4PRFA

A second look at the hdv ribozyme structure and dynamics.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords Hepatitis Delta virus ribozyme
publication title New tools provide a second look at HDV ribozyme structure, dynamics and cleavage.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4prfA00
1R8PA 5D77A 3MUMP 2JVOA 3K0JA 2LXIA 4WCEQ 3BEGB 2CQIA 1VBYA 1RKJA 1NJIT 2FC8A 3G6ES 2XNQA 1VQNS 1HD0A 4PKDB 2N3LA 3CCES 1WEYA 2MKJA 3CCSS 3G96A 1X4BA 2OJ3A 5DM7Q 2JVRA 4WF9Q 3V4MA 1X4GA 4PRFA 3FEXB 2DITA 4UQTA 2DNLA 1F9FA 2E44A 3LPYA 1VBZA 2L41A 1VQKS 3THTA 3BO2A 1SJFA 1W2BR 3SDEB 4Y00A 3PIPQ 2M2BA 4Y0FA 1FJEB 2CQHA 2LA6A 1QM9A 2CPZA 2DGWA 1U1PA 2LKZA 2PE8A 2DNKA 1UAWA 3Q2SC 2XNRA 3R1LA 2F3JA 3TP2A 2LQ5A 4CH0S 5LSLA 2MXYA 2D9PA 1X4EA 1Q86T 2G0CA 1WHVA 2MZQA 3CXCR 1X4FA 5JVHQ 3CUNA 1X0FA 1D9AA 3UD4P 5GAEU 5DDPC 2MSTA 3G4SS 4YB1P 5CYJA 1VBXA 3LQVA 1VQPS 1VQ7S 3G8SA 1FXLA 2M4MA 2DNQA 2FPHX 3L3CA 1H6KX 2RU3A 2MQNA 2ZJRQ 2HGNA 4RU2A 2HVZA 4LJMA 4TLQA 2DK2A 1M5VC 1SJ3P 2VOOA 1HL6A 2J76E 2M88A 2DISA 1U2FA 3DXBA 2VONA 2RVJA 2LMIA 2MMYA 1KD1T 2OIHA 2L08A 1DZ5A 1H2TZ 5DETA 3G9CA 2MGZB 2ZJPQ 2RRBA 2QFJA 2LA4A 1K9MT 1NU4A 2YWKA 3CCUS 2CQPA 2XS7A 2RS8A 2F9DA 1WI8A 1AUDA 4W92B 2KRBA 1DHMA 3U1LA 3FEYB 3D2WA 1OPIA 1R8HA 2DH9A 1U1KA 4F02A 4IOAQ 2MKSA 3P5TL 2DNPA 1P1TA 2XSFA 2OSRA 1FO1A 1M90T 1M5KC 2YH1A 2DGSA 2CQ2A 2YTCA 3SMZA 3J7ZT 1M1KT 1HA1A 2AYGA 3CC4S 3EGZA 3TYTA 3CC7S 1ZH5A 2O3DA 2WBRA 3B4DA 2N3OA 2DH8A 3S6EA 3S8SA 2YKAA 4P6QA 2CQ4A 2KN4A 2E5IA 3I56S 2GO9A 3HHNB 2MYFA 3ZZZA 2KXHA 2MKCA 4UY8T 3VAIA 5EN1A 3CMAS 1D8ZA 3B4MA 2CPJA 2MY8A 1WF0A 3US5A 3NNCA 1X5PA 2X1GA 2D3OR 2OTJS 2DGVA 5GAHU 4A8XA 2KVIA 1PGZA 3UWTA 1XN9A 3CTRA 2CPEA 4FXVA 3R27A 3MUTP 3UD3P 2MHNA 1QVFR 4QU6A 4TU7A 3RW7A 2DNHA 2CQ1A 2F9JA 2A3JA 1ZZFA 4WKRA 5HO4A 1WEXA 2EVZA 1K8AT 5CXTA 3NS5A 5DDOC 2QEXS 1U1OA 2X1AA 2ERRA 2KI2A 3EX7B 2DNOA 1VQ9S 1L3KA 1YWXA 2DO4A 2KXNB 2KHCA 4YUDA 1G2EA 3UCUP 1SJQA 1VQ5S 3CD6S 1WELA 1K73T 2AYEA 4WFAQ 2M0GB 2LYVA 1VQ6S 2E5GA 4IO9Q 2DGOA 2AD9A 2XB2D 3MXHP 2CPDA 2DHXA 1S79A 1Q7YT 2K8GA 2K3KA 2MQPA 2YH0A 3VAHA 3P3DA 2LECA 1M5OC 2J0SD 3S01A 4W90B 1OO0B 5LJ5Y 2DH7A 3J7YU 4CQ1A 2ZJQQ 3RW6A 5IM0A 2I2YA 4TU8A 3HI9A 5HL7Q 3I55S 2CQDA 1YHQS 4C0OC 2Q79A 3CULA 2MY7A 3THPA 2GHPA 1BY9A 3MI7X 2RUGA 1DBDA 2M8HA 1SJ4P 4BS2A 2EK6A 4QU7A 2AYMA 1FT8A 1KQSR 5H1SV 2ADBA 3CCLS 3VALA 3BO4A 5JVGQ 2MQLA 2LEAA 2AYBA 1WI6A 2KYXA 2OTLS 2KH9A 1RK8A 2DNNA 2MB0B 1UP1A 1URNA 2RQ4A 2KFYA 3CCMS 2LEBA 1U1MA 1FJ7A 1FHTA 1WHWA 1Q82T 3ZZYA 1WF2A 4FXWA 2DGTA 2FC9A 3VAMA 1FJCA 2HGMA 3CMES 2VODA 1VQOS 2M9KA 2MJUA 1N8RT 3Q2TC 4IOCQ 1QVGR 2KU7A 3TO8A 1YI2S 3SDEA 2HYIB 4QPTA 1VQMS 2RT3A 2DNZA 1CVJA 5CA5A 2QA4S 2M70A 1VC5A 2RS2A 2KM8B 1X4HA 2I38A 2BZ2A 1H2VZ 3MD1A 5D78A 3CCQS 1VQLS 4CH1A 5DM6Q 1U1QA 3PIOQ 2PEHA 2DIUA 1N54B 2N82B 2XS5A 1UW4A 2E5HA 5DDRC 1WG5A 1ZZNA 1X4AA 1UFWA 4J5OA 3BS9A 3S7RA 2KXFA 2FHOB 2FY1A 4QQBA 1WTBA 1HD1A 2MZJA 2CQGA 3IRWP 5GAGU 1U1LA 2J8AA 3H2UB 3IWNC 3CCJS 1X4DA 3CCRS 1X5OA 4ED5A 1YJ9S 2CPYA 3SXLA 4LIRA 4C7QA 2E5JA 2ADCA 4OZ1A 2N7CA 1OWXA 2DGQA 1SJRA 2MGZA 1YJWS 1KOOA 1JJ4A 2MJNA 1N52B 2CQCA 1O0PA 1M5PC 3VF0B 5GVQA 4IUFA 5FJ4A 1VQ8S 2MQQA 1WG4A 3MOJB 3JB9k 4PR6A 2XS2A 2MZ1A 3MUVP 1U6BA 2M8DB 2SXLA 2DNYA 1PO6A 4U67Q 4EGLA 2RQCA 2L9WA 3R1HA 2CQBA 5MLCV 3UE2A 3H2VE 2CPIA 4OZ0A 1DRZA 2MPUA 4WFBQ 2MKIA 2JWNA 2CPHA 2DO0A 5BJRA 3U1MA 1U1NA 4WIIA 1WWHA 4YOEA 3EGNA 2CPFA 1JJ2R 1H2UX 1U6FA 2DIVA 2BOPA 4F25A 2MQMA 1FNXH 2LCWA 1IQTA 2MSSA 1WEZA 1YJNS 3UCGA 2MQOA 1VC0A 3CPWR 3CC2S 3UCZP 2JRSA 3NS6A 4CIOA 3OW2R 1WG1A 5LJ3Y 2DNGA 2V94A 2DHAA 2DNMA 5GADU 1S72S 2MKKA 2DNRA 2MZTA 3VAJA 2U2FA 4V19X 1P27B 3NNAA 3P49B 2KM8C 1VC6A 2NLWA 2CQ3A 3ULHA 2LXUA 1YIJS 3N9UC 2CPXA 3P6YC 2OSQA 5IQQA 3CCVS 1WHXA 2HGLA 1YTYA 1KC8T 1A9NB 5GMKa 1X5TA 1N88A 3G8TA 3BO3A 3NMRA 2MZSA 3DLLQ 5LXRA 1KOHA 2RNEA 1NO8A 2RRAA 4ERDA 2VOPA 2X1BA 4WFNQ 4LMZA 2DGXA 2M7SA 4Z2XA 5LXYA 3NNHA 2B0GA 1WF1A 2DHSA 1JJHA 2J0QD 2M52A 2HZCA 1VQ4S 1U1RA 2D9OA 4M5DB 2EK1A 1Q81T 2DHGA 2DGUA 2CJKA 2X1FA 2NZ4A 3VAGA 2KG1A 2U1AA 3G71S 2UP1A 3MDFA 1X4CA 2G4BA 1WHYA 1X5SA 1SXLA 5LSOA 1B7FA 2JX2A 1JMTA 4TU9A 2DB1A 5IFMA 3MURP 2KRRA 3CF5Q 2KG0A 5IM0B 2MZRA 2MKHA 2G1DA 1A7GE 2CQ0A 3VAKA 4ZKAA 5ITHA 1YITS 3MD3A 4F26A 1OIAA 5DDQC 3VAFA 4C4WA 2KT5A
chains in the Genus database with same CATH superfamily
1R8PA 2Z56B 4A8KA 2QV6A 5LT5A 2B8QA 1AYEA 2IIHA 4DMZA 2BV3A 2V9WA 4CLKA 2ALZA 4LSLA 2JEFA 1U47A 2Y8WA 5DM7Q 3M9MB 7FD1A 1KTQA 1RHUB 1UKUA 1RBLA 1ZS6A 1S1UA 1EIYB 1NKBA 3FZ2A 2LKZA 1WC6A 1PC4A 3PM9A 5HROA 2LQ5A 3OLBA 1T03B 1H98A 3VGSA 5JVHQ 3P5BP 1H3DA 1TL1B 1U09A 3DMJB 1YGYA 2AEJA 1TQLA 2YPZA 2F8EX 1H6KX 4AT1B 3CJKA 5ETVA 1HHTP 3BGUA 3A3OB 2AF6A 3D66A 5HSPA 3C6UB 2BJ8A 4KKOA 2MGZB 4ER8A 3V6KA 4QIEA 1SUQB 1UEUA 2FVCA 2XO7A 3U1LA 1GXUA 4AL6A 2JH3A 4OI6A 4G1QA 3P5TL 5B0FA 1HR0F 2EEYA 2OEMA 5F8NA 3ITHA 2CQ2A 1FFWB 2ZH1A 1BUXA 2BE7D 1LWEB 1N6QA 3CC7S 4HACB 5D0RA 2CQ4A 3C15B 4CLTA 3HHNB 4RNFA 2OKQA 3VAIA 2AW0A 1HWLA 2MY8A 1HPZB 4OYAA 1TK0A 4TYBA 3IP0A 2DRAA 2ZH7A 4F36A 2MHNA 2ZD1A 3OLAA 3RW7A 4TN2A 2CIMA 1RAJA 3V6DA 3MOZA 1AW0A 5CXTA 3GIRA 3EX7B 1UVKA 1PSDA 1RWPB 4NLXA 2R2UA 1ACMB 2J9CA 2M0GB 4MFBA 5J1EA 1FA0A 2DHXA 4OJGA 1JKHB 4WZQA 2VFUA 4QW9A 1XMOF 2HQCA 4DV7J 2CQDA 2Z30B 2Q79A 3Q89A 1XERA 2R2RA 3ISZA 3OR2A 2PEBA 5H9FJ 4ZLLA 3O3LA 1NDPA 1RBAA 5KT5A 3HVTA 1QUVA 4IQXA 2RJZA 1L3SA 4ES1A 3DLJA 1FKOB 3RBDA 2MJUA 3Q2TC 1U6ZA 3M7VA 2KU7A 1YI2S 3SDEA 3IBFB 3NGRA 5DZ7A 2W1BA 4ZVEA 2HYIB 1RCXB 5A8KA 3UVJA 4DL6A 1LWFA 2BJ7A 5D78A 4WTOB 1BMQB 2NREA 2PEHA 2Y8YA 3TA2A 3M8QB 3AOCA 3HZGA 3R5GA 5DDRC 3CW2C 2QLFB 1CC7A 1D9FA 3T41A 1TFYA 3HDSA 1F9EB 2V4RA 1DQ9A 1X7VA 5AJ3J 1RT1B 2CQGA 3GILA 4X4UA 3UDVA 4FYDA 4RO0A 1BXNA 4NLWA 3M8ZA 3U1NA 4DX8H 4ZP8A 2V2QA 1JLBB 1T11A 2N7CA 3UNGC 3F41A 2CQCA 1U0HA 3A3PB 4UZCA 3CJSA 4DR3F 4Z37A 2HHHJ 1RADB 3GR1A 4OZLA 4QIVA 3KLEA 1FI4A 2OELA 3DLBA 4ELTA 1HBNB 6FD1A 2NXEA 2V50A 4PXDA 2CG8A 3JQJA 2CPFA 2FJEB 2MQMA 2VBZA 1H73A 2MQOA 3PKYA 3KLHA 2IM0A 2H3EB 1X31C 3NBPB 3PR4A 3A12A 2NXCA 3MMJA 1B0PA 4M5GA 3M6VA 4O3OA 3ZNJ1 1NLKL 2XY5A 2LXUA 4ZN3A 2HQGA 3P6YC 1Q0NA 4HEA9 4O0NA 4DLEA 1QAIA 4QR2A 2ZC3A 2Z2YB 1S9FA 2OHDA 1JLEA 4ERDA 3MEGB 1Y3JA 4LMZA 3PG9A 2ZNYA 4A8OA 4P72A 4D3GA 4JOUA 3DFEA 2R7SA 2G4BA 1C1CA 3NGDA 5M2RA 2BR0A 2CDQA 5LM7E 1DTQB 2FVQA 3H5SA 4ANCA 3RUBL 2CNKB 4Q5VA 3Q23A 2UV8A 4Y3CA 2C1EB 5EX3A 2XY6A 3NEKA 4WCEQ 3G2XA 4X4OA 1VBYA 4NMXA 4HTJA 4O3PA 5CYQB 3CCSS 4GKKF 2GNKA 3HHLC 5KFFA 1MMLA 2GCFA 4PRFA 1R7IA 4GKJF 4YB5A 4DI6A 1Q78A 1JLQA 1UVIA 4QR0A 1TL4A 1UA1A 2DVIA 4P52A 4O44A 2COLA 1QAXA 2DXEA 3GFYA 1EX8A 2GGPA 1T05B 2YKQA 4A8MP 2ZJRQ 1H74A 4DR7J 3KG1A 3FZBA 4WXOA 4JI7J 3R6LB 2CNOB 3IGVA 2DISA 2HQDA 4JI4F 1DZ5A 3G9CA 2YNGB 2RRBA 2XS7A 1GMWD 2C22A 1RT6B 1A0OB 3FBEA 3VCDA 4UTGA 1HYSB 4DV0J 1S6PB 1M1KT 1ZH5A 2CWKA 1PYOB 1JLAB 5J2MA 2YKAA 4N41A 2ZE2A 5DQHA 5EN1A 1TL3B 3SV3A 3TJ9A 3D5MA 3JSBA 3UWTA 3CTRA 4N76A 4FXVA 5F9NA 5KFOA 3RTVA 2DRBA 3GTYX 1HBOB 4QIGA 4USUA 1XR7A 1IBCB 3M6XA 2KI2A 4I4BA 2YKOA 3CD6S 2OPQB 4WFAQ 2EI5A 2J7WA 2BJ1A 1S79A 2QA1A 1M5OC 3MMCB 4FPRA 5K8OA 5BR8F 3HT0A 2MY7A 4YHHF 1BY9A 5T7LA 3OD2A 3I0SA 3DM2A 1FT8A 2XY7A 4BC7A 2RIJA 3MMBB 3T9NA 1SPBP 1WTFA 4KH1B 2FY8A 2W2OP 2HBRB 2P2CB 1U1MA 2DCLA 4JI2F 1SH0A 3M8PB 3TO8A 2OI2A 3FSIA 3OJUA 2RDJA 1QSSA 1CPZA 1RAEB 2Z2LA 1S76D 3PJXA 3I0RB 4ZJQA 4DLGA 3CD5A 1ZZNA 1X4AA 7AT1B 2I5JA 2R2TA 4QQBA 1RBOB 4DL5A 2EFQA 1YSJA 1U24A 3HPOA 2Z2MA 5DGBA 4ED7A 1VCTA 4QPXA 1DJ0A 2OEJA 1N5YA 1NK9A 3HM9A 1KOOA 5E41A 2YVSA 1YJTA 2YKMB 2B4VA 1M5PC 4G1IA 3NGKA 4IUFA 2ABYA 1QE1B 4K4VA 5B0GA 3MUVP 3OT9A 3Q83A 1VR6A 4WP8A 2M8DB 6FDRA 4YS2A 1W26A 5DS7A 2ZVIA 3D1OA 3H2VE 4OZ0A 1Y5LB 3MPYA 1OYDA 3TNVA 2DO0A 3U1MA 3J81U 4RW9B 2R8HA 3B6BA 2AX1A 1FNXH 4ZIVA 4U6PA 4DG1A 3KXDA 4PG4A 2FGCA 4CIOA 5I3QA 3OW2R 8RUCA 5I3UA 2FUG9 4LVOP 3NRBA 5BYSA 3DGPA 3VWSA 2HVDA 1H7XA 3AQPA 2CQ3A 4CCHA 5F8MA 1NDCA 2Y1LB 3W8PA 4KHMA 2B4PA 4ECQA 5HQMA 2J0XA 1EQMA 1BWVA 4OJ1A 4EZ6A 1RU1A 4JBCA 3S1TA 3T5HA 4RW6A 1NH7A 2RNEA 4A48A 1KFDA 2RRAA 1R6VA 3GU0A 3PR5B 5IC4B 1EKRA 2YKNA 3VVUA 1PAEX 1MN7A 4R5PB 4OI0A 3FMWA 2CJKA 3LTOA 1SXLA 3ILJA 3OL6A 2HHWA 3X3UA 3QLHA 4ZKAA 5F8HA 3HXMA 1JWWA 3MD3A 5L39A 1ZTWA 4PEOA 4H4OA 2JZ5A 2XMMA 2K3IA 4DUYF 2DD8S 2EFNA 2HHQA 3DDKA 4DV7F 3MEDA 4IR1A 4DSIA 1UZHA 3T1AA 4EYHB 3LP2B 2CZVC 3LGNA 1X4GA 2V2KA 1VDHA 3EE3A 2BKNA 1F9FA 2OLWA 1AB8A 5BYRA 3EICA 1SJFA 1NJZA 3ILLA 2GVZA 3GJSB 1RHKB 3AXKA 1QM9A 3PX4A 3BR8A 1FTRA 3QQCD 2HNZB 2NR0A 3CJ2A 3TQEA 1D9AA 5GAEI 2I6WA 4ITSA 4CLUA 3TAPA 1VHFA 3G8SA 2FPHX 1N5VA 4EFAC 3M8YA 3D0GE 4K4SA 4DL3A 1N48A 4RNHA 4B17A 2Z4PA 5AJ3F 1BWEA 4J9PA 2M5YA 3EZ5A 2LDYA 5LMUJ 4B08A 2VQEJ 3FBCA 4FXDA 1VMBA 4W92B 3FKBA 4RL1A 5LL6d 2RHSB 3DRRB 2MKSA 1N36F 2DNPA 2HEKA 3CJ0A 1FJGF 2OPRA 2DH8A 3S6EA 4URQU 1M1HA 4JUZA 7FDRA 5KFHA 3MR3A 3K89A 1HNIB 4HR2A 3G87A 1JQGA 1PGZA 5HQLA 3LWMA 4AE5A 3M30B 3R27A 3AODA 3MUTP 4P71A 4Y65A 1RT5B 1Q79A 3PNIA 2V8VA 3FJ2A 2D74B 4DOZA 3CDUA 2C2ZB 1VQSA 3DRSB 1L3KA 1CJKB 3JQMA 1UJ4A 2VF3A 3BJYA 5CD4H 2ATCB 2ILZA 2R42A 3GV7B 4W90B 3W66A 3I55S 2YQ1A 4PWUA 2R8KA 4K4WA 2WOMA 1KVJA 3FSYA 2CJAA 2V69A 2AJQA 4XAKA 5KG6A 4YB6A 4LFCJ 2KFYA 4PPDA 3D28A 3O6QA 4NA1A 3NAHA 1OQ6A 5IXUA 1FJCA 5CYMB 4ED8A 1WORA 1Z2ZA 1TL7A 1CQNA 1D9DA 3KG4A 1RT2B 2V67A 1VQMS 2YXLA 2QMUB 2DR8A 2GHWA 5C25B 3QIPA 4NRUA 2Z8QA 4CH1A 2R8GA 3MM8B 3BM7A 4WZMA 2XS5A 2ZH5A 4ZVGA 2P9CA 2KXFA 3PFOA 4LF5F 4XDDA 4QCLA 4NXNJ 3JSMA 2J8AA 3CCRS 2R3VA 2VKRA 1RT7A 1RISA 3MR5A 2P6SA 3BGOP 2Q3PA 3K17A 1VLYA 5J2PA 2UUBJ 2XS2A 5KFYA 1VK8A 2FJBB 2RF2B 4U67Q 1NK5A 2ZUAA 2ZKUA 4J9QA 2CQBA 5KFPA 4ZPAA 4DR7F 5A6WA 1AA1B 4NMLA 3TAMB 4Q8FA 1F5AA 1VK3A 4I7FB 2E1AA 2LFVA 2ZFHA 3GJTB 1JXLA 5FIIA 2NYIA 4OJ3A 4DUTA 5J2NB 1LFWA 2NPFA 2XMTA 1U7LA 4ZJLA 2DNGA 1QSYA 1JLGB 2O5DA 4LF7J 1LW0A 4HDHA 4DV0F 2AU0A 1PYSB 2GHVC 2BRKA 3MM6B 2HVHA 4IYQA 2W01A 4PPZA 1LKZA 2CPXA 1TVRA 2K7KA 4UOHA 3QMQA 1SC6A 4ICLB 4WK3A 2VICA 5CH7B 3BBCA 1FD8A 2IA6A 1YRUA 3RBZA 3KJQB 3D3BJ 1JJHA 4K4UA 2EWHA 3MGJA 4PYAA 2A0FB 2EFVA 1G1XA 4JP8A 3D6MB 1NK8A 3QZ7A 5HBMA 2MKHA 1J27A 2G1HA 3QNWB 4LR9A 1S0VA 2B4OA 4ELVA 3QJPA 3EVMA 3E51A 3KK3B 2ROEA 4EEYA 2ZHOA 4PKDB 4WKYA 1VBKA 3FEXB 2DITA 3FRZA 1PJ5A 4WJBA 4GVLA 5A8RA 3LP0B 2WTFA 1NXIA 5LMNF 2IM3A 1TKDA 1TZ0A 3N6NA 5SZTA 2BE2B 2QG9B 1TELA 2FZGB 4ZCKA 1B3TA 2LQJA 5IT9Y 2BABA 3RR7A 2A2DA 3GR0A 3GQCA 3ET6A 4QIFA 2OD4A 1AFIA 3R8YA 5BXIA 3GIKA 5DETA 3PYFA 2FVSA 1D1UA 2CFXA 1FDDA 1L3VA 1XNRJ 1GNKA 2C2EA 3ETMA 4N47A 1TKTA 4EYIB 5K9FA 4F4YA 3TYTA 2AIRB 5E2QA 2J6TA 1RU2A 5HVFA 3U7JA 1EZZB 3VVTA 4ZMMA 3IWXA 1IUJA 1X5PA 3HKWA 3BH7B 4OHXA 5CAAA 1C0UA 1RT2A 1UWAA 3SEOA 2IAJB 1JIHA 3GJQB 4B3OA 2E1PA 2FVPA 1EP4A 4F4XA 3NMAA 3BKUA 4ETZA 4L76A 5ETNA 3MM5A 1KNZA 3PDNA 2GC8A 3CCWA 5THWA 2W9CA 4USVA 1HQUA 2AEFA 4I2QB 4CM0A 3UDCA 2C28A 2QLJB 4K2JA 4FVMA 1WOPA 4KH0B 5IM0A 3HI9A 2V4QA 3H59A 4W98A 2ZH8A 5D3GA 5HMYA 1IM4A 3B78A 2GMLA 1KQSR 3TX8A 3VALA 4LF9J 3HHEA 2AZ3A 4WP3A 2BYCA 1V3RA 1NKEA 4OZ2A 2DGTA 3OFFA 4R8UB 2ZH9A 1CJVA 1K0TA 4WFZA 3QT6A 4OX7A 1NJWA 4I7FA 2Z2ZA 1NPRA 1YQHA 2KM8B 1NUEA 1RGVA 2BZ2A 4O3RA 1UFKA 1FKAF 3MF5A 3CB4A 2OUGA 2WVEA 1FF2A 3RZAA 1PILA 2WVBA 1UFWA 1XWLA 1L3TA 4J9MA 3LPEA 4DCJB 1WTBA 3W5XA 4EZ9A 3MAAA 1T9XA 2CNLB 3EPIA 1B70B 2VDHA 2M3DA 4B9NA 1WKJA 5D4OA 1T94A 3HHDA 4IFYA 4FF3A 1QSLA 2RHQB 1ZM2A 2HRTA 1YJWS 2CJQA 3ENAA 3EMTA 3I9ZA 1O0PA 5GVQA 2MQQA 4DR4J 3IXQA 3DRYA 1PO6A 4ZVHA 2B9EA 4Q44A 1IKXA 4PABA 4X4PA 4JI8J 1TAQA 3AH6A 3UE2A 4KAIA 4EI2A 4Y34A 1GTEA 2JC1A 4I2PA 3PO5A 3KK2A 1JJ2R 4KPYA 4YQWA 1KLMB 1DAXA 1S1VB 2RD5C 5ETLA 2VQEF 5KTQA 2C3MA 3BPDA 3CPWR 3QGPA 2GQCA 1TUGB 2DHAA 4XPCA 2F4VJ 4NASA 5ETQA 3MR6A 3DLKB 4CLLA 3LAKA 2JJ4D 5ETSA 3M32B 1RHMB 2V2VA 1O6XA 4Z7YA 1TR0A 5B7WA 3UR3C 2HNDB 1U2RA 4ZVPB 5HJYA 2HNYB 3GZ7A 5J2QB 3H20A 3DLGA 4UF4A 2BQUA 2ZNZA 4RW7B 3RAXA 2BANA 2XMJA 4FYYB 2VL1A 2AJ2A 5U47A 3FCWA 2YX4A 4USMA 5C2CA 4OYIA 2RAQA 3GCXP 2GAHC 1Y9OA 3LGHA 4DF8A 1PKUA 2MDAA 5D8HB 1FRXA 2GW8A 5D77A 2E66A 3EDRB 3RJMB 4N7TA 4ZCMA 1JLFA 3TRGA 4ED4A 2ZHAA 1VQNS 1TKXA 4LSNA 1HW9A 2ZEJA 2GO8A 1TAUA 5A0YB 2V5HG 2OJ3A 2B7BB 4ZCIA 3IM8A 4XK8C 4MKAA 4LFCF 4C8OA 1S57A 4DL2A 2VG5A 2CQHA 2YKPA 1IKWB 3KDOA 4NLYA 5KFKA 4DSKA 2CPZA 1U1PA 1HNZJ 2PE8A 1S1WA 2W2NP 1FVQA 1VGYA 2VG6B 5KG1A 5A6PA 4DCOB 2G0CA 2IAJA 1X0FA 4X66J 1IXKA 4C3KA 3LQVA 2W25A 3DU6A 3I87A 4NL5A 4TLQA 2QRRA 2HW3A 2YBVA 1O5JA 1IWAA 4L73A 4HTIA 3M2VB 1J5EJ 4NXNF 1NZ8A 3LP1A 2LDIA 3IA0A 3EPGA 4PXBA 4USJC 2OPSA 2HMIA 3GFXA 1KKHA 1Z1ZA 4L75A 5F0WA 1L3UA 4C8ZA 4CRJA 2K06A 2J7KA 1M90T 1V5VA 2YX1A 4GO7X 3J7ZT 3Q0AA 1S1XA 4P6QA 2GO9A 1G3OA 4J9UE 1V5IB 3OSPA 3UD5A 2OTJS 1YRXA 3TI0A 4MKBA 2LU2A 1NJXA 1XN9A 2PA3A 1CS4B 1RKIA 4CO5A 4F50A 1F6TA 2VBYA 4NPOA 2UUAJ 4N56A 2UXCJ 3OSNA 3CNQP 2IA0A 4KRWA 4K4TA 3E01A 1SKRA 1TL5A 2LYVA 4U96A 1VQ6S 1CULA 3O1LA 4F04B 2YNHB 1P9YA 1T9WA 3IRXA 3VQSA 2FZKB 5HLFB 4FYWB 4Q8EA 4OX9J 4CT8A 3CDEA 1N56A 2J7UA 5JVGQ 2H48B 4RBVA 9ATCB 3K57A 2EFGA 2KYXA 1LK7A 1RXOB 5KFTA 3HJFA 1UW9A 4JI3J 2UXDJ 1FJ7A 4F4ZA 4EBDA 4CLWA 3MFIA 3L9ZA 2QC3A 4TY9A 4OI3A 1NCLA 1YG0A 4USWA 4PXEA 3QFWA 3LAMA 2JFDA 1ICEB 3A1YG 3KLFB 3AA9A 4QPTA 2N4DA 5T14A 2QA4S 2EKNA 1N32J 2M70A 4C9DA 2RB7A 4A46A 4WWSA 3OTBA 1SH3A 4E0DA 2XLIA 4RPFA 4J9VA 4I67A 1WDTA 4KT0C 4MKYA 2UXBJ 3BQ1A 3CJ3A 3M32A 4OYXA 2G0JA 4L3NA 3ELHA 1LW2B 4CLPA 3VGVA 1PJ6A 1SC4B 3ETOA 2E7VA 3CEDA 1RTIB 2HRUA 1IJEB 1WG4A 4G6VB 1HBMB 2OP5A 2SXLA 4AL5A 4EGLA 3F0NA 4M5LA 2UUTA 3WZ0A 5C24A 2A2CA 5B0BA 4OJHA 3OTDA 2IRYA 4RUBA 2FHMA 3UFCX 1C0TA 4KHRA 2HZAA 5D0EA 2V34A 4ZPBA 1U25A 5B0DA 3RB6A 2BJEA 3PHTA 3UN2A 1VIOA 3AHPA 2QLBB 1SIWB 1S7HA 4ECXA 4M63A 3JYTA 3IAM9 1RZMA 1HNXF 4ES3A 2DY9A 4IFVA 2GQQA 3J80Y 2DPIA 3EGVA 3LW5C 1VRUB 2B0GA 1GMVA 1TUVA 3HULA 4NCAA 1UWBB 1I94J 3HSJA 4NRTA 2FLPA 1FK9B 2XYPB 3M1VA 4ZDNA 1BQNA 3DHWC 3ADAC 3MEEB 4F0KA 2GZOA 1NMEB 2GVDB 1KVKA 1AT1B 2JL9A 3JAMY 2LVWA 1ZA2B 3MMAA 1S9EA 2KO1A 1S6QB 4IH6A 4KO0B 4B9TA 2VH7A 1T9YA 2LQBA 4ATNA 1FE0A 2YNIB 4KB7A 4PG6A 2NUUG 4DV5F 1BQMA 4LF9F 2G13A 2HK3A 3QO9A 3FBFA 2KYZA 4ED2A 4ZVSB 2ZDPA 4DR6J 3TJ8A 3QSIA 2DNKA 2XNRA 3G86A 2MXYA 1CS4A 1AROP 5DO2A 3CUNA 4QOTA 2GQ2A 4YB1P 2XZDB 5E3PA 2W2MP 3PHEA 3MR2A 2MQNA 4WFXA 4U8VA 1T02A 3ZZOA 3KKFA 1SQGA 5HAOA 3DXSX 1EJ7L 4UOCA 2IYGA 2MMYA 1Q16B 2F4FA 1U45A 1S59A 3LF0A 3MCOA 2CQPA 3SQGB 2KVQE 1S49A 3D4JA 1IR2A 2KZMA 4LVNP 2VIHA 4F02A 2GX8A 1FNMA 2XSFA 5IWAJ 1RTJA 1E6VA 4NE9C 3MWBA 3QPIA 4DR4F 3EGZA 2R7UA 4LRDA 1IKVA 2VC1A 1N0VC 2KN4A 5JUMA 1ZM3A 3LWLA 4JI8F 3ZZ0A 2E9RX 1D8ZA 2CPJA 1RTDB 4F0MA 5GAHI 4A8XA 1KLNA 3C14B 3MPUB 2B6AA 1V3ZA 4QU6A 4DU8A 3R5AA 4OYBA 2C3PA 4B9VA 2NXNA 2CQ1A 5KFBA 1FCAA 3W62A 5JXSA 1HMVB 1RWKB 5EWGA 3EM1A 3C8YA 1G2EA 2F4VF 4M5DA 3GYXB 4L3KA 1I3OB 1FRJA 3W60A 3EYZA 4IO9Q 1MMDA 3ENWA 3L7UA 3P3DA 2YWFA 4WTYA 4KFBA 4CQ1A 3MPDA 1VIXA 4TU8A 5IZHA 3KOAA 1J5OA 4WIQA 3CULA 3K59A 1T3OA 1DLOB 4ID5B 3W7BA 2QO3A 2ADBA 2HS3A 4O4GA 1YZ7A 3I5BA 2AP6A 4MH8A 2P9GA 3T1HJ 1WI6A 2VBXA 3PXGa 4DEZA 2NYHA 3KLIB 2LEBA 3BDPA 2ZBRA 5E33A 3PRVA 1WC1A 3TVZA 3LA0A 4ZPCA 4DUZJ 4QIWD 4LBHA 4J9KA 3H4BA 1CJTB 4TYAA 5KT7A 2IVMA 3KHHA 2ZH6A 3LO3A 2KHDA 4IG0B 2A1BA 2XC9A 2N82B 3RBEA 1XNQJ 3DI6A 2IM2A 3W2VB 3C16B 4KGKA 2IC3B 4I64A 5IT0A 4IQMA 3HMJG 5GAGU 1U1LA 4CLYA 2HBQB 1J2VA 3IWNC 2ZITA 4A47A 1N33J 1OWXA 1HNZF 2JDJA 4A8WA 3KLGB 2ZZTA 5E3AA 2AV5A 1MROA 2G2OA 4UY85 2MZ1A 3W9JA 4X66F 1RA7A 4DX5A 1EKSA 2FLLA 1Z2LA 2CG4A 2XYGB 3V4IA 4ZVRB 1WKLA 3D9BA 3OFGA 5ETOA 1FERA 2IVYA 1J5EF 4YOEA 3OR1A 1TMMA 4G3IA 3TANA 4KBIA 2DPJA 2V9KA 4WU3A 2QSWA 4ED6A 3D3CJ 1R3NA 4A8QA 4C6AA 2XEXA 2V94A 4J9OA 3SCJE 5C5JA 4RX6A 5GADI 2DNMA 2HWTA 1U26A 1RAIB 1XTZA 1MWYA 1P27B 2D69A 2KM8C 3RRGA 1NEEA 4YR0A 3BGRB 3ULHA 2R7QA 2DXFA 1G7CB 2CRLA 3TZXA 2CZ4A 1H38A 1X5TA 1Y0HA 1T8EA 1NO8A 1NK6A 1IN0A 5CQGA 4CZCA 4ZP6A 3BN7A 4U7UK 2CJBA 2D9OA 3CMQA 4Z7CA 3Q8YA 3M2UA 3Q24A 2UXCF 1WHYA 4HT5A 5LSOA 3DCAA 5IFMA 2KG0A 4LF4F 5FDLA 1RTHB 1Q5VA 3P45B 2Y1JA 1IBKJ 1E6YB 2CQ0A 2VPYB 4ETXA 3NOCA 4USIA 2QZ8A 4JV1A 3MZIA 3POTA 3DOLB 1FNOA 1ULRA 3D1HA 2FC8A 4F67A 4F2SA 1KONA 2HKEA 2B43A 4OX9F 4PQUB 1RI7A 4AFFA 3ZFVA 4WF9Q 5ETKA 4X4RA 4DV4J 1GXLA 4UQTA 2UUCJ 3G82B 1UVNA 3BO2A 3AB4B 4JI3F 3NCPA 6AT1B 1SV5A 3A3NB 5G0RB 5HANA 1MWQA 5AT1B 3ZZTA 3QT8A 3NS7B 1TUWA 3BKTA 4WE1A 3GSIA 1S0MA 5K20B 4LF1A 3J7YI 1X4FA 3WQPA 4N5SA 1N32F 3TWZA 3KK1B 4KJIA 2AKWB 1RT4A 3FCHA 4Q45A 1FRKA 1VQ7S 5RUBA 1FDBA 3I32A 1M5VC 2Y0SD 2W8LA 3W2WA 2OFGX 4RW8B 1KD1T 3N28A 3MAQA 1H2TZ 2FIUA 2PMWA 4H4MA 1WC3A 4DL4A 3DDNA 2XZWA 4Y2KA 4ZITA 1DHMA 1OPIA 1MN9A 4LREA 3HHLA 4Q2MA 1VLOA 3IM9A 3JS9A 5HMXA 3F44A 3SMZA 2NXUA 4Q0BB 4P73A 2AYGA 3ZTPA 4UUXA 2DHHA 1APSA 5L1IA 3MM9A 1ITPA 2E5IA 3EVOA 4OV6A 4QWDA 3NNCA 3IAS9 2VHGA 2X3DA 3TA1A 4H4KC 5L1KA 4ED0A 1CJTA 1QVFR 4ECSA 4DDFA 4GVBB 2A3JA 2ASLA 1YVFA 3A8EA 4UZBA 2ZH3A 2EXUA 3RAQA 3UCUP 1YJRA 2GIFA 1RB0A 1OY8A 3PEJA 1K73T 2AYEA 2NQPA 4FNHA 2KJVA 3WIVA 2ASYA 3C6TA 4EUVA 2XMKA 3VZHA 3SQOP 2ZOMA 4L6V3 3S01A 4OX6A 1ZA1B 1DTTB 4DSEA 2ZDOA 1S4FA 3M05A 2LEAA 2QMWA 2KH9A 1I94F 4ZA1A 3CCMS 1CJUB 3GIMA 3MECA 2F8HA 3KHRA 1C1BA 2HGMA 4DFKA 2V8HA 4YY3F 2HURA 2V4JA 2H65B 2XI3A 1I1GA 3GSDA 4DN0A 4CM2A 1VC5A 2AMCB 4ECZA 1Q7LB 1HI8A 3FRYA 3J81Y 3CCQS 2IDLA 1XR6A 3W5YA 1UL3A 3OQ2A 1UW4A 1WG5A 2YNFB 3BQ0A 1DQAA 5AE3A 1RT3B 2GMHA 1FXRA 3OHBA 3QT5A 3OXFA 5HQ8A 1RHJB 1DURA 2PD1A 4FBTA 2VG7A 2WONB 4OYOA 1UVJA 3D1QA 2R7VA 1YJ9S 4RW4B 2YWWA 3SXLA 2E5JA 4DR6F 1RSCA 2DKOB 1PJ7A 2HIYA 3R9LA 1JJCB 2XHWA 3V6HA 4Q7AA 1RAOA 3WX4A 2B5JA 2HBYB 3OBIA 2L9WA 4U8YA 4CTAB 1SC3B 2ZZNA 5K8NA 1GX6A 4WFBQ 3QRPA 4KV8A 3TZZA 4ZHRA 4C11A 2Q6BA 1JLCA 4F25A 1SL2A 5CD4A 2BE9B 4NLPA 3PY8A 4ALZA 2XWYA 3ZTOA 3NGTA 4LIWA 3UO0A 4E2FB 4RKUC 5KG4A 4DFJA 5IWAF 1JX4A 3DRPA 1YIJS 4HYKA 4NLVA 3C19A 2OSQA 1WSVA 3CCVS 1ZYQA 1F3FA 3H5UA 3PYGA 1VFJA 3KHLA 3TVYA 4TY8A 3Q8PB 4A8SA 2YY3A 3W8GA 3DGVA 4ED1A 1F9HA 3L7PA 3M2RB 5F3ZA 2R7OA 3GLJA 5CZXA 2QMXA 4BBYA 1WUUA 5K8PA 4IO1A 1RAFB 1REVA 2KG1A 3T5KA 1B7FA 1V9OA 2MZRA 1T95A 4OHZA 3DLEB 4M95A 1K44A 2LEPA 3IS9A 4Y28C 5IC6B 5E3RA 2CQIA 2F40A 2PMZD 1NJIT 4X65J 3K5LA 3A8IA 1V6HA 1XIQA 3C3LA 5C7PA 1TV6A 1S9GA 2ZWPA 3T1HF 2NZCA 1VQKS 2ALYB 1BQXA 5L38A 1IKYA 1LXNA 1ZAWA 3M8WA 1HNVA 2DGWA 2E5LF 5ADZA 1UAWA 3DOKA 4I56A 1S0NA 3K58A 1SL0A 4DUYJ 2MKYA 4DUZF 1QD1A 1Q86T 2MZQA 1XR5A 3NOGA 4DWIA 2J8SA 1VQPS 3L4BC 1FKPA 4JB8B 1XNQF 4IDKB 1RAGB 2W9BA 1SCJB 2J76E 2BEFA 3KJFB 3QFHA 2RVJA 2NSBA 2RKIA 2VKZG 3ZO7A 2L08A 2PN6A 3CJ8A 1LNQA 1AXQA 4ZPWR 4C0BA 1YBAA 1F2HA 3AY0A 3PRDA 1N33F 2KL8A 3BF4A 2V8PA 1WDDA 2HFSA 3PJ9A 2Q66A 1RYSA 2PO4A 2EFOA 3DNCA 4DSJA 1RE1B 1YDLA 3CCTA 3CC4S 2O3DA 2WBRA 2HQIA 3EVWA 1SQFA 4B02A 2AZ1A 3NKYA 1WOSA 3IC1A 2XZTB 3R97A 3I31A 1HQEA 2D3OR 1NSPA 4HHJA 2XSJA 1EQ0A 1G4CA 1FXDA 2WSEC 1NPPA 1FD2A 2D3UA 2X3GA 4K4ZA 3FFIA 1N36J 1DARA 2DNHA 3PW4A 4WKRA 4CYUB 1MU2A 3VV2B 2MLYA 5KFZA 4UOGA 2X1AA 4P2MA 3CIZA 4ILRA 1FJGJ 2VFRA 3VR1A 1KQGB 2DO4A 1LWCB 3NWRA 3KJVB 3L7OA 2VZ9A 2E5GA 4U9RA 3BN4A 2K3KA 2LECA 3JXOA 3J7YU 3DYAA 1N5QA 1YHQS 2XWXA 5DG9A 2E7XA 1X0PA 2WHOA 2YQ3A 3ZXWA 1DBDA 4AQYJ 3BO4A 1AZSB 4IOBA 4IG3B 2MLZA 2B56A 4OLPA 3QGGA 4JV0A 1Q82T 3M6UA 3ZZYA 2RU9A 5F8LA 3NY0A 3CMES 1URRA 2EG2A 1T3NA 3ZTQA 3SSRA 5L46A 3W9IA 4PXCA 1IBKF 2DNZA 1C2PA 3U27A 4TLRA 2RS2A 3MD1A 5DM6Q 3H5XA 1T03A 1IBMJ 1ZETA 4J5OA 1TL1A 5I42B 3DMJA 1CBKA 1UZDA 2OPPB 4DV4F 3KNAA 4RUCA 1EARA 2WZ1A 3KMSA 2C3OA 1CG2A 2UUCF 4PWDB 3CVKA 2C2MB 5HP1B 3AAWB 2FJDB 1SH2A 3C6UA 4MK7A 2MGZA 5CCLA 5IT9U 1M5HA 4ZOSA 3EGWB 1SUQA 4LT6A 2HQ3A 2JNJA 4NZ6A 4TVAB 5EWFA 2OFHX 5FLXY 3R1HA 2FZCB 4LF5J 4NEZA 5KFWA 2PI5A 1LWEA 2XMWA 1BC6A 2O01C 4F0HA 4HACA 2XGQA 2HHTA 2JWNA 3C15A 1VQYA 2F63A 1X9SA 3GCWP 1S5ZA 2R8JA 1HPZA 2BUNA 1HBUB 4DZDA 4DV2J 2V68A 4YFUA 5G4DA 1F5BA 2AJ1A 1TKZB 3KMQA 5A8WB 4NLGA 4X64J 2JFKA 5HMZA 1WHXA 4OV1A 3X1LB 3D6HB 1WOOA 3WIUA 4BHQA 1F1BB 1JKHA 4QJVA 4LR8A 3NXZA 3Q8UA 2XULA 3MM7B 4AL7A 4NI2B 3SBMA 2LQ8A 1Q53A 2AGOA 1YX2A 4IKAA 1FE4A 3DHXA 4YB7A 2Q1LA 3DRXA 2I1RA 3VAKA 4KC5A 1R0BG 2F65A 5DDQC 5KFRA 1FKOA 1DFDA 4ZP7A 3IFEA 3CO9A 2LXIA 1VISA 3BEGB 4NYOA 4YMEA 3ISNC 3FK4A 3IG1B 2AX0A 5LSRA 1NBEB 2MKJA 5DQGA 3QWPA 1NDLA 3QJLA 3IR6B 3M8QA 2KT2A 3T1YJ 4C8KA 4YR3A 4B3RJ 1P1LA 4V1Ak 3SCIE 2J6UA 3PTWA 3BH6B 4GMKA 1RT1A 1Q8BA 3Q8SB 1CLFA 4CH0S 1LXJA 4RZRA 1SKWA 3UD4P 1JLBA 3G4SS 3AQOA 2DEIA 4Y2CA 1VBXA 4X2BA 4FS1A 1KQFB 3QATA 5C42B 2R7WA 3G6YA 4IR9A 2QLWA 1R0AB 1SJ3P 2BBEA 2Q6CA 2VQFJ 4JV5J 2M88A 1PIEA 3DXBA 4DR5J 4NCGB 4HH0A 1Y3KA 3TZYA 2WW8A 2YWKA 1GH8A 3TOQA 1HBNA 5LMNJ 2CAJA 2XLJA 2GIQA 2ZM6F 4IOAQ 3AOBA 1K1SA 1FO1A 5K14B 2GS8A 5D0GA 3NBPA 4RWWA 2IRXA 3CMAS 2BQRA 2QJ3A 3V2UC 4GO5X 2R7RA 2X1GA 4LFBF 2DGVA 3DOMB 2HQFA 1WSRA 4C3LA 4U7CA 1XMQJ 4DFPA 3KHGA 3D54A 2D7SA 4JYAJ 1FFSB 3WC2A 2FD2A 1XEZA 4MK9A 2GJ2A 1ZZFA 2AT1B 1S77D 2DT9A 1K8AT 2Q43A 3MEGA 3CD7A 3SFUA 2ZZMA 2GJIA 4HDGA 4YUDA 3AB2B 5HI7A 3M9OB 5KT4A 1EETB 3JSRA 1M0SA 2LQ9A 4EO6A 2ZBIA 2IY5B 1DTQA 4QR1A 3GV8B 2GHPA 2RUGA 2DCUB 1VRTB 2M8HA 4BS2A 1ZOTA 2HS4A 4LBIA 2JEIA 2BVZA 1EB0A 3R7NB 2B8PA 2NSCA 5CYQA 2O67A 3B54A 2DRDA 1X60A 3ILIA 1S1TB 4Y2IA 2M9KA 3AD9C 4NXMJ 4X4VA 4LF6J 4CO1A 5AXKA 4LSLB 5KFNA 4HT7A 2ZHBA 3A13A 1PBUA 2DIUA 4F2RA 2KKHA 3FQKA 2FJXA 3OXGA 5J1PA 3HFZB 4X65F 2FY1A 2B51A 3N0VA 2QIFA 1T05A 1S1UB 3IRWP 3I5AA 5HROB 3GFZA 1X5OA 4ECVA 4LIRA 3E8OA 2OH2A 2PSZA 4K5RA 5E3CA 2YNGA 1JJ4A 1MWZA 5FD1A 5M2UA 1RT6A 3CJKB 3MCMA 1NM2A 3NAIA 4OYWA 2OMOA 3RB3A 1HYSA 1S6PA 2FVRA 2BOAA 2MPUA 1JLAA 1N4LA 4WIIA 1Y5NB 1TL3A 4G1QB 3RGIA 3H8YA 3ITHB 1WEZA 1NHUA 1YJNS 1N6QB 1B4SA 2UV8G 2MZTA 1OPZA 1MSWD 4ECWA 1HBOA 3WHIA 1XK8A 5E5NA 2BMBA 3H90A 3IGNA 1Y4ZB 2OPQA 3FGVA 2ZD1B 4Q2LA 4DX7A 3IN5A 5LXRA 3IO1A 3V6DB 2VOPA 3MMCA 1QLNA 5LXYA 1WF1A 1T0TV 4C8LA 2RH3A 3R7BB 2IJRA 1YKWA 2BKPA 2ACMA 3O2IA 3MDFA 4MFBB 5J1EB 1X5SA 3C66A 3OV7A 3MMBA 2Z58B 4WP9A 2XMAA 4U7UD 4TQRA 4DV3F 5ITHA 1YITS 3OR2B 3CO0P 3M8PA 2AQ4A 4HHUA 2FJWA 1ZM4A 4A4JA 1ROFA 4M5JA 3OVSA 3HVTB 4JI1J 4NZ7A 4AQYF 8ATCB 2QA4G 1RQ0A 3I0RA 2H4WB 4C48A 3CE8A 4DQSA 3SDEB 4IRKA 5EX0A 5A8KB 1NB7A 3UVJB 1LWFB 3PV8A 4RNOA 2RE1A 3DOMA 2IJNA 3RAMA 1KHVA 2QE5A 5KFVA 3CXCR 3EDQB 5KFQA 4BDPA 2MSTA 1UPMB 2HRYA 3OL7A 2FHJA 2YKMA 1VRQC 1IBMF 2HVZA 4C97A 4NCBA 1LWXA 2AJFE 1QE1A 1P8GA 5F8GA 2VOOA 3MCNA 3W9HA 4NLTA 3QBCA 3T19A 3KYLA 4NA3A 3QAEA 2Z57B 1U0HB 3FEYB 2RRNA 4RW9A 2F1FA 2IM1A 3WBZA 1RABB 4DL7A 4UOFA 4DCPB 1M5KC 4RR5A 2VDIA 3KLEB 2PGCA 2QX0A 2WAQD 2XGPA 2JLEA 1HWJA 2QL7B 3Q8VA 2GFFA 3T3FA 1R8BA 2C2NA 3UW1A 3KLHB 3K5OA 3AOAA 2VC0A 2JC0A 3UN5A 4NEYA 4DV2F 1PYTA 2NUHA 5H9EK 2QYGA 4F4AA 2Y3YA 2DJWA 5KG2A 4Y2MA 4MK8A 3F73A 2P6TA 3J80U 2D1CA 3G8QA 4DL0C 4KGVB 1NJYA 4R5PA 4X64F 4K59A 5KFMA 5DG7A 3TW0A 2CPDA 3VTIA 2W2PP 1JLEB 2J0SD 2PFFB 2R7TA 1TP7A 3BSCA 1VS3A 1P9QC 3CJQA 4FKYA 4HL9A 4B3MJ 3K5MA 2KB2A 2AYMA 5A76A 1QDUB 3FSXA 1ZTTA 1C1CB 4XPEA 3JAMU 3U02A 3MEKA 2HHSA 4HHHA 4RJVA 3LP2A 4ZIWA 2BM0A 2EG1A 4FXWA 1JB0C 4F3MA 3VAMA 4B3SJ 2PDAA 4FVCA 4WPAA 2IBKA 4P74A 3W63A 2HNZA 2HHUA 2WB1D 1F3VA 2QSFA 3S7RA 1JLQB 4I69A 4R0JA 2XMUA 3HT3A 1T7PA 3PZPA 1MW7A 3T1YF 1RHQB 1HW8A 2W4CA 4F4WA 1UVLA 4O44B 4ED5A 5KFAA 4B3RF 4XIUA 1FX4A 4WFYA 4C7QA 2KTQA 2GGPB 4NWBA 3HVAA 2XHCA 4FYXB 2P9EA 2QLXA 2L9DA 4LF2A 3BB5A 2HHXA 1VQ8S 3DRRA 3R5DA 3FBBA 4UW2A 1IJFB 2KFNA 1VOMA 2F8MA 3HJVA 2VQFF 4JV5F 4O3NA 1XQIA 5BJRA 4DR5F 3LGMA 2WSCC 1KRPA 4F7VA 3EGNA 1N0UA 1U6FA 1HNIA 2GJFA 4RUHA 3LH2S 3UCGA 3UI3A 3UCZP 2CJXB 1TK5A 3NS6A 2BJDA 3ICLA 3M30A 4URGA 3H5YA 5J2MB 1R31A 3GG1A 1UJ6A 2ZE2B 1TU0B 5L9NA 4FF4A 3P49B 1RT5A 4ZPTR 4X62J 3VHQA 1WC5A 2MEWA 3DRSA 2FTRA 4EBEA 1CJKA 5IQ6A 1CEZA 3G8TA 5L1LA 3BO3A 4DSLA 3NMRA 2XYHB 3NWGA 4LRCA 1XMQF 4FF1A 2L9NA 4P2FA 4WFNQ 3BQ2A 3NNHA 3MR7A 4JYAF 2HFNA 4OX8A 3VAGA 2IPOB 4OYPA 5K5MA 4O0IA 2K1RB 1SKUB 3N79A 3NGUA 2KRRA 4I68A 3I82A 1WKKA 4ZCLA 1K1QA 2OD6A 1HNXJ 5T7LB 5CYMA 1OIAA 1S12A 4G1PA 4J9NA 1Y5IB 3I0SB 3DM2B 2PMHA 4A8YA 2E29A 3O44A 4OHVA 2N4CA 3MCSA 4ZVFA 3TA0A 5C25A 2VFTA 3MM8A 2HVEA 1RLDA 2DNLA 2HAIA 3ENVA 3BYPA 2QT7A 4YR2A 4K0KJ 1LQ9A 2LA6A 2VFVA 1OYEA 5EDWA 3BSNA 3VQTA 4NXMF 2F3JA 1GFWB 3FUYA 1G6BA 2QYCA 1U49A 4LF6F 1QY7A 5GAEU 2GA7A 2I5JB 2CDRB 2M4MA 3OHAA 2HGNA 4DV5J 2IFXA 4PG5A 4PYDA 1S7IA 1KBRA 3N5FA 2RF2A 1UFLA 2A10A 1N5YB 2HWHA 4QYZK 2OIHA 1Y7PA 1K9MT 4EWTA 3TAMA 5A2QU 1WI8A 2PC6A 4DQPA 4FN5A 3R5JB 1GEHA 2AHOB 1SC1B 4DR1J 3QSYB 2AWZA 5J2NA 4CLZA 3B82A 4J37A 4I0WA 1B99A 1JLGA 3H2LA 3I56S 2K7JA 1FDAA 4HKQA 1WF0A 3MM6A 3TEGA 3SZ2A 4DG1B 4HLBA 5ETMA 4KTQA 5I3UB 4ICLA 1HHSA 1LFPA 2QA2A 5B09A 4R25A 3N01A 3DGPB 4Y2AA 1NKCA 1RWVB 1GT8A 2EVZA 4LF8F 2W7AA 4PAAA 3THVA 1H0HB 2VUGA 2DNOA 4DU7A 4OI2A 1SJQA 5HJXA 5SUHA 4DV1J 1WD6A 2HAFA 4RW6B 2GV1A 1Q7YT 2CJ9A 4FPIA 5HVGA 5HL7Q 2K2PA 4C0OC 2YKNB 2CA9A 5M2PA 4YDXA 4YEAA 3EJMA 2ASJA 3I96A 3KK3A 2ATLA 3RYLA 1RK8A 3RRKA 2DNNA 4NX9A 3G6VA 2RQ4A 2PT0A 3QLHB 1WF2A 5HATA 2HS0A 4DXLA 2FC9A 2XI2A 4H4OB 5GMEA 1W7WA 2FB0A 4D3HA 2UVUA 4EMDA 2RT3A 3BR9A 1YJ7A 2WK4A 5CA5A 3MEDB 2Y9HA 1X4HA 3LP0A 4LSZB 3IR7B 3FC9A 4NA2A 3T6JA 4LBPA 1S97A 1JXVA 1N5TA 4RWXA 2BE2A 4RNMA 5DLGA 3ZTRA 3KUGA 4J9LA 4JI1F 2GVZB 1HD1A 4OI4A 2E9TA 1HFEL 2RMLA 3H2UB 2ZOGA 1NDKA 2CPYA 3KDNA 4OZ1A 1ZBTA 4AUKA 4LFAJ 4BCAA 3OTOJ 2J6SA 2MJNA 2XO6A 1F60B 2RQMA 3SSSA 1OMSA 5D0HA 4FDFA 2G9OA 4RBUA 4TXSA 1Q8LA 3TVKA 5B08A 1R8CA 2NPIA 2EBEA 5T41A 2K1RA 3KUEA 3D6TB 5F9LA 2CPHA 2E7WA 2W9AA 4PG8A 4ANDA 1LK5A 1RA6A 1JXEA 3T5LA 5KT6A 2DEJA 3CC2S 2HLTA 1WG1A 2OPRB 1KEKA 1LOUA 4LQ3A 3R5CA 4CT9A 2ZUGA 3DKDA 1FRIA 4KYZA 2VPZB 1A9NB 3V5RA 2W2QP 2QTWA 3R3TA 4I2QA 1HI0P 4LRAA 3DLLQ 3OFEA 2W24A 4M5MA 3JQKA 3GJRB 4B9UA 4OYMA 4Y6IA 1VQ4S 1XC9A 2DGUA 2X1FA 2U1AA 2UP1A 2FDNA 3MURP 2WVDA 2G1DA 1WC0A 2V6AA 1B0TA 4DSFA 1HWUA 1FWPA 2WOMB 4R8UA 2KT5A 2JVOA 2CWXA 2X7IA 3GYGA 3PRBA 1RKJA 4GRSA 4NOHA 3OUYB 5KAKA 3BREA 2ZBQA 4B3MF 3G96A 1X4BA 2AEMA 2G0IA 3V4MA 4ZK7M 3QGHA 3GIIA 3HSZA 3LPYA 1HKAA 1TL7B 1W2BR 1RJJA 4Y00A 3PIPQ 4Y0FA 2YWGA 1NK4A 1Q8KA 4LF4J 1R27B 4B3SF 3QIPB 4XDCA 4NLSA 5KT3A 5F41A 4I1TA 3ZNUA 2D9PA 1WHVA 5KG7A 5B0CA 3JSMB 4LJMA 1NB2A 5L1JA 1FESA 1SI9A 3BBFA 1HNWJ 1RT7B 3H0PA 3DDIA 4F3OA 2Y1IA 4ZPDA 4MAKA 2FLNA 1R6YA 5J2PB 1CQMA 3D2WA 3FEZA 1R8HA 4CO4A 2HPUA 2XMVA 2CADA 3FDSA 4MJKA 2VJUA 1KLMA 1S1VA 4KY3A 4GC6A 1EHWA 2YH1A 1SVDA 4ECYA 2DGSA 4EBCA 1HA1A 4MYUA 1R8AA 3H25A 3HHLD 2AGQA 1KWMA 4KQZA 5E3QA 2ZWOA 2MKCA 4M5KA 4CDIA 4FF2A 3PO4A 3US5A 4WYLA 3DLKA 2DYAA 4RLEA 2CVEA 3UD3P 3D6FB 3M9NB 2HNDA 1LW0B 1KP6A 2HNYA 5J2QA 2N7YA 1U1OA 3QRRA 1TVRB 1HWKA 4DJBA 4M5IA 4LRBA 4KHPJ 4RW7A 1SQEA 4X62F 1S99A 5DZ6A 3MXHP 1R43A 3WC0A 3HKZD 1OO0B 1IVZA 2I2YA 2XG8A 2V0NA 4ZLNA 3CJ5A 4OYZA 2BW2A 4N8OA 4R0EA 3TAQA 4KE5A 3CCLS 2MQLA 3EZUA 3ONQA 4EO8A 1UP1A 4QW8A 4C98A 5HBMB 1F2GA 5A0YA 3K5NA 2RILA 3GG0A 1N34J 3AJ1A 3SCKE 4TQSA 1WNEA 1VQOS 1N8RT 2WVFA 4H4KA 3QJJA 3H42A 4V19J 2CJYB 2XTJP 1C4CA 1IKWA 1H2VZ 1VQLS 1N54B 1IM6A 3ISND 4MTPA 2VG6A 4K50A 2HBZB 1WJ9A 1TFWA 2HHHF 5I4MA 3BYRA 2FHOB 4DBQA 4OLOA 4PUOB 1FRMA 2ZBPA 5A8RB 2V2ZA 4NYZA 3AXMA 4A8FA 1SJ1A 3TUIC 4PWWA 2HFOA 2ROGA 2UVWA 4YY3J 5KG5A 5IS2A 4K0KF 1Y00A 3M2VA 2MTLA 3CDBA 4P7VA 5KFDA 2JHEA 2LXFA 1S10A 3J7Z5 2XM3A 2DGQA 4EK2A 1SJRA 1IBLJ 2LLZA 2NCKL 5KFIA 4P75A 1NSKL 2H5JB 1RUSA 3ET6B 2DNYA 2KJWA 5L8RC 3I4HX 2EBGA 3W65A 5DRKA 2FHKA 1DRZA 1H72C 3DC2A 3QGIA 2VPWB 4HI1A 5BYQA 2I9SA 3RB0A 1TKTB 3DU5A 1VC0A 2JEGA 2EKYA 2JRSA 1VJQA 1K0VA 1OSCA 4DR1F 3OUYA 4I6AA 3RU0A 5IOLA 4WYWA 5E7OB 2JLFA 4M94A 4MIWA 1C0UB 2BJ9A 3M4XA 4B3OB 4OFZA 5IV3A 2B9WA 1N88A 4WU2A 1EP4B 2KFZA 1FRLA 1NHKL 2YNHA 3JSYA 2QGFB 3J7A1 3MM5B 3W64A 4E8UA 4RNNA 2W9CB 5HLFA 1X8DA 1HQUB 2ACYA 3A8JA 1U1RA 1Q81T 2DHGA 1FRHA 3VZIA 5H9FK 2R4FA 3C2PA 1JMTA 5IM0B 3FQLA 4X4SA 1IR1A 4FZVA 4DV1F 2R9LA 2UUWA 2CNNB 5D3GB 4C2MA 2QN6B 4C4WA 3MUMP 1PBAA 2OGUA 1VHIA 3F56A 3KLFA 2J5AA 4DQRA 4DPTA 3G6ES 2N3LA 3MTKA 1GTHA 4XTTA 3MHYA 3ZTSA 2IRUA 1BHNA 1CJVB 3AD8C 4M5HA 4JI7F 2E44A 5D4NA 2DY1A 1WACA 4CO2A 3EZOA 3FCVA 3R1LA 2IVFB 1HIYA 3PJWA 1LW2A 4KPCA 2BA9A 3HFVA 3FVYA 5CYJA 3TQ1A 5KFEA 1FXLA 1RTIA 2I8EA 3D7SB 3D67A 2E1RA 3MAAB 3QWUA 1HBMA 4B3TJ 4IH5A 1GMWA 4NLUA 2IMOA 1SIZA 2VONA 4ILMA 5KFSA 4IFYB 4QBUA 4ZPVR 1CC8A 3SFGA 3RB4A 3M8SA 2RS8A 2YWEA 2E5LJ 2EC0A 2KRBA 5FLXU 3CJ4A 4LFAF 3OTOF 1YBUA 4CNYA 2UU9J 1IKXB 2D3ZA 3K5PA 4FNIA 2YTCA 3IR5B 2RUSA 4MMOA 2C2KB 2N3OA 3CDAA 1U2CA 1UVMA 4I2PB 3W61A 3KK2B 4DQQA 4ILLA 3T9ZA 5DLFA 3HSDA 2GMJA 1EAYC 1W2IA 2KVIA 4FYVB 3SV4A 2CZ9A 4TU7A 4YDDB 3OTCA 3CD0A 2F9JA 4LR7A 1KN6A 1FWKA 1PG5B 1VRUA 2QEXS 1FEHA 5KFXA 1UWBA 4ZS6A 1PC5A 2ZKTA 4PUOA 1FK9A 1C4AA 1JNRB 4ZLPA 1N5SA 2DGOA 2AD9A 2XB2D 1VYAA 2K8GA 3MEEA 2C3UA 1MMNA 2F5GA 2GVDA 3DLGB 1VJWA 2HLUA 2H51B 4KGMA 3MI7X 3CCZA 3R2DJ 3TJAA 2BANB 4K8RA 1OQ3A 5AE2A 4BC9A 4O3SA 2VV5A 1S6QA 2VASA 4KO0A 2AYBA 2OTLS 1URNA 2HZVA 1FHTA 2YNIA 2POKA 1NHVA 8AT1B 5K8MA 1IQZA 1Y11A 3D0IE 1JLFB 5B0EA 1KQKA 4J90A 4DZ6A 1TKXB 4LSNB 3T6BA 1YRTA 4P10A 3MFHA 1U1QA 2H9ZA 2E1CA 3GE9A 3ILOA 1KS2A 2IBOA 2X51A 1OY9A 2VG5B 2BKOA 5D6GA 2MZJA 3P96A 4ID8A 1HQ2A 1S1WB 1X4DA 1PCAA 3GP9A 3I9V9 1U0SA 3RR8A 3CDWA 1X9WA 1LEOA 3SQGA 4J91A 3OFHA 1U6BA 2FLOA 1RYRA 1RDRA 2NXJA 1SL1A 3N6LA 3LP1B 4O4RA 3LOUA 3TZWA 1UETA 2Z0GA 3HO1A 4DF4A 2V8DA 1BE4A 1RWOB 3LANA 2YQ0A 2OPSB 1HNWF 2W8KA 2HMIB 1WWHA 3P8BB 3Q8QB 4NLDA 3P4UB 1V3SA 4ENOA 1Z4UA 3GV5B 1RTDA 4KIAA 2LCWA 2RSQA 2MSSA 3E3XA 1KR4A 4S0MA 3C14A 2F7VA 3OJSA 1NK7A 4MKVA 3HHKA 1RAAB 1I51B 1S1XB 3NNAA 1QAYA 1VC6A 2BDPA 1D3WA 1HMVA 2HGLA 3E2EA 2VA2A 1GX5A 2OAUA 2MZSA 5EUHA 1KTVA 2ZC4A 1X9MA 3QYYA 2WVCA 1GQEA 2J0QD 2FJVA 5KFUA 4B9MA 2M52A 5I3PA 2ASDA 1DLOA 2EK1A 4ECTA 3E01B 4ID5A 5C2GA 2NZ4A 3G71S 1CULB 1L5UA 4X84A 4W4MA 3QRQA 3IRXB 5KOXA 3KLIA 4KHPF 3RRHA 1KSPA 3BKFA 2J9DE 3BSAA 1YK9A 5CZVA 4ELUA 1ZPWX 3K0JA 2HWIA 2E1MC 4ES2A 2XCAA 4UT4A 4IG0A 2JVRA 3EWGA 3O5TB 3W2VA 1VBZA 1UCNA 3C16A 2QFIA 2BW7A 2IC3A 1FJEB 1N34F 1K47A 2DBBA 5LMUF 3H40A 1TMJA 4KGZB 3MPVA 3BGFA 1X4EA 3CWJA 5HK4A 4DR2J 1RWWB 4K4XA 3KLGA 2HIQA 2DNQA 1HI1A 2RU3A 1XJWB 4RU2A 2G2ZA 4B9LA 1W25A 3PX6A 2BX6A 5KFGA 2LMIA 3OL8A 4E98A 1NH8A 3HVWA 4EU0A 2LA4A 4C0HA 5F8IA 1AUDA 3H4DA 1OS5A 2HG4A 3ZZPA 1P1TA 2OSRA 1IBLF 1OY6A 1TK8A 5C24B 2WRMA 2JOQA 4I6YA 4MYTA 4C8MA 5HN0A 3B4DA 3S8SA 4LUBA 1LV5A 2ZH2A 1SB6A 1RWMB 2KXHA 3DN9A 2V8GA 3BGRA 2B3TB 1S6OA 4DPYA 3AJDA 1M5SA 2EFPA 5GAHU 1C0TB 2Y1RI 4ZLJA 4P9SA 2VA3A 3GMGA 2ZM6J 4M1KA 4OL8A 1D09B 1R0CB 2RDDA 4K7QA 4OZ5A 5HO4A 2PIIA 3TR5A 3MTJA 5DDOC 4UQGA 2B7CB 3R2CJ 3AJ2A 1YWXA 2PA8D 2KHCA 2KXNB 3JYTB 3SIPB 3J81j 3D68A 3M6WA 4IFVB 4OZ3A 2R8IA 3CIMA 2MQPA 4LFBJ 4DV6J 5B0AA 5LJ5Y 5AE1A 2DH7A 1B64A 3BSOA 2QL9B 1RTHA 4DFMA 3O8WA 1E6YA 3BPSP 3BGLA 2PFDA 3M1VB 4QU7A 1BQNB 3DOLA 5IV4A 2VJVA 2P8IA 1T9VA 3OXLA 3EXCX 3PYEA 5J1NA 3LUYA 1YLXA 3L95X 4N8NA 3KTQA 4PQUA 1RAHB 1WHWA 1Y10A 5IT4A 1QVGR 1MNEA 3OPKA 3G82A 4JI0J 3MMAB 3GFHA 1S9EB 1H7WA 2I0XA 5G0RA 2I38A 1FTCA 2VB6A 3Q86A 3PIOQ 3K8WA 1BQMB 2UUBF 2E5HA 3KWMA 3UR0A 3KK1A 3QO9B 1DY3A 4P2XA 4QZVB 5GAGI 2FJAB 3UQSA 4DHVA 2HVIA 1QJHA 4X4TA 2HK2A 2DR5A 1QTNB 4RW8A 4KR0B 1U8SA 2DR7A 4OMFG 5FJ4A 3AFGA 4LF7F 3DLHA 4IRDA 2RQCA 1I5OB 1UA0A 4CI0B 4TKTA 3D0HE 4Q0BA 4B3TF 3NGSA 3L09A 2MKIA 3QT7A 2CKWA 3JTOA 2W4DA 3HF5A 3ZZUA 2RDIA 3PCOB 1RTJB 1S0OA 2AGPA 2ZOFA 1E6VB 4BWMA 2E9ZA 5D4LA 4DQIA 1IKVB 4JI5J 1U8WA 2UU9F 5GADU 4QWAA 2MKKA 1UMJA 2DNRA 4XO0A 2DR9A 3UDEA 4V19X 4GVBA 3N4WA 3FMBA 4DPWA 1YTYA 3TUZC 2B6AB 3TUPA 2R7XA 2YPYA 2HHPA 5H9EJ 4OQJA 3W3SA 1MG7A 1HLWA 3H7HB 2M7SA 1DTTA 5GMDA 1MLAA 2DHSA 3PYDA 4J7CA 2R2SA 1JK9B 4M5DB 3SCLE 3J7AN 2J9EA 3AA8A 2W4PA 2P5VA 3LALA 2DB1A 4CWBA 4KFBB 1VI7A 1CJUA 2C42A 1J5OB 1O51A 1DQ8A 1RCOB 4AYBD 3KJNB 4O4GB 2W7OA 1YJUA 4OI1A 4P2SA 1HD0A 1WEYA 2ZVSA 3HFKA 4FS2A 4K5SA 4NLRA 2YNFA 1RWNB 4OHWA 2B9XA 1RT3A 1ZAVA 3THTA 1KHWA 4NZ0A 3KLVA 1NPKA 2M2BA 2DXDA 3HCXA 4OHYA 1RTZA 4J9SA 4DV3J 2WONA 2C2RA 3UN3A 1QUPA 2FYXA 4FKXA 3DI6B 1UTAA 4RW4A 1XNRF 2RQKA 2B4UA 2WBMA 3H98A 2XBPA 1XMBA 4I6WA 3L3CA 3RBXA 1FX2A 4CNZA 3KG0A 2FGOA 2JEJA 1KDNA 3W5ZA 2FHJD 2WSFC 4CTAA 1YZ6A 3HZEA 1R89A 1NU4A 4ZVOB 1MROB 2F9DA 4MIAA 2ZH4A 4DN9A 2ZBCA 1U1KA 3K8VA 1B0VA 4HVZA 4DPOA 1RWXB 5CCMA 4K4YA 3V4IB 5AXNA 4IH7A 1T9TA 2PI4A 3N5BA 1T9UA 2MYFA 1FEEA 3OR1B 4UY8T 4QWBA 1UJ5A 4CLFA 3M8RA 1OSDA 3K7RA 4KSEB 3I6PA 4JI6J 2L3MA 3IWLA 4PZVA 2WW4A 1NZAA 2A18A 3TEHB 4H54A 3SSQA 3M2RA 5KOWA 3NS5A 3VGTA 2XCPA 2ERRA 2H4YB 2C2DA 2EPIA 4O23A 1WELA 2BRLA 3UDLA 5HVHA 3R5BA 3V81B 2G2YA 4GC7A 2YH0A 3VAHA 2ZJQQ 3ZZRA 3VGUA 1FWLA 4P7TA 4ZVQB 3THPA 3DLEA 5JJBA 1U48A 4ZVUB 5MAOA 5ETTA 1SJ4P 3M2UB 3PVXA 3A8KA 1A6LA 2JSXA 2JLGA 2GIRA 3Q22A 1IR0A 3T5JA 5FDLB 1HWIA 4ED3A 4DPXA 3OVAA 2IMWP 4PCQA 2DR6A 1F5CA 3A4TA 3PFEA 3HLUA 3ENQA 3POTB 4USTA 3PEHA 2B9YA 3EUNA 5EGYA 1CVJA 1IWGA 1HARA 4IRCA 4UUWA 3JTNA 2OO4A 3ZC4A 4M8LA 3BS9A 4WXWA 5L9XA 2J0WA 1SV5B 3RG6A 2BXJA 2KT3A 3HD1A 4IDKA 4CO3A 5KFCA 3HD2A 4WE1B 2WCXA 1RWUA 2ADCA 5HMWA 4F8RA 3IBWA 3JTPA 1RT4B 4OIXA 2AJ4A 1HR0J 5D15A 5ETPA 1BLUA 1UEKA 2CVIA 3MOJB 3CJRA 4DR2F 3W2WB 4WBFA 2KZZA 5AXLA 3QIDA 4N77A 4QYZJ 3IMQJ 5MLCV 4H4MB 3UPFA 4X4QA 2YWHA 2NS1B 4KGXB 2KDOA 1U1NA 3CGIA 4DS5A 1I6JA 4ZN1A 3HHLB 1H2UX 3N6MA 3HP6A 1ZPVA 1IQTA 4ECUA 2MQ8A 5ETRA 4BLGA 1P6TA 4FBUA 2EC2A 2IHR1 3WX8A 3AT1B 5LJ3Y 1D8YA 1WC4A 3MM9B 2GAGC 3MPWA 2C3YA 2U2FA 4ZJOA 2BJ3A 1AUSL 4O3QA 4CYUA 4Q43A 3BZQA 1FDNA 1NNDA 4JV2A 3I5CA 2CUYA 3TARA 1LWCA 3KJVA 4TNOA 1XMOJ 5GMKa 1NAQA 3GPAA 4L72B 5F3TA 5F0UA 1AFJA 3I4PA 2VPXB 2VD3A 1GMUA 5CABA 2HHVA 1NSAA 1NK0A 1U02A 2IJFA 4K2XA 3CJTA 3PW5A 1Q8IA 4DPUA 1ZAXA 1AZSA 3C6TB 4IG3A 1BGXT 2JX2A 5EWEA 4TU9A 2HFZA 4LQ9A 2MHEA 3B8HA 1U4BA 1A7GE 4F26A 3IBCB 2AJ0A 5F8JA 3GYNA 4DV6F 3QAUA 2HSEB 1FFGB 4F3QA 3BV8A 4PG7A 5A2QY 2EW9A 2XNQA 2XQCA 3CCES 2VBWA 3MECB 9RUBA 4CP5A 4MIBA 5KG3A 1C1BB 2HFUA 4OZNA 2HFVA 2L41A 4AXJA 2ROPA 5I42A 1YJVA 2V4JB 4ZP9A 2MLXA 1HHQA 2OPPA 3UNYA 1O8BA 3Q2SC 4HH1A 2QL5B 4JI0F 3TP2A 2J9DA 4PWDA 2UZAA 5LSLA 2YX7A 4AXIA 5HP1A 5KFJA 3OVBA 4B9SA 5DDPC 4DR3J 4QWCA 2V63A 2VG7B 4USHA 2DK2A 1NRKA 1HL6A 1UPPA 2A6MA 1U2FA 5KG0A 3HVRA 2ZJPQ 3V81A 1GAOA 2QFJA 3CCUS 3GWCA 4LRFA 1PAUB 4C8YA 3HX9A 2DH9A 2IDEA 1SBRA 2B5JB 1NSQA 1HBUA 4AD6A 3KUHA 2UUAF 4ZVTB 1Q5YA 2UVVA 2FQQB 3KFWX 1S4EA 2DTJA 4KV8B 3NLCA 1Q95G 5DJBA 3ZZZA 1TKZA 4ZHRB 4C11B 3PKMA 3B4MA 1JLCB 5A8WA 4CO0A 4L74A 4CH7A 1RLCL 2CPEA 2BM1A 3DRPB 1S48A 4OZJA 4QYRA 4RBTA 1OJ4A 2W7PA 3FNNA 1WEXA 3K2YA 3R6GB 2H5IB 4JI5F 5CHCB 3MM7A 3V6JA 1VQ9S 2UXDF 1FVSA 4NI2A 1VQ5S 3GONA 2LP4A 4TY8B 4X4NA 4KKOB 4C3MA 1Q4RA 3G6XA 3MAHA 5EHHA 4YP3A 2BQ3A 3RW6A 3EXYA 2H1YA 5AXMA 3OL9A 1XBWA 4GKKJ 1S6UA 2EK6A 1REVB 5H1SV 4GKJJ 4G65A 4J9RA 4C8NA 4LF8J 1REGX 4YN3B 2UXBF 3IG1A 2H5EA 2MB0B 3NG8A 2XLKA 1UEVA 1RHRB 1BD6A 5KT2A 2VODA 3IS9B 4IOCQ 4HI2A 1QAJA 4RU9A 4PQAA 3HK2A 3QZ8A 2LU1A 2CYYA 3KNGA 3WDOA 5E0OA 1TV6B 1S9GB 5LOQA 3PW7A 4DS4A 1IKYB 4JI4J 1HNVB 5C42A 4NLOA 3BDEA 4ANEA 3SI8A 1CSJA 3DOKB 1R0AA 3CCJS 2OMLA 1D0EA 2D41A 3AD7C 1SKSA 1YBTA 4NCGA 3NL0A 1GXTA 3TUJC 1FKPB 1N52B 1JNZB 3HSGA 3PX0A 3VF0B 4U95A 3NCRA 3BBBA 2D3O1 4WK1A 2VU5A 4QWEA 2W9BB 3JB9k 4PR6A 4USKA 2RKIB 5K14A 5JMNA 1TTHB 1RACB 3OTEA 2A6OA 2CPIA 3SYZA 2BACA 3PW2A 3GB0A 5D4PA 1QTMA 4ECRA 2C2OB 2UVRA 2H54B 2WB4A 2DIVA 2BOPA 1RP5A 4RUAA 4NLQA 5DQIA 3GIJA 3W1YC 3CSKA 3NCQA 4FP9A 2OEKA 1F0XA 1S72S 2L48A 3VAJA 3C46A 2APOA 2NLWA 1M1GA 1HQEB 3N9UC 4URSA 2Y0BB 2XSJB 5IQQA 3TX0A 1KC8T 4MT1A 4CLSA 4BWJA 1KFSA 3Q8RB 5BR8J 1ELOA 3FFIB 5DGAA 3NP5A 1EETA 5DG8A 4YHHJ 2CXEA 2O66A 2VFSA 1KOHA 3R7SB 1MU2B 4JI6F 2X1BA 2DGXA 4Z2XA 4NYPA 1ZM9A 1KVIA 2HZCA 1VRTA 2O1PA 4F4KA 1X4CA 3CT9A 3PACA 4JI2J 1GK8A 3CF5Q 3DYAB 1Q1KA 3PW0A 4M5NA 2IYIA 1B7YB 5KFLA 4DX6A 2ILYA 1S1TA 3VAFA
chains in the Genus database with same CATH topology
4ZP7A 1R8PA 5D77A 4A8KA 2QV6A 3IFEA 5LT5A 3MUMP 3CO9A 2E66A 2LXIA 3F56A 3KLFA 4ZCMA 1JLFA 2J5AA 3BEGB 4NYOA 4DMZA 4DQRA 2BV3A 3TRGA 4YMEA 2V9WA 2ZHAA 3G6ES 3ISNC 1VQNS 3IG1B 1TKXA 2AX0A 2N3LA 4LSLA 4LSNA 1HW9A 5LSRA 2ALZA 2GO8A 2MKJA 3MTKA 5DQGA 1U47A 2JEFA 1TAUA 1GTHA 3QWPA 5A0YB 2V5HG 2OJ3A 2B7BB 5DM7Q 4ZCIA 3MHYA 3QJLA 2IRUA 3IR6B 3M8QA 2KT2A 4XK8C 3M9MB 4MKAA 7FD1A 4JI7F 2E44A 1KTQA 4C8KA 5D4NA 4LFCF 4C8OA 1UKUA 4YR3A 4DL2A 2VG5A 1P1LA 3SCIE 2J6UA 2CQHA 2YKPA 4GMKA 1IKWB 1RT1A 4NLYA 1S1UA 5KFKA 1NKBA 1Q8BA 2CPZA 1U1PA 4DSKA 1WACA 3FZ2A 4CO2A 2LKZA 3Q8SB 1CLFA 2PE8A 1S1WA 1PC4A 3PM9A 5HROA 3R1LA 2IVFB 2LQ5A 1FVQA 4CH0S 3OLBA 1VGYA 1T03B 2VG6B 5KG1A 1H98A 3PJWA 5A6PA 1LW2A 2G0CA 5JVHQ 2IAJA 1LXJA 2BA9A 4RZRA 1X0FA 1H3DA 3UD4P 1SKWA 1TL1B 1JLBA 3FVYA 3AQOA 3G4SS 1IXKA 1U09A 3DMJB 5CYJA 4Y2CA 4C3KA 1VBXA 3LQVA 2W25A 3TQ1A 1YGYA 4X2BA 5KFEA 4FS1A 1KQFB 3DU6A 1FXLA 1RTIA 2I8EA 1TQLA 2F8EX 1H6KX 5C42B 3I87A 4NL5A 2R7WA 2E1RA 3G6YA 4TLQA 4IR9A 3QWUA 2QRRA 2QLWA 3CJKA 1R0AB 1HHTP 1SJ3P 1HBMA 3BGUA 2BBEA 4IH5A 2Q6CA 2HW3A 1O5JA 2AF6A 2M88A 4NLUA 2IMOA 1SIZA 3DXBA 4HTIA 2VONA 3M2VB 4ILMA 4NCGB 4NXNF 5KFSA 4IFYB 4QBUA 3C6UB 4HH0A 1Y3KA 3LP1A 4ZPVR 4KKOA 1CC8A 3SFGA 2MGZB 3V6KA 4QIEA 2LDIA 2WW8A 2YWKA 3IA0A 3M8SA 3TOQA 3EPGA 3RB4A 1GH8A 4PXBA 2RS8A 2YWEA 1HBNA 1SUQB 1UEUA 2EC0A 4USJC 2KRBA 2FVCA 2OPSA 2XO7A 3U1LA 1GXUA 4AL6A 2HMIA 2XLJA 3GFXA 2JH3A 1Z1ZA 2GIQA 4OI6A 3CJ4A 5F0WA 1L3UA 4C8ZA 4G1QA 2ZM6F 4IOAQ 3P5TL 5B0FA 2J7KA 4LFAF 1HR0F 3OTOF 1K1SA 4CNYA 1FO1A 1IKXB 1M90T 5K14B 2D3ZA 5F8NA 3ITHA 3K5PA 2YX1A 2YTCA 2CQ2A 4FNIA 3IR5B 4GO7X 2ZH1A 3J7ZT 3NBPA 1N6QA 1LWEB 4RWWA 4MMOA 3Q0AA 3CC7S 2IRXA 2N3OA 3CDAA 1UVMA 1S1XA 4P6QA 2CQ4A 2GO9A 4I2PB 1G3OA 3HHNB 4RNFA 2OKQA 3VAIA 3KK2B 3CMAS 2AW0A 4DQQA 2BQRA 1HWLA 2MY8A 3V2UC 4ILLA 1HPZB 4GO5X 3T9ZA 2R7RA 5DLFA 2X1GA 3OSPA 4LFBF 2GMJA 2OTJS 1W2IA 1YRXA 2DGVA 3TI0A 4MKBA 2KVIA 4C3LA 4U7CA 1TK0A 4TYBA 4DFPA 2LU2A 3SV4A 1NJXA 1XN9A 2DRAA 2PA3A 3KHGA 2ZH7A 1RKIA 3D54A 4CO5A 2D7SA 4F50A 2MHNA 2VBYA 4TU7A 2ZD1A 3WC2A 4NPOA 4YDDB 3OTCA 3OLAA 2FD2A 3RW7A 4TN2A 3CD0A 2CIMA 1XEZA 4MK9A 1RAJA 2F9JA 4N56A 2GJ2A 1ZZFA 3V6DA 3MOZA 1S77D 1KN6A 2DT9A 1K8AT 2Q43A 5CXTA 3MEGA 1AW0A 1VRUA 3CD7A 2QEXS 1FEHA 3OSNA 5KFXA 3SFUA 3EX7B 2ZZMA 2GJIA 1UVKA 2IA0A 1UWBA 1PSDA 4HDGA 4YUDA 4KRWA 3AB2B 4ZS6A 1PC5A 2ZKTA 4K4TA 4PUOA 4NLXA 5HI7A 3M9OB 2R2UA 1FK9A 3E01A 1C4AA 5KT4A 1SKRA 1JNRB 1TL5A 4ZLPA 1EETB 2J9CA 2M0GB 2LYVA 3JSRA 1N5SA 4MFBA 1FA0A 2DGOA 5J1EA 2AD9A 3O1LA 2XB2D 2DHXA 1M0SA 2K8GA 4OJGA 1JKHB 3MEEA 2LQ9A 4WZQA 2YNHB 4EO6A 2VFUA 2ZBIA 3IRXA 3VQSA 2C3UA 1DTQA 4QW9A 1XMOF 1MMNA 2CQDA 4QR1A 2Q79A 3DLGB 3GV8B 5HLFB 1XERA 1VJWA 2HLUA 2GHPA 4Q8EA 4KGMA 2R2RA 3ISZA 3MI7X 4CT8A 3CDEA 2RUGA 3CCZA 2DCUB 3OR2A 1N56A 1VRTB 2M8HA 4BS2A 2J7UA 1ZOTA 2BANB 2HS4A 1OQ3A 5H9FJ 5AE2A 2JEIA 4BC9A 4O3SA 2VV5A 5JVGQ 2BVZA 1S6QA 2VASA 4KO0A 3O3LA 4RBVA 3K57A 2AYBA 2EFGA 2KYXA 1LK7A 2OTLS 5KT5A 2NSCA 5CYQA 1URNA 5KFTA 3HJFA 3HVTA 1FJ7A 2O67A 1FHTA 4F4ZA 1QUVA 2YNIA 4EBDA 2POKA 4IQXA 2RJZA 1NHVA 1L3SA 3MFIA 4ES1A 3DLJA 1FKOB 3RBDA 1S1TB 4TY9A 2M9KA 2MJUA 4OI3A 4Y2IA 3Q2TC 1YG0A 1U6ZA 4PXEA 5K8MA 2KU7A 1IQZA 1YI2S 3SDEA 3LAMA 2JFDA 3D0IE 3A1YG 3KLFB 1JLFB 3AA9A 4QPTA 2N4DA 4ZVEA 5B0EA 2HYIB 1KQKA 5T14A 5A8KA 2QA4S 4X4VA 2M70A 4CO1A 5AXKA 4DL6A 1LWFA 1TKXB 4LSLB 5KFNA 4LSNB 5D78A 4C9DA 3T6BA 1YRTA 3MFHA 2RB7A 4HT7A 4A46A 1U1QA 2ZHBA 2NREA 2H9ZA 2PEHA 2DIUA 4F2RA 3TA2A 3OTBA 2E1CA 3M8QB 3HZGA 2KKHA 3FQKA 2FJXA 5DDRC 1SH3A 1CC7A 3GE9A 3OXGA 1KS2A 2IBOA 4E0DA 5J1PA 2XLIA 2X51A 1D9FA 1TFYA 4I67A 2VG5B 4X65F 3HDSA 2FY1A 2B51A 3N0VA 4KT0C 4MKYA 2QIFA 5D6GA 2V4RA 1T05A 1DQ9A 1X7VA 2MZJA 3P96A 1RT1B 2CQGA 1S1UB 3GILA 4ID8A 3IRWP 3BQ1A 4X4UA 1S1WB 3I5AA 5HROB 3GFZA 4FYDA 3CJ3A 1X4DA 3M32A 1X5OA 4NLWA 4L3NA 3U1NA 1LW2B 4DX8H 4ECVA 4ZP8A 4LIRA 3E8OA 2OH2A 3I9V9 2PSZA 1JLBB 2N7CA 4K5RA 3RR8A 3ETOA 5E3CA 3CDWA 2YNGA 1X9WA 3CEDA 1RTIB 1JJ4A 3SQGA 1MWZA 3UNGC 3F41A 2CQCA 5FD1A 5M2UA 2HRUA 1RT6A 1IJEB 3CJKB 1WG4A 4G6VB 1HBMB 1I94F 3NAIA 3OFHA 1U6BA 2OP5A 4DR3F 4Z37A 2SXLA 4AL5A 2FLOA 1RYRA 3GR1A 4EGLA 1RDRA 2OMOA 4OZLA 3RB3A 4QIVA 1SL1A 1HYSA 3KLEA 3N6LA 3LP1B 4O4RA 3LOUA 1UETA 3DLBA 2UUTA 1S6PA 3WZ0A 2Z0GA 3HO1A 4DF4A 2V8DA 5C24A 2FVRA 4ELTA 3LANA 2MPUA 1HBNB 1JLAA 2A2CA 5B0BA 6FD1A 2OPSB 1HNWF 1N4LA 2W8KA 4PXDA 4WIIA 2HMIB 1WWHA 4OJHA 1Y5NB 1TL3A 4NLDA 4G1QB 3OTDA 1V3SA 2CPFA 3Q8QB 3H8YA 1Z4UA 2FJEB 3GV5B 1RTDA 2IRYA 2MQMA 4KIAA 2LCWA 2RSQA 2VBZA 2MSSA 3E3XA 3ITHB 1WEZA 1NHUA 1YJNS 2FHMA 1KR4A 3UFCX 2MQOA 3PKYA 3KLHA 1C0TA 2IM0A 4KHRA 2F7VA 3NBPB 3OJSA 1NK7A 1N6QB 3PR4A 3HHKA 2UV8G 3MMJA 1B0PA