4O44B

Crystal structure of hiv-1 reverse transcriptase in complex with 4-((4-(mesitylamino)-6-(3-morpholinopropoxy)-1,3,5-triazin-2-yl)amino)benzonitrile (jlj529), a non-nucleoside inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A mechanistic and structural investigation of modified derivatives of the diaryltriazine class of NNRTIs targeting HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 99
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4o44B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44B03
4RW8A 4ED8A 5F8JA 3KLFA 2FVQA 3KLIB 2ALZA 1REVB 2JC1A 3DOKA 4J9KA 3KLEB 4MIBA 3LP2A 4KKOB 3DOKB 5KG4A 2R8GA 1C1CB 4Q0BB 3I0RA 1OS5A 3N6NA 3OL7A 3GV7B 2FLLA 4ECWA 3CJ2A 2YNGA 5C25B 1XR6A 1IKXA 4K4UA 2IM0A 4EEYA 1LWEB 3OSPA 4DG1B 5D3GB 1RTDB 3V4IA 3LANA 1HPZB 2HNYA 1RT3A 5CYQB 4IRCA 3C6UB 1JLBB 3T19A 2OPQA 1HYSB 4WE1A 2HMIA 4RNMA 3SFUA 4LSNA 2D3ZA 3DLEA 1D0EA 2YKNA 2FJXA 3NGDA 5HBMA 4Y2AA 4Q44A 4DEZA 3BGRA 3DRPA 4WYWA 4R8UB 1C0UA 4J9MA 5HBMB 4NLOA 5F8NA 1HQUA 2IM2A 4I2QA 1HNIB 1TKXA 3IN5A 3EPGA 4RW7A 4WXWA 1JLBA 1HYSA 4DL4A 4JV1A 1RT3B 3MECA 5CYQA 4JV2A 3V4IB 5F8HA 2ATLA 1RTDA 4NLSA 3JYTB 4G1QB 2OPRA 3HVWA 2IM3A 4H4OA 4O3OA 3BQ2A 4LQ3A 3N6MA 4RNFA 4EYHB 4RW4B 5J2MA 1HMVB 4RW6B 1KLMA 2WOMA 2UUTA 4ZPBA 2DPIA 1S9GA 3DM2A 1BQNA 5KFPA 2IC3A 2IC3B 3QLHB 3QLHA 3H5UA 4RW8B 2BQRA 5DQIA 4NLDA 5JXSA 2IAJB 1RT4A 1S1TB 4IRKA 4J9QA 3KHRA 4NLGA 1K1QA 1S6PB 4WZQA 2HNZA 3IGVA 4ZHRA 4ZP7A 3PW0A 3BQ1A 3CVKA 3TAMB 2C28A 3CJ3A 1SV5A 1TKTB 5KFKA 4MFBB 2V4RA 2E9RX 1IKWA 3MECB 3CDEA 4MKAA 4KO0A 4ZP9A 1LWCB 3QIPA 3CO9A 5KFIA 2RKIB 4IOBA 1QAJA 5KT7A 3PVXA 1RYSA 4ED2A 1FKOB 3T5LA 5HLFA 1RTJA 3DYAB 4ECTA 3DRSB 4Q43A 4ZVHA 2YKNB 2C22A 4ED1A 3MFHA 2BE2A 1S4FA 4WZMA 5K14B 1RT5B 2FLPA 3JSMA 4DG1A 5D3GA 3QIDA 1S6QA 1S9EB 1JKHA 3M8PA 3Q8SB 1S1TA 4ECUA 3BREA 4GC6A 3GV8B 1S1XA 3LAMA 4ECSA 5KT6A 4ECVA 3M9MB 3KK2A 1C1CA 4Q0BA 3FFIB 1JLAB 2JC0A 3PW7A 5C42A 1KLMB 4IH5A 2FVRA 3T5KA 4YMEA 4RW4A 5CYMA 1RT7B 2C2RA 1MU2B 1RA6A 2O5DA 2IM1A 1J5OB 2AX1A 4NLYA 4QWBA 3RB3A 4MH8A 4G1QA 4K4VA 1S48A 4NYZA 4H54A 3KNAA 2ZE2B 4ECYA 3DMJB 2YNFB 2VA3A 5L9XA 2RF2B 2BRLA 5KFVA 1HNIA 1JLFB 2BQ3A 1HQUB 3V81A 4TYBA 1RT7A 5L1LA 4M94A 5C42B 4LSLA 4KV8B 3H5YA 4ID5B 5DQHA 5KT4A 3FRZA 3LP1A 5KG2A 1NHUA 3PR5B 1RA7A 1RTHA 1EP4B 4WE1B 2HMIB 3SFGA 3C6UA 4K4SA 2B5JA 3E01B 4J9LA 2HNYB 1RTIB 3BSAA 1JKHB 2IMWP 3LP0B 3BSNA 3MR5A 4NLTA 5EDWA 1VRUB 2BANB 3DI6A 3LP0A 3V6DB 1S97A 2J6SA 2R8HA 4Y34A 4ECQA 1IKXB 1LW2A 3H4DA 3UDLA 3BR9A 2E9ZA 4RNOA 1DTQB 5F9NA 2ASDA 4Y2CA 2W9CA 1JLGB 1FKOA 3DRRA 2JEIA 3IRXB 4R0EA 5KFOA 2QE5A 3UPFA 1JLFA 4EBEA 3OLBA 3KHLA 2ZE2A 4NLQA 4EBCA 3BJYA 1TL1A 2XWYA 1T94A 5FDLB 1N5YA 4NRUA 4U6PA 2DPJA 2BR0A 2YKMA 5KFDA 2XI2A 4HYKA 4H4MA 5KG1A 5DLGA 5KFJA 4KSEB 3T5HA 3ITHB 1JLQB 4K4TA 1TP7A 1HNVA 3ISND 1MU2A 4URQU 4K4ZA 2YNHA 3CJ5A 1C2PA 2I5JB 1LW0A 1RT6B 3GV5B 1SUQA 4RU9A 3C6TA 5KFWA 2C2DA 4U7CA 3FFIA 3MFIA 1N6QB 2AWZA 3H5SA 5EWEA 3KK3A 1JLCB 4GC7A 4I2PA 2OPPA 4PWDA 3RBDA 3PJWA 1S0MA 2UVVA 4DL3A 3DLKA 4YQWA 3H40A 3GIMA 3IG1B 3KJVA 5J2MB 3I0SB 1S6QB 1JLEA 3M8PB 4ZPDA 1RYRA 5T14A 4O4GA 1QE1A 4KE5A 4Y3CA 2W8KA 4J9OA 1TL3A 1TL3B 1RT1A 4B3OA 4B3OB 5F8IA 2B6AB 2BQUA 1IKYB 1SH3A 3ICLA 1C0TB 3VQSA 5KT5A 2HNDA 2R2RA 5DG7A 1FK9B 1DLOA 1TKZA 3RB4A 4F4YA 2R2SA 3IGNA 4Q45A 1MMLA 4YR2A 2JLEA 4ZVGA 1S0OA 3KK1B 3OSNA 4KHMA 2V4QA 1LWCA 2QV6A 4FS1A 4DL6A 3HVTB 3DLGA 1IKWB 4WXOA 5I3UB 4F4ZA 4IG0A 3H59A 3BSCA 3PHEA 1KHWA 5KFBA 2YNIB 2V9WA 2GIQA 3M9OB 4O3PA 4IDKB 1IKVA 2YKMB 2XI3A 4ZVEA 3RBEA 1ZTTA 5KFTA 1LWEA 4KAIA 1TL1B 1QAIA 5KFCA 2WHOA 5F8MA 2UVWA 4Q8EA 3SI8A 4NCGA 2VG6B 2YNGB 2FVCA 1XR5A 3RB6A 2R2UA 3DRRB 4I7FA 4IR9A 2UUWA 2W9CB 4IG3A 2HNDB 4ZVFA 1EETB 1LWFB 5HROB 4PQUA 1HARA 3KLIA 4TQSA 2AQ4A 3KLGA 4O3SA 3QZ8A 3DOLA 2HAIA 2OPRB 4ICLB 3QO9A 3CDUA 5KFAA 5KFSA 3PW4A 3KLHA 2JEFA 4K4WA 2V0NA 1Z4UA 3KJVB 3MEDB 1TQLA 1EP4A 4WFXA 3KHGA 4NZ0A 1I6JA 3GIJA 4IFVA 1JX4A 3LP1B 1TVRB 1RAJA 4KHRA 2WB4A 5L1JA 3C6TB 4ED3A 4R8UA 1SUQB 3Q8RB 4EO6A 3OHAA 4EBDA 1ZETA 5KFYA 4LSNB 1NHVA 4ED6A 3Q8PB 3Q8QB 2WRMA 3MEDA 1TV6A 3OL6A 2CJQA 1S1UB 1S1WB 3MEEB 2FVPA 2VG7B 1N56A 3V6KA 4NLWA 1HQEB 2WONB 4R5PB 3NBPA 4J9RA 5C24B 1IM4A 3QGGA 3GQCA 3IS9A 3RAXA 3I0RB 3KMQA 1EETA 4PQUB 3ISNC 5EUHA 2VA2A 2XGPA 3LP2B 4KKOA 1GX6A 5J2PA 1JLAA 2HWIA 2GC8A 4K4YA 2J6UA 3LAKA 2ILYA 5HP1A 1NNDA 1BQMB 4XPCA 4MK7A 4O3NA 2AX0A 1UWBB 3CJ0A 4JV0A 3V6JA 2UVRA 3NBPB 1XR7A 4NLVA 2D7SA 5KG5A 1HQEA 4TN2A 5KG3A 4RW9A 2W9BA 5KT3A 2FJVA 3GILA 1IKVB 1S1VA 4QWAA 1RTIA 4NLXA 2C2EA 2B5JB 2YNIA 3CDWA 3GIKA 2BE2B 1FKPA 4J9NA 1D1UA 3FQKA 3MR3A 5I42A 4QW8A 4IRDA 3DLGB 4KV8A 4XO0A 4DL2A 4NLPA 4QWCA 3KK1A 1T03B 2RKIA 5KFQA 3OHBA 4XPEA 3DMJA 4TXSA 1RT2B 1FK9A 2WTFA 1C0TA 2I1RA 4ZPCA 3QYYA 5J1EA 2AGOA 1FKPB 2B6AA 2OH2A 3KLHB 4QWDA 3QO9B 4ICLA 3TAMA 3I5CA 4NLRA 5KG0A 4ZHRB 5DGAA 4OL8A 4FBTA 1QE1B 1QUVA 3MR2A 5CYMB 3I0SA 5J2QB 5KT2A 2JEGA 1RT4B 4IG3B 4J9PA 5KFLA 3I5BA 3HHKA 4I7FB 1UWBA 3H4BA 3H5XA 2XCAA 3G6YA 5KFGA 1VRTA 2VG5B 4KFBB 2BRKA 1SH2A 1S10A 1S1XB 5J2PB 2FLNA 2UVUA 3TVKA 4F50A 4K4XA 1YVFA 2IJNA 3UQSA 4WYLA 4G3IA 1T05B 1RT5A 4QWEA 1JLQA 5K14A 4KBIA 3NKYA 3ITHA 3G6XA 3EZUA 2WONA 4H4MB 4R5PA 2R2TA 5F9LA 3G6VA 2VG7A 3JYTA 3PW5A 1S0NA 1S1WA 1S1UA 3MEEA 4FS2A 1R0AA 3MEGB 2RDIA 1RTJB 3DYAA 5HLFB 4QPXA 3UR0A 3IRXA 4PUOB 1TKZB 1C0UB 3PJXA 1DLOB 4K50A 3BGRB 3DRPB 4ZMMA 2FJWA 3T5JA 5I42B 4QW9A 1C1BB 4MFBA 5KFEA 4IH7A 1SV5B 1TKTA 2IA6A 2ZKUA 1HPZA 1S9FA 1S1VB 3MF5A 2WCXA 5KFNA 4RW9B 2W9BB 3KHHA 4ZP8A 3E01A 4WFZA 3DLKB 2IAJA 3DOLB 5C5JA 2OPSB 2IJFA 2OPPB 4PWDB 5C25A 3QGHA 4TY8B 5KFXA 2ASLA 3KLGB 5HP1B 5DG9A 2R8IA 5L1KA 4ID5A 2W9AA 3QGIA 1S9GB 5EWFA 4LSLB 3H2LA 2W7PA 2WOMB 3RB0A 1RT6A 1REVA 2WK4A 3KLFB 4O44B 2VG6A 1HNVB 3T1AA 4MK9A 4F4XA 5F8GA 4F4WA 1N4LA 3MEGA 4IR1A 3M8QB 1T3NA 4IFYA 4IFYB 3E51A 3DDKA 5DQGA 2XCPA 3M8QA 4IDKA 1TV6B 3MTKA 3MR6A 5EWGA 3CJ4A 3NAIA 4O4RA 3EPIA 2XC9A 1TKXB 3OL8A 1T05A 4O44A 4I2QB 1RDRA 5I3UA 3NL0A 1JLGA 4RUCA 3HVTA 2ZD1A 4ED7A 3RAQA 5DG8A 4KFBA 4IH6A 1TVRA 3DLEB 1VRTB 2VG5A 4RZRA 3FSIA 2ILZA 4Q8FA 4TY8A 4IQXA 5F8LA 2OPSA 1LW2B 1ZTWA 4YR0A 2XGQA 5DLFA 5KG6A 4TY9A 3PZPA 1JXLA 2CKWA 3G86A 3NAHA 2R8JA 2FVSA 3FQLA 3JSMB 2B43A 4ED0A 3LALA 4TYAA 5J2NB 5KFMA 4O4GB 1C1BA 5HROA 1LWFA 4YR3A 4ECZA 3KMSA 1RT2A 1S49A 3KLEA 4J9SA 3N6LA 2AGQA 1JLCA 3KK3B 4PUOA 3V81B 1DTTB 4URSA 4ZPAA 1N6QA 4NCGB 2RF2A 3CIZA 2AGPA 4JUZA 4EYIB 1R0AB 1W25A 2I5JA 3KOAA 1GX5A 3M9NB 2YNHB 4HKQA 1N48A 4O3RA 1CSJA 1J5OA 1WNEA 2RDJA 1K1SA 1U09A 3QZ7A 3NMAA 3TQ1A 1JIHA 1S6PA 4RNHA 4IG0B 4IKAA 5FDLA 1N5YB 2R8KA 4KB7A 4NLUA 3BQ0A 3V6HA 4FBUA 3OLAA 1SH0A 4DL7A 3KK2B 1BQMA 1DTTA 2EC0A 3FDSA 3HVAA 1KHVA 1BQNB 3DM2B 4ECXA 1HMVA 4RW6A 1S9EA 5J2QA 1DTQA 5KFHA 4TQRA 4ECRA 3D5MA 3IS9B 1IKYA 2F8EX 5KFUA 5J2NA 5C24A 4H4OB 1RT1B 4YP3A 3H98A 4RUAA 2BANA 1VRUA 3DI6B 3V6DA 5J1EB 3D28A 5KFRA 4URGA 1JLEB 2W8LA 2D3UA 4DL5A 5JUMA 3IG1A 2AU0A 3DRSA 5DGBA 4RW7B 4I2PB 4X2BA 1RTHB 2GIRA 4MKBA 4RNNA 1T03A 3GYNA 3OL9A 3HKWA 3PR4A 3QIPB 3CWJA 4EO8A 4KO0B 5KG7A 2ZD1B 3KLVA 4ZP6A 1LW0B 4O3QA 2JEJA 4IFVB 4WFYA 3GIIA 3I5AA 4LQ9A 2OPQB 4MIAA 5KFZA 2YNFA 2IBKA 4MK8A 4TLRA 3BSOA 2E9TA 2ASJA 2HNZB 3PW2A 2J6TA 2HWHA 2W7OA 5L1IA 2D41A 5KFFA 4M95A 4NRTA
chains in the Genus database with same CATH superfamily
1B3TA 3GFYA 1DQ8A 1FVSA 1VQYA 2A3JA 4BWMA 4F4AA 1REVB 5A8RB 2RS2A 4C8OA 5ETOA 3KLEB 4A47A 1X9MA 4KKOB 4C9DA 2RNEA 3F44A 1T0TV 2DTJA 1PKUA 2QL5B 3VHQA 4K2JA 1HBNA 1M1HA 3N6NA 4UF4A 2FLLA 1GAOA 2ZNYA 3QJJA 3TEHB 4QYZK 3KJQB 1Q4RA 1S5ZA 1IKXA 2AYBA 1RAHB 1FKAF 4EEYA 1KDNA 2C2OB 1LWEB 2CNKB 3H42A 4Q5VA 3OSPA 4DG1B 3KNGA 4JI6J 3I87A 2K7JA 3IBWA 3V4IA 4LVOP 3LANA 1HPZB 2HNYA 1RT3A 5CYQB 3BKFA 3CJ8A 3A13A 5E2QA 3CJKB 1HYSB 3T19A 3PRDA 3TA1A 1DFDA 4DV7F 2KU7A 3BH6B 3SFUA 2JLGA 1U47A 1VQ4S 1KN6A 3CEDA 3K2YA 3DLEA 1D0EA 3NGDA 3T9NA 1NM2A 1ZETA 2R7TA 2BJDA 1U1PA 4WYWA 2BOAA 1X9WA 2H48B 2GQQA 1GFWB 4DR6F 1HQUA 2BKNA 4I2QA 1L3TA 2CQIA 2NYHA 1J2VA 3W66A 1A7GE 3EPGA 4RW7A 1JLBA 1N36F 1YRTA 2ZWOA 3MECA 3QFWA 1YZ7A 3RG6A 2DCUB 1FRLA 4ZLNA 4G1QB 4DL0C 4USHA 3W62A 4DUTA 4ZCLA 5A76A 1YBTA 4JYAF 2MQQA 1RXOB 1NXIA 3AXMA 3TR5A 3LW5C 2I2YA 4LQ3A 1XNQJ 5GAHI 2HHXA 2E5GA 3GU0A 3MAHA 4FF2A 4RW4B 3MUMP 5J2MA 4IOCQ 1KLMA 2G2OA 2VZ9A 3DM2A 2VQFF 1S79A 1BQNA 5KFPA 2IC3A 3QLHA 1SCJB 2QA4S 2UU9F 2BQRA 3MCMA 1LK5A 3EX7B 2HVHA 5DS7A 4OJHA 4EMDA 3MWBA 4L3NA 4NLGA 4FZVA 4WZQA 4QQBA 2HLTA 1KP6A 3BQ1A 5AE2A 3TAMB 3ISZA 4OZ2A 2DYAA 5KFKA 2ZZNA 1OY9A 1U1KA 2E9RX 1RI7A 2FYXA 2H54B 2OMLA 2DK2A 2VUGA 4QR2A 4HT7A 1RLDA 5D4NA 3TX0A 4DMZA 1JMTA 4S0MA 3QIPA 4ZP9A 3J7YU 1R6YA 2ZVIA 5I3PA 1PYTA 4CDIA 3I56S 2PA3A 3OV7A 1VBYA 3MM7B 5KT7A 1YBAA 4ED2A 1FESA 2XLIA 1RHJB 5E3RA 1IXKA 4ZVHA 1LXNA 5GAGU 2Z2LA 1T9YA 4J37A 3MFHA 2BE2A 1U6ZA 4J9VA 3JTNA 4JP8A 5LMUF 2HK3A 2HFZA 3ELHA 1PAUB 5K8OA 1S9EB 3U02A 5JVHQ 3Q8SB 4FXVA 2LQ5A 2ZHBA 3LAMA 2BACA 4H4KA 1T9UA 7AT1B 1XWLA 1SL2A 4V19J 4WKRA 3KK2A 4Q0BA 3BZQA 3IAM9 3FFIB 2AW0A 2FQQB 3K8VA 1NSQA 2Q1LA 4I0WA 3JB9k 1EKSA 4OI3A 1YIJS 2DGWA 3D0GE 2O67A 4IH5A 4YMEA 2WB1D 5C7PA 1RT7B 3QT6A 1BMQB 4QIWD 5E33A 1RA6A 4DV4F 2KHDA 3TWZA 2G0JA 3VR1A 4DR3J 2AX1A 2F63A 4JB8B 4NLYA 1FDAA 4QWBA 5GMDA 4K4VA 1HBUB 1URRA 1WTFA 1YX2A 2CVEA 4H54A 4CI0B 4BS2A 2CPDA 4I6AA 3CUNA 2CQ2A 2DBBA 4UW2A 5KFVA 4C0OC 4C98A 2GGPA 4B17A 2A10A 3FBEA 4EI2A 1SKUB 5LOQA 1N32F 1JJHA 4TKTA 4ALZA 2KN4A 3BPSP 4ID5B 3LP1A 4YB1P 3L3CA 5L9NA 1PBAA 2HMIB 2AKWB 4R25A 2PMZD 3SFGA 1WUUA 1WDTA 2KT2A 3B6BA 4J9LA 4B9MA 3LP0B 3TW0A 1SJ1A 3BSNA 3MR5A 1WACA 4NLTA 2FY1A 5HMXA 4BC7A 2F4VF 4I6WA 2J6SA 2DT9A 4KPYA 4ECQA 2B9EA 4DUYF 2MKKA 4DLGA 1MW7A 3K5PA 3P3DA 3DKDA 2YH0A 3BR9A 3UDLA 2VL1A 1GXUA 2EKNA 3EDRB 2KL8A 2W2OP 1EB0A 1GT8A 1AZSB 3EWGA 4Y2CA 4ZITA 1VQPS 2W9CA 3EE3A 1PIEA 4DBQA 2MQOA 2OGUA 3HSZA 3CCWA 4B9LA 2W4CA 3BN4A 4ELUA 2HKEA 3NOGA 3HHLD 3R6LB 4X65F 2UUAF 1I51B 2CZ4A 3QJPA 2LA6A 2YTCA 5FJ4A 1T94A 2XYHB 4MT1A 2A2CA 5K9FA 4MJKA 2KM8B 5KFDA 2XI2A 3ZTSA 4H4MA 2BM0A 1GNKA 3MTJA 4KSEB 2G4BA 1DURA 1Z2ZA 4LFCJ 4OYXA 1HNVA 4H4KC 1B64A 1MU2A 2PI5A 2IBOA 4X4RA 3N5FA 3D0HE 4WIQA 1XMQJ 2IVYA 1SUQA 2HGMA 4JI7J 3CE8A 3MEKA 1FRXA 5KFWA 4DSFA 3FFIA 2GMLA 1WOSA 1N6QB 1R8AA 1YLXA 4RR5A 2J5AA 3RW7A 5IV4A 2UXCJ 5EWEA 4JBCA 2DB1A 3L09A 4I2PA 4PWDA 2DNKA 3RBDA 3PJWA 4BCAA 3I31A 1WJ9A 3I0SB 1ZZNA 3MD3A 3C15A 1UVNA 3PO4A 1QE1A 2FHMA 4OJ1A 1EQ0A 3GFXA 4HVZA 4J9OA 1JJ4A 1TL3B 1RT1A 2L9NA 3GG0A 4OYMA 5LMNF 2V2KA 2M70A 2OHDA 4RWWA 1XJWB 4K5SA 1SH3A 1NK5A 2N4DA 2ZJPQ 2E7XA 3VQSA 3HFZB 3POTB 1X0FA 4IYQA 1IQZA 2R2SA 3K59A 4YR2A 2JLEA 1H2VZ 4ZVGA 3OSNA 3GLJA 3QRRA 4LRAA 1LWCA 5K8NA 2HBYB 4FS1A 2QLXA 3NGKA 4DL6A 4WP8A 5CQGA 2P6SA 1BY9A 7FDRA 2V6AA 3PHEA 3VWSA 2UP1A 2KZMA 2ZHOA 4FPIA 4UOGA 2V9WA 3D6MB 4HTJA 2QFIA 2M8HA 4OX6A 4QR1A 4UOFA 2JHEA 1U1NA 2IFXA 4NCBA 3OD2A 1TL1B 1IR0A 2UVWA 3H2UB 3I82A 3TQEA 4Q8EA 4NCGA 2VG6B 4RL1A 4NA3A 4X64F 3W9JA 1JK9B 5IT0A 3MM8A 4DXLA 1V3RA 1ZPWX 4IR9A 2UUWA 2W9CB 1RBAA 2PDAA 1EETB 1LWFB 4PQUA 2H4WB 2AQ4A 3KLIA 1YQHA 1WORA 1RU1A 4NX9A 3FZBA 1P8GA 4LRFA 4ICLB 2JEFA 3PW4A 1GK8A 4K4WA 1CJUB 3Q2SC 4A8SA 3CD7A 4UY8T 2OTJS 2EFOA 1LNQA 3KJVB 3DGPA 3FBBA 4RLEA 5D15A 3U1NA 2RRAA 3ET6A 3R7SB 4FF4A 1P6TA 2RVJA 4CO2A 4LR7A 4KTQA 4YOEA 4DR4F 2DD8S 1TVRB 4DQRA 4FNIA 3A12A 3QSYB 3HT3A 2ATCB 2LU2A 1GMUA 1R0CB 3QT7A 4I69A 2GMHA 3OHAA 2VONA 2MTLA 1F60B 2FUG9 2HBQB 5KFYA 2LXIA 4A8XA 3K58A 3T1HF 4LF7J 4LF8F 1XNQF 1FCAA 5IWAF 1NUEA 1WKKA 4YDXA 4FDFA 2CJQA 4ZVTB 4CP5A 2BJ1A 3MEEB 2KXHA 2ASYA 2RRNA 4PG4A 3V6KA 3QAEA 4NYOA 4CLPA 3NGSA 3PRBA 4P2FA 5C24B 2E5IA 1HBNB 2GJ2A 1HR0F 2VFVA 1WHXA 2C2NA 3BV8A 3LUYA 1RAFB 5EUHA 4JI0F 3SV4A 5D8HB 5F0WA 4CLTA 3EDQB 4OZ1A 5ETSA 1IWAA 4MK7A 1RKJA 2AX0A 3R7NB 1M90T 3L7UA 3V6JA 3GSIA 2UVRA 1HFEL 2C2KB 2X1FA 1NPRA 3Q2TC 2PFFB 2HQDA 1RTIA 4NLXA 5SUHA 2B5JB 2L41A 3CDWA 4W98A 1V3SA 2BE2B 4C6AA 5B08A 1FKPA 2BW2A 3NGRA 2RILA 3KG1A 1D1UA 3FQKA 4UOCA 3MR3A 3N28A 3HVRA 4J9NA 2DGVA 2PT0A 3EM1A 3Q83A 5LM7E 4C48A 4QPTA 3W2WA 3KK1A 1U7LA 4ZN1A 3Q8YA 5ETRA 3K5MA 1O6XA 2EBGA 2G0CA 4CH1A 2VQFJ 3AODA 1PBUA 1FO1A 4DR1J 1M5KC 1MSWD 4I67A 4ZVPB 2OEMA 4PWWA 1ZM2A 2LVWA 2XSFA 2WTFA 3G82B 4AXJA 1XC9A 1KQFB 1TFYA 4KHPJ 5J1EA 5ETKA 2C2MB 1NK4A 1ZH5A 3HPOA 2BE7D 4ITSA 1ZAVA 5HQLA 5KG0A 4NLRA 2POKA 3OR1A 2FHJD 2FY8A 3CSKA 5B0FA 4FBTA 4BHQA 1XNRJ 2CQ4A 2CQ0A 1V5VA 1AUDA 4CM2A 5KT2A 4V19X 4PAAA 4PPDA 2B4UA 2E1MC 4U95A 1Q5VA 1W26A 3OR2B 3W2VA 1X9SA 4M5MA 1VRTA 2VG5B 4U9RA 4WBFA 2RB7A 3TA0A 1S1XB 2DGOA 2ZDPA 1EQMA 3HSDA 1PYSB 5F3TA 3UQSA 5E0OA 3OTOF 1T05B 2OI2A 3C14B 5AXLA 1JLQA 1LOUA 3R5AA 4KBIA 4QCLA 3ITHA 3ILJA 3S8SA 3BDPA 2WONA 1S0NA 2M52A 5LMUJ 2KFYA 3GFZA 1T02A 2RDIA 1J27A 1XTZA 1CVJA 1MNEA 2QYGA 4DSIA 1RZMA 2PMHA 2Z57B 1FD8A 1Z1ZA 4PUOB 3AJ1A 3MMAB 5DO2A 3TVZA 4LF5J 3K17A 3R2CJ 2ABYA 3JQJA 1C0UB 3PJXA 1DLOB 8AT1B 3DRPB 2HQ3A 2L9DA 3Q22A 1G4CA 3TA2A 3ZZZA 4MFBA 1T11A 1SJQA 2J7UA 1TKTA 1FXLA 4E2FB 1RHMB 1WHYA 4A46A 3NLCA 1HPZA 1REGX 2NSBA 3FC9A 1RWXB 5DDRC 4CT9A 2BV3A 5CCMA 3KHHA 1KS2A 1ZS6A 4JI6F 1G2EA 4WFZA 3CCMS 3DLKB 4P72A 2YX4A 4LF2A 1PC4A 3OBIA 1RBLA 1HW8A 3SIPB 1VJWA 5L1KA 2LCWA 2CPEA 1ACMB 5EWFA 4YFUA 2W7PA 4B3MF 4RBUA 3FKBA 4Y2MA 1REVA 1OJ4A 2WK4A 1AFIA 3O1LA 2LQ9A 2B9WA 2GVZA 2HS0A 2QMXA 3BYPA 4J90A 3J7ZT 3T1AA 3ZTQA 2V4JA 5F8GA 2VIHA 3T1YJ 3FMBA 3M32A 5DM7Q 4WU3A 2H5EA 4IFYB 2XCPA 4QBUA 3DLJA 2RD5C 3W61A 2ZBPA 2OFGX 5EWGA 3NAIA 1YGYA 2QA2A 4HI2A 1U48A 1TKXB 3OL8A 2XLKA 2GAGC 4O44A 4FKXA 4DZDA 4BLGA 2COLA 3AA9A 3RAMA 3HVTA 4DX6A 2DHGA 4PXEA 2VDIA 1VRTB 2VG5A 1NB2A 5IT4A 4RZRA 3FSIA 3EVWA 2VFSA 1NHKL 2G2ZA 2V68A 4CH7A 4DWIA 3SMZA 5F8LA 5IV3A 1S72S 3UE2A 5KG6A 2I38A 3AB4B 3ENAA 4TY9A 3PZPA 1VC0A 1GMWA 1H7WA 3IP0A 2LQBA 1OPIA 3OTEA 4K5RA 1I94J 1U6BA 1PILA 2FVSA 2DHXA 2XYGB 3IAS9 3ETOA 3OR1B 2P8IA 2Y1RI 3CCTA 4M5NA 4N77A 1VOMA 1VFJA 4TYAA 1X4AA 3KJFB 2A1BA 3SDEA 1FT8A 2B51A 2CNNB 2XZWA 5HROA 1LWFA 1N5TA 1H3DA 3D4JA 2RU9A 3KMSA 1CJVA 1S49A 3SZ2A 1HWKA 3KK3B 4DV4J 3M4XA 4PUOA 3V81B 4C8YA 1DTTB 3PACA 4ZPAA 2YQ1A 5IOLA 1E6YA 1FXDA 4NCGB 2BEFA 4P9SA 5HATA 3VAKA 4EZ9A 2D74B 3QRQA 4HHJA 2BW7A 1GX5A 3ZZTA 2AMCB 2YBVA 1N48A 2MZSA 3HULA 4J7CA 4O3RA 3H2VE 1WNEA 3EXYA 1K1SA 1BHNA 3DU5A 1HKAA 2XMTA 3ZTPA 2Q66A 3PJ9A 3NMAA 2K3KA 1S6PA 1RISA 4RNHA 4OJGA 1VLYA 5D4PA 2KFZA 3DDNA 4ZN3A 4JI3F 3AAWB 2HHTA 3N79A 1TL7B 5ETNA 3U1MA 2HHPA 2EC0A 3M6WA 3HVAA 1NDKA 1KHVA 1WEZA 3IC1A 3MMCA 5B0EA 5BXIA 1YRUA 2FC8A 1FXRA 2XMJA 4CLUA 1KSPA 5KFHA 4TQRA 2QLWA 4ECRA 5HAOA 3AOAA 5IC6B 3SSSA 3UNYA 5J2NA 1BUXA 1CJTB 4USJC 5C24A 1FNMA 3VALA 4CH0S 2FC9A 4Q7AA 1NH8A 1CQNA 2V63A 3V6DA 3DI6B 1YJUA 3D28A 5J1EB 4RUAA 4NMLA 4DL5A 2W8LA 3GYXB 1CG2A 1HQ2A 4OX9F 2VBZA 3WX8A 4LF7F 4X2BA 4DFMA 4UOHA 3K5OA 1LWXA 2CG8A 1T03A 1TMJA 1UEVA 1Y4ZB 2JDJA 3F41A 1D8ZA 3DRYA 3CWJA 3NOCA 4KGKA 4DV7J 4B3RF 3NMRA 5KG7A 2ZD1B 3KLVA 2YPYA 3SSRA 4TU7A 1F3VA 2ROGA 3CO0P 2KZZA 3HJFA 2OPQB 2HRYA 2YNFA 3KTQA 1Q7YT 3RRHA 2E9TA 2M7SA 4G6VB 3W3SA 2A18A 2MLYA 4ZK7M 4X4TA 2HWHA 1K8AT 2W7OA 4JI2J 2HBRB 2A6MA 3PEJA 2PO4A 1VQ5S 2UU9J 2DCLA 5KFFA 1IR2A 4M95A 3CCUS 2XMWA 4RW8A 4OX9J 2XM3A 5F8JA 3KLIB 2O1PA 3J80U 3MHYA 2JC1A 3R5CA 5D0EA 5K8MA 5HN0A 1R8PA 1F9EB 2BJEA 4MIBA 4J9KA 1HI0P 1S4EA 3DOKB 2PEBA 2HFNA 3I0RA 1OS5A 3T9ZA 1OQ6A 3GV7B 4C8MA 4ECWA 3GB0A 2YNGA 3R1LA 5C25B 4DCOB 1QSYA 1E6VB 1XR6A 4B3SJ 2YVSA 3BBBA 5LMNJ 2Y0BB 5D3GB 3MUVP 1RTDB 2KT5A 4CNYA 4DDFA 2BM1A 2NXJA 3SV3A 4R0JA 3I4HX 1I5OB 2VJUA 1D9FA 2WZ1A 3J81U 2R3VA 3LPYA 1T8EA 4ES1A 2BZ2A 4QIEA 2YKNA 1RE1B 3GSDA 5HBMA 3LGNA 1FDDA 3ZZPA 3K0JA 3BH7B 3VQTA 4X62J 2IRYA 4QIFA 5HBMB 1IN0A 3OUYA 4NLOA 5F8NA 4YHHJ 2QLBB 5G0RA 4LMZA 2VPWB 1UPPA 3ET6B 5BYSA 3UN5A 3WHIA 4WCEQ 3OTBA 2NXCA 3UVJB 4PG6A 2ATLA 3HZGA 4NLSA 5BYQA 3JYTB 2R4FA 3AY0A 2GCFA 3N9UC 1RWNB 3HVWA 2IM3A 4H4OA 2NUUG 2MQ8A 4PXDA 4O3OA 2F3JA 2AJ4A 2LECA 2DY1A 1IUJA 1H73A 1T3OA 1UW9A 3CD5A 2LYVA 1EARA 1O5JA 5CYJA 3QBCA 4RW6B 2UUTA 3SCKE 2WOMA 1RGVA 4I4BA 4ZPBA 2DPIA 1HWIA 1S9GA 2KFNA 1YJVA 4ANEA 1KQGB 2N7YA 5T41A 2VC0A 1AYEA 1U25A 1NU4A 4LRBA 1H2TZ 1FJGF 3GZ7A 2IAJB 4WIIA 4F4KA 1KVIA 5EHHA 4IRKA 3QMQA 4J9QA 1AXQA 4U7UK 3OL9A 4X84A 3HHDA 2X1BA 1H2UX 5DETA 3CCLS 1QSSA 1VQKS 3CVKA 4CTAA 2E44A 2DVIA 2J0WA 2ADBA 1VRQC 2QO3A 4NL5A 4UUXA 5H1SV 2V4RA 2F4FA 5ETLA 1H6KX 3CDEA 1VQ7S 1SL0A 5F0UA 2ZH9A 3RW6A 1LWCB 1U6FA 2CYYA 3CO9A 1Q5YA 5K5MA 5KFIA 2RKIB 2W01A 4IOBA 3VGSA 1QAJA 1RYSA 2L48A 1FKOB 2DHHA 3T5LA 3DYAB 1YJ7A 4Q43A 2CQPA 1VQ8S 1RUSA 5HI7A 2C22A 1LFPA 3PRVA 2CA9A 2HIYA 2P6TA 1UWAA 1RHRB 2MZTA 3R5BA 1S4FA 3BKUA 2ZZMA 5K14B 3E2EA 3PEHA 5IQ6A 2DR6A 2C3MA 2N82B 4KGXB 4CLYA 2LDYA 2QGFB 4F8RA 1JKHA 1OSCA 2MY7A 2WAQD 3PM9A 3BREA 4KYZA 2W2PP 4RPFA 3GV8B 1RAOA 4GC6A 3OXGA 1UVLA 2KXNB 2XY5A 2ZH1A 2DKOB 1C1CA 1FFGB 4KIAA 1U45A 1F2GA 2OSRA 2DNRA 3IM9A 5CABA 2WBMA 1KLMB 3B4MA 2FVRA 1FX4A 3AT1B 4RW4A 3R7BB 5HVFA 5CXTA 1RADB 2BJ7A 4PCQA 1UA1A 4NOHA 1U2CA 1U2RA 2ZUGA 3NS7B 1MU2B 2C2RA 2O5DA 3JS9A 1RABB 3IWXA 3FUYA 4N56A 1YRXA 2JRSA 5B0AA 3ZO7A 1HBUA 3RB3A 3HD2A 3U27A 1JNZB 4DQQA 2AT1B 2R7VA 1S48A 3WC2A 1APSA 1S99A 3DMJB 2YNFB 2IYIA 5L9XA 3G6ES 2KO1A 2DIVA 4X62F 1HQUB 3V81A 1S76D 5L1LA 2H3EB 4B02A 4M94A 3P5BP 3EICA 2CFXA 4F3MA 1VQ9S 4KV8B 1PCAA 2P9EA 2V9KA 3A1YG 3MCNA 4DPUA 5DQHA 3H5YA 2MZRA 1DHMA 1QSLA 2HG4A 2OD4A 2W2QP 3L9ZA 3PR5B 1EP4B 1K47A 2BBEA 2C3UA 2LU1A 5ETVA 4ZJQA 2E5LF 2XLJA 4DS4A 4CCHA 3LO3A 2HNYB 2IRXA 3BSAA 1JKHB 4QYRA 4DN9A 6FD1A 3HM9A 4DSJA 3WDOA 3DI6A 1S97A 3LP0A 4M5GA 3MMJA 2KH9A 2GIFA 1LW2A 4MMOA 3HDSA 3IM8A 1RCXB 1V3ZA 3PX4A 3I9V9 1KFDA 2KB2A 1DTQB 5F9NA 1RCOB 3X3UA 4RNOA 1YJRA 1QDUB 4AT1B 4Y28C 3CMQA 1GEHA 1Q8IA 1U0SA 3PIPQ 3V5RA 1M5PC 1FKOA 4OHYA 5A0YA 2HK2A 2VPZB 2R8GA 2JEIA 2QE5A 4PG5A 3UPFA 3W5ZA 3R6GB 4B3TF 4A8FA 3ZZOA 2P5VA 4KHPF 4JV5J 2ZE2A 4NLQA 4DLEA 4C4WA 1N34F 2UUCF 2BR0A 4HYKA 5IS2A 2OELA 5KFJA 1MMDA 2C42A 3M6XA 2ACMA 5DDPC 3GCXP 4DV6J 3ISND 1RKIA 4URQU 3W7BA 3BB5A 2YNHA 2DXEA 4F0HA 3H7HB 4K4ZA 2I5JB 5C2CA 1OYEA 3R5DA 2OJ3A 2DNPA 2EK6A 4HR2A 4F25A 4UT4A 3PKMA 5C2GA 2RIJA 3GJQB 3L7PA 3MPYA 4RWXA 4FKYA 3H5SA 4P52A 3KK3A 3J7A1 1O8BA 2RT3A 2UVVA 3CC2S 2BE9B 2YWKA 3DLKA 4USVA 3H40A 3IG1B 1FRKA 3D67A 3FCVA 3PYDA 1S6QB 3MGJA 4ZPDA 1WEYA 1TMMA 4HTIA 4ETZA 4O4GA 3CF5Q 3DRXA 3EGNA 4Y3CA 1X5TA 4RUBA 3R1HA 4IUFA 4B3OA 1WSRA 4AL7A 4LF6F 1CJTA 3MOZA 3K5NA 4X4VA 2B6AB 2CQGA 2CZ9A 2GA7A 3ICLA 3FK4A 1OQ3A 1VCTA 4GKKF 3DOMB 2HNDA 4DFPA 1DLOA 1T9XA 3OJSA 2P2CB 4F4YA 3F73A 3CULA 3UD5A 3IGNA 2B9YA 2C1EB 4Q45A 3M8YA 1M1GA 3Q86A 1VC6A 1IBCB 1R8HA 3BF4A 2HZCA 2OD6A 2QV6A 4JI4J 2LP4A 3LF0A 1IKWB 1OO0B 5I3UB 4WXOA 3H59A 4B9NA 1KHWA 4C7QA 4NXMF 3H8YA 3NP5A 3AB2B 1IR1A 2GIQA 3AOBA 4ILMA 3M9OB 1BLUA 4DF8A 2GNKA 4LIWA 2YKMB 2XI3A 1Y11A 4ZVEA 3RBEA 2MPUA 4DPWA 4KAIA 2GS8A 3KJNB 3HMJG 1UCNA 5F8MA 4DR5J 3G9CA 3OFFA 4DR7F 2ZBQA 3H20A 2AF6A 5LT5A 2YNGB 4OI1A 3SQOP 4A8WA 2VC1A 2R2UA 5AE1A 2JX2A 2VBYA 4DV0F 3BKTA 4BC9A 1VQMS 1J5EJ 4DSKA 5ETMA 4FYYB 4WF9Q 2XEXA 4ZVFA 1HNXJ 5HROB 4CM0A 2D1CA 1KOHA 4USIA 2MXYA 4X4SA 4TQSA 3CMES 2GVDB 4LFBF 3ILIA 3QPIA 2HZVA 3QO9A 2JH3A 3CDUA 3PYGA 4K7QA 3KLHA 1RP5A 2D69A 3GJTB 1ITPA 5ETQA 2V0NA 4F02A 2GQ2A 3NG8A 2VFTA 1Z4UA 2XBPA 3RYLA 4DR2F 1SJ3P 2DGQA 1TQLA 5EX3A 4CO5A 2KTQA 4M5LA 2V8GA 2NZ4A 3IO1A 4WFXA 2H4YB 3T6JA 1I6JA 3MM9A 4OX7A 1S6UA 4Y2IA 3AQOA 3TUIC 1RAJA 1JX4A 1CJKA 2WB4A 3PNIA 4HEA9 4DPXA 2AZ3A 2CJYB 3TUPA 2YKAA 4R8UA 4ATNA 4EBDA 1RHKB 2ALYB 3CC4S 2I9SA 2Q3PA 2AJFE 2MB0B 1NHVA 3CDAA 3CCES 4JOUA 4JI5J 2XNRA 1Q79A 3CC7S 2DH8A 1MLAA 1ZM3A 4J9UE 1JNRB 3D3CJ 4W92B 1V9OA 1S1WB 4NYPA 3THPA 2LKZA 2VG7B 1ZM9A 3LA0A 4NLWA 1N56A 1HQEB 2CPHA 2VASA 4LR9A 1HD0A 1WC6A 3NBPA 3M32B 4XTTA 4J9RA 1PO6A 1NLKL 2FZGB 4ERDA 1SQEA 1AB8A 2B3TB 3NRBA 4ZCKA 2W7AA 3RAXA 2Y9HA 1PJ6A 1RK8A 5D6GA 3KKFA 2VA2A 3ISNC 3KMQA 4LRCA 3PFEA 4ZKAA 4KKOA 2J6UA 3DXBA 3VAFA 1AFJA 4HDGA 3TAQA 1FEHA 4LF8J 2EXUA 3FRYA 1SC6A 1BQMB 4XPCA 5DM6Q 3D7SB 5A6PA 4JV0A 4I68A 2W4PA 1UW4A 3NBPB 1XR7A 4NLVA 4Z7CA 1URNA 1HQEA 2AEMA 4AD6A 4DX5A 3AFGA 2BJ8A 3D6FB 3GILA 3Q23A 1P1TA 1WC0A 4HDHA 2MHNA 4U8YA 2CPIA 8ATCB 3MAQA 1ZOTA 2FZKB 4OHZA 3IBFB 3P4UB 2YNIA 1N88A 2KRRA 4TU8A 1NJWA 4DX7A 2ZOMA 2XHCA 2HHSA 2AJQA 2FHJA 1T9WA 3OXFA 1TAQA 4YDDB 4KV8A 1VYAA 2D3OR 4NLPA 3ZC4A 1M5VC 2U1AA 2EVZA 2HSEB 3B8HA 3MM6A 3W2WB 2K1RB 4XPEA 2OKQA 3NWGA 1FJEB 4M5KA 1DAXA 3DN9A 3CTRA 3MPDA 3VTIA 2I1RA 1HHSA 1GTEA 1Y00A 2FJBB 3QYYA 3UN2A 3LGHA 2OH2A 2EFNA 3KLHB 3HLUA 2CPYA 3QO9B 3IBCB 9RUBA 4WP3A 3BO3A 2Z58B 4ZHRB 4OL8A 3ILOA 5LSRA 1KD1T 4BBYA 3D54A 1MG7A 5CYMB 1FVQA 5H9FK 4PPZA 2MKHA 2J8SA 3PFOA 1KWMA 1DJ0A 4FXWA 4ZJLA 4J9PA 3GJSB 3J7Z5 1AW0A 2FGCA 2XCAA 5KFGA 1HNWJ 1PG5B 2VICA 1BQXA 1Q78A 3QRPA 4KFBB 1EHWA 4P2MA 2EI5A 1F6TA 3MD1A 4RKUC 3Q24A 4F50A 3VAGA 4ZJOA 1YITS 1YDLA 1NK8A 4WYLA 3HJVA 4NI2A 4KH0B 4XDCA 2Q79A 2V8PA 2HLUA 1RT5A 1UFLA 2J9CA 2ZEJA 3LQVA 1QVGR 3MPVA 3FEXB 3PW5A 2GQCA 2R2TA 2A6OA 1R6VA 5E7OB 2VG7A 1S1WA 3MEEA 3MAAB 3OJUA 1R0AA 1SC1B 3MEGB 3GTYX 2Z4PA 3R5JB 2DNYA 1SQGA 2C3OA 4P6QA 1PJ5A 2SXLA 3DYAA 5HLFB 4OHXA 1YJTA 5A8KA 2ERRA 4U96A 2GVZB 1HBMB 3TZWA 1WWHA 3J7YI 1TAUA 4N7TA 1XN9A 2HQFA 4Y00A 2EFVA 4ZIWA 3BGRB 2P9GA 1VMBA 2IMOA 3DOMA 3H90A 1RWUA 3M1VB 4PG8A 5LSLA 1PAEX 3T5JA 4DFKA 1HI8A 1MROA 2QT7A 3K57A 3R97A 1VQNS 1SV5B 3K89A 2IA6A 3DLBA 2YPZA 2ZKUA 3M6UA 2ZBCA 3DGPB 3UWTA 1S1VB 2J9EA 3BM7A 4I64A 4HL9A 2WCXA 5D78A 4NXNF 2CWXA 3E01A 1SVDA 2IAJA 3CNQP 1NMEB 3MM5B 2OPSB 2IJFA 3MPUB 3SCJE 4GVBB 5B0BA 4TY8B 2ASLA 4UY85 2G13A 3EZOA 2J9DE 4WPAA 5DG9A 1B4SA 2DXDA 5T7LA 1H98A 2ZM6F 3Q0AA 1TELA 3TJAA 1NB7A 3QGIA 2HURA 3ZZ0A 4HT5A 3TEGA 3BDEA 2R9LA 4M5JA 3MM8B 1NK6A 3AXKA 1VC5A 4B9SA 1X4FA 3MI7X 4MK9A 3W64A 4F4XA 2XY6A 2ZH8A 3A8IA 2LA4A 5M2UA 3M8QB 3QNWB 1KTVA 1VJQA 3W8GA 1YG0A 1XQIA 1KKHA 2BKPA 3E51A 3WX4A 4CQ1A 3AA8A 1F2HA 3KYLA 4FPRA 2EG1A 2Z2MA 4O4RA 5FD1A 1T05A 2V94A 4P10A 5HMWA 5I3UA 3KHGA 4LF4J 3RAQA 1VIXA 3D3BJ 2K3IA 2PIIA 4M5HA 5E41A 3UCUP 3UN3A 2X3DA 1WTBA 4IH6A 4OYAA 1TVRA 1U1QA 1F9HA 4UQGA 4B3RJ 2GMJA 2ILZA 3Q89A 1XIQA 2DXFA 4F67A 2DNHA 3HP6A 4IO9Q 4Q8FA 1LW2B 1ZTWA 2ZFHA 1GMVA 1JXLA 3M7VA 1CC7A 2IPOB 5GAEI 4DHVA 3THTA 1X5PA 4L72B 1Y10A 4LF9J 4U67Q 3LALA 2CJ9A 3R2DJ 1FERA 2JZ5A 3G8TA 4LBPA 4O4GB 4OZJA 2EFGA 1JJCB 3C15B 4J5OA 3AD9C 1X4HA 5EGYA 2NS1B 2V50A 4ZA1A 4ANDA 3D68A 1VDHA 2AGQA 1NRKA 2GGPB 2VJVA 2MQMA 1F1BB 3KWMA 5J1PA 4WFNQ 3SYZA 4OZ0A 4N5SA 1O51A 1RAEB 1RLCL 1CQMA 2EPIA 1W25A 1UEKA 2I5JA 1HIYA 2B56A 2HZAA 2M9KA 1FNXH 2YNHB 3KOAA 1CSJA 4PG7A 2AJ2A 3DU6A 3DC2A 2F65A 1VQSA 2MKIA 3MMBA 4NXMJ 4DR6J 3DLHA 1U09A 1ROFA 3WIVA 1C4AA 2MKSA 1UJ6A 3TQ1A 2HWTA 3G87A 4OYWA 3JAMY 2NXEA 1KQKA 4ED4A 3CXCR 1TL5A 3HI9A 3PCOB 2R8KA 1IJFB 1G1XA 3V6HA 4EK2A 2Z56B 1KVJA 2YWEA 4W4MA 1SH0A 3OLAA 1ZPVA 3PG9A 1RWVB 2HFVA 2B4VA 1UVIA 2WW8A 4WU2A 1AZSA 1HMVA 1FRJA 1S9EA 1DTQA 4RUHA 2UZAA 2HYIB 2GJFA 1IKYA 4H4OB 3FMWA 1RT1B 1B70B 3GG1A 3H98A 2UV8G 3NS5A 3P8BB 5CZVA 4YP3A 1R43A 2FIUA 1CBKA 5KFRA 3K5LA 3PV8A 1FDBA 2J8AA 3M6VA 2DIUA 2D3UA 4MYUA 3BBFA 2B8PA 5JUMA 2QFJA 2AU0A 4DR1F 1NJIT 2ZDOA 4RJVA 2HVZA 2KJWA 4I2PB 1Q95G 1K0VA 3OTDA 2V2QA 2GIRA 2CQCA 1VR6A 3JQKA 3MMCB 2RU3A 2VBWA 1HD1A 3HKWA 5E3PA 3ILLA 4YHHF 4GO5X 3QSIA 1LW0B 4O3QA 2DISA 5HK4A 2CPFA 4WFYA 5AXNA 5M2PA 1HNZF 4MIAA 2VQEJ 2YQ3A 4YS2A 4CTAB 2AEFA 2DGUA 2XB2D 1U26A 2ROPA 2D3O1 1IBLF 3PW2A 3ZTOA 1CJUA 4P75A 1N5SA 2NQPA 1RTZA 1H0HB 1RACB 2QZ8A 1YK9A 2CQHA 5GAGI 1UP1A 3VZIA 3NNHA 4NRTA 4ED7A 3NWRA 4ED8A 5ITHA 3KLFA 2XNQA 2IJRA 3T1YF 2ALZA 1NKEA 1WI6A 2DO0A 3AOCA 4M1KA 3DOKA 4WWSA 2BJ3A 2XMAA 3FBFA 1C1CB 3BO4A 3UDEA 3OL7A 4CO1A 4GVBA 1CPZA 4QIGA 2OEKA 3C2PA 2VQEF 3EGWB 1FI4A 1N8RT 4RBTA 2VU5A 5HSPA 1SC4B 5GAEU 4QYZJ 1TK5A 4WTYA 3C6UB 1AUSL 4KT0C 3IRWP 2OPQA 1WF0A 2HMIA 2OMOA 4U8VA 3D1HA 2YH1A 4LSNA 2B4OA 5SZTA 2D3ZA 4FP9A 1UFWA 2OIHA 2FJXA 2ZH2A 4B9TA 2PFDA 4Y2AA 3OUYB 3BGRA 1XNRF 1QAYA 5CHCB 4J9MA 2JOQA 3H0PA 4YN3B 1K73T 2J7WA 1RWOB 4FVMA 2IM2A 3CGIA 4O23A 5HQ8A 1RBOB 1X4BA 3C19A 2I6WA 2UXBF 4DL4A 4JV1A 2D9PA 2B8QA 1RT3B 5CYQA 1A0OB 3JXOA 3CJKA 3V4IB 4QZVB 3SCIE 3MAAA 2MYFA 4F0KA 1RTDA 3HD1A 4ZS6A 4RU2A 3RBXA 3P49B 1WKLA 1RHQB 4WK3A 4ZLLA 5IT9U 2PSZA 4MTPA 2Z2YB 2QG9B 2OPRA 3CB4A 5HMZA 4I6YA 1E6VA 1CLFA 3BQ2A 3C16B 2MY8A 3N6MA 4K2XA 4RNFA 1D3WA 4ZDNA 4PKDB 3AJDA 1HMVB 4N8OA 3A8EA 1N0UA 2M8DB 1NZAA 3AD8C 3FZ2A 2V34A 1WHVA 4QU7A 4MIWA 2MQLA 4PABA 4EUVA 2LFVA 4RW8B 1GXLA 1FA0A 2LQJA 3TI0A 4XIUA 4F2RA 4NLDA 4IOAQ 1HNWF 3OQ2A 1RT4A 2I0XA 3GONA 1UL3A 2LEAA 3M8WA 3KHRA 1K1QA 1S6PB 3KG4A 1ZA1B 2DHSA 2NREA 3IGVA 1A9NB 4ZP7A 4JI8F 4YUDA 1NK7A 2C28A 3KUEA 4ES3A 1SV5A 1HA1A 1R89A 4DUZF 4MFBB 2VPYB 2HW3A 2LQ8A 4IQMA 5THWA 3C66A 5DJBA 4MKAA 4C8ZA 1SKRA 1A6LA 2EFPA 2OLWA 5G4DA 5FIIA 3RR7A 3FEYB 4C3KA 1HBMA 1FTCA 2HHHF 2PD1A 5HLFA 3NEKA 4LVNP 2UUBF 2DNOA 2FPHX 3W65A 2YKNB 2F7VA 2QMWA 5IM0A 1X60A 3BGFA 3D66A 1JXEA 3SQGA 4WZMA 2Q6BA 1KEKA 2PEHA 1RT5B 1SIWB 2FGOA 2C3PA 2MJNA 3M2UA 3QQCD 1EAYC 5D3GA 2BVZA 2HGNA 3M8PA 4ECUA 2FD2A 4OHWA 1S1TA 2ZKTA 2JFKA 5B7WA 4C8LA 1X8DA 1H72C 1VGYA 2Z0GA 4EFAC 4F7VA 3M9MB 4ECVA 4FF3A 3FCWA 4A8QA 5BR8J 1JLAB 1ZM4A 1V5IB 5CD4A 5C42A 3PW7A 1ZA2B 4ID8A 4OZ5A 4RO0A 3T5KA 4DSLA 5CYMA 5LJ5Y 3X1LB 4ZIVA 5LSOA 4JYAJ 5J1NA 2HAFA 3UR3C 1V6HA 2EKYA 1I1GA 3KUGA 2IM1A 2WSCC 1NSPA 4OIXA 4PYDA 1J5OB 2M3DA 2QMUB 2F9DA 2CPXA 4WJBA 1YJWS 1UA0A 4G1QA 3UCZP 4XDDA 3AJ2A 2BA9A 3BGOP 3LH2S 4NYZA 3G82A 3QJLA 3HCXA 3VAHA 2RUSA 3KNAA 2BXJA 3ENQA 3G8QA 4DCJB 4GVLA 2BQ3A 1UZDA 1TUWA 1RT7A 2AP6A 5K8PA 1G6BA 4AQYJ 2PI4A 4NA1A 5KT4A 2UXBJ 1BWVA 4PR6A 4JI1J 2AJ0A 2DNLA 1U2FA 3SDEB 1RA7A 1RTHA 1W2IA 1VBZA 3UNGC 4XK8C 3E01B 1Y9OA 5U47A 2F5GA 3PX0A 4E8UA 1VRUB 3V6DB 4F3OA 4PWUA 4NWBA 4P74A 2QSWA 1IKXB 2CJAA 4FNHA 2E66A 4FYXB 4C97A 5F3ZA 2FB0A 2NYIA 2ASDA 5A2QY 2KHCA 4NASA 1KNZA 2BOPA 3CJTA 1JLGB 3DRRA 2H5JB 4YB5A 3UD3P 2RH3A 2AHOB 1JLFA 5H9EK 4N76A 3CCRS 1YTYA 3HO1A 1TL7A 4JI2F 2QC3A 2HBZB 2XWYA 4G1PA 3R9LA 4CO4A 1N5YA 1UEUA 2HVEA 4U6PA 3CJSA 5CZXA 3OW2R 3M30A 2DPJA 2ZH6A 4M5IA 3JAMU 5KG1A 2ACYA 3ITHB 2VFRA 1JLQB 2EFQA 3NGTA 1Q8KA 1YI2S 2HIQA 3I4PA 3C46A 3G2XA 1C2PA 2Y1LB 2O01C 3FGVA 4D3GA 4TU9A 2W2MP 2BDPA 2MKCA 3GV5B 1WC1A 4RU9A 2IY5B 3N4WA 2C2DA 2RRBA 1E6YB 2AWZA 2ZITA 2DHAA 2ROEA 2EW9A 3US5A 5KTQA 4PXBA 4YY3F 1S0MA 4WTOB 2Y8WA 1NJZA 4DL3A 4YQWA 4O0IA 3NNAA 1CC8A 3AH6A 5J2MB 4D3HA 3M8PB 1JLEA 2NSCA 3J81j 3J80Y 4DR2J 1RYRA 2DY9A 5T14A 2E1CA 2HS4A 4KE5A 3MCSA 2W8KA 3UDCA 4B3OB 4AL6A 2BYCA 1D9AA 5F8IA 4LREA 1CULB 2QLJB 3HZEA 3D2WA 1JXVA 5HMYA 2CQDA 2AEJA 5KT5A 2DRAA 5DG7A 2R2RA 4P7VA 2FDNA 1F5AA 4PYAA 2RE1A 2IHR1 1Y5LB 1NK9A 4NPOA 1HWUA 1BE4A 5BR8F 1SXLA 4C11B 2FTRA 1U1RA 1MMLA 2MGZB 1S0OA 4GKJJ 2JVRA 3KK1B 1S7IA 2ZJRQ 1NSKL 4AUKA 2N3LA 2UXCF 2R7RA 1R31A 3HVTB 4QOTA 4F4ZA 2MDAA 1S6OA 4X4NA 4IG0A 3CMAS 3BSCA 5KFBA 1WF1A 2DR5A 2YNIB 3GE9A 1G7CB 3CD6S 4PRFA 4NA2A 4XAKA 3SBMA 4IDKB 3N0VA 3C8YA 3M30B 2CDRB 4M5DA 1XMBA 1R7IA 2V2VA 5AE3A 3CW2C 4C2MA 2HHWA 1LWEA 2KJVA 4CLSA 4FN5A 2UUCJ 2RMLA 4P7TA 5CA5A 3IR7B 3SI8A 3FJ2A 1IQTA 2FVCA 1XR5A 5MAOA 2UUAJ 4X4PA 1RAIB 5LL6d 3DRRB 3P45B 3RB6A 3JQMA 4GKJF 1JQGA 3G96A 4X66F 4L6V3 2HNDB 1N5VA 1MMNA 3DCAA 3O8WA 5D0HA 3G71S 5A8RA 2J0XA 1VK3A 3LOUA 1U8SA 3KLGA 4ETXA 2MJUA 3C16A 4OLPA 7FD1A 3QZ8A 2IDLA 5DZ7A 2OPRB 2EC2A 3PX6A 1WOPA 5CAAA 4P73A 4X4UA 3EGVA 3FSXA 1IBLJ 2JSXA 5DDOC 2GW8A 1VISA 1N33F 4KRWA 4Z37A 4KGZB 4KQZA 3GJRB 3HSGA 3BN7A 1RQ0A 3QFHA 4ZVOB 2FJDB 3GIJA 3PO5A 2GJIA 5L1JA 3O3LA 4AYBD 3IFEA 1Q8BA 3Q8RB 1SUQB 4HH0A 4DN0A 1RWWB 4EO6A 1S0VA 2X51A 2XSJA 3W5YA 1VS3A 5IZHA 5DRKA 4ED6A 2QIFA 2ZNZA 3Q8PB 2E7WA 2O66A 2WRMA 1TV6A 1OY8A 3JSBA 1Y5IB 2YWFA 3Q8QB 3OL6A 1J5EF 1L3KA 1AROP 2KG1A 3G4SS 2WONB 2J76E 1HW9A 3HK2A 1X5OA 2KVQE 2V2ZA 2OTLS 2BUNA 2B0GA 2DO4A 4ES2A 1WEXA 3QWUA 5D77A 4DR3F 1YJ9S 1M1KT 4B3MJ 4JV5F 2VPXB 5A0YB 1EETA 4PQUB 3NGUA 1R8BA 4DSEA 3LP2B 5IFMA 2FHKA 2HWIA 1JLAA 2VDHA 2GC8A 2Y0SD 3BYRA 3DNCA 3LTOA 1DY3A 2HHHJ 2DEJA 4MAKA 2ILYA 2C2ZB 1IBKF 4O3NA 3ULHA 3OR2A 1BGXT 3CJ0A 3W2VB 4Q2LA 3OFEA 2H1YA 3ENWA 2ZOGA 5KG5A 4ZPVR 2Z30B 1TK8A 1EIYB 4RW9A 3M8RA 4PXCA 1HL6A 4QWAA 4DPTA 1L3UA 1PC5A 2QLFB 3K8WA 2YWGA 4Y6IA 4LFAF 3TJ8A 5I42A 4IO1A 4QW8A 1WKJA 4XO0A 1RAGB 4K0KJ 3ZFVA 4QWCA 2IRUA 3S7RA 2VOOA 5HANA 2F9JA 3DMJA 1FWKA 1RT2B 2FJAB 2HS3A 4TXSA 4LBIA 1M5SA 1R27B 1HWJA 4ZPCA 2XMMA 4CLFA 1FKPB 2B6AA 2HFOA 1N5QA 4ICLA 1NDLA 5DGAA 2BJ9A 2AZ1A 1WHWA 2OUGA 3GYGA 3NXZA 4YEAA 2KM8C 4DV3J 5GADU 1W2BR 3I0SA 5J2QB 2OAUA 3P96A 2JEGA 1RT4B 1IBKJ 2XS2A 4IG3B 2CJKA 4NXNJ 1F5CA 3FNNA 1HLWA 3HHKA 3ONQA 4NZ6A 2XULA 4L73A 3H4BA 2QA4G 4FF1A 4WK1A 1R8CA 3H5XA 2U2FA 1LEOA 1ZAWA 5A8WB 1S10A 2FLNA 5LJ3Y 4OZNA 2Z8QA 1S77D 3I32A 4FYVB 3RRKA 2E5JA 3M2RA 3J81Y 4JI7F 3UO0A 3BGLA 1FE4A 1P27B 2AJ1A 5K14A 3B4DA 3NKYA 4L74A 3DGVA 2IVMA 5EX0A 3M8SA 3G6XA 5F9LA 1L3SA 2F8MA 4AQYF 1LFWA 3JYTA 2YQ0A 4YB6A 1S1UA 4DPYA 3HHLB 4FS2A 1KQSR 2KDOA 3B82A 2HHVA 2G1HA 5IC4B 4DOZA 1NZ8A 2QL7B 2W4DA 4KJIA 1VBXA 2MLXA 3A8KA 3BS9A 1RAAB 2OSQA 1JB0C 1HBOB 1TKZB 3BO2A 2BABA 3RRGA 2E7VA 1GTHA 3D9BA 4DPOA 1SQFA 2X3GA 1C1BB 2N7CA 1X4GA 4IH7A 1DARA 2R42A 2CJBA 1NH7A 1R3NA 4DU7A 2QSFA 3M8ZA 1HHTP 3MF5A 2RAQA 5KFNA 4RW9B 1U0HA 2QN6B 2Q43A 3RJMB 2RQ4A 2W9BB 4OYBA 4OI0A 1OPZA 2F4VJ 5C5JA 2WBRA 1WI8A 3I96A 3OVSA 4FYDA 4PWDB 1HNZJ 5C25A 1TU0B 5KFXA 1Y5NB 5HP1B 1NSAA 3D6TB 3EVOA 5E3CA 2W9AA 4C8KA 1SI9A 1S9GB 2CVIA 3DLLQ 3QAUA 3H2LA 1QVFR 2WOMB 1B7YB 4FVCA 1F3FA 5KOWA 3S01A 2KXFA 1VIOA 1TK0A 3W8PA 3KLFB 2VG6A 3B78A 1HNVB 1ZAXA 1KR4A 2CQ1A 1ZYQA 4F4WA 2XZDB 3IXQA 1T3NA 1NO8A 5DQGA 2ZBIA 3WZ0A 4MKVA 3NY0A 3MR6A 3A3NB 4LRDA 4C3MA 2XC9A 4MKYA 5G0RB 3ZZYA 4ED5A 2G1DA 1NCLA 2MQNA 3I9ZA 3NL0A 3W9IA 5M2RA 1QTMA 5DG8A 1KFSA 2HHUA 1P9YA 2DRBA 3ZNJ1 3DLEB 2DEIA 1RWKB 1UETA 3RBZA 4ILLA 3EZ5A 4TY8A 4IQXA 1HWLA 2OPSA 4YR0A 2XGQA 1RSCA 4BDPA 4ZVQB 3VV2B 1FHTA 2RQKA 2RQMA 4DV3F 2CKWA 5GAHU 3G86A 1WELA 2BMBA 2Y3YA 2R8JA 3FQLA 3PYEA 3NCRA 2B43A 2DGXA 1RWMB 3PHTA 4OV6A 4FYWB 3A3OB 5DZ6A 3BEGB 5HQMA 2UUBJ 3TNVA 2HPUA 1Q16B 3TUJC 5J2NB 1FF2A 4WP9A 1C1BA 3W9HA 4YR3A 4ECZA 3RZAA 2MSSA 4ZVUB 3V4MA 4OI6A 4ZLPA 4X64J 3N6LA 2Q6CA 1JLCA 4URSA 3BGUA 1N6QA 2H51B 4DUZJ 2YXLA 3CIZA 2LMIA 3N5BA 2AYGA 4Z7YA 6AT1B 2NPFA 2Y8YA 4HKQA 3RGIA 2HRUA 2R7UA 3MMBB 2RDJA 3TANA 3QZ7A 5IQQA 3ZTRA 3GP9A 1UJ4A 3GMGA 1DQ9A 2V69A 2RHQB 3PKYA 2MKJA 5FDLA 4I56A 2Y1IA 3P6YC 5ADZA 4KB7A 3BQ0A 2E1RA 1M0SA 2YY3A 2RS8A 3HFVA 1WDDA 3HX9A 3KK2B 2M0GB 3TZYA 1QD1A 2B9XA 3FDSA 4DL7A 2XY7A 1S7HA 4DV6F 3DM2B 2DH7A 2AYEA 2PA8D 3MCOA 4OMFG 5GMKa 2N4CA 3IA0A 3RUBL 4RW6A 5J2QA 2HQCA 3IMQJ 4Q2MA 2NPIA 3D5MA 3IS9B 2CADA 4L75A 3TOQA 2F8EX 3EVMA 5KFUA 1N34J 2KKHA 3U1LA 4DU8A 3W1YC 1ZBTA 4B3TJ 3HKZD 4QR0A 4URGA 1T9TA 2FHOB 2XMUA 3DRSA 4LT6A 3OFGA 2RDDA 5DGBA 4RW7B 1YWXA 3UI3A 1KRPA 2E29A 4MKBA 3GYNA 2KT3A 2V8HA 4J91A 2GHPA 4QJVA 3T6BA 3QIPB 3TVYA 2ZJQQ 2R7OA 1FX2A 2L3MA 2HHQA 2QJ3A 4JI3J 4IFVB 2L9WA 1VQ6S 5GADI 2VOPA 3GIIA 3I5AA 4LQ9A 1MN7A 1NBEB 1UFKA 4DQPA 2F40A 4MK8A 4TLRA 3BSOA 5D4OA 1JJ2R 2ASJA 2HNZB 1L3VA 3CCJS 5AXKA 4AFFA 1FJ7A 3CCQS 2MQPA 2D41A 2IA0A 2CNLB 2HVIA 2V4JB 2XTJP 2V8DA 1BWEA 3KDNA 3TRGA 1DZ5A 3ZZRA 2FVQA 4CLKA 1IBMJ 2G2YA 2CQBA 1WG1A 2UV8A 3OXLA 3LP2A 1P1LA 3C3LA 5KG4A 4V1Ak 1UVJA 4Q0BB 5T7LB 4DUYJ 1LXJA 4OYZA 3CJ2A 2VHGA 2WVEA 1U4BA 3KDOA 1S59A 2IM0A 3CCSS 2V5HG 1XMOJ 4K4UA 2E1AA 2K8GA 4N47A 3S1TA 3PY8A 1FFWB 3BPDA 4NMXA 1LK7A 3AQPA 1I94F 4Y65A 5L8RC 1AT1B 4ZPTR 1JLBB 4WE1A 4ILRA 4RNMA 2XSJB 5I4MA 1X7VA 3QT5A 1IJEB 4Q44A 4DEZA 3DRPA 4R8UB 5LXYA 1C0UA 2QA1A 3R5GA 4EWTA 2GZOA 4OV1A 3HFKA 4PZVA 5ETPA 2DNQA 3L4BC 5AJ3J 1HNIB 1TKXA 2W1BA 3P5TL 4WXWA 2ZBRA 1HYSA 3CIMA 3UW1A 3IN5A 4JV2A 1OIAA 3A3PB 3K7RA 5F8HA 3N01A 2JJ4D 5A6WA 4LIRA 4L76A 3IR5B 2GVDA 1B0PA 1UTAA 4O0NA 4NI2B 1NKBA 2XO6A 1QLNA 2C3YA 4EYHB 1PGZA 3IWNC 1K0TA 4LBHA 2IIHA 5JVGQ 3E8OA 1SJRA 3ZXWA 2ZH5A 1U1OA 2CZVC 2OFHX 4QWEA 3QLHB 2IC3B 3H5UA 3PYFA 4QIVA 3LWLA 3H25A 1SL1A 3TUZC 5DQIA 4F26A 3J7AN 2DNGA 5JXSA 4DV5F 1S1TB 3TX8A 3FEZA 3HXMA 2AD9A 1KOOA 4M5DB 5FLXU 1D9DA 4A8KA 4OJ3A 2HNZA 3O44A 3R27A 4ZHRA 1VK8A 4M8LA 2H9ZA 4ZCMA 3VAMA 2B4PA 4TVAB 3SQGB 5RUBA 3PW0A 3CJ3A 5LXRA 1TKTB 2MZ1A 2RJZA 2X1GA 5MLCV 4OHVA 4DJBA 1IKWA 3NNCA 3MECB 5H9EJ 1HNXF 4F04B 2QEXS 4KO0A 2M5YA 3OFHA 4P2SA 3Q8VA 2VODA 3Q8UA 2WVBA 1SPBP 3WBZA 4NCAA 1OSDA 1X5SA 3MMAA 2ADCA 3PVXA 5AT1B 1GH8A 2EG2A 3TP2A 1RTJA 4N8NA 4ECTA 1CJVB 5D0GA 3DRSB 2G9OA 2A2DA 3L7OA 1KLNA 3DXSX 3FVYA 4ED1A 3GPAA 4RX6A 1N54B 1N52B 2XMKA 1QTNB 1GMWD 1U02A 2W24A 5GMEA 1S12A 3VZHA 4AE5A 1VQOS 3C14A 3DFEA 3JSMA 1Q82T 2FLPA 3I55S 2CPJA 3HF5A 4DG1A 1K9MT 3QIDA 1S6QA 4DQIA 1C4CA 2A0FB 2K7KA 3UCGA 4YY3J 3W60A 1S1XA 2HQIA 3CPWR 4JI5F 4ECSA 2KVIA 3TZZA 5KT6A 4JI4F 1FWPA 4EU0A 2XO7A 2JC0A 1QAXA 2DH9A 4EZ6A 4DR4J 4ZOSA 2LXFA 2PMWA 2FZCB 1Q8LA 4YB7A 1FJCA 2CWKA 5E3AA 3GR0A 1QY7A 1F5BA 1SKWA 4DV1J 2WVDA 3WQPA 4MH8A 1YKWA 4C0HA 2ZC3A 4E98A 2PN6A 5D4LA 1B0VA 5B0DA 1N36J 3W63A 2ZE2B 4ECYA 2VA3A 1YJNS 2RF2B 3KG0A 2BRLA 1HNIA 1JLFB 1RJJA 4KH1B 5IWAJ 1FD2A 3CCZA 4TYBA 2J7KA 4OI4A 1UVMA 3G8SA 4KGVB 3GIRA 5C42B 4LSLA 3DHXA 3JTPA 5IT9Y 4X4OA 1TFWA 1Q53A 3FRZA 3VAJA 5KG2A 2EBEA 1PJ7A 1NHUA 4DV1F 3HHNB 3CJQA 3V2UC 2R7WA 4TNOA 4WE1B 5B0CA 1U49A 1DBDA 3C6UA 2B7BB 2B5JA 4HH1A 4OX8A 1FEEA 1X4CA 1RTIB 2YX7A 2IMWP 1UPMB 1LQ9A 1GXTA 2O3DA 2X7IA 3ADAC 4G65A 5B0GA 5EDWA 4A8YA 1NK0A 2BANB 3R8YA 1OY6A 3ETMA 2R8HA 5DDQC 4Y34A 2ZUAA 3S6EA 3CD0A 4LF5F 3H4DA 2MEWA 3ZNUA 3MUTP 2E9ZA 4DI6A 4ENOA 2YKPA 4HHHA 5D0RA 2PC6A 3UDVA 3CJRA 1SC3B 3L95X 5JMNA 5CD4H 3IRXB 4R0EA 2LDIA 5KFOA 1T7PA 4EBEA 1X31C 5E3QA 3OLBA 3KHLA 1NAQA 1UAWA 1FRMA 1VI7A 3QT8A 4HLBA 4EBCA 2DNNA 1TL1A 4UTGA 1XBWA 4C3LA 3BJYA 5FDLB 4NRUA 4GKKJ 2EK1A 3KFWX 2AIRB 2YKMA 3MPWA 1B7FA 3SXLA 3T5HA 2CNOB 3R3TA 4F3QA 5DLGA 4LF6J 4ELTA 4K4TA 1TP7A 3LWMA 2E5LJ 3CJ5A 1TUGB 1LW0A 1RT6B 4ER8A 3T1HJ 1L5UA 1KONA 1SJFA 4ZLJA 2K2PA 4JI1F 3C6TA 4U7CA 3MFIA 2NXNA 4CWBA 2YKQA 2VKRA 4CO0A 2APOA 2DGSA 1JLCB 4GC7A 2OPPA 1XK8A 3MDFA 1T95A 4UQTA 1SKSA 2BKOA 2MKYA 3KJVA 1WSVA 2CXEA 3M05A 3GIMA 4DQSA 3EGZA 3D1QA 2CJXB 2DJWA 4DFJA 2NR0A 3M2UB 4CRJA 2OP5A 4ELVA 1QUPA 1TL3A 4ZVSB 4CO3A 1SB6A 2DNMA 3SSQA 2RSQA 4ANCA 3HT0A 3JSRA 2WW4A 3KUHA 1IKYB 1MWYA 1R0BG 2L08A 2BQUA 2ZZTA 2OO4A 2YKOA 1C0TB 2H5IB 3PIOQ 1FK9B 1YHQS 1VLOA 1TKZA 4OZ3A 2NLWA 1RHUB 3DHWC 3RB4A 1HBOA 4DV0J 1GQEA 1D8YA 4KPCA 5I3QA 4KHMA 1CS4B 4LUBA 2J9DA 5KOXA 2V4QA 1U1MA 3VGVA 1SIZA 4UZBA 1VQLS 4U7UD 2LXUA 3RU0A 3DLGA 5HVGA 1NJXA 1UKUA 4CZCA 3FBCA 2E5HA 4A8OA 5BJRA 1WC3A 3JSYA 1G3OA 3PDNA 4O3PA 4NE9C 3IR6B 1IKVA 4K50A 4GRSA 4LFCF 3M2RB 1IWGA 3MXHP 1ZTTA 5KFTA 5KFCA 5EN1A 1QAIA 2WHOA 3QATA 4B3SF 2VBXA 1CS4A 1W7WA 2BX6A 2LEBA 1T9VA 3LPEA 2WSFC 3B54A 4Y2KA 1NPPA 1M5HA 1U8WA 1BC6A 4I7FA 1Q7LB 3MZIA 1EX8A 4IG3A 2JLFA 3POTA 3MOJB 2XWXA 4ZCIA 1HARA 5HJYA 4W90B 1EKRA 2JL9A 2WSEC 4O3SA 2CRLA 1ULRA 3DOLA 2HAIA 1QJHA 2NXUA 5BYRA 3D6HB 3TO8A 5KFAA 2M4MA 2V67A 2V8VA 1Y7PA 5KFSA 1F0XA 1MWZA 2N3OA 2GHVC 1I3OB 2GHWA 5IXUA 1TKDA 4N41A 2HEKA 3MEDB 4BWJA 2ZWPA 2QX0A 4EGLA 2D9OA 4HI1A 2GO8A 9ATCB 5AJ3F 1IVZA 1EP4A 1BXNA 4USMA 1FJGJ 1Y3JA 3OTCA 1D09B 2CPZA 4NZ0A 5CCLA 4IFVA 4DR7J 3LP1B 1O0PA 4KHRA 5H9FJ 3C6TB 4ED3A 1U1LA 2RQCA 3EYZA 6FDRA 2NZCA 1X4EA 1Y0HA 1U24A 2CQ3A 2JFDA 2K06A 4LSNB 3VVUA 3T41A 1QM9A 1OYDA 4LF1A 4OYPA 3MEDA 3ZZUA 3O2IA 4KR0B 3GFHA 2ZHAA 4LF4F 2I8EA 1S1UB 2FVPA 4KGMA 1N33J 1X0PA 1N0VC 3VAIA 4R5PB 3VGUA 3BR8A 5HO4A 4USWA 2ZH3A 4PEOA 1Z2LA 3EUNA 1IM4A 2FJEB 3QGGA 5E5NA 4X65J 4DF4A 3GQCA 3IS9A 3I0RB 2CIMA 4KC5A 2Z2ZA 1XERA 2LLZA 3GR1A 2XGPA 2DR9A 1GX6A 5A2QU 5J2PA 4K4YA 4Z2XA 3LAKA 4X66J 5HP1A 1NNDA 1UVKA 4DZ6A 2XQCA 1UWBB 4IRCA 1WC4A 4PQAA 1PSDA 1K44A 2D7SA 1TR0A 3OT9A 4TN2A 4DV5J 1U0HB 4OLOA 2HGLA 5KG3A 2W9BA 5KT3A 2FJVA 4G1IA 1FRIA 1IKVB 1S1VA 3QWPA 2C2EA 1NJYA 2QRRA 1VBKA 3AHPA 2VV5A 2VB6A 4K8RA 3M2VB 3GIKA 3PTWA 3CCVS 1MROB 2XYPB 1YBUA 3DLGB 2FLOA 4IRDA 1ELOA 3HHEA 4DL2A 4L3KA 1AA1B 4CIOA 1T03B 1N32J 2RUGA 2RKIA 1FNOA 5AXMA 3I6PA 5KFQA 5L46A 5ETTA 3OHBA 1UMJA 3F0NA 1XMOF 2XG8A 1Q86T 3TARA 1FK9A 2P9CA 1NDPA 2H65B 2AV5A 4USKA 1C0TA 2W2NP 3HHLA 2J0SD 2IDEA 1WD6A 2AGOA 3A8JA 2DNZA 1P9QC 3EJMA 3M2VA 8RUCA 4QWDA 3TAMA 3I5CA 2J0QD 1IBMF 1WG4A 4DR5F 4DX8H 1QE1B 3E3XA 4MYTA 4NEZA 3TJ9A 1QUVA 1DRZA 3MR2A 3FCHA 1MWQA 5KFLA 2ZVSA 4P2XA 3I5BA 1M5OC 4I7FB 1UWBA 1XMQF 2XS7A 3VVTA 5A8WA 3G6YA 2OEJA 5HJXA 2VFUA 2DR8A 2DITA 2BRKA 1SH2A 5J2PB 1NDCA 2UVUA 3TVKA 4F2SA 3HHLC 4K4XA 1YVFA 2IJNA 2KYXA 2IYGA 2KI2A 4G3IA 3MR7A 1Q81T 4WFAQ 3D1OA 3UFCX 1TTHB 3EZUA 4R5PA 4H4MB 3G6VA 2DR7A 5FLXY 4HHUA 4OQJA 1EZZB 2XHWA 1KC8T 5B09A 1SBRA 3GWCA 3UVJA 4OFZA 2DRDA 1OMSA 4C8NA 1RTJB 3OPKA 4A48A 4K59A 2K1RA 2WVCA 4QPXA 1BD6A 3MM7A 3UR0A 3IRXA 4P71A 4K0KF 4C11A 3TZXA 4F36A 2AYMA 2HVDA 4LFAJ 4ZMMA 3OTOJ 1IM6A 2GV1A 1XEZA 2FJWA 2YWHA 5I42B 3IWLA 3NS6A 1FFSB 4QW9A 3TAPA 3WIUA 5KFEA 1EJ7L 1FTRA 2MSTA 2CUYA 1FWLA 4DV2F 5CH7B 3UD4P 1S9FA 4OYIA 3CDBA 4ZPWR 1ZZFA 3CT9A 4CLLA 4UUWA 1YZ6A 1ICEB 4I1TA 3SCLE 4USTA 1RWPB 4ZP8A 3TYTA 2JWNA 2CDQA 3DOLB 3QGHA 2OPPB 3KLGB 3WC0A 4LR8A 3W5XA 5GVQA 2B7CB 2GAHC 2R8IA 3HSJA 4ID5A 3M1VA 2DGTA 4LSLB 4KY3A 3RB0A 3JTOA 1RT6A 1Q0NA 4O44B 2UXDJ 2NCKL 3KXDA 2MZQA 5A8KB 2ZC4A 2CG4A 1N4LA 2VD3A 4CLWA 3MEGA 4IR1A 4JI0J 3PXGa 4LF9F 1SJ4P 4IFYA 1HHQA 3DDKA 4AXIA 2JNJA 3M8QA 4IDKA 1UZHA 4CLZA 1TV6B 3MTKA 4LJMA 2GX8A 1WC5A 3CJ4A 2F1FA 2IVFB 3EPIA 2Y1JA 2GO9A 2M2BA 4I2QB 1RDRA 2MHEA 1JLGA 1UJ5A 2VF3A 2ZD1A 3U7JA 4B08A 4F0MA 2JVOA 4RUCA 4HACA 4KFBA 3A4TA 3VF0B 1VHFA 4NZ7A 3MM9B 1OWXA 2VKZG 4A4JA 5DLFA 2HFUA 3MM5A 2EWHA 3EXCX 2R7QA 1FRHA 4RBVA 4TLQA 3ENVA 3NAHA 3VCDA 4ZVRB 3JSMB 2HQGA 1HI1A 4CT8A 3AD7C 3OVBA 2W25A 4ED0A 1HR0J 5JJBA 1H38A 2CAJA 1H7XA 5KFMA 3GCWP 1H74A 2QTWA 5F41A 2E1PA 2RHSB 4X4QA 1RT2A 3KLEA 2YWWA 3LGMA 4J9SA 1Q1KA 4LFBJ 3QGPA 4E0DA 2MZJA 2MLZA 4Y0FA 1TZ0A 2RF2A 1S57A 5L39A 2KG0A 2VH7A 2AGPA 4JUZA 4EYIB 4WFBQ 1R0AB 4M63A 4C0BA 3M9NB 1Y3KA 5HL7Q 3MURP 1KVKA 1KBRA 3RR8A 1RB0A 1J5OA 3O5TB 1CEZA 4GMKA 2PGCA 2QL9B 4DS5A 2R7SA 4DCPB 1B0TA 1JIHA 2EEYA 4GO7X 4IG0B 4IKAA 1N5YB 4OZLA 2ZH7A 4JI8J 1VHIA 3EMTA 4NLUA 1NPKA 3THVA 2XMVA 4FBUA 1TUVA 4WKYA 4OYOA 2QYCA 4FXDA 1BQMA 1DTTA 2M88A 5K20B 2MGZA 1BQNB 2NUHA 2ZOFA 4DV2J 2MMYA 3NCPA 1NKCA 1DQAA 4ECXA 2GFFA 2XS5A 4A8MP 3DDIA 1F9FA 3F56A 1CULA 4CYUA 4NEYA 1PYOB 5KAKA 1YSJA 4UZCA 1RU2A 4CYUB 2BANA 1VRUA 1B99A 3O6QA 5L38A 1JLEB 4B9UA 2HRTA 5IM0B 3RTVA 1TL4A 3IG1A 2PE8A 4LSZB 2ZM6J 1KTQA 1JWWA 2X1AA 2UXDF 4AL5A 1RTHB 1WG5A 3MM6B 4RNNA 1NEEA 1WF2A 2KYZA 2HFSA 3PR4A 4EO8A 4HACB 1X4DA 4KO0B 2G0IA 3BBCA 3D0IE 3VGTA 1LKZA 4ZP6A 1CJKB 1MN9A 2JEJA 4B9VA 2ZH4A 3FSYA 3T3FA 4QU6A 5KFZA 2IBKA 4K4SA 1FE0A 1LV5A 2KRBA 4OI2A 3SEOA 2J6TA 1WOOA 2F8HA 2YX1A 1FDNA 4CNZA 3NCQA 5L1IA 3OVAA 5HVHA 2WVFA 4USUA 2XZTB 2LEPA 2R7XA
chains in the Genus database with same CATH topology
3GFYA 1DQ8A 1FVSA 1VQYA 2A3JA 4BWMA 5A8RB 1REVB 2RS2A 4C8OA 3KLEB 4A47A 1X9MA 4KKOB 4C9DA 2RNEA 3F44A 2R8GA 2DTJA 1HBNA 3N6NA 2FLLA 3QJJA 1GAOA 2ZNYA 1Q4RA 1IKXA 2AYBA 1FKAF 4EEYA 1LWEB 3OSPA 4Q5VA 4DG1B 3KNGA 3I87A 2K7JA 3IBWA 3V4IA 4LVOP 3LANA 1HPZB 2HNYA 1RT3A 5CYQB 5E2QA 3CJKB 4IRCA 3TA1A 1DFDA 1HYSB 3T19A 3PRDA 4DV7F 2KU7A 3SFUA 2JLGA 1U47A 1VQ4S 1KN6A 3CEDA 3K2YA 3DLEA 1D0EA 3NGDA 3T9NA 1ZETA 2R7TA 2BJDA 1U1PA 4WYWA 1X9WA 2GQQA 4DR6F 1HQUA 4I2QA 1L3TA 2CQIA 1J2VA 1A7GE 3EPGA 4RW7A 1JLBA 1N36F 1YRTA 3MECA 2DCUB 1FRLA 4G1QB 4DL0C 4USHA 4ZCLA 4JYAF 2MQQA 4LQ3A 3TR5A 2I2YA 3LW5C 2HHXA 5GAHI 2E5GA 4FF2A 3MAHA 4RW4B 3MUMP 5J2MA 4IOCQ 1KLMA 2VZ9A 3DM2A 2VQFF 1S79A 1BQNA 5KFPA 2IC3A 3QLHA 2QA4S 2UU9F 2BQRA 1LK5A 3EX7B 2HVHA 5DS7A 4OJHA 3MWBA 4L3NA 4NLGA 4FZVA 4WZQA 4QQBA 2HLTA 3BQ1A 5AE2A 3TAMB 3ISZA 5KFKA 2ZZNA 1U1KA 2E9RX 1RI7A 2OMLA 4QR2A 5D4NA 2DK2A 2VUGA 4HT7A 4DMZA 1JMTA 4ZP9A 3QIPA 3J7YU 1R6YA 5I3PA 1VBYA 1J5EF 2PA3A 3OV7A 3MM7B 5KT7A 1YBAA 4ED2A 1FESA 2XLIA 5E3RA 1IXKA 4ZVHA 1LXNA 5GAGU 2Z2LA 4J37A 3MFHA 2BE2A 1U6ZA 3JTNA 5LMUF 2HFZA 5K8OA 1S9EB 3U02A 5JVHQ 3Q8SB 4FXVA 2LQ5A 2ZHBA 3LAMA 2BACA 4H4KA 4V19J 1XWLA 1SL2A 4WKRA 3KK2A 4Q0BA 3BZQA 3IAM9 3FFIB 2AW0A 3K8VA 1YIJS 2Q1LA 4I0WA 3JB9k 1VC0A 4OI3A 2DGWA 3D0GE 2O67A 4IH5A 4YMEA 2WB1D 1RT7B 4QIWD 5E33A 1RA6A 4DV4F 2KHDA 3VR1A 2AX1A 4NLYA 4QWBA 1FDAA 4K4VA 1HBUB 1URRA 1WTFA 2CVEA 4BS2A 4H54A 4CI0B 2CPDA 4I6AA 3CUNA 2CQ2A 2DBBA 4UW2A 5KFVA 4C0OC 4C98A 2GGPA 4B17A 2A10A 1N32F 1JJHA 4TKTA 4ALZA 2KN4A 4ID5B 3LP1A 4YB1P 3L3CA 5L9NA 2HMIB 4R25A 3SFGA 4J9LA 2KT2A 4B9MA 3LP0B 3TW0A 1SJ1A 3BSNA 3MR5A 1WACA 4NLTA 2FY1A 5HMXA 4BC7A 2F4VF 4I6WA 2J6SA 2DT9A 4KPYA 4ECQA 4DUYF 2MKKA 4DLGA 1MW7A 3K5PA 3P3DA 3UDLA 2YH0A 3BR9A 2VL1A 1GXUA 1GT8A 4Y2CA 1VQPS 2W9CA 4DBQA 2MQOA 3CCWA 4B9LA 2W4CA 3BN4A 4ELUA