3O2IA

The crystal structure of a functionally unknown protein from leptospirillum sp. group ii uba
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
93
structure length
93
Chain Sequence
DMHIYELVSRDRTHPVRIYLLHSEYWTEDEFYNLLLEAFQRSSASDWHLQILEVSKYLVTAHGFVEAGGLQEIGFPGELSKTEVRRRINAFLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title The crystal structure of a functionally unknown protein from Leptospirillum sp. Group II UBA
rcsb
source organism Leptospirillum rubarum
molecule tags Structural genomics, unknown function
total genus 26
structure length 93
sequence length 93
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3o2iA00
3O2IA
chains in the Genus database with same CATH superfamily
4DSLA 1QUVA 2VJVA 5CXTA 2YX7A 4IH6A 2MZQA 2R7OA 4F2RA 4DQIA 1C4CA 4RU2A 4F4YA 3K5LA 2XGQA 1ROFA 1WWHA 3K59A 2KJWA 2V2ZA 3MM6B 2BDPA 2E9TA 1HHSA 5EWFA 3KLGA 4C97A 3OR2B 1Q1KA 3U7JA 2CYYA 3PVXA 2FJAB 4IDKB 4IO9Q 2MGZB 1WUUA 2OEKA 3QYYA 1JJCB 4O4GA 5F3TA 2I38A 4R0JA 2DHGA 4N8OA 1YIJS 3L7UA 2A6MA 3MEEA 3GIKA 3QFHA 3PJWA 3I55S 4WYWA 4B9LA 1RBLA 1JXEA 1TL5A 2MZRA 1IR0A 1D8ZA 3NAHA 2X3DA 5C42B 5FJ4A 4Y2CA 1FK9A 4F0HA 5DM7Q 4GMKA 1UA1A 1NRKA 2W8KA 3CIMA 1RT7B 3MCNA 1LXJA 1N33J 3MTJA 2B6AB 3I5BA 3RRKA 5DQIA 2NPFA 3OTOF 2OKQA 4L3KA 1BXNA 2ZJRQ 5D3GB 3CCTA 3F41A 2O3DA 2DNKA 4LJMA 4TN2A 3WX4A 4LF7J 2VFUA 1PAUB 3JQJA 2G4BA 3CJ0A 5A8KB 1RHKB 1VRQC 3EGVA 4LQ3A 4L74A 2AJQA 4QYZK 3KYLA 1QY7A 1O0PA 4N77A 1HQ2A 2JLEA 4F26A 2Y0BB 4AT1B 4IR9A 1HLWA 4OYIA 1YJTA 4B3OA 4MJKA 1WG1A 1NZ8A 3EWGA 3UNYA 4DUTA 3BPSP 3H5UA 4N7TA 1IQZA 3LAKA 1N52B 4NYPA 1BE4A 5HMXA 2NXUA 2YWKA 2V4JB 1RT6A 2RMLA 4OHVA 2CXEA 3ZNJ1 2EKYA 4YB1P 2HKEA 2EC0A 3GYNA 2WB1D 4WTYA 1GT8A 2MY8A 1HNIA 3KJVB 1FWPA 2FHJD 4R5PA 2XY5A 4I2QB 1QDUB 1SUQA 3CCES 5IM0B 4H4OA 2CZ9A 4PKDB 1HHTP 3N01A 4TQRA 3GLJA 2PD1A 3A3NB 3KG1A 5HATA 4L6V3 2GGPB 1R0AA 5G0RA 5BYRA 3V2UC 1WEXA 1D1UA 5H9EJ 2GHWA 3GPAA 2FJDB 1RA6A 3O8WA 4E2FB 2MPUA 2VG6B 2VQEF 3OUYB 1JLEB 5E3RA 1F3FA 1UZDA 2X3GA 2DYAA 2LCWA 1WF2A 3EJMA 1R8CA 3NXZA 2RKIA 3POTA 4DR2J 1F9HA 1KEKA 3CJKB 4OYMA 1WOOA 2EKNA 1SJ1A 3W66A 4DQRA 1V6HA 1HBNB 4YN3B 2HHSA 5HO4A 3IBCB 4ENOA 5KFWA 2MQLA 1CJKA 4ZLPA 3DMJA 1P8GA 2R9LA 9RUBA 2NREA 3QMQA 2OELA 4RUCA 1LOUA 1U1KA 4FF1A 1ZAXA 3B78A 1F6TA 2M88A 1X5SA 3TX8A 2OTLS 2MQOA 1VRTB 4X84A 1V9OA 4DJBA 2LA4A 3K2YA 2XYGB 4OV6A 5T41A 3B54A 3I5CA 3BQ0A 4OZ0A 2FUG9 2QMUB 2ZBQA 1RBAA 2VH7A 5D8HB 3D9BA 3GJSB 3VVUA 2V9KA 3AFGA 4EU0A 4F4WA 1VBZA 1S72S 4BCAA 3RGIA 4WK3A 2GJFA 4ZVTB 2NYHA 1QSYA 3OPKA 5GAHI 4FNHA 1U02A 5HJXA 3IG1A 5GAEU 2LFVA 2AD9A 1IBMJ 2WBRA 4H4MA 1KQKA 4J9PA 1NKCA 1QM9A 4NLPA 4OX9J 1FHTA 2F4FA 4CO1A 3CC2S 4A47A 3FRZA 2YNGB 1F2HA 1ITPA 1I3OB 1IBKJ 2EVZA 1X4BA 4IFYA 4B9TA 1ZA2B 3JQKA 5AE2A 1TMJA 2EW9A 1FKOB 2I1RA 1WDDA 2ZFHA 2AX0A 3B82A 4OIXA 1KFSA 3OHBA 3BF4A 3DLBA 2M8DB 4OX6A 4ZOSA 1VMBA 3LALA 5DJBA 5JVHQ 1U45A 3A13A 1NK7A 2CQIA 1VIOA 5HQLA 2JX2A 4OQJA 3MD3A 1WC4A 1FFGB 3QGIA 1TELA 1PBAA 1WKJA 2ABYA 2Q6CA 1IVZA 2MKKA 1S99A 1FD8A 3EZUA 2MMYA 1S6QA 3K8WA 1HQEA 4R8UB 3S01A 2NZCA 1IJFB 2JVRA 3K0JA 1AROP 3N0VA 3JAMU 1HNVA 1CULA 2J76E 3MEGB 3CMAS 4CYUB 1GMWD 3MEDA 3LW5C 2EG2A 1AYEA 4PXEA 5J2PB 3FZ2A 3OLAA 4L76A 4ZPTR 3NBPB 1VK3A 3IR5B 4Q45A 2ZZNA 1YJNS 4NXNJ 1VDHA 4ZITA 4KIAA 1CQMA 4DV0F 4NLXA 4RZRA 2IRXA 5J1PA 2BJ3A 4CNZA 3MAAA 4YHHF 4F4XA 4X4OA 4LSNB 1XNQF 2HHVA 1HI0P 4PYDA 1CJTB 1DQ9A 1T9TA 4EBDA 3KJFB 4MKAA 2J8SA 4DQQA 1IKYB 3LGMA 2YPYA 1FRXA 4U7UD 1Q8KA 2VFVA 2KXHA 2B4UA 3BM7A 3CC7S 4ED4A 1HYSB 2DNOA 5K20B 5KFNA 4B02A 2LA6A 1XMOJ 5LT5A 1RTHA 2CJBA 2ROPA 3NGSA 2J7KA 2MQNA 1N32F 3M8ZA 1C4AA 3LTOA 3WQPA 3M2UB 4UY85 2C3UA 3T5LA 3GG1A 4TY8A 3CCMS 3HDSA 4ES1A 1LK5A 4QW8A 2XNQA 4QPXA 5KT6A 1S1UA 4DV7F 2R8KA 3HLUA 3EGWB 1O6XA 4MKBA 2L48A 2K3IA 1E6YB 3KNAA 1Y5NB 4KHMA 4NYZA 2U2FA 3ITHB 1Q79A 3D67A 4KH1B 3ENQA 5A2QU 2QG9B 3D3BJ 1RHQB 1X4AA 1PG5B 1FKAF 2PDAA 3I5AA 2BV3A 3PR4A 3QT5A 4K4SA 1WKLA 2P8IA 3IC1A 4PG7A 5IT4A 1RTIA 2IAJA 2BACA 1K44A 1EX8A 4QJVA 1FTCA 1K8AT 1L3UA 2RE1A 4DR4F 1AZSB 5DG8A 2N7CA 3NS5A 1H98A 3BKUA 4PWWA 2E5LF 1Y9OA 3TR5A 3EPGA 1M90T 3C6TB 4LBHA 3CGIA 4DV6F 3ZNUA 4OI2A 4DCPB 3D1QA 2VQFF 5E5NA 2UXDJ 4NLOA 4WPAA 1P1LA 1RT1B 2MZSA 4FXDA 2HVEA 1LNQA 1D9AA 4I6AA 3R1LA 2CQDA 3T5HA 2W4PA 2FJVA 1VRUB 3VZIA 3OTCA 3DI6A 5MLCV 3L7PA 1NK9A 4B9UA 5A76A 3VAFA 4X4NA 2R8IA 2V34A 3MR7A 2J7WA 2ZOMA 3N9UC 3M2VA 2YBVA 5ETVA 4TU7A 1AA1B 1F9FA 1UVJA 3PW2A 3CCJS 3CJ5A 4DL4A 2IBOA 4OHYA 5K8NA 4ES3A 3PO5A 1YI2S 2LDIA 3NS6A 5HK4A 2AGPA 1WHWA 3TAMA 4YR0A 1IKWA 1S12A 2Y8YA 1RT4B 3I0RB 1FXRA 4X62F 3C14A 4OHXA 5F3ZA 4X64J 3QO9A 5CA5A 4LSLB 3UD3P 4OZ3A 4IUFA 2EC2A 4LQ9A 2WB4A 1B99A 3ET6B 1D3WA 2DGVA 4L75A 4WZQA 3FBFA 2VUGA 4J7CA 4PG6A 2OH2A 4ELUA 2QA4S 3IM9A 2NXNA 4K0KJ 2OPRB 1JKHA 3CUNA 2PSZA 2CJKA 3BR9A 1VLOA 1EARA 3NLCA 3UVJA 4Z37A 2E9ZA 5F41A 1S6PB 1C0TA 1Y4ZB 3JQMA 2GCFA 3I0SA 4OYBA 2NZ4A 4ECQA 1PJ5A 3G96A 2CQPA 3VALA 2IJFA 2ASLA 5D0EA 2CQ2A 1LXNA 3MWBA 2PT0A 2L08A 1TL7A 1NK5A 1RWUA 4ZP9A 2ZM6J 1OSCA 1NMEB 3RBXA 4DPUA 3IWLA 5BR8F 4DV5F 4WTOB 3MD1A 3R97A 3O1LA 1QVGR 3AA9A 1ZM9A 4LF8F 1I6JA 4U7CA 1FDNA 4NASA 2VODA 3P5TL 4DL0C 3KLGB 3W1YC 2HWHA 3FMWA 3DRPA 4K4WA 4B9SA 3ADAC 3ELHA 1T9YA 4C7QA 1AB8A 4C8LA 4NEZA 2P9GA 4O4GB 3CDAA 4DR3F 4Q44A 2JEIA 3MFIA 2JEGA 4FVMA 4IFVA 3MEEB 3BSNA 2RH3A 3CDUA 5HQ8A 2GQCA 2C28A 4ZVEA 1W2BR 1FF2A 4AL7A 4OMFG 2DPIA 3U1LA 1PKUA 3J7Z5 2BVZA 4RBUA 3JYTA 2R42A 3HF5A 2DGOA 1KR4A 5DDOC 4IOAQ 3JB9k 2RRBA 4DSJA 4DL6A 3MMJA 3W8PA 4M5GA 4AE5A 3QWPA 1FK9B 4KTQA 2OJ3A 3G86A 2XLJA 3HHDA 4FPRA 3BSOA 3UW1A 4DV3J 2ASJA 3M9OB 3NGUA 1NK6A 2Q79A 2JZ5A 5AE3A 4TXSA 5U47A 2G0CA 2FVPA 2XSFA 4ITSA 3Q0AA 5H9FJ 1M1HA 2FJBB 1R89A 1RU2A 2BJEA 2XO6A 3MZIA 2LYVA 4X4UA 2DGTA 2DXDA 1O51A 4PAAA 2B51A 4C3LA 2JC1A 1RA7A 5K14A 4EO6A 4LIRA 3CDBA 2WHOA 2GO8A 2VA3A 1EP4A 1H73A 2YWGA 1LV5A 3G8QA 1IWAA 5I3QA 2J6TA 4G1IA 3V6KA 2GQ2A 2LQ8A 4B3OB 3CD7A 1B3TA 4ZLJA 3CO9A 5CYJA 2JHEA 3BREA 2C2OB 4EEYA 3V4IA 5ETRA 2OLWA 1XN9A 4B3MJ 1M5PC 1VYAA 1X31C 1RT6B 2RQCA 5KT3A 1TKZA 5L1JA 3AQPA 2DO4A 1S9GA 1UEVA 1UETA 3SCIE 4DCJB 2KXFA 3R9LA 1HI1A 2ZH3A 5G4DA 5A0YA 1K0TA 1TK5A 2NXCA 5I42A 1HNIB 4R5PB 3UCZP 2D3ZA 2HS3A 2VFSA 5H9FK 1SUQB 4U95A 3Q89A 4H4OB 4K59A 2CPYA 3OTEA 3CO0P 3HJFA 4PWDA 3PFOA 1WSRA 5SZTA 4UTGA 4BBYA 1YRTA 2DEIA 3MUMP 4YDXA 4DSKA 1EKSA 2MZTA 4RUHA 2KYZA 1YG0A 1R0AB 5G0RB 1REVA 1SC1B 1X4HA 5F0UA 4JI0F 3THVA 2OFGX 4NLVA 2YNHA 5IT9U 3M32B 2GIQA 3O2IA 5K5MA 1NLKL 3ZZTA 3HCXA 3OL7A 2AYBA 3EGNA 2RKIB 3POTB 3Q8VA 2GX8A 1TUVA 1ZPWX 5C24A 1CJKB 3QBCA 3PYFA 1ZZFA 2HAFA 5E2QA 2XEXA 3NNAA 3IWXA 5CYMA 3W9HA 4WIIA 3IR6B 2X1FA 2XMVA 2R7XA 2BE2A 3PDNA 2R8HA 1S1WB 3M2RB 1X5TA 2E7VA 4ED3A 4EYHB 1IBLJ 1RTJA 1SC3B 4CLWA 3D0IE 1HKAA 1ZM3A 3JSBA 4P75A 4ZKAA 3ZZPA 4P10A 1U6BA 3UR0A 4W98A 2XC9A 1HHQA 2YX1A 3KOAA 2I5JA 4O3NA 1TMMA 1JLQA 2ZD1A 2E1CA 1NK8A 2GNKA 2DPJA 2QFIA 2ZBRA 2COLA 4LUBA 5L1KA 1MWQA 4LVOP 4OHZA 2RT3A 3SFUA 1NJZA 4F3MA 1TR0A 4ED2A 5F8GA 2ZBIA 3PXGa 2V8GA 1H2TZ 2LQ5A 1P27B 4QIWD 4HHJA 4ID5A 3IG1B 5HVGA 3NKYA 4DFKA 3OT9A 2HNYA 2DBBA 1HD0A 1LFPA 4RPFA 2YKQA 4H4MB 1IJEB 3BQ1A 4KRWA 3EGZA 1GX5A 1I51B 3EUNA 1CSJA 1S0NA 2KT5A 1W26A 1SKSA 1WJ9A 2FY1A 1JLBB 4IFYB 1IKVA 1Q0NA 1ZM4A 3VAMA 2HGLA 2HVDA 3GILA 2KXNB 5KFUA 1WKKA 1UJ6A 2F8HA 4F36A 5GADI 3OW2R 4OL8A 3DKDA 2QSFA 4KKOA 2GS8A 4W90B 4UOCA 5LJ3Y 1Q4RA 2NUUG 3R1HA 2DNRA 4Y28C 2ZE2A 3OTOJ 1RXOB 1FJ7A 1CEZA 1VISA 1YHQS 1WOSA 3C16A 4DR5F 1S6QB 1HNZF 3TEGA 3TNVA 1FNMA 1Q53A 1HQEB 3UN2A 4R25A 4N76A 3QIPA 1N56A 3GFXA 4Q8EA 3SXLA 1HNVB 3RAXA 1CULB 2LKZA 4ETXA 5AT1B 1WEZA 1YJ7A 3M8YA 4OZNA 2D74B 3SCJE 1HFEL 1TP7A 2AX1A 1TKXA 3MEDB 3WIUA 1KQGB 2BMBA 3AJ1A 2I6WA 2IM3A 1FFWB 4HI1A 5ETOA 3OQ2A 3BBBA 2FJXA 5HL7Q 4JI8F 2HYIB 2GHPA 3CCWA 1FNXH 5FLXU 4USTA 3MMCA 4B3RF 4X65J 3MAAB 2QLWA 4F25A 2DXFA 4NXMF 5DZ7A 3V4MA 1AUSL 3D5MA 2QL5B 5LMUF 4CO4A 3I9V9 1SQFA 2QYCA 2RRAA 2CQCA 5LM7E 4RWXA 2EPIA 2YH0A 2VJUA 3C66A 3FCHA 2JEFA 3BR8A 3P49B 2ZH1A 2ZBCA 4XDCA 3VGVA 2DHAA 2MKIA 5IC4B 3KK1A 1QAXA 2GHVC 2HFZA 3P5BP 4ED6A 1LK7A 5KFYA 1UEUA 3I82A 4C8ZA 4N8NA 1RTHB 1VLYA 4DX8H 4A8OA 4ECXA 2VQEJ 3PO4A 5M2PA 2W9CA 2BA9A 3LGHA 3R7NB 4TY8B 4P2FA 4IH5A 5BXIA 3M4XA 5C7PA 2ILZA 2R7QA 1NDCA 1OQ6A 4JV1A 3LP2A 3VGTA 1S1UB 3E01A 4LF7F 2ATLA 3L3CA 1LW0A 3NAIA 3D6FB 3B8HA 1X60A 3TJ9A 2EBEA 3OVAA 3T9ZA 3HT0A 3H8YA 2ADBA 2ROGA 2QMXA 2HHUA 4CNYA 5CQGA 4LF2A 4NI2A 2CJ9A 3HJVA 4QWDA 4LF4F 4BHQA 1U4BA 2B9XA 2QJ3A 4C98A 3BB5A 4NRUA 1RTIB 1QE1A 4JV2A 1Y3KA 3U1NA 3W2WA 1SH0A 3AD9C 3M6UA 2IAJB 4E8UA 3K5PA 4ELTA 3ZC4A 3GYXB 2F9DA 4CLLA 4JV0A 1MMLA 3KNGA 2K1RA 2XI2A 1BC6A 1PC5A 1KHWA 4A46A 2G9OA 3QRPA 4X4RA 2P6TA 1D0EA 1SKWA 1G2EA 2FVSA 4ELVA 2UV8A 2LU1A 3NCPA 3TZYA 3G6VA 2E5IA 5HMZA 3QJLA 4A8MP 2KZZA 1CQNA 1Q86T 1B0VA 3OL9A 2A2CA 3MCMA 3PACA 3DI6B 4D3GA 3SDEA 1F9EB 1MROA 1U26A 5F8IA 2I8EA 5IOLA 2N4CA 4UOFA 3EZOA 3MTKA 2X1GA 4MFBA 2BQ3A 2CAJA 3I56S 3M2VB 3FSYA 1X9SA 4DR2F 2OAUA 4PWUA 4RKUC 2B7CB 1HR0J 4KPYA 4LIWA 1FRLA 3TQEA 3T3FA 1EKRA 3SIPB 4NA2A 4FPIA 2FY8A 3EDRB 3QGGA 4WKYA 2UUBF 1SBRA 5JVGQ 2GA7A 2XS2A 5F8NA 2FJEB 3TAMB 2XMTA 1IKWB 2CWXA 2Q66A 4IG0A 1I1GA 4CLZA 1XC9A 3C14B 3MUVP 2PMHA 1JB0C 3JXOA 1VHFA 5C2GA 3PYDA 2V67A 2IA0A 5DG9A 1JJ2R 2UVRA 5HP1A 2B8QA 1FEHA 4USKA 2FGOA 4OX8A 2YQ3A 4CO3A 5KG7A 2R8JA 4A8XA 1GMWA 2W4DA 2RNEA 3JSMA 1JKHB 3LWMA 4DR7F 2J6SA 1FXDA 1C0TB 3IGVA 3I0SB 2RUGA 2IDLA 1EETA 4L3NA 4AYBD 3M6WA 3KLHA 2NUHA 4X4SA 1NUEA 5EN1A 3Q2TC 4J9OA 2PIIA 3A3OB 3DLJA 1TL7B 2VFRA 4ILRA 4DV0J 1T8EA 4YY3F 5D15A 2HFVA 3NGTA 4LREA 3CJ4A 4K4XA 4K4TA 3ISZA 3QAUA 2ALYB 4YHHJ 2RVJA 4G1QA 1RCOB 1UVLA 5C2CA 1XNQJ 1SC4B 1N4LA 4RLEA 2HAIA 4C4WA 4I67A 4DN0A 2BBEA 3ENAA 1R6YA 3D0GE 3KWMA 3DRPB 2FZCB 3HVWA 4ECTA 2PFDA 4AQYF 3KMSA 3BH6B 4Y00A 1LQ9A 4USIA 1U0HA 4NWBA 3JTNA 3U02A 1SKRA 1VQNS 3SCKE 3SSQA 4DS4A 2XMKA 2VF3A 2XZWA 3R2CJ 1S76D 4PEOA 3MCOA 1YRXA 4DL3A 1RB0A 3JYTB 4EGLA 3H4DA 2WW4A 4DV7J 3P3DA 4ZP6A 4WK1A 2H48B 3G6ES 3FBCA 2M3DA 4LRFA 2IVFB 5J2MA 1JNRB 1N5QA 1C0UA 5KT2A 1U2RA 3DU5A 2BOAA 4WU3A 4DFMA 1X4GA 2D9PA 5FIIA 2H51B 2FLNA 2YKNA 4OYPA 4Y2IA 5KFPA 3OV7A 4DX7A 2EFPA 4CLYA 3UCGA 4YB6A 4FYYB 3PIPQ 1BMQB 1TL1B 3TJAA 2ZHOA 5JUMA 2WW8A 3FSIA 5K14B 1GMUA 4DZ6A 1PYSB 2QEXS 3ILOA 4YB5A 1RHMB 1PYOB 8ATCB 4DR4J 2OGUA 1EP4B 4DOZA 2YKAA 2CNNB 3UNGC 4V1Ak 1J5OA 5CD4A 1H72C 1T94A 3K57A 2E5LJ 3VGUA 4DV6J 4WF9Q 1TK0A 3I32A 5HVFA 1BHNA 4TYAA 3SBMA 3GR1A 3MR2A 2VQFJ 5E3CA 2Y1IA 1RACB 2RRNA 1YZ6A 4CCHA 4CDIA 4PXCA 3T1HJ 1V5VA 2DVIA 2O5DA 1URNA 3V4IB 3RBEA 2JEJA 3O44A 2HS0A 3MECA 4M63A 2E5HA 3RAQA 5EHHA 2Z0GA 1GXTA 1TKZB 4KO0A 3CULA 1S9GB 1NXIA 2QLBB 5A0YB 2OSQA 4HT5A 2J8AA 2KU7A 5I42B 1WI6A 4JI1F 1D09B 3UO0A 4ZVUB 4PWDB 4AFFA 2DGWA 2ZKUA 2XLKA 4DV4F 2C1EB 4WP9A 3WC2A 2MB0B 1PJ6A 2UXBJ 5KFFA 3SFGA 1AW0A 1REVB 2M52A 1T03A 1XJWB 1OPIA 3J81U 5DDPC 4X62J 2HVHA 4EK2A 2YNHB 2D7SA 1JQGA 1U6ZA 5GVQA 2KJVA 1QUPA 4CO5A 4HEA9 4USUA 4ECUA 4ED8A 3RRHA 2JOQA 1BWVA 4J9MA 1JLCA 2R2UA 4NL5A 1OIAA 2GJ2A 1SI9A 4PQUA 4C2MA 5C24B 1RE1B 4GVLA 1ZAWA 5CYMB 5IV4A 2BE2B 2ZC4A 1SIWB 4USWA 4CO2A 3KHLA 1RTJB 1IKXA 4DQSA 1VQ4S 3RTVA 2GIRA 1TAQA 5LSLA 2R8GA 4J91A 4DEZA 4P2XA 2LDYA 4K50A 2R7TA 4ANEA 2XM3A 2KZMA 3Q8YA 2RQKA 5AXNA 1HWJA 5BR8J 2CUYA 2I5JB 5EGYA 4DV5J 1RAFB 2BRLA 1JLQB 2ZD1B 4ICLA 4RUAA 1S4EA 4IG3A 2ROEA 4OHWA 3TUIC 2XY6A 3ETOA 2PA8D 2HPUA 3Q8QB 2CDQA 4O44A 1T9UA 4KT0C 4RW7A 2GMJA 1U1RA 1Q7YT 4ID5B 4NZ7A 4QOTA 1P9QC 4M5LA 4DR3J 4DI6A 2JNJA 2HNYB 3BEGB 3H7HB 1TTHB 3GJTB 1RBOB 2J9EA 2DH8A 3H2UB 3NGRA 3EVMA 4UZBA 2XNRA 1M5VC 2P5VA 4B9MA 4XO0A 1NDKA 5D4NA 1YKWA 2FVCA 3E51A 2YKOA 1LWEA 2C42A 3CCRS 4RW8A 2QL9B 1IKVB 4P7VA 3K89A 3Q8UA 3BZQA 4P9SA 1RWVB 2EXUA 3PEHA 1FESA 2OP5A 1XR6A 1ICEB 2G0JA 3JS9A 4PG5A 4GC6A 4WE1A 1GXUA 1KTQA 2C2DA 4KKOB 5GAHU 5E41A 1GTEA 3MMAA 3CW2C 3N5FA 1IR2A 4CLKA 2W2MP 2ZE2B 3QZ8A 3SQOP 4OZ2A 4OJHA 3C16B 3LPEA 2BM0A 4Q43A 2B9WA 9ATCB 4ES2A 1K1QA 1RI7A 2E7WA 4F0MA 5KFAA 3ISNC 3DLEA 3W5YA 2AJFE 3UE2A 2M7SA 2DTJA 2AW0A 2IM2A 3PX4A 1CS4A 4NCGA 1RAAB 2W7AA 4OZ1A 1CC8A 1MN7A 2H54B 2B8PA 5FDLA 1PCAA 1TKXB 2ZITA 3QT6A 3HHLC 2UU9F 3FNNA 3M30A 4WWSA 2Z4PA 2DD8S 4QIEA 3PW7A 2HWTA 1RHRB 2KG1A 4DSFA 2FDNA 3LP0A 3DFEA 2HVZA 1N5YA 1MW7A 4ZIWA 1L5UA 2XHCA 3GU0A 1Q78A 2IA6A 3I4PA 4Y65A 4DX5A 3H40A 3HSJA 2E7XA 3W3SA 2Z30B 2QFJA 4RW9A 1BY9A 3IGNA 1EIYB 3OFFA 4N56A 3CDEA 3ZZZA 3MAHA 1F5CA 3GB0A 2KRRA 4USJC 2XYPB 1BQNA 2CG8A 3QPIA 1F0XA 4ZDNA 1S77D 2YKMA 4ZVPB 1G6BA 4FKXA 4DDFA 2DNQA 3IWNC 1LWCA 4HDHA 2EK6A 1NJWA 1CG2A 4GO7X 2GZOA 3KK1B 3AA8A 2J6UA 1M5SA 4NZ6A 4E98A 4JI0J 5KFIA 2GFFA 3UDEA 3DLLQ 3G6YA 3KK2A 5A8RA 1B70B 4EBCA 3LP2B 3E01B 3OXGA 3AXMA 2DRAA 3IR7B 1VQSA 1T9VA 2DHHA 2BJDA 1LW0B 2QX0A 4K7QA 3NGDA 4ECWA 2NCKL 3EX7B 3BDPA 2R7UA 1VQMS 2HIQA 2W2QP 3S1TA 2QZ8A 4NI2B 2MHEA 3OFGA 3GJQB 2DR5A 3QZ7A 4PQAA 1D9DA 1LWFA 1WG5A 3HI9A 2AZ3A 4RL1A 1QE1B 1WC5A 2MKHA 2UXCF 3W2WB 4WXOA 2XS5A 1S0VA 1YJUA 3CWJA 5CAAA 3Q83A 4WCEQ 4B3MF 4RBTA 1GNKA 3GFYA 2K1RB 1UFWA 2D9OA 2AF6A 1ZTTA 2VBWA 2YX4A 3WIVA 4DLGA 2H5IB 1K47A 2KFNA 4CH1A 2HVIA 2MZ1A 2GJIA 1IM6A 1KONA 2DT9A 1S1TA 2QMWA 4C3MA 4JI4F 4V19J 3NMRA 2HURA 2XMJA 2ZH6A 1FTRA 3ZTSA 4K4ZA 2JJ4D 5KFTA 1UPMB 1GAOA 3Q8PB 2WSCC 1Y00A 3J80U 2QIFA 1RAHB 1KOHA 3FRYA 3DLGA 3SDEB 2ZJPQ 4F02A 1MROB 3FFIA 1ZPVA 3O6QA 2W2OP 4N5SA 2IC3A 4MT1A 4AL5A 4MFBB 1IUJA 1HPZA 1R7IA 2DNPA 5K9FA 3EICA 1W2IA 2KTQA 1S5ZA 3J7A1 3DOKA 2L3MA 2G13A 1XIQA 4KPCA 3DN9A 2QSWA 4X4TA 2CPEA 4IG0B 1EJ7L 1HW9A 4TNOA 4WBFA 3QFWA 2F4VF 1A9NB 4JYAF 1NKEA 2XTJP 3TZWA 2QE5A 4ZPWR 2E5GA 1KVJA 4DR5J 1HNZJ 5HP1B 2A10A 4MYUA 1SIZA 5KFJA 3PX6A 5DDQC 3MM7A 4GRSA 5I4MA 2DK2A 4NPOA 1J5EF 2AQ4A 2HZVA 2HNZA 3JSMB 3BO4A 2K7KA 3ETMA 4KQZA 1BLUA 3HO1A 2CRLA 5K8OA 2XZDB 4YMEA 3KUEA 3WZ0A 1EETB 4G6VB 2KN4A 2HIYA 2DY9A 4C8YA 3J7YI 4HYKA 4LFBF 3MPVA 3KLHB 4JI8J 1NH8A 1RWPB 2FLLA 2KDOA 2XO7A 4QYZJ 3KG0A 4NMLA 3UPFA 5KFVA 2VHGA 1DAXA 3LQVA 1WC0A 4B3RJ 1KQSR 5HJYA 4LRDA 2ZHBA 3A3PB 1Q7LB 2DCUB 4ZPVR 3BBFA 4NXMJ 4G1QB 1WHXA 4ATNA 5LMUJ 1N5VA 3RB0A 2GIFA 5BJRA 2W1BA 5A6PA 2VG7A 3OR1A 2B4OA 3AT1B 1DRZA 3KFWX 1X5OA 5B0FA 1YRUA 4J9NA 2C3YA 3DRYA 3CDWA 4IO1A 2RDIA 2E29A 3RUBL 4RO0A 2EK1A 3H5SA 3AOCA 1S7HA 1S1XA 1TFYA 1U0HB 3AB2B 4UZCA 4U96A 5A8WA 4ZVRB 3CJ8A 2RD5C 2DNMA 4HDGA 3OJUA 2A3JA 3IS9A 1YDLA 5D4OA 4MIAA 2MLYA 3D4JA 1JMTA 4RNHA 4ZLNA 4AXIA 4ANDA 5CD4H 2GVZB 3W7BA 3V6HA 3BO2A 1IR1A 2VBYA 3CC4S 2ACMA 5L9XA 2XMAA 5KFEA 2F8EX 1C0UB 1YVFA 1XMQF 4O3SA 2Z2LA 1Q95G 4XK8C 2F9JA 1FE4A 1KSPA 3HVRA 4OI4A 3MM9A 4HTIA 2HS4A 3QIDA 2YKNB 3O3LA 4LF4J 4KHPF 3LAMA 1RISA 4KGKA 1JK9B 1HNWF 1D8YA 1GX6A 1SKUB 2IIHA 3B4DA 3B6BA 4IDKA 4GC7A 1X4EA 4KH0B 2V9WA 2K06A 3D68A 4DMZA 3CF5Q 4ECRA 2PI4A 2XLIA 1T0TV 4LRBA 2HQFA 1SC6A 4X65F 2YWWA 2VOOA 5DDRC 1J5OB 2QO3A 1NHUA 2EWHA 2F7VA 3M8RA 2WSFC 1FA0A 3NNHA 4X4VA 3LANA 3C8YA 3U27A 1DLOB 2AGOA 1RZMA 2GAHC 2ZOFA 3CE8A 4ERDA 1U2FA 1PO6A 1NJXA 4DV1F 2Z2MA 1N54B 1UEKA 2AEFA 3MECB 4NMXA 5IV3A 2YY3A 1FXLA 1NDLA 1RABB 2MKSA 4KO0B 2ADCA 2VU5A 1R31A 2B56A 2OI2A 4QWEA 1BUXA 4CH0S 1S57A 1VQ8S 1FRIA 2L9NA 3HD1A 4ED7A 3UDVA 2RU3A 1B64A 2B43A 5IS2A 4USHA 2DNHA 2DNZA 4JOUA 2HRTA 1OS5A 4K4UA 1U09A 1BQMA 1KD1T 4FXWA 4NA3A 5KG3A 3JSYA 3GFHA 3DU6A 2UUBJ 1IWGA 2XZTB 1VC6A 1ZM2A 3BGUA 2KRBA 2Q43A 3HXMA 1T03B 2AYMA 4DPXA 2IRUA 1JXVA 2ZKTA 1U0SA 4RBVA 4ZA1A 3AD8C 3HMJG 3FSXA 3PYGA 2YH1A 2D3O1 1SJRA 1PC4A 1XEZA 2VPZB 1XBWA 1JLCB 3PV8A 3IMQJ 5F8LA 5HROA 3GIJA 4ILLA 4EUVA 4PQUB 2KT3A 3IN5A 3SSSA 2ZOGA 2DIVA 2AYEA 4DR7J 3RB6A 3V81A 3KKFA 1PJ7A 4RNMA 3FCVA 4WZMA 2C3PA 1VI7A 2ZWOA 3MCSA 3A8EA 1KLNA 3HVAA 1TK8A 3ZTOA 2CKWA 1IKXB 1CJVA 5KG6A 2WONA 1L3VA 1R43A 4AL6A 3TW0A 2XHWA 2QLFB 1T3OA 4LF6F 4YR3A 3VAKA 4YY3J 2RU9A 4ZCKA 1FERA 2XS7A 3C2PA 4USMA 2JVOA 3IFEA 4ICLB 3SV4A 1SJ3P 2N3LA 3D28A 4IG3B 3OUYA 4LFAF 2QLXA 1XERA 3PR5B 2CWKA 3DLKA 4QZVB 4O44B 1UWAA 4FXVA 4K4VA 4RW7B 1PIEA 2OHDA 3CIZA 1HBNA 1H2UX 1EQ0A 4AQYJ 1HR0F 1OYDA 3NEKA 1UVMA 3FVYA 5JXSA 3ZFVA 4WKRA 3T41A 4A8QA 5I3UA 1H7XA 1WHVA 4LMZA 1Q5YA 2AEMA 3ZO7A 4WIQA 1KFDA 3NOCA 3AD7C 3W2VA 4UUXA 5IFMA 4F2SA 4B3SF 3PFEA 1X0FA 4BS2A 3M8SA 5KFHA 1LWEB 2WOMA 1V5IB 4RW8B 4J9KA 2XY7A 3W9JA 1HWKA 3E2EA 3LO3A 3H5YA 2HHTA 1P6TA 4WE1B 2CIMA 5D0GA 1FRHA 1G4CA 4M5IA 3KXDA 5HSPA 1RKIA 3R7SB 3MMAB 3FEZA 1N8RT 5D0RA 2MQMA 3D66A 5KFGA 2CG4A 1L3SA 2CADA 5ETNA 1TUWA 3N6MA 1RDRA 5J2QA 4NLQA 3KHGA 4K8RA 1Y10A 3PX0A 3R3TA 1ELOA 3DLEB 2CPXA 1DTTA 3BGFA 1RAJA 2V69A 3UN3A 1CS4B 4NCGB 4LF9F 1RTZA 4WXWA 2CJAA 5FDLB 4P72A 3DRSA 1S0OA 4ETZA 3M30B 2AIRB 2PFFB 5GADU 1PYTA 2DO0A 1RU1A 1DARA 2ZVIA 2XSJA 3LP0B 1KS2A 3OHAA 3QGPA 4C6AA 1Z2ZA 2ZWPA 1B4SA 1N5YB 2YPZA 3D6TB 1FX2A 3TYTA 3EM1A 1WSVA 3AQOA 4O3OA 2GQQA 4CI0B 2VBZA 2W25A 3GSDA 5KT4A 3DM2A 4FKYA 3QT7A 4ZN3A 3BH7B 1FVSA 1RAIB 3E3XA 1SL2A 3HHNB 1AFJA 2V6AA 4RW9B 2APOA 4WFYA 4M5NA 1H38A 4JI1J 4D3HA 3LGNA 3I31A 4ZPCA 5ETKA 1BQNB 4JI5F 3DOLA 4P52A 3IAM9 1RT3A 4DV4J 4FP9A 3FCWA 1LWCB 5ETQA 2KKHA 1WF0A 3GV8B 2D69A 3F73A 3J81j 4WP3A 1HMVA 2G0IA 4I2PA 2NXEA 5KFLA 3ZTRA 4KB7A 1GQEA 2B9EA 2M0GB 4FVCA 4Z2XA 3R5GA 5KG4A 3PHEA 3RW7A 2K8GA 1P1TA 1N34F 5HAOA 1WC3A 4A8SA 2W9BA 3KK2B 1W7WA 1FDAA 5A8RB 3PEJA 2CJYB 4KGZB 4BWJA 1SJQA 1UCNA 2Z57B 4URQU 1RSCA 2W7OA 2CZ4A 3HFVA 4ZVFA 2HFNA 2Y8WA 4F04B 1VCTA 2MDAA 3CCZA 4DUZF 4F50A 5B0GA 2DNGA 4KBIA 4JI2J 1REGX 2UP1A 4P2MA 3C3LA 3VQSA 2V8HA 2LQJA 1KQFB 1NAQA 4CZCA 5CHCB 1IN0A 4J9LA 2ZJQQ 5E3QA 2D41A 2ZZMA 2VASA 3H0PA 1LWFB 4WP8A 1V3ZA 2KI2A 3T1HF 4WU2A 3MOJB 4MIWA 4H54A 1YJRA 1UJ4A 1SL1A 3HKWA 5IXUA 3G2XA 4G65A 2OMOA 4PG8A 4IRCA 2N7YA 4B3TJ 5GAGI 4FF3A 4XPCA 1HBMA 1S48A 3Q2SC 3KJQB 3CCUS 1H3DA 1JIHA 2PGCA 1S1TB 3NWRA 2CVEA 3R5AA 2Z8QA 3LP1A 4ZK7M 1A0OB 3MM5A 2C2NA 1U1OA 1IBCB 3G6XA 1UVNA 4OYWA 3ONQA 1N6QA 3CB4A 4ZCIA 3ITHA 3NG8A 4HHHA 4H4KA 4ER8A 2UXBF 5AJ3F 4WFZA 5JJBA 2RHSB 2M8HA 4Y2MA 4ECSA 3DLGB 4EYIB 1SL0A 3FFIB 2HHWA 4USVA 3JAMY 2IC3B 1JLAA 2AZ1A 1HPZB 2PA3A 2HMIA 1APSA 3ISND 1VBXA 3MI7X 3BN7A 1RUSA 4UUWA 3US5A 1SH3A 5K8PA 1IXKA 1TL3A 4QIGA 4TKTA 1JLFA 3HHLD 5SUHA 4TYBA 4CM2A 4RWWA 3C6TA 4Q8FA 5C5JA 5CCMA 4IRKA 3BJYA 3BO3A 2MJUA 2RF2A 1HARA 4KGXB 3MXHP 3BYRA 3A8JA 3ZZ0A 2N82B 4HLBA 3IXQA 1H0HB 2V2KA 4ZP8A 4TU8A 3G4SS 5IC6B 2CNLB 1KVKA 3MM7B 3W63A 5BYQA 3FKBA 2OD6A 4Y34A 2BM1A 2HNZB 1OY8A 2KG0A 4ZLLA 4DSEA 2IBKA 2D3OR 2MZJA 3KK3A 2UU9J 2V0NA 3IA0A 4HL9A 2HBRB 2MTLA 4RW4A 2C2MB 3W5XA 1FNOA 1ULRA 4YOEA 2JH3A 1WG4A 2VPWB 3VZHA 3LOUA 3T5JA 3WBZA 3SI8A 3P8BB 3FBEA 3KLEA 3VQTA 5D6GA 3ZTQA 4OFZA 1X4FA 1IQTA 3WDOA 4O0NA 2BJ1A 4CLFA 2VFTA 2Z2ZA 3HZGA 1M5HA 2FB0A 3PRBA 2GV1A 3W60A 1FDBA 1YJ9S 2MXYA 2VG7B 3OR1B 1NSKL 4IRDA 3WHIA 5A2QY 3OL6A 4OLPA 4OX7A 1VQOS 2CVIA 4X2BA 4PABA 1V3SA 4DFJA 3HKZD 1Q8LA 2HQIA 4DG1A 1S1XB 2V68A 5B08A 3D2WA 4CO0A 3TANA 3NL0A 5A8WB 3ILJA 2D1CA 4J90A 1L3KA 4KYZA 3IS9B 5ETTA 4TVAB 2GMHA 4KR0B 2CFXA 5LSRA 1RLCL 2DRBA 4NCBA 2HQCA 4C0OC 1C2PA 2VZ9A 1QSLA 1R27B 3MMBA 1X4DA 1JLGA 5I3PA 1TKTA 4TU9A 3AY0A 5LL6d 2H5EA 4OV1A 1T9XA 5DQGA 2AGQA 3AB4B 3Q86A 1ZA1B 2F40A 4X4QA 3KUGA 5KFXA 5KFDA 4PR6A 1NB7A 3MM9B 3QRRA 1VIXA 4O3QA 3LUYA 3GR0A 3M6XA 1VQYA 5L39A 5IWAF 2GAGC 3SEOA 1JX4A 1NSAA 2YNIA 4ID8A 2ZH5A 4DR1F 4A8WA 1PILA 5DETA 1RT2A 3RB4A 5E3PA 1KLMA 2UXCJ 3UFCX 2HQDA 4KSEB 4MIBA 2E5JA 1MWYA 4DS5A 2POKA 5AXLA 2ZHAA 4YB7A 3EDQB 1CJUA 4IYQA 4DQPA 2HSEB 5KG5A 3GG0A 4NLRA 4U6PA 3N79A 5EX0A 4ZVOB 4TLRA 3RZAA 3TA2A 2YNFA 2IMOA 4JI4J 2OD4A 1UW9A 1OQ3A 2E1RA 4X66F 1ZBTA 1OSDA 1U8WA 4F3QA 3T6BA 3K5OA 4PPDA 4IQXA 3F56A 3R5BA 5L38A 1S10A 3RB3A 4M5DA 2DR9A 4C8MA 3VVTA 2CJQA 4I68A 2LP4A 3AHPA 1DQAA 1FI4A 2IVMA 3CCLS 1TAUA 2DIUA 1VJQA 2OIHA 1HW8A 4C11A 2JSXA 2WK4A 2V94A 4OYZA 2PE8A 2Q3PA 2ZVSA 4F4KA 2CQBA 1MN9A 3W65A 2DRDA 1BQMB 2LEPA 4QU6A 4CTAA 4LFCF 2OPQA 1YJVA 3E8OA 3OFEA 4DHVA 4UT4A 5B0EA 2QC3A 3NY0A 1QSSA 2ZUGA 3DMJB 2VIHA 4HI2A 3AH6A 3Q22A 3CJ3A 3MPWA 2F4VJ 3I96A 4JYAJ 1DQ8A 3QRQA 2YWEA 2FPHX 3M1VA 1MU2A 4XPEA 2A6OA 2H5JB 4L73A 2W2PP 2VBXA 1VQ9S 3W9IA 2RSQA 1J5EJ 1ZS6A 5HROB 4NLUA 4MKYA 3V81B 2OPSA 3H59A 2ZC3A 3RW6A 1H74A 2V4RA 5RUBA 4ZP7A 5LXYA 5AXMA 2AV5A 5DM6Q 1KVIA 4M1KA 1GTHA 2BANA 2VPXB 5L46A 2WVBA 3MAQA 3S7RA 4C48A 4DU8A 4LFBJ 2P6SA 1CJVB 3DGPA 4FBTA 2WONB 3V6JA 1FEEA 3L7OA 4LVNP 2YQ1A 2E1AA 4ALZA 1QTMA 2R7VA 2ERRA 4ANCA 1QAIA 2F1FA 1HBUA 4UW2A 3M32A 4DX6A 4M5MA 3WC0A 3TRGA 5LSOA 4I1TA 3DLKB 3GE9A 2WTFA 2JFDA 4N41A 4DR6F 3TWZA 4WYLA 4C0HA 4DXLA 3QJJA 4RW6A 5L9NA 2CDRB 3DYAA 1WELA 3GIMA 1TUGB 4FF4A 2KO1A 3T6JA 4QIFA 1R3NA 5I3UB 1KOOA 4OJGA 2U1AA 2LQ9A 5LXRA 2HW3A 2A1BA 2F65A 1S1WA 3G8TA 2EI5A 3M2RA 2ACYA 2HGNA 2IYGA 3W2VB 3EVWA 1C1CA 3QLHA 4U9RA 4GKJF 1G1XA 3PW5A 1PBUA 2Y9HA 2BQRA 4W92B 3OVBA 1FCAA 2WOMB 3KDNA 2Z58B 1FRKA 3KMQA 1FDDA 2W24A 1YWXA 5KFSA 1OY9A 5B0CA 2X7IA 1XMQJ 1WDTA 4Q5VA 2V2VA 5CYQA 4V19X 1RAOA 4HHUA 4QCLA 5KFOA 3RG6A 5F8JA 5CABA 1LFWA 3SSRA 2KT2A 3RYLA 1UWBA 1HWIA 4KHPJ 4FYDA 5H9EK 5ETLA 4DUYJ 4E0DA 2WZ1A 2AKWB 5E7OB 1KN6A 1HNWJ 1RHJB 1X7VA 5J2QB 1U8SA 2MY7A 3TUZC 4QWCA 2QV6A 3AJ2A 2ZH8A 3A8KA 2ZNZA 4HVZA 2ZDPA 1YBTA 5J1NA 3TUJC 6AT1B 3C15A 1DTTB 1FO1A 2FHJA 1WORA 4Q7AA 4O3PA 3KHHA 2Y0SD 1RTDA 4ZPDA 1X9MA 2OO4A 1E6VA 4FS1A 3Q8SB 3DRSB 3VF0B 1QLNA 1JLBA 4JI3F 2FHOB 1RWOB 3PYEA 2VICA 3CNQP 3RBZA 2DB1A 4ECYA 4L72B 3PRDA 1EHWA 2KL8A 1LKZA 1OPZA 2XSJB 1RHUB 5IT9Y 2DNYA 4DV1J 2OPPA 2DGXA 5ITHA 1Y0HA 4MMOA 2VDIA 3DM2B 2HG4A 3R6GB 1X8DA 2UVVA 1V3RA 3FUYA 4BC7A 1K0VA 4QR2A 3UCUP 1C1BA 3GONA 1QAJA 3SQGA 2JFKA 3DOLB 2W9AA 1RT3B 2UUAF 2HWIA 2MSTA 3GMGA 4QBUA 4URSA 3EYZA 1DJ0A 2M5YA 4DZDA 3FEXB 1U25A 2RQMA 3MDFA 2WAQD 1TKDA 1HMVB 2ZH9A 1T3NA 2I2YA 4C8KA 4I2PB 3F44A 5KFRA 1ZZNA 1KWMA 2DHSA 3WX8A 3GP9A 1MSWD 1JJHA 2XQCA 2DH9A 1YJWS 1XMBA 3CTRA 1GMVA 2W9BB 5KG2A 3SV3A 2W01A 5IQQA 3EPIA 3K17A 2B4PA 2CPHA 1RAGB 1JWWA 3FQLA 3TUPA 4ZVHA 2VG5A 1Q16B 2EFGA 3VV2B 3HK2A 1ZAVA 2R2TA 1NSQA 4MTPA 2Q6BA 2J9CA 3BKTA 2OTJS 3D6MB 4YFUA 3MGJA 1MWZA 3NGKA 3CEDA 3T9NA 4NOHA 4PRFA 1U24A 1WHYA 3QSIA 1KRPA 3H42A 3TI0A 2HHHF 3MEKA 4LF6J 3AJDA 4NZ0A 4M5KA 1FRMA 4MAKA 3W5ZA 2BX6A 2BABA 4OZLA 1Q82T 3HT3A 3HP6A 1LWXA 2KVIA 3KLIA 2FQQB 3PW4A 2AHOB 1GXLA 1RAEB 3MF5A 2ALZA 4LFAJ 1HBMB 5HANA 3AAWB 2FC9A 2I9SA 3DCAA 2GO9A 3CJSA 4DV2F 5KG0A 2HGMA 3C6UA 3LP1B 3MM5B 3R27A 4RNFA 2IY5B 2DITA 4KV8A 1N6QB 1YZ7A 2DKOB 3MUTP 2H9ZA 2VC0A 3AODA 2CQ0A 1Q5VA 3G82A 1YBAA 3DRXA 3QO9B 2R2SA 3P4UB 3OSNA 4B3SJ 3CJRA 1JLAB 2FD2A 2FGCA 4ZS6A 2O1PA 4GKKF 2HMIB 5CZVA 3R8YA 3OL8A 2Q1LA 2C22A 1NH7A 2OUGA 2JDJA 3BGRA 4WFBQ 1TL3B 1NJIT 1AFIA 3KTQA 2DGQA 1JLFB 1XR5A 1KBRA 3UVJB 4A8FA 3HSZA 3K8VA 2AMCB 5FLXY 1N36F 3L9ZA 2IMWP 2RF2B 1FX4A 1PGZA 4DBQA 3PY8A 3R5CA 3DOMA 1HNXF 1UL3A 2KYXA 2CQGA 2JRSA 1DFDA 3M8QA 3CXCR 5DGAA 4YDDB 3V6DA 4ED0A 2AT1B 3RJMB 3MFHA 4KFBA 1GFWB 4PXBA 2OEJA 2CJXB 4RR5A 2O01C 3EE3A 4PYAA 1N5SA 4LF9J 4KE5A 1CC7A 1FVQA 3HPOA 5M2UA 3KK3B 2MYFA 2KHDA 2GMLA 1KTVA 4BWMA 4ZJQA 4RW4B 5DLFA 3TVYA 2CA9A 2LQBA 1Q8IA 5F9LA 2J9DA 3M8WA 3FEYB 2UZAA 4EBEA 3KLEB 4KGMA 3MURP 2V4QA 2ZNYA 5E33A 2C3OA 2NYIA 3B4MA 1OMSA 4IFVB 1VK8A 5D0HA 2NR0A 2ILYA 4PUOA 1G7CB 1VGYA 1U2CA 4A8YA 4JI5J 2J9DE 4P73A 1Y3JA 2BR0A 1RT5A 3BS9A 1F5BA 2NSCA 2X1BA 4B08A 1DURA 2MJNA 2RJZA 3MHYA 1ZH5A 2CPIA 4DG1B 1FFSB 3TP2A 4Y2KA 5EDWA 3CJQA 2QA2A 4O3RA 3J7YU 3CPWR 4B9NA 2R4FA 3U1MA 1N34J 2BJ7A 3BGOP 3I6PA 1HL6A 4QWBA 1ZTWA 3K5MA 3DNCA 1RYRA 3DHWC 3ENVA 4NLYA 2IDEA 2VDHA 2BW7A 3DDNA 5AE1A 3D54A 2ZBPA 3MMBB 1SXLA 2FLOA 3TZZA 2ZH4A 4O0IA 4CQ1A 2CQ1A 2Z56B 3M8PA 1RQ0A 1JLGB 3BV8A 1TKTB 2W7PA 1NJYA 2F3JA 4DUZJ 4MK7A 1QAYA 3D1OA 3UQSA 1X0PA 2GW8A 4O23A 5DG7A 3LH2S 3HFZB 1XNRF 4I69A 1UP1A 4TLQA 2YNIB 3CCQS 4Y2AA 3BPDA 1RT2B 2RQ4A 1KLMB 4HKQA 4KC5A 4M8LA 4K2JA 2R7WA 8RUCA 2XGPA 1CJUB 2WVFA 3GYGA 4P7TA 2OMLA 2C2KB 2HLTA 4U67Q 4JI6J 1R8PA 1SVDA 4M5JA 4DFPA 1QVFR 5KAKA 2NXJA 1HQUA 1MG7A 2YNFB 2C3MA 2LXFA 4QYRA 2NLWA 3TVKA 2W8LA 4QIVA 2FC8A 1M1KT 4LRAA 4P74A 2C2RA 2FYXA 2H1YA 1U48A 4M5DB 2KFYA 5AJ3J 5KG1A 4OI6A 3PCOB 2N3OA 4LR7A 2E9RX 3PW0A 1ZOTA 1DHMA 5E0OA 2BJ8A 3M9MB 4JV5F 1IM4A 3GJRB 3ZZYA 1R8AA 3M6VA 3THTA 4JI7F 4RU9A 2CNOB 1FWLA 4C11B 1U1MA 1TL1A 3DLHA 4H4KC 2X51A 3HHLA 2DCLA 3D7SB 2DGSA 2ZUAA 2AEJA 4HTJA 4CTAB 2OPQB 4FBUA 1Y5IB 4FYVB 4P6QA 1I94J 3BKFA 4NYOA 4I6YA 4FZVA 4LR8A 4QQBA 1TV6A 3T1YF 4JI2F 3TOQA 1A7GE 2V5HG 3UR3C 1KP6A 2F5GA 4HR2A 2V8DA 2E44A 4P71A 2PMZD 4DPWA 1SQGA 5KOXA 5LMNF 3M1VB 1MU2B 2IYIA 3DC2A 1WNEA 3A8IA 2PEHA 4N47A 2WVCA 4UOGA 4LF5F 3PHTA 6FDRA 1UW4A 1ACMB 1XK8A 3IP0A 5B0BA 2OPSB 3RR7A 4B3TF 3KLFA 4F8RA 1U1PA 2BANB 2IRYA 3GCXP 3RAMA 2H4WB 2HFSA 4W4MA 3DGPB 4FNIA 4DL5A 5HLFA 1RKJA 3VAHA 3QQCD 1R0BG 3EXCX 5KFKA 4OLOA 3JSRA 4QWAA 1N48A 1JNZB 1S6UA 2F8MA 1QJHA 4Q0BA 4IH7A 4QR1A 4KGVB 5GAEI 1HBUB 2HHQA 2AP6A 1S59A 2RB7A 2CPJA 1B0TA 2B3TB 2BUNA 1RJJA 3R5JB 1FE0A 3EVOA 2YKPA 2LLZA 3FC9A 1MLAA 5KFMA 4J9RA 1Z2LA 4S0MA 4RW6B 2V8PA 2HK3A 2HBYB 3DYAB 5B09A 4ZN1A 1JXLA 2Y1LB 2FJWA 1TL4A 2QTWA 5ETSA 4I6WA 4AXJA 1ZETA 3VHQA 1TVRA 1LW2A 3KJNB 3PZPA 1R8BA 1S49A 1C1CB 4NEYA 1S1VA 3QLHB 3H90A 2J5AA 1Z4UA 1NU4A 5EWGA 4EFAC 2J0SD 3F0NA 2H3EB 1UMJA 3HHEA 3BYPA 1YGYA 1FWKA 5KFQA 4CP5A 3HD2A 4GVBA 3MM8A 4BC9A 2M9KA 3THPA 3QIPB 3RU0A 2V50A 4PPZA 5D77A 5CYQB 2OEMA 2UUCF 3FDSA 4F4ZA 5JMNA 4UQGA 5DLGA 5M2RA 3VWSA 5T7LA 1UWBB 5IWAJ 5HN0A 4DL7A 3N4WA 2GVDA 1Y5LB 3BDEA 1UZHA 4DR1J 1JJ4A 3VR1A 4DWIA 1RCXB 4CLTA 4XIUA 3OBIA 4RX6A 4Q2LA 2XBPA 1F1BB 3X3UA 2VONA 2XULA 3C15B 2VV5A 3MMCB 3VTIA 4WJBA 2CQ3A 2AU0A 4QR0A 3I9ZA 1FKPA 1RTDB 4DLEA 1PAEX 1E6VB 3S6EA 4M94A 4FS2A 5J2NA 1WTFA 2IPOB 1DTQA 2M70A 5KT7A 3J81Y 4X66J 3M9NB 3GTYX 3UI3A 3A1YG 2AJ4A 1FJGF 3D6HB 1VBYA 4ZHRA 2IM0A 2OPPB 4IOCQ 3PKYA 3SCLE 4DL2A 3QNWB 2P2CB 1F60B 1XQIA 4MK8A 1YX2A 1BQXA 4ECVA 2CQHA 3TARA 4PCQA 2V8VA 1S4FA 2HEKA 2VKRA 1NSPA 2QL7B 2W9CB 1C1BB 5L1LA 1URRA 3SQGB 2VB6A 1N0VC 4FN5A 2J0QD 1U1QA 4ZIVA 4RUBA 4YP3A 4LFCJ 1TFWA 4A48A 3HFKA 3GQCA 3UWTA 4EZ9A 2PI5A 5DGBA 3T5KA 5IQ6A 3GV5B 4UY8T 3PM9A 3Q8RB 5CH7B 5J1EA 2EEYA 2M4MA 3VGSA 1XWLA 2HBQB 4K4YA 1NK0A 1W25A 3N28A 3W62A 1U49A 4IKAA 4NX9A 5C25A 1OWXA 4QW9A 3IRXA 5CCLA 3HVTA 2FLPA 5BYSA 4MH8A 3EMTA 3LPYA 2XYHB 1U6FA 3BSCA 2HHXA 1WOPA 1WF1A 2WVEA 2VG5B 3OTDA 2KVQE 3GSIA 4TQSA 2L9DA 2D3UA 2KHCA 1WTBA 3PNIA 4Q2MA 4K5SA 1U1LA 2QYGA 4PXDA 4FDFA 2WVDA 4F7VA 1HBOA 1CPZA 1WC1A 2BW2A 1U47A 2AWZA 3R7BB 4I7FA 1VJWA 2XMWA 2QA4G 5F8HA 3NCQA 2B9YA 2BQUA 3H4BA 3QWUA 2KM8B 4MK9A 2VKZG 3FZBA 5FD1A 2CQ4A 1UVIA 2QN6B 1DY3A 4OJ3A 2K3KA 2ZEJA 3ZZRA 5DQHA 2BXJA 2VOPA 4XDDA 1VOMA 1T95A 2K2PA 2HNDA 3OJSA 3H20A 3KLIB 3L09A 5D78A 3HM9A 1S7IA 5KFZA 1N33F 4CLSA 2L9WA 2NQPA 3IO1A 1RK8A 4BDPA 4ECZA 5HBMA 4MKVA 2F63A 4ED5A 3DGVA 1OY6A 2XMMA 2LEAA 2QRRA 3NOGA 3CCSS 3CSKA 4DR6J 4CRJA 2H4YB 3C6UB 1Q8BA 3N6LA 1NPRA 4ZMMA 4KV8B 1Q81T 1T7PA 2DGUA 2DHXA 1YK9A 1S9EA 2NS1B 3NP5A 2OFHX 1UJ5A 3GZ7A 4KJIA 1MMDA 2BOPA 1VQLS 3BGLA 1CBKA 2EFOA 2HRUA 3H25A 2DNLA 4P2SA 4DCOB 1UAWA 3AXKA 2XMUA 2J0WA 3G82B 3ZZOA 4GKJJ 3SYZA 2VL1A 3OFHA 4OZJA 2N4DA 4OI0A 3HZEA 3CMES 1NDPA 4NRTA 5GAGU 2E66A 2QT7A 3A4TA 3OLBA 3BGRB 2YWFA 3D3CJ 1G3OA 4J9UE 4HACA 3KLVA 3UDCA 2R3VA 4YS2A 3GCWP 2V2QA 5H1SV 2LECA 5HQMA 4ED1A 2M2BA 3DOMB 3W61A 2DR7A 2IM1A 3MR3A 2R2RA 4C9DA 1VBKA 4ZCLA 3M8QB 2EFVA 3DDKA 1I5OB 3V6DB 1OO0B 5AXKA 3CVKA 2UV8G 5KFCA 2PMWA 4KFBB 4CLPA 1AT1B 1SV5A 2JLFA 5D4LA 3CJTA 3D1HA 2VD3A 5CZXA 4C3KA 3QJPA 2BYCA 3H98A 3QT8A 3R5DA 1F2GA 5GMKa 2HBZB 3OSPA 4CT8A 1GK8A 2I0XA 4JI3J 2KB2A 4IOBA 4YR2A 2V63A 3K58A 3DRRA 5EUHA 3EXYA 3R6LB 1QD1A 2P9CA 2R7SA 2ZZTA 4WFAQ 4ILMA 4TY9A 2B4VA 1M5KC 4NLSA 2W2NP 5THWA 4NLTA 1VS3A 4U8VA 2JL9A 3CJ2A 3TEHB 4KAIA 3VCDA 4B17A 2E1MC 2BE9B 2EG1A 1T05A 3PKMA 1R8HA 1J27A 4PUOB 3VAGA 2YVSA 2ASYA 1WC6A 1WI8A 7FD1A 2HFUA 1RP5A 1DBDA 2DISA 3CD5A 2B5JA 7AT1B 1SPBP 3D0HE 3C19A 2UUAJ 1T9WA 2IJNA 1EAYC 1SH2A 2FHKA 1RT5B 1SCJB 1R6VA 2CZVC 3TA1A 3HSGA 5J2MB 1SJFA 3EZ5A 1NK4A 3J7ZT 2XB2D 3MM6A 1H7WA 3N5BA 2IJRA 2FZKB 3A12A 4R0EA 4PZVA 2MLXA 4DUYF 3OR2A 1NNDA 2QLJB 2LXIA 2DNNA 1PSDA 3HULA 2MGZA 2MSSA 1VQKS 2CPZA 2HHPA 4QU7A 3M8PB 5L8RC 8AT1B 1NM2A 3MPYA 3ZXWA 2BE7D 1D9FA 4FF2A 1IBMF 2PEBA 3L95X 5GMDA 3W8GA 2DR8A 5DO2A 1RWMB 4NCAA 3TX0A 4ZPBA 4OX9F 5DZ6A 3IAS9 2BKPA 4EI2A 4F0KA 3ICLA 2FIUA 2YQ0A 5C42A 2RIJA 1IBKF 3J80Y 2HHHJ 4RNOA 2AJ1A 3N6NA 4UQTA 3T19A 2A2DA 1RT7A 1XTZA 2FVQA 2BKOA 4EO8A 2KM8C 2CPFA 1N32J 3TZXA 2B6AA 5HVHA 4I0WA 1TU0B 5D3GA 1HQUB 1XR7A 3IM8A 4DV2J 1EQMA 2LMIA 4K2XA 2GVZA 2DH7A 1NCLA 4JUZA 2ZH2A 3DXSX 5A8KA 2YTCA 4G1PA 1WEYA 4C8NA 3TAQA 2EFQA 3T1AA 3HSDA 2G1HA 2XWYA 2G2YA 3QATA 4LBPA 1VC0A 1A6LA 4UOHA 2WCXA 1N0UA 4YEAA 4F3OA 1S97A 1SB6A 4GKKJ 5DRKA 2XCPA 1B7YB 3ZZUA 1HD1A 2LXUA 3HHLB 4KHRA 3VAJA 3ULHA 4NXNF 2YXLA 4DPTA 4NLWA 3TVZA 2V4JA 5IZHA 5IT0A 1B0PA 1F5AA 4IR1A 5B0DA 4C8OA 1KNZA 3OXFA 4ZVSB 4K5RA 1RWKB 2HQGA 1TV6B 1N36J 2MKYA 4DF8A 3KJVA 1KC8T 4I2QA 3IBWA 4HH0A 2UUWA 5IM0A 3UDLA 1K1SA 1HNXJ 1FT8A 1YTYA 1DLOA 5EX3A 1K9MT 1OJ4A 4AD6A 4NLDA 1HA1A 4F67A 2JLGA 2UVUA 1VQ7S 3FMBA 2JWNA 2GGPA 1NBEB 5EWEA 4U7UK 4YQWA 3BN4A 1FRJA 2HRYA 1XMOF 3NMAA 4EMDA 4LBIA 2Y1RI 2EBGA 1VQ5S 5ETPA 1SJ4P 3DDIA 2VG6A 1UTAA 3DXBA 2A18A 1JLEA 2H65B 3KLFB 1NEEA 2XI3A 5D4PA 3CJKA 2WBMA 4J9SA 5HLFB 4KY3A 2HLUA 1H6KX 2DXEA 3UN5A 1RWWB 4UF4A 2FZGB 1L3TA 3TA0A 4XTTA 1SQEA 1K73T 1HI8A 5KFBA 1S6OA 4Z7CA 1VHIA 4Q0BB 3GFZA 1UFKA 5B7WA 2FVRA 1N5TA 1Y11A 2FTRA 3K7RA 4F4AA 4DPYA 1VRTA 3FGVA 4J37A 3CD0A 4OI3A 2RUSA 6FD1A 3W64A 3MR5A 1QTNB 1YLXA 2QGFB 2LEBA 4WFNQ 5E3AA 2VPYB 3O5TB 3IRWP 1TQLA 5F0WA 1J2VA 4WFXA 3I87A 4A4JA 1TVRB 1LW2B 1ZYQA 2AJ0A 1O8BA 1NZAA 3K5NA 1S1VB 3BSAA 3PJXA 3H2VE 1AXQA 5GMEA 4DN9A 4OJ1A 3G8SA 1FD2A 2RAQA 2J0XA 2UXDF 4CM0A 2MKJA 1CVJA 1UPPA 1UKUA 4ZVGA 2BEFA 4GVBB 3RBDA 7FDRA 4ZJLA 2UVWA 3FJ2A 2PO4A 3MM8B 1FJCA 1T11A 2SXLA 1VQ6S 1NO8A 3PG9A 4LF8J 3SMZA 1XNRJ 5T7LB 2YNGA 2XG8A 2MEWA 3HX9A 3JTPA 2GVDB 2IHR1 3C46A 1CLFA 1UA0A 1NB2A 1FKOA 1DZ5A 2JC0A 3LF0A 4CWBA 3ENWA 3GWCA 3PTWA 3J7AN 2VC1A 1FJEB 2XWXA 2RHQB 3BQ2A 1FKPB 2KH9A 3R2DJ 3CT9A 4X64F 2MKCA 1VFJA 2O66A 2CPDA 3P96A 5J2NB 3X1LB 4OYOA 1DTQB 4A8KA 1RADB 5K8MA 4R8UA 2YKMB 1N88A 2LVWA 2MQQA 3UD5A 4ZHRB 5B0AA 4K0KF 3MEGA 2HZAA 2BRKA 2WSEC 1BWEA 1H2VZ 3Q23A 4CYUA 3AOAA 3FQKA 4JV5J 3HHKA 5KOWA 4JI7J 2G1DA 1RWXB 1M5OC 3G87A 4CLUA 5J2PA 2CNKB 1NPKA 2ZDOA 4ZVQB 3NBPA 3TO8A 2Y1JA 3NS7B 3KDOA 4U8YA 4O4RA 1YBUA 4HT7A 3MPDA 2ZM6F 1VR6A 1TZ0A 4B9VA 3V5RA 3FBBA 2G2ZA 4LF1A 3M7VA 2NSBA 4Z7YA 3T1YJ 4DU7A 1NKBA 5KT5A 4M95A 4LSNA 2P9EA 5J1EB 2RS2A 3LA0A 1CJTA 5ADZA 1KKHA 5C25B 3MR6A 5LMNJ 3G9CA 1IKYA 3IRXB 3HVTB 1NPPA 1RYSA 1B7FA 1HYSA 3SZ2A 2NPIA 1YSJA 4LF5J 2B0GA 3P6YC 1NHVA 3LWLA 3ILLA 3H5XA 1Z1ZA 3MOZA 1S9FA 1HBOB 4AUKA 3RR8A 5A6WA 4I7FB 3M2UA 4PG4A 4JI6F 1GEHA 4ZCMA 4DPOA 4DSIA 2WRMA 3PIOQ 3G71S 1LEOA 1WACA 3RRGA 4FYXB 2ASDA 3S8SA 4OZ5A 3KG4A 1E6YA 3DHXA 4LT6A 2C2ZB 4FYWB 4DV3F 3BBCA 2HNDB 4J9VA 3ILIA 3FK4A 4CT9A 4CH7A 3JTOA 4RNNA 5HMYA 2ZH7A 4CIOA 5HBMB 2VA2A 4I56A 1KDNA 5KTQA 3NNCA 5HMWA 5F8MA 4OYXA 3VAIA 1EB0A 2IVYA 4DF4A 3OVSA 1RLDA 3L4BC 2L41A 2RDJA 3GIIA 2Z2YB 4G3IA 1RWNB 2DEJA 4I64A 1YQHA 1OYEA 3I4HX 4HH1A 2KFZA 3QGHA 1BGXT 2A0FB 4QPTA 2AJ2A 2DY1A 1VQPS 3DOKB 1X9WA 1S9EB 1R0CB 4Y0FA 1X4CA 3P45B 1AZSA 4IQMA 5DS7A 5T14A 4Y6IA 4JBCA 1I94F 2RILA 5LJ5Y 1U7LA 3AOBA 3M05A 3QAEA 3GV7B 3NRBA 2HK2A 4EWTA 2IFXA 1RT1A 4LRCA 4ZPAA 1NHKL 2HZCA 1WD6A 2R7RA 2MLZA 4RJVA 4LR9A 4J5OA 1VRUA 3PJ9A 2FHMA 4JP8A 2GC8A 1P9YA 4URGA 5L1IA 2UUCJ 2Y3YA 2UUTA 3TJ8A 1T02A 4YUDA 1M1GA 3NWGA 1EZZB 4HACB 3KUHA 3TAPA 2EFNA 3IBFB 3QSYB 3OD2A 2HFOA 1KHVA 2ATCB 2MQ8A 1HWLA 4OYAA 2RDDA 3CCVS 2RS8A 2OSRA 4OI1A 1HWUA 2QA1A 4GO5X 5ETMA 4JB8B 4ZJOA 2K7JA 2O67A 2B7BB 4C0BA 1S0MA 3Q24A 1SV5B 2PN6A 4NA1A 4MYTA 1RT4A 2PC6A 3H2LA 3I0RA 1HIYA 4I4BA 1S79A 1GH8A 1MMNA 3GIRA 1BD6A 1VC5A 1MNEA 4LSLA 4X4PA 1UFLA 3NCRA 4XAKA 1YITS 3PRVA 5LOQA 2LU2A 4M5HA 1O5JA 3ET6A 3CD6S 3DRRB 2DJWA 4EZ6A 1Y7PA 1AUDA 1FJGJ 5F9NA 2DR6A 2HQ3A 2C2EA 1UVKA 2MHNA 2OPRA 2X1AA 2AYGA 2BJ9A 2W4CA 4NE9C 1S6PA 3UD4P 1M0SA 1RGVA 3OXLA 2E1PA 2BKNA 5MAOA 2XCAA 4BLGA 4NLGA 1T05B 2BZ2A 2MQPA 1IBLF 4J9QA 3ZTPA 2G2OA 4LSZB 1X5PA 3KHRA 1F3VA 2B5JB 5HI7A 2YWHA 3TQ1A 1U1NA 2J7UA 3CMQA 3OTBA 4Y3CA 3MPUB
chains in the Genus database with same CATH topology
4DSLA 2CG4A 4NYOA 1L3SA 1QUVA 4NRUA 5CXTA 1RTIB 4I6YA 4FZVA 4QQBA 1QE1A 4JV2A 1TV6A 1Y3KA 2YX7A 3T1YF 3U1NA 4IH6A 4JI2F 3W2WA 1SH0A 2MZQA 2R7OA 4F2RA 3M6UA 2IAJB 3N6MA 3TOQA 4E8UA 4DQIA 1C4CA 1RDRA 3K5PA 4RU2A 3ZC4A 4ELTA 5J2QA 1A7GE 4NLQA 3GYXB 3KHGA 4F4YA 2F9DA 3K5LA 2XGQA 3PX0A 2V5HG 3UR3C 1ROFA 1WWHA 4JV0A 3K59A 2KJWA 1MMLA 3KNGA 2V8DA 2E44A 2PMZD 2K1RA 3MM6B 5LMNF 2XI2A 5KOXA 1BC6A 1PC5A 3M1VB 3R3TA 2BDPA 1MU2B 2IYIA 1KHWA 1ELOA 2E9TA 4A46A 1HHSA 2G9OA 3DLEB 5EWFA 2CPXA 3KLGA 3DC2A 1WNEA 4C97A 1DTTA 2PEHA 3OR2B 3BGFA 4N47A 4X4RA 4LF5F 1Q1KA 2P6TA 6FDRA 1RAJA 1UW4A 3U7JA 1D0EA 2CYYA 4NCGB 1SKWA 3PVXA 1G2EA 2FJAB 2FVSA 4ELVA 4LF9F 2UV8A 1XK8A 2LU1A 4IDKB 4IO9Q 2MGZB 4WXWA 2CJAA 3QYYA 5FDLB 3DRSA 1S0OA 3NCPA 5B0BA 4O4GA 4ETZA 5F3TA 2OPSB 3RR7A 2I38A 3M30B 4R0JA 2DHGA 3G6VA 4B3TF 2E5IA 5HMZA 2PFFB 3QJLA 4N8OA 5GADU 2DO0A 1YIJS 4A8MP 1DARA 2KZZA 1CQNA 1Q86T 3KLFA 2XSJA 3MEEA 3GIKA 3LP0B 4F8RA 1KS2A 3OHAA 1B0VA 3QGPA 1U1PA 1I6JA 3OL9A 2A2CA 1Z2ZA 2BANB 2IRYA 3PJWA 3RAMA 1N5YB 3I55S 4WYWA 4B9LA 3PACA 3TYTA 3DI6B 4FNIA 4DL5A 3AQOA 4O3OA 5HLFA 1RKJA 1JXEA 2GQQA 1TL5A 4CI0B 4D3GA 2MZRA 1IR0A 1D8ZA 2VBZA 3NAHA 2W25A 1MROA 3SDEA 3VAHA 1U26A 5F8IA 2I8EA 3GSDA 5KT4A 3DM2A 2N4CA 5C42B 5FJ4A 1FVSA 3MTKA 2X1GA 3E3XA 3EXCX 1SL2A 4Y2CA 5KFKA 3HHNB 4MFBA 1AFJA 2BQ3A 1FK9A 3I56S 4OLOA 3JSRA 3M2VB 4RW9B 4QWAA 1N48A 1JNZB 1S6UA 2APOA 3FSYA 2F8MA 5DM7Q 1QJHA 4GMKA 1UA1A 1NRKA 1HI0P 4Q0BA 4WFYA 4IH7A 1X9SA 4DR2F 2OAUA 4PWUA 4QR1A 4RKUC 2W8KA 1H38A 2B7CB 3CIMA 1RT7B 4LIWA 4D3HA 4KPYA 1FRLA 3LGNA 3I31A 5GAEI 1HBUB 4ZPCA 2HHQA 1LXJA 3T3FA 1BQNB 4JI5F 3DOLA 2AP6A 4NA2A 3IAM9 1RT3A 2RB7A 2CPJA 3MTJA 4FP9A 1B0TA 3QGGA 4WKYA 2UUBF 2B3TB 2BUNA 1RJJA 1SBRA 1FE0A 5JVGQ 2GA7A 2XS2A 5F8NA 2FJEB 2YKPA 3TAMB 2B6AB 2LLZA 1LWCB 2XMTA 3I5BA 1IKWB 2KKHA 2Q66A 4IG0A 1WF0A 3RRKA 3GV8B 5KFMA 4J9RA 1I1GA 5DQIA 2NPFA 3OTOF 1XC9A 1Z2LA 2OKQA 4RW6B 3F73A 2ZJRQ 5D3GB 3DYAB 1HMVA 3CCTA 3MUVP 3F41A 5B09A 2O3DA 4I2PA 2DNKA 4LJMA 4TN2A 3WX4A 1JXLA 2PMHA 2VFUA 2FJWA 5KFLA 1JB0C 1TL4A 1VHFA 4KB7A 1GQEA 2G4BA 2M0GB 2IA0A 4FVCA 5DG9A 1JJ2R 2UVRA 4I6WA 4Z2XA 3CJ0A 4AXJA 1ZETA 5HP1A 5KG4A 3PHEA 3RW7A 1TVRA 1LW2A 1P1TA 2K8GA 1FEHA 5A8KB 1N34F 3PZPA 2FGOA 1R8BA 4OX8A 4A8SA 4LQ3A 2YQ3A 2W9BA 2AJQA 4CO3A 5KG7A 3KK2B 1FDAA 3KYLA 2R8JA 5A8RB 3PEJA 4A8XA 1QY7A 1S49A 1O0PA 4BWJA 4N77A 2W4DA 1C1CB 1SJQA 1S1VA 2RNEA 3QLHB 3JSMA 2JLEA 2J5AA 1Z4UA 4F26A 1JKHB 1NU4A 4URQU 3LWMA 5EWGA 4EFAC 4DR7F 4IR9A 2J0SD 2J6SA 2W7OA 2CZ4A 1FXDA 1YJTA 4ZVFA 2HFNA 4B3OA 1C0TB 1UMJA 3HHEA 1YGYA 3IGVA 4MJKA 1WG1A 5KFQA 2MDAA 3CCZA 4DUZF 3I0SB 2RUGA 4F50A 5B0GA 2DNGA 3MM8A 4BC9A 1EETA 2M9KA 4L3NA 3THPA 4AYBD 3QIPB 4KBIA 3RU0A 3H5UA 1IQZA 4PPZA 3LAKA 5D77A 3M6WA 2UP1A 5CYQB 3C3LA 2UUCF 1N52B 3VQSA 3KLHA 2V8HA 2LQJA 1KQFB 3FDSA 2NUHA 4NYPA 1NAQA 4CZCA 5HMXA 2NXUA 5CHCB 4X4SA 1IN0A 4F4ZA 2YWKA 4J9LA 2V4JB 5EN1A 4UQGA 2ZJQQ 5E3QA 3Q2TC 4J9OA 5DLGA 5M2RA 1RT6A 2RMLA 3VWSA 2D41A 2PIIA 5T7LA 3DLJA 4OHVA 1UWBB 2ZZMA 2VFRA 2VASA 4ILRA 1T8EA 5HN0A 4YY3F 4DL7A 2EKYA 3N4WA 1LWFB 3CJ4A 4YB1P 4K4XA 1V3ZA 1Y5LB 4K4TA 3BDEA 2KI2A 1JJ4A 3ISZA 3T1HF 3QAUA 3VR1A 2EC0A 4DWIA 3GYNA 4WU2A 2WB1D 4WTYA 1GT8A 2MY8A 1HNIA 3KJVB 2FHJD 4R5PA 2XY5A 3MOJB 4I2QB 2RVJA 4G1QA 4MIWA 4H54A 1UVLA 3CCES 1SUQA 4XIUA 1YJRA 3OBIA 1UJ4A 5IM0B 1SL1A 4H4OA 4PKDB 1HHTP 3HKWA 5IXUA 2OMOA 3N01A 4PG8A 4IRCA 1N4LA 4RLEA 2N7YA 4RX6A 4TQRA 2HAIA 4Q2LA 2PD1A 5GAGI 4C4WA 2XBPA 4I67A 4DN0A 4FF3A 3X3UA 4XPCA 1HBMA 2VONA 2BBEA 2XULA 1S48A 3Q2SC 2VV5A 1R6YA 1Q82T 3D0GE 3KWMA 3MMCB 3VTIA 4WJBA 3CCUS 3DRPB 3KG1A 2CQ3A 3HVWA 2AU0A 4QR0A 1H3DA 4L6V3 4ECTA 1JIHA 3I9ZA 1FKPA 1RTDB 2GGPB 1R0AA 4DLEA 5G0RA 2PGCA 5BYRA 3V2UC 1E6VB 1S1TB 1WEXA 4AQYF 2CVEA 3KMSA 3R5AA 3S6EA 4M94A 4Y00A 1LQ9A 2Z8QA 1D1UA 4USIA 3LP1A 4ZK7M 4FS2A 3MM5A 5H9EJ 1U1OA 2GHWA 2FJDB 5J2NA 1WTFA 3G6XA 1RA6A 4NWBA 1DTQA 3O8WA 1UVNA 2MPUA 2VG6B 2M70A 5KT7A 2VQEF 3ONQA 1N6QA 3JTNA 3OUYB 1JLEB 3CB4A 3J81Y 5E3RA 3U02A 3M9NB 2X3GA 4ZCIA 2LCWA 1SKRA 1WF2A 3ITHA 3NG8A 1VQNS 3UI3A 4H4KA 3SCKE 3A1YG 1R8CA 2AJ4A 1FJGF 3SSQA 2RKIA 3POTA 4DS4A 1VBYA 2UXBF 5AJ3F 2XMKA 4WFZA 1KEKA 2XZWA 3CJKB 5JJBA 4ZHRA 2M8HA 1S76D 4Y2MA 2IM0A 1SJ1A 2OPPB 4IOCQ 1YRXA 4DL3A 3PKYA 4ECSA 3JYTB 4DQRA 3SCLE 4DL2A 4EGLA 3DLGB 1V6HA 4EYIB 1HBNB 1SL0A 1F60B 4MK8A 3H4DA 3FFIB 2HHSA 5HO4A 5KFWA 2HHWA 2MQLA 1BQXA 4ECVA 2CQHA 2IC3B 3JAMY 3TARA 4PCQA 3P3DA 1JLAA 1S4FA 2V8VA 4ZP6A 2VKRA 1HPZB 4WK1A 4ZLPA 3G6ES 3DMJA 2PA3A 2HMIA 1APSA 3ISND 1P8GA 2M3DA 2IVFB 2R9LA 5J2MA 1JNRB 1N5QA 1VBXA 1C0UA 5KT2A 2W9CB 1C1BB 5L1LA 1U2RA 2NREA 3DU5A 3MI7X 1URRA 3QMQA 3SQGB 2VB6A 3BN7A 4RUCA 1N0VC 4WU3A 1LOUA 1U1KA 4UUWA 3US5A 1SH3A 5K8PA 1IXKA 1TL3A 4FF1A 1ZAXA 3B78A 4QIGA 4FN5A 4DFMA 4TKTA 2J0QD 2M88A 1U1QA 1X4GA 1X5SA 2D9PA 3TX8A 4YP3A 5FIIA 2OTLS 1TFWA 1JLFA 4A48A 3HHLD 1VRTB 2MQOA 2FLNA 2YKNA 4Y2IA 5KFPA 3OV7A 4X84A 1V9OA 3HFKA 4DJBA 2LA4A 5SUHA 3K2YA 2EFPA 4TYBA 3GQCA 5T41A 3UCGA 3I5CA 3UWTA 4YB6A 4RWWA 4EZ9A 2PI5A 5DGBA 3C6TA 4Q8FA 3BQ0A 4OZ0A 2FUG9 5CCMA 5C5JA 4IRKA 3BJYA 3BO3A 2MJUA 2RF2A 3T5KA 2VH7A 5D8HB 5IQ6A 1HARA 3PIPQ 1TL1B 3GV5B 3MXHP 4UY8T 3PM9A 3Q8RB 2ZHOA 5CH7B 5J1EA 5JUMA 2M4MA 2WW8A 3ZZ0A 2N82B 4HLBA 3IXQA 3FSIA 5K14B 2V9KA 1XWLA 4EU0A 1H0HB 2V2KA 4K4YA 1W25A 1NK0A 2QEXS 4ZP8A 3N28A 4TU8A 3G4SS 4YB5A 1U49A 4F4WA 1VBZA 4IKAA 4NX9A 5C25A 1OWXA 4QW9A 3IRXA 5CCLA 3MM7B 3HVTA 1EP4B 4DOZA 2FLPA 2YKAA 5BYQA 5BYSA 4MH8A 3UNGC 2OD6A 1S72S 4Y34A 3LPYA 1J5OA 4BCAA 2BM1A 4WK3A 2HNZB 1T94A 1U6FA 2KG0A 3BSCA 3K57A 1QSYA 2HHXA 4DSEA 3OPKA 1WF1A 5GAHI 4FNHA 4WF9Q 1TK0A 2VG5B 3OTDA 3I32A 4TYAA 2IBKA 4TQSA 2L9DA 2D3UA 2KHCA 1WTBA 3IG1A 2D3OR 3GR1A 3PNIA 4Q2MA 3MR2A 2MZJA 4K5SA 5GAEU 3KK3A 1U1LA 2V0NA 3IA0A 4PXDA 5E3CA 2Y1IA 2RRNA 4HL9A 4CCHA 4PXCA 2AD9A 1HBOA 1CPZA 2DVIA 4RW4A 2BW2A 2O5DA 2WBRA 2AWZA 1U47A 4H4MA 1KQKA 1URNA 4I7FA 3V4IB 1VJWA 4J9PA 1NKCA 1FNOA 3RBEA 2JEJA 1QM9A 4NLPA 2XMWA 3O44A 2QA4G 1FHTA 1ULRA 2HS0A 5F8HA 4YOEA 3NCQA 4CO1A 2JH3A 3MECA 1WG4A 2B9YA 2BQUA 3H4BA 3CC2S 4M63A 2E5HA 3RAQA 3QWUA 2VPWB 4A47A 5EHHA 3VZHA 2KM8B 3FRZA 4MK9A 3LOUA 2Z0GA 3T5JA 2VKZG 3FZBA 1GXTA 2YNGB 1TKZB 3WBZA 3SI8A 4KO0A 5FD1A 3KLEA 3CULA 2CQ4A 3VQTA 1UVIA 1S9GB 5D6GA 4OFZA 4OJ3A 2K3KA 2EVZA 1X4BA 4IFYA 1X4FA 4B9TA 3ZZRA 1IQTA 5A0YB 2OSQA 3WDOA 4HT5A 2J8AA 5DQHA 2BXJA 2KU7A 5AE2A 2EW9A 5I42B 2VOPA 4XDDA 1WI6A 1FKOB 1T95A 1VOMA 2VFTA 4JI1F 2I1RA 3HZGA 2K2PA 2ZFHA 2HNDA 2AX0A 3OJSA 3H20A 3B82A 4OIXA 3KLIB 1KFSA 1M5HA 3L09A 5D78A 3HM9A 4PWDB 2FB0A 3PRBA 4AFFA 3OHBA 2DGWA 3BF4A 2GV1A 3DLBA 1FDBA 1YJ9S 2M8DB 2ZKUA 5KFZA 2XLKA 1N33F 2L9WA 2MXYA 4OX6A 4DV4F 2VG7B 3OR1B 3IO1A 1RK8A 1VMBA 3LALA 4ZOSA 5DJBA 5HBMA 5JVHQ 4ECZA 4BDPA 3WC2A 4IRDA 4ED5A 1U45A 2XMMA 2LEAA 5A2QY 3OL6A 2QRRA 2MB0B 4OLPA 4OX7A 1NK7A 3CCSS 2CQIA 1VIOA 5KFFA 3SFGA 1AW0A 2JX2A 1REVB 3CSKA 4OQJA 1VQOS 2CVIA 2M52A 3MD3A 1T03A 4X2BA 1OPIA 1V3SA 3QGIA 5DDPC 4DFJA 2HVHA 3HKZD 1Q8LA 3C6UB 2HQIA 4DG1A 1Q8BA 1S1XB 2ABYA 2Q6CA 3N6LA 5B08A 3D2WA 4CO0A 3TANA 3NL0A 2MKKA 5A8WB 1S99A 4ZMMA 1FD8A 2YNHB 3EZUA 2MMYA 1S6QA 4KV8B 1Q81T 2D7SA 1T7PA 2DGUA 2DHXA 3K8WA 1HQEA 1U6ZA 2D1CA 3S01A 4R8UB 1S9EA 5GVQA 1L3KA 2KJVA 1QUPA 2NS1B 3NP5A 2OFHX 3IS9B 1UJ5A 3GZ7A 4KJIA 4CO5A 1MMDA 2BOPA 1IJFB 1VQLS 2JVRA 3K0JA 3BGLA 1AROP 3N0VA 4HEA9 2GMHA 2EFOA 2HRUA 4ECUA 1HNVA 4ED8A 3RRHA 2JOQA 2J76E 4J9MA 1JLCA 2R2UA 3H25A 4KR0B 2DNLA 2CFXA 5LSRA 3MEGB 4P2SA 1UAWA 2XMUA 4NL5A 4B3MF 2J0WA 1OIAA 2GJ2A 3ZZOA 2DRBA 4NCBA 1SI9A 4PQUA 3CMAS 4C0OC 4C2MA 1C2PA 5C24B 2VZ9A 3SYZA 1QSLA 1R27B 3MMBA 3MEDA 2VL1A 1ZAWA 3LW5C 1X4DA 3OFHA 4OZJA 5CYMB 2N4DA 4OI0A 2EG2A 3HZEA 1JLGA 5I3PA 3CMES 2BE2B 4NRTA 4PXEA 5GAGU 1TKTA 2E66A 5J2PB 4TU9A 3AY0A 3FZ2A 5LL6d 2QT7A 2ZC4A 1SIWB 2H5EA 3OLAA 4OV1A 4CO2A 4ZPTR 5DQGA 2AGQA 3OLBA 3BGRB 3AB4B 2YWFA 3NBPB 1VK3A 3IR5B 4Q45A 3KHLA 2F40A 2ZZNA 1YJNS 1RTJB 5KFXA 4X4QA 5KFDA 1IKXA 4PR6A 1NB7A 3MM9B 1G3OA 4DQSA 1VIXA 4O3QA 3LUYA 3GR0A 3M6XA 4KIAA 1CQMA 1VQYA 5L39A 4DV0F 5IWAF 3SEOA 1VQ4S 3RTVA 4NLXA 2GIRA 4RZRA 1TAQA 2IRXA 5LSLA 1JX4A 2YNIA 5J1PA 3KLVA 2R8GA 3UDCA 4ID8A 4DEZA 2ZH5A 2LDYA 4DR1F 4K50A 2R7TA 4CNZA 4A8WA 1PILA 5DETA 1RT2A 4YHHF 4F4XA 3RB4A 5H1SV 4X4OA 2LECA 2KZMA 4ED1A 2RQKA 2M2BA 5AXNA 5E3PA 1KLMA 1HWJA 3UFCX 4LSNB 1XNQF 2I5JB 4KSEB 2DR7A 2HHVA 5EGYA 2IM1A 2BRLA 1JLQB 2ZD1B 4MIBA 2E5JA 3MR3A 1MWYA 2R2RA 4C9DA 4ZCLA 4ICLA 4DS5A 2POKA 4RUAA 5AXLA 3M8QB 1DQ9A 2ZHAA 4YB7A 4EBDA 4IG3A 2EFVA 2ROEA 4OHWA 3DDKA 4MKAA 3TUIC 4DQQA 2XY6A 1IKYB 3ETOA 3LGMA 1OO0B 4IYQA 2PA8D 1FRXA 5AXKA 3CVKA 2VFVA 2UV8G 5KFCA 4DQPA 2HPUA 2KXHA 5KG5A 3Q8QB 2B4UA 2CDQA 3BM7A 3CC7S 4KFBB 3GG0A 1HYSB 1SV5A 4O44A 2JLFA 2DNOA 4NLRA 5D4LA 4U6PA