4PRFA

A second look at the hdv ribozyme structure and dynamics.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New tools provide a second look at HDV ribozyme structure, dynamics and cleavage.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
molecule keywords Hepatitis Delta virus ribozyme
total genus 24
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4prfA00
1ZH5A 2HZCA 2CPHA 1WF1A 3TO8A 4EGLA 1A7GE 4QU7A 3G8SA 1VQPS 1WHWA 2DGSA 2XNRA 1NJIT 1WG4A 2DHSA 3D2WA 4C0OC 2KXHA 1DRZA 2DNLA 3U1MA 2KN4A 2MY8A 3H2UB 1Q7YT 1D9AA 1M5OC 3MI7X 2QFJA 4QPTA 2M52A 1H2VZ 2CQ3A 1OPIA 1X5OA 1VQ4S 2HYIB 2KVIA 3FEYB 2MZ1A 3P49B 2M4MA 1A9NB 2MPUA 2V94A 3S8SA 4YB1P 2VOOA 2YH1A 2LEBA 2KRRA 5ITHA 4Z2XA 1VQ6S 1KOOA 2O3DA 1N8RT 4M5DB 2M2BA 2MSSA 4CIOA 1K9MT 2AYMA 4QU6A 2DH9A 2CQPA 3CCLS 1PO6A 1Q86T 2E5JA 5DM7Q 3CC4S 2RQCA 2E5HA 2EK1A 1S79A 2X1BA 4PKDB 5HO4A 2I2YA 2M70A 4F25A 4Y0FA 3G4SS 5GADU 3J7YU 1K8AT 5CYJA 3CD6S 1RK8A 1NU4A 3IRWP 1U1OA 1VQ8S 3PIOQ 4UY8T 2QEXS 4C4WA 3ULHA 2LQ5A 1X4GA 4TLQA 1VC5A 3CCES 2MZJA 1R8HA 5LSLA 1U2FA 1SJ4P 5CXTA 1CVJA 3N9UC 2F3JA 2DIUA 2OJ3A 2XS5A 2MKIA 2MGZA 1S72S 3CCRS 2M9KA 5GAEU 1QVGR 1UAWA 4FXWA 4A8XA 2KI2A 2CJKA 3J7ZT 1SJFA 2D9PA 2DNZA 3NNHA 1VC6A 3UD4P 4UQTA 5DETA 3TYTA 4WF9Q 2DHXA 3IWNC 2YKAA 2RVJA 1U1QA 1WWHA 4IOCQ 2L41A 2N3OA 3CUNA 2KXNB 2CQCA 2E44A 2OIHA 4OZ1A 2KG1A 3UCZP 4WIIA 2N82B 3BO2A 2CQBA 1X5TA 5DDRC 3CPWR 4YUDA 1WHYA 2JVOA 3VAFA 1QVFR 1KOHA 4ERDA 1FJCA 3FEXB 3CCSS 3MD1A 4U67Q 3G6ES 1VQOS 1YJ9S 3P6YC 1JMTA 1P27B 2XNQA 2X1AA 2GO9A 2OSQA 4LMZA 2MXYA 2EVZA 2HGMA 3VAGA 2RS8A 2KT5A 1N88A 1U1MA 4WKRA 2RRAA 1SJ3P 3Q2TC 2MKJA 3CCMS 4IOAQ 4LJMA 1FO1A 1PGZA 1VQNS 1FJ7A 1WEYA 3BO3A 1M5PC 2VOPA 1RKJA 2RUGA 3P5TL 2MQMA 3HI9A 2RT3A 2JVRA 5IQQA 2DK2A 1YHQS 4CH0S 2LMIA 1U6BA 2ADCA 1SXLA 2M0GB 2ERRA 3SXLA 3LQVA 5LJ5Y 2KXFA 1OWXA 1IQTA 2L9WA 1K73T 5H1SV 1VBYA 3U1LA 4FXVA 3UCGA 5DDOC 1WF2A 1W2BR 1URNA 2BOPA 2XS7A 1JJHA 2G4BA 2CQ0A 2VODA 3VAMA 2CPDA 2U1AA 3UWTA 4LIRA 1X0FA 4ED5A 2YWKA 3HHNB 2DIVA 3CF5Q 1WEXA 5GVQA 3H2VE 3MUTP 1Q82T 2KG0A 2LEAA 3S7RA 3VALA 2X1GA 1WHVA 1X5SA 2MQQA 3EX7B 4W90B 5GAGU 3NNAA 3R1HA 1O0PA 3Q2SC 5D77A 2CQDA 2CPFA 1WHXA 5DDQC 4PR6A 2CPZA 2L08A 1FNXH 1YWXA 4IUFA 1FXLA 1UW4A 2F9JA 2CPJA 2K8GA 4WCEQ 5IM0A 2MQNA 3MURP 2DNPA 2M8DB 2MMYA 3THTA 1HD1A 2UP1A 1VBZA 2DGQA 2CQ1A 4OZ0A 2MKHA 3CXCR 4J5OA 3VAKA 1HA1A 1WEZA 2BZ2A 2LXUA 1H2UX 3BEGB 2DGTA 1X4AA 1X4FA 2DNYA 3LPYA 3VAIA 2DH7A 2DITA 2AYBA 3NMRA 2D3OR 2RRBA 2ADBA 3G8TA 3BO4A 2MQLA 4BS2A 2QA4S 2CPYA 2CPXA 1U1NA 2DGOA 2X1FA 3ZZZA 3S6EA 2MJUA 1OIAA 2DNMA 2KM8C 4RU2A 3MOJB 2I38A 3CCQS 1VBXA 2MKKA 2PE8A 1ZZNA 1X4CA 2ZJPQ 2LXIA 2M8HA 1F9FA 2CQIA 1L3KA 2Q79A 2DNGA 4WFAQ 1VQ9S 3RW6A 2J76E 3UE2A 2KFYA 1U1PA 2KM8B 2F9DA 1UFWA 3DXBA 2KU7A 2N3LA 2MHNA 5LXRA 3MD3A 1AUDA 3VAHA 2MZTA 2YH0A 2HGLA 4IO9Q 1X5PA 2DNHA 1H6KX 2LKZA 1XN9A 2ZJRQ 3CCJS 2M88A 1YJNS 1G2EA 1SJQA 1WTBA 3MXHP 3SMZA 1VC0A 3TP2A 3V4MA 2DNKA 3RW7A 2KRBA 2XSFA 2DGUA 4TU9A 3S01A 1WELA 2OTLS 5IFMA 1YJWS 3L3CA 1SJRA 2G0CA 1P1TA 2MYFA 1ZZFA 1U1LA 2FY1A 2LECA 1OO0B 3R27A 2FC8A 1U1KA 3CCVS 1UP1A 1VQKS 1NO8A 2JRSA 4Y00A 2FPHX 3US5A 5DM6Q 2B0GA 2LA4A 3OW2R 4F02A 2CQHA 2MSTA 3SDEA 1VQ5S 2GHPA 5HL7Q 2AYGA 2MQPA 2M7SA 1YTYA 3B4MA 4CH1A 1JJ4A 3UCUP 2EK6A 3JB9k 2LYVA 3SDEB 1M1KT 2SXLA 2AD9A 2DGVA 4TU7A 2DHAA 3P3DA 2XS2A 2K3KA 2DO0A 2J0SD 2FHOB 2CPEA 1WG5A 5FJ4A 3MDFA 4CQ1A 3EGZA 5LSOA 1U6FA 2JWNA 2RQ4A 2DGXA 2FC9A 2LA6A 1WF0A 1DHMA 1WG1A 2MJNA 3R1LA 1KD1T 3CULA 2G1DA 5LXYA 5GAHU 2WBRA 2DHGA 2E5GA 2LCWA 2DNQA 4WFBQ 5DDPC 2MZQA 2OTJS 4F26A 1FHTA 1M5KC 2MZSA 2XB2D 3K0JA 1VQMS 1BY9A 2D9OA 2KYXA 2DNOA 1HD0A 2RNEA 2MKCA 1N52B 4YOEA 3CTRA 2YTCA 3UD3P 4P6QA 3VF0B 1X4HA 2HVZA 1HL6A 2KHCA 2CPIA 2E5IA 1FT8A 3VAJA 2DISA 3NNCA 1YI2S 1VQ7S 1QM9A 5BJRA 3THPA 1FJEB 2U2FA 3ZZYA 3I56S 5EN1A 4W92B 2VONA 2RU3A 2ZJQQ 2CQ4A 2CQ2A 4TU8A 3CC7S 2J0QD 3I55S 1X4BA 1YIJS 3PIPQ 2NLWA 5CA5A 1M5VC 2MKSA 2MB0B 2DH8A 2PEHA 4WFNQ 2DO4A 3CC2S 2RS2A 2CQGA 2N7CA 3G96A 2HGNA 1H2TZ 3EGNA 1VQLS 3G9CA 5JVHQ 1KC8T 1M90T 3CMAS 1WI6A 2MQOA 3CCUS 2MZRA 1JJ2R 2NZ4A 2JX2A 5MLCV 3G71S 1R8PA 3B4DA 3CMES 5LJ3Y 2DB1A 1DBDA 1B7FA 5D78A 2DGWA 2MY7A 2A3JA 1DZ5A 2DNRA 1X4EA 2MGZB 4PRFA 2OSRA 3BS9A 4ZKAA 3DLLQ 1X4DA 5IM0B 3MUVP 2KH9A 1U1RA 1KQSR 5GMKa 3MUMP 2AYEA 1YITS 1Q81T 4V19X 1N54B 4QQBA 2J8AA 5JVGQ 4C7QA 1D8ZA 3NS6A 3NS5A 2DNNA 1WI8A
chains in the Genus database with same CATH superfamily
1ZH5A 3GFXA 3HVTB 5K8NA 4DSIA 1HBMB 2B56A 3PO5A 1HBUA 1EP4B 2RAQA 3CNQP 4ITSA 4RBTA 4ELTA 4OYIA 2W7AA 3UR3C 4YR3A 2UU9J 2DGSA 1UJ5A 4TQRA 2A2DA 2XNRA 1U8WA 5CYQB 2DHSA 2R7VA 2HIYA 2IBOA 2KXHA 4Q5VA 2COLA 2ZHAA 4L74A 2HHTA 2KN4A 3H2UB 4KHRA 4M63A 1BQMA 3R3TA 1FWKA 3M32B 4KHMA 2QIFA 3AB2B 4CO0A 3MI7X 1NHVA 3T1AA 2R4FA 1S9GA 2ZH8A 4QPTA 1WC6A 3ENQA 3ZZUA 2V2ZA 3DRRB 5U47A 2CQ3A 2ZBCA 1CLFA 2HYIB 4LF4J 3E8OA 2CRLA 1CS4B 3BBFA 2FZKB 3D1OA 5GAEI 4M5DA 3P49B 2VB6A 1A9NB 2DEJA 2MPUA 2V94A 3C16B 4JP8A 2P2CB 4FYXB 3HM9A 4YB1P 3NS7B 1NK7A 4WP9A 2IMWP 2OI2A 1SV5B 2HBRB 2HBYB 2JZ5A 4DSFA 4X4VA 4XIUA 3MF5A 1FNOA 1S0OA 5CYMA 2BV3A 5D4OA 2O3DA 3M2RA 1Y5NB 1V5IB 1HPZA 2HHPA 2XCPA 1NZ8A 1J27A 1SIWB 2AW0A 3NG8A 3QPIA 4NI2B 3W9HA 3EPGA 2CQPA 2PMWA 1I1GA 1PO6A 5ETQA 4YB7A 2XY5A 2E5JA 5KAKA 1XNQJ 5LOQA 1MU2B 5DM7Q 2ACYA 4H4MA 3W8PA 3TVYA 2R7TA 1APSA 1OSCA 3H98A 4A8FA 2QLBB 2QMXA 5HO4A 2IIHA 5KT4A 2F8MA 1WOPA 2BKPA 3GJTB 1SI9A 4USKA 3KYLA 1S0VA 3E2EA 1SB6A 5I42B 4DQQA 1GH8A 1GX6A 2WSEC 4CO4A 2IYIA 4YR2A 2IVYA 3N4WA 5CH7B 1KFSA 3LAKA 2YKQA 1IBCB 4WTOB 4LFCJ 1HQ2A 3GYNA 5CYJA 3CO9A 2QYCA 1N32F 2W2MP 1Y00A 1NSAA 1NU4A 1R6YA 2RDDA 3V6DB 3OFGA 1RDRA 1ULRA 5HATA 6FD1A 4DBQA 2GNKA 3AOCA 4U6PA 3SV3A 5GMEA 2AGPA 2D1CA 3FQLA 2IAJA 3UNGC 1Y9OA 1MWYA 1JLCA 4TLQA 3CCES 1VC5A 3QGIA 2D41A 1C2PA 2DXEA 2LLZA 2OAUA 5LSLA 1HBNA 3UPFA 3HVRA 3TAQA 5CXTA 4PG7A 1S9GB 1OS5A 3QNWB 4WP8A 3ITHA 2XS5A 3ZZOA 4OYAA 5HLFB 4DMZA 1ZTTA 4K5RA 4N47A 1QVGR 4W4MA 2CYYA 2F4VJ 4OYMA 1NPRA 2CJKA 1HNIB 3J7ZT 1YJUA 3AFGA 1SJFA 3H5XA 2RIJA 4B02A 1F2HA 2H51B 4ZVSB 4CO3A 2XZWA 1X8DA 2YWEA 3KWMA 1N33F 4HHUA 6AT1B 2CG8A 5DZ7A 1UA1A 4OYWA 3IAM9 2J9DE 4OI0A 3KK1A 5DETA 4CM2A 4JV1A 3DOMB 1NK8A 1VCTA 3ZTQA 4OIXA 5AXNA 2DHXA 3TA0A 2QJ3A 5EWEA 2CG4A 5MAOA 2RVJA 4HH0A 2EFNA 2CVIA 4RUCA 1C0UB 1U1QA 1MLAA 1G1XA 1KTQA 1RT3A 4I6AA 2N3OA 4KTQA 3IGNA 1TV6A 4EZ9A 1CJTB 2QV6A 5IT9U 4WIIA 4N7TA 2VJUA 2CQBA 4KYZA 1JX4A 1X5TA 4UOGA 5J1PA 4WE1B 4LIWA 1LW0B 3CPWR 3KG1A 4AQYJ 3V4IA 4M95A 4OV6A 1F0XA 2RMLA 2JEFA 1TAQA 2EKYA 3D6HB 3IR5B 1KOHA 1FRKA 4QR0A 3TX0A 4B3OB 3NGDA 4AXJA 4ERDA 4I4BA 4DFMA 4LRFA 3KMSA 2K1RB 3HO1A 1WD6A 2H5IB 2ILZA 2Q3PA 3I0SB 4U67Q 1UKUA 1UEUA 3KK2B 1JLAB 2F4FA 2V69A 1N5SA 4IYQA 1U48A 1UVIA 1RTZA 3SI8A 2XNQA 5BR8F 2GO9A 3M6VA 4WBFA 3GJQB 1T94A 4UF4A 3PW2A 4NA1A 2LQBA 2PA3A 2VA3A 1SKWA 4A4JA 2DR9A 1FWLA 1TL3B 2BE2A 3W1YC 5KFDA 5HVHA 5KFFA 3LUYA 4K4SA 3HHLB 4K5SA 1S1TB 3I0RA 3M8PB 4GMKA 2ZC4A 1JLEB 2AP6A 2W2OP 3D1QA 5LM7E 2EWHA 2KT5A 5CD4A 1SVDA 4DV1J 2K3IA 4IQMA 2V0NA 4IG3B 1U1MA 4TXSA 1C4AA 1LFPA 4LRBA 2RRAA 5ETSA 4BLGA 4IOAQ 1PYSB 2AJFE 1AZSA 1EHWA 4LJMA 2PGCA 2R42A 2X7IA 2JEIA 4Y28C 1TMMA 4F4AA 4OX9J 5GAGI 3RB3A 2DCLA 3RR7A 4K50A 3KG0A 1Z2ZA 4NEZA 3M7VA 3BO3A 3NGTA 2W25A 3UR0A 2VG7B 4KT0C 1WKJA 5B0GA 5I3PA 2NXJA 3P5TL 1JLBA 2J6TA 4AL5A 2B4UA 3I32A 1MWZA 3W2WA 4L76A 3RAXA 1IKVB 4PWDB 2DK2A 4EBCA 3DI6B 1CBKA 4ZCIA 3QIDA 4I2QB 5J2NB 1YHQS 2R8HA 2LMIA 1N36J 5L1IA 4LFBF 3QO9A 2ZM6J 2M0GB 3HZEA 3NY0A 1HWIA 3DOKA 3MM5A 4OX7A 2H4YB 1FE4A 2KXFA 5EX0A 4OX8A 4ED4A 2L9WA 1WC4A 5ETLA 2ZH6A 3KKFA 3MEEA 3NAIA 2ZOMA 4KPCA 3C2PA 2E1AA 4DX5A 1W2BR 2KVQE 4R5PA 2YKMA 1WKKA 3D67A 4EZ6A 3R2CJ 2HHWA 3GIIA 1UJ6A 5HBMB 5C5JA 1F2GA 2GZOA 2IM0A 2V9KA 2ZE2A 3HJFA 4CLLA 3VAMA 3UWTA 4ED5A 2JLFA 4U8YA 2VD3A 4F2RA 2HPUA 2DIVA 5DQGA 4DV4J 1WEXA 2V8VA 1IBKF 3MUTP 4ZVTB 4A8SA 3Q86A 1H7WA 3B54A 1C1BB 3D1HA 3DRSA 3N5FA 1KWMA 2W4PA 4FYYB 1S6OA 4L72B 1AFIA 3BKUA 2X1GA 4ICLB 1TL7A 4ZDNA 3T41A 1LEOA 4W90B 2D3ZA 2F65A 3Q22A 3NNAA 3UVJA 1O0PA 1S6PB 3GMGA 3SQGB 3HMJG 2FHMA 1RWWB 4RW9B 1L3VA 4NCBA 2CPFA 1WHXA 1JLGB 2YBVA 3DRXA 1S1VA 4PZVA 2BDPA 2B6AB 2L08A 4OHVA 4DCPB 3LOUA 1FD2A 1FNXH 2WTFA 1YWXA 3AODA 1U6ZA 3FUYA 4Y65A 4U9RA 4KGMA 4W98A 2CPJA 4WCEQ 3IN5A 4J9KA 1RGVA 3R5BA 3BJYA 3MURP 3EPIA 3SCIE 4LBHA 1YZ6A 2UVVA 4HACA 2LQ8A 2MMYA 3EVWA 3FQKA 1Y10A 1TL4A 2XM3A 1HD1A 5A8WB 3POTB 5HQ8A 3IG1B 3B8HA 2DGQA 3HHDA 3TUZC 4NLDA 3EDRB 3LO3A 1EQMA 1BE4A 1FEHA 3VGSA 4YDDB 4JI3F 1DAXA 3AD9C 2V8PA 2I5JA 5E41A 3PEHA 4KPYA 1SKUB 5EHHA 1RBAA 2GS8A 4HDHA 2YKNA 3QT5A 1BQNA 2JLEA 3NOCA 4JI4J 2RUSA 1FRJA 4K4VA 2R8JA 2IRUA 3HKWA 3C3LA 2WONA 2DNYA 2DH7A 2BJ8A 2ZWOA 3BQ2A 2GFFA 1HYSA 2DR6A 1F3VA 2MLZA 2RRBA 4ZVEA 1QE1A 2G2ZA 2HMIB 1P6TA 2IDEA 4NZ0A 2KO1A 2Z4PA 2DJWA 1VGYA 3FSIA 1JLQB 4DSKA 3JAMU 3F56A 3W62A 2XMAA 4AUKA 2Z2LA 5A8KB 4O3OA 2X1FA 3ZZZA 3NL0A 3TAMA 4C11B 2BW2A 2WW4A 3O1LA 3KHHA 3T1YJ 1RTHA 3EXYA 4OZ2A 4NCGA 4F4YA 3T1YF 1TK8A 4NLRA 3FCHA 4DS4A 3MMAB 4QOTA 1XIQA 1HI0P 1RAOA 2I9SA 1ZZNA 4JYAJ 3DRPB 2ZJPQ 4FYWB 4RNHA 1EIYB 5C2GA 3QWPA 4WWSA 2VG6B 4F67A 3AD7C 1L3KA 3WC0A 4LRAA 2DNGA 2ZOFA 2J76E 2IJNA 5EWGA 2KFYA 2OPQA 1G6BA 4P75A 4B17A 4KHPF 4F36A 2C2KB 3DDKA 4IRCA 2MHNA 2HHVA 2NYHA 3HHLD 3IWLA 3NGKA 2XGQA 1Y5LB 2R7QA 3MCNA 1T05B 1LQ9A 4Q2LA 1X60A 2FLNA 2FVCA 2HQFA 1FX4A 4DV0J 1TVRB 2FJWA 3G2XA 5A0YA 3VQTA 1IM6A 4IRKA 1B70B 2AQ4A 1PIEA 3LP1A 1FK9B 1IR1A 3AA8A 4LSLB 3KUGA 3CCJS 2BA9A 2Q66A 4DQSA 4Q0BA 4B3MF 1Y4ZB 1DTTB 3OR1A 3MXHP 2R7UA 2RJZA 3RRHA 1VC0A 1UVNA 4I0WA 4CCHA 1ZM3A 3V4MA 3SFGA 1IR0A 3RW7A 4RPFA 2R8GA 3S01A 2E1PA 2GX8A 3CSKA 3MECA 3QT8A 4KR0B 1KSPA 5KFTA 3GV8B 4RNNA 2UUBF 4USHA 3I5CA 1WC1A 2V68A 2R3VA 1NLKL 3KLFA 2B6AA 3PEJA 4OI1A 5CAAA 4DR5J 1Q7LB 2LECA 1RT1B 2FC8A 5E7OB 5A2QU 3JS9A 1BHNA 2QRRA 2VA2A 4LF6F 2XMVA 4DSEA 4OX6A 4LF6J 1AROP 2ZKTA 4RZRA 4ED1A 1XTZA 3G82B 5B08A 1REVB 2MEWA 3MM9A 4HH1A 4EFAC 5KFXA 1DQ9A 1K1SA 2VBYA 4JI8F 4LF5F 3IGVA 4F02A 4LF5J 2CQHA 2MSTA 5E3AA 2WHOA 3SDEA 4DV3F 4LF7J 4NXMJ 4CLWA 5JJBA 4IO1A 1QSSA 2GHPA 4MFBB 4NXMF 2MQPA 1YTYA 4MFBA 1JJ4A 5DRKA 2MLXA 3KJQB 4OZ3A 4GC7A 3JB9k 2HQGA 1T3OA 2YKMB 4IG0A 4I2PB 1HHTP 2IVMA 2DGVA 5I3UB 1YKWA 5F0WA 4KH1B 1T9TA 2F4VF 4U8VA 2GCFA 3EJMA 2DKOB 3RAQA 2E5LF 2QZ8A 1OYDA 3A3NB 2DO0A 2K3KA 2O1PA 3MM5B 5KG1A 4UZCA 4DR4J 5FJ4A 3R8YA 3T5JA 3M1VA 4CQ1A 1ZM9A 2K7KA 3OXGA 4WYLA 3V2UC 5IV4A 3MAAA 5KFNA 1NJWA 5J2NA 1QD1A 4NPOA 3QJPA 4M5LA 2OPSB 1IJEB 2DGXA 3DHXA 2I8EA 3PW4A 3J7A1 1RYRA 3BGUA 3QIPB 3N01A 2VFTA 3W2WB 4DN0A 4CNZA 4X66J 3GIMA 4DWIA 2LCWA 1MMNA 3A8JA 2WVFA 3MECB 4XO0A 4JI0J 2VG7A 1M5KC 4DV5J 1VQMS 1BY9A 1ITPA 5KFPA 2CDQA 2R7OA 4URSA 3ICLA 1PJ5A 2QGFB 1FXDA 5AE1A 4DV0F 4NLGA 4J9RA 4DUYF 1UWBB 3R7NB 1LXNA 1H98A 2NPIA 1HD0A 1I3OB 2HAFA 1NCLA 2ZDOA 3D9BA 3M2UA 3CDBA 5D0GA 3TJ8A 2BYCA 3ZFVA 1U4BA 2WVCA 4TQSA 4YOEA 1NJXA 4ANCA 3AQOA 3TNVA 4FS1A 3UD3P 3BBBA 3CW2C 1HIYA 5A0YB 3D0HE 3VV2B 1HNXF 5FDLB 8RUCA 2X51A 2CPIA 2E5IA 1JLEA 2QT7A 3I4PA 1FXRA 2FIUA 2VUGA 3DYAB 2KDOA 1RWOB 1U26A 1QM9A 3HLUA 2VFVA 5KG0A 1VQ7S 1FJEB 2VBZA 1U7LA 1IJFB 4XTTA 1S0MA 4B9SA 2JSXA 3ZZYA 2B9EA 2XSJA 4X2BA 1LKZA 3E01A 5EN1A 9ATCB 4W92B 4RR5A 4KFBA 3HF5A 2ZJQQ 3SZ2A 1LK7A 2RD5C 3TUIC 4TU8A 3NWGA 3BPDA 3W3SA 1RTJA 4KY3A 2J0QD 2C2MB 2HWTA 4L6V3 3I55S 3SCKE 5J2QA 4XPCA 2C2NA 1RHUB 4WE1A 1PAUB 4WTYA 1IKYA 3K58A 4CLFA 3T3FA 1FKPA 5RUBA 2HQCA 1XBWA 3CC2S 1TV6B 4IH6A 2CQGA 2G0JA 1U02A 1YJRA 3BREA 2N7CA 1VIXA 3W7BA 3G96A 3PVXA 3KOAA 4HYKA 3PG9A 1H2TZ 3OLAA 2PI4A 3EGNA 3FBFA 4ECSA 2OO4A 3KHGA 3MR3A 2HFNA 2WVDA 4A48A 2FLPA 1BD6A 2F1FA 4K7QA 2NZ4A 1JJ2R 4DV1F 1UEKA 5KG2A 1NDKA 3L95X 3G71S 1YG0A 3ADAC 1VRUB 3J80U 1GEHA 2ZHBA 1T9YA 2DB1A 4LFAF 3MPDA 3MAQA 4LF8F 4QR2A 4V1Ak 1UFLA 5KT6A 1CJUA 1VJWA 3H90A 3UN2A 5HJXA 4U95A 5HLFA 4PRFA 2OSRA 2YNFA 3FSYA 1JNZB 1FE0A 1XWLA 4J90A 3CCZA 2W8KA 1MW7A 4OJHA 1F5BA 4PG8A 4ILLA 2KFZA 2UXCF 3KHRA 3MUVP 4JB8B 3HHKA 4CLYA 1CJUB 2XYGB 4KGVB 2ALYB 2IAJB 2DY9A 1ZM2A 1FFSB 1Y0HA 1YRUA 4O44B 4DV7F 1GMWA 2XMWA 3FJ2A 2AYEA 3D4JA 2FVPA 3DMJB 3SQGA 3DOLA 3ISNC 3VZHA 4Q45A 2ZM6F 1YITS 3DLHA 4V19X 1IBMJ 4ZS6A 3C15B 2WAQD 4DR6F 4C7QA 4DS5A 3NS5A 4O3SA 2DNNA 4DXLA 1NJYA 4P10A 2ZBPA 5B0DA 3G9CA 2I6WA 3DLEA 1NUEA 2W4DA 4ZCLA 4Q43A 4DX8H 3IBWA 3H5YA 2ASYA 1A7GE 3OLBA 4QU7A 2JHEA 1WHWA 2J0XA 5D0HA 4Z7CA 2Z30B 4OFZA 1AFJA 1WG4A 4UUWA 3D2WA 2F7VA 3I5BA 2F63A 1IKYB 4H4MB 2O01C 1MU2A 3U1MA 2MY8A 7FD1A 5I3QA 4X65F 2Z56B 1D9AA 2GQQA 4CNYA 1M5OC 2XHWA 4DU7A 2JLGA 2BXJA 3HSDA 2HWHA 1DQ8A 2M52A 2PMZD 1OPIA 5AXMA 2VASA 2V2QA 3FC9A 3NGUA 4NLQA 4NA3A 2WOMB 1IKXA 4CLKA 3IMQJ 5B0CA 3MTJA 4FDFA 3NBPB 5DQHA 2YH1A 4EBDA 4I2QA 1JWWA 1JKHA 3FRYA 1YJ7A 3FK4A 5ITHA 3OJUA 3C16A 1SL0A 3CMQA 5CCMA 1KOOA 2EBGA 2E9TA 3DN9A 1KR4A 1B0VA 4M5DB 1XR5A 2MSSA 4DV5F 3RBXA 3O6QA 5L1KA 3G8QA 2OP5A 1ZTWA 2CADA 2IBKA 4XDCA 1IR2A 2FLLA 1G3OA 2VU5A 1JXEA 3C14A 3EZ5A 2ZFHA 4DSLA 2HQIA 4K2JA 1SC6A 2ABYA 3NLCA 4L3NA 5B0EA 3W5XA 3OXLA 4M5HA 5AJ3J 4ZP7A 2RQCA 3CC4S 2XO6A 5CYQA 2ASJA 4WZQA 3BM7A 2NXUA 3OXFA 2I2YA 1MROB 1DTQA 2LP4A 1BWVA 2M70A 3M8ZA 5HAOA 4ZHRB 4LF4F 2KZZA 1UCNA 3UDCA 2VH7A 1SIZA 3D66A 5D4LA 2DBBA 4DQPA 3NCRA 4MT1A 3QIPA 2A0FB 1XQIA 4QBUA 1TKZB 3WDOA 4DDFA 1K8AT 3KLEB 3CD6S 1A6LA 1RK8A 2CJXB 3PJWA 4KIAA 4ZVRB 3MMCB 4FVCA 3IRWP 3I31A 1VQ8S 3LALA 5LMUF 4PUOA 3PIOQ 3BKFA 3CJQA 2QEXS 4C4WA 2KT3A 4DL6A 3M30A 4DSJA 4B9TA 3OV7A 1UPPA 3ULHA 3BKTA 3MFHA 4PQAA 4ZITA 3HFVA 5L9XA 1N5YB 2GQ2A 4F0KA 3ISZA 2W2NP 4QW9A 1Q8KA 3I0SA 3KK2A 2MZJA 2AMCB 3Q8SB 4Q7AA 2RU9A 3D0IE 2EBEA 3JQMA 2B8PA 4TY8B 2OJ3A 4YMEA 4MK8A 2MKIA 3BB5A 2MGZA 1XNRF 1TMJA 4O4GA 4WIQA 2Y8YA 2ZBQA 1S72S 4OMFG 1KRPA 2GIQA 3F41A 1UAWA 2QMUB 4KE5A 1S77D 1RT7A 4OZJA 2DVIA 1LW2B 1N5QA 2GA7A 1XJWB 4RWWA 3DRYA 1CJKB 1VBKA 2D9PA 4ZMMA 3X1LB 1NSKL 2DNZA 7FDRA 3GZ7A 4A47A 1P1LA 3BGFA 5AE3A 1VC6A 5DLFA 2VPWB 4WF9Q 3I87A 5F41A 4O4RA 3H7HB 4N41A 1K44A 1TFWA 2GIRA 3JAMY 1NDPA 4IOCQ 3BN4A 4EWTA 4EYIB 2KXNB 1GNKA 2UZAA 1RA7A 5HQLA 3OSNA 2OIHA 2KG1A 2L48A 3CDEA 4LRDA 2N82B 4E98A 4ES2A 5K8OA 1S49A 4ECTA 1Z2LA 1WHYA 2HG4A 3G87A 1S1UB 1QVFR 3LWMA 4LR8A 1LWXA 3VVTA 3O3LA 3PYFA 4PXCA 3TUJC 4BC9A 1SC4B 2HS0A 4LSLA 3KK3B 2VQEF 3FEXB 3CCSS 3LP1B 2JFKA 3B82A 4ZPVR 1TELA 1JMTA 1P27B 2B9WA 2XI2A 3B6BA 2MDAA 4KRWA 2AEJA 3MR5A 1VRUA 3LP2B 1T05A 3KLVA 1RHMB 1VK3A 1UVJA 1FTCA 1VRTA 2BJ7A 4LMZA 2PC6A 1KQKA 4YY3F 2HGMA 1O51A 4N8NA 2B7CB 4USWA 1I6JA 1T11A 2MHEA 3GB0A 3VAGA 1AW0A 1S48A 1FA0A 3MCOA 3U27A 4ER8A 2NPFA 2C3UA 3ZTPA 4FBTA 2PMHA 3DDNA 4CTAA 2VG6A 4GKKF 1KEKA 4JI6J 3ILIA 4FF2A 3K17A 3R5GA 4C3LA 5K8MA 2VICA 3BGRB 4HDGA 5ETRA 3UO0A 4ZPCA 3K89A 3KNAA 4R0EA 5KFRA 1VQNS 3LGNA 1FJ7A 1RTJB 3J7YI 4YQWA 4WXOA 1FKAF 1FRMA 4NCGB 5F3ZA 1RKJA 3IXQA 4F4ZA 2HNYB 1FVQA 4KFBB 3QT6A 5A8KA 4ZLJA 2QSWA 2ROEA 1FFWB 2W1BA 3LTOA 4CT8A 2BR0A 2EEYA 2K2PA 2LFVA 2H9ZA 1SV5A 3PR5B 4EU0A 5KFKA 1GT8A 1WSRA 2W2PP 3FZ2A 2V67A 4WKYA 5ETKA 1FERA 2PDAA 2ZH3A 1U49A 4GKJF 4F4WA 2WONB 3DXSX 2W9CB 1L3TA 2WW8A 3AOAA 2ERRA 2YXLA 5IZHA 4X66F 4PPZA 4R8UA 2WVEA 1OWXA 1BQNB 1S6QB 4OJ3A 4X84A 1K73T 1TKXA 4QR1A 5D8HB 2F40A 2CA9A 2J5AA 4EYHB 5H9FJ 4DLEA 2I5JB 3LW5C 4JI0F 4X65J 4ED8A 1URNA 2XS7A 2BVZA 4PYAA 1CC7A 1PAEX 3O5TB 1BQMB 4AL6A 4CLSA 2NREA 2VODA 3IG1A 3HJVA 3ZNJ1 2CPDA 2U1AA 3DNCA 3M8WA 4HACB 3CIMA 4WFYA 3G6XA 5T7LB 1EP4A 1HBUB 1NZAA 2BMBA 1W26A 2FGCA 3H2VE 1Q82T 2IRXA 3G86A 1RUSA 1W2IA 3O44A 1XMBA 2EXUA 4ELVA 2KG0A 2LEAA 3CJ0A 3VALA 5BYRA 4JI5F 1WHVA 1X5SA 1PG5B 2VDHA 1S1VB 3RYLA 2VZ9A 3EX7B 1Q79A 2B9YA 4K4ZA 3OFEA 2YNHB 4R25A 3A4TA 2CQDA 3T1HJ 1ZETA 3C6UB 1F6TA 3GFYA 2KYZA 4DR2F 1KVIA 1GXUA 2HVDA 3UNYA 2CPZA 1HNWF 4ECVA 3MWBA 2KZMA 3BSAA 1FXLA 4DR7F 3IRXB 4YHHF 3AAWB 5IM0A 3ENWA 4Y6IA 1S57A 2VPZB 3VQSA 3I96A 4CYUA 1H3DA 2ZE2B 3M4XA 5M2RA 3WZ0A 1NNDA 4CT9A 1RABB 3D28A 5D3GB 4RJVA 2C2RA 3CXCR 5EWFA 3CJKB 3HCXA 1WNEA 4LF1A 2KT2A 5HI7A 3ENVA 4JI1J 3BEGB 4CM0A 4NXNF 1ELOA 2HURA 2N7YA 2DGTA 1KLNA 1RAHB 3PNIA 5LMUJ 3EGVA 2VJVA 5HVGA 1REVA 2JL9A 2VFUA 4IDKB 4LF2A 2BJEA 2OEMA 4P7VA 1N33J 1QY7A 1WUUA 5IC6B 1IKWA 3NMRA 2UUWA 2KL8A 1UVMA 4TYAA 3FBEA 2ADBA 2YNGA 4TKTA 2YPZA 4N77A 2OH2A 1RT1A 2Y1RI 3PYEA 2ZBRA 2G9OA 1F3FA 4DPXA 2QFIA 3FFIA 1UZDA 3KLFB 1Q95G 1IKVA 1OSDA 2CFXA 2CPYA 2JNJA 2QA1A 2RF2A 3GYGA 3Q83A 5KFAA 5F8GA 3TEGA 1Q5VA 2MJUA 1TK0A 2HFOA 1VK8A 4RU2A 1GK8A 2B5JA 2CAJA 3MM7A 3M8SA 4LQ3A 1HNVA 4WXWA 4RW4A 1MG7A 5A6PA 3CCQS 1VBXA 1AUSL 2F8EX 1LWCA 2NSCA 1KONA 1C4CA 4C9DA 1Q1KA 4B3TJ 3THVA 4RW4B 2Z2MA 1HNVB 2GMLA 2PE8A 3HSGA 3N6MA 4ZVOB 1UFKA 4UTGA 4BWMA 3PO4A 5F9LA 4FBUA 3M8QB 2CQIA 2W9BA 4ECQA 2Q79A 4NZ6A 3FGVA 1TVRA 2ACMA 2QL5B 3BBCA 4D3HA 1FDNA 3FFIB 4IG3A 4DPWA 3M9NB 2KFNA 5DG9A 3CT9A 3Q23A 5F8HA 1KDNA 2AJ0A 3I0RB 1UFWA 3MTKA 4DEZA 3DFEA 2KU7A 2ZH4A 3C66A 1FRLA 5ETMA 4ETZA 3MD3A 3AHPA 1RI7A 1SPBP 2EC2A 3DGVA 3GCWP 4OZNA 1A0OB 4ZCKA 5BYSA 4U7UD 4LR9A 3FBBA 2AYGA 2YH0A 2HGLA 4IO9Q 1X5PA 2BANA 2VDIA 2MQ8A 2HFSA 2RRNA 1V5VA 3CDWA 4NYOA 3F44A 2FB0A 5C24A 1DARA 2AWZA 5LT5A 3ILLA 2Z0GA 2DRBA 5DLGA 3BSCA 4M8LA 4N5SA 1RXOB 1YJNS 4NCAA 3DRPA 3BF4A 2CKWA 4F2SA 1Q8BA 5D3GA 4X4UA 2EG2A 2LEPA 2FDNA 2VBWA 2FYXA 2AHOB 4ZVGA 4DPYA 3MMAA 3HX9A 3TP2A 4J9PA 4ECWA 4FNHA 3RRGA 1KQFB 4HL9A 4QYZK 1VFJA 2AV5A 1RSCA 2OPPA 2KRBA 2RDIA 4JI2F 1QAYA 2PN6A 4HT5A 3VTIA 1Y3KA 3OUYB 2W4CA 3IWXA 4C0HA 5HP1B 4P9SA 3R6GB 1J5EF 4NLXA 1RACB 3L3CA 1CJTA 2G0CA 2QMWA 3IS9A 2LDYA 4ZPWR 3GFZA 4RUHA 1OO0B 1JIHA 3QGPA 5HMYA 1E6VA 4M5IA 2EG1A 1QE1B 3C6UA 2C2DA 1U1KA 2BRLA 4PQUA 4F50A 1NMEB 2XWXA 3NCPA 4WFZA 1UTAA 2IJRA 4CLPA 4IH5A 2WB4A 1NO8A 1UVLA 2JRSA 1Q8IA 4U7CA 1DLOA 3PFEA 1I5OB 1RT6B 1OMSA 3H2LA 1J2VA 3US5A 1F9EB 4ZK7M 5HMXA 5DM6Q 1YK9A 1T03A 2IY5B 2LA4A 2ZWPA 1FCAA 2AJ4A 2DTJA 3OTOJ 3OW2R 2IC3B 1RADB 2RQKA 1R7IA 1RT2A 4QWDA 1X31C 5AXLA 5HL7Q 3MOZA 2M7SA 2BJ3A 2QA2A 5FD1A 5LMNJ 3NRBA 2ZZNA 3VGUA 2EK6A 4P71A 4A46A 1Y3JA 1K1QA 1G4CA 2LYVA 3ETMA 1RAGB 3TEHB 2ZD1B 2DEIA 1FRXA 1CJVA 4MIWA 4X64J 2EC0A 1T03B 2HNDA 4K2XA 4FP9A 4K4TA 2RS2A 4JI5J 3P96A 2PIIA 4X62F 1Q4RA 4FYDA 1UMJA 2NZCA 1V3SA 2YVSA 1GFWB 1O6XA 4X4QA 2XGPA 4DV4F 1SL2A 1IBKJ 3MDFA 1JLGA 1NK9A 2GAHC 2VC0A 4DR5F 5LSOA 2RQMA 3UVJB 2ASDA 4C97A 1BC6A 1OY8A 1T3NA 1WG1A 2YX1A 3R1LA 1KD1T 2UV8G 2NXCA 2FY8A 1C1BA 4DQRA 2WBRA 3V81A 2HNYA 2DHGA 3NGRA 5KFOA 2DNQA 2PFDA 3QQCD 4WFBQ 3OUYA 2R8IA 2OTJS 4MK9A 4AL7A 1R8AA 2WK4A 3R97A 2J8SA 3ONQA 1Z4UA 2GQCA 1AT1B 3QZ8A 1KP6A 3UDVA 1H73A 3TANA 5IT4A 1D0EA 2KYXA 2FQQB 4TLRA 1U2RA 3BGRA 5E3CA 2Y9HA 3K5OA 4MYUA 4C8KA 4R5PB 3CTRA 3D7SB 2VKZG 3TJAA 1TKTA 4DL0C 3PKYA 3T9ZA 1X4HA 3B78A 2ZH7A 1PJ7A 1FDAA 2HVZA 1HL6A 3W8GA 1GXTA 1VISA 4H4KA 5F8MA 3CWJA 1FT8A 4KO0A 2QN6B 3FCWA 2P6TA 3WIUA 3JSMA 1RBOB 1GTHA 1J5OB 3ZZ0A 4DF4A 1YI2S 1JK9B 2CVEA 3SQOP 5BJRA 3AD8C 1VLYA 3I9ZA 1KKHA 3K8WA 4H4OB 1WTFA 3RR8A 1EAYC 2HKEA 3A3PB 4PWDA 2GVZB 3K57A 4IFVA 2BQUA 3BH6B 1NKBA 2AIRB 2RH3A 3CJ5A 5IV3A 2CQ4A 5ETOA 4PYDA 1SJ1A 2JDJA 3DRRA 3U7JA 1XMQF 4EK2A 5AT1B 1S1UA 3MM8A 1XNQF 3EM1A 3M32A 1X4BA 2GMHA 2QTWA 3DLJA 5HVFA 3Q8PB 1YIJS 1I94J 1RWVB 3AJDA 1D09B 2HRTA 2MKSA 2H3EB 4Y3CA 4J9SA 2RKIB 3KLIA 4ZPBA 4YB6A 1PSDA 5L46A 3W2VA 1N4LA 2JFDA 2ALZA 1YRTA 2VV5A 2W7OA 2X3DA 2E1MC 3SCJE 2J7KA 4QWBA 2QLWA 3R5AA 1RU2A 3QSIA 3TX8A 1VQLS 1MWQA 2YNGB 1SCJB 3OTEA 1RCXB 5HROB 3Q8QB 3BQ0A 2ZNZA 4OLOA 3CMAS 1OY6A 1WI6A 1Y11A 2MQOA 1M90T 4JI4F 2Q6BA 5HJYA 5MLCV 4B3SF 2GHWA 4K4XA 3Q8YA 3OL6A 2YPYA 4UOCA 1L3SA 1Q0NA 3W64A 1VLOA 3CJ8A 3K2YA 2E7XA 1B64A 4JYAF 1UZHA 2WSFC 1RT5A 4DFJA 1RT7B 1NXIA 3HDSA 4WZMA 2K1RA 2GJ2A 3K5NA 2ZVSA 3Q8VA 1PJ6A 1L5UA 2WSCC 2MGZB 3BS9A 3VWSA 4WFXA 1ZA1B 2GV1A 4CO1A 4X4RA 3OTOF 3OVAA 3PX6A 3DLLQ 4FXDA 1UW9A 2OPRB 5LMNF 2BKOA 1RWUA 5IM0B 1BLUA 3BR8A 1RWKB 1PCAA 1M1GA 1RB0A 4RUBA 4ES1A 5KTQA 1KQSR 1N5YA 2XYPB 3GJRB 1GX5A 3D5MA 3MUMP 3JSBA 3TVZA 4ENOA 1EJ7L 2CWKA 1C0UA 2YNHA 2KJVA 4EO8A 5D6GA 1N54B 1N36F 1JXLA 2J8AA 2LQJA 1RTIB 5E33A 3JTNA 5JVGQ 1D8ZA 5JUMA 4X4PA 4B3SJ 2OFHX 5FIIA 1CG2A 1EX8A 4NWBA 1WI8A 2HHHF 1HMVB 2Y0SD 2HZCA 2CPHA 4TN2A 1YX2A 2C28A 3TO8A 3GWCA 4EGLA 1TUWA 1OJ4A 2CDRB 4ZHRA 1S99A 4KV8B 1DTQB 3M9OB 1NJZA 3GJSB 3J81j 4QW8A 2XTJP 3PZPA 2NQPA 1REGX 3PW5A 1DRZA 2DNLA 3ET6B 1Q7YT 2HNZA 1H0HB 4KJIA 3OHAA 4RWXA 4FF1A 1LV5A 4DCJB 1H2VZ 3L4BC 1VQ4S 2YNIA 1TKXB 2OD4A 4ZLPA 1S6QA 2VG5A 2MZ1A 3Q0AA 1KS2A 2AJQA 2VC1A 1FTRA 3SCLE 3CJ3A 1HQEB 3BSOA 2BW7A 4H4OA 3LGHA 3ZXWA 4O3NA 1AA1B 1RJJA 5IWAJ 2GAGC 3AY0A 4ID5A 3M6WA 2NXNA 2UVUA 3A3OB 1VQ6S 3HT0A 2PO4A 4JV5J 4Y2KA 1N8RT 2M2BA 5KFUA 4CIOA 1K9MT 1QDUB 2L3MA 4KQZA 4ALZA 2FVQA 4QU6A 4M5NA 3CJTA 4Y34A 3H59A 3HSJA 1Q5YA 2CNLB 4K8RA 2XLJA 1Q86T 1QTMA 3J80Y 4MTPA 3TWZA 4ZPDA 1R0BG 3SSSA 2VQFF 4RUAA 3P4UB 5M2UA 5T14A 5DG7A 3PJ9A 5D0RA 2OEJA 1K47A 2E5HA 4KKOA 2ILYA 1S79A 2X1BA 4PKDB 3H0PA 1FESA 1RA6A 3KUEA 4Q2MA 3UFCX 4DUYJ 1JLFA 2V63A 4O3RA 3LAMA 3LA0A 4HR2A 3AJ1A 1F5CA 1OQ6A 1Q53A 2YWFA 3D0GE 4F25A 4Y0FA 1HPZB 1CULB 2GIFA 3KG4A 5J1NA 3SIPB 2HBZB 1R6VA 5GADU 5DO2A 2E66A 2ZDPA 3CCWA 3DMJA 2XCAA 3N79A 1U1OA 4WU3A 4UY8T 1GMWD 2BM0A 3FSXA 3LP2A 4ZN3A 1NKCA 4O44A 1HQEA 1EB0A 1V9OA 2V50A 4OV1A 2XQCA 1V3ZA 4ZVPB 3MM6B 3TJ9A 3T5KA 1R43A 5CQGA 3TARA 1X4GA 4J9MA 3KK3A 2YNIB 2NCKL 3BPSP 2WB1D 4E2FB 2HNDB 5GAHI 4ECXA 4KB7A 1SJ4P 4DOZA 4GVBB 3BYPA 2R8KA 5M2PA 3HT3A 4FF4A 1CVJA 4PG4A 5CHCB 2DIUA 2EFVA 4WP3A 3MPVA 2RDJA 2HLUA 2ZH2A 3HD2A 3CCRS 1LWFA 1T9UA 3CIZA 5GAEU 4LREA 4FXWA 4ZP8A 2IC3A 4A8XA 2AX0A 3TZWA 1NK5A 1QSYA 1P9QC 4B9UA 4KV8A 2P5VA 3W60A 5HK4A 1R8BA 4LSNB 3LGMA 1HBMA 5KFEA 3HVTA 1KFDA 1J5OA 3RUBL 1RISA 3ZZPA 4CWBA 3V6JA 4UY85 1RAFB 3TYTA 3EGZA 1FKOA 4DCOB 4UQGA 2ATLA 3FEZA 4USVA 1F1BB 2XWYA 2YKAA 3IWNC 4IH7A 1C1CA 1HBOB 2Y0BB 4P7TA 4DU8A 3M8RA 4AYBD 4JI8J 1GMVA 4OLPA 1XERA 4Y2CA 5E3QA 5LL6d 4X4OA 4NA2A 4TYBA 2L41A 4Q8EA 4P2FA 2EFQA 1RE1B 1BGXT 4G6VB 4LFBJ 2C3YA 2E44A 1XR7A 1TU0B 2HAIA 3UCZP 4QYZJ 3TQ1A 3BO2A 5L1JA 1FRHA 2BKNA 2KTQA 1S1WA 1MMDA 2V8GA 4USJC 1HNZF 1R31A 1VR6A 2JVOA 2VF3A 1ZAVA 4YUDA 4ED3A 3F0NA 3PRVA 4DL5A 1KNZA 2DR5A 2OD6A 3GR1A 2IPOB 1NRKA 3HD1A 3HP6A 2W01A 3QLHB 4M1KA 3WX8A 3RB0A 1HYSB 1FJCA 3QBCA 1SKRA 5J2PA 3G6ES 1TQLA 2MKYA 1RT5B 2BRKA 2RB7A 1RT4B 3E01B 1FWPA 5C24B 3KLGA 3P6YC 2X1AA 2HZAA 2HHUA 1TAUA 4H54A 3CB4A 1U25A 3QFWA 1C0TA 4NOHA 1U0HA 4QPXA 2MXYA 2A1BA 1NDCA 2EVZA 2PA8D 2FGOA 3EVOA 2AGOA 4JOUA 3DYAA 8ATCB 4QWAA 3I4HX 3EXCX 2UUCF 5HSPA 2YWHA 2HHXA 3T5LA 2PSZA 3RAMA 2CIMA 4H4KC 2C22A 4NYPA 5IS2A 3OPKA 3M8QA 2V8DA 4RO0A 1SJ3P 4HLBA 3CVKA 3CCMS 1R0AA 2QA4G 3GIRA 1QAXA 3M2UB 4F3MA 1FO1A 1DURA 3BV8A 3QAUA 1XK8A 2UV8A 2ZC3A 5GADI 3ILJA 5A2QY 4RKUC 4I56A 3IO1A 2P9CA 3HXMA 3UN3A 4OHYA 3MM7B 3LANA 1FJGF 4ECZA 3GSIA 2UXDF 2F5GA 5E3PA 1MN7A 4IFVB 5BYQA 1WACA 2MQMA 1KHVA 2H54B 5F8IA 2JVRA 2EFOA 4NE9C 4DR4F 3DHWC 3IBFB 3VR1A 2Y1LB 4P2MA 4I69A 4CH0S 2J9CA 1RAJA 2FVRA 2OKQA 3MMJA 5ETPA 3KTQA 4K4UA 1B99A 1S7HA 4UT4A 1UJ4A 1SXLA 2FJDB 2GHVC 1IM4A 3LQVA 4KO0B 5KFBA 3JSMB 3V6HA 2E9ZA 2C3PA 1NAQA 2CJ9A 3QZ7A 3TAPA 5SZTA 3TR5A 1VBYA 1T0TV 1E6YA 3C6TB 3KJFB 1HARA 4KC5A 2VBXA 4NZ7A 5DDOC 1WF2A 1YSJA 4KGKA 4ZVHA 3GPAA 2Q6CA 4I2PA 2D3UA 1RWMB 4JI6F 2JOQA 1JJHA 2G1HA 2CQ0A 4ZA1A 3UDLA 4C98A 2G4BA 4CO2A 2C2OB 4M5KA 4RLEA 2XMJA 4WK1A 2QLFB 1AYEA 4IFYA 4LIRA 1T9XA 1UWAA 4LVOP 2UXCJ 2YWKA 4HI1A 1RWPB 2LVWA 3L7OA 3CF5Q 2BE7D 3HHEA 4ES3A 3V81B 2V9WA 1SC1B 1RWNB 2HFZA 2HWIA 4NMXA 3TOQA 3S7RA 3GILA 5DGAA 2MQQA 2YQ1A 3C15A 4A8KA 5GAGU 3A8KA 1KLMB 1HKAA 3Q2SC 3HVAA 3BDPA 5IT0A 1YBUA 3I5AA 4OYXA 1TK5A 4PCQA 3TA2A 1NHKL 1U09A 1KVJA 4OQJA 2YQ0A 1U8SA 5KG4A 5KFQA 5AXKA 2RHQB 1P8GA 3AXMA 4C8LA 2F9JA 2K8GA 4IUFA 3CD7A 3FDSA 2FTRA 4Q44A 1U47A 5T7LA 4KGZB 2V4JB 3OT9A 1V3RA 1YVFA 1QUPA 1R89A 3KXDA 2M8DB 1ZS6A 2DRDA 3OVBA 4K4WA 4PABA 2DHHA 3THTA 2KB2A 4J9QA 3D6TB 3GG0A 1F60B 2CQ1A 4J5OA 2FLOA 4YFUA 4ED0A 1HA1A 1WEZA 4GO7X 2Z2ZA 3E3XA 7AT1B 3AB4B 1H2UX 4WU2A 1RT6A 1Q16B 4CH7A 3H5UA 3HK2A 3T6JA 4R8UB 1R0CB 1JQGA 2Z8QA 2ZKUA 4OI2A 1EKRA 2XMTA 4DPUA 3LPYA 5IT9Y 2DITA 2D3OR 2R2TA 4B9VA 2H1YA 2R2SA 4G1QA 4GKJJ 4PXEA 3LP0B 1SH0A 3KJNB 1S9EA 3PW0A 4BS2A 5KFVA 3NCQA 4QIFA 1NH7A 5KFIA 1T8EA 2PT0A 2CPXA 2R7RA 2DGOA 2UVWA 1AXQA 2FHJA 3S6EA 3VGTA 3W5YA 1YBTA 4ZLNA 4DUTA 1FKPB 5CZXA 3MOJB 4FVMA 4D3GA 4DG1A 1OY9A 3PHTA 4O3PA 3GQCA 4KAIA 4C8OA 3ZNUA 4AT1B 2UXBJ 2GVDA 4QYRA 3NP5A 2CNOB 2WBMA 2XI3A 1J5EJ 1RTHB 3BGLA 3PFOA 5E3RA 1B3TA 2LXIA 4FPIA 1B0TA 3DM2A 4LBIA 3J81Y 2GW8A 3RBDA 2C1EB 1EETB 1FFGB 4NLPA 4NRTA 5BR8J 2HHQA 4R0JA 2XSJB 3CJ2A 2DCUB 4CTAB 4WFAQ 4PG5A 1JLQA 5C2CA 3RW6A 1S9EB 1ZM4A 1TL1A 1H38A 2FJXA 4MKBA 4HHJA 3DLGA 1NEEA 4G1QB 1U1PA 4B9MA 5K9FA 2IM2A 3OQ2A 2HMIA 2C2ZB 2F9DA 4UUXA 3EE3A 2G13A 2K7JA 2N3LA 3MAHA 4O0IA 3Q8UA 4FKXA 5LXRA 4URGA 2J7WA 1NKEA 1AUDA 3U02A 3VAHA 2MZTA 3HSZA 4RL1A 3MEGA 4RW8A 1WORA 3JXOA 2I1RA 5FDLA 2M3DA 4UOFA 1XN9A 3FVYA 1K0TA 1FEEA 1N5TA 1N6QA 3CJ4A 3IFEA 1FI4A 1N0VC 4LBPA 1SJQA 4BWJA 5KG7A 2R2UA 4ECRA 4OX9F 3JSRA 1DJ0A 3MEDA 2VL1A 1NSPA 2WVBA 3MPWA 3SMZA 3KDNA 4NLVA 3HVWA 2QSFA 3RTVA 1TUGB 3A8EA 4XDDA 2JC1A 2XSFA 5K20B 2DGUA 2DY1A 2OFGX 4B9NA 4B3TF 5E5NA 1S1XA 2FUG9 1SQEA 1WELA 4DPOA 2BABA 2OTLS 4CLTA 1WOOA 1YJWS 1XMOJ 1S4FA 5K14A 2KHDA 2ZBIA 4USTA 2BBEA 5C25A 2GJFA 1P1TA 1U1LA 4A8OA 1DFDA 5HMWA 5HQMA 2XO7A 2FY1A 3TI0A 2OPSA 1PC4A 3R27A 3CCVS 3MAAB 4HTJA 3U1NA 5C42A 1NSQA 2CZVC 1BMQB 1UP1A 1IKWB 2QE5A 1S6UA 1RKIA 3GCXP 1IQZA 4HT7A 3W66A 4BCAA 4J9OA 3ENAA 4LFAJ 3EYZA 2B4PA 2D69A 1T9WA 3GFHA 2UUAF 1CJKA 1HQUB 9RUBA 2FPHX 3ZZRA 4DV3J 4LF7F 1ZYQA 1HLWA 4YHHJ 4DX6A 2NYIA 3M05A 4ZP6A 4IG0B 4OZ5A 4ZLLA 3QGHA 3QFHA 5KOWA 3IP0A 2XZTB 1YQHA 2CJAA 4NRUA 1VQ5S 2X3GA 3N28A 5KT3A 2JJ4D 3KFWX 4O4GB 4X4NA 4CH1A 5HBMA 1TKDA 4ILMA 2HHSA 1IXKA 1PKUA 4P52A 4TY8A 3SDEB 1LOUA 4UZBA 1M1KT 2AD9A 1PYTA 4E0DA 1B4SA 2J9EA 3SEOA 2E5LJ 4TU7A 1E6YB 2M5YA 3P3DA 2IMOA 4ANDA 3HULA 3IBCB 3IRXA 3H4DA 5L39A 2XLIA 3DOKB 1RQ0A 2OMOA 3M2VA 3R6LB 4C3MA 3KJVA 4PAAA 4JUZA 2DYAA 1WSVA 4NEYA 2ROPA 5J2MA 3C8YA 5C42B 2VPYB 3R7BB 4MH8A 4B3RF 5CCLA 2JWNA 2IM1A 1AB8A 2CJYB 3MEKA 5E0OA 2FC9A 4CRJA 3KLEA 2IA0A 3MHYA 3HPOA 5EUHA 1KTVA 2G1DA 5C25B 4PPDA 1RAIB 3QATA 5K14B 1V6HA 1HHSA 5CABA 5CD4H 1LWEB 5DDPC 1S1XB 2MZQA 5ETVA 4F7VA 5KFMA 1NK4A 1N34J 2XB2D 5FLXU 1MROA 3CDUA 4JV5F 2ATCB 4QIEA 1ZBTA 4I7FB 3PX4A 1RLDA 3ZTOA 1DTTA 2D9OA 1EZZB 3HHLC 3OR1B 4C8YA 1AZSB 2MKCA 1HR0J 3EZUA 2QL9B 3HFKA 5AJ3F 4X4TA 1FK9A 2ZH1A 3DDIA 2O67A 2O66A 1B0PA 1GTEA 2YTCA 3W61A 1DQAA 3C14B 3VF0B 1OYEA 3GTYX 3MMBA 2VQFJ 1VHIA 3IC1A 4DHVA 2OMLA 4YY3J 5I4MA 4DL4A 1X0PA 3F73A 2XHCA 3VAJA 3D3CJ 2WCXA 5KFCA 1RAEB 2DISA 2W9CA 1TL5A 1JKHB 2R7WA 3NNCA 4MYTA 2R7SA 1U0HB 3VGVA 5EDWA 1C0TB 1YBAA 3THPA 3NBPA 3DLGB 1WJ9A 3DLKA 3N0VA 4CDIA 2VHGA 3GONA 4DFPA 1S10A 4F8RA 5JMNA 4K0KF 1JLAA 2UU9F 2VONA 2EI5A 1ROFA 3QT7A 3UD5A 1HI8A 3R5CA 2L9NA 3DM2B 5B0AA 5DQIA 4OL8A 1ZAXA 2XY6A 4DL7A 2HVHA 2OGUA 1NH8A 2L9DA 4MKYA 5JXSA 1Y7PA 4B3OA 4Y2IA 4DV2J 1HW8A 1O5JA 1S7IA 4OZLA 1VMBA 1SBRA 2HEKA 4RU9A 4X64F 2MB0B 4OHZA 4BBYA 2V6AA 1YJVA 2DH8A 2DO4A 5A76A 3PHEA 4F0HA 2Y3YA 1LFWA 4MIAA 1IWAA 1RT3B 1RWXB 2HGNA 5SUHA 5F3TA 4JI1F 4NXNJ 4JI7F 5JVHQ 2W9AA 4DR2J 1KC8T 4UOHA 5F8LA 2HHHJ 2DR8A 2MZRA 3CE8A 3KDOA 3ZZTA 4WJBA 3KK1B 1VRTB 2WZ1A 2H5EA 2OHDA 1R8PA 2UUCJ 3B4DA 3BH7B 3EZOA 2ZVIA 4DL3A 3CMES 3MR7A 3DGPB 4ID8A 4NLUA 8AT1B 3Q8RB 3PACA 1DBDA 4GO5X 4YS2A 1YRXA 2OLWA 1FDDA 3RJMB 4LFCF 3I9V9 3PKMA 4M94A 2MY7A 2A3JA 2MTLA 3PRBA 4QIVA 4USUA 2ZUAA 1LWFB 1DZ5A 4MIBA 4J9NA 1N56A 1YGYA 1X4EA 3POTA 1HWUA 2NXEA 4BHQA 4IRDA 2FZGB 2ZZTA 5D15A 1RP5A 3M6XA 3EVMA 4OI6A 4OJGA 1X9SA 4ED6A 1SQGA 2V4JA 5B0FA 4X4SA 1X4DA 3QRRA 3MCMA 2J0WA 5IC4B 2KH9A 1U1RA 2NS1B 3FZBA 3CCTA 3MM6A 5GMKa 5KFWA 2B3TB 4XPEA 4JI3J 2P9EA 3T1HF 3DGPA 4TY9A 4L73A 2J0SD 3SSRA 2PD1A 1QAJA 3H42A 4BC7A 4OI4A 4DR6J 3HFZB 3G6VA 4DR3J 3RB4A 5FLXY 4C8ZA 1Q81T 1H72C 1FVSA 1S4EA 1DY3A 2IDLA 3MPUB 4I6WA 4QQBA 2YWGA 1MNEA 3IAS9 3NS6A 3P5BP 2Q1LA 4QJVA 2JEGA 2W7PA 1NDLA 1F9HA 1HR0F 2XZDB 1WF1A 4IOBA 3OL8A 3R7SB 3GSDA 1SKSA 5HN0A 1HFEL 5L8RC 1JLFB 3G8SA 1VQPS 2G0IA 1SC3B 3MGJA 4RX6A 5H9EK 4KKOB 1NJIT 2CZ9A 4C0OC 4B3MJ 4L3KA 2W2QP 2QC3A 5J2QB 3VHQA 1VJQA 2YKPA 2QFJA 3OR2B 3BSNA 4Y2AA 1TR0A 4ATNA 4OYPA 3UQSA 2DRAA 1ZA2B 2OEKA 1X5OA 4ANEA 4IQXA 2C2EA 5GMDA 2KVIA 4P74A 3ETOA 3FEYB 2EPIA 3M9MB 3M2RB 2M4MA 2J6SA 4DL2A 5F8NA 3M6UA 5KFLA 3S8SA 2Z57B 4ID5B 4NLYA 3M30B 4DZDA 4CI0B 1FJGJ 2PEBA 1B7YB 2VOOA 2IHR1 2LEBA 2KRRA 2HS3A 1UA0A 3Q89A 5IXUA 1TKZA 2DPIA 2YKOA 4Z2XA 4KHPJ 4QWCA 2OUGA 4DLGA 5H9EJ 1N5VA 1QJHA 1N34F 4OHWA 4ZJOA 1JLBB 2HQDA 5THWA 2AYMA 3K59A 2XYHB 4OYOA 3MMBB 2DH9A 3EGWB 2FD2A 4NLTA 4ZCMA 3CCLS 3N6NA 5KT2A 2AEMA 3RGIA 2ZH5A 1RZMA 3OFFA 2BJDA 2AZ3A 3KLHA 1GQEA 4J91A 4EMDA 4J9LA 3KLHB 1UEVA 3QWUA 1UWBA 3ELHA 4UW2A 4ZP9A 2NR0A 3GYXB 4WPAA 4NYZA 1BXNA 2EK1A 2J7UA 3K5PA 5ETNA 2LXFA 4AFFA 1GXLA 2BJ9A 1LWEA 3M8YA 3LF0A 1LXJA 1URRA 4PWUA 4CO5A 2QG9B 3SV4A 4ECUA 1SL1A 4K4YA 3EWGA 3G4SS 1S1TA 2F8HA 3M8PA 4NX9A 2HIQA 3J7YU 1OPZA 4F4XA 2Z58B 4I1TA 1TL3A 1R3NA 4A8QA 1RTDB 4HKQA 2R7XA 3SYZA 4HHHA 5HANA 3MR6A 2HVEA 1N48A 3M1VB 3T19A 1CEZA 1EQ0A 4JBCA 3K5MA 2B8QA 3KJVB 5F9NA 4MKVA 3KLGB 2LQ5A 3BDEA 2ASLA 2N4CA 2MLYA 1IKXB 2WOMA 3UW1A 5F8JA 3TZYA 3J7Z5 5J2PB 4YR0A 1R8HA 1M5SA 2GO8A 1U2FA 3V6KA 3QLHA 1QLNA 2GC8A 5I3UA 3N9UC 4G1PA 2F3JA 1G7CB 1ZOTA 3OR2A 3R5JB 2XMMA 3ISND 5KT5A 2J9DA 4QCLA 4P2XA 3C19A 4LUBA 1FRIA 4DPTA 3CJSA 3V4IB 5B09A 4A8MP 2M9KA 4HEA9 5KFGA 3J81U 2Y1JA 1UL3A 2KI2A 1EKSA 4ZPAA 2DPJA 1NHUA 4F0MA 1I51B 2D7SA 2D74B 5K5MA 2VQEJ 4ED2A 3DLEB 3BQ1A 3NNHA 2G2YA 3OJSA 4QWEA 3UD4P 4CZCA 3PRDA 1JB0C 4UQTA 3SFUA 3SBMA 2B4VA 4M5JA 3PYDA 4B9LA 3DOLB 5KFZA 2HRYA 3W5ZA 2BM1A 2EW9A 2AZ1A 1RCOB 1WWHA 2BOAA 2CWXA 2YX7A 4RBUA 2KKHA 4WK3A 5L9NA 5KG5A 3CUNA 3CD5A 3TW0A 3PV8A 1MSWD 3IA0A 4FYVB 2VIHA 1NK6A 4DQIA 1HNIA 3QYYA 1MMLA 2CQCA 4N76A 2DXDA 5D4PA 4DI6A 1FX2A 4OZ1A 2E1RA 3FNNA 5ETTA 5DDRC 3VAFA 1W25A 1Y5IB 3ITHB 3JSYA 3K8VA 3MM8B 1NM2A 2YNFB 3GU0A 2UXDJ 3MEDB 4GVBA 3T9NA 1LNQA 1HBNB 3D54A 4TNOA 4LRCA 3EUNA 3P45B 1YJ9S 3MD1A 1H7XA 1VQOS 1N6QB 3GIJA 2HW3A 2GVZA 4DUZJ 3RG6A 2Y1IA 4ZJLA 3CJRA 3JYTA 2OSQA 4LF9F 1H74A 3BYRA 3MEGB 4RW8B 4XAKA 2E7WA 4FKYA 3UDEA 6FDRA 2W8LA 1FNMA 1ICEB 3PW7A 1IWGA 3WIVA 4MAKA 2AT1B 2QO3A 1WC0A 3TQEA 3KMQA 2BEFA 2ZZMA 3KNGA 4P2SA 4ELUA 2RS8A 3JTOA 2OPQB 4A8YA 1Z1ZA 4L75A 4U7UK 1WKLA 4V19J 1N88A 1U0SA 2C3OA 2V2KA 4LT6A 5G0RB 3ILOA 4QIGA 3MPYA 4WKRA 1SH2A 4O0NA 3RRKA 4BDPA 3Q2TC 3OVSA 4ED7A 2MKJA 2V5HG 5DG8A 1VIOA 2LU2A 1D9FA 4YN3B 2LDIA 4MK7A 5KFSA 3MCSA 2BX6A 2A6OA 2HVIA 2PFFB 4HVZA 4DR1J 1PGZA 2A6MA 4Y2MA 4DG1B 1NBEB 1WEYA 3EICA 1M5PC 4AE5A 4YEAA 3DLBA 2VOPA 2RUGA 4NI2A 1VS3A 3RZAA 1NPKA 3QGGA 4RW6B 4JV2A 1D9DA 3HI9A 5CYMB 1CC8A 4DFKA 2RT3A 4XK8C 5IQQA 3DLKB 3KHLA 3LP0A 4ZOSA 3OD2A 3PM9A 4B08A 4ZJQA 3JQKA 2C42A 2P6SA 3GR0A 3GIKA 4YP3A 1IBMF 1U6BA 4J37A 3W65A 2ADCA 1M5HA 2AEFA 3D3BJ 3OTDA 2HSEB 3TA1A 3JTPA 3SXLA 3Q24A 4EBEA 1L3UA 5LJ5Y 1RHKB 1IQTA 4C2MA 1CS4A 2ROGA 2YKNB 4M5MA 1HI1A 4DZ6A 5H1SV 5DGBA 3U1LA 3S1TA 2BQ3A 4FXVA 4PXBA 3UCGA 4I67A 4FPRA 1X9MA 2ZD1A 1XEZA 4LQ9A 3P8BB 2BOPA 2V8HA 3AH6A 4EEYA 2BQRA 3VCDA 3ET6A 3AOBA 3TZXA 1TZ0A 2CNKB 5KG6A 5C7PA 1HNZJ 3QRQA 5A8WA 1RT2B 3VZIA 4I7FA 1X0FA 3PTWA 1BUXA 4I6YA 3HHNB 3EMTA 2Q43A 2HFVA 1PILA 2I0XA 3L9ZA 5GVQA 1DLOB 1UVKA 3QAEA 3H40A 2BJ1A 4QZVB 4ECYA 1HMVA 3NMAA 3C46A 2FJAB 3TUPA 2CUYA 3TRGA 4IR9A 1OQ3A 3A8IA 3BN7A 4DUZF 1S76D 3R1HA 4RNOA 4RW9A 4MJKA 4K59A 2FJBB 5D77A 1HNWJ 3GE9A 4LR7A 1ACMB 3D6FB 3QMQA 4YDXA 1E6VB 1NB2A 5DDQC 5ADZA 5J2MB 2OELA 4ILRA 4C0BA 1T9VA 2XY7A 4PR6A 4DR7J 3IS9B 3M2VB 4ZPTR 1TUVA 1W7WA 4I64A 1UW4A 3DRSB 4RNFA 4ZIWA 4NMLA 2FZCB 4AQYF 3QJLA 5HP1A 1S9FA 2MQNA 2OPRA 2DNPA 1JNRB 1HW9A 3AA9A 2XMUA 4QIWD 4LF8J 3TVKA 1JJCB 1NK0A 2V4QA 2A18A 1WDTA 3LWLA 2UP1A 3NKYA 1NPPA 1I94F 4DV2F 1VBZA 1U24A 4YB5A 1XNRJ 4OZ0A 2MKHA 1K0VA 1XR6A 3VAKA 2BZ2A 5HMZA 3DU6A 5DS7A 2LXUA 1VQSA 2AKWB 3PXGa 3V5RA 3ZTRA 1QAIA 3OL9A 3R9LA 1FF2A 1HQUA 3IR6B 4KGXB 1U45A 2XG8A 3AXKA 3GP9A 2POKA 1R27B 2RHSB 4ZN1A 2B51A 3MM9B 3OL7A 1VI7A 1XMOF 2E1CA 1X4AA 2YX4A 3G82A 5H9FK 2HQ3A 1X4FA 2QLJB 1CSJA 3N5BA 2ZHOA 1YJTA 3VAIA 2AYBA 3DC2A 5HROA 1RU1A 3G8TA 2HBQB 2YWWA 3BO4A 2MQLA 3CO0P 3DI6A 1SUQB 2CXEA 5A8RA 4ZIVA 1IUJA 3WQPA 2QA4S 4AD6A 2GJIA 1S12A 2CJQA 1BQXA 2K06A 4J9UE 3W2VB 1U1NA 4RW7B 2UXBF 2RSQA 1OIAA 2DNMA 2RKIA 1QUVA 3KLIB 2KM8C 3LPEA 3O2IA 4O23A 2ZH9A 1YLXA 2I38A 2WRMA 2XULA 2ZITA 4JV0A 2YY3A 5IOLA 2KJWA 2MKKA 1XMQJ 1LWCB 3FCVA 2Z2YB 2V34A 3H25A 4Q0BB 2J6UA 2BACA 1X4CA 1UETA 2VKRA 4CLZA 1R0AB 2B4OA 2M8HA 2QYGA 3DCAA 4RW7A 1F9FA 3OTCA 2IA6A 3O8WA 3QSYB 2FVSA 1S97A 2B9XA 3GLJA 4NL5A 3W63A 2ZNYA 2E7VA 5D4NA 2V4RA 4A8WA 1VQ9S 3UE2A 1Q8LA 3RU0A 5B7WA 4NLSA 3RB6A 4USIA 3GG1A 2KM8B 2DR7A 5F0UA 2JEJA 3DXBA 1D3WA 2IFXA 3MR2A 3A12A 2BE2B 1D1UA 3R2DJ 1WDDA 2QLXA 2RE1A 4KBIA 1P9YA 4IDKA 1TP7A 5KT7A 2EFPA 5A6WA 3D6MB 2DNHA 1S59A 2EFGA 1RLCL 1TL1B 1H6KX 2LKZA 3FRZA 3IR7B 3PYGA 3X3UA 2N4DA 1CQMA 2HS4A 4ETXA 3NEKA 1TKTB 2BUNA 1EETA 4G65A 3A13A 3SSQA 2ZJRQ 5CZVA 2M88A 1TFYA 4OYBA 1KBRA 1G2EA 4DR1F 4PWWA 1WTBA 2GVDB 3ZTSA 4CYUB 2P8IA 5BXIA 3H8YA 5KFJA 3NOGA 5J1EB 1TTHB 2DNKA 4FN5A 3K5LA 1VDHA 4C8MA 4DN9A 3RBEA 1S1WB 1IVZA 2IJFA 4TU9A 1M1HA 5IFMA 1HNXJ 3TAMB 4C11A 3MZIA 3H4BA 4CP5A 1SJRA 1XC9A 4GRSA 2MYFA 1ZZFA 3MFIA 1SH3A 5KFYA 4F4KA 1FDBA 1HHQA 1MN9A 3PDNA 3JQJA 1QTNB 1RBLA 1UPMB 1VOMA 4G1IA 4HI2A 2H5JB 3CDAA 2APOA 3K7RA 3TZZA 1VQKS 1FKOB 2DD8S 2BE9B 1YDLA 2IVFB 3AQPA 2AX1A 3R5DA 4DR3F 3I82A 3H5SA 4KSEB 3T5HA 4IR1A 2XBPA 1VYAA 4I68A 4Y00A 4LSNA 4ZVQB 2B0GA 3VVUA 1CJVB 1RAAB 2CNNB 3OFHA 4ZVUB 3UI3A 4F3OA 5T41A 2W24A 4J9VA 2A10A 4FF3A 2QL7B 4JI2J 2AJ1A 2RILA 3WHIA 3H20A 1M0SA 2H65B 2HFUA 2P9GA 3B4MA 3CGIA 3BGOP 3ZO7A 1YZ7A 3OHBA 4DV6F 3UCUP 3QRPA 4TVAB 2ZUGA 1QSLA 2H48B 2SXLA 2B43A 4Z7YA 4OI3A 3L7PA 2FJVA 2DHAA 4GVLA 3EDQB 1JLCB 3OTBA 5KG3A 2XS2A 3I6PA 5E2QA 1KN6A 3J7AN 4DV7J 2IM3A 3LH2S 1ZAWA 1WG5A 2CPEA 1RHRB 2FHOB 3D68A 4KH0B 5L38A 4P72A 2UUBJ 4URQU 5IQ6A 2XLKA 3V6DA 4PQUB 1S6PA 1U6FA 1KLMA 2E29A 2RQ4A 4K0KJ 3KUHA 2LA6A 4EUVA 1WF0A 1DHMA 2MJNA 1CQNA 1HWJA 1TL7B 4ICLA 3CULA 1N32J 3PR4A 4OJ1A 1CULA 3FMWA 4RW6A 5LXYA 5GAHU 3L7UA 2UUAJ 2E5GA 1FHTA 5I42A 4F26A 2V2VA 2MZSA 2CZ4A 1IN0A 1EARA 1Q78A 2OPPB 3BZQA 3RBZA 5L1LA 3K0JA 3NGSA 5J1EA 1RHQB 4IFYB 5DZ6A 5EGYA 1T7PA 4GKKJ 2R2RA 2DNOA 2RNEA 2R9LA 2LQ9A 4CLUA 3OBIA 1WC3A 3G6YA 3CCUS 2GMJA 1GAOA 1N52B 5AE2A 5LSRA 2AGQA 1VQYA 4P6QA 1SQFA 1VHFA 2ZEJA 3A1YG 1VRQC 2AJ2A 3MEEB 4PG6A 5G0RA 4S0MA 3C6TA 3PCOB 4DJBA 5G4DA 4JI7J 2VFSA 2FJEB 2BANB 2KHCA 4F04B 1BWEA 1JXVA 1IBLF 3OSPA 5KOXA 4LF9J 1D8YA 4DF8A 3DU5A 1T02A 3QO9B 1IBLJ 2NUHA 2Y8WA 3T6BA 4Z37A 5IWAF 5DJBA 2U2FA 4OYZA 4LVNP 3W9IA 5EX3A 2XC9A 1KHWA 3JYTB 4U96A 3FKBA 4OHXA 3AT1B 3I56S 1PBUA 2W9BB 2XMKA 5KFHA 2NUUG 2VG5B 3N6LA 2RU3A 4USMA 3CEDA 2CQ2A 1CPZA 2G2OA 4LSZB 2UVRA 4P73A 1ZPVA 4PEOA 4FS2A 2E9RX 3CC7S 2VPXB 2ZOGA 4O3QA 3WBZA 2HNZB 2QX0A 4M5GA 4NASA 4WYWA 3ZC4A 4X62J 1RYSA 3PIPQ 4Q8FA 1RHJB 2NLWA 5D0EA 5CA5A 3HZGA 1M5VC 2HZVA 1U2CA 2B5JB 2NSBA 3E51A 3UN5A 3W9JA 2PEHA 4WFNQ 4C6AA 1FD8A 1KQGB 3WX4A 2RF2B 4DV6J 2PI5A 2AF6A 5K8PA 1KVKA 2IRYA 4HTIA 1SUQA 2HLTA 4N8OA 5A8RB 4NLWA 1HWLA 4E8UA 2LU1A 3HHLA 1RTIA 3AJ2A 2DT9A 2B7BB 2VFRA 4DX7A 3L09A 3HKZD 4FNIA 4J7CA 2DXFA 2EKNA 2JX2A 4C48A 4ZVFA 4F3QA 1S0NA 4B3RJ 2H4WB 4AXIA 4RBVA 2GGPA 1F5AA 1T95A 5LJ3Y 2FHKA 2IYGA 1O8BA 1LW2A 5D78A 1RT4A 1B7FA 2DGWA 2JH3A 1ZPWX 3IM9A 3CJKA 2YQ3A 3QJJA 3BR9A 1LK5A 4RNMA 2DNRA 3DKDA 4FZVA 1PBAA 1X7VA 4MMOA 4EO6A 2O5DA 2XEXA 4ZKAA 1X9WA 4C8NA 4N56A 2D3O1 1LW0A 4MKAA 4C3KA 2AU0A 3PY8A 3GV7B 3IM8A 3NWRA 4G3IA 2JC0A 2FHJD 2C3MA 1PYOB 2CJBA 3PX0A 3WC2A 1S5ZA 3NAHA 4PXDA 3NXZA 1N0UA 1R8CA 4NLOA 4EI2A 1HWKA 5B0BA 2GGPB 3GV5B 1WOSA 2UUTA 1PC5A 2HK2A 2HRUA 4PUOB 4GC6A 1C1CB 1GMUA 1HBOA 1WC5A 3FBCA 3MMCA 3FMBA 1RTDA 1NB7A 2HK3A 3DOMA 3CD0A 4IKAA 3PJXA 2A2CA
chains in the Genus database with same CATH topology
1ZH5A 3GFXA 3HVTB 5K8NA 4DSIA 1HBMB 2B56A 3PO5A 1HBUA 1EP4B 4ITSA 4RBTA 4ELTA 2W7AA 3UR3C 4YR3A 2DGSA 1UJ5A 4TQRA 2A2DA 2XNRA 5CYQB 2DHSA 2R7VA 2IBOA 2KXHA 4Q5VA 2COLA 2ZHAA 2KN4A 3H2UB 4KHRA 4M63A 1BQMA 3R3TA 3M32B 4KHMA 4DQRA 2QIFA 3AB2B 4CO0A 3MI7X 1NHVA 3T1AA 2R4FA 1S9GA 2ZH8A 4QPTA 3ENQA 3ZZUA 3DRRB 5U47A 2CQ3A 2ZBCA 1CLFA 2HYIB 3E8OA 2CRLA 3D1OA 5GAEI 4M5DA 3P49B 2VB6A 1A9NB 2MPUA 2V94A 3HM9A 4YB1P 1NK7A 2IMWP 1SV5B 2JZ5A 4DSFA 4X4VA 4XIUA 3MF5A 1FNOA 1S0OA 5CYMA 2BV3A 5D4OA 2O3DA 3M2RA 1Y5NB 2HHPA 1HPZA 2XCPA 3NG8A 2AW0A 1SIWB 3QPIA 3EPGA 2CQPA 1I1GA 1PO6A 4YB7A 2XY5A 2E5JA 5KAKA 1MU2B 5DM7Q 2ACYA 4H4MA 2R7TA 3TVYA 1APSA 1OSCA 3H98A 4A8FA 2QMXA 5HO4A 5KT4A 2F8MA 1SI9A 3KYLA 1S0VA 3E2EA 1SB6A 5I42B 4DQQA 1GH8A 1GX6A 2WSEC 4CO4A 2IYIA 4YR2A 2IVYA 3N4WA 5CH7B 1KFSA 3LAKA 2YKQA 3GYNA 5CYJA 3CO9A 2QYCA 1N32F 1Y00A 1NU4A 1R6YA 3V6DB 3OFGA 1RDRA 1ULRA 6FD1A 4DBQA 2GNKA 4U6PA 3SV3A 2AGPA 2D1CA 3FQLA 2IAJA 3UNGC 1Y9OA 1MWYA 1JLCA 4TLQA 3CCES 1VC5A 3QGIA 2D41A 1C2PA 2LLZA 2OAUA 5LSLA 3HVRA 1HBNA 3UPFA 3TAQA 5CXTA 4PG7A 1S9GB 1OS5A 3ITHA 2XS5A 3ZZOA 5HLFB 4DMZA 1ZTTA 4K5RA 4N47A 1QVGR 2CYYA 2CJKA 1HNIB 3J7ZT 1YJUA 1SJFA 3H5XA 2RIJA 4B02A 1N33F 4CO3A 2XZWA 1X8DA 2YWEA 3KWMA 1UA1A 3IAM9 2J9DE 4OI0A 3KK1A 5DETA 4JV1A 1NK8A 4OIXA 5AXNA 2DHXA 3TA0A 5EWEA 2CG4A 5MAOA 2RVJA 4HH0A 2EFNA 2CVIA 4RUCA 1C0UB 1U1QA 1G1XA 1KTQA 1RT3A 4I6AA 2N3OA 4KTQA 3IGNA 1TV6A 4EZ9A 2QV6A 4WIIA 2CQBA 1JX4A 1X5TA 5J1PA 3CPWR 4WE1B 4LIWA 1LW0B 3V4IA 3KG1A 4M95A 4X4UA 1F0XA 2RMLA 2JEFA 1TAQA 2EKYA 3IR5B 4QR0A 1KOHA 1FRKA 4B3OB 3NGDA 4AXJA 4ERDA 4I4BA 4DFMA 3KMSA 2K1RB 1WD6A 2ILZA 3I0SB 2Q3PA 4U67Q 3KK2B 1UKUA 1UEUA 1U48A 1JLAB 1N5SA 4IYQA 1UVIA 3SI8A 2XNQA 5BR8F 2GO9A 3M6VA 1T94A 3PW2A 4NA1A 2LQBA 2PA3A 2VA3A 1SKWA 4A4JA 2DR9A 1TL3B 2BE2A 5KFDA 5KFFA 4K4SA 3LUYA 3HHLB 4K5SA 1S1TB 3I0RA 3M8PB 4GMKA 2ZC4A 1JLEB 2AP6A 3D1QA 2EWHA 2KT5A 2K3IA 4IQMA 2V0NA 4IG3B 1U1MA 4TXSA 1C4AA 1LFPA 2RRAA 4IOAQ 2AJFE 4LJMA 2PGCA 2JEIA 4Y28C 5GAGI 3RB3A 2DCLA 3RR7A 4K50A 3KG0A 1Z2ZA 3BO3A 2W25A 3UR0A 2VG7B 4KT0C 5B0GA 5I3PA 3P5TL 1JLBA 2J6TA 4AL5A 2B4UA 3I32A 1MWZA 3W2WA 3RAXA 1IKVB 4PWDB 2DK2A 4EBCA 3DI6B 4ZCIA 3QIDA 4I2QB 5J2NB 1YHQS 2LMIA 5L1IA 4LFBF 3QO9A 2M0GB 3HZEA 1HWIA 3DOKA 3MM5A 4OX7A 1FE4A 2KXFA 5EX0A 4OX8A 2L9WA 2ZH6A 3KKFA 3MEEA 3NAIA 2ZOMA 3C2PA 2E1AA 1W2BR 4R5PA 2YKMA 4EZ6A 2HHWA 3GIIA 1UJ6A 5HBMB 5C5JA 1F2GA 2IM0A 2V9KA 2ZE2A 3HJFA 3VAMA 3UWTA 4ED5A 2JLFA 2VD3A 4F2RA 2HPUA 2DIVA 5DQGA 1IBKF 2V8VA 1WEXA 3MUTP 4A8SA 1H7WA 3DRSA 1C1BB 3D1HA 3N5FA 4L72B 2W4PA 1AFIA 1S6OA 2X1GA 4ICLB 4ZDNA 4W90B 2D3ZA 3Q22A 3NNAA 1O0PA 1S6PB 3GMGA 3SQGB 3HMJG 2FHMA 4RW9B 1L3VA 4NCBA 2CPFA 1WHXA 1JLGB 2BDPA 3DRXA 1S1VA 2B6AB 2L08A 4OHVA 3LOUA 1FD2A 1FNXH 2WTFA 1YWXA 1U6ZA 4J9KA 4Y65A 4U9RA 4KGMA 4WCEQ 2CPJA 3IN5A 1RGVA 3R5BA 3BJYA 3MURP 3EPIA 3SCIE 2UVVA 2MMYA 3FQKA 1TL4A 1HD1A 5A8WB 3POTB 5HQ8A 3IG1B 3B8HA 2DGQA 3HHDA 3TUZC 4NLDA 4YDDB 3LO3A 4JI3F 1FEHA 1DAXA 2I5JA 5E41A 3PEHA 4KPYA 5EHHA 4HDHA 2YKNA 1BQNA 2JLEA 1FRJA 4K4VA 2R8JA 2IRUA 3HKWA 3C3LA 2WONA 2DNYA 2DH7A 3BQ2A 2GFFA 1HYSA 2RRBA 4ZVEA 1QE1A 2HMIB 1P6TA 4NZ0A 2KO1A 2Z4PA 2DJWA 1VGYA 3FSIA 1JLQB 4DSKA 3F56A 4AUKA 2Z2LA 5A8KB 4O3OA 2X1FA 3ZZZA 3NL0A 3TAMA 4C11B 2BW2A 3KHHA 3O1LA 1RTHA 3EXYA 4NCGA 4F4YA 3T1YF 1TK8A 4NLRA 3FCHA 4DS4A 3MMAB 4QOTA 1HI0P 2I9SA 1ZZNA 3DRPB 2ZJPQ 4RNHA 3QWPA 2VG6B 4F67A 3WC0A 1L3KA 2DNGA 2ZOFA 2J76E 2IJNA 5EWGA 2KFYA 2OPQA 1G6BA 4B17A 4KHPF 3DDKA 4IRCA 2MHNA 2HHVA 3HHLD 3IWLA 3NGKA 2XGQA 1Y5LB 2R7QA 1T05B 1LQ9A 4Q2LA 2FLNA 2FVCA 1TVRB 2FJWA 5A0YA 3VQTA 4IRKA 2AQ4A 3LP1A 1FK9B 3AA8A 4LSLB 3CCJS 2BA9A 2Q66A 4DQSA 4Q0BA 4B3MF 1Y4ZB 1DTTB 3OR1A 3MXHP 2R7UA 2RJZA 3RRHA 1VC0A 1UVNA 4I0WA 4CCHA 1ZM3A 3V4MA 3SFGA 1IR0A 3RW7A 2R8GA 3S01A 2GX8A 3MECA 3CSKA 4KR0B 1KSPA 5KFTA 3GV8B 4RNNA 2UUBF 4USHA 3I5CA 3KLFA 2B6AA 3PEJA 4OI1A 2LECA 1Q7LB 1RT1B 2FC8A 5E7OB 4LF6F 2QRRA 2VA2A 2XMVA 4DSEA 4OX6A 1AROP 2ZKTA 4RZRA 4ED1A 1XTZA 5B08A 1REVB 3MM9A 4HH1A 4EFAC 5KFXA 1DQ9A 1K1SA 2VBYA 4JI8F 4LF5F 3IGVA 4F02A 2CQHA 2MSTA 5E3AA 2WHOA 3SDEA 4DV3F 4C9DA 5JJBA 4IO1A 1QSSA 2GHPA 4MFBB 4NXMF 2MQPA 1YTYA 4MFBA 1JJ4A 5DRKA 4GC7A 3JB9k 1T3OA 2YKMB 4IG0A 4I2PB 1HHTP 2DGVA 2IVMA 5I3UB 5F0WA 2F4VF 2GCFA 3RAQA 2E5LF 2QZ8A 3MM5B 2DO0A 2K3KA 2O1PA 5KG1A 5FJ4A 3T5JA 3M1VA 4CQ1A 1ZM9A 2K7KA 3OXGA 4WYLA 3V2UC 1NJWA 3EGZA 5KFNA 3QJPA 5J2NA 4NPOA 2OPSB 1IJEB 2DGXA 3DHXA 2I8EA 3PW4A 3J7A1 1RYRA 3BGUA 3QIPB 3N01A 2VFTA 3W2WB 4DN0A 4CNZA 3GIMA 4DWIA 2LCWA 1MMNA 3MECB 4XO0A 2VG7A 1M5KC 1VQMS 1BY9A 5KFPA 2CDQA 2R7OA 4URSA 3ICLA 4DV0F 5AE1A 1FXDA 4NLGA 4J9RA 4DUYF 1UWBB 1LXNA 1H98A 2NPIA 1HD0A 3M2UA