4O44B

Crystal structure of hiv-1 reverse transcriptase in complex with 4-((4-(mesitylamino)-6-(3-morpholinopropoxy)-1,3,5-triazin-2-yl)amino)benzonitrile (jlj529), a non-nucleoside inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A mechanistic and structural investigation of modified derivatives of the diaryltriazine class of NNRTIs targeting HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 99
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4o44B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44B03
2AGPA 3RB3A 1LWCA 2FVCA 3KHLA 1REVA 5DQIA 4YR0A 4J9OA 2JEFA 4KFBA 4ZHRB 1I6JA 1RT7A 4KV8B 4RU9A 2IC3B 3DMJB 1N6QB 4QWBA 1TL1B 4J9KA 3H2LA 4KKOB 4QW8A 4DL5A 5DGAA 3LANA 2QE5A 2J6SA 2RF2B 2WONA 3G6VA 1T03A 3DLEA 1S6QA 2D41A 2HWHA 3CJ0A 4RW9B 1ZTWA 3M8PA 3MFIA 4ECXA 2DPIA 4U7CA 4J9LA 4EEYA 3V6DB 4MK7A 3N6NA 1N5YA 1WNEA 4B3OA 3HVTA 3FQLA 1C1BA 4F50A 2W7OA 2B5JA 2XC9A 1HARA 1VRTA 2GC8A 5HP1B 4NLOA 1FKOB 3EPIA 4DL3A 5C24B 3KK1B 4KBIA 2V0NA 3GV7B 3NMAA 5KFDA 3BREA 4K4XA 4QWEA 4RW7A 2R2SA 3MR6A 3PW2A 3UPFA 5CYQB 2IM1A 1RT4B 5F8LA 5KT4A 3OLBA 4LSLB 4ZMMA 4ECYA 5KG4A 4QWDA 1HMVB 5KT3A 4WFXA 3CIZA 4R5PB 4IRKA 4WZMA 3BSCA 4YMEA 1RT1B 4K4SA 3PW0A 4ZPDA 4O3QA 4ICLB 3BSAA 4YR2A 3QYYA 5KFAA 2WTFA 5F9NA 3OSNA 3TQ1A 4QWAA 4EO8A 3NBPB 1TV6A 5KFHA 4MFBB 1IKXA 2IJNA 3I5BA 2ASDA 4IDKA 4I2QB 2CJQA 3KK3A 4O3PA 2J6TA 4NLGA 2YNIA 4RNMA 4M95A 2IJFA 4DG1A 1VRUB 1RTIA 3IGVA 1S1TB 3NAIA 3UDLA 3LAMA 4QPXA 1NHVA 1IM4A 1JLGB 2ZE2B 2OPQA 2HMIB 4K4ZA 1D1UA 2WHOA 2IBKA 2IMWP 5L1LA 2GIRA 4EYHB 1RTDA 3RBEA 4I2PA 1S1VA 1C0TA 4DL4A 2BRKA 1JKHB 1EP4B 4I7FB 1FK9A 1S4FA 3QLHB 1IKVA 1TKZB 2BANA 2UVWA 2I5JA 3JYTB 4RNHA 3H5YA 2HWIA 5F8GA 2OPSA 1DTTB 4IG0A 4O3RA 1TVRA 2E9ZA 3IG1B 2VG5B 3FQKA 5HBMA 2ATLA 1RT5A 3TVKA 3E01A 5DG8A 4ECRA 3T5JA 1N48A 3N6LA 1HNIA 3LP0B 4NYZA 4ECQA 3MF5A 1T05B 5KFEA 5DG7A 4ED7A 2UVUA 3DYAA 3BQ2A 5EWGA 4PUOB 4Q0BB 2B43A 3MECA 3FSIA 5J2NB 2YKNA 3HKWA 5KFKA 2AX0A 2HNYA 3H5XA 1RT2A 1OS5A 4IG3A 3CWJA 4Y34A 4J9MA 2VG6A 5CYMB 3T1AA 3DM2B 1LW2B 2OH2A 5KG2A 1TP7A 2WB4A 4MKBA 1ZETA 1S1XA 1CSJA 4IRCA 4NLSA 3GV5B 2ZKUA 1JXLA 3V81B 1SV5A 4NRTA 1LW2A 4KHRA 2JC0A 2R8IA 1JIHA 3DM2A 2VG7A 4ECUA 4IRDA 5CYMA 2VG6B 2BE2A 4H4MA 2WRMA 1RT2B 4LSNB 2YNFA 2C2DA 2YKNB 2FJVA 5KFFA 3DRSA 1C1CB 3QIPB 4RNFA 2V4RA 1SUQA 3T5HA 4G3IA 4PUOA 4Q0BA 1S6PA 2ZD1A 3D5MA 4Q44A 3TAMA 3KLFA 4NLRA 4ZP8A 1T05A 2W9AA 4F4ZA 4G1QB 4NLPA 1HNIB 3E01B 3LP1A 1XR6A 3IG1A 1JLQA 2OPSB 4IG0B 4RW8B 2FVRA 1GX6A 4WYWA 3KK2B 3ICLA 4ECTA 1TQLA 3CDUA 2JEIA 3HHKA 4Q8FA 1TKXB 5KFCA 4Q8EA 3SFUA 2FJXA 4ZPCA 3MEDA 4JV2A 1C0TB 3DOKA 3MEEB 2OPRB 5HLFB 3KLIB 5C5JA 1RTDB 1ZTTA 3MTKA 1DTQA 2D3UA 2V4QA 1GX5A 2OPQB 5I3UA 3GIMA 4ECZA 2UVVA 5F9LA 3KLEA 1RT3A 1RTIB 2B6AB 5K14B 3KK3B 3GIJA 4I2QA 4IH7A 2J6UA 4MFBA 2W9CB 1RTJA 4ZPAA 3BQ1A 3KLIA 4NLUA 3V6HA 3CDEA 4ZP6A 3BSOA 4R8UB 5KFVA 1S0MA 4WE1B 4TYAA 5C42B 4ED3A 4DL7A 5HROA 1HMVA 2ALZA 3KK2A 4RW8A 1XR7A 5F8MA 1RTJB 3LP1B 2XGQA 5K14A 1MU2A 1JLBA 4DL2A 4HKQA 2B6AA 3FDSA 4RW7B 4RZRA 1D0EA 1JLAA 5KFBA 3NGDA 3PZPA 3QIDA 3OL9A 2AX1A 1SUQB 3GIKA 1RYSA 5I3UB 1EETA 4WFYA 5JUMA 2AU0A 5C24A 3MFHA 4XPCA 5KFRA 1DTQB 3JSMB 2R8JA 4MK9A 1VRTB 4H4MB 5KFNA 3QGIA 1S0NA 1S1UB 1C1BB 2VG7B 2OPRA 3OL7A 3MEEA 3DOKB 1RA6A 4RNNA 5L1KA 3MEDB 3GIIA 3V81A 3PJXA 4PWDA 2D7SA 5KFOA 1TKXA 4M94A 1RYRA 1S97A 4RW9A 3PW5A 4GC6A 3GV8B 5KFMA 1JLQB 4X2BA 4Q43A 4ZVFA 3DRPB 5KFIA 1RT6A 4XO0A 3I5AA 3TAMB 3KLFB 5T14A 1S6PB 4LQ3A 3DYAB 3MR2A 5EWFA 2BRLA 2W7PA 1RT6B 1JX4A 3LP0A 2YNFB 3DRPA 3KHRA 4ED1A 2ASLA 5HBMB 3DLKA 2VG5A 2FVQA 1N4LA 4TY9A 5JXSA 1DTTA 4K4VA 5KT6A 1UWBB 1IKVB 3QLHA 4H54A 3H5UA 4PWDB 4TXSA 1JLFA 3RAQA 3LALA 5KFZA 4I2PB 1S1UA 3V6JA 1XR5A 3UR0A 2DPJA 2UUWA 2C22A 3JSMA 2VA3A 3KMQA 4WYLA 2HMIA 5J2NA 1EETB 3CJ4A 1JLGA 2ZE2A 4PQUB 3MECB 4ZP9A 4K4YA 1IKWA 1JLAB 5KFWA 1S1TA 4NRUA 5KFPA 1JLBB 1MU2B 1S9FA 2AWZA 3OSPA 4IDKB 4NZ0A 1RT5B 2BQRA 1IKXB 3E51A 5KG3A 1TVRB 4KSEB 3NBPA 4J9NA 4ED0A 3JYTA 5HROB 5F8HA 4K4WA 2FLLA 2BANB 5C42A 1TKZA 4IH5A 4YQWA 4EBCA 4WE1A 1FK9B 3M9MB 2R8HA 4EBEA 3H40A 1TL3B 3I0SA 4Y2AA 4R5PA 5KFJA 1JKHA 4R8UA 2XCPA 4URSA 1RTHA 4ED8A 2CKWA 3BR9A 3C6UA 1RDRA 2W9CA 2V9WA 3ISND 5C25B 1RT4A 5KFUA 5L1IA 3T5LA 4F4WA 3ITHB 1HYSA 3CO9A 3SI8A 3DOLA 3D28A 1RT3B 2XI2A 3OLAA 3KLEB 4Q45A 4DG1B 4J9SA 3KK1A 3DDKA 4KB7A 3MR5A 3RAXA 1FKOA 3KLVA 3PHEA 4JV0A 4EO6A 2RDJA 2JLEA 3V4IA 2O5DA 2XI3A 3CVKA 5HLFA 2XGPA 5I42A 5KFYA 4B3OB 3PR5B 4EBDA 3V6DA 1N56A 2EC0A 1T03B 1JLEB 1HQUB 1KHVA 3RB6A 2E9TA 3H5SA 3NL0A 5KFLA 4K4TA 4KKOA 5KFGA 4QW9A 1TL1A 3OHBA 5D3GB 2IC3A 3G6XA 1W25A 4IR1A 4G1QA 5DG9A 3SFGA 5F8NA 4ZPBA 4TQSA 2IA6A 1QUVA 2ZD1B 4GC7A 4XPEA 5DQGA 3NAHA 5EUHA 1LWCB 2GIQA 1C1CA 3DRSB 3QIPA 2ILYA 4OL8A 1RAJA 4LSNA 5KFXA 3FFIB 1TKTB 3PR4A 2IM0A 2BE2B 1QAIA 2B5JB 4Y3CA 4FBUA 2HNDB 4MKAA 4ED6A 4O4RA 3HVAA 4MIAA 4RW4A 4RUAA 1N5YB 1SV5B 2I1RA 5KG5A 1KLMB 4J9QA 2BQ3A 3KLHA 2HNZB 1S1XB 3M8PB 4URQU 4YR3A 2C2EA 1NNDA 4F4XA 3DLEB 1HQEA 2OPPB 4DEZA 4TQRA 5J2QA 3LP2B 2FLPA 3H4BA 3I5CA 4IG3B 3DMJA 1N6QA 1K1SA 1S1WB 1RT7B 2HNYB 4KV8A 2FJWA 2FVSA 1RA7A 4ZP7A 4ZHRA 3M9NB 5FDLB 3GYNA 1MMLA 4U6PA 1JLCB 2W8KA 4URGA 4JV1A 1Z4UA 1J5OA 3EZUA 2JEJA 4TY8B 3LAKA 4QWCA 3FRZA 4YP3A 4FBTA 4RW6A 1BQMB 4KO0B 4NCGB 4IH6A 4ECVA 3DRRB 2E9RX 2I5JB 1LW0B 3C6TA 3KHGA 4ED2A 4ZVHA 2W8LA 5J2PB 4R0EA 2YNHA 1R0AB 3BSNA 1S0OA 2XCAA 4NLTA 1EP4A 4I7FA 3KHHA 3V6KA 1BQNA 2YKMB 3IS9B 2AQ4A 1S1VB 3MEGA 3DRRA 4ID5A 4TLRA 4HYKA 2AGQA 1BQMA 1HPZA 4KO0A 4NCGA 3CJ3A 3PVXA 3KNAA 3RBDA 3NKYA 5DQHA 2BR0A 3I0RB 4TY8A 4TN2A 1J5OB 2JEGA 2IM3A 5J1EB 4O44B 1K1QA 3CJ2A 1JLCA 1VRUA 5KT5A 4O3NA 2YNIB 4NLDA 4WXOA 2AGOA 1S9GB 2IAJA 1S1WA 4WFZA 3QZ8A 3DLGA 1DLOA 1YVFA 3KJVB 1HNVA 1TV6B 4RNOA 2BQUA 3Q8SB 3OL8A 2OPPA 3G86A 5KG1A 3N6MA 3IRXA 4ICLA 4H4OA 2W9BA 4O4GB 2RKIB 1RT1A 5KG6A 2HNZA 4IFVB 4O3OA 4K4UA 3KOAA 1KLMA 3BGRA 3M8QB 2C2RA 4RW4B 5L9XA 3T5KA 2HNDA 2RDIA 1S9EB 1SH3A 1S10A 3QO9A 4IFYB 1KHWA 4ECSA 5KFTA 3FFIA 4LSLA 1S49A 4FS2A 2XWYA 2WOMA 5CYQA 4JUZA 5F8IA 3QZ7A 5DLFA 5DLGA 4K50A 3H98A 1U09A 3MR3A 1QE1A 3RB0A 3EPGA 3Q8PB 5F8JA 4IOBA 4KAIA 4MIBA 3RB4A 1T94A 5HP1A 4RUCA 5D3GA 3G6YA 4IFYA 1S9EA 4MK8A 3HVTB 1S48A 3KLGA 1JLEA 1HQUA 3UQSA 1LWFA 4FS1A 4IFVA 4NLYA 4J9RA 4O4GA 1LWFB 1S6QB 3CJ5A 3KLGB 2WONB 2RF2A 5I42B 2R2UA 4KHMA 4TYBA 2HAIA 3V4IB 4O3SA 3DLGB 2FVPA 1S9GA 4KFBB 3GILA 2ASJA 1QE1B 3OL6A 4WXWA 4DL6A 4O44A 4F4YA 1REVB 3DOLB 3CDWA 1SH0A 2UVRA 3ITHA 1HYSB 3I0RA 2WOMB 4NLQA 5KT7A 5C25A 1FKPB 2YNGA 3KMSA 3VQSA 5KFQA 3H4DA 2WCXA 3C6UB 5KFSA 3QO9B 4ID5B 3MEGB 5EWEA 1RTHB 4LQ9A 5KG0A 4MH8A 3BGRB 3M8QA 2R8KA 1TL3A 3I0SB 5J2MA 4ZVGA 3M9OB 4IR9A 4WZQA 2RKIA 2JC1A 5J2PA 4H4OB 3IRXB 2W9BB 1LW0A 3C6TB 4NLVA 2R2RA 5KT2A 2UUTA 1IKYA 2VA2A 4IQXA 1HNVB 3KJVA 4NLXA 4RW6B 1C0UB 1DLOB 1LWEB 2QV6A 3BJYA 2IAJB 3GQCA 2R8GA 3DI6B 4KE5A 2D3ZA 1SH2A 3H59A 2IM2A 3Q8QB 1NHUA 3BQ0A 2WK4A 5EDWA 4ECWA 1IKWB 5J1EA 4Y2CA 2R2TA 1QAJA 4PQUA 5FDLA 3T19A 2ILZA 3OHAA 2C28A 2FLNA 3QGGA 3DI6A 4IKAA 5KG7A 3ISNC 1C0UA 1LWEA 3IGNA 1HPZB 3LP2A 5J2QB 3PW4A 1IKYB 4ZVEA 4EYIB 3HVWA 1HQEB 3IS9A 3IN5A 1BQNB 2YKMA 1JLFB 3Q8RB 3KLHB 2YNHB 1R0AA 3QGHA 5J2MB 3PW7A 1UWBA 3PJWA 4NLWA 1C2PA 5DGBA 2F8EX 1T3NA 3DLKB 1TKTA 1FKPA 2YNGB 5L1JA 4J9PA
chains in the Genus database with same CATH superfamily
4C3LA 5HK4A 1CJTA 3R6GB 1LWCA 3A8KA 4ZOSA 4LMZA 4CM0A 4YR0A 1N36F 3MR7A 2FGOA 2RVJA 1ZOTA 1LWXA 4KFBA 3N0VA 3VVTA 2VH7A 1M0SA 1NDLA 2CPYA 5AJ3F 3W64A 3HT0A 3H2LA 2RS8A 2B9XA 3MGJA 3LANA 2QE5A 1S7HA 2WONA 3G6VA 4ZVTB 2HWHA 1S6QA 1HBOB 2V8HA 4OYOA 3AA8A 3BPSP 1SI9A 2PMZD 1T11A 4P2MA 5DDRC 3JAMU 3MFIA 2KZMA 3OQ2A 4MK7A 1N5YA 1F1BB 4HACA 3HVTA 2LFVA 3CE8A 3UDVA 2W7OA 4F50A 4JI5J 3G87A 3Q8UA 3IM8A 5AE2A 3FEXB 2CWXA 4RBUA 1RXOB 5A8KB 1VRTA 2GC8A 2VC0A 3AQPA 5CH7B 1FX4A 1FKOB 3HCXA 4RBTA 4ZK7M 4DL3A 1ZM4A 2OAUA 3KK1B 2JX2A 3M4XA 4WTYA 1NK8A 2YVSA 5KFDA 3O8WA 1KNZA 2A0FB 2ZH7A 4BHQA 2H4YB 2R2SA 3POTA 3RRKA 1WC1A 3UFCX 3PW2A 2C2OB 5T41A 5IQ6A 1Q4RA 3GTYX 2ZH9A 4FN5A 1R8BA 1KS2A 4P7TA 2CAJA 2P9CA 4BWMA 4OFZA 3CIZA 4R5PB 1Y3JA 2VQFJ 3QRPA 2IY5B 3BSCA 2CQGA 2CJKA 1QD1A 1HBMA 1N52B 4ZPDA 4O3QA 4YR2A 3QYYA 5F9NA 4B3SJ 3M1VA 3OSNA 3ZTSA 4EO8A 3AOCA 3QMQA 1Q82T 2ASDA 4IDKA 1AUSL 4I2QB 2CJQA 4LBPA 1P9YA 3F56A 3GLJA 4RNMA 2KXNB 4M95A 3KUEA 5M2RA 1RTIA 3VALA 1YIJS 3LAMA 3JTPA 1NHVA 1FA0A 2CQ0A 3N79A 4OHXA 2EFPA 2WSEC 3LWMA 3HD1A 5L1LA 1XMBA 2GIRA 1E6YA 2HPUA 3R3TA 2GO9A 4LIRA 2WVBA 4K8RA 4R0JA 1U47A 3LTOA 4U67Q 2BRKA 4KGMA 3Q83A 1HKAA 4I7FB 3L4BC 4XDDA 1DQ8A 2Z56B 4L3KA 4U8YA 2AF6A 2F4FA 3WHIA 3ETMA 3QLHB 1O6XA 3MPDA 1F9EB 1LK7A 2EBEA 3JYTB 2MKCA 4CO0A 1U49A 2E9ZA 4DMZA 5EN1A 2FD2A 3ILOA 3D4JA 4PG6A 1HI0P 1TFWA 3FQKA 4DR3J 1U1QA 2MDAA 3E01A 2RRBA 3B8HA 4N8NA 2CNOB 2XMUA 3ZTOA 3M6UA 4F67A 1N48A 2UUBJ 4ECQA 3WX8A 2UVUA 5DG7A 1N0VC 2B7CB 4C2MA 4UQTA 1YJUA 3G71S 5ETQA 4ZVRB 2ACMA 2DIUA 4X4OA 4CWBA 3H5XA 1M5HA 3CWJA 4IG3A 1NH8A 2HFOA 2NXCA 4MTPA 1Q79A 2B8QA 2LYVA 4GO7X 5CYMB 4LFAJ 2EK1A 5E2QA 2HHWA 1K0VA 3ZTRA 5HMXA 3QSYB 4Y0FA 1U1KA 4WKYA 2OH2A 3N5FA 2GGPA 4OJ3A 4YEAA 2H65B 1S1XA 2MLZA 2VU5A 4NLSA 3I55S 3RAMA 4NRTA 2JC0A 4WU2A 2VG7A 2R7RA 2ZJPQ 4M5DA 8ATCB 4LF5F 4C7QA 3EZOA 1VQSA 2WSFC 5KFFA 1Q1KA 1S72S 2CZ9A 4ZS6A 3T5HA 5HVHA 3K58A 3PYDA 2ZD1A 3D5MA 3TAMA 1L3UA 2BYCA 1BY9A 3I32A 3K5PA 4FPRA 4CTAB 2F3JA 3J7ZT 5C2GA 3ZZTA 2BJ8A 3UVJB 3IG1A 2FHKA 3ENAA 4RW8B 1GX6A 1X4HA 1WC4A 2K2PA 3AY0A 3ICLA 4YHHF 2GMHA 2ZBQA 2L9WA 2NSCA 3HHKA 4L72B 4Q8FA 4Q8EA 4DR2J 1D8YA 4DUYF 4JV2A 2VPYB 1C0TB 3MEEB 3MMAA 2V6AA 5DDQC 2AJ2A 3KLIB 2VBZA 2F1FA 1SC6A 1B0VA 2B9YA 1RTDB 2W2MP 3DXSX 4DPOA 4Z2XA 1KD1T 1XNQF 4WIQA 2VV5A 4EGLA 1HA1A 2D3UA 4IO9Q 2X3GA 4L6V3 4PYAA 5I3UA 3W1YC 4ECZA 4F26A 4A8KA 2N7CA 3KLEA 4DFKA 1N36J 4CLZA 2BABA 1VBXA 2J5AA 3F41A 4DS4A 3Q2SC 4IH7A 1HI8A 5IFMA 3NMRA 4GO5X 4NCAA 3DDIA 4CM2A 3U7JA 4TU9A 4DV5J 2QA1A 1RBOB 4NLUA 3TEHB 2DO4A 3MCOA 5ETOA 4ZP6A 3BSOA 1F6TA 3UCGA 1FEEA 2MQOA 4WE1B 4TYAA 2VL1A 1P9QC 2ZVIA 4ED3A 1KOOA 1KBRA 1A0OB 5HROA 2DK2A 2RQ4A 2XHCA 3LGHA 4P75A 3SDEB 3HHNB 1XR7A 5F8MA 1UWAA 2C3OA 3B4MA 4RR5A 3LP1B 3L3CA 3TA2A 2IHR1 3GYXB 1MU2A 2JWNA 3PNIA 2Z2LA 4RW7B 2KJWA 1ELOA 1ULRA 3PZPA 2AX1A 1SUQB 3H90A 5I3UB 5JUMA 1KTVA 3CF5Q 1FJGJ 4DOZA 1VQ6S 4JYAJ 4XPCA 3I82A 3G2XA 2QLBB 1VRTB 1W2IA 2W01A 4FPIA 1XMOJ 1MW7A 3QGIA 1AB8A 3HFVA 3SV4A 1X0FA 4M8LA 3OL7A 3AOAA 3DOKB 3ZTQA 3MEDB 4HDHA 3V81A 2NZCA 3D6MB 3RR7A 2QO3A 1UZHA 2HQGA 1Q8BA 5KFOA 1RYRA 4OV1A 2CQ1A 4P2FA 1S97A 3PW5A 1HNZJ 2CIMA 4UQGA 2XY7A 2HHHF 2XYHB 1SIZA 4DSJA 1WACA 3A3NB 1JLQB 1X5SA 3SCIE 3J7AN 2FHJA 2VD3A 2VKRA 2VPWB 2VDIA 3OVSA 1LV5A 1KQGB 1KVKA 1WSVA 2A18A 2P6TA 3DRPB 4TLQA 2KB2A 5KFIA 5B0AA 3VHQA 5CCLA 1NU4A 1ZH5A 1HNXF 5E7OB 3MPUB 1R0BG 4FNIA 1S6PB 5K8OA 5T14A 2YWEA 1WF1A 2LVWA 4ES2A 4ZLPA 4BBYA 4LF6F 4LQ3A 2FY1A 3K0JA 4H4KC 3LUYA 2E7WA 4NEZA 3DRPA 1YZ6A 4Y2KA 4F04B 3SYZA 4M5NA 1U1NA 1W2BR 1F60B 5JXSA 4KC5A 3JAMY 1UA1A 1PYSB 5GAEI 4ZCIA 1IVZA 4ED5A 4K4VA 3WDOA 1C4AA 5B0BA 4C9DA 1RJJA 1FRHA 1FXRA 4C8ZA 3JS9A 3GFXA 3CJ8A 2L48A 1HD0A 4A8YA 1FHTA 4I2PB 4HLBA 3V6JA 3MM7B 2CADA 2KT2A 3VR1A 2DPJA 3UR3C 2QRRA 1WHWA 2DR6A 4WYLA 4AXIA 4ERDA 2HMIA 5SUHA 3M2VB 1FT8A 1VQ8S 3MECB 4MKVA 1SL2A 2DNLA 3GSDA 1S1TA 1WEXA 4LBHA 5KFPA 1VK3A 2Z4PA 3DCAA 1UP1A 2I0XA 4DSEA 1VC5A 2XO7A 2VODA 4X64J 2PN6A 4NZ0A 4AL5A 2BVZA 1MWQA 3E51A 4KSEB 2FLOA 5HVGA 2MGZA 2HZAA 3FVYA 3US5A 1FDNA 4EI2A 4DX6A 3HVRA 4GKJJ 2HHUA 1TKZA 2MB0B 2OFGX 1Y9OA 3M9MB 1TL3B 4Y2AA 2KKHA 4R5PA 1YLXA 2VFUA 3NOCA 3TQEA 4F0HA 3BBFA 3M05A 1TL7B 1HQ2A 2CQCA 2X7IA 3H20A 3TUIC 2BJ7A 4NA1A 2V8VA 5RUBA 4A48A 2HHSA 4AXJA 2V8GA 3CJRA 3ISND 3EVMA 4CYUA 2F63A 4ZITA 1CULA 3ILJA 4F3QA 3DOLA 5A8WA 1RT3B 4TU8A 2UUCJ 1TAUA 4LFBF 3DGPB 4DG1B 3R9LA 3J7YU 3H0PA 4KB7A 1FKOA 2RB7A 3CNQP 2J0WA 4NZ7A 4EO6A 4KH0B 1UETA 1FRJA 2XI3A 2CQ4A 3H42A 5I42A 4OZ1A 3CUNA 1MROA 1H38A 4ATNA 2H48B 1ICEB 2JSXA 1CQMA 3JTOA 3W2VA 3J7YI 5CQGA 3BO2A 1PSDA 1U2RA 1KKHA 2DXFA 2RH3A 5CZVA 1EIYB 2EC0A 3CCVS 1JLEB 1HQUB 1KHVA 1Q53A 3BBBA 2V34A 5LL6d 5EGYA 4KKOA 4ILMA 4X64F 2Q79A 1TL1A 2Q6BA 5HJYA 2KVQE 3NCRA 3UVJA 4QW9A 2IC3A 5D0GA 3SIPB 3OHBA 3IM9A 4IR1A 4I68A 2V50A 2HBRB 5CZXA 4UZBA 3JTNA 3SFGA 6FD1A 2WW4A 1PC5A 1GXUA 4TQSA 2MKKA 2JZ5A 4GC7A 1HNWF 1S0VA 5FJ4A 3GFZA 4AQYF 1LWCB 1WHXA 1XTZA 2CA9A 1C1CA 3DRSB 2G0JA 2EBGA 2GIQA 4OL8A 1RAJA 2ILYA 2OEKA 3J81U 4DV1F 1RE1B 1YBAA 2DNMA 2NXUA 5KFXA 2IBOA 1DBDA 1HBNB 3MM8A 3BYRA 3R7BB 2B5JB 1XIQA 2QLJB 1ZA2B 2XSJB 4HL9A 5JMNA 1X60A 1XEZA 4RW4A 2FPHX 1N5YB 1CBKA 3HVAA 4MIAA 5D0RA 3U1NA 4DL0C 5KG5A 4JI5F 4J9QA 3KLHA 1S1XB 2BUNA 2QFJA 1CJUB 1RZMA 1TL4A 2YX1A 3OBIA 2HVIA 1X4AA 2OPPB 4PAAA 3FSYA 1PBAA 4ZIWA 2GA7A 1DHMA 2YKPA 2BOPA 3I5CA 3TAPA 1U4BA 4ZP7A 4B9TA 1RT7B 2HNYB 2FJWA 4YB6A 2VQEJ 5FDLB 4DR4J 2YWHA 3GYNA 1AFJA 1JLCB 2GW8A 1F0XA 3OR2B 2X3DA 4C0OC 1NK6A 2UUBF 2HIQA 4TY8B 2OP5A 1K9MT 1WC3A 4A8QA 1IQTA 4YP3A 3C15A 4RW6A 2KTQA 4M5LA 3GFHA 1G2EA 4IH6A 1OQ3A 3NRBA 2CJ9A 2E7XA 3DRXA 1LW0B 5AXLA 3KDNA 2KL8A 4P7VA 4EMDA 4DQIA 2E5JA 2YNHA 4DSLA 4ZCLA 3WQPA 1YJ7A 4NLTA 4I7FA 2EFVA 3V6KA 4X4TA 1EB0A 3IS9B 1G4CA 4DHVA 3D6HB 4USVA 1S1VB 1O5JA 3NS6A 5ETVA 1BE4A 2HQDA 3KNAA 1XMQF 3M6XA 1OYDA 4OI6A 3RBDA 2B4UA 1OMSA 1J5OB 2JEGA 4G65A 2IM3A 1TK8A 1R31A 9ATCB 1X4FA 3GB0A 4O3NA 1HWJA 1LFWA 3PDNA 3BDEA 3DC2A 4L3NA 4WXOA 2MKSA 4WFZA 3W2WA 3DLGA 4USHA 1KVJA 1YJRA 4QIFA 3VAGA 2Q66A 3KJVB 1HNVA 2YY3A 4NOHA 3T6BA 1WOOA 2V8PA 4RNOA 1UVLA 3QJLA 3OL8A 2PEHA 3N6MA 3SCJE 3SMZA 1OY9A 4ICLA 4H4OA 2HVZA 2WBMA 2I6WA 2Y3YA 2HURA 5KG6A 3S8SA 2HNZA 4IFVB 3AH6A 5GMDA 3R7SB 3BGRA 3K8WA 4B3MF 5L9XA 4ZJLA 2RDIA 3NGSA 5M2PA 3T5KA 3VAMA 4LREA 1WHYA 4ECSA 4RWWA 1PILA 3ADAC 2P6SA 1N5QA 4LSLA 4HDGA 4OZ3A 4FVCA 5DLGA 1OIAA 2QL9B 1F5BA 4PABA 3BF4A 2ASYA 2K8GA 3M6VA 2AEJA 2F8MA 5IM0A 3QT8A 1QE1A 2LEBA 1IR1A 4CLUA 3EPGA 1A6LA 1KDNA 4IOBA 4KAIA 4MIBA 3CPWR 3RB4A 5HP1A 3PYGA 4RUCA 5D3GA 1IBLJ 3KTQA 1BLUA 4IFYA 1DURA 4NXNF 3J7Z5 1JLEA 1HQUA 1D9FA 2XQCA 3F0NA 3BGLA 1J5EF 3ONQA 1SPBP 2BEFA 2EK6A 4NLYA 1GQEA 1AFIA 3FEYB 1TUGB 4PYDA 2XLIA 1DJ0A 3N5BA 4AYBD 4ZJQA 4QOTA 4EK2A 3IWNC 2RHSB 3W2WB 1T9YA 4KFBB 1RADB 5BYQA 5A2QU 3J81j 3GILA 3OL6A 1YWXA 4CCHA 1UFWA 1ROFA 4JI2J 3H2UB 3ITHA 1K47A 3W8PA 2OJ3A 1HWIA 1NUEA 2MKJA 2B4PA 1FRKA 4N5SA 4DJBA 1UEKA 1AXQA 3M8ZA 4MYTA 3QO9B 1ZBTA 4ELUA 1APSA 3R5CA 2Z58B 3ZTPA 3I0SB 3DHWC 3M9OB 3PIOQ 4LF7F 3KKFA 3RBZA 2R7VA 2JC1A 4ZN3A 2V67A 4DR2F 3PX6A 1LW0A 1H72C 4JV5J 2E7VA 1EJ7L 1R3NA 2J76E 2PDAA 4GRSA 4NLXA 4RW6B 4NX9A 1RHUB 1LWEB 4ZDNA 3TEGA 4XTTA 5ETNA 4A4JA 1HD1A 3D7SB 3TX8A 3MDFA 4FDFA 4ECWA 4OZLA 3TOQA 3G82A 2MQQA 1QAJA 4PQUA 2ZHOA 3M2VA 4I4BA 1P1TA 4QYZJ 1NPPA 1KN6A 2LKZA 3HHLB 3HP6A 1LWEA 3MM5A 5MAOA 4M5JA 3LP2A 3KUGA 3PW4A 1IKYB 2V4JB 2ZBPA 1XMQJ 1TMJA 1Q86T 3HVWA 1T95A 1HQEB 2EXUA 3IS9A 2J9CA 1BQNB 1IM6A 3IN5A 2CQ2A 2HS3A 4NI2B 3N4WA 3VVUA 4I6YA 3PJWA 5FIIA 4DLGA 5DGBA 2NSBA 3GCXP 3L7PA 4U7UK 1FTCA 1YZ7A 1MNEA 3NEKA 4JI8F 4QIVA 2PI5A 3MM8B 4DR1J 4QIEA 4MMOA 2MQMA 3D1HA 3IFEA 2PO4A 4OYIA 3TI0A 2CDRB 2AGPA 3MUTP 3KHLA 2YXLA 1O0PA 3PACA 1FF2A 1DRZA 1QTNB 4I69A 2DISA 3KWMA 1RWVB 1QY7A 4KTQA 1Y7PA 4N56A 4ZHRB 3EUNA 2ERRA 1SJFA 1N34F 3DLHA 1I6JA 4KV8B 3O2IA 3EVWA 4QWBA 4F2SA 2HLTA 4KKOB 3GCWP 5HI7A 2RUSA 4K59A 4QW8A 4DL5A 2XO6A 1VYAA 5DGAA 2RF2B 3I31A 4QR1A 3DGVA 2D41A 2VIHA 2J9DE 4RW9B 1ZTWA 3M8PA 5LMNF 4ECXA 2BDPA 4U7CA 4J9LA 1JJ2R 2YWKA 3V6DB 1MROB 1WNEA 3ILLA 5G0RA 4GKKF 4B3OA 2PA8D 4UZCA 2IYIA 1C1BA 2N3OA 4B9UA 2DKOB 2XC9A 3CCSS 1RUSA 4NLOA 4AUKA 7FDRA 2DGVA 3TZYA 2B8PA 5C24B 3MD1A 3GV7B 4ELTA 3NMAA 3TVYA 3SSRA 3BREA 4K4XA 1B70B 1X4GA 3ET6A 2AV5A 3OTCA 4QWEA 2H3EB 2YPYA 3MR6A 2ZHAA 1CULB 1JJHA 4OJ1A 2J9EA 2J7WA 2IM1A 1RT4B 2HRTA 1RBAA 3AD8C 4OI1A 4LSLB 1SC1B 4CNYA 5K8MA 5KT4A 3OLBA 3CJKB 2HVDA 2HG4A 3KG1A 4ECYA 3G4SS 2HHTA 5D8HB 3X3UA 4OX9F 4B9NA 3T1HF 4C48A 4XK8C 4IRKA 4USMA 5ITHA 3EDQB 4ICLB 1NAQA 2MSSA 3ZZ0A 4YS2A 2CJBA 2PA3A 1RWKB 4E8UA 1SIWB 3L09A 3SCLE 2M9KA 4DQSA 3M8RA 4UY85 1PCAA 2LQ9A 2FC9A 4O3PA 3SCKE 3KK3A 3RG6A 1FVSA 2YNIA 3DU6A 1RK8A 2IJFA 3UDLA 4DV7F 4NXMJ 2XZTB 4QPXA 4CT9A 3VAIA 4ER8A 5IT4A 1VHFA 1IM4A 1NB7A 1JLGB 3BV8A 5DRKA 3BDPA 1U0SA 4KJIA 1RAOA 2WHOA 4K4ZA 1JWWA 3D67A 4KYZA 2MZTA 2R7TA 2EFOA 5HANA 4C98A 4WCEQ 3HPOA 1YK9A 5A2QY 4KGZB 4YY3J 4DL4A 2IRUA 4QJVA 2FJEB 3IWLA 1EP4B 2J0XA 3QJJA 1FK9A 4P2SA 4Y28C 4OLOA 2QGFB 1IKVA 1TKZB 2BANA 1BUXA 2UVWA 2VFRA 2R7OA 4NEYA 1I5OB 1UAWA 4CLYA 1A9NB 4WKRA 4FNHA 2M52A 2OPSA 5GAGU 1SJRA 4O3RA 1U1OA 3IG1B 2C3PA 2DH7A 1RT5A 3TVKA 4DBQA 4X65J 4ECRA 4DFMA 4CH1A 3ZFVA 3VZHA 3MF5A 1T05B 2N4CA 3PRVA 5J1NA 4DN9A 4CIOA 3DYAA 1G7CB 3BQ2A 5EWGA 4OX8A 2ADBA 4PUOB 4Q0BB 3RBXA 5KFKA 4WJBA 2HNYA 4ZVUB 2YKAA 1OS5A 4Y34A 4USIA 1DZ5A 4GMKA 4QIGA 3HHDA 3V5RA 1LW2B 3LGMA 5I3QA 5IT9U 2B56A 1TP7A 5KG2A 4MKBA 4X65F 1ZETA 1CSJA 3PKMA 4N41A 1VR6A 1WI6A 1VOMA 2AHOB 3NCPA 2H5EA 3R5AA 4C8MA 5A0YB 2R8IA 2RU9A 3P49B 2XSJA 4I0WA 5CYMA 4HR2A 2DNQA 4LF2A 2A6OA 2N82B 1BMQB 1RWOB 4HTIA 1ZAVA 5H1SV 3BEGB 2E1AA 3M8WA 3ZNUA 2BJ3A 3DRSA 1C1CB 2CJXB 4RNFA 4G3IA 1U8WA 2ALYB 3UN2A 1S6PA 3NLCA 2U2FA 4ZP8A 4NLRA 4Q2MA 1T05A 1PIEA 2W4PA 5FLXY 4G1QB 1Y00A 4NLPA 2CVIA 1FD2A 2V2QA 1WD6A 4ZLJA 2DH9A 4J37A 3TZZA 1TUVA 3IAS9 1TMMA 1TL5A 2YWFA 1LNQA 2OPSB 1U0HB 5E3CA 2Q3PA 3R1LA 1K0TA 1GXTA 3LF0A 1YRUA 3CDUA 2R7XA 2JEIA 3GSIA 3T1YF 1TKXB 4DWIA 3W5YA 4NXNJ 1QJHA 3I9ZA 2BKNA 2OPRB 2BE7D 1T9UA 2YQ0A 3UCUP 3MOJB 5F0WA 4OYBA 1E6YB 3TR5A 1ZTTA 2QJ3A 2QN6B 2DXEA 3O1LA 3C3LA 1FE4A 4DUTA 2V4QA 4M63A 3TYTA 5E3RA 2UVVA 1MSWD 1SQGA 3JSRA 5F9LA 4DN0A 1FJGF 1NDKA 5GADI 5HATA 2FJBB 2DIVA 1BWVA 1KOHA 2KRBA 4CQ1A 1ZM2A 4DS5A 4I2QA 3QRQA 1SB6A 3D1QA 1Q5YA 1T3OA 4ITSA 2W9CB 3BQ1A 3SDEA 1X4EA 2LP4A 5KFVA 1P1LA 3CCUS 1HHTP 2WBRA 3AFGA 4I6WA 1FVQA 1S0MA 3GIRA 1SKUB 3NY0A 3TO8A 2MKYA 2FQQB 1FESA 5C42B 3DN9A 3BM7A 3ILIA 3M32B 3NGKA 4E2FB 4AE5A 5LSOA 1YITS 4B9LA 2ZM6J 3MI7X 4KPCA 3L7OA 3M7VA 3SBMA 3PTWA 3G8QA 1ZPVA 1RTZA 5K14A 1U1MA 3VAKA 4F2RA 4DL2A 4HKQA 3MAAA 1PJ5A 2RMLA 1JLAA 1VC6A 2POKA 3OL9A 2M3DA 4OYXA 3GIKA 2ZH3A 1RYSA 1EETA 2CQIA 5IWAJ 3E3XA 5GAGI 3MFHA 1TKDA 4YOEA 5CHCB 3D3CJ 3NWRA 3HFKA 4MK9A 3CCMS 2DNPA 4HHUA 1CS4B 4RUBA 1RHQB 2E5GA 2EI5A 2OKQA 3MEEA 4LRDA 4RNNA 1BWEA 3H2VE 3GIIA 2BMBA 1WWHA 3TANA 2QYCA 3RRHA 4B3SF 4RWXA 1BXNA 1HBUA 1Q5VA 2CQDA 3W65A 5CD4A 5FD1A 3C14A 1NHKL 5DDPC 1FJCA 3QPIA 4V19X 3TWZA 3D0HE 1HR0F 1PG5B 1H2TZ 2O01C 4F36A 1WG4A 5I4MA 4JOUA 3I5AA 3TAMB 2ZDPA 4RX6A 2RHQB 2X1FA 5EWFA 2GIFA 5EHHA 4YFUA 2YNFB 1VQYA 3QSIA 3RGIA 2D3OR 2ASLA 3MD3A 4ZKAA 5HBMB 4RKUC 2B4VA 2W2NP 1DTTA 1GNKA 3W63A 5KT6A 4F4KA 3BKFA 5CA5A 1UWBB 2XTJP 2M8DB 3DLJA 3MPVA 4A8FA 2MPUA 4PWDB 4TXSA 1JLFA 3IO1A 3WIVA 3RAQA 2DNGA 3TNVA 3LALA 2V4JA 1CS4A 3KG0A 1EKSA 2UUWA 2X51A 5HVFA 2WSCC 2ZNYA 4DV2F 2L3MA 2C22A 1GK8A 2VA3A 3M2UA 5A76A 3J7A1 2W1BA 3OT9A 1JLGA 2WAQD 4HTJA 1SJQA 4OZJA 4K4YA 3R5JB 4KY3A 4QQBA 4CO3A 4WF9Q 1JB0C 2HQIA 2L9DA 1FI4A 4RLEA 2K06A 4ILRA 3CIMA 1JLBB 1T9TA 2DNHA 2HFSA 1FNXH 3AB4B 4AD6A 5A8RB 5JVGQ 1WDDA 4H4KA 3OSPA 3HJFA 1RT5B 1NPKA 4WTOB 4QR2A 2BQRA 2KXFA 2P8IA 2YQ1A 3AODA 2GAGC 5BJRA 5CD4H 2HVHA 2KYZA 5IXUA 2YQ3A 3CSKA 2KU7A 5HROB 3C8YA 4RO0A 2BANB 3W5ZA 3NCQA 4EBCA 1WC6A 1FK9B 4FYVB 3RJMB 2R8HA 3OFEA 1WF0A 4UY8T 3I0SA 1UJ5A 1WELA 1DARA 3HDSA 1JKHA 2D69A 3J80U 3OJUA 2UXDJ 1IR2A 2COLA 3BR9A 3C6UA 1RDRA 4M5HA 3WIUA 5AE1A 2V9WA 2RQCA 1CQNA 1FRLA 5GMEA 4ELVA 5L1IA 5KFUA 3HSGA 4F4WA 4LFBJ 3CO9A 2QMXA 4X4QA 3SI8A 1NPRA 2ATCB 1AUDA 4F3OA 2Z0GA 4HVZA 2XI2A 4JB8B 2UXBJ 2VONA 3KLEB 1N5TA 3K59A 1REGX 4J9SA 3SV3A 1N33F 3EMTA 3DDKA 3MR5A 1X5PA 1RWMB 3N9UC 4N77A 3UNYA 1WG1A 3HHLC 2G0IA 2R9LA 3V4IA 2QSFA 2DEJA 4QPTA 2O5DA 1IR0A 3OVAA 2F4VF 4IYQA 2O3DA 2BV3A 1WKKA 1SL1A 4LRCA 4DR6F 1G6BA 2BZ2A 1T03B 2E9TA 3NL0A 4OX7A 4LFAF 2XNQA 2JHEA 2YTCA 5KFLA 4K4TA 2HFUA 3CD0A 5KFGA 5HSPA 4YN3B 3G6ES 3G6XA 4Q2LA 1YG0A 4QIWD 1LQ9A 1O51A 4JI7F 3N01A 1YJTA 3KJQB 2CPZA 3ZZYA 2RE1A 1EKRA 2D9PA 4OI4A 5IM0B 1QUVA 2ZD1B 1B7YB 4XPEA 1V3RA 1NLKL 1XK8A 4OX6A 5EUHA 4JI1J 4OJGA 2X1AA 3WC0A 3QIPA 5E33A 4Z7YA 1YJ9S 1QSLA 4DR3F 4C8LA 2BKPA 2V2VA 3P5TL 2G2ZA 3TZWA 2GJ2A 1YHQS 2E1MC 4WP3A 3ISZA 3MM6A 3UNGC 2IM0A 5A8KA 2BE2B 2GMLA 4Y3CA 2XZWA 4ED6A 2AD9A 4LR9A 5G0RB 2WB1D 2BQ3A 1U6BA 3W66A 3FMBA 3P45B 2CPJA 4F4XA 3DLEB 3PEHA 3IWXA 2PMWA 5K9FA 4WK3A 3MZIA 4DEZA 4P74A 5J2QA 2MJNA 3LP2B 5LJ3Y 4X84A 3H4BA 2DGOA 1VJWA 3G8TA 2FLPA 3DMJA 1N6QA 3MMJA 4IOAQ 1WHVA 1FEHA 1HNWJ 1M1KT 1QUPA 1GTHA 3ELHA 4CH0S 2KM8B 4C8KA 3P4UB 3ZZZA 3G8SA 4JV1A 2CXEA 3GFYA 1H2UX 1V3SA 2JRSA 2N3LA 3AJ1A 5D0HA 4KO0B 1HFEL 4OZ0A 5HL7Q 4ECVA 4DXLA 2NREA 1H74A 4B9VA 3TJ8A 2E9RX 3C6TA 2WVFA 4ED2A 1WC0A 2CNKB 4ZVHA 2W8LA 2VFSA 4IQMA 4R0EA 4OHZA 1R0AB 4C6AA 3BSNA 1RBLA 4DUYJ 3KHHA 1EP4A 4HH0A 3TA1A 4OLPA 1BQNA 2AQ4A 3PX0A 3QFHA 3IP0A 4M1KA 1X8DA 2R4FA 2DTJA 3D1OA 4TLRA 8RUCA 3BO3A 4HYKA 2AGQA 4KO0A 1P8GA 1IJFB 1TU0B 3HHLA 3P96A 3NKYA 5DQHA 1YJWS 1N8RT 2HBYB 3I0RB 4EZ6A 4TN2A 2F40A 1I94F 3G82B 4NL5A 1KQKA 1TK0A 1K1QA 2ACYA 3CJ2A 2JOQA 1FRMA 4C0BA 1SC4B 1H2VZ 3VGTA 2AGOA 1HWLA 2IAJA 1S1WA 2P5VA 4OYZA 1J2VA 3QZ8A 3G9CA 3PYEA 2QA4G 1RAIB 3M8YA 1TV6B 4AT1B 1RCXB 5F3TA 3PO5A 1JJCB 3CDAA 3Q8SB 1Y3KA 4QYZK 2OPPA 4RL1A 5KG1A 1FNMA 1N5VA 4QBUA 3IRXA 1H73A 3MM9A 4AFFA 4O4GB 4DUZJ 3MCSA 3RW7A 3GQCA 1HW8A 3GU0A 1KLMA 3M8QB 2XSFA 4ANCA 4DZ6A 4CTAA 2DR9A 3RR8A 1SH3A 4ANDA 2XLKA 2GCFA 1HBNA 3CCTA 2MZ1A 3FFIA 2RRAA 2B7BB 2KG1A 4LR8A 3QZ7A 5MLCV 9RUBA 2CPDA 4J90A 4K50A 1S5ZA 1UVKA 1CG2A 3Q89A 1LXNA 3MR3A 4HEA9 2P2CB 3RB0A 3GJQB 3DHXA 5F8JA 2DVIA 1F5CA 1T94A 3NP5A 3MWBA 3OTEA 1B99A 4ZIVA 1BQXA 5HMZA 4JI8J 1XJWB 2ZH8A 1T9VA 1YJVA 2E1RA 2V68A 3LPEA 4MK8A 4ZCKA 3HVTB 4FYDA 5ETMA 1ITPA 1MWYA 3JQMA 1LWFA 1X9SA 2I2YA 4QCLA 4FS1A 4IFVA 3P5BP 1JJ4A 1OWXA 4LR7A 1S6QB 1HBOA 2QLFB 2XHWA 3KLGB 5EX0A 3B82A 2VOOA 1BD6A 4TYBA 2H4WB 3HHEA 4OZNA 1QVFR 3MAQA 3DLGB 1LK5A 3BKTA 3EJMA 3O44A 1S9GA 4DI6A 1KC8T 3HT3A 1QE1B 2NUUG 3TARA 1GMVA 4F4YA 5CXTA 3DOLB 5A8WB 1XC9A 1HR0J 1BC6A 1HYSB 4I64A 3DLLQ 2RSQA 2BW2A 2RAQA 5C25A 4DR7J 3VQSA 3B6BA 2DGWA 3GR0A 2F8HA 4F3MA 3C6UB 5KFQA 4USUA 1TFYA 1Y10A 3OV7A 1RTHB 5KG0A 4NCBA 4ZVGA 4IR9A 4WZQA 1GMUA 4PG7A 2Z2ZA 3C6TB 2XULA 2MZJA 2E29A 4K2XA 2UUTA 1IKYA 2F7VA 3DLBA 1HNVB 3KJVA 2ZWOA 2LA6A 1DLOB 2GVDB 3BJYA 2IAJB 2MZSA 1IBMF 1VIOA 3UD5A 3TP2A 1RHJB 4NA2A 4F25A 1KWMA 2DGSA 2NYHA 2KM8C 4JBCA 4UF4A 5EDWA 1IKWB 3W9HA 1GH8A 2OELA 1SJ1A 3FCHA 3OHAA 2XS5A 3QGGA 2IFXA 2CPHA 3MURP 3RYLA 3ISNC 1N0UA 3K5NA 3A12A 3QQCD 3CW2C 3MM7A 4ES1A 3BN4A 4FXVA 2OUGA 3FBFA 3VTIA 4EYIB 2B3TB 4WP8A 2FC8A 2YKMA 3Q8RB 1WF2A 1ZYQA 4FF4A 4GKKJ 3UD3P 3PW7A 3QGHA 5J2MB 2DCUB 2M2BA 4LRFA 2RS2A 1C2PA 3E2EA 2KHDA 4NYPA 3OXLA 1VMBA 3IBCB 1T3NA 1AT1B 3H25A 2PMHA 3MM6B 1OSDA 1IBKJ 4CLTA 1B3TA 4C11A 3RB3A 4JI3J 5DQIA 2BACA 4B9MA 4B3RF 1L3VA 4WFBQ 5D15A 1JK9B 4X4SA 4J9OA 5C7PA 2JEFA 2A2DA 1KEKA 3CXCR 3TUJC 3TUZC 2IC3B 3DMJB 1N6QB 2K7JA 3AB2B 1OPIA 2GZOA 4NWBA 1DAXA 4Q5VA 2J6SA 2NPFA 3GR1A 2DNZA 5L38A 3DLEA 2OMOA 3CJ0A 1MG7A 2B51A 2HQFA 2DPIA 3JXOA 4LF1A 4DV4J 6FDRA 2DHSA 3N6NA 4TU7A 1SKRA 3UCZP 5L8RC 3NNCA 3FQLA 1B7FA 4FYWB 4EFAC 4OYPA 5IV3A 2QA2A 2BA9A 4BWJA 2ADCA 3L9ZA 5HP1B 2RRNA 3EPIA 4UTGA 1GT8A 2KYXA 2IVYA 4KBIA 2J8AA 2V0NA 4PXBA 1UVJA 2LLZA 2QIFA 2FHOB 1Q81T 1E6VA 1RAHB 4FF2A 4RW7A 1NJXA 1L3KA 5HQLA 3HMJG 1JMTA 1HI1A 4CLFA 3UPFA 4X4UA 2X1BA 3BGUA 3W8GA 4X4PA 1FWPA 1YKWA 4ETXA 1U1PA 4ZMMA 2KO1A 1IBMJ 3R5BA 1IJEB 5K8PA 3PXGa 5D4OA 1X9MA 5KG4A 2JH3A 1J27A 1G3OA 2VBWA 1HMVB 2IRYA 1RHKB 2Y0SD 4HHJA 2W4CA 4WFXA 4QWDA 2E5LF 3C16A 2PGCA 1EX8A 5ETSA 1HNZF 1RT1B 4CLPA 5SZTA 2NXEA 3BSAA 3MM9B 3TJAA 3U27A 2CG8A 2WTFA 3PW0A 1EQ0A 2FHMA 3TQ1A 4QWAA 2ZKTA 5THWA 3GONA 1H3DA 1TV6A 3T1HJ 1U2FA 2HVEA 2EFQA 2H1YA 2ZDOA 2J6TA 4NLGA 1UVMA 4OV6A 1S1TB 2HK3A 4PPZA 4JI2F 1VDHA 3WBZA 4TKTA 4FYXB 2HMIB 5L1KA 5HAOA 4PR6A 5IZHA 4EYHB 3KJFB 4GVBB 4DX5A 3OTOJ 3RBEA 1F9FA 4I2PA 1R8PA 2DHGA 1S1VA 2NS1B 1C0TA 3MMAB 5IC6B 1JKHB 3GJTB 2XNRA 4YUDA 2Y8YA 2VC1A 3CD6S 2DO0A 1DY3A 2YPZA 2UP1A 2I5JA 1V3ZA 2OSRA 2HWIA 5F8GA 4IG0A 1VIXA 4O0NA 2VG5B 4BC7A 2ATLA 1AZSA 2OD6A 2HRYA 3T5JA 1D8ZA 1UJ4A 3N6LA 4M5MA 1HNIA 2HSEB 3BGFA 5A8RA 2EW9A 2ZVSA 4JP8A 1VQKS 4CLSA 4ED7A 2HZVA 3AAWB 4PXCA 2QT7A 4UT4A 1SQEA 2DITA 3MECA 2DXDA 2G13A 2W2OP 3DFEA 4OQJA 1UA0A 5J2NB 3J81Y 4USJC 5D77A 2DT9A 2AX0A 2DRDA 2QSWA 3BKUA 3Q0AA 3R1HA 1B4SA 5T7LB 1SJ3P 4N76A 2OMLA 2ZM6F 4J9MA 3A3OB 2HHHJ 2VG6A 2CDQA 4J5OA 3DM2B 4U8VA 1ZZFA 3FSXA 5B0CA 1VQ7S 3FNNA 1NK7A 5ETPA 3THPA 3EICA 2C2ZB 2WB4A 5D78A 3SEOA 2V2ZA 2Z2YB 1HHQA 4FKYA 3GV5B 2OLWA 4B3MJ 4IRCA 2V63A 1NKEA 3V81B 1SV5A 2V9KA 5E5NA 2ZJRQ 4KHRA 5AXKA 2CPIA 3CCRS 2GS8A 3DM2A 1X7VA 4DUZF 4ECUA 1K8AT 4C8NA 4C8OA 4IRDA 2RNEA 2VG6B 1NEEA 2C3MA 3BS9A 3D66A 3FCWA 4H4MA 2WRMA 1T8EA 1KFSA 2YX7A 1RT2B 1X5TA 2HBZB 1N33J 4LSNB 2C2DA 1TUWA 2YKNB 2UU9F 3QIPB 4I56A 4L76A 4L74A 2V4RA 1SUQA 2FGCA 4NYOA 1K73T 2BJDA 3M6WA 1U48A 4DF4A 2UUAJ 4CO4A 3KLFA 2H5IB 2M8HA 1FE0A 4F4ZA 5C2CA 1N5SA 1U7LA 1CC7A 3E01B 1XR6A 1M5SA 4KPYA 1S57A 4M5KA 1HL6A 3PJ9A 4IG0B 2FVRA 2M70A 4WYWA 3KK2B 2VBYA 1TQLA 2MXYA 2JVOA 2Q1LA 4YB7A 3M30A 3SFUA 3W2VB 2FJXA 5AT1B 3MEDA 4DV6J 4JI4F 1NSKL 3J80Y 5HLFB 3L7UA 3LO3A 4LT6A 3EXYA 5C5JA 3MTKA 2J7UA 1LFPA 3OUYA 3HZEA 2AZ3A 1FXLA 2FUG9 3KFWX 2LQ8A 4B3RJ 3GIMA 4OYAA 1ZA1B 5HO4A 3TUPA 1DQ9A 3LGNA 4J91A 2B6AB 4A8WA 5K14B 1VHIA 3GIJA 2JFDA 4BLGA 2J6UA 4Q7AA 2EFNA 3OUYB 1UEVA 3PYFA 2LQ5A 1RTJA 2IYGA 4QR0A 3R27A 3KLIA 4DPYA 3MHYA 3V6HA 1TL7A 1UPPA 3M1VB 5F41A 1RWPB 4HI1A 3M32A 3ZC4A 2L08A 2NUHA 1U2CA 4R8UB 4PRFA 3DU5A 2KH9A 4FKXA 3A1YG 1RWUA 1Q8KA 4L73A 2D9OA 3M2RB 4C4WA 1HMVA 2ALZA 3HI9A 2E66A 3MPWA 3AOBA 3PFOA 3QRRA 1WUUA 5L46A 1S59A 2EEYA 2FTRA 4N8OA 4P2XA 3CJKA 2VBXA 1F3VA 3PY8A 1JLBA 1Q95G 4PG5A 4WIIA 4JI6F 2B6AA 3R2DJ 4KRWA 3IC1A 1D0EA 1Y11A 1I94J 1Y0HA 2LA4A 5KFBA 3NGDA 4ZPWR 1NJIT 3V4MA 3W62A 1PBUA 2AU0A 5C24A 2DYAA 2AJ4A 5KFRA 3K2YA 3T3FA 2LQBA 1DTQB 2QMUB 2N7YA 2R8JA 3GJRB 1S0NA 1LEOA 1CC8A 3NS7B 4IUFA 1C1BB 3FGVA 3DXBA 1SJ4P 1XNQJ 2MKIA 2E1CA 4DLEA 3I56S 2KT3A 2HGNA 1GTEA 1TKXA 3X1LB 2BJ9A 1M5OC 2OD4A 2DGUA 2QL5B 3EX7B 2OHDA 2DNNA 5KFMA 1UMJA 2IVMA 3R5DA 3QT6A 3F73A 2Y1IA 4Q43A 4X2BA 4DU8A 2F4VJ 1U24A 4J7CA 5GAEU 3EVOA 3W61A 1WJ9A 4DX7A 1YDLA 2CG4A 2HAFA 2HGMA 4DR5F 3R8YA 3DYAB 2A3JA 4P9SA 2W7PA 3IR7B 2LXFA 4LJMA 1M1GA 1RT6B 3QFWA 5HMYA 1JX4A 3A4TA 3LP0A 3KHRA 1N32F 3I9V9 1NSQA 5BR8F 2CRLA 3JB9k 2FVQA 1N4LA 2YKQA 3GJSB 2CNLB 3ETOA 2IPOB 3C14B 4H54A 3QLHA 2CPEA 2UXDF 2M88A 3H5UA 3MAHA 2LECA 2XMJA 3AJDA 2AJQA 3LA0A 4DV5F 3I6PA 2ZZTA 1QDUB 2DD8S 3CO0P 1S1UA 5LMNJ 1XR5A 2C1EB 3UR0A 3ZZOA 4ZCMA 2D1CA 3HX9A 4DQRA 4Y2MA 1H7XA 1H7WA 3CCQS 1RQ0A 2K7KA 3KMQA 2O67A 3CJ4A 4DSKA 1IKWA 2XLJA 1JLAB 4RUHA 5KFWA 4OI0A 3OVBA 4NRUA 3N28A 2HK2A 3LW5C 2CVEA 4IDKB 3IA0A 1IKXB 8AT1B 4JI0F 1OO0B 1IBKF 1M5KC 3OFHA 3NBPA 4DV6F 2CPXA 4ED0A 4JI4J 3U1LA 2KHCA 1VQ5S 3M2RA 2NXNA 5L9NA 2FLLA 3MOZA 1YBUA 2I38A 4LUBA 4ES3A 2MQLA 3I4PA 4I1TA 4EBEA 1VBYA 3H40A 4OZ2A 3SQGB 1X4CA 2DGXA 2XBPA 3OTBA 2Q6CA 3OXGA 1RTHA 1HWUA 4PKDB 4R8UA 4MYUA 5D0EA 7FD1A 2CKWA 3WZ0A 5DETA 4YY3F 4ID8A 4B08A 1R43A 2MHEA 4WU3A 5IV4A 3T5LA 4F02A 3ITHB 1VRQC 1IWGA 3AXKA 1CJVB 2CQHA 3D28A 3UWTA 4DV3J 1QSSA 3OLAA 2E5IA 5K5MA 2IMOA 4Q45A 2G2YA 4ALZA 2QTWA 4DCJB 3RAXA 4NXMF 3A3PB 2JFKA 4PZVA 3DNCA 1OJ4A 4DV0F 1R6YA 2JLEA 4BS2A 2C2KB 1BGXT 3KG4A 5HLFA 2HZCA 2RD5C 4OIXA 3PR5B 4B3OB 2XGPA 4EBDA 3B78A 2V69A 1WG5A 5CYJA 1T9WA 4U95A 3SZ2A 3WC2A 3RB6A 1NJZA 4W90B 3AD9C 1M5VC 3MEKA 4USKA 1UEUA 1ZS6A 3C46A 4OX9J 1WOSA 1R7IA 1FXDA 5D3GB 2M7SA 2XMTA 4DQQA 1CPZA 1QSYA 3OFFA 3ZO7A 1CJKB 1XMOF 2RIJA 5DG9A 1JXVA 5F8NA 3POTB 1RSCA 3BH7B 5E3QA 5BXIA 1PC4A 5DQGA 1RKIA 3VGVA 4QU7A 2FDNA 5CAAA 1SQFA 4LSNA 3NS5A 2GHPA 1ZM3A 2EFGA 4ZLNA 3PR4A 2KFZA 1UCNA 1KR4A 1QAIA 3DKDA 3IR5B 2BOAA 4UOCA 4O4RA 5D4LA 2E44A 3O5TB 3HULA 2JL9A 2FB0A 3BGOP 3DDNA 2DY1A 5AE3A 2C2EA 4YR3A 3NGTA 4HT7A 1NNDA 1NXIA 2G2OA 3FBEA 4U7UD 1S77D 2KRRA 2ZNZA 2MY8A 1EHWA 3TW0A 1RGVA 2ROPA 1AROP 5BR8J 3MM5B 4IG3B 4Y2IA 1SXLA 2ZH2A 1K1SA 1S1WB 4KV8A 2FVSA 3QNWB 1RA7A 4P6QA 1VQMS 2CYYA 3KNGA 4B17A 5KAKA 2NLWA 4U6PA 2GQQA 1LKZA 2PE8A 3D3BJ 4K2JA 2W8KA 2DBBA 1UZDA 1DFDA 1Z4UA 4JI7J 1YRTA 2DR8A 1LXJA 3EZUA 4USWA 2NR0A 3LAKA 1FRIA 1VLYA 2I9SA 4QWCA 2XMVA 4PWUA 2ZZNA 3FRZA 1PYTA 4CP5A 4FBTA 4KH1B 2KZZA 1WOPA 2J9DA 4NCGB 4NPOA 2DY9A 3MMCB 1XWLA 1RWWB 2A2CA 2WZ1A 3UW1A 1KP6A 1XNRJ 2CZ4A 3K57A 3C66A 4A8XA 1TELA 2XMKA 2VB6A 1S0OA 1VLOA 3UI3A 4C3KA 4PG4A 5K20B 4V1Ak 2YKMB 2VJUA 2Y1LB 2UV8A 1VBKA 4DV0J 3DRRA 4LVOP 3ENWA 5H9FJ 2OIHA 4NCGA 1HHSA 3TJ9A 1VQOS 3PVXA 1UJ6A 1X9WA 3T9NA 5H9EK 1SKSA 4M5GA 2DHXA 2QMWA 3K7RA 3OFGA 1YRXA 3RTVA 3D6TB 2XYPB 3KJNB 3RU0A 4O44B 1M1HA 2LU1A 1HW9A 1RAAB 2YBVA 1JLCA 4EZ9A 1TK5A 4QZVB 5KT5A 1KFDA 2YNIB 4NLDA 3UDEA 1NK4A 4ZLLA 2WVDA 2IDEA 5LMUJ 4ETZA 3W3SA 4UOGA 1VFJA 1S99A 2JLFA 2QG9B 2VFVA 2PI4A 2JNJA 1NZ8A 4F0MA 2K1RA 2LEAA 4Y65A 5B09A 1HBMB 5LOQA 2W9BA 1C4CA 2RKIB 1RT1A 1I3OB 1RISA 2QLWA 3LQVA 3MMBA 1FCAA 4LVNP 4P72A 4O3OA 3HF5A 2C2RA 3MXHP 1S10A 1WTFA 4V19J 3EYZA 4IFYB 1KHWA 4X62F 2XY6A 1NDCA 3T41A 4FS2A 2DRBA 2EPIA 2WOMA 2QZ8A 2WW8A 2XWYA 5F8IA 2YH1A 3BPDA 4OYWA 5CCMA 4DSFA 1Z1ZA 4ZA1A 3ET6B 3EWGA 3H98A 4K7QA 4WWSA 5IWAF 4BC9A 2VHGA 1VQ4S 3GZ7A 1YTYA 2HW3A 1S4EA 1U6ZA 3CJQA 2ROGA 3D0IE 3Q8PB 3CC4S 1FX2A 4LF8J 2JDJA 4JI6J 4A8MP 2XS2A 3BBCA 2F65A 2VQEF 3G6YA 4B02A 1Y5LB 2MLYA 3FC9A 4DDFA 5LSLA 1VI7A 2BM0A 1S9EA 3HJVA 1L3SA 2VUGA 4D3HA 3FBCA 5GADU 3KLGA 3ZXWA 3HK2A 3UQSA 2Z2MA 3LPYA 2QYGA 2B9WA 2VFTA 3H7HB 3CC7S 2PIIA 3FEZA 3PO4A 1LWFB 2FJAB 2XZDB 2K1RB 3CJ5A 3Q8YA 1R8AA 4DPTA 1FKAF 4FF3A 3HD2A 5HQMA 2R2UA 4P10A 2HQ3A 2APOA 2V5HG 2IDLA 4A8SA 4RJVA 2FVPA 2BM1A 4J9PA 2AZ1A 3CJSA 2UUAF 1NZAA 1FDBA 2DRAA 2K3KA 4WXWA 5LJ5Y 3EZ5A 3VGSA 4ANEA 4DL6A 3THVA 3SXLA 1IQZA 2VKZG 3CDWA 1SH0A 2UVRA 2MMYA 3BH6B 4RBVA 4CNZA 4NLQA 4CYUB 1FKPB 2YNGA 3AJ2A 3KMSA 2VICA 2CQPA 2KDOA 2WCXA 3MEGB 2YWGA 5EWEA 3GWCA 3GPAA 4MH8A 1KVIA 3BGRB 2DCLA 2W2PP 3SQGA 2UUCF 3NWGA 1D9AA 2HRUA 2R8KA 3OD2A 2RKIA 2Y1RI 5J2PA 4H4OB 3IRXB 2YWWA 4X66F 4NLVA 2J0QD 2R2RA 1URNA 2OTJS 1AYEA 2A1BA 2MGZB 3PIPQ 1S7IA 2VA2A 4IQXA 4OHYA 4Y00A 1YBTA 1C0UB 1MMNA 4K5SA 2R8GA 1VISA 2KVIA 1VQNS 1SH2A 3H59A 4J9VA 2IM2A 3Q8QB 1KQSR 4OJHA 2HIYA 2EKNA 4K0KJ 5J1EA 4Y2CA 2R2TA 1QAYA 2GMJA 5FDLA 3T19A 1IWAA 2FJDB 2ILZA 2MLXA 1PJ6A 2CWKA 4IKAA 1FDDA 4EU0A 5HN0A 5KG7A 1FNOA 1H0HB 2GVDA 3RRGA 1C0UA 3IGNA 3TZXA 1HPZB 1T02A 1Z2ZA 2FIUA 4ZVEA 3S1TA 1G1XA 2A6MA 4LRBA 3QAEA 1JLFB 4P73A 3PM9A 2YNHB 2HS0A 1X0PA 2XWXA 3K5LA 1QM9A 3CCWA 3ENQA 1SVDA 1V5VA 4NLWA 3TA0A 2F8EX 2PEBA 3HHLD 2W25A 4KT0C 3MMCA 1IBLF 2QLXA 3DLKB 2I8EA 2HHQA 4LF8F 2ZOFA 4EWTA 5AJ3J 3D68A 5L1JA 2P9EA 3GP9A 4ILLA 2FVCA 3OR2A 2QX0A 1REVA 2MQNA 1AA1B 3GE9A 5H9EJ 1UFKA 1WKJA 3B54A 3EM1A 1QVGR 3Q22A 1RT7A 2PD1A 4RU9A 2MKHA 4C0HA 3D2WA 2GJIA 2AEFA 1TL1B 3W9IA 4J9KA 1FRXA 1MLAA 3QT5A 4DR6J 1T03A 3FKBA 1N54B 1ACMB 5B0DA 2FYXA 3K89A 3AHPA 4EEYA 2VZ9A 4CLKA 1R0CB 4W98A 4O0IA 2U1AA 3CCLS 2HFVA 2B5JA 4B3TF 3CULA 1HARA 2R3VA 2XYGB 4CT8A 3P6YC 1MN9A 2UZAA 4XDCA 1N88A 3P3DA 1TZ0A 2DGQA 1RHRB 5U47A 1VK8A 3TX0A 2GAHC 3FRYA 2GVZB 1NBEB 3FMWA 2ZZMA 3ZNJ1 2HS4A 1RWXB 3MAAB 3Q23A 3MPYA 4KGKA 4LF4J 5F8LA 5CYQB 1B0PA 3KDOA 1HNXJ 1RWNB 1RAFB 5H9FK 3AXMA 4NMLA 5B08A 3FUYA 3W60A 5CABA 1FFSB 2AIRB 1YJNS 4PG8A 1SKWA 1KTQA 5IT9Y 5KT3A 3UD4P 3THTA 5KOXA 2GJFA 2C2MB 1RU1A 4WZMA 1UFLA 4YMEA 2JLGA 4K4SA 1D9DA 5ETKA 1WI8A 2HQCA 2KN4A 4IO1A 1VC0A 3IXQA 3QWPA 5KFAA 1SBRA 3AA9A 4CO5A 3WX4A 2VQFF 3NBPB 2AKWB 5KFHA 2E5LJ 4MFBB 1IKXA 2IJNA 4USTA 4X4VA 2OI2A 2V94A 3I5BA 4DCOB 3U1MA 1WC5A 2JJ4D 3LWLA 1EZZB 2QC3A 4QYRA 4YB1P 2GHWA 3PKYA 4DG1A 1VRUB 2FZCB 3IGVA 3NAIA 1L5UA 3QT7A 4DCPB 1PYOB 3NXZA 1CJVA 4LBIA 2ZE2B 3IBFB 2OPQA 1YGYA 2UXCF 1D1UA 5F3ZA 2IBKA 2ZUGA 2IMWP 3JQJA 2MJUA 4MAKA 1Q78A 4PXEA 4CI0B 1RTDA 1NDPA 2IJRA 1IBCB 1Y5NB 1GMWA 1UTAA 4NE9C 1U1LA 4MT1A 4XAKA 1RAGB 4YDDB 3P8BB 3QAUA 5HJXA 3V2UC 5BYSA 4EUVA 1S4FA 4JYAF 2Z8QA 2YX4A 4HHHA 1RB0A 2H54B 5E3PA 2AJ1A 2KXHA 4RNHA 4ZVQB 3H5YA 4GKJF 1DTTB 1TVRA 2MTLA 3U02A 5HBMA 4G1IA 4DV1J 1IN0A 5DG8A 1NJWA 1GFWB 1VJQA 3UDCA 3LP0B 1PAEX 1RCOB 1U25A 4NYZA 2J7KA 4W4MA 5LXYA 2YH0A 5KFEA 1N34J 2DNYA 3CJTA 4LSZB 3VQTA 3ZZPA 2B43A 1OPZA 3KYLA 1WKLA 2ZC3A 3ULHA 3FSIA 4CRJA 2YKNA 2B4OA 3FJ2A 3HKWA 3A13A 1RT2A 1UW4A 2AMCB 3T1AA 4Z37A 4X66J 1SC3B 3H8YA 4KHPJ 1T9XA 3O6QA 4DR1F 1WORA 2VDHA 5ETLA 5HQ8A 2CJAA 2CPFA 4FVMA 3OJSA 4FXWA 2ZKUA 1JXLA 3OPKA 3MCMA 2VJVA 5DO2A 1LW2A 4AL6A 2O66A 3TVZA 1JIHA 4E0DA 1UVIA 4DQPA 4CH7A 2AT1B 2BE2A 4F4AA 4FYYB 4LF4F 2F5GA 3BR8A 2YNFA 2HHVA 2EG2A 2FJVA 2DR7A 3DOMA 3S6EA 3B4DA 3EE3A 3PEJA 3Q86A 2EC2A 3JQKA 4PUOA 4Q0BA 2ZUAA 4Q44A 2KFNA 3HSJA 3I4HX 4CO2A 2W9AA 5IT0A 2WVEA 2NQPA 1FERA 1CJKA 1NRKA 1HNIB 2X1GA 4PXDA 3UE2A 5E41A 3G96A 4PWWA 3QGPA 3LP1A 2UU9J 4LF9F 4CDIA 1YI2S 2XB2D 1JLQA 2HFZA 3UN5A 2DR5A 2ABYA 1NK0A 1S76D 1Q7YT 1TAQA 4ECTA 1Q16B 3EGVA 4BCAA 3R97A 3FBBA 1KRPA 4CO1A 1X31C 3BZQA 1FJ7A 5KFCA 4ZPCA 4C97A 1Y5IB 2NXJA 3DOKA 4JI0J 2CZVC 1U45A 1FDAA 4ZN1A 4W92B 4GVBA 3O3LA 4E98A 4MJKA 1S12A 1DTQA 1PAUB 1ZAXA 5F0UA 5D4NA 1GX5A 2IVFB 2OPQB 1Q0NA 1RLCL 3DGPA 3ENVA 3CMAS 1RT3A 1RTIB 1R89A 2ZITA 3E8OA 3HZGA 4HT5A 3BN7A 5D4PA 2GV1A 4A46A 1VBZA 2LMIA 3KK3B 3NGRA 2Y8WA 3ZZRA 2MEWA 1SCJB 2ZOMA 2D74B 2IRXA 3CT9A 2Y1JA 4DR4F 2LXUA 4MFBA 2YKOA 3MUMP 4N47A 4ZPAA 3CDEA 5IC4B 1ZZNA 3MCNA 1IUJA 3M30B 4N7TA 3PFEA 4YHHJ 3C16B 3HKZD 4Y6IA 1T0TV 4DL7A 3KK2A 2LCWA 2LU2A 2M5YA 3IMQJ 4RW8A 5BYRA 1U0HA 1RTJB 3OXFA 3W9JA 1KLNA 2L41A 2XGQA 4LFCJ 4A47A 3I96A 1NMEB 2NZ4A 1Z2LA 3FDSA 4RZRA 3NNHA 2LDYA 2VPZB 2V2KA 2UXCJ 3QIDA 4WFNQ 4AQYJ 2ZHBA 4WFYA 3CCZA 2PSZA 3NG8A 1NB2A 4ZPTR 3M2UB 4C8YA 3JSMB 1XQIA 1S79A 2ZH5A 4H4MB 3RW6A 5L39A 5KFNA 5DZ6A 1NCLA 1S1UB 4WFAQ 2VG7B 2OPRA 4X62J 4BDPA 1RA6A 4HACB 2MY7A 4G1PA 1URRA 3EDRB 2E5HA 5DDOC 2BE9B 4M5IA 3PJXA 4PWDA 2D7SA 2VPXB 3S01A 2OTLS 3EGZA 4M94A 4OMFG 1LOUA 2GFFA 4RW9A 1V9OA 2GGPB 2M0GB 4NA3A 2R42A 3AQOA 4UW2A 3BO4A 1OQ6A 2DEIA 2ZH1A 5B0FA 4GC6A 3D0GE 3GV8B 3VAJA 2G0CA 5FLXU 1YSJA 2H5JB 3VZIA 1GMWD 2ROEA 4ZVFA 5T7LA 2CUYA 5DS7A 2MHNA 4F0KA 2JVRA 1Q8IA 2ZWPA 1RT6A 4XO0A 1IXKA 3MTJA 3T9ZA 3KLFB 2SXLA 4I67A 4DSIA 2C3YA 1QLNA 2F9JA 3A8IA 1D09B 2A10A 3MR2A 5GAHU 2BRLA 2V8DA 4C11B 4LFCF 3IBWA 2BW7A 3DOMB 4KGVB 4ED1A 4UOHA 1VQPS 5E3AA 5B0GA 2BX6A 2Z30B 5I3PA 3DLKA 2VG5A 4TY9A 3R2CJ 1I51B 1HWKA 1WEZA 1K44A 5A0YA 3GMGA 1GEHA 3HSDA 5DZ7A 1J5EJ 5G4DA 1IKVB 1R27B 3NOGA 1HBUB 2OEJA 4HI2A 4NI2A 2MYFA 2ZJQQ 1RP5A 4WK1A 2FHJD 3OR1A 4RPFA 2LEPA 5KFZA 4DFJA 3UN3A 3CCJS 2W2QP 4PCQA 1XNRF 5ADZA 4ED4A 4KHPF 4GVLA 4R25A 3JSMA 5IS2A 2G4BA 1V5IB 2XMWA 2HBQB 3CD7A 5J2NA 1S6UA 1EETB 2ZFHA 2ZE2A 4PQUB 3MUVP 4ZP9A 2DH8A 2K3IA 2AJFE 3R5GA 3K5MA 5EX3A 4B9SA 1MU2B 1D3WA 1S9FA 2CJYB 2E1PA 3VGUA 2AWZA 4G6VB 2D3O1 5JJBA 1NK9A 1T7PA 1W7WA 2VASA 4I6AA 5KG3A 1TVRB 2ZH4A 2H51B 1RLDA 4J9NA 4Z7CA 1FTRA 1F9HA 3JYTA 1P27B 3FZ2A 5F8HA 4K4WA 2HFNA 3OW2R 5C42A 4YQWA 4IH5A 2GHVC 4S0MA 3M8SA 3T1YJ 4WE1A 1Y4ZB 2OEMA 1X5OA 2W4DA 3GYGA 4DU7A 2AYBA 5KFJA 4ED8A 2XCPA 3PRBA 4J9UE 4URSA 4DF8A 4P71A 3K8VA 2W9CA 1XN9A 1EARA 4X4RA 4ZPVR 1M5PC 2AW0A 5C25B 2O1PA 1RT4A 1I1GA 2ZH6A 2HYIB 4YB5A 1HYSA 2CQ3A 5DM7Q 1UW9A 2HWTA 3ZZUA 2FY8A 4KIAA 2UXBF 1E6VB 2CNNB 1JNRB 1RACB 4OYMA 4LF6J 2EVZA 4NMXA 3KK1A 2MQ8A 4OZ5A 2Q43A 3W7BA 3PG9A 3KLVA 2OGUA 2F9DA 3PHEA 4JV0A 3KUHA 3S7RA 2WVCA 2RDJA 3PRDA 4OI2A 3CVKA 4NASA 1MWZA 5KFYA 3HM9A 2PFFB 4DPUA 1ZAWA 4WP9A 3V6DA 4JV5F 1MMDA 1UPMB 1N56A 3NNAA 1UL3A 1DQAA 2DNOA 2EG1A 1FWKA 4RU2A 2KI2A 4LF7J 3H5SA 1CVJA 2VF3A 5IOLA 3HSZA 1NO8A 3QWUA 1FWLA 2QA4S 1UVNA 5DM6Q 1SL0A 2Y9HA 1NSPA 2VOPA 1W25A 2NPIA 5LXRA 4G1QA 2ZC4A 4ZPBA 2IA6A 4JI3F 4LIWA 1U6FA 3NAHA 1KSPA 2L9NA 1CJTB 3QBCA 4DV2J 1S6OA 2DHHA 4DV3F 5K8NA 3FFIB 1TKTB 1GXLA 4M5DB 1FD8A 1ZM9A 4FBUA 1PGZA 2HNDB 4MKAA 4O23A 4RUAA 1SV5B 1JXEA 1RU2A 1KLMB 2I1RA 3T6JA 4XIUA 2R7WA 2HNZB 1NKBA 2Z57B 3M8PB 3CD5A 4URQU 4DV4F 2ZBIA 1W26A 4P52A 1HQEA 1FFGB 1RHMB 3CMQA 4FF1A 1P6TA 5J1PA 4TQRA 4KR0B 3Q2TC 1OSCA 2DB1A 1F2HA 2GX8A 5KFSA 2DHAA 3AT1B 4ZHRA 2KJVA 1VQLS 3M9NB 4IOCQ 2ZBCA 1MMLA 1NJYA 4DV7J 4URGA 4L75A 1J5OA 2JEJA 2ZEJA 2GQ2A 4PPDA 1O8BA 2ZBRA 2QL7B 4UUXA 1AZSB 4X4NA 1R6VA 5M2UA 2CFXA 3IRWP 1BQMB 2H9ZA 3CCES 3VAFA 2HEKA 2R7UA 3DRRB 2DJWA 4AL7A 3D54A 2I5JB 1R8HA 4ZVSB 2RU3A 3KHGA 2HHPA 5J2PB 2XEXA 1RKJA 1FO1A 1WSRA 2XCAA 5A6WA 1VQ9S 4LRAA 4OI3A 1M90T 2B0GA 3D9BA 3MEGA 1HIYA 4ID5A 2RJZA 5ETRA 1RAEB 1WEYA 2DGTA 1BQMA 1HPZA 2R7SA 3CDBA 2DNRA 3CJ3A 3IAM9 4DR7F 3HO1A 5GVQA 2BR0A 4C3MA 2PFDA 2Y0BB 4TY8A 2RILA 4NZ6A 5LM7E 3VCDA 3CMES 3CB4A 5J1EB 3Q24A 2LQJA 4A8OA 3NGUA 1N32J 2XMMA 2GO8A 1F5AA 4K5RA 7AT1B 2DNKA 1VRUA 4CLLA 1PKUA 1NKCA 1QTMA 3I87A 2RQKA 1S9GB 2NYIA 1VGYA 3IR6B 3A8EA 5DJBA 1DLOA 1YVFA 2CQBA 5B7WA 4PEOA 4DPXA 1U8SA 6AT1B 1GAOA 2BQUA 4ENOA 1NSAA 1TTHB 3G86A 4FZVA 3W5XA 2HHXA 2KFYA 1WTBA 1CJUA 1VS3A 2FZGB 5AXNA 1OY6A 3KOAA 2P9GA 4RW4B 4QU6A 2HNDA 2BKOA 1S9EB 1ZPWX 3QO9A 3OTDA 2J0SD 4FXDA 4MKYA 5KFTA 2GNKA 1V6HA 2FZKB 2XG8A 3BYPA 2G1HA 1S49A 1EQMA 5A6PA 4F8RA 5CYQA 2C2NA 4JUZA 3SSSA 5DLFA 5HMWA 4ZVPB 2KG0A 1X4DA 1KONA 1NM2A 1U09A 2C3UA 3AD7C 3JSBA 3PV8A 1MN7A 3KXDA 2GVZA 1YQHA 2LXIA 5B0EA 2OFHX 4F7VA 5KTQA 1B64A 1U1RA 2EKYA 2RUGA 2G9OA 1JQGA 3Q8VA 3SQOP 3GG1A 3R7NB 3UO0A 1YX2A 1L3TA 2AYEA 3K5OA 4CZCA 3HLUA 2RQMA 4KGXB 1S48A 4KQZA 4D3GA 4DPWA 3CC2S 1CEZA 2N4DA 1AW0A 2AJ0A 4DFPA 1U02A 3TAQA 2KT5A 2C42A 4O4GA 4J9RA 2PC6A 4UUWA 1Q8LA 1F3FA 4DR5J 2WONB 2RT3A 2RF2A 3FZBA 5I42B 3LH2S 3PHTA 1JNZB 2M4MA 2BJEA 4HH1A 4KHMA 5LMUF 3JSYA 1R8CA 3V4IB 2HAIA 4UOFA 1X4BA 3PX4A 4ZJOA 2QEXS 2AEMA 4LF9J 5E0OA 4O3SA 4U9RA 2XM3A 1NH7A 1H98A 2MZRA 1QAXA 4WPAA 2R7QA 4K0KF 1F2GA 2ASJA 1CLFA 2HKEA 3DRYA 3C19A 4O44A 2IIHA 2OSQA 4JI1F 1REVB 2XS7A 4DX8H 2MSTA 1U26A 2HLUA 1VCTA 1NK5A 3I0RA 1KQFB 2WOMB 5LT5A 1Q7LB 3F44A 4OHVA 5KT7A 2UV8G 2AP6A 4K4UA 1WDTA 3CTRA 3H4DA 2W7AA 3A8JA 3VWSA 2G1DA 2LDIA 4ID5B 1RABB 5JVHQ 3EGWB 2W24A 3K17A 4LQ9A 2MQPA 2AYGA 1UKUA 3M8QA 2XY5A 1TL3A 1EAYC 5J2MA 2B9EA 4PQAA 4TNOA 2AYMA 3BB5A 3MMBB 3SSQA 4DZDA 2W9BB 2BJ1A 4OHWA 5KT2A 3PCOB 3FCVA 1RI7A 4TVAB 3C15B 2QV6A 3EXCX 5D6GA 1XBWA 4CLWA 1OY8A 3DI6B 1FFWB 1TR0A 3D6FB 2D3ZA 4KE5A 3RZAA 3TRGA 2OO4A 1NHUA 3BQ0A 3QJPA 4MIWA 2WK4A 1OYEA 2BBEA 3HFZB 2NCKL 4U96A 5KOWA 2C28A 2FLNA 4WBFA 1B0TA 2ZOGA 3RUBL 2QFIA 3DI6A 2MZQA 3EGNA 2XMAA 2IA0A 5GMKa 5LSRA 4ZVOB 5J2QB 3VV2B 3VF0B 4LF5J 2HGLA 3LOUA 5IQQA 2EWHA 2PT0A 3OR1B 1XERA 1PJ7A 2RDDA 5GAHI 1PO6A 4B3TJ 2GQCA 1HLWA 3KLHB 1R0AA 1H6KX 1UWBA 2BXJA 3C2PA 3OTOF 1A7GE 3L95X 3R6LB 3HXMA 3CEDA 3VAHA 1FJEB 2J8SA 1TKTA 5ETTA 1FKPA 2YNGB 3CGIA 1BHNA 3QATA 4FP9A 3GG0A 4YDXA 5AXMA 3FK4A
chains in the Genus database with same CATH topology
4C3LA 4ZOSA 1LWCA 4LMZA 4YR0A 1N36F 2FGOA 2RVJA 1ZOTA 3N0VA 4KFBA 2VH7A 1M0SA 2CPYA 5AJ3F 3MGJA 3H2LA 2RS8A 2B9XA 3LANA 2QE5A 1S7HA 2WONA 3G6VA 2HWHA 1S6QA 1HBOB 2V8HA 2PMZD 3AA8A 5DDRC 1SI9A 3MFIA 2XY7A 3OQ2A 4MK7A 1N5YA 3HVTA 3CE8A 4F50A 2W7OA 5AE2A 3FEXB 4RBUA 5A8KB 3RW6A 1VRTA 2GC8A 2VC0A 3AQPA 5CH7B 4ZK7M 1FKOB 4RBTA 4DL3A 1ZM4A 2OAUA 3KK1B 2JX2A 3M4XA 4WTYA 1NK8A 2YVSA 5KFDA 3O8WA 1KNZA 2ZH7A 4BHQA 2R2SA 3POTA 3RRKA 3UFCX 3PW2A 5T41A 5IQ6A 1Q4RA 2ZH9A 4FN5A 1R8BA 1KS2A 4P7TA 2P9CA 4BWMA 4OFZA 3CIZA 4R5PB 1Y3JA 3BSCA 2CQGA 2CJKA 1HBMA 1N52B 4ZPDA 4O3QA 4YR2A 3QYYA 5F9NA 3M1VA 3OSNA 4EO8A 3QMQA 1Q82T 2ASDA 4IDKA 4I2QB 2CJQA 3F56A 4RNMA 2KXNB 4M95A 5M2RA 1RTIA 3VALA 1YIJS 3LAMA 3JTPA 1NHVA 1FA0A 2CQ0A 3N79A 4OHXA 2EFPA 2WSEC 3LWMA 5L1LA 1XMBA 2GIRA 1E6YA 2HPUA 3R3TA 2GO9A 4LIRA 1U47A 4R0JA 4U67Q 2BRKA 4KGMA 4I7FB 4XDDA 1DQ8A 4DR5F 2AF6A 3QLHB 1LK7A 2EBEA 3JYTB 2MKCA 4CO0A 1U49A 2E9ZA 4DMZA 2FD2A 1HI0P 4PG6A 1TFWA 3FQKA 1U1QA 2MDAA 3E01A 2RRBA 3B8HA 4N8NA 4F67A 2XMUA 1N48A 3M6UA 4ECQA 2UVUA 5DG7A 1N0VC 2B7CB 4C2MA 4UQTA 1YJUA 3G71S 2DIUA 4X4OA 3H5XA 1M5HA 3CWJA 4IG3A 1NH8A 2HFOA 4MTPA 5EN1A 1Q79A 2LYVA 2HHWA 4GO7X 5CYMB 2EK1A 5E2QA 5HMXA 4Y0FA 1U1KA 4WKYA 2OH2A 3N5FA 2GGPA 4OJ3A 4YEAA 1S1XA 4NLSA 3I55S 3RAMA 4NRTA 2JC0A 4WU2A 2VG7A 2R7RA 2ZJPQ 4M5DA 4LF5F 4C7QA 1VQSA 2WSFC 5KFFA 1Q1KA 1S72S 4ZS6A 3T5HA 3K58A 2ZD1A 3D5MA 3TAMA 1L3UA 2BYCA 1BY9A 3I32A 3K5PA 4FPRA 2F3JA 3J7ZT 3ZZTA 3IG1A 2FHKA 4RW8B 2K2PA 1GX6A 1X4HA 3AY0A 3ICLA 4YHHF 2GMHA 2L9WA 2NSCA 3HHKA 4L72B 4Q8FA 4Q8EA 1D8YA 4DUYF 4JV2A 2VPYB 1C0TB 3MEEB 3MMAA 5DDQC 2VBZA 3KLIB 2F1FA 1SC6A 1B0VA 2B9YA 1RTDB 3DXSX 4DPOA 4Z2XA 1XNQF 2VV5A 4EGLA 1HA1A 2D3UA 4IO9Q 2X3GA 4L6V3 4A8KA 5I3UA 4ECZA 4DFKA 4F26A 2N7CA 3KLEA 2BABA 1VBXA 2J5AA 3F41A 4DS4A 3Q2SC 4IH7A 1HI8A 5IFMA 3NMRA 4GO5X 4NCAA