2NSCA

Structures of and interactions between domains of trigger factor from themotoga maritima
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
109
structure length
109
Chain Sequence
MEVKELERDKNRVVLEYVFGAEEIAQAEDKAVRYLNQRVEIPGFRKGRIPKNVLKMKLGEEFQEYTLDFLMDLIPDTLKDRKLILSPIVTERELKDVTARVVVEVHEEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trigger factor
publication title Structures of and interactions between domains of trigger factor from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Chaperone
total genus 24
structure length 109
sequence length 109
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2nscA01
2NSBA 2NSCA
chains in the Genus database with same CATH superfamily
2FDNA 3IBFB 4Y6IA 4N8OA 3NRBA 2WW4A 3GJSB 4CLUA 2AEMA 4NYOA 1RAJA 5IQQA 1LWXA 4X64J 3T1YF 1H98A 3IR5B 2R7SA 2W8LA 5KFZA 5DRKA 2CJBA 3CDAA 3DOMB 4OHWA 2DT9A 3KJVA 1RAEB 2MLZA 3OTOJ 3CMES 2VKRA 4JP8A 2OHDA 3R5GA 4TLQA 1NK4A 1J5OA 2KRBA 4DR2J 3G2XA 2V94A 2WSEC 4DFPA 2E1PA 1RT7B 1VOMA 3QIPA 1DTQA 2AGPA 1WG5A 4B3SJ 4N8NA 3RAXA 2ZJRQ 2IIHA 3S7RA 3PXGa 2RKIB 3HHLD 3MCOA 1T9UA 4QR0A 2D3OR 1RDRA 1YJVA 4LF8F 1S1VB 3MM5A 4MH8A 2CNLB 2VFSA 4FBUA 2RE1A 3SCJE 4MFBB 4HACA 1TKTB 1UW4A 4O3PA 2GJIA 4BWMA 4Y00A 2B3TB 2AW0A 3HKWA 2FHMA 4QJVA 4NYZA 3GIKA 5IS2A 4YR0A 4OYZA 4RUCA 2JJ4D 1JXLA 4JYAF 4HLBA 2DXFA 1NCLA 4JI0F 3MHYA 2QMWA 2GQ2A 3I0RA 2XS2A 4KO0A 3EJMA 3V81B 2F8EX 3FMWA 2F9JA 5E5NA 1AYEA 3A13A 2G0IA 5ETPA 4F4ZA 5DGBA 1KVJA 4LF7F 1DTTB 4DLEA 5ETQA 2N4DA 1T9WA 2VHGA 3VQTA 2OJ3A 3OR1A 3UCGA 1Q81T 3DOLA 3AHPA 1P1TA 2J7WA 2UU9J 1FHTA 2DR8A 2LEBA 1QDUB 4JI6F 4CO5A 4ZHRA 5HMZA 3KG4A 1VQSA 2GVZB 5EWGA 2CDRB 5LT5A 2IVYA 5C24A 4J9VA 3ENAA 5IV4A 1U1MA 4Y3CA 5D15A 5HATA 1FJGF 2VG7B 1AB8A 4HL9A 1QTNB 1RT5B 2XZTB 2X1AA 2NZ4A 2LP4A 2WB4A 4Y65A 4WWSA 2I38A 1RAHB 3KFWX 2QO3A 5KFSA 2ZD1A 3MMAA 1Q78A 4RU9A 1GMVA 2V2ZA 5DJBA 4X62J 4EBEA 5F8JA 1D1UA 1FRJA 3BF4A 4NLPA 1XMQJ 1HPZA 3PRDA 2OPQA 1VQMS 2HEKA 1LWEA 3G6ES 4DFMA 1PIEA 3TQ1A 2J6UA 4URQU 4R5PA 4ILMA 2ZFHA 4DG1A 1XIQA 3J7YI 5E0OA 3ETOA 5CQGA 4LSNB 2NS1B 1F6TA 3DYAB 1HNIA 1F2GA 1Q16B 2C2MB 2L3MA 2AD9A 1B7FA 2AYMA 1S6QB 2CPIA 3K8WA 2KXHA 4DEZA 4JI4J 3MGJA 3G87A 2DNGA 3TAPA 3EGNA 1BUXA 1KOHA 3BBFA 3SSRA 2XHWA 2R7TA 3QQCD 3G82A 3B78A 1FEEA 2ZNYA 3E51A 4L3KA 2J6TA 2JZ5A 2WONB 4NOHA 5L8RC 1FXLA 4B9LA 5HP1A 2BOPA 2OI2A 2VB6A 4OI3A 4O0IA 1FVSA 1ZTTA 2OPSA 1G2EA 4LF9J 2ZUGA 2CNKB 2VBWA 1Z2ZA 5SUHA 4F25A 4YOEA 2B5JA 3W5ZA 1ZTWA 5IC4B 3I56S 4LQ3A 4CM2A 3EXYA 1LW2B 1VRTB 2W2PP 2LU2A 1NPRA 1ZA2B 1QY7A 5A8RB 2F8MA 1V5IB 2CVIA 2RUSA 4V19X 4YY3J 4FVCA 2E1CA 3RB3A 3HLUA 2G9OA 5J2MB 4LF4J 3F56A 2XMAA 1TK0A 4P2XA 3UO0A 1X4DA 2YTCA 3IR6B 2XZWA 5I3UB 1NSKL 3EUNA 1NDCA 1HHSA 3IGVA 4FYWB 4LFAJ 3D0HE 2HNZB 2MJNA 4YB1P 4RBTA 2RQCA 2E9RX 2B6AB 1T95A 2QLBB 4DI6A 2YQ3A 3AY0A 4RZRA 3J80U 4ED1A 3IM9A 1ZYQA 2KT3A 5I42A 3MFHA 2L9WA 5FIIA 4CLLA 4J9KA 3MEDA 3AOAA 2Z2ZA 1UJ6A 4R0EA 4A8SA 2FVSA 4QIVA 1EARA 2W8KA 3KKFA 1OY9A 1AFIA 2OPRB 4ED7A 3NL0A 2VONA 2HRTA 2XTJP 2UXDF 2M70A 1I6JA 5KFYA 3PEHA 3OW2R 4F0HA 2UUAF 1EETA 2VIHA 3NGTA 2KTQA 4PUOB 1HNWF 3DFEA 3NGKA 2ATCB 5B09A 2CJAA 4P72A 4FYXB 2FLOA 4OI4A 3QFWA 2L08A 1RT2B 3CIZA 2FHKA 5I3PA 4CNZA 4USHA 4AL5A 2R8IA 2HAFA 1OO0B 2NYIA 2LA6A 3MZIA 4IDKB 1VQYA 3RRGA 4ECTA 3HSZA 3KK1B 5KFIA 2XMWA 3PYEA 2HZCA 4HYKA 2EBEA 3V2UC 4QWBA 3OLBA 3J7AN 3EMTA 2QLFB 3M30B 4ZVQB 3D1HA 3BDPA 3LF0A 4FF4A 1WACA 2CUYA 1IBLJ 4C9DA 4U95A 3ZZZA 3IS9B 3M8ZA 2GQCA 5L46A 2ZNZA 3OFEA 3FBBA 1RCXB 2VASA 1YG0A 4EK2A 4V19J 2R3VA 2DRDA 3ZTRA 4CLWA 3H5YA 3OFHA 4ECUA 4QU7A 3ZZTA 2NR0A 4DWIA 5MAOA 1B0PA 2QEXS 3OVAA 2DBBA 2GC8A 3EE3A 2W24A 4F3QA 5J1NA 5ETNA 2FJVA 2P6SA 3CCZA 2PFFB 2VICA 3JSYA 1VLYA 3CD5A 3QYYA 5E7OB 4UQTA 5LOQA 2PIIA 2QRRA 4HHUA 2C22A 1F9HA 2FVRA 4WTYA 2XCAA 2YKOA 2JHEA 1NJWA 3JYTB 2WVFA 4DPXA 1XNRJ 4DL5A 2D1CA 3BBBA 1WKLA 3O1LA 5DM6Q 3K57A 2Z4PA 3QSIA 4CO2A 4EMDA 1XJWB 1YRUA 2UUBF 1C1CB 3AH6A 3SFUA 1NDLA 3D28A 1YJUA 4RW4A 3GTYX 3L9ZA 3PX4A 1AW0A 4DL4A 2DK2A 2V0NA 4AD6A 4ICLB 3IA0A 4E8UA 3CCRS 1RLDA 4OZ1A 1HQUA 2R7WA 1FE4A 5MLCV 3CWJA 1YWXA 4D3HA 3BGUA 4DXLA 3FBFA 4KKOA 4QBUA 1U1RA 1UPMB 3QSYB 4ERDA 2DY1A 5EDWA 1FJCA 2VPXB 3KLFB 1N5VA 4Q2LA 1SPBP 5KFLA 2XGQA 5CABA 1IKWA 4B3OB 3W7BA 3U1NA 4IRCA 1JLCA 2DJWA 3ADAC 1K73T 1UEVA 5I3QA 3HD1A 2XY6A 3OTDA 1H0HB 2HK2A 3E3XA 5A0YB 4RW6A 1E6VA 2POKA 2VOPA 2GVDA 2V50A 4V1Ak 3I5AA 3RRHA 2V4RA 2J8AA 2PEHA 4P52A 4LFBJ 1X5SA 2Y1IA 4AL7A 5D3GB 3QRRA 3RBDA 4TNOA 4H4MA 5K8NA 5IFMA 2XYGB 3EWGA 1QVGR 4LFCF 1PAUB 1WSVA 5ITHA 1HMVA 3VF0B 2R2SA 2LKZA 5HJXA 2VUGA 2HLUA 2BVZA 3CC2S 3KLVA 1Z2LA 4RW9A 4NXMJ 1LWFB 4DV1F 2EC0A 3Q83A 2D9OA 3BREA 2FZGB 4K2XA 4JI8F 2F7VA 1NBEB 3ILOA 3TI0A 1MSWD 4IH5A 4C4WA 4FYVB 3C6TB 4M8LA 2DIVA 2E5LJ 1C1BA 3QGIA 2ZDOA 3OXLA 2ZM6F 1SBRA 3DLGB 1YZ6A 4M5IA 1IBMF 2DITA 4LRAA 3ONQA 5J1EA 2DGSA 3TX0A 1N0VC 1EX8A 3TAMB 2AX1A 2BJ8A 3KOAA 2GHPA 4QPXA 3U02A 1VIOA 3UDCA 2GMHA 4IQMA 1RHKB 1QUPA 1HD0A 3CCSS 4OYIA 4F67A 4JB8B 4Q8FA 2XMKA 3LGHA 1U6BA 3DLLQ 3DI6A 4KGKA 3NWGA 2UUWA 5F9NA 1O51A 5HO4A 2B9EA 2R7XA 3DHWC 1HQEA 1M5OC 1KKHA 1P8GA 2FPHX 3GYXB 1FESA 2HHUA 3QGGA 3KUGA 3CCQS 2YQ0A 2JEIA 3KK2B 4PQUA 1J5OB 3FFIA 2YKMA 3QWUA 3KMQA 3M2RB 3DLJA 3TEHB 1FVQA 3NWRA 3BO4A 1VISA 2XHCA 3M8PA 3P96A 3QIPB 3W3SA 1LXNA 3QT6A 2BX6A 4KHPF 2XYPB 1DTQB 1L3UA 4ILLA 2KH9A 3B6BA 1TK5A 4LJMA 1OY6A 1U2RA 3NAIA 4ENOA 4R25A 1NK6A 2HURA 4OJGA 1VQ8S 2CZ4A 3DXSX 4LF2A 2D69A 1N5YA 3CD7A 4BBYA 3NLCA 3PDNA 1JJ2R 4X4OA 3RB6A 3MM5B 3UPFA 3M32B 1NHKL 3EDQB 2MKJA 4DV5F 1U49A 4CYUA 2W4DA 4HACB 1RWXB 2DPJA 2ALZA 4DR1J 4ZPVR 4DV3J 2OTJS 4DV6J 1WOPA 4P6QA 1FKOA 2GJ2A 5K8PA 3OSNA 3I0RB 2VF3A 3MPVA 2Q1LA 4QOTA 1IUJA 3HP6A 2E1RA 2OSQA 5KT2A 2W9AA 1KP6A 3W61A 3IWLA 4X4TA 3N9UC 3N0VA 1HW9A 2Z57B 3TZWA 3RW7A 3GSDA 4FF1A 1K44A 1UETA 3RG6A 4DL2A 5I4MA 5KFJA 3OR1B 4QW9A 4ETXA 3DOLB 1UVNA 4B08A 4CLKA 1RT3A 1GXUA 4ZHRB 2XM3A 1X4AA 4UOHA 4IFVA 1KLNA 1RWPB 3I4PA 2RSQA 5C24B 1NK7A 3D5MA 4B3MF 1MG7A 3QT7A 2KB2A 4P2SA 4PXCA 2JEGA 2RD5C 1Q1KA 3G86A 1T3NA 2F5GA 1PBUA 3UDVA 5ETSA 1FNXH 2VBYA 3G8TA 4NMXA 3O3LA 2ZD1B 3MMAB 4NLDA 4A4JA 1B64A 5L9XA 1TUGB 5D4NA 3CJ0A 4QWEA 1UTAA 1HPZB 2CZVC 2GJFA 2OPQB 3P5TL 4A8KA 2BDPA 4GKKJ 5HL7Q 4F4AA 1LWEB 2AGOA 4ZDNA 4R5PB 1W25A 2YNHA 4DG1B 5IT9Y 4FVMA 1HNIB 3QJJA 1EP4A 4ZPCA 2AJQA 3FJ2A 4DSJA 3HKZD 3DLBA 4AE5A 5L39A 3W2WB 1V3ZA 2MY8A 3JSRA 1RHRB 3I31A 2AJ0A 4X2BA 4TLRA 3T5KA 1ICEB 2C2OB 5L1JA 4X4NA 2B8QA 5DETA 5E3RA 2PA8D 2H5IB 4MIBA 4DFJA 1FNOA 4DF8A 1RA6A 4F50A 3W60A 2Z8QA 4ZS6A 3TUPA 3FRYA 2OPSB 2H51B 2ADCA 2UXBF 1YQHA 1CJKB 5M2PA 1YLXA 2B5JB 1HWUA 3NXZA 2UV8G 5KFEA 4O4RA 4TY8A 1VJQA 2VPZB 2F4FA 4U9RA 4O4GA 2KI2A 3MFIA 3JQJA 2FZKB 3AAWB 2KXNB 3QIDA 3LPEA 2SXLA 1SV5B 2CWKA 4UZBA 4CWBA 2M52A 2E9ZA 3NOGA 3HHDA 1V9OA 1KBRA 4MKVA 4X64F 4A48A 1WSRA 4OYXA 1K1QA 3WC2A 4X66J 4IRKA 5HANA 1NZ8A 3OTOF 5KFRA 2VOOA 4DR2F 3M2UA 3W5YA 3C16A 4YR2A 2ZC3A 3Q2TC 2LQJA 5I42B 2IBOA 3MEDB 4DUZJ 3EVMA 3SEOA 5HVHA 1PYSB 2NXJA 5HLFA 4B3SF 1LW0A 2MGZA 1LOUA 5AXLA 5KFOA 2HHSA 2LECA 3P4UB 1X60A 4UF4A 3HM9A 5J2NA 4PG8A 3MM7A 3R27A 5B0BA 4F04B 4UY8T 2IAJA 2VQFJ 1Q8IA 5D0HA 4DR3J 1QD1A 4ZCMA 3C66A 4KR0B 2YPYA 2HWHA 5EN1A 4U7UD 3D67A 1JK9B 3LA0A 3EVWA 4F0KA 1MROA 6FD1A 1YTYA 4DPTA 3FQLA 2W2QP 1S4FA 3OXGA 1KSPA 2IRUA 2Z2LA 2J5AA 1NHUA 4RBUA 4NLGA 1YJTA 2K06A 3R2CJ 2HW3A 2UVUA 2IRXA 3PVXA 1KOOA 1HNXJ 3VTIA 4O3SA 1S12A 2HSEB 1HBNA 2VV5A 2KM8C 4DSIA 4P71A 4IRDA 2H4YB 2UU9F 2ZITA 3M9NB 4IUFA 4KV8A 5KFMA 2HGMA 3N01A 2V5HG 2JFDA 3R6GB 2ZZNA 3KJQB 2BKNA 1O0PA 2FVQA 2QYGA 1IQTA 1G1XA 3T9NA 2KT2A 2W9BA 3QJPA 2OO4A 1X0FA 4I7FA 2EFNA 2HPUA 3T6JA 4NASA 4OHVA 2CQCA 4C8YA 5A2QY 3V4IA 3WIVA 2CVEA 3G96A 5DZ7A 1ZPWX 3J7YU 2WVCA 1VQOS 3T9ZA 3NAHA 2KXFA 1GMWD 1L3TA 4IR9A 2HHVA 3DMJA 5DDRC 1QAJA 3T3FA 5KFBA 4F36A 4C8KA 1S59A 4X62F 4I67A 2NXNA 4U96A 1X5OA 3CC4S 1DURA 3VGSA 1Q82T 2PN6A 2ZJQQ 2BJ1A 2IYGA 4OX6A 3EYZA 1RHMB 4Q44A 1REVA 5G0RA 2VQEJ 1KD1T 3CULA 4HVZA 3VCDA 2G1DA 4USUA 5JVHQ 2GMJA 4KFBA 3GU0A 1OQ3A 3UN3A 3D3CJ 4PAAA 1LWCA 3A12A 3N6MA 3BH7B 4JI4F 1JJ4A 1SL0A 4QYZK 3EZUA 3BQ2A 3ZNUA 2FJWA 1HQUB 4FYDA 4ZJQA 5FLXY 4RPFA 2ZOFA 3PO5A 4KKOB 3DRYA 2A1BA 3GYNA 2HQDA 1I51B 2H54B 3H59A 4ZKAA 4NCGA 2I6WA 1VBKA 2QA4G 4NRTA 4O23A 4ETZA 2HMIB 2DEIA 4LF9F 3IC1A 1SCJB 1NSPA 2WW8A 1JLCB 1JXVA 4DV2J 2BANA 1TL3A 2CFXA 5AJ3J 3DLHA 3OR2A 4P10A 1YJWS 1XQIA 4OZJA 2HKEA 1WTBA 4RW6B 1E6VB 3OLAA 4OJ1A 1J5EJ 2GVDB 1AZSB 4W98A 4RW7A 1X9WA 1D0EA 4H4MB 3C15A 4NLVA 4YY3F 1RACB 3QRQA 3IAS9 3BGFA 3PRBA 4LF4F 2VFVA 2BW2A 4J9LA 3GONA 5GAEU 2I5JA 1S6PA 4MMOA 1HMVB 4AXIA 2H5EA 3DU5A 4QR2A 1FDDA 4LF6J 5JXSA 3CPWR 3HK2A 1NH8A 5B0AA 5CYMA 4GC6A 1N48A 1DY3A 1JXEA 2RRNA 3M6VA 2BZ2A 4M63A 1EKSA 4RW9B 3HHLC 4LFAF 1IKYA 1XWLA 4P2MA 3U1MA 1TKDA 3VR1A 5DM7Q 3KJNB 2XC9A 1R6YA 1RAAB 1NU4A 4Q43A 4J9UE 2LDIA 3M9OB 1X4GA 1GXLA 2WVDA 2M3DA 3SCIE 1C1BB 2EXUA 2ZH6A 2B9WA 3BKUA 3PIPQ 4ECQA 2AU0A 4CRJA 2RRBA 3HX9A 1FFGB 1FE0A 2PEBA 4O44A 1M5SA 3TR5A 1AA1B 4JV2A 3THPA 5ETOA 1S10A 2X7IA 1DLOA 2PA3A 3N6NA 2FGOA 3BGLA 1JJHA 4LUBA 3IR7B 1NRKA 4ZLLA 2EWHA 1FI4A 2ZH1A 3DOKA 3DI6B 3N5FA 2JLFA 4BWJA 1NKBA 5IOLA 2HFSA 3VHQA 3BN4A 4IG0A 1P1LA 4WE1A 1IKXA 3GR0A 3RTVA 5KTQA 1HQEB 3EGZA 2A3JA 2G2ZA 2ILYA 1RBOB 1FF2A 4CO0A 3NEKA 2HRUA 3HULA 2APOA 2V9KA 2XYHB 2ZHBA 1HKAA 4NYPA 1SVDA 3THTA 3E01A 3PRVA 3VWSA 2HVIA 4EO6A 4PQUB 3FFIB 1X5TA 4Q7AA 4ZP6A 1DHMA 1MWQA 1FJ7A 2RDIA 3TJ8A 2DVIA 3C2PA 1UFLA 1NK9A 3RUBL 2JNJA 4UTGA 5THWA 1D9AA 1TL7A 2ZKTA 1XERA 2R8HA 3H5UA 1AROP 2NREA 3DOMA 1FXDA 2OIHA 2VPWB 4ID8A 2AP6A 4YUDA 1N5YB 1IBLF 2BUNA 2BQRA 1BHNA 5HQLA 1PJ5A 3PFOA 1CVJA 4ELUA 4CYUB 1S48A 2MY7A 1PG5B 3FEZA 4WBFA 5A6WA 2YNGA 1CQNA 5EWFA 3PACA 5AE3A 3I6PA 2DR5A 2QMXA 1CC8A 4C98A 1V3RA 2QL9B 2V67A 4J9MA 3W5XA 3R5JB 1RWUA 2VA2A 1WOOA 5D78A 2ZH2A 4PWWA 1FERA 1FKOB 2NXUA 3UD5A 3I5CA 3DM2A 1X4CA 1VDHA 4TU8A 2V8DA 1F9FA 2E66A 1HWJA 2O67A 4MFBA 2I8EA 2HS3A 1TKTA 4PG6A 1CPZA 2FTRA 3GCXP 3V4MA 1S1XA 2JVRA 4HI2A 2V8PA 5KG4A 3R6LB 3QMQA 1XNRF 1ELOA 4UOCA 3MCMA 3T41A 2DGQA 2YY3A 3TANA 4WZQA 1F9EB 2BJ3A 1RT3B 1C2PA 1FDBA 4F7VA 4QYZJ 2J0XA 4IFVB 1IN0A 2DRAA 4KGMA 4C8LA 2FLPA 1DAXA 1RYRA 1UVJA 3AJ1A 2MKHA 1NJZA 4RNFA 2JLEA 4QZVB 2W2MP 3CVKA 2D3UA 2QGFB 3MR6A 1WWHA 2B0GA 2R7RA 3CW2C 4X4PA 3F73A 1ZH5A 1RTJA 1N34J 1VQ7S 1XTZA 2V63A 2JRSA 2DIUA 2FHOB 4ZJOA 2YKQA 3MAAA 1RQ0A 3P3DA 4RX6A 2AT1B 2GAHC 2R7OA 1F5AA 3ICLA 3R5CA 2CQPA 2P8IA 2YNHB 1RT5A 3K89A 2EK6A 4HH0A 4LMZA 1WHWA 4QIEA 4LFBF 3MXHP 2QFJA 1FA0A 3UD3P 1EP4B 2BEFA 1NHVA 2JDJA 2HZVA 3QBCA 2JX2A 3PX0A 4C11A 1OIAA 1OYDA 1RGVA 3MR3A 1T7PA 1BWEA 1S6OA 1KEKA 3IXQA 3RBEA 2HWTA 3ENWA 3CJKA 3HJFA 2AJ4A 2C2RA 2G4BA 4R8UA 2Z2MA 2PSZA 4IH6A 2LVWA 2E9TA 4NXMF 3ENQA 1S5ZA 2DO4A 4F2SA 4B17A 4BC7A 4A8YA 2VU5A 4FNHA 4B9SA 3BSNA 3QAEA 5EGYA 4KH0B 3ZZPA 2X3GA 1MWYA 2HVEA 4K5SA 2W7OA 2E5LF 2EFGA 4NLXA 5KFDA 2FYXA 1VYAA 4OLOA 4RNOA 2V8VA 2CPZA 2ATLA 2D74B 2QA2A 2YWKA 3M4XA 4NZ6A 2C2DA 3U27A 3R7NB 4H4KC 4TY8B 1HHQA 1BD6A 4RKUC 4KBIA 2ERRA 3NY0A 3FBCA 5LMNJ 3WX8A 3UDEA 1Z1ZA 3NCQA 2NZCA 3MI7X 2J8SA 3TA0A 4MIAA 5KG0A 2ZH5A 3CDUA 5KFAA 2ASYA 4X84A 1EQ0A 1RK8A 3KHRA 1VRTA 1XNQJ 2P2CB 2P9GA 5DG7A 5E3CA 1JLAA 4DFKA 4DUYF 3X3UA 2CZ9A 3FRZA 2OELA 1Y4ZB 4ZLPA 3M8QA 1JWWA 3M2UB 2KVIA 1S1UA 2K7KA 5HN0A 3C16B 2HBRB 5KG2A 2CWXA 2CKWA 4B9VA 2KFYA 3DGPA 3Q8PB 1DJ0A 4PYDA 4OJHA 3NGUA 3QO9A 4X4SA 3TARA 5HLFB 1LW0B 4LRBA 4ES3A 3JTPA 2MGZB 1C4CA 2RUGA 4KPYA 2FVCA 2HNZA 1VFJA 3SV3A 1NB7A 3CJ3A 4K7QA 2R2TA 1S0NA 2LU1A 3UE2A 2OH2A 2G2OA 3HXMA 5J2NB 3MM7B 3PIOQ 3MMCA 2IAJB 2Z0GA 1WEZA 4C8OA 3L7PA 4RWXA 3VVTA 2J7UA 3BQ0A 2M5YA 3K58A 4OYMA 3QT5A 4DR1F 2MZQA 3NGSA 1SI9A 1PC5A 1MROB 2OD6A 3DKDA 4ZCLA 4DQRA 2IPOB 4DX5A 4DV6F 3AODA 4TY9A 3VAKA 3MF5A 1T9VA 4J9NA 4I68A 3OL7A 4ZCKA 3H2UB 3NNCA 1VQPS 3CCVS 1HNVA 3MM8A 4USMA 3D3BJ 3GIJA 3HZEA 1HBNB 1SKSA 1EB0A 2E44A 4PZVA 5CZVA 1T03A 4KV8B 4IG3B 1RHQB 2F63A 3PR5B 2EFVA 3KK1A 3DCAA 1XR6A 4DR6J 1HNZF 3Q22A 2IA6A 1UW9A 4PG5A 4Q2MA 1U02A 3JSMA 5C25A 2W9BB 3IBCB 5HQMA 4DZDA 3BBCA 4I7FB 1WTFA 1YHQS 1BY9A 2YWWA 3TVZA 5ETTA 1VQ9S 2R42A 3M30A 4Y2IA 3OSPA 2NCKL 1VMBA 3V4IB 3GCWP 3QT8A 3P6YC 1KQGB 3CT9A 1ZAWA 3H40A 3ZTSA 5HI7A 4KYZA 3DMJB 2A2DA 2XMVA 4LIRA 3NNHA 3OXFA 3Q86A 1HFEL 1S49A 1ZS6A 4ANDA 1Q53A 4DL7A 1VCTA 3H2LA 4NLOA 6AT1B 4DQPA 4GKKF 4EYHB 1YIJS 3CEDA 2DKOB 3AB2B 5GAGI 3C19A 2Y8WA 2XS5A 5G0RB 5J1PA 4GO7X 2ROPA 4OV1A 4G3IA 4ZPTR 3BH6B 2K2PA 1QJHA 3RAQA 4RUHA 4NXNJ 1JLQA 1BXNA 2DNLA 3AD8C 3WC0A 1U7LA 4EBDA 1QSLA 1X7VA 3K0JA 2WBRA 2MKIA 3H5XA 1RBAA 3NCRA 3ZZOA 3W64A 1TKZA 4FXWA 1KTQA 2CIMA 1NKEA 2B4VA 1Q4RA 4ECRA 1U8WA 4ED2A 4F4YA 1BLUA 1FTRA 2MZRA 2NPFA 4NCGB 2QG9B 3W1YC 2V2VA 5CXTA 4JI2J 2YX7A 5F41A 4JUZA 4IFYB 2HAIA 3TAQA 3G71S 2XMTA 1FT8A 3KUEA 4RW8A 5DZ6A 2ZOMA 3GILA 5LSRA 1F3FA 1KRPA 4CIOA 1FRIA 1U45A 3J7A1 1TL3B 3OFGA 5ETKA 1RT6A 2C1EB 3OR2B 1N4LA 1WI8A 1BWVA 1PBAA 3T19A 4XIUA 3KYLA 2OLWA 1NKCA 3H98A 3WBZA 3KK3A 5FD1A 5K8OA 2HHPA 4Z2XA 4RW7B 2V4JA 3C15B 1R7IA 2V2QA 3WZ0A 2H1YA 1QAYA 4CLTA 4YS2A 1Y5LB 3O5TB 2I5JB 4X4RA 1Q79A 2CQIA 4DZ6A 1N36J 2WZ1A 3D0IE 2NLWA 3G9CA 3R3TA 2N3LA 5CYMB 2KJWA 3W8PA 2OMLA 3MECB 4I69A 2CPHA 1IKYB 4JI7J 4X66F 3PNIA 4ZPBA 4WCEQ 2VZ9A 1QAIA 3D1OA 2BRKA 4K4UA 1ZETA 1WEYA 2DHXA 3Q23A 2BJ7A 2GIRA 2NYHA 2ZWPA 1OS5A 4OLPA 2GCFA 3CB4A 4GRSA 3KG1A 3CUNA 5A8WA 4DUZF 4I6WA 2MTLA 3D1QA 4FZVA 4OI0A 1WC3A 2VKZG 4ZN1A 3SDEA 4QWAA 3GJQB 3NS5A 2G13A 4O44B 4KSEB 4WK1A 4NLUA 2YVSA 3I9V9 1DLOB 1SKRA 3IN5A 2VQFF 4DR3F 2WK4A 1W2IA 3J81Y 1RWOB 2V6AA 1HYSA 9RUBA 1U24A 2BMBA 1RTIB 3DOKB 4NA3A 4A46A 3ILJA 3PKYA 4IG0B 4WE1B 1IKXB 3L09A 1OQ6A 1GNKA 5KG7A 4NZ7A 4PWUA 2DD8S 2R8JA 3GG0A 5LMUJ 4WP8A 3MD1A 2M0GB 2V69A 4EZ9A 4L75A 1T11A 5GMKa 4BC9A 1HW8A 3I0SA 4I56A 3VAIA 4OIXA 5IC6B 1R31A 3HDSA 5GADU 2GX8A 1TVRA 2BQUA 4OX7A 1TL7B 2DGXA 4DS4A 1HNXF 1C4AA 2ADBA 4P74A 2YWEA 4ES2A 4RNHA 1GTEA 3MPWA 4A8WA 1D3WA 4DSLA 4RO0A 3GFYA 3HF5A 4DV4J 3M8RA 3KK2A 4ZPDA 3M2RA 4Q8EA 3GIIA 3SCKE 3PY8A 3K5OA 1UCNA 1GX6A 1SL2A 1HI8A 3OHBA 4Y0FA 1GMUA 4X65J 4LR9A 3MEGA 4LF5J 3LH2S 2ZH7A 2C3UA 4ECVA 1EQMA 2CPFA 2YNGB 5L1LA 2C2ZB 2K3IA 3WDOA 1Q8KA 3GJTB 1T9YA 1VR6A 1U2CA 2RU9A 2BQ3A 3GB0A 3DDIA 3DM2B 5HBMA 3M32A 4OL8A 3O6QA 3Q89A 4EEYA 1R3NA 4U7CA 4K59A 2P9EA 1Q7YT 1S1XB 3D4JA 2ASLA 2G0JA 4J9SA 4OHZA 1KTVA 1T9TA 2MB0B 1A0OB 1KONA 3S1TA 1YI2S 5E33A 2VQEF 3V6HA 3TOQA 3DRRA 3OL8A 4FS2A 4OZLA 3IRWP 5LXYA 4A8MP 2QZ8A 3SMZA 3GV7B 3IM8A 2B43A 1DQ9A 4UUXA 4WYWA 3B4DA 3KUHA 4M5MA 1JIHA 4K4WA 3SIPB 1WC0A 2HQCA 1Y11A 1NMEB 4RUBA 5IZHA 1G7CB 2CQ3A 4UQGA 5KT5A 3ZZ0A 1TUWA 4KAIA 1LNQA 1RTJB 2H3EB 4L76A 5F0UA 1FX2A 1EIYB 3UWTA 4DCJB 2A6MA 4ZVFA 3CDBA 3H42A 2LQBA 3MAAB 2XMMA 2U1AA 3THVA 2CXEA 1MN9A 4DV2F 4B3TJ 2C3MA 3CJ8A 3ZFVA 5AJ3F 3PW7A 1U8SA 2QA1A 4A8QA 4LSZB 1QLNA 1J5EF 3JAMU 2IBKA 5DO2A 3C3LA 5HVFA 4LIWA 2Z30B 3QRPA 4OX9J 3ILLA 3OV7A 4JI5J 3B82A 2N7YA 2ZH9A 5FJ4A 3BJYA 2KYZA 4WK3A 5CD4H 4IOCQ 1V6HA 4QCLA 4C11B 2IJRA 2P5VA 4LF6F 1NZAA 4Q0BA 2HFNA 3GQCA 1N5TA 2YWFA 4ECSA 3CJKB 2HLTA 2R4FA 3N5BA 1SJ1A 2AMCB 4R8UB 4I6AA 4J7CA 2EK1A 3R2DJ 2FQQB 3BO3A 2BM1A 1CJTA 3F0NA 1YZ7A 1FK9A 3H25A 3W2WA 1GQEA 2B9YA 3BQ1A 5KT4A 4YFUA 3W9HA 4GVLA 3CDEA 3MM6B 1JMTA 3JAMY 1V3SA 3I55S 5AXMA 4DF4A 4UOFA 2OP5A 1IXKA 2BA9A 1JQGA 4CM0A 2C2EA 2Z2YB 3MTKA 4AFFA 4PXBA 2E7WA 3CNQP 5BYSA 4DDFA 1U47A 2BM0A 2F65A 2HHXA 4ZOSA 4ZPAA 1RT1A 1CJKA 4JV5F 2BE7D 3B54A 3CO9A 4KE5A 1HR0J 1MMLA 4KPCA 1MMDA 1JLAB 3MR2A 3R1HA 1LK5A 3RYLA 2LMIA 1I94J 2GO8A 3OBIA 3QFHA 2KZMA 3CJ2A 1OPIA 2NUHA 5CCMA 3M8QB 4ZVUB 1J2VA 1BMQB 1ACMB 1SV5A 3FZBA 3RRKA 1S1UB 3W2VB 1M5PC 2JOQA 4OZ5A 2AZ1A 3DGPB 1HBMA 2OSRA 4HHJA 1QUVA 4I64A 4EO8A 3ZZRA 2CNOB 2XNRA 1M5KC 1WHVA 3QO9B 2J7KA 2PD1A 1R0AA 3C6UA 4F02A 1N33J 1SKWA 1YJRA 5L38A 2DNYA 2PE8A 4I0WA 3MMCB 3LAKA 4N7TA 2HHHJ 3HD2A 2YKPA 3OFFA 4ITSA 1UEKA 3UR0A 4ILRA 4K4XA 3PW0A 1WELA 1U25A 1TTHB 3EZOA 3RB4A 1I1GA 2BKOA 4AUKA 2UUBJ 5DQHA 3LWMA 3IRXA 4I4BA 1NNDA 1FFWB 5LSOA 1F1BB 2ABYA 3DLKA 3OVSA 5E3PA 3N6LA 3KLEA 2EI5A 2UUCJ 5CZXA 1H2VZ 2KO1A 4DSFA 2AJFE 3OJSA 3BV8A 2PMZD 1JNZB 4NLWA 2ZHAA 2I9SA 4YDDB 2UVRA 1HNVB 3A8KA 3MM8B 1UWAA 4DPOA 4QIWD 4ECZA 2F1FA 3PTWA 3VAJA 1KR4A 1Q7LB 3N28A 5H1SV 3BB5A 2LXFA 2E29A 1IM6A 1SUQA 4KTQA 1T03B 2ILZA 3GPAA 2MHEA 3D6TB 2QLJB 4FPRA 1EZZB 4ZVOB 3JB9k 3K5PA 2W4CA 1IR1A 1SH0A 2C3YA 2KL8A 3JSMB 5C25B 2VBXA 1X4FA 3IG1A 2B7CB 2LFVA 3Q24A 5GMEA 1ZZFA 3BGOP 1O8BA 2IRYA 1X4EA 2BE2A 2CQ0A 4ANCA 2Q3PA 5F8MA 2CA9A 2DGWA 4M5JA 4HTIA 2KVQE 1N34F 4OX8A 2DNKA 3L7OA 5EHHA 4ED8A 2EBGA 4C8ZA 3HSGA 1R8HA 1AXQA 1U0HA 2ZJPQ 5H9FK 2WB1D 3DRSA 4LVNP 2DHHA 2RDDA 3CD0A 4USWA 2Q79A 3H7HB 1EKRA 3PFEA 2HGLA 3SZ2A 1VIXA 3DLEA 2QL5B 1FWKA 4TQRA 1R6VA 1QM9A 1SIZA 2XI3A 1FWPA 1WEXA 2MYFA 1R8CA 4MK9A 3LQVA 3ELHA 1IJEB 4I1TA 1JLQB 4JBCA 3RBZA 1TUVA 5KFNA 2L9DA 1S0VA 5IWAJ 4FS1A 5IT0A 1Q5VA 2C42A 1XBWA 1TKZB 2BR0A 4EI2A 4LBIA 5GAHU 2GV1A 4NI2A 3A8JA 2WHOA 3ETMA 2CPDA 4F4XA 2QLXA 2J9CA 3DRPA 1OY8A 4M5DA 4J9OA 3IBWA 4RW8B 4XPEA 3PKMA 4MKAA 4PXEA 4Y34A 3D7SB 1S4EA 4NLYA 3TZXA 4I2QA 2XY5A 1RT6B 1MW7A 1TV6A 3TUJC 4DU7A 5LMNF 3KK3B 2FZCB 2HVHA 2CDQA 2PMHA 3H4BA 4TXSA 2FC9A 2V4JB 4OYPA 1SJQA 3AXMA 1N88A 1QSYA 5E41A 1X31C 1RYSA 4JI1J 2HMIA 2DNQA 2V2KA 1U1PA 3IP0A 3T1AA 2RJZA 1D8ZA 2XS7A 2AF6A 1BGXT 1S0MA 3JSBA 2J0QD 2MDAA 1UPPA 1WORA 1IBKJ 3BR8A 2H5JB 2XMUA 1XNQF 1M5VC 1AZSA 2DCUB 2D7SA 2UZAA 1NAQA 4YR3A 2HHWA 4DV5J 4K4SA 1TZ0A 4KC5A 4J37A 2XG8A 3D6MB 1WG1A 2H48B 4C0BA 1HWIA 1DBDA 2PT0A 2C2NA 1G4CA 1M90T 4WYLA 1S77D 3TUIC 3AXKA 3TVKA 3SBMA 2MHNA 5A8WB 2VJVA 4KY3A 2AQ4A 4ZIVA 3HI9A 1UWBA 2QX0A 3JQMA 2GQQA 3SDEB 4KT0C 2GNKA 1ZOTA 2IVMA 1BC6A 3OTBA 4C48A 2HNYA 1VQLS 2AV5A 1FTCA 2K1RB 3IWNC 2C3OA 4KGXB 4IOBA 4DL0C 2BXJA 3W66A 2PI5A 4XAKA 3KLGA 2M8DB 4QIFA 1FD8A 1CEZA 1HI0P 4HT7A 4U8YA 1HYSB 1H7WA 1UVMA 1KC8T 4FYYB 3WHIA 5KG1A 1I3OB 4CLPA 2FY1A 2FLLA 3MCNA 1KS2A 1R43A 1SB6A 4USKA 2BACA 4FXVA 3NP5A 2RF2A 2F9DA 4YB5A 4LRDA 4CCHA 3CXCR 4OJ3A 5E3AA 1N56A 3MCSA 3I0SB 2PGCA 5HROA 2WCXA 4RUAA 3GE9A 3KLHB 2J0WA 1U4BA 2KDOA 3AJDA 5T41A 2ALYB 1TVRB 1DQAA 3A8IA 2VG6A 3ISND 4DN0A 4KRWA 4CH1A 1FKAF 1IR2A 3HJVA 3FGVA 1S9GB 4HR2A 1VBYA 3DN9A 1IM4A 3HHEA 3VAFA 1WHXA 1UAWA 1VJWA 1HWKA 3BYPA 4YDXA 3QZ8A 4DR6F 1WOSA 1U09A 4IO9Q 1WD6A 2HVZA 2Q66A 5F9LA 3UR3C 5D4LA 3C14B 3ZNJ1 4JOUA 1SJ4P 1CJVA 3MEGB 3IWXA 3BSAA 4OZ0A 1PJ7A 4PWDA 5EX3A 2Y0SD 2OAUA 3GR1A 2W7PA 4ZVHA 1UP1A 4ZVRB 4FXDA 1W7WA 2B56A 4P7TA 4ZPWR 4ZK7M 2IA0A 2VPYB 2HBYB 2X1GA 1M5HA 3TJ9A 2H65B 2Y9HA 2M9KA 1S0OA 3FUYA 2K7JA 5HBMB 5H9FJ 4DCOB 3ZZUA 3BN7A 4QU6A 4ELVA 3ENVA 3NBPA 1YX2A 3CCUS 1U48A 3VAHA 2FJXA 5DDQC 1Y5NB 2X1BA 3O2IA 3LP1A 4CP5A 1BQXA 2GO9A 2U2FA 3DRRB 4IR1A 1Y7PA 2IC3A 2RHQB 1HLWA 3PCOB 1CULA 4NCBA 4NXNF 5F8IA 2DH7A 3AD9C 2VFTA 5B08A 1FRXA 3MMBA 3CC7S 2ZH8A 4ID5A 4K8RA 4HTJA 1H73A 2NXEA 4QW8A 2V9WA 1X4BA 1TMJA 5HVGA 2XCPA 1RAOA 3VQSA 2CPEA 2MQPA 5LM7E 2DISA 1RB0A 4JI2F 1HI1A 2XLKA 5IT9U 2GIFA 3AD7C 5IQ6A 2QJ3A 1RU2A 5KOXA 2PI4A 1QAXA 1TFYA 4LSLA 3GG1A 1WI6A 1TKXA 3K8VA 2BKPA 3FMBA 3MD3A 1MWZA 5C5JA 4F3OA 1RCOB 1X9SA 1FRLA 2IM3A 4DMZA 1HHTP 3EM1A 4NEZA 3A3PB 4B3RJ 3NGDA 3DC2A 2HBQB 3K5MA 1FXRA 3PM9A 1Y0HA 4ZVPB 3G6XA 1VK8A 3PO4A 4JI3J 5E3QA 2OEMA 1RLCL 1N36F 1Y5IB 4MK7A 3PZPA 4Q0BB 2HGNA 5EWEA 5CA5A 1TQLA 1JLGA 2DNHA 1VQNS 4P75A 2OEJA 4DQSA 4JI7F 3KHHA 1Y00A 3HT0A 2Y1LB 1CJTB 1S79A 3POTA 5ETVA 1FK9B 2DO0A 2ZBPA 5D6GA 2ZVSA 3GMGA 1CLFA 2FD2A 6FDRA 4HT5A 1S76D 1MU2A 4YHHJ 5KAKA 1KLMA 1H7XA 4FPIA 3NS6A 5F3ZA 1C0TA 1U26A 3AOCA 2VC0A 3ET6A 1B4SA 3LGMA 3CJTA 4WP9A 5B0CA 5B0GA 2KFZA 1EHWA 2KHCA 1YBUA 4HKQA 1H3DA 1VC0A 3Q8YA 4G1PA 2FY8A 4CZCA 1KHVA 3PJ9A 5J2PA 1T02A 4BDPA 2AJ1A 2QA4S 1RWNB 1IWAA 3AJ2A 5AE1A 1DZ5A 3LP0A 1RT1B 3RW6A 2ZVIA 2HS4A 3MAHA 4OYOA 2DHSA 3FK4A 4CI0B 1PJ6A 5CH7B 4OV6A 4M5HA 1N54B 1R89A 2BRLA 2PMWA 4L72B 3TA1A 2FGCA 2L9NA 5LMUF 2DRBA 2UVVA 1ZA1B 2QL7B 3UVJA 3P49B 3MUMP 3VGVA 1CSJA 2YBVA 1RXOB 3ZTPA 1U6FA 4ECXA 3BR9A 4M5LA 3KHLA 1FRKA 4WFYA 2VL1A 4LT6A 2HWIA 3FSIA 1HBMB 1PSDA 5KFKA 4ZJLA 1YSJA 2KRRA 3CCMS 4EWTA 2ACYA 2AGQA 3WIUA 2DNNA 1NDKA 2DXEA 1R0AB 3R9LA 3C6UB 2QMUB 3GSIA 4DV4F 2UXCJ 2MXYA 3CJ5A 1M1HA 1PILA 3L95X 2JC0A 2L48A 4ZVEA 4J90A 2Z58B 2O66A 4GKJJ 3FCVA 3G4SS 4NLRA 1SC6A 3TW0A 3KTQA 4X65F 2IJFA 4LF5F 2K8GA 2MZJA 2CQGA 2XSJA 2G0CA 4DSKA 3RZAA 2CJKA 3G8SA 3IRXB 1GT8A 3KJFB 4Y2KA 1RWKB 3LUYA 3DLKB 2AEJA 2GA7A 4DJBA 2IMWP 3T6BA 1RP5A 3QGHA 4DV7J 4AYBD 3ITHA 4Y2CA 3KLEB 1U1OA 4ZVGA 3H0PA 1REGX 3D6HB 3MEKA 2KJVA 4OYBA 2EPIA 2R2RA 2DGUA 2DNRA 4AQYJ 2IMOA 2RRAA 3GZ7A 1RADB 4NLQA 1OJ4A 3ZO7A 4ANEA 1OYEA 3A1YG 2YKAA 2B9XA 4OZNA 1B0VA 3DDNA 1SUQB 5BXIA 4Z37A 1NB2A 1GFWB 3JQKA 5A2QU 1ZM9A 2C2KB 3FEYB 1RA7A 4DR7J 1SQGA 3IAM9 2E5IA 1RT4A 2HK3A 3IG1B 2RS8A 3M2VA 2KG0A 5D8HB 1Q0NA 2EC2A 4HI1A 4ZITA 2BE2B 2GIQA 4TYBA 4TU9A 3MM9A 1YRXA 3LP2A 4M94A 4IG3A 3C8YA 2DGOA 2FJAB 1NEEA 3PJXA 1KDNA 1WF2A 2OMOA 2P6TA 3NG8A 3OL9A 4B3TF 1U0HB 2RQ4A 2MLXA 4S0MA 2DEJA 1XC9A 3DRSB 2HIQA 3R7BB 1TL1A 2EG2A 2ZZMA 2FC8A 5GAEI 4WIQA 2MSTA 4FP9A 3MR5A 2GZOA 4DLGA 1YRTA 5FLXU 3N79A 2XWXA 4OX9F 5JUMA 3DLEB 1OSDA 4JI5F 3JXOA 4OI2A 2VDIA 2JFKA 1RABB 2I1RA 2QT7A 4H4OA 3UW1A 4YMEA 4DL3A 5D4OA 3GFHA 4MAKA 1XMQF 2CRLA 4MYTA 3GIMA 4FDFA 4HHHA 3RU0A 2LQ5A 2BYCA 3DNCA 3PW4A 4OZ2A 4P2FA 4IO1A 2HQGA 2IM0A 5B0FA 4N56A 4EFAC 3M9MB 1N6QA 4NI2B 4K50A 1XMOJ 3LWLA 2CG8A 3X1LB 1FNMA 5EX0A 2NXCA 2LDYA 3DRPB 2JEFA 4A8OA 1SQEA 4M5DB 4KHMA 3T1HJ 3J80Y 4ZCIA 3SQGA 1YKWA 1HIYA 4I2QB 3KLIA 1F2HA 2EVZA 1YBAA 1HBUA 1KFSA 4CT9A 4WFBQ 4DS5A 1KWMA 1ZM2A 3I4HX 1TV6B 1DRZA 1OWXA 1U2FA 1V5VA 5JJBA 2KZZA 1FDAA 2FVPA 1JLFA 4IFYA 1NSAA 8ATCB 2GW8A 5A6PA 3CDWA 1IQZA 1QTMA 3CE8A 4LREA 3TWZA 3QWPA 1PO6A 3Q8RB 2KU7A 2WOMA 3AOBA 3CF5Q 3TZZA 1ZAXA 4F4KA 3PYGA 4MK8A 3MWBA 1K47A 4ES1A 4WFNQ 2EKYA 1T05A 1WC4A 4ECWA 1HR0F 2XMJA 5K5MA 3JTOA 3OHAA 1RTDA 3HVTA 2HRYA 4N76A 4NEYA 4O0NA 4DPWA 1I94F 3R5BA 3IMQJ 2YPZA 1QVFR 4RL1A 1A6LA 5AXNA 4ELTA 3F41A 1TELA 3HZGA 2YQ1A 4J91A 4WFZA 5F3TA 2VC1A 2PFDA 3TP2A 3S01A 3MECA 2BJEA 3HFZB 1SQFA 1QE1A 1UWBB 1XR7A 2MKSA 4I6YA 1RKJA 2KT5A 1N33F 2HNYB 1RHUB 4BCAA 2FHJA 3E2EA 4W4MA 2AYBA 1S9FA 3FZ2A 3ZC4A 3KLGB 2FB0A 1H72C 1O5JA 2HHHF 2XB2D 1JLEA 5BR8J 3L4BC 3M6XA 3CD6S 4M5NA 3TEGA 4I2PA 5GMDA 3CMAS 5B0EA 2ACMA 2R7VA 3TQEA 3HT3A 2GGPA 2ZH4A 3EXCX 5AE2A 2ZWOA 2VG5B 4C2MA 2MZTA 2HNDA 1W26A 1XR5A 2RF2B 4B9NA 1F5BA 5FDLA 3UDLA 3I82A 2H9ZA 2UUCF 3EGVA 2GFFA 3NMAA 5HROB 4OMFG 2RVJA 1WDDA 3UCZP 3T5LA 2ZC4A 1RTIA 9ATCB 1Z4UA 4P7VA 2VG6B 2MSSA 1XN9A 3NNAA 4XO0A 4CLYA 4EYIB 4EBCA 2C3PA 1GAOA 1WC1A 3HFKA 4W90B 3PX6A 4FBTA 1VLOA 3FQKA 2EFPA 1S9EA 1XMBA 4CT8A 1UL3A 2F3JA 4GO5X 1CS4B 3HHLA 2YX1A 4HH1A 4GVBB 3HCXA 2XLJA 3W65A 1A7GE 1CJVB 3PYFA 4PWDB 1NDPA 2XY7A 3CIMA 3OTEA 4DPYA 4GMKA 3D54A 3BGRA 4PRFA 3LALA 2MQOA 1P27B 2DHGA 2LQ8A 2RDJA 3CJQA 5BYRA 2Y8YA 2ZOGA 3Q8UA 4J5OA 4QYRA 2M2BA 4K4TA 3M8SA 2XWYA 3HHKA 4N77A 2GHWA 2HFZA 3NBPB 2J0SD 2B4UA 2OPPA 4ER8A 4PPZA 2W1BA 2IM1A 4CTAB 1X9MA 4FNIA 4CO1A 2IDLA 2CJ9A 1Q5YA 2EFQA 3LP1B 2E7XA 2QSWA 2OGUA 1G3OA 3JS9A 2CPYA 2IC3B 4YEAA 2BV3A 3B8HA 1CULB 2O3DA 4B9TA 2HFUA 4LBHA 2LLZA 3K2YA 1URRA 5HMXA 3AQPA 3MMBB 4ID5B 5IWAF 3VAGA 2DR9A 5DG8A 3J81j 4NL5A 1U1KA 2AKWB 1ROFA 1UFKA 2V68A 1N32J 4NMLA 2QYCA 2X51A 2NUUG 4W92B 5T14A 1PC4A 3MTJA 1S1WA 1HA1A 5LJ3Y 3NOCA 5DQIA 2QE5A 5HSPA 1W2BR 1VQKS 1S72S 1P9QC 4IH7A 3BM7A 3R5AA 4XK8C 3KDNA 2JLGA 4YB6A 1TMMA 3UCUP 4LSLB 1TR0A 4X4QA 4DUYJ 3KJVB 1TKXB 2CJXB 1VI7A 2CJYB 3FSYA 4PABA 4CLSA 2AYEA 3OJUA 3PHTA 2CAJA 2E1AA 2WVBA 3CO0P 4DPUA 2UVWA 4DU8A 1VRQC 1NJIT 1SKUB 5F8LA 5H9EK 3CCTA 2N4CA 2XGPA 3MR7A 5M2UA 2A6OA 3BYRA 4JI1F 3GP9A 1CJUA 1WNEA 3EZ5A 1N8RT 4EGLA 3CGIA 1IVZA 1VHIA 4KH1B 4ATNA 1IBKF 5K14A 3H4DA 5C2GA 3SYZA 4J9QA 1JLGB 3EVOA 2Y1RI 2CG4A 3HSJA 1UMJA 2M4MA 3LGNA 3D0GE 2RNEA 3PV8A 2BABA 2NQPA 3POTB 3A3NB 3OTCA 1U6ZA 2IVFB 1S7HA 4AL6A 3M7VA 1MU2B 3VZIA 1KLMB 4U67Q 1JLBA 2J9DA 2XO6A 5K8MA 3G6VA 1B99A 1C0TB 3ET6B 5KT7A 3R8YA 5B7WA 2G2YA 5C2CA 4KO0B 2J9DE 4Y2AA 1G6BA 5J2PB 5U47A 2DXDA 4CLFA 4DX7A 1RWWB 2GHVC 2V4QA 4ED6A 4L3NA 3LPYA 1X0PA 3MM6A 1J27A 3LP0B 1LEOA 2F8HA 2R8GA 2KG1A 2RS2A 4NE9C 2JSXA 2DGTA 2AX0A 2HHTA 3P45B 4DV0J 5LL6d 1HNZJ 2M7SA 3BKTA 1WDTA 3UVJB 2RAQA 2UUTA 4XDDA 4K4VA 1C0UA 1T94A 4URGA 1URNA 5F8NA 3EX7B 3BSCA 4DR5J 1ZZNA 3NMRA 2YNIA 2HBZB 3ISZA 4USVA 4WXOA 4TQSA 1IKVA 1Y3KA 4USTA 5L1IA 1RE1B 3H2VE 4O3QA 4XTTA 3QJLA 2A18A 1HBOA 1RAFB 2J6SA 1RUSA 4JV0A 3P5BP 2YXLA 3W2VA 5KG5A 4E98A 4C0OC 2DH9A 3MEEA 3V6DA 3HFVA 1WKKA 2GS8A 2MMYA 2K3KA 3FDSA 5F8HA 3O44A 2W2OP 2Q43A 1YITS 3CCES 4ZVSB 2XSJB 4YQWA 4PKDB 3UNGC 3ZXWA 3P8BB 4KJIA 3T5JA 3H90A 1E6YA 1JB0C 3ITHB 2J76E 4H4KA 2E1MC 1Y9OA 5DS7A 5JMNA 2F4VJ 3G82B 2MLYA 1UA0A 2RMLA 5CYJA 5AXKA 4UT4A 2WTFA 2X3DA 1LFWA 3C46A 5HP1B 4DV3F 5HQ8A 4DOZA 1RHJB 3FBEA 1VGYA 1YJ7A 2W7AA 1RI7A 1XK8A 5KFCA 2QN6B 4F3MA 4ED3A 4M5KA 2VDHA 1I5OB 3LANA 1RTHA 3V5RA 2ZZTA 1S97A 2ZBRA 1RWMB 4UUWA 1RT4B 5LJ5Y 3I87A 4ZLJA 5AT1B 5KFTA 1UJ5A 5ADZA 3M2VB 2N3OA 4C8NA 2N7CA 3VAMA 4QWCA 2IYIA 4K0KJ 2QV6A 4O3NA 2RH3A 1OPZA 2M88A 3RAMA 3D66A 5DG9A 4ZP7A 1SL1A 3MM9B 1SC1B 3CCJS 3LP2B 3EPGA 2XULA 5DGAA 2JVOA 2BW7A 5HJYA 1R8AA 1NLKL 2PO4A 2HIYA 3RBXA 1TFWA 4CQ1A 5KOWA 5EUHA 2FJDB 2Q6CA 1TAQA 4IQXA 3N4WA 1TL1B 2PC6A 5H9EJ 4F4WA 2RU3A 1RSCA 3KNGA 5A8KA 4OYAA 1NK0A 4B3RF 1SH2A 2PDAA 3PYDA 3U1LA 4DR4J 4H4OB 4JI3F 3TA2A 3DXBA 1U1NA 3PEJA 4J9RA 3FVYA 3ZZYA 4WKYA 3K59A 1R8PA 4UZCA 4KHRA 1CC7A 3NS7B 2MEWA 1ZM3A 2DCLA 1FJEB 4URSA 1EETB 2HZAA 3Q2SC 1N6QB 5D0EA 3DU6A 2W01A 1U1QA 1AUDA 4YHHF 1GK8A 4B02A 1FEHA 2KM8B 4UY85 4OHYA 3CCLS 1YK9A 3AQOA 5C42A 3SQGB 3KLIB 5C7PA 4WJBA 2YKNA 1HBUB 4B9MA 5KFHA 4KIAA 4R0JA 3MMJA 3CJ4A 2DGVA 4NWBA 5A76A 1XEZA 4WU3A 3M8WA 3SV4A 1JLFB 1L3SA 3JTNA 2P9CA 1VC6A 3T1YJ 2CQHA 3ISNC 2WOMB 4L74A 4Y2MA 3M1VA 2DNPA 2MQLA 2FLNA 1H2TZ 1D9DA 2LCWA 3AT1B 2YWGA 3LOUA 1T05B 3W62A 4TYAA 3UN5A 1IWGA 4NA1A 5CYQA 1Q95G 1NJYA 2XLIA 1RTDB 1NM2A 3HVTB 1VS3A 1NPKA 1K8AT 1HQ2A 1GX5A 1B0TA 5GADI 4RNNA 2YNFA 3BSOA 3I32A 2O1PA 2M8HA 3FCWA 2XNQA 4ED5A 2CYYA 1S1TA 3VGTA 2QLWA 3J7ZT 5DDPC 4USIA 5D0RA 1CBKA 4ALZA 3PJWA 2W9CA 2CJQA 4WU2A 3UNYA 4PG4A 3FNNA 4CLZA 2R2UA 4ED4A 1WG4A 2FUG9 3HO1A 1QE1B 3J7Z5 3J81U 1CQMA 1RTZA 1LKZA 2EKNA 2A0FB 4LF8J 2D3O1 3I5BA 5CHCB 2ZHOA 5IT4A 2UXCF 1NO8A 2VBZA 2Z56B 3MOZA 3QLHA 5DDOC 4L73A 4AXJA 2XZDB 3L3CA 4PR6A 4GKJF 1OMSA 3BKFA 2KYXA 1JLEB 1U0SA 4QIGA 1H38A 1JX4A 4I2PB 2F40A 3SXLA 4JYAJ 4JI0J 2GGPB 2AWZA 3WQPA 2LYVA 3G8QA 1RISA 3SQOP 1QSSA 4RW4B 3M6WA 2ASDA 5IM0A 2HNDB 2XBPA 1H6KX 2XO7A 2K1RA 2QTWA 5FDLB 2HQIA 2FJBB 2JL9A 2COLA 2OD4A 4DV7F 1NSQA 1PYOB 2VD3A 2IM2A 4LF7J 3W63A 1KVKA 3PG9A 2IDEA 4MYUA 4WXWA 5LSLA 2GAGC 1IBCB 2W25A 4JI6J 4AQYF 4C3LA 4Y28C 1LQ9A 4Q45A 3SCLE 1IKWB 2DNOA 4KB7A 3A3OB 5KFXA 1S9EB 1VRUA 1JNRB 2GMLA 4M1KA 2AHOB 4RR5A 3KXDA 4HDHA 1FJGJ 4H54A 4DR7F 3KLHA 3HHLB 3D68A 4EZ6A 2B4PA 3FEXB 2WVEA 1GTHA 4LR7A 4C6AA 5L1KA 5K20B 2HVDA 4M5GA 3BDEA 2ZBQA 1S9GA 4DUTA 4ZP9A 4DX8H 5L9NA 1UEUA 2KKHA 1L3VA 3V6JA 3BGRB 2Y3YA 2RILA 1FFSB 1H2UX 4AT1B 2WRMA 2A2CA 2N82B 4MKYA 2ZBCA 3C14A 3OQ2A 1YDLA 2YX4A 1KN6A 3AA9A 1N5SA 2OKQA 4RWWA 1WC5A 4FN5A 2JC1A 4F2RA 1MN7A 4C0HA 2DR7A 1VBZA 2OPPB 3U7JA 3DGVA 5BYQA 1ZBTA 1AUSL 1SIWB 2ZE2A 2XEXA 2E5JA 3TVYA 4NLTA 3IO1A 1B7YB 4N41A 3OUYA 3HVRA 1DQ8A 3EGWB 3GIRA 1FO1A 4MJKA 5J1EB 4RJVA 1KHWA 2V8HA 2HHQA 1R27B 1PAEX 1A9NB 5D77A 3FKBA 1RKIA 5T7LA 3MUTP 5M2RA 5DLGA 5J2QA 4K2JA 3EICA 1XMOF 2B51A 4G1QA 4JV5J 3RGIA 1UFWA 1IJFB 5F8GA 1S1WB 1FKPA 3MPDA 3QZ7A 3R97A 2ZBIA 1TK8A 1Y10A 3T1HF 4DHVA 1BQMA 3OVBA 2I0XA 1BQNA 3BS9A 3DDKA 1VBXA 4RBVA 1TP7A 1JKHA 4E2FB 2E5GA 2YKMB 2C28A 1LK7A 3M8PB 1WKJA 4F26A 4PPDA 2R7UA 2MZ1A 2A10A 2LQ9A 7FDRA 1R0BG 1CJUB 4PYAA 1FRHA 1VQ4S 1RZMA 3BEGB 4QR1A 1NJXA 3LAMA 5K14B 1UA1A 3K5LA 5KFPA 4BS2A 1F3VA 1K0TA 5KFFA 1FX4A 2HS0A 2WBMA 4WFAQ 1RT7A 2CQ4A 5JVGQ 5HMWA 2HQ3A 3W9JA 4N47A 1YJNS 1O6XA 5IV3A 2CADA 2HFOA 1JLBB 2ROEA 2ASJA 4WPAA 4ZVTB 2FJEB 2VA3A 1SC4B 2RKIA 1UJ4A 3QNWB 2Q6BA 2UXDJ 4OHXA 3NCPA 3RJMB 1GH8A 5SZTA 2OEKA 2DTJA 1S1VA 1D9FA 3Q8SB 1KFDA 2UUAJ 1JJCB 1RAIB 2AIRB 3TX8A 3GLJA 2YWHA 3HVAA 1HNWJ 1M0SA 4WFXA 3M6UA 1UVLA 1KNZA 4U7UK 1F60B 4PQAA 5BR8F 1NK8A 4WTOB 3VVUA 3TNVA 5HAOA 3MPUB 4U8VA 4P73A 2XQCA 3V81A 2MKCA 1D8YA 3SSQA 1T0TV 2L41A 4IYQA 1RAGB 2E5HA 3PR4A 3Q0AA 3UQSA 5KFWA 1N0UA 3FCHA 3R1LA 1DTTA 1UZDA 3PHEA 3IGNA 1C0UB 1WF1A 4DL6A 1TL5A 5KFUA 3NKYA 2ROGA 2YNIB 3VGUA 2LXIA 3OT9A 2ZKUA 2CPXA 2GVZA 3ILIA 1Y3JA 1IKVB 1K9MT 5KG6A 3TUZC 1NH7A 2CNNB 3H20A 4OZ3A 1PCAA 2JH3A 4TKTA 1P6TA 3MOJB 3US5A 3WX4A 3GJRB 4ZN3A 1K1SA 1HBOB 2J9EA 5IXUA 2WSFC 2VG7A 3HVWA 3HSDA 3KNAA 4NPOA 1P9YA 2YH1A 2EFOA 3LW5C 1RWVB 1T3OA 3MEEB 5HK4A 1APSA 3AA8A 2RQMA 1IR0A 3V6DB 2WSCC 3QAUA 4WZMA 3MPYA 4MTPA 2KFNA 3V6KA 5DQGA 1WUUA 2W2NP 1ZPVA 4LRCA 5D0GA 2E7VA 5F0WA 2BE9B 1WC6A 2OUGA 2AYGA 3CMQA 2JEJA 2O5DA 3LO3A 1E6YB 3RR8A 3D2WA 5B0DA 1TAUA 1L3KA 2HYIB 1D09B 4LSNA 1L5UA 1SC3B 3DYAA 3AFGA 4ZLNA 3S6EA 1VQ5S 4YP3A 1CG2A 3QPIA 1S6QA 3BPSP 4MT1A 1UVKA 2LXUA 5E2QA 3UFCX 4C3MA 1LXJA 1SXLA 2H4WB 2G1HA 4G65A 4GC7A 2R8KA 4LBPA 3G6YA 4MIWA 1VK3A 1T9XA 2RB7A 3A4TA 3KHGA 1ITPA 5LXRA 2EW9A 1EJ7L 1RTHB 2MQNA 4UOGA 5GAHI 4C8MA 2IFXA 2YH0A 2WONA 4XPCA 3GFZA 3K17A 4O4GB 2EG1A 2VFUA 4K4YA 3KG0A 4G6VB 2DNMA 2CPJA 3KMSA 2MJUA 3MDFA 1N32F 4U6PA 1HD1A 4A47A 4MKBA 1X4HA 1TL4A 4DX6A 3BPDA 2LEAA 4LR8A 1RBLA 2OTLS 2MQQA 3CSKA 3CCWA 4NRUA 1PKUA 2RIJA 4PEOA 1GMWA 1LW2A 1LV5A 4K4ZA 1LFPA 3I9ZA 2R9LA 5A8RA 3SSSA 4DQQA 4DBQA 1M1KT 2VH7A 4BLGA 3SFGA 5J2MA 1KQFB 2XI2A 4FF3A 3DHXA 3UI3A 4LFCJ 4FKYA 2CQ2A 1KQKA 5A8KB 2DH8A 4CDIA 4IKAA 4OFZA 1FWLA 2AZ3A 5I3UA 3TYTA 4CO4A 3I96A 2DY9A 4PCQA 5K9FA 4DV1J 1MMNA 4O3OA 3VV2B 2DHAA 2Y0BB 4UW2A 2FIUA 4NZ0A 4JI8J 2B6AA 2MQMA 3VZHA 2HFVA 4DSEA 2LEPA 2W4PA 4QPTA 3DRXA 4XDCA 2V34A 2ZDPA 4RLEA 2ZM6J 4OI6A 3H8YA 3R5DA 1IBMJ 4PXDA 1B70B 4F0MA 2BJ9A 3E8OA 2AEFA 4J9PA 3D6FB 1S57A 2HG4A 4QWDA 4DN9A 1K0VA 2VFRA 5C42B 2MPUA 1HWLA 1F5CA 2OPRA 2MQ8A 1RU1A 3EPIA 1WF0A 4USJC 2UV8A 2YKNB 4TVAB 3A8EA 4KQZA 1SH3A 4ED0A 4LQ9A 3GFXA 4PUOA 5KG3A 4C97A 4LVOP 1ULRA 2B7BB 4CH7A 1S6UA 5KT3A 2MKYA 1U1LA 4NA2A 1MNEA 2HQFA 1RT2A 4ZMMA 3M1VB 1H74A 4NLSA 2BOAA 4JV1A 3RR7A 4RU2A 2BBEA 5CAAA 5G4DA 4YB7A 1GEHA 2LA4A 5KFGA 3HPOA 8RUCA 3M05A 3UN2A 5CYQB 4IDKA 4O3RA 1FRMA 5HMYA 3TJAA 4DV0F 2YNFB 4DQIA 3ULHA 2RHSB 2RT3A 1KQSR 1S7IA 2DPIA 4WP3A 3OPKA 2OFGX 4Z7CA 5DLFA 4PG7A 1S1TB 2ZEJA 4FKXA 2EEYA 4KHPJ 1Q8LA 2B8PA 3HHNB 2NSCA 4A8FA 2BJDA 2NSBA 2UP1A 2W9CB 4DR5F 3ZTOA 1N5QA 1M1GA 1NPPA 3ZTQA 4ZIWA 3OL6A 2CQ1A 3RB0A 3K7RA 3IS9A 4ZA1A 2X1FA 1KVIA 4BHQA 3W9IA 4Z7YA 4E0DA 3GWCA 2IY5B 3H5SA 2ZUAA 3QLHB 4LRFA 7FD1A 4OYWA 3O8WA 3PW2A 1Q86T 3M8YA 4WKRA 3EDRB 3L7UA 1VC5A 1REVB 2AJ2A 7AT1B 4KGVB 1UVIA 4KFBB 3AB4B 4X4UA 1EAYC 4G1IA 3GV5B 2D3ZA 3FC9A 5IM0B 4N5SA 4P9SA 1LWCB 3QGPA 1WJ9A 3MUVP 2Y1JA 2DB1A 3GYGA 1HARA 1SJFA 3CJRA 5KT6A 3VALA 4QQBA 5CCLA 3JYTA 5KFVA 4HEA9 1SJ3P 2F4VF 1X5PA 3T5HA 1YGYA 4KGZB 1F0XA 1UZHA 2OFHX 2QC3A 2WAQD 4OI1A 2IHR1 4CH0S 2QFIA 2DNZA 1ZM4A 1C1CA 2VG5A 4IOAQ 5ETRA 3GV8B 4CO3A 4K5RA 2I2YA 4ICLA 5ETLA 3D9BA 1PYTA 1AFJA 5ETMA 1N52B 4TU7A 1VRUB 2BANB 1B3TA 2JWNA 2O01C 4B3MJ 3QATA 4WF9Q 3FSXA 1NXIA 1AT1B 3TRGA 2QIFA 4RNMA 1UKUA 1MLAA 2KHDA 2QSFA 3Q8VA 4EUVA 4C7QA 3KLFA 4K0KF 2B4OA 4B3OA 4CNYA 1WHYA 1S6PB 4C3KA 1R8BA 4WIIA 2DYAA 1R0CB 3HMJG 1DFDA 1CS4A 1FDNA 2XSFA 5A0YA 4L6V3 5CD4A 1Q8BA 2NPIA 2R7QA 4DCPB 3K5NA 1X8DA 4GVBA 4F8RA 3SI8A 5D3GA 3MURP 4TN2A 3BO2A 3B4MA 1FD2A 4NCAA 5GAGU 2D41A 3TO8A 2MKKA 4LF1A 2ZE2B 1FCAA 3NGRA 3W8GA 3F44A 1ZAVA 1T8EA 4A8XA 5BJRA 4ECYA 3OUYB 1PGZA 4D3GA 1TU0B 4DR4F 4NX9A 1NK5A 1GXTA 2ZH3A 3BZQA 5GVQA 3UD4P 1LWFA 3CTRA 4OQJA 4ZP8A 5KFQA 1S99A 2V8GA 3KDOA 4B9UA 1BE4A 1NUEA 4X4VA 4CTAA 2IJNA 3CJSA 3C6TA 3OD2A 4YN3B 3S8SA 3MAQA 5T7LB 4FF2A 8AT1B 3IFEA 3TZYA 3R7SB 3LTOA 1SJRA 5J2QB 1DARA 3DLGA 1VHFA 2D9PA 3PW5A 2VODA 2UXBJ 4G1QB 1RJJA 3Q8QB 1HL6A 2VJUA 1FKPB 4M95A 4Q5VA 1YJ9S 3TAMA 2RQKA 2MZSA 2CQDA 2FHJD 1YBTA 1BQMB 5D4PA 4EU0A 4HDGA 2CQBA 1BQNB 2KN4A 1OSCA 2DR6A 1VQ6S 1JKHB 1YVFA 3E01B 5RUBA 3KWMA
chains in the Genus database with same CATH topology
2FDNA 2ILZA 4Y6IA 2MHEA 4N8OA 3NRBA 2UUTA 4XDDA 4ETZA 2HMIB 4FPRA 4LF9F 4NYOA 3IC1A 1RAJA 2WW8A 4K4VA 1JLCB 5IQQA 3JB9k 3K5PA 2W4CA 2BANA 1TL3A 1C0UA 1T94A 2CFXA 3T1YF 1SH0A 2C3YA 4URGA 1J5OB 1URNA 1H98A 3JSMB 3DLHA 5F8NA 3IR5B 5C25B 2VBXA 3OR2A 1X4FA 3BSCA 3EX7B 1YJWS 4OZJA 3IG1A 1WTBA 2B7CB 3Q24A 4RW6B 1E6VB 1ZZNA 2R7SA 3OLAA 2W8LA 3NMRA 5KFZA 5DRKA 2CJBA 3CDAA 4OJ1A 4OHWA 1ZZFA 2YNIA 1O8BA 2DT9A 3KJVA 3ISZA 4WXOA 2IRYA 1X4EA 2BE2A 2CQ0A 3CMES 2VKRA 4TQSA 2Q3PA 1IKVA 4RW7A 4TLQA 1NK4A 1X9WA 5F8MA 1J5OA 1D0EA 4H4MB 2DGWA 1Y3KA 2KRBA 4NLVA 4HTIA 5L1IA 4YY3F 1N34F 3H2VE 4O3QA 4OX8A 3IAS9 3BGFA 3QJLA 2A18A 2V94A 2WSEC 3PRBA 4LF4F 4DFPA 2VFVA 1HBOA 2BW2A 2DNKA 1RT7B 1VOMA 2I5JA 5GAEU 4J9LA 2J6SA 1S6PA 3QIPA 4MMOA 1HMVB 4AXIA 4JV0A 2H5EA 3L7OA 3DU5A 4QR2A 5EHHA 4ED8A 1FDDA 2EBGA 5JXSA 1DTQA 3CPWR 4C8ZA 3W2VA 5KG5A 2AGPA 4E98A 1R8HA 2DH9A 4C0OC 1AXQA 1NH8A 3MEEA 3HK2A 5B0AA 5CYMA 4GC6A 1N48A 1JXEA 2ZJPQ 1WG5A 2RRNA 2WB1D 3V6DA 3M6VA 3DRSA 4N8NA 3FDSA 2MMYA 2K3KA 3RAXA 2BZ2A 4M63A 2ZJRQ 4LVNP 5F8HA 3CD0A 3O44A 4RW9B 3HHLC 2Q43A 1YITS 4LFAF 1IKYA 2Q79A 3CCES 3S7RA 2XSJB 4YQWA 1XWLA 3PFEA 2HGLA 3U1MA 3PXGa 2RKIB 1TKDA 3SZ2A 3HHLD 3VR1A 5DM7Q 1VIXA 4PKDB 2XC9A 3DLEA 4QR0A 3UNGC 2D3OR 4TQRA 1RDRA 1YJVA 4LF8F 1R6YA 4KJIA 1NU4A 1S1VB 3MM5A 4MH8A 2VFSA 1QM9A 1SIZA 2XI3A 4Q43A 3T5JA 1WEXA 2LDIA 2MYFA 3M9OB 4FBUA 1X4GA 1E6YA 1R8CA 1GXLA 1JB0C 2RE1A 3ITHB 3LQVA 2M3DA 4MFBB 4MK9A 3SCIE 3SCJE 1C1BB 2ZH6A 1IJEB 1TKTB 2B9WA 2J76E 4I1TA 4H4KA 2E1MC 1JLQB 1UW4A 4JBCA 1Y9OA 5DS7A 4O3PA 3PIPQ 4ECQA 2AU0A 1TUVA 2GJIA 4BWMA 2RRBA 4Y00A 3HX9A 2B3TB 1UA0A 2AW0A 3HKWA 2RMLA 2FHMA 5CYJA 5KFNA 2L9DA 4QJVA 5AXKA 4NYZA 2WTFA 3GIKA 4FS1A 1S0VA 5IT0A 5IS2A 1FE0A 1LFWA 4YR0A 3C46A 2C42A 4O44A 1M5SA 1XBWA 5HP1B 4RUCA 1TKZB 2JJ4D 1JXLA 4JYAF 3TR5A 4DV3F 4HLBA 4JI0F 5HQ8A 4DOZA 2BR0A 4JV2A 5GAHU 3MHYA 2QMWA 2GQ2A 2GV1A 1VGYA 2WHOA 2CPDA 3THPA 1S10A 3I0RA 4F4XA 1DLOA 2W7AA 2QLXA 2PA3A 3N6NA 1RI7A 2FGOA 4KO0A 1XK8A 3BGLA 5KFCA 2XS2A 1JJHA 4F3MA 4ED3A 3V81B 4LUBA 3IR7B 2J9CA 1NRKA 3DRPA 2F8EX 3FMWA 2EWHA 3LANA 4M5DA 4J9OA 2F9JA 5E5NA 3IBWA 2ZH1A 3DOKA 4RW8B 1RTHA 3V5RA 4XPEA 4F4ZA 3PKMA 3DI6B 1S97A 5DGBA 3N5FA 2JLFA 4BWJA 4MKAA 1NKBA 4PXEA 4UUWA 4Y34A 4LF7F 1KVJA 1DTTB 4DLEA 1RT4B 4NLYA 4I2QA 5LJ5Y 3BN4A 4IG0A 1P1LA 4WE1A 1IKXA 3GR0A 3RTVA 2N4DA 3I87A 2XY5A 5KTQA 1RT6B 1HQEB 3EGZA 2A3JA 2ILYA 3VQTA 2OJ3A 5KFTA 3OR1A 1UJ5A 3UCGA 1FF2A 1Q81T 1MW7A 3DOLA 3AHPA 4CO0A 5ADZA 3M2VB 2N3OA 1P1TA 1TV6A 2J7WA 2HRUA 4C8NA 2N7CA 2APOA 2V9KA 3VAMA 2DR8A 1FHTA 2ZHBA 4QWCA 2IYIA 4NYPA 2QV6A 2LEBA 3TUJC 4JI6F 4O3NA 2RH3A 3THTA 5LMNF 1OPZA 4CO5A 4ZHRA 3KK3B 5HMZA 3E01A 3KG4A 3VWSA 2HVHA 1VQSA 2CDQA 2M88A 2HVIA 3RAMA 2PMHA 3H4BA 5DG9A 4EO6A 4ZP7A 1SL1A 4TXSA 4PQUB 3MM9B 3FFIB 3CCJS 3LP2B 2FC9A 2V4JB 1X5TA 1SJQA 5EWGA 4Q7AA 1N88A 4ZP6A 5LT5A 2XULA 3EPGA 1QSYA 5E41A 2IVYA 5DGAA 1DHMA 1RYSA 2JVOA 5C24A 2HMIA 1R8AA 2DNQA 1U1MA 2V2KA 4Y3CA 1U1PA 2PO4A 1TFWA 3T1AA 1FJ7A 4CQ1A 2RDIA 2RJZA 1FJGF 2VG7B 2DVIA 3C2PA 5KOWA 1UFLA 1NK9A 1D8ZA 2XS7A 2AF6A 4HL9A 5THWA 1BGXT 1S0MA 1D9AA 3JSBA 2J0QD 2MDAA 2ZKTA 1XERA 3BR8A 5EUHA 2R8HA 1RT5B 2X1AA 2XMUA 2FJDB 3H5UA 1AROP 2NZ4A 2NREA 1XNQF 3DOMA 2Q6CA 2WB4A 1TAQA 1FXDA 4Y65A 4IQXA 3N4WA 1TL1B 1M5VC 2OIHA 2I38A 3KFWX 2QO3A 2DCUB 2VPWB 5KFSA 2D7SA 4ID8A 2UZAA 2ZD1A 1NAQA 2PC6A 2AP6A 4YUDA 3MMAA 4F4WA 4YR3A 2RU3A 5H9EJ 1Q78A 1N5YB 1IBLF 2HHWA 4K4SA 3KNGA 2BUNA 4RU9A 2BQRA 5A8KA 1TZ0A 4KC5A 4J37A 1NK0A 2XG8A 3PFOA 4B3RF 5DJBA 4EBEA 5F8JA 2PDAA 1SH2A 1D1UA 1WG1A 1FRJA 3BF4A 4NLPA 4C0BA 1HPZA 1CVJA 3PRDA 1HWIA 1DBDA 2PT0A 3U1LA 4ELUA 2OPQA 1VQMS 1M90T 4H4OB 4JI3F 4WYLA 1S77D 1S48A 1LWEA 3TUIC 3G6ES 3TVKA 4DFMA 3TQ1A 2J6UA 4URQU 4R5PA 2MHNA 2MY7A 3FEZA 3TA2A 4ILMA 2ZFHA 5A8WB 3DXBA 1U1NA 5A6WA 4DG1A 2YNGA 3J7YI 3PEJA 4J9RA 2AQ4A 3FVYA 5E0OA 3ETOA 5CQGA 3ZZYA 3HI9A 4LSNB 2NS1B 4WKYA 1UWBA 3K59A 1CQNA 1R8PA 5EWFA 3DYAB 2GQQA 3PACA 3SDEB 1HNIA 4KHRA 4KT0C 5AE3A 1F2GA 1CC7A 2GNKA 3I6PA 2DR5A 1ZOTA 1Q16B 2QMXA 1CC8A 4C98A 2IVMA 1V3RA 4J9MA 2L3MA 1BC6A 3OTBA 2AD9A 1B7FA 1ZM3A 1RWUA 2AYMA 1S6QB 2DCLA 2HNYA 2AV5A 5D78A 1VQLS 2ZH2A 2VA2A 2CPIA 1FERA 1FTCA 2K1RB 1FJEB 1FKOB 2NXUA 3K8WA 4URSA 1EETB 3IWNC 2C3OA 2KXHA 3Q2SC 4IOBA 4DL0C 1N6QB 2BXJA 3I5CA 3DM2A 2PI5A 3DU6A 1X4CA 4DEZA 4TU8A 4XAKA 3KLGA 3MGJA 2V8DA 1F9FA 2E66A 1HWJA 1U1QA 2O67A 2M8DB 4QIFA 1FD8A 2DNGA 1CEZA 4MFBA 3TAPA 2I8EA 1AUDA 2HS3A 1TKTA 4PG6A 1CPZA 1HI0P 2FTRA 3EGNA 4YHHF 4HT7A 3V4MA 1S1XA 1HYSB 4B02A 2JVRA 4HI2A 1FEHA 2KM8B 1KOHA 4UY85 1H7WA 3SSRA 1KC8T 1UVMA 4OHYA 5KG4A 2XHWA 3CCLS 2R7TA 3AQOA 5C42A 3B78A 1FEEA 5KG1A 3SQGB 2ZNYA 3E51A 2J6TA 3QMQA 2JZ5A 2WONB 3KLIB 2FY1A 1XNRF 4WJBA 2YKNA 1ELOA 4NOHA 2FLLA 1HBUB 1KS2A 5L8RC 4B9MA 1R43A 1SB6A 5HP1A 4B9LA 1FXLA 4UOCA 2BACA 4FXVA 5KFHA 2BOPA 4KIAA 4R0JA 2VB6A 3NP5A 2RF2A 2F9DA 4OI3A 2DGQA 3MMJA 2YY3A 4YB5A 3CJ4A 2DGVA 4NWBA 3TANA 4WZQA 4CCHA 4O0IA 1RT3B 1FVSA 3CXCR 1C2PA 1ZTTA 1FDBA 4OJ3A 2OPSA 1G2EA 5E3AA 1XEZA 4WU3A 2ZUGA 1N56A 2VBWA 3MCSA 3I0SB 3SV4A 1JLFB 1L3SA 1Z2ZA 4QYZJ 2J0XA 2PGCA 4IFVB 5SUHA 3JTNA 5HROA 1IN0A 2DRAA 2P9CA 2WCXA 1VC6A 4RUAA 3GE9A 4F25A 4YOEA 3KLHB 4KGMA 4C8LA 2J0WA 2B5JA 1ZTWA 2FLPA 1DAXA 3I56S 1U4BA 1RYRA 2CQHA 3ISNC 2WOMB 4Y2MA 4LQ3A 2KDOA 1UVJA 3AJ1A 3EXYA 2MKHA 1NJZA 5T41A 4RNFA 3M1VA 2DNPA 1TVRB 1DQAA 1LW2B 1VRTB 2VG6A 2MQLA 2FLNA 2JLEA 4QZVB 3ISND 4DN0A 3CVKA 1H2TZ 2D3UA 4KRWA 2LU2A 1D9DA 2LCWA 4CH1A 2YWGA 3LOUA 3MR6A 1T05B 1FKAF 1WWHA 4TYAA 2B0GA 1QY7A 3FGVA 4NA1A 2R7RA 4X4PA 1S9GB 3F73A 5A8RB 2F8MA 5CYQA 1ZH5A 2CVIA 1NJYA 2XLIA 1RTDB 3HVTB 1RTJA 1VS3A 4V19X 1VBYA 1K8AT 3DN9A 4FVCA 1VQ7S 1XTZA 1GX5A 1B0TA 5GADI 1IM4A 2E1CA 4RNNA 3RB3A 3HLUA 2YNFA 2G9OA 5J2MB 3BSOA 3I32A 2JRSA 3HHEA 2O1PA 2DIUA 2FHOB 2M8HA 3F56A 3VAFA 2XNQA 4ED5A 2YKQA 1RQ0A 1S1TA 1UAWA 1VJWA 1HWKA 1WHXA 2CYYA 4YDXA 2QLWA 3QZ8A 1TK0A 4DR6F 3J7ZT 3P3DA 4RX6A 1U09A 1X4DA 4IO9Q 1WD6A 2HVZA 2YTCA 5DDPC 2Q66A 4USIA 5F9LA 3IR6B 2XZWA 3UR3C 2R7OA 5I3UB 1F5AA 5D4LA 3EUNA 4ALZA 3PJWA 3ICLA 2W9CA 3R5CA 2CJQA 1SJ4P 4JOUA 4WU2A 4PG4A 3FNNA 3MEGB 2CQPA 1HHSA 3IWXA 2R2UA 3IGVA 3BSAA 4OZ0A 4PWDA 2YNHB 1RT5A 2Y0SD 5EX3A 2EK6A 4HH0A 2OAUA 3GR1A 1WG4A 2W7PA 4LMZA 3D0HE 4ZVHA 2HNZB 2MJNA 2FUG9 1WHWA 4QIEA 1UP1A 3HO1A 1QE1B 4YB1P 3J7Z5 3MXHP 4LFBF 4RBTA 2RQCA 1CQMA 2QFJA 1LKZA 2E9RX 4FXDA 2B6AB 1T95A 2B56A 1FA0A 4P7TA 4ZPWR 2YQ3A 4ZK7M 2IA0A 3UD3P 1EP4B 3AY0A 2VPYB 2X1GA 1NHVA 4RZRA 1M5HA 2JDJA 3I5BA 5CHCB 4ED1A 2JX2A 2ZHOA 5IT4A 2UXCF 1NO8A 2VBZA 3PX0A 1ZYQA 2KT3A 3MOZA 2M9KA 5I42A 3MFHA 3QLHA 1S0OA 2L9WA 5FIIA 4C11A 5DDOC 4AXJA 1OIAA 4J9KA 3MEDA 1RGVA 3MR3A 2K7JA 5HBMB 3L3CA 1T7PA 5H9FJ 1BWEA 1UJ6A 1S6OA 3ZZUA 1KEKA 4PR6A 4R0EA 3BN7A 3IXQA 4QU6A 4A8SA 3RBEA 2HWTA 4GKJF 4ELVA 3ENWA 3CJKA 3HJFA 2AJ4A 2KYXA 1JLEB 3ENVA 2C2RA 2FVSA 4QIVA 2G4BA 4R8UA 3NBPA 4QIGA 1H38A 2Z2MA 1JX4A 4I2PB 3CCUS 2F40A 3SXLA 1U48A 2PSZA 4IH6A 3VAHA 2W8KA 2LVWA 3KKFA 5DDQC 2FJXA 4NXMF 2E9TA 3ENQA 1AFIA 1Y5NB 2OPRB 4ED7A 2GGPB 2AWZA 2LYVA 3NL0A 2DO4A 3G8QA 1RISA 2VONA 2X1BA 4F2SA 2UXDF 2M70A 3O2IA 3LP1A 4B17A 4BC7A 1QSSA 1I6JA 4A8YA 5KFYA 4RW4B 3PEHA 3M6WA 4FNHA 2ASDA 5IM0A 4B9SA 3BSNA 1BQXA 2GO9A 2HNDB 2U2FA 2XBPA 3DRRB 1H6KX 3QAEA 5EGYA 3OW2R 4IR1A 3ZZPA 2X3GA 2XO7A 2K1RA 2UUAF 1Y7PA 1EETA 1MWYA 5FDLB 2HQIA 2IC3A 4K5SA 2KTQA 2FJBB 2JL9A 2COLA 2OD4A 4DV7F 2W7OA 2E5LF 4PUOB 2EFGA 4NLXA 2VD3A 4NCBA 5KFDA 2IM2A 4NXNF 1HNWF 3DFEA 4OLOA 5F8IA 3NGKA 4RNOA 2DH7A 2V8VA 5B09A 2VFTA 2CJAA 2CPZA 5B08A 2ATLA 1FRXA 2D74B 2QA2A 2YWKA 3MMBA 2FLOA 3M4XA 4NZ6A 3CC7S 2ZH8A 4ID5A 4OI4A 2L08A 4HTJA 1RT2B 3CIZA 2C2DA 4QW8A 4MYUA 3U27A 2FHKA 2V9WA 4H4KC 4TY8B 1X4BA 5I3PA 4WXWA 4CNZA 4USHA 5LSLA 1BD6A 4RKUC 4AL5A 4KBIA 2W25A 2R8IA 2ERRA 1OO0B 2NYIA 2XCPA 2LA6A 4AQYF 1Z1ZA 3NCQA 3VQSA 3MI7X 3MZIA 4C3LA 2CPEA 4Y28C 1LQ9A 3TA0A 2MQPA 4Q45A 3SCLE 2DISA 4MIAA 4IDKB 1VQYA 3RRGA 1IKWB 4JI2F 4ECTA 3KK1B 1HI1A 2XLKA 5KFIA 2XMWA 2DNOA 4KB7A 5KFXA 1S9EB 5KG0A 1VRUA 1JNRB 5IQ6A 2ZH5A 3CDUA 2GMLA 4M1KA 2HZCA 5KOXA 4HYKA 2PI4A 4HDHA 4H54A 1QAXA 4DR7F 5KFAA 2EBEA 2ASYA 3KLHA 4X84A 1TFYA 3HHLB 3V2UC 4QWBA 3OLBA 4EZ6A 1RK8A 4LSLA 3GG1A 1WI6A 2B4PA 3FEXB 3KHRA 3M30B 1GTHA 1VRTA 1TKXA 3K8VA 3FMBA 3D1HA 3MD3A 2P9GA 1MWZA 5E3CA 5DG7A 1JLAA 5C5JA 3BDPA 5L1KA 3LF0A 4FF4A 1WACA 4F3OA 3BDEA 4DFKA 1S9GA 4DUYF 3X3UA 1X9SA 1FRLA 2IM3A 4DMZA 1HHTP 4C9DA 4ZP9A 4DX8H 5L9NA 1UEUA 2KKHA 3ZZZA 3IS9B 1L3VA 3V6JA 2GQCA 3NGDA 3DC2A 3FRZA 3K5MA 1FXRA 3BGRB 3PM9A 1Y4ZB 4ZLPA 3M8QA 1JWWA 3M2UB 1Y0HA 2ZNZA 3OFEA 2KVIA 1S1UA 2K7KA 5HN0A 3G6XA 1VK8A 3PO4A 2VASA 5KG2A 1YG0A 2RILA 5E3QA 2CKWA 1H2UX 4B9VA 4V19J 2KFYA 2WRMA 2A2CA 3DGPA 2N82B 3Q8PB 1N36F