2W2NP

Wt pcsk9-deltac bound to egf-a h306y mutant of ldlr
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
93
structure length
93
Chain Sequence
TTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Characterization of the Wild Type Pcsk9/Egf-Ab Complex and Natural Fh Mutants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/receptor
molecule keywords PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
total genus 24
structure length 93
sequence length 93
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2w2nP01
3QFHA 3SQOP 2Z57B 2Z58B 2W2MP 3A3PB 2QTWA 1SPBP 3GCXP 4NMXA 1V5IB 3A3NB 3H42A 4JP8A 4K8RA 2W2PP 3VV2B 3CNQP 1ITPA 2ZWOA 3BGOP 3T41A 3P5BP 3WIUA 2Z56B 2ZWPA 2E1PA 4NE9C 1SCJB 3GCWP 2Z30B 2W2OP 2Z2ZA 3BPSP 3WHIA 2XTJP 4OV6A 3WIVA 2W2NP 1R6VA 2Z2YB 3VHQA 2W2QP 3CO0P 4YN3B 3A3OB 2PMWA 3AFGA
chains in the Genus database with same CATH superfamily
2GVDA 2WVBA 1V9OA 4X64F 1TK0A 1IBKJ 4LF4F 4K4SA 2XI2A 3OFGA 4RNFA 4MFBB 2EC2A 3CCWA 2H54B 2L9NA 2R8GA 3E2EA 1JXEA 1URRA 2YWWA 4M5IA 2KHDA 4RNHA 3R5CA 2NZCA 4R0EA 4RUCA 4W90B 3VAFA 3TVKA 4HI2A 4USWA 4LUBA 4ZVGA 4M8LA 2R2UA 1X60A 4DUTA 3NRBA 5AE3A 2HWHA 4JI2J 3PVXA 3LPEA 2MLZA 4ZCKA 2CPXA 1UVNA 9ATCB 3NBPA 5E2QA 4Y2KA 3TNVA 1MLAA 1WF0A 2CXEA 4P10A 5ETTA 3J81j 4EZ9A 1YK9A 2LU1A 2ZH5A 1NB7A 3IG1B 3HI9A 1S1VA 4B08A 1ZZNA 3TQEA 4WIIA 2RQKA 3PW5A 2OTLS 1JLEA 3SFUA 1U8WA 5KFOA 3HMJG 4IYQA 4OHXA 2FC8A 3TP2A 2YNFA 3W66A 2F5GA 4HHHA 4GC6A 2EVZA 1KWMA 3AD9C 3CDAA 4OZ0A 2E5LF 1UJ6A 4DR6F 3CCVS 2ZHBA 3TAQA 4CNYA 5HBMB 1HBOA 2IVMA 4V1Ak 4B9TA 1Z2LA 9RUBA 3BH6B 2HHHF 2X51A 1F3VA 3D3BJ 2UUAF 1RCXB 1BWEA 1FNMA 1JIHA 4IQMA 5L39A 2Q6CA 5F9NA 2QMXA 1CC7A 4X84A 3M2RA 5BYQA 3MUMP 2KRRA 3NG8A 1Y11A 3OFFA 4USMA 2VG6B 4QW9A 2Z30B 3J81U 5CH7B 4CNZA 1YJNS 2OKQA 4BWMA 5BR8F 1RLCL 4NASA 1FRMA 4GKJF 2BA9A 1NH7A 2MEWA 4NWBA 4HLBA 4LR9A 5CYQA 1X4DA 2AJ0A 3BGUA 3EGZA 1Q8BA 5HQ8A 2JFDA 2ZVIA 5K8OA 2I6WA 3ZZUA 4EZ6A 4I2PB 2BQUA 4LSLB 1NK7A 2A3JA 2HURA 1XR5A 2NZ4A 4F4ZA 4X4UA 1LW0B 2HNDB 4NLXA 1NJZA 2ZC3A 4DV2J 4MKVA 3FC9A 3TUZC 3Q86A 2DISA 3EVMA 3RTVA 4ZCIA 2XC9A 2X7IA 4KYZA 2ZNYA 1FNOA 2Z56B 1GQEA 1QSYA 1UPMB 3CB4A 2ASJA 2DJWA 4Z37A 1APSA 1U09A 3HF5A 1L3VA 4JI4F 4LF7F 2HK3A 1CJKB 2LXUA 3WBZA 4Q44A 3IBCB 3M2RB 2B5JA 2AZ1A 2CFXA 4PG7A 3ILJA 1LW2A 5DQHA 4ZPWR 1IJFB 4DFKA 1FXRA 2ZM6J 3OVSA 1TELA 3J7AN 2HYIB 3NS7B 3SMZA 4QWDA 1R0BG 3L7UA 3CCSS 1N88A 1WF1A 3J7YU 1Q82T 1DRZA 2OAUA 3H20A 3M30B 3DRPA 4WFNQ 1WC5A 4NRTA 2GMLA 2ZH6A 3A12A 2A6OA 4ECSA 5DLGA 1JJ2R 3HVWA 3D4JA 3JB9k 3K5PA 2VICA 3N01A 3DLJA 1RT5B 2E1MC 3LQVA 4DBQA 4PR6A 2W4CA 3U02A 2DNMA 1OY8A 4ZHRB 2QL9B 3DMJA 2O01C 2P9CA 4YOEA 1C1CA 3UFCX 1VBKA 2ACMA 4NEZA 4AUKA 2LDIA 3CDUA 1T05A 3R1HA 3MCNA 2NS1B 3RRKA 3ZNUA 4OZ1A 3S01A 4DR2J 1RHKB 2ZBCA 3ISZA 4NA2A 4ZMMA 1Y3KA 2LCWA 5CAAA 2CVEA 3I4PA 3DOMB 1NZ8A 1UW9A 3C14B 1JLCB 3CJRA 4FF4A 3QFHA 2LDYA 1FKPB 3CVKA 2ATCB 2QMUB 1I51B 4TU7A 4C3MA 1D9DA 3KLVA 3T1HJ 1SUQA 2CPDA 4ED6A 3CMES 4QYZJ 3M30A 3OFEA 1EAYC 3A3NB 1R8HA 1RWVB 4HT5A 4KB7A 2CVIA 4JI3J 2QV6A 1E6VB 1Y3JA 3Q24A 2F40A 4O3OA 1VC0A 1VYAA 2HVDA 1HWJA 3ELHA 3JTPA 5I4MA 1ACMB 1B64A 4ZPTR 2A6MA 3KLIB 4KR0B 4OHWA 1NSKL 2GVDB 2DXEA 4YB1P 4QU6A 2IMWP 2IJNA 4DR5J 3MPWA 1LWFA 1YSJA 3GR0A 2Q66A 2KZZA 3HX9A 2PMWA 5HSPA 1M1KT 1MWZA 2FGOA 3KYLA 3IR6B 4RW8B 3G87A 2KYZA 4G1IA 1NKCA 1DTTB 2CQDA 3I0SA 2R2SA 1HWIA 2D3OR 1PO6A 4I6YA 1RK8A 2KJVA 1VRQC 1FEEA 2HS3A 4J5OA 5HVHA 4CZCA 2GVZB 4FNIA 1X4GA 4JI1F 2RT3A 3EICA 1RT6B 2V9KA 1Q79A 2QGFB 3T41A 5IV4A 2ATLA 2IBKA 2DRAA 1RAOA 4URSA 4XAKA 5C2CA 5JUMA 2N3OA 3SFGA 2FVQA 2C42A 2NREA 1H7WA 2BZ2A 3A13A 3HD2A 4DQIA 2IY5B 1E6VA 4CQ1A 1RT1A 4MIWA 2V4JA 5THWA 1SJRA 2DKOB 5JVHQ 1AROP 3V2UC 2GMJA 3GFHA 4N7TA 2C3UA 3OXFA 1UVMA 1S9GB 1HNZF 4K4UA 4ID5B 2E9RX 3AFGA 3K58A 2R8KA 4DUYF 3G82B 3I9ZA 3RRGA 4CYUB 3Q8UA 4ZPBA 1HYSA 3A3PB 4IO9Q 1F6TA 2AGOA 2YNIB 2HFUA 3MECA 3MM5B 2O67A 4ZCLA 2QLBB 5GAGU 1VRUB 3M8QB 2B9EA 1FDBA 3T9ZA 5IT4A 4EK2A 5IXUA 2K3KA 2YX1A 1NK6A 4DR4J 2CQ1A 1SB6A 1TUGB 5KFAA 3N79A 5KOXA 3GFZA 5KFDA 2UUWA 1DHMA 2K3IA 1OQ6A 5ETSA 3GIKA 4NLRA 2R2RA 1BQMB 2SXLA 1RADB 3MM8B 2W8KA 2V67A 3TZZA 1FDNA 1PAUB 5T7LA 3ZTSA 3T1YJ 2Y1JA 1M5OC 3P8BB 5FDLA 1B3TA 4FF3A 2HZCA 2M8HA 5DJBA 3OT9A 5IC4B 4F0KA 2AJ1A 3P3DA 2NLWA 2FY8A 5AJ3F 4ZLPA 3HHDA 3OHBA 3W9IA 1UEVA 4ANCA 2B7CB 3RR8A 2J6TA 5B0FA 5GAEI 2XCAA 3RG6A 2IDEA 1TUVA 2XYGB 5D4PA 3ZZYA 3HT3A 5H9EK 1NK8A 3BJYA 4DSKA 4MKAA 2XEXA 2DY9A 3HHLA 3P5TL 4ZIVA 1RHMB 1TFYA 4IQXA 4C98A 1DTQA 2UZAA 4RW9A 1H74A 4BCAA 2GIQA 2BJ7A 2MQOA 2QA4S 1XK8A 3FSYA 5D77A 3LP1A 1U6BA 4DR4F 1QAYA 2HHSA 4IH6A 3FFIA 5DO2A 4PPZA 2K8GA 4LF5F 2PE8A 2BXJA 1R31A 4DMZA 4CO3A 1MMLA 3G86A 1ZAXA 4IG0A 4MH8A 4KHPJ 2RRAA 4LR8A 1VFJA 3QIPB 4DR1J 1RCOB 1W2IA 3IS9B 3OR2A 2QN6B 4CH7A 3UWTA 3A1YG 4OI6A 1HNZJ 2KL8A 1Y4ZB 4ECZA 2F7VA 2GHVC 5HAOA 3U1NA 1R0CB 1JB0C 2VA2A 2KYXA 4JI5F 4M5KA 4LBPA 1JLEB 2XGQA 1SC1B 1J5EJ 3LA0A 4AXJA 1CJVB 1SH0A 1RWKB 4ETZA 4K0KJ 4DL5A 1WEYA 2F65A 4LIWA 4IOCQ 1YRTA 1YRXA 2F9DA 1XMOF 2PFFB 1KQFB 1XQIA 5HROB 1EX8A 4XPCA 1T05B 1REVA 2MDAA 3AXKA 4MIBA 4OX7A 4ENOA 1M5SA 1S12A 5T41A 3R9LA 1RKJA 1KDNA 4EEYA 4HH0A 3OL8A 1RTIA 3L7PA 3MAAA 2JEIA 3J81Y 2HHVA 3FGVA 3MWBA 1WEXA 3WC0A 1NJXA 3QRQA 2KG1A 4QU7A 1OJ4A 1F9EB 3FZ2A 2FJDB 3JTOA 2BABA 2BM0A 3EMTA 3PIPQ 1EARA 1FWPA 2BE2B 3A8KA 4DV3F 1UFLA 5D3GA 1H72C 2ASLA 3DN9A 4CH1A 3KJVA 1WNEA 2J5AA 2QYCA 1UA0A 3ULHA 1UL3A 1GXLA 1YVFA 2AKWB 3HHNB 4ANDA 2ROPA 4ZJLA 4M5HA 3DDIA 1M1HA 3P96A 4C8NA 2V0NA 3MOJB 3C15B 1OS5A 5KFQA 3W7BA 2DY1A 1U49A 3H2LA 3KJFB 4C6AA 4ES3A 4YMEA 4USUA 4BBYA 2HZAA 3I32A 2IRUA 2MSTA 5CD4H 1FHTA 2XWYA 3LH2S 1FXDA 4C3LA 5KFXA 2G1DA 3C6TB 4KC5A 1BC6A 5KT3A 5KG2A 4NLDA 1X4BA 4LSNB 1S6QB 4ZK7M 1O51A 1SJQA 1NPRA 1JLFB 5E3AA 3PW4A 1U0HA 3D68A 3NMRA 2H1YA 2POKA 3MFIA 4ZP8A 1DTTA 2X3GA 2DNYA 3MCMA 4ERDA 4GO5X 3DI6B 4JV0A 5J2NB 3SDEB 4U7UD 3V6KA 3RGIA 2H48B 1LWCB 1FRHA 2J9DE 4XDDA 4U8YA 4DV4J 2WCXA 3Q89A 3B82A 4OLPA 4ZLJA 3H59A 2WZ1A 4WXOA 4ZVUB 5IS2A 2VFVA 3QAEA 4R8UA 2HRUA 4DF8A 4JI8J 4LRCA 4KT0C 2LXFA 4RW7B 1VQPS 2LU2A 3EDRB 2WSCC 2IDLA 2BJ1A 5JVGQ 3GV8B 2KB2A 1HBMB 4TKTA 5K14B 3H4BA 3D0GE 4XK8C 1CEZA 4ZJOA 3TEGA 4DFMA 2FTRA 2LEPA 4B3MF 4C8OA 4QOTA 4AQYF 4OHYA 3K2YA 2VFUA 2OFHX 3EVWA 4CLZA 5J2PA 2DNOA 4LSNA 4CLLA 2AGPA 2DNPA 2IRYA 2V2QA 1D3WA 4JV1A 1Y5NB 4I6AA 2UVWA 3DYAA 1X5SA 2BJ9A 1K9MT 1RA6A 1I94J 2JEFA 4P2FA 3NWRA 4PUOB 3UD4P 2B56A 4I6WA 2CQ4A 3PXGa 3KFWX 1TL1B 1NSQA 1N5SA 4H4KA 3T5KA 4DL7A 4JV5F 3THVA 4K4XA 2DIUA 2MPUA 3KDOA 1R0AA 1VLOA 3M8PB 1L3TA 2GW8A 4USVA 1F2HA 2G0CA 3IRXA 3OXLA 1B0PA 4FXWA 2VBXA 3NS6A 5HO4A 3PX4A 3CT9A 2WOMA 5B7WA 4HL9A 4JI7J 2HVHA 2XSJA 3SQOP 1SJFA 2ABYA 2H3EB 4HDGA 5LXYA 4CT9A 3TQ1A 2D3ZA 1S7HA 3R27A 4YFUA 2CJKA 2YXLA 3SEOA 1H6KX 5CCMA 3CMAS 3RAXA 4F3OA 3QGHA 4DCJB 3KDNA 2Y1RI 1HIYA 5J1EB 2L9DA 2XO7A 1WOPA 5B09A 1I94F 2UUBJ 3C2PA 2K1RA 4Q0BA 1WELA 4V19X 5C42A 1J2VA 2V6AA 4CT8A 5GAHI 2HHHJ 2BEFA 2WK4A 1J27A 2DNQA 3CWJA 1PJ7A 3W5XA 1DBDA 5CHCB 4N5SA 1CVJA 1TL1A 5HI7A 5ETNA 1URNA 4DR6J 2DNKA 4OZ3A 2YPYA 4GVBA 2CAJA 4EBEA 2HHPA 3JQKA 4FKXA 3UVJB 4MK9A 4U7UK 1XR7A 4O3RA 3HK2A 1S57A 2PSZA 2YBVA 3UR3C 1FRJA 4M5MA 1NAQA 2EFGA 2K2PA 3ZNJ1 4I2QA 3AJDA 2J7KA 3DOLA 1WDTA 2D69A 4Y2CA 4IUFA 3QAUA 3TJ8A 1JXLA 3W62A 1HNVA 4KPYA 2Y0BB 3NKYA 2DGUA 2RRNA 3TZYA 1YJ9S 1NDKA 2C3PA 3D5MA 4RWXA 3R3TA 1TKDA 4DL2A 3CDEA 4C48A 1JLAB 1WHVA 2E1AA 2UP1A 4M1KA 4MKBA 1HI0P 1JLQA 2EC0A 1G7CB 4A8WA 4LFBF 3UQSA 5ETOA 1GTEA 1HI8A 3HSJA 3I31A 2C2MB 2ASDA 4OZNA 4PQAA 2OPPB 4DN9A 2DCLA 3JAMY 4FXVA 4AL5A 1NEEA 1KTQA 5L1IA 2KT2A 2YH1A 3GFYA 1U47A 1JLBA 3GE9A 3VQTA 2VG5B 1P1LA 2BJ8A 4QR0A 3DLLQ 3TI0A 1NPKA 2CJQA 2ROEA 2VFSA 3GFXA 4FYXB 2XLIA 2UVVA 1N33F 1NJIT 4K8RA 4A8XA 3J7Z5 2BJDA 2WVDA 2N7CA 1RT5A 1G2EA 1U1RA 3IG1A 3ZZRA 4DSLA 3Q2SC 3I6PA 2LA6A 4ILMA 1MROA 1WC1A 4QR2A 4M5DB 5C24B 1BY9A 3HO1A 4ED2A 1Y00A 4NCGA 2XY5A 2JLEA 3CXCR 1IM6A 2XMTA 4A8YA 3MMCB 1BHNA 3BR8A 3MEKA 3R97A 3VGUA 3PFEA 3PYFA 1XBWA 4P73A 3CCTA 4YN3B 2IJRA 4LBIA 2JNJA 2FLPA 5KFCA 2VA3A 2ACYA 4ZKAA 3EX7B 3BQ1A 3TOQA 4B17A 5G0RB 7AT1B 3MAHA 3OTOJ 3RU0A 3MAQA 3RB0A 1FFGB 2IA6A 3GSDA 1M1GA 3HLUA 4M5GA 4ZVHA 2OEJA 3FCHA 3PNIA 4C9DA 1NM2A 1VQYA 4IFYB 2NPFA 1QLNA 1TTHB 4C8ZA 2F8EX 1LWCA 2CJ9A 4FZVA 3WX4A 2J6SA 2R7WA 4A47A 2V2ZA 3LANA 1S6OA 2DHXA 1GK8A 2DGOA 1O5JA 3FBCA 1A6LA 3L09A 4WCEQ 2GAGC 3CCZA 2IPOB 5DDOC 4P6QA 4DCPB 1U24A 2LKZA 1R6VA 2OPSB 1UJ5A 2AX1A 1VS3A 1BWVA 2ZH7A 3HHEA 4HKQA 1R3NA 2BRKA 4RJVA 3GV7B 2HNYB 2V5HG 2W2QP 1LW0A 4C7QA 5F8IA 2PI5A 3QATA 4HTJA 4B9MA 4KHPF 5D0GA 3V4MA 1VR6A 2NUUG 3OJSA 4YP3A 4B9SA 2Z58B 3ZZTA 2DXFA 2NCKL 1V3SA 1R8CA 2L41A 1T3OA 5DLFA 1C1BB 1KLMB 2HMIA 2RQ4A 5KFZA 1BUXA 2OELA 3MEGB 2AEFA 2CJBA 3GV5B 2E66A 2Z0GA 1RBLA 1HQ2A 5CYMB 2MKKA 5L8RC 4O4RA 1PJ5A 4K7QA 2DXDA 3PO5A 3PTWA 1IVZA 3MFHA 3M8SA 2VIHA 1VQ8S 4OX9F 3QZ8A 2LXIA 4LT6A 5KFYA 3OSPA 1L3UA 4WYWA 2XSJB 2AJFE 1RWNB 5H9FJ 2KVQE 3T5LA 2UXDF 1X31C 1IWAA 1NK0A 3TANA 1DQAA 4PWUA 3W2VB 2Q3PA 3KHRA 4ED8A 3CJ4A 4KO0B 2CADA 2ZEJA 3W64A 2J7UA 2QO3A 4FPRA 3FJ2A 4K4YA 3JXOA 2B9WA 1T03B 1WHWA 4NLUA 4ILLA 1RP5A 1HYSB 3QZ7A 4ZP7A 1QD1A 1H0HB 2HGLA 2PGCA 2K06A 4NI2A 5DZ7A 5ETLA 5IWAJ 3EZ5A 3VZIA 2DH7A 3MF5A 1X4CA 3S7RA 5LSOA 5KT4A 3EVOA 2CNOB 2YWFA 3DRRB 3U1LA 1ICEB 4ED5A 4YDXA 2CG8A 1MWQA 2VJVA 4O3QA 1OIAA 1YTYA 1FE0A 4WJBA 2R3VA 3FBEA 3T5HA 2WVFA 3BQ2A 2HIQA 4NX9A 2HHTA 3GB0A 2RRBA 3X1LB 2FLOA 4PPDA 3Q8PB 5CYMA 1WD6A 3WHIA 3M2VB 4AD6A 1HR0F 2W2NP 5GADI 2KI2A 3M8YA 4Q8FA 2I5JB 1RT7B 3AOCA 4CLFA 3NGSA 4KGZB 4Q5VA 2YKPA 4ECWA 1U45A 1Q86T 2KKHA 1O0PA 3IO1A 4N77A 1RGVA 2XGPA 3WX8A 4FDFA 2E7VA 4KBIA 1S9FA 3SYZA 4PXCA 2MKYA 1LKZA 1IUJA 1HA1A 5RUBA 3UD3P 2KFZA 4QWBA 5F8MA 1EJ7L 3NGTA 3GJRB 5ETVA 2VFRA 4G1PA 1KOOA 2ZOFA 3BGRA 3BBFA 1UFKA 1RT2A 1TR0A 2AEMA 2M4MA 2NYIA 1S1WB 2QIFA 1Y10A 3JQJA 3N6MA 4QIWD 5B0GA 3CJKB 3OUYB 4H4KC 4TYBA 2C3MA 4P7VA 1QVFR 3B54A 4B3RJ 2HEKA 2XO6A 2RILA 3EGWB 2WB4A 2JZ5A 3HKZD 3UNGC 5MAOA 4B3OA 1FESA 4Y0FA 1ZM4A 3FEXB 3LOUA 1FI4A 1LXNA 5K8NA 3ENAA 5KFLA 1YIJS 4M95A 3IWNC 2HHUA 5A8KB 3HJFA 4RUBA 5ETMA 4U8VA 4IG3A 2J76E 4UUWA 2LP4A 3TW0A 4FF1A 4QIGA 3BKTA 4QYZK 2HAFA 2ILZA 2IBOA 1VQSA 1H2UX 3P45B 3S1TA 5CZVA 1U6FA 3S6EA 1UZDA 3H90A 3MMBB 2MXYA 2YVSA 1YDLA 4QCLA 3DLKA 3FRZA 2ZWOA 2OPRA 3CJ0A 4J90A 2KT3A 3MM9A 3G6VA 4O0NA 2LYVA 5F0UA 5HMXA 3MM6B 5SUHA 1NK5A 3DLEA 2CPIA 3G8TA 4IFVB 5HQLA 1HPZB 4RW6B 1S9EB 3BDPA 2B4OA 1GH8A 1HW8A 1MU2B 1BMQB 2CNLB 2HQDA 3MTJA 4KGXB 1VRUA 3DRSB 3HULA 3R5JB 2E9TA 1TL4A 4NLGA 1IQTA 4LFBJ 4N8NA 3F41A 1Q8LA 1S4EA 1VLYA 2FQQB 1TKZA 3QLHA 2DHGA 3J80U 3A3OB 4ECQA 1U2RA 1T3NA 4F8RA 4F26A 2GO9A 4Q2LA 1NKEA 1ZYQA 2RJZA 5IOLA 2E5HA 1M5PC 1WI8A 3SI8A 1UJ4A 1FJGJ 3EDQB 3KNGA 4DV5F 3DLBA 1OQ3A 3CE8A 1TL7B 3DGVA 5F8LA 2NSBA 2R7QA 4G1QB 1OWXA 1T9UA 2KH9A 2CPYA 5KAKA 2DB1A 1S1UA 5KG5A 4RZRA 5LJ3Y 4TXSA 3TAMB 1SCJB 2MJUA 4OZ2A 3NNCA 1RWMB 3DOLB 3OHAA 4UUXA 4J9VA 5C25A 3CCLS 1WC6A 3BO3A 1VBYA 1SKRA 2F4VJ 2JH3A 4N8OA 2CQCA 3Q8SB 3MM6A 3FQKA 4TN2A 3IAM9 2BKOA 2BUNA 1S48A 1LWEB 4P7TA 4CIOA 3FBBA 4R0JA 3O1LA 7FDRA 3CC2S 2OGUA 3CEDA 3H0PA 2VZ9A 5GVQA 3VAKA 2AYGA 2FJWA 2YKQA 1S72S 2KM8C 1YBUA 4C3KA 1F9HA 3KMSA 1XNQF 3NOGA 1T9TA 1EETA 4J9NA 2ZH2A 3C14A 1RUSA 3R5DA 1EZZB 2HBZB 3MEDB 1C0UA 1RTDB 1DLOA 2QMWA 1EQ0A 1FWKA 5D0RA 4CTAA 3IM9A 2BVZA 3BN4A 3PHEA 1W2BR 3VGVA 3ISND 2V8GA 2Q6BA 3HFZB 1ZETA 3D28A 1Q1KA 3W60A 2NXUA 1ZOTA 1U1NA 2FJEB 1OYEA 4YB7A 2F3JA 1EKRA 1RB0A 3A8IA 4PZVA 3W8GA 2V8VA 1EKSA 1OY9A 4LIRA 2FJXA 3D7SB 1LOUA 1ZM2A 1FFSB 5JXSA 4DFPA 2J9DA 4DR1F 4IR1A 1RU1A 4NCGB 2O3DA 2H5EA 4ED3A 4LF6F 2N4CA 3KJQB 1KD1T 4CWBA 3CCMS 2W24A 4PXDA 1T03A 3C8YA 3KLGA 2FHKA 3MPYA 5M2UA 2NQPA 3HDSA 1JKHA 1U1KA 2ZH1A 1VQMS 3POTA 3M6UA 4LF5J 4PQUA 3VV2B 1UEUA 4XTTA 3GIIA 3P5BP 3MPDA 3OL9A 1HNIA 1ZZFA 2VC0A 3MR7A 2RAQA 1KP6A 4F3MA 3QJLA 2FJVA 3D0HE 2Z4PA 4RWWA 3DRPB 5HLFA 1QTNB 1VQ7S 1NK9A 2AEJA 4WP8A 4DCOB 3SZ2A 5HK4A 4CLTA 1RYRA 4LF8F 2FZGB 1RT1B 4GVLA 5KFHA 2R7RA 3CUNA 4LF7J 2W8LA 2UXDJ 1FO1A 2RS8A 3CW2C 3SIPB 3P6YC 1KBRA 4FPIA 4A4JA 3MURP 1QTMA 3DCAA 3NEKA 3QO9B 4BC7A 5K8MA 1MN7A 4IDKA 4LF1A 1WOSA 2E7WA 2GJ2A 3BO4A 4KTQA 1WSVA 3TVZA 2LQJA 4WWSA 2ALYB 3GIRA 2BACA 2CJAA 1T95A 2IC3B 4ZVEA 1OPIA 5A6WA 2FLLA 2VOPA 2QZ8A 2DPJA 4F4KA 1B7YB 2P6SA 4LVNP 3TZXA 3OUYA 3LP0B 1VQNS 4L73A 1RLDA 1ZH5A 1TAQA 4CLSA 1D09B 4CM2A 4N56A 2CPZA 2J9EA 4OV1A 2KHCA 1I5OB 3RAQA 2RMLA 4RL1A 3MGJA 2NYHA 2A2CA 3BM7A 4M63A 4I67A 3DI6A 4R5PA 2CQPA 5AE2A 5KFNA 1RU2A 4DUYJ 2R8HA 3Q8YA 4DJBA 2JHEA 4DXLA 4YQWA 4KFBA 1MMDA 2JJ4D 4BC9A 2P6TA 5DQIA 1D1UA 2DO0A 3NBPB 2HVIA 1GT8A 2KZMA 2XMAA 2CRLA 5F8HA 4F4XA 2HG4A 2VH7A 4TLRA 2XI3A 4KV8B 5CA5A 1PYSB 4IOBA 5KFRA 1D0EA 4UW2A 1UVKA 4NPOA 3FRYA 4RW4A 4DG1B 4TU9A 4DV0F 4DV3J 3W3SA 2VPYB 3W2WA 1WG1A 1N36J 4NLOA 1HD0A 2WBRA 3EUNA 3QIDA 4UQTA 1RABB 3L9ZA 1C4AA 1UAWA 3QT6A 3UDCA 4FXDA 2AWZA 2FHJA 5KFEA 4TNOA 5IM0A 3PACA 3CCQS 2LEBA 1N5TA 2F9JA 2HFSA 3OTDA 3QLHB 1QAIA 2M2BA 5LL6d 5BYSA 2CQ3A 4J9PA 1XMOJ 4DU7A 3NGRA 2DNGA 4ZITA 5A8RA 3IS9A 2Z8QA 4ICLB 4I2PA 2ZBRA 4MYUA 2V94A 2EXUA 4DV5J 4O4GA 1QSSA 1LNQA 1PC4A 1ITPA 1YX2A 3H4DA 2GMHA 1KQKA 3NCQA 4EBCA 2AF6A 4ZPAA 4ID5A 5C24A 4ES1A 4RW4B 2U1AA 2R4FA 3AXMA 3KHGA 5LOQA 3OR1A 1KONA 3TO8A 2APOA 3D54A 3IC1A 3RRHA 3QYYA 1CJKA 4ED0A 2OIHA 2GX8A 4JI7F 4X64J 5L46A 4LF4J 3MEDA 3R2DJ 2NPIA 2G2YA 2RU9A 3FBFA 1HMVB 1T0TV 1XEZA 2W1BA 5ADZA 3V81B 4V19J 2OTJS 4A8QA 1UFWA 5E3CA 1SPBP 3IR5B 1TVRB 3ENVA 3UW1A 3CC4S 1U2CA 3K8WA 2BJ3A 4BWJA 1AUDA 2QLFB 1LQ9A 5T7LB 3KNAA 2MQNA 2VPXB 3Q8VA 4L3NA 1HQEA 4M5LA 2KT5A 4P2XA 5F41A 4DL0C 5HMZA 2AYBA 2ZKTA 4LREA 5I42B 3AH6A 4R8UB 1QUVA 5I3UA 5HVGA 3BPSP 1LWXA 5DETA 1GEHA 4NMLA 5B0BA 3C15A 1AUSL 2HQFA 4DN0A 3W1YC 3JYTB 4WP9A 2MLYA 3MD3A 5DQGA 4B9LA 1QE1A 2IVYA 1RAFB 2XCPA 5E33A 2B4PA 2C2RA 1IKYB 2QJ3A 2Y1LB 5E3RA 2W7PA 4O44A 1LFWA 1RHRB 1T9YA 1PC5A 2M88A 1WHYA 4OYIA 3VAJA 3BGLA 4H54A 2KXNB 3DLHA 3DGPA 1KQGB 3BSCA 4M94A 4TYAA 1CPZA 1JJHA 3HVRA 4QWAA 2B51A 1FEHA 2HLUA 3PJWA 4DV0J 2MJNA 2KFNA 1BLUA 2QA1A 2YKMB 2C2EA 3RZAA 2ZDPA 2YY3A 1BXNA 2YNHA 3B4MA 3F44A 1FKPA 1JLBB 4QQBA 4F67A 4ZLNA 3I5AA 4EMDA 2AT1B 2MZJA 3P49B 2WSFC 3F0NA 4KY3A 3H8YA 2JX2A 2RQMA 3D9BA 2RF2B 2B4VA 1S1UB 5BXIA 5L1JA 1HR0J 3IR7B 4Y00A 2YNGB 1K8AT 3NWGA 1H7XA 3BBCA 1U8SA 1OSDA 1IBCB 3SQGA 2Z57B 4RX6A 3G82A 3QFWA 3NGDA 2AV5A 1FNXH 1YQHA 4EFAC 4A8KA 4DL3A 1JX4A 5AXLA 3PY8A 4JV5J 3D6TB 4J91A 4HHJA 3BQ0A 3ET6A 4NLYA 2CDRB 4C8MA 3S8SA 4DV1F 4NZ6A 3GPAA 1CJUB 2FGCA 2CQ2A 2HSEB 5ETPA 2M9KA 3MTKA 4J37A 3MMAA 2LQ8A 3I96A 1OY6A 1U4BA 2R7VA 2W2OP 3DLGB 3I0SB 3M2UB 3D2WA 1BD6A 2LECA 3WIVA 4F7VA 4DR5F 5DS7A 1S49A 4WE1A 2CNNB 2FPHX 4UZBA 5SZTA 3MXHP 1YBAA 1HKAA 2VDIA 1XNRJ 1Z1ZA 4WP3A 1KR4A 1NHVA 3PEJA 4N41A 2RSQA 5D4OA 4EU0A 4TLQA 2BMBA 7FD1A 1D8ZA 3F56A 5J2QB 2FY1A 2C2KB 2YNGA 1BQNA 3TA2A 4JI8F 3U27A 3I55S 2QSFA 2O1PA 3W2WB 2A10A 3RBXA 2ZZMA 3MEEB 4KH1B 1B70B 4ES2A 3DHWC 4FKYA 1F3FA 1S9GA 3LGHA 3LUYA 2E1CA 4Q7AA 5IV3A 1PSDA 2C2OB 2C2ZB 3DNCA 5E0OA 5CZXA 2IRXA 4GMKA 3V6JA 3H40A 1F60B 2DRBA 2OJ3A 1C1BA 2W25A 2ZZNA 3QRPA 3NAIA 3LWMA 4MFBA 1TL3A 2VV5A 2XHCA 4USHA 1IJEB 2CQGA 5EGYA 1H2TZ 5KFPA 1F5BA 4CDIA 4R25A 4D3GA 2JC0A 4K4WA 3MDFA 3FDSA 4WPAA 3HKWA 2YQ0A 3KMQA 4ZCMA 3RR7A 3M8QA 4PWDA 1WDDA 1XWLA 1WC3A 1FWLA 5FDLB 1A0OB 3CJTA 5AXNA 4Q8EA 4QBUA 2VB6A 3BGFA 3ZO7A 5DDRC 4A8SA 1TP7A 3LGNA 2R8JA 2B6AB 3FCVA 3R6GB 2EG1A 5L9XA 5KFGA 4YHHF 3EJMA 4WFXA 2EKYA 4DS4A 2HIYA 2HQIA 4JP8A 4KO0A 4J9SA 3SV4A 2NXEA 1ZTTA 3IXQA 4DX6A 1Q4RA 1H2VZ 3HSGA 4MTPA 3AJ1A 2GJFA 4CO5A 5ETRA 3OTOF 3B4DA 3M6WA 3I56S 1TZ0A 1D9FA 1N6QB 1IBMJ 1NUEA 1RWXB 4FVCA 2CG4A 2UXBF 2WHOA 2MKCA 3RBZA 3GJSB 4ZP9A 5E3QA 4NLSA 3TYTA 2EK6A 3EZOA 2QFJA 2QE5A 4P9SA 2OEKA 3IFEA 2B9XA 4CO0A 5LJ5Y 3NNAA 1TVRA 3GLJA 4PG5A 2Y3YA 4NI2B 4UZCA 5A2QU 3MCSA 2HLTA 2MYFA 3C16B 2WRMA 3I87A 5M2RA 1U6ZA 4J7CA 4RKUC 4P2MA 2DNZA 3LALA 1HWLA 2Y0SD 3CDWA 1VCTA 3UN5A 4ATNA 4JBCA 2QX0A 1UTAA 1QUPA 3D6FB 1WOOA 3TA0A 4A48A 4W92B 5KOWA 4LF6J 4R5PB 1FT8A 2HPUA 3KUEA 4YHHJ 3M2VA 2O66A 4RO0A 3I0RB 2FUG9 3BYPA 2PA3A 3BPDA 3T1AA 1Y5LB 2YH0A 2ZUAA 3JQMA 3O2IA 4DPYA 4F4YA 1XC9A 4FBUA 3I5BA 2Z2ZA 5GMDA 3V4IA 3BKUA 4WBFA 2VPWB 3OV7A 3FEZA 1N0VC 2XG8A 4DX7A 4MT1A 1YJRA 3HFKA 5L1LA 4UTGA 1DZ5A 4ZA1A 4DG1A 3PJXA 4ILRA 3C6TA 5BR8J 4GKJJ 4CLKA 2YPZA 5HANA 2ZZTA 1WWHA 2Y1IA 4C8KA 3M8ZA 1JLFA 4OLOA 3KG1A 2B43A 1SQEA 2G9OA 4YUDA 4FYVB 4KQZA 1IKXA 4NMXA 3LP2B 4Q0BB 1HBNA 2F63A 2XNRA 1AT1B 4PXBA 2QEXS 2RHSB 1KFDA 2OSRA 5HL7Q 4I7FA 5F3ZA 2CPFA 1DY3A 3BEGB 3KLFA 3AOAA 3HD1A 3I9V9 4DPOA 2C28A 2J7WA 2P8IA 3CJSA 3FMBA 2DR5A 1UEKA 5HJYA 2BRLA 2XMVA 4NA1A 1EB0A 3BYRA 1VC5A 3KTQA 3CJ8A 2AP6A 4KHMA 1Q53A 4F50A 1RAGB 2OPRB 1VC6A 2MY7A 3OTBA 2DGXA 2MZSA 2IAJB 4NYOA 1FA0A 1I3OB 2L9WA 1S1VB 3MM7B 3JSBA 4PKDB 3KK3A 1S9EA 2OPQA 4TY8B 1C1CB 1HLWA 4CO1A 4WU3A 4CLUA 2UUBF 4MK7A 2IYIA 4KGVB 3DLEB 1ZM9A 5LMNJ 4RUAA 3MR3A 2A0FB 4NL5A 3IAS9 1IR1A 2CQIA 1WJ9A 4AXIA 3L4BC 5DDQC 2ZH9A 4U67Q 4OYAA 3OLAA 5J2NA 3GONA 1OO0B 4A8MP 3MEGA 1HBNB 2PT0A 2GV1A 3ZZOA 1CULA 1U1MA 2GA7A 2IJFA 1S99A 1KEKA 3CIZA 1OYDA 1RZMA 4RNNA 1SKSA 3RAMA 2F4VF 3DXBA 4I7FB 3KLFB 2C2DA 2IM0A 1Y0HA 5B0EA 2M8DB 1OPZA 4A8FA 4JI5J 1FERA 3IGVA 4UF4A 4Q45A 1N54B 1ZTWA 1N5YB 1KRPA 3DXSX 1VQLS 3M1VB 4U7CA 4Y34A 4KKOA 5GAEU 4ECXA 2XBPA 4ETXA 1QY7A 1TMMA 4MAKA 4C0BA 1VQ5S 1FJEB 2LQ5A 3VTIA 3CIMA 3DC2A 3OW2R 2C2NA 2IHR1 3KHLA 4LFAF 1QE1B 2XWXA 2RD5C 2KRBA 4PAAA 4F02A 1IQZA 2BKNA 4JUZA 1KVIA 1LWFB 3Q23A 2IFXA 3BDEA 3KG0A 5D4LA 3VVTA 4CLWA 4U6PA 1X4EA 4USJC 4F2SA 4NLPA 3RBDA 4DI6A 4RW8A 3DGPB 3TUIC 2FVSA 4USKA 4ECTA 2FIUA 2HRTA 1GXTA 3E01A 3UDEA 2CWKA 4GKKJ 1X0PA 1K44A 2IA0A 2JL9A 3R7NB 1HBUA 2KG0A 5L1KA 2D3O1 4LQ3A 1Q8IA 1O6XA 2PEHA 3L7OA 1JNRB 1N36F 5JMNA 2LFVA 3AT1B 1LW2B 5D4NA 5EHHA 1YJUA 1RTDA 2P2CB 2OSQA 3J80Y 3E8OA 3VALA 4NEYA 4DL4A 2OD6A 1YJVA 5HJXA 2VFTA 4L3KA 4OYOA 3KHHA 3G96A 2EI5A 2VODA 1CLFA 1VJQA 4DV4F 1S76D 4F25A 1FJCA 1PYOB 5HN0A 2F8HA 1X4AA 5KG1A 2BOPA 1N0UA 5CYJA 2RUSA 1HNVB 4IRKA 3K17A 4C8LA 3CC7S 1A9NB 4BLGA 1S6UA 1S0NA 3M4XA 2E1PA 3SCIE 2GS8A 2KM8B 1Z4UA 4XDCA 1NHUA 2V63A 5DDPC 4HYKA 3HSDA 4URQU 3MMJA 2E5GA 2YKNA 3DHXA 3IMQJ 3W8PA 2XLKA 3OFHA 5A8WA 4I0WA 4L75A 4ZPDA 1HI1A 1S6QA 4PG8A 4K5SA 1LK7A 4NA3A 2JDJA 3SCLE 2V8DA 4PABA 3R8YA 3OJUA 3G6YA 2LEAA 2WONB 1VI7A 1D9AA 2E1RA 1N52B 2H5IB 3BS9A 2RHQB 2QG9B 2HNZA 2YX4A 3CTRA 3GYGA 4JOUA 1I6JA 3M2UA 4B3SF 1HNWF 4YY3F 2NSCA 2JLGA 4OI0A 1C2PA 3DFEA 4WTOB 2AX0A 3DOKA 1VHIA 2DIVA 2N7YA 3EE3A 2XZDB 3NLCA 3TX8A 4G1QA 1KS2A 4OJHA 4PYAA 2VOOA 3GG1A 1GMWD 1RYSA 5AJ3J 4J9QA 1X7VA 2W4DA 3K5OA 1IXKA 2VKRA 3TR5A 4B02A 3HP6A 2VHGA 2VONA 1RTZA 4M5DA 4IOAQ 3EZUA 1ZA2B 2BANB 2D41A 3LTOA 4JI1J 4L6V3 2XMUA 4G65A 4WXWA 4OYZA 1NXIA 1Q81T 4JV2A 2IC3A 3MMCA 3RB4A 6FDRA 2VUGA 2WB1D 4ECYA 2MKIA 5LSLA 1H98A 5DRKA 1IKXB 3GP9A 3ZTOA 1VIOA 1Q8KA 3DRSA 2IVFB 4QPTA 3PW7A 4OI4A 1TQLA 1IR0A 1NPPA 1RI7A 2GZOA 4ELUA 1RAIB 3FFIB 2B7BB 4MMOA 2COLA 4FYYB 1H73A 1RQ0A 2F4FA 1N4LA 3BR9A 4D3HA 3ZTQA 4DL6A 4IG0B 2V2KA 3PM9A 3CNQP 2NXNA 1SKUB 3GTYX 2DYAA 3I4HX 4JI0J 1UMJA 3ZTRA 1YG0A 1NK4A 4J9UE 5I3UB 4ECVA 4Q2MA 3O8WA 3B6BA 3CJ2A 4KHRA 4OV6A 2HGMA 1CS4B 2HAIA 2GQQA 1UVJA 2WOMB 1NDPA 3IM8A 5KG4A 3CD5A 3QGGA 3UN3A 1Q5VA 3WQPA 4Y65A 3N0VA 4OL8A 3P4UB 2C3OA 5D6GA 4DV6F 4E0DA 1N6QA 1MWYA 3UNYA 6AT1B 2KXFA 3MR2A 1IN0A 1VK8A 3Q22A 2W9BB 1BGXT 3GYNA 3GCXP 4NCBA 1X4HA 1DURA 3M05A 3MUVP 3CJKA 3GQCA 2VDHA 4W4MA 5B0CA 2AJ4A 2FYXA 2CIMA 4WKYA 1VK3A 1P9YA 3JSRA 2D9PA 1WUUA 3NXZA 4WFAQ 3M9NB 1NCLA 2AZ3A 2UUAJ 4ED4A 4CH0S 2HHWA 4EO8A 4FS1A 4DR7F 1RSCA 2ZKUA 5A8RB 3RB3A 3T3FA 3C6UA 3GCWP 4ZP6A 1HNIB 3TUPA 3QWUA 2M3DA 3HVTB 3OTEA 4B3MJ 4OJ3A 4RU9A 3Q8QB 3PKMA 4KKOB 2EFNA 4F4AA 4IO1A 2W9CB 1IKVB 1FKOA 1KVKA 5A76A 3FK4A 1SL0A 2XNQA 2DR7A 2M52A 3OQ2A 4CI0B 4IKAA 3T1YF 1SJ3P 2BE9B 3G2XA 3OVAA 5FD1A 2UXCJ 3UCZP 1CS4A 1YWXA 4H4MA 1KQSR 1FTRA 5KFIA 2RIJA 1NNDA 2DEIA 2XHWA 5KFWA 2KFYA 3CPWR 1SIZA 4EYHB 1RBAA 4OYMA 3FCWA 2CJXB 2YNFB 1V5IB 3EGVA 4ZS6A 2G4BA 3T1HF 1ZAWA 1SQGA 3W63A 2DGSA 1LFPA 5HBMA 2RQCA 4C11A 4K4TA 1UWBB 2DEJA 2HQCA 3PR4A 4OI2A 3BSNA 2XYPB 3KUGA 5KG0A 4JYAF 3FVYA 1HHTP 2CPEA 1ZBTA 2VASA 2VBWA 5B0DA 3LP0A 3THPA 4DR2F 3M6VA 1L3SA 3LWLA 2GQ2A 4LF9F 1JWWA 1VRTB 1RWUA 3QMQA 1K73T 2HHXA 2HGNA 1Q0NA 2FJAB 2X1BA 1UKUA 2OMLA 2RUGA 3D1HA 3FUYA 2MQQA 1UA1A 1AXQA 1KTVA 2CQBA 2DGWA 1XJWB 3M32A 3N5BA 1NU4A 4X4SA 5GADU 3N4WA 2NXCA 2UUTA 4XO0A 5LMUJ 4O3SA 3EGNA 2KN4A 2EG2A 3T9NA 1X5OA 4H4MB 2EFPA 2UV8A 3TAMA 4PCQA 3BO2A 1KFSA 2D7SA 3DU6A 5H1SV 3K5LA 1P9QC 2J0WA 1X5PA 2DT9A 1T11A 2FHJD 2LQ9A 2QL7B 5HP1A 5A8WB 1LV5A 1SL1A 2DPIA 4E8UA 3D6MB 3O3LA 4FS2A 1U1LA 2PDAA 3CCJS 4OJ1A 2V4QA 2AQ4A 1IKYA 1VIXA 4OZLA 4CRJA 5LSRA 5DM6Q 4JI4J 1PIEA 2H4WB 4MK8A 5AXMA 4DEZA 1FRLA 2L3MA 4AE5A 4ER8A 4P2SA 3MOZA 3MPUB 1RKIA 1CSJA 4QW8A 2WW4A 4YDDB 3KK1A 4B3RF 2VBYA 3PW0A 3N28A 1X8DA 4X4PA 3HHKA 3VAGA 1R8AA 4RR5A 4DV2F 1FJ7A 1T9WA 5EX0A 2XMKA 3U1MA 1WI6A 1YKWA 3VAIA 1NO8A 4DZDA 4JI3F 3TJ9A 1WC4A 4HTIA 4P74A 4JB8B 2VJUA 4NLVA 2BQRA 1NJYA 2M70A 5CQGA 1HNXJ 1RTJB 1RWWB 2PFDA 3KKFA 3NL0A 4EWTA 3ADAC 1GTHA 1RISA 1T9XA 1T8EA 1MMNA 4URGA 5KT2A 2ZJQQ 1VBZA 3N9UC 1S0MA 3ONQA 1M0SA 2PN6A 5IZHA 1FVQA 3OXGA 1KN6A 1S0OA 2FHOB 1WKJA 4CLYA 5DM7Q 3W5ZA 2RDDA 4WK3A 5L38A 2AIRB 2VD3A 4C0HA 3D1OA 4UOHA 2AU0A 4LRFA 5ETQA 4PYDA 3R5GA 1JKHB 4PQUB 3H5YA 3E01B 2MB0B 3RJMB 1VBXA 4KGMA 1NZAA 4X65F 2V9WA 3CD6S 4ID8A 3H5XA 5AXKA 2VQEF 4C8YA 5DG7A 2R7XA 5GAGI 1U25A 2J8SA 4Y3CA 3LAMA 4EI2A 2D9OA 4GVBB 3SDEA 4X4RA 5HLFB 4I4BA 4OI1A 4WE1B 8AT1B 4RW7A 2CZ4A 4NE9C 4ZVFA 3IRWP 1HQUB 2XMJA 2MGZA 4LSLA 4O3PA 4OHZA 8ATCB 1FD8A 1SQFA 3NCRA 3THTA 5K8PA 4RBUA 3MM9B 5IFMA 3MPVA 2XMMA 5GMEA 4X62F 2Q1LA 4LFCF 1V6HA 5K9FA 1UCNA 3MMBA 4F04B 4WKRA 3QO9A 4DSIA 4JI2F 1WORA 4DPWA 3NAHA 1YZ6A 3IWXA 1N48A 1FXLA 3K89A 5CD4A 4DV1J 1DARA 3GYXB 2DH8A 1SIWB 4YR2A 1X9WA 1VDHA 1RT4A 1SJ1A 3LGMA 4ZJQA 1EETB 1HD1A 2ZH4A 2YKOA 5EWEA 2ZITA 3OD2A 1ULRA 3GU0A 4FN5A 1SH3A 4OJGA 4TY9A 4A8OA 2MQPA 2GGPB 3GIJA 3H5SA 4FF2A 2V50A 1DLOB 3AODA 4LSZB 4NXMF 1SKWA 3NGUA 2CWXA 3CJ5A 2LA4A 2GVZA 3H2UB 3FKBA 1ZS6A 2EFOA 4QIEA 1AA1B 3LPYA 1WG5A 2OO4A 2Z2MA 2FDNA 2DBBA 4Z7YA 3RW7A 5KFUA 3CCRS 1CC8A 3ZZZA 1HWUA 2BE2A 1HQEB 2HFVA 3GMGA 1HHSA 4CLPA 2A2DA 1X0FA 2Z2YB 4ALZA 2MKSA 3RUBL 2HBRB 4F0HA 1K1QA 3V6HA 4ZPCA 2RF2A 3G6XA 4ZDNA 2L08A 2MLXA 2GC8A 3CO0P 3IRXB 4JI6J 1TUWA 3PYGA 2JRSA 3BSAA 2G0JA 4KV8A 4DV7F 3R2CJ 1X4FA 2DR9A 3C3LA 4OYWA 2BANA 5FIIA 4PWWA 3KLHB 4P71A 2MKHA 1OMSA 3HVAA 2W7AA 2B8PA 5A6PA 2WW8A 1AYEA 4AT1B 4C11B 5JJBA 1GNKA 4O44B 2I38A 4DQRA 1SJ4P 1L5UA 2D1CA 1J5OB 5A0YA 1HFEL 1F9FA 1RAHB 2CJYB 5J1EA 3C19A 2QA4G 1AFJA 3DOMA 3PYEA 1D8YA 1PAEX 1PGZA 2MZRA 4UT4A 4ZPVR 1C0UB 1VRTA 3TA1A 1SC6A 1N5VA 3FSXA 2EFVA 2HHQA 3RBEA 4FVMA 3VVUA 4X4OA 4X4TA 1E6YB 1UPPA 5LMNF 1X9MA 1BE4A 3QPIA 3M32B 4O0IA 1JLCA 2FZKB 1A7GE 4MYTA 5E3PA 1U7LA 4ECUA 3K57A 4WIQA 2ALZA 3H5UA 1YGYA 4DX5A 4ICLA 3KUHA 1JK9B 1TL5A 2ZC4A 1QVGR 2DD8S 2ZOGA 2V2VA 4QZVB 4ED7A 2UVUA 1TFWA 5IT9U 2P9GA 1TV6B 2IM2A 2W01A 2DNRA 2XS5A 2ADBA 1QJHA 2AYEA 1K47A 1T94A 1T9VA 5HP1B 4OIXA 1RA7A 2E29A 2MQLA 4NYPA 2RU3A 3JSMB 3K5MA 1YRUA 2VPZB 3BGOP 3KLGB 4ZN3A 1RBOB 3G8QA 5I3PA 5U47A 3OR1B 2EPIA 2JFKA 5C2GA 5KT5A 4HACA 1CJTA 1Q7LB 2MZQA 2YWEA 4QR1A 1UZHA 1NKBA 4EYIB 4CCHA 1CJUA 2CPJA 4QIFA 4X4NA 1S79A 3L95X 3DDNA 2MQMA 3F73A 4DQSA 1N5QA 1NDLA 1KVJA 2K7JA 1U1OA 3FSIA 1UETA 4K2JA 1TKXA 2YX7A 4Z2XA 1RT6A 2FVRA 1JLQB 3AB2B 3T19A 3UE2A 1SC3B 3H7HB 3HVTA 2VU5A 2VG5A 4Q43A 1RAJA 5IT0A 4KFBB 1S6PA 1S1XB 4G3IA 5CXTA 2QTWA 1K0VA 1U0SA 1V5VA 5I42A 1XERA 2CZ9A 1B7FA 4HH1A 5ITHA 1WEZA 3IWLA 3MM7A 4J9MA 5H9EJ 4DWIA 2YTCA 3OPKA 1SI9A 2OI2A 5D15A 3TEHB 4DSFA 1HNXF 3KJNB 2ZWPA 4RLEA 2EKNA 2GFFA 2MZTA 4BHQA 5DZ6A 2E5JA 3SSSA 2GQCA 4DR3J 2RB7A 4AL7A 3ICLA 4IRCA 4LF2A 4NXMJ 2FC9A 5F0WA 2GCFA 2DGVA 4L74A 4RBVA 3G9CA 3QGPA 3HHLC 3VCDA 3I82A 1S59A 4KRWA 5IC6B 2ZHOA 3CF5Q 5D8HB 2QLWA 4DS5A 3ISNC 4NLTA 1NMEB 1I1GA 4I69A 2YNIA 1AZSA 2PMHA 2JC1A 4LRAA 3ETMA 4DHVA 3GILA 2DR8A 4KE5A 3EPGA 1EIYB 5DG8A 2R7TA 2KDOA 2D3UA 4N76A 1J5EF 1VQ6S 4RNMA 2GAHC 4WFYA 1CULB 2DNLA 2GIFA 2P5VA 2FZCB 4M5JA 4U95A 1U02A 2VQFF 1B0TA 2UXBJ 2I5JA 1N33J 1T7PA 1H3DA 4K2XA 1UWAA 3ZZPA 4B9UA 4O4GB 2PMZD 4DR3F 4OYXA 3G71S 2KXHA 3MM8A 1CG2A 1HARA 1Q16B 2XS7A 2ZE2B 4KH0B 1KC8T 8RUCA 1NBEB 3PDNA 2MGZB 2ZH8A 2M7SA 3OSNA 3C66A 4QYRA 1FKAF 4S0MA 2X3DA 2HNYA 3PRVA 4AFFA 1U1QA 2CQHA 2GHWA 3A4TA 2E7XA 3UDVA 3PEHA 4RBTA 1JLGA 2I9SA 2AD9A 2AYMA 2OPSA 3BV8A 1SC4B 2FLNA 2B4UA 3Q8RB 2DRDA 2HK2A 3ENQA 4LJMA 6FD1A 2XB2D 2GIRA 4OYBA 5EX3A 4CYUA 1KLMA 1T02A 4OX6A 4UOCA 3UR0A 3M9MB 4DLGA 2UUCJ 4ZIWA 1UVLA 3UCGA 3CMQA 1NB2A 1CBKA 2N82B 2V68A 3C16A 3KK1B 4DSJA 4MJKA 4J9RA 1P1TA 1B0VA 3PZPA 1IR2A 3HPOA 5J2MB 1TMJA 3WC2A 2HMIB 4KIAA 2ZBIA 1PBAA 1SUQB 3JAMU 1AB8A 1F1BB 2JVOA 4WU2A 1R89A 2K7KA 2X1AA 1F5AA 4IG3B 5MLCV 1BQMA 2RS2A 2XZTB 4ZVRB 3TRGA 4YR3A 3TX0A 3NMAA 4A46A 1HW9A 3AA9A 1X5TA 2OLWA 3MD1A 4HVZA 1RT3B 2B3TB 2G0IA 5F9LA 4DF4A 1NJWA 1QAJA 2NUHA 5HMYA 1Y5IB 2U2FA 2YWHA 3DLKB 1WKLA 1VQ9S 3QRRA 2M0GB 2ZM6F 3SSQA 5BJRA 3MCOA 4RUHA 1PYTA 4NOHA 4O23A 3KLEA 1PBUA 3HCXA 3PX0A 4UY8T 2YKNB 2MTLA 5HROA 3HZGA 3CJ3A 3Q0AA 4LRDA 1R43A 3CD7A 5B08A 1RTIB 1HWKA 3C46A 2YWKA 3O6QA 2IMOA 1FDDA 2X1GA 3RW6A 1R8PA 1E6YA 2C1EB 1REVB 2VBZA 3DYAB 4P52A 2MKJA 4BS2A 4NLQA 2J0QD 3PG9A 5G0RA 1R6YA 2YNHB 3V81A 1S0VA 1RWOB 1REGX 2QYGA 2XLJA 1B4SA 2E5IA 2H9ZA 2HNZB 2ERRA 2QA2A 1RTHA 2XS2A 4IFYA 2JOQA 3O5TB 3HM9A 2W9CA 3M9OB 1Q5YA 2B8QA 4YS2A 4HHUA 1JJ4A 1JNZB 4N47A 1EQMA 2R2TA 4OI3A 4EGLA 4UY85 4DV7J 3JTNA 2OUGA 5ETKA 1QDUB 3R6LB 1KHWA 2XSFA 4JI6F 3SQGB 1P27B 3AQOA 3GIMA 1TV6A 3U7JA 2OPQB 4TY8A 5EUHA 2JVRA 1YJTA 3DMJB 4KSEB 5K20B 3KLEB 1RT2B 1XR6A 3JYTA 3R5BA 4Y2MA 5HATA 3W61A 3QSYB 4DPUA 4KJIA 3PR5B 5CABA 4KPCA 2HBYB 2VG7B 2R42A 1XMQF 3MECB 4ANEA 1U0HB 2KO1A 3BKFA 3V6DA 1NDCA 1S1WA 3MR6A 1AFIA 4DSEA 5C42B 2IYGA 3ILOA 1S4FA 3LF0A 3ENWA 3W65A 2G1HA 3DM2A 5AT1B 5A8KA 3G6ES 1JJCB 2V34A 4CTAB 1TKXB 3BN7A 2MSSA 3A8JA 2ZUGA 3CJQA 2C3YA 2B0GA 2EK1A 5KFTA 3ETOA 2YKAA 5HQMA 4ELTA 3KOAA 2HW3A 2BX6A 1SVDA 2BYCA 4WFBQ 3IN5A 2W9AA 1S97A 4MKYA 4NXNJ 2RVJA 2BJEA 4B3TJ 1FJGF 2DH9A 4WK1A 2UU9J 5GAHU 3PCOB 2D74B 1GX6A 1HBMA 5K14A 2BR0A 1KHVA 4YEAA 3CGIA 5IQQA 3W2VA 1VHFA 4DX8H 2Q43A 1B99A 1PG5B 4HR2A 4E2FB 1N34F 4QWCA 2CPHA 2Q79A 1MU2A 2ZVSA 4KGKA 4DU8A 3GR1A 2EFQA 3EM1A 3PRDA 4YY3J 4C97A 5I3QA 2CKWA 3MMAB 3VQSA 4CO2A 1V3ZA 3UO0A 5L9NA 1TK8A 2JEJA 4OZJA 1HNWJ 3POTB 1Q95G 2H65B 2HWTA 3TZWA 3VGSA 1HBOB 2AJQA 3BB5A 3ET6B 4NCAA 1S1TA 2HWIA 2J8AA 3WZ0A 3FEYB 1G3OA 2PA8D 3RB6A 1FK9A 1LK5A 2HFZA 3AHPA 4EO6A 2MY8A 4DFJA 4J9KA 2QL5B 3HHLD 3T5JA 3DLGA 1FFWB 2OPPA 2AJ2A 3PFOA 3TAPA 4ED1A 5KFFA 4PUOA 1NSAA 2DR6A 3OR2B 1SV5A 4LR7A 1RT7A 2L48A 2N4DA 2ZNZA 5KG3A 1C4CA 2B9YA 1RTJA 2LVWA 3BREA 3QQCD 2N3LA 4JI0F 3DKDA 4USTA 4P72A 4DDFA 3VAMA 1N56A 1MW7A 3DRYA 5J2QA 3TUJC 1DAXA 1W25A 5KFVA 5KTQA 1CJVA 2FHMA 3NOCA 2GHPA 1FDAA 1KKHA 1W26A 3AD7C 3W9JA 1IKWA 3X3UA 1Q78A 3AJ2A 1MN9A 4GC7A 2W7OA 1K0TA 3AOBA 5IQ6A 4I1TA 3R7SB 4PXEA 1YI2S 4HEA9 4RU2A 1S77D 1G6BA 2F1FA 3AY0A 3MM5A 4WF9Q 1IBKF 1G4CA 1ROFA 3LW5C 4USIA 3GJQB 2RE1A 4X4VA 1V3RA 3IGNA 4K0KF 4WZQA 4C2MA 1KSPA 3PV8A 2VF3A 3QT8A 2BQ3A 1L3KA 4YR0A 1XN9A 4ZLLA 2J6UA 2PIIA 2B6AA 1QM9A 5BYRA 2X1FA 4ZOSA 3EWGA 5C7PA 1F5CA 5E7OB 5E5NA 3UN2A 3QWPA 2MHNA 2F8MA 3PYDA 4EBDA 2EBGA 3M1VA 3UD5A 5GMKa 2XM3A 1QSLA 4ZHRA 3MI7X 1Y7PA 3J7ZT 1GXUA 4DPXA 5LMUF 2UVRA 3US5A 2KJWA 2ZJRQ 1YJ7A 4C0OC 2MZ1A 1DFDA 2G13A 2HS4A 4UQGA 1N32J 2XY6A 5KFJA 1JLAA 3B78A 4C4WA 5IWAF 4Y2AA 3CCES 1YITS 1WTFA 2HRYA 4YB5A 4OHVA 3JS9A 4H4OB 3SCJE 3VGTA 2W9BA 4ECRA 5EDWA 1DTQB 4RW9B 3H42A 4F2RA 3IP0A 4ZN1A 3L3CA 4P75A 2XMWA 5LT5A 3HXMA 3G8SA 1LXJA 4U96A 4DLEA 4K59A 4TU8A 1XMBA 1U2FA 4J9LA 4CP5A 1IWGA 5EWFA 4PG6A 4DQPA 1NHKL 3LAKA 3V5RA 2XTJP 2AW0A 2RDIA 4OX9J 3AAWB 5CYQB 4WZMA 1RTHB 3PRBA 4I56A 3D67A 4F3QA 4I64A 5LXRA 3GG0A 3KLIA 4GO7X 4UOFA 3EXCX 1KLNA 3QJJA 1BQNB 2Y8WA 3NY0A 3FMWA 4LF8J 4G6VB 1NSPA 3GSIA 3VF0B 3OL6A 3KLHA 3MHYA 2VG7A 3D3CJ 3BH7B 4J9OA 2W2PP 1FCAA 1ZM3A 1YZ7A 3LP2A 3K7RA 1ELOA 4LBHA 4X65J 1YJWS 1TL3B 3HFVA 2HS0A 1DQ8A 3M6XA 3GWCA 4K50A 1WSRA 1MSWD 3QSIA 3NNHA 2HVZA 4QPXA 5C5JA 3ZFVA 2XQCA 3SBMA 3H25A 3CCUS 1NRKA 5HVFA 5EWGA 3OLBA 1WG4A 3G4SS 3H98A 4FNHA 4OMFG 4OQJA 4E98A 3MUTP 4NZ7A 4XPEA 3M8PA 3DOKB 4PG4A 2RDJA 2EBEA 3N6NA 4X4QA 2DK2A 2V4JB 4KAIA 3J7A1 2I8EA 3ILIA 3RYLA 1X9SA 5H9FK 4NYZA 1HHQA 2KU7A 2BDPA 3FZBA 3D6HB 3KK3B 2HVEA 2XZWA 4MIAA 4B9VA 4FYDA 1C0TB 3VWSA 4NXNF 5J1PA 4EUVA 1F0XA 2V69A 3B8HA 4TVAB 4ZVQB 2YWGA 3UDLA 3JSMA 2JWNA 1TKTA 1S7IA 4DUZJ 1SXLA 4HI1A 2IIHA 1KOHA 2J9CA 4F0MA 2ADCA 1RT4B 1RXOB 4WTYA 5KT6A 4FBTA 5F8JA 1CJTB 2LLZA 1R7IA 1FRKA 1WF2A 2G2ZA 4FYWB 2CDQA 4Y28C 1GMWA 3R1LA 2CNKB 3AD8C 4LFCJ 1GMVA 5F3TA 1M5KC 1FK9B 1VJWA 2YQ3A 4HDHA 2DNNA 3R5AA 1AW0A 2YKMA 4Y6IA 4B3OB 2WTFA 1XMQJ 1XNQJ 1VOMA 2LMIA 1RAAB 2GNKA 2EWHA 2GGPA 3AB4B 3MZIA 3TARA 3HT0A 3HSZA 4NLWA 4QIVA 1FVSA 5DGAA 1VQKS 2PI4A 2W2MP 1UVIA 2BKPA 1S6PB 2EEYA 1WACA 1IBLJ 1IBMF 1H38A 1SBRA 2GJIA 3BZQA 3I0RA 1G1XA 4AL6A 3BBBA 3UPFA 2CUYA 2WBMA 4B3TF 2P9EA 1N5YA 2A18A 2FD2A 2ZOMA 3A8EA 4B9NA 2R9LA 3WIUA 3V4IB 1C0TA 2RNEA 4LRBA 2H4YB 3EPIA 1RHQB 2VQEJ 2IM1A 1YHQS 2DVIA 4IRDA 1U48A 3GJTB 1MNEA 3OTCA 4OZ5A 2UV8G 2VKZG 2I2YA 4ZVOB 2QSWA 2RKIA 1PILA 1SH2A 1UW4A 1WHXA 3KXDA 5CCLA 2NXJA 1J5OA 4B3SJ 2R8IA 1HBUB 4NZ0A 2DTJA 2QLJB 2MMYA 4JYAJ 3NGKA 2BV3A 2OD4A 2H51B 3DU5A 3LP1B 1HMVA 1ZA1B 3DRRA 1R27B 2G2OA 3QIPA 5F8GA 2EW9A 1M5HA 1DJ0A 3KK2A 1ZPWX 5KFBA 2E5LJ 1TAUA 2DITA 1M5VC 2UU9F 2R7SA 2OFGX 3M8WA 2W4PA 5KG6A 3ZTPA 1FE4A 5M2PA 3PO4A 2DGQA 4LMZA 2CQ0A 2XY7A 4TQRA 2QLXA 3EXYA 3O44A 3WDOA 1FRXA 2OEMA 3CULA 1JQGA 2ZE2A 3H2VE 2FJBB 2Y9HA 3QJPA 4YB6A 1LEOA 5G4DA 3BF4A 2IAJA 1P6TA 2JSXA 2MHEA 5FLXY 3CO9A 2PO4A 4AYBD 1XNRF 2CZVC 2HNDA 3HZEA 3OVBA 4H4OA 1YBTA 3ZC4A 1VQ4S 1FX2A 1VMBA 4K5RA 4K4VA 3QNWB 4U9RA 4ZVPB 4I68A 3FQLA 4IH7A 3K5NA 4ZVSB 4XIUA 1GMUA 2HBQB 3T6JA 1PKUA 4IR9A 4X2BA 1N8RT 4HACB 3OBIA 3SSRA 1XTZA 2PEBA 4WYLA 4GKKF 1S1TB 2ZDOA 1Z2ZA 4DUZF 1FX4A 2B5JB 4LQ9A 1GFWB 5D0HA 3MAAB 2AGQA 1RHUB 1FF2A 3KK2B 5DGBA 3KJVB 1WKKA 3N5FA 1R0AB 2DHSA 4DV6J 4RNOA 1EHWA 2OP5A 4UOGA 1GX5A 3M7VA 3UVJA 2AMCB 1RAEB 2ZD1A 3ITHB 1TU0B 3I5CA 1MG7A 1RACB 4PRFA 3UI3A 3W5YA 2WAQD 3CDBA 1OSCA 2HQGA 3PHTA 4OFZA 3QT5A 3J7YI 2HQ3A 1NH8A 2DO4A 3ILLA 3Q83A 4IFVA 3MR5A 3EYZA 2V8HA 3K59A 4LF9J 5FLXU 1TK5A 3JSYA 5KFMA 3VR1A 1BQXA 5AE1A 4F4WA 2ZJPQ 2E9ZA 1QAXA 2QRRA 3HHLB 3PKYA 5A0YB 2KVIA 1TKZB 4M5NA 2H5JB 2HFOA 4DQQA 5F8NA 2QFIA 2XYHB 5KG7A 2DGTA 2FB0A 1IM4A 2VG6A 4F36A 1RE1B 3TWZA 2CA9A 3FNNA 2AHOB 1AZSB 3E51A 3M8RA 2M5YA 2HZVA 2R7OA 4ELVA 2LQBA 3IBWA 1VISA 2JEGA 2VL1A 2C22A 5DG9A 1TL7A 2UXCF 1WTBA 1IKVA 1FKOB 4PEOA 5E41A 4QJVA 4K4ZA 1ZPVA 4NRUA 2J0XA 3IBFB 3SV3A 2ZBPA 4L72B 2BW2A 3SXLA 2ZD1B 1YLXA 3ITHA 5D0EA 2VC1A 3K8VA 2RH3A 5C25B 1U26A 3QT7A 2V4RA 2ZFHA 4DZ6A 2XULA 1JLGB 3AQPA 1RHJB 1LWEA 3PJ9A 4DOZA 3QGIA 4DR7J 3OL7A 1ZAVA 4IDKB 2O5DA 4TQSA 1FD2A 1W7WA 3DRXA 5J2PB 2V8PA 5J1NA 4OX8A 3T6BA 2UUCF 3Q2TC 1HPZA 1JXVA 4RW6A 2A1BA 2ROGA 2HFNA 3SCKE 3TJAA 2DHHA 3V6DB 3HJVA 4HT7A 1K1SA 2J0SD 1CQMA 5LM7E 3TVYA 3VAHA 2QC3A 2Y8YA 3VHQA 2MQ8A 4PWDB 2IM3A 5J2MA 1M90T 2DNHA 2WONA 1N32F 5FJ4A 5IT9Y 5HMWA 3DM2B 4LVOP 4FP9A 1Y9OA 3D0IE 2QT7A 1EP4B 1DQ9A 2I0XA 2BW7A 3CSKA 1NLKL 3C6UB 4WFZA 2ZHAA 5D3GB 2HKEA 2WVCA 1N34J 1S1XA 4Y2IA 1FRIA 2DCUB 2Z2LA 1RJJA 1HQUA 3R7BB 2FVCA 4O3NA 4X66F 3PW2A 1IBLF 4ITSA 3ZZ0A 4CM0A 2VQFJ 4QWEA 5KFSA 4DPTA 1VGYA 2R7UA 2KTQA 5B0AA 1RT3A 3ZXWA 2WSEC 1F2GA 1WC0A 2BBEA 3DDKA 1MROB 2WVEA 3W9HA 1Q7YT 1RDRA 2BM1A 2OH2A 3D1QA 1R8BA 1SL2A 2PD1A 1UWBA 4BDPA 1CQNA 5KT7A 3BGRB 2CYYA 4L76A 2ASYA 2E44A 3PIOQ 4OYPA 1JMTA 2RKIB 5D78A 4CO4A 3E3XA 3UCUP 5IM0B 2BE7D 3LO3A 3NCPA 3BSOA 5KFKA 2GO8A 1FTCA 4GRSA 2JLFA 2K1RB 2OMOA 1O8BA 3PX6A 1EP4A 2ZH3A 2NR0A 1PCAA 1XIQA 2YQ1A 3KWMA 1U1PA 2FVPA 3GZ7A 1KNZA 3N6LA 5T14A 3IA0A 5K5MA 3NS5A 4X62J 1SV5B 4LFAJ 5EN1A 4X66J 1S5ZA 4IH5A 1PJ6A 2ZBQA 3K0JA 3QBCA 4I2QB 1HL6A 3D66A 4W98A 1UP1A 3NP5A 2PC6A 4Z7CA 5A2QY 1S10A 3VZHA 1VQOS 4ZVTB 1GAOA 1RWPB 2ILYA 1P8GA 4AQYJ 2DHAA 3AA8A 2I1RA 3MEEA 1TKTB 2OHDA 1IKWB 2BOAA 3KG4A 4RPFA 3CD0A
chains in the Genus database with same CATH topology
3QFHA 3SQOP 2Z57B 2Z58B 2W2MP 3A3PB 2QTWA 1SPBP 3GCXP 4NMXA 1V5IB 3A3NB 3H42A 4JP8A 4K8RA 2W2PP 3VV2B 3CNQP 1ITPA 2ZWOA 3BGOP 3T41A 3P5BP 3WIUA 2Z56B 2ZWPA 2E1PA 4NE9C 1SCJB 3GCWP 2Z30B 2W2OP 2Z2ZA 3BPSP 3WHIA 2XTJP 4OV6A 3WIVA 2W2NP 1R6VA 2Z2YB 3VHQA 2W2QP 3CO0P 4YN3B 3A3OB 2PMWA 3AFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QFH A;  3SQO P;  2Z57 B;  2Z58 B;  2W2M P;  3A3P B;  2QTW A;  1SPB P;  3GCX P;  4NMX A;  1V5I B;  3A3N B;  3H42 A;  4JP8 A;  4K8R A;  2W2P P;  3VV2 B;  3CNQ P;  1ITP A;  2ZWO A;  3BGO P;  3T41 A;  3P5B P;  3WIU A;  2Z56 B;  2ZWP A;  2E1P A;  4NE9 C;  1SCJ B;  3GCW P;  2Z30 B;  2W2O P;  2Z2Z A;  3BPS P;  3WHI A;  2XTJ P;  4OV6 A;  3WIV A;  2W2N P;  1R6V A;  2Z2Y B;  3VHQ A;  2W2Q P;  3CO0 P;  4YN3 B;  3A3O B;  2PMW A;  3AFG A; 
#chains in the Genus database with same CATH topology
 2GVD A;  2WVB A;  1V9O A;  4X64 F;  1TK0 A;  1IBK J;  4LF4 F;  4K4S A;  2XI2 A;  3OFG A;  4RNF A;  4MFB B;  2EC2 A;  3CCW A;  2H54 B;  2L9N A;  2R8G A;  3E2E A;  1JXE A;  1URR A;  2YWW A;  4M5I A;  2KHD A;  4RNH A;  3R5C A;  2NZC A;  4R0E A;  4RUC A;  4W90 B;  3VAF A;  3TVK A;  4HI2 A;  4USW A;  4LUB A;  4ZVG A;  4M8L A;  2R2U A;  1X60 A;  4DUT A;  3NRB A;  5AE3 A;  2HWH A;  4JI2 J;  3PVX A;  3LPE A;  2MLZ A;  4ZCK A;  2CPX A;  1UVN A;  9ATC B;  3NBP A;  5E2Q A;  4Y2K A;  3TNV A;  1MLA A;  1WF0 A;  2CXE A;  4P10 A;  5ETT A;  3J81 j;  4EZ9 A;  1YK9 A;  2LU1 A;  2ZH5 A;  1NB7 A;  3IG1 B;  3HI9 A;  1S1V A;  4B08 A;  1ZZN A;  3TQE A;  4WII A;  2RQK A;  3PW5 A;  2OTL S;  1JLE A;  3SFU A;  1U8W A;  5KFO A;  3HMJ G;  4IYQ A;  4OHX A;  2FC8 A;  3TP2 A;  2YNF A;  3W66 A;  2F5G A;  4HHH A;  4GC6 A;  2EVZ A;  1KWM A;  3AD9 C;  3CDA A;  4OZ0 A;  2E5L F;  1UJ6 A;  4DR6 F;  3CCV S;  2ZHB A;  3TAQ A;  4CNY A;  5HBM B;  1HBO A;  2IVM A;  4V1A k;  4B9T A;  1Z2L A;  9RUB A;  3BH6 B;  2HHH F;  2X51 A;  1F3V A;  3D3B J;  2UUA F;  1RCX B;  1BWE A;  1FNM A;  1JIH A;  4IQM A;  5L39 A;  2Q6C A;  5F9N A;  2QMX A;  1CC7 A;  4X84 A;  3M2R A;  5BYQ A;  3MUM P;  2KRR A;  3NG8 A;  1Y11 A;  3OFF A;  4USM A;  2VG6 B;  4QW9 A;  2Z30 B;  3J81 U;  5CH7 B;  4CNZ A;  1YJN S;  2OKQ A;  4BWM A;  5BR8 F;  1RLC L;  4NAS A;  1FRM A;  4GKJ F;  2BA9 A;  1NH7 A;  2MEW A;  4NWB A;  4HLB A;  4LR9 A;  5CYQ A;  1X4D A;  2AJ0 A;  3BGU A;  3EGZ A;  1Q8B A;  5HQ8 A;  2JFD A;  2ZVI A;  5K8O A;  2I6W A;  3ZZU A;  4EZ6 A;  4I2P B;  2BQU A;  4LSL B;  1NK7 A;  2A3J A;  2HUR A;  1XR5 A;  2NZ4 A;  4F4Z A;  4X4U A;  1LW0 B;  2HND B;  4NLX A;  1NJZ A;  2ZC3 A;  4DV2 J;  4MKV A;  3FC9 A;  3TUZ C;  3Q86 A;  2DIS A;  3EVM A;  3RTV A;  4ZCI A;  2XC9 A;  2X7I A;  4KYZ A;  2ZNY A;  1FNO A;  2Z56 B;  1GQE A;  1QSY A;  1UPM B;  3CB4 A;  2ASJ A;  2DJW A;  4Z37 A;  1APS A;  1U09 A;  3HF5 A;  1L3V A;  4JI4 F;  4LF7 F;  2HK3 A;  1CJK B;  2LXU A;  3WBZ A;  4Q44 A;  3IBC B;  3M2R B;  2B5J A;  2AZ1 A;  2CFX A;  4PG7 A;  3ILJ A;  1LW2 A;  5DQH A;  4ZPW R;  1IJF B;  4DFK A;  1FXR A;  2ZM6 J;  3OVS A;  1TEL A;  3J7A N;  2HYI B;  3NS7 B;  3SMZ A;  4QWD A;  1R0B G;  3L7U A;  3CCS S;  1N88 A;  1WF1 A;  3J7Y U;  1Q82 T;  1DRZ A;  2OAU A;  3H20 A;  3M30 B;  3DRP A;  4WFN Q;  1WC5 A;  4NRT A;  2GML A;  2ZH6 A;  3A12 A;  2A6O A;  4ECS A;  5DLG A;  1JJ2 R;  3HVW A;  3D4J A;  3JB9 k;  3K5P A;  2VIC A;  3N01 A;  3DLJ A;  1RT5 B;  2E1M C;  3LQV A;  4DBQ A;  4PR6 A;  2W4C A;  3U02 A;  2DNM A;  1OY8 A;  4ZHR B;  2QL9 B;  3DMJ A;  2O01 C;  2P9C A;  4YOE A;  1C1C A;  3UFC X;  1VBK A;  2ACM A;  4NEZ A;  4AUK A;  2LDI A;  3CDU A;  1T05 A;  3R1H A;  3MCN A;  2NS1 B;  3RRK A;  3ZNU A;  4OZ1 A;  3S01 A;  4DR2 J;  1RHK B;  2ZBC A;  3ISZ A;  4NA2 A;  4ZMM A;  1Y3K A;  2LCW A;  5CAA A;  2CVE A;  3I4P A;  3DOM B;  1NZ8 A;  1UW9 A;  3C14 B;  1JLC B;  3CJR A;  4FF4 A;  3QFH A;  2LDY A;  1FKP B;  3CVK A;  2ATC B;  2QMU B;  1I51 B;  4TU7 A;  4C3M A;  1D9D A;  3KLV A;  3T1H J;  1SUQ A;  2CPD A;  4ED6 A;  3CME S;  4QYZ J;  3M30 A;  3OFE A;  1EAY C;  3A3N B;  1R8H A;  1RWV B;  4HT5 A;  4KB7 A;  2CVI A;  4JI3 J;  2QV6 A;  1E6V B;  1Y3J A;  3Q24 A;  2F40 A;  4O3O A;  1VC0 A;  1VYA A;  2HVD A;  1HWJ A;  3ELH A;  3JTP A;  5I4M A;  1ACM B;  1B64 A;  4ZPT R;  2A6M A;  3KLI B;  4KR0 B;  4OHW A;  1NSK L;  2GVD B;  2DXE A;  4YB1 P;  4QU6 A;  2IMW P;  2IJN A;  4DR5 J;  3MPW A;  1LWF A;  1YSJ A;  3GR0 A;  2Q66 A;  2KZZ A;  3HX9 A;  2PMW A;  5HSP A;  1M1K T;  1MWZ A;  2FGO A;  3KYL A;  3IR6 B;  4RW8 B;  3G87 A;  2KYZ A;  4G1I A;  1NKC A;  1DTT B;  2CQD A;  3I0S A;  2R2S A;  1HWI A;  2D3O R;  1PO6 A;  4I6Y A;  1RK8 A;  2KJV A;  1VRQ C;  1FEE A;  2HS3 A;  4J5O A;  5HVH A;  4CZC A;  2GVZ B;  4FNI A;  1X4G A;  4JI1 F;  2RT3 A;  3EIC A;  1RT6 B;  2V9K A;  1Q79 A;  2QGF B;  3T41 A;  5IV4 A;  2ATL A;  2IBK A;  2DRA A;  1RAO A;  4URS A;  4XAK A;  5C2C A;  5JUM A;  2N3O A;  3SFG A;  2FVQ A;  2C42 A;  2NRE A;  1H7W A;  2BZ2 A;  3A13 A;  3HD2 A;  4DQI A;  2IY5 B;  1E6V A;  4CQ1 A;  1RT1 A;  4MIW A;  2V4J A;  5THW A;  1SJR A;  2DKO B;  5JVH Q;  1ARO P;  3V2U C;  2GMJ A;  3GFH A;  4N7T A;  2C3U A;  3OXF A;  1UVM A;  1S9G B;  1HNZ F;  4K4U A;  4ID5 B;  2E9R X;  3AFG A;  3K58 A;  2R8K A;  4DUY F;  3G82 B;  3I9Z A;  3RRG A;  4CYU B;  3Q8U A;  4ZPB A;  1HYS A;  3A3P B;  4IO9 Q;  1F6T A;  2AGO A;  2YNI B;  2HFU A;  3MEC A;  3MM5 B;  2O67 A;  4ZCL A;  2QLB B;  5GAG U;  1VRU B;  3M8Q B;  2B9E A;  1FDB A;  3T9Z A;  5IT4 A;  4EK2 A;  5IXU A;  2K3K A;  2YX1 A;  1NK6 A;  4DR4 J;  2CQ1 A;  1SB6 A;  1TUG B;  5KFA A;  3N79 A;  5KOX A;  3GFZ A;  5KFD A;  2UUW A;  1DHM A;  2K3I A;  1OQ6 A;  5ETS A;  3GIK A;  4NLR A;  2R2R A;  1BQM B;  2SXL A;  1RAD B;  3MM8 B;  2W8K A;  2V67 A;  3TZZ A;  1FDN A;  1PAU B;  5T7L A;  3ZTS A;  3T1Y J;  2Y1J A;  1M5O C;  3P8B B;  5FDL A;  1B3T A;  4FF3 A;  2HZC A;  2M8H A;  5DJB A;  3OT9 A;  5IC4 B;  4F0K A;  2AJ1 A;  3P3D A;  2NLW A;  2FY8 A;  5AJ3 F;  4ZLP A;  3HHD A;  3OHB A;  3W9I A;  1UEV A;  4ANC A;  2B7C B;  3RR8 A;  2J6T A;  5B0F A;  5GAE I;  2XCA A;  3RG6 A;  2IDE A;  1TUV A;  2XYG B;  5D4P A;  3ZZY A;  3HT3 A;  5H9E K;  1NK8 A;  3BJY A;  4DSK A;  4MKA A;  2XEX A;  2DY9 A;  3HHL A;  3P5T L;  4ZIV A;  1RHM B;  1TFY A;  4IQX A;  4C98 A;  1DTQ A;  2UZA A;  4RW9 A;  1H74 A;  4BCA A;  2GIQ A;  2BJ7 A;  2MQO A;  2QA4 S;  1XK8 A;  3FSY A;  5D77 A;  3LP1 A;  1U6B A;  4DR4 F;  1QAY A;  2HHS A;  4IH6 A;  3FFI A;  5DO2 A;  4PPZ A;  2K8G A;  4LF5 F;  2PE8 A;  2BXJ A;  1R31 A;  4DMZ A;  4CO3 A;  1MML A;  3G86 A;  1ZAX A;  4IG0 A;  4MH8 A;  4KHP J;  2RRA A;  4LR8 A;  1VFJ A;  3QIP B;  4DR1 J;  1RCO B;  1W2I A;  3IS9 B;  3OR2 A;  2QN6 B;  4CH7 A;  3UWT A;  3A1Y G;  4OI6 A;  1HNZ J;  2KL8 A;  1Y4Z B;  4ECZ A;  2F7V A;  2GHV C;  5HAO A;  3U1N A;  1R0C B;  1JB0 C;  2VA2 A;  2KYX A;  4JI5 F;  4M5K A;  4LBP A;  1JLE B;  2XGQ A;  1SC1 B;  1J5E J;  3LA0 A;  4AXJ A;  1CJV B;  1SH0 A;  1RWK B;  4ETZ A;  4K0K J;  4DL5 A;  1WEY A;  2F65 A;  4LIW A;  4IOC Q;  1YRT A;  1YRX A;  2F9D A;  1XMO F;  2PFF B;  1KQF B;  1XQI A;  5HRO B;  1EX8 A;  4XPC A;  1T05 B;  1REV A;  2MDA A;  3AXK A;  4MIB A;  4OX7 A;  4ENO A;  1M5S A;  1S12 A;  5T41 A;  3R9L A;  1RKJ A;  1KDN A;  4EEY A;  4HH0 A;  3OL8 A;  1RTI A;  3L7P A;  3MAA A;  2JEI A;  3J81 Y;  2HHV A;  3FGV A;  3MWB A;  1WEX A;  3WC0 A;  1NJX A;  3QRQ A;  2KG1 A;  4QU7 A;  1OJ4 A;  1F9E B;  3FZ2 A;  2FJD B;  3JTO A;  2BAB A;  2BM0 A;  3EMT A;  3PIP Q;  1EAR A;  1FWP A;  2BE2 B;  3A8K A;  4DV3 F;  1UFL A;  5D3G A;  1H72 C;  2ASL A;  3DN9 A;  4CH1 A;  3KJV A;  1WNE A;  2J5A A;  2QYC A;  1UA0 A;  3ULH A;  1UL3 A;  1GXL A;  1YVF A;  2AKW B;  3HHN B;  4AND A;  2ROP A;  4ZJL A;  4M5H A;  3DDI A;  1M1H A;  3P96 A;  4C8N A;  2V0N A;  3MOJ B;  3C15 B;  1OS5 A;  5KFQ A;  3W7B A;  2DY1 A;  1U49 A;  3H2L A;  3KJF B;  4C6A A;  4ES3 A;  4YME A;  4USU A;  4BBY A;  2HZA A;  3I32 A;  2IRU A;  2MST A;  5CD4 H;  1FHT A;  2XWY A;  3LH2 S;  1FXD A;  4C3L A;  5KFX A;  2G1D A;  3C6T B;  4KC5 A;  1BC6 A;  5KT3 A;  5KG2 A;  4NLD A;  1X4B A;  4LSN B;  1S6Q B;  4ZK7 M;  1O51 A;  1SJQ A;  1NPR A;  1JLF B;  5E3A A;  3PW4 A;  1U0H A;  3D68 A;  3NMR A;  2H1Y A;  2POK A;  3MFI A;  4ZP8 A;  1DTT A;  2X3G A;  2DNY A;  3MCM A;  4ERD A;  4GO5 X;  3DI6 B;  4JV0 A;  5J2N B;  3SDE B;  4U7U D;  3V6K A;  3RGI A;  2H48 B;  1LWC B;  1FRH A;  2J9D E;  4XDD A;  4U8Y A;  4DV4 J;  2WCX A;  3Q89 A;  3B82 A;  4OLP A;  4ZLJ A;  3H59 A;  2WZ1 A;  4WXO A;  4ZVU B;  5IS2 A;  2VFV A;  3QAE A;  4R8U A;  2HRU A;  4DF8 A;  4JI8 J;  4LRC A;  4KT0 C;  2LXF A;  4RW7 B;  1VQP S;  2LU2 A;  3EDR B;  2WSC C;  2IDL A;  2BJ1 A;  5JVG Q;  3GV8 B;  2KB2 A;  1HBM B;  4TKT A;  5K14 B;  3H4B A;  3D0G E;  4XK8 C;  1CEZ A;  4ZJO A;  3TEG A;  4DFM A;  2FTR A;  2LEP A;  4B3M F;  4C8O A;  4QOT A;  4AQY F;  4OHY A;  3K2Y A;  2VFU A;  2OFH X;  3EVW A;  4CLZ A;  5J2P A;  2DNO A;  4LSN A;  4CLL A;  2AGP A;  2DNP A;  2IRY A;  2V2Q A;  1D3W A;  4JV1 A;  1Y5N B;  4I6A A;  2UVW A;  3DYA A;  1X5S A;  2BJ9 A;  1K9M T;  1RA6 A;  1I94 J;  2JEF A;  4P2F A;  3NWR A;  4PUO B;  3UD4 P;  2B56 A;  4I6W A;  2CQ4 A;  3PXG a;  3KFW X;  1TL1 B;  1NSQ A;  1N5S A;  4H4K A;  3T5K A;  4DL7 A;  4JV5 F;  3THV A;  4K4X A;  2DIU A;  2MPU A;  3KDO A;  1R0A A;  1VLO A;  3M8P B;  1L3T A;  2GW8 A;  4USV A;  1F2H A;  2G0C A;  3IRX A;  3OXL A;  1B0P A;  4FXW A;  2VBX A;  3NS6 A;  5HO4 A;  3PX4 A;  3CT9 A;  2WOM A;  5B7W A;  4HL9 A;  4JI7 J;  2HVH A;  2XSJ A;  3SQO P;  1SJF A;  2ABY A;  2H3E B;  4HDG A;  5LXY A;  4CT9 A;  3TQ1 A;  2D3Z A;  1S7H A;  3R27 A;  4YFU A;  2CJK A;  2YXL A;  3SEO A;  1H6K X;  5CCM A;  3CMA S;  3RAX A;  4F3O A;  3QGH A;  4DCJ B;  3KDN A;  2Y1R I;  1HIY A;  5J1E B;  2L9D A;  2XO7 A;  1WOP A;  5B09 A;  1I94 F;  2UUB J;  3C2P A;  2K1R A;  4Q0B A;  1WEL A;  4V19 X;  5C42 A;  1J2V A;  2V6A A;  4CT8 A;  5GAH I;  2HHH J;  2BEF A;  2WK4 A;  1J27 A;  2DNQ A;  3CWJ A;  1PJ7 A;  3W5X A;  1DBD A;  5CHC B;  4N5S A;  1CVJ A;  1TL1 A;  5HI7 A;  5ETN A;  1URN A;  4DR6 J;  2DNK A;  4OZ3 A;  2YPY A;  4GVB A;  2CAJ A;  4EBE A;  2HHP A;  3JQK A;  4FKX A;  3UVJ B;  4MK9 A;  4U7U K;  1XR7 A;  4O3R A;  3HK2 A;  1S57 A;  2PSZ A;  2YBV A;  3UR3 C;  1FRJ A;  4M5M A;  1NAQ A;  2EFG A;  2K2P A;  3ZNJ 1;  4I2Q A;  3AJD A;  2J7K A;  3DOL A;  1WDT A;  2D69 A;  4Y2C A;  4IUF A;  3QAU A;  3TJ8 A;  1JXL A;  3W62 A;  1HNV A;  4KPY A;  2Y0B B;  3NKY A;  2DGU A;  2RRN A;  3TZY A;  1YJ9 S;  1NDK A;  2C3P A;  3D5M A;  4RWX A;  3R3T A;  1TKD A;  4DL2 A;  3CDE A;  4C48 A;  1JLA B;  1WHV A;  2E1A A;  2UP1 A;  4M1K A;  4MKB A;  1HI0 P;  1JLQ A;  2EC0 A;  1G7C B;  4A8W A;  4LFB F;  3UQS A;  5ETO A;  1GTE A;  1HI8 A;  3HSJ A;  3I31 A;  2C2M B;  2ASD A;  4OZN A;  4PQA A;  2OPP B;  4DN9 A;  2DCL A;  3JAM Y;  4FXV A;  4AL5 A;  1NEE A;  1KTQ A;  5L1I A;  2KT2 A;  2YH1 A;  3GFY A;  1U47 A;  1JLB A;  3GE9 A;  3VQT A;  2VG5 B;  1P1L A;  2BJ8 A;  4QR0 A;  3DLL Q;  3TI0 A;  1NPK A;  2CJQ A;  2ROE A;  2VFS A;  3GFX A;  4FYX B;  2XLI A;  2UVV A;  1N33 F;  1NJI T;  4K8R A;  4A8X A;  3J7Z 5;  2BJD A;  2WVD A;  2N7C A;  1RT5 A;  1G2E A;  1U1R A;  3IG1 A;  3ZZR A;  4DSL A;  3Q2S C;  3I6P A;  2LA6 A;  4ILM A;  1MRO A;  1WC1 A;  4QR2 A;  4M5D B;  5C24 B;  1BY9 A;  3HO1 A;  4ED2 A;  1Y00 A;  4NCG A;  2XY5 A;  2JLE A;  3CXC R;  1IM6 A;  2XMT A;  4A8Y A;  3MMC B;  1BHN A;  3BR8 A;  3MEK A;  3R97 A;  3VGU A;  3PFE A;  3PYF A;  1XBW A;  4P73 A;  3CCT A;  4YN3 B;  2IJR A;  4LBI A;  2JNJ A;  2FLP A;  5KFC A;  2VA3 A;  2ACY A;  4ZKA A;  3EX7 B;  3BQ1 A;  3TOQ A;  4B17 A;  5G0R B;  7AT1 B;  3MAH A;  3OTO J;  3RU0 A;  3MAQ A;  3RB0 A;  1FFG B;  2IA6 A;  3GSD A;  1M1G A;  3HLU A;  4M5G A;  4ZVH A;  2OEJ A;  3FCH A;  3PNI A;  4C9D A;  1NM2 A;  1VQY A;  4IFY B;  2NPF A;  1QLN A;  1TTH B;  4C8Z A;  2F8E X;  1LWC A;  2CJ9 A;  4FZV A;  3WX4 A;  2J6S A;  2R7W A;  4A47 A;  2V2Z A;  3LAN A;  1S6O A;  2DHX A;  1GK8 A;  2DGO A;  1O5J A;  3FBC A;  1A6L A;  3L09 A;  4WCE Q;  2GAG C;  3CCZ A;  2IPO B;  5DDO C;  4P6Q A;  4DCP B;  1U24 A;  2LKZ A;  1R6V A;  2OPS B;  1UJ5 A;  2AX1 A;  1VS3 A;  1BWV A;  2ZH7 A;  3HHE A;  4HKQ A;  1R3N A;  2BRK A;  4RJV A;  3GV7 B;  2HNY B;  2V5H G;  2W2Q P;  1LW0 A;  4C7Q A;  5F8I A;  2PI5 A;  3QAT A;  4HTJ A;  4B9M A;  4KHP F;  5D0G A;  3V4M A;  1VR6 A;  2NUU G;  3OJS A;  4YP3 A;  4B9S A;  2Z58 B;  3ZZT A;  2DXF A;  2NCK L;  1V3S A;  1R8C A;  2L41 A;  1T3O A;  5DLF A;  1C1B B;  1KLM B;  2HMI A;  2RQ4 A;  5KFZ A;  1BUX A;  2OEL A;  3MEG B;  2AEF A;  2CJB A;  3GV5 B;  2E66 A;  2Z0G A;  1RBL A;  1HQ2 A;  5CYM B;  2MKK A;  5L8R C;  4O4R A;  1PJ5 A;  4K7Q A;  2DXD A;  3PO5 A;  3PTW A;  1IVZ A;  3MFH A;  3M8S A;  2VIH A;  1VQ8 S;  4OX9 F;  3QZ8 A;  2LXI A;  4LT6 A;  5KFY A;  3OSP A;  1L3U A;  4WYW A;  2XSJ B;  2AJF E;  1RWN B;  5H9F J;  2KVQ E;  3T5L A;  2UXD F;  1X31 C;  1IWA A;  1NK0 A;  3TAN A;  1DQA A;  4PWU A;  3W2V B;  2Q3P A;  3KHR A;  4ED8 A;  3CJ4 A;  4KO0 B;  2CAD A;  2ZEJ A;  3W64 A;  2J7U A;  2QO3 A;  4FPR A;  3FJ2 A;  4K4Y A;  3JXO A;  2B9W A;  1T03 B;  1WHW A;  4NLU A;  4ILL A;  1RP5 A;  1HYS B;  3QZ7 A;  4ZP7 A;  1QD1 A;  1H0H B;  2HGL A;  2PGC A;  2K06 A;  4NI2 A;  5DZ7 A;  5ETL A;  5IWA J;  3EZ5 A;  3VZI A;  2DH7 A;  3MF5 A;  1X4C A;  3S7R A;  5LSO A;  5KT4 A;  3EVO A;  2CNO B;  2YWF A;  3DRR B;  3U1L A;  1ICE B;  4ED5 A;  4YDX A;  2CG8 A;  1MWQ A;  2VJV A;  4O3Q A;  1OIA A;  1YTY A;  1FE0 A;  4WJB A;  2R3V A;  3FBE A;  3T5H A;  2WVF A;  3BQ2 A;  2HIQ A;  4NX9 A;  2HHT A;  3GB0 A;  2RRB A;  3X1L B;  2FLO A;  4PPD A;  3Q8P B;  5CYM A;  1WD6 A;  3WHI A;  3M2V B;  4AD6 A;  1HR0 F;  2W2N P;  5GAD I;  2KI2 A;  3M8Y A;  4Q8F A;  2I5J B;  1RT7 B;  3AOC A;  4CLF A;  3NGS A;  4KGZ B;  4Q5V A;  2YKP A;  4ECW A;  1U45 A;  1Q86 T;  2KKH A;  1O0P A;  3IO1 A;  4N77 A;  1RGV A;  2XGP A;  3WX8 A;  4FDF A;  2E7V A;  4KBI A;  1S9F A;  3SYZ A;  4PXC A;  2MKY A;  1LKZ A;  1IUJ A;  1HA1 A;  5RUB A;  3UD3 P;  2KFZ A;  4QWB A;  5F8M A;  1EJ7 L;  3NGT A;  3GJR B;  5ETV A;  2VFR A;  4G1P A;  1KOO A;  2ZOF A;  3BGR A;  3BBF A;  1UFK A;  1RT2 A;  1TR0 A;  2AEM A;  2M4M A;  2NYI A;  1S1W B;  2QIF A;  1Y10 A;  3JQJ A;  3N6M A;  4QIW D;  5B0G A;  3CJK B;  3OUY B;  4H4K C;  4TYB A;  2C3M A;  4P7V A;  1QVF R;  3B54 A;  4B3R J;  2HEK A;  2XO6 A;  2RIL A;  3EGW B;  2WB4 A;  2JZ5 A;  3HKZ D;  3UNG C;  5MAO A;  4B3O A;  1FES A;  4Y0F A;  1ZM4 A;  3FEX B;  3LOU A;  1FI4 A;  1LXN A;  5K8N A;  3ENA A;  5KFL A;  1YIJ S;  4M95 A;  3IWN C;  2HHU A;  5A8K B;  3HJF A;  4RUB A;  5ETM A;  4U8V A;  4IG3 A;  2J76 E;  4UUW A;  2LP4 A;  3TW0 A;  4FF1 A;  4QIG A;  3BKT A;  4QYZ K;  2HAF A;  2ILZ A;  2IBO A;  1VQS A;  1H2U X;  3P45 B;  3S1T A;  5CZV A;  1U6F A;  3S6E A;  1UZD A;  3H90 A;  3MMB B;  2MXY A;  2YVS A;  1YDL A;  4QCL A;  3DLK A;  3FRZ A;  2ZWO A;  2OPR A;  3CJ0 A;  4J90 A;  2KT3 A;  3MM9 A;  3G6V A;  4O0N A;  2LYV A;  5F0U A;  5HMX A;  3MM6 B;  5SUH A;  1NK5 A;  3DLE A;  2CPI A;  3G8T A;  4IFV B;  5HQL A;  1HPZ B;  4RW6 B;  1S9E B;  3BDP A;  2B4O A;  1GH8 A;  1HW8 A;  1MU2 B;  1BMQ B;  2CNL B;  2HQD A;  3MTJ A;  4KGX B;  1VRU A;  3DRS B;  3HUL A;  3R5J B;  2E9T A;  1TL4 A;  4NLG A;  1IQT A;  4LFB J;  4N8N A;  3F41 A;  1Q8L A;  1S4E A;  1VLY A;  2FQQ B;  1TKZ A;  3QLH A;  2DHG A;  3J80 U;  3A3O B;  4ECQ A;  1U2R A;  1T3N A;  4F8R A;  4F26 A;  2GO9 A;  4Q2L A;  1NKE A;  1ZYQ A;  2RJZ A;  5IOL A;  2E5H A;  1M5P C;  1WI8 A;  3SI8 A;  1UJ4 A;  1FJG J;  3EDQ B;  3KNG A;  4DV5 F;  3DLB A;  1OQ3 A;  3CE8 A;  1TL7 B;  3DGV A;  5F8L A;  2NSB A;  2R7Q A;  4G1Q B;  1OWX A;  1T9U A;  2KH9 A;  2CPY A;  5KAK A;  2DB1 A;  1S1U A;  5KG5 A;  4RZR A;  5LJ3 Y;  4TXS A;  3TAM B;  1SCJ B;  2MJU A;  4OZ2 A;  3NNC A;  1RWM B;  3DOL B;  3OHA A;  4UUX A;  4J9V A;  5C25 A;  3CCL S;  1WC6 A;  3BO3 A;  1VBY A;  1SKR A;  2F4V J;  2JH3 A;  4N8O A;  2CQC A;  3Q8S B;  3MM6 A;  3FQK A;  4TN2 A;  3IAM 9;  2BKO A;  2BUN A;  1S48 A;  1LWE B;  4P7T A;  4CIO A;  3FBB A;  4R0J A;  3O1L A;  7FDR A;  3CC2 S;  2OGU A;  3CED A;  3H0P A;  2VZ9 A;  5GVQ A;  3VAK A;  2AYG A;  2FJW A;  2YKQ A;  1S72 S;  2KM8 C;  1YBU A;  4C3K A;  1F9H A;  3KMS A;  1XNQ F;  3NOG A;  1T9T A;  1EET A;  4J9N A;  2ZH2 A;  3C14 A;  1RUS A;  3R5D A;  1EZZ B;  2HBZ B;  3MED B;  1C0U A;  1RTD B;  1DLO A;  2QMW A;  1EQ0 A;  1FWK A;  5D0R A;  4CTA A;  3IM9 A;  2BVZ A;  3BN4 A;  3PHE A;  1W2B R;  3VGV A;  3ISN D;  2V8G A;  2Q6B A;  3HFZ B;  1ZET A;  3D28 A;  1Q1K A;  3W60 A;  2NXU A;  1ZOT A;  1U1N A;  2FJE B;  1OYE A;  4YB7 A;  2F3J A;  1EKR A;  1RB0 A;  3A8I A;  4PZV A;  3W8G A;  2V8V A;  1EKS A;  1OY9 A;  4LIR A;  2FJX A;  3D7S B;  1LOU A;  1ZM2 A;  1FFS B;  5JXS A;  4DFP A;  2J9D A;  4DR1 F;  4IR1 A;  1RU1 A;  4NCG B;  2O3D A;  2H5E A;  4ED3 A;  4LF6 F;  2N4C A;  3KJQ B;  1KD1 T;  4CWB A;  3CCM S;  2W24 A;  4PXD A;  1T03 A;  3C8Y A;  3KLG A;  2FHK A;  3MPY A;  5M2U A;  2NQP A;  3HDS A;  1JKH A;  1U1K A;  2ZH1 A;  1VQM S;  3POT A;  3M6U A;  4LF5 J;  4PQU A;  3VV2 B;  1UEU A;  4XTT A;  3GII A;  3P5B P;  3MPD A;  3OL9 A;  1HNI A;  1ZZF A;  2VC0 A;  3MR7 A;  2RAQ A;  1KP6 A;  4F3M A;  3QJL A;  2FJV A;  3D0H E;  2Z4P A;  4RWW A;  3DRP B;  5HLF A;  1QTN B;  1VQ7 S;  1NK9 A;  2AEJ A;  4WP8 A;  4DCO B;  3SZ2 A;  5HK4 A;  4CLT A;  1RYR A;  4LF8 F;  2FZG B;  1RT1 B;  4GVL A;  5KFH A;  2R7R A;  3CUN A;  4LF7 J;  2W8L A;  2UXD J;  1FO1 A;  2RS8 A;  3CW2 C;  3SIP B;  3P6Y C;  1KBR A;  4FPI A;  4A4J A;  3MUR P;  1QTM A;  3DCA A;  3NEK A;  3QO9 B;  4BC7 A;  5K8M A;  1MN7 A;  4IDK A;  4LF1 A;  1WOS A;  2E7W A;  2GJ2 A;  3BO4 A;  4KTQ A;  1WSV A;  3TVZ A;  2LQJ A;  4WWS A;  2ALY B;  3GIR A;  2BAC A;  2CJA A;  1T95 A;  2IC3 B;  4ZVE A;  1OPI A;  5A6W A;  2FLL A;  2VOP A;  2QZ8 A;  2DPJ A;  4F4K A;  1B7Y B;  2P6S A;  4LVN P;  3TZX A;  3OUY A;  3LP0 B;  1VQN S;  4L73 A;  1RLD A;  1ZH5 A;  1TAQ A;  4CLS A;  1D09 B;  4CM2 A;  4N56 A;  2CPZ A;  2J9E A;  4OV1 A;  2KHC A;  1I5O B;  3RAQ A;  2RML A;  4RL1 A;  3MGJ A;  2NYH A;  2A2C A;  3BM7 A;  4M63 A;  4I67 A;  3DI6 A;  4R5P A;  2CQP A;  5AE2 A;  5KFN A;  1RU2 A;  4DUY J;  2R8H A;  3Q8Y A;  4DJB A;  2JHE A;  4DXL A;  4YQW A;  4KFB A;  1MMD A;  2JJ4 D;  4BC9 A;  2P6T A;  5DQI A;  1D1U A;  2DO0 A;  3NBP B;  2HVI A;  1GT8 A;  2KZM A;  2XMA A;  2CRL A;  5F8H A;  4F4X A;  2HG4 A;  2VH7 A;  4TLR A;  2XI3 A;  4KV8 B;  5CA5 A;  1PYS B;  4IOB A;  5KFR A;  1D0E A;  4UW2 A;  1UVK A;  4NPO A;  3FRY A;  4RW4 A;  4DG1 B;  4TU9 A;  4DV0 F;  4DV3 J;  3W3S A;  2VPY B;  3W2W A;  1WG1 A;  1N36 J;  4NLO A;  1HD0 A;  2WBR A;  3EUN A;  3QID A;  4UQT A;  1RAB B;  3L9Z A;  1C4A A;  1UAW A;  3QT6 A;  3UDC A;  4FXD A;  2AWZ A;  2FHJ A;  5KFE A;  4TNO A;  5IM0 A;  3PAC A;  3CCQ S;  2LEB A;  1N5T A;  2F9J A;  2HFS A;  3OTD A;  3QLH B;  1QAI A;  2M2B A;  5LL6 d;  5BYS A;  2CQ3 A;  4J9P A;  1XMO J;  4DU7 A;  3NGR A;  2DNG A;  4ZIT A;  5A8R A;  3IS9 A;  2Z8Q A;  4ICL B;  4I2P A;  2ZBR A;  4MYU A;  2V94 A;  2EXU A;  4DV5 J;  4O4G A;  1QSS A;  1LNQ A;  1PC4 A;  1ITP A;  1YX2 A;  3H4D A;  2GMH A;  1KQK A;  3NCQ A;  4EBC A;  2AF6 A;  4ZPA A;  4ID5 A;  5C24 A;  4ES1 A;  4RW4 B;  2U1A A;  2R4F A;  3AXM A;  3KHG A;  5LOQ A;  3OR1 A;  1KON A;  3TO8 A;  2APO A;  3D54 A;  3IC1 A;  3RRH A;  3QYY A;  1CJK A;  4ED0 A;  2OIH A;  2GX8 A;  4JI7 F;  4X64 J;  5L46 A;  4LF4 J;  3MED A;  3R2D J;  2NPI A;  2G2Y A;  2RU9 A;  3FBF A;  1HMV B;  1T0T V;  1XEZ A;  2W1B A;  5ADZ A;  3V81 B;  4V19 J;  2OTJ S;  4A8Q A;  1UFW A;  5E3C A;  1SPB P;  3IR5 B;  1TVR B;  3ENV A;  3UW1 A;  3CC4 S;  1U2C A;  3K8W A;  2BJ3 A;  4BWJ A;  1AUD A;  2QLF B;  1LQ9 A;  5T7L B;  3KNA A;  2MQN A;  2VPX B;  3Q8V A;  4L3N A;  1HQE A;  4M5L A;  2KT5 A;  4P2X A;  5F41 A;  4DL0 C;  5HMZ A;  2AYB A;  2ZKT A;  4LRE A;  5I42 B;  3AH6 A;  4R8U B;  1QUV A;  5I3U A;  5HVG A;  3BPS P;  1LWX A;  5DET A;  1GEH A;  4NML A;  5B0B A;  3C15 A;  1AUS L;  2HQF A;  4DN0 A;  3W1Y C;  3JYT B;  4WP9 A;  2MLY A;  3MD3 A;  5DQG A;  4B9L A;  1QE1 A;  2IVY A;  1RAF B;  2XCP A;  5E33 A;  2B4P A;  2C2R A;  1IKY B;  2QJ3 A;  2Y1L B;  5E3R A;  2W7P A;  4O44 A;  1LFW A;  1RHR B;  1T9Y A;  1PC5 A;  2M88 A;  1WHY A;  4OYI A;  3VAJ A;  3BGL A;  4H54 A;  2KXN B;  3DLH A;  3DGP A;  1KQG B;  3BSC A;  4M94 A;  4TYA A;  1CPZ A;  1JJH A;  3HVR A;  4QWA A;  2B51 A;  1FEH A;  2HLU A;  3PJW A;  4DV0 J;  2MJN A;  2KFN A;  1BLU A;  2QA1 A;  2YKM B;  2C2E A;  3RZA A;  2ZDP A;  2YY3 A;  1BXN A;  2YNH A;  3B4M A;  3F44 A;  1FKP A;  1JLB B;  4QQB A;  4F67 A;  4ZLN A;  3I5A A;  4EMD A;  2AT1 B;  2MZJ A;  3P49 B;  2WSF C;  3F0N A;  4KY3 A;  3H8Y A;  2JX2 A;  2RQM A;  3D9B A;  2RF2 B;  2B4V A;  1S1U B;  5BXI A;  5L1J A;  1HR0 J;  3IR7 B;  4Y00 A;  2YNG B;  1K8A T;  3NWG A;  1H7X A;  3BBC A;  1U8S A;  1OSD A;  1IBC B;  3SQG A;  2Z57 B;  4RX6 A;  3G82 A;  3QFW A;  3NGD A;  2AV5 A;  1FNX H;  1YQH A;  4EFA C;  4A8K A;  4DL3 A;  1JX4 A;  5AXL A;  3PY8 A;  4JV5 J;  3D6T B;  4J91 A;  4HHJ A;  3BQ0 A;  3ET6 A;  4NLY A;  2CDR B;  4C8M A;  3S8S A;  4DV1 F;  4NZ6 A;  3GPA A;  1CJU B;  2FGC A;  2CQ2 A;  2HSE B;  5ETP A;  2M9K A;  3MTK A;  4J37 A;  3MMA A;  2LQ8 A;  3I96 A;  1OY6 A;  1U4B A;  2R7V A;  2W2O P;  3DLG B;  3I0S B;  3M2U B;  3D2W A;  1BD6 A;  2LEC A;  3WIV A;  4F7V A;  4DR5 F;  5DS7 A;  1S49 A;  4WE1 A;  2CNN B;  2FPH X;  4UZB A;  5SZT A;  3MXH P;  1YBA A;  1HKA A;  2VDI A;  1XNR J;  1Z1Z A;  4WP3 A;  1KR4 A;  1NHV A;  3PEJ A;  4N41 A;  2RSQ A;  5D4O A;  4EU0 A;  4TLQ A;  2BMB A;  7FD1 A;  1D8Z A;  3F56 A;  5J2Q B;  2FY1 A;  2C2K B;  2YNG A;  1BQN A;  3TA2 A;  4JI8 F;  3U27 A;  3I55 S;  2QSF A;  2O1P A;  3W2W B;  2A10 A;  3RBX A;  2ZZM A;  3MEE B;  4KH1 B;  1B70 B;  4ES2 A;  3DHW C;  4FKY A;  1F3F A;  1S9G A;  3LGH A;  3LUY A;  2E1C A;  4Q7A A;  5IV3 A;  1PSD A;  2C2O B;  2C2Z B;  3DNC A;  5E0O A;  5CZX A;  2IRX A;  4GMK A;  3V6J A;  3H40 A;  1F60 B;  2DRB A;  2OJ3 A;  1C1B A;  2W25 A;  2ZZN A;  3QRP A;  3NAI A;  3LWM A;  4MFB A;  1TL3 A;  2VV5 A;  2XHC A;  4USH A;  1IJE B;  2CQG A;  5EGY A;  1H2T Z;  5KFP A;  1F5B A;  4CDI A;  4R25 A;  4D3G A;  2JC0 A;  4K4W A;  3MDF A;  3FDS A;  4WPA A;  3HKW A;  2YQ0 A;  3KMQ A;  4ZCM A;  3RR7 A;  3M8Q A;  4PWD A;  1WDD A;  1XWL A;  1WC3 A;  1FWL A;  5FDL B;  1A0O B;  3CJT A;  5AXN A;  4Q8E A;  4QBU A;  2VB6 A;  3BGF A;  3ZO7 A;  5DDR C;  4A8S A;  1TP7 A;  3LGN A;  2R8J A;  2B6A B;  3FCV A;  3R6G B;  2EG1 A;  5L9X A;  5KFG A;  4YHH F;  3EJM A;  4WFX A;  2EKY A;  4DS4 A;  2HIY A;  2HQI A;  4JP8 A;  4KO0 A;  4J9S A;  3SV4 A;  2NXE A;  1ZTT A;  3IXQ A;  4DX6 A;  1Q4R A;  1H2V Z;  3HSG A;  4MTP A;  3AJ1 A;  2GJF A;  4CO5 A;  5ETR A;  3OTO F;  3B4D A;  3M6W A;  3I56 S;  1TZ0 A;  1D9F A;  1N6Q B;  1IBM J;  1NUE A;  1RWX B;  4FVC A;  2CG4 A;  2UXB F;  2WHO A;  2MKC A;  3RBZ A;  3GJS B;  4ZP9 A;  5E3Q A;  4NLS A;  3TYT A;  2EK6 A;  3EZO A;  2QFJ A;  2QE5 A;  4P9S A;  2OEK A;  3IFE A;  2B9X A;  4CO0 A;  5LJ5 Y;  3NNA A;  1TVR A;  3GLJ A;  4PG5 A;  2Y3Y A;  4NI2 B;  4UZC A;  5A2Q U;  3MCS A;  2HLT A;  2MYF A;  3C16 B;  2WRM A;  3I87 A;  5M2R A;  1U6Z A;  4J7C A;  4RKU C;  4P2M A;  2DNZ A;  3LAL A;  1HWL A;  2Y0S D;  3CDW A;  1VCT A;  3UN5 A;  4ATN A;  4JBC A;  2QX0 A;  1UTA A;  1QUP A;  3D6F B;  1WOO A;  3TA0 A;  4A48 A;  4W92 B;  5KOW A;  4LF6 J;  4R5P B;  1FT8 A;  2HPU A;  3KUE A;  4YHH J;  3M2V A;  2O66 A;  4RO0 A;  3I0R B;  2FUG 9;  3BYP A;  2PA3 A;  3BPD A;  3T1A A;  1Y5L B;  2YH0 A;  2ZUA A;  3JQM A;  3O2I A;  4DPY A;  4F4Y A;  1XC9 A;  4FBU A;  3I5B A;  2Z2Z A;  5GMD A;  3V4I A;  3BKU A;  4WBF A;  2VPW B;  3OV7 A;  3FEZ A;  1N0V C;  2XG8 A;  4DX7 A;  4MT1 A;  1YJR A;  3HFK A;  5L1L A;  4UTG A;  1DZ5 A;  4ZA1 A;  4DG1 A;  3PJX A;  4ILR A;  3C6T A;  5BR8 J;  4GKJ J;  4CLK A;  2YPZ A;  5HAN A;  2ZZT A;  1WWH A;  2Y1I A;  4C8K A;  3M8Z A;  1JLF A;  4OLO A;  3KG1 A;  2B43 A;  1SQE A;  2G9O A;  4YUD A;  4FYV B;  4KQZ A;  1IKX A;  4NMX A;  3LP2 B;  4Q0B B;  1HBN A;  2F63 A;  2XNR A;  1AT1 B;  4PXB A;  2QEX S;  2RHS B;  1KFD A;  2OSR A;  5HL7 Q;  4I7F A;  5F3Z A;  2CPF A;  1DY3 A;  3BEG B;  3KLF A;  3AOA A;  3HD1 A;  3I9V 9;  4DPO A;  2C28 A;  2J7W A;  2P8I A;  3CJS A;  3FMB A;  2DR5 A;  1UEK A;  5HJY A;  2BRL A;  2XMV A;  4NA1 A;  1EB0 A;  3BYR A;  1VC5 A;  3KTQ A;  3CJ8 A;  2AP6 A;  4KHM A;  1Q53 A;  4F50 A;  1RAG B;  2OPR B;  1VC6 A;  2MY7 A;  3OTB A;  2DGX A;  2MZS A;  2IAJ B;  4NYO A;  1FA0 A;  1I3O B;  2L9W A;  1S1V B;  3MM7 B;  3JSB A;  4PKD B;  3KK3 A;  1S9E A;  2OPQ A;  4TY8 B;  1C1C B;  1HLW A;  4CO1 A;  4WU3 A;  4CLU A;  2UUB F;  4MK7 A;  2IYI A;  4KGV B;  3DLE B;  1ZM9 A;  5LMN J;  4RUA A;  3MR3 A;  2A0F B;  4NL5 A;  3IAS 9;  1IR1 A;  2CQI A;  1WJ9 A;  4AXI A;  3L4B C;  5DDQ C;  2ZH9 A;  4U67 Q;  4OYA A;  3OLA A;  5J2N A;  3GON A;  1OO0 B;  4A8M P;  3MEG A;  1HBN B;  2PT0 A;  2GV1 A;  3ZZO A;  1CUL A;  1U1M A;  2GA7 A;  2IJF A;  1S99 A;  1KEK A;  3CIZ A;  1OYD A;  1RZM A;  4RNN A;  1SKS A;  3RAM A;  2F4V F;  3DXB A;  4I7F B;  3KLF B;  2C2D A;  2IM0 A;  1Y0H A;  5B0E A;  2M8D B;  1OPZ A;  4A8F A;  4JI5 J;  1FER A;  3IGV A;  4UF4 A;  4Q45 A;  1N54 B;  1ZTW A;  1N5Y B;  1KRP A;  3DXS X;  1VQL S;  3M1V B;  4U7C A;  4Y34 A;  4KKO A;  5GAE U;  4ECX A;  2XBP A;  4ETX A;  1QY7 A;  1TMM A;  4MAK A;  4C0B A;  1VQ5 S;  1FJE B;  2LQ5 A;  3VTI A;  3CIM A;  3DC2 A;  3OW2 R;  2C2N A;  2IHR 1;  3KHL A;  4LFA F;  1QE1 B;  2XWX A;  2RD5 C;  2KRB A;  4PAA A;  4F02 A;  1IQZ A;  2BKN A;  4JUZ A;  1KVI A;  1LWF B;  3Q23 A;  2IFX A;  3BDE A;  3KG0 A;  5D4L A;  3VVT A;  4CLW A;  4U6P A;  1X4E A;  4USJ C;  4F2S A;  4NLP A;  3RBD A;  4DI6 A;  4RW8 A;  3DGP B;  3TUI C;  2FVS A;  4USK A;  4ECT A;  2FIU A;  2HRT A;  1GXT A;  3E01 A;  3UDE A;  2CWK A;  4GKK J;  1X0P A;  1K44 A;  2IA0 A;  2JL9 A;  3R7N B;  1HBU A;  2KG0 A;  5L1K A;  2D3O 1;  4LQ3 A;  1Q8I A;  1O6X A;  2PEH A;  3L7O A;  1JNR B;  1N36 F;  5JMN A;  2LFV A;  3AT1 B;  1LW2 B;  5D4N A;  5EHH A;  1YJU A;  1RTD A;  2P2C B;  2OSQ A;  3J80 Y;  3E8O A;  3VAL A;  4NEY A;  4DL4 A;  2OD6 A;  1YJV A;  5HJX A;  2VFT A;  4L3K A;  4OYO A;  3KHH A;  3G96 A;  2EI5 A;  2VOD A;  1CLF A;  1VJQ A;  4DV4 F;  1S76 D;  4F25 A;  1FJC A;  1PYO B;  5HN0 A;  2F8H A;  1X4A A;  5KG1 A;  2BOP A;  1N0U A;  5CYJ A;  2RUS A;  1HNV B;  4IRK A;  3K17 A;  4C8L A;  3CC7 S;  1A9N B;  4BLG A;  1S6U A;  1S0N A;  3M4X A;  2E1P A;  3SCI E;  2GS8 A;  2KM8 B;  1Z4U A;  4XDC A;  1NHU A;  2V63 A;  5DDP C;  4HYK A;  3HSD A;  4URQ U;  3MMJ A;  2E5G A;  2YKN A;  3DHX A;  3IMQ J;  3W8P A;  2XLK A;  3OFH A;  5A8W A;  4I0W A;  4L75 A;  4ZPD A;  1HI1 A;  1S6Q A;  4PG8 A;  4K5S A;  1LK7 A;  4NA3 A;  2JDJ A;  3SCL E;  2V8D A;  4PAB A;  3R8Y A;  3OJU A;  3G6Y A;  2LEA A;  2WON B;  1VI7 A;  1D9A A;  2E1R A;  1N52 B;  2H5I B;  3BS9 A;  2RHQ B;  2QG9 B;  2HNZ A;  2YX4 A;  3CTR A;  3GYG A;  4JOU A;  1I6J A;  3M2U A;  4B3S F;  1HNW F;  4YY3 F;  2NSC A;  2JLG A;  4OI0 A;  1C2P A;  3DFE A;  4WTO B;  2AX0 A;  3DOK A;  1VHI A;  2DIV A;  2N7Y A;  3EE3 A;  2XZD B;  3NLC A;  3TX8 A;  4G1Q A;  1KS2 A;  4OJH A;  4PYA A;  2VOO A;  3GG1 A;  1GMW D;  1RYS A;  5AJ3 J;  4J9Q A;  1X7V A;  2W4D A;  3K5O A;  1IXK A;  2VKR A;  3TR5 A;  4B02 A;  3HP6 A;  2VHG A;  2VON A;  1RTZ A;  4M5D A;  4IOA Q;  3EZU A;  1ZA2 B;  2BAN B;  2D41 A;  3LTO A;  4JI1 J;  4L6V 3;  2XMU A;  4G65 A;  4WXW A;  4OYZ A;  1NXI A;  1Q81 T;  4JV2 A;  2IC3 A;  3MMC A;  3RB4 A;  6FDR A;  2VUG A;  2WB1 D;  4ECY A;  2MKI A;  5LSL A;  1H98 A;  5DRK A;  1IKX B;  3GP9 A;  3ZTO A;  1VIO A;  1Q8K A;  3DRS A;  2IVF B;  4QPT A;  3PW7 A;  4OI4 A;  1TQL A;  1IR0 A;  1NPP A;  1RI7 A;  2GZO A;  4ELU A;  1RAI B;  3FFI B;  2B7B B;  4MMO A;  2COL A;  4FYY B;  1H73 A;  1RQ0 A;  2F4F A;  1N4L A;  3BR9 A;  4D3H A;  3ZTQ A;  4DL6 A;  4IG0 B;  2V2K A;  3PM9 A;  3CNQ P;  2NXN A;  1SKU B;  3GTY X;  2DYA A;  3I4H X;  4JI0 J;  1UMJ A;  3ZTR A;  1YG0 A;  1NK4 A;  4J9U E;  5I3U B;  4ECV A;  4Q2M A;  3O8W A;  3B6B A;  3CJ2 A;  4KHR A;  4OV6 A;  2HGM A;  1CS4 B;  2HAI A;  2GQQ A;  1UVJ A;  2WOM B;  1NDP A;  3IM8 A;  5KG4 A;  3CD5 A;  3QGG A;  3UN3 A;  1Q5V A;  3WQP A;  4Y65 A;  3N0V A;  4OL8 A;  3P4U B;  2C3O A;  5D6G A;  4DV6 F;  4E0D A;  1N6Q A;  1MWY A;  3UNY A;  6AT1 B;  2KXF A;  3MR2 A;  1IN0 A;  1VK8 A;  3Q22 A;  2W9B B;  1BGX T;  3GYN A;  3GCX P;  4NCB A;  1X4H A;  1DUR A;  3M05 A;  3MUV P;  3CJK A;  3GQC A;  2VDH A;  4W4M A;  5B0C A;  2AJ4 A;  2FYX A;  2CIM A;  4WKY A;  1VK3 A;  1P9Y A;  3JSR A;  2D9P A;  1WUU A;  3NXZ A;  4WFA Q;  3M9N B;  1NCL A;  2AZ3 A;  2UUA J;  4ED4 A;  4CH0 S;  2HHW A;  4EO8 A;  4FS1 A;  4DR7 F;  1RSC A;  2ZKU A;  5A8R B;  3RB3 A;  3T3F A;  3C6U A;  3GCW P;  4ZP6 A;  1HNI B;  3TUP A;  3QWU A;  2M3D A;  3HVT B;  3OTE A;  4B3M J;  4OJ3 A;  4RU9 A;  3Q8Q B;  3PKM A;  4KKO B;  2EFN A;  4F4A A;  4IO1 A;  2W9C B;  1IKV B;  1FKO A;  1KVK A;  5A76 A;  3FK4 A;  1SL0 A;  2XNQ A;  2DR7 A;  2M52 A;  3OQ2 A;  4CI0 B;  4IKA A;  3T1Y F;  1SJ3 P;  2BE9 B;  3G2X A;  3OVA A;  5FD1 A;  2UXC J;  3UCZ P;  1CS4 A;  1YWX A;  4H4M A;  1KQS R;  1FTR A;  5KFI A;  2RIJ A;  1NND A;  2DEI A;  2XHW A;  5KFW A;  2KFY A;  3CPW R;  1SIZ A;  4EYH B;  1RBA A;  4OYM A;  3FCW A;  2CJX B;  2YNF B;  1V5I B;  3EGV A;  4ZS6 A;  2G4B A;  3T1H F;  1ZAW A;  1SQG A;  3W63 A;  2DGS A;  1LFP A;  5HBM A;  2RQC A;  4C11 A;  4K4T A;  1UWB B;  2DEJ A;  2HQC A;  3PR4 A;  4OI2 A;  3BSN A;  2XYP B;  3KUG A;  5KG0 A;  4JYA F;  3FVY A;  1HHT P;  2CPE A;  1ZBT A;  2VAS A;  2VBW A;  5B0D A;  3LP0 A;  3THP A;  4DR2 F;  3M6V A;  1L3S A;  3LWL A;  2GQ2 A;  4LF9 F;  1JWW A;  1VRT B;  1RWU A;  3QMQ A;  1K73 T;  2HHX A;  2HGN A;  1Q0N A;  2FJA B;  2X1B A;  1UKU A;  2OML A;  2RUG A;  3D1H A;  3FUY A;  2MQQ A;  1UA1 A;  1AXQ A;  1KTV A;  2CQB A;  2DGW A;  1XJW B;  3M32 A;  3N5B A;  1NU4 A;  4X4S A;  5GAD U;  3N4W A;  2NXC A;  2UUT A;  4XO0 A;  5LMU J;  4O3S A;  3EGN A;  2KN4 A;  2EG2 A;  3T9N A;  1X5O A;  4H4M B;  2EFP A;  2UV8 A;  3TAM A;  4PCQ A;  3BO2 A;  1KFS A;  2D7S A;  3DU6 A;  5H1S V;  3K5L A;  1P9Q C;  2J0W A;  1X5P A;  2DT9 A;  1T11 A;  2FHJ D;  2LQ9 A;  2QL7 B;  5HP1 A;  5A8W B;  1LV5 A;  1SL1 A;  2DPI A;  4E8U A;  3D6M B;  3O3L A;  4FS2 A;  1U1L A;  2PDA A;  3CCJ S;  4OJ1 A;  2V4Q A;  2AQ4 A;  1IKY A;  1VIX A;  4OZL A;  4CRJ A;  5LSR A;  5DM6 Q;  4JI4 J;  1PIE A;  2H4W B;  4MK8 A;  5AXM A;  4DEZ A;  1FRL A;  2L3M A;  4AE5 A;  4ER8 A;  4P2S A;  3MOZ A;  3MPU B;  1RKI A;  1CSJ A;  4QW8 A;  2WW4 A;  4YDD B;  3KK1 A;  4B3R F;  2VBY A;  3PW0 A;  3N28 A;  1X8D A;  4X4P A;  3HHK A;  3VAG A;  1R8A A;  4RR5 A;  4DV2 F;  1FJ7 A;  1T9W A;  5EX0 A;  2XMK A;  3U1M A;  1WI6 A;  1YKW A;  3VAI A;  1NO8 A;  4DZD A;  4JI3 F;  3TJ9 A;  1WC4 A;  4HTI A;  4P74 A;  4JB8 B;  2VJU A;  4NLV A;  2BQR A;  1NJY A;  2M70 A;  5CQG A;  1HNX J;  1RTJ B;  1RWW B;  2PFD A;  3KKF A;  3NL0 A;  4EWT A;  3ADA C;  1GTH A;  1RIS A;  1T9X A;  1T8E A;  1MMN A;  4URG A;  5KT2 A;  2ZJQ Q;  1VBZ A;  3N9U C;  1S0M A;  3ONQ A;  1M0S A;  2PN6 A;  5IZH A;  1FVQ A;  3OXG A;  1KN6 A;  1S0O A;  2FHO B;  1WKJ A;  4CLY A;  5DM7 Q;  3W5Z A;  2RDD A;  4WK3 A;  5L38 A;  2AIR B;  2VD3 A;  4C0H A;  3D1O A;  4UOH A;  2AU0 A;  4LRF A;  5ETQ A;  4PYD A;  3R5G A;  1JKH B;  4PQU B;  3H5Y A;  3E01 B;  2MB0 B;  3RJM B;  1VBX A;  4KGM A;  1NZA A;  4X65 F;  2V9W A;  3CD6 S;  4ID8 A;  3H5X A;  5AXK A;  2VQE F;  4C8Y A;  5DG7 A;  2R7X A;  5GAG I;  1U25 A;  2J8S A;  4Y3C A;  3LAM A;  4EI2 A;  2D9O A;  4GVB B;  3SDE A;  4X4R A;  5HLF B;  4I4B A;  4OI1 A;  4WE1 B;  8AT1 B;  4RW7 A;  2CZ4 A;  4NE9 C;  4ZVF A;  3IRW P;  1HQU B;  2XMJ A;  2MGZ A;  4LSL A;  4O3P A;  4OHZ A;  8ATC B;  1FD8 A;  1SQF A;  3NCR A;  3THT A;  5K8P A;  4RBU A;  3MM9 B;  5IFM A;  3MPV A;  2XMM A;  5GME A;  4X62 F;  2Q1L A;  4LFC F;  1V6H A;  5K9F A;  1UCN A;  3MMB A;  4F04 B;  4WKR A;  3QO9 A;  4DSI A;  4JI2 F;  1WOR A;  4DPW A;  3NAH A;  1YZ6 A;  3IWX A;  1N48 A;  1FXL A;  3K89 A;  5CD4 A;  4DV1 J;  1DAR A;  3GYX B;  2DH8 A;  1SIW B;  4YR2 A;  1X9W A;  1VDH A;  1RT4 A;  1SJ1 A;  3LGM A;  4ZJQ A;  1EET B;  1HD1 A;  2ZH4 A;  2YKO A;  5EWE A;  2ZIT A;  3OD2 A;  1ULR A;  3GU0 A;  4FN5 A;  1SH3 A;  4OJG A;  4TY9 A;  4A8O A;  2MQP A;  2GGP B;  3GIJ A;  3H5S A;  4FF2 A;  2V50 A;  1DLO B;  3AOD A;  4LSZ B;  4NXM F;  1SKW A;  3NGU A;  2CWX A;  3CJ5 A;  2LA4 A;  2GVZ A;  3H2U B;  3FKB A;  1ZS6 A;  2EFO A;  4QIE A;  1AA1 B;  3LPY A;  1WG5 A;  2OO4 A;  2Z2M A;  2FDN A;  2DBB A;  4Z7Y A;  3RW7 A;  5KFU A;  3CCR S;  1CC8 A;  3ZZZ A;  1HWU A;  2BE2 A;  1HQE B;  2HFV A;  3GMG A;  1HHS A;  4CLP A;  2A2D A;  1X0F A;  2Z2Y B;  4ALZ A;  2MKS A;  3RUB L;  2HBR B;  4F0H A;  1K1Q A;  3V6H A;  4ZPC A;  2RF2 A;  3G6X A;  4ZDN A;  2L08 A;  2MLX A;  2GC8 A;  3CO0 P;  3IRX B;  4JI6 J;  1TUW A;  3PYG A;  2JRS A;  3BSA A;  2G0J A;  4KV8 A;  4DV7 F;  3R2C J;  1X4F A;  2DR9 A;  3C3L A;  4OYW A;  2BAN A;  5FII A;  4PWW A;  3KLH B;  4P71 A;  2MKH A;  1OMS A;  3HVA A;  2W7A A;  2B8P A;  5A6P A;  2WW8 A;  1AYE A;  4AT1 B;  4C11 B;  5JJB A;  1GNK A;  4O44 B;  2I38 A;  4DQR A;  1SJ4 P;  1L5U A;  2D1C A;  1J5O B;  5A0Y A;  1HFE L;  1F9F A;  1RAH B;  2CJY B;  5J1E A;  3C19 A;  2QA4 G;  1AFJ A;  3DOM A;  3PYE A;  1D8Y A;  1PAE X;  1PGZ A;  2MZR A;  4UT4 A;  4ZPV R;  1C0U B;  1VRT A;  3TA1 A;  1SC6 A;  1N5V A;  3FSX A;  2EFV A;  2HHQ A;  3RBE A;  4FVM A;  3VVU A;  4X4O A;  4X4T A;  1E6Y B;  1UPP A;  5LMN F;  1X9M A;  1BE4 A;  3QPI A;  3M32 B;  4O0I A;  1JLC A;  2FZK B;  1A7G E;  4MYT A;  5E3P A;  1U7L A;  4ECU A;  3K57 A;  4WIQ A;  2ALZ A;  3H5U A;  1YGY A;  4DX5 A;  4ICL A;  3KUH A;  1JK9 B;  1TL5 A;  2ZC4 A;  1QVG R;  2DD8 S;  2ZOG A;  2V2V A;  4QZV B;  4ED7 A;  2UVU A;  1TFW A;  5IT9 U;  2P9G A;  1TV6 B;  2IM2 A;  2W01 A;  2DNR A;  2XS5 A;  2ADB A;  1QJH A;  2AYE A;  1K47 A;  1T94 A;  1T9V A;  5HP1 B;  4OIX A;  1RA7 A;  2E29 A;  2MQL A;  4NYP A;  2RU3 A;  3JSM B;  3K5M A;  1YRU A;  2VPZ B;  3BGO P;  3KLG B;  4ZN3 A;  1RBO B;  3G8Q A;  5I3P A;  5U47 A;  3OR1 B;  2EPI A;  2JFK A;  5C2G A;  5KT5 A;  4HAC A;  1CJT A;  1Q7L B;  2MZQ A;  2YWE A;  4QR1 A;  1UZH A;  1NKB A;  4EYI B;  4CCH A;  1CJU A;  2CPJ A;  4QIF A;  4X4N A;  1S79 A;  3L95 X;  3DDN A;  2MQM A;  3F73 A;  4DQS A;  1N5Q A;  1NDL A;  1KVJ A;  2K7J A;  1U1O A;  3FSI A;  1UET A;  4K2J A;  1TKX A;  2YX7 A;  4Z2X A;  1RT6 A;  2FVR A;  1JLQ B;  3AB2 B;  3T19 A;  3UE2 A;  1SC3 B;  3H7H B;  3HVT A;  2VU5 A;  2VG5 A;  4Q43 A;  1RAJ A;  5IT0 A;  4KFB B;  1S6P A;  1S1X B;  4G3I A;  5CXT A;  2QTW A;  1K0V A;  1U0S A;  1V5V A;  5I42 A;  1XER A;  2CZ9 A;  1B7F A;  4HH1 A;  5ITH A;  1WEZ A;  3IWL A;  3MM7 A;  4J9M A;  5H9E J;  4DWI A;  2YTC A;  3OPK A;  1SI9 A;  2OI2 A;  5D15 A;  3TEH B;  4DSF A;  1HNX F;  3KJN B;  2ZWP A;  4RLE A;  2EKN A;  2GFF A;  2MZT A;  4BHQ A;  5DZ6 A;  2E5J A;  3SSS A;  2GQC A;  4DR3 J;  2RB7 A;  4AL7 A;  3ICL A;  4IRC A;  4LF2 A;  4NXM J;  2FC9 A;  5F0W A;  2GCF A;  2DGV A;  4L74 A;  4RBV A;  3G9C A;  3QGP A;  3HHL C;  3VCD A;  3I82 A;  1S59 A;  4KRW A;  5IC6 B;  2ZHO A;  3CF5 Q;  5D8H B;  2QLW A;  4DS5 A;  3ISN C;  4NLT A;  1NME B;  1I1G A;  4I69 A;  2YNI A;  1AZS A;  2PMH A;  2JC1 A;  4LRA A;  3ETM A;  4DHV A;  3GIL A;  2DR8 A;  4KE5 A;  3EPG A;  1EIY B;  5DG8 A;  2R7T A;  2KDO A;  2D3U A;  4N76 A;  1J5E F;  1VQ6 S;  4RNM A;  2GAH C;  4WFY A;  1CUL B;  2DNL A;  2GIF A;  2P5V A;  2FZC B;  4M5J A;  4U95 A;  1U02 A;  2VQF F;  1B0T A;  2UXB J;  2I5J A;  1N33 J;  1T7P A;  1H3D A;  4K2X A;  1UWA A;  3ZZP A;  4B9U A;  4O4G B;  2PMZ D;  4DR3 F;  4OYX A;  3G71 S;  2KXH A;  3MM8 A;  1CG2 A;  1HAR A;  1Q16 B;  2XS7 A;  2ZE2 B;  4KH0 B;  1KC8 T;  8RUC A;  1NBE B;  3PDN A;  2MGZ B;  2ZH8 A;  2M7S A;  3OSN A;  3C66 A;  4QYR A;  1FKA F;  4S0M A;  2X3D A;  2HNY A;  3PRV A;  4AFF A;  1U1Q A;  2CQH A;  2GHW A;  3A4T A;  2E7X A;  3UDV A;  3PEH A;  4RBT A;  1JLG A;  2I9S A;  2AD9 A;  2AYM A;  2OPS A;  3BV8 A;  1SC4 B;  2FLN A;  2B4U A;  3Q8R B;  2DRD A;  2HK2 A;  3ENQ A;  4LJM A;  6FD1 A;  2XB2 D;  2GIR A;  4OYB A;  5EX3 A;  4CYU A;  1KLM A;  1T02 A;  4OX6 A;  4UOC A;  3UR0 A;  3M9M B;  4DLG A;  2UUC J;  4ZIW A;  1UVL A;  3UCG A;  3CMQ A;  1NB2 A;  1CBK A;  2N82 B;  2V68 A;  3C16 A;  3KK1 B;  4DSJ A;  4MJK A;  4J9R A;  1P1T A;  1B0V A;  3PZP A;  1IR2 A;  3HPO A;  5J2M B;  1TMJ A;  3WC2 A;  2HMI B;  4KIA A;  2ZBI A;  1PBA A;  1SUQ B;  3JAM U;  1AB8 A;  1F1B B;  2JVO A;  4WU2 A;  1R89 A;  2K7K A;  2X1A A;  1F5A A;  4IG3 B;  5MLC V;  1BQM A;  2RS2 A;  2XZT B;  4ZVR B;  3TRG A;  4YR3 A;  3TX0 A;  3NMA A;  4A46 A;  1HW9 A;  3AA9 A;  1X5T A;  2OLW A;  3MD1 A;  4HVZ A;  1RT3 B;  2B3T B;  2G0I A;  5F9L A;  4DF4 A;  1NJW A;  1QAJ A;  2NUH A;  5HMY A;  1Y5I B;  2U2F A;  2YWH A;  3DLK B;  1WKL A;  1VQ9 S;  3QRR A;  2M0G B;  2ZM6 F;  3SSQ A;  5BJR A;  3MCO A;  4RUH A;  1PYT A;  4NOH A;  4O23 A;  3KLE A;  1PBU A;  3HCX A;  3PX0 A;  4UY8 T;  2YKN B;  2MTL A;  5HRO A;  3HZG A;  3CJ3 A;  3Q0A A;  4LRD A;  1R43 A;  3CD7 A;  5B08 A;  1RTI B;  1HWK A;  3C46 A;  2YWK A;  3O6Q A;  2IMO A;  1FDD A;  2X1G A;  3RW6 A;  1R8P A;  1E6Y A;  2C1E B;  1REV B;  2VBZ A;  3DYA B;  4P52 A;  2MKJ A;  4BS2 A;  4NLQ A;  2J0Q D;  3PG9 A;  5G0R A;  1R6Y A;  2YNH B;  3V81 A;  1S0V A;  1RWO B;  1REG X;  2QYG A;  2XLJ A;  1B4S A;  2E5I A;  2H9Z A;  2HNZ B;  2ERR A;  2QA2 A;  1RTH A;  2XS2 A;  4IFY A;  2JOQ A;  3O5T B;  3HM9 A;  2W9C A;  3M9O B;  1Q5Y A;  2B8Q A;  4YS2 A;  4HHU A;  1JJ4 A;  1JNZ B;  4N47 A;  1EQM A;  2R2T A;  4OI3 A;  4EGL A;  4UY8 5;  4DV7 J;  3JTN A;  2OUG A;  5ETK A;  1QDU B;  3R6L B;  1KHW A;  2XSF A;  4JI6 F;  3SQG B;  1P27 B;  3AQO A;  3GIM A;  1TV6 A;  3U7J A;  2OPQ B;  4TY8 A;  5EUH A;  2JVR A;  1YJT A;  3DMJ B;  4KSE B;  5K20 B;  3KLE B;  1RT2 B;  1XR6 A;  3JYT A;  3R5B A;  4Y2M A;  5HAT A;  3W61 A;  3QSY B;  4DPU A;  4KJI A;  3PR5 B;  5CAB A;  4KPC A;  2HBY B;  2VG7 B;  2R42 A;  1XMQ F;  3MEC B;  4ANE A;  1U0H B;  2KO1 A;  3BKF A;  3V6D A;  1NDC A;  1S1W A;  3MR6 A;  1AFI A;  4DSE A;  5C42 B;  2IYG A;  3ILO A;  1S4F A;  3LF0 A;  3ENW A;  3W65 A;  2G1H A;  3DM2 A;  5AT1 B;  5A8K A;  3G6E S;  1JJC B;  2V34 A;  4CTA B;  1TKX B;  3BN7 A;  2MSS A;  3A8J A;  2ZUG A;  3CJQ A;  2C3Y A;  2B0G A;  2EK1 A;  5KFT A;  3ETO A;  2YKA A;  5HQM A;  4ELT A;  3KOA A;  2HW3 A;  2BX6 A;  1SVD A;  2BYC A;  4WFB Q;  3IN5 A;  2W9A A;  1S97 A;  4MKY A;  4NXN J;  2RVJ A;  2BJE A;  4B3T J;  1FJG F;  2DH9 A;  4WK1 A;  2UU9 J;  5GAH U;  3PCO B;  2D74 B;  1GX6 A;  1HBM A;  5K14 A;  2BR0 A;  1KHV A;  4YEA A;  3CGI A;  5IQQ A;  3W2V A;  1VHF A;  4DX8 H;  2Q43 A;  1B99 A;  1PG5 B;  4HR2 A;  4E2F B;  1N34 F;  4QWC A;  2CPH A;  2Q79 A;  1MU2 A;  2ZVS A;  4KGK A;  4DU8 A;  3GR1 A;  2EFQ A;  3EM1 A;  3PRD A;  4YY3 J;  4C97 A;  5I3Q A;  2CKW A;  3MMA B;  3VQS A;  4CO2 A;  1V3Z A;  3UO0 A;  5L9N A;  1TK8 A;  2JEJ A;  4OZJ A;  1HNW J;  3POT B;  1Q95 G;  2H65 B;  2HWT A;  3TZW A;  3VGS A;  1HBO B;  2AJQ A;  3BB5 A;  3ET6 B;  4NCA A;  1S1T A;  2HWI A;  2J8A A;  3WZ0 A;  3FEY B;  1G3O A;  2PA8 D;  3RB6 A;  1FK9 A;  1LK5 A;  2HFZ A;  3AHP A;  4EO6 A;  2MY8 A;  4DFJ A;  4J9K A;  2QL5 B;  3HHL D;  3T5J A;  3DLG A;  1FFW B;  2OPP A;  2AJ2 A;  3PFO A;  3TAP A;  4ED1 A;  5KFF A;  4PUO A;  1NSA A;  2DR6 A;  3OR2 B;  1SV5 A;  4LR7 A;  1RT7 A;  2L48 A;  2N4D A;  2ZNZ A;  5KG3 A;  1C4C A;  2B9Y A;  1RTJ A;  2LVW A;  3BRE A;  3QQC D;  2N3L A;  4JI0 F;  3DKD A;  4UST A;  4P72 A;  4DDF A;  3VAM A;  1N56 A;  1MW7 A;  3DRY A;  5J2Q A;  3TUJ C;  1DAX A;  1W25 A;  5KFV A;  5KTQ A;  1CJV A;  2FHM A;  3NOC A;  2GHP A;  1FDA A;  1KKH A;  1W26 A;  3AD7 C;  3W9J A;  1IKW A;  3X3U A;  1Q78 A;  3AJ2 A;  1MN9 A;  4GC7 A;  2W7O A;  1K0T A;  3AOB A;  5IQ6 A;  4I1T A;  3R7S B;  4PXE A;  1YI2 S;  4HEA 9;  4RU2 A;  1S77 D;  1G6B A;  2F1F A;  3AY0 A;  3MM5 A;  4WF9 Q;  1IBK F;  1G4C A;  1ROF A;  3LW5 C;  4USI A;  3GJQ B;  2RE1 A;  4X4V A;  1V3R A;  3IGN A;  4K0K F;  4WZQ A;  4C2M A;  1KSP A;  3PV8 A;  2VF3 A;  3QT8 A;  2BQ3 A;  1L3K A;  4YR0 A;  1XN9 A;  4ZLL A;  2J6U A;  2PII A;  2B6A A;  1QM9 A;  5BYR A;  2X1F A;  4ZOS A;  3EWG A;  5C7P A;  1F5C A;  5E7O B;  5E5N A;  3UN2 A;  3QWP A;  2MHN A;  2F8M A;  3PYD A;  4EBD A;  2EBG A;  3M1V A;  3UD5 A;  5GMK a;  2XM3 A;  1QSL A;  4ZHR A;  3MI7 X;  1Y7P A;  3J7Z T;  1GXU A;  4DPX A;  5LMU F;  2UVR A;  3US5 A;  2KJW A;  2ZJR Q;  1YJ7 A;  4C0O C;  2MZ1 A;  1DFD A;  2G13 A;  2HS4 A;  4UQG A;  1N32 J;  2XY6 A;  5KFJ A;  1JLA A;  3B78 A;  4C4W A;  5IWA F;  4Y2A A;  3CCE S;  1YIT S;  1WTF A;  2HRY A;  4YB5 A;  4OHV A;  3JS9 A;  4H4O B;  3SCJ E;  3VGT A;  2W9B A;  4ECR A;  5EDW A;  1DTQ B;  4RW9 B;  3H42 A;  4F2R A;  3IP0 A;  4ZN1 A;  3L3C A;  4P75 A;  2XMW A;  5LT5 A;  3HXM A;  3G8S A;  1LXJ A;  4U96 A;  4DLE A;  4K59 A;  4TU8 A;  1XMB A;  1U2F A;  4J9L A;  4CP5 A;  1IWG A;  5EWF A;  4PG6 A;  4DQP A;  1NHK L;  3LAK A;  3V5R A;  2XTJ P;  2AW0 A;  2RDI A;  4OX9 J;  3AAW B;  5CYQ B;  4WZM A;  1RTH B;  3PRB A;  4I56 A;  3D67 A;  4F3Q A;  4I64 A;  5LXR A;  3GG0 A;  3KLI A;  4GO7 X;  4UOF A;  3EXC X;  1KLN A;  3QJJ A;  1BQN B;  2Y8W A;  3NY0 A;  3FMW A;  4LF8 J;  4G6V B;  1NSP A;  3GSI A;  3VF0 B;  3OL6 A;  3KLH A;  3MHY A;  2VG7 A;  3D3C J;  3BH7 B;  4J9O A;  2W2P P;  1FCA A;  1ZM3 A;  1YZ7 A;  3LP2 A;  3K7R A;  1ELO A;  4LBH A;  4X65 J;  1YJW S;  1TL3 B;  3HFV A;  2HS0 A;  1DQ8 A;  3M6X A;  3GWC A;  4K50 A;  1WSR A;  1MSW D;  3QSI A;  3NNH A;  2HVZ A;  4QPX A;  5C5J A;  3ZFV A;  2XQC A;  3SBM A;  3H25 A;  3CCU S;  1NRK A;  5HVF A;  5EWG A;  3OLB A;  1WG4 A;  3G4S S;  3H98 A;  4FNH A;  4OMF G;  4OQJ A;  4E98 A;  3MUT P;  4NZ7 A;  4XPE A;  3M8P A;  3DOK B;  4PG4 A;  2RDJ A;  2EBE A;  3N6N A;  4X4Q A;  2DK2 A;  2V4J B;  4KAI A;  3J7A 1;  2I8E A;  3ILI A;  3RYL A;  1X9S A;  5H9F K;  4NYZ A;  1HHQ A;  2KU7 A;  2BDP A;  3FZB A;  3D6H B;  3KK3 B;  2HVE A;  2XZW A;  4MIA A;  4B9V A;  4FYD A;  1C0T B;  3VWS A;  4NXN F;  5J1P A;  4EUV A;  1F0X A;  2V69 A;  3B8H A;  4TVA B;  4ZVQ B;  2YWG A;  3UDL A;  3JSM A;  2JWN A;  1TKT A;  1S7I A;  4DUZ J;  1SXL A;  4HI1 A;  2IIH A;  1KOH A;  2J9C A;  4F0M A;  2ADC A;  1RT4 B;  1RXO B;  4WTY A;  5KT6 A;  4FBT A;  5F8J A;  1CJT B;  2LLZ A;  1R7I A;  1FRK A;  1WF2 A;  2G2Z A;  4FYW B;  2CDQ A;  4Y28 C;  1GMW A;  3R1L A;  2CNK B;  3AD8 C;  4LFC J;  1GMV A;  5F3T A;  1M5K C;  1FK9 B;  1VJW A;  2YQ3 A;  4HDH A;  2DNN A;  3R5A A;  1AW0 A;  2YKM A;  4Y6I A;  4B3O B;  2WTF A;  1XMQ J;  1XNQ J;  1VOM A;  2LMI A;  1RAA B;  2GNK A;  2EWH A;  2GGP A;  3AB4 B;  3MZI A;  3TAR A;  3HT0 A;  3HSZ A;  4NLW A;  4QIV A;  1FVS A;  5DGA A;  1VQK S;  2PI4 A;  2W2M P;  1UVI A;  2BKP A;  1S6P B;  2EEY A;  1WAC A;  1IBL J;  1IBM F;  1H38 A;  1SBR A;  2GJI A;  3BZQ A;  3I0R A;  1G1X A;  4AL6 A;  3BBB A;  3UPF A;  2CUY A;  2WBM A;  4B3T F;  2P9E A;  1N5Y A;  2A18 A;  2FD2 A;  2ZOM A;  3A8E A;  4B9N A;  2R9L A;  3WIU A;  3V4I B;  1C0T A;  2RNE A;  4LRB A;  2H4Y B;  3EPI A;  1RHQ B;  2VQE J;  2IM1 A;  1YHQ S;  2DVI A;  4IRD A;  1U48 A;  3GJT B;  1MNE A;  3OTC A;  4OZ5 A;  2UV8 G;  2VKZ G;  2I2Y A;  4ZVO B;  2QSW A;  2RKI A;  1PIL A;  1SH2 A;  1UW4 A;  1WHX A;  3KXD A;  5CCL A;  2NXJ A;  1J5O A;  4B3S J;  2R8I A;  1HBU B;  4NZ0 A;  2DTJ A;  2QLJ B;  2MMY A;  4JYA J;  3NGK A;  2BV3 A;  2OD4 A;  2H51 B;  3DU5 A;  3LP1 B;  1HMV A;  1ZA1 B;  3DRR A;  1R27 B;  2G2O A;  3QIP A;  5F8G A;  2EW9 A;  1M5H A;  1DJ0 A;  3KK2 A;  1ZPW X;  5KFB A;  2E5L J;  1TAU A;  2DIT A;  1M5V C;  2UU9 F;  2R7S A;  2OFG X;  3M8W A;  2W4P A;  5KG6 A;  3ZTP A;  1FE4 A;  5M2P A;  3PO4 A;  2DGQ A;  4LMZ A;  2CQ0 A;  2XY7 A;  4TQR A;  2QLX A;  3EXY A;  3O44 A;  3WDO A;  1FRX A;  2OEM A;  3CUL A;  1JQG A;  2ZE2 A;  3H2V E;  2FJB B;  2Y9H A;  3QJP A;  4YB6 A;  1LEO A;  5G4D A;  3BF4 A;  2IAJ A;  1P6T A;  2JSX A;  2MHE A;  5FLX Y;  3CO9 A;  2PO4 A;  4AYB D;  1XNR F;  2CZV C;  2HND A;  3HZE A;  3OVB A;  4H4O A;  1YBT A;  3ZC4 A;  1VQ4 S;  1FX2 A;  1VMB A;  4K5R A;  4K4V A;  3QNW B;  4U9R A;  4ZVP B;  4I68 A;  3FQL A;  4IH7 A;  3K5N A;  4ZVS B;  4XIU A;  1GMU A;  2HBQ B;  3T6J A;  1PKU A;  4IR9 A;  4X2B A;  1N8R T;  4HAC B;  3OBI A;  3SSR A;  1XTZ A;  2PEB A;  4WYL A;  4GKK F;  1S1T B;  2ZDO A;  1Z2Z A;  4DUZ F;  1FX4 A;  2B5J B;  4LQ9 A;  1GFW B;  5D0H A;  3MAA B;  2AGQ A;  1RHU B;  1FF2 A;  3KK2 B;  5DGB A;  3KJV B;  1WKK A;  3N5F A;  1R0A B;  2DHS A;  4DV6 J;  4RNO A;  1EHW A;  2OP5 A;  4UOG A;  1GX5 A;  3M7V A;  3UVJ A;  2AMC B;  1RAE B;  2ZD1 A;  3ITH B;  1TU0 B;  3I5C A;  1MG7 A;  1RAC B;  4PRF A;  3UI3 A;  3W5Y A;  2WAQ D;  3CDB A;  1OSC A;  2HQG A;  3PHT A;  4OFZ A;  3QT5 A;  3J7Y I;  2HQ3 A;  1NH8 A;  2DO4 A;  3ILL A;  3Q83 A;  4IFV A;  3MR5 A;  3EYZ A;  2V8H A;  3K59 A;  4LF9 J;  5FLX U;  1TK5 A;  3JSY A;  5KFM A;  3VR1 A;  1BQX A;  5AE1 A;  4F4W A;  2ZJP Q;  2E9Z A;  1QAX A;  2QRR A;  3HHL B;  3PKY A;  5A0Y B;  2KVI A;  1TKZ B;  4M5N A;  2H5J B;  2HFO A;  4DQQ A;  5F8N A;  2QFI A;  2XYH B;  5KG7 A;  2DGT A;  2FB0 A;  1IM4 A;  2VG6 A;  4F36 A;  1RE1 B;  3TWZ A;  2CA9 A;  3FNN A;  2AHO B;  1AZS B;  3E51 A;  3M8R A;  2M5Y A;  2HZV A;  2R7O A;  4ELV A;  2LQB A;  3IBW A;  1VIS A;  2JEG A;  2VL1 A;  2C22 A;  5DG9 A;  1TL7 A;  2UXC F;  1WTB A;  1IKV A;  1FKO B;  4PEO A;  5E41 A;  4QJV A;  4K4Z A;  1ZPV A;  4NRU A;  2J0X A;  3IBF B;  3SV3 A;  2ZBP A;  4L72 B;  2BW2 A;  3SXL A;  2ZD1 B;  1YLX A;  3ITH A;  5D0E A;  2VC1 A;  3K8V A;  2RH3 A;  5C25 B;  1U26 A;  3QT7 A;  2V4R A;  2ZFH A;  4DZ6 A;  2XUL A;  1JLG B;  3AQP A;  1RHJ B;  1LWE A;  3PJ9 A;  4DOZ A;  3QGI A;  4DR7 J;  3OL7 A;  1ZAV A;  4IDK B;  2O5D A;  4TQS A;  1FD2 A;  1W7W A;  3DRX A;  5J2P B;  2V8P A;  5J1N A;  4OX8 A;  3T6B A;  2UUC F;  3Q2T C;  1HPZ A;  1JXV A;  4RW6 A;  2A1B A;  2ROG A;  2HFN A;  3SCK E;  3TJA A;  2DHH A;  3V6D B;  3HJV A;  4HT7 A;  1K1S A;  2J0S D;  1CQM A;  5LM7 E;  3TVY A;  3VAH A;  2QC3 A;  2Y8Y A;  3VHQ A;  2MQ8 A;  4PWD B;  2IM3 A;  5J2M A;  1M90 T;  2DNH A;  2WON A;  1N32 F;  5FJ4 A;  5IT9 Y;  5HMW A;  3DM2 B;  4LVO P;  4FP9 A;  1Y9O A;  3D0I E;  2QT7 A;  1EP4 B;  1DQ9 A;  2I0X A;  2BW7 A;  3CSK A;  1NLK L;  3C6U B;  4WFZ A;  2ZHA A;  5D3G B;  2HKE A;  2WVC A;  1N34 J;  1S1X A;  4Y2I A;  1FRI A;  2DCU B;  2Z2L A;  1RJJ A;  1HQU A;  3R7B B;  2FVC A;  4O3N A;  4X66 F;  3PW2 A;  1IBL F;  4ITS A;  3ZZ0 A;  4CM0 A;  2VQF J;  4QWE A;  5KFS A;  4DPT A;  1VGY A;  2R7U A;  2KTQ A;  5B0A A;  1RT3 A;  3ZXW A;  2WSE C;  1F2G A;  1WC0 A;  2BBE A;  3DDK A;  1MRO B;  2WVE A;  3W9H A;  1Q7Y T;  1RDR A;  2BM1 A;  2OH2 A;  3D1Q A;  1R8B A;  1SL2 A;  2PD1 A;  1UWB A;  4BDP A;  1CQN A;  5KT7 A;  3BGR B;  2CYY A;  4L76 A;  2ASY A;  2E44 A;  3PIO Q;  4OYP A;  1JMT A;  2RKI B;  5D78 A;  4CO4 A;  3E3X A;  3UCU P;  5IM0 B;  2BE7 D;  3LO3 A;  3NCP A;  3BSO A;  5KFK A;  2GO8 A;  1FTC A;  4GRS A;  2JLF A;  2K1R B;  2OMO A;  1O8B A;  3PX6 A;  1EP4 A;  2ZH3 A;  2NR0 A;  1PCA A;  1XIQ A;  2YQ1 A;  3KWM A;  1U1P A;  2FVP A;  3GZ7 A;  1KNZ A;  3N6L A;  5T14 A;  3IA0 A;  5K5M A;  3NS5 A;  4X62 J;  1SV5 B;  4LFA J;  5EN1 A;  4X66 J;  1S5Z A;  4IH5 A;  1PJ6 A;  2ZBQ A;  3K0J A;  3QBC A;  4I2Q B;  1HL6 A;  3D66 A;  4W98 A;  1UP1 A;  3NP5 A;  2PC6 A;  4Z7C A;  5A2Q Y;  1S10 A;  3VZH A;  1VQO S;  4ZVT B;  1GAO A;  1RWP B;  2ILY A;  1P8G A;  4AQY J;  2DHA A;  3AA8 A;  2I1R A;  3MEE A;  1TKT B;  2OHD A;  1IKW B;  2BOA A;  3KG4 A;  4RPF A;  3CD0 A; 
#chains in the Genus database with same CATH homology
 3QFH A;  3SQO P;  2Z57 B;  2Z58 B;  2W2M P;  3A3P B;  2QTW A;  1SPB P;  3GCX P;  4NMX A;  1V5I B;  3A3N B;  3H42 A;  4JP8 A;  4K8R A;  2W2P P;  3VV2 B;  3CNQ P;  1ITP A;  2ZWO A;  3BGO P;  3T41 A;  3P5B P;  3WIU A;  2Z56 B;  2ZWP A;  2E1P A;  4NE9 C;  1SCJ B;  3GCW P;  2Z30 B;  2W2O P;  2Z2Z A;  3BPS P;  3WHI A;  2XTJ P;  4OV6 A;  3WIV A;  2W2N P;  1R6V A;  2Z2Y B;  3VHQ A;  2W2Q P;  3CO0 P;  4YN3 B;  3A3O B;  2PMW A;  3AFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...