2JDJA

Crystal structure of hapk from hahella chejuensis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
105
structure length
105
Chain Sequence
METIIHKIRLFDVAQADAFEFWVQNVDYATCPDLPSVVRFDVHRASLQANAPYHYVEVIKITDRAAFDADMETSTFAGLVQAFSRMAEVVEELAGEQLGSGYAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords REDY-LIKE PROTEIN
publication title Structural Insight of the Role of the Hahella Chejuensis Hapk Protein in Prodigiosin Biosynthesis.
pubmed doi rcsb
source organism Hahella chejuensis
total genus 21
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11639 HapK REDY-like protein HapK
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2jdjA00
1Y0HA 2LDIA 4U9RA 5B0DA 3IWXA 4YEAA 4Y2IA 2KKHA 2OP5A 3IWLA 3HHLB 3KKFA 1KVJA 2KT3A 2CRLA 2LQ9A 2JDJA 2EW9A 1W2IA 4EFAC 2FB0A 2GGPA 1TR0A 1S6UA 1X8DA 1KVIA 1RJJA 3VTIA 2GA7A 2K7JA 3BR8A 2GCFA 2OAUA 3I9ZA 4OJ1A 1YG0A 1FE4A 4HI2A 1S6OA 2QLWA 3FMBA 3TRGA 3HF5A 2W4CA 1IUJA 4FNIA 3BB5A 3T9NA 2AW0A 5B0CA 1GXTA 1AFJA 2AP6A 2HLUA 2ROGA 5T7LB 1CPZA 3MCSA 2QYCA 2RILA 5B0BA 2ACYA 1FVQA 2G9OA 1X0PA 2AJ0A 1MWYA 2XMVA 2VV5A 1YRXA 4A47A 3QGPA 1Q53A 4OIXA 2N4DA 2HFNA 2KYZA 4HH1A 1AFIA 4OJGA 4F67A 3K7RA 3E8OA 1URRA 3BGUA 1OQ3A 1TUVA 5F0UA 2IYIA 2HIQA 1YJTA 1X7VA 2N4CA 2K7KA 2ZDPA 1Y3JA 1AW0A 2GO8A 2GV1A 2OFHX 1QUPA 3HHLA 4ZA1A 2RU9A 5B08A 5KAKA 3LGMA 2VH7A 5B09A 1Q4RA 1FESA 1XBWA 2XMKA 3LO3A 1KQKA 1TZ0A 3QMQA 3TOQA 2OD6A 3BM7A 4A46A 3KNGA 2W4PA 2XMMA 1GXUA 1SB6A 4HL9A 3FGVA 1Y3KA 3HX9A 3DCAA 2FTRA 1CC8A 1P6TA 1R6YA 2N7YA 5B0EA 4HH0A 2K1RA 2LXFA 3BN7A 1WD6A 2XMJA 2RSQA 5T7LA 3FRYA 5B0GA 1U7LA 4NPOA 2OFGX 4Y2KA 1SQEA 2IYGA 1OPZA 2QLXA 2QIFA 2W4DA 1MWZA 3HHLC 1YJVA 3KG0A 2BBEA 1N5QA 4DPOA 3CJKB 1OQ6A 1FE0A 1ULRA 1V3ZA 2PGCA 2HQIA 2HLTA 2XMTA 4HI1A 1LQ9A 3HHLD 2BJDA 1Q8LA 1OSDA 3HDSA 4NL5A 4Q2LA 2ASYA 3MZIA 3KG1A 3HFKA 1N5TA 1YJUA 4ZOSA 5B0FA 2PD1A 1N5SA 2GGPB 2KT2A 2AJ1A 2GFFA 3F44A 1FEEA 1N5VA 2ROEA 4A4JA 4Q2MA 3BF4A 3TNVA 4OJ3A 1Q8BA 2OD4A 1TL4A 2ZDOA 1Y9OA 1FD8A 5IXUA 2L3MA 4OJHA 5K9FA 2BUNA 1FVSA 4Y2MA 1VQYA 4YDXA 2HFOA 4DL0C 1CC7A 1JK9B 1VQSA 4QOTA 2XMUA 2XMWA 5A6PA 5B0AA 3WDOA 2BJEA 2LQBA 3BDEA 2BYCA 2RMLA 2IFXA 1TL5A 1K0VA 2K1RB 2Q3PA 2OMOA 4FNHA 1APSA 3CJKA 3DXSX 2FHMA 2FIUA 2OKQA 4A48A 1SI9A 3LGNA 4DN9A 2K2PA 3UDCA 3GZ7A 5A6WA 1JWWA 1P8GA 2ROPA 1YJRA 5F0WA
chains in the Genus database with same CATH superfamily
4LBHA 2FHJA 5AE1A 2VOPA 3BS9A 3QFWA 5M2RA 2CQ2A 3AJ1A 1R8BA 4KV8A 5GAHI 3NNAA 2ZH3A 4KY3A 2KDOA 4R5PB 3PVXA 4H4KA 2ZFHA 4WP9A 1U09A 1WHVA 3J7YI 3R2CJ 2ZH5A 2OH2A 1W25A 5IWAF 2F4VF 3LGHA 3HKZD 5CAAA 2FHOB 4MFBA 4I0WA 3QFHA 3JAMU 2GS8A 2FJBB 3FRZA 3F41A 2EFOA 3FBBA 2DNYA 1HMVB 3FRYA 5K5MA 3CCZA 2QC3A 1Q16B 1I94J 3SBMA 1QAIA 5HMZA 3I0SB 1FDNA 3F44A 4J9KA 2ZBQA 5J1NA 2PEBA 3DLKB 4UY85 2O01C 4ZP6A 2HSEB 2IPOB 1MG7A 3ZXWA 3AXKA 5KT3A 3KKFA 2VIHA 4O4GA 2UUTA 2H48B 1RI7A 1FFGB 1LOUA 4ZP8A 5HQ8A 2G1DA 4PYAA 1KKHA 2EFGA 4DV6J 3CIZA 4QQBA 1SL1A 2UUBF 2B8PA 1AFJA 5I3PA 2XMVA 3J81Y 4DL7A 1AFIA 5ETKA 1O51A 2BOPA 2XHWA 3D6FB 2EC2A 3JYTA 4QIWD 3HHLA 1VHIA 5KT2A 3K5OA 4BS2A 4PG4A 3CCMS 5KG2A 4ENOA 4C0OC 3UI3A 4K4ZA 4NLUA 4J9LA 3S6EA 3D9BA 3MECA 4ZLLA 1ROFA 2CPZA 4NYOA 2OPQB 4GO5X 4MIBA 4F25A 5C7PA 3HVTB 2COLA 2DR5A 4QWDA 1K8AT 3QAEA 4RNFA 2XGPA 2IMOA 1NPRA 3M9NB 3G2XA 4ILRA 2C2NA 4MH8A 4B9UA 3W7BA 2VQFJ 1MWQA 2BACA 3PYDA 2UXDF 2CPIA 3Q8PB 4ED3A 4J9UE 2R9LA 2V9KA 3OR2A 1RLDA 3CEDA 1MU2A 1K47A 5E3CA 2CNNB 3CW2C 3ILJA 2C3YA 3TVKA 2QA4S 1IKWA 1SJRA 1N56A 2W25A 5EX0A 2WOMB 2RQMA 3OV7A 1EJ7L 2J7KA 1PG5B 1SIZA 3SDEB 1HQ2A 3ISND 2ZD1B 1XN9A 2FDNA 2M7SA 2ZBIA 4CWBA 2CPXA 2DNNA 2Z2YB 3D68A 4J91A 2HWTA 4DR4J 4CLPA 5DG8A 4M1KA 2WHOA 5IXUA 4OJHA 1F0XA 2V5HG 3EVOA 1MMLA 4LF2A 4P10A 2W7OA 3F56A 3QRPA 2HNZB 2RQKA 1QLNA 1HBMA 2QZ8A 3HHNB 2KKHA 3TA0A 2JDJA 1FRIA 3DNCA 3JTPA 4K4WA 4KHPF 1TU0B 3TRGA 2W4CA 2KTQA 4PPDA 2DIUA 1RACB 2CJBA 1ZZFA 1PGZA 3PJWA 2VBWA 2Z58B 2HHWA 3TYTA 2LU2A 2LQJA 2GV1A 3QLHA 1M1GA 5K8NA 3UPFA 5KG7A 1BXNA 2B4VA 3MAHA 2KRBA 1BE4A 1N33J 1NK6A 4PR6A 1RHQB 1N36J 1Q79A 2MMYA 3BZQA 3NS7B 1UVJA 1PILA 1LQ9A 3MM6A 3QYYA 3RGIA 1RA7A 2ZE2A 4IQXA 3JTOA 1VS3A 4KV8B 4Y2MA 1ZS6A 2JFKA 2PE8A 5D4NA 5GAGU 1X5TA 4UTGA 2YWKA 2BM0A 1GMWD 4USJC 1VC5A 1CEZA 3HZEA 1Y0HA 4FF2A 4YB7A 1WOOA 1K44A 1X8DA 4JI7F 4MFBB 4Y2CA 4NZ6A 4JYAF 1ZAVA 1N8RT 1YJWS 4QWBA 3O8WA 3UD4P 4HVZA 4DQIA 2GHWA 1XNRJ 2CWXA 3BPSP 4M5NA 2EFPA 4CI0B 3R5JB 3CJ0A 1NH7A 1VQMS 2DR6A 3DCAA 1X9MA 2H9ZA 4FF4A 2RT3A 2WONA 2J8AA 3EX7B 1HHSA 1SQFA 4N7TA 7FDRA 2M2BA 4O4GB 4MKAA 3M05A 3CD6S 2RVJA 4IFVA 1YSJA 4K2JA 2A1BA 2BUNA 3R5AA 1KN6A 4CTAA 1RE1B 2IIHA 2ASLA 2CZ9A 1LNQA 2YPZA 2CQ0A 1DURA 2UU9J 4RW7A 3JYTB 3HHLB 4EFAC 1FXLA 2JOQA 1R27B 2HGNA 1I1GA 1DTQA 3NGRA 1G3OA 4AXIA 1UW4A 1REGX 4PG8A 2AGQA 1FXRA 2ZH2A 4RNMA 2EFNA 2P5VA 5LXRA 4G6VB 1YRTA 3WBZA 4F0HA 4KGMA 3MECB 4OHYA 4J37A 4O0IA 2Z4PA 1HWJA 3HFZB 3RRHA 5KAKA 5BYRA 4OX9J 4WK3A 2B4PA 1IKXB 4Y65A 2IA0A 2WVBA 2HBRB 1KFSA 1XMOJ 3KDOA 2DRAA 3CCWA 1I94F 1SL2A 1S99A 3CUNA 1JJHA 1AYEA 3OR1A 2XMTA 2CNLB 2ROEA 2IRUA 4WFNQ 4KRWA 2QL7B 1AROP 2R2UA 1WKJA 3OR2B 2WRMA 2EBEA 4OLOA 1HPZB 2R7QA 1MU2B 2J0XA 1R8PA 4DV6F 1IKWB 3Q22A 5KFZA 3R97A 2XS2A 3ILIA 4B9VA 4FBTA 4PPZA 5E41A 3OQ2A 2AW0A 3FZBA 2ACYA 5KFEA 1ZM4A 3RBXA 2XNQA 4HH1A 3ONQA 4OJGA 3EDRB 2HFUA 5F8IA 2WVDA 2ZDPA 2Q43A 1M5KC 5F41A 1QUPA 1RHRB 1IM4A 2HVEA 3LO3A 3RBZA 2F40A 3SQOP 4F3QA 1RTHA 5J2MA 1K9MT 4Q8FA 4HTIA 4EI2A 1T9WA 2BANA 2AV5A 1U02A 3GJSB 4ES2A 2MJNA 1HBMB 1U8WA 1OY6A 3GJQB 5DQGA 4MK9A 1F5BA 4NLDA 4DUYJ 1K0VA 4X4VA 2VQFF 4RW6A 4TU7A 4U96A 2OPPA 3TAPA 4KGVB 3QLHB 1OO0B 3AD9C 3RR7A 3NCRA 1S6UA 2BV3A 2A6OA 2F5GA 3KUEA 5DM6Q 2HNYA 1X4GA 3L9ZA 3GCWP 1GX5A 1FNMA 3GYXB 4KGXB 4Y00A 2FUG9 3BGUA 3Q83A 4ATNA 3R6GB 1XR6A 2CG4A 2KVQE 4DR5J 2VD3A 2W1BA 1D3WA 2ZE2B 3CO0P 1F9HA 1KQKA 2QFIA 2RE1A 2N82B 3FC9A 2AJQA 1RWMB 4DXLA 4USWA 4EGLA 4QR1A 1QD1A 3CD7A 4DR4F 3HM9A 2DNGA 3BEGB 3UN3A 1IQTA 4P71A 4LVOP 1F2GA 3PCOB 1Z2ZA 3WX4A 3EUNA 3CVKA 2RQ4A 3PACA 1YGYA 4RWWA 1XJWB 3SXLA 2BABA 1ZZNA 5ITHA 1ZAWA 4YEAA 1IKVA 4N8NA 2LCWA 3LAKA 1Z1ZA 1RWNB 4EBEA 1MNEA 1U8SA 2CQ1A 4UOFA 1YHQS 2C2MB 1Y5IB 4WF9Q 4DI6A 1HWUA 2QEXS 3OW2R 2B0GA 3MHYA 2WONB 1PAEX 3CDBA 5F3TA 3VGSA 3DDKA 1HLWA 3NS5A 5IOLA 2ZEJA 3LP0A 4M5MA 5F0UA 4EZ6A 2QTWA 3IMQJ 1JLAA 5A2QU 1N33F 3N9UC 1L5UA 4IFVB 4W4MA 1N36F 5BXIA 3TA1A 3CJTA 2GJIA 4CTAB 1IVZA 3JSBA 4J9RA 4RW7B 1RTJA 2OTJS 2OGUA 3O3LA 4X4UA 1DTQB 1Y5LB 1EQMA 3KHGA 1RA6A 4HEA9 4TQRA 3OTOF 4QU6A 4KQZA 2QRRA 3I55S 4ZPTR 4DZDA 2VFSA 3S1TA 4DR7J 3I4HX 1EZZB 1IBLJ 2MPUA 1L3VA 1PJ7A 3PX0A 2X1FA 1JLBA 4M5KA 1A0OB 2M4MA 1MSWD 5B7WA 5BR8J 2HIYA 1WHXA 4NCBA 1R31A 1M5OC 2W2NP 4FYYB 2G9OA 1IR2A 1N34J 1MWYA 1RU2A 1XNRF 2KYZA 2AX0A 3LP2A 2G2YA 3OR1B 4M94A 1VQ7S 1VBZA 1X4DA 2O66A 2PC6A 4DL3A 3LPEA 4KYZA 2Z57B 1YQHA 1A9NB 2ATLA 3PKMA 4O44A 3T1AA 2RD5C 3S01A 2O3DA 2YH0A 3G82A 1U1KA 1LXNA 2LXFA 4DPXA 3TZYA 3PO4A 3R5GA 2AYBA 3H5YA 1TK8A 3IO1A 1T9UA 3P45B 2AEFA 3HFKA 5L9NA 2WSCC 2GX8A 5D77A 2ZNZA 3M6WA 4IO9Q 1SC1B 2GAHC 2HFOA 4DL0C 2UU9F 3P5BP 3PW5A 1KQGB 2I1RA 2DB1A 1RWUA 4F04B 3CXCR 2RH3A 3RAMA 3FZ2A 1VQ9S 1FHTA 3OBIA 1D1UA 3VGTA 2N7CA 3M6XA 3VF0B 1GXLA 5GMKa 4BHQA 3GB0A 1VJWA 1RTHB 5J2MB 1OJ4A 4O3PA 2ZJRQ 2BANB 3ULHA 4OX9F 2G2ZA 1TFYA 4F67A 2MKIA 1TV6A 2FJWA 1OS5A 3W3SA 4CLWA 3M6VA 2B3TB 1BQMA 1XMOF 5G4DA 3FSIA 1U1MA 4H4KC 1FJCA 3C66A 4URQU 1LWFA 2V8VA 2H4YB 4LSNA 1UVNA 3ZNJ1 2HG4A 4C48A 1FJ7A 1SV5A 2BMBA 4DX7A 1VCTA 4RW6B 3I5BA 2HHTA 2RQCA 2OPPB 4CRJA 2JH3A 2MXYA 3ETOA 2NPFA 3EGVA 3MMCA 5HO4A 4N77A 1A6LA 1NDPA 2AKWB 2NUUG 2HNYB 2QMWA 4I6YA 1TL5A 2LXUA 3PEJA 3L7OA 1RAEB 1UZHA 1JWWA 3PW0A 5DLFA 3RR8A 3E2EA 4P9SA 2GAGC 1TUWA 1RTDA 2C2OB 2IJRA 4LSLA 4L76A 3US5A 3IGVA 3EXYA 3ENAA 3ENWA 2E1PA 1BWVA 2UV8G 2QE5A 2V2KA 2O67A 1VQOS 1ZM9A 4F4KA 1TZ0A 2JHEA 1FFWB 4C8MA 3PV8A 2ZZMA 4BWMA 2JVRA 3OHAA 2FTRA 5B0EA 2F8EX 2W2MP 3Q23A 2VL1A 2F3JA 1U24A 3KG4A 3HHLC 3ETMA 4LR9A 3H2VE 2A3JA 3R8YA 3V5RA 1IKVB 2GVZA 3R27A 1FERA 3LWLA 3CTRA 4DUYF 2E5LJ 1HI8A 4RNNA 3PR5B 4S0MA 3SCLE 4CLUA 2QGFB 3GCXP 2DNMA 1S1UA 3NBPA 1B4SA 3KOAA 2ZC3A 3IM8A 4MIWA 5SUHA 4PQUA 5DDPC 3LP0B 3GZ7A 3WC2A 4JI3J 1YJ7A 1JLAB 2HZVA 3H4DA 1T94A 3D6MB 4DU8A 2ACMA 5LMNF 3K0JA 3RB3A 1U6ZA 2VPZB 1TELA 2ASDA 2UP1A 2B9WA 4UUXA 4A47A 5RUBA 5I3UA 3QGHA 4P6QA 3B82A 1WG5A 1RTJB 4X4PA 5GMEA 2DITA 2M70A 1CC8A 1QSLA 4HKQA 3W2WA 2JEIA 3QIPB 3CJQA 1MWZA 2CJYB 3MM8A 4ERDA 4URSA 4NLTA 4USTA 1KLMA 3JAMY 1NKBA 1JLBB 3WX8A 3QPIA 1TKDA 2QT7A 4RW9A 4OYWA 1FRHA 4X4RA 3CJSA 2XY7A 3D67A 2PSZA 5G0RA 3LP2B 4KPYA 3U1NA 4YHHJ 2YQ3A 2BR0A 1WF0A 3UW1A 2HGLA 3NXZA 1W2IA 5KT7A 3QSIA 1KVIA 4UOGA 3H4BA 4CH0S 5CYJA 2FZKB 4O44B 3VHQA 4L75A 3G82B 2DGQA 5EDWA 1AXQA 3D1QA 1WOPA 2CJAA 2IM3A 5CCLA 3CDWA 1V3RA 2LECA 4PYDA 2R8KA 2GHPA 4CZCA 1KOOA 2D9OA 2XI3A 4AD6A 2YKNA 2UUWA 4NEZA 4OYAA 2C3MA 2CQIA 4NLYA 1FA0A 3EDQB 4NWBA 1GH8A 1U2CA 2CDQA 1Q1KA 3M8SA 2X1AA 4NL5A 2DH9A 3HK2A 2GFFA 1WEZA 1CVJA 4FVCA 2RB7A 1HARA 3KYLA 5D0EA 4DR7F 4LRCA 1NHKL 1SH0A 3EE3A 1IBLF 2MQOA 3KFWX 5DG9A 1TV6B 3LQVA 3JQJA 5BR8F 3G8TA 1RU1A 5B0DA 4X62F 5HAOA 1BQMB 4ANCA 5ETTA 1S9GB 2FD2A 3A4TA 4M5IA 1N34F 2V4RA 2MY8A 1LWFB 5E5NA 1GTHA 2MZQA 4LSNB 3GQCA 3HSDA 4NCAA 3EPIA 2I0XA 1C4CA 2BE2A 1RTZA 1MMNA 1SV5B 5IC4B 1NJYA 1K0TA 3K8WA 2ZH1A 3D0IE 2J6TA 1EARA 1IQZA 3M8WA 1N54B 4P73A 3MMCB 3PDNA 2ZC4A 5MAOA 1F60B 2L08A 4WTOB 3QMQA 2V4JB 1WSRA 2N7YA 4Q45A 2I8EA 4E2FB 4W90B 2HRTA 1DY3A 2OJ3A 2FYXA 2OSRA 2BE7D 1NK8A 5A0YA 4U7UD 3W9IA 2MKCA 3KG1A 5H9FK 1KC8T 3PFEA 1JJCB 2NYIA 4K4XA 4LRBA 3AQOA 1RTDB 2FC8A 3G87A 5KFTA 4DL6A 3EM1A 3BO2A 1JNZB 4JOUA 1UA1A 4LSLB 2VKZG 2F8HA 5K8OA 2ZVSA 1EB0A 3ZO7A 3W64A 1K73T 2XC9A 2GNKA 4KE5A 5CA5A 1H7WA 2XWYA 3RU0A 1BMQB 2UXBJ 2L41A 1F5CA 1FWLA 3TP2A 3GLJA 2UVRA 4K50A 3MCSA 2KXHA 3HVRA 4RUCA 4MMOA 2ZH4A 1B99A 1AUSL 1TUGB 3CWJA 4IRCA 2XYPB 1RT3A 2GVZB 1F2HA 2MTLA 3MXHP 5KFVA 1B0PA 3TOQA 2DEJA 3DC2A 3QGIA 1Y00A 2R8GA 2F63A 4FPRA 3NAHA 4Y3CA 1S1UB 1V5IB 3NBPB 3BDPA 2D7SA 1GEHA 2CQ3A 4PQUB 4NX9A 2ZNYA 1WEYA 1VC0A 2VZ9A 4UOHA 2VASA 4KHMA 4XDCA 3GIIA 3AA9A 1TQLA 2FLPA 2OHDA 4YFUA 3IG1A 1YJ9S 2Z8QA 4IH6A 2KFNA 3CCES 3KLVA 5I3UB 4OMFG 4YS2A 1UA0A 4X4OA 3OJSA 2LEPA 3F0NA 1SJ1A 4WFXA 4C8LA 1PYSB 2KT5A 1HW8A 1RGVA 4NEYA 4FF1A 2ZWPA 3PIOQ 3W2WB 1FVQA 2Q6BA 3SCKE 4QWAA 2J9CA 2B6AA 2QJ3A 3MM8B 2KI2A 4ZPCA 4LR8A 2EVZA 1KLMB 4Z2XA 1N52B 1P9YA 2OPSA 2R7WA 4DV4J 1U1NA 2AQ4A 3MOZA 1SJFA 2LFVA 3TX8A 4WBFA 2Z2LA 4RW9B 3Q8VA 1E6VA 3M2VA 3ITHA 5K8MA 2VODA 5G0RB 2E5LF 2Y9HA 3UCUP 3HVAA 4J7CA 4WYWA 4IQMA 2EG1A 4F0KA 2HW3A 1HWKA 4N41A 1WJ9A 5HMWA 2DNKA 3QZ7A 4E98A 1WSVA 2J6SA 4JI3F 4NMLA 3BSCA 4OHZA 3FCHA 3LPYA 4JI4J 1HBUA 3QJJA 2QLFB 3IAS9 2HHXA 1RT2A 2DNQA 1RXOB 1YG0A 2LDYA 4ECUA 4DR3F 1LW2A 5ETQA 5L8RC 2YKNB 5KFJA 1VR6A 4WU2A 1BHNA 4ECQA 3VZHA 2B9EA 2BRLA 3P4UB 2LA6A 4YY3J 3KLIA 4JI6J 1S59A 3HHEA 1FRKA 1VBKA 3DFEA 3KNGA 1NLKL 1SQGA 1TKXA 2CXEA 4AYBD 3DOLA 1LV5A 4ZVTB 3TW0A 2C1EB 2OELA 1Q81T 2IJFA 1R8CA 5B0AA 1VISA 1HL6A 4YUDA 3DLLQ 2UVUA 3HSGA 4U6PA 1R0AA 1T8EA 3VCDA 4F02A 4QYZJ 2ZHOA 3T3FA 3RZAA 2P2CB 2O1PA 2BE2B 4YHHF 3OL6A 4O3OA 1P8GA 8ATCB 4IFYA 1TMJA 2LLZA 1ZM3A 2LQ9A 1D9FA 2X51A 2DNLA 4CM0A 3J7Z5 1UCNA 2X1GA 3DOMA 3AB2B 2HFNA 4MT1A 2B56A 3H7HB 4YOEA 1C1CA 2HVHA 1KWMA 5E3QA 2IYIA 5A0YB 1R6VA 2FHJD 3EGNA 4WU3A 1JQGA 1U1QA 1MN7A 3UR0A 2VFUA 2Z30B 5IQQA 1NM2A 4RUAA 4LIRA 2RJZA 4NA3A 2QN6B 4HH0A 5B0GA 5L39A 4N5SA 3TUIC 3SSSA 5BYSA 4OYXA 5KT6A 2ZKTA 1JLFA 4LBPA 4EBDA 1PCAA 3I56S 3ZZZA 1FTRA 5HQLA 3I5CA 3DRSA 3D66A 3LOUA 5KT5A 2OMOA 4ZCKA 3ZZYA 2VBXA 3MMBA 1RT3B 4M63A 1BQNA 1SKSA 2H5EA 3I31A 4FXWA 1WI6A 1S7HA 3M1VA 4WWSA 1R0CB 5GADU 3DGPA 1RT4B 5J1EA 1RWPB 3EZOA 3PHTA 1SIWB 4DU7A 3AA8A 4ECSA 2OLWA 2WVCA 3W5YA 3LH2S 2OFHX 3GYNA 1QJHA 4GVLA 4CNYA 1X5PA 5KFYA 2OIHA 3L7UA 3T41A 4DV7J 1DQ8A 3IG1B 4G65A 2B43A 2R8IA 2YNFA 5JXSA 1NRKA 2Y1JA 2VDHA 1JJ2R 5KFUA 3HHLD 1KDNA 3M2RA 2DCLA 5U47A 4AE5A 1X4BA 3MMAA 2NSCA 1HBNA 4FPIA 1R8HA 1HBOA 1YK9A 3ZC4A 3GFYA 4RZRA 3EJMA 2B6AB 4A48A 4EU0A 3LGNA 5EWGA 5KFFA 4P72A 2UXBF 3LTOA 2C28A 1BQXA 4DUZF 1NJZA 2OPSB 4PAAA 2C3UA 4ZIWA 2EKNA 1RK8A 5JMNA 3I9ZA 2POKA 1T95A 2W2QP 4IG3A 1E6VB 1R0BG 3M2VB 2DGTA 3ITHB 4K4VA 3N5FA 3NMAA 1X4EA 4I2QA 4ZVOB 5THWA 3KTQA 1X7VA 1FRJA 4UQGA 3UDEA 2HBYB 4QIGA 2J8SA 3QT8A 2VH7A 1FESA 2BRKA 4CLKA 3DRRA 2VFVA 1N5YA 3T19A 5IT9U 3MUTP 3V6KA 2WBRA 3MGJA 4PQAA 1F1BB 1U7LA 4ZVRB 4J9VA 3ZTOA 1TTHB 2XM3A 4ZLJA 2J7WA 1R3NA 2ZOGA 2XY6A 5A2QY 3CSKA 5LMUJ 2LMIA 1RT5A 1Q8LA 1HBUB 1RT2B 4TYBA 3RW7A 4WZQA 1LW2B 2XULA 3PYFA 4PCQA 3ZTQA 4JBCA 2DGSA 2CJQA 2FVSA 1HFEL 4LF6J 1NHVA 1PYTA 1NHUA 1WTBA 2F9JA 4H54A 3BV8A 1SVDA 1V3SA 2VJVA 1KVJA 3NOCA 3KLIB 4FKXA 2GMJA 3WIUA 3GU0A 1TKXB 3KHLA 4ELUA 3MPYA 2C3OA 2NXJA 5DRKA 3A12A 2JLFA 2DGVA 4RPFA 4UW2A 1W7WA 2XTJP 3LALA 2E66A 1HNXJ 3W1YC 2Q6CA 1R0AB 2DH7A 4CNZA 3HP6A 4PWUA 2ZH6A 3DOKB 1L3UA 1GAOA 3ADAC 1GT8A 4B9TA 2CJ9A 2VBZA 4IFYB 5D4OA 1F6TA 4C3MA 3A8EA 4TU9A 2KG1A 1N5VA 3BJYA 3EYZA 5DQHA 4R0JA 3FQKA 3OVAA 2JRSA 4ED0A 2DBBA 2J76E 1I3OB 4CQ1A 4ED8A 4JI4F 5IM0A 3GSIA 3DOMB 2R7OA 4FNHA 2HNDA 4FP9A 1C1CB 4HDGA 2FVQA 2LDIA 1RWXB 3OTCA 5E7OB 2ADBA 3J7ZT 1VQPS 4J9OA 2WK4A 5C24A 1DQ9A 3EGZA 1ZAXA 2M8DB 4E0DA 5LOQA 4YY3F 2N4DA 1NJWA 2ZH7A 2J0WA 3L4BC 1ZH5A 4JI6F 5KFNA 3I6PA 4DN0A 3FEXB 3CCTA 1NSPA 5ETVA 3T5HA 1VRUA 4WP8A 2PDAA 1JLFB 2G13A 3LP1A 3PW4A 3JSYA 1FO1A 4CO5A 2J5AA 4AXJA 3DRSB 3NGTA 3S7RA 1SQEA 2NYHA 2C22A 2FJAB 4F8RA 4RU2A 5L1KA 3MMBB 3AAWB 1BQNB 4Q43A 1FTCA 3NP5A 3MM5A 4E8UA 3H42A 3M1VB 4YDXA 3DGPB 2GO9A 4PG6A 2YX4A 3WDOA 5J1EB 1KVKA 2VG6A 1GMWA 4CIOA 4YR0A 4K5RA 4KIAA 2VONA 2Y1IA 3V4MA 2KL8A 3KJNB 4GO7X 4CT9A 4ICLA 3PFOA 4FYDA 1MMDA 1DZ5A 2RKIA 4MYTA 1H73A 3KLHA 1HNWJ 5LM7E 2RUGA 1X9WA 2YNFB 2KJWA 3BBFA 5IS2A 4OYPA 4ED1A 4USUA 3QWUA 4WKYA 3ZZRA 3M8RA 2BDPA 3OL9A 1NPPA 3PJ9A 1TK0A 2B5JA 3M2RB 4F3OA 4H4MA 1WC1A 4A46A 2PT0A 3MMAB 4NA2A 3DI6A 2YWEA 1KQFB 1HBNB 4IO1A 1HBOB 2QIFA 5KFSA 2EWHA 2E5IA 3O2IA 3QT5A 3OVSA 2KB2A 1NDKA 4LF5J 3ZTPA 4DQRA 1S79A 3MEDA 4P2SA 1NMEB 4G1QB 2IM0A 1VQYA 2XZDB 4IG3B 3OHBA 3PR4A 1P1TA 4ZVQB 1QVGR 4HT5A 2Q3PA 5KFIA 4I2QB 2JJ4D 2V94A 2CQPA 1FWKA 4HI1A 1HI0P 4K4UA 3DLHA 1DTTA 3CULA 2HURA 2XSJA 5EGYA 3KK2A 1KQSR 3DRRB 1N5YB 4NZ7A 2E5JA 1IWAA 1SKWA 4WFBQ 5CH7B 2K8GA 1B70B 4OYMA 3IBFB 2YX7A 1RT5B 1T0TV 2ZH8A 5B08A 2PEHA 2YWWA 2D3UA 2ZVIA 4ECRA 3GSDA 2YKPA 2HFSA 3BREA 4NLOA 2W8LA 1NDLA 2DISA 2D41A 3PZPA 2K1RA 3BN7A 3KUGA 3M7VA 4IR9A 3DGVA 1R43A 2W4DA 4N76A 2PA8D 3BH7B 3VALA 2E9RX 3D5MA 4I7FA 1AZSA 4IOAQ 1XERA 2CPDA 4FDFA 3DLGA 4BCAA 1N4LA 3D0HE 1PSDA 4QOTA 3BDEA 4DSIA 4I6WA 5AE3A 1UW9A 1OY9A 3ZZPA 1HNZJ 1FJGF 4LF7J 4NYPA 1VQKS 4P75A 1UP1A 1YZ7A 3BO4A 4KB7A 2KHDA 3MUVP 2W01A 3J81j 1WORA 3CNQP 3QGPA 1OMSA 1G7CB 4CYUA 4ED6A 4I64A 2UUCJ 2RRAA 2PIIA 2IDLA 3X1LB 4I67A 1GQEA 5LMUF 4Q44A 5IM0B 2BJ8A 1FNXH 2HNDB 4I56A 3D3BJ 4DPOA 2U1AA 3DRYA 2VPYB 1OSDA 4F50A 2WCXA 4WFYA 2HZCA 1SH3A 4ZP9A 4TY8A 3QJPA 2AWZA 3I0RA 5C24B 1PIEA 2VKRA 2BEFA 1FVSA 2XYHB 3QRQA 1IR1A 3GWCA 4LF6F 2ZJQQ 2BKNA 4OV6A 5KFAA 3MAQA 1SI9A 4LF1A 5AXKA 2VPWB 4O3QA 1VRUB 4RWXA 5D3GA 3LP1B 1RBLA 2XO7A 4ETXA 5AT1B 3X3UA 3I5AA 3PHEA 2V8GA 1X0PA 5D4PA 4MAKA 2G0JA 4OHWA 2J0QD 5C42A 1HNXF 4P52A 3C16A 4X65J 2E7WA 2MGZA 4ZS6A 1UVLA 1WDTA 3THVA 3RG6A 5IFMA 2BQRA 2VG6B 4NPOA 5JVGQ 1Y4ZB 2HVDA 2R4FA 1RSCA 2MHEA 3UE2A 3POTA 4A8WA 3BQ0A 2IRYA 4ICLB 4ZJQA 1H2UX 2RKIB 1G6BA 3HMJG 1T7PA 4TLQA 3KLHB 2BJEA 2KHCA 3JS9A 2HRYA 3UQSA 3DXSX 1RAOA 2IA6A 2OI2A 2YKMA 1VQ5S 2KT3A 3OT9A 3Q2SC 1QSYA 2B5JB 4F4AA 4H4MB 1VQ6S 3JQKA 2KN4A 4HTJA 3T5KA 3V6HA 3DI6B 2RNEA 2DHSA 3RJMB 4X4QA 2D3O1 3NNCA 5GVQA 2XI2A 3RAQA 2IVFB 2IRXA 4ZVSB 5HVFA 4X2BA 2MSTA 3VQTA 1GK8A 4PABA 1DLOA 3P6YC 4ED4A 4DPWA 3MEDB 1RKIA 1KSPA 2UXCJ 1B0TA 3AHPA 1BGXT 1SJQA 4HHHA 1RABB 1XTZA 4ZVPB 1AT1B 3K89A 4OZ1A 1XNQJ 1NPKA 3JTNA 1TP7A 4NLQA 2J0SD 2BJDA 1SJ4P 1DTTB 5HSPA 2XSJB 3KK2B 4B9SA 1N5SA 4NLXA 1V9OA 4DQQA 1DFDA 2DK2A 4JP8A 1PJ5A 3QAUA 1VYAA 3D28A 2WB1D 3FVYA 1VGYA 1NKEA 1T05A 3PO5A 1CJUA 2JX2A 4XPCA 2MKHA 2E5HA 2RHQB 2CVEA 2C2DA 4ES1A 4ECWA 2CAJA 3SV4A 3NCPA 5KFWA 2KZZA 1HNWF 3L09A 3WC0A 4UUWA 2QYGA 4CM2A 2VUGA 2N3OA 2KFYA 4OHXA 3HZGA 1FK9A 4R8UA 1CPZA 2BW7A 2VFTA 1PBUA 5CHCB 1URRA 4QZVB 2JSXA 2DNOA 4I7FB 3OFEA 2DJWA 3SMZA 2HMIA 1FEHA 2QLBB 1AZSB 4RX6A 3DLGB 5CYMA 1M1HA 2R7XA 2HQCA 4LF5F 4CLZA 1QY7A 1OPIA 3QJLA 1A7GE 3OFHA 2R8HA 4EUVA 3H98A 3R1HA 2PMZD 2QG9B 1LK5A 1IKYA 5DDRC 3L7PA 4TVAB 5DZ6A 2PI5A 5LJ3Y 3TO8A 4TKTA 4AL7A 4OYIA 2ILZA 4PZVA 4CYUB 4B3TJ 4CT8A 4EMDA 1WUUA 1S4FA 1N0UA 3GP9A 3A8KA 3K2YA 4C8KA 3TEGA 3Q24A 5GAEI 2CQDA 5CD4A 3J7A1 1VFJA 2DYAA 2Y0SD 2DGUA 1RP5A 1FF2A 3GJTB 1S0VA 3C15A 3T1HJ 1ZA1B 2CZVC 2MQ8A 2M8HA 1L3KA 3D54A 1V5VA 3M6UA 2E1RA 2ZHBA 1RHMB 3OXGA 3ENQA 4TY8B 2V2VA 3I0RB 1DARA 1UWAA 1GXUA 5A8RA 4NLSA 4V19X 3UD5A 5D0RA 4YB1P 3UDLA 2EFQA 4MKVA 5DM7Q 1EETA 3K8VA 3PRVA 2MKYA 1REVA 5D3GB 4AQYJ 4WPAA 4PXCA 2HZAA 4MIAA 1VBXA 2PO4A 3MM7A 5HJYA 2DR9A 4B9NA 3TUJC 3FBFA 1HNZF 5C42B 4LF7F 3C16B 2J7UA 1AUDA 2ROPA 4QW8A 2MGZB 2OTLS 3IWLA 2HHVA 3MFIA 2WW8A 2QV6A 3CC7S 2AP6A 4LR7A 1S1XA 3PG9A 1FRLA 3SQGA 1UJ5A 1H38A 4DR6J 1BUXA 3CC4S 1Q78A 2AZ3A 1KFDA 4A8YA 1S9EA 2UUCF 4OI1A 3M8QA 4DSLA 3POTB 1FWPA 2E5GA 4ZPWR 4DF4A 3S8SA 4ITSA 2HBQB 1NCLA 4FVMA 3KJFB 4XO0A 1GMVA 4EWTA 3C3LA 1VHFA 3HFVA 3QBCA 1UPPA 2Q79A 3CCQS 5KFKA 4C0BA 1JMTA 2DGXA 2YKMB 4LFCJ 3IFEA 2ABYA 2NZCA 3VAIA 4WP3A 1RYSA 1WDDA 2W8KA 5EWFA 4YMEA 1TFWA 4TN2A 4RBTA 4ZVHA 2BX6A 4Y0FA 3AJ2A 2HYIB 3H5UA 4YDDB 3MD3A 2DTJA 1NNDA 2IM1A 1ZM2A 3N01A 2L9DA 3VVUA 2VA2A 1VK3A 1MW7A 3MCOA 1DLOB 4K7QA 2PFDA 4ZMMA 1G4CA 3ZZUA 1WC5A 3OL7A 4NRTA 4X65F 3BGLA 2XMAA 1RKJA 4IDKA 2NSBA 1H3DA 1RWOB 4QBUA 1XQIA 2DGWA 4K0KJ 4KTQA 1O8BA 1XEZA 2ZH9A 3U02A 2RDIA 2B7CB 1TL7A 4LRFA 1T05B 1CJUB 2QMXA 4QU7A 2G0IA 2XG8A 3D6TB 4O0NA 3OSPA 1GX6A 3G6ES 1N48A 4J9PA 1M90T 3ISNC 1NK9A 2NS1B 5HANA 1FD8A 2AGPA 1HNVA 3BKTA 4EEYA 2W2OP 2Y1LB 1FK9B 1OYDA 4R8UB 5A6PA 5CABA 2ILYA 2FGOA 2ZHAA 2QA4G 2XQCA 2WSFC 3IM9A 2HMIB 3PEHA 1CQNA 3CJRA 4QYRA 4LF8J 2FVPA 5CYMB 5E3PA 1FX4A 2B51A 3T9NA 2NXNA 3KMSA 3K5LA 1LWXA 2CJXB 2ROGA 4L3KA 1LKZA 4XAKA 1FKPA 1DAXA 2E7XA 4NYZA 2UXCF 4DPYA 1RYRA 2YVSA 2QSWA 1XNQF 1IKYB 2AEMA 3W9HA 3LANA 4J9NA 1LK7A 3DRXA 2OSQA 3T9ZA 4TLRA 1VC6A 4IH5A 3V2UC 1RISA 1V3ZA 4O3NA 1U49A 3OXFA 2OPRA 3JB9k 3MPVA 5IT9Y 2MHNA 2I2YA 1U2RA 3OPKA 2Q66A 2AD9A 2FJDB 4JV5J 3B54A 5KG0A 2E29A 4C0HA 3C15B 4ECZA 3SSRA 2OKQA 2KJVA 3UDCA 4KBIA 3CJKA 2JNJA 4LT6A 3TAQA 5HBMA 2E1AA 2EW9A 4ZPDA 2GGPA 3BKUA 3BSNA 1BD6A 5H9EK 3HF5A 5A8RB 5KFGA 4K4TA 3BSAA 1C0TA 1LWEA 5LXYA 2MY7A 4M5LA 4LQ9A 1NXIA 1RAGB 2QMUB 2LEBA 1WC3A 2CQHA 3CCLS 1EETB 1NSQA 4ZJLA 5GAHU 1BWEA 5B09A 3VAKA 1REVB 1T9VA 4DBQA 4ZCLA 4ZCMA 3J7YU 2B9YA 1NZ8A 5DETA 9ATCB 3MM7B 5T7LA 4GKKJ 5C5JA 2IYGA 3NGSA 4I68A 3KJQB 3TJAA 1VLOA 2W9CA 2FLLA 3BN4A 3SV3A 1VMBA 5H1SV 1JX4A 4DWIA 4QR0A 2YNGA 2NQPA 5D4LA 1EP4A 3P96A 1NH8A 8AT1B 4B3TF 2FQQB 3SQGB 3R6LB 2CJKA 4DV2J 4NLGA 2KH9A 1KHVA 2MLXA 3R5CA 1S9EB 5A6WA 3ICLA 3M8QB 2NXEA 2HHPA 4BLGA 2XEXA 2DGOA 2AJ2A 4ZVEA 3Q8RB 2D1CA 1S57A 3MM6B 3CJ8A 2HHSA 3T1HF 3UD3P 1QSSA 3GJRB 2IY5B 1PBAA 2R3VA 1BC6A 3U7JA 4PG7A 2JLEA 1UFWA 2CPJA 4L3NA 2YBVA 4DR1J 2GVDA 2PA3A 2VU5A 2NUHA 4FYVB 2WAQD 1S6QA 2MZRA 5KOWA 4KT0C 4M8LA 1KBRA 4RUHA 3N6MA 4ILMA 4YN3B 5AJ3J 4TXSA 3OTDA 5GAGI 4ZPVR 4F4WA 2HHUA 4FBUA 2JVOA 2F65A 4DV0J 3T5LA 2DKOB 5HP1A 2DY1A 5L38A 4EYIB 1YKWA 1J5EJ 1SH2A 2CNKB 3W5XA 1HI1A 2H54B 1CC7A 3SSQA 4IDKB 5F8JA 4Z37A 5C2CA 9RUBA 3UVJA 2W7PA 4XDDA 1CLFA 4U9RA 4I1TA 1RBOB 3SYZA 1TVRA 2YY3A 3QQCD 1Y7PA 1TL7B 2YWGA 3I96A 4DR6F 3QRRA 3SFUA 1S1TA 1S77D 1FX2A 1RAFB 5LT5A 3CJ2A 2UVVA 2AMCB 4OYBA 3MF5A 4P74A 2I6WA 2AHOB 4LFAJ 1RLCL 3MPUB 3QT7A 1HNVB 3N28A 4I4BA 1F9FA 1U2FA 3DDNA 1I5OB 3MM9A 4MKBA 5F8MA 2OMLA 1FDBA 1HWIA 2KM8C 2DPJA 2PN6A 2Q1LA 1N5TA 3CF5Q 3NGKA 3LW5C 2XMWA 3CMES 3DRPA 2ZUGA 3MEGA 1OSCA 1FKPB 1CG2A 2FHMA 4OI6A 4DN9A 2JZ5A 4USVA 6AT1B 2NREA 1FE4A 1S6OA 1RAHB 1Z2LA 3SDEA 3H5XA 1B7YB 1TKZA 4P7TA 4K0KF 3TWZA 5KFPA 2V8HA 2L9NA 1O0PA 4B17A 4OX7A 4O4RA 4QIVA 4B02A 1NZAA 5KFDA 4ZJOA 3HHDA 3CCUS 1RCXB 2OPRB 1KRPA 5JUMA 5CZVA 1RAIB 4B3SJ 1R6YA 2J9DE 2BQUA 4AUKA 1S1VA 3MMJA 1Y5NB 2LA4A 1IWGA 1NSKL 3R1LA 3FFIA 3V6DA 3CJKB 1FE0A 3AD7C 2HQFA 3K59A 5HBMB 2RRNA 2GGPB 2IC3A 3SCIE 2W7AA 2AZ1A 3EZ5A 1MN9A 4C11A 2AYEA 2HFZA 2Z56B 2ZOMA 4DPUA 1QAXA 1C0TB 4MKYA 3CB4A 1LWEB 4NCGA 4LF8F 3N5BA 3GFHA 4U95A 4HHJA 5EUHA 2AEJA 3SIPB 1QM9A 3C8YA 3CCRS 3IBWA 3A8JA 3RB6A 3I32A 2QX0A 1SPBP 3BB5A 2IAJA 5T7LB 2I9SA 2DT9A 2J6UA 1FCAA 1TL3A 4DEZA 1EQ0A 3EWGA 3B6BA 2W9CB 2EC0A 3CGIA 1XWLA 2VOOA 3A3PB 3A13A 2FHKA 1UEUA 1YRUA 2YNGB 3MI7X 4DQPA 1EP4B 3IA0A 1RT6A 4KAIA 1BLUA 4DOZA 4GMKA 4DHVA 3D4JA 2W9AA 3GIMA 3DLBA 1OQ6A 5I42A 2PGCA 1YZ6A 4JV5F 4L74A 2BQ3A 2FPHX 2XZTB 4ZDNA 4ZPBA 1F5AA 4A8QA 1CJVA 2BA9A 3HO1A 2L3MA 3GIJA 3BGOP 3G6XA 3GILA 5E3AA 3TJ9A 4NA1A 2HKEA 3VAMA 4F2RA 4DL5A 3M32A 1U4BA 2RS8A 3H2LA 4M95A 2MDAA 5J2PA 3IWXA 4LVNP 3BQ2A 2GVDB 3TEHB 2Z2MA 2DNPA 1S6QB 3BR8A 4L73A 4JV0A 2DVIA 1Q8IA 4IOCQ 1TAUA 1R7IA 4W92B 3R7SB 3NL0A 4LJMA 2NXUA 3L95X 5FLXU 3PJXA 3VAHA 1FXDA 4EK2A 4O23A 1XC9A 2ALYB 4Z7CA 4ED7A 4FF3A 4IYQA 5HP1B 1Q4RA 3R3TA 4GKKF 4J9MA 3W9JA 2XSFA 3ELHA 3OSNA 2BM1A 1OWXA 2VA3A 3UVJB 2MLYA 3UNYA 3D7SB 2WBMA 2MYFA 5HLFA 3A1YG 2HLTA 2DRBA 5ETLA 2XCPA 4AFFA 3KLGA 1TVRB 4LF9J 1Q8BA 4C7QA 1OIAA 1Y9OA 4DV2F 2BKPA 1S1TB 2BOAA 4ZVGA 4A8SA 2PI4A 1NB7A 4N56A 1U25A 4WK1A 4NZ0A 3UN2A 3HSZA 3G4SS 2MSSA 7AT1B 4DR5F 4DJBA 1F3FA 2GZOA 1IKXA 2V67A 5H9FJ 2CRLA 3VR1A 1JLEA 3EMTA 2K7JA 2GCFA 4JI8J 1OY8A 1FDAA 1WI8A 1IUJA 2QLJB 3MM9B 2OO4A 1JXEA 4DR1F 2N3LA 3MCNA 1YWXA 4X4TA 2YWFA 1NKCA 3O1LA 3VAGA 5HI7A 3GV7B 4KFBA 3RBEA 4DMZA 4DUTA 3I4PA 4DG1A 4ZITA 1ZYQA 2I38A 4ANEA 2EG2A 1UFKA 5AJ3F 4RLEA 4F26A 1HPZA 3DRPB 1CSJA 4PWDA 4MTPA 4DV0F 3MEGB 1SKRA 1VIOA 1HWLA 2DXFA 3W65A 4KC5A 1J5EF 4URGA 2HQIA 3K5NA 4K59A 5DGBA 2Y1RI 2QL9B 1WKKA 1Q7YT 1HHTP 4L6V3 3A8IA 4EZ9A 4Y6IA 1RB0A 3QATA 1TKZB 1SJ3P 1JJ4A 4U7CA 2VC1A 5E3RA 2CG8A 2LYVA 2EKYA 3CJ5A 3TANA 3NG8A 4U8VA 3GR0A 1YTYA 1Q8KA 3VTIA 1RBAA 2GQCA 3J80U 2HWIA 5KFQA 2B4OA 3KHRA 5HMXA 4LFAF 1S1VB 3HJVA 1FDDA 4OV1A 2FJEB 3FFIB 3V6DB 3AD8C 2N4CA 1M5VC 5DGAA 4LF4J 4K4YA 3QZ8A 2IC3B 2V6AA 2HPUA 1WWHA 4OI3A 3SI8A 2DCUB 4C11B 2HQGA 1S76D 1R89A 2RSQA 4NCGB 3UN5A 4P2FA 3K5MA 4Z7YA 2HWHA 3CDUA 3EGWB 3GFZA 1H98A 5KFXA 1I6JA 1NBEB 2MEWA 3VZIA 5LJ5Y 2IAJB 2WB4A 2C3PA 3TVYA 3SEOA 3MWBA 1TL3B 2MQNA 2P6SA 3MAAA 3UWTA 2GMLA 4DX5A 3QWPA 3OUYA 4F2SA 1AB8A 4C8YA 2G0CA 3T6BA 2E9ZA 3ILOA 2C2EA 2OEKA 4DFMA 1TL1A 3L3CA 1RT6B 4WE1A 2RRBA 3FBCA 3T5JA 2GQ2A 1EAYC 3OTOJ 1ZTWA 3T1YJ 1NUEA 4B3SF 5I42B 1YJTA 4F3MA 1Y3JA 3FUYA 4ZKAA 1CBKA 1TAQA 3Q8UA 1CJVB 1HQEA 3W60A 2VJUA 2V2ZA 3I87A 4NXMJ 2XB2D 4RBUA 4FXVA 5BJRA 3M30A 3G6VA 2KYXA 2VBYA 3M9MB 2CPEA 2MKJA 2LEAA 4PXBA 3M32B 2E44A 2WVFA 3IBCB 5J2PB 4DFKA 1TKTA 4DZ6A 5EHHA 1O6XA 2A10A 4NI2A 2DXDA 5GMDA 1UL3A 2FZCB 4UF4A 1YBAA 3TUZC 2Z2ZA 3LA0A 2FY8A 1APSA 2WZ1A 4AT1B 4A8FA 4ZCIA 2LKZA 4OQJA 1YJRA 1ICEB 3BYRA 4DQSA 3OXLA 4UY8T 4UOCA 4ECYA 2PMWA 4F4YA 3AJDA 4LUBA 2VHGA 4HI2A 3UO0A 4OI0A 1C2PA 2M0GB 1ZPVA 1EKRA 5CCMA 3M4XA 1KEKA 1KP6A 3OLBA 4Y28C 1S4EA 2ZKUA 5HLFB 4YR2A 1CQMA 3CO9A 3KLGB 4CO0A 4UT4A 2JC1A 4C2MA 1LEOA 1VOMA 2OEMA 2MLZA 5J2QA 1Y3KA 2XMJA 2XWXA 2OUGA 1B0VA 3RBDA 3W2VA 4A8XA 1M5PC 2EXUA 4ZHRA 1NJIT 3D1OA 1P1LA 5IT4A 3MTKA 2X3DA 1JLEB 3UFCX 2M52A 2P9GA 2I5JA 1VQSA 1DJ0A 1VI7A 2MKKA 2LQBA 2W24A 4FZVA 4USHA 2L9WA 2A18A 3NLCA 4KFBB 5KFMA 3AODA 2BE9B 2P9CA 4DG1B 4G1PA 5T14A 2IBKA 3M8PA 4ES3A 2QLWA 4OZ5A 3IR7B 3W8PA 2U2FA 3MR3A 4FNIA 1U45A 2OEJA 3ZZ0A 3GONA 4PWDB 4BWJA 2GIQA 4M5GA 3IR6B 4OIXA 5FD1A 1VLYA 1PJ6A 5KG1A 5KFCA 2DHHA 1FRMA 1ZTTA 3KDNA 1IBMJ 4LSZB 3O6QA 4J5OA 1T9XA 2WTFA 3ENVA 1WG4A 5ETMA 3RAXA 4LF9F 5L1LA 4YR3A 3TZXA 3GR1A 1TMMA 2XLIA 4RU9A 5B0FA 3BKFA 2VF3A 2P8IA 4TY9A 1D8ZA 4I69A 2A2CA 3GIRA 1JLGA 1IJFB 1PC5A 3N4WA 1Q82T 1MLAA 5DQIA 1WELA 2MKSA 3PX6A 1IN0A 2EI5A 2FLNA 1UWBA 4JI8F 1VBYA 1ELOA 4ALZA 4U8YA 1NK7A 4F36A 4KH1B 1HKAA 3KHHA 4X84A 4MK7A 3VVTA 2XS5A 5FDLA 4GVBA 3ZZOA 2PFFB 4ECVA 4A8KA 2IVYA 3CCVS 4ED5A 1S49A 1NJXA 3D2WA 5EX3A 4QJVA 1KONA 2M9KA 1SC4B 4P7VA 1S7IA 5KG3A 1RQ0A 3NS6A 4NLVA 4JV1A 4WKRA 1BY9A 3MCMA 4ZA1A 4ELVA 3AY0A 4ILLA 3TVZA 2CUYA 3W66A 2XMMA 4D3GA 4CLSA 3H90A 1HR0J 1VRTA 2KO1A 5LMNJ 3QGGA 3CMAS 1P27B 3MAAB 1VDHA 3OUYB 2V9WA 3HKWA 1U1OA 4A4JA 5AXMA 1FJEB 4B3OA 1TL1B 2IHR1 4L72B 4DS5A 2BJ9A 3PYGA 3Q8SB 2XMUA 2GQQA 4WE1B 2AYMA 5IT0A 1J5OA 3C6UA 5C25A 2DNHA 3NWGA 2FVCA 1N0VC 3C19A 2GIRA 2MQPA 1HQEB 3DU5A 2OAUA 4P2XA 1UJ4A 3FMBA 3BGFA 3KXDA 5K8PA 1JLQA 3TX0A 4WIQA 3RW6A 2RUSA 3AT1B 3PW7A 3M30B 4LF4F 1RADB 3PRBA 4IG0A 1Q7LB 1XIQA 2MQQA 1OYEA 4C8OA 2JL9A 3FCVA 4PRFA 1TKTB 3LGMA 4PXDA 1S48A 4NI2B 4QR2A 3CCJS 4CLTA 1QAJA 2FY1A 3IGNA 2YKQA 3CPWR 2QLXA 1Q5YA 1C0UA 3TARA 2NR0A 1G1XA 2ASYA 3UCZP 2YKAA 3HVWA 3E51A 1ZPWX 1UJ6A 3TNVA 3D6HB 2VDIA 3VAJA 4OFZA 3EVMA 2E1MC 4EYHB 5LSOA 3IS9A 5HJXA 3BYPA 1M1KT 4LRDA 2AF6A 1T3NA 3IR5B 2R7RA 1F3VA 2KRRA 3DU6A 4NRUA 1FT8A 3PTWA 3P3DA 3QIPA 5J2QB 2M88A 3T1YF 4K4SA 2DR8A 5B0CA 4XPEA 4PEOA 4F4XA 3BPDA 4RO0A 4PXEA 3RRGA 4LIWA 3W2VB 4R0EA 5HN0A 3KLEA 5IV4A 1TUVA 1SUQA 1YBUA 2IMWP 2A0FB 4ZHRB 4NXMF 2CDRB 2F7VA 4X62J 3JSRA 2XY5A 3JQMA 2I5JB 1T03A 4WCEQ 4ZIVA 1FD2A 3LUYA 4QPTA 1N6QA 4Q8EA 4Y2KA 1H2TZ 5E2QA 2DR7A 1SC3B 1QUVA 2D74B 3BBBA 2X1BA 3SFGA 1WC0A 1NK4A 3NGUA 4J9SA 3M8PB 2OD4A 5F3ZA 4V19J 2YXLA 5DDOC 1QTNB 2AU0A 1VQ4S 3OTEA 4DSJA 1UPMB 4I6AA 3PY8A 3M8ZA 2JC0A 3H59A 5KFBA 4QCLA 5AE2A 2R2RA 1ITPA 2XLKA 5I3QA 3W61A 4KGKA 5F9NA 4ID8A 4ZP7A 3KK1A 1U1RA 2QO3A 2RAQA 3UNGC 1YITS 2XBPA 2BW2A 3THPA 1VIXA 4PWWA 2MQLA 4JB8B 2DH8A 5KTQA 1JLGB 2V4QA 2YNHA 3GV8B 1YDLA 2C2ZB 1SC6A 4WXWA 3NEKA 2RDDA 5KT4A 1UWBB 1S9GA 4BDPA 4PG5A 3RRKA 5CYQA 1YJUA 1UZDA 4ZPAA 4UZBA 4QIEA 5FDLB 2AT1B 3FCWA 4GVBB 4IKAA 2B7BB 4FKYA 4ZLNA 1T9TA 2M3DA 3DOLB 5ETRA 4OX6A 4DV4F 4ZLPA 2VG7A 3U1LA 2V4JA 3DYAA 1VQ8S 4JV2A 3AOAA 3H25A 5KFRA 2K3KA 2RDJA 1RUSA 2DIVA 1RWVB 1WNEA 4DX6A 1VRTB 3V4IA 3FDSA 3G86A 2IBOA 4CH1A 1HNIA 4UZCA 2DO4A 2CQBA 1K1QA 1IBMF 3HLUA 5D15A 3OLAA 2MZTA 2MQMA 4DF8A 2RS2A 4B3OB 4FYWB 5FIIA 3IC1A 3HX9A 5E0OA 1ZA2B 5LSLA 1H0HB 3OD2A 1J5OB 3C6UB 5C25B 1S6PA 1X31C 4QPXA 3IAM9 2CQCA 1SXLA 4USIA 3OJUA 5CZXA 4I2PA 1X60A 5LSRA 2XLJA 2HK2A 3W62A 1JLQB 4TYAA 3D1HA 3G8QA 1JK9B 3AQPA 4IG0B 3BM7A 4ETZA 2HHQA 4XK8C 1YVFA 3CJ4A 2FB0A 2HQ3A 5L46A 3KWMA 1HYSA 1H72C 4DL4A 2V34A 5CQGA 4TU8A 5BYQA 3EVWA 2AJ0A 2CWKA 1C0UB 3DKDA 1T02A 4B3RJ 4WJBA 2FJXA 3EXCX 1HR0F 2DEIA 2AIRB 3EZUA 3NY0A 4DSFA 3QT6A 3MR5A 2AGOA 4KO0A 4OHVA 4DR3J 3IS9B 4TQSA 2XZWA 4LBIA 1AA1B 3NMRA 2EK1A 3HDSA 1WKLA 8RUCA 3FSYA 2XO6A 3BF4A 4GRSA 4D3HA 2J9DA 3OL8A 2DO0A 4M5DA 1KOHA 3RTVA 2MZSA 2IFXA 3FKBA 5IQ6A 5GADI 2W2PP 3KLEB 3Q89A 1SUQB 1U48A 3HT0A 3NCQA 4Y2IA 2OP5A 3KLFA 1B7FA 2HS4A 2AJ4A 2CQ4A 3CJ3A 2R7UA 1T03B 2WVEA 1KS2A 1N6QB 3BQ1A 2QA1A 5DS7A 5A8KA 2QYCA 2RILA 2P6TA 3TUPA 1PKUA 3FQLA 4DV3J 3LWMA 4C3LA 4JI5J 4C8ZA 1X4HA 3TAMA 1XMQJ 5FLXY 3H8YA 3I82A 4FN5A 3KG0A 2BBEA 2L48A 1M5SA 4F0MA 1O5JA 4WFZA 1I51B 4X4NA 3ZFVA 4Q2LA 2V69A 1Q0NA 2CPHA 5C2GA 5M2UA 4OLPA 3RUBL 5K9FA 3G9CA 2YTCA 3TI0A 3R7BB 1YI2S 3VWSA 1CJTA 2Y3YA 3KK1B 1WEXA 2F1FA 1YLXA 3V81A 2FZGB 3O5TB 2VG5A 2JEFA 5ETOA 4ECTA 1FKAF 2VICA 4IOBA 4DV7F 2YNHB 1FKOA 2G4BA 4DLEA 5EN1A 2YNIA 4DX8H 4NMXA 3HT3A 3GIKA 4DR2J 1D9DA 4JI0J 1DQAA 4CO1A 2GO8A 3AB4B 5CYQB 5K14A 4ER8A 2BKOA 1HHQA 1HIYA 1ACMB 2W4PA 2ZM6J 2EFVA 1EHWA 4B9MA 2HRUA 2KZMA 1DBDA 4ZVUB 3PIPQ 1SKUB 1UKUA 4PKDB 3ZTRA 2LU1A 2VG7B 3DYAB 6FDRA 1FEEA 5D0GA 2ADCA 3DHWC 3K58A 2J9EA 3G71S 2B4UA 3V4IB 3H20A 2HGMA 1S1WA 3DMJA 3FSXA 4NXNJ 1HNIB 1WC6A 4HT7A 5HK4A 4GC6A 4HYKA 1WOSA 2NXCA 2LQ5A 1FFSB 4IUFA 3N79A 1UAWA 3BGRA 4P2MA 2GMHA 3VQSA 2H5JB 5AXNA 2C42A 5DDQC 3IXQA 1HA1A 1S6PB 1JIHA 4ZN1A 3P8BB 4CO3A 4I2PB 4CH7A 1NK0A 3ZNUA 2UUAJ 4WZMA 4DUZJ 1MROA 3J80Y 5SZTA 2OD6A 4JUZA 2XGQA 3BH6B 2CPYA 5T41A 4DFPA 3FMWA 3E3XA 5F8HA 3AFGA 2DXEA 2HS0A 4YB5A 1UEVA 1ULRA 3C14A 1SCJB 4WTYA 4DV1J 5KG5A 4CLYA 2VC0A 4FS2A 1LW0A 2MJUA 3HPOA 5F8GA 5EWEA 5L1IA 1T3OA 2FJVA 1HYSB 5JJBA 4J9QA 1RT4A 5F8LA 3KJVA 3DN9A 4DFJA 3QSYB 3NWRA 5FJ4A 4RL1A 2XNRA 2M5YA 2BZ2A 2FIUA 3JXOA 3J81U 2XHCA 2G2OA 1X4AA 5CD4H 1XMBA 1TR0A 1S72S 1S0OA 4OJ1A 1UTAA 2AX1A 4G1IA 3MM5B 4KO0B 4HACA 3G8SA 3CIMA 4K2XA 1RT7A 2CNOB 3QO9A 1M0SA 1NSAA 1LFPA 4EO6A 1U0HA 1X5SA 1GTEA 3AXMA 2R7SA 1U26A 3T6JA 3MR6A 2V8DA 2IJNA 2R7TA 1NDCA 1U6FA 1DRZA 4DCJB 2GC8A 2NCKL 2DNRA 3W8GA 4DLGA 1B64A 4M5DB 4RUBA 3PNIA 5MLCV 4FYXB 3AH6A 1JXVA 4DDFA 4C8NA 3NGDA 4HHUA 4WYLA 1NU4A 5DG7A 3NAIA 2EK6A 4LRAA 2KG0A 3KLFB 1VRQC 1U1PA 3GG0A 1VJQA 2ZITA 1HW9A 2ZDOA 3HD2A 2ZUAA 3BSOA 1X5OA 3DLJA 3P49B 1Z4UA 3G96A 5A8KB 4JI2J 1PAUB 3MR7A 5E33A 4RBVA 3H5SA 4U67Q 2HK3A 1PYOB 3IN5A 2V50A 2DD8S 3ZZTA 3GFXA 4Q7AA 4O3SA 2BJ3A 4DCOB 3MPWA 3TAMB 3N6LA 3TZZA 4X64J 5A8WA 2KXNB 1JLCA 4B3RF 1IBKJ 4EBCA 1L3SA 3TR5A 4X66J 3UCGA 2K3IA 1YRXA 4DL2A 2ZBCA 3FEZA 1AW0A 4ID5A 3MOJB 5KG6A 4ED2A 1YX2A 1Q86T 2K06A 4XTTA 3D3CJ 3M2UA 5I4MA 1C1BA 2RF2A 4C98A 2FGCA 1ZOTA 2ZZNA 4O3RA 1IM6A 2V0NA 1CJTB 4CCHA 2DPIA 1WD6A 3PM9A 1IR0A 2E1CA 4Q0BA 1VK8A 2APOA 4IH7A 2R8JA 3V81B 5AXLA 2HHHJ 1N32J 2VG5B 2W9BA 4BC9A 3KK3A 3ILLA 3K57A 3R7NB 7FD1A 2F4FA 3W63A 2QSFA 4CO2A 4BC7A 4MJKA 3SCJE 4XIUA 1FKOB 1TL4A 5HMYA 1WC4A 1XR5A 1N88A 5A76A 6FD1A 2YNIB 4GKJJ 4NOHA 1UVMA 1VQLS 2H3EB 2K1RB 3TQ1A 2VB6A 5HQMA 5ETPA 4FXDA 4USKA 1WHYA 5DO2A 3HSJA 3GMGA 4ZVFA 1WACA 1Q5VA 5K14B 4DCPB 4K8RA 3CD0A 3DOKA 4DV3F 1RHUB 3FNNA 1Q95G 1V6HA 4PUOA 4C97A 4JI5F 3RB4A 2R2SA 1X0FA 1EKSA 1D09B 2K7KA 3CDEA 2HVIA 1W26A 1XMQF 4B3MJ 2V8PA 4LFBJ 3R9LA 1UEKA 2NLWA 3CE8A 1CULA 1QDUB 4JI1J 1CJKA 3C2PA 4NLPA 1S1WB 3DMJB 1X4CA 3CCSS 4YP3A 3U27A 3HXMA 2JWNA 3MUMP 3BBCA 2ZWOA 1J27A 3KMQA 2KM8B 4RW4A 3BGRB 1JXLA 3VV2B 3KNAA 3HD1A 4OZLA 3MTJA 2Z0GA 1F9EB 3M9OB 1H74A 1U47A 2LP4A 4WIIA 2X7IA 4RW8A 2GJFA 2KXFA 1ZETA 1MROB 5D78A 2VQEJ 4DR2F 4G3IA 2CKWA 2UZAA 4JI0F 2VPXB 2UVWA 4ZN3A 1XR7A 2VV5A 1QE1A 3TZWA 5L1JA 3E8OA 4H4OA 4OYOA 2HIQA 2Y0BB 3C14B 4WXOA 4C3KA 2R42A 2ZM6F 1KHWA 2RU9A 1YJNS 3NNHA 1LW0B 1JKHA 1FI4A 1SB6A 3H2UB 3MD1A 3FEYB 4HL9A 1H6KX 3KJVB 4Y34A 4GC7A 2YPYA 1M5HA 4KH0B 2R2TA 2B8QA 2DNZA 4ZK7M 1H7XA 4KGZB 3U1MA 4OZ3A 3JSMA 4NLRA 2VFRA 2BXJA 3PYEA 4OJ3A 2X3GA 4NXNF 1K1SA 4HACB 4OI4A 5KFLA 1RT7B 2EBGA 3QO9B 5F9LA 4OZNA 3GTYX 1U0HB 2HEKA 5KOXA 1RHKB 2EEYA 4IRKA 1LWCA 3I9V9 3B4DA 1RTIA 3Q0AA 3OTBA 1WHWA 2UUAF 2QL5B 3PRDA 5M2PA 3CDAA 1KTQA 4B08A 3PX4A 2JFDA 2NZ4A 3B78A 1UVKA 3DXBA 3SZ2A 4G1QA 2HAIA 3K5PA 5H9EJ 3AOBA 2A6MA 4CLLA 1KR4A 1FJGJ 1HQUA 4QYZK 3MFHA 1T9YA 2LXIA 1S97A 2HQDA 4IR1A 4DV1F 5DZ7A 2ZZTA 1OPZA 2WSEC 4CP5A 1YJVA 1U0SA 1N5QA 4MYUA 4OZ0A 3FJ2A 3MZIA 3DM2A 2AJ1A 2CQGA 1QVFR 4C6AA 3IRXA 2D69A 5A8WB 1JLCB 4DV5J 1RZMA 2E9TA 3GYGA 2BVZA 2MZ1A 3WIVA 3GV5B 3E01A 4ID5B 2YKOA 3MEEA 1CS4A 2HBZB 2JLGA 1Y10A 2HVZA 3M2UB 2A2DA 4HR2A 3N6NA 4F4ZA 4KHRA 1C1BB 2V68A 2RF2B 2YWHA 1KNZA 3LAMA 3HULA 2H51B 3DDIA 3LF0A 5IC6B 4Q0BB 3NOGA 1DHMA 1FRXA 1RCOB 2IDEA 2GJ2A 4N8OA 2DHGA 3RYLA 2W9BB 3KK3B 2G1HA 3VAFA 2D3OR 5DLGA 4LQ3A 1SL0A 4AL6A 2GHVC 1RT1A 2YQ0A 4KKOA 2XMKA 5HVHA 2CFXA 2SXLA 3GPAA 4AL5A 3H40A 3OFFA 1S0NA 3FBEA 3RB0A 3THTA 1W2BR 1GMUA 2YX1A 2JEJA 2WW4A 1KTVA 3CMQA 5HROA 3D0GE 4W98A 1ZBTA 2ZBPA 4ZOSA 4JI2F 3IP0A 2UV8A 1S10A 2R7VA 5IV3A 4B9LA 1YBTA 4PUOB 1QTMA 1PO6A 3Q86A 5K20B 1NB2A 3C6TA 2K2PA 3QIDA 3PW2A 4M5JA 4U7UK 4X64F 3K17A 2H4WB 1RAAB 2KFZA 1IBKF 4Q5VA 2ZOFA 3N0VA 4J90A 2GA7A 4X66F 4F7VA 3TQEA 3MURP 1UFLA 1CULB 3G6YA 1WTFA 1CJKB 2HLUA 2RIJA 3ET6A 1NAQA 1UVIA 4KPCA 3UR3C 4RKUC 2QA2A 1QAYA 1NK5A 2D9PA 4MK8A 5J2NA 5IWAJ 2F4VJ 1S9FA 4RW4B 3R2DJ 4OL8A 2HHHF 3M8YA 3Q2TC 4N47A 5J1PA 1N32F 3B4MA 1JB0C 3Q8YA 1KLNA 2KU7A 1UETA 4RW8B 3VGVA 1RWKB 4FS1A 1LXJA 4CDIA 4GKJF 3WQPA 3HI9A 2KT2A 4DSEA 4K5SA 3GG1A 2MB0B 2ERRA 1RWWB 3QNWB 4YQWA 1U6BA 5LL6d 3DLEA 2BYCA 5HVGA 4YB6A 1QE1B 1E6YA 2CADA 4H4OB 2KVIA 3NKYA 4OZ2A 2XCAA 2GIFA 3BO3A 1JKHB 1RJJA 1WG1A 3FK4A 1GXTA 4B3MF 4RJVA 4V1Ak 4LFBF 4OYZA 5ADZA 2UUBJ 2AJFE 3JSMB 2XS7A 4JI1F 2JEGA 1XBWA 3NRBA 2LQ8A 5L9XA 2RU3A 3H0PA 4R25A 4LREA 2IM2A 4C9DA 4DS4A 4R5PA 1P6TA 1D0EA 1H2VZ 2OFGX 1L3TA 5HATA 2C2KB 1SBRA 1S1XB 5D6GA 3V6JA 3PXGa 5KFOA 1XK8A 4OZJA 2LVWA 1LWCB 1EIYB 1RTIB 2CYYA 2EPIA 4ANDA 4A8OA 1HMVA 2RMLA 4QIFA 1JNRB 4OI2A 3P5TL 2GW8A 3IWNC 2YH1A 2Y8YA 1X4FA 2VQEF 1YIJS 3I0SA 1PC4A 2V63A 3DLKA 2QFJA 1HQUB 3HCXA 3KUHA 2XYGB 1T11A 3EICA 2UXDJ 5DJBA 3MR2A 1IJEB 1S5ZA 4RNHA 5IZHA 1HD0A 2HAFA 3DM2B 1GNKA 3WZ0A 2HFVA 4AQYF 4UQTA 4CLFA 3IRXB 4M5HA 5HL7Q 3FGVA 5CXTA 4OX8A 3R5BA 4NE9C 4ECXA 1FNOA 4DSKA 2P9EA 3OFGA 1EX8A 2CVIA 3E01B 1D8YA 3B8HA 3MEEB 1CS4B 3MDFA 4NLWA 1G2EA 2DRDA 2CZ4A 2HS3A 2F9DA 2H65B 1C4AA 3MEKA 1LFWA 2BJ7A 4RNOA 4RR5A 1WF2A 2C2RA 3IRWP 4HDHA 5F0WA 3GE9A 3A3NB 4TNOA 1RT1B 2B9XA 1RAJA 2OPQA 2IVMA 4KR0B 4KKOB 3HVTA 3C46A 1RHJB 5B0BA 4KHPJ 2RHSB 3Q8QB 1Q53A 2ASJA 3K7RA 1P9QC 4LFCF 5HROB 3WHIA 5GAEU 2MZJA 2PMHA 4IRDA 1U1LA 4QWEA 3O44A 4HLBA 1RDRA 3W5ZA 4QWCA 1NEEA 4LMZA 3CT9A 2Y8WA 2D3ZA 2E7VA 4QW9A 1B3TA 3ISZA 2H5IB 2FLOA 3VGUA 3C6TB 5ETSA 4DV5F 2YQ1A 3HHKA 4A8MP 2PD1A 5KG4A 4C4WA 1S12A 4USMA 2NPIA 2WOMA 2CIMA 2ZBRA 3OVBA 3ET6B 2BJ1A 2ZD1A 1S0MA 1KD1T 3TJ8A 1VQNS 1IXKA 1URNA 2CA9A 4KJIA 3TA2A 4BBYA 2DHXA 2O5DA 4WFAQ 2CPFA 2FC9A 1R8AA 1X9SA 2AYGA 5J2NB 1TK5A 4X4SA 5F8NA 1HD1A 2FVRA 1UMJA 5JVHQ 4JI7J 4JYAJ 2ALZA 3UDVA 2HNZA 5D0HA 3HJFA 4Y2AA 3J7AN 2ZJPQ 1OQ3A 5KFHA 1WF1A 3ZTSA 2DY9A 1IBCB 3R5DA 3EPGA 2H1YA 4CO4A 2V2QA 4NASA 3F73A 3AOCA 3CC2S 3DHXA 3DLEB 4DPTA 5ETNA 1D9AA 1E6YB 3A3OB 1GFWB 3CD5A 4KSEB 4EO8A 1Y11A 1NO8A 4Q2MA 3PKYA 1J2VA 4ELTA 2ATCB 3BR9A 3MPDA 2DHAA 5D8HB 2F8MA
chains in the Genus database with same CATH topology
4OX6A 4DV4F 2WSFC 2FHJA 4ZLPA 2VG7A 3U1LA 1UA0A 5AE1A 4X4OA 2HMIB 2V4JA 3PEHA 3DYAA 1VQ8S 4JV2A 3OJSA 2LEPA 2VOPA 1SJ1A 3BS9A 3H25A 1CQNA 4QYRA 4WFXA 5M2RA 5KFRA 2CQ2A 3AJ1A 2FVPA 1R8BA 4C8LA 2KT5A 4KV8A 5GAHI 2K3KA 1HW8A 1RGVA 5CYMB 5E3PA 2ZH3A 2RDJA 4FF1A 2KDOA 2B51A 2DIVA 4R5PB 4H4KA 3PVXA 1WNEA 3PIOQ 3T9NA 3KMSA 2ZFHA 3W2WB 1VRTB 3K5LA 2ROGA 1LKZA 1U09A 3V4IA 1WHVA 3FDSA 1FVQA 2Q6BA 3SCKE 4QWAA 3J7YI 4XAKA 3G86A 2IBOA 4CH1A 1FKPA 2ZH5A 1HNIA 2OH2A 2J9CA 1W25A 2B6AA 5IWAF 1DAXA 2KI2A 3MM8B 2E7XA 2F4VF 2DO4A 2CQBA 4NYZA 4ZPCA 2UXCF 1K1QA 3HKZD 2EVZA 1RYRA 1IBMF 1KLMB 4Z2XA 3HLUA 1N52B 3OLAA 2MZTA 2MQMA 2YVSA 2OPSA 2R7WA 4DF8A 1U1NA 2FHOB 2RS2A 2AQ4A 4MFBA 2QSWA 1XNQF 1IKYB 4I0WA 4B3OB 3MOZA 1SJFA 5FIIA 3IC1A 3LANA 3TX8A 3HX9A 2FJBB 5E0OA 3FRZA 2Z2LA 3F41A 4J9NA 1LK7A 2EFOA 3DRXA 4RW9B 1E6VA 2DNYA 2OSQA 3T9ZA 3M2VA 4TLRA 5LSLA 1H0HB 1HMVB 3FRYA 1J5OB 3C6UB 5K5MA 3ITHA 5C25B 3CCZA 1S6PA 5K8MA 2VODA 1Q16B 5G0RB 4QPXA 1VC6A 2E5LF 3IAM9 4IH5A 2CQCA 3NNAA 3UCUP 1SXLA 4USIA 3OJUA 3V2UC 1RISA 5CZXA 4I2PA 1V3ZA 3HVAA 5LSRA 2XLJA 4O3NA 1U49A 3OXFA 1QAIA 2OPRA 3I0SB 1FDNA 5HMZA 4WYWA 4IQMA 3F44A 3JB9k 2EG1A 3MPVA 2HW3A 5IT9Y 2MHNA 1HWKA 2I2YA 4J9KA 1U2RA 4N41A 3OPKA 2Q66A 5J1NA 2AD9A 3DLKB 1JLQB 4TYAA 2FJDB 3D1HA 5HMWA 2DNKA 3G8QA 3QZ7A 4UY85 1JK9B 4E98A 2O01C 4ZP6A 5KG0A 2J6SA 4JI3F 2E29A 4NMLA 4C0HA 3BSCA 4ECZA 3AQPA 4OHZA 3SSRA 4IG0B 3FCHA 3LPYA 2OKQA 2KJVA 3UDCA 3BM7A 4KBIA 3CJKA 5KT3A 4ETZA 2HHQA 4LT6A 4XK8C 3TAQA 3KKFA 1HBUA 3QJJA 4O4GA 1YVFA 5HBMA 2E1AA 3IAS9 2EW9A 2HHXA 1RT2A 3CJ4A 4ZPDA 2FB0A 2GGPA 2UUTA 2DNQA 2HQ3A 1RI7A 1LOUA 4ZP8A 5HQ8A 3BSNA 1YG0A 2G1DA 2LDYA 1BD6A 3KWMA 1HYSA 2EFGA 3HF5A 4DL4A 4ECUA 5A8RB 3CIZA 5CQGA 1LW2A 4QQBA 4DR3F 1SL1A 2UUBF 5KFGA 4K4TA 5L8RC 4TU8A 5BYQA 3BSAA 1AFJA 2YKNB 5I3PA 1C0TA 2XMVA 2AJ0A 1LWEA 5KFJA 3J81Y 4DL7A 5LXYA 2MY7A 4WU2A 4LQ9A 1C0UB 1AFIA 1O51A 2BOPA 2LEBA 1T02A 2CQHA 2XHWA 4WJBA 4ECQA 3CCLS 1EETB 3VZHA 2BRLA 2LA6A 5GAHU 4QIWD 3JYTA 2FJXA 3HHLA 1BWEA 3KLIA 5KT2A 3EXCX 5B09A 1HR0F 3VAKA 1REVB 4DBQA 3K5OA 3HHEA 4ZCLA 1FRKA 3DFEA 3KNGA 4ZCMA 3J7YU 3EZUA 4DSFA 4PG4A 4BS2A 3MR5A 2B9YA 2AGOA 5DETA 4KO0A 3CCMS 1TKXA 5KG2A 4AYBD 4C0OC 3MM7B 5T7LA 3DOLA 4OHVA 3UI3A 3IS9B 4TQSA 1LV5A 4K4ZA 2XZWA 5C5JA 2IYGA 4NLUA 3TW0A 4J9LA 4I68A 3S6EA 1Q81T 2W9CA 3MECA 2IJFA 1R8CA 2FLLA 5B0AA 1ROFA 3NMRA 2CPZA 3BN4A 2EK1A 3HDSA 1HL6A 3SV3A 1VMBA 4YUDA 4NYOA 5H1SV 1JX4A 4DWIA 2OPQB 4GO5X 4MIBA 4F25A 4QR0A 3FSYA 3DLLQ 3HVTB 3BF4A 2COLA 2UVUA 2YNGA 2DR5A 2NQPA 5D4LA 1EP4A 4U6PA 3P96A 1R0AA 1T8EA 3VCDA 4QWDA 4F02A 4QYZJ 2ZHOA 4D3HA 3RZAA 1NH8A 2J9DA 3OL8A 3T3FA 4B3TF 2DO0A 2O1PA 4M5DA 2BE2B 4YHHF 3OL6A 3SQGB 1K8AT 3QAEA 1KOHA 3RTVA 2CJKA 2MZSA 2IFXA 5IQ6A 4RNFA 4O3OA 4NLGA 2KH9A 2XGPA 1KHVA 5GADI 2IMOA 3R5CA 1S9EB 3KLEB 3M9NB 1SUQB 5A6WA 3ICLA 3M8QB 1P8GA 2HHPA 4IFYA 1U48A 3NCQA 4Y2IA 2OP5A 2LLZA 2XEXA 1ZM3A 4ILRA 2DGOA 2LQ9A 4ZVEA 4MH8A 3Q8RB 2D1CA 1D9FA 3W7BA 4B9UA 3KLFA 1B7FA 3MM6B 2HS4A 2HHSA 2BACA 2X51A 2AJ4A 2CQ4A 3T1HF 3CJ3A 2UXDF 2R7UA 2CPIA 2DNLA 3UD3P 1T03B 3J7Z5 3Q8PB 4ED3A 1KS2A 2R9LA 3BQ1A 2QA1A 5DS7A 5A8KA 2QYCA 1N6QB 2RILA 1QSSA 2V9KA 2X1GA 3OR2A 3DOMA 3AB2B 2P6TA 2HFNA 3CEDA 1MU2A 2B56A 1BC6A 4YOEA 1C1CA 2HVHA 3FQLA 5E3CA 5E3QA 2IYIA 3U7JA 5A0YB 2FHJD 4PG7A 2C3YA 3EGNA 2JLEA 3TVKA 1UFWA 2CPJA 4L3NA 4WU3A 2QA4S 1U1QA 1IKWA 2PA3A 3LWMA 1SJRA 3UR0A 4C3LA 2NUHA 1N56A 2VFUA 2W25A 5EX0A 5IQQA 2WOMB 1X4HA 2WAQD 4RUAA 1S6QA 2RQMA 2MZRA 3TAMA 3OV7A 4C8ZA 4LIRA 5KOWA 4KT0C 4M8LA 2RJZA 4NA3A 2J7KA 4RUHA 4HH0A 1SIZA 3N6MA 3SDEB 5FLXY 5B0GA 3ISND 2ZD1B 3H8YA 3I82A 5L39A 1XN9A 4ILMA 4FN5A 2FDNA 2M7SA 2ZBIA 4TXSA 3KG0A 2BBEA 3OTDA 4N5SA 3TUIC 3SSSA 2L48A 5BYSA 4ZPVR 5GAGI 1M5SA 4F4WA 2HHUA 4FBUA 1O5JA 4WFZA 2CPXA 2JVOA 4X4NA 3ZFVA 2DNNA 4Q2LA 3T5LA 5KT6A 2CPHA 5HP1A 2HWTA 5M2UA 4OLPA 5L38A 2ZKTA 5DG8A 4M1KA 4EYIB 1JLFA 2WHOA 1SH2A 4EBDA 5IXUA 3I56S 4OJHA 5K9FA 3ZZZA 3G9CA 1F0XA 2YTCA 3TI0A 1HI1A 1CC7A 2V5HG 1MMLA 1FTRA 3VWSA 1YI2S 3KK1B 3SSQA 3I5CA 4IDKB 3DRSA 2W7OA 1WEXA 3F56A 3LOUA 5F8JA 4Z37A 2F1FA 2HNZB 5KT5A 3V81A 2RQKA 2OMOA 4ZCKA 2W7PA 4XDDA 3O5TB 2VG5A 3ZZYA 2VBXA 3MMBA 1QLNA 1CLFA 1RT3B 4U9RA 1HBMA 2QZ8A 2JEFA 3HHNB 4M63A 1BQNA 2KKHA 4ECTA 1FKAF 3TA0A 4I1TA 3SYZA 2JDJA 1SKSA 1FRIA 1TVRA 3DNCA 2H5EA 2YY3A 3I31A 3JTPA 4FXWA 1Y7PA 1WI6A 4IOBA 4K4WA 4DV7F 2YWGA 3I96A 4KHPF 2YNHB 1FKOA 4DR6F 3TRGA 1S7HA 2G4BA 2W4CA 2KTQA 4DLEA 3SFUA 5EN1A 3M1VA 4PPDA 1S1TA 2DIUA 5GADU 1S77D 2YNIA 3DGPA 5LT5A 4DX8H 3HT3A 3CJ2A 2UVVA 1RT4B 2CJBA 5J1EA 1SIWB 1ZZFA 1PGZA 3AA8A 3PJWA 3GIKA 3MF5A 2VBWA 4ECSA 1D9DA 2HHWA 2OLWA 1DQAA 3TYTA 2LU2A 4CO1A 2LQJA 3LH2S 2GO8A 2GV1A 3QLHA 2OFHX 3AB4B 5CYQB 5K8NA 3UPFA 5KG7A 5K14A 3GYNA 2B4VA 1QJHA 3MAHA 4CNYA 1X5PA 5KFYA 2KRBA 2OIHA 2W4PA 1HNVB 3N28A 2EFVA 4I4BA 1F9FA 4B9MA 1U2FA 1DQ8A 2HRUA 3DDNA 3IG1B 1NK6A 2KZMA 1DBDA 4PR6A 3MM9A 2B43A 2R8IA 2YNFA 4MKBA 5JXSA 1NRKA 5F8MA 2OMLA 2Y1JA 1Q79A 3PIPQ 2MMYA 1FDBA 1HWIA 1JJ2R 2KM8C 3BZQA 1UVJA 2DPJA 1UKUA 4PKDB 5KFUA 1PILA 2LU1A 1LQ9A 3HHLD 2VG7B 3MM6A 2PN6A 3QYYA 2Q1LA 1N5TA 3CF5Q 3DYAB 1RA7A 3NGKA 6FDRA 1FEEA 2ZE2A 3LW5C 4IQXA 3M2RA 2DCLA 3JTOA 5U47A 1VS3A 4KV8B 2ADCA 3DHWC 4AE5A 1X4BA 3MMAA 3K58A 2NSCA 4Y2MA 2JFKA 2J9EA 2PE8A 1HBNA 5D4NA 2XMWA 1R8HA 1HBOA 2B4UA 3DRPA 3G71S 2ZUGA 3V4IB 3ZC4A 3CMES 5GAGU 3H20A 1X5TA 3GFYA 2HGMA 1S1WA 4RZRA 3DMJA 3MEGA 3FSXA 2YWKA 1OSCA 1FKPB 2BM0A 1HNIB 1CG2A 2B6AB 2FHMA 4A48A 4OI6A 3LGNA 4DN9A 4USJC 4EU0A 4HT7A 2JZ5A 5KFFA 5EWGA 4GC6A 1VC5A 1CEZA 3HZEA 4HYKA 2UXBF 1Y0HA 2C28A 1BQXA 4FF2A 4DUZF 2LQ5A 1NJZA 4YB7A 2NREA 4IUFA 2OPSB 1X8DA 3N79A 4JI7F 2C3UA 1UAWA 4MFBB 4Y2CA 4NZ6A 4JYAF 1RK8A 3I9ZA 1FE4A 2POKA 1S6OA 1Z2LA 1T95A 3SDEA 3BGRA 3H5XA 2GMHA 3VQSA 1TKZA 4IG3A 4P7TA 1E6VB 5AXNA 2C42A 4K0KF 3M2VB 2DGTA 1ZAVA 3ITHB 5DDQC 3IXQA 1HA1A 1S6PB 5KFPA 4K4VA 2V8HA 1N8RT 3N5FA 3NMAA 1JIHA 2L9NA 1O0PA 4B17A 1YJWS 4QWBA 1X4EA 4I2QA 4OX7A 4O4RA 3O8WA 4QIVA 5THWA 3UD4P 4CO3A 3KTQA 4B02A 1NZAA 4I2PB 4CH7A 1X7VA 5KFDA 1FRJA 4UQGA 1NK0A 4HVZA 4DQIA 3HHDA 4QIGA 3CCUS 2GHWA 2OPRB 4WZMA 1KRPA 2EFPA 2VH7A 5JUMA 4CI0B 1FESA 2BRKA 5CZVA 3DRRA 1MROA 2VFVA 3J80Y 5SZTA 3CJ0A 2OD6A 1N5YA 4JUZA 2XGQA 1NH7A 3T19A 1VQMS 3DCAA 3MUTP 2CPYA 5T41A 3V6KA 1R6YA 2J9DE 4DFPA 2BQUA 3FMWA 1X9MA 2H9ZA 4FF4A 2WBRA 3MGJA 2RT3A 3E3XA 4AUKA 1S1VA 3MMJA 4PQAA 5F8HA 1Y5NB 1U7LA 2LA4A 2WONA 3R1LA 2J8AA 3EX7B 2J7WA 2HS0A 3FFIA 3V6DA 1HHSA 1R3NA 2ZOGA 7FDRA 2XY6A 4YB5A 3CJKB 5A2QY 3CSKA 1UEVA 1FE0A 1ULRA 2LMIA 1RT5A 2M2BA 1Q8LA 1HBUB 4WTYA 4O4GB 3K59A 5HBMB 2RRNA 5KG5A 4MKAA 1RT2B 3M05A 4TYBA 3RW7A 2GGPB 2IC3A 2VC0A 4WZQA 3CD6S 3SCIE 1LW0A 2W7AA 3EZ5A 4FS2A 2RVJA 2MJUA 4IFVA 4C11A 3HPOA 5F8GA 5EWEA 5L1IA 1T3OA 2FJVA 1HYSB 2AYEA 5JJBA 1YSJA 2HFZA 2A1BA 2BUNA 4J9QA 1RT4A 1LW2B 5F8LA 2ZOMA 3KJVA 3R5AA 1KN6A 3DN9A 4DFJA 2XULA 4CTAA 1QAXA 1C0TB 4PCQA 4MKYA 5FJ4A 3CB4A 2XNRA 1LWEB 2ASLA 4NCGA 2M5YA 2CQ0A 4JBCA 2DGSA 1DURA 2BZ2A 2CJQA 2FIUA 1HFEL 2FVSA 3N5BA 4LF8F 4RW7A 3GFHA 1NHVA