4PRFA

A second look at the hdv ribozyme structure and dynamics.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatitis Delta virus ribozyme
publication title New tools provide a second look at HDV ribozyme structure, dynamics and cleavage.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 24
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4prfA00
2MJNA 2DNGA 1AUDA 1SJQA 2AYGA 3S7RA 2M52A 5IM0B 5BJRA 2CQGA 4WKRA 5CYJA 4QPTA 2CQDA 2OJ3A 2DGOA 1WF2A 4YB1P 2XNRA 2DISA 1X4FA 1K9MT 3B4DA 2X1BA 5JVGQ 1VBYA 4CH1A 2DIUA 3K0JA 4PR6A 2RS2A 2OIHA 2U1AA 2M7SA 2CPHA 2DHSA 3B4MA 2CQCA 1YJ9S 1WHXA 2MQLA 4IOAQ 2KU7A 3S6EA 2KM8C 3CMAS 2M8DB 3BO3A 3FEYB 2I38A 2LQ5A 2RQCA 3MUVP 3VAJA 1YITS 2FPHX 3CCJS 2D9OA 4EGLA 2CPYA 2KXFA 2DNOA 3UD3P 2RRAA 2UP1A 1X0FA 1VQ6S 3THPA 2JX2A 2DK2A 1VQMS 4LMZA 2CQ2A 3MXHP 2FC9A 2DNHA 2G0CA 2EK1A 2OTJS 3PIOQ 3S01A 1YHQS 3BS9A 5H1SV 2N7CA 1U1RA 3VAMA 2KVIA 1N8RT 3NMRA 4F26A 1UW4A 4QU7A 2XS2A 3PIPQ 2L08A 1NO8A 1FO1A 2OSRA 4TU9A 3CCLS 3CD6S 1K73T 1WWHA 1VQ7S 2MB0B 1A9NB 1X5TA 1FJ7A 4IOCQ 2CQHA 4YOEA 2MQOA 1HD1A 2ADCA 2MZTA 2ZJPQ 4CH0S 2DNNA 2GHPA 5LSOA 3MD3A 3VAFA 1U1NA 2KG1A 2MKCA 2RT3A 4TU7A 1WI6A 2J76E 2MZQA 4OZ1A 4WIIA 1FJCA 1N88A 3NNCA 2OSQA 3L3CA 1DRZA 3MUTP 3US5A 1S72S 3I55S 2F3JA 1YI2S 1VBZA 4ERDA 2KM8B 2XS5A 2JWNA 2KHCA 3G6ES 1WI8A 1FJEB 1SXLA 2YKAA 3RW6A 2M2BA 3VAKA 2LEAA 2DNYA 1JJ2R 1KQSR 2F9DA 2MZSA 2DH7A 4V19X 1QM9A 1UAWA 4FXWA 2BZ2A 3EX7B 3MI7X 2MKJA 2DGXA 2MPUA 3CC7S 3IWNC 3MOJB 1X5OA 1DBDA 2A3JA 1Q81T 3BEGB 2LA4A 2HZCA 2PE8A 1HA1A 3CCRS 2CPFA 1SJ3P 2X1AA 2MGZA 1SJ4P 1Q7YT 2DNRA 2MY8A 3J7YU 2RQ4A 1X4DA 3SMZA 5ITHA 1H2VZ 2CQ3A 4U67Q 3THTA 2FHOB 2KG0A 3N9UC 2DHAA 5DM7Q 2M9KA 2ERRA 1HL6A 3J7ZT 2VONA 1JMTA 5GAEU 2MQNA 5D78A 1FHTA 2DNMA 4CQ1A 2RVJA 3MD1A 3TO8A 1O0PA 3EGNA 1YJNS 2YH0A 1N54B 1VQ4S 1X4BA 2YH1A 2J0QD 3G8TA 1VQLS 1U1PA 1IQTA 1OO0B 2D9PA 1U1QA 3R1HA 2ADBA 1KOHA 1OWXA 2E5JA 1X4EA 5CXTA 2XNQA 2CPIA 2DH8A 5EN1A 1YJWS 2M0GB 2DNPA 2DGWA 3ZZZA 2MKIA 4WFNQ 2EK6A 2CJKA 2LMIA 2VODA 1P1TA 4J5OA 3G4SS 2M88A 3CCES 3G8SA 1D9AA 1U6FA 2OTLS 3UWTA 3DXBA 4OZ0A 2HGLA 3MUMP 3U1LA 2N82B 4QU6A 1M5PC 2HGMA 1QVGR 2K3KA 1UFWA 2GO9A 3FEXB 3EGZA 2NZ4A 1UP1A 2K8GA 2L9WA 2DGUA 4WCEQ 3UD4P 2LXIA 2MSSA 1A7GE 4C7QA 3SDEA 2N3OA 1PGZA 3ZZYA 2X1GA 2LYVA 3NS5A 1X4AA 3VALA 4QQBA 2MJUA 2FC8A 5GMKa 2MQPA 2CQ0A 1JJ4A 2U2FA 2M8HA 2XSFA 2MZ1A 2KT5A 3R27A 1VC0A 1R8HA 2Q79A 4WFAQ 3VAIA 3CPWR 5IFMA 2MXYA 5GVQA 1WG5A 4PRFA 3BO2A 2AYMA 4W90B 2MZRA 2CQIA 3UCGA 5DDQC 1VC6A 3Q2TC 4BS2A 2KXNB 1VQ8S 2HVZA 4ZKAA 5DDOC 2CPJA 1VQKS 1URNA 3DLLQ 4WF9Q 1K8AT 2AYBA 1OIAA 2SXLA 2X1FA 4TLQA 5GAGU 4RU2A 1KOOA 2CPEA 1X4HA 4Y0FA 2AYEA 3P3DA 2MKHA 1S79A 2DIVA 1H2TZ 5MLCV 2DNKA 1DZ5A 2MMYA 2LKZA 4LIRA 1KC8T 2CQBA 2KRRA 2PEHA 1X4GA 1Q82T 2MY7A 1WHVA 2KI2A 2M4MA 2DB1A 2HGNA 2D3OR 1QVFR 1W2BR 4Z2XA 3JB9k 1FXLA 1G2EA 3SXLA 5IM0A 3CC2S 2JVRA 2I2YA 2DGTA 1L3KA 3Q2SC 3VAGA 5CA5A 3OW2R 2E5GA 1U1OA 2QEXS 2LA6A 5FJ4A 4WFBQ 2DGSA 4F02A 2MKKA 2MSTA 1SJRA 3P5TL 3UE2A 3RW7A 2DGQA 2CQ1A 5DDRC 3CXCR 2FY1A 1M1KT 2RS8A 1BY9A 2DNZA 5LSLA 2CQPA 4UY8T 1U1KA 5D77A 1Q86T 3CULA 1U1MA 5IQQA 1WTBA 3CF5Q 4IUFA 2VOOA 5LJ5Y 1B7FA 2KXHA 2E5HA 2MYFA 2J8AA 3CCUS 3HHNB 2VOPA 1VQ5S 2RU3A 2DH9A 1X4CA 2MKSA 2MZJA 3CCVS 1WEXA 1ZZFA 4CIOA 3LQVA 2MGZB 1P27B 2KYXA 3MDFA 3LPYA 1YTYA 4ED5A 5JVHQ 2XS7A 4FXVA 2LECA 4YUDA 1ZH5A 2E44A 2RUGA 1U6BA 2NLWA 2QA4S 3H2VE 5GAHU 2CPZA 2JRSA 5GADU 3G9CA 3P49B 2LCWA 2ZJQQ 1HD0A 3CCQS 1VQOS 3CC4S 2KH9A 4LJMA 3D2WA 3VF0B 1WG4A 5LJ3Y 4A8XA 2KRBA 4TU8A 3R1LA 1WEYA 2MQMA 2DNLA 3U1MA 1VBXA 3NNHA 1M5VC 3TP2A 5LXRA 2DO0A 2F9JA 3IRWP 2MHNA 3NS6A 2HYIB 3P6YC 2O3DA 1CVJA 1M5KC 1X5SA 2DGVA 2V94A 5LXYA 2KFYA 3CMES 2L41A 1F9FA 2M70A 5HL7Q 3MURP 1YIJS 3CTRA 1WEZA 2RNEA 2CPDA 2E5IA 1R8PA 2EVZA 3NNAA 1VQNS 2QFJA 4IO9Q 1JJHA 1WG1A 2JVOA 1U2FA 5HO4A 2LXUA 1ZZNA 1N52B 1WF0A 2DITA 2MQQA 2N3LA 3I56S 3G71S 2LEBA 1SJFA 1VQ9S 1NU4A 3CUNA 2AD9A 3H2UB 1KD1T 1WHWA 3SDEB 2CPXA 1U1LA 1FNXH 1XN9A 1VC5A 2RRBA 2J0SD 2DNQA 2CQ4A 4PKDB 3UCUP 2XB2D 1VQPS 3S8SA 4UQTA 4P6QA 1RKJA 1OPIA 3V4MA 3UCZP 2ZJRQ 1DHMA 2DHXA 3CCMS 2B0GA 2G4BA 3TYTA 3BO4A 5DETA 2YTCA 4C4WA 4Y00A 4F25A 1D8ZA 3HI9A 5DM6Q 1M5OC 2YWKA 1WHYA 3ULHA 1WELA 1PO6A 1X5PA 1YWXA 1NJIT 1RK8A 3CCSS 1WF1A 4C0OC 2G1DA 5DDPC 2WBRA 2KN4A 2DO4A 1M90T 2DHGA 3VAHA 3G96A 1H2UX 1FT8A 1H6KX 4M5DB 2BOPA 4W92B
chains in the Genus database with same CATH superfamily
2MDAA 1BE4A 1AUDA 2D41A 5MAOA 2CYYA 4K4SA 2HFOA 2OJ3A 2R2TA 4DSEA 2J9DE 2IVYA 4MH8A 3L7UA 2A18A 1RT7B 4FDFA 2OIHA 4K59A 1HFEL 2KU7A 2ZUAA 2ZWOA 2YKMB 4ZLJA 2ZHAA 3T5HA 4J7CA 3PDNA 4JI6F 4ZP8A 1X0FA 2PI4A 3KWMA 1VYAA 3VGVA 4HH0A 4O0NA 2GQCA 1QDUB 3KUEA 3M8PB 2OFHX 1WTFA 2W4CA 2W8KA 1FFSB 2DKOB 2H51B 2RF2B 2ADCA 2MZTA 4KFBA 1I5OB 3JTOA 2KG1A 1R0BG 5A8WB 1CS4B 5L46A 4WIIA 4TY8B 3K5MA 2F4VJ 4GO5X 1SC4B 2KM8B 4BHQA 1ZAWA 4M1KA 3H98A 1E6VA 2DH7A 2UUCJ 2GMJA 2C3YA 1GX6A 4CO4A 2HZCA 3OVAA 2B4VA 1HA1A 2J7UA 3RB4A 3QATA 1NZ8A 1FD2A 1HWIA 5KG0A 2V4RA 4J9SA 1H2VZ 2R7OA 1N32F 4K5SA 3ENQA 4E8UA 2FHOB 4EYHB 3DMJB 2M9KA 1UFLA 3G82B 1DLOB 3EGNA 1N54B 5M2RA 1FWPA 3M9MB 1RLCL 4FF1A 1V3ZA 2V9WA 4TQSA 2OPRA 1YJWS 2FVPA 4CNYA 3W2VB 2RD5C 1VGYA 4WZQA 2HHXA 1TU0B 3OLAA 1GTHA 2HGLA 4QR2A 1U0SA 4P2XA 1XR7A 2EFGA 2R2SA 3DRRB 4JBCA 5A6PA 1HNXJ 2FC8A 2CQ0A 1JJ4A 2JLFA 2KJWA 4FYYB 2E1PA 3SCIE 2CQIA 3Q2TC 1URNA 3QSIA 4Y2MA 3IXQA 5D15A 2BJ7A 2A1BA 4RL1A 2NUHA 2VPWB 3K57A 1SH3A 4B3TF 1Q8BA 2IM0A 1S79A 2H4WB 1UWAA 4WXOA 2HHQA 4DI6A 4DJBA 4K5RA 4X64J 3MEDA 1WORA 2IBKA 4EBDA 2WOMA 5HBMA 1S12A 2D74B 4PWDA 4MKAA 2JEIA 1WKKA 2A0FB 5J1PA 1F3FA 3OW2R 4USWA 4DU7A 1KWMA 2ZWPA 5A76A 2LA6A 3ZTQA 1EARA 3A3PB 4JV1A 2W9BA 3NOCA 2HVIA 5E3CA 3V6HA 3WC0A 4LF8J 1S99A 1BY9A 2XMJA 4Q43A 4DSFA 2QG9B 3QFWA 4ZVSB 1HR0F 1NZAA 4ED8A 1CJKB 1ZM9A 4JI1F 3SSRA 4RBVA 2GS8A 4NCGB 2MKSA 5A8RA 2IJFA 1AXQA 2OPQB 1RE1B 2VG5A 1YTYA 3GG0A 2QV6A 3FBBA 3AJDA 2X3GA 1Y4ZB 5KFZA 3QYYA 3PX0A 1UZHA 3LAMA 4CTAB 3GJTB 3CGIA 2XYPB 2HHUA 3IMQJ 2WZ1A 3GFXA 4CLKA 3HDSA 2KRBA 2B8QA 3R97A 1YJVA 3BH6B 1NK0A 4A48A 4N76A 3TP2A 2WVDA 4ECTA 3PXGa 4A8OA 1HLWA 4ILLA 2BJ8A 1RT2A 3SEOA 1JJHA 5KFMA 2PN6A 1I1GA 2YNGA 4FPRA 5GMDA 4BC7A 2HBYB 2MQQA 3MAAA 3TNVA 4O4GA 4M94A 5J2MA 1XN9A 3MAHA 2J0SD 3S8SA 4LFBJ 1AT1B 1RKJA 2ABYA 2ZBRA 2AJ2A 2ZJRQ 1DHMA 2FJEB 4C8OA 2DEJA 1HBNB 7FDRA 3MMAB 1TL7A 4KIAA 3OFEA 1OY8A 1BQMA 3PG9A 2AW0A 1K1SA 2OHDA 1E6YA 2F63A 2V8DA 4TY9A 2YWKA 2XG8A 2NQPA 1TAUA 3C15B 4IRDA 1PAUB 2V68A 3OVSA 4WFXA 1H6KX 1MSWD 2AYGA 1A6LA 3Q8UA 3S7RA 4LFAF 2R8JA 4ECSA 3MM9A 4R0JA 4CH1A 3KJQB 4ZK7M 4I67A 1GX5A 2CQCA 2MQLA 3G6VA 3LWLA 3PR4A 3PRVA 1S0OA 2JNJA 3W66A 2DNOA 2FJWA 2NR0A 4LMZA 1OY6A 4ZLPA 4IG3A 1YHQS 3CJ0A 3H90A 2XM3A 4J9MA 4D3HA 3BQ1A 1PYOB 3UDLA 4LQ9A 2ZFHA 3TZZA 3PZPA 3MCSA 3Q8SB 3TEHB 4NLUA 5LSOA 1KP6A 3DLEB 1S1TB 1UFKA 1YDLA 3GE9A 3US5A 2QLJB 4OX9F 4RW7A 3NRBA 1NK8A 4CH7A 3RW6A 4OYWA 1JJ2R 2Z2ZA 3MPDA 1HQ2A 3B78A 1H98A 1X5OA 4ECQA 4I7FB 2LFVA 4F4YA 2PE8A 1HARA 4EI2A 1AZSB 3GONA 2CPFA 2NUUG 1S1UB 1IJFB 1N5TA 1QSLA 1J27A 1T02A 1FXDA 4DDFA 1YRTA 2HMIA 5E33A 1YJNS 2YH0A 3DDIA 4KHMA 4NWBA 2MHEA 4B3OA 2HQCA 1I51B 2P9EA 3R6LB 3AOBA 3UFCX 2B43A 4R0EA 4ITSA 4IR1A 3FCVA 2R4FA 1CLFA 1FFGB 2AJ4A 3PW0A 4JI8J 1RTZA 3AQOA 1XIQA 1SKSA 4JV5J 4OZ0A 2FHKA 1RCOB 3AT1B 3AY0A 4ES1A 2NZ4A 2DGUA 2BXJA 3Q24A 3PW2A 2HHWA 2ZDPA 2X1GA 3VZHA 4NLSA 4USUA 4LF6J 2HNZA 2Q6CA 3DHWC 3L9ZA 3LGNA 2BJ9A 1S59A 3AFGA 2SXLA 1J5OA 3QGIA 3R7SB 5CH7B 3AXMA 4DPTA 1VI7A 1EP4A 4EO6A 5FD1A 1JLGA 1Z2ZA 2CQBA 5EWGA 1RLDA 2V8HA 2DXEA 2KI2A 1LOUA 3UPFA 2YWGA 3SXLA 1S0VA 2IY5B 2OO4A 2PC6A 5EWEA 1QTMA 1RT7A 2IBOA 5IXUA 3ZZPA 1WC3A 3A1YG 5DLGA 3OL8A 4CO3A 3LALA 2B4PA 2YKMA 2Y9HA 2ZBPA 4PXDA 1FERA 2BYCA 2JL9A 5C2GA 4RNMA 3E01B 2Y8WA 1KHWA 1RA6A 3MGJA 3M8PA 2BKPA 2MZJA 4DV3F 4OZ3A 4X4QA 4W4MA 1KEKA 1NDKA 2OGUA 2FJAB 1KKHA 2RF2A 5HLFB 4CT9A 1WSRA 3ZTSA 4I0WA 2CPZA 5A8WA 1CS4A 5JUMA 4ED0A 3M30B 4QIEA 4TY8A 4A8XA 2KL8A 2IA0A 2QL5B 4WU2A 3UI3A 2H65B 4G1PA 2X3DA 3OBIA 5DZ6A 4DQPA 3BREA 2L41A 4X4NA 1WNEA 4PPZA 4N8OA 2DXFA 3I56S 2AGQA 1VQ9S 4JUZA 3DMJA 1BUXA 1H74A 3IA0A 3G82A 3PYDA 1DLOA 4C48A 4DSIA 4AXIA 2PA3A 4KGXB 4EFAC 3AA8A 5T7LB 4DV6J 1C4AA 2HQ3A 3V4MA 4Q8FA 4A4JA 2Z58B 4QIWD 1OYEA 3HI9A 2CJBA 3W2VA 1P8GA 2H3EB 3PO4A 1WELA 3QPIA 1DJ0A 3CCSS 4ER8A 2BOAA 2RKIB 3FKBA 3SCKE 5DLFA 2KJVA 2Z4PA 3NCQA 4OJ3A 1Y5LB 2WHOA 3DRRA 4OHWA 4QPTA 5J2NB 2CQDA 4K0KJ 1Z4UA 3CCWA 3QJPA 4AXJA 2XZWA 5AT1B 2UUAF 1U47A 5JVGQ 2HVDA 3K0JA 2RS2A 2VPXB 3BN4A 5FLXU 3TJ9A 2J7WA 1D9DA 3FEYB 3RAQA 3KKFA 2EKYA 1N6QB 2BM0A 3T3FA 3L4BC 1JXVA 3THPA 2J8SA 5KFUA 2HQDA 3DOLB 1H73A 4U7CA 2WRMA 2UUBJ 3PIOQ 2DT9A 1JNRB 1F3VA 3MPWA 3PIPQ 1T0TV 1T9WA 3EPIA 1BXNA 3T1HF 3M4XA 4J9OA 2XZTB 4L6V3 2AHOB 2F8HA 2CUYA 3ENAA 2DVIA 3EPGA 2BW2A 2GV1A 3W63A 1D1UA 1IBMF 4LF4J 1FTCA 3SZ2A 2OSQA 1FE0A 4FF2A 3OFGA 3I9V9 3PHEA 3KHRA 3BR9A 3M8ZA 1XQIA 2Q3PA 1CJKA 4QWCA 1HMVB 3W8PA 3AXKA 2G2OA 4NCGA 2P8IA 2OPQA 2D3UA 3SMZA 2LLZA 2UXDF 4WTOB 4C8LA 5KT7A 2JZ5A 3WZ0A 1P9YA 4XTTA 5D0HA 3QIDA 4CTAA 4B9SA 3H40A 2EFOA 1G6BA 1B3TA 5KFYA 1URRA 3FK4A 4OL8A 3DXSX 4YY3J 4IH5A 1IBKF 4IQMA 2VC1A 2C3OA 3M6UA 4WFNQ 3BBBA 3CJ5A 2GX8A 1MWYA 2CJKA 5ETPA 5IOLA 4CRJA 2IM1A 2OFGX 3PFOA 4ZVPB 3KK2B 1Y0HA 4QIFA 3MUMP 3ZXWA 5HN0A 3GYNA 4WCEQ 1YJ7A 4DF4A 3M32B 1U6ZA 3BSAA 2MJUA 2MQPA 2ILYA 1IBCB 2VDHA 2XSFA 3I6PA 2LDIA 5I3UB 5GVQA 4DV4F 4KKOB 1VLYA 1SC3B 1HBNA 3MMAA 3PACA 1JLAB 3AOAA 4NXMF 3MCMA 2HURA 3IAM9 4I1TA 2UU9J 4RX6A 1N5VA 3C15A 5SZTA 3MF5A 1NJXA 4LR7A 1EIYB 3MEEB 2VL1A 1Q82T 3DLBA 1DQ9A 1RACB 1HWJA 2UXCF 3A12A 3PFEA 2AEMA 3FRYA 4B3RJ 1S97A 3P5TL 1U24A 3LGHA 2JEGA 4ILMA 1NKCA 1TFYA 4HDGA 3TUPA 2W8LA 2G0IA 3UVJB 4DR3F 4LSZB 4ECYA 4I6AA 2B4OA 2HHPA 3CCUS 2XY7A 4C8NA 1ZZFA 3D0GE 2OD4A 4OYAA 4B3SJ 1SV5B 4QCLA 2RDJA 4A46A 5FLXY 1I6JA 3DLEA 3T6JA 1EAYC 4ZPAA 1ZETA 3AJ1A 4DR2F 3QT7A 1WG4A 4UOFA 2KZMA 3FVYA 4RUHA 1NCLA 1GEHA 1TAQA 2UVRA 3D0IE 6AT1B 2J9EA 2KYZA 4ZDNA 2QA2A 4C98A 2D69A 4NA3A 4I7FA 4RWXA 2ASYA 5IT0A 3P8BB 1AZSA 5THWA 3KHHA 4KO0B 1KFSA 2LQ8A 2C2OB 3LP0B 1CSJA 5K8PA 3TARA 1S1UA 5IV3A 2F5GA 2IYIA 2QO3A 4OHXA 4C3MA 3G71S 2AD9A 4ELTA 2ILZA 4Y65A 4ZPVR 2RRBA 4OV1A 2WTFA 3A8IA 4ZJLA 2XB2D 2A6MA 4IO1A 2YWEA 4UQTA 2CAJA 4DFMA 3BO4A 2YY3A 3ILLA 3W60A 5HVFA 3O6QA 3T9NA 1M5OC 1PC5A 1KSPA 5HSPA 2PIIA 4G1QA 1N34F 3AQPA 2DO4A 4FF3A 1FT8A 1V3SA 2PMZD 3F73A 1S7IA 3F41A 4DV0F 1IR0A 3D66A 1NK7A 2U1AA 1SQGA 4KT0C 3MCNA 1TR0A 1FDBA 4NRUA 2I38A 4ZPDA 4HR2A 3GFZA 4WE1B 2AX0A 2Z57B 2DK2A 2QT7A 1MLAA 1EHWA 2DRAA 4TYBA 1J2VA 1WDTA 3D9BA 3QAUA 2FLOA 1GNKA 2VG7B 3WX8A 4C8YA 3SFUA 1HWLA 2QGFB 2E1AA 2NPIA 2HRTA 1XMQF 4JYAF 2J76E 1IJEB 1DRZA 3A4TA 4EO8A 3VGUA 3TA2A 4LQ3A 2KHCA 1SXLA 3PRBA 2M2BA 4USJC 1RABB 1NJZA 3V4IB 2XMWA 2CDRB 2BJDA 4FXWA 3L7OA 3E01A 3GLJA 2R7TA 2HQFA 2A3JA 3KTQA 2RHSB 1H7WA 3W9IA 2FVSA 4DCPB 5HLFA 3OTOF 2HWIA 1UPPA 3EUNA 3M30A 4K4TA 3TO8A 1N0VC 1TZ0A 1X4BA 1UEKA 3RBEA 3NLCA 1RHQB 1BD6A 1ZBTA 3HVRA 1KLMB 3DRYA 2D9PA 3UW1A 1HPZB 2E5JA 2ALZA 4OX8A 1UKUA 4HTJA 4EEYA 2CJXB 1TL3B 4F50A 1P1TA 4DMZA 3G8SA 2ZH1A 1PYTA 3O5TB 5B0FA 4NZ6A 5K8MA 2CZ9A 3EGZA 3RTVA 4PABA 3DGVA 2EEYA 2IDLA 4DXLA 5C24B 3SQOP 2M5YA 3CO0P 1LW0B 3LH2S 3QBCA 5T7LA 2CNLB 2HVZA 2GIQA 3FBCA 3OHAA 2YQ1A 4Q44A 4Y0FA 1LK5A 1HHSA 3SI8A 2EC0A 2AEFA 2D3ZA 4ZLLA 4NLOA 2RKIA 1T8EA 1UA0A 1WACA 5M2UA 4DFKA 4LBIA 4A8KA 4F3MA 3HLUA 4KBIA 5J2NA 3JSYA 1SL1A 5KFIA 2ROGA 4ILRA 4OQJA 2I1RA 4ED2A 1SJRA 3UE2A 4G6VB 5CZVA 2ASLA 4DX5A 3C19A 1WKJA 1PJ7A 1AUSL 2DNZA 2IRUA 4L74A 4XPCA 1N6QA 4O3QA 3CULA 1X9WA 1T05B 3H2LA 2YKNB 3DOLA 1SBRA 4ZCMA 3EDQB 1NH8A 1TL1B 2F4FA 3CJQA 1C2PA 3BSOA 4W98A 1P27B 2P9CA 2ZKUA 4ED5A 3CDBA 2W01A 2HIQA 3SCLE 2RMLA 1U6BA 2YQ3A 2QA4S 3TQ1A 4MTPA 3N01A 5GADU 2UXBJ 4QW8A 1LKZA 1B4SA 4DR7F 4L3KA 2IVMA 4DSLA 4LVNP 4LF5J 3EICA 4P72A 2DO0A 1JLQB 4Y2IA 2O3DA 2DGVA 1MN9A 1F9FA 3FZ2A 2C2DA 4I2QB 3M9NB 2Z0GA 2MLYA 1MG7A 1WG1A 5HO4A 4K4XA 4FBTA 4C0BA 4ES3A 2QLFB 4FVCA 3HVTB 3IM8A 3NKYA 2Z2MA 3H7HB 1VC5A 3ZTOA 4DUTA 3BKFA 4X66F 2HVHA 1LW2B 2C3MA 4CO2A 3TAMB 4UUXA 2V6AA 3HFZB 4X4RA 1T3OA 2K1RB 5L1JA 4YHHJ 2YTCA 1TELA 4C3KA 3CIMA 4AQYJ 3QT5A 1T11A 1TUVA 4DWIA 3M8WA 5ETNA 1X5PA 4ED6A 4CYUB 1RK8A 1QLNA 3I4HX 2ZBIA 3KK2A 3HHKA 1OSCA 1GMVA 3SSSA 4CT8A 4DQRA 3W3SA 3AODA 1RBOB 3M32A 2CQGA 2QTWA 3KXDA 1EZZB 4NXNJ 4B17A 1SH2A 3GR1A 2XI2A 5ETKA 2XCAA 1LFPA 5I3UA 1B0VA 3CNQP 1S6QB 4KKOA 5EUHA 3G6XA 2O67A 3T5LA 3M9OB 2GGPB 3R5AA 4IOAQ 2FGCA 1JLAA 2M8DB 1R7IA 4F8RA 1NHVA 1CBKA 4EBEA 1RHKB 4N5SA 2WW8A 2EWHA 2NXNA 1YG0A 1FDNA 2I6WA 4JI5F 4K4UA 2FDNA 1FKPB 3GYGA 3MEEA 2KVIA 1GK8A 3OUYB 2DRBA 2H5IB 5F41A 3SCJE 4DCJB 2L08A 2C3PA 5KTQA 4DX8H 4YOEA 3EXYA 2DXDA 3TVKA 1NH7A 1HBOB 2OAUA 2HHTA 3Q0AA 3KHGA 3CE8A 3LW5C 5K14B 3GSIA 1YI2S 3GV7B 3EVWA 3V5RA 1R6YA 5KAKA 3UVJA 1TFWA 2EKNA 3EX7B 2DGXA 3OD2A 3CC7S 1EKSA 1HIYA 3CJTA 1DBDA 4U9RA 2W1BA 3E2EA 4URGA 3ZTRA 2XMUA 5B0BA 1SJ4P 2J5AA 4ZP6A 1SV5A 5KT5A 1HNVB 1NAQA 2DHAA 3IM9A 3JTPA 5IC6B 1H72C 4UY85 5KG7A 3MD1A 4AL7A 3W8GA 3AAWB 3GP9A 5E2QA 2VQFF 2MTLA 3V6DB 2FLPA 4FKYA 2GVDB 2Y1IA 4X62F 2YX7A 3B6BA 1XC9A 1WC6A 1JLFB 3CCES 1UVMA 1DFDA 2OPSB 4KO0A 4DR4J 3LP0A 4OHYA 4QU6A 3IR5B 1UWBB 3D3BJ 3TX0A 4RR5A 2HRUA 2GVZB 4NLXA 2HLUA 5AJ3J 1X4AA 2A2DA 2M8HA 3PJWA 2ZH7A 1VC0A 4XK8C 2DTJA 2YWFA 4ZHRB 2RRNA 4ECUA 4DR1J 4U6PA 3BDEA 1X9MA 4XIUA 3RRGA 1OIAA 3EZOA 4TLQA 4BC9A 2HRYA 1Q5VA 5U47A 4HTIA 4Y2CA 2ZOGA 4Q5VA 2YNIB 5HATA 5H9FK 2FGOA 3R2DJ 1TUGB 4KR0B 1X4GA 1WHVA 4F4ZA 3Q8QB 2HGNA 5JMNA 1VK3A 1RHRB 3H42A 3TA1A 2P2CB 3ISZA 3R2CJ 3MWBA 1XTZA 3K89A 2DR7A 5D4LA 3CJ8A 4YDXA 3BZQA 1FRIA 4LF7J 3HZEA 4DL3A 5LMUJ 1FK9B 3HSJA 4WE1A 4IUFA 5KFBA 2ZE2B 2KXHA 3H20A 1RT4B 5KT4A 1NEEA 5B0CA 3FSXA 4Y2KA 3UDCA 2XC9A 2V9KA 2MGZB 2VG7A 3NMAA 2XS7A 1R8BA 2QL9B 4YUDA 4ZIVA 2FUG9 3MOZA 1KQKA 5IQ6A 3RAXA 3L09A 4CM0A 3N6LA 3CJKB 1L3TA 2WCXA 1ACMB 2BE9B 4UT4A 4YR2A 2EW9A 1OS5A 1S6PB 1WEYA 4Z7YA 3CDAA 5KFAA 2E7XA 3PEJA 1FVSA 3V4IA 2V2ZA 4M5GA 4O23A 1LXNA 1EQMA 2E1RA 5EWFA 2RNEA 1XMBA 2HK3A 5B7WA 3OTEA 2XMMA 3DYAB 2JVOA 2ZNYA 3PYFA 3ZC4A 4DV5J 2DJWA 3C16B 1O5JA 1DTQB 2EG1A 4QOTA 2DY9A 3AB4B 4BWMA 1T9VA 1RWWB 3BJYA 3NP5A 2VD3A 4N77A 2QRRA 1KLMA 3PYEA 1IN0A 1HPZA 4C4WA 1D8ZA 1TL3A 1PO6A 2CJYB 4EZ9A 4OYBA 2KN4A 3G96A 5K5MA 2E7VA 2B6AB 4OHVA 4PG5A 3T6BA 5D0GA 1UZDA 2XTJP 5E41A 1TQLA 3PKMA 1FWLA 4NRTA 3TQEA 3DN9A 2CG8A 2DGOA 2PI5A 1X4FA 4WK1A 5C24A 1LXJA 3N4WA 3LP2B 1LW0A 4J9RA 2DHSA 1FF2A 1RTHB 1SVDA 4C3LA 4ZVFA 3DCAA 4NLTA 5KFNA 1SPBP 2QMUB 2HHVA 3FDSA 2BA9A 1IKWB 2RRAA 4J37A 4DV1J 1OSDA 4IQXA 2RILA 3MXHP 4TKTA 5EDWA 1VLOA 2BANB 1FRHA 4QU7A 1Z1ZA 1NO8A 4TU9A 5C5JA 5HQMA 1WWHA 1A9NB 4JI4J 2ZJPQ 1X31C 1NSKL 1KNZA 2XGQA 3B82A 5RUBA 1Q1KA 2MZQA 4OZ1A 2DEIA 3GTYX 4RUCA 5DQHA 2VQEJ 3QO9B 2C28A 2MZSA 1IKVB 1T05A 4B3MF 2YKNA 3K8WA 2UUBF 1FESA 1TL1A 2ZM6J 4N7TA 4TNOA 5KT6A 4CLTA 4PG6A 2AGOA 3BPDA 4GC7A 1MMLA 2XLJA 2B5JB 2C1EB 1NJYA 1UVIA 3UN5A 5H9FJ 3GG1A 2VONA 1FHTA 4YR0A 2BVZA 3P96A 4C8KA 1RKIA 1KVKA 3LGMA 1IWGA 2KDOA 3J7AN 5EN1A 1JLQA 2DNPA 3AD9C 4MJKA 5ETOA 2LMIA 3TJAA 4I2QA 4DLGA 1OPZA 1HHTP 1X60A 2OTLS 1Q53A 4WFYA 5DO2A 2HFVA 3PY8A 2YWWA 3VQSA 8AT1B 2E9TA 3HVTA 2KFZA 3QAEA 4M8LA 4QQBA 2J6SA 5GMKa 1YX2A 1X0PA 1R8HA 2IMWP 1LW2A 1WG5A 3TAMA 4RO0A 2KXNB 2K1RA 5DDOC 4CLSA 4PYAA 4UZBA 1UVKA 1KDNA 3GIJA 4OZNA 1G7CB 5MLCV 4CYUA 1K0TA 5ETLA 1TTHB 2KRRA 4AYBD 3R8YA 4C6AA 2VASA 1BWEA 2D3OR 3JB9k 1FXLA 2ZOMA 3NWGA 2E1MC 1S6UA 1U1OA 4GKKF 4ICLB 2CWKA 2LVWA 4CM2A 1S6QA 2GGPA 3DLKB 2RQMA 2XZDB 3HZGA 3VVUA 1M5SA 2L48A 2ZOFA 4WWSA 2GZOA 2P6TA 1FTRA 2KHDA 1K44A 4URSA 1FKPA 2RU3A 2IM3A 4OMFG 3N5FA 4DUZF 3FCHA 3QWUA 1TMMA 3OUYA 2WSFC 1RDRA 2HFZA 2A6OA 1PC4A 1GXTA 1QAXA 1F1BB 3EXCX 3LF0A 4CLZA 2RUGA 2IDEA 3PX4A 2AQ4A 1HBOA 5EX0A 1NSQA 1WOOA 3P49B 1VQOS 5C25B 5K14A 5SUHA 1D0EA 4OFZA 1IM6A 3NGUA 2HKEA 3NNHA 2I8EA 2ZH3A 2MHNA 4NLQA 1S76D 1ZM2A 3B8HA 3SQGB 1IKYB 3MM7B 3CMES 3ELHA 1N36J 3KNGA 3T5JA 3R6GB 1U2FA 3MMJA 2UUWA 3AHPA 1JLEB 1Y00A 4OZ5A 1NU4A 1HNVA 4FYDA 1WHWA 2COLA 1UA1A 4RBUA 4A8MP 2R7QA 3DI6B 3CD7A 4P7VA 3BGUA 4QYZK 4M5HA 3ONQA 2FQQB 3V6DA 3GQCA 2GVDA 4F3QA 1RHMB 1GXLA 3TYTA 2BM1A 1UCNA 1JLFA 1H3DA 4KH1B 2M3DA 2OPSA 2LQBA 2KKHA 2OH2A 1TK8A 1XBWA 2WB1D 2DHGA 1HNZF 1UWBA 2UUTA 1RAJA 1HI0P 1FJGJ 2GVZA 4F2RA 2UVVA 5F8NA 4QWEA 4LF9J 2VG6B 2X1BA 4YMEA 4NI2B 2GAHC 4ZHRA 1W2IA 5DS7A 3NGKA 4NEYA 3O44A 5JJBA 1B0TA 3O1LA 4DLEA 5LT5A 3FMWA 5F8GA 3IG1B 1W26A 2QA1A 3PW7A 2JC1A 2YNIA 3CDEA 2BJEA 3L95X 3D1QA 3LAKA 2G0CA 3RYLA 2YKQA 1UW4A 4OV6A 4ZVTB 2QN6B 1VQ7S 2MQOA 4Z7CA 2IPOB 2DNNA 2DPIA 1F5AA 2DR6A 1FJCA 2JJ4D 2F3JA 2LQJA 2PD1A 3QSYB 2Z30B 4X4PA 1FK9A 2CNKB 2CFXA 4DEZA 3P5BP 2MKJA 2ZEJA 2ZE2A 3IWNC 2BJ3A 4ECWA 2UZAA 1RT4A 1NUEA 5IS2A 1KN6A 3C66A 5E3RA 4OYPA 1SJ3P 4KJIA 1Z2LA 2MGZA 5D3GB 4IR9A 2F8EX 3V6KA 2R2UA 3POTB 1T7PA 4JI6J 2RQ4A 1X4DA 2G0JA 5IT9Y 5L39A 4RZRA 3HHEA 3BF4A 4OI3A 1JMTA 3BQ0A 5BR8F 3CJKA 2GIRA 2ZKTA 4Q45A 1VQ4S 2J0QD 1SL2A 1S6PA 4HT5A 1IQTA 3PO5A 1U1QA 3R5JB 1OWXA 1EX8A 3GMGA 2XNQA 4HHUA 1YK9A 1RT3B 2BE2B 1JJCB 1N0UA 4OJHA 1D9AA 1KR4A 2BRKA 3DYAA 1FDDA 2W2MP 4J9QA 3RZAA 3C16A 4RBTA 1DTQA 3HT0A 2EI5A 4L3NA 4CDIA 2LYVA 2BQUA 2KT5A 1YLXA 1S5ZA 1TL5A 4V19J 2E29A 4GO7X 3BO2A 2FLLA 1N32J 2NXJA 3C46A 2CPJA 1KQGB 1S7HA 3KJVB 3HX9A 5GAGU 2HFNA 5DGAA 4I6YA 4ELUA 3ZZOA 2F65A 1WC5A 3KUGA 3ISND 1W25A 1SCJB 3J80U 4X2BA 4TQRA 5HJYA 2B6AA 2O5DA 3RJMB 1W2BR 3MFHA 5C2CA 4FVMA 3OJUA 4YFUA 4ZN1A 3HP6A 4B9LA 4PG4A 1Y7PA 1VRUB 4A8SA 4F02A 3LP2A 1FRXA 3R7NB 1HHQA 3UN2A 1RTHA 3D1OA 3FQLA 5BYRA 5HMZA 2RS8A 3PRDA 5IZHA 2NXEA 4P73A 3PVXA 1T94A 1Q86T 4ZVQB 1IKWA 2LU2A 4K8RA 4QYZJ 2ZC4A 4EWTA 2GC8A 1FD8A 1SKRA 2DH9A 2WW4A 4WKYA 2BANA 3CCVS 3NGDA 4B3TJ 3LPYA 3PW4A 2D1CA 2NLWA 4QWAA 2IRYA 2DY1A 4P7TA 2BW7A 4LBHA 3RR8A 2W7PA 1XMOF 1NBEB 4LFCJ 2Q43A 1M5VC 3QO9A 3D54A 1IKVA 4ATNA 3TEGA 2IC3A 4M95A 2GW8A 5C42B 1S1VB 1YIJS 2CPDA 2E5IA 2QFJA 1QD1A 1HR0J 2B5JA 4K2JA 1SJFA 2C3UA 4Q2LA 2W2PP 4JI1J 2UXBF 2WONB 1RT6B 1SB6A 1VISA 4PKDB 2JFDA 2XULA 1GAOA 4TN2A 3WC2A 4ZMMA 3WX4A 2A2CA 2VB6A 4ZVRB 4TLRA 2JEJA 5KFSA 2YKOA 5DDPC 1VDHA 2WBRA 3H59A 3GJQB 2MJNA 2JSXA 2C2NA 3W5XA 3RBDA 2OUGA 3D7SB 4HEA9 1B7YB 1N33F 1KVJA 4OI1A 3V81B 5AE3A 3IBWA 4N47A 2AIRB 3DU6A 2I5JB 1WHXA 2J6UA 5F8JA 3HO1A 4H4MB 2FVRA 4J9KA 2DR5A 1VHFA 2BDPA 2V2QA 1C4CA 1LWXA 3JYTB 1WD6A 2R9LA 2FZGB 3ILJA 1S9EA 3Q8PB 2EPIA 5GMEA 3CVKA 4XO0A 1JIHA 3CCLS 3HHLC 3IGVA 2FJVA 1Y3KA 2CQHA 1HD1A 1KS2A 5CABA 4ICLA 3NS7B 1BQNB 2WB4A 2CIMA 1LWCB 3DLKA 4C11B 4LFAJ 4LREA 2HEKA 3J80Y 4DZDA 4NZ0A 3GJSB 2VBXA 4G1IA 1UAWA 4DPXA 3LO3A 4ZP7A 3M1VB 3T5KA 2RIJA 1YJRA 3KJFB 5KOXA 3IBFB 1JXEA 1UMJA 2IAJB 1TKDA 4MIBA 5J2PB 1QSYA 4XDDA 3NAHA 3THTA 2R8HA 2W25A 1BGXT 2CADA 5DM7Q 5J1EB 4CO1A 4UUWA 4Q7AA 5C25A 3GIKA 2YXLA 1NPRA 4Q0BB 2V4JB 3AOCA 3K7RA 2JDJA 3JQKA 3DC2A 3VHQA 3SQGA 3FNNA 1IKYA 2YNHB 3MM7A 1SKWA 2VODA 5LMNF 4OX9J 5KFEA 1I3OB 3D28A 1NPKA 1W7WA 4DZ6A 1RWOB 1QVGR 1RWPB 5D4OA 2DR9A 5HI7A 1VBKA 4QJVA 4EBCA 1JLEA 4S0MA 1N56A 2LXIA 1V5IB 4FN5A 2KT3A 4ETXA 3DI6A 3TVZA 4NE9C 4WFAQ 4IFYB 3A8JA 4J9UE 1Q95G 1VC6A 2IYGA 2E9ZA 3GJRB 4R25A 5HMXA 1IWAA 3HJFA 3LP1B 4BDPA 1NDPA 1V3RA 2NSBA 2EBEA 4KAIA 2AZ1A 1EKRA 1Y5IB 5AE2A 4JV2A 2RU9A 1S1XB 2DGTA 1L3KA 2HQIA 3DRPB 3FSIA 2J7KA 2VG6A 4NCAA 2R8GA 2MKKA 2Q6BA 4NI2A 4USVA 2B9XA 5F9NA 2LDYA 4KV8B 4ZJOA 3MTKA 1AROP 5B09A 4IG0B 3KNAA 2R7UA 3CDUA 3IG1A 4FKXA 3N0VA 4KC5A 1U1MA 1WTBA 2VBZA 2AP6A 3ZZTA 5K20B 1O51A 1N5QA 4JI7F 4DBQA 3MDFA 3I87A 3IR6B 2BX6A 3HULA 4Z37A 3ISNC 3CW2C 3DNCA 3SSQA 3ETMA 5E0OA 5I4MA 3IC1A 1HYSB 1VBXA 2VV5A 1DQ8A 3MM8B 2C2KB 1CVJA 4YDDB 1S9GB 2KFYA 3F44A 4DUYJ 5HL7Q 2H1YA 3CTRA 4CLWA 1UJ5A 3BDPA 3FC9A 5IWAF 3QIPB 2QIFA 3NEKA 5D3GA 4ELVA 3NY0A 3POTA 4CLLA 4QBUA 4C8MA 2FLNA 4DV3J 1KTVA 4K4ZA 3WBZA 4NLRA 2VFSA 4KHPF 4WPAA 4MIWA 3AA9A 1RT3A 2BE2A 3ZZRA 5HK4A 1M0SA 4OI4A 1YJUA 1WHYA 2J0WA 4I56A 4DPYA 1AYEA 3R5DA 3RR7A 1M90T 2DCLA 4AD6A 4M5DB 3KG0A 2NPFA 3FBEA 4J9VA 3EJMA 5IM0B 4F2SA 2VFRA 1IR1A 2DYAA 4PPDA 2XNRA 4X84A 4OX6A 4DHVA 2OPPB 3GIIA 1HNWF 5HMWA 3UNGC 1FKOB 2HK2A 2HQGA 3B4MA 2XYGB 4CP5A 1X8DA 1XR5A 2KO1A 4GRSA 2VJVA 3KJVA 1YJTA 3MUVP 3TAPA 1SL0A 3CCJS 3KMQA 4EGLA 4DR5F 3MPVA 2DPJA 3OTDA 3NXZA 4Q8EA 2FC9A 5KFQA 4ED1A 2VH7A 5F8MA 1R89A 2GHWA 2EFPA 4HL9A 1F9EB 1XNRF 2VA2A 4I2PB 4LF2A 1RTIB 2KVQE 4O3NA 3EVOA 1VRUA 2GNKA 5F8IA 3KLEB 1RT5B 2QC3A 2RSQA 5DZ7A 1QTNB 3TUZC 4URQU 3N28A 3SV3A 3KLGB 2HPUA 1SIZA 2UUAJ 5JXSA 3CD0A 1RSCA 5F8HA 1G3OA 5EGYA 1ZS6A 1MMNA 2LA4A 3CCRS 3JAMU 1Q7YT 2PEBA 2PO4A 1HWKA 1HNIB 4KHRA 3HHLB 4PXEA 2YX4A 5EX3A 4P71A 1FRJA 4X65F 2CJQA 4QR0A 5D78A 2DNMA 3GWCA 1FEEA 3T1HJ 3OTBA 1FKAF 3RB6A 4HDHA 1IBMJ 5C42A 1S1VA 1S10A 3ITHB 2WBMA 2R7WA 4QW9A 1IBLF 2XSJB 1FVQA 3C6TB 4DL6A 4YS2A 2HS0A 2MSSA 2N3OA 3EZUA 3A8KA 2WONA 4B08A 1RT6A 3FMBA 5KG3A 1DARA 3CD5A 1DURA 4NYOA 5CD4A 2UXDJ 2AYMA 1ROFA 4ZKAA 1APSA 4KGVB 4KTQA 3K17A 2NYHA 3MECB 4B9UA 1DZ5A 5BYQA 2HIYA 2ZC3A 4FYVB 4ED4A 1RISA 3BYPA 2G2YA 1IBKJ 3HK2A 2M4MA 4ZPTR 3JXOA 3PR5B 4IH7A 2MLZA 2JVRA 2I2YA 1AW0A 3Q2SC 4NA1A 5CA5A 2C22A 3V81A 3A3NB 4USKA 3IBCB 2MSTA 3WHIA 2GO8A 2I5JA 2OI2A 3EYZA 4HHJA 4LRDA 2FY1A 3JQJA 4H4MA 2XO7A 3IGNA 3E3XA 2GMLA 2HS4A 1FX4A 1HWUA 3JYTA 1J5EF 5IQQA 3TANA 4LRBA 4DV4J 1GXUA 4LVOP 4D3GA 2W2NP 4DL4A 4NXMJ 1CC7A 3LQVA 2NXUA 3MM5B 2C2ZB 3HKZD 5HQLA 1MWZA 1ZH5A 2YNFB 4M5LA 4WP8A 5GAHU 4CLFA 3I32A 2J6TA 3OJSA 1BQNA 1YVFA 3CCTA 3RB0A 1LWCA 4C11A 3DLHA 2UXCJ 5HVHA 3I96A 9ATCB 4WP3A 3IO1A 1XNQF 3F56A 2QX0A 3TZYA 2IIHA 3NOGA 4CLUA 4PEOA 1ZPWX 3M1VA 3MMCB 4FPIA 2M70A 1R8PA 2IAJA 4IO9Q 3G86A 5J2PA 3KJNB 1WF0A 3NBPB 4DR3J 5E7OB 1REVB 3ZO7A 3OSPA 2PFDA 1KHVA 1VK8A 5FDLB 5B0GA 2B8PA 4DV2F 2CPXA 3GZ7A 1U1LA 1UJ4A 2HZAA 5J1EA 2Y0BB 1GMUA 2BACA 3HXMA 4JI2F 1RAHB 5ETMA 3W7BA 3L7PA 5L9NA 3M6WA 4Q0BA 3GV8B 2I0XA 2V4JA 1Q8LA 3BKUA 3CCMS 3QJLA 5GAGI 3PX6A 2K3IA 2YNHA 5L8RC 3TA0A 4ZVGA 2HHSA 1RAGB 2B9WA 4OLOA 4O3OA 4DR2J 3JAMY 3T1YF 1UEUA 4MKVA 3OFHA 1LNQA 3BBCA 2G1DA 4WP9A 4TYAA 3NGRA 1Q81T 4W92B 4I68A 2D7SA 1WSVA 2YBVA 4NMLA 4DG1B 2M52A 2W7OA 4WKRA 1PAEX 2DISA 2O01C 1OMSA 1XR6A 2VF3A 4Q2MA 4IFYA 4F36A 1KLNA 3BH7B 2V8GA 1L3UA 5E5NA 4USIA 3TUIC 3CMAS 4KGMA 4M5IA 3TZWA 1K0VA 5HROB 1U0HB 3LP1A 4B3OB 1U48A 2FPHX 5IT4A 1GMWD 5F9LA 2CZVC 1VQ6S 3KLHB 1NK9A 2VJUA 4DR6J 2DNHA 2GCFA 2ZVSA 2FYXA 3LOUA 2WVBA 1WJ9A 3R3TA 3MAQA 5KFLA 5DG8A 1G4CA 2H9ZA 1L3SA 4AUKA 1S1XA 3E51A 5CHCB 1K73T 4ENOA 1N34J 2MB0B 5A0YB 3H4DA 5D4NA 3DRPA 1TMJA 3TWZA 3KLIB 3JTNA 4RW6B 4KV8A 1U8WA 2PT0A 4IG0A 2ROEA 3LA0A 1OYDA 1F5CA 5K8OA 2V69A 3DGPB 2Z56B 2QLWA 3OT9A 4DL5A 4HT7A 4PYDA 3OFFA 4G65A 3Q8VA 2MY8A 4O44B 1PJ6A 2CQ3A 3MM6B 2KG0A 1LWFB 1VMBA 1SC6A 2MLXA 3J7ZT 5GAEU 4CLYA 1VR6A 1C0UB 3BB5A 5I3QA 4XPEA 4PWUA 3MMBB 4GMKA 2GJIA 1U1PA 3FQKA 1HYSA 2ZH4A 1UW9A 3R1HA 4R8UB 2ADBA 1N5YB 4E0DA 3JQMA 3LANA 3MM8A 1XMQJ 4JYAJ 1KFDA 2M0GB 5KG5A 1S9GA 3GYXB 1U8SA 5L1KA 5DRKA 4LUBA 4C8ZA 3QIPA 1OJ4A 4ZCKA 2Y1JA 1UP1A 4U7UD 5F0WA 4NYZA 1S1TA 3R5CA 2IVFB 1NDCA 4MFBB 2L3MA 3KOAA 4GKJF 2Z8QA 1M1GA 3AJ2A 2U2FA 4MYTA 2MZ1A 1SJ1A 3K2YA 5KFVA 3R7BB 2XGPA 4DL7A 5DDQC 3OTOJ 4DPUA 1VRQC 2AYBA 1S1WB 2FJBB 2BUNA 4ZVUB 4LR8A 3HPOA 2W4DA 2PEHA 1I94F 3QMQA 4M5DA 4DV7J 3GCWP 4ZA1A 2DB1A 3CDWA 5IM0A 1WOSA 2LP4A 4RUBA 5A8KB 3J81Y 5DGBA 2ZITA 2B51A 2E5GA 4X4TA 3BR8A 2RQKA 3W62A 2OPPA 1FKOA 4CCHA 3PKYA 1RYRA 4K4VA 1ZTTA 2RE1A 3MEKA 2V4QA 4QR1A 3J7Z5 2MYFA 4MKBA 4PG8A 4FXDA 4M5KA 2EFVA 3EVMA 3HVAA 5KFKA 1L3VA 1EJ7L 4I2PA 3NGSA 3I31A 1RTIA 1CQNA 2FY8A 4RNFA 4DX6A 2AGPA 5ETTA 3KLEA 1RT5A 4JI3F 2C42A 2ASDA 1GQEA 3KLGA 4IFVB 5LXRA 2JC0A 1RBAA 2HYIB 3KLFB 3HVWA 2K7KA 3DLGB 3WIVA 2GQQA 4U7UK 1LFWA 3KG1A 2YPZA 3DKDA 1H0HB 3MPYA 1HNIA 3I5AA 2GAGC 3HHLA 2LEBA 5HMYA 2ZH5A 1Q7LB 1HW9A 3Q8RB 5AXMA 3M8QB 1WUUA 4LSLB 4FS1A 5HVGA 3ICLA 3VV2B 1REGX 4LFCF 1IVZA 1KRPA 4GVBB 3M2RB 1KTQA 4OJGA 3MHYA 4WIQA 1JLBB 3ZNJ1 3BN7A 4Y00A 3HSZA 3FEZA 3W65A 4DR7J 3BKTA 3ITHA 3M8YA 2XSJA 2W2QP 2DNGA 3C6TA 4HKQA 2F4VF 4J9LA 2WVFA 5AXKA 4YB1P 1P9QC 1B70B 1F60B 2CVIA 2UUCF 5IC4B 2HHHJ 1IM4A 1YZ6A 2HW3A 1YJ9S 4QPXA 2QLBB 2ASJA 2VKZG 3Q22A 4U96A 4OI2A 2AT1B 5KFCA 4KRWA 2E66A 2RQCA 2XWXA 3UR3C 4MK9A 1WC1A 3K8VA 4X66J 3MECA 2HNDB 4OZLA 3CIZA 4MAKA 4DSJA 4F26A 3HFKA 2HBQB 3C14B 1YBAA 4RJVA 2OSRA 4B9MA 2VUGA 2QYGA 4IOCQ 3CB4A 4DPWA 1LWEB 3RB3A 3MD3A 2IA6A 5HJXA 1N88A 4ANDA 2W2OP 4FYXB 1S72S 1S77D 2BBEA 4ERDA 2ZBCA 4BBYA 3H8YA 3VAKA 4PXCA 5KOWA 4ZCLA 1KBRA 4BLGA 2BZ2A 4Y6IA 1EQ0A 1PKUA 1ZM3A 1HNXF 1D8YA 3I5BA 2X1AA 3M7VA 2QJ3A 3N5BA 4O3PA 4NMXA 3MM5A 3KFWX 1HKAA 3CEDA 3UDVA 2VC0A 4JI5J 2YNFA 3IRXB 3D4JA 1C0TB 4DU8A 4MIAA 4ED7A 1RP5A 3HMJG 1NB2A 4IDKB 3G8TA 4WXWA 2RHQB 2XMTA 3TZXA 1R3NA 2CZ4A 4X64F 1KOHA 1X4EA 1U49A 2DCUB 2DGWA 4M5JA 3MMCA 4J9PA 1SQEA 5A2QU 3U1NA 1HQEB 3HHDA 2BMBA 3NBPA 1UFWA 1REVA 3BBFA 5FDLA 3UN3A 4CI0B 4LF8F 4FS2A 2B9EA 3NS5A 3BSCA 1LQ9A 3R27A 2Q79A 3QRRA 5IFMA 3LTOA 2NSCA 1VQKS 1HMVA 3X1LB 1K8AT 2GFFA 2AWZA 5J2QB 2AYEA 4C0HA 1MN7A 2VQFJ 3DFEA 3GIMA 2DNKA 3G8QA 3NG8A 3LPEA 5LL6d 4LIRA 2XEXA 4X62J 3H4BA 4Z2XA 4DG1A 2N4DA 3VAGA 3T41A 3TR5A 4WZMA 3D6FB 3C6UB 2N4CA 2CA9A 1YRXA 2Y1RI 2OP5A 4NLPA 2H4YB 1FFWB 4FYWB 4RW8B 3UO0A 1UL3A 3A13A 4WYWA 1U02A 3PNIA 4F4AA 2CKWA 2ZHOA 3SBMA 1VJWA 3I5CA 4KGKA 4KE5A 5HROA 2IFXA 1U0HA 4UY8T 1VCTA 1Q8KA 1RBLA 3CF5Q 2K7JA 1XERA 3KLHA 4RLEA 4KQZA 2H5EA 1T03B 2J9DA 2XY6A 2GJ2A 3SIPB 2F8MA 1WEXA 4CIOA 4G1QB 4LFBF 4FNHA 1Y11A 2MEWA 5HAOA 2QSFA 1UEVA 5A0YA 3UD5A 2E44A 4IYQA 3K5LA 4ZPBA 4PAAA 2JRSA 3KLIA 1FWKA 4RW6A 4ID8A 2QYCA 1CJTB 3QRQA 2PFFB 3IWLA 4K4YA 3OR2B 5DJBA 3ET6B 2F9JA 4AL5A 4ZN3A 2JLGA 2F7VA 3DGPA 1X5SA 1NNDA 2B3TB 1QUPA 3NWRA 2HFUA 4C9DA 3CJ2A 3IN5A 2PGCA 1FDAA 1ZZNA 4O44A 2DITA 1QAJA 5KFTA 1R43A 2YPYA 3N6MA 3MM6A 2ZZTA 2AF6A 1LWFA 2BKOA 4OI0A 2NYIA 4F67A 5KG1A 3MR7A 2CQ4A 4KPYA 3NAIA 1C0UA 1F0XA 2AJFE 3MMBA 3UCZP 1CQMA 4R8UA 1N5YA 4DUYF 4F25A 5DM6Q 2QFIA 3ULHA 1UVJA 1RWNB 1NJIT 3OSNA 1SI9A 3DHXA 3IFEA 4QWDA 4P74A 4MFBA 4OYXA 1FRMA 2XWYA 2EFNA 2EG2A 4NASA 4RW4B 5D6GA 1VBYA 1ZA2B 2Q1LA 2Y1LB 3K5NA 2CPHA 3BPSP 3TX8A 2Z2LA 1S1WA 2BE7D 5A2QY 3VAJA 5KFDA 1D3WA 2WK4A 1YSJA 1M5HA 2J0XA 2AX1A 5BXIA 3H0PA 1MWQA 1MROB 2OEJA 4EMDA 2HVEA 3SFGA 2NS1B 2LQ9A 4E2FB 2AKWB 3BS9A 2CXEA 4GVLA 2XS2A 2VA3A 5A8KA 4QYRA 1DTTB 4CWBA 4PUOB 1B99A 4FZVA 4R5PB 5GAHI 5K9FA 2RT3A 4ECZA 3VZIA 4A8QA 4JI8F 4P2FA 2PDAA 4JV5F 4KYZA 2XS5A 1PIEA 2N7YA 3B54A 3Q83A 5D0RA 2LEAA 2IHR1 1JKHB 5G0RB 9RUBA 1QM9A 5KG4A 4ECRA 3D5MA 1YBTA 1RT1B 2PA8D 3FJ2A 1ZAVA 4LF6F 4OZ2A 2WVCA 1K1QA 4U95A 2QE5A 1RAFB 4Y3CA 3N9UC 2JH3A 4YB5A 2ERRA 1FNOA 4CQ1A 1N5SA 1FCAA 4JOUA 2L9DA 3N79A 1ICEB 4IFVA 3W1YC 3GB0A 2DH8A 2W7AA 1YZ7A 3KLFA 3DLGA 2QLXA 4FBUA 3UR0A 4LBPA 3UWTA 1MU2B 1DY3A 5LM7E 2JHEA 2L9WA 3H25A 4B3MJ 3UD4P 3HFVA 1A7GE 1AA1B 4PWWA 3I9ZA 3KK1B 1D09B 2ZH2A 3M8QA 2YKPA 3QT6A 3O8WA 4LSLA 1UETA 1RTDB 1VJQA 1ZTWA 2FZKB 4GVBA 3M2RA 3RGIA 3ZNUA 1JLBA 3O3LA 3QLHB 3Q89A 1RU2A 4RU2A 5T41A 4I64A 4I4BA 3CJ3A 3CWJA 1QAIA 3OL7A 3FCWA 4FNIA 1R8AA 4CZCA 3RRHA 4C97A 2NZCA 4WK3A 4O3SA 3W9HA 2ROPA 1RAEB 2E7WA 2G9OA 1B64A 3MR6A 2DGQA 2G1HA 4RPFA 2RAQA 2AEJA 2AMCB 1NM2A 4AFFA 3SYZA 1F5BA 3CJ4A 5D77A 1RWKB 2HNDA 3PEHA 3KK3B 2E5HA 2AZ3A 2OELA 1RWMB 1VS3A 1X4CA 3GSDA 2JOQA 3PV8A 3C14A 2KYXA 2GA7A 2OKQA 4YB6A 1U26A 1WC0A 3WIUA 4DV6F 4FXVA 2IJRA 1LWEA 4M5MA 2RB7A 3H5SA 3EGWB 3HT3A 4H4OB 2ZJQQ 3PJ9A 5GAEI 2A10A 3CC4S 2FHJA 2QL7B 3HKWA 2ZZNA 4MMOA 3R1LA 2VZ9A 1Q78A 2X7IA 1NKBA 2BRLA 1FRLA 4RNHA 4GKKJ 1PYSB 2LU1A 3P6YC 1AFJA 4PXBA 5LXYA 3THVA 3PW5A 4K0KF 2LXFA 2O1PA 4OJ1A 4DQSA 2XCPA 3W9JA 2OEKA 4NA2A 4DL2A 2E9RX 2UV8A 1U4BA 2XYHB 1U45A 2WSEC 5DQIA 4ZVEA 2P6SA 3Q86A 3SDEB 2HG4A 1RWXB 3IRXA 1RZMA 2XMVA 4DUZJ 1N4LA 1C0TA 4OYIA 3UQSA 2DNQA 2ZH9A 3KDOA 2ATLA 4IDKA 7AT1B 2J9CA 2HS3A 4U8VA 2V2VA 1Q8IA 1Y3JA 1UVNA 4F7VA 4L76A 2ACYA 1QJHA 3O2IA 3ZZ0A 3FUYA 1HQEA 1TV6B 4ZOSA 4G3IA 1JB0C 3ZTPA 1H2UX 1V6HA 1GTEA 1SJQA 2CVEA 2RH3A 4ED3A 4LF4F 1BHNA 1OQ6A 3PHTA 5CYJA 1F9HA 1SH0A 5HQ8A 3TAQA 1K9MT 3ILOA 2UV8G 3B4DA 3H5UA 4B9NA 2EFQA 1BC6A 4USMA 4PQUB 1EB0A 3WQPA 2Q66A 3T19A 1NSPA 2LQ5A 5J2QA 1IKXB 3UD3P 2HLTA 2O66A 2C2RA 2EK1A 3OLBA 3S01A 1N8RT 1VHIA 3M6VA 3C6UA 3HF5A 4RW9B 4YY3F 1CEZA 5D4PA 1NLKL 3EWGA 4A8WA 1HNZJ 4RW8A 4NYPA 4DS4A 4TU7A 1WI6A 1HQUB 3T9ZA 3MPUB 1RAAB 3I55S 3JSBA 1VBZA 4MYUA 2FZCB 1RXOB 4DR6F 5DG9A 2GMHA 1ZPVA 3IR7B 1T03A 3G87A 4DN9A 3GU0A 2E5LJ 2GJFA 2P5VA 3SV4A 3EE3A 4CLPA 2DNRA 3J7YU 1JNZB 2XHCA 1R0AB 2HNYB 1U7LA 5ITHA 3MR3A 5IT9U 1KVIA 1HW8A 1BWVA 4HI1A 4UOCA 2UU9F 2CNNB 4EU0A 1CJTA 4RNOA 1VQLS 3OR2A 3ET6A 2BABA 5KFRA 1NHUA 4XAKA 5CXTA 2CPIA 1CG2A 1Q79A 2B4UA 4OIXA 4HYKA 1S4FA 3P4UB 2EK6A 2HWHA 3F0NA 4P2SA 3BGFA 1ULRA 4NCBA 1M5PC 2HGMA 4B3RF 1TKXB 2K8GA 5I3PA 1VIOA 4B02A 2Y8YA 5HANA 2CNOB 2PMHA 2YVSA 4H4KC 4Y34A 4F4KA 3ZZYA 5KFJA 1WOPA 4AE5A 4MKYA 3GILA 2MXYA 4F0MA 3OHBA 4RNNA 1PILA 2CJ9A 3DLLQ 3QFHA 4V1Ak 2ZUGA 1HI8A 5BR8J 1X4HA 1HBMB 3VTIA 3KYLA 5HP1B 2DIVA 4B3SF 1H2TZ 1LEOA 1BLUA 1CULB 3C3LA 1QVFR 1SQFA 2ZNZA 4K4WA 3D3CJ 4NPOA 4ZP9A 2EBGA 2VICA 2GHVC 3LUYA 4RW4A 3X3UA 3RUBL 3W2WB 2QMXA 2XMAA 3HHLD 5F3TA 1JWWA 2K2PA 4XDCA 3KG4A 4LSNB 3MR2A 3BGRB 5AXLA 5F0UA 1U1KA 3M05A 3JSRA 1R31A 2VOOA 2I9SA 1B7FA 2J8AA 1MROA 4N41A 4DV7F 1RYSA 4OI6A 3HSDA 2ALYB 3DOKB 4ECVA 3PYGA 5JVHQ 1LV5A 4JI0J 1NJWA 1Y5NB 1DTTA 3TVYA 4J90A 2VPYB 3OL9A 2WAQD 4PUOA 2CJAA 3BV8A 4R5PA 3H2VE 5D8HB 3OVBA 2HAFA 3G9CA 4I69A 2LCWA 4JP8A 1UVLA 3CCQS 1PSDA 1IQZA 2DRDA 1VIXA 4HACB 1JKHA 5G0RA 3OR1B 3FRZA 3CSKA 4ZVHA 2JEFA 1RHUB 3H5YA 1ZAXA 2IMOA 3CO9A 3BGOP 1RT1A 3NNAA 2P9GA 1P1LA 5KG2A 2N3LA 2ACMA 4DF8A 3CUNA 1UJ6A 1KD1T 3M2UB 4AT1B 5KFPA 1T9YA 3IWXA 3QWPA 2DBBA 3QGPA 1RI7A 4P6QA 4A8YA 4OX7A 4TXSA 5AE1A 3DU5A 1OPIA 3MEGB 4HHHA 1VOMA 3MZIA 2B0GA 2G4BA 5DETA 2KFNA 3DOMB 3EDRB 5AXNA 2R2RA 5CCMA 2JFKA 1YWXA 2DR8A 3M2VB 1XMOJ 2B7BB 3GCXP 1MU2A 3TI0A 3DLJA 3PCOB 4NLGA 3DDNA 7FD1A 1U2RA 2W9CB 3TOQA 3GFHA 3KK1A 1HBUB 1WF2A 1TUWA 1GMWA 1IUJA 1NSAA 4KY3A 1RTDA 5ETQA 4F3OA 4LT6A 2M7SA 2G13A 4ZVOB 1JLCB 1C1BB 4EYIB 1SUQB 3D1HA 3QLHA 2HAIA 4NZ7A 3OXFA 1A0OB 3M8RA 1YITS 2XI3A 1RQ0A 2D9OA 2UP1A 1QY7A 4NOHA 4YN3B 4LIWA 4KH0B 2CQ2A 2V50A 2OTJS 1NPPA 4P52A 4KPCA 5H1SV 2N7CA 4WBFA 4N56A 1FO1A 5CD4H 3QRPA 1QE1B 1VRTB 1X5TA 4CH0S 2V0NA 3GPAA 2HHHF 4M63A 5I42B 4IKAA 2W9AA 1G1XA 5DQGA 1N33J 2JWNA 3A8EA 3G6ES 2DD8S 6FDRA 1FJEB 2CRLA 4L73A 4P9SA 2DNYA 2F9DA 4M5NA 4V19X 2RDIA 3MCOA 4HVZA 3KK3A 1TVRB 1IR2A 1RAIB 2GIFA 3D67A 2VFVA 2KT2A 3FSYA 1NHKL 3IS9B 2BKNA 3I4PA 5A6WA 1TKTB 2CWXA 1PBAA 1XK8A 4H4OA 5CYMB 1O0PA 4NEZA 1UPMB 1OY9A 4HI2A 1VFJA 1KQFB 3VVTA 1GT8A 2D3O1 2FIUA 2E1CA 1V5VA 2HBRB 2XHWA 3J7A1 4K50A 2V67A 3QGGA 3CCZA 4J5OA 1U6FA 3R5BA 1NK4A 1U2CA 5KT3A 3U1LA 2N82B 3ZFVA 5K8NA 3RU0A 3TRGA 2R7RA 1RWVB 2MQ8A 2ZVIA 3SDEA 2R7VA 5B08A 3PTWA 2C2EA 4OYMA 1NB7A 4Y28C 3VAIA 2QZ8A 4ZJQA 1WKLA 2R42A 3BM7A 2HFSA 2MZRA 4BS2A 4QIVA 1VQSA 2YWHA 4WF9Q 1FE4A 2X1FA 2UVWA 3NGTA 3S1TA 4DQIA 3QQCD 4F4XA 2VBYA 4IRKA 1TV6A 1R6VA 3KLVA 2OD6A 1Q5YA 4TVAB 5ETVA 1RU1A 4ANCA 4KB7A 3ETOA 5LMNJ 4LF5F 2MKYA 2QEXS 2APOA 3OPKA 1T3NA 1MW7A 4A8FA 2BR0A 2VPZB 3RW7A 4PQUA 1Y10A 2CQ1A 3CXCR 4ID5B 2RUSA 2CQPA 4YQWA 5L9XA 1IKXA 1TL4A 1PCAA 2VOPA 1X7VA 2BJ1A 4MK8A 2R7XA 4DS5A 3I0RB 3EM1A 4WFZA 2XO6A 2ZH8A 2K06A 4RW9A 4YHHF 4O4RA 2YX1A 4IH6A 1HQUA 4AQYF 3D2WA 3VF0B 3HD2A 4TU8A 1U25A 4UOGA 4OHZA 2W24A 2DNLA 1OQ3A 1RADB 2AJ1A 2KB2A 2Y0SD 5KT2A 4ZPCA 1T9XA 3NS6A 3M8SA 3AB2B 1U09A 1M5KC 4H54A 2V94A 5B0EA 5G4DA 4NXNF 4MK7A 2EVZA 4ZPWR 1WDDA 2W4PA 1S48A 4GC6A 1R0AA 3JSMB 2R8IA 2HNYA 1FA0A 4EUVA 4F4WA 1ELOA 4O3RA 4F04B 2WSCC 1FNXH 4JI7J 1Q16B 4CO5A 3R5GA 5B0DA 2XQCA 3BYRA 4DSKA 3UCUP 2B9YA 1S9FA 1VQPS 1SKUB 4DX7A 4DOZA 3FBFA 2DHHA 4WYLA 2FJXA 1FI4A 4UTGA 5E3PA 3E8OA 3GV5B 3ENWA 4PQAA 3CJRA 4QZVB 2POKA 4LR9A 1HI1A 3GIRA 4FF4A 1TKZB 4C0OC 3DRSB 3IP0A 3K58A 3JS9A 5KFWA 3VAHA 1CJVB 1RAOA 2BOPA 1TKXA 1KONA 4NLWA 2AJQA 2BQ3A 2FD2A 2EXUA 3D6TB 1RTJB 5IWAJ 1O8BA 1T9UA 4F0KA 5L1LA 3RBZA 4PR6A 2XLKA 1X9SA 2G2ZA 4F0HA 4LF1A 3S6EA 5CYQB 1XWLA 1H7XA 1CJUB 1GH8A 1HBMA 1RUSA 2CPYA 8ATCB 2KXFA 5HP1A 4LRAA 4KHPJ 3DM2B 1VQMS 1CULA 3C8YA 4ZIWA 3NMRA 3VAMA 4PCQA 3HSGA 3CD6S 3QT8A 3I0SB 2FB0A 4P2MA 3LWMA 2Z2YB 4OLPA 1JXLA 4OZJA 4UZCA 2GHPA 1B0PA 3VAFA 3W2WA 1U1NA 1O6XA 2BEFA 1SC1B 2MKCA 1S0NA 1NRKA 2H5JB 1EETB 3L3CA 1DQAA 1RHJB 1NK6A 5ETSA 2ZD1B 4LSNA 1WI8A 3KUHA 2YKAA 4DR4F 3BGRA 4L72B 4NL5A 2VFTA 2RDDA 3OL6A 1HNWJ 3MI7X 2CG4A 1QAYA 3MOJB 1CPZA 1C1CB 5AJ3F 3BEGB 3EMTA 4B9TA 4KGZB 1WC4A 1NXIA 3DOKA 2B7CB 4DN0A 4DR5J 4DR1F 4ES2A 1S57A 3W5ZA 4ZCIA 2B56A 1HL6A 2XBPA 1JX4A 1XJWB 2VKRA 2RVJA 3QNWB 1XNRJ 2YH1A 4X4UA 4HACA 3CJSA 2PMWA 4ZLNA 4J91A 3OR1A 4RKUC 1CC8A 4CNZA 3EZ5A 5ETRA 3R9LA 3G4SS 3AD8C 3FFIB 1MNEA 1DAXA 1P6TA 1AFIA 4UOHA 2GO9A 3RRKA 3CT9A 1FX2A 5J1NA 1S0MA 3P45B 1MMDA 2Y3YA 2BQRA 3M2UA 2VBWA 4LF7F 2WVEA 3ADAC 4EK2A 3TW0A 5LMUF 3W61A 5BYSA 3OXGA 4PRFA 2RJZA 1T9TA 3VCDA 3MEGA 2VIHA 4OYZA 4LRFA 4IRCA 3DOMA 4X65J 1KOOA 2CPEA 2FHJD 3CMQA 4JB8B 1JK9B 3P3DA 4NLVA 1R8CA 2MKHA 3OXLA 4HH1A 2LKZA 3M2VA 3D6MB 1KC8T 1QSSA 3DRXA 5FIIA 2OMOA 4EZ6A 2IC3B 4YR3A 1YBUA 2VU5A 4YEAA 2C2MB 3A3OB 2W9CA 1YQHA 3CC2S 1D9FA 2EC2A 1HBUA 1M1HA 4KFBB 1IBLJ 5FJ4A 5KFXA 4WFBQ 2IJNA 1YGYA 3HD1A 2FTRA 1JLCA 1C1BA 1SUQA 2KZZA 3UNYA 5KG6A 4HLBA 1E6VB 4DV5F 4Y2AA 3NL0A 1VQ5S 2ZBQA 1K47A 5LOQA 1RJJA 1QE1A 3J7YI 1VRTA 4ECXA 4DQQA 1ZOTA 4QWBA 3Q23A 1R0CB 5LSRA 1HD0A 3HCXA 3RBXA 5I42A 2KH9A 1YKWA 2MQMA 3ILIA 3IRWP 2OPRB 3V6JA 1NDLA 1TP7A 1TVRA 3K5PA 4UW2A 2R7SA 4N8NA 3AH6A 1VQNS 2V8VA 2F1FA 1N52B 5F3ZA 3IS9A 3BGLA 4BWJA 2LEPA 1J5EJ 1S9EB 1TKTA 2VDIA 3OTCA 4JV0A 5KFHA 1NKEA 1T95A 4QIGA 5CYMA 2V2KA 4ALZA 4DV1F 5CCLA 1ZM4A 1RA7A 2FVCA 2AJ0A 4ZITA 2NCKL 3NCRA 4DL0C 4IOBA 4BCAA 5L38A 1XEZA 4NLDA 4MT1A 4JI4F 3D0HE 5CAAA 1WF1A 2NREA 3KDNA 1XNQJ 4OYOA 3MEDB 2WOMB 5HBMB 4DFPA 4PWDB 3U7JA 4E98A 3VR1A 5BJRA 2V63A 4AL6A 5KFGA 2VQEF 2X51A 4O0IA 3MFIA 4PG7A 1BQXA 2DIUA 2W9BB 5E3AA 4DV2J 2ATCB 2ZM6F 2KM8C 3G2XA 1ZYQA 2UVUA 3BO3A 2OEMA 5E3QA 1NK5A 2V34A 4JI2J 1ZA1B 3V2UC 5T14A 2OMLA 3ZZUA 2V5HG 3HM9A 3AD7C 1R27B 2JX2A 4UQGA 3FGVA 4ANEA 2ZZMA 4FP9A 1U1RA 2HZVA 5CZXA 2HBZB 2AV5A 5A8RB 3W64A 4USHA 3TUJC 1TK0A 2VG5B 4X4VA 4X4SA 3T1AA 3PM9A 4H4KA 1GFWB 3T1YJ 3MTJA 1FJ7A 4K7QA 3I82A 8RUCA 4NLYA 5F8LA 4YP3A 1FRKA 3RAMA 2H48B 3NNCA 2ZHBA 5H9EK 1BMQB 3MUTP 3K5OA 4ID5A 1Y9OA 2VHGA 4B9VA 1KQSR 1IXKA 2R3VA 2QA4G 2FHMA 2MPUA 4RWWA 4A47A 1RGVA 3D68A 1RT2B 4P10A 2F40A 2YNGB 3I0RA 3MAAB 4U67Q 1SIWB 2XLIA 4I6WA 4O4GB 1LK7A 3EGVA 5J2MB 1RCXB 2MQNA 3N6NA 1S6OA 2H54B 5M2PA 3WDOA 1PJ5A 3FZBA 4J9NA 2XMKA 1PBUA 3NCPA 1OO0B 3IAS9 2KTQA 1Q0NA 3RG6A 1TL7B 4DFJA 4DCOB 1BQMB 3BQ2A 3VWSA 2NXCA 2XY5A 3K59A 1E6YB 2E5LF 3ZZZA 4LRCA 2MKIA 3GR0A 1FEHA 2M88A 2VFUA 3DXBA 2QMWA 3QJJA 2K3KA 3PJXA 3JSMA 3FEXB 1ITPA 5IV4A 1H38A 2IRXA 3UDEA 4C7QA 2ZH6A 1F2HA 1PGZA 3VALA 4RU9A 3MM9B 3GFYA 1N48A 4PZVA 4DPOA 3CPWR 3U02A 4C2MA 4W90B 2CDQA 3UCGA 2JLEA 2OLWA 1VQ8S 4L75A 5GADI 3BSNA 1FXRA 2FJDB 3HJVA 1F6TA 3D6HB 3Q8YA 2MMYA 1TKZA 3DRSA 2AU0A 3VGTA 1Q4RA 4ETZA 3H5XA 4IG3B 1CJVA 3VQTA 1NMEB 2MY7A 4K2XA 3MR5A 1G2EA 1F2GA 3J81U 1RTJA 4WTYA 4UF4A 3TJ8A 3DDKA 3VGSA 2DGSA 2BV3A 3QGHA 4YB7A 5D0EA 5DDRC 1N36F 1M1KT 5CYQA 1RB0A 1S49A 4RW7B 1CJUA 4GKJJ 5LSLA 2ZDOA 4ZS6A 2HWTA 4P75A 5LJ5Y 2HSEB 3DM2A 3J81j 3HHNB 2YQ0A 4WU3A 3ENVA 4RUAA 1YRUA 3KMSA 3I0SA 2LECA 1I94J 5KFFA 2PSZA 4WJBA 2HMIB 4LJMA 3G6YA 1RWUA 3KHLA 1EETA 2GQ2A 5DG7A 5LJ3Y 4KSEB 1TK5A 2ZD1A 3U1MA 4NX9A 1FJGF 5C7PA 5CQGA 1S4EA 4USTA 4X4OA 1VQYA 2QSWA 5EHHA 1C1CA 4CO0A 3MURP 1AB8A 1WEZA 2FVQA 3QZ7A 3C2PA 3U27A 2R8KA 5L1IA 4LF9F 4JI0F 2LXUA 2V8PA 3H2UB 2L9NA 1JQGA 3OQ2A 3W5YA 1V9OA 2HNZB 3OV7A 3QZ8A 1L5UA 5ADZA 4DV0J 2DHXA 6FD1A 1FNMA 2IM2A 1J5OB 5B0AA 1UTAA 4JI3J 4U8YA 1PG5B 1EP4B 1QUVA 5H9EJ 1JLGB 3FFIA 5KFOA 3M6XA
chains in the Genus database with same CATH topology
4CT8A 4DQRA 2MDAA 3KG0A 1SJQA 2CVEA 2RH3A 2NPFA 4ED3A 1AUDA 4LF4F 3W3SA 1OQ6A 2D41A 5MAOA 2CYYA 5IM0B 4F2SA 2VFRA 3M32A 2CQGA 4K4SA 5CYJA 2HFOA 2OJ3A 1SH0A 2R2TA 4B17A 5HQ8A 4DSEA 3TAQA 4PPDA 1SH2A 3GR1A 2XI2A 2XNRA 2J9DE 2XCAA 2IVYA 4MH8A 4X84A 1K9MT 2A18A 2UV8G 4OX6A 1LFPA 3B4DA 4DHVA 2OPPB 1RT7B 3H5UA 3GIIA 5I3UA 1HNWF 5HMWA 1B0VA 3UNGC 4B9NA 2EFQA 1FKOB 1S6QB 2OIHA 1BC6A 4KKOA 5EUHA 3B4MA 3G6XA 4PQUB 2O67A 3T5LA 4K59A 1X8DA 2GGPB 3R5AA 3M9OB 4IOAQ 1XR5A 3T19A 1HFEL 2KO1A 2KU7A 2Q66A 2FGCA 3KJVA 1YJTA 1JLAA 2YKMB 2M8DB 1R7IA 4F8RA 1NHVA 2ZHAA 3T5HA 2LQ5A 4EBEA 3MUVP 3TAPA 3PDNA 5J2QA 1SL0A 3CCJS 4N5SA 1IKXB 2WW8A 4EGLA 3KMQA 2EWHA 4JI6F 1YG0A 3UD3P 1FDNA 4ZP8A 4DR5F 1X0FA 2PI4A 3MPVA 3KWMA 2DPJA 2HLTA 2O66A 3OTDA 4HH0A 2C2RA 4JI5F 3SSSA 4Q8EA 2GQCA 2FC9A 5KFQA 4ED1A 2FDNA 4K4UA 3M8PB 1FKPB 2EK1A 3OLBA 2OFHX 3MEEA 2VH7A 3S01A 5F8MA 2KVIA 1N8RT 1WTFA 1R89A 2GHWA 3OUYB 5F41A 2DRBA 2EFPA 3SCJE 2L08A 4HL9A 1XNRF 2W4CA 2W8KA 2VA2A 4I2PB 1RTIB 2C3PA 5KTQA 3M6VA 4DX8H 2RF2B 4YOEA 3C6UA 2MZTA 2ADCA 3EXYA 4KFBA 3HF5A 4O3NA 4RW9B 1VRUA 4YY3F 2GNKA 3JTOA 5D4PA 3TVKA 1NH7A 1CEZA 2KG1A 1HBOB 5F8IA 4A8WA 2OAUA 3G9CA 3KLEB 5A8WB 2HHTA 1RT5B 3Q0AA 4RW8A 3KHGA 4NYPA 3CE8A 4DS4A 4TU7A 1WI6A 1HQUB 3LW5C 5K14B 4WIIA 3T9ZA 2RSQA 4TY8B 3TUZC 3I55S 1YI2S 4URQU 3K5MA 3JSBA 3N28A 4GO5X 3SV3A 3GV7B 4MYUA 3KLGB 2HPUA 2KM8B 1VBZA 4BHQA 3V5RA 1ZAWA 1SIZA 1R6YA 4M1KA 5KAKA 3H98A 1E6VA 5JXSA 1TFWA 2DH7A 3CD0A 4DR6F 2GMJA 5DG9A 3EX7B 2DGXA 2GMHA 5F8HA 1ZPVA 3CC7S 2C3YA 3IR7B 1T03A 1G3OA 1GX6A 4CO4A 1DBDA 4U9RA 4DN9A 5EGYA 1MMNA 2LA4A 2HZCA 3E2EA 3OVAA 4URGA 2B4VA 2P5VA 1HA1A 3CCRS 2J7UA 2XMUA 3SV4A 3RB4A 5B0BA 1SJ4P 1FD2A 1HWIA 1Q7YT 5KG0A 2DNRA 3J7YU 1JNZB 2V4RA 1R0AB 2HNYB 2PO4A 1HWKA 1HNIB 1U7LA 2J5AA 5ITHA 1H2VZ 4ZP6A 4J9SA 2R7OA 4KHRA 1SV5A 3HHLB 4PXEA 1N32F 2YX4A 4K5SA 5EX3A 3MR3A 3ENQA 4E8UA 1HNVB 2FHOB 1NAQA 1FRJA 5KT5A 4EYHB 1KVIA 2DHAA 3DMJB 1HW8A 2M9KA 3JTPA 4X65F 1UFLA 2CJQA 1DLOB 4UY85 4QR0A 5D78A 2DNMA 4HI1A 4UOCA 3MD1A 5KG7A 4AL7A 3EGNA 2UU9F 4EU0A 1N54B 3GWCA 3AAWB 5M2RA 5E2QA 2VQFF 4RNOA 1VQLS 3OR2A 1FEEA 3M9MB 3V6DB 2FLPA 2Y1IA 1V3ZA 4X62F 2BABA 2YX7A 4FF1A 5KFRA 1NHUA 2V9WA 4TQSA 4XAKA 5CXTA 2OPRA 3OTBA 1XC9A 1FKAF 2CPIA 3RB6A 1YJWS 2FVPA 1CG2A 1Q79A 2B4UA 1JLFB 4CNYA 4OIXA 4HYKA 1S4FA 3W2VB 4HDHA 2EK6A 2RD5C 1S1VA 1VGYA 5C42A 4WZQA 1S10A 2HHXA 3ITHB 2HWHA 3CCES 1UVMA 1DFDA 2OPSB 3OLAA 2WBMA 2R7WA 4QW9A 4KO0A 4P2SA 1GTHA 3BGFA 2XSJB 1IBLF 1ULRA 2HGLA 4NCBA 3LP0A 4OHYA 4QR2A 1M5PC 2HGMA 3IR5B 4B3RF 4QU6A 1UWBB 1FVQA 1XR7A 1TKXB 2K8GA 5I3PA 1VIOA 4B02A 2EFGA 2R2SA 3C6TB 3DRRB 4DL6A 2HRUA 2PMHA 4JBCA 2YVSA 4H4KC 2HS0A 2MSSA 5A6PA 2N3OA 3EZUA 4Y34A 4NLXA 2WONA 2HLUA 4F4KA 4B08A 3ZZYA 5KFJA 1X4AA 2A2DA 1RT6A 2FC8A 3FMBA 5KG3A 1DARA 2CQ0A 3CD5A 1JJ4A 2JLFA 2KJWA 2M8HA 4AE5A 3PJWA 2ZH7A 4MKYA 3GILA 1DURA 1VC0A 4XK8C 4NYOA 2DTJA 2YWFA 4ZHRB 2RRNA 2MXYA 4ECUA 2AYMA 3OHBA 3SCIE 2CQIA 4RNNA 1PILA 3Q2TC 1ROFA 4U6PA 4ZKAA 3BDEA 1X9MA 4XIUA 1URNA 1APSA 4Y2MA 3IXQA 2CJ9A 3DLLQ 3RRGA 2A1BA 2NUHA 2ZUGA 1OIAA 2VPWB 1HI8A 4TLQA 3K57A 4KTQA 4BC9A 2HRYA 1X4HA 5U47A 1SH3A 4HTIA 4Y2CA 4B3TF 1HBMB 1Q8BA 3VTIA 3KYLA 5HP1B 2IM0A 1S79A 2DIVA 4B3SF 3MECB 1H2TZ 4B9UA 2ZOGA 4Q5VA 2YNIB 1DZ5A 5BYQA 4WXOA 2HHQA 2FGOA 2ZC3A 1RISA 4DJBA 1BLUA 3C3LA 4K5RA 4KR0B 3MEDA 1X4GA 2IBKA 4EBDA 2WOMA 1WHVA 5HBMA 3HK2A 4F4ZA 3Q8QB 2M4MA 2HGNA 4ZPTR 1QVFR 2D74B 4IH7A 3PR5B 4PWDA 4MKAA 2ZNZA 4K4WA 2JEIA 4NPOA 1VK3A 4ZP9A 2JVRA 3TA1A 5J1PA 2I2YA 1AW0A 2EBGA 3Q2SC 4NA1A 2GHVC 3ISZA 5CA5A 3OW2R 2C22A 3LUYA 4RW4A 3V81A 3X3UA 3MWBA 2LA6A 1XTZA 3W2WB 2QMXA 2MSTA 2GO8A 2W9BA 3HHLD 5F3TA 2DR7A 2I5JA 5D4LA 4JV1A 4YDXA 1JWWA 2HVIA 2K2PA 3BZQA 3EYZA 4HHJA 4XDCA 1FRIA 5E3CA 3V6HA 2FY1A 4H4MA 3WC0A 1S99A 1BY9A 3IGNA 2XO7A 3E3XA 2GMLA 3KG4A 2XMJA 4Q43A 4LSNB 3MR2A 2HS4A 3BGRB 3HZEA 5AXLA 4DSFA 5F0UA 4DL3A 1U1KA 1HWUA 1FK9B 3JYTA 3M05A 1J5EF 5IQQA 3JSRA 1HR0F 1R31A 4WE1A 3TANA 1NZAA 5KFBA 2I9SA 4IUFA 2VOOA 1B7FA 2ZE2B 4ED8A 1GXUA 1ZM9A 2KXHA 2J8AA 3H20A 4JI1F 1RT4B 4LVOP 1MROA 3SSRA 4D3GA 4N41A 5KT4A 1NEEA 5B0CA 4DV7F 4RBVA 3FSXA 4NCGB 2MKSA 1RYSA 4DL4A 4OI6A 5A8RA 2IJFA 4Y2KA 1CC7A 1AXQA 3UDCA 2XC9A 2V9KA 3LQVA 2MGZB 3DOKB 2VG7A 2OPQB 4ECVA 2NXUA 3NMAA 2VG5A 1YTYA 3GG0A 3MM5B 2QV6A 5JVHQ 1LV5A 3HKZD 2XS7A 1NJWA 1Y5NB 1MWZA 1DTTA 1R8BA 3TVYA 4YUDA 2X3GA 1ZH5A 2VPYB 1Y4ZB 2WAQD 3OL9A 4PUOA 2FUG9 5KFZA 3QYYA 2YNFB 3PX0A 3MOZA 2CJAA 4R5PA 3H2VE 1KQKA 5GAHU 5IQ6A 5D8HB 3RAXA 3LAMA 3I32A 3L09A 4I69A 2LCWA 4CTAB 3CCQS 2J6TA 3N6LA 3CJKB 3OJSA 1L3TA 1BQNA 3CGIA 1UVLA 1YVFA 3CCTA 2HHUA 2WCXA 3GFXA 3RB0A 1PSDA 1LWCA 1IQZA 4C11A 4YR2A 2EW9A 1OS5A 3HDSA 3DLH