4O44B

Crystal structure of hiv-1 reverse transcriptase in complex with 4-((4-(mesitylamino)-6-(3-morpholinopropoxy)-1,3,5-triazin-2-yl)amino)benzonitrile (jlj529), a non-nucleoside inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A mechanistic and structural investigation of modified derivatives of the diaryltriazine class of NNRTIs targeting HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 99
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4o44B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44B03
3RBDA 4J9OA 1S1WB 4DG1A 1XR6A 4J9KA 2OPSB 2XI3A 1ZETA 4I2QB 2HAIA 2HNZA 4RUAA 4GC7A 1RTIA 4KSEB 3DLKB 4XO0A 3KLFB 1ZTWA 4F4WA 5K14A 2WOMA 2GC8A 5KG5A 4R5PA 1HQUB 2R2SA 2O5DA 4TY9A 1T03B 4KV8B 3UDLA 2WK4A 3QIPA 3DYAA 1QUVA 4RW6B 5JXSA 1JLAB 2OPRA 1VRUA 5CYMB 3V81A 3V6DA 5KFBA 5C42B 2FVPA 4TY8A 1MMLA 1TKZB 3C6TA 3TQ1A 1EETA 4ED1A 1IKYA 2UVVA 2AX0A 4ZHRA 4EBDA 4RUCA 4ZP9A 5KG6A 4MK8A 1NNDA 1RT4B 2OPQB 4NLPA 5KFUA 4TYBA 3ITHB 4ED2A 3LAMA 4NLSA 5KFLA 1BQMA 4MK9A 1MU2B 4HKQA 5KFWA 3HVAA 4RNFA 3KLEB 5D3GB 3DLGB 4KHRA 3HVTB 5KFKA 3QZ8A 2IA6A 1U09A 2D3UA 1D1UA 3PJWA 2QV6A 5C25A 3KK3A 3CJ2A 4RW7B 1FK9B 3E01A 3OL6A 1RT2B 4NCGA 5HBMA 4PWDB 1IKWA 2BR0A 3JSMB 2HNZB 5KFTA 5KFYA 5DQHA 3QGGA 2IM3A 3V4IA 4KB7A 4DG1B 5F8GA 1C0UA 3MEDA 1TL1B 3NBPB 4KFBA 3IN5A 5KFZA 2BQRA 2HNYB 4JUZA 3DM2B 2W9BA 3DOLB 4MIAA 5L1KA 3JYTB 3DRSB 5J1EA 1JLEB 1LWEA 4F50A 4ECVA 2YKMB 4YQWA 3KLIB 2VG5B 3NAIA 1T3NA 4MH8A 2IM2A 3RAQA 3H59A 1HPZB 4K4VA 4LSLB 1S49A 4NYZA 2OH2A 1DLOB 5DQIA 4URSA 5DGBA 3DRRA 4IFVA 3KK1A 5KFOA 1JLCB 5KG0A 2BRKA 2ILYA 1N6QA 2W8LA 1TV6A 3BJYA 3ITHA 3MEEA 4NLQA 3KHGA 3H4BA 3BSAA 1TL3A 3M9OB 3C6UA 1RT1A 4EO8A 4ECUA 1S1VA 4KKOA 2VG7A 1TKXB 3V6HA 1S0NA 2VG6B 3I0SA 1SUQB 1N5YB 4RZRA 3DYAB 4QWBA 4K4ZA 1LWFA 2YNFB 3HVWA 4ECZA 3M9MB 2E9ZA 1HYSB 4O3QA 1S48A 1DTTB 3M8QA 4LSNB 4YP3A 4K4XA 3T19A 4FS2A 2AX1A 2OPPB 3C6UB 3I5AA 2BANB 3I5CA 1QE1A 2HWHA 1LWCB 4ZP8A 3ISND 4XPEA 2ASLA 4K4SA 5DG9A 4Y3CA 3GILA 3OSPA 1S1VB 4KKOB 4ID5B 1UWBB 1S1UB 1JLBA 3RB6A 4WE1A 4IKAA 4IH6A 1RTDA 2W7PA 2ASDA 2FLPA 3NGDA 4IRCA 4MKBA 1S6PB 2RF2A 4RW9A 2RDJA 4B3OA 1HPZA 3VQSA 3H40A 3OL9A 1S9EB 2IM1A 2YNIA 4O3PA 1C0TA 5EUHA 1RTJA 4IH5A 1SV5A 3D5MA 1RT6B 1BQMB 2J6UA 3DM2A 1LWCA 1RTDB 1S1TB 3CJ0A 3FFIB 2AGOA 1RT5A 3EPIA 3Q8PB 3V6JA 2VA3A 4URQU 1JKHB 5C25B 3KK3B 4RW7A 5J2QA 5I3UA 2J6TA 1N56A 5KT7A 4Q0BA 4H4MA 1HYSA 4WZQA 4IG3A 3GQCA 4O3SA 4Y2AA 5KT3A 2UVUA 4I7FB 1S4FA 1K1QA 3N6MA 4DL5A 3E51A 4ZMMA 1MU2A 2JEIA 3SI8A 3BGRA 1HARA 3MEEB 2UVWA 3LP1B 3HVTA 1JLQA 3RAXA 3BQ0A 4ID5A 4Q44A 4Y2CA 5F8HA 4TQSA 3NL0A 1EP4B 2VG7B 4ECTA 4EO6A 1EETB 2R2RA 3T1AA 3CWJA 3GIKA 2ALZA 4KO0B 2DPIA 2ZD1A 3MEGA 1R0AB 3KOAA 3T5LA 1CSJA 3FQKA 4ZP7A 4ED6A 3KK2B 1JLAA 2OPRB 3DI6B 3V6DB 5KFSA 4QPXA 4IRKA 1N6QB 4JV2A 1K1SA 4DEZA 3GV8B 4O3OA 5F8JA 3QGIA 4IG0A 1S9EA 3TAMA 3CDUA 3DRPA 4F4ZA 2FLLA 5KFGA 2IAJA 4NLWA 4ECYA 1RTIB 3KLFA 3T5KA 4YR3A 2YNHB 2JC0A 5KG1A 3BQ2A 2I5JA 1QAJA 5KFAA 2BQUA 3DMJB 1UWBA 3BSNA 1HMVB 4O4GA 5F8MA 5I3UB 5J2QB 5HLFB 1C2PA 2W9CB 1TL1A 2B6AB 3FQLA 3QYYA 5JUMA 2UUWA 4R8UB 5F9NA 1HQEA 4O44A 3JSMA 4IR1A 1HNVA 2RDIA 1BQNB 3KHLA 2YNHA 4QWEA 1FK9A 3E01B 2RKIA 1RT2A 4NCGB 5KFHA 1JX4A 1SV5B 5KG3A 3KLVA 3EZUA 3OHBA 1LW0B 2IC3B 2FJXA 2D3ZA 2BE2A 4MK7A 2WONA 3FDSA 4RNOA 2YKMA 4RNNA 4MFBA 2FVQA 3LP0A 2HMIB 2XGPA 4EEYA 3DOLA 4TQRA 2W7OA 1S6PA 2RF2B 4RW9B 3NKYA 5HLFA 5EWGA 2ZE2B 3M8PB 2FJWA 4NLDA 4K4UA 4J9QA 1KLMA 5KFPA 2AWZA 3SFGA 1S9GB 4PWDA 4ZVGA 1TKTB 1J5OA 2WONB 3DRPB 2XI2A 4NRUA 4RW4A 1S0MA 4ED8A 2WB4A 4IOBA 4FBTA 4R5PB 3DLEB 3LP2A 5KFIA 5L1JA 1FKOB 4O4RA 3QIPB 2XCPA 2E9TA 1C1CB 3CDWA 4U7CA 1T05B 4ZPCA 2ILZA 4ECXA 3PHEA 2B6AA 2I1RA 2WHOA 3H5UA 1KHVA 4DL2A 4ZVFA 2C2EA 1RTJB 2FJVA 5J2NA 4QW8A 2D41A 5C24A 3T5JA 2XWYA 3KK1B 2IJNA 3LAKA 1TVRB 1DTQA 3H2LA 1HNIA 3BGRB 4Y34A 5KFQA 3CDEA 5J2PB 4WFYA 4NLRA 4RW6A 4MFBB 1GX5A 3PW2A 1RDRA 4DL3A 5KG7A 2VA2A 3KLIA 4KBIA 3UPFA 2IC3A 1S1UA 2B43A 2J6SA 2R8IA 2C28A 3RB3A 5F8NA 1RAJA 5KFRA 4M95A 2W9CA 4ZP6A 1TVRA 4X2BA 4WXOA 1HNIB 1IKVA 2B5JA 5C5JA 4R8UA 4NLUA 5J2NB 1S1TA 3PJXA 2GIQA 3V6KA 2W9BB 3T5HA 4WZMA 1JLQB 1RT6A 2IAJB 3PZPA 3DLEA 3LP2B 3OL7A 3PW0A 3KHHA 2BANA 4ZPDA 3LALA 4TXSA 1JXLA 3BSCA 3Q8QB 4RW8A 2IMWP 3TVKA 4EBEA 2YNGA 4IG3B 5F8LA 5DLFA 3NMAA 2CKWA 2R8KA 2WCXA 2ZE2A 3QO9B 3OLBA 1WNEA 3RB0A 3MR2A 4IFYA 4EBCA 1GX6A 3H5SA 2XC9A 1LW0A 4JV0A 1JLGB 2YNGB 1SH0A 3GIIA 2R8GA 4IRDA 3LP0B 3ISNC 2HMIA 2YKNA 3MECA 2IM0A 4PUOB 1T03A 2IBKA 4Q8EA 3KHRA 5EWFA 4FS1A 3IRXA 3V81B 4I2PB 5KFXA 5HROA 2HNYA 1HNVB 1BQNA 1REVB 2FVCA 3N6NA 4I2QA 1S97A 1JLEA 1LWEB 1IKVB 4YMEA 5KT4A 2DPJA 3DLKA 3CJ4A 4O4GB 3GV5B 4FBUA 1FKPA 3V4IB 4DL4A 5L1IA 1LW2A 5J2MA 3FFIA 2I5JB 3DRRB 4IFVB 1QAIA 4O3NA 5HROB 5KG2A 4G3IA 3Q8SB 1RA7A 5D3GA 5KFNA 4B3OB 3KMSA 1TP7A 3DOKB 1RA6A 2CJQA 3MR5A 2E9RX 3I0RA 2ZKUA 4LQ9A 4Q45A 2IJFA 3KLHB 2EC0A 2BQ3A 5KFVA 4K50A 3KK2A 4DL6A 1TKXA 3EPGA 3UR0A 1RT4A 2OPQA 3HKWA 3NBPA 4KFBB 1C0UB 3MEDB 4KE5A 1RYSA 1JLBB 4IFYB 1RT3B 4MKAA 1C1CA 2JC1A 5DQGA 5KT2A 3PR5B 3H4DA 3KLHA 3QIDA 4TY8B 5F8IA 4KHMA 4IR9A 4OL8A 4G1QA 1YVFA 3UQSA 4HYKA 4I7FA 3DI6A 3IGNA 2C2DA 1S1XA 1RYRA 1RT3A 4J9PA 1HQUA 1HQEB 4QWAA 4URGA 4NRTA 1S9FA 3KMQA 2R2UA 5KFJA 3PR4A 2R2TA 3H98A 1EP4A 4K4WA 4TN2A 1TL3B 3OSNA 2AQ4A 2BE2B 2OPSA 1SH2A 5KFEA 5CYQA 2FLNA 3FRZA 2V4QA 3DOKA 5KFCA 5KFMA 1OS5A 3IS9A 3M9NB 3BR9A 3GIJA 4IQXA 3OHAA 4NLGA 1JLCA 4O44B 2V4RA 3I0RB 5C24B 1JLFA 3CIZA 3ICLA 2WOMB 2RKIB 1JLGA 2AU0A 4JV1A 5CYQB 1C1BA 1ZTTA 4TYAA 3KLGB 3QGHA 4WFZA 3IGVA 2R8HA 4TLRA 4J9LA 4RNHA 2C2RA 3DMJA 1T94A 2JEJA 4IH7A 3KJVA 1S6QB 2HNDB 3BREA 4WXWA 3MF5A 1IKYB 5HBMB 5KT6A 4RNMA 3IRXB 4NLVA 4WYWA 2V9WA 4LQ3A 4G1QB 4Q8FA 1TKZA 3C6TB 3HHKA 1TQLA 3DDKA 1T05A 4MIBA 2WRMA 5L9XA 3G6XA 3N6LA 4ECRA 1N48A 1S1XB 4ICLB 3BQ1A 4ECWA 4U6PA 3OLAA 1S9GA 3MR6A 3KLEA 2FVSA 1XR5A 3I5BA 1RT7B 5KT5A 4H4MB 4RU9A 4PQUA 2HWIA 4J9SA 4RW4B 4NLTA 3BSOA 4ED7A 5I42A 2YKNB 3MECB 5K14B 4Q43A 4M94A 2VG6A 3I0SB 1S0OA 1SUQA 3GIMA 5EWEA 4WYLA 5KFFA 3KJVB 3QO9A 3QZ7A 4ZPBA 3LP1A 3M8PA 3NAHA 2JEFA 2JEGA 5DGAA 5C42A 3PVXA 1KHWA 3GV7B 3CJ5A 1N4LA 1S10A 1JLFB 1D0EA 4ICLA 5I42B 2YNIB 1SH3A 2AGPA 2VG5A 3GYNA 4F4XA 4IDKA 3QLHA 1FKPB 1RT7A 3IG1A 3Q8RB 1IKXB 3D28A 4WFXA 3H5YA 4LSLA 5J2PA 3MFHA 1N5YA 3MTKA 4EYHB 3CJ3A 2JLEA 1S6QA 2HNDA 4QW9A 3PW5A 4KV8A 5DG7A 3KNAA 1RT5B 4R0EA 3KLGA 3MFIA 3LANA 1W25A 1REVA 4H54A 3JYTA 4NLOA 4NZ0A 2XCAA 4ECQA 1JKHA 2UVRA 1TV6B 1VRTB 4IDKB 5F9LA 5DG8A 3G6VA 1IKWB 2R8JA 4I2PA 4H4OB 4EYIB 4QWDA 3QLHB 5FDLA 1Z4UA 3IG1B 4IG0B 3TAMB 3G6YA 4WE1B 5L1LA 4XPCA 1RTHB 4K4TA 4ZVEA 3DRSA 5J1EB 1VRTA 4NLYA 2W8KA 5DLGA 4F4YA 1RT1B 2GIRA 2ZD1B 3MEGB 4KO0A 2WTFA 1HMVA 1QE1B 5HP1A 4ZPAA 1IM4A 4ED0A 2W9AA 3PW4A 2OPPA 2QE5A 1FKOA 1NHUA 1RTHA 2D7SA 1DTTA 3M8QB 4LSNA 2UUTA 4KAIA 4NLXA 3OL8A 2XGQA 4DL7A 3RB4A 5EDWA 4PQUB 5FDLB 4ECSA 1VRUB 5CYMA 3RBEA 2FVRA 3DLGA 1TKTA 1J5OB 5T14A 2ASJA 4RW8B 5KG4A 4O3RA 3CVKA 4QWCA 2AGQA 5HP1B 3MR3A 1LW2B 5J2MB 1R0AA 4J9MA 2B5JB 1JIHA 4YR2A 1LWFB 2YNFA 3SFUA 3H5XA 4YR0A 4ZHRB 2C22A 2BRLA 1KLMB 2ATLA 1S1WA 4ED3A 1C1BB 4J9RA 1I6JA 4K4YA 4ZVHA 3FSIA 1IKXA 5KFDA 3CO9A 4H4OA 1C0TB 3PW7A 1XR7A 4GC6A 1DTQB 4PUOA 4Q0BB 3G86A 3IS9B 2F8EX 1DLOA 1NHVA 2V0NA 4J9NA
chains in the Genus database with same CATH superfamily
1WDDA 5E41A 2HRTA 5IT9Y 4Y65A 2DNMA 1XR6A 2G1DA 2CG8A 3MAHA 3ZTQA 1UW9A 3VAHA 4J9KA 2XY5A 3AB2B 2HAIA 5HMYA 1AFJA 2Y8WA 2VQFF 4DDFA 4KSEB 3KLFB 2Q6BA 3CC2S 4MKYA 2RRAA 2MLXA 3Q8YA 4R0JA 1WUUA 4WJBA 4ZDNA 4DSFA 2BBEA 1HQUB 2R2SA 2EK6A 4B02A 2GVDB 3M2VA 4WIIA 5HVFA 3DYAA 1DARA 3HK2A 3C15B 3V6DA 3KNGA 3QT7A 2ZH8A 3UN3A 3LOUA 3NNCA 4USKA 1Q95G 1MMLA 4PZVA 5EX3A 5HMXA 3EE3A 2UVVA 2Z2MA 1R27B 3CIMA 4ZHRA 2M4MA 4EBDA 2W2PP 2IPOB 4OX9F 4ZP9A 5A2QY 1NK6A 4YB7A 4I68A 3BQ2A 4DSLA 4RX6A 4MK9A 3K57A 2AEFA 4DR1J 2NLWA 2ROEA 1X7VA 4KHRA 3JTPA 1Y9OA 1U09A 2YVSA 2XMTA 1D1UA 3Q0AA 3H8YA 4OHYA 2DGWA 3NOGA 3KK3A 4PYAA 1YBTA 1ZAVA 3OL6A 3M32B 1VIOA 3FEXB 4LFCJ 4S0MA 1NUEA 1SJRA 3CMQA 5KFYA 2DNGA 3IMQJ 2WVBA 4I69A 1HBNB 2IM3A 4Y28C 1NKCA 3KJQB 2BJ9A 2XEXA 3IN5A 3ZZPA 1ZA2B 1OY8A 3DM2B 1FRHA 3OXGA 2W9BA 1Q4RA 1RAAB 4MIAA 3JYTB 2YTCA 4U96A 3ZC4A 1T3NA 3DN9A 4EZ9A 1UETA 3MMJA 1XN9A 2N82B 2LXIA 3SYZA 2K3KA 2MLZA 1IQZA 4MT1A 3TZWA 4CO0A 4DU8A 3UE2A 1RGVA 2FZKB 2XMJA 1JK9B 4LSLB 1S49A 2RH3A 2VBZA 4F3QA 2QLXA 3D0GE 1DLOB 4DCJB 3KG1A 4JI1F 3AJ1A 4NASA 2ABYA 4B08A 1VFJA 1B70B 2MKIA 1N6QA 3D9BA 3AT1B 3LGHA 2W8LA 3A8JA 5K8MA 3WC2A 3PACA 3BJYA 3CULA 1T8EA 2UU9F 3NNAA 2RT3A 2MQQA 2GJFA 3AQOA 2CPFA 3BSAA 4ECUA 1RT1A 4PQAA 4EO8A 1S1VA 1TKXB 3MEKA 1HNWJ 3BBCA 3BN7A 1WHXA 3DYAB 4ECZA 4LREA 3EXCX 3W63A 1DTTB 3M8QA 1B0VA 2BX6A 3SXLA 4YP3A 3T1YJ 3T41A 2AX1A 4GKJF 1RKIA 1J5EF 2KYZA 1ZAXA 4DV3F 3I5AA 3I5CA 4TU9A 1O51A 2F3JA 1WSVA 3IXQA 2HWHA 2ASLA 4I67A 3Q2SC 2DY1A 1PC4A 2C3OA 2KXHA 1UVLA 3CNQP 3AAWB 1Y3KA 4Y3CA 3GILA 3OSPA 1S1VB 3FGVA 3I96A 3PY8A 4WE1A 2Y1JA 1RTDA 3KDOA 2ASDA 3NGDA 2CVIA 3RJMB 1S6PB 2EFOA 2KDOA 2MKJA 3KG0A 3MAAA 2DNLA 4H4KA 1PBAA 1HPZA 2ZC4A 3H40A 3R27A 1R8HA 4IUFA 3R8YA 2NXJA 3S6EA 1C0TA 1CBKA 4KQZA 3RZAA 4IH5A 1U0HA 2QL7B 2RS8A 1BQMB 3DM2A 1LWCA 1G1XA 1S1TB 2NPIA 3CJ0A 3FFIB 4OJ3A 3D0HE 3BH6B 1RJJA 3CCZA 1L3SA 1WI8A 3LWMA 2VA3A 4URQU 2CWXA 2E5IA 3Q89A 4LR8A 4RW7A 4KRWA 3HM9A 2YY3A 4LFAF 1BD6A 2HSEB 3ELHA 3OT9A 1NXIA 2ZJPQ 4WZQA 4X4NA 4Y2AA 3S1TA 2OFHX 5KT3A 2UVUA 2H9ZA 2MY8A 1FWKA 4QR0A 3E51A 4ZMMA 4DL5A 1MU2A 3J7A1 4M5JA 3SI8A 4CP5A 2XZWA 1HARA 5KOWA 1S57A 2H1YA 2Z0GA 4P52A 3HVTA 1JLQA 2EKYA 2PA3A 4TQSA 4Q44A 2UVWA 2BUNA 4EO6A 2RHQB 3EZOA 3HDSA 3ETOA 2OSRA 2YBVA 2DNOA 4QPTA 1X8DA 1DQAA 2AYMA 3PCOB 2XB2D 1G2EA 2OPRB 2CJKA 1B64A 4ZVSB 1U02A 1H73A 1XBWA 2V4JA 2WSEC 3X3UA 1NJYA 2ZEJA 2YH1A 3CDUA 1LFWA 2LQBA 3K17A 5KFGA 4DQSA 3KLFA 3LO3A 4NA3A 4YR3A 2HS0A 3MMAA 2CPHA 2MQMA 4P2MA 1E6VA 1QAXA 2AKWB 2CNOB 2G0IA 2QZ8A 3QSYB 1HMVB 1XQIA 1FA0A 1ZM3A 5I3UB 5J2QB 2M5YA 5F8MA 1M5PC 1HR0F 5K9FA 2W9CB 4P2FA 2VUGA 3CCQS 4ZA1A 3MMBA 1UEKA 2VFRA 2I6WA 2IRUA 3K5NA 2XZTB 3P96A 3N01A 3CC7S 1KQFB 1BQNB 2YNHA 1T0TV 1B99A 4NCGB 3MUMP 3PO5A 1WD6A 1U0SA 5HI7A 1M5KC 2UXDF 3D54A 1FJGJ 1IUJA 1LW0B 2P2CB 3OHBA 4KPYA 1U6FA 2BE2A 4MK7A 3NCQA 1CJVB 3S01A 1FFGB 4X4TA 2RVJA 2XGPA 3VTIA 4OHWA 4EEYA 3DOLA 3SDEB 1VQKS 2RF2B 3BPSP 3G4SS 2BW7A 2DTJA 2O01C 1ZETA 4K4UA 1BXNA 2HVIA 4J9QA 1KLMA 3RR7A 3LW5C 3K5PA 3OTBA 2EG2A 2VFVA 3VQTA 3J81j 4DPTA 4ZVGA 1SC6A 4DR5J 2JH3A 2XI2A 1S0MA 2UUBF 3IO1A 2VQEF 4R5PB 1S7IA 2DVIA 1F0XA 2UUBJ 2VC0A 3VAIA 1PYOB 3D68A 1R8AA 3QIPB 1N54B 4OZNA 1H2TZ 4NXMJ 3HI9A 1C1CB 4ZCLA 1T05B 1IR2A 4HHHA 4OYOA 4L3KA 5A0YA 2EW9A 5ETQA 3H5UA 4U7UD 4E98A 1NK8A 3PFOA 2CDQA 2XMUA 4ANEA 1OQ6A 3DLJA 5J2NA 4ZLNA 1X31C 1FD2A 2R7QA 3DOMB 4QW8A 2XWYA 1TVRB 4PG8A 3HHDA 4F0HA 2HRUA 4FKYA 4QYRA 2D69A 4NLRA 2QFIA 1P6TA 1GX5A 2HYIB 5I4MA 4AT1B 1Q53A 1S1UA 3C16A 1UFKA 2HHHJ 2YQ0A 2C28A 3K59A 1HD1A 4DX8H 2AZ1A 4BDPA 1RAJA 2G0JA 2V94A 3ET6B 1LOUA 3VGUA 4UZBA 4ZK7M 1S76D 2W9CA 2B4VA 4ZP6A 3CD6S 2NUHA 1HNIB 1IKVA 4C9DA 1OY9A 1N5TA 4R8UA 1GMUA 4P73A 5J2NB 1S1TA 2MKHA 2NS1B 4OV1A 2XNQA 4PXDA 8RUCA 4CYUA 4CO2A 1RT6A 2IAJB 3POTA 3DLEA 5GVQA 3CEDA 2HHVA 3R5JB 2KI2A 4HHJA 3WBZA 6AT1B 4A8QA 4N41A 3HSGA 3W5ZA 1VQ7S 1JXLA 3BSCA 3BDPA 1TL7B 5C2CA 3OPKA 1WKKA 5F8LA 4OMFG 3UW1A 2JFKA 4CLYA 4KGXB 2LECA 2RILA 3O2IA 2R8KA 1S6UA 3OLBA 4MAKA 1I94J 4FYWB 2XSFA 2PEHA 2HZCA 4HR2A 3CCLS 2DHHA 1TFYA 4JOUA 3NGKA 1ZPWX 2KHDA 3ZTOA 2UUAJ 3M6WA 3MM7B 2DH8A 3OXLA 3W61A 2XC9A 3R6GB 4FF4A 4DR2F 2F4FA 1OSDA 1JLGB 2YNGB 1U8WA 3MPYA 4DN9A 2A2DA 2PN6A 5HATA 4CNZA 3ISNC 4NL5A 3HJFA 2YKNA 3MECA 2IM0A 4NYOA 2A2CA 5KG7A 4WP9A 4LFAJ 3CXCR 5HQMA 3G8QA 2DR5A 2VOPA 4USJC 4JI3F 3CJKA 2JNJA 2KVIA 5DJBA 3FK4A 5CD4H 4DR6J 4I2PB 1KWMA 1Q5VA 2MQNA 1WOOA 1R6VA 1S97A 1LWEB 4YMEA 1NSPA 4HHUA 2GO9A 3VHQA 1BQXA 1HA1A 3DLKA 4DLGA 2MQ8A 4JI4J 4FF2A 5AXLA 1FKPA 4DL4A 4JI4F 1T9VA 2Z8QA 4BHQA 4FPRA 2CPXA 2I5JB 1GMWD 2WW8A 1UJ5A 2W24A 3EXYA 5A76A 1OJ4A 1RA7A 5D3GA 1LFPA 2XG8A 3US5A 1TP7A 4ZN3A 3DOKB 4WWSA 2E9RX 1TZ0A 1NDCA 1NDKA 2IJFA 3KLHB 4LIWA 2ZH7A 2Y1RI 3ADAC 3RBXA 4OX7A 5KFVA 1XNRF 5E0OA 2R3VA 1TFWA 4DL6A 3EPGA 3DLLQ 3UR0A 5AJ3J 2KG0A 2DGXA 2DEIA 1N0UA 2DHGA 3HKWA 4KFBB 3PG9A 1RWUA 1WEZA 1PJ7A 2QSWA 1JLBB 5K8NA 1RT3B 1RYSA 2KFZA 4GKKF 1TAUA 4DR2J 1WTBA 2OIHA 2IFXA 3DXBA 4DCOB 3FBFA 2CQHA 3H4DA 3W2VA 2E7WA 2KJVA 3Q86A 4TY8B 5B0DA 5F8IA 4JP8A 3IWXA 2OD6A 4HYKA 4G1QA 1D9AA 3UCGA 3I9V9 1RUSA 4CLPA 2O3DA 1JJHA 2BJ3A 4ZVOB 2D3OR 1XWLA 3IGNA 4DMZA 1S1XA 1NPPA 2HK2A 1W7WA 3UVJB 1IVZA 1RACB 3M2UA 4QJVA 4QWAA 1VQYA 1D09B 2AJ1A 4NRTA 3IR6B 4M5IA 2R2UA 1MWQA 1P8GA 5KFJA 1NB7A 3QJPA 3H98A 1EP4A 4K4WA 4TN2A 1NDLA 1V3ZA 2Q43A 2AQ4A 2BE2B 2X1FA 2AD9A 3FRZA 4CH7A 2QMXA 4JI5J 5ETOA 4X4OA 2X51A 3SCJE 3WC0A 4DUZF 2C2NA 1JLCA 2V4RA 4CO1A 5C24B 3C14A 4C0OC 3H90A 1U2FA 1PKUA 3DRXA 2NSBA 1JNRB 4QR2A 4WIQA 1VC6A 3JTOA 4OI0A 3PEHA 3AHPA 5SZTA 1C1BA 2HGNA 3IM9A 3QGHA 4M5DB 5I3PA 3IGVA 2R8HA 2ZJQQ 4RNHA 3DLHA 1KVIA 3KJVA 1HHSA 3O8WA 3MF5A 3CMAS 3FEZA 4LFCF 5KT6A 4RNMA 4ZCIA 4LQ3A 1UJ4A 2DNPA 3EDRB 5AXKA 3FVYA 3P5TL 1FNXH 3K0JA 1KR4A 3MCSA 1T05A 1B7FA 4KIAA 4ECRA 7FDRA 2GQCA 3VAJA 1VLYA 2DEJA 2M8DB 2DXFA 4USUA 3MR6A 4DR1F 1T11A 2QL5B 1CQMA 1F2HA 2GMHA 4H4MB 2J8SA 4PQUA 2HWIA 4J9VA 2XLIA 4J9SA 4NXMF 2RSQA 4ILLA 3OQ2A 4O0NA 4CDIA 4DI6A 4Q43A 1LKZA 4OYBA 4LF9J 1S0OA 2L08A 2BW2A 3ZZTA 5DDQC 3KJVB 5KFFA 3EYZA 1CJKA 5EGYA 1RCOB 4DUYF 2JEGA 3EGWB 8AT1B 1I51B 3IR7B 4UQTA 3GV7B 1RAHB 2RB7A 1ZM2A 3WHIA 2V9KA 2DHXA 4ICLA 5I42B 1Q8LA 2QA2A 3G2XA 1F60B 4P9SA 3CW2C 4UOFA 5A8WA 1B4SA 3D4JA 9RUBA 5AXMA 3H42A 4F4XA 5DRKA 1RT7A 3NGRA 3Q8RB 2XWXA 4WFXA 3H5YA 4LSLA 5J2PA 1OWXA 2I8EA 1N5YA 2GHWA 3A12A 3BR8A 3GTYX 3MTKA 2HNDA 1F6TA 4QW9A 1AZSB 3W8PA 3L3CA 1RAIB 3J7YI 3LANA 5E5NA 1REVA 4NLOA 2R7OA 1P1LA 2HLTA 3P4UB 5H9FJ 3THTA 4IDKB 2JLFA 3MCOA 3PFEA 3FJ2A 1SL1A 2R8JA 3GJSB 3W3SA 2YKAA 4DPOA 4QWDA 1XMQJ 1Z4UA 3MTJA 3M6UA 3KWMA 4FVCA 3TAPA 3F44A 1WOPA 1RTHB 4LRCA 3J80U 5K5MA 4AQYJ 4JI7J 3ZNJ1 1VRTA 1MN9A 4NLYA 3QGPA 1KRPA 1WC6A 1FJEB 4LF5J 3CCSS 1JXVA 3AOCA 3PX6A 2M88A 4GO7X 1U1QA 1G6BA 3BN4A 1SQGA 2U2FA 4DV0F 4ZN1A 3T1HF 3C19A 2FJEB 1IM4A 2B9EA 4OZJA 2WAQD 2YX1A 3B4DA 4ZPAA 1RZMA 4AFFA 4CLTA 3TJAA 1WC4A 3OV7A 4DR7F 1RWMB 3OVBA 1EARA 3MPDA 6FDRA 1QTMA 2WVEA 3KHGA 4LSNA 1HW9A 3TO8A 2KU7A 1H3DA 5GMEA 2P6TA 1J2VA 2DXDA 4PQUB 4HH0A 2HBZB 3Q24A 2ZOFA 1DJ0A 2FIUA 2ZOMA 3C15A 3DLGA 1J5OB 5J1PA 4FYXB 1X9SA 5H9EJ 1TK0A 2Z56B 3BO2A 3MHYA 3MR3A 1S5ZA 1WDTA 3PRBA 3RRKA 3NL0A 4DFJA 4NWBA 1DRZA 4FYDA 3BB5A 1O5JA 1Z2LA 1IBCB 3UD3P 1X5PA 1HI8A 1XERA 4JYAF 4C8ZA 3EVOA 4J9UE 2EBEA 4OJ1A 4F0KA 5B08A 4X4SA 1PG5B 5E3AA 4ED5A 4ED3A 1IBKF 5LMNF 1JWWA 4J9RA 3PJ9A 2AMCB 1Y3JA 3OUYA 1N32J 1IKXA 3BKTA 2OMOA 4H4OA 1NBEB 2U1AA 2MQLA 2R7RA 2LP4A 3EUNA 3OJUA 3R2CJ 4M5MA 2KFNA 1ITPA 4PUOA 1H2UX 2DITA 2F5GA 5HJXA 3GU0A 4YOEA 3ENVA 3WDOA 1FX2A 4DV2J 2ZNZA 5IWAF 2XMAA 4A8WA 1YG0A 1S1WB 1T9UA 3ZZOA 3PKMA 3TA1A 5ETLA 4UY8T 4ETZA 2P5VA 1SC3B 3BV8A 3BKFA 3HVRA 2CUYA 4I6AA 4C8YA 4RUAA 2R7VA 3J80Y 3PX0A 2HRYA 5KG5A 3MURP 1IBMJ 2RAQA 5T41A 4KV8B 3UDLA 4NA1A 4ZVQB 3FBBA 1VQMS 4RW6B 4OZ5A 2OPRA 3OFHA 3V81A 2NCKL 1KTQA 1XIQA 5L39A 2BJ8A 2V4JB 2ROPA 3VCDA 1Q81T 1N33J 1EETA 3TUZC 2AEJA 2X3DA 4U95A 2QLJB 3H2VE 2CZVC 2AX0A 4M5GA 3O3LA 5CA5A 2GVZA 3MDFA 1FO1A 4JI8F 1N52B 5KFUA 1F5BA 1OQ3A 3LAMA 1CJKB 4NLSA 5GMDA 5B0FA 5KFLA 4HKQA 1N0VC 3HVAA 1CC8A 4RNFA 1UEUA 1SKUB 2E7XA 5D3GB 2V8PA 2VV5A 3DLGB 2YH0A 4G1PA 3MOJB 3HVTB 1EKRA 1TUGB 1L5UA 4DS4A 2IA6A 2D3UA 2MZJA 1AUSL 2ZHBA 1YRTA 2QLWA 3CJ2A 3QWUA 4N8NA 4OHXA 1FK9B 3E01A 2GQ2A 4NCGA 3IBCB 4OZ1A 3U1MA 5K20B 2Z57B 1KSPA 1RHMB 3JSMB 2N7YA 4ZIVA 3M8SA 1YLXA 1VBYA 1QSLA 3SEOA 5GMKa 4X64F 2YX7A 3U27A 3NBPB 1X4CA 4FDFA 3VGVA 3MUVP 3Q8UA 3OR2A 1UVNA 2MEWA 3DOLB 3SDEA 1N5VA 3OTEA 6FD1A 4DR3F 1NSQA 4DPWA 1VBZA 1LWEA 4F50A 2W2MP 3KLIB 3NAIA 4TKTA 4UUXA 3U02A 4MH8A 1CJUA 2DIUA 3RAQA 4B3RF 2LQ8A 1HPZB 1K9MT 1WC1A 3UDEA 1RHRB 4PPDA 2H5IB 4URSA 1IM6A 3N0VA 3VZHA 5DQIA 4IFVA 1LK7A 1KFDA 4KTQA 1JLCB 3G71S 5D15A 3PRDA 4ER8A 2UV8A 3KFWX 2APOA 1TV6A 3R7NB 3GB0A 4OJGA 2IRXA 1WKJA 1ZYQA 4NLQA 2QO3A 3H4BA 3RR8A 3M9OB 3V6HA 1C4AA 1HNZJ 4QIFA 1AYEA 1U24A 4AE5A 4NCBA 2VG6B 1TL7A 2FHJA 3AA9A 1N5YB 1VRQC 2QG9B 5ETRA 5GAEU 2HKEA 2YNFB 2DR8A 2VFSA 2E9ZA 3M9MB 1TK5A 1HYSB 3D6HB 1LXNA 4O3QA 3U7JA 4DV1F 3GFXA 4NXNJ 2VICA 4V19X 4FS2A 3T19A 1VQ9S 5GAGU 3NP5A 4X4UA 1LXJA 2PMHA 4G65A 2OPPB 3HPOA 2KT5A 3BH7B 2BANB 4HT7A 4ZJQA 2PFDA 2EBGA 1HBMB 1AXQA 4ZP8A 4XPEA 4K4SA 2HAFA 5DG9A 1S6OA 4WK1A 1UWBB 1S1UB 2ASYA 3M8YA 4ANDA 3RB6A 1QLNA 4IH6A 2VOOA 4JV5F 1OPZA 4HH1A 1S59A 2ZBRA 4MKBA 4B9NA 3L09A 5H9FK 2HHXA 3IFEA 4B3OA 1NAQA 2ADCA 1VIXA 2JVOA 4E2FB 4AUKA 3CCWA 3TI0A 4DSIA 3OL9A 2G2YA 2LYVA 3BF4A 3FC9A 4FKXA 1MN7A 2ZUAA 4O3PA 3HLUA 5LT5A 3VR1A 3U1LA 2A1BA 1TKDA 3M4XA 4AL5A 1P1TA 1Q7LB 2ZBPA 2B0GA 3GSIA 4MYTA 3TRGA 1Q79A 3RRHA 1U47A 2HVDA 2IJRA 2IDLA 2MZSA 2KFYA 1RT5A 3EPIA 1VK8A 1CS4A 1R89A 3NWRA 2EFVA 3IR5B 3KK3B 1WHWA 2XHCA 1X5OA 2F8HA 4HI2A 2J6TA 2DYAA 1NZAA 2PGCA 2VDHA 2HS3A 3TJ8A 2ZKTA 1CULA 4C48A 2B3TB 4QOTA 2K8GA 4IG3A 4O3SA 1S4FA 4QCLA 4ILRA 1ZBTA 2V8DA 3BGRA 2CFXA 3B4MA 1FI4A 3J81Y 3ILOA 3LP1B 2OAUA 4HLBA 4HT5A 1RTZA 1FRKA 4I6WA 4Y2CA 4ZOSA 7AT1B 3W9IA 1EP4B 1WC5A 2VKZG 2FUG9 3FCVA 2D9OA 3GIKA 4KO0B 3A3OB 2ZD1A 3BZQA 3CD7A 4C0BA 3T5LA 1V3SA 1CSJA 1PBUA 4ZP7A 4WKYA 2QLBB 4NZ7A 3TW0A 2QFJA 4WBFA 1KNZA 1PO6A 1N6QB 1R8PA 3GG1A 4EI2A 2AW0A 1MLAA 1Q5YA 1VQLS 2O67A 3TVYA 4O3OA 3GV8B 1T02A 5LJ3Y 3H0PA 4PPZA 3U1NA 2Z2ZA 4EWTA 2Y0BB 2HHQA 5F0WA 3DRPA 1NU4A 4F4ZA 1NO8A 2IAJA 4NLWA 4P74A 4FVMA 4ZJOA 3MZIA 2YNHB 5KG1A 1TK8A 1QAJA 1YZ6A 3KG4A 1YBUA 4RWXA 1M1HA 2M3DA 3MMCA 3R9LA 4CTAB 2MKCA 2GMLA 3BSNA 4A8OA 3W1YC 2IYGA 1ZAWA 2BKOA 2IY5B 5A2QU 4HVZA 1TL1A 2B6AB 3QYYA 4KY3A 4P7TA 4I56A 3W64A 2I9SA 4GVBB 5F9NA 1HQEA 2F65A 5DETA 2E1PA 5FD1A 2RDIA 4CLFA 1X4GA 4DR4F 1MW7A 1AROP 1D9FA 4B3MF 5KG3A 2V63A 2XTJP 3EZUA 3HO1A 4FF3A 2D3ZA 4RU2A 2WBRA 4LBPA 2PT0A 3FDSA 1FT8A 2J9EA 3R7SB 2FVQA 4RNOA 3VAGA 5LMUJ 2D1CA 1NJIT 3G87A 3RUBL 4B3MJ 2XNRA 2W7OA 4RW9B 3MXHP 2BKNA 2F8MA 1I3OB 1WORA 2HLUA 3M8PB 2FJWA 2K3IA 5D4OA 3W5YA 1T7PA 2OELA 5KFPA 4TLQA 4O23A 4OLOA 5T7LA 2DJWA 4BLGA 1S9GB 3NS7B 4ZVRB 4C11B 2JL9A 1TKTB 2ZWOA 5D4NA 2WONB 2HG4A 2HFUA 4F3MA 1YK9A 4IOBA 3PV8A 2EG1A 2L3MA 2DR7A 3C3LA 3AD7C 4C6AA 2GX8A 3LP2A 3AJDA 5BYQA 3W2WB 2CIMA 5LMNJ 1U1RA 1Q7YT 4BS2A 2B4OA 2FDNA 2ZVIA 4B9TA 2G2ZA 3IAM9 3GCXP 3TUJC 4JYAJ 3PTWA 1I5OB 4ZPCA 2CVEA 2ILZA 4DV4F 4ECXA 2R7TA 1LK5A 2VBWA 2CQ1A 1KHVA 2HPUA 2ZBQA 8ATCB 1SI9A 4OLPA 2ATCB 2VU5A 2C2EA 1DAXA 2DBBA 3T5JA 1FDDA 1FDAA 3ZTPA 5KFQA 1DTQA 4FYVB 4YHHJ 2GV1A 1U1PA 3GJTB 2O1PA 2DNYA 5J2PB 4LUBA 2EFQA 2HBYB 3H20A 2G13A 2NR0A 2OP5A 2A18A 1RDRA 4C2MA 2NXEA 2VA2A 2I2YA 4M5NA 2J6SA 5F8NA 1LEOA 2HFVA 2RIJA 3L7OA 5KFRA 2LEAA 5IV3A 2HHSA 4C0HA 1TVRA 3RW7A 1Y0HA 4WXOA 2B5JA 1NLKL 2WSCC 1AA1B 3CMES 5C5JA 4GVBA 4OIXA 3WZ0A 1CVJA 1UWAA 3QBCA 4OYAA 3V6KA 3TARA 3BDEA 2L9NA 3BO3A 2E5HA 4USVA 3OL7A 2XYGB 1R0CB 1YJTA 1U1MA 2BANA 2GO8A 2HQCA 4ZPDA 2RDDA 3SCIE 1SQEA 2R4FA 3MMAB 5LMUF 1UMJA 3VZIA 2J7UA 5B0AA 3ZTRA 4QIWD 3Q8QB 4U7UK 4EBEA 3UWTA 2YNGA 4DSJA 2AYBA 2XM3A 3HJVA 5DLFA 3CC4S 3NMAA 2H51B 2ZE2A 3LGMA 4DR4J 3EGNA 2BVZA 4DN0A 1FXDA 2GGPB 2LQJA 4X62J 4DV2F 3K5OA 5ETVA 5DS7A 4DX5A 2F1FA 4IFYA 3NGSA 3TX8A 4LVOP 2X1AA 1GX6A 1FCAA 3ENQA 3H5SA 1Y5IB 2HHTA 3I87A 2K1RB 4L75A 2JZ5A 3E8OA 1Y10A 2BJDA 3GFYA 4C3KA 3D3CJ 3MM8A 2MGZB 1IBKJ 1T03A 2IBKA 4W92B 1GAOA 1WG4A 1WWHA 3KHRA 1KN6A 5EWFA 4CWBA 5KFXA 2H65B 4F2SA 5HROA 2C2MB 4K0KJ 5A8RA 3TUIC 4CLSA 2JVRA 1CULB 2XLKA 4QU6A 1IKVB 5KT4A 4LF9F 4X4QA 2PMWA 3OTDA 2I38A 3VVTA 5M2UA 3DRYA 3Q22A 4O0IA 2QIFA 1GT8A 2KVQE 4CLZA 1X0PA 4FBUA 3HFZB 5L1IA 1VC5A 5JMNA 1UZDA 1KQGB 3FFIA 4LRDA 3TP2A 2FQQB 2PE8A 3DRRB 4Q2LA 1QAIA 4O3NA 4NI2A 3A3PB 4X65J 4X4RA 4G3IA 1HNWF 2NZ4A 1BC6A 4YB1P 4DX7A 2ZHOA 3HX9A 4RUBA 5E33A 3GYXB 2CQ4A 2CJQA 3MR5A 4DFMA 3B54A 1Q82T 4DSEA 2HFZA 3T1HJ 3W2VB 3DOMA 4P10A 4YB6A 1PC5A 2D9PA 5DDOC 3VALA 2BQ3A 2K7KA 3HHLC 4UTGA 4WP3A 4A8MP 1K73T 4LF5F 4K50A 3KUEA 3IBWA 2ZZTA 2UU9J 2GVZB 3G82A 5GADU 1C0UB 3MEDB 1RWVB 2YWWA 2VC1A 4MKAA 2QA4G 1NK9A 2V67A 3F0NA 1TMMA 2JC1A 1S72S 2J5AA 4PAAA 1XMQF 3TAQA 1Q0NA 4WU3A 1ZM9A 3AJ2A 1J27A 3KLHA 3A8IA 1PAUB 3K8VA 3P49B 4OJHA 3UN5A 4KHMA 4EFAC 1AUDA 5ADZA 1F5AA 1FJ7A 1YVFA 1M90T 2MMYA 5ITHA 3M7VA 3MPWA 4ZLPA 4I7FA 1EQ0A 1EJ7L 4TVAB 4HEA9 1O0PA 2BE7D 1HQUA 1HQEB 4DPUA 1YRUA 3GR1A 4DX6A 2IBOA 1N36J 3HHEA 4EMDA 1RLDA 5D4LA 3DLBA 2XHWA 3KMQA 3BGOP 3R6LB 1O8BA 2G1HA 1RKJA 2Y0SD 2CZ9A 1DZ5A 4DF4A 4JV5J 4ZVUB 2F63A 4ES1A 4JI8J 3OSNA 2GQQA 2OPSA 1S99A 1SH2A 2N4CA 4X66J 2FLNA 1ELOA 4U9RA 5KFMA 1YJ9S 1OS5A 2CJAA 2DIVA 3IM8A 1X4DA 3IS9A 4LIRA 5EHHA 3GIJA 4AL7A 3OHAA 1SPBP 5KTQA 3EZ5A 1CLFA 3I0RB 2HBRB 4KT0C 1JLFA 3O1LA 3ICLA 1AW0A 4NXNF 1M1GA 2E1RA 2WOMB 2FJDB 2Y1IA 1JLGA 2RD5C 1YX2A 3BEGB 1ZOTA 5CYQB 1T9YA 4TYAA 3KLGB 1TMJA 1VI7A 1H6KX 1X4BA 2C2RA 2CNKB 1UVIA 4K5RA 1JNZB 1T94A 5B0BA 3DHXA 1AZSA 3R5DA 3I56S 4WXWA 1HNZF 1IKYB 1OYEA 2PO4A 5ETMA 3IRXB 4PG7A 4UOCA 4WYWA 4G1QB 2EVZA 1TKZA 1RBLA 2GHPA 1TQLA 1U25A 3DDKA 3HHKA 4MIBA 5ETNA 2VH7A 3N6LA 1KEKA 1N48A 1LV5A 4LF6J 4PEOA 4ECWA 3X1LB 4C7QA 3OLAA 4CIOA 3UDVA 3AFGA 5I3QA 3D1QA 3FRYA 4RW4B 4UZCA 3BO4A 3T3FA 3G82B 5I42A 2C3UA 2ZJRQ 2J7WA 2QT7A 5GADI 2VKRA 3UCZP 2LA4A 3ZZZA 3LUYA 4CH1A 4WYLA 2UXBJ 3AXMA 3NOCA 3QO9A 2H48B 1F9EB 3QZ7A 2EWHA 4DR3J 3TEGA 2VBXA 2JEFA 2LA6A 2KYXA 1L3TA 4F8RA 1Q78A 2CQDA 1FE0A 1VYAA 2BJEA 2OUGA 1N4LA 1FRIA 1WHVA 1S77D 1UPMB 4JI5F 4C4WA 1DHMA 2VG5A 5BYSA 4C8KA 4IDKA 3QLHA 1FKPB 5D6GA 2ZZMA 4BC9A 4QBUA 1MMDA 1QTNB 3D28A 2BJ7A 3MFHA 3DHWC 3IWNC 4K8RA 3CJQA 3ZZ0A 2JLEA 1S6QA 1QSYA 1UKUA 2ZOGA 4KV8A 2DXEA 4CLLA 4IQMA 5DG7A 3KNAA 2LVWA 4R0EA 3NCRA 2ZH6A 1I94F 1W25A 4NZ0A 1WJ9A 5A8RB 2Q1LA 1RE1B 2HFOA 4J9NA 4NEZA 4DR7J 4I4BA 2CZ4A 1TV6B 2AJ2A 2GA7A 1BUXA 4RPFA 3BKUA 2UVRA 3KTQA 1UVJA 1KLNA 4CTAA 5F9LA 3NLCA 1NK4A 3OTCA 1IKWB 3JTNA 1N33F 3D1HA 3SSRA 3V5RA 2HQGA 4FPIA 1T95A 3HT0A 4C3MA 4DZDA 3KUHA 3IG1B 1NK5A 4DSKA 4IG0B 3TAMB 4WE1B 1SIZA 3MCMA 5L1LA 4JI0J 3KKFA 3BS9A 3AY0A 2FC9A 5AJ3F 3AOBA 5DLGA 3JXOA 2ZC3A 4ZPTR 3I55S 2RQCA 1HMVA 4ANCA 4AL6A 1QE1B 1FD8A 2BABA 1KTVA 1U7LA 3MM9A 4ED0A 4ZKAA 2W9AA 2VPWB 4HTJA 4ALZA 2BE9B 2CQGA 1P9QC 1FX4A 1HBUB 1WF1A 2BM1A 2QE5A 1FKOA 1NHUA 1R31A 2BKPA 2D7SA 2LKZA 2UUTA 4GO5X 4FYYB 1XNQJ 4XIUA 4N5SA 3RB4A 5HVGA 2KHCA 3CO0P 2J9CA 1SQFA 1FTRA 3HFVA 3MD1A 3ZZUA 4ECSA 2DNZA 3RBEA 2FVRA 5T14A 1TKTA 1X4EA 1Q86T 5C7PA 4RW8B 4OZ0A 5KG4A 1RLCL 4O3RA 3BBFA 1TL5A 2AGQA 2GNKA 3L9ZA 5D0GA 1X9MA 1LW2B 5J2MB 1DURA 2B5JB 4K0KF 3MGJA 5AE2A 4YR2A 3SFUA 2LQ5A 3F56A 2EEYA 5B7WA 3UNGC 1JXEA 2H4WB 3T6BA 1FEEA 4DOZA 1JB0C 2XO7A 2ATLA 1I6JA 2XULA 1WI6A 4LSZB 3UN2A 4DPXA 2GHVC 3D66A 4YS2A 3CO9A 3HSDA 5KFDA 2YPZA 2KXNB 4DR5F 4RUHA 4GC6A 3PW7A 1DTQB 1IXKA 1CC7A 2DB1A 1BWEA 2MZ1A 2YQ1A 4OI3A 2ZM6J 1DLOA 4DV5F 3NS5A 1IJFB 2XBPA 2RS2A 1FEHA 3BM7A 4J9OA 2HURA 3HULA 3N5BA 2DNRA 4DG1A 2QLFB 2VL1A 3RBZA 5A0YB 2XI3A 3P3DA 3HHLA 4I2QB 4QYZK 4A8SA 1PYSB 1WTFA 4KGZB 3ULHA 1RTIA 2YWGA 1ZTWA 4XO0A 3PKYA 4F4WA 2VODA 5K14A 1I1GA 2GC8A 2ZH9A 1OO0B 2O5DA 4TY9A 3HXMA 1T03B 1RWXB 4ENOA 2AYGA 1UP1A 2F40A 1QUVA 4AQYF 1V5VA 1VRUA 5CYMB 1X4FA 1E6YA 1Y4ZB 5DDPC 3HD1A 1UA1A 4TY8A 1H38A 3C6TA 3TQ1A 1HR0J 2V8GA 1FKAF 4ED1A 3M6XA 4C11A 1NKBA 2KO1A 1X60A 1D3WA 1VBXA 2B4PA 4OYPA 1RWPB 4CRJA 4DCPB 2VHGA 1SJFA 1VQNS 1Y5LB 1NNDA 1MG7A 4NLPA 4M8LA 2VIHA 1SBRA 2CA9A 4ELVA 4AYBD 3GJRB 1M5VC 2KXFA 3KLEB 1ZPVA 3QWPA 3DDNA 1ROFA 5AT1B 2JX2A 2AJ4A 5HMWA 4OZ2A 2V8VA 5KFKA 2FHJD 2ALYB 2CQ0A 2NXNA 1ZM4A 3M30A 2QTWA 4NX9A 3TA0A 2HQ3A 1RT2B 4PWDB 1RWNB 2R9LA 3UR3C 5IT4A 2FB0A 1BHNA 1FRXA 2J0SD 2HNZB 5DQHA 2DNQA 2HZAA 1VOMA 2XS5A 5F8GA 4KB7A 4EK2A 4ELTA 1C0UA 3MEDA 2C1EB 1Q1KA 2VASA 2MKYA 4CNYA 4LT6A 2LDIA 2HNYB 5KFZA 2BQRA 4B3TF 5IFMA 2RE1A 3QFHA 3FBEA 1WC0A 5L1KA 2QA4S 1XMOF 3M1VB 1RISA 4Y6IA 3RAMA 4YQWA 1HWIA 1UFLA 1WG5A 2KH9A 4A8KA 3QJLA 4IOAQ 1KOOA 1RCXB 3OW2R 4K4VA 1FXRA 3ETMA 4NYZA 5DM6Q 2OH2A 2FJBB 3MOZA 2HGMA 3VVUA 3DRRA 4QZVB 3KK1A 4LMZA 1FERA 2W01A 3GONA 4U8YA 5KG0A 2IYIA 2ILYA 3CCMS 3PO4A 1LNQA 4YEAA 2EFPA 1IR1A 4UOGA 2OLWA 4E8UA 2A6MA 3ITHA 2VPYB 4TU7A 4JI2F 4D3GA 1GNKA 3MM7A 2OHDA 1MWYA 5D0RA 5HANA 5BR8J 1TL3A 4LRFA 3PYGA 1S4EA 3IP0A 4KKOA 4NMLA 2VG7A 3ZXWA 3RRGA 3I0SA 3IA0A 1SUQB 2UXDJ 4P6QA 4RZRA 4K4ZA 4QWBA 1LWFA 3GIRA 4DUTA 4KJIA 5GAHI 4OI4A 4Z2XA 1CG2A 1L3KA 1T9TA 1GXUA 2DKOB 4B9MA 3MCNA 2KL8A 1S48A 2XZDB 2HVZA 2DO4A 5BJRA 4K4XA 4MYUA 3BGFA 1UCNA 1KONA 3O44A 3NEKA 4OX6A 3C6UB 4YN3B 2JDJA 3P8BB 4LRAA 2IHR1 2B9XA 2HBQB 4H4KC 1BY9A 4P2SA 4CM0A 4YUDA 3CCRS 1LWCB 4LR9A 3ISND 2CQPA 4XK8C 4J90A 1U1LA 2J0QD 3RU0A 2QMWA 2LU2A 2Y8YA 2CQBA 1OY6A 2ZUGA 4KKOB 4NPOA 2H3EB 3LA0A 1JLBA 4LBHA 5EX0A 2DRBA 3ENWA 4GKJJ 4FZVA 2FLPA 4IRCA 1WEYA 2F9JA 4RW9A 1QVGR 1R0BG 1CJTB 1R43A 1RAEB 3C16B 2IM1A 4CLKA 2ZH5A 2V5HG 2FHOB 5EUHA 4ZIWA 1HFEL 3QNWB 2GJIA 1PGZA 2E44A 1ICEB 1SVDA 2EXUA 2NYIA 2M52A 3GJQB 3QMQA 4UUWA 4OX8A 1HWJA 2GAGC 1FWPA 4NYPA 2AGOA 3M1VA 4UT4A 1QJHA 1U4BA 3V6JA 1UTAA 1SCJB 2HQDA 4GKKJ 3K2YA 1JKHB 2PSZA 5C25B 2HW3A 3I82A 4PWWA 3VV2B 1JQGA 2RU3A 1U26A 4Q0BA 4H4MA 1SIWB 1HYSA 3PHTA 4EUVA 3I32A 3IBFB 3GQCA 4ILMA 1KD1T 1YITS 1GXLA 1K1QA 4N77A 2E29A 3N6MA 2A10A 2XS7A 5G0RB 5L46A 4J37A 1RI7A 4ZVTB 1VQ4S 2JEIA 2Z58B 2VF3A 9ATCB 2J9DA 2JWNA 3IAS9 3RAXA 3BQ0A 4ID5A 5L9NA 2V2KA 4LF1A 1GEHA 3PEJA 3Q83A 5F8HA 5JVHQ 4F02A 2VG7B 1PILA 3M2RB 3CWJA 3T1AA 3G6ES 1EIYB 1GK8A 3C2PA 3MEGA 1R0AB 3GMGA 1U45A 2KRBA 2IA0A 4ITSA 3CGIA 4LF6F 3H2UB 3KK2B 1HHQA 1JLAA 1M5SA 3DI6B 2WBMA 5CZXA 5KFSA 4QPXA 4IRKA 4JV2A 2FPHX 3OVSA 2D3O1 1K1SA 2AP6A 3QGIA 4IG0A 1S9EA 3TAMA 2OO4A 4LF4F 4DR6F 3W8GA 3FZBA 2X1GA 1BE4A 1Q8KA 2H5EA 3F41A 5HQ8A 3SZ2A 3D67A 4NA2A 5HL7Q 1RTIB 2Z30B 2FLLA 4JI3J 3T5KA 5G4DA 4IYQA 1WF0A 2CQ3A 2JC0A 3K58A 5KFAA 4JBCA 2L48A 3DMJB 2CXEA 4O4GA 2BMBA 2X7IA 4M5LA 5HLFB 3OJSA 1RWKB 1XMOJ 2YX4A 1R6YA 1UEVA 3BYPA 2CPZA 3G8SA 3LWLA 2P9EA 2CPEA 1J5EJ 4B3TJ 3UI3A 5LXRA 3JB9k 4R8UB 3Q23A 3P45B 4O44A 3JSMA 1X9WA 4IR1A 1ZH5A 1F9FA 3DXSX 1HNVA 4LFBF 1V3RA 3KHLA 3TQEA 4QWEA 1FK9A 3E01B 2RKIA 5KFHA 5FLXU 2Y9HA 3OD2A 3OUYB 3OR1B 3D7SB 3LF0A 4P7VA 2PD1A 4W4MA 2FJXA 2IC3B 2VB6A 3W7BA 1VK3A 2X3GA 4OZLA 2WONA 2YKMA 2FGCA 4MFBA 3W62A 3LP0A 2HMIB 4WFBQ 4L3NA 4DQIA 3ISZA 2VFUA 4K2JA 3NKYA 3M8WA 5HLFA 4ERDA 3BPDA 3NY0A 3D2WA 3AODA 1HQ2A 5CH7B 4R25A 2VJVA 3QT6A 4PWDA 1U2RA 1J5OA 1FFSB 3DRPB 2DHSA 1R7IA 4NRUA 4RW4A 4CI0B 2ZH1A 2E5LF 2E1AA 2WB4A 3C8YA 3E3XA 1YGYA 3OR1A 2XYHB 2F9DA 1Q8BA 1FKOB 4OI6A 2J7KA 2RHSB 5IQQA 1NK0A 3TZXA 2E9TA 2MDAA 4N7TA 4HL9A 2LEPA 2RUSA 3CDWA 4K7QA 3SMZA 2N7CA 4WKRA 2CAJA 1RAOA 3PHEA 2B6AA 2N4DA 3D3BJ 4ZJLA 1HWLA 2DNKA 5HSPA 1K44A 4IO9Q 1RTJB 4RO0A 3PIOQ 5EN1A 1M5HA 3KK1B 2IJNA 3LAKA 1K8AT 5B0CA 3JSRA 3BGRB 2W4DA 3LPYA 2HFSA 2E7VA 3CDEA 1RADB 4HACA 4USWA 4WFYA 3CF5Q 3CPWR 4WTYA 2ZM6F 4LF2A 1HI0P 4LFBJ 4DL3A 1TAQA 1TTHB 5CQGA 2C2OB 3KLIA 2IVYA 3QATA 1HLWA 2B43A 4KBIA 3CSKA 4OFZA 3RGIA 2CG4A 3UPFA 5D8HB 2XMVA 3AD8C 3RB3A 2WB1D 4M5HA 1VMBA 4M95A 4UOHA 1O6XA 2VD3A 5B09A 2DGOA 2DK2A 5IQ6A 4Z37A 3DU6A 3AA8A 3ZTSA 2H4YB 1SB6A 2BXJA 4WCEQ 2W9BB 5FIIA 3OR2B 1NPKA 4PXBA 3T5HA 4WZMA 3PZPA 2YXLA 3LP2B 3PW0A 4LR7A 3KHHA 3PIPQ 1U8SA 4LF4J 3PYDA 3DU5A 2B7CB 2DGSA 3OXFA 3S8SA 3LALA 4EGLA 2KB2A 2IMWP 2OEKA 2COLA 3PM9A 2G9OA 4F2RA 1YJVA 2RJZA 3UCUP 2DH9A 2EFGA 2CKWA 4Q5VA 1YWXA 2WCXA 3R2DJ 1NJXA 1NPRA 4K5SA 1SJQA 3L7PA 2UXCF 1YJ7A 2C3MA 4PXEA 2KG1A 2MQOA 1WNEA 4PKDB 1H72C 3M8RA 2YQ3A 2NXCA 3MR2A 2AYEA 4EBCA 3RB0A 4RL1A 4DFKA 2DT9A 3O5TB 1QUPA 1IQTA 2Z2LA 1SH0A 1SJ3P 3JSBA 5D77A 4LJMA 4IRDA 2ZWPA 2DGTA 2K7JA 4DFPA 1KQSR 4F7VA 4JI0F 4XDCA 2B51A 1BWVA 4Y0FA 4DS5A 1SJ4P 2OTLS 5E3QA 3DFEA 4FS1A 3IRXA 2MSTA 3V81B 4I6YA 1UAWA 1IWGA 3DKDA 1SKWA 1TUVA 4NI2B 3K7RA 4G1IA 4X4PA 3QRRA 1REVB 2FVCA 4DJBA 2OI2A 1SC4B 4I2QA 3N6NA 3ZZYA 1U1KA 1JLEA 1FNOA 2RUGA 3HSJA 3GSDA 4U67Q 2IDEA 4P72A 2YWFA 2QN6B 4DV7F 3AD9C 3CJ4A 4O4GB 1KOHA 3HHNB 2LQ9A 3AXKA 4BC7A 4FP9A 2UUCF 1RABB 4IO1A 2GZOA 1NM2A 4IFVB 5HROB 3Q8SB 5KFNA 2LU1A 2YPYA 4B9VA 3I0RA 1U49A 1FESA 4LQ9A 5CABA 4Q45A 2EC0A 3LH2S 4LBIA 1FJCA 3KK2A 3UNYA 2E1MC 2MZTA 1RK8A 4UF4A 3TNVA 3FBCA 3W60A 2DRAA 2M0GB 2K1RA 2PC6A 2MJUA 2AF6A 3T9ZA 3NBPA 4KE5A 1T9XA 2LEBA 1VGYA 4IFYB 1U6ZA 1ZS6A 1FXLA 2QYCA 5AE3A 2O66A 5DQGA 3MM6B 1H98A 3PR5B 2VDIA 2XS2A 2W4PA 5IS2A 3OFGA 4YY3J 4IR9A 4OL8A 3UQSA 2MHEA 2RQMA 3MPUB 1FNMA 1GQEA 1XK8A 3D6FB 3PRVA 2C2DA 2HIQA 2QJ3A 5BR8F 2HQFA 3WIVA 2J76E 3L95X 3Q8VA 4EU0A 1YIJS 1UPPA 1S9FA 3FMBA 1RQ0A 3CT9A 2R2TA 3HZGA 1VHIA 1QY7A 2I0XA 3SSSA 3G96A 4CO3A 4WTOB 5CYQA 1F3FA 2KT3A 4NMXA 2V4QA 1DQ9A 2NQPA 1Y00A 5IXUA 4QU7A 2OTJS 4CT9A 5KFCA 3P6YC 2UV8G 4B9LA 1M0SA 4RBUA 1MSWD 1U6BA 1Q16B 4J5OA 3D0IE 2XMWA 2CJXB 3OVAA 1X5TA 2KJWA 2HS4A 3CIZA 5KAKA 3T1YF 4I0WA 2LCWA 2AU0A 3L7UA 4OI2A 4WFZA 4Y2IA 1HBOA 2V2QA 3CD5A 4TLRA 4J9LA 2JEJA 2BYCA 3DMJA 3CJTA 1S6QB 1FE4A 1F9HA 3BREA 4ZITA 2W2NP 5H9EK 2MKSA 5HBMB 2RRNA 2XYPB 4NLVA 2ZH3A 2V9WA 4DV6J 4UW2A 1N34J 1X4AA 3C6TB 3MUTP 5L9XA 4A46A 2WRMA 3G6XA 1N36F 2EFNA 1QD1A 2LXUA 2Y1LB 3N79A 2VBYA 4KGKA 4ICLB 3BQ1A 2VONA 3CE8A 1S9GA 1HI1A 3KLEA 1UVKA 3NMRA 1RT7B 3W9HA 1F3VA 1URRA 2EKNA 3HHLD 3ZFVA 5KT5A 4NLTA 4RU9A 2ROGA 1NJWA 4ED7A 2MGZA 5K14B 3MI7X 5L8RC 4DWIA 3IRWP 3I0SB 1S12A 2K06A 1SUQA 1VJQA 3D1OA 3ILJA 5EWEA 3GIMA 1DFDA 3MPVA 4L72B 3OFFA 1IN0A 1RHQB 3KJNB 4L73A 3RG6A 5DGAA 2QMUB 4Y2KA 5IT0A 1SKSA 3UDCA 3PVXA 1KHWA 4W90B 3CJ5A 2PI5A 1JLFB 2OMLA 4XAKA 4F04B 1SH3A 4F25A 3R1HA 4TNOA 3M05A 3N28A 1IKXB 3V4MA 2QEXS 3SSQA 4ZLLA 4JI1J 4CZCA 4FXDA 1MMNA 3EJMA 2VFTA 2GVDA 3PW5A 1ZZNA 4ZCKA 2JHEA 2Q79A 1H7XA 3K89A 3KLGA 4F36A 3MFIA 1QVFR 3TUPA 2JOQA 4ECQA 1JKHA 3HKZD 4PYDA 3J7AN 3DGVA 5KOXA 2DGQA 5K8PA 3SIPB 1HNXJ 3PXGa 4OX9J 3CDBA 1UFWA 5CD4A 1N5SA 1RWOB 1IR0A 3EM1A 2IVFB 5DG8A 3TYTA 3G9CA 2ZBIA 1AB8A 4C8LA 4USTA 4UY85 4HACB 1QSSA 4FXWA 3VAKA 2QX0A 2Q3PA 2HHWA 3G6YA 3R5CA 2AHOB 3QT8A 5IV4A 2XQCA 1VISA 4K4TA 4ZVEA 1WKLA 3CCJS 4C97A 4F4YA 1A9NB 4LF7F 4PABA 5IZHA 3AB4B 1FVQA 4K2XA 2GIRA 3MEGB 4KO0A 3NG8A 2ACMA 3FMWA 5HP1A 1Y7PA 2CQ2A 2VPZB 4ES2A 2VQFJ 3PW4A 1YJWS 2AV5A 4DV1J 2GGPA 1N8RT 2CNNB 2R42A 5ETPA 2XSJA 3NXZA 4WU2A 2DNNA 4KAIA 3ENAA 3OL8A 5EDWA 3S7RA 2AEMA 1EX8A 1HWUA 1VRUB 5CYMA 3MWBA 1E6YB 2ASJA 2ZZNA 1ACMB 4IOCQ 1OMSA 5IM0B 3CJSA 3TX0A 5D0HA 4N56A 1XEZA 1YZ7A 2FYXA 3RYLA 2XO6A 4KHPJ 4FNHA 1R0AA 4J9MA 1UA0A 3N9UC 1JIHA 4G6VB 4OYIA 4P75A 1LWFB 4KGMA 4ZHRB 2DGVA 4FNIA 1NH7A 2HGLA 3JSYA 2MKKA 2V69A 4LF8J 2LFVA 2IIHA 2JLGA 3WX8A 3LQVA 5HK4A 2OKQA 1UL3A 5IT9U 3DGPA 2CWKA 3FEYB 5HO4A 3NGTA 1DY3A 3A3NB 4ZVHA 1W26A 3E2EA 1IBLJ 1XR7A 3T9NA 1SJ1A 4EZ6A 1RHKB 3PNIA 2CPJA 4AXJA 4Q0BB 1R8CA 1REGX 3FCHA 3G86A 3CUNA 5RUBA 1FFWB 4X4VA 1U2CA 4X64J 4AXIA 4LRBA 1YKWA 2CDRB 4J7CA 4M63A 3RBDA 3OTOJ 2XMMA 3G8TA 2OPSB 4DQRA 1R3NA 2MPUA 4M5DA 2HNZA 1CQNA 5CZVA 4OI1A 5LJ5Y 4GC7A 3DLKB 1YSJA 2BJ1A 2WOMA 3GLJA 4GVLA 3W65A 1CEZA 5K8OA 4R5PA 4DV4J 1APSA 1MWZA 3TJ9A 1FRJA 3ILIA 2FTRA 2WK4A 3QIPA 5JXSA 1SXLA 1JLAB 2MZRA 5IOLA 5HN0A 2XY7A 5KFBA 5C42B 2FVPA 4OYXA 1U48A 1B7YB 4F0MA 4F4KA 2KM8B 1PJ5A 1TKZB 1TU0B 3GYGA 3HD2A 5CAAA 3R7BB 5MAOA 3WX4A 2UXBF 1IKYA 3L4BC 1WEXA 1GTEA 4KH0B 3CCTA 4NE9C 3TVZA 3QQCD 1GXTA 2NYHA 5ETTA 2H54B 4RUCA 1MROB 5KG6A 4MK8A 1RT4B 2OPQB 1NB2A 1G4CA 4ED2A 4TYBA 3ITHB 5G0RA 1BQMA 5KFWA 1MU2B 4B3SJ 2PDAA 4WFNQ 1VQ6S 4USIA 1PCAA 2EC2A 4V1Ak 4JI2J 2FJAB 3QRQA 3QZ8A 2DHAA 3QAEA 4FXVA 3PJWA 2QV6A 5C25A 1KP6A 4RW7B 5HBMA 1IKWA 2CADA 4ES3A 2BR0A 5KFTA 2HZVA 3QGGA 3V4IA 2GIFA 4DG1B 2NZCA 4KFBA 3PDNA 1TL1B 4QQBA 1Z1ZA 4A4JA 2FY8A 4D3HA 4F3OA 4JUZA 4CYUB 3N5FA 4OZ3A 3J7Z5 3W66A 3DRSB 5J1EA 1JLEB 2LLZA 4TU8A 4ECVA 2YKMB 3B8HA 1UW4A 2VG5B 1VDHA 4MJKA 2HFNA 1KQKA 3VF0B 1VQ5S 2IM2A 4Y2MA 1GH8A 3H59A 1CJTA 4U8VA 3ET6A 1AT1B 2A3JA 4PWUA 4C3LA 1D8YA 3ZO7A 3HT3A 5DGBA 2GFFA 2ZBCA 2F4VJ 5KFOA 2M7SA 4X66F 2ERRA 5H1SV 2BRKA 1KKHA 3CB4A 1JJ2R 1F2GA 2Y3YA 1YQHA 4RR5A 5CXTA 4BCAA 1WOSA 2CYYA 1HBMA 3D6MB 5M2RA 3MEEA 3IWLA 3SQOP 3C6UA 2BEFA 3TWZA 1YJUA 1K47A 4M5KA 1S0NA 2QL9B 2QRRA 3KDNA 2KTQA 2W25A 3HVWA 3M30B 1ZA1B 3R5BA 4JB8B 1XTZA 5IC4B 2EI5A 2A0FB 4LSNB 1R8BA 2QGFB 3PYEA 4NOHA 1PSDA 3CD0A 3UD5A 1AFIA 2CPYA 3GP9A 3W5XA 3KUGA 3IC1A 3KYLA 1QE1A 2CJYB 2OGUA 2HHPA 1MROA 3M2RA 1HBUA 4PXCA 1RB0A 1RHUB 2F7VA 1U0HB 2G0CA 1QDUB 4ID5B 1CJVA 5THWA 1WF2A 2L9DA 2GJ2A 4IKAA 4A8XA 2W7PA 1XJWB 3QT5A 4BBYA 2RF2A 2RDJA 1WACA 4Z7YA 2FLOA 3VQSA 3MR7A 4DPYA 2XLJA 4GMKA 1S9EB 5D0EA 5A8WB 2R7WA 2YNIA 3GPAA 2DR6A 3I4PA 4DV5J 2MTLA 4DXLA 1N88A 1A6LA 1T3OA 1RTJA 2V8HA 2WSFC 1SV5A 3D5MA 1RT6B 1NH8A 1YDLA 2ZDOA 3POTB 4GRSA 1X5SA 4ZVPB 2J6UA 1YHQS 2L41A 2DCLA 5BYRA 1RTDB 1OSCA 1NRKA 2ACYA 2MLYA 2WVDA 1UZHA 3A13A 4X84A 1WG1A 4JI6F 2W2OP 4UQGA 2JRSA 2M9KA 3R3TA 5AE1A 3Q8PB 5FJ4A 4DL0C 2CJBA 4PRFA 1NKEA 1NSAA 5JJBA 2XY6A 2WVCA 5GAEI 4ED4A 5J2QA 5I3UA 4KH1B 2DNHA 1B0PA 2B8PA 5LOQA 7FD1A 1N56A 1Y5NB 5KT7A 1VC0A 1P27B 2G4BA 4M1KA 3LPEA 2M70A 2B9WA 5HQLA 4I7FB 2AJFE 3K5LA 2NREA 3C46A 1H7WA 4I1TA 1VR6A 1G7CB 4ZLJA 1VBKA 4HI1A 4A8FA 4JI6J 3MEEB 1WHYA 3HSZA 3A8EA 2YKPA 4CLUA 1X0FA 3Q2TC 2QSFA 3DNCA 2HEKA 1EQMA 1H0HB 2CPDA 4ECTA 1VQOS 5CYJA 1EETB 2R2RA 1W2BR 1F5CA 2GAHC 2ALZA 2DPIA 1XNQF 2V68A 3MM5B 3SCLE 3EGVA 2LXFA 3JQKA 3KOAA 4BWJA 3FQKA 4ED6A 2BOPA 3V6DB 3NGUA 1M5OC 3J7YU 2W4CA 4WP8A 5E7OB 4DEZA 5LXYA 3FSXA 5F8JA 1RBOB 4AD6A 2OJ3A 3NRBA 4FF1A 2B4UA 3K5MA 4ECYA 2UP1A 3TZYA 2RMLA 1URNA 4DBQA 4WF9Q 3TR5A 5E3RA 3B78A 2I5JA 3OFEA 5CHCB 2V50A 5LSLA 2BQUA 1UWBA 3KXDA 1C2PA 1RAFB 4F26A 3THPA 1NDPA 2P6SA 5F3TA 4DHVA 4V19J 2D74B 3FQLA 4DUZJ 5DZ6A 2C42A 3CJKB 5JUMA 1TL4A 2UUWA 1DBDA 2B9YA 3FZ2A 1G3OA 1HKAA 4HDHA 1LWXA 3BBBA 3KJFB 4B17A 3HMJG 3NS6A 3R5AA 1JX4A 1RT2A 3GCWP 4BWMA 5DM7Q 1SV5B 3KLVA 4YHHF 1TELA 4RNNA 4USMA 1SKRA 2CPIA 3WIUA 4TQRA 3GFHA 1S6PA 4KGVB 3EMTA 3R1LA 1DQ8A 5EWGA 2ZE2B 2AZ3A 3HFKA 2HWTA 4NLDA 5D4PA 5ETSA 2B8QA 3SCKE 5DO2A 2KN4A 3ZNUA 2AWZA 3TOQA 4CO4A 2GW8A 4CQ1A 1KFSA 4I64A 3SFGA 1L3VA 2R7SA 1FRLA 2DD8S 2ZH2A 2FGOA 2FZGB 3QFWA 2RU9A 4ZS6A 2WW4A 4CM2A 1NEEA 1KS2A 4CT8A 4RJVA 3CCES 3CCUS 4ED8A 1VQPS 4FBTA 3UO0A 2NSCA 3DLEB 5KFIA 2FD2A 2ZVSA 5L1JA 4O4RA 3I31A 2AJQA 2XCPA 1RU2A 4ETXA 3DCAA 5HJYA 4U7CA 1IBMF 4LF8F 1XNRJ 1WSRA 3MMBB 5ETKA 1TUWA 2I1RA 1EB0A 2WHOA 3R97A 2E1CA 3NNHA 3LTOA 5B0GA 4DL2A 3I6PA 4K59A 5E3CA 4ZVFA 5JVGQ 2FJVA 2D41A 5C24A 2CRLA 3C14B 2VJUA 3H2LA 3ONQA 1VCTA 1HNIA 1RHJB 4N8OA 4Y34A 2J0WA 4CH0S 4B3RJ 1WC3A 3RTVA 2ADBA 2KT2A 4RW6A 4KYZA 2W1BA 4MFBB 1NSKL 3FKBA 3PW2A 1NZ8A 2IC3A 2R8IA 5CCLA 4FN5A 4J91A 1N32F 2EPIA 2DISA 4OHVA 2MQPA 3QPIA 4X2BA 2NPFA 3NWGA 3QAUA 4ZPWR 4WFAQ 2E5GA 2LMIA 1HBNA 4NLUA 1OYDA 5HMZA 3PJXA 4DZ6A 2GIQA 4A47A 1D8ZA 4MMOA 2B7BB 5LM7E 1JLQB 2KRRA 1P9YA 1V5IB 5FLXY 2BV3A 2AT1B 2YKQA 3C66A 4TXSA 3MM8B 2L9WA 3JAMY 2FHKA 4RW8A 4RBVA 4ATNA 5IM0A 3PYFA 3TVKA 3OBIA 4IG3B 3GZ7A 1U1OA 4WPAA 4F67A 1Q8IA 4YFUA 2YWEA 2Z2YB 2ZH4A 3QO9B 3T6JA 1BGXT 5T7LB 2HHUA 1V6HA 3A1YG 3HHLB 4F4AA 4KR0B 3GE9A 2KKHA 2ZNYA 1GFWB 2C2KB 3B6BA 3SQGA 4ZCMA 1LW0A 2EK1A 4JV0A 1BMQB 4KC5A 2P9GA 4L74A 3GIIA 3FNNA 2PA8D 2R8GA 1H74A 3LP0B 2HMIA 2IVMA 2NXUA 2MHNA 4PUOB 1EAYC 4Q8EA 3M2VB 5CCMA 1U1NA 4OYZA 4L6V3 3JQMA 1FHTA 2HNYA 1HNVB 2MY7A 1BQNA 5LSRA 2RRBA 2ZHAA 3EVMA 1NK7A 3FUYA 2BACA 1VLOA 2RQ4A 3FSYA 3EX7B 1PYTA 1YTYA 4X65F 2A6OA 3CTRA 2DPJA 2HHHF 1GTHA 2KZMA 2V2ZA 2AJ0A 3GV5B 3MAQA 3UD4P 3V4IB 3VGTA 1KVKA 4NEYA 1LW2A 5J2MA 3O6QA 1KC8T 1LQ9A 2NUUG 3D6TB 4USHA 4Z7CA 5KG2A 3JAMU 3QJJA 4CLWA 2E5JA 1FRMA 4C98A 2H5JB 3MAAB 4B3OB 3KMSA 4XDDA 4OV6A 3A8KA 1RA6A 4Q2MA 4P2XA 3J7ZT 1BLUA 3AOAA 1EZZB 2ZKUA 1UVMA 3DC2A 4ID8A 2F4VF 1FDBA 3MD3A 2DO0A 3A4TA 5HVHA 3HP6A 1FWLA 4LF7J 2K2PA 2VPXB 1TKXA 1EKSA 1NCLA 5M2PA 1W2IA 5DDRC 2LDYA 3MM9B 1RT4A 2OPQA 3I9ZA 4YDDB 3RW6A 3WQPA 4OYWA 4DUYJ 3UVJA 3M2UB 3H7HB 1C1CA 3TZZA 2VQEJ 1FTCA 2HQIA 5LSOA 2C3YA 4RWWA 3ZZRA 5KT2A 4NCAA 2DY9A 2RQKA 3SV4A 1JJ4A 3J81U 4DQPA 1X4HA 1IWAA 3QIDA 4OHZA 3VWSA 4X62F 5U47A 1WELA 2DH7A 2YWHA 3THVA 4QYZJ 2OSQA 3DI6A 1QAYA 4LVNP 4P71A 1YJRA 3W2WA 1RAGB 2IMOA 1RT3A 2MYFA 4QIEA 3W9JA 4J9PA 1RYRA 4ELUA 3VAMA 2OEMA 4URGA 1ULRA 4DF8A 1PAEX 1S0VA 2XSJB 1KVJA 4Q7AA 5GAGI 1F1BB 2GMJA 2DGUA 1CS4B 4DU7A 3PR4A 4PG5A 1YBAA 2MJNA 3HF5A 4B3SF 3HCXA 4C8NA 1RSCA 2BOAA 1SL0A 1TL3B 1YJNS 2PI4A 1FJGF 1VS3A 2HVEA 5KFEA 4DQQA 1HD0A 3LGNA 4N47A 5E3PA 3DOKA 4B9SA 3CCVS 2C3PA 2OFGX 2HVHA 5BXIA 3B82A 3M9NB 3BR9A 3CJ8A 4IQXA 3H25A 4NLGA 1HHTP 4O44B 3VAFA 1CPZA 5AXNA 2MXYA 4A48A 1RBAA 3VGSA 2OEJA 4YB5A 2RKIB 4JV1A 1L3UA 1ZTTA 2V6AA 4QR1A 1SC1B 2PIIA 1E6VB 3MMCB 4IH7A 2HNDB 1VJWA 4PG4A 2QYGA 5IC6B 2HK3A 4N76A 1K0TA 1RP5A 3M32A 3EVWA 2JFDA 1XC9A 3HZEA 4W98A 4Q8FA 2FHMA 3TANA 1NJZA 3DDIA 2M8HA 4OQJA 4RKUC 5B0EA 1MNEA 2ZITA 1S1XB 3TA2A 3EGZA 4RBTA 2DCUB 4DV6F 2J0XA 1N34F 1HL6A 2SXLA 4U6PA 2Z4PA 2FVSA 1XR5A 3GWCA 3I5BA 2VZ9A 2P8IA 2FY1A 2UUCJ 4A8YA 5A6PA 2Q6CA 2FZCB 2PMZD 3BSOA 2C2ZB 2CQCA 2GCFA 2YKNB 3MECB 1RU1A 3I4HX 4M94A 1N5QA 2BDPA 2VG6A 3R5GA 1V9OA 2W2QP 2UZAA 2POKA 3TEHB 2E66A 2W7AA 4ZPBA 2CQIA 3LP1A 3M8PA 1Y11A 2BA9A 3NAHA 5A8KA 2MZQA 2BZ2A 5GAHU 1FF2A 5C42A 3CJRA 4ZPVR 1IJEB 2R7XA 1S10A 1D0EA 5A6WA 5L38A 2AGPA 2YNIB 5E2QA 1S7HA 2HIYA 3GG0A 4Y00A 3GYNA 2Q66A 4KHPF 2JJ4D 4QIVA 3IG1A 5DZ7A 2DRDA 2AIRB 2V34A 1EHWA 2XMKA 2YKOA 1A0OB 2ZFHA 1D9DA 1RWWB 4RLEA 2QA1A 4EYHB 3CJ3A 4B9UA 1YI2S 5J1NA 4YDXA 1SL2A 2WVFA 2R7UA 1CJUB 2FC8A 1RT5B 1T9WA 5LL6d 1FDNA 3F73A 3QRPA 1HBOB 4H54A 5HAOA 3JYTA 2XCAA 5IWAJ 4MIWA 1VRTB 4OYMA 3EDQB 1NMEB 2M2BA 1VQSA 3EWGA 4YY3F 5MLCV 2GS8A 4MKVA 3NCPA 3G6VA 1HWKA 4PR6A 3PX4A 2PFFB 3AQPA 4I2PA 4H4OB 4EYIB 1S79A 3QLHB 5FDLA 3DGPB 4MTPA 5F41A 1C4CA 1TR0A 3BGUA 3SQGB 3P5BP 2RNEA 4XPCA 3SV3A 1H2VZ 1VHFA 3DRSA 5J1EB 5C2GA 1M1KT 4C8MA 2ZDPA 2W8KA 4CCHA 3GR0A 4L76A 3K8WA 2P9CA 4QIGA 3UFCX 1RT1B 4PG6A 4DV3J 2WTFA 2ZD1B 3SBMA 3MM5A 1GMWA 2N3LA 5F0UA 3N4WA 4E0DA 1QM9A 2UUAF 1XMBA 1HIYA 3FCWA 1PIEA 2X1BA 3M6VA 2OPPA 3M8ZA 2G2OA 4DLEA 1HNXF 1GMVA 3ILLA 3OTOF 1B0TA 3JQJA 3BYRA 1RTHA 1JMTA 1DTTA 3M8QB 2QC3A 3BGLA 4KPCA 4NLXA 4HTIA 2XGQA 2MSSA 5F3ZA 4DL7A 1JJCB 4C8OA 2KZZA 5FDLB 1NHKL 1A7GE 1OPIA 2V2VA 3GFZA 2IRYA 2JSXA 4DV7J 3CVKA 4QWCA 3JS9A 5HP1B 1IBLF 1B3TA 4DV0J 4HDGA 4WK3A 5A8KB 2MB0B 2YNFA 3H5XA 4YR0A 2C22A 3MM6A 1PJ6A 2B56A 2CJ9A 2CNLB 3CDAA 1VQ8S 1KDNA 2BRLA 1KLMB 4CO5A 2BM0A 4JI7F 1S1WA 1HW8A 1C1BB 2J8AA 1Z2ZA 3AH6A 2DR9A 1YRXA 4NZ6A 3V2UC 2KM8C 4K4YA 1ZZFA 3FSIA 5SUHA 2V0NA 2OD4A 2E5LJ 1C0TB 1OIAA 3QSIA 5D78A 2N3OA 1K0VA 1UJ6A 2WZ1A 3EICA 3IS9B 1RXOB 2F8EX 2YWKA 1FVSA 1KBRA 1NHVA 2J9DE 2PEBA 4PCQA 4XTTA 2UXCJ
chains in the Genus database with same CATH topology
5E41A 5IT9Y 4Y65A 2DNMA 1XR6A 2G1DA 4J9KA 3MAHA 3VAHA 1ZETA 4ERDA 2XY5A 3AB2B 2HAIA 5HMYA 1AFJA 2VQFF 4DDFA 4KSEB 3KLFB 2Q6BA 3CC2S 4MKYA 2RRAA 4WJBA 4R0JA 4ZDNA 4DSFA 4IUFA 2BBEA 1HQUB 2R2SA 2EK6A 4B02A 3M2VA 4WIIA 3DYAA 1DARA 3HK2A 3V6DA 3KNGA 2ZH8A 3NNCA 3LOUA 1MMLA 5HMXA 2UVVA 2Z2MA 1R27B 3CIMA 4ZHRA 2M4MA 4EBDA 4OX9F 4ZP9A 5A2QY 1NK6A 4YB7A 4I68A 3BQ2A 4DSLA 4RX6A 4MK9A 3K57A 2NLWA 2ROEA 1X7VA 4KHRA 3JTPA 1Y9OA 1U09A 2YVSA 2XMTA 1D1UA 3Q0AA 3H8YA 4OHYA 2DGWA 3KK3A 3OL6A 1ZAVA 3M32B 1VIOA 3FEXB 1SJRA 5KFYA 2DNGA 4I69A 1HBNB 2IM3A 4Y28C 1NKCA 2XEXA 3IN5A 3ZZPA 3DM2B 1FRHA 3OXGA 2W9BA 1Q4RA 4MIAA 3ZC4A 3JYTB 2YTCA 1T3NA 3DN9A 4EZ9A 1UETA 3MMJA 1XN9A 2N82B 2LXIA 3SYZA 2K3KA 5IQ6A 1IQZA 4CO0A 3UE2A 1RGVA 2XMJA 1JK9B 4LSLB 1S49A 2RH3A 2VBZA 4F3QA 2QLXA 3D0GE 1DLOB 3KG1A 3AJ1A 2ABYA 4B08A 1VFJA 2MKIA 1N6QA 2W8LA 5K8MA 3WC2A 3PACA 3BJYA 3CULA 1T8EA 3NNAA 2RT3A 2MQQA 3AQOA 2CPFA 3BSAA 4ECUA 1RT1A 4PQAA 4EO8A 1S1VA 1TKXB 3MEKA 3BN7A 1WHXA 3DYAB 4ECZA 3EXCX 1DTTB 3M8QA 1B0VA 4YP3A 3SXLA 4GKJF 2AX1A 1RKIA 1J5EF 2KYZA 1ZAXA 4DV3F 3I5AA 3I5CA 4TU9A 1O51A 2F3JA 3IXQA 2HWHA 2ASLA 4I67A 3Q2SC 1PC4A 2C3OA 2KXHA 1UVLA 3AAWB 1Y3KA 4Y3CA 3GILA 3OSPA 1S1VB 3FGVA 3I96A 3PY8A 4WE1A 2Y1JA 1RTDA 2ASDA 3NGDA 2CVIA 1S6PB 2EFOA 2KDOA 2MKJA 3KG0A 2DNLA 4H4KA 2ZC4A 1HPZA 3H40A 3R27A 1R8HA 3S6EA 1C0TA 4KQZA 3RZAA 4IH5A 2RS8A 1BQMB 3DM2A 1LWCA 1G1XA 1S1TB 2NPIA 3CJ0A 3FFIB 4OJ3A 3D0HE 1RJJA 3CCZA 1L3SA 1WI8A 3LWMA 2VA3A 4URQU 2E5IA 4RW7A 4KRWA 3HM9A 2YY3A 4LFAF 1BD6A 4WZQA 2ZJPQ 4X4NA 4Y2AA 3S1TA 2OFHX 5KT3A 2UVUA 2H9ZA 2MY8A 4DL5A 4QR0A 3E51A 4ZMMA 1MU2A 3J7A1 3SI8A 2XZWA 1HARA 5KOWA 2Z0GA 2UVWA 3HVTA 1JLQA 2EKYA 2PA3A 4TQSA 4Q44A 2BUNA 4EO6A 3HDSA 3ETOA 2OSRA 2DNOA 4QPTA 1X8DA 1DQAA 2AYMA 2XB2D 1G2EA 2OPRB 2CJKA 1B64A 1XBWA 2V4JA 2WSEC 3X3UA 1NJYA 2YH1A 3CDUA 1LFWA