5DM6Q

Crystal structure of the 50s ribosomal subunit from deinococcus radiodurans
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L1
total genus 17
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5dm6Q00
2F9JA 5LXYA 3MXHP 2MGZA 2RRBA 2J0SD 3NMRA 2MYFA 2M2BA 5H1SV 3THTA 2RU3A 4UQTA 4CIOA 2DNQA 2FC9A 1KD1T 1X5PA 2K8GA 2E5HA 3TYTA 3VAJA 5CYJA 3H2UB 2LXUA 3U1MA 4UY8T 1VC6A 1M90T 2MZTA 2DHAA 2KVIA 2DNLA 3G6ES 2DO4A 2DH7A 2VODA 2MQLA 1VQNS 1KOHA 2J8AA 2DNMA 1X4GA 1FHTA 5DDRC 3PIOQ 1HA1A 4PRFA 2MQMA 2F3JA 2CQGA 2MKHA 5GAEU 2SXLA 4U67Q 3S6EA 1VQ7S 2DGOA 3MURP 1WHXA 1DHMA 2MSSA 5GAHU 2KI2A 3MD1A 1YJ9S 2MSTA 2CPFA 2M8HA 4LMZA 2GO9A 2DH8A 1S72S 2QFJA 2X1GA 1X4FA 2LYVA 1P1TA 3D2WA 3G8TA 2LMIA 2DGWA 3P49B 1H2VZ 3EGNA 2MKCA 2JX2A 1VBYA 3CCMS 3BO3A 2FC8A 2YWKA 1WTBA 3J7ZT 1ZZNA 1VQ9S 2MB0B 3U1LA 1XN9A 1WHWA 1X4AA 2KG1A 1WF1A 3MUTP 4F02A 3EX7B 3VAKA 3UWTA 1R8PA 2E5JA 2OTJS 2HGNA 4TLQA 4TU7A 2OSQA 2KXHA 1DRZA 1YITS 1S79A 2PEHA 4QPTA 2DHGA 4YB1P 3NNAA 1HD1A 1X5SA 2CQ2A 3B4MA 3CCRS 1U6BA 2MQPA 1M5VC 2JVRA 5MLCV 3MUVP 1WWHA 2OSRA 4LIRA 1U1QA 1VQ8S 1X5TA 2RRAA 2KN4A 3NS6A 1K9MT 1PO6A 2DNGA 3CPWR 2I2YA 3LQVA 5DDPC 2L08A 1A7GE 1FO1A 2ZJRQ 4IO9Q 3CC7S 3VALA 3B4DA 1UAWA 2CQ4A 2QEXS 5DDOC 2L9WA 1YIJS 5D77A 3CCJS 2EK1A 4ERDA 3FEXB 3P6YC 4IUFA 1KC8T 1VC0A 5LSLA 1AUDA 4CH1A 2EK6A 2LEBA 1WELA 2OTLS 2GHPA 4WIIA 2KG0A 1U1MA 3CUNA 3G9CA 4WFAQ 3VAHA 1DBDA 2D9OA 2CPXA 1A9NB 2XNQA 2KXNB 2MQQA 5IFMA 2RQ4A 4F25A 5DDQC 2DGXA 2XSFA 3K0JA 3VAMA 2CPYA 2CQBA 5LJ3Y 1D8ZA 1VQ6S 1VQ4S 4ED5A 3THPA 2G1DA 2CQ0A 2I38A 1HL6A 4QQBA 2L41A 4FXVA 3DXBA 1U1OA 4RU2A 2X1AA 1B7FA 2DNZA 2HGLA 1SJ4P 2MJUA 1VBXA 2B0GA 1X4HA 2OIHA 1K8AT 2XS7A 5ITHA 3H2VE 3RW7A 3TP2A 1WEYA 2RVJA 3J7YU 4EGLA 3BEGB 2AYBA 2BOPA 4YUDA 2DH9A 3CCES 2DGSA 1OO0B 1X4DA 3VF0B 3UD4P 4QU6A 2DB1A 2E44A 5LXRA 5JVGQ 3UCUP 1PGZA 1URNA 5DM6Q 1VQMS 2JWNA 4IOCQ 1WI8A 3EGZA 4WKRA 1CVJA 1WG1A 2KRRA 2KM8C 3G8SA 4BS2A 3ULHA 4WF9Q 4M5DB 3VAFA 1FJEB 2DNHA 2CQHA 1WHVA 2KT5A 2RT3A 1X4EA 2X1FA 1NJIT 1P27B 2MKIA 2YH1A 1JJHA 3UD3P 1YJWS 1WHYA 5IM0A 2VONA 1DZ5A 4ZKAA 1L3KA 2FPHX 2BZ2A 1Q81T 5FJ4A 2N82B 3CTRA 4WFBQ 3BS9A 1K73T 2KM8B 2CJKA 2MXYA 2MZJA 1FJ7A 3CMAS 4OZ0A 1VBZA 3JB9k 1U1RA 2JVOA 2XNRA 1VQPS 3BO4A 1WI6A 2DK2A 2DNRA 4OZ1A 1X0FA 2M70A 2A3JA 5GMKa 1G2EA 1FXLA 1Q82T 2MZSA 3P3DA 1KQSR 2D9PA 2VOPA 2AYEA 2FHOB 2PE8A 4Y00A 2MKJA 2XS2A 2CPIA 2G4BA 2KYXA 1VQLS 2CQCA 4CQ1A 1JJ4A 1W2BR 2G0CA 2ADBA 2MQNA 1UW4A 1X4CA 2DIVA 3PIPQ 2EVZA 2ZJPQ 5BJRA 3Q2TC 2KH9A 1WEZA 3LPYA 3S8SA 3I56S 2AYGA 2DNNA 2UP1A 2MPUA 2AD9A 2NZ4A 3IWNC 2DGVA 4WFNQ 1SJ3P 1N54B 4Z2XA 4TU9A 2N7CA 2U2FA 3R1LA 2O3DA 2V94A 2CPZA 2DNYA 5GADU 2QA4S 3MD3A 1KOOA 5GAGU 5GVQA 2E5IA 3HI9A 4W90B 2M0GB 2XB2D 4C7QA 3MI7X 3CCVS 2MHNA 2DGQA 2Q79A 2RNEA 1ZH5A 3G96A 1SJFA 1M1KT 2CPJA 2DHSA 2MZQA 2LCWA 3Q2SC 3IRWP 5IM0B 1VQOS 2CPEA 1U1LA 1VC5A 2N3OA 1HD0A 3CULA 2CQ3A 1SJRA 2J76E 2M52A 4Y0FA 5LSOA 2J0QD 1UP1A 1QM9A 3SXLA 3SDEB 1IQTA 3HHNB 2RQCA 2YTCA 1UFWA 2CPDA 4QU7A 1FT8A 1Q7YT 3CC4S 1VQKS 3S01A 3RW6A 2RS2A 4YOEA 2KRBA 3SMZA 2KXFA 1YWXA 4F26A 2M4MA 2DISA 3NNHA 3OW2R 5CXTA 2M88A 3V4MA 2VOOA 3CCUS 3CMES 4PKDB 3MUMP 5IQQA 2MY7A 1YI2S 2NLWA 4A8XA 3CCSS 2MZRA 1R8HA 1F9FA 2DGUA 2F9DA 1ZZFA 2KU7A 2MKSA 2HGMA 2M9KA 3MDFA 1NU4A 5DM7Q 1WF0A 1O0PA 2DNPA 2LQ5A 2RS8A 2WBRA 5CA5A 3MOJB 1X5OA 2DO0A 2CQPA 2ERRA 2MMYA 2M7SA 3ZZZA 5LJ5Y 3FEYB 2HZCA 3I55S 1SJQA 2RUGA 1SXLA 4CH0S 2OJ3A 4TU8A 1U1KA 1BY9A 4J5OA 1RK8A 3TO8A 4W92B 1OWXA 2E5GA 1M5PC 2D3OR 3P5TL 2LA6A 1WEXA 2MY8A 2DGTA 1YHQS 1VQ5S 1N8RT 1YJNS 1U1PA 4PR6A 3VAIA 1N52B 2X1BA 1H2TZ 2KFYA 3G71S 2HYIB 3UCGA 1H2UX 2KHCA 1M5KC 2U1AA 3CC2S 4C0OC 1M5OC 4FXWA 1Q86T 2CQDA 4WCEQ 2LEAA 1U6FA 5DETA 5HO4A 2MQOA 1YTYA 4IOAQ 2XS5A 1NO8A 2JRSA 3R27A 5JVHQ 2N3LA 2MJNA 3S7RA 2DNOA 2HVZA 2DHXA 2K3KA 1U2FA 3ZZYA 1JJ2R 1FNXH 5EN1A 2CQ1A 3BO2A 3US5A 1X4BA 2M8DB 2DNKA 3SDEA 3R1HA 2ZJQQ 3CCQS 1OPIA 1D9AA 2FY1A 2MKKA 3CCLS 2DITA 1N88A 1RKJA 1QVFR 2YH0A 1U1NA 2AYMA 3CXCR 2DIUA 2LA4A 3NS5A 3G4SS 4P6QA 1QVGR 3N9UC 3CF5Q 5HL7Q 2MGZB 2LECA 2CQIA 4V19X 1WF2A 2LKZA 2LXIA 3DLLQ 1WG5A 3UCZP 1WG4A 3NNCA 1FJCA 2YKAA 1JMTA 4C4WA 2MZ1A 3UE2A 1OIAA 3CD6S 3VAGA 3L3CA 1H6KX 4LJMA 2ADCA 2CPHA 5D78A
chains in the Genus database with same CATH superfamily
4EO6A 5KG7A 1C1BB 2OFHX 5IOLA 3W7BA 1HMVA 2JFKA 4YB6A 2MYFA 3AD7C 1IJEB 3KLGB 2VG6A 4E98A 4TYBA 3I9ZA 2DNQA 1KD1T 5LM7E 2AWZA 1YG0A 1BWVA 2UUAF 4CYUB 3A3OB 3CCTA 1X5PA 3NGKA 2K8GA 1SC4B 1OYEA 3FMBA 4C8MA 5KT6A 4LFCJ 2CZ9A 3KK3A 4JI3J 5A8WA 2YWGA 2AU0A 3JTNA 2N7YA 2G0JA 2J7WA 4R25A 2HNYA 5K5MA 2YNFA 1L5UA 1LWXA 3AT1B 2BJ3A 2HFOA 4P73A 1KFSA 1GEHA 1XMOF 4BWJA 3R5CA 4ES3A 4MIAA 3PKYA 2VODA 2C2EA 4HI1A 1HR0J 1KOHA 1JKHA 2J8AA 3KLVA 3KJVA 4IRDA 1X4GA 4IG3A 7FD1A 4MKYA 3MEEA 4L76A 2V50A 1D3WA 2HQFA 3PIOQ 4ILLA 4F0MA 2BOAA 5C42B 4RZRA 1HA1A 1RQ0A 2KVQE 4EO8A 2MQMA 2EWHA 5GAEU 5KFYA 3M32B 1F3FA 3T9NA 2SXLA 5A0YB 5J2MB 2QA2A 4U67Q 2HIYA 3HK2A 4IKAA 4ECYA 3MURP 2K7JA 1WHXA 4RO0A 4JYAF 1DHMA 1U8SA 2E1RA 1LWEB 4ZPWR 1XTZA 2EFOA 4OZJA 2CPFA 1JNRB 1UVLA 2CJBA 1SKWA 4F2RA 4K7QA 4WFYA 4O3RA 2GFFA 2LXFA 2ROPA 2GO9A 2DH8A 3D6HB 3TUIC 3SFUA 3KDOA 5KFIA 2ZH3A 4CWBA 2QFJA 2ATLA 4F2SA 1N33F 3W66A 1ZTWA 4B3TF 4AQYF 3IR7B 3UVJA 3KKFA 2B7CB 5CH7B 3W9HA 3QRQA 2LYVA 3H8YA 1SJ1A 3MR7A 3P8BB 1YBUA 4LUBA 1XWLA 5HK4A 5KFTA 2RQMA 4XPEA 4DR1F 4ECQA 1GXUA 4MIBA 4OI1A 3TW0A 2HFZA 1S6QA 1I5OB 1UVJA 4IH7A 3WHIA 1S9EA 1ULRA 3K5PA 4O0IA 5KOWA 4KHPJ 4DR5F 3RG6A 2MKCA 4DN0A 1VBYA 4ZS6A 2EG1A 3DOKB 3OL7A 3AJDA 2AX0A 2CADA 2QL7B 3TEHB 2F4VJ 1UKUA 2RHQB 1WD6A 1V9OA 1FX4A 2EC0A 4N77A 3U1LA 3VHQA 4DQPA 2QA1A 1GXTA 4NLOA 3Q89A 3W5XA 2KG1A 2OUGA 2DD8S 3NBPB 3C15B 4Q43A 2V8VA 1S1WB 1X7VA 3EX7B 1Y5NB 3IR6B 2ZUGA 2H5EA 4KIAA 2GIQA 5E3PA 4O3PA 3VAKA 1TL1A 4DV7J 3IC1A 4A4JA 3G6YA 2DPJA 3W9IA 2PDAA 4HTJA 4LF8F 1HNZJ 1QDUB 2KXHA 2LDYA 3FBEA 4ZVQB 2XMUA 3CJKB 2PEHA 1WTFA 4ZVTB 3RAMA 4UOGA 1RT6A 4R5PA 2Y1JA 2KFNA 1TL1B 4QPTA 3IS9B 1LW2B 3BPSP 1AZSA 4NCAA 1HD1A 2ABYA 4DV4J 4B9UA 1XMOJ 3B4MA 1TMMA 2BE7D 3PTWA 1NSQA 1Q5YA 3OL6A 1GMWA 5ADZA 1TFWA 3AXMA 4MFBA 1U49A 1HYSB 3NRBA 5E0OA 1WWHA 2OSRA 2P9EA 4Q0BB 1U1QA 1VQ8S 3JSYA 2VASA 4I68A 4OJ1A 1PO6A 3R7NB 2DNGA 4IR9A 3CPWR 2I2YA 3LQVA 3T1YJ 3MM6B 4LRFA 3TOQA 2L08A 3LUYA 4IFYB 4PG4A 1CJVA 2RDJA 4NX9A 1ZPVA 1GAOA 3LWLA 5GMEA 4O4GA 4ZK7M 3IXQA 4GKJJ 2CJXB 5D0GA 3OR1A 2ZJRQ 2VU5A 4KJIA 4IOAQ 4QIGA 1NDKA 4HI2A 2W2OP 3PACA 1SQEA 3U1NA 3TA0A 3OFFA 3CIMA 4P75A 4P10A 4X4VA 2NUHA 3CE8A 3CCJS 5A76A 1AB8A 1A0OB 3EZUA 4ITSA 1RAAB 3EWGA 4ZPVR 5ETNA 5HI7A 3VTIA 3KLFB 2YKQA 3MGJA 2ZVSA 5D0RA 3NWGA 4I2PA 3P6YC 4JV2A 2DCUB 1FJGJ 3FUYA 3P96A 2LQJA 4M5IA 3CD7A 3FZ2A 2EK6A 2KJWA 2YWHA 1WELA 3RJMB 2JC1A 4ECVA 2OLWA 2KG0A 4FNIA 1IBMF 1TP7A 3AODA 3L9ZA 5H9EK 1CJUA 2HNZA 4OYIA 1HW8A 1TVRA 2ZZMA 4QIFA 3R7SB 3V5RA 2CPXA 1A9NB 4ID5B 2RU9A 3J80U 4QZVB 4KC5A 2AGPA 3GFYA 2B6AB 2DGXA 2QA4G 3A12A 1X9MA 3K0JA 2XCAA 5E3CA 2CPYA 2A6MA 3G87A 3GFHA 5LJ3Y 4YR3A 1LK7A 3HULA 3EPIA 1R8AA 3HFKA 4X66F 1D8ZA 1Y00A 1RYRA 1VQ6S 2KL8A 4ZCLA 1TUGB 4J9MA 5F8HA 3THPA 2G1DA 4G1QB 3T1HF 2BV3A 2YWWA 2AZ1A 2JLFA 2BJ7A 4A8KA 3FGVA 2JLGA 3T5HA 2CZVC 3QWPA 4ZCIA 4UZCA 4RU2A 2X1AA 4LFBJ 2AJ1A 4AT1B 5FIIA 4NZ7A 2DNZA 4X66J 2HGLA 4RNMA 2V2ZA 1Q1KA 4M5MA 2XM3A 2VPZB 3OTBA 3PDNA 1VBXA 1NM2A 2B0GA 1ZM3A 2QSWA 4QIVA 2OIHA 5LSRA 4ED0A 1S6PB 4USVA 1NKEA 1YDLA 2M5YA 3ENAA 1GFWB 2H48B 3DCAA 3H2VE 1FNMA 3PJ9A 4I2QB 4F4YA 1XMQF 4B3RF 1EQMA 5J1NA 1Q78A 1SC3B 5KFCA 4DV6J 1QE1A 2KZMA 3CCES 4C11B 3VF0B 9ATCB 4PZVA 3OL9A 4QU6A 4WP8A 1NUEA 3KLEA 2P9CA 3V2UC 4X62F 2DB1A 4MYTA 3OSNA 2W25A 1C2PA 2ZNZA 3IMQJ 2FGCA 4RX6A 5KFAA 5F41A 3K57A 5JVGQ 3UCUP 1URNA 2C3YA 4B9LA 1JLEA 1SV5B 2JWNA 2YQ0A 4LVOP 5ETLA 3V4IA 2FYXA 4BDPA 2AIRB 3U27A 3TA2A 2KRRA 3TQ1A 4WF9Q 4USIA 4WXWA 4PUOB 3VAFA 4GKKJ 3EMTA 2XI2A 4Y28C 2PFDA 4OYXA 4L6V3 2KT5A 4AUKA 1SKUB 4YY3F 1F1BB 1X4EA 2ZHBA 2E29A 3T6BA 1YRUA 4TY8A 1TKXA 4G1PA 4DR6F 1Y3KA 1DTQB 2WBMA 4CLLA 1FD8A 2V34A 2YQ3A 3H0PA 3DOMB 3RB3A 5JMNA 4CNZA 2MLYA 4LSZB 2BR0A 2OPSB 1S7IA 1Z2LA 4J9OA 3PR4A 5IM0A 2VONA 3CSKA 4P71A 3LP2B 4DN9A 4J9LA 3H25A 1L3KA 1V6HA 3CJ4A 1NBEB 3POTA 4DV5F 1S1TA 1XC9A 2BZ2A 4OLPA 2ZE2B 2FJBB 3MMCB 3PX0A 2HK3A 3TWZA 5E3AA 5E41A 2VH7A 3OT9A 4W4MA 3V6DA 3SEOA 1FJ7A 4OZ3A 3T6JA 4LQ9A 1PYSB 4OZ0A 3OTOJ 2AJ4A 4W90B 2HBRB 1VBZA 1IVZA 2VG7A 1VJQA 3QQCD 3DMJA 3ZNJ1 3DRSA 2YWFA 4JOUA 1NDCA 4KV8B 2JVOA 5HMWA 3BM7A 1FERA 4ZVEA 1VQPS 3A1YG 1T3OA 3H90A 1ITPA 3FBCA 1U47A 4OZ1A 4OJGA 2M70A 1YJTA 3LH2S 3CJ5A 4M5DA 3ZTPA 2KTQA 4LF4F 1LK5A 4DL4A 2EXUA 3I4HX 3NAHA 5J1EB 4ECWA 1ZM9A 1UW9A 4PXDA 4CLKA 3CIZA 2E1AA 2JLEA 4EUVA 4Y00A 3DRPA 2RDDA 2CPIA 4QWEA 1N36F 2XS2A 1IQZA 2NSCA 1S57A 3M6XA 3PYFA 4WTYA 2W8KA 2HZVA 1QAJA 1PBAA 1ZOTA 3M2RA 4TXSA 4ZCKA 2CQCA 1HBNB 4MH8A 2XULA 4O3OA 2G0CA 2EFVA 4CQ1A 2BKNA 1W2BR 1UW4A 3MAHA 4IOBA 3W2WB 1X4CA 4A47A 4TNOA 3KHHA 2DIVA 1RLCL 4WJBA 4E2FB 3PIPQ 1RT3A 2CXEA 1UFLA 1U24A 2XYPB 2J6SA 3W60A 3H7HB 4FPIA 2KH9A 3Q2TC 5ETSA 1ZAWA 3M8YA 3PEJA 1F5AA 2XY6A 1HWUA 1J5OB 1QTNB 1JLFA 1RP5A 2QO3A 3DLKA 3L95X 5IZHA 3M8RA 4U8VA 5KFMA 2YKOA 1JJCB 5CYMB 3GWCA 2AD9A 3LOUA 2R9LA 2UXDJ 2OPPA 2KZZA 4LBPA 3GQCA 1N54B 2XSJB 4ZHRB 2LU1A 3R1LA 1RT2A 1J2VA 1RHMB 4KPCA 3Q8VA 4OHWA 5GADU 1XERA 4ZJOA 3MD3A 2YKMA 3W64A 1J5EF 1NCLA 1BMQB 1RT2B 1Z2ZA 2E5IA 3HI9A 2VL1A 3O6QA 3QFHA 4IG0B 4CO2A 1HBOA 3UN3A 5B0BA 5L39A 2ASJA 2KKHA 4NMXA 2AF6A 3MI7X 2XB2D 2RNEA 3K59A 4EI2A 1ZH5A 3E01B 1RU1A 3BSCA 1CSJA 1NB7A 1M1KT 2QL9B 4LRDA 1WC3A 2ACMA 2G13A 2HHPA 2WVEA 2FUG9 5IM0B 3G6XA 3N6LA 4ZLJA 3K89A 4DR7J 3M32A 5F9NA 2B4PA 3VCDA 2FIUA 3SV4A 1PCAA 2W8LA 5CAAA 4QBUA 5LSOA 4A8MP 1S1XA 1U48A 1B3TA 4L75A 3RYLA 4LBHA 1ZM4A 2JC0A 2GJIA 3HKZD 2IA6A 1RWMB 2PMHA 1KVKA 3R3TA 4JI5J 2QE5A 4RBVA 1WORA 2I9SA 2CPDA 4YN3B 1N0VC 5ETVA 4C8NA 3LTOA 1FT8A 2J0WA 2E5LJ 1HPZA 2D3ZA 4H4OA 5L9XA 3DYAA 3QZ8A 4JI0J 2KXFA 4KY3A 3PG9A 2GQCA 4HHJA 3LALA 2GAGC 4F36A 3JAMU 4QR1A 4NOHA 1N5QA 3RBDA 1NKCA 4K0KJ 1L3UA 2UV8G 2VOOA 4C8KA 1AZSB 3W8GA 3GV5B 3W5ZA 1S10A 3PKMA 4PKDB 2GJFA 3MUMP 2HQGA 1SQFA 3LPEA 5IQQA 3NAIA 5F8LA 3MR6A 1FKPB 2E7WA 2J7KA 4I56A 1RTIB 1U2CA 2RAQA 2CWKA 2P6TA 2DGUA 3MEKA 4N5SA 3K5MA 2MKSA 2GJ2A 2H4WB 2M9KA 2KT3A 1NU4A 1KTVA 1FDBA 2GMLA 2LEPA 3K2YA 4BCAA 4M95A 1RT3B 3ZZRA 2HBQB 2LQ5A 5CA5A 2DO0A 2CQPA 2ZITA 4K2XA 4MFBB 3KHRA 3BH7B 3ZZZA 2M7SA 2YQ1A 2ERRA 1G1XA 4PYAA 1LQ9A 5A6PA 5LJ5Y 2UXBF 3LAMA 5A8KB 1FDDA 4GVBA 4NLSA 4K4UA 3IM9A 5DJBA 4ANCA 2HFUA 2E5LF 2E66A 1LW2A 2EFGA 1BY9A 2RMLA 3AD8C 1EKRA 4Y2CA 1UJ5A 3GJSB 2OI2A 5ETPA 1RT1B 3LP0A 5LMUJ 1G7CB 2E5GA 1CS4B 5K20B 1OMSA 4X4RA 1J5EJ 2LA6A 4K59A 5A8WB 1WEXA 2MY8A 5A2QY 2HMIA 4OQJA 3GG0A 3HHLB 5CZXA 2P8IA 3UPFA 4F0KA 3WX4A 1YHQS 2ZBRA 4BLGA 1N8RT 3QT8A 3EVOA 1U1PA 1IWAA 1FRKA 2XGPA 3ZFVA 3DC2A 3C2PA 2DRBA 3Q8YA 1NB2A 2LQ8A 4IFVB 3DKDA 4OYZA 4BBYA 4YHHJ 4DV1F 3G71S 1H2TZ 4L74A 2KFYA 4DSLA 1CLFA 4BHQA 4C9DA 4FNHA 4P9SA 2QL5B 3LGMA 5GAGI 1VBKA 1JX4A 1M5KC 1CPZA 2ZH7A 4JI1J 4WK3A 5AJ3J 3I5AA 1UMJA 4P74A 3OR2B 3EJMA 3Q83A 3AOAA 4FXWA 1REGX 2R3VA 3FC9A 2V8HA 3IRXB 3RB6A 1I94F 1U6FA 2R7RA 1EP4A 5DQIA 1YTYA 3GYGA 2BMBA 2XS5A 3BQ0A 4K8RA 3DLGB 4F7VA 4U95A 3HFVA 3HVRA 2N3LA 4PG5A 3BPDA 4QYRA 5T7LB 3M2VA 3RGIA 3SCKE 3TX8A 3JAMY 5GAHI 1EP4B 4ED2A 2DNOA 3J7A1 4OL8A 4J90A 1S76D 3ILLA 1Y10A 4F0HA 3HSZA 5KOXA 2ZVIA 4X4PA 1FNXH 5EN1A 2AEMA 3CGIA 2XLKA 4P2FA 1NEEA 5T14A 2G2ZA 1FFGB 2DNKA 3SDEA 1VIOA 3FRYA 3Q8PB 3MM5B 3GP9A 4NRTA 4LF5F 4NLXA 4PWUA 1XNQJ 4QCLA 1MU2A 1QAIA 3MM5A 2FY1A 2OPQA 1PC4A 3CCLS 2DITA 1DLOA 3HD1A 5BR8F 1N88A 4K4XA 1MU2B 1R3NA 2FHJA 2CJYB 1U1NA 3FCHA 4K2JA 2HS3A 4HVZA 4OYWA 2V63A 2DIUA 3SSRA 3G4SS 1QVGR 4P6QA 3N6NA 4CTAA 5HL7Q 4RL1A 2OKQA 1REVB 4DDFA 3IAS9 2MGZB 2LECA 2CQIA 4JI1F 4O3NA 3DU6A 4U7UD 2PGCA 3DLEA 3WDOA 3KFWX 1MLAA 2FHJD 1WG5A 3UCZP 1N5VA 4NI2A 4F50A 2YKAA 2ZFHA 4QR2A 4I67A 3D68A 1NK9A 5C42A 4N8NA 4NYZA 4KFBA 3UE2A 1UEUA 2BANB 2W2QP 5KFUA 3MPWA 5GADI 1WSRA 3L3CA 5KG1A 1S5ZA 4I7FA 3OHAA 4EBDA 5CHCB 1H6KX 3IM8A 3J81Y 4A8FA 4WZMA 5LMUF 5I3UB 1U25A 2V2KA 1UWBB 1S12A 3M8ZA 4DL0C 4YB7A 2BW7A 4DZ6A 3H5SA 3EPGA 3DLBA 1TKXB 1SL1A 5LXYA 2VIHA 1NHUA 2V5HG 2M2BA 1RHUB 1Y0HA 3VGTA 3THTA 4KO0B 4LSLB 3SI8A 3WIUA 3MEDA 3F73A 2YNFB 2XLJA 2YPYA 1T8EA 1DTTB 1VCTA 2MLXA 3KK1A 2B9XA 3FZBA 4Y65A 2Z8QA 2CJ9A 3UR0A 4N56A 4DUYF 1HIYA 3OXLA 3NXZA 3H4BA 2D3O1 2D3UA 2F1FA 2VFTA 4CLFA 3H2UB 2LXUA 2CVIA 3TAMA 3OV7A 1S0MA 4LF6F 4L73A 1PJ5A 1YQHA 2OELA 2MZTA 4UY8T 1S0NA 2HNDB 2KVIA 1BQMB 2R8IA 2ZC4A 4WU2A 1RKIA 2QLJB 4ZPCA 3OUYB 4I6AA 3IBCB 1CJVB 4DSKA 3MMBA 3AQOA 1ELOA 2MQLA 3RTVA 4LFCF 1RDRA 1VQNS 3ETOA 3QATA 1U0HA 2B7BB 1ZA2B 3M2VB 2JH3A 3DMJB 1HQ2A 2P9GA 4O3QA 3S1TA 1NNDA 1C4AA 1HBUA 4BC7A 1R89A 4HLBA 5ETKA 1OQ6A 2PT0A 4H4OB 1UVNA 2MKHA 3KUHA 3QJPA 4DUTA 2XMWA 3MWBA 4B9TA 4UOCA 3S6EA 3MHYA 1M1GA 1VQMS 1FFWB 4EBCA 3JSBA 3QAEA 1RYSA 2Z2YB 3I87A 1KNZA 2XHWA 2MSSA 3NGRA 3N4WA 1URRA 3GE9A 2JL9A 2FJEB 3MD1A 1YZ7A 4A8QA 4A8WA 4HEA9 1K44A 1VK3A 1ZAVA 1RU2A 2KYZA 1N34F 1HI0P 4B9VA 1SIWB 4DCJB 1T03A 2VBWA 2VG5B 3P5BP 4EYHB 2B5JB 2K1RB 4NMLA 2A10A 1G4CA 3HJVA 4DUZJ 5I3PA 1RWKB 5CD4H 3N5FA 3H5YA 1I1GA 4EMDA 4GKKF 3IN5A 3UDCA 3L09A 4JBCA 1PJ7A 2RSQA 1HBNA 1WACA 2DRDA 3CCZA 4G6VB 2DGWA 2H4YB 4OYMA 1NK0A 3P49B 2HHUA 2AGQA 1L3SA 4X4SA 2J7UA 3KJQB 3RRHA 1T11A 2JX2A 5A8RA 2E9ZA 4DQQA 2XSJA 4IRCA 3BO3A 2D69A 4C98A 2NPIA 3DHWC 2YWKA 4PG7A 1YLXA 4X2BA 2JEJA 1NZ8A 2B4VA 4M5LA 2I5JA 4C3KA 2YKMB 1HMVB 1YRXA 4CO5A 4DL2A 1ZZNA 1VQ9S 1XN9A 2YPZA 3M2RB 3CJQA 2ATCB 3MUTP 2VJUA 2DRAA 2I0XA 3F44A 4F02A 2E5JA 2PD1A 3E01A 4HR2A 5CD4A 4X4QA 4ZIWA 4TU7A 1C0UB 3BN7A 3BSAA 4NLGA 1A6LA 2BX6A 2VPYB 1XMQJ 2R7XA 3TJ8A 1N32F 2HWTA 2WVFA 2VQEJ 4FF3A 2PSZA 2XG8A 4RU9A 1IKYA 1UZDA 3R9LA 3NNAA 3FDSA 2GX8A 4ETZA 2XWYA 4U96A 2HW3A 2RKIA 1HLWA 2OPPB 2HK2A 2X51A 5C7PA 4ZLLA 3CCWA 1RAGB 2AMCB 2ZM6J 4RNFA 2ZH1A 2JVRA 5F8GA 1O5JA 1OJ4A 3DOLA 1XQIA 4ATNA 2C3UA 3CJ8A 3SBMA 5FLXY 4DL3A 1OSCA 3NS6A 3BSOA 4ER8A 1KVIA 3LWMA 1F5CA 3UR3C 4L72B 5CCMA 3IBFB 5B0AA 2O66A 4E8UA 2XHCA 1RT7B 2BM1A 2NYIA 1PSDA 2HS4A 3EYZA 2JZ5A 2WONB 4I69A 3I0SA 4C8ZA 4I1TA 3UW1A 3NP5A 3CD5A 4CI0B 3D28A 4H4KA 4ENOA 4XO0A 4PCQA 4RW7B 4HH1A 1BD6A 3B4DA 1Z4UA 3WZ0A 4USTA 2XO6A 3GV7B 4ICLB 3MAQA 2QEXS 4V19J 2HURA 4K4SA 2LVWA 3H2LA 3GIIA 3MM8B 3D7SB 1WDTA 3FEXB 5K8NA 1T03B 2ILZA 2YNHB 3HHLC 1VQSA 1VGYA 4AL5A 3PVXA 1F5BA 1YRTA 3M05A 3VGVA 5LSLA 4C3MA 4J9NA 3SV3A 1VC0A 4FF2A 3I5BA 2QTWA 2VPXB 3LGNA 2VFVA 4NLYA 1G6BA 5EX3A 2RRNA 2ZNYA 4WIQA 2FHMA 4WIIA 2OTLS 3MCOA 2C2NA 1JQGA 3GB0A 3LANA 2W2PP 3HHEA 1U1MA 2Y1IA 1Q8BA 4NYOA 3BJYA 4FN5A 3IAM9 1KLNA 3FSYA 4NWBA 4AXJA 1V3RA 4WFAQ 2DHHA 2C22A 2XNQA 3K5OA 2MQQA 3AH6A 3J7AN 5IFMA 1Q0NA 3R6GB 1N56A 4F67A 4B3OB 4F25A 4OX8A 2PC6A 5DDQC 4ZDNA 1FNOA 2V4QA 5T41A 2XC9A 4HKQA 1NK4A 3RAQA 3QLHA 2OHDA 5L8RC 4OV6A 5F9LA 4OHXA 2XMMA 2H9ZA 1LW0B 3I0RB 2Z56B 1TK5A 3SQOP 2F63A 5EUHA 1HHSA 2IC3B 3ZTOA 4ED5A 1HNIB 4YHHF 1HI8A 2D41A 2G1HA 2CQ0A 3M9MB 2C3PA 4DV1J 1LW0A 1FD2A 1QAYA 3I0RA 4KB7A 5L1IA 2AEJA 1HYSA 1JLGA 2L41A 4NPOA 3MPVA 4KRWA 1E6YB 1N5TA 2D7SA 3BR9A 5AJ3F 3KK1B 2BE2B 4M63A 1S6UA 1FE4A 3HF5A 1EHWA 3ZZPA 5DQGA 2AQ4A 4JV5F 2EC2A 4XPCA 4FXDA 5ETOA 1NDLA 2HVDA 4CO0A 3QT5A 1R7IA 2IVYA 2MJUA 3PW2A 3RR8A 3KK2A 4CO3A 5EWFA 3N0VA 4V1Ak 3NL0A 1JLFB 3DLKB 2XS7A 2XQCA 4FYWB 5C2GA 1BUXA 3AJ1A 1XR6A 3OTEA 2FJVA 3BH6B 4MJKA 3GR1A 3J7YU 5CABA 2QFIA 1CULB 3QJLA 2CNNB 3G8QA 3PO5A 4ZHRA 4B3SF 3KG0A 3NCPA 1X4DA 3BV8A 4GVLA 3X1LB 3PCOB 2ZH5A 1KBRA 5HMYA 2W7PA 2AZ3A 3RRGA 2WONA 4YR0A 1RBLA 1JIHA 1WC5A 1WKKA 3I5CA 3M6UA 2FD2A 4IFVA 2MKYA 4F8RA 3WC0A 2QYGA 3EGZA 2YY3A 5B0FA 1BXNA 2Y9HA 4Y2AA 4WKRA 2QV6A 1RAOA 4ZVSB 1S9FA 3ULHA 2F5GA 1FRIA 5BYRA 4WXOA 4M5DB 3MPUB 1OPZA 4NXMF 1HBMB 4OYAA 4I2PB 3D1QA 1TVRB 3QAUA 2RT3A 2ZUAA 4DSFA 2NSBA 3IRXA 4RUHA 2X1FA 4CO4A 3C6TB 2B5JA 2CZ4A 4EBEA 2GV1A 5J2QA 2OPQB 3EE3A 1S97A 2Q1LA 1C1CB 1WC4A 5HBMA 2VB6A 3P45B 3UD3P 1YJWS 1TL3A 3R5BA 3UFCX 3MM9B 2VZ9A 3ILIA 3R5GA 4J37A 2R2TA 2FVSA 3C6UB 3GLJA 4DS4A 3JXOA 2FPHX 4CZCA 2V8PA 5KFHA 2W9BA 3A3PB 4DFPA 5F8IA 5FJ4A 3T19A 1FE0A 3M6WA 5KFRA 1C1BA 1OS5A 2JDJA 3SQGB 5KFSA 4DU8A 3NBPA 3QT6A 2P2CB 2GVDB 1LXJA 2NS1B 1NRKA 2KM8B 2CYYA 2L9DA 2LP4A 5KG0A 5AE2A 3BKTA 3SQGA 2FVPA 3CMAS 3BSNA 2BABA 1JLQA 1N48A 2WSCC 3BBCA 5F8MA 2CG8A 4C0HA 3GSDA 3HO1A 1TV6A 1XK8A 2DXEA 5B09A 2HRUA 2N4CA 1H72C 3CDBA 3F56A 4X64F 3C14B 3J7Z5 1JLGB 2W4CA 1DARA 1RHKB 2VPWB 4AYBD 4HL9A 5HVHA 4LQ3A 2L3MA 4E0DA 1JWWA 2JHEA 1QE1B 2BRKA 3TUZC 1F60B 4P7VA 2AYEA 1HNXJ 1JKHB 1JLBA 2Q66A 5E2QA 2G4BA 3MMBB 2BJEA 3W5YA 3PJXA 1HNWJ 2HBZB 3MM6A 4I7FB 5CZVA 4C6AA 1JJ4A 4YB5A 2UXCJ 2CJQA 1PKUA 3MMJA 4WK1A 2ADBA 4RBTA 2NREA 2OD4A 5DG9A 1HWIA 1S1XB 1EETB 2LQBA 2NYHA 3H5UA 4PXCA 4ZVRB 3HM9A 4ALZA 2ZJPQ 1RTDA 2DR8A 4H4KC 5BJRA 4DPOA 4QWDA 1ZM2A 2RD5C 4QIEA 5C24B 3QRPA 1EX8A 1GMUA 2GA7A 4UUWA 5K8PA 1MMNA 3MEGA 3D67A 2UP1A 3CDEA 2MPUA 2HLUA 4FPRA 3GFXA 1CJKB 1ROFA 1F2HA 2DGVA 1GK8A 2Y8YA 3I6PA 4G1IA 1SJ3P 2BW2A 4Z2XA 2CKWA 2U2FA 4W98A 5D4NA 4P7TA 3HX9A 4GC7A 4DFMA 1MWYA 1TKZB 3EICA 4KGXB 3KJFB 3VQSA 2QA4S 5GAGU 5HP1B 1S1TB 1L3TA 2R8GA 5GVQA 2HFNA 4CM0A 2W01A 2I6WA 2A18A 3W62A 1T3NA 3PW4A 3KJNB 2FZCB 5A6WA 3RB0A 2DGQA 2Q79A 2OD6A 2Y3YA 1HBUB 2YKNB 2DHSA 3A8JA 4KBIA 3ISNC 4RW4A 5HLFA 3AB4B 1XJWB 1BGXT 4Y3CA 2FJAB 4N47A 2CNKB 4J91A 1VQOS 3D0GE 3IR5B 1VC5A 4PG8A 5KG2A 3OLAA 1HD0A 3CULA 1RCXB 3Q8QB 5IWAJ 2HQCA 3FKBA 2CQ3A 2WOMA 4TVAB 3T9ZA 4Y0FA 1T02A 4U6PA 4FBTA 2HAFA 3ZZ0A 2DR5A 4B3RJ 3TUPA 4CCHA 3SDEB 4USMA 4ED3A 5KFVA 1NK6A 3LA0A 1AA1B 4FYYB 1GMWD 3KMSA 1X9WA 3PY8A 3GJQB 3KK3B 3DDNA 1B99A 3F0NA 3MR2A 2B56A 3Q8UA 1EIYB 3QIDA 4Q45A 4ELVA 3CC4S 2BA9A 1RT1A 2KRBA 3LP0B 3MECB 4ZLPA 2HNYB 5DQHA 1H38A 1U26A 2CIMA 1NPRA 2MHEA 3AXKA 4HH0A 3NGTA 3EXYA 2XBPA 2PIIA 2JEFA 4FDFA 5HN0A 3PO4A 1UJ4A 2IA0A 4ANDA 5CXTA 2B51A 3V4MA 2AP6A 1RABB 3TNVA 1AYEA 2F8HA 4OYOA 3CMES 2Z58B 4A8YA 3R8YA 5ETTA 3TVKA 2W24A 2JNJA 4HHHA 4NCGA 5DRKA 3J7YI 2R7WA 3GU0A 1D0EA 4N41A 1HNWF 1RWNB 2ZWOA 2B9EA 2NLWA 4KGKA 4J9SA 3GFZA 4A8XA 1KLMB 5KFPA 2HIQA 3MTKA 5AE3A 2ZZNA 3ZTRA 2KU7A 4ZPBA 5A8KA 1TAUA 1SQGA 2DCLA 3MDFA 4RW6A 3J80Y 4CM2A 3QPIA 2V8DA 2VHGA 2XMKA 4RBUA 4FKXA 2WBRA 4LRAA 3SCLE 4ZN3A 2XGQA 3HJFA 3AOBA 4DCPB 3MOJB 1W2IA 1MROB 2GHWA 5AXLA 1Q5VA 3TZZA 2HHHF 4RW9B 2MMYA 3BDEA 2XLIA 1T94A 2ZEJA 1LV5A 1C0UA 1T9VA 3MM7A 1HWLA 3QYYA 1SUQB 4FP9A 1SJQA 2FVQA 2UVUA 4OX9J 1B0PA 2IM3A 3HT0A 4AXIA 2OJ3A 3UVJB 2ASLA 2NXJA 2ZH2A 4TU8A 4DPUA 4QYZJ 3EVMA 4X65F 2C3MA 1RK8A 4MMOA 2BJ1A 2GIFA 1GT8A 1OWXA 2EFQA 1BQNB 2A2DA 3A13A 1XNQF 1R0BG 2VQFJ 1RBAA 2C2MB 1R27B 4PABA 4PXEA 4PWDB 5IV4A 2RE1A 4DCOB 2OH2A 4K4TA 3POTB 1AFJA 2AV5A 2DXFA 2VBZA 4WTOB 4DV2J 4NASA 1IWGA 2QYCA 1SI9A 3W2VA 2IM1A 4CTAB 2HYIB 2V2QA 1TL3B 3WBZA 1S59A 2HHSA 1K0VA 1HQEA 2CVEA 2FZKB 2RILA 2RHSB 4WYWA 5SUHA 5KFNA 2WVDA 3V6DB 1BHNA 4C0OC 1M5OC 3NS7B 1UTAA 2XZDB 5L1JA 2DTJA 2WCXA 3ICLA 2OP5A 3R6LB 2IAJB 2X7IA 5FLXU 4R8UA 3BGOP 1ZBTA 5HO4A 2HHTA 4G3IA 4ZVFA 4AL6A 1NO8A 2MDAA 4JYAJ 4EZ9A 3LF0A 2IPOB 4HDGA 4G1QA 4KH0B 2D1CA 3CJKA 3UD5A 5HJYA 4J9QA 4HYKA 1F6TA 2ZBCA 4FBUA 4X4UA 3MM8A 1RT5A 1PAEX 2DHXA 5L1LA 4JI0F 4Q2MA 3I4PA 1S1WA 2CQ1A 1RT4B 2R8JA 2PA8D 1S1UA 1Q95G 4DR2F 3US5A 4OJHA 4KKOB 2M8DB 4RW8B 1DLOB 4X65J 4DG1B 1H74A 2QJ3A 1TL7B 4UZBA 3R2CJ 2IYGA 1DURA 3CCQS 2R7UA 4DXLA 3G86A 1LNQA 3U02A 2BKPA 2V0NA 3NWRA 1D9AA 2ROGA 1U0SA 4WYLA 4YQWA 3TEGA 4I64A 5HJXA 1FDAA 5EWEA 5KFGA 1XMBA 2FJXA 1RKJA 1RB0A 2B3TB 2YH0A 2K3IA 3D6TB 5DGAA 1FJGF 1HWKA 1GMVA 2YNIA 1BQMA 3NS5A 4PQAA 1WUUA 2KJVA 2UV8A 3CF5Q 2E9TA 1RAHB 2F4VF 2APOA 1IJFB 5B0DA 2Y1LB 5C2CA 2LXIA 2UUWA 2VFSA 2F8MA 2XY7A 1N6QA 3DLLQ 3NMAA 2QC3A 3NNCA 1PBUA 2VC0A 5K8MA 1FJCA 2RF2A 5M2RA 3CJTA 3FK4A 3H98A 2XY5A 2AT1B 3D9BA 2GVZB 4D3GA 4DPXA 5J2PB 1EZZB 3OFGA 1BLUA 3CDWA 3GJTB 3FQLA 4IH6A 2MZ1A 2V4RA 3V81B 4OHYA 2CNOB 3KG4A 4CT8A 1VQYA 3MMAA 1Q8IA 2Q6CA 1HKAA 2DT9A 4I4BA 4J9UE 4MAKA 3HCXA 4FS1A 1DTQA 2DXDA 1UVKA 4CRJA 1SH2A 3DN9A 2AGOA 1TK0A 2R7SA 4ECXA 2F9JA 3WX8A 4RUAA 4UF4A 3IWXA 3PHTA 1R6YA 2RRBA 3KLIA 5IQ6A 2OPSA 3NMRA 3FBFA 3C46A 4RUCA 3GCWP 4UQTA 4CIOA 1IKXA 3QGPA 4URGA 3C19A 3KNAA 4ZPDA 5E3QA 2HQ3A 5F8NA 5D0EA 2E5HA 1X31C 3VAJA 3BB5A 4ZIVA 5F3TA 2YKNA 1RXOB 1U09A 3DOLB 3U1MA 4FS2A 4Q8EA 3CDAA 1VC6A 2MLZA 4MK7A 4LFAF 3HT3A 1D09B 5KFDA 4B3MF 4IDKB 4NL5A 4X4OA 1T9WA 4QYZK 2W4PA 3BBBA 1V3ZA 2RJZA 2NQPA 4GRSA 2VG7B 3A8EA 2BXJA 2OEJA 2DY9A 3HZEA 3OTOF 2J6TA 4DSIA 4O44A 4DV0F 3IO1A 2DNMA 3TZXA 4DV6F 1VQLS 4S0MA 5DDRC 5G0RA 1FHTA 4RW7A 2OFGX 3BREA 1R43A 4DR2J 3ENVA 3OLBA 3MFHA 1UCNA 2AJQA 4PRFA 2ZDOA 4KQZA 4X4NA 2F3JA 2H51B 3C14A 4R0EA 4UOFA 1D9DA 1VHFA 2V68A 2J9CA 1RWOB 2NZCA 2YNHA 3M2UA 3RAXA 2V67A 1SL2A 1KQFB 4PQUA 1XR5A 4B3SJ 1VK8A 1NJXA 1RTIA 3MM9A 1RAEB 3MCNA 1C0TA 5GAHU 1YJ9S 4LF4J 2MSTA 3HP6A 1BE4A 2M8HA 4ZP7A 4QW9A 3W2WA 4LMZA 4OI2A 4DF4A 4WP9A 4ED7A 3M30B 5M2PA 3E2EA 3V6HA 1ZAXA 4DR6J 2X1GA 3ILOA 3KXDA 1WOSA 4YMEA 3ZC4A 3CJRA 4I2QA 2QZ8A 3QFWA 1X4FA 3BN4A 4NLTA 2QLWA 4C8OA 2BDPA 2R2UA 3BKUA 1S48A 4NXMJ 5KFEA 5BYQA 1VMBA 4IYQA 3N28A 1R6VA 1P1TA 2HQDA 1HWJA 4LF2A 3G8TA 3PRBA 1H2VZ 2GCFA 2GC8A 2LU2A 4OX6A 2GQ2A 2K06A 3M4XA 3U7JA 4ES2A 3I96A 5KT3A 2WAQD 2IM0A 2XTJP 4ZN1A 1MMDA 3RRKA 3EGNA 4HACA 4Q8FA 2ASDA 4Q5VA 2OEMA 1DTTA 4ZVGA 3HHLA 4TN2A 1MN7A 2FC8A 4NLQA 2AKWB 1N0UA 4ANEA 2R8HA 4DF8A 1D9FA 4WE1B 1YK9A 2Q43A 2W9CB 4PUOA 1UZHA 1TKTA 1F9HA 4DL7A 3T1AA 1X4AA 2EW9A 3CDUA 1SVDA 3OXGA 1X9SA 3C66A 2F7VA 1WF1A 8AT1B 3KLHA 1W26A 1R8PA 1RZMA 2HHXA 2HGNA 1WKLA 4MT1A 3KUGA 5D4PA 2ZDPA 4RKUC 3WQPA 1KEKA 1QSLA 4HT5A 4LF5J 2R7TA 3TANA 1DRZA 1YITS 4QOTA 1NK7A 1CQNA 2HNDA 3Q8SB 2DHGA 4GMKA 3JS9A 8RUCA 2IMWP 4YB1P 4Q44A 1TZ0A 1CBKA 1OSDA 1TMJA 1X5SA 4LT6A 5HVFA 2QRRA 1PJ6A 3DRSB 3EGVA 3PV8A 4P2MA 3MTJA 5H9EJ 3TR5A 5KFXA 4FF4A 1KTQA 4OIXA 4PG6A 3TRGA 3HSDA 4TQRA 2WTFA 3CCRS 1NJZA 4DQIA 2HHWA 3DYAB 2GNKA 3NG8A 4NA3A 3OVAA 3FRZA 4LIRA 4AD6A 4WKYA 4JI8J 3PR5B 1Y9OA 1K9MT 3ET6A 5G4DA 3DDKA 4G65A 5I42B 4KV8A 2OAUA 2UXCF 4OMFG 1FO1A 1RT4A 3ENQA 1SH3A 2ILYA 2E1MC 2ZOMA 1HNIA 1H7WA 3Q24A 4K4ZA 1CJUB 2C1EB 2R2SA 2OO4A 2XYHB 2QG9B 3BGUA 3CVKA 3FJ2A 5LT5A 4IO9Q 3R5JB 3VALA 2BVZA 3W3SA 1S9GA 2CQ4A 5DDOC 2L9WA 3K58A 3PZPA 1IM4A 1K1SA 5D77A 1IR0A 1MN9A 3HPOA 2EK1A 2R42A 1GXLA 4C97A 3NCRA 4NLRA 5AT1B 3UDEA 2B43A 3C6UA 5HMXA 3BGRB 1LOUA 5MAOA 4IUFA 3KK2B 2RDIA 3ILJA 4TYAA 3D0HE 4ZPTR 1R0CB 4CH1A 1S1VA 2PEBA 2LEBA 5DG8A 2D74B 4IO1A 1BC6A 1TL5A 2GVDA 5I4MA 1HHTP 2VKZG 2IM2A 1U8WA 1XNRF 2VICA 2H5JB 3AD9C 3KMQA 1AXQA 2MEWA 3IGNA 3L7OA 5CYMA 3VAHA 2VG6B 3P4UB 1JLCB 2KXNB 4R0JA 4EFAC 5J2PA 3TAQA 2W2NP 1JLAB 2RQ4A 4O0NA 1FK9A 1DAXA 3O8WA 2DYAA 3EZOA 3HLUA 5KAKA 2QMWA 1RCOB 4M8LA 1UEVA 3EGWB 1B4SA 2UUAJ 2CQBA 1S6PA 3E8OA 1WNEA 1JXEA 2ZHAA 2G2YA 2XMJA 1CC7A 1PYTA 2ZOGA 3E3XA 3PYEA 2V9KA 5U47A 1VQ4S 2RKIB 4NLUA 5H9FK 2I38A 1HL6A 4QQBA 2AW0A 2CA9A 3FQKA 3V6KA 2UZAA 1FRLA 4KHRA 2H65B 1L3VA 2PI4A 4FXVA 1U1OA 1YX2A 1B7FA 5IC4B 5GMDA 2BQUA 2VV5A 1KHVA 3MZIA 2GQQA 3OL8A 1NK8A 3DLGA 1RUSA 3MPYA 4H4MB 4MTPA 1CULA 5E33A 2B6AA 1SJ4P 4R8UB 2NXEA 5HVGA 2CWXA 4DUZF 2C2DA 3N79A 4F04B 1Y5IB 3AFGA 4OX7A 5CQGA 3JQJA 4WWSA 1K8AT 5KT4A 3TX0A 1KQGB 5ITHA 2F65A 2NXUA 4I6WA 1CEZA 2UVVA 3RW7A 1HNZF 2UUTA 3CJSA 2RVJA 1GX6A 4EGLA 2ZOFA 1W7WA 3MOZA 2AYBA 1VR6A 1RISA 3HVWA 1H7XA 4IRKA 2LQ9A 2Z0GA 1LWCB 4RNHA 5K8OA 2DGSA 1OO0B 2XMVA 4MKAA 4P2XA 3UD4P 1YZ6A 4KHPF 3QIPA 4CLUA 1RJJA 1YBAA 2E44A 1KR4A 4YEAA 5LXRA 5HP1A 1VISA 3Q86A 2E1CA 5AE1A 5HROA 1M0SA 1O6XA 1TV6B 3D6FB 3O44A 3I32A 3LP2A 1WI8A 3M2UB 5D6GA 2WK4A 4M5KA 4DL5A 3EDQB 4DU7A 1WG1A 2KM8C 1CVJA 3G8SA 2E9RX 1NZAA 3UDVA 2NXNA 3HDSA 3OVSA 1VRUB 1FWPA 1S6QB 1FJEB 2DNHA 1S6OA 2CQHA 1WHVA 3EVWA 3GYXB 4Q7AA 1RTJB 2B8QA 1TUVA 2NXCA 2FJDB 3ETMA 1VOMA 2PA3A 2RIJA 3DM2B 1P27B 2CDQA 3PEHA 3QGHA 1RE1B 2YH1A 1NJIT 4B3OA 1JJHA 2BQRA 3W65A 3SZ2A 3ZO7A 4CLPA 3H42A 2A6OA 4DS5A 4LR8A 1T9UA 4GO5X 4KGMA 1H73A 1WHYA 4R5PB 4UQGA 2QLBB 4DV4F 1VLYA 1VLOA 5E5NA 4RW8A 2I8EA 4RJVA 2XEXA 4ZKAA 4OZ5A 1QY7A 4Y6IA 4OHZA 1JLQB 2VJVA 1Q81T 1HARA 1ZYQA 3W1YC 1KSPA 5HQLA 2WW8A 1JLAA 2GIRA 3KDNA 3CTRA 1K73T 3BS9A 3NGDA 2HVHA 9RUBA 2HBYB 1ZPWX 3W8PA 4DV7F 1YJ7A 2MZJA 3QGIA 1CJKA 5D4OA 7AT1B 4ZITA 3PYDA 1MMLA 3V81A 2WSEC 2BJ8A 2PMWA 4DLGA 3EDRB 4C3LA 1U1RA 2BM0A 2FB0A 4M5GA 1P8GA 4PXBA 3H40A 5F0WA 3O3LA 2IBOA 1WI6A 4JB8B 2DK2A 3LP1A 4DX7A 4C8YA 3M1VA 1GTEA 1OY9A 4F3QA 3P3DA 3GONA 3OR1B 3RB4A 4CLWA 1KQSR 1S0VA 2QT7A 2D9PA 4UT4A 4RW6B 4DZDA 5B0EA 2ZE2A 3UDLA 2VOPA 1WC1A 1WC0A 4JUZA 4Z37A 4UY85 2MKJA 3ENWA 3JTPA 2ZH8A 1RTDB 4NZ6A 1E6VB 5I3QA 2XCPA 1RWXB 4OJ3A 1UVIA 4CDIA 2HAIA 3HHKA 4MKBA 4OHVA 4KT0C 3DI6A 4F3OA 1Y7PA 2MQNA 3ZNUA 2A0FB 3BGFA 2HRYA 3NOGA 4XTTA 3M9OB 1I94J 4JV1A 5CCLA 4OYBA 2HEKA 3PNIA 5C25A 3C8YA 1HQUA 1N5YB 3BYPA 3G82A 3OQ2A 2HQIA 4DOZA 4X4TA 3FVYA 3LPYA 5H9FJ 4ED4A 3S8SA 3TARA 3QSYB 3DU5A 1FDNA 3QGGA 1NMEB 1Y11A 1UA0A 3M9NB 1WJ9A 3HKWA 2FVRA 1KONA 4WPAA 3IWNC 4OI6A 1N34J 5RUBA 2WW4A 4WFNQ 4TU9A 2POKA 2E7VA 3DLEB 3O5TB 4FYXB 2O3DA 4CT9A 2V94A 4CLZA 2CPZA 2DNYA 2IIHA 4Y34A 2W9BB 1UEKA 4EYIB 2QGFB 3GIKA 4NCGB 2M0GB 3PX4A 4KFBB 2EKNA 3D6MB 3EUNA 4ID5A 1REVA 4C7QA 2HPUA 4F4KA 3CCVS 4DR4J 1SH0A 1LFWA 2ACYA 1EAYC 2MHNA 3CNQP 4OZNA 3FSIA 1JB0C 4LF9J 2YKPA 2CPJA 1FWKA 2IRXA 3C15A 1NHKL 1NH8A 2MZQA 5J1PA 4LF7F 3Q2SC 4NXNF 2R7VA 5IT4A 2WSFC 4RPFA 3PXGa 2UUCJ 2BACA 4PPDA 3RUBL 2PN6A 1U1LA 4WZQA 3RU0A 1PYOB 1VFJA 1MROA 3UNYA 2J76E 4TQSA 2J0QD 1V5IB 4KO0A 2IHR1 2QX0A 2V9WA 4C8LA 1UP1A 3JQMA 5KT2A 2IRYA 3D0IE 4WFZA 4J9VA 3LO3A 1FK9B 4UUXA 2QLXA 5FD1A 2ZD1B 4QWAA 4A48A 2RQCA 4LFAJ 4LF6J 1SCJB 4NE9C 2R2RA 4ZP8A 1O8BA 1NSKL 4X62J 1JLBB 3KYLA 1Q7YT 2KO1A 3NEKA 5IT0A 2Y0BB 3D5MA 3OHBA 2HFSA 5LMNJ 4YOEA 2IMOA 1KS2A 3SMZA 3QMQA 3KLEB 1HNXF 4XDCA 2G2OA 3AHPA 1YWXA 3T1HJ 2E1PA 2M4MA 2DISA 3D54A 4IG3B 1N4LA 2VQFF 2GMJA 2R7OA 4PWDA 3ZTQA 3X3UA 5AXNA 5A2QU 3KLHB 2YWEA 4XDDA 2ALZA 1K0TA 5LMNF 1Q7LB 3R5AA 4CLTA 3QJJA 4DX5A 2KFZA 4LR9A 4YY3J 5A0YA 1RHJB 4UOHA 1QAXA 4OFZA 1N5SA 1YJUA 3W9JA 4LSNA 3BZQA 4ELTA 1V3SA 1TFYA 3GPAA 2GVZA 5CYQA 5J2NB 1SUQA 2EEYA 4M5HA 5F8JA 3GR0A 5FDLB 5DM7Q 1R0AA 1Q16B 3DGPB 1WF0A 1O0PA 2EFNA 2DNPA 2RS8A 2XWXA 3I0SB 5DGBA 3K5LA 4IQXA 1X5OA 3IG1B 3M8QB 5JUMA 5HATA 1FXDA 5B08A 2QMUB 2HFVA 2Y1RI 1EARA 5FDLA 3HXMA 2WVCA 5EHHA 1B70B 2VDIA 3AB2B 1Q4RA 3CJ0A 3CMQA 1IBMJ 3ET6B 3ZTSA 3GYNA 1SXLA 4CH0S 2BRLA 5HROB 1IKXB 4ILRA 1SC6A 2J6UA 4F3MA 5J2QB 1U1KA 4NLPA 1FKOB 4XK8C 5HQ8A 1VRTA 5DO2A 3TO8A 3TI0A 3QSIA 1FI4A 4J9RA 4B9SA 2D3OR 2AJ0A 1PG5B 4AE5A 1V5VA 4EK2A 3G6VA 1SB6A 1KN6A 4OI4A 1X8DA 4LBIA 1B64A 3DOKA 2DGTA 2HWIA 3NY0A 1Q8KA 1VQ5S 1YJNS 1VIXA 5SZTA 1JNZB 1B0TA 4RUBA 3FCVA 4PR6A 2UUBF 1N33J 2FY8A 4ZJQA 4B3TJ 1DY3A 3VAIA 3M8PA 5EX0A 4OI0A 1Y5LB 1RAJA 2I5JB 3B78A 1PC5A 1KFDA 1KWMA 2AHOB 3UCGA 4DR1J 1KVJA 2KHCA 4WFXA 2U1AA 3CC2S 2W9AA 4OI3A 1D1UA 3DLJA 1GX5A 4N7TA 1RA6A 1UPPA 2JOQA 2Z2ZA 1SBRA 5KFKA 3ZZOA 1IKVA 2CQDA 5DETA 1YSJA 4I6YA 4P52A 1S9GB 3VR1A 4M5NA 4C2MA 7FDRA 2MQOA 5JVHQ 4F4WA 3Q23A 4CH7A 2B9WA 3NGUA 1KRPA 2FLOA 3ADAC 2IDEA 3IGVA 3I82A 4M5JA 3N01A 2HVZA 3WIVA 1C0TB 2K3KA 3A3NB 1E6YA 2Z4PA 3ZZYA 2MTLA 4WU3A 3BO2A 1IR1A 3MAAA 1X4BA 4N76A 3ITHA 3PYGA 1OQ3A 2XZWA 4JI8F 4DWIA 2PO4A 4F4AA 4DLEA 4ED6A 3R1HA 3OVBA 3W61A 4C11A 4ECSA 3M6VA 2ZC3A 1OPIA 2UU9F 3FNNA 5KFBA 2WVBA 1AUSL 4JI4J 1C4CA 1M5HA 5K14B 4Y2IA 3J81j 2MKKA 5C5JA 4IQMA 2ALYB 3L7UA 1FTCA 3V4IB 3FEZA 1GNKA 2EFPA 4K50A 4FKYA 2AYMA 3H4DA 3D1HA 5L1KA 3CXCR 1TKDA 1HFEL 2BJDA 1YGYA 1QD1A 2LA4A 2HLTA 4KYZA 4PWWA 1FWLA 3N9UC 4JI4F 3MEGB 3KHLA 1AW0A 2P6SA 2GO8A 3THVA 1WF2A 3KTQA 3AY0A 2LKZA 1RLDA 2O5DA 2DEJA 1O51A 2X3GA 4JP8A 1Y3JA 1S7HA 1WG4A 4K5SA 1BQXA 2KHDA 3ELHA 4O23A 5ETMA 2DR9A 2QLFB 5KFLA 4OX9F 3M7VA 4CLYA 3GV8B 5IT9U 1S4FA 3N6MA 1KKHA 1HBOB 5LOQA 1OIAA 2UVRA 3VAGA 4ZVPB 2QIFA 5KFFA 3HHLD 3AA9A 3W2VB 4LJMA 4ICLA 2ADCA 1TR0A 3PW0A 3OXFA 5DLGA 2ASYA 4PQUB 2CPHA 3OUYA 2UVWA 2B8PA 4QWBA 4QW8A 3T5LA 5EDWA 4Y2KA 3MXHP 2MGZA 1I6JA 2Q6BA 1I3OB 1P1LA 4USJC 3PX6A 2J0SD 2KDOA 2IY5B 1HPZB 5H1SV 4DX6A 2H3EB 2RU3A 2FC9A 2Z30B 4B02A 1TK8A 3K7RA 2YX7A 1T9YA 1Z1ZA 2NUUG 3JYTA 1CG2A 2HS0A 4KR0B 3TJ9A 2B4OA 4WP3A 3M8WA 3TYTA 5HSPA 5CYJA 3QLHB 1M5SA 4GO7X 4NLVA 3VZIA 1FVSA 2HRTA 4O4RA 4U8YA 5B7WA 1SPBP 3KLGA 1RAIB 3PM9A 1B0VA 5D4LA 1M90T 2IC3A 2DHAA 1RI7A 4AFFA 2DNLA 4DG1A 1WOPA 2DO4A 4RLEA 3G6ES 1U45A 4USKA 1S0OA 2NR0A 3CJ2A 2H1YA 2DH7A 1T9TA 4A8SA 2HHQA 4RWXA 1F3VA 3FFIA 1KQKA 4P2SA 5DG7A 4CLSA 1FEEA 1P9YA 3GZ7A 2G0IA 3MEDB 4DI6A 4HT7A 1MWQA 3IBWA 1TKTB 3AOCA 1T9XA 3EXCX 3J81U 2UXBJ 1RWPB 3K8WA 2CQGA 3LP1B 2EBGA 2ZZTA 5THWA 3RR7A 1UVMA 1IBKJ 4FVMA 1NHVA 2O67A 3NOCA 4DV0J 2DGOA 1VQ7S 1FKAF 2JSXA 3UI3A 1QJHA 2OEKA 5L46A 1KLMA 4Y2MA 4GKJF 2W7OA 2CRLA 4ZP9A 4DFJA 3IFEA 2KI2A 5KG5A 4UTGA 2BQ3A 4JI7F 1LFPA 3C3LA 4DPYA 1K1QA 2J5AA 3OD2A 3CT9A 1S72S 4MIWA 3D4JA 3PRDA 1FX2A 2HG4A 2XMTA 1AT1B 4ED1A 1PILA 4DV2F 1TUWA 3KUEA 3CJ3A 4O3SA 4Q2LA 2NPFA 1LWFA 2OPRA 3D2WA 5KFJA 5F0UA 2LMIA 1RWWB 3HSJA 3QO9B 2ZWPA 1OYDA 3GIRA 5HAOA 3UNGC 2IBKA 2GZOA 3NLCA 2HZAA 1TELA 3DGVA 4CP5A 2EKYA 3BDPA 2R7QA 1ZA1B 3MR5A 4LF9F 2EBEA 3C6TA 5IXUA 3G82B 3K17A 3KNGA 3CCMS 3OJUA 3QRRA 3CO0P 4DR7F 4QR0A 3JSMB 2YNGA 1YJVA 2M3DA 3H20A 4LF8J 1NLKL 5ETQA 2IFXA 2K1RA 3AA8A 3SSSA 3KLIB 5KFZA 3J7ZT 4WBFA 1WTBA 4RR5A 1VRTB 2MB0B 3DDIA 2CNLB 5DS7A 5T7LA 4JV5J 1WHWA 3LW5C 2VFRA 4MKVA 4JI2F 3FBBA 4J9PA 3MMCA 3A4TA 4JI5F 2FQQB 2OMOA 2OTJS 4B9NA 3D66A 1VHIA 1U2RA 3UWTA 3HMJG 4DQSA 1NK5A 2DY1A 4TLQA 4NXNJ 2OSQA 3BGRA 2LDIA 2L48A 1D8YA 1S79A 4LREA 3L7PA 4K5RA 4USWA 5G0RB 1OY6A 1ICEB 2VBXA 2VFUA 4ED8A 4K0KF 4ECZA 2W4DA 2XZTB 1XIQA 3T5KA 1NPKA 2CQ2A 1FXRA 2QSFA 3NKYA 3MR3A 4DV3J 2ZKTA 3OBIA 3HZGA 5I42A 2VA3A 3GIMA 4ETXA 4PAAA 2MQPA 1M5VC 4J7CA 1MW7A 3MECA 5B0GA 4YFUA 2CAJA 1JLCA 4YDXA 5MLCV 2WHOA 3MUVP 2CJAA 4BWMA 3ISZA 1X5TA 2AEFA 2RRAA 2FDNA 2GAHC 2KN4A 4OZLA 2BBEA 3MFIA 2DKOB 5IT9Y 3RZAA 5DDPC 5IC6B 3UO0A 5HQMA 5KFWA 4DSJA 3O1LA 1A7GE 1T0TV 4ZVHA 3Q22A 1FRJA 2G9OA 3H59A 1IKYB 1RHRB 4M1KA 1DJ0A 1ACMB 2JEGA 2BANA 2V8GA 4JV0A 3VZHA 5BYSA 3F41A 3CC7S 4XAKA 4TY9A 2AX1A 4U7UK 1UAWA 1IKWB 3Q0AA 1S1VB 4IH5A 3VVTA 3GTYX 4GVBB 1VYAA 1YIJS 5DLFA 4ERDA 4KGZB 1QLNA 5GAEI 4CNYA 5CYQB 5J2NA 1MWZA 2NCKL 2BJ9A 3IA0A 1S99A 5KG6A 4DPWA 4ILMA 1P9QC 2RF2B 1KC8T 3DGPA 1AUDA 1LWEA 1RT6B 2IJRA 2J0XA 3QZ7A 1RTHA 1UL3A 4NEYA 3N5BA 1HNVB 2GHPA 4ECUA 1UWBA 5KG4A 4OYPA 4B3MJ 1R31A 2ZBQA 2HHVA 1YJRA 2H54B 3GG1A 4HACB 2HSEB 3MMAB 1RTHB 4KAIA 2HWHA 8ATCB 1S49A 2ROEA 5EGYA 4OZ2A 5JJBA 3CUNA 4F4XA 3G9CA 1APSA 1TQLA 1FA0A 1DBDA 2D9OA 2WB4A 4DV5J 2DEIA 1G3OA 4AQYJ 2IYIA 3AAWB 1RWVB 3T1YF 3C16A 2XSFA 6AT1B 2J9DE 2AJFE 1NJYA 1LEOA 3DOMA 3VAMA 1TKZA 1WKJA 6FD1A 4QJVA 1H0HB 4IFYA 3VVUA 2Z2LA 3CW2C 4GC6A 4LFBF 2DBBA 1Q53A 2KB2A 3C16B 5D78A 1TAQA 1AROP 1EQ0A 2RQKA 4O4GB 2H5IB 4DR5J 3OTCA 4H4MA 4KSEB 1RACB 1E6VA 4LR7A 4U9RA 3ZZTA 1IXKA 2Z2MA 4HDHA 2A2CA 3DXBA 4TLRA 3JYTB 4ZOSA 1S4EA 2ZH6A 1DQ9A 4DX8H 1RWUA 3OJSA 1IUJA 1HW9A 5C25B 4PPZA 4C0BA 2VKRA 2WOMB 2Z57B 3HVTA 1T05A 1X4HA 3QNWB 5IWAF 3DXSX 4B08A 1JXLA 1XR7A 1S1UB 3R5DA 1FRHA 3TP2A 3HVTB 1WEYA 1T05B 2K7KA 2LLZA 3NGSA 4FZVA 3BEGB 2R8KA 4L3NA 3HFZB 3OFHA 2WB1D 2BOPA 2GS8A 1R8BA 2DH9A 2PMZD 4X84A 4YUDA 2GW8A 2CUYA 2FVCA 1DQAA 1M1HA 2WZ1A 3BBFA 4DL6A 1PGZA 4EEYA 3FCWA 1K47A 2WRMA 3ONQA 2L9NA 3UN5A 4MYUA 2VBYA 5DM6Q 3G2XA 3BQ2A 5A8RB 4IOCQ 3DM2A 3T3FA 3R7BB 2QN6B 2HKEA 3CB4A 2CJKA 4NLWA 3SFGA 3JQKA 4BS2A 3O2IA 1U4BA 1NSAA 2F8EX 2YNIB 1IKWA 3OTDA 1NXIA 4LIWA 1IBLJ 2FLPA 1RADB 4W92B 3D3CJ 3RBZA 2QMXA 3SCJE 4YS2A 4AL7A 2BKOA 1NH7A 1IKVB 1NDPA 1I51B 5F3ZA 5L9NA 2DPIA 2FLNA 3TZWA 3AQPA 4YDDB 2MKIA 3CD0A 1PAUB 5K14A 4UW2A 4OLOA 5KT5A 1N32J 1CC8A 3EZ5A 5J2MA 2DR7A 2A1BA 4KPYA 1GTHA 3TAPA 1H98A 4M94A 2BE9B 3TQEA 2VF3A 4RW9A 1SL0A 3KOAA 4LF1A 2JJ4D 2V6AA 3KLFA 2IJFA 3ITHB 1DZ5A 3QBCA 4CO1A 4YR2A 1EKSA 2ZM6F 3D1OA 3SYZA 4NA1A 2N82B 3CWJA 4ZCMA 1DFDA 1U7LA 2P5VA 2EI5A 3BGLA 3GJRB 4KHMA 4WFBQ 1RBOB 4ZA1A 2MXYA 1RAFB 5ETRA 5AXKA 3NCQA 3KJVB 1FVQA 1HR0F 2VQEF 5HBMB 3JB9k 3MEEB 3V6JA 1VDHA 5E3RA 4LVNP 3TA1A 4NLDA 2XNRA 2K2PA 4XIUA 2B9YA 3R97A 1RTZA 3TJAA 1XEZA 1MG7A 1S9EB 2F40A 2OMLA 2J8SA 3DRYA 2DNRA 3A8KA 1WC6A 2OGUA 4LSNB 5GMKa 2A3JA 1X0FA 5D3GA 3OFEA 1G2EA 1FXLA 1U6BA 1Q82T 2MZSA 5KG3A 2IDLA 3GMGA 2GMHA 2X3DA 2N4DA 3GIJA 2V4JA 2FHOB 1IM6A 2PE8A 2VUGA 3IWLA 3OPKA 4LRBA 4O44B 4PYDA 2HHHJ 1HQUB 1YVFA 2KYXA 4KTQA 3BYRA 2W1BA 2ZBIA 1T7PA 2FJWA 2CG4A 2C3OA 1ZTTA 1U6ZA 1FRXA 1NSPA 1TL7A 3SIPB 2EG2A 4ZLNA 4ZPAA 1LWCA 4FVCA 3HVAA 1VRUA 1X0PA 1QUPA 2EVZA 1IBKF 4DMZA 2ZD1A 4ES1A 1XBWA 1VJWA 1WEZA 3PRVA 3BQ1A 4DR3F 3BKFA 3I56S 1RA7A 2AYGA 2DNNA 3CEDA 5HLFB 3DNCA 3B82A 1FKPA 4BC9A 5BXIA 5E7OB 1SC1B 4K4WA 2Y0SD 2NZ4A 3M30A 4DBQA 1JXVA 3JTOA 2LFVA 4L3KA 2YX1A 2GHVC 1IBLF 2DR6A 2MQ8A 1QUVA 4KGVB 1FF2A 2N7CA 1J5OA 4B9MA 4URQU 4USHA 2XYGB 1KOOA 2J9EA 1GQEA 2IVFB 1SKRA 3PW5A 2R4FA 2O1PA 5BR8J 1CS4A 2CDRB 3ZZUA 3PW7A 3H5XA 1UWAA 2C2OB 4H54A 3TVZA 1FESA 4FF1A 1X60A 3A8IA 3G96A 1T95A 5D8HB 3KHGA 5D0HA 1F9EB 1N36J 1SJFA 1N6QB 2YBVA 2HVIA 3PFEA 3AJ2A 2LCWA 3DRPB 4NYPA 1IN0A 3R2DJ 2BE2A 4K4YA 4ID8A 3IRWP 1BWEA 2CPEA 2IVMA 2BUNA 3L4BC 4TY8B 2Q3PA 2N3OA 2IJNA 1U02A 2ZH4A 4DR4F 4MK9A 4NRUA 2HMIB 2PI5A 1MNEA 1SJRA 2M52A 3UQSA 2DVIA 3PFOA 3B54A 2YNGB 3MAAB 3M1VB 3QO9A 1SKSA 2JEIA 1QM9A 4LF7J 3MCSA 1NPPA 4LRCA 3SXLA 3VQTA 1FTRA 1HHQA 3WC2A 3HHNB 1IQTA 2YTCA 1UFWA 1UPMB 3I9V9 4P72A 2Y8WA 1QSSA 2RH3A 4QU7A 1EB0A 3QWUA 4Q0BA 2C42A 1WOOA 1VQKS 3S01A 1OY8A 4EU0A 5KT7A 2RS2A 3RW6A 1UETA 4PEOA 1ZETA 2VDHA 2UUCF 4YP3A 2VA2A 2EPIA 4F26A 2C2RA 3SCIE 4JI6J 3PJWA 3TVYA 2B4UA 4U7CA 3OW2R 3MCMA 5D3GB 2M88A 3NNHA 4EZ6A 1FFSB 5D15A 1SIZA 3CCUS 3MM7B 4DV3F 2COLA 4DUYJ 5KTQA 1B7YB 1H3DA 1Q8LA 3M8PB 4URSA 3T5JA 2UUBJ 2I1RA 5DZ7A 4DJBA 2YX4A 4IG0A 4IDKA 3DI6B 3VWSA 2MY7A 1ZS6A 4JI6F 4EWTA 1YI2S 4ELUA 3RBXA 3KWMA 1HI1A 3W63A 2MZRA 3JSMA 1R8HA 1F9FA 4ZP6A 3CCSS 1MSWD 3TUJC 1FEHA 1BQNA 1ZZFA 1UFKA 2F9DA 3DHXA 2HGMA 2GGPB 5KFQA 4NA2A 5EWGA 3Q8RB 4DR3J 1HBMA 3K5NA 1CQMA 4ZMMA 4FYVB 2BEFA 2XMAA 2GGPA 1KP6A 3B6BA 4HHUA 1AFIA 3FEYB 2HZCA 3VV2B 1JK9B 4NI2B 3I55S 5IV3A 4DSEA 2RUGA 3HD2A 1RTJA 1C1CA 1DQ8A 1PIEA 2ZBPA 4J9KA 2FHKA 1KDNA 5LL6d 1VRQC 4QIWD 4Z7CA 4J5OA 3ISND 1WSVA 1P6TA 3QT7A 5IS2A 1NAQA 3HHDA 4QPXA 1QTMA 2ZHOA 1M5PC 1QSYA 4IR1A 5AXMA 3P5TL 3GSIA 2UU9J 5I3UA 4ECRA 1FRMA 2FZGB 4ZJLA 2RUSA 3I31A 1RT5B 1UJ6A 4I0WA 2ZH9A 4CYUA 1HNVA 1RGVA 2V2VA 2V69A 3MF5A 3TZYA 1Y4ZB 2FLLA 1JLEB 1SV5A 3LGHA 4LSLA 2W7AA 5HANA 1N52B 2C2ZB 2IRUA 2X1BA 3BF4A 2VD3A 2ZKUA 3FMWA 3IS9A 3K8VA 1H2UX 4NZ0A 2VC1A 4DEZA 1S77D 2BYCA 3DRRA 3M8SA 3LAKA 2YVSA 2F4FA 3SSQA 5L38A 2PFFB 4RNOA 4N8OA 4TKTA 4ZVOB 2KT2A 1VI7A 2E7XA 2DJWA 4B17A 3B8HA 3DRXA 1Q86T 1RHQB 3DRRB 2XO7A 4WCEQ 2LEAA 4OV1A 1CJTA 1YBTA 1TU0B 4WE1A 5K9FA 2HVEA 2JRSA 1IR2A 2W9CA 3R27A 4K4VA 4QWCA 1TL4A 2C2KB 4NCBA 4X64J 1TTHB 6FDRA 4JI7J 2MJNA 1CJTB 3PHEA 2W2MP 1J27A 3S7RA 3GILA 1Q79A 1U2FA 3IP0A 3E51A 3VGUA 3TAMB 1VS3A 1JJ2R 3EM1A 5DZ6A 4USUA 3VGSA 5B0CA 3UN2A 5KFOA 5C24A 1F2GA 3RBEA 1GH8A 1LKZA 3KG1A 1HQEB 4MK8A 2ZJQQ 4A8OA 3MPDA 4KE5A 4ECTA 2O01C 3BR8A 2AJ2A 1EETA 4DQRA 2XI3A 1LXNA 1RT7A 4HTIA 2IAJA 4RWWA 1U0HB 1LWFB 2OPRB 2YXLA 4KH1B 2V4JB 4DHVA 4DPTA 1NKBA 1QVFR 1N5YA 2RB7A 4JI3F 2FTRA 4C48A 4DFKA 4RNNA 3DLHA 4D3HA 4F4ZA 1R0AB 2VG5A 3CO9A 3QIPB 1F0XA 3HSGA 3JSRA 3T41A 4FYDA 3ZXWA 1FKOA 3IG1A 3M8QA 3GCXP 4NEZA 4KKOA 4Z7YA 4V19X 2UXDF 3FFIB 4RW4B 4A46A 2HNZB 3DFEA 4JI2J 1KHWA 3OR2A 5JXSA 2FGOA 5J1EA 5M2UA 1IBCB 1JMTA 1WDDA 2JFDA 4C4WA 1R8CA 1NJWA 3OSPA 1RSCA 3CD6S 1UA1A 4ZVUB 1W25A 3FSXA 2C28A 3D3BJ 1XNRJ 2CFXA 1EJ7L 3BO4A 5HMZA 2J9DA 1YKWA 1FCAA
chains in the Genus database with same CATH topology
4EO6A 5KG7A 1C1BB 2OFHX 3W7BA 1HMVA 2JFKA 4YB6A 2MYFA 1IJEB 3KLGB 2VG6A 4E98A 4TYBA 3I9ZA 2DNQA 1KD1T 2AWZA 1YG0A 2UUAF 3CCTA 1X5PA 3NGKA 2K8GA 3FMBA 4C8MA 5KT6A 3KK3A 5A8WA 2YWGA 2AU0A 3JTNA 2N7YA 5K5MA 2J7WA 4R25A 2HNYA 1L5UA 2YNFA 2HFOA 1KFSA 1XMOF 4BWJA 3R5CA 4ES3A 4MIAA 3PKYA 2VODA 2C2EA 4HI1A 1KOHA 1JKHA 2J8AA 3KLVA 3KJVA 4IRDA 1X4GA 4IG3A 7FD1A 4MKYA 3MEEA 1D3WA 4ILLA 3PIOQ 5C42B 4RZRA 1HA1A 1RQ0A 4EO8A 2MQMA 2EWHA 5GAEU 5KFYA 3M32B 3T9NA 5A0YB 2SXLA 5J2MB 4U67Q 2QA2A 3HK2A 4IKAA 4ECYA 3MURP 2K7JA 1WHXA 4JYAF 1DHMA 1U8SA 2E1RA 1LWEB 4ZPWR 1XTZA 2EFOA 4OZJA 2CPFA 1JNRB 1UVLA 2CJBA 1SKWA 4F2RA 4O3RA 4WFYA 2GFFA 2LXFA 2ROPA 2GO9A 2DH8A 3TUIC 3SFUA 5KFIA 2ZH3A 2QFJA 4F2SA 1N33F 1ZTWA 4B3TF 4AQYF 3IR7B 3KKFA 2B7CB 5CH7B 2LYVA 3H8YA 1SJ1A 4LUBA 1XWLA 5KFTA 4XPEA 2RQMA 4DR1F 4ECQA 1GXUA 4MIBA 4OI1A 3TW0A 2HFZA 1S6QA 1UVJA 4IH7A 1S9EA 1ULRA 3K5PA 4O0IA 5KOWA 4DR5F 2MKCA 4DN0A 1VBYA 4ZS6A 2EG1A 3DOKB 3OL7A 2AX0A 1UKUA 1WD6A 1V9OA 2EC0A 4N77A 3U1LA 4DQPA 2QA1A 1GXTA 4NLOA 2KG1A 2DD8S 3NBPB 4Q43A 2V8VA 1S1WB 1X7VA 3EX7B 1Y5NB 3IR6B 2ZUGA 2H5EA 4KIAA 2GIQA 5E3PA 4O3PA 3VAKA 1TL1A 4LF8F 3IC1A 4A4JA 3G6YA 2DPJA 2PDAA 4HTJA 2KXHA 2LDYA 3CJKB 2XMUA 4R5PA 2PEHA 1WTFA 3RAMA 2Y1JA 1RT6A 2KFNA 1TL1B 4QPTA 3IS9B 1LW2B 4NCAA 1HD1A 2ABYA 4B9UA 3B4MA 3OL6A 5ADZA 1TFWA 4MFBA 1U49A 1HYSB 3NRBA 5E0OA 1WWHA 2OSRA 2P9EA 4Q0BB 1U1QA 1VQ8S 3JSYA 2VASA 4I68A 4OJ1A 1PO6A 4IR9A 2DNGA 3CPWR 2I2YA 3LQVA 3MM6B 3TOQA 2L08A 3LUYA 4IFYB 4PG4A 2RDJA 4NX9A 1ZPVA 1GAOA 3LWLA 4O4GA 4ZK7M 3IXQA 3OR1A 2ZJRQ 4KJIA 4QIGA 4HI2A 3PACA 1SQEA 3U1NA 3TA0A 3OFFA 3CIMA 4X4VA 2NUHA 3CE8A 3CCJS 3EZUA 4ITSA 4ZPVR 5HI7A 3VTIA 1HNXF 3KLFB 4DSLA 1CPZA 2YKQA 3MGJA 2ZVSA 3P6YC 3NWGA 4I2PA 4JV2A 2DCUB 3P96A 2LQJA 3CD7A 3FZ2A 2EK6A 2KJWA 2YWHA 1WELA 2JC1A 4ECVA 2OLWA 2KG0A 4FNIA 1IBMF 1TP7A 2HNZA 1HW8A 1TVRA 2ZZMA 4QIFA 3V5RA 2CPXA 1A9NB 4ID5B 2RU9A 4QZVB 4KC5A 2AGPA 3GFYA 2B6AB 2DGXA 2QA4G 1X9MA 3K0JA 2XCAA 5E3CA 2CPYA 5LJ3Y 4YR3A 3GFHA 3EPIA 1LK7A 1R8AA 3HFKA 4X66F 1D8ZA 1Y00A 1RYRA 1VQ6S 4ZCLA 4J9MA 5F8HA 3THPA 2G1DA 4G1QB 3T1HF 2BV3A 2JLFA 4A8KA 3FGVA 2JLGA 3T5HA 2CZVC 3QWPA 4ZCIA 4RU2A 2X1AA 2AJ1A 5FIIA 4NZ7A 2DNZA 2HGLA 4RNMA 1Q1KA 2VPZB 3OTBA 3PDNA 1VBXA 2B0GA 1ZM3A 2QSWA 4QIVA 2OIHA 4ED0A 1S6PB 1NKEA 2M5YA 3H2VE 3DCAA 1FNMA 4I2QB 4F4YA 1XMQF 4B3RF 5J1NA 1Q78A 5KFCA 1QE1A 2KZMA 3CCES 4C11B 3VF0B 3OL9A 4QU6A 3KLEA 2P9CA 3V2UC 4X62F 2DB1A 4MYTA 3OSNA 2W25A 1C2PA 2ZNZA 4RX6A 2FGCA 5KFAA 3K57A 5F41A 5JVGQ 3UCUP 1URNA 2C3YA 4B9LA 1JLEA 1SV5B 2JWNA 4LVOP 4BDPA 3V4IA 3U27A 3TA2A 2KRRA 3TQ1A 4WF9Q 4USIA 4WXWA 4PUOB 3VAFA 2XI2A 4Y28C 4AUKA 2UUCF 4L6V3 2KT5A 4YY3F 1X4EA 2ZHBA 2E29A 3T6BA 1YRUA 4TY8A 1TKXA 4G1PA 4DR6F 1Y3KA 1DTQB 2WBMA 1FD8A 2YQ3A 3RB3A 4CNZA 2BR0A 2OPSB 4J9OA 1Z2LA 3PR4A 5IM0A 2VONA 3CSKA 3LP2B 4DN9A 4J9LA 3H25A 1L3KA 1V6HA 3CJ4A 3POTA 4DV5F 1XC9A 1S1TA 2BZ2A 4OLPA 2ZE2B 2FJBB 3MMCB 3PX0A 5E3AA 5E41A 2VH7A 3V6DA 3SEOA 1FJ7A 3T6JA 4LQ9A 4OZ0A 4W90B 2AJ4A 1VBZA 2VG7A 3DMJA 3DRSA 2YWFA 4JOUA 4KV8B 2JVOA 5HMWA 3BM7A 1FERA 4ZVEA 1VQPS 3A1YG 1T3OA 1U47A 4OZ1A 4OJGA 2M70A 1YJTA 3LH2S 3CJ5A 4M5DA 2KTQA 4LF4F 1LK5A 4DL4A 3I4HX 3NAHA 5J1EB 4ECWA 1ZM9A 4PXDA 4EUVA 3CIZA 2E1AA 2JLEA 4QWEA 4Y00A 3DRPA 1N36F 2CPIA 4O3SA 2XS2A 1IQZA 2NSCA 3M6XA 4WTYA 2W8KA 1QAJA 1ZOTA 3M2RA 4TXSA 4ZCKA 4O3OA 2CQCA 1HBNB 4MH8A 2XULA 4CQ1A 2G0CA 2EFVA 1W2BR 1UW4A 3MAHA 4IOBA 3W2WB 1X4CA 4A47A 4TNOA 3KHHA 2DIVA 4WJBA 3PIPQ 1RT3A 1UFLA 1U24A 2J6SA 3Q2TC 2KH9A 1ZAWA 3PEJA 2XY6A 1F5AA 1J5OB 1HWUA 3L95X 1JLFA 1RP5A 2QO3A 3DLKA 5IZHA 3M8RA 5KFMA 2YKOA 5CYMB 3GWCA 2AD9A 3LOUA 2R9LA 2OPPA 2KZZA 3GQCA 1N54B 2XSJB 4ZHRB 2LU1A 3R1LA 1RT2A 1J2VA 4OHWA 5GADU 1XERA 3MD3A 2YKMA 1J5EF 1Z2ZA 1RT2B 2E5IA 3HI9A 4CO2A 2VL1A 3O6QA 4IG0B 5B0BA 5L39A 1HBOA 2ASJA 1S0MA 2XB2D 1AFIA 2KKHA 2AF6A 3MI7X 2RNEA 3K59A 1ZH5A 3E01B 3BSCA 1CSJA 1NB7A 1M1KT 2G13A 2HHPA 2FUG9 5IM0B 3G6XA 3N6LA 3M32A 5F9NA 2B4PA 3VCDA 2FIUA 3SV4A 2W8LA 4QBUA 5LSOA 4A8MP 1S1XA 1U48A 3RYLA 1ZM4A 2JC0A 2GJIA 3HKZD 2IA6A 2PMHA 3R3TA 2QE5A 4RBVA 2I9SA 2CPDA 1N0VC 4C8NA 1FT8A 2J0WA 1HPZA 2D3ZA 4H4OA 5L9XA 3DYAA 3QZ8A 2KXFA 2GQCA 4HHJA 3LALA 3RBDA 4QR1A 4NOHA 1N5QA 1NKCA 1L3UA 2UV8G 2VOOA 4C8KA 3GV5B 1S10A 3PKMA 4PKDB 3MUMP 5IQQA 3NAIA 5F8LA 3MR6A 1FKPB 2E7WA 2J7KA 4I56A 1RTIB 3MEKA 2P6TA 2DGUA 4N5SA 3K5MA 2MKSA 2GJ2A 2M9KA 2KT3A 1NU4A 1KTVA 1FDBA 2GMLA 2LEPA 3K2YA 4BCAA 4M95A 1RT3B 3ZZRA 2LQ5A 5CA5A 2DO0A 2CQPA 2ZITA 4K2XA 4MFBB 3KHRA 2ERRA 3ZZZA 2M7SA 1G1XA 5LJ5Y 1LQ9A 5A6PA 2UXBF 3LAMA 5A8KB 1FDDA 4K4UA 4NLSA 5DJBA 2E5LF 2E66A 1LW2A 2EFGA 1BY9A 2RMLA 4Y2CA 1UJ5A 1RT1B 3LP0A 1G7CB 2E5GA 4X4RA 2LA6A 4K59A 5A8WB 1WEXA 2MY8A