5DM6Q

Crystal structure of the 50s ribosomal subunit from deinococcus radiodurans
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
publication title Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5dm6Q00
2MQQA 3MURP 1WELA 2MZSA 3VAHA 1Q81T 1KOOA 1HL6A 3NS5A 5ITHA 3PIPQ 1S72S 2KG0A 5GVQA 3THPA 2LECA 3CD6S 2MQOA 1FT8A 2BZ2A 5GADU 2U2FA 2HGLA 2BOPA 2AYGA 1X4FA 5LJ3Y 2M2BA 3IWNC 4QU7A 2DNNA 4CQ1A 3ULHA 1U1MA 1W2BR 2MZQA 1VQ6S 1OPIA 2MZTA 2OSQA 3CMAS 1NJIT 3K0JA 3NS6A 2G1DA 4WKRA 2VOPA 1SJRA 5JVGQ 5BJRA 2HGMA 3R1HA 4QPTA 4WFAQ 3BO4A 3BEGB 3I55S 3J7YU 1D8ZA 2MKIA 1QVFR 3SXLA 2G4BA 1M5VC 1WI8A 2MZJA 1H2TZ 3VAKA 2ZJRQ 2LA4A 2E5HA 3B4MA 2GO9A 3D2WA 2JVRA 2DITA 5IM0A 3R1LA 2M88A 2CPYA 2X1BA 1FXLA 1AUDA 1VQPS 2CQ3A 3CUNA 1JMTA 2M8HA 2MB0B 4LJMA 2DB1A 2RRAA 2CQBA 3CC4S 3S01A 3V4MA 4TU9A 1OO0B 4WIIA 3NNHA 3HHNB 2NLWA 2DNYA 1CVJA 2WBRA 2KXFA 2RVJA 2KXNB 3VAMA 1OIAA 2L9WA 5GAEU 5IM0B 1QVGR 2DGVA 5IFMA 3UE2A 1JJHA 2YWKA 3G4SS 1M90T 2CQ1A 3LPYA 1WG4A 2DH8A 5H1SV 5JVHQ 4OZ1A 2JWNA 2ERRA 1FJCA 1RKJA 1Q86T 3VALA 1P27B 2U1AA 5DDOC 2KU7A 2LXUA 3NMRA 1HD0A 2I2YA 5D77A 2MKSA 3MUVP 3DXBA 2KN4A 2RS8A 1Q7YT 2MGZA 2SXLA 4FXWA 2N7CA 2HYIB 1A7GE 1WTBA 1M5OC 4PR6A 1A9NB 4QQBA 1YJNS 5EN1A 2YKAA 2M8DB 1FJEB 3EX7B 1L3KA 1K73T 2F3JA 2DNPA 1WG5A 2KM8C 2G0CA 3J7ZT 2JVOA 1HA1A 1R8HA 3BS9A 1VQKS 1URNA 2MQNA 4IOAQ 5CYJA 4ED5A 2MQMA 2CQIA 2MGZB 2EK1A 2OTLS 3OW2R 1QM9A 1WWHA 2E5GA 2M4MA 5DDQC 2F9JA 2XS7A 3P5TL 1X4AA 2CPXA 2LCWA 2XNRA 2MSTA 1WHYA 3MD1A 5MLCV 3PIOQ 1U1PA 2L08A 1VQMS 1WHVA 1WEXA 2M70A 2FPHX 2K3KA 2ADCA 4TU7A 3CPWR 2YH0A 1YJ9S 4CIOA 2MKJA 2VOOA 3LQVA 1S79A 2M0GB 2KG1A 3RW7A 1U6BA 2KI2A 3MXHP 4TU8A 3DLLQ 1RK8A 2YTCA 4ERDA 1VC6A 1X5SA 1BY9A 4U67Q 2OIHA 2CQDA 1N54B 3SMZA 5LXRA 3THTA 2V94A 1UFWA 3VAIA 2DHAA 1PO6A 1VC0A 4P6QA 3VAFA 1X4EA 3UCUP 5DM7Q 3CCQS 1SJQA 3UWTA 2DHSA 3VAJA 3S6EA 3G6ES 3MOJB 2MKKA 1U1QA 1X4HA 1H2VZ 2EK6A 4BS2A 2RQ4A 1WF0A 1H2UX 1SJ3P 2DHXA 1WF1A 2LXIA 5DM6Q 1YITS 3TP2A 2DGSA 2AYMA 1FO1A 2MJUA 2DGWA 3G8SA 2KHCA 2CPHA 3VF0B 3G71S 5FJ4A 1U1RA 2MSSA 2CQ2A 1KD1T 4M5DB 2ADBA 2QA4S 4CH1A 4W92B 3BO2A 2DNKA 2KT5A 4CH0S 2RS2A 1SXLA 2D9PA 2LEBA 5CXTA 2D3OR 2XS5A 3JB9k 2MHNA 1VC5A 1K9MT 1M5PC 2MPUA 1X5PA 2DO0A 1O0PA 1SJFA 3B4DA 3MD3A 2E5IA 1UP1A 1VBZA 1U2FA 1VQ7S 2CQPA 4WFNQ 2ZJPQ 4IUFA 3CCUS 3Q2TC 1JJ2R 1N88A 2KVIA 3H2UB 1U6FA 2J0QD 3NNAA 1SJ4P 1R8PA 2DNGA 2E44A 3SDEA 2MY8A 4UQTA 2MXYA 1X0FA 2LQ5A 2HGNA 2FHOB 2AYEA 2FY1A 2XS2A 2LYVA 1M1KT 4OZ0A 3S8SA 5HO4A 2CQCA 2JX2A 2VODA 2DNOA 2KRBA 3CF5Q 1KC8T 3CC7S 2CPFA 2A3JA 2CQ4A 1X4BA 5GAHU 2LKZA 3CCJS 3SDEB 2X1FA 1ZZFA 1U1NA 2DIVA 4LMZA 2GHPA 2QEXS 4C0OC 3CXCR 1X4GA 1F9FA 2DIUA 2HZCA 1IQTA 1ZH5A 2MQPA 3NNCA 1WHWA 4UY8T 2DISA 4F26A 4QU6A 1VQ8S 4W90B 2CPZA 1H6KX 4YUDA 3P3DA 2RT3A 4RU2A 2XB2D 2KFYA 3UCZP 1NU4A 1YTYA 1UAWA 3G96A 1VQLS 3CMES 2X1AA 2CQHA 2CPIA 3G9CA 5LSOA 1U1LA 2CQGA 5D78A 2MJNA 3TYTA 2DH9A 3MUMP 5LSLA 4LIRA 2M7SA 2DNZA 3L3CA 4FXVA 3MDFA 1WEYA 2DNRA 5DDRC 1VQOS 2J76E 2FC9A 3VAGA 3CULA 2CPJA 2RU3A 2PEHA 4Z2XA 2RUGA 2MMYA 2K8GA 1YIJS 3CCSS 3FEYB 2OJ3A 3CCMS 2LEAA 2CPEA 3MI7X 2EVZA 2B0GA 2E5JA 2OSRA 1PGZA 2RNEA 2DGQA 1P1TA 2NZ4A 2MZRA 4V19X 2DGUA 2D9OA 1WF2A 4YOEA 2FC8A 2CQ0A 3S7RA 2XSFA 1KOHA 2DNHA 5GAGU 3CC2S 3US5A 2AYBA 1HD1A 1FJ7A 1N52B 2KM8B 2CPDA 1X5TA 2CJKA 2DNLA 1YHQS 3H2VE 1X4CA 5IQQA 3I56S 1YJWS 1U1OA 1WG1A 1VQ5S 2J0SD 3P49B 2MKHA 2PE8A 1VQ9S 2MKCA 2RQCA 2QFJA 1WEZA 2LA6A 1OWXA 2MQLA 1DRZA 3HI9A 3U1MA 2AD9A 2F9DA 2UP1A 5DDPC 4WFBQ 1YWXA 2O3DA 4F25A 2X1GA 2DNMA 2N3OA 1VBXA 3R27A 2VONA 2YH1A 2L41A 3CCLS 2KH9A 1VQNS 4C4WA 3TO8A 4ZKAA 2DO4A 2J8AA 5GMKa 1DZ5A 1UW4A 2DGTA 1U1KA 1WHXA 1D9AA 2DHGA 1M5KC 2DNQA 1XN9A 3EGNA 3RW6A 2N3LA 2KXHA 1K8AT 2LMIA 3FEXB 4IOCQ 3EGZA 5LJ5Y 3IRWP 3CCRS 2KRRA 1N8RT 3UCGA 2DGOA 4C7QA 2HVZA 2DGXA 1ZZNA 1Q82T 2OTJS 3MUTP 2Q79A 1WI6A 4EGLA 4Y00A 4TLQA 2MYFA 2MY7A 2RRBA 1KQSR 2KYXA 3BO3A 2DK2A 2M9KA 4A8XA 3CCVS 1NO8A 1VBYA 3UD3P 1B7FA 2M52A 4F02A 1JJ4A 3Q2SC 2N82B 1G2EA 2I38A 4PRFA 4WCEQ 1DHMA 4IO9Q 1FHTA 3P6YC 2ZJQQ 3ZZYA 5CA5A 1X4DA 3N9UC 3U1LA 5DETA 2XNQA 3CCES 1DBDA 2DH7A 3UD4P 3G8TA 3CTRA 1YI2S 5HL7Q 2JRSA 2MZ1A 1VQ4S 1X5OA 5LXYA 4WF9Q 3ZZZA 4Y0FA 4PKDB 4YB1P 4J5OA 1FNXH
chains in the Genus database with same CATH superfamily
2IJRA 1S6PB 4F04B 3MCNA 1HL6A 3BGUA 2GAGC 1B0VA 2ZEJA 5K5MA 2UUAJ 2EI5A 2LECA 1WC0A 3PW7A 1LK5A 3FCHA 1X4FA 1DFDA 4CQ1A 1T02A 2MDAA 4F2RA 3KNAA 2PSZA 1OYDA 1QSLA 2BA9A 3UDEA 4IDKB 4DV5J 1HWKA 1APSA 4DFPA 3N0VA 5IM0A 3AOAA 3H2LA 1JLQB 1VQPS 1JMTA 2MB0B 2GQCA 1LFPA 1QSYA 1ROFA 2VPXB 3RG6A 4HI1A 4NCAA 4ZLLA 3KLEA 4I2PA 2MLXA 3UE2A 2YWKA 4YR0A 4LF8F 2ERRA 1S0OA 2RILA 4CLSA 4B9SA 2MKSA 1TUVA 3MUVP 1NCLA 2KN4A 2R2SA 3T5JA 1N48A 3B54A 4DV4F 4ATNA 4ED4A 4ECRA 5DQGA 2JSXA 1F60B 5B0GA 2JVOA 2XWYA 3KNGA 1G1XA 2ATCB 5EGYA 4C3KA 5CCLA 5B0EA 1WWHA 4OI0A 3R7BB 3BV8A 3PIOQ 3BSNA 2UXDF 3R5JB 1MWZA 3HHEA 4CDIA 2AX1A 4DLEA 3NGDA 3HLUA 4Q2MA 3IBWA 1RK8A 6FD1A 4MK9A 4ZS6A 2FVPA 3RBEA 2RRNA 2ZVIA 3CCQS 4J7CA 3PTWA 4B08A 1Q8BA 1OY8A 3D6TB 2K2PA 1ZAXA 3BSOA 3LGNA 1WF1A 3GJSB 5E33A 4OZJA 1FDDA 3V6DB 2EC0A 3LP1B 4ED6A 2WSCC 1FFWB 3V5RA 2V4RA 5F8MA 1NMEB 4CLTA 1H3DA 5M2PA 5J2NB 3R8YA 2VQFF 2J5AA 5KFLA 3UN5A 5E41A 3MMCB 2FD2A 3K7RA 2IBKA 1V3RA 2BJ9A 3GFHA 1M5PC 4J9VA 2MPUA 1CSJA 2XI2A 1O0PA 1SJFA 1NK9A 2R2TA 4K0KF 1JLEA 3MCSA 3GONA 3MEGB 2CQPA 4R0EA 1VDHA 3ADAC 1JJ2R 3QO9B 3GU0A 1SJ4P 1LWFB 2G9OA 3PFEA 2OAUA 3BKUA 1NHUA 4OYZA 3TANA 1JB0C 3MAQA 1XJWB 2A3JA 4DSJA 3N6NA 2QT7A 4LF1A 4RNOA 3DHWC 2RH3A 4DL5A 1NDKA 2UUCJ 2FHKA 3NNCA 4KRWA 3TVZA 2BJ7A 5G0RA 4ELUA 2L48A 1YTYA 5IT9U 4P9SA 1N5YA 4F4AA 1CC8A 4JI5J 2HHXA 2I1RA 3V4IA 3A4TA 3HFKA 3AXKA 1TUGB 2CPEA 3KK3A 2RNEA 1B70B 1RHJB 3M2VA 1FESA 2R7QA 5F41A 2Y8WA 3OHBA 1FE4A 4ECUA 4X4QA 2KT2A 2MLZA 2PIIA 4TYBA 1EHWA 3HF5A 2JZ5A 2HFUA 5HK4A 2N3OA 4CNZA 2ZH2A 2OMOA 4YDXA 3GE9A 4PEOA 1CULA 4Q44A 2ZH7A 2NZCA 1LXJA 3AD8C 4UOHA 4ER8A 1S1WB 3FCVA 4P2FA 1HQEA 2R8GA 2DGXA 2KJVA 4F67A 1M5HA 4TLQA 3THVA 2FJXA 1Y9OA 3E8OA 1NPPA 1NKBA 1JXLA 4F02A 2WRMA 2IVFB 2N4CA 3ITHB 4USUA 3KHHA 2C42A 5DETA 3OFHA 3CTRA 5HL7Q 3C14B 5HATA 2FIUA 2GIRA 2OPQA 5HN0A 5HP1A 4JI0J 2VG6B 5GVQA 2G13A 5ETOA 3THPA 2MQOA 2J9EA 2BVZA 2OELA 5C25B 4P71A 4QU7A 4MFBB 2OPPB 4KH1B 3CCWA 2B4OA 1U1MA 4ITSA 1HBNA 4NZ0A 4OQJA 1S9EB 1S99A 4LFAJ 4B3OA 4NCGB 3KJNB 1N56A 2E5LJ 4HHJA 3MEDA 3LTOA 3GG1A 1M5VC 3PEJA 2ZJRQ 2UUBJ 4PXBA 9ATCB 1FXLA 1AUDA 3DOMB 3CDWA 5FD1A 1WC3A 4ZJOA 5AJ3J 4NLPA 4DQPA 1QVGR 2AGOA 1KTQA 1SJ1A 3TJ8A 2IVMA 3SCKE 1WG4A 5H9FJ 2XO6A 1K47A 2Q6BA 4ID8A 4YMEA 3TQ1A 4NLDA 1RBAA 1DLOB 4M8LA 2W8LA 1AW0A 1A7GE 5J1EB 2W2PP 3EX7B 4XO0A 1Q16B 5KFIA 3MPDA 2HHVA 3RAQA 4DSEA 5B0AA 4F4YA 3ISND 4PG4A 1CS4A 2HIYA 3KOAA 1FD2A 3FK4A 1EIYB 1T9TA 2VOOA 3W8PA 4CLZA 4TU8A 1GQEA 4JI5F 1N54B 1RYRA 4M5IA 6AT1B 5DM7Q 2NYIA 4TKTA 2HK3A 1GH8A 1NKEA 1FDNA 1H2VZ 2EK6A 2UV8A 4M5DA 3IM9A 1C1CA 1PAUB 1PJ6A 3DRPB 3RUBL 2RJZA 2F8HA 1XTZA 4KC5A 2ZC3A 2CWKA 4KGVB 1Z2ZA 4QYRA 2ADBA 1M0SA 3ZXWA 3GFXA 3FFIB 2PGCA 3I31A 5E3PA 2D3OR 3JSMB 4AQYJ 1FNMA 1V5IB 1X5PA 4YR3A 2XMAA 2E5IA 1VBZA 3POTA 1YBAA 4HTIA 4CLFA 3N79A 3Q2TC 2VC1A 5KG0A 5L1JA 3RBZA 4JV5J 3BPSP 3NGUA 2J0QD 5HJYA 2KZMA 1TL5A 4QIEA 2MXYA 1RAOA 1NDCA 1HFEL 2XSJA 4Y34A 1IVZA 3N01A 1S5ZA 1ZZFA 5HQMA 3ENVA 3RRKA 4J9RA 4NLVA 4UY8T 3DLHA 4A8FA 1RT6B 4W90B 2YX1A 4EFAC 2KFYA 3GIIA 1RTIB 1JLAB 3I5AA 2CQGA 4OI1A 3CIZA 3RBXA 3FRZA 5FIIA 3OR1B 3GILA 3CULA 1OY6A 3I6PA 3T6JA 2FB0A 4OJ1A 2HBQB 1JNZB 5JXSA 4IDKA 5U47A 3HULA 4A8SA 3UPFA 1REGX 3C6UA 3HXMA 2D9OA 1WF2A 1XK8A 1ZAWA 3S7RA 1Y11A 4WYLA 3NBPA 2ROEA 4X4NA 2XZWA 3UD5A 2DNLA 4OFZA 2UUBF 3MECB 3IBFB 2F8EX 2PMWA 2G2YA 4DF8A 5AJ3F 1Z1ZA 3Q8QB 2I9SA 3UFCX 2L41A 2FVCA 4JI4J 3PRVA 3IRXB 1S6QA 2RE1A 1NB2A 4C8NA 1FXRA 3LWMA 4OJHA 4JV2A 4G1IA 2LP4A 2P9EA 2J6SA 2RKIB 1OMSA 2O1PA 2LQBA 4TNOA 1DY3A 4I56A 4I6AA 3H5SA 1VBYA 5SUHA 4CWBA 4M63A 2CFXA 2Q1LA 3WIVA 1NK6A 3HJVA 1U25A 3D3CJ 3KK2B 1VRUB 3QRQA 3ZZYA 7AT1B 4OX9F 4WP9A 5CA5A 4NLXA 2DH7A 2MZ1A 4WFZA 2C2KB 3GV8B 3AB2B 2C2DA 4PKDB 2YQ3A 3DI6A 3BPDA 2HHHJ 3ILOA 4DQRA 2AWZA 1X7VA 5KFBA 3V6KA 2KG0A 2EXUA 4AUKA 1WC6A 2HGLA 1KHWA 3ULHA 4WU3A 1TK0A 4ED8A 5JVGQ 4E8UA 4RR5A 2E9ZA 2Z56B 2ZZTA 4WFAQ 3FRYA 3L95X 2Y1RI 2WSEC 4EO8A 5AE2A 1WC5A 5J2NA 1D0EA 2HWHA 3K57A 2HG4A 2ZBIA 4ZVOB 4I69A 3NS7B 3W5ZA 3DKDA 4LBHA 2LDYA 2Z58B 4RW8A 2KXNB 4AQYF 3NRBA 1IKVB 1HNXJ 1IKWA 1GNKA 1S12A 3FBFA 2W7OA 2C2MB 3QO9A 1LWFA 2F7VA 4RBTA 1S6UA 2BABA 2ASYA 4JV5F 3UN3A 5K8OA 5AXKA 5DG7A 3MM8A 1Q8KA 4X4OA 2WHOA 2B5JB 4Y2MA 4B9LA 3CJ5A 4QQBA 3D28A 1R6YA 1K73T 2DCLA 2C28A 4JI7J 2JHEA 1HA1A 4F8RA 3HDSA 1NAQA 5IV4A 3KG0A 4M5GA 3FKBA 2EK1A 5J1PA 4O3RA 5A8RA 1EKSA 2IIHA 4ZPCA 2BJ8A 3P5TL 1KSPA 1TL7A 1KWMA 3ENWA 2B3TB 3I82A 1YK9A 1GTEA 5HMWA 3TA2A 3P8BB 3TEGA 1VOMA 2HS4A 3K17A 3DLJA 3OTBA 3EZOA 3D0GE 3TA0A 5K8MA 4I2QA 1PJ7A 3H42A 1T95A 3QT8A 4JI1J 2QLJB 4DG1A 4ZVQB 3BBBA 3H25A 2R9LA 3WC2A 3TP2A 4IH7A 2QV6A 1R0AB 2L9NA 2KT3A 4YB5A 4QWAA 4OYAA 1OJ4A 3R97A 1KD1T 3GIRA 2C2ZB 2X3DA 4NLRA 4ETXA 5EWGA 1IKXA 2GQ2A 4DWIA 2XQCA 1TTHB 1S1WA 4JI4F 3MR6A 1M5SA 1U2FA 2ROGA 4WFNQ 1GEHA 3MWBA 2YNHB 2RDIA 3C2PA 4BWMA 3LANA 3DFEA 4Z7YA 1RAIB 3MMAB 1T9WA 2F65A 3M6WA 2BQUA 2QMXA 4OX6A 3SDEA 3ITHA 2MY8A 3L4BC 1SC3B 5HLFB 4FNIA 4GRSA 3G6VA 3W61A 2CQCA 4EZ9A 2KO1A 2UUTA 1ICEB 2AJ0A 4C2MA 3TZWA 2W2QP 2QEXS 3EPGA 3J7A1 1BUXA 1S1UB 1ZH5A 1Q95G 2VG6A 1PYOB 4U96A 1RHMB 4ETZA 2JL9A 3HP6A 3P3DA 2DPJA 2HHHF 3G9CA 2CNNB 1FKPB 3CJTA 3M6UA 3O44A 1ZS6A 2A10A 5E0OA 2ASDA 3JYTB 4K5RA 4Q8FA 3PYGA 2VPWB 3TAPA 4C8OA 2J76E 1KFSA 2FC9A 4KYZA 2CPJA 5KFGA 4JBCA 2B9WA 4X62J 2OSRA 1RT5B 2MZRA 3I87A 2XSFA 5IZHA 1UWBB 2D69A 2DNHA 5IQQA 3P49B 3C66A 4P75A 4ZIWA 4WJBA 1S0VA 2O3DA 1PJ5A 4Q0BB 2ZBCA 3MTJA 3BDPA 1HNXF 1D1UA 1O5JA 4EYHB 5CYQA 4Y2IA 4DUTA 1AYEA 1C4AA 2J8SA 2AGQA 1P8GA 5DG9A 5KG4A 3R9LA 1DLOA 1SKSA 2PFDA 2IA6A 5KFRA 1MMLA 3NAIA 4KHPJ 3K2YA 3PW2A 1SKWA 4C7QA 1ZZNA 3KK1A 2P2CB 4RUHA 3OTOJ 8AT1B 2PEBA 3CCVS 1I94J 4JI7F 4FPIA 5I3UB 5KOXA 2I38A 2AU0A 2ASJA 3HMJG 4HYKA 2GJFA 2D3ZA 4MAKA 2IC3B 1X9WA 2FJDB 3WX8A 1C0UA 2HQCA 1RT1B 5L39A 5L8RC 1S72S 5A8KB 2J9DE 2Z2ZA 3A8JA 2OEJA 4L76A 1PC5A 4JI1F 4RW4B 5J2PA 3T3FA 2V2VA 4FP9A 1JLCB 4NMLA 3CJ0A 3QMQA 4NOHA 1YVFA 4O0NA 2DR6A 1FDBA 3BO4A 1IM4A 3QGGA 1ZPWX 3C19A 3MOZA 4KT0C 1F0XA 2MZJA 2PO4A 2KHDA 4DUZF 5THWA 3NGKA 1VRTB 4A8MP 2M8HA 2O67A 4G3IA 3IN5A 3CC4S 3S01A 1YRTA 4OYMA 3LAKA 2DGVA 4RNNA 2Q66A 1JJHA 4CLPA 3V81A 4J9OA 2WZ1A 1GXTA 4N8NA 5JVHQ 1RKJA 1P27B 1HPZA 3FEZA 3X1LB 4YB6A 2HYIB 1OY9A 1WTBA 4DJBA 5EN1A 2YKAA 1H38A 4PYAA 4IOAQ 4IQXA 3KJFB 5LOQA 2OTLS 5B7WA 1T9VA 1R8BA 2LCWA 2YWWA 1RTIA 5MLCV 4DSFA 3BKFA 5I3PA 1FRKA 1U4BA 1WEXA 2C2EA 1XR6A 4ZPBA 2YWEA 1RAAB 1YSJA 3J80U 2M0GB 3RW7A 3OR1A 2KI2A 4FPRA 3DDIA 3MEEB 3JTPA 1T9XA 3MCOA 2LXFA 1X4EA 1R0CB 3RB3A 2PA3A 5HVHA 1R0BG 3VAJA 3W9IA 4W4MA 1WJ9A 1X4HA 1H72C 2VASA 5F8JA 1NXIA 3IGVA 2NR0A 2AEJA 2YKNB 1TVRB 3PO5A 4MKVA 4X66F 1BHNA 2LFVA 4EBEA 3VF0B 3PR4A 1HMVB 3L7PA 4ZLJA 4M5LA 2HLTA 1U0SA 2HS0A 5DQHA 3JS9A 4CH0S 4LFCJ 1Q8LA 3D3BJ 2ZDPA 3EYZA 5K20B 3SBMA 2KVQE 4FS1A 2P6SA 4BC7A 1SUQB 3D1QA 4B3TJ 4OZ2A 4FYWB 3KLIA 4KHPF 4EMDA 2KVIA 1XERA 3LGHA 3MPUB 3NL0A 1TAUA 1IBMJ 3OTOF 3H40A 3I0RB 4DMZA 1OQ3A 1U45A 1S48A 1HW9A 5CYMA 5BXIA 1T05A 1KC8T 4GO7X 3TX0A 1UJ5A 5MAOA 3A3OB 3MR7A 2HZCA 4PWDA 2K1RA 3D54A 2OKQA 1HQUB 2A6MA 2NUUG 2GIFA 3SSSA 3LO3A 4WK3A 4AE5A 1IBKJ 4PPDA 1YBUA 2HSEB 1HWLA 2ROPA 2ZNYA 2QA1A 1IJEB 2RDJA 3QIDA 2HVEA 3TQEA 4AFFA 3K8VA 3GLJA 2RUGA 5E3QA 1I51B 1YIJS 1K44A 3MI7X 5DGAA 4BDPA 1F9EB 2ZH6A 4CNYA 2FC8A 4LQ9A 4KTQA 5GAGU 4ZVUB 1IM6A 4WZMA 3DOLB 4USIA 1OWXA 4BBYA 3VWSA 4OZ3A 3N6LA 1FWKA 1RTHB 3CCLS 4AT1B 4B3SF 1UCNA 1XN9A 2A2CA 3MZIA 2B5JA 1NH7A 1NLKL 2BRKA 3LH2S 4MIBA 3DNCA 3AOBA 3OXFA 3ZZRA 3UCGA 4WYWA 1Q53A 2YX7A 3U7JA 3MUTP 1FRHA 1WI6A 3AA8A 2ZH8A 4B17A 1JK9B 1N36F 1U2RA 1BE4A 4DUYJ 4IO9Q 5DZ7A 3VQTA 2AZ1A 2UXBJ 2AHOB 5CAAA 2FUG9 2H9ZA 1GMWA 3JTNA 3O5TB 4Q2LA 4P7VA 4NYZA 4CO4A 4HL9A 4DV3J 1U0HA 5A2QY 3I0SB 3FCWA 3W62A 2X3GA 4FS2A 1KOOA 4UQGA 2IM2A 3Q83A 3ZZTA 3VCDA 2QGFB 5JJBA 5I4MA 1J27A 1EARA 4F0HA 3GPAA 4NMXA 4ZJQA 3GV7B 3CMAS 1NJIT 4K50A 1UEKA 2V5HG 3I55S 4KKOA 4JB8B 4KFBA 5HVGA 1IBCB 1V5VA 1QTMA 3D2WA 4MH8A 4J9QA 3AHPA 4OX8A 1RWUA 3IS9B 2DB1A 4LFCF 2F8MA 1QUVA 4ECZA 1QE1B 4WKYA 4USVA 3D6HB 2YNHA 1RHRB 3P96A 4WFXA 4B3TF 2C3UA 3Q0AA 1MMNA 3HHLA 3NMRA 3TEHB 1RWWB 4NE9C 1CJKA 2QRRA 1IBMF 1KN6A 3ZTQA 1TR0A 4Y65A 2KYZA 4F36A 4Q7AA 1A9NB 3AJ2A 2VPZB 2YQ0A 3MPVA 2BM1A 1XR7A 3HVRA 3IGNA 3W65A 4O3QA 3HVTA 3MPYA 3M9OB 1AUSL 1UVLA 1X4AA 4ZCLA 1NK0A 2COLA 3OTCA 3EM1A 1NSPA 2K3KA 2JJ4D 2IYGA 2XC9A 4TU7A 1IBKF 3JYTA 3HVAA 1S79A 2FTRA 2HNZB 3TA1A 4CT8A 3HD1A 1AZSA 2DHAA 3EMTA 1VISA 1RWVB 1RT5A 4XDDA 3JXOA 5JUMA 1UVKA 4IRCA 1HBUA 1CQNA 4JUZA 2V8HA 2I8EA 2NXEA 1FO1A 2H1YA 4RO0A 2HMIB 1C0TA 3FBEA 4GKJJ 3OVAA 3KJVB 3KTQA 4DI6A 1SC6A 4A8OA 2DT9A 2D9PA 5D6GA 2XS5A 3HZGA 3IWXA 3M7VA 3BF4A 3D0IE 3SSQA 1JLBB 2ZHOA 4XAKA 5KFZA 1Q4RA 1UP1A 2JH3A 1VQ7S 3ZO7A 3W63A 2CNOB 3GJRB 1N88A 1S9GB 5IT4A 2W9CB 3IC1A 3LW5C 4URGA 5I3UA 2N4DA 1IN0A 1TZ0A 2HWIA 2QA2A 5DG8A 2V8PA 5B0CA 3D6MB 3QSYB 4DR1F 3S8SA 5GMDA 4FBTA 2XGQA 2DNOA 3LP2B 5CHCB 3BGOP 2IC3A 2UXBF 4J9NA 5GAHU 1KVKA 2GHVC 2GHPA 4C0OC 5KG6A 3HSJA 1LK7A 3EVOA 5FLXU 2DISA 3KG4A 1U2CA 4P73A 3BR9A 4DQIA 4DV3F 1TKZB 4B3MJ 4QPXA 3W2WB 5EUHA 2W8KA 1IJFB 4URQU 3MUMP 3T5KA 4RW4A 3T5HA 3JSBA 1JLCA 1N6QB 1VQOS 4F0KA 1KLNA 4B3RF 2OPSA 1HARA 5D4NA 1UL3A 2V6AA 4ID5B 2EVZA 1MROB 4C3LA 1NJZA 4C8YA 3RBDA 1KS2A 2J0WA 1HW8A 1VMBA 3T5LA 3MM5B 4O4RA 1VRTA 3DCAA 1PSDA 1FJ7A 4KGKA 5KT6A 2OMLA 2DR7A 1L3VA 3H2VE 1U1OA 5B0DA 2MKHA 3H90A 4HH1A 2RQCA 4FF4A 3HI9A 2F9DA 4A8KA 3RB4A 4F25A 1KDNA 4ZP7A 4USMA 1UWAA 2VONA 4ZCKA 4A48A 1RWOB 2HFSA 2DYAA 3ZTSA 2ZE2B 1RUSA 4IQMA 2RIJA 1BQMB 3ET6A 3Q22A 2KXHA 4GVBB 3D0HE 2E66A 3I5CA 2POKA 2Z8QA 2DEIA 2MYFA 4TQRA 1KQSR 2D74B 3PW5A 1F6TA 1N5SA 2B7BB 1WC1A 1G2EA 2OO4A 4ZVHA 1FHTA 3P6YC 2ZITA 1TL4A 3BN7A 2J7KA 2C2OB 1FX4A 1IUJA 4ICLB 4NYOA 3MEEA 4RW9A 3D6FB 1CJVB 2VJUA 1FNXH 5F8NA 4LSNB 1RTDB 3VAHA 1S7IA 4HHUA 4QWBA 4NRUA 3KXDA 3KMQA 2RF2A 4U95A 5GADU 4FBUA 4NX9A 3OT9A 2DNNA 3M8SA 2YKNA 1TVRA 1LFWA 1Q0NA 1K1SA 1SJRA 5A6PA 1MMDA 1NHKL 2Y0SD 2FHJA 3T1YJ 2G4BA 1JWWA 4GKJF 1H2TZ 1HHQA 3J81j 4ILMA 2DITA 2BV3A 3GB0A 4PUOA 5F8GA 1FK9A 4NL5A 1ZBTA 2HQFA 4ZHRB 4TU9A 1KFDA 3DGVA 3HHNB 1SUQA 1CVJA 2WBRA 4CLLA 4DX6A 5A6WA 5IM0B 3JAMU 3PW4A 2DCUB 4MKAA 4RL1A 2YWGA 2DEJA 1FTCA 4FYVB 3NOCA 5IT9Y 3VALA 3I0RA 4X4SA 3Q8SB 4NA1A 4O44B 3KLEB 3CT9A 2RS8A 2WVFA 2MGZA 3W9HA 2B4VA 5IWAJ 4OZ5A 1M5OC 4ANDA 4QYZK 1RWPB 1ZM2A 1EAYC 1SH2A 1LW2A 4KE5A 3EXYA 2F63A 1HQUA 1EETB 2M4MA 1VYAA 2HHUA 2FVQA 1RGVA 1U1PA 2HFOA 1G7CB 1WHVA 3EXCX 4DHVA 3K5LA 2GO8A 3MR3A 3M2UA 4R8UA 2YH0A 3VVTA 4F0MA 1TKTB 1N0UA 3QT6A 2B4UA 4O0IA 4GVLA 2GFFA 4RZRA 3NGSA 2NSBA 4ES1A 3EGWB 2WOMA 4G1QB 4PZVA 1WUUA 1TL3A 1UVNA 1NJYA 2PA8D 2DHXA 5L1IA 2V8DA 4KV8B 3MM9A 4HR2A 2PI4A 4QW9A 2QLXA 2FDNA 1X0PA 3SZ2A 1XR5A 2DRDA 4FZVA 4WTYA 2QG9B 3IR5B 1RTHA 2E7VA 3V6JA 5T41A 2QC3A 1F5BA 3CO0P 4FKXA 2VFSA 2VB6A 1RHUB 1LEOA 1UPMB 3DDKA 5KFOA 3QRRA 4E98A 3CNQP 5E5NA 4CTAA 5EWFA 2IY5B 1U6FA 2ZFHA 2VJVA 2JEIA 3NNAA 5ETLA 2QZ8A 3N28A 1JLEB 3GYGA 2RMLA 4ED2A 3PW0A 3FJ2A 2QIFA 4ZP8A 3OV7A 2X1FA 4Y3CA 2YWFA 1S4FA 2HVHA 2OGUA 2DIUA 2ACMA 2R7OA 1IQTA 4AL5A 3I0SA 2VBYA 2A1BA 3BBCA 1DQ9A 3SFUA 2RD5C 3BJYA 2DRBA 5HROB 2CPZA 4BHQA 1Q5YA 4ANEA 4O3PA 4I68A 2OI2A 1TK5A 4DZDA 1F9HA 2QYGA 1NK8A 1VLOA 2ALYB 2C3MA 3PV8A 3N5BA 2V8GA 5F9LA 3CD5A 2W24A 5HVFA 2RU3A 2J9DA 2YX4A 1QJHA 3KG1A 2IFXA 3MM7A 1TMMA 2D41A 4K5SA 2XYHB 3V4IB 3K8WA 3B6BA 4X65J 4IH6A 2CJKA 2VFRA 1SL1A 2H65B 2ZDOA 3KK3B 3D1OA 4WE1B 3J7AN 1HBMA 4F3OA 4NCBA 4NASA 2YH1A 3KMSA 3NOGA 3OSNA 4FYDA 4ZKAA 3GQCA 2ZWOA 2ZOGA 1OPZA 2QL7B 3QAEA 3HKZD 1L3SA 1B99A 3PDNA 2CYYA 1DQ8A 2GMJA 1Q82T 3G87A 1CULB 4Y6IA 2G1HA 3CIMA 2RRBA 4CT9A 2DK2A 2M9KA 3K5NA 1NO8A 4H4KA 4EK2A 1HQEB 4HLBA 3GIKA 1S1XA 4FYYB 4O4GA 4WPAA 1SL0A 3U27A 3CCES 3PHEA 1VQ4S 1FCAA 3TUJC 4DR6F 2V50A 1G4CA 2MZSA 2KB2A 1UTAA 3A1YG 2RHSB 4NLTA 2EEYA 5KFEA 1FXDA 1TUWA 2OPQB 1TELA 5ETKA 1N32J 4PXDA 4DQQA 3ILLA 3D66A 2VQEJ 5AT1B 2HMIA 4PXCA 3KJVA 5GAHI 3MEKA 1TL1B 3AH6A 1YRUA 1QVFR 5KFAA 2YKPA 1HBNB 4EBDA 3VAKA 4B3OB 3B4MA 4YFUA 3HM9A 3D4JA 1HYSA 2P9CA 5IV3A 2XZDB 5C24A 1R8AA 2DNYA 2Z2YB 3C16A 3IMQJ 5I42B 4DXLA 1XEZA 2W9CA 1YJRA 1BLUA 1LQ9A 1Z2LA 3KLFA 2JWNA 2OFHX 3AY0A 2ZH1A 2LU1A 3BGLA 3FGVA 5KFDA 2CAJA 3UI3A 3LP2A 4PR6A 1GFWB 3AA9A 1FJEB 4LRAA 2W2OP 1T3NA 4DR7J 1BWVA 2AEMA 1FKAF 3QYYA 3BS9A 2VICA 4PWWA 2AV5A 4ES2A 1LXNA 3OR2A 1VS3A 1QM9A 2YKOA 4KY3A 1H7WA 4OHYA 2IVYA 3DOKA 1JLGA 1NHVA 2BDPA 4A8WA 1UA0A 5A76A 3TAQA 4EI2A 3MXHP 3DLLQ 3LALA 3NWRA 1Y10A 2OIHA 2BW2A 2CQDA 3FQKA 4DPTA 1CS4B 3W64A 4ID5A 2WB4A 1PO6A 1VC0A 4CLKA 5HQ8A 2V2ZA 2H4WB 1WKLA 3MM5A 3T41A 3AXMA 3T6BA 4DSKA 4X4PA 2CKWA 2GQQA 1XNQJ 3CD0A 1RAGB 4DL0C 6FDRA 3MFHA 4PYDA 4X65F 2GGPB 5AE1A 2HFNA 4H4KC 4M5DB 1C1CB 2R8KA 2VG7B 2ALZA 3N4WA 3VZHA 1BQMA 3DLGB 2HFZA 5GADI 1UW9A 2DY1A 4N7TA 4N5SA 2GW8A 4ES3A 3GV5B 3R2CJ 1WKJA 2HZAA 5E7OB 2X51A 3UNYA 3DN9A 3AFGA 4UQTA 1CQMA 3M30B 3VVUA 2RHQB 4F4ZA 2FY1A 2L3MA 1KHVA 5HO4A 2JX2A 3R5BA 3VZIA 4W98A 4LFBJ 1U1NA 4GC7A 1X4GA 1F9FA 2IM3A 3UVJA 2AP6A 1RTDA 3BYPA 4P10A 4JI2F 4IR1A 1UAWA 3G96A 2CPIA 5A0YA 3MMBA 4NLOA 2JLGA 1N34F 4ZVFA 3CEDA 4ZPTR 4ECTA 2WW4A 3IFEA 4EU0A 3D5MA 4PCQA 4EO6A 3LF0A 3FEYB 1J5EF 2ZD1B 2EG1A 3A8IA 2DGQA 4ECXA 5ETQA 5F0UA 5LT5A 1AROP 4D3GA 5L38A 2NPIA 4E2FB 2QLBB 4UTGA 1TP7A 3ZC4A 3BGFA 3DDNA 4ZHRA 2QX0A 3C6UB 4IFYA 3OXLA 4JV1A 1WEZA 4HTJA 5F8IA 2VHGA 2UP1A 5DDPC 2FQQB 3NBPB 4QZVB 1VBXA 4ZVSB 4OYIA 1Y5IB 2JC1A 5KG3A 4O44A 1V3ZA 1I5OB 1D9AA 4JV0A 1M5KC 3TVKA 4B02A 1RCOB 1X31C 3IRWP 3H98A 1EP4A 3PCOB 1ZM4A 4DV1J 3L9ZA 5K8PA 1S6QB 2HAIA 4Y00A 3N5FA 4DR7F 4A8XA 1EETA 3QNWB 1VK8A 5C2CA 4PRFA 5CQGA 2B6AB 1T03A 1LOUA 1DTTB 2Q6CA 3G2XA 2ZHBA 3NKYA 4H4MB 2XNQA 3HT0A 1TKTA 1DBDA 3EE3A 5BR8J 1RXOB 9RUBA 2HNDB 1V3SA 5J1NA 1YG0A 4G1QA 3TVYA 5LSRA 3QATA 3OLBA 1PIEA 4CYUB 4RWWA 3IWNC 3DI6B 3QGHA 4KV8A 4MK7A 4J91A 1P6TA 1CJTB 2C22A 4LF5J 2V8VA 1D09B 3K0JA 1RT4A 1W26A 1XNQF 1AXQA 1UVIA 2OH2A 4P52A 2V4QA 1KKHA 4XTTA 5J2MB 2J6TA 1R89A 5D0RA 3LGMA 2QMUB 1WI8A 1UVMA 3R6GB 3M6VA 3X3UA 2BJEA 4A4JA 3G82B 1FRJA 4OYOA 1Y5LB 3A3PB 1HQ2A 3GFYA 2C2NA 3M8QA 2YPZA 4DR4J 4DV6J 3D67A 2HS3A 2G2ZA 4RW8B 3QWPA 2UXCF 4N76A 3IA0A 5D77A 4IRKA 1Z4UA 1MN7A 3GYNA 1IKWB 2SXLA 2N7CA 4KH0B 4LVOP 4KPCA 2RQKA 4CO1A 2GVDA 1WG5A 2KM8C 1NRKA 1UZHA 4NA3A 2HW3A 3CJKA 3FDSA 4ED5A 3MM8B 1Q5VA 4LFBF 2E1CA 2WVDA 2MQ8A 5HROA 4GKKJ 1NDLA 2IPOB 2UU9J 3EPIA 4UOCA 2EFNA 2Y1LB 1NZ8A 4RU9A 4OMFG 5A8RB 1TL7B 1RACB 4OJGA 2WTFA 3CCZA 1X5SA 2FJBB 2V94A 3OXGA 2E7XA 2UUAF 2BKOA 2WK4A 3G6YA 2DHSA 1NM2A 5IC4B 3PJXA 4CO5A 2JDJA 5KFHA 3IR7B 3T9ZA 2E1RA 2V68A 5T7LB 2XMMA 1YDLA 4I2QB 5KG2A 1KLMA 4WE1A 1Q1KA 2OPRB 2KHCA 1HI8A 5L1LA 4DG1B 4GC6A 4DV5F 1O6XA 3D1HA 1NNDA 2EWHA 3GSIA 4U8VA 3BO2A 1IXKA 2BUNA 1JNRB 2MHNA 1CC7A 3PKYA 4FF1A 1T94A 2R7XA 4K7QA 3TNVA 2QO3A 3MD3A 3D68A 2FZCB 1RU1A 1IKXB 1QAYA 2EFVA 4ZPVR 4IUFA 3OFEA 1L3TA 3RR8A 4DV0J 4DV1F 4A8YA 2B56A 1X8DA 5DGBA 3UNGC 2LQ5A 2XS2A 1Q79A 4ED3A 3QBCA 2QSFA 2E9RX 3FBCA 1ZA2B 4GMKA 3SQGB 1DJ0A 3SDEB 4M94A 3UO0A 3OQ2A 3T19A 1VFJA 1WC4A 2JEGA 3KFWX 2WONA 2F4VJ 4YUDA 5KFQA 5LSOA 1U1LA 5D78A 1GXUA 3TYTA 3HSDA 3OD2A 1ZM9A 4L3KA 4PG7A 1SIWB 4QCLA 2ILYA 4C3MA 4LF5F 1TL1A 2IHR1 4J9UE 2LEAA 2B0GA 2E5JA 2KZZA 3HX9A 4LF2A 4YOEA 4RUAA 3CC2S 1YJWS 2DRAA 1VQ5S 1CPZA 5I42A 2LA6A 2Z4PA 3NG8A 1RE1B 5C42A 4YR2A 2VZ9A 3K5MA 3WIUA 3MTKA 5HBMA 3JQJA 2EFGA 2JNJA 2RB7A 3HO1A 3TARA 4DOZA 4DV6F 2W9AA 3DMJB 1N0VC 3J80Y 3F73A 3Q8PB 1UZDA 5KFXA 5CYQB 2DBBA 1YLXA 4RLEA 4LUBA 2HHTA 4KHMA 4DPUA 1RADB 1TV6A 4JI3J 3BO3A 2DJWA 4K4VA 2N82B 4RX6A 1YRXA 1DHMA 3KK1B 4GKKF 2EBEA 3N9UC 2UUCF 3G8TA 4DN9A 4YQWA 2E29A 1WELA 1Q81T 3QAUA 4AXIA 3DRSA 2RQMA 2BZ2A 2U2FA 4BLGA 4J9SA 1JKHA 5E2QA 2BOPA 1C0UB 4OHZA 4JI8J 2F4FA 1NJXA 1SV5A 3O2IA 3I9V9 4U6PA 4EBCA 2DY9A 4WKRA 2GGPA 5K9FA 3PKMA 3J81U 2D7SA 1B7YB 2AF6A 3BEGB 1R31A 2BE7D 4K4ZA 2VG7A 5J2PB 2OLWA 2PD1A 1RT2A 2CUYA 4OHXA 1XMBA 1KONA 1KNZA 1F3FA 1WACA 3TX8A 4DPWA 3DLGA 4HH0A 4RUCA 1QD1A 1NJWA 3TUPA 1OO0B 3CD7A 4ZIVA 2CNKB 2BRLA 2VFTA 2G0JA 3MM6A 5B08A 1UA1A 5BYQA 4F4WA 3CJSA 3PY8A 1FNOA 2V9WA 2R7UA 3M30A 2KU7A 2E7WA 4DV0F 1Q7YT 2GX8A 4FXWA 4PXEA 3V81B 5ETSA 1YJNS 4PAAA 4IG3B 3HCXA 3J7ZT 4JP8A 2XG8A 1VQKS 1WDTA 2MQNA 1HPZB 5CYJA 1EQ0A 2CQIA 4OI3A 5A8WA 3G86A 3OW2R 4ZOSA 1R7IA 1JJCB 1U8SA 1R6VA 4X4TA 1D9DA 1LV5A 3PG9A 3RRHA 2UVWA 3CPWR 1QAJA 5HJXA 3EJMA 3DLEB 1TKDA 3LAMA 1KP6A 4JI0F 2KKHA 3F44A 4RWXA 2OD6A 1HHTP 3KYLA 4KR0B 4ED0A 4P6QA 1FKOB 3JSYA 2HHQA 2ZD1A 4YY3J 1B0TA 2EW9A 4AYBD 1FA0A 1U1QA 1RT3B 4PQUB 3TOQA 4P2XA 4DU8A 4LFAF 3OHAA 3DRYA 4N8OA 2V34A 1RAJA 1T3OA 2E5LF 1ZYQA 4EZ6A 3ETMA 2KTQA 3IAM9 3DU5A 2BXJA 3VTIA 2CQ2A 2UVUA 1NDPA 5ETVA 1KBRA 4OYBA 2QA4S 2KFNA 5HSPA 1P9QC 2RS2A 5AE3A 3JB9k 4ZCMA 1RWNB 3BSAA 3BSCA 3DRRA 2H51B 3R6LB 4YS2A 1RBLA 3CCUS 1JX4A 1RI7A 1U48A 4RNHA 2B6AA 3F0NA 3Q24A 1DTTA 4K4YA 3KLIB 4H4MA 1YJTA 3LUYA 2CQ4A 4HVZA 2YNIB 4LBIA 3ONQA 2DIVA 2HNDA 2DD8S 2RAQA 5CYMB 1T05B 4CYUA 4DF4A 2X1AA 1QSSA 3R2DJ 2MJNA 3NGRA 4PWDB 1PBUA 3L3CA 1CJTA 4FXVA 2K1RB 3KLGB 4MKYA 2DNRA 2HLUA 4JI8F 2NXNA 2BJ3A 2ZBPA 4TY9A 2MMYA 4K4TA 1A6LA 5J2MA 4DFKA 3DRXA 1DQAA 1PG5B 3FQLA 2BMBA 5KAKA 1BXNA 4EUVA 3US5A 1HD1A 3TZZA 1N52B 2M5YA 1RYSA 3G82A 4J90A 1VQ9S 3SFGA 4KQZA 3WBZA 1U09A 2G2OA 1RKIA 1NK5A 4BCAA 1GMWD 3R27A 2KH9A 3TO8A 2V0NA 5GMKa 4CM0A 1U1KA 2MEWA 3SEOA 2DHGA 2EFOA 2AT1B 4WWSA 4JOUA 4IOCQ 1UPPA 4FNHA 3HVWA 1IR1A 4OZNA 4LVNP 2DGOA 3JQMA 2OTJS 2V2KA 4EGLA 4YDDB 3JSRA 1YGYA 4P74A 2JEFA 4DBQA 3T1AA 4NI2B 4FN5A 3K58A 4XDCA 2HFVA 3DU6A 2VA2A 4C98A 1YJUA 1J5OB 4DSIA 1FRLA 5CABA 2A2DA 4Q45A 3NCPA 5KFNA 4IKAA 3G8QA 2P5VA 5G4DA 4LBPA 5KG1A 3LP0A 1RA7A 5CZXA 3DC2A 4EEYA 3H5XA 4U7UK 3KHRA 3WQPA 1IBLJ 4NLQA 5F3ZA 2CJ9A 3HT3A 3MURP 5L9NA 3R7NB 3NS5A 5F9NA 2E9TA 4USTA 2JLEA 2OHDA 4YY3F 4DCJB 1U0HB 4WP3A 5T7LA 4DX8H 3W1YC 3C6TB 4N47A 3OJUA 2MZQA 2XHCA 3HHLD 3ZTPA 1SQFA 4G65A 4CLWA 2OPRA 5AXMA 2IJFA 2HKEA 3GCWP 4B9NA 4C8ZA 4UUXA 3OFGA 2VFUA 1K1QA 1U8WA 1EB0A 3GJTB 2GO9A 2WCXA 1VIXA 4OL8A 4DV2J 2VQFJ 2H5EA 4MIAA 3CUNA 4KKOB 2RRAA 4C8KA 4KFBB 1IR2A 3NNHA 1Q8IA 4QOTA 1X9MA 2W2NP 5FLXY 1VHFA 2K7KA 1MLAA 4NRTA 3LPYA 1I1GA 1FJCA 2W7PA 1R3NA 3HJFA 2BYCA 2XI3A 1HD0A 4XK8C 1N4LA 1RTJB 2HVDA 2Z0GA 2A18A 2YVSA 3UDCA 4USWA 5KFJA 4RW6B 1BMQB 3SQGA 3SV4A 5KT3A 5HMXA 4USJC 5KOWA 1TMJA 3HHLB 4X64J 2XTJP 2AKWB 1CJKB 4NYPA 4K2XA 3QSIA 3HFVA 4QYZJ 2HEKA 5KFTA 2VV5A 7FD1A 1RWXB 2XNRA 3MD1A 4UUWA 3DLBA 4NPOA 1VQMS 2Y0BB 2M70A 3G6XA 2XY7A 1HNVA 2NREA 3TAMB 3UN2A 3HVTB 4R25A 4MIWA 4F3QA 5FDLA 2GCFA 4C9DA 2VFVA 4HI2A 5LL6d 3MMJA 4ANCA 4C8LA 4E0DA 1RP5A 2HHPA 3Q23A 1SJQA 3UWTA 3GSDA 3G6ES 5EX0A 3VGSA 3GYXB 3M8RA 5J2QB 1SJ3P 1H73A 1AZSB 3HK2A 5KFCA 1WOSA 4I1TA 4CH7A 5HMZA 5FJ4A 1HBUB 2WB1D 4NZ6A 4NLSA 1XBWA 1FJGJ 2DR8A 2ZH4A 2VF3A 4UOGA 1PBAA 1CJUB 2E1AA 3UW1A 1C0TB 2QYCA 2BW7A 2E1PA 5B0BA 4HACA 3DMJA 3RTVA 2XEXA 1WOOA 2XY6A 4F7VA 1FRMA 3VHQA 3TW0A 1RHQB 4WXWA 5KTQA 5K8NA 1R27B 1CG2A 4B9VA 4LT6A 1RWKB 1NZAA 2P8IA 4ZK7M 3CDBA 4CO2A 3GR1A 3UDLA 1E6YA 2QTWA 1W7WA 2C3OA 3Q8YA 1RB0A 3W60A 2JFKA 3K89A 2NCKL 3CCJS 4A8QA 3CXCR 4ZVRB 2HBYB 4QW8A 4KIAA 3FC9A 2V63A 1GAOA 2IAJA 1IBLF 4HT7A 4DFMA 2W4PA 2DH9A 4NLUA 3R5AA 3OJSA 2CJXB 2AJ1A 2D3UA 1DURA 1QY7A 2R8HA 1Y7PA 3RRGA 3JAMY 4IOBA 2CZVC 3CCMS 2ZZMA 2RDDA 3TZXA 3PACA 2VU5A 5DS7A 1XIQA 1KOHA 1TKXA 1FERA 2OPSB 3FZ2A 1SBRA 1ITPA 2UZAA 1C1BA 1YHQS 5DZ6A 2IDEA 5ADZA 4DV2F 1FFSB 2PE8A 2I6WA 3OBIA 2AD9A 4A46A 2XYPB 3AD9C 2YQ1A 1RT7B 3ZTRA 4DS5A 1VQNS 1EX8A 2XMUA 3PFOA 1MU2A 1UW4A 1WHXA 3DGPA 1UJ6A 3MF5A 2ZOFA 2LU2A 2GA7A 4U7UD 4XPEA 4IG3A 4ECSA 2XO7A 2CJBA 4I0WA 2BX6A 2LEPA 3ET6B 2B8QA 3IP0A 3WHIA 1B7FA 4X64F 1FWLA 5KT2A 1JJ4A 3H20A 4J37A 2FHJD 4R5PA 1X4DA 4LR8A 1HWJA 3T9NA 3UD4P 5HANA 3DLEA 1CBKA 3BGRB 2QN6B 3R5DA 3E3XA 2MQQA 1FKOA 1PILA 2W7AA 3QJJA 4KO0A 3O1LA 5ITHA 3UDVA 2W1BA 4LF4J 1RT3A 4PQUA 2R2RA 4RW9B 2AYGA 2B4PA 4DPXA 2BOAA 4HDGA 2GAHC 3J7Z5 2HQ3A 2HNYB 1W2BR 2OSQA 2RF2B 4RNMA 3NS6A 4N41A 2G1DA 5BJRA 3VGTA 3BDEA 1E6VB 4X62F 2C3PA 1QTNB 3AJ1A 3A12A 4OHWA 2JEJA 3QZ7A 3BR8A 5DLFA 4NEYA 1SPBP 1FJGF 2DXDA 1OQ6A 1UJ4A 3KLVA 3V4MA 2UVRA 2BE2A 3OSPA 4I67A 4Q43A 4NWBA 1RAEB 1VCTA 3CJQA 1FEEA 4PUOB 2K06A 1FK9B 4BC9A 1MG7A 3ETOA 4P7TA 1RHKB 1S77D 2I2YA 4CI0B 2CJQA 2DPIA 1B3TA 3CMQA 5BYSA 2YNIA 1DAXA 2DNPA 1AFIA 2XLKA 1FVQA 4AD6A 3VR1A 1I94F 1URNA 1YX2A 2EBGA 3QQCD 2MGZB 3KWMA 2HIQA 2XMVA 2E5GA 3ISZA 4B9UA 1WHYA 2DXFA 2R7WA 1LW2B 5EX3A 2PT0A 1YJ9S 3KLGA 2HBRB 2QL9B 3LQVA 3OVSA 5KFYA 2KFZA 4LF7J 5D0HA 1F5AA 3M2UB 2AJQA 4R8UB 3DM2B 3RGIA 4BS2A 2RQ4A 1WSRA 5KT5A 3HSZA 3Q8UA 1H2UX 1YITS 1AT1B 4G6VB 3HZEA 4TQSA 3M1VB 2WOMB 1LW0B 2CZ4A 3NGTA 3IM8A 4QWDA 2DGWA 4ZP6A 1TL3B 1KR4A 4C11B 2RU9A 4YB7A 2HWTA 3MM9B 5H9EK 1WDDA 3KUEA 1RISA 3FUYA 1FD8A 2YY3A 4TY8A 4I6YA 3KHGA 2WVBA 3FZBA 1S1VB 3B4DA 2I5JB 3TRGA 3ZZUA 3QIPA 3QFWA 1R8CA 3CGIA 3PNIA 3UR0A 3SV3A 2AQ4A 4NI2A 1SVDA 4CTAB 2VDHA 1J5OA 2AYEA 4DL2A 3H4DA 4OX9J 3CCTA 1ACMB 1X4BA 1ZOTA 4L6V3 2M3DA 4KHRA 3K5PA 4YN3B 2IRUA 2JC0A 4F26A 1S57A 3PR5B 4IFVB 1B64A 1BQNB 5KFWA 1DTQB 3VV2B 4LF4F 2M7SA 3C6TA 2DNZA 5HAOA 1ZTTA 3MDFA 2CJYB 1LWEB 2NQPA 4KGMA 3GFZA 4LQ3A 4Z2XA 1F5CA 2P6TA 1U49A 2IA0A 1P1TA 2XMTA 2CIMA 2VBXA 2MLYA 3MM7B 3DHXA 1QUPA 2R8IA 1Y3JA 1DRZA 1NPKA 3R3TA 2CADA 4FXDA 3PO4A 2YKMA 3S1TA 3NXZA 2EFQA 4C4WA 3CDEA 3LPEA 1RTJA 4H4OA 1HBMB 3NAHA 2LDIA 3KKFA 4RW6A 5F8HA 3DLKA 1FEHA 5D0EA 2CVEA 1U24A 4F3MA 1VI7A 2MY7A 2KJWA 3Q2SC 1F2GA 4UZCA 2Z30B 1N5QA 3AQOA 5KG7A 3EWGA 3CJ2A 2B43A 1VRQC 1S6PA 3PX0A 3TAMA 5SZTA 2HAFA 3H5UA 5LXYA 1S1XB 4Y0FA 1QAIA 4O4GB 4PG8A 2KDOA 3DXSX 2Y1JA 2W4DA 1UKUA 3PIPQ 2EKYA 2EKNA 4DCOB 4LF7F 1U26A 5J2QA 4NLGA 1FE0A 4X4UA 2MZTA 3QJLA 7FDRA 2PDAA 2BACA 2HGMA 3M8WA 4I4BA 1JLQA 1KQKA 4JI6J 4HT5A 5KT4A 2R2UA 2AMCB 3OUYB 5CCMA 1CJUA 3GZ7A 5K14B 4QIGA 2E5HA 1S97A 3EUNA 2JVRA 3TUIC 1SC4B 5ETTA 3I96A 2CQ3A 3ZZ0A 2UV8G 5T14A 4ZMMA 1YJVA 2C1EB 2NLWA 2I0XA 2KXFA 1RAFB 2L9WA 3LA0A 5IFMA 4PABA 3ENQA 3H4BA 3G4SS 1HYSB 2CQ1A 5C24B 2GS8A 5H1SV 3PYEA 3C16B 2NUHA 4DL3A 3M9NB 1N33J 1L3KA 3KLFB 1VBKA 2YPYA 3BM7A 2R8JA 4WTOB 3H8YA 2B9EA 2DHHA 4DUYF 3WX4A 4Q8EA 4TN2A 1WNEA 2CPXA 5KFVA 3QT5A 1Q78A 3W3SA 3F41A 1T11A 3PM9A 1GTHA 4O3SA 2FPHX 4ZVTB 4OYPA 1BQXA 2AEFA 3EGVA 3OR2B 2MKJA 4QR2A 1U6BA 4DX7A 3DOKB 3FVYA 4Y2CA 1JLGB 3SMZA 2NSCA 4K2JA 3VAFA 4ZVGA 3V6DA 1MNEA 5JMNA 2ZM6J 4CRJA 3LP1A 2UUWA 1NSAA 3MR5A 4KPYA 4U7CA 3R5GA 2HPUA 5DM6Q 1S0MA 3FNNA 4DR3J 1YBTA 3H7HB 3HHLC 3OL7A 1S0NA 1S49A 3MMCA 2CPHA 2O66A 3NEKA 1H7XA 3CB4A 3RR7A 1RT7A 1HR0J 3CSKA 4DL7A 1IKYB 1HWIA 3MEGA 3Q89A 1M1HA 4ENOA 1VC5A 2XULA 3QWUA 5AXLA 3OVBA 3SCIE 1KRPA 4K4SA 1JXVA 3OL6A 2FGCA 1RWMB 1FI4A 1HBOB 2CG8A 3Q8VA 1OSDA 2GIQA 2V69A 2ZHAA 3KUHA 3JTOA 5CH7B 2LYVA 5KFUA 1LNQA 2KRBA 2IYIA 1T0TV 4A47A 1EQMA 1FRIA 3KDOA 5IS2A 3PEHA 3BGRA 5KFMA 4ZITA 4X4RA 4KGXB 4V19J 1TAQA 4C0BA 4QU6A 4LRDA 3QZ8A 2FVSA 1MW7A 1H6KX 2XB2D 1VQLS 3H5YA 5RUBA 3CDUA 1FX2A 3W9JA 3UVJB 2HNYA 5DDRC 1E6VA 5A0YB 5C5JA 3MMBB 3PZPA 5LMNJ 2C3YA 4JI6F 2OD4A 2DGUA 1SQGA 1SI9A 1JIHA 4DR5J 4DUZJ 2W2MP 4ZJLA 2KM8B 1HLWA 5KG5A 1Y0HA 4LSLB 3K5OA 2QMWA 2QFJA 2NS1B 4FYXB 3U1MA 3ENAA 4P2SA 1YWXA 4WFBQ 2BJDA 2RUSA 2X1GA 2YNGB 2BANB 4U9RA 1RTZA 2DO4A 4IFYB 2DR9A 2CG4A 1BD6A 3EGNA 1SKUB 1HKAA 4M5JA 3P45B 1KEKA 2IMWP 4RBUA 4JYAJ 2HVZA 1O51A 2Z57B 1N33F 2WSFC 2B51A 3N6MA 1TK8A 4OLOA 3GIJA 4ZLPA 3EVWA 3CE8A 3RYLA 3C14A 1EP4B 3TJAA 2VG5B 3H59A 2CZ9A 3RAMA 3U1LA 2J7UA 4S0MA 3V6HA 3BKTA 3W8GA 3CO9A 2CXEA 5C25A 1T03B 2HQDA 4YB1P 4MFBA 2OPPA 3BQ0A 3GIMA 3O8WA 4B3MF 1S9EA 3DM2A 4K8RA 2J7WA 4NCGA 2OEMA 5IXUA 3C15B 3ZFVA 5DO2A 2ZM6F 1M1GA 2M2BA 4J9KA 5CD4H 1U47A 1C4CA 4C8MA 3E51A 3M1VA 2F40A 3QJPA 5KFFA 1LW0A 1VQ6S 2ASLA 1H98A 4IH5A 2CNLB 3E01B 4PG6A 2DVIA 4HHHA 1KQGB 4C11A 4X66J 4USHA 4DR3F 3DOMA 4NLWA 5KFSA 1N5VA 4ECVA 1HNZJ 3A3NB 1JLFB 2OFGX 4B9MA 3DYAB 1HR0F 4IRDA 1RT4B 3BQ1A 4K4WA 2X1BA 1T9YA 1UMJA 1S1VA 4C6AA 2HBZB 4NEZA 3OPKA 2CWXA 2I5JA 2RVJA 3FSXA 4DCPB 1RAHB 2P9GA 2K7JA 5J1EA 2XGPA 1TQLA 2B9YA 1UVJA 4WXOA 2U1AA 5DDOC 2LXUA 1SC1B 2WVEA 1X60A 5E3AA 2FJVA 3VGVA 2FJEB 3M8QB 4ZN3A 2M8DB 4L75A 2AJ4A 8RUCA 1XMQJ 1R8HA 3CW2C 2XMWA 2AJFE 4IG0B 3TJ9A 4Q5VA 4LR9A 2XS7A 4I6WA 4IFVA 5DJBA 1VQYA 1BQNA 2GVDB 2YNFB 1DTQA 4F4XA 2R7RA 3PYDA 4ELTA 2B9XA 3FMBA 1FVSA 3CJKB 4CLUA 1CLFA 3O6QA 2R7VA 4OYWA 1LWEA 4ERDA 1S76D 1VC6A 4U67Q 3OLAA 3THTA 1S6OA 2FY8A 2D1CA 2ZH3A 3DRPA 2BQ3A 4LRBA 3PJWA 3W5YA 4IR9A 4O23A 5LMNF 1G6BA 3R7SB 2MKKA 8ATCB 3UQSA 2LXIA 5CZVA 2GHWA 2FZGB 4DR5F 4ECWA 4BWJA 1KQFB 2E1MC 3FFIA 2MJUA 4MKBA 3T1YF 3JSMA 1BC6A 3RU0A 4DR2J 3AJDA 4FF3A 1RZMA 1HWUA 4CH1A 1ZTWA 2AW0A 4W92B 3EZUA 2DNKA 2KT5A 1KLMB 5C7PA 2GZOA 1GXLA 3EZ5A 2LEBA 1I3OB 3SI8A 4B3SJ 3PRDA 2O01C 1UEVA 4FKYA 5EDWA 2CDRB 4EYIB 5BYRA 1N5TA 3K59A 2NXCA 4JYAF 2XMJA 3LOUA 3EDQB 3B8HA 1MWQA 2DNGA 2E44A 3OFFA 4LIWA 4WIQA 4EWTA 1X0FA 5L46A 5IWAF 1RA6A 1N36J 2ZZNA 4QWEA 3AB4B 2QLWA 3HD2A 4AL7A 3PXGa 1RT6A 4B9TA 2J0XA 2IDLA 3CC7S 2CPFA 1T9UA 4LREA 5HQLA 3J81Y 4LMZA 1JLAA 1ZPVA 1V9OA 2JOQA 1NPRA 5ETRA 2H5JB 1OYEA 2F1FA 1VIOA 1R43A 5F0WA 4ZVEA 1NK4A 1GMVA 2WONB 2HQGA 3GMGA 2FHMA 3PVXA 3C46A 2WAQD 1AA1B 5CD4A 1HHSA 5DRKA 2K8GA 5D4PA 2ILZA 4QIWD 3MECA 3OUYA 3B82A 4QWCA 5K14A 4UY85 1XC9A 1GX6A 2NZ4A 2OP5A 3NWGA 2CQ0A 1HNZF 3KHLA 2IM0A 2CPDA 3EVMA 1X4CA 3BYRA 2J0SD 5EHHA 4DN0A 2MKCA 3IRXA 4L3NA 1ZM3A 3MAAB 1SH3A 2BE9B 1UEUA 5D4OA 2XYGB 3KJQB 4ZVPB 2LVWA 2A0FB 2BBEA 5B0FA 2BJ1A 2RKIA 4RW7B 2WW8A 2W4CA 1V6HA 5C42B 3GR0A 2LMIA 2ZOMA 3IXQA 5HBMB 3IG1B 3KK2A 1VRUA 4I64A 4WK1A 2JFDA 1F1BB 1WKKA 5HI7A 1XMQF 4QR1A 2PC6A 3OL8A 1T8EA 1JXEA 2ZJQQ 1TV6B 1UETA 1NSKL 3ISNC 2V9KA 1NH8A 5F3TA 2BM0A 1YI2S 3QGPA 4LF9J 3ZZZA 3AT1B 3JQKA 4FDFA 4J5OA 4DQSA 1PAEX 3GJQB 2ACYA 3D7SB 1EKRA 4FVMA 2ZBQA 4L72B 5I3QA 1FT8A 4NLYA 5LJ3Y 1RBOB 3FMWA 2H3EB 2R4FA 3QLHB 2R3VA 2Q3PA 3W2VB 3NY0A 4I7FB 2ZH9A 3DRSB 2UVVA 4QPTA 1JKHB 3J7YU 1SV5B 1IKYA 2GJ2A 1WSVA 3AAWB 1MN9A 1IKVA 4DR2F 1IWGA 4DSLA 5H9FK 4KGZB 4WIIA 1RT2B 4Z37A 1GMUA 5GAEU 1HBOA 1RLDA 4K4XA 4DS4A 2DH8A 1Q86T 1RU2A 1FDAA 3A8KA 3DXBA 3PX4A 3MM6B 4MTPA 3AQPA 3PYFA 4DR1J 1VK3A 1D3WA 2G0CA 1KVIA 2ZKUA 4ZPDA 2MQMA 4CM2A 4DPOA 5D3GB 4P72A 5DDQC 2VDIA 3CJ8A 4ECYA 3M8ZA 2MSTA 2HQIA 5F8LA 3M9MB 3KUGA 2R7SA 2ADCA 4M95A 5A8WB 1K0TA 1BY9A 1TFWA 2DXEA 3VAIA 1RCXB 1R0AA 2VBZA 4B3RJ 2GMLA 5B09A 3S6EA 4ZLNA 2OEKA 1P9YA 3MOJB 1N32F 2ZWPA 1WF0A 4NXNJ 4KJIA 2VQEF 3NMAA 2DGSA 4OI6A 4LSLA 1B0PA 2HHWA 1Y3KA 3G8SA 3ZZPA 3BQ2A 1HNIB 3RAXA 4M5MA 2MSSA 3I9ZA 3U1NA 2KL8A 4YHHJ 2YNGA 2BANA 4C97A 4QJVA 4XPCA 2GVZB 2ZUAA 3CWJA 5M2RA 3MMAA 2CDQA 4N56A 4ZN1A 1NUEA 4AXJA 5HLFA 4UOFA 4WBFA 2PN6A 2YKQA 1OSCA 3SIPB 3L7UA 1NKCA 5DQIA 2BQRA 3BREA 3GG0A 4CCHA 3M8PB 4KB7A 1RLCL 4OIXA 3WC0A 1F3VA 3D9BA 3DRRB 3ILJA 4PG5A 2QE5A 4OI4A 1T7PA 1FTRA 2VG5A 3M32B 1S1UA 4DZ6A 2FHOB 3MAHA 1H74A 1NEEA 4NXMJ 4ZA1A 4WP8A 4HDHA 1RDRA 1FKPA 2XBPA 4U8YA 3BB5A 2V67A 4LF9F 3ZTOA 2QSWA 3BZQA 4L73A 3CMES 3C15A 4N77A 3T1HJ 3U02A 4C0HA 1P1LA 4PQAA 1XMOJ 1WEYA 3W5XA 2VKRA 2NPFA 3ICLA 3E01A 2Q43A 1LWXA 4R0JA 3Q86A 1UWBA 4P2MA 3IWLA 1JLFA 3PJ9A 3HPOA 1PGZA 3DYAA 2D3O1 3RB6A 5D15A 1AFJA 1VR6A 1YZ7A 4Q0BA 1BWEA 4LRCA 4DL4A 2PI5A 3UR3C 1WG1A 5LM7E 2XY5A 1RQ0A 2ZUGA 2MQLA 2VH7A 1WORA 1GT8A 2DR5A 2B7CB 4DPYA 2DNMA 4ED7A 5IQ6A 2WBMA 4HEA9 4TXSA 4QIFA 4RUBA 2W9BB 1DZ5A 4L74A 1SCJB 2V4JB 3AOCA 2EC2A 4HKQA 2N3LA 1BGXT 1S10A 1K8AT 5LJ5Y 3CCRS 1SKRA 2H48B 2KRRA 1LWCB 1N8RT 4FF2A 3MPWA 4IG0A 2OUGA 3OTDA 2XLIA 4RPFA 4QR0A 3KLHB 3TI0A 1QLNA 5D0GA 3Q8RB 4LRFA 2YNFA 3HHKA 1RT1A 4CLYA 2GC8A 1Q7LB 3W66A 5KFPA 5A8KA 3ELHA 1X5OA 4X2BA 3PX6A 1F2HA 4ZDNA 2CVIA 3LP0B 2LQJA 2GMHA 4AL6A 3PRBA 1HIYA 2CJAA 1Y5NB 3TWZA 2HVIA 5ETNA 2FJAB 2BR0A 1OPIA 1OS5A 2YXLA 4NXNF 2VOPA 4H54A 3TR5A 3M05A 2H5IB 1FFGB 2Y8YA 5LMUJ 1D8ZA 2MKIA 3BN4A 3MCMA 1NK7A 1RABB 4C48A 4YHHF 1UFLA 1VLYA 5ETMA 2CPYA 2W25A 2FLPA 3ZNJ1 3OTEA 3QFHA 3VAMA 1S1TB 2HURA 2EFPA 1YZ6A 2J9CA 3MGJA 2Y3YA 4ILLA 2FYXA 1WD6A 3SYZA 3V2UC 2ZC4A 3M2RB 1SH0A 4NXMF 1W2IA 4DU7A 1REVB 3EDRB 3TZYA 2R42A 3ILIA 1YKWA 4OI2A 1TU0B 3CJRA 5BR8F 4CIOA 1NBEB 1K0VA 2KG1A 3T1HF 4DL6A 2YTCA 1XMOF 3F56A 5LXRA 1HNVB 4M1KA 2ZH5A 4MT1A 1VGYA 3ZNUA 1HI1A 5FDLB 3GCXP 1FWPA 4GO5X 4LR7A 2XWXA 1EZZB 3CDAA 1HMVA 2APOA 5IOLA 4LF6J 1IWAA 4J9LA 1MWYA 4UW2A 2HRYA 2HHSA 4OLPA 3MAAA 1X9SA 3G71S 1U1RA 3QPIA 2EG2A 4Y28C 1DARA 2Z2MA 5IC6B 1SXLA 4RW7A 1QDUB 3RZAA 1K9MT 4PPZA 3QRPA 2BEFA 2DO0A 3A8EA 1SB6A 5H9EJ 3IG1A 2O5DA 3IBCB 2IRXA 2VC0A 4I2PB 4DR4F 4HACB 2ATLA 4ILRA 5GAGI 1AB8A 3J7YI 1NSQA 2WVCA 1W25A 3RJMB 5EWEA 2IBOA 1NB7A 2FGOA 3O3LA 1M1KT 3BH7B 2VODA 3A13A 1XNRJ 3HKWA 3HSGA 1CEZA 2PMHA 3CVKA 1E6YB 4Y2KA 5GAEI 1WHWA 2GJIA 4KBIA 4DR6J 2JLFA 2Z2LA 3I32A 2RT3A 4RU2A 2UU9F 4ZP9A 2MTLA 3TUZC 4LIRA 3QLHA 1O8BA 2IAJB 3W2VA 4I7FA 3AODA 1H0HB 3CCSS 2OJ3A 1KVJA 1VHIA 3DOLA 1VQSA 5LMUF 2NXJA 1L5UA 1X5TA 4MMOA 1XQIA 2FLNA 3P5BP 3EICA 1WTFA 3BBFA 3NP5A 1FRXA 3HHDA 4UT4A 1TKXB 4CO3A 1C1BB 4OX7A 3W7BA 4DEZA 1ULRA 2J8AA 4IO1A 1PKUA 2DNQA 3RW6A 4RNFA 3EGZA 4ZPAA 1J2VA 1MU2B 1Y00A 1ZA1B 1D8YA 4NA2A 5E3RA 3DGPB 2C2RA 5D3GA 4USKA 3WZ0A 4WCEQ 3AD7C 4F50A 3M6XA 2QJ3A 4ALZA 4V1Ak 4J9PA 5M2UA 3FBBA 1PYSB 3MR2A 1JQGA 1B4SA 4F4KA 4R5PB 2F4VF 4UF4A 2AJ2A 3I4PA 5KT7A 3B78A 5G0RB 4M5KA 4RKUC 4F2SA 3CD6S 2VL1A 4PWUA 4QIVA 1N5YB 4K59A 1PYTA 2H54B 2GNKA 3LWLA 4ECQA 1YJ7A 4KO0B 3SSRA 4DLGA 2FLLA 1S7HA 4CP5A 2PFFB 4DV7J 1HNWJ 1HNIA 4LF6F 4TLRA 3R1HA 3IR6B 3IS9A 3SXLA 4OV1A 2Y1IA 3L09A 1QE1A 2GVZA 1VJWA 1FF2A 2LA4A 4ZPWR 4J9MA 3M2VB 2ABYA 3R1LA 2M88A 4TVAB 2G0IA 4K4UA 2QLFB 4LJMA 2CQBA 3M8YA 4CO0A 1SIZA 1OIAA 3NCRA 1M90T 2PMZD 3M8PA 2XM3A 2BE2B 3R5CA 2X7IA 4OZ1A 2LQ8A 1C2PA 3M32A 3MFIA 4M5NA 2AZ3A 1S59A 1U02A 1KTVA 1U7LA 2RSQA 2B8PA 2F3JA 4JI3F 2VBWA 3CJ3A 1XNRF 2R7TA 1TFYA 4YEAA 2AGPA 3I5BA 2F9JA 4O3NA 1GX5A 3CJ4A 2HNZA 3VQSA 2L08A 2V2QA 5E3CA 4JI2J 1S4EA 1ZAVA 1HI0P 3PHTA 1UFKA 2CRLA 1D9FA 1N34J 5KFKA 2XLJA 4DDFA 1S9FA 1VJQA 2LLZA 1PCAA 2HRUA 1SQEA 3GTYX 2W01A 1UFWA 3SQOP 5HP1B 3UCUP 3VGUA 2VKZG 2NYHA 3E2EA 1RJJA 2BKNA 1J5EJ 4OZLA 2XHWA 2XCAA 2AYMA 4QBUA 5DLGA 1QAXA 4RBVA 1I6JA 2K3IA 4TYAA 3OL9A 2QFIA 4URSA 5A2QU 3MEDB 2J6UA 1JLBA 4MYUA 3KDNA 2W9BA 2ZVSA 5CXTA 1ELOA 2V4JA 2XMKA 1S9GA 2VIHA 3WDOA 1IR0A 2HZVA 2N7YA 3L7OA 1LWCA 3QGIA 4LF8J 1WOPA 4TY8B 2ZJPQ 2LQ9A 3H2UB 2NXUA 2XZTB 3GP9A 3KLHA 1R8PA 4D3HA 4XIUA 4O3OA 2HK2A 5IT0A 4DX5A 2QA4G 2YWHA 3C8YA 4DV4J 3QIPB 2HGNA 1A0OB 4OZ0A 3M4XA 2IM1A 4KSEB 5L1KA 1IQZA 2F5GA 4DFJA 3CF5Q 5C2GA 5GMEA 4ZCIA 4LSZB 2VPYB 1TKZA 4IYQA 3HFZB 2LKZA 2MKYA 3W2WA 2ZBRA 2VD3A 2IJNA 2MQPA 2UXDJ 2VUGA 5L9XA 4MJKA 3QT7A 1N6QA 1VQ8S 4OJ3A 2AIRB 3UCZP 1NU4A 2QL5B 2GV1A 4ED1A 2CQHA 2AX0A 2EPIA 1L3UA 4OHVA 4MK8A 5LSLA 3H0PA 1MROA 4UZBA 4Y2AA 2FLOA 4OV6A 2DKOB 3VAGA 2PEHA 3SCLE 3IAS9 4DV7F 1U6ZA 1XWLA 1HNWF 2FZKB 5HMYA 4V19X 3NLCA 2AYBA 3GWCA 4KAIA 3C3LA 4MYTA 4WZQA 4WU2A 3I56S 4NZ7A 1SL2A 3FSYA 2ZE2A 3NCQA 5ETPA 4YP3A 2FJWA 1MSWD 1S1TA 4GVBA 1RSCA 2IRYA 4X84A 2XCPA 2Y9HA 4X4VA 1G3OA 4G1PA 2BKPA 2DGTA 3FSIA 2A6OA 4K0KJ 5D4LA 1YQHA 2L9DA 2UXCJ 2ZKTA 3FEXB 1GK8A 4FVCA 2YKMB 3BH6B 2H4YB 4CZCA 2DTJA 4RJVA 3M2RA 1PC4A 2MHEA 3POTB 2YBVA 4WFYA 3MHYA 2Q79A 3IO1A 4H4OB 1EJ7L 2VA3A 2KYXA 1REVA 1LKZA 3UD3P 2HRTA 2M52A 4ELVA 3DLKB 4ICLA 4Z7CA 1ZETA 4M5HA 1CJVA 5AXNA 4LSNA 2ZNZA 3SCJE 2CA9A 2XSJB 4OYXA 1Y4ZB 3RB0A 2IMOA 3I4HX 1URRA 2JRSA 5D8HB 4WF9Q 3ZZOA 3P4UB 2FVRA
chains in the Genus database with same CATH topology
3I0SB 3GIMA 2E29A 1WELA 2X3GA 1Q81T 3O8WA 4FS2A 4B3MF 1S6PB 1S9EA 1KOOA 4UQGA 1HL6A 2IM2A 3BGUA 3QAUA 3ZZTA 1B0VA 4AXIA 3DM2A 2J7WA 4NCGA 5K5MA 3VCDA 2EI5A 3DRSA 2LECA 2RQMA 5JJBA 3PW7A 1LK5A 2BZ2A 3FCHA 2U2FA 4J9SA 1JKHA 5E2QA 5IXUA 2BOPA 1C0UB 5DO2A 3ZFVA 1X4FA 5I4MA 4OHZA 2ZM6F 2M2BA 1NJXA 1DFDA 1SV5A 3O2IA 4CQ1A 4J9KA 5CD4H 1U47A 3I9V9 1C4CA 1T02A 2MDAA 4C8MA 3E51A 3M1VA 4U6PA 4EBCA 2F40A 3GV7B 3QJPA 5KFFA 1LW0A 1VQ6S 2ASLA 4F2RA 1H98A 4IH5A 3CMAS 3E01B 1NJIT 3KNAA 4PG6A 2PSZA 2DVIA 4WKRA 4K50A 2GGPA 5K9FA 3PKMA 1QSLA 1KQGB 2D7SA 4C11A 2V5HG 4USHA 4DR3F 2AF6A 3DOMA 3BEGB 2BA9A 3I55S 4KKOA 4NLWA 1R31A 5KFSA 1N5VA 4KFBA 4IDKB 4ECVA 4K4ZA 2VG7A 5J2PB 2OLWA 2PD1A 1JLFB 1RT2A 2OFGX 1HWKA 4B9MA 4OHXA 1APSA 3DYAB 1XMBA 4DFPA 1KONA 1KNZA 1QTMA 3N0VA 3D2WA 1HR0F 4IRDA 5IM0A 1RT4B 1WACA 4MH8A 3DLGA 3TX8A 4HH0A 3H2LA 3AHPA 4J9QA 1JLQB 4RUCA 3BQ1A 4K4WA 2X1BA 1UMJA 4OX8A 1VQPS 1NJWA 1JMTA 1RWUA 1S1VA 2MB0B 2GQCA 3IS9B 1LFPA 2DB1A 4LFCF 1QSYA 1OO0B 1ROFA 2F8MA 1QUVA 2VPXB 3OPKA 4ECZA 3CD7A 1QE1B 2I5JA 4WKYA 2RVJA 4HI1A 3FSXA 2BRLA 4NCAA 2VFTA 2YNHA 3KLEA 4I2PA 3MM6A 3P96A 3UE2A 2P9GA 2YWKA 2K7JA 5B08A 1UA1A 4WFXA 5J1EA 5BYQA 4F4WA 4B3TF 4YR0A 2XGPA 4LF8F 2C3UA 1TQLA 2B9YA 3Q0AA 3PY8A 1FNOA 1MMNA 1UVJA 4WXOA 2ERRA 1S0OA 2U1AA 5DDOC 2V9WA 2R7UA 3M30A 2KU7A 2RILA 3HHLA 2LXUA 3NMRA 4B9SA 2MKSA 1TUVA 2E7WA 3MUVP 4DV0F 5E3AA 2KN4A 1Q7YT 2GX8A 2QRRA 2R2SA 4FXWA 1IBMF 1TR0A 3T5JA 2FJVA 1KN6A 1N48A 2FJEB 4Y65A 2KYZA 3M8QB 4PXEA 3V81B 4DV4F 4Q7AA 1A9NB 4ATNA 1YJNS 2M8DB 4ECRA 5DQGA 3AJ2A 2JSXA 4IG3B 1F60B 5B0GA 2VPZB 2AJ4A 3J7ZT 2JVOA 2XWYA 3KNGA 1R8HA 3MPVA 2BM1A 1G1XA 2XG8A 2XMWA 1VQKS 2AJFE 2MQNA 1HPZB 1XR7A 4IG0B 5CYJA 3HVRA 2CQIA 4OI3A 3IGNA 5EGYA 5A8WA 3G86A 3OW2R 4O3QA 4ZOSA 1R7IA 4C3KA 5B0EA 1WWHA 3HVTA 3MPYA 5CCLA 3M9OB 4Q5VA 4OI0A 2XS7A 1U8SA 4I6WA 1UVLA 4IFVA 1X4AA 5DJBA 1VQYA 1BQNA 3PIOQ 4X4TA 3BSNA 4ZCLA 2UXDF 1NK0A 2COLA 2YNFB 1DTQA 1MWZA 2R7RA 4F4XA 1D9DA 3HHEA 3OTCA 4ELTA 2B9XA 2AX1A 2K3KA 1LV5A 2JJ4D 4DLEA 3FMBA 1FVSA 3CJKB 2IYGA 3RRHA 2XC9A 2UVWA 4TU7A 3CPWR 1CLFA 3O6QA 1QAJA 1IBKF 3JYTA 3HVAA 3NGDA 3HLUA 1S79A 2R7VA 4Q2MA 3DLEB 2FTRA 2HNZB 3IBWA 1LWEA 1TKDA 3TA1A 3LAMA 1RK8A 6FD1A 4ERDA 1S76D 1VC6A 4CT8A 4MK9A 4JI0F 4ZS6A 4U67Q 3OLAA 2KKHA 3F44A 2FVPA 4RWXA 2OD6A 3RBEA 1HHTP 3KYLA 4KR0B 1S6OA 3THTA 4ED0A 2DHAA 4P6QA 2RRNA 2D1CA 2ZH3A 1FKOB 3DRPA 3JSYA 2BQ3A 3CCQS 2HHQA 2ZD1A 1RT5A 4XDDA 1B0TA 3PJWA 2EW9A 4AYBD 1FA0A 4O23A 5LMNF 1G6BA 4IR9A 5JUMA 4B08A 1Q8BA 1UVKA 2MKKA 1U1QA 1RT3B 4IRCA 4PQUB 3TOQA 1HBUA 1CQNA 2K2PA 1ZAXA 4JUZA 3UQSA 3BSOA 3LGNA 1WF1A 2LXIA 4LFAF 5CZVA 2GHWA 3OHAA 5E33A 4OZJA 2V8HA 3DRYA 4N8OA 2I8EA 1RAJA 1T3OA 2E5LF 1FDDA 4DR5F 4ECWA 3V6DB 1ZYQA 4BWJA 4EZ6A 1KQFB 1FO1A 2E1MC 2EC0A 3FFIA 2MJUA 2HMIB 3LP1B 1C0TA 4MKBA 4ED6A 3T1YF 2WSCC 3JSMA 2KTQA 3IAM9 3OVAA 3KJVB 3KTQA 3DU5A 3V5RA 2V4RA 1BC6A 2BXJA 3RU0A 5F8MA 3VTIA 2CQ2A 1H3DA 2UVUA 5M2PA 4FF3A 1SC6A 2QA4S 1HWUA 4CH1A 1ZTWA 2AW0A 4W92B 2KFNA 5J2NB 3EZUA 2DNKA 1P9QC 2KT5A 2J5AA 5KFLA 4A8OA 2VQFF 2RS2A 2DT9A 2D9PA 5E41A 1KLMB 3MMCB 5D6GA 1GXLA 3EZ5A 2LEBA 5AE3A 2XS5A 2FD2A 3JB9k 4ZCMA 3HZGA 3K7RA 2IBKA 3IWXA 1V3RA 3BF4A 3SI8A 3BSAA 3D0IE 3GFHA 3PRDA 1M5PC 2MPUA 1CSJA 2XI2A 2O01C 1UEVA 1O0PA 1SJFA 3SSQA 1NK9A 3BSCA 5EDWA 1JLBB 2ZHOA 4XAKA 5KFZA 3DRRA 2R2TA 1Q4RA 4EYIB 1UP1A 2JH3A 1JLEA 4K0KF 3MCSA 5BYRA 3MEGB 2CQPA 1VQ7S 1N5TA 4R0EA 3CCUS 1JJ2R 1N88A 1S9GB 3K59A 5IT4A 1JX4A 2W9CB 4JYAF 2XMJA 3IC1A 3LW5C 4URGA 3LOUA 3QO9B 2N4DA 5I3UA 1SJ4P 1LWFB 1IN0A 3B8HA 2DNGA 1RI7A 2E44A 2G9OA 3OFFA 1TZ0A 4LIWA 4EWTA 1U48A 2HWIA 3PFEA 2OAUA 2QA2A 2B6AA 4RNHA 5DG8A 1X0FA 5B0CA 5IWAF 1RA6A 3Q24A 2ZZNA 1DTTA 4K4YA 4QWEA 3AB4B 2QLWA 3KLIB 3S8SA 4DR1F 1NHUA 2XGQA 4FBTA 4AL7A 3PXGa 1RT6A 2DNOA 4H4MA 3TANA 1YJTA 3LP2B 1JB0C 5CHCB 4B9TA 2J0XA 3CC7S 2IC3A 2CPFA 3LUYA 3MAQA 4DSJA 2A3JA 2CQ4A 3N6NA 2QT7A 2UXBF 4RNOA 4J9NA 3DHWC 4HVZA 2YNIB 5GAHU 3ONQA 2RH3A 2GHVC 3J81Y 4DL5A 4LMZA 2DIVA 2GHPA 1JLAA 4C0OC 1ZPVA 1V9OA 2HNDA 2DD8S 5KG6A 1LK7A 2JOQA 2FHKA 3NNCA 4KRWA 2DISA 3KG4A 5CYMB 3TVZA 3BR9A 5G0RA 4DQIA 4DV3F 1T05B 4ELUA 2F1FA 1VIOA 2L48A 1TKZB 1YTYA 4DF4A 1R43A 4QPXA 3W2WB 2X1AA 5F0WA 5EUHA 2W8KA 1IJFB 4URQU 4ZVEA 1N5YA 1NK4A 1QSSA 2MJNA 3MUMP 4PWDB 1CC8A 4RW4A 3T5KA 2HHXA 3L3CA 4FXVA 2K1RB 3T5HA 3KLGB 4MKYA 2WONB 3JSBA 2DNRA 1JLCA 3GMGA 1N6QB 2I1RA 2FHMA 3PVXA 2HLUA 1VQOS 4JI8F 3C46A 3V4IA 2WAQD 1KLNA 4B3RF 3HFKA 2OPSA 1HARA 1HHSA 5D4NA 4TY9A 1UL3A 5DRKA 2MMYA 2K8GA 4K4TA 5D4PA 1A6LA 5J2MA 4ID5B 2CPEA 4DFKA 2EVZA 2ILZA 4QIWD 1MROB 3MECA 4C3LA 3OUYA 1NJZA 3KK3A 4C8YA 3B82A 2RNEA 3RBDA 3DRXA 4QWCA 1DQAA 1KS2A 2J0WA 5K14A 1HW8A 3FQLA 4UY85 1VMBA