5M2PA

The structure of the ycf54 protein from synechocystis sp. pcc6803
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
MATYYYALASQKFLLEEEPFEEVLKERRRDYGEKNKEIDFWQVIQPAFLNAPELAEAKAKAPEKNVAIVSTNKSFIVWVKLRLEYVLTGEFEAPSDAIPDPLASLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Ycf54-like protein
publication title Conserved residues in Ycf54 are required for protochlorophyllide formation in Synechocystis sp. PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2016-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10674 Ycf54 Protein of unknown function (DUF2488)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1860 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5m2pA00
3HZEA 3JSRA 5M2RA 5M2PA 5M2UA
chains in the Genus database with same CATH superfamily
2QMWA 2VQFJ 4JI1F 1N6QA 4NXMJ 2YBVA 2EK1A 2DHSA 2KHCA 4I0WA 3L7PA 2DH7A 5J2MB 4KFBB 2ZJRQ 1H72C 3DOKA 4CP5A 2IM1A 4DSLA 4A48A 2Q3PA 2QN6B 1FJEB 3W7BA 5K8MA 1HBOB 4DL4A 3LTOA 4DUZJ 4USJC 4XK8C 1RADB 4QYRA 2YX1A 5D0HA 2NXCA 2M52A 3Q2TC 3GJSB 2IIHA 1XR6A 2HFVA 2HURA 2MJNA 3FCHA 1XMQJ 2U2FA 4LBHA 2POKA 2IFXA 3KMQA 2EBGA 8ATCB 5KTQA 1VQ9S 3GFHA 1PJ5A 1ZBTA 2VASA 1HR0F 1RT4B 3KK3B 5IS2A 2OH2A 1U4BA 4KPCA 2HBYB 2HQIA 2W01A 3KG1A 2KDOA 1VJWA 4P7TA 2HEKA 1VQ4S 2BM0A 3I6PA 3BF4A 2CPHA 3CDBA 5L38A 1RCXB 3DGPB 4ZLJA 3D0IE 5CAAA 3C15B 3GSDA 3LP0B 3JS9A 5IT4A 2WZ1A 3EM1A 2W4CA 3BZQA 5A8KA 1TQLA 3Q86A 1BQMA 2FZCB 2H3EB 3BQ0A 1RWMB 4JI7F 4JI8F 4XDCA 3R5DA 3EYZA 3OJSA 4EWTA 2A0FB 1JLEA 2HAFA 4FVCA 3PNIA 1Y3KA 3K59A 1S48A 3GV5B 1S1UA 1F6TA 2DXEA 3BKFA 2IRUA 3TUZC 3KNGA 2BBEA 1DFDA 4NEZA 4CZCA 5KFRA 3OXFA 5HBMB 4JI5F 4W98A 2XMUA 1QSLA 4M5NA 3OV7A 3VALA 4PWDB 1Y11A 3VVUA 2J76E 4P10A 1WEXA 5J2QA 3KHLA 1RE1B 4FVMA 1R7IA 4NCAA 5ADZA 1WSRA 3ISZA 2F5GA 2LQJA 4GRSA 4KSEB 3SIPB 2IDLA 1SKSA 1Q16B 1NJWA 1N56A 1UEKA 1QSSA 4OZ3A 4KHPJ 1CVJA 2V4QA 4F4WA 4F0MA 1B7YB 3A8JA 5LMNJ 1FNMA 3DLJA 4LFCJ 4C7QA 2VG6B 1XC9A 5JVGQ 2GNKA 1LOUA 4JI1J 4JV2A 3TARA 2QL7B 2FB0A 1AROP 3CC4S 4IH6A 3CJ5A 4DG1B 4GKKF 1NB7A 3QIPB 3TI0A 3QT5A 2OMOA 2FGCA 4RL1A 2W2NP 4UOCA 1SC3B 2R7TA 4RWXA 2GAGC 3ZTSA 2AYGA 4UY8T 1S1WA 3FEZA 4ZN1A 4HHHA 1BE4A 4K5SA 5AJ3F 1EQ0A 2OMLA 2VBXA 1WTFA 2VFRA 1U8SA 1LNQA 2HRTA 2OTLS 1ZPVA 1S9GB 4N8OA 1Q8LA 2DCUB 2B4UA 1SJRA 2NXNA 2CPDA 2UUAJ 1TK8A 2CZ9A 1Q0NA 5B0BA 4KFBA 3CCZA 3GJTB 2WVDA 1HR0J 1PILA 5CD4H 1N88A 2VBWA 2DIUA 5E33A 3QNWB 1HBOA 3ZZ0A 5FD1A 1I6JA 1Q95G 2V8HA 2G2YA 1QAYA 2AHOB 3ILLA 2PEHA 4YS2A 5CD4A 4EK2A 5BYRA 2GGPB 5SUHA 1HWLA 1CPZA 3D7SB 2CZVC 3H90A 1BUXA 4XDDA 2HS4A 4CQ1A 1SQGA 2PFFB 2YNFB 3ICLA 1JLQA 2GJ2A 3WIUA 3MPVA 5DQGA 4OHVA 4JI8J 1TMJA 3CJKB 2DH9A 1UVNA 3R8YA 4QCLA 4P2XA 3US5A 3Q2SC 1R0BG 3DOLB 2GA7A 4OLPA 2LKZA 4JUZA 4DR2F 2V2QA 1FNXH 1RT4A 1R8CA 3KK3A 2B6AB 4GKJF 4RU9A 3RR8A 3NMRA 1X5OA 5LOQA 1LWEB 4C48A 3ZXWA 3RRGA 3DGPA 2F7VA 1KHWA 1WF0A 3FBEA 2B7CB 2QEXS 1EETB 4JI5J 3LP0A 1HNXF 1IKYA 4WKRA 3TJ8A 4Q44A 2W2QP 2IM2A 4KPYA 1R27B 3SCJE 2QGFB 2D3ZA 2JLGA 2PMHA 3T1YF 2EG2A 1Q5VA 3EVWA 4YN3B 4FPIA 5EWGA 1TKZB 5HO4A 2B9YA 3JYTB 3GSIA 5AXMA 2ROEA 3C2PA 4HHJA 4FPRA 4YP3A 3CGIA 4PXEA 1B0PA 2FHKA 3OT9A 5HBMA 1Y0HA 1SH0A 4PWDA 3IS9B 3AXMA 4PXCA 4NLQA 2VPXB 2CQ0A 2DGOA 4KY3A 5AXLA 1U6BA 5AT1B 2B9XA 1ZAWA 3MM9B 1TU0B 3BKTA 5U47A 4ZP8A 1U1LA 4ZVTB 4N41A 1ZPWX 3DXBA 4C11B 3SZ2A 3AH6A 3JTOA 2P6TA 1R43A 1PAEX 1JNZB 2W2MP 4QR2A 3V5RA 3NBPB 4IQXA 3PJ9A 4IFYB 4OJ1A 3CMQA 2ZFHA 2YWWA 4C0HA 1YGYA 2C3UA 3NOCA 1B64A 1KOHA 5AJ3J 2E9RX 2W9BB 4DFKA 2OD4A 2VG6A 3K5NA 1S1XB 2PC6A 3GG0A 3CMES 1MN7A 1VMBA 3E2EA 3SFUA 2CPFA 3JB9k 4DG1A 2D3OR 2NS1B 1HHQA 2YPZA 5KG0A 1IQZA 4ZN3A 3EGZA 3ENQA 3TUPA 2DHGA 2FJXA 2HIQA 3NS7B 2LCWA 4FKXA 1RA6A 1WORA 1XMBA 2Y1IA 1F60B 1QDUB 5EDWA 2BW7A 4IG0B 1KLMB 3DDKA 2R8KA 4X4TA 1OIAA 3R1LA 3I55S 2WK4A 2PN6A 2JL9A 5JUMA 4IOBA 3A1YG 3UPFA 4M5LA 1S9GA 3B4DA 1NZ8A 4AT1B 1YG0A 1RK8A 3KLIB 4CO1A 5K20B 3EVOA 4F7VA 2C2KB 2EFNA 1U48A 1W26A 2CJBA 4DR2J 1RABB 3R2DJ 1YJUA 2AJ1A 4Z7YA 1HMVB 3CJQA 4DSIA 4TLQA 1Q8KA 2HS0A 2QL9B 4WU2A 1K1QA 1HNXJ 5IWAF 2BABA 3GB0A 2GGPA 1AYEA 3K5OA 4DFMA 1IR0A 2FHJD 4LRAA 5DM6Q 2HVDA 4MIAA 3PYGA 4A47A 3NKYA 2YNFA 2FVCA 1IJFB 5FIIA 4OZ2A 4NL5A 4ED2A 4OYOA 3GYXB 3M1VB 3POTB 3T1YJ 2CQ1A 3CVKA 2HWHA 3DOLA 3M8QB 1OQ3A 4ES1A 4FXWA 4ES2A 1N54B 1FXRA 2YKOA 2D69A 4DV7F 3NL0A 3FQLA 3LGNA 2B6AA 2J7WA 3MZIA 1LFPA 1LWEA 4DV3J 4IO9Q 3I32A 2OKQA 1PC4A 2NZ4A 5B0GA 5ETQA 1EETA 3M32A 2FLPA 2I5JA 5DZ6A 1JXEA 1NHVA 2OHDA 1SQEA 3FUYA 3RU0A 3LP1B 2GMJA 2R8GA 4YDDB 1KN6A 3WIVA 3F73A 1S1TB 4LBPA 1WF1A 2VL1A 1R8PA 2W25A 3BDPA 2BE9B 2WONB 1TKZA 2I8EA 2R2UA 3LANA 1RT1B 1RWPB 3JYTA 3TZXA 1RISA 1GK8A 4ZHRB 4F4AA 3MMJA 4R25A 1B7FA 5HJYA 2J0SD 5GAHI 4N8NA 2GVDB 3D68A 1OPZA 4RR5A 3CC2S 3IS9A 2UU9F 3JQJA 3ZFVA 3W9IA 4M5IA 2R2RA 5D0EA 3IR5B 1FRKA 2MKIA 4RW6B 1TZ0A 1HBMB 3MM9A 3AHPA 3H2LA 1VJQA 2C3MA 3UI3A 3ISND 5HVFA 4C11A 3IC1A 1FKOB 1L3SA 3TR5A 1DQ8A 4WP3A 3TUJC 3NBPA 4K4UA 2LFVA 3HHDA 4IFYA 1HI8A 2J0QD 1R89A 2IA6A 5F8HA 4Z2XA 3M8YA 3CT9A 2HLUA 3PHTA 1M1HA 2W9BA 2Y9HA 4CNZA 3LA0A 3CJ8A 4LF8F 2LA6A 3DC2A 1JJ2R 2HQCA 3FRZA 2HVEA 4ZJLA 3THTA 4O3SA 2ZZMA 4OYBA 2BMBA 1S49A 4W90B 3UW1A 1UTAA 2HBRB 3GIIA 3QAUA 1VRUA 2DR6A 4UTGA 2XGPA 2O67A 4FS1A 3BSAA 1VHFA 4QR1A 3PR4A 3O2IA 1N52B 3DGVA 3RBZA 3U1MA 1NMEB 3G8QA 2FUG9 3LH2S 3D28A 1S76D 3FJ2A 4ZLLA 4IG0A 1GMUA 1KLMA 2RS2A 4H4KA 4C9DA 5IWAJ 5T41A 4H4OB 1Y5IB 1OYEA 1SPBP 3FFIB 4X4UA 2JEFA 2ZVIA 3PIPQ 3OW2R 1NDKA 4OLOA 4JBCA 2P9EA 2RJZA 3KLIA 2QSWA 1WTBA 4CH1A 4KIAA 1NNDA 2HFOA 5F3TA 3R7NB 4Q5VA 4DR3F 4DV7J 1FA0A 1SCJB 4K4XA 4FYVB 2L3MA 1HMVA 3QATA 2HVHA 1Y4ZB 4OHXA 2Y0BB 3QZ7A 3C16B 5BJRA 2BYCA 4B9VA 1L3UA 2M8HA 3VGSA 2CIMA 3BSNA 1V3ZA 3ELHA 3J80U 5F3ZA 2H1YA 1FWLA 3PM9A 4PYAA 1EJ7L 1FRMA 2NSBA 2VZ9A 4IOAQ 3FK4A 2PMZD 5EWEA 1RWWB 4RUBA 5IFMA 3M1VA 2ZHAA 1F5CA 4DPWA 3VAJA 5JJBA 1UZHA 4K50A 3M8QA 3DMJB 1YZ6A 5FDLB 1OY8A 1VBXA 3KNAA 3EICA 2WRMA 5KFYA 3D66A 3W2WB 2Q79A 3ZTQA 5J2NA 3MM7B 5HMYA 4OL8A 1T11A 2MGZB 1GNKA 3HLUA 2YQ1A 1I5OB 2C2DA 3EGWB 1UAWA 4L76A 1EAYC 2QMXA 1SB6A 4ZP7A 1SC4B 5D3GB 2H65B 1EARA 2F63A 3JSMB 3KXDA 2ZOGA 2DNNA 2UU9J 3LP1A 1S12A 2MHEA 2ZOFA 5L46A 2MKYA 1ZAXA 2XM3A 4ELUA 1LFWA 4IRCA 2E5LF 5EHHA 4KH0B 1S1TA 3V6DB 2R7VA 1H2UX 3CC7S 3UFCX 2H5JB 2KJVA 2DIVA 2LEPA 4MIWA 2RRAA 2IYIA 2WONA 1TAQA 1KKHA 2MZTA 4EYIB 1RT1A 1SI9A 1KSPA 3KLGB 4DWIA 2A6OA 1VRTB 3HP6A 4URSA 4ZHRA 4I56A 1MMLA 1ZOTA 2K7JA 2KXFA 5L39A 5LXRA 3HZEA 5K5MA 2BRKA 2WBMA 2GVDA 4LF8J 2DNMA 5KG1A 3W1YC 5IT9Y 4NYZA 1BQNB 1MG7A 1KDNA 4JP8A 4OZ0A 4RW6A 4OMFG 1HBMA 3HKWA 2CQHA 4LF2A 2J7UA 2R2SA 1LKZA 2XI2A 1TK0A 4L73A 4N47A 4MYTA 1FKOA 4UUWA 2RQ4A 5KFOA 2MHNA 2K8GA 2ZM6F 1FI4A 2RAQA 1WDTA 2HYIB 5IOLA 3QGPA 4RNMA 2UP1A 4OYAA 4DL0C 1RT7B 3NP5A 1AA1B 4ECYA 3MGJA 1RZMA 4M94A 4PPDA 1O0PA 2V2VA 1U47A 3GJQB 1N34F 1WHYA 4X4PA 2BM1A 2ZHOA 3IWLA 5ETPA 5KFJA 3T1HF 3CIMA 4NXNF 2QJ3A 4KHRA 1KWMA 2YKAA 2IMOA 4DR3J 3KHHA 3HFZB 3QFWA 1UJ4A 1VBKA 3PJWA 3ZTRA 4DR6F 4ZIWA 4NLPA 1WC3A 4WXOA 4K2JA 4ZPCA 3M9OB 2KRRA 2ZDOA 4H4OA 1QAXA 3FFIA 1C0TA 3DRRB 4RNOA 4JI3F 2QFJA 4A8QA 3HO1A 2MYFA 2AEJA 1N5TA 3FQKA 3E8OA 4KE5A 2ZC3A 4IKAA 2CA9A 2E1CA 2AEMA 5GVQA 1FE4A 1R31A 4QU6A 2CJQA 4O4RA 1NK4A 1QAJA 1SKWA 4DPOA 3C16A 1VOMA 3F0NA 2WSEC 4NLOA 5LMUF 1VQOS 1FJ7A 3UCGA 4QIFA 3SDEB 2BE7D 4DF4A 2KZMA 1ZYQA 1YQHA 1MW7A 3N5FA 2E5LJ 4CO0A 4CLZA 3EPIA 2VJUA 3DHXA 4DSEA 1G2EA 3M6VA 3A13A 1UZDA 3VWSA 2XEXA 2OPRB 2R2TA 2EWHA 2ACMA 3DMJA 5FDLA 3TAMB 3W2WA 1VHIA 8AT1B 4NE9C 3DFEA 5CYQB 4AQYF 3MM7A 5A6WA 4C3LA 2MGZA 1X0FA 2D3UA 5D15A 3KG4A 3OVAA 5D3GA 2JOQA 3JSMA 1G6BA 1VFJA 1HWIA 4R0EA 4CLKA 2NZCA 4I6AA 1S59A 4WTYA 1Q81T 2G1DA 1KBRA 3W5XA 4OJHA 3V6DA 2LDIA 2NSCA 3O5TB 5D4NA 5DDRC 3RRHA 1TAUA 2P9GA 2XMTA 1FK9B 2ZM6J 1JKHB 5IQ6A 4DEZA 4DCJB 2V4JB 2FLOA 2DO0A 1VRTA 2FZGB 3DRPB 3GLJA 1HWKA 4B9NA 1RLCL 1SJQA 1FRLA 5SZTA 1U02A 2CQ3A 4ZVUB 2HHHF 3ADAC 1E6YB 2F1FA 2RILA 1BQNA 2B4OA 3K5MA 2YXLA 5J1EB 5HMXA 1N34J 2AYBA 3QQCD 2NPIA 4GVBB 3T1HJ 4NXNJ 1NDCA 1T9TA 1NJIT 4C4WA 2EKNA 5ETKA 3R27A 1V3SA 4TU8A 2KN4A 2MTLA 2DPIA 3HMJG 5RUBA 3HKZD 3FEYB 3R7SB 4DR6J 4QIEA 4LIRA 2W4DA 3W9HA 1RKJA 1RT7A 1GH8A 1KVKA 4AD6A 2MZQA 5HATA 3SMZA 3H0PA 4RZRA 4JI3J 2PE8A 2MKCA 1KFSA 1FKAF 2MEWA 4NYPA 2OIHA 3CDUA 4TYBA 1I51B 4I2PB 2V4RA 4UQGA 3TJ9A 3KHRA 3PRBA 1LV5A 2GO9A 3MEDB 4DV2F 2YQ3A 3HHKA 3RB6A 2OI2A 3MI7X 5LMUJ 2DGTA 4LRDA 2C2RA 1NK5A 5CYMB 1ZM9A 4C8LA 5I42B 3EXYA 1KVJA 4AYBD 9ATCB 3L95X 3DDIA 1T9YA 3OL6A 4FYWB 3T5LA 1UWAA 2BJ9A 1PO6A 2ZD1B 2GHWA 3OTCA 4G3IA 4USVA 3TANA 2OEMA 2P8IA 3M2RB 3KLEB 3CCUS 2ZUGA 4AQYJ 2QA2A 3X3UA 3MR7A 3Q8SB 4DL7A 3GZ7A 3FBFA 3R2CJ 5B08A 1SV5B 4TU9A 3P96A 2JX2A 3JSYA 3SDEA 5HQLA 3W60A 2R7OA 4QIGA 4N7TA 1APSA 2HK2A 1ZM2A 4KYZA 3OR2A 4EZ6A 1NSAA 2NXJA 2OPRA 1OSDA 5CQGA 1UVIA 3FNNA 3MR3A 4OJGA 3TAMA 2ZDPA 3HVTB 3R5AA 5IT0A 4NLTA 4IRKA 2LU2A 3CEDA 2V0NA 4LF1A 4DSFA 5CYQA 4CLLA 1KVIA 4ES3A 3TA0A 5HLFB 4OQJA 5KFDA 4ZVSB 3RW7A 2HHHJ 2CPZA 2X1AA 5K8NA 1G1XA 2RVJA 2B9EA 4ZJOA 1S7IA 4HACB 1DQAA 1Z2ZA 2B56A 3JSRA 4R5PB 2CPEA 4HTIA 1VDHA 1XEZA 2K2PA 2PO4A 4Y2KA 2CQDA 2X51A 3NGTA 4OYWA 4P72A 1FK9A 1JKHA 3IAM9 1NU4A 3BGOP 2Y8WA 4PWUA 2V4JA 3D0GE 4YHHF 3PV8A 1ZH5A 5JXSA 2I38A 2GCFA 2HHTA 4A8OA 3CE8A 2C28A 2QA4S 1DBDA 1IVZA 5HANA 2BJ8A 2GZOA 1U49A 1DTTA 2GW8A 3BREA 1E6YA 3OFHA 4F04B 2XC9A 4NEYA 5J1EA 1EKSA 4J9PA 1WOSA 2W9CA 1ZA1B 4F3OA 3DLKB 3M8SA 3U1LA 3AY0A 5L1KA 9RUBA 1HNIB 3H4BA 4ILMA 3MPYA 1WC4A 4DV2J 2AYEA 1S57A 1GAOA 2RU3A 4NOHA 4UY85 1HI1A 4PCQA 4I7FB 2MZ1A 1D09B 1FFWB 1I1GA 1VCTA 1D1UA 1SJFA 4XAKA 5GAGU 4J9UE 4K4WA 2YH1A 3AAWB 1TKXA 2DRBA 1NKCA 4UOFA 2XS7A 1MROB 4K4SA 3PW4A 2B7BB 4Q8FA 4H4KC 3FSIA 4AL7A 3CD5A 2RUSA 1ZM4A 2MJUA 3NAHA 3NGUA 3ITHA 2X3GA 3EMTA 3MEDA 5BXIA 4A4JA 1HBNB 2NUUG 1NH7A 1QJHA 1FDAA 1YJVA 2D74B 1U6ZA 2HMIB 1KFDA 2JHEA 2IAJB 2WAQD 4LUBA 4ECSA 2LEAA 3N28A 3C14B 4EU0A 4ICLA 4ECTA 1D9FA 3DM2B 5CYMA 1U1RA 2Z56B 3HULA 2KFZA 2C2NA 4NX9A 3W5ZA 3CNQP 1FEHA 4GVLA 5I42A 3TAPA 3VAFA 4E2FB 1CJVA 4PPZA 2PD1A 2QLWA 4B3SF 2CPJA 2JFDA 1P9YA 3I0RB 1T03B 1FERA 4KRWA 5A0YB 4P2FA 2ZD1A 3LP2B 3UR0A 4A8YA 3TAQA 3M2RA 1U1OA 4B3RF 3KLEA 4F26A 2VJVA 1DHMA 2J9EA 1UA1A 3PRVA 3FCWA 3QRPA 1Q82T 1URRA 4ZOSA 4O0IA 1WELA 2YKPA 1PGZA 2F8HA 1VGYA 2VDHA 2EW9A 3BM7A 3MTJA 1SV5A 2FY8A 2AKWB 4QW9A 2CJKA 2EEYA 1R3NA 1FDNA 2VUGA 2RDIA 3KDNA 4IYQA 1ZETA 2DNHA 3CB4A 5LL6d 2HRUA 2I9SA 5B0AA 1IR2A 2ZEJA 1ROFA 5CXTA 3WDOA 2VPWB 3IGNA 2HG4A 2PEBA 1MWQA 2E5JA 3FGVA 2MQ8A 5I4MA 1RT5B 3HVTA 3ZNUA 2HHUA 1HHTP 3MEEA 1B3TA 1MWZA 1B70B 3LAMA 4F50A 7FD1A 2J7KA 2H4WB 4JB8B 1GX6A 4YHHJ 1YITS 5KG4A 3ZZYA 4WFNQ 3HD2A 4NCGB 5HLFA 4YB6A 4ZK7M 3GILA 1P8GA 3NGKA 2AF6A 4HEA9 1W25A 5KFFA 2AEFA 3R6LB 3LOUA 2GAHC 5D0GA 4DOZA 3BYPA 4HACA 2FHOB 3NS6A 4C8NA 4LR7A 4UQTA 2VQEF 1FD8A 4Y2CA 3O6QA 2ZH8A 4R5PA 3GFXA 5C7PA 4KGKA 4LF9J 2DEJA 4U7CA 2Y8YA 3ZNJ1 4QPXA 3UNYA 5DS7A 5LXYA 2OLWA 4ZVPB 4PEOA 1FX4A 5K9FA 3IBFB 3DOMA 2AGQA 2HBZB 2MZSA 3I87A 4V19X 3OJUA 3C46A 2EFQA 3QO9B 4BLGA 2QE5A 2C3YA 1KQKA 3PW2A 4PQUB 3NWRA 3OQ2A 2ZNYA 3KWMA 1DJ0A 4YEAA 3DLKA 1PAUB 2GVZA 4WZQA 4FNIA 2C3PA 3EZOA 1HNIA 4U6PA 2Q43A 4C3KA 4ED4A 1C4CA 1VQ8S 4FBTA 3D54A 4TU7A 4UOHA 3CF5Q 1WJ9A 4I7FA 1MU2B 4PUOB 1YSJA 4C0BA 5HSPA 5HMZA 2FDNA 2AWZA 2X1BA 3J81U 2MQOA 2H4YB 5KFGA 4DXLA 3LWMA 2OD6A 3OTDA 1N5VA 2DHXA 4DQRA 1FESA 5CCMA 4B3SJ 3SQGB 2M0GB 2FTRA 5DDOC 5KFZA 1HQEA 2RB7A 1FF2A 3VGVA 1U1QA 4B3RJ 4DPTA 2WVEA 3IRWP 4F0HA 1IN0A 1KLNA 1HBNA 2LA4A 1IKVB 1WKKA 3EDRB 3HXMA 1GFWB 2IAJA 4X64F 4JYAF 3C14A 3MR6A 4Q43A 1T7PA 5A6PA 3MR2A 1D9DA 3KLFB 3DM2A 4DZDA 3Q22A 4KV8B 1Z2LA 2YWEA 2K1RB 3QAEA 2E29A 2IVYA 1T9XA 2CDRB 2HVZA 3H98A 2CQ4A 3I0RA 4QPTA 5HROB 5A0YA 3MOJB 3N01A 4WCEQ 5I3QA 3VGUA 3LP2A 1Q78A 2DH8A 4DR4F 1CQNA 2DGQA 1HL6A 2DNLA 2IM3A 3O3LA 3T19A 2QZ8A 4HT5A 1WI6A 5D78A 1FDDA 2VA3A 2G1HA 1VK3A 2JSXA 4ZVGA 3VZHA 5LM7E 1LQ9A 3FSYA 2B3TB 1RHQB 2OGUA 1JXLA 3HHLD 1JK9B 5HP1B 3GV8B 1BQXA 2WSFC 3Q0AA 5E2QA 2G0IA 2KRBA 2O3DA 2RMLA 4NLWA 1H2VZ 4DLGA 4DR7F 1NSPA 3UDCA 3OTEA 2BE2A 3AODA 2W8LA 2CFXA 2XULA 4RW8B 3KYLA 3MF5A 5M2PA 1JJHA 3TOQA 1RT5A 3T41A 3CD7A 4U95A 1H74A 2BKPA 2PT0A 4LF5F 4ZLPA 4QW8A 3J7AN 3T9NA 5HQ8A 1REVB 3OSNA 1YDLA 4NWBA 5KFNA 5DQIA 1RAOA 4NCGA 3OBIA 4BWMA 2DGVA 1NDLA 1AZSB 1R0CB 4DMZA 2R9LA 4DV1F 2W24A 2HKEA 4WE1B 4NZ7A 2BKOA 4DN0A 2HQGA 1WKJA 3VQTA 1QVGR 5F8GA 4LVOP 2EG1A 1NB2A 5DETA 2Z2LA 1N48A 2MQQA 6AT1B 3QPIA 1S9EB 2DR9A 4OI6A 2D1CA 1R0AB 1RWOB 3SCLE 3HJVA 2QG9B 4KTQA 1O8BA 2F40A 1U45A 5KT5A 3VAGA 2HNZB 2AW0A 3QO9A 1H6KX 5BR8F 3TX8A 4PQUA 1HNZF 4F3QA 4QJVA 3FMBA 3V81B 1HFEL 3D1HA 3CCSS 2XSJB 4B3MJ 3B82A 2VIHA 3IG1B 3A3OB 3T5HA 3QGHA 2IBOA 2MLYA 3UDVA 5IXUA 2E7XA 1NK6A 2XCPA 4J9LA 2AMCB 2J0WA 3KTQA 4A8WA 5JVHQ 1KRPA 4QWEA 4PQAA 1UETA 4X64J 1ICEB 1UCNA 1MU2A 4PUOA 4CLUA 1UW4A 4JYAJ 1Y9OA 1KOOA 3D6MB 2XMVA 5FJ4A 4ANDA 4K4TA 4ZCIA 4LFBF 3TZWA 3BO4A 4DS4A 1D0EA 5KG2A 2ZBIA 1JLCB 4TKTA 3ILOA 1WWHA 3SQGA 3W3SA 2Q1LA 4P6QA 2QYCA 4DFPA 3KJFB 3QBCA 4DR4J 3EVMA 2ZBPA 4DR5F 1TTHB 3UQSA 3T5KA 4LRBA 4FBUA 3MAAB 1AT1B 2M8DB 1LWCB 4AE5A 4Q0BB 5DJBA 1IKVA 1QAIA 2QLBB 3NNAA 2XY6A 4MK9A 4O23A 3VF0B 2JEJA 4ZCMA 3W5YA 3K8WA 4MKAA 2XY7A 1X5SA 3KLFA 3LQVA 4OYMA 3VZIA 4KV8A 1NHKL 3MMAB 2K1RA 1OPIA 3QIDA 1YX2A 4C0OC 3TW0A 4ZVOB 4DR7J 4NPOA 2CPIA 1FHTA 2V63A 5HROA 3N9UC 1QUPA 2KVIA 2KYZA 2RU9A 4KGMA 1XNRF 3CD6S 4LF5J 4WIIA 3D5MA 3IBCB 2LXUA 1QLNA 2H51B 4OZ1A 4UZCA 1IKWB 1WC6A 3I5CA 3AJ2A 1HPZB 4K4ZA 5HP1A 4CM2A 4DV1J 3ENWA 3Q23A 1RTDB 3AXKA 1TL5A 4NZ0A 4E98A 4I6YA 3GG1A 2XG8A 4D3GA 2ADBA 2ZJQQ 2N3LA 4RW8A 4YR3A 2DY9A 2YNGB 2CQCA 4ANCA 1REVA 3PZPA 3OTOF 3Q83A 4L74A 2IJNA 5BYQA 2J8AA 5F8NA 1VIXA 1M5OC 4XPCA 3DDNA 1S1UB 5CCLA 3MEKA 4MK7A 2P2CB 4EGLA 5BR8J 2AQ4A 1HNZJ 4WE1A 3F44A 1LEOA 1JLBB 2BV3A 3M4XA 1FRJA 4KT0C 3K57A 4MFBB 5KFMA 3AB2B 2WOMB 3CUNA 1X60A 2W4PA 1RBLA 2BJ3A 1X4HA 2DVIA 1PKUA 4DV5F 4DBQA 1R0AA 3BH7B 1DY3A 2D41A 1FO1A 2HLTA 1XK8A 3CJ2A 4Y2MA 4J9SA 2QL5B 2UXBF 1URNA 3MCSA 2HNZA 4EO6A 4WP9A 4LFBJ 3SCIE 1Z4UA 1F3VA 3PTWA 3UDEA 5GADI 3KUEA 3GR0A 3HSZA 2XSJA 2OSQA 2ZE2A 1RYRA 3IG1A 4OX8A 2ZBQA 4DR5J 4J9NA 3DLLQ 4ZPAA 4NLYA 4JI4F 4I67A 3KJVB 5CZVA 3TUIC 4GC7A 3DLHA 3ZO7A 3MECB 4U7UK 2R7SA 2XYGB 3KUHA 2KB2A 4JI0F 2ZWPA 4K2XA 2B4PA 1FFGB 2RDJA 4FF1A 3KLVA 5CABA 3D1OA 1N5YA 3DI6B 1UW9A 3R5CA 3IM8A 1SIWB 4NA1A 4CO5A 2WSCC 2EK6A 3FEXB 3V6KA 1RHKB 3GFZA 1XN9A 1F5AA 1JLCA 1FVQA 4NMLA 2FHMA 1IXKA 4QWBA 4F0KA 4FKYA 3CJ0A 3G8TA 3ZC4A 3OLAA 3MAAA 1XNRJ 1LWCA 4Q0BA 3GCXP 4G1PA 4USMA 3MD1A 3MR5A 3N6NA 3U02A 2HIYA 2IYGA 5E3QA 1UMJA 3MM5B 2V2ZA 1SC6A 5ETVA 1RT3B 1D8YA 3EZUA 1WUUA 1VK8A 3LGMA 1X9WA 2JC0A 3MMAA 1KNZA 2VG5B 3PFEA 4FYXB 4O4GB 3K58A 3H5XA 2ZWOA 5KOWA 1JLQB 3M9NB 1RWNB 1TL4A 3B78A 2UVWA 2WBRA 4ECUA 4BDPA 1U24A 3QJLA 3OTOJ 3TQ1A 4ECVA 3S7RA 2VA2A 2V2KA 4ED1A 4DSKA 1GTHA 3FBBA 3OXGA 1IKWA 1J5EF 2DD8S 3QYYA 2XQCA 4C3MA 1HPZA 2ILYA 3NMAA 3CW2C 2EKYA 3R3TA 3BDEA 1NJYA 1RTDA 3F41A 3IWXA 5MAOA 4OX9F 1TL3B 1IKYB 2BEFA 2MXYA 3H7HB 2KU7A 3FDSA 2GQQA 2VH7A 2L41A 4I69A 2YNGA 3KK2B 4DV5J 1PSDA 3PFOA 2N4CA 3PYFA 2VG7A 1KD1T 2XS5A 3AD9C 3CCMS 2MLZA 3BS9A 1WF2A 2UXBJ 2DNZA 1LXJA 4RLEA 3CCVS 5KFQA 1J27A 4WFZA 3TA1A 4WFXA 3MTKA 3EPGA 2OEKA 1KHVA 2VKRA 1PC5A 1JLBA 4Y34A 3PXGa 4MFBA 1IBKF 3OHAA 3J7YI 5L1LA 2WOMA 4JI4J 3O44A 4CLFA 3HVRA 3DCAA 1QM9A 3PW5A 3D6FB 4DX5A 3D2WA 5A2QY 4U8YA 2VHGA 4JI0J 1S97A 2K7KA 4WZMA 2B4VA 5EUHA 5DRKA 2E7WA 4F02A 2YPYA 1TMMA 3BV8A 1U6FA 3PCOB 2V8VA 4TQSA 2AJ0A 3L3CA 4W92B 1YBUA 1M1GA 1CC7A 2YWGA 2QLXA 2WCXA 4ZPVR 1PYOB 2ASJA 1Q7LB 4CLYA 2GMHA 3EUNA 1TL1B 4PZVA 1HNVB 4OV6A 2VDIA 4LREA 4RU2A 1SKRA 2R7XA 3RGIA 1WG1A 3KK1B 2CVIA 3KJVA 1M1KT 2XO7A 3CCTA 3DLEA 2XMMA 3MECA 4IH5A 2LECA 3CMAS 1AW0A 1F5BA 4QYZK 2UXCF 4Y3CA 3HI9A 4Q2MA 3DI6A 2MQNA 4TVAB 4H4MB 2O01C 4RPFA 1Z1ZA 1TFWA 4DX6A 3GFYA 4F4XA 3D67A 2DKOB 3FKBA 4K5RA 4AL5A 1RTHB 4GO5X 1U7LA 5F9NA 4OX6A 3DN9A 5F9LA 1Q86T 4J37A 4OI1A 4ZITA 2LLZA 5AXNA 1J5EJ 5B0DA 1VQMS 3MM5A 1RT3A 3H5YA 3BQ1A 4BHQA 2FJWA 3P49B 1QY7A 4LBIA 4OX9J 2ZITA 4DPYA 2VG5A 2MY7A 2CWXA 4AL6A 2HGMA 2LXFA 1VQPS 2KYXA 5KG3A 4O4GA 3K8VA 1J5OA 3IFEA 3IN5A 2F9DA 4JI7J 1PBUA 4RNNA 2M3DA 2N82B 1S77D 1SL2A 2RIJA 5DGBA 4X4OA 3RG6A 1GMVA 3ZZUA 4WYWA 1HWJA 2HS3A 1K9MT 2D9PA 1TKTB 1KP6A 2VF3A 2OFHX 2J0XA 3D6HB 4WJBA 4WP8A 3H2UB 2RH3A 3VQSA 1TL3A 2RDDA 4DL6A 3M32B 5EWFA 3RR7A 1U0SA 3OPKA 2I5JB 4P2SA 3HFKA 1GXUA 2FD2A 1IBKJ 4TLRA 3VGTA 1A6LA 2W1BA 2GIFA 4MIBA 4USUA 3KK2A 1T94A 5ETRA 3PY8A 3CCWA 2UUBF 4I6WA 4KQZA 7AT1B 4NLVA 5KT4A 4C8YA 1CQMA 1NLKL 5IQQA 2OEJA 2V50A 3MUTP 1MMDA 4NCBA 4DS5A 1H7XA 2V9WA 4IG3B 2XWYA 4DR1F 2KT5A 2YNIB 3F56A 2YQ0A 3SQOP 5B0CA 1U2FA 1FKPB 4L72B 4CDIA 1YJNS 4GKKJ 3ZTPA 4FYYB 3CULA 4QWDA 4UF4A 2M4MA 2UVRA 2RS8A 2BJEA 3PO4A 1EKRA 2BW2A 2ACYA 2FVPA 4B9LA 2V94A 5DG8A 4USIA 1M5SA 4KC5A 4DFJA 3CJSA 2UXCJ 3AT1B 3UVJA 1NUEA 1VR6A 2B43A 1TL1A 1HNVA 1YRUA 4XO0A 2YTCA 5L9XA 3NXZA 1YBAA 2VFSA 2OPSB 4RBTA 2VFVA 3KK1A 2G4BA 1N5SA 5GAEU 1T8EA 2Z8QA 4RNFA 1VRUB 2A18A 4DU7A 3UE2A 3A8IA 4ILLA 5HN0A 2I6WA 2HQFA 1FVSA 5C2GA 3K2YA 4M8LA 3CCQS 2XHWA 4H4MA 1RWUA 3Q24A 1YJ7A 2YX4A 5D4PA 1KC8T 3QGIA 3GIMA 1R8BA 4ETZA 2V6AA 3P45B 3JXOA 4WFBQ 1RI7A 4M63A 1YWXA 1RTHA 2Z57B 4KB7A 3T5JA 4MYUA 2JEGA 2Y1RI 5FLXY 2PA3A 5KFVA 1Y7PA 4OX7A 5F8IA 2XMWA 4GKJJ 2ILZA 1TFYA 4EI2A 2DNRA 2PA8D 1NO8A 1YI2S 3TO8A 3DKDA 4CT9A 2UUWA 2DR5A 2KVQE 1FNOA 6FD1A 2Y1LB 2ZH9A 1CS4B 4ECRA 2DT9A 1JB0C 4WF9Q 1LXNA 4J91A 3ZTOA 1KS2A 2UUBJ 3S01A 1TUWA 3N4WA 3GU0A 4HL9A 3KJNB 2ERRA 2MZJA 1XR5A 2IJRA 1VQSA 2OAUA 1V5IB 1TKTA 5J2NB 4WBFA 4DL3A 1ZAVA 4EMDA 3CJ4A 1U1KA 2FHJA 3ULHA 4OJ3A 1VI7A 1OYDA 3WC2A 1RBOB 2FJEB 4F67A 1U2CA 4B9TA 4BC7A 5E5NA 1OMSA 3K5PA 3DYAB 4NLDA 1Q79A 1Y3JA 2IM0A 2R7UA 2NXEA 1FCAA 2FJAB 4HHUA 4U7UD 1BC6A 1DARA 1FXDA 1RWXB 4X4SA 2HGLA 1HA1A 4EZ9A 1VIOA 1ZTWA 1VQKS 2YVSA 2CPXA 2Z2MA 2MB0B 4HTJA 4MKYA 2C42A 3AJ1A 2N4DA 3NGSA 4LSNB 4OHYA 2XZTB 4OZ5A 4IG3A 2KJWA 3AOCA 3HK2A 3PYEA 1RWKB 1X31C 2B8PA 1RP5A 2YNIA 4FXVA 4USKA 5J1PA 2NPFA 3OLBA 1FKPA 3AD8C 2R8IA 2MQPA 4F4YA 1FEEA 2E1PA 1IM4A 2LU1A 3RBXA 1WD6A 1EIYB 1PG5B 4TY8B 1RYSA 4LQ3A 4RW7B 3UN3A 4OHWA 3CDEA 3D6TB 2XLJA 4FF2A 1UL3A 2AGOA 4JOUA 1H7WA 2E5IA 3PRDA 1LWXA 2LEBA 5L1JA 4LQ9A 3QFHA 1S6QB 3TZZA 2GQ2A 1X8DA 2OPSA 2YKNB 1NDPA 1ITPA 2E1RA 1WEYA 5KFSA 4DUZF 5CHCB 2GJFA 3M8PA 3U7JA 1CJUA 4Y00A 4LT6A 2DHHA 3PHEA 4EFAC 2VC0A 2X1FA 2J6UA 3G96A 3AQOA 2FLNA 4A8FA 2ZKTA 1WDDA 3K17A 4DUTA 2KXNB 1S0VA 4CYUB 4LF6F 1EB0A 2QA4G 1XERA 3MD3A 3I9ZA 1PYSB 2LP4A 2NLWA 3ET6B 4YB1P 2I1RA 1T0TV 1XTZA 1YJTA 3RB3A 4OYPA 1S0MA 1RQ0A 2HZAA 1C0TB 3L4BC 5T7LB 3OL8A 2ROGA 1UVJA 2C2EA 5KFPA 5C25B 1HARA 3WHIA 2OO4A 2D9OA 3HF5A 2DRAA 4NZ6A 2BZ2A 3FMWA 1ZZFA 3B8HA 2XNRA 2UUCF 4JI6F 3J7ZT 3SEOA 4F25A 5D4LA 4Y2AA 1C1BB 1K1SA 2F9JA 1SL1A 3IAS9 1TUVA 4P2MA 1IBMF 1CULB 2FPHX 1RSCA 2OPQB 4FZVA 3BBFA 3T6JA 3PEHA 1U09A 1ZA2B 4P74A 1CS4A 4CI0B 1I94F 4QBUA 5HMWA 1WNEA 1CJTB 4FXDA 2RRBA 5H9EK 3VVTA 3WQPA 3MPWA 3C66A 1VC6A 1C0UB 2XWXA 4PYDA 5KFLA 1U1NA 3BO2A 1DTQB 1TKDA 3OFFA 5KFWA 2IPOB 1NKBA 4MKBA 2JLFA 3M6WA 3H20A 1BGXT 4WIQA 1RACB 2HQDA 1YKWA 3DYAA 2RT3A 3AB4B 1RAFB 4BS2A 3LUYA 3RBEA 4F3MA 1M5KC 5KFEA 2MPUA 1UWBB 3MMBB 3B6BA 2EC2A 5F0UA 1WC1A 2DNQA 4J90A 4URQU 3SSQA 2PI4A 4QYZJ 2DO4A 2V69A 3GMGA 4RX6A 2FYXA 2X7IA 1UKUA 1WACA 3AA8A 4Q2LA 2E9ZA 1RAEB 1RT6B 1YIJS 3V4MA 4LSNA 1FXLA 5B0FA 3HDSA 3LF0A 5DM7Q 4C2MA 4Y2IA 4LSLB 3GONA 3NCRA 1B4SA 5HQMA 2XYHB 1ZZNA 1Q1KA 2CG4A 3PYDA 3AOAA 4NLGA 1MN9A 2ZH4A 2Q66A 3HSGA 1H3DA 4TY8A 5E3AA 4RW7A 3V2UC 2ZJPQ 4KAIA 3E51A 2WB4A 2ZH7A 1WEZA 4LF6J 4OZJA 4DPUA 1U8WA 2UUAF 2B0GA 4M5KA 4NLXA 1YRTA 2LQ5A 4CO2A 3TVYA 1S6QA 3CO9A 3DLBA 2DHAA 3UO0A 1UJ5A 4ZVEA 2KM8C 3MCOA 2YKNA 3BKUA 2V8DA 2HBQB 4RBUA 3ZZPA 3HT3A 4U96A 1C4AA 2LQBA 2KO1A 2LYVA 3MUVP 5GAHU 3M6UA 4ID5B 1DLOB 2IVMA 3A3PB 1VLYA 1BD6A 2UUCJ 3CPWR 4JI6J 4CYUA 2LQ8A 3NAIA 4OI2A 3GIKA 4NRTA 1JLGB 2J6TA 3R5BA 3QT8A 2GIQA 1AUDA 3ET6A 2CPYA 3QWPA 4WFYA 3TYTA 1IBMJ 3GP9A 4ED6A 5T7LA 3W64A 3U1NA 5GAEI 1GQEA 4IUFA 2DCLA 4DX8H 1I94J 5C25A 5LSRA 2HFNA 1FT8A 4ZPTR 2MSTA 1RTZA 3H40A 3U27A 2AU0A 3N6MA 5JMNA 3CCLS 5EN1A 3BPDA 3W61A 2JVOA 4CWBA 3OSPA 2GS8A 2IC3B 1C1BA 1XJWB 1RT2B 2Z30B 4ZVHA 4ECXA 3ENAA 1DQ9A 3OXLA 1CULA 2OPQA 4KBIA 3S6EA 2WVFA 2OPPB 5F0WA 3NNCA 4EO8A 3PJXA 2MLXA 3OR2B 2V68A 2AIRB 5F8LA 1F9HA 2B5JB 1AB8A 1CJTA 1X4CA 2D7SA 4P73A 4RW9B 4M1KA 2M7SA 1HW9A 1C0UA 1GXLA 3P4UB 3THPA 3WX4A 5LJ5Y 1S6OA 2DXDA 4E0DA 2R8HA 3DLGB 4ED3A 1K0VA 2VOPA 2HK3A 1OQ6A 5KG5A 3W66A 1DTQA 4ZP9A 1GMWD 3A12A 2UUTA 1T9WA 2NXUA 1GX5A 3BR9A 4LF4F 4YR2A 5C24B 1H2TZ 2FC8A 5MLCV 3MM8A 1XMOF 3DRXA 4ED7A 2YKMA 1G7CB 3I96A 2C22A 1A7GE 3TX0A 2JH3A 1RDRA 1UWBA 3MMBA 1JIHA 1JLFB 1NK8A 1FE0A 5M2UA 3VAIA 1CC8A 2MQLA 4CRJA 1GMWA 3H8YA 1UJ6A 1HNWF 3W63A 1N4LA 4ZPWR 3JAMY 3LPEA 1SVDA 5J2MA 2UV8G 1RT6A 4NMXA 8RUCA 4ZMMA 2M5YA 4OHZA 1T05B 1V6HA 2KT2A 3QJPA 2WVBA 1DTTB 4LSLA 5L9NA 3CXCR 1RHMB 2F8EX 1MLAA 3P5TL 2GC8A 2R42A 4ZCKA 5IT9U 4ELTA 4DV4F 3AQPA 3V6JA 1X4DA 1SQFA 2W7AA 5KFBA 1UFLA 2W9CB 2MDAA 2FIUA 2OELA 1FWKA 5IZHA 4N5SA 3KMSA 3M8ZA 1OSCA 1D9AA 1L3VA 1NJXA 2LMIA 2LQ9A 3UD5A 5AXKA 1NJZA 1J2VA 1X7VA 3GR1A 4B3OB 2XMAA 2J9CA 2KH9A 2EC0A 1U0HB 1NXIA 2QYGA 3C6UB 2ATLA 2GMLA 1N36F 1TKXB 1S79A 3C15A 4OI0A 1HWUA 1SJ3P 2LDYA 2CQGA 4ID5A 1T02A 1DLOA 2O1PA 4AXIA 3ITHB 2YWKA 4ERDA 2G2OA 2Y1JA 2YY3A 2RQCA 1NK0A 1S4FA 3MAHA 4Q8EA 2O66A 1JLGA 5IM0B 2AD9A 2AJQA 3IXQA 4P52A 3K0JA 4HH1A 2CG8A 4CH0S 1M0SA 4ICLB 3RB0A 3I31A 5D0RA 3I0SB 1HHSA 2R7WA 3SYZA 1CJVB 4DV3F 5GMKa 4QWCA 3A8EA 1RKIA 5KT3A 1OY6A 5IC4B 4NLSA 3OD2A 3I56S 2D3O1 1AFJA 1KR4A 3B4MA 2VC1A 4O3QA 3SI8A 2IC3A 4YB7A 3BJYA 2GHVC 2BR0A 4PXBA 2DNKA 3MFHA 3Q8VA 4LF4J 2Y3YA 1RT2A 3NEKA 1NSKL 1HBUB 2A3JA 4CLPA 1XMOJ 3SBMA 1L3TA 5IC6B 2RUGA 4HH0A 5ETNA 3L7OA 2OPPA 4FS2A 5ETSA 3DU5A 4U9RA 3PX6A 2B5JA 2WW8A 3BGLA 3G86A 1QTMA 4RW9A 4TXSA 6FDRA 1U1PA 3RBDA 4WK3A 3MEEB 1HNWJ 1HW8A 4MT1A 3DLGA 3PO5A 4DV0F 2J6SA 2BJ1A 2AJ4A 1FRHA 1LW0B 3QIPA 2XTJP 4ECQA 2FGOA 5LSOA 1NK9A 3RYLA 2FC9A 5C24A 4IOCQ 2QLFB 3ILIA 3OTBA 4C8MA 3CJ3A 4KGVB 2DNGA 4IDKB 2OFGX 3CTRA 4DV4J 1X9SA 5CH7B 2BXJA 4N77A 5G0RB 2YWFA 3CJTA 1JLFA 3H5UA 1Y00A 2BRLA 3FZBA 3N79A 3NRBA 2FJBB 2DR8A 1D8ZA 4LR9A 1ULRA 3W62A 3M2VB 3TZYA 4J9VA 5LJ3Y 3IGVA 1NAQA 4YFUA 4J9OA 3D0HE 1UA0A 3DOMB 2QC3A 3JAMU 1SJ1A 1T05A 2DTJA 2ZC4A 2ATCB 1NPRA 1MNEA 4KKOB 1N36J 4Y28C 2WHOA 2QA1A 2HVIA 3UCZP 4O3OA 4PWWA 2CJXB 3GPAA 5AE2A 5KFCA 1K47A 4ZLNA 3J80Y 4HI1A 3HVWA 3KG0A 2GVZB 2RRNA 3TEHB 2VBYA 4K0KF 3JQMA 2ZVSA 4RUAA 1K0TA 1PJ6A 2CYYA 3ISNC 2C2ZB 3P5BP 2QO3A 4YQWA 3M05A 3CJKA 4USWA 2UVVA 2P5VA 1VLOA 4NRUA 3CDWA 2ZH1A 2UV8A 2NR0A 4B3OA 1X4FA 4K4VA 2HSEB 4YB5A 2W8KA 1U0HA 1SH3A 2FLLA 3C6UA 3MFIA 4QIWD 1X4GA 2DEIA 3OFEA 2EI5A 2QMUB 3N6LA 5GMDA 3G82B 1NEEA 1X4BA 1HQEB 3OFGA 4P7VA 5H9EJ 3OR1B 4PG8A 3UR3C 1ZM3A 1U2RA 4EBDA 4F2RA 4C8ZA 2DRDA 5IM0A 2KZZA 2I0XA 3QSIA 1B0VA 5I3PA 3OL7A 3I0SA 2ZUAA 4I68A 5B09A 4OZNA 2CVEA 1UEVA 2AP6A 2ZNZA 3AOBA 3EGNA 2NYHA 2H5IB 4DV6F 2M2BA 2X3DA 3VV2B 4EEYA 1H98A 1TL7B 3ETMA 1MWYA 1FTRA 1A9NB 4PR6A 1Y10A 3CWJA 2CNNB 4DV0J 4PG7A 4I2QB 2MSSA 3THVA 4Y0FA 1KTQA 4O3NA 5DDPC 2QFIA 4X66F 4XTTA 1G4CA 3M30B 3TQEA 2C1EB 1HBUA 2ZZTA 2Z58B 2IY5B 1SIZA 4CLSA 4USTA 4V19J 2V8PA 2W2OP 2KHDA 2VPYB 1CLFA 4ZS6A 4A46A 4PG6A 1RTJB 1PJ7A 2CZ4A 2JJ4D 2MY8A 5G4DA 3UN5A 3SCKE 1JJ4A 5A8WB 1Y5LB 5C5JA 2BE2B 3TEGA 1S1XA 3NCPA 4MKVA 1UVKA 1LK5A 3BGUA 2IBKA 5GMEA 4U8VA 4MJKA 3HHLB 1Q5YA 5A8RB 1LW0A 2RQMA 1K44A 1XIQA 4Q7AA 4EBEA 1YLXA 1YRXA 3Q8UA 5KFHA 3HSDA 1O6XA 5KT7A 1MSWD 2L9WA 1Q8IA 3DRYA 4IDKA 2W2PP 4LVNP 4IR9A 2CQIA 4HR2A 5G0RA 2G9OA 5EGYA 4QU7A 1XNQF 1ZTTA 1FDBA 4A8KA 5H1SV 4OZLA 4HYKA 3VAKA 4K0KJ 2CJ9A 2JZ5A 3M2VA 2PGCA 3E3XA 3IWNC 3HPOA 1T9VA 3A3NB 3RB4A 3SV3A 3BQ2A 1TP7A 4ZCLA 3J81j 4UT4A 2ZZNA 2V9KA 5ITHA 3MXHP 3RW6A 5DZ7A 5ETMA 4CCHA 3ILJA 4KKOA 1BMQB 4ECZA 1GXTA 4LR8A 2XY5A 1WHVA 2XMJA 3T1AA 1S72S 2FVRA 4J9RA 1VQ6S 2HZVA 5D4OA 2A1BA 4YDXA 5BYSA 2FJDB 1DRZA 2H9ZA 3QGGA 4DQIA 5A76A 4ZP6A 1RWVB 1RTIB 1F3FA 3GV7B 1VC5A 3R6GB 2CXEA 3L7UA 3MAQA 1D3WA 3POTA 5K14B 2BQ3A 3A4TA 3CSKA 4Z37A 4L3KA 1IWGA 4Z7CA 2A2CA 3MWBA 3JSBA 1QVFR 5H9FK 3G9CA 1X4EA 2HPUA 3QLHB 5KT6A 5HVGA 4ZA1A 1F2GA 2ROPA 2CNOB 4DV6J 3G82A 4NYOA 1RAJA 1H73A 3CCRS 4J9MA 3K7RA 2F4VF 1G3OA 3OR1A 3SSRA 3MCNA 5KOXA 3BYRA 3G6XA 4WPAA 1TK5A 3EDQB 2RE1A 2KFNA 2BKNA 2CQ2A 2H54B 2ASLA 3PX4A 4X66J 5K8PA 2HNDB 1NPPA 5L1IA 1RGVA 3IO1A 4LSZB 2DGSA 4EUVA 2GO8A 4FYDA 5DDQC 2N7CA 1YJ9S 4C97A 2HFUA 4PXDA 3S1TA 5ETTA 2LXIA 3GCWP 4HT7A 3OUYB 4QQBA 1S0OA 4R8UB 3MURP 1VC0A 3RAMA 1RAHB 3KJQB 4QZVB 1TL7A 3TVZA 4K59A 4L75A 3PG9A 2NQPA 1X9MA 4TN2A 2ABYA 4ITSA 4I2QA 3BPSP 4TY9A 4DZ6A 4X4QA 2X1GA 4F36A 4S0MA 2Z4PA 1NM2A 5HAOA 2HHPA 3CD0A 3ZZZA 1PYTA 3RUBL 3DU6A 3M30A 4OYZA 1T3OA 3DXSX 1Q4RA 4L6V3 5J1NA 3D3CJ 3VAHA 4M5GA 3R9LA 3KDOA 2EFGA 1OS5A 4ILRA 1DAXA 1P9QC 1RTJA 2VQEJ 4NASA 2ZH2A 3W2VB 1JLAB 5A8WA 1L3KA 1XNQJ 5AE1A 3HCXA 3QMQA 2ZH3A 4IRDA 1H38A 3GIJA 2XHCA 2BOPA 3HHLA 2ALZA 1O51A 2E1MC 4ZDNA 5A8RA 2VONA 1IUJA 1RU2A 4OI3A 3P3DA 2KI2A 3RAXA 2DPJA 4OYXA 4DQSA 1BHNA 1FWPA 4A8SA 3BGFA 3AA9A 1X0PA 2K3KA 5E3RA 3O8WA 4LMZA 3WX8A 5DGAA 3MCMA 2PDAA 2G0JA 2NREA 1Y5NB 1C2PA 2ALYB 4FF4A 4ED8A 2FJVA 2CQPA 3LWLA 3RZAA 5DQHA 5E41A 1K8AT 2DGUA 3VCDA 2ADCA 1FTCA 4MK8A 2CJAA 1U1MA 3H2VE 3BB5A 2FY1A 3NWGA 2JRSA 1EHWA 2E9TA 1VS3A 4DCPB 1SJ4P 4ZKAA 1WG4A 2C2OB 4F8RA 1NKEA 4J7CA 2QX0A 2J9DA 2XI3A 2ZE2B 2F4VJ 3D9BA 4MAKA 1N0UA 4QR0A 2KFYA 4TQRA 4RWWA 1RTIA 5D77A 3EE3A 3ZZTA 2XBPA 5K14A 2YWHA 2XS2A 1VQLS 3LGHA 1SL0A 1XR7A 3R1HA 2HHXA 2Z2YB 1N5YB 1QE1B 3UD4P 4RKUC 3QLHA 2CNLB 2APOA 4RJVA 3UDLA 1OO0B 2CQBA 1KQGB 3ZZOA 2JFKA 4CM0A 1FD2A 3G6YA 1F9FA 4Q45A 1RAAB 1HLWA 4ED5A 4B08A 2Q6CA 1TV6B 3FBCA 1T95A 3J7Z5 3DRSB 4CLWA 2O5DA 2XNQA 1N0VC 5LSLA 4NLUA 4YUDA 3SXLA 1UFWA 1HQ2A 1JJCB 1NSQA 2HNDA 2R8JA 5THWA 4EYHB 2A2DA 5GAGI 4FF3A 2CRLA 2V67A 2E44A 1BY9A 1R8AA 1PBAA 2M9KA 3K89A 3KLGA 2MKKA 2E7VA 3TNVA 3KHGA 4OFZA 4ZJQA 4G1IA 2YH0A 3OUYA 4R8UA 1HYSB 1KQSR 1UEUA 1EP4B 1F0XA 4KHMA 2DJWA 2XZWA 1M5HA 1KQFB 4DI6A 2CWKA 5IV3A 3NGDA 1NCLA 2L9NA 2AJ2A 4G1QB 1X5PA 2HHSA 1DURA 3EX7B 5EX0A 2Z0GA 2C3OA 2WW4A 3BSCA 1F9EB 2MKHA 1BWEA 2XO6A 3MPUB 2BDPA 3V4IB 1AFIA 1T3NA 3Q8PB 1HQUB 5D6GA 3QJJA 3FSXA 3W2VA 1JLAA 5J2PB 1RUSA 2PMWA 3BN4A 4YR0A 4HVZA 1P6TA 1VISA 3MDFA 3BGRB 3TRGA 3R5JB 3LO3A 2JEIA 1V3RA 2IRYA 3RJMB 3M9MB 2VG7B 5LT5A 4ZVFA 2I2YA 2AX0A 2EFOA 3RAQA 3Q89A 1V5VA 3D4JA 2JDJA 2V34A 2JNJA 5KFIA 3UCUP 3MPDA 1VBZA 1IBCB 3Q8QB 1S0NA 3J7A1 4OI4A 3N0VA 2OJ3A 4HDHA 2QV6A 4XPEA 2G0CA 1S1VB 1VQYA 4ENOA 2PFDA 4B17A 5L8RC 3DRRA 3QT7A 4CH7A 1RXOB 2K06A 4ZVRB 4E8UA 2HWIA 4DLEA 4O3PA 3GE9A 3CIZA 3IRXB 1TUGB 2ZBRA 2A6MA 3MOZA 5KAKA 3PDNA 5DLFA 5E3CA 1PCAA 3CDAA 1T9UA 4Y6IA 4DL5A 2DNPA 2KL8A 2XGQA 4LRFA 3HJFA 4JV1A 1S6PB 1GEHA 4JV5F 4CO4A 1UP1A 2VV5A 4NLRA 3NLCA 2DNYA 1LW2B 3OVSA 2B8QA 3C19A 3I4PA 3IM9A 2V5HG 2EFVA 2HQ3A 3PW7A 3W65A 3DLEB 1WKLA 1Q8BA 2RHSB 2HHWA 1UVMA 4RNHA 5HL7Q 5E3PA 1N33F 3LALA 3BEGB 2BQUA 1OJ4A 4TYAA 2EVZA 2KM8B 2PI5A 1QE1A 5M2RA 2ZH6A 1JWWA 3W8PA 1XQIA 2VICA 5AE3A 1YJWS 1X5TA 1RHRB 1RHJB 4IR1A 1JNRB 2HW3A 1B99A 1IKXB 3AFGA 3EZ5A 1IM6A 3IMQJ 1SBRA 1M90T 1E6VB 1P27B 2C2MB 1S6UA 4O44B 1TV6A 3HZGA 3DRSA 4N56A 3AJDA 4K4YA 2EXUA 2YNHB 3H5SA 1RU1A 2XZDB 2F8MA 3LPYA 4F2SA 3OL9A 5CYJA 3SV4A 3Q8RB 5F8JA 4X65F 3GJRB 4K8RA 2EPIA 1FX2A 3MM6B 2VOOA 4AXJA 4DL2A 1WHXA 1EQMA 3DRPA 3FCVA 1K73T 3K5LA 5ETLA 1J5OB 4RUCA 4FN5A 1HYSA 2WB1D 2FZKB 1EP4A 3QRQA 4QWAA 1QUVA 3HM9A 3GYNA 1Q7YT 1V9OA 2HFSA 1SH2A 2W9AA 3UN2A 4GVBA 1R6VA 4G1QA 1HD1A 5HJXA 1AUSL 1FJCA 4LF9F 2KG1A 2JLEA 4KO0B 4LFAF 4UZBA 3Q8YA 4C98A 4PAAA 3V4IA 1R8HA 4NA2A 3P6YC 4G6VB 2IHR1 1SUQB 2HAIA 1HQUA 1P1TA 4YMEA 4JI2F 2COLA 4FDFA 3JTPA 3J81Y 1S7HA 3HX9A 3D1QA 2DITA 5J2PA 1RCOB 4WTOB 5E0OA 2DXFA 4IFVB 4PG5A 3HT0A 2FVSA 4LRCA 4C8OA 3BGRA 5K8OA 3KKFA 4I2PA 4M5MA 1A0OB 2AX1A 5H9FJ 3UNGC 3VTIA 2GIRA 4GMKA 1S9FA 2CKWA 4NI2B 3TJAA 1YTYA 4JV5J 2AV5A 3HVAA 1S1VA 5E7OB 4P75A 3T3FA 2DGXA 1CJKB 2RNEA 5KFXA 3TVKA 2IJFA 2J9DE 1WC5A 2VKZG 3BN7A 4RO0A 4DDFA 4QOTA 3BBBA 2XYPB 2N3OA 1N33J 2RF2B 3IRXA 1EX8A 2ZBCA 3PKYA 4A8MP 3I5BA 1QD1A 3UVJB 2DISA 2R7QA 3C8YA 1RLDA 1S6PA 4ZIVA 3QSYB 3MHYA 3PEJA 2XMKA 4ETXA 3DNCA 1LW2A 3EJMA 3LAKA 4CIOA 3OHBA 3IA0A 1GT8A 1JXVA 4EBCA 2RD5C 4A8XA 2CADA 3EGVA 4WKYA 3PW0A 4IQMA 2K3IA 3BR8A 4X84A 5T14A 4J5OA 4X65J 5F41A 3KUGA 5F8MA 1CBKA 3QZ8A 3PIOQ 2VB6A 3CJRA 1C1CB 2XB2D 4CTAB 3HHNB 1KTVA 2CJYB 3H42A 2E1AA 1MMNA 1P1LA 1M5VC 4ZPDA 5DO2A 2DYAA 4J9QA 1IKXA 3BSOA 2HGNA 2AJFE 1IQTA 1RA7A 1VQ7S 1E6VA 4O44A 4I4BA 4HDGA 3M2UB 4GC6A 3QWUA 2F3JA 2YNHA 1NHUA 5GADU 4RUHA 2OTJS 3A8KA 2N7YA 1UPPA 1UVLA 2FQQB 3IR6B 4QIVA 2UZAA 1RB0A 2E5HA 4C6AA 1CG2A 5B0EA 2XLKA 1N5QA 1WOPA 3KLHB 4LFAJ 3FRYA 3MM6A 4HKQA 1SXLA 3EXCX 2YX7A 3MEGB 1UPMB 2E66A 2GJIA 3PKMA 4WK1A 3E01B 4JI2J 1ACMB 3WBZA 2DBBA 3S8SA 3GWCA 3I5AA 3G6VA 2BJDA 4IO1A 4DF8A 1L5UA 4MH8A 4X4NA 1YHQS 4F4ZA 1X4AA 3FZ2A 2CDQA 2VPZB 4BBYA 5KT2A 4J9KA 5DLGA 3C6TB 2BACA 2RQKA 4FP9A 1H0HB 3R7BB 3PX0A 4UOGA 4WXWA 2H5EA 4KO0A 4I64A 2IA0A 1NRKA 2DK2A 2Y0SD 4KH1B 2NUHA 1RBAA 4LF7F 3HHLC 1SUQA 4HI2A 4ALZA 4ID8A 4ZVQB 1VYAA 3UD3P 1NZAA 2E5GA 4ANEA 3GIRA 3RRKA 1RJJA 3G4SS 2BOAA 2ZOMA 4ZPBA 4U67Q 4IFVA 4DU8A 2VU5A 4G65A 2CUYA 2XCAA 3T9ZA 4WWSA 1RAIB 4BC9A 3PVXA 2R7RA 4KR0B 1MROA 3QT6A 1WSVA 4W4MA 4URGA 4B3MF 1LWFB 2H48B 4OV1A 4B9MA 2HHQA 2M88A 4DCOB 4LIWA 1DZ5A 2KKHA 2ASYA 4USHA 4ER8A 4PKDB 1F1BB 3G6ES 2HMIA 2R3VA 4R0JA 4NI2A 3L9ZA 4IH7A 3M6XA 3W8GA 2G2ZA 1CJKA 4B9UA 4UUXA 3SSSA 4O3RA 3BBCA 4JV0A 1U25A 3HFVA 4WYLA 2QLJB 3NY0A 4X4RA 4CNYA 2RF2A 2HRYA 1T03A 3ONQA 5A2QU 2LVWA 2B51A 3PACA 2AZ1A 4TNOA 3G8SA 2DY1A 2P6SA 2BX6A 4PG4A 2RHQB 2NYIA 3IR7B 2DB1A 4OYIA 2L48A 1W7WA 4I1TA 2Z2ZA 3L09A 1TR0A 4UW2A 2A10A 2QIFA 2BANB 3GYGA 3M8PB 2W7OA 1CJUB 5C42B 4ECWA 5I3UB 4KGZB 3M7VA 3V6HA 5KFAA 1TVRB 4K7QA 2VFTA 1VQNS 3HSJA 4GO7X 3GTYX 2CAJA 2R4FA 3FC9A 3J7YU 4KJIA 5KFUA 1FJGF 1C1CA 1S99A 4CTAA 1AXQA 2UXDF 1HIYA 1BWVA 2AT1B 3IP0A 1IR1A 2BVZA 2ZKUA 1NPKA 2HZCA 1XBWA 4RW4B 2KXHA 4C8KA 2RKIB 3M2UA 1EZZB 4DQQA 5DG9A 3ENVA 2GX8A 4AUKA 3P8BB 4B3TF 3PR5B 4P9SA 3KLHA 1JQGA 3O1LA 2Q6BA 5D8HB 1CSJA 4WFAQ 3MEGA 3OVBA 4LF7J 1WI8A 2U1AA 3UWTA 2MMYA 3H59A 2YKQA 3E01A 7FDRA 1RAGB 1N8RT 1HKAA 5C2CA 2OSRA 2W7PA 3VR1A 3ZZRA 1M5PC 2HWTA 1NK7A 1NH8A 4DUYF 3D3BJ 1VQ5S 3M8WA 2BJ7A 4DPXA 2VD3A 4XIUA 1WC0A 3CCES 3NS5A 2G13A 2QSFA 1O5JA 3C6TA 1RHUB 1F2HA 2NCKL 4L3NA 3I4HX 2GQCA 3NG8A 2J8SA 2DNOA 2EBEA 5HI7A 2PSZA 1ZS6A 4ATNA 3QRRA 4X2BA 1B0TA 4Y65A 5EX3A 2L08A 1CEZA 5KG7A 1WG5A 2JVRA 4DR1J 1ELOA 4V1Ak 2HNYB 1REGX 1W2BR 3BH6B 3NCQA 5KG6A 4M5DB 2HHVA 4YY3F 2MKJA 3C3LA 3CO0P 5B7WA 2PIIA 3BO3A 1N32F 4DX7A 4DHVA 1KEKA 4P71A 3MMCB 3H4DA 2ZHBA 1LWFA 2ASDA 1N6QB 2JWNA 1GTEA 2DR7A 2VBZA 5ETOA 2KTQA 3R97A 1S4EA 3DOKB 1IBLF 1SKUB 1YBTA 2BQRA 3G2XA 3B54A 4BCAA 2JC1A 1YJRA 2SXLA 1QSYA 3EWGA 1NBEB 3TP2A 4B9SA 4X62F 1HD0A 5CA5A 3HHEA 4AFFA 2KG0A 2WVCA 4CO3A 1JX4A 4DQPA 2DGWA 3DHWC 3I82A 3VHQA 1YZ7A 3X1LB 4LJMA 2VQFF 3G87A 4NXMF 3LW5C 2AYMA 4KGXB 3IBWA 1VBYA 1FJGJ 2MKSA 2UXDJ 2F4FA 2WTFA 3TA2A 4NA3A 1FRIA 1XWLA 4X4VA 3I9V9 2MQMA 1VRQC 2V8GA 1HI0P 3CCJS 5DG7A 2QTWA 2BANA 3FVYA 1OY9A 3N5BA 3KFWX 2M70A 5C42A 5I3UA 1JMTA 1I3OB 4HLBA 5A8KB 3H25A 2BUNA 1TVRA 1BQMB 4PABA 3SFGA 4B3TJ 2IDEA 2CNKB 2BA9A 1XMQF 3JQKA 4DSJA 4ED0A 4ELVA 1QTNB 3NGRA 4WU3A 3G71S 4MMOA 1JLEB 2ZH5A 2GV1A 2AGPA 1TELA 3AD7C 2RSQA 2IMWP 1R6YA 4F4KA 4RW4A 4DUYJ 2B9WA 3R5GA 1AZSA 3HD1A 1U26A 1OWXA 4RBVA 2RKIA 1PIEA 3JTNA 4YOEA 5KFTA 1LK7A 1Q53A 5FLXU 3M8RA 5J2QB 2UVUA 1S9EA 5HVHA 1SC1B 3WC0A 5KFKA 2KT3A 2VFUA 3NNHA 1FRXA 2OUGA 3KOAA 3NOGA 3VAMA 4YY3J 4MTPA 1BXNA 3TWZA 4N76A 4B02A 1N32J 5HK4A 3WZ0A 2J5AA 5CZXA 3V81A 1IJEB 2GFFA 2MZRA 3GQCA 2L9DA 1YVFA 3W9JA 4OIXA 4O0NA 2IVFB 4M5JA 4CT8A 4BWJA 3T6BA 1KONA 1S10A 4H54A 1IWAA 1IBLJ 2OP5A 4PRFA 2GHPA 2QRRA 5IV4A 2HNYA 3MM8B 2XSFA 3MUMP 2YKMB 4M5DA 4DJBA 1WOOA 4D3HA 4X62J 2QT7A 4KHPF 2AZ3A 4DN9A 2VODA 1BLUA 2EFPA 2IRXA 1S1WB 1WHWA 2P9CA 2XLIA 4M5HA 3ETOA 1FFSB 2HFZA 4FNHA 5LMNF 4LFCF 4M95A 1W2IA 2F65A 2FVQA 3MMCA 1UFKA 1YK9A 4CLTA 3RTVA 1S5ZA
chains in the Genus database with same CATH topology
2V0NA 4HT7A 3OUYB 4QQBA 1S0OA 4DSFA 2QMWA 4JI1F 4R8UB 2B43A 3MURP 1TL1A 5CYQA 1VC0A 1N6QA 3RAMA 1HNVA 1YRUA 4XO0A 4QZVB 3TVZA 2EK1A 1KVIA 2DHSA 4K59A 2YTCA 2KHCA 5L9XA 4ES3A 4I0WA 2NQPA 1X9MA 3L7PA 1YBAA 2DH7A 5J2MB 3TA0A 4TN2A 2VFSA 4OQJA 5HLFB 4KFBB 2ZJRQ 5KFDA 2OPSB 2ABYA 3DOKA 4RBTA 2IM1A 4ITSA 2VFVA 4I2QA 4DSLA 4TY9A 4X4QA 3RW7A 3KK1A 2G4BA 1N5SA 2Q3PA 2X1GA 4A48A 5GAEU 2Z4PA 1FJEB 2CPZA 2HHPA 3W7BA 2X1AA 1T8EA 3CD0A 3ZZZA 5K8NA 2Z8QA 5K8MA 1G1XA 1HBOB 4RNFA 4DL4A 3DU6A 2RVJA 3M30A 1T3OA 1VRUB 3DXSX 2A18A 1DQAA 1Q4RA 3UE2A 1Z2ZA 2B56A 4L6V3 4USJC 4ILLA 4XK8C 5HN0A 5J1NA 3JSRA 4R5PB 2CPEA 4HTIA 4QYRA 2YX1A 1FVSA 2M52A 1XEZA 3VAHA 2K2PA 3K2YA 4M8LA 2PO4A 2EFGA 1OS5A 2CQDA 2X51A 4Y2KA 3Q2TC 4ILRA 3CCQS 2XHWA 1DAXA 1P9QC 1RTJA 1RWUA 4H4MA 3Q24A 1XR6A 2ZH2A 2MJNA 2YX4A 3W2VB 1FK9A 1JLAB 5D4PA 5A8WA 3FCHA 1JKHA 3IAM9 1NU4A 1L3KA 4PWUA 1KC8T 2V4JA 5AE1A 3D0GE 3QMQA 3QGIA 3GIMA 1R8BA 2U2FA 4YHHF 2ZH3A 3PV8A 2POKA 4IRDA 1ZH5A 2IFXA 4ETZA 2EBGA 3KMQA 5KTQA 1H38A 3GIJA 5JXSA 1VQ9S 2I38A 3GFHA 2BOPA 2GCFA 2HHTA 4A8OA 3CE8A 3HHLA 2C28A 2ALZA 1ZBTA 2QA4S 1O51A 2E1MC 4ZDNA 5A8RA 2VASA 1RI7A 4WFBQ 4M63A 1DBDA 2VONA 1YWXA 1HR0F 1RTHA 1U49A 1RT4B 1IUJA 1DTTA 3KK3B 4OI3A 5IS2A 2GW8A 2KI2A 1E6YA 3BREA 3P3DA 3RAXA 1U4BA 2DPJA 4DQSA 3OFHA 2HQIA 3KG1A 4KB7A 3T5JA 2XC9A 2KDOA 1VJWA 3BGFA 4MYUA 4P7TA 4A8SA 5J1EA 2JEGA 3AA9A 1VQ4S 2BM0A 2Y1RI 3BF4A 2CPHA 3CDBA 3I6PA 5L38A 1X0PA 2K3KA 5FLXY 2PA3A 5E3RA 3O8WA 5KFVA 4J9PA 3D0IE 4LMZA 2W9CA 1Y7PA 4OX7A 5DGAA 4F3OA 3DLKB 3GSDA 5F8IA 2XMWA 3M8SA 3LP0B 2ILZA 5IT4A 2PDAA 1TFYA 2NREA 1Y5NB 2W4CA 1C2PA 3U1LA 3BZQA 5A8KA 4FF4A 3AY0A 5L1KA 1TQLA 4ED8A 2DNRA 2FJVA 1HNIB 2CQPA 2PA8D 3LWLA 3RZAA 3H4BA 4ILMA 3MPYA 5DQHA 1BQMA 5E41A 1K8AT 1NO8A 2DGUA 1YI2S 2AYEA 1GAOA 3VCDA 2RU3A 4NOHA 4UY85 1HI1A 3TO8A 4PCQA 3BQ0A 2ADCA 4JI7F 4JI8F 4XDCA 3R5DA 4CT9A 3EYZA 1FTCA 4I7FB 2CJAA 2UUWA 4MK8A 2MZ1A 3OJSA 2DR5A 4EWTA 1I1GA 1FNOA 1JLEA 1D1UA 6FD1A 1SJFA 4XAKA 5GAGU 1U1MA 3H2VE 4FVCA 3PNIA 1Y3KA 2ZH9A 3BB5A 2FY1A 3K59A 4ECRA 3NWGA 1S48A 2DT9A 2JRSA 1JB0C 3GV5B 4K4WA 2YH1A 4WF9Q 3AAWB 1S1UA 1TKXA 1VS3A 2DRBA 4O3RA 2E9TA 1LXNA 1NKCA 1KS2A 2XS7A 2IRUA 3S01A 1MROB 3TUZC 1SJ4P 4K4SA 3N4WA 3PW4A 4ZKAA 3KNGA 4HL9A 2BBEA 1DFDA 4CZCA 1WG4A 2B7BB 2ERRA 4Q8FA 2MZJA 1XR5A 4F8RA 1VQSA 4H4KC 3FSIA 2OAUA 5KFRA 3OXFA 4AL7A 1TKTA 1NKEA 5HBMB 4JI5F 5J2NB 3CD5A 2XMUA 4DL3A 1QSLA 1ZAVA 1ZM4A 2MJUA 3CJ4A 1U1KA 2FHJA 3OV7A 2J9DA 3NAHA 3VALA 4PWDB 3ITHA 3ULHA 2X3GA 4OJ3A 2XI3A 2J76E 3MEDA 1VI7A 4A4JA 1WEXA 5J2QA 1HBNB 2ZE2B 2NUUG 1NH7A 1QJHA 1FDAA 3WC2A 2FJEB 4F67A 3KHLA 1YJVA 2D74B 1U6ZA 4B9TA 4BC7A 2HMIB 4FVMA 1KFDA 4MAKA 1R7IA 1N0UA 2JHEA 4NCAA 2IAJB 2WAQD 4LUBA 5ADZA 3ISZA 5E5NA 3K5PA 4ECSA 2LQJA 2LEAA 3N28A 4QR0A 3DYAB 4KSEB 4EU0A 2KFYA 4TQRA 4NLDA 1RTIA 4ICLA 4RWWA 4ECTA 1Q79A 5D77A 1D9FA 3DM2B 3ZZTA 5CYMA 1U1RA 1SKSA 2XBPA 2KFZA 1Y3JA 5K14A 2IM0A 2YWHA 2R7UA 1Q16B 4NX9A 2XS2A 1VQLS 1FEHA 1FCAA 1NJWA 2FJAB 1N56A 1QSSA 5I42A 1BC6A 1DARA 1SL0A 1XR7A 3TAPA 3VAFA 1FXDA 3R1HA 2HHXA 4X4SA 1N5YB 1QE1B 2HGLA 4PPZA 2PD1A 3UD4P 2QLWA 1HA1A 1CVJA 4B3SF 4EZ9A 2V4QA 4F4WA 2CPJA 1VIOA 2JFDA 3I0RB 4RKUC 3QLHA 1T03B 1FERA 4KRWA 5A0YB 1ZTWA 1VQKS 2ZD1A 3LP2B 2APOA 3UR0A 1FNMA 3DLJA 4A8YA 2YVSA 2CPXA 2Z2MA 4C7QA 2MB0B 2VG6B 4HTJA 3UDLA 3TAQA 1OO0B 2CQBA 3M2RA 1U1OA 5JVGQ 1XC9A 1KQGB 4MKYA 2C42A 3KLEA 4B3RF 2GNKA 3ZZOA 2JFKA 3AJ1A 4F26A 2N4DA 4LSNB 1LOUA 4OHYA 1DHMA 1FD2A 3G6YA 3TARA 4JV2A 2FB0A 2J9EA 1UA1A 1F9FA 4OZ5A 4Q45A 1AROP 4IG3A 2KJWA 4ED5A 4B08A 3CC4S 3HK2A 4IH6A 1Q82T 1URRA 3CJ5A 4ZOSA 4DG1B 4GKKF 1RP5A 2YNIA 2Q6CA 1NB7A 3QIPB 1TV6B 3TI0A 4O0IA 1WELA 4FXVA 2YKPA 1PGZA 1T95A 2F8HA 1VGYA 5J1PA 3J7Z5 3DRSB 2EW9A 3BM7A 3MTJA 1SV5A 2OMOA 2NPFA 2O5DA 2XNQA 2FGCA 4QW9A 1N0VC 2CJKA 3OLBA 1FKPA 5LSLA 1R3NA 2R8IA 1FDNA 2VUGA 2RDIA 4NLUA 2MQPA 4YUDA 4IYQA 3SXLA 1ZETA 1UFWA 4UOCA 4F4YA 2DNHA 1FEEA 3CB4A 5LL6d 2HNDA 2R8JA 5THWA 2R7TA 4EYHB 2HRUA 2A2DA 5GAGI 4RWXA 1IM4A 2I9SA 2LU1A 5B0AA 4FF3A 2CRLA 1WD6A 2AYGA 1ROFA 4TY8B 1RYSA 2E44A 4UY8T 4LQ3A 4RW7B 1S1WA 5CXTA 1BY9A 3FEZA 3WDOA 2VPWB 4OHWA 1R8AA 2M9KA 3IGNA 3CDEA 2HG4A 2XLJA 3KLGA 4K5SA 2MKKA 5AJ3F 4FF2A 1UL3A 2E5JA 2AGOA 3FGVA 2OMLA 2VBXA 1WTFA 2VFRA 4JOUA 3TNVA 5I4MA 1U8SA 3KHGA 4OFZA 1RT5B 3HVTA 2HHUA 4G1IA 1HHTP 3MEEA 2OTLS 1MWZA 1H7WA 1ZPVA 2YH0A 3OUYA 1S9GB 2E5IA 3PRDA 4N8OA 3LAMA 4R8UA 4F50A 7FD1A 1HYSB 2J7KA 1KQSR 2LEBA 5L1JA 1UEUA 1EP4B 1Q8LA 2DCUB 2B4UA 4LQ9A 1GX6A 1S6QB 1SJRA 1YITS 2CPDA 5KG4A 2GQ2A 1F0XA 3ZZYA 4KHMA 2DJWA 2XZWA 4WFNQ 1TK8A 1X8DA 1M5HA 4NCGB 1KQFB 5HLFA 4YB6A 4KFBA 4ZK7M 5B0BA 2OPSA 3GILA 1P8GA 3CCZA 3NGKA 2YKNB 2AF6A 1PILA 4HEA9 2E1RA 5CD4H 1WEYA 5KFSA 1W25A 3NGDA 1N88A 4DUZF 5KFFA 5CHCB 2VBWA 3M8PA 2DIUA 5E33A 3U7JA 3LOUA 2L9NA 4G1QB 1X5PA 1HBOA 4Y00A 3ZZ0A 4LT6A 2HHSA 1DURA 5FD1A 4DOZA 1I6JA 2V8HA 3PHEA 2FHOB 3EX7B 5EX0A 2Z0GA 2C3OA 3BSCA 3NS6A 1QAYA 4C8NA 2MKHA 4EFAC 2VC0A 2X1FA 1BWEA 2J6UA 3G96A 4UQTA 2VQEF 3AQOA 2FLNA 4A8FA 1FD8A 4Y2CA 2PEHA 2ZKTA 3O6QA 4R5PA 3GFXA 2ZH8A 3V4IB 2BDPA 4KGKA 5BYRA 1AFIA 2GGPB 5SUHA 1T3NA 1HWLA 2KXNB 1S0VA 3Q8PB 4LF6F 1CPZA 1HQUB 2QA4G 1XERA 3MD3A 4U7CA 2CZVC 3I9ZA 5D6GA 3QJJA 4XDDA 2HS4A 4CQ1A 4QPXA 3FSXA 3W2VA 1JLAA 5DS7A 5LXYA 2PFFB 2YNFB 3ICLA 5J2PB 1JLQA 2OLWA 2NLWA 2GJ2A 4YB1P 3MPVA 2I1RA 5DQGA 4OHVA 5K9FA 1XTZA 1YJTA 3CJKB 2DH9A 1UVNA 3RB3A 4QCLA 3BN4A 1S0MA 1RQ0A 4YR0A 3US5A 1C0TB 3DOMA 2AGQA 4HVZA 1P6TA 3Q2SC 5T7LB 2MZSA 3OL8A 3DOLB 3I87A 2GA7A 3MDFA 3BGRB 4OLPA 2ROGA 3TRGA 2LKZA 4JUZA 4DR2F 3LO3A 2JEIA 1V3RA 2IRYA 3M9MB 1RT4A 1FNXH 1R8CA 2VG7B 3KK3A 3OJUA 4V19X 5LT5A 1UVJA 2C2EA 3C46A 2EFQA 5KFPA 4ZVFA 5C25B 1HARA 3QO9B 2I2YA 2AX0A 2EFOA 2QE5A 3RAQA 2C3YA 2B6AB 2JDJA 1KQKA 4GKJF 4RU9A 2OO4A 3RR8A 3PW2A 2D9OA 3HF5A 2DRAA 4PQUB 3NMRA 1X5OA 1LWEB 4NZ6A 3OQ2A 5KFIA 3UCUP 2BZ2A 3RRGA 3FMWA 2ZNYA 1ZZFA 3DGPA 3B8HA 3KWMA 1VBZA 2F7VA 1DJ0A 1KHWA 1WF0A 3Q8QB 1S0NA 3J7A1 4OI4A 2B7CB 4YEAA 3DLKA 3N0VA 2XNRA 2OJ3A 2UUCF 4HDHA 2QEXS 1EETB 2QV6A 3LP0A 1HNXF 4WZQA 4XPEA 1IKYA 4JI6F 4FNIA 2C3PA 3J7ZT 4WKRA 3SEOA 4F25A 1HNIA 4Q44A 4U6PA 5D4LA 4Y2AA 1C1BB 2Q43A 4C3KA 1K1SA 2G0CA 1S1VB 1C4CA 1VQYA 2IM2A 4KPYA 1VQ8S 2F9JA 1SL1A 4B17A 1R27B 4FBTA 5L8RC 3SCJE 3IAS9 3D54A 1TUVA 4TU7A 3CF5Q 3DRRA 4CH7A 1IBMF 2FPHX 4I7FA 1MU2B 2D3ZA 4PUOB 1YSJA 2JLGA 2OPQB 4C0BA 2PMHA 3T1YF 4E8UA 5HMZA 2HWIA 4FZVA 2FDNA 3T6JA 2AWZA 2X1BA 4DLEA 2EG2A 4O3PA 3PEHA 2MQOA 1U09A 3GE9A 3CIZA 3IRXB 5KFGA 5EWGA 3LWMA 1TKZB 5HO4A 4CI0B 1I94F 4QBUA 5HMWA 2OD6A 3OTDA 1WNEA 1N5VA 2DHXA 4DQRA 4FXDA 2B9YA 3MOZA 5KAKA 2RRBA 3PDNA 3JYTB 5DLFA 5E3CA 1FESA 5AXMA 2ROEA 5CCMA 3CDAA 3C2PA 3SQGB 4Y6IA 4DL5A 3MPWA 3C66A 2DNPA 2M0GB 1VC6A 1C0UB 4HHJA 2FTRA 4FPRA 2XGQA 2XWXA 5KFZA 5DDOC 4YP3A 3CGIA 4PXEA 1B0PA 1HQEA 2FHKA 5KFLA 3HJFA 2RB7A 5HBMA 1FF2A 1Y0HA 1U1NA 3BO2A 4JV1A 1S6PB 1SH0A 1U1QA 1DTQB 4PWDA 2HHWA 1TKDA 3OFFA 3IS9B 4JV5F 4CO4A 5KFWA 3IRWP 4PXCA 4NLQA 1NKBA 1UP1A 1IN0A 2JLFA 2VV5A 2VPXB 4MKBA 2CQ0A 3M6WA 4NLRA 1HBNA 2DGOA 2LA4A 1KLNA 3NLCA 2DNYA 1LW2B 3H20A 5AXLA 3OVSA 1U6BA 1IKVB 1BGXT 2B9XA 1ZAWA 3I4PA 3MM9B 2V5HG 3HXMA 2IAJA 2EFVA 2HQ3A 5U47A 4X64F 3PW7A 4ZP8A 4JYAF 3DLEB 1U1LA 1Q8BA 3DYAA 4N41A 1ZPWX 3DXBA 4Q43A 3MR6A 1T7PA 2RT3A 4C11B 3SZ2A 3AH6A 4RNHA 3JTOA 5A6PA 2P6TA 3MR2A 1R43A 3AB4B 1D9DA 5HL7Q 5E3PA 3KLFB 4BS2A 1JNZB 3LUYA 3DM2A 3RBEA 3Q22A 1N33F 4F3MA 4KV8B 1M5KC 3LALA 3BEGB 5KFEA 2MPUA 4QR2A 1Z2LA 3V5RA 2BQUA 2YWEA 1UWBB 3MMBB 3NBPB 4IQXA 2K1RB 3QAEA 4TYAA 2EVZA 2KM8B 2PI5A 2E29A 4IFYB 4OJ1A 2IVYA 1QE1A 2ZFHA 5M2RA 2ZH6A 2HVZA 1JWWA 5F0UA 3H98A 2CQ4A 3I0RA 4QPTA 2DNQA 4C0HA 5HROB 5A0YA 4URQU 3MOJB 1YGYA 2C3UA 3N01A 5I3QA 3SSQA 4WCEQ 2PI4A 5AE3A 3LP2A 1Q78A 1KOHA 4QYZJ 2DH8A 1YJWS 1B64A 2DO4A 4DR4F 3GMGA 4RX6A 2E9RX 1CQNA 1X5TA 2W9BB 4DFKA 1UKUA 1WACA 2OD4A 3AA8A 2VG6A 4Q2LA 2DGQA 3K5NA 1HL6A 4IR1A 2E9ZA 1JNRB 2DNLA 2IM3A 2HW3A 1S1XB 3O3LA 3T19A 2QZ8A 1RT6B 1YIJS 4HT5A 3V4MA 1IKXB 4LSNA 1FXLA 1WI6A 5D78A 5B0FA 2PC6A 3GG0A 3CMES 1FDDA 3EZ5A 1VMBA 2VA3A 3E2EA 3HDSA 3LF0A 1VK3A 3SFUA 2CPFA 2JSXA 4ZVGA 3VZHA 4C2MA 3JB9k 1SBRA 4DG1A 5DM7Q 4Y2IA 2D3OR 1E6VB 1M90T 2NS1B 1P27B 1LQ9A 1S6UA 4O44B 1TV6A 4LSLB 5KG0A 1IQZA 3FSYA 3HZGA 2B3TB 3DRSA 1JXLA 3HHLD 4N56A 3NCRA 3EGZA 4K4YA 3ENQA 1JK9B 2YNHB 3H5SA 5HP1B 3GV8B 1BQXA 1Q1KA 1ZZNA 2CG4A 2F8MA 3LPYA 4F2SA 3OL9A 2DHGA 2WSFC 5CYJA 3SV4A 3Q0AA 4NLGA 2FJXA 2HIQA 5E2QA 3Q8RB 2LCWA 4X65F 5F8JA 1RA6A 2KRBA 2ZH4A 2EPIA 2Q66A 1XMBA 2Y1IA 1F60B 5EDWA 2O3DA 2RMLA 4NLWA 1H2VZ 4DLGA 4DR7F 1H3DA 4TY8A 3MM6B 4IG0B 3UDCA 5E3AA 1KLMB 4RW7A 3DDKA 2R8KA 2VOOA 4X4TA 1OIAA 4AXJA 3R1LA 3OTEA 3I55S 2BE2A