4PRFA

A second look at the hdv ribozyme structure and dynamics.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New tools provide a second look at HDV ribozyme structure, dynamics and cleavage.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
molecule keywords Hepatitis Delta virus ribozyme
total genus 24
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4prfA00
1H2UX 2JRSA 2MZQA 5LSOA 4Z2XA 3TYTA 2MKKA 2Q79A 5GVQA 4UY8T 2DITA 2MY7A 4QPTA 3EGZA 2CPIA 2CQBA 5DM6Q 2LA6A 1UAWA 3BS9A 1WEYA 2HYIB 4FXWA 3J7ZT 5GADU 1A9NB 1YIJS 2J0QD 3CXCR 2QA4S 3R1HA 1FT8A 2XS5A 4W90B 1UW4A 2F3JA 2HGLA 3CCQS 1JJ4A 3NNAA 2DNMA 1DHMA 4PRFA 2D3OR 2RS2A 2OTJS 2KM8C 3D2WA 2LMIA 4J5OA 2DNZA 3US5A 1DRZA 2CPEA 1BY9A 1SXLA 1VQ6S 1D8ZA 5D78A 3G4SS 2UP1A 3IWNC 2KG0A 4C4WA 4YOEA 2DGTA 2DGXA 2I38A 2MKJA 2PE8A 4TU8A 4QQBA 3UWTA 2JWNA 2CQ1A 2MZJA 3U1LA 2CQGA 1L3KA 2M9KA 1UP1A 1Q82T 1WG4A 1U1PA 2KVIA 1WF0A 2CQ3A 1ZZFA 5DDPC 4BS2A 4PR6A 2AD9A 3CTRA 4TLQA 3G8TA 4V19X 1NO8A 2AYMA 2E5IA 2MJUA 2DHGA 3CMES 2AYBA 2ADCA 2LA4A 2DHSA 1U1NA 4ZKAA 3U1MA 2DGQA 1VQ7S 5LXRA 2N7CA 2CPJA 2DNGA 2CPXA 3V4MA 1FJ7A 3MUVP 3LPYA 2MMYA 3UCZP 3PIOQ 1YHQS 3THTA 3NMRA 3JB9k 2CQ2A 2MHNA 3NS5A 2RNEA 5H1SV 4WFNQ 3S7RA 4M5DB 5EN1A 2RU3A 1UFWA 2ADBA 1F9FA 2YWKA 2CPHA 1WI6A 3G96A 2M8DB 3VF0B 2CPFA 2DGWA 3DXBA 3Q2SC 2M4MA 2LEAA 5BJRA 1SJFA 1QM9A 1CVJA 3SDEB 5LJ5Y 1KQSR 2MQPA 3MURP 2HGMA 2BOPA 1JJHA 1XN9A 5CYJA 1HD0A 4EGLA 4IUFA 5IM0A 2NLWA 2MY8A 3ZZZA 1U1LA 2E5GA 4FXVA 4F26A 1X4DA 5IFMA 1VBXA 1DBDA 2DGUA 2KXFA 2KN4A 1G2EA 1D9AA 2O3DA 3FEYB 2CQDA 2HVZA 2CJKA 1KC8T 3BO4A 2U2FA 2YTCA 1FJCA 2DGSA 4ERDA 5LSLA 2KM8B 3CPWR 1N52B 2D9PA 2JX2A 3CCES 2G0CA 1JMTA 3CCLS 4LJMA 1VBYA 2CQIA 2XSFA 4IOCQ 1WG5A 2RUGA 1FJEB 2X1FA 1X4GA 1FO1A 3H2UB 2FC9A 3N9UC 2CQ4A 4F25A 5FJ4A 2DNLA 2DH8A 2F9DA 2M7SA 4WIIA 3MXHP 2EK6A 2MPUA 1DZ5A 5DETA 1FHTA 2E5HA 4WKRA 3R1LA 2RT3A 3G6ES 2KG1A 2KXHA 1O0PA 2GHPA 3CF5Q 4C0OC 1U1QA 1PO6A 3DLLQ 2OIHA 2MQLA 1SJQA 2PEHA 3IRWP 5D77A 1K73T 1SJRA 1VQMS 1KD1T 5IQQA 2DIUA 2DNOA 2LCWA 2CPDA 3UD4P 2F9JA 1VQNS 2K3KA 5DDRC 1ZH5A 2XB2D 2JVRA 3OW2R 1R8PA 2JVOA 1VQ8S 1X4EA 1X4CA 2OSRA 3NNHA 2FC8A 2YH1A 2VOOA 5GAGU 1X0FA 3ULHA 1WHXA 3VALA 4Y0FA 1YWXA 1VQPS 3UE2A 2BZ2A 2RS8A 1M90T 3CC7S 2L9WA 4F02A 2CQPA 4QU7A 2SXLA 2DK2A 3G8SA 4Y00A 2E5JA 1U1KA 1IQTA 2DNNA 3S01A 1WI8A 2AYGA 2MKCA 1YJWS 1WEXA 2DHAA 5JVHQ 3CCRS 4ED5A 1S79A 3RW6A 1H6KX 1KOHA 3MUMP 1N88A 4OZ1A 2DNYA 3I56S 2CQ0A 2N82B 1YJ9S 1R8HA 3G9CA 1M5KC 2NZ4A 1YJNS 5GMKa 1WTBA 2M52A 4YUDA 3EX7B 1U6BA 1VC5A 3HHNB 1VBZA 1FXLA 1X5SA 4C7QA 2WBRA 1HD1A 2LECA 3Q2TC 2L41A 4W92B 3CCMS 2VOPA 3CC2S 2QFJA 2KRRA 2M8HA 1KOOA 2J0SD 2D9OA 1N54B 5CA5A 1OIAA 2J8AA 1WHYA 3THPA 2ZJPQ 1WHWA 1M5PC 2DGVA 3J7YU 1YITS 2MYFA 3CCUS 2KYXA 2RVJA 2DO4A 1X4BA 1VC6A 2DISA 5CXTA 4LMZA 4WF9Q 4OZ0A 2HZCA 1WG1A 4CH0S 3BO2A 3VAMA 3VAKA 1Q81T 3NS6A 2VONA 5DDOC 2XS2A 2ERRA 1H2VZ 1VQOS 3CULA 2E44A 3VAGA 2DNKA 2FHOB 5DDQC 1VQ5S 1VQKS 2MB0B 1X5PA 1A7GE 5JVGQ 2KT5A 1FNXH 2LYVA 2OSQA 1U1MA 1K8AT 3K0JA 2DO0A 3MD1A 5DM7Q 2KH9A 2VODA 3HI9A 2M70A 2G4BA 3MI7X 2X1AA 2K8GA 2DHXA 3PIPQ 2RRAA 3BEGB 3CD6S 1VQ9S 1OWXA 2DB1A 2MSTA 1JJ2R 2MKSA 3SXLA 1K9MT 3B4DA 4PKDB 5LJ3Y 3CMAS 3EGNA 2AYEA 1U1RA 3UD3P 3H2VE 3VAFA 3CCJS 1U1OA 1P1TA 4QU6A 1WHVA 4A8XA 2CQCA 2LXUA 1OO0B 4P6QA 2MGZB 1ZZNA 2MSSA 3TP2A 2MKIA 2LEBA 1X4FA 3TO8A 3G71S 1H2TZ 1OPIA 1VC0A 2MQNA 1URNA 2V94A 2LKZA 1X4AA 2MGZA 3RW7A 1Q86T 2DIVA 2XNRA 4LIRA 2MZ1A 3I55S 2N3LA 4RU2A 4TU9A 5ITHA 2MQQA 1NU4A 5GAEU 4TU7A 2M2BA 4U67Q 2DH9A 2DGOA 3VAJA 1WEZA 1HL6A 2X1BA 2MZRA 2CPZA 2DNHA 4YB1P 2OJ3A 3NNCA 4CIOA 2M0GB 2KI2A 2CQHA 1WF2A 2DNQA 1M5OC 3LQVA 5MLCV 1SJ3P 1M1KT 3CUNA 1P27B 2I2YA 1YI2S 2G1DA 2EVZA 1RKJA 1SJ4P 3CCVS 1Q7YT 2A3JA 2KFYA 1RK8A 4CQ1A 2FPHX 2MZSA 2ZJRQ 1HA1A 5IM0B 2KHCA 4UQTA 2KXNB 4WCEQ 1YTYA 2RQ4A 5LXYA 1WWHA 1QVGR 2RRBA 1AUDA 4WFAQ 2MJNA 2X1GA 2MZTA 4CH1A 2RQCA 3CCSS 2LXIA 2M88A 5HL7Q 1NJIT 1X5TA 1X4HA 3VAIA 2OTLS 2YKAA 2DH7A 3ZZYA 3MUTP 3L3CA 2DNRA 2MXYA 2KU7A 4WFBQ 2FY1A 2U1AA 5GAHU 1W2BR 2EK1A 2MQMA 2B0GA 3S6EA 3MOJB 2ZJQQ 4IO9Q 1S72S 3MD3A 2KRBA 5HO4A 3CC4S 2CPYA 3VAHA 1M5VC 1U2FA 3P6YC 1VQ4S 2N3OA 1U6FA 2L08A 3UCGA 2QEXS 2LQ5A 3BO3A 4IOAQ 2GO9A 3MDFA 3SMZA 2XS7A 3P49B 3P5TL 2DNPA 1WF1A 3UCUP 1PGZA 2MQOA 1N8RT 3SDEA 1WELA 1QVFR 1X5OA 2XNQA 2YH0A 3R27A 3B4MA 3FEXB 1B7FA 1VQLS 2HGNA 2J76E 2MKHA 3P3DA 3S8SA
chains in the Genus database with same CATH superfamily
1DQ9A 2NSCA 3H42A 3MPYA 1S77D 2W2OP 3UD5A 4I6WA 1RAOA 1WKLA 2BE2B 5KFXA 3PR5B 1FWPA 5LSOA 5CXTA 2V6AA 1IBMF 4M5NA 1NK8A 4GVBB 1IKXB 1S48A 4GMKA 1SC6A 3W8PA 4ANCA 3C3LA 5AXKA 2GIRA 5K8PA 4GVLA 4Y65A 2VC1A 3HJVA 3A8IA 5HK4A 2FVSA 2UU9J 1Q8LA 4CLZA 4P9SA 3QGGA 1TKXB 3QLHB 5ETKA 3MM8B 3J7ZT 3KXDA 5GADU 1A9NB 1SV5B 2BKPA 1M0SA 4IH5A 3HHLC 2FY8A 3QGHA 4WP3A 4L73A 5CZXA 3KOAA 3CXCR 1IKVB 4ITSA 2HK2A 5AJ3F 2QA4S 4A8MP 3R1HA 2HG4A 3OXGA 2B9WA 4RZRA 2B9XA 1QSSA 1HWLA 3CO9A 4DX6A 3OHBA 2GVDA 3H90A 1NHKL 4AE5A 7AT1B 1JLBB 1DHMA 3SV3A 4QR0A 2BQ3A 2YQ0A 3GR0A 2BABA 1F5CA 4NI2B 5FDLB 4EO6A 2I5JB 2Y1RI 2AGPA 4WXWA 1U02A 4DSIA 1FESA 1UFKA 2LMIA 2VG7A 4PQUB 2ZH5A 3US5A 2NS1B 5IS2A 5KTQA 5EWFA 1H7XA 1BY9A 2CPEA 5DG8A 1UA0A 2EI5A 2QX0A 1S1UA 1HYSB 1S6PA 4DQSA 3BPDA 4QIWD 4AQYJ 1UEKA 3G4SS 2OELA 2XMVA 2FYXA 1MN9A 2BJ1A 5J2NB 4ZLLA 4QPXA 2DR9A 3AHPA 3I96A 4DX5A 4A8FA 1PCAA 3IS9A 4ECQA 3MTJA 1WC5A 3BREA 5D6GA 3C15B 3KLIB 2KG0A 2MKJA 2KJWA 3QIDA 4LF1A 4K7QA 4WWSA 2V2VA 4TU8A 3WIVA 2HQCA 1BD6A 4NWBA 5BYRA 4AL7A 2B51A 5A8RA 3GU0A 1G7CB 3U1LA 3PRVA 3BH7B 4N41A 5M2RA 4ECWA 1RT3B 4EBDA 3AFGA 1WG4A 1CQNA 5J2MB 1U1PA 4TN2A 2I9SA 3HXMA 2E66A 2HHXA 4NI2A 4I0WA 1WF0A 3DCAA 3OR2B 1WC0A 1SIWB 4X4NA 1NLKL 3ET6B 4PR6A 5DDPC 4BS2A 2BW7A 2UUTA 2AYMA 2E5IA 3CMES 4F4YA 2FJBB 2ADCA 1S6OA 5I42A 5J2MA 2DHSA 1OJ4A 3QWUA 2HBRB 3GFZA 1EKSA 3O8WA 3KK1B 4FPRA 1VQ7S 1WD6A 2G9OA 1YSJA 4ED1A 1R0AA 4URGA 4ETZA 5B0BA 4X4UA 4TY9A 1RTIA 3W66A 2CPXA 4Y2IA 2ZVIA 1X60A 3LP2B 3QIPA 1RLCL 5I3QA 3GQCA 3TUPA 1RBAA 3NL0A 1CJTA 1BE4A 1E6VA 3BH6B 1RWOB 3THTA 1CJKB 4OLPA 3PX0A 2A10A 3DRPA 4Q44A 5KFGA 4I7FB 3JB9k 3A8EA 1ULRA 2FZCB 5F0UA 1EHWA 3I0RA 4JI6J 5ETMA 2H1YA 1RWKB 2BX6A 2GJ2A 3B82A 4M5DB 4NCAA 1GQEA 1IR0A 2W2NP 3PJXA 4WP9A 2B8PA 3K2YA 3MM5B 1JIHA 2RU3A 2VIHA 5KFFA 2R7RA 4B3SJ 3W65A 1RLDA 2R4FA 4ZVOB 3V81A 4EUVA 3A3PB 1F9FA 4QIEA 4Y2KA 3U7JA 4EEYA 1QTMA 3WZ0A 3N6MA 2ZFHA 1KTVA 2DGWA 3PEHA 1TV6B 3Q2SC 1RWWB 4RWWA 2LEAA 3SFGA 1Z2LA 1Q78A 1SJFA 3FK4A 4R0JA 2HAFA 3GIMA 2BRKA 1QM9A 3FEZA 3FMWA 5D0HA 4GKKF 4K4XA 3EGVA 2GO8A 5D3GB 4CH7A 2HGMA 3TNVA 3O6QA 5DZ6A 1VFJA 2V8HA 3VQTA 4Q8EA 2PEBA 3HPOA 4OQJA 3ZZZA 1IBKJ 4FF2A 1TL1A 3B6BA 5HLFA 1JB0C 2Z30B 4YEAA 1WSRA 1WC3A 3ZZOA 1GAOA 2LDIA 2CZ4A 4KV8B 5I3UB 4LFCJ 4OI1A 4F4AA 1EP4B 3H59A 2D7SA 2R7QA 4RW9B 3MEGB 4KHRA 5KOWA 1BMQB 4J9VA 2YKPA 1WOOA 1YLXA 5A6PA 3IS9B 2FUG9 3HVWA 2UVRA 4A4JA 4ETXA 1O8BA 3I0SB 4UOHA 1FKAF 3TA2A 5J2PB 1TMJA 1IM4A 2NR0A 3EJMA 1NAQA 4LJMA 2C28A 2VBWA 4P73A 1IBLF 2CQIA 1RCOB 4WU3A 1QDUB 1MG7A 4ZPWR 4H54A 4IOCQ 4NXMF 4RU9A 3GIKA 1GX6A 4CO1A 1R6VA 2X1FA 3A3NB 3CJTA 2GGPB 3T9NA 4X4PA 3H2UB 2FC9A 5F9NA 1X9WA 1Q95G 2HHPA 1BQNA 1T8EA 5T41A 2BJDA 4LF8F 3G86A 1AB8A 2N7YA 2FJWA 1FKPA 2E5HA 3FVYA 4F0KA 4OHXA 4WKRA 2RT3A 1WKJA 1T9WA 2Y1IA 1M1HA 4DJBA 5ETLA 5HVHA 2OPRA 4RNMA 3G6ES 3OXFA 3UR3C 2KG1A 2BR0A 4FKXA 4OI3A 3DRPB 3P5BP 3DFEA 4USHA 3T1YJ 3LP0B 2UUAJ 5EX3A 3RBZA 1TFYA 1R8AA 3QGIA 4DV1J 1B0TA 3L09A 5B09A 2WSFC 3IRWP 1BGXT 3ITHB 1RT2B 5IT9U 3MR3A 1UWBB 2HMIB 1UW9A 1GK8A 3FZ2A 3T6JA 3TR5A 1LQ9A 3TJAA 3J81Y 3AA9A 1N36F 3PY8A 2W2PP 4NLSA 2LCWA 1NKBA 4DQQA 3T1HF 4C8OA 4YFUA 4CLFA 1AUSL 1ZH5A 5F8MA 1RHJB 4X4OA 3PZPA 5B0CA 1SH0A 4OZ2A 2Z8QA 4HHJA 5HATA 1TAUA 1FEHA 1LK7A 1RT1A 1SV5A 2GFFA 1KNZA 3CJ2A 1OYEA 2CIMA 3VQSA 2KJVA 1R43A 4P52A 5KT3A 5GAGU 2QLXA 4EBEA 3RB0A 1WHXA 2AEMA 3VALA 1K0TA 2R7WA 4YHHJ 4XTTA 2B4OA 2HNDB 4ECZA 2YPYA 2G0IA 2RS8A 4GVBA 3J7Z5 3RB4A 1N56A 1MSWD 4ED7A 1VMBA 2DXDA 3C66A 4NLUA 3R3TA 2VFRA 5L9XA 2XI2A 1YRUA 2AYGA 4NYZA 4XDDA 4RBVA 1UZDA 4CNZA 2JNJA 3DOLA 3BQ2A 3KG0A 2LEPA 1S10A 1QUPA 5KFVA 2HQFA 4OYAA 3TX8A 2NREA 1H6KX 1Q8IA 3D6HB 3EE3A 1KQKA 3SI8A 5KG6A 2E9TA 1LK5A 2XULA 1EQMA 1HFEL 1N48A 1JJCB 4USWA 4ENOA 4DR5J 3I56S 1TK5A 2OEMA 3M2RB 3M32B 1WOPA 2UUWA 4U6PA 3SZ2A 1JLEB 1N34J 4LVNP 5KG2A 3FQLA 3UR0A 4JI4F 2JLEA 2Z2YB 1S99A 3IAM9 1M5KC 1FTRA 2FZGB 2KYZA 3EXCX 4YR2A 2NZ4A 4PG6A 4DPTA 5DQIA 4JI0F 1WTBA 2H5EA 3ETOA 2M52A 3HX9A 4OHYA 3RRGA 3C6TA 2J9EA 4I56A 4ZVTB 3PRBA 3GP9A 1O51A 2RDDA 1FXLA 1SC4B 1HNWJ 1X5SA 4G1PA 1LV5A 2WBRA 3LALA 4ANDA 5L8RC 3SSRA 1NJZA 2IM2A 4FYWB 2HNYB 2B9YA 3HSDA 3DC2A 4ELUA 4FXDA 3CJ5A 2BE2A 2H4YB 1PKUA 4NCGB 3CC2S 2RKIA 2QFJA 2W4CA 2D9OA 2J0SD 2ZBCA 4NLWA 4U95A 5CA5A 1WHWA 1M5PC 1LOUA 2OD4A 1HNIA 4IFVB 3OV7A 3K5MA 1N5YA 1YITS 5ETVA 2MYFA 3CCUS 4OZ3A 2IA0A 2LU2A 4RUHA 2X51A 4PXDA 4DU7A 1U48A 4ECTA 1YBTA 1X4BA 1F60B 2F8EX 3Q89A 4JP8A 3WDOA 1RTJB 5C5JA 4E0DA 1XJWB 3A13A 2R3VA 3LOUA 3MAAB 3MM6B 4DPXA 3M6VA 4CH0S 1WG1A 4KO0B 5IWAJ 3VAMA 1XMQJ 4WF9Q 3HULA 2VONA 2K7KA 3D28A 3GILA 1RT6A 2GS8A 2ERRA 4PUOA 4I4BA 5KAKA 1H2VZ 2GQCA 2XTJP 3MAHA 2VZ9A 2Z58B 1R27B 3V6KA 3VZIA 3C6UA 5GAEI 2ZWPA 2GQQA 1KQFB 1C1BA 4RUBA 3KJVA 3ZTOA 3CULA 4ZA1A 1J5OA 1CJTB 1VQKS 4J9LA 1IKYB 1X5PA 3AOAA 3HFVA 3NGKA 3PEJA 5CD4H 3Q8PB 2FVPA 2R7XA 3HHEA 1HWJA 3ILLA 2KT5A 1FNXH 1LWEA 2HK3A 2V67A 4L76A 2GIQA 3RTVA 1U6ZA 3CJ8A 1U1MA 2EKYA 3CJRA 1YDLA 5DM7Q 2PIIA 4KH0B 3G6VA 2PFFB 2GMHA 5D3GA 3MI7X 3GTYX 2X1AA 4KFBB 3EXYA 2Q1LA 2ROPA 3GJSB 4MIBA 5B08A 2QJ3A 4DQPA 5D4OA 4CO3A 3CD6S 1MMLA 3H5UA 3R7NB 3Q8VA 3KHHA 1HHTP 4F3MA 1QY7A 1K9MT 2W4DA 4OYMA 5LJ3Y 1Y10A 4CWBA 1IR2A 1ZAXA 1T94A 2Y3YA 2ZEJA 4H4MA 5JXSA 1RBOB 4DL6A 2IFXA 4USKA 2C22A 2C2DA 1IKWB 2R7OA 4DR4F 4JOUA 4C8YA 2UUCJ 1RAGB 3W60A 3UD3P 3HMJG 4V19J 4FYDA 1BQXA 4DPUA 3CO0P 4LFCF 4LRBA 2VICA 2FLPA 1BWEA 3KLFA 1OS5A 2VDHA 3MM6A 1OO0B 3Q8UA 2UZAA 5K8NA 2DBBA 7FD1A 2RUSA 2LEBA 4KHMA 4MKVA 1R8CA 4H4OA 4RPFA 3W7BA 9ATCB 1RYSA 1H2TZ 2CUYA 3GYGA 2ZOGA 1HPZB 3EPIA 1TR0A 1UJ4A 2GAHC 1SL0A 2XY7A 3NLCA 1URNA 2AJ4A 3OUYA 1DURA 4DR6J 1UJ6A 2DIVA 1R7IA 3I4HX 1E6YB 4M5KA 4B3TJ 1UVKA 4QWBA 5ITHA 2MQQA 4XAKA 2HNYA 3BJYA 1KBRA 1L5UA 1NEEA 2H54B 3DGPA 2J7UA 5GAEU 4QR1A 1TKTB 1XQIA 3BF4A 3NS7B 2DH9A 2Y1LB 4C0BA 4DLGA 2HHWA 4NCBA 3AOBA 3AQOA 1QLNA 3M8QA 3CCZA 2MZRA 1QSYA 5H9EK 2YNGB 4ATNA 2XMUA 2ZH2A 2FD2A 2V9KA 4ECXA 3FBFA 3DLKB 3K5PA 2OJ3A 1RI7A 2OFGX 3AT1B 3DHWC 3I5CA 2M0GB 3NCRA 3SSSA 3TVZA 4ZN3A 2F4FA 3LQVA 4B3SF 1UEVA 1RYRA 3W62A 4DPYA 1HHQA 2QMUB 3HHLD 3WHIA 5D4PA 4MKBA 2HAIA 1FEEA 4NCGA 2EVZA 4ZPAA 5KFDA 2JJ4D 4CYUA 4DBQA 4JUZA 1S6UA 2A3JA 4IFYA 2KFYA 2QN6B 3JSBA 2FPHX 1DTQA 3BPSP 3VWSA 4K4VA 3I5BA 1F5AA 1IJFB 2A1BA 2ZM6F 3OPKA 2KHCA 3DOKB 2C42A 4CYUB 1W2IA 1TL7A 1YTYA 1TTHB 3UNYA 3DLGB 3TEGA 4DV5J 1NUEA 5AXNA 3ETMA 3A8JA 2W7AA 1E6VB 4OX9F 3FMBA 1UJ5A 2VV5A 4KGKA 3ZZ0A 4WFAQ 1NJYA 3OFGA 2RF2A 2CJQA 2GHVC 1D0EA 3H20A 4MK7A 4CZCA 2E7XA 3F56A 3SFUA 3CCSS 2R42A 3MCMA 1IKVA 4PXBA 2AW0A 2M88A 5HL7Q 3SCLE 1EARA 3RRHA 2FGOA 2RU9A 1X4HA 4N5SA 4QJVA 1P9YA 2WVCA 2YKAA 4MIAA 3LW5C 1T03A 3ZZYA 1JLBA 3LPEA 3L3CA 1O6XA 2DNRA 3T3FA 4UOFA 4ED2A 2KFZA 4P75A 1GXLA 1IWGA 3GZ7A 3T41A 4F0MA 4DR7J 3D9BA 1Q0NA 4R5PB 2OEJA 4JI7F 1W2BR 3R2DJ 4ZIWA 4DV7F 3H5YA 1HARA 4ZDNA 2C2EA 1TUVA 2E29A 4USIA 2N4DA 2DPJA 3E01A 2HFNA 2JOQA 2V50A 5K8OA 2WW4A 1S9EB 2NUUG 3MEEA 2KRBA 1CJVB 4OMFG 4RNHA 5HO4A 3VHQA 3M1VB 3CDUA 2IMWP 2ZH8A 4E98A 3VAHA 5EN1A 3W3SA 2N3OA 1NDPA 5FIIA 2XZDB 3UCGA 1CJUA 5EHHA 3UN5A 1N34F 4IOAQ 2UUBF 3MDFA 1FVQA 3DGVA 4LRFA 1KFDA 5HANA 4DV1F 5CCMA 1GFWB 2ATCB 1XMOF 3UCUP 4KGZB 2AEJA 4DSFA 2MQOA 3PYEA 3QO9B 2R2UA 1T9UA 1S1XA 1Q5VA 4DUTA 3C19A 3W61A 4IQXA 2AV5A 2AWZA 3JTNA 3LA0A 3B4MA 1FJGJ 2EEYA 1FK9A 1XR6A 3DNCA 1R3NA 1FERA 2K2PA 3RBXA 1JLGA 2PA3A 3T1HJ 2YNGA 3MPWA 3AD8C 5KFUA 4OJHA 2HS0A 3PR4A 1HNXJ 2MKHA 4ANEA 2XO7A 2YKOA 4E2FB 3KK3A 4PXCA 3P3DA 1WACA 1RAAB 2ZE2B 1H2UX 2B7CB 2B43A 4B9NA 1YJVA 2MZQA 4NL5A 4RWXA 4Z2XA 3DM2B 2P6TA 3TYTA 2G2OA 2MKKA 2LQ9A 2Q79A 1TL7B 1FD8A 3IN5A 4Z7YA 2DITA 1V9OA 2MY7A 4QYRA 2LVWA 3VGSA 2CPIA 2CQBA 1S12A 2RH3A 3KWMA 4DL7A 3BS9A 1WJ9A 1HR0J 1WEYA 3G6YA 2YNHA 4FXWA 1RKIA 3GFYA 1H98A 5KG5A 4DQIA 1FDBA 2E5LF 1FT8A 1S9FA 2LQBA 2F3JA 1KLMA 3K7RA 3BGOP 4O4GB 1U45A 4O3RA 3IG1B 1YRXA 5BR8J 4DFKA 1BHNA 1NMEB 2XI3A 1D3WA 5T14A 2HFVA 3GV7B 3BSAA 3TQ1A 3MFIA 3HLUA 4NXNF 3ILJA 3H4BA 2D3OR 2EC0A 2E1CA 4S0MA 2OPPB 3GR1A 3D2WA 5J2QA 5AXMA 2DNZA 4FYVB 3KFWX 3RRKA 3PYGA 1SXLA 4RW4B 5LM7E 3TARA 1KSPA 4YMEA 2DR5A 4LQ3A 3BKFA 3FDSA 2E1RA 3HT0A 4ZCKA 2VA2A 4CTAB 5D78A 2PSZA 5F8LA 4Y2MA 2Y0BB 4ID5A 1YX2A 1T02A 3CW2C 1F3VA 3OR1A 4ICLA 4KIAA 4DSEA 3MHYA 1TL1B 5HLFB 3IWXA 3IWNC 1MWQA 3NGDA 4A8YA 2R7SA 4C4WA 3D6FB 4CM2A 2XG8A 4QQBA 3UWTA 4DG1B 5F3ZA 4KRWA 2MZJA 2VDIA 4HI2A 2V5HG 2XMTA 2VKRA 3BZQA 1SH3A 2CJ9A 3KJNB 2DXEA 1L3KA 1UP1A 3MZIA 1Q82T 1BC6A 2UUCF 5HROA 2DT9A 1RT7A 2EPIA 2HNZB 2KVIA 4PCQA 1D1UA 5AT1B 1IXKA 2CQ3A 5D0GA 1ZZFA 3SBMA 3M9MB 3PV8A 5CH7B 4TLQA 3R6GB 4Z7CA 3G8TA 2AD9A 1HBUB 1NB7A 1RTDA 4DWIA 1F0XA 5J2QB 3CDWA 2XSJB 3FRYA 2LA4A 2IDEA 1PAEX 1S1TB 1WC4A 2AT1B 3MM5A 4RJVA 5C7PA 5KFBA 4OZNA 2P9GA 2ALYB 3W2VA 3U1MA 2DGQA 4QWEA 3HHKA 2UXDJ 5LXRA 1TUGB 2YQ1A 5SUHA 4B3MJ 3JSMB 2ROGA 4QWAA 1ZS6A 2VFSA 4YDDB 2BEFA 5FD1A 4RW7B 4O4GA 3ZC4A 4RW9A 3ZXWA 2E1MC 4L3KA 4P2FA 3L95X 4HDHA 1XMQF 4B3TF 3CDEA 3V4MA 3M9NB 2CNOB 1F9EB 1WSVA 3X1LB 1I94F 3R9LA 3W9HA 3H25A 3QJLA 2QL9B 1KEKA 1GH8A 1FD2A 2HWHA 4UQGA 1OPZA 3VTIA 3NMRA 2QA2A 3GMGA 5KG7A 4BWMA 1F9HA 2C2ZB 3R5BA 2MHNA 2JC1A 4WZMA 4K4TA 2M3DA 5IV3A 5I3PA 2RNEA 3IM9A 3D67A 5E41A 4JYAJ 2UV8G 2C3PA 3DM2A 4ZPTR 2BJEA 3S7RA 5KG4A 4A46A 2B9EA 3KK1A 4O3SA 4DHVA 1XEZA 3RAMA 1N0UA 1UFWA 2ASLA 1JKHA 1NH8A 1FF2A 1SI9A 2HQ3A 3ZZRA 4EYHB 2ADBA 4DDFA 2RE1A 3IBCB 3IR5B 3LUYA 5L9NA 2YWKA 1ZM9A 1WI6A 2F8MA 1FNMA 2BV3A 3GSDA 1YJUA 5EGYA 3VF0B 4YP3A 3KHGA 4DV6J 2M8DB 3DXBA 4OHZA 2QC3A 5L46A 4K4WA 1I6JA 1LWCA 3JQJA 3OTDA 3OFFA 1GMUA 1N5SA 3JQMA 1UFLA 2GCFA 2IVFB 3UW1A 3EPGA 3KJQB 1CVJA 1RAHB 4C11A 4WJBA 4Y28C 5B7WA 4GC6A 3KMQA 1KQSR 3MURP 2ZM6J 2VFVA 3KG1A 1XN9A 4PG4A 5CYJA 1S97A 4FP9A 2BKOA 4OZJA 1NK6A 1LWCB 2BJ8A 4N77A 2NLWA 1RTDB 1U1LA 1LWXA 3DU6A 4EO8A 4DV5F 1NK7A 4FXVA 4N76A 1HQEA 3DXSX 4JV0A 2HBZB 3H7HB 4F26A 2XY5A 2HRYA 3MAQA 4DL2A 1RZMA 1YZ7A 3MM8A 1Q5YA 2BXJA 1MU2A 2YKNB 5A8KA 1VBXA 1DBDA 2KXFA 3RJMB 4FVMA 5KFCA 2QV6A 1P6TA 2IJFA 4DFJA 4U9RA 3TAQA 2CQDA 3FEYB 4RW7A 2HVZA 3Q23A 2AGOA 1KC8T 2IMOA 1FCAA 1ROFA 2BANA 2IYGA 3PRDA 4LSNA 1RE1B 3BO4A 4IO1A 1PJ6A 3OFEA 1DFDA 3CPWR 3WX4A 1FJCA 2JX2A 2UVWA 5AE3A 1S4EA 1XMBA 1VRUA 3MEDA 2BJ3A 4NLDA 1S0NA 2UVVA 4DR6F 3PHTA 2HFSA 2GX8A 1X8DA 2QL5B 2ZKUA 3KLGB 2XSFA 2C2NA 1RHMB 1FJEB 5BYSA 3HP6A 4I64A 4M5HA 3DOMB 3FGVA 3N9UC 3CDAA 2CQ4A 3HD2A 3M2RA 2KO1A 4QR2A 5HN0A 3H5XA 1N5VA 5G0RA 2DNLA 2DH8A 2M7SA 2BKNA 4WIIA 4OJ3A 4F2SA 2EK6A 2EFGA 1B0PA 5E3PA 4RLEA 2AKWB 1RQ0A 1JNZB 4GO5X 4LUBA 4U8VA 4HLBA 4QW8A 2VQEJ 1UPPA 1T9XA 3R1LA 2K06A 3OTBA 1RA7A 3T19A 3ENWA 2GHPA 2H4WB 1WC1A 5HSPA 4C0OC 4X64F 4QW9A 1U1QA 1PO6A 2LDYA 2FGCA 3GFHA 3TAMA 1CC8A 3A4TA 5KFJA 3DI6A 3IXQA 4FVCA 2HNZA 5GAHI 4NLGA 5E3QA 3K8WA 3TVYA 4C6AA 2AJ0A 2J9CA 3ILOA 1IN0A 3W2WA 4M5MA 1RWPB 5SZTA 3KK3B 2YXLA 4CI0B 2IVMA 4Q5VA 1CC7A 1A0OB 2C2RA 4NMLA 4CLLA 1ZM3A 2W2QP 1VQOS 5DLGA 4JI3F 1KLNA 2WTFA 4HYKA 1VDHA 1R89A 3CJSA 1I1GA 1JQGA 5G0RB 5KFWA 4WIQA 2K1RA 1RTJA 5ADZA 2YX7A 1R8PA 3R6LB 5KT6A 2VF3A 4OHVA 1OYDA 2O66A 3BGRA 3NGUA 3LP2A 1RTZA 3PVXA 3H0PA 1X4CA 2WW8A 4CLTA 1Y5NB 2OSRA 2QYGA 4BBYA 2FHJA 3R5CA 4Z37A 1FE4A 5BXIA 2WRMA 3CIMA 2BE7D 4DPOA 3ULHA 4ILRA 4DS4A 3IRXB 1RHKB 3MMCB 1RAJA 2CAJA 1VRQC 4IKAA 1VQPS 1UEUA 3UE2A 2HHSA 4NYPA 3C16A 1VK3A 2DK2A 2QLFB 1V3SA 1PG5B 3QBCA 4Y00A 3OJUA 1GMWA 2J5AA 2VPXB 2XHCA 3JTOA 4PPDA 2Z0GA 5A2QY 1IQTA 4O44B 1LXNA 1JKHB 2XYPB 4X2BA 1MN7A 2ZH7A 2R7VA 1J2VA 4Q45A 2MKCA 2RHSB 4YR0A 1SJ1A 1WEXA 1DQAA 2DHAA 1JLCA 4LF7F 2OI2A 3CCRS 4ED5A 3Q8SB 3THVA 3DRSB 4HACB 1C4AA 3GJRB 2ILZA 2WB4A 4WE1B 1S1VB 4UZCA 3C15A 2NUHA 3KLIA 3MUMP 2HEKA 2LU1A 1N88A 1IUJA 3BGFA 2YPZA 5LMNF 3JTPA 2CWKA 4F4KA 2N82B 1NK9A 4I67A 4WFYA 4LSLB 2UUBJ 1S1UB 4DR1J 2FHKA 2V8GA 1GTEA 1ZAVA 1T9TA 4OYPA 3BM7A 1SQGA 5K9FA 2VJUA 4OI4A 4RNOA 3V5RA 1ZTWA 3OR2A 2BUNA 3ISND 4H4KA 3IP0A 4ZPCA 1VC5A 2NCKL 3GJTB 3HHNB 2IHR1 2XMMA 4I69A 5ETSA 3CCWA 1VBZA 3AJ1A 4MFBA 4Q7AA 3FRZA 4USJC 3WQPA 1VI7A 1ZA2B 5KFZA 5IQ6A 2BQRA 2UXCJ 1U4BA 3IWLA 4TY8A 5A8RB 1FFSB 4ZPDA 3RR8A 1UVNA 3OLBA 3SEOA 2LQ8A 2NPIA 3ILIA 2QSFA 3R8YA 1JLCB 4BLGA 5LSRA 4GO7X 1VRTA 3W2WB 3SYZA 3J7AN 2VOPA 1HNXF 2M8HA 3DLJA 4CLWA 2YX1A 2QO3A 2J8AA 1OIAA 2DY1A 1PC5A 2UV8A 1CJKA 1QTNB 1SKUB 1C1CB 3M2VB 3NWRA 4M5LA 2GNKA 1UCNA 1N5TA 4DX8H 3J7YU 3EDQB 4LFBJ 1XTZA 4LR8A 3R97A 4N8OA 2XLIA 2HHTA 4O23A 1OSCA 3F41A 4KH1B 4DI6A 5KFQA 2DISA 2I5JA 3M2UA 1V5IB 5E2QA 3AB4B 3AAWB 5ETRA 3Q22A 3V6DB 1BXNA 3I9V9 1U49A 4OZ0A 4B9UA 3BO2A 2Y8WA 2GA7A 5E0OA 4B02A 3NRBA 1LXJA 3M8QB 2YWFA 1Q81T 4KHPF 2H65B 3ZZUA 4TYBA 4OX8A 3EZOA 4PQAA 4AXJA 3QRRA 4LF6J 1U0SA 2IM0A 1XERA 4C9DA 1FRLA 1T9VA 1QE1B 2G0JA 3IAS9 2HQDA 1H72C 3O5TB 4NZ0A 4OZ5A 1FDNA 3WBZA 2E44A 3VAGA 2JH3A 1S1VA 5BR8F 2FHOB 2HFZA 3V81B 1A7GE 4FDFA 4O4RA 1QAIA 3BBCA 3NEKA 1WDDA 2GQ2A 4ZVQB 4Q0BB 5C42A 2J7KA 1G6BA 3LF0A 2J8SA 1P8GA 3HKWA 3AJDA 3D7SB 3W9IA 2YWWA 4B9LA 2OSQA 1K8AT 3OBIA 3TUJC 5E3RA 2Z2ZA 4YDXA 3X3UA 1L3SA 4NLOA 1VYAA 4DU8A 3PHEA 3HM9A 4ELTA 2EBGA 1N6QB 3IM8A 4N56A 5IT0A 2E1PA 2EW9A 3S1TA 3D3BJ 2IVYA 5HJYA 4DV6F 1OY9A 3BEGB 5ETNA 2VB6A 3QAUA 3U1NA 1REVA 3ENQA 3SQGB 1OWXA 3R7BB 3ZTPA 2QA4G 5A2QU 5A0YA 2W9CA 1VQ9S 1IQZA 2DR6A 2YNFA 4PWDB 3EICA 5DS7A 2H48B 3SXLA 2D1CA 3B4DA 2AU0A 2W4PA 3E8OA 5HBMB 3WIUA 4C8KA 1GNKA 3MM7B 1GMVA 4KR0B 1HLWA 1IJEB 3BKTA 5D0RA 4ZJOA 1YVFA 4AYBD 4NA2A 4DN0A 6FD1A 2UVUA 1HHSA 4X4VA 1X9SA 2W9CB 4F4XA 4B9VA 4JI5F 4J9QA 1NPRA 2P8IA 5CZVA 4ZCIA 2A2CA 4MK9A 4EYIB 3H98A 1PAUB 2R8GA 1S6QA 5CYMA 1N0VC 3DDNA 5IWAF 1RB0A 1WNEA 1AW0A 4X62J 4P6QA 5FLXY 3MCNA 4IG0A 2MGZB 1R31A 3SV4A 3RR7A 1V6HA 4HTJA 2KL8A 2QA1A 2GVZB 4PYAA 2MKIA 2IA6A 2H5JB 2MKYA 3RU0A 3MWBA 4QIFA 1VC0A 5E33A 4ZN1A 5D8HB 2LKZA 5K8MA 1X4AA 4C98A 4ZHRB 3J81U 4IG0B 1Q86T 1L3TA 4LIRA 1Y7PA 3QT6A 2BA9A 1C0UA 4RU2A 4KE5A 1TELA 1FRMA 3JAMY 4DR2J 2XO6A 1C0TB 5KFYA 4HH1A 3TZWA 3K5LA 4B17A 4M95A 1JLEA 4TU7A 4B9TA 2M2BA 2APOA 1ZAWA 3NGTA 1RADB 2DGOA 4I6AA 3OUYB 4BC9A 2VQFF 3LGMA 2Z2LA 4IDKA 1EB0A 4WK1A 1RGVA 3DLGA 3DYAA 1O5JA 1EETB 4JYAF 1HBMB 2B5JA 3NXZA 1EIYB 4YB1P 2D69A 3NNCA 1R0CB 3NKYA 4CIOA 1XR5A 3A12A 4WKYA 3FZBA 3K17A 1JLAA 1TKZA 1JLFB 3L4BC 3QMQA 4LSZB 4DCJB 3I32A 3BKUA 3IR7B 4OI0A 1SJ3P 3CJKB 4YR3A 1MW7A 3W5XA 4QBUA 3HVTB 4ECUA 2Z57B 2G1DA 2FDNA 4CO5A 1RKJA 3PW5A 1FRXA 5L39A 5HMYA 4DSJA 3GWCA 2WONB 3NGRA 2ZDOA 2CJYB 2NPFA 4ZITA 1Q7YT 4DR4J 2B6AA 4D3HA 3LP1B 5HI7A 3MTKA 4CQ1A 2EWHA 4Y34A 3OVSA 2ZJRQ 5AE2A 2QSWA 1HA1A 5IM0B 2HBQB 3CMQA 2DRDA 4JI2J 1MLAA 4WCEQ 5F41A 2RQ4A 5KFEA 1WWHA 1QVGR 2RRBA 2YQ3A 4M1KA 3R2CJ 1X31C 2I1RA 4DUZF 2RDIA 5KFNA 2ZWOA 1D09B 3KJFB 4JI2F 4DV0F 1AUDA 2VPWB 4G3IA 3NP5A 4DL3A 3HJFA 4QZVB 4DL0C 2AHOB 2EFPA 2R8KA 1B64A 3BGLA 1KFSA 3NGSA 1NCLA 3G82B 4IFYB 2DKOB 4OI2A 1NJIT 4DG1A 4MKYA 2A6MA 1SH2A 2ZUAA 4RW8A 4EK2A 3OQ2A 2OTLS 1VISA 5IZHA 1XNRF 1F2GA 3MECB 1WC6A 4ZCMA 3MUTP 5IT9Y 1RHQB 1VR6A 4BWJA 2MXYA 2W7OA 4WFBQ 2V68A 2HIYA 2U1AA 4ZCLA 3T1AA 3THPA 4L3NA 4ZLJA 3POTA 2FY1A 5GAHU 2UU9F 3M4XA 3MR2A 4OX6A 1TU0B 1VJWA 2RD5C 3K89A 3B54A 3OFHA 1S0OA 2PMHA 2JZ5A 3MPVA 1HWIA 4N8NA 3S6EA 3UO0A 4DX7A 3H4DA 4NLYA 1AT1B 1JLFA 2EFNA 3VVTA 2IM1A 2NYHA 3DU5A 1S7IA 2QZ8A 3QQCD 2VQEF 3CC4S 2CPYA 2HVEA 2VG6A 1M5VC 3RB3A 4PWDA 2D3O1 1VQ4S 1TL3A 3M8PB 1RWVB 1U6FA 4QIGA 1EJ7L 1AZSA 1U25A 2LQ5A 3BO3A 4ZMMA 5DZ7A 4ID8A 5DO2A 5KOXA 2CA9A 2F7VA 3P49B 3TOQA 3B8HA 1H38A 4EMDA 1VBKA 2N4CA 4OIXA 2XGPA 1S0MA 2Y9HA 1HNVA 4R8UA 1PGZA 2IPOB 4WP8A 3SIPB 4ECYA 3GYXB 4WFZA 3MPDA 3HDSA 4YY3F 2WZ1A 4O0IA 3SDEA 2HHHJ 3M8RA 4KJIA 1N33F 2NYIA 2HLUA 1X5OA 2HLTA 5F3TA 1Q16B 1HKAA 3R27A 2C2KB 4AQYF 3BGUA 3TVKA 1HQUA 3BDPA 1UA1A 2XZTB 2MEWA 2Q3PA 2KHDA 3GYNA 4J90A 3M9OB 5HBMA 4IG3A 4QCLA 5ETOA 4C8NA 5HQMA 1VHIA 3AB2B 2J76E 3ICLA 4JV5J 2XQCA 3PACA 1NNDA 2QLWA 1SVDA 3QFHA 1FXRA 4I1TA 4DV4J 2ZVSA 4NLQA 4PYDA 4ED6A 1N5QA 1T95A 3T9ZA 5CYMB 3ZFVA 4LREA 4FYXB 3TZZA 1PBAA 5GVQA 2CNLB 2GV1A 1S59A 3GLJA 4FPIA 3GSIA 3KNGA 4O3OA 4BCAA 1U0HB 3QPIA 4FS2A 2HVHA 4JBCA 3LAMA 2J9DA 2IC3B 2LA6A 1M5SA 1LFWA 1UAWA 4ICLB 4ZP7A 3TEHB 2HYIB 3N5BA 3RUBL 1YIJS 2WBMA 2CG8A 2J0QD 1IWAA 1T3NA 1KONA 2QG9B 3AODA 1UW4A 3G87A 4W90B 2G2ZA 3CCQS 5B0DA 3K58A 3EUNA 4NRUA 2D74B 2DNMA 1NZ8A 3FCHA 3ISZA 2RB7A 3C46A 1BLUA 3CT9A 3T5JA 3MECA 4KYZA 3N6LA 2AJQA 1UWAA 5LMUF 5K20B 1Y3JA 4CLPA 2RS2A 3RB6A 3UQSA 4PRFA 2OTJS 1XMOJ 2BW2A 4FZVA 4MYTA 2KM8C 1VIXA 1F2HA 2JHEA 2EFQA 1Y11A 3E3XA 2G2YA 2XMWA 1S1WA 3D1OA 3N01A 4LF4F 2IY5B 3KLHA 4ES1A 1HI1A 2CRLA 3PM9A 1HNZF 1FWKA 4O3QA 4LF5F 1VQ6S 4DR1F 1GEHA 2PMZD 5L1JA 4ZK7M 3IA0A 2BQUA 2E5LJ 1BQMB 1JK9B 1JX4A 1TUWA 4LBIA 3D68A 4DCPB 4YOEA 4HHHA 1C2PA 2PE8A 3POTB 1T05B 3BN4A 3FBEA 3D0HE 3PW2A 4K4SA 3VGVA 1Z1ZA 3QNWB 2CQ1A 2AIRB 1LWEB 1ICEB 1BQMA 1S49A 2CQGA 3M6XA 3H2LA 1JXLA 2RJZA 3BBBA 5F8GA 1IBMJ 3OTOJ 3TJ8A 2EG1A 1FFGB 4RNNA 2IRXA 4ZP8A 4HH0A 5HMXA 1NO8A 2X3GA 4XK8C 3W5ZA 4V19X 4ILMA 3BB5A 3I87A 2AYBA 4K4UA 1LW0A 2PC6A 3LAKA 4CNYA 4KSEB 3MR7A 2N7CA 4NOHA 3KMSA 1KN6A 1S1XB 3JS9A 3LTOA 3PFOA 2PMWA 1U8WA 1K1SA 2CPJA 3CB4A 3UDVA 3ZNUA 1EZZB 1OY6A 1QE1A 3G8QA 4OYIA 3V2UC 1HBOB 5IT4A 4OYWA 4K5RA 4KKOB 2W8KA 1L3VA 1RHUB 5HROB 4ZLPA 4LF6F 5J1EB 3CWJA 3LPYA 3CE8A 2P9EA 3I9ZA 3UCZP 1V3ZA 2C3OA 3RG6A 1NK0A 5GADI 4FF3A 1HYSA 2CJBA 2VH7A 2W2MP 1PYTA 4M8LA 4WK3A 1W7WA 1YJTA 3HSGA 4MT1A 1WORA 2ZD1A 4Q8FA 3M30B 1CLFA 1Y4ZB 5H1SV 4WFNQ 3OL7A 4H4OB 1JLQB 4Q43A 4PG8A 1TKDA 2ZOFA 4YB6A 2ACMA 1OQ3A 1AROP 1S5ZA 4MYUA 1SQFA 4RBTA 2ILYA 3W64A 2HURA 1HQUB 2OKQA 1DQ8A 1KVKA 1HBMA 1NXIA 4KV8A 2G1HA 1Y5IB 3MMBB 5I3UA 5KFOA 2CPHA 4WTYA 1Q4RA 4N47A 3G96A 3K59A 2FLOA 3C6UB 5DG9A 4F4WA 2NZCA 4TQSA 2NSBA 3MOZA 1FE0A 5DGBA 3JXOA 5BJRA 5KFAA 2BRLA 2KT2A 5C24A 2EC2A 3CCTA 4MTPA 3SDEB 2BOPA 4BDPA 2DCUB 1JJHA 4O0NA 3MAAA 4IUFA 1P1LA 1TP7A 2J6TA 1XIQA 2ZC4A 3FBCA 2E5GA 2VA3A 4HHUA 4F0HA 3CC7S 3ZZTA 3OT9A 5CD4A 4MMOA 3Q86A 3AQPA 4HEA9 4ZJLA 2YNHB 1X4DA 5IFMA 3BR8A 4X66F 4KPCA 4Y2AA 3MPUB 2DGUA 4DV0J 4B3MF 2KN4A 4USMA 4JI1F 3GIIA 1G2EA 2HZVA 4X62F 3GG1A 4RKUC 5CQGA 1C1BB 2O3DA 5D4LA 3AD9C 2I6WA 4CT8A 4F3QA 3KJVB 3NCQA 3QZ7A 2U2FA 5H9FK 3QWPA 2YTCA 1PJ5A 2DGSA 4FS1A 3R7SB 5LSLA 1I94J 4ZIVA 4ERDA 2D9PA 2WSCC 2FJDB 2G0CA 3ISNC 4J9PA 5HQLA 1JMTA 5H9EJ 1DJ0A 4HVZA 1VOMA 2QLJB 4P7VA 4EZ6A 1VBYA 3L7OA 2XYHB 1CULA 1CSJA 1HW9A 4DUYF 4QYZJ 3GV8B 1WG5A 1RAFB 2RUGA 5DGAA 4JV2A 4ECSA 2IDLA 2WK4A 3RYLA 4CLKA 3ONQA 2BACA 3PW0A 4FNHA 5BYQA 4PZVA 1S0VA 4F25A 4URQU 3LO3A 2VQFJ 1RUSA 4OL8A 2F9DA 1MWYA 4CLYA 1SUQA 3I82A 1HIYA 4HT7A 5DETA 1DZ5A 2HHQA 1G3OA 3BSNA 1ACMB 3QO9A 1T05A 2IRYA 4R0EA 1HPZA 2AP6A 2KXHA 1FX4A 1EAYC 1KR4A 3D0GE 3EMTA 4NEYA 4F67A 5A8WB 3RAXA 2EFVA 2J6SA 1UZHA 1NB2A 3HHLA 5KT4A 2IAJB 3DLLQ 2MQLA 1SJQA 3EZUA 2HHVA 1OSDA 4EFAC 3D1HA 5L1IA 2VPZB 3A8KA 3OHAA 3KLFB 2ZH6A 4DR3F 4DR5F 2ATLA 4HT5A 2PI4A 1VQMS 4F4ZA 3DMJB 3DRYA 1MNEA 3OL8A 4IH7A 2DIUA 2G13A 3CEDA 3OTEA 5U47A 2DVIA 3O44A 4I6YA 1XNQJ 4Y6IA 1FKPB 4C97A 3P96A 3UD4P 2UXBJ 3FSXA 1GX5A 4JV5F 3IFEA 3V6DA 3C14B 1YJ7A 2J6UA 3VCDA 4ZVUB 4NASA 1V3RA 3G2XA 2JVOA 4A8KA 4IG3B 5HP1B 2KTQA 1VQ8S 5KT5A 3KG4A 4FF1A 3TAPA 3KLEA 1OMSA 1SL2A 2FC8A 4H4MB 4DZDA 1TL4A 1X0FA 3P45B 2AEFA 2JDJA 3KDNA 1NJWA 2F63A 4NXMJ 1YWXA 2R7TA 2AX0A 2BM0A 4RUCA 3D4JA 4XPCA 3CVKA 4DSKA 4F02A 2DR8A 2CQPA 2VFUA 4QU7A 1ZM4A 1FDAA 2L3MA 2V2ZA 2SXLA 3N5FA 3NAIA 4G1QB 5F8JA 3G8SA 2V4QA 4X84A 2HHHF 2HRTA 1HNIB 2DNNA 2Q6CA 2J0WA 2ZE2A 3S01A 4WFXA 2DCLA 3J80Y 2OUGA 1GT8A 1RT1B 3C16B 5JVHQ 2R8HA 2H5IB 5IXUA 2Q66A 4WYLA 1S79A 1PSDA 5DQGA 3RW6A 1FK9B 1NPPA 5FDLA 1RA6A 4KPYA 3H5SA 2VKZG 3FC9A 1PJ7A 1KOHA 3MMCA 7FDRA 1TFWA 1CBKA 4QWCA 5K5MA 2E7WA 2DNYA 1HBNA 2O67A 3PFEA 4OZ1A 4ZVRB 1M5HA 4OHWA 4QOTA 3J81j 3QZ8A 4WBFA 3DRSA 4DQRA 2VG5A 1NHVA 1R8HA 1NRKA 2AJ1A 2CG4A 3M8ZA 4OYZA 2QYCA 4Y2CA 3T6BA 3UNGC 2Y8YA 2HBYB 1SC3B 1RT7B 3OL6A 1YJNS 4JI3J 2NXNA 1S76D 4LQ9A 4YY3J 3BV8A 4DF8A 1U6BA 4FBUA 2AZ3A 2IJRA 2V0NA 2CJXB 2YKMA 3BR9A 3KUHA 4P74A 4IQMA 2HZAA 4AXIA 3DLHA 2MQ8A 1H7WA 4C7QA 4FKYA 1S9EA 3MEEB 1REVB 4PEOA 3SQGA 4C3KA 4DEZA 2R8IA 3Q2TC 2BANB 3D1QA 2ZDPA 1EX8A 2XWYA 4W92B 3CCMS 1U26A 2ASDA 2ZNZA 4DV2J 3D6MB 4YQWA 1ZBTA 1FRHA 2KRRA 3GV5B 1KOOA 4KBIA 4LVOP 1N54B 4FN5A 2R7UA 1RP5A 2AMCB 2RQKA 1WHYA 2ZJPQ 1V5VA 2PGCA 4YHHF 4KTQA 4DV4F 2DGVA 4LRAA 2VBYA 5B0FA 4LF9J 1TL5A 4P7TA 3W1YC 3BN7A 5KFKA 4D3GA 1M1GA 4J9UE 1RT4A 4TVAB 3MCSA 3LGHA 1QUVA 2DO4A 1HWUA 2VG5B 1VS3A 1VC6A 3PO5A 4CO4A 2OPPA 1X0PA 4RUAA 2MLZA 4LMZA 2HZCA 1N32F 2LXFA 3M1VA 3VAKA 3NS6A 2J0XA 4NLXA 3TJ9A 5DDOC 2A0FB 3HKZD 4KY3A 4ZVPB 4LF7J 4CLSA 2XLJA 3KLEB 5HVFA 4K5SA 1S6PB 1UVMA 3OXLA 1B70B 3M32A 1RWMB 3QFWA 4J9NA 4AL5A 2ZZTA 1KLMB 1LW2B 1ZETA 1HBUA 2AJFE 3KLGA 4A48A 2HIQA 3C14A 2ZOMA 1VQSA 1C1CA 3MMBA 1NH7A 4L72B 5M2UA 5GMDA 3DI6B 5LMNJ 2QMXA 4DV3J 1VQ5S 2L48A 2FVQA 2BM1A 1VK8A 3W2VB 1TZ0A 2LYVA 5LMUJ 3GCWP 3FNNA 1TVRA 4NYOA 2DO0A 3IBWA 3MD1A 4DMZA 3JAMU 4AL6A 1F6TA 4JI0J 2C3MA 4TY8B 3M30A 2JL9A 1NJXA 4MH8A 5E3CA 2VODA 1HQ2A 2CNNB 4LRCA 2M70A 2NXEA 2QFIA 3AA8A 3W8GA 3L9ZA 2BE9B 2I0XA 4UT4A 3I31A 5GAGI 2G4BA 2DHXA 1VRTB 5D0EA 3T5LA 1HNZJ 2BDPA 3NAHA 4LF5J 3BBFA 5J2NA 3HSJA 3OR1B 3HFKA 4ILLA 2E7VA 2RRAA 3HZGA 1JLAB 1TKZB 3KLHB 1UVJA 1IR1A 2DB1A 1MMNA 1R0BG 2F8HA 2MKSA 1PC4A 2PA8D 2RIJA 3CJ3A 4IYQA 3DLKA 4RBUA 1IKYA 3TRGA 3VV2B 3R5JB 4FBTA 4AT1B 1NDLA 5DJBA 1R0AB 2GMJA 3LANA 2OGUA 2HPUA 2WONA 1U1RA 2AYEA 4LFBF 3MMAA 2CXEA 3OTOF 3H2VE 4HL9A 4A8SA 1BWVA 1LW0B 2OMLA 4PUOB 3LH2S 3CCJS 1U1OA 1P1TA 2MTLA 1I5OB 4QU6A 4YN3B 4EI2A 4A8XA 3NY0A 3SCJE 3HT3A 1WUUA 2ZZNA 3TP2A 1TK0A 3QGPA 4K2XA 3BDEA 3CIZA 4WXOA 1X4FA 2GW8A 2HRUA 3FCVA 5A0YB 5L38A 4M5DA 1Y0HA 3G71S 1AFIA 1OPIA 1HNWF 2MQNA 1RTIB 2V94A 1NPKA 4H4KC 2MGZA 3RW7A 1NK4A 4U7UK 1D8YA 2XNRA 3J7A1 1HMVB 4TYAA 2N3LA 4TLRA 3ZNJ1 3ZTSA 3B78A 2BMBA 5HVGA 5KFHA 3EDRB 2V8VA 1NU4A 1RABB 3KYLA 4CTAA 4CRJA 1TL3B 2POKA 3M8PA 4NLRA 4I2PA 4ZHRA 5KFLA 1CS4B 3VAJA 5L1KA 1NSKL 4RL1A 3PYDA 1T0TV 2XBPA 4UUXA 1FKOB 2X1BA 2ZH9A 4TKTA 2FJVA 1Q8BA 2OP5A 3DN9A 3JQKA 1LFPA 1RACB 3C6TB 3PKMA 4FF4A 2CPZA 1AXQA 3OSPA 4UUWA 2HVIA 1SKSA 4KT0C 3JSYA 4DV7J 3I0SA 2P6SA 2XWXA 1HI0P 2YNIB 2CQHA 2YWEA 1WF2A 3FSYA 5T7LB 1NBEB 2V2QA 5F8IA 2IJNA 5MLCV 5JMNA 2A18A 3PJWA 4XDCA 2ZBRA 3IG1A 1HBNB 2YX4A 2AZ1A 4Q2MA 2I2YA 2C2OB 2RKIB 3KUEA 1EP4A 1SJ4P 2VFTA 2WAQD 4G65A 4RW8B 5F0WA 4JI5J 4C8ZA 4ZVGA 4NZ7A 1K1QA 1RK8A 1F1BB 3GCXP 3CD0A 5HJXA 4J9MA 1A6LA 4EU0A 4OI6A 3H40A 2IYIA 1CS4A 2B5JB 4UQTA 3OD2A 3NBPA 4Q2LA 4CLUA 4X4TA 4OYOA 3M6WA 2FLLA 1FJGF 1Q7LB 5C25A 1VQYA 3M05A 3AXMA 2B56A 3VGTA 2AF6A 3EVOA 5J1EA 4XIUA 2ZUGA 2CJAA 2X1GA 3DOMA 4J91A 3M8SA 4JI1J 2MZTA 1LKZA 2B4PA 2YNIA 2ZHOA 3BQ0A 3P4UB 2RQCA 1RCXB 1CJVA 2FHJD 3PTWA 1AZSB 1U7LA 2VG7B 4PQUA 2LXIA 2QE5A 2KZZA 4WE1A 1VCTA 4I2QA 2B6AB 2WVBA 2V9WA 1YZ6A 1X5TA 4Q0BA 2AQ4A 1R8BA 3VAIA 1VRUB 1ZM2A 2CYYA 3MEDB 4CO0A 4X65F 4I2PB 4LSLA 2KU7A 2VBXA 3U27A 1N4LA 2IIHA 3L7PA 4PWWA 3C8YA 4GC7A 4F36A 4ER8A 4B9MA 3KNAA 4OYXA 9RUBA 2XCAA 2V8PA 1UKUA 1N6QA 3CJ0A 1NKEA 4B3OB 1CQMA 1FTCA 1NSPA 2GMLA 2WSEC 2B0GA 8RUCA 3JYTB 5B0EA 1RJJA 3MOJB 2K3IA 1KP6A 4C8MA 1S7HA 3ENVA 3MD3A 2BBEA 2CNKB 5AJ3J 3RBDA 1S72S 3OSNA 3QIPB 1LNQA 4G6VB 3SQOP 2A2DA 1K47A 2XM3A 1U2FA 3P6YC 2P9CA 4MAKA 4OYBA 3PCOB 4ZVSB 3JYTA 3G6XA 2L08A 3KK2A 3EZ5A 2GO9A 1REGX 1HQEB 3IGVA 1NSAA 3P5TL 4KQZA 4ZS6A 5KG0A 2VJVA 3BGRB 2YWHA 1D9FA 1WKKA 4W98A 2OHDA 4G1IA 4ED8A 4DR3J 2YKQA 3FUYA 1F3FA 3R5GA 4A8WA 4AD6A 2Y1JA 4K4ZA 1SPBP 1WELA 1Z2ZA 2YH0A 3EGWB 1WDTA 4MFBB 2R9LA 2PDAA 3OTCA 3DDIA 3FEXB 4OJGA 4F04B 5EWGA 3RZAA 1SKWA 3G82A 3QSIA 4LT6A 4J7CA 2HGNA 5F9LA 4C3MA 2JLGA 2UXBF 1Q53A 2VG6B 4EWTA 1RWUA 1PYSB 2K1RB 3ITHA 4J9RA 1QD1A 4HI1A 2V63A 2CZ9A 3RBEA 3N79A 2VU5A 2FVRA 3R5AA 4M94A 1SB6A 1OY8A 3CDBA 4NLVA 2ZH3A 4B3RF 4NX9A 2AJ2A 1RU1A 2DEIA 2JRSA 5D15A 4K4YA 4LF9F 1XNRJ 3Q0AA 1CEZA 3FKBA 4KGXB 1YBUA 2ZBIA 3K57A 2JC0A 4DSLA 5A6WA 3NBPB 3E2EA 5CHCB 4M5JA 4QPTA 5I4MA 3EGZA 5DM6Q 1LEOA 4GRSA 1SUQB 1IKWA 5EUHA 4E8UA 4JI7J 1QAXA 4C48A 1GTHA 2EG2A 3PKYA 1IBCB 1NM2A 2MHEA 1EETA 3BYPA 3CNQP 2EXUA 1FFWB 5G4DA 2H9ZA 4KGMA 3UN2A 2K7JA 3MXHP 1W25A 5ETTA 5A76A 5IV4A 2XS5A 1HMVA 3HVRA 1KKHA 1S1TA 4QWDA 2HGLA 3CGIA 1APSA 1JJ4A 3NNAA 3QSYB 4IOBA 5KFTA 2Z4PA 4Y3CA 2DJWA 5E5NA 2PI5A 4M5GA 3K5OA 1MMDA 4XO0A 2XYGB 2OAUA 3Q8QB 4K0KF 3PG9A 4O3NA 3N0VA 4C2MA 5C42B 3IO1A 4X4RA 4GKJF 4J9SA 2FZKB 1VGYA 4JV1A 4J5OA 2FHMA 1T11A 2VUGA 1DRZA 2JLFA 4JI8F 1C4CA 2WVDA 5KFSA 1N33J 4JI6F 2V4JA 1FRJA 2R2TA 2WVEA 1PYOB 1D8ZA 3DGPB 3F44A 2XGQA 4WZQA 3VGUA 3MMAB 2UP1A 4O3PA 4R25A 1TKXA 1RAIB 2FB0A 3QLHA 1NZAA 1YKWA 5C2CA 2Q6BA 5DRKA 5KT2A 5HMWA 2DGTA 2DGXA 2I38A 4L6V3 5HAOA 5LT5A 4ED3A 1Y5LB 2JWNA 2OPSB 3FFIB 3NOCA 4HR2A 2W9BB 4PG5A 4WTOB 4KO0A 5F8NA 3AY0A 1ITPA 4OZLA 4DCOB 2XHWA 4DL5A 2M9KA 2GVZA 4OFZA 5CAAA 2BOAA 1GMWD 4HDGA 4DR7F 4DV2F 4U7UD 1Q8KA 1Q1KA 2GGPA 3GG0A 5J1PA 3DDKA 5KT7A 3BQ1A 3I6PA 1S4FA 4RW4A 1NK5A 2ZH4A 1UWBA 3CTRA 1KTQA 4IFVA 1N5YB 2MJUA 2DHGA 2PT0A 4OV6A 3UFCX 2PFDA 2CDQA 2B4VA 1U1NA 4CP5A 2RHQB 1W26A 2IBKA 5ETPA 4ZKAA 4KC5A 4URSA 1B3TA 5KFIA 4RX6A 1GXTA 3QT5A 5GMEA 1MWZA 1N32J 4IDKB 5C2GA 1LW2A 2DNGA 2QGFB 2VBZA 4I7FA 1U47A 4ZVEA 3GFXA 1RDRA 2DTJA 2QTWA 4TQRA 3MUVP 1FJ7A 4NXNJ 1BUXA 2L9NA 1AYEA 3K5NA 3TWZA 2MMYA 5IC6B 2ZITA 3P8BB 2V2KA 2WVFA 5IC4B 3PIOQ 1YHQS 4IR1A 3DLEA 1XWLA 2KKHA 2FTRA 2CQ2A 2WB1D 2DY9A 2AX1A 1Y9OA 3EWGA 4NE9C 4CO2A 3NWGA 1UL3A 1CULB 3NS5A 4M5IA 4IH6A 1IBLJ 4CT9A 2CDRB 1UPMB 1ZTTA 1U2CA 5J2PA 3PDNA 2F40A 2HSEB 3GB0A 1WOSA 1FRKA 3MR5A 3LP1A 2F65A 4F2RA 1NDCA 3F73A 4BHQA 4LF2A 4O44A 4ZVHA 1J5OB 1MU2B 2JFKA 3IR6B 5A8KB 4DFMA 3L7UA 3DOLB 1FRIA 4ES2A 2C3UA 3EVWA 4X4SA 2CPFA 3MR6A 3M2VA 1P9QC 1XR7A 2M4MA 4TXSA 1TKTA 3HSZA 4OV1A 3PNIA 3OVAA 4U8YA 1LWFB 2QLBB 2JSXA 2MLXA 5LJ5Y 3PW7A 2MQPA 2CADA 2Y0SD 3DLBA 1HD0A 2OLWA 2ROEA 4WU2A 4EGLA 5HMZA 5IM0A 2MY8A 2GJFA 3D5MA 1K0VA 3GPAA 2W1BA 2F1FA 3TUZC 1AA1B 4OJ1A 1B99A 2XMKA 2UXDF 1IVZA 2KFNA 1N36J 1C0TA 1YRTA 5E7OB 2V4JB 1D9AA 5EWEA 4USVA 2KT3A 3O3LA 2VPYB 2CJKA 4ZP6A 3KDOA 4B9SA 3IBFB 2PN6A 2YY3A 3T5KA 2E9ZA 2OPRB 2P5VA 1ZOTA 3NG8A 2KM8B 2GAGC 1N52B 2BJ9A 3CCES 1QJHA 4B3OA 1HWKA 1VJQA 2XMAA 2OEKA 2HVDA 4N7TA 1JLQA 3CCLS 1Y3KA 4RW6A 1EQ0A 1FHTA 5AXLA 5I42B 3C2PA 3CJQA 1BQNB 2ACYA 4U96A 3TAMB 2ZHBA 2CWXA 3CJKA 3IGNA 3KHRA 4FYYB 1XBWA 3V4IA 1H0HB 5RUBA 4NLTA 1RT2A 4WYWA 5THWA 2XY6A 4DS5A 1S6QB 1X4GA 5ETQA 1X9MA 1FO1A 3KK2B 3RGIA 2QMWA 2KB2A 4ZJQA 5FJ4A 3SCIE 1GXUA 5DG7A 3LP0A 3DYAB 1CPZA 1X7VA 2MPUA 3TW0A 3QJPA 2LP4A 3UN3A 5C24B 4NZ6A 4IR9A 1RTHB 1UVLA 3IC1A 1RU2A 1QAYA 2B3TB 3WC0A 2HHUA 3QRQA 1L3UA 1O0PA 1TV6A 1KQGB 1F5BA 3CF5Q 4JB8B 3OLAA 1LWFA 3Q8RB 4CM0A 2OIHA 4R5PA 1RT5B 3UPFA 2PEHA 2R2RA 3O1LA 4UY8T 3M7VA 5D77A 1K73T 3KKFA 4EZ9A 2HW3A 1SJRA 3QAEA 2XZWA 1KDNA 4UZBA 2HNDA 4HTIA 2GC8A 3FBBA 4LR7A 5IQQA 1SL1A 1KD1T 4X66J 3AJ2A 2O01C 4DFPA 2ABYA 3F0NA 2F4VJ 4LBHA 2DNOA 2DEJA 3KTQA 2CPDA 2OO4A 2XCPA 2F9JA 4USTA 2R2SA 1FNOA 2K3KA 5DDRC 5L1LA 3W5YA 3PYFA 5DLFA 1VQNS 2XB2D 2JVRA 4UOGA 3OW2R 2X3DA 1KVIA 2D3ZA 2QRRA 1KHWA 4AUKA 5A8WA 1DARA 1HBOA 4C0HA 4IRKA 1FXDA 1X4EA 1ZPVA 4K8RA 4ZOSA 4DLEA 3NNHA 3MM7A 2YH1A 2C2MB 3DOKA 4A8OA 4RW6B 2VOOA 2EFOA 3GIJA 3D6TB 1FKOA 4DUYJ 4Y0FA 3TX0A 2V69A 5J1NA 1DTQB 4BC7A 2ZD1B 2DXFA 3EVMA 1VLYA 2BZ2A 2W7PA 4WPAA 1IKXA 1YK9A 2L9WA 3M8YA 1M90T 4W4MA 1U24A 1J5EJ 1J27A 1MROB 3J7YI 2WOMA 4X65J 3HD1A 3LGNA 3ET6A 2LLZA 2E5JA 1TQLA 1ZPWX 1U1KA 5HQ8A 2Q43A 1QSLA 1SKRA 4DF4A 4GKJJ 2XSJA 2RILA 2IAJA 2VL1A 1RSCA 1S1WB 1WI8A 2COLA 2YBVA 4KHPJ 1YJWS 3ZTQA 2WOMB 3AD7C 4RR5A 4G1QA 1NDKA 4K0KJ 3E01B 3PXGa 1T03B 2YVSA 4EBCA 4ZLNA 3HF5A 3TZXA 4X64J 1AFJA 3AH6A 4F8RA 4LFAF 3EYZA 1NKCA 3TI0A 3N6NA 3TA0A 3IRXA 3QRPA 2IC3A 2W01A 3FQKA 3CSKA 3W9JA 4C11B 4X4QA 1TK8A 2BVZA 3Q24A 4JI8J 2OPSA 3DRRA 3FFIA 3ZTRA 2W9BA 3IMQJ 2CQ0A 2ZZMA 3VZHA 2O5DA 1YJ9S 4TNOA 3G9CA 3BSOA 4ECRA 4F50A 3OVBA 2JEIA 3GIRA 2HWTA 5C25B 2CFXA 1RXOB 3CD7A 5CABA 1XNQF 3M6UA 5GMKa 1SC1B 2RAQA 4YUDA 3EX7B 3DRRB 3QATA 3M2UB 2D3UA 5EDWA 4UOCA 3QYYA 4ELVA 1U0HA 3KLVA 3GONA 2GZOA 4HACA 4MK8A 1HD1A 2LECA 2NXUA 3JSRA 2L41A 3NOGA 3LWLA 5JUMA 4YS2A 4KFBA 4P2SA 1RTHA 5AE1A 5CCLA 2HMIA 3NMAA 2HKEA 2DD8S 5CYQA 2P2CB 4M63A 1H73A 3GJQB 1FA0A 1S9GB 3AOCA 4B3RJ 4ES3A 4C3LA 4YB5A 1TVRB 4ECVA 3HHLB 1U09A 3HFZB 4PWUA 2KYXA 2RVJA 5D4NA 1T7PA 1PILA 1HI8A 2I8EA 4ZPBA 2ZBPA 2XLKA 1FDDA 2W25A 3JSMA 3RAQA 3NCPA 3O2IA 6AT1B 1YJRA 1RWXB 1ZYQA 3HZEA 2XS2A 2NXJA 1S57A 3UDLA 4UW2A 4L74A 1I3OB 2EKNA 2GVDB 2BYCA 2E1AA 2FVCA 2MLYA 2LQJA 2HFUA 4KKOA 3Q83A 4XPEA 4A8QA 2FIUA 2DRBA 1WTFA 2DNKA 5DDQC 2X7IA 2MB0B 5EX0A 1Q79A 8ATCB 5JVGQ 1RT4B 3PO4A 2GHWA 1PIEA 3D54A 4V1Ak 2DRAA 3K0JA 5B0AA 2DYAA 1ELOA 1VLOA 3SSQA 3TANA 3I0RB 2KH9A 1NSQA 3HO1A 3HI9A 4NLPA 4UTGA 2LFVA 3VR1A 2HS3A 2K8GA 4OLOA 2NXCA 3MF5A 2R8JA 3PIPQ 2VC0A 1B7YB 1MROA 1SCJB 4ID5B 5B0GA 4J9KA 2UXCF 3OL9A 2V34A 1UMJA 6FDRA 5KG1A 2QT7A 5T7LA 1CG2A 2ZC3A 1RT6B 2ZKTA 4PAAA 4B08A 1IM6A 2MSTA 2QL7B 1JJ2R 2KDOA 2RMLA 3DKDA 4NA3A 3MMJA 3HK2A 1FWLA 3I4PA 4PKDB 4GKKJ 3CJ4A 2RSQA 2ZNYA 2RDJA 1B4SA 4J9OA 2VD3A 2DPIA 3D3CJ 1H3DA 5E3AA 4RO0A 3CMAS 2CVIA 3EGNA 1KHVA 3KHLA 3WC2A 1RAEB 1HNVB 4DZ6A 2RQMA 4R8UB 4PABA 3GE9A 3VAFA 2XC9A 2ZHAA 3PX4A 1VIOA 2H3EB 3HHDA 1K44A 1TMMA 3N28A 1SQEA 2W24A 3FSIA 2JEGA 1D9DA 3PW4A 1WHVA 4DXLA 2CQCA 2LXUA 3V4IB 4CCHA 3QT7A 1JXVA 1ZZNA 1YG0A 1UTAA 1RISA 1DTTA 2MSSA 5K14A 1RT3A 2OD6A 2ASYA 2XEXA 3MCOA 3MEKA 3TO8A 4DUZJ 3U02A 2GIFA 4OX9J 3TZYA 2YKMB 1S9GA 2BJ7A 1TAQA 3I5AA 2QIFA 2C1EB 4DOZA 1DLOA 4DV3F 2MZ1A 3I55S 3T5HA 1Z4UA 2L9DA 2A6OA 3DLEB 3HVTA 3W63A 4TU9A 8AT1B 3EM1A 2WHOA 2ZH1A 1KWMA 2RF2B 2YKNA 4QIVA 4IRDA 2VASA 2XMJA 2B8QA 4NPOA 4P2MA 4MJKA 5FLXU 4U67Q 1JXEA 4PXEA 2PO4A 1WEZA 5KFPA 1HL6A 2VHGA 1JNRB 4DPWA 1QAJA 3DHXA 1JWWA 2CZVC 2H51B 3DRXA 3MGJA 3WX8A 1JLGB 4P72A 4F3OA 1KVJA 4P2XA 2D41A 2DNHA 4YB7A 1RWNB 4K2JA 1XC9A 2FLNA 1HW8A 3ADAC 3BSCA 2KI2A 4AFFA 1M5OC 2DNQA 5M2PA 2HFOA 4ZPVR 3CUNA 1P27B 1M1KT 4C8LA 1YI2S 1C0UB 1RBLA 4PPZA 3OJSA 4MIWA 2IM3A 2J7WA 1U2RA 2B4UA 2CVEA 4USUA 1I51B 5MAOA 1G4CA 2OPQA 3CCVS 4NA1A 1UETA 3ELHA 4J37A 4LR9A 4LSNB 2M5YA 3DMJA 2E9RX 1H74A 1VHFA 2MZSA 3R5DA 4ALZA 2KZMA 4F7VA 3ENAA 4NRTA 4KGVB 4MKAA 1OQ6A 4LIWA 3UI3A 2F4VF 4K50A 2Z56B 4DN9A 5IOLA 5F8HA 2OMOA 1SIZA 1XK8A 2FJAB 4I68A 4OX7A 2KXNB 2W9AA 4ED4A 1IBKF 5LXYA 3QT8A 2DHHA 1T9YA 5KG3A 1Y00A 3K8VA 2ALZA 3BYRA 5HP1A 3V6HA 2C3YA 5LL6d 2MJNA 4HKQA 2NQPA 2PD1A 5H9FJ 3N4WA 2GJIA 3FJ2A 3MFHA 4QYZK 1FVSA 2FJEB 1R6YA 2V8DA 4FNIA 4P10A 4CH1A 3ZO7A 2JEJA 1FI4A 2HQIA 1E6YA 4UF4A 2W8LA 3SCKE 4DR2F 3HVAA 4KB7A 2IBOA 3HCXA 3TUIC 3MM9B 2DH7A 1J5EF 3TA1A 2DR7A 2FQQB 4NMXA 2O1PA 1YGYA 3KUGA 2WCXA 2HQGA 3MEGA 4LBPA 3E51A 1NHUA 3LWMA 3FCWA 1YBAA 1ZA1B 3MM9A 3PX6A 4CDIA 1HR0F 3Q8YA 3TQEA 3VVUA 5JJBA 4ZVFA 1YQHA 2EK1A 3UDCA 1RHRB 2MQMA 2OH2A 1CJUB 2F5GA 4LRDA 1DLOB 2Z2MA 5LOQA 2HS4A 2ZJQQ 2IRUA 4IO9Q 4LF8J 4LFAJ 4RNFA 1UVIA 2JFDA 2JEFA 2ZBQA 1T3OA 2YNFB 4L75A 3A3OB 2J9DE 2HWIA 4A47A 1DTTB 4K59A 5K14B 3D0IE 5DQHA 1RT5A 1FX2A 2QEXS 4ED0A 3T1YF 2UUAF 4JI4J 1DY3A 2OPQB 3SMZA 2XS7A 3CD5A 2DNPA 2FJXA 1B0VA 1WF1A 3PJ9A 1KRPA 1G1XA 4P71A 1SBRA 3AXKA 5KFRA 2V4RA 4U7CA 3H8YA 4DL4A 1N8RT 4LF4J 5CYQB 3UVJB 1DAXA 2MDAA 1QVFR 2XNQA 3UDEA 3D66A 1URRA 4NEZA 4KAIA 2B7BB 3ZZPA 1B7FA 4UY85 1KS2A 3M8WA 1VQLS 4I2QB 4IRCA 3QJJA 3J80U 2CKWA 1PBUA 1U8SA 2EBEA 2KVQE 3A1YG 2YWGA 3UVJA 4PG7A 2OFHX 2RRNA 3V6JA 1EKRA 4ZP9A 2ASJA 2AGQA 3S8SA 5KFMA
chains in the Genus database with same CATH topology
1DQ9A 2NSCA 1S77D 3MPYA 4I6WA 2BE2B 3PR5B 5KFXA 5LSOA 1IBMF 1NK8A 1IKXB 1S48A 4GMKA 1SC6A 3C3LA 5AXKA 2GIRA 5K8PA 2FVSA 4Y65A 2VC1A 1Q8LA 3QGGA 1TKXB 3QLHB 3MM8B 3J7ZT 5GADU 1A9NB 1SV5B 1M0SA 4IH5A 3HHLC 3QGHA 5CZXA 3KOAA 3CXCR 1IKVB 4ITSA 5AJ3F 2QA4S 3R1HA 4A8MP 2HG4A 3OXGA 2B9WA 4RZRA 2B9XA 1QSSA 1HWLA 3CO9A 3OHBA 4AE5A 1JLBB 1DHMA 4QR0A 2BQ3A 3GR0A 2BABA 1F5CA 5FDLB 4EO6A 2I5JB 2Y1RI 2AGPA 4WXWA 4DSIA 1FESA 2LMIA 2VG7A 4PQUB 2ZH5A 3US5A 2NS1B 5IS2A 5KTQA 5EWFA 1H7XA 1BY9A 2CPEA 5DG8A 1UA0A 2EI5A 1S1UA 1HYSB 1S6PA 4DQSA 4QIWD 3G4SS 2XMVA 5J2NB 4QPXA 2DR9A 3AHPA 3I96A 4A8FA 3IS9A 4ECQA 3MTJA 3BREA 2KG0A 5D6GA 3KLIB 2MKJA 2KJWA 3QIDA 4TU8A 1BD6A 4NWBA 5BYRA 4AL7A 2B51A 5A8RA 3U1LA 1G7CB 4N41A 5M2RA 4ECWA 1RT3B 4EBDA 1WG4A 1CQNA 5J2MB 1U1PA 4TN2A 2I9SA 3HXMA 2E66A 2HHXA 4I0WA 1WF0A 3DCAA 3OR2B 4X4NA 1SIWB 5DDPC 4BS2A 4PR6A 2UUTA 2AYMA 2E5IA 3CMES 4F4YA 2FJBB 2ADCA 1S6OA 5I42A 5J2MA 2DHSA 3QWUA 3GFZA 3O8WA 3KK1B 4FPRA 1VQ7S 1WD6A 2G9OA 1YSJA 4ED1A 1R0AA 4URGA 4ETZA 5B0BA 4X4UA 4TY9A 1RTIA 2CPXA 4Y2IA 3QIPA 3LP2B 5I3QA 3GQCA 3NL0A 1E6VA 3THTA 4OLPA 3PX0A 2A10A 3DRPA 4Q44A 5KFGA 4I7FB 3JB9k 3A8EA 1ULRA 5F0UA 3I0RA 2GJ2A 3B82A 4M5DB 4NCAA 1GQEA 1IR0A 3PJXA 3K2YA 3MM5B 1JIHA 2RU3A 5KFFA 2R7RA 2R4FA 3V81A 4EUVA 1F9FA 4QIEA 4Y2KA 3U7JA 4EEYA 1QTMA 3WZ0A 3N6MA 2ZFHA 1KTVA 2DGWA 3PEHA 1TV6B 3Q2SC 4RWWA 2LEAA 3SFGA 1Z2LA 1Q78A 1SJFA 4R0JA 3GIMA 2BRKA 1QM9A 3FEZA 3FMWA 4GKKF 4K4XA 2GO8A 5D3GB 4CH7A 2HGMA 3TNVA 3O6QA 1VFJA 2V8HA 3VQTA 4Q8EA 3HPOA 4OQJA 3ZZZA 4FF2A 1TL1A 5HLFA 1JB0C 4YEAA 3ZZOA 1GAOA 2LDIA 2CZ4A 4KV8B 5I3UB 4OI1A 1EP4B 3H59A 2D7SA 2R7QA 4RW9B 3MEGB 4KHRA 5KOWA 2YKPA 5A6PA 3IS9B 2FUG9 3HVWA 2UVRA 4A4JA 4ETXA 1O8BA 3I0SB 1FKAF 3TA2A 5J2PB 1IM4A 2NR0A 4LJMA 1NAQA 2C28A 2VBWA 1IBLF 2CQIA 4WU3A 4ZPWR 4NXMF 4IOCQ 4H54A 4RU9A 3GIKA 1GX6A 4CO1A 2X1FA 3T9NA 2GGPB 4X4PA 3H2UB 2FC9A 5F9NA 1X9WA 2HHPA 1BQNA 1T8EA 5T41A 2BJDA 4LF8F 3G86A 2N7YA 2FJWA 1FKPA 2E5HA 3FVYA 4WKRA 4OHXA 2RT3A 2Y1IA 4DJBA 2OPRA 4RNMA 3G6ES 3OXFA 3UR3C 2KG1A 2BR0A 4OI3A 3DRPB 3DFEA 4USHA 3LP0B 5EX3A 1TFYA 1R8AA 3QGIA 1B0TA 3L09A 5B09A 2WSFC 3IRWP 1BGXT 3ITHB 1RT2B 3MR3A 1UWBB 2HMIB 3FZ2A 3T6JA 3TR5A 1LQ9A 3J81Y 3AA9A 1N36F 3PY8A 4NLSA 2LCWA 1NKBA 4DQQA 3T1HF 4C8OA 4YFUA 1ZH5A 5F8MA 3PZPA 4X4OA 5B0CA 1SH0A 2Z8QA 4HHJA 1TAUA 1FEHA 1LK7A 1RT1A 1SV5A 2GFFA 1KNZA 3CJ2A 2CIMA 3VQSA 2KJVA 1R43A 5KT3A 5GAGU 2QLXA 4EBEA 3RB0A 1WHXA 3VALA 1K0TA 2R7WA 2B4OA 2HNDB 4ECZA 3J7Z5 2RS8A 3RB4A 1N56A 1MSWD 4ED7A 1VMBA 3C66A 4NLUA 3R3TA 2VFRA 5L9XA 2XI2A 1YRUA 2AYGA 4NYZA 4XDDA 4RBVA 4CNZA 3BQ2A 3DOLA 3KG0A 2LEPA 1S10A 1QUPA 5KFVA 3TX8A 2NREA 1H6KX 1Q8IA 1KQKA 3SI8A 5KG6A 2E9TA 1LK5A 2XULA 1HFEL 1N48A 1TK5A 3I56S 3M32B 3M2RB 4U6PA 3SZ2A 2UUWA 1JLEB 4LVNP 5KG2A 3FQLA 3UR0A 4JI4F 2JLEA 3IAM9 1S99A 1M5KC 1FTRA 2KYZA 3EXCX 4YR2A 2NZ4A 4PG6A 5DQIA 4JI0F 1WTBA 2H5EA 3ETOA 2M52A 3HX9A 4OHYA 3RRGA 3C6TA 2J9EA 4I56A 3PRBA 1O51A 1FXLA 1X5SA 4G1PA 1LV5A 2WBRA 3LALA 5L8RC 3SSRA 1NJZA 2IM2A 2HNYB 2B9YA 4ELUA 3DC2A 4FXDA 3CJ5A 2BE2A 3CC2S 2QFJA 4NCGB 2RKIA 2W4CA 2D9OA 2J0SD 2ZBCA 4NLWA 5CA5A 1WHWA 1M5PC 1LOUA 2OD4A 1HNIA 4IFVB 3OV7A 3K5MA 1N5YA 1YITS 2MYFA 3CCUS 2IA0A 2LU2A 4RUHA 2X51A 4PXDA 1U48A 4ECTA 2F8EX 1X4BA 1F60B 3WDOA 5C5JA 4E0DA 1RTJB 3LOUA 3MM6B 5CXTA 4WF9Q 3M6VA 4CH0S 1WG1A 4KO0B 3VAMA 2VONA 2K7KA 3D28A 3GILA 1RT6A 2ERRA 4PUOA 4I4BA 5KAKA 1H2VZ 2GQCA 3MAHA 2VZ9A 1R27B 3V6KA 3VZIA 3C6UA 5GAEI 2GQQA 1KQFB 1C1BA 3KJVA 3CULA 4ZA1A 1J5OA 1VQKS 4J9LA 1IKYB 1X5PA 3NGKA 3PEJA 3Q8PB 2FVPA 2R7XA 3HHEA 1HWJA 2KT5A 1FNXH 1LWEA 1U1MA 2GIQA 3RTVA 1U6ZA 2EKYA 5DM7Q 2PIIA 3G6VA 2PFFB 2GMHA 5D3GA 3MI7X 2X1AA 4KFBB 3EXYA 2Q1LA 2ROPA 4MIBA 5B08A 4DQPA 5D4OA 4CO3A 3CD6S 1MMLA 3H5UA 3KHHA 1HHTP 4F3MA 1QY7A 1K9MT 2W4DA 5LJ3Y 1ZAXA 1T94A 4DL6A 4H4MA 5JXSA 2C22A 2C2DA 2IFXA 1IKWB 2R7OA 4DR4F 4JOUA 4C8YA 3UD3P 3HMJG 4V19J 4FYDA 1BQXA 4LFCF 1BWEA 2FLPA 3KLFA 1OS5A 3MM6A 1OO0B 2UZAA 5K8NA 2DBBA 7FD1A 2LEBA 4KHMA 1RYSA 1R8CA 4H4OA 3W7BA 1H2TZ 3EPIA 2ZOGA 1HPZB 1TR0A 1UJ4A 1SL0A 2XY7A 3NLCA 1URNA 2AJ4A 3OUYA 1DURA 1UJ6A 2DIVA 1R7IA 3I4HX 1E6YB 1UVKA 4QWBA 5ITHA 2MQQA 4XAKA 2HNYA 3BJYA 1L5UA 1NEEA 3DGPA 2J7UA 5GAEU 4QR1A 1TKTB 3BF4A 4C0BA 4DLGA 2DH9A 2HHWA 4NCBA 3AQOA 1QLNA 3M8QA 3CCZA 2MZRA 1QSYA 2YNGB 2XMUA 2ZH2A 2FD2A 2V9KA 4ECXA 3DLKB 3K5PA 2OJ3A 1RI7A 3DHWC 2OFGX 3I5CA 3NCRA 2M0GB 3SSSA 3TVZA 3LQVA 4B3SF 1UEVA 1RYRA 3HHLD 5D4PA 4MKBA 2HAIA 1FEEA 4NCGA 2EVZA 4ZPAA 5KFDA 2JJ4D 4DBQA 4JUZA 1S6UA 2A3JA 4IFYA 2KFYA 3JSBA 2FPHX 1DTQA 3VWSA 4K4VA 3I5BA 1F5AA 1IJFB 2A1BA 2ZM6F 3OPKA 2KHCA 3DOKB 2C42A 1W2IA 1YTYA 3DLGB 5AXNA 2W7AA 1E6VB 4OX9F 3FMBA 1UJ5A 2VV5A 4KGKA