4O44B

Crystal structure of hiv-1 reverse transcriptase in complex with 4-((4-(mesitylamino)-6-(3-morpholinopropoxy)-1,3,5-triazin-2-yl)amino)benzonitrile (jlj529), a non-nucleoside inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
427
structure length
427
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title A mechanistic and structural investigation of modified derivatives of the diaryltriazine class of NNRTIs targeting HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 99
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4o44B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44B03
3TVKA 3E51A 2ASJA 1S9GB 5C42B 5I42A 1QUVA 1LWFB 4Q44A 3IG1A 2FJVA 3N6NA 5KG4A 2XI3A 5KT4A 2CJQA 3KLVA 3IRXA 4ECTA 1DTQB 1MU2B 2QE5A 5K14A 4ZMMA 5L1KA 1SUQB 3M8PB 2W9BA 4ECZA 1HQEA 4PWDB 1TKTA 2R2SA 4ZPAA 2IA6A 3DM2A 2WONB 4KKOB 4ZHRA 1BQNB 4K4VA 4EEYA 4IR9A 3JYTB 5KT3A 4YR2A 3Q8QB 3TQ1A 4X2BA 2IM2A 3OLBA 1IM4A 4O3OA 5CYQB 3M9NB 3BGRA 4KV8B 3RB0A 4DG1A 2DPJA 3PW5A 2FLLA 4K50A 3DMJA 3KOAA 1GX5A 4WYLA 4ECUA 4NCGA 3QZ8A 3I0SA 3LAMA 3VQSA 4WFZA 3GQCA 3TAMA 3H59A 1S10A 3KLGA 1RDRA 4IR1A 4EO6A 1REVA 4OL8A 1EP4B 3KLIB 3HHKA 4H54A 4IH6A 3G6YA 4R5PA 1NHUA 2BQ3A 4IFVB 3SFGA 3SI8A 5KFRA 4DL2A 2ZD1B 2IM1A 2BQRA 3NL0A 4IDKB 4Q8EA 5J1EA 2FVPA 2GC8A 5EWFA 3GIKA 2ZKUA 3PW7A 4PQUA 5F8JA 4WZMA 5HBMB 3M9OB 3LAKA 3PVXA 3QZ7A 3PR5B 4DL4A 3CWJA 1RT7B 2IMWP 4K4XA 2XI2A 3HVWA 4LSNB 3MECB 3GYNA 2R2RA 1S49A 1JLQA 2HNZA 4I7FA 3DI6B 3DLEB 5J2MA 1DTTA 3OL7A 1JLGA 2GIRA 4EYIB 4M95A 4DEZA 3T5KA 2FLNA 2ILZA 3LP2B 1SH2A 2W7OA 3G86A 1FKOB 5HLFB 4DL7A 5F8HA 5F8GA 1S1XA 4Y2CA 1S6PA 1N6QB 3M9MB 4ED3A 1D0EA 1TQLA 1TL3B 4H4MB 1HNVA 1N48A 2UVVA 2V9WA 3ISND 1RT4B 3MEGA 3PHEA 3IN5A 5DGAA 1OS5A 5KFLA 4ECXA 2JLEA 4QWBA 3G6VA 2IAJB 4RW4A 1KHWA 4MIBA 3DYAA 5DLGA 3FDSA 1S1WA 1C1CB 3I5CA 3DLKB 2E9RX 5L1JA 2YNGB 5KFBA 5EDWA 4WZQA 1LW0A 3BJYA 1IKXB 1IKYB 5C25A 1I6JA 4HYKA 4WXOA 4TXSA 1HYSA 5F9NA 1T05B 4G1QA 3FFIB 4IRDA 1S9EA 3NBPA 1JLEB 2OPSA 4NLOA 2JEIA 1RTIB 1TP7A 4QWEA 2FJXA 4H4OB 4K4YA 4NLWA 1JLAB 2FVSA 4LSLB 5KT2A 4TY9A 5KFUA 4NLVA 1S4FA 3KLEB 3KLHA 1LWEA 5DG8A 1JXLA 3DRSB 2ALZA 2BE2B 1R0AA 1C0TA 1XR6A 4K4SA 5KG2A 1BQMA 1VRTA 4XPEA 5KG0A 2UVWA 5J2QB 5I3UA 2HNYA 4QW8A 3GIJA 1JIHA 3FQKA 4EBEA 3KJVB 1TV6A 4QWDA 3T1AA 5I42B 4U7CA 4U6PA 3IG1B 4Y34A 4QW9A 1S0MA 5CYMB 4ECRA 3IRXB 5K14B 4XO0A 3MFIA 4RW8A 5KFIA 2W9BB 1C0UA 3RBDA 1HQEB 4K4WA 1TKTB 3Q8PB 1ZETA 4YQWA 3DM2B 4O3RA 2C22A 4G3IA 1DLOA 3C6UA 4TLRA 4KHMA 3UDLA 2AGPA 2R8IA 3KK3A 1HQUA 5F8LA 1RTHA 1W25A 4MK8A 5KFFA 3OL6A 3BGRB 3V6HA 4DG1B 3QGIA 4QWAA 3I5AA 2JEFA 1RT5A 1FK9A 4ECQA 2I5JB 3MEEA 3I0SB 1S1TA 4RUAA 3GV8B 4FBTA 2YNIA 3GIIA 3TAMB 2BANA 2WB4A 1REVB 4ED8A 2J6SA 4ED7A 4F4YA 2YKNA 4KFBA 4R5PB 2IM3A 2QV6A 3H40A 4J9MA 1KLMB 3RAXA 2W9AA 2AX0A 2WHOA 5EUHA 3EPGA 3KNAA 1S1UA 4KHRA 5T14A 5J1EB 4YMEA 1MMLA 5J2PB 4O3PA 4PQUB 3KK2A 4O44A 2IC3A 4K4TA 3PR4A 4F4XA 2IM0A 1RT1A 4ECVA 4O4GA 5KFPA 4I2QA 3H2LA 1ZTWA 4IRCA 4RNFA 2D41A 2ASDA 1TL1A 3FQLA 4IH5A 1RT2A 4NLUA 3DDKA 3NKYA 2JEJA 2HNZB 3MFHA 4DL6A 4I7FB 4ICLB 5J2MB 3QIPA 1DTTB 4NZ0A 4TN2A 1K1SA 4WXWA 4RW6A 1VRUB 3QGHA 3DLGA 4NLTA 3MF5A 3GV7B 5KFTA 3IGNA 4MK7A 2VG7B 2WOMA 4Q43A 1S9FA 1S6PB 3KHHA 4NYZA 4J9KA 5HROA 1SV5A 1S1VB 3H4BA 2HNDB 1JX4A 1HNVB 5KFZA 2ZE2A 3OHBA 4URSA 1FKPA 4Q0BA 4F4WA 3MEGB 1S6QB 4J9LA 5KFNA 2VG6B 3OLAA 2D3ZA 2RF2A 3C6TB 4M94A 2JC0A 3HKWA 5KT7A 4RW4B 5DQGA 2XCPA 3DYAB 3N6LA 2AQ4A 2CKWA 2BR0A 4K4UA 3ITHA 1C2PA 3V6JA 3BSCA 2RKIA 1LW0B 2YNHA 2C2DA 4KO0A 5C25B 3CDUA 1HYSB 4ED0A 1QE1A 4ZP9A 2IJNA 3H5YA 4RNOA 4NLPA 4G1QB 1S9GA 2BRKA 2OPRA 3IS9A 1LWFA 2OPSB 3NBPB 2WK4A 4KB7A 2OPQA 2R8KA 2OPPB 3DOKB 1HNIA 3DRPA 2XWYA 4Y3CA 4ZP8A 1NHVA 1DTQA 2B5JB 4I2PA 5KFWA 4WE1A 1T94A 4ZVEA 2XC9A 3KLHB 1LWEB 5KG5A 2WONA 1R0AB 1C0TB 4O4RA 3H98A 3T5HA 1BQMB 2UUWA 1S0NA 3CJ4A 4J9RA 1VRTB 5F8MA 3KLFA 2HNYB 5L9XA 3HVTB 3ISNC 1XR5A 1TV6B 4RW9B 2IJFA 2W8LA 4KV8A 5J2NA 4B3OA 5F9LA 5KFDA 2FVCA 2HWIA 3MR6A 3T5LA 1U09A 4RW8B 3T5JA 1C0UB 2W9CA 3Q8SB 4R8UA 1RT3B 1J5OA 1EP4A 3KLIA 3DRRA 2JC1A 3JSMA 5FDLA 3C6UB 5C24A 4ID5A 2YKMA 3KK3B 2HMIA 3DOLB 1RTHB 3M8QA 3CIZA 4ZVFA 4Y2AA 4ECSA 3LP0A 4YR0A 4F4ZA 1RT5B 2C2EA 5HP1A 5HBMA 3MEEB 4NLQA 1S1TB 3BR9A 3N6MA 2YNIB 1EETA 4K4ZA 4TY8A 4NRTA 2BANB 3OL9A 1RT7A 1LW2A 3G6XA 5F8IA 2UVRA 2YKNB 4R0EA 2FJWA 4LSNA 3EPIA 2C2RA 4ZVHA 3NAIA 2UUTA 3IGVA 2VA2A 3CJ0A 3ICLA 1JLBA 3PZPA 4NLGA 2FLPA 1QAIA 3FRZA 3KMSA 2FVRA 1IKVA 3KK2B 1JLFA 3MEDA 4MIAA 1UWBA 2IC3B 4ZHRB 4FS2A 4IG0A 4WYWA 1RTJA 4ZPBA 5C5JA 2O5DA 1RT1B 3PW2A 4DL3A 1T03A 4O4GB 3KK1A 5DG7A 1TKXA 4I2QB 3V6DA 3MR3A 4J9SA 3LANA 1TL1B 3CDEA 3CJ2A 1RT4A 4YR3A 1RT2B 3CVKA 1RT6A 3DMJB 5KFMA 4MFBA 3QO9A 2B6AA 1RTDA 4NCGB 5EWEA 3QYYA 3QIPB 2UVUA 3CJ3A 4XPCA 4RW6B 3KLGB 1TKZA 5KFCA 4NRUA 3GIMA 3DLGB 3V81A 4WFYA 3OSNA 3KHLA 4KE5A 4IRKA 4JV2A 3PJXA 1HMVA 4O3SA 2WOMB 2XCAA 2GIQA 2WTFA 2ATLA 4TQSA 1TVRA 1SV5B 2AGOA 2ZE2B 4KSEB 1S48A 1FKPB 4Q0BB 2WRMA 3CO9A 4H4OA 5DQHA 3LALA 1N4LA 1LWCA 5KG7A 4MKBA 1IKWA 2RF2B 4NLSA 4EO8A 2V0NA 4FS1A 3I0RA 2XGQA 1SH0A 3ITHB 2HWHA 3RB6A 2RKIB 1Z4UA 4RW7A 2YNHB 4RNHA 4KO0B 1JLCA 4NLXA 3V4IA 3CJ5A 3QIDA 3OL8A 1QE1B 4JV0A 1JLQB 3D5MA 3CDWA 2OPRB 3IS9B 3UQSA 5DLFA 1JLGB 2OPQB 2BRLA 1HNIB 3DRPB 5CYMA 5KFAA 4LQ9A 5KFQA 2JEGA 5KFSA 4I2PB 2VG5A 4WE1B 3KHGA 2YNFA 4NLDA 4IFYA 4IH7A 4J9QA 1S1XB 4URQU 3QLHA 4JUZA 3PJWA 3LP1A 5KFXA 3E01A 1RYSA 1N5YA 1C1BA 1HPZA 1RAJA 4IG3A 4ZP6A 5DG9A 3KLFB 4F50A 5KT5A 2HAIA 4HKQA 4ECWA 2E9TA 5JXSA 4J9NA 5J2NB 4B3OB 3OHAA 2C28A 1JKHA 4ED1A 1S1WB 2I5JA 3GV5B 3EZUA 5D3GA 5EWGA 4PUOA 2RDIA 2W9CB 4NLRA 3BSOA 2R8JA 4KBIA 4R8UB 1J5OB 4QPXA 3DRRB 5C42A 1ZTTA 1S9EB 2WCXA 5KFVA 3JSMB 4ZPDA 1HARA 4Q45A 1KLMA 5FDLB 5C24B 2D3UA 1YVFA 1MU2A 2YKMB 4ID5B 2HMIB 5KFGA 1SUQA 3M8QB 3M8PA 5DGBA 4DL5A 1XR7A 2J6UA 3HVAA 4PWDA 5J2PA 3LP0B 5HP1B 2AWZA 4KKOA 3H4DA 1BQNA 3RAQA 3KMQA 3JYTA 1EETB 4TY8B 5JUMA 2AGQA 5I3UB 3NAHA 4RUCA 1LW2B 3BSNA 5CYQA 3GILA 1RYRA 1NNDA 2I1RA 4EYHB 2DPIA 4O3NA 5KG3A 2R2UA 4J9OA 2AU0A 4TYAA 4WFXA 4ICLA 4O3QA 4RNNA 4J9PA 4IQXA 1JLBB 3BQ0A 3NGDA 3FSIA 3PW4A 4IKAA 1VRUA 2E9ZA 4RZRA 1D1UA 1IKVB 1JLFB 3MEDB 3BREA 1UWBB 1SH3A 5KFJA 4RNMA 4IG0B 2VG7A 1RTJB 1RA6A 4IFVA 5KFKA 4JV1A 1T03B 1DLOB 4ZVGA 2D7SA 2ZD1A 1S1VA 3KK1B 1TKXB 2HNDA 3V6DB 2AX1A 5KFYA 1HQUB 4MK9A 2XGPA 4EBCA 4NLYA 4URGA 4ED6A 4IOBA 4IDKA 1S6QA 1RT6B 2R2TA 5KT6A 4MFBB 3QO9B 2B6AB 2VG6A 1RTDB 4RU9A 3MR5A 1FK9B 3C6TA 3V6KA 3UR0A 4GC6A 5L1IA 5F8NA 4ECYA 3SFUA 2J6TA 5DQIA 2W7PA 1TKZB 2V4QA 3V81B 1HMVB 4KFBB 2OH2A 3UPFA 3MECA 1TVRB 3DI6A 3DLEA 1GX6A 2OPPA 3DOKA 2FVQA 2ILYA 1S1UB 3LP2A 3PW0A 2B5JA 3H5UA 1QAJA 1LWCB 3I5BA 4MH8A 1FKOA 2BQUA 4O44B 2B43A 5HLFA 1IKWB 4TQRA 3BQ1A 3RBEA 3I0RB 5KFHA 1N6QA 5KFOA 2ASLA 3MTKA 1TL3A 4H4MA 4RW7B 5L1LA 1T3NA 3RB3A 2R8GA 1S97A 1JLCB 2IBKA 3HVTA 3V4IB 3MR2A 3BQ2A 3OSPA 1S0OA 4FBUA 4RW9A 2F8EX 4MKAA 3KHRA 3H5XA 2IAJA 4Q8FA 4YP3A 1RA7A 4KAIA 1C1CA 4ZPCA 3DLKA 2YNGA 4QWCA 4TYBA 2W8KA 1N56A 2EC0A 3NMAA 1IKXA 2VG5B 4ED2A 1IKYA 2YNFB 4IFYB 3BSAA 2R8HA 1RT3A 3QLHB 1T05A 1WNEA 3FFIA 3LP1B 5HROB 1JLEA 3E01B 1N5YB 1C1BB 3T19A 1HPZB 4LQ3A 4IG3B 1RTIA 3D28A 3H5SA 3DOLA 1JLAA 4LSLA 3Q8RB 1CSJA 3KLEA 1JKHB 3DRSA 2BE2A 4GC7A 3RB4A 2V4RA 5KG6A 2VA3A 1KHVA 3QGGA 5D3GB 4ZP7A 2RDJA 5J2QA 4PUOB 5KFEA 5KG1A 4EBDA 3KJVA 1K1QA
chains in the Genus database with same CATH superfamily
1S9GB 4Q44A 5K14A 4ZPAA 4LF6F 1NO8A 2DNOA 5E33A 4KYZA 1WG5A 3AH6A 4OHYA 1Y5NB 3F0NA 2OI2A 4DV0F 1GMVA 3KTQA 3QZ8A 3OW2R 1WKLA 4YB7A 4OL8A 2RVJA 2FD2A 2B7BB 4FYYB 2DCLA 4X64F 1H72C 2DKOB 4F3OA 5IS2A 3TX0A 4LSNB 1CJKB 1JLQA 2FZKB 1JNZB 1DTTA 2KFZA 5CXTA 3W5XA 2ILZA 2F1FA 4CNYA 2XMVA 4EU0A 1HBMA 2LCWA 1ZM2A 1S6PA 4G6VB 3R1LA 3M9MB 4LRCA 1KVKA 1ELOA 2MLZA 2QLWA 3CJ8A 4OI4A 4WZQA 4DL0C 1EARA 2AF6A 1SJFA 3RRHA 3J81Y 2E5JA 5IWAF 5LOQA 2V94A 2MJUA 3D9BA 4K4YA 4LF8F 3DRSB 4K0KJ 2X7IA 1TV6A 4QWDA 3KUEA 4LSZB 3DFEA 3VALA 1V6HA 2CIMA 1U24A 4HHUA 3TX8A 1K0TA 3GFHA 5KFIA 4B9UA 2ZZNA 4O3RA 4JBCA 4JI6J 1CJVB 2GO8A 2OJ3A 1DURA 1EQMA 1W7WA 2CRLA 4RUAA 3ZTPA 3MPDA 2PMWA 3H40A 1F3VA 2OELA 2ZH7A 4LBIA 3W1YC 1QVFR 4LFBF 1KQGB 1KVIA 4UZBA 3UCUP 1MWQA 2XSJA 1VQ9S 2C1EB 2YPYA 1D9FA 2V2KA 2RAQA 1B4SA 2FY8A 2VG7B 4ZVRB 1FDBA 2YBVA 1HI8A 3M9OB 2JC0A 2KI2A 2X3DA 5KT7A 3N6LA 4EI2A 1PSDA 2FZGB 1J27A 2H9ZA 4JI8F 2NREA 4YOEA 3GE9A 5KFWA 2HHXA 4O4RA 4DR7F 4J5OA 4GO5X 5D4PA 4TU9A 1VOMA 2MXYA 2IJFA 4KV8A 4HHJA 1DQ9A 1SJ3P 2XLKA 5GMKa 1U09A 3T5JA 1SC1B 4HEA9 1SCJB 5FDLA 1FERA 1HBUA 3U1LA 4OZNA 1JNRB 5F0UA 3W5YA 3N6MA 3OJSA 1TL5A 2HFNA 2KKHA 2NS1B 3BGOP 1RJJA 2C2RA 3N01A 2DY1A 3W2VA 2RDDA 1DQ8A 2JFDA 2VKZG 3KMSA 1UVLA 4P10A 4ZPBA 3CJSA 2YTCA 2QL9B 3M8YA 2QIFA 1RT6A 4NCGB 2RNEA 4CM2A 4G65A 1RWVB 3OSNA 2ZM6F 2WTFA 1TVRA 3RZAA 3M2RA 4OX6A 1HI1A 5I4MA 3D68A 3MPUB 1LWCA 4NXNF 4NLXA 2EFGA 3D5MA 2OPRB 3M8ZA 1JLGB 2HQCA 2E7WA 1ZM4A 5LMNJ 1DQAA 1O6XA 3BEGB 4OHZA 4AYBD 2XB2D 3QSIA 1PAUB 2NR0A 1C4AA 1C4CA 4NXMJ 1JKHA 4ED1A 2N7YA 3GLJA 4R8UB 4QPXA 1ZTTA 1KLMA 4DV4J 1YVFA 5DGBA 1SUQA 4DL5A 2CWXA 3T9ZA 5DDOC 3H4DA 2QA4S 2F4VJ 3NAHA 2J5AA 4F26A 1FF2A 2R2UA 1SI9A 5GADU 2H3EB 3QJLA 1NK9A 4ZCLA 2E7XA 2AYMA 3M32A 4A46A 3CSKA 5KFKA 2D7SA 3RG6A 4DUZJ 3HFVA 1F1BB 5K5MA 3PKYA 5F8NA 3JAMY 3OVAA 1HMVB 2B9XA 1VQOS 1CQMA 2UXCF 2PE8A 1X9WA 1KS2A 2GHVC 3DHXA 1IKWB 1P1LA 5KFOA 1CQNA 2GHPA 2HBRB 3T1YJ 4H4MA 4QQBA 2R8GA 3UCGA 3V4IB 2UV8G 3QGPA 5IXUA 3G8QA 4YEAA 1N56A 1E6YB 2EC0A 4QU7A 5CYJA 2YNFB 4DUTA 3UN5A 3PX4A 4WFAQ 5CCLA 2M8HA 2V4RA 4OYWA 2HHUA 2M9KA 3WDOA 3OT9A 3N6NA 1VLYA 4UT4A 4RWWA 2G2ZA 1K0VA 1X4EA 2GQCA 1BQNB 3VAMA 3GMGA 3RW7A 3GR1A 4EZ9A 3GZ7A 2BYCA 2YX4A 5CYQB 5E3AA 4ALZA 3BGRA 1RISA 3CCSS 3OXLA 4P71A 2R7OA 2XYHB 2GO9A 4IFVB 1F0XA 2QMWA 3GJTB 1ITPA 2F8MA 1VBZA 5D8HB 1RUSA 3QZ7A 2CJYB 1VMBA 2Y9HA 3R6LB 3PRDA 5J2MA 2M3DA 3G86A 2APOA 1X4FA 4BLGA 4I69A 4ED3A 5H9FJ 1W2BR 2V9WA 4O0IA 5LMUJ 3G6VA 2HRYA 1HI0P 1FRLA 3OUYA 1EHWA 1E6VB 1KQKA 3QATA 3NBPA 2OPSA 4C2MA 4V1Ak 4OI6A 1S57A 3KLHA 5IM0A 1C0TA 2HHHJ 4B3TF 3OXFA 1AW0A 2LQ5A 2RUSA 2J7KA 3P3DA 5LXRA 3ZXWA 5F8LA 5J1PA 5KFFA 3O2IA 4DV2F 2RRAA 2I5JB 2MLYA 1A6LA 2WB4A 2XG8A 2DHHA 1J5EF 4ED7A 1OY9A 4R5PB 1HNWJ 3BDEA 1P6TA 4Q2LA 1M0SA 3IAS9 4O44A 2RB7A 2IM0A 4RNFA 3Q2TC 3DDKA 2YVSA 4I7FB 2YQ3A 1K1SA 3AQPA 1BWEA 2VOPA 1RSCA 4MK7A 3D0IE 4Q43A 1CULA 3S7RA 1VBKA 5D77A 2DITA 5B7WA 4ZJOA 4C97A 3HSDA 4DS5A 3HLUA 3CDUA 3GYXB 4G1QB 1LWFA 2O1PA 2Z58B 4HI1A 4BC7A 3R3TA 2VQFJ 3HZGA 5T7LA 1FJCA 3T5HA 3M6UA 3ENQA 2CG4A 5F9LA 1T3OA 3FRYA 1OQ6A 1J5OA 1HFEL 2KN4A 1YTYA 1H38A 4ZVFA 1N54B 1NUEA 2DR7A 2A3JA 2C2EA 2HS3A 3I87A 3DDIA 1RT7A 2AZ1A 3NAIA 1OY8A 1GQEA 1S6UA 3M30A 2J9DA 2WVCA 1SL0A 4IG0A 1RTJA 1RWPB 3G96A 5D0EA 4JYAF 4Z2XA 1U2RA 5DG7A 3MR3A 4I2QB 2MSTA 3GG1A 3CJ2A 2YX1A 3CVKA 1AZSB 4NCAA 2XS5A 1NMEB 1NZ8A 1YKWA 2DGVA 3VZIA 1VQPS 6FD1A 4PABA 2G9OA 2FHKA 2M8DB 3ZZZA 3D3CJ 3W60A 2XGQA 2IDEA 2LQ8A 4YUDA 2AJ1A 4LJMA 3OL8A 1QE1B 1JLQB 5IQ6A 3NY0A 4IFYA 1NSPA 4IH7A 4OZ2A 1WC1A 1RCXB 4DOZA 2Y8WA 5M2PA 3LP1A 3UNGC 4E0DA 2QYGA 2P6TA 4ANEA 3EZUA 2BUNA 1QAYA 2IFXA 3QMQA 2CA9A 2BDPA 3HVRA 2ZBQA 2AWZA 1S99A 4ZCMA 1U2CA 4TY8B 2ZEJA 2H48B 1LW2B 1AUDA 1CC8A 2H5JB 4WWSA 2AU0A 1RWXB 4HLBA 2E9ZA 1FVSA 2IRYA 4G1IA 1IKVB 1G4CA 1NH8A 2HZAA 3BREA 3PYDA 4ZVGA 4C8YA 1S1VA 2AX1A 2XGPA 4PCQA 3NGKA 3PY8A 3IAM9 1TKZB 3EUNA 1NKEA 1SB6A 3PO4A 2SXLA 1X5TA 2OPPA 5U47A 1NXIA 4UQTA 2AIRB 2W7AA 4B3MF 3HVTA 2ROEA 5CD4A 3WQPA 2OFGX 1FWPA 1GEHA 2VC1A 3DU6A 3TQEA 2J0WA 3NCRA 4GO7X 4DR1F 4LIRA 2C42A 3CCLS 2FJVA 1T9VA 5KT4A 1KQFB 4CYUA 4RO0A 3RYLA 4I6AA 3QFHA 4LRAA 1RLDA 3JYTB 5AXLA 1RHMB 3GCWP 2ZWOA 5E41A 4ZS6A 4KV8B 5HK4A 3KOAA 4OMFG 4OJ1A 2JWNA 2F9DA 4IH6A 3IA0A 3ZTQA 4Q8EA 3MPYA 3HJVA 3BH7B 1AROP 1UW9A 3MM6A 1JMTA 4X4RA 2LVWA 1T9YA 2DNGA 4MT1A 1D0EA 2ZH6A 1OS5A 4RW4A 1LW0A 4B9LA 3N4WA 2UXBF 1VQYA 4I67A 3NRBA 1RTIB 4JI7F 4QWEA 2V50A 1JLAB 4LSLB 4ZA1A 4TY9A 1CEZA 5DG8A 2PC6A 4LBHA 2UUBJ 4ES2A 1M5KC 3C14B 2V8PA 4RW8A 3LO3A 5B0FA 1WORA 1NK0A 3W7BA 4MK8A 1MNEA 3HZEA 2JEFA 2PMZD 3GV8B 2BANA 3SV4A 2CPHA 5LL6d 2WBRA 4OYZA 1KLMB 2D3O1 1MMLA 5FLXU 2DY9A 1RT1A 2Q1LA 2ZHOA 2KJWA 1ZTWA 3T41A 3NKYA 2JX2A 1X60A 2Y0BB 4B9VA 3KHHA 1B7YB 2QGFB 3HDSA 5KFNA 3LWMA 4M94A 5D4LA 4I6YA 3CD6S 1C2PA 3BSCA 4LF6J 3HPOA 4DF4A 2E66A 1RHJB 3H5YA 3IS9A 3VGUA 2H4YB 4P2FA 1FHTA 3S6EA 4PRFA 1R31A 4DV0J 4E8UA 1T94A 2M52A 2WONA 3CCZA 2DXEA 4DR2F 5J2NA 2KXNB 1M5VC 4X64J 2JC1A 2QLJB 3EGWB 4WKYA 2HQFA 3T6JA 3C6UB 5C24A 1UL3A 1P9QC 3KK3B 8ATCB 1UPMB 3JQMA 3LP0A 2R42A 3C16A 3EVMA 2VC0A 7AT1B 1VBXA 3IGVA 3EZOA 4NLGA 1QAIA 4F2RA 1Q1KA 2KYXA 2MZJA 4QIEA 4DQQA 4RBTA 4ES3A 1TKXA 3V6DA 4NL5A 3EGNA 1RT4A 3CC4S 4LF7F 5IWAJ 2B6AA 4CLKA 3QIPB 2JRSA 3CJ3A 1ZBTA 3N28A 4NRUA 1WF0A 4JV2A 3PJXA 2BJ1A 4O3SA 3HFKA 1K8AT 1S77D 1WHWA 1SIWB 2RQCA 2X1BA 1FKPB 3LALA 3HT3A 5BYSA 1OMSA 2ZHAA 3W9HA 4LQ9A 2VG5A 2HS4A 4URQU 3MMAB 3ZZOA 4KGKA 1MWZA 4WP8A 1RBAA 1RWUA 2OEKA 1JXEA 4USUA 3NWRA 4K2JA 5C42A 3BGFA 3MPWA 2JH3A 3AA8A 4NA3A 2YKMB 3M8PA 3TANA 4PWDA 5GMDA 4DSIA 5IM0B 5HP1B 1SVDA 2EFQA 2HQIA 4RUCA 3CDBA 5E2QA 4J9PA 4KPYA 4QJVA 5ETOA 4PWUA 4DWIA 2GA7A 5DM6Q 5AE3A 5KFYA 4JI8J 5HN0A 1YJWS 5A6WA 4RU9A 4GC6A 4USIA 3ADAC 1Y00A 2ROPA 1SPBP 1RKIA 4DR7J 6FDRA 2A18A 2HZCA 3DI6A 4ANDA 3R97A 2GVZB 1GX6A 3LGHA 2FYXA 4O44B 2B43A 2VDIA 4OX8A 2HHPA 3LUYA 2ASLA 3DC2A 3UO0A 2KZMA 3OXGA 1DFDA 2IAJA 4YP3A 4R0JA 2QLXA 1IKXA 4J7CA 4IG3B 2N3OA 4UY85 4WKRA 2EFOA 4L72B 3KLEA 4LF4F 3EJMA 5A8KA 2VA3A 3QSYB 4B9MA 2D3OR 3TWZA 1LWFB 1UVIA 2AYEA 1ZH5A 2DRAA 1OO0B 2ZM6J 4YR2A 3Q8QB 1W2IA 6AT1B 3MMBB 4DFJA 2IM2A 8RUCA 3VQSA 1UMJA 4IUFA 3TAMA 1RDRA 1R0CB 2MZRA 4NXNJ 1WOSA 3A8KA 5J1EA 5HO4A 4WZMA 3M8RA 3ZNUA 3PR5B 2FHJA 2V8VA 1RT7B 2XMWA 4WPAA 4GVBA 3U02A 4ANCA 3EGVA 1SKSA 4JI1F 1TL3B 2IA0A 4N7TA 4YB5A 4ECXA 4PZVA 2UUAF 3L7OA 2E9RX 5KFBA 3DLJA 4C8OA 1NB2A 3KDNA 4NLOA 1S5ZA 3HP6A 4GMKA 1PG5B 1R0AA 4AXJA 4OYMA 4ZJLA 3P96A 3J7YU 2E1CA 5JJBA 1VK3A 3BBFA 2DCUB 1CS4B 1T9UA 3O3LA 2WAQD 2HVDA 1RXOB 1HQEB 2DB1A 3Q23A 1I3OB 1U1NA 3UDCA 2FJAB 3RW6A 2UV8A 1M1HA 3OPKA 3UD3P 4KTQA 2HWTA 3HD2A 2IIHA 4X66J 4KFBA 1SQEA 1FD2A 1U45A 2QV6A 1L3SA 3EZ5A 4OZ1A 4O3PA 4PQUB 3KK2A 1VS3A 4K4TA 3PG9A 4F4XA 5G0RB 2DNZA 3CJTA 3US5A 4NZ6A 5IOLA 4B3RF 4NLTA 4OYBA 3G9CA 1S9FA 2HHWA 4HACB 1S1VB 2QYCA 3O8WA 2Q43A 5L46A 1XJWB 2RF2A 2XCPA 3HKWA 4TLQA 5C25B 2OPPB 3CTRA 4Y3CA 4M5KA 3ZO7A 1M5PC 1NSAA 4ILRA 4DQSA 3CJ4A 3RRKA 1U26A 1U2FA 3HVTB 1SC6A 2GS8A 2XMTA 2QL7B 2ZH5A 3Q8SB 3QJJA 4GKKF 2Z30B 5EGYA 3CXCR 5HBMA 1FRIA 1S0VA 2HVIA 4C8KA 3A8EA 1YBUA 1WDTA 5LJ5Y 2XMUA 1RBOB 3M1VA 3C19A 3DRYA 3PZPA 1N32J 2J9CA 1K73T 1XMBA 1GMUA 2KO1A 4W4MA 1HHQA 2O5DA 2EPIA 4O4GB 2DIVA 4RBUA 3ISZA 4XPCA 4RW6B 2VBWA 1EAYC 3ET6A 2XCAA 4B3TJ 4TQSA 1LWXA 1SV5B 3HHLA 4UOGA 5AJ3F 3CCJS 2DBBA 3W2WB 2V0NA 2MZ1A 3V2UC 3BS9A 1GTHA 1RLCL 5B0BA 3QIDA 1VQSA 4DV2J 5KFSA 4A47A 2AKWB 4IO9Q 1LV5A 1J5EJ 1I1GA 1T9WA 4M5DA 3RBXA 5EHHA 3U27A 2MQQA 2DNHA 2EFNA 1YIJS 3JSMB 3K5MA 3MM9A 3HM9A 2P9CA 1FRXA 3EX7B 2RQ4A 4DZ6A 2E1PA 2J76E 1NNDA 1LK5A 5A0YB 1QSYA 3VHQA 3PYEA 1F9FA 2HVHA 5ETTA 1RAHB 3PEJA 3BQ0A 2DR9A 2QFIA 4WIQA 2LECA 4LF5J 2V5HG 2JVOA 1H74A 4DU8A 3HHDA 4MK9A 1YHQS 4IOBA 4IDKA 2VDHA 3QO9B 3D6FB 4C8ZA 1MROA 4HVZA 1D9AA 3I9V9 1R6YA 3HULA 2V69A 2X1AA 3FCWA 3DLEA 1WJ9A 5M2RA 2PO4A 4TQRA 5HSPA 4LR9A 3CMAS 3BO4A 5L1LA 5A8WA 3RB3A 2IMOA 1TL7A 3MM8B 3WZ0A 1VC6A 2P5VA 4MKAA 2K7KA 1MN9A 3BSAA 2R8HA 2P9EA 1RT3A 3HHLD 4PYAA 4PG7A 3TRGA 1JLEA 1N5YB 1V5IB 2R7XA 1SJRA 1RAGB 3QGGA 5D3GB 2OO4A 4JYAJ 3E2EA 2HHQA 4ZMMA 2W9BA 2CJKA 4PXBA 1D9DA 2WONB 3POTB 1KEKA 4X2BA 1I94F 4X84A 2E1RA 3I9ZA 3LAMA 4USJC 3C15A 1FE4A 3H42A 3GONA 3VZHA 2BQ3A 1Y5IB 1IVZA 5B0GA 2KRBA 3PRBA 2GC8A 2AJFE 5F8JA 4IQMA 2HNZA 2RUGA 1CVJA 3OL7A 2YWWA 4DEZA 3NOCA 1LK7A 4Y2CA 4RJVA 1N0VC 1RT4B 3PHEA 2JLGA 2JLEA 3FDSA 2AJ4A 1TMMA 5BR8F 2HQ3A 4RL1A 4OYPA 1T05B 2EXUA 1RWWB 4NLWA 2FVSA 2DIUA 1BQMA 5HVHA 1BQXA 3M8SA 3KJQB 1JIHA 1KOOA 2N82B 2NXJA 3IG1B 4F8RA 2HW3A 4QBUA 1YBTA 2XMAA 2AGPA 2CQ3A 3PX6A 1W25A 3JTPA 3MM7A 1MN7A 3I0SB 4CO4A 5K8NA 4ELVA 4A8YA 1REVB 4B3MJ 1EQ0A 2FLOA 4L74A 1XN9A 1KVJA 3IM9A 1V3RA 3NWGA 5A2QY 5KFPA 4I4BA 1TL1A 1VIXA 2OP5A 3MFHA 2A6MA 1Z2ZA 4TN2A 4N41A 1VQ5S 1KRPA 1LXNA 3GV7B 4DR1J 1N5TA 1O5JA 2ZE2A 4EMDA 2FQQB 4J9LA 4ZIVA 1GAOA 5IQQA 3ZC4A 5HVGA 3DRPA 3JSYA 2F3JA 1FD8A 4ZVEA 4AT1B 1RGVA 1LWEB 1TELA 2EK1A 3KJFB 2XZDB 1ICEB 2D69A 4DR3F 2DEJA 1QJHA 4MIWA 1R0BG 4HH1A 2W9CA 1S6OA 2U1AA 4CQ1A 2BABA 3OR1B 4DLGA 1H2VZ 2J8SA 3BGUA 4ID5A 3NS7B 2CQDA 3DGPB 2J7UA 4YR0A 2C2MB 5ETLA 1S1TB 3RAMA 2OUGA 2X51A 2M2BA 3RU0A 5DO2A 5F8IA 2EVZA 1A9NB 2CYYA 1R8PA 1URRA 1G7CB 1FFGB 2BE7D 3UN3A 2XZWA 4IO1A 2DR6A 2KT3A 4C7QA 3BPDA 2A2CA 3HF5A 1YQHA 5K8MA 4YR3A 1VQLS 3B4MA 5EWEA 4NOHA 3A1YG 3KHLA 5KFCA 4X4SA 3SBMA 4NMLA 2GIQA 2XEXA 4FF3A 2HKEA 4H4OA 3J80Y 2CG8A 2AZ3A 2AJ0A 3IP0A 2V67A 2PDAA 1MMNA 3RB6A 3J7AN 4TNOA 5CYMA 4AFFA 2JEGA 2R7TA 3A4TA 3CB4A 4J9VA 2HHSA 1RYSA 1HPZA 1RAJA 2LQ9A 3KLFB 4U9RA 5KT5A 1G2EA 3AA9A 1ZAVA 5GAGU 1FEEA 2Z2ZA 3K8WA 1GTEA 5GAEU 1FX4A 2D3UA 3NNAA 5JUMA 2AGQA 1N5SA 3R5CA 4BC9A 4RUHA 3DXBA 3Q0AA 1R8HA 2J9DE 1JLFB 3MEDB 2QMXA 1UWAA 4FZVA 3UR0A 4NE9C 4NLYA 3DLBA 1S6QA 2MJNA 4WJBA 2R9LA 2IHR1 2V68A 1GK8A 5IZHA 4KFBB 4A4JA 2R7QA 4DR2J 3TP2A 2LDYA 2ZOGA 2BX6A 1VISA 4PXCA 3I5BA 1HWKA 2Y8YA 1WUUA 2F65A 4N8NA 1TAUA 2HFSA 2QTWA 1S0OA 2KH9A 2L48A 3ELHA 4KAIA 5HAOA 2VFRA 2G2OA 1OJ4A 2F63A 2WSEC 1IKYA 4FXWA 2ZUGA 3E01B 3FJ2A 2MKHA 1IM6A 2FJBB 3O44A 1T0TV 4W92B 2J7WA 1U6BA 2M4MA 3KJVA 1NK7A 4L76A 3QRRA 3KLVA 4GKJJ 4F4AA 4BDPA 1RABB 1L3KA 3NS6A 4EEYA 2PIIA 1XMOF 2XM3A 1YJ7A 3DMJA 1WKJA 3I4HX 4A8FA 3H59A 3HHKA 1SJ1A 1A0OB 2ZD1B 2KJVA 2ALYB 2ZKUA 5HBMB 2XI2A 1UPPA 3MECB 2R2RA 5KTQA 3HFZB 1WSVA 4RPFA 4LFAJ 2VFVA 1HNVA 3H2UB 3CD0A 4CH1A 5KFLA 2YKQA 3DYAA 3W61A 4AE5A 2VOOA 3DLKB 2ABYA 4HYKA 5F9NA 2YQ0A 2CQPA 4IYQA 4PG8A 2E5GA 1TP7A 3W5ZA 2LEBA 5KG2A 1WELA 4NI2A 5KOWA 1VYAA 4EBEA 2HVEA 4DU7A 1RI7A 5I42B 1NH7A 3RR7A 3R5BA 3MFIA 3CJKA 4FVCA 4I6WA 1TUGB 4WCEQ 1XMQF 3UDLA 1UEVA 1R6VA 1RTHA 1X5SA 4DG1B 3DOMB 1FRHA 1IBMF 3FEXB 1YSJA 2XYPB 1IJFB 4DDFA 2EFVA 3NCQA 3S1TA 3LGMA 3DLLQ 2H51B 3VGTA 2HPUA 1FKAF 2BMBA 2FJDB 1RT2A 2M0GB 3MOZA 3N0VA 3VV2B 2VU5A 2DNNA 3GFZA 3MF5A 2LEAA 3IGNA 2M5YA 1XC9A 1S7IA 1FNOA 2YKOA 3MEGB 1NK4A 3OLAA 3SXLA 3RBDA 1MROB 2C3OA 1RU2A 3U1NA 3BDPA 2XWYA 3IBFB 3B6BA 2XULA 2YXLA 1HLWA 2H5EA 2N4DA 2B7CB 1TL7B 2W2NP 2RD5C 5KFDA 2HWIA 1NJYA 3UI3A 1RT3B 3G2XA 1YWXA 4PXEA 4EK2A 2ZH8A 2B56A 4XDCA 4HL9A 1V3ZA 2B9EA 3E8OA 2ZH3A 1XNQF 4DCOB 3B54A 2IBOA 3G6XA 2FJEB 4JI1J 2YKNB 4R0EA 3AJ1A 2UUAJ 1UWBA 2IC3B 1YX2A 3BKUA 5DDPC 2KFYA 5AT1B 4ZVOB 1X31C 5B0DA 3P5TL 4MFBA 4FYWB 4CLTA 5K9FA 3MM5B 4F25A 3EMTA 1O8BA 4Q0BB 2CUYA 2A2DA 3I6PA 1HR0F 1KFSA 1S12A 4OYOA 4KO0B 2YPZA 4HH0A 1OPZA 3R2DJ 3SDEA 5KAKA 1UTAA 5C7PA 4KGXB 4NLDA 2BJ8A 2OKQA 1NM2A 1C1BA 3HXMA 4PUOA 2RDIA 2R8JA 2GJIA 1FTRA 1ZM3A 1VQ8S 3IR6B 3H20A 3OFGA 2F40A 1R3NA 4B3RJ 3QAUA 2L9NA 1UFLA 4USVA 2PSZA 5HQMA 4YFUA 2BKPA 3CD7A 3NGDA 3PW4A 4ZLPA 4DLEA 3M6VA 4RZRA 1D1UA 3ILJA 2ZJPQ 4JV1A 3PJ9A 3KK1B 4K5RA 2ZNZA 2PA3A 3B82A 2HFOA 5KT6A 3MM7B 3ETMA 2DXDA 3MAHA 2CNKB 2D1CA 3MAAB 4N56A 1U1LA 2DNQA 1B0TA 1UEUA 1N6QA 4M5NA 3DLHA 4RW7B 1JLCB 4GKKJ 2MY8A 1YJTA 5DDQC 2RE1A 1NRKA 3UW1A 2VODA 3PYFA 3QLHB 2LDIA 3FFIA 4OJGA 1RQ0A 3D28A 3H5SA 3BN4A 2HYIB 1FFSB 2CDQA 4FF2A 4DV3F 2B4UA 4LRFA 3RB4A 1CPZA 4GVLA 5D0HA 2DHXA 4J91A 4L6V3 4EBDA 5I3QA 1K1QA 3TVKA 2CJQA 5H9FK 4OFZA 1TKTA 2R2SA 4ZHRA 2DYAA 1EKSA 4KQZA 3MMCB 3MCMA 5AJ3J 3AHPA 4PR6A 4ELUA 2WVBA 2YWHA 3LPEA 3I32A 4DBQA 2BQRA 3GIKA 3TI0A 4P75A 4XK8C 3MTJA 1MLAA 1NJIT 2D9OA 1CJTA 2G0JA 4Z7YA 4DV6F 3T5KA 3MDFA 2V2VA 5HLFB 2HLUA 1U0HB 1TUWA 1HW8A 2JZ5A 1ZPWX 5DGAA 1Q5VA 2YNGB 5EDWA 2Z57B 1GT8A 4H4OB 1YJ9S 2LEPA 4C3KA 4B17A 1JXLA 2HEKA 4FDFA 1SL1A 1BY9A 2KZZA 1VRTA 3DNCA 2QG9B 5J2QB 2HNYA 5HJYA 4M5GA 3CW2C 2HFZA 1S0MA 5CYMB 2CVEA 2OEJA 3BR8A 4DI6A 2XNQA 2C22A 4NWBA 3K58A 1N33F 2Q79A 4TLRA 5F3TA 1RT5A 3GJRB 4ZVSB 2YNIA 4MJKA 2E7VA 3TO8A 2B4PA 3EE3A 4DCJB 3RAXA 3EPGA 1S1UA 3HCXA 3BBCA 2MYFA 1WHVA 3CCRS 3C3LA 2JHEA 4NLUA 5A8RA 4DX8H 3QT7A 2B9YA 5ETVA 2BBEA 3K5OA 4PXDA 4J9KA 2MKSA 2B4OA 4QCLA 2MTLA 1S6QB 4X4UA 2AQ4A 1H73A 3IO1A 4ID8A 2AW0A 2YWGA 4C11A 1HYSB 1I94J 2OPQA 2LU1A 1NHVA 1Y3KA 2CQHA 1Q95G 1NSQA 1TFYA 4CM0A 2JSXA 1B0VA 2G0CA 3IR7B 1XR5A 3CD5A 1FA0A 2V4JA 1V5VA 3QQCD 2V2ZA 2K1RB 3R5AA 3DRRA 2KXFA 4D3HA 1TAQA 2HMIA 2BXJA 1WF1A 1WG1A 4J9UE 4ECSA 2PA8D 2ZHBA 2XO6A 1CC7A 3LTOA 2WSCC 4LF9F 4ZVHA 1DBDA 4OZ3A 4YY3F 2UUTA 1JLBA 4KC5A 3B4DA 4OZ0A 4JI4F 4B3SF 3PW2A 2C3PA 1T03A 1N5VA 2V8HA 5BR8J 3L3CA 2GGPB 3DMJB 3E3XA 5ETSA 3MUMP 4G1PA 2DNMA 4OI0A 2ZNYA 9RUBA 3G6ES 2WOMB 1ZZNA 2NCKL 3F73A 2AYGA 3J7A1 5CZVA 3CO9A 1N4LA 3GFYA 4L3KA 2E29A 4WK3A 1QTNB 3SIPB 2VFUA 3CDWA 3UQSA 3FBCA 4DV7F 1OYEA 1HNIB 3HX9A 3Q2SC 3IXQA 2CQ2A 2DJWA 2V9KA 1V9OA 1T9TA 4ECWA 1QSLA 3L09A 3GV5B 1FVQA 2LA6A 3K8VA 1KC8T 2A10A 4DFMA 1VC5A 2DH9A 4KBIA 2KDOA 3IC1A 2FPHX 1LQ9A 4ZPDA 3EWGA 3CMES 2W4PA 5J2PA 2Z4PA 1SJ4P 1YRTA 3IRWP 4UUWA 2DPIA 4LVOP 2NSCA 4IOAQ 7FDRA 4JV5F 1RA6A 3KUHA 2VBZA 4RX6A 4AXIA 3MR5A 4P6QA 2ROGA 4Z37A 4ZK7M 3LPYA 2Q6BA 3M2VA 1M1GA 1QVGR 3SQGA 1NZAA 1QAJA 3BQ1A 1QD1A 5L9NA 1B70B 3AOCA 1T3NA 4MYTA 4C0HA 2MGZB 4KT0C 2CJAA 2AT1B 1VQ4S 4QIGA 4Z7CA 4K5SA 2Z0GA 1KLNA 5G4DA 4CLUA 3FK4A 1VLOA 1KD1T 1WKKA 1Q4RA 1LEOA 1CSJA 2CNLB 3OR2B 2QO3A 3JQKA 3MHYA 1KHVA 2HK2A 4QR0A 5KG4A 3IRXA 2IA6A 3DM2A 2N7CA 2ZC4A 4KKOB 3A3PB 4DR4J 4X4PA 2Q3PA 2DR5A 2DPJA 3PW5A 5ETQA 2DGQA 3SCJE 4U7UK 3G6YA 1NHUA 4CO5A 2KHCA 1HBOA 3WBZA 2OEMA 5JMNA 2DNKA 4DV5F 5FLXY 2KT2A 2CQBA 1SH2A 2LXFA 4JP8A 1FKOB 4M5MA 3GU0A 4CO1A 2CPIA 2R7WA 1N0UA 1N36F 2POKA 1C1CB 1NHKL 4OQJA 4A8WA 1I6JA 4DQRA 4PPDA 1YJVA 3DGVA 2Z2YB 2BE2B 3Q83A 4XPEA 1Q53A 3J7ZT 3GIJA 5L39A 1FDAA 2GVDA 3VQTA 1X8DA 1VQMS 5DZ7A 3AOAA 1C0UA 4K4WA 5B0CA 4YQWA 1H98A 2KG1A 1HQUA 4DR6F 3EXCX 3OQ2A 3TARA 3MEEA 3FZ2A 3PM9A 3GIIA 2XLIA 1NK6A 5IC6B 3ONQA 4QR1A 1F5AA 4J9MA 3QPIA 1RAFB 3PFEA 1N5QA 4U8VA 2QC3A 1P27B 3QWPA 1HHSA 2ASDA 2CJXB 2Q66A 2JEJA 2GIFA 4I64A 3QGHA 1TUVA 4ZPVR 1U1QA 1FJGJ 3SV3A 4CZCA 2WW4A 1UA0A 1IWGA 2VZ9A 1VK8A 4ZLLA 2BR0A 3ITHA 4ZCIA 2RKIA 1Y11A 4RBVA 2OSRA 2YNHA 2FY1A 2IJNA 1XMOJ 4W90B 2MQ8A 1JB0C 4ZP8A 2GFFA 4FXVA 9ATCB 4I2PA 1R8AA 4WE1A 1PYSB 5DRKA 5A6PA 1IR2A 4X65F 4J9RA 1K47A 1F6TA 1P9YA 3NGSA 1LFWA 1HNZF 3D1OA 2KU7A 2AEMA 1ZZFA 2B3TB 2DNRA 3FBBA 3NMRA 4D3GA 4QYZJ 3M8QA 3TA2A 3UR3C 2XYGB 3QAEA 3GJSB 1EETA 3JSRA 3VAFA 2VA2A 3CJ0A 1T95A 3G82A 4ZHRB 2ZDPA 5CCMA 4CCHA 4X4QA 3BH6B 1RTDA 1NPKA 3TOQA 5RUBA 1SC3B 2PD1A 3DLGB 3V81A 2JLFA 1G3OA 2WRMA 3VGVA 3I0RA 3MUTP 2P6SA 4RNHA 5E3CA 2R3VA 4LT6A 1XMQJ 1U8WA 2BRLA 2EI5A 2GAHC 4ES1A 4OYXA 1IBMJ 2C2ZB 2W2OP 4C8MA 3G8SA 5DG9A 4CT9A 2HRUA 4B3OB 1ROFA 1RWMB 3BSOA 4DN9A 1SC4B 4Q45A 2XTJP 2RHSB 5B08A 4X4TA 5H9EJ 4QU6A 3CCMS 2QMUB 1VQKS 1IBLF 4ICLA 4O3QA 2R7SA 1HWUA 3QT5A 2EBGA 3W8PA 4DQPA 5EN1A 2MB0B 4RNMA 4X4OA 3C6TA 2CJ9A 4K59A 3WC2A 4ZVUB 5DQIA 2ZJRQ 4ETZA 1RAAB 4C3MA 1CJKA 4W98A 2BJEA 5DM7Q 4DN0A 1S1UB 3CE8A 3DRXA 3DN9A 1YZ6A 3CCWA 4C48A 1AA1B 4Q8FA 3UVJB 1FDDA 3UD5A 1XNQJ 1WNEA 2W2MP 1IBKF 3MGJA 3DRSA 3I82A 4GC7A 1Q86T 2RDJA 2HURA 5ITHA 4WK1A 3GTYX 1RHKB 3SZ2A 1RAEB 2GMLA 1MU2B 4L75A 2BJ3A 3TVYA 4USTA 1NSKL 2KVIA 2ZVIA 3BYPA 1LNQA 2VB6A 1IM4A 1CJVA 1L5UA 3RB0A 2FLLA 3GB0A 3TW0A 5ETRA 1NCLA 1WC6A 2BW2A 1HR0J 2GX8A 4CO0A 1RWOB 2BEFA 4DFPA 4ED4A 4AD6A 4BHQA 1I51B 3NS5A 3LAKA 2CQ0A 3CPWR 2LQBA 1S49A 2FC9A 1JJCB 4Y2IA 1KBRA 1NKBA 1FJEB 3LP2B 2H4WB 5CD4H 4CIOA 5F8GA 4DSJA 1NDLA 1BUXA 1RCOB 1N88A 3OD2A 2U2FA 1KHWA 3EVOA 2Z56B 3GCXP 1S9EA 1RZMA 3S8SA 2C2OB 3AAWB 2K3IA 3AJ2A 1Z1ZA 5K14B 3PFOA 1DLOA 4PG4A 1HD0A 1VRQC 2CPFA 4NPOA 3HMJG 2LMIA 1BD6A 1WEXA 2IY5B 1HWLA 3CMQA 5E3RA 1NDPA 3KKFA 1YGYA 5J2PB 1PJ7A 3PR4A 3VF0B 3DU5A 2DGSA 4ECVA 4JI3F 2HGNA 2QEXS 1PC5A 1DTTB 4DV3J 3RTVA 1HBMB 5E3QA 1S6PB 1EJ7L 2ZBIA 5KFZA 1F2GA 4P72A 3CO0P 4V19J 2VF3A 3A8JA 3PCOB 3AFGA 2XSFA 3M2VB 4WU3A 2OPRA 5CAAA 5ETKA 3SQGB 4USKA 1X9MA 3TZXA 4OYAA 4RLEA 1RACB 2WVFA 4QIFA 2RSQA 1YLXA 2UP1A 3L95X 3ISNC 4ETXA 1TV6B 1EKRA 4Y65A 3W3SA 1M1KT 1KDNA 4R8UA 1KONA 4CH0S 3NOGA 1NB7A 3AD9C 4QZVB 1F3FA 1H3DA 5SZTA 4F2SA 5A76A 1U6FA 4DV6J 3WIUA 4PAAA 1PBUA 1WTBA 3ICLA 2FLPA 4E2FB 1R43A 4USWA 4JI0F 3UFCX 5GVQA 3CDEA 3BZQA 3M2UA 4EZ6A 3D1HA 1KQSR 2XSJB 3ZZUA 3ENVA 2H5IB 3JTOA 1HMVA 4AQYJ 2VJVA 1YZ7A 2AGOA 1HBOB 1IXKA 1IKWA 1M5HA 1CLFA 1Z4UA 3V4IA 1UVKA 3PKMA 2DXFA 1N33J 3Q86A 4JB8B 3R2CJ 1E6YA 2YNFA 4PPZA 3ULHA 1JJ2R 2VQEF 4DPOA 1WD6A 4P7TA 3TJAA 5FJ4A 4HKQA 2RU3A 4OLOA 1NPPA 1HARA 1EB0A 5FDLB 3PIPQ 1UVNA 1HBUB 2J6UA 1YDLA 4YN3B 5GAHU 2E5LF 1BQNA 3KMQA 1UJ4A 1OPIA 2J0SD 5CYQA 1M5OC 4Y0FA 3W2VB 4DZDA 4OX9F 1WI6A 3JSBA 2GV1A 2J9EA 4IFVA 4ED6A 1HQUB 5LJ3Y 1RT6B 4I0WA 3CNQP 5L1IA 4ECYA 3OFEA 5AXNA 3FSYA 2NSBA 5IT4A 1R89A 5HJXA 1TVRB 1RHQB 3M2RB 3F44A 1LWCB 1RK8A 2CFXA 3O5TB 2Y1IA 2DNPA 3TR5A 4RW9A 2F8EX 2W24A 2CZVC 2E1AA 4KHPF 4QWCA 4HTJA 3TUJC 1E6VA 5D4OA 4LF9J 2UU9F 3W66A 4A8XA 4DX7A 2FIUA 4YY3J 1HWIA 1ZS6A 3C8YA 1JKHB 5KG1A 4JI4J 1XR7A 4FYDA 2CPXA 2EG2A 5CHCB 1SUQB 3TAPA 2DD8S 2J0QD 4B9TA 3R5GA 5DZ6A 3ENAA 5IT9U 4P7VA 2O01C 2ZH2A 2BOAA 4L73A 3M32B 4R5PA 5CZXA 1OSDA 2N3LA 2I6WA 1WI8A 1U02A 1YJRA 3PW7A 4DV7J 4K4XA 3SCLE 1U47A 2HBYB 3ZZRA 4I7FA 5BYRA 2RRBA 2FLNA 4ZLJA 3G82B 3VWSA 3ENWA 1S1XA 3N5BA 2XS2A 4FKXA 4JOUA 4H4MB 1HQ2A 4C4WA 4KH1B 1Q7LB 2ZZMA 3J80U 2Z8QA 2NQPA 3N9UC 4G1QA 3R6GB 1X0PA 5LT5A 1S4FA 1XR6A 3TEGA 3A3OB 4JV5J 5SUHA 4U7CA 4QW9A 3Q24A 4DV1F 3GWCA 1XIQA 2HRTA 2B8QA 4KHMA 3BGRB 3V6HA 2RT3A 2VD3A 2OGUA 4ERDA 3BV8A 1XBWA 4LF8J 2IVFB 2IM3A 3CF5Q 1AFJA 3TUIC 3KNAA 1TK0A 3CCVS 4I2QA 1HWJA 5K8PA 3FQLA 1NK5A 1AZSA 4ICLB 5J2MB 1Q7YT 2FDNA 1N8RT 1IUJA 2EK6A 1Q82T 3C6TB 2FTRA 2CKWA 1U25A 4KGZB 3OUYB 2ZWPA 1B0PA 3D66A 1QE1A 4ZP9A 4RNOA 4NLPA 3F56A 3NBPB 4KB7A 2OPSB 2WK4A 4LFBJ 3PTWA 2EFPA 3KLHB 2VKRA 1NDCA 2OAUA 1C0TB 3KFWX 2FC8A 2NXEA 1VJWA 1DZ5A 2C3UA 2FVCA 2IJRA 4DR5F 1XK8A 5BJRA 2IRUA 3HT0A 3EM1A 2AEFA 3SSRA 3M7VA 4DV5J 4QIVA 4KJIA 1FNXH 2DISA 2W2QP 3BR9A 4B9NA 4K4ZA 4TY8A 2QX0A 1LW2A 3EPIA 5CH7B 1HIYA 1PYOB 2P9GA 2MDAA 3DHWC 1N36J 4QOTA 1IKVA 3BPSP 4WTOB 4FS2A 1UJ6A 1U1RA 4DPUA 2NYIA 3FEZA 4DL3A 1IWAA 4J9SA 3O6QA 1JK9B 5KFMA 3AJDA 2ERRA 1TKZA 2AD9A 1X5PA 1WC0A 2W01A 1CULB 5ETNA 2A1BA 2YKPA 1FEHA 1JJ4A 4S0MA 4JV0A 2MLXA 4DPTA 5DLFA 2ZDOA 4DR6J 2UZAA 5MLCV 4FYXB 5T7LB 4USMA 4J9QA 3HHNB 2MZSA 3CULA 3RR8A 4JI2F 1PO6A 3CJRA 2HQDA 2QZ8A 1S4EA 1J5OB 1S9EB 1NJZA 2NXCA 2QL5B 1FI4A 3QWUA 3CDAA 3RAQA 3JYTA 3NLCA 3BSNA 2A0FB 3I56S 2I1RA 4EYHB 1HD1A 4GRSA 4EUVA 2CZ9A 4TYAA 1PC4A 3KJNB 1B99A 1VRUA 3M30B 1HA1A 2CZ4A 2P2CB 5KFJA 4IG0B 1RTJB 1Q79A 1DLOB 4PKDB 1VQ6S 4NZ7A 3SFUA 4HHHA 4DSFA 1VIOA 4X65J 2KYZA 4DQIA 1G1XA 4NMXA 4A8SA 2VIHA 2PGCA 3PW0A 1HNZJ 2BQUA 2NPIA 4XIUA 2BM1A 2ZVSA 2IBKA 3P8BB 4UF4A 4ZOSA 3WIVA 1FFWB 2L41A 4DSEA 4K7QA 3O1LA 4IFYB 1NLKL 4MKYA 3LP1B 1X7VA 1RTIA 2D9PA 4C0BA 1JLAA 4LSLA 2PMHA 2UXCJ 2BOPA 4LMZA 2XWXA 1UFWA 5KG6A 1RHRB 3MD1A 4ZJQA 4Y6IA 4C0OC 3E51A 3FEYB 2CQGA 3C14A 3QRQA 2R4FA 1SQFA 4CDIA 5AE2A 3VAGA 4CLFA 1GX5A 3C46A 4ECUA 3MEKA 1S10A 3KLGA 4IR1A 3W64A 4H54A 2CPYA 1GXUA 5HQ8A 2WBMA 4NA2A 1VR6A 2J0XA 2GHWA 1WG4A 2XZTB 1ZAWA 4DL4A 4J37A 1AFIA 5AE1A 2XY7A 2W7OA 4DPWA 1OSCA 3BF4A 1SIZA 2RH3A 2VASA 1Q8IA 4QWBA 3M2UB 1J2VA 1VBYA 4FN5A 3OFHA 2MQNA 2BVZA 2JVRA 2JEIA 1O51A 3PV8A 2FJXA 3J7YI 3FZBA 1IBLJ 4K4SA 4X66F 2VPXB 5F3ZA 3D6TB 3T1AA 1RP5A 1WHXA 1BE4A 4CYUB 3ZZYA 1NPRA 2F8HA 4K2XA 4KR0B 1ZETA 3C6UA 2PN6A 1EX8A 3KK3A 1BWVA 3K5LA 4ECQA 5CA5A 3WC0A 4OI1A 2ZJQQ 2C2NA 2MSSA 4YMEA 4UOCA 2DHSA 3D0HE 3QFWA 3H2LA 2D41A 1IBKJ 3MM6B 3QIPA 5E7OB 3KXDA 4LR8A 3P6YC 1TK8A 2LKZA 3P4UB 2W1BA 3H4BA 2XO7A 2HS0A 1FKPA 2JDJA 4F4WA 3DXSX 5HMXA 4ATNA 2D3ZA 1VJQA 4P74A 4RW4B 1ULRA 2BKNA 2K06A 3CCES 1LW0B 3ZZ0A 1BLUA 3GYGA 2XC9A 3UDVA 3MMAA 3K0JA 4C6AA 3B78A 1N32F 4RW9B 2W8LA 2GW8A 2YWEA 1RWKB 3MR6A 4RW8B 2JOQA 2GNKA 2W2PP 3KUGA 3PXGa 1Y5LB 2YKMA 4A8OA 4ZDNA 5HP1A 3TUPA 5ETMA 2BANB 1WHYA 3LF0A 2M70A 2DT9A 3RRGA 4TU8A 3FRZA 1RT1B 2BACA 4TU7A 1TMJA 2J8AA 4OZLA 2GAGC 4OZ5A 3ZNJ1 4WFYA 4KE5A 1UKUA 4I68A 3P5BP 2B51A 2NZCA 3AD7C 4TKTA 2GVZA 3ZZPA 1S7HA 4P2XA 4KSEB 1MG7A 2VBYA 1HNXF 1TFWA 5IV3A 2N4CA 3H0PA 3IS9B 2OIHA 1X4AA 5KFAA 1NDKA 4LRDA 2VPYB 3ETOA 1S1XB 1Y0HA 2VFSA 4ZN3A 4IG3A 3EGZA 4F50A 2HAIA 5J2NB 2V8GA 5LSOA 3OHAA 2CVIA 2C28A 1GMWA 2I9SA 2K3KA 4LF5F 4LRBA 5K8OA 1PBAA 4ZITA 2CNNB 5C24B 4JI3J 3LP0B 1U1KA 3K89A 3C16B 3MMBA 1RYRA 2XLJA 1U4BA 4KGVB 1FRKA 3MR7A 1X4CA 1FDNA 2DRDA 1RB0A 3AT1B 1X5OA 1TKXB 2HNDA 3V6DB 1WWHA 1DRZA 1D8YA 3A12A 3SEOA 4CWBA 4ZVQB 4NYOA 3AQOA 2B6AB 5E5NA 2W7PA 2V4QA 3AODA 1K44A 3UPFA 4LBPA 4U67Q 4ED5A 2HK3A 4X4NA 4OV6A 3DOKA 4ZVTB 2ILYA 3QBCA 2B5JA 2G2YA 1PCAA 2RU9A 1TL3A 3FUYA 2KB2A 3C66A 4FBUA 2VL1A 1QSSA 1U48A 3H5XA 4PWWA 4TYBA 2VG5B 2KTQA 3VAKA 1YG0A 3M8WA 3MWBA 2I0XA 2OMLA 5BYQA 3Q8RB 4JI5F 3HKZD 2QA4G 4JI0J 4ZP7A 5KFEA 2GZOA 5C42B 4UOFA 4X62F 1SKWA 4EWTA 3EDRB 2L9WA 3UCZP 1CS4A 3M8PB 2CPJA 1HQEA 4PWDB 1M90T 3R27A 3DKDA 4YHHF 3MURP 4K4VA 4IR9A 1UVMA 1F9EB 3OLBA 1GMWD 1TU0B 4OJHA 4CTAA 3MZIA 4WFZA 2YY3A 1SKUB 1VHIA 4FF4A 2O3DA 2B8PA 4PQUA 5THWA 1MSWD 3IWLA 5G0RA 3W62A 2LXIA 5F41A 2VQEJ 2K2PA 3DI6B 3MI7X 3FC9A 4OI3A 4BWMA 4DUYF 4DL7A 4HACA 4HDHA 2UVVA 4OV1A 3IN5A 1FESA 5EX0A 2GQQA 3NP5A 2UXDF 2IAJB 1XERA 3W65A 2L3MA 1S72S 3IM8A 1IKXB 2E5LJ 5C25A 2BKOA 3MAQA 2WB1D 4WXOA 4B08A 4WP3A 5HATA 4OX9J 3P49B 1FTCA 3KLEB 2ALZA 5A8KB 4C98A 5KG0A 2AP6A 1JXVA 2NZ4A 4Y34A 1WOPA 3IBCB 1Q81T 3NNCA 3SYZA 3OTEA 3T9NA 2FGOA 4N76A 3CIMA 3K7RA 3TJ9A 2UXBJ 4UQGA 3OL6A 1U1MA 2I38A 4JI7J 2LP4A 4FBTA 3TAMB 2AJQA 2MKCA 5J1NA 3KG4A 2WHOA 5EUHA 5J1EB 3IFEA 5FD1A 3AY0A 2LA4A 4KHPJ 2HBQB 8AT1B 5B0AA 4FF1A 3TEHB 4O4GA 3TZWA 1CG2A 4IRCA 4AL5A 4ZLNA 3IBWA 3BYRA 2UU9J 3ZFVA 4GVBB 3CJQA 4PYDA 4RW6A 1VRUB 3EXYA 4FP9A 3J81j 5KFTA 4DX6A 1TR0A 3NGTA 4NYZA 1SV5A 2RMLA 3HHEA 3W2WA 3H7HB 2KHDA 2XHWA 3RUBL 2AJ2A 4PG5A 3D6HB 3V5RA 3J81U 4K4UA 2E1MC 2CQCA 4HI2A 1NKCA 5JVGQ 4UY8T 1R0AB 2MHNA 1S0NA 2HSEB 1BMQB 2LFVA 4WIIA 2CPZA 2DHAA 4DPXA 1UA1A 5D78A 4U96A 1RWNB 1EP4A 1WF2A 3JSMA 3TA0A 4A8MP 2PFDA 5CQGA 4OHWA 4Y2AA 3LOUA 1OY6A 2DGTA 3L7PA 1SKRA 3OL9A 4AL7A 2JFKA 3NNHA 3VTIA 2UVRA 5A0YA 3CGIA 2W4DA 2KM8B 3OVSA 3KK2B 1BXNA 5C5JA 3HK2A 3QO9A 1VQNS 1F5CA 2G0IA 3KLGB 1U6ZA 4BBYA 1FNMA 3A8IA 5DDRC 3OFFA 3D1QA 4DV1J 2RF2B 4NLSA 3NGRA 2V63A 4BS2A 2I2YA 5D0GA 4DFKA 3MM8A 4RWXA 1X4GA 4YS2A 1FT8A 4LF7J 2Z2LA 1VDHA 3L4BC 5GAGI 3PEHA 3KG0A 3D2WA 2W4CA 1N5YA 4ZP6A 1XNRF 1P8GA 2PEBA 4ZPTR 5GAEI 2B4VA 1Q8LA 2PI5A 2HZVA 3TA1A 5D3GA 1U7LA 4NLRA 3BM7A 4P2MA 5K20B 1M5SA 1YJNS 1SL2A 3POTA 5L8RC 4RUBA 5KG3A 4CH7A 2DO0A 3M1VB 4IQXA 5HI7A 3QT6A 2MY7A 4UW2A 2RQKA 4EBCA 4XAKA 4EFAC 1QUPA 4WF9Q 2DR8A 4Q5VA 2J6TA 3SCIE 2QT7A 1UVJA 2OSQA 3ET6B 1N52B 2DGUA 3HHLB 1R8CA 2FVQA 2B9WA 4DR5J 4DMZA 2ADCA 2EBEA 1F5BA 2YH0A 4OZJA 4GKJF 1KWMA 3KHRA 1RA7A 3U1MA 5HMYA 2PFFB 4ZPCA 3TZZA 1KSPA 1T05A 3BKFA 4LQ3A 4LF1A 3R7NB 4U95A 3PIOQ 2KRRA 3K5PA 5IFMA 4M5DB 3IR5B 2Y1RI 2IDLA 3IG1A 1X9SA 2XI3A 3ILLA 2A6OA 2IYIA 3MM9B 2QLFB 1WEZA 3VGSA 2QA1A 3TQ1A 3SCKE 3D54A 1UETA 1FXRA 4K50A 4DS4A 5I3PA 2MZTA 1PIEA 3OTCA 3I0SA 1R8BA 3RBZA 3GQCA 3ZTOA 4LFAF 4LF4J 2CPDA 4EO6A 1REVA 3SI8A 3I55S 4OJ3A 3JAMU 4IDKB 5EWFA 1EZZB 3W63A 1X0FA 4UTGA 2ZOFA 2EWHA 3G71S 2NXUA 1OWXA 1OIAA 3HVWA 3GYNA 3DLEB 2GIRA 5BXIA 2GMJA 4JI2J 1SJQA 3NCPA 3MUVP 3AXKA 3T1HF 1TQLA 5A8WB 2OTJS 3BGLA 1S59A 1S1WA 5L1JA 3K17A 4XTTA 4OI2A 4TXSA 3C2PA 1JLEB 4HTIA 1N34F 2MQPA 3DCAA 4NLVA 1LWEA 1NBEB 2BZ2A 3NEKA 3P45B 1KN6A 4XO0A 2W9BB 3MOJB 3OR1A 3OBIA 4CLYA 4LFCF 3DGPA 4QWAA 1FK9A 1S1TA 3MD3A 2ADBA 3C15B 2VICA 3HD1A 1U1OA 2AX0A 4U8YA 1T9XA 2VUGA 4DX5A 1Q8KA 3BKTA 1W26A 2HNZB 2Y1LB 4DL6A 3R5DA 4QYZK 1WSRA 5F0WA 3Q22A 3OJUA 2R7UA 4LR7A 2HNDB 4FVMA 4B02A 3OHBA 3AOBA 4URSA 4QYRA 3UNYA 3V6JA 1GNKA 4NCBA 2R8KA 2AEJA 2CXEA 3DOKB 2OTLS 1DTQA 2B5JB 4NA1A 4P2SA 3JQJA 4FPIA 4RR5A 2CADA 3PYGA 5DJBA 5KG5A 4Y2MA 2CQ1A 4N5SA 1BQMB 2QFJA 2KL8A 3KLFA 1Z2LA 5L9XA 4MKVA 4YDXA 4DSLA 1SQGA 1ZM9A 4O0NA 2YH1A 3FGVA 3JXOA 4CLZA 2Q6CA 4H4KA 2PI4A 2HHVA 3CIZA 2G1DA 2CPEA 2OHDA 2AV5A 3FCVA 3ZZTA 2ZC3A 3BO3A 4HR2A 1RAOA 1KP6A 1JLFA 3MEDA 4ITSA 2IVYA 4C3LA 2ZOMA 1TL1B 4CTAB 1WOOA 3TJ8A 3OV7A 3A3NB 4U7UD 1LKZA 3Q8YA 4E98A 4FKYA 1KTVA 5H9EK 4QIWD 2YQ1A 2ZE2B 4I56A 1BC6A 3FBFA 2FHOB 5DQHA 1KR4A 4MKBA 4EO8A 3MMJA 3BN7A 2HWHA 4FPRA 4MTPA 2ZH1A 3DRPB 1DJ0A 3LH2S 4DXLA 3PJWA 3E01A 3LA0A 1JQGA 5JXSA 4LF2A 2FHJD 1UZHA 2W9CB 4FNIA 3G87A 2MKJA 4KGMA 1FCAA 4ID5B 3QT8A 1QY7A 2CQ4A 1L3TA 3GILA 1Y7PA 1VQ7S 2RQMA 4CNZA 2X1GA 2HIYA 2ZD1A 4N77A 2YWKA 4K8RA 1VCTA 2O67A 2UUCF 2GJFA 1X4HA 2BE9B 2EEYA 1WC3A 2EC2A 3MECA 3AB4B 1XTZA 4MH8A 3MPVA 2YKAA 1FRJA 4L3NA 3LW5C 4ZPWR 1Q8BA 2CWKA 3SSSA 3DLKA 2GCFA 2W8KA 4ER8A 2HIQA 2KM8C 5AXKA 1Q5YA 5IV4A 2XBPA 1HPZB 1VGYA 2ACMA 2COLA 2DVIA 2VHGA 4F36A 1ACMB 3LQVA 2E5IA 2NYHA 3GIRA 2ASJA 5I42A 4PQAA 4ECTA 2MKIA 3THVA 3JS9A 1NJXA 2RS2A 3HSZA 4P52A 5KT3A 2E5HA 3CUNA 1Y10A 2JNJA 2DK2A 4DG1A 1ZOTA 3DOMA 5HQLA 1K9MT 4FYVB 1CJUA 1FWKA 3FSXA 2H1YA 1HNXJ 4NASA 4QR2A 1EP4B 1PAEX 2MKKA 2Y0SD 3W9JA 5KFRA 3S01A 3BO2A 3CCTA 1FXLA 2ACYA 4ELTA 2IMWP 5D6GA 1ZPVA 1F60B 2Y3YA 5F8HA 1H2TZ 3M4XA 2ZZTA 1N48A 3LGNA 3MEGA 1LOUA 1AT1B 4MIBA 5L38A 1IKYB 2VH7A 3Q89A 4IRDA 4KY3A 3VVTA 5KFUA 4F04B 1HL6A 2UVWA 5I3UA 4QW8A 3KJVB 1TL4A 4U6PA 1H0HB 4ECRA 2ZFHA 2VONA 3EICA 3HHLC 1WACA 2BV3A 3ILIA 4G3IA 1YJUA 2R8IA 1UAWA 3H8YA 4LVNP 1VI7A 2ZBRA 4F0MA 3OTOF 4ILLA 2YKNA 1A7GE 3IWXA 1NU4A 3HSGA 3HI9A 4DSKA 3HJFA 3CCQS 4C8LA 2IC3A 3WX4A 1SBRA 2H65B 4IH5A 2YX7A 2MZQA 4JI5J 3PX0A 2X1FA 3PDNA 1PJ5A 3MM5A 1HNVB 3D7SB 4Q0BA 4X62J 2FZCB 3TYTA 5DQGA 1R7IA 3DYAB 4YHHJ 4KO0A 2VV5A 2CJBA 4F3QA 2ATLA 3VVUA 2M7SA 2QLBB 3FCHA 2FGCA 1S76D 1AYEA 2UUWA 1YRUA 4NI2B 5F8MA 2ZITA 3BB5A 1B64A 3CJKB 3VAJA 5KOXA 2E44A 2LU2A 3KLIA 1REGX 1FRMA 2F5GA 1RTHB 1UZDA 1YITS 3UDEA 4OLPA 4NLQA 4DUYJ 2HGLA 2RJZA 2LYVA 2I8EA 1YRXA 4DPYA 1UFKA 1YI2S 4DR3J 2UXDJ 2HG4A 2KVQE 4WYWA 1XWLA 3KK1A 4Q2MA 1RT2B 3QYYA 2XMKA 2IRXA 4IRKA 4X4VA 1R27B 4A48A 3PRVA 3MAAA 4KIAA 4WBFA 1S48A 2PT0A 3R1HA 5KG7A 3Q8UA 1JJHA 1SH0A 2O66A 4ZVPB 4RW7A 1JLCA 2RHQB 3CJ5A 1WEYA 3FKBA 3U7JA 3KHGA 3QLHA 1TK5A 1IQZA 1KTQA 1T8EA 4MMOA 1S1WB 1URNA 1NAQA 1RTZA 3FMBA 5KFVA 1G6BA 3HO1A 4WP9A 3D0GE 4OYIA 3HVAA 3MCOA 1AB8A 3SSQA 2G1HA 3R7SB 1H6KX 1FE0A 4ZIWA 1Q78A 3MMCA 4O3NA 3JTNA 4J9OA 5LSLA 3H2VE 4K0KF 3FSIA 4IKAA 1UWBB 1SH3A 4CT8A 5IT9Y 3GG0A 5E0OA 2K8GA 2XY5A 4MFBB 2VG6A 1FX2A 1FK9B 3V6KA 2AMCB 2QRRA 3TZYA 3TUZC 4JI6F 2XHCA 5EX3A 3H25A 2NXNA 4UUXA 3MCNA 5H1SV 5HLFA 1U0HA 1SXLA 2DGXA 2VJUA 4WU2A 4AL6A 1S97A 3BQ2A 3MR2A 1V3SA 2ATCB 2KXHA 3SDEB 4DR4F 2YNGA 2HGMA 1Y3JA 1VHFA 2LLZA 1DY3A 3GSDA 4CP5A 1C1BB 1DHMA 1D8ZA 4OX7A 3DOLA 2MQMA 1FJ7A 4J90A 1KFDA 3KG1A 3L9ZA 5J2QA 4PUOB 1QUVA 2YWFA 3M05A 2BJ7A 1DTQB 2QE5A 4ECZA 5DS7A 1BHNA 5D0RA 2WZ1A 2P8IA 4O3OA 3M9NB 4R25A 3WHIA 2OD4A 1Y9OA 1HBNA 4HT7A 2IM1A 1ZYQA 2LQJA 4IOCQ 3ZTSA 3R5JB 3W8GA 3PVXA 5D4NA 1KOHA 2X3GA 3CWJA 3KDOA 4TVAB 2DTJA 4CO2A 3HSJA 1XNRJ 4EYIB 2CQIA 4KPCA 3Q8VA 4O23A 4HT5A 5DETA 2B0GA 1N6QB 2BM0A 1FO1A 1NEEA 5B09A 4RKUC 3PACA 3BJYA 1HYSA 4BCAA 1U49A 3FFIB 3K2YA 1UEKA 1TKDA 3UE2A 1D3WA 1LXJA 5KT2A 2DNLA 2WVEA 3PHTA 1H7XA 7FD1A 3FQKA 1QTMA 3VAIA 5E3PA 5ETPA 2C3MA 2DGOA 1TKTB 1GXLA 3Q8PB 2K1RA 1OYDA 1XEZA 1PILA 3UD4P 2GMHA 4P73A 4NYPA 2DH8A 4Q7AA 1NK8A 5LMNF 4WFBQ 2JL9A 5T41A 3SMZA 1FJGF 5HMZA 4ED8A 4F4YA 2DH7A 3M6WA 1Y4ZB 3GFXA 4NXMF 1Q0NA 2CNOB 4KRWA 4MYUA 1RHUB 2C3YA 5ADZA 4YDDB 1YBAA 2GGPA 5HL7Q 4DV4F 1GH8A 2ZH4A 3NGUA 5C2CA 1CJTB 4NZ0A 2K7JA 4WXWA 4KH0B 2F4VF 2WOMA 4Y2KA 5HROA 5CABA 2BW7A 4NEYA 3L7UA 4XDDA 1ZA2B 4DUZF 4ED0A 2HVZA 2BJDA 2BRKA 1S9GA 2M88A 3GR0A 2MMYA 1HNIA 4M8LA 5GADI 1VRTB 1RAIB 2HNYB 3D67A 3T5LA 4N8OA 4EGLA 3AB2B 3T1YF 4DJBA 3THPA 2BJ9A 3PO5A 2VFTA 4M5JA 4DHVA 1IBCB 2VPWB 4F4ZA 1RT5B 2XS7A 3D4JA 2YNIB 2L9DA 2V34A 3T1HJ 4LSNA 3QJPA 1APSA 2HLTA 2FVRA 1RADB 1MW7A 3T6BA 1O0PA 2HBZB 3QNWB 2V2QA 1CBKA 4F67A 4QPTA 3LANA 3CEDA 5A8RB 3OVBA 2WW8A 4NEZA 2UVUA 1CJUB 1PGZA 1N34J 1B7FA 1FXDA 1GXTA 4N47A 3UN2A 3X1LB 5HANA 4OHVA 4FS1A 2DEIA 2EW9A 3D3BJ 4C11B 2RRNA 2MGZA 2OPQB 1X4DA 4LFCJ 4DF8A 1L3VA 3F41A 4JUZA 3G8TA 4CLLA 2EKNA 5B0EA 3TVZA 4CLPA 2NPFA 3J7Z5 3UWTA 3OR2A 3FBEA 4ENOA 2V4JB 5EWGA 2MKYA 1QAXA 3I4PA 3WX8A 3DRRB 5LMUF 3DDNA 5LM7E 2HMIB 4A8KA 3SQOP 4YB1P 1UW4A 2V8DA 4KKOA 1T11A 1UCNA 5LSRA 1T7PA 1FWLA 5I3UB 3OTBA 3OTDA 1YK9A 2ZBPA 2DGWA 1PYTA 4RNNA 3KNGA 2ZKTA 1JLBB 5JVHQ 2HHHF 2VG7A 2DO4A 2IYGA 4ZN1A 1T03B 4CRJA 4ZCKA 2R2TA 3THTA 2DNYA 1RU1A 4RU2A 4Y00A 5AXMA 1F9HA 3MXHP 3M6XA 4OHXA 3AXMA 2FB0A 1FKOA 3RBEA 5KFHA 3MTKA 1I5OB 1HNWF 2WVDA 2EG1A 2DRBA 1C1CA 2DHGA 3NMAA 2RILA 1VC0A 3N79A 1Q16B 1DAXA 2NUUG 2IVMA 3H90A 2BE2A 3GP9A 3LWLA 3ZTRA 3D6MB 4MAKA 1TTHB 4NX9A 5L1KA 3JB9k 3RGIA 4OIXA 1B3TA 1ZAXA 2VQFF 2LXUA 4WYLA 4NCGA 4CLSA 3FVYA 3IWNC 3KLIB 5M2UA 1IJEB 3SFGA 4DL2A 4P9SA 2G13A 3B8HA 3NL0A 2FVPA 3CT9A 4I1TA 1UP1A 3CCUS 1UJ5A 4F4KA 1JLGA 4M95A 3KWMA 1ZA1B 5FIIA 4FXDA 3TAQA 1AUSL 1TZ0A 3ISND 5DLGA 1WDDA 3I5CA 4ZKAA 2MPUA 4CLWA 1D09B 3EVWA 2ZBCA 2R7RA 1MMDA 1RKJA 3K5NA 2FHMA 1IR0A 1BGXT 1U8SA 3IRXB 3W9IA 1T02A 3IMQJ 2UUCJ 2AYBA 3DM2B 3ILOA 3PNIA 2F9JA 1WC4A 5IC4B 3NG8A 3QGIA 3I5AA 4M63A 4LREA 4F0KA 2Y1JA 2J6SA 3I96A 2W9AA 1DARA 4KHRA 5T14A 1U0SA 3R8YA 2CDRB 2XMJA 3EYZA 5HVFA 2QN6B 1F2HA 4LIWA 3CC2S 2HQGA 4YB6A 3DLGA 3GPAA 3VCDA 5HMWA 2L08A 1RE1B 2ZH9A 1JX4A 3R9LA 1IQTA 1MWYA 2MEWA 3EDQB 2PEHA 2VG6B 1AXQA 3KYLA 4M5HA 1KNZA 4F3MA 2HHTA 5D15A 2C2DA 3V4MA 5C2GA 2OD6A 3A13A 2FUG9 2BA9A 1H7WA 3QRPA 2MQLA 4H4KC 3H98A 1HHTP 2QSWA 2XQCA 1IR1A 1JWWA 2WSFC 1QDUB 1WTFA 2GVDB 4F7VA 4B3OA 2JJ4D 4Y28C 1HKAA 1C0UB 2OFHX 3R7BB 3X3UA 1QLNA 3FMWA 3VAHA 3DOLB 2VPZB 1EIYB 4B9SA 4WTYA 4UZCA 4AQYF 3MEEB 3TNVA 4NRTA 4C9DA 1HW9A 3K59A 1XQIA 2KFNA 2W25A 2FJWA 3AD8C 2QSFA 2OLWA 5A2QU 1U1PA 2D74B 3FNNA 1VFJA 2V6AA 4HDGA 4CI0B 4MIAA 3NXZA 5GMEA 4F02A 1PJ6A 2XNRA 4M5IA 2MQOA 1P1TA 3VR1A 3GIMA 1IN0A 5IT0A 1HBNB 2GJ2A 2NUHA 2GQ2A 3ITHB 4C8NA 2RKIB 2YNHB 1S79A 4B3SJ 2NLWA 3UVJA 3RJMB 2KG0A 5KFQA 4I2PB 4WE1B 2Z2MA 2IPOB 4F0HA 5KFXA 3CC7S 4FNHA 3OTOJ 2G4BA 2E9TA 4J9NA 5LXYA 3K57A 2EKYA 1NJWA 2I5JA 2F7VA 2C2KB 4AUKA 1LFPA 2HAFA 2HFVA 5GAHI 4V19X 1PKUA 2WCXA 4UOHA 1MU2A 5KFGA 3M8QB 1OQ3A 3T3FA 1KKHA 2OMOA 3MCSA 2HFUA 2VBXA 1EETB 4M1KA 4ILMA 3GJQB 4BWJA 4WFXA 2MHEA 1RBLA 4USHA 2XMMA 2UUBF 1L3UA 3G4SS 2ASYA 4CO3A 4URGA 2XY6A 1RTDB 3N5FA 4PG6A 1GFWB 3V81B 2OH2A 1QM9A 2F4FA 1H2UX 4DCPB 3LP2A 3H5UA 3I0RB 1X4BA 2QA2A 3OSPA 4A8QA 2CAJA 2RS8A 5MAOA 3GSIA 2R7VA 4M5LA 4PEOA 4ED2A 2KT5A 4LUBA 5HROB 3T19A 1WC5A 4WFNQ 3I31A 3BBBA 2RIJA 2H54B 2ZUAA 2AHOB 2QJ3A
chains in the Genus database with same CATH topology
1S9GB 4Q44A 3IG1A 3E2EA 1X9SA 2XI3A 3SZ2A 2IYIA 3MM9B 2GMLA 1MU2B 5K14A 4ZMMA 2HHQA 2W9BA 2CJKA 4PXBA 3TVYA 4ZPAA 1D9DA 4LF6F 2WONB 1NO8A 1WEZA 3POTB 1KEKA 2DNOA 2KVIA 2QA1A 5E33A 1WG5A 3TQ1A 4X2BA 1I94F 2VB6A 3SCKE 3D54A 1IM4A 1UETA 3AH6A 4X84A 1FXRA 1L5UA 4OHYA 1Y5NB 3RB0A 2FLLA 4K50A 2E1RA 3I9ZA 4DV0F 4DS4A 5I3PA 2MZTA 3KTQA 3GB0A 3OTCA 3TW0A 3QZ8A 3I0SA 3LAMA 1R8BA 2BW2A 3OW2R 3GQCA 4USJC 4LFAF 2CPDA 2GX8A 4EO6A 1REVA 1FE4A 4YB7A 4OL8A 4CO0A 3VZHA 2BQ3A 1Y5IB 3SI8A 4DFPA 2RVJA 5B0GA 2KRBA 3I55S 3PRBA 4BHQA 4OJ3A 2FD2A 2B7BB 4IDKB 5EWFA 2GC8A 2AJFE 5F8JA 2DCLA 4X64F 3NS5A 1X0FA 3LAKA 4IQMA 2CQ0A 4F3OA 2ZOFA 2EWHA 3CPWR 3G71S 2NXUA 1OWXA 5IS2A 1OIAA 2LQBA 3HVWA 4LSNB 3GYNA 1S49A 2FC9A 1JLQA 2HNZA 2RUGA 1JNZB 4Y2IA 3DLEB 1CVJA 1DTTA 3OL7A 2GIRA 4DEZA 2KFZA 5CXTA 1NKBA 2ILZA 1LK7A 3LP2B 2F1FA 4CNYA 5CD4H 2GMJA 1FJEB 2XMVA 4EU0A 1HBMA 1SJQA 4CIOA 3NCPA 3MUVP 2LCWA 5F8GA 1ZM2A 4Y2CA 3T1HF 1S6PA 4G6VB 4DSJA 1N0VC 3M9MB 3R1LA 1TQLA 5A8WB 1ELOA 1RT4B 3PHEA 2OTJS 2JLGA 1N88A 2JLEA 2QLWA 2U2FA 1KHWA 3BGLA 4OI4A 3FDSA 1S1WA 5L1JA 4WZQA 4DL0C 2AJ4A 4OI2A 5BR8F 2AF6A 2HQ3A 4TXSA 1SJFA 3RRHA 1T05B 1S9EA 3C2PA 1JLEB 3J81Y 2E5JA 5IWAF 2V94A 2MJUA 4HTIA 4NLWA 2FVSA 4K4YA 1N34F 2MQPA 4LF8F 3DCAA 4NLVA 3S8SA 1LWEA 3AAWB 3DRSB 2DIUA 1BQMA 2BZ2A 2K3IA 1BQXA 3M8SA 1JIHA 1KOOA 1TV6A 2N82B 4QWDA 3IG1B 3DFEA 1KN6A 3VALA 1V6HA 2CIMA 1U24A 3AJ2A 1Z1ZA 4F8RA 5K14B 4XO0A 3TX8A 1K0TA 3GFHA 5KFIA 2W9BB 2HW3A 4QBUA 3MOJB 4B9UA 2ZZNA 3PFOA 3OR1A 4O3RA 4JBCA 1DLOA 4PG4A 1HD0A 3OBIA 2AGPA 2CQ3A 2CPFA 2GO8A 4NPOA 3DGPA 1W25A 3HMJG 3PX6A 4LFCF 3JTPA 2OJ3A 1DURA 3MM7A 4QWAA 1FK9A 3I0SB 4CO4A 1S1TA 2CRLA 4RUAA 3MD3A 2ADBA 5K8NA 2LMIA 4ELVA 1BD6A 4A8YA 1REVB 1WEXA 1HWLA 2FLOA 3H40A 1XN9A 1U1OA 5E3RA 2AX0A 1KVJA 2ZH7A 3KKFA 1V3RA 1YGYA 5J2PB 2VUGA 1QVFR 3PR4A 3VF0B 3DU5A 3NWGA