5DM6Q

Crystal structure of the 50s ribosomal subunit from deinococcus radiodurans
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L1
publication title Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
pubmed doi rcsb
total genus 17
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5dm6Q00
4W90B 2AYGA 2CQHA 3NS5A 5CXTA 1RK8A 1U1MA 2OSQA 2RT3A 4M5DB 2DGQA 3THPA 2MKKA 4IOAQ 1U1OA 2DHXA 4BS2A 2YH1A 2MSSA 2YTCA 1VC6A 3DXBA 3CPWR 5IQQA 1YJNS 2LECA 1D9AA 2XS7A 2MZQA 1PGZA 3BS9A 3ULHA 1WF1A 2DO4A 3SXLA 2ZJRQ 3H2UB 1M5KC 2CQGA 2RRAA 2X1BA 3UCGA 4F26A 1ZH5A 2F3JA 3VF0B 2CQ1A 3EX7B 4ERDA 4CIOA 3HI9A 1VQ8S 2LXIA 2LCWA 2AD9A 2DNYA 3CCQS 4YB1P 2DH8A 1F9FA 5LXYA 5IM0B 3R27A 1W2BR 3TYTA 3N9UC 5DM7Q 2KHCA 3MUTP 3MURP 3SMZA 1WWHA 5DDRC 5LJ5Y 4LMZA 2DNPA 3MOJB 2MZ1A 2KG1A 2B0GA 1VQMS 2KH9A 1VQOS 1FJ7A 4QQBA 2MZRA 2DNHA 1YTYA 1H2VZ 1U6FA 2E5GA 3I55S 2EK1A 1M1KT 2L9WA 2O3DA 2ZJQQ 2XS2A 2KRRA 3LPYA 5MLCV 1X4CA 2VODA 2CPIA 1WHXA 2L08A 3SDEA 4WKRA 2EVZA 5JVHQ 1HD0A 2MQQA 1WEYA 2MB0B 2CPDA 2CQCA 1UAWA 4YOEA 3FEYB 2OTLS 3ZZZA 1N88A 1YHQS 2CPHA 1UW4A 2ADBA 2VONA 4OZ1A 2MXYA 2MZJA 1VQ7S 2CPEA 4LIRA 2JVRA 2DH7A 4RU2A 1FT8A 2DIVA 5DM6Q 1K73T 2XSFA 3BO3A 5GADU 2LA6A 1K8AT 4FXWA 3CF5Q 3P5TL 1URNA 3CCUS 3P49B 1KQSR 4YUDA 2MGZB 3CULA 2RUGA 4WF9Q 4QPTA 2G4BA 5LSOA 1VQ6S 1X4EA 3U1MA 2DGTA 2CQIA 2MYFA 1KOHA 3CCVS 1JJHA 1H6KX 2DNRA 2RQ4A 2KU7A 3S01A 2DGOA 1X4FA 3MUVP 4WFAQ 2MMYA 1X5PA 2DH9A 1HL6A 3G4SS 4IOCQ 2FHOB 3UCZP 1BY9A 2M7SA 2FC9A 1P27B 2DNKA 4C4WA 5ITHA 3CCRS 2MKJA 1U2FA 2CQDA 2HVZA 1WI8A 1U1KA 2MQPA 4TU8A 2N3LA 2M88A 3CCSS 2M2BA 3TP2A 2X1AA 3I56S 4PKDB 1N52B 3CCES 3DLLQ 1NJIT 1FJCA 2D9OA 3NNCA 2MQOA 2QA4S 3K0JA 3MI7X 3VAKA 1FJEB 1YIJS 1B7FA 3IRWP 3IWNC 2DK2A 2LA4A 4ZKAA 1JJ2R 1X5TA 3VAGA 1WG1A 2KM8C 2LKZA 4C0OC 2RVJA 5DETA 2DNNA 2KI2A 3MD1A 2U2FA 4TU9A 3CMES 1WHWA 2F9JA 4ED5A 2RRBA 1X4AA 1VQKS 3BEGB 2MKCA 1DZ5A 1X4GA 1SJ4P 2K3KA 2JRSA 2MJUA 2PE8A 2KRBA 4QU7A 3ZZYA 1R8HA 2DISA 2YWKA 2LEAA 2SXLA 5D78A 1WEXA 3FEXB 1OO0B 2G0CA 2HZCA 3UCUP 1OWXA 3S7RA 1YITS 1HD1A 2CQ0A 3VAJA 1YWXA 1WELA 2K8GA 4U67Q 3VALA 2DNLA 1PO6A 2RS2A 2DGVA 2OTJS 1FO1A 1X4DA 2CQ4A 3CCJS 2CPJA 2MQLA 4F02A 2D3OR 3UD3P 1UP1A 1WG4A 2N3OA 2KFYA 1VC0A 2MHNA 2LYVA 2EK6A 2RNEA 1N8RT 1ZZNA 2DGXA 2JX2A 3VAHA 1H2TZ 4UQTA 3S6EA 2GO9A 1M5VC 3CC2S 1X4BA 4Y00A 2QEXS 1U6BA 2MKHA 2M70A 2CQBA 2N7CA 1M5PC 1R8PA 2M4MA 1OIAA 1VQ9S 2E5IA 2MQMA 2DO0A 2DB1A 2CQ3A 2M52A 2MZSA 2JVOA 3OW2R 2MSTA 2MKIA 2NZ4A 4C7QA 5EN1A 1SJFA 3R1LA 1JMTA 1X0FA 2ERRA 1P1TA 1WF2A 5BJRA 2UP1A 3MXHP 5DDOC 3JB9k 3HHNB 2DIUA 4J5OA 1HA1A 1WF0A 2CJKA 2NLWA 1O0PA 2HYIB 1D8ZA 3RW6A 2JWNA 2LMIA 5CYJA 5HO4A 2RU3A 3CCMS 3L3CA 2G1DA 4IO9Q 1FXLA 1M5OC 2DNOA 1G2EA 2MJNA 2HGMA 1X5OA 4PRFA 2DNGA 5FJ4A 3U1LA 2J8AA 3BO4A 3NS6A 4P6QA 2XNQA 3G8TA 3H2VE 1U1RA 3CTRA 2LXUA 4EGLA 4Y0FA 3CCLS 2DHSA 2KN4A 2I38A 3G8SA 3MD3A 4QU6A 5GVQA 1SXLA 1UFWA 2ADCA 3S8SA 4LJMA 2PEHA 1VQNS 2DGUA 3TO8A 4FXVA 2AYBA 3G96A 2MQNA 1FHTA 2MKSA 1NU4A 2DNMA 2J76E 2HGNA 2AYMA 1VC5A 2CPXA 1X5SA 1Q7YT 5IM0A 1VBZA 3P3DA 3Q2TC 3D2WA 1U1NA 2M8HA 3NMRA 1H2UX 1WEZA 4OZ0A 3EGZA 2ZJPQ 2LQ5A 2M0GB 3MDFA 1YI2S 1DBDA 1WHYA 5HL7Q 2DHAA 2KYXA 3LQVA 1WI6A 3G71S 4IUFA 2N82B 1Q81T 1A9NB 3V4MA 1L3KA 1VBYA 3CXCR 4V19X 1KOOA 1WTBA 2OJ3A 3G6ES 2AYEA 1OPIA 4W92B 3NNHA 5GMKa 1JJ4A 2XS5A 3MUMP 2DGSA 3UWTA 1IQTA 2I2YA 4UY8T 2FC8A 5DDPC 4PR6A 1U1LA 2KXNB 3CC7S 3CMAS 1WG5A 3PIPQ 2OSRA 4Z2XA 3VAFA 1SJQA 3BO2A 3NNAA 5GAEU 3THTA 2DGWA 3CUNA 2YKAA 2WBRA 3J7ZT 2KG0A 2OIHA 2X1GA 2F9DA 3B4MA 3PIOQ 2KM8B 3UE2A 2DNZA 4TU7A 2D9PA 2QFJA 2MGZA 3VAIA 2CPYA 4CQ1A 1Q82T 1DRZA 1K9MT 1VQLS 2VOOA 5LSLA 5GAGU 1FNXH 2FPHX 2Q79A 1U1QA 1S79A 1VBXA 2M8DB 2VOPA 2MZTA 1ZZFA 3EGNA 1AUDA 3UD4P 2MY8A 2V94A 2E44A 5JVGQ 2CPZA 2M9KA 1N54B 1A7GE 4F25A 1QVFR 2DITA 2FY1A 5CA5A 1RKJA 1KC8T 2MPUA 1SJRA 2DHGA 3R1HA 4A8XA 1YJ9S 3CD6S 4CH1A 1QM9A 4CH0S 1CVJA 2HGLA 2YH0A 1SJ3P 2KT5A 1VQ5S 5DDQC 2J0SD 2XB2D 2E5HA 2CPFA 3B4DA 1WHVA 3SDEB 2KVIA 1NO8A 1U1PA 2X1FA 2A3JA 2DNQA 2BOPA 2CQ2A 2L41A 3US5A 2E5JA 3J7YU 2U1AA 5LXRA 2GHPA 2RS8A 1KD1T 1XN9A 1Q86T 1X4HA 3RW7A 1M90T 2BZ2A 2LEBA 3P6YC 5LJ3Y 2XNRA 2KXFA 4WFNQ 4TLQA 1VQ4S 5IFMA 3VAMA 4WFBQ 4WIIA 1DHMA 5D77A 5GAHU 1QVGR 4WCEQ 3G9CA 2J0QD 3CC4S 1VQPS 2CQPA 2RQCA 1YJWS 1S72S 3Q2SC 2KXHA 5H1SV 2MY7A
chains in the Genus database with same CATH superfamily
4WE1B 1FCAA 3LP0B 1Q8KA 4EO8A 1HI1A 1HYSA 1VHFA 1S0MA 4MIAA 1PGZA 4ZS6A 3HKWA 2DKOB 2R9LA 4ZVPB 2JEFA 2FVCA 5KT2A 1WDDA 2HFSA 4DF8A 4U7CA 1Q1KA 4JOUA 3MCMA 3DOMA 2WAQD 4OZ2A 4ENOA 1FVSA 5DDRC 1VHIA 4QQBA 1NPPA 3MECA 4LR8A 4TXSA 5E2QA 5KFOA 1U6FA 3IS9A 3E01A 2L9WA 2O3DA 4UOCA 1IM6A 4H4KC 1RBOB 2KRRA 4LBHA 4J9KA 3GIIA 2ZE2B 2EVZA 3KJQB 3O5TB 5LSRA 2XGQA 1TKXA 4JV5F 1WC4A 3GV5B 2XY6A 3KJVA 3M1VB 5FDLB 4K2JA 5D3GB 1URNA 5LT5A 3U1MA 3PW5A 6AT1B 3H59A 3T5HA 1P1LA 2VG5A 2VKZG 2VQEJ 3A1YG 2KKHA 5DRKA 2HK3A 2M7SA 2MKJA 3PM9A 2M2BA 2QV6A 4FF3A 3P45B 3GJRB 2HIYA 2YQ3A 1N52B 5AJ3J 1T9XA 1TR0A 4HACB 4CO4A 2Y8WA 4E98A 2U2FA 3CMES 4UOHA 1TQLA 2F9JA 3DDIA 1N6QB 2JRSA 5F8MA 3BGRA 3H40A 2MJUA 3H2LA 3ZZUA 2JEGA 3IBFB 4QWBA 4DV5J 5L9NA 5D78A 1VR6A 3FDSA 1OWXA 1V3ZA 2UUBF 4K2XA 2DNLA 2VJUA 3D6HB 4FF4A 2LVWA 4ZPVR 4LQ9A 1RHQB 2A2CA 5E3QA 4F02A 4Y2CA 1FEEA 2IM1A 3I0RB 2B8PA 3A8JA 2K7KA 3MEGB 2YNGA 4I0WA 2PT0A 3T1AA 4YS2A 2NYHA 2V63A 3N79A 3EM1A 1JMTA 4MYTA 3T9ZA 1MU2B 2C22A 5E3AA 1WF2A 2R2TA 4FVMA 1UCNA 5HROA 4DQPA 3BR8A 2PMHA 2NLWA 1RI7A 4KBIA 1KTVA 4O0NA 3ZXWA 2CAJA 1FXLA 4ZCLA 4X4TA 1KHVA 4PRFA 4USJC 3KHGA 2DCUB 4PXCA 2XNQA 3CCLS 3TAQA 4URQU 4YR0A 3UN2A 1HBOB 2AQ4A 3OUYA 2IM0A 2XBPA 2AP6A 5IM0A 1VQSA 5ETRA 2IM3A 5C2CA 3RB4A 1YI2S 4DS4A 4NXMJ 1RU1A 2Y1JA 5M2RA 1G1XA 4V19X 2ZUGA 3VHQA 1OPIA 2W2MP 3NNHA 4I6WA 2KB2A 1FD8A 2QL9B 2KJWA 3CJ3A 2HS4A 5DDPC 4PR6A 2UUTA 3MR7A 4YQWA 2E9TA 2KHDA 5KFFA 1F5CA 2WB4A 2EKNA 1DFDA 1DQAA 1D09B 2NXJA 3CD5A 1V3SA 4LFAJ 2VV5A 3NAHA 3FCWA 3KHRA 2Q79A 1VLYA 4TY8A 1T03A 2BJDA 3HSZA 2HURA 4NA3A 3J7AN 1YGYA 2DHGA 4J9PA 4C0HA 3QT6A 4USHA 3DI6B 4DXLA 1GEHA 3CVKA 2ZHBA 2VFVA 3CJRA 3F56A 2DVIA 4ZP8A 3R2CJ 1S97A 3ICLA 3QAUA 1TKXB 2E5JA 1KD1T 3GIJA 1XN9A 4OJ1A 1UTAA 5LJ3Y 3WIVA 2VASA 1B7YB 1I94J 1U0SA 4LF9J 3VAMA 2OLWA 3T6BA 2LDYA 1VQPS 4DSEA 2IAJB 1YJWS 3GB0A 4LF8J 2CJ9A 4HHHA 1IBLF 4CYUB 4W90B 2BM0A 1H7XA 2YH1A 2UUAF 4KFBA 2Q1LA 2CVEA 3DXBA 5L46A 1NKCA 4M5MA 1QE1A 1VK8A 3QIPA 3ULHA 4USIA 4RZRA 1NJZA 5J1EA 2CQ1A 4KO0A 3TYTA 1NZAA 5K14B 1IQZA 4LMZA 2FZGB 3R7BB 4DV3J 3QWUA 4W4MA 2DNHA 1QTNB 1YKWA 4J90A 5HVHA 5HBMB 2W8LA 4ZVHA 2E7WA 5JJBA 2UXCJ 5GAEI 2ROGA 4ZCIA 4OI0A 1UEKA 3ZO7A 3UQSA 4HI1A 4LVOP 3MEEB 2V8VA 3A3PB 2CPIA 5C5JA 2IBOA 4H4KA 1Q95G 5D15A 3Q8VA 2P9EA 1FJGF 2CPHA 1CEZA 1UW4A 3W8GA 3JYTA 4LR9A 4ELTA 1UWAA 2VICA 4KSEB 3OL7A 4DR2J 2L48A 3LA0A 2MGZB 4ECTA 3THVA 2AEJA 3OSPA 1JJHA 2DNRA 5KFTA 4IOCQ 3KK3B 4NLYA 3MPWA 2HBZB 1B0PA 1HHTP 2F5GA 3UO0A 1K1SA 3DM2A 2OPQB 3FRYA 3GILA 1S4EA 3AHPA 2RILA 1B0VA 4ZP6A 3I56S 1LW0B 4JI2F 3CCES 5EWGA 1C2PA 1TAQA 1T7PA 1RKIA 4A8SA 2DK2A 4ZKAA 1OYDA 2DR6A 2ZH3A 5CYQA 3OVAA 4HDHA 2FJBB 4IO1A 2GHWA 4WTYA 3A3OB 1U02A 4K4UA 3OUYB 4FBTA 4IH7A 1RTIA 3BZQA 1Q16B 5KFBA 2FGCA 2VPYB 1F6TA 1C0UB 5F8GA 2SXLA 2HVDA 2HZCA 2NREA 1RA7A 4PYDA 4UOFA 2XSJB 9ATCB 4QIWD 1Y7PA 3WX4A 5IV4A 2V2VA 2BKNA 4NXNF 2W9BA 2EK6A 1IUJA 3J81U 3KLHB 1H2TZ 1M5VC 1X4BA 2M3DA 2N7CA 1R8PA 2E5IA 2G1HA 4DV1J 1N5YA 4JYAF 4TVAB 3QZ8A 2YWHA 2VFUA 1IM4A 1R8AA 3A4TA 1HFEL 3D6MB 1RT6A 4M94A 3KNGA 4EEYA 4JI6F 2IJNA 3AJDA 3RW6A 1GMUA 2PSZA 3MM8B 2JLGA 4JI5J 4F3QA 3H90A 3ZTQA 3EZ5A 4RWXA 3Q8YA 2C3YA 3NGDA 1FKAF 1QD1A 2FHKA 1PG5B 1NEEA 1IKVA 4QU6A 3H5UA 4F3OA 1RLDA 1SXLA 4CNZA 4LJMA 2Z2ZA 4AUKA 3W5YA 4HEA9 5CYMB 4DQRA 4A8KA 2L9DA 4USTA 2QC3A 3M32B 1WHYA 4YB5A 4XK8C 3PW2A 2BE2B 3VGSA 1NDLA 2J7KA 4M5IA 2WBMA 2MLYA 3T5JA 2H9ZA 1EKSA 4CNYA 5H9EK 3VVTA 4C8NA 4NLDA 4ANCA 4LQ3A 3PIPQ 4KFBB 2R7UA 4P9SA 2R7OA 5C25A 2ZH8A 2O67A 3TUIC 4LR7A 4JV5J 2CPYA 3NWGA 3TWZA 2A1BA 4QW9A 5GAGU 4NE9C 3CNQP 3WDOA 1ZTTA 4CO2A 1S9GA 5CA5A 5F41A 3NMAA 3EWGA 1HIYA 4Y2IA 3NG8A 2J0SD 2ZM6F 2HFUA 4PQUB 4LFBF 4IH5A 1U1PA 4QIEA 1RUSA 5G0RB 4CLFA 4RW6A 3M8PA 3AFGA 4X2BA 4DPYA 1ZS6A 4YEAA 2ROEA 5IFMA 1NHUA 3G9CA 2DT9A 2CQPA 2P2CB 2OAUA 1KVJA 3GZ7A 3JTNA 1T0TV 4MJKA 2F7VA 4OZJA 1H72C 2BYCA 3HHKA 4P7TA 3THPA 3GIMA 1KLMA 3R8YA 2DRAA 3MM9A 4R8UA 1P9QC 3R9LA 4BC7A 3CCTA 3UW1A 3BR9A 2CQGA 5H9EJ 2R2UA 4DR6F 1Y3KA 2UUBJ 2P9GA 1HMVA 2VFRA 2LXIA 3CCZA 1EB0A 3V2UC 4C8LA 2DNYA 1NSPA 2XZDB 3N9UC 2GAGC 1V5VA 3SMZA 2KH9A 3W66A 1UVKA 4RUBA 2HRYA 1RTIB 4IQXA 1GMWD 1N5VA 2XS2A 3UVJA 3ET6A 2IMWP 3KDOA 2CPDA 4RNFA 2XC9A 4Y28C 2XYHB 2QLFB 4M95A 2O1PA 2AMCB 4M5JA 3SI8A 1ZBTA 3PW7A 3MTJA 5J2MA 3CCUS 5KG0A 1QAJA 3R5AA 1N5YB 1N32F 1SH2A 3GIKA 4XTTA 2RQ4A 4EYHB 4B3TJ 4L6V3 5KFYA 2FC9A 2ZNZA 5K5MA 4U95A 4DHVA 3MHYA 2HVZA 1LWEA 3M6VA 4U7UD 2X1AA 1S49A 2RRNA 3LO3A 4ETZA 1YBAA 1KTQA 1S9EA 2QT7A 3HCXA 3DDNA 1FDNA 4TU9A 1X4AA 1VFJA 3MOZA 3D4JA 5IQ6A 2ZH7A 1ZM3A 4TN2A 3EVMA 3V6HA 4BLGA 4ER8A 1RCOB 1FDBA 2W1BA 4FNIA 4WP9A 3DU5A 4B9SA 4CDIA 2KFYA 2FJDB 1S1WB 2LYVA 1DTQB 1HLWA 1EJ7L 4B9LA 5DO2A 3RGIA 3OTCA 2E1MC 5ETNA 1ULRA 2JVOA 1ZM4A 2GCFA 3EUNA 1UEVA 1PSDA 3MM5A 4C98A 4J9MA 3T19A 2IBKA 5DDOC 2E29A 2ASDA 1KRPA 1SL2A 3OPKA 4PG8A 2RU3A 1XEZA 2G1DA 1Q5YA 4DX5A 4Q43A 3ILLA 1NK9A 2FJXA 1T8EA 3FNNA 3O1LA 4B9MA 1FX4A 4E0DA 1L3SA 2PEHA 4GKJF 3G96A 2O01C 4LSLA 5SUHA 2XMAA 3E2EA 3I5CA 1UJ5A 3NMRA 3CJ4A 4WTOB 5KT6A 4U6PA 3G71S 2WW4A 1O5JA 3OXFA 3ZFVA 4QWDA 2HEKA 1YZ7A 3B6BA 2RUSA 3Q83A 2WCXA 1KLMB 3R7SB 3BV8A 3MM9B 1S99A 3OJSA 4H4OA 3J7ZT 3TVKA 1U0HB 2W7AA 2KM8B 4ES3A 4ZLPA 3K5MA 4JV0A 1SQGA 1K9MT 3C6TB 5B7WA 1MW7A 2C1EB 3W60A 3N01A 2MZTA 2J6TA 5F3TA 1XR7A 4KAIA 2MPUA 3R1HA 5A6WA 3CJ8A 4NEYA 4F8RA 1BQMA 4N8OA 5DDQC 4NZ7A 2IJRA 1HWLA 1EZZB 3ET6B 4WP8A 5K20B 5LXRA 4X4UA 5C42B 3M8ZA 4HVZA 5AE2A 1M90T 3OFHA 2BXJA 2XYPB 4MYUA 4DMZA 1VQ4S 1CJVA 1R3NA 2RHSB 5J2MB 5GAHU 2R8HA 2QL5B 2A6OA 2ALYB 3LALA 3GV8B 2JC0A 3HLUA 4OYPA 4JUZA 1V6HA 2GAHC 2HQGA 4N7TA 3K17A 4QYRA 1YRUA 4BS2A 2H65B 2XG8A 5B0AA 3TAMA 2Z2YB 1PKUA 3CDEA 2D7SA 3SFUA 2Z57B 3F0NA 4EO6A 1F2HA 2D41A 4DSLA 3OTOF 1WSVA 2HQ3A 4HI2A 4ECVA 2P9CA 4OYMA 4DR1F 3UR3C 3OJUA 4NXNJ 5DQGA 1SUQB 1CC8A 2GJ2A 4L73A 2NSCA 2RH3A 4JYAJ 3I55S 3MGJA 1WOPA 3TNVA 1BUXA 1LW2B 1TUVA 2VODA 3SDEA 4LSNB 2F63A 3JQMA 1S1XA 4JI6J 1VQ7S 4LIRA 2Y3YA 4J9QA 1S76D 2DIVA 1B4SA 3HHDA 1A6LA 2KZZA 1NJYA 3MR5A 3CULA 1RT3B 4RW4A 2PI5A 3BF4A 4DLGA 1B0TA 1BLUA 1SI9A 2CNOB 2B4OA 3AQPA 3MUVP 2ACYA 1RT2B 2DH9A 2QFIA 2KT2A 1S6QA 3J7YI 2NUHA 2WSFC 4WPAA 2FZKB 4PG6A 3M8RA 4PXDA 1IVZA 1B7FA 3IRWP 1MN7A 2LA4A 1N0UA 1X5TA 4FN5A 1YVFA 4Z7YA 5T41A 4NLQA 2RRBA 1VQKS 4ZPCA 1D9DA 1BD6A 2ZH9A 4AT1B 1U8WA 2DHHA 2BABA 4LSZB 3CJ5A 4P74A 4RLEA 5U47A 1T02A 3OVBA 1RTJA 3VAJA 3FBBA 5LMUF 4U67Q 3VALA 1Y00A 4P2SA 3C66A 2OTJS 1CG2A 4YB6A 4C8ZA 2F65A 3QRQA 3MM7A 1CS4B 4UF4A 4YHHF 2GO9A 4DQIA 1N36F 1KFSA 4WIQA 1VQ9S 4K50A 5ETLA 2CQ3A 4C8YA 4NRUA 2ZM6J 4H4OB 3LH2S 2QN6B 1TV6B 4LFBJ 1FNMA 5M2UA 2FJVA 3JB9k 1R89A 2QRRA 4PUOB 1JWWA 4XPEA 4J9UE 2AJ1A 4J9RA 1RACB 3RJMB 3L4BC 1UPMB 4LUBA 1WTFA 5FJ4A 4M5DA 1J2VA 1RT4A 1DJ0A 1F60B 2L3MA 5F8NA 2ZC3A 1VQNS 3CIZA 2CPXA 3KOAA 4NCGA 2R2SA 1VBZA 1I5OB 2V4JB 5B0GA 1TVRB 4DN0A 3FZ2A 3IR6B 3U27A 2HVEA 1T95A 4MMOA 4DR3F 2CUYA 1ZA1B 4AFFA 5J2PB 3D0IE 1OYEA 1VOMA 4ECRA 2HNZB 1V3RA 2XS5A 2WVEA 1GX5A 2JC1A 4Y65A 5L1JA 2GVZA 2PMZD 3C14A 4OIXA 3DMJA 3VAFA 2Z0GA 1SJQA 1SL1A 3UNGC 5GAEU 1VRQC 2W9CB 5KT4A 4OI3A 1BHNA 4ICLB 3M9OB 2W24A 1XK8A 3QSIA 2AWZA 1FRHA 4AL7A 5A0YB 2YNIA 3C6UA 5KFSA 2VOPA 2CKWA 2BKPA 1SV5A 4OYIA 4LIWA 1QUPA 1D0EA 2MKYA 2CPZA 3KWMA 2M5YA 4QR2A 3G2XA 3FVYA 3NCRA 1YG0A 3ZZTA 3H5XA 2XB2D 5DGBA 2UXBJ 2QSWA 1WHVA 3SDEB 1TMJA 3RBEA 2PGCA 3I4PA 3H98A 2BOPA 1WD6A 2CZ4A 3BM7A 2B4UA 4WFXA 1MROA 1R8BA 5HLFA 3CD0A 2EFNA 3IAM9 5KG1A 1HR0F 4JI7J 2V8DA 2DR7A 4UUXA 1DLOA 1RHRB 1BQNA 2OPRB 2DTJA 3EVOA 3CB4A 4QZVB 4C11B 1TKZA 2A10A 3D67A 4MKBA 4CLUA 1LWCA 3NS5A 2BA9A 3I4HX 2IMOA 3PRVA 2CJYB 1X9WA 2E7VA 3W3SA 4ILLA 3FK4A 1YJNS 1EHWA 4PABA 2RF2A 2DO4A 1KN6A 1HNWF 3H4BA 1QAXA 3H2UB 3UCGA 4PZVA 4DI6A 4KRWA 3VF0B 3FCHA 3RRGA 2DYAA 4TYBA 2FVQA 4A8QA 3NL0A 4I69A 1RAEB 1SKSA 5IT9U 1UETA 2GVDA 3L7UA 4HYKA 3QZ7A 2MZRA 3JTPA 2EFPA 2IFXA 5HMXA 1NZ8A 3GIRA 1N5TA 2BKOA 1X9SA 1LWFA 2JH3A 3ILJA 4OJGA 4CO5A 1VI7A 2RMLA 3D54A 2L08A 3JSMA 1RTJB 2B6AA 3MAAB 2ILZA 2ADBA 4CLKA 2VONA 3RR8A 3SQOP 3F44A 4RBVA 3E3XA 5I4MA 3MPDA 3N0VA 4CLWA 3HPOA 4C8KA 4DFMA 3MMCA 2UUWA 1QAIA 1ZA2B 2UUCF 2V2KA 2ZOGA 4FZVA 3HVTA 1RT7B 1RTDB 2RIJA 3MMBA 1BC6A 2F4VF 1UJ6A 1T9WA 3R5GA 1IKWA 3PR5B 1RT5B 4GKJJ 2ZFHA 3BGLA 4WFAQ 1SC6A 4S0MA 3HSGA 4PQAA 3TRGA 2J6UA 4KTQA 1XQIA 1RTHB 4AL5A 1RT4B 3DLJA 4DR7F 1KONA 2H5JB 4DSJA 1FWLA 4NI2A 3DYAA 5KFVA 5AXKA 1CULA 3HHEA 4J7CA 3Q89A 1SJ4P 3DKDA 4NEZA 5ETKA 1Q5VA 1RWOB 5HP1B 2QLBB 2CNNB 3GFHA 3UCUP 4ATNA 3HP6A 4Q45A 1RAJA 4ZLLA 2C2MB 5A8RA 1VIOA 3BGOP 2R2RA 3J7Z5 2WHOA 3DLGB 1JXVA 1NDKA 1X4DA 1C0TA 2ROPA 4IH6A 1S1VA 2HHUA 1UL3A 2RNEA 2PA3A 1ZZNA 3X1LB 4YY3J 2OP5A 4RW8A 3EYZA 4NRTA 2CQBA 1JLEB 2M4MA 3BYRA 3M8YA 3MM6B 1RT1B 4DFKA 2M52A 3JS9A 1JLQB 2DY9A 5J2NB 2BRLA 4IDKA 2R7RA 2XMVA 1X0FA 4LFCF 1EKRA 1GT8A 4A8FA 5F0UA 2HVIA 2EG1A 2BBEA 4ECWA 4OHYA 1VCTA 2IM2A 3CCMS 1NSAA 3BN7A 3R5BA 2YNIB 3C6UB 3U1LA 4NLUA 3L95X 9RUBA 4P6QA 4EFAC 3OL6A 2QX0A 4ZLNA 1DY3A 2HRTA 5I3QA 1SIWB 3MD3A 3NGTA 3HJFA 4KH0B 3S8SA 4BBYA 4QOTA 1U25A 1IKXB 2NXCA 5DS7A 1MROB 2OHDA 1KKHA 4DPOA 2M8HA 1K44A 1HNVB 4N77A 1KQGB 5D8HB 1JNZB 3LP1A 1U7LA 2GMJA 2LQJA 1OQ6A 5ETVA 3M8QA 2QA1A 4GKKF 4DR1J 1FVQA 1LV5A 1TKZB 1H73A 3TA2A 1Z1ZA 2W25A 2AYEA 1R0AA 3EVWA 1LWCB 5AXLA 3G82B 2ZBQA 4I64A 2VF3A 2K1RB 8RUCA 4LF6J 3PJ9A 4A8WA 2HLUA 1HNXF 5L39A 3NAIA 1RAIB 2D9PA 4M5GA 1QSLA 5EWFA 3GTYX 1VQLS 2ZOFA 5KOWA 2M8DB 2XWYA 1F9EB 3EGNA 5BR8J 4OI4A 2W4DA 2R8GA 4O44A 1N54B 3ENWA 2C2EA 2PFFB 4A8XA 3CD6S 2DXDA 2J9DA 4ZHRA 2AKWB 2ZITA 1QM9A 4G1PA 1CVJA 2YH0A 2I1RA 3OFFA 4HT7A 4BC9A 4GVBA 4YFUA 2KVIA 4ZVOB 2Q3PA 2VB6A 3DLKB 4IG3B 5D0HA 4DV0F 3NY0A 2L41A 1TFWA 3KLGB 2YY3A 3NBPB 2V68A 4WFZA 2DR5A 3MMCB 1XMOF 2A18A 2OELA 3HVTB 4GC7A 3H0PA 4DQQA 3HHLC 4DLEA 2FVSA 2VFSA 4OHVA 2FLLA 3TZXA 2XI2A 4F04B 3MZIA 2F40A 4X4NA 1FK9B 3H7HB 4FXDA 4NOHA 2ZJRQ 1HBNA 3SBMA 2HHWA 1GXUA 5LMUJ 1HNZF 3HSDA 1VQ8S 2B43A 5KT7A 4OI6A 5EDWA 1CLFA 1NJWA 3QJJA 2LU2A 4PCQA 3M9MB 2E1PA 4YHHJ 1D8YA 5JMNA 2XHCA 2MZ1A 1VQMS 1N36J 1VQOS 1XNRF 1SB6A 1OSDA 4KKOA 4USUA 3QJLA 3RYLA 2FHJD 1H74A 3PR4A 3HVWA 2ZJQQ 2VD3A 4DL7A 2VG7B 3OD2A 3JXOA 2QMUB 2BE9B 4OZ1A 2I0XA 3MAHA 4W98A 4OZNA 1C0TB 3MCOA 2XSFA 2D69A 4HKQA 3CJKB 1K8AT 1O51A 1X9MA 4HL9A 4EYIB 1WORA 3P49B 5D0RA 3ETMA 4O4GA 5HJXA 2WOMB 1NM2A 1EAYC 2MYFA 2OD6A 1U6ZA 1SJ1A 2VFTA 1X4FA 3SQGA 3OTDA 2AJ2A 1X5PA 1HL6A 3Q8SB 1GXTA 3KHHA 1T9TA 3UCZP 1Y0HA 3SIPB 1YJVA 1I6JA 2CQDA 2GHVC 2MQPA 3GCXP 3BJYA 2D9OA 1E6VA 3MI7X 3W2VB 1YIJS 4FYXB 4ANDA 3H20A 1AZSA 4DX8H 1RLCL 1OSCA 3QPIA 2VG6A 4IFYA 1U26A 2KI2A 1Z2LA 3BEGB 4YDXA 3RTVA 5ADZA 2XLKA 3FSXA 3Q8PB 3F73A 3FSIA 1XNQF 2YNHB 1XIQA 5J2QA 3LP1B 4JI1F 3NOGA 1HPZA 1VS3A 3DOLA 4BHQA 1KSPA 1CBKA 2CQ4A 5B0DA 4DU7A 3GMGA 2D3OR 2N3OA 1VC0A 3M2RA 4DZ6A 2C3UA 4F2SA 2J0XA 1U4BA 1SL0A 1S77D 1JLAA 3HSJA 4Q0BB 1PBUA 3AT1B 3QLHA 1P1TA 2G13A 2UP1A 2DIUA 4KT0C 3GLJA 3VGTA 2Y8YA 2B4VA 2CFXA 2W7PA 1T94A 2YWFA 1M5OC 1NKEA 2HHPA 3HT3A 1X5OA 2AX0A 4DR4F 3IWXA 3RB3A 4M5LA 3K5NA 1F9HA 1VK3A 1S57A 2VDHA 3N28A 1NKBA 2AJ0A 1PC4A 1FXRA 4I2PA 1SCJB 3ZTSA 3I0SB 3WIUA 3I9ZA 4IRDA 3DRYA 2B56A 4ECSA 1BXNA 1Q7YT 3P3DA 1PBAA 1HNWJ 4RW7A 1WEZA 3IM8A 4ZPWR 3MDFA 2P6TA 2XMWA 2YKNB 1U2RA 5KFLA 3PX0A 1Q81T 4LF5F 2Y9HA 5C24A 2Y1RI 4OYAA 2E66A 1JLCB 3TARA 1M0SA 1KOOA 3KK1B 4HHUA 3ITHA 3G6ES 3FBEA 5K9FA 2OPSB 4Z7CA 3I31A 2KTQA 1ICEB 1UWBA 2QIFA 1UVMA 2K3IA 2YKMB 3KK2A 3G6YA 4K7QA 1HBNB 4AE5A 5KFJA 1MMLA 3V6DA 3QAEA 4B3SF 2ZD1A 2QFJA 4F4AA 1JLGA 1XR5A 2CJAA 3RZAA 2F4FA 3O3LA 1XJWB 4RJVA 2VZ9A 1S6PA 3GJTB 5J1NA 2DPIA 2E44A 1JLFB 4R0EA 2BJ7A 4DUTA 6FDRA 4DV2F 5GAGI 1XBWA 2KT5A 2MLZA 3PW4A 3JQJA 1NJXA 1GXLA 5K8NA 2BRKA 4P71A 4B9TA 1C1BA 5KFCA 1RB0A 4X4SA 1B70B 2C3OA 5DG7A 3J7YU 3DGVA 1RAHB 2BW7A 3PYFA 2HKEA 5CHCB 5KFXA 3VWSA 2X7IA 4Q7AA 2OD4A 2QMWA 2B5JA 4G1QB 1T9VA 2RQCA 3PYEA 5E3RA 4RBUA 3PG9A 3HHLA 5H1SV 1GMVA 4G1IA 1RJJA 3K57A 3SQGB 3DGPB 1T9YA 4K5SA 2MSSA 5KTQA 2ALZA 1MLAA 5IXUA 2XS7A 1K0TA 2GNKA 4DS5A 1Z2ZA 4CIOA 1TL7A 2VJVA 3TEGA 5B09A 3QRRA 3R27A 1NRKA 4AQYJ 2HNYA 4J91A 2J0WA 1WWHA 2YX4A 4I68A 4HLBA 4ED4A 2ACMA 5CABA 3QFHA 2EK1A 1M1KT 3OFEA 4C8MA 2GJIA 1R8CA 2VPWB 2JEIA 1WHXA 4WKRA 3KLIA 2IHR1 4IQMA 2R8KA 2RQMA 4ED0A 2YBVA 1M1GA 1FRJA 3T5LA 3QJPA 1NSKL 1XMQF 4MKYA 1IR0A 3M2RB 3LUYA 3CF5Q 1FRIA 3JTOA 4OQJA 1Y10A 3KLFA 2G4BA 1O6XA 1S59A 1EP4B 4OX6A 1RYRA 1JQGA 2CQIA 3CGIA 4AYBD 4Y2MA 4H4MB 5KFGA 3BDEA 2EC2A 3TUJC 1FERA 2OUGA 1U24A 4YN3B 1P27B 1FDDA 5ITHA 3CCRS 3HXMA 4DSFA 2F8EX 4P2FA 4NLPA 4PKDB 3NRBA 3DLLQ 3A8KA 3NNCA 4GKKJ 2HMIB 2ZEJA 2H5IB 2DXEA 4DL5A 5E3PA 5HVFA 3A12A 1M5HA 2IVMA 4PG7A 4RBTA 2HZVA 3MCNA 2HHQA 3ZNJ1 2WB1D 4UZBA 1CJUB 1LK5A 2OFGX 3GG1A 2BDPA 4LBIA 1WACA 2QL7B 1J5OA 3MF5A 2PN6A 3MEKA 3TUPA 2G2ZA 5C24B 2IC3B 1WJ9A 2Y0BB 3PXGa 1SKUB 3W5ZA 3SSQA 1SIZA 5A6PA 3AY0A 3SZ2A 1HWJA 2V50A 1UWBB 2GX8A 4X4PA 3M2UB 1HBMB 1KBRA 2CYYA 1NB7A 3RRHA 2I5JA 3SSSA 3W1YC 3DOKB 2KT3A 4DV0J 1HA1A 1WF0A 2F8MA 4JI0F 1OY6A 4QIVA 1TKTB 5CYJA 2HS3A 1S1UA 2DNOA 1G2EA 1S6PB 1XMOJ 2J8AA 1S1TA 2EEYA 1P9YA 3POTA 1UFWA 4JV2A 4ETXA 1NHVA 2HQCA 1C1CB 4K5RA 4O0IA 3KNAA 2HFVA 5GMDA 3G8QA 4K4XA 4I4BA 3BKFA 4ID5B 2C2KB 2M0GB 1HNZJ 1KWMA 1N34J 2KYXA 2VDIA 4X4OA 2NCKL 1F0XA 2B5JB 2Z30B 3N6NA 4A47A 4RX6A 2H4YB 3QO9A 1DURA 1LQ9A 1PYSB 3PACA 1T3NA 1RWNB 3GJSB 1ZOTA 3NEKA 3BBFA 3KUEA 2ZDPA 1JJCB 4DUYF 4G3IA 2QE5A 5ETSA 5CAAA 2OIHA 1TL3A 4B9NA 3NP5A 1F3VA 3MEDA 4A8OA 4OI2A 1S0VA 1IBKF 2ABYA 4EU0A 3C15A 2HNYB 1BE4A 2EFQA 4K0KJ 3CSKA 3ZZRA 4OX9J 3T6JA 3UD4P 4NYPA 1YK9A 4RL1A 2AEMA 4C6AA 1U47A 2QYGA 4OMFG 1HQEB 4AD6A 3GFZA 3R5JB 1BGXT 1LEOA 3HMJG 3WBZA 4MK9A 3VQTA 4O23A 4EBCA 2C28A 3N5BA 4NLWA 1MWZA 1B3TA 4ES1A 2KJVA 3ZNUA 1YLXA 3BB5A 3OR1B 1ITPA 1SH3A 4DEZA 1FXDA 4ZVFA 4KPCA 5KG6A 4CLTA 3KLFB 1S48A 3QNWB 3MPVA 3ZTPA 3W7BA 4CH7A 2QA2A 3IGVA 2DRBA 3KHLA 1R7IA 5GAHI 2YTCA 2OPPB 3MMAA 4KC5A 2ZZTA 4ZVQB 3H5YA 2BJ1A 3Q0AA 3IG1A 4NLXA 5F0WA 2PI4A 4ANEA 3CCQS 3OR2A 1YQHA 2AHOB 1B99A 4WJBA 1DQ9A 2DNPA 1HQUA 4R5PA 2ZOMA 1FJ7A 1NHKL 2J9DE 4OHZA 1T05B 2W4CA 4BWJA 5DZ7A 1SVDA 4ZOSA 2AIRB 4QWCA 1KNZA 5JVHQ 1WEYA 4WK1A 4B3RJ 5IC6B 5CZXA 1MNEA 4RU2A 1VRUB 1DTTB 2LA6A 4HH0A 3ZZOA 4DR4J 3EXYA 1RWWB 3R5DA 1KQSR 4YUDA 1TFYA 2VKRA 1EETB 1FKOB 5A2QU 3NGUA 2JEJA 2YNFA 4O3OA 1TU0B 4LF7F 3CEDA 3C16B 1CJKA 3HFZB 4MT1A 2XO7A 2OI2A 3DHXA 3FCVA 1L3VA 3M30A 3T1HJ 2DNKA 3OV7A 5L9XA 4EBDA 2BANA 3R6GB 4J9SA 5HMYA 3TP2A 1FRMA 2FIUA 1FJCA 2ZH4A 4LF5J 1S1TB 5D0EA 1FJEB 3CJ0A 5F8IA 1E6YA 3NGSA 3CMQA 1X60A 2IYIA 2LKZA 4LBPA 1R43A 3POTB 3LP2A 3MTKA 4X66F 3V81B 3CO9A 5EUHA 2XYGB 4ED5A 1X4GA 3HT0A 2FB0A 1KVIA 1FKPA 3ZTRA 3PFOA 4B3SJ 4ECXA 1YITS 1NBEB 3WQPA 3BBBA 4D3GA 1HYSB 4B17A 4F4ZA 4KH1B 4C3MA 1FE0A 3PRDA 3K89A 2KVQE 2RDJA 2H5EA 1N8RT 4UQTA 2O66A 3BREA 3Q8QB 4Y00A 2MKHA 3N5FA 4DV2J 5BYRA 3NKYA 4ZCKA 4G65A 4LRDA 3DOMB 4F4YA 5A8KA 1JNRB 4FNHA 3QGGA 5BJRA 2EPIA 3MECB 4BCAA 3H5SA 4Q44A 3IS9B 4WXWA 3AOBA 3E01B 1D8ZA 2CG8A 5I42A 4O3SA 4EI2A 4AL6A 3KFWX 4ZMMA 3OLBA 2GW8A 4CLPA 3G8TA 3H2VE 2V2ZA 1VRTA 4GMKA 4Y0FA 3KJVB 4KV8A 2RAQA 4LF1A 5IWAF 1R0CB 5G4DA 3BSOA 4U8YA 3BDPA 1YJTA 1FHTA 5L1LA 2KFNA 2CWXA 3GP9A 2LQ5A 2VG5B 3PKMA 3LANA 4LT6A 4JBCA 1B64A 1G7CB 1NAQA 1F5BA 2G0IA 3KTQA 5K8OA 1RHJB 2B9YA 2YKQA 4LF4F 2DGSA 1GX6A 5DQHA 5HJYA 5KFNA 3BO2A 3IC1A 1QDUB 3OTEA 4IG0A 2BVZA 4MFBA 3D3BJ 1PJ7A 3BGRB 3M7VA 2FQQB 1UJ4A 3ILOA 4N41A 5E41A 1FNXH 4L76A 2NS1B 2WW8A 4K4VA 4B3OA 1HBUA 3M4XA 4R5PB 1R31A 2OEMA 2OKQA 4QWAA 4KPYA 1PJ5A 1YJ9S 3DRPA 2HNDA 5KAKA 3CWJA 3MPUB 2UVRA 2OO4A 3RU0A 3B4DA 2E1AA 2ZBRA 3BN4A 4ED8A 2DNQA 5EWEA 1HNIA 2PC6A 1SQFA 2WSCC 2YNGB 2HWHA 2ATCB 4I6YA 4PWUA 5HROB 4C0BA 5T7LA 2HBRB 2IPOB 5FD1A 2WVCA 2LU1A 1FRLA 4OV1A 2QMXA 3D28A 2BMBA 4F36A 4IOAQ 3J80Y 1U1OA 5AJ3F 3OBIA 5KFEA 2QG9B 5ETOA 5IQQA 1VYAA 3W9JA 2BANB 2ZKUA 2E5LF 2KO1A 1M5KC 2X1BA 2R4FA 4DG1A 1GTEA 1OS5A 3EX7B 1KR4A 4OL8A 1ZAWA 1ROFA 2XLIA 2YXLA 5E3CA 5IM0B 4AXJA 4EWTA 3PV8A 1Q8LA 2V2QA 3VZHA 4DV5F 1Y11A 1LFPA 2B0GA 2NZCA 4RUHA 1TTHB 5IOLA 1RSCA 3D5MA 3TZWA 3B54A 3HZEA 3M8WA 2MB0B 2HWTA 3O8WA 1UKUA 2RSQA 3ADAC 2XWXA 4M5HA 3PEJA 4FF1A 2CPEA 1NSQA 1FT8A 1TL1A 5LMNF 1RWXB 2ZH5A 4MKVA 2BQRA 3NLCA 4RUAA 2G2OA 4TQSA 2Y1IA 3OSNA 3T3FA 4ZN3A 4TY8B 1T03B 5A8KB 4UQGA 2GGPA 3I5AA 5LOQA 4YP3A 3D9BA 2FJWA 3IRXA 3KLEA 3VV2B 2PFDA 1U2FA 5A76A 2Z2LA 3JQKA 5I42B 1ZYQA 4U7UK 4OX7A 3K0JA 2FLOA 4OHWA 3VAKA 4TY9A 5DLGA 5KT3A 2HBQB 1NB2A 1JJ2R 5KFIA 3MCSA 3MFIA 2ZWOA 4KHPF 3TA0A 4ECUA 2FVPA 5ETMA 3VVUA 2HQIA 1DZ5A 1K47A 2YX1A 1NPRA 1WKKA 4DUYJ 4QU7A 1UFKA 3V4IA 3RAQA 1QSSA 2HHVA 4K4ZA 3FBFA 1JXLA 2EKYA 1IBKJ 1HHSA 1Y5IB 1UEUA 1FO1A 1QE1B 4FYVB 3QIPB 2Z58B 4DZDA 3ISNC 2D74B 5J1EB 2DGXA 5DQIA 4R0JA 1OIAA 4KO0B 4N47A 2R7XA 4LFAF 2RU9A 2MSTA 1NK5A 4O3QA 4JI3F 4V1Ak 3FMWA 2AEFA 2ZHOA 4DPWA 4EK2A 5EHHA 3LTOA 5GADI 4WE1A 4WYLA 3D0GE 2HK2A 3QYYA 1S9FA 4IFVA 3RBDA 3DRPB 4HDGA 3MR2A 4NA2A 3JYTB 2I38A 3G8SA 4MAKA 4UOGA 1VIXA 3GPAA 3EICA 3TO8A 1I94F 1UMJA 4LF9F 2J76E 2VIHA 2HGNA 1X5SA 1L3UA 3V6KA 1KDNA 1U1NA 4OZ0A 4LF8F 4ZVTB 1RP5A 2KFZA 3TX8A 1BWVA 1HKAA 2N82B 1A9NB 5D0GA 4O4RA 5T7LB 4CP5A 3DM2B 2QLWA 1H0HB 2DEJA 2ZE2A 3QATA 3P8BB 1IQTA 4FP9A 3CMAS 1F2GA 3QRPA 4CT9A 2HHHF 3W8PA 3IN5A 3DDKA 5CYQB 1KP6A 3M1VA 5FDLA 4F67A 2Z4PA 1LOUA 3B4MA 5D3GA 3GSIA 3ZTOA 3HF5A 4DV3F 2XTJP 1FFGB 3CW2C 3N4WA 2V8HA 5ETTA 2UXCF 4ES2A 4OYXA 3BQ0A 2IVFB 3CJ2A 5MAOA 2HHTA 2FY1A 1RKJA 3GV7B 4ZVEA 3ENAA 1V9OA 3AB2B 3H4DA 3LWMA 1J27A 3O2IA 4DWIA 2W9BB 2YWWA 1WUUA 4WZQA 4DR2F 5F8HA 2P8IA 3ONQA 4HACA 3CE8A 1XMBA 4NLOA 1Q8IA 1N48A 1YRTA 2KXFA 4WFNQ 4TLQA 3TEHB 4NYOA 2HSEB 1N6QA 1FRKA 1RT6B 3AOCA 4BWMA 2ZZNA 1TMMA 2W4PA 4OYWA 1EARA 5HQMA 2ATLA 4R25A 2AYGA 2RHQB 5CXTA 4DL3A 2DGQA 3EJMA 1KHWA 4CTAA 4RPFA 2BW2A 4K4YA 1JKHA 1IKVB 3QGIA 1VMBA 3I0RA 2RRAA 4F0HA 4XPCA 4MIBA 3MAQA 2FHMA 4FKYA 3HI9A 4FS2A 4NA1A 2GV1A 1RWMB 4F2RA 4DX6A 2AX1A 3ENQA 1H2VZ 2F8HA 3QT7A 5K8MA 5BYQA 1BWEA 5HQ8A 4A8YA 1HD0A 4YOEA 1VLOA 3NXZA 1N88A 3EGWB 2YPYA 2MZJA 3T1YF 1G3OA 3FSYA 2K06A 7FD1A 4DV1F 3AXMA 3TZYA 1HBOA 5C25B 3KYLA 2Q6BA 2HPUA 4FXWA 2JLFA 1Q79A 3DC2A 1MG7A 4A46A 4ED1A 3GYXB 1V5IB 1VGYA 2UXDF 2R42A 3GWCA 5IWAJ 3CCVS 1S9GB 2DGOA 5C2GA 3KMSA 1WC6A 1BY9A 5KT5A 2QSFA 4D3HA 2P6SA 1IBLJ 4NWBA 2V4QA 2E7XA 3HX9A 2UUAJ 3PHEA 3GG0A 4IFVB 4P2XA 1NK7A 2VHGA 3ILIA 4RW6B 3M8PB 4C0OC 2RVJA 5DETA 1MN9A 4LF4J 2UZAA 1SH0A 1OMSA 6FD1A 1WHWA 4NLGA 5DGAA 3DXSX 2PE8A 1RA6A 2LEAA 2VUGA 5H9FK 3NWRA 4I7FA 5AXMA 3VCDA 2DGVA 3AD8C 3ENVA 4R8UB 1OQ3A 3DI6A 3PTWA 3PKYA 3MFHA 3RBXA 4DV4F 3H42A 3VTIA 2VL1A 3VAHA 4RNHA 1HMVB 1FJGJ 3FC9A 1M5PC 4QBUA 2BQUA 2DB1A 3FFIA 3JSRA 2EXUA 3OW2R 2NZ4A 3LAMA 4C7QA 3D0HE 1SJFA 1AT1B 4L74A 4KY3A 2ERRA 3P5BP 2R8IA 4G6VB 3W62A 1FWPA 2IAJA 2HYIB 3I6PA 2JWNA 1FA0A 3KUHA 3WHIA 3BSNA 3UVJB 4CYUA 4RNMA 5B08A 5D6GA 2L9NA 1T9UA 1U1RA 1NH7A 2HLTA 2GJFA 4MTPA 4DV6F 2JFKA 3OTBA 2IRXA 2YQ1A 4JI2J 5RUBA 1AXQA 3I87A 4PPZA 1P8GA 2AYMA 1RWVB 2HHXA 3FMBA 4J9NA 4IR1A 1RBLA 2E5LJ 5K14A 4K8RA 2W2PP 5HSPA 5HL7Q 2C2DA 1WC0A 5HBMA 1F1BB 2AV5A 2V34A 2OJ3A 5CH7B 1LWEB 5H9FJ 4LRCA 5D4LA 3MEEA 4PWDA 2MQ8A 1TUGB 5F3ZA 4UY8T 4FPIA 2IA0A 3Q8RB 4CTAB 2KL8A 2HQDA 1JKHB 2DGWA 3KXDA 1S9EB 1WOOA 2JL9A 3PIOQ 4X62F 1S6UA 5L1KA 5D4OA 2MGZA 3W5XA 3IR5B 3IFEA 5LMNJ 2LQ8A 4XAKA 1D1UA 8ATCB 2WVDA 3IR7B 2MY8A 4ELUA 2M9KA 3QBCA 3FEZA 3UN3A 1IN0A 2OFHX 3KK3A 1FFWB 1FNOA 2GIRA 2OPQA 1LW0A 4USWA 2X1FA 2V8PA 4C3LA 2CQ2A 4DFJA 2RS8A 4C3KA 3QT5A 4DPXA 2CADA 1Y5NB 3AXKA 3KG4A 3RW7A 2NQPA 4YMEA 3MM5B 4B3TF 2B7CB 1PILA 1DHMA 2J0QD 4KHPJ 3UDVA 1C0UA 1RADB 1PJ6A 2X51A 4O3NA 2WVFA 5CD4A 2RT3A 2XSJA 1YBTA 4K4WA 2KDOA 3DCAA 4P10A 4YR2A 3BS9A 4OI1A 4L75A 2DRDA 1OJ4A 4U9RA 3KLHA 4Y6IA 1O8BA 2BJ8A 4LSLB 3GONA 2LCWA 4USKA 2DD8S 5AXNA 2RE1A 4DSIA 1W2BR 5DM7Q 2AGPA 1Q8BA 5LJ5Y 5KFZA 3QFWA 4X64F 5HQLA 1VJQA 2AW0A 4KR0B 3A3NB 4JI3J 1HARA 3MM8A 4I7FB 1YHQS 1BQXA 2C2NA 4I6AA 3KDNA 3D66A 3AD7C 4EBEA 4M8LA 3AAWB 1S12A 1R6VA 4DJBA 4WYWA 4QPTA 1S5ZA 5CYMA 3SCIE 3FFIB 1UVLA 4HTJA 2H3EB 3M32A 2X3GA 3CJTA 3K5LA 2VU5A 3VR1A 2BE2A 2AZ3A 1BQMB 3RAXA 4ZLJA 1U1KA 4KHMA 2M88A 3CCSS 2XCAA 3RAMA 3I96A 4KE5A 2CJBA 3UPFA 5KFAA 2DPJA 1NJIT 2MQOA 5CD4H 1IKYA 2PEBA 2RKIA 4TKTA 2VBZA 4FPRA 4O3RA 2KM8C 2IYGA 3SCJE 3ZZ0A 2V5HG 4DR6J 4ZPDA 2XM3A 4PEOA 1YRXA 4N76A 1CJVB 2N4DA 4ID8A 2HHHJ 1J5EF 5L8RC 4P73A 1U2CA 2XZWA 1GNKA 3OXGA 4OZ5A 1OO0B 2QLJB 2FDNA 4I56A 2VQFF 2VH7A 1GAOA 2ZC4A 1XTZA 1VQYA 3TAMB 4NZ6A 4B02A 3U02A 3HDSA 1RAFB 4PQUA 3IAS9 4PWDB 5F9NA 2KYZA 2QJ3A 2QEXS 3D3CJ 5G0RA 3UDEA 1YBUA 3OXLA 4ZVGA 5KFQA 1RABB 2JLEA 5EN1A 1ZETA 4NL5A 4X65F 2B9WA 1JK9B 5DZ6A 2JHEA 4DUZF 4J9VA 1N32J 3HJVA 2D3O1 3RR7A 1IWAA 1Q4RA 4Y3CA 4X4VA 4XO0A 3JAMU 4IO9Q 3WC2A 5KOXA 1AA1B 3BO4A 5I3PA 2AU0A 3I5BA 1S1XB 2LXUA 2VBYA 3PFEA 1FDAA 4EMDA 3ETOA 2KN4A 4DCPB 1SQEA 5CCMA 3DRSA 2XULA 3M6XA 3EZOA 1HW9A 1VC5A 1UVNA 4RW4B 1ZM9A 3DRRA 2QTWA 3FZBA 2XMJA 3EGZA 4LF2A 3HFVA 3A13A 4X4QA 3LQVA 3N6MA 2BE7D 1S6QB 5I3UA 4ZN1A 2VC0A 3UNYA 4F4KA 4EUVA 1IWGA 2OMLA 1WTBA 2HRUA 2ZVSA 4F0MA 3KMQA 1JJ4A 2I2YA 3OHBA 1U1LA 4QYZK 4WK3A 4Z2XA 2H51B 3SV3A 1SKRA 2FY8A 3UDLA 2YKAA 5FLXY 2JSXA 3GFXA 1RTZA 2VBWA 1EIYB 2V8GA 2ZWPA 3T1YJ 4QWEA 1OY8A 4CM0A 3RG6A 2ZKTA 5LL6d 1R0BG 5J1PA 3C3LA 5JVGQ 2AJQA 2IJFA 4ZA1A 5IT4A 2LLZA 5KFWA 1QVFR 2DITA 2E1CA 4CZCA 4F50A 2UXDJ 4C8OA 2A0FB 4A48A 3M2VA 2HS0A 4L3KA 1SJ3P 2UVVA 4ZPTR 3MM7B 2XQCA 3EDRB 3U7JA 3K5OA 2MEWA 2GHPA 4HHJA 1S10A 4EZ9A 1UA1A 1F3FA 3L7OA 4CWBA 3FRZA 4ED3A 4AXIA 4DSKA 2HVHA 4F3MA 3OHAA 3BPSP 3GR1A 1EQ0A 1MMNA 3Q86A 1HW8A 4NYZA 1TP7A 1REVA 4M5DB 2Z56B 4QR1A 2FZCB 3PY8A 3FUYA 4JI4F 2OEKA 4RUCA 3U1NA 4GVLA 3IA0A 1N56A 3MR6A 1S1WA 2VA3A 1DTQA 1RDRA 4KIAA 4QYZJ 1RWPB 1IKYB 2V9WA 2AD9A 3M6UA 1TL4A 4NCGB 2RKIB 2J6SA 4DV4J 3MUTP 1JX4A 3MURP 3PDNA 1YTYA 5FIIA 5THWA 3VGUA 4OYZA 2EBEA 3LPYA 3EDQB 1X4CA 2CWKA 4HR2A 2MQQA 4LRBA 1TK0A 3T9NA 3FEYB 4JP8A 3GQCA 2GVZB 1TKDA 1S7IA 3PZPA 2CDQA 4MIWA 3C14B 1RHUB 3DMJB 3GR0A 4RU9A 2V6AA 4DFPA 4H54A 5GADU 1R6YA 3R2DJ 3IBCB 2B9EA 1N5QA 1L3TA 1GH8A 3K58A 1N5SA 2H1YA 2RUGA 3OT9A 4E2FB 4IYQA 4JI8F 4DV6J 1H6KX 2YKOA 1SV5B 4DR5F 2MMYA 2XHWA 2P5VA 2ASJA 3CJQA 2FHOB 4HH1A 4B9UA 2ZVIA 3FQLA 3HD1A 1CPZA 4B3MF 4K4TA 2RDDA 4ZJLA 5HLFB 1FWKA 4DPUA 5IZHA 1U0HA 3DRSB 1ZTWA 2H4WB 3OTOJ 1DLOB 1AYEA 1BQNB 1NXIA 1XR6A 1NLKL 3OVSA 3C6TA 2R7WA 5D4PA 1HI8A 2YWKA 3Q22A 4UY85 2GIQA 3DRRB 3HKZD 2G0CA 2FGOA 1IR1A 2CNKB 4X62J 1ACMB 2J9EA 4CO0A 2K2PA 5I3UB 2RS2A 3UI3A 1WC5A 2RF2B 2CPJA 3L09A 4QPXA 2MQLA 2AGQA 3C19A 4DL2A 2MHNA 3TOQA 1S0NA 2JX2A 4QJVA 3DNCA 2ZBPA 4DF4A 3RUBL 1NK6A 1C4CA 1TZ0A 5C42A 2QYCA 1ZAVA 3DLBA 3CDUA 1LXJA 1SC4B 2GVDB 2Z2MA 3CIMA 5A2QY 4WKYA 1YJRA 3DLEA 4Y34A 1I51B 1FTCA 2W7OA 3BH7B 3ISZA 3AODA 3MMJA 1LWFB 5B0CA 2LMIA 2VC1A 4CLSA 1R27B 3QIDA 1FI4A 2UXBF 1REGX 3JSMB 2B6AB 2UVWA 1KQKA 3NS6A 4PAAA 1SKWA 3CTRA 2BJ9A 4EGLA 3M2VB 4XDDA 3UD5A 2HAIA 4BDPA 4JI7F 3RB0A 2K7JA 4F0KA 2AYBA 2YPZA 3R5CA 2B4PA 1KEKA 3MMBB 2HQFA 3CJSA 4B9VA 3Q2TC 3BH6B 1IKWB 1C4AA 1SUQA 1UFLA 3TA1A 2WK4A 3D1OA 3V4MA 1AFJA 3J7A1 2DEIA 2IVYA 3CXCR 1REVB 4DBQA 2ZNYA 1VDHA 3W65A 1IXKA 4W92B 2COLA 4OFZA 2IRUA 1ZAXA 5DLFA 3A8IA 1LW2A 4X64J 4LSNA 2FC8A 3CC7S 4URGA 4C48A 5E33A 2GMHA 4NI2B 3DYAB 2KG0A 1CULB 2X1GA 2F9DA 2R7QA 4IOBA 3C2PA 4DL0C 4TU7A 2YVSA 1KS2A 1LKZA 1RT3A 3AA9A 1DRZA 3HULA 1UZHA 2HFZA 2UU9F 2C2RA 3V6JA 4ZJOA 4EZ6A 1ZZFA 3CDAA 2V94A 1RT2A 1Q78A 5A8RB 3N6LA 4P75A 1K0VA 1S1VB 1U8SA 2J5AA 3CDBA 5C7PA 1NO8A 4Q2LA 4PG4A 4RW8B 4USVA 2DXFA 5EX3A 1OPZA 3K5PA 4A4JA 2B51A 4MKAA 1K1QA 2GMLA 1N33F 3MPYA 2DY1A 3TAPA 2DBBA 4IDKB 3P4UB 4WFBQ 4WIIA 1KFDA 3CC4S 4C97A 2HBYB 1GMWA 2XMKA 2RD5C 1S72S 3IMQJ 3UFCX 4KGVB 2GFFA 1YX2A 1JXEA 2OSQA 2HG4A 1FFSB 2MKKA 3PNIA 4DR3J 1J5EJ 1HWIA 4WFYA 1W7WA 3CPWR 1Y3JA 3PW0A 1CSJA 3GSDA 2VQFJ 1CS4A 1ZPVA 5HVGA 1LK7A 4YB1P 1QJHA 5LXYA 2RQKA 3JSYA 1TV6A 1GK8A 5HATA 3NOCA 2CNLB 3OLAA 3MOJB 2GO8A 1WOSA 1H98A 1RHKB 5CZVA 3LWLA 4NCBA 3M8QB 4PUOA 5HMWA 3HHLD 1R0AB 5MLCV 2C2ZB 3SSRA 4X65J 2OGUA 1I1GA 3IP0A 2OTLS 4YY3F 4DUZJ 1JIHA 3LGMA 3TW0A 4KGXB 2MXYA 3ZZPA 2MTLA 2V67A 2EFVA 3NCQA 1KQFB 4CM2A 4ED6A 1UW9A 1N4LA 4I2QA 2MDAA 4NLRA 2NR0A 4UUWA 5LSOA 5L1IA 1HR0J 1X4EA 2AJFE 2CDRB 3VQSA 7FDRA 4QR0A 2F1FA 2XI3A 2V4JA 3EZUA 3TVYA 3K7RA 1TVRA 3DLEB 5K8PA 2HFNA 4O44B 4ED7A 2FYXA 4J37A 5J2PA 4ZHRB 2E1RA 3E51A 2DR9A 1FEHA 2HNZA 1IBCB 4FKXA 2N3LA 4GVBB 2W9AA 2EFGA 3Q8UA 2LEPA 4K4SA 2GQCA 1A0OB 3IWNC 4ZP9A 3VAGA 1AB8A 1FRXA 1LFWA 4U96A 2W9CA 2BJ3A 2GQQA 4RNOA 3GFYA 3KJNB 2K3KA 4ICLA 2D3UA 2NPFA 4B08A 1R8HA 2VBXA 5A0YA 3W2WA 4ZPAA 1RGVA 3FEXB 2VA2A 1HD1A 4X84A 3BSCA 4LF6F 1T11A 3FBCA 4F4WA 1HHQA 3J81Y 1NK4A 5B0EA 1Y4ZB 3PJXA 1QY7A 1M5SA 1RAAB 2MZSA 2FUG9 1YJUA 3B8HA 2UUCJ 2PDAA 1UPPA 5BR8F 3PRBA 2OPRA 2XEXA 4M1KA 4KKOB 4J5OA 2CJKA 2F4VJ 4C11A 3FJ2A 4OZ3A 3BKUA 5KFPA 3O44A 2DNGA 2NXUA 3QGPA 2FLNA 1ZM2A 3BGUA 3W61A 2VPZB 3BQ2A 5BXIA 1NCLA 4KYZA 4ZP7A 1PAEX 3BSAA 3EPIA 5GVQA 1RE1B 4KGKA 4X4RA 4FXVA 2ASLA 2MQNA 2W01A 2W2OP 4DR7J 2DJWA 3LAKA 3GE9A 4O4GB 4JI4J 2BQ3A 4RW9A 3ZC4A 4DN9A 1TELA 2JDJA 3UN5A 1HWUA 4NLSA 2ZH1A 5KFDA 3LOUA 5GMEA 5GMKa 3C46A 1KLNA 1CJTA 3MAAA 4ZK7M 1E6VB 4CCHA 1WG5A 1YSJA 2OSRA 1AZSB 4Q5VA 2CG4A 4ZIWA 3NNAA 2VG6B 4IFYB 3CUNA 1Y5LB 4IRKA 4DU8A 3C8YA 4U8VA 2C42A 1RCXB 2DNZA 3AB4B 1Y9OA 1RT7A 3LPEA 4DCJB 1PIEA 1RTDA 1Q82T 2HFOA 2VOOA 2Z8QA 2FPHX 3WX8A 3L9ZA 2CZVC 1RT5A 4WU3A 4LFCJ 2GQ2A 1A7GE 5J2QB 4JI8J 1NK0A 4CH1A 1HPZB 2PIIA 3DOLB 3OFGA 5M2PA 1FX2A 1RTHA 2W2NP 3DU6A 4ITSA 4DR5J 1URRA 5EX0A 5IV3A 2W2QP 2MLXA 1S0OA 1JLAB 2U1AA 1UA0A 4KGZB 3SEOA 4JB8B 3KJFB 1Q86T 3SFGA 4XDCA 3QLHB 2B8QA 2NYIA 1QVGR 4B3MJ 4I2QB 2PD1A 4RNNA 3PVXA 3HO1A 3Q2SC 2KXHA 3LF0A 5HP1A 1U09A 2C2OB 2BEFA 2CQHA 2HAFA 4FS1A 1H7WA 3H25A 3Q24A 2DHXA 4WU2A 2YWEA 2XZTB 4PG5A 3DLGA 5B0FA 1D9AA 1AFIA 1WF1A 3J80U 4WWSA 2FD2A 4I2PB 4J9LA 4F26A 1ZH5A 1RAGB 2F3JA 4HT5A 2EBGA 1X31C 1D3WA 3M9NB 1IBMF 2AT1B 3NGKA 2Y0SD 3AA8A 2JOQA 1JLEA 3TR5A 3E8OA 2D1CA 1RT1A 3MM6A 2FTRA 1HNXJ 1JLQA 4RW7B 4ED2A 5J2NA 4NMLA 3WC0A 1ZPWX 2XO6A 2KG1A 4N5SA 2HW3A 2NSBA 2OH2A 3AQOA 1MSWD 4RO0A 3R7NB 3ITHB 3Q23A 3W2WB 1DQ8A 2ZHAA 4RWWA 2CZ9A 4DL6A 3DN9A 3ZZZA 1XERA 2JVRA 5SZTA 5IC4B 1K73T 3PEHA 3KK2B 3NGRA 3V6DB 3NS7B 1RISA 2ZD1B 1IKXA 1JLGB 4WF9Q 3BGFA 3RRKA 2I6WA 1IJEB 4OYOA 4XIUA 3P96A 1HNVA 3T41A 3G4SS 1NNDA 1GQEA 3SCLE 4KJIA 3IO1A 1MWQA 4TYAA 4TU8A 4PXBA 3G82A 1C1BB 2K1RA 3RB6A 1MMDA 2HHSA 4DX7A 1FE4A 1D9FA 3A8EA 2CRLA 2BV3A 5AT1B 4ILMA 4L72B 2Q43A 2DNNA 3MD1A 2CIMA 3GYGA 1RXOB 1FD2A 2MKCA 1EQMA 1LXNA 4DQSA 5KFUA 1VISA 3GYNA 3CCWA 1SBRA 3AD9C 1YDLA 4GO5X 4RW9B 4CRJA 4CO1A 1CC7A 3HHLB 2CQ0A 1YWXA 1WELA 4MH8A 1XNRJ 2K8GA 2UU9J 5KG5A 5JUMA 2LFVA 3CCJS 1UZDA 2QO3A 1UP1A 4WP3A 1CJTB 3DLKA 4IG3A 1APSA 4ALZA 3CC2S 4ZIVA 1TL7B 3G87A 2MQMA 4NLTA 3KLGA 3I82A 2HZAA 4OX8A 3CT9A 3NBPA 4USMA 3R1LA 1PYOB 3W9HA 4QIGA 5A8WA 3MWBA 5HI7A 2EWHA 1N33J 4Z37A 3L3CA 1KVKA 2RDIA 3SV4A 2N4CA 2UV8A 3KLIB 2J7WA 3GU0A 3IWLA 2AGOA 2DHSA 1FK9A 3KKFA 4YR3A 2ADCA 1U48A 1NU4A 1PAUB 3HM9A 1QAYA 1X7VA 4M5NA 2BX6A 2DR8A 3HVAA 4UW2A 2OMOA 4ECQA 3T5KA 4J9OA 3BPDA 1VJWA 2POKA 2DHAA 5LM7E 1RQ0A 4UZCA 3FGVA 5KFKA 1CQNA 1L3KA 4CLYA 3HFKA 3JSBA 2G9OA 4YDDB 1XNQJ 2VG7A 2XMUA 3MUMP 2I8EA 3UWTA 4DV7F 1AROP 2KXNB 4JI1J 4O3PA 2PMWA 2V69A 3AJ1A 4AQYF 1PC5A 3CJKA 3QT8A 2QA4G 2LQBA 2C3PA 3VAIA 4IKAA 3IXQA 4QIFA 4OHXA 2WOMA 2RJZA 4OZLA 1J5OB 2ILYA 3DLHA 3OQ2A 1SPBP 3F41A 2V4RA 4KGMA 2FVRA 2JJ4D 3BBCA 1U45A 1NDPA 2CPFA 4OLOA 4NZ0A 1YZ6A 5HK4A 3W2VA 2AZ1A 3EE3A 4QW8A 2V0NA 4ZVSB 1X4HA 4V19J 2I5JB 1QSYA 2BUNA 1I3OB 4OJHA 4WCEQ 1FTRA 2MY7A 1S1UB 3LGHA 1JB0C 2D3ZA 1RK8A 1U1MA 2GZOA 2YNHA 2J7UA 1RWUA 1RWKB 5BYSA 4N56A 1T3OA 3AOAA 5L38A 3NCPA 4F7VA 4CLLA 2OEJA 3SXLA 5KFRA 3LGNA 2R3VA 3VGVA 4OJ3A 2BOAA 5KFMA 4DL4A 4LVNP 4ERDA 4CO3A 1IJFB 4C2MA 1F9FA 2YQ0A 3DHWC 3HZGA 5T14A 2KHCA 4Q0BA 2IDEA 5AE3A 2B9XA 2W8KA 3IM9A 2E5GA 5EGYA 2MHEA 3M8SA 3QO9B 3M05A 3CDWA 1DAXA 2UVUA 2ZH6A 2CQCA 4NX9A 2VPXB 4NASA 2R8JA 2XCPA 4JV1A 3TJ8A 2DH7A 5DM6Q 2XGPA 3DFEA 2BACA 2ZUAA 3AH6A 1TL3B 1OY9A 3I0SA 1NPKA 4ZCMA 5CQGA 3O6QA 2I9SA 3PO5A 2LP4A 4ECYA 3MEDB 2NPIA 1RU2A 1G4CA 1VQ6S 4RKUC 2DGTA 2J9CA 3C15B 5D4NA 1N0VC 3AJ2A 4NPOA 3TJAA 5HAOA 2KU7A 4OYBA 3S01A 5ETQA 2YKNA 2ZH2A 5A8WB 1TUWA 3TANA 4ZVRB 2FJAB 5KFHA 1CQMA 3D1QA 1WSRA 4TQRA 1JLCA 3K2YA 3D7SB 3KK1A 3B78A 4P2MA 4M63A 1X0PA 1U49A 2OPSA 2EW9A 1TL5A 2QA4S 5DG8A 4I67A 2BJEA 3WZ0A 1IR2A 2EG2A 2YKMA 3QQCD 2R7VA 2GIFA 2UV8G 1EX8A 3MR3A 1WDTA 1N34F 3VZIA 3K59A 2LDIA 3M6WA 4A8MP 2KRBA 3PYGA 3IGNA 3W9IA 4IR9A 1WEXA 2BM1A 1NDCA 2KZMA 1JLFA 4CLZA 3PJWA 1PO6A 1SC3B 3MMAB 3D1HA 2WRMA 1QLNA 1W25A 3TUZC 2LXFA 1WKJA 3UD3P 3IG1B 3GJQB 3ELHA 3S6EA 2EFOA 1BMQB 1U6BA 2M70A 2G2YA 2A2DA 3OR2B 3QSYB 1VBKA 1XMQJ 1Q0NA 3KLVA 4K0KF 5F8JA 4OX9F 1HQUB 3PO4A 3HVRA 3MXHP 4FF2A 3EMTA 4G1QA 4DOZA 1HWKA 1O0PA 3HK2A 5HO4A 1RHMB 5ETPA 3R6LB 4TLRA 2MJNA 2HGMA 1S4FA 3L7PA 3DGPA 2ZZMA 4P52A 3HD2A 3QMQA 2N7YA 4GRSA 4MK7A 2DGUA 2VQEF 3G86A 3K8WA 2DCLA 2EC0A 3D2WA 5DJBA 2YNFB 1WNEA 1S7HA 1H2UX 4FVCA 2ASYA 2R7TA 1CJKB 1DBDA 1IBMJ 2IRYA 4IUFA 1H38A 4LREA 2B3TB 3W64A 1S6OA 2IY5B 3M30B 1RZMA 3S1TA 2J8SA 4FYWB 2EI5A 2Q6CA 2WONA 2QZ8A 3SYZA 1XWLA 5KG3A 1E6YB 3THTA 2WBRA 5AE1A 3LP2B 4ZPBA 3UE2A 1YJ7A 4C9DA 4CQ1A 5E7OB 2QLXA 1HQ2A 5LSLA 1TAUA 1FKPB 1UVIA 1EP4A 2WSEC 1RBAA 1U1QA 4H4MA 3BKTA 2GC8A 1AUDA 1WC3A 3D6FB 3JAMY 2ZBIA 1QTMA 1KC8T 1SJRA 4K59A 4JI0J 4B3RF 4ILRA 2GS8A 4CH0S 4NMXA 2E5HA 4L3NA 2RB7A 2R7SA 2ZBCA 4ZDNA 2HMIA 2IIHA 2FLPA 4PWWA 1NUEA 4FYDA 5HANA 5B0BA 2BZ2A 2LEBA 4DDFA 4DPTA 3KG0A 2FHJA 3T1HF 1CJUA 2XLJA 4I1TA 3I9V9 3OL8A 1JLBA 1VC6A 1VRTB 2IC3A 4DCOB 5JXSA 2LECA 2CXEA 5IS2A 4KV8B 2MZQA 5E0OA 1AW0A 4NXMF 2E9RX 2BR0A 5IT9Y 2O5DA 4FDFA 2B7BB 3UR0A 1NK8A 2DH8A 1LNQA 4HTIA 4KB7A 1M1HA 3KUGA 4CT8A 3M2UA 1HBMA 2NXNA 3OL9A 4NLVA 3DOKA 3B82A 2XY5A 3D6TB 1NH8A 1GTHA 1TK5A 3BQ1A 4WZMA 3CO0P 1TKTA 3EGVA 1H3DA 4LRAA 3TQEA 1UAWA 3TJ9A 2CJXB 4KHRA 5KG4A 2NXEA 4IRCA 3BO3A 4WXOA 3J81j 4IG0B 4MFBB 2V9KA 4Y2KA 3P5TL 3TI0A 1C1CA 1QUVA 2IDLA 1GFWB 4TNOA 1RYSA 1KOHA 2A6MA 3CD7A 4ID5A 4GO7X 4B3OB 4E8UA 1HBUB 3LP0A 5IT0A 4ZJQA 4FYYB 1NMEB 5CCLA 2LQ9A 2HNDB 2NUUG 4C4WA 3I32A 1PCAA 3BYPA 1WI8A 2YWGA 1DARA 1G6BA 4UT4A 1HNIB 2E9ZA 1WG1A 4DV7J 3KG1A 2FJEB 2HWIA 4ZVUB 3D68A 3ZZYA 2DISA 4ELVA 3PHTA 2HIQA 2APOA 3S7RA 5HMZA 4N8NA 3QWPA 2XMTA 2WTFA 1HQEA 1WG4A 4DG1B 2JZ5A 4PYAA 4Q8FA 2WONB 3TZZA 2PO4A 3PCOB 2DO0A 1WC1A 2JNJA 2MKIA 3OR1A 1FF2A 2JFDA 4RR5A 3X3UA 3R3TA 2XY7A 3HHNB 1Z4UA 4NCAA 3PX6A 3EXCX 4LF7J 3GCWP 3RBZA 4YB7A 2QGFB 3TQ1A 2OPPA 7AT1B 4Q8EA 1TL1B 3G6XA 4PPDA 4WBFA 5KG7A 2YX7A 1Q7LB 3TVZA 3EPGA 3IBWA 3ISND 2MKSA 2DNMA 1FESA 1AUSL 1SC1B 2H48B 1ELOA 2CVIA 4X66J 2ZJPQ 2Y1LB 2WVBA 1WKLA 3FKBA 1F5AA 2GGPB 1WI6A 1TK8A 4PXEA 1T05A 3IRXB 1VBYA 2CJQA 3KLEB 3V5RA 4M5KA 5F9LA 3K8VA 2H54B 2X3DA 2ZDOA 2PA8D 2GA7A 3LW5C 3H8YA 2Q66A 3R97A 4UTGA 1W26A 1JLBB 1PYTA 3MEGA 2G0JA 2CA9A 1LWXA 1Q53A 1VRUA 2C3MA 1MWYA 1DTTA 4URSA 1MU2A 1X8DA 5HN0A 5E5NA 8AT1B 4Q2MA 4QCLA 3SCKE 1XC9A 1EETA 5FLXU 1FKOA 4GC6A 1HI0P 2YKPA 3DRXA 1S79A 4P72A 3V4IB 1VBXA 3C16A 5KG2A 4F25A 3G6VA 4ZITA 3FQKA 2WZ1A 4KQZA 1RAOA 2HGLA 1VQ5S 4ECZA 4OLPA 1W2IA 4CI0B 3TX0A 2A3JA 4F4XA 3QGHA 5DG9A 3US5A 1UVJA 3PX4A 3P6YC 4P7VA 3PYDA 2XNRA 1L5UA 3V81A 4OV6A 3W63A 2AF6A 4FBUA 4JI5F 4MK8A 2IA6A 5D77A 4LRFA 4Y2AA 3UDCA 2AJ4A 5F8LA 1P6TA 2XMMA
chains in the Genus database with same CATH topology
4OV1A 2GFFA 2QMXA 3NS5A 2BA9A 3D28A 4WE1B 1FCAA 1JXEA 2OSQA 3LP0B 3I4HX 2HG4A 2IMOA 2MKKA 4IOAQ 3PNIA 3J80Y 1U1OA 5AJ3F 1HWIA 4WFYA 4EO8A 1HI1A 3OBIA 5KFEA 3W3SA 1X9WA 1HYSA 1VHFA 1S0MA 4ILLA 3CPWR 1Y3JA 5IQQA 1YJNS 4MIAA 2RF2A 1PGZA 4ZS6A 3HKWA 3PW0A 1CSJA 2BANB 2DO4A 1KN6A 3GSDA 2ZKUA 1HNWF 3H4BA 2E5LF 2KO1A 1QAXA 3H2UB 2R9LA 1M5KC 2X1BA 2R4FA 3UCGA 4DG1A 2FVCA 1GTEA 2JEFA 1ZPVA 1OS5A 4KRWA 3VF0B 5KT2A 3EX7B 1KR4A 3FCHA 4OL8A 3RRGA 2FVQA 1LK7A 4TYBA 1ZAWA 4A8QA 3NL0A 1ROFA 4U7CA 4I69A 1Q1KA 2XLIA 4DF8A 4YB1P 5E3CA 1QJHA 4JOUA 5LXYA 5IM0B 4AXJA 4EWTA 1SKSA 3PV8A 1Q8LA 2RQKA 3JSYA 3VZHA 1UETA 3DOMA 4DV5F 2WAQD 1TV6A 1FVSA 4HYKA 5DDRC 3QZ7A 1LFPA 3OLAA 2GO8A 3MOJB 1H98A 2B0GA 4QQBA 2MZRA 5CZVA 3JTPA 2EFPA 3MECA 5E2QA 4TXSA 4RUHA 5KFOA 1U6FA 2IFXA 5HMXA 3LWLA 1N5TA 4NCBA 3M8QB 4PUOA 5HMWA 3IS9A 3E01A 1X9SA 1LWFA 2L9WA 2O3DA 4UOCA 4H4KC 2JH3A 2KRRA 3D5MA 3HHLD 4OJGA 1R0AB 4CO5A 1VI7A 4J9KA 5MLCV 2RMLA 3GIIA 2ZE2B 3D54A 3SSRA 2L08A 3JSMA 1RTJB 2B6AA 2EVZA 3HZEA 1I1GA 2MB0B 3O5TB 2HWTA 3O8WA 1UKUA 2OTLS 4YY3F 1JIHA 2RSQA 3LGMA 2XWXA 3TW0A 5LSRA 2XGQA 1TKXA 2ILZA 4JV5F 2ADBA 3PEJA 2VONA 2MXYA 3GV5B 2XY6A 3RR8A 2CPEA 4FF1A 3F44A 3KJVA 4RBVA 3E3XA 1FT8A 5I4MA 1TL1A 3ZZPA 3M1VB 3N0VA 5FDLB 5LMNF 2EFVA 3HPOA 3NCQA 1KQFB 4C8KA 4DFMA 3MMCA 4ED6A 2ZH5A 5D3GB 2UUWA 1QAIA 2BQRA 1URNA 2UUCF 3NLCA 2V2KA 2ZOGA 4RUAA 4FZVA 1N4LA 3HVTA 1RT7B 4I2QA 4TQSA 1RTDB 2MDAA 2Y1IA 4NLRA 2RIJA 3OSNA 2NR0A 4UUWA 3MMBA 5LSOA 5L1IA 5LT5A 1BC6A 1X4EA 2AJFE 1UJ6A 3U1MA 2F4VF 3VQSA 7FDRA 3T3FA 3PW5A 1IKWA 4QR0A 2F1FA 2XI3A 3H59A 4TY8B 1T03B 2V4JA 3PR5B 3EZUA 1RT5B 3TVYA 3T5HA 3K7RA 5A8KB 1P1LA 1TVRA 2VG5A 2ZFHA 3BGLA 3DLEB 4UQGA 2GGPA 2HFNA 3I5AA 2VKZG 4O44B 5K8PA 4WFAQ 4ED7A 1SC6A 4J37A 3A1YG 2KKHA 5DRKA 4PQAA 3TRGA 4YP3A 2M7SA 5J2PA 2FJWA 4ZHRB 3IRXA 3KLEA 2J6UA 2MKJA 2E1RA 1U2FA 4KTQA 3E51A 2Z2LA 3PM9A 5I42B 2DR9A 1RTHB 1FEHA 1ZYQA 2HNZA 2N3LA 2M2BA 2QV6A 4FF3A 2W9AA 2EFGA 2YQ3A 1N52B 4U7UK 4AL5A 4OX7A 3K0JA 1RT4B 2LEPA 3DLJA 4K4SA 2FLOA 4OHWA 3VAKA 4TY9A 5DLGA 5KT3A 1TR0A 4DR7F 2GQCA 1KONA 3IWNC 4ZP9A 1JJ2R 5KFIA 4DSJA 3MCSA 4CO4A 3MFIA 3VAGA 1FRXA 1LFWA 3DYAA 4KHPF 4E98A 2W9CA 5KFVA 3TA0A 5AXKA 4ECUA 2FVPA 2GQQA 2U2FA 3HHEA 3CMES 4RNOA 1TQLA 2F9JA 2HQIA 3GFYA 1DZ5A 1N6QB 1SJ4P 2K3KA 4ICLA 2JRSA 5F8MA 3BGRA 2D3UA 2NPFA 3H40A 2MJUA 2YX1A 3H2LA 3ZZUA 2JEGA 4QU7A 4QWBA 4B08A 1R8HA 2VBXA 5A0YA 3W2WA 5L9NA 5D78A 4ZPAA 3V4IA 1RGVA 5HP1B 3FDSA 3RAQA 3FEXB 3GFHA 1QSSA 2VA2A 2HHVA 4K4ZA 3UCUP 4ATNA 1OWXA 3HP6A 4Q45A 1HD1A 1V3ZA 1RAJA 4X84A 2UUBF 3BSCA 1JXLA 5A8RA 4LF6F 2EKYA 4K2XA 2DNLA 1VIOA 4F4WA 2R2RA 3J7Z5 1HHSA 1Y5IB 1UEUA 4FF4A 2WHOA 3DLGB 2LVWA 3J81Y 1NK4A 1FO1A 4ZPVR 4LQ9A 1X4DA 1C0TA 1QE1B 2A2CA 2ROPA 4IH6A 3QIPB 5E3QA 1S1VA 4F02A 3ISNC 1FEEA 2IM1A 4Y2CA 3I0RB 2HHUA 1UL3A 2RNEA 2D74B 2PA3A 5J1EB 2DGXA 5DQIA 1ZZNA 3X1LB 5B0EA 2OP5A 1Y4ZB 2K7KA 3PJXA 4RW8A 3EYZA 4R0JA 1QY7A 4NRTA 2CQBA 1JLEB 2M4MA 1M5SA 1OIAA 2YNGA 3MEGB 4KO0B 4N47A 3MM6B 1RT1B 2R7XA 4DFKA 2M52A 4LFAF 2MZSA 2FUG9 1JLQB 2PT0A 4I0WA 2RU9A 2MSTA 1NK5A 3T1AA 5J2NB 3N79A 1YJUA 4O3QA 4JI3F 1JMTA 2BRLA 4IDKA 3B8HA 3FMWA 4MYTA 3T9ZA 2PDAA 2XMVA 1MU2B 5BR8F 2R7RA 1X0FA 3PRBA 2C22A 5E3AA 4LFCF 1WF2A 2OPRA 2XEXA 4M1KA 1GT8A 2R2TA 4FVMA 4KKOB 4A8FA 5F0UA 2HVIA 2EG1A 5HROA 4J5OA 4DQPA 3BR8A 2PMHA 2NLWA 1RI7A 2BBEA 2CJKA 4KBIA 4C11A 1KTVA 4ECWA 2ZHOA 4OHYA 2IM2A 3FJ2A 3CCMS 3BN7A 5EHHA 3R5BA 2YNIB 3C6UB 5GADI 1FXLA 4ZCLA 4X4TA 5KFPA 3O44A 1KHVA 4WE1A 4WYLA 4PRFA 4USJC 2DNGA 2NXUA 3QGPA 2FLNA 3U1LA 1ZM2A 4NLUA 3D0GE 3L95X 3BGUA 3KHGA 2DCUB 2VPZB 3BQ2A 3QYYA 1S9FA 4P6QA 4PXCA 2XNQA 4IFVA 4EFAC 3OL6A 3RBDA 3DRPB 4HDGA 4ZP7A 3MR2A 4NA2A 3CCLS 3JYTB 5I3QA 3TAQA 2I38A 4URQU 3BSAA 3G8SA 1SIWB 3MD3A 4YR0A 4MAKA 3EPIA 5GVQA 3HJFA 1VIXA 3S8SA 1HBOB 2AQ4A 3OUYA 4BBYA 4QOTA 1U25A 4KGKA 4X4RA 3TO8A 4FXVA 2ASLA 1IKXB 2MQNA 2IM0A 1I94F 1UMJA 2AP6A 2XBPA 4LF9F 5DS7A 2J76E 2DJWA 3LAKA 2HGNA 3GE9A 4O4GB 1MROB 1X5SA 1L3UA 3V6KA 2BQ3A 4RW9A 5IM0A 1VQSA 4DPOA 3ZC4A 1U1NA 2M8HA 4DN9A 2IM3A 1HNVB 4OZ0A 4LF8F 3RB4A 2JDJA 1RP5A 4N77A 4DS4A 1YI2S 2KFZA 1KQGB 3TX8A 2Y1JA 5D8HB 1JNZB 1HWUA 3LP1A 1U7LA 2GMJA 4NLSA 5M2RA 2LQJA 2N82B 2ZH1A 1OQ6A 1A9NB 3M8QA 2QA1A 4O4RA 5T7LB 4GKKF 1G1XA 1FVQA 1LV5A 4V19X 1TKZB 3TA2A 5KFDA 3LOUA 3DM2B 2ZUGA 1Z1ZA 2W25A 2QLWA 2AYEA 1H0HB 1OPIA 1R0AA 3NNHA 1LWCB 4I6WA 5AXLA 2KB2A 5GMKa 3C46A 2ZE2A 1KLNA 4I64A 1FD8A 2K1RB 1IQTA 2KJWA 3CJ3A 2HS4A 5DDPC 4PR6A 4ZK7M 4FP9A 1E6VB 4CCHA 3CMAS 4A8WA 1WG5A 1F2GA 1YSJA 2OSRA 2HLUA 4CT9A 2HHHF 2UUTA 4Q5VA 2CG4A 3NNAA 4YQWA 3IN5A 1HNXF 2E9TA 3DDKA 5CYQB 2VG6B 3M1VA 4IFYB 5L39A 1Y5LB 5FDLA 3CUNA 2KHDA 4F67A 5KFFA 4IRKA 2Z4PA 1F5CA