2NSCA

Structures of and interactions between domains of trigger factor from themotoga maritima
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
109
structure length
109
Chain Sequence
b'MEVKELERDKNRVVLEYVFGAEEIAQAEDKAVRYLNQRVEIPGFRKGRIPKNVLKMKLGEEFQEYTLDFLMDLIPDTLKDRKLILSPIVTERELKDVTARVVVEVHEEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trigger factor
publication title Structures of and interactions between domains of trigger factor from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Chaperone
total genus 24
structure length 109
sequence length 109
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2nscA01
2NSBA 2NSCA
chains in the Genus database with same CATH superfamily
2GX8A 4WIIA 4WBFA 1E6VB 1YBTA 1WTFA 3DLLQ 4ZHRA 3P5BP 4K5RA 4ZCKA 2UV8A 3VAGA 2WZ1A 2ZH4A 4MYTA 3C6UB 1HMVA 3CCQS 1CJKA 1RT1B 4NLTA 3RB4A 3SV4A 3FKBA 3GWCA 2ZE2A 1MMLA 3EX7B 5KFVA 2HRUA 1RTDA 5ETNA 3OL9A 3ETMA 2G0JA 3GMGA 4HT5A 3GCXP 2IJFA 2MGZA 1A7GE 2V8DA 4JI5J 1FVQA 1YGYA 1B4SA 1KC8T 5C25B 2HBRB 1K0VA 5LSLA 3U1MA 4YEAA 3LP1A 5IXUA 1F1BB 2HIQA 4JV2A 2VODA 4KB7A 4CLLA 3S6EA 3ONQA 1G6BA 3LGHA 5HN0A 2HGLA 1LXNA 4RBVA 2DR5A 3BQ1A 3NS7B 3BYPA 2GGPA 1RBLA 4B9NA 5IT9Y 3BQ2A 2VQEF 1U4BA 4P75A 2BKOA 3BO3A 1VS3A 1MROB 1S0OA 2C2RA 2HK2A 4DSFA 1VK3A 3CXCR 3BPSP 4KGXB 2FVSA 3QATA 1EHWA 3KTQA 4DL4A 3M6VA 3O2IA 2R8GA 3I0RB 2HQDA 2OEKA 4K4SA 1VISA 1T8EA 5IM0B 2COLA 2XWXA 3E3XA 4G65A 1U0SA 2MLZA 3N28A 2JVRA 4QU7A 2HWTA 4DWIA 1U1RA 1HI1A 3A3NB 2VJUA 3VAJA 5ETQA 3ZZPA 3RAXA 1DQAA 1SUQB 3M8ZA 3G82A 3R3TA 2W01A 1OY8A 2I0XA 4OYOA 1SL1A 2E9RX 2OHDA 4ED1A 2CAJA 5KT5A 2HRTA 5KG7A 1R43A 2WVEA 2XQCA 4I4BA 1KLMA 1QAJA 3CIMA 1RHKB 3AY0A 2VJVA 1BWVA 3TJ9A 1VRQC 4NLVA 4LF8J 3MM8B 5H9EJ 3OJSA 3RBXA 2WCXA 4FVCA 1VBYA 3T19A 2IHR1 4OV6A 4YS2A 2IYGA 2PMZD 5T7LB 2LEBA 1VQYA 1QM9A 4UY85 4DSIA 4EO8A 1Q4RA 3IGVA 5A8WB 1NB7A 4PXEA 3GU0A 4YB7A 2HFSA 4OQJA 2DRDA 4IG0B 1VQ6S 3HSGA 3LH2S 3C16A 2NLWA 2J6TA 1T94A 3TUPA 3H42A 4OYBA 3JSRA 1PJ5A 4ELVA 3FFIA 1WELA 4NYOA 2KJWA 4KRWA 3POTB 1NCLA 4D3GA 1UJ6A 1HWUA 2I9SA 4J9PA 4JI6J 1XNRF 3DGPB 2B9XA 1XR7A 5ETMA 1W26A 3M8PA 3GIKA 3HSJA 2MZJA 1ZETA 2B8QA 1DTTA 2MY7A 1R8PA 2XHCA 4U95A 2XY5A 2HLTA 1IBKF 3DKDA 4MK8A 4F3QA 1KNZA 4C9DA 2KH9A 4X4QA 4OYWA 1IR2A 4EU0A 3ET6B 4TYBA 3IM9A 1UL3A 4WXWA 5GAEI 1NPKA 1TL7A 4DV2F 1IKYB 1BQXA 4I6AA 1T05A 4OX6A 4HTJA 1YZ6A 4YY3J 4I6WA 2G9OA 4USUA 1JLGB 3IP0A 4LBPA 1RHUB 3CD6S 1PGZA 3KHHA 2W2NP 1JNZB 1TZ0A 5ETTA 4CYUA 2MLYA 3BB5A 4JI1F 3MPDA 2IAJB 1NK5A 3UNGC 2HZVA 1X7VA 4U96A 4UT4A 2RHSB 4PZVA 1YJTA 3NAHA 4LFCF 1NM2A 1XQIA 4O44B 3HKZD 1UA0A 1LWFB 3NGDA 2NXEA 3QJPA 2A1BA 1IKWA 1UAWA 3RG6A 4GC6A 3M2UB 3SSQA 2K3KA 5J1EB 5HJYA 4LF5J 3OV7A 4Y2MA 4DX8H 5KTQA 4RW9A 3MMJA 2IIHA 2DIVA 2IC3A 2QL7B 4JBCA 2D41A 3DXBA 1RAHB 2EFQA 3SI8A 3VTIA 3UE2A 3DRRB 1HBNA 1YQHA 3SDEA 3X3UA 1SQFA 1IJFB 3PW5A 4C4WA 2KB2A 3IM8A 3HHNB 4EBCA 1IBLJ 2UUBJ 1Y5IB 2YKOA 3PHTA 4DMZA 1UWBA 4RW6A 5EX3A 1WDDA 3MM6A 4CT9A 2B9WA 4DPOA 4LFBF 3ETOA 1S79A 4RBTA 5L1KA 1FO1A 2G1DA 2M8HA 4AE5A 2O5DA 2DHXA 2FJVA 1X9WA 1SQGA 3HFVA 2K3IA 2F9JA 1BQMB 3H90A 4ES2A 2UXCF 4DQQA 1LNQA 4S0MA 5MLCV 5I3QA 4J9LA 3PFEA 3M2VA 1A6LA 1UFLA 2WHOA 4IH6A 4U67Q 2DT9A 3DLGA 2J6SA 2W8LA 1PG5B 4XDDA 1F5CA 3M6XA 3D6TB 1HW9A 1U1OA 2IMOA 1AFJA 1PC5A 3QWUA 3AD9C 1GXUA 1NRKA 3CCWA 3MMAA 4YHHF 1QUVA 2J7KA 3A1YG 1OYDA 4K4TA 1LW0B 2Y0BB 2HYIB 1KFDA 3U27A 2ZJQQ 1L3UA 1ZTTA 2NPFA 3TRGA 3MR6A 1J5EJ 5ETRA 3KOAA 1VRTB 1N33F 2AZ1A 4QR2A 3RRGA 4K4UA 4ZOSA 4MJKA 4JV5J 3MD1A 3MWBA 3ZO7A 1H0HB 2ZOGA 3A12A 4WK3A 4ECWA 2QX0A 2N3LA 2P9GA 2YY3A 4QJVA 2N7YA 5D0GA 2JJ4D 2AGPA 2H5JB 2JEGA 3FCHA 4R0EA 4DR1J 2XMTA 2O3DA 2RKIB 3LW5C 4M63A 3MUMP 3NWRA 1E6YB 2CPFA 5KFFA 1FDAA 1FJGJ 2W4DA 5L9XA 4DX6A 4WE1A 1N36J 3JTPA 3NNAA 3V6KA 5D8HB 5HLFA 3RAQA 4OJHA 4MIWA 1D8ZA 3KHRA 3EXYA 1QSYA 1TELA 5HBMA 2FC8A 1I5OB 3H5XA 1PC4A 4KH0B 5IT0A 2P9CA 2GJIA 1H74A 3CJ8A 1S9FA 1SCJB 1HLWA 2HVIA 3DLHA 4C98A 2QFJA 7AT1B 4LMZA 4KAIA 3WBZA 3R27A 3LWMA 4OX9J 2E7XA 2MSSA 5C5JA 4B3MJ 1U8WA 1HNZF 2V2ZA 4KYZA 4IFYA 5B08A 3W2VA 2HMIA 2XBPA 1U2RA 3BGRB 2W9AA 3KMQA 4E8UA 2B5JA 2IM0A 2YH0A 1FX4A 1RA6A 1VQNS 1PCAA 1KEKA 5ETVA 1MMNA 2LU1A 3WZ0A 2CQ4A 3OL7A 2OO4A 1NK8A 2Z57B 5IOLA 5GVQA 4FXDA 3JYTA 1HPZA 4AQYJ 2QA4S 1NH7A 4H4MB 2PMWA 3ILOA 3ENAA 3OXGA 2R42A 5A2QU 3NGTA 4C8OA 4JYAJ 3DLEA 1UCNA 2LXFA 4F25A 2DGTA 3P8BB 2DK2A 3NGKA 4YUDA 3CDEA 1FJEB 3TUZC 3CIZA 3L9ZA 5K8PA 2XMUA 5I4MA 3LAMA 2QRRA 4I64A 3Q83A 4OI1A 2FHKA 3H2LA 5EGYA 4CIOA 2VQFF 4ID8A 1HHTP 2CPEA 4NA1A 2QV6A 1KTVA 3R1HA 2W2OP 2HNZA 3NXZA 5HP1A 2R2TA 2C3OA 3QZ7A 4O3NA 2MMYA 1U26A 4LF4J 5KG0A 5LM7E 4CRJA 1RLDA 3KK3A 1VQMS 1VIXA 4CO2A 4RNMA 3FBEA 3FEXB 4U9RA 5J2MA 1JLCA 4EBEA 1NKEA 5GAEU 1FRLA 3TQEA 4FVMA 1DQ8A 1S57A 2RU9A 5KFXA 1VLYA 5H1SV 1OS5A 2HAIA 5HL7Q 1WC3A 2RQ4A 2WONB 2HNDA 2KDOA 3GTYX 1S6QB 2FJBB 2R9LA 1EETB 1O51A 2YH1A 2ZDPA 2PA3A 1I6JA 2R7VA 2MKIA 2Z0GA 1T9YA 2I5JB 1M1KT 3I9ZA 4DUTA 4CI0B 3TYTA 2E5HA 2VFRA 1WG5A 1NHKL 3KG0A 3DRSB 2MYFA 4ZVTB 2NSBA 2JFKA 4YB6A 1FXLA 2QMWA 2CRLA 2OMLA 4LF7J 2L9NA 1E6VA 3JQMA 2C3PA 1KWMA 3H5UA 4KO0B 5KFIA 4RNFA 5B0GA 3MECB 5CYJA 2B3TB 5CA5A 3QQCD 1K9MT 1U47A 3W8PA 1DQ9A 2B0GA 2FB0A 3IR5B 1NEEA 4A8SA 1R0BG 2E1MC 4LRDA 4UOHA 3J81Y 1X60A 4LSNB 4CNZA 1AW0A 4DUZF 2H9ZA 1SIZA 3D7SB 1RT3A 2BABA 1I94F 1N48A 2VL1A 4Y2KA 4F0MA 2PFDA 5ITHA 3D2WA 1FWKA 3ISNC 2EC0A 1IKXA 1P1TA 3RR8A 1KQKA 1NDKA 2PD1A 1DURA 4MK7A 4IRCA 2W7PA 5IFMA 2XULA 2HPUA 3MTJA 1JWWA 2ILYA 4ZIWA 2RJZA 3R7SB 2J0QD 3HVWA 2VONA 4P72A 1RWKB 2IM3A 1EQMA 4YMEA 1MROA 1VFJA 4IR1A 2DXEA 1KLNA 4A8YA 2HBQB 1ZA1B 2HWHA 2OD6A 3MXHP 5LXYA 3HHLB 2IVYA 4PEOA 3HJFA 3IMQJ 3I0RA 1JKHA 1CJUA 3FK4A 1BQNA 3AH6A 3ZZ0A 4JI4J 3MM5A 3NCRA 1U1NA 2V2QA 2HQFA 1U6ZA 3VF0B 2Z56B 1ZOTA 2A6OA 1CJVA 2V67A 4ZVOB 1UVMA 2AW0A 3VAIA 1JLQB 4ZK7M 4UZBA 1JMTA 3LPYA 4QU6A 4WKRA 2BW2A 2A6MA 1S9EB 2IYIA 1N5YB 1H38A 4ATNA 4ED4A 1PILA 1WWHA 4O3QA 1KONA 4FDFA 2X3DA 5C2GA 3G9CA 2B6AA 2HGNA 3CE8A 2ZBRA 2M52A 3QT8A 3VR1A 2F5GA 2XHWA 1QE1B 2OP5A 3TZYA 4ZCIA 5AXMA 1XBWA 1WI6A 1RKJA 2BE2B 4NA2A 3M9MB 2FJAB 3CCSS 1FTRA 4DU7A 4IOCQ 2OSRA 2QE5A 4WP8A 1YX2A 3S7RA 2BRKA 2Q1LA 1BXNA 3DU5A 1JX4A 2UP1A 5A8WA 2PMHA 1EP4B 1TV6B 3LP2A 1J2VA 1WTBA 4DFKA 3QIPB 2HFOA 4ZS6A 3NWGA 2L9WA 2CQBA 4UUXA 1AROP 2EBEA 4JI5F 1UVKA 4MKBA 4OX7A 3D3BJ 1VJQA 2HFZA 1UFKA 3CF5Q 1RWMB 4XK8C 3R5JB 2BZ2A 3QLHB 3D4JA 3CJTA 3PYFA 3BZQA 4I0WA 2NSCA 3SSSA 3VGSA 4QYZK 3UR0A 1JLBB 2QYGA 4F2RA 1SJQA 2AEMA 1FCAA 2RIJA 1RGVA 1FDDA 3K5LA 4UY8T 4NOHA 4RW4B 2HVEA 5F9LA 3JXOA 3BSAA 2BANA 2JL9A 3K5OA 5EX0A 1KVJA 1LEOA 3T6BA 2XWYA 1IM6A 2QFIA 1LOUA 1CLFA 1V3ZA 3BR8A 3M30B 5HQMA 4HDHA 3M8QB 2WVCA 2KT5A 4DV7J 3B4MA 2MY8A 4TLRA 2EBGA 1KOOA 1JJCB 2X51A 1B64A 5KFNA 3SQGA 3UNYA 2JLEA 3P6YC 3OTOF 2J8SA 1RT2B 2DGVA 5ADZA 4PQUA 3UN5A 5D4PA 4B3TJ 3NMRA 2C2NA 4TU7A 2ZVSA 3N9UC 1S1UB 3QO9B 4DZ6A 2OTLS 4LQ3A 4O3RA 3KLGA 3C15B 1TTHB 4DR5J 2RRBA 4LRBA 4O44A 4LR8A 4PUOB 2E9TA 2KG1A 4U7UD 5E3QA 2R2RA 2DNLA 1HA1A 1XMBA 2XMAA 5F0UA 1VOMA 2KM8B 2BW7A 2JVOA 6FD1A 5JUMA 2Z2LA 1FESA 3ZZOA 3V4IA 1Y9OA 2B9EA 3RB3A 4AUKA 9RUBA 2W2MP 2XGPA 2QA4G 2F8EX 5E5NA 2YKQA 3W2WA 1M1GA 3DRRA 5DQIA 3ZTOA 3U02A 2JWNA 4KC5A 3OUYA 4I67A 4B3RJ 1S6PA 2HHTA 1PKUA 2RDDA 1Y5LB 3AHPA 4ELUA 1RISA 2NXCA 2W7AA 2VPWB 2AJ0A 3Q86A 4LR7A 1GK8A 1T0TV 3TA0A 4DR4J 4C7QA 2YKPA 3LOUA 1PBUA 4KY3A 2FVQA 4C0HA 3S8SA 5B7WA 1HNIB 3G87A 3PX4A 3J7AN 1PSDA 3ZZYA 4QYRA 2XYHB 3KK2A 3VGTA 2VU5A 4Z2XA 1FK9A 8RUCA 4JP8A 1RT6B 3TVZA 4I6YA 2UUCJ 2GAHC 3WX8A 4DPWA 1LKZA 1D0EA 3B8HA 3MEDB 2ZH9A 3M32B 1D09B 2Y9HA 3HF5A 3NS6A 1X4AA 2BM0A 4RU2A 2DGXA 3GQCA 3RR7A 4ED3A 1GMWD 2BDPA 1TKTB 4CT8A 3BSNA 3GILA 1V3RA 1EARA 2VF3A 2QSFA 4NXMF 4ZVRB 3ICLA 3VALA 2GQ2A 4CLTA 2QMXA 3UCGA 3PJXA 1U0HB 1Q78A 1AXQA 2XI2A 1CULA 4O4RA 3GJRB 4HACA 4WFYA 2B43A 1HD0A 3CSKA 1AUSL 4M5LA 3A8EA 4YY3F 1LFPA 4GVBB 1NXIA 1O6XA 3D68A 4ZITA 4PAAA 4PG7A 3I5CA 4H4OB 3F56A 2PA8D 2DNQA 4KIAA 1RT7B 2M70A 1ZPVA 2HEKA 4P2MA 2OELA 1VQ4S 2DNKA 4Y28C 2EEYA 3NNHA 1UA1A 1KHVA 3EWGA 4ERDA 5KFCA 1GNKA 4X65F 3MM9A 2JRSA 5IWAF 1XMQF 1FT8A 1XN9A 2CVEA 4R5PA 4F04B 1ROFA 4OZ2A 2PE8A 5FIIA 4KGKA 2NPIA 1FRJA 5E7OB 2RU3A 1T7PA 3DYAA 2YBVA 2MEWA 2OFGX 1C1CA 1WKLA 3Q24A 2VV5A 3BF4A 3PJWA 1IWAA 3D5MA 2HNYB 5A0YA 2Y1RI 2UUBF 3W9IA 3Q8UA 1RAGB 3OR2A 1H72C 1HR0J 4FPRA 2YNIB 1TVRA 3DI6B 5SZTA 1HFEL 1Z1ZA 1TK5A 1REVB 3LGNA 2AX1A 3E51A 3MAAB 3V6JA 4A8OA 3PXGa 2A2CA 2E7VA 1IUJA 2YQ1A 2VDIA 2KO1A 3OT9A 1J27A 1TKXA 4RLEA 3PZPA 3OXFA 1URRA 4H4MA 4Q0BB 1U25A 4C3LA 1JNRB 2XNRA 5C24B 3DOKA 3GZ7A 3DN9A 1YBUA 3PEJA 3RRKA 3OVSA 1ZH5A 3S01A 1ZM4A 2WB4A 3Q8RB 5D6GA 1S1XA 3WX4A 3FRYA 2AU0A 4I7FB 5DZ7A 1N34J 4ILLA 1KTQA 3M2RB 3VZIA 2FZKB 2BOAA 2IVFB 2CKWA 5F8GA 4Q44A 4MKVA 2FJEB 4KFBB 3BGFA 1H2VZ 1J5EF 2MQNA 4I1TA 1Q86T 2DNZA 2UV8G 1JLAB 1RI7A 5HROA 1Z2ZA 1TUGB 4CM2A 5GAHU 1M5KC 2YNGA 4JV1A 3NG8A 2H4WB 4M5MA 3UQSA 3SZ2A 4RW8B 2V34A 2CQ2A 3IRXB 4XAKA 1EJ7L 5A8RA 3TP2A 5FLXY 4F4KA 2DHSA 3G8SA 4ZLJA 5IQQA 4USVA 1GEHA 2K7JA 5K5MA 2MKKA 1RCXB 2PI5A 3UO0A 2DRBA 4D3HA 4DV1F 5D3GA 4DR3F 4LREA 2OPRA 4M8LA 3EVOA 5DDRC 4ZP8A 3D1HA 4TQRA 4FXWA 4RZRA 2FHJA 3N79A 1S0MA 5JMNA 3KLVA 2LP4A 2KXHA 1NK6A 3FEZA 5AXLA 2W9CA 1B7YB 3H20A 5KFQA 2QLXA 4NLPA 3BSCA 1CJKB 1SJRA 4OX9F 4LVOP 3GG1A 3GJQB 5L1IA 3TVKA 2WW4A 5JXSA 1RTDB 1OPZA 3FRZA 2CQDA 2KZMA 4EYHB 3C19A 1RAIB 1HNWJ 2XY7A 2MGZB 4LSLA 1RADB 4F4YA 1M5HA 4IUFA 5AXNA 4IO9Q 4C8KA 2CJ9A 5K8MA 3ENWA 4K4XA 4CTAA 1M1HA 1KOHA 2RB7A 2BE7D 3F0NA 2X3GA 1HBOA 3BEGB 2AJFE 3CDUA 2N3OA 1SJFA 4AQYF 4YDDB 1FWPA 5HMZA 2XSJA 1KHWA 2UUWA 2IFXA 5THWA 4LSNA 1ZZNA 4RUAA 4O3SA 1VBKA 2HLUA 2LYVA 4C3KA 5B0CA 4ZPVR 5CH7B 3KLEA 3TI0A 3GIIA 5CZXA 1JB0C 1NH8A 1RDRA 1D9FA 1XMOF 4JYAF 4FNIA 3DMJA 4QIGA 1RWOB 1YG0A 4MTPA 4KKOA 2VFTA 4ZPBA 2FLLA 5G0RA 1LWCA 1S10A 3CD7A 1H2UX 5J1NA 1BUXA 2CQ0A 2XB2D 2VKRA 2B9YA 4OZ3A 4AXJA 1PIEA 4K2JA 4ED6A 3EGVA 4FYYB 2V9KA 2GMLA 1NMEB 1FFWB 1AZSA 4LF6J 2GA7A 4LF2A 5HQ8A 2Q43A 1MLAA 1C1BA 5K9FA 5IC6B 1VMBA 2DIUA 3TX8A 2G2ZA 2HVZA 4RKUC 3CGIA 2RILA 1VC5A 5B0BA 1H7XA 1EZZB 4DR7F 3G82B 4WCEQ 2RD5C 3CD5A 2OPPA 2RRNA 2QLFB 2V8HA 2ZHBA 1Y3KA 4EFAC 4TU8A 3LP0A 1NJWA 1M5PC 2DCLA 4X4VA 3QMQA 3NOGA 3U1LA 3U1NA 5EWEA 2ALYB 4IDKA 2HZAA 4WP9A 2FYXA 3H0PA 2A2DA 3LF0A 2VHGA 2NZCA 1YJNS 1NHUA 1FFSB 4LQ9A 2FUG9 3JB9k 3TJ8A 1JLQA 1OPIA 2XYPB 5BJRA 4TLQA 5IQ6A 3D9BA 3US5A 1YITS 1KR4A 1NZAA 2ADBA 2VFVA 2MZRA 1OQ6A 3A8IA 2J9CA 1QDUB 1B0PA 1RHRB 3OW2R 4AD6A 3H5YA 1G1XA 1FDNA 4P9SA 3F44A 5KT3A 3HD2A 2JC0A 3C16B 2GW8A 3FMBA 1UVNA 3FSYA 2NREA 4MIAA 3H4DA 4OZ1A 4X2BA 2BE2A 3FFIB 5KFSA 1DBDA 4P74A 2KRBA 3IO1A 3SIPB 1QVGR 2XCPA 4UQGA 5LL6d 4OHVA 3SBMA 5D77A 2BQ3A 2XSFA 2KI2A 2E29A 5LJ5Y 4WYWA 4CH0S 1IQTA 3KHLA 3QIPA 4NRTA 3GONA 2Y1LB 1Q5YA 3L95X 4C8YA 3SFGA 3QAUA 1VYAA 4DBQA 1DTTB 4WFNQ 3OTEA 4ETZA 4QWEA 4A4JA 2DPJA 2C2MB 2ZBQA 3IA0A 3W65A 3RRHA 2GMJA 3G96A 1F9HA 3W61A 3IBCB 5ETKA 2FHOB 3AFGA 1JIHA 4GKKF 1TL7B 2CQHA 5AJ3J 5LMNJ 4B3OA 1T05B 1FWLA 2HHHJ 4IKAA 5KG3A 4RW4A 2D3UA 4IH5A 2CG8A 5J1PA 1F5AA 3GYNA 3D6MB 1N88A 4NLWA 4WZMA 2CPZA 3DCAA 2EI5A 5B09A 2W8KA 4CYUB 4NLGA 4DV0J 4L3KA 2ACMA 4TY9A 3BYRA 3QAEA 5CXTA 3BO4A 4URQU 4NL5A 1K73T 5DRKA 1XTZA 4NX9A 3T6JA 4WF9Q 4IRDA 3R7NB 1IKWB 1IBMJ 4MFBB 3OVBA 2BM1A 1SIWB 4RW9B 2LKZA 2CUYA 1RT2A 2CDRB 3CJKA 2CYYA 1X5SA 2MPUA 3HZGA 3EPGA 4Q43A 1F2HA 3PIOQ 3FZ2A 2WOMA 4I2PA 3DRXA 3RB6A 1GAOA 3MR2A 2AKWB 1HBNB 3C15A 3HSZA 1N54B 2DHHA 2HS3A 3T1AA 3N5FA 2ZM6F 2F4FA 4ZVPB 4R25A 1UWBB 4RW6B 2ROEA 2IM2A 2RE1A 3MM6B 1IM4A 1ZAXA 3PVXA 3D0HE 1FKPA 3CCJS 4XDCA 1T3OA 4CQ1A 3BBCA 1WEYA 1B70B 1D3WA 4WPAA 1S0VA 1TAUA 1CC7A 2DO4A 2DXFA 3BDPA 1URNA 3UD3P 5DM6Q 4LRAA 4DG1A 4DCPB 1CEZA 2OPSA 2XC9A 2C28A 2EVZA 4F4WA 4F50A 5K8NA 1RBAA 3CCRS 5DQGA 1GTHA 2WSEC 3DLGB 3PO5A 3D0IE 3HXMA 4O23A 2DVIA 4CLUA 1TUVA 3CDBA 3RAMA 2LU2A 4X4SA 1SJ3P 4ZPDA 3LQVA 2VPYB 4PKDB 2J9EA 4JI0F 3Q0AA 2GQCA 4OLPA 1HNIA 4DR6F 3EVMA 4DL3A 5HSPA 1Q79A 2XS2A 2L3MA 3PRVA 1YBAA 1HQEA 5HMWA 4FBTA 4PG6A 4EBDA 4DUYF 4WFAQ 1P27B 3KMSA 1RT6A 4ZDNA 1UMJA 3M8RA 2CZVC 2QMUB 4JI7F 3FC9A 1VQSA 4WKYA 4LIWA 4R0JA 5DJBA 4HR2A 1UEUA 3OR1A 4YFUA 3S1TA 1VRUB 2PC6A 2Q6BA 4DF8A 1SC3B 1FHTA 2EW9A 3WC2A 4BDPA 3EJMA 5A8KA 1U1QA 4NE9C 1T95A 2B4UA 3H40A 4RW7B 1RTIA 2M88A 2UXBJ 2MKCA 1RHJB 4ANEA 5LT5A 1H7WA 5AT1B 1TMMA 4IO1A 3TZXA 4W4MA 3GSIA 2YQ3A 3MCNA 1RWXB 2ADCA 2MHNA 3KJFB 3RZAA 1N0UA 1TFWA 2EG1A 3MR3A 3R6GB 1X9SA 1KVIA 5E3CA 4WE1B 4HLBA 2EKNA 1Q8LA 2K2PA 4MT1A 2RQCA 5HLFB 4OI4A 3CC4S 3JSYA 2P8IA 3M9NB 2HFUA 1UP1A 5KOXA 1GQEA 3QWPA 4GKJF 3MPYA 2QGFB 4H4OA 4YDXA 1WHVA 2DKOB 4ZPTR 1Y3JA 4DR5F 2CPJA 4CLKA 1Z2LA 1NDLA 2CNOB 5CAAA 4DV4F 4YOEA 3Q8VA 3OBIA 3IAM9 2YPZA 2PO4A 4UUWA 3IAS9 7FDRA 1RT4A 2YNFB 4IFYB 4ZMMA 4X62F 3W2VB 2HMIB 2OUGA 3JSBA 3CEDA 2AYMA 5KFPA 2E7WA 1TL1A 2CWKA 2XM3A 3EPIA 3OSPA 1HBMA 5KFYA 2KKHA 3PV8A 5CYQA 3GJTB 3VCDA 2FY8A 3K5NA 2DJWA 4DDFA 2HVHA 2HHSA 2BBEA 1HPZB 4DV6J 3D6FB 3PW0A 2LMIA 5DO2A 4F67A 2WTFA 2YNIA 4DSEA 4DR4F 3DI6A 4NCGB 3TA1A 4KT0C 2VBWA 3TOQA 3IXQA 5IZHA 4NXNJ 2VPXB 1W2IA 2GCFA 4FN5A 1REVA 3ZXWA 3DLEB 1P8GA 4P7VA 4DV5J 1D8YA 2VKZG 4WXOA 2V5HG 3LA0A 3MAAA 4DXLA 1L5UA 2E5LJ 4URSA 4B9LA 5D0EA 3GLJA 3AOBA 3L7PA 3O1LA 5D4LA 2WAQD 4QPTA 3BKFA 2APOA 2AJ4A 2E9ZA 3GYXB 3TZWA 3BQ0A 2KJVA 3UCZP 1NK9A 1UETA 1N6QB 4C3MA 2KT3A 3FQKA 1U6BA 4P71A 2XLKA 3DNCA 2F8HA 2D7SA 3HHLC 2HNZB 3ILIA 1RYSA 5HP1B 5FJ4A 2Z4PA 3B78A 2HFVA 2BE9B 2HQGA 4DV3J 1YWXA 3BM7A 2AJ2A 3KK3B 1KFSA 1N4LA 2ILZA 3K0JA 4FPIA 1JLCB 1HQUB 4PABA 1FE0A 4F2SA 1I3OB 2RS8A 5HQLA 3HVRA 1WSRA 2UVWA 1IXKA 1WOPA 1PAUB 4YR0A 1X9MA 3M1VB 2X1BA 3TJAA 1YJUA 4DX7A 2VUGA 4CDIA 2HNDB 3GSDA 3TVYA 4F8RA 4WZQA 1RTZA 2CQPA 4KHMA 3T9NA 4OHYA 3QT7A 1T3NA 1TAQA 3CJ4A 1DRZA 1NSPA 1Q7YT 2J0WA 1N8RT 2HQIA 3DDKA 4F4AA 6FDRA 4K0KF 2X1FA 2QL9B 5J2PA 4CZCA 2VH7A 1RBOB 2AYBA 4F26A 2W4CA 1NKCA 4B3SJ 4N76A 4ANCA 2EK6A 4YR3A 1P1LA 3CJRA 4F0KA 2CQ1A 5KG4A 2Y8WA 4USJC 2NYHA 4DU8A 4ER8A 4HTIA 4F3OA 5KG6A 1UPPA 3GFYA 4LT6A 4N41A 3CJ5A 2GIQA 5A2QY 2AYEA 4DFJA 3K7RA 3JQKA 4ZKAA 2B7CB 1N0VC 4J9SA 2BJ8A 1RJJA 1T9WA 3CCZA 2GZOA 1QY7A 2K06A 3K8WA 1OIAA 1RT3B 4ZVGA 2LDIA 1XERA 4R8UA 8AT1B 3R1LA 2XMMA 1KKHA 3CUNA 1CQMA 2HQCA 4HEA9 2ASJA 4IH7A 5GAGU 2JOQA 3E01A 2FTRA 1VHFA 1IKXB 5HVFA 3CC2S 1S1TA 1FNMA 3KK1A 5HVGA 2W9BA 2X1GA 5DDOC 3UDCA 4AL6A 1WUUA 3KG1A 4PYDA 4OZLA 4RJVA 1NJIT 1N5SA 2EFNA 5GMDA 4Q5VA 3PTWA 2ZH1A 3J7YU 1T03A 3ZTSA 1BMQB 1FKOA 3GG0A 3FJ2A 3QRPA 5KFKA 3TAQA 2OIHA 2MSTA 1T02A 1O8BA 3ZZTA 2AF6A 2LQ5A 1XJWB 5H9FJ 1C0UA 2V69A 1MMDA 5LOQA 1Q5VA 1SL0A 2ZVIA 1VR6A 3CB4A 5F3TA 1JKHB 2RUSA 1S9GB 1CJUB 4DPTA 2FDNA 3TAPA 1BQNB 3UWTA 3M8SA 2K1RB 1FVSA 3MF5A 1WACA 3MM5B 4ITSA 1N32F 3QPIA 2ASDA 1CJVB 3CCTA 1JLEA 3HVTA 1M90T 3JAMU 2B4VA 2XEXA 1BC6A 2KM8C 1TQLA 3M7VA 3AA8A 1GX6A 3B6BA 5GADI 1HD1A 2YWHA 1WF0A 2OPQB 2ZH6A 1U45A 3T3FA 4LF9F 2B6AB 2UXDF 1SH3A 2YKMA 4NI2A 2J9DA 1QTNB 4ECZA 2EG2A 2OEMA 5EN1A 4RWXA 5LSRA 4TNOA 4QPXA 2PSZA 4L3NA 5ETPA 2AD9A 1RK8A 1OYEA 1TL4A 3VAKA 1XNRJ 3M4XA 3MM7A 5A6PA 2C3MA 4M5HA 4CLZA 2DY1A 1XC9A 2N82B 3JTOA 1UW9A 2GIRA 3MR5A 3LP2B 3BO2A 4J37A 4V1Ak 2R4FA 2UVVA 2CWXA 1TK8A 4EMDA 4K4YA 1YRTA 3T5HA 5CZVA 2ZH2A 3Q23A 3VHQA 3DDNA 2GVDB 1JXVA 1WF1A 2UVRA 2IBKA 4M5KA 3AJ1A 2F4VF 4K7QA 1HARA 1XR5A 2KVIA 5D4NA 1S48A 2HK3A 5M2PA 4OYMA 2BEFA 4EEYA 4G3IA 5B0FA 2LCWA 2Z2YB 1RTHA 2RQMA 1SKWA 2B4PA 2H3EB 3NGRA 4ZLLA 1T9TA 2BANB 4JI1J 4OZJA 3CTRA 3SMZA 1S7HA 5A76A 4WTOB 1NUEA 3QGHA 2XI3A 4LFCJ 4Y0FA 4B02A 4ECUA 5AE3A 4FNHA 2H5EA 2HFNA 5B0EA 2DEIA 2VG5A 5DLGA 2ZH5A 4E2FB 2K7KA 2OLWA 4G1IA 3KJVA 3K17A 2GC8A 2AQ4A 2XMVA 2G1HA 1L3VA 3EVWA 5K8OA 1VGYA 1HNVA 3PX6A 3SQGB 2CDQA 4DR2F 1VK8A 3J80U 3TUIC 2NQPA 2NXNA 5F9NA 4PQUB 2QYCA 2O1PA 2YQ0A 1XR6A 1WDTA 1FEEA 5T41A 4KGVB 1ZBTA 3QZ8A 4NMLA 5JVGQ 2F8MA 2ATLA 3MFHA 1BD6A 3KNAA 3KLGB 2YWEA 2UU9F 3PHEA 4C6AA 3NCPA 1F0XA 4Y2AA 4CO0A 3LPEA 3WIVA 2D74B 3D0GE 2I38A 1YVFA 2DGUA 1RHQB 3R5DA 2ACYA 1IR1A 4MFBA 1AFIA 2XO7A 1RAFB 1MWQA 3HSDA 4B9MA 1TKZA 2UXCJ 3Q8QB 2MJNA 3V4IB 1RWNB 4B17A 4A8FA 4OJ1A 1IR0A 1VJWA 2ZOMA 2VZ9A 3Q22A 1VBXA 1R0CB 3Q2SC 3T1HF 3FCWA 3W2WB 2QLWA 3A3OB 4M1KA 5D78A 4N8OA 3OUYB 3DDIA 2E1CA 5ETLA 1S6PB 1VLOA 2KN4A 1RKIA 3ZFVA 2KFYA 2YWGA 1W25A 1IBCB 4YHHJ 2D9OA 3ENVA 4JB8B 1P6TA 5DDQC 1WC0A 4QR1A 1UJ5A 2M0GB 3G6YA 3KK2B 5GMKa 3DFEA 3KUGA 1DLOA 4Y00A 1FK9B 1WC4A 3R5AA 1CBKA 1SXLA 1N33J 2QL5B 2P6TA 4ZIVA 3VQSA 3MEGA 3HI9A 3O5TB 2NZ4A 3MPUB 3DOLA 1TR0A 3EICA 3CPWR 2QLBB 3V6HA 3AT1B 4L74A 3SCIE 1FJ7A 4ENOA 4KSEB 1KP6A 1MG7A 4C0BA 4C11A 4PWDA 3WDOA 4KE5A 4PCQA 3M9OB 1S49A 4O3OA 4NZ6A 2R7TA 1ULRA 2AIRB 1BWEA 1S59A 5AJ3F 2IY5B 1CULB 4HACB 4KHRA 2UUAF 3AAWB 2EFVA 4YB5A 2H54B 1VQ8S 2P5VA 4CLWA 1VRUA 2R7RA 3W62A 1S5ZA 3DHXA 1WOSA 4USIA 3K8VA 4F0HA 4DS4A 4TY8A 2XLJA 2VDHA 4QW8A 2VG6A 5DDPC 4DV0F 4QIFA 4CLSA 3NOCA 4RW7A 3J81j 3V6DA 5F41A 4KJIA 1F5BA 4DL5A 3FCVA 4G1QA 3MEEA 4WU2A 1HNZJ 3MPVA 4NZ7A 1APSA 1RQ0A 4OYXA 2KU7A 3FBFA 1IBMF 2MZ1A 3I56S 3P96A 5AE1A 3MAHA 1MU2B 3MM9B 3X1LB 3J7A1 1U7LA 4TKTA 4R5PB 2QA1A 3GR0A 3MEKA 3OHAA 1LK5A 1XNQJ 1LK7A 5J2QB 3DYAB 1EIYB 3KLFA 1C1CB 2HKEA 4QBUA 4LIRA 4PPDA 2XCAA 4UOFA 1TP7A 5A0YB 1NLKL 2VC0A 4J9NA 3OR2B 1IKVB 1R27B 5E3AA 1R8HA 2MZTA 1X5OA 3TA2A 4GC7A 1BY9A 4MYUA 4M95A 2YNFA 3PYGA 1TVRB 2CQIA 1N5VA 3PR4A 4M5IA 3WC0A 1TL3B 2VD3A 3IGNA 2WBMA 4J90A 1RHMB 4FP9A 4IG3A 1N5QA 5F8MA 2DNRA 1JJ4A 1F3VA 2F63A 2R7XA 2DH8A 5J2NB 2CJXB 3C3LA 3VAHA 1ICEB 1FRKA 2LXUA 5C42A 1TKXB 1VQLS 2AGOA 2V8VA 2NR0A 2DGQA 3MTKA 3CO9A 1RA7A 3PR5B 1Q53A 4KGZB 3T5JA 3DOKB 2A0FB 3TNVA 4TYAA 4UTGA 1K1QA 4NCGA 3BKTA 1B0VA 2EFOA 3PG9A 2LQ9A 4ED7A 2W7OA 2GNKA 4GVLA 3I82A 3HCXA 3CC7S 1T9XA 4XO0A 1NDPA 3AD7C 3PKMA 3IWNC 1S1XB 1QUPA 3NBPA 3GR1A 3OFEA 5LSOA 2ZBIA 4P2FA 2DGSA 2M4MA 1Q8IA 4USTA 4CLYA 1EAYC 2R8HA 1QSSA 4NEZA 1SC1B 4N56A 2CPYA 4ILMA 3R97A 4DN9A 2GVZA 3NL0A 4IYQA 4NMXA 2C1EB 1NB2A 4F7VA 1N6QA 3R2DJ 1WG4A 4RU9A 3NAIA 1DFDA 4GO5X 4AT1B 1BLUA 5HROB 2PT0A 2RQKA 2VG7B 2YNGB 5E33A 3A8JA 2JLFA 1SPBP 4P10A 8ATCB 1RT5A 1K1SA 3Q8YA 2R2SA 1LXJA 1NNDA 3D28A 2GHWA 2LEPA 2LDYA 1TU0B 3G6XA 2BKNA 1K8AT 5A8RB 4E0DA 3ITHA 1RAEB 1HQUA 4CH7A 2L41A 1HQ2A 3SCKE 4NCBA 3DRPA 4KPCA 2ZUGA 2D3O1 3O8WA 3NY0A 5K20B 5D3GB 2L48A 2MQMA 2OPRB 3NNCA 4QWAA 3M1VA 1ZA2B 1PO6A 1WOOA 4IQMA 1S1WA 3DLJA 1K47A 2YWWA 2C2KB 2W9CB 2H4YB 4K4VA 2ASYA 2E1AA 3M8WA 2BRLA 3NGUA 3I4HX 2QO3A 5DG7A 1Y00A 3EE3A 4DUZJ 3KLIB 5IV4A 3LUYA 1SQEA 1YI2S 2EFPA 2V2KA 4A48A 3CJQA 4LSLB 3OTCA 1CQNA 1JLFA 3CT9A 3TANA 2Q3PA 1R6VA 2BR0A 1FRIA 2FGCA 4JI2F 3TARA 1A9NB 2ERRA 3QFHA 2E5GA 2E5JA 4CTAB 1DARA 5DG8A 3SYZA 3SFUA 2IRUA 1TKDA 1S77D 4HVZA 1HBOB 1RSCA 2KT2A 5BR8J 3FSIA 2I8EA 1QLNA 4X66F 1HL6A 2XSJB 4A8QA 4DV6F 3KXDA 2ZHOA 2VOPA 1UVIA 1WHXA 1UVLA 4QOTA 4JI8F 3C8YA 3KLEB 4NXNF 4JI3F 1HBUA 3N6MA 3L4BC 3NMAA 1Q1KA 2P6SA 3ZTPA 3DMJB 4DV5F 3ZTQA 5L9NA 2XMKA 4ETXA 3EGNA 4KKOB 2NCKL 3R5GA 1SVDA 4BLGA 5G0RB 1LWCB 4C8LA 1U6FA 3ISND 3PJ9A 4ZA1A 5H9EK 2IM1A 4A46A 2QIFA 3IBFB 2AYGA 1FFGB 3MCOA 3TUJC 1U1KA 2LA4A 4PQAA 3AQOA 3D1OA 5KFUA 3F73A 1RCOB 2AWZA 1AZSB 2CIMA 3R5CA 1C1BB 2NUHA 2KXNB 1IWGA 2XNQA 4CM0A 2N4DA 1F6TA 2DGWA 1V6HA 3TQ1A 1YRXA 5A6WA 2OPPB 1EX8A 5KG5A 1TUWA 1LWEA 2HBZB 3LP0B 2Z30B 3R9LA 3UVJB 4FF1A 1S9GA 3ULHA 2C22A 4IDKB 2K1RA 4GMKA 2DGOA 2MQLA 3MGJA 2GQQA 3DRYA 3IS9A 4FKYA 3LTOA 1TMJA 2C2OB 2VOOA 2E5IA 4ES1A 3VAFA 2UUTA 4EI2A 1HWLA 1R8AA 1RE1B 1YHQS 1J5OA 2YWKA 1HI0P 4ECXA 1FRXA 2IDLA 2OPQA 3PDNA 3O3LA 4DPUA 1KQFB 1YJWS 1NBEB 4OZNA 2ZKTA 4MK9A 3I5BA 5CD4A 3EXCX 2DBBA 2M7SA 1U2FA 1WEXA 1TFYA 3UPFA 4WFXA 1NJYA 1IQZA 4B3SF 2J76E 5KT7A 3GP9A 1GFWB 3HM9A 3UN2A 5C2CA 5K14A 3EZUA 1UW4A 3NGSA 4USWA 3D6HB 1Q82T 3BDEA 3OL8A 1ZM2A 1RU1A 3B54A 2LQJA 3OXLA 1KVKA 2AHOB 1TL5A 2N7CA 3MURP 2GJFA 3Q89A 4ZVFA 5F8NA 3WQPA 4C48A 2CFXA 2RF2A 5SUHA 3VWSA 2V63A 3H4BA 3C2PA 3SV3A 2GVDA 1B7FA 2CQCA 4RUBA 2GHPA 1LV5A 1VQKS 2Y8YA 3K5PA 3OTOJ 3KLHA 1WORA 4DS5A 2ROGA 4KPYA 4LSZB 4B3OB 3FSXA 4Q2MA 3BH7B 2OJ3A 3NCQA 4O3PA 3GFXA 1ZAVA 1YLXA 1GH8A 3AA9A 2IRYA 1VDHA 1MNEA 3QYYA 3W5ZA 1D9DA 2A18A 2CPXA 3HZEA 3CCMS 4KHPJ 2Q66A 2DR8A 3K58A 4W98A 4Z7YA 5L1LA 4GRSA 4M5DA 4J9UE 1QSLA 5DGBA 4F02A 4W90B 1U1PA 1MSWD 4ICLA 2ZWOA 4WU3A 1IVZA 2M5YA 1M5VC 3MDFA 1BGXT 5EWGA 3GV5B 1DHMA 4U7CA 2PEBA 1KN6A 1X5PA 1X4EA 3K5MA 3CJKB 2VBXA 2D9PA 2WB1D 2DHGA 2RMLA 2KTQA 1G2EA 3MMCA 2WOMB 1H3DA 4I2PB 3FBCA 3C14A 4FF2A 1RABB 2FPHX 4ZJOA 2ZUAA 1L3TA 2R7UA 2IJRA 1X0FA 2DCUB 3SSRA 4IQXA 3DGVA 4HHHA 1X4HA 1K0TA 4V19X 4ZN3A 2ZWPA 2EPIA 3I55S 3W64A 1OWXA 1HYSA 2LFVA 4OLOA 1R3NA 4LF8F 1FKPB 1UZDA 2CJQA 3ILLA 4AXIA 3QIDA 2FJDB 1R8BA 5KFAA 3IR6B 4L72B 3N6LA 5KG2A 2OAUA 2Y3YA 4Z7CA 4LF1A 5AE2A 3OLAA 1MWYA 4CP5A 4DG1B 1AUDA 2OPSB 2EC2A 5KFRA 3AODA 2EFGA 3WHIA 3K2YA 2ABYA 4OIXA 5F3ZA 4J9MA 4UW2A 2JDJA 4OMFG 3NLCA 4J5OA 4NXMJ 1UEKA 4MH8A 2B56A 3GE9A 2F1FA 4I2QA 3T41A 2MTLA 1A0OB 3MI7X 2KHDA 3BJYA 3CCLS 2OMOA 1SBRA 4UZCA 1SL2A 1GXTA 3P3DA 1HQEB 2DR7A 2VASA 1UFWA 4UQTA 3QT6A 2AP6A 4JI6F 3CD0A 3MOJB 1QD1A 1PYSB 2W25A 2L9DA 2XYGB 3UDLA 1S4EA 2PN6A 4ED8A 1RUSA 4E98A 2J5AA 3OR1B 4DQIA 5I3PA 2ZNZA 4KTQA 3PY8A 4FYWB 4NLRA 4Y34A 2Z2ZA 4N7TA 2RRAA 4ED2A 5KFBA 1B99A 2FVRA 3I32A 5A8KB 1V5IB 3HULA 2OKQA 2KZZA 1RTIB 4YR2A 3MCMA 2VBZA 3NRBA 4CCHA 4BWJA 2BVZA 2LVWA 4QYZJ 4TN2A 1HNXJ 4AYBD 4X65J 4ID5A 5IWAJ 1XMQJ 3FNNA 1YZ7A 3CW2C 2MQOA 2UZAA 4PRFA 3UD4P 1YJRA 4PR6A 4ZVHA 5C7PA 4TVAB 2P2CB 4URGA 5E2QA 1F9EB 1VBZA 2D3OR 3IR7B 1NKBA 4CO5A 4F3MA 4OHWA 1UPMB 3KUEA 1DY3A 2VBYA 1N5TA 5DETA 4ES3A 3BR9A 2DNYA 3QSIA 4O4GA 4DLGA 3BV8A 1X0PA 2C2ZB 3JTNA 3DM2A 5T14A 3KNGA 4LF5F 5L46A 1RT4B 1MU2A 3A3PB 2IMWP 1K44A 2EKYA 2XMJA 3A4TA 4F4XA 2NUUG 3RGIA 1ZS6A 2ZZNA 1TL1B 2BOPA 1W7WA 1HBMB 5J2QA 2NXUA 2Z2MA 1WF2A 5CYQB 1WC1A 2V0NA 2VPZB 1S1VB 3R6LB 1IBLF 3IG1A 4DL2A 3V2UC 2QEXS 3ZZUA 1CJTA 1HWIA 1GTEA 1IKVA 1RLCL 3W63A 4B9SA 3IC1A 3TAMA 5E41A 5B0DA 4L76A 2YKNA 1YRUA 5E3RA 4QQBA 4WJBA 2F3JA 1TL3A 4A8MP 2RDIA 1OY9A 2KFNA 1WD6A 2RT3A 2CNNB 3ZZZA 1EQ0A 2J8AA 4HHJA 2EXUA 2RVJA 1PBAA 2DNMA 2Q79A 4XTTA 5J2NA 3PRDA 5I42A 4DFPA 3TZZA 2VA2A 4RWWA 4PWUA 1YJ7A 2BV3A 5FDLA 3H2UB 4NA3A 3DLKA 1XIQA 1FNOA 3EZOA 4QWCA 3T5KA 1C0TB 2PDAA 4WTYA 2B7BB 1HW8A 4LR9A 1NDCA 4RR5A 1EB0A 4Q8EA 3JSMA 1CS4A 3GPAA 2V8PA 4K50A 1S0NA 2CJAA 1RAAB 4OZ0A 3W1YC 1ZM9A 4YP3A 1NPPA 3ZTRA 4DV1J 4DR3J 5LJ3Y 2ZJPQ 3UDEA 2XLIA 1T9UA 4KV8A 1PJ7A 4G1PA 2DNPA 2RS2A 4DJBA 4JV5F 4NCAA 4NLYA 3C6TA 4P2SA 2VG7A 4NYPA 1FD2A 3I31A 5BXIA 2VICA 4C0OC 2HG4A 1LW2B 2MKHA 4P73A 4B08A 4PG8A 2DNNA 4K4WA 5KT2A 2YX4A 3G71S 4DQSA 3N5BA 3HK2A 4DR1F 2R7WA 1SV5A 2HHQA 4TXSA 1VQ7S 1QTMA 1SKRA 3UD5A 5KFTA 4OI3A 4LFAJ 5J2PB 4KQZA 1FJGF 3H8YA 1N36F 3QT5A 3QSYB 1FXRA 1V3SA 4CLFA 3JS9A 2FC9A 2GHVC 1RTJA 1GMUA 1XNQF 1VCTA 2FHMA 2OFHX 1R0AA 4Q7AA 3FEYB 4QW9A 4AFFA 2FQQB 1DTQA 3EMTA 3VV2B 3W8GA 4WWSA 2KFZA 4DPXA 1JXEA 4O0NA 1S76D 4EO6A 2MKSA 3VZHA 3CDAA 1V9OA 1XEZA 2J0SD 2XTJP 3R2CJ 5I3UB 2BA9A 4JV0A 2ZD1A 3HT3A 3KLIA 4NYZA 2HVDA 4B3MF 3LAKA 1KS2A 4ZP9A 2W2PP 2BJ9A 4P2XA 5L39A 1XMOJ 2HS0A 1CC8A 3V81A 2FJXA 3RBDA 2Q6CA 2SXLA 4RL1A 2D1CA 4L6V3 1FA0A 2CJKA 5F0WA 2MJUA 2D69A 2ZH3A 4R8UB 2OH2A 3EGWB 4ZVQB 2XG8A 3KG4A 2CPHA 3BGUA 3OVAA 2BJ1A 1U09A 1U2CA 5KFGA 1WC5A 4CLPA 3E01B 2BYCA 5LXRA 1DJ0A 1S1TB 3ELHA 3KK1B 4NLDA 2BJDA 3KDOA 3KWMA 2W9BB 2FVCA 3A13A 1G3OA 4ECQA 2JSXA 5IT9U 3I0SA 1RAJA 5E0OA 4DR7J 2HHPA 2E44A 2CJYB 2V8GA 1GMWA 4EZ6A 1T03B 1KD1T 2H1YA 1FKOB 2GJ2A 3NEKA 2CQGA 3DOMA 5DG9A 1C0UB 1S12A 2HQ3A 4NLOA 1M5SA 5KT4A 5D0RA 3D1QA 2H51B 3CNQP 2LECA 1S7IA 2ZOFA 4ZN1A 3CDWA 3KYLA 5BYSA 2AJ1A 3GIJA 3BSOA 4F4ZA 2DNOA 5BYQA 3KUHA 4HH1A 2DO0A 2G2YA 4QCLA 3G2XA 1JLEB 2VC1A 3HVTB 1V5VA 3TEGA 5CYMA 1I1GA 4LF4F 2BKPA 1FERA 4FF3A 2PI4A 3MD3A 4BBYA 3H5SA 1DZ5A 2DHAA 2YKAA 1RXOB 4DL0C 1CG2A 5D0HA 4U8VA 2F7VA 1NSQA 3TEHB 1UVJA 2VB6A 2QN6B 3AOCA 3G8QA 1ZZFA 4FS2A 2QZ8A 4HYKA 2CPDA 3UVJA 2YKMB 4NI2B 2U2FA 4U6PA 4BC9A 2LQBA 2CZ9A 3VGUA 2FVPA 3EDQB 3C6UA 4ZP7A 4C8MA 2RHQB 1M0SA 2RH3A 1RT1A 3V5RA 3MM7B 4U8YA 5KOWA 3CVKA 4DSJA 2QTWA 4IOBA 1JXLA 3EZ5A 2M3DA 1RWVB 1U02A 5ETOA 3W5XA 4WFZA 2I1RA 3ENQA 3QRRA 9ATCB 4OYPA 3UW1A 4N77A 3MR7A 2MXYA 5C25A 2HS4A 1AA1B 4LF7F 3HHDA 1UEVA 4ECRA 3PNIA 2FIUA 1N52B 4GKKJ 4USMA 2AEJA 4DSLA 5EDWA 2HZCA 5BR8F 2GO9A 2ZH8A 2MQPA 2V4RA 4ZLPA 1LQ9A 1RTHB 2HSEB 3VVTA 1SJ4P 2JLGA 5KFOA 3W9JA 3BGLA 3CJ3A 2XO6A 1RWUA 1RWPB 1GMVA 4Q2LA 4FXVA 5F8HA 1S6OA 4H4KA 3BH6B 2VG5B 4J7CA 4M5NA 3CJ0A 2NYIA 5IC4B 3KJVB 5IM0A 4HHUA 4K2XA 2YX7A 1O0PA 4HT7A 4JUZA 2UVUA 3I6PA 1HNVB 5IT4A 5LMUJ 1MW7A 4OYIA 2QA2A 3RBEA 2W1BA 3G6ES 4NLQA 5HK4A 4MAKA 1KBRA 1P9YA 5HMXA 3JAMY 1SUQA 4QR0A 2ZZMA 2HWIA 3AXKA 2CA9A 4HH0A 2DRAA 3JQJA 2ZM6J 4NZ0A 4P6QA 3PCOB 3B82A 2DYAA 3RTVA 2DXDA 3MM8A 2R7OA 3T1YJ 3H59A 2ZC3A 1WKKA 2IDEA 2AEFA 3FZBA 5T7LA 2GAGC 1TKZB 1U8SA 1RB0A 3BN7A 4DHVA 2ATCB 4JI4F 4DSKA 4USHA 4UOGA 1L3KA 3QGIA 1HHSA 1YJ9S 3PX0A 1FXDA 1SH2A 4AL7A 1ZAWA 1X8DA 4IG0A 4V19J 2A10A 1BHNA 4QIWD 4PXCA 1CSJA 1R31A 2JC1A 4Y2CA 1Y4ZB 4LRCA 4XPCA 1JJHA 3R7BB 2ALZA 1RAOA 2V9WA 4JI0J 3GCWP 2BQUA 2YWFA 4HL9A 4MMOA 5KFDA 4CH1A 2HURA 4DR6J 4P52A 1Q95G 3POTA 4Y3CA 3VGVA 4DUYJ 2X7IA 4HDGA 7FD1A 2DB1A 4JI7J 3DGPA 1R8CA 1NSKL 1DLOB 1SJ1A 2WW8A 1IN0A 3MUTP 4A8KA 3I5AA 2G0IA 4N8NA 4H54A 5GAHI 1F2GA 3UR3C 1NAQA 1REGX 3MEGB 3ZZRA 4DI6A 3GFZA 3NS5A 1AT1B 1MN9A 3DOLB 1FJCA 4OI2A 3I96A 4B9VA 3HKWA 4U7UK 2ZKUA 3ET6A 2PGCA 2QG9B 1VQ9S 4C11B 4PWDB 1IKYA 4ANDA 4WP3A 2ZZTA 2JFDA 5KFJA 4J9KA 3P4UB 2MB0B 5CCMA 3C46A 2ASLA 1JLGA 3LO3A 3J80Y 2HGMA 3Q2TC 4EWTA 3MMBB 2LLZA 2VIHA 4DN0A 4DFMA 2OGUA 4LBHA 4RO0A 2CQ3A 4GKJJ 3W9HA 3OHBA 3T5LA 2IAJA 3CULA 5CQGA 4TY8B 1LFWA 3SCLE 4MKYA 4RX6A 1U48A 3WIUA 2ZEJA 1Q8BA 4KHPF 2FGOA 2VG6B 4ECSA 2C42A 3CO0P 1LWFA 2QJ3A 4DV4J 3V6DB 4EK2A 4PG4A 3BBBA 4C8NA 4G1QB 3M2UA 3K89A 3MEEB 5DZ6A 4DV7F 5KFEA 1U24A 5J1EA 1F3FA 1H98A 2FHJD 3RUBL 1EKSA 3TW0A 2M9KA 4X62J 2X1AA 4YQWA 4K4ZA 4PWWA 3LGMA 1ZTWA 3IRWP 1WKJA 4O0IA 2R8IA 5IS2A 1B0TA 1YK9A 2MHEA 3UI3A 1HHQA 2YXLA 3VAMA 3LWLA 4B3TF 3B4DA 2ZBPA 1C2PA 4EZ9A 4EYIB 3THTA 2ZNYA 3HMJG 2KYZA 5EWFA 2IJNA 3KLFB 1WG1A 3HP6A 3SXLA 3CMAS 2XS5A 1NJXA 4A8WA 4OJGA 1Y0HA 1VQOS 1QAYA 3UFCX 1T9VA 1SH0A 3ZNJ1 2N4CA 4J9QA 3RBZA 4OI0A 2FJWA 4X64J 2J6UA 4CO3A 5L8RC 5G4DA 1FRHA 2XMWA 1BQMA 3OSNA 1YSJA 1PYTA 4HKQA 2HHUA 2CADA 4IG3B 4TQSA 4Q8FA 1RZMA 2JEJA 1ELOA 3BREA 2MZQA 4P7TA 4DEZA 2RDJA 3PFOA 3N01A 4CO4A 2G4BA 4A8XA 2V6AA 1SC4B 1S1VA 3MUVP 4B3RF 5C42B 4NLXA 3J7Z5 4L73A 4OV1A 2M2BA 2V4JB 3G4SS 2F65A 1NPRA 3IWXA 2D3ZA 5KFHA 4ECVA 1RACB 1VC6A 2OD4A 4LBIA 2E1PA 4LVNP 1LW0A 2MZSA 4RBUA 4LUBA 3KJNB 3O44A 3NBPB 3H2VE 3BN4A 2K8GA 5GMEA 3PACA 5DS7A 1OMSA 2HAFA 5DGAA 2UUCF 3HT0A 3BKUA 2V2VA 1VRTA 4X4TA 1O5JA 3RYLA 3GV7B 3K57A 1S6UA 1OY6A 2GVZB 2AX0A 1GXLA 3CJ2A 4QIEA 3HX9A 2AJQA 2B4OA 2FY1A 1HKAA 2LA6A 2JX2A 3HHLD 2CPIA 1RU2A 3VQTA 1S99A 1Y10A 2V68A 4X4NA 5JVHQ 1C0TA 2FLOA 3FDSA 3M6UA 4EGLA 1RT5B 2RKIA 5KG1A 2GFFA 2IA6A 2WVBA 2IRXA 3HJVA 5HATA 1E6YA 1NK7A 4QWBA 2FZGB 3PKYA 2NS1B 4K0KJ 1SKSA 1HNXF 5DLFA 3AOAA 3FGVA 3OFGA 2J0XA 1X4CA 3AB4B 3ITHB 1OJ4A 2QLJB 3OJUA 1QJHA 4NEYA 3DRPB 4ZPCA 3R8YA 2DISA 2YNHB 4ECTA 1X31C 4Y6IA 3D54A 3CCUS 1WNEA 1Z4UA 1S1WB 5FD1A 2YTCA 1LW2A 2RUGA 3FBBA 4N47A 1WJ9A 2DEJA 5F8LA 2JEIA 2JH3A 3CMES 2DD8S 3M6WA 3TO8A 4X4RA 3BGRA 2FLNA 2G13A 1RWWB 4C97A 1AB8A 1JLFB 1QVFR 4TU9A 1DAXA 5EHHA 2EWHA 2Y1IA 2YX1A 3Q8PB 2AV5A 5U47A 2XY6A 1S97A 3RU0A 2H5IB 4Z37A 2E66A 3GYGA 2RNEA 5I3UA 1Y7PA 4IFVB 2I2YA 2H48B 3J81U 1HR0F 2VQEJ 1IJEB 4H4KC 1KDNA 2IPOB 4YN3B 1FEHA 3OTBA 2Y1JA 3PIPQ 1HBUB 4ZCLA 1NO8A 4HI2A 4BCAA 1Q8KA 4RUHA 4DLEA 4HI1A 1D9AA 1KQGB 1KQSR 2IBOA 3MPWA 3RJMB 2OSQA 2MKYA 4ZP6A 2ZHAA 3I87A 2RSQA 2LEAA 2JZ5A 1QAIA 4QIVA 3TWZA 4PYAA 3E8OA 1N32J 1WEZA 1RP5A 1ITPA 1RYRA 3OL6A 2YVSA 1WHYA 1U1LA 4L75A 3QJJA 2ZITA 2W2QP 2QC3A 3HFKA 2MDAA 3L09A 2L08A 1N34F 2FD2A 2BJEA 2ZDOA 3HHEA 2ROPA 3HDSA 2P9EA 3HVAA 4LF9J 2UXDJ 5L38A 4MKAA 3GV8B 1LWEB 2HHWA 2V50A 4ELTA 1H73A 2KRRA 2QSWA 2VFSA 2WONA 4ZHRB 1S6QA 4BWMA 3KDNA 3IFEA 1EETA 3W66A 2CNLB 1UKUA 3G86A 5L1JA 1HMVB 2R7QA 3AQPA 3IS9B 1FD8A 2JHEA 2I5JA 3EGZA 3GFHA 2I6WA 1SB6A 3SQOP 3I9V9 3A8KA 3IBWA 2ZE2B 3DLBA 3ADAC 3P5TL 3V4MA 3DRSA 5E3PA 2U1AA 1J5OB 2MQQA 1Y11A 1OSDA 1HWKA 4WIQA 2XS7A 2O67A 3GIMA 4QWDA 4LFAF 3H25A 2DH7A 4KO0A 3F41A 3MECA 4X4OA 5IV3A 3LP1B 2F4VJ 4ZPWR 2CXEA 3K59A 3KHGA 4A47A 3QGGA 5K14B 1KSPA 2KHCA 1VQPS 3HLUA 1PJ6A 3QGPA 4OYZA 2VFUA 3NKYA 2GGPB 1BE4A 1HNWF 2MQ8A 1IBKJ 4BHQA 4K5SA 1Q0NA 3PW7A 4OFZA 2RF2B 2AGQA 3DXSX 4ILRA 3HFZB 4Y65A 3NP5A 2WVFA 1L3SA 4PPZA 4DV2J 1S72S 4DR2J 3UDVA 2POKA 1T11A 3KLHB 1TK0A 1NK0A 5DQHA 1FDBA 4DCJB 1C4AA 3ILJA 1XWLA 4UOCA 3R5BA 3UCUP 2OTJS 1PAEX 3FMWA 3MHYA 1WC6A 3BS9A 1SKUB 1FX2A 2FZCB 4I69A 2UU9J 2LQ8A 2BMBA 1KLMB 2BACA 2AZ3A 2O01C 3MCSA 3HHLA 4M5DB 2F40A 4ZLNA 2KVQE 2F9DA 3W3SA 2ZH7A 2LXIA 5CD4H 2BUNA 4M5GA 2BXJA 4ICLB 2FLPA 4W92B 2DH9A 2BJ7A 1CVJA 1FRMA 4XIUA 5BYRA 5B0AA 2Y0SD 1YIJS 4USKA 3T1HJ 3BGOP 4LF6F 3MMCB 2R3VA 5KFLA 6AT1B 1X4DA 3C14B 4ALZA 2DPIA 2WBRA 1S9EA 2GO8A 1N5YA 4OHZA 4KH1B 4Q45A 2GMHA 4M94A 3MAQA 3CCES 3H98A 1U49A 1ZYQA 1NJZA 2XGQA 4LFBJ 1HYSB 2OEJA 3KJQB 2WSFC 4ZCMA 1QE1A 3D3CJ 3QRQA 1FNXH 5CHCB 5KAKA 1G4CA 1PYOB 4FKXA 5CABA 5F8JA 2JNJA 5EUHA 4I56A 1EP4A 5HI7A 1TV6A 2E1RA 4OYAA 3BPDA 2DNGA 4DQRA 3RW6A 3M8PB 1FE4A 2W24A 2C3YA 4KBIA 1Q81T 1I51B 4RNOA 2B51A 2MLXA 1GT8A 2IA0A 4CNYA 1QAXA 2C2DA 3CMQA 4FS1A 4YB1P 1X4BA 4FBUA 3M05A 4K8RA 3G8TA 4I2QB 2BX6A 3QLHA 4DPYA 3T9ZA 1R7IA 1JLBA 3N6NA 2UUAJ 3QFWA 2G2OA 1F9FA 4EUVA 2HBYB 3D67A 2A3JA 4OJ3A 1EKRA 1OSCA 4OX8A 2HHXA 1YKWA 1NU4A 4IRKA 4ED0A 4IOAQ 4MIBA 2H65B 3AXMA 4Y2IA 2O66A 2PEHA 3M30A 4C2MA 4NRUA 3M8QA 3VVUA 2DTJA 3OFHA 4FYXB 3I4PA 5D4OA 4QZVB 2DITA 4K59A 3D66A 5HANA 2V94A 1ACMB 4I68A 4ID5B 2GS8A 2BJ3A 1OO0B 1C4CA 5LMNF 2KYXA 3MMBA 4DX5A 2IC3B 2HHHF 5LMUF 1S1UA 3QO9A 1YDLA 1P9QC 3SDEB 1WI8A 1VI7A 5D15A 2RAQA 4PUOA 3CCVS 2J9DE 1MWZA 1UJ4A 1YJVA 4O4GB 2PIIA 2OI2A 3E2EA 3L3CA 1HI8A 1G7CB 2G0CA 2YPYA 3TX0A 1AYEA 3ZC4A 3T1YF 4FZVA 4RNHA 4F36A 3C66A 2KXFA 2DY9A 1R6YA 3DM2B 1M5OC 2WK4A 3M2VB 4FF4A 5GAGI 3PYEA 5HAOA 2HW3A 2DNHA 1Y5NB 4J9RA 1VHIA 4RNNA 4PG5A 3MFIA 2AMCB 1UTAA 4BC7A 3IG1B 2J7WA 2CZ4A 4RUCA 3PYDA 5KT6A 1CJTB 2VA3A 4ED5A 3OQ2A 3J7YI 3ISZA 1MN7A 5AXKA 5GADU 3FVYA 1R89A 3TAMB 4NWBA 2IVMA 5ETSA 3MMAB 4UF4A 1NK4A 2YKNB 4DF4A 1XK8A 3HO1A 2CNKB 3SCJE 4X84A 4B9TA 1VIOA 2CG4A 4KR0B 5CCLA 2ZJRQ 4AL5A 4ZJLA 1NSAA 5M2UA 4DL7A 1U1MA 4X4UA 3BBFA 3W60A 4GO7X 3MEDA 4DOZA 3M32A 1GX5A 4PXDA 3AJDA 2HRYA 2WVDA 4OI6A 1FI4A 2ZBCA 5I42B 4DZDA 4IR9A 3AB2B 1TKTA 3FUYA 3MOZA 1LWXA 2VQFJ 2V4JA 4DQPA 1KRPA 4BS2A 5FDLB 2KG0A 1HWJA 3HD1A 4OL8A 1Q7LB 1ZM3A 3IWLA 3GB0A 4FYVB 3P49B 3DLKB 4X4PA 2HIYA 1U0HA 4KGMA 4CWBA 4ZJQA 3PM9A 4NLUA 3PRBA 4ECYA 3JSMB 4ZVSB 5KFWA 2B8PA 2BQRA 3HHKA 4DL6A 1CS4B 3AJ2A 5JJBA 4OHXA 4GVBA 3PEHA 2XZTB 1X5TA 1CPZA 3W5YA 1ZPWX 3EYZA 2R8JA 2ZC4A 2HHVA 1X4GA 4WK1A 4KV8B 4NLSA 3DU6A 4CO1A 5HBMB 2QT7A 1NZ8A 3C6TB 3J7ZT 1JK9B 3DHWC 1RT7A 3GIRA 3QNWB 4PXBA 3MZIA 3QJLA 5KFMA 3EM1A 3QBCA 3RW7A 1FTCA 3FQLA 3PW4A 2UXBF 2V4QA 5HO4A 1OQ3A 3THVA 3L7UA 3HPOA 2Z58B 1JJ2R 1YTYA 3N4WA 5FLXU 5M2RA 4B9UA 4WYLA 1SV5B 3OD2A 4J9OA 2WSCC 4JI2J 4C8ZA 3H7HB 5HMYA 5DM7Q 2B5JB 1WSVA 2R2UA 4ZVEA 3U7JA 2CVIA 2GV1A 2YNHA 4ZPAA 2R7SA 3KFWX 4LJMA 2C2EA 3P45B 1B3TA 2DR6A 1RTJB 5HJXA 3G6VA 2HNYA 1H2TZ 3JYTB 1F60B 1R0AB 5KFZA 1SI9A 3DC2A 4X66J 1DTQB 3O6QA 1WHWA 3EUNA 4J9VA 4JI8J 1FKAF 2AT1B 1Q16B 2XZDB 5F8IA 4NPOA 1UWAA 3GJSB 3AD8C 2ZD1B 3M8YA 1X4FA 4JI3J 4X64F 4JOUA 2MKJA 4WFBQ 1I94J 3V81B 2CJBA 4G6VB 3W7BA 2XZWA 3PW2A 1NHVA 5RUBA 1SC6A 5H9FK 1JQGA 3CJSA 1N56A 3LANA 1FF2A 4FYDA 4LRFA 4DCOB 4NASA 4Q0BA 1HIYA 4N5SA 5C24A 1VC0A 1UZHA 4IFVA 3OTDA 3OFFA 2DR9A 3Q8SB 5HVHA 3SEOA 4I7FA 3KKFA 5MAOA 3I0SB 3M2RA 3TR5A 1W2BR 3L7OA 2JEFA 2NXJA 5J2MB 4KFBA 3CWJA 3N0VA 3OPKA 2WRMA 2E5LF 3DOMB 4J91A 2ZFHA 4XPEA 1S4FA 2C3UA 1JLAA 4ZVUB 4OZ5A 1VQ5S 2GIFA 3OLBA 2M8DB 1H6KX 3PO4A 3LALA 3EDRB 4RW8A 3UN3A 3IRXA 4M5JA 3IN5A 3RB0A 2PFFB 2KL8A 2R8KA 5CYMB 4DV3F 3THPA 4RPFA 2J7UA 1D1UA 2W4PA 3ZNUA 2EK1A 2Z8QA
chains in the Genus database with same CATH topology
2UVUA 2YNIB 3I6PA 1HNVB 3HI9A 2GX8A 3O5TB 5IT4A 1TVRA 3DI6B 2NZ4A 1MW7A 3DOLA 4WIIA 5SZTA 1E6VB 2QA2A 1TR0A 1HFEL 3RBEA 3CPWR 1WTFA 1Z1ZA 1TK5A 3DLLQ 4ZHRA 4NLQA 3G6ES 4MAKA 3V6HA 4K5RA 4ZCKA 5HMXA 1REVB 2UV8A 3VAGA 3JAMY 1SUQA 2AX1A 3LGNA 3SCIE 3E51A 1FJ7A 4QR0A 2ZZMA 2HWIA 2ZH4A 4KSEB 4MYTA 3V6JA 4HH0A 3C6UB 4A8OA 1HMVA 4C0BA 4C11A 4PWDA 3WDOA 4KE5A 2DRAA 3PXGa 2A2CA 4PCQA 3M9OB 3CCQS 4NZ0A 1IUJA 1S49A 4P6QA 2KO1A 4O3OA 3B82A 3RTVA 1RT1B 4NZ6A 1ULRA 4NLTA 2R7TA 3RB4A 3SV4A 3GWCA 1BWEA 1TKXA 4RLEA 3MM8A 2ZE2A 1MMLA 3EX7B 5KFVA 3PZPA 2R7OA 5AJ3F 2HRUA 3OXFA 1RTDA 1URRA 3OL9A 4H4MA 3GMGA 4HT5A 3AAWB 4KHRA 2UUAF 2EFVA 4Q0BB 1U25A 4C3LA 1JNRB 2IJFA 2XNRA 5C24B 2MGZA 3DOKA 3H59A 1A7GE 4YB5A 3GZ7A 2ZC3A 2V8DA 3DN9A 1VQ8S 3PEJA 2P5VA 1VRUA 3RRKA 3FZBA 5T7LA 3OVSA 1TKZB 1FVQA 1U8SA 2R7RA 1ZH5A 3S01A 3DHXA 4USIA 1YGYA 3K8VA 4DS4A 1ZM4A 2WB4A 3BN7A 4TY8A 3Q8RB 5D6GA 2XLJA 1KC8T 4DHVA 4JI4F 4DSKA 1S1XA 3WX4A 4USHA 3FRYA 4QW8A 5C25B 4I7FB 2AU0A 1L3KA 4ILLA 1K0VA 2VG6A 3QGIA 3U1MA 5LSLA 5DDPC 1HHSA 4YEAA 4DV0F 4QIFA 1KTQA 1YJ9S 3M2RB 3LP1A 5IXUA 3VZIA 3PX0A 2HIQA 1FXDA 4RW7A 3V6DA 1SH2A 4AL7A 5F41A 4JV2A 4KJIA 1F5BA 4DL5A 2VODA 1ZAWA 4KB7A 2IVFB 3S6EA 1X8DA 4G1QA 3MEEA 2CKWA 4IG0A 4V19J 4WU2A 2A10A 4QIWD 3ONQA 5F8GA 1G6BA 4Q44A 4PXCA 3MPVA 4NZ7A 1APSA 1RQ0A 5HN0A 2FJEB 4KFBB 1CSJA 3BGFA 1R31A 2HGLA 1H2VZ 1LXNA 2KU7A 1J5EF 2JC1A 4RBVA 1IBMF 2DR5A 2MQNA 4Y2CA 2MZ1A 1Y4ZB 4I1TA 3I56S 4XPCA 1Q86T 2DNZA 3BQ1A 3P96A 1JJHA 2UV8G 5AE1A 1JLAB 2GGPA 3MAHA 2ALZA 1MU2B 2V9WA 3MM9B 3X1LB 3J7A1 4B9NA 2BQUA 5IT9Y 2YWFA 3BQ2A 4HL9A 4MMOA 5KFDA 1RI7A 4CH1A 2VQEF 1Z2ZA 5HROA 1U7LA 4TKTA 1U4BA 4R5PB 3POTA 2QA1A 5GAHU 1M5KC 2YNGA 3GR0A 3MEKA 3OHAA 4JV1A 4Y3CA 1LK5A 3NG8A 3BO3A 1VS3A 3UQSA 1MROB 3SZ2A 1S0OA 2C2RA 4DSFA 4RW8B 1LK7A 5J2QB 3DYAB 4HDGA 1VK3A 2CQ2A 7FD1A 3CXCR 3KLFA 1C1CB 2DB1A 3IRXB 4XAKA 3DGPA 4QBUA 2FVSA 4LIRA 1R8CA 4PPDA 2XCAA 1DLOB 1TP7A 1SJ1A 3KTQA 5A8RA 3TP2A 5A0YB 4DL4A 3M6VA 2WW8A 3O2IA 1IN0A 3MUTP 3I0RB 2R8GA 5FLXY 4F4KA 2VC0A 4J9NA 2DHSA 3G8SA 4A8KA 3I5AA 5IQQA 4K4SA 4N8NA 3OR2B 1T8EA 1IKVB 2K7JA 4H54A 5K5MA 2COLA 2XWXA 3E3XA 5IM0B 5GAHI 1F2GA 1R27B 2MKKA 5E3AA 2PI5A 1R8HA 3UR3C 2MZTA 1X5OA 3TA2A 2DRBA 3N28A 1NAQA 4GC7A 1BY9A 4D3HA 3MEGB 4MYUA 3ZZRA 2JVRA 4DV1F 4QU7A 4M95A 5D3GA 2HWTA 2YNFA 3GFZA 3NS5A 4DR3F 4DWIA 2OPRA 1TVRB 4M8LA 2CQIA 3DOLB 1N5VA 3PR4A 1U1RA 5DDRC 1FJCA 3WC0A 4ZP8A 1HI1A 3D1HA 1TL3B 2VD3A 4TQRA 3VAJA 4OI2A 3ZZPA 3IGNA 4FXWA 3RAXA 2WBMA 3I96A 4B9VA 3HKWA 4RZRA 2FHJA 4U7UK 2ZKUA 1DQAA 3N79A 4FP9A 4IG3A 2PGCA 1SUQB 1S0MA 3R3TA 3KLVA 2I0XA 2KXHA 1NK6A 3FEZA 5AXLA 1N5QA 1VQ9S 5F8MA 2DNRA 1SL1A 2E9RX 2W9CA 4ED1A 1JJ4A 5KT5A 3H20A 5KG7A 5KFQA 4C11B 1R43A 1IKYA 4PWDB 2QLXA 4I4BA 4NLPA 2R7XA 1KLMA 2DH8A 1QAJA 3BSCA 5J2NB 1SJRA 2JFDA 3C3LA 5KFJA 4OX9F 3VAHA 1FRKA 2LXUA 3CIMA 4LVOP 3AY0A 3GG1A 5C42A 4J9KA 1TKXB 2MB0B 5CCMA 4NLVA 1VQLS 2AGOA 3C46A 5L1IA 3TVKA 3MM8B 5H9EJ 3OJSA 2ASLA 1JLGA 5JXSA 2WCXA 2V8VA 3LO3A 3J80Y 1RTDB 1OPZA 4FVCA 2HGMA 2DGQA 3FRZA 2CQDA 2NR0A 3Q2TC 3MTKA 2KZMA 4EWTA 4EYHB 1VBYA 3MMBB 3T19A 3CO9A 2XY7A 1RA7A 3PR5B 1Q53A 2LLZA 3T5JA 2MGZB 3DOKB 4LSLA 4DN0A 3TNVA 2IHR1 4DFMA 4TYAA 4F4YA 1K1QA 1M5HA 4NCGA 4IUFA 1B0VA 2EFOA 5AXNA 4IO9Q 2LQ9A 4ED7A 2W7OA 2GNKA 2IYGA 2PMZD 5T7LB 2CQ3A 3I82A 4C8KA 2CJ9A 3OHBA 2LEBA 5K8MA 3T5LA 1VQYA 1QM9A 2IAJA 5CQGA 3CC7S 4UY85 3CULA 4XO0A 4TY8B 1LFWA 3ENWA 4DSIA 3SCLE 4K4XA 4MKYA 4CTAA 4RX6A 4EO8A 1Q4RA 3PKMA 1KOHA 3IWNC 1S1XB 1U48A 1QUPA 1Q8BA 3NBPA 4KHPF 2RB7A 2FGOA 3GR1A 2VG6B 4ECSA 2X3GA 3IGVA 3OFEA 2C42A 5A8WB 1NB7A 4PXEA 2ZBIA 1HBOA 3BEGB 5LSOA 1LWFA 2AJFE 3V6DB 4YB7A 3CDUA 2N3OA 2DGSA 2M4MA 1Q8IA 1SJFA 4PG4A 4C8NA 4G1QB 3M2UA 4OQJA 3MEEB 4IG0B 4YDDB 4DV7F 4AQYF 5KFEA 1U24A 5HMZA 1VQ6S 5J1EA 1H98A 2XSJA 2R8HA 1QSSA 3LH2S 2NLWA 1KHWA 2J6TA 2FHJD 1T94A 4N56A 3TW0A 2CPYA 2M9KA 2UUWA 4ILMA 2IFXA 2X1AA 4YQWA 5THWA 4LSNA 1ZZNA 4RUAA 4O3SA 4DN9A 2HLUA 4K4ZA 2LYVA 3NL0A 4IYQA 4C3KA 5B0CA 4ZPVR 1N6QA 3LGMA 5CH7B 1ZTWA 1WG4A 3JSRA 3KLEA 3IRWP 4ELVA 4RU9A 3FFIA 3NAIA 3GIIA 5CZXA 1JB0C 3TI0A 1WELA 1DFDA 4GO5X 4O0IA 2R8IA 4NYOA 1NH8A 1RDRA 1D9FA 5IS2A 1B0TA 2MHEA 3UI3A 1BLUA 2KJWA 5HROB 1XMOF 4JYAF 4FNIA 4KRWA 3VAMA 2PT0A 3DMJA 3LWLA 3POTB 4QIGA 4B3TF 2RQKA 2VG7B 2YNGB 3B4DA 5E33A 1YG0A 1C2PA 4D3GA 4EZ9A 4EYIB 4MTPA 3THTA 4KKOA 2JLFA 2VFTA 4ZPBA 2FLLA 1UJ6A 5G0RA 1HWUA 1LWCA 2ZNYA 2I9SA 1RT5A 1K1SA 3HMJG 1S10A 3CD7A 2KYZA 1H2UX 5EWFA 2R2SA 2IJNA 3KLFB 1LXJA 4J9PA 1NNDA 1WG1A 3D28A 1XNRF 3HP6A 5J1NA 3SXLA 2GHWA 3CMAS 2B9XA 2LEPA 2XS5A 2LDYA 2CQ0A 2XB2D 3G6XA 1K8AT 1XR7A 1NJXA 2VKRA 5A8RB 4E0DA 2B9YA 4A8WA 4AXJA 4OJGA 1Y0HA 1VQOS 3ITHA 1HQUA 1QAYA 3M8PA 4CH7A 3GIKA 3UFCX 4ED6A 1SH0A 2N4CA 2L41A 2MZJA 1ZETA 4J9QA 3SCKE 1DTTA 2MY7A 4NCBA 1R8PA 2V9KA 3DRPA 4OI0A 2GMLA 2ZUGA 2FJWA 2J6UA 4CO3A 3O8WA 5L8RC 2GA7A 2XY5A 5G4DA 5D3GB 5HQ8A 2Q43A 2L48A 2MQMA 5K9FA 1C1BA 1FRHA 2HLTA 1BQMA 2OPRB 2XMWA 1IBKF 4QWAA 3NNCA 3M1VA 1VMBA 2DIUA 4MK8A 3TX8A 4F3QA 2HVZA 4RKUC 1PO6A 3OSNA 3CGIA 1KNZA 2RILA 4C9DA 1YSJA 1VC5A 2KH9A 4X4QA 5B0BA 4EU0A 4HKQA 4IQMA 1H7XA 1S1WA 3DLJA 2HHUA 4IG3B 4TQSA 4Q8FA 4DR7F 4TYBA 2JEJA 1ELOA 1UL3A 4WXWA 4WCEQ 2RD5C 3CD5A 5GAEI 3BREA 2MZQA 2W9CB 4P7TA 4DEZA 2OPPA 2RRNA 2RDJA 3PFOA 2V8HA 4K4VA 2ASYA 4DV2F 1IKYB 3N01A 2ZHBA 4CO4A 2E1AA 2G4BA 1BQXA 1Y3KA 4EFAC 4I6AA 4A8XA 4TU8A 2BRLA 3MUVP 1S1VA 1T05A 3I4HX 2QO3A 3LP0A 1NJWA 5DG7A 4B3RF 5C42B 1M5PC 4OX6A 4NLXA 4HTJA 1Y00A 3J7Z5 4OV1A 4I6WA 2DCLA 3KLIB 2G9OA 2M2BA 3LUYA 1JLGB 2V4JB 3G4SS 4X4VA 1SQEA 3QMQA 1YI2S 3U1LA 3U1NA 5EWEA 2EFPA 3IWXA 4IDKA 3CD6S 1PGZA 2V2KA 4A48A 3KHHA 4LSLB 2D3ZA 3OTCA 5KFHA 1CQNA 1JNZB 1TZ0A 2A2DA 3LF0A 1JLFA 3CT9A 3TANA 2Q3PA 1YJNS 4ECVA 2BR0A 1FRIA 2FGCA 4JI2F 3BB5A 1NHUA 3TARA 1A9NB 4LQ9A 2FUG9 3JB9k 2ERRA 1VC6A 4JI1F 2E5GA 2OD4A 2E5JA 2IAJB 1JLQA 4LVNP 1LW0A 2MZSA 4RBUA 1OPIA 4LUBA 5BJRA 1NK5A 4CTAB 3UNGC 1DARA 1X7VA 3O44A 4TLQA 5DG8A 5IQ6A 3SYZA 3US5A 1YITS 3NBPB 3SFUA 2IRUA 1KR4A 1YJTA 3H2VE 3NAHA 1TKDA 3BN4A 1NZAA 2ADBA 2K8GA 4LFCF 2VFVA 1S77D 4O44B 2MZRA 1OQ6A 3HKZD 3PACA 4HVZA 1HBOB 1UA0A 2J9CA 5DS7A 1LWFB 3NGDA 3QJPA 2A1BA 2KT2A 1B0PA 5DGAA 1IKWA 1UAWA 3OW2R 2UUCF 3FSIA 3H5YA 1G1XA 4GC6A 2I8EA 3M2UB 1QLNA 3SSQA 2K3KA 4X66F 1VRTA 4X4TA 1FDNA 5J1EB 1HL6A 2XSJB 1O5JA 3F44A 5KT3A 4A8QA 2JC0A 3OV7A 4DV6F 4Y2MA 3RYLA 4DX8H 5KTQA 4RW9A 3MMJA 2GW8A 3GV7B 3K57A 1S6UA 3FMBA 2ZHOA 2VOPA 1UVNA 1UVIA 1WHXA 1UVLA 2DIVA 2IC3A 3FSYA 2NREA 4MIAA 3H4DA 4QOTA 2AX0A 4OZ1A 4JI8F 1GXLA 3CJ2A 4JBCA 4QIEA 3HX9A 2D41A 3C8YA 3DXBA 2AJQA 3KLEB 4X2BA 2BE2A 3FFIB 2B4OA 5KFSA 2FY1A 1DBDA 4NXNF 2LA6A 4JI3F 1HBUA 2JX2A 3N6MA 2EFQA 3HHLD 3SI8A 3NMAA 2KRBA 1Q1KA 2CPIA 2P6SA 3UE2A 1S99A 3DRRB 3IO1A 3VQTA 3VTIA 3DMJB 5JVHQ 4DV5F 4X4NA 1C0TA 5L9NA 2FLOA 2XMKA 4ETXA 1HBNA 1YQHA 3EGNA 3SDEA 2XCPA 1QVGR 3X3UA 3PW5A 1IJFB 4UQGA 4C4WA 5LL6d 2KB2A 3FDSA 4KKOB 4OHVA 3HHNB 3M6UA 4EGLA 5G0RB 1LWCB 4EBCA 1U6FA 3ISND 1RT5B 2RKIA 5KG1A 2GFFA 4C8LA 5D77A 2IA6A 2IRXA 1Y5IB 2YKOA 2XSFA 2BQ3A 2KI2A 4DMZA 1UWBA 4ZA1A 1E6YA 1NK7A 4RW6A 4QWBA 5EX3A 3PKYA 2NS1B 2E29A 2IM1A 1SKSA 4A46A 1HNXF 3MM6A 4CT9A 2QIFA 5LJ5Y 5DLFA 4WYWA 4CH0S 3FGVA 2B9WA 4DPOA 3OFGA 1IQTA 3KHLA 2J0XA 3QIPA 4NRTA 4LFBF 1X4CA 3AB4B 3ETOA 3ITHB 2AYGA 3L95X 4C8YA 1S79A 3SFGA 3TUJC 1U1KA 2LA4A 3QAUA 4PQAA 1QJHA 3OJUA 3AQOA 4RBTA 4DBQA 5L1KA 1DTTB 1FO1A 3D1OA 5KFUA 2G1DA 3DRPB 2M8HA 4ZPCA 4WFNQ 3F73A 3OTEA 4AE5A 2O5DA 4ETZA 4QWEA 2DISA 4A4JA 2DHXA 2FJVA 2AWZA 2DPJA 1X9WA 2YNHB 2CIMA 4ECTA 2K3IA 2F9JA 4Y6IA 3R5CA 1C1BB 2NUHA 2KXNB 1BQMB 4ES2A 3D54A 2UXCF 4DQQA 3IA0A 3RRHA 5MLCV 5I3QA 2GMJA 3G96A 4J9LA 3PFEA 2XNQA 3M2VA 1A6LA 1UFLA 3CCUS 2WHOA 4IH6A 2N4DA 2FHOB 4U67Q 2DGWA 1Z4UA 1WNEA 1V6HA 1S1WB 3TQ1A 5FD1A 1YRXA 2YTCA 1LW2A 1JIHA 5A6WA 4GKKF 2OPPB 2RUGA 2CQHA 2DT9A 4N47A 3DLGA 5F8LA 5KG5A 2J6SA 2W8LA 2JEIA 4XDDA 4B3OA 1F5CA 3M6XA 1T05B 1LWEA 2JH3A 3CMES 2DD8S 3LP0B 1HW9A 4IKAA 5KG3A 1U1OA 3M6WA 2IMOA 1AFJA 4RW4A 3TO8A 1PC5A 2D3UA 4X4RA 4IH5A 3QWUA 1GXUA 3BGRA 5J1PA 1F5AA 4FF1A 2FLNA 1S9GA 2G13A 3GYNA 1N88A 3ULHA 2C22A 1NRKA 4NLWA 3CCWA 4WZMA 4IDKB 4C97A 2K1RA 3MMAA 2CPZA 4GMKA 3DCAA 4YHHF 2DGOA 1QUVA 1JLFB 2MQLA 2EI5A 5B09A 2W8KA 3MGJA 1QVFR 2GQQA 3DRYA 1DAXA 3IS9A 4TU9A 4NLGA 2J7KA 2EWHA 4TY9A 5EHHA 3A1YG 4K4TA 1LW0B 2VOOA 2E5IA 3QAEA 4ES1A 3VAFA 2Y1IA 2YX1A 3Q8PB 5CXTA 2AV5A 5U47A 2HYIB 3BO4A 2UUTA 4URQU 4NL5A 2XY6A 1K73T 5DRKA 1XTZA 1KFDA 3U27A 2ZJQQ 4NX9A 1HWLA 1L3UA 1ZTTA 2NPFA 3TRGA 3MR6A 3T6JA 4WF9Q 1S97A 3RU0A 1R8AA 1YHQS 4Z37A 1J5OA 2YWKA 1HI0P 4ECXA 4IRDA 1FRXA 2E66A 1IKWB 2RNEA 2OPQA 3PDNA 3O3LA 1YJWS 1KQFB 4MFBB 4OZNA 5I3UA 1VRTB 3KOAA 1Y7PA 2ZKTA 4IFVB