5M2PA

The structure of the ycf54 protein from synechocystis sp. pcc6803
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
MATYYYALASQKFLLEEEPFEEVLKERRRDYGEKNKEIDFWQVIQPAFLNAPELAEAKAKAPEKNVAIVSTNKSFIVWVKLRLEYVLTGEFEAPSDAIPDPLASLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved residues in Ycf54 are required for protochlorophyllide formation in Synechocystis sp. PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Photosynthesis
molecule keywords Ycf54-like protein
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2016-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10674 Ycf54 Protein of unknown function (DUF2488)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1860 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5m2pA00
3JSRA 5M2PA 3HZEA 5M2UA 5M2RA
chains in the Genus database with same CATH superfamily
1RADB 1DLOA 3W9HA 1WD6A 2F8MA 2M7SA 3MMCB 4Q8EA 1B0TA 4PG7A 1KOOA 4AQYF 5JXSA 1N5YB 2B6AA 4ZIVA 2DH9A 4A8YA 5IM0A 1T3NA 3C2PA 4NE9C 1AUDA 4LRFA 1Q8BA 3EVWA 4NMXA 3KFWX 1IR2A 2ZVIA 4MYTA 1Q8IA 4OJ3A 3PO5A 2E1AA 1U6ZA 2MHNA 1TMMA 4DJBA 4QWBA 5J1EB 1VGYA 2DYAA 2OFHX 2Y0BB 4ZPTR 5D0HA 3UPFA 1FXDA 3P3DA 3C6TA 3GV7B 4ZMMA 4DR2J 1IBLF 1ZM3A 3HHDA 2KXNB 2MQ8A 4Q5VA 2Y8YA 2V8VA 5ETLA 3BB5A 3NBPB 1VJQA 1NJYA 3TOQA 2NCKL 3HVTB 4LF1A 3T5LA 5CD4H 3TA0A 2PSZA 2MKKA 2BJ9A 4ETXA 4B9LA 2Q3PA 3M8SA 1KNZA 4ZOSA 3OFEA 2CNKB 3IO1A 1WHWA 4NLUA 3M6XA 5BR8F 2MZ1A 2AYBA 4F4XA 1OYEA 4JV5J 4O0NA 2N3OA 1YIJS 3MOZA 4KE5A 5MAOA 1T8EA 5B7WA 4N47A 1S9FA 4EMDA 3ILJA 1UA0A 2VG5A 3MOJB 1RWWB 3MPDA 1O0PA 3BSCA 4DL6A 2RKIB 3N5FA 3QAEA 1PILA 3GE9A 5IT0A 2OIHA 4LFCJ 2JNJA 2CQ2A 3BKFA 3TA2A 2H4YB 2UUAF 2PIIA 2NXUA 4OI1A 2E1CA 2CWKA 4WJBA 4USUA 2EFPA 2CJYB 3J7ZT 1S1UA 3DRRA 4K2XA 3TZZA 2ADBA 1VBXA 3HJFA 1CPZA 3GB0A 3H42A 1HPZB 3KLIB 1PYSB 3PW2A 1ZBTA 3UVJB 2HKEA 4RX6A 4LBIA 4F3QA 2FPHX 4FF3A 3BN7A 2DCUB 2J0WA 3IAS9 3LGMA 3TUZC 1T9TA 2DPJA 2LEBA 1T9YA 1JJ2R 4FBUA 4JV5F 2CPZA 4NCGB 4MKYA 4TQSA 2A2DA 1HI8A 3KHGA 3R2CJ 5J2NB 3I96A 3O44A 2QLFB 2V8GA 2CZ4A 2UVWA 1MWYA 2K1RB 1U1RA 4JI8J 3QGHA 1B4SA 4LF5J 4DOZA 3PYGA 2CJQA 5J2PB 1HPZA 3KLIA 3LA0A 3D0GE 2W9BA 5D15A 3G6XA 4RUHA 2UUAJ 4LF7F 1FJ7A 1RT3B 1H3DA 4YDDB 2ZDOA 3OL7A 3MEDA 3TJAA 3T1HF 4RZRA 3H40A 2AV5A 2LEPA 2HGNA 2LDIA 1QDUB 2BRKA 4LR8A 1YDLA 1N5TA 4Y3CA 2DGUA 2YTCA 4FN5A 1H73A 3LWMA 3H5YA 4J9VA 2B5JA 2HWTA 1F6TA 2CZ9A 3C19A 4R25A 4DV0J 5J2NA 3MHYA 1YZ7A 4M1KA 2K8GA 3AQOA 3HHLB 4JUZA 2EG1A 1KQSR 1E6VA 2GC8A 5E41A 3S01A 3L7PA 2YQ0A 2C42A 4MJKA 3KJVB 1WEYA 2VG7A 4FS1A 1BUXA 2ILZA 2BJ7A 2ASDA 2DIUA 3GR0A 1IKVA 2OH2A 4LF5F 3V6KA 1JLEA 1VYAA 3CO0P 5K14B 4Y28C 1P1LA 3DOLB 3FCVA 2XI3A 2YKMB 3LP2B 4KYZA 4CTAB 1QVGR 1LFWA 5A8KA 3P8BB 2Z2MA 1E6YA 1HIYA 4EO6A 1UW9A 4DR4J 2ATCB 2OPSB 2QEXS 4QU7A 4O3SA 2IVFB 3HHLA 1U0HB 1IKWB 1OY6A 1RWPB 1TK0A 1RAGB 1YVFA 2RT3A 1I6JA 2FC9A 5BYSA 1IN0A 5DLGA 5DDPC 2Q6BA 2IC3A 2J9CA 1TKDA 4FYWB 4WP8A 3VAGA 3Q23A 3AHPA 3OTEA 1SC1B 2I38A 3R5GA 4ZPAA 2AZ3A 4P2SA 2XZWA 4WIQA 3TJ9A 2UXBF 2A10A 4F7VA 4JI2F 4NCAA 1HWKA 2FLNA 4MYUA 3AOAA 1QD1A 3DRYA 2KG0A 2FGCA 2W2OP 4Y65A 4DV5J 3GIMA 3SBMA 5IWAF 3CCLS 1QY7A 2J0XA 3BM7A 4PR6A 1QSLA 5HVHA 2HRTA 1AXQA 2NUHA 4LSNB 3ZZYA 2B8QA 4PQUB 3TVZA 2HHVA 4B9TA 3ZZUA 3QIPA 4WXOA 3FFIA 4RBVA 4C3MA 5LT5A 1RACB 4EBCA 1T9VA 3QMQA 3F0NA 3HCXA 1TUWA 1PC4A 2M5YA 4WCEQ 1UFLA 2A2CA 1PCAA 1YK9A 1IJEB 4I1TA 2BA9A 2MMYA 2CJBA 3ETMA 3DI6A 4OYOA 5D78A 3ZNJ1 5HP1B 1H72C 1YTYA 3BQ2A 1U1OA 3K8WA 4QR0A 2ASJA 3THVA 1RT1B 3MPWA 3PIPQ 3IWXA 3OSNA 3IMQJ 1V3ZA 3BH6B 3PJWA 4LF8F 3PYDA 1CC7A 4OYAA 3MAQA 2XO7A 4DN9A 2ZH5A 1EP4B 2GQ2A 2P2CB 4DV1F 1RT6B 2CG8A 3FSXA 3HHNB 4L6V3 1EQ0A 5CQGA 2BUNA 4OX8A 3EMTA 3RB6A 1HYSB 4EU0A 1AW0A 2ROPA 2NR0A 3DI6B 2H5IB 4OZ0A 3TAPA 1SQEA 1S0VA 1RTIB 5A76A 4ED6A 4IR9A 1Z2ZA 1G7CB 1NHKL 3JSBA 1RCOB 3NGUA 2HQ3A 4F04B 1HHQA 3TZXA 2G1DA 4USKA 3MUTP 1U24A 4DX8H 2AEFA 3FNNA 1L5UA 3HULA 2UU9J 1SKRA 3ONQA 1N88A 2RIJA 3NEKA 3KLVA 4BLGA 3J80U 4R0EA 4C0HA 3PW4A 5A8WA 1WG5A 1XMBA 2DXFA 3EZ5A 3V4MA 1XBWA 2OPQB 2FY8A 3B4DA 2CPXA 1BLUA 5HL7Q 3NGDA 1S6OA 3ZZOA 3DOKA 2IM3A 4DX5A 2J0SD 2Z2LA 2AYMA 1NHVA 4P2FA 4RW9A 2DJWA 4I6AA 3M9OB 5LMUF 4C0BA 1N5SA 2PD1A 4C2MA 2CIMA 3OUYB 3W64A 2DD8S 2KFYA 4CZCA 1HWJA 1FT8A 2H5JB 5T7LB 3CJ2A 1SVDA 3GIRA 2IPOB 3JTNA 4NZ0A 4O4RA 1GMWA 2Y0SD 4FYYB 4PG6A 3WX4A 4HYKA 1URNA 3S6EA 2MQQA 3SDEA 3QRRA 1F9EB 1S1VB 3R3TA 4DCJB 4ZIWA 1N6QB 1NDCA 2HFNA 3BPSP 4ILRA 3DLGA 5D4NA 2ACYA 3AD7C 2OFGX 4RW9B 3I31A 1FWKA 5LSLA 5C42B 4IG3A 4K4VA 2CPEA 3BQ1A 3EUNA 2W01A 1WDTA 4J91A 1HQ2A 4N8OA 3R97A 4CO0A 5CCMA 4WE1A 4ZDNA 3TAQA 2ZNYA 2C3PA 2YWWA 4G1IA 4ZVTB 2PN6A 4M94A 2AYEA 3OR2A 3NY0A 5HVGA 4DV3J 4DF8A 3WC2A 3GU0A 1HNXF 3WIVA 4OYMA 5K20B 5KT6A 3I0RB 2V4RA 1YQHA 2ZH3A 1YHQS 3IXQA 1MNEA 1C4CA 3OXLA 1TFYA 4TNOA 5GAEU 4IG0A 2UUCF 3A8EA 3IA0A 3UD5A 2LVWA 2V2QA 4ICLB 2QIFA 5BXIA 3QNWB 5AXMA 4JI4J 4KTQA 4ECRA 1N5YA 2NUUG 4IRKA 2XLKA 3IG1B 5KG1A 5GAGI 3OL8A 2KVIA 3TO8A 1HQEA 4J9OA 4CCHA 1IM6A 3W61A 4W92B 4N8NA 2W2NP 3JYTA 2B9XA 3DHWC 3CJ5A 5KFPA 2BBEA 4P2XA 4CH0S 5F8IA 3FBBA 1MU2B 1X4DA 1KP6A 3CT9A 5DDRC 3OJSA 1ZAXA 1LW0A 2HK2A 1T11A 1TKZA 2GJIA 3KUHA 4HH0A 5HJXA 4MK8A 2OI2A 3ILLA 3EYZA 2O01C 1AZSB 3HK2A 3CC4S 1Q53A 3TAMB 5LOQA 3H2LA 1D1UA 4F0KA 2W2PP 3UCZP 2XHCA 5GAHU 4JI4F 2M88A 3LP1A 2MGZA 3D0IE 3QT5A 4IQMA 4P2MA 2GMJA 3KLEB 3RTVA 1M90T 2WONB 1U6BA 2WW4A 2XGPA 3HPOA 2HQDA 3SCIE 4JV2A 3Q2TC 1QTNB 4LT6A 4TN2A 4C8KA 1V6HA 3QGIA 4DPUA 3RW6A 4O3NA 1WC4A 2FD2A 5L38A 1T05A 2NSCA 4DFPA 5K9FA 2AIRB 2G1HA 3HSJA 4DR1J 3CC7S 1FVSA 1RB0A 3IWNC 2V0NA 2OPPB 4OLOA 1TZ0A 1S4EA 3C14A 2WBMA 4GRSA 3HSGA 1TAQA 5EX0A 3GG1A 3CMQA 4G1PA 4ED5A 1V5VA 5DO2A 3D3CJ 3UI3A 2HNDB 4X4TA 1MROA 2JLEA 4QR1A 4ECYA 3H5XA 1FRLA 2WK4A 2J9DA 1N54B 3O1LA 1PJ7A 2OPRB 4DSIA 4Q44A 2IM2A 1KQKA 3U1NA 1JLBB 5HO4A 3MR6A 1ZPWX 3D67A 4WK3A 3Q8RB 2IJNA 1KVIA 3BKTA 4PXCA 1SUQB 2VUGA 5KFNA 2HQFA 1HKAA 2HWHA 2VL1A 3HT3A 4AL5A 4C8LA 2C2KB 2NZ4A 1MW7A 3D66A 5GAHI 2XQCA 1VBYA 5EGYA 3CTRA 3D6HB 3ISNC 2V94A 3M32B 5ETQA 5DDQC 4EEYA 4ECVA 2MKYA 3RU0A 2YNHB 5F8JA 1LK7A 3M8QA 2HVIA 2D74B 2NS1B 2UZAA 2ZITA 3MI7X 3QGPA 2KVQE 1XR7A 1RT3A 2H1YA 2DCLA 1VJWA 3FCWA 1F5BA 2KI2A 1FRIA 2K2PA 2R8JA 2BOAA 1F5AA 4ZVGA 3QLHA 3EDQB 4NLTA 1P1TA 1RHMB 3FGVA 1CJUA 2YWFA 3MXHP 3AA8A 2COLA 1RKIA 2LKZA 2BX6A 3W5XA 3BF4A 4CLFA 3VZIA 4HDHA 1RKJA 5ADZA 3W2WB 4LVOP 3KNGA 1TUGB 2N7YA 2V50A 1FXRA 3QGGA 1M1GA 5FD1A 3EPGA 4F3OA 1EB0A 1EETA 1TV6A 4WPAA 2FZKB 3TQEA 1HWUA 5J2MA 5JVHQ 2HNZB 2YX4A 1SIWB 1Y3KA 5AJ3J 1UAWA 3EGVA 4QWDA 1WEXA 3Q8SB 4RNHA 2CQPA 2DVIA 1YJTA 1UKUA 1VQ4S 3M6WA 4F26A 1LEOA 2R7RA 3I5CA 1NJXA 2U2FA 5C2CA 1E6YB 1U8SA 5A8RA 2B51A 2D41A 4BWMA 4ZCIA 4AD6A 2OPSA 1Y5LB 3EWGA 1VBZA 4PG5A 4HTJA 1DY3A 2XMKA 1ZAWA 3R7SB 3CJKA 1JXVA 1H2VZ 2XMJA 3R1HA 2VG5B 2V34A 1WF1A 3SQGA 4NEZA 3PRBA 1NRKA 1X4HA 1NMEB 1NK0A 2IMWP 3Q0AA 3G6ES 1S4FA 2LCWA 1C4AA 1RBAA 2RB7A 2E1PA 2FYXA 4FPIA 4K5SA 5ETSA 2ZUAA 4WFBQ 5KT3A 1L3SA 1JNRB 1TQLA 1XTZA 1YZ6A 4RW6A 3DLJA 3PFOA 1WHVA 2MQMA 1Z1ZA 1Q8LA 1VK3A 3TANA 1VQOS 2V8DA 2NPIA 4EBDA 4RU9A 4OZ5A 5G0RA 1G1XA 2C2NA 2DR9A 4EZ6A 1KTQA 1LOUA 1UCNA 3BR9A 1K9MT 3HSDA 2V67A 4HI2A 2NZCA 2MKCA 2R7UA 2I8EA 3FQLA 3AAWB 4NCGA 5E0OA 4MK9A 2LEAA 2HGLA 4LSLA 4OYZA 3TWZA 3W7BA 2G2OA 2B9YA 1X5PA 4QW8A 5BJRA 5KFFA 4L75A 2JEFA 4JYAF 3W5YA 4I67A 4PUOB 1IVZA 3EDRB 2ZFHA 2JRSA 4M5NA 4DV6J 2H65B 4KFBB 1T3OA 3AY0A 3LPEA 4ZHRB 4GC6A 1IQZA 2R42A 1QAJA 4YS2A 3C15A 1RT2B 1WSVA 3OD2A 2Y1LB 2FDNA 1HD0A 2H5EA 2KT3A 2L9NA 2BRLA 2HFVA 5G0RB 3NWGA 2QSWA 4X4VA 3EVOA 1S99A 3UN2A 4NXMF 4QU6A 4DUZF 3PCOB 2HFOA 3L9ZA 3MPVA 3OFFA 4OV6A 4ZCKA 5KFDA 2B4PA 5FLXU 3R5AA 1SPBP 2B5JB 4YB5A 3OTOF 5DM6Q 4EYIB 1SKWA 4X2BA 1FJGF 3ZTSA 1J5OA 1X8DA 1NU4A 2NXEA 2HLTA 4H4MB 3CCUS 4DL2A 2Y8WA 1S6UA 3UQSA 2NYIA 4YHHF 3F56A 1SJ1A 5H9FK 3M1VA 4M8LA 3IAM9 4K4YA 1OJ4A 5KFBA 2M8HA 4LF2A 3RBDA 1BQMB 1RHRB 2ZBRA 3M2VA 2JLFA 2EC2A 2BZ2A 4RWXA 1LWCA 1GMVA 3QT7A 3GILA 2XB2D 4ED8A 2MQLA 2YWHA 3PIOQ 3Q89A 3NGKA 3NKYA 2GHVC 3KK1A 4X4RA 3G6YA 1FRMA 2IHR1 1U25A 4DFMA 2FC8A 3GJSB 3DOMA 3QFHA 4P73A 2Z4PA 2Z56B 3AJDA 3DOKB 4IFVB 5C5JA 3OTOJ 1XMOJ 3GPAA 1SCJB 1UMJA 4DZ6A 2WB1D 2CVIA 2KT2A 5IM0B 1DQ8A 1F9FA 1TKXA 3OXGA 3TX8A 2GAGC 5HMZA 2ZM6J 2VIHA 1OPZA 4DHVA 1IBCB 3V6HA 4F4AA 3OVSA 4JI7J 3PKMA 1VRUB 4DL7A 3JAMU 4OI3A 5C25B 2MPUA 4D3GA 5B0GA 2MLYA 2EFGA 2C3MA 5E3CA 3BBFA 2ROGA 1G4CA 4JBCA 2RILA 3R6LB 3RR7A 4IOAQ 1IXKA 3B4MA 2OJ3A 4LSNA 1XIQA 2V6AA 4B9VA 4PQUA 2VDHA 4FNIA 1MN9A 3QPIA 2HHHJ 3NCRA 1K8AT 1VLOA 4NA3A 4MIWA 1DHMA 2F3JA 3VAJA 2YWGA 2HMIA 3K7RA 1XMOF 4C97A 1S6PA 1RAEB 1VI7A 3I9V9 4NI2B 1JKHB 4LIWA 3V5RA 3N6MA 1FRHA 3LALA 2FJVA 2BACA 5ETRA 2ZH2A 3HHEA 2N82B 5IT9U 2IAJA 1S1TB 2XG8A 3D68A 3N79A 2QTWA 5E33A 1RT1A 3TEGA 3US5A 4NLDA 3BGUA 1XQIA 4DR3F 2W1BA 5JJBA 2OEKA 1RI7A 2CPDA 1D8ZA 1YJ7A 2NSBA 3ENVA 4TLRA 4UY85 1SB6A 3LP0A 3UR0A 2XULA 3DRXA 4X65F 2XYGB 5DS7A 3LGHA 1RT5A 2OSQA 3PFEA 4KV8B 3UW1A 1RABB 2CDRB 1U26A 1R31A 2CPIA 3FZBA 4LRDA 1UPPA 2VC1A 1JLFA 3FCHA 1WOOA 2ZH4A 5JVGQ 4CLYA 3V81B 3RB3A 1WWHA 2VICA 3PRVA 4HLBA 2DEJA 4RU2A 1JLAA 2R7OA 2QA4G 1J2VA 3MAAA 2RHQB 4WP9A 2EFVA 3J7YU 4Y0FA 1RTZA 2ERRA 3EE3A 4Q8FA 3NMRA 4UQTA 3KOAA 7FD1A 4PEOA 3C16B 1H98A 1HWLA 3HFKA 4L76A 3D6MB 4JP8A 3N0VA 4CO5A 1HNWJ 2F9DA 3CJTA 4TY8A 3G87A 4KSEB 2YX1A 2QJ3A 4YEAA 3DYAA 1BC6A 1Y7PA 4ZA1A 1RT5B 4KV8A 2BM0A 4YB7A 4U7UK 3SSRA 4ZLPA 2O67A 4NPOA 3KK2A 2W9BB 5J2PA 1N34F 3MR5A 4IRCA 4RW7A 4X4NA 4C98A 4KH0B 3IRXB 4ECSA 3QWPA 1D8YA 2D1CA 2VFSA 4Z2XA 3DGPB 3MEDB 3MAAB 1TVRB 2D9PA 2AJ4A 5E3QA 1IBKJ 4CDIA 4ID8A 4NA2A 3TARA 4IRDA 2CQHA 3W9IA 2BANA 5M2PA 3VHQA 5DQGA 4IO9Q 3UNYA 1DARA 2YKOA 3ZZ0A 1NK8A 2CQCA 4G1QB 2DHGA 3AD8C 3HSZA 3ISZA 4FVMA 2P8IA 3HJVA 3H5UA 4KQZA 2XM3A 3VAMA 3CJ3A 3HXMA 3IBFB 2GJFA 2BW7A 2UUWA 4RUAA 2FUG9 4RW7B 5HBMB 1NO8A 3SEOA 3OHAA 3M2RA 1FRKA 5A0YB 2HLUA 2IDEA 2X51A 3DLGB 5H9EK 1R8BA 2V63A 1DBDA 1NPPA 2CQDA 4PG4A 1BQNB 5ITHA 3LP2A 1DLOB 2IRYA 3ILIA 4CTAA 1WEZA 3OJUA 1UTAA 3DMJB 4WWSA 1O51A 4F50A 2BV3A 1S10A 1S0NA 1KN6A 2IVYA 1GT8A 1K47A 1HBOA 4LUBA 1NLKL 2XY6A 3BYRA 3RBEA 4GKKJ 4B3RJ 5RUBA 2XLIA 4HT7A 1J5EF 3CJQA 2IFXA 5BYQA 3OR2B 4YDXA 4B9UA 3RRGA 4JI6J 4BWJA 1GH8A 3P5BP 1FKPA 3EX7B 3VAIA 1B70B 4UZCA 1KEKA 2QL5B 3D2WA 4USIA 4IDKB 1NK9A 4NYOA 2KXFA 4ZVQB 4WKYA 1VLYA 3VV2B 2B56A 3I87A 2J9EA 1Q0NA 5L39A 1JJHA 2BXJA 1RYRA 2JX2A 3KLHB 2PMHA 4DS5A 1WC1A 1UEVA 4J9MA 4WYLA 2VDIA 4X4OA 4MT1A 1H2TZ 1YJUA 1FJGJ 2Y1JA 1KS2A 5IFMA 4IH7A 4J9UE 5HAOA 1A0OB 1D0EA 4CT8A 4DMZA 2VFVA 3OL9A 4ED7A 1N5VA 3AJ2A 1BMQB 4GKKF 1RAIB 1APSA 3CCJS 4IDKA 1SJ4P 3M4XA 2DHHA 1WTFA 1UZHA 1SH3A 3GP9A 3A13A 5CYMA 4HHUA 3UNGC 4ZPBA 1N48A 1RAJA 3N5BA 2MSSA 3NGRA 5DG8A 5T14A 2DNMA 4OJHA 2FY1A 2HHWA 1UVKA 4CLSA 3VAHA 4ZVPB 4A8FA 1RHKB 1FF2A 1KTVA 1WKLA 3KJQB 1FVQA 2NPFA 1HNIA 1AZSA 2E5LF 4WBFA 3RGIA 4M5DA 4NRTA 2YKQA 2J0QD 3T5JA 1R6YA 5KG7A 2BOPA 3CMES 2MZTA 4ED2A 2JOQA 5KFUA 1HNVA 3WDOA 1Q81T 4LFAF 1MWZA 1RYSA 1Y0HA 8AT1B 3KHHA 4FZVA 4DXLA 2ZOGA 2KL8A 3DXSX 4FXVA 3TW0A 1ZH5A 1K0VA 3KLFB 1VDHA 2WCXA 3ISND 1VC5A 4DV7F 2YWKA 3ILOA 2GVZB 4LF7J 1URRA 4TYAA 2GS8A 1Q79A 3TVYA 2RMLA 2E44A 5D4LA 3CCQS 3PV8A 3C14B 1S97A 4ZVOB 2X7IA 3F73A 3BO4A 1HR0F 2HHXA 1RAHB 1IBMF 2LDYA 5CA5A 3GONA 3SSQA 2XC9A 1BD6A 2E5LJ 1EKRA 1W26A 5THWA 5KFLA 4DL0C 3J7Z5 2RQ4A 1Q82T 1WC3A 4R0JA 2FHJA 3DU6A 5LXRA 1TFWA 4BC9A 5DG7A 2RQKA 4EWTA 3P6YC 1VK8A 4YB6A 2X1BA 4PUOA 2GVDA 4NEYA 1SXLA 4ZLNA 3GIJA 2OMLA 5D4OA 4FF2A 2J6TA 3PG9A 3QAUA 4CNZA 1CG2A 1K73T 2UVRA 2PE8A 3JS9A 2YQ3A 4H4KC 4Y2MA 3EXCX 2C2EA 4LRCA 4LFCF 1GMWD 2HHUA 1VR6A 1D09B 1HR0J 3EZUA 1FESA 3BGRA 1M1KT 1S1VA 3FVYA 3M9MB 2OUGA 3B54A 4YUDA 1LWFB 3UE2A 4FYVB 1ZM2A 2OTJS 2BKOA 1TL1B 3PHTA 1PC5A 4DQQA 1S57A 4ZPCA 2UXDJ 1F1BB 2ZBIA 4WU3A 2DK2A 5BR8J 4RW4A 4PXDA 4N56A 4QZVB 4NYZA 3QSIA 4CT9A 2QA4S 1QSSA 5CAAA 4IFYB 4AFFA 4W4MA 5A6PA 2ILYA 3DRSA 2DH8A 2Z2YB 2HBZB 1UETA 4F0HA 3B8HA 1FERA 5J2QA 3Q86A 4MFBA 4ZPWR 3EPIA 3HVAA 3RRKA 2DRBA 1OSCA 1IR1A 2WBRA 4B3MJ 2GIQA 1REVA 2CG4A 2ZWPA 3IS9A 4XDDA 1ZTTA 3W3SA 3VTIA 3H20A 4QOTA 3M7VA 5E2QA 4DV0F 4ELTA 1NK4A 4ECTA 1XMQJ 2UP1A 4DV2F 4TVAB 1QJHA 2HZCA 1C2PA 3L3CA 2IYGA 3FK4A 2FVCA 2EBGA 3K57A 2GQCA 1C1BB 1PAEX 2RDDA 2V8PA 3PRDA 5DETA 3K59A 3MEGB 2YVSA 2W7AA 4MFBB 2OKQA 3CD5A 2FJEB 1DAXA 1N36J 4PRFA 2LXIA 3BS9A 3ULHA 4CP5A 4DN0A 1SV5A 2DGXA 2Q79A 2DGSA 4ZPVR 4AE5A 3OVAA 2E7XA 3QYYA 4I0WA 4JI8F 4CO2A 4JOUA 1DURA 2PMZD 3WC0A 2V4QA 4A8WA 4CYUA 5ETMA 1DJ0A 3JSMA 1J5OB 4U8VA 5I3PA 3C3LA 3SI8A 2KYZA 1LQ9A 2LYVA 1Y9OA 1HMVB 4ID5A 5D0RA 3IM9A 3T1HJ 2B3TB 3ENWA 3MM5A 4WK1A 1RLDA 1WUUA 2YNGA 2ZE2A 4RNOA 1XMQF 3IGNA 1SBRA 2Y1IA 1NJWA 2WONA 2ZBCA 5F3TA 3HD1A 4IOBA 3T41A 3TYTA 5KT5A 1DTQB 1LXNA 3JSRA 1XK8A 2QFJA 2X3DA 4NLGA 4FF4A 2QN6B 2ALYB 1Q5VA 3VGSA 2CPFA 1N4LA 4NLSA 3JSMB 4JI0F 4A48A 1FDAA 3PZPA 2BJDA 2G2ZA 1ROFA 3IC1A 4R8UA 5HMYA 2IIHA 4ECXA 4UOHA 5HATA 3UDEA 2PI5A 5IWAJ 3GCWP 1LNQA 2G2YA 2XZTB 2LFVA 1F60B 2F1FA 1WNEA 4NXNF 4OI2A 2V8HA 1TR0A 2EK6A 2ZBPA 3IN5A 3VWSA 2OPRA 1RA6A 3ETOA 3VCDA 4PG8A 4FVCA 2RH3A 2OHDA 4P7VA 2LLZA 1UJ4A 3VZHA 1CULB 5HLFA 1HW8A 4OHXA 3OLAA 5DRKA 1LKZA 5KT4A 3AA9A 2XEXA 4D3HA 5T7LA 4V19J 1IQTA 2XSJB 3OR1A 2KKHA 3VR1A 4ZPDA 4RW8A 4C11A 3R2DJ 1GXTA 3M8QB 2XYHB 1DTTB 2WOMA 4F4YA 5DZ6A 5SZTA 1XERA 3UCGA 2MY8A 4EBEA 1N0VC 3HVTA 3PM9A 4F4ZA 1H7WA 3MMJA 1ZZFA 4LJMA 4NLPA 4QIFA 3CCRS 2NQPA 4F0MA 3N9UC 2M70A 1U1LA 2BANB 3NAHA 3W65A 2MQPA 3VAKA 4NXNJ 3SCJE 2FVSA 3BSNA 5HLFB 3KMSA 3V6DB 2DNOA 1NPKA 1N33J 3DRPB 3GFZA 4FYXB 2H4WB 1NPRA 2LQBA 3KHLA 3MMBA 5KT7A 5A2QY 4ED1A 2AU0A 1TK8A 1FFGB 4C7QA 2VHGA 1Y11A 2FJWA 3I9ZA 4FNHA 2MDAA 4Y2KA 4K4TA 2AJ1A 4KC5A 2ROEA 4LF9F 4WF9Q 1IBLJ 4R5PB 4I6WA 4UF4A 3UDVA 4DU7A 9RUBA 2WVBA 1NH7A 2XS5A 1WF0A 1UVJA 2QMXA 2WB4A 1XNQJ 1U1PA 3ZTQA 1MMDA 1Z4UA 4HHHA 4UOCA 2R2TA 4FDFA 4ZVFA 2D3UA 3MM9A 1RU2A 2IJFA 2HS4A 5AE2A 3PY8A 1VFJA 2CJ9A 2VQFJ 3CJKB 1HL6A 4YOEA 5GAGU 4K0KJ 1RQ0A 5F0WA 1QAYA 2F40A 4YB1P 4LVNP 4PZVA 5F8MA 4U7CA 3QIPB 1U7LA 3A1YG 2V9KA 2YKNB 3HI9A 1MWQA 5HROB 5EHHA 2HS3A 4LSZB 1I94F 1BHNA 2G0IA 3W2VB 1RBOB 3U7JA 3KK3B 4DL5A 2DISA 3F41A 3GG0A 3G82B 1R27B 2PA8D 1Y00A 3D4JA 4OYIA 5A2QU 2DHXA 3J7A1 3H5SA 1SQGA 3VVTA 1REGX 2GIFA 1RTDA 1S0MA 4N76A 4QBUA 4TKTA 1RDRA 3UDLA 5HK4A 1EHWA 4KRWA 1GAOA 4NYPA 3R7BB 4ZP9A 2KJWA 3CJRA 3MMAA 1D9AA 1EP4A 5F9NA 2ZH6A 3PO4A 1LWXA 1VIXA 2YKNA 4OX9J 2G0JA 3C16A 3GCXP 3PDNA 4M5LA 4TXSA 2N7CA 3RJMB 4A8SA 4DX6A 2OMOA 2DEIA 3FDSA 3ZZRA 4TY8B 5LMUJ 2JDJA 1HBUB 4NWBA 4LQ3A 3BBCA 4F3MA 3B6BA 5GMDA 2HQGA 2DR6A 4KFBA 5E3PA 4Y34A 3TR5A 5C2GA 3CCZA 3TZWA 2KHCA 5I3QA 4CIOA 4ZVEA 3QZ8A 4DF4A 3RB0A 2XNRA 2UUCJ 3MECB 3MUMP 2GX8A 2K7JA 3BPDA 1NNDA 5D0EA 2AX1A 3A3NB 4YMEA 3HMJG 4RNMA 1U47A 1IKXA 4F2RA 3I4PA 1QUVA 2EBEA 2ZVSA 1JX4A 2H51B 3ENQA 5HMWA 5KFMA 5I42B 4WFAQ 4C8YA 2K06A 3EXYA 2XWXA 4TYBA 3D1HA 8RUCA 5DGAA 3L09A 1VQPS 3LWLA 2HHQA 4IH6A 2WTFA 3DDNA 2OD6A 1RWXB 1PBUA 4MKBA 1B0VA 4WXWA 4PXBA 3IBCB 4U96A 5T41A 3QSYB 3M32A 5IT4A 4B3OB 2IJRA 2DY9A 2GHWA 4IYQA 2EFQA 2KJVA 1VIOA 4MIAA 4AYBD 3GIKA 2I2YA 1IKXB 2DTJA 4HACB 2Z57B 1Y5NB 1VQ5S 3PTWA 4OZNA 1RTJB 4ITSA 4Q0BA 4U6PA 1M5HA 2C3OA 3FC9A 4NASA 2GMHA 3KXDA 3D5MA 3DOMB 3CD7A 1XNRJ 1SL2A 4S0MA 5EDWA 1S12A 1YLXA 3D9BA 5HQLA 1GX5A 4DR4F 4KHPJ 2B4UA 3IGVA 4ERDA 3WHIA 3C46A 1FD2A 2VBXA 3CDBA 5BYRA 2MZQA 1TKXB 2LP4A 2M9KA 1T0TV 3CGIA 3MCOA 3PYFA 4K5RA 4ZITA 2CQ0A 4K50A 4O44A 4NOHA 2BM1A 4XO0A 5J2MB 5LXYA 2CYYA 2HNZA 4Q0BB 1BXNA 4ECZA 1N33F 1N8RT 3TRGA 3VGUA 1BY9A 2YKAA 1RWMB 1NHUA 3LH2S 1I1GA 4PWUA 4JI2J 1T9UA 2CNLB 3CB4A 1NB7A 5C24B 3MURP 5KFZA 3KKFA 1FD8A 3FRZA 3OT9A 4YR0A 4HVZA 5F8GA 1HYSA 2VJUA 2R8IA 1JLQA 4TLQA 5E7OB 4G6VB 5ETVA 3ICLA 4NRUA 4PWDB 1LXJA 5CYQA 2V68A 4F36A 2J5AA 2MJUA 2PO4A 3K89A 4H54A 2LXFA 3L7OA 2FJXA 1B7YB 5B0EA 1QTMA 1VQKS 4JI3F 4WZQA 2PDAA 5J1PA 3JTPA 3SYZA 2FZGB 1T9XA 4DR1F 1REVB 3IS9B 2DNRA 1HNVB 1V3RA 2NXJA 3KUGA 4X4QA 2D69A 2ZD1B 3OBIA 3PYEA 2Q66A 2CXEA 1RA7A 2IM0A 1NDLA 2W9CB 3SXLA 1NXIA 1N5QA 2CJKA 1X5OA 1TL5A 2HVDA 3KLFA 2DPIA 2HBQB 3A3OB 3QO9B 3T5KA 3DLBA 2R7XA 3UDCA 1LK5A 4B9MA 1QAXA 3LP1B 3J81j 5LJ3Y 2CPHA 1VQSA 3MPYA 1UWBA 2XY7A 1FTRA 1AA1B 5JUMA 3I4HX 1NBEB 3CW2C 1BQXA 1TKTB 3MD1A 4QYZJ 2BJ1A 1T7PA 5DG9A 3TUPA 2V2VA 3FBEA 4H4KA 4ZP8A 4JI3J 2CJXB 2I9SA 1YJNS 2UU9F 2DB1A 2QL7B 2W4CA 2VF3A 4OHVA 1JLGA 4A8QA 1IR0A 2XSFA 1X60A 4UY8T 2YXLA 4CH7A 4I7FA 2DRAA 4CH1A 1RTHB 2W7PA 2C2OB 2MZRA 2RD5C 3CCWA 3UN5A 2DIVA 2ZKUA 4GVBA 4K4UA 2AT1B 2POKA 4NL5A 4ECWA 1MSWD 2GVDB 1RXOB 1TELA 3MD3A 3CIZA 2J7UA 2W4PA 4YP3A 2IRXA 2YNFA 3QATA 2AEMA 2W4DA 3TA1A 3EICA 2B6AB 3H8YA 4C3LA 4BCAA 4TY9A 2J6SA 4EI2A 2EK1A 2OSRA 3OV7A 2CVEA 3RR8A 2FGOA 4RBTA 2JH3A 1MMLA 4C3KA 1UFWA 3H59A 4DR6F 1WELA 3I0RA 3V2UC 1A6LA 2GCFA 3A12A 4DSLA 4OYWA 4KH1B 2KM8B 3K17A 1L3UA 1IBMJ 2FJAB 1GEHA 2C22A 1GTEA 1KVJA 2RVJA 1M5OC 3MM8A 3CDAA 5HVFA 3JXOA 2ZEJA 2VA2A 4DV6F 5KFOA 5I3UB 1OY8A 2EW9A 2JJ4D 3NS6A 1JMTA 2KZZA 3POTB 2YWEA 3BO2A 4K4WA 2WSCC 4RW8B 3D6FB 4OV1A 4L72B 4WTYA 4B17A 3MDFA 4M5KA 3MEEA 4HH1A 1S6QA 3KG4A 4CWBA 2J6UA 1N32J 4FBTA 2U1AA 5HMXA 2HVHA 3QJLA 2HS0A 1CLFA 3I56S 1F5CA 1L3KA 2VD3A 3OTBA 4DQRA 5KFCA 3DHXA 3HZGA 2X1FA 3H4BA 2R7TA 3K5LA 1R0AB 4WFNQ 3X1LB 1OQ6A 1A9NB 3CCSS 3Q83A 4CM0A 1UJ5A 1YRXA 4FKYA 3ZZPA 4YQWA 3PR4A 2R2RA 1JKHA 2B9EA 2B9WA 3EJMA 3CULA 2HWIA 2HAIA 4QQBA 2OELA 2YNIB 2XCPA 3FSIA 3TI0A 2MY7A 3H7HB 1R0BG 1UW4A 1RE1B 3E3XA 3QIDA 2FB0A 1F2GA 1O5JA 4M63A 5H9EJ 4M5HA 3OLBA 4USHA 3J7AN 2FJBB 4DR7F 1KLNA 1WORA 2AP6A 2BJ3A 1VQ6S 3K2YA 2GQQA 4M5DB 3D0HE 1JQGA 2J8AA 1R0AA 1KFSA 2IBKA 3HO1A 1N32F 1HD1A 3A8JA 2XY5A 3ZO7A 1EAYC 4FKXA 2R7VA 4Z7CA 2KFNA 2RS8A 1PO6A 4DUZJ 3NCQA 1DQ9A 1U2RA 1JLAB 2H3EB 3DLHA 1ITPA 3SQGB 2EVZA 4KAIA 3M8YA 1Q8KA 2LMIA 5LSRA 4ZVRB 1IKYA 2C3YA 1KDNA 3DFEA 3GTYX 3KDOA 1WC5A 2P5VA 4P72A 3W2VA 1GMUA 5IQQA 1S7HA 3D7SB 5EWGA 1PG5B 4ZVSB 1FDNA 4ZJOA 1OQ3A 2O66A 3ENAA 3KJVA 1RCXB 5AT1B 1RTDB 2HHHF 1VQMS 5B0DA 6AT1B 1Q7YT 4FXWA 1FKAF 5IS2A 3A8KA 3CO9A 2AF6A 2FHJD 5F41A 4B9NA 1Y10A 3C6UB 4GKJF 1VOMA 1OS5A 1NM2A 3SCKE 1WKJA 2EWHA 4DU8A 1OIAA 4IH5A 4U8YA 3PX4A 1IKYB 3AD9C 4OZ1A 4DI6A 1YRTA 1SJQA 3BYPA 1GXLA 2RRBA 4RUBA 1FX2A 3PR5B 4DR3J 4EFAC 1EETB 1TV6B 1ULRA 4DUYJ 2ZM6F 4KGXB 5HBMA 1GNKA 3MCMA 4RR5A 1VQ9S 1RGVA 3MECA 2UXCF 2Q6CA 1HLWA 3DLKA 3S8SA 1NKEA 2VG6B 3MCSA 2DNKA 2HNYA 1FE0A 2I5JA 2QX0A 5KFYA 3M2VB 4CLUA 2UUBJ 5H1SV 3C6UA 5LL6d 2C1EB 4DX7A 2L9DA 1RWOB 3MGJA 4GO5X 3U27A 4Q7AA 4CQ1A 5CD4A 4O3QA 3KK1B 3W66A 1WHYA 1EZZB 3L7UA 2CZVC 3M2UA 3AFGA 5KOWA 4FXDA 4ZP6A 1DFDA 1KR4A 1PGZA 3SMZA 1EQMA 3L95X 2JC1A 3BBBA 1RHJB 1B7FA 3IFEA 3GQCA 2AGPA 2XMVA 2VG7B 4J9LA 1GTHA 2QA1A 3H98A 1TTHB 2OAUA 1FDBA 3CSKA 3P4UB 4MMOA 5DDOC 2DR7A 2IA6A 4LF4F 4MIBA 3HDSA 1QM9A 2F65A 4DUYF 1JLEB 2QA2A 1X4AA 4LF6F 4NCBA 3NL0A 5AJ3F 2VU5A 2LA4A 2QE5A 2WVFA 4X4PA 2KRBA 1CS4A 1H2UX 1VRTA 2OD4A 4DDFA 4X66F 1N56A 2ASYA 5IZHA 3K0JA 2BDPA 2IVMA 1NCLA 4RO0A 2ABYA 2ZC3A 4CLKA 4F67A 3GYNA 2CQ3A 3CMAS 4I64A 2XYPB 3HZEA 1R89A 1NDPA 1RWKB 2R4FA 2IC3B 1RT6A 1S1WB 3GJTB 2PGCA 2HAFA 4DBQA 3TZYA 5LMNJ 4QCLA 1JB0C 2R2SA 2CQ1A 3TUIC 1S6PB 3TNVA 2XMUA 3BQ0A 1CSJA 3RRHA 3ET6A 5E3AA 4A8MP 1KQGB 2DGTA 4ZJQA 3MAHA 4JV0A 5GMEA 2VB6A 4DG1B 2MJNA 4Y2CA 2CQ4A 1ZYQA 4B3TF 4GMKA 2XBPA 2MQNA 4OZ2A 5C24A 4J90A 2AQ4A 1N34J 3MMAB 4DSKA 2ZBQA 2A6OA 3G9CA 1S1XB 2HK3A 4XTTA 5KTQA 3HKWA 4IKAA 1W2IA 2DNYA 2DXEA 2PEBA 1OSDA 5DJBA 4ZS6A 3UR3C 5F9LA 1FA0A 5A8WB 1C0TB 5F3ZA 3W8GA 2BVZA 1JLQB 4JI6F 3J7YI 1HBUA 2IA0A 3MWBA 2I1RA 1F3FA 2WHOA 2YX7A 2JZ5A 1Q1KA 1SC6A 5CZXA 3N28A 3JSYA 5KOXA 4USMA 2ZH1A 2VODA 2HSEB 1T02A 4LMZA 2JLGA 2BYCA 3BH7B 1SL0A 4BC7A 3RAMA 1S5ZA 1M5VC 1PIEA 2WZ1A 2RRNA 3D6TB 3IP0A 1KC8T 4DWIA 3BDPA 2DH7A 2ZD1A 3GIIA 5I42A 3O6QA 3PKYA 3T5HA 1SC3B 3MF5A 1FX4A 3SDEB 3WQPA 4CO4A 4CM2A 3CCVS 1HW9A 1H7XA 4Q43A 4V19X 4LBPA 4IFVA 4KPYA 2Z58B 4K4ZA 1VQLS 2FJDB 1FDDA 4K7QA 1KONA 2JWNA 4KHMA 1F0XA 2CNNB 2F8HA 2BE9B 2KYXA 3N6LA 4OYXA 4FYDA 4YN3B 2E5IA 3FEXB 4EZ9A 1FXLA 3EGWB 4LIRA 2EG2A 1HNZJ 2L3MA 1ZA2B 3CJ8A 4QPXA 1XJWB 4USWA 5B09A 1DRZA 5C25A 4CO3A 1SKSA 5I4MA 2BABA 2RUSA 5HN0A 4UQGA 1EKSA 1GX6A 2XMTA 4IOCQ 3M05A 3K5OA 4I7FB 1F3VA 5LM7E 1JLCA 4DZDA 2WSEC 2K3KA 4ICLA 2KDOA 3FBFA 3SQOP 4X64J 4DEZA 4ELVA 2GA7A 3FQKA 1O6XA 2ACMA 2YNFB 2HMIB 1SQFA 3BKUA 2MXYA 2KT5A 1K44A 3N4WA 3UO0A 3THTA 1S1TA 3LUYA 2XGQA 3CE8A 2XCAA 4WYWA 2R7WA 5IV3A 1HNZF 2DBBA 3W8PA 3JYTB 1RP5A 2ADCA 4DV4J 5CH7B 3K5PA 2PFFB 3M8WA 2LQ5A 2F7VA 3FEZA 2AWZA 2D7SA 3KTQA 3D1QA 2JL9A 3LP0B 3DLEA 9ATCB 3M30B 1M1HA 3D1OA 2BQ3A 2HG4A 5ETTA 3DLLQ 1LWEA 3DN9A 5F8NA 1TKZB 4U67Q 2UUTA 1UPMB 3MM6A 2HRYA 4ELUA 1RHQB 4ETZA 1ZM9A 4N5SA 1M5KC 2AEJA 2GO9A 4KGZB 4QWAA 5I3UA 2YQ1A 3UD4P 1C1CB 4AXIA 3MEGA 3OTCA 1FFWB 1U1MA 2DGWA 2HYIB 3S7RA 1CJKB 4DV7J 2VPWB 2RF2A 2ZOMA 3N01A 1FRJA 3NOGA 4X62F 2Q1LA 2CFXA 3WIUA 1U1KA 3OFGA 4DV4F 3EGNA 3EM1A 5B0CA 1VRQC 3ADAC 4DR5F 2NXCA 3MM6B 3H90A 4ILLA 4CI0B 2QT7A 1RAAB 2Z8QA 1ZS6A 2QZ8A 4QYZK 4X65J 4QJVA 2AJ2A 3DGPA 2HVZA 4RNNA 1T94A 4J9QA 1ZOTA 3EGZA 1HMVA 4ID5B 1HQEB 3OFHA 2LECA 2QGFB 2QLJB 4ZLJA 2LQ9A 4A8KA 1UWBB 2N3LA 4CLTA 4B3SJ 2GGPA 3B78A 4HT5A 3NS5A 1CJKA 1AT1B 3HT0A 4WIIA 3QJPA 1IM4A 1FNXH 2AJQA 2RKIA 1L3TA 4KKOB 1U09A 2FZCB 3NGSA 3AOBA 2W9AA 2WVCA 1U2FA 3R27A 5KFQA 2XTJP 3CWJA 3M6VA 2ZKTA 4K8RA 2W25A 4DQIA 4DFJA 1RTHA 1O8BA 1S1UB 3DRRB 3LQVA 2E1MC 2Y1RI 5KG3A 5CABA 1U48A 1WACA 3G86A 3JQKA 2ZJRQ 2RNEA 5AXNA 5KFAA 4DV2J 1B3TA 3HM9A 1TU0B 2D3O1 3DMJA 3CD6S 4DPXA 1IBKF 2WAQD 2ZH9A 4BDPA 5C7PA 1AYEA 1JNZB 4B3SF 2GW8A 1YGYA 2DGVA 4QW9A 5F8HA 2UXDF 1PSDA 3RZAA 2VPZB 4B3OA 2CAJA 2K1RA 1P27B 2EXUA 4YFUA 4C8NA 2AKWB 1KLMA 3MCNA 2HZAA 3VGTA 2HNDA 4HACA 1DTTA 2PT0A 2WOMB 4ZN3A 4LR9A 4K2JA 4F8RA 1RTJA 1QVFR 3KMQA 2MTLA 2MSTA 3SFGA 3G8TA 3MMCA 1C0UB 1FKOA 3P45B 3G71S 2ZH8A 2MKJA 1H74A 3MM8B 4B3MF 4HR2A 3Q8YA 1JLBA 4P10A 1A7GE 4J9KA 1OWXA 4Q2LA 4DSEA 2CJAA 2VKRA 5F8LA 4L3KA 1LWFA 2V69A 5KT2A 2F4FA 5D6GA 2DITA 2ZHBA 2OEJA 2E5GA 6FD1A 5DQIA 1DZ5A 2KFZA 5D0GA 1PJ6A 1Q95G 2XNQA 3SIPB 3JAMY 3MMBB 1Y5IB 3I5AA 3IWLA 3NAIA 1U45A 4F2SA 2KZMA 1VCTA 1QE1B 3MEEB 4WZMA 3JQJA 2BE2A 1QAIA 2E9RX 4FS2A 3PXGa 2MZJA 3V4IA 3NXZA 1IKVB 2CQIA 1G6BA 2DNGA 1UVMA 1CJUB 3OTDA 3ZTOA 2EFOA 2RHSB 1S9EA 2DGOA 1OY9A 4DV5F 2HHSA 1NK7A 2MYFA 4UW2A 4AQYJ 2JHEA 4ZLLA 4JV1A 3W2WA 2QV6A 4NMLA 4I2PA 5IQ6A 1RAOA 2O1PA 4O3OA 2KXHA 5L1IA 3AB4B 3K8VA 1YBUA 3VALA 2BE2B 1I51B 1ZA1B 5IC6B 4EO8A 5HJYA 1MLAA 3V4IB 3O5TB 2J8SA 4PYAA 2FHMA 2QYCA 2RJZA 3IR5B 3LW5C 2P9GA 5KFRA 5EN1A 2RQMA 3ZFVA 2QMWA 3E01A 1SJ3P 2FHOB 3A8IA 5KFXA 4DCPB 4CLPA 3HD2A 1W2BR 3UVJA 1S79A 1T03A 4JI0J 2ZWOA 1TP7A 2MZSA 4DV1J 4F4KA 4U9RA 1B64A 3GFYA 2WVDA 1HBNB 1FHTA 4CYUB 2DHSA 4KT0C 2RDIA 3PEJA 4URQU 2RSQA 1RISA 2C2ZB 3QT8A 4ER8A 3PX0A 4QPTA 2L48A 3JTOA 2KH9A 1VC6A 2YPZA 3B82A 4URSA 2YNGB 2CADA 1TL4A 2ZE2B 2XMMA 1P6TA 1KBRA 1S48A 2YH0A 3GJQB 3LAKA 4LR7A 4RW6B 2XO6A 2F5GA 1R8HA 4KGKA 4NLVA 4I56A 4DG1A 4DQSA 1HBMB 4K4XA 4Y6IA 2XMAA 1LW2A 4DR2F 4I2QA 2JFDA 1BQMA 1HBNA 2HGMA 1WG4A 3A4TA 4M5JA 1K1SA 2RQCA 4NA1A 5K5MA 2DNNA 2DO0A 1U8WA 3FMWA 3LPYA 4EYHB 2BJ8A 2VPYB 1OO0B 3IRWP 1IWGA 4O23A 4RBUA 4F02A 1RU1A 4M95A 1TL3A 4J37A 3KDNA 4PABA 2UV8A 5L9XA 3TQ1A 3PW0A 2LQ8A 4AUKA 4O3RA 2J7KA 5KAKA 3GJRB 3CF5Q 1I94J 1FK9A 4ANCA 3MFHA 3NNAA 4IFYA 2XI2A 3T3FA 2VG6A 4IQXA 5EUHA 3OHBA 5FDLB 3T6BA 2NLWA 4KO0B 4XPCA 1R8AA 1TK5A 2KTQA 4A4JA 4C4WA 1DQAA 2DT9A 1IJFB 2YKMA 4LF9J 3H0PA 4ECUA 1UZDA 1WC0A 2XSJA 3OR1B 4C11B 5DM7Q 5JMNA 1HHTP 3M2UB 1HQUB 2MQOA 4OZLA 1CC8A 5KG4A 4ED0A 4ZVHA 5K8OA 3SV4A 4L73A 5GVQA 1XNQF 1IWAA 3H2UB 4G65A 4OX9F 1TUVA 3MR7A 3R5BA 4OL8A 3DKDA 2Z30B 2LU1A 3BO3A 1U49A 1NZ8A 2JC0A 2H9ZA 2ZDPA 3RBXA 5KG2A 1WI8A 3N6NA 2VQFF 2QRRA 1W7WA 3M8RA 1C1BA 3V6DA 5J1EA 1M5SA 2Z0GA 2N4DA 2VZ9A 3NRBA 2LXUA 1NJZA 3AODA 2E7WA 4FP9A 3T9NA 2NYHA 1CS4B 1VRTB 3ZNUA 1RWUA 5MLCV 4OI6A 2FVQA 1AFJA 2CPJA 1FNMA 1S6QB 3R5JB 2EFNA 8ATCB 2GV1A 4ANDA 4CLLA 5L9NA 2ALZA 3ZZTA 3S1TA 3QWUA 1F9HA 2IRUA 4E0DA 2XMWA 1B0PA 4RPFA 2A6MA 3RAQA 3HFVA 2H54B 2CWXA 3TEHB 2Y9HA 5KFGA 1Q7LB 5L46A 1OPIA 1K0TA 3MM9B 4I69A 4LBHA 2AZ1A 4DPOA 2W8KA 4N41A 2HW3A 2C3UA 1M0SA 4PWDA 3BREA 1VRUA 3FJ2A 3VQTA 1CJTB 1FWLA 2GMLA 4NZ7A 1WOPA 2YNIA 2W2QP 3FMBA 1WI6A 4P74A 1DTQA 1RJJA 3PW5A 3CCTA 4P75A 1V3SA 1YBAA 4NLXA 2EI5A 4OHZA 3NMAA 1N36F 5DQHA 4QIVA 2DY1A 3E2EA 4IG0B 1S1XA 3KWMA 2FIUA 3KK3A 2E5HA 2KN4A 4KR0B 2FVPA 2OEMA 3KHRA 4WFZA 1XNRF 3U1LA 4LFBF 4O4GB 2C2RA 3CVKA 3KK2B 2W9CA 3A3PB 4KIAA 3IG1A 5B08A 4KJIA 1JJCB 1HHSA 1NUEA 2BR0A 1CJTA 1JXLA 2DNHA 3MTKA 3RBZA 2IAJB 3SSSA 2V4JB 4ANEA 4YY3F 2GFFA 1C1CA 1NEEA 1NSPA 1WHXA 2KRRA 4W98A 3THPA 3GV8B 1YBTA 4A46A 1ZETA 3O8WA 2YKPA 2JFKA 4JI5F 4DSJA 4DS4A 2EKNA 2SXLA 4NLYA 4G1QA 5KG5A 1ZZNA 1TKTA 1AFIA 3T19A 4B08A 4DCOB 1HI0P 5SUHA 3T1YJ 2R8KA 1LW0B 5A6WA 5GMKa 5KG6A 1XEZA 2HIYA 2KB2A 1JLFB 3DXBA 5KFKA 3HKZD 3QZ7A 1MMNA 3CJSA 1PBAA 1K1QA 3LF0A 3HHKA 2QSFA 3R5DA 3BV8A 1U6FA 3IM8A 3P96A 2B43A 4LFBJ 3G8SA 4WU2A 4C8MA 2F63A 1S7IA 4GVBB 4C8OA 5L8RC 2W7OA 1ICEB 2MGZB 3FUYA 3DM2B 3KLEA 3K5MA 1UEKA 4DSFA 5KFSA 2VOOA 2JVRA 4HL9A 1BWEA 5E3RA 4NLOA 4C9DA 3W9JA 4YY3J 5DLFA 2HBRB 2VBWA 4DR7J 1VQNS 2RRAA 3QQCD 3T9ZA 5AE1A 2IBOA 4JI5J 3NWRA 3GZ7A 2CRLA 2J7WA 2RU9A 3AJ1A 3W5ZA 2EKYA 2E5JA 3IRXA 2OPPA 2AW0A 4I4BA 3TUJC 3D3BJ 1GQEA 1Q16B 3MPUB 3OW2R 4CLZA 3T1YF 2XS7A 1TVRA 2HQCA 1YJ9S 1CEZA 1HARA 1Y4ZB 4NLQA 5M2RA 5K14A 1TAUA 3Q22A 3DM2A 5DGBA 3AQPA 2JEIA 3WBZA 3KLHA 2LA6A 3MUVP 2KU7A 3TX0A 3W60A 4HKQA 3VVUA 1IKWA 4TU8A 3QFWA 2ASLA 1N0UA 2EEYA 3IBWA 5AXKA 4RNFA 3FKBA 1PJ5A 4QWEA 4XDCA 2M52A 2HIQA 2DRDA 3LO3A 2YNHA 3TVKA 3KJNB 4WTOB 2C28A 1S0OA 2DR8A 1KHWA 2M8DB 3I0SA 2A1BA 4BS2A 3DLEB 3PNIA 1AB8A 4ZP7A 1BQNA 2HURA 5M2UA 4TU9A 3I55S 3CCES 1S9GA 1J27A 4N77A 1WDDA 1V5IB 4TQRA 4H4OA 1HBOB 5IC4B 4ZN1A 1S72S 2H48B 4A8OA 3SCLE 4IR1A 2ZZTA 2I6WA 1M5PC 1RK8A 2QFIA 1WTBA 4ZJLA 3SV3A 3HVRA 4LRAA 1FKPB 3FFIB 1VHFA 3RYLA 3BSOA 1KFDA 1S1WA 5CZVA 2UVVA 4K0KF 3NS7B 1HI1A 5D3GB 5ETOA 1U1QA 1F2HA 3T6JA 4F4WA 3NGTA 4OFZA 2AGQA 5D77A 1X0PA 3TJ8A 1N52B 2KM8C 1JWWA 1H0HB 1WJ9A 1S9GB 1XR5A 2QMUB 4NLRA 3UCUP 2VBZA 3NNCA 3CDWA 5IT9Y 4A8XA 4V1Ak 1S9EB 3NLCA 4I6YA 4EGLA 3TAMA 1R8PA 2E1RA 2YY3A 1ZTWA 5A8RB 3ZTRA 1VQ7S 1AROP 5HANA 2X1GA 4HHJA 4ES1A 3HP6A 3MR2A 3ZTPA 2GGPB 5FJ4A 3D28A 4OX6A 4WFYA 1UVIA 5D3GA 1RLCL 1R7IA 2AMCB 2PEHA 3BGFA 5CYMB 3CJ4A 4OZ3A 3KJFB 1HWIA 1KOHA 2HRUA 2ZUGA 4OYBA 4PWWA 1NH8A 5HI7A 2K7KA 1YWXA 3G4SS 2PI4A 2F9JA 3PACA 5B0FA 3OQ2A 3MTJA 4PCQA 1EARA 5L1JA 2K3IA 3E01B 4PQAA 3UFCX 4DV3F 3MM7A 2IYIA 3ZC4A 3P5TL 5EX3A 1T03B 1HNXJ 4J9PA 1S76D 1SH2A 3JB9k 1UVNA 4J9RA 2WW8A 4AL7A 3GWCA 3GSIA 2MKHA 4HI1A 2AX0A 2GNKA 2OPQA 3SZ2A 3DGVA 3P49B 1BE4A 2GJ2A 1X4EA 2DNZA 2GVZA 2WSFC 1W25A 1NSKL 5K8MA 1QSYA 4DL4A 4URGA 4FF1A 2LU2A 1TL1A 4JI1J 3FRYA 2EPIA 5HQMA 4IUFA 3GFXA 4N7TA 2M2BA 3SFUA 3M8PA 1WSRA 4OI4A 4Z37A 4ZHRA 3MM7B 1CQNA 4B02A 3CXCR 1FJEB 1KSPA 2DKOB 4RW4B 2VQEJ 1NDKA 4B9SA 1HBMA 4O0IA 1LW2B 2GHPA 1C0UA 1FKOB 5GADI 4GO7X 3QLHB 3M8ZA 4RWWA 4WFXA 3U1MA 5K8NA 2VFTA 1ACMB 1RZMA 2DR5A 1VQYA 2BKPA 5AE3A 3CCMS 3BZQA 4LRBA 4Y00A 5EWFA 1YJWS 2HZVA 2B8PA 1UA1A 5C42A 4IG3B 2VH7A 2IY5B 1U0HA 2D3OR 5HSPA 3HHLD 4KHPF 4FPRA 2MHEA 1RWNB 3K5NA 4DQPA 1NK5A 4JI1F 4WE1B 3DDIA 5IOLA 4BBYA 4NLWA 3M1VB 3NNHA 3QRPA 3ZXWA 1YITS 2N4CA 2L9WA 4OHWA 3I5BA 4KO0A 1P8GA 2RE1A 3BGRB 2VQEF 1TL7B 5ETPA 1R8CA 1X5SA 1KD1T 3DC2A 1UJ6A 1NKCA 3C6TB 1Z2LA 4LQ9A 1LV5A 2OLWA 2QLXA 1UVLA 2O3DA 4XAKA 1BWVA 2ZHOA 4MK7A 1LWEB 2CUYA 2VPXB 5U47A 3LTOA 3RB4A 2GO8A 3MFIA 2R9LA 4PKDB 4L74A 3G2XA 2UV8G 2W8LA 2MEWA 2V9WA 1H6KX 2DHAA 4OQJA 4UZBA 1VMBA 1NZAA 2CA9A 2QG9B 3R7NB 1VQ8S 4O3PA 4QIWD 3KG0A 3KG1A 2ZNZA 3NCPA 4F25A 1X31C 1NAQA 2BKNA 3CIMA 2VV5A 5J2QB 3J80Y 2RU3A 1ZM4A 1RT7A 3HVWA 1YSJA 3CEDA 2R2UA 2UUBF 3W1YC 4USTA 2OTLS 1X4CA 5GADU 2E29A 3DNCA 1SH0A 3EVMA 3IR7B 5KFVA 2ZJPQ 1NSAA 1XC9A 2A3JA 3PEHA 3J81Y 2V2ZA 1SL1A 4W90B 1UP1A 2HHPA 4OMFG 4A47A 1P9QC 1R0CB 2QO3A 2LQJA 2QYGA 5J1NA 3H2VE 3GV5B 2MLXA 4P71A 1RWVB 3KLGB 1U1NA 5E5NA 5ETNA 2F8EX 2JEJA 1RT7B 2D9OA 2A18A 5H9FJ 1GXUA 1FE4A 4JB8B 1RTIA 1Q86T 1RT2A 1ZPVA 2R7QA 2BEFA 3RUBL 5KG0A 2NREA 2ZH7A 3OVBA 4DL3A 4I2QB 1VC0A 1YG0A 3PJXA 5CHCB 3G6VA 4X66J 1CULA 2R3VA 4LF4J 2DNLA 1NB2A 3FEYB 2E9ZA 2UXBJ 4KHRA 3KUEA 2G13A 1VHIA 2PMWA 4UOFA 3MM5B 4PPDA 1MROB 2CKWA 4KPCA 3AB2B 4RLEA 1RAFB 2XHWA 1YI2S 1QLNA 1TL3B 2R8HA 1CVJA 5LMNF 4H4MA 4HTIA 3BDEA 2APOA 3U02A 4ECQA 3PHEA 2X1AA 4OLPA 5IV4A 4GC7A 4XIUA 2CQBA 4QR2A 4MKAA 3GFHA 4DPYA 5FDLA 1PAUB 2DO4A 2DNQA 3RG6A 2GAHC 3BN4A 2F4VJ 2VONA 1JJ4A 4R8UB 3POTA 1E6VB 4HDGA 1FTCA 3VAFA 2B7BB 4DR5J 4JI7F 1KLMB 1KKHA 3FBCA 4NXMJ 2HQIA 4LF6J 1RUSA 4DR6J 4OJGA 3DLKB 4KY3A 4IO1A 3H4DA 4CRJA 4USJC 2HNYB 2I5JB 2XLJA 3NOCA 4YR3A 2QL9B 1WC6A 3Q24A 2BE7D 2P9EA 1SJRA 1VBKA 4Z7YA 4ATNA 5K8PA 3RAXA 3GMGA 4YR2A 3R1LA 4RL1A 4AT1B 2R8GA 4LREA 3Q8QB 2HVEA 2KHDA 3BSAA 3GLJA 4USVA 4XK8C 3I82A 4I68A 4KGVB 4ZCLA 3MZIA 5LJ5Y 2XS2A 4JYAJ 2MLZA 4KGMA 2F4VF 2ZZMA 2YPYA 2E66A 1R43A 2Z2ZA 1AUSL 4PYDA 2RUGA 1SJFA 4M5IA 3M2RB 5A0YA 3DCAA 5IXUA 2FTRA 3QJJA 1YRUA 1VISA 4UUXA 4J9NA 2HBYB 3C8YA 4OZJA 2GZOA 1XWLA 2IMOA 3M30A 1P9YA 1QUPA 3PJ9A 1UFKA 4CO1A 7AT1B 4QIEA 3OL6A 1H38A 1VS3A 2G9OA 4PPZA 3CC2S 3HLUA 4CLWA 2ZHAA 2RDJA 1CQMA 1X4FA 2BQUA 3DRPA 2Y3YA 4NI2A 2VA3A 4L3NA 2NXNA 2FVRA 3AOCA 1UWAA 4I2PB 2R7SA 2JSXA 2QLWA 2I0XA 1ZAVA 2W24A 3ITHA 3RW7A 3TP2A 4Q2MA 4ENOA 1RBLA 1UL3A 4NZ6A 4E2FB 2XZDB 3LANA 3Q8UA 1NSQA 4R5PA 3Q8PB 1X9MA 1XN9A 4NX9A 4QIGA 3R9LA 2QC3A 4K4SA 3I0SB 4J9SA 4YHHJ 1X9SA 4RUCA 3ET6B 1RSCA 3PVXA 3KNAA 3IR6B 2C2MB 3BEGB 2CPYA 4C8ZA 4ZK7M 2B4VA 2V2KA 3M6UA 4KB7A 3V81A 4UT4A 4H4OB 3ELHA 1SC4B 3HX9A 7FDRA 3LAMA 4LFAJ 4X64F 1PYOB 1XR6A 2OP5A 3OPKA 2L08A 3ITHB 1UEUA 4P52A 3AXMA 1R3NA 1FEEA 1G2EA 3CPWR 5D8HB 3T1AA 2P9CA 1OYDA 5CCLA 3BJYA 3VGVA 1HA1A 5HROA 2E7VA 4XPEA 4OHYA 3DDKA 1NKBA 4G3IA 2ZOFA 1KQFB 3DYAB 1Q4RA 3FSYA 4ED3A 3G82A 3K58A 1YKWA 3OXFA 1SI9A 3HF5A 4HEA9 4P9SA 2AGOA 1S49A 4X84A 2X3GA 3C15B 4ED4A 3CDEA 6FDRA 3MR3A 4DLEA 3PX6A 2KO1A 1GK8A 2C2DA 1FJCA 2M3DA 3Q8VA 5LSOA 3QRQA 1WG1A 3CNQP 4Y2IA 1YJVA 3M9NB 4DFKA 2ZZNA 2DNPA 1YX2A 4GVLA 3DOLA 4X4SA 2J9DE 2FLPA 2MB0B 4C6AA 2G0CA 4MTPA 5A8KB 5L1KA 1Q5YA 1BGXT 2FLOA 2VFRA 2M0GB 4K59A 4GKJJ 1X7VA 2AJFE 5EWEA 4EK2A 1R6VA 2BJEA 2HPUA 3R8YA 2G4BA 1HNWF 3GYGA 2VJVA 5DZ7A 4AL6A 4LF8J 3O2IA 4Y2AA 3LOUA 5CYJA 3OUYA 1WF2A 5D4PA 4BHQA 3GYXB 4MKVA 4KBIA 2VC0A 1U2CA 2VBYA 3D54A 4O44B 1LWCB 3AXKA 1X4GA 1D3WA 3VF0B 2FLLA 2UXCJ 1MG7A 2VASA 1PKUA 4E8UA 2VOPA 4Q45A 3Q2SC 3QT6A 1JIHA 2MKIA 5KFWA 4RKUC 1OMSA 1SKUB 4U7UD 3R6GB 3I6PA 2A0FB 4C48A 3H25A 1D9FA 4RJVA 3VQSA 3J81U 1IUJA 1JLCB 3NP5A 4OYPA 5G4DA 2IDLA 4ZCMA 2PA3A 2B0GA 2AHOB 4OIXA 3CD0A 2XWYA 1I5OB 5ETKA 4ES3A 1S77D 3ZZZA 4WKRA 3AT1B 1QE1A 1FRXA 3NG8A 4OI0A 2ATLA 1EJ7L 4UOGA 5CYQB 5AXLA 1CBKA 1HFEL 3G8QA 1FFSB 5F0UA 1RHUB 3G96A 2O5DA 1U4BA 1FO1A 4X62J 1CJVA 5HQ8A 2YBVA 3L4BC 2RS2A 3C66A 1FNOA 1V9OA 3PW7A 1JXEA 2ZC4A 3E8OA 3LGNA 2L41A 2BQRA 4B3RF 4ZVUB 2QLBB 3E51A 4QYRA 1EX8A 4P7TA 5KFHA 5L1LA 1C0TA 3QBCA 2UVUA 1FEHA 3GR1A 3O3LA 1JK9B 3UN3A 3X3UA 4DLGA 1X9WA 3CDUA 5CXTA 2AD9A 1Q78A 2AYGA 4DUTA 3QO9A 3DRSB 4AXJA 1X4BA 1YJRA 1HNIB 3WZ0A 1TL7A 1CJVB 2HFSA 3BR8A 3HFZB 4MAKA 4UUWA 4E98A 4OJ1A 5FLXY 2CDQA 1T9WA 2GIRA 2RF2B 3W63A 5GAEI 3FZ2A 1MU2A 4B3TJ 1TMJA 4M5GA 2HHTA 1SIZA 3UD3P 1FWPA 3KYLA 3V6JA 4O4GA 2Q43A 4C0OC 4MH8A 2ZJQQ 2J76E 2HFUA 2DGQA 4ALZA 2HFZA 1B99A 4LSLB 5HP1A 3OSPA 1KHVA 4P6QA 5KFTA 2V4JA 1KRPA 2YH1A 2JVOA 1EIYB 3W62A 2P6SA 2PC6A 2FQQB 2D3ZA 1J5EJ 3GSDA 2OO4A 1PYTA 3F44A 2OGUA 4J7CA 1SV5B 1T95A 2VFUA 4PXEA 1RT4A 4DPTA 4ES2A 4KKOA 2P6TA 1Y3JA 1X0FA 1T05B 2M4MA 2JEGA 3JQMA 2CQGA 4UTGA 4TU7A 1GFWB 4U95A 2V5HG 1I3OB 5KFEA 2E9TA 2BW2A 2PFDA 3MEKA 4M5MA 1N6QA 1WKKA 5FIIA 4WP3A 2FHKA 2WVEA 3HHLC 5B0AA 3WX8A 4OX7A 1NJIT 1FI4A 1MN7A 1LFPA 3BGLA 3DU5A 4CNYA 4DPWA 4EUVA 3M8PB 1ELOA 2HEKA 3KLGA 1NK6A 3BGOP 4X4UA 2IM1A 2KG1A 5KFJA 1KVKA 2RAQA 2B7CB 2VKZG 2BMBA 1RT4B 3AH6A 2EC0A 3UWTA 1FK9B 4ZKAA 3CUNA 4ILMA 2DXDA 2AJ0A 3CJ0A 1SUQA 3EZOA 1G3OA 1U0SA 4QWCA 1D9DA 4J5OA 2WRMA 1JLGB 1L3VA 3I32A 1S59A 1X5TA 1WOSA 4PAAA 2MKSA 5B0BA 2W2MP 3R5CA 2B4OA 2CNOB 1HQUA 1KWMA 1FCAA 1U02A 5KFIA 3NBPA
chains in the Genus database with same CATH topology
1DLOA 1WD6A 2F8MA 2M7SA 3MMCB 4Q8EA 1B0TA 1KOOA 4AQYF 5JXSA 1N5YB 2B6AA 4A8YA 2DH9A 1T3NA 5IM0A 3C2PA 1AUDA 1Q8BA 4OJ3A 3KFWX 4MYTA 3PO5A 1Q8IA 2E1AA 1U6ZA 2MHNA 4DJBA 5J1EB 4QWBA 1VGYA 2OFHX 4ZPTR 3UPFA 3GV7B 3CCLS 1FXDA 3P3DA 3C6TA 1IBLF 4ZMMA 1ZM3A 3HHDA 2KXNB 4Q5VA 2V8VA 3BB5A 3NBPB 1NJYA 3TOQA 3T5LA 3HVTB 5CD4H 3TA0A 2PSZA 2MKKA 4B9LA 4ETXA 2Q3PA 3M8SA 1KNZA 4ZOSA 3OFEA 3IO1A 4NLUA 1WHWA 3M6XA 5BR8F 2MZ1A 2AYBA 4F4XA 2N3OA 1YIJS 3MOZA 4KE5A 5MAOA 1T8EA 5B7WA 4N47A 1S9FA 1UA0A 2VG5A 3MOJB 1O0PA 3BSCA 4DL6A 2RKIB 3N5FA 3QAEA 1PILA 3GE9A 5IT0A 2OIHA 2CQ2A 1KN6A 3TA2A 2UUAF 2PIIA 2NXUA 4OI1A 2E1CA 4WJBA 2ADBA 2EFPA 3J7ZT 1S1UA 3DRRA 4K2XA 3HJFA 1VBXA 1CPZA 3GB0A 3PW2A 1HPZB 3KLIB 1ZBTA 4RX6A 4F3QA 2FPHX 4FF3A 3BN7A 2DCUB 2J0WA 3IAS9 3LGMA 3TUZC 2DPJA 2LEBA 1JJ2R 4FBUA 4JV5F 2CPZA 4NCGB 4MKYA 4TQSA 2A2DA 1HI8A 3KHGA 5J2NB 3I96A 3O44A 2V8GA 2CZ4A 2UVWA 1MWYA 2K1RB 1U1RA 3QGHA 4DOZA 5J2PB 2CJQA 2W9BA 1HPZA 3KLIA 3D0GE 3G6XA 4RUHA 4LF7F 1FJ7A 1RT3B 1H3DA 4YDDB 2ZDOA 3OL7A 3MEDA 4RZRA 3H40A 2AV5A 2LEPA 2HGNA 2LDIA 2BRKA 4Y3CA 3SQGA 2JEIA 1N5TA 2DGUA 2YTCA 4FN5A 3LWMA 3H5YA 5J2NA 2B5JA 2HWTA 4R25A 3MHYA 4M1KA 2K8GA 3AQOA 3HHLB 4JUZA 2EG1A 1KQSR 1E6VA 2GC8A 5E41A 3S01A 3L7PA 2C42A 4MJKA 3KJVB 1WEYA 2VG7A 4FS1A 2ILZA 2ASDA 2DIUA 3GR0A 1IKVA 2OH2A 4LF5F 3V6KA 1JLEA 3TA1A 5K14B 4Y28C 1P1LA 3DOLB 1QVGR 2XI3A 2YKMB 3LP2B 4CTAB 1LFWA 5A8KA 2Z2MA 1E6YA 4EO6A 2OPSB 2QEXS 4QU7A 4O3SA 2IVFB 3HHLA 1IKWB 1TK0A 1YVFA 2RT3A 1I6JA 2FC9A 5BYSA 1IN0A 5DLGA 5DDPC 2Q6BA 2IC3A 2J9CA 1TKDA 3VAGA 3Q23A 3AHPA 3OTEA 2I38A 4ZPAA 4P2SA 2XZWA 2UXBF 2A10A 4JI2F 4NCAA 1HWKA 2FLNA 4MYUA 3DRYA 2KG0A 2FGCA 4Y65A 3GIMA 5IWAF 1QY7A 2J0XA 3BM7A 4PR6A 1QSLA 2NUHA 1AXQA 4LSNB 2HHVA 3ZZYA 4PQUB 3TVZA 4B9TA 3ZZUA 3QIPA 4WXOA 3FFIA 4RBVA 4C3MA 5LT5A 4EBCA 3QMQA 1PC4A 2M5YA 4WCEQ 1UFLA 2A2CA 4I1TA 1IJEB 2BA9A 2MMYA 2CJBA 5D78A 3DI6A 5HP1B 1YTYA 3BQ2A 1U1OA 3K8WA 4QR0A 2ASJA 3THVA 1RT1B 3MPWA 3PIPQ 3IWXA 3OSNA 1V3ZA 3PJWA 1CC7A 3MAQA 2XO7A 4DN9A 2ZH5A 1EP4B 2GQ2A 4DV1F 1RT6B 3FSXA 3HHNB 4L6V3 5CQGA 2BUNA 4OX8A 3RB6A 1HYSB 4EU0A 1AW0A 2ROPA 2NR0A 3DI6B 4OZ0A 1SQEA 1S0VA 1RTIB 1N33F 4ED6A 4IR9A 1Z2ZA 1G7CB 3JSBA 2HQ3A 2G1DA 3MUTP 1U24A 4DX8H 3FNNA 1L5UA 1SKRA 3ONQA 1N88A 2RIJA 3KLVA 4R0EA 4C0HA 3PW4A 5A8WA 1WG5A 1XMBA 3EZ5A 3V4MA 1XBWA 2OPQB 3B4DA 2CPXA 1BLUA 5HL7Q 3NGDA 1S6OA 3ZZOA 3DOKA 2IM3A 2J0SD 2Z2LA 2AYMA 1NHVA 4RW9A 2DJWA 4I6AA 3M9OB 5LMUF 4C0BA 1N5SA 2PD1A 4C2MA 2CIMA 3OUYB 2DD8S 2KFYA 4CZCA 1HWJA 1FT8A 5T7LB 3CJ2A 4NZ0A 4O4RA 4PG6A 3JTNA 4PG7A 3WX4A 2Y0SD 4HYKA 1URNA 3S6EA 2MQQA 3SDEA 1S1VB 3R3TA 1N6QB 2HFNA 4ILRA 5D4NA 3DLGA 2ACYA 2OFGX 4RW9B 3I31A 5LSLA 5C42B 4IG3A 4K4VA 2CPEA 3BQ1A 3EUNA 4N8OA 5CCMA 4CO0A 4WE1A 4ZDNA 3TAQA 2ZNYA 2C3PA 4G1IA 4M94A 2PN6A 2AYEA 3OR2A 4DF8A 3WC2A 1HNXF 5KT6A 3I0RB 2V4RA 1YQHA 2ZH3A 1YHQS 3IXQA 1MNEA 1C4CA 3OXLA 1TFYA 4TNOA 5GAEU 4IG0A 2UUCF 3A8EA 3IA0A 2LVWA 4ICLB 2QIFA 5AXMA 4KTQA 4ECRA 1N5YA 2NUUG 4IRKA 2XLKA 3IG1B 5KG1A 5GAGI 3OL8A 2KVIA 3TO8A 1HQEA 4J9OA 4CCHA 4W92B 4N8NA 3JYTA 2B9XA 3DHWC 3CJ5A 5KFPA 2BBEA 4CH0S 5F8IA 1MU2B 1X4DA 3CT9A 5DDRC 3OJSA 1ZAXA 1LW0A 2GJIA 1TKZA 4HH0A 4MK8A 3EYZA 2O01C 3HK2A 3CC4S 1Q53A 3TAMB 3H2LA 1D1UA 3UCZP 5GAHU 4JI4F 2M88A 3LP1A 2MGZA 3D0IE 4IQMA 2GMJA 3KLEB 3RTVA 1M90T 2WONB 1U6BA 2XGPA 3HPOA 3SCIE 4JV2A 4LT6A 4TN2A 4C8KA 1V6HA 3QGIA 3RW6A 4O3NA 2FD2A 5L38A 1T05A 2NSCA 4DFPA 5K9FA 3CC7S 1FVSA 3IWNC 2V0NA 2OPPB 4OLOA 1TZ0A 5EX0A 2WBMA 1TAQA 3GG1A 4G1PA 4ED5A 5DO2A 3UI3A 2HNDB 4X4TA 1MROA 2JLEA 4QR1A 4ECYA 3H5XA 1FRLA 2WK4A 2J9DA 1N54B 3O1LA 2OPRB 4DSIA 4Q44A 2IM2A 1KQKA 3U1NA 1JLBB 5HO4A 3MR6A 1ZPWX 3Q8RB 4WK3A 2IJNA 1KVIA 4PXCA 1SUQB 2VUGA 5KFNA 3HT3A 2NZ4A 2HWHA 2VL1A 4AL5A 4C8LA 1MW7A 5GAHI 1VBYA 4DR7F 3CTRA 3ISNC 3M32B 2V94A 5DDQC 4EEYA 4ECVA 3RU0A 2YNHB 5F8JA 1LK7A 3M8QA 2HVIA 2NS1B 2D74B 2UZAA 2ZITA 3MI7X 3QGPA 1XR7A 1RT3A 2DCLA 1VJWA 1F5BA 2KI2A 1FRIA 2K2PA 2R8JA 1F5AA 4ZVGA 3QLHA 4NLTA 1P1TA 3FGVA 2YWFA 3MXHP 3AA8A 2COLA 1RKIA 2LKZA 3BF4A 3VZIA 4HDHA 1RKJA 5ADZA 3W2WB 4LVOP 3KNGA 2N7YA 5FD1A 1FXRA 3QGGA 4F3OA 3EPGA 1EETA 1TV6A 1HWUA 5J2MA 5JVHQ 2HNZB 2YX4A 1SIWB 1Y3KA 1UAWA 3Q8SB 4QWDA 1WEXA 4RNHA 2CQPA 2DVIA 1YJTA 1UKUA 1VQ4S 3M6WA 4F26A 2R7RA 3I5CA 1NJXA 2U2FA 1E6YB 1U8SA 5A8RA 2B51A 2D41A 4BWMA 4ZCIA 5F8HA 2OPSA 1Y5LB 1VBZA 4PG5A 4HTJA 2XMKA 1ZAWA 3CJKA 1H2VZ 2XMJA 3R1HA 2VG5B 1WF1A 3PRBA 1NRKA 1X4HA 1NK0A 2IMWP 3Q0AA 3G6ES 1S4FA 2LCWA 1C4AA 2RB7A 4K5SA 4WFBQ 4DR5F 5KT3A 1L3SA 1JNRB 1TQLA 1XTZA 4RW6A 3DLJA 3PFOA 1WHVA 2MQMA 1Z1ZA 1Q8LA 1VK3A 3TANA 1VQOS 2V8DA 2NPIA 4EBDA 4RU9A 4OZ5A 5G0RA 1G1XA 2DR9A 4EZ6A 1KTQA 1LOUA 3BR9A 1K9MT 2R7UA 4HI2A 2MKCA 2I8EA 3FQLA 3AAWB 4NCGA 5E0OA 4MK9A 2LEAA 2HGLA 4LSLA 3W7BA 3TAPA 5BJRA 2B9YA 1X5PA 4QW8A 5KFFA 2JEFA 4JYAF 4I67A 4PUOB 2ZFHA 2JRSA 4KFBB 1T3OA 3AY0A 4ZHRB 4GC6A 1IQZA 1QAJA 1RT2B 2FDNA 1HD0A 2H5EA 2KT3A 2L9NA 2BRLA 5G0RB 3NWGA 2QSWA 4X4VA 1S99A 4QU6A 4NXMF 4DUZF 2HFOA 3MPVA 3OFFA 4ZCKA 5KFDA 4ED3A 3OTOF 2B4PA 4X2BA 3R5AA 2B5JB 4YB5A 5DM6Q 4EYIB 1SKWA 1J5OA 1X8DA 1NU4A 2HLTA 4H4MB 3CCUS 4DL2A 1S6UA 3UQSA 2NYIA 4YHHF 3F56A 1SJ1A 3M1VA 4M8LA 3IAM9 4K4YA 2XS5A 5KFBA 2M8HA 3RBDA 1BQMB 3M2VA 2JLFA 2BZ2A 4RWXA 1LWCA 3GILA 2XB2D 4ED8A 2MQLA 2YWHA 3PIOQ 3NGKA 3NKYA 2GHVC 3KK1A 4X4RA 3G6YA 1FRMA 2IHR1 1U25A 4DFMA 2FC8A 3DOMA 2Z4PA 4IFVB 5C5JA 3DOKB 1UMJA 2WB1D 2CVIA 2KT2A 5IM0B 1DQ8A 1F9FA 1TKXA 3OXGA 3TX8A 5HMZA 1OPZA 4DHVA 3V6HA 3OVSA 1VRUB 4DL7A 4OI3A 5C25B 2MPUA 4D3GA 5B0GA 2EFGA 2C3MA 5E3CA 2ROGA 4JBCA 2RILA 4IOAQ 3RR7A 1IXKA 3B4MA 2OJ3A 4LSNA 4B9VA 4PQUA 4FNIA 3QPIA 3NCRA 1K8AT 4NA3A 4MIWA 1DHMA 2F3JA 3VAJA 2YWGA 2HMIA 3K7RA 1XMOF 4C97A 1S6PA 1VI7A 3I9V9 1JKHB 4LIWA 3V5RA 3N6MA 1FRHA 3LALA 2FJVA 2BACA 2ZH2A 3HHEA 2N82B 2IAJA 1S1TB 2XG8A 3N79A 5E33A 3US5A 1RT1A 4NLDA 3BGUA 4DR3F 5JJBA 1RI7A 2CPDA 1D8ZA 2NSBA 4TLRA 3ENVA 4UY85 1SB6A 3LP0A 3UR0A 2XULA 3DRXA 4X65F 5DS7A 3PFEA 2OSQA 1RT5A 4KV8B 3UW1A 5EGYA 1U26A 1R31A 2CPIA 3FZBA 2ZH4A 3V81B 2VC1A 1JLFA 3FCHA 5JVGQ 3RB3A 1WWHA 4HLBA 4RU2A 1JLAA 2R7OA 2QA4G 1J2VA 2EFVA 2ERRA 3J7YU 4Q8FA 3NMRA 4UQTA 3KOAA 7FD1A 1H98A 1HWLA 3HFKA 4CO5A 3N0VA 2F9DA 1BC6A 4TY8A 4YEAA 4KSEB 2YX1A 3DYAA 1Y7PA 4ZA1A 1RT5B 4KV8A 2BM0A 4YB7A 4U7UK 3SSRA 4ZLPA 2O67A 4NPOA 3KK2A 2W9BB 5J2PA 1N34F 3MR5A 4IRCA 4RW7A 4X4NA 4C98A 4ECSA 3IRXB 3QWPA 1D8YA 2D1CA 2VFSA 4Z2XA 3MEDB 1TVRB 2D9PA 2AJ4A 5E3QA 4ID8A 4NA2A 3TARA 4IRDA 2CQHA 2BANA 5M2PA 4IO9Q 5DQGA 1DARA 2YKOA 3ZZ0A 1NK8A 2CQCA 4G1QB 2DHGA 3ISZA 4FVMA 4KQZA 3VAMA 3H5UA 3CJ3A 3HXMA 2UUWA 4RUAA 2FUG9 4RW7B 5HBMB 1NO8A 3SEOA 3OHAA 3M2RA 1FRKA 5A0YB 2HLUA 2X51A 3DLGB 1R8BA 1DBDA 2CQDA 4PG4A 1BQNB 5ITHA 3LP2A 1DLOB 2IRYA 4CTAA 3OJUA 1WEZA 2J6SA 3DMJB 4F50A 1FJGF 1O51A 2BV3A 1S10A 1S0NA 2IVYA 1GT8A 4LUBA 1HBOA 2XY6A 3RBEA 2XLIA 1J5EF 4HT7A 4B9UA 2IFXA 5BYQA 3OR2B 4YDXA 3RRGA 4BWJA 1GH8A 1FKPA 3EX7B 3VAIA 1KEKA 3D2WA 4USIA 4IDKB 4NYOA 2KXFA 4WKYA 1VLYA 2B56A 3I87A 2J9EA 5L39A 1JJHA 2BXJA 1RYRA 2JX2A 3KLHB 2PMHA 4DS5A 4J9MA 1UEVA 4WYLA 1H2TZ 1YJUA 2Y1JA 1KS2A 5IFMA 4IH7A 1D0EA 4CT8A 4DMZA 2VFVA 3OL9A 4ED7A 1N5VA 3AJ2A 4GKKF 1APSA 3CCJS 4IDKA 1SJ4P 3M4XA 1WTFA 5CYMA 1SH3A 1N48A 3UNGC 4ZPBA 1RAJA 3N5BA 2MSSA 5DG8A 5T14A 2FY1A 2DNMA 4OJHA 2HHWA 1UVKA 3VAHA 1UVLA 4A8FA 1FF2A 1KTVA 2NPFA 1FVQA 1HNIA 2E5LF 4M5DA 4NRTA 2YKQA 2J0QD 3T5JA 1R6YA 5KG7A 2BOPA 3CMES 2MZTA 4ED2A 2JOQA 5KFUA 1HNVA 3WDOA 1Q81T 4LFAF 1MWZA 1RYSA 1Y0HA 3KHHA 4FZVA 2ZOGA 3DXSX 4FXVA 3TW0A 1ZH5A 1K0VA 3KLFB 2WCXA 3ISND 1VC5A 4DV7F 2YWKA 1URRA 4TYAA 1Q79A 3TVYA 2RMLA 2E44A 5D4LA 3CCQS 3PV8A 1S97A 3F73A 2HHXA 1HR0F 3BO4A 1IBMF 2LDYA 5CA5A 3SSQA 2XC9A 1BD6A 5THWA 5KFLA 4DL0C 3J7Z5 2RQ4A 1Q82T 4R0JA 2FHJA 3DU6A 1TFWA 4BC9A 5DG7A 2RQKA 4EWTA 3P6YC 1VK8A 4YB6A 2X1BA 4PUOA 1SXLA 3GIJA 2OMLA 5D4OA 4FF2A 2J6TA 1K73T 3QAUA 4CNZA 1CG2A 2UVRA 4LF8F 2PE8A 4H4KC 2YQ3A 4LFCF 4Y2MA 3EXCX 2C2EA 2HHUA 3EZUA 1FESA 3BGRA 1M1KT 1S1VA 3FVYA 3M9MB 4YUDA 1LWFB 3UE2A 1ZM2A 2OTJS 1TL1B 1PC5A 4DQQA 4ZPCA 2ZBIA 4WU3A 2DK2A 4RW4A 4PXDA 4N56A 4QZVB 4NYZA 4CT9A 2QA4S 1QSSA 4IFYB 4AFFA 5A6PA 2ILYA 3DRSA 2DH8A 1UETA 3B8HA 1FERA 5J2QA 4MFBA 4ZPWR 3EPIA 3HVAA 3RRKA 2DRBA 1OSCA 2WBRA 2GIQA 1REVA 2CG4A 3IS9A 4XDDA 1ZTTA 3W3SA 3VTIA 3H20A 4QOTA 5E2QA 4DV0F 4ELTA 1NK4A 4ECTA 2UP1A 4DV2F 1QJHA 2HZCA 1C2PA 3L3CA 2IYGA 2FVCA 2EBGA 3K57A 2GQCA 1C1BB 3PRDA 5DETA 3K59A 3MEGB 2YVSA 2W7AA 4MFBB 2OKQA 3CD5A 2FJEB 1DAXA 4PRFA 2LXIA 3BS9A 3ULHA 4DN0A 1SV5A 2DGXA 2Q79A 2DGSA 4ZPVR 4AE5A 3OVAA 2E7XA 3QYYA 4I0WA 4JI8F 4CO2A 4JOUA 1DURA 2PMZD 3WC0A 2V4QA 4A8WA 3JSMA 1DJ0A 1J5OB 3C3LA 5I3PA 3SI8A 2KYZA 1LQ9A 2LYVA 1Y9OA 1HMVB<