2W2NP

Wt pcsk9-deltac bound to egf-a h306y mutant of ldlr
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
93
structure length
93
Chain Sequence
TTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
publication title Structural and Biochemical Characterization of the Wild Type Pcsk9/Egf-Ab Complex and Natural Fh Mutants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/receptor
total genus 24
structure length 93
sequence length 93
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2w2nP01
3H42A 3BPSP 3AFGA 2W2MP 2W2QP 1ITPA 1V5IB 2ZWPA 3CNQP 2Z56B 1SPBP 2Z2YB 3WIUA 2W2PP 4JP8A 4K8RA 3GCWP 2W2NP 3WIVA 3VV2B 2PMWA 3BGOP 3GCXP 3VHQA 3CO0P 2Z58B 2W2OP 3WHIA 1SCJB 3A3PB 3A3NB 3A3OB 3QFHA 4NMXA 2Z2ZA 4NE9C 2Z30B 2QTWA 1R6VA 4OV6A 4YN3B 3P5BP 2ZWOA 2E1PA 2Z57B 2XTJP 3SQOP 3T41A
chains in the Genus database with same CATH superfamily
4OYBA 1DZ5A 3P49B 3V2UC 2YY3A 2OJ3A 2OMLA 1C0TA 2BQ3A 4B17A 2XMKA 3ZZOA 3PR5B 3ZZZA 5L9XA 3IC1A 3MOZA 4DR1F 1H2VZ 3DOMB 4QPXA 1M90T 2DRAA 1JK9B 4DR2F 3R7BB 3LP0B 4JI2F 2Q6BA 2XWXA 4B9NA 1HMVB 4WFYA 1N5YB 1U1PA 4DG1B 2NS1B 5DGAA 2XMVA 2AZ3A 1X7VA 2YNFA 1EQ0A 4I6WA 2N4CA 2H3EB 2POKA 3UDVA 5IT9Y 2IRYA 3MMCB 2V4JA 3DLBA 2XLKA 5HVFA 1U49A 2QYGA 3HVRA 5A8WB 3MEEA 4HT5A 4LR8A 2UXCJ 2C3YA 3ZNJ1 4DF8A 4JBCA 2JRSA 2NSCA 3LQVA 2CJ9A 3HT3A 4PR6A 4MK7A 2KN4A 3G8TA 3THVA 3KJFB 4DL5A 2WCXA 3FZ2A 1FRXA 3VALA 2D3O1 4I2QB 3LPEA 2ZKUA 1CJTB 2VBZA 5CYQB 4FP9A 2FHOB 4QOTA 5J2MA 1QE1A 4QBUA 2JEFA 4K5RA 4ID5B 1WWHA 3M9OB 2KT5A 1NK7A 2D3UA 5C2GA 4RBTA 1DRZA 4HEA9 2J6TA 3QJLA 5K8OA 3EJMA 1B0VA 4ED3A 4DCOB 3K2YA 2HQCA 3LP2A 4IRKA 4TLQA 3CJ0A 4WK3A 3FKBA 1NSKL 1VMBA 1N34F 4EZ9A 4HH0A 3AH6A 1QVGR 1JX4A 2MLZA 2RDJA 3SV3A 3W64A 4CLZA 1AROP 2HFNA 1Q5YA 2Z2LA 4RW8A 4FYYB 4N5SA 1HHTP 4EO8A 2DGOA 3QJPA 4B3TJ 3IR6B 3KFWX 4YR0A 3ILJA 1ZA1B 4KO0A 1KWMA 2RVJA 3UCUP 2YNIB 2JLEA 2BXJA 2CNLB 2GZOA 1BUXA 4L72B 3CDEA 2UUWA 3KTQA 1LQ9A 1PSDA 2YKOA 2Y1LB 1LW0A 1S97A 3MTJA 3BM7A 2UXDJ 2N82B 1JXVA 2CQDA 3L09A 2MZJA 2IDLA 4OZ5A 2HBRB 3ENVA 2VH7A 4ZPVR 1X5TA 1QAXA 3RAMA 3SZ2A 1S1TA 1UMJA 4FYWB 4KGZB 5LMNJ 4GKJF 2RU9A 1LWEA 3DRSB 4FYXB 1BQMB 2OD6A 3F0NA 4ZOSA 1I3OB 2ILYA 4MIAA 2C2OB 2HVIA 3FQKA 3DN9A 4ZCIA 3IA0A 3TAPA 2AJQA 2HVDA 5IWAJ 2KT3A 1OPIA 5U47A 4QWBA 5D0GA 4YP3A 3BV8A 3R6LB 1L3VA 4CYUA 4WKYA 3C2PA 3CCZA 4QIVA 2M70A 1SVDA 4DPUA 3M2VA 4BDPA 1RTDB 1JLGA 4UOCA 3HSGA 1NZAA 1FX4A 1HHQA 1Y00A 3BR8A 2HFZA 1FJGJ 3BBFA 2JEGA 2J8SA 4S0MA 1V3RA 3VQTA 1HBNA 5L38A 4OI4A 4RZRA 3NCRA 2O66A 1RACB 3SSQA 2B4PA 4U95A 3NAHA 4GVBA 4TY8B 3QMQA 2IYGA 2HVZA 2PD1A 3WX4A 5KFWA 3DU6A 4DU8A 4ED4A 1OMSA 4CLWA 3FRYA 1YJWS 4ED1A 2CPXA 2HBZB 3QBCA 1GNKA 1JLQB 2DH9A 4I7FA 1MROB 2V9KA 2AHOB 4DWIA 3D4JA 2BM1A 3K57A 3MPWA 1U6BA 3KWMA 1QTMA 4C8YA 5EWFA 2VQFF 3C6UA 2BZ2A 4C3KA 1FTCA 1BGXT 2D41A 2HVHA 1LNQA 2NXCA 3IGNA 4IH7A 3NBPA 5D78A 2AGOA 2HZVA 2VFTA 1UCNA 3QQCD 1LWCA 3HZGA 3OHBA 4KV8B 4EI2A 1OYEA 2J8AA 4DV7J 3TWZA 5AE1A 2DR5A 3V6HA 2C2KB 2VG7B 3R7NB 2C2EA 4LF6F 1G4CA 2RSQA 4D3GA 2PE8A 3HD1A 3KK1A 1OWXA 1RAHB 3OLAA 1CEZA 3CJ3A 4M5JA 3C3LA 2HHSA 1PYSB 1RWUA 3KYLA 4PXBA 2DGTA 4OHVA 2Y0SD 2FLNA 4QPTA 1KFDA 1TQLA 2V4QA 3NNHA 2J9DE 2EBGA 1RAAB 2R8GA 1WD6A 2RKIB 1HFEL 1Z2LA 4PUOA 2OFGX 4P52A 2QZ8A 2X7IA 5KOXA 4CO5A 1M5HA 2R7OA 3CCWA 1OY9A 1WG5A 2HKEA 1HKAA 3CDBA 3R6GB 3W9HA 2YPZA 3VGVA 3ZC4A 5GAGU 4ERDA 3B4MA 4O3SA 2PO4A 1NAQA 2VFRA 2IAJA 4C6AA 4L74A 2A2CA 4L73A 2FJVA 3DLLQ 1QDUB 2AP6A 3PJ9A 1QSSA 4QW8A 1IKVB 3AAWB 1VQNS 3J7A1 1VBKA 2PFFB 3LPYA 1NK0A 2RE1A 1CULB 1LK5A 3TEGA 3QT6A 4RUBA 1Z2ZA 3ZZPA 4N76A 3IRXA 5D4LA 2QLWA 2DB1A 4HH1A 2RMLA 3V6DB 1TFWA 4QWAA 4X65J 5I3QA 5DS7A 4KBIA 4K2XA 4C3LA 1W2BR 4JI6F 3MAHA 1VGYA 3GWCA 5F8LA 2IRXA 1WORA 4G3IA 2LQ9A 2QRRA 2YWHA 4HYKA 2KM8C 3MCSA 4X64F 4IR9A 3MEDA 1X9WA 4O3NA 3CCLS 3AQOA 1RHRB 3DLJA 3FNNA 1IVZA 5E2QA 1ROFA 2HZCA 2K7JA 4JP8A 1NDPA 2VC0A 5HBMA 4C98A 4C9DA 5HMZA 1KN6A 2VA3A 3DLHA 1FXRA 2BM0A 2GIRA 3A12A 2H5EA 4M5DA 2IDEA 4FKYA 4GMKA 3GIKA 2AGQA 4NEYA 4LF7J 4QYRA 4EZ6A 3A3PB 3SSSA 2PDAA 4ETZA 2FZGB 2RF2A 1S6PA 3PJWA 4RUAA 1HHSA 2GJFA 1FFWB 4DV6F 2AWZA 3C46A 4X66J 5GAHI 4ES3A 1N32J 3W8GA 1OO0B 4ELTA 3TZYA 3AJ1A 1NJWA 1QAIA 3PR4A 2MLYA 4A48A 2YTCA 4PG7A 4F67A 3D6MB 1N52B 3HM9A 4NYPA 1XERA 1R7IA 1TMMA 3MGJA 4Q43A 4YQWA 1OSDA 3GV7B 1PAEX 1LXJA 2IM1A 2AYGA 1T03A 3BKUA 1VQOS 3TW0A 2LP4A 2UUCJ 2FGOA 3D7SB 4FDFA 1JLBB 4Q0BB 1FESA 2RQMA 3UCGA 4OYIA 4LJMA 1GAOA 4G1QA 4AL7A 2J0WA 5CHCB 4CNYA 4RW9B 3UN3A 4FNIA 4ZPCA 3UFCX 2IBOA 4GO7X 4FF4A 4Y2IA 2PMHA 3GJSB 1VQPS 1YJTA 1SL0A 4M63A 4X4VA 2OPSA 2BACA 2F65A 1QLNA 2LDYA 1XMQF 2CNOB 2CVIA 4P74A 4RNMA 2XGQA 2G2YA 5BXIA 5HO4A 3MD3A 4O0IA 3CJKB 3P96A 3PX4A 1LWFB 4ZVRB 5HLFA 3CD5A 4EYIB 4I6YA 1YX2A 3GCXP 3NS5A 1HI8A 1BWEA 3G96A 2BR0A 2YBVA 5AJ3J 3KLGB 1KHWA 2WVDA 2A6OA 2ASDA 4KC5A 1LW2A 5HMXA 3QGHA 1FRJA 4DX6A 2RQ4A 5CCMA 4DLEA 2UU9J 1U0HB 2B7BB 2M88A 3MOJB 4KH0B 3HF5A 4DV5J 4ECUA 3HT0A 1TL5A 2ASLA 2UV8G 1WC0A 2ZKTA 4C8ZA 5JMNA 1TUWA 3TARA 4MKYA 5KFTA 4RKUC 2RRNA 2JX2A 3BO4A 2OFHX 3G82A 4OYPA 1SB6A 3B8HA 2ZEJA 5KT7A 4Y34A 1S1VB 3RAQA 4WJBA 5E3RA 4B3MJ 1B70B 5ETSA 4MFBB 3AOAA 4ZHRA 3NG8A 4Q44A 1RAEB 5B08A 4ES2A 4BWMA 5M2RA 2ZWOA 4WP9A 1WTFA 2BKPA 1HIYA 2A2DA 1IBKJ 2QLJB 3EE3A 4CM0A 3T5LA 4U7UK 3MM6A 5K9FA 1WDDA 3G6XA 4MAKA 4Q45A 2RQCA 5I42B 3OPKA 2QC3A 4ALZA 3TI0A 1SKWA 3W1YC 1S9GB 2O5DA 2RIJA 1TZ0A 2AX0A 4RJVA 4Y2MA 1GXUA 3M8PB 3HVTB 3HHLC 3FUYA 1JJ2R 3I96A 4NLRA 1RWMB 4UZBA 3KDNA 1RCXB 2VA2A 2F4VJ 2WW4A 3GG1A 3KLFB 4W90B 4N7TA 1SH0A 2KFNA 3C15B 4AL5A 3P45B 4YB1P 1Q7YT 3SCKE 2C2DA 1C2PA 2DNNA 4N47A 3BO2A 1TVRB 4JI0J 3J7Z5 2PN6A 1MN7A 4PYDA 3IM9A 1S0OA 3E3XA 3CJ8A 3Q0AA 4LF4J 4NXNF 3CCRS 2HK3A 3M6WA 2R42A 3HO1A 4ZPBA 3S6EA 5B7WA 3FC9A 3I55S 4KKOB 2MKCA 4KTQA 2IYIA 4HI2A 4QU7A 3CWJA 2Z2YB 3FCWA 4JB8B 1N33F 3HP6A 3FBBA 4OYOA 1RT1B 3FSXA 3UDEA 4DZDA 1K0TA 1PC4A 2G1DA 3CD7A 2Y0BB 3N79A 1TK0A 5FD1A 3JQMA 1X5SA 1KEKA 2V34A 4PQUA 2K8GA 1X0FA 3EPGA 2XBPA 4O3QA 2YKMA 3PCOB 1HBUB 1RWXB 1I94F 2HS0A 3NNCA 1D9DA 2RAQA 2PA8D 4V19X 5B0DA 3ULHA 4NXMF 2ROEA 5EGYA 1P9YA 1JXLA 1DAXA 1GX5A 3ZFVA 1EKSA 2UZAA 2AJFE 2CJBA 4M5GA 2J6SA 4OZNA 2DNYA 3M4XA 4DSLA 1AUSL 1UPPA 4ED2A 3S1TA 4OLPA 4O4RA 3I5CA 1RHKB 1AFJA 2MJNA 2KU7A 1TUGB 2AJ1A 2PIIA 1UWBA 1JLFA 4I56A 2RD5C 5DGBA 4PG4A 2QA2A 4DX7A 4KGVB 3IR7B 1GXTA 1SL2A 4C2MA 2GAHC 4DBQA 5D0RA 3TQ1A 3VAKA 5DM6Q 1M1HA 1PYTA 3C8YA 2QLXA 5KFFA 2IVYA 5D4PA 5KT4A 2XMWA 2MPUA 2Q79A 4LSLB 2QA4G 3MCMA 4W98A 2AT1B 1U1RA 4F7VA 3MMAB 2EPIA 2GVDA 4U67Q 1JLCB 5IXUA 4UTGA 2XY7A 5IZHA 1AW0A 3L3CA 4K4VA 1UEUA 3PW5A 2E7WA 4LF5J 1URNA 1S12A 1TELA 5A8RA 1J5OA 1MSWD 1PYOB 2VG6A 3HCXA 5D6GA 4MIBA 4ANEA 2ZZNA 3QAEA 3EGNA 1UEKA 4QIWD 2ATLA 1FKAF 1NBEB 2V4JB 1RAGB 3PDNA 2DNMA 1YITS 1X4DA 2GGPA 3THTA 2AZ1A 3M9MB 3F56A 4UQGA 1NKCA 3M05A 3I9ZA 4X62J 1SKUB 4HL9A 3SQGB 4M5MA 2VQEF 2CRLA 3BQ0A 3UO0A 3QWUA 4H4OA 3N6MA 3J81Y 1NM2A 4FYDA 1FEHA 2MZRA 2MSTA 2YWWA 1FTRA 4JI4J 2HFOA 4OV6A 3F73A 4TVAB 1RI7A 5DO2A 1NK4A 3RU0A 3R7SB 1OQ6A 1VQ7S 2C3UA 2B4OA 2V5HG 1RBOB 5J2MB 3MM7B 3GIIA 2IY5B 3VHQA 2M2BA 1C1BB 1QTNB 1CBKA 4TKTA 3UE2A 2I2YA 4R5PA 2ZHAA 1R3NA 3HHNB 4CO4A 1P27B 3L4BC 2JC1A 1HWLA 3ITHA 3I0RB 3J80Y 2VICA 4F4WA 4AXIA 1S6UA 5HK4A 2V8PA 4ENOA 3LP2B 4J9RA 3OFEA 1T9UA 1DFDA 3EWGA 2QSFA 4DMZA 4ED7A 1LV5A 3C6TB 5IM0A 2NUUG 1UFKA 3NGDA 1X9MA 2YVSA 1O51A 1NDCA 3M1VA 3TX8A 3V81A 1SJ1A 1K0VA 2R7VA 2FVQA 4LFBF 1FFGB 4A8OA 1RWVB 2KO1A 4RW8B 1R27B 4NYZA 2RNEA 3TR5A 4USIA 4WU2A 2RHSB 4AL6A 1WOOA 2W9CA 4KFBA 1S48A 1UL3A 4F4XA 4HHUA 2I38A 4KY3A 3KLVA 3NAIA 5IT9U 2XY5A 4M94A 2WZ1A 2GW8A 3GQCA 1VFJA 2XCAA 3UD4P 3DLGA 4OLOA 2W4PA 2YXLA 4O23A 4LT6A 2E5IA 4B3RJ 2F5GA 2Q1LA 2QSWA 3GYXB 4OJ3A 2FJXA 1NK6A 4KHPJ 4NCGA 5D3GA 4B3SJ 4F3QA 2AQ4A 3EX7B 4F2RA 2LEAA 1LWEB 2WAQD 3FRZA 1ITPA 4ANDA 3PKYA 3RR7A 2W4CA 1B0TA 2HMIA 4WXWA 5IT0A 2ADCA 2DNGA 3PRBA 3AJ2A 3KLHA 6FDRA 1URRA 2ZOGA 3NWGA 4U8VA 3MECA 1IR2A 1NH7A 3U27A 1CJVB 1SV5B 2G0IA 3CJQA 2YKPA 1PKUA 4RW6A 4YR3A 3C66A 1M0SA 4DHVA 2MKKA 2W2NP 5K8MA 1EARA 1UPMB 1K73T 4PCQA 2G13A 2E1PA 4DV3J 4P2XA 2M52A 2B9EA 1RT4B 4YR2A 4JI3F 1U0SA 2L48A 5EUHA 5SZTA 2QX0A 4FVCA 3I4HX 3T1YF 2CQBA 1IKXA 1AUDA 4GVLA 2ZITA 1HBNB 5HQMA 3MR5A 1RUSA 2GQQA 2N7YA 1IM6A 4GVBB 4PZVA 5MLCV 2AYEA 4K4SA 1CS4A 2C28A 2KJWA 2VPXB 4EWTA 1CPZA 1TL1A 4CNZA 4Y6IA 4WPAA 2K3IA 1HBOB 2UUTA 4DFPA 2JDJA 4IH5A 2AJ0A 2RS8A 1VJQA 1R8BA 3C6UB 1HNZF 4Q8EA 1S6QB 2HIQA 2B7CB 4DFJA 5CXTA 6AT1B 2HWHA 4X4SA 3W61A 1GTHA 2CUYA 4GO5X 3M6XA 2F1FA 4BLGA 1FDNA 4HTIA 3TJ8A 2ZBCA 2D9OA 3BSAA 2XMUA 5J1EB 3OL6A 3W7BA 1N5QA 5E41A 1J5EF 3LP0A 1S1UB 2VBYA 5FDLA 2I5JA 5JVHQ 1HMVA 4F2SA 1AZSB 3HLUA 3CJ2A 3DOLB 2DKOB 2YX4A 3T1HJ 2OSRA 4LRBA 3R5CA 1B4SA 4JYAJ 3BS9A 4ZJLA 3HSDA 3MMCA 3Q8UA 3ZZTA 2HSEB 4F4YA 2V2VA 5A8WA 3JTNA 2DPIA 1SQGA 3K5MA 4OL8A 1R6VA 3B4DA 2B4UA 1VQ6S 1IKWB 4FN5A 1HD1A 1JXEA 5DDQC 3D1HA 4WF9Q 2OO4A 4H4MB 1IXKA 1X60A 1SJRA 1ACMB 3ETMA 3UR0A 2XYPB 2BRKA 1HBMB 3E51A 1R89A 3DYAB 3M8QB 2DITA 1WHWA 3AD9C 1BD6A 4YDDB 5KFDA 3CC2S 4I2QA 4CLYA 1WTBA 3JB9k 4KIAA 4KB7A 3A4TA 2YNHB 1CJTA 2V4RA 1MNEA 2D69A 3H2LA 2IAJB 5CYQA 2XM3A 3LWMA 3Q86A 1U2RA 3GTYX 1FJEB 1U7LA 4D3HA 2JL9A 3N5FA 3VGSA 4RX6A 1PG5B 5ADZA 4KPCA 4ECQA 2BKOA 5KFOA 3PW7A 3OSPA 2AF6A 3PACA 1FA0A 3CCES 2OEJA 3QIPB 4J90A 5B0EA 3KLIA 2P9GA 4DR6F 4LF1A 1TP7A 4XO0A 5C42A 3ZZRA 3CT9A 4HHJA 8AT1B 4I0WA 2AU0A 5CA5A 2BA9A 1FD8A 3MMBB 2CDQA 2UUBJ 2XULA 4OFZA 3BGFA 4TXSA 3UDCA 2FDNA 2KL8A 2OPQB 4FYVB 3THPA 1TAQA 2EBEA 3QRRA 3I4PA 3O44A 3O1LA 3PHTA 4X4RA 1O0PA 4WFBQ 2ZUGA 3L7OA 1NJZA 3FEZA 4ZCMA 1T11A 4OQJA 3R5AA 4K4WA 3HHEA 1QD1A 3GONA 2VV5A 2C42A 3HMJG 4LF9J 2YKAA 1WHVA 3I32A 3IFEA 2M0GB 5T7LB 5JXSA 1HD0A 1VQLS 3JTPA 4B9LA 2CZVC 1XK8A 3W9JA 4ITSA 1FWLA 2ZM6J 4TQRA 4DF4A 2IJNA 4DN0A 2H4WB 1CJKB 1RJJA 3JQKA 3K17A 1PC5A 2XY6A 1V3ZA 1VQYA 2KM8B 2I1RA 2RF2B 2KG0A 4DR5J 2W7PA 3KG0A 4JI5F 1V9OA 3LALA 1BQMA 2CPEA 1AXQA 1RAIB 1HNWF 2HBQB 3TVKA 2NPFA 2DXEA 1HYSB 2QGFB 1FXLA 4RW7B 1DJ0A 4CLLA 1ZS6A 2DT9A 3EMTA 1HQUA 1CG2A 1CC8A 1UZHA 4KPYA 4C0HA 1U45A 1F3FA 4XK8C 2G0CA 4BS2A 1RTDA 3GSIA 3N01A 1QY7A 2HQIA 2C2NA 2HNZA 3CJTA 3T41A 2UUAF 1XMBA 2KXHA 5CYMB 2VJUA 1N36J 1R8CA 5HL7Q 2A18A 3EDRB 4ZLPA 2YWGA 4DQRA 2YNGB 2B8PA 3L9ZA 4G1QB 4C97A 2R7UA 4F0HA 2HS4A 2A0FB 1JJ4A 4TY8A 2BJ7A 4J9UE 2C3MA 1NJXA 1DY3A 3O5TB 3W3SA 1PCAA 5LJ5Y 3HKWA 2W1BA 1VBZA 1SKSA 5MAOA 4I69A 1SKRA 3DRRB 4PKDB 4OYWA 3KK2B 3TA1A 1XR6A 2K1RA 1JLQA 2CPYA 4OJGA 4CLPA 1VQKS 4IFYA 5KG7A 3KMQA 5ETKA 2FVSA 2BUNA 1U25A 1U6ZA 4A8MP 4DV2F 1UA1A 3LAKA 4IQMA 1U6FA 3HI9A 4LVNP 2DGUA 4MKAA 2CG8A 3D54A 2FHJA 4CLKA 4QYZK 1U8SA 1KQKA 3N0VA 1TL4A 4KV8A 1OS5A 2DNOA 2C2RA 1F5AA 4FF2A 4WIIA 5KG4A 2BE2B 1SBRA 4O44A 2LU2A 3CDUA 1ZA2B 2VG7A 1FWKA 4YB6A 1JJCB 2R9LA 2DH8A 3PW0A 2AKWB 1ZAVA 5DG7A 1WSRA 2L08A 2IRUA 4QJVA 4ZDNA 1KDNA 5LOQA 4DV0J 4ANCA 3SIPB 2R7RA 4F36A 2N4DA 1Q8KA 4I6AA 1Z4UA 3CDWA 2HLTA 2CPJA 4PWDB 4B9UA 2RQKA 3RRGA 3K5OA 4DL2A 1KHVA 3CMES 2AW0A 2RKIA 3SDEB 3G6ES 1UVJA 3SCLE 1PIEA 3VAIA 2CXEA 4HKQA 2H51B 3MAQA 3VZHA 2B3TB 2XGPA 3DM2B 1F9FA 4YHHF 5F41A 3KG4A 1I51B 3TP2A 3TO8A 2HAFA 5B09A 2DNLA 2X3GA 4X4NA 3LGNA 2DNHA 3D68A 3O2IA 1Y5IB 4ECRA 4FPIA 1IKVA 3AB2B 4ZCLA 3U7JA 2HRTA 1TKDA 2DRDA 3HFVA 3NS6A 1L3UA 1CULA 3I56S 2WVBA 5AT1B 4AUKA 3GJTB 3SCIE 2R7SA 4DL4A 3BSNA 4K0KJ 1SJFA 3V6DA 1YJ9S 3H7HB 1DTTB 2W8LA 1UKUA 2GJ2A 4J91A 2JLGA 4OX8A 2XS5A 5KFGA 1HQEB 3HHLB 1WEXA 1Y9OA 2R2UA 4UY8T 4U7UD 2EWHA 3VF0B 3GJQB 3HVWA 3IWXA 1GX6A 4XDDA 5IC6B 5DM7Q 1NJYA 1JMTA 4M5LA 2UVUA 3DLKB 3GIMA 1N0UA 5AE3A 3QT7A 2DGXA 3BEGB 4F02A 3KLEA 1N8RT 1VHIA 5C25A 3UD3P 2O1PA 2H5JB 1Y5LB 4IOBA 5I3UA 1H2UX 2HZAA 2DXFA 3MF5A 4NLVA 3CNQP 1NEEA 4OI3A 2F4FA 3IMQJ 1VI7A 1NUEA 1SI9A 4NCAA 1YJNS 4WZQA 4K2JA 2M7SA 2MQQA 1P9QC 2RDIA 4K4TA 1Y0HA 3BN7A 4OIXA 4ED0A 3CPWR 3QLHB 1TKTA 1JLFB 2FVRA 1YTYA 1XNQJ 5DJBA 4ZITA 5J2QA 3M2UB 4ILLA 4HLBA 3OFGA 2QO3A 5CH7B 4O0NA 2B4VA 4CT9A 4DUZF 2Q66A 3BH6B 3MM5A 4RUHA 5FJ4A 4IOCQ 1U1LA 2JSXA 2XO6A 2ZFHA 2F63A 3DKDA 2E7XA 2AGPA 1IBLJ 1HWUA 3G8SA 2FC9A 1JLBA 4RR5A 2IM0A 3PW4A 2OEMA 2VKZG 4MJKA 4J7CA 4N41A 2B56A 3PO4A 2V68A 4RW9A 1WUUA 2LXFA 1RLDA 2IHR1 3KJVA 5EX3A 5A2QU 2IVFB 3OVSA 5KG5A 4JOUA 4DXLA 2HHHF 2CQ1A 5LM7E 4EO6A 5E3PA 2RRBA 1FERA 3I5BA 5GADI 4I64A 3JTOA 3TOQA 2E9ZA 3BJYA 4F3OA 5DETA 3TZXA 3TVYA 4DR3F 3CJKA 4N8OA 4CRJA 3SI8A 1T05B 2AV5A 4YY3J 5C5JA 4MYUA 2KYZA 3ICLA 2V2QA 2XLJA 4HDGA 3KLGA 1PILA 3RAXA 3POTA 3PIOQ 1N4LA 3HXMA 2ZE2B 3UVJA 1D9AA 1N56A 2HWIA 1BWVA 4PABA 3MM8B 2PT0A 2UVVA 5KFJA 5LXYA 1QAJA 1DQ8A 2J5AA 2DHSA 4JV5J 3QNWB 3EXYA 4DSFA 3BKTA 1BLUA 2YX1A 1FO1A 1W26A 1IKYB 3P5TL 4R5PB 1U09A 1NB7A 2R2TA 1VIXA 4DQIA 1VBYA 3EUNA 4PQAA 4AYBD 2RUGA 2HEKA 1JLAA 1ZM4A 3MD1A 1HR0F 2AYBA 1FKPA 3SXLA 5KFZA 1RCOB 4OX9J 1S1XB 4LSZB 2N3LA 3OTDA 1VLOA 2V67A 5LMUF 1EQMA 3D9BA 3RB3A 2R7WA 2X3DA 3QATA 2AEMA 3K59A 2HRYA 3OVAA 3U02A 3TZZA 1VRUB 1E6VB 3US5A 1AA1B 5C7PA 2XZDB 4CI0B 5I42A 1FX2A 5GAEU 1BE4A 1K9MT 4KFBB 4YB5A 1U1KA 3W60A 2G2OA 1S9GA 3D1QA 1R31A 4GRSA 3EDQB 3MHYA 3FCHA 3NMRA 3M8PA 3HVTA 3UPFA 2LQ8A 4XDCA 2EI5A 2R4FA 2DR6A 4ZVHA 4AQYF 2BJ1A 5HN0A 4W4MA 3KLFA 1RLCL 3C15A 3A3OB 3CE8A 5IT4A 5DDRC 3PYFA 4C7QA 2ZBQA 3OJSA 1XMOF 1VQ4S 3J81U 2Q43A 3G2XA 1WC6A 3J7AN 4ZMMA 4KJIA 1B7YB 3JSMB 1TVRA 1H3DA 2Y8YA 4JUZA 1PO6A 1GMWA 1FRIA 4R0JA 1B0PA 3PNIA 3AQPA 5CQGA 3GSDA 3KLHB 2J9EA 2HBYB 4TN2A 1Y11A 4BC7A 3OTOF 1M5PC 2LU1A 2MQPA 5D15A 2UXBF 4KKOA 2V50A 2ZBPA 2EFNA 3VTIA 1UETA 2KFZA 1MMNA 3VGUA 2GV1A 1L3KA 1S72S 2ADBA 1R43A 5K5MA 4DSIA 1RT1A 4WFNQ 4C3MA 3QO9B 3AJDA 4QYZJ 2MMYA 5KG2A 3BPDA 5KFIA 3LANA 2P9EA 3GR0A 4UUXA 1FE0A 4QWDA 4Q5VA 5DDPC 1RWPB 4A8KA 2CJYB 2KB2A 5D77A 2Y3YA 4NLUA 1SC6A 5FIIA 1CS4B 4DV2J 4DPOA 2GNKA 3KKFA 4OHWA 1TL1B 4JI1F 2OUGA 1IBMJ 4J9NA 3C14B 1FI4A 4JI7F 3ENWA 2OHDA 3H4BA 3FK4A 3Q23A 5T41A 5KFHA 2BYCA 2Z2MA 4OX7A 1NKBA 1I1GA 2HRUA 1KOOA 3CUNA 2GO8A 3FBEA 3DMJB 1K1SA 3R9LA 4DUYF 4PG8A 1HWJA 1UJ6A 3ZTQA 1TMJA 2HHUA 1NO8A 4C8LA 2J7UA 4LRCA 4NLOA 1Q7LB 3LOUA 1WEYA 1FJCA 5HROB 2VUGA 3S7RA 4LSLA 2Y9HA 3MMAA 3GYNA 1JLCA 1IQTA 2EFQA 5LT5A 1BMQB 1XBWA 5FDLB 2I5JB 4PAAA 2YWEA 5KG3A 4DR7F 2XNRA 4H4KA 2RHQB 4NWBA 3OW2R 4C11B 1FNMA 3BDPA 4LFAJ 1S79A 3QYYA 4DSKA 1EETA 1SH3A 1S4FA 5HMWA 2RB7A 4LFCF 4OV1A 3OXFA 2GMLA 2ZDPA 2R2SA 4LF8F 5F9LA 4Z2XA 2FPHX 7AT1B 1WC1A 4LF2A 2EKNA 4B9MA 1H72C 3SQGA 3GIJA 4EUVA 2R8HA 4NI2A 2JOQA 3GMGA 1VISA 2HGLA 2CG4A 4OHZA 2V69A 3ZTRA 3NLCA 1FXDA 2ZC3A 4F04B 3WC0A 1RSCA 3UN5A 3I0SB 1RWNB 3QT8A 3LF0A 2E5LJ 2XB2D 3BPSP 3MM7A 4DUTA 2DHAA 1OYDA 4RPFA 5L8RC 1C1BA 1NHVA 3TUZC 1VBXA 3G87A 4F0MA 3ISND 2P5VA 2Z57B 3TUPA 4IOAQ 1FDDA 3I0RA 4TYAA 4FBTA 3KLIB 1SQEA 5KT2A 3JYTB 3HJFA 3GE9A 4RNNA 3B6BA 3I82A 3PYEA 5C42B 1ZZNA 1ZTWA 3C6TA 4WFXA 2OAUA 2KI2A 2LQBA 3PFOA 2C22A 1T3NA 2ZJQQ 1JQGA 2XSJA 2D3ZA 4RW4A 4DV4J 1F60B 3H4DA 2DGQA 3W2VB 2FIUA 3GFXA 1XNRJ 1EAYC 3RRKA 3Q24A 3LP1B 2HQ3A 4BHQA 2QYCA 1OIAA 3EM1A 3M30A 3DI6B 3IWLA 3M8WA 1HNXJ 1OQ3A 4DCPB 1HLWA 4ZVFA 1NCLA 2AJ2A 2N7CA 4NLTA 2E29A 1IJEB 1XR5A 1WI8A 1RAJA 3DGVA 2ZOMA 4JI8F 4URSA 4OHYA 4WP3A 3RB6A 2OP5A 4Y65A 1RT6B 1RHJB 3CEDA 3NWRA 4PG5A 3K0JA 2E7VA 2CQ0A 5HANA 4DPYA 4DSEA 2V2ZA 1VOMA 3DRXA 3JAMY 4GKKF 5JVGQ 2IFXA 4IYQA 2COLA 2AD9A 1V6HA 4PPZA 4IFVB 1F5BA 4CO0A 1SL1A 3IRWP 1YHQS 4YS2A 1FRLA 4O3RA 1SC1B 1ZTTA 1MWQA 5JUMA 4OYZA 3WC2A 2P9CA 2OTLS 3MTKA 1CJVA 1SV5A 3Q8SB 2HHPA 2BOAA 3QAUA 2H5IB 1HQUB 4DU7A 2XYGB 2ZD1B 1FK9B 1L3SA 1MW7A 5IS2A 1PJ6A 2GAGC 3P4UB 3WX8A 2YWFA 1H7XA 4DV1J 1RT4A 2BKNA 4OYXA 2NXUA 1GH8A 2HNZB 2KRBA 1S5ZA 1HW8A 2YQ1A 4R8UA 1VRQC 4M1KA 1RA6A 1R8PA 1NJIT 4WYWA 1ZPWX 2V2KA 1S0NA 1WHYA 2QL7B 2DGVA 3OL7A 2M3DA 2JC0A 1R0AA 4M5IA 1RT7B 1RB0A 2WVCA 4M95A 2VFUA 5DQGA 2K1RB 2UVWA 1HBOA 4HR2A 3IM8A 2E9RX 4NZ6A 4IFYB 1UFLA 3M9NB 4BWJA 3RJMB 2FHMA 3CXCR 2YQ0A 3OUYB 5LXRA 2JHEA 1S6QA 1VR6A 1DTQB 4OZJA 2EC2A 1NXIA 3MUVP 1M5VC 3T6BA 1N54B 2DNKA 1JNRB 2WONA 1T94A 3VV2B 3CCVS 1R0CB 3FBCA 4FZVA 3W5YA 1JB0C 4FF3A 4F25A 1TL3B 3D0GE 1NLKL 3OTBA 3IAM9 4O44B 2ALZA 3MCNA 2UXCF 5J1EA 2D1CA 4RNHA 5AXLA 4XPCA 3IWNC 2PC6A 3SMZA 1S1UA 2FC8A 3AY0A 4PG6A 2PI4A 3T19A 4ETXA 2B9WA 1UJ4A 3HFKA 1AZSA 3IN5A 5T14A 1QUVA 4RWXA 2VDHA 1RTZA 3OTEA 3CMAS 1XWLA 3DOLA 4YOEA 1O6XA 4WFZA 1F2GA 2WHOA 1ZOTA 2BANB 3TZWA 2CPIA 3CC7S 3EGZA 3AT1B 3NL0A 1ULRA 2LVWA 2QJ3A 2XMMA 4K8RA 5HJYA 2LA6A 4NEZA 4DN9A 2MLXA 1IKWA 3NNAA 4F4AA 5I3PA 2MY7A 4ZN3A 4H4MA 2WSFC 2Y1RI 4B3OB 4AE5A 3HX9A 3HPOA 1HBMA 4TLRA 3DYAA 3M8QA 4NLWA 5BR8J 3RUBL 4IG3B 2VZ9A 4M5KA 2EC0A 3A3NB 3PY8A 4ZP8A 1PBUA 1Q0NA 1H2TZ 1XR7A 1L3TA 2YNHA 2KZMA 1N0VC 2MDAA 2VC1A 3FMBA 3OL9A 3SV4A 3T9NA 3RB4A 1FE4A 4RUCA 3CIZA 3AODA 2DO0A 4FS2A 3M8ZA 1DQ9A 4QR1A 1XQIA 1LKZA 5K8NA 4B3TF 4DQPA 2CKWA 3QIPA 3BGRB 5F9NA 4DI6A 4ZA1A 2NQPA 2CQ4A 1RBAA 4LMZA 4KYZA 2YH0A 3V4IB 4ICLB 1QVFR 2DNZA 1JJHA 3T5KA 1RYSA 2ATCB 3AOBA 4P10A 4DR4J 4PYAA 3DLEB 2ZH3A 3RGIA 1YRXA 2XG8A 3MMBA 1WNEA 2OGUA 4IQXA 1XEZA 1S0MA 1KR4A 4B9VA 5ETQA 1D1UA 3HSZA 4LIWA 2CYYA 2UXDF 2W2QP 3H2VE 2ZWPA 2OPQA 1KTQA 2GCFA 1VJWA 4ED8A 2E5JA 3OXGA 3WIVA 2M8DB 3MPVA 4FXVA 4OI0A 1QM9A 5IFMA 2XMAA 5EWGA 3ZO7A 5DLFA 4DL7A 4L75A 4USMA 3Q22A 1F9EB 1VCTA 2M9KA 3MUTP 3MAAB 3EZ5A 3GV8B 5LMNF 1V5IB 5EDWA 2BQRA 2ZJRQ 5C24B 2FVCA 3KLEB 2EK1A 2LXUA 4TYBA 2IA0A 2H1YA 5C25B 5L9NA 3K5PA 5T7LA 3RRHA 5I3UB 3NKYA 2B51A 3ADAC 5GADU 4NMLA 5IWAF 5G4DA 1TKXB 1CJKA 3DGPB 3BN4A 3R5GA 4M5HA 3TRGA 4I67A 1BY9A 5F8JA 3OTCA 1X5OA 2HLUA 2QLBB 2IA6A 4TQSA 2NREA 1FJGF 3LTOA 4ZN1A 3G4SS 3V6JA 1TKTB 1HYSA 2RDDA 4RW7A 3R2CJ 1YIJS 4DR1J 5J2QB 3DNCA 4DZ6A 2F7VA 4K5SA 1ZH5A 4JV1A 3NGSA 1Y10A 4DR2J 1UVKA 1YWXA 5B0AA 3SCJE 4QIGA 4ZIVA 4JI2J 2X1GA 3MM5B 1BXNA 2IM3A 2DBBA 4RNFA 4DSJA 3S01A 3NGRA 5CYMA 4USJC 1M1KT 1HPZB 5KFPA 3FGVA 3V6KA 3RBDA 2YNGA 3Q83A 2VASA 4RBUA 5SUHA 1ZETA 4LVOP 2ALYB 2VG5A 3KJVB 2GC8A 1DQAA 3N28A 8RUCA 3DRRA 4DV7F 3KK2A 2DYAA 3BDEA 5LSLA 3M32B 2IMWP 1E6YA 3B78A 4LQ9A 3A1YG 2G0JA 4ECSA 2KFYA 2V6AA 3H5YA 5E5NA 1VQMS 1N88A 4QR0A 3POTB 3IBFB 1DLOB 1WOPA 3UVJB 2P8IA 3K5LA 5ETPA 1NH8A 4HT7A 1AT1B 4KHRA 2PFDA 1KQGB 4OX6A 4Y28C 5J2PB 4ECTA 2BV3A 1ZPVA 1S59A 2P6TA 2BE2A 4RU9A 2GHPA 2MXYA 3LO3A 4ZVPB 3CJSA 4DCJB 3SFGA 4QIEA 2XI2A 3W66A 1P6TA 4WTYA 1T3OA 1XN9A 2CWKA 3VWSA 1N34J 3Q89A 1JLAB 1G7CB 1ICEB 1FKPB 1SJ4P 3CIMA 4TU8A 3D1OA 3P3DA 2MGZA 1VC0A 2ZH1A 3KK3B 3M8YA 4CZCA 4WE1B 4JV2A 5D0HA 4M5NA 4KH1B 2E44A 4PWDA 3FSYA 4XAKA 3SBMA 2ZH9A 1FFSB 3SDEA 4U96A 5A76A 1TTHB 4ECZA 2GA7A 5A0YB 3HKZD 1H7WA 1FHTA 1WSVA 2Z58B 2O3DA 4DS4A 5F8MA 3TVZA 3DM2A 2ZH8A 2CIMA 1JKHB 5KFVA 1CLFA 1RP5A 3J7ZT 3DDIA 1FNOA 3SFUA 2VODA 3VCDA 4MTPA 2J9CA 4J9LA 1T9XA 2FJDB 4X65F 1IJFB 4ZVOB 2LMIA 5K8PA 3PKMA 4GKJJ 1MU2B 2MY8A 1Q78A 1TV6B 3M2RB 2JLFA 3A13A 2WVFA 1UVIA 3KDOA 3KOAA 1MWYA 3Q8QB 5J1PA 2Y1JA 2GO9A 3N9UC 4LRAA 3H0PA 4PPDA 5ETVA 1KLMA 2W24A 1TR0A 4WCEQ 2F8HA 1YLXA 1Q5VA 1T0TV 3BQ2A 1DTTA 2DK2A 2RU3A 3NS7B 2VONA 2DY9A 1HQEA 1K44A 3HHLA 2FZCB 2ZBRA 3MUMP 3FSIA 3AHPA 4LF7F 2HFSA 1Q1KA 1KBRA 2OD4A 3MDFA 3MURP 4P6QA 3E01B 4DFMA 3CJ4A 3DLKA 4RU2A 4IUFA 5B0GA 5KFRA 4NCBA 4RO0A 4O3PA 2YKQA 4X66F 5JJBA 2SXLA 1N32F 3FZBA 2LYVA 1Y3KA 4UQTA 2C2MB 2CA9A 2FB0A 3K8VA 4CLTA 1B7FA 4OZ1A 1S1WB 1YJVA 3R2DJ 1IN0A 2HPUA 2QL9B 3WBZA 3FEXB 2HURA 2AYMA 2OMOA 2VD3A 2EG1A 2VQFJ 3KUEA 3M7VA 1VC5A 3VVTA 4NLGA 5KFCA 2ZDOA 5F0UA 1ZZFA 1TU0B 3W65A 4OYAA 2XLIA 2ZVSA 3N4WA 4P9SA 2Z0GA 3WDOA 4NLPA 2L9DA 2UUCF 5IC4B 3MFHA 3QLHA 1UZDA 3P8BB 5D8HB 5CD4A 1EHWA 2BJ3A 4KGMA 2W01A 2WOMA 3M2UA 1TK5A 3DC2A 4X84A 2QA1A 4LF6J 1WC3A 2F9JA 4QCLA 2VB6A 3PYDA 3BB5A 1LOUA 3U1LA 1JWWA 3TJ9A 1UFWA 2OPPB 3KJQB 3OXLA 4FVMA 1UVMA 1YK9A 2R7TA 1S99A 4G65A 3MEGB 2DHGA 1HQ2A 4MKVA 2CJQA 2F9DA 1RTIB 1VHFA 3CULA 3EGWB 5AJ3F 5HMYA 2EVZA 1B64A 2C3PA 5H9EK 4RLEA 1NHUA 3M8RA 3P6YC 3H5UA 4QWEA 2BW7A 1H38A 4LBIA 1EETB 2UU9F 1HWKA 4DV5F 3PIPQ 2ZNYA 4F3MA 3U1NA 1Q4RA 3NCPA 3R97A 1EX8A 1S0VA 1G6BA 3MR6A 2MHEA 4DPWA 4ZVGA 2MQNA 7FDRA 1T05A 3MWBA 2RUSA 1FCAA 3A8JA 4NI2B 3DXBA 4F4KA 2KRRA 2ZE2A 4OJHA 4IDKB 4I68A 4B3MF 2E9TA 1UW4A 3AXKA 5ETOA 3MM8A 3A8EA 1RDRA 5LSOA 1GTEA 4J9KA 5LSRA 2DD8S 4CLUA 2V8DA 5THWA 1FWPA 3K5NA 4DQQA 3NMAA 5EN1A 3CD0A 1U48A 1QAYA 5CCLA 1XIQA 1IBKF 4CM2A 1IKYA 3QRPA 5A6PA 2PGCA 3IXQA 2DISA 4U9RA 5HATA 4DLGA 2J76E 3CMQA 4JI6J 4ZK7M 2DJWA 2L3MA 4ZKAA 1S1XA 3BBCA 4QQBA 3M6VA 1U26A 1KQFB 2XQCA 1WKLA 3CC4S 3IR5B 4USVA 2CZ9A 1CQNA 2CZ4A 4X64J 1UA0A 2GHWA 1YRTA 1VRUA 4KE5A 3O3LA 2XSJB 1U8WA 3DDNA 4RW4B 5BYRA 2F4VF 1E6VA 1RHUB 4YDXA 3MCOA 1XTZA 4LREA 1RWOB 4P71A 2CADA 1Q95G 2K3KA 3M30B 2EEYA 1FDBA 2R7QA 4Q7AA 3PX6A 4JI0F 3UNYA 4XPEA 5IQQA 2DCLA 2JH3A 4F26A 3VAGA 4KGXB 4LF4F 1HNVB 3X3UA 3CVKA 3ISNC 2XC9A 1YKWA 2D74B 1RWKB 4ATNA 2VHGA 1KVIA 2KVQE 2ZJPQ 1Q82T 1X5PA 2XZWA 2DR8A 4DV6J 2XS7A 2PSZA 4ECYA 1KC8T 1KS2A 1Y4ZB 3L95X 3QZ8A 3BF4A 2LCWA 1YBAA 4G1PA 3ENQA 2LXIA 4USTA 2FJBB 2GJIA 3JSMA 1T9YA 1SXLA 1BQNB 2R3VA 5CYJA 2ZH6A 4LIRA 1LFPA 4Q8FA 4I2PB 3G86A 3DHXA 2PMZD 4URQU 1FT8A 3H8YA 1G1XA 1RT2B 1MMLA 3PJXA 4DEZA 1VK8A 5KFAA 5F8IA 2NZCA 3KG1A 4YMEA 4URGA 1YJUA 2VPWB 4DOZA 2CWXA 2R2RA 5AE2A 1LFWA 3K89A 4I4BA 2V0NA 3QO9A 3HHKA 4MK8A 2EFVA 1QSYA 2BQUA 3LGMA 1FRMA 4R8UB 4ZCKA 5GMDA 1IWAA 1AFIA 3AD8C 1H74A 2Y8WA 1RT5A 1TKZB 1BHNA 1XMQJ 3OQ2A 3OLBA 3OJUA 4LSNB 3HZEA 2R8IA 2V63A 5KFSA 3Q2SC 1R0AB 1NB2A 3W5XA 5AXMA 2H65B 3EVMA 5F3ZA 2ZHBA 1RKIA 2LQ5A 2B9YA 2ZHOA 5KFEA 3HHDA 2JEIA 2NR0A 3L7PA 1WDTA 1XJWB 3C14A 1F2HA 1F1BB 2Z30B 1EIYB 3LAMA 2NCKL 2UVRA 3NCQA 2CJXB 4LF5F 2YH1A 1P1LA 2NXJA 3ILLA 3DMJA 5ETMA 1X31C 2WONB 3W62A 2E5HA 2J7WA 4WU3A 1CJUA 3JAMU 5F3TA 3HFZB 4KT0C 3GYGA 4CLSA 3BR9A 1DURA 4PWUA 5HROA 3S8SA 3DRPB 1YJ7A 4ZPDA 3BKFA 1VQ9S 3OFHA 4I1TA 3SSRA 1WG1A 2OEKA 1BC6A 4CO3A 2HVEA 4X62F 2HWTA 3QGPA 1N6QB 2DR7A 4PXEA 3R5JB 4Y00A 2J7KA 3CF5Q 3FDSA 4C11A 1BQXA 4P7TA 3D6FB 4JI4F 2E66A 4WIQA 2BW2A 4Y0FA 3SYZA 1A9NB 3LH2S 4H54A 2ASYA 1Y7PA 1FDAA 2LFVA 4BC9A 4UUWA 1T8EA 3GILA 1H98A 2CJKA 4X4QA 4NYOA 1V5VA 2L41A 2CVEA 4J37A 2RILA 2U1AA 4YEAA 3G71S 1FD2A 3OR2B 5C2CA 3FJ2A 3VGTA 4RL1A 1NRKA 1AB8A 4F50A 1WF2A 1RT3B 3RBXA 1D8YA 4Y3CA 2GQ2A 3I0SA 3PFEA 4MIWA 3OSNA 1RXOB 3IBWA 2VBWA 4USWA 2B9XA 2APOA 3FVYA 1D3WA 1FKOB 3EYZA 3PVXA 1D8ZA 4DS5A 1REVA 2ZC4A 5GAHU 2XMJA 2ERRA 4NXNJ 2OPRA 2ROGA 2E1RA 4A46A 4AXJA 3KHHA 2GQCA 4J9SA 4A8YA 3JYTA 3FEYB 4UW2A 4HVZA 4YB7A 2MQOA 5DZ6A 3OVBA 3PRDA 2V8GA 2FHJD 2FHKA 3PHEA 2V8VA 1VRTB 1UVNA 1N33J 1H0HB 2KVIA 5IV4A 1DHMA 2FTRA 5A8KB 3TUIC 5E33A 1OY8A 3QJJA 3W2VA 1GMVA 4B3RF 2KKHA 1WELA 2XYHB 5BJRA 1WC5A 3ZTSA 1R0BG 3V4MA 1H73A 3LP1A 4KHPF 5D4OA 4DX5A 2DTJA 4CLFA 2DEJA 4B3SF 3DI6A 2HYIB 1I94J 1GMUA 2JWNA 4MH8A 4O4GB 2CPHA 3NEKA 4NXMJ 2A6MA 2U2FA 3MR7A 2YKNA 4Y2CA 4Q2MA 4DL3A 1Q16B 4FS1A 2ACMA 3IBCB 2KYXA 1TK8A 1RT6A 3I31A 2ZZMA 3K7RA 4DPTA 2IC3B 1RQ0A 3UWTA 4K4YA 4P2SA 4V1Ak 3RB0A 4PWWA 3WZ0A 2ZNZA 3UNGC 1LWXA 5AXKA 3D6TB 4B08A 1RABB 2AX1A 4IFVA 4DV3F 1C1CA 2JFKA 4CIOA 2DNRA 2IIHA 2PEBA 4ZVUB 1RYRA 2AMCB 2Z2ZA 5H9EJ 4KRWA 1IWGA 3JXOA 4E98A 2A1BA 2OLWA 1LXNA 4CDIA 2HS3A 5G0RB 2QTWA 2ZD1A 1FK9A 2LKZA 4E2FB 4HHHA 3C16B 3DU5A 1HI0P 1SQFA 3A8IA 2HNDB 2YWKA 1TAUA 3BZQA 2VU5A 4N56A 2XZTB 2XNQA 2VPYB 4B02A 2VFSA 5ETTA 3T1AA 2JVRA 3H2UB 4OZLA 1KOHA 4NRUA 3VAMA 3R8YA 3FFIB 6FD1A 3IAS9 5I4MA 3OR1B 3WIUA 2HNYA 1NDKA 3KNAA 4KGKA 5F8HA 3CW2C 4WP8A 5FLXY 1HI1A 3MPUB 4LBPA 1X4HA 2EFPA 2XHWA 3H40A 4ZJOA 3UW1A 2VG5B 5LJ3Y 1RT7A 2A10A 3KUHA 1WC4A 3VZIA 2IPOB 2HFUA 1HW9A 2FGCA 4TU7A 3Q2TC 4DDFA 2BDPA 3AA9A 3Q8RB 2VQEJ 1RK8A 4IH6A 4ER8A 2GIFA 2HQFA 1KQSR 2W9BB 5CAAA 1E6YB 3RR8A 4WK1A 3OUYA 4QWCA 1R8AA 1CC7A 1T02A 2J9DA 1DTQA 3MM9B 3GB0A 3NY0A 1OSCA 3N6LA 2DGSA 4EYHB 4RBVA 3H5SA 2YX7A 3T1HF 2CQPA 4WXOA 5J2NB 4K59A 4JYAF 4ILRA 3CB4A 1KTVA 4IKAA 1F6TA 2QMUB 3O6QA 1TL3A 1KLNA 4QW9A 5HI7A 2VOPA 4E0DA 1FRHA 1F5CA 2DNPA 4A47A 2OIHA 4HI1A 3N5BA 3PO5A 1KNZA 2DGWA 3RW6A 2D3OR 5L1IA 4KHMA 2Y1IA 3DCAA 5E3QA 4A4JA 3BQ1A 4QZVB 4QR2A 3DDKA 1RU1A 2RS2A 5HAOA 2MGZB 3R1LA 1RTHA 2BANA 3ZNUA 1Y3JA 4OJ1A 4LFBJ 3I5AA 4CTAA 2VFVA 1SC3B 4ZVEA 5EWEA 2MQ8A 2CPDA 2GVZB 3TA0A 1MLAA 1T7PA 2E1MC 4X4OA 5IV3A 2MKIA 4B3OA 4USKA 3X1LB 4PXDA 2BJ8A 4IG3A 1SPBP 4F8RA 1RTJB 1A0OB 1HA1A 3FBFA 4IG0B 2VF3A 4WKRA 2KDOA 3L7UA 2QIFA 2C3OA 1VLYA 1WHXA 4ES1A 5A2QY 2UUBF 4KR0B 3ETOA 3D66A 3IG1A 2CNNB 4FNHA 4KSEB 2AJ4A 1T9VA 1CVJA 3KUGA 3CCTA 3BGUA 2QV6A 3G9CA 1IQZA 3ZTPA 2O67A 2LLZA 2RH3A 3BGRA 1L5UA 4U6PA 1YBUA 3W2WB 3TQEA 1KLMB 3V4IA 2K7KA 4ICLA 4X4PA 3P5BP 1JLEB 1SIZA 2FJEB 2NLWA 4ZVQB 3DLEA 4EK2A 3ONQA 5DQIA 4A8WA 4LF9F 5K14A 2H48B 1RGVA 3PX0A 2VPZB 3NGUA 5J1NA 1SUQA 1SCJB 2FYXA 4OI1A 1NZ8A 1NK9A 3CCSS 2EFGA 4EEYA 4JI3J 3GFYA 2ZM6F 2BOPA 1Z1ZA 3NOCA 5L1JA 1VQSA 1TFYA 3G6VA 4A8SA 3T1YJ 1PJ5A 4N77A 1WG4A 3MAAA 4LQ3A 3MPDA 2EG2A 3H90A 4OZ0A 4DR5F 1X9SA 5C24A 1U2FA 2HIYA 1WKJA 1I5OB 3K8WA 1YZ6A 3RW7A 4HACA 2WBRA 1C0TB 1REGX 1X0PA 1PGZA 1IM4A 2HG4A 3D2WA 4P2FA 3MMJA 2FQQB 2P2CB 4WFAQ 3D3CJ 1RE1B 1TKXA 2Z4PA 3D28A 3DGPA 4K7QA 2Q3PA 3ZZUA 1YDLA 1U47A 2C2ZB 2X1BA 1HNZJ 4MMOA 1VQ8S 2JEJA 4CCHA 3CJRA 5HJXA 4DPXA 1VQ5S 3PYGA 2EK6A 2YNFB 2H9ZA 5F8GA 3ET6A 2C1EB 2NZ4A 1N36F 4NPOA 2HGMA 2J0QD 2DHXA 4EFAC 5RUBA 2WOMB 3IS9A 3MEEB 3CDAA 5KT6A 1RHMB 1QUPA 1SJQA 4DX8H 2M8HA 5EHHA 1J5EJ 4AFFA 4U7CA 5DLGA 3DOKA 4J9VA 4FXDA 3QPIA 2OI2A 4LRFA 3UDLA 1UEVA 4CH0S 4DJBA 1APSA 3HSJA 1EP4A 4J9OA 7FD1A 1HPZA 4HTJA 5HP1A 3AB4B 1F3VA 1YZ7A 1U4BA 4C8OA 1GMWD 3D5MA 3OV7A 3TX0A 1S9EA 1QE1B 3UR3C 1IUJA 2XS2A 1HNIA 3UD5A 3TAMA 2MZSA 4FXWA 3FCVA 1FEEA 3EVWA 2FUG9 5E3CA 1EZZB 4PRFA 5HVGA 2RRAA 2WSCC 3GZ7A 2BMBA 3M32A 5F8NA 2HHXA 2EXUA 3PEHA 2G4BA 2ZH7A 2E1CA 2FLOA 2B6AA 1DLOA 1C0UA 4UOFA 2G1HA 2B8QA 4DV0F 2HW3A 3HVAA 3KHLA 2B5JA 5J2PA 2ZVIA 3W5ZA 4DQSA 3MXHP 3EICA 4LR7A 1ZM2A 4KO0B 1B3TA 4DR6J 1F9HA 4NX9A 2PEHA 3R1HA 4MKBA 2W7OA 2DVIA 3CO9A 3EZUA 3KHRA 2CQHA 4NRTA 4RNOA 5KFMA 3CCUS 3NXZA 1LW0B 3I9V9 1X4CA 5KFYA 2G2ZA 5KT5A 3KK3A 4IRDA 3CD6S 1RBLA 2CFXA 4WE1A 2XWYA 2KTQA 2HFVA 4C8NA 2I9SA 1X4BA 4K4ZA 3Q8YA 1S1TB 2NYIA 1GT8A 2R8JA 1A7GE 5A0YA 3RZAA 2QEXS 3TANA 1PAUB 1KSPA 1X4AA 1JKHA 2GX8A 4ZLNA 1WJ9A 3ILIA 4ZLJA 4K0KF 3EVOA 1YG0A 4CYUB 1Y5NB 1ZBTA 2DR9A 4J9MA 3M2VB 3EPIA 4NZ0A 3BREA 1MU2A 3O8WA 4UZCA 1JLGB 2JVOA 1TV6A 3VAFA 3M2RA 4JI5J 3GCWP 5KFNA 5DZ7A 3OT9A 2QN6B 3OL8A 1HNWJ 4EBCA 1H6KX 1J2VA 4NLDA 1U02A 3NP5A 1P1TA 5GAEI 4L3KA 2XCPA 4ZS6A 1P8GA 2N3OA 4CH7A 1J27A 2GFFA 3BO3A 1YJRA 3B54A 5H9FK 2HQDA 2MKYA 4NMXA 8ATCB 3JQJA 1TL7A 4N8NA 4CO1A 3CCQS 1NPPA 2VBXA 1UVLA 1UP1A 2MHNA 3UCZP 2MSSA 2M4MA 1V3SA 4I7FB 2UUAJ 4X4TA 3MI7X 4EGLA 2VOOA 1K1QA 2EKYA 3E01A 1N5TA 4EBEA 3J80U 1SIWB 4ZIWA 5D0EA 3D67A 4LBHA 3T5HA 1KP6A 4UT4A 2DO4A 2DCUB 4A8XA 2PMWA 2FJWA 2RT3A 3NBPB 4NE9C 4FBUA 1KONA 4ZPAA 3OFFA 3OD2A 1WEZA 4UOHA 1LWCB 3J81j 1NDLA 2I8EA 3PM9A 3PZPA 1R8HA 3T6JA 5HQ8A 2DHHA 4C48A 1XNQF 2XO7A 1S1WA 1RT5B 1WACA 3DOMA 5KFUA 4QIFA 3I6PA 5KFQA 1X4GA 3GG0A 4E8UA 2NUHA 5KFBA 4OI2A 2VJVA 4CO2A 1LEOA 1N5YA 3KK1B 1WI6A 4DG1A 2BJDA 2DNQA 3Q8VA 1M5KC 1IBLF 1NSAA 3NRBA 3M8SA 4LRDA 3QZ7A 2FJAB 3R27A 1U2CA 5ETLA 2D9PA 2XMTA 2ZH4A 2F8EX 2FVPA 3KJNB 3BGOP 2AEJA 3CTRA 4X4UA 4V19J 2AEFA 4C0OC 1MMDA 4NA2A 3J7YI 2W9AA 1CJUB 1YGYA 3RBZA 4HDHA 4PUOB 4P73A 2RJZA 3D6HB 1RWWB 4C4WA 2JJ4D 2CNKB 2OPPA 2HGNA 3GP9A 3CO0P 2I6WA 1U1NA 2DRBA 2KZZA 5L46A 4LR9A 4RWWA 3MEGA 4DL0C 4MYTA 4J9QA 4ELUA 1RTIA 4ZP7A 2HK2A 2P6SA 3VVUA 4YY3F 1KKHA 5E0OA 2WBMA 3BBBA 3H20A 4TNOA 3LGHA 5KG1A 3UN2A 4ID5A 3H98A 4L76A 5HQLA 3R3TA 2KHDA 4K50A 3DRYA 1RHQB 4Y2AA 2BJ9A 1VS3A 1FF2A 3RBEA 1Q8IA 1S57A 2W7AA 5IOLA 1W7WA 1GK8A 4JV5F 4P7VA 4YHHJ 5CZVA 4OI6A 1S7HA 3IRXB 4P72A 3KNGA 4GC7A 3JSBA 2CPFA 3E8OA 3TA2A 4YUDA 2HHWA 4L6V3 4IDKA 4XIUA 4DL6A 4B9TA 1RU2A 4OX9F 2W25A 9RUBA 2V9WA 4ZP6A 3TAQA 2DXDA 1NSPA 2OELA 3Q8PB 2WRMA 2QLFB 5HVHA 1T9TA 3QSYB 1PBAA 4A8FA 2BEFA 3MEDB 2F40A 2W2PP 3QWPA 2YNIA 3D3BJ 2IJRA 4C0BA 2IJFA 1REVB 5KFXA 2NPIA 2ASJA 5HBMB 2OPRB 4Z37A 2H4YB 1EB0A 4M5DB 4OZ3A 2KHCA 1UAWA 1G2EA 3GPAA 4PXCA 1HL6A 2VKRA 3JSYA 2GS8A 1DBDA 1S7IA 1ZAWA 3ELHA 3FMWA 2KXNB 3DRSA 1S6PB 3F44A 2X51A 5L1LA 2I0XA 1I6JA 1CQMA 4TU9A 1AYEA 4QU6A 1D0EA 4A8QA 3TJAA 5E3AA 3CSKA 1C4AA 1FJ7A 2FZKB 3QT5A 3M6UA 3HDSA 5DG8A 5DRKA 4YFUA 1PJ7A 3SQOP 2YKNB 2MKSA 5KT3A 2B0GA 1HNVA 3KMSA 3RYLA 3E2EA 3MFIA 3T3FA 2NYHA 2MQMA 5M2PA 1UW9A 2LDIA 2BABA 1T03B 3LUYA 4FPRA 4NLQA 4CP5A 2KJVA 4ELVA 2ABYA 2L9NA 1C1CB 3LWLA 4J5OA 4ECWA 3JS9A 1RADB 4ZPWR 5DG9A 1BQNA 1K47A 5DDOC 2BVZA 1ZYQA 3D0HE 4DUZJ 4I2PA 3UQSA 2V8HA 1ZM3A 3T5JA 2OPSB 1RT2A 5L1KA 2NSBA 3DHWC 2FLLA 3IP0A 1MROA 3GJRB 4NL5A 1CSJA 2CQIA 2E1AA 4USHA 2WVEA 2VIHA 5HLFB 4ZVSB 4ZP9A 2KH9A 2MZ1A 4NLXA 1IBMF 1NSQA 1GXLA 2QE5A 1LW2B 4ED6A 2HNYB 1DARA 4WYLA 2HHHJ 2W2OP 4OYMA 4FF1A 1TKZA 2BE9B 4IO1A 1QJHA 1Q8LA 4LSNA 2NXNA 1RKJA 3ZZ0A 5AXNA 3CCJS 1Q79A 4ECXA 4NZ7A 5GVQA 2D7SA 3F41A 4DR3J 3VAHA 2ZH2A 3V5RA 2CQ2A 1NK5A 2ZH5A 5BYQA 3CGIA 3BYRA 3G82B 4BBYA 3BH7B 1UJ5A 1VDHA 1GQEA 1B99A 4WBFA 5B0FA 3TNVA 4EU0A 2OH2A 5HSPA 4WTOB 4ZHRB 1FVSA 4X2BA 2HAIA 4KQZA 2QFIA 1W25A 2Z8QA 2WB4A 3H25A 5A6WA 2QFJA 3HJVA 2J0SD 2HHVA 1WKKA 4UOGA 2QMXA 3IGVA 4LFAF 4AD6A 3QSIA 3AD7C 3MM6B 2ACYA 1M1GA 3UI3A 3MR2A 3K58A 2GIQA 1HR0J 3DRPA 4ZVTB 4ID8A 1D9FA 2ZZTA 2DIVA 2W8KA 2L9WA 2MJUA 3BSCA 1LK7A 3DXSX 2MQLA 4YN3B 1Q86T 3QRQA 2QA4S 3GFZA 1NPRA 1N6QA 5LMUJ 5CABA 5GMKa 1SH2A 5ITHA 2FLPA 1R6YA 5KAKA 3WHIA 5LL6d 1RTHB 4CWBA 4CTAB 3R5BA 1FVQA 2IBKA 4IR1A 2CDRB 4F4ZA 2E5LF 3QGIA 3TUJC 3JSRA 3AOCA 2NXEA 2IM2A 3MEKA 2JFDA 5M2UA 5H9FJ 2CQGA 5KFKA 1WF0A 2MTLA 3HULA 2B43A 2MYFA 2HQGA 5EX0A 5FLXU 2OKQA 3OR2A 1OY6A 2LA4A 4AQYJ 1YBTA 2JZ5A 2A3JA 2UP1A 1YRUA 3AXMA 1RT3A 4L3NA 1GEHA 3WQPA 1HWIA 1NNDA 5ETNA 1KFSA 4Q2LA 3LA0A 2DIUA 1XMOJ 4CH1A 1KVKA 1S49A 2CPZA 3IG1B 1JIHA 5E7OB 4ZJQA 1FKOA 4DV4F 2R7XA 4CT8A 3ZXWA 1NKEA 2F3JA 1XNRF 1YI2S 1X4FA 1IBCB 2IVMA 4PQUB 2E5GA 2YKMB 3BSOA 3OTOJ 2WB1D 1HNXF 3GLJA 2EW9A 5GAGI 3DFEA 2UXBJ 5BYSA 1SC4B 4UY85 1N5SA 1T95A 2F8MA 3U1MA 4EBDA 1VRTA 3GFHA 5K14B 4P2MA 1SUQB 1S10A 5A8KA 2ZOFA 3MR3A 2Z56B 2MKHA 2BE7D 1YQHA 3GIRA 2MEWA 1NHKL 3T9ZA 3ILOA 1UWBB 4MT1A 3HD2A 1WOSA 4O4GA 3PW2A 2BRLA 4AT1B 1S6OA 5DQHA 3PRVA 3C19A 3ISZA 4G1IA 2EFOA 4MK9A 4HACB 1U1MA 3QFHA 1RA7A 3BYPA 2XTJP 3HK2A 3H42A 5H1SV 2IC3A 2CAJA 3NGKA 1UWAA 1YVFA 1M5OC 4JI1J 4NOHA 1VC6A 1RAFB 4NLYA 1SJ3P 4USUA 2LQJA 4JI7J 2W4DA 4IO9Q 4F0KA 2X1AA 2GVDB 2GMHA 4Z7CA 1QSLA 4Q0BA 1S4EA 4C8KA 3GV5B 1O5JA 2M5YA 1VIOA 1ZM9A 5ETRA 4DV1F 5A8RB 1J5OB 5KFLA 2VG6B 5KG0A 4DUYJ 4B9SA 1D09B 3ET6B 4NASA 1FRKA 3N6NA 1MG7A 3TEHB 3VQSA 5D4NA 3IS9B 5G0RA 2GGPB 4WWSA 4ECVA 3C16A 2LEBA 1W2IA 2XSFA 1LWFA 3DOKB 3EZOA 2HNDA 3B82A 2MKJA 2KG1A 1Q81T 4DR7J 4BCAA 2CQCA 3OBIA 4ZPTR 2G9OA 1IR1A 3FQLA 4O3OA 4H4OB 1U24A 2MZQA 2X1FA 3GR1A 1EP4B 3FFIA 5IQ6A 4OMFG 3OR1A 4NLSA 2VL1A 3QIDA 5HP1B 5B0CA 3I87A 1Q53A 2XEXA 1U0HA 3IO1A 3ZTOA 1M5SA 2CJAA 1OJ4A 4LFCJ 2VDIA 3QGGA 4K4UA 1S9EB 4LF8J 1YSJA 1A6LA 1HNIB 2BJEA 3TAMB 3HHLD 4NA1A 1RZMA 2UV8A 3KHGA 4P75A 3H59A 2GMJA 1UTAA 3ITHB 1S1VA 3BGLA 4TY9A 3MPYA 4Y2KA 1MN9A 2W9BA 2QL5B 4MFBA 4XTTA 2W2MP 3D0IE 9ATCB 4GC6A 2FD2A 4IRCA 3MM9A 3G8QA 1EJ7L 2B6AB 5IM0B 1ZAXA 2DH7A 2BBEA 1NU4A 1C0UB 5CD4H 3V81B 3M1VB 3VR1A 1RISA 4LUBA 4M8LA 4DFKA 3RTVA 4NA3A 5J2NA 5GMEA 4UF4A 1Q8BA 2B5JB 2DPJA 1C4CA 3SEOA 2GHVC 1IR0A 2DEIA 2LEPA 1XC9A 2DY1A 3A8KA 1S77D 1GFWB 2WW8A 2W9CB 2R8KA 1X4EA 1KRPA 2CQ3A 1RAOA 4WZMA 3OHAA 3G6YA 2J6UA 2MB0B 4FKXA 3W9IA 1OPZA 3QFWA 2H54B 4R25A 1X8DA 5F0WA 5BR8F 4JV0A 1MWZA 1JNZB 1VK3A 2IMOA 3DLGB 1KVJA 1N5VA 3ZZYA 1T9WA 4PEOA 3PV8A 3KXDA 2GVZA 1VYAA 2ZBIA 4NCGB 4K4XA 5D3GB 4OZ2A 1S76D 2OSQA 3EXCX 1O8BA 2QG9B 1EKRA 2Q6CA 3H5XA 2HMIB 3AA8A 3NOGA 4JI8J 2HHQA 2LECA 1WF1A 1RTJA 2ILZA 4IG0A 3MECB 2FY8A 3VAJA 4RW6B 2JNJA 5KOWA 1S9FA 4DR4F 3TYTA 2PI5A 4GKKJ 2HHTA 5B0BA 3MZIA 2KT2A 2FY1A 5CZXA 1N48A 5KG6A 3AFGA 2O01C 2PA3A 3PXGa 4EMDA 4KAIA 1G3OA 1TUVA 3EGVA 1HARA 2QT7A 4CQ1A 4ILMA 2OTJS 1F0XA 1IKXB 1HBUA 4ZLLA 3NGTA 2KXFA 3W2WA 3PG9A 3CCMS 2ZUAA 3J7YU 3ENAA 1JLEA 5L39A 1K8AT 5KTQA 2YQ3A 3W8PA 3W63A 2WTFA 4G6VB 2J0XA 4U8YA 2K2PA 1TL7B 2ROPA 4ED5A 1ELOA 2BX6A 3PEJA 2AIRB 4W92B 4J9PA 2WSEC 3RG6A 1NMEB 2MZTA 2QMWA 3CJ5A 2XHCA 1NPKA 5K20B 3PTWA 4OHXA 4Z7YA 1U1OA 3GU0A 4H4KC 1KD1T 2WK4A 2V94A 2K06A 4R0EA 3LW5C 2XI3A 1U1QA 1FNXH 3R5DA 4C8MA 1NK8A 2YPYA
chains in the Genus database with same CATH topology
3H42A 3BPSP 3AFGA 2W2MP 2W2QP 1ITPA 1V5IB 2ZWPA 3CNQP 2Z56B 1SPBP 2Z2YB 3WIUA 2W2PP 4JP8A 4K8RA 3GCWP 2W2NP 3WIVA 3VV2B 2PMWA 3BGOP 3GCXP 3VHQA 3CO0P 2Z58B 2W2OP 3WHIA 1SCJB 3A3PB 3A3NB 3A3OB 3QFHA 4NMXA 2Z2ZA 4NE9C 2Z30B 2QTWA 1R6VA 4OV6A 4YN3B 3P5BP 2ZWOA 2E1PA 2Z57B 2XTJP 3SQOP 3T41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H42 A;  3BPS P;  3AFG A;  2W2M P;  2W2Q P;  1ITP A;  1V5I B;  2ZWP A;  3CNQ P;  2Z56 B;  1SPB P;  2Z2Y B;  3WIU A;  2W2P P;  4JP8 A;  4K8R A;  3GCW P;  2W2N P;  3WIV A;  3VV2 B;  2PMW A;  3BGO P;  3GCX P;  3VHQ A;  3CO0 P;  2Z58 B;  2W2O P;  3WHI A;  1SCJ B;  3A3P B;  3A3N B;  3A3O B;  3QFH A;  4NMX A;  2Z2Z A;  4NE9 C;  2Z30 B;  2QTW A;  1R6V A;  4OV6 A;  4YN3 B;  3P5B P;  2ZWO A;  2E1P A;  2Z57 B;  2XTJ P;  3SQO P;  3T41 A; 
#chains in the Genus database with same CATH topology
 4OYB A;  1DZ5 A;  3P49 B;  3V2U C;  2YY3 A;  2OJ3 A;  2OML A;  1C0T A;  2BQ3 A;  4B17 A;  2XMK A;  3ZZO A;  3PR5 B;  3ZZZ A;  5L9X A;  3IC1 A;  3MOZ A;  4DR1 F;  1H2V Z;  3DOM B;  4QPX A;  1M90 T;  2DRA A;  1JK9 B;  4DR2 F;  3R7B B;  3LP0 B;  4JI2 F;  2Q6B A;  2XWX A;  4B9N A;  1HMV B;  4WFY A;  1N5Y B;  1U1P A;  4DG1 B;  2NS1 B;  5DGA A;  2XMV A;  2AZ3 A;  1X7V A;  2YNF A;  1EQ0 A;  4I6W A;  2N4C A;  2H3E B;  2POK A;  3UDV A;  5IT9 Y;  2IRY A;  3MMC B;  2V4J A;  3DLB A;  2XLK A;  5HVF A;  1U49 A;  2QYG A;  3HVR A;  5A8W B;  3MEE A;  4HT5 A;  4LR8 A;  2UXC J;  2C3Y A;  3ZNJ 1;  4DF8 A;  4JBC A;  2JRS A;  2NSC A;  3LQV A;  2CJ9 A;  3HT3 A;  4PR6 A;  4MK7 A;  2KN4 A;  3G8T A;  3THV A;  3KJF B;  4DL5 A;  2WCX A;  3FZ2 A;  1FRX A;  3VAL A;  2D3O 1;  4I2Q B;  3LPE A;  2ZKU A;  1CJT B;  2VBZ A;  5CYQ B;  4FP9 A;  2FHO B;  4QOT A;  5J2M A;  1QE1 A;  4QBU A;  2JEF A;  4K5R A;  4ID5 B;  1WWH A;  3M9O B;  2KT5 A;  1NK7 A;  2D3U A;  5C2G A;  4RBT A;  1DRZ A;  4HEA 9;  2J6T A;  3QJL A;  5K8O A;  3EJM A;  1B0V A;  4ED3 A;  4DCO B;  3K2Y A;  2HQC A;  3LP2 A;  4IRK A;  4TLQ A;  3CJ0 A;  4WK3 A;  3FKB A;  1NSK L;  1VMB A;  1N34 F;  4EZ9 A;  4HH0 A;  3AH6 A;  1QVG R;  1JX4 A;  2MLZ A;  2RDJ A;  3SV3 A;  3W64 A;  4CLZ A;  1ARO P;  2HFN A;  1Q5Y A;  2Z2L A;  4RW8 A;  4FYY B;  4N5S A;  1HHT P;  4EO8 A;  2DGO A;  3QJP A;  4B3T J;  3IR6 B;  3KFW X;  4YR0 A;  3ILJ A;  1ZA1 B;  4KO0 A;  1KWM A;  2RVJ A;  3UCU P;  2YNI B;  2JLE A;  2BXJ A;  2CNL B;  2GZO A;  1BUX A;  4L72 B;  3CDE A;  2UUW A;  3KTQ A;  1LQ9 A;  1PSD A;  2YKO A;  2Y1L B;  1LW0 A;  1S97 A;  3MTJ A;  3BM7 A;  2UXD J;  2N82 B;  1JXV A;  2CQD A;  3L09 A;  2MZJ A;  2IDL A;  4OZ5 A;  2HBR B;  3ENV A;  2VH7 A;  4ZPV R;  1X5T A;  1QAX A;  3RAM A;  3SZ2 A;  1S1T A;  1UMJ A;  4FYW B;  4KGZ B;  5LMN J;  4GKJ F;  2RU9 A;  1LWE A;  3DRS B;  4FYX B;  1BQM B;  2OD6 A;  3F0N A;  4ZOS A;  1I3O B;  2ILY A;  4MIA A;  2C2O B;  2HVI A;  3FQK A;  3DN9 A;  4ZCI A;  3IA0 A;  3TAP A;  2AJQ A;  2HVD A;  5IWA J;  2KT3 A;  1OPI A;  5U47 A;  4QWB A;  5D0G A;  4YP3 A;  3BV8 A;  3R6L B;  1L3V A;  4CYU A;  4WKY A;  3C2P A;  3CCZ A;  4QIV A;  2M70 A;  1SVD A;  4DPU A;  3M2V A;  4BDP A;  1RTD B;  1JLG A;  4UOC A;  3HSG A;  1NZA A;  1FX4 A;  1HHQ A;  1Y00 A;  3BR8 A;  2HFZ A;  1FJG J;  3BBF A;  2JEG A;  2J8S A;  4S0M A;  1V3R A;  3VQT A;  1HBN A;  5L38 A;  4OI4 A;  4RZR A;  3NCR A;  2O66 A;  1RAC B;  3SSQ A;  2B4P A;  4U95 A;  3NAH A;  4GVB A;  4TY8 B;  3QMQ A;  2IYG A;  2HVZ A;  2PD1 A;  3WX4 A;  5KFW A;  3DU6 A;  4DU8 A;  4ED4 A;  1OMS A;  4CLW A;  3FRY A;  1YJW S;  4ED1 A;  2CPX A;  2HBZ B;  3QBC A;  1GNK A;  1JLQ B;  2DH9 A;  4I7F A;  1MRO B;  2V9K A;  2AHO B;  4DWI A;  3D4J A;  2BM1 A;  3K57 A;  3MPW A;  1U6B A;  3KWM A;  1QTM A;  4C8Y A;  5EWF A;  2VQF F;  3C6U A;  2BZ2 A;  4C3K A;  1FTC A;  1BGX T;  2D41 A;  2HVH A;  1LNQ A;  2NXC A;  3IGN A;  4IH7 A;  3NBP A;  5D78 A;  2AGO A;  2HZV A;  2VFT A;  1UCN A;  3QQC D;  1LWC A;  3HZG A;  3OHB A;  4KV8 B;  4EI2 A;  1OYE A;  2J8A A;  4DV7 J;  3TWZ A;  5AE1 A;  2DR5 A;  3V6H A;  2C2K B;  2VG7 B;  3R7N B;  2C2E A;  4LF6 F;  1G4C A;  2RSQ A;  4D3G A;  2PE8 A;  3HD1 A;  3KK1 A;  1OWX A;  1RAH B;  3OLA A;  1CEZ A;  3CJ3 A;  4M5J A;  3C3L A;  2HHS A;  1PYS B;  1RWU A;  3KYL A;  4PXB A;  2DGT A;  4OHV A;  2Y0S D;  2FLN A;  4QPT A;  1KFD A;  1TQL A;  2V4Q A;  3NNH A;  2J9D E;  2EBG A;  1RAA B;  2R8G A;  1WD6 A;  2RKI B;  1HFE L;  1Z2L A;  4PUO A;  2OFG X;  4P52 A;  2QZ8 A;  2X7I A;  5KOX A;  4CO5 A;  1M5H A;  2R7O A;  3CCW A;  1OY9 A;  1WG5 A;  2HKE A;  1HKA A;  3CDB A;  3R6G B;  3W9H A;  2YPZ A;  3VGV A;  3ZC4 A;  5GAG U;  4ERD A;  3B4M A;  4O3S A;  2PO4 A;  1NAQ A;  2VFR A;  2IAJ A;  4C6A A;  4L74 A;  2A2C A;  4L73 A;  2FJV A;  3DLL Q;  1QDU B;  2AP6 A;  3PJ9 A;  1QSS A;  4QW8 A;  1IKV B;  3AAW B;  1VQN S;  3J7A 1;  1VBK A;  2PFF B;  3LPY A;  1NK0 A;  2RE1 A;  1CUL B;  1LK5 A;  3TEG A;  3QT6 A;  4RUB A;  1Z2Z A;  3ZZP A;  4N76 A;  3IRX A;  5D4L A;  2QLW A;  2DB1 A;  4HH1 A;  2RML A;  3V6D B;  1TFW A;  4QWA A;  4X65 J;  5I3Q A;  5DS7 A;  4KBI A;  4K2X A;  4C3L A;  1W2B R;  4JI6 F;  3MAH A;  1VGY A;  3GWC A;  5F8L A;  2IRX A;  1WOR A;  4G3I A;  2LQ9 A;  2QRR A;  2YWH A;  4HYK A;  2KM8 C;  3MCS A;  4X64 F;  4IR9 A;  3MED A;  1X9W A;  4O3N A;  3CCL S;  3AQO A;  1RHR B;  3DLJ A;  3FNN A;  1IVZ A;  5E2Q A;  1ROF A;  2HZC A;  2K7J A;  4JP8 A;  1NDP A;  2VC0 A;  5HBM A;  4C98 A;  4C9D A;  5HMZ A;  1KN6 A;  2VA3 A;  3DLH A;  1FXR A;  2BM0 A;  2GIR A;  3A12 A;  2H5E A;  4M5D A;  2IDE A;  4FKY A;  4GMK A;  3GIK A;  2AGQ A;  4NEY A;  4LF7 J;  4QYR A;  4EZ6 A;  3A3P B;  3SSS A;  2PDA A;  4ETZ A;  2FZG B;  2RF2 A;  1S6P A;  3PJW A;  4RUA A;  1HHS A;  2GJF A;  1FFW B;  4DV6 F;  2AWZ A;  3C46 A;  4X66 J;  5GAH I;  4ES3 A;  1N32 J;  3W8G A;  1OO0 B;  4ELT A;  3TZY A;  3AJ1 A;  1NJW A;  1QAI A;  3PR4 A;  2MLY A;  4A48 A;  2YTC A;  4PG7 A;  4F67 A;  3D6M B;  1N52 B;  3HM9 A;  4NYP A;  1XER A;  1R7I A;  1TMM A;  3MGJ A;  4Q43 A;  4YQW A;  1OSD A;  3GV7 B;  1PAE X;  1LXJ A;  2IM1 A;  2AYG A;  1T03 A;  3BKU A;  1VQO S;  3TW0 A;  2LP4 A;  2UUC J;  2FGO A;  3D7S B;  4FDF A;  1JLB B;  4Q0B B;  1FES A;  2RQM A;  3UCG A;  4OYI A;  4LJM A;  1GAO A;  4G1Q A;  4AL7 A;  2J0W A;  5CHC B;  4CNY A;  4RW9 B;  3UN3 A;  4FNI A;  4ZPC A;  3UFC X;  2IBO A;  4GO7 X;  4FF4 A;  4Y2I A;  2PMH A;  3GJS B;  1VQP S;  1YJT A;  1SL0 A;  4M63 A;  4X4V A;  2OPS A;  2BAC A;  2F65 A;  1QLN A;  2LDY A;  1XMQ F;  2CNO B;  2CVI A;  4P74 A;  4RNM A;  2XGQ A;  2G2Y A;  5BXI A;  5HO4 A;  3MD3 A;  4O0I A;  3CJK B;  3P96 A;  3PX4 A;  1LWF B;  4ZVR B;  5HLF A;  3CD5 A;  4EYI B;  4I6Y A;  1YX2 A;  3GCX P;  3NS5 A;  1HI8 A;  1BWE A;  3G96 A;  2BR0 A;  2YBV A;  5AJ3 J;  3KLG B;  1KHW A;  2WVD A;  2A6O A;  2ASD A;  4KC5 A;  1LW2 A;  5HMX A;  3QGH A;  1FRJ A;  4DX6 A;  2RQ4 A;  5CCM A;  4DLE A;  2UU9 J;  1U0H B;  2B7B B;  2M88 A;  3MOJ B;  4KH0 B;  3HF5 A;  4DV5 J;  4ECU A;  3HT0 A;  1TL5 A;  2ASL A;  2UV8 G;  1WC0 A;  2ZKT A;  4C8Z A;  5JMN A;  1TUW A;  3TAR A;  4MKY A;  5KFT A;  4RKU C;  2RRN A;  2JX2 A;  3BO4 A;  2OFH X;  3G82 A;  4OYP A;  1SB6 A;  3B8H A;  2ZEJ A;  5KT7 A;  4Y34 A;  1S1V B;  3RAQ A;  4WJB A;  5E3R A;  4B3M J;  1B70 B;  5ETS A;  4MFB B;  3AOA A;  4ZHR A;  3NG8 A;  4Q44 A;  1RAE B;  5B08 A;  4ES2 A;  4BWM A;  5M2R A;  2ZWO A;  4WP9 A;  1WTF A;  2BKP A;  1HIY A;  2A2D A;  1IBK J;  2QLJ B;  3EE3 A;  4CM0 A;  3T5L A;  4U7U K;  3MM6 A;  5K9F A;  1WDD A;  3G6X A;  4MAK A;  4Q45 A;  2RQC A;  5I42 B;  3OPK A;  2QC3 A;  4ALZ A;  3TI0 A;  1SKW A;  3W1Y C;  1S9G B;  2O5D A;  2RIJ A;  1TZ0 A;  2AX0 A;  4RJV A;  4Y2M A;  1GXU A;  3M8P B;  3HVT B;  3HHL C;  3FUY A;  1JJ2 R;  3I96 A;  4NLR A;  1RWM B;  4UZB A;  3KDN A;  1RCX B;  2VA2 A;  2F4V J;  2WW4 A;  3GG1 A;  3KLF B;  4W90 B;  4N7T A;  1SH0 A;  2KFN A;  3C15 B;  4AL5 A;  3P45 B;  4YB1 P;  1Q7Y T;  3SCK E;  2C2D A;  1C2P A;  2DNN A;  4N47 A;  3BO2 A;  1TVR B;  4JI0 J;  3J7Z 5;  2PN6 A;  1MN7 A;  4PYD A;  3IM9 A;  1S0O A;  3E3X A;  3CJ8 A;  3Q0A A;  4LF4 J;  4NXN F;  3CCR S;  2HK3 A;  3M6W A;  2R42 A;  3HO1 A;  4ZPB A;  3S6E A;  5B7W A;  3FC9 A;  3I55 S;  4KKO B;  2MKC A;  4KTQ A;  2IYI A;  4HI2 A;  4QU7 A;  3CWJ A;  2Z2Y B;  3FCW A;  4JB8 B;  1N33 F;  3HP6 A;  3FBB A;  4OYO A;  1RT1 B;  3FSX A;  3UDE A;  4DZD A;  1K0T A;  1PC4 A;  2G1D A;  3CD7 A;  2Y0B B;  3N79 A;  1TK0 A;  5FD1 A;  3JQM A;  1X5S A;  1KEK A;  2V34 A;  4PQU A;  2K8G A;  1X0F A;  3EPG A;  2XBP A;  4O3Q A;  2YKM A;  3PCO B;  1HBU B;  1RWX B;  1I94 F;  2HS0 A;  3NNC A;  1D9D A;  2RAQ A;  2PA8 D;  4V19 X;  5B0D A;  3ULH A;  4NXM F;  2ROE A;  5EGY A;  1P9Y A;  1JXL A;  1DAX A;  1GX5 A;  3ZFV A;  1EKS A;  2UZA A;  2AJF E;  2CJB A;  4M5G A;  2J6S A;  4OZN A;  2DNY A;  3M4X A;  4DSL A;  1AUS L;  1UPP A;  4ED2 A;  3S1T A;  4OLP A;  4O4R A;  3I5C A;  1RHK B;  1AFJ A;  2MJN A;  2KU7 A;  1TUG B;  2AJ1 A;  2PII A;  1UWB A;  1JLF A;  4I56 A;  2RD5 C;  5DGB A;  4PG4 A;  2QA2 A;  4DX7 A;  4KGV B;  3IR7 B;  1GXT A;  1SL2 A;  4C2M A;  2GAH C;  4DBQ A;  5D0R A;  3TQ1 A;  3VAK A;  5DM6 Q;  1M1H A;  1PYT A;  3C8Y A;  2QLX A;  5KFF A;  2IVY A;  5D4P A;  5KT4 A;  2XMW A;  2MPU A;  2Q79 A;  4LSL B;  2QA4 G;  3MCM A;  4W98 A;  2AT1 B;  1U1R A;  4F7V A;  3MMA B;  2EPI A;  2GVD A;  4U67 Q;  1JLC B;  5IXU A;  4UTG A;  2XY7 A;  5IZH A;  1AW0 A;  3L3C A;  4K4V A;  1UEU A;  3PW5 A;  2E7W A;  4LF5 J;  1URN A;  1S12 A;  1TEL A;  5A8R A;  1J5O A;  1MSW D;  1PYO B;  2VG6 A;  3HCX A;  5D6G A;  4MIB A;  4ANE A;  2ZZN A;  3QAE A;  3EGN A;  1UEK A;  4QIW D;  2ATL A;  1FKA F;  1NBE B;  2V4J B;  1RAG B;  3PDN A;  2DNM A;  1YIT S;  1X4D A;  2GGP A;  3THT A;  2AZ1 A;  3M9M B;  3F56 A;  4UQG A;  1NKC A;  3M05 A;  3I9Z A;  4X62 J;  1SKU B;  4HL9 A;  3SQG B;  4M5M A;  2VQE F;  2CRL A;  3BQ0 A;  3UO0 A;  3QWU A;  4H4O A;  3N6M A;  3J81 Y;  1NM2 A;  4FYD A;  1FEH A;  2MZR A;  2MST A;  2YWW A;  1FTR A;  4JI4 J;  2HFO A;  4OV6 A;  3F73 A;  4TVA B;  1RI7 A;  5DO2 A;  1NK4 A;  3RU0 A;  3R7S B;  1OQ6 A;  1VQ7 S;  2C3U A;  2B4O A;  2V5H G;  1RBO B;  5J2M B;  3MM7 B;  3GII A;  2IY5 B;  3VHQ A;  2M2B A;  1C1B B;  1QTN B;  1CBK A;  4TKT A;  3UE2 A;  2I2Y A;  4R5P A;  2ZHA A;  1R3N A;  3HHN B;  4CO4 A;  1P27 B;  3L4B C;  2JC1 A;  1HWL A;  3ITH A;  3I0R B;  3J80 Y;  2VIC A;  4F4W A;  4AXI A;  1S6U A;  5HK4 A;  2V8P A;  4ENO A;  3LP2 B;  4J9R A;  3OFE A;  1T9U A;  1DFD A;  3EWG A;  2QSF A;  4DMZ A;  4ED7 A;  1LV5 A;  3C6T B;  5IM0 A;  2NUU G;  1UFK A;  3NGD A;  1X9M A;  2YVS A;  1O51 A;  1NDC A;  3M1V A;  3TX8 A;  3V81 A;  1SJ1 A;  1K0V A;  2R7V A;  2FVQ A;  4LFB F;  1FFG B;  4A8O A;  1RWV B;  2KO1 A;  4RW8 B;  1R27 B;  4NYZ A;  2RNE A;  3TR5 A;  4USI A;  4WU2 A;  2RHS B;  4AL6 A;  1WOO A;  2W9C A;  4KFB A;  1S48 A;  1UL3 A;  4F4X A;  4HHU A;  2I38 A;  4KY3 A;  3KLV A;  3NAI A;  5IT9 U;  2XY5 A;  4M94 A;  2WZ1 A;  2GW8 A;  3GQC A;  1VFJ A;  2XCA A;  3UD4 P;  3DLG A;  4OLO A;  2W4P A;  2YXL A;  4O23 A;  4LT6 A;  2E5I A;  4B3R J;  2F5G A;  2Q1L A;  2QSW A;  3GYX B;  4OJ3 A;  2FJX A;  1NK6 A;  4KHP J;  4NCG A;  5D3G A;  4B3S J;  4F3Q A;  2AQ4 A;  3EX7 B;  4F2R A;  2LEA A;  1LWE B;  2WAQ D;  3FRZ A;  1ITP A;  4AND A;  3PKY A;  3RR7 A;  2W4C A;  1B0T A;  2HMI A;  4WXW A;  5IT0 A;  2ADC A;  2DNG A;  3PRB A;  3AJ2 A;  3KLH A;  6FDR A;  1URR A;  2ZOG A;  3NWG A;  4U8V A;  3MEC A;  1IR2 A;  1NH7 A;  3U27 A;  1CJV B;  1SV5 B;  2G0I A;  3CJQ A;  2YKP A;  1PKU A;  4RW6 A;  4YR3 A;  3C66 A;  1M0S A;  4DHV A;  2MKK A;  2W2N P;  5K8M A;  1EAR A;  1UPM B;  1K73 T;  4PCQ A;  2G13 A;  2E1P A;  4DV3 J;  4P2X A;  2M52 A;  2B9E A;  1RT4 B;  4YR2 A;  4JI3 F;  1U0S A;  2L48 A;  5EUH A;  5SZT A;  2QX0 A;  4FVC A;  3I4H X;  3T1Y F;  2CQB A;  1IKX A;  1AUD A;  4GVL A;  2ZIT A;  1HBN B;  5HQM A;  3MR5 A;  1RUS A;  2GQQ A;  2N7Y A;  1IM6 A;  4GVB B;  4PZV A;  5MLC V;  2AYE A;  4K4S A;  1CS4 A;  2C28 A;  2KJW A;  2VPX B;  4EWT A;  1CPZ A;  1TL1 A;  4CNZ A;  4Y6I A;  4WPA A;  2K3I A;  1HBO B;  2UUT A;  4DFP A;  2JDJ A;  4IH5 A;  2AJ0 A;  2RS8 A;  1VJQ A;  1R8B A;  3C6U B;  1HNZ F;  4Q8E A;  1S6Q B;  2HIQ A;  2B7C B;  4DFJ A;  5CXT A;  6AT1 B;  2HWH A;  4X4S A;  3W61 A;  1GTH A;  2CUY A;  4GO5 X;  3M6X A;  2F1F A;  4BLG A;  1FDN A;  4HTI A;  3TJ8 A;  2ZBC A;  2D9O A;  3BSA A;  2XMU A;  5J1E B;  3OL6 A;  3W7B A;  1N5Q A;  5E41 A;  1J5E F;  3LP0 A;  1S1U B;  2VBY A;  5FDL A;  2I5J A;  5JVH Q;  1HMV A;  4F2S A;  1AZS B;  3HLU A;  3CJ2 A;  3DOL B;  2DKO B;  2YX4 A;  3T1H J;  2OSR A;  4LRB A;  3R5C A;  1B4S A;  4JYA J;  3BS9 A;  4ZJL A;  3HSD A;  3MMC A;  3Q8U A;  3ZZT A;  2HSE B;  4F4Y A;  2V2V A;  5A8W A;  3JTN A;  2DPI A;  1SQG A;  3K5M A;  4OL8 A;  1R6V A;  3B4D A;  2B4U A;  1VQ6 S;  1IKW B;  4FN5 A;  1HD1 A;  1JXE A;  5DDQ C;  3D1H A;  4WF9 Q;  2OO4 A;  4H4M B;  1IXK A;  1X60 A;  1SJR A;  1ACM B;  3ETM A;  3UR0 A;  2XYP B;  2BRK A;  1HBM B;  3E51 A;  1R89 A;  3DYA B;  3M8Q B;  2DIT A;  1WHW A;  3AD9 C;  1BD6 A;  4YDD B;  5KFD A;  3CC2 S;  4I2Q A;  4CLY A;  1WTB A;  3JB9 k;  4KIA A;  4KB7 A;  3A4T A;  2YNH B;  1CJT A;  2V4R A;  1MNE A;  2D69 A;  3H2L A;  2IAJ B;  5CYQ A;  2XM3 A;  3LWM A;  3Q86 A;  1U2R A;  3GTY X;  1FJE B;  1U7L A;  4D3H A;  2JL9 A;  3N5F A;  3VGS A;  4RX6 A;  1PG5 B;  5ADZ A;  4KPC A;  4ECQ A;  2BKO A;  5KFO A;  3PW7 A;  3OSP A;  2AF6 A;  3PAC A;  1FA0 A;  3CCE S;  2OEJ A;  3QIP B;  4J90 A;  5B0E A;  3KLI A;  2P9G A;  4DR6 F;  4LF1 A;  1TP7 A;  4XO0 A;  5C42 A;  3ZZR A;  3CT9 A;  4HHJ A;  8AT1 B;  4I0W A;  2AU0 A;  5CA5 A;  2BA9 A;  1FD8 A;  3MMB B;  2CDQ A;  2UUB J;  2XUL A;  4OFZ A;  3BGF A;  4TXS A;  3UDC A;  2FDN A;  2KL8 A;  2OPQ B;  4FYV B;  3THP A;  1TAQ A;  2EBE A;  3QRR A;  3I4P A;  3O44 A;  3O1L A;  3PHT A;  4X4R A;  1O0P A;  4WFB Q;  2ZUG A;  3L7O A;  1NJZ A;  3FEZ A;  4ZCM A;  1T11 A;  4OQJ A;  3R5A A;  4K4W A;  3HHE A;  1QD1 A;  3GON A;  2VV5 A;  2C42 A;  3HMJ G;  4LF9 J;  2YKA A;  1WHV A;  3I32 A;  3IFE A;  2M0G B;  5T7L B;  5JXS A;  1HD0 A;  1VQL S;  3JTP A;  4B9L A;  2CZV C;  1XK8 A;  3W9J A;  4ITS A;  1FWL A;  2ZM6 J;  4TQR A;  4DF4 A;  2IJN A;  4DN0 A;  2H4W B;  1CJK B;  1RJJ A;  3JQK A;  3K17 A;  1PC5 A;  2XY6 A;  1V3Z A;  1VQY A;  2KM8 B;  2I1R A;  2RF2 B;  2KG0 A;  4DR5 J;  2W7P A;  3KG0 A;  4JI5 F;  1V9O A;  3LAL A;  1BQM A;  2CPE A;  1AXQ A;  1RAI B;  1HNW F;  2HBQ B;  3TVK A;  2NPF A;  2DXE A;  1HYS B;  2QGF B;  1FXL A;  4RW7 B;  1DJ0 A;  4CLL A;  1ZS6 A;  2DT9 A;  3EMT A;  1HQU A;  1CG2 A;  1CC8 A;  1UZH A;  4KPY A;  4C0H A;  1U45 A;  1F3F A;  4XK8 C;  2G0C A;  4BS2 A;  1RTD A;  3GSI A;  3N01 A;  1QY7 A;  2HQI A;  2C2N A;  2HNZ A;  3CJT A;  3T41 A;  2UUA F;  1XMB A;  2KXH A;  5CYM B;  2VJU A;  1N36 J;  1R8C A;  5HL7 Q;  2A18 A;  3EDR B;  4ZLP A;  2YWG A;  4DQR A;  2YNG B;  2B8P A;  3L9Z A;  4G1Q B;  4C97 A;  2R7U A;  4F0H A;  2HS4 A;  2A0F B;  1JJ4 A;  4TY8 A;  2BJ7 A;  4J9U E;  2C3M A;  1NJX A;  1DY3 A;  3O5T B;  3W3S A;  1PCA A;  5LJ5 Y;  3HKW A;  2W1B A;  1VBZ A;  1SKS A;  5MAO A;  4I69 A;  1SKR A;  3DRR B;  4PKD B;  4OYW A;  3KK2 B;  3TA1 A;  1XR6 A;  2K1R A;  1JLQ A;  2CPY A;  4OJG A;  4CLP A;  1VQK S;  4IFY A;  5KG7 A;  3KMQ A;  5ETK A;  2FVS A;  2BUN A;  1U25 A;  1U6Z A;  4A8M P;  4DV2 F;  1UA1 A;  3LAK A;  4IQM A;  1U6F A;  3HI9 A;  4LVN P;  2DGU A;  4MKA A;  2CG8 A;  3D54 A;  2FHJ A;  4CLK A;  4QYZ K;  1U8S A;  1KQK A;  3N0V A;  1TL4 A;  4KV8 A;  1OS5 A;  2DNO A;  2C2R A;  1F5A A;  4FF2 A;  4WII A;  5KG4 A;  2BE2 B;  1SBR A;  4O44 A;  2LU2 A;  3CDU A;  1ZA2 B;  2VG7 A;  1FWK A;  4YB6 A;  1JJC B;  2R9L A;  2DH8 A;  3PW0 A;  2AKW B;  1ZAV A;  5DG7 A;  1WSR A;  2L08 A;  2IRU A;  4QJV A;  4ZDN A;  1KDN A;  5LOQ A;  4DV0 J;  4ANC A;  3SIP B;  2R7R A;  4F36 A;  2N4D A;  1Q8K A;  4I6A A;  1Z4U A;  3CDW A;  2HLT A;  2CPJ A;  4PWD B;  4B9U A;  2RQK A;  3RRG A;  3K5O A;  4DL2 A;  1KHV A;  3CME S;  2AW0 A;  2RKI A;  3SDE B;  3G6E S;  1UVJ A;  3SCL E;  1PIE A;  3VAI A;  2CXE A;  4HKQ A;  2H51 B;  3MAQ A;  3VZH A;  2B3T B;  2XGP A;  3DM2 B;  1F9F A;  4YHH F;  5F41 A;  3KG4 A;  1I51 B;  3TP2 A;  3TO8 A;  2HAF A;  5B09 A;  2DNL A;  2X3G A;  4X4N A;  3LGN A;  2DNH A;  3D68 A;  3O2I A;  1Y5I B;  4ECR A;  4FPI A;  1IKV A;  3AB2 B;  4ZCL A;  3U7J A;  2HRT A;  1TKD A;  2DRD A;  3HFV A;  3NS6 A;  1L3U A;  1CUL A;  3I56 S;  2WVB A;  5AT1 B;  4AUK A;  3GJT B;  3SCI E;  2R7S A;  4DL4 A;  3BSN A;  4K0K J;  1SJF A;  3V6D A;  1YJ9 S;  3H7H B;  1DTT B;  2W8L A;  1UKU A;  2GJ2 A;  4J91 A;  2JLG A;  4OX8 A;  2XS5 A;  5KFG A;  1HQE B;  3HHL B;  1WEX A;  1Y9O A;  2R2U A;  4UY8 T;  4U7U D;  2EWH A;  3VF0 B;  3GJQ B;  3HVW A;  3IWX A;  1GX6 A;  4XDD A;  5IC6 B;  5DM7 Q;  1NJY A;  1JMT A;  4M5L A;  2UVU A;  3DLK B;  3GIM A;  1N0U A;  5AE3 A;  3QT7 A;  2DGX A;  3BEG B;  4F02 A;  3KLE A;  1N8R T;  1VHI A;  5C25 A;  3UD3 P;  2O1P A;  2H5J B;  1Y5L B;  4IOB A;  5I3U A;  1H2U X;  2HZA A;  2DXF A;  3MF5 A;  4NLV A;  3CNQ P;  1NEE A;  4OI3 A;  2F4F A;  3IMQ J;  1VI7 A;  1NUE A;  1SI9 A;  4NCA A;  1YJN S;  4WZQ A;  4K2J A;  2M7S A;  2MQQ A;  1P9Q C;  2RDI A;  4K4T A;  1Y0H A;  3BN7 A;  4OIX A;  4ED0 A;  3CPW R;  3QLH B;  1TKT A;  1JLF B;  2FVR A;  1YTY A;  1XNQ J;  5DJB A;  4ZIT A;  5J2Q A;  3M2U B;  4ILL A;  4HLB A;  3OFG A;  2QO3 A;  5CH7 B;  4O0N A;  2B4V A;  4CT9 A;  4DUZ F;  2Q66 A;  3BH6 B;  3MM5 A;  4RUH A;  5FJ4 A;  4IOC Q;  1U1L A;  2JSX A;  2XO6 A;  2ZFH A;  2F63 A;  3DKD A;  2E7X A;  2AGP A;  1IBL J;  1HWU A;  3G8S A;  2FC9 A;  1JLB A;  4RR5 A;  2IM0 A;  3PW4 A;  2OEM A;  2VKZ G;  4MJK A;  4J7C A;  4N41 A;  2B56 A;  3PO4 A;  2V68 A;  4RW9 A;  1WUU A;  2LXF A;  1RLD A;  2IHR 1;  3KJV A;  5EX3 A;  5A2Q U;  2IVF B;  3OVS A;  5KG5 A;  4JOU A;  4DXL A;  2HHH F;  2CQ1 A;  5LM7 E;  4EO6 A;  5E3P A;  2RRB A;  1FER A;  3I5B A;  5GAD I;  4I64 A;  3JTO A;  3TOQ A;  2E9Z A;  3BJY A;  4F3O A;  5DET A;  3TZX A;  3TVY A;  4DR3 F;  3CJK A;  4N8O A;  4CRJ A;  3SI8 A;  1T05 B;  2AV5 A;  4YY3 J;  5C5J A;  4MYU A;  2KYZ A;  3ICL A;  2V2Q A;  2XLJ A;  4HDG A;  3KLG A;  1PIL A;  3RAX A;  3POT A;  3PIO Q;  1N4L A;  3HXM A;  2ZE2 B;  3UVJ A;  1D9A A;  1N56 A;  2HWI A;  1BWV A;  4PAB A;  3MM8 B;  2PT0 A;  2UVV A;  5KFJ A;  5LXY A;  1QAJ A;  1DQ8 A;  2J5A A;  2DHS A;  4JV5 J;  3QNW B;  3EXY A;  4DSF A;  3BKT A;  1BLU A;  2YX1 A;  1FO1 A;  1W26 A;  1IKY B;  3P5T L;  4R5P B;  1U09 A;  1NB7 A;  2R2T A;  1VIX A;  4DQI A;  1VBY A;  3EUN A;  4PQA A;  4AYB D;  2RUG A;  2HEK A;  1JLA A;  1ZM4 A;  3MD1 A;  1HR0 F;  2AYB A;  1FKP A;  3SXL A;  5KFZ A;  1RCO B;  4OX9 J;  1S1X B;  4LSZ B;  2N3L A;  3OTD A;  1VLO A;  2V67 A;  5LMU F;  1EQM A;  3D9B A;  3RB3 A;  2R7W A;  2X3D A;  3QAT A;  2AEM A;  3K59 A;  2HRY A;  3OVA A;  3U02 A;  3TZZ A;  1VRU B;  1E6V B;  3US5 A;  1AA1 B;  5C7P A;  2XZD B;  4CI0 B;  5I42 A;  1FX2 A;  5GAE U;  1BE4 A;  1K9M T;  4KFB B;  4YB5 A;  1U1K A;  3W60 A;  2G2O A;  1S9G A;  3D1Q A;  1R31 A;  4GRS A;  3EDQ B;  3MHY A;  3FCH A;  3NMR A;  3M8P A;  3HVT A;  3UPF A;  2LQ8 A;  4XDC A;  2EI5 A;  2R4F A;  2DR6 A;  4ZVH A;  4AQY F;  2BJ1 A;  5HN0 A;  4W4M A;  3KLF A;  1RLC L;  3C15 A;  3A3O B;  3CE8 A;  5IT4 A;  5DDR C;  3PYF A;  4C7Q A;  2ZBQ A;  3OJS A;  1XMO F;  1VQ4 S;  3J81 U;  2Q43 A;  3G2X A;  1WC6 A;  3J7A N;  4ZMM A;  4KJI A;  1B7Y B;  3JSM B;  1TVR A;  1H3D A;  2Y8Y A;  4JUZ A;  1PO6 A;  1GMW A;  1FRI A;  4R0J A;  1B0P A;  3PNI A;  3AQP A;  5CQG A;  3GSD A;  3KLH B;  2J9E A;  2HBY B;  4TN2 A;  1Y11 A;  4BC7 A;  3OTO F;  1M5P C;  2LU1 A;  2MQP A;  5D15 A;  2UXB F;  4KKO A;  2V50 A;  2ZBP A;  2EFN A;  3VTI A;  1UET A;  2KFZ A;  1MMN A;  3VGU A;  2GV1 A;  1L3K A;  1S72 S;  2ADB A;  1R43 A;  5K5M A;  4DSI A;  1RT1 A;  4WFN Q;  4C3M A;  3QO9 B;  3AJD A;  4QYZ J;  2MMY A;  5KG2 A;  3BPD A;  5KFI A;  3LAN A;  2P9E A;  3GR0 A;  4UUX A;  1FE0 A;  4QWD A;  4Q5V A;  5DDP C;  1RWP B;  4A8K A;  2CJY B;  2KB2 A;  5D77 A;  2Y3Y A;  4NLU A;  1SC6 A;  5FII A;  1CS4 B;  4DV2 J;  4DPO A;  2GNK A;  3KKF A;  4OHW A;  1TL1 B;  4JI1 F;  2OUG A;  1IBM J;  4J9N A;  3C14 B;  1FI4 A;  4JI7 F;  3ENW A;  2OHD A;  3H4B A;  3FK4 A;  3Q23 A;  5T41 A;  5KFH A;  2BYC A;  2Z2M A;  4OX7 A;  1NKB A;  1I1G A;  2HRU A;  1KOO A;  3CUN A;  2GO8 A;  3FBE A;  3DMJ B;  1K1S A;  3R9L A;  4DUY F;  4PG8 A;  1HWJ A;  1UJ6 A;  3ZTQ A;  1TMJ A;  2HHU A;  1NO8 A;  4C8L A;  2J7U A;  4LRC A;  4NLO A;  1Q7L B;  3LOU A;  1WEY A;  1FJC A;  5HRO B;  2VUG A;  3S7R A;  4LSL A;  2Y9H A;  3MMA A;  3GYN A;  1JLC A;  1IQT A;  2EFQ A;  5LT5 A;  1BMQ B;  1XBW A;  5FDL B;  2I5J B;  4PAA A;  2YWE A;  5KG3 A;  4DR7 F;  2XNR A;  4H4K A;  2RHQ B;  4NWB A;  3OW2 R;  4C11 B;  1FNM A;  3BDP A;  4LFA J;  1S79 A;  3QYY A;  4DSK A;  1EET A;  1SH3 A;  1S4F A;  5HMW A;  2RB7 A;  4LFC F;  4OV1 A;  3OXF A;  2GML A;  2ZDP A;  2R2S A;  4LF8 F;  5F9L A;  4Z2X A;  2FPH X;  7AT1 B;  1WC1 A;  4LF2 A;  2EKN A;  4B9M A;  1H72 C;  3SQG A;  3GIJ A;  4EUV A;  2R8H A;  4NI2 A;  2JOQ A;  3GMG A;  1VIS A;  2HGL A;  2CG4 A;  4OHZ A;  2V69 A;  3ZTR A;  3NLC A;  1FXD A;  2ZC3 A;  4F04 B;  3WC0 A;  1RSC A;  3UN5 A;  3I0S B;  1RWN B;  3QT8 A;  3LF0 A;  2E5L J;  2XB2 D;  3BPS P;  3MM7 A;  4DUT A;  2DHA A;  1OYD A;  4RPF A;  5L8R C;  1C1B A;  1NHV A;  3TUZ C;  1VBX A;  3G87 A;  4F0M A;  3ISN D;  2P5V A;  2Z57 B;  3TUP A;  4IOA Q;  1FDD A;  3I0R A;  4TYA A;  4FBT A;  3KLI B;  1SQE A;  5KT2 A;  3JYT B;  3HJF A;  3GE9 A;  4RNN A;  3B6B A;  3I82 A;  3PYE A;  5C42 B;  1ZZN A;  1ZTW A;  3C6T A;  4WFX A;  2OAU A;  2KI2 A;  2LQB A;  3PFO A;  2C22 A;  1T3N A;  2ZJQ Q;  1JQG A;  2XSJ A;  2D3Z A;  4RW4 A;  4DV4 J;  1F60 B;  3H4D A;  2DGQ A;  3W2V B;  2FIU A;  3GFX A;  1XNR J;  1EAY C;  3RRK A;  3Q24 A;  3LP1 B;  2HQ3 A;  4BHQ A;  2QYC A;  1OIA A;  3EM1 A;  3M30 A;  3DI6 B;  3IWL A;  3M8W A;  1HNX J;  1OQ3 A;  4DCP B;  1HLW A;  4ZVF A;  1NCL A;  2AJ2 A;  2N7C A;  4NLT A;  2E29 A;  1IJE B;  1XR5 A;  1WI8 A;  1RAJ A;  3DGV A;  2ZOM A;  4JI8 F;  4URS A;  4OHY A;  4WP3 A;  3RB6 A;  2OP5 A;  4Y65 A;  1RT6 B;  1RHJ B;  3CED A;  3NWR A;  4PG5 A;  3K0J A;  2E7V A;  2CQ0 A;  5HAN A;  4DPY A;  4DSE A;  2V2Z A;  1VOM A;  3DRX A;  3JAM Y;  4GKK F;  5JVG Q;  2IFX A;  4IYQ A;  2COL A;  2AD9 A;  1V6H A;  4PPZ A;  4IFV B;  1F5B A;  4CO0 A;  1SL1 A;  3IRW P;  1YHQ S;  4YS2 A;  1FRL A;  4O3R A;  1SC1 B;  1ZTT A;  1MWQ A;  5JUM A;  4OYZ A;  3WC2 A;  2P9C A;  2OTL S;  3MTK A;  1CJV A;  1SV5 A;  3Q8S B;  2HHP A;  2BOA A;  3QAU A;  2H5I B;  1HQU B;  4DU7 A;  2XYG B;  2ZD1 B;  1FK9 B;  1L3S A;  1MW7 A;  5IS2 A;  1PJ6 A;  2GAG C;  3P4U B;  3WX8 A;  2YWF A;  1H7X A;  4DV1 J;  1RT4 A;  2BKN A;  4OYX A;  2NXU A;  1GH8 A;  2HNZ B;  2KRB A;  1S5Z A;  1HW8 A;  2YQ1 A;  4R8U A;  1VRQ C;  4M1K A;  1RA6 A;  1R8P A;  1NJI T;  4WYW A;  1ZPW X;  2V2K A;  1S0N A;  1WHY A;  2QL7 B;  2DGV A;  3OL7 A;  2M3D A;  2JC0 A;  1R0A A;  4M5I A;  1RT7 B;  1RB0 A;  2WVC A;  4M95 A;  2VFU A;  5DQG A;  2K1R B;  2UVW A;  1HBO A;  4HR2 A;  3IM8 A;  2E9R X;  4NZ6 A;  4IFY B;  1UFL A;  3M9N B;  4BWJ A;  3RJM B;  2FHM A;  3CXC R;  2YQ0 A;  3OUY B;  5LXR A;  2JHE A;  1S6Q A;  1VR6 A;  1DTQ B;  4OZJ A;  2EC2 A;  1NXI A;  3MUV P;  1M5V C;  3T6B A;  1N54 B;  2DNK A;  1JNR B;  2WON A;  1T94 A;  3VV2 B;  3CCV S;  1R0C B;  3FBC A;  4FZV A;  3W5Y A;  1JB0 C;  4FF3 A;  4F25 A;  1TL3 B;  3D0G E;  1NLK L;  3OTB A;  3IAM 9;  4O44 B;  2ALZ A;  3MCN A;  2UXC F;  5J1E A;  2D1C A;  4RNH A;  5AXL A;  4XPC A;  3IWN C;  2PC6 A;  3SMZ A;  1S1U A;  2FC8 A;  3AY0 A;  4PG6 A;  2PI4 A;  3T19 A;  4ETX A;  2B9W A;  1UJ4 A;  3HFK A;  1AZS A;  3IN5 A;  5T14 A;  1QUV A;  4RWX A;  2VDH A;  1RTZ A;  3OTE A;  3CMA S;  1XWL A;  3DOL A;  4YOE A;  1O6X A;  4WFZ A;  1F2G A;  2WHO A;  1ZOT A;  2BAN B;  3TZW A;  2CPI A;  3CC7 S;  3EGZ A;  3AT1 B;  3NL0 A;  1ULR A;  2LVW A;  2QJ3 A;  2XMM A;  4K8R A;  5HJY A;  2LA6 A;  4NEZ A;  4DN9 A;  2MLX A;  1IKW A;  3NNA A;  4F4A A;  5I3P A;  2MY7 A;  4ZN3 A;  4H4M A;  2WSF C;  2Y1R I;  4B3O B;  4AE5 A;  3HX9 A;  3HPO A;  1HBM A;  4TLR A;  3DYA A;  3M8Q A;  4NLW A;  5BR8 J;  3RUB L;  4IG3 B;  2VZ9 A;  4M5K A;  2EC0 A;  3A3N B;  3PY8 A;  4ZP8 A;  1PBU A;  1Q0N A;  1H2T Z;  1XR7 A;  1L3T A;  2YNH A;  2KZM A;  1N0V C;  2MDA A;  2VC1 A;  3FMB A;  3OL9 A;  3SV4 A;  3T9N A;  3RB4 A;  1FE4 A;  4RUC A;  3CIZ A;  3AOD A;  2DO0 A;  4FS2 A;  3M8Z A;  1DQ9 A;  4QR1 A;  1XQI A;  1LKZ A;  5K8N A;  4B3T F;  4DQP A;  2CKW A;  3QIP A;  3BGR B;  5F9N A;  4DI6 A;  4ZA1 A;  2NQP A;  2CQ4 A;  1RBA A;  4LMZ A;  4KYZ A;  2YH0 A;  3V4I B;  4ICL B;  1QVF R;  2DNZ A;  1JJH A;  3T5K A;  1RYS A;  2ATC B;  3AOB A;  4P10 A;  4DR4 J;  4PYA A;  3DLE B;  2ZH3 A;  3RGI A;  1YRX A;  2XG8 A;  3MMB A;  1WNE A;  2OGU A;  4IQX A;  1XEZ A;  1S0M A;  1KR4 A;  4B9V A;  5ETQ A;  1D1U A;  3HSZ A;  4LIW A;  2CYY A;  2UXD F;  2W2Q P;  3H2V E;  2ZWP A;  2OPQ A;  1KTQ A;  2GCF A;  1VJW A;  4ED8 A;  2E5J A;  3OXG A;  3WIV A;  2M8D B;  3MPV A;  4FXV A;  4OI0 A;  1QM9 A;  5IFM A;  2XMA A;  5EWG A;  3ZO7 A;  5DLF A;  4DL7 A;  4L75 A;  4USM A;  3Q22 A;  1F9E B;  1VCT A;  2M9K A;  3MUT P;  3MAA B;  3EZ5 A;  3GV8 B;  5LMN F;  1V5I B;  5EDW A;  2BQR A;  2ZJR Q;  5C24 B;  2FVC A;  3KLE B;  2EK1 A;  2LXU A;  4TYB A;  2IA0 A;  2H1Y A;  5C25 B;  5L9N A;  3K5P A;  5T7L A;  3RRH A;  5I3U B;  3NKY A;  2B51 A;  3ADA C;  5GAD U;  4NML A;  5IWA F;  5G4D A;  1TKX B;  1CJK A;  3DGP B;  3BN4 A;  3R5G A;  4M5H A;  3TRG A;  4I67 A;  1BY9 A;  5F8J A;  3OTC A;  1X5O A;  2HLU A;  2QLB B;  2IA6 A;  4TQS A;  2NRE A;  1FJG F;  3LTO A;  4ZN1 A;  3G4S S;  3V6J A;  1TKT B;  1HYS A;  2RDD A;  4RW7 A;  3R2C J;  1YIJ S;  4DR1 J;  5J2Q B;  3DNC A;  4DZ6 A;  2F7V A;  4K5S A;  1ZH5 A;  4JV1 A;  3NGS A;  1Y10 A;  4DR2 J;  1UVK A;  1YWX A;  5B0A A;  3SCJ E;  4QIG A;  4ZIV A;  4JI2 J;  2X1G A;  3MM5 B;  1BXN A;  2IM3 A;  2DBB A;  4RNF A;  4DSJ A;  3S01 A;  3NGR A;  5CYM A;  4USJ C;  1M1K T;  1HPZ B;  5KFP A;  3FGV A;  3V6K A;  3RBD A;  2YNG A;  3Q83 A;  2VAS A;  4RBU A;  5SUH A;  1ZET A;  4LVO P;  2ALY B;  2VG5 A;  3KJV B;  2GC8 A;  1DQA A;  3N28 A;  8RUC A;  3DRR A;  4DV7 F;  3KK2 A;  2DYA A;  3BDE A;  5LSL A;  3M32 B;  2IMW P;  1E6Y A;  3B78 A;  4LQ9 A;  3A1Y G;  2G0J A;  4ECS A;  2KFY A;  2V6A A;  3H5Y A;  5E5N A;  1VQM S;  1N88 A;  4QR0 A;  3POT B;  3IBF B;  1DLO B;  1WOP A;  3UVJ B;  2P8I A;  3K5L A;  5ETP A;  1NH8 A;  4HT7 A;  1AT1 B;  4KHR A;  2PFD A;  1KQG B;  4OX6 A;  4Y28 C;  5J2P B;  4ECT A;  2BV3 A;  1ZPV A;  1S59 A;  2P6T A;  2BE2 A;  4RU9 A;  2GHP A;  2MXY A;  3LO3 A;  4ZVP B;  3CJS A;  4DCJ B;  3SFG A;  4QIE A;  2XI2 A;  3W66 A;  1P6T A;  4WTY A;  1T3O A;  1XN9 A;  2CWK A;  3VWS A;  1N34 J;  3Q89 A;  1JLA B;  1G7C B;  1ICE B;  1FKP B;  1SJ4 P;  3CIM A;  4TU8 A;  3D1O A;  3P3D A;  2MGZ A;  1VC0 A;  2ZH1 A;  3KK3 B;  3M8Y A;  4CZC A;  4WE1 B;  4JV2 A;  5D0H A;  4M5N A;  4KH1 B;  2E44 A;  4PWD A;  3FSY A;  4XAK A;  3SBM A;  2ZH9 A;  1FFS B;  3SDE A;  4U96 A;  5A76 A;  1TTH B;  4ECZ A;  2GA7 A;  5A0Y B;  3HKZ D;  1H7W A;  1FHT A;  1WSV A;  2Z58 B;  2O3D A;  4DS4 A;  5F8M A;  3TVZ A;  3DM2 A;  2ZH8 A;  2CIM A;  1JKH B;  5KFV A;  1CLF A;  1RP5 A;  3J7Z T;  3DDI A;  1FNO A;  3SFU A;  2VOD A;  3VCD A;  4MTP A;  2J9C A;  4J9L A;  1T9X A;  2FJD B;  4X65 F;  1IJF B;  4ZVO B;  2LMI A;  5K8P A;  3PKM A;  4GKJ J;  1MU2 B;  2MY8 A;  1Q78 A;  1TV6 B;  3M2R B;  2JLF A;  3A13 A;  2WVF A;  1UVI A;  3KDO A;  3KOA A;  1MWY A;  3Q8Q B;  5J1P A;  2Y1J A;  2GO9 A;  3N9U C;  4LRA A;  3H0P A;  4PPD A;  5ETV A;  1KLM A;  2W24 A;  1TR0 A;  4WCE Q;  2F8H A;  1YLX A;  1Q5V A;  1T0T V;  3BQ2 A;  1DTT A;  2DK2 A;  2RU3 A;  3NS7 B;  2VON A;  2DY9 A;  1HQE A;  1K44 A;  3HHL A;  2FZC B;  2ZBR A;  3MUM P;  3FSI A;  3AHP A;  4LF7 F;  2HFS A;  1Q1K A;  1KBR A;  2OD4 A;  3MDF A;  3MUR P;  4P6Q A;  3E01 B;  4DFM A;  3CJ4 A;  3DLK A;  4RU2 A;  4IUF A;  5B0G A;  5KFR A;  4NCB A;  4RO0 A;  4O3P A;  2YKQ A;  4X66 F;  5JJB A;  2SXL A;  1N32 F;  3FZB A;  2LYV A;  1Y3K A;  4UQT A;  2C2M B;  2CA9 A;  2FB0 A;  3K8V A;  4CLT A;  1B7F A;  4OZ1 A;  1S1W B;  1YJV A;  3R2D J;  1IN0 A;  2HPU A;  2QL9 B;  3WBZ A;  3FEX B;  2HUR A;  2AYM A;  2OMO A;  2VD3 A;  2EG1 A;  2VQF J;  3KUE A;  3M7V A;  1VC5 A;  3VVT A;  4NLG A;  5KFC A;  2ZDO A;  5F0U A;  1ZZF A;  1TU0 B;  3W65 A;  4OYA A;  2XLI A;  2ZVS A;  3N4W A;  4P9S A;  2Z0G A;  3WDO A;  4NLP A;  2L9D A;  2UUC F;  5IC4 B;  3MFH A;  3QLH A;  1UZD A;  3P8B B;  5D8H B;  5CD4 A;  1EHW A;  2BJ3 A;  4KGM A;  2W01 A;  2WOM A;  3M2U A;  1TK5 A;  3DC2 A;  4X84 A;  2QA1 A;  4LF6 J;  1WC3 A;  2F9J A;  4QCL A;  2VB6 A;  3PYD A;  3BB5 A;  1LOU A;  3U1L A;  1JWW A;  3TJ9 A;  1UFW A;  2OPP B;  3KJQ B;  3OXL A;  4FVM A;  1UVM A;  1YK9 A;  2R7T A;  1S99 A;  4G65 A;  3MEG B;  2DHG A;  1HQ2 A;  4MKV A;  2CJQ A;  2F9D A;  1RTI B;  1VHF A;  3CUL A;  3EGW B;  5AJ3 F;  5HMY A;  2EVZ A;  1B64 A;  2C3P A;  5H9E K;  4RLE A;  1NHU A;  3M8R A;  3P6Y C;  3H5U A;  4QWE A;  2BW7 A;  1H38 A;  4LBI A;  1EET B;  2UU9 F;  1HWK A;  4DV5 F;  3PIP Q;  2ZNY A;  4F3M A;  3U1N A;  1Q4R A;  3NCP A;  3R97 A;  1EX8 A;  1S0V A;  1G6B A;  3MR6 A;  2MHE A;  4DPW A;  4ZVG A;  2MQN A;  7FDR A;  1T05 A;  3MWB A;  2RUS A;  1FCA A;  3A8J A;  4NI2 B;  3DXB A;  4F4K A;  2KRR A;  2ZE2 A;  4OJH A;  4IDK B;  4I68 A;  4B3M F;  2E9T A;  1UW4 A;  3AXK A;  5ETO A;  3MM8 A;  3A8E A;  1RDR A;  5LSO A;  1GTE A;  4J9K A;  5LSR A;  2DD8 S;  4CLU A;  2V8D A;  5THW A;  1FWP A;  3K5N A;  4DQQ A;  3NMA A;  5EN1 A;  3CD0 A;  1U48 A;  1QAY A;  5CCL A;  1XIQ A;  1IBK F;  4CM2 A;  1IKY A;  3QRP A;  5A6P A;  2PGC A;  3IXQ A;  2DIS A;  4U9R A;  5HAT A;  4DLG A;  2J76 E;  3CMQ A;  4JI6 J;  4ZK7 M;  2DJW A;  2L3M A;  4ZKA A;  1S1X A;  3BBC A;  4QQB A;  3M6V A;  1U26 A;  1KQF B;  2XQC A;  1WKL A;  3CC4 S;  3IR5 B;  4USV A;  2CZ9 A;  1CQN A;  2CZ4 A;  4X64 J;  1UA0 A;  2GHW A;  1YRT A;  1VRU A;  4KE5 A;  3O3L A;  2XSJ B;  1U8W A;  3DDN A;  4RW4 B;  5BYR A;  2F4V F;  1E6V A;  1RHU B;  4YDX A;  3MCO A;  1XTZ A;  4LRE A;  1RWO B;  4P71 A;  2CAD A;  1Q95 G;  2K3K A;  3M30 B;  2EEY A;  1FDB A;  2R7Q A;  4Q7A A;  3PX6 A;  4JI0 F;  3UNY A;  4XPE A;  5IQQ A;  2DCL A;  2JH3 A;  4F26 A;  3VAG A;  4KGX B;  4LF4 F;  1HNV B;  3X3U A;  3CVK A;  3ISN C;  2XC9 A;  1YKW A;  2D74 B;  1RWK B;  4ATN A;  2VHG A;  1KVI A;  2KVQ E;  2ZJP Q;  1Q82 T;  1X5P A;  2XZW A;  2DR8 A;  4DV6 J;  2XS7 A;  2PSZ A;  4ECY A;  1KC8 T;  1KS2 A;  1Y4Z B;  3L95 X;  3QZ8 A;  3BF4 A;  2LCW A;  1YBA A;  4G1P A;  3ENQ A;  2LXI A;  4UST A;  2FJB B;  2GJI A;  3JSM A;  1T9Y A;  1SXL A;  1BQN B;  2R3V A;  5CYJ A;  2ZH6 A;  4LIR A;  1LFP A;  4Q8F A;  4I2P B;  3G86 A;  3DHX A;  2PMZ D;  4URQ U;  1FT8 A;  3H8Y A;  1G1X A;  1RT2 B;  1MML A;  3PJX A;  4DEZ A;  1VK8 A;  5KFA A;  5F8I A;  2NZC A;  3KG1 A;  4YME A;  4URG A;  1YJU A;  2VPW B;  4DOZ A;  2CWX A;  2R2R A;  5AE2 A;  1LFW A;  3K89 A;  4I4B A;  2V0N A;  3QO9 A;  3HHK A;  4MK8 A;  2EFV A;  1QSY A;  2BQU A;  3LGM A;  1FRM A;  4R8U B;  4ZCK A;  5GMD A;  1IWA A;  1AFI A;  3AD8 C;  1H74 A;  2Y8W A;  1RT5 A;  1TKZ B;  1BHN A;  1XMQ J;  3OQ2 A;  3OLB A;  3OJU A;  4LSN B;  3HZE A;  2R8I A;  2V63 A;  5KFS A;  3Q2S C;  1R0A B;  1NB2 A;  3W5X A;  5AXM A;  2H65 B;  3EVM A;  5F3Z A;  2ZHB A;  1RKI A;  2LQ5 A;  2B9Y A;  2ZHO A;  5KFE A;  3HHD A;  2JEI A;  2NR0 A;  3L7P A;  1WDT A;  1XJW B;  3C14 A;  1F2H A;  1F1B B;  2Z30 B;  1EIY B;  3LAM A;  2NCK L;  2UVR A;  3NCQ A;  2CJX B;  4LF5 F;  2YH1 A;  1P1L A;  2NXJ A;  3ILL A;  3DMJ A;  5ETM A;  1X31 C;  2WON B;  3W62 A;  2E5H A;  2J7W A;  4WU3 A;  1CJU A;  3JAM U;  5F3T A;  3HFZ B;  4KT0 C;  3GYG A;  4CLS A;  3BR9 A;  1DUR A;  4PWU A;  5HRO A;  3S8S A;  3DRP B;  1YJ7 A;  4ZPD A;  3BKF A;  1VQ9 S;  3OFH A;  4I1T A;  3SSR A;  1WG1 A;  2OEK A;  1BC6 A;  4CO3 A;  2HVE A;  4X62 F;  2HWT A;  3QGP A;  1N6Q B;  2DR7 A;  4PXE A;  3R5J B;  4Y00 A;  2J7K A;  3CF5 Q;  3FDS A;  4C11 A;  1BQX A;  4P7T A;  3D6F B;  4JI4 F;  2E66 A;  4WIQ A;  2BW2 A;  4Y0F A;  3SYZ A;  1A9N B;  3LH2 S;  4H54 A;  2ASY A;  1Y7P A;  1FDA A;  2LFV A;  4BC9 A;  4UUW A;  1T8E A;  3GIL A;  1H98 A;  2CJK A;  4X4Q A;  4NYO A;  1V5V A;  2L41 A;  2CVE A;  4J37 A;  2RIL A;  2U1A A;  4YEA A;  3G71 S;  1FD2 A;  3OR2 B;  5C2C A;  3FJ2 A;  3VGT A;  4RL1 A;  1NRK A;  1AB8 A;  4F50 A;  1WF2 A;  1RT3 B;  3RBX A;  1D8Y A;  4Y3C A;  2GQ2 A;  3I0S A;  3PFE A;  4MIW A;  3OSN A;  1RXO B;  3IBW A;  2VBW A;  4USW A;  2B9X A;  2APO A;  3FVY A;  1D3W A;  1FKO B;  3EYZ A;  3PVX A;  1D8Z A;  4DS5 A;  1REV A;  2ZC4 A;  5GAH U;  2XMJ A;  2ERR A;  4NXN J;  2OPR A;  2ROG A;  2E1R A;  4A46 A;  4AXJ A;  3KHH A;  2GQC A;  4J9S A;  4A8Y A;  3JYT A;  3FEY B;  4UW2 A;  4HVZ A;  4YB7 A;  2MQO A;  5DZ6 A;  3OVB A;  3PRD A;  2V8G A;  2FHJ D;  2FHK A;  3PHE A;  2V8V A;  1VRT B;  1UVN A;  1N33 J;  1H0H B;  2KVI A;  5IV4 A;  1DHM A;  2FTR A;  5A8K B;  3TUI C;  5E33 A;  1OY8 A;  3QJJ A;  3W2V A;  1GMV A;  4B3R F;  2KKH A;  1WEL A;  2XYH B;  5BJR A;  1WC5 A;  3ZTS A;  1R0B G;  3V4M A;  1H73 A;  3LP1 A;  4KHP F;  5D4O A;  4DX5 A;  2DTJ A;  4CLF A;  2DEJ A;  4B3S F;  3DI6 A;  2HYI B;  1I94 J;  1GMU A;  2JWN A;  4MH8 A;  4O4G B;  2CPH A;  3NEK A;  4NXM J;  2A6M A;  2U2F A;  3MR7 A;  2YKN A;  4Y2C A;  4Q2M A;  4DL3 A;  1Q16 B;  4FS1 A;  2ACM A;  3IBC B;  2KYX A;  1TK8 A;  1RT6 A;  3I31 A;  2ZZM A;  3K7R A;  4DPT A;  2IC3 B;  1RQ0 A;  3UWT A;  4K4Y A;  4P2S A;  4V1A k;  3RB0 A;  4PWW A;  3WZ0 A;  2ZNZ A;  3UNG C;  1LWX A;  5AXK A;  3D6T B;  4B08 A;  1RAB B;  2AX1 A;  4IFV A;  4DV3 F;  1C1C A;  2JFK A;  4CIO A;  2DNR A;  2IIH A;  2PEB A;  4ZVU B;  1RYR A;  2AMC B;  2Z2Z A;  5H9E J;  4KRW A;  1IWG A;  3JXO A;  4E98 A;  2A1B A;  2OLW A;  1LXN A;  4CDI A;  2HS3 A;  5G0R B;  2QTW A;  2ZD1 A;  1FK9 A;  2LKZ A;  4E2F B;  4HHH A;  3C16 B;  3DU5 A;  1HI0 P;  1SQF A;  3A8I A;  2HND B;  2YWK A;  1TAU A;  3BZQ A;  2VU5 A;  4N56 A;  2XZT B;  2XNQ A;  2VPY B;  4B02 A;  2VFS A;  5ETT A;  3T1A A;  2JVR A;  3H2U B;  4OZL A;  1KOH A;  4NRU A;  3VAM A;  3R8Y A;  3FFI B;  6FD1 A;  3IAS 9;  5I4M A;  3OR1 B;  3WIU A;  2HNY A;  1NDK A;  3KNA A;  4KGK A;  5F8H A;  3CW2 C;  4WP8 A;  5FLX Y;  1HI1 A;  3MPU B;  4LBP A;  1X4H A;  2EFP A;  2XHW A;  3H40 A;  4ZJO A;  3UW1 A;  2VG5 B;  5LJ3 Y;  1RT7 A;  2A10 A;  3KUH A;  1WC4 A;  3VZI A;  2IPO B;  2HFU A;  1HW9 A;  2FGC A;  4TU7 A;  3Q2T C;  4DDF A;  2BDP A;  3AA9 A;  3Q8R B;  2VQE J;  1RK8 A;  4IH6 A;  4ER8 A;  2GIF A;  2HQF A;  1KQS R;  2W9B B;  5CAA A;  1E6Y B;  3RR8 A;  4WK1 A;  3OUY A;  4QWC A;  1R8A A;  1CC7 A;  1T02 A;  2J9D A;  1DTQ A;  3MM9 B;  3GB0 A;  3NY0 A;  1OSC A;  3N6L A;  2DGS A;  4EYH B;  4RBV A;  3H5S A;  2YX7 A;  3T1H F;  2CQP A;  4WXO A;  5J2N B;  4K59 A;  4JYA F;  4ILR A;  3CB4 A;  1KTV A;  4IKA A;  1F6T A;  2QMU B;  3O6Q A;  1TL3 A;  1KLN A;  4QW9 A;  5HI7 A;  2VOP A;  4E0D A;  1FRH A;  1F5C A;  2DNP A;  4A47 A;  2OIH A;  4HI1 A;  3N5B A;  3PO5 A;  1KNZ A;  2DGW A;  3RW6 A;  2D3O R;  5L1I A;  4KHM A;  2Y1I A;  3DCA A;  5E3Q A;  4A4J A;  3BQ1 A;  4QZV B;  4QR2 A;  3DDK A;  1RU1 A;  2RS2 A;  5HAO A;  2MGZ B;  3R1L A;  1RTH A;  2BAN A;  3ZNU A;  1Y3J A;  4OJ1 A;  4LFB J;  3I5A A;  4CTA A;  2VFV A;  1SC3 B;  4ZVE A;  5EWE A;  2MQ8 A;  2CPD A;  2GVZ B;  3TA0 A;  1MLA A;  1T7P A;  2E1M C;  4X4O A;  5IV3 A;  2MKI A;  4B3O A;  4USK A;  3X1L B;  4PXD A;  2BJ8 A;  4IG3 A;  1SPB P;  4F8R A;  1RTJ B;  1A0O B;  1HA1 A;  3FBF A;  4IG0 B;  2VF3 A;  4WKR A;  2KDO A;  3L7U A;  2QIF A;  2C3O A;  1VLY A;  1WHX A;  4ES1 A;  5A2Q Y;  2UUB F;  4KR0 B;  3ETO A;  3D66 A;  3IG1 A;  2CNN B;  4FNH A;  4KSE B;  2AJ4 A;  1T9V A;  1CVJ A;  3KUG A;  3CCT A;  3BGU A;  2QV6 A;  3G9C A;  1IQZ A;  3ZTP A;  2O67 A;  2LLZ A;  2RH3 A;  3BGR A;  1L5U A;  4U6P A;  1YBU A;  3W2W B;  3TQE A;  1KLM B;  3V4I A;  2K7K A;  4ICL A;  4X4P A;  3P5B P;  1JLE B;  1SIZ A;  2FJE B;  2NLW A;  4ZVQ B;  3DLE A;  4EK2 A;  3ONQ A;  5DQI A;  4A8W A;  4LF9 F;  5K14 A;  2H48 B;  1RGV A;  3PX0 A;  2VPZ B;  3NGU A;  5J1N A;  1SUQ A;  1SCJ B;  2FYX A;  4OI1 A;  1NZ8 A;  1NK9 A;  3CCS S;  2EFG A;  4EEY A;  4JI3 J;  3GFY A;  2ZM6 F;  2BOP A;  1Z1Z A;  3NOC A;  5L1J A;  1VQS A;  1TFY A;  3G6V A;  4A8S A;  3T1Y J;  1PJ5 A;  4N77 A;  1WG4 A;  3MAA A;  4LQ3 A;  3MPD A;  2EG2 A;  3H90 A;  4OZ0 A;  4DR5 F;  1X9S A;  5C24 A;  1U2F A;  2HIY A;  1WKJ A;  1I5O B;  3K8W A;  1YZ6 A;  3RW7 A;  4HAC A;  2WBR A;  1C0T B;  1REG X;  1X0P A;  1PGZ A;  1IM4 A;  2HG4 A;  3D2W A;  4P2F A;  3MMJ A;  2FQQ B;  2P2C B;  4WFA Q;  3D3C J;  1RE1 B;  1TKX A;  2Z4P A;  3D28 A;  3DGP A;  4K7Q A;  2Q3P A;  3ZZU A;  1YDL A;  1U47 A;  2C2Z B;  2X1B A;  1HNZ J;  4MMO A;  1VQ8 S;  2JEJ A;  4CCH A;  3CJR A;  5HJX A;  4DPX A;  1VQ5 S;  3PYG A;  2EK6 A;  2YNF B;  2H9Z A;  5F8G A;  3ET6 A;  2C1E B;  2NZ4 A;  1N36 F;  4NPO A;  2HGM A;  2J0Q D;  2DHX A;  4EFA C;  5RUB A;  2WOM B;  3IS9 A;  3MEE B;  3CDA A;  5KT6 A;  1RHM B;  1QUP A;  1SJQ A;  4DX8 H;  2M8H A;  5EHH A;  1J5E J;  4AFF A;  4U7C A;  5DLG A;  3DOK A;  4J9V A;  4FXD A;  3QPI A;  2OI2 A;  4LRF A;  3UDL A;  1UEV A;  4CH0 S;  4DJB A;  1APS A;  3HSJ A;  1EP4 A;  4J9O A;  7FD1 A;  1HPZ A;  4HTJ A;  5HP1 A;  3AB4 B;  1F3V A;  1YZ7 A;  1U4B A;  4C8O A;  1GMW D;  3D5M A;  3OV7 A;  3TX0 A;  1S9E A;  1QE1 B;  3UR3 C;  1IUJ A;  2XS2 A;  1HNI A;  3UD5 A;  3TAM A;  2MZS A;  4FXW A;  3FCV A;  1FEE A;  3EVW A;  2FUG 9;  5E3C A;  1EZZ B;  4PRF A;  5HVG A;  2RRA A;  2WSC C;  3GZ7 A;  2BMB A;  3M32 A;  5F8N A;  2HHX A;  2EXU A;  3PEH A;  2G4B A;  2ZH7 A;  2E1C A;  2FLO A;  2B6A A;  1DLO A;  1C0U A;  4UOF A;  2G1H A;  2B8Q A;  4DV0 F;  2HW3 A;  3HVA A;  3KHL A;  2B5J A;  5J2P A;  2ZVI A;  3W5Z A;  4DQS A;  3MXH P;  3EIC A;  4LR7 A;  1ZM2 A;  4KO0 B;  1B3T A;  4DR6 J;  1F9H A;  4NX9 A;  2PEH A;  3R1H A;  4MKB A;  2W7O A;  2DVI A;  3CO9 A;  3EZU A;  3KHR A;  2CQH A;  4NRT A;  4RNO A;  5KFM A;  3CCU S;  3NXZ A;  1LW0 B;  3I9V 9;  1X4C A;  5KFY A;  2G2Z A;  5KT5 A;  3KK3 A;  4IRD A;  3CD6 S;  1RBL A;  2CFX A;  4WE1 A;  2XWY A;  2KTQ A;  2HFV A;  4C8N A;  2I9S A;  1X4B A;  4K4Z A;  3Q8Y A;  1S1T B;  2NYI A;  1GT8 A;  2R8J A;  1A7G E;  5A0Y A;  3RZA A;  2QEX S;  3TAN A;  1PAU B;  1KSP A;  1X4A A;  1JKH A;  2GX8 A;  4ZLN A;  1WJ9 A;  3ILI A;  4ZLJ A;  4K0K F;  3EVO A;  1YG0 A;  4CYU B;  1Y5N B;  1ZBT A;  2DR9 A;  4J9M A;  3M2V B;  3EPI A;  4NZ0 A;  3BRE A;  1MU2 A;  3O8W A;  4UZC A;  1JLG B;  2JVO A;  1TV6 A;  3VAF A;  3M2R A;  4JI5 J;  3GCW P;  5KFN A;  5DZ7 A;  3OT9 A;  2QN6 B;  3OL8 A;  1HNW J;  4EBC A;  1H6K X;  1J2V A;  4NLD A;  1U02 A;  3NP5 A;  1P1T A;  5GAE I;  4L3K A;  2XCP A;  4ZS6 A;  1P8G A;  2N3O A;  4CH7 A;  1J27 A;  2GFF A;  3BO3 A;  1YJR A;  3B54 A;  5H9F K;  2HQD A;  2MKY A;  4NMX A;  8ATC B;  3JQJ A;  1TL7 A;  4N8N A;  4CO1 A;  3CCQ S;  1NPP A;  2VBX A;  1UVL A;  1UP1 A;  2MHN A;  3UCZ P;  2MSS A;  2M4M A;  1V3S A;  4I7F B;  2UUA J;  4X4T A;  3MI7 X;  4EGL A;  2VOO A;  1K1Q A;  2EKY A;  3E01 A;  1N5T A;  4EBE A;  3J80 U;  1SIW B;  4ZIW A;  5D0E A;  3D67 A;  4LBH A;  3T5H A;  1KP6 A;  4UT4 A;  2DO4 A;  2DCU B;  4A8X A;  2PMW A;  2FJW A;  2RT3 A;  3NBP B;  4NE9 C;  4FBU A;  1KON A;  4ZPA A;  3OFF A;  3OD2 A;  1WEZ A;  4UOH A;  1LWC B;  3J81 j;  1NDL A;  2I8E A;  3PM9 A;  3PZP A;  1R8H A;  3T6J A;  5HQ8 A;  2DHH A;  4C48 A;  1XNQ F;  2XO7 A;  1S1W A;  1RT5 B;  1WAC A;  3DOM A;  5KFU A;  4QIF A;  3I6P A;  5KFQ A;  1X4G A;  3GG0 A;  4E8U A;  2NUH A;  5KFB A;  4OI2 A;  2VJV A;  4CO2 A;  1LEO A;  1N5Y A;  3KK1 B;  1WI6 A;  4DG1 A;  2BJD A;  2DNQ A;  3Q8V A;  1M5K C;  1IBL F;  1NSA A;  3NRB A;  3M8S A;  4LRD A;  3QZ7 A;  2FJA B;  3R27 A;  1U2C A;  5ETL A;  2D9P A;  2XMT A;  2ZH4 A;  2F8E X;  2FVP A;  3KJN B;  3BGO P;  2AEJ A;  3CTR A;  4X4U A;  4V19 J;  2AEF A;  4C0O C;  1MMD A;  4NA2 A;  3J7Y I;  2W9A A;  1CJU B;  1YGY A;  3RBZ A;  4HDH A;  4PUO B;  4P73 A;  2RJZ A;  3D6H B;  1RWW B;  4C4W A;  2JJ4 D;  2CNK B;  2OPP A;  2HGN A;  3GP9 A;  3CO0 P;  2I6W A;  1U1N A;  2DRB A;  2KZZ A;  5L46 A;  4LR9 A;  4RWW A;  3MEG A;  4DL0 C;  4MYT A;  4J9Q A;  4ELU A;  1RTI A;  4ZP7 A;  2HK2 A;  2P6S A;  3VVU A;  4YY3 F;  1KKH A;  5E0O A;  2WBM A;  3BBB A;  3H20 A;  4TNO A;  3LGH A;  5KG1 A;  3UN2 A;  4ID5 A;  3H98 A;  4L76 A;  5HQL A;  3R3T A;  2KHD A;  4K50 A;  3DRY A;  1RHQ B;  4Y2A A;  2BJ9 A;  1VS3 A;  1FF2 A;  3RBE A;  1Q8I A;  1S57 A;  2W7A A;  5IOL A;  1W7W A;  1GK8 A;  4JV5 F;  4P7V A;  4YHH J;  5CZV A;  4OI6 A;  1S7H A;  3IRX B;  4P72 A;  3KNG A;  4GC7 A;  3JSB A;  2CPF A;  3E8O A;  3TA2 A;  4YUD A;  2HHW A;  4L6V 3;  4IDK A;  4XIU A;  4DL6 A;  4B9T A;  1RU2 A;  4OX9 F;  2W25 A;  9RUB A;  2V9W A;  4ZP6 A;  3TAQ A;  2DXD A;  1NSP A;  2OEL A;  3Q8P B;  2WRM A;  2QLF B;  5HVH A;  1T9T A;  3QSY B;  1PBA A;  4A8F A;  2BEF A;  3MED B;  2F40 A;  2W2P P;  3QWP A;  2YNI A;  3D3B J;  2IJR A;  4C0B A;  2IJF A;  1REV B;  5KFX A;  2NPI A;  2ASJ A;  5HBM B;  2OPR B;  4Z37 A;  2H4Y B;  1EB0 A;  4M5D B;  4OZ3 A;  2KHC A;  1UAW A;  1G2E A;  3GPA A;  4PXC A;  1HL6 A;  2VKR A;  3JSY A;  2GS8 A;  1DBD A;  1S7I A;  1ZAW A;  3ELH A;  3FMW A;  2KXN B;  3DRS A;  1S6P B;  3F44 A;  2X51 A;  5L1L A;  2I0X A;  1I6J A;  1CQM A;  4TU9 A;  1AYE A;  4QU6 A;  1D0E A;  4A8Q A;  3TJA A;  5E3A A;  3CSK A;  1C4A A;  1FJ7 A;  2FZK B;  3QT5 A;  3M6U A;  3HDS A;  5DG8 A;  5DRK A;  4YFU A;  1PJ7 A;  3SQO P;  2YKN B;  2MKS A;  5KT3 A;  2B0G A;  1HNV A;  3KMS A;  3RYL A;  3E2E A;  3MFI A;  3T3F A;  2NYH A;  2MQM A;  5M2P A;  1UW9 A;  2LDI A;  2BAB A;  1T03 B;  3LUY A;  4FPR A;  4NLQ A;  4CP5 A;  2KJV A;  4ELV A;  2ABY A;  2L9N A;  1C1C B;  3LWL A;  4J5O A;  4ECW A;  3JS9 A;  1RAD B;  4ZPW R;  5DG9 A;  1BQN A;  1K47 A;  5DDO C;  2BVZ A;  1ZYQ A;  3D0H E;  4DUZ J;  4I2P A;  3UQS A;  2V8H A;  1ZM3 A;  3T5J A;  2OPS B;  1RT2 A;  5L1K A;  2NSB A;  3DHW C;  2FLL A;  3IP0 A;  1MRO A;  3GJR B;  4NL5 A;  1CSJ A;  2CQI A;  2E1A A;  4USH A;  2WVE A;  2VIH A;  5HLF B;  4ZVS B;  4ZP9 A;  2KH9 A;  2MZ1 A;  4NLX A;  1IBM F;  1NSQ A;  1GXL A;  2QE5 A;  1LW2 B;  4ED6 A;  2HNY B;  1DAR A;  4WYL A;  2HHH J;  2W2O P;  4OYM A;  4FF1 A;  1TKZ A;  2BE9 B;  4IO1 A;  1QJH A;  1Q8L A;  4LSN A;  2NXN A;  1RKJ A;  3ZZ0 A;  5AXN A;  3CCJ S;  1Q79 A;  4ECX A;  4NZ7 A;  5GVQ A;  2D7S A;  3F41 A;  4DR3 J;  3VAH A;  2ZH2 A;  3V5R A;  2CQ2 A;  1NK5 A;  2ZH5 A;  5BYQ A;  3CGI A;  3BYR A;  3G82 B;  4BBY A;  3BH7 B;  1UJ5 A;  1VDH A;  1GQE A;  1B99 A;  4WBF A;  5B0F A;  3TNV A;  4EU0 A;  2OH2 A;  5HSP A;  4WTO B;  4ZHR B;  1FVS A;  4X2B A;  2HAI A;  4KQZ A;  2QFI A;  1W25 A;  2Z8Q A;  2WB4 A;  3H25 A;  5A6W A;  2QFJ A;  3HJV A;  2J0S D;  2HHV A;  1WKK A;  4UOG A;  2QMX A;  3IGV A;  4LFA F;  4AD6 A;  3QSI A;  3AD7 C;  3MM6 B;  2ACY A;  1M1G A;  3UI3 A;  3MR2 A;  3K58 A;  2GIQ A;  1HR0 J;  3DRP A;  4ZVT B;  4ID8 A;  1D9F A;  2ZZT A;  2DIV A;  2W8K A;  2L9W A;  2MJU A;  3BSC A;  1LK7 A;  3DXS X;  2MQL A;  4YN3 B;  1Q86 T;  3QRQ A;  2QA4 S;  3GFZ A;  1NPR A;  1N6Q A;  5LMU J;  5CAB A;  5GMK a;  1SH2 A;  5ITH A;  2FLP A;  1R6Y A;  5KAK A;  3WHI A;  5LL6 d;  1RTH B;  4CWB A;  4CTA B;  3R5B A;  1FVQ A;  2IBK A;  4IR1 A;  2CDR B;  4F4Z A;  2E5L F;  3QGI A;  3TUJ C;  3JSR A;  3AOC A;  2NXE A;  2IM2 A;  3MEK A;  2JFD A;  5M2U A;  5H9F J;  2CQG A;  5KFK A;  1WF0 A;  2MTL A;  3HUL A;  2B43 A;  2MYF A;  2HQG A;  5EX0 A;  5FLX U;  2OKQ A;  3OR2 A;  1OY6 A;  2LA4 A;  4AQY J;  1YBT A;  2JZ5 A;  2A3J A;  2UP1 A;  1YRU A;  3AXM A;  1RT3 A;  4L3N A;  1GEH A;  3WQP A;  1HWI A;  1NND A;  5ETN A;  1KFS A;  4Q2L A;  3LA0 A;  2DIU A;  1XMO J;  4CH1 A;  1KVK A;  1S49 A;  2CPZ A;  3IG1 B;  1JIH A;  5E7O B;  4ZJQ A;  1FKO A;  4DV4 F;  2R7X A;  4CT8 A;  3ZXW A;  1NKE A;  2F3J A;  1XNR F;  1YI2 S;  1X4F A;  1IBC B;  2IVM A;  4PQU B;  2E5G A;  2YKM B;  3BSO A;  3OTO J;  2WB1 D;  1HNX F;  3GLJ A;  2EW9 A;  5GAG I;  3DFE A;  2UXB J;  5BYS A;  1SC4 B;  4UY8 5;  1N5S A;  1T95 A;  2F8M A;  3U1M A;  4EBD A;  1VRT A;  3GFH A;  5K14 B;  4P2M A;  1SUQ B;  1S10 A;  5A8K A;  2ZOF A;  3MR3 A;  2Z56 B;  2MKH A;  2BE7 D;  1YQH A;  3GIR A;  2MEW A;  1NHK L;  3T9Z A;  3ILO A;  1UWB B;  4MT1 A;  3HD2 A;  1WOS A;  4O4G A;  3PW2 A;  2BRL A;  4AT1 B;  1S6O A;  5DQH A;  3PRV A;  3C19 A;  3ISZ A;  4G1I A;  2EFO A;  4MK9 A;  4HAC B;  1U1M A;  3QFH A;  1RA7 A;  3BYP A;  2XTJ P;  3HK2 A;  3H42 A;  5H1S V;  2IC3 A;  2CAJ A;  3NGK A;  1UWA A;  1YVF A;  1M5O C;  4JI1 J;  4NOH A;  1VC6 A;  1RAF B;  4NLY A;  1SJ3 P;  4USU A;  2LQJ A;  4JI7 J;  2W4D A;  4IO9 Q;  4F0K A;  2X1A A;  2GVD B;  2GMH A;  4Z7C A;  1QSL A;  4Q0B A;  1S4E A;  4C8K A;  3GV5 B;  1O5J A;  2M5Y A;  1VIO A;  1ZM9 A;  5ETR A;  4DV1 F;  5A8R B;  1J5O B;  5KFL A;  2VG6 B;  5KG0 A;  4DUY J;  4B9S A;  1D09 B;  3ET6 B;  4NAS A;  1FRK A;  3N6N A;  1MG7 A;  3TEH B;  3VQS A;  5D4N A;  3IS9 B;  5G0R A;  2GGP B;  4WWS A;  4ECV A;  3C16 A;  2LEB A;  1W2I A;  2XSF A;  1LWF A;  3DOK B;  3EZO A;  2HND A;  3B82 A;  2MKJ A;  2KG1 A;  1Q81 T;  4DR7 J;  4BCA A;  2CQC A;  3OBI A;  4ZPT R;  2G9O A;  1IR1 A;  3FQL A;  4O3O A;  4H4O B;  1U24 A;  2MZQ A;  2X1F A;  3GR1 A;  1EP4 B;  3FFI A;  5IQ6 A;  4OMF G;  3OR1 A;  4NLS A;  2VL1 A;  3QID A;  5HP1 B;  5B0C A;  3I87 A;  1Q53 A;  2XEX A;  1U0H A;  3IO1 A;  3ZTO A;  1M5S A;  2CJA A;  1OJ4 A;  4LFC J;  2VDI A;  3QGG A;  4K4U A;  1S9E B;  4LF8 J;  1YSJ A;  1A6L A;  1HNI B;  2BJE A;  3TAM B;  3HHL D;  4NA1 A;  1RZM A;  2UV8 A;  3KHG A;  4P75 A;  3H59 A;  2GMJ A;  1UTA A;  3ITH B;  1S1V A;  3BGL A;  4TY9 A;  3MPY A;  4Y2K A;  1MN9 A;  2W9B A;  2QL5 B;  4MFB A;  4XTT A;  2W2M P;  3D0I E;  9ATC B;  4GC6 A;  2FD2 A;  4IRC A;  3MM9 A;  3G8Q A;  1EJ7 L;  2B6A B;  5IM0 B;  1ZAX A;  2DH7 A;  2BBE A;  1NU4 A;  1C0U B;  5CD4 H;  3V81 B;  3M1V B;  3VR1 A;  1RIS A;  4LUB A;  4M8L A;  4DFK A;  3RTV A;  4NA3 A;  5J2N A;  5GME A;  4UF4 A;  1Q8B A;  2B5J B;  2DPJ A;  1C4C A;  3SEO A;  2GHV C;  1IR0 A;  2DEI A;  2LEP A;  1XC9 A;  2DY1 A;  3A8K A;  1S77 D;  1GFW B;  2WW8 A;  2W9C B;  2R8K A;  1X4E A;  1KRP A;  2CQ3 A;  1RAO A;  4WZM A;  3OHA A;  3G6Y A;  2J6U A;  2MB0 B;  4FKX A;  3W9I A;  1OPZ A;  3QFW A;  2H54 B;  4R25 A;  1X8D A;  5F0W A;  5BR8 F;  4JV0 A;  1MWZ A;  1JNZ B;  1VK3 A;  2IMO A;  3DLG B;  1KVJ A;  1N5V A;  3ZZY A;  1T9W A;  4PEO A;  3PV8 A;  3KXD A;  2GVZ A;  1VYA A;  2ZBI A;  4NCG B;  4K4X A;  5D3G B;  4OZ2 A;  1S76 D;  2OSQ A;  3EXC X;  1O8B A;  2QG9 B;  1EKR A;  2Q6C A;  3H5X A;  2HMI B;  3AA8 A;  3NOG A;  4JI8 J;  2HHQ A;  2LEC A;  1WF1 A;  1RTJ A;  2ILZ A;  4IG0 A;  3MEC B;  2FY8 A;  3VAJ A;  4RW6 B;  2JNJ A;  5KOW A;  1S9F A;  4DR4 F;  3TYT A;  2PI5 A;  4GKK J;  2HHT A;  5B0B A;  3MZI A;  2KT2 A;  2FY1 A;  5CZX A;  1N48 A;  5KG6 A;  3AFG A;  2O01 C;  2PA3 A;  3PXG a;  4EMD A;  4KAI A;  1G3O A;  1TUV A;  3EGV A;  1HAR A;  2QT7 A;  4CQ1 A;  4ILM A;  2OTJ S;  1F0X A;  1IKX B;  1HBU A;  4ZLL A;  3NGT A;  2KXF A;  3W2W A;  3PG9 A;  3CCM S;  2ZUA A;  3J7Y U;  3ENA A;  1JLE A;  5L39 A;  1K8A T;  5KTQ A;  2YQ3 A;  3W8P A;  3W63 A;  2WTF A;  4G6V B;  2J0X A;  4U8Y A;  2K2P A;  1TL7 B;  2ROP A;  4ED5 A;  1ELO A;  2BX6 A;  3PEJ A;  2AIR B;  4W92 B;  4J9P A;  2WSE C;  3RG6 A;  1NME B;  2MZT A;  2QMW A;  3CJ5 A;  2XHC A;  1NPK A;  5K20 B;  3PTW A;  4OHX A;  4Z7Y A;  1U1O A;  3GU0 A;  4H4K C;  1KD1 T;  2WK4 A;  2V94 A;  2K06 A;  4R0E A;  3LW5 C;  2XI3 A;  1U1Q A;  1FNX H;  3R5D A;  4C8M A;  1NK8 A;  2YPY A; 
#chains in the Genus database with same CATH homology
 3H42 A;  3BPS P;  3AFG A;  2W2M P;  2W2Q P;  1ITP A;  1V5I B;  2ZWP A;  3CNQ P;  2Z56 B;  1SPB P;  2Z2Y B;  3WIU A;  2W2P P;  4JP8 A;  4K8R A;  3GCW P;  2W2N P;  3WIV A;  3VV2 B;  2PMW A;  3BGO P;  3GCX P;  3VHQ A;  3CO0 P;  2Z58 B;  2W2O P;  3WHI A;  1SCJ B;  3A3P B;  3A3N B;  3A3O B;  3QFH A;  4NMX A;  2Z2Z A;  4NE9 C;  2Z30 B;  2QTW A;  1R6V A;  4OV6 A;  4YN3 B;  3P5B P;  2ZWO A;  2E1P A;  2Z57 B;  2XTJ P;  3SQO P;  3T41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...