXF 5EN1A 2AZ1A 2PDAA 5B0EA 5HL7Q 2DR5A 4DZDA 3DOMB 2C28A 3V6KA 4B02A 2VA2A 1Q5YA 5ETSA 3VAJA 4C0HA 1XBWA 3DHXA 4MIAA 3QJPA 1S6PA 1Y7PA 4X64F 1FD8A 1FD2A 1YJRA 2R2TA 2ZH7A 1DURA 3UCGA 4C3LA 3DDNA 2DGVA 3GWCA 3HHLC 4EO8A 3OL9A 1LWXA 1VQNS 2LP4A 3SQGB 2CQGA 1KKHA 2FZGB 2DD8S 3BO3A 4PZVA 1NK9A 1FHTA 2UUBF 4R5PA 1FE4A 4NLYA 1NLKL 1WC4A 3C16A 3VGVA 2CAJA 2F3JA 2H51B 4IFVA 3V2UC 3NG8A 3M9OB 3PX6A 3IAM9 4XIUA 3OTOJ 1JLQA 1OWXA 1RHMB 2AEFA 3AXKA 5KFKA 1Y3JA 1HQEA 1MWZA 3C66A 3I0RB 3M32A 5L1JA 3CJSA 3PO4A 4NCBA 1S9GB 3K2YA 4DX8H 2MQQA 2JSXA 3MM7B 3FQKA 2LQJA 3OXGA 4YS2A 1N32F 2XY6A 1UZHA 3H5SA 4HR2A 4CDIA 1F1BB 3AOAA 4ECZA 1J27A 3H4DA 4RW7B 2PD1A 2NREA 4A8SA 2EC2A 2Z2YB 3D6MB 1B0TA 4GVLA 2CDRB 2V34A 3SQGA 2IRYA 6FD1A 1T03A 2CZ4A 3M1VA 3G71S 3BV8A 3AJDA 3G6XA 4AL6A 5DG7A 2B8QA 3Q89A 4YOEA 2E7WA 3DLKB 1UEKA 3QT8A 3I5BA 2V8PA 3Q8QB 3OHBA 3OJUA 2ZHBA 5K5MA 3HT0A 5IT0A 4LRDA 1KWMA 3P45B 4LFAF 3GJRB 3LWMA 5L38A 2HVHA 2FVCA 5DRKA 5L9NA 4OYPA 3CNQP 1SC1B 2UXDJ 4E2FB 3I9ZA 2BX6A 4XDCA 2UUTA 4PG6A 3EICA 3CJ4A 1H7WA 2AZ3A 2RUGA 2XZTB 5A8KA 4M1KA 4ZLJA 4RW7A 2J8AA 2QLFB 4NA3A 4ANEA 2WSFC 1HD0A 4AXIA 4DPYA 5KG2A 4KRWA 2N82B 4CH0S 2B4OA 4A8KA 2FPHX 3D66A 3ZTSA 3OFGA 1C1BA 3LPEA 4HHHA 1X4BA 1Z2LA 4UF4A 4ZVEA 4C11B 4B9TA 2DR8A 1WOPA 2Z4PA 3C6UB 1J5EJ 1IKXA 1B4SA 1VQLS 3VGSA 5DLFA 2PI4A 2X1AA 3MM8B 3AOBA 5D78A 1FFGB 3JTOA 4DSKA 4KT0C 2C2RA 4Q0BB 2ZH8A 2RQMA 3V6DA 1QVFR 3R5JB 3QRRA 2BRLA 3G4SS 4I68A 2A10A 1RWXB 5G4DA 2MKCA 3D28A 1OS5A 4CLTA 4ZVOB 2FB0A 2OO4A 5M2UA 2CIMA 4JV1A 2FIUA 3NGSA 1WOOA 3LWLA 2B9YA 3PO5A 4IO9Q 1YJUA 4NZ7A 3ZZYA 1IKYA 1GNKA 3A1YG 3QGGA 3VZHA 2EPIA 2VFSA 2VC0A 2D7SA 2DNKA 5KFDA 1URRA 1PGZA 1Z2ZA 2W8LA 2HHVA 5T14A 2YKOA 4QOTA 4Q8FA 4OI2A 2MY8A 4ZA1A 3MAQA 5HO4A 4NLOA 5KFQA 4OX7A 2CYYA 4CNZA 1WORA 2EFQA 4A8WA 4D3GA 4YB7A 4MAKA 2EFOA 1PC4A 2CPEA 4PWWA 3MEEA 1D8YA 1WACA 3CD0A 1VHIA 3O2IA 2NSBA 4DL4A 2XNRA 1J5OA 2Y9HA 5H9FJ 3WIVA 5E3CA 4ZJLA 1WC3A 3PW2A 2F9JA 4LR7A 1N0UA 3CJ0A 4N41A 4Q8EA 3LGNA 1S57A 4DLGA 1U2FA 2R3VA 2GZOA 1FT8A 4L75A 1RTHA 1WSRA 1L3VA 2GGPB 1DBDA 3FDSA 3SFGA 1HL6A 3IO1A 4LF7J 1N34F 2IC3A 4JB8B 2HYIB 4DV5J 1RT1B 2FD2A 4DL3A 2JEJA 1T94A 4MFBB 5G0RB 2AJFE 2V8HA 5K9FA 5HQLA 5KT5A 2G2ZA 2WW8A 3GFZA 4DWIA 4DU8A 4JV5J 3KLIA 1YLXA 2BV3A 3T5LA 4URSA 1PAUB 3CJKA 1PCAA 2EBEA 3ISZA 3PJXA 3T9NA 3GONA 3VVUA 1FXLA 2H1YA 2K3IA 3MPVA 4PCQA 2Y1LB 2J9DE 3GG0A 3MEDA 5A8RA 3FMWA 1NZAA 2YKMB 1TMMA 3GSIA 1KFDA 1UAWA 2DGXA 2XSJB 4P7TA 4CTAB 4DV6J 2JHEA 3E3XA 4C6AA 1P6TA 1CPZA 2ZH1A 1GXLA 3ENAA 2YWHA 3I5CA 3P96A 4ZVRB 1GEHA 4EGLA 1GTHA 1SPBP 3MFIA 1U26A 3J81j 1FKAF 2A18A 3GB0A 3CDAA 2L08A 3NNCA 3RBXA 2R7RA 4USTA 2NLWA 2V68A 3DLBA 1MNEA 5LMNF 3R1HA 4F25A 1H2TZ 4UZBA 3S6EA 3Q8VA 4ID8A 1H2VZ 2OP5A 3KUHA 4IH6A 4K59A 4P2SA 1U1MA 1JX4A 1IBLJ 3DCAA 4LF8F 3MEKA 2HFSA 3CJKB 3PIOQ 3PZPA 5DETA 2B6AB 4NLPA 4ZVHA 2RIJA 4GKJF 4Y28C 3T5KA 3M30B 1YJWS 1IKVB 4FNHA 4LR8A 5C2GA 3HFZB 4I6YA 2IM2A 4PG5A 1D1UA 1BWEA 2AHOB 3W2VB 5E7OB 3MMAA 3G82B 3IR5B 1X4EA 2GVZA 3W7BA 4YB6A 2HHPA 1I5OB 3C16B 3R5DA 1S6QB 3AA8A 3JYTB 5DDRC 3DFEA 4QPXA 1RU2A 3DOLB 1NMEB 4Y65A 1B7YB 1UVKA 2E9TA 1RWPB 1IBMF 2RRNA 4DI6A 4DS4A 4PWDA 1S12A 2DHHA 4M5HA 5T7LA 2DEIA 3IRXA 5LJ3Y 2ATLA 4DSIA 4KTQA 3ZC4A 4KGXB 1VOMA 3TQ1A 1WF1A 2KFZA 1T05B 3DKDA 2UXCF 3NKYA 5DDQC 3CJQA 3TVZA 1T03B 2NXCA 1EZZB 2HVEA 2RDJA 3VAMA 2KL8A 2MKJA 2FVRA 2G1DA 1CC8A 1YJ7A 1WHWA 2I5JA 3K8VA 4QR0A 5B09A 2WAQD 4PXEA 1RWNB 1RTZA 4UOFA 4N5SA 1XMOF 3TW0A 3R6LB 2HK2A 3HSGA 3HKWA 4DL0C 4H4OA 2L41A 4DR4J 2DGTA 3MM6A 1H0HB 4I2QA 3NY0A 1WNEA 5AXMA 2W8KA 3QJLA 4KGVB 4I67A 1JLQB 3DNCA 1K44A 2OSRA 1JXEA 1T9TA 1U8WA 1F3VA 3QJJA 2YVSA 4BLGA 5C7PA 5CA5A 3V81B 4ZHRA 3UQSA 2KVIA 3QGPA 1IVZA 1TL4A 2DCUB 5IWAJ 4RBTA 2BJ9A 3OVSA 3TRGA 4DL2A 3UPFA 3KK2A 4DR5J 3BYRA 1HYSB 5AT1B 4M5DA 2XYHB 1QD1A 3FGVA 3R9LA 2ERRA 2Q1LA 1HA1A 4KO0B 1ZTTA 2HHHJ 1EHWA 1EB0A 1F6TA 1ZOTA 3VGUA 4ECYA 1S97A 1REVA 3RBDA 4JYAJ 1LQ9A 3SV3A 1QAXA 2CQBA 2KHDA 2LCWA 1RT4A 2LXIA 2AW0A 2QL5B 4YY3J 3V6DB 2AGOA 2R7OA 4NEYA 4LF9J 2XM3A 1NK5A 3MPWA 4KYZA 4LF4J 2M8HA 1CJTA 2YBVA 1E6YB 4NRTA 4F0KA 1B0PA 1VGYA 1WKJA 1OQ6A 2YKNB 5DS7A 1KRPA 2XHWA 3BREA 5HBMB 3NLCA 4YUDA 2KFNA 1U45A 2NYIA 4RW4A 1NK0A 2PA8D 3OTEA 2E1CA 3L95X 3KLVA 3RB4A 1XQIA 4IG3A 5FLXY 4AL7A 2W4PA 1DLOA 3Q22A 1UEVA 2XS2A 3CJ3A 4JI7J 3M4XA 3AXMA 5AXNA 4ZCKA 3QZ8A 3MTKA 3ZNUA 1N5QA 2QC3A 1B99A 1F5AA 2BM1A 1RTDA 2FJXA 2Z30B 1KNZA 5K14A 4K4ZA 4P7VA 2F8EX 2RU9A 2MLYA 1U1KA 1HWUA 3FQLA 1S10A 2O3DA 3EVWA 3KJVA 3C6TA 2IM3A 4EYHB 1VMBA 2YY3A 1K0VA 2HFZA 3GR1A 2V50A 4WP8A 4J91A 5KT7A 4QWCA 1PAEX 2AYMA 2YWEA 2C2ZB 2GAGC 1J2VA 1S4EA 2QYCA 3OR2A 4KFBA 4U7UD 3L7UA 2ROGA 2N7CA 4JI1J 4MTPA 1S4FA 5I3UA 1HQ2A 1VRUA 2KXNB 2WB1D 3I55S 3C3LA 3LP2B 3NRBA 5HQMA 4IR9A 3DLGA 2FC9A 5LXYA 1FJGJ 1HFEL 2OSQA 2I38A 2KB2A 1DQ9A 2FTRA 4YQWA 3GQCA 2G9OA 4QZVB 1R7IA 5FJ4A 4K2JA 4A48A 2VL1A 5KT2A 3TZWA 4FZVA 1S0OA 3FRZA 2W2OP 3TI0A 1NHKL 3CCTA 3A8EA 3PW4A 1HD1A 2IFXA 3V5RA 1AW0A 1Y0HA 4G1IA 1ZPVA 4DR1J 3LP1B 2IVMA 5L8RC 1S9EB 2Z2MA 3PEJA 5D0GA 4RNNA 1DTQA 1VQMS 3C46A 3B54A 4UUWA 4K4TA 1IKXB 1DQ8A 4ERDA 3NGTA 1QTNB 4LF9F 5BR8F 3UD5A 4YY3F 3T1HF 2CADA 4CO2A 2V8VA 2J5AA 4CYUB 4JYAF 1WEYA 5J2PA 4ES3A 4NLDA 4GVBA 1RE1B 4PXDA 2CJQA 4NLWA 4O3NA 1KEKA 2H4WB 4Q45A 1UFWA 3SXLA 3M2VA 3PVXA 2HNYB 2HURA 4DHVA 1FNOA 4G6VB 2LA4A 1FO1A 1LWEB 1FI4A 1UW4A 2BZ2A 2VB6A 2YWKA 3O6QA 3QIPA 2W9CA 3NNAA 2ZZMA 3UDVA 4ZLLA 1M1GA 1LW2A 1WELA 2KT2A 2R9LA 3M6UA 4LFBF 4IDKB 3D6TB 5IT9Y 4WE1B 3R7NB 1WKKA 3M8PA 3OUYB 4A8QA 2DHSA 4I56A 3IR6B 1T3NA 1YBAA 5JJBA 4CCHA 4IOCQ 3AY0A 3LP0A 4RW9B 3H42A 2MQMA 1OYEA 3BGRB 4YFUA 3CW2C 3JYTA 2UXBJ 1R31A 3O8WA 4F4WA 4B9VA 1KC8T 2P2CB 2R4FA 3POTB 2ZUAA 2E5HA 2QIFA 1WJ9A 5RUBA 2V69A 3OTDA 4OHXA 1EX8A 3V81A 3A12A 3PX4A 4RWWA 5L39A 1Q79A 3ET6B 1UA1A 1L3SA 1DY3A 3HD1A 5FD1A 2KZZA 2UUWA 2C2KB 2OELA 3CO0P 4W98A 3C14A 3KLEA 3SYZA 2FJWA 1GXTA 1SQFA 2B4VA 4ZN3A 5B0FA 1VRQC 4CM0A 3J80U 1BE4A 3R1LA 2JL9A 2RQKA 6FDRA 4TN2A 1IKVA 4UUXA 2EKYA 2RMLA 1XJWB 3HF5A 4FXVA 4FF3A 3FZBA 4X4PA 2CNOB 3D0IE 4DPUA 5DQGA 2H4YB 4ZVUB 2YKNA 3MEDB 5A8RB 5ADZA 4B3SF 2NQPA 4OYZA 3T19A 5HLFB 1WF2A 4Y3CA 4U95A 3TZZA 1URNA 1FVSA 5SUHA 1UWBB 2LXFA 4WFAQ 1UVMA 4IR1A 4P10A 3AJ1A 4LSZB 4CLPA 1JNZB 3EPGA 1FXDA 4A8OA 2F5GA 1VK3A 4PRFA 2HFNA 1YWXA 3CJTA 1NUEA 3SQOP 1Y9OA 1CQMA 3FJ2A 4FPIA 4LRBA 4F26A 3KK2B 1S49A 1FK9A 2AJ0A 3DMJA 1Q7YT 1EP4A 4LF8J 1HYSA 2OPPB 2VOOA 4KO0A 4NZ6A 4ANCA 1U1NA 2LU1A 3CTRA 4ECVA 4K4VA 3AB4B 3O3LA 2MKHA 2WVDA 4DDFA 5CABA 4CLWA 1VC6A 5J1NA 3OLBA 3J7A1 5DDOC 3JSMA 2GNKA 1XR6A 1RAFB 5GAGU 4E0DA 4L73A 2B5JA 4M5IA 4WK1A 4OLPA 4RNOA 2CJKA 2GHVC 4NLSA 4DPOA 5C24B 4DV6F 2NXJA 1W25A 2HLTA 3I0RA 3M32B 2ZM6J 1RSCA 4ED5A 2ZJQQ 4WFZA 2YNGB 1U1QA 1JWWA 1Z1ZA 2KN4A 2J6SA 4DV3F 4B3SJ 3MMCA 2AJ4A 3D67A 2DY9A 3ULHA 5HN0A 3MR7A 1JLCA 3DMJB 2ZUGA 3RR7A 4OZNA 2APOA 5ETQA 3LAMA 5L1KA 1YBUA 2YH0A 3IS9B 1M5SA 1SJFA 1R8BA 4YB5A 4ILMA 1KONA 1Q1KA 1OY9A 4NX9A 5A76A 2Y1JA 4F2SA 1P1LA 1WD6A 4DV5F 3PTWA 2AJQA 5LMUF 1NAQA 1M1KT 1H3DA 4MIBA 2KG1A 3MF5A 2BKOA 1AZSB 1T05A 1R27B 1HNIB 4ZVTB 5KTQA 2HSEB 1RBLA 2FLLA 3MZIA 2FJVA 3OFHA 3U7JA 1FFWB 1XTZA 2JLFA 2JJ4D 4P74A 4LQ9A 2QRRA 3UWTA 4DSFA 5I42A 4MKAA 3KK1A 4HLBA 4P9SA 5I3UB 4K4WA 2AYBA 2UXBF 3K59A 1N56A 5E3PA 2ZE2B 3BKTA 5E3AA 2BQRA 1CBKA 3QNWB 2I6WA 1U1LA 2B43A 2J9DA 2Y0SD 4TKTA 1OQ3A 2LQ5A 4CLKA 2Q3PA 1PILA 2MY7A 4LFBJ 2MYFA 4WP9A 1IKWB 2MZJA 3H2LA 3M6VA 4LMZA 3HVWA 3KWMA 4N7TA 4PG8A 1N5YA 2KT3A 4J9OA 2DRDA 2YPYA 4FYYB 2RF2A 1S1TB 1Q4RA 1U7LA 3EGVA 3KUGA 5KFVA 2AYEA 1HW9A 2H65B 4AE5A 4DV4F 1HMVA 3JSRA 4F4ZA 4EBEA 1NKCA 2BKPA 2WSEC 2ZHOA 2AP6A 4OX9F 2WW4A 1TFYA 2ZKUA 4J9LA 2DYAA 1EJ7L 1OSCA 2ZNYA 1FRMA 2BKNA 4CO0A 4F67A 4A47A 3Q23A 4DV7F 1F2HA 1RCOB 1HWIA 4KFBB 4DBQA 3BBCA 2O1PA 5KT4A 2IMWP 4UOCA 2R7VA 4WKRA 1OYDA 2JH3A 4RU9A 2ZKTA 5ETLA 4RZRA 2QA2A 4K2XA 2R2UA 1IKYB 1R0CB 4ED1A 2DKOB 2I0XA 3LTOA 3KFWX 3JAMY 1WDTA 2MTLA 3ICLA 1ZZNA 1HNVA 1XIQA 1Y4ZB 4DR1F 3G9CA 2UUCJ 3KLIB 2CPXA 2KM8B 4EU0A 1S5ZA 4R8UB 4N8OA 2HKEA 5DGBA 4K0KJ 4J5OA 2ZBPA 4IKAA 3UN2A 1QAIA 1RABB 3K89A 4ZPVR 4AYBD 4LFCF 4QW9A 3THPA 1TAUA 2UU9F 3RRKA 1YI2S 1FDNA 1X60A 3TANA 2OMLA 2E7VA 2DIVA 3HFKA 3JQJA 2GIFA 3QWPA 4LFAJ 2V8GA 5J2MA 3KOAA 1HBUB 2EK6A 2ZDPA 3CMQA 3R3TA 2IM0A 2NXEA 3GE9A 4O4RA 2DH9A 2YNHB 5T41A 3ZTPA 2XLJA 1OPIA 2MKSA 4OYMA 3MDFA 2IJFA 3L7PA 4CLFA 3Q86A 1RYSA 2DRAA 3BF4A 1KTQA 2YH1A 3E51A 4L74A 2GV1A 4P2FA 1LXJA 5AE2A 3JAMU 4ZVSB 3PR5B 5AE3A 2B56A 1RUSA 2E44A 2K8GA 3N6LA 2MKKA 1WG4A 3OL8A 1KP6A 3AB2B 3EXCX 3QZ7A 3BSNA 3HHNB 3CD5A 4WZMA 4NYZA 1FJCA 2LEPA 1HNZJ 1CJVB 4FN5A 1VC5A 3CB4A 2CG8A 3C15B 2DHAA 1Q5VA 5F3TA 3VCDA 2OFGX 4OI1A 4ED4A 5D3GA 2YX4A 4JBCA 1B64A 2LQ8A 1DJ0A 1RWOB 1F9EB 3UN5A 2JEFA 3ILJA 1KTVA 4ZLPA 5AE1A 4USIA 2RKIB 3HULA 2L48A 3FVYA 5KFOA 2GVZB 2K7JA 5KFFA 4MK9A 5CCMA 1XK8A 5KFWA 4ECQA 2SXLA 2UUBJ 1U49A 3CCQS 2VJVA 5A0YB 2RDIA 4HL9A 1BHNA 4MK8A 2DNPA 4M5LA 4BWMA 2OIHA 4LF4F 4ZITA 1U4BA 2V67A 2FQQB 3MURP 3NBPB 2E66A 2OPRA 1BQNA 3HHLD 4KE5A 2P8IA 2MEWA 3SDEB 1N6QA 2MQOA 3X1LB 2MQ8A 3Q8UA 2VA3A 4WZQA 3S1TA 2HHHF 3N4WA 2F7VA 1IR0A 3T1YJ 1VFJA 3ILLA 5AJ3J 4ED3A 4G3IA 3J7ZT 1SQGA 1SJ1A 2VIHA 3UDLA 1PJ6A 1WHYA 2FGOA 3I4HX 3E01B 4FNIA 5D8HB 2AF6A 2B7CB 2I5JB 4BC9A 3HVAA 2K1RB 4QJVA 1S1UB 2RDDA 4DUZJ 4ZVFA 2ZH3A 2YKMA 2QO3A 1A0OB 2EG1A 2GVDA 1NO8A 5B0AA 2CUYA 4CO3A 2C3YA 2VUGA 2KH9A 4AL5A 3G8SA 2G13A 2ZC4A 1TQLA 5ETRA 1I94F 4KHRA 2KXFA 2ZBIA 3DOKA 4PG4A 3SIPB 2J0QD 2HNDA 1FEEA 3PKMA 1YITS 1WTFA 3CDBA 2WTFA 4KY3A 1X4HA 5IV3A 1SVDA 4OZJA 3B8HA 4OFZA 2Z58B 3RGIA 2A3JA 1N5YB 1KHVA 2VG7B 1V5IB 2XMWA 4YP3A 2RF2B 2QV6A 1O5JA 2OHDA 3CJ8A 3RAXA 1EIYB 1IBKF 3E8OA 2HMIB 3MAHA 4QIGA 5D77A 2JNJA 3QSIA 4J7CA 4DLEA 4KBIA 5KG0A 4ICLB 2LMIA 4ED2A 5CYQB 1IM4A 5HMXA 3GJSB 1LKZA 3KK1B 1HBMA 4OJGA 4I2QB 4DQRA 2GQQA 1LV5A 4M94A 4DXLA 2XQCA 2ZZTA 3S7RA 2YWWA 3D1OA 3OJSA 4M5GA 3RW7A 5KFRA 1W26A 1X4GA 2M2BA 4DX6A 4DL5A 2RILA 1CQNA 3BH6B 1NK4A 1CVJA 4DR7J 3IS9A 2GCFA 3Q2TC 3R2DJ 1SC3B 4G65A 2ZZNA 3T1AA 3GV5B 2J0XA 2FHJA 3DRSA 1JKHB 4DEZA 4X4NA 3UCZP 2BR0A 3SMZA 4F3MA 4F4KA 1SQEA 3NNHA 2RHSB 1IBLF 4OZ2A 4IUFA 1HNIA 5HI7A 2CA9A 1S9FA 1VRTB 5D6GA 2CXEA 3HHEA 1YK9A 3HZEA 1R8HA 3SZ2A 2FHKA 2LFVA 2A2DA 3LF0A 4QQBA 4UQGA 3JSMB 2NR0A 4KJIA 2C3UA 3V4IA 3CCWA 3MWBA 2XMKA 3QT5A 4O0NA 3NEKA 4DUYF 1UVLA 3D3CJ 4ETXA 1EARA 3CGIA 3N9UC 2XY7A 3JB9k 1XEZA 1RT5A 3QRPA 4CT8A 2HQIA 2HEKA 4RX6A 1KLMA 5DZ6A 5L1LA 3MPUB 1ELOA 1DLOB 2QG9B 5EX0A 1IQZA 2RUSA 3V6JA 2VD3A 1JXVA 2Q43A 3EDQB 3N5FA 3W2WB 2AMCB 1YZ7A 4NPOA 1ZAXA 4WTYA 4CZCA 3CD6S 1GMVA 1FX2A 1M5VC 4DG1B 4JV5F 5E0OA 3CWJA 3I56S 3X3UA 2HNZA 3NCQA 3G2XA 4JI6F 3H7HB 3W64A 1AZSA 4NLGA 1N34J 2BEFA 4ZVPB 1FRKA 4JI4F 5DG8A 4LF7F 5ITHA 1C4AA 1FF2A 4P52A 1HARA 3OR1B 4QYZJ 2JWNA 3IXQA 5HMZA 5ETTA 1MMLA 2MGZB 1EKSA 4NCGA 3W66A 2HHUA 1MW7A 2W2NP 4CI0B 1U1OA 1NKEA 3R5GA 3T3FA 1S48A 1NSAA 2J9CA 4UZCA 1B3TA 2DPIA 2AX1A 2GAHC 2GMLA 4X4TA 2FZCB 5CYMB 2A6MA 4X2BA 2GMHA 4BHQA 2UVWA 3U02A 1NSQA 2P9CA 3ENWA 1QAJA 2Y3YA 4Q2LA 5HJXA 4DG1A 1VQ5S 1GTEA 4FYDA 5HK4A 1VHFA 1NPPA 2DNLA 2XHCA 2FLOA 1C1CB 2ZC3A 3DXSX 3MAAB 1N5VA 3DRXA 3T41A 4C98A 3KLHB 4OI4A 2DNRA 4RWXA 4ZP8A 3KHLA 3CCUS 1XMQF 2R8KA 1FTCA 2LU2A 3BGUA 3H20A 4P72A 1RT2A 3LP1A 5KFZA 3BGFA 1Q95G 4OYAA 2YQ1A 1TELA 4UOGA 3WC0A 1S1WA 1U48A 9RUBA 2AKWB 3CC4S 4CH1A 3TA0A 1HW8A 1VDHA 2EI5A 4DR6J 4ZPCA 1TL1A 1JJ4A 2GGPA 1RT3A 1RHUB 2ZITA 3EZ5A 2VV5A 1HR0J 1JLAB 3DN9A 3IM9A 2VKZG 3W5XA 5D4OA 1OO0B 5FDLA 2ZD1A 3CEDA 3RAMA 1GX6A 3LP2A 2XS5A 5KG5A 1G4CA 1LNQA 4QU7A 2OLWA 3EXYA 2W9CB 1GK8A 1FESA 1SV5B 1X4FA 1S6UA 4HACB 1LWEA 2VG7A 1RZMA 2QGFB 3QPIA 1LWFB 2R2RA 4JI5F 5IFMA 1OMSA 4RNMA 4WE1A 1M5HA 1SI9A 2ACMA 1QSYA 1LW0A 2GO8A 3RRGA 4DV1F 2YQ0A 3RW6A 4JV0A 3M9MB 4C8OA 1WUUA 2FDNA 3JSYA 2W2MP 3QT7A 4I1TA 3TVYA 5K8PA 4X65J 2KKHA 2JX2A 4Z7YA 1GH8A 1PKUA 2H3EB 1U2RA 3QO9A 5J1EB 2DNYA 3VWSA 5A2QY 3GFXA 5J2MB 3M8QA 3PRDA 2BJ7A 2FLNA 2QMXA 5FDLB 1CS4B 1H74A 2HQCA 2R7UA 4A8MP 3LAKA 2W2QP 4R0JA 1C0UA 3EUNA 1BC6A 1HNWF 3MM5A 1BLUA 2W2PP 3P5BP 4HKQA 5D4LA 1IXKA 1Q16B 1ZM2A 3W5ZA 5DDPC 1RBAA 3I0SA 1LFWA 4IOAQ 4OJ3A 2CNLB 4ZDNA 3DGPB 3QWUA 3V6HA 1R6VA 4RUHA 2R8IA 1E6VB 3LPYA 2KU7A 1MROA 4I7FA 5DM7Q 2PSZA 1XERA 4ZCIA 4TYAA 1NB2A 3KTQA 3GYXB 4OJ1A 1LEOA 5D3GB 3K5NA 1SJ3P 4LVOP 2XI3A 2WBMA 3ZZZA 1N32J 3H25A 4DQSA 3GV7B 3OL6A 1ZYQA 1NK6A 1WC0A 1FWKA 1TL5A 2KDOA 5U47A 2FHJD 3ZZOA 3TAPA 4B3OB 3DOLA 1UWBA 2F4FA 3W65A 5JMNA 3OTOF 3CF5Q 2CRLA 4B9UA 2Z57B 3PRBA 2CQ0A 2JZ5A 4QU6A 2F8HA 2ZBCA 3I0SB 4HVZA 2OMOA 3EPIA 2MLXA 2W4DA 5E2QA 1MWQA 2EWHA 4KR0B 1SKRA 1E6VA 3QQCD 2PIIA 3TJ9A 1PYTA 4LF6F 2CG4A 4LVNP 1VQ9S 3EMTA 4MKBA 3M8SA 3HHLA 4Q2MA 1P27B 1P1TA 2DNMA 4FKYA 4I2PA 2WCXA 4YEAA 4J9KA 1V3ZA 5IQ6A 3RTVA 2JDJA 3M8WA 1SUQB 1WI8A 2FLPA 2YXLA 3QATA 3C6UA 4C4WA 3IC1A 2XMUA 1BGXT 3F41A 4QR2A 2HGNA 2NPIA 4HH1A 2HRTA 1D3WA 2D3ZA 2YKAA 1SBRA 2XGPA 2KJWA 2GW8A 2CPJA 5C24A 4LRAA 3W61A 5KFHA 2QSFA 2RU3A 1H98A 3U1MA 4B3TJ 2MDAA 4BC7A 3FUYA 1CSJA 1JQGA 1KDNA 4R5PB 2ROPA 2DR9A 2DHGA 4WWSA 4J37A 3CVKA 3VR1A 4OI0A 4HHJA 4B3TF 1AT1B 5ETKA 1U1PA 1QAYA 2DISA 1YTYA 4KSEB 3GLJA 3G8TA 4X4SA 5F9LA 1F0XA 3H98A 2GC8A 4OIXA 1VC0A 4GKKF 2Q6BA 4PQUA 4PYAA 1BD6A 5A8KB 1YGYA 2J7KA 3GFHA 2XMJA 3MAAA 2PN6A 5CYQA 1RT6B 1RT7A 2LLZA 3TJAA 2ZH9A 3NL0A 4OHWA 2V4QA 1HQUB 3H2UB 4FXWA 3NGDA 3T5JA 3R7BB 4ZJOA 2AGQA 4WXOA 1YX2A 3LO3A 1EQ0A 4OYIA 1CJUA 4EZ9A 2W9BA 3P49B 3BKUA 3FBEA 1S1WB 4WBFA 4ZVGA 3MUTP 3A13A 4O3RA 1GMUA 1NJYA 3BO2A 4JI0J 1DTTA 3BB5A 1GXUA 1IQTA 4NE9C 4O3QA 3BSOA 1IWGA 3MR5A 4QWBA 3TNVA 3NXZA 2F65A 1TL7A 3HDSA 1HBOB 3MMBB 5HVGA 2XO6A 4QIEA 1UJ4A 3ZO7A 2XULA 2CQ4A 3P8BB 1K0TA 4EYIB 4U7CA 2VF3A 6AT1B 5GAEI 1HBMB 2VG5A 1H7XA 2IPOB 2MSSA 1V6HA 3NAIA 2B3TB 2D69A 2IC3B 3PJWA 5CYMA 3J81U 4TU7A 1VQSA 2HHSA 1ROFA 1KLMB 2VQEJ 4R8UA 1IKWA 5HJYA 3HVRA 3TUIC 3U1NA 4DCPB 3M8ZA 4YMEA 5IM0B 3BQ1A 4LIWA 5CXTA 4GO5X 1A9NB 5DGAA 2M3DA 3K5OA 4LSNA 3OVBA 5A2QU 1N5TA 2D3OR 4KH1B 2FUG9 1RAIB 2DNGA 1N88A 3ZZTA 4PKDB 4C48A 3CIMA 2L9NA 2MB0B 4DQIA 2HWHA 2OGUA 2JRSA 2V9KA 1RAJA 3FFIA 3JTPA 4C97A 4JI8J 2X3GA 1RAHB 2FGCA 4QYZK 2HIQA 4TY8B 1KHWA 1UPMB 4OZLA 3D2WA 2ZHAA 3Q8PB 1O51A 2CQPA 3CJ2A 4DSEA 4H4MB 1S6OA 1GQEA 1PG5B 1UTAA 2VHGA 2Q66A 3BS9A 4DV0J 5A6PA 1S0MA 1DRZA 4FF2A 2BJDA 1R6YA 3WQPA 3PYEA 3KNAA 4YHHF 3EX7B 3QAUA 2IVYA 3PV8A 4LSNB 1WG5A 2YNFB 1ACMB 4LF6J 4EFAC 5K14B 3B4DA 2GX8A 4LREA 2XLKA 3TX8A 1DQAA 3BGLA 3IG1B 3PYFA 1BY9A 2GO9A 5B0CA 1WEZA 4LBHA 1DTQB 1PYSB 1U0HB 4NLTA 3W5YA 5J2QA 3NMAA 2JEIA 1FERA 2OPSA 3L09A 1KQGB 2FHMA 4MT1A 3W2VA 3BPSP 3K0JA 2GMJA 3I4PA 4CYUA 3QFHA 3AODA 1T9VA 1U24A 1PIEA 2A1BA 4AXJA 4FBUA 4F4YA 2AGPA 3AAWB 3KXDA 1J5OB 2QTWA 1U2CA 4J9NA 2F40A 4EO6A 3WHIA 1JLBA 3FEYB 3GZ7A 3ZFVA 4I0WA 1X5SA 3NS6A 1T8EA 2UZAA 3H5XA 4WYWA 2W7AA 2YNFA 2HHQA 4KKOA 5KG7A 1OPZA 1ULRA 3IRXB 3NS7B 3TA1A 2HBZB 3LGHA 1TL3A 4Q5VA 5HVHA 1RWUA 3MUVP 4O44A 3D0GE 3PYDA 2DK2A 5DJBA 3BO4A 1NJXA 1Y5LB 1Q8BA 2LEBA 4BBYA 2BACA 5L1IA 2MZSA 3SSRA 1T7PA 2C2MB 2F9DA 1IWAA 5KFNA 1RHJB 4FF1A 3OHAA 2LQBA 2VBWA 2W7OA 1RK8A 4ELVA 3T5HA 1YJ9S 4Z2XA 4CH7A 2BJ8A 1VJQA 4QPTA 4WIQA 2KZMA 4HTIA 1RHRB 4NEZA 4NOHA 5F9NA 1T95A 1RQ0A 1CEZA 1UP1A 2JC0A 4C2MA 5MLCV 4WK3A 1FKOB 3N28A 1HBUA 1R0BG 1TUWA 2R2SA 1VLOA 2R8JA 2NXNA 5J2PB 3MFHA 4YR2A 3BM7A 1G7CB 1YQHA 1F3FA 3IA0A 4RR5A 2FYXA 2KYXA 1RISA 1CS4A 2M88A 2OAUA 2V4JA 3ET6A 4LRCA 3AD8C 5CH7B 4LF5F 2IY5B 4JI4J 2EK1A 1ZTWA 1SJRA 4XAKA 1YRTA 2ZJRQ 2QA1A 3TUZC 3NBPA 2XSFA 2WONA 3LOUA 4NL5A 4JI5J 3PW0A 4F3QA 3PY8A 1TP7A 1U02A 2CJAA 4K50A 3W1YC 3IAS9 2R8HA 1FDBA 3HLUA 1RAAB 4USJC 2E1RA 3MECB 2R7TA 3MTJA 1SKUB 4LJMA 2BJEA 4MYTA 3BBFA 1HR0F 4FBTA 3B78A 4DSLA 1Q78A 2HFUA 1UJ6A 2K1RA 2OFHX 2C2NA 4GC6A 2IAJA 3WZ0A 1NJZA 4QBUA 4DR6F 4CO4A 2DGWA 2XS7A 4DUYJ 5F8HA 1U8SA 2MZRA 3AJ2A 5A6WA 2K7KA 2KVQE 4BWJA 2HNDB 1S6QA 2QMWA 3RU0A 4Y2MA 3QSYB 2CQCA 1C0TA 2RJZA 4G1QB 5C2CA 2BDPA 3HMJG 4RPFA 1WC1A 1XMQJ 2DRBA 4CLSA 3EE3A 3I96A 3WBZA 5IT4A 1SJ4P 2HS3A 4X4UA 1U09A 4MK7A 4NASA 1DFDA 1GX5A 3IWNC 5HATA 1VQ8S 3T9ZA 3FMBA 3ZZRA 4EEYA 1N6QB 2IA6A 3R2CJ 4Q44A 2MQPA 1JB0C 5EWFA 2KHCA 3M6XA 4OYXA 5IC6B 4DFJA 2HMIA 4NXMF 4DF8A 4OHZA 1FRHA 4ZIWA 3CCRS 4F02A 3HHDA 5EWEA 2E5IA 1M5KC 2LVWA 5D15A 3MHYA 3TUJC 4DFKA 1XNRJ 1DTTB 2D3UA 2LYVA 1NDCA 4NYPA 2MJNA 1IM6A 4NRUA 5KFXA 2KTQA 1PJ7A 1TL7B 2YTCA 2QLJB 3WC2A 3TZYA 4JI6J 1VRUB 3D54A 3W8PA 4F36A 3MM9B 2EBGA 1KQSR 4NA1A 2FVSA 3HK2A 3CO9A 1Q0NA 3GCXP 1NZ8A 3PYGA 2RS2A 1G1XA 1CC7A 3HCXA 2OD4A 4NLUA 1RTJA 2HQ3A 1H73A 1FKPA 3K5PA 3QAEA 1WDDA 4KPCA 4CO5A 3RB3A 1NBEB 2EFPA 4ZLNA 3NAHA 1SL0A 3CMAS 4ZHRB 1U6ZA 2POKA 3M2RA 3N6MA 4UTGA 3GIKA 2HNZB 2E5JA 3W63A 3JQKA 1QSLA 2ZWPA 2R42A 3GG1A 1FA0A 2IYGA 2O5DA 2D9PA 3M1VB 2VQFF 4X4OA 3KJVB 3FCHA 5IT9U 1ZZFA 1OY8A 3ONQA 2JEGA 4N77A 1AYEA 3A3NB 2KT5A 2RB7A 2ZE2A 3GYGA 2BOAA 2NUUG 2FHOB 3OR2B 5KFGA 2DTJA 2IDLA 3MMBA 3M7VA 2XO7A 1RT5B 3NGRA 4PYDA 2CPFA 1YIJS 1JJHA 2AV5A 2DO0A 3MEGB 1R3NA 1N8RT 1JJCB 3UI3A 1I6JA 4DR7F 1JXLA 3CCZA 4B9SA 1C1CA 2BE7D 5BYRA 1B70B 2XEXA 3NGUA 1QLNA 2YWGA 2WVBA 3KG1A 5B0GA 1U47A 1YJNS 1XMBA 1HQUA 5AXKA 2C3MA 4Y00A 2DCLA 2ZVSA 3OUYA 1WTBA 2M52A 4ID5A 2AYGA 4ELUA 4OZ3A 3M8YA 4ZJQA 3QIDA 1P8GA 2JVRA 2VPWB 3OR1A 4ES2A 3KG0A 2MGZA 2W25A 2OPQA 2N3OA 1VBZA 3MI7X 3BN4A 4UOHA 5HAOA 2XGQA 1U0SA 1YVFA 2O01C 3FEXB 1JLAA 4RBUA 4QIVA 2DH8A 2ZD1B 1VJWA 3PX0A 3DU5A 4CLZA 1L5UA 4GVBB 2CPHA 1RP5A 2IM1A 5GADU 4PG7A 7AT1B 3DI6B 3H90A 1KR4A 1VK8A 3KLHA 2KXHA 2CJXB 1SC4B 2HZCA 1TV6A 1TVRA 3Q2SC 2O67A 1M1HA 2ZBRA 1HWKA 1R8AA 1C4CA 1F60B 2G1HA 2G2YA 4LBIA 4LR9A 4X4QA 2RQCA 2GJIA 2MXYA 4EBDA 2UVRA 3M05A 1KVJA 2Y1IA 1HNZF 1BWVA 5IS2A 1U0HA 4WIIA 3AD7C 5J1PA 1TKZB 5LT5A 4ZIVA 1X5OA 4FKXA 1HWJA 1NPKA 2CQHA 2H9ZA 2Z8QA 4USHA 1S1VA 3ZTRA 1NHUA 3MGJA 2BOPA 2D74B 2F63A 3JQMA 3VF0B 3MR3A 4AQYF 3RAQA 4A8XA 4WTOB 4AT1B 4DUZF 3BQ0A 1B7FA 1S1XB 2JLGA 1D9FA 4B9NA 1FWLA 5HVFA 5IQQA 4K4UA 3FZ2A 3K58A 4ALZA 3N01A 3POTA 2OTLS 2VFUA 3GP9A 1SV5A 3FRYA 2B51A 1RHKB 4USWA 1X9SA 5AJ3F 4USUA 4KKOB 2XLIA 3T1YF 2ASLA 2E9ZA 3AOCA 3I6PA 1UZDA 2UU9J 4LFCJ 1WG1A 1FK9B 5G0RA 7FD1A 1S59A 1RXOB 5E33A 1A7GE 2VZ9A 4K0KF 2YKQA 3D4JA 1UCNA 5J2NA 1FNXH 2MKIA 4UW2A 4L6V3 1S1VB 3ZZ0A 3EYZA 1XR7A 1JLGB 2PA3A 2WRMA 4L3NA 5GVQA 1FEHA 1ZM4A 2BRKA 3MMAB 3IWLA 2OPSB 3MXHP 1PC5A 2B5JB 4K4XA 1TTHB 4ED8A 3C2PA 2CQIA 2VPYB 5FLXU 4UY85 5H9FK 2ZJPQ 1PBAA 1RB0A 5KFEA 3CT9A 4DV7J 1TL1B 1BMQB 1WC6A 2M4MA 2PMHA 2VBXA 1UEUA 2XZWA 3P3DA 3NOCA 3Q8YA 1JLFA 4KIAA 4O4GB 3OL7A 4ECUA 1RU1A 1R43A 2WK4A 3H8YA 4FDFA 1X9WA 2E29A 4DV4J 3HX9A 1HHSA 1EQMA 2M9KA 1S6PB 2D1CA 1NK7A 1MMDA 3UW1A 4RW8B 3GIJA 1SIZA 3OBIA 1RCXB 3K8WA 4QWAA 1TZ0A 1SJQA 3DLEA 4LF2A 1VI7A 3KUEA 3BDPA 1LXNA 3BGOP 1RWMB 4K7QA 2HPUA 4P71A 4ZP7A 2BQUA 5D0RA 3MOZA 3DGVA 2NPFA 1RKJA 2DXFA 2A2CA 3DU6A 2HW3A 1WEXA 1YZ6A 2MLZA 1PBUA 2V5HG 3MCNA 4LUBA 2NUHA 4RL1A 3UR3C 3DHWC 3W8GA 3M6WA 4ER8A 3MD3A 4IYQA 2NZCA 4WYLA 5LSOA 2B9XA 1MU2B 2ZH4A 2R7WA 2PEBA 3G6ES 3FEZA 2KJVA 3NCPA 4DJBA 3VAHA 4O3SA 3UNGC 3IBFB 2OPRB 3SDEA 2QEXS 1CJKB 1M90T 1RACB 4IH5A 1D9DA 1FWPA 3MM5B 2Z0GA 2M0GB 3D9BA 3H2VE 4C8NA 1WI6A 3L4BC 1NJWA 4I2PB 2UUCF 4IQXA 3K17A 1UPPA 1Y00A 4NYOA 1IN0A 4HDHA 3G6YA 2QMUB 2RVJA 4XO0A 3CC2S 4JUZA 3PCOB 5LMUJ 3VV2B 2UUAJ 4KB7A 3H4BA 5C42A 4JI2J 1SUQA 3N0VA 2W9BB 3EJMA 2RHQB 4XK8C 4C0BA 2OKQA 2AU0A 4IQMA 3VTIA 5F8LA 1CJTB 3M2UB 4X4RA 3N5BA 4DV3J 4OX9J 2Z2ZA 3ISND 3IRWP 3D1QA 2DXEA 5KFIA 2CFXA 3GIMA 2DVIA 1UKUA 4B3OA 2VOPA 2W4CA 3Q83A 1SB6A 2XI2A 1Q8KA 5DM6Q 2I2YA 3RG6A 2HGLA 4DN9A 2PGCA 4B17A 1WKLA 1T9YA 3HVTA 3OLAA 4ANDA 1IR1A 3W9IA 1FXRA 2HAFA 4HT5A 1EKRA 1RT7B 1RTJB 3G6VA 2WZ1A 3NCRA 1TKDA 4KHPF 2YPZA 3Q24A 4NMLA 2VFRA 5F0UA 3A3OB 5DZ7A 3TARA 2HS4A 4HTJA 2IRUA 4F8RA 1UFLA 4Q0BA 1ZS6A 1QY7A 2DO4A 3LW5C 4K4SA 2CQDA 2FJEB 1GAOA 1NM2A 1RADB 2EKNA 2EFNA 3GSDA 3I32A 1F5BA 2KYZA 4H4KA 4HI2A 4ICLA 3VZIA 2YNHA 1HBOA 2D41A 2I9SA 2CJYB 1IBCB 4J9RA 4DR3J 4WP3A 2VKRA 3VHQA 5F8MA 1O8BA 1RAEB 1F5CA 2CPYA 2Z56B 2AEMA 3CCES 4JI3F 2X51A 4YDDB 1HI1A 4J90A 1WF0A 2W1BA 4ZPBA 3ZTQA 4FYWB 3IM8A 4CLLA 1X4CA 2E5LJ 3LGMA 4CRJA 2DJWA 3F0NA 2VG5B 4MJKA 4B3MF 2XMTA 3T6JA 5HP1A 3UD3P 1NSPA 3UDEA 5E3RA 3K5LA 5HMWA 3JTNA 2NCKL 3G8QA 4U8VA 4ECSA 3WDOA 2VICA 2HZVA 3UCUP 1HNVB 2Z2LA 2N7YA 3RYLA 4DPTA 1JKHA 1RT6A 1ZBTA 2EVZA 5J2NB 4DCJB 3R6GB 4F4AA 2H5EA 2HWIA 1KVIA 1T9UA 4J9UE 2KM8C 1N36J 1M5OC 2VDHA 3RRHA 4NZ0A 3CJRA 2ZM6F 3C6TB 1CJUB 2ATCB 5KG6A 2AX0A 2CNKB 3BZQA 1L3KA 3DLKA 2G0IA 5H1SV 1RHQB 1S1TA 2VG6B 2ZWOA 3DYAA 4TY8A 3SSQA 1Q86T 5F8JA 4NCGB 3BR9A 3FFIB 1HWLA 3MPDA 5D4NA 3VGTA 3UE2A 4I69A 2VDIA 2AD9A 3IBCB 4PEOA 1BUXA 2CPZA 3ENVA 2QLBB 5HP1B 3J81Y 3VALA 1TK8A 1AUSL 5C25B 3EDRB 3UN3A 4PUOB 1H2UX 1M0SA 4IFYA 2NXUA 4DX5A 5E41A 4ED7A 1VQKS 3M2VB 4K5SA 2M7SA 3TAQA 4KHPJ 4OI3A 4IG0A 3PW7A 3RB0A 3FNNA 1YBTA 1KOHA 2AIRB 1YRXA 2CJBA 3RJMB 2C2EA 2R7XA 3AQOA 1M5PC 3KK3A 3KLGA 4ZVQB 3CPWR 5B0DA 3D7SB 4I6WA 2IMOA 3BGRA 4J9VA 2VC1A 2LEAA 3LP0B 2BE2B 3THVA 3BPDA 5CQGA 4PUOA 5C25A 4MKYA 5JXSA 3T1HJ 1TR0A 4OZ0A 4C8MA 1TKTB 2HRUA 5BR8J 2ZH5A 2YX1A 2XY5A 1CJKA 5AXLA 4NLXA 2CWKA 2JOQA 4JI2F 3VQTA 4N47A 5IZHA 3OW2R 4M95A 2DHXA 1FFSB 3D6HB 3JXOA 3PDNA 4DFMA 4TXSA 2E9RX 1GMWA 4OX8A 3QIPB 2B7BB 3F56A 4S0MA 2VODA 2XMAA 4C8ZA 1LW0B 4CO1A 4CIOA 2L3MA 2AJ1A 5GMDA 3RUBL 4B08A 4OMFG 4X84A 1RT2B 3C15A 1K47A 4NA2A 1VQ7S 5E5NA 1SC6A 1I51B 3HSZA 4LT6A 3TEGA 3I5AA 4ZS6A 5GAHI 1O0PA 2RE1A 2QSWA 5KFCA 1VR6A 2E7XA 1TKZA 4DV2J 3HPOA 1XNQF 4JI1F 1NRKA 2G4BA 1NU4A 1BQMB 1FRIA 3TEHB 3GU0A 4PABA 4F4XA 4IRKA 5C5JA 2W9AA 1WHXA 2WHOA 2DNHA 2N4CA 3KMSA 1FVQA 2BW7A 2WOMB 2XC9A 2QN6B 9ATCB 1RWVB 1X31C 3C19A 2PMZD 4NXNF 2OPPA 1X7VA 4AFFA 2GIRA 5KAKA 2BANA 1EP4B 3TP2A 2EW9A 4O44B 4HHUA 4XPCA 4RW8A 1Z4UA 2QE5A 3K57A 4WXWA 3PNIA 2KRRA 2DR7A 2QL9B 5F8NA 4R0EA 4DQQA 4JI7F 4ZPTR 2J0WA 3OTCA 4EI2A 1CG2A 3G82A 2D3O1 3SI8A 3AD9C 3GR0A 5HROA 3KJQB 4ZOSA 3M2UA 4QWEA 4B9MA 4ZMMA 1CULA 3G96A 2ZDOA 4OI6A 2OEMA 2PC6A 2QA4S 2BM0A 1VYAA 2VPZB 1XC9A 1W7WA 2HBRB 3MM9A 3HSJA 1X5PA 3ISNC 5D0HA 2YNGA 4P75A 1JLCB 2RQ4A 4ZCLA 5HSPA 4RUAA 2CNNB 3GTYX 2OEJA 1APSA 3MMCB 2V4JB 3QYYA 2R7SA 4KGKA 2KI2A 4FS1A 3FSIA 1S72S 5ETVA 1KSPA 4O4GA 3GPAA 2ZNZA 1N4LA 1FRJA 1QM9A 4TU9A 4A8FA 4QWDA 2HFVA 2K3KA 2WONB 1W2IA 2XZDB 7FDRA 3CDEA 1K9MT 3DLLQ 1FJGF 1C1BB 2QT7A 4DR5F 2VPXB 5HROB 2KG0A 1K1QA 3KDOA 4LBPA 2UVUA 5KFSA 2CPIA 4C11A 3CDUA 3DRSB 1QJHA 3ETMA 4OZ1A 3OVAA 4ZPAA 3Q8RB 1V9OA 2CZ9A 2VH7A 1VQ4S 2Y8YA 2W01A 2E1MC 1FRLA 4OLOA 4WU2A 4OV1A 1U25A 2V63A 3D1HA 1S7HA 3NOGA 4RW4B 1IJFB 4ELTA 5ETPA 4KV8A 4W90B 2F8MA 3CE8A 2ZOFA 2ZH2A 4DR4F 2IYIA 4RUCA 4OJHA 4DV2F 4GRSA 1XNQJ 3MCSA 3T6BA 4XDDA 4HYKA 1QE1B 1W2BR 4D3HA 1S0VA 1HI8A 5EWGA 1XMOJ 1A6LA 2HQDA 2CQ3A 3MEGA 4OYOA 3CIZA 1PSDA 2X1FA 3HO1A 2AJ2A 3EZUA 3ITHB 4I4BA 3BH7B 3BSAA 1I3OB 1LK7A 2QL7B 4YR3A 2UXCJ 3W2WA 1T9XA 4L72B 4WPAA 1S76D 3QLHB 4M5JA 2DH7A 4OHYA 3KK3B 1Y5NB 3UD4P 1HMVB 4FVMA 1QUVA 3FSYA 4CWBA 1P9YA 3HM9A 1FJEB 2FJBB 5SZTA 5IXUA 2XNQA 3H5UA 3CXCR 3CUNA 1YG0A 1QVGR 2BE2A 3MOJB 3DRRA 4TQSA 2C1EB 2FY8A 3MD1A 4ZN1A 3RR8A 1X0FA 2XYGB 2FJAB 2BJ3A 4RU2A 5ETMA 1O6XA 1X8DA 3GILA 3M9NB 1SH2A 4OYWA 4TYBA 1Q8IA 5I3PA 5I42B 2XG8A 3PEHA 1SL2A 1BXNA 4IG3B 1TK0A 4DFPA 2HHTA 3ITHA 4IFYB 3H0PA 5KT6A 3A4TA 4TQRA 3WX8A 2DGSA 1F2GA 1FKPB 4RUBA 2FJDB 1FTRA 2JC1A 3BBBA 4ZP9A 2F1FA 1RA6A 3SSSA 1LWFA 4NWBA 3S8SA 2UP1A 4GKJJ 3W9JA 2HIYA 1GFWB 1S0NA 1PJ5A 4ID5B 3M2RB 1TKXA 3DM2B 5KFAA 4DN0A 2D9OA 2HWTA 2HS0A 4UQTA 3KLGB 1REVB 1P9QC 2RT3A 3EM1A 3PM9A 4P2MA 1K73T 4L76A 3BKFA 1ZM3A 2Q6CA 3A8KA 4EK2A 1UW9A 4U9RA 5DO2A 2VG6A 2ABYA 1JNRB 4L3KA 1V3SA 2CZVC 1BQMA 1NPRA 2JLEA 4DCOB 3BDEA 1XN9A 2X1GA 3PHTA 4FF4A 3OSNA 1RT3B 1B0VA 3KYLA 4PXBA 1VIXA 2E5GA 4RW6B 4USVA 2C3PA 2PT0A 1FDDA 1H6KX 3V4MA 5A8WA 4N56A 3OV7A 3KHGA 4UT4A 1CJVA 3OXLA 3W62A 3OQ2A 3CSKA 3OXFA 4ZCMA 2BABA 3DI6A 4RNHA 4OZ5A 1FNMA 1N36F 2PI5A 4RBVA 4RLEA 2V94A 3R5CA 3VAFA 5BYSA 1MWYA 1C2PA 1T0TV 2LDIA 2P6SA 5LJ5Y 3L3CA 1Q53A 2H48B 1S79A 1VCTA 4I7FB 3U1LA 5J2QB 1IBMJ 4ES1A 2DGOA 1TUVA 1RAGB 2EXUA 1S9EA 4CT9A 1ZAWA 4KQZA 4IRDA 4F04B 2ZOGA 3FC9A 4RW9A 2QFIA 2QZ8A 2U2FA 1AROP 3US5A 8ATCB 4B3MJ 2B9WA 3ENQA 1KOOA 2E5LF 2P9EA 5M2RA 3B82A 1ZA2B 3P4UB 1XWLA 4CTAA 3DLJA 2DGUA 4EMDA 4JI3J 2OUGA 3DYAB 2PO4A 3H59A 3EWGA 3G87A 2IRXA 3M8QB 2B9EA 5GMEA 5A0YA 1H38A 4DR3F 1GT8A 2M70A 5EGYA 3DRPA 4KPYA 3DLGB 4YR0A 4DS5A 3D0HE 4PXCA 4CNYA 2BW2A 1N0VC 3TJ8A 5KOXA 4O3PA 5K8MA 2OEKA 3IN5A 2C2DA 3CJ5A 3ILIA 4C9DA 5KFTA 5BXIA 3GMGA 1QTMA 3KHRA 2VONA 1JLEA 5HQ8A 2EC0A 1NB7A 2C42A 5LMNJ 3LH2S 4U7UK 3FKBA 4PPZA 2X1BA 2B6AA 1UFKA 5JUMA 4UY8T 4PQAA 3S01A 3QGHA 3E01A 1FKOA 2DGQA 3PKYA 4KGZB 4LQ3A 3NGKA 5KFBA 1LFPA 1IR2A 2HK3A 3R97A 1KVKA 1HPZA 2V4RA 3LA0A 2IVFB 5KG4A 2ZEJA 2CWXA 2UV8G 3O1LA 4TNOA 3HP6A 5LM7E 2LXUA 1MU2A 2BA9A 3UR0A 4K4YA 1LWCB 1Y10A 1K8AT 1IUJA 4ECRA 1D0EA 3BJYA 3SCIE 2HQGA 2IA0A 4TU8A 2MQLA 1NDPA 3I82A 1SH3A 1TUGB 2NS1B 4Y2KA 5ETOA 5H9EK 2VU5A 1JJ2R 3DLHA 2W7PA 2EEYA 4DF4A 2GFFA 2IJNA 2ZFHA 3I87A 3MECA 3W60A 2UUAF 3ZNJ1 3J7YU 4EZ6A 1ZM9A 2NYHA 1LW2B 3VVTA 3H5YA 2HAIA 4MMOA 3IMQJ 1ZAVA 2IAJB 2A6OA 4CQ1A 4LF5J 1NSKL 4FVCA 4F7VA 1S1UA 2RH3A 2H5JB 1F9FA 4FPRA 3D3BJ 2GVDB 2GA7A 2I1RA 3FBBA 2GJ2A 1QSSA 3PG9A 4WJBA 2L9WA 3UFCX 2WB4A 5I3QA 2XWXA 2XB2D 5CZXA 4CP5A 1Y3KA 5CYJA 3A8IA 4ECXA 1AFIA 1S9GA 3BSCA 3MM6B 5BJRA 5CD4A 3K5MA 2QJ3A 4Y2IA 3M8RA 4J9QA 4E98A 1EAYC 2AWZA 3IP0A 4C8LA 2DITA 1HHTP 4ILLA 3TX0A 2VFTA 2RRBA 4ZK7M 3MR6A 4OV6A 1UMJA 3CD7A 5F0WA 5HMYA 2ROEA 3R5BA 1MN7A 1VISA 3LUYA 2WBRA 2MJUA 2OJ3A 1ZH5A 1RBOB 1D8ZA 2HVIA 2BE9B 3PACA 1I1GA 1NKBA 5F8GA 2B4UA 1HLWA 4YDXA 2W24A 4URQU 3RZAA 3BN7A 2KO1A 3NP5A 4CLYA 5MAOA 1VBXA 2R8GA 3UNYA 2LA6A 4PPDA 5HLFA 2DBBA 1KQKA 1Q8LA 3HT3A 3N6NA 4C0OC 3D6FB 2WVFA 4ED6A 2K06A 1RKIA 5CZVA 2MZTA 4A4JA 1J5EF 4GMKA 2MMYA 4IOBA 3TR5A 5EHHA 5GAHU 1WOSA 2IIHA 1VBKA 2QYGA 3FCWA 4XTTA 5KFMA 3GFYA 2HRYA 3C8YA 1SH0A 4C8KA 1D09B 1T9WA 4YHHJ 3HZGA 4FP9A 3JSBA 3KJNB 3PXGa 5KT3A 4X64J 2ILYA 4IH7A 2KRBA 4DV0F 3IG1A 3IR7B 3DRYA 4NI2A 3CCJS 2QFJA 1V3RA 1VQPS 1YHQS 1VQOS 3GYNA 3H40A 1PO6A 5C42B 5K8NA 4LRFA 2UXDF 2CVIA 4HI1A 1R8CA 3TVKA 3LQVA 2X7IA 2BUNA 5KFJA 2K2PA 1VRTA 2EG2A 4JI8F 4F0HA 1DHMA 2XYPB 3MM8A 5LL6d 4H54A 4CM2A 5K20B 2FY1A 1KLNA 1EETA 1XR5A 1Y5IB 4OL8A 3DXBA 2R7QA
chains in the Genus database with same CATH topology
3G86A 4DQPA 1KS2A 2DNOA 2UVVA 4RW6A 3V4IB 3KLFB 1R89A 3CULA 3OFFA 5KFUA 4I64A 4KJIA 5GAEU 4WFYA 3E2EA 2ACYA 2AQ4A 3P6YC 4U6PA 1TL3B 3Q8SB 4NLQA 4JV2A 3OFEA 3PFOA 5EX3A 2RS8A 3AH6A 1D9AA 2XBPA 4C7QA 1OSDA 2BBEA 4G1PA 5LSRA 1UVJA 5JVGQ 1TKXB 3DM2A 2DNZA 3NS5A 4BDPA 4J9MA 2B4PA 3NMRA 2HHXA 2EFVA 1YJVA 1YRUA 1RI7A 4TLQA 2CPDA 1JK9B 2ILZA 3D5MA 4M63A 5CCLA 1NEEA 3CCSS 5JVHQ 4F3OA 1R8PA 4N76A 4ZPDA 2U1AA 1UL3A 1X0PA 4RKUC 1RTHB 1TVRB 1TV6B 5DQHA 4ATNA 2YNIA 2M5YA 4LSLA 1LOUA 4MFBA 5GMKa 1L3UA 2J6UA 2IBOA 5KFLA 2XCPA 3B4MA 3CMES 3W3SA 2XMMA 3F44A 3KLEB 5CHCB 4KHMA 2G0CA 3TO8A 4V19J 4Y2CA 3OSPA 3J80Y 1HBNB 3MEEB 1X4DA 4DSJA 1FJ7A 3QO9B 1WHVA 5J1EA 3MUMP 2MQNA 2PE8A 3M8PB 2N3LA 4O23A 2MSTA 3MPYA 3VAIA 1VBYA 2JFDA 1NNDA 2XSJA 1N48A 3DDKA 3WX4A 3FSXA 1X9MA 3OTBA 4M8LA 5K8OA 1YSJA 2BYCA 1RGVA 3SCLE 1TKTA 4QIFA 5F41A 3NWGA 2J7WA 5KOWA 2COLA 3HI9A 5FIIA 4HH0A 3TOQA 4HDGA 2WOMA 2V0NA 1AFJA 4F50A 2CKWA 2GIQA 1MROB 3AHPA 1G2EA 4Q7AA 3DGPA 4X66F 1HBNA 4MIWA 1UETA 5DLGA 4QYRA 5F8IA 2Y1RI 2DT9A 4JOUA 4A46A 1JLEB 1FCAA 2J6TA 1DZ5A 1LK5A 3M30A 1CLFA 4Z37A 4QW8A 4YB1P 4J9SA 4DR2F 4ZKAA 1KN6A 3HKZD 1RTIA 1YJTA 3MR2A 2FVQA 2MPUA 3PW5A 3IGNA 1G6BA 2HVZA 1U6FA 4PWUA 2HHWA 1IJEB 3TA2A 1MMNA 2VBYA 2CVEA 5LXRA 1UJ5A 3I9V9 2CQ2A 1XNRF 2B0GA 5M2PA 4BS2A 4PWDB 1C0UB 2IHR1 2DB1A 3PR4A 5CD4H 2XWYA 2RRAA 1KFSA 4M5DB 3DLEB 5L9XA 2J0SD 4QR1A 4KGMA 3ZZPA 2J9EA 4J9PA 4A8YA 3RBEA 1VQYA 1WWHA 2JFKA 3KKFA 2J7UA 3KNGA 3IGVA 3TAMB 2KFYA 1EETB 2HFOA 2LKZA 3F73A 2GHPA 3CCVS 1X4AA 3KMQA 5F3ZA 5E3QA 1N52B 2LQ9A 3BEGB 4C3MA 2NSCA 4FF3A 4DL7A 4C3KA 1HQEB 3KLFA 2ZH6A 4IRCA 3L7OA 3PFEA 3I31A 3VAGA 2V8DA 3KG4A 1NH8A 2HLUA 1NK8A 1C0TB 3ETOA 1RYRA 2ASYA 1Q7LB 3EGNA 2CJ9A 4OQJA 3HHLB 4RNFA 3DOMA 2VFVA 1K1SA 4MH8A 2XMVA 2VASA 3EGWB 5KFPA 4F2RA 4WFBQ 1N54B 2M8DB 3SCKE 3RB6A 1UA0A 4C8YA 2EFGA 2OD6A 3Q0AA 1UVNA 2DIUA 4NCAA 3U27A 4GC7A 3N79A 4ETZA 1RT4B 3J7Z5 1TAQA 3TYTA 4WF9Q 2DPJA 2OPQB 2MZQA 2P6TA 5IWAF 5HBMA 4KV8B 1QE1A 1E6YA 5B7WA 5DG9A 1VS3A 1NJIT 2FC8A 4W92B 1BQXA 2RD5C 4LIRA 4PQUB 3HHKA 3AQPA 4ITSA 4X4VA 3MM7A 2OH2A 2UV8A 2F4VF 4TLRA 1S99A 1T02A 3ZZUA 1R0AB 2HG4A 4EUVA 1RTDB 5IM0A 3HXMA 5H9EJ 3VAKA 4V19X 4WCEQ 3QLHA 2HGMA 1DARA 2RNEA 1N5SA 2WSCC 1QUPA 3IFEA 4DOZA 4QCLA 4EWTA 2P9GA 5B08A 4Y0FA 1NHVA 2CQ1A 1Q82T 2YKPA 1AUDA 4HT7A 2ADBA 3SV4A 2RSQA 2DNQA 4IFVB 2MHEA 1SKSA 3KHHA 5A8WB 5EUHA 4NLVA 1ZPWX 4H4MA 4E8UA 4WKYA 1JMTA 4U67Q 4Y6IA 1R0AA 2I8EA 4MYUA 3LALA 2BQ3A 1FRXA 2O66A 4FXDA 1KQFB 2YX7A 1MSWD 2JVOA 3P5TL 5I4MA 4WU3A 3GV8B 1KD1T 3QGIA 2ALZA 2ASJA 5LSLA 5B0BA 1SIWB 3K7RA 1VQ6S 4GO7X 4PR6A 1RDRA 4QIWD 5GADI 2MHNA 4TY9A 1S77D 2C3OA 1SL1A 1RTIB 5DQIA 4OX6A 2N4DA 2L9DA 3QMQA 4NLRA 2BXJA 4ILRA 1NH7A 5THWA 5KG3A 3MMJA 3DRRB 1ZETA 4B3RF 3CCMS 1DAXA 1HI0P 4KC5A 4O3OA 5KFYA 1SXLA 3SFUA 4FS2A 4KAIA 2Q79A 4IG0B 3R5AA 3DC2A 3R27A 2GQCA 3J7YI 2LDYA 3EGZA 3LANA 3O5TB 4ECWA 1BQNB 4H4KC 2J76E 4XPEA 3O44A 3OPKA 1RJJA 2QA4G 1N33F 2CDQA 5D4PA 4IDKA 1OIAA 2QLWA 2E1AA 4R25A 2VQEF 1JIHA 3GIIA 4DL6A 3BR8A 3PHEA 5KG1A 4ZPWR 1JLGA 4P6QA 2V9WA 2RKIA 1G3OA 4K5RA 5GAGI 3VQSA 3CC7S 1AXQA 1FDAA 3HJFA 5T7LB 3CDWA 1VIOA 1RA7A 2QLXA 1JLBB 4JI0F 2ADCA 1S1XA 4ZP6A 4Q43A 3PIPQ 2NZ4A 4URGA 3BQ2A 1JLFB 4HEA9 1RT1A 2LECA 1T3OA 5BYQA 4EBCA 2P5VA 2PFFB 2ZOMA 2HNYA 4ECTA 2YNIB 4LSLB 3SCJE 3CCLS 2GQ2A 1VLYA 2OTJS 2MZ1A 4I6AA 5EDWA 4Y2AA 2YQ3A 3UDCA 1U6BA 1TK5A 2IBKA 1SKWA 1HPZB 3TAMA 4Y34A 4H4OB 4ED0A 2ASDA 2DNNA 2V2KA 2VBZA 4B9LA 1LWCA 3IWXA 4X62F 4WFXA 2FVPA 2YWFA 3IBWA 4AUKA 2PEHA 1Q81T 2BVZA 4N8NA 4WFNQ 1L3TA 1TFWA 2GHWA 4G1QA 4O0IA 3HVTB 1X5TA 2C22A 2XCAA 3DRPB 4DMZA 1U1RA 1FE0A 3AA9A 2BANB 3DOKB 4OHVA 3THTA 4BCAA 1HNXF 4IO1A 5EN1A 2PDAA 5B0EA 5HL7Q 2DR5A 2C28A 3V6KA 4B02A 2VA2A 3VAJA 4C0HA 1XBWA 3DHXA 4MIAA 3QJPA 1S6PA 1Y7PA 4X64F 1FD8A 1FD2A 1YJRA 2R2TA 2ZH7A 1DURA 3UCGA 4C3LA 3DDNA 2DGVA 3GWCA 3HHLC 4EO8A 3OL9A 1VQNS 3SQGB 1FHTA 2CQGA 2DD8S 3BO3A 1NK9A 2UUBF 4R5PA 1FE4A 4NLYA 2F3JA 4IFVA 3V2UC 3M9OB 3NG8A 3PX6A 3IAM9 4XIUA 1JLQA 1OWXA 5KFKA 1Y3JA 1HQEA 1MWZA 3C66A 3I0RB 3M32A 5L1JA 3PO4A 4NCBA 1S9GB 3K2YA 4DX8H 2MQQA 2JSXA 3MM7B 3FQKA 2LQJA 3OXGA 1N32F 2XY6A 3H5SA 3H4DA 4RW7B 2PD1A 2NREA 4A8SA 1B0TA 3SQGA 6FD1A 1T03A 2IRYA 2CZ4A 3M1VA 3G71S 4AL6A 3G6XA 5DG7A 4YOEA 2E7WA 3DLKB 3OHBA 3I5BA 3Q8QB 3OJUA 2ZHBA 5K5MA 5IT0A 4LFAF 3LWMA 5L38A 2HVHA 2FVCA 5DRKA 5L9NA 3I9ZA 4XDCA 2UUTA 4PG6A 3CJ4A 1H7WA 5A8KA 2RUGA 4M1KA 4RW7A 2J8AA 4NA3A 2N82B 4X65F 2WSFC 1HD0A 4AXIA 5KG2A 4KRWA 4CH0S 2B4OA 4A8KA 2FPHX 3OFGA 1C1BA 1X4BA 1Z2LA 4ZVEA 4C11B 4B9TA 2DR8A 2Z4PA 3C6UB 1IKXA 1VQLS 5DLFA 2X1AA 3MM8B 5D78A 3JTOA 4DSKA 4KT0C 2C2RA 4Q0BB 2ZH8A 2RQMA 3V6DA 1QVFR 2BRLA 3G4SS 4I68A 2A10A 5G4DA 2MKCA 3D28A 1OS5A 5M2UA 2FB0A 2OO4A 2CIMA 4JV1A 2FIUA 3LWLA 2B9YA 3PO5A 4IO9Q 1YJUA 4NZ7A 3ZZYA 1IKYA 1GNKA 3A1YG 3QGGA 3VZHA 2EPIA 2VFSA 2VC0A 2D7SA 2DNKA 5KFDA 1URRA 1PGZA 1Z2ZA 2W8LA 2HHVA 5T14A 2YKOA 4QOTA 4Q8FA 4OI2A 2MY8A 4ZA1A 3MAQA 5HO4A 4NLOA 5KFQA 4OX7A 2CYYA 4CNZA 2EFQA 4A8WA 4D3GA 4YB7A 4MAKA 2EFOA 1PC4A 2CPEA 3MEEA 1D8YA 1WACA 3CD0A 3O2IA 2NSBA 4DL4A 2XNRA 1J5OA 5H9FJ 5E3CA 3PW2A 2F9JA 1N0UA 3CJ0A 4N41A 4Q8EA 3LGNA 4DLGA 1U2FA 1FT8A 1RTHA 1L3VA 2GGPB 1DBDA 3FDSA 3SFGA 1HL6A 3IO1A 1N34F 2IC3A 2HYIB 1RT1B 2FD2A 4DL3A 2JEJA 1T94A 4MFBB 5G0RB 2AJFE 2V8HA 5K9FA 5KT5A 2WW8A 3GFZA 4DWIA 3KLIA 2BV3A 3T5LA 4URSA 3CJKA 2EBEA 3ISZA 3PJXA 3T9NA 1FXLA 2K3IA 3MPVA 4PCQA 2J9DE 3GG0A 3MEDA 5A8RA 3FMWA 1NZAA 2YKMB 4P7TA 1KFDA 1UAWA 2DGXA 2XSJB 4CTAB 2JHEA 3E3XA 1P6TA 1CPZA 2ZH1A 1GXLA 3I5CA 2YWHA 3P96A 4EGLA 1GTHA 3MFIA 1U26A 1FKAF 2A18A 3GB0A 3CDAA 2L08A 3NNCA 2R7RA 2NLWA 3DLBA 1MNEA 5LMNF 3R1HA 4F25A 1H2TZ 3S6EA 4ID8A 1H2VZ 2OP5A 4IH6A 4K59A 4P2SA 1U1MA 1JX4A 4LF8F 3DCAA 3MEKA 3CJKB 3PIOQ 3PZPA 5DETA 2B6AB 4NLPA 4ZVHA 2RIJA 4GKJF 4Y28C 3T5KA 3M30B 1YJWS 1IKVB 4FNHA 4I6YA 1D1UA 2IM2A 4PG5A 1BWEA 3W2VB 5E7OB 3MMAA 3IR5B 1X4EA 3W7BA 4YB6A 2HHPA 3R5DA 1S6QB 3AA8A 3JYTB 5DDRC 3DFEA 4QPXA 3DOLB 4Y65A 1UVKA 2E9TA 1IBMF 2RRNA 4DS4A 4PWDA 5T7LA 5LJ3Y 2ATLA 3IRXA 4DSIA 4KTQA 3ZC4A 1VOMA 3TQ1A 1WF1A 2KFZA 1T05B 2UXCF 3NKYA 5DDQC 3TVZA 1T03B 2RDJA 3VAMA 2MKJA 2FVRA 2G1DA 1CC8A 3K8VA 1WHWA 2I5JA 4QR0A 5B09A 2WAQD 4PXEA 1XMOF 4N5SA 3TW0A 3HKWA 4DL0C 4H4OA 2L41A 2DGTA 3MM6A 1H0HB 4I2QA 3QJLA 1WNEA 5AXMA 2W8KA 4I67A 1JLQB 3DNCA 2OSRA 1JXEA 3QJJA 2YVSA 5CA5A 3V81B 4ZHRA 3UQSA 2KVIA 3QGPA 1TL4A 2DCUB 4RBTA 3OVSA 4DL2A 3TRGA 3UPFA 3KK2A 1HYSB 4M5DA 3FGVA 2ERRA 2Q1LA 1HA1A 4KO0B 1ZTTA 1ZOTA 4ECYA 1S97A 1REVA 3RBDA 1LQ9A 3SV3A 1QAXA 2CQBA 2KHDA 2LCWA 1RT4A 2LXIA 2AW0A 2AGOA 3V6DB 2R7OA 1NK5A 3MPWA 2M8HA 4NRTA 1E6YB 1B0PA 1VGYA 2YKNB 1OQ6A 5DS7A 1KRPA 4M94A 2XHWA 3BREA 5HBMB 3NLCA 4YUDA 2KFNA 1U45A 2NYIA 4RW4A 1NK0A 2PA8D 3OTEA 2E1CA 3L95X 3KLVA 3RB4A 5FLXY 4IG3A 4AL7A 2W4PA 1DLOA 3Q22A 1UEVA 2XS2A 3CJ3A 3M4XA 5AXNA 4ZCKA 3QZ8A 3MTKA 1N5QA 1RTDA 1F5AA 2BM1A 1KNZA 2FJXA 4K4ZA 5K14A 4P7VA 2F8EX 2RU9A 1U1KA 1HWUA 3FQLA 1S10A 2O3DA 3KJVA 3C6TA 2IM3A 4EYHB 1VMBA 2YY3A 1K0VA 2HFZA 3GR1A 5KT7A 4QWCA 3OR2A 2AYMA 2YWEA 1J2VA 2QYCA 4KFBA 2ROGA 2N7CA 4MTPA 1S4FA 5I3UA 1VRUA 2KXNB 2WB1D 3I55S 3C3LA 3LP2B 3NRBA 4IR9A 3DLGA 2FC9A 5LXYA 1HFEL 2OSQA 2I38A 2KB2A 1DQ9A 2FTRA 4YQWA 3GQCA 2G9OA 4QZVB 1R7IA 5FJ4A 4A48A 2VL1A 5KT2A 4FZVA 1S0OA 3FRZA 3TI0A 3CCTA 3A8EA 3PW4A 1HD1A 2IFXA 3V5RA 1AW0A 1Y0HA 4G1IA 1ZPVA 3LP1B 2IVMA 5L8RC 1S9EB 2Z2MA 3PEJA 4RNNA 1DTQA 1VQMS 3C46A 4UUWA 4K4TA 1IKXB 1DQ8A 4ERDA 4LF9F 5BR8F 4YY3F 3T1HF 4CO2A 2V8VA 2J5AA 4JYAF 1WEYA 5J2PA 4ES3A 4NLDA 4PXDA 2CJQA 4NLWA 4O3NA 1KEKA 4Q45A 1UFWA 3SXLA 3M2VA 3PVXA 2HNYB 3CCJS 4DHVA 1FNOA 4G6VB 2LA4A 1FO1A 1LWEB 2VB6A 1UW4A 2BZ2A 2YWKA 3QIPA 3O6QA 2W9CA 3NNAA 2ZZMA 1LW2A 1WELA 2KT2A 2R9LA 3M6UA 4LFBF 4IDKB 5IT9Y 4WE1B 3OUYB 3M8PA 4A8QA 2DHSA 4I56A 3IR6B 1T3NA 1YBAA 5JJBA 4CCHA 4IOCQ 3AY0A 3LP0A 4RW9B 2MQMA 3BGRB 4YFUA 3JYTA 1R31A 3O8WA 4F4WA 4B9VA