3O2IA

The crystal structure of a functionally unknown protein from leptospirillum sp. group ii uba
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
93
structure length
93
Chain Sequence
b'DMHIYELVSRDRTHPVRIYLLHSEYWTEDEFYNLLLEAFQRSSASDWHLQILEVSKYLVTAHGFVEAGGLQEIGFPGELSKTEVRRRINAFLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title The crystal structure of a functionally unknown protein from Leptospirillum sp. Group II UBA
rcsb
source organism Leptospirillum rubarum
molecule tags Structural genomics, unknown function
total genus 26
structure length 93
sequence length 93
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3o2iA00
3O2IA
chains in the Genus database with same CATH superfamily
3C15A 5KFJA 1SBRA 2IAJB 1XQIA 1Y0HA 2ABYA 2OTJS 3NBPA 5I3UB 2RKIA 4R5PB 1T9XA 2JNJA 1VBZA 2D7SA 1RWKB 2PI4A 2JFKA 4H4KA 4C6AA 3IP0A 2PA8D 2XWXA 1OS5A 3MEEB 5J2QA 3BKTA 2UXDF 3CW2C 1WF0A 3QZ7A 5D4PA 4MAKA 4ZVFA 1CQNA 4G65A 1YJUA 2PGCA 4DV4F 2ZHAA 3BGFA 4CLYA 3C6UB 1IKYB 5LJ5Y 2V8VA 3KLGA 3DKDA 1YJNS 1LOUA 4DR6F 5HROA 2F9JA 2FHKA 3OHBA 3PFEA 2CPHA 2M4MA 2LXFA 4FS2A 3M6VA 5DDQC 2JLEA 1T05B 2W2MP 3CO0P 1W26A 5HJXA 2O67A 1LW0A 2FJAB 2GFFA 1VYAA 1FVQA 1SCJB 4OYPA 4ZP9A 2GZOA 4NLGA 2VD3A 4M5MA 4MIWA 2G0JA 2IA6A 1M5OC 1RWPB 3OHAA 2DCLA 2KFZA 1GMVA 4UY85 4DL6A 1IBKJ 4CTAB 2EXUA 4DLGA 1MROA 2H3EB 3CC2S 2PD1A 5CZVA 4J9UE 2VPWB 1RAGB 5D3GB 3D0IE 4IOBA 2RJZA 1TKDA 2H4YB 3GIMA 1XNQF 3KOAA 2DR6A 1NXIA 2NZ4A 3I82A 1RTJB 2F40A 1BQNB 3G71S 3KLEB 3HPOA 3HVAA 1YLXA 4KHPJ 2IMWP 3A8KA 4X64F 4OZLA 2MJUA 3J7ZT 4ANCA 3M1VB 2VHGA 2F8EX 3H20A 4LJMA 1UJ6A 3SXLA 4K4TA 3R6GB 3QT7A 3MMCA 1O5JA 1FKPB 4O4GB 1J5OB 2VBXA 3TO8A 3EGZA 3KK2B 1U6BA 5L1KA 4DSFA 4YB5A 2YWGA 1FTRA 4ZJQA 1XMQF 4DFPA 1FK9B 2RU9A 2MJNA 3TVKA 3N6MA 3OR1B 3ETMA 3PW0A 2J9EA 3U7JA 2Q6CA 1U0SA 1G6BA 4CO4A 1TKZB 1TAQA 2BANB 4DX6A 3BSNA 1MU2A 4QIWD 2J7KA 1FHTA 1WDTA 5HJYA 1OMSA 4YN3B 1LW2B 5B0GA 2HBQB 2KI2A 2HS0A 2Z2LA 1TL4A 4OJGA 2WBRA 1R7IA 1G2EA 2H4WB 2IVYA 4N56A 3HVWA 4P74A 2XYHB 3Q0AA 1JXVA 3H2LA 1QVGR 4C8NA 1PAUB 4PXBA 2RRAA 5KG3A 1V6HA 2AJ4A 3NGDA 1S4FA 5IQQA 2D1CA 1VQ4S 1S77D 3R9LA 4A8KA 3TNVA 1TK0A 3MPDA 3VCDA 3IWNC 5EN1A 1QSSA 2RF2A 4CQ1A 4B3SJ 2KT2A 3R5GA 2UUBJ 1X4BA 4TLQA 3JSRA 1RAOA 2HWTA 1PJ6A 2QFIA 2GCFA 4PQUA 4J9PA 2VONA 3EXCX 5ETTA 4A8XA 2V0NA 5EUHA 2B6AB 4HEA9 1Q7LB 4O3QA 1RU1A 2WVFA 3ZZZA 1R0CB 3BGOP 2CVEA 2XULA 5GAEI 2NPFA 1SPBP 4L72B 3CGIA 3PW4A 4UW2A 4NLPA 4FYXB 2K1RA 3AQOA 1RT4B 4OHYA 5G0RB 1GH8A 3J81j 2GJ2A 1WG5A 1HNZF 4ZVEA 4KH1B 1HD1A 1UFWA 1FXDA 5FD1A 3NG8A 1NCLA 4RNMA 3I4HX 4X4PA 4RW8B 2HIQA 1D9DA 2VPZB 3J81Y 3VV2B 3TX0A 2FY8A 4NI2B 1DTTA 4RU9A 1PYSB 1WWHA 1FRKA 1S7HA 5KG6A 3DNCA 4LSNA 3DU5A 2DKOB 1VC6A 2UXCF 3MCNA 4EEYA 1RAJA 2DNOA 4OHZA 2LLZA 3C16A 4IKAA 4PAAA 4RW6B 4KTQA 3MCSA 2E7VA 2DR7A 3KFWX 2Y1IA 1RTIA 4WFAQ 2MDAA 1D3WA 3T1HJ 1NSAA 2BRLA 2D9OA 1KWMA 2I5JB 2DNGA 1CJUB 3HZGA 3SBMA 2BW2A 3VAFA 1ZTWA 1DBDA 2QLBB 5DO2A 2R2TA 3CCES 1UJ4A 4P73A 2R7SA 2M7SA 2FJXA 2HKEA 1IBLJ 3D4JA 3T1YJ 3D1HA 2ACYA 1NKEA 4MMOA 4F04B 1Z2LA 2WVCA 3M4XA 3Q8RB 2JDJA 1RDRA 3OLBA 1NJYA 5E41A 4HH0A 3RBZA 1H74A 3KJVA 1E6YB 3DDIA 3A3PB 3OD2A 1JIHA 5CD4A 1NBEB 1UZDA 1QTNB 2ZM6J 4UTGA 4F3OA 5AXLA 4DDFA 2ZZTA 1Q81T 2X1BA 1JLCB 3AJDA 2KG0A 1S76D 3MWBA 2E5LF 4HI2A 3NS6A 1R43A 1WJ9A 4X65J 3W60A 2R42A 4JI2J 5A8WB 1Q79A 2L41A 1FJGJ 1QVFR 2KZMA 3V2UC 1UKUA 1S9GA 1CVJA 4C4WA 1HNWJ 3B8HA 5K14A 1XEZA 2ROEA 1YGYA 2IBOA 3NBPB 2BM0A 2ZC4A 4C8LA 3CJKA 3GU0A 4KRWA 2QJ3A 4M1KA 4ATNA 1VQOS 3DRSA 2ATCB 5A0YA 3GTYX 1TKXB 1VRUA 1PBAA 3CVKA 1MWZA 4I0WA 4MKAA 3TX8A 4LFBJ 1JKHB 2FVPA 4DOZA 3I31A 3HSDA 4ED2A 2HQIA 4CH7A 5GVQA 3UDEA 3GJQB 3PX0A 1T02A 2XSJB 1RWMB 2XHWA 3A8IA 1X5PA 3MD1A 4M5JA 3KLGB 3B4DA 2AD9A 1ZH5A 2KL8A 2FTRA 3OL8A 3SQGB 2I9SA 3UDCA 1KOHA 2AP6A 4YR0A 4YB6A 1HNIB 4HI1A 5KT7A 2Z58B 4NLVA 1S6PB 3IO1A 3BREA 5LXRA 4ZJLA 3PJWA 1QUPA 1VQSA 2YNIA 4F4AA 2XMTA 5KFTA 2ZBIA 2HLTA 2NSCA 4IQMA 2D3ZA 3P96A 2DGUA 4EFAC 4RUBA 1KVKA 1KTVA 3A3NB 5T7LA 4DV7F 1N48A 2R2RA 5C24B 1HHSA 5HVGA 2KH9A 3S1TA 5MAOA 2P9GA 3SDEB 3ENWA 4DV2F 3CJRA 1QAYA 2DEIA 4URQU 5GAEU 2UUWA 4B9SA 4N76A 4F4KA 4LF4F 3R5AA 2CQPA 4LF7F 1RWXB 3UCGA 3CJ4A 3U02A 3V6JA 1F2HA 4FXWA 3FSIA 4DR7F 4IG3B 3H25A 4G1PA 3FUYA 1B7YB 4ZVUB 2XM3A 4LBPA 2P9EA 2CPXA 3W8GA 3MMCB 3MMBA 2NSBA 3RW6A 3Q8VA 4O3PA 3QJPA 4ALZA 1R31A 5IWAF 2FHJD 1RA6A 6AT1B 1GMUA 4OJ1A 2DITA 2EW9A 4I1TA 4XO0A 3HFZB 2GVDA 3W2VA 1HKAA 1Y3JA 3KLFB 3AD7C 3KUHA 3NOGA 3HT0A 1U02A 3RBEA 5ETVA 1U49A 4ERDA 1HI8A 5IM0A 1WDDA 3KNAA 3K8WA 5DGAA 5C25B 3HMJG 1LWEA 4KQZA 3G9CA 2MZJA 4UQGA 2HHWA 1JLGB 1YHQS 2XCAA 4TQRA 1ELOA 3V81B 4XK8C 2HQGA 3NCQA 4EZ9A 1RHQB 4KGZB 2H9ZA 1N52B 3BM7A 5HMZA 1UA1A 3OXGA 3RB4A 4I2PA 3FEXB 2ZKTA 2M8HA 3LF0A 4LF9J 3KMSA 2WB4A 4CO5A 2F1FA 2YXLA 2GNKA 3LANA 5IS2A 4Z2XA 1EIYB 1ZM9A 1Y10A 1R8HA 3G2XA 1ZM4A 1VI7A 4DQQA 4M94A 1WHWA 4ILLA 3IWLA 1XWLA 2Y1LB 3FEZA 3UD3P 1EJ7L 2EG2A 1RBOB 4GKJJ 2ZOMA 3QT5A 4LFAF 2CPYA 1HL6A 4OFZA 4P2SA 1KR4A 4GKKF 4DN0A 3QAUA 4ZPAA 5F8LA 3GWCA 4KFBA 1NJXA 1IQTA 4GVBB 2ZBRA 1N5YA 2VL1A 3R2DJ 2G1HA 3OUYA 1JJHA 5D4LA 5HVHA 3L7OA 2XG8A 2V8DA 2YH0A 2UXDJ 3M6WA 2GHPA 4LF2A 2QE5A 3AA9A 5B0AA 2FLNA 1RKIA 3TJ9A 2HFOA 5LSRA 4JV1A 4V19X 3MEGB 4JI5F 1U1LA 3ZTQA 4DV4J 2OLWA 4N7TA 3M2UB 1DTQA 1T11A 1ZM2A 4IG0A 4ZN1A 4DR6J 2YKMA 5EWFA 2GX8A 2QSFA 5CA5A 2YBVA 4NMXA 3J7YI 4M63A 1N33F 4QR2A 4HHJA 3NRBA 3LPYA 3ISZA 2AKWB 2GAGC 3J81U 1DTTB 4DV5F 4JOUA 1X5SA 1AZSA 1BLUA 4ED3A 2CDQA 4ECUA 1U48A 1ZZFA 2IVMA 3M8ZA 4YFUA 1JLFB 4CO3A 2K06A 2QMWA 2V2QA 4MK9A 4KGKA 3GONA 1SIWB 2GGPB 2G2YA 4DV0F 3BQ2A 4XPEA 4DQIA 4HT5A 2CQCA 3IG1A 4J7CA 2HSEB 2DYAA 1HQEB 4CT9A 2BW7A 1ZAVA 5ETNA 5AE2A 1AUSL 1XNQJ 2EKNA 4KHRA 4FF1A 2HNZB 4ZVPB 4U8VA 4X64J 2GQQA 3MTKA 1S99A 2FLLA 4J9VA 1RT1B 3J7A1 3PNIA 2K7JA 1OSCA 4QW9A 2ZUGA 2MKYA 4KGMA 2JEGA 2K2PA 3OFEA 4P2MA 3WX8A 4ES3A 1SKRA 2YKNB 4K7QA 1JXEA 3CULA 4PG6A 4ELTA 3H5UA 4WFZA 3UNGC 2FVSA 3PX6A 1S59A 2JSXA 3LGNA 5B7WA 3AOAA 4PKDB 3NAIA 1XMQJ 2OFHX 1PSDA 2RQKA 4LRCA 3PYEA 1EX8A 5D0RA 1QDUB 3BO3A 3RB6A 1S12A 1TFWA 3QPIA 1CULB 1OYEA 2HGLA 1V5IB 2HIYA 3CC4S 2YQ1A 1QUVA 4O44A 2XTJP 3I96A 4Y34A 5K14B 4AFFA 4P2FA 4TYAA 2JLFA 3DOMA 3G96A 2W7AA 5L46A 3PIPQ 4DPXA 2IM3A 2J0WA 4USJC 1C0TA 2EBGA 2RE1A 2WZ1A 4TY8B 3M6XA 3BGUA 2VG5A 2DIUA 2VG6A 5J1EB 3OVSA 1C1CB 2VV5A 3UDLA 1NJIT 4I67A 3BSAA 3AB2B 5IV3A 2HMIB 3Q8YA 4DMZA 2PFDA 4IH6A 4LFCF 4K4WA 4CT8A 2WONA 2OPRA 5M2UA 3K0JA 1HBNA 3NCRA 4AYBD 3GCXP 3MR6A 1F6TA 4RKUC 4LF1A 1MSWD 4Q44A 2HFNA 3Q83A 2D3UA 1X4CA 4LR9A 4Y3CA 4WE1B 4U6PA 4KC5A 2CYYA 1F9HA 5DG7A 5GMDA 3BO4A 5DS7A 2C28A 4Y2IA 2YKQA 4L3KA 2V8PA 2QLXA 4PZVA 2DK2A 1OY9A 4DSJA 4UT4A 3QMQA 3KG1A 2HG4A 1HNZJ 2RDDA 4JI1F 2GHWA 2DRAA 1RE1B 4ZMMA 4ICLA 3M2RB 5KFAA 3Q8SB 1H98A 1T3NA 1F9FA 5KFMA 2ZE2B 4LT6A 4KO0A 1S79A 1DHMA 2YNFA 3W66A 4ITSA 1WTBA 3GFYA 2NQPA 5KT2A 4ES1A 2IM1A 3OTOF 1QSYA 4ILRA 5CXTA 2E7WA 1FE4A 4C3MA 2KXHA 2R7XA 2IJRA 2B4UA 2A6MA 2DNLA 4G6VB 2ZZNA 2MY8A 2CQ0A 2LECA 2VBWA 4IOAQ 2PEBA 3IS9A 1TZ0A 3CJSA 4EU0A 2FPHX 3EUNA 3PRBA 5HO4A 4JYAF 3Q2TC 2L9NA 4N8OA 2V8GA 2XYPB 1NDKA 1NK9A 4WCEQ 1HI0P 2HFSA 3DRYA 3JYTB 4EI2A 5DJBA 2RRBA 4K0KF 1XBWA 2ZH9A 3FQKA 3LAKA 2ZHOA 3MMJA 1YJTA 3W2VB 3AXKA 1IKWB 4NOHA 3C8YA 2QV6A 3W5ZA 3AB4B 2P8IA 4HVZA 3TQEA 1DQAA 2HQFA 4G1IA 3Q86A 5KFBA 2W9AA 1LWEB 1U6ZA 2DGWA 4ANDA 3CDEA 2XY5A 3EZUA 5D77A 2OHDA 3C6TB 1TQLA 3MAHA 4MTPA 2WOMA 3KJNB 3SSRA 3M9NB 5FJ4A 2KZZA 3CXCR 5IT9U 2EFOA 2HHHF 3PDNA 3D7SB 2R8IA 2XSFA 4P71A 3AH6A 3PIOQ 2VFSA 5AJ3F 3H4DA 1Y11A 5BYSA 1P9YA 3D68A 4JV2A 4WBFA 1S6OA 5CYMA 1X5TA 2DNNA 4NPOA 1HNVB 3LW5C 1ZETA 1BMQB 4U95A 2VJVA 4Z37A 4MK8A 3ZZRA 2Q6BA 3V6DB 4B9LA 3BEGB 3LOUA 2CVIA 1BQMA 2D69A 4HR2A 2POKA 1T94A 1D0EA 5J1NA 2L48A 3G8SA 3QATA 2RS2A 4G1QB 4OYBA 4J5OA 3OVAA 1RCOB 1O0PA 1BQXA 3IRXA 4C0OC 3PX4A 5LMUF 4F3QA 4YHHJ 2H5IB 3SCIE 4C0HA 2EFPA 3OL7A 3KK1B 4DI6A 1N4LA 4YDXA 2RRNA 1L5UA 2HBZB 3K7RA 2WVDA 4ZCKA 3TQ1A 1GTHA 5H9EJ 1W25A 2XGQA 2E1AA 4Y00A 1S5ZA 1ZOTA 5HATA 4B3RF 2GC8A 3Q23A 3CDAA 4B3MF 1Y3KA 2HFZA 3F73A 4UQTA 2WRMA 2HEKA 4CWBA 2UU9F 1LK5A 4YP3A 4FF4A 3JXOA 4UZCA 4Y2MA 1DTQB 1UTAA 3WIUA 4O23A 5LMNF 1QE1A 4ZIWA 2BQ3A 2YKMB 4RW4A 4QOTA 1W2IA 2J0SD 1WORA 1BY9A 1WSVA 4USKA 1AZSB 4DX7A 5KOXA 4F2SA 1VISA 3CDWA 3KHHA 4ZLNA 3HKWA 2WVEA 4YOEA 3CJQA 3D0HE 1G7CB 1M0SA 3FK4A 3VGTA 4DL3A 3GP9A 5FDLA 4QWDA 4PR6A 4DV7J 5DM6Q 1S1TB 5CZXA 3MEDB 4CRJA 4PPDA 2RVJA 5KAKA 2DH7A 3HZEA 3EGWB 4DV1F 2E1CA 4DV2J 2CQGA 2V69A 2EVZA 3U1NA 1J2VA 2CA9A 3I0RA 4LF4J 2Z2YB 4LF7J 3PHTA 3IWXA 2HHQA 1FKOB 1VK8A 4ZVQB 2IPOB 3Q24A 4QPTA 2ZH7A 1ZZNA 5I4MA 3CJTA 4QIGA 4DR7J 1R89A 3AY0A 4MKVA 3CPWR 3RBXA 2Z2MA 4ZPBA 4ID8A 4DPUA 3UR3C 2K8GA 5F3TA 1F3VA 4B9UA 3HHLA 1WOOA 4EWTA 4ZHRA 1Q0NA 5IWAJ 4K4VA 1RT7B 2QL5B 2Q79A 2KFYA 3MXHP 3PZPA 2MKKA 3EGNA 4ECRA 1HWIA 4OZ0A 4QPXA 2QYGA 1FO1A 2GIQA 2HWHA 1H7XA 1S1VA 4OI2A 3AAWB 3K2YA 1RU2A 3OFHA 2JRSA 1RT2B 1M5HA 4ECQA 2EPIA 5RUBA 2LVWA 4O3NA 2XMVA 1CJVB 2DGVA 3ZTPA 2J6UA 2ZOGA 1RT3A 1RP5A 1WSRA 2AJFE 1WKJA 1AFJA 1X4GA 1HBOA 2UV8A 1UEVA 3W2WB 1AB8A 1C0TB 1UJ5A 2EFVA 1F60B 1SV5A 1NK4A 2FJVA 4OQJA 4UF4A 2ALZA 1EAYC 3M2VB 2ZH3A 3WDOA 3DI6A 3L7UA 4HKQA 5KFHA 4DG1B 4CH1A 3BO2A 1X4HA 4LFAJ 4CZCA 2J8AA 4EYIB 2PI5A 3R2CJ 1P1TA 2FLOA 4C11A 1F5BA 4GKKJ 5KG1A 2GVZB 4EBCA 1GNKA 1SQFA 3Q8PB 2NREA 3K5MA 1T9TA 4J9RA 4NA2A 1CBKA 1X9WA 1FDAA 2F8MA 3D6MB 1PBUA 1HWLA 4X62F 5I3QA 3I5AA 1B70B 1IM4A 4F26A 3PXGa 3PY8A 1NK0A 4YB1P 3FCWA 3QGHA 5HQ8A 2PE8A 2AU0A 2ZBCA 3DM2A 4DL2A 3HO1A 4DBQA 1RTHA 3QWUA 2NR0A 2B5JA 3UN3A 2QYCA 2C3OA 1S1WA 1EKRA 2IDLA 4ES2A 3PJ9A 2OEKA 4DF8A 2QN6B 2E5IA 2HQCA 3QLHB 1CS4A 5F8MA 1IKXB 2XNQA 4CCHA 2RU3A 5IZHA 2H54B 1N33J 2HBRB 3IAM9 3UO0A 4R0EA 3C66A 2QTWA 3HX9A 3LP2A 3QQCD 3MUMP 2DPIA 4DV5J 1B0PA 1NH8A 1Y4ZB 3S8SA 3FFIB 2C22A 2DO0A 3H98A 2OIHA 1SUQA 4J91A 3MURP 4BS2A 1ZBTA 6FDRA 2ERRA 3CJ5A 2QC3A 5D8HB 2BE7D 2BKOA 4DV0J 2KVIA 4P52A 4D3HA 1TVRB 2PFFB 1UPPA 4IH7A 4C3KA 2HAFA 3IS9B 5L9NA 2FY1A 2LQJA 3I87A 3CCUS 2FHMA 1CJKA 2XC9A 3D2WA 5J2PA 3N4WA 1T7PA 2YH1A 3CCLS 2MEWA 1FESA 1YK9A 3MMAA 1HBMA 2W2OP 5KFQA 4Y28C 4KPYA 3M6UA 2DGTA 1AXQA 1XR7A 2HGMA 3KUEA 4YR2A 1LFPA 2HNDA 3BSOA 3CIZA 1VBXA 1X9MA 5A2QY 2MQOA 3OTCA 1N5SA 1PGZA 1IN0A 1TV6A 3T5HA 2Z0GA 1EKSA 2F65A 1TKTA 4WIQA 4RW9A 4USIA 4WFYA 2DR5A 3KLIB 2ZWPA 1NZ8A 4HH1A 1TR0A 2KN4A 1XK8A 3K89A 2FQQB 2LDIA 3IFEA 1SB6A 2IMOA 1FRJA 1BGXT 2CPDA 2DNMA 4NYOA 3ULHA 1RAFB 2J8SA 1TMMA 3OVBA 2J0XA 1VGYA 4RR5A 1GT8A 1TUGB 3TOQA 5GMKa 1FA0A 2FVRA 2QO3A 1YJRA 3PEJA 2R3VA 4YB7A 4XDCA 4NCAA 5L39A 2G13A 1RADB 3W8PA 2X1GA 1D8ZA 4LFCJ 3L3CA 4ETXA 1KLMA 2QEXS 2VICA 4UUXA 1L3VA 3VAJA 1S9FA 3H90A 1WC5A 1Y5IB 4ED1A 2IHR1 3BYPA 1ZAXA 1VLYA 5HP1B 1FWLA 2NZCA 5A8KA 1LK7A 3G6XA 4NLUA 1P9QC 1KVIA 1NDPA 4RW4B 2AJ1A 1VJQA 3V4IB 1RWVB 5J2MA 1FRLA 1T8EA 2XS7A 4AL7A 3DGVA 3KXDA 3P8BB 1SJ4P 5D0EA 2HRUA 1HNXF 1MN7A 1M1GA 2E5GA 2LEBA 3VTIA 4Q8EA 2UP1A 4M5DA 2ZD1A 5IT0A 1TL1B 1RQ0A 2BV3A 2CJ9A 3P4UB 4KR0B 2RSQA 2W2NP 4JI1J 3OW2R 4PUOA 3TUIC 1JQGA 2H5JB 2CUYA 3RRGA 3CF5Q 2YNGB 3D1QA 3BDPA 3TAPA 2ZBPA 4K4XA 4LBIA 1FVSA 3D5MA 4TY9A 5F8HA 3SI8A 2GQ2A 2Y8YA 2CIMA 3HLUA 1NRKA 2WVBA 1SH3A 2HVEA 2AEJA 2KYZA 3P5TL 4U7CA 3OTOJ 2IAJA 4F25A 1U2RA 3C14A 3EWGA 1TL7B 2JZ5A 2ZKUA 2VZ9A 2DRBA 3MM8B 1KDNA 1FD8A 1DFDA 4ZCMA 3TYTA 3BDEA 5E3AA 4RW7B 1RSCA 3MEEA 3HHLB 3SMZA 5HVFA 5I42B 4JYAJ 2PC6A 3UN2A 4K0KJ 3EYZA 1VQPS 2CJYB 4IDKA 3V5RA 4EBEA 1YI2S 3R6LB 3PHEA 2DXFA 4B17A 3SV4A 1NSQA 2B7CB 5KFPA 1KSPA 3C6UA 1IKYA 1MN9A 3CD5A 5JXSA 4OYZA 3TI0A 4DS4A 2Z30B 2DIVA 2DBBA 1T0TV 1S0NA 2JEJA 3A1YG 4FYDA 1T05A 2VOPA 4FPIA 3N01A 3R5DA 4WZQA 2Q1LA 2HHHJ 1U45A 1R8BA 4I6WA 1HBOB 4BWJA 5AJ3J 3MDFA 4UOHA 3K5OA 2GIRA 3OL9A 2A0FB 4YMEA 1SV5B 3SQOP 1Q8KA 2EI5A 2J6TA 1VIXA 4CTAA 3DLKA 3DI6B 2IC3A 1UL3A 1WOSA 1FEHA 1NK6A 4DL7A 3TANA 3MOZA 1T9VA 2WSFC 5D3GA 2DR8A 4AL6A 3W9JA 3DHWC 1M90T 4ZP7A 2FB0A 1BQNA 3BH7B 3KLEA 2C3UA 4A8SA 1REGX 5LMUJ 3NMRA 2LQ9A 4X2BA 1FE0A 3CUNA 3NGTA 2JVRA 2JC0A 3D28A 5CABA 5IQ6A 2DGQA 3M1VA 3PR4A 1R6YA 5L1JA 1Y00A 2LEPA 2B4VA 1JLQB 4OHVA 4ZPVR 1L3KA 2HGNA 3DRRB 4KGXB 2O1PA 4RO0A 1FKPA 4O4GA 1J5OA 4I64A 3R7BB 1GXUA 3KK2A 4B3RJ 2HFUA 3R7NB 4B3MJ 2AEMA 1H38A 4IR1A 2FHOB 3W61A 1VRTB 2D9PA 4ECYA 2UU9J 3BN7A 4AUKA 2W8LA 5LMNJ 3UWTA 4AXJA 1MMNA 3M30B 1FK9A 2UUCF 2F63A 2LEAA 1RK8A 3IMQJ 1UVNA 3A8JA 4H54A 1YWXA 5DLGA 4KSEB 3NP5A 1TKZA 3OJSA 2V94A 3D3CJ 1X31C 2DH8A 2CJAA 4QU6A 3PFOA 2UVRA 2W7OA 3O6QA 4J9SA 3FGVA 1IR0A 1D1UA 5CHCB 1U1QA 4ZLPA 3QO9B 2BQRA 5BYQA 3HHKA 3GV8B 2VB6A 2C2EA 2GMJA 1Q86T 2P5VA 2WSCC 3DDKA 5DG8A 3PKMA 4USMA 2AW0A 3O3LA 1EETB 2J9DE 4DV1J 2FUG9 2O01C 5J2PB 3IM8A 2IYGA 2QMXA 3N28A 2DISA 4I7FB 5L1LA 5L38A 4PEOA 2DNRA 2W9CB 3A4TA 3ZNJ1 1RXOB 2SXLA 4U8YA 3SFUA 4NL5A 3V6HA 2VC1A 4HTIA 4PQAA 2B6AA 4UOGA 3CCRS 2N4CA 1HFEL 5GAHU 1XC9A 4WFNQ 3VAKA 3P3DA 1D9FA 4X84A 3H40A 4K5RA 3GJSB 4IR9A 1WKKA 2ZFHA 2Q3PA 3D0GE 1KD1T 1F3FA 1IKVB 3OL6A 1TKTB 2EK6A 4F0MA 1RT4A 2X1AA 3DRPB 5G0RA 2ZH1A 1SC6A 4NEYA 2MKCA 2MKIA 1BUXA 5A8RB 1WEZA 4Y2AA 3LGMA 2GIFA 1LFWA 3N9UC 2ROPA 2BYCA 4RW8A 1RTDB 2VA2A 2L08A 3LP1A 1FRMA 3RG6A 4DR4F 4OYAA 1Q5YA 4OHXA 4AT1B 3DLHA 2WSEC 2FVCA 3SCLE 3SSQA 4OLPA 3HP6A 4RW6A 4LRAA 2P2CB 4LSLB 2FJDB 2F7VA 4FVMA 4NZ7A 4N47A 4LMZA 1WI6A 4KKOA 4RNHA 4OI1A 1SI9A 4K2XA 2MGZA 1U6FA 3PYDA 2N82B 2I5JA 1KLMB 1CJUA 2HRTA 1BD6A 1S7IA 4NE9C 3MUTP 1PYOB 3CNQP 2LFVA 4C97A 2QIFA 4DPOA 1YSJA 4Y0FA 3CJ2A 5F8IA 4DS5A 4GRSA 3CJ8A 2V8HA 1PG5B 1UP1A 3H7HB 2C1EB 1OY8A 3DLBA 1E6YA 1ZA1B 1P1LA 1FX2A 2D3O1 2IRYA 1R8AA 2U2FA 4LBHA 1T9UA 2VQFF 1OSDA 1EZZB 4ZCIA 3PCOB 1QLNA 3O44A 1VQLS 2W4PA 2X3DA 1RAAB 3GFHA 3JB9k 3QRRA 3G82B 3UFCX 3G86A 2VPXB 3THPA 4RPFA 1JLCA 4HL9A 4CNZA 1ZM3A 1VHFA 5DZ6A 4X4TA 2DR9A 3HD1A 4YUDA 1Y5NB 4L75A 4USVA 2I1RA 4KHMA 5KG5A 4DPTA 2AIRB 4I68A 4NMLA 3QZ8A 3OTBA 1P8GA 2PMWA 4C3LA 1AT1B 5E3PA 3J80Y 3R3TA 3ILIA 5B08A 4DCOB 1UVLA 3K59A 3G6VA 4BC7A 2MTLA 2HFVA 3GFXA 1YZ7A 4P7VA 1IVZA 3C14B 3PW7A 4K4YA 3CCQS 2YX7A 3HCXA 2DHHA 2JEIA 2ZOFA 1TKXA 5D0HA 3H2UB 3R8YA 5JUMA 3NOCA 2ZDOA 1BHNA 1JKHA 3DFEA 2YX4A 4IDKB 1FNMA 2K3KA 3VVTA 1TFYA 4NLOA 1O51A 4MKYA 1LEOA 2B56A 2XSJA 2BZ2A 2PDAA 2IVFB 1TAUA 4UY8T 1WF2A 3GQCA 2PMHA 4C8YA 3SQGA 3CC7S 4RUAA 2OMLA 3TZYA 4FBUA 4IRCA 1HNIA 1XTZA 2DNZA 3AFGA 1ZS6A 3BBBA 5H9FJ 1VQ7S 1S6PA 2UXBF 3KLVA 3DYAB 2R7QA 3UI3A 2F8HA 1L3TA 1FNXH 3MCMA 1SJ3P 1BWVA 4P72A 2MY7A 1UAWA 1NKBA 4J90A 2E9RX 1I5OB 4ENOA 5E33A 3VAMA 3DLKB 2AZ3A 1E6VA 5C24A 1TL5A 5I3PA 2IC3B 4OI6A 1RUSA 5CYQB 3OLAA 2DVIA 4F02A 5D78A 4LF5F 3A3OB 1D9AA 4OI0A 3SDEA 3AT1B 3CMES 3HSZA 3D54A 3TEHB 4TVAB 2M3DA 2HAIA 4DV3F 1EB0A 4J9QA 2RILA 4LIWA 2VQEF 3VZHA 4CYUB 1SL0A 2CNOB 2UVWA 1BWEA 1JLBA 5LM7E 2RH3A 4IG3A 5ITHA 1RHJB 1XNRF 4C8OA 3QGIA 2JEFA 5ETLA 1B3TA 4NRUA 3KTQA 4DPWA 3F0NA 1JK9B 2WK4A 5HBMB 4WZMA 4ECXA 4OHWA 1FX4A 5BR8F 4DLEA 2AX1A 4IUFA 3U1MA 5K20B 1S48A 3K5PA 3RB0A 5KFOA 2C2OB 2FJWA 1S1UB 2MLZA 3KLFA 2Y3YA 4QBUA 3EJMA 5BYRA 2QA4G 1AYEA 1NJZA 1F0XA 1OIAA 3MOJB 3DLLQ 2ZH6A 4ZVOB 5C25A 1H0HB 1S0VA 5HLFB 4OX9F 2J76E 1JLGA 3D67A 4M5KA 4B08A 3HVRA 4H4MB 1S49A 3PRDA 3V81A 1HNXJ 2YKAA 3T5JA 1HR0F 5D15A 3GZ7A 1I1GA 3S7RA 3H2VE 2HURA 3BBCA 2ADCA 4KIAA 3J7AN 2QX0A 2W2PP 1RLDA 1T95A 2QT7A 5KFKA 1IUJA 3CMQA 3JSYA 2BJ9A 1G3OA 1S0OA 2W4CA 1IQZA 5GAGU 2NUHA 3LA0A 4HTJA 4ECSA 3ZZPA 3QRPA 2MZQA 2AEFA 2GJIA 2NUUG 2C2NA 4HHUA 4QJVA 1RYRA 1N6QB 1DQ8A 3TZXA 2LU1A 2KU7A 3RBDA 3W5XA 2NXCA 4GVBA 4E8UA 1IBCB 4HACB 3L7PA 2VH7A 3JAMU 1R0AB 3W62A 2CXEA 3I32A 2CKWA 4JI6F 4URGA 2M52A 3ZTRA 5F9NA 1PJ5A 4QZVB 3UNYA 4CLZA 1X4FA 4X4NA 3DXSX 4ZP6A 1VOMA 5H1SV 3MEGA 1MG7A 1U7LA 3M2UA 2RD5C 5KFCA 5DG9A 2XQCA 3KKFA 3RGIA 2EFQA 2F4VF 4L73A 2M70A 3LP1B 5HANA 1K9MT 3ZZ0A 1ZTTA 3GSDA 3MD3A 3ENAA 3TUJC 2IYIA 3TZZA 1NHKL 4M5HA 4XTTA 3I56S 7FDRA 2XHCA 1JLFA 5KOWA 4KGVB 3OR2A 5D6GA 1L3UA 1U26A 4BC9A 3I6PA 4L76A 2GGPA 2K7KA 4NXMJ 5AE1A 4M5NA 3MFHA 1SJ1A 1TELA 4JI4F 3NGKA 4KKOB 5AXKA 2MGZB 1HQEA 3R1LA 3D9BA 3VAIA 1GXLA 1P27B 1IM6A 4M5LA 1PO6A 1N32F 3OXLA 3RZAA 1V3ZA 2HNZA 1VHIA 2NPIA 1N36F 2EK1A 1UMJA 5LSLA 3N79A 1RT1A 1SQGA 4DL4A 5KT4A 3ILLA 5ETRA 4QWBA 3SCJE 1HQUB 4RLEA 2X7IA 2YKNA 4Y2KA 1FF2A 4JI7F 1I94F 2BM1A 2BKNA 4MIAA 3EVMA 1AUDA 3NGUA 1VIOA 2KG1A 2DB1A 1NKCA 2G0IA 4PG4A 3CJ0A 1JLAA 2CNLB 2HS3A 3I0SB 2E1MC 3ENVA 2JFDA 3VR1A 2IIHA 4Z7CA 4DF4A 2HVIA 3L09A 1KNZA 2UUCJ 4V1Ak 3THTA 4M95A 2MKSA 5FLXY 3DC2A 5MLCV 4QCLA 3FRYA 1CULA 1CLFA 2JH3A 4Q8FA 3LGHA 4ED6A 4S0MA 3ILJA 4GO7X 2WBMA 3N6LA 2J5AA 2HLUA 1TU0B 1F2GA 4JBCA 2VU5A 2W25A 1ZA2B 4RWXA 1YBAA 1VBKA 4TY8A 2R4FA 4WTOB 5CH7B 2BVZA 2EBEA 1JXLA 5J1EA 1C1CA 2IRUA 2N7CA 1GMWD 2CDRB 2WW4A 2Y9HA 2CPIA 3T41A 5HL7Q 2HMIA 2KB2A 9RUBA 4H4KC 2XMUA 3B4MA 4PXCA 4GO5X 2OPPB 4JI8F 2VBYA 1XMOF 1O8BA 5GADU 3HVTB 4X4RA 1YBTA 4RBTA 4A8QA 2BOAA 2ZJRQ 5J2NB 2BJ1A 2VPYB 1F9EB 3UD4P 3HSGA 2GHVC 2JC1A 4JI0F 4WE1A 4MYUA 2M5YA 3TA1A 2CAJA 4F4YA 3LP0B 1NDCA 2RNEA 2BX6A 3E01B 2LXIA 1VMBA 3RAXA 5KT3A 4LRDA 2DHSA 2IFXA 3QJLA 1RWWB 1GX5A 3VQSA 1I3OB 3BH6B 3KDOA 5HAOA 4WK1A 2W9BB 3ZTSA 2U1AA 2ZH5A 5KFUA 3GV5B 2M88A 5ETMA 6FD1A 1E6VB 3ZFVA 3DOLB 4CO1A 2Z2ZA 2ZHBA 3M2RA 2OO4A 1J5EF 3CD7A 2CNKB 2ZE2A 4DUZF 4DX5A 4DR4J 3EICA 2Z57B 3B78A 1S10A 1K8AT 3ITHB 2LQ5A 5KTQA 1TTHB 2XMJA 2GS8A 1EQ0A 1JLBB 1KHVA 3R5BA 1N0UA 2VG7A 2CPZA 3VGVA 2V4JB 4UOCA 2VKZG 1SVDA 1SKSA 4PRFA 1RAIB 1KQSR 2OKQA 3W9IA 2OPQA 2A3JA 2CJQA 1U47A 3JYTA 1RHUB 4F50A 4B3OB 1SIZA 1NK7A 2ALYB 1KQFB 2CPEA 4A48A 5B0DA 4ETZA 1KS2A 1IKWA 1HARA 2V2VA 1FRIA 4W4MA 3M8PB 4OL8A 3KLHA 1KRPA 3S6EA 2AYEA 3IM9A 1JWWA 3BKFA 2MSSA 2RB7A 2HWIA 3H59A 3BN4A 1KEKA 3I9ZA 1VQ9S 3C6TA 2CADA 1NM2A 4AXIA 1Q53A 3M8SA 1XR6A 2VQFJ 2DXEA 4CLWA 5HK4A 2I0XA 2NXNA 1S6QB 2ILYA 2UUTA 3BBFA 5F8JA 1TUWA 1JX4A 2GO9A 1NNDA 4DQRA 4USTA 1CJTB 1HNVA 3QBCA 3DMJB 4F36A 3NXZA 1N88A 3QYYA 3ZC4A 1R8PA 2BA9A 1UW9A 3V6DA 4PXDA 2H51B 1TL3B 2XWYA 4WFXA 3UW1A 8ATCB 2DNKA 3OT9A 4G1QA 4DEZA 1UZHA 1S6UA 3GE9A 3I4PA 3R5CA 4LQ9A 5K8NA 4R0JA 2DCUB 1HD0A 4TU8A 1KP6A 4WF9Q 4B9TA 3RAMA 3JTNA 2BRKA 3KK1A 3HM9A 1T03B 3PW5A 1C0UA 5C2CA 2WTFA 3KK3B 5IOLA 5HMWA 1YG0A 4C8MA 5D0GA 4ECTA 5EGYA 5K8OA 4DR5F 5K8MA 3QT8A 2XBPA 1N8RT 3UVJB 3TUPA 2UUAF 1H73A 2ZEJA 4USHA 1PCAA 3MECB 4A8OA 2V4QA 1H2UX 4ZJOA 2KHDA 3JQKA 3F41A 1NDLA 1IJFB 5HMYA 2CRLA 2UXBJ 2QL9B 2MQNA 1SH0A 5FIIA 2FZKB 2W1BA 3KHLA 4PG8A 5KG0A 1FFWB 1U2CA 2WHOA 1NAQA 3OR2B 3E51A 5ADZA 4NLDA 1VQMS 2BJDA 1FFSB 4OJ3A 1S1TA 1N5QA 3MAQA 4DR1F 3MEDA 2ASDA 1TUVA 1VC5A 1VS3A 1WACA 2HZCA 5HSPA 5DZ7A 4WJBA 4LF5J 4A8WA 2HVZA 3QWPA 2B3TB 4C8ZA 1WTFA 4I2QB 1S1XA 4DR2F 2UV8G 3TARA 4DV3J 2FIUA 4O0IA 3R97A 2W01A 1FKOA 1FJCA 3OSPA 2VQEJ 2R7VA 4EUVA 2BEFA 2HNYB 3MI7X 2DT9A 4K59A 2KVQE 1V9OA 1SC3B 1NB2A 2IDEA 1XNRJ 4ZA1A 4ZP8A 1XMBA 1NHVA 3BGRA 4CLUA 1U1KA 2JLGA 4NYPA 5B0EA 3ETOA 3GG1A 1RHRB 2NS1B 3QJJA 5A6PA 5BR8J 1U09A 1WC4A 3MAAB 5SUHA 2AF6A 1JLAB 1Q1KA 1RT7A 3HFVA 1X0FA 1RT6A 5E5NA 5HI7A 4IO1A 1U1MA 2HHTA 2V9KA 1XN9A 4J9KA 2FYXA 2RMLA 1NK5A 4AL5A 2MZSA 3G87A 3IRWP 1KLNA 3GIIA 1RAEB 4RBVA 4BBYA 2BABA 3I5BA 4DWIA 4OX9J 2QLWA 5FLXU 2PA3A 1Y5LB 2L9WA 2FC9A 4CIOA 3IBFB 1RT2A 2V2KA 4O4RA 1CJVA 2LP4A 1V3RA 2IBKA 4JB8B 1HR0J 4DU8A 1U24A 4I6YA 4U96A 5F8GA 3MM6B 3SIPB 1LNQA 3W2WA 4I69A 1WI8A 1MMLA 1APSA 4ECZA 2LKZA 5KFGA 1Z2ZA 4NEZA 1OY6A 4CM2A 1N34F 2HVHA 3GPAA 1WF1A 3M2VA 4CP5A 1HYSB 4KH0B 4OZ1A 4DG1A 4RUCA 4DQSA 2G0CA 2YVSA 3UDVA 2VFUA 1Y9OA 1NSPA 2OUGA 3M8RA 2V34A 3RR8A 3PR5B 2GVZA 3US5A 1IR2A 1RCXB 1U0HB 1PC5A 1Y7PA 3QNWB 4ZVSB 2XZTB 1Q8LA 3EDQB 2HHVA 2IJNA 3EPGA 4JI6J 2KXNB 3T5KA 3GIJA 2RDIA 2LU2A 3P5BP 4WXWA 3TP2A 3M32B 1HBUB 4Q2LA 4X4QA 4X66F 4PWDA 3MEKA 2KT3A 3CO9A 3MF5A 1KKHA 3ENQA 1ZPWX 4BCAA 3UD5A 2OPSA 3CCMS 3MUVP 1X7VA 1X5OA 2XB2D 1UEUA 2QA2A 1YTYA 4OJHA 2XMKA 4CNYA 3W63A 1CG2A 5M2PA 2F4VJ 2QMUB 3QLHA 2R8GA 1IKXA 1C4CA 2FDNA 3DN9A 1R3NA 1SQEA 3ZZUA 1FJEB 3PKYA 4MIBA 2B9EA 4NASA 1H2TZ 1LV5A 3DLGA 3FFIA 4BDPA 4MT1A 2WAQD 5DETA 4ZVTB 2UXCJ 4FF2A 5BXIA 2XMWA 1CPZA 1NLKL 3J7Z5 1OPZA 4GC7A 3EPIA 2ROGA 2VG7B 3MM9B 1RT5A 3CTRA 3SSSA 1TVRA 3UQSA 4E0DA 4JI4J 1WHYA 3CJ3A 2OPQB 2AGOA 2I8EA 1WG4A 3LTOA 2BDPA 4U7UK 4DL5A 2OFGX 3U1LA 2BE2B 1N32J 1ULRA 3NS7B 1VQYA 2HHSA 1DQ9A 2EFGA 1X4EA 1N36J 5KFVA 5B0CA 3SFGA 3LAMA 2OI2A 1A7GE 3KLHB 4H4OA 2C2ZB 3G8TA 3D3BJ 2BR0A 5A76A 2DD8S 2ZC3A 4MFBB 1HPZA 5ETSA 3UE2A 5DDOC 4JI7J 1I94J 5KFNA 3VGUA 1QAIA 2CQ4A 4DV6F 3TJAA 1L3SA 4UUWA 1GTEA 4JV5F 3SZ2A 3NL0A 2O5DA 3BPSP 4JUZA 4CO2A 1UWBB 3MCOA 2HK3A 3M8QB 3MM7B 3KLIA 4NLWA 3AHPA 2E5LJ 1WKLA 3M9OB 1KVJA 2Z8QA 2A1BA 4LF8F 3EMTA 2FZGB 4IO9Q 4LVOP 2XS2A 4HDHA 4X4VA 2QLFB 4WYLA 1QAJA 3IAS9 4J9LA 4ZVRB 2HPUA 3P45B 4B9VA 1RLCL 3PACA 1U1OA 2KXFA 1N5TA 3NGRA 4DL0C 4ED7A 2QRRA 4ER8A 2OP5A 1K73T 1HI1A 2E1RA 4Q0BB 3DOKB 3EX7B 1IWGA 2OD6A 4OYOA 2Q43A 2DHAA 2F9DA 5JMNA 2BKPA 1YJ7A 1C0UB 1C1BA 5DGBA 3ET6B 5LL6d 5CAAA 3RJMB 3F44A 2HZVA 1YKWA 2L3MA 5L8RC 4N41A 1FXLA 1FJ7A 1FDDA 2GA7A 4JI8J 2HQDA 1XMOJ 2E66A 4PYAA 4TN2A 1UVKA 2GO8A 2FD2A 2A2DA 4KT0C 1S72S 3QSYB 3DLJA 2N4DA 2HYIB 4WXOA 4RBUA 4ZPDA 4URSA 4IRKA 5HP1A 4P6QA 3D6HB 1JLEB 3POTB 4JI0J 3SV3A 3T19A 2BOPA 1GX6A 2OGUA 1WELA 4NX9A 3IC1A 2MQPA 3V4IA 4QIVA 4NA3A 1JB0C 4F2RA 5H9EK 4ANEA 2RHQB 3MR5A 1EP4A 4JP8A 4CO0A 1QM9A 4ID5B 3LO3A 3TAMB 1DAXA 5KT6A 5IFMA 1TL1A 2DPJA 4MJKA 4F7VA 2ASYA 3GR0A 3E2EA 1LQ9A 2E5JA 2XNRA 1K0VA 5DM7Q 2VDHA 2YPZA 4ZCLA 4A8YA 4RU2A 3S01A 4KV8B 5CYJA 3DDNA 2YNGA 1K44A 3B82A 3GIKA 3CB4A 1AROP 1J5EJ 4NLXA 1S9EB 4FXDA 3EXYA 4ZPTR 1RI7A 5F0UA 2XZWA 4DUZJ 4XIUA 1S1XB 2H5EA 4R8UB 4PWUA 5KG4A 2EEYA 1RACB 1OQ6A 3PYGA 2CQ1A 2CJBA 3JS9A 3PEHA 4ZIVA 4DX8H 3DLEA 3AXMA 1TL7A 4NCGB 3MM8A 4A8FA 2AGQA 2CFXA 5C5JA 2DY9A 4RW7A 1YITS 3BGRB 1Q16B 3MPUB 3PVXA 2B51A 4HYKA 3PTWA 5I42A 2AYMA 3W9HA 2D41A 2GMHA 4ZVHA 3ZZYA 5K5MA 4F4WA 1KTQA 1JJCB 3C15B 3GR1A 1VQ6S 4OI4A 5LJ3Y 4YHHF 1RT6B 2RQ4A 2OELA 2RKIB 3HXMA 3UCUP 3W1YC 1Q5VA 5IT4A 4QIEA 3RRHA 3M05A 4RNOA 4K2JA 5G4DA 4LF6F 3NLCA 4EK2A 2KTQA 3CMAS 3EDRB 5J2QB 2LA6A 3TRGA 4JV0A 4CH0S 2DGXA 2YWEA 4FNHA 3T9NA 3CEDA 1H2VZ 3TWZA 1P6TA 3G6YA 1QJHA 1D09B 1FNOA 2AT1B 2B4OA 1UVMA 1YVFA 4WPAA 3KYLA 4I4BA 5AXNA 1VBYA 4CI0B 3PV8A 3DGPA 5JVGQ 3CCVS 1VFJA 2MMYA 5HROB 2BJ8A 2FVQA 5E3QA 3RTVA 3SEOA 2BUNA 3IGNA 1LW0B 5KT5A 3T9ZA 3PM9A 1FEEA 3ZZTA 2MKJA 2HW3A 5E0OA 4A46A 2C2DA 2AMCB 3U27A 1OPIA 3HT3A 3ICLA 4FF3A 2QGFB 3PO5A 4OX8A 1A0OB 2KJWA 5EWEA 2I6WA 1MROB 5CCLA 4FDFA 2JOQA 1W2BR 1JLQA 3DXBA 3DRRA 1WC6A 5HN0A 1GAOA 2QFJA 1AW0A 4IYQA 3E8OA 3WHIA 3CD0A 2KDOA 2KM8C 3MZIA 3CIMA 1NPRA 4PWDB 4DHVA 4DR5J 2ZNYA 5KG2A 3JQMA 2GV1A 4NZ0A 3SCKE 4DSIA 3H5SA 2OPSB 2ILZA 2VIHA 4JI5J 4UZBA 1VRTA 2I38A 1RA7A 2UUAJ 3UR0A 3K58A 3K17A 4N5SA 1FWPA 3M30A 1TP7A 2RQMA 2VFVA 3IR5B 1D8YA 2HRYA 4F0HA 4FYWB 1B7FA 4CLKA 3RAQA 4OX7A 2ZBQA 3VAHA 2XI2A 5A6WA 2RHSB 4O3RA 2ZJPQ 2P9CA 3TVYA 3DLGB 2QSWA 2OJ3A 3GSIA 1JNRB 4ECVA 3LQVA 3T6BA 2XLKA 2N3LA 1FRXA 2OEMA 4DCJB 5KFZA 3D6FB 5AXMA 3QO9A 2Y0BB 3T1AA 4WIIA 5K9FA 4Y6IA 3NS5A 4EO6A 2ZZMA 1RT5B 1FERA 3HHDA 4DR1J 3GYXB 3W64A 2CJXB 4PCQA 5IT9Y 1MU2B 1H3DA 2VFRA 1EETA 5KFSA 3FCVA 4QW8A 4DR2J 4HT7A 4I6AA 4AE5A 2YX1A 4I7FA 4LRFA 3T3FA 2W9CA 5LT5A 3M7VA 4H4OB 1K47A 4IOCQ 2X3GA 2VASA 4KJIA 4YY3F 3FMBA 4FBTA 4CLLA 2XZDB 1HPZB 4RNNA 3HULA 2RF2B 2FZCB 2KO1A 3TW0A 3ELHA 1QD1A 1LWCA 3QIPA 2OTLS 4PG7A 3MFIA 1UVJA 3IA0A 5IV4A 2QL7B 4PQUB 4CLSA 1IKVA 1YX2A 3W5YA 3DRPA 4C48A 2YTCA 1O6XA 2PEHA 3DRXA 5KFRA 1UCNA 5A8RA 4DR3F 1JMTA 3AA8A 1VQKS 2IM2A 4RJVA 1RTDA 4FPRA 3I55S 4CLPA 4C8KA 2BBEA 3KDNA 1YIJS 4B9NA 5IXUA 2K1RB 1HIYA 3TVZA 3TAQA 3PW2A 2R8HA 8RUCA 5B0FA 2BXJA 1U1RA 3VGSA 3EM1A 1K0TA 1A9NB 5DDRC 4Y65A 4JI3F 4IFYA 4GMKA 1WNEA 1C1BB 2VKRA 4FN5A 2ADBA 4FYYB 1N34J 4G3IA 1NK8A 4LSLA 2C3PA 3KMQA 1SJRA 3NY0A 4Q2MA 2EC2A 4QR0A 3KHRA 1RKJA 1MWQA 1WUUA 2EFNA 1QSLA 2XO7A 4W90B 4RUHA 5DRKA 3ZXWA 3BQ1A 3P6YC 4LSNB 3VALA 1FTCA 3DHXA 4TLRA 3R5JB 1RHMB 5LOQA 5HMXA 3T5LA 1JJ2R 2YWKA 3JSMA 2DRDA 1ZPVA 4QYZJ 3C16B 4YEAA 1LXNA 4DN9A 4FKXA 2E5HA 2XLJA 2UVUA 1WG1A 1VJWA 4NWBA 2B9XA 1RTIB 4WP8A 2DNPA 4WWSA 3H42A 4F3MA 3HI9A 3BF4A 1U1NA 4F0KA 1H6KX 2RDJA 2F5GA 3V6KA 5SZTA 1EP4B 2J9CA 1PKUA 4X66J 1RAHB 1PC4A 2R7UA 3MR2A 3G82A 1W7WA 1T9YA 4AQYF 1URNA 4QYZK 1HW8A 2GW8A 2EC0A 3EE3A 3KJVB 4QWEA 5DLFA 1WEYA 4RL1A 3WC0A 2BJEA 1F1BB 2M0GB 4E2FB 4DFMA 3QGGA 5GAHI 3EZ5A 2CG8A 1FRHA 2LCWA 2MZRA 7FD1A 4NXNF 4F67A 1RB0A 1DY3A 3RB3A 1RWNB 1MMDA 3G8QA 3C3LA 1VCTA 4M5GA 3V4MA 2B0GA 4K4SA 3DLEB 2R8JA 3L9ZA 4IRDA 2CWKA 2PSZA 1MWYA 3CCSS 4KY3A 1YDLA 1Q8IA 2AYBA 4WTYA 2R8KA 2ZH2A 2HHXA 2KRBA 4WFBQ 1CC7A 2YY3A 1X4DA 1S9GB 2W24A 2JJ4D 4DUYF 4E98A 2XGPA 2R2UA 3O2IA 3HHLC 1YJ9S 3CJKB 2MQQA 4BHQA 2IRXA 2FC8A 3N6NA 1GXTA 3DRSB 5A0YB 1VRUB 3HK2A 4XDDA 7AT1B 4USUA 1Z1ZA 2ASLA 2XMAA 1AA1B 3FBEA 1REVA 1XR5A 5DDPC 1MLAA 3BGLA 4HLBA 4RX6A 4NLYA 4LRBA 2YNHA 4DV6J 2J9DA 2Y1RI 3HHEA 3DYAA 2AJ0A 4JV5J 2DO4A 1NMEB 5E3RA 4P2XA 9ATCB 3DGPB 4ZVGA 1M5KC 3RUBL 1PAEX 1B64A 4ELUA 1RYSA 1M1HA 4O3SA 3FZ2A 2CZ9A 4LF8J 5CYQA 3ZTOA 1GQEA 3GMGA 5EX3A 2HBYB 2YPYA 1DZ5A 2YNIB 2F3JA 3BSCA 5AT1B 3X3UA 3FSXA 1FD2A 4CYUA 3NMAA 3D66A 5T7LB 5B09A 1ROFA 1KQKA 2PT0A 1Q8BA 4CLFA 1Q7YT 5HBMA 2DY1A 2VC0A 3MPVA 4F4XA 2H1YA 2QZ8A 2CG4A 1VLOA 3F56A 2BE9B 4XPCA 5B0BA 1S1UA 4QR1A 4BLGA 1SKWA 1FKAF 2E9TA 1YQHA 4NCBA 2IA0A 3OQ2A 1N5VA 2MYFA 3J7YU 3MMBB 2MPUA 5EX0A 3PRVA 3P49B 4WYWA 5HLFA 1FI4A 2R2SA 3H0PA 3KJQB 3T6JA 4DQPA 3CSKA 3AJ2A 4H4MA 3MR7A 2GVDB 2K3IA 3VWSA 2RUSA 2IY5B 3OBIA 1WC3A 2G9OA 2WCXA 5CCMA 3HDSA 2KT5A 3Q2SC 2V50A 1S57A 5IM0B 4K4ZA 1M5SA 3UN5A 2RAQA 3OV7A 2Y8WA 2VF3A 1NHUA 2QA4S 1SJFA 2B8PA 1CQMA 2GQCA 1WC1A 4OYIA 1H72C 4D3GA 3OXFA 3QRQA 5HQLA 1U1PA 1FFGB 3NGSA 2J7UA 3NCPA 3R7SB 4QWCA 2OH2A 3CDUA 2O66A 4I2PB 5KFFA 3QIDA 4C0BA 1KC8T 3HSJA 2H65B 1UFKA 1N6QA 4Z7YA 2AX0A 2CNNB 2MHEA 1T9WA 2E7XA 4DSKA 4HACA 2DHXA 3ZO7A 2E9ZA 1R0AA 2C42A 2MQMA 1R6VA 4KAIA 4B9MA 3HF5A 3TUZC 2YKOA 3ZNUA 2VBZA 1LWCB 3QIPB 3H5YA 3TA2A 1HHTP 5A2QU 2ASJA 1JNZB 4A8MP 1IBMF 2OSRA 4KFBB 1KONA 5F9LA 1N5YB 1EHWA 4DPYA 5ETKA 4ZOSA 1EQMA 1B0VA 4UOFA 3OUYB 1UA0A 4WK3A 4LF6J 3BR9A 2B7BB 3C2PA 2JHEA 3NWGA 2J6SA 3Q8UA 5ETPA 3QAEA 4PG5A 1RJJA 1CC8A 4FXVA 3IN5A 2YWFA 3IR6B 1VK3A 2F4FA 2GJFA 3BKUA 3H4BA 3AODA 1FCAA 2JX2A 4A4JA 4J9NA 4B3TF 1HA1A 3PYFA 4IG0B 4IFYB 1QY7A 4BWMA 1TMJA 1C4AA 1ICEB 2YWHA 2OEJA 1C2PA 2KRRA 1TK5A 2DGOA 1SL1A 3K5LA 2OSQA 3LUYA 2QG9B 4FP9A 2VDIA 2XYGB 1UW4A 3JSMB 1GEHA 3PG9A 2PO4A 3D6TB 2CQ2A 2AZ1A 2H48B 4ZK7M 1DURA 3C46A 4EYHB 4KBIA 4J9OA 2FGOA 4KB7A 4C9DA 5E3CA 3IG1B 3NWRA 2OMOA 1DLOA 1KQGB 2GMLA 4HHHA 5GMEA 1HQUA 3VF0B 4X62J 5GAGI 3FSYA 2CPFA 4Y2CA 2A6OA 4OLOA 3IXQA 2LYVA 2V68A 3OTDA 2MB0B 1S4EA 2COLA 3I0SA 4CM0A 1I6JA 1S97A 2HQ3A 1OJ4A 4TKTA 4DU7A 2M8DB 4C2MA 2BACA 3FJ2A 3AJ1A 3QSIA 5EDWA 4AD6A 1FWKA 2C3MA 4OZ3A 4ED0A 2G4BA 2ZJQQ 1YBUA 3UCZP 4ZKAA 2V4RA 3MTJA 1NB7A 2LQBA 2CWXA 5HQMA 5K8PA 1WHXA 3KNGA 2VOOA 2IM0A 3NNHA 4OZNA 2VODA 5D4OA 2NXJA 5BJRA 2NLWA 1NJWA 1I51B 3GLJA 4NRTA 2HHPA 3GFZA 2VJUA 1XERA 3AQPA 1DJ0A 2J0QD 1M5PC 3LWLA 2KHCA 3KG0A 4DCPB 2MSTA 3QT6A 3RR7A 4O44B 4TNOA 4MKBA 2MXYA 2P6SA 1VQ5S 3DOMB 3FEYB 2OPPA 3LWMA 4PABA 2A18A 3E3XA 1G4CA 3HVTA 3M8YA 5T14A 3FKBA 3JTOA 4TXSA 5J2NA 2VG5B 1TK8A 3N5BA 2VG6B 3VAGA 1ZYQA 1IJEB 2GAHC 1QTMA 1VDHA 4PXEA 1J27A 1V3SA 4DSLA 4YY3J 3SYZA 3CCWA 1NUEA 3MGJA 1Q95G 2WONB 1OO0B 1REVB 2OPRB 3LP0A 2HK2A 3M9MB 1RWOB 3QFHA 1HBNB 3GJTB 4KYZA 3E01A 2YNHB 3FBCA 4XAKA 2KKHA 2YWWA 3FDSA 2MLXA 4GC6A 2LDYA 5EHHA 2VA3A 3GCWP 1PJ7A 2G2OA 2W9BA 4B02A 2RT3A 2KM8B 1YZ6A 3RU0A 2LA4A 2DNHA 2OAUA 3FVYA 4DR3J 1X60A 2W2QP 2G2ZA 3GIRA 3DOLA 3MHYA 1SXLA 2B9YA 1R8CA 2Y1JA 1KFDA 3BJYA 3IBCB 2CQ3A 1MNEA 1X0PA 3D1OA 4Q45A 5H9FK 4DZ6A 2Y0SD 4U7UD 1PILA 2BJ3A 3KHGA 3ITHA 1HWKA 4L3NA 5D4NA 2CQIA 3ISNC 3NKYA 1U4BA 4WKYA 3RW7A 4JI3J 3H5XA 4ICLB 4ZS6A 5DQHA 1UETA 4DZDA 2V4JA 3KG4A 3L95X 1YJWS 3IGVA 2RS8A 4K8RA 4KO0B 2D3OR 2YNFB 3PO4A 2VFTA 1UFLA 4I56A 2DH9A 2Q66A 2CPJA 3CCZA 1Q4RA 2V5HG 4FS1A 4B3OA 1AFIA 2Z56B 3HHLD 3FRZA 4DJBA 4ZPWR 3VZIA 4TU9A 4EBDA 3M8PA 1LKZA 2A2CA 1HQ2A 3NEKA 1ACMB 4PPZA 4IQXA 2DTJA 3OJUA 4L6V3 4FVCA 2KFNA 5C42A 1SL2A 5KFWA 3TR5A 1OWXA 1JJ4A 2C3YA 3AD8C 2O3DA 3HKZD 1R0BG 1S6QA 3IBWA 5GADI 4F8RA 3W3SA 4LSZB 1X9SA 1CJTA 1IR1A 4LVNP 4AQYJ 4OZJA 1ZAWA 3DMJA 3UPFA 5IC4B 2WW8A 2UVVA 4LQ3A 4YR3A 3I9V9 2CZ4A 3OFFA 2WOMB 2R7OA 1X4AA 4OYXA 1TL3A 4FKYA 1UVIA 1HMVA 4NXNJ 1DARA 1NO8A 1KHWA 4EGLA 5CYMB 5AE3A 4C7QA 1LWFA 2BMBA 4P75A 1YRXA 4OX6A 1SC4B 5THWA 1RHKB 4J9MA 4LR7A 3WBZA 3AOCA 2OD4A 5E2QA 1YRTA 1IBKF 1U8SA 5KFEA 2DNQA 1OQ3A 2P6TA 4RZRA 5KFLA 1FT8A 1BQMB 4U67Q 3CWJA 1T03A 2AYGA 1KN6A 2B43A 1VRQC 1WEXA 3GB0A 1HW9A 3LPEA 3KK3A 3EVWA 3AD9C 1GK8A 4DUYJ 2KJVA 2HHUA 2MZTA 1N0VC 5M2RA 3IRXB 4KHPF 1GMWA 4A47A 2AWZA 4Q43A 3UVJA 2FJEB 2V2ZA 2C2KB 3KJFB 4NLRA 4IFVA 1G1XA 4FNIA 5KG7A 2X1FA 2XCPA 3MECA 2QA1A 3MR3A 3W65A 1GFWB 4DSEA 4ECWA 5KFXA 4ED8A 4X4SA 3EVOA 2EWHA 3K8VA 4F4ZA 3W7BA 1UWAA 2CQBA 4FZVA 3A12A 4P9SA 2LMIA 3FNNA 4WKRA 3RRKA 1QE1B 1MW7A 2G1DA 3MM5A 1CEZA 3C19A 1CSJA 2AQ4A 4OV1A 1VQ8S 5DQIA 1Q82T 1RABB 1DRZA 3HFKA 3CDBA 2C2MB 4V19J 4I2QA 4ZITA 4ED5A 2XEXA 5E7OB 4OMFG 5L1IA 3VVUA 3EZOA 3ILOA 5FDLB 2HNYA 3JTPA 3OTEA 3N0VA 4ZPCA 1SH2A 4ZDNA 1HWUA 4ED4A 1DLOB 1HWJA 5CQGA 4MK7A 2DNYA 5ETQA 2RIJA 2YKPA 3MPYA 2ZUAA 4Q5VA 1UEKA 1IWAA 1B99A 2LQ8A 4B3SF 3A8EA 3I0RB 2UUBF 1YJVA 2AHOB 1FDNA 3O8WA 3GILA 3MAAA 2ACMA 2LXUA 1RZMA 1VQNS 1ITPA 1VR6A 5I3UA 2B4PA 1RBAA 1RBLA 4R5PA 4OZ2A 3CD6S 2FHJA 4TYBA 1KFSA 1RWUA 2AGPA 2ZNZA 2KYXA 4ZHRB 4GVLA 4Q7AA 2VUGA 3X1LB 2EKYA 1A6LA 2PN6A 3NAHA 2FGCA 4W98A 2DEJA 3KWMA 3J80U 2R9LA 2RQCA 2FLPA 4L74A 8AT1B 3MM6A 4P7TA 3BR8A 3MPWA 4X4OA 5F3ZA 3VHQA 3OSNA 1KOOA 2M2BA 1S1VB 4HDGA 5F8NA 2I2YA 1FXRA 3OPKA 3PJXA 2N3OA 5KFDA 3O5TB 3FBBA 1HYSA 3Q89A 5IC6B 1F5AA 1RT3B 1NU4A 3WQPA 2W4DA 1URRA 5F41A 4LUBA 2L9DA 4WU2A 3LH2S 1T3OA 2XI3A 1XIQA 3I5CA 3FZBA 4EZ6A 3FBFA 2N7YA 2MZ1A 4EMDA 1U0HA 4NXMF 4RNFA 2ZH4A 4YS2A 4LREA 4CDIA 3G6ES 2ATLA 1M5VC 5KFYA 3T1HF 5C7PA 3DCAA 2CQHA 4USWA 5L9XA 3N5FA 4YQWA 1WC0A 4WP9A 4QQBA 3M32A 3ZZOA 1HBUA 1RTJA 4C11B 2XMMA 2ZDPA 2V6AA 4M5IA 1IBLF 2YQ3A 4M8LA 3T1YF 1IBMJ 3EGVA 4OYMA 1FDBA 1RGVA 1PYTA 4QYRA 2AJQA 4NYZA 2C2RA 4C98A 5U47A 4WU3A 3BV8A 4K4UA 2M9KA 4PYDA 3CE8A 2ZM6F 1BC6A 3QFWA 3Q22A 4ZLLA 1YRUA 3IR7B 4IH5A 4OI3A 2XY7A 4QWAA 3K5NA 2MQLA 3DM2B 2MLYA 1NSKL 2X51A 1HLWA 1N56A 3JSBA 1RTHB 2B5JB 5CD4H 4K50A 1S1WB 2WB1D 2ZVIA 4B3TJ 4RWWA 4X65F 3BB5A 4CLTA 4JI2F 1CS4B 3OR1A 5JJBA 3MM9A 3TJ8A 2RUGA 3TA0A 1FJGF 1NPKA 3DU6A 1HHQA 5DQGA 3LP2B 2BANA 2Z4PA 1HNWF 4NLSA 3FMWA 2V63A 1LWXA 2CZVC 1LW2A 4NLTA 3G4SS 1SUQB 2BE2A 2ZITA 2R7TA 1SJQA 4QU7A 4ZN3A 3HD2A 2NYHA 3HJFA 1Q78A 2A10A 3FC9A 5KFIA 1B0TA 2V67A 5LSOA 3QGPA 4X4UA 1WHVA 3THVA 4MFBA 1CJKB 2NXEA 4PWWA 4LFBF 5C42B 2CJKA 1SC1B 3TZWA 2XO6A 2CQDA 3L4BC 1U8WA 3BS9A 2NYIA 4OV6A 3NNAA 1U2FA 3B54A 3MMAB 1HBMB 4DXLA 4MYTA 3BYRA 1UWBA 1Z4UA 3M8QA 3MM7A 3JAMY 2BQUA 2QLJB 5C2GA 3WZ0A 3B6BA 4O0NA 3WIVA 2HNDB 4WP3A 4LR8A 2APOA 4YDDB 4KE5A 2DHGA 1V5VA 3OFGA 4NZ6A 1S0MA 3AOBA 3FQLA 1BXNA 1HMVB 1B4SA 1F5CA 4U9RA 1UPMB 1TV6B 2HZAA 4J37A 2XS5A 3A13A 2HS4A 4OYWA 4RW9B 3GYNA 1LWFB 1K1QA 4QIFA 2V9WA 3RYLA 3ADAC 4KPCA 5J1PA 3O1LA 2IJFA 3ISND 4DFKA 2HVDA 1EARA 1BE4A 3BQ0A 3ONQA 3NNCA 4W92B 4Q0BA 1R27B 5JVHQ 3DOKA 3CCJS 2PIIA 2MKHA 1XJWB 4N77A 3GV7B 2YQ0A 1QAXA 1NH7A 3ET6A 5EWGA 4ZLJA 4NI2A 4NLQA 4TQSA 4FYVB 3H8YA 3HHNB 2W7PA 4NA1A 4ILMA 2UZAA 2NXUA 4N8NA 1VC0A 5F0WA 2B9WA 4IFVB 2FJBB 2ZH8A 3GJRB 3GYGA 1JLEA 3JQJA 3POTA 4EO8A 2J7WA 3K57A 4P10A 1PIEA 3BPDA 5T41A 2AJ2A 3WC2A 1U25A 4O3OA 2XY6A 2JWNA 3TEGA 2DJWA 3CCTA 4ID5A 3TAMA 3R1HA 5A8KB 1NEEA 1LXJA 1M1KT 2MQ8A 1NZAA 2EG1A 3MM5B 2NCKL 4LIRA 2ZWOA 3BZQA 2R7RA 2D74B 2MHNA 4K5SA 2E29A 1X8DA 1IXKA 4KV8A 5J2MB 2DXDA 3CT9A 3GG0A 5ETOA 1S9EA 2AV5A 3M8WA 3WX4A 3LALA 2W8KA 4DFJA 4ELVA 1RISA 2ZVSA 4TU7A 4M5DB 2ZD1B 4R8UA 1K1SA 1KBRA 2BJ7A 1WD6A 4R25A 1WOPA 1H7WA 4MH8A 4LF9F 4PUOB 2XLIA 2E44A 1OYDA 3VQTA 4OIXA 1N54B 2B8QA 2PMZD 4NCGA 3HJVA 1RTZA 3FCHA 2JVOA 5LXYA 1NPPA 5A8WA 3KUGA 2E1PA 2R7WA 4GKJF 3Q8QB 4DUTA 2JL9A 4OZ5A 1SKUB 3R27A 2DGSA
chains in the Genus database with same CATH topology
5KFJA 1SBRA 3THTA 2IAJB 4ZHRA 4IRDA 4M95A 1Y0HA 2ABYA 2MKSA 5FLXY 3DC2A 2PSZA 2OTJS 3NBPA 5MLCV 1MWYA 4K4VA 3CCSS 4QCLA 1Q8IA 1RT7B 3FRYA 5I3UB 2AYBA 1CLFA 2RKIA 2Q79A 4WTYA 2R8KA 2ZH2A 2HHXA 4R5PB 2JH3A 2KRBA 2KFYA 4WFBQ 4Q8FA 3MXHP 1CC7A 1VBZA 2D7SA 2YY3A 3PZPA 2MKKA 3EGNA 1X4DA 1S9GB 4ECRA 2JFKA 4H4KA 2PI4A 4ED6A 2W24A 2JJ4D 2PA8D 2XWXA 1OS5A 3MEEB 1HWIA 4GO7X 4OZ0A 4DUYF 4QPXA 2WBMA 3N6LA 4E98A 5J2QA 2XGPA 2J5AA 2HLUA 2UXDF 1FO1A 1WF0A 3QZ7A 2R2UA 2GIQA 5D4PA 4MAKA 2HWHA 3O2IA 3HHLC 1F2GA 4JBCA 1YJ9S 1H7XA 1S1VA 2W25A 4OI2A 4RWXA 3AAWB 4ZVFA 1YBAA 3K2YA 4TY8A 2R4FA 3CJKB 2MQQA 5CH7B 4BHQA 2BVZA 2EBEA 1CQNA 2JRSA 3OFHA 1YJUA 1RT2B 1JXLA 1M5HA 4ECQA 2IRXA 2FC8A 5J1EA 2EPIA 1C1CA 2IRUA 2LVWA 4O3NA 2N7CA 3N6NA 2PGCA 1GXTA 2XMVA 4DV4F 3DRSB 2DGVA 2J6UA 2ZHAA 2CPIA 2ZOGA 3BGFA 5A0YB 5HL7Q 1RT3A 1VRUB 3C6UB 1IKYB 3HK2A 4XDDA 5LJ5Y 2HMIA 2V8VA 3KLGA 2KB2A 1RP5A 2AJFE 1AFJA 1X4GA 1Z1ZA 1HBOA 4H4KC 2XMUA 1YJNS 2ASLA 3B4MA 2UV8A 1UEVA 4GO5X 4PXCA 3W2WB 1LOUA 2OPPB 4DR6F 4JI8F 5HROA 2F9JA 2VBYA 1C0TB 1UJ5A 2FHKA 2EFVA 3OHBA 1O8BA 1XMOF 3PFEA 2CPHA 1F60B 1REVA 1XR5A 5DDPC 5GADU 2M4MA 2LXFA 3HVTB 4X4RA 4FS2A 1SV5A 3M6VA 5DDQC 2JLEA 1NK4A 1T05B 3BGLA 4HLBA 4RX6A 2FJVA 4NLYA 2YNHA 4OQJA 4RBTA 4A8QA 2O67A 1LW0A 2FJAB 2J9DA 2ZJRQ 2ALZA 2GFFA 2Y1RI 3HHEA 5J2NB 3DYAA 2VPYB 3M2VB 2ZH3A 2AJ0A 3WDOA 3DI6A 3UD4P 2DO4A 4HKQA 1FVQA 5KFHA 2GHVC 2JC1A 5E3RA 4ZP9A 4DG1B 4JI0F 4NLGA 4WE1A 2VD3A 4CH1A 3BO2A 4ZVGA 4MIWA 4MYUA 1X4HA 4CZCA 4EYIB 2J8AA 2IA6A 1M5KC 2M5YA 3TA1A 1M5OC 2PI5A 4F4YA 3OHAA 3LP0B 1P1TA 2DCLA 2RNEA 2FLOA 1B64A 4C11A 1F5BA 4ELUA 2KFZA 1RYSA 4DL6A 4UY85 5KG1A 3E01B 2LXIA 1VMBA 3RAXA 4O3SA 4EBCA 3FZ2A 5KT3A 1GNKA 4CTAB 3Q8PB 2NREA 5CYQA 1GQEA 3K5MA 4DLGA 1MROA 3GMGA 5EX3A 2DHSA 2PD1A 3CC2S 5CZVA 2IFXA 4J9RA 3QJLA 1DZ5A 2VPWB 4NA2A 1GX5A 3VQSA 2YNIB 5D3GB 3D0IE 2F3JA 4IOBA 4WK1A 2RJZA 2W9BB 1X9WA 1TKDA 1FDAA 2U1AA 3GIMA 2F8MA 1XNQF 3BSCA 3KOAA 2ZH5A 2NZ4A 3X3UA 3I82A 5KFUA 3FSXA 1HWLA 3GV5B 1RTJB 2M88A 1FD2A 4X62F 2F40A 1BQNB 5I3QA 6FD1A 1E6VB 3G71S 3NMAA 3I5AA 3KLEB 3HPOA 3HVAA 3ZFVA 3DOLB 1IM4A 4CO1A 5T7LB 2ZHBA 2IMWP 4F26A 4X64F 3PXGa 3M2RA 5B09A 3PY8A 2OO4A 1NK0A 1J5EF 4YB1P 3CD7A 3QGHA 5HQ8A 1ROFA 2ZE2A 1KQKA 4OZLA 2PE8A 2AU0A 2MJUA 4DUZF 2PT0A 2ZBCA 3DM2A 3J7ZT 3M1VB 4DL2A 3HO1A 2F8EX 4DBQA 3H20A 4LJMA 1Q8BA 1UJ6A 1RTHA 1Q7YT 5HBMA 3SXLA 4K4TA 2VC0A 3MPVA 3QWUA 2NR0A 2B5JA 3B78A 1S10A 4F4XA 1K8AT 2QYCA 2LQ5A 3ITHB 5KTQA 2C3OA 1S1WA 2QZ8A 3MMCA 2XMJA 4ES2A 1O5JA 1FKPB 4O4GB 1J5OB 2VBXA 3TO8A 2CG4A 1JLBB 3EGZA 4DF8A 1KHVA 3KK2B 1U6BA 2E5IA 3F56A 3QLHB 5F8MA 3R5BA 1IKXB 2XNQA 1N0UA 5B0BA 4XPCA 5L1KA 1S1UA 4DSFA 4QR1A 2RU3A 4YB5A 5IZHA 2YWGA 1SKWA 2VG7A 3IAM9 4R0EA 2CPZA 3C66A 3HX9A 2V4JB 3LP2A 1FTRA 4UOCA 2VKZG 1FKAF 2E9TA 3MUMP 2DPIA 1B0PA 1NH8A 1SKSA 1Y4ZB 4PRFA 3S8SA 1XMQF 1KQSR 1YQHA 4DFPA 4NCBA 2OKQA 2IA0A 3FFIB 3OQ2A 2C22A 2DO0A 2OPQA 1N5VA 2A3JA 1FK9B 2MYFA 3H98A 2OIHA 1SUQA 2CJQA 1U47A 3J7YU 3MMBB 2MPUA 2RU9A 5EX0A 3JYTA 4F50A 4B3OB 1SIZA 1NK7A 4WYWA 3P49B 2MJNA 3MURP 5HLFA 3TVKA 4BS2A 2R2SA 1ZBTA 3N6MA 2CPEA 3OR1B 1KQFB 4A48A 5B0DA 6FDRA 2ERRA 3PW0A 2J9EA 3T6JA 3CJ5A 3U7JA 4ETZA 1KS2A 5D8HB 1IKWA 4DQPA 1HARA 3CSKA 3AJ2A 4H4MA 2Q6CA 2KVIA 1G6BA 2K3IA 4CO4A 3VWSA 1FRIA 4D3HA 1TVRB 2PFFB 1TKZB 4IH7A 4C3KA 1TAQA 2BANB 3BSNA 3M8PB 4OL8A 3KLHA 3IS9B 1MU2A 3OBIA 4QIWD 2J7KA 2G9OA 3S6EA 5L9NA 2FY1A 1KRPA 1FHTA 2WCXA 5CCMA 3HDSA 2LQJA 2AYEA 1LW2B 3I87A 2KT5A 5B0GA 1JWWA 3CCUS 3Q2SC 2FHMA 4K4ZA 5IM0B 2XC9A 2MSSA 1M5SA 2KI2A 2RB7A 2HWIA 3H59A 2HS0A 3D2WA 3BN4A 1KEKA 3OV7A 5J2PA 3I9ZA 2Z2LA 1TL4A 3N4WA 1VQ9S 3C6TA 1NHUA 2WBRA 4OJGA 2YH1A 1T7PA 1R7IA 2QA4S 1G2EA 2IVYA 3CCLS 4N56A 3HVWA 1SJFA 3Q0AA 4AXIA 1CQMA 1Q53A 3M8SA 1FESA 2GQCA 1XR6A 3H2LA 1QVGR 4C8NA 3MMAA 2I0XA 1HBMA 4PXBA 1S6QB 2ILYA 2UUTA 2RRAA 4D3GA 5KG3A 3OXFA 5F8JA 1V6HA 5KFQA 4Y28C 1U1PA 1JX4A 4KPYA 2GO9A 2AJ4A 3NGDA 1S4FA 1NNDA 2DGTA 2J7UA 3M6UA 3NCPA 1AXQA 5IQQA 2D1CA 4DQRA 1VQ4S 1S77D 1XR7A 2HGMA 3TNVA 4A8KA 4YR2A 4QWCA 1TK0A 2OH2A 1HNVA 1LFPA 3CDUA 3VCDA 2HNDA 2O66A 3BSOA 3CIZA 4I2PB 3IWNC 5KFFA 3QIDA 4C0BA 1KC8T 2RF2A 4CQ1A 1QSSA 5EN1A 3DMJB 1VBXA 2KT2A 1X4BA 1X9MA 1N88A 1N6QA 4TLQA 3JSRA 3QYYA 3ZC4A 1R8PA 5A2QY 2BA9A 2AX0A 3V6DA 2MQOA 2MHEA 2HWTA 3OTCA 4PXDA 1N5SA 1PGZA 1IN0A 2GCFA 1TV6A 4PQUA 1TL3B 2E7XA 2XWYA 4WFXA 3UW1A 4J9PA 4DSKA 3T5HA 2Z0GA 2VONA 2DHXA 3EXCX 2DNKA 2E9ZA 4G1QA 4DEZA 1TKTA 1R0AA 4RW9A 2C42A 1S6UA 2MQMA 3GE9A 4USIA 4A8XA 3I4PA 3R5CA 2V0NA 3KLIB 4KAIA 4LQ9A 4WFYA 2DR5A 4B9MA 3HF5A 5EUHA 5K8NA 3TUZC 4HH1A 2YKOA 1TR0A 2B6AB 2KN4A 2VBZA 4R0JA 2DCUB 1HD0A 1LWCB 1XK8A 3QIPB 3H5YA 4HEA9 4TU8A 3TA2A 1Q7LB 4O3QA 4WF9Q 1HHTP 3ZZZA 2ASJA 4B9TA 2LDIA 3RAMA 2CVEA 3IFEA 1JNZB 1SB6A 2IMOA 3JTNA 4A8MP 1FRJA 2XULA 1IBMF 2BRKA 2OSRA 4KFBB 5GAEI 1BGXT 3KK1A 2NPFA 1KONA 4L72B 3CGIA 5F9LA 3HM9A 3PW4A 4UW2A 4NLPA 2CPDA 1T03B 1N5YB 2DNMA 4NYOA 3PW5A 1C0UA 3ULHA 2K1RA 4ZOSA 2WTFA 3AQOA 1B0VA 1RT4B 3OVBA 4OHYA 3OUYB 2J0XA 5HMWA 3KK3B 5G0RB 1UA0A 1YG0A 1VGYA 4C8MA 1GH8A 4WK3A 3BR9A 2B7BB 2GJ2A 4ECTA 1WG5A 1GT8A 1HNZF 4ZVEA 3TOQA 5GMKa 1FA0A 2FVRA 1HD1A 2QO3A 1UFWA 1YJRA 1FXDA 5EGYA 3C2PA 3PEJA 5FD1A 2JHEA 3NG8A 3NWGA 2J6SA 5K8OA 4RNMA 4DR5F 3I4HX 4YB7A 4X4PA 5K8MA 4XDCA 4NCAA 2XBPA 5L39A 3QAEA 4RW8B 4PG5A 1N8RT 1RJJA 2HIQA 1CC8A 4FXVA 3IN5A 1D9DA 2VPZB 3J81Y 2UUAF 2YWFA 3IR6B 1VK3A 2G13A 1DTTA 4USHA 2X1GA 4RU9A 3H4BA 1WWHA 3MECB 1FCAA 1FRKA 4A8OA 1D8ZA 1S7HA 2JX2A 5KG6A 2V4QA 3DNCA 4A4JA 4LSNA 4J9NA 1H2UX 3DU5A 3L3CA 4B3TF 1HA1A 1VC6A 2UXCF 4IG0B 4IFYB 4ETXA 1KLMA 2KHDA 2QEXS 1QY7A 4UUXA 4BWMA 1L3VA 3F41A 4EEYA 1RAJA 2DNOA 4OHZA 1IJFB 1C4AA 5HMYA 3VAJA 2CRLA 2LLZA 1S9FA 2YWHA 1C2PA 2KRRA 4IKAA 1Y5IB 1TK5A 4ED1A 2IHR1 4RW6B 4KTQA 3MCSA 2MQNA 1SH0A 5FIIA 1ZAXA 2DR7A 3KFWX 2DGOA 2Y1IA 1SL1A 1VLYA 3K5LA 2OSQA 5HP1B 1RTIA 5A8KA 3KHLA 4PG8A 4WFAQ 5KG0A 3LUYA 1LK7A 3G6XA 2WHOA 2MDAA 4NLUA 1D3WA 1P9QC 4FP9A 1NAQA 2BRLA 1KVIA 4RW4B 2D9OA 1UW4A 3OR2B 2I5JB 2DNGA 3HZGA 3VAFA 2BW2A 1ZTWA 2AJ1A 1DBDA 5DO2A 3V4IB 3JSMB 2R2TA 3E51A 3CCES 1UJ4A 5J2MA 1FRLA 1Q86T 2R7SA 2PO4A 5ADZA 2CQ2A 4NLDA 1VQMS 1T8EA 2BJDA 2M7SA 4OJ3A 2FJXA 2XS7A 1S1TA 1N5QA 3MAQA 4AL7A 4ZK7M 1DURA 4DR1F 3D1HA 3MEDA 1SJ4P 3C46A 4EYHB 2ASDA 1TUVA 2ACYA 1VC5A 2HRUA 4KBIA 4J9OA 1NKEA 4MMOA 1HNXF 2E5GA 1VS3A 1WACA 2LEBA 2HZCA 2FGOA 4KB7A 3VTIA 4Q8EA 4WJBA 2UP1A 4C9DA 5E3CA 4A8WA 4M5DA 3IG1B 1Z2LA 2ZD1A 5IT0A 2HVZA 1TL1B 1RQ0A 2BV3A 2OMOA 2B3TB 3M4XA 1DLOA 3QWPA 1KQGB 1WTFA 3Q8RB 2CJ9A 2JDJA 4C8ZA 4I2QB 1RDRA 3OLBA 1S1XA 4KR0B 4DR2F 2GMLA 1NJYA 5E41A 4HH0A 1HQUA 2UV8G 2RSQA 3VF0B 5GAGI 3KJVA 3TARA 3FSYA 1E6YB 2FIUA 4O0IA 1JIHA 3OW2R 4PUOA 1FKOA 3TUIC 1FJCA 2CPFA 4Y2CA 3OSPA 2R7VA 4OLOA 3IXQA 4EUVA 3RRGA 3CF5Q 2YNGB 2LYVA 4F3OA 2HNYB 3D1QA 5AXLA 3MI7X 2DT9A 3OTDA 2MB0B 3BDPA 4DDFA 2COLA 4K59A 1Q81T 1V9OA 3I0SA 3TAPA 1I6JA 2X1BA 1S97A 2HQ3A 4ZA1A 4ZP8A 1XMBA 4K4XA 1NHVA 3BGRA 4TKTA 2M8DB 4C2MA 1U1KA 2JLGA 4NYPA 5B0EA 1FVSA 1JLCB 3D5MA 4TY9A 5F8HA 2KG0A 3ETOA 3GG1A 3SI8A 2GQ2A 2BACA 1S76D 3MWBA 2NS1B 3FJ2A 2CIMA 2E5LF 3AJ1A 3QJJA 3HLUA 1NRKA 1SH3A 4HI2A 5A6PA 5EDWA 2KYZA 3NS6A 3P5TL 4U7CA 1U09A 2IAJA 1R43A 5SUHA 4F25A 1U2RA 2C3MA 2AF6A 4ED0A 2G4BA 2ZJQQ 1JLAB 1Q1KA 1RT7A 2JZ5A 3UCZP 4ZKAA 2ZKUA 1X0FA 2V4RA 3MTJA 2VZ9A 1NB7A 3MM8B 2DRBA 1FD8A 1RT6A 5E5NA 5A8WB 2LQBA 1DFDA 4ZCMA 1Q79A 2L41A 3TYTA 3BDEA 5E3AA 5K8PA 1WHXA 4RW7B 1QVFR 3KNGA 2KZMA 3V2UC 1UKUA 2IM0A 2VOOA 1S9GA 4OZNA 5HI7A 3NNHA 1CVJA 4IO1A 1U1MA 2VODA 4C4WA 2HHTA 5D4OA 2V9KA 3MEEA 5BJRA 3B8HA 1XN9A 2NLWA 3HHLB 3SMZA 4J9KA 5I42B 5K14A 1XEZA 2ROEA 1NJWA 1YGYA 2RMLA 1NK5A 4NRTA 2IBOA 2HHPA 4AL5A 2MZSA 3GFZA 3IRWP 1KLNA 2PC6A 3GIIA 3NBPB 1XERA 3AQPA 4RBVA 2BM0A 2ZC4A 4BBYA 2BABA 3I5BA 1DJ0A 3EYZA 4C8LA 3CJKA 1VQPS 4IDKA 4DWIA 2QLWA 2J0QD 2PA3A 3V5RA 1M5PC 1Y5LB 2L9WA 3LWLA 2FC9A 4CIOA 2KHCA 4EBEA 1RT2A 1YI2S 4KRWA 2V2KA 3KG0A 3PHEA 4O4RA 4M1KA 2MSTA 4ATNA 1VQOS 4B17A 3RR7A 3SV4A 3DRSA 2B7CB 1V3RA 5KFPA 5A0YA 2IBKA 1TKXB 1VRUA 4O44B 1KSPA 3C6UA 1IKYA 1U24A 4I6YA 4TNOA 3CD5A 4MKBA 5JXSA 5F8GA 3CVKA 3MM6B 2MXYA 3TI0A 4DS4A 2P6SA 1MWZA 1VQ5S 3W2WA 4I69A 2DIVA 2DBBA 4I0WA 4MKAA 1WI8A 1MMLA 3FEYB 2OPPA 3LWMA 3TX8A 1S0NA 2JEJA 3A1YG 4FYDA 1APSA 2A18A 4ECZA 1JKHB 2FVPA 4DOZA 2LKZA 3E3XA 5KFGA 3I31A 3HVTA 5T14A 4ED2A 1Z2ZA 2HQIA 4CH7A 5GVQA 1T05A 2VOPA 3N01A 3R5DA 1N34F 3JTOA 3PX0A 1T02A 4TXSA 4WZQA 2HVHA 5J2NA 2VG5B 2XSJB 1WF1A 3M2VA 1TK8A 3N5BA 2VG6B 2XHWA 3VAGA 1ZYQA 1X5PA 2Q1LA 3MD1A 1IJEB 1U45A 1QTMA 1HYSB 1R8BA 3KLGB 4I6WA 3B4DA 4PXEA 1V3SA 2AD9A 4OZ1A 4DG1A 1ZH5A 4DSLA 1HBOB 2FTRA 4RUCA 4DQSA 2G0CA 2YVSA 3OL8A 3SYZA 3SQGB 2I9SA 3CCWA 2VFUA 3UDCA 4BWJA 1KOHA 3MDFA 1Y9OA