3O2IA

The crystal structure of a functionally unknown protein from leptospirillum sp. group ii uba
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
93
structure length
93
Chain Sequence
DMHIYELVSRDRTHPVRIYLLHSEYWTEDEFYNLLLEAFQRSSASDWHLQILEVSKYLVTAHGFVEAGGLQEIGFPGELSKTEVRRRINAFLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title The crystal structure of a functionally unknown protein from Leptospirillum sp. Group II UBA
rcsb
source organism Leptospirillum rubarum
total genus 26
structure length 93
sequence length 93
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3o2iA00
3O2IA
chains in the Genus database with same CATH superfamily
3O5TB 2OD6A 3VR1A 1KLNA 2ZWPA 2G1HA 4ZCKA 3JB9k 2CQ0A 5L38A 5E33A 4PUOB 5FD1A 1HI8A 1PYTA 1X8DA 1FRKA 2OEJA 1CULA 2CJXB 4I56A 5KT5A 1SKUB 2AD9A 5GAHU 1RWNB 2BM0A 3VAMA 2PD1A 4OIXA 1N34F 1HD0A 2OTLS 2DNMA 2HHXA 1TAUA 2K3KA 4I6AA 5KFOA 3NS5A 1FFWB 5DJBA 3PTWA 4JYAF 4E2FB 5J2QB 2VZ9A 1ZTWA 2DR6A 2BYCA 2O66A 5EWFA 4B3SF 3W2VA 5B7WA 5FDLB 1VBZA 1V3ZA 1U0SA 2AV5A 1YZ6A 1GX6A 1PILA 5K14A 4DFJA 5F9NA 2GQQA 3D4JA 4LIWA 2E66A 1YVFA 3D6HB 4C8OA 3ZTQA 2HLUA 1MNEA 1VCTA 3NWGA 4LR8A 2DGWA 2HVDA 1VRUB 4DV3F 2V2QA 3FDSA 3DLGB 4IUFA 1TQLA 2IHR1 1HYSA 3P3DA 1FNMA 3AXMA 5CYQB 1A0OB 2JOQA 2L48A 3W65A 1HNVA 4KHMA 2HKEA 2MGZB 4OX6A 1P9QC 2FPHX 2XI2A 4KY3A 2OPSB 1ULRA 4CT9A 4GKKJ 4ZPAA 5F3TA 2QGFB 2KVIA 2E5LF 1G4CA 5HQLA 3D5MA 4ZVOB 3J81j 2FHJA 1V5VA 3M2VA 2C3YA 1T03B 3QWPA 4YB6A 3CMQA 2JLGA 3MFIA 3K5LA 1K47A 3H25A 2P5VA 1ZM9A 2HNYB 3L7UA 3M2UB 3MM8B 4M5IA 2B6AB 2WW8A 5IC6B 4ES2A 4DLEA 3CD0A 2V8VA 3SCJE 3EM1A 3EGWB 1NNDA 2VONA 4ECRA 5GMDA 1V5IB 2RU9A 1WJ9A 3EZUA 1MMNA 3BB5A 1CBKA 2MJUA 3SSSA 1TL3A 1CJUB 5D0EA 4R8UB 1RWXB 3SDEB 4ENOA 1WF1A 4ZPCA 3JQKA 2CDQA 2HFNA 4F3QA 3N4WA 1M1KT 3GR0A 2DISA 3VGSA 2HQIA 4K4XA 4RUCA 1SL0A 1PBAA 2K2PA 1YBAA 2AW0A 3VVTA 3TJ9A 4KJIA 4K4TA 7FDRA 4R5PB 1XMOF 1T11A 3MCSA 1BXNA 3AD7C 3O44A 1NAQA 3TX0A 3M4XA 1S48A 4N77A 1UEVA 3VF0B 3OTCA 1FKAF 1RWVB 2LXFA 1OY9A 3I55S 1FK9B 1VJWA 2P6SA 2Z2MA 1KKHA 4ED2A 4NASA 2LEAA 3R7NB 1E6VA 3SSRA 3NLCA 4MAKA 3JTOA 2H1YA 4RJVA 4IOBA 4HH0A 1QAIA 4L72B 2KFZA 3L09A 4ZITA 3OFFA 4PWWA 1U6BA 1WG5A 2C2DA 3SFGA 3D3BJ 1YI2S 3DDNA 2ZE2A 2UXDJ 2ZJQQ 2IBKA 4YY3F 5D8HB 3OLAA 3GV7B 3TQEA 1BQNB 2QFIA 3T1HJ 2W2QP 1EARA 3QLHB 1Q95G 3DNCA 4CM0A 3HZGA 4NMXA 3VAFA 1S76D 5FLXY 4CLSA 1HBNA 1ZOTA 1C1BA 4DI6A 3IWXA 2E5HA 1KLMA 3MM7B 1R3NA 2BZ2A 1NU4A 1HIYA 4A8KA 2UXBF 1RT5B 3KG4A 5GADI 1OMSA 3G4SS 3UNGC 1T9YA 1Z2LA 5I4MA 3VQTA 1QD1A 2FZKB 3OVBA 3VGUA 2XS5A 4CLLA 2EEYA 3T5LA 4CM2A 5H1SV 2APOA 3IM9A 3G96A 1J2VA 2R7XA 2ZH3A 2DXEA 2LYVA 2V34A 3GSDA 4LVOP 1GFWB 4DPYA 3D1HA 4MTPA 4IO9Q 4RBUA 4ZVEA 3DYAB 2R8HA 2CKWA 1YKWA 4RW8A 4Y0FA 1HWJA 2FLNA 3M6WA 3BS9A 2KXFA 1Y00A 2CZ4A 1VC0A 1B0TA 4ZN1A 1U0HA 4NLRA 5K20B 2RVJA 3KDOA 3KWMA 4DV1F 4CLZA 3NS6A 3D68A 1U49A 2HBRB 2ZWOA 3NMRA 1LK7A 2J9DE 4JI7F 3KK2B 3ISZA 2LVWA 4NCBA 3MEEA 2B4UA 1OYDA 4IG0B 2J5AA 1NDPA 3MEDA 3KMQA 1PC4A 1RT3A 1ZBTA 1HPZB 4EO6A 3C8YA 2DY1A 4IOCQ 1NJXA 3QFWA 4QIEA 2C42A 5CABA 3TVYA 1XMQJ 3ZNUA 5C42B 3W7BA 4IFVB 1B7FA 1FD8A 2FJVA 2HNZB 3HF5A 4FKYA 1Q7YT 4YEAA 1JLCB 1IJEB 2YKNA 3RR7A 5T7LA 1D9AA 2EC0A 4ZDNA 3AODA 4PG7A 4N7TA 3V6DA 4CT8A 1GMUA 1ICEB 4WCEQ 3BYRA 3GV8B 2BE2B 5EGYA 3HDSA 2PA8D 4YB7A 2A6OA 1RSCA 1SH2A 4F25A 3K7RA 2XMAA 2XMWA 1BD6A 3BBCA 3EDRB 4DSFA 4DN0A 3BO4A 3W64A 3JQMA 1G1XA 2RD5C 2Q1LA 2PFDA 4IRDA 2L9DA 1VS3A 4NLVA 1EZZB 2HQCA 2J9EA 2HK3A 1N5TA 2KG0A 4P52A 2O1PA 2PC6A 3D0IE 1OPIA 2F1FA 1LFPA 4R0JA 2B0GA 1ZA2B 2COLA 3PO4A 4ZCIA 3ILLA 4RUHA 3OJUA 3BGOP 4O4GA 4DQPA 3ZZTA 3IWLA 2NSBA 5DZ7A 4CYUB 4MIWA 3GJTB 1WUUA 3LAKA 4XPEA 2B7BB 4X64F 2P9CA 2KVQE 2Y0BB 1NM2A 3M8PA 3FEZA 5C2CA 3EE3A 1JLBA 2RMLA 4WP9A 2MHNA 4NCAA 1RT2B 4WFZA 4DHVA 1YQHA 3WZ0A 3BF4A 1D9DA 4TY9A 4OHVA 4ZVQB 5KFMA 3NRBA 3MMAA 4N8NA 4DV4F 2ZBRA 1SJ3P 3MR6A 2KJVA 3LGNA 2AX0A 1C0UA 1WDDA 3A3PB 4DV5F 2D9OA 3J7YI 1NXIA 3P49B 1JLQA 2PEHA 3VAGA 2OPQB 4YQWA 3BREA 2E1CA 4WXWA 2PE8A 2QG9B 5T14A 4DSLA 3MAAB 5DZ6A 1U26A 3DRRB 2OMLA 2A10A 1SH3A 3WIVA 1U4BA 2GHWA 5M2PA 2CYYA 5ETOA 2C1EB 2H9ZA 3DCAA 1X60A 4KBIA 5CXTA 1S1WB 2YVSA 5B0DA 2HQGA 1IBMF 3C46A 4GRSA 4O44B 4Y34A 4RZRA 1R8HA 1DFDA 3KJFB 4DFMA 2QE5A 1RKIA 1H7WA 4AQYJ 4LRDA 5ETQA 4ICLB 4P2XA 2VDHA 5IQ6A 3HO1A 4ID8A 3EZOA 1CJKB 4WE1B 4QIGA 4RWXA 1TKXA 2VOOA 1UEUA 2R2TA 2VG5A 2V9WA 4ZOSA 1LW2A 4QW8A 4QQBA 2DGVA 2LA4A 2JLFA 1HNZF 3M9MB 1IKWA 2R7OA 1TR0A 5E41A 1U7LA 4LF1A 2ZFHA 3KHLA 4ED7A 3PG9A 5F8MA 1R43A 1P1LA 3D6MB 2ZDOA 2ASLA 3W2WB 2H5EA 4ZVTB 4EK2A 4UOCA 4PXBA 5A8WB 1N8RT 1ZTTA 1MU2A 1C0TA 3Q86A 3LWLA 3I6PA 4L3KA 2VFRA 2HFSA 4CO3A 1IN0A 3RRGA 2FC8A 2LU2A 1RT1A 1U1NA 5CYMA 1FO1A 1KBRA 5F0WA 3ENWA 4LREA 3QT8A 2XYPB 3MPWA 2KI2A 1MWQA 3UN5A 5I3UB 3JAMY 3LQVA 3M6VA 2HFUA 4DR6F 2V4RA 4TXSA 3RJMB 4ZPBA 2VPXB 2WSFC 1GEHA 3DOMA 2QT7A 4F4AA 1WHVA 5LL6d 1WTBA 1CJVB 2ZBCA 1N32J 2EC2A 3M8YA 4ED5A 4IOAQ 3GPAA 1FFGB 4B08A 2R8JA 2FUG9 3MWBA 3PXGa 1VIXA 3CC7S 4NLWA 1FRJA 2F9DA 2YKQA 2M8HA 1UW9A 3R1HA 2W2PP 3Q23A 2VFUA 1KTVA 4JI0F 4J9LA 3HSGA 4RW4A 1IBKJ 3M2RA 4Z37A 4O3OA 4ECSA 3TUZC 1RTIB 1A7GE 1NUEA 1DAXA 1Q82T 4Q44A 2JFKA 5AT1B 2EFNA 5CCLA 4RW9A 2EWHA 3EJMA 5A8RB 3PW4A 2KZZA 1SBRA 4NRTA 3SBMA 2DNGA 4NZ6A 2D3O1 4QWBA 4F3MA 1SC6A 2LQBA 1TL5A 2QA4G 1DHMA 4KV8A 1D8YA 4LQ3A 4QYZK 3O6QA 1VBKA 2PFFB 3MUMP 5GMEA 1WHXA 3UCUP 4I0WA 4FVMA 3KLHB 1VBYA 1E6YA 1NDCA 2HWHA 3DC2A 3GYNA 1YLXA 4GKJJ 3JSMA 1H2TZ 5CD4H 1XTZA 3NY0A 2MSSA 2F8MA 3E8OA 3QIPB 2HBQB 1IJFB 5IXUA 4X4NA 3EDQB 2QA4S 3TUPA 1VMBA 4DSIA 1IR1A 4TN2A 3I9ZA 2AMCB 2KRBA 4JV1A 3P5TL 2DGUA 4G1QB 4V19X 2LQ8A 2N7CA 3ZTOA 2IC3A 2CQ3A 1SIZA 4GMKA 1RISA 1T0TV 3EVMA 5AXMA 3EVOA 3JQJA 1RAEB 4I1TA 1PBUA 4NZ7A 4YR0A 3VVUA 3HFVA 3GG0A 2K1RA 5IM0A 4JI6J 1NK5A 4Q8FA 1YWXA 4D3GA 4EYHB 1UVNA 2GO9A 2CDRB 5HQ8A 1DLOB 2VG6A 3HVRA 2FB0A 3P8BB 4Q2MA 1Y5LB 4ZVHA 2E7XA 2KHCA 3PV8A 4IQXA 2YKMA 5A76A 2AHOB 1EX8A 4OI6A 1T94A 2JNJA 2F4VJ 2DIVA 5F8GA 1YJTA 1TKTB 1GQEA 1S9GB 2D3UA 4KRWA 3I5BA 3DHWC 4IFYA 1W25A 4FNIA 2OI2A 3Q8RB 1IVZA 4FYXB 4F36A 5HMXA 2GC8A 2M88A 1VQ4S 3UR3C 4JI2J 3LW5C 4WFXA 3MI7X 4MIBA 3ITHB 2MDAA 1S6QB 1PJ6A 5DDQC 3OTOJ 4QJVA 3FSYA 4DL0C 2LEBA 4KE5A 4PQUA 1Y3KA 5HROA 3OUYB 2ADCA 4QOTA 3PKYA 3HSZA 1QUVA 4TU9A 3MXHP 5GAEU 1HWKA 2CAJA 2CQBA 2JVRA 1RTHB 2KYZA 2QEXS 2AJFE 2GIFA 1VRTB 2XULA 3AQOA 3OPKA 5KFBA 2CPYA 4PWDB 5L8RC 2KG1A 3PW0A 2HGLA 3CJ8A 4NLSA 3ILJA 3TARA 1YJWS 5KFQA 2DRDA 4Q7AA 3DOKA 3WX4A 1VQ5S 4CIOA 2X1GA 2HHUA 2AX1A 4CP5A 2G0CA 3CVKA 2DXDA 1S57A 2PT0A 3KJVA 2P9GA 4NZ0A 2WOMB 1FJGF 1IKVA 4K59A 2A1BA 1RKJA 3OFGA 2RF2A 4J9PA 3KLEB 3NS7B 3TW0A 1N52B 1HQEB 3Q0AA 2RJZA 3KK3B 4KFBA 4EMDA 3WIUA 2NR0A 3ENAA 2GIQA 2MYFA 2CPHA 3AH6A 3NBPB 2IM2A 3EWGA 4QIWD 4IH6A 3H2LA 1W7WA 3T41A 3I87A 4MMOA 2UUWA 2XCPA 3T3FA 4DG1A 5GAGU 4NYZA 4FN5A 4EWTA 2DH7A 4V1Ak 4X4PA 4L73A 2HBYB 4XK8C 1PAEX 2NCKL 4ZLLA 2L41A 1CULB 2F63A 3M30A 5KFFA 2ALYB 2X51A 3I4PA 4Y3CA 2UUBJ 4ZHRA 2UVRA 4FBTA 5ETLA 1TZ0A 3IGVA 5T41A 1RBAA 2HGNA 1WF2A 4LRBA 4JI8J 3DXBA 5LM7E 3TUJC 1U1RA 2PN6A 3BQ0A 5CD4A 2J7WA 4KGVB 1UL3A 1XNQJ 4Y2IA 1X4BA 5JVGQ 2CPZA 1FE4A 3CCLS 4URQU 3G6XA 3W2VB 3DXSX 5HMYA 2WW4A 2IVMA 3D3CJ 1NK9A 2PDAA 1REVA 3L7PA 3QQCD 2XHWA 4WZQA 2L08A 5K14B 4DV6J 4JI3J 2AWZA 1I94J 4PQAA 1PG5B 4NLUA 1EQMA 4P9SA 4WPAA 3O3LA 4HI1A 3R3TA 4X4UA 3WBZA 3A12A 4WK1A 1XNRJ 4J9VA 1HYSB 1OO0B 1SVDA 4MKBA 3Q8UA 5B08A 2XQCA 2YKOA 4PAAA 2XEXA 1L3VA 1HNVB 2AEFA 3S1TA 4X4VA 1AROP 2VODA 3RAMA 2MQQA 3JSRA 4JB8B 5SUHA 3GONA 2QYCA 4JV0A 2EK1A 3CULA 1FCAA 1LW0A 3QGIA 4OX8A 3BV8A 5LMNF 4HACA 2FVCA 1ZETA 2KZMA 1CSJA 2HNDA 2NS1B 4UY85 4KHPF 2UP1A 1EJ7L 2BABA 2UUAJ 1OSCA 1VQMS 3M2VB 2DK2A 4KPCA 4PKDB 1YHQS 1KTQA 4FDFA 4FXWA 2CWXA 1SB6A 4C8NA 4EUVA 3NL0A 3CW2C 2IYIA 4K8RA 3G9CA 1H72C 1U1PA 4U95A 2LQ9A 4WIIA 5A6WA 4DQSA 5C25A 4RO0A 1IUJA 2YQ1A 4WFAQ 1CLFA 1XR5A 3Q8QB 4ANCA 1TL4A 2JL9A 2HRUA 1X4FA 4NYPA 1KQSR 3QIDA 3N6LA 2ZNYA 3WDOA 3RBEA 3HHNB 3GR1A 4X65F 1U1OA 1KHWA 5ETTA 2BMBA 3NGUA 4P7TA 1TL3B 4A8WA 1HNXJ 4OLPA 3VTIA 3PDNA 2C3MA 2WBRA 2BJ7A 5AXNA 5K8OA 3PO5A 4NE9C 2RQ4A 2DNPA 2LCWA 1N0UA 5I3PA 5AJ3J 3DRYA 4KH0B 3C2PA 4EEYA 1M1HA 2C2OB 3FRZA 4DCPB 3CF5Q 4HKQA 4K4VA 2HHHJ 4N8OA 1O0PA 2F8HA 3H5SA 1OYEA 1RHJB 2FTRA 4TLQA 1S9EA 3H4DA 4ZPDA 3V4IA 2IM3A 4DSKA 3QFHA 1SCJB 1WOPA 1D1UA 2R7SA 4YDXA 1VHFA 1QLNA 3K17A 3BH7B 1VLOA 5A8KA 3M32A 1RI7A 2YWWA 1EAYC 2HW3A 1SJ1A 1C4AA 3PFOA 3MOZA 4I2QA 1FDDA 1E6VB 2IA0A 1S0VA 3PR5B 3LGMA 1WTFA 2KN4A 3RZAA 4WWSA 2DGTA 3HULA 3D9BA 1SJRA 2DJWA 1RAAB 3RYLA 1Q5YA 1X4CA 3UDVA 1Q79A 1YJUA 2QLWA 4F04B 1V3RA 3FNNA 3BDEA 2V6AA 3POTA 3BR8A 1R6VA 5KFPA 2ZE2B 1KQFB 3U1MA 1QVGR 4DSJA 4QR1A 2PEBA 3PIOQ 4YB1P 1UVJA 1QY7A 2GVZA 4UZBA 1LOUA 1ZAVA 5DQGA 2RE1A 8ATCB 2VBYA 1RXOB 1HBNB 2NXEA 2XY7A 2HAIA 2VPZB 1C1BB 1KLMB 4F0KA 4EBEA 2VKZG 2ZHOA 2NZ4A 1NSAA 4LR7A 3PYGA 4RNNA 2XNQA 2K06A 5IQQA 2DVIA 1SQGA 3CJQA 3HMJG 5D3GA 4JP8A 3PJ9A 4I6WA 4M8LA 4NPOA 3BJYA 1RWUA 4ES3A 3JTPA 3FCHA 2B3TB 5AXLA 2IDEA 3BPSP 5SZTA 4DXLA 2LP4A 3THVA 1TMMA 4DCJB 4RW8B 2Z30B 2M4MA 3N01A 3HCXA 2AZ1A 4C98A 3BN7A 4NA3A 1EETA 1JNZB 2XYGB 1WACA 3UO0A 1X9WA 1U0HB 3KHGA 3LWMA 1QDUB 3PYDA 2M3DA 1C1CA 1V3SA 3EGNA 2H48B 1LFWA 3QGPA 3KJNB 2VBXA 3MEEB 3M9NB 2GGPA 2F4FA 3I31A 3KTQA 4NLDA 1P27B 3MEDB 1N4LA 3BGUA 1RT3B 2GS8A 4P10A 5L39A 4KGZB 4DBQA 5C7PA 2JSXA 4ECXA 4AE5A 5D77A 5J2NA 3PKMA 2R42A 3KK1A 4CNYA 3CCJS 3RB4A 1Q8IA 1AB8A 3ISND 3DOLA 3PACA 1Q8KA 3HHKA 4A8OA 2YKNB 2XZTB 3QT6A 3PZPA 4ILRA 4ATNA 4C8YA 5T7LB 3MAQA 2M7SA 2E9TA 4J9SA 3V6DB 2XMMA 4GO7X 1VQPS 2MHEA 3SV4A 5BR8F 3BN4A 1SKWA 2WVCA 2Q79A 2ASYA 2R2UA 3V81A 2NQPA 2KYXA 1R8BA 2F40A 4PPZA 4JV2A 2E5IA 3BM7A 3MM6A 4DV0F 4NXNF 2RKIA 2CIMA 1WEXA 4MYUA 1ITPA 3NG8A 5ETPA 1SJFA 2KDOA 1RWPB 3ZZ0A 2GX8A 1X9MA 1LV5A 4NLPA 5DG9A 1H0HB 3MR7A 3LA0A 3OXFA 4ED4A 5LXYA 2ZJPQ 1GAOA 2DHAA 2G1DA 4Z7YA 2N4DA 2ZM6J 6FDRA 1RHQB 2SXLA 4O4GB 4AL7A 2CFXA 3H2VE 3ZTPA 2CVEA 1YBTA 4UOFA 3THTA 2R8IA 4DV2J 1R0CB 1VQ7S 4WKYA 3FBFA 2DB1A 3BBBA 1SL2A 1K8AT 1N5VA 3KOAA 3M8PB 1GMVA 3C16A 3K89A 1JLBB 3U1NA 4M5DA 2IVFB 4B3SJ 2MXYA 5KFHA 2AEJA 2UVWA 5I42A 3ILOA 1LEOA 1T05A 2BKNA 1RDRA 2HHQA 2IM0A 4OQJA 3MMAB 4OLOA 4B3MF 2MLXA 3OLBA 3TAMA 4IRCA 1C0UB 1U1KA 4CDIA 4W90B 3VCDA 2JH3A 2DKOB 1NKBA 1RAHB 1JLQB 2RU3A 3H98A 2ZOMA 3ZC4A 2M8DB 2VA2A 4TYAA 3HD2A 2ZH5A 1JQGA 2FJAB 2RNEA 2HQDA 3CJSA 4LMZA 3CJ5A 4ZP8A 4FXDA 4HR2A 5GADU 4USUA 2ATLA 2AJ1A 1OS5A 2DH8A 3T1YJ 3B4DA 3O2IA 2YX7A 3IBFB 2KHDA 8AT1B 2E5LJ 1DZ5A 2E9ZA 3OTBA 4Y2CA 3BH6B 2JLEA 3EMTA 2HBZB 2DGSA 2BANA 4HL9A 3MPDA 5JMNA 5KFEA 1UFLA 1C4CA 2Z58B 2Y8YA 1TKXB 4GKKF 4K0KJ 2CQ4A 2B51A 4N56A 5AE3A 5KOXA 2VG5B 1LW2B 1K1SA 1GXLA 2CG4A 5KFYA 1U1LA 1IKWB 3CJ0A 4DUYJ 4NLXA 1KOHA 3WQPA 3MPUB 2ZZTA 2MQOA 2FDNA 3QPIA 2FJDB 1NMEB 2RHSB 1SC4B 1AXQA 2HS0A 3NNAA 1MWYA 1N5YA 2C3PA 2DY9A 3NXZA 1N0VC 1YJVA 3IG1A 1MU2B 1C0TB 4KKOA 4OYAA 1FVQA 4RNHA 3UDLA 5C5JA 3R7BB 5MLCV 1RT1B 5CYMB 3R6LB 2BQRA 1U8SA 2ATCB 1KP6A 1R8CA 3UWTA 4UF4A 3C3LA 1PJ7A 2CQGA 1KONA 1XMOJ 4UY8T 1HKAA 2RH3A 4H4MA 3C66A 5K5MA 3DRPA 1IBLJ 3IAM9 2WONA 3DOMB 5FIIA 2J6SA 4GVLA 1NK7A 5HP1A 1Q8BA 4NI2A 2KL8A 1P1TA 1S6OA 2RQKA 2BQ3A 2FZGB 1U45A 5GAHI 2ZH7A 4QPTA 5KFSA 5F8LA 2IAJA 2YPYA 4TQSA 1TK5A 5CA5A 3B78A 2W9BA 1J5OA 5B0EA 2XSJA 2NUUG 2K7KA 3OXLA 3H20A 4X4SA 5DDPC 4DX5A 1HQUA 3MGJA 1WELA 4U7CA 2GVDA 1T9TA 1TVRA 4RW4B 1M5SA 3M2RB 1DARA 1X4HA 3D54A 3M8QA 5KFCA 2UZAA 4DR1J 2IRYA 1RCXB 3DRXA 1EP4A 2V8PA 4IH7A 4RW9B 1JXVA 4HTIA 2GA7A 1DJ0A 3EGZA 3W5XA 5H9EK 2UXDF 2I0XA 3C15A 4C9DA 4C48A 1WC6A 2N4CA 3NGKA 5ETRA 4KV8B 4M5LA 3T1HF 1F9FA 1JXLA 3JXOA 4DPTA 4DR4J 3Q89A 4ILLA 2ZC3A 2BJ8A 3AD8C 1E6YB 2WBMA 3CUNA 3MCOA 4P74A 3RW7A 1XQIA 3JSMB 1NO8A 2N7YA 1S1XA 5IFMA 5IWAJ 2EFGA 4ZJOA 3VZIA 1RT6A 2BVZA 1NKCA 1R89A 1KEKA 4URGA 2JFDA 4U96A 2UXCF 1QTMA 3NKYA 3MURP 1MW7A 3UFCX 1F60B 1FWPA 2VJUA 2VPWB 3DU6A 1AUSL 2OEKA 2HFZA 3M8ZA 1D09B 2CQ2A 9RUBA 2M9KA 3I56S 2IC3B 2OEMA 2OSQA 4LF6F 2ZZMA 3T5JA 3CIMA 2P6TA 3A3NB 1ZAWA 1FXRA 2V0NA 1PAUB 1RQ0A 4NWBA 4NMLA 3CDWA 2K1RB 2IJRA 5IM0B 3GCXP 2VQEF 4BS2A 4ETXA 3ENQA 1SQFA 1HARA 4R0EA 4CH7A 4ED6A 3FKBA 3NGDA 1UFKA 3UD5A 4ELTA 5DLGA 2IIHA 2NUHA 2YKMB 1PGZA 3DM2A 4DR3F 1GTHA 3CCMS 4WFBQ 1VQLS 1SXLA 2CG8A 2ZH1A 1XMQF 4LR9A 3KXDA 2HHWA 2PIIA 4IFYB 3TA2A 2DR5A 2V4JB 2DTJA 3K0JA 2B9XA 1U25A 4JI5F 3M6XA 4CTAA 3LP1A 1K9MT 4YS2A 1LQ9A 4MIAA 3NGRA 1URRA 2Y3YA 4J9NA 1D8ZA 2BE7D 3VQSA 1U48A 1UVKA 5B09A 2B4PA 3GYXB 3UNYA 1TTHB 2I5JA 4PQUB 1ZM4A 4ED3A 5HROB 1RU1A 3L4BC 2VFTA 4JV5F 5KT2A 4J9QA 1UJ5A 2VH7A 4P7VA 4USWA 4IRKA 4LF5J 4H4KA 1RZMA 1R6YA 5ETMA 4PXDA 1NEEA 1WC3A 3AA8A 3T1AA 4KB7A 3HFKA 2CRLA 1NSPA 3QMQA 3DLEA 2HHSA 3A8IA 1HNWF 1R8AA 2CPXA 4URSA 3MM5A 3IGNA 4ZIWA 3DOKB 4DS4A 1SJQA 3C6TA 4NA1A 5HO4A 4ETZA 3QSYB 4I69A 1IR0A 1M5HA 2HWTA 3R2DJ 2VASA 1LWCA 4LRAA 5J2PA 4OFZA 3NEKA 3R6GB 3FEYB 3KJVB 4K7QA 2DNZA 3JYTA 4ANEA 2NXUA 1IKVB 4QZVB 1VOMA 1S0OA 2RF2B 3X1LB 3QATA 1S59A 2EFOA 1JLGA 1S12A 1P9YA 1S4FA 5IS2A 3F73A 2RQCA 5F8IA 3BGLA 4KFBB 4J9RA 1R31A 1APSA 3LALA 1HW8A 3CJ4A 3P6YC 2KRRA 3UI3A 4ZCMA 1RACB 4O3SA 2FJWA 2W9AA 3RRHA 1SL1A 2JDJA 1RT4A 2JEFA 1HW9A 2DNQA 2FGCA 4OV1A 4USTA 2R8GA 1QUPA 1DTQA 2G0JA 4FYDA 4DG1B 5CZVA 1JIHA 2AF6A 4KGXB 3TRGA 1D9FA 1Q0NA 1MROA 1RADB 5CYQA 1IBMJ 3KNGA 2MJNA 3M30B 3QT5A 4X4OA 2XLIA 5L1LA 1MLAA 4ZHRB 2W9CA 1NPPA 2XMKA 4C97A 4AL5A 1L3TA 3D6TB 1UA0A 5DLFA 4WXOA 5HJXA 1KNZA 3IRXA 3PJWA 4M5NA 2Q6CA 1Q7LB 1SKSA 1KFDA 2EKNA 4RU2A 3TVKA 4PR6A 1A6LA 1H74A 1HNZJ 4DCOB 3PX4A 5FLXU 1FWKA 3CDBA 1I3OB 4P71A 3HJVA 2QSFA 1REVB 1WSRA 5KG6A 1MMLA 3MM8A 2BR0A 1UVIA 2Z4PA 1JK9B 4ELVA 1P6TA 4WP8A 4WU3A 2IVYA 3HK2A 5BXIA 1WEZA 1U09A 4BHQA 2DR9A 4J9MA 1Q81T 4DWIA 2Z2LA 2XO6A 1GTEA 4FS2A 2M52A 3MMJA 2ASDA 1RJJA 3DGVA 2V4QA 4C8KA 2GCFA 4OZ2A 2GJFA 2CQIA 4CO4A 2OLWA 2GZOA 3QRRA 4DR6J 1LW0B 3BSCA 4C3MA 1DY3A 3LP2A 4HACB 2HNDB 4DR2F 3PNIA 3QJJA 2Z8QA 4CH0S 3CO0P 1FRHA 3ICLA 1XK8A 4M1KA 4CO5A 3TZYA 4RBTA 1AA1B 5IOLA 2ASJA 5HBMA 4AXIA 3H0PA 4WFNQ 2UVUA 4RW6A 2HRTA 4OI3A 1TKDA 5C25B 2V8DA 2JHEA 1WEYA 4BDPA 1FEHA 5A2QU 1UEKA 3RUBL 4TQRA 1UA1A 2OUGA 1KRPA 4TKTA 2Y1RI 1RU2A 2MB0B 2MSTA 2OSRA 4AD6A 2E1RA 1EHWA 4LQ9A 4XTTA 3IBCB 1U02A 4HTJA 4A48A 1M5PC 3CGIA 1KN6A 5HI7A 3OV7A 3H59A 2BX6A 1M0SA 2Q66A 1KQKA 3FMWA 4C0BA 2MKCA 2QFJA 4YP3A 1TMJA 2JEGA 2HS3A 3ELHA 5KT4A 1CG2A 1VJQA 3SXLA 1XIQA 5DM7Q 3QLHA 1GNKA 1RLCL 2MQNA 3VAIA 3US5A 1FD2A 3OL8A 3PR4A 4LFCJ 4ZCLA 4RUBA 1GMWD 1S9EB 2IJFA 1SUQA 3V4IB 4U9RA 2WVDA 5IT9U 3N5FA 5J1PA 1LWFA 2W2NP 2AGQA 2QRRA 4EI2A 1SKRA 1XR7A 2L9NA 5A8KB 3M32B 2FLOA 2OGUA 4DU7A 1NZAA 3MEKA 1HQ2A 2YTCA 4J91A 2ZOGA 5DRKA 4ED0A 3I96A 2R3VA 4I2QB 2KFYA 3CC4S 2HHTA 1YJ9S 3TI0A 5K8MA 2VFVA 3A3OB 1ACMB 4WJBA 4CQ1A 3DLHA 2J9DA 4B9NA 2AKWB 4HT7A 2G13A 3TA0A 4OI0A 3QJLA 3HHLA 4B9SA 1DQ8A 2O01C 5HVFA 4QU6A 2AYMA 2QV6A 5KFZA 5IT4A 3POTB 1QVFR 3K5PA 3BPDA 4OX7A 2FY8A 3T6JA 2JWNA 1BHNA 2V2VA 5ITHA 1URNA 3RB6A 1DURA 1F6TA 3LUYA 2GVZB 1UJ4A 4J9KA 1L5UA 1GXUA 1UTAA 4KIAA 3PIPQ 2HVEA 1X0FA 1SC3B 4C11A 4LT6A 2W2MP 4FF1A 3EPIA 2QTWA 2XTJP 2A0FB 1FTCA 4NL5A 2W01A 3MECA 1F5CA 4EGLA 4UOGA 4YR3A 5D3GB 4O3NA 1Y3JA 1X4AA 2QLXA 2F4VF 4FYVB 1HL6A 4HHUA 1RAGB 2B9EA 1GXTA 5HLFA 3T9ZA 3EXCX 2MPUA 3W66A 3D66A 2ZH4A 3FZBA 2EFQA 2ERRA 1RAOA 1Q1KA 3GB0A 1F2HA 2IM1A 2K8GA 2M2BA 1R0AA 1EETB 4JI2F 3DLJA 4C0HA 2ZH6A 2VUGA 2P2CB 2V5HG 2QMXA 1NJZA 2V8HA 4H4OA 5KG1A 3OTOF 1MMDA 4XIUA 3NNHA 1C1CB 2OPRA 1S97A 3OTDA 2VFSA 2GGPB 1WC0A 5F9LA 3LOUA 4BBYA 2XYHB 2MZRA 4DFPA 1S5ZA 1WC1A 5KT7A 2J7UA 1N5QA 4P73A 2YH0A 2A2CA 3PHTA 5J2NB 2ZC4A 2FQQB 4F2RA 3TJ8A 3OTEA 2Z57B 3KK1B 1PO6A 3RG6A 2FHKA 3DOLB 1RCOB 1RB0A 3TANA 2F65A 2ZHAA 3KLFA 2ROEA 3H2UB 1HBMA 1TL1A 2B7CB 3R2CJ 5D4OA 1LXJA 1WOOA 3EPGA 4ZVGA 3IO1A 1TK0A 4OYMA 1BLUA 5GMKa 1FKPA 3EUNA 4UOHA 2DEJA 3FQKA 1IKYA 3KLIA 2OH2A 4K4YA 2HFVA 3GWCA 3RW6A 5CYJA 2NXCA 4K4ZA 2DT9A 3V81B 4OHYA 2MKYA 3GTYX 4KGMA 2DPIA 3ZFVA 4EZ9A 3G87A 4Q8EA 3UW1A 4NYOA 3HVTA 3MM6B 5L1JA 3GIJA 2RKIB 2X3DA 1S6UA 2RRBA 1WSVA 2J7KA 1NHUA 2WHOA 4Y2MA 3EXYA 3M9OB 2KT5A 2RS2A 3PW2A 1RA6A 4CO0A 5KFDA 1Q78A 3OFHA 3SIPB 2BJDA 2LXUA 3D1OA 5KTQA 3G71S 5A6PA 2MTLA 4LBPA 5KFWA 3D1QA 1U8WA 3LO3A 1NB2A 3V6KA 4LFAF 1IQZA 2F8EX 4W98A 3G6VA 4WYLA 2IYGA 1X5PA 3CB4A 2P9EA 5JUMA 2LEPA 1WG4A 1F3VA 5KFRA 3KUGA 1WC4A 3CDAA 4HYKA 1I1GA 4UW2A 3C16B 2UUBF 2W7OA 4M5DB 3GQCA 5I42B 4BLGA 1S72S 1VQ6S 2YNFA 1TKZA 1HMVA 2I2YA 2MY7A 4LF7F 1B7YB 3U02A 2KM8B 4XO0A 3PW7A 3Q2SC 2E1PA 3TAMB 3ILIA 1X5SA 1MG7A 3NGSA 3N79A 4KR0B 1XNQF 1D0EA 1S99A 2NXJA 3CE8A 4R25A 4OI1A 1GT8A 4UQGA 3PEHA 4P72A 2OELA 4TLRA 3Q2TC 4W92B 4O3PA 4YMEA 4DV6F 4JI3F 1KD1T 3IMQJ 1I94F 5J1EA 2DCUB 6AT1B 4A8XA 2D1CA 4NEYA 4LBIA 3N0VA 4OI4A 2E7WA 1XNRF 3TAQA 1RLDA 4CLUA 2YKPA 5LMNJ 1F2GA 4LUBA 3QAUA 2HMIA 3N6MA 1TFYA 2JJ4D 3NCPA 5GAEI 2B4VA 5HATA 2XLJA 4P2FA 2IY5B 4WBFA 3J7AN 1AZSA 2BANB 4I64A 4CO2A 3DN9A 3IRWP 3SSQA 4I7FA 1T9XA 4B3TJ 4ZMMA 3K8WA 3TJAA 2UUAF 4DUZF 2FHOB 4PXCA 2IA6A 4KH1B 5MAOA 1RBLA 2MKHA 1H7XA 1TUVA 4P6QA 2AGOA 2KKHA 3CTRA 2HZAA 4F0HA 2QL5B 5U47A 1F0XA 4YHHJ 3IG1B 2C22A 3TZZA 3E51A 4KKOB 2GQ2A 2IRUA 3TZXA 3CJKA 4U7UD 1H98A 3OR2A 4YN3B 3H4BA 4F4ZA 2DGOA 2MY8A 3M1VB 3PJXA 3KLGA 1IKXA 3HT0A 3HZEA 2HK2A 1HNXF 1UKUA 2IMOA 1YBUA 2CPDA 2A3JA 3RB3A 2X1BA 1SIWB 2LLZA 3I0RA 1H2VZ 1CC8A 5H9FJ 2V8GA 5EWEA 2ROPA 3ENVA 4Y2KA 1VI7A 5AJ3F 1R7IA 5LSRA 4A4JA 4H4MB 2V67A 3DRPB 5GAGI 4USIA 2HHHF 1ZZNA 3W61A 3NCQA 3T19A 4X62F 2D74B 3RB0A 3H42A 5HP1B 4NI2B 4M94A 1RHKB 3P4UB 2DH9A 2G0IA 4IYQA 1K0VA 3MF5A 4B9VA 2QA2A 5DDOC 2XGQA 4DL3A 4PEOA 4LF9J 1N33J 2G4BA 4ED1A 2IAJB 3IM8A 1J5OB 2W9BB 3LANA 2XSJB 3PM9A 1FDAA 3HXMA 3VALA 4C8MA 1HQUB 1U6FA 1RTJA 4CI0B 2GVDB 3SCKE 1TVRB 3IFEA 2BRLA 5EUHA 4I68A 2ZITA 3M8QB 2W8LA 3QWUA 1UWBA 4C2MA 3MFHA 1T9VA 1EP4B 1UVLA 1N6QA 5ETNA 3UCGA 3ZZOA 1OQ6A 4LSNA 4Y2AA 4WU2A 3U1LA 5DG7A 3C15B 4O3RA 4CWBA 3HVWA 3UQSA 2FD2A 2RT3A 3TZWA 4QWCA 1JJHA 1JB0C 5RUBA 3AOBA 3O8WA 2HVIA 2RDJA 5B0GA 5LOQA 3MAHA 4W4MA 1RP5A 1S77D 1S1XB 1UPMB 5DGBA 5E0OA 1Y5IB 1U1MA 4K50A 2BXJA 3PVXA 3MM9A 2W4PA 1ZPVA 3GILA 3UD4P 4GVBA 4F2SA 3K2YA 4FP9A 5LMUF 1QJHA 4L74A 2DBBA 4LRCA 1JLFA 1H3DA 4C8ZA 5KAKA 1V9OA 1G3OA 4IR9A 3PFEA 3T5HA 4U6PA 1ELOA 4AT1B 1PJ5A 1RTZA 1VRQC 5DETA 1LWEA 3K8VA 1U47A 3SQGA 4ALZA 3GE9A 5F41A 2MKJA 4ZPWR 4HHHA 4Q0BA 2IBOA 3QT7A 3BSOA 3UCZP 2C2ZB 5ETKA 1VQOS 5GVQA 2VL1A 3EGVA 2W1BA 1RHRB 3DM2B 2DD8S 3ZZPA 2J0WA 3Q8VA 1KC8T 4J7CA 3CCRS 1BC6A 1YTYA 1Q16B 3LTOA 4GC6A 2V9KA 4FZVA 1RUSA 2CJAA 2CNLB 1JX4A 2KM8C 5KFTA 4B3OA 2WAQD 3TYTA 4OHXA 3DLKA 4X4RA 5C24A 4CTAB 3K59A 3LP1B 2YNHA 3LAMA 2DXFA 4QR2A 1DTTA 3AJ2A 4M5JA 4DV0J 4NXNJ 3OHAA 3Q22A 2EKYA 2ZD1A 3BR9A 2I5JB 2JX2A 1QSLA 1FNOA 3CCVS 4OYBA 2DIUA 2XY6A 1YRTA 2XM3A 3CO9A 2XBPA 3OJSA 2I6WA 4RNMA 4NLTA 2AQ4A 3G8SA 1O6XA 2KB2A 1RE1B 4FNHA 4DR7F 3N28A 2R4FA 4KQZA 1U2FA 1AYEA 2OPPA 2OKQA 3ETMA 1NLKL 2HYIB 3Q24A 3UDCA 2A2DA 3DLEB 1X7VA 4TY8A 5M2RA 3KMSA 2EG2A 1PIEA 3MTKA 2DRBA 5D6GA 2FJEB 3IBWA 3MM5B 3G82A 1NK4A 3C6TB 2W4CA 2ZBIA 1UP1A 3OD2A 2ZM6F 1VK3A 2YBVA 3VAHA 2UV8A 1LWCB 4PYDA 4F02A 1HNIA 5J2PB 1VIOA 2KT2A 4IG3A 2H4YB 4KGKA 2PGCA 3ET6A 2WK4A 4N47A 3OW2R 3JYTB 2HURA 3MOJB 3CIZA 2HHPA 2MQMA 1Y0HA 4DV2F 3BGRA 4B3MJ 4Q45A 2RIJA 1JJCB 2XSFA 3MR3A 3HHLD 2QL9B 1XR6A 1JLGB 3M8WA 2R7VA 3Q8SB 1YGYA 3AB2B 2OMOA 3MD1A 1S10A 5IV4A 3DKDA 1TK8A 2D41A 2C2EA 2BQUA 1RT4B 2Q6BA 4AXJA 2VU5A 2VD3A 1AFJA 3PYEA 1DTQB 4ECYA 4C3KA 5KFJA 1WHYA 1U2CA 4WF9Q 4DZ6A 4DUTA 2R2RA 3FGVA 2ZHBA 2YNGB 4UTGA 4B9UA 2C28A 1RTDA 4B3RF 4HVZA 3L7OA 3IR5B 3J7A1 1G2EA 2CQPA 1MROB 3U27A 3NP5A 1LNQA 2AJ2A 4KSEB 1YJ7A 3DMJA 4ES1A 2LDIA 2H65B 1VLYA 2W9CB 1X4DA 3MEGB 2QLJB 3NMAA 4KTQA 1UMJA 4I2PA 3CJRA 2C2MB 1RAIB 1NSKL 3T1YF 3CDEA 2PMHA 5J2MB 1FDNA 2VKRA 1WKLA 1VDHA 3IRXB 2MQPA 2H3EB 4KYZA 1FVSA 3MR5A 2CJBA 1N54B 1HWIA 1N36J 2FC9A 3T5KA 3D0HE 4QCLA 2HQ3A 1WI6A 2B9WA 1XC9A 2HG4A 2XMTA 2NPFA 2B4OA 1QM9A 3PRDA 4GC7A 5KG3A 4HEA9 3E2EA 5HK4A 4F26A 3CSKA 2CQDA 4K0KF 4ZVFA 2Q43A 5D4NA 1WC5A 1RT7A 4B17A 1RA7A 2ZVSA 2XS2A 3AOCA 4ER8A 2FVQA 4J9UE 1W26A 1JLAA 4DUYF 2HZVA 3R5DA 1VR6A 2GMHA 4DS5A 4H54A 4ZN3A 2BOAA 2XMVA 4OYOA 5KT3A 1BQMA 2AYBA 1U1QA 3UR0A 3C19A 2QMUB 3CJ2A 1RGVA 2KTQA 1NB7A 2JEIA 1NK6A 3OVAA 5KFNA 3A13A 4YDDB 5BJRA 3LP2B 3TOQA 3PX6A 1TP7A 2QLBB 3W9JA 3F44A 3FCVA 4WP3A 3PHEA 4Y28C 3Q83A 3MDFA 5E3AA 4A8SA 4RPFA 3B4MA 4F8RA 2MZTA 2CJQA 2GNKA 2UUCJ 4ZK7M 3FFIA 3QRQA 3BKTA 4OHZA 5HBMB 1PC5A 4LF8J 3RBZA 4RW6B 1IBLF 4BC9A 2HWIA 2IRXA 3ADAC 3I32A 4NLQA 2WTFA 2N82B 4OZ1A 2BACA 1KQGB 4TU8A 4CH1A 3WC0A 1J5EJ 4DV7J 5CH7B 4OJ3A 4EBCA 4KPYA 1FESA 1AT1B 1S1TA 3ZZYA 1T7PA 4E8UA 4NXMF 1EB0A 2NYIA 3FBBA 2PSZA 3FSIA 5E3RA 4DR1F 2J76E 4PG6A 4XDCA 4KC5A 1SUQB 5CHCB 3HVAA 3GIIA 2U1AA 3MR2A 3I0SA 1LWFB 2UU9J 1BWVA 4ECQA 2ZBPA 1FRIA 2XG8A 1DBDA 3AJDA 4DR4F 3HKWA 3R5AA 2UXCJ 4OX9J 1S6PA 3KJQB 4IQMA 1NKEA 3W63A 2KXNB 1VQKS 1FI4A 5DQHA 5IWAF 2W7PA 2YPZA 4F3OA 2E9RX 4H4KC 1H2UX 4LF6J 1FTRA 3HHLB 1FNXH 4F50A 5K8NA 4PABA 1SPBP 1G6BA 1T02A 4JI4F 2WSEC 3GLJA 4IH5A 2MQ8A 2GJIA 1I5OB 2VQEJ 3BO3A 2X7IA 5BYQA 3FRYA 3AXKA 4M95A 1S1UA 2JEJA 2Y9HA 3B82A 4LVNP 1T8EA 1QE1A 2VF3A 1M5VC 3Q8YA 4ID5A 1JXEA 3A8JA 4C11B 1Y4ZB 4MH8A 4DR3J 2ALZA 5HVGA 5IT0A 4JI1F 2GJ2A 3R7SB 1RWWB 4OZJA 2C3OA 1VC6A 3MECB 5A2QY 2FVPA 2DO4A 2FVSA 1JMTA 3FBEA 4X66J 1RBOB 4JI5J 3OFEA 4IDKA 2U2FA 3CCES 1ZS6A 2WVBA 1HBUA 3LH2S 2F7VA 1X31C 5HLFB 5KFLA 2GAGC 2BJ1A 3V4MA 1RWMB 1KVKA 4FXVA 2H51B 2J9CA 4HT5A 1F1BB 1ZM2A 3R1LA 2BBEA 3GYGA 3OSNA 5HSPA 3TEGA 3D2WA 1R0AB 3HP6A 4LF4J 4JV5J 2KT3A 2PO4A 3RBXA 4KT0C 2PI4A 4H4OB 4MKVA 2MKKA 5K9FA 2OPRB 3CCZA 5IT9Y 4J5OA 2JC1A 1YJNS 3G6ES 1JKHA 3EYZA 3FJ2A 2OP5A 1KFSA 1M5OC 1SJ4P 4U8VA 2W2OP 2XZWA 2Y0SD 1HNWJ 2HAFA 3NGTA 4NLYA 4LF5F 3QO9A 2BRKA 5IC4B 3T6BA 1NK0A 5F8HA 2MLYA 1UPPA 3BDPA 1HHSA 1QAYA 4OYZA 4J37A 5KT6A 3TVZA 3J7Z5 3N6NA 1Q5VA 3DDKA 2HRYA 2IDLA 3KLFB 3I9V9 2XO7A 4AUKA 5D4LA 3DLLQ 5CCMA 2GFFA 1YDLA 3RRKA 1HBMB 1TL1B 3RTVA 4DOZA 3BQ2A 3BO2A 1SI9A 4QIVA 3GCWP 5L1KA 1FKPB 5E3PA 1IKYB 3KLIB 3HLUA 4RU9A 2RUSA 3S01A 3SI8A 2GIRA 3QSIA 2MKIA 4QBUA 2BKPA 3DGPA 4DR5J 4NLGA 1FX4A 1KR4A 2VJVA 3BKFA 2LMIA 5L9XA 3HVTB 3DDIA 3KLVA 2C3UA 4YFUA 8RUCA 3EZ5A 3OR1A 3OQ2A 5DDRC 1U2RA 3TWZA 2YWGA 4QWEA 3TAPA 2MEWA 3CMAS 3QZ7A 3D28A 2XZDB 1FHTA 2K7JA 3KYLA 1FFSB 4B02A 2FJBB 5B0BA 3J80U 1YITS 3L95X 3SYZA 4OZ5A 1T3OA 5G0RA 1BUXA 1FRMA 4ZVSB 5HANA 4DEZA 4ZP9A 4BWMA 1RK8A 2BM1A 5HN0A 2BJEA 1O51A 2WZ1A 1R8PA 4LFBJ 4OJHA 1PKUA 4G3IA 1Y9OA 3HI9A 1XJWB 2VQFF 4GO5X 2ILYA 3A8KA 2CQHA 5M2UA 1LKZA 3C6UA 1HLWA 2HZCA 5HMWA 2Z2ZA 1VQ9S 2QJ3A 1XWLA 3GIRA 4X2BA 4U67Q 2CNKB 2VG7A 4UT4A 4K4SA 3R8YA 3KUHA 2IJNA 1UZDA 5E2QA 1AUDA 2YNFB 1TKZB 2O67A 2D7SA 2X1FA 3SCIE 1HMVB 4OZNA 4DL5A 3H5YA 2HIYA 5HVHA 2RRAA 2CPIA 3H90A 3RAQA 4DL6A 3OHBA 1HR0J 2C2RA 3PRBA 1S1VA 4UZCA 3CCWA 2LKZA 3GU0A 5KFUA 3G6YA 4O0NA 2QIFA 3PEJA 5BYSA 1CS4A 4LF2A 2E5GA 4X84A 4J9OA 1Z1ZA 5J1EB 2DNHA 4O3QA 4ILMA 1NK8A 5E3CA 1Y7PA 1ZPWX 1VYAA 3NNCA 3KDNA 4FYYB 1OIAA 3DHXA 4HDHA 2B5JA 1FRLA 1EIYB 2V69A 3H40A 2ZH9A 5DGAA 1PCAA 2HMIB 5DM6Q 4FPIA 1N34J 4DR2J 2A18A 5LXRA 2ZH2A 5D0HA 4C4WA 2FVRA 2EBGA 2V94A 1AZSB 2BE9B 4JYAJ 2DHGA 1UWAA 3SMZA 1X5TA 1GMWA 4I7FB 3I82A 3AAWB 3GJQB 4RW7A 5B0CA 2YH1A 3HHLC 2B8QA 4U8YA 2JVOA 5L9NA 4PG4A 1F9HA 2R2SA 1H73A 4CCHA 3NOCA 1KWMA 3FQLA 4USHA 1RWKB 2CJKA 5DO2A 2RUGA 1NDKA 1IQTA 2XS7A 2BA9A 2UVVA 1YX2A 2FLLA 5HMZA 3MMBA 1GX5A 4O23A 2Z0GA 1NJWA 3Q8PB 1K73T 2KXHA 1O5JA 2ZBQA 4DV3J 4A47A 4KO0A 2E44A 2OD4A 4FKXA 3CD7A 2MZQA 4UUXA 3F41A 3FCWA 3CJKB 1Z4UA 3OR2B 2XI3A 4DQQA 3KLGB 1IM6A 3AFGA 3KG1A 1UETA 1M1GA 4HHJA 1IKXB 1RAFB 1HFEL 3IS9A 2N3OA 4O4RA 1YRUA 2CQCA 2RQMA 2DYAA 2RB7A 3I0RB 1JWWA 2EW9A 3W62A 3MMCA 4MKYA 3TA1A 2BUNA 1HA1A 1MWZA 3MPVA 4F4WA 2Q3PA 4C0OC 3QBCA 4M5GA 2HEKA 4TNOA 4LFCF 2CPJA 1B99A 4QYZJ 1WD6A 4Y00A 1K1QA 1BY9A 3LGHA 2GV1A 2RDDA 1TL7A 1YK9A 2J0QD 4LSLA 3S7RA 3M7VA 3J81U 4TYBA 2AYGA 1KDNA 4A46A 1CJTA 3B54A 4KHRA 2WVFA 2EG1A 1TUGB 1HBOA 3W9IA 2GAHC 2H4WB 1RTJB 2QX0A 2V2KA 3CC2S 3RAXA 3DU5A 4DX7A 1UWBB 1FKOA 4Q43A 4QU7A 2O5DA 4A8FA 3ETOA 2ZDPA 4PWUA 1MN7A 3CCQS 3P45B 4Q5VA 1N6QB 4LSNB 3CWJA 4EU0A 3BBFA 5ETVA 4PG8A 2UV8G 4ZKAA 2DNYA 2FIUA 4JOUA 3UVJA 2QMWA 3JTNA 4K2JA 2FHJD 2NXNA 2WB4A 5IZHA 3CMES 4RR5A 1NHVA 4YUDA 3N5BA 4ZLNA 5DQIA 2YQ0A 4OV6A 2D3ZA 9ATCB 1PSDA 7FD1A 5ETSA 1EKRA 3B8HA 3MM9B 1R27B 4ECWA 4ZVRB 5B0AA 1FEEA 2V4JA 4RL1A 4X4TA 1S4EA 1TU0B 4LBHA 3W1YC 4GVBB 3TEHB 1N56A 3CEDA 1JLFB 1K44A 1T95A 4HLBA 2XC9A 1SV5A 3BGFA 3EICA 2R7QA 3IA0A 2XHCA 4NX9A 4YY3J 4D3HA 1LWEB 1R0BG 3SQGB 4Q0BB 1NBEB 3UE2A 1RAJA 4EO8A 2ZUGA 4AFFA 1FRXA 1N5SA 4MJKA 3E3XA 1OPZA 5FJ4A 2ACMA 3GSIA 4NCGA 3RBDA 3H7HB 3HM9A 1ZA1B 3ZTSA 5ADZA 2ABYA 4ZVUB 4TVAB 3P96A 2UXBJ 2FYXA 4ZVPB 2EBEA 4ECUA 3HHEA 4IO1A 1YIJS 3H5UA 2XNRA 4DPOA 1JJ4A 3QGGA 3KUEA 2EXUA 3L9ZA 2XCAA 4P75A 1VHIA 1NZ8A 1FJ7A 4B3OB 3VV2B 1WORA 3B6BA 2W8KA 1S0NA 2DNOA 3DRSA 3ZZUA 4XAKA 3DLKB 3UN2A 3U7JA 5C24B 2YNHB 3BSAA 3GZ7A 3J7YU 2ZZNA 1DTTB 1X0PA 1NDLA 3V5RA 2J0XA 3OL9A 3PY8A 2B9YA 5I3QA 1CPZA 2ZD1B 2MKSA 2IMWP 3MCNA 4K4UA 1DQAA 3QGHA 4M5MA 4DV1J 4WZMA 2VDIA 3FVYA 2FGOA 3D67A 4JI7J 3GG1A 3C14A 3D7SB 2DO0A 2YNIA 1WWHA 2RDIA 2ZOFA 2E29A 1H38A 5D78A 1WKJA 3VWSA 1HWLA 2C2NA 2OPPB 2NSCA 4DL7A 2VG6B 2RRNA 1PYSB 4TY8B 4OZ0A 4LFAJ 4N5SA 3GIMA 1SQEA 4MFBA 4F67A 3RR8A 3J7ZT 3H5XA 2BOPA 4RWWA 1B64A 1TV6A 3G82B 2WSCC 5AXKA 2M5YA 4JBCA 2FLPA 4OHWA 3LPEA 1NH7A 1HNIB 4Q2LA 2J8SA 1T9WA 4IG3B 3AY0A 3ZXWA 3IR7B 3ET6B 1ZM3A 4G1PA 4LF7J 3BGRB 2D69A 1AW0A 3UD3P 2GHVC 2BW7A 4FF2A 1JLEA 2PMWA 2VICA 4RX6A 2HVZA 1BMQB 2I9SA 2WVEA 5A0YA 3VGTA 2AYEA 3DI6A 2J8AA 1NPKA 3GFXA 3DFEA 3ONQA 4OL8A 4E0DA 3LP0A 2LQ5A 4QWDA 1Q4RA 4X4QA 4ZJQA 2XY5A 1UW4A 3IR6B 2Y1JA 2ADBA 3CDUA 5CAAA 3OVSA 3M8RA 2W4DA 3E01A 1RTDB 2BJ9A 3V6JA 4XDDA 2GW8A 2OJ3A 1Y10A 3DLBA 1T9UA 2MMYA 3DMJB 4PUOA 4X64J 4BCAA 1FX2A 4I2PB 1D3WA 2VPYB 4DPXA 2Y8WA 2EK6A 4QWAA 3HX9A 2Z2YB 1VGYA 4ZIVA 4LSZB 2NREA 4USJC 3QNWB 2AIRB 1FDBA 4DUZJ 2BV3A 3G86A 2HLTA 4RNOA 5IV3A 4DV4J 2I1RA 3SCLE 3FUYA 3KHHA 4OYWA 5J2QA 4B3TF 4L6V3 1IM4A 4Y6IA 4DV5J 1KVJA 3TX8A 1KOOA 5FDLA 4YR2A 3VAKA 2R9LA 3OT9A 1RT7B 2DNRA 4CRJA 2HIQA 1IXKA 3ZO7A 1KVIA 1JLAB 3WHIA 1HI1A 2YQ3A 3A4TA 2P8IA 4XPCA 2DHHA 3OBIA 3L3CA 4PRFA 4Z2XA 1HD1A 4K5SA 2UUTA 4ZJLA 2LU1A 3NWRA 3FMBA 2BKOA 3RU0A 1VRUA 1BQMB 4P2SA 3DLGA 4OYXA 1F3FA 3VZHA 4YHHF 2XGPA 3BKUA 4ZS6A 2GQCA 1X9SA 2L9WA 5D4PA 3KKFA 3ISNC 3CCSS 2MGZA 4PYAA 1VQSA 2E1MC 5EHHA 2LDYA 3R9LA 4X62J 3QRPA 2VA3A 3AT1B 4PG5A 3OL6A 1I6JA 2OPSA 3PX0A 4DF8A 1YZ7A 4QR0A 4F0MA 4FF3A 3FFIB 4JUZA 3G8TA 2WB1D 2VHGA 2CPEA 3THPA 4AQYF 1CVJA 2FZCB 4MK7A 1T03A 2RS8A 2D3OR 1X4GA 1XMBA 2KO1A 4I6YA 2AJ0A 4DL4A 2HNYA 4AYBD 3M2UA 5KFIA 2DR7A 2YWFA 2B6AA 1SC1B 4MKAA 4LF9F 1N33F 1RHUB 2NLWA 1KSPA 4RUAA 1CQNA 3GIKA 1V6HA 2HSEB 4G65A 1S1TB 2LFVA 3W5ZA 2F9JA 2W7AA 4KAIA 4ZP7A 5CZXA 2MQLA 4CLFA 3IWNC 3ZNJ1 2JC0A 2HGMA 3SV3A 1CJUA 2QSWA 4R8UA 4YOEA 1OQ3A 3SDEA 4C7QA 4C6AA 2GMJA 2X3GA 3W60A 1RABB 2LXIA 3K5NA 2Y1LB 3W8PA 1KHVA 3UDEA 1PYOB 2CA9A 2KFNA 4FPRA 3CNQP 4F7VA 3I0SB 3VHQA 3HHDA 1S7IA 1Z2ZA 2G9OA 2DNNA 2J0SD 2EI5A 4R5PA 1S6PB 3AHPA 3I4HX 3EX7B 5THWA 2QL7B 2CZVC 2AZ3A 5LMUJ 1U6ZA 2AT1B 1FK9A 4DX6A 4DMZA 1L3SA 3PRVA 4CNZA 5KG0A 2YXLA 3IAS9 3CXCR 4QW9A 2RILA 3K57A 1N32F 2DRAA 4JI0J 2DGQA 3AD9C 1LWXA 3H8YA 5EX0A 1ZYQA 1CQMA 1NSQA 3QZ8A 1S1UB 2OTJS 2BEFA 1B0VA 1QE1B 4RBVA 4ID5B 2HVHA 1IBKF 5KFVA 4B9MA 4OYIA 1BQNA 4FS1A 2AJ4A 2BW2A 2QYGA 2EFPA 1FERA 2AU0A 2ZJRQ 3QJPA 3MM7A 4ZPTR 5HAOA 2AEMA 4ERDA 2B43A 5EN1A 3BSNA 4PPDA 2DHSA 4IDKB 1RT5A 3NAHA 1S9FA 2V50A 5LSOA 1HBUB 1WDTA 4DQIA 2I38A 1HHTP 2F5GA 1YG0A 2LQJA 1TAQA 5E7OB 5KG7A 1FT8A 1K0TA 4GKJF 3BZQA 2OFHX 4EBDA 2FHMA 2ROGA 2NZCA 3PYFA 3FBCA 3DYAA 3FC9A 3FZ2A 1C2PA 3R27A 5G4DA 5JXSA 5KFGA 4RNFA 1Q86T 1MSWD 4IR1A 4DR7J 4DN9A 2CPFA 4DJBA 3GJSB 1JKHB 1W2IA 3M05A 4S0MA 4BC7A 4M5KA 5LT5A 1NPRA 3PW5A 3KK2A 2NYHA 1FF2A 3K5MA 1B0PA 3QO9B 4IG0A 4WIQA 1FXDA 4JI6F 1IWGA 1HPZA 4ANDA 1FXLA 5C42A 3F56A 4IFVA 1M5KC 2HNZA 2QC3A 2W25A 3KNAA 2VB6A 2DGXA 4C3LA 2VBZA 2E7VA 1VQYA 2HFOA 4ZLJA 1JLCA 3JSYA 4IKAA 1WG1A 4WYWA 4NRUA 4OYPA 5F8JA 1Y11A 2AJQA 3JS9A 4ECTA 2E5JA 1AFIA 4ECVA 4C8LA 3HFZB 3DGPB 2ZH8A 1N48A 2POKA 1B3TA 2BE2A 1S79A 3IC1A 1ZZFA 1EQ0A 5AE2A 4AL6A 5DS7A 1NH8A 3NOGA 3GFZA 3OR1B 2CJ9A 4F4YA 4HDGA 2F3JA 3A1YG 4ECZA 4QYRA 4USVA 1I51B 1BE4A 1WNEA 1EKSA 4N41A 5KG5A 2XLKA 4MYTA 5G0RB 4EFAC 2B56A 5F8NA 4B3RJ 2Z56B 4USKA 2BJ3A 2HHVA 3AA9A 4WKRA 5HQMA 4TU7A 1MN9A 5D0RA 3OSPA 3TP2A 4DF4A 3HKZD 2KJWA 2OIHA 1IBCB 1G7CB 3C6UB 2GMLA 2QLFB 5E5NA 1FA0A 3R97A 2YX1A 5HJYA 5LJ5Y 4CYUA 5KOWA 3VAJA 2VV5A 1HHQA 1FJGJ 1WHWA 2YX4A 2WCXA 2VG7B 2R7RA 3AQPA 1P8GA 3CD5A 1RT2A 2Y1IA 1H6KX 4PZVA 1N36F 3D0GE 2JRSA 4CLPA 2DNLA 2DR8A 1S1VB 2YKAA 4J90A 1DQ9A 1F5AA 3HPOA 2GHPA 4OZLA 3W8GA 2OO4A 4FF4A 3N9UC 3D6FB 3JAMU 3I5AA 4K2XA 2AGPA 3AB4B 1L3KA 1CS4B 2G2OA 4U7UK 5JJBA 2W24A 2G2YA 2OPQA 1Q8LA 4OMFG 3T9NA 3G8QA 3MAAA 5F3ZA 3DRRA 4FYWB 2MLZA 2V2ZA 3A8EA 2B5JB 1NRKA 4FBUA 2PA3A 1X4EA 4PXEA 4OZ3A 3M1VA 2LA6A 4DPWA 3PCOB 1WI8A 1ZAXA 1HI0P 4UUWA 5KFXA 2C2KB 1S1WA 4HI2A 1YRXA 2HPUA 3AOAA 4G1IA 1B4SA 4NEZA 3TUIC 4O44A 1RWOB 3CJ3A 4QPXA 3GMGA 1LK5A 5E3QA 2OHDA 3HD1A 4NOHA 2K3IA 4ICLA 4CO1A 2VIHA 4RW7B 5EDWA 1SH0A 3J80Y 2ZKUA 1T05B 1UZHA 2PMZD 4JI8F 2MZSA 1CJKA 4WE1A 1DRZA 3IN5A 2I8EA 1UCNA 5D15A 2ZEJA 2FY1A 4DZDA 2KH9A 4DDFA 4DQRA 4BWJA 2UUCF 2MZ1A 3OXGA 4NLOA 4WTYA 2FJXA 4LF8F 4OJGA 1F5BA 3MMBB 4LRFA 4CLTA 2CXEA 3CCUS 4KO0B 3JSBA 2VOPA 4EZ6A 3MZIA 4NXMJ 1REGX 3W2WA 3LF0A 3UPFA 5A8WA 2EVZA 4MK8A 5K8PA 2BDPA 2RAQA 1J5EF 4DV7F 1NJIT 3X3UA 2B8PA 2H54B 2OAUA 2WRMA 4EYIB 3M8SA 1CC7A 2X1AA 1VFJA 2CWKA 4DX8H 3R5JB 1UVMA 2VC0A 2IFXA 3IS9B 4FVCA 1IR2A 1S7HA 5BYRA 3S6EA 1FJEB 4L76A 4G6VB 4RKUC 2DPJA 4KHPJ 2HS4A 3MMCB 3OL7A 3K58A 4Y65A 5H9EJ 2ZNZA 3R5GA 1QTNB 4Z7CA 2DNKA 1QSSA 3K5OA 2O3DA 3CD6S 5I3UA 3V2UC 2CVIA 3GFYA 1YSJA 2N3LA 1TL7B 3NCRA 2QZ8A 5CQGA 1J27A 4LSLB 2UU9F 4N76A 4A8YA 5HL7Q 3SFUA 2CQ1A 2EFVA 1CJVA 1CJTB 4ZP6A 1JNRB 2A6MA 1T3NA 1YJRA 4JI4J 4OX9F 4L75A 2VC1A 1HBOB 3MHYA 1N88A 4NA2A 1TFWA 1U24A 4X65J 3IXQA 4P2MA 1QSYA 4A8MP 2V63A 1TUWA 1RYSA 1XN9A 1NCLA 3MCMA 4I4BA 4CZCA 3W3SA 1UFWA 1FKOB 2IPOB 1N5YB 5J1NA 2V68A 2G2ZA 3LPYA 4CLWA 3TQ1A 2HQFA 1VBXA 4QIFA 5LSLA 3F0NA 1WF0A 1VQNS 3P5BP 1A9NB 1F9EB 2CNNB 3CPWR 4WFYA 1RTIA 4JI1J 4WK3A 2D9PA 2YWHA 2CJYB 4DFKA 1S49A 5H9FK 1VC5A 3MPYA 5EX3A 3BQ1A 5A8RA 2CADA 3UVJB 2RHQB 3BYPA 1WKKA 1B70B 3KFWX 7AT1B 4DL2A 1FE0A 2L3MA 2PI5A 3CJTA 4CLYA 1JJ2R 1VK8A 4M5HA 2WONB 2LECA 1X5OA 4RLEA 3KLHA 2R8KA 4B9TA 4A8QA 4V19J 4DU8A 3ZZZA 1OY6A 2M70A 2OFGX 2DITA 2ACYA 3HT3A 3ULHA 4X66F 3QIPA 2XMJA 4DLGA 1S0MA 3AJ1A 3S8SA 1FJCA 4K5RA 2ILZA 4ED8A 3MD3A 4ZPVR 2E1AA 3MTJA 6FD1A 1SV5B 3NAIA 2RSQA 4CLKA 2XB2D 1UJ6A 1BQXA 3QYYA 3GFHA 4G1QA 4I67A 1BGXT 2AP6A 4OJ1A 1LXNA 4LF4F 2R7WA 3V6HA 3GJRB 4PCQA 2CUYA 3FEXB 1O8BA 3GV5B 3GP9A 3IP0A 4NCGB 1GH8A 1RYRA 3J81Y 3FK4A 1DLOA 2QA1A 4MT1A 1IWAA 4L3NA 2ZKTA 2XWYA 2DHXA 4WTOB 1FWLA 5JVHQ 1VISA 2QN6B 4MK9A 2KU7A 3R5BA 1VQ8S 1ROFA 4YB5A 3CCTA 3DRSB 3MUTP 1TKTA 1S9GA 3RGIA 1RT6B 4HH1A 2XWXA 4B9LA 3W5YA 2H5JB 3I5CA 5KG2A 5KFKA 1M90T 4DPUA 1OJ4A 4ITSA 4OI2A 3ITHA 3W9HA 5L46A 1S6QA 2CZ9A 5KG4A 3CT9A 3VGVA 1GK8A 3C14B 4DR5F 2YNIB 3R5CA 1HWUA 3WC2A 5DG8A 3OUYA 2R7TA 1NJYA 3O1LA 4F4XA 2XMUA 4F4KA 1Q53A 1NHKL 3QAEA 5C2GA 3TNVA 2ZUAA 2MZJA 5LJ3Y 2VBWA 1L3UA 1XERA 2YNGA 1KS2A 5AE1A 1CEZA 1RTHA 2VQFJ 4MFBB 4O0IA 3BEGB 2ZVIA 1TV6B 1TELA 1VRTA 1OWXA 3HSJA 4PWDA 4DSEA 1QAJA 5KFAA 4USMA 1OSDA 4M63A 2DEIA 2YWKA 2JZ5A 3MEGA 4UQTA 1W2BR 2EPIA 4LFBF 2QO3A 3G2XA 3HJFA 3UN3A 4ZA1A 5J2MA 1QAXA 2M0GB 5B0FA 5BR8J 3HSDA 3KG0A 1UAWA 2GO8A 1OY8A 5F0UA 3TO8A 1JLEB 2WOMA 5D0GA 3SZ2A 3M6UA 5A0YB 3TR5A 1Y5NB 3DI6B 2R7UA 3KLEA 4K4WA 5L1IA 1HQEA 4E98A 1XBWA 2H5IB 3KK3A 3LP0B 3ZZRA 1XEZA 2YWEA 3WX8A 2J6UA 2CNOB 2J6TA 4ELUA 4LJMA 2DCLA 3MUVP 1HR0F 2NPIA 1RHMB 3ZTRA 4LIRA 1WOSA 5EWGA 3NBPA 3SEOA 3EVWA 4ZLPA 1ZH5A 2YY3A 3SQOP 3E01B 3KHRA 1BWEA 3FSXA
chains in the Genus database with same CATH topology
1TKZA 3RYLA 3O5TB 2OD6A 3VR1A 2WB4A 1HMVA 2I2YA 1X4CA 2MY7A 4LF7F 5IZHA 1KLNA 1Q79A 1YJUA 3CMES 3U02A 2KM8B 2QLWA 4ZCKA 1V3RA 4XO0A 3PW7A 1NHVA 3JB9k 4YUDA 3N5BA 3FNNA 2CQ0A 3Q2SC 5L38A 3TAMB 3BDEA 3POTA 5E33A 1X5SA 4PUOB 5DQIA 5FD1A 3N79A 3BR8A 1HI8A 4KR0B 5KFPA 2D3ZA 2ZE2B 1KQFB 1XNQF 1PSDA 1D0EA 3U1MA 1QVGR 7FD1A 4DSJA 4QR1A 1X8DA 1FRKA 1S99A 3B8HA 3MM9B 1R27B 3PIOQ 4ECWA 5B0AA 4YB1P 1FEEA 4I56A 2V4JA 5KT5A 1UVJA 1QY7A 3CE8A 1LOUA 1ZAVA 4R25A 4OI1A 5DQGA 1GT8A 2RE1A 5GAHU 4X4TA 2AD9A 4UQGA 3PEHA 2BM0A 3VAMA 2PD1A 4OIXA 1N34F 2VBYA 4TLRA 1HBNB 1HD0A 2OTLS 2XY7A 1N56A 2HAIA 2DNMA 2VPZB 3Q2TC 2HHXA 1C1BB 4W92B 3CEDA 4O3PA 1JLFB 4YMEA 1TAUA 1T95A 2K3KA 1KLMB 4DV6F 4JI3F 1KD1T 4EBEA 2VKZG 4I6AA 2ZHOA 4HLBA 5KFOA 2XC9A 3NS5A 1I94F 1SV5A 5DJBA 5J1EA 2DCUB 2NZ4A 3BGFA 2R7QA 4A8XA 3IA0A 4JYAF 2D1CA 4RNNA 2XNQA 5IQQA 2DVIA 4NX9A 5J2QB 2VZ9A 1ZTWA 2BYCA 2O66A 3N0VA 4OI4A 4D3HA 5EWFA 2E7WA 4B3SF 3HMJG 3W2VA 5B7WA 1XNRF 5D3GA 3TAQA 5FDLB 1LWEB 1VBZA 3SQGB 2YKPA 4M8LA 4I6WA 4Q0BB 4NPOA 3UE2A 3BJYA 1F2GA 1V3ZA 1RAJA 4LUBA 1RWUA 3QAUA 2HMIA 3N6MA 4EO8A 2ZUGA 4AFFA 1FRXA 1TFYA 1N5SA 2AV5A 4MJKA 2JJ4D 1GX6A 3NCPA 3E3XA 4ES3A 5GAEI 1OPZA 3JTPA 1PILA 3FCHA 5FJ4A 2B4VA 5K14A 2XLJA 4DFJA 5F9NA 2B3TB 5AXLA 3RBDA 2GQQA 4NCGA 3HM9A 4LIWA 2E66A 1YVFA 5SZTA 5ADZA 4C8OA 2ABYA 2BANB 2HLUA 4I64A 1MNEA 3DN9A 4CO2A 3IRWP 3THVA 3SSQA 3P96A 3NWGA 2DGWA 4I7FA 4RW8B 1VRUB 2M4MA 2EBEA 4DV3F 4ECUA 3N01A 3HHEA 4IO1A 4C98A 3FDSA 3BN7A 3DLGB 4NA3A 1YIJS 3H5UA 4IUFA 2XNRA 4DPOA 1JJ4A 1TQLA 3QGGA 1EETA 2IHR1 1JNZB 4ZMMA 2XCAA 1HYSA 3K8WA 1WACA 3P3DA 1FNMA 1X9WA 3KHGA 1FJ7A 4B3OB 2UUAF 5CYQB 3LWMA 4DUZF 2JOQA 2W8KA 2FHOB 1S0NA 2L48A 1HNVA 2M3DA 2DNOA 3DRSA 1C1CA 1V3SA 3ZZUA 4KHMA 3EGNA 4PXCA 4XAKA 2IA6A 3DLKB 1LFWA 2MGZB 3QGPA 5MAOA 2VBXA 3U7JA 3MEEB 5C24B 3M9NB 2GGPA 3I31A 4OX6A 3KTQA 2YNHB 3BSAA 3GZ7A 1P9QC 2FPHX 3J7YU 4NLDA 2MKHA 2ZZNA 1P27B 2XI2A 3MEDB 1H7XA 1TUVA 1N4LA 1DTTB 1X0PA 4P6QA 3BGUA 2AGOA 1RT3B 3V5RA 2KKHA 1ULRA 2J0XA 2OPSB 4ZPAA 5F3TA 4CT9A 3CTRA 2KVIA 3OL9A 3PY8A 2E5LF 5L39A 2B9YA 4DBQA 5I3QA 1CPZA 3D5MA 2ZD1B 5U47A 1F0XA 2JSXA 2FHJA 3IG1B 2C22A 2MKSA 4ECXA 2IMWP 3E51A 4KKOB 5D77A 1DQAA 4AE5A 4K4UA 3QGHA 5J2NA 2GQ2A 2IRUA 3M2VA 3CJKA 3PKMA 2C3YA 4WZMA 1T03B 3FVYA 2FGOA 3QWPA 3KK1A 4CNYA 3CCJS 1H98A 3RB4A 4YB6A 3OR2A 3H4BA 3GG1A 1Q8IA 3ISND 4F4ZA 2DGOA 3DOLA 2DO0A 2YNIA 2MY8A 3M1VB 3PACA 3PJXA 3KLGA 2JLGA 1WWHA 3MFIA 3HHKA 3K5LA 4A8OA 2YKNB 3PZPA 2RDIA 2ZOFA 2E29A 1H38A 4ILRA 3H25A 4ATNA 1IKXA 2P5VA 4C8YA 1ZM9A 2HNYB 3HZEA 3M2UB 5T7LB 1UKUA 2IMOA 3MM8B 1HNXF 3MAQA 2CPDA 2B6AB 2M7SA 2WW8A 5D78A 2A3JA 2E9TA 4J9SA 3RB3A 2X1BA 1SIWB 2LLZA 3V6DB 2XMMA 3VWSA 3I0RA 1H2VZ 1CC8A 5H9FJ 1HWLA 2V8GA 2OPPB 4ES2A 4GO7X 5EWEA 2ROPA 1VQPS 3ENVA 4DLEA 3CD0A 2NSCA 4DL7A 4Y2KA 2MHEA 2V8VA 2VG6B 1VI7A 2RRNA 3SV4A 3SCJE 1R7IA 5LSRA 5AJ3F 4A4JA 5BR8F 3BN4A 4TY8B 4OZ0A 4N5SA 3GIMA 4H4MB 1SQEA 1SKWA 4MFBA 3EGWB 1NNDA 2Q79A 2VONA 3DRPB 4ECRA 4F67A 4USIA 2ASYA 5GAGI 2R2UA 3J7ZT 2HHHF 3RR8A 2BOPA 3H5XA 3V81A 2NQPA 1ZZNA 4RWWA 1B64A 3NCQA 2KYXA 3T19A 1TV6A 2D74B 2RU9A 4X62F 3RB0A 1R8BA 5HP1B 3EZUA 2WSCC 2F40A 4M94A 1MMNA 3BB5A 5AXKA 4PPZA 4JV2A 2M5YA 2MJUA 4JBCA 2E5IA 3SSSA 2FLPA 2DH9A 3BM7A 3MM6A 1TL3A 3MF5A 4IYQA 1K0VA 4B9VA 4DV0F 4NXNF 4OHWA 2RKIA 1NH7A 2QA2A 1HNIB 5DDOC 4R8UB 2CIMA 1WEXA 4MYUA 4Q2LA 2XGQA 4DL3A 3NG8A 2G4BA 4IG3B 3SDEB 1WF1A 4ZPCA 1SJFA 3AY0A 4ED1A 2KDOA 3IR7B 1ZM3A 2IAJB 2CDQA 2HFNA 3ZZ0A 2GX8A 4G1PA 1X9MA 1LV5A 4NLPA 4F3QA 3N4WA 1H0HB 3GR0A 2DISA 5DG9A 2W9BB 3LANA 2XSJB 1M1KT 2HQIA 3PM9A 1FDAA 3BGRB 4K4XA 1AW0A 3HXMA 3UD3P 3OXFA 3VALA 4C8MA 1HQUB 1U6FA 2GHVC 1RTJA 4CI0B 5LXYA 4FF2A 4RUCA 1JLEA 2ZJPQ 1SL0A 4RX6A 3SCKE 2HVZA 2K2PA 1TVRB 3IFEA 1GAOA 2DHAA 2BRLA 2G1DA 1YBAA 5EUHA 2AW0A 4I68A 2N4DA 2I9SA 2ZITA 3M8QB 4KJIA 2W8LA 3QWUA 1UWBA 4C2MA 5A0YA 4K4TA 2AYEA 3DI6A 6FDRA 7FDRA 2SXLA 2J8AA 4R5PB 3MFHA 3PW5A 3MCSA 1XMOF 3O44A 1NAQA 3GFXA 1EP4B 3DFEA 4O4GB 4AL7A 2CFXA 3H2VE 3M4XA 1S48A 3ONQA 4N77A 1UEVA 1UVLA 2CVEA 3VF0B 4OL8A 3THTA 1N6QA 3UCGA 3ZZOA 4E0DA 1OQ6A 3LP0A 4LSNA 3OTCA 4Y2AA 2LQ5A 4QWDA 1FKAF 1Q4RA 4WU2A 2R8IA 2LXFA 4X4QA 3I55S 1FK9B 1VJWA 2P6SA 2XY5A 2Z2MA 3U1LA 5DG7A 1VQ7S 4WKYA 1UW4A 4O3RA 2DB1A 3IR6B 2Y1JA 2ADBA 3CDUA 4ED2A 1SL2A 3HVWA 2LEAA 3UQSA 2FD2A 1K8AT 1E6VA 1N5VA 3KOAA 3SSRA 3NLCA 4MAKA 2RT3A 3JTOA 3M8PB 3OVSA 3M8RA 4QWCA 2W4DA 1JJHA 1JB0C 1JLBB 4IOBA 4HH0A 4M5DA 2IVFB 3U1NA 2MXYA 1QAIA 5KFHA 4L72B 2KFZA 2UVWA 3E01A 5I42A 3L09A 1RTDB 3O8WA 2HVIA 3V6JA 1T05A 3OFFA 4XDDA 1RDRA 2RDJA 2GW8A 2HHQA 5B0GA 2IM0A 4OQJA 2OJ3A 3MAHA 3MMAB 1RP5A 1U6BA 4OLOA 4B3MF 1S77D 3DLBA 1S1XB 1WG5A 3OLBA 2MMYA 3DMJB 3TAMA 3SFGA 2C2DA 4PUOA 4IRCA 1C0UB 5DGBA 5E0OA 1Y5IB 1YI2S 3DDNA 1U1MA 4K50A 2ZE2A 2BXJA 4BCAA 2ZJQQ 4YY3F 1U1KA 2IBKA 4I2PB 5D8HB 3PVXA 4W90B 3OLAA 1D3WA 3MM9A 3VCDA 3GV7B 2VPYB 2W4PA 1ZPVA 2EK6A 2JH3A 1BQNB 3GILA 1NKBA 4QWAA 3HX9A 1JLQB 3QLHB 1VGYA 3DNCA 2RU3A 3H98A 3UD4P 3HZGA 2ZOMA 3VAFA 1S76D 3ZC4A 5FLXY 4F2SA 2NREA 2M8DB 3K2YA 4FP9A 1HBNA 5LMUF 4USJC 1QJHA 1ZOTA 2DBBA 2VA2A 1C1BA 4TYAA 1JLFA 1FDBA 2E5HA 3IWXA 1KLMA 2ZH5A 2BV3A 3MM7B 2RNEA 2FJAB 1H3DA 3G86A 4C8ZA 2HLTA 4RNOA 5KAKA 2I1RA 1V9OA 1R3NA 4LMZA 1G3OA 2BZ2A 3CJ5A 4ZP8A 3PFEA 4IR9A 3SCLE 1NU4A 3KHHA 3T5HA 4FXDA 4A8KA 5GADU 2UXBF 1RT5B 3KG4A 4U6PA 5J2QA 1ELOA 5GADI 4B3TF 2ATLA 4L6V3 2AJ1A 1OS5A 1IM4A 3G4SS 4Y6IA 2DH8A 3UNGC 3B4DA 1Z2LA 3TX8A 1KOOA 1KVJA 3O2IA 2YX7A 5FDLA 1LWEA 3K8VA 3VQTA 5DETA 5I4MA 1U47A 2KHDA 4YR2A 3VAKA 3SQGA 4ALZA 2R9LA 1RT7B 3GE9A 5F41A 2MKJA 4ZPWR 3OVBA 4Q0BA 2IBOA 2DNRA 2XS5A 2HIQA 1IXKA 3BSOA 3T5LA 1DZ5A 2E9ZA 3UCZP 1KVIA 1JLAB 5H1SV 2APOA 3OTBA 3G96A 1J2VA 2ZH3A 1HI1A 2YQ3A 4Y2CA 2LYVA 2R7XA 2JLEA 4XPCA 1VQOS 5GVQA 3OBIA 3GSDA 3L3CA 4PRFA 4Z2XA 2DGSA 1HD1A 4K5SA 2UUTA 4LVOP 3D1HA 2VL1A 4MTPA 2BANA 4IO9Q 4RBUA 2LU1A 4ZVEA 3FMBA 4HL9A 3DYAB 2R8HA 5KFEA 2CKWA 3DM2B 2DD8S 3RU0A 4RW8A 1VRUA 3ZZPA 1BQMB 1UFLA 1HWJA 1C4CA 2J0WA 4Y0FA 1KC8T 2FLNA 4P2SA 1TKXB 4GKKF 3CCRS 3M6WA 2CQ4A 3DLGA 2B51A 1BC6A 4N56A 5AE3A 3BS9A 5KOXA 2KXFA 2VG5B 1YTYA 1Q16B 3VZHA 4GC6A 2V9KA 4FZVA 1Y00A 1LW2B 2CZ4A 4YHHF 1VC0A 2XGPA 1K1SA 1B0TA 2CJAA 1JX4A 2KM8C 4ZS6A 1GXLA 5KFTA 2GQCA 4B3OA 4NLRA 1X9SA 2RVJA 3KWMA 2L9WA 2CG4A 2WAQD 3KKFA 5D4PA 3TYTA 5KFYA 4DV1F 1U1LA 3NS6A 4OHXA 1IKWB 1U49A 3CJ0A 3ISNC 1LK7A 2J9DE 3DLKA 3CCSS 4JI7F 4NLXA 3KK2B 3NMRA 3ISZA 2LVWA 2MGZA 4NCBA 4X4RA 3MEEA 5C24A 4CTAB 3K59A 1KOHA 1VQSA 2B4UA 3LP1B 2E1MC 5EHHA 2LDYA 2YNHA 3LAMA 4IG0B 2MQOA 2FDNA 2J5AA 3QPIA 4QR2A 2VA3A 4PG5A 2FJDB 3MEDA 1DTTA 3KMQA 3OL6A 1I6JA 3AJ2A 1AXQA 1PC4A 1RT3A 2OPSA 1ZBTA 3PX0A 2HS0A 4DF8A 3NNAA 1HPZB 1MWYA 3OHAA 2C3PA 1N5YA 3Q22A 2EKYA 4EO6A 2ZD1A 1N0VC 4QR0A 4FF3A 3C8YA 1YJVA 3FFIB 3BR9A 2I5JB 4JUZA 3G8TA 3IG1A 1MU2B 2WB1D 2JX2A 1C0TB 4QIEA 2C42A 3TVYA 1QSLA 1FNOA 2CPEA 4KKOA 3THPA 5C42B 3CCVS 4AQYF 1FVQA 1CVJA 3W7BA 4IFVB 1B7FA 4MK7A 1FD8A 2DIUA 2FJVA 2HNZB 1T03A 2RS8A 4RNHA 3UDLA 2D3OR 2XY6A 1YRTA 3HF5A 5C5JA 1Q7YT 1X4GA 1XMBA 2XBPA 3CO9A 4YEAA 3OJSA 2KO1A 4I6YA 2AJ0A 1JLCB 1IJEB 5MLCV 4RNMA 2YKNA 3RR7A 4NLTA 1RT1B 4DL4A 2AQ4A 3G8SA 2KB2A 5CYMB 2HNYA 4AYBD 3M2UA 4FNHA 5T7LA 5KFIA 2BQRA 1D9AA 1U8SA 2DR7A 4ZDNA 2EC0A 2YWFA 2B6AA 4DR7F 3N28A 2R4FA 4MKAA 4LF9F 1R8CA 3UWTA 4KQZA 1N33F 4PG7A 3C3LA 2NLWA 1U2FA 3V6DA 2CQGA 1KONA 4CT8A 1KSPA 2OPPA 2OKQA 4WCEQ 4RUAA 4UY8T 2HYIB 3Q24A 2RH3A 3UDCA 2A2DA 3DLEB 3GV8B 1CQNA 1X7VA 4TY8A 2BE2B 5M2RA 3GIKA 1V6HA 4H4MA 3KMSA 3C66A 2EG2A 5EGYA 1S1TB 3HDSA 5K5MA 2PA8D 3DRPA 2F9JA 3MTKA 2DRBA 5D6GA 2FJEB 2W7AA 3IBWA 3IAM9 2WONA 4YB7A 4KAIA 5FIIA 3MM5B 1SH2A 2J6SA 4ZP7A 1NK7A 5HP1A 5CZXA 2MQLA 1NK4A 1Q8BA 3C6TB 3K7RA 4F25A 2W4CA 2ZBIA 2XMWA 3IWNC 1BD6A 1P1TA 1S6OA 2RQKA 2BQ3A 1UP1A 2JC0A 1VK3A 2ZM6F 2HGMA 3VAHA 3SV3A 1U45A 2UV8A 1LWCB 2QSWA 4F02A 4DSFA 1HNIA 4R8UA 5J2PB 5GAHI 2ZH7A 4YOEA 1VIOA 4DN0A 2KT2A 1OQ3A 4IG3A 3SDEA 3BO4A 4C7QA 4QPTA 5KFSA 4KGKA 2PGCA 2GMJA 5F8LA 2RD5C 2IAJA 2X3GA 2Q1LA 2WK4A 1G1XA 4N47A 3OW2R 4IRDA 3JYTB 2LXIA 4TQSA 3K5NA 1TK5A 5CA5A 2L9DA 3B78A 2W9BA 5B0EA 1J5OA 2XSJA 3CIZA 3MOJB 1VS3A 2NUUG 2HHPA 4NLVA 2K7KA 1Y0HA 2MQMA 3OXLA 3BGRA 4DV2F 3H20A 1KHVA 4X4SA 2KFNA 4FPRA 4Q45A 5DDPC 2RIJA 1HQUA 2J9EA 3I0SB 1N5TA 2KG0A 2XSFA 3MR3A 3MGJA 3HHLD 1WELA 2O1PA 1XR6A 4U7CA 2PC6A 1JLGB 1TVRA 4RW4B 3D0IE 1M5SA 3M2RB 3HHDA 1DARA 2R7VA 1OPIA 1X4HA 2F1FA 3D54A 1LFPA 1Z2ZA 4R0JA 3Q8SB 3M8QA 5KFCA 2UZAA 2IRYA 1YGYA 2G9OA 2DNNA 2B0GA 2J0SD 3AB2B 2COLA 2EI5A 4R5PA 3PO4A 1S6PB 4ZCIA 3AHPA 2OMOA 4RUHA 3OJUA 3MD1A 3I4HX 3DRXA 1S10A 1EP4A 4O4GA 3EX7B 4DQPA 5THWA 3ZZTA 3IWLA 2CZVC 2NSBA 4IH7A 4RW9B 1TK8A 2D41A 2C2EA 2BQUA 4HTIA 1RT4B 2GA7A 4MIWA 1DJ0A 1U6ZA