4PRFA

A second look at the hdv ribozyme structure and dynamics.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatitis Delta virus ribozyme
publication title New tools provide a second look at HDV ribozyme structure, dynamics and cleavage.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 24
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4prfA00
1X5SA 3P3DA 3VALA 2DK2A 5D77A 1O0PA 5GVQA 2DHSA 4Y0FA 2CQPA 2DGQA 2MJNA 1L3KA 4WIIA 5GAEU 1DBDA 1P1TA 2DNNA 3RW6A 2MQLA 2D9PA 2RQCA 2J0QD 1H2VZ 4ZKAA 3DXBA 2FC8A 1VQMS 3J7ZT 3CCLS 1KOOA 5LSOA 1URNA 5DM7Q 2MZTA 3I56S 2DNQA 2U2FA 2OTLS 2CQGA 2M7SA 2LEBA 3H2VE 2M52A 4F26A 3UCZP 1S72S 2MYFA 2AYMA 4CH1A 2CPFA 1U1KA 1OWXA 2HGLA 5GAHU 2DNGA 1VBZA 2KFYA 1VQPS 2I38A 3VAFA 1R8PA 2DO0A 2RT3A 3DLLQ 2CQDA 3CC7S 2ADCA 1WI8A 2KT5A 2YH1A 1FNXH 2QFJA 2MKHA 3B4DA 2MMYA 4Y00A 1YTYA 2DNPA 3CC4S 5DDOC 3SDEB 2LQ5A 3P49B 2DGXA 4EGLA 1H6KX 3NNAA 1WEZA 1KD1T 4PRFA 1FHTA 1YHQS 1Q7YT 3G8SA 4ERDA 5HL7Q 1U6FA 2X1BA 2N3OA 1WF1A 4YOEA 1A7GE 3SMZA 2LYVA 3NS5A 4Z2XA 2VONA 1NU4A 2N7CA 2JVOA 1FT8A 2KN4A 2AYGA 2N3LA 1JMTA 3V4MA 5IM0B 2E5IA 2YH0A 1U1PA 1VQ9S 2MQNA 2WBRA 3I55S 1Q82T 2F3JA 2CPIA 2MZRA 3RW7A 2ZJRQ 2XNQA 3G9CA 1B7FA 1OO0B 1CVJA 1DZ5A 2MGZB 2DGWA 3FEYB 1WEXA 1WF2A 2MZSA 5DETA 1N54B 4TLQA 3S7RA 2DNMA 3MUVP 2KG0A 3CULA 3BO3A 1H2TZ 2X1FA 2M8HA 4F25A 1G2EA 5GAGU 2I2YA 2HYIB 3PIOQ 4LIRA 4LMZA 2E5GA 1VQNS 2G1DA 1WHYA 2J0SD 2M70A 3CMES 3HHNB 1VQKS 3NMRA 2HGNA 2NZ4A 3HI9A 1VC5A 3ZZZA 1U1NA 2MJUA 1QVFR 2KXHA 1JJ4A 1WG5A 2RQ4A 1UAWA 1RK8A 1YIJS 1SJRA 2CPHA 2CQCA 4C7QA 3R1LA 4FXVA 2XNRA 2MPUA 2ZJQQ 3UD3P 2CQIA 3B4MA 2LECA 2J8AA 1VQOS 2VOPA 2LEAA 3R1HA 1M90T 2YWKA 5IQQA 4YB1P 2DNRA 1WG1A 3MXHP 2D9OA 2CQBA 1M5KC 2LMIA 2DISA 2HGMA 2CQ0A 5CA5A 1WF0A 1X4FA 3CCSS 2MQMA 1U1LA 2E44A 2M0GB 2JWNA 1SJ3P 1YJ9S 2G0CA 2MKJA 2KH9A 2CQ2A 1R8HA 2PEHA 3R27A 1DRZA 3N9UC 1FJ7A 3VAMA 4U67Q 3P6YC 3CCRS 1ZZNA 4BS2A 2FC9A 1X0FA 1W2BR 5FJ4A 1VBYA 2DH9A 3G96A 3BEGB 2V94A 1OPIA 2MXYA 2LA6A 2RS2A 4RU2A 3LPYA 3G6ES 2GHPA 2DGVA 3D2WA 4F02A 2MKSA 3BS9A 5GMKa 4ED5A 2OSQA 2RRAA 1BY9A 1UFWA 3CTRA 4WKRA 1M5VC 2CQ1A 2YTCA 2DNHA 2DNOA 1PO6A 4M5DB 2QEXS 2DGTA 4WFNQ 2DHAA 1JJHA 2DGOA 4OZ0A 3MD1A 1U1RA 3ZZYA 1HA1A 1QM9A 2KI2A 1X4DA 1WTBA 2CPZA 4OZ1A 3MUTP 4CIOA 2JX2A 2OSRA 1QVGR 4PR6A 4TU7A 1DHMA 2NLWA 2DITA 4A8XA 3EGNA 2KM8B 3CCUS 2OJ3A 2DIUA 2BOPA 5LXYA 2E5HA 1X4AA 2L41A 4LJMA 1FO1A 3G8TA 3CCES 1KC8T 1RKJA 4QU6A 2EK1A 2DH7A 5DDQC 2YKAA 4W90B 1SJQA 1HD0A 2F9DA 2LA4A 1YJNS 3CMAS 1VQ5S 3NNCA 1VQLS 2DHXA 2E5JA 2MY8A 3CF5Q 2QA4S 4P6QA 2HZCA 3UD4P 3P5TL 1K8AT 2CJKA 1M5PC 1WELA 2L08A 1KQSR 2M8DB 2L9WA 3THTA 3SDEA 4WF9Q 2VODA 1SXLA 2MKCA 2N82B 4WFAQ 1SJ4P 3CCQS 2LKZA 5MLCV 2RS8A 3PIPQ 3U1MA 5HO4A 3CCVS 2RNEA 3CCJS 1UP1A 2RU3A 2OIHA 2XS5A 1VQ6S 3JB9k 5JVGQ 2X1AA 1X4BA 1KOHA 4V19X 1IQTA 2KYXA 2MKIA 1WWHA 4IOCQ 2K3KA 3K0JA 1U1OA 2KVIA 5IM0A 4CH0S 3MI7X 5DDRC 3G4SS 3OW2R 1X4EA 3MDFA 1N88A 2AYBA 1X5PA 3CC2S 1X5OA 3NNHA 1M5OC 2KXNB 2MKKA 5BJRA 2MQPA 1VBXA 2BZ2A 1YITS 2MGZA 1PGZA 3U1LA 1H2UX 3EGZA 3UCGA 1X4CA 2DO4A 2D3OR 5LSLA 2DNYA 3CPWR 1FXLA 3LQVA 2GO9A 4QQBA 3CUNA 2M2BA 2J76E 4UY8T 1ZZFA 2K8GA 1M1KT 3UE2A 3CD6S 3TYTA 1WI6A 2JVRA 1K73T 5D78A 4IOAQ 2KG1A 3IRWP 2FY1A 2DH8A 2CQ4A 2XSFA 1Q81T 3Q2SC 3J7YU 3MUMP 4QU7A 4C0OC 1D9AA 1FJEB 3BO2A 2DNKA 2VOOA 3CCMS 1D8ZA 3VF0B 4C4WA 5JVHQ 1VC6A 2PE8A 2AD9A 3L3CA 4YUDA 2M88A 3ULHA 1XN9A 1N8RT 2FPHX 2F9JA 2MZ1A 2ERRA 2MB0B 1NO8A 1X4HA 4WCEQ 2XS2A 5LJ5Y 2DIVA 3VAGA 3IWNC 1VQ8S 3H2UB 3VAJA 2Q79A 1YI2S 3Q2TC 2MSSA 2M4MA 2RVJA 3MOJB 2DNLA 1S79A 2CQ3A 2UP1A 4J5OA 2KM8C 5EN1A 1WG4A 2KHCA 1P27B 1YJWS 2ADBA 2M9KA 2EK6A 2SXLA 3TO8A 1YWXA 2RRBA 5DM6Q 1Q86T 4WFBQ 2KRBA 1K9MT 2XS7A 1ZH5A 2XB2D 1SJFA 3S01A 1U6BA 2O3DA 1FJCA 1NJIT 2OTJS 4IUFA 1U1MA 2CQHA 4TU8A 5CYJA 1U2FA 2DHGA 3MURP 4TU9A 5CXTA 1X5TA 1X4GA 4W92B 3VAKA 2DNZA 3S6EA 1VC0A 4QPTA 1OIAA 1JJ2R 3VAHA 2CPEA 3NS6A 3THPA 2LXUA 1UW4A 4CQ1A 1AUDA 2DB1A 5H1SV 2MQQA 5LXRA 2CPXA 5LJ3Y 2HVZA 1A9NB 4PKDB 1HL6A 5IFMA 2LXIA 1U1QA 2KXFA 2AYEA 3G71S 1N52B 2MSTA 1WHVA 2MY7A 2KRRA 3UCUP 1VQ7S 3TP2A 2DGSA 5DDPC 3BO4A 4FXWA 4UQTA 3UWTA 3EX7B 2KU7A 2MZJA 2X1GA 1VQ4S 1HD1A 3FEXB 4IO9Q 2RUGA 2DGUA 5GADU 2CPYA 3CXCR 2MZQA 1WEYA 2B0GA 2EVZA 2FHOB 2LCWA 2MQOA 3VAIA 3S8SA 2CPJA 1F9FA 2A3JA 1WHWA 3US5A 2JRSA 3MD3A 3SXLA 2MHNA 2ZJPQ 2U1AA 2CPDA 1WHXA 2G4BA 5ITHA
chains in the Genus database with same CATH superfamily
5GVQA 3B54A 4CO1A 2RQCA 5KT5A 2J0QD 4ZKAA 1APSA 2J9DA 1JLQB 1DTTB 2Q6CA 3NG8A 3DM2A 2DNQA 3JSBA 4F36A 3ETMA 5F8GA 1L3VA 1HQEA 2WW8A 2WSEC 4ECZA 3SCJE 1VQPS 1UL3A 2ADCA 2QL5B 4AQYF 2VQEJ 4IQXA 3AJDA 3CCWA 4NMLA 2HHQA 3OL8A 4USMA 4WK1A 2XWXA 3ADAC 1OY9A 4C98A 4O4RA 1VISA 4ZS6A 2RH3A 4YDXA 1WF1A 1GXUA 4EYIB 4Y2CA 1IBKJ 4OI0A 2P9EA 2YH0A 1VQ9S 1XC9A 3G9CA 5KFCA 2IAJA 1VIOA 5C7PA 4QW8A 4DUTA 2F1FA 1CPZA 1RAGB 2VG7A 3FMBA 3V6DB 5C24A 4M63A 4LF5F 1P9QC 3NMRA 2JJ4D 1JLGB 5L1LA 2IDEA 5KFPA 1RLDA 1OS5A 1YDLA 1BD6A 1UFLA 2VZ9A 4JI0J 2LEAA 3OLAA 5IQQA 4OZ3A 3BR8A 3DU6A 2LMIA 3EM1A 3ICLA 5KFMA 2XQCA 3M9OB 2BOAA 3PG9A 3DRRB 1NB7A 3N9UC 4FBUA 3KK3B 5K5MA 1FA0A 4NZ6A 2GC8A 3R5CA 1PJ6A 2G13A 4G3IA 3G87A 5E3RA 4XDCA 5T7LA 4MYUA 3MEDB 1RCOB 1JLFB 4F04B 2PGCA 2XWYA 2KI2A 4OV6A 4OZ1A 4DG1A 4AQYJ 8AT1B 3EGNA 5CYMB 1GK8A 3R5JB 3KLGA 4C48A 2BOPA 3ETOA 4FNIA 5B0BA 3TZYA 1FO1A 2GIFA 4LRCA 3C6TB 3KJQB 2AJQA 1EETB 1MU2B 1WC1A 2Z2LA 2XBPA 3IA0A 4ZCIA 5A0YA 4X4PA 1FKPB 3OL6A 1S1UB 5K8NA 2H65B 3CVKA 4KKOB 4OYXA 2OFGX 2Y0SD 4A8KA 4ES3A 4RNHA 3W1YC 4HTJA 4OYMA 2BQRA 2Y0BB 4FYVB 3PW0A 1RTIB 4LF5J 4EO8A 2XGPA 2MQPA 3D1QA 1ZTTA 1LK5A 3T1HF 2B6AA 1NAQA 3QIDA 2AMCB 1NKBA 1T0TV 1M1KT 3FRZA 4ETZA 1SUQB 2P6SA 1UVLA 3VQSA 3MUMP 4KGKA 4ZIVA 4Q0BA 2VOOA 5ETPA 2KDOA 5EUHA 2RQKA 2M88A 1C2PA 1JXEA 2DRAA 4MFBB 1Q95G 4CTAB 4BCAA 2W9CB 2QC3A 2RU9A 4UW2A 3BQ2A 5A6PA 4ELUA 2Z4PA 4DL6A 3BYRA 1FXDA 4Y2AA 1RWKB 2XMWA 2M9KA 1U8SA 3PV8A 1OYEA 3R5BA 3MPUB 1TK0A 4MKVA 2KB2A 3B8HA 1NDCA 3A4TA 4OYOA 4LVNP 1H3DA 1SJFA 1U6BA 3FKBA 2Z2MA 5L9XA 2CQHA 3MM9A 2DHGA 2FYXA 3IXQA 2VPXB 2FLLA 1A6LA 4RW8A 5D3GA 2CPEA 4YHHF 1HI8A 3HHLC 1YZ6A 4C11A 2EG2A 2AJFE 3QLHB 1JKHB 1GNKA 1RU1A 4KHRA 3KHLA 4ILLA 3I5CA 3TP2A 3ILOA 3UDCA 4O3RA 3A12A 2O01C 2NXUA 1KEKA 2RIJA 1OSDA 1S6QA 1VQ4S 4OJ3A 4KB7A 3N0VA 4J37A 4NXMF 2MLXA 1WHWA 5KFFA 5I3PA 3IBFB 1E6YA 2IHR1 1S6UA 5H9FJ 3NAHA 4RW7A 3HKWA 3DXBA 3DOKA 1RISA 2HS0A 2B56A 2OPQB 5F9NA 4KIAA 5DM7Q 2MZTA 5ETVA 3T1HJ 3DOMA 3ZO7A 3AXMA 3A13A 3UCZP 2HG4A 2ZH5A 1IBMF 2K1RB 3D4JA 3KFWX 3SSRA 4I64A 3IO1A 4ZCLA 4ECXA 3VZIA 4M94A 3JTNA 2MMYA 3TX0A 2M5YA 3SDEB 2P8IA 4Q44A 2QGFB 2AJ1A 1FDBA 3G8SA 2R7RA 5G0RB 3I0RB 3DDKA 4ICLB 3M30A 2Z8QA 4LRBA 2AYGA 3V4MA 3JQMA 3KLIA 4FXDA 4E8UA 1TKXB 1REVA 4LF1A 1N5YB 1BGXT 3N5FA 3S7RA 4H4OB 4PG8A 4P75A 3AOAA 4F25A 1S57A 1R31A 1Y00A 4YHHJ 1VQYA 4Y6IA 5B0EA 3TX8A 1HMVA 1WHYA 1EP4B 4OX9F 1G6BA 3HI9A 5L1JA 3HVTB 4H4KC 8RUCA 2WVBA 4IO1A 1U1NA 1PCAA 4DQQA 4CNZA 4C8NA 4PG6A 4HI2A 1BLUA 2XNRA 1FNOA 4G6VB 2VG5B 4HVZA 3R1HA 3C15A 3RRGA 2YWKA 1YJRA 1WG1A 3MXHP 3D66A 2GQ2A 2XO6A 1FRXA 4C3KA 4X66F 1WC3A 4NXMJ 3IBWA 5KFGA 4DR1F 2OEMA 1XR5A 4RX6A 3IRXB 1CLFA 2YNIA 2NR0A 2FY8A 4KBIA 2EBEA 2B8PA 3T19A 1U2RA 1PSDA 3POTA 1A0OB 2MKSA 1UEVA 1SV5A 2FLPA 2PMZD 4ED8A 4WZQA 2MLZA 2QRRA 3SQOP 3FRYA 4M8LA 1PO6A 1IBMJ 5KFVA 1CS4B 1GMWD 1RHMB 4HDHA 2OSRA 2G0IA 1JLQA 1DTTA 3R5GA 2MEWA 1VK3A 1FEEA 4ECVA 4PPDA 4ZVEA 5E3AA 3DRXA 1Q8BA 1RUSA 3AA8A 5F0WA 3PYFA 4USUA 4K4SA 3UR0A 2GVDB 4XPEA 4CM0A 4DZDA 5HQMA 2VD3A 2FIUA 4WFAQ 3U1MA 3K5PA 1UP1A 4B3TF 3KLEB 2IJNA 2ZZNA 3CJ5A 2MKIA 3ZTRA 4IOCQ 5KG0A 3BH7B 3I6PA 1H73A 1SQFA 3ENQA 4OX9J 1H2UX 2Y1LB 4JBCA 5F8LA 1EJ7L 1WI6A 2HWHA 5DS7A 2FVSA 2E29A 3V6DA 1YJVA 3K7RA 5C25A 2FZCB 4B9LA 4K4XA 5KFWA 2RHSB 3MTJA 1TKTB 1LNQA 3O3LA 4ZDNA 2DNKA 1JLGA 4X66J 1VGYA 4Q43A 3DI6B 3MMAB 4DV4F 1NB2A 2MZ1A 3TR5A 4DR1J 4U8YA 2E66A 2JSXA 3FZ2A 1QY7A 1SBRA 2M4MA 2KM8C 3DRSB 4WFBQ 3ZZUA 2DCUB 1FVQA 4AXIA 4GMKA 2OAUA 3S01A 2AHOB 1CC7A 1HARA 2OTJS 1XMOF 4ZITA 2WAQD 4OZ2A 3MURP 5C2CA 1VC0A 5RUBA 1N5VA 2VH7A 2XCAA 2LXFA 2V5HG 3NMAA 2IM2A 3MEDA 1JLFA 5THWA 2FB0A 2VC0A 3QATA 2EBGA 3T9NA 3NWRA 4K8RA 3TAPA 5CYMA 2AT1B 2XZWA 3LW5C 4ZJQA 4JI1F 3T6JA 4ZPCA 1U26A 1MWYA 3C6TA 1LWCB 2WOMB 4YR3A 4B3TJ 1EETA 3MD3A 1MU2A 1WHXA 2IM1A 4IYQA 2XGQA 4WFZA 1L3KA 1EIYB 1CJKB 4B3OB 1FKPA 1ZA2B 4N8OA 1S1UA 3AD9C 4CLUA 2BKNA 4KKOA 2W25A 3X3UA 2Q3PA 4LT6A 2C2MB 4DR5F 4L75A 1K44A 1S72S 1H98A 2ATCB 1PC5A 1TFWA 1RTIA 2RT3A 4P2XA 1PC4A 4DSIA 1Y0HA 2QFJA 4DN0A 1H7WA 3H2LA 1RWPB 2HQCA 4U7CA 2CWKA 2J9DE 3EXYA 1HR0F 5BYQA 4M5HA 4WK3A 3HXMA 1WEZA 2I8EA 3ET6B 3M2VB 1J5OB 4DV4J 1YHQS 2FGOA 5KT4A 1SUQA 1U6ZA 3M2RB 2V2VA 4YOEA 4FF2A 4LFAF 2Y3YA 2O1PA 3AJ2A 1QE1B 2MQNA 2YY3A 2A6OA 1KVKA 5SZTA 1OO0B 4DPWA 4MFBA 3BDPA 4CTAA 3FCWA 5HJXA 2W9CA 4TLQA 2DNMA 4K4WA 4RL1A 3TWZA 7FDRA 1XMOJ 1B7YB 1TUVA 3SCLE 2VL1A 4LIRA 4FYYB 4ED7A 1M5SA 1WKKA 4LF9F 4UOCA 3W2WB 3JS9A 3JSRA 1AUSL 4DS4A 2R2TA 3EPIA 4RW6B 2FHKA 4GC7A 2BE9B 2CJYB 1NRKA 3QLHA 4JI1J 4XTTA 1JKHA 5HMWA 4ZP7A 2NUUG 3NL0A 2G0CA 1S1VB 2CRLA 5I4MA 1RA6A 4BS2A 5DQGA 5LMNF 2YWFA 1OJ4A 4FDFA 5KFIA 2VG6B 4RU2A 4CO5A 3BGOP 9RUBA 3TA1A 2R9LA 2ASYA 2BJ9A 5CD4A 4KT0C 4ANDA 4DR5J 3Q23A 4WKRA 4M5DB 4J90A 2KJVA 2IBKA 4XPCA 2IJFA 3ZZYA 1X4DA 1GQEA 2PI4A 5L1IA 1ZA1B 3GG0A 1WDDA 4WKYA 2QMUB 2OPQA 1S7IA 4I4BA 2AEJA 3OHAA 1HR0J 1JJCB 2EPIA 2F8MA 4X64F 3H98A 1U49A 4DSEA 2LA4A 4LFAJ 3RBZA 2GZOA 1WELA 2M8DB 4DSLA 3SDEA 3QAUA 2IRUA 3W2VB 2A2DA 2MKCA 1YSJA 4LFCF 3MAAB 4RNNA 5G0RA 3I0RA 2FD2A 4ICLA 2V2ZA 4N41A 5JVGQ 2C3UA 3HD1A 2W8LA 2D74B 1EX8A 1DLOB 3P96A 2XHCA 1N88A 2EFQA 2KXNB 1QAIA 1TKXA 4FP9A 1N5YA 3EGZA 3PYGA 4DV5F 3NGUA 4H4OA 2M2BA 2HHSA 1YJTA 1PIEA 4TYAA 3MEGB 3V6KA 4LF9J 2W01A 4NLPA 2CNKB 2QYGA 1KHWA 3DFEA 3QGPA 3I5AA 3HHEA 2ZNYA 1EP4A 2DYAA 3HVTA 5KFNA 2D3ZA 1VC6A 2CJBA 2XLKA 3QSIA 3ZZRA 4ZVRB 1NO8A 5GMDA 1YGYA 2KL8A 2VG5A 2W2NP 5AE2A 2Q1LA 2Q79A 5E0OA 5KFYA 2GJIA 3CMQA 2AEFA 5LMNJ 3EZUA 1YJWS 5HAOA 1K9MT 1N6QB 3MZIA 1UVIA 4LSNB 5KG1A 4OYWA 2HMIB 1JX4A 1IKVB 1Q78A 4HLBA 3IRXA 4M1KA 2AZ3A 3L95X 1U02A 3THPA 2ZKTA 2GO8A 1TL1B 1UFKA 4ED1A 1IKXB 2QX0A 1AUDA 2J6SA 2NXEA 1FEHA 4UZCA 2NS1B 3LF0A 2FLNA 2QIFA 2HFVA 3UDEA 1CS4A 1TUWA 2KFNA 4X64J 3BO4A 2LQ9A 1RHUB 5FD1A 4X4NA 1N34F 1HD1A 3I9V9 4FYDA 5KT6A 5AXLA 2LQBA 3GLJA 4LFCJ 1NPKA 3GFYA 1U7LA 2JRSA 4KTQA 2WONB 1Y3KA 1OQ6A 3J7AN 1R0AB 2D9PA 2GVDA 2DRBA 1H2VZ 3ZZTA 1URNA 3FC9A 3HKZD 4DV5J 1LQ9A 4TY9A 3KLEA 3TEHB 3H2VE 1C0TB 2ALYB 2VASA 3RB3A 4M5LA 1B3TA 3O8WA 4QOTA 3VGTA 1IR2A 1F5AA 2HK2A 3WHIA 4ECSA 3JYTB 1FX2A 1NEEA 4ZA1A 1KNZA 5HL7Q 2DD8S 4DV0F 4MKYA 4FKXA 1TKTA 3CD7A 1RT4B 3IG1B 5D0RA 5D6GA 3DI6A 4ATNA 3MMAA 2BDPA 1Q0NA 1WKLA 3MUVP 1T02A 3CULA 4QR0A 4CT8A 3AD7C 3DRSA 2CFXA 4PG7A 4O3NA 1X9WA 1RHJB 2Z57B 3W3SA 2HYIB 3QFWA 1CC8A 2G1DA 1VQNS 2BACA 1JLAB 1HQUB 2AKWB 4GKKF 2CA9A 4MMOA 1FRLA 3GV5B 2G9OA 2CPHA 2CQCA 2IC3B 2PDAA 2ZJQQ 1S1XB 5B0GA 1TKZB 2J8AA 3I9ZA 1N34J 3KWMA 3CCTA 5GAEI 3OFEA 2CADA 4OZNA 1JIHA 5B7WA 3CCSS 1FI4A 4J9LA 3PW2A 1NPRA 2CXEA 3VVTA 4C8KA 2FJAB 1DRZA 3FVYA 2ZH4A 2WB4A 1WOOA 5U47A 5BR8F 3BEGB 3MHYA 2BW7A 5IV3A 3L09A 2GHPA 1FJGF 1LWCA 2WOMA 4F4YA 4ZN1A 1Q1KA 2DHAA 4KGVB 4KGZB 4UUWA 3MD1A 3HFVA 1HA1A 3E8OA 1CJKA 3J80U 4B3OA 3CDWA 1S4EA 4NZ7A 1K0VA 4KC5A 1F5CA 3ILJA 4WYLA 3Q8PB 2X7IA 3G8TA 4OZLA 4DX5A 2BANB 4MTPA 4DV0J 1YJNS 2H9ZA 4FPRA 4IG3B 4TQSA 2R2SA 3NY0A 2P9CA 3ZZOA 5E33A 3R5AA 1D9DA 3M2VA 3ET6A 1J5OA 3CCQS 2A6MA 4KPYA 1FD8A 1BE4A 3M2RA 1F1BB 2BM0A 4O0IA 4ED3A 2O5DA 1HPZB 1S7HA 1YKWA 2B4UA 4AT1B 1QE1A 3MI7X 3OW2R 3CC2S 1SC1B 4ZIWA 1IN0A 3VZHA 1Q79A 2IJRA 2ZH8A 4GKKJ 3FFIB 3LQVA 4QQBA 1VCTA 4YR0A 4DV7F 3UE2A 3QGIA 2FVCA 4DR6J 2FHJD 1S48A 3MCOA 4IH7A 5G4DA 2BJ3A 1F9HA 2R8GA 3AOBA 2AJ2A 3GSIA 3KMSA 1NJWA 4C0OC 3RBDA 5KTQA 3TJ9A 4QCLA 1KHVA 5FLXU 1X0PA 4KHMA 4DX8H 1SH3A 4USKA 3W2WA 2MB0B 1RHKB 5LJ5Y 2R3VA 4F67A 4RW6A 3CIZA 1N4LA 2CQ3A 4LUBA 5I3QA 4LF7F 5BR8J 3BSNA 4YB5A 3C2PA 4Y65A 3GTYX 5E41A 1FJGJ 4CLLA 1S1VA 1EKRA 3OTDA 3DRYA 3ZXWA 1S0MA 4QYZK 1RWOB 2HRYA 2RAQA 1N0VC 5KOWA 4OI4A 1JJ2R 4DQPA 2VG6A 1BUXA 4HHHA 4RWWA 4QIEA 4Y34A 2AX1A 4DI6A 2HIQA 2ZBIA 5LXRA 3SCIE 1UTAA 3PR4A 5DGBA 4M5DA 4OIXA 4F2SA 4MIWA 5CQGA 3GIJA 2F5GA 1QSSA 4KFBB 4LQ3A 1RAHB 2A1BA 2C2RA 3QGGA 1V5VA 2HZVA 4IDKB 5HANA 4FPIA 2W4DA 2MZQA 2ZWOA 3A8JA 4ZP9A 4MK9A 1AT1B 1NDPA 4NE9C 2Z0GA 1AYEA 1T11A 2ZJPQ 1IBLF 1JK9B 4WIIA 2JEJA 3GYXB 3W2VA 1C1CB 3MAAA 1HW8A 3EDRB 2QL7B 2H5IB 5HQLA 4ZVQB 2L9DA 4BWJA 1DLOA 5AE1A 1C4CA 3CC7S 2KT5A 3HX9A 3D1HA 3M8QB 2J9CA 1RAIB 4P7VA 3EGVA 4JUZA 2QLWA 4I7FB 1RBAA 3MEGA 5J2MA 1Q7YT 2AQ4A 2VC1A 4DPUA 1F60B 4I69A 4FYWB 3NS5A 2OELA 4LF7J 3FDSA 2XZDB 2MDAA 4ZHRB 2YPYA 4RWXA 3ILLA 3TVZA 3PZPA 2HQGA 2OO4A 4ED0A 1J5EF 3EVOA 2F7VA 2AGOA 3KJFB 4NLOA 3PIOQ 3H90A 1N6QA 2LFVA 2J7KA 4LSNA 4TQRA 1VQKS 3NGKA 2IVFB 2VV5A 2HMIA 1VC5A 1AB8A 1ZBTA 1ZM2A 1CG2A 1UAWA 2V67A 4DF4A 2EI5A 4YFUA 2NSBA 1TL1A 4EEYA 3BJYA 1IKXA 2B5JB 4DSFA 5AT1B 3CJ0A 3CJ3A 3CJSA 4TY8B 1NH7A 2ZBCA 2KO1A 1NCLA 1IBLJ 1XBWA 3AB4B 3AH6A 3EDQB 4USIA 1YRXA 2DH9A 4C8ZA 2V94A 3HHKA 2HFSA 3LPYA 1RT7B 2DGVA 3W63A 2AV5A 4YN3B 3H7HB 4K50A 2WONA 2DNHA 2XC9A 3ZTOA 3OHBA 3FUYA 1R0AA 3ZTQA 2P9GA 1GMUA 4LBPA 3CD0A 3KLHB 3M6VA 4EI2A 2DIUA 5LXYA 3TUIC 1VQSA 1XJWB 1C0TA 1RWUA 3R6GB 4NLTA 2HFZA 4C8MA 1SH0A 2A2CA 2Y1IA 1V9OA 2XTJP 1P6TA 3M8SA 3OFGA 4ES2A 3KLVA 4MH8A 5ETSA 4P10A 4JOUA 3THTA 3JYTA 3KNAA 1RT1B 2CVIA 4C8YA 3P45B 4DFKA 2NCKL 1JLCB 3V81B 1X4BA 4TYBA 1J5EJ 4V1Ak 4F3OA 3QIPB 5IWAF 3G4SS 1RT4A 3OL7A 1Z2LA 1UVJA 3IG1A 1LW2B 4OI1A 3BQ1A 5D0HA 2MKKA 1O6XA 3KUHA 1PGZA 5F8MA 4PABA 2ZVIA 3TUZC 1FVSA 1ELOA 1VRTB 4UY8T 2OFHX 1Y3JA 3M32B 3M2UB 1KVJA 3OR2B 4OYAA 1T9YA 4QU7A 4J9UE 1D9AA 1JLAA 1HQUA 2YWEA 2EKNA 3T3FA 2VBZA 3CCMS 2V8DA 4OI2A 3WIUA 4DXLA 4N8NA 3W62A 2FVQA 4YQWA 1NK9A 1JWWA 4RJVA 2IC3A 1KLMB 2CG8A 3K5OA 1S1XA 1RTJB 1TKZA 2CG4A 1F0XA 2A18A 3KJNB 2CZ4A 1YI2S 2HNZB 1S79A 1IJEB 5EN1A 1TUGB 3TANA 3MECB 1F5BA 4ZLPA 4CZCA 1S9FA 4XIUA 3KDNA 2O3DA 5LL6d 1XK8A 3BB5A 4NX9A 3UD5A 2B3TB 1S10A 3JQJA 1KBRA 2HHPA 4A46A 3CDBA 5I42B 3NCPA 3T5LA 5LT5A 2PA8D 2CPXA 5KFJA 3CJQA 4LSZB 4L3NA 2YX1A 1V5IB 1T05B 3NCQA 4BC9A 3OXLA 1MMLA 2DGSA 1RP5A 2ACMA 3EX7B 2KU7A 2MZJA 1KQFB 5DLFA 1NM2A 4MK8A 4CO3A 2OPRB 4O3SA 2DY9A 1RI7A 2BANA 3K59A 4DQIA 3H20A 1EARA 4LF6J 2U1AA 1E6VA 4IG3A 1WORA 2ZBQA 2CQPA 2MJNA 3LAMA 2VDIA 5IWAJ 5GAEU 1VDHA 5F9LA 2HFUA 2AGPA 1RAOA 2FC8A 4GKJJ 3J7ZT 1KOOA 2UXDF 2LEBA 2XMJA 4DMZA 2NSCA 4UTGA 1HPZA 2C2EA 1OSCA 3TZZA 3H5UA 3OTOF 1UMJA 4DQRA 3FFIA 1HBNB 3H4DA 4Y3CA 1TMJA 3W9IA 3KJVB 2UUWA 3PW7A 3VQTA 1LOUA 4J91A 1REGX 1IWGA 3CGIA 4IG0B 4AYBD 1G1XA 2IDLA 1XR6A 2GJ2A 2N3LA 2QT7A 2J8SA 1NMEB 2QMWA 4PCQA 2O67A 2F4VF 2OPSB 2PFDA 2QE5A 2HQFA 3KMQA 3BKTA 3FSYA 3D6MB 3LO3A 1FK9B 2X1FA 5D4PA 4F0KA 2ROGA 1HWJA 1LXNA 2HHXA 4BBYA 3HHNB 3IMQJ 4B9TA 1GXLA 5ETTA 2IVYA 4ER8A 4DU7A 2VICA 3Q8RB 1GEHA 2B9EA 2HWTA 2CQ0A 4FF3A 5DZ6A 3D0IE 3GV7B 4GC6A 4OHVA 2VU5A 2XEXA 1KFSA 4KFBA 2E7XA 1JNZB 4LRFA 1MLAA 4U67Q 3K17A 3FCHA 3CCRS 3DDIA 3Q8SB 4IDKA 3AJ1A 3LGMA 4F0MA 3W61A 2QMXA 2UXDJ 1RT6B 5H9EK 1TKDA 2VJUA 4NLVA 2J6TA 3A3OB 3WC2A 4QYZJ 3OTOJ 4TU7A 2ZH3A 1C1CA 2WRMA 1ZETA 2NUHA 1KC8T 1TV6B 4M95A 3O6QA 3WZ0A 2WVEA 3PJWA 1HD0A 2ILZA 2PA3A 3R6LB 2MY8A 1NH8A 3M8QA 1WOPA 5KFHA 1RE1B 2JFDA 1NKEA 4I7FA 4HT7A 2F4VJ 4P9SA 4WXWA 1VHIA 3BSAA 1DQ8A 3BN4A 2RU3A 2QLXA 3A3NB 4P73A 4KRWA 3Q24A 2W9BB 3ISNC 4NLWA 2G0JA 2NYIA 1ZTWA 2K2PA 4ZHRA 1Y5LB 2RDJA 4KV8B 1K1QA 4PQAA 2LDIA 2QZ8A 2DNYA 3NEKA 2BEFA 5J2QB 3BYPA 1DFDA 2AJ4A 1W7WA 4MIAA 3H40A 4TXSA 1QTMA 5D78A 2KG1A 2H5JB 2DH8A 2XSFA 3Q2SC 2XHWA 3KXDA 3JSMB 2X51A 3BO2A 2DT9A 4C4WA 3MM7B 4Y28C 2PE8A 5ETQA 1L5UA 3PTWA 1XN9A 4DWIA 4P52A 1MMNA 4DL4A 3D6TB 1Q4RA 2B5JA 2GV1A 2DVIA 1RCXB 2RRBA 3WDOA 3TUJC 2UV8A 4TY8A 1Y4ZB 3N6NA 1ZAVA 4JI7F 1NJIT 4ECWA 2PIIA 7FD1A 2C3OA 3F0NA 5C42B 1RT7A 2C22A 4ELVA 3CD5A 1UJ5A 1WHVA 3BGFA 3UNGC 3AODA 4FS1A 4F4WA 3HMJG 2CUYA 4FXWA 4I6WA 1KTVA 2ZOGA 3KLHA 3OTCA 2X1GA 4E0DA 2V6AA 3KK2B 4O4GB 2E9TA 3H4BA 2B0GA 2EVZA 2FHOB 2MKYA 3S8SA 2RSQA 2HRTA 5K8PA 2OP5A 2CPDA 3FGVA 2G4BA 4ZVOB 4CRJA 2DK2A 4Y0FA 1RT1A 1M1GA 3NGDA 4OHYA 3K89A 4D3HA 4AUKA 3SQGB 1VYAA 1URRA 3I4HX 1JLCA 3LAKA 5H9FK 5HSPA 4CH1A 1U1KA 4LIWA 4ALZA 2YVSA 3QIPA 2I38A 1R8PA 1PILA 1LW2A 2NPFA 4N47A 2YH1A 2P6TA 1FNXH 1HBMA 4X4SA 3MCMA 4G1PA 3NWGA 2GX8A 2HKEA 1VRTA 5CAAA 1FHTA 2ZZTA 3M32A 3M2UA 2F40A 2OPPB 1U6FA 4C0BA 3OR2A 1A7GE 3ENWA 1FT8A 3DC2A 3S1TA 2AX0A 3D0GE 4TVAB 4ECYA 5A8KB 2F3JA 2W2OP 3RW7A 5HN0A 4LR8A 4EYHB 2HK3A 4NRUA 4LRDA 2PMWA 1KLMA 3FEYB 1WEXA 2L48A 1RTJA 1LWXA 2VFSA 4JI7J 4PQUB 1Y5IB 5B09A 4JV2A 1H2TZ 5D4NA 2HNZA 3SSSA 2M8HA 2LP4A 3W5YA 3EMTA 3MECA 2IMWP 2NYHA 2KYZA 2AU0A 3GYNA 2ZBPA 3R2CJ 5IT9Y 3ZZZA 2RQ4A 3V4IB 1YIJS 2FHJA 4K4YA 2BKOA 1S97A 5I42A 2HQ3A 1N5SA 2LECA 3E2EA 4WFXA 1M5KC 2DISA 2BYCA 2HGMA 2H3EB 5FIIA 3PHEA 2BW2A 4A47A 1R3NA 1RA7A 2IYGA 3J80Y 1T05A 2JWNA 4J9KA 2Y9HA 2QG9B 1RKIA 1LWFB 2KH9A 2CQ2A 1R8HA 2PEHA 1FJ7A 4BDPA 5J1EB 3OJSA 1PKUA 5FJ4A 2OPRA 5GAHI 3HULA 4B9NA 1UETA 4X4UA 2R7XA 4F02A 4F7VA 1PYSB 5L1KA 5KG5A 4OHXA 4HR2A 2CIMA 3ZNUA 1CJVB 4QIWD 2NLWA 1TK8A 1NSQA 1XIQA 2OJ3A 1ICEB 2ACYA 4OJGA 2EEYA 3OLBA 2W2MP 1CEZA 3KUEA 1OYDA 3I5BA 4IH6A 1FWPA 3IN5A 3CMAS 2UVUA 2HS4A 2HNDB 5K20B 1BC6A 2CJKA 4P6QA 3P5TL 5DGAA 3WX4A 2L08A 1XR7A 4G65A 4I68A 1RJJA 4DV1F 1HBNA 2B51A 2VODA 1SXLA 4B17A 3KJVA 5HJYA 5J1NA 2OIHA 1ZYQA 2LU1A 1BMQB 4IG0A 3C16B 3HLUA 1ZS6A 4ZVPB 5FLXY 2C3PA 1X4EA 3RR7A 3D0HE 1Q5VA 2OPSA 1X4CA 2F8HA 1R8BA 2YPZA 2E1MC 5E3CA 1FK9A 7AT1B 4IOAQ 1HIYA 4BC7A 3I0SB 4FYXB 1CJUB 5AJ3F 4U7UD 4F4KA 2Y1RI 3PX0A 1NK5A 2VPYB 4ES1A 1T7PA 2XY7A 5C5JA 1Q8LA 1VRUB 2FPHX 2XS2A 2IRXA 3M4XA 1RHQB 2O66A 2RDIA 2BJ7A 2DNLA 2BV3A 5KFEA 2KHCA 2J7WA 3P5BP 3DHWC 3R9LA 2IY5B 3DMJB 3KOAA 1ZPVA 2QYCA 4NCGB 4A8SA 2DR9A 3AB2B 1LFPA 2B9XA 3T6BA 3TJ8A 3PX4A 2VA2A 4IUFA 2YKMB 3TZWA 3WC0A 3M9NB 2J6UA 3VAKA 3VAHA 2UUAF 3D5MA 2VBXA 3Q0AA 2BRKA 2WVFA 1RT6A 4MK7A 2OHDA 2KXFA 2K3IA 3THVA 3GSDA 2YXLA 1O51A 3QO9A 3PHTA 2Q6BA 1VRQC 5HVHA 2EFGA 2EC2A 4HACB 4RR5A 3GCWP 4DV1J 3CNQP 4EU0A 1KWMA 1MSWD 3BM7A 1TV6A 4KHPF 3K5MA 3SXLA 2V9KA 3PEJA 4EUVA 3PCOB 2VKRA 9ATCB 1Q8IA 1DBDA 4ZP6A 1YBTA 3OD2A 4K4TA 5ETLA 5T41A 3MPYA 5LSOA 3E01B 3V5RA 1MW7A 2JC1A 1QUVA 2R7QA 2M52A 3W65A 4F26A 5A6WA 2W9BA 5H9EJ 1N48A 4RNOA 2KFYA 3DLLQ 2X3GA 4KV8A 3AXKA 5B0FA 3TQEA 5AJ3J 4DHVA 3QJJA 3PEHA 1T9VA 3HVRA 5J2QA 3QQCD 2IYIA 2FUG9 3TNVA 3FMWA 2E1PA 3ZTPA 2IIHA 3Q22A 4ERDA 4IQMA 2VONA 4CO0A 3JSMA 3EPGA 3K5NA 3LPEA 2GMJA 2WBRA 3I55S 3OPKA 3MM7A 2MZRA 1B7FA 4FVCA 3QYYA 3UVJB 1DZ5A 2V69A 3JXOA 4C3LA 3SFUA 1Z1ZA 2VF3A 2KG0A 3DNCA 4YMEA 3T9ZA 2HURA 3ONQA 4L3KA 3DLEB 2E5GA 3CMES 3LGNA 2HGNA 3MTKA 3T5JA 2ROPA 4DFPA 3JTOA 3PM9A 4O0NA 4LQ9A 4EK2A 3QPIA 2CQIA 3QBCA 4JP8A 1M90T 2V4RA 5C42A 4YB1P 3T1AA 1AXQA 2HVHA 1KR4A 2DHHA 2HS3A 1VHFA 1F2HA 1WF0A 1X4FA 3RGIA 2E44A 4URQU 4KHPJ 3PYEA 2DR5A 2KT2A 4OI6A 2OI2A 1S59A 2FC9A 3FEZA 1X0FA 3BKUA 1XEZA 1TAUA 4PAAA 3K58A 3KK2A 2YWWA 3NOCA 1RTHB 4O4GA 1HNWF 4N7TA 3D2WA 3O2IA 4EO6A 2XMAA 1BY9A 2XMKA 2LDYA 2XMUA 5FDLB 2DKOB 2YTCA 2GGPB 4RUHA 4F0HA 1EB0A 4NOHA 1UVKA 1WTBA 2ZM6F 3G82B 1OQ3A 3N79A 1QVGR 1AZSA 3HSDA 1MN9A 3SQGA 3BBCA 1Y5NB 2KKHA 5KFLA 3HM9A 3I31A 3MWBA 1N56A 4R8UB 1B4SA 3QT7A 2XYPB 4QWDA 2NXCA 1U0SA 3NAIA 1F6TA 5HMXA 3GJRB 1PG5B 3MFIA 2HW3A 1F3VA 5DRKA 4QR1A 3RBXA 3I32A 1VQ6S 3CIMA 1FTRA 2IMOA 1IQTA 4DUZF 5B0DA 4C3MA 2QLBB 2GMLA 4RW4B 5A8KA 1UA0A 1X5OA 4PEOA 4NPOA 1VFJA 1HKAA 2MQ8A 4PQUA 3PX6A 2V8VA 3TEGA 2K8GA 1JLEB 2BQUA 1V6HA 2E1AA 1YG0A 1Q16B 1P1LA 4OZ5A 4MIBA 3GPAA 4GO7X 4U95A 1T95A 4FF1A 2XLJA 3V4IA 3TAMB 2F9JA 2JEFA 2ROEA 4OMFG 3KDOA 3PDNA 3H2UB 3BREA 4XAKA 4A4JA 1NUEA 2AGQA 1HNWJ 3MR2A 4G1QA 1HBOA 5L8RC 2IRYA 1W2IA 1NNDA 1LWFA 4TLRA 3HDSA 1FJCA 4K59A 3AQOA 5J1EA 4P74A 1IR0A 1U2FA 2UXCF 2ZM6J 2DNZA 1RWNB 4LBHA 4QPTA 4CLSA 1PBUA 3BDEA 3IWXA 3W64A 4DL5A 4CQ1A 3UPFA 1A9NB 1FRHA 2JL9A 5B0AA 3A8IA 2LVWA 1PBAA 2RUSA 2KRRA 4EBEA 4LR9A 4DDFA 3OSPA 1CJVA 5MAOA 1XMQF 4PUOB 4DN9A 5B0CA 2Z2ZA 3L7OA 1T94A 3CEDA 4W98A 2NREA 3LTOA 2E9ZA 3QWPA 4UOGA 1WEYA 2LCWA 4ZPTR 1DY3A 1XWLA 1LV5A 1EHWA 3R7BB 2A3JA 6AT1B 1IKWB 1RAAB 4LSLB 4CH7A 2HNDA 4DUZJ 3EWGA 4N77A 4IR1A 3GG1A 1VQMS 2H51B 3V6JA 4O23A 3HJVA 3KNGA 3KLFB 1DQ9A 4ZOSA 2FQQB 2RILA 2FHMA 1FXRA 3C16A 5GAHU 3CB4A 4EWTA 1SL2A 2CQDA 2CJXB 3MMJA 1DARA 2HHTA 3MM6B 1RT5B 4O3OA 1SC6A 4FBTA 4OX7A 1CJTB 2DGXA 3R3TA 1KD1T 4PRFA 3N5BA 4NLQA 1FRMA 1XNRF 3RAXA 2X1BA 2N3OA 1WD6A 2BQ3A 4L73A 1C4AA 1X7VA 3I0SA 2N7CA 2ZNZA 1CJUA 2W1BA 4OYZA 4LVOP 2CJAA 2JC0A 4B9MA 1HHTP 1VRUA 3GIMA 5DETA 2W7OA 2HHHF 4Y2IA 3I96A 1TL5A 4Q7AA 4WE1B 2UXCJ 1WNEA 1TQLA 2FLOA 4DL7A 3OV7A 2ZH9A 3DMJA 2DY1A 1MWQA 4NCGA 4DJBA 3F44A 2NZ4A 3J81U 2E9RX 1QVFR 3MFHA 3H5SA 1WG5A 2YKMA 3R1LA 2IA6A 1XMQJ 3CJ4A 4Z7CA 4LRAA 4WP9A 1VMBA 1PJ5A 1WDTA 4S0MA 5A2QU 4WU3A 2WW4A 3MR5A 2VA3A 5L38A 4AL7A 2DNRA 1TL7B 1V3RA 3BR9A 4X4TA 3MMCB 3D3CJ 2ZDPA 3GR0A 1SCJB 1S1WB 1SPBP 5IT4A 3CDUA 3EZOA 1WACA 2JNJA 3MR7A 4HACA 4PYDA 2D3O1 3OL9A 3G96A 1U25A 3AD8C 2LA6A 5IV4A 1Y10A 2BKPA 4UUXA 2VKZG 4JI6F 4DSJA 3C3LA 4R0EA 4WWSA 3OVSA 2CQ1A 3U27A 2EFOA 3MR3A 2QEXS 2WB1D 2DGOA 4NI2B 2JH3A 1QM9A 2XLIA 3GFZA 5D0EA 1UWAA 3OXGA 3VV2B 1EQ0A 3LP1B 3BV8A 3P4UB 4PR6A 3E01A 4LFBF 3RB4A 3Q8VA 4WP8A 3SBMA 3DRRA 3DXSX 1XQIA 2XO7A 1VLYA 3Q8QB 1XNRJ 3KK3A 2W9AA 4MJKA 1N32F 1RACB 5KFBA 3F56A 3UD4P 4DL0C 4EBCA 1M5PC 1GFWB 1L3SA 3A3PB 3W66A 3MPVA 5MLCV 2OD6A 4JV5F 2HHHJ 1K0TA 4ED4A 1LXJA 2L3MA 4HI1A 3BH6B 2K3KA 4B9VA 3KYLA 2HHWA 3FQKA 2NQPA 3H8YA 1IM4A 4DCPB 4NYPA 2DPJA 4FS2A 3UVJA 1YITS 3U1LA 2GO9A 3CUNA 3JQKA 3WBZA 3CD6S 2UXBF 3IRWP 1YVFA 4JI8F 3DLEA 3I82A 4UZBA 4X2BA 4NA3A 2RMLA 5HVFA 3JAMY 1FKOB 1YBAA 1BQMB 1D8ZA 1QTNB 3GILA 3MOZA 3L3CA 4PPZA 5IXUA 4C11B 2V2QA 1K1SA 2RVJA 2UP1A 1VOMA 5HATA 1HNXF 1Q86T 2BABA 4UOFA 4GVBB 1S1TB 4JI6J 1KQGB 1NKCA 5CZVA 2R8IA 5K14B 5KFSA 3D1OA 1FFSB 2OLWA 3SSQA 3EYZA 1NZAA 1F9EB 3VTIA 1O8BA 5KFAA 1RTHA 1HWIA 2OGUA 3NS7B 3VCDA 4I6YA 4LFBJ 5I3UB 5FDLA 4N5SA 1RTDB 2AYEA 2GGPA 1B99A 2W4PA 1RT3B 1C0UB 3HT0A 4NCBA 3GQCA 4YR2A 1N32J 4UQTA 5E7OB 2YNGB 4R25A 3C19A 3BGRB 4NLXA 1IUJA 1SKUB 4R8UA 2MQOA 4YEAA 4JV5J 1TZ0A 4DL3A 2XY6A 4NCAA 2C2OB 1SKWA 1O0PA 3FK4A 3NKYA 3QNWB 3A8KA 4L72B 5HQ8A 2ZHOA 4ID8A 4B02A 4L74A 1DJ0A 3J7YI 3CCLS 3RB0A 1HQ2A 2OTLS 4NEZA 4J9SA 2CQGA 1M5HA 4USHA 4C8OA 2UXBJ 2B9YA 4ZVSB 1RYSA 1JB0C 2DNGA 1VBZA 3CO9A 2ZFHA 3MMBB 4RW4A 4JI8J 4MKBA 1DURA 1R43A 5E3QA 1D9FA 3UN3A 1NK6A 2ZH6A 3M9MB 4RKUC 4ZVGA 2LQ5A 4NASA 4QWBA 1JLEA 2YQ3A 4JB8B 4KPCA 2ZE2B 1ZM4A 3OXFA 4XDDA 3D54A 3M8YA 3NCRA 1U1PA 5KFZA 4ZVTB 1Q82T 1HNXJ 4F4ZA 4ETXA 2H54B 2XYGB 4PG5A 3TAMA 2K1RA 1T9XA 3O44A 2LQJA 5M2PA 3KTQA 1ZAWA 5IOLA 5DG8A 1S76D 3E3XA 5EWGA 3MCNA 3BSOA 1F3FA 1VI7A 3DOLB 1YRUA 3ITHB 2W8KA 5GADI 1SIWB 2MJUA 3W5ZA 4ZCMA 5CYQB 3EICA 5CZXA 1FCAA 2OEKA 4WIQA 4OYIA 3IM8A 2DCLA 3M6XA 3UDVA 3HSZA 3QJLA 1V3SA 4JV1A 3GMGA 2HHVA 3AHPA 4PUOA 1RB0A 3VHQA 2KVQE 4OX8A 1NK4A 1FFWB 4URGA 4PZVA 1TVRB 2ZWPA 4TN2A 2BJ8A 2RRAA 2UVVA 1TFYA 2GAGC 3HHLD 1RQ0A 1IKWA 3OVAA 4LSLA 4CWBA 1BWEA 2VFRA 2CVEA 4RUCA 4H4MB 8ATCB 4U7UK 4ZLNA 3GV8B 5F3ZA 2AZ1A 3O5TB 1YJ7A 2VDHA 3KLFA 3M7VA 4WTYA 4A8QA 2UUBF 2GMHA 2EFNA 3EXCX 4J9RA 4GVLA 4P72A 5DDQC 1S6PB 4W90B 2HVIA 3ZC4A 2E5JA 1XERA 3CF5Q 5KT7A 5D8HB 3MM6A 1RT5A 2ZEJA 2GA7A 1G4CA 3HJFA 3D68A 1CJTA 3N01A 5C25B 1OY6A 1RWMB 2LKZA 4RW9B 5HO4A 1PAUB 1KLNA 3NXZA 1RT2B 1KOHA 2DPIA 3PY8A 2PO4A 3GCXP 5KG2A 1KP6A 3MDFA 4XK8C 3KG1A 3SZ2A 5F41A 1VLOA 1VBXA 5HBMB 2MHEA 4IOBA 1I94F 4FKYA 3LOUA 4WE1A 1R8CA 3DLKB 2JVRA 3HK2A 2FY1A 1SQEA 5KFUA 2WVDA 3TARA 1FJEB 2V2KA 3VF0B 5JVHQ 3A1YG 4YUDA 3RB6A 3C66A 5HVGA 4NLSA 1QAYA 1X4HA 2V50A 3DHXA 1TL7A 1PAEX 2HLTA 4LBIA 6FD1A 4NXNF 2KRBA 3MMCA 2HBRB 1S1WA 4URSA 2GHWA 2Y1JA 1RAFB 3KKFA 2GQCA 1M0SA 3NS6A 3IAS9 4ZJOA 2XMVA 1T9WA 4WFYA 4NZ0A 2UUBJ 2VBYA 1NJXA 3WQPA 1N52B 4NI2A 4ANCA 2MY7A 3R97A 3UCUP 1VQ7S 4NEYA 5DDPC 1LEOA 3LP1A 2YBVA 1VJQA 2YKNB 2RRNA 5AXNA 3G6VA 3FEXB 3L4BC 4B08A 2CPJA 4I2PB 4K5SA 1FNMA 3AOCA 1U4BA 2JLFA 3QFHA 4L6V3 4DF8A 3HZGA 2E5LF 4CDIA 5EDWA 4AD6A 3BSCA 1NPPA 4PG4A 3I56S 3BPSP 1I94J 3CWJA 2Q66A 5HROB 1OWXA 2BE7D 2ZC3A 1W25A 4F4AA 3O1LA 3H42A 2WSCC 2LQ8A 1KS2A 3M8RA 4B9SA 2MKHA 4C8LA 5D0GA 2QJ3A 3PR5B 4ZPAA 3DLHA 3M6WA 3TVYA 2XI3A 3ELHA 2BUNA 1Q8KA 3SMZA 1RBOB 2CZ9A 1FX4A 5IM0B 1FKOA 3NRBA 1BQMA 2ZBRA 4NXNJ 2XNQA 5CHCB 2ZH7A 1D8YA 2MGZB 4DEZA 3BO3A 4CYUB 5LMUF 2HAIA 4GVBA 1S1TA 2J0SD 4PWDB 2H5EA 5K14A 1BWVA 1TK5A 1RK8A 2DBBA 1SJRA 2DR8A 4K2JA 4K7QA 2OH2A 2QO3A 2YWGA 2VOPA 2F63A 2R42A 1HW9A 3CDAA 1R6YA 3KK1B 2A10A 3M8ZA 2D9OA 5I3UA 5JUMA 3LGHA 5CA5A 2G2ZA 3TW0A 3QZ7A 1RTDA 3N4WA 4LF8F 1U24A 2QL9B 3PRDA 3B78A 1RT3A 1C0UA 1C1BB 1YZ7A 3IS9B 3RTVA 2EFPA 4EMDA 3P6YC 1ZZNA 2YNGA 2E5LJ 3DU5A 2MXYA 3BGRA 2HRUA 1SL0A 4P2FA 5GMKa 2C2DA 4OHWA 4IRKA 4Q2LA 1S77D 2DNOA 1H74A 4J9MA 4J7CA 5HP1B 1HBUB 3GE9A 3SIPB 4ID5B 4OV1A 2JX2A 3VGSA 4M5IA 4OJ1A 4WPAA 4JI2F 5ETMA 4F3QA 3FBEA 4WXOA 2ZKUA 3B6BA 1SJ1A 2YKAA 3MMBA 1NK8A 1SJQA 2F9DA 1HWUA 4WJBA 4OI3A 2HZCA 4A8FA 5SUHA 5GAGI 4WF9Q 2XMTA 2GQQA 4KY3A 3HHLB 2N82B 1N5QA 3PIPQ 1SC3B 3QGHA 3CCJS 1YBUA 3RAMA 2ZE2A 3PVXA 3IR6B 1FERA 2KYXA 5LMUJ 4A8WA 1Y11A 1UPMB 3UI3A 2KVIA 4CH0S 3AT1B 2CNNB 2BE2B 3IGNA 1SKSA 2VFUA 4QBUA 2BZ2A 4I56A 3EZ5A 3Q8YA 2YKOA 2ZVSA 2A0FB 1LW0B 5K8OA 4F8RA 4CO2A 5D4LA 3UN2A 4NA2A 2J5AA 2PN6A 2CQ4A 3J7YU 4PWUA 2X3DA 3DOLA 3ITHA 1UZDA 5KFDA 3C6UB 4LF8J 1UKUA 4DV7J 1GMWA 2C2NA 3AAWB 3QT5A 4NYZA 4F3MA 2XULA 5CYQA 2VIHA 4D3GA 4DU8A 3CCZA 1O5JA 1P27B 3D67A 2ADBA 3PJXA 4QZVB 2DR7A 2CDRB 1S0NA 1FE0A 1CQMA 4QWEA 3RG6A 2B8QA 4QIFA 3H5XA 3HFKA 4BHQA 1TVRA 1X5TA 3CW2C 3KHHA 2B4PA 4ZCKA 4BLGA 3G8QA 1FDAA 4UOHA 4RZRA 4GRSA 2W24A 2QN6B 4JI2J 2HVZA 1KONA 2QLFB 5E3PA 3G71S 2I5JB 5KFRA 3TQ1A 3DLGB 4H4MA 4DPXA 1VR6A 5A76A 3MM8B 4HHUA 2L9NA 1YK9A 2RF2B 3SI8A 5GADU 1VBKA 1DQAA 1IKVA 1S6PA 1HNZF 1NSKL 2GIRA 1KRPA 4ILRA 1GMVA 3ZFVA 2KT3A 5KT3A 2YKPA 2AIRB 2C2ZB 1P1TA 2VFVA 2PT0A 3CJRA 4PXEA 5HMYA 1RABB 4RW9A 2R7OA 4EBDA 3HT3A 1TU0B 1RT2A 3Q8UA 2AYMA 2CPFA 2HGLA 4ECRA 4DZ6A 3TJAA 1FWKA 1G7CB 4RU9A 2R8HA 5HBMA 2N7YA 4OL8A 5HI7A 3CC4S 3FSIA 2WK4A 4OLOA 1H6KX 2HHUA 3GFHA 3DLKA 4Q5VA 2LYVA 3FJ2A 5F3TA 3J81Y 4RO0A 2BRLA 2QLJB 4N76A 2D7SA 2M3DA 5KFOA 3KUGA 2XY5A 5CH7B 1U09A 5EGYA 5A2QY 1WF2A 3PACA 1K47A 4USJC 2HEKA 3H59A 3HPOA 3VR1A 5KG6A 3GJQB 3D3BJ 1JNRB 2H4YB 1MG7A 3MR6A 3RJMB 2C3YA 3EGWB 2ZDOA 3OTEA 2W4CA 3MPDA 3H0PA 3MM5B 1Y7PA 1B70B 1MN7A 4NLDA 2MPUA 3B4MA 4WZMA 3BPDA 3IBCB 2B4OA 4ZP8A 4OFZA 1HLWA 3M6UA 1H72C 4CO4A 4RUBA 5DQHA 2R2RA 4RBVA 4A8YA 3N6LA 4JV0A 1QAJA 1U1LA 2HWIA 1X31C 1HNZJ 2BJEA 3M8PB 1BHNA 3IR5B 2VBWA 3UQSA 1S9GB 3IR7B 1N0UA 3D6FB 2YKNA 4WBFA 1CULB 3SV4A 1OPIA 3LA0A 2XSJB 3PO4A 3BS9A 3AY0A 4WP3A 2WVCA 1UFWA 3CTRA 4I2PA 4NRTA 3JTPA 3MGJA 1HHSA 2R4FA 2DGTA 1OY8A 4WFNQ 4EZ9A 1NBEB 4QYRA 3PO5A 3C46A 4CIOA 2EWHA 2PEBA 3PXGa 1H0HB 2KM8B 1KTQA 1NDLA 1RYRA 5EX3A 2L41A 1SQGA 5HROA 1S0OA 2BMBA 2EK1A 4DR7F 5J2PB 2RHQB 3RAQA 3L7UA 1LWEB 4CCHA 3NNCA 1N5TA 4HKQA 4A48A 1K8AT 3SYZA 2FVRA 3GR1A 1KQSR 2E7VA 1SKRA 2JEGA 3W8GA 2QA2A 4OLPA 4FVMA 4OYBA 1HNVB 1U48A 1UA1A 2ASJA 5CD4H 1WWHA 2D3UA 5IM0A 1GAOA 2AEMA 1IWAA 2W7PA 1X5PA 4J9NA 4MAKA 1M5OC 2YNHB 3BKFA 1ITPA 1RWXB 4QWCA 2MGZA 3UCGA 1BQNB 4B9UA 3MCSA 2OD4A 3PFOA 3M1VB 3RRHA 4CYUA 2R2UA 3W9JA 3LANA 2JLGA 3WX8A 1GT8A 1UWBB 1J2VA 1VS3A 2FGCA 1WC4A 1TL3B 5F8NA 4H54A 4HL9A 4WYWA 1SIZA 3QSYB 4PWDA 2PD1A 2JEIA 2W2PP 5D4OA 3HSGA 4ZPDA 1NK7A 2K06A 3RR8A 1EQMA 2RD5C 4LF2A 4WCEQ 3VAGA 3IWNC 3GIRA 1QJHA 4KO0B 3KK1A 4N56A 4J5OA 2IBOA 3WIVA 1YWXA 5DM6Q 2YX4A 2FTRA 5C2GA 1C1BA 2EXUA 3IS9A 4KR0B 1X4GA 2APOA 1EAYC 4QW9A 4KGMA 4HH1A 3C14B 1U0HB 3JSYA 2N4DA 5H1SV 4IR9A 4PKDB 1HL6A 3T5KA 3CSKA 2E7WA 3FQLA 4DLEA 4ZVUB 1UJ6A 1S4FA 5HP1A 4DR7J 3ENVA 3NGTA 1TELA 1HBUA 5KFKA 4ID5A 2OEJA 4LR7A 2IA0A 4EFAC 3IWLA 2VFTA 2QTWA 4IO9Q 5AXKA 2RUGA 4O44B 1T9TA 3R5DA 2FDNA 2D69A 1KDNA 2B4VA 2CJQA 3P3DA 3VALA 2R8JA 5J2MB 1NHKL 5KT2A 1S9EB 3GIIA 4CM2A 2WSFC 3HHLA 3DYAB 3U1NA 1RXOB 4HT5A 2R7WA 2C42A 4KH0B 2U2FA 1X60A 2M7SA 1FESA 3J7A1 1HI1A 2FJBB 4X4QA 1IVZA 4P2MA 4NYOA 3VAFA 1FTCA 2BE2A 2ILYA 3QJPA 3B4DA 2W2QP 2KFZA 4I2QB 4MYTA 1LW0A 3L7PA 1KKHA 4Q8EA 1X9MA 2WTFA 3VVUA 1UJ4A 2FJWA 4QJVA 2K7JA 1NU4A 1T03B 2BR0A 2KJWA 2HNYB 3C6UA 2PC6A 3ILIA 4UY85 4P7TA 2MZSA 1RWVB 3OSNA 1N54B 2LEPA 3LP0B 2AP6A 3OTBA 1B64A 3CJKB 2V34A 1IXKA 4J9OA 2GIQA 3F41A 5LSRA 3GU0A 3HVWA 5GAGU 2BJDA 1GXTA 2HFNA 4NLRA 3PYDA 1QUPA 4DOZA 4RUAA 4PXBA 2Z58B 4C7QA 3IGVA 3GIKA 3NBPB 4NL5A 1FF2A 1S99A 2ABYA 1SB6A 1WSRA 5ETRA 3KG4A 2CQBA 1WSVA 2HBYB 1J27A 5L46A 3MEEB 5IQ6A 4UQGA 4B3RF 1SI9A 3DLBA 2I5JA 1S12A 1YJ9S 2IPOB 3DLGA 3GONA 3MM8A 3OR1B 3Q86A 1RU2A 3HZEA 4IFYB 1PYTA 2DRDA 2UVRA 1R6VA 3HHDA 2RF2A 3FSXA 1TMMA 3LALA 1MROB 5DO2A 4ZMMA 1B0TA 3GWCA 4H4KA 3J81j 1M5VC 3NGRA 3U7JA 1JJHA 3BGLA 1U1RA 4NLUA 5J1PA 4QIGA 3GJTB 5E5NA 4PWWA 2FJDB 4HHJA 4YB7A 4USVA 4LF4F 2I9SA 1YRTA 4ANEA 5KFXA 2VJVA 3H25A 4OYPA 2H1YA 1X4AA 2DTJA 1X9SA 3OUYB 3U02A 4ZK7M 1U47A 2DXFA 1WOSA 4CLYA 1HWKA 3G2XA 2C2KB 1I3OB 3J7Z5 2L9WA 1ROFA 2GFFA 2DEIA 2HBQB 4R5PB 4K4ZA 3JB9k 4AE5A 4PXCA 1IR1A 4DR6F 4ZLJA 1WC6A 4K4VA 2V68A 1UZHA 5BJRA 2OUGA 4ENOA 3X1LB 1MWZA 3UR3C 1WJ9A 4YB6A 3TYTA 1TTHB 4DV6F 4PYAA 5IT9U 1Q81T 1MNEA 4C2MA 5HK4A 4TNOA 3I87A 3GP9A 1U8WA 3MM5A 1RBLA 4B3RJ 3CJ2A 1OMSA 3V81A 3ULHA 3PRVA 3DN9A 4U9RA 3R7NB 2Z2YB 4M5KA 3Q2TC 4J9QA 2MSSA 3FNNA 3SEOA 1R0CB 4B3MF 1N33F 5EWEA 3IFEA 3OJUA 3TO8A 6FDRA 4X62F 2ZITA 1GX6A 2XB2D 3M8PA 3LH2S 1GTHA 2OMLA 1U1MA 1S9GA 4K2XA 4DS5A 2AW0A 1CULA 5D15A 2RE1A 5CXTA 2WCXA 2P5VA 3S6EA 1OIAA 2XSJA 1E6VB 4DX7A 4I0WA 4LF4J 2HFOA 1FDNA 1ZPWX 1AA1B 5LJ3Y 5IFMA 3B82A 5ETOA 3PKYA 2COLA 3DRPB 2QSFA 4JI4F 3MPWA 3CO0P 5ETNA 3AQPA 2UZAA 2JZ5A 1T3OA 1L3UA 3TOQA 2DGUA 2VPWB 3QRRA 1NDKA 1D1UA 4ZLLA 2POKA 3PRBA 3F73A 1VJWA 5J2PA 2MHNA 1LWEA 5D77A 4I6AA 1WC0A 2DHSA 2XI2A 5BYSA 3PFEA 2BX6A 2MQLA 2EC0A 1HNVA 2R7TA 4F2RA 3DLJA 2JFKA 3CE8A 3Q83A 1I51B 4X4VA 3L9ZA 5CABA 2FZKB 3RRKA 3N28A 4DV6J 2XMMA 2CAJA 4TKTA 2DO0A 2I1RA 2YNHA 3RZAA 4ZN3A 3EVMA 4BWMA 2YQ0A 3LUYA 1N36F 1BQNA 2Z56B 3LP2B 1H38A 3P49B 4EGLA 3T5HA 5DG9A 3M1VA 3NNAA 2CNLB 3UFCX 1RWWB 2VUGA 4ECTA 1UWBA 3K8WA 3TAQA 3FZBA 1FD2A 1Q53A 1TL3A 2BM1A 3HVAA 4B3MJ 1N33J 1JMTA 2ATLA 4J9PA 4X62J 2GVZB 1KVIA 2HZAA 2B43A 2XCPA 4ECUA 2RQMA 4KO0A 3BGUA 1ULRA 1G2EA 1ZAXA 2I2YA 2HPUA 1S0VA 3TI0A 1XMBA 2KXHA 3RUBL 1HYSB 2OKQA 4DPTA 1NHUA 4JI4J 3AFGA 4HH0A 2V4JB 2HLUA 3UD3P 3C14A 1U0HA 3W5XA 3T41A 3K2YA 5F0UA 1RLCL 2HSEB 4UT4A 3OVBA 2MQMA 1FFGB 2BVZA 1RADB 1RAEB 1P9YA 2M0GB 3SFGA 5J2NB 2GNKA 2CZVC 2B7CB 1WC5A 4HEA9 3QZ8A 3LWLA 1VBYA 5DZ7A 1QAXA 3H5YA 1FKAF 2RS2A 5E2QA 4R0JA 3G6ES 2B9WA 1JXLA 4O44A 4ED5A 2HBZB 5BXIA 4RNMA 3W8PA 2J9EA 1JXVA 4Q8FA 3CDEA 4DV3F 1NJYA 4QR2A 2CPZA 2HQIA 1S9EA 4DL2A 3MUTP 4XO0A 1MMDA 3DYAA 1DHMA 1N36J 2BXJA 4JYAF 3PW4A 2AF6A 4C9DA 3W9HA 1RKJA 1IM6A 5GMEA 1HNIB 2N4CA 1UCNA 3QAEA 2RKIB 3KG0A 2QA4S 5IT0A 4NMXA 1TR0A 3M8WA 1H7XA 4I2QA 2QV6A 4KE5A 4K0KF 2RNEA 5T14A 3Q89A 1DAXA 4V19X 1T03A 3W60A 1U1OA 4J9VA 2HNYA 1LFWA 2YX7A 3LWMA 5LM7E 2RDDA 1Q5YA 2UUCF 3D9BA 5LSLA 1PYOB 3LP0A 3CJKA 5JXSA 1KQKA 1ZZFA 3K5LA 4CLKA 1K73T 2IFXA 2V8GA 2AJ0A 1RHRB 2FVPA 3HF5A 1B0VA 1IKYB 3NLCA 3BF4A 4NA1A 3DCAA 2RJZA 1N8RT 3ENAA 3NBPA 5KG4A 2AWZA 2DR6A 4Z7YA 4DCOB 5IS2A 3VAJA 4CLZA 3MOJB 1TL4A 1D09B 1RZMA 4X65F 2CKWA 3MEEA 4RNFA 2H48B 1NJZA 3HP6A 2HIYA 2XS7A 2GJFA 3DGVA 2V63A 2XZTB 3OR1A 2ZHBA 4DR2F 4IFYA 4DV3J 4TU8A 2CDQA 4TU9A 1BQXA 2BJ1A 4C6AA 5JMNA 4Q45A 4E2FB 1MROA 4JI5F 2V0NA 2V9WA 4A8MP 4JYAJ 4C0HA 1WKJA 3VWSA 1UEUA 4ED6A 2F8EX 2ZUAA 5HLFB 2UU9F 4LF6F 2PI5A 2IM3A 2UUAJ 3UWTA 5A8WB 3KHRA 1AFJA 2CNOB 1R8AA 2DXDA 3ZNJ1 2DEJA 2UUTA 4GKJF 2EKYA 3OUYA 4K0KJ 1HBMB 3VAIA 1FWLA 3P8BB 1F9FA 3DGPB 1JLBB 2YNFB 2E1RA 2C3MA 1X5SA 2FZGB 3C8YA 2DGQA 4HDGA 3DDNA 2DNNA 3RW6A 5M2UA 4M5MA 2UUCJ 1CBKA 4R5PA 1NHVA 2LLZA 1FRKA 2QFIA 4GO5X 5BYRA 3K57A 1OPZA 2JOQA 4PXDA 2ZD1B 2DJWA 2CWXA 2ZOMA 1I5OB 2C1EB 1QSLA 3FBBA 3N6MA 2DNPA 5KFTA 2EG1A 4Y00A 5DDOC 2Q43A 4MKAA 2J0WA 1FRJA 3HCXA 4NLGA 3BN7A 3AA9A 1F2GA 4X65J 4KYZA 2KN4A 1YQHA 2WHOA 3ISND 4F50A 5HMZA 2CPIA 4IFVB 2ZJRQ 4QWAA 3NP5A 3G6YA 3QMQA 1CVJA 1R0BG 3FBCA 4O3QA 3M05A 4DR2J 5K8MA 4DV2F 2PMHA 1FDDA 5B08A 1HFEL 3TUPA 3TA2A 2C28A 1D3WA 5KFQA 2XM3A 4JI5J 3T1YF 4USWA 2OPPA 5IC6B 5A8RB 4U8VA 4FNHA 1QSYA 2UU9J 2JHEA 2IM0A 1NSAA 4AFFA 4AXJA 1S49A 3ZZ0A 3IAM9 3HO1A 3UW1A 1AW0A 4ZPWR 4AL5A 5DQIA 3ZTSA 3DRPA 4DX6A 4M5JA 1P8GA 4OZJA 4QIVA 3MF5A 5EWFA 1W2BR 3IM9A 3UN5A 3MEKA 1EZZB 2CYYA 2OSQA 3FCVA 4X4RA 3IP0A 4OZ0A 2WZ1A 2KHDA 3TA0A 3GB0A 3UDLA 4DLGA 3KHGA 1TP7A 2B7BB 1DTQB 4NWBA 3EVWA 1XNQF 1I1GA 3CCUS 4DFMA 2E5HA 3MAHA 1R89A 1T9UA 1NXIA 2JDJA 4I67A 4QU6A 1I6JA 2QA4G 2DH7A 4FF4A 1ZM3A 2IVMA 4K4UA 1VQ5S 2OMOA 4ED2A 2VQFF 1VQLS 1VK8A 2DHXA 1PJ7A 4U6PA 5K9FA 3ZZPA 3RU0A 3LP2A 2UV8G 2FJEB 4QPXA 1KSPA 2VPZB 5DJBA 1M1HA 2G2YA 3VGVA 3QRQA 3CCVS 2R8KA 4YDDB 1X8DA 3DM2B 3QWUA 3BBFA 2XS5A 4M5NA 4OX6A 4DV2J 4G1IA 5M2RA 2X1AA 1HQEB 4RPFA 3K0JA 1JQGA 1NK0A 2GVZA 2AYBA 3CT9A 3NNHA 5IC4B 1UVMA 1UVNA 3T1YJ 1SL1A 2DO4A 3VGUA 1FXLA 4V19J 2YWHA 4I1TA 4DR4F 2PFFB 2NXNA 2J76E 2G1HA 1RDRA 1B0PA 2P2CB 5ETKA 4ZVFA 1HYSA 2AD9A 1AFIA 2K7KA 2NZCA 2IAJB 2V4JA 2ERRA 4CNYA 4KAIA 2DIVA 1WUUA 3QO9B 2VG7B 3G6XA 3DKDA 1WG4A 4U96A 5CCMA 4ILMA 1FRIA 5C24B 3PKMA 5J2NA 2ALZA 4CLWA 3TVKA 1UPPA 5AE3A 1Y9OA 1FE4A 3TZXA 3BBBA 3R7SB 5CYJA 2Y8YA 3D28A 3PNIA 4OHZA 2D1CA 2HVDA 4P71A 4Q2MA 1Z4UA 1GX5A 2LXUA 3BQ0A 2J0XA 3IC1A 4DR3F 1XNQJ 2ZOFA 1WTFA 2J7UA 2H4WB 3OQ2A 2W7AA 2DXEA 2CJ9A 2XG8A 4LREA 2ZH1A 2MSTA 4CLTA 4IH5A 2R7SA 2GCFA 4HYKA 3QT6A 2VQFJ 2V8HA 2ZUGA 4DQSA 4DPOA 2HAFA 1SC4B 5L39A 4DUYF 2CPYA 1ZOTA 3CXCR 2VHGA 2EW9A 5LOQA 4Y2KA 1HNIA 2QSWA 1BXNA 3NOGA 2RKIA 5T7LB 1R7IA 4O3PA 3QRPA 1QDUB 4OJHA 3EUNA 2KZMA 3GZ7A 2UVWA 3EE3A 4OQJA 4DG1B 4KJIA 2YKQA 1Z2ZA 5F8HA 5F8JA 3KLGB 2D41A 1G3OA 4DR4J 1NLKL 1XTZA 1GH8A 2MYFA 2JLEA 3HFZB 2GHVC 4IKAA 1NSPA 1CQNA 1WI8A 1U2CA 5A0YB 1NZ8A 1YTYA 4B3SF 3MAQA 3EJMA 2NPIA 4RBUA 2E1CA 4CT9A 2LU2A 3GFXA 3JAMU 4CI0B 4DBQA 4Z2XA 4ECQA 1VIXA 2JVOA 1T3NA 1IKYA 1QD1A 4EZ6A 2E5IA 4MT1A 2G2OA 5IZHA 3TRGA 2DGWA 2HQDA 3CJ8A 2B6AB 3SCKE 5L9NA 4E98A 3OFHA 2XYHB 5KG3A 3E51A 2NXJA 4DR3J 4LMZA 2M70A 2KTQA 1T8EA 5F8IA 4Q0BB 4DCJB 5AXMA 1JJ4A 3R2DJ 4P2SA 4FXVA 4WTOB 4YP3A 3R8YA 5KOXA 2RB7A 4W4MA 3UNYA 1VQOS 2KZZA 2ASLA 3FBFA 1EKSA 3BZQA 4DUYJ 1HHQA 2GW8A 1RAJA 1AZSB 3A8EA 1SJ3P 5HLFA 1IBCB 5DLGA 2MKJA 3ISZA 3R27A 5A8WA 3VAMA 4KH1B 1GTEA 3MM9B 4X4OA 4F4XA 2F65A 3PW5A 3QT8A 4RW8B 5D3GB 1TAQA 1LK7A 3DGPA 1JLBA 2YNFA 2V8PA 2ASDA 1KN6A 1S5ZA 2YQ1A 1L3TA 4YY3F 1RSCA 4A8XA 2DITA 1S6QB 2ZC4A 1IQZA 4B3SJ 3RYLA 4LJMA 3CCES 3OT9A 1UW9A 2ZD1A 2FJXA 4ZVHA 3UO0A 2ZHAA 4AL6A 4M5GA 5CCLA 4DSKA 3CJTA 1E6YB 5KAKA 5EHHA 2EFVA 2BA9A 2R7UA 4RW7B 3OBIA 3DOKB 1SJ4P 2RS8A 3W7BA 4JI3F 2BBEA 3DOMB 4CLFA 3G82A 2R7VA 3GYGA 3HD2A 5DDRC 2Y8WA 4IFVA 4IRDA 2MTLA 2D3OR 1CSJA 3CPWR 1HWLA 2HVEA 5ADZA 4G1QB 3V2UC 2MLYA 1HBOB 1S6OA 2I0XA 2ZZMA 4WU2A 4IRCA 1U45A 2WBMA 4A8OA 1RTZA 3M30B 1W26A 2VQEF 2Z30B 1ZM9A 4FN5A 1KFDA 5KG7A 4L76A 3KLIB 3K8VA 5A8RA 2F4FA 1UEKA 1REVB 1LKZA 2I6WA 3GJSB 4X84A 2GAHC 4ITSA 4NLYA 1RGVA 1Q7LB 3NGSA 1VQ8S 1D0EA 1IBKF 1SVDA 1YLXA 2EK6A 2SXLA 3D7SB 2VB6A 1ZH5A 1HMVB 2ZH2A 3RBEA 4RBTA 4K5RA 4YS2A 4ELTA 1QLNA 5JJBA 4KGXB 4DFJA 4UF4A 4Y2MA 2GS8A 1YJUA 3HSJA 4W92B 3OFFA 3G86A 3C15B 1YX2A 5DG7A 1ACMB 1UW4A 4YY3J 2DB1A 3D6HB 2MQQA 2QA1A 2LXIA 1U1QA 4CLPA 4KQZA 3PJ9A 5EX0A 1AROP 4Z37A 1SH2A 4DPYA 4ZPBA 1V3ZA 4JI0F 2FJVA 1DTQA 4HTIA 4ZJLA 3SV3A 3I4PA 4FZVA 1IJFB 2YNIB 2PSZA 4CP5A 1HI0P 1R27B 4KSEB 4RLEA 3POTB 4ZPVR 1SV5B 4USTA 4JI3J 2V4QA 3US5A 4C97A 3V6HA 5ITHA
chains in the Genus database with same CATH topology
2HNDA 3P3DA 3VALA 1IBLF 1JK9B 5GVQA 2R8JA 5J2MB 4N77A 4WIIA 5KT2A 1S9EB 4CO1A 2RQCA 3GIIA 5KT5A 2J0QD 4IR1A 4ZKAA 2JEJA 3GYXB 2WSFC 3GG1A 3DYAB 3HHLA 3U1NA 3W2VA 2J9DA 1VQMS 1APSA 3V6JA 4HT5A 2R7WA 1JLQB 4O23A 1C1CB 2C42A 1DTTB 2Q6CA 1HW8A 3NG8A 3KNGA 3KLFB 3DM2A 1DQ9A 2DNQA 2U2FA 3JSBA 4ZOSA 2M7SA 1FESA 5F8GA 1L3VA 2L9DA 4BWJA 2RILA 1HQEA 3J7A1 1HI1A 2WW8A 2FHMA 2WSEC 1FXRA 2FJBB 4X4QA 4ECZA 5GAHU 4NYOA 3SCJE 1VQPS 1DLOA 3VAFA 3CB4A 4EWTA 5AE1A 1SL2A 1FTCA 1C4CA 1UL3A 2BE2A 2ILYA 2CQDA 3CC7S 2ADCA 4AQYF 2KT5A 3HX9A 3D1HA 4IQXA 3MMJA 3M8QB 1DARA 2HHTA 2J9CA 3MM6B 1RT5B 3QJPA 3B4DA 4P7VA 4O3OA 1SC6A 4JUZA 4NMLA 3CCWA 2KFZA 4I2QB 4MYTA 1LW0A 3L7PA 4FBTA 2HHQA 2QLWA 4OX7A 4Q8EA 3OL8A 2DGXA 3R3TA 4I7FB 4WK1A 2XWXA 1X9MA 2WTFA 3MEGA 1KD1T 4PRFA 3N5BA 4C98A 4NLQA 1FRMA 1XNRF 5J2MA 4O4RA 1UJ4A 1Q7YT 2FJWA 2AQ4A 3RAXA 2VC1A 4ZS6A 2X1BA 2N3OA 2RH3A 1WD6A 2BQ3A 4YDXA 1WF1A 1C4AA 1F60B 1GXUA 1X7VA 4I69A 4QJVA 4EYIB 3NS5A 2K7JA 1NU4A 3I0SA 4Y2CA 2N7CA 2ZNZA 1T03B 4OI0A 2P9EA 3FDSA 2BR0A 4LVOP 2KJWA 2HNYB 2CJAA 2YH0A 1VQ9S 2JC0A 1XC9A 3C6UA 2MDAA 4ZHRB 3G9CA 2PC6A 5KFCA 4RWXA 4B9MA 2IAJA 1HHTP 1VRUA 1VIOA 3TVZA 3PZPA 2OO4A 4UY85 4P7TA 2MZSA 3OSNA 4QW8A 3GIMA 5DETA 2W7OA 1N54B 2HHHF 4ED0A 2LEPA 3LP0B 2AP6A 4Y2IA 3I96A 3OTBA 2F1FA 1B64A 1CPZA 3CJKB 1TL5A 1IXKA 4J9OA 2GIQA 2VG7A 4Q7AA 3F41A 4WE1B 1J5EF 3FMBA 5LSRA 1WNEA 2F7VA 1TQLA 2AGOA 2FLOA 3HVWA 5GAGU 4DL7A 2BJDA 3OV7A 3V6DB 1GXTA 5C24A 4M63A 2ZH9A 4NLOA 3PIOQ 4LF5F 1N6QA 3DMJA 2J7KA 2HFNA 4NLRA 4LSNA 4TQRA 1P9QC 1VQKS 3NGKA 1QUPA 4NCGA 4DJBA 3NMRA 3F44A 4DOZA 2IVFB 2VV5A 2NZ4A 2HMIA 1VC5A 2JJ4D 2E9RX 1ZBTA 1JLGB 1ZM2A 5L1LA 3MFHA 1QVFR 1CG2A 3H5SA 1WG5A 1UAWA 2YKMA 4RUAA 4PXBA 4DF4A 5KFPA 2EI5A 1OS5A 4C7QA 1BD6A 3R1LA 3IGVA 3GIKA 4YFUA 1UFLA 2NSBA 2VZ9A 2IA6A 3NBPB 4NL5A 3CJ4A 1FF2A 1S99A 1VMBA 2ABYA 1SB6A 1TL1A 2LEAA 3OLAA 4WU3A 4EEYA 5IQQA 3BJYA 3MR5A 2VA3A 3KG4A 1IKXA 5L38A 4AL7A 2DNRA 3BR8A 3DU6A 2B5JB 1V3RA 2CQBA 2LMIA 3ICLA 3MEEB 5IQ6A 5KFMA 4UQGA 4DSFA 4B3RF 3M9OB 3BR9A 1SI9A 3CJ0A 3CJ3A 3DLBA 2I5JA 4X4TA 3MMCB 2ZDPA 1YJ9S 3GR0A 4TY8B 1S1WB 3DLGA 1NH7A 5IT4A 3CDUA 3MM8A 3OR1B 2ZBCA 3DRRB 1WACA 2KO1A 3HZEA 4IFYB 1NB7A 3N9UC 2UVRA 1XBWA 4FBUA 3AB4B 3AH6A 3HHDA 3KK3B 3OL9A 4USIA 5K5MA 2RF2A 1YRXA 2DH9A 3FSXA 1U25A 2V94A 3G96A 4C8ZA 3HHKA 2LA6A 3LALA 3LPYA 1MROB 1RT7B 1FA0A 4UUXA 2DGVA 2VKZG 4NZ6A 5DO2A 2GC8A 4JI6F 4ZMMA 4DSJA 3C3LA 1B0TA 2AV5A 3GWCA 4R0EA 3R5CA 4H4KA 2G13A 4K50A 3OVSA 5E3RA 4G3IA 1M5VC 2CQ1A 4XDCA 3U27A 5T7LA 2EFOA 2WONA 4MYUA 2DNHA 3MEDB 2XC9A 3MR3A 2QEXS 2WB1D 1JLFB 3U7JA 1JJHA 2DGOA 3BGLA 2JH3A 3OHBA 1U1RA 4NLUA 2PGCA 2XWYA 1QM9A 2KI2A 2XLIA 5J1PA 1R0AA 4OZ1A 4QIGA 3GFZA 3OXGA 5E5NA 4DG1A 2P9GA 2FJDB 4HHJA 4YB7A 3LP1B 3CD0A 4LF4F 4PR6A 2I9SA 3KLHB 1YRTA 3E01A 4LFBF 3EGNA 3M6VA 5CYMB 5KFXA 3H25A 3RB4A 3KLGA 2DIUA 2BOPA 3ETOA 5LXYA 3TUIC 4FNIA 1X4AA 2DTJA 1VQSA 5B0BA 1X9SA 1FO1A 1C0TA 1RWUA 3DRRA 3DXSX 4NLTA 3OUYB 3U02A 2XO7A 3C6TB 1VLYA 3Q8QB 2HFZA 2AJQA 4C8MA 3KK3A 1SH0A 2A2CA 4ZK7M 2W9AA 1U47A 2Y1IA 1V9OA 4MJKA 1EETB 1N32F 1MU2B 2Z2LA 1P6TA 5KFBA 1HWKA 3F56A 2XBPA 3M8SA 3OFGA 4ES2A 3IA0A 3UD4P 4DL0C 4EBCA 3KLVA 4MH8A 1M5PC 4ZCIA 3J7Z5 5A0YA 4JOUA 4X4PA 2L9WA 1ROFA 1FKPB 3OL6A 2GFFA 1L3SA 3THTA 3JYTA 3KNAA 1RT1B 1S1UB 3MPVA 5K8NA 3CVKA 2CVIA 4KKOB 4R5PB 4C8YA 5MLCV 2OD6A 2OFGX 4JV5F 2Y0SD 4A8KA 4ES3A 4DFKA 1K0TA 4RNHA 4K4ZA 1LXJA 1JLCB 3JB9k 4HTJA 2L3MA 1X4BA 4TYBA 3V81B 4HI1A 4AE5A 2BQRA 4PXCA 2K3KA 4F3OA 4DR6F 4B9VA 3QIPB 3KYLA 2HHWA 3FQKA 5IWAF 3G4SS 2NQPA 1RT4A 4K4VA 3PW0A 1RTIB 3H8YA 1Z2LA 3OL7A 1UVJA 1IM4A 3IG1A 1LW2B 4OI1A 3BQ1A 4NYPA 2MKKA 5BJRA 4EO8A 2DPJA 4FS2A 2XGPA 2MQPA 1YITS 3D1QA 1ZTTA 1PGZA 3U1LA 5F8MA 1LK5A 3X1LB 3T1HF 2GO9A 1MWZA 3UR3C 2B6AA 3TUZC 1FVSA 1NAQA 3CUNA 4YB6A 3QIDA 1ELOA 1VRTB 1NKBA 4UY8T 2OFHX 1Y3JA 3FRZA 3WBZA 1M1KT 3CD6S 3TYTA 2UXBF 4ETZA 4DV6F 3M32B 3M2UB 1SUQB 3IRWP 2P6SA 1YVFA 4JI8F 1UVLA 1KVJA 3DLEA 3I82A 1Q81T 3VQSA 3OR2B 1MNEA 3MUMP 4X2BA 4NA3A 4QU7A 4C2MA 4KGKA 2RMLA 1D9AA 1JLAA 4TNOA 1HQUA 2YWEA 3JAMY 3I87A 4Q0BA 1FKOB 2VOOA 3T3FA 1YBAA 1BQMB 3MM5A 2VBZA 3CCMS 1D8ZA 2V8DA 4OI2A 2KDOA 3CJ2A 4N8NA 5EUHA 3GILA 2FVQA 3MOZA 4YQWA 2RQKA 4PPZA 3L3CA 3V81A 5IXUA 1NK9A 1JWWA 2M88A 3ULHA 4C11B 2IC3A 1C2PA 3DN9A 1JXEA 2DRAA 4MFBB 1KLMB 3K5OA 4CTAB 1S1XA 4BCAA 1RTJB 1TKZA 2W9CB 2RU9A 2CG4A 1K1SA 4U9RA 1F0XA 4UW2A 2A18A 2CZ4A 1YI2S 3BQ2A 2MSSA 5A6PA 4J9QA 3Q2TC 2HNZB 3FNNA 2RVJA 4ELUA 3SEOA 1S79A 2Z4PA 4DL6A 2UP1A 1IJEB 5EN1A 1FXDA 4Y2AA 5EWEA 4B3MF 1N33F 2XMWA 3IFEA 3TANA 3OJUA 3MECB 2M9KA 1VOMA 3TO8A 6FDRA 1F5BA 1Q86T 1U8SA 3PV8A 1HNXF 4X62F 3R5BA 2BABA 4ZLPA 2ZITA 1GX6A 1TK0A 1S1T