3O2IA

The crystal structure of a functionally unknown protein from leptospirillum sp. group ii uba
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
93
structure length
93
Chain Sequence
DMHIYELVSRDRTHPVRIYLLHSEYWTEDEFYNLLLEAFQRSSASDWHLQILEVSKYLVTAHGFVEAGGLQEIGFPGELSKTEVRRRINAFLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title The crystal structure of a functionally unknown protein from Leptospirillum sp. Group II UBA
rcsb
source organism Leptospirillum rubarum
molecule tags Structural genomics, unknown function
total genus 26
structure length 93
sequence length 93
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3o2iA00
3O2IA
chains in the Genus database with same CATH superfamily
3O3LA 3VAJA 1C0TA 1SXLA 1UJ6A 1HNVA 3ENAA 2E1PA 2HIYA 2MKJA 5ETOA 3US5A 2QYGA 1NDLA 5K8PA 5DDRC 5JVHQ 3QT8A 2HEKA 4OYMA 1JIHA 5CABA 1LWFB 4KGVB 4R8UA 2APOA 2C2NA 4GVBA 4MKYA 1TP7A 2KXNB 4LF9F 3V81A 4X4NA 2XCPA 2OIHA 4BBYA 1HBUA 2O01C 2XG8A 5IS2A 3MM9A 4BS2A 3DRRB 1NJXA 4KR0B 4ECQA 1JKHA 2J9CA 1VBZA 5H9EK 4ZA1A 2QJ3A 1XMBA 4X4UA 1I3OB 2RD5C 4ZVPB 3QRQA 4LT6A 5FD1A 2H5JB 2N3OA 3I5BA 3QIPA 1G4CA 2IRYA 3DI6A 5HLFA 1OIAA 4F26A 1ZPVA 3T5LA 1REGX 1SKUB 1YBAA 5IFMA 3O5TB 3QJPA 4EMDA 2XGPA 4QU6A 2MZSA 4ED3A 3BR8A 1SPBP 3N01A 2HNZA 1RTZA 3POTB 4IO9Q 2GVDA 3BYRA 4EK2A 5K20B 4EBDA 2CJXB 4F3QA 4BHQA 1NK5A 4AD6A 1G3OA 3BKFA 1SH2A 3ILOA 1TL1B 3OW2R 1EP4B 4P71A 5HJYA 4JI8J 4KE5A 3CJKB 3Q22A 3M9NB 1HHTP 3WC2A 3T1AA 2R8KA 3MECA 5E5NA 3MF5A 3MMAA 3NOGA 3RW7A 4C8LA 5SZTA 2B9XA 3CC7S 4LFAF 3C16B 4XTTA 1MU2A 4X4RA 2HVZA 4CI0B 2Q66A 1JLQA 3UDCA 2BJ1A 2NUHA 4M5IA 3S1TA 4DLGA 1WC0A 3T1YJ 1WELA 2J7WA 3I4HX 3EXYA 5B7WA 2W2MP 1V3SA 4X4PA 2XSFA 2ZH7A 2BUNA 3R5CA 3J81j 3J7ZT 1PCAA 4F4AA 2OAUA 1RT6B 2WVCA 2ZC4A 1U0SA 2HQCA 3M4XA 3V6DB 3H20A 2ZNYA 5F3TA 5L46A 1GXUA 2GX8A 3RR7A 4TU9A 3JAMY 4E8UA 4U8YA 3K58A 5LSOA 1FWKA 4FZVA 2EFQA 4LMZA 4B9SA 3MEGB 2RAQA 2HMIA 4JB8B 1O51A 1DTTA 2C3UA 5B0GA 3K5MA 4Y3CA 2GNKA 3ADAC 1NPPA 2XQCA 2YQ0A 5HQMA 2E5LJ 2OGUA 2FHKA 2QL7B 3AQOA 4Q7AA 3GMGA 1WTFA 3UD5A 2QEXS 4WBFA 5HVHA 4M95A 3VAKA 3LPYA 3M32B 1OJ4A 2AYGA 2J9DA 1VJWA 1NK7A 2CJYB 4DZDA 3DM2B 4ZP6A 2AHOB 3CCLS 4L72B 2OMLA 3T6JA 2GZOA 2YNGB 3KJVA 1NZAA 4ZOSA 4CLTA 3R3TA 4CT8A 2HG4A 2N7YA 2QMXA 3CDEA 5ETKA 2DXEA 1VBYA 1Q81T 3JSMA 4OI4A 1TKTA 1EAYC 2DRDA 3KMQA 2LCWA 5D0EA 4C8NA 3M6UA 4OJHA 1F5CA 2MZQA 4WU2A 3PHTA 4FYXB 2CQ0A 1JXVA 1KP6A 5D6GA 1KLMB 3UN5A 2WRMA 4KGKA 1RT7B 1GMUA 1LNQA 2UXCF 1S1TB 3MZIA 1S97A 3GILA 3SV4A 3DYAB 2R2SA 3D66A 5F8JA 2QX0A 2HNDB 2OFHX 4NI2B 2J7KA 1TMMA 1AB8A 4NCBA 1GFWB 3VTIA 3MAAB 4J9VA 4J9UE 3IA0A 3W62A 3GPAA 1REVA 4ZPDA 3TWZA 3PW5A 1AFIA 1PKUA 3Q89A 3KLVA 2F8EX 3ICLA 4DV6F 2E1AA 3JTNA 1KC8T 1Y3JA 4OZ5A 4DR7F 2XMUA 2W7OA 1UL3A 3JYTA 3CD6S 4P2XA 4HT5A 2YX4A 1I94J 4RO0A 1HI8A 2RUSA 9ATCB 1ZBTA 1L3VA 3NBPA 1F60B 1UA1A 3W2WA 4DV5F 1VC6A 2UU9F 1HQEA 4IRCA 2ZBRA 3C3LA 4XDDA 3QGHA 4DX8H 2BJ3A 2KTQA 2FGOA 3G6YA 4RNOA 3I55S 4X2BA 2PC6A 5I3PA 1EKRA 1B3TA 1RP5A 1HBNB 5DQGA 2LP4A 3PY8A 2VDIA 2FJXA 1XNQF 1WC1A 2RRNA 2U1AA 2HHWA 3NL0A 4QWEA 3P5TL 1HQUA 4O44B 5A76A 2FHJA 4MAKA 5A6WA 4EYHB 3U02A 4KH0B 3GYNA 3LA0A 1I5OB 5DG7A 2M3DA 3LP1B 1T05A 3QJJA 3TAMA 4CP5A 1NDPA 2FJVA 3WX8A 2GMHA 2QLJB 4RW8A 4DUYJ 2HFUA 5F41A 4DCOB 1IVZA 3C6UA 4B9MA 3I9V9 3G9CA 1B7YB 3HVTB 4JV5J 4DV7J 2G2YA 1LEOA 2YKPA 4PG5A 2BX6A 3J81Y 1WDTA 3FC9A 1NB2A 5KFLA 3NWGA 4DEZA 4USIA 1D9AA 3L4BC 1RT2A 1YZ7A 2CFXA 2KU7A 5FDLB 4O0NA 4DR5J 1KQFB 1T03B 4ZVOB 2JX2A 1Y5NB 2D9OA 2W9BB 1WD6A 2YNIB 3BKUA 1S12A 3DOLA 2KG1A 2B6AB 1N4LA 1UVNA 1NZ8A 1VI7A 3TOQA 3V6JA 2GO9A 3MTKA 5KT4A 3LANA 2KT2A 4C11B 1C4CA 3CDAA 5HO4A 3PR5B 2DEJA 4DQIA 4LF8F 3VGTA 1NK6A 3VVUA 2XZTB 4NMLA 4ZPWR 3HP6A 3NGDA 2YNHA 3RG6A 3TJAA 1FE4A 4HI1A 2Y8YA 2MGZA 1ZAXA 2FPHX 1VBKA 3SQGB 3OFEA 4NLDA 2Y1IA 3CMAS 4OHXA 2M8HA 3FQKA 2HQGA 3HFVA 1NSPA 1PYSB 3OUYA 2KYXA 5CHCB 1ACMB 1RKJA 2IJRA 4DQSA 1PAUB 2ZUAA 1KFSA 5KT5A 2GGPA 3VV2B 4WYLA 1TL3A 4NLYA 2VKZG 2D1CA 1PG5B 5A2QU 2JEJA 2BJ8A 2YNFB 2OH2A 3KTQA 1QAXA 1Q82T 2BKPA 5F8LA 1UEVA 2XSJA 4LF7F 2AYBA 4QZVB 5IV4A 3GR1A 3ITHA 1D09B 1T9XA 4DS4A 2N4DA 3ET6A 1SJFA 4L76A 4RWWA 5DM7Q 1UW4A 3IR5B 3AD9C 4DQRA 3CD5A 4UTGA 1L3TA 2FVQA 2DNNA 5GAHU 3UWTA 1F0XA 1UP1A 1WG5A 5ETTA 2H51B 4PG6A 1CQNA 4NZ6A 1JLBA 2I0XA 3MR2A 3PX4A 1YLXA 4WXWA 4X4SA 4RL1A 1SC1B 2CPXA 2ATCB 3Q8UA 4MIBA 5J2MB 5GAEU 3I9ZA 2WTFA 1BE4A 3H59A 4NX9A 2IDLA 2VG6B 3RBXA 4OYXA 2DGTA 2HS4A 2I1RA 4ID8A 4YEAA 1U1OA 2HHHJ 4L3KA 3SCKE 5KFYA 3BGRB 2ZH4A 4PQUB 5KAKA 2G0CA 3KG4A 5HMXA 1VQ7S 5A6PA 2OTLS 3OL9A 3FRYA 4K5RA 3ZTPA 1FRHA 3FKBA 2B9YA 2M52A 1DZ5A 4J37A 1OO0B 1OYEA 4YHHJ 3WDOA 2VG5A 2IJNA 2BANB 3CULA 3QRRA 3GR0A 3Q2SC 3RUBL 4IQMA 2JOQA 2EK1A 1N8RT 4M1KA 2NS1B 3DRPB 2OKQA 3RU0A 5K8MA 2AP6A 2DK2A 2R7VA 4USWA 2LQBA 3ILJA 3C6TA 4OV1A 4JI3J 2BM0A 3QO9B 4NLSA 4NWBA 2C3MA 4K4TA 3G4SS 1FKOB 2I5JB 1FTCA 2YY3A 1ZTWA 2B4PA 2HBYB 1UVMA 2HQIA 2K06A 3TO8A 1MMLA 2HGNA 3N4WA 4C6AA 1YITS 4JI8F 1HR0J 2ZD1B 4JI4J 3SCIE 1RQ0A 1IQZA 3MEDA 1NJWA 4A8QA 4RNFA 3W9IA 3BPDA 2CQIA 2FQQB 3AAWB 1SVDA 3NCQA 2CJAA 4RPFA 4ZP7A 4N5SA 3KLEA 4ED4A 2EG1A 4YDDB 4W90B 3QGGA 4TYBA 5EDWA 1KONA 2V2KA 2HBRB 3HSJA 3TZWA 2C2OB 4J9OA 5LMUJ 4DFPA 4BC7A 4C0OC 3T1YF 2JJ4D 2HVDA 5GADI 2UVRA 1VRTA 1F9FA 1E6VA 1NKEA 4X62J 2I6WA 3DU5A 2P6TA 3NNCA 3CJ3A 3NP5A 3PRVA 3NKYA 3Q2TC 5KFRA 2N7CA 3T1HJ 4C8OA 3DLEB 1OQ3A 4M5LA 1HNWJ 2J76E 4RW7B 3X1LB 4I7FB 2K1RA 1R8CA 4B9TA 3AH6A 2OPPB 2CA9A 4Y2AA 2BM1A 3SCLE 1MWQA 4IFYB 2B7BB 3C14B 5T7LA 4LFCJ 4DF4A 2XI3A 5LT5A 3CB4A 5AXMA 3DU6A 1LW0A 1RXOB 3PKYA 2RE1A 1XNRJ 2D3UA 2QLFB 1U6BA 5BJRA 2JZ5A 3KK1A 5GVQA 4Y2KA 1OSDA 4L75A 1U8SA 3O6QA 4HTJA 4CO1A 2KFNA 4DG1B 3VAIA 1VQNS 5J2PB 3HMJG 3AXMA 3DOMB 1RT1A 1M5HA 2VG7A 2QZ8A 1JLCB 4ICLA 1T9YA 2C2MB 4KV8B 2CQ3A 2YQ3A 5KG7A 2IMOA 2DGXA 3UI3A 4HHJA 2IBOA 2W9CB 1BD6A 2UVUA 2UV8G 4F50A 3IWLA 4WE1A 3U1MA 2E9RX 1CJUB 2A1BA 2CPFA 4AXIA 4LSZB 2BBEA 2J9DE 1ZM2A 3OTOJ 1DJ0A 4WXOA 4ZN3A 5M2RA 3M6VA 4QWAA 2MQNA 2ZH1A 5JVGQ 1NSQA 5DJBA 3MR6A 4DFJA 1M5KC 3THTA 3VAHA 3F0NA 2ZH9A 3CO9A 3A4TA 2IBKA 1JJ2R 2BKOA 1J2VA 3QRPA 3THPA 3I82A 2NXUA 1UPPA 2M88A 1WC6A 3IS9B 2WVFA 4OLPA 1MNEA 4ZHRA 2IVMA 2BJ7A 1FDNA 5HJXA 4XIUA 2ZDPA 2QGFB 3CNQP 4WFXA 2MSTA 3W61A 1I94F 1IM6A 2J6TA 1NHVA 2RKIA 4ED2A 5HMWA 4ANDA 1U25A 1YHQS 2FZCB 4O3OA 4CLSA 4IG0B 4PEOA 4WTOB 3HPOA 2H4YB 2IIHA 5IT9Y 1RYSA 5D3GA 4YR3A 4OJGA 3TX8A 2G0JA 4OHYA 3AT1B 3HXMA 1VQPS 1OYDA 5A0YA 5K9FA 1VIXA 4KFBB 2AX1A 4WP3A 3C15B 4DSKA 4N41A 1CULB 1B99A 1S1UA 4FKXA 1WORA 2UUBJ 3TVKA 2LXUA 2KZZA 1NM2A 3IXQA 3LWLA 4QPTA 3D7SB 4DUYF 3G8TA 1JLAA 4Y0FA 1IKVB 3ZXWA 1U6FA 1VQ9S 4K4SA 4DV7F 4LRFA 4LSNB 4RW9A 1VFJA 5HQ8A 4PG8A 2A0FB 3JQMA 4D3GA 1CJKB 2XMJA 2CADA 1VQMS 3DLHA 4XDCA 3UD3P 3OTBA 2KG0A 3CE8A 4WFAQ 2C3YA 2R7QA 4ES1A 1IQTA 1XERA 4DSLA 4LBPA 3MI7X 4DR5F 2NREA 3FGVA 5HMYA 4I2PB 5KG0A 3HHLD 1VK3A 4FNHA 1P9QC 5CQGA 1G7CB 2DPJA 4XPEA 2OUGA 2CQ1A 2GJIA 1RAFB 3TUPA 2UVVA 4X4TA 4ECSA 3MCNA 2H5IB 3PW4A 4OL8A 1S6PA 4ZVUB 2H54B 4R0EA 2MTLA 2BABA 4RJVA 1UFKA 2DNRA 3SSQA 5F8IA 1S9EB 4ECRA 2BE2A 3D68A 4HDHA 4FBTA 2ILZA 2LQ8A 2CWKA 3BBCA 1TL4A 2K2PA 2ZE2A 2HNYB 1RTJA 3SIPB 4F0MA 1N32J 1Q8KA 5I42A 2C1EB 4I2QB 4FP9A 4RW4B 1LWCB 1WOSA 1RSCA 4NLRA 2X51A 2J0SD 3VALA 4HYKA 4QIVA 3V5RA 2E66A 3ENQA 1XC9A 2VONA 3K89A 3W2VA 4I69A 4TQRA 5B0EA 3BGUA 3KHLA 4K8RA 4QCLA 5HI7A 4PABA 3FJ2A 3ZFVA 3FBEA 3R1LA 1FRIA 3PFEA 4O4GB 2ZZMA 3PJ9A 5F3ZA 2ALYB 5CYMB 3CIZA 1B0PA 4WYWA 2JC0A 3CIMA 1R43A 1IR1A 1N0VC 4NZ0A 3R7NB 1C1CB 4DPYA 3I96A 2CZVC 2CYYA 4ALZA 1WC3A 1LWEA 1U0HB 3S01A 2MMYA 2NZ4A 2ZVSA 3MPVA 2DBBA 4WPAA 3OPKA 3M05A 4B3MJ 2W7PA 2XLJA 4ZN1A 2HFVA 2CJQA 4OZ3A 4IDKB 2XY6A 2BDPA 2V8HA 1NRKA 1SL2A 3WC0A 2OSRA 2Z56B 3G82A 3KLFB 4HT7A 3P4UB 1VHFA 3R1HA 3BS9A 4FPIA 2C3PA 6AT1B 4FYWB 4PXCA 4LF1A 4CTAA 4K50A 5AT1B 2LFVA 4B3TJ 3M9OB 3Q8QB 2DH8A 2WBRA 1Y00A 2HHHF 2HKEA 1S0NA 3QGIA 2VFUA 4FPRA 3IWNC 3BDEA 4ILLA 2M0GB 3X3UA 3CJSA 3ZTRA 4CLWA 2ZH6A 2MZ1A 3PVXA 4YOEA 1HWLA 2FJBB 1XR6A 2JWNA 5K14B 3AQPA 1KTQA 1BWVA 5D0GA 5AE1A 2VJUA 1VQLS 4ZVQB 2A3JA 4NLPA 1ZZFA 2IM3A 2D3O1 2V8GA 3PEHA 5L1IA 2YKQA 2XS7A 1RTDB 2BOAA 4OFZA 3CDWA 2CWXA 4NPOA 5C5JA 3HKWA 1EETB 3PO4A 1M5PC 1NDCA 2Z2ZA 3M2UA 4PUOA 3BSCA 3MM7A 1PJ5A 2YWGA 1S57A 2FC9A 4TVAB 5LXYA 4Y2MA 4P2SA 1RI7A 1HA1A 3BN4A 4K4ZA 2RDIA 4JI4F 3P3DA 1AZSA 3GSIA 3I0SA 1DTQB 3F41A 3GFXA 4F0HA 4RBVA 3FFIB 5F8NA 5HROB 2QE5A 4UUWA 4C3LA 1SL1A 2VPXB 1ZM9A 3WBZA 4A8MP 1QSYA 3RB0A 1T9VA 7FD1A 4L74A 1NK8A 2V4RA 4F3MA 2B9WA 3I5AA 2PMHA 2ZFHA 1TKZB 5LMUF 4Q43A 2GA7A 2DVIA 5B09A 2CG8A 3C8YA 4RUCA 4Z7YA 1Q8IA 4X62F 2HQDA 1HMVA 1K44A 1YJ7A 2OFGX 3BO4A 2AX0A 2PIIA 3A8JA 3CJQA 2D3OR 2YH1A 1FRKA 1HNWF 3C2PA 2NXJA 4DLEA 3H7HB 2DR5A 1M5SA 4CT9A 5CYQB 2LXIA 2CNNB 1UJ4A 1U49A 2V9WA 3DMJA 1CEZA 4LFCF 3MXHP 1U1KA 3NMRA 4OIXA 2R3VA 3HHEA 1S9GB 2OEMA 4WWSA 3OHBA 3SDEA 4AL5A 3BGOP 1LKZA 2KJWA 1XNRF 1S6QB 4FN5A 4IH5A 4QJVA 1BQXA 3BO3A 4DR1J 4OMFG 2W25A 2CKWA 5CZVA 5GMEA 2MQLA 1DQAA 3GJQB 3GG1A 1J5EJ 4CIOA 4KPYA 4ID5A 1YSJA 3D3CJ 4OQJA 4ECTA 1FRJA 4MIWA 1X5PA 4CQ1A 1AUDA 1RZMA 2W2NP 3MR5A 3TUJC 4WK3A 3MMBA 2NCKL 2NZCA 2NXCA 5M2PA 4QOTA 4DR3F 5KG1A 2F7VA 2A18A 5KTQA 1OMSA 1X4GA 2VODA 4X65J 5C42B 2ZM6J 1RWNB 4HI2A 1FJCA 3GTYX 3TANA 1ROFA 2RT3A 4MYUA 1YQHA 1VLYA 3BQ1A 4FS2A 3V6HA 5LXRA 4GVLA 3G8SA 2VQFJ 1VQ5S 5AXNA 3T9NA 3OTOF 1N6QB 4N56A 4OI1A 2HRTA 3PYFA 5DLFA 5CCMA 5L38A 2M5YA 5LJ3Y 5KFNA 1X8DA 2XY5A 3GJSB 4A8YA 4USMA 3LP2B 4A8KA 1JLEA 2HGMA 2AW0A 4EFAC 5DRKA 2AWZA 4YUDA 3M7VA 3R7BB 4A8WA 1KR4A 4YR2A 4KY3A 3OSNA 4QIGA 1HD1A 2V4JA 1FFWB 1UJ5A 1PJ7A 2GHPA 1VBXA 5FLXY 1HQ2A 2WZ1A 1YWXA 1WUUA 1YKWA 5A8RA 1IBCB 2M2BA 1X31C 1RABB 4C8ZA 2V94A 5SUHA 4JUZA 3DDKA 1RLCL 2UUWA 3BR9A 5HP1A 4U7UD 3T5JA 1SKWA 1LWXA 2KRRA 3CCRS 3DFEA 4RUBA 3KK2A 3Q24A 4H4MB 3LOUA 4E2FB 5C2GA 4ZDNA 2EFOA 4ZPTR 4N8OA 3TP2A 2I38A 2UUBF 4MH8A 2FGCA 2EBGA 4CCHA 3R5DA 5GAHI 4G3IA 2NXNA 1LW2B 1JQGA 1L3UA 1NJYA 3A3OB 2DNMA 1FD2A 3IFEA 2GVZA 2BACA 4P10A 4FF3A 1RT4B 1KOOA 1S99A 2YKMA 2I9SA 3L7OA 3CEDA 1Y10A 2W2PP 1PJ6A 2V50A 3N5FA 1FNXH 2MKYA 5GAEI 3M1VB 1QVGR 1RYRA 2G2OA 4P52A 1VQKS 1S59A 4FVMA 4DL7A 3R2CJ 3KLHB 2DT9A 1VRUA 3QGPA 1JLFB 3OXGA 3NOCA 1NKBA 3TEGA 3BJYA 1EKSA 3BO2A 4G6VB 4ECVA 2YPZA 2B8PA 3BQ0A 2Z0GA 5E2QA 4KHMA 4WTYA 4AQYJ 1VRQC 3JTPA 5GAGU 4FF2A 4CDIA 3K59A 4DZ6A 4B3RJ 3OV7A 2N82B 2FB0A 3HF5A 2P9GA 2RVJA 1N32F 2CQ2A 1RHKB 1UEUA 3ZTQA 2JEIA 4RUHA 2DHXA 4ECUA 1RTIB 3TZXA 5CCLA 3G6XA 1RT3B 2DGSA 2HWTA 3F44A 2RU3A 1GMWA 4TLQA 4IR9A 2JEGA 3BN7A 3Q8SB 5L1JA 1HW9A 2B56A 3GV8B 2QA4G 3MM6A 3N0VA 1NKCA 1R6VA 3NRBA 1PC5A 5ADZA 4ITSA 5E33A 1KQSR 3HDSA 3R5BA 2CG4A 1Y3KA 4YB1P 1T9WA 3NCPA 3IAS9 1F2GA 3TVYA 2W8LA 1DHMA 2DHAA 5KT2A 5LJ5Y 1XMOJ 2HAIA 3HD2A 2P6SA 1SC4B 1PC4A 3N5BA 1VISA 2ERRA 5EWEA 1I51B 1Y7PA 3QQCD 2GHVC 2FZKB 1YRTA 4ZPAA 4KYZA 5U47A 2LYVA 3HHLA 4YN3B 3EDRB 1N0UA 1WDDA 4B3MF 4F3OA 2VOOA 1B7FA 1Q5VA 1HBMB 3SBMA 4G1QB 3T19A 4JBCA 5J1PA 2GC8A 3TJ9A 2ZOGA 2SXLA 3OTCA 2HSEB 3RB6A 2FY8A 1AYEA 2DRAA 4CO4A 4WKRA 3PIPQ 3D28A 3EVWA 1DFDA 1YJ9S 3UR3C 4WP8A 2CQHA 4G1PA 5KG5A 4URGA 4B3TF 3Q8VA 1VK8A 3RBZA 2GQ2A 1PBAA 1RE1B 1QAYA 5DM6Q 4OI3A 3OVBA 4LF6J 1X4DA 4FXWA 4DUZJ 1CC7A 3K8WA 2CQBA 4QIWD 3B4DA 1HFEL 1AW0A 3ZZYA 4I4BA 1Q78A 2AF6A 2YWWA 3GIIA 1X0FA 4RNMA 5HANA 4TNOA 4NE9C 2IPOB 2KJVA 2AJ4A 1YGYA 4YB7A 5E3AA 4EEYA 4PQAA 4NCGB 1R0AB 3KMSA 3BPSP 3QLHA 5CYJA 1RB0A 3L9ZA 2RDJA 2KVQE 1PAEX 1RLDA 3M30B 2CJBA 4JI5J 1DQ9A 4V19J 2CPYA 2HBQB 3HHDA 1J5OA 4PZVA 3CCJS 1HIYA 2MHNA 4JI2J 1HYSA 3HT0A 1EJ7L 1UVJA 5L39A 4JI0J 1FWPA 1X4BA 2YWKA 3CC2S 5B0FA 4MTPA 1PYTA 4ELTA 1XR5A 2XO6A 4Y00A 1QAIA 2H4WB 2QL5B 1WF1A 4BC9A 1RWXB 3RYLA 4J5OA 4NASA 2LDYA 1FFGB 4ERDA 1RT5A 1PYOB 1YG0A 4J9NA 2JH3A 1O8BA 1TZ0A 3NGSA 4ED5A 4Z2XA 2JL9A 2QL9B 4ZCIA 2B9EA 1RDRA 3IBCB 4LIRA 4A4JA 1IBMF 4HH1A 1S1WB 3OL8A 5BR8F 1H74A 1FESA 1H38A 1FDAA 1ULRA 4USTA 1SIWB 1VJQA 3H40A 2LVWA 4P75A 1IKXA 4YB6A 4F4YA 4ATNA 3MD3A 2VC0A 3NS5A 2BOPA 4PPDA 1C1BA 1CJTB 5L1KA 3V4IA 2OPRA 3EUNA 4MFBB 2IC3A 1S79A 3H42A 5JXSA 2LQJA 1JLGA 2K8GA 2F1FA 2DB1A 1X4FA 3M8QB 1KKHA 3UCUP 1MLAA 3PW7A 5JUMA 2ZHBA 1B70B 3MMCA 3M8WA 1FFSB 2CIMA 3MDFA 1NPRA 2GIFA 2B4OA 1ZA1B 4DR1F 1TAUA 2VFTA 3H2VE 1J5EF 2J0WA 5KG6A 1BLUA 2XTJP 2Y3YA 3MGJA 2R9LA 1ELOA 1NH8A 2NUUG 4D3HA 4ZKAA 2PN6A 1BY9A 2MXYA 4JV2A 2CUYA 2AEJA 2YBVA 3VGUA 3GIRA 5L1LA 3AY0A 3AJDA 3PJWA 4UW2A 1NHUA 1N5TA 3R97A 2UUAJ 2H65B 2CVEA 2W2OP 4FF1A 1EARA 1H0HB 2PA8D 3I4PA 3M8PA 4RU9A 1W26A 1FNMA 4X65F 1IKWB 2ZM6F 3IG1A 3MUTP 2OEKA 2POKA 3ILLA 2MSSA 4LR7A 5KFQA 2EPIA 2YKNA 5K5MA 1HWIA 3M2VB 3CJ4A 2VICA 2VQFF 5E3CA 4MT1A 2VQEJ 4LR8A 4K4UA 1CC8A 3UVJB 3GLJA 4DV4J 4I67A 2R8HA 4LSLA 1CBKA 4OX7A 2V9KA 2FUG9 2DGUA 3GFZA 4EWTA 1XMQF 4L73A 1AA1B 2GQQA 2GQCA 3CSKA 1QSSA 1X9WA 1T8EA 4F2SA 4P2FA 2MZTA 2R7WA 2QA2A 3GFHA 3OFGA 4Y65A 4RKUC 4UOGA 3PYEA 2OPQA 1CPZA 4X66J 5E41A 3T5KA 2I2YA 1S1XB 3NS6A 3J7A1 1U1MA 3JSBA 2BYCA 2YH0A 4HL9A 1GXTA 5A8WA 3PYGA 4M5DA 1URRA 4C97A 4DV2F 3MPUB 1HWJA 3Q83A 4RNNA 2D69A 3DLGB 1IJFB 4P7VA 2C2EA 1X7VA 2WCXA 4MIAA 1M1KT 2DNGA 2AEMA 5JJBA 4F4KA 3QT6A 1HNIA 2P9CA 3MOZA 1C2PA 3NLCA 1SJ1A 2OLWA 5L8RC 2LQ9A 3I6PA 4OZLA 2B5JB 3PW0A 3GFYA 2DIVA 1MWYA 3KUHA 2LU1A 1UWAA 3W9JA 2ZBQA 3C19A 2Y1RI 2Z4PA 3B8HA 1P27B 2OPSB 2HIQA 4UT4A 3VQTA 4BLGA 1H98A 2E7WA 5J2NB 3AHPA 4WIIA 1DLOB 3OL6A 1Z2ZA 2EBEA 4NOHA 1FKAF 2JLEA 2PI4A 1VC5A 1Q79A 2JVRA 4ZMMA 2DH7A 4GC6A 2CXEA 2IRXA 3MPYA 1S7HA 4PR6A 2X3DA 1WEZA 1PO6A 4JV0A 3D4JA 3I87A 2A2DA 1LWFA 2GMLA 2RQKA 3QBCA 2V5HG 1UZHA 2CRLA 4K4VA 4KPCA 3M8YA 2VV5A 1YRXA 4KC5A 1D9FA 2EKNA 4HACB 2V6AA 2NYIA 5J1EB 1RWPB 3GWCA 4X84A 1OY9A 2ZNZA 2FLOA 4OX9J 1BWEA 3NAHA 3NAIA 2O3DA 3DRRA 1WOOA 4RX6A 2H3EB 4P6QA 5KFOA 1FJEB 3PXGa 1HPZB 3GE9A 4B3RF 4Y34A 3W3SA 5HL7Q 2DR8A 3GIMA 1N5QA 2BE9B 2DHHA 4X64J 3FDSA 2XMMA 3C46A 4ZVEA 2CPHA 4DPWA 3KUGA 4ZS6A 1YJTA 4JP8A 1ZETA 5KG2A 5A2QY 4R0JA 4B9NA 1MG7A 1N5YB 1W2IA 2KI2A 3GG0A 4N76A 3NCRA 3A12A 4NYPA 3OFHA 1QTMA 1JK9B 3POTA 3K8VA 1TVRB 5AE2A 3GIJA 4DR4J 4I0WA 4NRTA 2XCAA 1EQMA 5HVGA 3FEYB 1TL1A 3IGNA 1EP4A 3LPEA 3QYYA 1XMOF 3W7BA 4DSFA 3CJKA 1FK9B 1SJ4P 4RZRA 4FXVA 4C8YA 2JC1A 2XS5A 4RBTA 1BC6A 5KFPA 2AZ1A 3C16A 4R25A 2XMTA 3IN5A 2YKOA 3AODA 3S7RA 5DGAA 4I6YA 3MR7A 3N6NA 3I0RB 4B3SJ 4OX8A 1GXLA 3AD8C 1OPIA 3TX0A 2KHCA 2LXFA 1NMEB 1V9OA 1RT6A 2AYEA 1UAWA 4L6V3 3V6DA 3ZC4A 4QWDA 2QC3A 1HL6A 2QLWA 2PI5A 3DRYA 5IT0A 1RWMB 1N36J 1K8AT 3MEGA 3CW2C 2LU2A 3D1QA 2HS3A 2IAJB 2A6OA 3KLIB 2R7UA 4XK8C 1VQ4S 5DZ7A 2ZH8A 4LF6F 4Z37A 2WSCC 4DUZF 1TAQA 2IM1A 2BQ3A 4JI1F 2B7CB 3BBBA 2FY1A 2P8IA 1Y0HA 3MHYA 2KO1A 2NSBA 1M1HA 3KLGB 3SSRA 2XMAA 2X1FA 2YWEA 3PNIA 2OD6A 3CMQA 1QTNB 3M32A 2MKKA 3UFCX 2M9KA 3DGPB 3DLKB 3RBDA 5KFBA 2ZBCA 3DM2A 2RILA 1Q0NA 5B08A 5J2QB 2F5GA 2YNGA 1JX4A 3VQSA 1RISA 4IG3B 5DS7A 4GO5X 1WKKA 5KFJA 4JI5F 3MFIA 4PYAA 2CPJA 1FTRA 2VASA 4JI2F 3ILIA 3K5NA 4JI0F 5B0DA 3DHXA 3W63A 2VFSA 4EUVA 2W4DA 1D3WA 4FXDA 4C2MA 2WOMB 1FKPB 5GMDA 2ATLA 2Z57B 3ZTSA 2CZ9A 1KLMA 1TMJA 4CLYA 3Q8YA 3T41A 3KWMA 1RT7A 1YJNS 1S1TA 2MKHA 3E51A 2MEWA 3GP9A 2HHSA 3PX0A 2ZKTA 4KGZB 2HNDA 4NI2A 3UW1A 3MAAA 2ASDA 3W9HA 5HMZA 1FWLA 4TXSA 4DV3J 2NSCA 3EICA 2F3JA 5DDQC 1JNZB 4B3OB 3OXFA 3EPIA 2PMZD 1SV5B 3MR3A 1TUGB 5HBMB 2ZVIA 3MPDA 1N54B 2L3MA 5C24B 2O67A 4ZVSB 3LTOA 3U7JA 3WHIA 3W64A 5DDPC 1S10A 3KK2B 1N5VA 2PA3A 4MKAA 2YTCA 2XI2A 1NXIA 4TY8B 2KM8C 1M5VC 2LEAA 4NYOA 5IWAJ 2KT5A 1U02A 2Q6CA 4V1Ak 4H4OB 1R6YA 3E8OA 1NPKA 1RWWB 1FT8A 3BGFA 4KHPJ 6FDRA 1HBNA 4F4WA 1R8AA 2M70A 1SI9A 2QLXA 3K5OA 2UXBJ 4O44A 2CPEA 4OYPA 3DRSB 2ACMA 4DX6A 5DETA 4NYZA 3CMES 4ZLPA 3HLUA 3LP1A 3BGLA 1SJRA 1S76D 1SBRA 4RW6B 5F9NA 1P6TA 4LQ3A 3CJTA 2GS8A 3CTRA 2XLIA 3RTVA 2UUAF 4U8VA 5KOXA 3KUEA 3HVTA 1YTYA 5AE3A 4P72A 3HX9A 1IKYB 2Z2YB 4O3SA 3FZBA 3HFKA 5E0OA 3WQPA 2QLBB 3U1NA 5KFGA 2HFZA 3G96A 3DOKB 4H4KC 1KLNA 2AJFE 2VQEF 2ZBIA 5IM0B 4ZP9A 1G1XA 5EX0A 5FDLA 2QT7A 2V8PA 3FNNA 4B9VA 1NH7A 4KRWA 4DV4F 2IYIA 1T03A 5GAGI 2FLLA 2AJ0A 2HHPA 2W9BA 1RAIB 2ASYA 2ZJRQ 5HK4A 2YNIA 3FEZA 5IQQA 3NS7B 1W25A 2B6AA 1DRZA 3HJVA 1CJVB 1JJHA 1H2TZ 5LL6d 3LP0B 3DHWC 3ZZUA 4USVA 4NLVA 2K3KA 4DOZA 2C2DA 3PFOA 4C11A 2BV3A 5CD4H 1NU4A 4IQXA 3OR2B 2F4FA 5HAOA 1SUQB 5AXKA 3S6EA 4USJC 4JV1A 4B02A 1C0UB 1HBOB 4X66F 5H9FJ 1RAJA 2WAQD 3SQGA 2X3GA 4J91A 1TL7B 2M8DB 1ZM3A 4AE5A 3H5YA 3K57A 3HCXA 2XLKA 4UY8T 3W5ZA 1B4SA 1SH0A 4WU3A 4ZVFA 2IJFA 2EC2A 2PEBA 3HVWA 3GV5B 1LK7A 1YBUA 3MAHA 4PXDA 5E7OB 4WFNQ 1UETA 5MAOA 2MB0B 3R6LB 1F5BA 4Q0BB 3QT5A 4QWCA 1FXLA 2GW8A 2DCLA 3O44A 1GH8A 2LEPA 1O5JA 2PE8A 2YNFA 1GX6A 5A8KB 4CYUB 2HVHA 2XNQA 4F67A 1TTHB 4KKOB 4F4ZA 3HKZD 5C2CA 3MEKA 2R7SA 2BR0A 5CXTA 3ZO7A 2W4PA 2QN6B 4OYAA 4H54A 2KXHA 3TR5A 3E01B 2HAFA 2E1CA 4AUKA 4JI7J 3JSYA 1RCOB 4DSIA 3M2RB 3G2XA 2KVIA 2B8QA 2XEXA 2Q79A 2P5VA 4KSEB 4EGLA 1QE1B 3VZHA 1RWVB 2XMKA 2RQMA 2JSXA 4OZJA 3BZQA 1FA0A 5J2MA 1IBLJ 2VG6A 3ISND 4EBEA 2V67A 3J7YI 3BQ2A 3P6YC 3BGRA 2L41A 1H3DA 4PQUA 5EHHA 2MHEA 2VBZA 3H98A 8AT1B 4CO3A 4NXNJ 1JWWA 1U26A 4XPCA 2R42A 4B17A 4L3NA 1RAOA 2BANA 1U1PA 4KQZA 4M5NA 2LKZA 1H2UX 3DRPA 1S1VB 4E98A 5ETMA 2BQUA 3D6MB 1NSKL 1U6ZA 3QO9A 2CNKB 5ETNA 3QZ8A 1MSWD 2JDJA 1FKOA 4DR4F 4YP3A 2I5JA 3FK4A 2WSEC 5HQLA 3IRXB 1KRPA 2ZD1A 1YRUA 3NGUA 4ZPVR 3TA1A 1Z4UA 2GFFA 1FF2A 3VVTA 2HWIA 4K2JA 2MQQA 3MM8B 2QFJA 4OJ1A 4H4KA 3PJXA 4LF5J 3MTJA 1IR0A 1NUEA 1Q95G 4R5PB 1RHMB 1RHRB 3EZOA 5ETVA 3UD4P 3V4IB 1IN0A 2R7OA 3ISZA 4PRFA 4B3SF 2UV8A 2EVZA 2AYMA 1TKXB 4J9SA 5MLCV 2JLGA 1BQNB 1WKLA 3GSDA 1UWBA 4OYWA 1TR0A 4B9LA 2C22A 1WF2A 3EMTA 5DO2A 2DNHA 3DLEA 1X9SA 3OR1B 4RW7A 1N36F 4F7VA 4I7FA 1RA7A 2PMWA 2QRRA 2OPPA 4DL6A 1VQ8S 2EFVA 4PWDB 4IFYA 1WWHA 2ZWOA 4ZIVA 3C14A 2FJAB 2CQGA 4MK7A 4DF8A 1VMBA 3CT9A 1WHYA 4IFVB 2VDHA 5I3UB 5KT6A 2BRLA 5CD4A 1T94A 3RB3A 2DRBA 3RB4A 4P2MA 4I6AA 4K4YA 2HFNA 1E6YB 3A13A 2MY7A 3R8YA 1X5TA 3QNWB 1F9HA 4DG1A 5J2PA 1RTHB 4MKBA 2W24A 1VR6A 3EVOA 3DOMA 4I6WA 4NZ7A 4CO5A 2ZWPA 3FZ2A 1RK8A 4AL6A 1JLCA 1H2VZ 4KV8A 1KEKA 2QA4S 4CM2A 1MN9A 3QSYB 1V3ZA 1Q53A 1MWZA 2W9CA 1TK0A 2ZJPQ 3H90A 1WTBA 1FERA 3DC2A 2F4VJ 1LXNA 3EGVA 3H25A 1NSAA 1SJQA 3HULA 2EEYA 2KDOA 2HYIB 1CJUA 1TV6B 4QR2A 2F63A 4W4MA 2HURA 5D15A 1UFLA 1BQMB 5D4LA 3THVA 4OYIA 4YS2A 3CCZA 3GCXP 2Y1LB 2VFVA 1KVIA 1T9UA 1N34J 2D41A 2C2ZB 3LF0A 2E5LF 1CS4B 4C0HA 1WHWA 3ZZTA 4RUAA 3NNHA 1NNDA 1WEXA 1RWKB 1X4EA 3HSDA 4DL2A 2CQDA 8ATCB 4DSEA 1SKRA 3R9LA 2DO4A 4DV3F 5F8MA 4WF9Q 1M90T 4LVNP 3LQVA 1U45A 2LA4A 3IS9A 2KYZA 3LALA 3PV8A 1MMDA 2GV1A 1S5ZA 3PRBA 4HR2A 4O3PA 3D6TB 3LH2S 1NCLA 2E7XA 1B64A 3D1HA 1PILA 2UP1A 4F8RA 4ZP8A 1LFPA 4QR0A 5IWAF 4NXMJ 4FVCA 3MEEB 1YBTA 3IR6B 4LF7J 2CPIA 4G1IA 3BH6B 4NCAA 2BW2A 3OTEA 2VHGA 4KHPF 2V69A 2XHCA 4ZPBA 4B9UA 4BWJA 4M5HA 2MKCA 3TRGA 1N33J 2UXBF 1IXKA 3BEGB 4XAKA 5C25B 2L08A 3DGVA 4KFBA 2ROEA 3QIDA 1HI0P 5D4OA 3C15A 3HHKA 3IM8A 1CULA 2W4CA 4M5JA 4IRKA 1N48A 2WONB 1GTEA 3VGVA 2FVSA 4OHWA 1IKVA 3L7UA 5AXLA 1XJWB 1S77D 3HFZB 1ZAVA 4LSNA 1Y5LB 4KO0B 3W66A 1CJKA 2VBWA 3AA8A 4MK9A 2B43A 1A9NB 3DNCA 4PG4A 4C8MA 3TZZA 2FJWA 2GAGC 2FHMA 2DNLA 3VCDA 4C3KA 1U24A 2X1GA 1C0TB 1RKIA 2BMBA 4I2PA 4ED8A 1F6TA 3EGNA 3K5PA 2QIFA 2ZOFA 2XMWA 3SSSA 2VPZB 2C42A 2B3TB 1HNXJ 4PWUA 3HK2A 1HNVB 2KXFA 1LQ9A 3NGRA 2MLYA 2HK2A 3UNYA 3VF0B 2PFFB 5E3RA 3ISNC 5G0RA 4ZCLA 1GMWD 1BXNA 3DN9A 1P1TA 2ZZNA 1OY6A 2X1BA 2VFRA 3UR0A 2M4MA 5H9FK 2PFDA 1S9EA 4DPUA 5C7PA 1U2RA 3U1LA 3N79A 4N77A 4R8UB 2HNYA 1FVSA 4GVBB 1CQMA 1RACB 3HHNB 2HFSA 3GJRB 3V81B 1FEHA 2VBXA 4JV5F 2Q1LA 2E1MC 4I2QA 4OV6A 2FVPA 4RW4A 1LWCA 1NBEB 1HBUB 1GMVA 3QFHA 3R6GB 4IKAA 2IVYA 1KQGB 3MM9B 3NNAA 3HVRA 1F1BB 1SC3B 1T9TA 3RRHA 1JKHB 2DXDA 2XO7A 4NA2A 5IOLA 2RB7A 4NLXA 4U6PA 2HK3A 2MPUA 4M94A 3L7PA 4J9KA 4QQBA 5DQIA 3QIPB 1ZTTA 2DTJA 2CDRB 1ZZNA 3DI6B 3RGIA 4PYDA 3J7AN 5JMNA 5HLFB 3BB5A 4F04B 1VOMA 3ZZRA 4OZ0A 3BYPA 1OS5A 2OD4A 3W8PA 4U67Q 1WG1A 3LWMA 4O4GA 3GU0A 1A7GE 2DNZA 1P1LA 4WJBA 5CYMA 3ETMA 4W98A 1C1CA 4NLWA 2Q3PA 2HNZB 3MFHA 5LOQA 4HEA9 4CWBA 2GVDB 1U0HA 3GV7B 1HARA 3KNAA 4OLOA 4OYBA 1EZZB 3LGMA 1WI8A 4JI7F 3EDQB 2F8MA 3MCMA 4CLFA 1Y9OA 3B4MA 3S8SA 2H9ZA 1ZS6A 1UA0A 2OP5A 2HHVA 4IDKA 3KJNB 5I3QA 1WC4A 1QSLA 2QO3A 3LO3A 3SXLA 3MECB 4YFUA 4M63A 5DG9A 3MMAB 3KLFA 4IO1A 4Q2MA 3HM9A 2WB1D 3NGTA 1MU2B 4DJBA 5EWGA 2NYHA 4C0BA 3A8EA 1FRXA 4YR0A 4DV1J 1IBLF 1JLQB 1T7PA 4IH7A 4K5SA 2Z2LA 1UPMB 1GEHA 4DCJB 3RW6A 4MK8A 1NK0A 2N4CA 3QWUA 3SFGA 2R7XA 5IZHA 3CCTA 2VIHA 4YDXA 2V4QA 4NXNF 1U4BA 4NLGA 3FBCA 2WW8A 5K14A 3RAQA 1S6UA 1T0TV 5ETRA 1W7WA 3TNVA 3I32A 1EIYB 1S7IA 3R5JB 2RDDA 2HMIB 1WC5A 3EGWB 3K7RA 1GT8A 2VC1A 1AXQA 2VZ9A 1RTDA 1JJCB 3PW2A 3CO0P 1DTTB 4X4VA 1H73A 2RRAA 1EETA 2OEJA 4C4WA 2MLZA 4HKQA 4FF4A 2R2TA 1TQLA 4UQGA 3CF5Q 2G9OA 2VA3A 3P45B 1HNZJ 1LFWA 2DYAA 4DV0J 3VAMA 2DJWA 4A8OA 4QPXA 2NLWA 1IM4A 1DTQA 2VD3A 3BV8A 1HW8A 3IGVA 3FFIA 1K1QA 5HROA 3KJVB 1GQEA 5J1NA 5D4NA 3FBFA 5KFZA 4LF5F 4PPZA 3B78A 2DH9A 1WJ9A 2DNQA 3RBEA 3JSMB 1VCTA 3JQKA 1QD1A 1TKTB 1TKZA 2COLA 2GIRA 3MUMP 5IC4B 3EWGA 2XS2A 5ETQA 2B4VA 4YHHF 1XQIA 4UUXA 1S49A 3V6KA 4OJ3A 3D2WA 2MZRA 4TU7A 1SQGA 1M0SA 1P9YA 2OO4A 3B6BA 3OVAA 4ES3A 3UE2A 3DDNA 3MPWA 3DLLQ 4JI3F 3MMJA 4HVZA 1X4CA 3EGZA 2WVBA 3DKDA 1XN9A 3FSIA 5CYQA 2HPUA 3H2LA 4QU7A 2XB2D 2C3OA 1HR0F 1REVB 1L3KA 3CVKA 3MUVP 2YWFA 4KGMA 3BF4A 1S9GA 3TEHB 2FLNA 5FIIA 3EJMA 4AYBD 2WHOA 2PO4A 2L48A 4LF2A 4LF4J 2FYXA 4J7CA 1Y5IB 4WFZA 4DWIA 3ZZ0A 2YPYA 1ZA2B 1S6QA 3GIKA 1ZH5A 3JYTB 4NLTA 2A2CA 5KOWA 3TUIC 4ZLLA 3QJLA 4ES2A 2OMOA 3WX4A 5KFDA 5BYRA 3NBPB 2XBPA 1S48A 3W2WB 1Q1KA 1HQEB 3OLBA 4CNZA 1UW9A 2MDAA 4FS1A 1NO8A 3CXCR 3HD1A 5THWA 3EYZA 3LGNA 4J9RA 3T1HF 1O0PA 1YVFA 2F4VF 4DHVA 4ED1A 4GC7A 1BGXT 2DXFA 5C42A 2HVEA 2HWHA 1HQUB 3CJ0A 3R2DJ 1FCAA 1NJIT 1AT1B 1TU0B 2CQPA 4U7CA 2K7KA 2GO8A 3RRGA 4NA1A 1N34F 1N6QA 2V0NA 2F9JA 4P9SA 1T05B 2QMWA 3CWJA 3TAMB 3A8KA 4UQTA 3J80U 5K8NA 4OYOA 3HI9A 2CPZA 4RW8B 3CJ2A 3C6UB 3T9ZA 4WK1A 2Y0SD 3LP2A 1RU2A 1VLOA 4O3QA 1AUSL 4CLUA 3IBWA 3ELHA 2V8DA 3H5SA 4J9PA 3CJ5A 3OT9A 4KH1B 4KIAA 3KG0A 3D6HB 5IT4A 2X1AA 2RRBA 5LSRA 1RT2B 1Q16B 4I56A 4DL3A 2WB4A 2KT3A 3IWXA 5IV3A 2V2VA 4LQ9A 3Q86A 3J7Z5 1NAQA 1LOUA 4NLQA 4OZNA 5DLGA 3CPWR 3TYTA 2LMIA 3FQLA 5B0CA 3CCMS 2ILYA 4NXMF 2AT1B 3DOLB 4ZITA 3HJFA 3D5MA 2MQPA 1I1GA 2IY5B 4OYZA 1ZM4A 4KHRA 3RR8A 2W2QP 1ZPWX 1U1LA 3ENVA 3D3BJ 5ITHA 3R5GA 5M2UA 2YNHB 2LECA 3NWRA 1UCNA 4H4MA 2MGZB 1N33F 3HHLC 3RRKA 5E3QA 2RHSB 3WIUA 1CG2A 3ZNJ1 2ADBA 3IC1A 1NEEA 4GRSA 4OHZA 2ZKUA 1MROA 2BEFA 1LW2A 3MD1A 3OUYB 2GAHC 5T41A 1Z1ZA 3EZUA 4EZ9A 3D67A 1RAHB 2PEHA 2GGPB 3R5AA 4M5GA 2XWXA 1CLFA 1TL3B 1X4AA 1V6HA 1RT4A 3A8IA 1IR2A 4FBUA 2MQOA 2P2CB 1SCJB 1UVIA 4P73A 2HRUA 4FKYA 2KM8B 2FLPA 2DO0A 2KB2A 4A8XA 1S4EA 4NA3A 3ZNUA 2G2ZA 3M1VA 3G71S 3AJ1A 2QFIA 2XSJB 4M5MA 4W92B 1K47A 1XR7A 1R27B 3ITHB 4GKKJ 4O0IA 4F4XA 3OLAA 1HI1A 2ZC3A 3KLHA 3ET6B 5D0HA 2JLFA 2IRUA 1JLFA 2HBZB 1HNXF 3CCWA 2E29A 3IMQJ 2IDEA 5AJ3J 2XMVA 1QUPA 4ZIWA 2XGQA 3LAKA 3H5XA 3PO5A 1W2BR 1KOHA 2E5HA 4DQPA 2W01A 2GJFA 2F40A 4DR6J 2L9WA 4DL4A 2C28A 3ENWA 1N88A 4MYTA 3FRZA 3PZPA 3QAUA 1R8BA 4F25A 3NXZA 2ADCA 1SIZA 1S6OA 3CCQS 1JLBB 1QM9A 1TK8A 1I6JA 2R8JA 3OTDA 3A3NB 2MKSA 4O3NA 1RTIA 4OZ2A 5RUBA 4TN2A 1BUXA 1MN7A 3L3CA 2HQFA 2QSWA 1RT3A 4RLEA 3RJMB 2DGQA 3GB0A 5FJ4A 4LRCA 3RAMA 1HWUA 1GX5A 2CPDA 3JAMU 4KGXB 2RNEA 3TAPA 3M9MB 2DY1A 2Q6BA 1U8WA 3TA2A 4LR9A 1KVKA 2AV5A 4PWWA 2VG5B 1JXLA 2ABYA 2BJDA 1URNA 3PHEA 1UWBB 3SYZA 1A6LA 1SB6A 2E5JA 3QSIA 6FD1A 1U09A 3IP0A 1UTAA 3C6TB 1TKDA 3T3FA 2EFPA 4LJMA 2Z8QA 1HHSA 1T3NA 3G86A 2W8KA 1L5UA 4NLOA 5T14A 4HH0A 3SMZA 2W1BA 4LFBJ 4JI6J 3BBFA 3BSOA 3OJUA 1HBMA 3BM7A 3MEDB 4G1QA 1B0VA 2CNOB 2AIRB 4UY85 3PYDA 2RQ4A 2UUTA 4C9DA 3W5YA 1YI2S 3KLEB 3ZZZA 2DEIA 2OTJS 2RMLA 1U47A 4P7TA 1SQFA 4I68A 1TUVA 4DV1F 2G4BA 4ZCMA 3AA9A 2CZ4A 3WIVA 2AZ3A 4Y6IA 2GHWA 4Q8FA 1VRTB 1E6VB 1VQ6S 3SEOA 1FHTA 4ENOA 5EN1A 4QBUA 1V3RA 4LREA 3P8BB 3NG8A 4U7UK 2ZEJA 2H5EA 1GK8A 5D8HB 1O6XA 1IBKJ 4A46A 4ELVA 4DR3J 4FNIA 3B54A 2ZOMA 3GYXB 3W5XA 3AB4B 4GMKA 1APSA 2QA1A 2K1RB 4UZCA 2DY9A 4NCGA 4DBQA 3QATA 1R0AA 1F3VA 4C48A 3ETOA 1M5OC 1N5SA 1G2EA 3IAM9 5T7LB 3M30A 1XWLA 2H48B 2IMWP 3OXLA 2CQCA 1LW0B 4M8LA 2XZWA 1YJVA 3TUZC 1H6KX 1HNZF 3KK1B 1QDUB 4ANCA 4USUA 4DV0F 4QR1A 3R27A 2ZHOA 2UZAA 1BMQB 2OHDA 1XIQA 5KFTA 1FE0A 1VDHA 5G4DA 3MM5A 3QZ7A 3CCUS 4GKJJ 1RT1B 4X4QA 3TJ8A 2QSFA 2DKOB 2VG7B 3KNGA 4ICLB 4TQSA 1D9DA 5ETPA 4LRAA 1SC6A 2EI5A 4P74A 2FJEB 4FYYB 3PX6A 2V8VA 2UUCJ 1CVJA 1GAOA 2HZCA 3J7YU 3H4DA 4OI0A 4WE1B 3O8WA 2ZDOA 3DDIA 4A47A 4ED7A 2MLXA 3M8SA 1S1WA 2D3ZA 4F0KA 4DFMA 3AOCA 2VBYA 4CLKA 4CLZA 1SL0A 1X60A 4F36A 1RA6A 2IHR1 4DMZA 5IC6B 1X4HA 2MY8A 4AFFA 2Y1JA 4AXJA 2BJ9A 4EO8A 2BVZA 2JNJA 2O66A 3L09A 2DGVA 1FJGJ 1WG4A 3FUYA 1CJTA 4Z7CA 2R7TA 1UVKA 2C2RA 3UQSA 4MFBA 4ZVTB 3J81U 4EU0A 4DPOA 2ZUGA 1HHQA 1SJ3P 3M8QA 2XC9A 2BRKA 3W8GA 1RUSA 4I64A 1DAXA 1IJEB 1VQSA 4LF4F 4LVOP 2RU9A 4ZHRB 1LXJA 3PCOB 4ZJQA 2C2KB 9RUBA 1U7LA 3MCSA 2RKIB 1RU1A 3ULHA 2WBMA 5KT3A 1FNOA 1RCXB 1RBOB 2VB6A 1KNZA 2ASJA 3EXCX 2LEBA 2G13A 3O1LA 5D3GB 2E9TA 3N28A 5KFCA 3IRWP 2HZAA 2KFYA 3KHRA 4J9MA 5BYQA 5LMNJ 2W9AA 1LK5A 1X5OA 5A0YB 4EYIB 1IKWA 3MWBA 3FSXA 2IA0A 3KYLA 1HD0A 2LLZA 5G0RB 4PCQA 1WI6A 2KKHA 1NK9A 3FSYA 1YK9A 2GIQA 3M2VA 1S1UB 4IOCQ 4Y2CA 3JTOA 2KH9A 2V34A 3UVJA 4PXBA 2KFZA 3KK3A 1JLAB 1D8ZA 2RQCA 1ZOTA 1WEYA 4ECYA 4QYZJ 4YMEA 4ZVRB 4RW9B 1SKSA 1FO1A 2Z30B 2RF2A 2LQ5A 4ANEA 3ONQA 4URQU 2EG2A 3D6FB 5D4PA 4JOUA 3OQ2A 4DCPB 3TI0A 1KN6A 1RWUA 3TAQA 4TY9A 3FEXB 4CM0A 1HWKA 1S1XA 3T6BA 2XYHB 2RHQB 2N3LA 4ZJLA 1P8GA 1GNKA 2DGWA 1H7WA 4MMOA 2QV6A 2JFDA 2YKAA 1Q7YT 2ROPA 3QWPA 1DARA 1HKAA 1S6PB 2WW4A 2WVDA 3DLGA 3KDOA 1R31A 2J8AA 4UOCA 4DR2J 3OL7A 1KTVA 3KJQB 3D0HE 1S4FA 2BE2B 2XYGB 5KFAA 3H4BA 3KDNA 2DR6A 1S0VA 2AGOA 2B5JA 2ZE2B 5DDOC 3OVSA 4ED6A 1RTJB 2CJKA 4TLRA 3MAQA 4DI6A 1JXEA 2E9ZA 5I42B 1RWOB 5HSPA 2WK4A 1TFWA 5L9NA 1Q86T 2A6MA 2OPSA 2ZJQQ 1Z2LA 1CSJA 3VZIA 4FYVB 3MOJB 2RIJA 5LM7E 5J2NA 1DLOA 4DN0A 3W2VB 2AJ2A 4DPXA 1TL5A 3W1YC 3E2EA 3GZ7A 3BKTA 4QW8A 1K9MT 2VU5A 2PSZA 2HGLA 3N9UC 4CH7A 3KHGA 3M8ZA 2ZITA 1YJRA 2L9DA 1S0MA 2R8IA 1DURA 3TQ1A 1VQYA 3CD7A 4GKKF 1H72C 2F9DA 1C4AA 2X7IA 2YWHA 4ELUA 4NEZA 3VWSA 2IVFB 2EFNA 2DNYA 3FCHA 2HQ3A 2OI2A 4WP9A 2ZBPA 3VGSA 1WHXA 4HACA 5K8OA 4ECWA 1LWEB 2O5DA 5F0WA 5AJ3F 4USHA 3G6VA 3PIOQ 5J1EA 3FCVA 1OSCA 1VGYA 3UDLA 3SCJE 4ZVHA 4DR6F 3FBBA 2J6UA 1WHVA 1A0OB 2FJDB 1HPZA 1RAEB 2NPIA 3TARA 5H1SV 3ZTOA 5IQ6A 3LW5C 4WIQA 1Q8BA 3G82B 4LRBA 2CJ9A 1XEZA 3VR1A 3D0GE 2EK6A 2XY7A 2OSQA 1YX2A 3H0PA 2HFOA 4CH0S 3P96A 2B4UA 4CTAB 2D74B 2V68A 1IWAA 1N5YA 3VHQA 1IUJA 2PD1A 4DL0C 1T11A 3TW0A 4WZMA 2PDAA 3K5LA 3I31A 2FDNA 2D9PA 2LDIA 2R4FA 2D7SA 3V4MA 1T3OA 1FJ7A 2KZMA 5L9XA 1TVRA 2VOPA 2R8GA 2J8SA 1T95A 4IH6A 4DL5A 1D8YA 4WZQA 2YQ1A 2BKNA 3TQEA 4CH1A 3HO1A 3FVYA 1IBMJ 3GONA 1FK9A 1M1GA 5BR8J 2JVOA 1NK4A 2V63A 2DNOA 3CJ8A 1ITPA 2J0XA 4USKA 4EO6A 3GQCA 4AQYF 2RS8A 4ZCKA 3HSGA 1FXRA 3HZGA 5D0RA 3UCZP 4U96A 1LV5A 3G87A 3M2UB 4PUOB 3MM7B 1X0PA 2AKWB 1PIEA 1S0OA 3M6WA 3DXSX 3AOBA 1FX2A 4MKVA 1FD8A 2IM2A 2VKRA 1SQEA 3QPIA 3I0RA 4LFBF 4JI6F 3KOAA 4DN9A 3UO0A 2ZHAA 1AZSB 2DNKA 3OFFA 2FTRA 1RHUB 3I0SB 1OQ6A 3D0IE 4Y2IA 2FHOB 3H2UB 1YDLA 3UCGA 3AOAA 1SH3A 4HDGA 3P49B 4IR1A 4CLPA 5LSLA 7AT1B 2RS2A 4YQWA 2IAJA 3KLIA 3OHAA 2XM3A 1XBWA 3K0JA 2I8EA 3A3PB 4J9LA 4A48A 1RHQB 2MYFA 1HMVB 4RWXA 1R8HA 2RUGA 1YZ6A 1AROP 1IBKF 3KLGA 2JRSA 5CZXA 4ED0A 1V5IB 3DGPA 3DLBA 1ZYQA 3DLKA 1NDKA 2ASLA 3WZ0A 3BSNA 2J0QD 3EPGA 5KT7A 2JHEA 5J2QA 2HHXA 3UDVA 1R89A 4OI6A 3PRDA 3DMJB 3OBIA 4ER8A 3G6ES 2EXUA 4IG3A 3NGKA 2UXDJ 1UEKA 2ZZTA 1D0EA 3UNGC 4AT1B 3SDEB 2VJVA 4TKTA 3QFWA 4A8FA 2MQMA 4AL7A 2ACYA 3GCWP 3CUNA 4CNYA 5E3PA 1TUWA 3N6MA 5IT9U 2BJEA 1EB0A 1XMQJ 4PG7A 2WOMA 1FKPA 4ID5B 4NMXA 5KFWA 4F02A 4KJIA 2R7RA 3SFUA 4TU8A 2AMCB 4GKJF 3I56S 2YX1A 2KN4A 2GMJA 4RNHA 2DHGA 4F2RA 1U48A 2Q43A 4J9QA 4O4RA 3R7SB 4LBIA 3HSZA 3MMBB 2ALZA 2UUCF 4JYAJ 2B51A 5KFUA 2FVRA 2YX7A 5KFMA 1VC0A 4V19X 1RADB 4DUTA 1EQ0A 1NHKL 4ILRA 4DV2J 4B3OA 4WFYA 1SV5A 2Z2MA 5HBMA 4K0KJ 2B0GA 5C24A 3SQOP 4BWMA 3Q8PB 4YY3J 2U2FA 2XZDB 2GCFA 1ICEB 1FEEA 1NB7A 1FJGF 4TY8A 3EX7B 4DSJA 5EX3A 2HW3A 4KT0C 1FRLA 3UN3A 2BZ2A 1JLEB 3GJTB 2HLUA 4H4OA 4KAIA 4EI2A 3ZZPA 2XYPB 1MROB 4CO0A 4OHVA 3NEKA 5KFFA 4UOHA 1R3NA 2V4JB 3HVAA 3FCWA 2DHSA 2BXJA 4C8KA 5HVFA 4O23A 4DX5A 4UZBA 5B0BA 1XK8A 3DYAA 1FX4A 4Q5VA 2O1PA 5A8RB 4QWBA 3IM9A 3DRSA 4ETZA 2FD2A 4LRDA 1U2CA 4MJKA 1Q7LB 4IRDA 1RBAA 5D77A 1J27A 2ZH5A 5HP1B 5EWFA 4RW6A 2NXEA 4HHUA 1UZDA 3RAXA 1X5SA 4M5KA 2NQPA 5LMNF 5EUHA 4OX6A 5HN0A 4IOBA 1WNEA 4U95A 1KDNA 3O2IA 1IKYA 3PR4A 2VF3A 1UVLA 3CCVS 5KFIA 1KVJA 4DX7A 1T02A 2UVWA 2VL1A 1VIOA 3DOKA 2IA6A 3CC4S 2L9NA 4NEYA 3EM1A 5IM0A 4K2XA 4C3MA 3SZ2A 2DGOA 4ILMA 1R7IA 3U27A 1Q4RA 4QYZK 2IFXA 2GVZB 3P5BP 2JEFA 4ZVGA 1WSRA 1OPZA 4CZCA 2YKMB 2ROGA 2GJ2A 4X4OA 1CJVA 3CD0A 3FMWA 3QMQA 3LP0A 2QTWA 4IOAQ 1U1QA 2J7UA 1KHWA 1QJHA 3K17A 4U9RA 3OR2A 2OJ3A 2AGQA 1SUQA 3TZYA 1JNRB 1C0UA 1HBOA 1JJ4A 4BCAA 4Q45A 5F8GA 3H8YA 4K4XA 1R0CB 1VRUB 4LF9J 1S72S 1TL7A 3PG9A 1OY8A 4TYAA 4XO0A 2BQRA 1EHWA 1D1UA 4ZPCA 3TVZA 4RBUA 4KBIA 2XNRA 4DR2F 1H7XA 3F56A 2RSQA 3D9BA 3PM9A 5ETSA 1TFYA 3EE3A 4LBHA 4HTIA 4Q0BA 4C7QA 2PGCA 2XWYA 2F8HA 4DDFA 5H9EJ 3BH7B 4GO7X 2MZJA 5KG4A 3A1YG 1YJUA 2E5GA 4Q2LA 7FDRA 3C66A 5EGYA 2FIUA 5A8KA 2H1YA 4C98A 4CYUA 4EBCA 1RGVA 4PAAA 4ECXA 4KKOA 4Q8EA 1AFJA 1UFWA 4O3RA 2EKYA 1Y11A 1TELA 2W7AA 3MM6B 1WF0A 5HATA 4ETXA 2DPIA 2E1RA 1YJWS 3M8RA 5ETLA 2QYCA 4LIWA 1KSPA 1Q8LA 4URSA 3E01A 2Y9HA 1PBUA 2M7SA 3M2RA 3AFGA 5I4MA 2A10A 1R0BG 3SI8A 4DFKA 4JI1J 1NLKL 2E44A 1QE1A 4NRUA 4PKDB 4LFAJ 2KHDA 4LUBA 3FMBA 3KHHA 2BW7A 3QT7A 4QIEA 3HHLB 1RAAB 1RBLA 3SV3A 4DQQA 3F73A 3JXOA 3OD2A 2AD9A 3VAFA 2CAJA 3LUYA 1KD1T 5F0UA 3W60A 5DZ6A 4KB7A 1MMNA 4DXLA 2LA6A 4DPTA 2E7VA 3BSAA 1L3SA 2HVIA 1QVFR 4WCEQ 5KFXA 2HHQA 2ZH3A 1WOPA 3CJRA 3D1OA 3IO1A 1S1VA 3MM5B 3JQJA 2G1HA 2J5AA 5KFVA 1QAJA 2MJNA 1DY3A 1FDDA 5DGBA 3UDEA 2J9EA 1VHIA 4FYDA 2MQ8A 2R2UA 2FC8A 4ZJOA 3HZEA 5D78A 3UN2A 2YXLA 5KFKA 3NMAA 2DITA 3AJ2A 3IRXA 4S0MA 2EWHA 1RAGB 5GMKa 2CVIA 4OX9F 3V2UC 3QLHB 1B0TA 1K0TA 1FXDA 3MM8A 2G1DA 3DRXA 5KFHA 3EVMA 2AJ1A 1WKJA 3W65A 3CCES 1J5OB 2HHTA 2FZGB 4K7QA 4R5PA 2YVSA 4X64F 1HYSB 2FHJD 2AQ4A 3JS9A 1X9MA 5F9LA 1TKXA 4IUFA 5F8HA 4QW9A 1BQNA 3KXDA 3BDPA 1YIJS 2BA9A 2K7JA 1N56A 3IBFB 1U2FA 3H5UA 2RJZA 4EZ6A 2MKIA 3RZAA 1TK5A 1JB0C 1RT5B 4Q44A 3DXBA 2UXCJ 3OR1A 3KKFA 2AGPA 1Y4ZB 2J6SA 3B82A 3GYGA 5BXIA 4ZLJA 1KQKA 1K1SA 4OZ1A 4RR5A 4PWDA 2AJQA 1EX8A 2CDQA 2OELA 3CCSS 4KTQA 4B08A 4OI2A 2MJUA 1FRMA 3NY0A 3CGIA 4IFVA 5KFSA 5I3UA 1IWGA 2QMUB 4DV6J 1F2HA 2NR0A 2Y8WA 4DR7J 1G6BA 1IKXB 1UKUA 3QAEA 1FDBA 2RH3A 3JB9k 3MCOA 2FVCA 1E6YA 1RJJA 4YB5A 5GADU 2VPWB 1C1BB 2OPRB 3OSPA 2R2RA 1RTHA 4DU7A 2IC3B 3N6LA 3K2YA 4DV5J 1JLGB 4G65A 2UU9J 2Z58B 2EW9A 2DR7A 1F9EB 4E0DA 2UXDF 3JSRA 4ZLNA 3PEJA 5DG8A 3MMCB 4CLLA 2DIUA 2DCUB 1N52B 3DLJA 5FLXU 1ZAWA 5CAAA 5KG3A 2HHUA 1RHJB 4N7TA 1QY7A 3AD7C 2QG9B 3BREA 3KK3B 4J90A 2DR9A 1XNQJ 2Y0BB 3MURP 1WACA 2VH7A 3CDUA 1TV6A 4BDPA 4HHHA 3UPFA 2VUGA 2HLTA 2RF2B 1BQMA 4DU8A 4UOFA 4Y28C 4K4WA 1V5VA 2JFKA 1KHVA 2ZH2A 3KG1A 1XTZA 1Q5YA 1CS4A 2BE7D 2WVEA 3EZ5A 3AB2B 4CRJA 2CNLB 5CA5A 1K73T 1FVQA 2WSFC 1DQ8A 4JYAF 2V2ZA 1F5AA 3M8PB 3G8QA 3Q0AA 4N47A 2DD8S 3IG1B 1MW7A 3AXKA 2YKNB 2NPFA 2AU0A 1HLWA 2G0IA 4K0KF 1QUVA 2V2QA 4FDFA 3Q23A 3PDNA 1KS2A 4A8SA 4YY3F 2HZVA 4UF4A 3M6XA 1WSVA 1F3FA 2IYGA 3VAGA 2P9EA 2AEFA 3PKMA 5DQHA 1JMTA 1U1RA 4QYRA 4LSLB 2KL8A 2E5IA 4I1TA 8RUCA 1VQOS 1S9FA 3MEEA 4CO2A 3PACA 5B0AA 2XHWA 2F65A 1R8PA 1GTHA 1K0VA 3LGHA 2IM0A 2HS0A 2KRBA 1BHNA 1KBRA 4LF8J 3DCAA 1UMJA 1VYAA 4ECZA 2OPQB 3Q8RB 1KFDA 5C25A 3HT3A 3ZZOA 2DNPA 1VS3A 3E3XA 5A8WB 4M5DB 4HLBA 2K3IA 2EC0A 4N8NA 3IR7B 1OWXA 3TA0A 2DISA 4QIFA 2HRYA 5CH7B 2WONA 3PTWA 2CQ4A 1HNIB 3LAMA 1QLNA 1DBDA 2EFGA 5KFEA 1U1NA 3J80Y 1PGZA 4WFBQ 4WKYA 2XULA 4KO0A 4PXEA 3T5HA 3CDBA 5BYSA 4K59A 4NLUA 2VA2A 4IG0A 3OJSA 1FI4A 4DS5A 1NJZA 4NL5A 2PT0A 1KWMA 3KFWX 3D54A 3KJFB 4RU2A 5IXUA 4ZK7M 3I5CA 2VPYB 1PSDA 4IYQA 3L95X
chains in the Genus database with same CATH topology
2XLKA 1HMVA 3O3LA 4UY8T 3VAJA 1C0TA 4DV0F 4QR1A 1SH0A 1SXLA 2OFGX 3R27A 3BO4A 4WU3A 2ZHOA 1UJ6A 2UZAA 4ZVFA 1HNVA 2IJFA 2AX0A 2PIIA 2D3OR 3HVWA 2YH1A 3GV5B 2MKJA 5KFTA 1FE0A 1FRKA 1LK7A 1HNWF 3US5A 3C2PA 3MAHA 4PXDA 5G4DA 4DLEA 3MM5A 5E7OB 4WFNQ 1UETA 3QZ7A 3CCUS 1RT1B 4X4QA 5K8PA 5MAOA 5DDRC 2QSFA 2DR5A 1M5SA 4CT9A 5JVHQ 2MB0B 5CYQB 1F5BA 2VG7B 4Q0BB 2LXIA 3KNGA 4QWCA 1FXLA 4ICLB 2GW8A 2DCLA 3O44A 4TQSA 1UJ4A 1U49A 1D9DA 1GH8A 2V9WA 2LEPA 3DMJA 1O5JA 1CEZA 2PE8A 1JIHA 4LFCF 1SC6A 2EI5A 3MXHP 1U1KA 2FJEB 1LWFB 3NMRA 4OIXA 3PX6A 2V8VA 4R8UA 2APOA 2YNFA 1GX6A 3HHEA 1CVJA 1S9GB 5A8KB 4MKYA 1TP7A 1GAOA 2HZCA 3J7YU 3OHBA 3H4DA 2KXNB 3SDEA 4OI0A 4LF9F 4AL5A 4WE1B 2HVHA 3V81A 1LKZA 2KJWA 4X4NA 2XNQA 4F67A 3O8WA 2ZDOA 4A47A 4KKOB 4F4ZA 1XNRF 3HKZD 4ED7A 1S6QB 4FN5A 1S1WA 4IH5A 2XCPA 3M8SA 2OIHA 2D3ZA 4BBYA 4QJVA 1BQXA 1HBUA 2O01C 2XG8A 3BO3A 4DFMA 5IS2A 4OMFG 2VBYA 2W25A 2CKWA 5CZVA 3MEKA 1SL0A 2R7SA 3MM9A 2BR0A 2MQLA 1DQAA 1RA6A 5CXTA 2IHR1 4BS2A 4DMZA 3GG1A 1X4HA 2MY8A 4AFFA 2Y1JA 3DRRB 2W4PA 1NJXA 4AXJA 4KR0B 4CIOA 4EO8A 4ECQA 2BVZA 4KPYA 1JKHA 4ID5A 2O66A 4H54A 1YSJA 2J9CA 2KXHA 3L09A 1VBZA 4OQJA 3TR5A 4ECTA 3E01B 1FRJA 2DGVA 2E1CA 4ZA1A 4AUKA 1WG4A 4MIWA 2R7TA 1UVKA 2C2RA 1XMBA 3JSYA 4X4UA 2RD5C 1X5PA 3UQSA 4DSIA 4CQ1A 4MFBA 1AUDA 3M2RB 4LT6A 3MR5A 5FD1A 3TUJC 4WK3A 4EU0A 2KVIA 4DPOA 2ZUGA 1SJ3P 3MMBA 2N3OA 3M8QA 2XEXA 3I5BA 2BRKA 3QIPA 2XC9A 2Q79A 2IRYA 5M2PA 2P5VA 4QOTA 4DR3F 5KG1A 3DI6A 2F7VA 2A18A 5KTQA 4I64A 4KSEB 5HLFA 4EGLA 1OIAA 1DAXA 1QE1B 4F26A 3VZHA 1X4GA 2XMKA 1IJEB 1ZPVA 1VQSA 2RQMA 2JSXA 3T5LA 4LF4F 2VODA 4LVOP 5C42B 2RU9A 4ZHRB 1LXJA 4OZJA 4HI2A 1FJCA 3BZQA 1U7LA 1FA0A 5J2MA 1YBAA 5IFMA 3O5TB 3TANA 3QJPA 1ROFA 2RT3A 3MCSA 2XGPA 4MYUA 1YQHA 4QU6A 1VLYA 3BQ1A 2MZSA 4FS2A 2VG6A 2RKIB 3ISND 4EBEA 3BR8A 5LXRA 4ED3A 3ULHA 2WBMA 3G8SA 3V6HA 3N01A 1VQ5S 2HNZA 3POTB 3J7YI 3BQ2A 5KT3A 4IO9Q 5AXNA 1FNOA 3T9NA 3OTOF 4EBDA 1N6QB 3P6YC 4N56A 4F3QA 4OI1A 5DLFA 2VB6A 4BHQA 3BGRA 1NK5A 2L41A 5CCMA 1H3DA 5L38A 2M5YA 5EHHA 5LJ3Y 1KNZA 4PQUA 5KFNA 1X8DA 1G3OA 2XY5A 2MHEA 1SH2A 3EXCX 2ASJA 2LEBA 2G13A 1TL1B 2VBZA 3O1LA 3OW2R 5D3GB 4A8YA 3H98A 1EP4B 2E9TA 3N28A 3LP2B 4KE5A 4CO3A 4A8KA 1JLEA 3CJKB 3Q22A 5KFCA 3IRWP 1JWWA 3M9NB 1U26A 2HGMA 1HHTP 2AW0A 4EFAC 4XPCA 2KFYA 3KHRA 3WC2A 4J9MA 5DRKA 2AWZA 3T1AA 5BYQA 4B17A 4YUDA 3MECA 5E5NA 4A8WA 3MF5A 2R8KA 4L3NA 2W9AA 3MMAA 3RW7A 1KR4A 4YR2A 4C8LA 3OSNA 1LK5A 1X5OA 5A0YB 4EYIB 1IKWA 4QIGA 5SZTA 3MWBA 2BANA 2B9XA 2IA0A 3FSXA 1HD0A 3KYLA 1U1PA 3CC7S 4KQZA 1HD1A 2V4JA 4LFAF 1MU2A 4X4RA 2LKZA 2LLZA 1H2UX 3DRPA 1S1VB 2HVZA 5G0RB 4E98A 1UJ5A 4PCQA 2GHPA 1WI6A 4CI0B 2BQUA 2Q66A 1JLQA 2KKHA 3FSYA 2GIQA 1NK9A 3UDCA 3M2VA 1VBXA 5FLXY 1S1UB 1U6ZA 4IOCQ 4Y2CA 2NUHA 3QO9A 3S1TA 4DLGA 1WELA 1YWXA 3JTOA 5A8RA 2J7WA 3I4HX 2KH9A 2M2BA 3EXYA 3QZ8A 5B7WA 1MSWD 2JDJA 1V3SA 4X4PA 1FKOA 2XSFA 2ZH7A 4DR4F 2BUNA 2V94A 3R5CA 4YP3A 4C8ZA 3J7ZT 2I5JA 5SUHA 2WSEC 2OAUA 4JUZA 3DDKA 4PXBA 2KFZA 1RT6B 2ZC4A 3KK3A 1JLAB 3M4XA 3IRXB 3V6DB 1KRPA 1D8ZA 2ZD1A 2UUWA 3H20A 2ZNYA 2RQCA 3BR9A 5HP1A 1ZOTA 5F3TA 1WEYA 4ECYA 1YRUA 4QYZJ 4YMEA 4ZPVR 1GXUA 3T5JA 4RW9B 2GX8A 3TA1A 1Z4UA 1SKSA 1FO1A 2GFFA 4TU9A 1SKWA 3RR7A 1FF2A 3JAMY 2HWIA 4E8UA 3K58A 2KRRA 2RF2A 5LSOA 4FZVA 2MQQA 2EFQA 2LQ5A 3MM8B 3DFEA 3CCRS 4LMZA 3ONQA 4URQU 3KK2A 2QFJA 3Q24A 4B9SA 2EG2A 3MEGB 4OJ1A 5D4PA 2HMIA 4H4MB 4H4KA 4JOUA 3OQ2A 3PJXA 3LOUA 1IR0A 3MTJA 1O51A 3TI0A 4ZDNA 2EFOA 1KN6A 4ZPTR 4R5PB 1RWUA 4N8OA 1DTTA 3TP2A 2C3UA 5B0GA 3K5MA 2I38A 3TAQA 4Y3CA 2GNKA 3UD4P 4TY9A 3FEXB 3V4IB 2UUBF 1HWKA 1S1XA 2FGCA 4MH8A 1IN0A 2EBGA 2R7OA 3ISZA 3T6BA 4PRFA 2FHKA 4B3SF 4CCHA 2UV8A 3R5DA 2EVZA 5GAHI 2AYMA 1TKXB 2N3LA 4J9SA 5MLCV 2JLGA 1P8GA 4G3IA 1GNKA 1BQNB 3AQOA 1LW2B 2DGWA 3GSDA 4Q7AA 1H7WA 1UWBA 3GMGA 1WTFA 1L3UA 1TR0A 4MMOA 1NJYA 2QEXS 2QV6A 4M95A 3VAKA 3LPYA 2JFDA 2YKAA 4B9LA 2C22A 1Q7YT 2ROPA 3M32B 3QWPA 2DNMA 1FD2A 2AYGA 3IFEA 2J9DA 1DARA 1S6PB 2BACA 1WF2A 3DLGA 1VJWA 1R31A 1NK7A 2J8AA 4UOCA 4FF3A 3DM2B 4ZP6A 5DO2A 2DNHA 3OL7A 1KTVA 1RT4B 3DLEA 3CCLS 1KOOA 1X9SA 3D0HE 4L72B 1S4FA 1S99A 2OMLA 2YKMA 3OR1B 2I9SA 3L7OA 4RW7A 3CEDA 1N36F 3T6JA 2BE2B 5KFAA 2YNGB 4I7FA 3H4BA 3KJVA 1RA7A 1NZAA 2QRRA 3N5FA 1FNXH 1S0VA 4ZOSA 2OPPA 5GAEI 3R3TA 4CT8A 2HG4A 2N7YA 4DL6A 2B5JA 2ZE2B 2AGOA 5DDOC 1VQ8S 3M1VB 2EFVA 3OVSA 2QMXA 4ED6A 1QVGR 1RTJB 4PWDB 3CDEA 1RYRA 2CJKA 4IFYA 1WWHA 4TLRA 3MAQA 2FJAB 1VQKS 1VBYA 2CQGA 1Q81T 4MK7A 3JSMA 4DF8A 1VMBA 4OI4A 1JXEA 1TKTA 3CT9A 3KMQA 1WHYA 2E9ZA 2LCWA 5I42B 4IFVB 5I3UB 4FVMA 4DL7A 3KLHB 5KT6A 2DT9A 4C8NA 1VRUA 3M6UA 2WK4A 2BRLA 3QGPA 1JLFB 4OJHA 1TFWA 1T94A 5L9NA 3OXGA 3RB3A 1Q86T 2OPSA 2ZJQQ 1Z2LA 2DRBA 1CSJA 1F5CA 1NKBA 3VZIA 3BJYA 3BO2A 2MZQA 4WU2A 3RB4A 4I6AA 3MOJB 4G6VB 2RIJA 4K4YA 2HFNA 4ECVA 5J2NA 2CQ0A 5D6GA 1E6YB 1KLMB 1DLOA 4DN0A 2MY7A 1X5TA 2WRMA 3W2VB 4DG1A 3BQ0A 2Z0GA 1RT7B 4KGKA 5E2QA 5J2PA 1TL5A 1RTHB 2UXCF 1S1TB 4KHMA 4WTYA 3MZIA 3JTPA 4MKBA 2W24A 3GZ7A 3E2EA 1S97A 3DOMA 4QW8A 5GAGU 3GILA 3SV4A 4I6WA 4NZ7A 3DYAB 4CO5A 2R2SA 1K9MT 4FF2A 5F8JA 2PSZA 2HGLA 3K59A 3N9UC 3FZ2A 4CH7A 2HNDB 2OFHX 1RK8A 2J7KA 3KHGA 4AL6A 4NCBA 1JLCA 2ZITA 3VTIA 1YJRA 3OV7A 1H2VZ 2N82B 2FB0A 3HF5A 4KV8A 2P9GA 1KEKA 2QA4S 2L9DA 1S0MA 2RVJA 1DURA 2R8IA 3IA0A 1V3ZA 3TQ1A 1VQYA 1N32F 1Q53A 1REVA 3CD7A 2CQ2A 1MWZA 4ZPDA 2F9DA 1UEUA 3PW5A 4GKKF 1C4AA 2W9CA 2YWHA 2JEIA 1TK0A 2ZJPQ 4RUHA 2DHXA 4ECUA 1FERA 1RTIB 1WTBA 4ELUA 3DC2A 1AFIA 3VWSA 3KLVA 2F8EX 2IVFB 2EFNA 1LXNA 3ICLA 5CCLA 3G6XA 2DNYA 2E1AA 4DV6F 1RT3B 3JTNA 3H25A 3FCHA 1KC8T 2DGSA 1Y3JA 2HQ3A 2HWTA 1SJQA 4OZ5A 4DR7F 2KDOA 3F44A 2HYIB 1TV6B 2RU3A 2XMUA 2W7OA 4QR2A 4TLQA 1UL3A 1WHXA 4IR9A 5K8OA 4ECWA 1LWEB 2O5DA 3JYTA 2JEGA 3BN7A 3CD6S 4HT5A 2YX4A 5F0WA 1UFLA 3Q8SB 5AJ3F 5L1JA 1BQMB 1HW9A 4USHA 5D4LA 3THVA 3G6VA 2B56A 3PIOQ 5J1EA 3GV8B 2QA4G 1HI8A 3MM6A 3CCZA 3N0VA 1NKCA 3NRBA 1OSCA 1VGYA 3UDLA 1PC5A 5ADZA 2VFVA 1KVIA 1ZBTA 3SCJE 2D41A 4ITSA 5E33A 1L3VA 4ZVHA 1KQSR 3HDSA 3LF0A 3R5BA 3NBPA 2CG4A 4DR6F 2E5LF 1Y3KA 1F60B 4C0HA 4YB1P 2J6UA 1UA1A 1WHVA 3W2WA 1WHWA 4DV5F 3ZZTA 1VC6A 4RUAA 3NCPA 2UU9F 1HQEA 4IRCA 2FJDB 1HPZA 3C3LA 3IAS9 4XDDA 3NNHA 2NPIA 3TARA 5H1SV 1NNDA 1F2GA 3TVYA 2W8LA 5IQ6A 1WEXA 1DHMA 3QGHA 4DX8H 1X4EA 2DHAA 3LW5C 2KTQA 2FGOA 5KT2A 3G6YA 4DL2A 5LJ5Y 2CQDA 1Q8BA 4RNOA 3I55S 4X2BA 2CJ9A 2PC6A 5I3PA 2HAIA 4DSEA 1XEZA 3VR1A 1SKRA 3D0GE 2DO4A 4DV3F 2EK6A 2P6SA 2XY7A 2OSQA 5F8MA 1PC4A 1RP5A 3N5BA 4WF9Q 1HBNB 5DQGA 1M90T 2ERRA 4LVNP 3PY8A 5EWEA 3LQVA 2FJXA 1Y7PA 2LA4A 1U45A 1XNQF 2GHVC 2RRNA 3IS9A 2HFOA 4CH0S 2U1AA 3P96A 2HHWA 2KYZA 3LALA 3PV8A 2B4UA 4CTAB 4QWEA 3NL0A 2D74B 1N5YA 1YRTA 1MMDA 2GV1A 1IUJA 3P5TL 2PD1A 3PRBA 1HQUA 4O44B 4ZPAA 3TW0A 4DL0C 2FHJA 4WZMA 4O3PA 2PDAA 4MAKA 3K5LA 3I31A 3LH2S 5U47A 2FDNA 2E7XA 2D9PA 2LDIA 2LYVA 5A6WA 2R4FA 4EYHB 3U02A 3HHLA 1B64A 2D7SA 3GYNA 3V4MA 3D1HA 1T3OA 1N0UA 4B3MF 1FJ7A 2KZMA 5L9XA 4F3OA 1TVRA 5DG7A 1PILA 2M3DA 2VOPA 2VOOA 3LP1B 2R8GA 1T05A 1B7FA 2UP1A 4F8RA 4ZP8A 1T95A 1LFPA 4QR0A 5IWAF 3QJJA 4IH6A 3TAMA 4DL5A 1D8YA 4WZQA 1HBMB 2FJVA 4FVCA 3MEEB 4G1QB 2GMHA 3T19A 4JBCA 4RW8A 3IR6B 5J1PA 5F41A 3C6UA 2GC8A 2CPIA 4B9MA 3I9V9 3G9CA 4G1IA 4CH1A 3HO1A 4NCAA 2BW2A 3OTEA 3FVYA 3HVTB 2ZOGA 2SXLA 3OTCA 4KHPF 1FK9A 3RB6A 2YKPA 2JVOA 4ZPBA 4BWJA 4B9UA 2DRAA 1NK4A 4PG5A 4CO4A 4WKRA 3PIPQ 2DNOA 3D28A 3J81Y 2J0XA 4EO6A 4AQYF 3GQCA 2RS8A 4ZCKA 1DFDA 2MKCA 1FXRA 3HZGA 3UR3C 1YJ9S 3TRGA 3UCZP 5KFLA 2CQHA 4G1PA 1LV5A 3NWGA 4DEZA 3M2UB 4USIA 1IXKA 1D9AA 3BEGB 4XAKA 5C25B 2L08A 4URGA 5KG5A 2UXBF 4B3TF 1RT2A 4PUOB 3MM7B 1X0PA 2ROEA 3QIDA 4KFBA 1S0OA 3M6WA 1VK8A 3DXSX 1HI0P 2CFXA 2GQ2A 5D4OA 1QAYA 5DM6Q 3HHKA 4OI3A 1FD8A 3OVBA 2IM2A 2VKRA 1X4DA 2KU7A 4FXWA 1CC7A 3K8WA 2W4CA 5FDLB 1SQEA 2CQBA 3QPIA 4QIWD 3B4DA 3I0RA 4LFBF 1HFEL 1KQFB 1T03B 4JI6F 2JX2A 1AW0A 1Y5NB 3KOAA 4IRKA 3ZZYA 4I4BA 2D9OA 4DN9A 1N48A 2W9BB 1WD6A 2ZHAA 2YNIB 2DNKA 1Q78A 3OFFA 2AF6A 2FTRA 3DOLA 2WONB 2KG1A 3I0SB 1GTEA 2B6AB 3GIIA 1OQ6A 1X0FA 4RNMA 3D0IE 1N4LA 2FVSA 4OHWA 1UVNA 4TNOA 4Y2IA 1IKVA 5AXLA 2KJVA 2AJ4A 1S77D 1YGYA 4YB7A 1VI7A 5E3AA 3TOQA 4EEYA 2FHOB 1ZAVA 4PQAA 3V6JA 2GO9A 3MTKA 4NCGB 5KT4A 3LANA 1R0AB 3KMSA 3H2UB 2KT2A 4LSNA 3UCGA 1C4CA 4C11B 3CDAA 3QLHA 1SH3A 4HDGA 5HO4A 3PR5B 5CYJA 4DQIA 4LF8F 1Y5LB 4KO0B 1NK6A 3P49B 4IR1A 2RDJA 4NMLA 4ZPWR 3HP6A 3NGDA 2VBWA 2YNHA 3M30B 5LSLA 2CJBA 1FE4A 3AA8A 4HI1A 4MK9A 2B43A 2MGZA 1A9NB 1DQ9A 1ZAXA 2FPHX 3DNCA 2RS2A 4V19J 2CPYA 4PG4A 3HHDA 4YQWA 4C8MA 2IAJA 1J5OA 3KLIA 3OHAA 2FJWA 3CCJS 1XBWA 3SQGB 2MHNA 3OFEA 4NLDA 3K0JA 2FHMA 2DNLA 1HYSA 2I8EA 2Y1IA 4J9LA 1UVJA 4A48A 3CMAS 5L39A 3VCDA 4OHXA 2MYFA 4C3KA 2M8HA 1HMVB 1U24A 3FQKA 1X4BA 2YWKA 2X1GA 4RWXA