2NSCA

Structures of and interactions between domains of trigger factor from themotoga maritima
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
109
structure length
109
Chain Sequence
MEVKELERDKNRVVLEYVFGAEEIAQAEDKAVRYLNQRVEIPGFRKGRIPKNVLKMKLGEEFQEYTLDFLMDLIPDTLKDRKLILSPIVTERELKDVTARVVVEVHEEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Trigger factor
publication title Structures of and interactions between domains of trigger factor from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 24
structure length 109
sequence length 109
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2nscA01
2NSBA 2NSCA
chains in the Genus database with same CATH superfamily
2F4VF 2MKSA 2KFNA 2XO6A 1B7YB 2B0GA 1N5YB 2YQ3A 5CZXA 2EG1A 1T7PA 3J7ZT 3H0PA 5CD4H 3RBEA 3IWXA 3J7YU 4OYIA 3EPGA 3UWTA 1HARA 4NLDA 1X0PA 4TLRA 2GJFA 4HKQA 4X4NA 2IY5B 2R3VA 3WC2A 4FPRA 4DV3J 4PUOB 2R8KA 4C98A 5KFRA 4ZIVA 3NNCA 3LA0A 2QYGA 4HTIA 3W9JA 2BOAA 2WVEA 3M2RA 4CTAB 4V19X 3OT9A 4ZLLA 3AOAA 1IKWA 1HD0A 2JEFA 1VQOS 4TN2A 1S6OA 1T9VA 3HSDA 4DR3J 2F4FA 2HQDA 2CFXA 4O0NA 1FD8A 4ZS6A 2VG7A 3ZTPA 4XAKA 3UVJA 4I68A 5D78A 5B0DA 1OPIA 4EYHB 3KNAA 4J7CA 4X64J 1Y9OA 3TARA 2HQCA 3CJ2A 4OZ5A 1UWBB 2F8EX 4LFAJ 1TP7A 4O3SA 1PCAA 3QMQA 3R7SB 1Z1ZA 4JI5J 3ISNC 2ZZNA 1VC6A 1TL7A 1D1UA 2V4QA 2BM0A 1SIWB 1NB2A 2XO7A 3PKMA 4TYBA 3OQ2A 4NXMF 3DLEA 3KDOA 3TUPA 5DQHA 1JLAA 1I5OB 1YITS 4IR1A 4TXSA 3G86A 1WSRA 3C14A 4ICLA 1MG7A 2LDIA 4KFBA 2AEJA 1S1WA 3PJWA 2YNIA 1RHUB 3Q24A 3D6FB 4E0DA 3OHBA 3PVXA 3CJSA 4NPOA 2KXHA 3MGJA 5SUHA 2XLJA 2F63A 4DS4A 1MWYA 1VIXA 4DV2J 5CAAA 3I4PA 3K8VA 1A6LA 1HBNA 4JYAF 3HM9A 1HR0F 7FDRA 1NH8A 3EICA 4IRCA 1EQMA 1Y0HA 2D7SA 3ZZZA 4Y2CA 1VLOA 5I3UB 4UOFA 4F0HA 1R8PA 4FNHA 3SDEA 4OHVA 2DR7A 2I2YA 2H3EB 1N6QA 3PYDA 1UW9A 1VDHA 1KOHA 1X4DA 3D4JA 2W9BB 2CNLB 5K8NA 3KLIB 2R7OA 1JLCB 4IG0B 1YZ6A 1T9WA 5LMNJ 4I6YA 4KO0A 4C8LA 2F9DA 4KC5A 4K59A 2EG2A 2X1GA 2FD2A 2M7SA 3M8RA 5GADI 1URRA 5I42A 3IRXB 1PBUA 4B3MF 4RW9B 2DPIA 5A8RB 2HNZB 2B51A 5CYQB 3G82A 2W4PA 2AYMA 2EFPA 3NGSA 5E7OB 2JRSA 2KXFA 5IQQA 1U26A 2AJFE 1IBKF 2DHHA 2YNHA 3K5MA 1VHIA 5DDRC 3TR5A 1HMVB 5KFWA 3OV7A 4XK8C 4OYOA 3M6VA 3DRRA 3EVWA 1T05B 2CPZA 2G4BA 2BW7A 4ED1A 2R7QA 4OL8A 2AIRB 2A6OA 1DAXA 1VIOA 1CC8A 2ZH5A 3V2UC 5HJYA 2NXEA 4W92B 5LL6d 1TV6B 1C0TB 4HI1A 2F1FA 4HDGA 2J8SA 4ZPDA 1U7LA 2DB1A 3AOBA 2AJ1A 4I1TA 5E0OA 2NYHA 4G3IA 3EZUA 4ZA1A 1HIYA 4LFCJ 2E1AA 3MF5A 2LFVA 4TVAB 2Z2LA 1BHNA 4Y6IA 2V8DA 3KMQA 4ZCKA 4EI2A 3AQOA 2VA2A 1REGX 5A6PA 2YNFB 1JLQB 5KFXA 1N5TA 1EKRA 2PO4A 1X4HA 1EIYB 1JLBA 4C0BA 2HWHA 2MKKA 2BVZA 4KYZA 3DU6A 1RHKB 2D74B 1RCXB 3FSXA 2XZTB 4HT7A 2E9ZA 3P49B 4DUZF 2WW4A 1JJCB 3T5LA 2C3MA 1QLNA 3MECA 4G1IA 2CAJA 4YHHF 2M8HA 3DMJB 2V8PA 1Q0NA 3MWBA 2V9KA 4LSNA 1TKXB 1TMJA 3VAFA 2X1BA 1U4BA 4NASA 4ZIWA 1TTHB 3D5MA 3IS9B 1FNMA 2FHJD 2VFUA 3P45B 3A3OB 5B0FA 3AXKA 2W1BA 2ZOGA 2LDYA 2VASA 1WTBA 3X1LB 2NYIA 1KFDA 3IGNA 4L76A 4E98A 4DPUA 2CQ4A 3CD7A 1T94A 3PW7A 1TL5A 3B4DA 2Y0BB 1QAIA 3HX9A 4DV7J 3OR2B 2J0WA 1SH2A 2IC3A 4PG8A 2O66A 3A8JA 4NLOA 4K8RA 1XC9A 4PQUA 1TAUA 1XEZA 4AL5A 4KJIA 5L38A 3GU0A 1S5ZA 1JX4A 2ZEJA 1HBUA 4LFBJ 2VD3A 3M30A 5MAOA 5SZTA 1CJKA 3HI9A 1B0PA 3CDWA 3T6BA 2HZVA 5KG2A 2VPWB 4AQYF 1FRHA 1RHMB 3KK3A 4Q43A 4R5PA 4M8LA 2B5JA 3FJ2A 1YG0A 3GJRB 4FYDA 4PXBA 1RAEB 1EP4B 1U0HB 2MZSA 3BZQA 4ZVEA 2VICA 3MR3A 4F8RA 3HHLC 2OEKA 3LGNA 2V4JA 1CS4A 3GSDA 2A2DA 2H4WB 2NZ4A 1NKEA 4WYLA 4K4WA 4Y28C 4J37A 4QR1A 2K1RB 3DKDA 3BV8A 1AT1B 3R97A 5CQGA 4NL5A 2HVZA 2KTQA 2K7JA 4JYAJ 1FRKA 2CPJA 4NI2B 3PACA 4QOTA 3D6TB 4BWMA 4X4VA 5K20B 4DQRA 1NJWA 4F25A 2VPZB 2PI4A 3JQJA 2H65B 2DXFA 4HLBA 2CPIA 2W8LA 2DHXA 4UY85 3KUEA 4FF1A 1FERA 1S49A 3LWLA 2QT7A 1RU2A 3CT9A 1KFSA 1RHQB 2FC9A 4AT1B 1XMOJ 2QV6A 3V4MA 1Q7LB 4Q2MA 3PG9A 3RAXA 1X8DA 2O5DA 3OTOF 2XWXA 3NEKA 2DNYA 3SQGA 3QAEA 1A0OB 2HAIA 3CJKB 1GTHA 1FDDA 4KB7A 1UVJA 5K14A 1T02A 4ES2A 1SL0A 3EXCX 2YBVA 2FVQA 2DRAA 2K8GA 4PQAA 3F73A 4Z7CA 1KQFB 4B3MJ 5IFMA 4DG1A 4DLEA 2QTWA 3BKTA 2OI2A 4ID5B 3M6WA 2W4DA 4OMFG 1NSKL 1KVIA 5KFDA 2IRXA 1NK0A 1SC4B 4OZ3A 2YQ0A 3HZGA 5HQMA 1WDDA 1T11A 4ECRA 1BUXA 1X5TA 2PSZA 3M8PB 5KT2A 2DNGA 1LXJA 3HDSA 3KLHA 2HHWA 4X2BA 3AD8C 2BR0A 3W7BA 4DR1F 2HIQA 1T9TA 2JEIA 4S0MA 3D0IE 3M2VB 2RIJA 2B9YA 2R7XA 1TU0B 4DR4F 5HMYA 4RNNA 3CGIA 4CLSA 2D9OA 3QJPA 3MR5A 3NWRA 2GVZA 4QW8A 3MM6A 1SB6A 2B9WA 3CCSS 4OHYA 1NPPA 1RT5B 5L46A 1IKVA 3R1LA 3IAS9 1BXNA 2JLFA 4KGMA 3FCVA 4MJKA 2CYYA 1GX6A 1G6BA 3OFEA 3B6BA 5E3CA 5C42B 2KO1A 5CABA 1YJ9S 4TLQA 2GQCA 5KFJA 3BB5A 4K5RA 2RHSB 3UQSA 3ILIA 2OIHA 8RUCA 4P74A 2BJ1A 4DQQA 3KUHA 4RW4A 2NPIA 5EGYA 3DRYA 3TAMA 1QSLA 2L9NA 2NS1B 4JI7F 4USJC 4DUZJ 4MYUA 3CCVS 2PIIA 1RT3A 3CCQS 2HLTA 3W63A 4YHHJ 3OUYA 1S7HA 4DL6A 5E3AA 1S48A 4BDPA 1GQEA 5KFAA 4ZPBA 3O5TB 5GADU 4O3PA 2G0JA 4DV0F 1QD1A 5AE1A 1YBUA 2AX1A 4X4SA 3CC7S 2CQ0A 5L1JA 2HEKA 1IWAA 3G4SS 1U48A 1WELA 2HRYA 1R43A 3JTOA 4NLXA 3EGWB 3PR4A 3JTNA 2QJ3A 2QLFB 2RJZA 1YSJA 2PMWA 4UUWA 1HL6A 3MUTP 1J5OB 2OPPB 2P6SA 4R25A 4KHMA 4NX9A 3EZOA 1FKOB 1HLWA 2B3TB 4FYYB 3WBZA 3RZAA 4NLQA 5A0YB 1GXTA 4RNFA 2JEJA 1I51B 2RKIA 3Q22A 1R0CB 5AXMA 2VPYB 3HSZA 2HSEB 2G0IA 3QGPA 2VOPA 1NNDA 3FZ2A 3PKYA 4AQYJ 4LF7J 1C0UB 3AJ1A 4EYIB 4JI2F 2PT0A 3HPOA 4F3OA 1TL4A 2OP5A 3IG1B 1GXUA 2CJXB 2UVRA 4B3RJ 5HANA 4NCAA 3O8WA 2YKOA 5DZ6A 2YKMB 4BHQA 3H98A 3JSMB 1WEZA 3SCIE 1Q8LA 4DR5F 3NGRA 3A8IA 3M8ZA 2A10A 3JAMY 4FF3A 3M8YA 4RU2A 3KLFB 1S12A 2BQRA 5EWEA 1DLOA 3ET6A 1S6PB 4NXNF 5KFQA 2AJ0A 1K0TA 4E2FB 3HVTA 2C3PA 4PWDB 1VCTA 1KS2A 2GVDB 1MSWD 3T1AA 1QM9A 2NXCA 3ULHA 2OPRB 4OYZA 1VRUB 3LPYA 2UUBF 2RRNA 1WHWA 1QVGR 4QQBA 4J9VA 4A48A 2IJRA 3D9BA 3QJJA 3AD7C 1OIAA 1F6TA 4HR2A 2ZH1A 2MB0B 2WONB 4J9LA 3M4XA 4RLEA 1APSA 2FVCA 2XMKA 3VF0B 3I0RB 4HTJA 4OI3A 2ILZA 1U49A 2FJDB 1CBKA 5E33A 1RK8A 1WHYA 2KKHA 3S01A 3ENAA 1YJWS 4O3RA 2Z2YB 4LF6F 5IV3A 3TW0A 4CRJA 2QLBB 1U2CA 3N5BA 2LU1A 1NJXA 3K5LA 3RB4A 1UFLA 1U1KA 4LT6A 1M1GA 4WF9Q 4Q44A 2CQ3A 3QNWB 4BCAA 1O8BA 4YB1P 3VAKA 4IRKA 3KYLA 2V50A 5HP1B 2C2NA 4I64A 4OX9J 2VB6A 3UD3P 4ILLA 4O44A 4FVMA 2ZHOA 1C1CA 4R8UA 5D4OA 4UF4A 1TKZA 4DR4J 3K57A 3NBPA 2WVCA 1U45A 2VFRA 1VJQA 4DCJB 3R1HA 2GAGC 5J2QB 3C6UB 5KG4A 4P2MA 4C8KA 5CZVA 2EXUA 3OD2A 4YR2A 1SV5B 3V6DB 3KHHA 1NRKA 1TVRA 3FCHA 2R8JA 3NOCA 2AHOB 3N6LA 3MPVA 2J7WA 4DDFA 2CQBA 1KLMA 1UW4A 2BE9B 5LSLA 5FDLA 4FNIA 2OPQB 3VAGA 4M5IA 2RD5C 1HWLA 3ONQA 2HFZA 4LF8F 5F8HA 3TQEA 3FSIA 4C9DA 1KDNA 4XO0A 4OJGA 4EBDA 4WU2A 4JI7J 5H9FJ 1V5VA 4P7TA 4F4KA 4CM0A 4PZVA 3FZBA 2BXJA 4X4PA 2I9SA 3DM2B 3I32A 2O01C 1E6YA 3QIPA 1O51A 4IH7A 3MMCA 1RABB 2I38A 1TL1A 3R2CJ 3R5DA 4U8VA 1S79A 2UP1A 5F9NA 1M90T 2OFHX 1DQ9A 2R2UA 1N34F 4ZVFA 5BJRA 1UJ6A 3CDAA 1RTJA 4B17A 3DLGB 3C6TB 1JLGB 5DRKA 5C5JA 3R6GB 1ELOA 1OWXA 2F40A 3UCGA 2ASJA 9ATCB 2CZ9A 1O5JA 5KFCA 1P1TA 2ZOFA 1RAIB 3E51A 2DBBA 3KK2B 4FDFA 1NHUA 1RUSA 1SCJB 3ZZOA 2YWEA 1WKLA 4XPEA 3CB4A 2A2CA 4MK8A 3MHYA 3MR7A 2DTJA 3C15B 2W2PP 2CUYA 3M6XA 2NUHA 2YH0A 4U7UK 4WFZA 4C48A 2VJUA 8AT1B 1WG5A 2CDQA 1CJVA 1WI8A 2F9JA 2DY9A 3R27A 3L95X 3JYTB 4DCPB 4H4KC 4DR2J 5JVHQ 5BR8F 1HQ2A 2MZJA 2D9PA 1VRTA 3UDVA 1PC5A 1UCNA 2UVUA 2FJWA 2VV5A 4DR5J 2KL8A 4KV8B 2HLUA 1I94F 2J76E 1MU2B 3KFWX 1HNWF 3J80U 3ISND 4NXNJ 3IBWA 1NB7A 3RR7A 5ETKA 1LWCA 3BN7A 1L3UA 1SH3A 1QAXA 4GO5X 5A8WB 2HFNA 3CCES 3FEZA 4F4WA 4CYUB 5I3PA 5EN1A 5EDWA 4JI6F 3UR3C 2ZE2A 3P8BB 2HNYB 2KYZA 4M5MA 2BJ8A 1UETA 3TRGA 3QRQA 5T7LB 2QN6B 2R7SA 2NXJA 3LF0A 3OBIA 2EKNA 5KOXA 3R5JB 3Q8VA 5IC4B 4MK9A 4QWEA 3T1YJ 1R8BA 4Y00A 1ZOTA 2XQCA 1S1XB 4F0KA 4QWBA 1RWMB 1MN7A 5DG9A 2L48A 5G4DA 4DPTA 5H9EK 2YKQA 1S59A 3POTB 2MKIA 4ILRA 1JB0C 2AKWB 3EVOA 2E7VA 3BYPA 1HHTP 1CSJA 1XNQF 3MAAB 1VK3A 2QZ8A 3GV5B 1D9FA 2VG6A 1UVNA 5DGAA 2B6AA 2XYHB 2HQIA 5KFYA 4N56A 1QE1A 2GS8A 2HKEA 3HD1A 2LQ5A 1IR2A 2V4RA 2BOPA 1KN6A 4LF4F 3NRBA 1LOUA 1R0AB 1HNIB 4CO0A 2V94A 4ZJLA 4CNZA 1Z4UA 3CMES 1VQKS 5B0GA 3KJQB 2YTCA 3TOQA 4BC7A 1S0NA 3BR9A 4I2PA 5ETRA 4ZP7A 1D8ZA 4A4JA 3MPWA 3HF5A 1N36J 3OVBA 3I0SB 3MPDA 3CF5Q 2C42A 5HL7Q 1SPBP 4CH0S 4MKVA 5HROA 5KFEA 5DG7A 1VI7A 1O0PA 4G65A 4JV0A 1U2FA 2ZKUA 1O6XA 3CO9A 1T95A 3O2IA 4LF8J 4V1Ak 5D3GB 3M2UA 2LEBA 4MIBA 2OMLA 1SC3B 2CNOB 1UEUA 2P9EA 2V8GA 4RU9A 4F4AA 3Q8PB 3RB0A 1R0BG 2XYPB 2DEIA 3G8TA 1RT2A 1FXDA 1EHWA 2LMIA 3IAM9 4USMA 5F3ZA 3ITHB 3W62A 5AJ3J 4C8OA 4ED6A 3W5XA 4CLYA 2NQPA 3QRRA 3L7UA 5IT0A 3CCUS 1GMVA 1FKAF 2VFVA 5G0RA 4C4WA 2C28A 3VVTA 4AFFA 3LWMA 3W5ZA 1N32J 2NREA 1Y00A 2DNLA 3DC2A 4J9QA 2LECA 3N28A 4QYZJ 4USKA 1Q79A 3EX7B 1PGZA 1HI8A 5IT9U 2DNPA 4RNOA 2BA9A 2FTRA 1HPZB 3TAQA 4TKTA 4IG3B 2FJAB 4F67A 4ELTA 1HQUB 2UUTA 2V2ZA 2D41A 1KNZA 2DISA 3IR5B 2VG5A 2DGXA 5B0AA 2DNQA 2HVIA 3IP0A 2E1PA 4ED0A 2R4FA 1RA6A 4CLUA 2ZM6J 2D1CA 3GB0A 3CCWA 1V9OA 4IR9A 3SFUA 4GKKF 2LVWA 1VBXA 1LWXA 3OTCA 5GAGI 3MUMP 1FHTA 2KRBA 3TO8A 1D3WA 4NEZA 3IN5A 5BR8J 1HYSA 3BQ0A 4F0MA 4QIVA 3R7NB 1X0FA 4ELUA 2AJ2A 1VK8A 4LRFA 4MFBA 1CEZA 3JQMA 1YKWA 1H7WA 2F3JA 2IM1A 1FRLA 3QJLA 4OZ2A 1SI9A 4PEOA 3ZZYA 3TZZA 3A3NB 4GMKA 2H5IB 4IRDA 1HBOA 4C3LA 3M2RB 1I94J 2K3IA 5H1SV 3HHDA 5IC6B 4BWJA 1IKWB 1YVFA 1RP5A 1KKHA 4M5JA 3BPDA 4E8UA 2C2RA 1X9MA 4C2MA 2CVEA 1ZAWA 3UVJB 5EX3A 1UPPA 2CQGA 1RJJA 1ZPWX 1TFWA 1DQAA 2FLOA 4L73A 1IXKA 2HMIA 4DCOB 1FX2A 4N5SA 3WC0A 4Q45A 2VOOA 1EB0A 4KIAA 1DRZA 1CC7A 1TL7B 3N6NA 2AWZA 4NWBA 3THPA 3AHPA 2KM8B 5E5NA 4MT1A 3OHAA 3DLEB 4AL6A 3I31A 1GMWA 2DRDA 3JQKA 4QWDA 1ZM9A 1N48A 5KFUA 3C14B 4ICLB 1SJ4P 2LKZA 3QT8A 1F2HA 4KFBB 3Q89A 2MQLA 1K8AT 5LM7E 1S1WB 2FHMA 2QO3A 2DO4A 4X62J 2YNIB 1XNQJ 1RBOB 3C2PA 3EGVA 3LQVA 4AXJA 2ZC3A 4ED5A 4A46A 3EZ5A 4RO0A 3GIJA 2XSJA 5HO4A 1RI7A 3ZXWA 4M5LA 3I5AA 4KY3A 3VAMA 4OHXA 4ZLPA 1HHSA 4EMDA 4P71A 4NLWA 3ZTRA 4ZHRA 3MOJB 2XLKA 4PCQA 2L9WA 3VV2B 3KG1A 1HBNB 1WEYA 3IMQJ 5FIIA 4OIXA 4RX6A 3MMBA 4LBIA 4K2JA 4DXLA 1JJ2R 5D77A 3VGUA 1EJ7L 1AA1B 1F1BB 3AODA 1G4CA 2KT2A 4WK1A 2DR9A 4AE5A 2CIMA 1ZZNA 3RG6A 1FFWB 3SDEB 4C6AA 3TEHB 1N6QB 4M95A 3NGUA 5J1PA 1PG5B 2J5AA 5A6WA 2LXFA 1IVZA 2IPOB 4HYKA 2XMJA 2ZDOA 4ZLJA 5EWGA 1L3VA 3RBZA 4KO0B 3OL6A 2OSQA 3BPSP 4ZCLA 3DLKA 1U1RA 1MROA 1BQNA 1N54B 4KKOA 5KT7A 1GMUA 4DV4J 3SIPB 4EUVA 4USUA 4LIWA 1JXVA 2YKAA 3QT6A 2D3OR 3DLJA 3G82B 1LK5A 5FLXY 2DNOA 4RR5A 2KH9A 2ZZTA 1AZSA 3VGVA 2YNHB 1NKCA 1DJ0A 2WW8A 2HFUA 3HJFA 1J5OA 4DSFA 3DRRB 3DOLA 3LUYA 3BEGB 3BF4A 2NXUA 2DY1A 4JV5F 3C3LA 4YDXA 3AOCA 2KHCA 4YOEA 1OJ4A 3I87A 5A76A 2N7CA 2BRKA 4ETZA 2BRLA 4DSJA 2HK3A 5KFHA 4DU7A 3H5UA 2B56A 2VC1A 3PCOB 1WTFA 1HW9A 3GONA 3QZ7A 4FYWB 3W64A 4DX6A 2YX4A 1OY6A 1AUDA 1V3SA 1RWVB 1XERA 4DQIA 2OHDA 3SCKE 4C7QA 3AJ2A 1U02A 1ZZFA 2R7VA 3GPAA 4LR7A 3ZZRA 4ZP9A 1RWXB 3LP1A 4PYDA 5D0RA 2YKMA 3KHLA 1JLBB 3IBFB 1KQSR 4JV1A 4FXDA 4GKKJ 2BANA 1UFKA 4QIGA 1VHFA 2VHGA 3TWZA 1BQMA 4WIIA 1TL3A 4DN0A 2XY5A 4LBHA 4ZP8A 2HQ3A 2X3GA 4LF9F 3MECB 2ROPA 1YJ7A 2J6TA 2RVJA 3J7A1 2QLXA 4LSNB 2KFYA 3W2VB 1OSDA 4Q5VA 4RBUA 3FBEA 2VQFJ 1Y3JA 2MLZA 1Q86T 2A3JA 1CULA 4YR0A 2EK1A 3FMBA 4HHJA 1M5KC 3AA9A 3MMAA 3T5KA 2ABYA 4W90B 2MKJA 3FBBA 2IC3B 1YJTA 4PYAA 2GJIA 4CO3A 2KU7A 3AA8A 2KB2A 4PQUB 4XIUA 5HQLA 3F44A 1IBLF 3HSGA 1H6KX 3TJ9A 3QO9A 1Q4RA 3OXGA 4USVA 1HBUB 4K0KF 1H98A 3B82A 2DR6A 3M30B 3S1TA 1CJKB 3TX0A 4FN5A 3H59A 2JVRA 4L3KA 3HULA 2VBWA 1P9QC 4USIA 1QDUB 1I6JA 2LQBA 3OLAA 2C2ZB 1NDKA 4I67A 2HK2A 3KK3B 4LVNP 1S6UA 4R5PB 4OYXA 4WBFA 3PZPA 2B5JB 1FT8A 1UVLA 4CNYA 3LW5C 2R7TA 2KI2A 2AMCB 2L3MA 2HBZB 2QX0A 2DNRA 3PM9A 2CQCA 5GAGU 3M32A 3KLEA 1YIJS 5E3RA 1VQ4S 2V4JB 1CS4B 4ENOA 3IRWP 2W9AA 2E7WA 2K06A 3AD9C 4ECUA 2FHOB 2ZD1A 4PG4A 4XDDA 3KNGA 2PA8D 1LKZA 3UI3A 1QAYA 1MN9A 3CD5A 3CJ0A 3IO1A 2D69A 3V81B 1TUGB 1S4EA 1RQ0A 2KDOA 4I7FA 3OTBA 2AJQA 1JK9B 4ED8A 1RU1A 3H40A 4NLYA 3E3XA 1NM2A 4OX8A 4KR0B 4FYXB 3E8OA 5JMNA 1YJNS 4OYMA 1FKPA 1P9YA 1VQYA 2N4CA 4FBTA 5KAKA 4Q8EA 2HIYA 2E5HA 2RT3A 1RKJA 3SQGB 2O3DA 4JP8A 4G1QA 2EC2A 2HURA 4F02A 3DRSA 5K14B 3W65A 4ZN3A 2M4MA 3T9ZA 2FC8A 2PC6A 5FLXU 1DURA 1RWWB 3EWGA 2AP6A 2HHSA 2RRBA 2CZ4A 1SKUB 4DG1B 4TU8A 4PR6A 2VJVA 3D67A 4IDKA 5DDQC 2K2PA 1F9EB 2H4YB 4WJBA 2BJ3A 2M5YA 4QIFA 3GIMA 3IM9A 1FJCA 1WD6A 3TA1A 4ZPAA 1V6HA 1LW0A 2OPSA 3RR8A 2Q3PA 5D4LA 3KLHB 3RAQA 1FE4A 5F8MA 2KN4A 3OTDA 2ADCA 4ALZA 2IM0A 4MYTA 4OZLA 3Q83A 3KK2A 1MW7A 4JV5J 4ECZA 1FTRA 2CPHA 2GVZB 3MM6B 4F36A 2OO4A 3D3CJ 4DR7F 1H2TZ 1Q5YA 1IKVB 5DLFA 2YXLA 1V5IB 2AW0A 2NLWA 2AEFA 4Z7YA 1H74A 1P1LA 2UUAJ 2DGWA 5KG3A 2XNRA 1L3SA 2KVIA 1SJ3P 1Y7PA 4Y65A 5D0EA 1R27B 4ZVHA 4DV5F 1W25A 2VFTA 1NDCA 3QBCA 2XMWA 4OJHA 2HGLA 4RW4B 2BE2A 3D6MB 3TAMB 4R0EA 4FXVA 1S0VA 3RTVA 2CKWA 4F26A 1FEHA 1RT3B 4LF9J 1NJIT 2CPYA 3SSQA 1ULRA 3P96A 4IOBA 1MNEA 3OUYB 2ZH8A 4ZLNA 1SL1A 3M9OB 3CO0P 2J8AA 3IC1A 4YDDB 2QMXA 4USHA 3T3FA 4MKAA 2CPFA 3CD0A 2MLXA 4B3OA 4HHUA 4WK3A 3E2EA 5M2PA 1I1GA 2F5GA 2PMHA 4AYBD 1M5HA 2NPFA 2P5VA 3H4BA 4TY8A 1NHKL 3NMAA 3K89A 1H2UX 1YBTA 3BSOA 2K3KA 1H0HB 3BBCA 4ZKAA 2I0XA 1ZA2B 1NSPA 3P4UB 3ILOA 1RT6B 3QAUA 1KVKA 3QWPA 5L1KA 4I69A 1JIHA 1VBKA 4BBYA 1KC8T 1FRXA 3NS6A 1IBLJ 4YB7A 2EKYA 4HDHA 1VFJA 2DKOB 1S76D 3QFWA 4UZCA 4K0KJ 4YFUA 3CCRS 3L3CA 2RKIB 2YVSA 3DCAA 2VKZG 3RB3A 4ECWA 2MSSA 3DHWC 3I55S 1ZH5A 1OY8A 4ZVUB 5BXIA 4C3MA 3UCZP 3LH2S 3TZYA 2B4UA 2ZUGA 2NCKL 4PXEA 3UR0A 4X4TA 2QEXS 1SKWA 4DPOA 4MAKA 3KHRA 1YJRA 3ETMA 5IM0A 3HMJG 3NY0A 3QYYA 2RUGA 3UNYA 2LLZA 1T0TV 2MJNA 4QWAA 3I4HX 4JI0F 2E66A 2DNHA 2YKNA 2EFGA 3HFKA 3MCNA 4DL4A 1DARA 1LFPA 2QGFB 2DGSA 1BGXT 3SI8A 3K0JA 4HACA 2XI2A 4IFYA 2CVIA 4RNMA 3D3BJ 3MTKA 1F60B 4UQTA 1DLOB 4PG7A 2DIVA 3ET6B 3NWGA 4OHWA 5L1LA 1XMQJ 4OZNA 1UZDA 1GXLA 1UPMB 2PA3A 2W2QP 2MPUA 3BGRA 4NLUA 3HVTB 2VH7A 2NR0A 1M5VC 3THTA 4NA2A 2C22A 3RB6A 2MKCA 4IQXA 2JC0A 2HVHA 2QSFA 4ITSA 1EAYC 3MOZA 2RE1A 5HN0A 4ZK7M 3KMSA 4P2FA 1SKRA 3GCXP 3AY0A 2G1HA 2EI5A 2XM3A 1UVMA 1KSPA 2HFSA 1I3OB 3CULA 4DV1F 3NS7B 3BS9A 3KG0A 4GVLA 1DFDA 1S0OA 4DPXA 2LP4A 1RZMA 3H42A 3QGGA 3E01A 4OLPA 4N47A 1X4FA 2VPXB 3I9V9 3OL8A 3IXQA 4ANEA 2U2FA 1FJGF 4I6WA 2BUNA 4OFZA 2OD6A 4YUDA 5KG0A 3Q86A 2ZNZA 4PXCA 3DRXA 3NL0A 4MIAA 1B0TA 4ZPTR 1HKAA 4EZ9A 4OI4A 4A8SA 1NH7A 2Z2MA 2J9EA 1RT7B 2EBEA 4DL2A 4O44B 3K5OA 4JB8B 1C1CB 1PJ6A 4R8UB 4O4GA 1TKZB 3QSYB 1UWAA 3NBPB 4YB5A 1IQZA 4NA3A 1VQ9S 5IXUA 4ECSA 1RLCL 2V2VA 3Q0AA 2CJAA 4DR7J 3RGIA 1S99A 1RA7A 5ETSA 1TVRB 1ZTTA 1REVA 3H2UB 2Q1LA 1XNRF 1RTIA 5F8IA 2C3OA 5GAEI 4BC9A 1KLMB 3TUZC 5DGBA 3R5AA 1W2IA 2X7IA 5FDLB 3CW2C 1HD1A 5K8PA 2WK4A 1SQEA 2XB2D 4DV5J 4B3TF 2W01A 1U8WA 2EW9A 2IA6A 4CIOA 1N33F 1EKSA 1S9EA 4LIRA 4EEYA 4M63A 3TVZA 1RT1B 3D68A 4DZ6A 4QCLA 3MXHP 1IQTA 2UXBJ 2FGCA 1WF2A 2FIUA 3K17A 4TQSA 2W2MP 5DETA 1E6YB 3QIPB 5ETMA 3MMCB 1TL1B 4OV6A 2LU2A 5F8GA 2Y1JA 2F7VA 4FZVA 5JVGQ 2JFDA 2WVFA 2HGNA 3MTJA 1VC0A 3VWSA 3BGFA 1Q78A 4ED7A 1RTJB 1X7VA 1N88A 2ZUAA 2FVRA 2D3UA 4QW9A 2FJVA 6AT1B 2CQIA 2Z0GA 4ES1A 3KJFB 3GIRA 1LEOA 3F56A 2GJ2A 2HFVA 1YK9A 5GMDA 3UDLA 4UY8T 5K9FA 4ETXA 4WXWA 3FCWA 2XZWA 2G0CA 5T41A 2P9CA 3JSBA 1AYEA 3GZ7A 4CDIA 4KGVB 2V2KA 1D9DA 4N41A 3K2YA 4V19J 2HRUA 3R3TA 2V5HG 1CJVB 1D09B 3MEKA 1SH0A 2C3YA 3Q8YA 4YN3B 3OLBA 2GHPA 3HFZB 3VTIA 3L4BC 1K0VA 2H48B 4AD6A 3ZNJ1 4BS2A 2C2EA 1BY9A 3UFCX 5HLFA 2XGQA 5BYQA 3W5YA 1WC5A 2RQMA 1VRTB 4NYOA 4P52A 2ZH3A 3MI7X 3AB4B 1UEVA 5I3QA 3TZXA 2AYEA 5ETQA 5JXSA 3QPIA 1V3ZA 3Q2TC 3W9HA 2XLIA 3H25A 7FD1A 2HGMA 2UXCF 5FD1A 4C8NA 3OL7A 4ZITA 2CG8A 2BX6A 3HJVA 1LWCB 1QTMA 1EZZB 2WOMB 4HVZA 4GKJJ 3D28A 3X3UA 3MD1A 1NUEA 1X5PA 1W7WA 2ZE2B 2AZ1A 2Z56B 1NK7A 1VYAA 4CLLA 2VF3A 2BEFA 1S9GA 4P2SA 2RF2A 5E41A 4DV1J 1VMBA 4JV2A 1NMEB 3KWMA 3QFHA 2FY1A 1Q53A 1QJHA 2C1EB 2HNDA 3QLHA 4JI3F 2FZGB 4KT0C 3MM7A 2Z2ZA 1B3TA 2YNGA 2FDNA 4RWWA 1OY9A 5KG1A 2XC9A 3IM8A 1FWKA 2W24A 2KVQE 1BWVA 2VG6B 3PW5A 2B6AB 2A1BA 2A6MA 2B7BB 4DL5A 2GIRA 3PXGa 1QE1B 4F3MA 3J7AN 2EFNA 2DR8A 5IOLA 4OYAA 4IYQA 1N56A 4F4XA 2BDPA 2QC3A 3ILJA 2QL9B 2IIHA 3G6ES 3MEEA 5KFBA 4U7CA 2W2OP 3SSSA 2XMTA 2HHQA 4ZOSA 2F4VJ 4CH1A 1YBAA 2HW3A 4NLTA 4I2PB 2DGQA 4USTA 3H5YA 3PR5B 1NAQA 1FRJA 3PIOQ 4LRCA 2HVEA 5LMUF 5KT3A 1RWPB 1XNRJ 2OELA 3W2VA 2Z30B 3HHEA 3C16A 5HROB 1VS3A 2B8QA 3R7BB 4KQZA 4FYVB 5DZ7A 4B3TJ 4XPCA 2VONA 1ICEB 4QPTA 4IOCQ 2JWNA 1N33J 3M2UB 4U67Q 4DFKA 3FBCA 3CJ3A 4EBCA 5K8OA 3EPIA 5J2PA 4Q2LA 1RAAB 3ZC4A 4ZVSB 4U7UD 2ZOMA 2W7OA 3CPWR 3PFOA 3UO0A 2ZH9A 5DQIA 1VQMS 4ZVTB 1RT2B 1WDTA 3K5PA 2HHTA 2RH3A 3NG8A 3CJ4A 1D0EA 4K4XA 4TY9A 2HBQB 3N0VA 4CM2A 4KGKA 1F3FA 1P27B 5G0RB 2HHUA 4NA1A 2H54B 1RTDA 2BMBA 1L5UA 3DLBA 5HMXA 1Q1KA 4DFJA 2LYVA 1JLEA 3DYAA 3G8SA 1X5SA 3Q8SB 4NXMJ 1CPZA 2PEBA 4QIEA 3CD6S 1UMJA 2V8HA 2VG5B 4K4SA 2HHPA 1RWNB 2IBKA 3NCRA 4X4QA 3A8EA 3PW2A 2G2YA 3HK2A 3HO1A 5DLGA 3MUVP 4W4MA 1UTAA 4WYWA 3GFYA 2N82B 4WTOB 4OYBA 2J9CA 7AT1B 5GAEU 2RS2A 4X65F 2YWWA 3CC2S 2QA4G 1HNVA 1HYSB 1HR0J 5CCMA 3V81A 1R31A 5KFPA 1GAOA 4MFBB 3TP2A 1CJTB 4KH0B 2M8DB 4X66F 4ATNA 4UTGA 2Q79A 5LJ3Y 1TUVA 3BH7B 2FYXA 2AGOA 4U8YA 4QYRA 4ZPVR 2K7KA 2E7XA 2W8KA 4NLSA 2ADBA 3NS5A 2ASDA 1HBOB 1LK7A 2ZH6A 3SEOA 5J2NA 2B7CB 2R7WA 2UXCJ 5EX0A 2XI3A 4I56A 2M2BA 3FC9A 3SSRA 4P2XA 2ILYA 1NO8A 1H3DA 3DRPA 4WFAQ 2EC0A 1CG2A 4WP8A 3DDNA 1RB0A 2MJUA 1X4GA 1N0VC 1S1VA 2E5GA 2HMIB 2RU3A 5IQ6A 4K4ZA 3FVYA 2DO0A 4K4VA 2X51A 4LMZA 3ISZA 3DGPA 3P3DA 1G7CB 3ZFVA 1YI2S 5ETLA 5HMZA 1IBKJ 1TAQA 1FK9A 1EX8A 4ZVPB 4RBTA 4PRFA 3FQKA 3DOKA 3R5CA 1IBCB 2OD4A 3EYZA 1M1KT 3NNHA 2IDEA 2ZWOA 1AFIA 2MHNA 3U7JA 4ECYA 4J9KA 2ZBPA 3CJTA 2OJ3A 1WC0A 1MMLA 1U25A 3M1VA 1MMDA 1GMWD 1WACA 3CTRA 4NCGA 1RTHA 3PY8A 2NZCA 3QRPA 1N4LA 1K47A 1FA0A 2CWXA 4QBUA 2V67A 2XSJB 1WOOA 2XY6A 2ZKTA 3OFFA 2DNNA 5ETPA 1ZM4A 3TANA 1TK5A 5E2QA 4FS1A 4ZHRB 2Q43A 5AXNA 4JI8F 1QTNB 4NYZA 4KAIA 3PX6A 3MMBB 4Z2XA 1SUQA 2E9RX 1RDRA 2H5EA 4HL9A 1JXEA 3MCOA 3QWUA 4X4RA 4LF2A 1WF1A 1YLXA 2CQ2A 2OAUA 2HFOA 3LPEA 2PEHA 5L39A 1NK8A 3PEHA 4URSA 1YDLA 4MTPA 3FRZA 3AT1B 5LMUJ 4J5OA 3VGSA 1KP6A 3D0GE 4HHHA 1HQEA 1FFGB 2H1YA 4LFAF 4DOZA 3DLKB 4B08A 2XHWA 4IOAQ 5C7PA 2QSWA 1MROB 1BQNB 1YRUA 3IFEA 4KKOB 4JI5F 2XMAA 1AROP 4YS2A 4EWTA 1S0MA 3RRKA 4PABA 3MM8A 4N77A 1U8SA 2QL7B 2MGZA 1IN0A 1AZSB 3LOUA 1XBWA 1UL3A 1SJ1A 2E5IA 1RT6A 1AUSL 2VKRA 4QZVB 5M2UA 3H7HB 3DOLB 3RW6A 4QJVA 2DK2A 1M0SA 1G1XA 4IFVA 2WVDA 4WCEQ 1PAUB 4MMOA 1GH8A 4EU0A 1YWXA 4HH0A 2ZVSA 3THVA 3A8KA 3US5A 2KXNB 1ZAXA 1PJ7A 2CQHA 2BJ7A 1Z2LA 1JJHA 1CLFA 3PX0A 8ATCB 2JOQA 3EVMA 4NLVA 4OYPA 3GP9A 2ZITA 1J27A 4MH8A 2ROGA 2DHSA 4CLPA 2J9DA 2IHR1 4NMLA 1R7IA 4M5HA 3S7RA 2RDJA 3BO4A 4UQGA 1U1MA 1IUJA 3LP1B 1WNEA 4NYPA 4P6QA 4KPCA 2V6AA 5L9NA 3SYZA 3UPFA 2OLWA 1QUVA 4UOHA 1LFWA 3OW2R 1HNXF 2BANB 1FE0A 1S7IA 2YWFA 1VQPS 2FLLA 1BQMB 5LMNF 1TL3B 3GCWP 2Y9HA 4QU7A 4FKYA 3WQPA 3TZWA 1JXLA 4X65J 3D66A 1KLNA 2VA3A 1FJEB 1T03A 5KOWA 2GW8A 2IRUA 2AGQA 3J80Y 4DX7A 2R7RA 1CULB 1GX5A 3BGLA 5HMWA 1BC6A 3IR6B 1DHMA 1BMQB 3WX4A 3OTOJ 2J9DE 4DS5A 2GQ2A 3MMAB 2OKQA 3SXLA 4DPWA 3VALA 1RBLA 2GMLA 3CMQA 2KZMA 2XZDB 2G9OA 1KD1T 3ZZ0A 1PYSB 2FZKB 2XS5A 3JTPA 3CVKA 2COLA 3W1YC 1EETA 1U6BA 3QO9B 3WX8A 3LO3A 3H8YA 1IKXA 1CJUB 3M8WA 4O3QA 3G96A 2JEGA 2WSFC 4B9MA 4KHRA 4LFCF 4WKRA 3PW0A 2B9XA 3B78A 2VIHA 1SC1B 2W9CA 3D0HE 4ERDA 4J9MA 1RT7A 2WSCC 1GFWB 4RL1A 3BSAA 4DR1J 3T41A 2GMJA 2FVSA 4I2QA 1IM4A 3DLHA 2XCAA 4TQRA 4C0HA 5DM6Q 2YPYA 1HNZF 1NLKL 2DGTA 1IWGA 3M32B 2BJ9A 2ZH7A 4WE1A 3KLEB 3MURP 1C1BA 5HBMA 4ID8A 1RYSA 4O3OA 5K5MA 2M88A 4ANCA 1HBMA 2ZD1B 1WORA 1B64A 4JI8J 2ZJRQ 3CDEA 2ZDPA 2AYGA 2R42A 4I7FB 1CQMA 1IKYB 4Y0FA 2G2OA 1H38A 2X1FA 2ACMA 3ZO7A 1NK6A 2W4CA 4DJBA 4UT4A 4O4RA 1FKPB 1H72C 1RT1A 2R9LA 2QRRA 4B02A 4DV7F 2ALYB 4ZPWR 2EFOA 4WXOA 1F5AA 2WB4A 1FNOA 3PYGA 4G1PA 3I6PA 4L3NA 4EK2A 3HHLA 4PWWA 4CO1A 1HWKA 2FGOA 4G1QB 4KBIA 4ER8A 3DRSB 3G8QA 3HT3A 2WRMA 4CH7A 4DV0J 3L09A 4LFBF 1UJ4A 5F8NA 3KK1B 5LOQA 1B0VA 4N7TA 3GV7B 1S1TA 2RQKA 1HHQA 2ZBCA 4IDKB 2DPJA 3GQCA 3NAHA 5AXKA 3M6UA 4H4OA 1KBRA 5D15A 3VHQA 1ROFA 5A2QY 4B9UA 3U02A 1IR0A 2AGPA 4M5KA 1LW0B 2XYGB 2RQCA 2ZJPQ 4LJMA 2AD9A 2CQPA 4NLPA 4B9TA 1Q8IA 2HHVA 2OPSB 3QQCD 1JWWA 1BLUA 3HZEA 3D1OA 4JI1F 5IT9Y 1LV5A 3HVAA 2HWTA 4ED4A 2BQUA 3M9MB 4J9RA 4WP3A 1LNQA 2BZ2A 1WC3A 3LP0A 2YWGA 3FGVA 1SIZA 2IFXA 5KG7A 5IWAF 4N8OA 1PYOB 5KFNA 2DR5A 2OFGX 3BM7A 5KT4A 4JI2J 3BBBA 5H9FK 3V4IA 4OZ0A 3N6MA 2IDLA 4LUBA 4RZRA 2VBZA 3I82A 2QIFA 3K8WA 4J9UE 1XMOF 1HNXJ 2BE2B 4A8OA 4QPXA 4ZCIA 4DFPA 2W2NP 4CLZA 1S77D 1F5CA 3L7PA 4IO9Q 3VVUA 1JMTA 2AEMA 3BDPA 4B9SA 1R8CA 3TAPA 3ICLA 1FDNA 4M5DA 1MWZA 2WOMA 4KTQA 5L9XA 4NEYA 3TVKA 2BBEA 5LT5A 2HZCA 3P5BP 1OS5A 5KFLA 3DXSX 1TMMA 4RUAA 5CH7B 3UD5A 3AAWB 3CUNA 4B3OB 3ZTQA 2HBYB 2UUBJ 1TKTA 2VU5A 4CCHA 5JUMA 1OMSA 5T14A 1QSSA 4PPDA 4LF5F 2UZAA 4TY8B 5M2RA 5HVGA 1DTTA 1U6ZA 4WFNQ 1GTEA 2ROEA 1FDBA 1N5SA 3FQLA 4ZJQA 1RWOB 4LRAA 2OEMA 2F65A 4J90A 2QLWA 4RW7A 2BJEA 1RAFB 1JKHA 4LF6J 3L7OA 4NE9C 1X4EA 1B4SA 2M3DA 3TUIC 2JLGA 1NEEA 4PKDB 2IBOA 3OR1A 4ANDA 5A8KA 3OVSA 2ZVIA 3BH6B 4W98A 3EE3A 4C0OC 1NCLA 3K58A 4NZ7A 2EWHA 1CVJA 2RMLA 1VBZA 1C2PA 3MCMA 3T1HF 2HQGA 3LTOA 3SZ2A 5KT5A 1X31C 4K4UA 3VGTA 2E9TA 4Y3CA 5F41A 1KTQA 3QZ8A 3R5GA 2QFJA 3BSNA 2H51B 2JZ5A 1LWFA 3FFIA 3UD4P 1WKKA 5IM0B 1DQ8A 4QR0A 4ECTA 2HG4A 3QGHA 3O44A 2QA4S 2YKNB 1HNZJ 4ZMMA 1F9HA 2CDRB 2UV8A 3CJ8A 2FVPA 5E3PA 9RUBA 3GR0A 3GTYX 3NKYA 2HS0A 1XIQA 1NK5A 4TNOA 4HACB 4IFYB 4JI4F 1X4AA 2JSXA 5DDOC 2Y1LB 5U47A 2G1DA 3QATA 3RJMB 1RGVA 3BGRB 1KQKA 3A13A 1TFYA 2BABA 3FEYB 1S97A 4K2XA 2BACA 4WIQA 3V5RA 2POKA 2RSQA 5F8JA 3GFZA 3VAIA 3N4WA 4NOHA 4H4MA 2MZRA 4ES3A 1LWEA 2RDDA 2AU0A 2Y8YA 5C25A 5IV4A 2XEXA 3TEGA 1RHJB 3NCQA 4LQ3A 3H90A 2HVDA 5KFKA 4J9PA 3J7Z5 4DV6F 2E1MC 3E01B 1RAOA 3GSIA 2DGUA 3RBXA 2IJNA 1VQSA 3LALA 2AQ4A 2OEJA 1N34J 1R6YA 4Q0BA 5D0HA 1HA1A 5A2QU 1TELA 3PO5A 3BQ1A 4LF7F 3V6KA 3MPYA 3EJMA 2KZZA 3C66A 4Q8FA 4B3RF 1ZM2A 4I6AA 4OZJA 3BKFA 4OHZA 4CLKA 2RHQB 4JI1J 3GLJA 4OQJA 4B9NA 2ATLA 4O4GB 1U09A 3KJVA 2E5JA 1WOPA 4J9SA 2AF6A 1RWKB 4P9SA 2YQ1A 4OI2A 3KLGA 5IWAJ 2OH2A 3ZZTA 2NUUG 4TU9A 4O3NA 5HATA 1K44A 5DJBA 1REVB 3M7VA 3HP6A 1SKSA 6FD1A 4URGA 1YQHA 1RTIB 4ZVGA 2KG0A 4UW2A 3UDEA 1ZETA 4TYAA 1PYTA 4A8QA 3D2WA 5ITHA 2KFZA 4LSLB 2MSTA 3PO4A 2ZFHA 5MLCV 1CJTA 3BDEA 4FS2A 1Z2ZA 2R8GA 3H4DA 3IA0A 2YWKA 3TJ8A 2YX1A 1UFWA 2GZOA 3FMWA 2DEJA 2Z4PA 1S9EB 2W7PA 3O1LA 1E6VA 2MQQA 3DOMA 3CWJA 3D1HA 3WIVA 4ILMA 3PEJA 4MKBA 3U1NA 1HNWJ 2I6WA 3GWCA 2CADA 1IR1A 5IZHA 2HS3A 3PHTA 5B08A 3UW1A 4LRBA 4F4YA 4HT5A 1M1HA 2RU9A 4QYZK 1OYDA 1X4CA 4JI6J 2KRRA 3LAMA 4ZCMA 5ETTA 4LF5J 2BKPA 3BO3A 1SQGA 3DI6A 2KYXA 4LR9A 4K7QA 3TUJC 2BQ3A 2ERRA 1NU4A 4RPFA 4EFAC 4OX9F 4LREA 3HVRA 1U47A 3DHXA 2AJ4A 1FWPA 1TKDA 2V2QA 3BBFA 4A8FA 2DGVA 1KOOA 1NPKA 1VC5A 2JDJA 3CCMS 2C3UA 1FFSB 1J5EF 4DI6A 3IWNC 4K50A 2B8PA 2J7KA 3NAIA 3Q8RB 2DJWA 1MLAA 1WOSA 4P7VA 2CG4A 3NGTA 2IYGA 3R9LA 2HAFA 3TVYA 3T1HJ 3G6XA 4KHPF 3HFVA 1B99A 1WHXA 5B0EA 1P8GA 1S72S 4M94A 2B4PA 4LF4J 5HLFB 4DR6F 2N4DA 1RISA 1TR0A 1ZTWA 2JL9A 4DF4A 1KHWA 2PMZD 1L3KA 2MHEA 3SCJE 1AFJA 2MEWA 4DUYF 1Y5NB 4MIWA 4JBCA 4M5NA 3QIDA 1H7XA 1RT4B 4FBUA 4KGXB 2KHDA 4HEA9 4JI4J 5CD4A 3U27A 4X4UA 1BE4A 3WIUA 4YEAA 3MMJA 2UVVA 4WFXA 4L75A 4F2RA 1CQNA 3HD2A 3LP2A 4CT9A 4DLGA 2OMOA 3T5HA 3FKBA 4FF2A 3GFXA 2L41A 4H4KA 3CCTA 2QA2A 1NZ8A 1S9GB 2RF2B 4P75A 3A1YG 4GRSA 4U96A 3W2WA 2YX7A 2CWKA 3OL9A 2SXLA 1JLFA 3MM5A 4DV6J 1TQLA 1YJVA 2HNDB 3QLHB 3D6HB 3MM7B 1XQIA 5C24A 2YNGB 2ALZA 2XBPA 4NRUA 3CDUA 5DM7Q 2E44A 3FUYA 1Y3KA 2GIFA 5C2GA 4GVBA 4NCBA 3KDNA 1KRPA 1PC4A 2Y1IA 4RUBA 1XJWB 4DR2F 1S6QA 4EBEA 5GMKa 1U1LA 2F8HA 1XWLA 1U1QA 4J9OA 5J1EA 3JB9k 5CYMA 4PWUA 2YKPA 1SVDA 6FDRA 4DSEA 1SC6A 4A8XA 3I5BA 1KWMA 3HHNB 4RUCA 1DY3A 4ED2A 1AB8A 1FI4A 3MEEB 2GGPA 4JOUA 2C2OB 1RYRA 4WFBQ 4YY3F 1R8HA 3W3SA 2DYAA 4M1KA 3J81j 3QSIA 3MDFA 5AT1B 2CJQA 4DL3A 2DH8A 2CNNB 1PAEX 1VQ8S 4F04B 3ENQA 1L3TA 2CPEA 3C16B 2EK6A 4X4OA 2Z57B 1LW2A 3M8QA 4RW8A 3MEGA 1U1PA 1K73T 1U0SA 2P6TA 2EEYA 5J2PB 3T1YF 3HLUA 3GFHA 4OLOA 1DTQA 1RBAA 4NLGA 1YHQS 1T3NA 2I8EA 3WHIA 1SBRA 1EQ0A 3FBFA 3NP5A 4KSEB 2MYFA 3AJDA 1RADB 2IRYA 3HT0A 2IM3A 2ZH4A 1NJZA 2W25A 2J6SA 3ILLA 2CPDA 1VLYA 5J2MA 1ZM3A 1RTDB 5ETNA 1T8EA 5IT4A 4C11A 1RE1B 4RW6A 2BYCA 1CJUA 1JLEB 1Q8BA 3DYAB 2VZ9A 3OJSA 4ECQA 3H5SA 2DGOA 2QYCA 1U2RA 2XTJP 1W2BR 3CC4S 5KFTA 3BR8A 3MM9A 2M9KA 1F0XA 1T9YA 1FRIA 1KTVA 4DUTA 4EO8A 3TX8A 1S1UA 3AFGA 2APOA 1J5EJ 1OPZA 4HI2A 1V3RA 4N8NA 2Q66A 2UUWA 2VDHA 3SV3A 2RB7A 4OZ1A 4ZVRB 1XR7A 2AZ3A 4Z37A 2MZTA 2YH1A 1N5YA 3PDNA 1WF0A 1MMNA 1N36F 2UU9F 3EM1A 1DZ5A 1IJEB 3A4TA 2X3DA 4O0IA 4RUHA 4KHPJ 3RU0A 1YZ7A 1WC4A 2DVIA 3M05A 1UVIA 2VL1A 1HNVB 1RACB 4CT8A 2L08A 3BGOP 3HSJA 3JSYA 1YTYA 4DR6J 2PD1A 4PUOA 3CSKA 1FO1A 1FJ7A 3L9ZA 5ETVA 1SJQA 2WSEC 1IKYA 2ZZMA 5HK4A 4CTAA 3GYNA 4A8YA 3AXMA 4DUYJ 2MKYA 1SJFA 2CXEA 2B43A 2P2CB 5J2NB 4YMEA 2E5LF 2J6UA 4NRTA 4C3KA 3SMZA 5DQGA 1KHVA 2MMYA 5AJ3F 4MK7A 2DXDA 3N01A 5DS7A 5F3TA 1LXNA 1UA0A 1ACMB 3DRPB 4RJVA 5IS2A 2MZQA 5RUBA 2CJYB 4USWA 5B0BA 1UWBA 4DN9A 3PRVA 4IH5A 3TA0A 4G6VB 1S1VB 3ZZUA 3OSPA 2KJWA 5JJBA 4URQU 2V68A 3CCJS 1N32F 1RAGB 3KOAA 3KK1A 1NSAA 3OXFA 4DSIA 4CQ1A 3IGVA 1C4CA 2HPUA 3DGPB 4K5SA 3PV8A 2YPZA 4YR3A 1F3VA 3IWLA 4YP3A 4C8ZA 4ZPCA 1FK9B 4WWSA 1WI6A 4NZ6A 2J0SD 2CQ1A 4IKAA 1FCAA 3BN4A 4UOGA 3DOKB 2JLEA 1XMBA 1WG4A 3PNIA 2ZM6F 2HBRB 1N8RT 3GIKA 4TU7A 3PJ9A 2J7UA 3M1VB 5H9EJ 4NCGB 1RTHB 3HCXA 4OV1A 5EHHA 3OPKA 1NZAA 3WZ0A 1VQNS 3MEDB 4JUZA 4EGLA 4IO1A 2JFKA 2G2ZA 3U1LA 3JAMU 2CJ9A 1RSCA 1Y4ZB 1FXLA 3TA2A 2X1AA 3CJRA 5I3UA 1SUQB 2DXEA 4WZMA 3MR6A 4KE5A 1HI1A 3GYXB 3VQSA 1UKUA 4LSZB 1GEHA 4LR8A 2KT5A 3SFGA 4YY3J 2B4OA 4DMZA 3VAJA 2XMMA 2W9BA 3KLIA 1JLCA 4IG0A 1VGYA 2IVFB 1Q5VA 3SV4A 3CJ5A 2GHWA 2Q6CA 1WSVA 1WUUA 1XK8A 3PW4A 1Y5LB 1URNA 1HQEB 1NBEB 2Y1RI 1K1QA 2BJDA 4XDCA 2EFQA 5CXTA 3IRXA 3C8YA 2D3O1 2XULA 4RW9A 5A8RA 2MY7A 5LSOA 2HNZA 4ECXA 3NLCA 3NCPA 4FXWA 3S8SA 5CYQA 4EO6A 3O6QA 1S57A 5DDPC 1VISA 4FP9A 3MM8B 2DH7A 3CMAS 3ETOA 3TI0A 2WHOA 2MGZB 1HMVA 4LRDA 4NMXA 2UUCF 1YGYA 3P5TL 5HJXA 1T05A 1WJ9A 2KJVA 5HVHA 1X9WA 1NSQA 3GE9A 1NDLA 1Q8KA 2UV8G 1QAJA 3VAHA 4X62F 3UNGC 3OTEA 1WWHA 4IFVB 3PJXA 3S6EA 1TV6A 1C0TA 5LJ5Y 1Q95G 4ZP6A 5GAHI 3KKFA 3W9IA 3QGIA 2HHXA 3NOGA 4AL7A 3DFEA 3G2XA 1U1OA 2IAJB 1Q81T 2I5JB 4DHVA 2YNFA 1JLQA 2E1RA 4KRWA 1TK8A 1U6FA 2N3OA 3GJTB 5CHCB 3LGHA 4OI0A 1F5BA 1S10A 2FHJA 3J81Y 1IJFB 5KTQA 2UU9J 2IYIA 1VJWA 1WEXA 2DRBA 3DGVA 3H5XA 3DMJA 3I5CA 4Q7AA 1D8YA 3KHGA 4B3SF 1TKXA 4ZVQB 2E1CA 2VBXA 4K4YA 3IS9A 1T03B 3MZIA 5CA5A 3LANA 2FPHX 3AH6A 1EARA 1TK0A 4DV4F 2XMVA 2GQQA 1K1SA 3VZIA 2GO8A 3BO2A 2QMWA 3DN9A 3OJUA 3R5BA 4CI0B 1UZHA 4CLFA 1F2GA 2E5LJ 3OR2A 4GC6A 1RWUA 3R8YA 2LQJA 2U1AA 3GJQB 1OYEA 1YX2A 1FXRA 4LQ9A 2OTLS 2QE5A 3SBMA 1VR6A 4L6V3 4CLWA 4B9LA 3CE8A 3GMGA 2BKNA 5HVFA 3ENVA 1EETB 2JVOA 2ZNYA 1NHVA 4CO4A 1IKXB 1FDAA 1Q7YT 3OSNA 3D1QA 2XGPA 1OSCA 1RTZA 1WG1A 1FF2A 3JSRA 2W9CB 2DCLA 3UCUP 2M70A 2R7UA 4RNHA 1EP4A 1U0HA 1B7FA 2XWYA 2JJ4D 2MKHA 4YQWA 4I2QB 4UOCA 3ELHA 2CNKB 1FX4A 2JNJA 1FESA 1XTZA 4WE1B 2MXYA 5F9LA 1WC1A 4WTYA 3TYTA 4FVCA 1C1BB 4OX7A 5HBMB 3P6YC 2ZHBA 4DWIA 2K1RA 2FUG9 3MR2A 4X84A 4NI2A 2IVYA 3V6HA 1HBMB 3MCSA 2NXNA 4CLTA 4QU6A 2RS8A 2VQFF 4CWBA 5ADZA 2GMHA 2ZH2A 3JXOA 3DDIA 1K9MT 4Y34A 4DBQA 3MAQA 4LSLA 2UVWA 1KEKA 2W7AA 1RAHB 4C8MA 1AW0A 4DQPA 1PBAA 3HXMA 4Y2KA 4F50A 3B4MA 2HHHF 2L9DA 4QIWD 1RKIA 1OQ3A 1VRQC 3HKWA 2PI5A 4ZVOB 2MQNA 2VG7B 3D54A 1WC6A 3CDBA 5AXLA 3CJKA 3NNAA 3LGMA 1YJUA 1NK9A 3HHLB 1R3NA 2B4VA 3BREA 2LXUA 1QSYA 2CPXA 3RYLA 3C19A 3EGZA 1UVKA 4ID5A 1BQXA 1S1TB 3HHLD 2ZHAA 1Q16B 1SL2A 1T9XA 1WKJA 2JH3A 2VBYA 1JLAB 4H4OB 2XMUA 1PIEA 1X5OA 2UUCJ 3M8PA 2WBMA 1GT8A 2LCWA 4IUFA 2DITA 3EUNA 3M2VA 4J9NA 4KPYA 2PE8A 5D0GA 2PGCA 3R6LB 4OI1A 2IJFA 3DLLQ 3CIZA 1F9FA 5KFFA 3G9CA 2A0FB 3T6JA 1A7GE 1RT5A 3EGNA 2R8HA 3EXYA 2HQFA 1PJ5A 1PSDA 1C4AA 2IVMA 3LP0B 3OXLA 2O1PA 3KLVA 2V34A 5CYJA 1FD2A 2R8IA 3SQOP 3ZZPA 1WHVA 4CO5A 3FDSA 5C42A 3GIIA 1R6VA 2RILA 2VQEF 3V4IB 2BKOA 3J81U 1XN9A 2PN6A 4B9VA 2LQ8A 5KFGA 1FWLA 5KT6A 3BJYA 4PG5A 2FY8A 2RNEA 4JI0J 2AT1B 3SCLE 3A12A 2GX8A 2MTLA 2FZCB 3PRBA 2GAHC 2V8VA 3GG0A 4DZDA 2P9GA 5F8LA 4B3SJ 3DXBA 1RT4A 4MKYA 2CJBA 5I4MA 1VQ6S 2ZC4A 1N52B 2BW2A 3RW7A 4P10A 2DH9A 3F41A 5C2CA 2AV5A 4ELVA 4M5DB 5D6GA 2WZ1A 2ZWPA 3KG4A 4GC7A 5I42B 3I56S 5THWA 2E29A 2HS4A 4IQMA 1YRXA 3BYRA 4O23A 4F4ZA 2ZBQA 3O3LA 4PG6A 1TKTB 3HHKA 4AXIA 2N3LA 1JQGA 2WVBA 3ZTOA 5LSRA 1DTTB 4CP5A 1X4BA 3GV8B 4A47A 2OPPA 2B9EA 4R0JA 1R89A 4DEZA 3F0NA 2AX0A 4DSLA 2BV3A 1FKOA 4WU3A 2GO9A 3N9UC 1ZAVA 2H9ZA 4RW7B 3W66A 2MQ8A 1B70B 1JKHB 5A0YA 1FJGJ 4ED3A 2XG8A 5B09A 5ETOA 3A3PB 2EFVA 5GAHU 4EZ6A 2QFIA 1VQ5S 1UJ5A 1Y11A 3OR1B 2CA9A 5A8KB 3UE2A 4GO7X 2XHCA 2QA1A 1C0UA 1QVFR 1ZBTA 3VCDA 3QT5A 3UN5A 1T3OA 4A8MP 4A8KA 2UUAF 4M5GA 2VODA 3IG1A 2GIQA 1M5SA 2XS7A 3NGKA 3R2DJ 2V69A 1XR6A 1LWFB 3FFIB 4FKXA 4D3GA 2FJEB 3JSMA 2C2DA 2OUGA 2J0QD 3RAMA 1S9FA 5KFVA 5CCLA 3FSYA 2GNKA 2R2RA 3CCZA 2DD8S 2I1RA 2N7YA 5KFIA 3KLFA 2H5JB 1FRMA 1S6PA 4DL7A 2XSFA 1HWJA 1KQGB 5HI7A 5HAOA 3UN2A 4A8WA 2JX2A 5E3QA 4I0WA 4PWDA 2GVDA 3AQPA 2OGUA 4F2SA 2DNKA 2OPRA 2LXIA 3HKZD 4N76A 1VRUA 1FNXH 2OTJS 2C2KB 5KFOA 4L72B 2O67A 3MFIA 1RLDA 2HHHJ 5LXYA 4IH6A 1BD6A 5DO2A 1X9SA 1SJRA 4RBVA 2WONA 3T5JA 3LAKA 3FRYA 2Y0SD 3I0RA 1UA1A 2YWHA 4H4MB 4WZQA 2M52A 1LWEB 5C25B 1ZA1B 2RRAA 1T9UA 3KJNB 4C8YA 1PO6A 4OI6A 5GVQA 1N5QA 1U1NA 3N79A 1Y10A 1KONA 3ENWA 5HQ8A 4Q0BB 3CEDA 4ZN1A 1PKUA 3TQ1A 1HWIA 5BYRA 4Y2IA 3KXDA 3Q8UA 2EBGA 2QMUB 4P72A 1S4FA 3GG1A 4DU8A 1N5VA 4AUKA 2V9WA 2JHEA 5HP1A 3Q23A 2M0GB 2FHKA 1Y5IB 1Q82T 3OFGA 1MWQA 1P6TA 3WDOA 2R2SA 2ASYA 1X60A 2HRTA 1FVSA 2EVZA 3AB2B 3CIMA 2Q6BA 1H73A 5AE2A 5J2QA 3C6UA 3VR1A 3RUBL 1VOMA 3KJVB 4PAAA 1YRTA 5J1NA 1FVQA 1VQ7S 3NGDA 3D7SB 1SV5A 3V6DA 2XCPA 1VQLS 2FLPA 2A18A 2HYIB 2PFDA 1JJ4A 2EPIA 3KLGB 1FTCA 3BQ2A 2RDIA 3B54A 1NK4A 1XMQF 3T19A 2MY8A 2IMWP 4YB6A 4H54A 3G6VA 3K59A 4OJ1A 3J7YI 2VQEJ 3CCLS 3IBCB 2OPQA 2UXDF 1TZ0A 5D4PA 1VBYA 2MZ1A 2KM8C 5KFZA 2WAQD 1G3OA 2D3ZA 2FQQB 1W26A 4DX5A 1GK8A 1NPRA 1E6VB 3DOMB 5D4NA 4U9RA 2DT9A 2WB1D 3ZTSA 3DM2A 2VDIA 3PRDA 1KVJA 5LXRA 3KTQA 5KFSA 5AE3A 4LF1A 3I96A 4I4BA 5FJ4A 5EWFA 2RQ4A 2MQMA 3PFEA 4NLRA 1M5OC 5GMEA 4F3QA 1IBMF 4UUXA 1N0UA 4WFYA 2GC8A 3CNQP 2LEAA 1FEEA 2YY3A 2P8IA 3DLGA 3C6TA 3MAHA 1JLGA 2MDAA 3C46A 4Y2AA 4DQSA 3DI6B 5F0WA 2VC0A 2LEPA 1UP1A 2RAQA 3I9ZA 3UN3A 4WPAA 3Q2SC 3DU5A 3TJAA 2RUSA 2Z58B 1QUPA 5KG5A 1J2VA 3PTWA 5F0UA 2XNQA 2Y8WA 4JI3J 3W61A 1OQ6A 1RHRB 4ZJOA 4WP9A 3GJSB 2GA7A 3W8PA 4QWCA 3KUGA 1GNKA 3C15A 3T9NA 5HSPA 3RRHA 4U95A 3OVAA 3K5NA 2VFSA 1ITPA 3JYTA 2IM2A 4DSKA 3OFHA 4KH1B 3W60A 1KR4A 4DPYA 1HI0P 3MEDA 3FNNA 3PX4A 3BKUA 5B7WA 2GFFA 4D3HA 2IA0A 4DV3F 4UZBA 1RCOB 2LA4A 3PIPQ 1AXQA 1TUWA 3JS9A 1ZYQA 1OO0B 2GCFA 3DNCA 3MD3A 4KV8A 3U1MA 2KG1A 5DG8A 2DHGA 2Z8QA 5KFMA 1MU2A 2BE7D 2DNZA 2UXBF 3ZNUA 1PILA 4DR3F 3G71S 2ASLA 2FJXA 2ZBIA 1NKBA 5A8WA 1D9AA 1NJYA 2DNMA 3N5FA 2WCXA 4OX6A 2ZJQQ 4CYUA 3PHEA 1RAJA 2PDAA 1JNRB 4X64F 3EDRB 3EMTA 3IR7B 3LP2B 1A9NB 4P73A 2HNYA 1BWEA 3GILA 2DIUA 1ZPVA 5T7LA 1R8AA 2QL5B 4KGZB 5KG6A 2VUGA 1HWUA 3GR1A 3RBDA 4PXDA 1NXIA 3PYEA 2JC1A 1S1XA 3W2WB 2WTFA 5B0CA 1JLFB 3MM5B 2C2MB 3POTA 2J0XA 3RRGA 3MFHA 5K8MA 1LQ9A 2XY7A 1UAWA 1ZS6A 4FF4A 1QY7A 2IMOA 3CXCR 3V6JA 5L1IA 3H2VE 2CZVC 3G87A 5C24B 3MAAA 2QG9B 3BGUA 1G2EA 3EDQB 2HZAA 3GYGA 4HH1A 2GHVC 4GVBB 5EUHA 1SXLA 2LA6A 2V63A 3Q8QB 5D8HB 4DV2F 1S6QB 3VZHA 5J1EB 5CYMB 3CJQA 2LQ9A 2NSCA 3VQTA 2IAJA 1R0AA 1HNIA 2I5JA 4DFMA 2KT3A 4LVOP 2GV1A 4RKUC 3ADAC 2ATCB 4DF8A 2FJBB 2GGPB 3DDKA 2Y3YA 4BLGA 2R2TA 2CRLA 4K4TA 1H2VZ 3PYFA 3FK4A 2ACYA 2WBRA 3B8HA 2CQDA 3I0SA 2AYBA 4OYWA 4FPIA 2ZBRA 2MLYA 3NXZA 3BSCA 4C97A 3H2LA 2OSRA 4XTTA 4GKJF 2CJKA 1M5PC 2UXDJ 3G6YA 5D3GA 3HVWA 3UDCA 4CO2A 2MQOA 1LW2B 2FB0A 3M8QB 3W8GA 3M9NB 1NDPA 4RW8B 4X66J 3MEGB 2FLNA 4DX8H 4PPZA 4Y2MA 1JNZB 4CZCA 4WKYA 1RXOB 1XR5A 4L74A 1DTQB 2HWIA 4DL0C 3ITHA 2DCUB 2NSBA 3NMRA 3H20A 2F8MA 2MQPA 1IM6A 3TNVA 4OJ3A 1IBMJ 1U24A 1HW8A 4ZDNA 4ECVA 4J91A 3M8SA 4F7VA 4LBPA 5J2MB 1DBDA 4U6PA 5L8RC 4C11B 4RW6B 3FEXB 4NZ0A 3MPUB 1SQFA 2DHAA 1HPZA 2BM1A 2V0NA 4IG3A 3QT7A 1HQUA 2XS2A 3MM9B 1UEKA 2PFFB 2QLJB 4RWXA 1HFEL 3K7RA 5BYSA 1S1UB 4QR2A 2G13A
chains in the Genus database with same CATH topology
2UUWA 1RA6A 3SV3A 2RB7A 3A8EA 2F4VF 3PW2A 4OZ1A 2D1CA 3GB0A 3HK2A 1XR7A 3CCWA 1V9OA 2MKSA 3HO1A 4IR9A 4Z37A 3SFUA 5DLGA 2MZTA 3MUVP 2KFNA 2YH1A 4GKKF 1N5YA 2LVWA 3PDNA 1VBXA 1WF0A 2B0GA 4WYWA 1MMNA 1N5YB 3OTCA 1N36F 2YQ3A 3GFYA 5CZXA 5GAGI 2UU9F 1DZ5A 1IJEB 2N82B 3MUMP 2EG1A 1FHTA 1T7PA 2J9CA 2KRBA 3J7ZT 4O0IA 3TO8A 5CD4H 3RBEA 3IWXA 4RUHA 5GAEU 1D3WA 3J7YU 3IN5A 3RU0A 2RS2A 4X65F 3EPGA 3UWTA 3CC2S 2QA4G 1HARA 4NLDA 2DVIA 1HNVA 3M05A 1X0PA 1UVIA 1HYSA 2VL1A 3BQ0A 1HNVB 4TLRA 4QIVA 1X0FA 1HYSB 4CT8A 2L08A 4ELUA 4HKQA 3JSYA 5CCMA 4X4NA 1YTYA 3V81A 1VK8A 4MFBA 1R31A 5KFPA 1CEZA 2PD1A 4PUOA 1GAOA 3WC2A 4MFBB 4FPRA 3TP2A 3CSKA 4PUOB 1FO1A 2R8KA 1FJ7A 2M8DB 1H7WA 1SJQA 4X66F 2F3JA 2IM1A 1FRLA 4ATNA 2WSEC 4C98A 5KFRA 2Q79A 3QJLA 5LJ3Y 1IKYA 1SI9A 1TUVA 2AGOA 2ZZMA 4QYRA 4ZPVR 3NNCA 2K7KA 3ZZYA 4CTAA 2E7XA 4GMKA 2W8KA 3GYNA 4HTIA 3M2RA 4NLSA 4CTAB 4A8YA 4V19X 4IRDA 2ADBA 3NS5A 1HBOA 4C3LA 3M2RB 2ASDA 1IKWA 1HD0A 2JEFA 2K3IA 5H1SV 3HHDA 1HBOB 4BWJA 1LK7A 1SJFA 1IKWB 1VQOS 4TN2A 1YVFA 2ZH6A 1S6OA 2B43A 3SEOA 1RP5A 5J2NA 2B7CB 2R7WA 2CFXA 5EX0A 5J2NB 4YMEA 4E8UA 2E5LF 2J6UA 2C2RA 1X9MA 1FD8A 4NRTA 4C3KA 2XI3A 4I56A 4ZS6A 3SMZA 2VG7A 2M2BA 4C2MA 4XAKA 3SSRA 1KHVA 4I68A 5DQGA 2MMYA 5D78A 2ILYA 5AJ3F 2CVEA 1ZAWA 1NO8A 5B0DA 5EX3A 4MK7A 1H3DA 3DRPA 3N01A 5DS7A 5F3TA 1LXNA 1UA0A 4WFAQ 1OPIA 2EC0A 3DRPB 1CG2A 5IS2A 2CQGA 4EYHB 4F3OA 2MZQA 1RJJA 3DDNA 3KNAA 1ZPWX 1TFWA 5B0BA 2MJUA 1Y9OA 3TARA 1DQAA 3CJ2A 1UWBA 1X4GA 4OZ5A 4DN9A 2FLOA 1N0VC 4IH5A 3TA0A 1S1VA 1UWBB 2E5GA 1IXKA 2F8EX 2HMIA 4G6VB 1S1VB 1TP7A 4O3SA 3ZZUA 2HMIB 3OSPA 3QMQA 2KJWA 5IQ6A 4URQU 5JJBA 3WC0A 4N5SA 4Q45A 2RU3A 3CCJS 2VOOA 4K4ZA 1N32F 3FVYA 3KOAA 1Z1ZA 3KK1A 2DO0A 3ISNC 2ZZNA 3OXFA 4K4VA 4DSIA 4CQ1A 2X51A 4KIAA 1VC6A 1DRZA 3IGVA 4LMZA 1D1UA 2V4QA 1C4CA 1CC7A 2BM0A 3ISZA 1SIWB 3DGPA 3N6NA 2AWZA 4NWBA 2XO7A 3P3DA 3THPA 3PKMA 1G7CB 3AHPA 4TYBA 3OQ2A 2HPUA 4K5SA 4NXMF 3ZFVA 3PV8A 1YI2S 2KM8B 5E5NA 3DLEA 5HMZA 3OHAA 5DQHA 4YR3A 1TAQA 1FK9A 3DLEB 3IWLA 4AL6A 1JLAA 3I31A 4YP3A 1YITS 4IR1A 4ZPCA 4C8ZA 4RBTA 1FK9B 4TXSA 4PRFA 3FQKA 1WI6A 4NZ6A 4QWDA 2J0SD 2CQ1A 4IKAA 1FCAA 1ZM9A 3BN4A 3G86A 1N48A 5KFUA 3DOKA 4ICLA 3R5CA 3DOKB 4ICLB 1SJ4P 2JLEA 1XMBA 2LDIA 4KFBA 2LKZA 2OD4A 3EYZA 4KFBB 1M1KT 2MQLA 3NNHA 1S1WA 1WG4A 3PNIA 2ZM6F 3PJWA 1K8AT 2YNIA 1N8RT 2MHNA 3GIKA 1S1WB 2FHMA 2QO3A 3U7JA 4ECYA 1AFIA 3Q24A 2DO4A 4TU7A 4J9KA 2YNIB 4E0DA 2J7UA 2OJ3A 3OHBA 1MMLA 3PVXA 1U25A 3M1VA 1MMDA 3C2PA 4NPOA 3M1VB 1WACA 3LQVA 2KXHA 4AXJA 3MGJA 2ZC3A 5SUHA 5H9EJ 4ED5A 3CTRA 4NCGA 4A46A 2XLJA 1RTHA 3EZ5A 3PY8A 4NCGB 1N4LA 1RTHB 4OV1A 4DS4A 1FA0A 5EHHA 2XSJA 3GIJA 4QBUA 5HO4A 1RI7A 3OPKA 3I5AA 1NZAA 2XSJB 3WZ0A 3VAMA 1VQNS 1MWYA 1VIXA 4OHXA 4ZLPA 1HHSA 3I4PA 3K8VA 2XY6A 2ZKTA 3OFFA 1A6LA 4NLWA 2DNNA 1ZM4A 3MEDB 4ZHRA 1HBNA 3TANA 1TK5A 4JYAF 5E2QA 2XLKA 3MOJB 4PCQA 2L9WA 4JUZA 4FS1A 3KG1A 4ZHRB 1HBNB 1WEYA 2Q43A 5FIIA 3HM9A 5AXNA 1HR0F 4OIXA 4RX6A 4JI8F 3MMBA 7FDRA 1NH8A 4NYZA 4EGLA 4KAIA 3PX6A 3MMBB 2JFKA 4IO1A 4Z2XA 5D77A 1JJ2R 3U1LA 4IRCA 2CJ9A 1Y0HA 1SUQA 1Y4ZB 2D7SA 3ZZZA 2E9RX 1RDRA 1FXLA 3TA2A 2X1AA 4Y2CA 5I3UA 1SUQB 2H5EA 4WZMA 3MR6A 4KE5A 1HI1A 4HL9A 5I3UB 1JXEA 3GYXB 3VQSA 1R8PA 1UKUA 2KT2A 3QWUA 4FNHA 4WK1A 2DR9A 4AE5A 2CIMA 3SDEA 4X4RA 4OHVA 1ZZNA 2DR7A 2KT5A 3SFGA 3SDEB 1WF1A 2I2YA 1N6QA 2B4OA 4DMZA 2CQ2A 3VAJA 2OAUA 1N6QB 4M95A 1KOHA 1X4DA 2XMMA 2W9BA 2HFOA 3KLIA 5J1PA 2PEHA 5L39A 1NK8A 2W9BB 3PEHA 4URSA 1JLCA 3KLIB 4IG0A 4MTPA 5K8NA 2J5AA 2R7OA 1VGYA 1JLCB 4IG0B 5A6WA 2LXFA 4HYKA 2IVFB 2XMJA 2ZDOA 3FRZA 4I6YA 5EWGA 1L3VA 4J5OA 4KO0A 3SV4A 3CJ5A 3D0GE 2GHWA 4KO0B 2Q6CA 3OL6A 1XK8A 3PW4A 4C8LA 2OSQA 1HQEA 2F9DA 1Y5LB 4KC5A 4K59A 1URNA 2EG2A 1HQEB 2X1GA 2Y1RI 4ZCLA 2FD2A 2M7SA 3DLKA 4LFAF 4DOZA 1U1RA 1K1QA 2BJDA 4XDCA 2EFQA 3M8RA 3DLKB 4B08A 1MROA 1BQNA 2XHWA 5CXTA 4IOAQ 3IRXA 3C8YA 1N54B 2QSWA 2XULA 4KKOA 4RW9A 5GADI 5A8RA 1MROB 1BQNB 1URRA 2HNZA 2MY7A 1YRUA 3IFEA 3IRXB 3NLCA 5LSOA 5KT7A 4RW9B 4KKOB 4ECXA 3NCPA 2DPIA 5A8RB 4B3MF 4FXWA 4JI5F 2HNZB 3S8SA 2B51A 4EUVA 5CYQA 4EO6A 1AROP 3O6QA 4LIWA 5DDPC 4FP9A 2YKAA 5CYQB 4EWTA 1S0MA 3RRKA 2D3OR 3DLJA 3MM8A 4N77A 1U8SA 2W4PA 3MM8B 2AYMA 2EFPA 2DH7A 5E7OB 2JRSA 1LK5A 5FLXY 2KXFA 2DNOA 5IQQA 2KH9A 1U26A 2AJFE 3CMAS 1IBKF 2MGZA 3ETOA 1IN0A 3TI0A 2WHOA 2MGZB 2YNHA 1HMVA 3K5MA 3LOUA 5DDRC 1XBWA 3TR5A 2YNHB 1UL3A 1HMVB 1NKCA 2UUCF 5KFWA 3OV7A 1YGYA 3P5TL 1DJ0A 2WW8A 1SJ1A 4XK8C 3M6VA 2E5IA 1T05A 2KJVA 1X9WA 1RT6A 3DRRA 3GE9A 3HJFA 1T05B 2CPZA 1J5OA 2G4BA 4DSFA 3DRRB 4ED1A 2R7QA 3DOLA 2VKRA 4QZVB 3LUYA 5M2UA 4OL8A 2UV8G 3BEGB 3DOLB 3VAHA 1QAJA 3RW6A 1DAXA 3BF4A 4X62F 3UNGC 4QJVA 3OTEA 2DK2A 1M0SA 1G1XA 1WWHA 1VIOA 4IFVA 2NXUA 4WCEQ 1CC8A 4IFVB 4JV5F 2ZH5A 3V2UC 4MMOA 3PJXA 3S6EA 4W92B 3C3LA 1GH8A 1TV6A 4YDXA 5LL6d 1C0TA 2KHCA 4EU0A 4YOEA 3I87A 1TV6B 5LJ5Y 1YWXA 1C0TB 4HH0A 4HI1A 2F1FA 2ZVSA 4HDGA 2N7CA 2BRKA 4ETZA 2BRLA 4ZPDA 3THVA 1U7LA 2DB1A 4DSJA 2AJ1A 5KFHA 4I1TA 5E0OA 3H5UA 4ZP6A 5GAHI 2B56A 2VC1A 4G3IA 3EZUA 3KKFA 4ZA1A 1WTFA 3US5A 2KXNB 1ZAXA 2E1AA 1HW9A 3QGIA 3MF5A 2HHXA 2CQHA 1Z2LA 3QZ7A 1JJHA 1CLFA 2Z2LA 4AL7A 3PX0A 3DFEA 2YX4A 2JOQA 4Y6IA 2V8DA 4NLVA 1U1OA 3KMQA 1AUDA 2ZITA 1V3SA 4ZCKA 2IAJB 1Q81T 1XERA 4MH8A 4DQIA 2I5JB 2ROGA 3SCKE 2DHSA 4C7QA 4DHVA 5I42A 3AJ2A 2YNFA 3AQOA 1JLQA 1ZZFA 2J9DA 2R7VA 2IHR1 2E1RA 4NMLA 1R7IA 5A6PA 2VA2A 2YNFB 4KRWA 3S7RA 3ZZRA 1TK8A 1JLQB 4ZP9A 5KFXA 1U6FA 2RDJA 3BO4A 1N5TA 2N3OA 2PO4A 1X4HA 3LP1A 5CHCB 1JLBA 4UQGA 1U1MA 1IUJA 2YKMA 3LP1B 4NYPA 4C0BA 2HWHA 1JLBB 4P6QA 3KHLA 2MKKA 1WNEA 2BVZA 4OI0A 5L9NA 3SYZA 3UPFA 1KQSR 4JV1A 4FXDA 3DU6A 2OLWA 1QUVA 1F5BA 2BANA 1LFWA 1S10A 3OW2R 4QIGA 2FHJA 2D74B 3J81Y 1IJFB 1VHFA 1FE0A 2BANB 5KTQA 1HNXF 3FSXA 4HT7A 1BQMA 2E9ZA 2YWFA 2IYIA 4WIIA 1TL3A 1VQPS 3P49B 4DUZF 4DN0A 1VJWA 2FLLA 1WEXA 1BQMB 2XY5A 2DRBA 5LMNF 1TL3B 3T5LA 2C3MA 3H5XA 1QLNA 3DMJA 4QU7A 3MECA 3I5CA 4Q7AA 1D8YA 3KHGA 4G1IA 4ZP8A 2HQ3A 4YHHF 2X3GA 2M8HA 3DMJB 3MECB 4LF9F 2ROPA 4B3SF 1TKXA 3MWBA 1JXLA 2V9KA 4LSNA 1TKXB 2RVJA 2J6TA 1KLNA 3VAFA 3J7A1 2QLXA 4LSNB 2VA3A 2KFYA 1FJEB 3W2VB 2E1CA 1T03A 2X1BA 2VBXA 4K4YA 1OSDA 5KOWA 3IS9A 1U4BA 1T03B 2GW8A 3MZIA 4Q5VA 3D5MA 2IRUA 5CA5A 3IS9B 3LANA 2FPHX 1FNMA 2FHJD 2VFUA 4RBUA 1Y3JA 3AH6A 1Q86T 2AGQA 2A3JA 5B0FA 3J80Y 1TK0A 2ZOGA 4DV4F 2LDYA 2VASA 1WTBA 2R7RA 3X1LB 2XMVA 2GQQA 1K1SA 2NYIA 1KFDA 2GO8A 3IGNA 2QMWA 2EK1A 3VZIA 4YR0A 3BO2A 4E98A 2CQ4A 3CD7A 3DN9A 3FMBA 3OJUA 1T94A 3R5BA 1GX5A 3PW7A 3BGLA 4CI0B 4HHJA 1M5KC 3AA9A 5HMWA 1TL5A 3B4DA 1QAIA 1F2GA 3HX9A 1BC6A 3OR2A 4GC6A 3IR6B 3OR2B 1DHMA 1RWUA 2J0WA 3WX4A 2J9DE 3MMAA 4DS5A 1SH2A 2IC3A 3T5KA 2ABYA 2LQJA 4W90B 2GQ2A 2MKJA 3MMAB 2U1AA 4PG8A 2OKQA 3SXLA 2O66A 2IC3B 1YJTA 1FXRA 3VALA 4LQ9A 2GJIA 4CO3A 2OTLS 2QE5A 4NLOA 2KU7A 4L6V3 3AA8A 4B9LA 1XC9A 3CE8A 4PQUA 1TAUA 2GMLA 1XEZA 2KB2A 4AL5A 4PQUB 2KZMA 4XIUA 3GMGA 3F44A 4KJIA 2G9OA 5L38A 1KD1T 1IBLF 1H6KX 3ZZ0A 1JX4A 2XS5A 3JTPA 3CVKA 3QO9A 1HBUA 2COLA 2VD3A 1EETA 1Q4RA 3M30A 3OXGA 3QO9B 1HBUB 1U6BA 3ENVA 3LO3A 4K0KF 1EETB 5MAOA 1H98A 3B82A 3S1TA 3H8YA 3M30B 5SZTA 1IKXA 2JVOA 3HI9A 1B0PA 2ZNYA 4O3QA 1NHVA 4CO4A 1IKXB 4FN5A 1FDAA 3H59A 3G96A 3CDWA 1Q7YT 2JEGA 2JVRA 3T6BA 3OSNA 2WSFC 3D1QA 4B9MA 4KHRA 4LFCF 5KG2A 4WKRA 2VBWA 1P9QC 2VPWB 3PW0A 2B9XA 4USIA 2XGPA 3B78A 1OSCA 1WG1A 4AQYF 1I6JA 1FRHA 2W9CA 1FF2A 3JSRA 2LQBA 3OLAA 3D0HE 2W9CB 2DCLA 3KK3A 4I67A 4Q43A 4R5PA 3UCUP 4M8LA 4ERDA 3KK3B 4LVNP 2B5JA 1S6UA 3FJ2A 4R5PB 4J9MA 1YG0A 2M70A 1RT7A 3PZPA 2R7UA 4RNHA 1EP4A 2B5JB 2WSCC 1FT8A 1UVLA 4CNYA 1B7FA 2XWYA 4PXBA 4FYDA 3LW5C 1EP4B 2MZSA 3BZQA 4ZVEA 3BSAA 2R7TA 2KI2A 2JJ4D 2L3MA 2GMJA 2FVSA 4I2QA 2MKHA 4YQWA 1IM4A 3DLHA 2XCAA 4TQRA 2DNRA 4I2QB 4UOCA 4C0HA 3MR3A 3PM9A 5DM6Q 4F8RA 3HHLC 2CQCA 5GAGU 1HNZF 3M32A 3LGNA 3KLEA 2DGTA 2V4JA 1YIJS 3M32B 1FESA 3GSDA 4WE1A 2ZH7A 3KLEB 1XTZA 5E3RA 1VQ4S 2V4JB 2A2DA 4WE1B 2MXYA 3MURP 2NZ4A 1C1BA 5F9LA 3IRWP 2W9AA 5HBMA 1NKEA 2E7WA 4ID8A 4WTYA 3TYTA 4FVCA 1C1BB 4OX7A 1RYSA 5HBMB 3P6YC 4WYLA 2ZHBA 4DWIA 2K1RA 4O3OA 4K4WA 4Y28C 4J37A 4QR1A 5K5MA 2K1RB 2M88A 2FUG9 4ECUA 5CQGA 2FHOB 3MR2A 2ZD1A 4NL5A 2HVZA 4PG4A 4X84A 4XDDA 2K7JA 2KTQA 3KNGA 2PA8D 1FRKA 1HBMA 2ZD1B 1LKZA 2CPJA 2IVYA 3UI3A 1QAYA 3V6HA 3PACA 4QOTA 4BWMA 1HBMB 3MCSA 1B64A 4X4VA 4QU6A 2RS8A 3CD5A 2VQFF 2ZJRQ 4DQRA 3CDEA 3CJ0A 5ADZA 3IO1A 3V81B 1NJWA 2ZDPA 4F25A 2GMHA 2VPZB 1RQ0A 2ZH2A 2PI4A 2KDOA 1K9MT 4Y34A 4I7FA 3OTBA 2AYGA 1JK9B 2AJQA 4ED8A 4HLBA 4I7FB 4DBQA 3H40A 1CQMA 4NLYA 3MAQA 1IKYB 4Y0FA 2CPIA 3E3XA 4LSLA 2UVWA 4FF1A 1KEKA 2W7AA 2W8LA 2DHXA 4OX8A 4UY85 4C8MA 4KR0B 1AW0A 1FERA 1S49A 3LWLA 2QT7A 3E8OA 1H38A 3HXMA 4DQPA 4Y2KA 1YJNS 4F50A 2X1FA 3CT9A