4O44B

Crystal structure of hiv-1 reverse transcriptase in complex with 4-((4-(mesitylamino)-6-(3-morpholinopropoxy)-1,3,5-triazin-2-yl)amino)benzonitrile (jlj529), a non-nucleoside inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title A mechanistic and structural investigation of modified derivatives of the diaryltriazine class of NNRTIs targeting HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 99
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4o44B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44B03
2V4QA 3DOKA 5F9LA 2YNIA 4F50A 1RT2B 5J2QB 2OPPA 3KJVA 3H40A 2JEIA 5C25B 5KG4A 3LP2B 4NLTA 2AU0A 2AGQA 4O44A 2AX1A 1C0UA 4IH5A 4KHMA 4RNHA 1S49A 5F8NA 1LWFA 3IS9B 3N6LA 1FKOA 1JLFB 1RT5B 3DM2B 4TXSA 2QE5A 4I2QB 2WONB 3GIIA 2VG6A 3MR3A 2O5DA 2UVRA 5KFNA 3CDUA 4KHRA 5KFEA 3RB4A 4WE1A 4Y2AA 1NHUA 2WTFA 4PWDA 4J9OA 2F8EX 5KFFA 1JX4A 4RUAA 3DLKB 4YR3A 2OPSB 3DOLB 1VRUA 2HWIA 3H4DA 2C2EA 3V4IA 5CYMA 1K1QA 4TY8A 3QGIA 3DRSB 3JSMA 4ZP7A 2FLPA 3PZPA 1C2PA 2DPJA 4J9LA 1TKTA 3MFHA 3RB6A 1RT6A 5KFUA 3OHBA 4EYHB 2I5JA 2D7SA 2FJVA 2BE2B 1TKXA 3C6UA 3BQ2A 2BQUA 3GILA 2BQ3A 4WXOA 5EWGA 3V6DA 4ZP6A 5HLFA 4ED3A 5C24B 4QWAA 3KLFA 4IH7A 5KFCA 4KBIA 1C0TA 3KHLA 3UDLA 4O3SA 1S1WB 3DRPB 5FDLA 2HNZB 3I5CA 1RT3B 1HQUB 4R8UA 3V6JA 4R5PB 5KT4A 4Q8FA 2BRKA 3FQLA 5F8MA 3KLHA 4WFYA 4RW4A 3C6TA 3MEEB 2C22A 3MEDB 4J9SA 1S1UB 1T3NA 1SV5A 5F9NA 4TQSA 3IN5A 4LQ9A 3CO9A 4J9RA 4J9NA 2OPQB 1EP4B 1S9EA 3NGDA 4I2PA 2HNYB 3QZ8A 3QO9B 4KKOB 4ZHRB 3CJ5A 4IOBA 2YNHA 5L9XA 5KFMA 3KK1B 4RNMA 4GC7A 3GV5B 4WZQA 3HVTA 4LQ3A 2XC9A 1TVRB 4IRKA 1RT1B 1S10A 2CKWA 5CYQA 1N5YB 1RTDB 1WNEA 1KLMB 1S1TA 2IC3A 2IM0A 3IGVA 4QWBA 1JLBA 3IRXB 4U7CA 3DMJA 4URGA 3QLHB 3QZ7A 3MECB 4WYLA 1S1XA 3OLAA 2R8KA 3QIDA 2IM2A 4ZVEA 4MFBA 5EUHA 3BSAA 1HARA 2UVVA 1JLEA 4O4RA 2W8LA 4FS1A 4IG0A 2BRLA 3H5YA 1GX5A 4O3PA 4NYZA 1C1CA 1HNVB 4NLYA 4KV8B 3T19A 4O3OA 3RB3A 2WRMA 4XO0A 4QW8A 3T1AA 4ZPDA 1HMVA 5J2MB 1W25A 2RF2A 4G1QA 4XPCA 4ZVHA 5I3UA 5KG2A 3KLIB 3V6KA 2AWZA 1DLOA 4H4OB 1RT4A 4IFVA 3T5KA 4TYBA 3NBPA 4PUOB 1T94A 3E01A 3PW2A 1EETA 4ECRA 2RKIB 4IRDA 1LW0B 3PVXA 4IFYB 5D3GA 4Q44A 1RA6A 2XI2A 3EPGA 1N6QB 4O3RA 3DOKB 3CJ3A 3MF5A 2E9RX 2YNIB 2I1RA 4ECUA 3IG1A 4NCGB 1KHVA 3LP0B 2HNDA 3BJYA 3RAQA 2C2RA 2WCXA 1DTQB 1FKPB 1TKZA 2OPPB 3KJVB 5KT6A 4ECVA 2ZE2B 4YQWA 4WFZA 5KFYA 3BSNA 1N56A 5KG3A 3LANA 2FLNA 2BQRA 2XWYA 4YR0A 2ZD1A 2IBKA 3OSPA 2B5JA 5HROB 1FKOB 1RTHB 3KLVA 1LW2A 4RNFA 2VG6B 5HBMA 1TL1A 3MFIA 1LWEA 1FK9B 4Q0BB 3M9MB 4WE1B 1MMLA 3DLEB 3RAXA 3JYTB 3NL0A 1DTTA 4MK9A 3H2LA 4O3NA 3DI6A 3M8PB 3V4IB 1RT7B 5CYMB 2FVQA 2V0NA 4IQXA 1S6QA 1KHWA 3SI8A 3KMQA 3Q8RB 1IKYA 3BSCA 4ICLA 1HPZB 4TY8B 4K4YA 5DGAA 2ZKUA 1ZTWA 3OL8A 4K4WA 2EC0A 3DDKA 4O4GB 3H98A 3BGRB 1D0EA 1VRTB 1S0MA 1TKTB 5L1IA 2D3ZA 1RT6B 2AX0A 5JXSA 2OH2A 2I5JB 1S9GA 4I7FA 1TKXB 3C6UB 2J6SA 1SH3A 2AQ4A 4ZVFA 3V6DB 4JV1A 5HLFB 2YKMB 3GV7B 3QGHA 4NLXA 1C0TB 1UWBA 5KFRA 2JEGA 5FDLB 4QWEA 3CIZA 2BANB 1IKWB 4MIBA 4Q45A 1S97A 5HP1B 3GV8B 4NLVA 1XR6A 2HMIA 1S0OA 3KLHB 2VG7A 2HAIA 4DEZA 5JUMA 4RW4B 3KK3A 3C6TB 3FDSA 4RU9A 4J9KA 2UUTA 1JXLA 4EBDA 1RTJA 5J2NA 4ED7A 4M94A 5L1KA 3MEGA 5KFHA 4XPEA 1T03A 1D1UA 1S9EB 1HQEA 2OPRA 2RDIA 4ZPBA 3M8QB 1RA7A 2GC8A 3GIJA 2YNHB 3DLGA 4IDKA 1TL3A 5I42A 3OLBA 3MR2A 3HVTB 2YKNA 4QPXA 3KMSA 1TV6B 5KFBA 4HYKA 4DL3A 5CYQB 4QWCA 2B6AA 5KFLA 4ECQA 4H4MB 3KLGA 4JUZA 2IC3B 2R2UA 2R8IA 4ED8A 4RW8B 1JLBB 5J1EB 3DMJB 3I0SA 1SUQA 1QAIA 5KFDA 2FVRA 5KT3A 4ID5B 4IRCA 4MIAA 3DRRA 4WZMA 2FVCA 5KG5A 5KFWA 3ITHA 4IG3A 4NLUA 4F4WA 1MU2B 1HYSA 5EDWA 4KB7A 3KLEB 1JLCA 4IG0B 4J9QA 2C28A 1JLGA 4IR1A 3V6HA 4DL7A 2JC0A 1HMVB 4K4XA 4G1QB 5I3UB 5C25A 3KK2A 5DLGA 1DLOB 4ED0A 4IFVB 3NBPB 2R2TA 3TAMB 3RB0A 3NMAA 2IA6A 5KFPA 5D3GB 1BQMB 2FJXA 3DM2A 3GQCA 4KFBB 4DL6A 2WONA 1U09A 1BQNA 2IAJB 3IG1B 2GIRA 5T14A 1C1BB 1SH0A 2CJQA 4NZ0A 2W9BB 4K4TA 1I6JA 4IR9A 1TKZB 1ZTTA 4MKBA 4ECZA 2VA3A 3V81B 3PW0A 4X2BA 5KFZA 2VG5A 4YMEA 4DG1A 3HVWA 5DGBA 2YNGA 4FBTA 1JIHA 2OPSA 3D5MA 1REVA 4QW9A 4J9PA 4NLGA 3FFIA 2ZD1B 2W7PA 2XGPA 2B5JB 4OL8A 4ED1A 1RDRA 5DG7A 5J2PA 4KE5A 3ICLA 1LW2B 3NAIA 4WFXA 5C5JA 3G6VA 2C2DA 4ZMMA 1TL1B 2HWHA 3OL7A 2ASJA 1LWEB 2FVSA 4MK7A 1JLQB 1JLAB 5KFQA 1XR7A 1QE1A 4TN2A 3PW5A 1ZETA 1DTTB 4K4VA 1N48A 1T05A 3DI6B 2QV6A 2WHOA 3HKWA 1S6QB 1OS5A 1IKYB 2XCAA 2E9ZA 5KFTA 2E9TA 4J9MA 1XR5A 3PW7A 4RW9A 3KHRA 5F8JA 4U6PA 3QGGA 4QWDA 1S9GB 2IJFA 3LAMA 3H59A 3I0RA 1LWCA 1C0UB 4O44B 3CVKA 2XGQA 3QIPA 5KG6A 3OSNA 3H5XA 2D3UA 3SFUA 2OPQA 2J6UA 2FVPA 1EP4A 1LWFB 2ALZA 3I5AA 4ECTA 3GIKA 5KG7A 4KKOA 3KHGA 5C42A 3DYAA 1RTIA 2R2SA 4URQU 3GIMA 1TVRA 2HMIB 1IM4A 3M9OB 2VG7B 1RTDA 3KK3B 4PWDB 4MH8A 2DPIA 2VA2A 5J2NB 2YNFA 1VRUB 4NLRA 2D41A 1HNIA 4PQUA 3BQ1A 4H54A 1RYSA 3CWJA 1HQEB 1N4LA 3N6MA 2W8KA 4IDKB 4B3OA 5I42B 3FSIA 3JSMB 5EWFA 2YKNB 1TP7A 4TYAA 1RYRA 2V9WA 2JEFA 2B6AB 3IGNA 2UVWA 3KLGB 3ISND 5F8GA 4HKQA 3EPIA 4KV8A 4RNNA 4KAIA 3D28A 5DQHA 1SUQB 3M9NB 5KG1A 4Y3CA 3KLFB 5DQGA 3KLIA 5L1LA 5KFJA 5K14A 5KFVA 4PUOA 4IG3B 4Q43A 4O3QA 4R8UB 1HYSB 4KO0A 1S6PA 1YVFA 4LSNA 3I5BA 4NLOA 3CJ0A 3BREA 1JLCB 5KT7A 1R0AA 3Q8SB 1N6QA 3G6XA 1JLGB 4NCGA 3CJ2A 3LP0A 2AGOA 1SV5B 1IKVA 4NLWA 4LSLA 1DTQA 1FKPA 5EWEA 3KK2B 2ZE2A 4EBCA 4I2PB 2FJWA 1SH2A 5KFAA 5DLFA 1IKXA 4YP3A 4ZVGA 4RW7A 5HROA 4RW6A 2XCPA 3RBEA 4K4SA 1RTHA 2WOMA 3VQSA 1TQLA 1S1TB 1BQNB 3LP1A 4ECSA 3PW4A 4ZPAA 4YR2A 1FK9A 4Q0BA 3DLEA 5KFGA 4EO8A 4EO6A 3UR0A 2VG5B 1J5OA 3CJ4A 3KOAA 3JYTA 1S1XB 4DG1B 2XI3A 3PHEA 2YNGB 2W9CA 1CSJA 1REVB 4MFBB 3OHAA 2W7OA 3M8PA 3LAKA 1RT7A 3FFIB 4G3IA 1K1SA 3NKYA 1JKHA 1JLEB 5J2PB 1S1VA 2UUWA 4ZPCA 3PJXA 1HPZA 1C1CB 4RUCA 3T5JA 4MK8A 1S0NA 1RT2A 4NRUA 2ILZA 4O4GA 3BGRA 1VRTA 3PJWA 2RF2B 5J2QA 1QE1B 1RT4B 3LP2A 3BSOA 1T05B 4ED6A 3E01B 1EETB 4NLSA 3UQSA 2YKMA 4KSEB 4WYWA 3IS9A 5KT5A 4NRTA 3PR5B 3NAHA 4DL5A 1JLFA 1RT5A 2IJNA 4I2QA 2BANA 1IKWA 4DL2A 4ZP8A 2HNDB 5HP1A 4GC6A 4IH6A 4RW9B 2ASDA 3HVAA 2ATLA 3G6YA 3UPFA 4WXWA 5DG9A 4NLPA 5KFSA 4EEYA 3DLKA 3I0RB 1LWCB 2IM3A 5KFKA 5DG8A 3QIPB 4EYIB 3DOLA 4RNOA 4ED2A 2R8JA 4R0EA 5F8HA 2IMWP 3M8QA 3HHKA 1QAJA 3T5HA 5C42B 5F8LA 4K4UA 3DRSA 3DYAB 5HBMB 1RTIB 4EBEA 5KFOA 5KFIA 3TQ1A 3BQ0A 1TV6A 3RBDA 4H4MA 1Z4UA 2BE2A 4RW8A 5J1EA 2YNFB 4M95A 3FRZA 4ECXA 5KFXA 1HNIB 4ID5A 4PQUB 2FLLA 5C24A 4F4ZA 3E51A 3G86A 5KT2A 3PR4A 3CDWA 4NLDA 1S9FA 1S1WA 4ICLB 3DRPA 4B3OB 2HNZA 3Q8QB 1RT3A 1HQUA 4JV2A 1MU2A 4R5PA 4RZRA 1RAJA 3KLEA 2GIQA 2BR0A 3MEEA 4TY9A 4I7FB 4FBUA 3MEDA 1S1UA 4FS2A 3GYNA 4ECYA 2WK4A 4K4ZA 3FQKA 1UWBB 2HNYA 5K14B 3ISNC 3QO9A 4ZHRA 1QUVA 3KK1A 3TAMA 3N6NA 3SFGA 4KO0B 1S6PB 4LSNB 4NLQA 1BQMA 1RT1A 1R0AB 1N5YA 1S4FA 3OL9A 3KHHA 4K50A 4KFBA 1GX6A 1KLMA 4ECWA 1RTJB 2IAJA 4IKAA 4Y34A 3IRXA 4JV0A 2RDJA 4Q8EA 4ZP9A 1C1BA 1S48A 3MEGB 1IKVB 2W9BA 4LSLB 4F4YA 2ASLA 2JLEA 1T03B 3OL6A 3TVKA 3MR6A 4DL4A 2B43A 3V81A 1NNDA 2OPRB 3QLHA 3MECA 4TQRA 3DLGB 2R8HA 3H5SA 1TL3B 1IKXB 2IM1A 2WB4A 5L1JA 3T5LA 4RW7B 3LALA 5KG0A 4RW6B 3BR9A 4URSA 1NHVA 2WOMB 4TLRA 4F4XA 1HNVA 3MTKA 3LP1B 3MR5A 3H4BA 3I0SB 5J2MA 1JLQA 1JLAA 3KNAA 2R2RA 3H5UA 3DRRB 4H4OA 1J5OB 2V4RA 5F8IA 2W9CB 3ITHB 5DQIA 2W9AA 2R8GA 3CDEA 2JEJA 3Q8PB 2RKIA 3QYYA 2JC1A 2AGPA 1LW0A 1JKHB 4IFYA 2J6TA 4MKAA 4Y2CA 2ILYA 1S1VB 3EZUA 2UVUA
chains in the Genus database with same CATH superfamily
3VQTA 3QSIA 2CRLA 4CO5A 2O3DA 3ENAA 4DPOA 2PMHA 4CLPA 1RHQB 3G4SS 2EFGA 3EGNA 1M5KC 3BN4A 4MMOA 4RLEA 2UP1A 2NXJA 4OYXA 3C19A 4EYHB 4YB1P 2FJVA 5HLFA 3M8YA 4WF9Q 4AXJA 1RU2A 3V6JA 1NJZA 2JLFA 4IUFA 2GFFA 3BBCA 3MPVA 4OZ0A 4WFYA 3J80Y 4XTTA 4FXWA 4OZ1A 3M2VA 4I2PA 1FVQA 2GJIA 3QO9B 2J8AA 3HVTA 3MM6B 5E3CA 1RTDB 1FJ7A 1FDDA 1RISA 1WF2A 3AT1B 3RRKA 4DI6A 3OLAA 4ZVEA 1XMOJ 4O4RA 3PKMA 2KJWA 4MIWA 4G1QA 3KLIB 3T5KA 3X3UA 4P2MA 2JRSA 1T94A 3PVXA 1ZM2A 4N56A 1J27A 3DOKB 2DGWA 1S57A 2NCKL 4FPIA 4DV4F 1U24A 4WFZA 3WX8A 2RHQB 3MM5A 4OHXA 2V8DA 3TA2A 2GJFA 3NGTA 1FX4A 2HBYB 4K5SA 1VQ9S 4ZKAA 1OYEA 1VJQA 1XJWB 4TY8B 4GKKJ 5ETMA 5GAHU 4K4WA 2K7JA 1S0MA 2HVEA 5IC4B 2D3ZA 3HHLC 4JI2J 2M8DB 2AQ4A 2MHNA 1R27B 5FDLB 1SPBP 5ETLA 1XR6A 4NL5A 2RAQA 5BYRA 4X66F 2MDAA 2VQFF 2I8EA 4C11A 3QMQA 2YNHB 1KTVA 2J9CA 2EC2A 1IBMF 3RB4A 5T7LA 5J1EB 4FDFA 1QSSA 1QAIA 4IRCA 2DNNA 2PI4A 2MZTA 3ITHA 4IG3A 5K20B 2B8PA 1B0TA 1JLGA 4HI1A 2Y8WA 5BR8F 1BQMB 4KFBB 5HI7A 5L9NA 1SH0A 4NZ0A 4IR9A 1FRXA 3PYFA 4X2BA 3KWMA 2YNGA 1KD1T 1UVJA 3D6FB 2C2KB 4OL8A 1WUUA 4KE5A 3NAIA 2CJBA 2HWHA 5D15A 1LFPA 5GAHI 1MSWD 5EGYA 1U6ZA 1NH8A 4K4VA 5C2GA 1ACMB 3MPWA 2VDHA 2YWGA 2DEJA 1QSYA 1OIAA 2GHPA 1ZPVA 2XULA 3KG4A 2HGNA 4Q2MA 2HS3A 1MWYA 4MH8A 1ZS6A 3HF5A 3M2RB 3SCLE 3NS6A 4WFBQ 3SCIE 5AJ3F 2X1BA 4PEOA 2FC9A 3S8SA 1I1GA 3F41A 5KFJA 3E8OA 5HMYA 2BJ9A 5I3PA 1YVFA 4M5LA 3P45B 1WJ9A 3PNIA 3CW2C 3GJTB 3GONA 4R25A 1IXKA 1VBZA 2C2MB 2ZE2A 2D9OA 4ZVGA 1H0HB 2Q66A 1G3OA 3HHNB 4A48A 4PQAA 4CTAA 2UUAJ 3CJ4A 1R7IA 3M8PA 4P7VA 4OJHA 1N36F 4RUCA 3PM9A 1EETB 3ZXWA 3CJ8A 2V50A 2OP5A 2W2QP 4DX5A 3VVUA 1FJCA 4I2QA 1PYSB 1KRPA 3DN9A 2M7SA 2A6OA 5KFKA 1SJRA 3QIPB 5JJBA 4C0HA 1DJ0A 3RAMA 1QAJA 5F8LA 5KFIA 3GJQB 1QM9A 5FD1A 4Y2IA 2L48A 3P4UB 2FGCA 1A9NB 4F2SA 4BWJA 4LIWA 1SKUB 2CIMA 3TO8A 3WBZA 1WHXA 5ETTA 4B08A 2BR0A 4I7FB 3GYNA 2LQBA 2CQIA 3FQKA 3HP6A 1L5UA 2VC1A 4LBHA 1KLMA 4USWA 4ZLNA 1KQGB 1KNZA 1GMWA 1HNXF 3QLHA 2R8HA 4P9SA 4RW7B 2EVZA 2V94A 2IPOB 4DSJA 4OLOA 4LT6A 4LRFA 4I1TA 3ZZOA 4IFYA 5LM7E 2ATCB 4K7QA 2SXLA 2OPPA 3BKFA 4IH5A 4KHMA 2ZWOA 1WEXA 5F8NA 4TXSA 3GIIA 3DOMA 2AEMA 3D3BJ 4PWDA 2AHOB 3OTEA 2K1RB 1WD6A 3H4DA 1PIEA 1Y5LB 5D4LA 3EZOA 1VQ6S 1HI0P 3MPDA 1SJFA 2G2YA 1AUSL 2DXDA 3TX0A 2M5YA 2HFZA 3N28A 2JVRA 1VR6A 3KDNA 2G13A 1QSLA 3MEDB 2M0GB 5HMWA 2ZITA 4DR2J 3JSBA 2L08A 2J0QD 4RNMA 4DZ6A 4QZVB 1FDBA 3DDNA 4ANEA 3C2PA 4DR4F 1S1TA 3S7RA 4F4AA 3IRXB 1FDAA 3K5LA 3QZ7A 2DGVA 1YJWS 1S1XA 2HW3A 2MSTA 3H5YA 1X5TA 4QW8A 1RAIB 3T1AA 3PDNA 2VC0A 1EB0A 1Y4ZB 4NA2A 4IFVA 2VPYB 2BJ3A 3B78A 2VKRA 4DV4J 2XO7A 3IG1A 3EGWB 2C2RA 3KJVB 3GP9A 1FVSA 5KG3A 5IV3A 3JAMU 1OY8A 3KLVA 3CPWR 1SC4B 3ONQA 1QD1A 2KFYA 4Q0BB 1VLOA 1WG5A 2V0NA 5IFMA 5ETSA 3I87A 3K58A 3DDKA 1VRTB 2W4PA 1BE4A 2BKPA 3PRDA 4LMZA 3HFZB 5HK4A 3PTWA 3MUMP 4X66J 4DBQA 4OZNA 4N76A 2HMIA 1JXLA 4USJC 4M63A 2OPRA 2BDPA 1FNMA 4QWCA 3JTOA 4L73A 2XMTA 4FPRA 4LF5F 2DNHA 1HYSA 4LR9A 4OI0A 3KLEB 4FF4A 3OPKA 2E7WA 2C28A 1VIOA 2QSWA 2LQ8A 1UTAA 4ED0A 1HNWF 3JTNA 5KFPA 1UZDA 3W2VB 1NHKL 1K9MT 3UW1A 2BBEA 2ZC3A 5T14A 2UUBF 2XYPB 3OXGA 3D5MA 3FFIA 3G6VA 3N5FA 3LH2S 4CI0B 3T1YJ 2DO0A 1HIYA 3VAHA 1JLAB 1XR7A 4HL9A 4CT8A 4UQGA 5D4PA 4HVZA 3HM9A 3M05A 2ZEJA 2P6SA 2YX4A 2XGQA 4DSIA 3AJDA 5KG7A 2Q1LA 3VVTA 4NPOA 3MM6A 1RTDA 3MAQA 4KQZA 4N7TA 4PQUA 3BQ1A 5AJ3J 3N6MA 1H2TZ 2W8KA 2OIHA 3CJSA 5DS7A 4MT1A 3DLJA 2V9WA 1RWMB 2B6AB 5B09A 5M2UA 1HHQA 3KLIA 2FGOA 1B99A 2B4OA 4B3SJ 4F0KA 3M32A 5KT7A 1TTHB 2R9LA 1IKVA 1L3KA 2EPIA 4C2MA 1IWGA 1FJGF 1RJJA 2XYGB 3OR2A 4ECSA 1Y11A 3GJSB 1WI6A 4NEYA 1P8GA 4DFMA 1AFIA 3LUYA 1YRUA 2XI3A 2LA4A 1CC7A 3PJXA 2DHSA 1RT2A 4JI8F 1XWLA 3IM9A 3BSOA 1KWMA 4IYQA 4P6QA 3PR5B 3CT9A 3NAHA 4DL5A 1VIXA 2IJNA 3DGPA 4U7UK 5CH7B 2G2ZA 5RUBA 4GC6A 4WCEQ 5DDPC 1XN9A 1D8ZA 3CCUS 1JMTA 3D68A 3FSXA 3D7SB 4NOHA 2IMWP 4K4UA 4KGVB 1YHQS 1WG4A 1Z4UA 5J1EA 4O0NA 5CZVA 3DRPA 3NXZA 1RT3A 3H8YA 3A8IA 2B8QA 2ZH2A 4LFBF 2JWNA 4PYDA 2AEFA 1KQFB 2V68A 4F36A 4CM0A 3FSYA 3HD2A 1BQMA 4KFBA 3GIRA 4ECWA 4JV0A 1T03B 3TVKA 1NNDA 2PA3A 3RW7A 3R8YA 2ZDPA 2E1PA 5KTQA 3QFHA 2EXUA 3O3LA 2D69A 3EE3A 3R5DA 3C16A 3TNVA 5LL6d 4X4RA 4XDDA 3Q8UA 5F9LA 2CZ4A 2Y8YA 3VHQA 3MMBB 3TZYA 1NKEA 1KQKA 3W9IA 3IS9B 2LFVA 2DGSA 3N6LA 1GEHA 3Q8VA 3BKTA 2KRRA 3D4JA 3S01A 4J9OA 2E5HA 4X4UA 3M2RA 4DX8H 3V4IA 2V8PA 3AQPA 2Z2YB 1NO8A 1S0VA 2IYGA 1TKTA 2MSSA 2MQQA 2BQUA 3TW0A 1W2BR 4CH7A 3V6DA 2YKOA 4O3SA 2YTCA 4OI6A 5LT5A 1KFSA 1WG1A 3QZ8A 5KFMA 3K89A 2BOAA 3PG9A 2IM0A 4GKJF 1N5SA 4QIEA 3BBFA 4QU7A 2YBVA 4IG0A 4U7UD 4XO0A 2LYVA 2G1DA 3NBPA 1F1BB 1EETA 1YG0A 3GYGA 2CDQA 4DCPB 5EHHA 2QA2A 3EPGA 3ETOA 1KHVA 4C3MA 3AA8A 1VISA 2YX7A 4YQWA 5KFYA 1TMMA 2B51A 1SJQA 4YR0A 2IBKA 3OQ2A 2MYFA 2C3YA 3OSPA 3MM7A 2EFPA 2CNNB 4V19X 1LWEA 1U1LA 4I7FA 1FDNA 4J37A 2YKMB 3MAHA 3Q2TC 3R5CA 2V2VA 3CIZA 3OVSA 2EFNA 4NYOA 1MLAA 3FDSA 3NNAA 4XPEA 1NJYA 3UDVA 2RDIA 3GIJA 2CVIA 3EJMA 4U95A 3A13A 3RTVA 5KFLA 4H4MB 2R7XA 4DLEA 4LF5J 2DD8S 4ELTA 2M2BA 3MD3A 4MIAA 2ZH9A 1M5VC 3RJMB 3P3DA 3OJUA 5KG5A 1WDTA 3VZHA 5D8HB 1PKUA 4I69A 2LQ9A 2LP4A 1X7VA 1P9QC 3V6HA 5THWA 2IA6A 4Z7YA 3CNQP 4WKYA 4K4TA 4MKBA 4ECZA 1KVJA 3PW0A 2DGOA 5D0GA 1H72C 1IBKJ 1SCJB 1RDRA 3UO0A 3KUEA 2XHWA 4V19J 1RE1B 2P9EA 3CTRA 2KT2A 1ZYQA 4QIVA 3KHRA 4O44B 3H5XA 3L95X 3W1YC 2MZJA 3EDRB 1WC5A 1U0SA 2X3DA 4DQSA 2VG7B 2RVJA 3DDIA 2YNFA 3R5GA 2XLJA 3NCRA 3HT0A 3MURP 3CCZA 1T9TA 2GAHC 4KAIA 3ZZ0A 1RGVA 4PXCA 2LXUA 3B82A 4KO0A 1TUVA 3FEZA 2DJWA 6FD1A 2EKYA 3K5MA 1HWUA 3R5JB 1HWIA 1DAXA 3HVRA 3LO3A 1M5HA 1NMEB 1BQNB 2NZCA 1P1LA 1U0HB 2M3DA 3D6TB 4Q0BA 3BR8A 4EO6A 1IR1A 1O51A 2VASA 1RHJB 2LA6A 4WBFA 5J2PB 2AIRB 2BA9A 5L39A 1VRTA 1SQEA 2HVDA 2CPYA 5CXTA 3E01B 4QPTA 3UQSA 2JZ5A 2MKCA 4USHA 1GT8A 2BW2A 3G6YA 5DG9A 5HJYA 4BS2A 4RNOA 3RR7A 2RT3A 4ITSA 3GYXB 2DR7A 3HZGA 5AE1A 3GLJA 2AYEA 3MM8A 4F4ZA 4I67A 1V3SA 2HNZA 3KLEA 2GIQA 2ZM6J 1OO0B 4LVNP 2LKZA 4CO4A 3D0HE 2CJAA 4RU2A 4K50A 2LU2A 1RAEB 1MW7A 4P10A 4BC7A 3BPSP 5L1JA 2MZ1A 3EZ5A 1RLCL 4KPCA 1OQ6A 1JLAA 1SIZA 3AJ2A 1T9WA 3M6UA 1HWLA 2LXIA 5CA5A 2GVZB 1SC1B 4J9VA 3FZ2A 2C2OB 5LXRA 2AX1A 3DM2B 1R0BG 1NHUA 5KFFA 4RUAA 5IT4A 4PXBA 4NYPA 4RBVA 1Z2LA 3UFCX 1FRJA 3N9UC 3PZPA 4NXNJ 4AQYF 4WP9A 4Q5VA 2I5JA 2R7VA 4WXOA 4L6V3 2KXNB 1QY7A 1X4HA 2P8IA 1M5OC 1LKZA 3C6TA 2C22A 1VCTA 4TQSA 1N88A 4EBEA 4KKOB 1KONA 4IOBA 1VHFA 4GKJJ 4WZQA 4LQ3A 2FUG9 2VFSA 3OTBA 4YHHF 1R89A 1RWUA 4DQIA 1UJ6A 4USVA 3NY0A 1H7XA 1HARA 4E2FB 4CNZA 2HKEA 4A47A 4PUOB 3FBFA 1N54B 3GJRB 4QIFA 4CQ1A 2YNIB 1ULRA 2VFVA 1Q1KA 2W2OP 2J9DE 4CZCA 1U4BA 3FJ2A 4B3MF 1N52B 1FK9B 1A7GE 3DLEB 3M1VA 5D0HA 4PCQA 1WSRA 4XK8C 2GMLA 2VQEJ 1VK3A 4M5GA 3H2LA 2AYGA 5CYMB 1RWXB 3SI8A 3D0IE 1X4BA 3LA0A 2AX0A 1QTMA 3C6UB 2ZBCA 1ZOTA 2R7RA 2OEMA 4DEZA 5LXYA 2H5IB 4RU9A 3ET6A 3PRBA 2H65B 1T03A 2WVBA 1HQEA 2CPDA 3M8RA 2ZJPQ 2YWKA 3MR2A 5CYQB 1NSAA 2CQHA 1PJ5A 1YI2S 4N41A 4NLUA 1SVDA 3C46A 2OEKA 2RSQA 3IBFB 2KZMA 3KK2A 3MMBA 1DLOB 3RB0A 2G2OA 3GQCA 4F4KA 5DDRC 5G0RB 3CCSS 4ID8A 1RCOB 3ZTSA 4J9UE 5LMUF 2XQCA 2HRTA 5AT1B 1LEOA 2IJRA 3EMTA 4K0KF 4N8OA 2DYAA 4B3RJ 3UVJB 1RAAB 3POTB 3PJ9A 2DEIA 5H9FK 5B0GA 3DYAA 3G71S 3O8WA 1FXDA 2GS8A 1LXNA 3M9OB 4CP5A 3M30B 2UXDF 3HK2A 1WKLA 2XSFA 4TYAA 4AL5A 2JOQA 1WTBA 4L76A 2RHSB 5L1LA 2OHDA 4DSFA 1YBTA 3ZZZA 3I5BA 2YH1A 1K8AT 1JLCB 4JI5J 1X9SA 3CJ2A 1TZ0A 5A8WB 4YB7A 1IBLJ 1YDLA 3W8PA 2LCWA 3RW6A 2GQCA 2KKHA 1Q79A 3A3OB 2VG5B 2O01C 2ZHOA 3OR1B 9ATCB 2HGMA 4X4NA 2D3OR 3OXLA 2DRDA 1UA1A 3LP2A 1U47A 4NXMJ 3UD3P 1VOMA 4MJKA 5IT9U 2YKMA 5E3RA 2ZZNA 4OJ3A 4F0HA 3MI7X 1RK8A 2HS4A 4WXWA 1G2EA 5KFSA 1GNKA 2IM3A 1FKAF 3W7BA 2HRUA 1BQXA 1TELA 4ANCA 2EWHA 4H4MA 2BE2A 5KFXA 2F9DA 4C98A 3PR4A 3UN5A 3ILIA 5ETOA 1CJKB 4NA1A 1UWBB 4ZS6A 4ZHRA 4ELUA 4LSNB 1TFWA 1UKUA 1R0AB 1YJNS 4U9RA 3KUHA 1OJ4A 1S48A 4QYRA 3CCWA 3MECA 1RXOB 1C4CA 2WB4A 3DXBA 3BO3A 4URSA 4F4XA 2FY8A 3FEYB 1RZMA 1XNRF 1QUPA 4H4OA 2W9CB 2W9AA 1SJ3P 1R8CA 4JBCA 2KT5A 1NXIA 3PCOB 3W65A 2MKKA 1B0VA 1RWOB 3GR0A 3TJAA 4O44A 1FD2A 1S49A 3VAFA 1HBNB 3G9CA 3Q23A 4FXVA 4LRBA 2RQMA 1WEZA 5E5NA 1T95A 4CO2A 4YR3A 2OPSB 3DOLB 2NLWA 2HHHJ 4MAKA 4ZP7A 2FLPA 3RB6A 4FKXA 5FIIA 2K3IA 3GILA 3B54A 5EWGA 4ED3A 3W5XA 4KBIA 2N4DA 5L8RC 1APSA 2L3MA 1TL7B 2FLOA 3QWUA 4C9DA 3WIUA 4J9RA 4YHHJ 2UXBJ 1J2VA 2QRRA 3IGVA 4LRAA 1X60A 3H42A 3BSAA 5MAOA 1RWKB 4L3KA 3D6MB 1X5OA 1W25A 3ETMA 2XNQA 3E01A 3HHLB 4I4BA 4ECRA 3V5RA 2DR6A 1GXLA 2XI2A 1R8AA 4NCGB 5J1NA 2WCXA 2XLKA 1DTQB 4FF1A 1MMDA 3MCMA 3W9HA 2OUGA 3KDOA 2CQDA 1E6VB 4QR2A 2BJDA 1EZZB 2FVQA 3J7ZT 4LF8F 1N5QA 1UWAA 1SH3A 1FCAA 4DR7F 1VQOS 1Y3JA 1KOOA 1N32J 1C0TB 2QLBB 2V63A 5HP1B 3KLHB 3KK3A 5J2NA 4K8RA 2RILA 3ZC4A 1VS3A 5KFHA 1WC0A 5LJ3Y 1WI8A 1D1UA 2J0XA 1T9UA 3HMJG 4RWXA 2YKNA 1X4CA 2HBZB 4FYYB 3PO5A 2CA9A 3KNGA 2HRYA 4C0OC 1ZZNA 2C1EB 1MU2B 1HHTP 1ZA1B 2XHCA 2ZC4A 3FBCA 2JC0A 4B9LA 5I3UB 1VJWA 2WZ1A 1UEUA 4I0WA 3A8JA 3DM2A 2GQQA 5BYQA 3CUNA 5A0YB 4ILLA 5LMUJ 4YS2A 5F3TA 1RB0A 2RRNA 3BYPA 4K0KJ 3G2XA 1DTTB 2HPUA 3L3CA 2O67A 5IQ6A 1Q86T 3DI6B 1NK0A 2CUYA 1HFEL 4C8KA 2XCAA 5KFTA 2E9TA 1EQ0A 1RKJA 2V4JA 1K0VA 1LQ9A 4X4TA 3CVKA 2ALZA 4KKOA 5C42A 3DGVA 1RTIA 1U26A 4JI4J 4U8VA 3BO4A 1FTCA 2VPZB 2W4DA 2KVQE 2MLXA 1Q8IA 2DY1A 1MWZA 2XMWA 4NI2B 4ES3A 4KIAA 1NPKA 5KFVA 4PUOA 3AB4B 2DGUA 3BREA 1Q53A 2HQFA 3THVA 4LSLA 1AZSB 5GADU 2A2DA 4P2FA 4O0IA 3RBEA 4WJBA 3NEKA 4U67Q 1FK9A 3DLEA 5KFGA 2KRBA 1SXLA 3EVOA 1CSJA 3NMRA 3W5ZA 1G6BA 1YJUA 2DGQA 5A2QU 1K0TA 3VWSA 5IZHA 2KFNA 3OFEA 4LIRA 5J2QA 1H3DA 3FCVA 2CPJA 1BC6A 4ZN3A 2CWKA 2VPWB 1CULB 5CD4H 1WWHA 1PBUA 2PMZD 1U2FA 3CCTA 1X0PA 4OHYA 4M8LA 1V9OA 5E41A 4L72B 1HNIB 2J9EA 3OTCA 1Z2ZA 2PI5A 3RU0A 4RZRA 4JYAF 3JSYA 1VK8A 3KK1A 1EKSA 4N5SA 1S4FA 4HH0A 3SSRA 2RDJA 2OFGX 2ASLA 4DL4A 2WVCA 4F02A 2KH9A 2I2YA 2F3JA 2BE7D 1MG7A 3P5TL 2D1CA 1T0TV 5J2MA 2R2RA 3RBZA 5F8IA 2MMYA 2R8GA 3QYYA 1JKHB 3Q24A 2CPEA 3MR7A 3CD7A 1HD0A 1KEKA 2HQGA 2MJUA 3POTA 3SDEB 2F7VA 1UFLA 4P73A 1KKHA 1WHVA 4P7TA 1VGYA 1D8YA 4KHRA 2A2CA 4DF4A 3VAKA 2CPZA 2AJ1A 2DHAA 1WC6A 5KAKA 1XNQF 1DQ9A 1RADB 3EXYA 4ZLPA 2ZH4A 4IO9Q 1HKAA 4C0BA 2I0XA 3WC0A 4R5PB 4Q8FA 4F67A 4KPYA 2Z2MA 3ZTRA 5F9NA 5A8WA 3IR7B 2CQPA 4ECQA 5L9XA 4OMFG 3QJPA 3F73A 2WW4A 1TFYA 2XC9A 1N5YB 3GSIA 3CJKB 2IC3A 4DF8A 4UUXA 4UY8T 1HWKA 1X4AA 2F65A 4DFJA 2V2QA 3T19A 4O3OA 3TZZA 1YJRA 4XPCA 3OUYB 3PO4A 1LW0B 3RAQA 1ZZFA 3DC2A 2ZJQQ 4UZBA 3BSNA 1N8RT 2FLNA 1CQMA 3EVMA 2BKOA 5HROB 2QC3A 3U7JA 1VC6A 1TL1A 1R43A 2HFNA 1NRKA 4I68A 1FJEB 2R4FA 2XZWA 4LF8J 4K5RA 2KVIA 1IKYA 4K4YA 2HQ3A 3OL8A 4KGKA 4DR7J 1SJ1A 2ZWPA 5L1IA 5AXNA 1S9GA 1CJKA 5K8PA 5CABA 4J5OA 5HLFB 2HEKA 3NCPA 4NLXA 5CHCB 1UWBA 2JEGA 1PC5A 2BANB 4Q45A 1S97A 1B4SA 1CS4A 3SZ2A 4FBTA 1H6KX 1T7PA 1B7FA 1TK5A 3M2VB 2MQNA 2FJAB 3ULHA 1J5EF 5E33A 3HVTB 3TJ9A 5KFBA 2WSFC 2AT1B 2CJXB 4JUZA 2R8IA 4RW8B 2DGTA 2AKWB 1Y00A 3HJFA 3WZ0A 4F7VA 3AXMA 1EAYC 4G1QB 2G0IA 1JXEA 4OYWA 2EBEA 3H7HB 2C3OA 1D09B 1HBNA 1U09A 2GIRA 1AUDA 1FNOA 1EARA 2DR8A 4DFKA 2OPSA 5E7OB 2DNLA 4PYAA 2EBGA 2GNKA 4ZMMA 4A8MP 3UI3A 3ILJA 5KFQA 1N48A 1NJIT 2ZNYA 2CAJA 3BDPA 5HL7Q 4DPWA 1TL7A 4M5HA 3H59A 1SKSA 3VAJA 3NGUA 4LJMA 4IO1A 3N5BA 3FKBA 3O44A 1R31A 1EX8A 3TA0A 3K7RA 3C66A 4C11B 5EWFA 1VYAA 5T7LB 3EWGA 2YQ1A 2NPFA 4P72A 2ZOMA 5K14A 4IG3B 3HHLA 2ZVSA 4IOCQ 4F2RA 1JLGB 4NCGA 1S77D 1Q95G 1DTQA 5DJBA 5D6GA 2M52A 1P27B 4DN0A 2X1GA 2AJQA 1NLKL 3AA9A 5DZ6A 2VZ9A 2KG0A 2MKHA 1J5OA 3K8VA 5IWAF 3PHEA 2YNGB 3J81j 4L75A 1JLEB 1NDKA 1S1VA 1R8PA 4WKRA 3T5JA 1LFWA 1A6LA 5HQLA 4F3MA 2AZ1A 4AFFA 4ED6A 5DETA 4KSEB 3BV8A 5BYSA 1PSDA 3ENQA 5HP1A 3CGIA 4X4QA 2UU9J 5HAOA 1UVMA 2RB7A 2QMXA 4R0EA 2H3EB 2M88A 1JJ4A 2DR9A 1MWQA 1EJ7L 2W01A 1CPZA 3JQMA 2YKAA 1UZHA 3PACA 5I4MA 1F2GA 1HQUA 1MU2A 3LGMA 3OTDA 4J91A 4C4WA 4FBUA 3CC4S 3EVWA 2HLTA 3ISNC 2D3O1 5K9FA 2R7WA 1YJTA 3OL9A 4Y34A 3ZZUA 4LF9F 1L3SA 2FDNA 4L74A 2VV5A 2IM1A 3D1HA 2RE1A 2B0GA 2FHKA 3BM7A 4CTAB 3F44A 5E3AA 3Q8PB 2RKIA 2VBYA 1FTRA 1Q5VA 4LF2A 4PG7A 1XERA 3HULA 3O2IA 2QE5A 4I2QB 3T1HJ 1RABB 1OPIA 2MKIA 2UVRA 2RDDA 1P6TA 2MQMA 4RUHA 1XNQJ 2HIYA 1P1TA 4J9LA 2DNYA 4N77A 1S76D 1R0CB 3TUZC 5HJXA 4RW4A 5D0RA 4J9SA 4ZITA 2L9DA 1S9EA 2GCFA 4UOCA 4DS4A 5DM7Q 1FI4A 1KLMB 2QT7A 3DMJA 5IQQA 2G4BA 1NK5A 3QLHB 2FZKB 1WELA 3QIDA 1ZPWX 2ZFHA 1QVFR 3NGSA 3CC7S 3I4HX 2QLFB 4ZVHA 1FWPA 5DDOC 5I3QA 4IFYB 3DHWC 1UVLA 4G1PA 4Q44A 2HG4A 4ECUA 2YPYA 4DJBA 3P8BB 2OPPB 1CBKA 5SUHA 2WBRA 4ZCLA 4RJVA 3M7VA 2XWYA 2ZD1A 4WPAA 2B5JA 3OVBA 3DOMB 3DNCA 4CLUA 1PO6A 1NSPA 4MK9A 2NR0A 1VQKS 1S6QA 2MY8A 2OELA 3QWPA 4DFPA 5JVGQ 2CNOB 4I64A 3QGHA 3TANA 4KGMA 1F9HA 1IJFB 4NLVA 1L3VA 3X1LB 1YZ7A 3FGVA 2FHJA 4IDKA 3PXGa 2AV5A 3O6QA 2Q3PA 3TARA 3IMQJ 2YQ0A 4KB7A 3NGRA 4HACB 1FRLA 3PIPQ 3B6BA 4IFVB 3BPDA 3SDEA 5LMNJ 3IG1B 3TZWA 1C1BB 4DR1F 3VGVA 4YB5A 4X62F 4ES2A 3Q2SC 3I9ZA 4B9VA 2F1FA 1UPPA 3H25A 2ASJA 2HBRB 1QE1A 4TN2A 4HTJA 1T05A 4AUKA 2CFXA 4ZPTR 5ETNA 4RW9A 3RUBL 4U6PA 3I0RA 5A8RA 3SFUA 2FVPA 1LWFB 4ZIVA 5BXIA 1CVJA 2HMIB 3ISZA 3CJKA 5C2CA 2DPIA 3R97A 4CT9A 3NP5A 1Y3KA 3EPIA 3WC2A 4NWBA 2KYXA 2Q79A 3ZTQA 1HYSB 4DXLA 3ZZYA 1SH2A 4PKDB 4X84A 5HROA 4RX6A 2R42A 2COLA 3AHPA 3LP1A 5IWAJ 3PW4A 3FMWA 3ZZRA 5D77A 2W7OA 3FFIB 2DNPA 2GMHA 2ZBPA 2VJVA 3CD5A 5B08A 4NRUA 1LWXA 3PJWA 3OD2A 1RT4B 4HDHA 1RT5A 2BANA 3I82A 3HSJA 3IR6B 2B4PA 1TK0A 3PX6A 4HT7A 5F3ZA 3HXMA 4DV1F 2WSCC 4I6WA 4DR2F 3RYLA 3D66A 3NS5A 2XLIA 4PAAA 4RW8A 4O23A 2G1HA 4PQUB 4N8NA 1RAHB 1S1WA 4USIA 3LF0A 2PGCA 4TKTA 1S1UA 2VKZG 2BJ7A 4YB6A 3M32B 4LF9J 3AXKA 2BX6A 3I56S 2MZQA 3MEGB 1IKVB 3IXQA 2DR5A 3LWMA 3MUTP 2RU9A 1X9MA 1VQLS 3DLHA 4TLRA 3OR2B 3Q86A 3H4BA 3I0SB 2VF3A 3BDEA 2GMJA 2CZVC 3CDEA 2JEJA 3VF0B 2QL7B 3CSKA 2IMOA 5B0EA 1RT2B 1YJ7A 1BD6A 4CLFA 2PMWA 5E3PA 2O1PA 1DZ5A 1ZM4A 2JVOA 2V34A 4FYXB 2KHDA 2RQCA 1FKOA 4E0DA 3TR5A 3DGPB 1JJHA 2O5DA 4WU3A 4KR0B 4F0MA 5L46A 1AYEA 1NB2A 1NPPA 2IY5B 2OAUA 3HHLD 1XMQJ 4OJGA 1CJVB 1PBAA 1LV5A 1OY9A 1TKXA 3NGKA 3HT3A 2PA8D 1SC6A 3B4DA 1XC9A 1UW9A 2OEJA 1FO1A 3DRPB 1RT3B 3RRHA 2FJDB 1U1QA 1EP4B 3M6VA 1LNQA 2R7SA 3CJ5A 1LK7A 1IUJA 4TLQA 2N7YA 3MZIA 3D1OA 3R6LB 5AXKA 1RWVB 4QWBA 1JLBA 2DXEA 1VFJA 4PG4A 3U02A 3TZXA 4AYBD 2UVVA 1JLEA 2ZUGA 1ROFA 4NYZA 2Y9HA 4UOFA 2WB1D 4X4OA 3C16B 3T1YF 2F63A 1WACA 3FBBA 3R1HA 2ZOGA 3LGHA 2I1RA 2MGZA 2KI2A 3W64A 1M1KT 4DMZA 4TU7A 1WOSA 1N56A 2IRXA 4WFAQ 3SYZA 2DH9A 4RNFA 3ILOA 3K5OA 3BBBA 3M9MB 5B0FA 3PHTA 2RUGA 3V4IB 1UPMB 2CQ1A 2MHEA 4HHJA 4E98A 3BGRB 1TKTB 3K59A 2OH2A 2RS8A 1N33F 2QA4S 3G8QA 1B3TA 1B70B 2YX1A 3V6DB 1N0VC 2VD3A 3SQGB 5KFRA 3T9NA 4MIBA 3JB9k 4MKVA 4DV3J 4B3SF 4J9KA 4ED7A 2E66A 4YDXA 2HHXA 3V4MA 1HNZJ 4ZPBA 1RA7A 4JI7F 4RKUC 3DLBA 3KLGA 2R2UA 3T6JA 4C8ZA 5EDWA 1CC8A 3FBEA 1VQ5S 4M5DA 4ZVPB 3N4WA 3I31A 4IG0B 3G82B 2KL8A 3AD7C 3CC2S 1R6VA 1KVIA 2K7KA 4DL7A 3UCZP 5DLGA 2Y0BB 3NBPB 4ZOSA 3CCES 3TAMB 3TJ8A 1RWPB 1UFWA 2Y3YA 4DR1J 1Q4RA 2E29A 2OO4A 3OW2R 2W9BB 2IFXA 1I6JA 3K0JA 1ZTTA 4X62J 1NU4A 1REVA 4ZVUB 1Q0NA 2ZH5A 3MM7B 3R5BA 1CJUA 2AJ4A 1LWEB 1XEZA 4KT0C 2CJYB 4IQMA 3GCXP 1MROB 4EUVA 2DIVA 4DZDA 2OLWA 1ZA2B 4ZDNA 3ENWA 3R6GB 1LWCA 1C0UB 3BF4A 5A8KA 2PE8A 4U96A 2BVZA 4M5KA 3D67A 4URQU 4DPUA 4FYWB 3CWJA 1H73A 3U1LA 3LOUA 5F8GA 2GW8A 2JHEA 1GXUA 3W61A 4Y3CA 4DV7J 4ETZA 3CEDA 1S6PA 3CJ0A 1Y5NB 5EN1A 3R27A 4CM2A 2Y1IA 1JB0C 3AH6A 4G65A 1IKXA 3TYTA 3PYGA 1TQLA 4Y65A 4Q7AA 2EKNA 3OHAA 5M2PA 3LAKA 5IS2A 4G3IA 2ZOFA 4MK8A 2ZVIA 2Y1JA 1G4CA 2GHVC 2FHJD 2WW8A 1JLFA 2Q43A 2RRAA 4DV1J 4W4MA 4ED2A 4PG5A 5F0WA 4TU9A 3DRSA 5KFOA 3Q8YA 5H9EK 4NZ6A 2YNFB 3MHYA 3NG8A 5AE3A 5C24A 4X4VA 2F8MA 2YPZA 2NUUG 1PYOB 4HACA 4NMLA 2HFVA 2AJ0A 3QJLA 4CIOA 2KG1A 4MYUA 4KO0B 3MPYA 2AEJA 2DH7A 1RT1A 3HI9A 4JV5J 2P9GA 4X65F 1C1BA 1CJTA 1FRMA 3DLGB 1TL3B 3AFGA 1UVIA 1NJWA 4Y6IA 4CLTA 3KNAA 3DRRB 2HK2A 2JC1A 4MKAA 4Y2CA 2UVUA 3J7AN 3O5TB 1OWXA 1XMBA 4USMA 2JEIA 2JH3A 2QFJA 4OI3A 1Q5YA 4ZK7M 5AE2A 1LWFA 1M5SA 5DM6Q 4OIXA 3S1TA 1NM2A 2VG6A 3OFGA 2M8HA 2QG9B 3W2WA 3QNWB 2Z0GA 2PN6A 3QGIA 1U2RA 2DPJA 5KFUA 1TK8A 3BQ2A 4C8OA 3QPIA 4ZP6A 3MM8B 4RBTA 4QWAA 5BJRA 5MLCV 2J7KA 2F5GA 2HNZB 5B0CA 1N5TA 3M2UB 4TVAB 3M6XA 2IHR1 2NXUA 3GU0A 3C15B 3J7YU 3E2EA 2G0JA 1AFJA 4WFNQ 3HPOA 1F5CA 1JJ2R 3FC9A 1IBKF 2VOPA 4LUBA 1DURA 1FFWB 2CDRB 4PXEA 1RT4A 3LWLA 4OFZA 5CAAA 2DIUA 3L7PA 5D3GA 4O3RA 2J76E 1VQ7S 2B9XA 2B4UA 1FKPB 2LEPA 4J90A 1U6FA 4I6AA 4GO7X 2P2CB 1SKRA 3QAEA 1RTHB 1LW2A 4JI0J 2XM3A 1HQ2A 4OI2A 1T9YA 4OHWA 4CYUA 2YQ3A 1N33J 2VJUA 4UW2A 4QYZJ 3CD0A 2ASYA 5JXSA 2I5JB 3BB5A 4ZVRB 4CLZA 2DHHA 2GGPA 5B0DA 3QSYB 4WTOB 1IKWB 5JUMA 9RUBA 3C6TB 2YKPA 2UUTA 1WOOA 4DQRA 3J7YI 3MEGA 4JI7J 1OSDA 3VV2B 2GC8A 5I42A 2PC6A 2NPIA 5ETVA 3I0SA 1SUQA 2A1BA 5KT3A 4ID5B 1F0XA 3HDSA 1JK9B 2YVSA 1T8EA 1EQMA 2XY6A 1FEHA 2GA7A 2CJ9A 2CVEA 4PR6A 1UMJA 5HATA 2R2TA 2P6TA 2MB0B 3NMAA 2EG1A 2HVIA 2CJQA 4PZVA 2DK2A 2P9CA 5KFZA 3VGTA 4KHPF 2CWXA 4LR7A 1CQNA 5E0OA 1G1XA 1HL6A 4ZIWA 4ED1A 5DG7A 4DOZA 1CJVA 4LF4F 3M1VB 3W3SA 5JMNA 1IR0A 1BUXA 4ZVTB 1OS5A 2D74B 1H74A 2KXFA 1G7CB 5HQ8A 3LAMA 1RWWB 1PGZA 3MCSA 4DUTA 2J6UA 2R7UA 1EP4A 1IN0A 2ZM6F 3KHGA 2BUNA 2CPFA 3EGZA 3R7SB 3IBWA 3TEHB 4HR2A 3ET6B 1NZAA 1HQEB 1UAWA 2HZVA 1BLUA 4GVBA 4B3OA 3FSIA 4IOAQ 4M5JA 2UUCJ 2LLZA 2XYHB 5DQHA 3M9NB 5DQGA 4AL7A 2Q6CA 2XMJA 4OZJA 4NLOA 3WHIA 4YN3B 4WP8A 4DS5A 3KK2B 1DY3A 5DO2A 2XSJB 1R3NA 1UCNA 1Y5IB 4B9UA 2ZKTA 4MFBB 3SV4A 1URNA 4JI6J 2Y1RI 3TWZA 1S79A 3BGRA 2A3JA 1S7HA 2RF2B 2LQJA 2JDJA 4NXNF 3H90A 4NLSA 4WWSA 3U1NA 3SQGA 3US5A 1WC1A 3UPFA 4A8FA 1DQAA 3W62A 3T5HA 3DYAB 1JNRB 3DU5A 1I94J 4RBUA 3NCQA 4CRJA 3G86A 5KT2A 2BACA 3JXOA 3G82A 4H4KC 1TKDA 3GZ7A 2QLXA 2WK4A 2OD6A 2K06A 1X5PA 4UY85 2HNYA 3QJJA 3N6NA 3TAMA 2EK6A 4X65J 2BKNA 2NXEA 4DPTA 2W9BA 1LK5A 3SSQA 1TL4A 4TQRA 1S7IA 1YTYA 4HH1A 1HNVA 3MTKA 1SKWA 3QAUA 2RH3A 1R6YA 3QT8A 2GX8A 2J6TA 2CQ3A 2X3GA 2VQEF 2V4QA 1X9WA 1MROA 4F50A 1HLWA 3LP2B 1GMWD 1C0UA 2UXCF 4UTGA 1JQGA 2DO4A 4DQQA 2DCLA 5KFNA 2WTFA 2F8HA 2C2EA 2FZGB 4OI1A 1NB7A 1UETA 2DHGA 2ADCA 1SB6A 4QCLA 1AT1B 1X4EA 2VUGA 2BE2B 2RIJA 5GAEI 1F5AA 3DCAA 3BYRA 3MTJA 3D1QA 4IH7A 2IYIA 1GTEA 3IA0A 4LF6F 3VAMA 3HFKA 2VU5A 4PPDA 3IR5B 2AJFE 2VBXA 4LQ9A 4C8NA 3HX9A 4DL0C 3K2YA 4OQJA 4LF7F 1U48A 5G4DA 4ZHRB 1X8DA 2L9NA 1K47A 1S10A 2AP6A 2FJBB 3M8ZA 2BM1A 3MECB 1RKIA 1ZBTA 2ZUAA 2W8LA 2HZCA 3IAM9 4NLYA 4KV8B 1HW9A 4ZPDA 3ELHA 6AT1B 5KG2A 1Q8KA 4H4OB 3PW2A 4C6AA 1D9FA 2E1MC 1U49A 4R0JA 5JVHQ 1VQYA 4RPFA 2C3MA 1WEYA 4B3RF 3TA1A 5DDQC 2AZ3A 4FXDA 3MFIA 2E7XA 2FHOB 3JYTB 1WDDA 3K5NA 4OHZA 2F4VF 3BZQA 4O4GB 4ENOA 1FNXH 2DTJA 4G6VB 3U27A 3CD6S 2CXEA 1L3TA 2JLGA 1HI1A 1KBRA 3M6WA 3GV8B 1S6OA 1RHMB 5FLXU 4RL1A 1FA0A 2F9JA 3QT6A 4JI5F 2B7CB 3MAAB 3DLGA 2HHTA 1RLDA 1TL3A 3HSDA 2Z4PA 3KMSA 1IBLF 1X4GA 3R2CJ 2V69A 2XMKA 1BMQB 1KP6A 2ALYB 3DRRA 2BJ8A 2HHVA 4EGLA 1RACB 3C3LA 4YY3F 5GAGI 5KOWA 4IR1A 4DR6J 4LBPA 2GJ2A 1UJ5A 1FX2A 2HHPA 3IM8A 4NXMF 1TAUA 4KHPJ 2MQPA 4YFUA 2VA3A 2PSZA 2W2PP 3L9ZA 2ZZMA 1WF1A 1NAQA 4NLGA 3PKYA 3SV3A 4WU2A 4LF4J 1VC5A 3K8WA 2CYYA 4MK7A 2DNOA 2W7AA 3PYDA 2YWWA 3TQEA 1DQ8A 2IVYA 1BXNA 1M90T 1HHSA 3M2UA 3RR8A 3GG1A 2YWFA 2FJEB 1XK8A 4BCAA 8RUCA 3KK3B 3C15A 5J2NB 1YLXA 2QJ3A 1VRUB 1BY9A 2DNRA 2C3PA 4DV2F 2PEHA 3RRGA 4C48A 1N4LA 1FEEA 3TVYA 1AB8A 2YKNB 2H54B 4DSEA 4J7CA 2RRBA 3D28A 3UD5A 1O8BA 1M5PC 3FZBA 2EFQA 4O3QA 1FD8A 5CYJA 1X5SA 1FKPA 4Z2XA 5EWEA 2Z2ZA 4QU6A 1M1GA 2CPXA 3BGUA 2ADBA 1PG5B 4JI1J 4RW6A 1RTHA 2WOMA 4NE9C 3TP2A 4ZPAA 3BEGB 2R7OA 3FNNA 4X4SA 3UR0A 2ZHBA 4USTA 2J0WA 1QDUB 2ERRA 4ZPCA 1C1CB 3DKDA 1W7WA 1N34F 2HHHF 3A4TA 4OYBA 1V3RA 2QSFA 4DPXA 3UR3C 1LXJA 4BLGA 1IKWA 3CMQA 2HNDB 3HVAA 2V4JB 2ATLA 4PXDA 3LQVA 3JS9A 5D0EA 3DLKA 4WK3A 2PFFB 2BZ2A 4A4JA 5HMZA 5C42B 3HD1A 1RTIB 4DUZJ 3BQ0A 3M8SA 3EX7B 1F3FA 2UXBF 4ZN1A 3IBCB 4ID5A 5IT0A 5CD4A 5CCMA 3C14A 2BV3A 3MEEA 4TY9A 4ECYA 2GVDA 2IBOA 4RO0A 4RUBA 1YBAA 3UE2A 2W2NP 4B9TA 3DLLQ 4LSLB 1JNZB 2RQ4A 2V8GA 3H5SA 3MCOA 1SBRA 3GCWP 3CCJS 1X4FA 8ATCB 1V5VA 1EHWA 3FMBA 2KFZA 5GMEA 2ASDA 5CQGA 1FF2A 1U25A 2QO3A 2UXCJ 5J2QB 5KG4A 1QJHA 5HVGA 4QR0A 2CQCA 5KOXA 3MR3A 1CEZA 2E1RA 3CDUA 1N32F 4WE1A 3T41A 1L3UA 2XB2D 5DZ7A 3CO0P 4A8QA 1F9EB 1K1QA 3GB0A 1YRTA 1EKRA 3TVZA 1RT6A 4EI2A 2D7SA 2G9OA 4LF6J 3OFFA 2LEAA 1O6XA 1A0OB 2OTJS 2DNZA 4QOTA 4A8KA 4LF7J 4TU8A 2AW0A 4GRSA 4ZVQB 2OMLA 4S0MA 1RHUB 4GC7A 3KK1B 2XSJA 3BS9A 3PX4A 2CKWA 3P49B 1YBUA 2HQDA 3MPUB 3AJ1A 4MFBA 2VICA 5B0BA 2BRLA 3VZIA 4O3PA 2PEBA 1Q81T 2RUSA 1HMVA 5J2MB 2RF2A 2AWZA 4HT5A 3BGLA 2N3LA 3BKUA 4IRDA 2E9RX 3LP0B 5IC6B 1TKZA 4B9MA 1X31C 2I9SA 3QGPA 3LANA 2BQRA 4X4PA 4DV6F 1MMLA 2DHXA 4UF4A 6FDRA 2F4VJ 4JI4F 1V5IB 4O3NA 1KHWA 4OYAA 1HPZB 4ES1A 3GV7B 4QWEA 2AD9A 2DY9A 2HAIA 5SZTA 4WIIA 4OLPA 5L1KA 2VIHA 1HBMB 3DFEA 2KTQA 1UP1A 3L7OA 3TX8A 1V3ZA 4F8RA 2MTLA 4OJ1A 2IC3B 4PABA 1D9DA 1TAQA 4X64F 4YY3J 2EEYA 2H48B 2HS0A 5HANA 2CNKB 3UDEA 2K3KA 4J9QA 4BWMA 4CWBA 1Q8BA 2LXFA 1CG2A 1P9YA 4V1Ak 2OFHX 4A46A 2WBMA 3KFWX 2IAJB 1UEKA 4FF2A 3T3FA 1R8BA 4DSKA 4DLGA 3UCGA 4DG1A 5DGBA 5M2RA 2C3UA 3OBIA 2Z2LA 3AD9C 3ICLA 1TL1B 4ZPWR 3KXDA 1YIJS 4UQTA 3DHXA 2EK1A 3HKWA 1IKYB 1REGX 2QYCA 1FRKA 2V9KA 2U1AA 1XR5A 1Y0HA 3MMAA 4FNIA 4QWDA 1S9GB 3ZNUA 5FLXY 3OSNA 2C2ZB 2D3UA 4NCAA 5IM0B 3CDBA 1HWJA 1CS4B 4DV2J 3AD8C 4NLRA 5ETKA 4P71A 3IGNA 2MY7A 2HYIB 4HKQA 4KV8A 1W26A 5CCLA 5HVHA 4OX9F 3CF5Q 2YXLA 2VQFJ 1IBMJ 1IVZA 4CNYA 5KFAA 4ALZA 1YK9A 4QIWD 1KTQA 4K4SA 3VQSA 1ICEB 2MKJA 3LPEA 2BW7A 2MKYA 3PRVA 3KOAA 3JYTA 4M5IA 3Q0AA 2X1FA 1N34J 2JL9A 4QQBA 4O4GA 1UVKA 5BR8J 2ZDOA 3UD4P 1ELOA 3AY0A 1KSPA 2J5AA 4WYWA 3I96A 1RBOB 4DL2A 4OV6A 1S5ZA 2ZH6A 3MAAA 4C97A 3NRBA 5HBMB 1HD1A 3I32A 2FLLA 2PIIA 2Q6BA 5DRKA 4ICLB 2VFTA 3Q8QB 2DNQA 2HHUA 3L4BC 1Q16B 1SJ4P 2HBQB 1RBLA 1SI9A 3CDAA 1IQZA 5K14B 3QO9A 3PX0A 3LGNA 1BWEA 3SEOA 2ZH3A 2Y0SD 4ZP9A 2POKA 2C42A 2IVFB 4WK1A 1NSQA 3QQCD 1WC4A 2FQQB 4KY3A 3SBMA 1WKKA 1J5OB 5DQIA 3N01A 3KYLA 3HZEA 4EYIB 3BGFA 1S1VB 3DOKA 4LF1A 4FKYA 3H40A 3H0PA 5HO4A 2KB2A 1ITPA 3GFYA 3UN2A 2WONB 1KR4A 2F40A 4G1IA 3ZTPA 4I56A 1N36J 1VRUA 1F9FA 4TY8A 3G6ES 3EDQB 1M0SA 1C2PA 3MFHA 2PT0A 4ZLLA 3G8SA 2QYGA 3UDLA 5FDLA 5GMDA 3VTIA 5LJ5Y 1HQUB 5KT4A 3GMGA 5F8MA 5T41A 4JB8B 3K17A 2FC8A 3GE9A 3ZZTA 4MTPA 1NDPA 1NDCA 2DNKA 3CO9A 2L41A 5IV4A 3NGDA 4ECTA 3THTA 2YNHA 4W90B 1UA0A 1VMBA 4OYZA 2HZAA 3D3CJ 4YOEA 4FS1A 1OQ3A 1VI7A 1C1CA 2KM8C 2HGLA 2AF6A 2LVWA 2RKIB 2JFKA 3PFEA 1HNXJ 3L09A 2HNDA 1HR0F 1SL0A 3FCHA 3L7UA 1C4AA 1T9XA 4DV6J 2RD5C 3OFHA 4C3LA 2XMMA 2QL5B 2NYIA 3VR1A 4CLKA 3N79A 3IC1A 2ZKUA 1D0EA 1VQPS 4EMDA 2IA0A 1XIQA 3EYZA 1UEVA 1UJ4A 1NK8A 1S0OA 1CLFA 2E1CA 4RW4B 1S9EB 4X64J 4Y0FA 2ABYA 2KXHA 3DMJB 1NKCA 1DBDA 3HSZA 3F0NA 2HK3A 3QRRA 3D6HB 4DV0F 3A3NB 1UW4A 1VLYA 2QIFA 3PFOA 4DR4J 2MQOA 2R7TA 2FJXA 3JSRA 1SL1A 1VBKA 3GG0A 3V81B 1GQEA 3MWBA 2ZD1B 2VOOA 2B5JB 2XBPA 2YWHA 2UU9F 1H98A 1T9VA 3ENVA 3TAPA 5C5JA 2VB6A 2C2DA 2FVSA 2QEXS 1X0FA 5ETRA 1ZETA 1AXQA 1NDLA 2XMVA 3AOAA 2KN4A 3K57A 5K5MA 1S6QB 2M9KA 3PW7A 2IVMA 3CMAS 2NXCA 3QIPA 2XZDB 2V8HA 4XAKA 2FB0A 3MCNA 1B0PA 3GIMA 2VA2A 4USUA 2H9ZA 1YWXA 4IDKB 3D2WA 3JSMB 1RYRA 2JEFA 1OY6A 2OKQA 3KLFB 4OX9J 3R2DJ 2ZH1A 3Q8SB 1ZM3A 2BE9B 2AYBA 2AGOA 3LP0A 1SV5B 2MZRA 2EFVA 2HURA 1GH8A 2GHWA 2UV8A 4OYOA 4BHQA 4RW7A 4HLBA 3PIOQ 4DPYA 1GK8A 3I4PA 2G0CA 4W92B 4YR2A 4HHHA 3T1HF 1GFWB 1RWNB 2HLUA 2HHWA 1HPZA 3TEGA 3AAWB 1HNWJ 1NCLA 1QE1B 1T05B 2ACMA 3JAMY 2UUBJ 4NRTA 3UCUP 3D9BA 1I5OB 4CO0A 1Z1ZA 4U8YA 3KTQA 4RW9B 4EEYA 5F41A 3I0RB 2K1RA 5A8RB 2E5IA 1HBMA 4DQPA 2PFDA 3TQ1A 1PAUB 3FRZA 2HVZA 4A8OA 4NLDA 3H2UB 4DN9A 3FCWA 1KS2A 3MEDA 1F60B 1QUVA 2NXNA 3SFGA 2KO1A 2IAJA 3IRXA 3D0GE 4F4YA 2DXFA 1D3WA 2RJZA 3OT9A 1VQSA 4M1KA 2E5GA 4B02A 2B7BB 3RGIA 1IBCB 3NS7B 1IWAA 3LP1B 5EX3A 3SXLA 4A8SA 3H5UA 3HLUA 3SCKE 2HSEB 2B9WA 1RU1A 3IO1A 3EZUA 4KYZA 1YX2A 2EI5A 3SQOP 1FJGJ 3KJVA 2QFIA 2AU0A 4RNHA 5IM0A 1RT5B 2B56A 2FIUA 4EK2A 5KFEA 2OJ3A 4YEAA 3NNCA 4JI8J 1H38A 2OSRA 4OZLA 3CCMS 1Y9OA 1RHRB 2R8JA 1U1RA 2CADA 5AXMA 2MEWA 3KG0A 1S1WB 3HFVA 3H2VE 5A6WA 3W9JA 4MKYA 2BRKA 2IDEA 3FQLA 2NSCA 4CH1A 1S1UB 4LVOP 3D54A 4B17A 1TUWA 2MZSA 3GV5B 1TVRB 4IRKA 4ELVA 4ERDA 3ZNJ1 2CQGA 5LMNF 1FHTA 2X51A 2NQPA 3GFXA 2R8KA 2IM2A 4LFBJ 4LBIA 1FESA 1Q82T 3MM9B 2XS2A 1HR0J 2ROPA 1YGYA 3W2VA 4ED4A 1RA6A 3RZAA 2H4WB 4NA3A 1WC3A 2E5LF 2C2NA 3M4XA 5H9EJ 1F5BA 1FKOB 2E1AA 2WVFA 2JX2A 5HBMA 3LPYA 3NL0A 4Y28C 1SQFA 4B3TF 4GMKA 3B4MA 2H5JB 3Q8RB 4ICLA 1ZTWA 2EC0A 3ILLA 1U45A 3MGJA 1TKXB 4ZVFA 4JV1A 4FYDA 2AJ2A 1FRHA 2HVHA 2DITA 3DXSX 1XBWA 2ZBIA 4EBDA 3EM1A 3OTOF 5ADZA 4C7QA 4K59A 1EIYB 1VQMS 3B8HA 2B6AA 4KGXB 4ED8A 2LEBA 3FEXB 1JLBB 5K8OA 4DV0J 5KFDA 2FVRA 4QBUA 4PG6A 5KFWA 4F4WA 1K73T 3J81U 4UT4A 3VCDA 3GSDA 1FT8A 4UOHA 4ZVSB 3BO2A 3KG1A 2ROEA 2L9WA 2ZHAA 2WONA 1WF0A 2MGZB 2MJNA 4YMEA 4DUYF 1B64A 4WFXA 2FHMA 2HQIA 1V6HA 5B7WA 3PW5A 2QLJB 1N5VA 4OZ2A 3TAQA 2QV6A 2QX0A 4WTYA 4OZ3A 1O0PA 3QBCA 4KJIA 1NZ8A 3QRPA 2W4CA 2CG4A 5F8JA 1D9AA 3TI0A 2Z30B 4WIQA 4H54A 2M4MA 2HAFA 2O66A 1Q8LA 3KLGB 3ISND 3NOGA 2MXYA 2X7IA 2DCUB 1NPRA 2LDYA 4L3NA 4M5DB 2V6AA 2VFUA 1T02A 3R9LA 4OZ5A 3ZTOA 1QVGR 3FRYA 4OX7A 4EBCA 3GFHA 3ADAC 5DLFA 3VGUA 5HMXA 2FPHX 3CCQS 1FFGB 4OYIA 4HHUA 1HBOB 1REVB 2J7UA 4DWIA 4JI3F 1SC3B 5ETPA 1XQIA 1CJUB 2H1YA 2ILZA 2A18A 4Y00A 1XMQF 3R1LA 1FXLA 3U1MA 2FD2A 3HHDA 3HSGA 4EWTA 3IS9A 4PRFA 4E8UA 3A12A 4IH6A 2XS5A 3WDOA 5K8MA 1LWCB 1MNEA 1E6YB 5A8KB 3A8EA 5F0UA 3RBDA 2XS7A 1U8SA 2NYHA 2MQLA 4NASA 3E51A 3P5BP 1U1MA 4JV2A 1RAJA 3OJSA 4FS2A 1UVNA 3CCLS 2E7VA 2VDIA 1RQ0A 2VODA 2XMAA 1S6PB 3S6EA 4IKAA 3BGOP 3MR6A 3V81A 3K5PA 5D4OA 1IKXB 3LALA 5KG0A 4FF3A 1GTHA 2Y1LB 1JWWA 1U1NA 3PEJA 1SQGA 3W66A 2WAQD 1WSVA 2KHCA 4K2XA 2AGPA 2ILYA 3UN3A 4A8XA 4B9NA 3AODA 1NK7A 1YSJA 2VBWA 5C25B 1OSCA 1WOPA 2KT3A 2I38A 1JLFB 3V2UC 4F25A 2QZ8A 1OYDA 4Y2AA 4ER8A 3CCRS 1KN6A 1PCAA 8AT1B 4DV3F 1KOHA 1RUSA 5LSOA 1KLNA 3DRSB 3JSMA 1HNZF 3FK4A 4DV5F 1OPZA 2DH8A 3JQKA 4P2SA 5C24B 1TL5A 3KLFA 4EZ6A 4KGZB 1GMUA 2M70A 2D9PA 4HTIA 1TUGB 2JJ4D 3W60A 1SL2A 3IWLA 1N0UA 4N47A 4Y2MA 1NKBA 1SV5A 2CQ4A 2OPQB 1Q78A 1RT1B 4U7CA 1U1OA 1CJTB 4WYLA 2CPIA 4F3OA 5EUHA 2JFDA 2KJVA 2Z8QA 3PYEA 1UFKA 4TYBA 4QYZK 2B3TB 3QT7A 3GR1A 3CE8A 3VGSA 3MF5A 2E5LJ 2I6WA 7FDRA 2XG8A 2LU1A 3EICA 5L38A 4ED5A 2VG6B 1RTZA 3ZO7A 4B3TJ 3DU6A 1FFSB 1VDHA 1HW8A 1RT7B 3W2WB 4IQXA 3G96A 3BSCA 5DGAA 1PC4A 2YH0A 3H98A 2XTJP 4ILRA 2A10A 3LTOA 3QFWA 3NLCA 3VAIA 4EZ9A 2ZZTA 2H5EA 4DV7F 2VPXB 3OTOJ 2VG7A 1PJ7A 3F56A 1DFDA 2IRUA 3ZZPA 2ZBQA 4AQYJ 3M8QB 5HSPA 3OLBA 1YQHA 2DNGA 4HYKA 4CH0S 3SSSA 1FE4A 4P2XA 3R5AA 3P6YC 4NEZA 2PDAA 2XMUA 2LMIA 5D78A 5AXLA 1WKJA 2WVEA 3FUYA 1RSCA 4YDDB 4DCOB 1U1KA 3R7NB 3W8GA 1AA1B 4UUWA 1S12A 4DX6A 5D3GB 1HBUB 4DL6A 1BQNA 4DUYJ 1U0HA 1M1HA 1FWLA 4KH1B 1VQ4S 2ACYA 3HVWA 4BDPA 4ILMA 2BJEA 2RQKA 5J2PA 1LW2B 1VBYA 2DBBA 4FZVA 4CYUB 2WHOA 2PO4A 2E9ZA 2HHSA 4J9MA 3OV7A 1DHMA 4UZCA 1NK4A 3NWRA 2AMCB 2GGPB 5KG6A 4B3MJ 3I5AA 3GIKA 7AT1B 1PJ6A 1AW0A 1TVRA 2Z56B 4NCBA 1IQTA 4FYVB 1RYSA 1GXTA 4FNHA 2BYCA 4JV5F 1NBEB 1U7LA 5I42B 5LSRA 1TP7A 3J81Y 2UVWA 4RNNA 1K44A 3MM9A 1SUQB 1YRXA 1NJXA 4ZVOB 1T3OA 4RWWA 4R8UB 2A0FB 1DRZA 2QN6B 4MYTA 4NLWA 4DR3F 4ANDA 4DU7A 5HVFA 2MQ8A 2OTLS 2XCPA 4C3KA 2XZTB 3UDCA 3H20A 1NUEA 2YY3A 2DKOB 2JSXA 2Z58B 4DSLA 4EU0A 4JI3J 2GAGC 3W63A 1VRQC 5E2QA 2DT9A 2HWTA 1K1SA 3NKYA 2MLZA 2UUWA 2GVZA 1TU0B 2DISA 2DGXA 3CJTA 3Q83A 1U8WA 2WSEC 2GZOA 1XTZA 2W2MP 2EW9A 3GWCA 3BN7A 2QLWA 3P96A 3R3TA 1YJ9S 4LFCF 2B9EA 4HDGA 3SIPB 2V67A 2FZCB 3HCXA 4PG8A 2XNRA 4GVBB 4B3OB 1S6UA 4KRWA 2W1BA 5B0AA 1FWKA 2QGFB 4AD6A 2UXDJ 4ZCIA 1RTJB 2BMBA 4Q8EA 3IRWP 4QR1A 2B43A 4DR5F 2OI2A 2ROGA 3T5LA 3BH7B 3MMCB 3BR9A 4OYPA 4ETXA 3MXHP 3VALA 3A8KA 4JI0F 4LSZB 2V4RA 2BABA 4OX6A 5E3QA 7FD1A 2RU3A 3UNGC 2YNIA 3T6BA 1OMSA 1KC8T 2YWEA 1NK9A 4OV1A 4B9SA 4A8WA 1RBAA 1I51B 2DVIA 1LOUA 2F8EX 1JX4A 3I9V9 2HWIA 4OHVA 5CYMA 2W25A 4DV5J 1FXRA 2MLYA 2OD4A 2FYXA 4LRDA 3C6UA 4HI2A 1Q7LB 2HFUA 1X4DA 4ZJQA 4KTQA 5KFCA 3CCVS 4CDIA 2V2KA 3VAGA 1QLNA 1IJEB 2GIFA 3CMES 2LQ5A 1WHYA 4KC5A 1FRIA 3IN5A 4J9NA 2CG8A 1RCXB 2GO8A 2HNYB 1QAYA 3QATA 5CYQA 1WNEA 3ZFVA 3BH6B 3TUIC 1U2CA 1VC0A 5J1PA 4RR5A 4NMXA 4GVLA 1HBOA 2R3VA 2YKQA 1GX5A 1HNVB 3RB3A 4LFAF 1ZAXA 1VHIA 3UWTA 3PEHA 1DLOA 5EX0A 5GADI 4C8LA 4H4KA 4QJVA 4CLYA 3Q89A 1N6QB 1WORA 3BJYA 2F4FA 3RBXA 2OGUA 5KT6A 1NSKL 5G0RA 1HI8A 1S4EA 3THPA 1E6YA 4FVMA 1XNRJ 2R7QA 2HIQA 2CNLB 4GO5X 3AQOA 2XEXA 4LR8A 5A76A 4BC9A 2A6MA 5IT9Y 1IR2A 3IWXA 1RI7A 4DDFA 2GQ2A 4BBYA 3IFEA 3UVJA 3W5YA 2GV1A 2QL9B 3OVAA 2WVDA 1MN7A 2UUCF 1KQSR 3M30A 2X1AA 4M94A 3E3XA 1JXVA 2E44A 2J9DA 2VH7A 5FJ4A 4M5MA 4WP3A 2MPUA 2FTRA 2DRAA 1F6TA 4QPXA 4DL3A 1TV6B 1YKWA 2RNEA 4WZMA 2FVCA 2HHQA 1JLCA 5HQMA 2KYZA 5GVQA 4ZLJA 4ZA1A 5C25A 4JI6F 1WTFA 1VQNS 3CULA 3M8WA 4FVCA 2VG5A 2H4YB 4CLLA 1JIHA 4J9PA 1RAFB 3OR1A 2XGPA 1MMNA 3OL7A 1O5JA 1JLQB 1I94F 3NWGA 3T9ZA 1I3OB 3LW5C 4LREA 1KFDA 1U02A 2HFSA 2H51B 2OPQA 2V2ZA 4PPZA 2QMWA 2IIHA 4Z37A 4AXIA 2R2SA 3AB2B 4LRCA 4ATNA 4F3QA 1IM4A 1H2VZ 3DRYA 3KJNB 2D41A 4UOGA 4CO3A 4CO1A 4DU8A 4YUDA 4FP9A 4C8YA 4CLSA 1KDNA 5KG1A 4XIUA 1RP5A 4LSNA 1YITS 4DR3J 1R0AA 5H9FJ 3G6XA 3MD1A 4I2PB 2FJWA 3O1LA 3J7Z5 1KVKA 4ZJLA 4ZCKA 3TRGA 2VHGA 2W9CA 1RT7A 2Z57B 2U2FA 3FVYA 3CJRA 3TUJC 2V8VA 2UV8G 4JP8A 2NREA 3HKZD 4NLPA 5LSLA 5DG8A 4LFCJ 3DOLA 5K8NA 5CZXA 3MM5B 1TR0A 1TMJA 4M5NA 5F8HA 3HHEA 3GTYX 3M8QA 3HHKA 3WIVA 2CPHA 1YJVA 1FERA 3JTPA 4M95A 4ECXA 3CXCR 4OX8A 3KJFB 5C7PA 2E5JA 1SIWB 5LOQA 2W24A 2K8GA 1BWVA 4OYMA 3R7BB 3KUGA 3J80U 1HBUA 3RG6A 3KHHA 1GX6A 4ZCMA 2N7CA 4DR5J 1S72S 2CQ2A 2JLEA 3OL6A 3MMJA 4PWUA 4F26A 2NZ4A 3PY8A 3AOCA 3IAS9 4RW6B 2XWXA 1NHVA 2WOMB 2N3OA 4PWWA 1PYTA 3MR5A 2ZBRA 4AL6A 1BGXT 1PAEX 3QT5A 4DHVA 3ITHB 2OSQA 4AT1B 3NNHA 4TNOA 1VQ8S 2BXJA 4NLTA 2AGQA 5IXUA 2BEFA 4A8YA 1E6VA 5ETQA 1S59A 3A3PB 3MUVP 3DLKB 2ZH8A 4DX7A 2VONA 3J7A1 1ZH5A 3OHBA 3A1YG 3MOZA 3TOQA 2BQ3A 1C0TA 3KHLA 2KM8B 3I5CA 4R8UA 1MN9A 3C14B 3KLHA 3MEEB 1DARA 1S99A 2GVDB 1T3NA 3MDFA 3SMZA 2IRYA 4DR6F 4CLWA 3NOCA 3N0VA 4Q2LA 4URGA 4AE5A 2QA4G 4JYAJ 1ZM9A 4LFAJ 2DB1A 3DRXA 1RAGB 2APOA 1H7WA 2WRMA 1BHNA 1XMOF 3EGVA 5A6PA 5I3UA 3V6KA 1T11A 3IWNC 2MKSA 3CJ3A 3KJQB 4W98A 3SCJE 4ZJOA 2ZH7A 4ECVA 2ZE2B 2EFOA 5A0YA 4QIGA 5A2QY 5IOLA 4JOUA 2B4VA 4WE1B 2EG2A 2KDOA 3RAXA 2BOPA 3CJQA 1DTTA 2KU7A 3DI6A 3M8PB 3I6PA 2BJ1A 1YZ6A 3EUNA 2N4CA 3EXCX 2CQBA 2DRBA 1RT6B 4GKKF 2J6SA 2LECA 1H2UX 3G87A 2B9YA 4HEA9 1QAXA 3GFZA 4JI2F 4K2JA 3Q22A 3KMQA 1RTJA 3CB4A 4USKA 4Z7CA 2HQCA 4OI4A 3G8TA 3MMCA 3IP0A 4NI2A 5GMKa 1GAOA 3GPAA 4JI1F 4ZPVR 2J8SA 2OMOA 1F3VA 4Y2KA 2XY7A 1HMVB 4K4XA 1AZSA 5ITHA 5U47A 3JQJA 1UL3A 4NX9A 1B7YB 1Y10A 2LDIA 2FY1A 1TKZB 1FE0A 4C8MA 4QW9A 4P75A 2NSBA 2W7PA 2GO9A 3WX4A 1WHWA 1NEEA 4DUZF 3C8YA 2VL1A 3UNYA 4CCHA 5D4NA 5GAEU 3QGGA 2IJFA 2K2PA 1CULA 3AOBA 3I55S 1U1PA 4PWDB 1URRA 1VBXA 4D3GA 3QRQA 1HNIA 4FN5A 3PV8A 5HN0A 4P74A 2N82B 4Q43A 1N6QA 2CJKA 2QTWA 2UZAA 1J5EJ 3WQPA 1NH7A 2IDLA 4YP3A 2CQ0A 1S1TB 1W2IA 1HA1A 2J7WA 4EO8A 4F04B 1S1XB 4DG1B 2VBZA 2UUAF 2JNJA 2BM0A 1JKHA 2CZ9A 2ZNZA 1S0NA 3HJVA 4DCJB 3MEKA 3TUPA 4P52A 1ZAVA 5H1SV 1Q7YT 2XY5A 5KT5A 1AROP 2DNMA 4ZP8A 1Y7PA 3MMAB 2XO6A 1IM6A 1RHKB 3OXFA 3CIMA 4NZ7A 1TV6A 1R8HA 2VFRA 2KZZA 4KH0B 2V5HG 3CDWA 1S9FA 4XDCA 4R5PA 2ZJRQ 4D3HA 2HFOA 4EFAC 1NK6A 4K4ZA 2NS1B 2P5VA 1F2HA 1JJCB 5GAGU 1ZAWA 4NLQA 2QMUB 1N5YA 2RMLA 2NUHA 4I6YA 2AYMA 3KKFA 2J0SD 2OPRB 2RS2A 3HO1A 3MOJB 1GMVA 1RAOA 2QA1A 1JLQA 1QTNB 1U6BA 3OUYA 2PD1A 1LW0A 1PILA
chains in the Genus database with same CATH topology
1R8CA 4JBCA 2EI5A 3VQTA 3O5TB 1OWXA 2KT5A 1XMBA 3KJVA 2CRLA 2JEIA 2MKKA 1B0VA 2JH3A 4CO5A 3GR0A 2AU0A 2QFJA 2O3DA 4OI3A 4O44A 1FD2A 4RNHA 4ZK7M 1S49A 5AE2A 4DPOA 3VAFA 1LWFA 5IM0A 1M5SA 1RT5B 5DM6Q 1HBNB 2PMHA 4OIXA 3S1TA 3G9CA 2VG6A 2B56A 2FIUA 3OFGA 3Q23A 5KFEA 2EFGA 3G4SS 2M8HA 4FXVA 3EGNA 2RQMA 1M5KC 2OJ3A 1WEZA 4YEAA 3BN4A 5E5NA 1T95A 4CO2A 4YR3A 2OPSB 3DOLB 3NNCA 3W2WA 1H38A 4MMOA 2OSRA 2Z0GA 4RLEA 2PN6A 2UP1A 2NLWA 4OZLA 3QGIA 4MAKA 3CCMS 1Y9OA 1U2RA 4ZP7A 2FLPA 2DPJA 3RB6A 5KFUA 4EYHB 4YB1P 1TK8A 2R8JA 3BQ2A 2FJVA 4C8OA 5FIIA 2K3IA 1U1RA 3GILA 3QPIA 5EWGA 4ZP6A 5HLFA 5AXMA 4ED3A 3MM8B 4RBTA 4QWAA 4WF9Q 5BJRA 5MLCV 3KG0A 4KBIA 4AXJA 2N4DA 2J7KA 1S1WB 3H2VE 2HNZB 3V6JA 5L8RC 5B0CA 5A6WA 1NJZA 1N5TA 2L3MA 2JLFA 4IUFA 1APSA 4MKYA 2BRKA 3FQLA 2GFFA 2FLOA 2NSCA 3MPVA 3QWUA 4OZ0A 4WFYA 4CH1A 3J80Y 3M2UB 1S1UB 4LVOP 4C9DA 3M6XA 4FXWA 4J9RA 4OZ1A 3M2VA 4I2PA 1FVQA 2GJIA 3QO9B 3D54A 2J8AA 4B17A 2IHR1 2MZSA 3GV5B 1J2VA 3HVTA 3MM6B 1TVRB 4IRKA 5E3CA 1RTDB 2NXUA 2QRRA 3J7YU 4ELVA 3E2EA 4ERDA 1FJ7A 3IGVA 1FDDA 2CQGA 5LMNF 1RISA 1FHTA 1WF2A 2X51A 2NQPA 1AFJA 3GFXA 3RRKA 3OLAA 2R8KA 4ZVEA 2IM2A 3BSAA 5MAOA 4WFNQ 4O4RA 3HPOA 3PKMA 1FESA 2KJWA 1F5CA 1JJ2R 1Q82T 1IBKF 3MM9B 2VOPA 4LUBA 1X5OA 1W25A 4MIWA 4G1QA 1DURA 2XNQA 3KLIB 4PXEA 3LWLA 1RT4A 3X3UA 3T5KA 2XS2A 2JRSA 4OFZA 1T94A 3E01A 3HHLB 4I4BA 4ECRA 2DIUA 3PVXA 3V5RA 1GXLA 1YGYA 2ROPA 5D3GA 1ZM2A 3L7PA 1RA6A 2XI2A 3W2VA 4N56A 4O3RA 2J76E 3DOKB 1R8AA 1VQ7S 2DGWA 2B9XA 4NCGB 5J1NA 3RZAA 2WCXA 2XLKA 4NA3A 2B4UA 1DTQB 1FKPB 2LEPA 4DV4F 4FF1A 2E5LF 1U24A 4WFZA 1MMDA 1U6FA 3M4XA 4I6AA 5H9EJ 4GO7X 1F5BA 1SKRA 3MM5A 1FKOB 3QAEA 4OHXA 1RTHB 2CQDA 1LW2A 2E1AA 2V8DA 1E6VB 2JX2A 5HBMA 3LPYA 3TA2A 4QR2A 4OI2A 4K5SA 1VQ9S 4ZKAA 4Y28C 3NL0A 4OHWA 4B3TF 4GMKA 2YQ3A 2BJDA 3B4MA 2FVQA 3J7ZT 4LF8F 3Q8RB 1N5QA 4ICLA