4PRFA

A second look at the hdv ribozyme structure and dynamics.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
95
structure length
95
Chain Sequence
b'PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatitis Delta virus ribozyme
publication title New tools provide a second look at HDV ribozyme structure, dynamics and cleavage.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 24
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4prfA00
2X1BA 1X0FA 2AYBA 2M2BA 2KFYA 1M90T 2X1GA 2KH9A 3N9UC 2L9WA 2X1AA 3US5A 3G6ES 2E5JA 1WG1A 1X4DA 2MZ1A 5D78A 1AUDA 1PO6A 2U2FA 3LQVA 1WG5A 2J76E 5DETA 2HVZA 3CCJS 1U1MA 1VBZA 4WFAQ 4J5OA 1KOHA 2M9KA 1KOOA 2DNHA 3EGZA 2FHOB 3P3DA 1HA1A 1YWXA 3MD3A 2A3JA 3CXCR 3IWNC 1WG4A 2CPYA 1QVGR 3CF5Q 5DM6Q 1U1LA 3IRWP 2BOPA 2OIHA 3H2UB 2LKZA 2M0GB 2CQIA 3B4MA 1WF2A 4EGLA 2ERRA 2J8AA 2MQNA 5D77A 2HYIB 1PGZA 1D8ZA 5BJRA 2D9OA 4IUFA 2RQ4A 2CQ4A 1X4HA 2KXNB 2DGXA 2MZQA 1P27B 2DHAA 3VF0B 1VQ7S 2E44A 2MJUA 3UCGA 1DRZA 2Q79A 3K0JA 2CQBA 2HGMA 3RW6A 2KHCA 1U6BA 1DZ5A 3U1LA 1ZZNA 2ADCA 2YTCA 1X4BA 2RRBA 2DNLA 4C7QA 1DHMA 2RUGA 1VC6A 1ZH5A 3CMAS 3G96A 3FEXB 5H1SV 4U67Q 2MZJA 2KYXA 3CC4S 3CCMS 4P6QA 2L08A 2LEBA 1H6KX 4M5DB 5CYJA 2XS5A 2RQCA 2UP1A 4PR6A 2DNGA 2MQQA 3EX7B 2AYEA 2GO9A 1Q7YT 1JJ4A 2M70A 2NLWA 5IQQA 2CQDA 2M8HA 2F9JA 2I2YA 1SXLA 2QA4S 3TYTA 2DIUA 1U6FA 2DNYA 4Y0FA 2DH8A 2K3KA 5LJ3Y 4WCEQ 1VQ9S 2KM8B 1U1NA 5LSOA 1X4GA 4QQBA 2VONA 1H2VZ 1H2TZ 2ADBA 2CQHA 5LJ5Y 1YJ9S 1U2FA 1WF0A 4TU7A 5CA5A 2QEXS 1YJNS 1NO8A 3CCVS 2FPHX 4CQ1A 3VALA 1VC5A 3CCRS 2FY1A 3S01A 1HD1A 1H2UX 3R27A 2KM8C 3DXBA 1G2EA 1OWXA 2MY7A 2RNEA 4ZKAA 3UE2A 2DHGA 1BY9A 2RS8A 3VAMA 2D3OR 1YIJS 1OIAA 1F9FA 2M7SA 5JVHQ 2DIVA 3CPWR 3HI9A 4QU6A 4UY8T 3OW2R 2LMIA 4ERDA 2EK1A 3J7YU 1X5SA 2DNNA 4IOCQ 1N54B 2CPEA 1SJ3P 1KQSR 2KXFA 2MMYA 2LQ5A 1JMTA 2LEAA 1YTYA 1WEYA 1ZZFA 2XS2A 1SJRA 3VAHA 2KXHA 3BO2A 2MPUA 1L3KA 2MSSA 2B0GA 3UD4P 2CQ1A 2DNZA 1FO1A 2D9PA 1UW4A 3Q2SC 3VAIA 2YKAA 4FXWA 1VC0A 1KC8T 4TU9A 1P1TA 2BZ2A 3ULHA 2MKIA 2DH7A 1WHXA 5GAHU 1WELA 1X5OA 3PIPQ 2LXUA 2AYMA 1B7FA 2CPXA 2JX2A 2V94A 2MHNA 3P6YC 4YUDA 2J0QD 2VOOA 2MKSA 1M5KC 2N82B 2CPHA 2DNRA 3RW7A 4TU8A 3MUVP 3G8TA 4YOEA 1FJCA 1M5PC 4CH0S 2AD9A 1WHYA 1U1RA 3D2WA 2MJNA 1SJFA 1Q82T 1YI2S 2WBRA 2EVZA 2LYVA 2XB2D 1N88A 4WFBQ 2CQ0A 2DNMA 1U1QA 2O3DA 3MD1A 3THTA 1X5PA 1YHQS 1DBDA 5HL7Q 2CPIA 5HO4A 4W92B 2N3LA 2N7CA 3TP2A 1M1KT 1WI8A 3J7ZT 1FJEB 1FT8A 2M88A 2RS2A 5DDRC 3VAJA 2ZJQQ 3MUMP 2KG0A 1YJWS 2CPFA 2DGVA 2MKKA 2M52A 3H2VE 4OZ0A 4PRFA 4IOAQ 2MB0B 3CD6S 3U1MA 2DGSA 3G71S 3SDEB 1VQNS 5IM0B 3LPYA 1R8PA 3CC2S 2DNQA 4YB1P 2MSTA 2U1AA 3VAGA 2X1FA 3S6EA 2KG1A 2DHSA 3SDEA 4Y00A 2KVIA 1IQTA 4LJMA 5IM0A 4CIOA 2QFJA 2RT3A 2G4BA 2YH1A 4WIIA 2MQPA 2NZ4A 3UCZP 2PEHA 2XSFA 1A7GE 2J0SD 4C4WA 3G8SA 1WF1A 4WF9Q 5LXRA 1X4FA 1X5TA 2KN4A 3CCLS 4TLQA 5DM7Q 1R8HA 2KT5A 5CXTA 4BS2A 3MXHP 1Q81T 2JRSA 3NS6A 1U1PA 1D9AA 2CPZA 1KD1T 3CCSS 4UQTA 1N52B 1WHVA 2MXYA 2M4MA 5FJ4A 5DDQC 5DDPC 1OPIA 3DLLQ 2DISA 2SXLA 2GHPA 3MUTP 3UCUP 1SJQA 2KI2A 3NNHA 3CCQS 2DGWA 1A9NB 1U1OA 2OTLS 4QPTA 2OSRA 2OSQA 5DDOC 3S8SA 2RRAA 3PIOQ 1VQ5S 1RK8A 2CPJA 4LIRA 3EGNA 1RKJA 2DGUA 2DO4A 2MY8A 3BEGB 2MYFA 2KRBA 3BO4A 4QU7A 5GAGU 5IFMA 2DO0A 5ITHA 2VODA 1WEXA 1HD0A 2MQMA 4OZ1A 3P5TL 2XNQA 3FEYB 4PKDB 3SMZA 2OTJS 2E5GA 2LXIA 3CUNA 2DNPA 5JVGQ 3Q2TC 2LA6A 2DH9A 4FXVA 1OO0B 2MKJA 1UP1A 3CCES 2OJ3A 2EK6A 2DK2A 1X4CA 1HL6A 3V4MA 4IO9Q 2LCWA 2MZRA 1CVJA 3MI7X 1JJHA 4C0OC 2MZTA 1QM9A 3VAKA 2DGQA 5GMKa 2CQGA 2KU7A 2KRRA 1FNXH 3BO3A 1X4AA 2N3OA 2VOPA 2XNRA 3NNCA 3CULA 1VQLS 2FC9A 2HZCA 4RU2A 1O0PA 2JVRA 3VAFA 3NMRA 3G4SS 1Q86T 1WEZA 1VBYA 1SJ4P 2DHXA 1S79A 2CQ2A 5GVQA 3HHNB 5MLCV 3NS5A 3JB9k 1S72S 2CPDA 3R1LA 3ZZYA 2LECA 2I38A 4F02A 2CQCA 2XS7A 1VQOS 4ED5A 1N8RT 3MURP 3P49B 2DNOA 4Z2XA 3UD3P 2RU3A 5LXYA 2AYGA 2JVOA 4WFNQ 2F3JA 2PE8A 1VQPS 1WTBA 1FXLA 1FJ7A 2L41A 1VQ4S 2ZJRQ 2DGTA 2G1DA 2MKCA 1VQMS 2E5HA 3CMES 3CTRA 1NU4A 1M5VC 4W90B 3SXLA 1WWHA 4F25A 3I55S 2YH0A 2HGLA 1UAWA 3S7RA 3THPA 4WKRA 4CH1A 1VQ6S 3NNAA 5EN1A 4LMZA 5GADU 3ZZZA 1M5OC 2K8GA 1W2BR 1K9MT 2DITA 2HGNA 2YWKA 2MQOA 1VQ8S 2CQ3A 1K8AT 2E5IA 3MDFA 1YITS 2JWNA 4V19X 5LSLA 3B4DA 2M8DB 1QVFR 2MQLA 1URNA 2DGOA 4A8XA 4F26A 3TO8A 2DNKA 2MZSA 1UFWA 3I56S 2MGZB 2CQPA 1XN9A 2FC8A 1NJIT 1WI6A 3BS9A 2LA4A 1JJ2R 2CJKA 2MGZA 3R1HA 1VBXA 1K73T 3CC7S 1WHWA 2ZJPQ 1FHTA 1U1KA 2G0CA 2RVJA 2MKHA 5GAEU 3UWTA 2DB1A 3G9CA 3L3CA 2F9DA 3CCUS 3MOJB 1VQKS 1X4EA
chains in the Genus database with same CATH superfamily
2COLA 2KFYA 4WJBA 5HQ8A 3I96A 2R4FA 1M5HA 3CCJS 3GR0A 3ZTRA 2HIQA 4DFJA 1V9OA 1Q8IA 1YWXA 5I3UA 4Q44A 5HROB 4K4XA 2OIHA 2M5YA 4MKYA 1NZ8A 3OR1A 1P9YA 1K0TA 1T8EA 3VF0B 4JI1F 3CDAA 2HURA 2OEMA 4P9SA 1EX8A 3C8YA 3BM7A 3MGJA 5C24B 5C2CA 4ZPDA 2UUAJ 3QWUA 3PX4A 3CC4S 1DQ8A 4C3MA 2UXBF 1H6KX 2ZH6A 2RQCA 4KC5A 2F4FA 2VU5A 5J1EB 4IFYB 1UEUA 4I6AA 4LSNB 5KFHA 3OHAA 3M7VA 4OZ3A 2Z4PA 1YJ9S 2XHWA 3DLEB 3CCVS 3I9V9 3KHRA 3KKFA 1U26A 3HZGA 2KM8C 4ZKAA 4UOHA 2QJ3A 2L48A 1YIJS 3QZ7A 4ZA1A 4QWDA 4JV1A 2R7RA 4JI1J 3WX8A 1M0SA 4QPXA 4OV1A 3M9NB 2HPUA 4KGVB 1JLEA 1SJ3P 3KOAA 4DOZA 2ACYA 1WC6A 2XS2A 4CLUA 1DTTA 1XK8A 4NWBA 3RU0A 3FQKA 1FDDA 2UXBJ 1EQ0A 2FZGB 3VAIA 3ZZOA 2AEFA 1XBWA 2G1HA 3KUEA 1IWGA 2AWZA 4ZVUB 3OR1B 4DPOA 4PQUA 1RA7A 4X4PA 3DDNA 5F8MA 3VCDA 1BC6A 3MECA 2XEXA 1YI2S 1RHQB 1N88A 2FDNA 5EUHA 4ZP9A 2ZBPA 4TKTA 4ECWA 4E0DA 5C2GA 5F8HA 3T5KA 3C2PA 1MMNA 1RWNB 2YWEA 2HFVA 2XLKA 3TP2A 2OPRA 5KFQA 1FJEB 4J91A 4HI1A 3M9OB 2FJWA 1XR5A 2DGVA 1RU2A 1DQ9A 2DR6A 4RW9A 2UUTA 2B56A 1IBMF 3CJ5A 1PCAA 5IM0B 4O3QA 4OJGA 2B43A 4RUBA 1TK0A 4KHPF 2F8HA 3FUYA 3PCOB 5J2MA 2R8IA 3BBCA 3T5HA 2W2OP 4I6WA 1SJ1A 4LREA 1CS4A 3DRXA 4KAIA 1YLXA 1UJ6A 2M4MA 1RWUA 4KQZA 2R7VA 1TMMA 2DISA 4USKA 2E29A 4YP3A 5KG0A 2B7BB 4DR6F 2CPJA 4IQMA 5E41A 5D3GA 3T1HF 2Y1LB 2MYFA 1SUQA 5F8GA 2PN6A 2EFVA 2LDIA 1FTCA 2WVCA 3G6VA 1YKWA 1NK6A 4PQUB 1ZM3A 4PWWA 1IBMJ 4K4TA 4DR4F 1X4CA 2V9KA 3N6NA 1NB7A 3MECB 1EP4A 3LP1A 4KHPJ 4KGXB 2HHWA 3W5XA 3HVTB 2DXFA 1O0PA 2C2ZB 3O5TB 4D3HA 3RAQA 3GJTB 2ZBIA 2RH3A 3CCZA 4HT7A 1S79A 3JB9k 2Q1LA 3RR8A 1H98A 5F3ZA 3Q89A 1ZA1B 1N8RT 2WAQD 1MSWD 4L76A 4DR6J 2O67A 3T1HJ 1GXUA 2VFUA 2MKCA 3PR5B 2E5HA 1GTHA 3EWGA 4DF4A 4IKAA 1LFPA 2NCKL 4NLUA 1HWJA 3AXMA 3I87A 4CYUA 4N47A 5J2MB 3MMJA 3RBZA 3HD1A 1WSVA 4CH1A 1L3SA 4DR4J 1YBUA 2BJ9A 3QO9A 4USHA 5KFCA 1OSDA 3ZFVA 4ZLPA 2MZSA 5D3GB 3HHLA 3TAMA 3I56S 4B3MF 2LQ9A 3FSYA 5A8WA 1WI6A 4C8NA 4TXSA 2NUHA 2HSEB 2ZJPQ 1NDPA 1FCAA 2DB1A 3MOJB 3DNCA 3O8WA 3MOZA 4AQYF 2X1BA 1I51B 3JSRA 2AYBA 4CT9A 2H5IB 3LP1B 1TZ0A 4P73A 3KUHA 1HI8A 2J5AA 2HQGA 4NZ6A 1KN6A 1F60B 1F2GA 3CXCR 2EW9A 2AU0A 4X4TA 5J2QA 4EZ6A 4DV5F 1U48A 3M8YA 2VFTA 2VB6A 2MJUA 2Q79A 2LDYA 3UDLA 3C14B 2B9WA 2Y8WA 4CLFA 4I64A 2BE9B 4B3MJ 3DRRA 5KFGA 3BDPA 3B6BA 2ZH2A 4CYUB 3NXZA 3BBBA 3NS7B 1TFYA 2E1CA 4CO0A 3MM7A 4UUXA 1Q7YT 4AQYJ 3MAAB 3DM2B 2I6WA 2DIUA 1H74A 3QO9B 5GMEA 4USIA 1S57A 2RU9A 2WHOA 5KT2A 3GWCA 5C25A 5L1KA 2PA3A 4EBEA 3D67A 2QEXS 1ZBTA 4M5NA 2JLFA 4W98A 2JDJA 4E2FB 1S6OA 3DU5A 4WWSA 3VAMA 2D3OR 4ZVFA 4Y6IA 2J6UA 3ISNC 2EK1A 5KFEA 3OTDA 3NMAA 2LQ5A 1X9WA 2ZITA 3PRDA 3M8RA 2C2KB 4OX9F 2O5DA 2D1CA 4ED2A 2HK2A 4USTA 1KC8T 3L4BC 2MKIA 3NOGA 3ZZTA 1HHTP 1IKXA 1H38A 3EVWA 4WTYA 3AODA 5HP1A 5AXLA 2QG9B 1GQEA 3MR6A 1TL3B 3AT1B 1GEHA 2N82B 3NBPB 4B02A 4GO7X 2JJ4D 2RDIA 2XO7A 1SJFA 4A8QA 1VFJA 4WFBQ 2CQ0A 4BC7A 3OBIA 1SV5B 5B0CA 2YNFA 1S99A 4L74A 2C2DA 4DX5A 5L9NA 2FGOA 3KHHA 1J27A 4OZ0A 5L1JA 3R5GA 5F0WA 5B0AA 3VZIA 5C25B 3F44A 2CJYB 3M6XA 1PJ6A 1VHIA 5KFYA 1HPZA 4LT6A 4OX9J 4GRSA 3JSMB 4HHHA 1S9EA 1HWKA 1QAYA 2RKIB 1F5BA 8ATCB 4TN2A 3CW2C 5IWAF 2EPIA 2QE5A 4OYAA 1Q5YA 1S1VB 5KT6A 2KDOA 1Y0HA 3CCSS 1SC3B 4WTOB 1N52B 1SJQA 1FK9B 4W4MA 2C3UA 3TNVA 4LF5F 2GO8A 2VC1A 4JI6F 3A3NB 5J2NA 1NJXA 1XIQA 1NXIA 2XBPA 3GP9A 1DLOA 5H9FJ 1VISA 1IKXB 2XNQA 3VGVA 2J6TA 3DGPA 5HP1B 3BJYA 3WC0A 4ED0A 3UI3A 1AW0A 1G4CA 4RW7A 2J0XA 1LFWA 3P5BP 4FBUA 1RT2A 1WACA 1QM9A 1JLBB 1WOOA 4CT8A 3M2UB 4HDHA 2GMLA 2YNFB 5IWAJ 1U24A 4BHQA 3Q8SB 3OTEA 1S59A 3MAHA 4PPZA 2V63A 4YN3B 3PR4A 5FDLB 1DJ0A 2CQCA 4ED5A 1Y5NB 1S1WB 5AXMA 1HPZB 2AEMA 3DCAA 2HS3A 3PJXA 1X9SA 4LF5J 2XMUA 1S9EB 1VQ4S 2ZJRQ 3E01B 4JI6J 1NMEB 3CT9A 1T0TV 4RNFA 3W9JA 2EI5A 3F0NA 5GAHI 4KH0B 2XMVA 2V2KA 4LIWA 3DGVA 2VBYA 1TTHB 2DITA 3K5MA 2DBBA 2M8DB 4NOHA 4QYRA 3M8PA 2NSBA 3JTPA 5J2NB 2ZDPA 2VG6B 4I4BA 3C6UA 2Q43A 4ILRA 1UFKA 1UJ4A 2MGZA 3QMQA 3KLHB 4KGZB 2G0CA 1JQGA 3L3CA 1RISA 5KFJA 2F9DA 4RW7B 2XSJA 2M2BA 1RT2B 2X1AA 1D8YA 2L9DA 3PM9A 3GONA 2HS4A 2BKOA 1NDCA 1PJ7A 1D09B 1PO6A 3FBCA 3I5BA 2EBGA 2DVIA 1VOMA 3ZTQA 1KOHA 3AJ1A 1SKUB 5FIIA 1XR6A 4BCAA 2EFGA 2B3TB 2LFVA 3IWNC 1WG4A 3EE3A 5HJYA 1VLOA 2XY7A 3KG1A 3MFIA 3B4MA 1CEZA 3GTYX 4TVAB 2WOMA 4JV5F 2JLGA 3UO0A 4ALZA 1G6BA 4F04B 4OFZA 4KFBA 4CO2A 2CQBA 3U1LA 4DWIA 4CNZA 2DR7A 2RRBA 5GAGI 1VC6A 4ETXA 2JC1A 4TYBA 1CG2A 1NZAA 2MDAA 4DSEA 4RJVA 5EWGA 4NRTA 2OGUA 2OKQA 5KFPA 1JJ4A 2BKNA 5THWA 1L5UA 1LWCA 3D1QA 3NGRA 2Y8YA 3RB4A 1BQMA 3ENWA 3GV8B 4DQPA 1JLFB 1N5SA 5CA5A 2Q3PA 3FQLA 5I3QA 3AOAA 2RAQA 2R9LA 3D0HE 4NLTA 3C6UB 3D6MB 4I2PA 4QIGA 2J7KA 3OVAA 1KDNA 4U7CA 2RDJA 1T9WA 5KFUA 4JV5J 1VLYA 1R3NA 4OL8A 2BANB 3PW0A 3QT7A 4ERDA 2ZBCA 3R2DJ 1JMTA 1SH0A 2HLTA 3C19A 4C2MA 4DV2F 2DNZA 4URGA 1HNIA 1JNZB 4C0BA 1QAJA 3T9ZA 2BZ2A 2A2DA 1U0SA 2WOMB 2XZTB 1TL7A 2CPXA 2MHNA 3IGVA 4WZQA 2CXEA 4DR7F 3QAUA 2CWKA 4CH0S 4LRAA 1S6PA 1XMOF 4F3OA 3D2WA 4HDGA 3TUIC 3QRQA 3MF5A 1U1QA 4AFFA 4F4XA 2B51A 3THTA 3MCOA 2E9ZA 5LSRA 4NLRA 2EXUA 1M1KT 3J81Y 3GFZA 4MJKA 3T5LA 3EPGA 1LWCB 1S7HA 2M52A 2P6TA 3CD6S 2MKYA 4FXDA 4DSKA 1KFDA 4DV2J 1V6HA 4CIOA 2QZ8A 2V2VA 3DFEA 4MKBA 3VR1A 3G8SA 3IG1A 1WF1A 3V6JA 2ZM6F 3D7SB 5DO2A 3Q83A 1FESA 1TFWA 1NDKA 3ONQA 2XC9A 2AJQA 4B3TF 4PYAA 5B0BA 4NXMF 4DFMA 5B09A 3LGNA 4DR7J 2CYYA 1ZYQA 4K50A 1EETB 3T1AA 1XMOJ 1CULA 3NOCA 1U1OA 2Q6BA 4QPTA 1MU2A 1UFLA 2FY8A 3IM9A 1HW8A 1U47A 4IR9A 2MQMA 4CTAB 2BRLA 4M5KA 3UR0A 3K57A 1TL7B 3QGIA 1UP1A 2DK2A 1N6QA 2BYCA 4PG7A 2ROEA 1I6JA 1RWKB 1JJHA 4WXWA 5D4OA 1S9FA 2N3OA 3NNCA 4RU2A 3UDVA 4HEA9 5AXKA 2ZM6J 2R2TA 3G4SS 4KRWA 1OYDA 5B08A 2DHXA 1V5IB 3TAPA 4B3TJ 4NXMJ 3I4PA 4YMEA 3HSGA 3NS5A 5CCLA 1ZM9A 4NEZA 4ELVA 3TOQA 4KHMA 4NCAA 2EWHA 2AYGA 1FJ7A 3R9LA 4BWMA 1U2RA 2EFNA 1UVNA 4GVBA 3IG1B 3T3FA 3KJQB 1VRUA 2QA1A 4CZCA 3NNAA 3JAMY 1N32F 1HFEL 1MMLA 2Q66A 4NLSA 3KDOA 1VBKA 4RUHA 3PVXA 3GSDA 2GJFA 3PO4A 1YBTA 1TKDA 2ZH7A 1W26A 1MU2B 5EDWA 4Q5VA 1HQ2A 4ZVHA 4HHUA 2VG7B 2E7VA 2UVWA 4ZPVR 4LR9A 3EVMA 3CDEA 1ZPWX 1NJIT 2LA4A 1NEEA 3R1HA 1K73T 1P1LA 1SB6A 1NJWA 4WYWA 4IDKB 4J9VA 3OXLA 4RNOA 1N6QB 1PAEX 3R5JB 2X1GA 4RW6B 3E3XA 1MG7A 5KG4A 4DSLA 1N5VA 3KHGA 4J9UE 5K8MA 3AJ2A 3W3SA 3VTIA 2HZVA 3CJ8A 3DRYA 3W65A 3O44A 3HF5A 3POTB 4OLOA 1U1LA 1TKTB 1RSCA 1XEZA 1N4LA 2ERRA 3SSSA 5IT0A 1N32J 2D9OA 1EJ7L 1Q5VA 4NLQA 4F67A 3QATA 2GGPB 4G1QA 3IM8A 2Y3YA 2UV8A 3H25A 1SC1B 1DHMA 2I9SA 2DD8S 1XTZA 3M8SA 3OV7A 4F50A 1NSAA 3CCMS 1OY8A 1VRUB 2ZE2A 5JJBA 4ID5B 2V4QA 3FFIA 1FXDA 1F0XA 2CADA 4DEZA 3I5CA 3CNQP 4ES1A 2ZH5A 4ES3A 2IM3A 2AQ4A 2E1MC 3FCWA 4RPFA 1T02A 2HIYA 3SV3A 2H4YB 2HNZB 4KJIA 2QRRA 2Y1RI 4JOUA 5GMDA 4C8ZA 1O51A 4FS1A 3S01A 2R8KA 1FNMA 2MY7A 2VKZG 5D0HA 1BY9A 3A3OB 2DR8A 2PMWA 2Y0SD 3IR7B 2XY5A 1CPZA 3A8KA 1MWQA 3EDRB 2CPEA 2YNHA 1SQFA 4CO3A 1L3KA 1S0NA 2C22A 2HKEA 4CO5A 3BGLA 3AB4B 3BQ1A 4QYZJ 4ZVRB 5KT4A 3L7UA 2YKAA 1P1TA 4KGMA 2FZKB 4RWXA 1WELA 2R8HA 3DOLA 5KAKA 4OZ5A 3CJRA 4BLGA 1C1BA 1RBLA 1M5KC 4G1QB 1M5PC 4J9RA 2AD9A 2ASLA 1QY7A 4H4OB 2EVZA 6FDRA 3RR7A 3MD1A 5HL7Q 1N34F 1HBNB 2ZVIA 5ETOA 1VJWA 5AE3A 3VAJA 3R3TA 4N41A 2KG0A 3OFGA 4YFUA 3DYAA 3RB0A 3QT5A 4C97A 1VQNS 1RADB 5DQIA 4ZLNA 5A8KA 3S6EA 4PWDB 4DN0A 3SQGA 4UOFA 2YH1A 3UN3A 3GYGA 4P52A 3CO0P 5C7PA 3RRKA 5CXTA 2GQQA 3MEGA 2Y1JA 1HARA 4NA2A 2G2YA 2JEJA 1YX2A 1S9GA 1KFSA 5HLFA 2FUG9 4X4OA 5ETRA 3TJ9A 4X66F 3HLUA 1SL0A 2HRTA 3PIOQ 2XYPB 3DLBA 1RKJA 5CH7B 3ZXWA 1N34J 2QLWA 4ECTA 2KJVA 2WB4A 3FEYB 3JYTB 5JVGQ 3ZNUA 4PWUA 2NSCA 3PW5A 2FLNA 1DURA 1T9VA 4R5PB 4K4VA 4ZCLA 4UOGA 1KHVA 4K4YA 4G6VB 2HVDA 1X4AA 2YWWA 1R6YA 3MEEA 3AA9A 4OQJA 2AT1B 1SJ4P 4GVLA 2CQ2A 4DG1B 3J7YI 3EUNA 2OAUA 3DYAB 3R1LA 3ZZYA 4X66J 4C3KA 5A8KB 3AOBA 4ZVOB 4FYVB 4UUWA 2RU3A 1HIYA 1NKEA 2OUGA 1QDUB 1ELOA 4CLTA 4ZPBA 1VDHA 2GIRA 4DUYF 2FD2A 2K2PA 3RBEA 3MEGB 4WPAA 3OL8A 1RT4B 3SI8A 2WK4A 1PSDA 4I67A 1IKWB 1S9GB 1NHKL 4XDDA 4FKXA 5HLFB 2VFRA 2VDIA 5KFWA 5A0YA 3N0VA 1QVFR 2MQLA 1Q79A 2DGOA 4CLPA 1UJ5A 4FVMA 1R0AA 3KMQA 2CZ4A 1B7YB 4MTPA 4ANCA 4NLGA 2E1PA 4XIUA 3MHYA 1KR4A 1L3VA 4A46A 3IXQA 3I0RA 1UVIA 4WIQA 4CO4A 2V8DA 2OPQA 1SC6A 3NLCA 4DBQA 3US5A 3ENAA 2E5LF 3VZHA 2IM2A 3D68A 4XK8C 2YKMA 2XLJA 4DUYJ 3P3DA 3MEEB 1WNEA 2BJ8A 3LAMA 3H5XA 1WDDA 4DV4F 4QR2A 2BJEA 5AT1B 3D0GE 4EWTA 3IGNA 3R2CJ 1FRKA 5KFOA 1DFDA 4UT4A 1R31A 1T9TA 3H59A 2HQIA 1N0VC 1M1GA 4MKVA 1DZ5A 2F8MA 5AXNA 1H0HB 3OVBA 4Y28C 2XY6A 5L39A 1TKXB 3TX8A 2JSXA 5ETTA 1JIHA 1OQ6A 3N5FA 4DL7A 5D4PA 3J81U 5B0EA 2MQ8A 1B0VA 3V4IA 1PYSB 2NLWA 3DN9A 4JBCA 3W2VA 4X62F 3K5LA 3NP5A 2NXEA 2E5LJ 2PSZA 2GHVC 5LSOA 5A6PA 1X4GA 2MHEA 4TU7A 2ROPA 3TI0A 2WCXA 6AT1B 1N5YB 3CCRS 4RLEA 2QYGA 3PO5A 4DV4J 4HT5A 2J9DA 1OIAA 4X4NA 3BB5A 2E9TA 3BZQA 3KLEA 2OPQB 1C0TA 4ZVPB 1KQSR 2C3YA 1OSCA 1ULRA 4DR5J 4FF2A 4PG5A 3H40A 2YKMB 2MSSA 3R5AA 3UD4P 2D41A 1OY9A 4ICLB 4ZN1A 3VGTA 4TNOA 1WHXA 4M63A 4QR1A 2CDQA 2R7OA 2E1RA 5C5JA 3SIPB 4X62J 2FJDB 4B3SF 1PC4A 1RAEB 4DJBA 2BXJA 1WHYA 4JI2F 3AAWB 2XB2D 4NMLA 4O3OA 3IO1A 1H7WA 1WKJA 1SIZA 1FRHA 3BSAA 4FBTA 1JXLA 5CYQB 3LGHA 3U02A 1FT8A 1CJVA 2UXCF 4K8RA 3W2VB 4IOAQ 1Q53A 4FYYB 3W9IA 1UEVA 3QYYA 5B7WA 1MW7A 2DHSA 1U25A 5LMUF 4Y00A 1BWVA 2AKWB 3UCZP 2V4RA 4C4WA 1LW0B 4L3KA 1VK8A 4YDXA 3C16A 1VMBA 3ITHA 1ZAXA 4QIFA 3JAMU 4EEYA 1F9HA 4B3SJ 2MXYA 2PI5A 3MEDA 3TUPA 4LR7A 3M1VB 3LF0A 4JI2J 1RWWB 2QMWA 5DDOC 1PYTA 4MK9A 4V19J 1RK8A 3H7HB 4BDPA 4ZCMA 2MY8A 2R2RA 3TARA 3CD5A 5F8JA 2PMZD 2DO0A 4QWAA 1TR0A 2QL9B 2QT7A 3SMZA 4CLWA 1RHUB 9ATCB 2UXCJ 5L46A 2QA4G 4FXVA 4DL4A 4J37A 1LW2A 2NXJA 4P2FA 3CCES 4WBFA 2XMWA 4DX8H 1HL6A 3TQEA 2DXDA 4ITSA 4LF8F 5A76A 2J9EA 2HHQA 3MAQA 5LMUJ 2VOPA 4G65A 1Z4UA 2R7XA 4B9NA 1D1UA 2OD4A 2LXFA 1RT6B 4ED1A 1ZS6A 5K9FA 5ETPA 1YJVA 1EQMA 4ZCIA 1RWPB 4A48A 4F02A 5U47A 3OLBA 1IJEB 5G4DA 3ZZ0A 1HWUA 4NPOA 2ATLA 1HNZF 2QLFB 2A6OA 1TL4A 2VH7A 1QLNA 3C16B 2RQKA 3Q24A 4ELTA 2RILA 2OFHX 1T9XA 5KFXA 4XDCA 4F36A 5KFSA 4LF8J 2JWNA 1RTIA 1Z2ZA 2KO1A 3W61A 3N4WA 5KT5A 2ACMA 4Q0BA 1FDAA 1ZETA 2HHXA 1WC0A 2CZ9A 1RT7A 2BA9A 3H8YA 2HQ3A 3F41A 2BABA 3BR8A 1RQ0A 2O66A 3CCUS 4LRDA 4RNHA 2C1EB 2W4DA 2OO4A 4P74A 2HMIA 3MWBA 1HNZJ 1CC8A 3LQVA 2J76E 5DETA 5HAOA 2X3GA 1K47A 3GIIA 4KPYA 3MD3A 2LQ8A 2B6AA 2GIFA 3W7BA 1EKRA 5E33A 4EBDA 2ZBQA 3TVYA 1R89A 3DRSB 2RQ4A 1MMDA 2MZQA 3NAHA 3MM9A 3UCGA 3G6XA 3UD5A 1HNVA 2KHCA 1LK7A 3PG9A 3NCQA 4LVOP 1T03A 1NJYA 3DLHA 1GH8A 4AL5A 2W9BA 4NI2B 1Q7LB 5KT3A 1F5CA 2PFDA 4A8FA 2PFFB 2CWXA 4YR2A 3OT9A 4RBUA 3QAEA 4RL1A 5IQQA 2I2YA 1NSKL 1VRQC 1NB2A 2DH8A 1RTIB 4HACB 5FLXY 3M6UA 4DL5A 4NCGA 1VS3A 4J7CA 1RTDA 2HFUA 4RWWA 5EWFA 1R27B 1YJNS 3KFWX 5DRKA 4K4WA 2HBQB 2V8VA 4F4KA 4ZOSA 2IAJB 4OHZA 4ENOA 2M7SA 1TVRB 2DIVA 5JVHQ 3MTKA 1RLDA 3K17A 4YEAA 3ENQA 4WU3A 3GQCA 1NK4A 4DR3F 3ETMA 2AIRB 2HMIB 3JTNA 4ZVTB 1CJKB 4FYDA 1SJRA 2KXHA 4KHRA 4CM2A 2ZOMA 4EZ9A 2B4VA 2B6AB 2DRDA 2W2MP 4R25A 2EKNA 4ZP6A 4ZPWR 2H9ZA 2AYMA 2VUGA 4NLWA 1IM6A 2MKSA 2Z30B 2ZDOA 3PW4A 4RNMA 3PXGa 2AGOA 3W8GA 2ZH3A 1T03B 2F40A 2ZH9A 4FPRA 1X5PA 1OPZA 3D6FB 3U1NA 1KVJA 1RT1B 2BM1A 2ZH8A 1RU1A 5HVFA 4X4SA 1VRTA 3W8PA 4DR3J 1JLAB 2QL7B 2MB0B 1E6VB 2CNKB 1YRXA 3Q8VA 3FMBA 3EPIA 2X1FA 3NL0A 4ZVEA 2RF2B 4NCGB 2V8PA 4IFVB 3SDEA 1RTDB 1DTQA 1G3OA 4NLOA 4MKAA 3KLIA 5LXRA 5CABA 2V68A 2YKQA 2VBWA 3NS6A 1FRIA 2V34A 1RACB 2ZH1A 1V3SA 2YXLA 1WHVA 1U8SA 4C48A 5KT7A 1WC1A 4TY9A 1JWWA 3R6GB 2F4VF 3KYLA 4QU7A 3SV4A 4ED8A 4OLPA 4UY85 1JKHA 4J9KA 1ZA2B 4CRJA 2HBYB 2HQDA 4E98A 2OTJS 2R7QA 2IPOB 1VHFA 5BR8F 4I0WA 3D0IE 3KK3A 4N77A 3KTQA 3THVA 3W64A 4M5GA 2KRRA 3HK2A 2J6SA 2BE7D 2HQFA 3LA0A 4RW4A 1RAJA 3M2VA 3KUGA 2OP5A 2XYHB 3DLKA 4LRFA 2VC0A 2ZOFA 1VRTB 3DDKA 4EO8A 4O3RA 2FVQA 1IVZA 2CNOB 2EKYA 3K8WA 1HBUA 3C66A 2VF3A 2AHOB 3FZ2A 2BW2A 3H90A 1DTQB 4OZNA 2F4VJ 2QX0A 2NR0A 1VQMS 2IJFA 1WWHA 4RW8A 3I55S 5BYQA 1C4AA 1GT8A 3S7RA 2EC0A 3QJLA 5DGBA 1YJRA 5BR8J 2XWXA 4QBUA 4DL2A 2L9NA 1NHVA 1KQFB 1Z1ZA 5T7LA 2CQ3A 3KDNA 3VGSA 1YITS 3HXMA 4V19X 3V2UC 2JFDA 4ZPAA 3HMJG 5E0OA 4M1KA 2IMOA 2E66A 4ETZA 4O4RA 4U8YA 2V4JB 4DLGA 4M5IA 2P5VA 2J8SA 4EU0A 3BGRA 3UWTA 3Q8PB 2BX6A 2VA2A 2ZWPA 2DHHA 1X4EA 1VQKS 5T41A 3N9UC 1UA1A 1ZPVA 6FD1A 4O3SA 4IG0A 4DX6A 2ASJA 4J5OA 1QUPA 3VVTA 1RTZA 1HA1A 1QVGR 1J5EF 3DLKB 3H2UB 3A4TA 4PUOB 1HBOB 1SKRA 2CQ4A 2UU9F 3MM8B 3O2IA 3M32B 1Q4RA 3DOMB 1HBUB 3R5BA 4DV7J 1TL1A 5LT5A 3AD9C 2HBRB 3TEHB 2ZHAA 3CJTA 2RUGA 2FQQB 5H1SV 4RW8B 4CDIA 4M5DB 1UZDA 2DNGA 2MQQA 2JL9A 2AYEA 2AX0A 4URQU 5K14B 3IBCB 3DHXA 1VQYA 5E3RA 1U1NA 3QSIA 4OI1A 5LJ5Y 4TQSA 1D0EA 3SZ2A 1VC5A 2UUCF 2ZC4A 3KHLA 1MROA 1J5EJ 1UL3A 4QZVB 2DHGA 2RS8A 4YHHF 1GFWB 3BGRB 1P6TA 2XI2A 1KLMA 3C15A 2HRUA 1QE1A 4N5SA 2MMYA 1RDRA 4ATNA 2JOQA 2LEAA 2QSFA 5D8HB 3J7A1 4A8WA 1AUSL 5LMNF 2D9PA 3BR9A 1KRPA 1IN0A 5HVHA 5I42A 3CE8A 3AFGA 4LQ9A 2AGQA 1FKOA 1UKUA 2DNRA 3FBBA 3G8TA 4BWJA 1TL1B 1YBAA 2YKNA 1TV6B 3E8OA 2M3DA 1RAOA 3CJQA 3W9HA 2GW8A 2DR9A 2UUCJ 2O3DA 4PQAA 1ZAWA 1FD2A 1RI7A 3GJSB 3UNGC 5HQLA 3GPAA 2N3LA 4WKYA 4YHHJ 1HQUA 4F2RA 2OLWA 4DX7A 1PC5A 2GIQA 4NRUA 1HW9A 1NHUA 1SI9A 1RT3B 1KBRA 3CJKB 4L3NA 1RWVB 2DNQA 2FLOA 3J81j 3OUYA 4F0HA 5LMNJ 2CNLB 1ZM4A 2XSFA 1T3OA 3CWJA 3NGDA 4Y2IA 4R8UA 3LP0A 5KG2A 3MXHP 3K59A 3QRPA 4D3GA 2V9WA 5FJ4A 2V8HA 2ZZMA 4J9NA 3A8EA 4OI3A 2DGWA 4WFZA 1RAIB 2CDRB 1CBKA 2DO4A 4ZPTR 2VODA 1RCOB 3AXKA 1RZMA 2A1BA 2OFGX 1LWEB 3T6BA 3D6TB 1FKOB 4M95A 3A13A 3RB6A 1M5SA 4DF8A 1S77D 4K4UA 3ET6B 1PBUA 5J2PB 2DGQA 1H72C 2O01C 2KU7A 2YWFA 1RTHA 3D3BJ 1PILA 2CIMA 3WQPA 1FFWB 2ALZA 1Y11A 4TLRA 3EVOA 4ED7A 1IWAA 3QIPA 3H2LA 2UUWA 1CQNA 4USJC 1GAOA 3HVWA 3HHKA 5E3PA 3MURP 3P49B 3MMBB 1FXRA 1VQSA 3DMJA 3QWPA 3AQOA 3UD3P 1DARA 3OUYB 3QZ8A 1VQPS 3KJVA 4OYBA 2L41A 5F41A 3A12A 4K59A 4YB6A 3OL7A 4R8UB 5DLGA 1VGYA 4GC6A 1KWMA 3OL6A 2OH2A 1U8WA 3ZZZA 3PYEA 2CJAA 3E2EA 3B8HA 1VQ8S 2LLZA 2AV5A 1VYAA 1SQGA 3LP2A 5FLXU 4UF4A 2HHPA 2BMBA 3TO8A 5KFRA 2CQPA 4XO0A 3L9ZA 3K7RA 1PG5B 3MMCB 3CC7S 3IBFB 1HI1A 3CJSA 3Q86A 5H9EJ 3KMSA 1AUDA 1I5OB 5I3UB 2IM1A 1KOOA 2GFFA 1EAYC 3CMQA 2MQNA 2GHWA 4I1TA 1FVSA 3K8VA 2YY3A 3PFEA 5KFIA 3P4UB 4QW9A 3DMJB 4NLPA 4R0EA 4KKOA 3PRBA 3MMAA 2WSFC 2R3VA 3CMAS 2H5EA 3TVKA 4C98A 1CLFA 4H4KA 2L08A 2KJWA 5CYJA 4KTQA 4U96A 3V6HA 3EX7B 1IUJA 4N8OA 2M70A 3TEGA 3MM5A 2CQDA 2BOAA 3TYTA 3GG0A 4Y0FA 3LP2B 5LJ3Y 2AJFE 3HT0A 2HVEA 3BKFA 5IT4A 3FBEA 2B9EA 3FK4A 3WIVA 2ZC3A 3IAM9 3Q8UA 3PRVA 1U7LA 2R7TA 1RJJA 3BQ0A 3NAIA 3PYFA 4OI0A 3CPWR 3HI9A 2E7XA 1RHKB 1JLEB 2XO6A 3HO1A 3PTWA 2HFZA 1DTTB 4HR2A 5J1NA 2D3UA 2ZFHA 2K7JA 2IDEA 4RR5A 4QW8A 3UVJA 4NA1A 1ACMB 2OELA 4C6AA 1JX4A 2AP6A 3EICA 2C2MB 4J9LA 3UR3C 2BRKA 2IM0A 1S6QA 2AJ0A 4X4VA 3G87A 1NLKL 2E7WA 4DV0F 2JX2A 1F6TA 3OL9A 3P6YC 4QOTA 3EZOA 4YOEA 1U09A 2B8QA 2QLBB 4KKOB 3DRPA 1REVA 2VASA 2J0WA 4YY3F 4KPCA 3TZYA 2OPRB 2OPSA 2CPIA 4ZVSB 3BH7B 5GAEI 2R7SA 4RW9B 2X7IA 2CAJA 4KB7A 2IC3A 3LPYA 2V2ZA 1VI7A 1AROP 2ZZNA 3BH6B 2W2NP 3KLGA 2RT3A 2G4BA 4B08A 4OYMA 5KG7A 4J9SA 4ZJLA 2WSEC 4FYWB 3GE9A 1CS4B 1HMVA 2Z0GA 4YS2A 4DV0J 2D69A 4DSFA 2FGCA 3A8IA 4WK1A 3RAMA 5K8OA 3KXDA 2ILZA 1Y4ZB 2OTLS 4OHXA 3QT6A 4YY3J 1SUQB 3O6QA 3FEZA 1OJ4A 1WEXA 1HD0A 3DU6A 4L75A 2CFXA 1GK8A 3NY0A 1K44A 1GXLA 3CUNA 3Q2TC 4I2QA 3BN4A 3HHLD 1T9YA 4CLSA 1EP4B 3B82A 5HMZA 4FNHA 2VA3A 5DJBA 1ITPA 4NX9A 3TW0A 1RWXB 2FC9A 2OPSB 5G0RA 2V50A 1FEEA 3NMRA 3TA1A 1Q86T 1BWEA 2HNDA 2YNGA 2UUBF 2P2CB 3WBZA 5HMYA 2CPDA 3BREA 4O0IA 4ANDA 3GJQB 3PDNA 3HM9A 2IC3B 3OTCA 5LXYA 2F3JA 2PE8A 2HAFA 3HCXA 3ISZA 3CMES 2NZCA 3TQ1A 2UVVA 2YH0A 3V6KA 2VBZA 1HMVB 3BGUA 2C3PA 4EYHB 2GCFA 2K8GA 4I56A 1W2BR 4FZVA 3PKYA 4ECSA 3BSOA 3HHLB 4MYTA 4C8MA 5KFKA 3I0SA 3TAMB 2CA9A 1YZ7A 3FCHA 4C8OA 3QGHA 4A8XA 2DNKA 2LP4A 5CYMA 3KK2A 5A8WB 3VQTA 2L3MA 5AJ3F 3QJJA 3IC1A 2VQEF 4NXNF 1RA6A 1YZ6A 3D6HB 1T95A 2UUBJ 4I2QB 1SBRA 2RQMA 4MAKA 2R8GA 4PCQA 1BE4A 1J5OA 2HHVA 1U0HA 2XGQA 4MFBA 4U6PA 4WK3A 1VCTA 2L9WA 2C2RA 4IH5A 3NCPA 3WZ0A 4WYLA 4DR2F 3SQOP 3EMTA 5IQ6A 2A3JA 2Z8QA 4Q2LA 5J2QB 3DLGA 5DM6Q 2IDLA 2DY1A 3IRWP 2BJDA 4NL5A 3D9BA 2M0GB 1Q16B 2AF6A 1D8ZA 5BJRA 2DR5A 1S10A 4JI8F 3U27A 4ZDNA 1S49A 3RW6A 3TUZC 3DRRB 2FJBB 3AD8C 1AFJA 1AB8A 5AJ3J 5KFLA 4FPIA 1Y5IB 2VQEJ 4NXNJ 2ATCB 3WDOA 2WBMA 3MM7B 4X4QA 3OLAA 3KK1A 3RRHA 3OXGA 3IS9A 2A18A 4IYQA 4ED4A 2XMAA 3PEHA 4DR1F 2H3EB 2HWTA 2YX7A 1VQ9S 4GC7A 4KE5A 4TYAA 2P8IA 4DR2J 1PIEA 4HYKA 4HLBA 5HBMA 2KHDA 4LFCF 5CYMB 3KK2B 3Q8YA 4A8KA 2XMTA 3I82A 1TL5A 1HD1A 3VQSA 4J9PA 1RB0A 2RNEA 3NCRA 5KFBA 2OPPA 3OHBA 1UMJA 3QLHA 4JI8J 3L7OA 3LAKA 4MFBB 4Q43A 1T3NA 3SYZA 3QIDA 3HPOA 1HQEA 5HMWA 1YTYA 1HHSA 1WUUA 2UVRA 1RBAA 2QLJB 7AT1B 4DPTA 1RGVA 3BO2A 4ZLJA 5MAOA 4YR3A 1IJFB 1T05A 3K2YA 2PIIA 2R2UA 3KNGA 4OI2A 2VG5A 2C42A 4PG4A 5HQMA 4F8RA 1FRXA 4MMOA 4MYUA 4EMDA 1RKIA 1FE4A 4X84A 4DR1J 2J9DE 3FZBA 3BYPA 2CPHA 1PYOB 4MK8A 4LFCJ 4F4ZA 1WKKA 3IA0A 1IR0A 4Y34A 5IXUA 1N56A 2PA8D 3KK1B 3MPWA 2AJ1A 3KG4A 4A47A 5DDRC 3RYLA 3CVKA 1O5JA 4ZJOA 1UVLA 2CPFA 3GG1A 4CO1A 2MKKA 4F0MA 2RJZA 4PRFA 1RAHB 1X31C 2HHSA 2BUNA 4WFYA 5HBMB 3T6JA 3V6DA 3CD0A 1S4EA 1D9DA 4U95A 1Y10A 1Y3KA 4ECYA 2NZ4A 1X7VA 1TKZA 2P9EA 2OPPB 3WC2A 1LXJA 1URRA 2YX1A 1ZTTA 2NYHA 4I68A 3GB0A 1KD1T 4UQTA 5DDQC 3K5NA 4OYOA 2KI2A 2GV1A 3C6TA 2H51B 2HFSA 2OSQA 3NWRA 1DLOB 3K5PA 2KT2A 5ITHA 5KFVA 2DRAA 3JXOA 1RAGB 3DGPB 1ICEB 2O1PA 1WJ9A 4JP8A 2LA6A 3M05A 2YQ1A 2B9YA 1FNOA 2NXCA 4N56A 1MNEA 4WE1A 4Z37A 4UZBA 1EB0A 2VPYB 3TANA 1VK3A 4ZCKA 1R8BA 3JS9A 3ILJA 2FTRA 5IS2A 1PAUB 1JLCA 4O44A 2KFZA 1S72S 2GQ2A 1UWAA 4EBCA 1Q8BA 2VPZB 1PBAA 4AE5A 3IWXA 3V6DB 4WFNQ 4K5RA 4WZMA 3KLFA 4IO1A 2BQUA 2RB7A 3KLVA 3SXLA 1UAWA 1NKBA 4LF4F 1NUEA 3THPA 2IRUA 1M5OC 4DZDA 2HGNA 5H9EK 2OMOA 4U7UK 4I69A 2AMCB 2E5IA 3M8PB 4DQRA 3JSYA 1XNQF 5RUBA 2B5JA 2FIUA 4KV8A 2MGZB 3RBXA 4LRCA 1HYSA 3HD2A 4FDFA 3Q8RB 5DG9A 2YKOA 2XSJB 4LVNP 3G6YA 4J90A 4RX6A 2MLXA 1RE1B 4L72B 3EXYA 3QGGA 4WE1B 1LOUA 3CB4A 1X9MA 4DFKA 4LF2A 5CZXA 4EK2A 4DPWA 2DNHA 3EGZA 2LVWA 2OD6A 4LF4J 2XMKA 1NK0A 3VVUA 2DPIA 5CD4H 5SUHA 2HEKA 1PGZA 1S48A 4KFBB 2CVEA 4UTGA 1VQ7S 3LANA 4ZS6A 4EI2A 2HGMA 4AXJA 2Z57B 1XNQJ 1U6BA 2JNJA 2RIJA 3W66A 2BJ7A 1UTAA 2QN6B 4LQ3A 5C24A 4PAAA 2PI4A 4P6QA 1R0CB 1GXTA 3Q8QB 4ED6A 4ED3A 2PC6A 4ECZA 3FRYA 4F4YA 1L3TA 1BQMB 5J1EA 1U6FA 1KONA 4IFYA 3EZUA 1YVFA 2VONA 1FWLA 4I2PB 4B17A 2XMMA 3GV5B 3BGFA 2FPHX 4P71A 4JI0F 4PABA 3B54A 3PW7A 2UXDF 4KSEB 4O3NA 3SBMA 2G13A 2KVQE 3Q23A 3FC9A 2GMJA 1S7IA 3T1YF 1NH8A 4WP8A 4UOCA 3QRRA 3H42A 2GMHA 1X5SA 5KFDA 4ZP7A 1N54B 2KXFA 1C2PA 2LEPA 1ZZFA 1QSYA 3RG6A 1HNIB 3I5AA 3GIJA 4TY8A 2CQ1A 5KG5A 2BE2A 2CJ9A 2VJUA 3IBWA 2EFPA 5F9NA 3CDWA 3M2RA 1RABB 1U02A 2XULA 1IBLF 1S6PB 3BKTA 1BQXA 3SFGA 3RW7A 3IR5B 2EFOA 2YQ3A 3GLJA 3ZZPA 1V3ZA 3JQMA 1F3FA 4JI0J 4EFAC 2UXDJ 1C4CA 3R7BB 3NG8A 1FX2A 2B9XA 1QJHA 3GCXP 3FCVA 2R2SA 1MWZA 3N28A 2EBEA 2MLYA 3OXFA 3T1YJ 2AW0A 3UPFA 4HH1A 2V5HG 2C2OB 4JB8B 3G71S 3FBFA 3QGPA 2W7AA 1T11A 2JZ5A 2UZAA 2C2NA 2KVIA 5IM0A 2W7PA 4DS5A 2ZHOA 1AYEA 1QTNB 1HI0P 2PEHA 3MTJA 2UV8G 4CLLA 1X4FA 1X5TA 3JSBA 5DM7Q 1R8HA 2IJNA 4OJ1A 5KFTA 1Q81T 3PJ9A 2FVCA 2MEWA 1IBLJ 3SFUA 2Z58B 1LWFA 4P7TA 1O8BA 4Q7AA 5CAAA 1CULB 1R0BG 1EIYB 5DDPC 3DLLQ 4NLVA 4A8OA 3IP0A 2GHPA 4KR0B 3CCQS 4LF6F 2XTJP 3ZTSA 1TUGB 1S1UA 1SH3A 4TY8B 2BBEA 2BE2B 2WONA 1XERA 5IFMA 1XWLA 1NAQA 2KKHA 4OZ1A 2JEFA 4B9MA 3M2RB 4PKDB 5E3AA 2DNPA 5D4LA 1FDNA 2FZCB 4X64F 3HKWA 3TAQA 2MTLA 3TA0A 3ELHA 1G1XA 3MI7X 1A0OB 2VJVA 3H5SA 4P2XA 4CP5A 3W62A 1VQLS 5CCMA 1ZAVA 1KHWA 3HVTA 3J7AN 3T41A 2EG1A 1SH2A 4XPEA 2R42A 1W25A 3GFYA 3K5OA 2LECA 2XWYA 1NK9A 2DNOA 4LF6J 4Z2XA 1NK8A 4GVBB 2F7VA 1WTBA 2C3OA 3GILA 1R8AA 3CTRA 2N4DA 3D4JA 3HVRA 3FGVA 4B9LA 3PV8A 3MR7A 1Y00A 2HGLA 2RUSA 4WKRA 3HT3A 1WORA 1LWFB 4X64J 4F3MA 1I94F 3R5DA 4USWA 8RUCA 1PJ5A 1H73A 4OJ3A 1DQAA 1FJGF 3UN5A 2XZDB 5CZVA 1SKSA 1S1UB 3CDBA 3LW5C 4Y2AA 3VGUA 1XN9A 2WONB 3JTOA 5EX3A 1KVIA 1JJ2R 4M5HA 3IRXA 2B8PA 5DZ6A 3GYXB 2H48B 4Z7CA 3N6LA 4EO6A 2QIFA 4DCPB 1CC7A 1T94A 1P9QC 2VZ9A 1AZSA 1BHNA 3R7SB 1X4DA 1N5QA 2WRMA 1X60A 1U1MA 1B0TA 1VBZA 2OHDA 1JXVA 3A3PB 5HVGA 2CPYA 3OFEA 2V0NA 2BOPA 4G1IA 4EGLA 5E5NA 3FKBA 1I94J 4ECRA 2POKA 3NGSA 1DRZA 1FJGJ 3MCSA 2Z2ZA 2XGPA 1QUVA 2QA2A 2ADCA 2HZAA 3C14A 2W8KA 3H4BA 2W01A 4LSLA 2ZE2B 3E51A 3AQPA 3MM6A 3FEXB 4U67Q 3FFIB 4I6YA 4LRBA 2GVZA 1YSJA 3DKDA 3PJWA 1UPMB 4KBIA 5LL6d 3Q22A 2ZBRA 1SQEA 3P8BB 1F2HA 1LV5A 3MAAA 3DM2A 1JLGA 3QT8A 4B3OA 2CQHA 3OTBA 1NO8A 1Q0NA 5H9FK 2XYGB 1OWXA 3IRXB 4LR8A 2YPYA 4JI3F 1T9UA 5L1IA 2VICA 1HNXF 4RUAA 1WSRA 1S6UA 5M2PA 2YNHB 4Z7YA 1VR6A 3LOUA 1AZSB 2DNNA 5E7OB 1IR2A 1B0PA 3BDEA 4AUKA 1SVDA 1LEOA 1AT1B 1FD8A 2E9RX 4UZCA 2IVFB 1BMQB 1UW4A 2W25A 2VIHA 2IY5B 3J80U 3DOLB 4NZ0A 3ULHA 5JUMA 1R6VA 2JEGA 2IBOA 3LWLA 5GAHU 3ZZRA 1C1BB 3K58A 2AZ1A 1KEKA 4A8SA 3T5JA 2PGCA 4ILLA 1VIOA 3MUVP 3W2WA 3W5ZA 5KOXA 1TL3A 4IQXA 3NBPA 3NWGA 1O6XA 4OYPA 3OVSA 4LSLB 3H5UA 3MM6B 2CZVC 4USVA 2VPWB 4QIEA 4JI3J 3TZXA 2GVZB 4N7TA 2JC0A 3LTOA 1SV5A 3GFHA 1HNXJ 3J7ZT 2GVDA 3PHEA 2ZJQQ 3GZ7A 3LPEA 2H5JB 4U8VA 5ETNA 4ECUA 3M6WA 5EX0A 2KZMA 1TMJA 1JLGB 3PX6A 1GNKA 3SCLE 3VAGA 4B3OB 3SQGB 1N36F 1FKPA 3EXCX 2QFJA 2IRYA 4ILMA 2MLZA 2IFXA 1A7GE 1JXEA 3JSMA 3BN7A 2RKIA 4NEYA 2J7UA 2WB1D 2PEBA 2VV5A 2KN4A 4TLQA 2KT5A 5HANA 4K4ZA 4FKYA 2VBXA 5ADZA 4DV5J 1S1VA 2X3DA 4KIAA 4G3IA 5JXSA 3W63A 3BSNA 3RB3A 2KFNA 1FK9A 2D7SA 2CJXB 2K7KA 3HZEA 5GAGU 2KTQA 2GS8A 2KL8A 5M2UA 2LXIA 4IRDA 4OJHA 2YVSA 1OO0B 4CNYA 4ZITA 2CUYA 3W2WB 4JV0A 2F5GA 2R8JA 2HBZB 4Y2KA 1N36J 1FNXH 1Y7PA 2HZCA 1JLBA 3M2UA 3N79A 3ETOA 5D4NA 4WFXA 2AJ4A 2GVDB 1YG0A 1T7PA 5MLCV 3UFCX 4DCOB 5F3TA 2C2EA 3CDUA 5FDLA 4DR5F 3TX0A 1FKPB 5IT9Y 5LM7E 1S1WA 2FVPA 4L6V3 4ZVQB 4O3PA 1RYSA 4ID8A 4F25A 3E01A 2DT9A 1QSSA 4IRCA 2VDHA 3X1LB 2GJ2A 5A0YB 2R7WA 1K8AT 1FEHA 1S12A 2GC8A 4DPXA 3DOKA 3MDFA 4GKKF 4EYIB 2CNNB 4HH0A 1R0AB 2BW7A 2GAGC 3HJVA 1S97A 5HSPA 3CIZA 2G2ZA 2VG6A 3I0RB 1WHWA 1E6YA 2DCLA 5A2QY 4NCBA 2RVJA 3SCJE 3KLHA 4K2JA 3GIMA 1M90T 1FDBA 5ETQA 3GIKA 2E5JA 3PACA 2F63A 4OX6A 3QBCA 2PT0A 3AA8A 2W4PA 4URSA 4Q8FA 2WW8A 4OV6A 1MLAA 5BYRA 3W60A 5KG1A 2J8AA 4IUFA 5DGAA 2P9CA 4GKKJ 4ECQA 2B4PA 3VWSA 2Y9HA 1FX4A 1V3RA 4HVZA 4C7QA 2MZJA 4C8KA 1DY3A 4QR0A 3V4IB 3LH2S 2XS5A 4CWBA 3N01A 2RSQA 2YWHA 2AX1A 1X0PA 7FD1A 5M2RA 2ASDA 1NCLA 3PHTA 3FSIA 3DOKB 3L95X 4J9QA 3AOCA 4ZPCA 2BR0A 2W1BA 2DTJA 2VFSA 1JLFA 1Q8LA 3MCNA 2ZHBA 2PD1A 1E6YB 2RHSB 5A8RA 3KLEB 4ZHRA 1C0TB 3CJ4A 4OZLA 1RAFB 4ELUA 2BANA 3BV8A 2NREA 1WEYA 1NM2A 3CCWA 2CRLA 2MPUA 9RUBA 2V2QA 4JUZA 2FHJA 4N8NA 4MT1A 4FXWA 3FRZA 1Y3JA 2KB2A 2DH7A 1B4SA 2NPFA 3PIPQ 2LXUA 2VOOA 4CM0A 1UPPA 1FJCA 2IJRA 2FVSA 2FHJD 3F73A 3ICLA 2MJNA 3D54A 4O23A 2ZUAA 4DZ6A 1RHJB 1DBDA 4C9DA 4K2XA 1CJVB 4P75A 1X8DA 3AHPA 3IR6B 1NPKA 4MIWA 3R97A 1OS5A 4H4KC 2EC2A 2K3IA 2PMHA 5F8IA 4IOBA 3IWLA 4B3RF 2QMXA 1REGX 3CC2S 4YB1P 2C3MA 1BD6A 2KG1A 4LBPA 4ECVA 3TJ8A 1NK7A 4DPYA 4WIIA 3JQJA 2J0SD 3ITHB 3OPKA 4DLEA 2RHQB 4C8YA 2ZH4A 5A8RB 4XAKA 3MEDB 4ZHRB 2JRSA 1D9AA 2CKWA 3EM1A 2ZNZA 4H54A 5CHCB 2HFOA 2CVIA 3F56A 1F9EB 1ZM2A 2PO4A 2HS0A 4AD6A 2OSRA 1EETA 2RRAA 1VQ5S 4PG6A 2DGUA 5L38A 5DQHA 3D28A 5K8PA 3BO4A 2YNIA 4P2MA 2WVEA 1LW2B 2E5GA 1DAXA 1Q8KA 4CTAA 3T9NA 2OJ3A 4V1Ak 4B3RJ 3V81A 1APSA 4DPUA 4GMKA 3EYZA 5GMKa 2CQGA 3LO3A 2R7UA 1C1CA 2XNRA 2JVRA 4LF1A 3VAFA 1BGXT 1RWOB 2BJ3A 4ZVGA 4JI4F 4C3LA 1AXQA 4DV3F 2XS7A 2WTFA 1B99A 2JVOA 4LUBA 1FXLA 1S4FA 4O0NA 2D3ZA 4DUTA 2DGTA 3AD7C 2XM3A 1M5VC 3PEJA 5CD4A 2W9AA 4ZJQA 2WW4A 1XR7A 1EARA 5ETMA 1NBEB 1GX6A 3TR5A 4CCHA 2HK3A 2ZOGA 2FJXA 4OIXA 4Q0BB 4B9UA 4NYPA 4QYZK 4X4UA 1RT7B 3BBFA 2YNIB 2G9OA 4F4WA 2VG7A 1SL2A 2ALYB 2IYGA 3BS9A 3HHLC 1WC3A 1XJWB 2CJKA 3DLJA 4K5SA 2JLEA 4JI4J 2GAHC 1FHTA 1U1KA 4A4JA 4KT0C 4GO5X 1CJUA 4DV3J 1Y9OA 4RO0A 3V81B 2A2CA 4IDKA 4PXCA 1WG1A 2BM0A 2U2FA 1WG5A 4RW6A 4DDFA 1C1CB 2HLUA 2ZEJA 3M8QA 2Z2MA 4QIWD 5GADI 3CF5Q 3POTA 2W2QP 2IA6A 1FI4A 1SL1A 3MM9B 1TKTA 2N7YA 4A8MP 2DGXA 3H98A 1HNVB 1BQNA 3OQ2A 2X51A 3V5RA 4DSIA 1TELA 1TAUA 2W9BB 2GGPA 3L09A 3PYGA 3RGIA 4RBVA 3G96A 3S1TA 4NLYA 3J7Z5 4B9TA 2LEBA 2ASYA 2Z2LA 2P9GA 4USUA 3OR2A 1NPPA 1FFSB 1C0UA 2VD3A 3OJSA 4ID5A 1FTRA 1S76D 1GMVA 3P45B 2F9JA 1K1QA 5HJXA 2XZWA 2DNYA 4KGKA 2KM8B 2RE1A 4QQBA 4OHYA 1H2VZ 4YDDB 1KNZA 3H5YA 1QSLA 4EUVA 2HNZA 2ABYA 2G0JA 2V8GA 2WZ1A 3R27A 4OX7A 3EDQB 2I8EA 4M5MA 2PDAA 4F4AA 4QJVA 1KQKA 3ZO7A 1CJUB 5D6GA 4FNIA 3OW2R 5L9XA 2LMIA 3EZ5A 3J7YU 4WP9A 3SCKE 2EEYA 4HHJA 5IC6B 1F3VA 1U4BA 2AGPA 4IR1A 3D1HA 3NRBA 3G8QA 4AXIA 2B0GA 3M8QB 4TQRA 5EWEA 1FO1A 1VC0A 4TU9A 3QFHA 3HSDA 3D5MA 3OTOF 1UWBA 4X65F 3GR1A 4ZP8A 1BQNB 3GV7B 3CJ0A 2W7OA 4YQWA 1U1RA 3RUBL 3GSIA 1YRTA 5B0DA 2DNMA 3DDIA 4H4MA 1FVQA 4H4OA 4PPDA 1CJTA 1D3WA 5D0GA 3K89A 3OR2B 2N7CA 2CJQA 1EZZB 1C0UB 2M88A 1HBNA 1UCNA 4FYXB 3RTVA 3U1MA 2W24A 3SDEB 2VQFF 1R8PA 2XG8A 5IZHA 4CI0B 5IT9U 4QCLA 1IQTA 3KLIB 5B0FA 4YB7A 2IBKA 4PWDA 4F3QA 2MQPA 3PX0A 1B64A 4FF4A 2ZKUA 4I7FA 2DRBA 3OTOJ 4E8UA 4X65J 1JNRB 3VHQA 3HHEA 4Y3CA 2QO3A 4DV7F 1HKAA 2J7WA 3AY0A 2ZZTA 3D3CJ 3IFEA 3S8SA 4Y2CA 4WP3A 1JKHB 3R5CA 2NPIA 4DL0C 5HATA 1NDLA 3PYDA 3P5TL 4ANEA 5A2QU 1UWBB 3KK3B 1RLCL 3JYTA 2FHMA 4DV6F 2BKPA 1NSPA 2VQFJ 5L1LA 3V4MA 4R0JA 1NNDA 1TUWA 4R5PA 4RW4B 3BO3A 3M2VB 4H4MB 3CULA 4RKUC 2FLLA 1CJTB 4MK7A 4WXOA 2ROGA 2FJVA 1FF2A 1PKUA 4IRKA 1LXNA 4ES2A 3NGTA 5EGYA 5GVQA 1LK5A 4PG8A 3BKUA 1N33F 1OQ3A 1FRLA 1IR1A 4DG1A 4JI5F 4KY3A 2F8EX 3O3LA 2A10A 2H4WB 1TUVA 1NU4A 4I7FB 2V6AA 1J2VA 3SSQA 2B4OA 1UVKA 5T7LB 5EN1A 4DV6J 4DQSA 4OHVA 2WVBA 2ZNYA 3HFZB 1XMQF 1RT4A 3KJFB 1IKWA 3B4DA 4MH8A 1JB0C 1URNA 5CQGA 3M8ZA 1QTMA 1RTJA 4RUCA 2OEKA 4UQGA 1UZHA 2W2PP 3I6PA 1TAQA 3ZC4A 1SCJB 3TWZA 4F2SA 5AE2A 4AT1B 1VBXA 7FDRA 1MN9A 4DHVA 1N33J 4GKJF 2OI2A 2K1RA 4XPCA 4JI5J 3UN2A 1KSPA 2CG8A 1X0FA 4IG0B 3UW1A 4NE9C 5L8RC 3ISND 2DJWA 4FP9A 3CJ2A 1U49A 1M1HA 2M9KA 1WKLA 3O1LA 4U9RA 1I1GA 1GMUA 1YRUA 2KXNB 1F1BB 1P27B 2BEFA 2E44A 1XMQJ 1UW9A 3AH6A 5KFFA 3K0JA 4G1PA 4FS2A 4JV2A 5DLFA 2KYXA 4YR0A 3SCIE 1RHRB 1B3TA 3QPIA 4ER8A 1HNWF 1N5TA 1CQMA 2Z2YB 1TKXA 1LNQA 1AFIA 4WU2A 4PR6A 4GKJJ 2XCPA 5E2QA 3M30A 2DXEA 2K3KA 1QAXA 1NKCA 2VHGA 5AE1A 1RTJB 2JHEA 1W7WA 1U2FA 1WF0A 2QGFB 1MROB 1F5AA 5K20B 3VALA 4DQQA 1N5YA 5F9LA 1QD1A 2G0IA 1KLMB 4QIVA 2BVZA 3C15B 4QU6A 2BQRA 2K1RB 4UY8T 4NA3A 1QE1B 2RRNA 4M5JA 5KFAA 4PXDA 3QFWA 1GX5A 3MCMA 3KJNB 2Z56B 5I42B 2NQPA 1HNWJ 1SC4B 4LBHA 2HWIA 3R7NB 4ICLA 1FE0A 5ETSA 1R43A 4DS4A 2QV6A 1R7IA 2YKNB 4RU9A 4JYAF 2HQCA 2NYIA 1RCXB 2HHHF 2Q6CA 2Y0BB 3A1YG 4NYZA 4OX8A 3PFOA 3QNWB 2LU1A 1HQUB 4X4RA 3KNAA 1WOPA 5DZ7A 3UNYA 4W92B 1Q95G 2GJIA 1RYRA 3GFXA 1YJWS 5CYQA 4DL3A 3M30B 1GMWA 2DEJA 2MSTA 2U1AA 4ECXA 1S0OA 1OY6A 2UVUA 3LP0B 4XTTA 2JEIA 1BUXA 4F0KA 3NKYA 1LW0A 2OMLA 1GMWD 3BF4A 2XCAA 4BS2A 5F8NA 1WDTA 5IV3A 4JYAJ 1OPIA 1NJZA 3MUTP 3NNHA 1FRMA 4S0MA 2GNKA 2HHHJ 3TJAA 1EHWA 1R8CA 3MR5A 3FMWA 3HVAA 2V67A 3DHWC 3M1VA 2VKRA 2IMWP 1TQLA 3ZNJ1 3BEGB 4OZ2A 3WIUA 3OD2A 3B78A 1K0VA 3AB2B 5KFNA 3QJPA 2XQCA 3BYRA 2EK6A 1SIWB 1P8GA 3MR3A 4IO9Q 3UQSA 1CVJA 3HKZD 1RTHB 3IMQJ 3OJUA 5BYSA 2YX4A 3I32A 4CLZA 2V69A 3QIPB 4CH7A 2BV3A 1TP7A 1WC4A 5HI7A 1RT6A 4Q8EA 2YQ0A 3IAS9 1S0MA 3KJVB 4OYIA 1U6ZA 2C28A 4ZIVA 3MPVA 1FA0A 2G1DA 2VL1A 4HTIA 2F1FA 1SKWA 3BSCA 1YJTA 1U2CA 2LQBA 3HFKA 1KP6A 4MIAA 3X3UA 2KT3A 2XHCA 4F7VA 2QFIA 5I4MA 1N0UA 4LMZA 5GADU 3NGUA 1WTFA 4OMFG 1FKAF 2LU2A 2RD5C 4Y65A 4CLKA 1GTEA 4N76A 5DG8A 3VV2B 5IV4A 3EGVA 5B0GA 4ZIWA 2G2OA 3GMGA 2FYXA 4NLDA 5D0RA 3U7JA 4PEOA 1IM4A 1SPBP 3SEOA 5E3QA 1QAIA 5IC4B 4OHWA 4DV1F 3G9CA 2XI3A 4ZMMA 2HHUA 2QSWA 4MIBA 2KZZA 1HHQA 3G6ES 3W1YC 2MZ1A 5D78A 4DXLA 3IN5A 3G82A 3CIMA 3CGIA 1ZTWA 2GQCA 3AJDA 5J1PA 2ZD1A 4WFAQ 3ZTPA 1FFGB 2FHOB 2GX8A 2W9CA 4QWCA 1KKHA 2D74B 2LKZA 1RXOB 1WF2A 4A8YA 2HYIB 2KYZA 4P72A 1YDLA 1X4HA 4DU8A 2AZ3A 3DRSA 3MMAB 2ILYA 2HVIA 3M6VA 1ZZNA 2YTCA 1TK8A 2DNLA 2BDPA 1VIXA 4FF1A 1YK9A 4FN5A 4M94A 5D0EA 2ZKTA 2HRYA 2I1RA 4NI2A 4LBIA 3MM5B 2UP1A 4DV1J 3HP6A 2GO9A 4NZ7A 1Q78A 3TRGA 2M8HA 2JH3A 3LUYA 3ILOA 5F8LA 3M8WA 4LFAF 1RHMB 3KWMA 1UETA 1LWXA 2ADBA 4HACA 2FY1A 3MEKA 3TZWA 3DXBA 4PXBA 5K8NA 5EHHA 4NMXA 1IKYA 3LALA 3EGWB 1WC5A 4NYOA 3GYNA 2AJ2A 1F9FA 3DC2A 3FNNA 2IIHA 2W4CA 3MPYA 4M5LA 2IAJA 2XLIA 1TVRA 4BC9A 4UW2A 4IOCQ 3G82B 3UVJB 3JQKA 4C0HA 2B4UA 3CEDA 4K7QA 3VAHA 2ZD1B 3CD7A 1UA0A 2IHR1 1CJKA 1AA1B 2W9CB 1S6QB 3Q2SC 5E3CA 4OZJA 3WX4A 3HDSA 3CSKA 4KO0A 4NLXA 3RRGA 1H3DA 2V94A 5KFMA 4J9MA 3WHIA 2J0QD 5KG3A 1S0VA 2NXUA 5IOLA 3DRPB 1REVB 4LFAJ 1WD6A 2DPJA 5K5MA 1HWLA 1Q82T 2WBRA 1RWMB 2NUUG 1KTVA 5T14A 2A0FB 4J9OA 2AEJA 1WI8A 4PXEA 2RS2A 1XQIA 3RJMB 1RT5A 5C42A 1RT1A 1NRKA 1RAAB 3H2VE 1N48A 3QQCD 4O4GA 1KQGB 2D3O1 1YJ7A 1D9FA 3LGMA 1MN7A 3KLGB 1JLAA 1E6VA 3CO9A 1NK5A 2FVRA 4M8LA 2BACA 1VJQA 2RF2A 4IFVA 3ZZUA 4WF9Q 1BXNA 4U7UD 2WVFA 1IKYB 1XMBA 4Y2MA 3CCLS 1IKVA 1U1PA 4ZN3A 4LSZB 2CPZA 4LF7F 4USMA 4RBTA 2SXLA 3UCUP 1A9NB 5HN0A 3GU0A 4LIRA 8AT1B 3EGNA 1JK9B 4OI4A 1JLQA 4DN9A 2HFNA 3I9ZA 4KO0B 4YB5A 4RZRA 3FDSA 5FD1A 4L73A 1I3OB 2FHKA 2GA7A 1FRJA 2FLPA 1IBKF 1IXKA 1WOSA 3I31A 4OYZA 2LCWA 2Y1IA 2MZTA 2QL5B 3H4DA 5G0RB 3GJRB 3VAKA 2HNDB 2YNGB 4IG3A 3ILIA 4DCJB 3I4HX 2HW3A 1Y5LB 1WEZA 4AYBD 3TVZA 1RT5B 3A8JA 4LF7J 5C42B 1KLNA 3N6MA 5KG6A 3RZAA 4O4GB 2I38A 5DS7A 2OEJA 3ZTOA 2LQJA 3R8YA 3EJMA 1S1TA 2ZUGA 3G86A 2NS1B 4CLYA 5F0UA 3HHDA 3FSXA 1IKVB 3HULA 1VQ6S 3C46A 3D1OA 3C3LA 1KTQA 1UVJA 3I0SB 4P10A 1IBKJ 2YWKA 5D15A 2MQOA 3BQ2A 3QSYB 5KFZA 4P2SA 1G7CB 5LSLA 3OSNA 4K0KF 4F26A 1JLQB 2QLXA 1UFWA 2BJ1A 2FC8A 1OMSA 1YGYA 1RUSA 3BGOP 4FVCA 4Q45A 2H1YA 4IH6A 1J5OB 4HTJA 1U0HB 2MKHA 2V4JA 4DQIA 3ADAC 2YWGA 3M4XA 5HMXA 2KH9A 2DY9A 2HWHA 4KYZA 3D66A 4C11A 4DFPA 2HVZA 3GIRA 2EFQA 2FB0A 3DLGB 3HFVA 4IG3B 4Q2MA 5A6WA 1BLUA 4ZLLA 4DU7A 2CQIA 1NPRA 5D77A 5JMNA 3L7PA 3H0PA 2YPZA 1IBCB 2DHAA 1HBMA 4PUOA 1HBOA 4RNNA 3MM8A 4IH7A 1MWYA 4K0KJ 4P7VA 3M32A 3DOMA 2HVHA 1S1TB 3RAXA 3R6LB 5ETLA 1X4BA 1ZH5A 1FWKA 2DEIA 1S1XA 2E1AA 4LFBF 1ZOTA 2JFKA 3IS9B 4DL6A 3MFHA 4HKQA 4M5DA 5DG7A 3CJ3A 3FVYA 1SXLA 2QA4S 4X2BA 3N5BA 4WCEQ 2APOA 1W2IA 1H2TZ 5K14A 1HWIA 4CQ1A 3MZIA 2DKOB 1H2UX 2ZWOA 4OYXA 1G2EA 3UE2A 4BBYA 3QLHB 1ROFA 3PW2A 3OFFA 2H54B 4K4SA 3M9MB 2P6SA 1HQEB 1OYEA 1Z2LA 1FWPA 4FF3A 3PNIA 4C11B 3HJFA 1T05B 2VFVA 4HI2A 4DUZF 2VG5B 3ENVA 3J80Y 4LFBJ 2NXNA 1XNRF 1H7XA 1RBOB 5ETVA 5DQGA 3NGKA 3HSZA 2HG4A 1X5OA 3Q0AA 3NEKA 1B7FA 3PZPA 1UEKA 3T19A 1HBMB 3CCTA 4DMZA 3MPUB 4YUDA 1A6LA 4TU8A 3KG0A 4DI6A 2K06A 1L3UA 2QC3A 3PY8A 2IYIA 2ZVSA 2XMJA 1LQ9A 2LYVA 3W5YA 1TV6A 1UVMA 3OFHA 1S1XB 3ILLA 1YHQS 1YQHA 5HO4A 1EKSA 1RP5A 2RDDA 2I5JA 3MUMP 3TUJC 2YKPA 3TZZA 3MPDA 5SZTA 2DGSA 2VPXB 3HSJA 2I0XA 4AL7A 1V5VA 1RT3A 3CJKA 2W8LA 4DUZJ 4LJMA 1TKZB 1TK5A 1S5ZA 2HHTA 2DCUB 1KS2A 4NASA 1K1SA 1XNRJ 1IQZA 1B70B 5ETKA 5HK4A 2B7CB 2HNYA 2RMLA 2DYAA 1U45A 3GCWP 3C6TB 2UU9J 2QTWA 4AL6A 2IVMA 5I3PA 2N4CA 1HLWA 1NSQA 2KRBA 3MR2A 3P96A 4C8LA 3FJ2A 3DI6A 2QYCA 2FJAB 1FERA 4JI7F 4LF9F 2DH9A 2BQ3A 3UDEA 2MKJA 1LWEA 4ZK7M 3UDCA 2MZRA 2IVYA 4C0OC 3ET6A 5J2PA 3BPSP 5LOQA 3RBDA 4HL9A 2IRXA 5HROA 2J9CA 1JLCB 3OSPA 1VBYA 4O44B 4PYDA 2I5JB 4PZVA 2EG2A 3HHNB 1HR0F 2F65A 2YBVA 3G2XA 3TA2A 2WVDA 1VQOS 2HAIA 5KTQA 3DXSX 3KLFB 2IA0A 5KOWA 3MMBA 2GZOA 2CJBA 4W90B 2H65B 4OYWA 4JI7J 4LF9J 2HNYB 1CSJA 1LKZA 3LWMA 1TU0B 1XC9A 4KH1B 3SSRA 1KVKA 4LSNA 1K9MT 4OI6A 3H20A 4DSJA 2FJEB 3HX9A 2B5JB 4KV8B 4B9VA 4B9SA 1JJCB 1HYSB 2QMUB 3DLEA 2UUAF 2CG4A 3DI6B 1YJUA 2A6MA 1Q1KA 5BXIA 5GAEU 1HR0J 2WSCC 4QWBA 3BPDA 3MMCA 4QWEA 3PKMA 1NH7A
chains in the Genus database with same CATH topology
1UVIA 2XGQA 1Y9OA 4MFBA 2COLA 4WK3A 2V8DA 4CO4A 4U6PA 2A2CA 4IDKA 2OPQA 1SC6A 2L9WA 3NLCA 4PXCA 4WJBA 4DBQA 5HQ8A 3US5A 2C2RA 4IH5A 3NCPA 2E5LF 1WG1A 3I96A 2BM0A 3VZHA 4WYLA 2R4FA 3WZ0A 1M5HA 2U2FA 4DR2F 1WG5A 4RW6A 3CCJS 3GR0A 4DDFA 1C1CB 2HLUA 2HIQA 2IM2A 4XK8C 4DFJA 2YKMA 2XLJA 1V9OA 3M8QA 2Z2MA 4QIWD 3P3DA 1Q8IA 1YWXA 5IQ6A 3MEEB 2A3JA 2Z8QA 4Q2LA 5J2QB 5I3UA 1WNEA 5GADI 4Q44A 3DLGA 5HROB 5DM6Q 3LAMA 3CF5Q 4K4XA 3H5XA 3IRWP 2BJDA 2OIHA 4NL5A 3POTA 2M0GB 2BJEA 1Q16B 2M5YA 4QR2A 4DV4F 4MKYA 2AF6A 2IA6A 1SL1A 3MM9B 1D8ZA 5BJRA 2DR5A 1TKTA 3D0GE 2N7YA 4EWTA 3OR1A 4A8MP 1S10A 1K0TA 3IGNA 1BWEA 2DGXA 1FRKA 3H98A 4JI8F 1HNVB 3VF0B 5KFOA 3U27A 1T8EA 4JI1F 1BQNA 3CDAA 1DFDA 4ZDNA 3OQ2A 1R31A 3H59A 2X51A 1S49A 2HQIA 1N0VC 3RW6A 3V5RA 3TUZC 3DRRB 3C8YA 4DSIA 3BM7A 2FJBB 3MGJA 1TAUA 2W9BB 1DZ5A 2GGPA 2F8MA 5AXNA 5C24B 1AFJA 3L09A 1H0HB 3OVBA 4ZPDA 4Y28C 2XY6A 4RBVA 3G96A 3QWUA 3PX4A 5KFLA 1Y5IB 5L39A 3S1TA 3CC4S 1TKXB 3TX8A 4NLYA 3J7Z5 2JSXA 4B9TA 1DQ8A 4C3MA 2LEBA 2ASYA 2UXBF 3WDOA 2WBMA 2Z2LA 1JIHA 1H6KX 2P9GA 1OQ6A 3MM7B 3N5FA 4X4QA 2ZH6A 4DL7A 3OLAA 3OR2A 2RQCA 3KK1A 5D4PA 4KC5A 2VD3A 1C0UA 5B0EA 3RRHA 3OJSA 1B0VA 3OXGA 3V4IA 3IS9A 5J1EB 4ID5A 1FTRA 2A18A 4IYQA 2NLWA 1S76D 4IFYB 3DN9A 1UEUA 4I6AA 4LSNB 5KFHA 4JBCA 3W2VA 4X62F 2F9JA 3PEHA 3OHAA 4DR1F 1K1QA 2HWTA 3K5LA 2XZWA 2DNYA 3NP5A 2YX7A 1VQ9S 2PSZA 4KGKA 4GC7A 4KE5A 2GHVC 2KM8B 4TYAA 5LSOA 2RE1A 5A6PA 4HYKA 1X4GA 4QQBA 4OHYA 1H2VZ 4YDDB 2MHEA 2Z4PA 1KNZA 3H5YA 1QSLA 4HLBA 5HBMA 2KHDA 1YJ9S 4EUVA 4TU7A 4LFCF 2XHWA 5CYMB 3KK2B 3DLEB 2HNZA 2ROPA 3TI0A 2WCXA 3CCVS 3I9V9 4A8KA 1N5YB 2XMTA 2ABYA 3I82A 4RLEA 3CCRS 1TL5A 3KHRA 3KKFA 1U26A 2V8GA 3PO5A 3HZGA 1HD1A 3R27A 3VQSA 2KM8C 4J9PA 4OX7A 2RNEA 3NCRA 4ZKAA 5KFBA 2OPPA 3OHBA 2L48A 2I8EA 4HT5A 2J9DA 1YIJS 1OIAA 1UMJA 3QZ7A 2PDAA 4ZA1A 4QWDA 4QJVA 1KQKA 4JV1A 3QLHA 5D6GA 4FNIA 2R7RA 3OW2R 3L7OA 3BB5A 5L9XA 4X4NA 1M0SA 2LMIA 4QPXA 3LAKA 4OV1A 2HPUA 3M9NB 3EZ5A 3BZQA 4MFBB 4Q43A 3J7YU 3SYZA 3KLEA 1T3NA 2OPQB 1C0TA 1JLEA 3QIDA 1SJ3P 1KQSR 3SCKE 3HPOA 4HHJA 3KOAA 1HQEA 2C3YA 5HMWA 1YTYA 4DOZA 1HHSA 2ACYA 1U4BA 1OSCA 1ULRA 2UVRA 2AGPA 4FF2A 2XS2A 1RGVA 4IR1A 1DTTA 3D1HA 4PG5A 3BO2A 1XK8A 3H40A 3NRBA 3G8QA 4AXIA 2YKMB 2MSSA 4NWBA 3RU0A 2B0GA 3R5AA 3UD4P 2D41A 3M8QB 4TQRA 3FQKA 5EWEA 4ICLB 5MAOA 4YR3A 1IJFB 1FDDA 1FO1A 1T05A 3K2YA 2PIIA 2R2UA 3KNGA 3VAIA 4OI2A 2VG5A 2C42A 3ZZOA 1VC0A 4PG4A 4TU9A 1XBWA 3D5MA 4F8RA 4TNOA 1FRXA 1WHXA 4MMOA 3OTOF 4MYUA 4M63A 4QR1A 2AWZA 1RKIA 2CDQA 1UWBA 2R7OA 4X65F 3GR1A 1FE4A 2E1RA 4ZP8A 3OR1B 4DPOA 5C5JA 4PQUA 4X84A 1RA7A 2FJDB 2J9DE 1BQNB 3GV7B 1PC4A 4B3SF 4X4PA 3FZBA 2CPHA 3DDNA 3CJ0A 2W7OA 4DJBA 5F8MA 3VCDA 1BC6A 2BXJA 4YQWA 1WHYA 3MECA 1U1RA 2XEXA 4MK8A 4JI2F 3AAWB 1YRTA 1YI2S 4F4ZA 5B0DA 2XB2D 1N88A 4NMLA 2FDNA 5EUHA 4O3OA 2DNMA 4ZP9A 4H4MA 3IA0A 3IO1A 4TKTA 1FVQA 4ECWA 1IR0A 4Y34A 4E0DA 4H4OA 1H7WA 5IXUA 5F8HA 4PPDA 1SIZA 3T5KA 1N56A 3C2PA 1FRHA 1D3WA 1MMNA 3BSAA 1JXLA 4FBTA 2YWEA 3OR2B 2PA8D 3KK1B 2N7CA 2XLKA 2CJQA 1C0UB 3MPWA 2AJ1A 2OPRA 3KG4A 5CYQB 3TP2A 5KFQA 1FJEB 3U02A 4A47A 1FT8A 2M88A 4HI1A 1HBNA 3RYLA 5DDRC 3CVKA 3M9OB 2UXCF 2FJWA 1O5JA 1XR5A 1UVLA 2CPFA 2DGVA 3GG1A 4CO1A 2MKKA 1DQ9A 3W2VB 2RJZA 4PRFA 4IOAQ 1Q53A 4RW9A 3RTVA 2UUTA 3U1MA 2HHSA 2B56A 1IBMF 2W24A 3SDEB 3CJ5A 1UEVA 3QYYA 5IM0B 2BUNA 2VQFF 4WFYA 1R8PA 2XG8A 4O3QA 4OJGA 5B7WA 5HBMB 2B43A 3T6JA 5IZHA 4CI0B 1MW7A 2DHSA 3V6DA 3CD0A 1U25A 5LMUF 4Y00A 1TK0A 1D9DA 4KHPF 4QCLA 1IQTA 3KLIB 5B0FA 2F8HA 4YB7A 2IBKA 4PWDA 4F3QA 1Y3KA 2MQPA 3PX0A 4ECYA 2NZ4A 1B64A 1X7VA 3UCZP 4FF4A 2V4RA 4C4WA 1LW0B 2ZKUA 1TKZA 2P9EA 4I7FA 2OPPB 3WC2A 1LXJA 1URRA 2DRBA 1VK8A 2YX1A 4YDXA 5J2MA 2R8IA 1ZTTA 1VMBA 3ITHA 4E8UA 3T5HA 1ZAXA 4I6WA 4QIFA 1JNRB 1SJ1A 3DRXA 4I68A 4KAIA 4EEYA 3GB0A 1KD1T 3HHEA 4UQTA 2MXYA 1UJ6A 2PI5A 2M4MA 3MEDA 1RWUA 4KQZA 4Y3CA 5DDQC 2R7VA 2QO3A 3K5NA 4DV7F 2DISA 2KI2A 2J7WA 2E29A 3AY0A 3M1VB 2GV1A 3LF0A 3C6TA 4YP3A 5KG0A 2B7BB 2QMWA 2OSQA 5DDOC 3IFEA 3S8SA 4MK9A 4V19J 4DR6F 4Y2CA 1RK8A 2CPJA 4BDPA 4ZCMA 2MY8A 4IQMA 5E41A 5D3GA 3T1HF 1JKHB 2R2RA 3R5CA 3TARA 1DLOB 2NPIA 3CD5A 5F8JA 4DL0C 2MYFA 2PMZD 3K5PA 2DO0A 1SUQA 2KT2A 4QWAA 5ITHA 5KFVA 2DRAA 5F8GA 2PN6A 1TR0A 3P5TL 2EFVA 2LDIA 2QT7A 2O1PA 3SMZA 1FTCA 3G6VA 1NK6A 1UWBB 2LA6A 3KK3B 3M05A 2QA4G 4PQUB 4FXVA 4DL4A 4J37A 1LW2A 1ZM3A 3JYTA 2FHMA 4DV6F 3CCES 4K4TA 4DR4F 2XMWA 1X4CA 2V9KA 3N6NA 1HL6A 4DX8H 1NB7A 5L1LA 3MECB 4ITSA 2B9YA 1FNOA 3V4MA 4LF8F 2J9EA 1MNEA 4WE1A 1EP4A 3LP1A 4N56A 3MAQA 2HHQA 4R0JA 1NNDA 4R5PA 4Z37A 2HHWA 4RW4B 3BO3A 3HVTB 2VOPA 3M2VB 4H4MB 1Z4UA 3CULA 4RKUC 1O0PA 3O5TB 2R7XA 2FLLA 4D3HA 4MK7A 3RAQA 2ZBIA 4B9NA