2NSCA

Structures of and interactions between domains of trigger factor from themotoga maritima
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
109
structure length
109
Chain Sequence
MEVKELERDKNRVVLEYVFGAEEIAQAEDKAVRYLNQRVEIPGFRKGRIPKNVLKMKLGEEFQEYTLDFLMDLIPDTLKDRKLILSPIVTERELKDVTARVVVEVHEEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trigger factor
publication title Structures of and interactions between domains of trigger factor from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Chaperone
total genus 24
structure length 109
sequence length 109
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2nscA01
2NSBA 2NSCA
chains in the Genus database with same CATH superfamily
2DVIA 3PO4A 1DRZA 1M5PC 3JS9A 1JK9B 1WJ9A 1SJ3P 3GONA 1FJGF 3QJJA 4ZIVA 2JFDA 1DY3A 4O44A 3M8SA 1GX6A 2V9KA 3KYLA 3BEGB 1XNRJ 3UCZP 4EI2A 5IWAJ 1VQLS 1AXQA 4LMZA 3JSBA 1CULA 1VK8A 4RBTA 2ZOGA 2E7VA 1FKPA 1S1XB 5KG3A 1T9YA 1F9HA 2CPYA 3OFFA 3UNYA 4J9OA 3UO0A 2H5JB 2HSEB 4EWTA 4IFVB 3HF5A 2CQIA 1WWHA 3MCSA 2DNZA 4CDIA 1QLNA 2OKQA 3OL8A 2CVIA 4GO5X 1R8AA 2ZHBA 2B9EA 2V4JB 4TQRA 3OR1B 1HQEB 4C8KA 3P49B 3IR5B 4L6V3 1YJUA 3OW2R 4DR6J 2DKOB 5B0GA 4C3MA 1SC4B 3EM1A 3H25A 4OI0A 2MJUA 3HVWA 1V6HA 3PJWA 4ENOA 2YPYA 4NRTA 4NCBA 3B8HA 3I5BA 5B7WA 5KFXA 5EDWA 4F4ZA 2NXCA 4A4JA 5IS2A 1IKVB 4ZS6A 3H90A 3VAGA 3DGPB 2B8QA 5DETA 1GX5A 2HEKA 3KK3B 5A76A 2VFSA 1YK9A 1AFIA 4U96A 1RT4A 2IVMA 2LA6A 1SUQB 1P9YA 2YX7A 3IP0A 1RU2A 1JLGB 4TU7A 4ZVGA 3MAAB 1UVIA 3JXOA 1WKKA 1QTMA 1NK0A 1FXLA 2XLJA 3P8BB 2V6AA 3A13A 2CQHA 5AJ3J 4ZITA 5D4LA 4DSLA 1JQGA 3GR0A 4DV6J 4AQYJ 4M95A 2QRRA 2EFGA 4E2FB 1FRMA 2XHWA 2BX6A 4F3OA 1LNQA 5B09A 3TAMB 5A2QU 4ANCA 2MLZA 4FF2A 1RSCA 4WZQA 1KSPA 1DARA 2K2PA 5J2QA 3KUEA 1F2HA 2IJFA 4P2XA 4OZ0A 3G8QA 4PWDB 3QFWA 1EETB 2NZCA 4M5MA 3CCLS 2A0FB 1N5TA 3TX0A 3DLGB 2W9BA 2DNHA 2GAGC 1I3OB 1TUVA 2MQMA 3KG0A 1O5JA 3W9HA 3B6BA 3C15B 4DCPB 3BGFA 3CJ3A 1FK9A 3PCOB 4OLOA 5LXYA 2B7BB 3FBEA 5D3GB 1KLMB 2VQFJ 4W92B 4QWCA 2CKWA 1U0HB 3SQGA 1EKRA 1K47A 3SQOP 3HSZA 3DYAB 3TAQA 3SYZA 4AD6A 3D68A 1NUEA 1HNWF 2VFRA 2HBZB 3KNGA 2V8VA 3OLBA 1RT7B 1YZ7A 3PO5A 2YNIB 4FS1A 1FJGJ 2CQ2A 4DF4A 2YNGA 4KGZB 4H54A 2OH2A 4JI1F 3ZTOA 5CD4H 3K7RA 4ILLA 3OTBA 1GMWD 2R2TA 3T5KA 2HRUA 1NB2A 3MEGA 4O3RA 3B4DA 2RRBA 3CJ0A 3BH7B 2DNOA 3IS9A 2QL5B 5HL7Q 2ZBCA 4LIWA 2BJ8A 1VQSA 3CO0P 1XQIA 3BBBA 2DHHA 3DHWC 4USVA 4MKYA 2VC0A 4QR1A 2MSTA 2FLLA 4LFBF 1U2FA 4B9SA 1KQGB 3ZTPA 1U1OA 2I9SA 2KZMA 1V5IB 5KT3A 2GJFA 2Z2LA 3DN9A 1JJ4A 2JEJA 2J9CA 4KT0C 3JB9k 2UXBF 2KXFA 4HH1A 4FNHA 4TYBA 3MGJA 3A1YG 1XMOF 4U9RA 1NHKL 1RTIA 1OWXA 3VF0B 1AZSB 4UOHA 3V6KA 2PDAA 1QAXA 5C24A 2A6OA 4NCAA 3V6DA 3GPAA 4TLRA 3LQVA 2LECA 1FTCA 1R0CB 2CADA 3W9JA 2X1BA 3CCMS 3NMAA 1YZ6A 3MM7A 3VGUA 1R8BA 2HVHA 3GV8B 1SC1B 4KHMA 2FVPA 3UR3C 1BQMB 2WOMB 4GKKJ 5HJYA 1M5KC 2MKSA 2J7WA 2EBGA 1GK8A 5DDPC 5BYSA 2YWGA 2GO9A 2XO7A 4ECRA 3LP2B 4RW7A 3CNQP 1CJVA 2YWEA 1C2PA 2FB0A 2IA0A 4OYPA 4RUCA 3ISND 1TL1B 1G4CA 4YP3A 4WP9A 3OSNA 1MWQA 2JRSA 3GIIA 3EDQB 1QUVA 1WSRA 3CE8A 3KLEB 4WK1A 1TKZB 5A0YB 3UCUP 4DV4F 2GVDB 1F6TA 3DKDA 4J37A 4PQUB 2HNDB 1D0EA 2M52A 2VH7A 2ASYA 2W8KA 2DCUB 2PFDA 4DWIA 2I8EA 5BXIA 1UFKA 3HVTA 3Q8YA 4KFBB 3QT7A 1JLAB 4OHXA 2YNHB 2MLYA 1FE0A 2G4BA 5HANA 2DNQA 2GO8A 3TO8A 3PKMA 4ZVFA 1Q78A 2DNLA 1NDPA 2C2RA 5EWFA 2L41A 2F1FA 2E5JA 1MWYA 4DQRA 2K1RA 2H5EA 4C8MA 2FVRA 1DBDA 1HYSB 2Q79A 1HKAA 2EKYA 1RGVA 4JI1J 3HSDA 2J9DE 1SPBP 3VVUA 4P2FA 4P72A 4GKJJ 4DS5A 1RWUA 2MQLA 4ELUA 3LTOA 1TKDA 2GA7A 2IRYA 4QIWD 1JX4A 4MAKA 4LQ9A 4IOBA 1SH0A 1UTAA 2ZUGA 1XC9A 4B17A 3IN5A 3Q8UA 4Q43A 3TWZA 3W2VB 4IR9A 1HARA 2OSQA 2XNQA 1GFWB 3SCIE 5HJXA 4K4SA 3POTA 4NA1A 3DRYA 1REVA 4GC7A 1OPIA 2FUG9 3CGIA 3UDLA 1WHWA 5KFJA 2BJ3A 4JI6F 1F2GA 4XK8C 1YVFA 4MTPA 1TV6B 3P4UB 2BKPA 1TL3B 4LRFA 2RF2B 2BR0A 3EZOA 3BS9A 2DGSA 2XEXA 3M1VB 4WKYA 2UXBJ 3BZQA 2LDYA 1NCLA 1NJYA 1ZAWA 3KK2A 2DR7A 2DJWA 4YHHF 1SV5B 4RO0A 1YJNS 1H2TZ 1HW8A 2FY8A 4YQWA 5CYQB 3H7HB 2WZ1A 1UVKA 1S57A 4FS2A 1NEEA 4JI4F 2LXFA 3KHHA 2DTJA 4Q8EA 2VPYB 3OUYA 2GV1A 3H5XA 4J90A 4C4WA 1R3NA 4EK2A 2V8PA 4DX8H 5JVHQ 2BQ3A 5C42A 2XYHB 4K4ZA 4M5LA 2GVZB 1JLQB 4IRKA 1FNOA 3M2RA 4ERDA 2XS2A 4I6WA 4OZNA 1QDUB 1ZS6A 1NJIT 5ETQA 4DBQA 3LWMA 1XK8A 4UQTA 5E2QA 4HVZA 2K7KA 3HT0A 1GTEA 3MI7X 4DQSA 2HW3A 3BQ1A 4TY8A 2AHOB 2LDIA 3EICA 5HQMA 1VQ7S 4DQIA 4P9SA 1EIYB 2CNKB 3QIDA 4MK7A 4XIUA 2MQQA 2FJBB 3PXGa 3MMCA 3MURP 2IVFB 3EDRB 3KHLA 4ITSA 1N0UA 2IRXA 4DL2A 2ZEJA 3FSYA 1RT1B 5LSRA 2LYVA 2IM1A 4WP3A 4Z7YA 3OTDA 1E6VB 4OYZA 3I9ZA 1RWXB 4JBCA 4DX5A 2IC3B 1Q1KA 1FESA 1L3SA 2B4PA 2HAFA 3K8VA 2COLA 2C2ZB 2ZVIA 1JLFA 4C8NA 1UJ4A 2GZOA 4ZVPB 3VAMA 2ZFHA 1S12A 3G8TA 4OHVA 1WF2A 4FF4A 4ED1A 3ILOA 4A8KA 2OPRB 5HAOA 2DITA 2HQGA 3RB6A 1KC8T 2KRRA 4JI8J 1PYTA 1O0PA 3AT1B 2JFKA 4WTOB 2HHVA 1MW7A 3D3CJ 4PQAA 5HATA 4ATNA 1U2CA 3RB0A 3RAXA 3UVJA 1UZDA 1VBXA 3P96A 2V34A 1TL4A 3NWGA 2JHEA 4DFPA 3R2DJ 5EHHA 5F3ZA 5KFDA 2BE2B 2AIRB 4YR2A 3M6UA 1NBEB 3SZ2A 3EGWB 1H6KX 4O0NA 5F8JA 1N5YA 1IBKF 2VU5A 3UE2A 4HH0A 4HACA 3EXYA 1VQ5S 4JI6J 2LA4A 1JMTA 3QLHA 1P27B 5D15A 3VCDA 2N4DA 4HTIA 2IRUA 2MPUA 1OIAA 2CIMA 3KXDA 2IBOA 2LEPA 2UP1A 2H4WB 4K5RA 1KQKA 5I42A 2VASA 3BDEA 5LXRA 4F02A 2ZH2A 3ILIA 4UF4A 2AW0A 5F8GA 4YHHJ 3QGHA 4O4RA 3OTOF 3QO9A 3OLAA 5L39A 1HIYA 2NXNA 2ZH7A 4JP8A 4Y28C 2WVCA 4ZVTB 4WYLA 4JI4J 1R0BG 3DRPB 1T9VA 4NXNF 4AT1B 3RUBL 2BW7A 3W5XA 1EQMA 1C0UB 1WC0A 1WSVA 2GIFA 1UETA 2K8GA 3MTJA 3W3SA 1NNDA 2OPQB 1D8ZA 3K5OA 4WIIA 1YJWS 2GMLA 2BA9A 2L48A 1S1UA 2WVBA 1I94F 1B0PA 3EWGA 3ISZA 1H3DA 1TL7B 2HBQB 1URRA 5IFMA 4P6QA 1WF0A 3E01B 2E9TA 3OHBA 2F4VF 1VQ4S 4Y0FA 2NXJA 5K20B 3O3LA 5J2NA 3GU0A 1X9SA 1RCOB 2IYGA 3KLFA 3IMQJ 3CCTA 1T3NA 2DXDA 4BC9A 1OY9A 3BGUA 2OEKA 4DR1F 4PXCA 2HGNA 2M7SA 4I4BA 3QZ7A 5F0WA 5IT4A 5D4NA 4CNYA 1FKAF 1HHTP 3PFOA 3D7SB 2ZH5A 4WKRA 2XI3A 3MUTP 2ZBIA 4WCEQ 3K17A 2LQ8A 4DL7A 4TKTA 9ATCB 2QMWA 3CD6S 2VQEF 1KN6A 4NLDA 1S1XA 3AA8A 4ED3A 2Q3PA 3OR2B 2ZKTA 4LBIA 2AJ4A 2CDQA 3SFGA 3RBZA 4PPZA 1XWLA 3ZTRA 3DFEA 3CCJS 2Y0SD 2FHJD 3NOGA 2V4JA 2VA2A 3OR1A 3KLHB 2BEFA 2VPZB 3QT5A 3L09A 4ZJLA 3TUZC 4P71A 4DCJB 3NCQA 3PZPA 2ZH9A 1BMQB 1B3TA 1PCAA 1A7GE 4ER8A 1HD0A 2KJVA 1CJTA 1SIWB 1VBZA 2I2YA 2PN6A 3JQJA 2BRKA 2EFOA 4KH0B 3BSNA 3QJLA 2L3MA 2CJAA 3FC9A 2JLEA 2YPZA 3GJQB 3C3LA 4KKOA 3B4MA 1IR2A 1R43A 1YJ7A 1RDRA 5CYMB 3IG1B 3KJVB 4KBIA 3MPVA 4QYRA 3DGPA 2A3JA 5HP1B 5CD4A 1M1KT 3Q8QB 1IBKJ 5GAHU 1O6XA 2OD4A 2DBBA 2B3TB 3M05A 4MYTA 1XR5A 1VBYA 3MAAA 1B0VA 5ETTA 1JNRB 2DGOA 4YY3F 2MGZB 3ET6B 2HNZB 4OJHA 1FT8A 1J5OB 1WEZA 1VK3A 2HQ3A 4LF9F 3MMAB 3NY0A 3LF0A 2UUAJ 4EBEA 3DLJA 2MY8A 2HQDA 2ATCB 5KT5A 3TAMA 4F26A 3OTOJ 2WAQD 3AQOA 4LBHA 5FLXY 1X5PA 1NSQA 1OSCA 2XS5A 4DMZA 3TZWA 1JLEA 3N01A 4I69A 4I6YA 1N5QA 1S7IA 4NXNJ 1F9FA 4OHWA 3FBFA 3N9UC 1U24A 1T02A 4RX6A 1S0NA 4N56A 3KHRA 2B5JB 4WPAA 3DLGA 4UOGA 4ZPTR 3SCJE 3HD1A 3TANA 1VHIA 2VDIA 3C15A 1I94J 2O67A 2LKZA 2J7UA 5D3GA 4PG4A 5T7LB 2HHTA 2C42A 1U0HA 1EHWA 1FERA 4B9NA 4O0IA 2DGWA 4F0MA 1X5OA 2NUUG 3DOLB 2F4VJ 1VGYA 4IH7A 3AB2B 2C3PA 4O4GA 3NRBA 1HLWA 4X4PA 2Q6CA 2HNYB 2DD8S 5HVHA 3KJNB 5K14B 4QR0A 4DR1J 4MH8A 1PAEX 2HFUA 2FJAB 4MIWA 4EEYA 1YKWA 4OQJA 2MQOA 3I9V9 3TARA 3PW5A 2LFVA 1KQFB 4ECQA 3V81B 3K57A 1RUSA 1C0TB 3A8KA 3W61A 3H59A 3TNVA 2YQ1A 1CJKA 2NCKL 4PUOB 3Q89A 4M94A 2AEFA 4Y34A 1S0MA 2CJ9A 3D0GE 3JAMY 2UVVA 3MAHA 2OO4A 2WVDA 2XHCA 1N52B 4OX8A 1YBUA 3RBXA 2AD9A 3RW6A 1SQGA 2ZJRQ 1GMUA 2ZZTA 5C25B 1HA1A 4ZK7M 2W9CA 2JLFA 4HYKA 1HBOB 2MDAA 7FDRA 3IM8A 5J2PB 1QVFR 3W60A 2PEBA 1T9TA 2MXYA 3UQSA 3O1LA 4RR5A 4G65A 4TU8A 2F8EX 4TQSA 2H65B 2RVJA 3LGMA 1IKXA 2WRMA 1VRUA 2W01A 3PTWA 3AXMA 1ACMB 3J7YU 2DNMA 1LW0A 2CA9A 2LEAA 3F56A 1NK9A 5KFIA 3EVOA 3A3PB 2FVCA 3L9ZA 1XN9A 1UFWA 4NA2A 2BZ2A 4ED0A 1QUPA 2E1RA 2OPPA 5MLCV 4M5NA 3T6JA 4QWEA 4Z2XA 2ZNZA 2XWXA 4TNOA 3HCXA 4X4NA 5L9NA 3W5YA 3IFEA 1OYDA 1DHMA 3UDCA 5K5MA 3I55S 2ZOMA 3MEEB 4H4KA 3NNHA 1AB8A 1LXNA 2M8DB 1MROB 1W2IA 4YY3J 3CIZA 1HPZA 4LF7F 3RRGA 2AX1A 3LP2A 4ZP7A 2UZAA 2VKRA 2EW9A 1IKWB 2W8LA 3TJ9A 1HNXF 1WOSA 1TKTB 3IA0A 1TL1A 4EBDA 1S1WA 2C2NA 5HROB 4MJKA 4NZ6A 5G0RB 1Y11A 3MM9B 3AD7C 1WELA 5ETSA 3VGSA 5IM0B 1KS2A 2V0NA 5GAEU 1JIHA 2V68A 4A46A 4UUWA 2ZC4A 1TKZA 5J1NA 1F1BB 4JI2F 2VIHA 2Z56B 2KM8C 2X3DA 2KTQA 2WCXA 2BVZA 4KFBA 2B9YA 5L8RC 3F0NA 1V5VA 2KG0A 1LWFB 4Q5VA 1TU0B 3LAMA 1T9WA 4F36A 1GT8A 4F3QA 4Q45A 5FLXU 1T03B 3NL0A 4DUZF 1HQ2A 5KG5A 2FPHX 5D77A 2AT1B 1HYSA 2UV8G 2FJWA 2BE9B 2WSEC 2HWTA 3UNGC 3LP1B 4J9MA 5BR8J 4KHRA 1RWNB 5HSPA 2VG6B 1GMVA 1QTNB 2EWHA 2N7YA 1TP7A 4KGVB 1IVZA 1FI4A 5DO2A 1S79A 2X3GA 5GAGU 1QSLA 1FJEB 4LSNA 2DR5A 1S6UA 5KOWA 4O44B 1KWMA 3DRSA 3VGVA 2G0CA 2DEJA 2KI2A 2OHDA 4HR2A 2FJVA 2HURA 2MKHA 1T05A 3FVYA 1RB0A 2R2RA 1CULB 5IT9Y 4U7CA 1L3TA 2FGOA 4NOHA 1FKPB 1EP4A 4ZKAA 3PFEA 4CLZA 4FZVA 4RNNA 3T1HF 1ZZNA 1UVJA 3ZZZA 4WP8A 4TVAB 5EGYA 2NZ4A 3TJ8A 4KYZA 3FBCA 5ETOA 2J76E 4XPEA 4ECXA 4FPIA 1TMMA 3BR9A 4RUBA 2XY6A 2CWKA 5ETNA 4DZ6A 4A8FA 3D4JA 3VR1A 2DNKA 3JTPA 2XM3A 1L5UA 3AA9A 1RT2A 1OY6A 3FBBA 4ES2A 2Z58B 3I5AA 2HK3A 4PXDA 3JAMU 1S5ZA 5DGBA 2RB7A 3QATA 3CMAS 3IAM9 3QZ8A 5RUBA 1UFLA 4RL1A 2F8HA 4YUDA 4GO7X 2HFNA 1Q7LB 2WK4A 2NQPA 4D3GA 1T94A 2OMLA 3CWJA 1ULRA 1RXOB 1UVMA 1Z4UA 2E1MC 4A47A 4IH5A 1HQUA 3ENVA 1PJ7A 3MHYA 2NUHA 1FRLA 4DR4F 1H74A 1KD1T 1FDBA 4TLQA 2DNPA 1O51A 4ZCKA 2MQPA 3MDFA 4LF7J 1YBTA 3UN5A 4DV5F 1K0VA 4NLUA 1RT5A 2XMTA 4ZPWR 2HS3A 5I3PA 5DG8A 2VFVA 4OX7A 3PHEA 4CH0S 3MCMA 2MYFA 4RNFA 3NG8A 3R7SB 3CSKA 3SV3A 4J9QA 2FJDB 5F9NA 3D6FB 4C8ZA 1BD6A 3AH6A 7AT1B 1VHFA 3CCSS 3DDKA 4R5PA 2QV6A 3QRQA 4Q2LA 3MMBA 3GSIA 1FRKA 2HGLA 3TZXA 5GVQA 4Q0BA 4JI7F 4DL3A 5J2QB 1NB7A 1RT1A 3GIRA 4EZ9A 3DRXA 2IC3A 3TUPA 2GJ2A 2IA6A 1TKXA 1W2BR 4DN0A 4JYAJ 4B3SJ 2V8GA 2BACA 2W9BB 1NJWA 4RU2A 1RWKB 1IWAA 5LT5A 3HVRA 2DK2A 1FK9B 2FLOA 1FRIA 2ZWOA 4W4MA 2OPRA 2RSQA 3SQGB 1IJFB 1U02A 2C1EB 4NLRA 3M32A 3P6YC 1PIEA 4B3MF 2CPHA 1K8AT 3U27A 2ACMA 1VQPS 1LEOA 5ETMA 3M6VA 3BM7A 3Q2TC 5DQHA 2YNGB 3VWSA 3T41A 4CYUA 2DIVA 4RJVA 4LVOP 2FIUA 4RW6A 1IQZA 4ICLB 3O5TB 3ZZOA 3R9LA 1RT6A 2WONA 3MEGB 2KHCA 3DRRA 1FE4A 3T1HJ 5D4PA 1RQ0A 3IS9B 1S48A 3BDPA 3QWPA 5CABA 1NH8A 2RRAA 5KG2A 4IO9Q 4IKAA 3QJPA 3A8EA 2KT2A 3NNAA 2FVSA 1DJ0A 3AD9C 4NLWA 3S7RA 1MMDA 2MKCA 4GVLA 1WUUA 5HQ8A 3TAPA 1B0TA 4A48A 4J5OA 4CI0B 4TXSA 3FMWA 1HWKA 4C6AA 1PBAA 4YR0A 3VAJA 4DL6A 3PYEA 2L9NA 2D1CA 2L9DA 5IT9U 1MNEA 3FZ2A 3TRGA 3PEJA 3PIOQ 4LR7A 4C8YA 1U1LA 3HHDA 3TQ1A 4KPCA 3S01A 1RTIB 4L3KA 3IR7B 3CJ4A 3CCZA 5C24B 3OD2A 2OPQA 2HYIB 1OY8A 4LF6J 1S9FA 4DR4J 2DY9A 5HVGA 3KLVA 3OTCA 3RYLA 1IBLF 2ZD1A 4F4YA 1ZAVA 1TL7A 3BB5A 4F4AA 2B7CB 1KDNA 1WHVA 2QLWA 4FKYA 5KT6A 3M8ZA 4ZIWA 3E01A 2RDDA 1Q8IA 3DXSX 4OYOA 3E2EA 2OTJS 2ABYA 4USHA 1KFDA 3CC2S 1RACB 1CJVB 3KTQA 2L08A 2W2PP 3AQPA 2Q43A 1Y7PA 3BQ0A 4JI7J 3GJTB 1CQNA 3T1AA 3OL7A 3DI6B 1UEUA 3BGOP 3OXGA 4J9LA 3FSIA 3L3CA 3EXCX 2R8GA 2HHHF 2IM2A 3PR5B 3ULHA 3NEKA 3OR2A 3SV4A 2PA3A 2CQ0A 3TR5A 3BREA 2DR6A 3DMJA 2QMUB 2CZ9A 1AUSL 4Y2AA 3MR6A 4KGKA 3HVTB 2KZZA 1NZAA 1XR7A 4LF1A 1WOPA 3ILLA 4S0MA 1RK8A 4OX9J 3OVSA 2LXUA 1YJ9S 4B3MJ 1U1MA 1NHVA 4JB8B 3HHLC 2K1RB 2EI5A 3GV7B 3OV7A 2XMJA 3WIUA 2BV3A 4A8XA 1R8HA 1NKCA 3ZZUA 1C4AA 1PBUA 2B0GA 2HQFA 1A6LA 1HBUA 2ZM6J 4KV8B 2N7CA 2D3UA 3R6LB 1ZTTA 4G3IA 3J7A1 3IG1A 2IYIA 3AOCA 4DR7F 2V2ZA 1VIXA 1X4EA 2HHUA 3OBIA 1D9AA 5F9LA 2YKMA 3OFEA 2EEYA 2B6AA 1FD8A 3PM9A 2RAQA 4UOFA 2A18A 3CO9A 2AGPA 1ZM4A 2MGZA 2HNZA 3HI9A 1REVB 2RE1A 2NSBA 4PCQA 2D3ZA 3FEYB 2M70A 4C3LA 1WOOA 3O6QA 3VV2B 3MD1A 4ZMMA 3R5GA 3MFIA 2CZVC 2E1CA 4NZ0A 3UWTA 1WHXA 1FFSB 2VB6A 2J5AA 2DO4A 4WFBQ 4C8LA 4M63A 1RU1A 2K3KA 3KLIA 3WIVA 4NE9C 4DFKA 3Q8SB 2JH3A 3TZZA 3UCGA 4ZHRA 3KK2B 5GMEA 2HIQA 4N76A 3UDEA 2B5JA 1DURA 2YNFA 1PC4A 1C1BA 4ETXA 3DOMB 3VGTA 1YITS 4Y2MA 3JSRA 3PRVA 1JXVA 4ES1A 3ZXWA 1S77D 3AFGA 3OUYB 5D0EA 3CDEA 3LANA 4M5DA 2ZVSA 3NBPA 2W2NP 3BO4A 4PG6A 1LW2A 2XGQA 3MOZA 4ZPDA 3CD5A 3RU0A 2CQCA 1UJ6A 4WIQA 4DLEA 3H5UA 3M8WA 4ZP8A 3M2RB 1UEKA 1UPPA 4CO2A 1XNQJ 2MKJA 2J0WA 2W1BA 1VLYA 2DISA 4DZDA 2IM0A 5K8NA 2F5GA 2K3IA 1TFWA 5JXSA 4NLYA 2PO4A 3J7YI 3SSRA 2HWIA 3MUVP 4TY8B 1TK0A 3RTVA 1YRXA 1Z2LA 2XQCA 4PUOA 2XY7A 2J8AA 1PO6A 2YKPA 3ILJA 3MECA 4A8WA 3MMCB 2D9OA 2RDIA 1Q81T 1X4FA 3NS5A 4PG7A 2BKOA 3GB0A 4NLSA 3MM8A 1KVIA 1TAQA 3CDWA 3K58A 2DH8A 3IM9A 4ELVA 2RHQB 2ZKUA 4DG1B 5DM7Q 4FYYB 1JLFB 4NLTA 2R3VA 2NLWA 1HBOA 4JV0A 2KL8A 4LFAJ 2WB1D 3CDUA 1S9GA 3TX8A 3D67A 4WE1B 1GEHA 4IQMA 3EVMA 5LM7E 1N36F 1N33F 1U1NA 4DX7A 2IJRA 2R7QA 3MR2A 4ED7A 3U1MA 3LH2S 3IBCB 5I3UA 2XI2A 2B4VA 2R2UA 1PG5B 3I4HX 3OSPA 3C46A 2MKYA 4NASA 2FGCA 4DR7J 3DOKA 2ROPA 4WF9Q 1ZOTA 3BYRA 3VAHA 2DEIA 2V5HG 5FD1A 1RAOA 4RZRA 3EZUA 3KUHA 2PEHA 4HHHA 2QSWA 4QBUA 5C2CA 4QWAA 3G6YA 3CTRA 3FK4A 4RNOA 3SDEA 1SKUB 1N5YB 4NXMF 3EPGA 3C8YA 4HACB 2J0QD 4QYZJ 1SJQA 3GV5B 3GFZA 1X5SA 1FX4A 3QLHB 4X64J 2RU3A 2BYCA 4LRCA 3I0SA 3CIMA 4KC5A 3J7ZT 4WXWA 3W2WA 6FDRA 1UP1A 3IWXA 4X62J 2XMAA 3NCRA 4DV7J 1ZH5A 2EBEA 3HLUA 4DXLA 2HS0A 5IT0A 3P45B 4WTYA 8RUCA 2GGPA 2XCPA 2PE8A 2CPDA 1VRTB 1DLOB 4Q8FA 2ACYA 1N88A 4J9KA 4CZCA 3KHGA 3KKFA 2ROEA 3U1NA 4OYAA 1LKZA 2HWHA 1VC5A 4N7TA 1BQNA 1K1QA 1T03A 1S1UB 1RZMA 1KOOA 2RNEA 3ELHA 1Z1ZA 3DLEB 4DEZA 4N8NA 4OZ5A 3BBCA 2E9RX 3SI8A 3MTKA 3GLJA 1TK5A 2P9EA 4WFXA 2MSSA 4L3NA 2FZKB 2KHDA 2KFYA 3QSYB 1Y3JA 1TUGB 5J2NB 2WVFA 1HHQA 1HI8A 3KLFB 3K59A 3BKFA 2E5LJ 3VTIA 2O3DA 3VAKA 3QT6A 2ZH1A 2GJIA 1PKUA 1AUDA 2C22A 2CJYB 2FZGB 4DQPA 2HFSA 4HI1A 3W62A 3M2UA 3MPUB 3U02A 1UEVA 3R5CA 1NK4A 1KVKA 2ERRA 1CC7A 4B3OA 5LSLA 1RT3A 2G0JA 3PV8A 3C2PA 3VZHA 1KQSR 2QFIA 3H2LA 1ZPWX 2N3OA 3N6NA 4PXBA 2KB2A 3S6EA 3MUMP 3I4PA 1C1CA 2WVEA 1UW9A 3OVAA 5ITHA 1NK8A 3R5JB 1VC0A 3QRRA 1N8RT 2JOQA 2FY1A 1V9OA 2A2CA 1N32F 4EO8A 1IBMJ 3Q8PB 4WFNQ 1RTJA 1LOUA 1N36J 3PW7A 4YEAA 1RBAA 1HNVA 3EGZA 1N33J 3IGVA 2CG8A 2DIUA 1T3OA 3I96A 1SL2A 3M8QA 1CJTB 2JWNA 4XPCA 2VBYA 5B0BA 3PRDA 2R8JA 2P8IA 1RAJA 3BYPA 4C7QA 2G9OA 3V5RA 4C8OA 4KKOB 3C6UA 4B3TJ 1MU2B 4U67Q 2VONA 2CPXA 1U1PA 2HZVA 4OZ2A 1Y0HA 2AF6A 4OZLA 2C3UA 5H1SV 4MIAA 4NXMJ 4CM0A 3BGRA 2DH9A 4ID8A 4YB1P 5HVFA 1N48A 3N5FA 1JNZB 1XMQF 1S72S 4XAKA 4H4OA 2ZUAA 3FGVA 3T1YF 2VJVA 1RTZA 5LMNF 5LMUF 4QR2A 2VA3A 2E1AA 2DHAA 5B0EA 4XTTA 4NLOA 3GJSB 3ENAA 1QVGR 3DU5A 4QYZK 1JLEB 4NLPA 3F44A 3CCVS 2HZCA 4I0WA 2QLJB 3CW2C 4K0KJ 4X65F 1RADB 2AP6A 1U6BA 4C0BA 4OV6A 4RW9B 4DPUA 1PGZA 3FZBA 2B4UA 4HEA9 4WBFA 1M1GA 3L4BC 4DV3F 2NPIA 2BOAA 2AMCB 4PKDB 4LFCF 1K9MT 4HHUA 5EWEA 4UY85 4PR6A 5GADI 2IFXA 2WBRA 5H9EJ 2ZE2A 3MAQA 2XBPA 4OI6A 2HIYA 4N5SA 4YDXA 1NPRA 2JDJA 4O4GB 3V4MA 4DPOA 3OTEA 3MM5B 4P73A 2M88A 1L3KA 1RA7A 4RKUC 1VJQA 5D8HB 3TYTA 1X4DA 3SCKE 3PRBA 2PIIA 3BO3A 4EYIB 4LRBA 2GMHA 2XGPA 5HI7A 2FDNA 3DU6A 2PMZD 4ICLA 2AQ4A 2Y1JA 2UXCF 3HJFA 3A8JA 3LWLA 1CJKB 1NM2A 2GHWA 4DJBA 3ZNUA 3TZYA 1OQ3A 1Q86T 4CO0A 1F5AA 4YN3B 1SJRA 3NKYA 4K4TA 4NWBA 3W66A 1RYRA 4QOTA 2XG8A 3RB3A 1SJ4P 1RWMB 3EYZA 4XDCA 4B02A 4K4WA 1FX2A 1RKIA 2AJQA 3HXMA 2O5DA 2PC6A 1LQ9A 1WG5A 1F3FA 4C97A 3QRPA 1UL3A 2OMOA 2W9CB 2V2KA 3Q8VA 1SQFA 1PYOB 2WW8A 4J9UE 4B9VA 3QGIA 2QA2A 4J9NA 1IKXB 1I6JA 4FF3A 5IQ6A 1VRUB 4ZVUB 3AODA 1SVDA 1LW0B 3TJAA 1VQKS 2QO3A 3L7PA 3M9MB 3T6BA 4JV5F 2VV5A 5LJ5Y 1VRQC 2OPPB 1REGX 2B43A 2PD1A 3M6XA 4U7UD 1DTQB 2OFHX 4CO5A 1XJWB 3BO2A 1SC6A 3R3TA 2R7TA 3PR4A 1FF2A 4QZVB 5L9XA 3CJ8A 4N8OA 2RD5C 8ATCB 3CVKA 1HPZB 2CQ3A 4QIVA 3DLKA 4OIXA 2X1FA 4PYDA 4CO1A 3MWBA 3GE9A 3GR1A 4C0HA 2DXEA 3MPYA 2RQKA 2LEBA 3IGNA 3PKYA 2QTWA 4HTJA 3K8WA 5LMNJ 3QSIA 4KB7A 2HVZA 5LMUJ 1YI2S 1WHYA 1S1WB 2Q66A 1U1RA 1AW0A 2DCLA 3VQTA 4KTQA 1PSDA 2M2BA 3NGRA 5KFCA 3DI6A 3KFWX 1VLOA 4QCLA 3PNIA 1AROP 5A8WB 1B64A 4X65J 3NGDA 4CIOA 3MZIA 1I1GA 4IG3B 3Q0AA 3CCQS 4A8QA 1WG1A 1ZYQA 3LGNA 1S1VA 2H5IB 3RGIA 3R5BA 2YQ0A 4DV3J 2HRYA 4OZJA 2CFXA 3DLBA 1DTTA 3CCES 4OYMA 4LFCJ 1XR6A 5THWA 4DR3F 4QW8A 1SL0A 1GTHA 2VFTA 4I64A 3ZO7A 4DOZA 1T11A 5J2MA 1RAFB 1KRPA 3FFIA 2G1DA 4IOCQ 5HBMA 4PWUA 5T41A 4CLKA 1M5OC 1HNWJ 4ZP9A 1GQEA 3GCWP 3WDOA 4EYHB 4DU8A 2QN6B 1BHNA 2DO0A 3LO3A 5GMKa 4WFZA 2CZ4A 3JTNA 2L9WA 3UDVA 3DC2A 3QGGA 3CF5Q 2MZSA 2U1AA 2JVRA 2VBXA 5H9EK 3Q83A 3MD3A 4KV8A 5M2RA 3SIPB 3OPKA 2UXCJ 3AXKA 3PY8A 5EUHA 4JV1A 1RAEB 4LSNB 1WD6A 3MEDA 2KYZA 3D28A 2CNNB 1TVRA 3DRSB 1R89A 3ICLA 1RWWB 1UWBA 2JEGA 3RR8A 2WTFA 4MT1A 2QGFB 3HMJG 4U8VA 1R0AA 1T05B 1RTHB 3TQEA 3MR3A 5KFOA 1JXLA 2ADBA 1EP4B 2OJ3A 1D9DA 2BXJA 2FHKA 1BC6A 2VC1A 2W4CA 3HULA 2ZHAA 3V2UC 4LFBJ 2F8MA 2ZJPQ 1MMNA 4FPRA 2Z30B 3AAWB 3GSDA 1HWJA 1V3SA 3AD8C 2R9LA 2R2SA 2AEJA 2OUGA 4GVBA 1RT2B 1XMOJ 2J8SA 3PG9A 1T8EA 4NL5A 3W1YC 4PPDA 3M2VA 4C3KA 3FKBA 1VDHA 1PJ6A 3DOMA 4JV5J 1V3ZA 4M8LA 4K5SA 2MZ1A 3EJMA 2D69A 5D0GA 4DF8A 4CH7A 3SEOA 1EQ0A 4JI3F 3CULA 4YFUA 2VDHA 1HWIA 1KKHA 5KG1A 2GIQA 5KFBA 3CMQA 1Q5YA 5F3TA 1HQUB 1KTQA 4MKAA 1SKSA 2GAHC 3ZC4A 3KK1A 4ILRA 2QE5A 3Q86A 1HMVB 2APOA 5KFFA 2BRLA 3QNWB 3P3DA 5HQLA 5KTQA 1RT5B 4KIAA 1WDTA 4F4WA 2HRTA 4NLGA 2ZH4A 3K5LA 2FHMA 4X4SA 1GAOA 1S9EA 3JSMA 4KGXB 2C2EA 3JTOA 4HKQA 1WG4A 2RILA 3QT8A 2AYEA 4Y2KA 3NCPA 2ILZA 3P5TL 4CLWA 5D6GA 3NS7B 1GXTA 2DY1A 2QC3A 2RQCA 4DCOB 5KFHA 2BKNA 4R5PB 4DV4J 4X84A 1FCAA 3N0VA 3MMBB 1KNZA 4Q0BB 4FXWA 2XY5A 2OELA 1ZA1B 4J9RA 1P1LA 4OLPA 1Q7YT 1EKSA 2CQBA 4TY9A 3OHAA 2I6WA 3CJSA 1ZTWA 5DG7A 4YR3A 5BYQA 4DR3J 3MM6A 4DFMA 1TKXB 5D0HA 4OZ3A 2OFGX 4DG1A 3NP5A 1D8YA 3LPYA 4O3PA 2JVOA 1BY9A 4Q44A 5JMNA 3MOJB 4ZVSB 1U25A 1M1HA 3G82A 4CLUA 2VUGA 3PHTA 2GS8A 4WE1A 2V2VA 2Y8YA 4LF2A 4BCAA 3V4IA 2P6TA 5KFUA 3AOBA 4M5KA 3M32B 2CUYA 2VBZA 1WACA 2OPSA 4Y65A 1U0SA 2KFNA 2PA8D 4CLTA 2HKEA 3PW4A 3LPEA 5K8PA 4UQGA 5CQGA 3T9ZA 4PABA 3WHIA 4I2QA 5CCMA 1P6TA 3US5A 5HK4A 2RQ4A 4DV2F 3D5MA 4K8RA 1QE1B 4CYUB 3GILA 4J7CA 3HP6A 2MZQA 1LWEA 3BSOA 2EK6A 4OJ1A 4RW6B 3A3OB 1RA6A 5HMWA 5A6PA 1HNIA 3QIPB 1CC8A 2DT9A 1RT6B 3UD5A 2WONB 4DQQA 2W24A 1Q95G 3DRRB 2YKAA 2OAUA 3BR8A 2QYCA 1OS5A 4JI5F 4IRDA 1FFGB 1BLUA 1NKBA 1W26A 2GIRA 1BXNA 1OO0B 4WWSA 3DDNA 4KAIA 2HHXA 4NEZA 2AX0A 4QJVA 1TL5A 3L95X 2EKNA 4ZVHA 4FXVA 1XIQA 2PI4A 3EGVA 5AJ3F 2HQIA 2G2OA 2MTLA 2IBKA 5IV3A 2QX0A 2UUCF 1ZA2B 2ALZA 2DGTA 5K8OA 3IXQA 5J1PA 2FHJA 4ZN1A 2LQBA 4ES3A 1R8CA 2Y8WA 3MR5A 1VRTA 1DLOA 4XO0A 1VISA 3MF5A 1LFWA 1N6QB 4A8YA 4OHYA 1U4BA 4MIBA 1NJXA 2NR0A 2LXIA 2GQCA 4ALZA 2ZD1B 3DLEA 4ED8A 4DUYF 3ETOA 2CXEA 1QAJA 1FRJA 3D0IE 2J9DA 4DPTA 1Q5VA 1Y5NB 1RHMB 1FKOB 4NA3A 1U7LA 2HLUA 2VQFF 1JJHA 4ZN3A 3LOUA 4K4XA 1SL1A 2BANB 2RT3A 1U09A 4M5JA 3MPDA 1CBKA 1R6YA 3A12A 1SJ1A 1FVQA 4R25A 2Z0GA 5C7PA 3AB4B 3SSSA 3W64A 2CAJA 2F4FA 2JLGA 2IMOA 2HVEA 2IHR1 1EARA 5SUHA 2PSZA 2J0SD 3GG0A 1R7IA 4NRUA 3M9OB 1UWAA 2BM0A 2WHOA 1RHUB 6AT1B 3CJ5A 3C14A 4RWWA 4CLYA 4ZJOA 5AXMA 2HAIA 4A8MP 5GMDA 4E0DA 2LU1A 5LL6d 1NSKL 3IC1A 3Q24A 3H2VE 4G1QA 2C28A 1FWPA 3DMJB 2MQ8A 4Y6IA 1RP5A 3HPOA 3EPIA 1RCXB 5M2PA 4IFYB 3CD0A 4QU6A 2E1PA 3QFHA 3D66A 4NMLA 1UAWA 1EB0A 5IXUA 3HFVA 4I1TA 1DAXA 1U8SA 1QM9A 2FD2A 3DNCA 2KVQE 4ZVEA 3H2UB 2NPFA 2HZAA 2P2CB 5CH7B 4C0OC 2NREA 2DPJA 5D4OA 2DHGA 3ZFVA 3T5HA 4NX9A 3IRWP 4IR1A 3UN2A 2ASLA 1N54B 3B78A 4O3OA 1Y00A 2QA4G 4DV2J 4ID5A 4D3HA 2ZHOA 1NSAA 2AV5A 1HBUB 1QSSA 4PXEA 3E8OA 3PYFA 2XZWA 1MU2A 3HHNB 1VI7A 2EK1A 2HMIA 3CJTA 2RIJA 3TI0A 3HHLA 4ZA1A 2OP5A 4QW9A 2EPIA 1S4FA 4O3NA 4F0HA 4OI2A 2Z2YB 2YKMB 1FDAA 4RLEA 3D0HE 2B6AB 5FDLA 3M6WA 4JI5J 2IIHA 3W8PA 4ZLJA 2FC9A 4C2MA 2R42A 2R7VA 1X4GA 1EX8A 4GKKF 2CQ1A 4AL5A 4W98A 3RBEA 4MMOA 2LQJA 3SCLE 4MFBA 1D9FA 2XULA 3MMJA 2UUCJ 5EWGA 2KU7A 3H40A 4ZVQB 5ETKA 5AT1B 3R8YA 1T95A 2HQCA 3KLIB 3R5AA 1S10A 2QLBB 4CO3A 1MN9A 4ZHRB 4ZOSA 3CPWR 3H42A 2Y1IA 3N6MA 1N56A 1M5HA 1JLCB 4RW9A 2HHSA 4RW4B 1M5SA 2YNFB 1T7PA 1C1BB 3LALA 5EX0A 2V67A 1HI0P 3MCNA 1U6FA 1HNZF 4I67A 4OZ1A 2IM3A 1NDCA 4X4VA 2AWZA 2F3JA 4DUYJ 3D54A 3W5ZA 3NGKA 4M5DB 4ILMA 1UA1A 4IG0B 3NBPB 3T5JA 1QAYA 1LW2B 1X4HA 1RWPB 2N82B 4ETZA 1H7WA 2ATLA 1IKYA 4Z37A 3WC2A 1F60B 4ELTA 2DR8A 1FRXA 3ISNC 4WXOA 3MM5A 3GG1A 1MLAA 2D3O1 2B51A 1RAIB 4F8RA 4W90B 2CVEA 5U47A 3Q8RB 2FZCB 1RWOB 4N41A 1WEXA 2HBYB 3PX6A 5DDRC 3M8YA 4GKJF 4LSZB 4OFZA 3NMRA 2BOPA 2HHWA 1CS4B 1TELA 5A8KB 1NSPA 3PDNA 2LU2A 2VZ9A 2VQEJ 5KG4A 2YX1A 2V69A 3MECB 1HBMA 4MK9A 2XYGB 4LF4F 2GW8A 4TN2A 1OJ4A 4NYOA 3V6HA 2HPUA 4FVCA 3KLGB 2GQQA 2RJZA 2G2ZA 3MM8B 3RW7A 5DZ7A 4RNHA 3M8RA 2R7RA 3SBMA 5E3QA 2UUBF 5F41A 1J2VA 4P7VA 2AKWB 5KAKA 5E3CA 3I82A 2YY3A 3ZTQA 2WSFC 4FN5A 1F5CA 2DH7A 4DV0F 4ECUA 2W7AA 2VOOA 4BBYA 2XMWA 3LP0A 4X4TA 2CQPA 3CXCR 1C4CA 1S9GB 1B99A 4CTAA 3VHQA 5L1KA 3CJKA 4P75A 3TP2A 1J5EF 3JYTB 4I6AA 4KPYA 5SZTA 4K59A 2CPIA 4RUAA 4UUXA 4G6VB 2LVWA 3BN7A 4N47A 1P1TA 1GXUA 5B08A 4USTA 1S4EA 5I3UB 3E51A 1FEEA 4DR2F 3JSYA 3HK2A 4LBPA 2SXLA 1VYAA 2FC8A 2J0XA 2XMUA 1YHQS 1DTQA 3DOKB 2CJBA 4QQBA 2CG4A 3KDNA 2VG7A 2Y0BB 3O44A 2QSFA 5F8MA 1X7VA 3R5DA 4C9DA 4DSEA 3QWUA 4C11B 3QPIA 4URSA 3BJYA 3FCWA 2Z2ZA 5DDQC 3HHEA 2BJ1A 2B9WA 1T0TV 3SDEB 3CJ2A 2NS1B 1RTDA 1R6VA 4LF9J 2FVQA 5KOXA 1TAUA 4GRSA 2JEIA 1E6YA 3I5CA 1G7CB 1FDDA 2AYBA 3HHKA 2VL1A 3I0SB 3SFUA 1O8BA 2F65A 5KFAA 2E7WA 3HDSA 3H8YA 2QFJA 3W2WB 5AE3A 2W2OP 4YS2A 4PYAA 5A8WA 2HFZA 1WTFA 2ZWPA 2Y3YA 5L1LA 4IG3A 4EUVA 4PG8A 2I5JA 4P74A 1WORA 2GGPB 3PX4A 1HNZJ 4UZBA 1VS3A 3DGVA 1NLKL 4ZP6A 1S1TA 5G4DA 3DXBA 3OQ2A 2G1HA 2ROGA 5DRKA 3V6JA 2YVSA 1N4LA 4KGMA 4K4VA 1X0FA 1GXLA 1BQNB 1YX2A 4LSLB 4RU9A 2FLPA 4EMDA 5E0OA 1QSYA 4FDFA 1U48A 3VAFA 4OI4A 2YKNA 3THTA 1P8GA 1S97A 1QJHA 4Q2MA 5E41A 2LQ9A 1K73T 1FXRA 3DCAA 2UU9F 1ZBTA 1OSDA 3CT9A 1TK8A 1TUWA 2MKKA 5J1EB 1MSWD 1LK7A 1JJCB 3QGPA 4JI8F 2EFNA 4L74A 5CZXA 3EE3A 1MWZA 3CJRA 2KDOA 5KFVA 4Z7CA 3IRXA 2XMVA 3RRHA 2W25A 2J7KA 2M0GB 3K5NA 2BW2A 5HO4A 4X4QA 3G86A 1Y3KA 2AZ3A 3G6VA 4TYAA 4R8UB 2DGQA 2ZNYA 2CNOB 4LF4J 3M2UB 3VALA 2JX2A 1RTHA 3N28A 1FEHA 5CA5A 3DM2B 4B3OB 2QZ8A 1RT3B 1BE4A 3K0JA 4YOEA 2NSCA 2UUBJ 1CSJA 4DV1F 2BM1A 2B9XA 2Y1LB 5F8HA 2E66A 1C1CB 3FSXA 3NAIA 2OLWA 4DV0J 4AE5A 3GIJA 4PRFA 1VR6A 1OQ6A 2BJEA 1VC6A 3PJ9A 1RISA 4DHVA 2VBWA 2HVIA 4C48A 2J6TA 5IQQA 1J5EJ 1RTJB 2ZOFA 2PI5A 5KT7A 1HNVB 1RLCL 2LQ5A 2LLZA 1HBNA 4ECZA 1CPZA 4WYWA 5KFPA 4DR2J 3H0PA 3M8QB 3NS6A 4KR0B 2GX8A 4L75A 1LXJA 1WI6A 4F50A 2QLFB 2ZZMA 4USWA 2VG5A 2X1GA 2UXDF 1WC4A 4KRWA 1H98A 2EC2A 3M8PB 4R0EA 3C6UB 4Y3CA 4YB5A 2HLTA 2Z2MA 4I7FA 3C66A 3DLLQ 1S6PA 3ONQA 3MR7A 3NGUA 3OL6A 1HMVA 2OGUA 2O1PA 4K4YA 1H72C 1YRUA 2DHSA 4DLGA 1M90T 4I2PA 2JNJA 4DL0C 2Y1RI 1OPZA 2RS8A 4WZMA 1HD1A 1HNXJ 3BGRB 2F63A 3GCXP 1VCTA 5DJBA 1QAIA 2HS4A 3GIMA 2XYPB 1LWXA 2EXUA 1D1UA 2FHOB 4H4OB 4F67A 2XSJB 1RWVB 4V19X 2OTLS 3THVA 1CJUA 3ZZRA 1S6QB 4K4UA 3M7VA 5KG7A 1LWCB 3CCRS 4P7TA 4JI2J 2AJ2A 2D74B 2JC1A 2WBMA 3R7NB 9RUBA 2DGVA 4B9UA 4ZPAA 1A9NB 4NI2A 1UCNA 1Y5IB 5IC6B 2RKIA 2K7JA 2MQNA 2UVWA 3K2YA 4IRCA 1SI9A 5T14A 4CO4A 2E5HA 4F04B 3ZZTA 1SJFA 5DS7A 4DSIA 4OJGA 5KFZA 4RW8B 2N4CA 4F7VA 1X5TA 4DUZJ 1RABB 4U6PA 4IDKA 4ECWA 2AGQA 1VQ6S 2W4DA 1SXLA 5E3PA 4WU3A 1NZ8A 4PZVA 2ZE2B 4AL6A 2BJ9A 3O2IA 1H73A 3X3UA 4I68A 3QBCA 3FUYA 2K06A 1WKJA 3BN4A 1ZZFA 4DI6A 2DRBA 3C16B 2UU9J 2KJWA 5A8RB 3Q2SC 4DS4A 2XMMA 1RHKB 4WFAQ 3FRYA 4KO0A 2VJUA 1NU4A 2YXLA 1QE1A 4NCGA 1DZ5A 1VQNS 1NO8A 1X4BA 3QIPA 5KFLA 5CZVA 3D1HA 3ZZPA 4EZ6A 4FKXA 2WSCC 2FYXA 3P5BP 2E5IA 4DX6A 4ZCIA 4DV1J 3GIKA 2KT3A 2DRDA 1R27B 4J9PA 4IO1A 3RAMA 3M30A 1WNEA 2WB4A 5HMZA 1CQMA 1JWWA 5AXLA 5GADU 3SXLA 3FJ2A 3R1HA 5F8NA 1IN0A 2XLIA 2G2YA 3I0RA 4M5HA 3G4SS 2H51B 2UUTA 1K1SA 4H4MA 3VAIA 3GFYA 1IM6A 1Z2ZA 2H3EB 4MYUA 5KFMA 2MHNA 2CDRB 2UUAF 1JKHB 2QIFA 3TA1A 2ZITA 3CCUS 4QIFA 1L3VA 4IQXA 3HJVA 4MKVA 4DR5F 2CRLA 1CEZA 3WZ0A 2UXDJ 1N6QA 2VD3A 1YLXA 2DNYA 3HX9A 4ANDA 1ZETA 1BGXT 3QMQA 1Q79A 1VFJA 3GFXA 4ZPVR 2Z4PA 3D6TB 2JSXA 2PMHA 1IM4A 4DV5J 1WF1A 2IJNA 1FKOA 1S6OA 4O23A 3B54A 3IO1A 2RHSB 2H1YA 4EGLA 4WFYA 1HWLA 2KXNB 4DN9A 3G71S 5KT4A 4J91A 2BANA 3L7OA 1Q53A 4ZVOB 3W65A 5ETRA 3D6HB 2E5GA 4DDFA 2VFUA 3DLKB 2FJXA 4Q7AA 2UUWA 2N3LA 1S49A 3G6XA 3AOAA 2DRAA 1S0OA 2P5VA 4HHJA 3HD2A 2Z57B 3HFKA 5KFSA 2G0IA 1N0VC 3UFCX 4YDDB 2ZBPA 3CCWA 3I56S 2BABA 4PWWA 3A8IA 2QT7A 1TTHB 1BWEA 5EN1A 2RH3A 1S0VA 2RU9A 3GZ7A 3GYXB 2C2MB 4NMXA 4NZ7A 2IPOB 2XO6A 1Q8BA 1S1VB 1XERA 1F0XA 2OEMA 1M5VC 1FD2A 3NLCA 4IFVA 2C2DA 1DTTB 4IFYA 1VQYA 2A6MA 4QWDA 1HFEL 2KYXA 2JJ4D 2J9EA 4DSFA 5J2MB 1APSA 5EX3A 1HQEA 3FFIB 4FBTA 3KG4A 5HBMB 3EMTA 2F9DA 1VQ9S 1GNKA 2KM8B 1HL6A 3HVAA 3QAEA 4OV1A 2CJQA 1KVJA 1RHRB 2A1BA 4HT7A 4AXJA 3UD4P 3RR7A 3RJMB 1NMEB 1L3UA 2OSRA 3BKUA 2HHPA 4RUHA 1HHSA 3EVWA 3U7JA 2XZDB 2UVRA 3KNAA 3MEDB 3OVBA 4HLBA 1TVRB 3W9IA 1ZM3A 5DLGA 3TVYA 4DU7A 1IKVA 2HFOA 2R7XA 1UWBB 2DGUA 4F2RA 1FTRA 3KK3A 3UI3A 4AL7A 1SUQA 5HLFB 1R0AB 4M5GA 2QL9B 3W7BA 1JLGA 4BC7A 3TOQA 2IAJB 2FQQB 3H5SA 2POKA 1KLNA 3A4TA 1YRTA 2GHVC 3D2WA 3IWNC 2PT0A 2VHGA 5M2UA 3GQCA 5DQGA 2D3OR 1PAUB 3FRZA 1NRKA 2F9JA 3OT9A 1ZM9A 3DDIA 2YQ3A 1NK7A 2ZJQQ 3CC7S 3BBFA 2BE7D 1SKRA 3EGNA 1PYSB 3CDBA 1AT1B 1IBCB 4LF8F 5B0CA 4DFJA 2QA4S 1FXDA 5KG6A 4DR5J 4GVBB 4YMEA 1UVNA 3LA0A 1JLCA 4RW4A 4UOCA 3AY0A 4PWDA 1H2VZ 1WC3A 1EETA 3M2VB 3NAHA 4ANEA 1R8PA 3PEHA 2CNLB 3A3NB 4RBVA 2HVDA 1IBLJ 2IDLA 3UPFA 3O8WA 2HG4A 4IG0A 2ASJA 1TMJA 5LJ3Y 3HT3A 2XSFA 3R2CJ 2LP4A 1RLDA 5BYRA 1KLMA 2XC9A 1FWKA 5F0UA 4X66F 2W2QP 5CAAA 3UD3P 4LUBA 4ECTA 3DYAA 3KK1B 2GC8A 3CB4A 5ETLA 1DQ9A 4UT4A 1NJZA 2MMYA 4KE5A 1VQOS 1RT7A 2YNIA 1S9EB 3JSMB 3HHLD 2NYIA 4B9LA 2AZ1A 2Q6BA 5BR8F 2CPJA 5B0FA 3KJFB 3WX4A 2DPIA 2V4RA 1B7YB 4ECSA 4HDGA 5AE1A 3CUNA 2JL9A 1CS4A 5A8KA 2OIHA 1B7FA 3J7AN 1Y5LB 2HHHJ 1RBLA 4OI3A 2MZRA 1UJ5A 3OL9A 3GYGA 2YTCA 1KR4A 4L73A 3FNNA 4WJBA 4ZCLA 2NXEA 3KLGA 2DYAA 2FLNA 1KHVA 5DG9A 3FEXB 4OYBA 3W8GA 1CG2A 2D9PA 3I31A 1KFSA 3MM6B 2JEFA 3KG1A 3WBZA 2JZ5A 3R97A 3PX0A 1J27A 3CDAA 1RKJA 3R7BB 1CLFA 1WEYA 4OJ3A 2X51A 3D6MB 2R7UA 1Q16B 1Y9OA 1OMSA 3G82B 4OMFG 5L46A 2R8IA 2DNRA 1T9UA 1S76D 4N77A 4DUTA 3JYTA 3D1OA 1UPMB 3V4IB 4FP9A 3PW2A 4BDPA 4IUFA 2CQGA 4U95A 2OPSB 4CRJA 3CEDA 2HHQA 1MMLA 1U2RA 1X9WA 1AZSA 3UN3A 2MJNA 4AXIA 2FTRA 4I2QB 5E3RA 3Q23A 4OI1A 4LQ3A 5KFKA 1LWEB 2ZH6A 1NPPA 3ITHB 2R8KA 4F4XA 2H48B 5L1IA 1HNIB 4EBCA 2W2MP 4C11A 2U2FA 1BUXA 1NHUA 4LRDA 1BQMA 2WOMA 2B4OA 2O01C 1N5SA 3G2XA 4OYXA 1RAHB 4K50A 2XB2D 4DSJA 3B82A 2CWXA 3MCOA 2AJ0A 5KT2A 1NK5A 1K44A 3R6GB 4PAAA 4A8SA 4USJC 2J6UA 3FMBA 5KFYA 5B0AA 3NWRA 1XBWA 3PYDA 2JC0A 4CCHA 4LF8J 4UZCA 4ED5A 1JLBB 5DLFA 1S99A 2VICA 4KHPF 2QYGA 3NOCA 1YDLA 2MY7A 3C6TB 1IQTA 1G6BA 3BSAA 4JV2A 2B56A 4K2XA 5DZ6A 3KLEA 2DR9A 1ICEB 1LFPA 5A0YA 3I6PA 2GVDA 5KFQA 1Y4ZB 4ED2A 4FYWB 3RZAA 4PQUA 2ZH3A 3BSCA 3JQKA 2HNDA 3N4WA 3KOAA 4NYPA 3ENQA 1KHWA 1LV5A 1JLAA 3FQLA 3T19A 2YNHA 1U47A 1JB0C 4X66J 2VPXB 4JYAF 1SKWA 4LSLA 4B3SF 3IWLA 4F3MA 4A8OA 4IYQA 2ZDOA 1UKUA 4G1PA 2Z8QA 2AJ1A 4QIEA 5I3QA 4ZLLA 3U1LA 1FVSA 4ED6A 5C2GA 5HMXA 2ZDPA 1NDKA 4DPYA 2KFZA 1H38A 1YBAA 1X8DA 3X1LB 5J1EA 1YIJS 3GMGA 1YG0A 4JUZA 3BPDA 5KFTA 2XTJP 1FNXH 1X4CA 1IJEB 3H20A 4BWJA 4FNIA 1VOMA 1EAYC 2RUGA 1KEKA 3FCVA 3HZEA 4R8UA 4PG5A 2X7IA 4NYZA 3C14B 2W7PA 5H9FJ 2CYYA 5A6WA 2XLKA 3DM2A 5KFNA 3W2VA 5D78A 2OEJA 1IWGA 3IBFB 1OYEA 4YB7A 3KJQB 2QG9B 4ZJQA 1X31C 1HWUA 4G1QB 4JI0F 4ED4A 3EUNA 1I5OB 5E3AA 2YX4A 1VQMS 1VIOA 3OJSA 3AJ1A 2I38A 2DGXA 1JXEA 2C2OB 1TV6A 4CP5A 1S59A 3OFGA 1TL3A 2RF2A 1LK5A 1NH7A 4DL5A 3M1VA 5LOQA 1H7XA 3G9CA 3HSJA 1UVLA 4B08A 2EC0A 2RRNA 3N79A 3J81Y 4O3SA 2RDJA 4ECYA 2BUNA 1VBKA 2YWHA 3LUYA 5C5JA 1SV5A 2OI2A 4JOUA 4Y00A 1FFWB 4UTGA 4HDHA 5CYQA 3M9NB 4BHQA 1SQEA 4MK8A 2BDPA 4DL4A 3MFHA 1U1KA 3J80Y 4KSEB 2KT5A 4ID5B 4QPXA 2ZZNA 4LRAA 4M1KA 1F9EB 1X60A 3NGSA 3M8PA 1PJ5A 1VQ8S 1HI1A 1WTBA 2YKOA 1RHJB 3SSQA 2HMIB 3HHLB 4AFFA 1FJCA 3RAQA 4OHZA 2YH1A 2ZH8A 4LF6F 3ETMA 4LT6A 3DLHA 2D41A 2GVZA 1JLQA 3H5YA 2XMKA 1RT4B 2X1AA 5FDLB 1GMWA 2M9KA 1KP6A 1JJ2R 3KUGA 3J7Z5 2V50A 3C19A 1PILA 4NLVA 2XSJA 2CPZA 5F8IA 5L1JA 5KFEA 1YJVA 3NGTA 2ZBQA 4HT5A 4F4KA 1PC5A 2C3YA 1S6QA 4EFAC 4KHPJ 2BQRA 4MFBB 3GFHA 3OJUA 3BQ2A 1LWCA 2CJXB 1RBOB 2ADCA 2UVUA 4UW2A 1YWXA 2NYHA 2DNNA 2XZTB 5KFRA 2CJKA 4EO6A 3PW0A 4QU7A 1E6VA 2R7SA 3AJ2A 2BQUA 1SCJB 1F5BA 4RW8A 4LJMA 3G87A 2VPWB 4P10A 2PMWA 2AGOA 1AA1B 2VKZG 1Y10A 4FYVB 1VJWA 2ILYA 4CLSA 1ZPVA 1AFJA 4NLQA 3TA2A 4E98A 3ZTSA 3LGHA 1QY7A 3GP9A 3R1LA 3C16A 2QA1A 4OX9F 4Y2CA 1IKYB 2LMIA 3PIPQ 1D09B 5A8RA 2EG1A 1W7WA 2UV8A 1P9QC 3GJRB 1YSJA 4M5IA 2ZBRA 2YWKA 1H0HB 2QJ3A 1FO1A 4V19J 2HFVA 4YB6A 4TU9A 2CPFA 2Q1LA 1SH3A 2KG1A 2R8HA 5JVGQ 2RMLA 2KVIA 2I0XA 2ZM6F 2XNRA 1N5VA 3JQMA 1UA0A 1SH2A 3TA0A 1CVJA 4ZPBA 2BE2A 2YWWA 3G96A 1HBMB 2IY5B 3L7UA 2C3MA 3TUIC 1ITPA 2MZTA 3F41A 4ZLPA 4JI0J 1ROFA 2V4QA 3MEKA 1YTYA 3G8SA 3FCHA 1U45A 1RAAB 2G13A 3D3BJ 3VZIA 3QAUA 3KMSA 3CMES 2DB1A 1N32J 5HMYA 5H9FK 1RYSA 5L38A 1D3WA 2M4MA 2QEXS 1KOHA 4F25A 3GYNA 3LP0B 4USKA 4NPOA 1NPKA 1TR0A 3TEHB 4ZVRB 5CYJA 1JKHA 3K5MA 4GMKA 4CTAB 5DQIA 3CJKB 3OFHA 2RUSA 4L72B 2MZJA 5KG0A 1RE1B 1UMJA 3CD7A 3PYGA 1G3OA 2KH9A 2QMXA 1X9MA 2DHXA 5DM6Q 2E29A 3DRPA 1WDDA 4RPFA 2MLXA 4IH6A 2A2DA 1RHQB 4LF5F 1C0UA 1UZHA 1NDLA 1URNA 3V6DB 4P2MA 2AYMA 2YWFA 2GCFA 4V1Ak 2H9ZA 1TFYA 3TW0A 2VG7B 3FDSA 4USUA 2F40A 3J81U 5JJBA 1U6ZA 3BH6B 1G2EA 2R7WA 2KO1A 2E7XA 2GHPA 1A0OB 3MM7B 8AT1B 7FD1A 1XMQJ 5AE2A 3I32A 3HO1A 1MN7A 1B4SA 1X4AA 1RTDB 3J80U 4KJIA 5DGAA 3TVKA 3T1YJ 2MKIA 4ECVA 2XCAA 1E6YB 3ZZ0A 2DNGA 4RW7B 1Q0NA 2A10A 1XNQF 1KTVA 3BGLA 4HL9A 3Q22A 2OD6A 5ETPA 1NXIA 3VVTA 3H4BA 2ZC3A 4P2SA 1NK6A 3BF4A 1ZM2A 2GNKA 3IAS9 3RB4A 2V2QA 1MG7A 2LCWA 1DFDA 1M0SA 2WW4A 2I5JB 3ZZYA 3AHPA 4F2SA 4O3QA 1I51B 4EU0A 4I56A 2Y9HA 2GQ2A 4CLPA 2V94A 2E44A 1FHTA 2NXUA 2EG2A 1UW4A 2XS7A 4WU2A 2H54B 4CLLA 5FIIA 2GFFA 1RI7A 5GAHI 1S1TB 3HM9A 3W63A 5JUMA 2PGCA 5E7OB 1FNMA 2P9GA 3IBWA 1WC6A 1XMBA 4NEYA 4KH1B 2CQDA 3HKZD 1Q8KA 3KLHA 1WC1A 4BS2A 3F73A 3FEZA 4RNMA 4OX6A 1TQLA 2B8PA 3AJDA 3S8SA 2M5YA 4RWXA 1H2UX 1YJRA 2VODA 4LFAF 3HSGA 5HN0A 4FVMA 5IC4B 3I87A 2YKNB 3UR0A 2W7OA 2IVYA 4QWBA 3J81j 3N5BA 3QYYA 4GC6A 3WX8A 4FXDA 2YH0A 1GH8A 4ZPCA 4AYBD 4X4RA 5CYMA 4NLXA 3IRXB 4OYWA 3KJVA 3H4DA 3R27A 2EFVA 5HP1A 3UW1A 1QD1A 5HLFA 5CXTA 1HR0F 4USMA 3NXZA 2IAJA 3OXLA 1SIZA 5CHCB 4LREA 1Q4RA 3ET6A 3POTB 2YKQA 4ZLNA 3E3XA 4QIGA 1J5OA 4CT8A 1S7HA 4CLFA 3ZNJ1 1TZ0A 3MMAA 2GMJA 3K89A 2QL7B 2PFFB 3HKWA 5IV4A 4X64F 5D0RA 3M4XA 3RBDA 2AU0A 2V63A 4CWBA 4CH1A 2HBRB 3WQPA 2EFQA 1NAQA 4B9MA 4BLGA 1V3RA 2KN4A 1HBNB 5KFGA 1G1XA 3GTYX 4X62F 3KMQA 4DV7F 1N34F 4OL8A 4L76A 4LF5J 4CNZA 2BJDA 5KFWA 3VQSA 1WI8A 2VG5B 1WKLA 5MAOA 1ZAXA 2C2KB 2J6SA 4DPXA 1IUJA 4LR9A 2KRBA 4J9SA 2EVZA 5T7LA 4I7FB 1S6PB 2E9ZA 5ETVA 2FJEB 1IXKA 3DOLA 3TEGA 5C42B 4I2PB 4FBUA 2W4PA 3QQCD 4B3RF 2HNYA 2MHEA 2MB0B 2O66A 1FA0A 4LR8A 5K14A 5E33A 2AYGA 2R4FA 4OYIA 3WC0A 1SB6A 2KXHA 4K2JA 1CJUB 4MKBA 4ZDNA 1U8WA 3T3FA 3V81A 2E5LF 1C0TA 3SMZA 3BV8A 3EX7B 4IOAQ 2RS2A 2EFPA 3MXHP 4CQ1A 5K9FA 3G6ES 4U8YA 3N6LA 2RQMA 4NI2B 1FWLA 3PJXA 3CC4S 2VF3A 1XNRF 2RKIB 5DDOC 1U26A 5IWAF 3D1QA 1KONA 4XDDA 5IZHA 1B70B 2QLXA 4Y2IA 1U49A 2MEWA 4B9TA 4FYDA 5C25A 2HK2A 4WK3A 4CM2A 2CPEA 1RAGB 5AXNA 2BBEA 4J9VA 4CT9A 4IDKB 3TVZA 1YQHA 5J2PA 2BJ7A 2YBVA 4HI2A 5LSOA 3DHXA 1RJJA 3RRKA 1BQXA 2M3DA 2DXFA 5B0DA 5F8LA 1IBMF 1XEZA 1R31A 3HZGA 3IR6B 4FF1A 3LW5C 2CQ4A 4DR6F 1X0PA 4H4KC 3BPSP 5GAEI 4R0JA 4ZCMA 4X4OA 2XWYA 3OXFA 6FD1A 3LAKA 4KO0B 3THPA 2V8HA 1YGYA 4URGA 4KQZA 4PEOA 3ITHA 2I1RA 3D9BA 1FDNA 1SBRA 4NCGB 1VMBA 4BWMA 4AUKA 3UVJB 4LIRA 1XTZA 5K8MA 1HR0J 4LVNP 4B3TF 5A2QY 4E8UA 3MEEA 3PVXA 2M8HA 1AYEA 4QPTA 1MROA 1K0TA 3MPWA 1BWVA 4USIA 3KWMA 3KDOA 4X4UA 5FJ4A 3PACA 2F7VA 3ADAC 3M30B 1F3VA 1IKWA 3BKTA 1KBRA 1TKTA 2IDEA 3RG6A 3TUJC 1T9XA 2AJFE 2P9CA 1FRHA 3I0RB 4DPWA 5I4MA 5HROA 1JLBA 5G0RA 3MM9A 4H4MB 3S1TA 3H98A 5I42B 3T5LA 4DSKA 2W9AA 4DV6F 5IM0A 3C6TA 4AQYF 4F0KA 2BMBA 4RBUA 1Q82T 5GAGI 1IR0A 3HFZB 1IR1A 1N34J 2ASDA 1YJTA 3QO9B 5IOLA 2AEMA 5AXKA 2KKHA 4JI3J 3GWCA 2P6SA 4C98A 2C3OA 1DQ8A 3FQKA 2V9WA 1ELOA 2IMWP 4KY3A 4K0KF 2D7SA 4P52A 1EJ7L 2VOPA 3CJQA 2ALYB 2R7OA 1NKEA 2H4YB 1LWFA 4U7UK 4G1IA 5E5NA 1U1QA 5ADZA 3EZ5A 3ENWA 1EZZB 1FJ7A 1DQAA 1WC5A 4X2BA 1Q8LA 3K5PA 4B3RJ 5CCLA 4K7QA 1SC3B 3T9NA 1W25A 4UY8T 3LP1A 1HW9A 2V8DA 4FYXB 2HGMA 4URQU 3NNCA 5BJRA 2VG6A
chains in the Genus database with same CATH topology
1T03B 3UFCX 2DVIA 3NL0A 4DUZF 4YDDB 3R5BA 2HRYA 3CCWA 3I56S 1DRZA 3PO4A 5KG5A 1M5PC 2BABA 2FPHX 4OZJA 5D77A 2CFXA 3DLBA 1DTTA 1HYSA 2QT7A 2UV8G 3CCES 2FJWA 1BWEA 1JK9B 1XR6A 5EN1A 5THWA 4DR3F 2WSEC 2RH3A 1S0VA 2HWTA 1SJ3P 2RU9A 4QW8A 1SL0A 3GZ7A 3GYXB 3UNGC 1FJGF 3QJJA 3LP1B 2JFDA 1GTHA 4O44A 2VFTA 4J9MA 4I64A 4DOZA 4NZ7A 5J2MA 3M8SA 1KRPA 3FFIA 2G1DA 4KHRA 1Q8BA 1GX6A 2V9KA 4IOCQ 2VG6B 1S1VB 5HBMA 4PWUA 5T41A 3KYLA 1M5OC 1XERA 3BEGB 4ZP9A 2EWHA 3UCZP 1F0XA 1GQEA 2N7YA 1M5VC 1TP7A 1FD2A 3NLCA 1VQLS 3WDOA 4IFVA 2C2DA 1DTTB 1AXQA 5DO2A 4EYHB 4IFYA 4LMZA 1S79A 2X3GA 1VQYA 3JSBA 5GAGU 4QWDA 1HFEL 2DO0A 1QSLA 2KYXA 1FJEB 3LO3A 4LSNA 5GMKa 1VK8A 2JJ4D 4RBTA 2ZOGA 2J9EA 2DR5A 4WFZA 1S6UA 5KOWA 4O44B 1FKPA 2CZ4A 3JTNA 4DSFA 1S1XB 5KG3A 5J2MB 5EX3A 2L9WA 1APSA 1HQEA 3DRSA 2G0CA 3DC2A 3FFIB 4FBTA 2KI2A 3QGGA 2CPYA 3KG4A 3CF5Q 2MZSA 5HBMB 2U1AA 3OFFA 4J9OA 2JVRA 2VBXA 2F9DA 2FJVA 3MD3A 4EWTA 4KV8A 5M2RA 1VQ9S 1GNKA 4IFVB 2MKHA 3HF5A 2KM8B 2CQIA 1WWHA 1T05A 3OPKA 3MCSA 3FVYA 1HL6A 2R2RA 3HVAA 3PY8A 2DNZA 3QAEA 5IT9Y 5EUHA 4JV1A 4U7CA 4OV1A 2CJQA 1WD6A 4LSNB 1KVJA 4DR7F 3MEDA 2KYZA 1L3TA 2OKQA 1QLNA 3OL8A 2FGOA 2CVIA 3D28A 4GO5X 1R8AA 2A1BA 2ZHBA 2V4JB 1TVRA 4TQRA 4NOHA 1FKPB 3OR1B 1EP4A 4ZKAA 3PFEA 1HQEB 3DRSB 4C8KA 3P49B 4FZVA 1R89A 3ICLA 4HT7A 4RNNA 4AXJA 3IR5B 1UWBA 4L6V3 3T1HF 1ZZNA 2JEGA 3ZZZA 2WTFA 3RR8A 1UVJA 3UD4P 3RR7A 5EGYA 1YJUA 2NZ4A 3HMJG 3OW2R 1L3UA 2OSRA 2J76E 4XPEA 1R0AA 5B0GA 1RTHB 2HHPA 4ECXA 4C3MA 1T05B 4RUHA 1HHSA 3U7JA 2UVRA 3KNAA 3H25A 3MR3A 3BR9A 5KFOA 3MEDB 1JXLA 3OVBA 4HLBA 1TVRB 2XY6A 2ADBA 1EP4B 2OJ3A 4A8FA 1ZM3A 1D9DA 5DLGA 3TVYA 3VR1A 2DNKA 3JTPA 1IKVA 2BXJA 2FHKA 4OI0A 2HFOA 2R7XA 1UWBB 2DGUA 2MJUA 2VC1A 2W4CA 4F2RA 1FTRA 3HVWA 1V6HA 3AA9A 3PJWA 1L5UA 1RT2A 3KK3A 3UI3A 2ZHAA 3V2UC 2F8MA 4AL7A 4NRTA 4NCBA 1SUQA 5HLFB 1R0AB 4ES2A 2ZJPQ 1MMNA 3I5AA 4PXDA 3B8HA 4FPRA 3W7BA 1JLGA 4BC7A 5DGBA 2RB7A 3TOQA 3AAWB 3GSDA 2IAJB 1HWJA 3CMAS 3H5SA 1V3SA 2POKA 3I5BA 5B7WA 5KFXA 5EDWA 1KLNA 1YRTA 3IAM9 2GHVC 3QZ8A 3D2WA 3IWNC 2R9LA 4F4ZA 1UFLA 2R2SA 4A4JA 2F8HA 5IS2A 1IKVB 2PT0A 4ZS6A 4YUDA 3VAGA 4GO7X 5DETA 1GX5A 1RT2B 2HFNA 5M2UA 3KK3B 1Q7LB 5DQGA 3GQCA 2VFSA 2WK4A 1AFIA 2NQPA 2D3OR 4D3GA 1RT4A 2IVMA 1T94A 3FRZA 1NRKA 2F9JA 2LA6A 1SUQB 1ZM9A 2OMLA 3CWJA 2YQ3A 2YX7A 1T8EA 1ULRA 4NL5A 1NK7A 2ZJQQ 1UVMA 1Z4UA 3CC7S 2E1MC 1JLGB 4IH5A 4A47A 4PPDA 3M2VA 1SKRA 3EGNA 4C3KA 4TU7A 3CDBA 4ZVGA 3DOMA 1HQUA 3ENVA 3MHYA 2NUHA 1FRLA 1V3ZA 1UVIA 4DR4F 4M8LA 4K5SA 2MZ1A 1FDBA 4TLQA 1KD1T 1QTMA 1NK0A 2DNPA 1O51A 4LF8F 1FXLA 2XLJA 5B0CA 4DF8A 4ZCKA 4DFJA 4CH7A 2QA4S 1FXDA 3SEOA 5KG6A 2MQPA 4JI3F 3CULA 3MDFA 2CQHA 4YFUA 4YMEA 1UVNA 4DV5F 1K0VA 4NLUA 5D4LA 1HWIA 4DSLA 1RT5A 5KG1A 1JLCA 3GR0A 4M95A 2GIQA 2XMTA 2QRRA 2EFGA 4ZPWR 5KFBA 1FRMA 4RW4A 4UOCA 2HS3A 2XHWA 3AY0A 4PWDA 1H2VZ 5I3PA 1EETA 5DG8A 4F3OA 3M2VB 2VFVA 3NAHA 4OX7A 5F3TA 3PHEA 5B09A 1R8PA 1HQUB 4CH0S 3TAMB 1KTQA 3PEHA 4MKAA 2MYFA 4RNFA 1SKSA 3NG8A 3ZC4A 3CSKA 4FF2A 4RBVA 3KK1A 4WZQA 4ILRA 3SV3A 4J9QA 2QE5A 1KSPA 3UPFA 1HMVB 2APOA 5KFFA 3O8WA 2BRLA 2FJDB 1DARA 2K2PA 5F9NA 5J2QA 3P3DA 4C8ZA 5KTQA 1RT5B 2IJFA 4KIAA 1BD6A 2HG4A 4F4WA 3AH6A 4IG0A 5LJ3Y 2ASJA 4OZ0A 4NLGA 3HT3A 2ZH4A 3G8QA 2XSFA 3K5LA 4PWDB 1VHFA 2FHMA 5BYRA 1KLMA 1EETB 3CCSS 3DDKA 3CCLS 4X4SA 2XC9A 1GAOA 4R5PA 2QV6A 5F0UA 4X66F 1S9EA 3JSMA 1N5TA 2C2EA 4Q2LA 3JTOA 4HKQA 3UD3P 4LUBA 3DLGB 4ECTA 2W9BA 1WG4A 2DNHA 2RILA 3DYAA 3MMBA 1FRKA 2HGLA 3KK1B 2GC8A 3CB4A 5GVQA 4Y2KA 2AYEA 4Q0BA 4JI7F 1TUVA 3NCPA 2MQMA 4DL3A 3KG0A 1DQ9A 1O5JA 5J2QB 1NB7A 2ILZA 1RT1A 3P5TL 3BGFA 1NJZA 3CJ3A 1FK9A 2MMYA 4EZ9A 4KE5A 5D6GA 1VQOS 4OLOA 5LXYA 2B7BB 1GXTA 3DRXA 5D3GB 1KLMB 2RQCA 4W92B 1RT7A 5KFHA 4QWCA 2IC3A 2GJ2A 2YNIA 4R5PB 2IA6A 1TKXA 1W2BR 4DN0A 1S9EB 3JSMB 3HHLD 2CKWA 4X84A 1FCAA 2NYIA 3N0VA 4B9LA 2V8GA 3SQGA 2Q6BA 5BR8F 2BACA 3MMBB 2CPJA 5B0FA 3DYAB 2W9BB 1NJWA 3WX4A 2DPIA 2V4RA 4RU2A 1KNZA 4Q0BB 3TAQA 4FXWA 2XY5A 4J9RA 1P1LA 3SYZA 5LT5A 3HVRA 1HNWF 4OLPA 4ECSA 4HDGA 2DK2A 1Q7YT 1FK9B 3OHAA 2CQBA 2VFRA 4TY9A 5AE1A 3CUNA 2JL9A 5A8KA 2FLOA 2OIHA 1ZTWA 3KNGA 4YR3A 5DG7A 1FRIA 5BYQA 1B7FA 2V8VA 2OPRA 1Y5LB 1RT7B 3MM6A 3OLBA 4DFMA 3PO5A 2YNIB 1TKXB 4FS1A 2CQ2A 4OI3A 2RSQA 4DF4A 2YNGA 3SQGB 2MZRA 1IJFB 1UJ5A 2OFGX 4H54A 4DG1A 3OL9A 3NP5A 4NLRA 2YTCA 2OH2A 4JI1F 1D8YA 3LPYA 4O3PA 2JVOA 3M32A 1BY9A 5CD4H 4B3MF 1KR4A 4Q44A 3P6YC 4WJBA 3FNNA 4ZCLA 2CPHA 3MOJB 1K8AT 3U27A 3KLGA 2FLNA 1U25A 1VQPS 1KHVA 5DG9A 3FEXB 3K7RA 1CG2A 2D9PA 4ILLA 3OTBA 3M6VA 2VUGA 3I31A 1KFSA 3MM6B 4WE1A 2R2TA 3BM7A 3KG1A 3WBZA 2JEFA 3Q2TC 2JZ5A 5DQHA 3PX0A 3T5KA 2HRUA 2YNGB 3MEGA 3CDAA 4O3RA 4BCAA 3V4IA 2P6TA 3VWSA 5KFUA 1RKJA 3B4DA 2RRBA 3CJ0A 3M32B 1CLFA 2VBZA 1WACA 2OPSA 1WEYA 2DIVA 4OJ3A 2DNOA 2X51A 4Y65A 4LVOP 2KFNA 1Q16B 2R7UA 1Y9OA 2PA8D 2FIUA 3IS9A 4RW6A 5HL7Q 2ZBCA 3PW4A 1IQZA 4LIWA 5K8PA 4ICLB 4OMFG 4UQGA 3O5TB 5CQGA 3T9ZA 1VQSA 3ZZOA 2R8IA 2DNRA 1S76D 1RT6A 4I2QA 5CCMA 1P6TA 4N77A 3US5A 3JYTA 2WONA 3D1OA 3MEGB 3V4IB 2RQ4A 4DV2F 3D5MA 2KHCA 3DHWC 4FP9A 3PW2A 4BDPA 4IUFA 4MKYA 1QE1B 2CQGA 2VC0A 2OPSB 3DRRA 4QR1A 3GILA 3HP6A 2MZQA 1FE4A 1LWEA 3BSOA 5D4PA 1RQ0A 2EK6A 1S48A 3CEDA 3IS9B 4OJ1A 1MMLA 4RW6B 3BDPA 2MSTA 2HHQA 2FLLA 4LFBF 3QWPA 1U2FA 1U2RA 4B9SA 1KQGB 1NH8A 2RRAA 1RA6A 5KG2A 1U1OA 2I9SA 2KZMA 1X9WA 4IO9Q 5KT3A 4IKAA 3QJPA 3A8EA 5HMWA 5A6PA 2KT2A 1HNIA 3NNAA 2FVSA 1DJ0A 2MJNA 3QIPB 1CC8A 2DT9A 1RT6B 4NLWA 4AXIA 2FTRA 3S7RA 1MMDA 3DN9A 2Z2LA 4I2QB 1JJ4A 2JEJA 2MKCA 5E3RA 2WONB 3Q23A 5HQ8A 2J9CA 4KT0C 4OI1A 3JB9k 2UXBF 3TAPA 1B0TA 2KXFA 4DQQA 4HH1A 4LQ3A 4A48A 4J5OA 2W24A 4FNHA 4TYBA 3DRRB 4CI0B 5KFKA 2YKAA 2OAUA 3BR8A 3MGJA 4TXSA 1LWEB 2ZH6A 3A1YG 3FMWA 3ITHB 1XMOF 2QYCA 1HWKA 1OS5A 4JI5F 4U9RA 2R8KA 4F4XA 4IRDA 1RTIA 1BLUA 1OWXA 5L1IA 3VF0B 4YR0A 1NKBA 2GIRA 1OO0B 3V6KA 3VAJA 2PDAA 3DDNA 4DL6A 1HNIB 4KAIA 2HHXA 1QAXA 5C24A 4EBCA 2L9NA 2AX0A 4QJVA 4C11A 2U2FA 2D1CA 4NCAA 3V6DA 1TL5A 2L9DA 3L95X 1NHUA 4TLRA 4ZVHA 1MNEA 4FXVA 1BQMA 2WOMA 3FZ2A 3TRGA 3LQVA 2B4OA 3PEJA 2O01C 2LECA 1N5SA 3PIOQ 1FTCA 2PI4A 4K50A 4C8YA 5AJ3F 2HQIA 1U1LA 2XB2D 4DSJA 3HHDA 3B82A 3TQ1A 2X1BA 2AJ0A 3S01A 3CCMS 2IBKA 3NMAA 1RTIB 2UUCF 5KT2A 2ALZA 1NK5A 3MM7A 3IR7B 2DGTA 5K8OA 1R8BA 3CJ4A 3CCZA 5C24B 3IXQA 5J1PA 2HVHA 2FHJA 4A8SA 2OPQA 4USJC 3GV8B 4KHMA 2HYIB 2J6UA 1S9FA 2FVPA 3UR3C 3FMBA 5KFYA 1BQMB 2WOMB 3KLVA 2LQBA 5B0AA 3OTCA 3RYLA 4ES3A 1XBWA 2JC0A 1IBLF 4CCHA 1R8CA 4ED5A 1JLBB 1M5KC 2MKSA 2J7WA 2ZD1A 5DLFA 1S99A 4F4YA 2EBGA 3MR5A 1VRTA 5DDPC 1DLOA 4KHPF 1ZAVA 5BYSA 4XO0A 2YWGA 3BB5A 2GO9A 3MF5A 2B7CB 1LFWA 2XO7A 4ECRA 1WHVA 2MY7A 2QLWA 3C6TB 3LP2B 1N6QB 4A8YA 4OHYA 1IQTA 4RW7A 1U4BA 1G6BA 5KT6A 3BSAA 4JV2A 2B56A 2YWEA 4K2XA 3KLEA 3E01A 2DR9A 1C2PA 1LFPA 1Q8IA 2FB0A 2IA0A 4MIBA 5A0YA 3I6PA 3DXSX 4RUCA 5KFQA 1Y4ZB 3ISND 1NJXA 4ED2A 3E2EA 1TL1B 2NR0A 2LXIA 3RZAA 4YP3A 2OTJS 4PQUA 2ABYA 2GQCA 2ZH3A 3BSCA 4ALZA 2HNDA 2ZD1B 3DLEA 3OSNA 3N4WA 3ETOA 4DUYF 4ED8A 2JRSA 1QAJA 3KOAA 1FRJA 3D0IE 2J9DA 3GIIA 4NYPA 1Y5NB 4USHA 1KFDA 3ENQA 3CC2S 1FKOB 4NA3A 1QUVA 1KHWA 1U7LA 1LV5A 2HLUA 1JLAA 3FQLA 3T19A 2VQFF 3CE8A 2YNHA 3KLEB 1U47A 3KTQA 2L08A 4WK1A 1TKZB 1JB0C 5A0YB 3UCUP 4DV4F 1JJHA 3AQPA 3LOUA 4K4XA 2VPXB 4JYAF 1SKWA 4LSLA 2Q43A 4B3SF 1SL1A 1Y7PA 2BANB 2RT3A 1U09A 4J37A 3BQ0A 3IWLA 4PQUB 1R6YA 4F3MA 4A8OA 2HNDB 1D0EA 4IYQA 2ZDOA 1CQNA 2M52A 1SJ1A 2VH7A 2ASYA 3T1AA 1UKUA 2W8KA 2DCUB 3OL7A 4DWIA 4G1PA 3DI6B 1FVQA 2I8EA 4R25A 1UEUA 2Z0GA 2Z8QA 3HVTA 3OXGA 4J9LA 3AB4B 2AJ1A 3FSIA 4QIEA 3L3CA 3EXCX 3SSSA 5I3QA 4KFBB 1JLAB 4OHXA 3U1LA 2YNHB 2JLGA 1FE0A 1FVSA 2IMOA 4ED6A 2G4BA 2R8GA 2DNQA 2GO8A 2IHR1 2ZDPA 2IM2A 3TO8A 5HMXA 3ULHA 3PR5B 2HHHF 3OR2A 4ZVFA 2PSZA 5SUHA 2PA3A 3SV4A 2J0SD 2KFZA 1H38A 1YBAA 1Q78A 3GG0A 1R7IA 2DNLA 2CQ0A 4NRUA 3M9OB 1X8DA 3TR5A 2C2RA 5EWFA 3X1LB 5J1EA 2L41A 2BM0A 1YIJS 2WHOA 3BREA 2F1FA 3GMGA 3DMJA 2E5JA 1MWYA 1YG0A 3CJ5A 4RWWA 4Y2AA 4JUZA 4DQRA 3MR6A 2K1RA 2H5EA 4KGKA 4C8MA 3HVTB 2KZZA 5AXMA 1NZAA 5KFTA 1DBDA 2FVRA 1HYSB 1XR7A 2HAIA 2Q79A 1FNXH 1X4CA 2EKYA 1IJEB 4A8MP 3H20A 4BWJA 4FNIA 4E0DA 1VOMA 2LU1A 2RUGA 5LL6d 1KEKA 1RK8A 3HZEA 4R8UA 3IC1A 4PG5A 3OVSA 3Q24A 1RGVA 2LXUA 3H2VE 2J9DE 4G1QA 1YJ9S 4NYZA 1U1MA 2C28A 3DMJB 1NHVA 3HHLC 2W7PA 5H9FJ 4DS5A 2CYYA 2K1RB 4Y6IA 1RWUA 2EI5A 2MQLA 3DM2A 5A6WA 1TKDA 4ELUA 2EC0A 1RP5A 5KFNA 3HPOA 3EPIA 5M2PA 3GV7B 4IFYB 3OV7A 2GA7A 2IRYA 4QIWD 3W2VA 4MAKA 1JX4A 4LQ9A 3CD0A 4IOBA 5D78A 4QU6A 2XMJA 1SH0A 2BV3A 4NMLA 1UAWA 2ZUGA 1XC9A 5IXUA 4A8XA 4I1TA 1R8HA 4YB7A 1DAXA 1U8SA 4B17A 1NKCA 3ZZUA 1HWUA 1C4AA 2B0GA 3IN5A 1QM9A 4G1QB 2FD2A 3DNCA 4JI0F 4Q43A 1A6LA 3EUNA 4ZVEA 3H2UB 2NPFA 5E3AA 1HBUA 5CH7B 2YX4A 1VQMS 4KV8B