2W2NP

Wt pcsk9-deltac bound to egf-a h306y mutant of ldlr
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
93
structure length
93
Chain Sequence
TTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/receptor
molecule keywords PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
publication title Structural and Biochemical Characterization of the Wild Type Pcsk9/Egf-Ab Complex and Natural Fh Mutants.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 93
sequence length 93
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2w2nP01
1V5IB 1SCJB 2Z2ZA 4YN3B 2Z56B 3BGOP 2W2OP 2W2QP 3CNQP 3CO0P 4K8RA 2PMWA 4NMXA 3VV2B 2ZWOA 1SPBP 1ITPA 2W2NP 3WHIA 3P5BP 3T41A 1R6VA 3AFGA 4JP8A 2QTWA 2W2PP 2Z57B 2Z2YB 3A3NB 4NE9C 3VHQA 2Z30B 2ZWPA 3A3PB 3SQOP 2E1PA 4OV6A 2Z58B 3BPSP 2W2MP 2XTJP 3GCXP 3WIUA 3H42A 3GCWP 3QFHA 3A3OB 3WIVA
chains in the Genus database with same CATH superfamily
2P9CA 3M2VB 3MUMP 5IWAF 5JVHQ 2UUCJ 5A0YB 4N5SA 3I6PA 5KFFA 2DXFA 3QGHA 3CJTA 4FN5A 3D1QA 1D1UA 3HD2A 4EBEA 4HHJA 2KM8B 2ZKTA 3G6VA 3KK2B 1IBMJ 4FF4A 4DPYA 4EMDA 5DETA 4OYIA 3LP2B 3Q0AA 3UN5A 3BREA 4KFBB 2M7SA 4UF4A 4Q8FA 3FEYB 5EWEA 5ADZA 2L9DA 1S7IA 5CYMB 1VQ9S 4DSIA 1NPRA 3ZFVA 2X1GA 3CT9A 3J7YI 3MEGB 3HT0A 3VCDA 5EGYA 1DAXA 3U02A 1Q7YT 1TP7A 1KQKA 4PWDA 2IBOA 3OTEA 3H5XA 4F25A 4USIA 1HMVA 1UJ6A 4H4OA 4N56A 2A6OA 3UPFA 1GTEA 1TL5A 3PR4A 4I64A 4C8YA 3ZZTA 3PY8A 2G2OA 2GVZA 4NA2A 4UW2A 5DDPC 3HT3A 1S1TA 3N0VA 2HHHF 1U1MA 4JI1J 1NSQA 2KHDA 1XN9A 1NUEA 2AZ3A 2HBZB 1NSKL 1IR1A 3PW7A 2DHAA 1XR7A 3OXFA 3PX4A 1JX4A 1I94F 2HGNA 2OGUA 3H42A 3ZZ0A 1NK7A 3H0PA 1T9YA 3KXDA 3NXZA 3AH6A 2OSRA 1R3NA 1S97A 4PWDB 5EDWA 1ELOA 5HI7A 1FDNA 2F8MA 1GXTA 3J81j 2IDEA 2CRLA 4KSEB 5DLFA 1NK8A 1H74A 1HMVB 4H4OB 2VFUA 4K0KF 5M2PA 2MXYA 3D0GE 2XMMA 2GVZB 1FNXH 2CUYA 1S1TB 2X7IA 4DPTA 3WIVA 5A6PA 5JJBA 2K1RB 1NXIA 4DV2F 5KFMA 3OVBA 3ZTQA 3PZPA 4RJVA 2DNMA 4CO3A 4QOTA 2JVOA 5K9FA 1WC1A 2JWNA 1IJFB 1K0VA 2GX8A 4YS2A 2LLZA 1RCXB 1RSCA 4QWAA 1QTNB 4OI2A 4DFMA 3MM6A 1VRUA 3DRRA 3K8VA 4O3PA 2BABA 4WFXA 2XQCA 2HGLA 2KVQE 4JI3J 2A3JA 2CQ0A 1Q7LB 5GAHU 4EFAC 2FLNA 2CQHA 3LTOA 1TV6A 5H1SV 4P2MA 4DSEA 3ZNJ1 5MLCV 1XERA 5I42A 2FDNA 2V6AA 4WIIA 3AD8C 4QCLA 4M5GA 4A8KA 3CJ5A 2NCKL 4I1TA 4BC7A 2FVRA 2JC1A 3W1YC 3AOAA 1RAIB 1RTZA 1UZDA 2P6SA 3TJAA 4E0DA 5E0OA 3MM6B 1VRUB 3DRRB 3OLAA 1NAQA 3CDAA 3GSDA 4FKYA 3WX4A 2CAJA 2LVWA 1REVA 2BE7D 1RXOB 1FRIA 1VIXA 1LW0A 3S8SA 2LFVA 4EEYA 3G6ES 1TV6B 5M2UA 1HW9A 3TX0A 4DR5F 2DGSA 5FIIA 3AA8A 2AJ2A 4M5HA 4ECQA 5F9LA 3GFHA 5I42B 2ZBRA 4NLYA 2QEXS 4WZQA 3WIUA 2HBYB 4HT7A 3OVAA 3EGWB 1T94A 4F3OA 6AT1B 1HNIA 3HM9A 3T5LA 3IXQA 3OXGA 1NLKL 1UCNA 1XBWA 5LXYA 2B8PA 3DMJA 3BH6B 3R7BB 1REVB 1S9GA 3ICLA 4DQSA 2BRKA 3DLJA 1JXEA 1LW0B 2DBBA 4X4TA 2BVZA 4P7TA 2CPHA 4OYZA 1YX2A 1U26A 4C2MA 4K4YA 4AUKA 3TNVA 1WEYA 2NXUA 4Q2MA 3P5BP 1FVQA 4K5RA 4KE5A 1NJXA 4NYOA 3BDEA 3JTOA 3I5AA 1X0PA 5KT4A 4DSJA 2VOPA 2E29A 1HNIB 3CMES 1WI8A 1QTMA 4P71A 2JEFA 3M9MB 2HFNA 3MFHA 3GIIA 1XNRJ 1XJWB 3DMJB 1LOUA 2VG7A 4GO5X 2HIYA 4JB8B 1S9GB 5IWAJ 5F8JA 3ZC4A 3SEOA 3QT6A 1EQ0A 5D3GA 2AJ1A 1KP6A 1TAUA 3IS9A 3HHLC 5HSPA 2XSFA 3LWLA 4TKTA 5LL6d 3M32A 1FRKA 2E1AA 4ZCMA 3B54A 5IV4A 3PJWA 4IOBA 1YBTA 5B0EA 1QE1A 4ES3A 2KFZA 1MN9A 4OZ5A 3ZO7A 4ZJQA 2IC3A 1VQNS 1M5HA 5F8GA 2OPSA 4J9NA 1JLBA 1PILA 2U1AA 1PBUA 3A8EA 3M2UA 1CC8A 3LAMA 3V2UC 1JLEB 4ZP6A 2W4DA 2J8SA 5EX3A 3A8KA 1VC5A 2VG7B 1LWCA 1F5AA 1V3RA 2QRRA 2F3JA 2GNKA 5D3GB 4EZ9A 3C16A 4YB6A 4K4VA 2EFGA 1JLQA 1TTHB 3IS9B 4ED2A 2HHHJ 1XR6A 3M32B 3M2RA 4I4BA 2V34A 1S77D 1IJEB 2YNFA 1RAEB 3AXMA 3UDLA 4A47A 4WWSA 1IQZA 4L3NA 1I94J 2NXCA 3W64A 2EG1A 3T1YF 2OPSB 3KDNA 1JLBB 3FRYA 3PACA 1MWQA 1UWAA 1U24A 4C0OC 3E2EA 1NSAA 3M2UB 2W01A 4Q45A 3B8HA 2GO9A 4FBUA 3JTPA 1LWCB 1WDTA 3C19A 2BKOA 2CJKA 2RMLA 1FFGB 1ULRA 4K0KJ 2KU7A 2HFUA 4B9NA 1JQGA 1AA1B 3GTYX 4J9SA 5ETOA 1TKTA 2C3UA 5KFCA 1JLQB 4B02A 3M2RB 2HPUA 4DV2J 1YRUA 2YNFB 2GC8A 4ELUA 3S6EA 2V8HA 4ATNA 2ASJA 4LF4F 4DXLA 3O2IA 1ZAXA 4YMEA 4OLOA 4ITSA 3DYAA 1N0UA 5L9NA 1EB0A 5KFPA 4CO0A 4P74A 4KYZA 4URSA 1RAAB 2F4FA 3P4UB 1FESA 3A3OB 4NLRA 1SCJB 4RX6A 9RUBA 4TXSA 3ZZOA 1Y3JA 1MWYA 2QV6A 3PJ9A 4DWIA 5E41A 1MN7A 2MYFA 2YNIA 4QQBA 2PEHA 1P9YA 5AT1B 2B51A 2XMWA 1TKTB 5JXSA 3IP0A 4RNMA 4Z2XA 2CNLB 2VG5A 5LMUF 2CQ4A 4NI2A 2W1BA 1YJNS 3EPGA 2J9DE 2Z2YB 3NEKA 4LSNA 4MK7A 4DV7F 4OZNA 3EXYA 3M30A 3DYAB 5HROA 4B9MA 3CSKA 1JNZB 2CQ3A 3QSIA 1YZ6A 4LRCA 2YQ0A 2DHHA 4GO7X 4IQXA 5L38A 1PAEX 3DU5A 2C2RA 1UJ5A 3SMZA 4NXNF 3J80Y 5J2PA 3K5PA 1F3FA 3VAHA 2YNIB 1YVFA 3KLEA 4DR5J 5AJ3F 1RADB 1AT1B 2IVYA 2OH2A 4Z37A 2XI3A 1LKZA 4KKOA 2R7QA 1EJ7L 3PEJA 4JYAF 4CNZA 3R6GB 1WC4A 2VG5B 1S1WA 4NI2B 2GQ2A 4N77A 1F6TA 1U1QA 4ZHRA 3SDEA 3C46A 2E7VA 4LSNB 4PXCA 2R7WA 3GB0A 3O6QA 3M30B 1J27A 3OR2A 2NXJA 2RSQA 3TP2A 5HROB 4C3KA 6FDRA 4LVNP 4M1KA 3W2WA 5DDOC 4Y00A 2R7OA 3UW1A 2L48A 2E9TA 4JI6F 3RG6A 1LFWA 3TA2A 4F7VA 5LMNF 3HJVA 5J2PB 1AUSL 3KLEB 2HQ3A 1KONA 1R89A 2D3UA 2BX6A 2HLTA 4JP8A 1ZETA 3W9HA 2ZH1A 3FGVA 4KKOB 4DL0C 4X4QA 5K8MA 1W7WA 1YLXA 1S1WB 1YSJA 5E3AA 3VZIA 4ZHRB 3IMQJ 3SDEB 2QL9B 3ZZPA 2NR0A 4JUZA 2FIUA 3Q8QB 1KKHA 2G1HA 1X0FA 3I82A 3OR2B 2XB2D 2B4OA 4DL5A 3W2WB 2OD4A 2DYAA 1M5SA 4ZPAA 1HHQA 3I31A 1VC6A 2HVZA 2U2FA 3M8SA 2AJFE 2HQGA 2G0IA 1R0CB 3HFKA 4DL2A 2ZH4A 3CDBA 3TAMA 3AJ1A 4PYDA 2Z8QA 2YKNA 2PI4A 1X4AA 3CE8A 2OI2A 2GHPA 4ZCIA 3MEEA 1B0TA 1UFKA 2EVZA 3LQVA 2WB1D 2RJZA 2GCFA 3CCTA 2A2DA 1KTQA 3UFCX 5IFMA 2DNHA 1YIJS 2A2CA 1SUQA 3TAQA 2GHVC 3GONA 3EM1A 3P3DA 5D78A 2R7TA 3NCPA 2KH9A 2YX4A 3SZ2A 3VGVA 1FRMA 3N6MA 5L39A 4J9VA 3OL9A 1U02A 3MFIA 3Q24A 3CCLS 4DX7A 2DVIA 3HZEA 2V2VA 4Q7AA 2MZQA 1DQ8A 2Z4PA 3GCWP 2VDHA 3D6FB 2QX0A 1WEZA 3H5YA 2VH7A 4F02A 2E5JA 3TAMB 4RW9A 4IH7A 3R6LB 3THVA 2MPUA 4YB5A 4B17A 2ZM6F 3V6JA 1NBEB 2VJVA 3MEEB 3CDWA 3BGOP 3T1YJ 4ZVOB 2PN6A 1BE4A 3MR5A 5T14A 2YPZA 2ADCA 2Y1LB 1SUQB 1EKRA 3IM9A 4C48A 1Y7PA 5DM6Q 3KMSA 2GJFA 3MTJA 3NL0A 5KT7A 2XS5A 2QL7B 3LP0B 2BR0A 1FK9A 3MTKA 3MR6A 2ZDOA 3M8WA 2CYYA 4KAIA 5BXIA 3ZTPA 5G0RA 1RI7A 3L7PA 1UVJA 3IC1A 1U1LA 4DF4A 1QY7A 4OJGA 4RW9B 5J2QA 3BR9A 2HQFA 4Q43A 4LF4J 3T6BA 1D9DA 4KC5A 2MKJA 4YQWA 2XGQA 3CC2S 4AYBD 3UCGA 4UTGA 3CJKA 2QIFA 2K2PA 1SV5A 4FPRA 2V2KA 4WJBA 3SQOP 1SKRA 3NG8A 2D9PA 1HQUA 4HVZA 3UR3C 3BN7A 5DO2A 4ZK7M 1FK9B 2XYGB 3ILJA 5DG9A 2CADA 4RW6A 5KG7A 1FFSB 1CEZA 1KC8T 3NWGA 5C24A 4X84A 1I1GA 4CCHA 1QJHA 2DH9A 2V63A 1AUDA 5LMUJ 4B9VA 3TEGA 5J2QB 3P96A 4PPDA 1RK8A 5EUHA 4ECZA 1H6KX 1RDRA 4GKKF 1F5CA 2ZDPA 4DV7J 3QT8A 3C8YA 5C7PA 3TVZA 3BZQA 4WTOB 3IWXA 4IG3A 4RU9A 3CJKB 3WHIA 1SV5B 2PT0A 1KQSR 2IVMA 1N34F 1OS5A 4WP9A 2WVBA 1SQGA 2FVQA 3W65A 4KR0B 1HQUB 1WC3A 5MAOA 1HKAA 3QATA 4NXNJ 1NK4A 3IAM9 3L95X 1VBXA 4RW6B 2KT3A 1QVGR 1VIOA 1QSSA 3D0HE 3KOAA 1B7FA 1RWOB 2V5HG 4R8UA 5C24B 4JYAJ 1EX8A 4DLGA 2BJ9A 3T5JA 1Q8LA 5HQLA 4J37A 1Y9OA 4ZCKA 5KG2A 1LWEA 1SJ1A 2OTLS 3FCVA 4LF8F 1Z2ZA 3KHRA 1EIYB 3GFZA 2AMCB 1IBLF 2H65B 2HVEA 2HK2A 4IG3B 2CPJA 3DRPB 1VRTA 3CIMA 2B8QA 2GVDA 3CCUS 1KTVA 2ZH8A 3DU6A 4JI6J 3A12A 2WBRA 1T9UA 1IBCB 3LH2S 5HMYA 3NY0A 5LMNJ 3OSNA 3GYNA 3GWCA 4U9RA 4U6PA 3G9CA 4PG7A 4WIQA 4DR4F 4HT5A 2RILA 1U2FA 2XO7A 1FWKA 3RB4A 4R8UB 2V4RA 2POKA 3EZUA 5DZ7A 2BKPA 3G6XA 2HS4A 4TQSA 4DUTA 3JSRA 1LWEB 2Q43A 3MM9B 3HHDA 3DRSA 5IT0A 2MLXA 2DNRA 2WVFA 3C66A 2RRAA 3RU0A 2DNZA 3GJQB 2H54B 1YJVA 4CH7A 4DZ6A 2HAFA 2QLBB 1B64A 2GVDB 4CLWA 3TYTA 5ETSA 2X3GA 3BKFA 5GMKa 2VBXA 4I6YA 3KLHA 1VMBA 2KRBA 3BV8A 5L8RC 2CQ2A 3NNHA 2BJEA 2GV1A 2KDOA 3M9NB 2R4FA 5CH7B 4YR0A 4ETZA 2HZCA 4AFFA 2AV5A 4ECYA 2QFIA 3HHLA 1RTHA 4ZOSA 3H98A 1WTFA 2K7JA 4NLQA 2GHWA 4K4ZA 3NMAA 4DV6F 3HCXA 3H2LA 1N32J 3DRSB 4QWBA 5K8PA 3ITHA 3ZZZA 2NREA 3W62A 2R8GA 2BW7A 1ZBTA 3HLUA 4UUWA 1F2HA 1H73A 5SUHA 5EN1A 3CEDA 4X4SA 5KG3A 4C8NA 4CLUA 1RLCL 4I68A 4CRJA 2V4JA 3OL8A 5IOLA 2ZJQQ 2FZKB 3MMBB 2BRLA 5I4MA 2E5GA 3KLHB 1N33F 3CJ4A 2HLUA 2ROGA 2VOOA 2ZM6J 3VAGA 2M3DA 2BACA 5D8HB 2ATCB 5F8HA 1UP1A 1N5YA 1RTHB 1OPIA 4PXBA 3UNYA 5IQQA 4BDPA 1RACB 2KL8A 1U09A 2F4VJ 4DDFA 4IH6A 1R8HA 5A8WA 2G2ZA 3ITHB 1W25A 2IM1A 1Q8KA 2B0GA 1M1HA 4LRFA 2OHDA 1GAOA 4QIWD 4OZJA 3PEHA 3QZ8A 4YN3B 5F8MA 3AB4B 4JI7F 3KLGA 1XNQF 3K59A 3UR0A 4IO9Q 1HR0F 3ELHA 5K5MA 1RUSA 2V4JB 1Q4RA 3FRZA 3DRYA 2FJDB 2IM3A 4RUHA 5L1LA 4H4MA 1HW8A 1M1GA 4K4TA 1OY9A 3BN4A 4R0EA 2YWHA 4BS2A 3D68A 1FD8A 2AYBA 4YEAA 3PTWA 1N5YB 5KFEA 3B78A 1SL0A 5D4LA 1RKIA 2C3OA 4DQQA 4ZP7A 5A8WB 3HHEA 2IPOB 1NNDA 2XYPB 4UOFA 2DISA 1CVJA 3QFHA 2YWGA 3KLGB 2FYXA 2VFVA 4KHMA 3UD4P 1TZ0A 1WHWA 2BA9A 4LT6A 2PDAA 5IT4A 3K5MA 4YDDB 2V2ZA 2RB7A 4HL9A 5HLFA 4H4MB 3ISZA 1DURA 5B0DA 1BXNA 3CULA 1LFPA 4K4XA 1RT2A 4LRBA 1ZZFA 3FMWA 4ILLA 4GKKJ 1URNA 3CO9A 4X64F 3FQLA 3NBPA 4WYWA 1TQLA 1IM6A 1F0XA 2GO8A 3FZ2A 1EKSA 3VAFA 3H4BA 5HMWA 1N34J 4EI2A 5CHCB 2WW8A 2A0FB 3TA0A 4F4XA 4LMZA 1BHNA 3BSCA 2JRSA 3VQTA 2LQJA 2QG9B 3W66A 5LOQA 5AXMA 2DNYA 1NJYA 3HSGA 1T95A 2W2PP 3L7UA 1RT2B 4MKBA 4KT0C 1ZA2B 4LF8J 2BJ1A 1APSA 4QZVB 3BQ0A 3BGRB 4IDKB 1IXKA 2UVVA 1IBLJ 4ZVRB 2PMZD 4RU2A 1RWMB 4I0WA 2GQQA 4LF2A 4DV4F 2Y1JA 3QIDA 4RW4A 2XMJA 4KHRA 1T3OA 4UY85 4KGVB 1DQAA 4JI0F 4C0BA 5C25A 2AQ4A 1HHSA 2KYXA 4LFCF 1UVLA 5RUBA 6FD1A 1K1SA 3QIPA 1HBOA 4OZLA 4DR4J 1SIZA 3GFXA 4J9KA 1H2UX 4CNYA 2AWZA 3OFGA 5A8RA 1S10A 3RTVA 3LPEA 3ILIA 1YBAA 2QGFB 5FDLA 1F60B 4F2SA 3LP1A 4P10A 5KT3A 1S0MA 1SIWB 3CTRA 4KPCA 3KK1A 1T8EA 2DGUA 3AOCA 4DHVA 4ZVTB 1G3OA 2RIJA 3BH7B 3ENQA 1X60A 1DY3A 3FCWA 3W9IA 4RW4B 1UEVA 2D7SA 3EZ5A 1XMBA 1EZZB 2Z0GA 3FDSA 4KGZB 1SBRA 4CH0S 4Y65A 4KBIA 5C25B 3EYZA 1RJJA 2CJQA 4CYUA 3QIPB 1HBOB 3US5A 2WB4A 2H9ZA 3HMJG 3T1AA 1FO1A 4HI2A 1WHYA 2XG8A 1H3DA 1U1RA 4F67A 4ELTA 2KM8C 2UP1A 1MLAA 1N56A 4A8YA 4PXEA 5I3QA 5A8RB 4PR6A 2JC0A 4DV6J 2ZBCA 2W24A 5FDLB 4DMZA 3LP1B 3N9UC 1SJRA 1WC6A 3GMGA 1V3SA 3KK1B 3AHPA 3BO2A 2AIRB 4O4GA 1DFDA 3HFVA 3BB5A 3E8OA 3V6HA 3V4IA 2HK3A 1KQGB 1MNEA 3CD7A 2YWKA 2LMIA 2MJUA 5E2QA 1P1TA 4OX8A 3KHHA 3LF0A 4CYUB 4L74A 1KVJA 2X1AA 4OI4A 1K9MT 4EWTA 3FEXB 1SKSA 5HL7Q 1N33J 2IY5B 3HKWA 4F3QA 4LQ3A 2BBEA 1NDKA 2Z2MA 1AYEA 2AEMA 1Y5NB 3I4HX 2DGOA 4DF8A 3IG1A 4OZ3A 4RR5A 2B5JA 3V6KA 4PQUA 1X4BA 1G2EA 1LEOA 1HWKA 2D3ZA 2RHSB 2K8GA 3KK3A 1U2RA 1CC7A 2C2MB 3QPIA 2LQ9A 4WK3A 4O4GB 7FD1A 1XNQJ 2ZC4A 2MKYA 4OJ1A 3V4IB 1HR0J 1Q78A 3KLVA 4X4VA 3VGTA 1FX4A 4KV8A 4P2FA 4K4WA 3TZYA 3VVUA 2OJ3A 2DXEA 2W9CA 3AJ2A 4C11A 1OSCA 3A13A 3NGRA 4ZVSB 5BYSA 3KUGA 2WONA 3NGDA 2I9SA 4UZBA 3IG1B 2B5JB 3CMAS 3DLGB 1HI0P 2H5EA 4IOAQ 3NS7B 3KK3B 1QUVA 2ASYA 3QGPA 3D1HA 1NJWA 4N7TA 2ERRA 2LXUA 3M8QA 4DV3F 4A46A 3PV8A 3J81Y 4LBHA 4X65F 1N6QA 1QAXA 4C0HA 3N4WA 2WTFA 2CPEA 2JDJA 1RLDA 2K06A 4RWWA 2W9CB 3RR8A 3HF5A 1T03B 4C11B 4J90A 2ZC3A 3ETOA 1JIHA 2V8GA 4X64J 2WONB 1KOHA 4X62F 1NK5A 1M90T 1MSWD 3GJSB 4J7CA 1JXLA 2XY7A 2ZNZA 4W92B 3D28A 3H5SA 1TELA 3S7RA 2PMWA 4MFBA 2G1DA 3M8QB 4FXVA 4OHWA 2LU2A 5KFXA 1B4SA 3CXCR 1D3WA 2E7WA 1VK8A 4ES2A 3EGNA 4GMKA 4F0HA 3CD6S 1N6QB 1I3OB 3D66A 3GJTB 1BY9A 4CT9A 4AD6A 4FXWA 4CLSA 1BQMA 2XS2A 1AW0A 3HJFA 2IM0A 3B4MA 4JI8F 3OTOF 2M70A 2MQ8A 2RQMA 4QIGA 1HWLA 3L4BC 4N8NA 3OR1B 1KVKA 2CPZA 1DTQA 4DUYF 2MLYA 3FNNA 2KFYA 3MPVA 3TJ8A 4DV4J 1FVSA 2Z57B 3E3XA 5KT2A 2IBKA 2NYHA 5FJ4A 4JI0J 2LXIA 4O4RA 1UAWA 3D54A 4MFBB 2B43A 4LFCJ 3QJJA 2HNYA 3WX8A 2OPQA 5A6WA 5B08A 1RBOB 4ZIWA 1FXDA 2FJXA 2G0CA 1E6VA 4M95A 1H7WA 3GR0A 4FZVA 4ECRA 2JEIA 4B3MF 4DFJA 3EVMA 1S6PB 3HXMA 3CCSS 1TMJA 1S5ZA 1BQMB 2BYCA 4BC9A 5JVGQ 4WF9Q 5THWA 1O8BA 3WBZA 2YWWA 4ECXA 3NS5A 2LQBA 3PRBA 4IOCQ 3RR7A 4MIAA 2PE8A 2AKWB 3BBCA 1DTQB 4ZLNA 3AY0A 2BE2A 2AGPA 3MUTP 5IC6B 2MMYA 4I2PA 2XO6A 2OMLA 1NJZA 3SFGA 2XWYA 1TK5A 2MQNA 5A2QY 1PGZA 1U45A 4B3RF 2HNYB 4ZP8A 1NSPA 2OPQB 4GC7A 1M5KC 5AXLA 1E6VB 2KG0A 2L9WA 4FNIA 2QZ8A 1VCTA 2W2QP 3DCAA 1ZAVA 4K2JA 2MKHA 1TL3A 1TVRB 2A18A 5B0GA 5T7LA 5J2MA 3KWMA 3Q8UA 2QJ3A 3UQSA 1CS4A 4CP5A 2EFPA 4WZMA 2YH1A 3MR3A 4KHPF 4JI2F 2BE2B 4I2PB 5H9EK 1YRTA 2HKEA 2ZVIA 4LIRA 2DGQA 4XDDA 2DH7A 2WW4A 4XDCA 2HFVA 3LGNA 1V9OA 4OHXA 3BGFA 3RZAA 4NLUA 5I3PA 1C0UA 3AXKA 2PO4A 1KR4A 1RP5A 4LF9F 1NPPA 4M5IA 3G96A 3OJSA 4F4YA 4CM0A 1NH8A 5KFZA 2DY1A 3KMQA 1TL3B 2XYHB 3KHLA 4DCPB 4DV5F 3ILOA 1A9NB 2OLWA 5T7LB 5J2MB 2KZZA 1TK8A 5IXUA 1CS4B 1NHVA 3HPOA 3M9OB 3VTIA 1RWKB 2IMOA 1XEZA 2E5IA 4DPUA 2KG1A 3MMAA 4NLPA 1OQ3A 3OSPA 3QRQA 2VD3A 3GYXB 4LSLA 4ZKAA 5DDRC 1YITS 3MM7A 2ZHAA 2KRRA 2XY6A 4M5KA 4UZCA 1FWLA 3M7VA 1VI7A 2M52A 1RB0A 1VC0A 4J9OA 5KT6A 4DPXA 3KHGA 2E7XA 5HANA 4HLBA 2XHCA 1C0UB 1UA0A 1RT6A 2IIHA 3DGPA 3T9ZA 4BCAA 1RGVA 4LR8A 3UN2A 3MOJB 2DGXA 1G1XA 3IRWP 2EFOA 3DLEA 2M9KA 3CIZA 8ATCB 3ZTSA 1BC6A 2W25A 2DCLA 3G71S 5ETPA 2RDJA 3L3CA 4B9TA 1BLUA 4ZIVA 3DXBA 4ZCLA 2EK1A 3CCMS 5BJRA 1ZPWX 3S01A 2XI2A 5T41A 1F2GA 4DPWA 2R7XA 3I87A 4OYWA 3AA9A 1VQ4S 1R6VA 3MM7B 2FJVA 2BW2A 2BZ2A 4NE9C 4DV3J 1T9XA 3I96A 4U8YA 3I5BA 1HNWF 2J6UA 2V4QA 2C28A 4X65J 3PX0A 2V68A 4USHA 5IZHA 2AHOB 5HP1A 1R8BA 4OZ0A 1JJ4A 1RT6B 4XO0A 1J5EF 3DGPB 1AZSA 3IRXA 3M6XA 4EK2A 2QA2A 3OJUA 3ADAC 5ETQA 4P72A 2V94A 3IO1A 2JEGA 1WG1A 3DLEB 5KFUA 5E3RA 4X62J 4TY8A 3FQKA 3KJNB 2CNNB 3M1VA 3TW0A 2UVUA 2FY8A 4LF7F 1TUVA 3CCWA 2VF3A 1SJ3P 1YJRA 4E8UA 4DL6A 5AE3A 2D3O1 4GKJF 3P5TL 2R3VA 3AQPA 4J9QA 2YWEA 2VU5A 1H72C 1UVMA 5ETTA 2MY8A 2XMVA 1DBDA 2AF6A 2GZOA 5DG7A 1BWEA 4CLKA 5B09A 2RNEA 5HP1B 2HW3A 2ZNYA 1AZSB 2DH8A 5BR8F 4OI6A 2Y1IA 1NKBA 3IRXB 3W7BA 4OIXA 4JI8J 2DHXA 3OTOJ 3GV5B 1SVDA 1O6XA 2KJVA 1FJ7A 4M63A 1WC5A 2VC0A 4B3TF 4TY8B 4P2SA 2HVIA 4DUYJ 5KFTA 3FK4A 5EWGA 3M1VB 3OT9A 1NDLA 1RWNB 3R5DA 1MU2A 5GVQA 4USUA 3T5HA 3V5RA 1ZOTA 2FJBB 4ZITA 4TU8A 3H7HB 2EFQA 5D4NA 2E1MC 3KG0A 1HQEA 4XAKA 4P6QA 3X1LB 4B3MJ 1PBAA 5KFWA 2PFDA 2UXBJ 2F40A 4HTIA 3DLLQ 1EP4A 2H48B 2IYGA 4DI6A 4YR3A 3MAAA 5GADI 4Y3CA 1UA1A 2VKRA 1QAJA 3MCSA 2PC6A 1FT8A 4C3LA 3A4TA 1Q79A 1SJ4P 2XY5A 2CZ4A 3AJDA 1I6JA 1I51B 4B3RJ 1Q1KA 5HAOA 1OYDA 2QFJA 1P6TA 4O0NA 3I0SA 4TN2A 2DNPA 4RBTA 4TVAB 4P9SA 2W8LA 3POTA 1FKPA 3SSQA 4MK9A 4OMFG 2W2NP 2QL5B 1V5VA 1B7YB 5SZTA 1EP4B 4MKAA 4I6WA 3KG4A 1VQ8S 2UUAF 2HRYA 2UV8G 4GRSA 4LQ9A 2RS8A 4NLVA 2DRDA 1SC4B 2J0SD 3HX9A 3O8WA 4J91A 4KHPJ 7AT1B 2CDRB 3TVKA 3M6WA 3R1LA 2DIUA 3LP2A 3DDKA 2VASA 1LXNA 4JI4F 1F5BA 3GG0A 1VOMA 2OTJS 4HHUA 5DM7Q 4CO5A 1WI6A 2BM1A 1M5OC 1NK9A 4E2FB 3MEGA 5KG4A 4U7UK 2C2OB 1KHVA 2FUG9 3RB0A 4LF9J 3I0SB 2ROEA 4WBFA 3BEGB 3POTB 4OYBA 1FKPB 3V4MA 2WBMA 1JWWA 3Q89A 4DV5J 4ZLPA 2O5DA 2VODA 2X1BA 3GR1A 4ALZA 2FGCA 4RW7A 4B3SF 4ECSA 1VBZA 1PO6A 3RB3A 1RBAA 3FC9A 2AU0A 3QT5A 2IFXA 2DR8A 3K0JA 2MQQA 2YPYA 3EDQB 5D0RA 1IKWB 3AB2B 4A8MP 2IJFA 4USKA 4ZA1A 2EI5A 2J7KA 1FKAF 1Q8IA 3NKYA 3SBMA 3K5NA 4WXWA 2DGWA 1D9AA 2W9BA 5CABA 2KO1A 3SYZA 4ES1A 1RQ0A 3E01A 3CWJA 1AROP 3GIKA 2JVRA 4PAAA 4NASA 1IR0A 1X4HA 1VDHA 1FRLA 3LAKA 4C98A 3DLHA 1QAYA 2XC9A 3KLFB 2MZJA 2WSCC 4RW7B 1U48A 1ZM3A 2CQGA 3ZNUA 2K1RA 2DCUB 4NYZA 5D4PA 3PHEA 3RAMA 5D0GA 3R9LA 3JSBA 3SXLA 3IBWA 3QJLA 3EPIA 2CPXA 1N48A 3BR8A 1IKYA 2ADBA 3TJ9A 1PG5B 2V9KA 1HNWJ 2FVCA 1N54B 2FPHX 1WHXA 2KN4A 1NEEA 5KFHA 1J5EJ 1H7XA 2ACYA 2EKYA 4WYLA 2W9BB 4RO0A 1NM2A 4G65A 4MH8A 1TFWA 3E01B 3QFWA 1GQEA 1HBMA 2IDLA 3QYYA 3MOZA 1GFWB 2IM2A 2ZBIA 3AD7C 1L3SA 4ZPVR 3DXSX 3O1LA 5FD1A 4LF7J 1RE1B 3Q83A 4RZRA 2IRUA 1R27B 4GKJJ 3K8WA 1IKYB 2ACMA 2GGPA 2PA3A 4YY3F 1SC6A 2XCAA 3DI6A 2JEJA 4W98A 2W2OP 4RUBA 2QN6B 2VC1A 2YKOA 1NCLA 1JLAA 5BR8J 4ZN1A 2EC2A 2XCPA 2EKNA 3PO5A 3QNWB 1T3NA 1SH0A 1X9SA 2BKNA 2KT5A 4OYOA 2EBGA 2AW0A 1HBMB 4V19X 1PCAA 3R2CJ 4IO1A 1RYRA 4B3TJ 4HKQA 3VAKA 1VQMS 2ATLA 1MMLA 3PJXA 1RHKB 3H20A 2R9LA 4DS4A 1LW2A 1H2TZ 2GGPB 5ETRA 4WFYA 5KFOA 2Q1LA 2RU3A 4DX8H 4RUAA 3DI6B 4F3MA 2UUBF 5IT9Y 2VUGA 2YX1A 2DR6A 4LBPA 1JLAB 2QSWA 4NCGA 2FLPA 2FLOA 3T5KA 1O51A 1VBKA 2UXCF 3FBCA 3R7NB 3MXHP 1CQMA 3P6YC 1N88A 2B9YA 1T02A 1HD0A 2N3OA 3F44A 4AE5A 1U47A 4QJVA 4Y2KA 4A8XA 2PIIA 2RF2A 4RNHA 1MMDA 3ILLA 3W60A 5GMEA 4ANEA 1VRQC 1V6HA 5LSLA 1YK9A 4KGXB 1HD1A 4KH1B 3PYFA 1LW2B 2CNOB 1ZM9A 2O1PA 1TK0A 3PYGA 1WEXA 4OQJA 5C42A 1N36F 3R97A 2D9OA 3LGMA 4X66F 3BSOA 1GMVA 3N5BA 4NCGB 2KXNB 5KAKA 4QU6A 1SJFA 1IM4A 5F8NA 4A48A 2I38A 4H4KC 2GJ2A 1JMTA 2UUAJ 3SCLE 4C7QA 2YKAA 3CDUA 4HH0A 4M8LA 3L7OA 1JNRB 2OMOA 2FC8A 4MIWA 2CQDA 2RF2B 3GIMA 4FP9A 4IUFA 2NQPA 2KI2A 3I0RA 2OSQA 4JI4J 1HWUA 2VBYA 2NS1B 1J5OB 3MEDA 3R2DJ 2O66A 2ZITA 4P7VA 2HWIA 2J0XA 2FHMA 3CJSA 2N7CA 1JLEA 4DJBA 1R8CA 4ED6A 2XTJP 3MPUB 3G86A 5C42B 3IBFB 2EK6A 4DX5A 4DR6F 3PW4A 2LQ5A 2PFFB 3CJ2A 3TQEA 3BO3A 1R6YA 4FS1A 5DZ6A 3ETMA 2V9WA 4ECVA 3BBBA 5IC4B 5DGBA 2JNJA 1NPKA 2BDPA 2YVSA 4B3SJ 4F36A 4QR0A 2W7PA 3ZTRA 1K1QA 4UY8T 3FJ2A 4OX6A 3I0RB 1RA7A 2M4MA 4CLYA 2MQMA 2QLFB 2DNNA 4I6AA 2VG6A 1M1KT 3MEDB 1VQOS 1H2VZ 1QDUB 3OHBA 4BLGA 2EG2A 2RUGA 4J9MA 1KLMA 4WP8A 2AX0A 3HP6A 3T19A 1TL7A 1FJCA 3VV2B 2OELA 1TAQA 2C3PA 3NAIA 2XMAA 5D0HA 1X9WA 3EDRB 2BV3A 2AYMA 5K20B 4J5OA 1A6LA 2LP4A 4CLPA 3U1NA 2C2DA 4NZ6A 4DR7F 2QYCA 1ZTWA 2CQ1A 5HJXA 2GIFA 2AD9A 4PXDA 2ZHBA 2DB1A 1S1UA 2COLA 2J5AA 4O23A 2VG6B 4FVCA 4NLTA 1SB6A 5HO4A 3ULHA 2IMWP 1FI4A 3OTDA 1L3KA 3IBCB 3HULA 5LT5A 2Q6BA 5M2RA 3PO4A 3NMRA 4D3HA 2G2YA 2UUTA 1KLMB 5H9FJ 4PZVA 2Y8YA 2K3KA 3Q8RB 3BDPA 1TL7B 2V8VA 4WXOA 3DOMA 3DKDA 4RBUA 2RKIA 5GAGU 3VF0B 4DR2F 1VR6A 2FGOA 3JAMU 4OHZA 3PNIA 2JSXA 3IN5A 1Y0HA 3CVKA 1RISA 2D41A 4MYUA 3FBFA 3VWSA 1S1UB 1UMJA 4TYAA 3DN9A 4YY3J 1A7GE 3PKYA 2Z2ZA 2Z56B 2L3MA 2CIMA 2AGOA 4LFBF 4G1IA 1X4FA 2RQKA 4TY9A 3M8RA 4NMLA 4KQZA 1KLNA 3GCXP 2BQRA 3GFYA 3DOMB 2BM0A 3MURP 4A8OA 4HI1A 4D3GA 1XWLA 2RKIB 1N5QA 1UFWA 3TRGA 2IRXA 4F4AA 4DLEA 4S0MA 1U0HB 4DOZA 2BQUA 1YKWA 4QWCA 4WU2A 1TL4A 3M05A 3OW2R 2KT2A 2QA4G 2RH3A 4K8RA 1TUGB 4W4MA 5J1EA 1WF1A 4WFAQ 2NUUG 2M5YA 2VPYB 3G82A 4ZLLA 5KFRA 2XMUA 3IR7B 2ZZNA 3TR5A 2E66A 2ZJRQ 1JJHA 4JI5F 1DARA 2VHGA 4O44A 5KG6A 1WF2A 3UNGC 3HVTA 1SH2A 4ANDA 1L5UA 2UXCJ 5KFGA 1VHIA 3H8YA 4ER8A 5HK4A 3DNCA 3B6BA 3SV3A 1MROA 5E3PA 2P6TA 3MAHA 1S49A 1UTAA 1GMWD 4B3OA 2DGVA 1ZA1B 3W2VA 5J1EB 4NCBA 4GVLA 1U2CA 3UO0A 1IQTA 1N5SA 3G82B 3K17A 1K47A 4TQRA 2HEKA 3CGIA 2ZFHA 2HGMA 2V8PA 2ZBPA 5CQGA 4CM2A 3LALA 2HFZA 2IA0A 3JXOA 1U4BA 1N36J 4HTJA 4EYHB 1NB7A 4X66J 4O44B 4NLWA 1S0OA 1CQNA 1FTCA 3H2VE 1KOOA 3HVTB 1S7HA 4DFPA 1WOSA 3GLJA 2XSJA 3MZIA 4L6V3 2J0WA 4LUBA 4OI3A 1NKEA 3FZBA 1UEKA 2UUWA 2C2KB 1C1CA 3C6TB 1MROB 1Q0NA 4EBCA 1U8WA 2DNQA 3EMTA 2WZ1A 1UPPA 5E7OB 4B3OB 4DQPA 3W2VB 4N76A 2HS0A 2E9RX 3D3BJ 4UOGA 4MYTA 2ZE2A 1VHFA 2YQ3A 4Y2MA 2OKQA 2DNGA 5DGAA 1SXLA 1IKVA 4RNOA 5CCMA 4BWMA 1W2IA 4DR6J 1FE4A 4DCOB 2AJQA 1B3TA 3KG1A 1RT3B 3FUYA 3HZGA 2XSJB 4K7QA 4TNOA 2J0QD 3EVOA 1C1CB 5HVFA 1QAIA 5KT5A 4Y28C 4ZVQB 1N5TA 1UVIA 4A8FA 5GMDA 2DT9A 2B56A 4ILRA 1ACMB 3Q2SC 2ZE2B 5FLXU 5B0BA 1RT5A 3U1LA 4AL5A 3Q8PB 4IFYA 1IKVB 1WD6A 3K89A 4UQTA 2LQ8A 5H9FK 1WF0A 2W7AA 4JV0A 3LP0A 4Z7YA 1PJ5A 4TU7A 4OJHA 2CA9A 3I55S 3TO8A 3FMBA 3H59A 1HNZF 4C8ZA 1O0PA 1NKCA 4DR7J 4ED8A 4FS2A 4MMOA 3UI3A 2ZH9A 2UXDF 2M8DB 3NWRA 3J81U 3UDVA 2PGCA 4ED3A 1XK8A 1YZ7A 4X4RA 3NOGA 2KTQA 3D5MA 1VISA 3N6LA 3TUZC 1RT5B 1SC3B 5L1KA 2J9DA 3BF4A 4IFYB 1CJUA 3JQKA 2F65A 3GIJA 4MAKA 2CJ9A 5CD4H 2V50A 4LIWA 4AQYF 1R7IA 3O5TB 3HSDA 2OEKA 1UJ4A 3ONQA 5CZXA 4J9LA 4YP3A 3V81A 2V8DA 1OO0B 4DR2J 3TARA 3NCQA 5D15A 3OQ2A 3K5LA 1OQ6A 2LA6A 2OPPA 1Z2LA 3RYLA 3GZ7A 5B0FA 2CPDA 3HSZA 3BQ1A 3QAEA 1WTBA 2JX2A 3NNAA 3P49B 4OHYA 4ZPDA 4I56A 4OJ3A 4M5DB 4LFBJ 3PKMA 1VQLS 4LR7A 3A3NB 4ECTA 1JXVA 1GMWA 1CJUB 1VQSA 4C3MA 2GA7A 1RAHB 1HI1A 1X4CA 1NB2A 4FYYB 3UDCA 1ZH5A 3D3CJ 1RWXB 1GTHA 4YB1P 2DPJA 4M5LA 3V81B 4NA1A 5CYJA 4EZ6A 3R5AA 4JV2A 5IV3A 3UVJA 2HIQA 3R7SB 2OPPB 3SSSA 3F0NA 2KVIA 2ZWPA 4YOEA 4CO1A 2CDQA 5KFBA 5E33A 2CQBA 3G4SS 3W5YA 1RT1A 2M2BA 4JI5J 3MPWA 5DQHA 3DRPA 1XQIA 1OIAA 2XWXA 2EC0A 2DIVA 2JFDA 4OYMA 3BYPA 4DU7A 4FPIA 2C2NA 2OFHX 2GMHA 2HHVA 2QA1A 4Y2AA 4QYZJ 4PRFA 4NPOA 1DRZA 2H51B 1VQ7S 2ILZA 4CTAA 5AJ3J 3T6JA 3MD3A 5K14A 1D09B 5A2QU 4NRUA 1UVKA 2MKCA 2XMTA 3UVJB 4C8OA 2FLLA 1FXLA 1FDBA 1HPZA 4M94A 1VLOA 1K73T 3C15A 2MLZA 3HHKA 1RWPB 2XZTB 5ETKA 4FNHA 2W4PA 1TUWA 1HIYA 3MM9A 3H90A 3P45B 2HBRB 1RT1B 3OPKA 4UQGA 2VBWA 4NEZA 2RAQA 3NCRA 5DDQC 3R5CA 1G7CB 2RT3A 2R7SA 3OLBA 5DLGA 3CCRS 1QM9A 1X5TA 3G6YA 2DY9A 3CJRA 4CTAB 4WE1A 4ZPCA 2Y1RI 1UVNA 3W8PA 1ZM4A 4QIFA 5K14B 1NJIT 2FHKA 3C14A 4PQAA 4LRDA 4M5JA 4H4KA 1HPZB 5AE2A 3C15B 3OFHA 3TUPA 4HHHA 1Q8BA 4YB7A 3MR2A 2ROPA 3LPYA 2D74B 1JLGA 3SFUA 1T05A 2V0NA 4F4ZA 2MKIA 4C8MA 2ZH5A 1FJEB 3EGZA 2RUSA 2UV8A 4Z7CA 3WC0A 1ZTTA 3FSYA 5CAAA 3KNAA 3VGSA 2YH0A 4KGKA 2Z58B 1CJTA 3VAIA 3MMBA 4UOHA 2H3EB 1JB0C 3E51A 3FBBA 3TEHB 5KFLA 4WE1B 4DL3A 3EX7B 2RE1A 5EHHA 5HVGA 1IBKF 3C14B 2JFKA 5HMXA 2HNZA 2C2EA 2VPZB 3UDEA 3QZ7A 2NPIA 1FERA 1U49A 1X5PA 5DG8A 2YXLA 3VHQA 1L3UA 2Q6CA 2Y8WA 1JLGB 1T05B 3NGUA 1PYSB 1B0VA 2K7KA 3RRHA 3RB6A 3MUVP 1D8ZA 4M5NA 2F1FA 1WKKA 5C2CA 3BBFA 3MM8A 1CJTB 2DNKA 2LYVA 2R8KA 3BQ2A 1HNZJ 4DFKA 2YY3A 4FYDA 2UXDJ 2HNZB 5E5NA 4F4KA 1EQMA 3WZ0A 3SV4A 2APOA 3D6MB 4ENOA 1ZS6A 1C4AA 4WPAA 3CUNA 2CZVC 2QE5A 3AT1B 5I3UA 3OFEA 4ZVUB 3TA1A 3K58A 3PYDA 1ZYQA 1S57A 4X4UA 3PXGa 3GILA 3KTQA 1WNEA 1RAOA 2DK2A 4AQYJ 2CZ9A 3BYRA 1JKHA 5LXRA 2EFVA 4PYAA 1GNKA 2NLWA 2VQEF 2OPRA 3PHTA 2LU1A 3MM8B 4CLFA 1YJWS 2HSEB 2IJNA 4HR2A 4Q5VA 4RLEA 5J2NA 3QGIA 2GS8A 4DN9A 4ECWA 4F2RA 3RBZA 2DITA 1DTTA 2MZTA 3VGUA 3R5GA 8AT1B 2R8JA 4GVBA 2V67A 2CPYA 3BSNA 3RRKA 2MZSA 3J7ZT 4C8KA 2JH3A 3MPDA 4OYPA 2CJXB 1T9WA 5I3UB 3CCZA 3A1YG 4N47A 4N41A 2LCWA 2P9EA 3FCHA 4DBQA 3LO3A 4PUOA 3CCQS 1JKHB 1G6BA 1B99A 2PI5A 1X9MA 1FEHA 2VDIA 2RHQB 4QYZK 4NZ0A 2OPRB 1BWVA 1Y4ZB 1EAYC 5GAGI 3QWPA 4LBIA 5F3TA 2IAJA 5J2NB 4RW8A 3PVXA 2HWHA 3D7SB 4L76A 3BPDA 3BO4A 2AEFA 1DTTB 1UKUA 1KBRA 1C4CA 5C2GA 4GVBB 2EBEA 3JS9A 3ZXWA 4F0KA 3BGRA 4HYKA 4IDKA 4CZCA 3VAJA 2RD5C 1YJ9S 4E98A 4NRTA 2HAIA 4C6AA 2HVDA 2OEMA 3JAMY 4QW8A 2R8IA 1FWPA 4LVOP 1IR2A 4H54A 1YI2S 3SQGA 3R3TA 4NX9A 4PUOB 2WOMA 4JBCA 1Q86T 1X4DA 1RAFB 1QE1B 2E5HA 3TOQA 2IC3B 4ZVHA 1VJWA 2KXHA 2IVFB 4U7UD 2GIQA 2IAJB 5HN0A 4RW8B 5B0AA 3CD0A 4P75A 1OYEA 4RUCA 4J9RA 4NZ7A 4FXDA 5GADU 3MCMA 5EX0A 3UCZP 2BJ8A 2HS3A 2HYIB 2CQPA 4YR2A 3D9BA 1VGYA 1PYTA 3OL6A 3Q23A 4PG6A 2E1PA 3C16B 1WG5A 2H1YA 4Y34A 2EXUA 4KPYA 1UZHA 3SQGB 4ZJOA 2QSFA 4NOHA 5F8LA 2PD1A 3QQCD 2ASDA 2WOMB 2MHNA 2K3IA 4NLSA 4IH5A 2EFNA 4CIOA 4DR3F 2GAHC 1RWUA 2BJ7A 2W8KA 4OYXA 1FJGF 1RABB 1QVFR 1NK0A 1FCAA 2UZAA 3N28A 4CQ1A 3UD5A 3RBEA 2KFNA 2VQFF 2Z2LA 2WHOA 2WSFC 4O3RA 2J6SA 2B4PA 1Q81T 2MSTA 1U0SA 5G4DA 2DD8S 1KS2A 2R7UA 3F56A 1DZ5A 4JOUA 4QR1A 2OP5A 2BQ3A 4ANCA 2A1BA 5L46A 1D9FA 3IR5B 4J9UE 3UD3P 2JLGA 1HNXF 2DXDA 1HLWA 4AXIA 5HQMA 1FTRA 2C2ZB 3MGJA 2HZAA 4GC6A 1FDDA 4WP3A 3CB4A 2VZ9A 1IBKJ 3BGLA 2VA2A 2ABYA 4ZN3A 4B9SA 2ILYA 1NZAA 2L41A 3W8GA 4X4OA 4DS5A 4CT8A 5F3ZA 3IWLA 4DU8A 1Z1ZA 1HFEL 4F50A 3FKBA 4IRCA 2B9EA 1BMQB 1S0VA 1P1LA 3NOCA 4TU9A 5DQIA 4DL7A 1ZM2A 3B4DA 3RW6A 3DHXA 1ZZNA 4A8QA 1YG0A 2HHUA 1FRJA 5F0UA 1S99A 2C42A 1GH8A 2AX1A 2NUHA 2AJ0A 4QIVA 2G13A 5KFIA 3NGTA 3N79A 1JLFA 2HBQB 3UWTA 2Q66A 1SKUB 5J1PA 3K57A 2ZOMA 2OD6A 4PEOA 2LA4A 2HFOA 1F1BB 2RQCA 3DLGA 1U1PA 5HBMA 2GAGC 4OV1A 4ZVEA 4RNFA 1IUJA 2XLJA 3I32A 1RWWB 1H98A 1KFDA 3WDOA 4JI7J 4NLOA 4ED4A 4QR2A 5KG0A 3BSAA 4EGLA 4L75A 2HNDA 2CXEA 2DKOB 2OEJA 2VQEJ 1UPMB 2E1CA 4F04B 3ET6A 4ZDNA 3R5BA 3CCVS 1KD1T 3CJ3A 2FJAB 1YJUA 1HL6A 5FLXY 1GXLA 1T03A 2XULA 1JLFB 1X7VA 2VONA 5KFAA 4G3IA 4KGMA 3QJPA 3PIOQ 3EE3A 4P52A 2FHJD 2QLJB 3FVYA 5HBMB 3PW0A 2CFXA 4LREA 1TKXA 2HHWA 2DHSA 4FF3A 4K4SA 3IA0A 1L3TA 5A8KA 2HNDB 4OYAA 1OPZA 1REGX 1S6OA 3TWZA 4ECUA 3ET6B 1BUXA 2JJ4D 2QYGA 1F9HA 1GK8A 4LJMA 2Y0SD 3SCJE 1XMQF 2DNLA 2N3LA 2CKWA 2OFGX 1UEUA 2F9JA 3CD5A 1FRXA 1N32F 2OIHA 2IRYA 2NZCA 1S9FA 1C2PA 2Q3PA 5BYQA 4WFZA 3OR1A 5IT9U 1QLNA 3NP5A 4USVA 2I0XA 1OWXA 1UFLA 4UT4A 3HK2A 1TKXB 3FFIA 4NYPA 3LUYA 3PRDA 2YNHA 2NSBA 5A8KB 4URQU 2YKNB 2YWFA 1GX5A 4NA3A 1HWJA 5KFNA 2CNKB 4XK8C 2H5IB 3ENVA 5HQ8A 2F8HA 2WCXA 4QPXA 2ALZA 4PG8A 3H5UA 4NLXA 3RAXA 2MY7A 1XC9A 4G1PA 2N4CA 1SPBP 2ZH7A 1S6PA 1UW4A 4OZ2A 3D6HB 2F4VF 2JZ5A 1RAGB 4PG5A 3TZWA 3QT7A 3TVYA 3M6VA 2HHQA 2E5LF 1CSJA 2MDAA 2B6AA 3HHLD 3KUEA 5HMZA 4OFZA 2VV5A 1WACA 2BE9B 1YWXA 4M5MA 4O3SA 1KVIA 4OHVA 1YTYA 3FFIB 2YKQA 4J9PA 4EUVA 1EHWA 1V5IB 2YNHB 4ZPTR 3Q2TC 1IVZA 1S72S 3OHAA 4XIUA 2C3MA 3OTBA 3PIPQ 3G8QA 1U8SA 2FB0A 1N0VC 4DR3J 3R27A 1OSDA 1HYSA 4ED7A 1VQ6S 2DEIA 4N8OA 2DPIA 5AXNA 1FJGJ 2DO0A 2MB0B 4DEZA 1TVRA 2Y9HA 2YKPA 3I4PA 2VQFJ 3MR7A 2QO3A 2RDDA 3OVSA 2DRAA 2FC9A 1K44A 3RJMB 2JLFA 2B6AB 4I69A 3TANA 3THTA 1T9TA 1LV5A 1D0EA 3KDOA 5A76A 2FY1A 3DLKA 2UVWA 3RBXA 5K8OA 5G0RB 1HNXJ 3TI0A 2FD2A 1PC5A 1FHTA 2ZWOA 2CG8A 3CJ0A 1L3VA 1H0HB 2VA3A 2LDYA 5EWFA 1HA1A 1HYSB 3Q86A 2FVPA 1TFYA 3QWUA 2V2QA 2L08A 4RWXA 1UWBA 4IG0A 2H4WB 1QSYA 1WSVA 1Y10A 1N8RT 4OX9F 4Y0FA 4DN0A 3ZTOA 5KG1A 4V1Ak 4DQIA 2J9CA 5GAHI 3R1HA 3CCJS 4I67A 2CQCA 2I1RA 4QWEA 3HSJA 2JL9A 2RDIA 4MTPA 3DLKB 2UU9F 2BXJA 5GAEU 2FHJA 3CJQA 4IR1A 1GEHA 1VQPS 1TR0A 3PCOB 1BQNA 3LW5C 5BYRA 1KQFB 4DSFA 3FSIA 4DV1F 4NEYA 4OI0A 2YQ1A 3OTCA 1S59A 5CYQA 1UWBB 4IG0B 1S48A 3W5ZA 1HARA 3OV7A 2IYIA 1F9FA 1R8PA 3C6UA 2DGTA 2C3YA 1KHWA 3AOBA 4WKYA 5LSOA 3RBDA 3DOLA 3HVAA 4NL5A 5CXTA 2MQLA 2F9DA 4LSZB 4ZMMA 4DX6A 1U1OA 1GXUA 3DRXA 1X31C 3FSXA 1H38A 3JYTA 1MW7A 1BQNB 4TLQA 2MZRA 2AEJA 4W90B 4OLPA 2M0GB 1LNQA 3HI9A 1MMNA 5CYQB 2MKKA 2R8HA 2YX7A 1T11A 1R8AA 3JB9k 4USJC 2QMWA 4DQRA 4CI0B 2F5GA 1VRTB 5D4OA 3G2XA 1NO8A 3O44A 3CC4S 3C6UB 5ETMA 2XEXA 5CZVA 1UL3A 3GYGA 3U1MA 3K2YA 5LJ5Y 2WAQD 3DOLB 3P8BB 2N82B 1P9QC 2ZBQA 1TKZA 3ISNC 3I56S 1S6QA 2ZKUA 4QW9A 5DS7A 4NXMF 1PAUB 2BOPA 2JOQA 3W63A 1SJQA 4X2BA 4IR9A 2XBPA 2J7WA 3H25A 5CA5A 3JYTB 4ELVA 4AL7A 3IFEA 5CCLA 3D4JA 1XMQJ 4OX7A 4DUZF 1Y5IB 2CJYB 1RHQB 2D69A 1FKOA 4NWBA 2LECA 3QRPA 3U27A 1SH3A 3R5JB 4PG4A 2QLWA 2A10A 5HJYA 4F0MA 1W2BR 4URGA 4B9UA 1EARA 1TKZB 2NXEA 1S6QB 4IFVA 3ZZYA 3JTNA 3ZZRA 2FQQB 4QPTA 1CJKA 3DOKA 2NXNA 1Q16B 3RAQA 1RA6A 4ID8A 1SQEA 3JSYA 4UUXA 3HHLB 2W9AA 4QWDA 3HVRA 1YDLA 2B7BB 3K5OA 2Y3YA 1KNZA 5E3CA 1PC4A 2HWTA 3C3LA 4FYVB 3MD1A 2VFSA 3PRVA 4Y6IA 2DHGA 3RRGA 1FKOB 1R0AA 5F9NA 3KFWX 3H4DA 2A6MA 1HWIA 3HKZD 4LFAF 3LANA 2E5LJ 3A8IA 4G1QA 2WK4A 1WELA 3M4XA 2R7RA 5L1JA 1FNMA 2RQ4A 4IFVB 5L9XA 4NLGA 3AFGA 1CJKB 3W5XA 3DOKB 4PPZA 1OY8A 1FE0A 3F73A 3PDNA 2LEAA 2FJWA 1N52B 1NMEB 4CWBA 1WJ9A 1J2VA 1T0TV 2GW8A 3PM9A 4QBUA 1XMOF 4AL6A 5LM7E 3Q22A 3MEKA 3R8YA 3SCKE 1WUUA 4IQMA 4O3OA 4NCAA 2O67A 1R0AB 2BOAA 3LWMA 3BGUA 4OZ1A 1G4CA 5D0EA 2BMBA 4LR9A 3MMCA 1O5JA 4G1QB 1VBYA 2CWXA 3IM8A 2VPWB 4R0JA 2VL1A 4BBYA 3OUYA 3ZZUA 4WFBQ 2R2UA 4YHHF 5D77A 3MAQA 5JMNA 1YJ7A 3I9ZA 2RU9A 5J1NA 2XNQA 3W61A 1RCOB 1RAJA 5D6GA 2JHEA 2O3DA 3H40A 3VQSA 3KUHA 1KFSA 4A4JA 3N6NA 2G4BA 2R42A 2B9XA 1S1VA 4ED5A 1PYOB 4CLLA 4O0IA 3BKTA 2BUNA 5AE1A 4OX9J 1HNVA 1A0OB 1FD2A 3CO0P 1YBUA 1RU1A 1GT8A 4HACA 4JI2J 4YFUA 1AFIA 1Q53A 3KJQB 3MMCB 2VFRA 3WC2A 3SI8A 1WDDA 1C1BA 3OUYB 2XMKA 2KB2A 1RBLA 1TL1A 1DQ9A 4HDHA 5HLFB 2UU9J 1IKWA 1HBUA 2J6TA 2OO4A 3HFZB 1NHUA 4FDFA 4F8RA 4CLZA 1VQKS 4CO4A 2Z30B 2PSZA 2LDIA 4DV1J 1KDNA 2ZZTA 1RWVB 2KJWA 3NBPB 3Q8SB 2VIHA 2F7VA 2HURA 1YGYA 2UVRA 1S1VB 1RTJA 1N4LA 3GE9A 2ZVSA 2HG4A 3KLFA 2N4DA 2HFSA 3DM2A 1HNVB 4RNNA 2XLKA 1WORA 1B70B 2ALYB 4HACB 4QYRA 4DPOA 5LSRA 1C1BB 3A8JA 3KJFB 1RHJB 3IR6B 1TL1B 4ID5A 1M0SA 3MECA 1PIEA 3N01A 4USTA 1JJ2R 3GQCA 3FEZA 1HBUB 1Z4UA 4HH1A 3T1HF 1U25A 1URRA 3UN3A 7FDRA 1LK5A 1QUPA 5JUMA 4U95A 3MI7X 1FXRA 1ROFA 4CDIA 3C2PA 2MEWA 2P2CB 3BS9A 3IGVA 2KKHA 3RGIA 4OV6A 5B0CA 4PCQA 3RUBL 2QA4S 3QBCA 3MM5A 1LXJA 3D1OA 2YTCA 1WKLA 4NMXA 3V6DA 2VFTA 2F8EX 2VJUA 5ITHA 5HVHA 4Q8EA 1RTJB 1S4EA 4FKXA 9ATCB 1U1KA 3DM2B 2FZGB 4RL1A 2NPFA 2SXLA 2XNRA 1FDAA 1PKUA 5C5JA 1I5OB 5KG5A 2BJDA 4JV5F 1D8YA 1NU4A 5DJBA 2ZUGA 1FA0A 4ZS6A 1U6FA 2LEPA 1HBNA 4ID5B 4NXMJ 4RPFA 3MECB 3CDEA 4U8VA 4DV0F 2P8IA 1R43A 4KY3A 2AYGA 5KFDA 1SKWA 3F41A 5KOXA 1WKJA 3PW2A 5F0WA 2OAUA 3TUIC 2B4UA 4DUZJ 2ZEJA 1HI8A 3MM5B 1F9EB 5CD4A 3TX8A 4DSLA 3V6DB 4NLDA 3UCUP 1YHQS 2BEFA 3EZOA 5DRKA 1C0TA 3VAMA 4EO6A 3QLHA 1S9EA 3TUJC 2IHR1 4IRDA 1UW9A 4ZVPB 4WK1A 4FBTA 2ZZMA 3J7YU 4FYXB 1AFJA 2JLEA 1JK9B 1KSPA 3O3LA 4ICLA 1HBNB 4BHQA 4QU7A 1KEKA 2ZOGA 2WVCA 4FF2A 2ZJPQ 3PX6A 2DNOA 3TQ1A 2N7YA 2KYZA 3BKUA 3L09A 1NK6A 2DR5A 2MKSA 2FJEB 4FYWB 2VBZA 4ZPWR 4O3QA 2VKZG 3DHWC 2E44A 3D2WA 3Q8YA 4FF1A 1TMMA 5H9EJ 1IN0A 2F63A 3GV7B 2EWHA 2G0JA 1C0TB 1V3ZA 4LFAJ 1U7LA 1YQHA 3QLHB 2RRBA 1S9EB 5KTQA 3ISND 4FVMA 2ZOFA 1OY6A 1NH7A 3W9JA 3NLCA 4ED0A 1S4FA 1Y00A 1GMUA 1KN6A 3A3PB 4ICLB 2GFFA 1RTIA 3J7AN 2HQCA 4R25A 2W2MP 4DR1F 3NNCA 4P2XA 2PA8D 3BM7A 2NZ4A 3DC2A 3QSYB 2YKMA 3EICA 1XMOJ 2MQPA 1ITPA 4Q0BA 4PQUB 1RT4A 2J8AA 2WSEC 4WCEQ 2R7VA 2C22A 3AD9C 1NDPA 2KHCA 2ZH3A 2GJIA 3MWBA 5LJ3Y 2QTWA 3SCIE 4ILMA 2LXFA 1PJ6A 1TKDA 4YHHJ 2MSSA 3MCNA 4KV8B 1J5OA 4O3NA 8RUCA 2J76E 1ICEB 3GIRA 2XLIA 2LEBA 5L1IA 3TAPA 1RTIB 4U96A 1N5VA 2C1EB 4Q2LA 3GG1A 4L3KA 4LF5F 4DCJB 3JSMA 2YKMB 2I8EA 1B0PA 4ERDA 1RZMA 3K7RA 3LGHA 4Q0BB 3BJYA 3B82A 2PMHA 1Y11A 1VS3A 1RT4B 3QGGA 1WWHA 2CG4A 3GSIA 2M88A 4F4WA 1E6YA 2XZDB 3OBIA 3D67A 3MDFA 2LKZA 2AGQA 2ZH2A 4P73A 2CPFA 2GQCA 1S76D 2EEYA 4V19J 3ENAA 3PYEA 1WOPA 2W4CA 1ZPVA 1MG7A 4LRAA 3MCOA 2HZVA 1T7PA 3G8SA 1XTZA 4IRKA 3JSMB 3T3FA 1SL1A 1VK3A 2QLXA 3CMQA 1M5PC 2RVJA 2BJ3A 2GIRA 2I2YA 2AJ4A 4Y2IA 4MJKA 4CO2A 1VJQA 3H2UB 5U47A 4WTYA 3THPA 1IWGA 1E6YB 2NYIA 4C9DA 5B7WA 4I7FA 2D3OR 2Q79A 2CJAA 1CBKA 2MZ1A 2FTRA 2FZCB 4LF6F 1FEEA 4XTTA 4TLRA 1CJVA 3IWNC 2HQIA 1S12A 3T1HJ 1FRHA 2CWKA 5HATA 5GAEI 2PEBA 3EVWA 5AXKA 2FVSA 2UXBF 2XM3A 1VLYA 1UETA 4KJIA 4K4UA 3OL7A 2NSCA 1S0NA 1HQ2A 1XIQA 2E1RA 2I5JA 4BWJA 4PWWA 1R0BG 4B08A 1Q5YA 3U7JA 4F26A 3TZXA 1YJTA 2B3TB 2DTJA 4ZLJA 4ZPBA 1VQYA 1X5SA 2MJNA 4I7FB 3PR5B 4JV5J 2CJBA 2EW9A 3AAWB 3UE2A 3L9ZA 1ZAWA 4USMA 4MT1A 3KKFA 1BGXT 1VYAA 2XZWA 1CJVB 4DG1A 3HVWA 4DV0J 4KO0A 1EETA 4B9LA 4ZP9A 2HHSA 3I9V9 4ZVGA 1DHMA 1RHRB 5KFSA 2HQDA 3VZHA 2DJWA 2E9ZA 2AYEA 2I5JB 1FNOA 1Y3KA 3NRBA 1KRPA 4RBVA 2WVEA 2B4VA 1RT7A 2BANA 3QO9A 2KXFA 1AB8A 4YUDA 5F41A 1IKXA 4U7CA 3VVTA 1LQ9A 4MKVA 1U0HA 4K59A 2MTLA 4X4NA 1Y5LB 3KJVA 4OI1A 3CJ8A 2CQIA 2P5VA 3S1TA 1U6BA 3EJMA 3D0IE 2QMXA 4DG1B 4DSKA 4IYQA 4KO0B 3MPYA 3CNQP 4OL8A 1EETB 2MHEA 3T9NA 2VPXB 2KZMA 1OMSA 2YNGA 2UUCF 3ENWA 4JV1A 2X3DA 4G6VB 1WG4A 3QMQA 4RKUC 3MMJA 4TYBA 2ZH6A 2YBVA 2QT7A 3KNGA 5ETVA 4EBDA 1IBMF 1RT7B 2BANB 3QO9B 3SIPB 1NDCA 3VR1A 1SQFA 2ASLA 4DZDA 5E3QA 5F8IA 1IKXB 3HDSA 2OUGA 2HRUA 5KOWA 3M8PA 4I2QA 4KRWA 4ZVFA 3KJVB 4L72B 1VFJA 1W26A 2CVEA 1JJCB 2MGZA 1DLOA 2DR9A 5K8NA 3KYLA 1OJ4A 2CPIA 4IKAA 2H5JB 2XS7A 1RYSA 1U6ZA 3EWGA 4DR1J 2HHTA 5ETLA 2IA6A 2UUBJ 2RRNA 2YNGB 1CLFA 3T41A 4KIAA 3OFFA 1BD6A 2IJRA 2ZD1A 4JI1F 1RHUB 1QD1A 1X5OA 4QIEA 3MMAB 5IM0A 1R31A 4LSLB 2XGPA 2VICA 3OXLA 1F3VA 3C6TA 3GJRB 1RKJA 3M8PB 4I2QB 4C97A 3DLBA 3AODA 3PFOA 2G9OA 2ZUAA 1NRKA 2ZHOA 5DQGA 1LWFA 1NHKL 3MHYA 3IGNA 1P8GA 3M8YA 4YDXA 2MGZB 1DLOB 3CPWR 4ED1A 2RS2A 3VALA 1FF2A 2DEJA 3NS6A 2P9GA 3AQOA 2HHPA 3DDIA 5KFYA 4HEA9 2AP6A 4WU3A 1AXQA 5KFKA 4LF5J 4EYIB 1CPZA 1SI9A 1RT3A 2X51A 3M8ZA 3JQMA 2B9WA 3BPSP 2ZD1B 3HD1A 1QSLA 3LA0A 3JQJA 5KFVA 1WC0A 3J80U 5IM0B 4EO8A 1WOOA 5ETNA 1CULA 1PSDA 1X4GA 1Q5VA 2HMIA 1Q95G 3CW2C 1LWXA 1FFWB 3NGSA 1NZ8A 4AT1B 2B7CB 2R2SA 4CH1A 3PG9A 1JLCA 3NGKA 1LWFB 4ETXA 3HO1A 2AZ1A 2X1FA 4KB7A 1SL2A 3GP9A 4JI3F 2HHXA 4MK8A 1S6UA 4Y2CA 5KFQA 3GPAA 1MWZA 4XPEA 5IS2A 1SC1B 3G87A 2QMUB 3NAHA 3LOUA 3CC7S 4PABA 1P27B 4L73A 4C4WA 1LK7A 4WKRA 2HRTA 4MKYA 1X8DA 1IWAA 2D1CA 3MF5A 4AXJA 3PW5A 1TU0B 1CULB 1CG2A 2W7OA 2GMJA 3D6TB 4WFNQ 3RW7A 3Q8VA 1U1NA 2HMIB 1YRXA 1S1XA 1VQ5S 4K2XA 2DO4A 3W3SA 4LF6J 2VB6A 1JLCB 3KLIA 2GMLA 2Y0BB 3QRRA 3DGVA 2MQOA 4PKDB 2CVIA 3CCES 1FX2A 1GX6A 1PJ7A 4A8WA 3M6UA 3IAS9 4ZJLA 4CLTA 1DJ0A 1HHTP 2J9EA 1Q82T 1RTDA 3G8TA 3EGVA 1S79A 4Q44A 2R2TA 2L9NA 4MIBA 3WQPA 2M8HA 1MU2B 4USWA 4U67Q 3GV8B 4R5PA 3X3UA 2AT1B 4K5SA 4UOCA 3J7A1 3DDNA 1XR5A 3OD2A 1T9VA 1K8AT 1S1XB 3SSRA 5IQ6A 3GU0A 2HVHA 3KLIB 2DR7A 1HQEB 1BQXA 3PFEA 3N5FA 4HDGA 3CF5Q 5KFJA 2R2RA 1M5VC 3M2VA 4M5DA 3EXCX 4K50A 3EUNA 5A0YA 2QC3A 4KTQA 1WHVA 1WSRA 2DRBA 4A8SA 2WVDA 1RHMB 2H4YB 1RTDB 3MAAB 3KK2A 3QAUA 4XPCA 2J7UA 2V69A 4DL4A 4LF1A 1X4EA 4PWUA 4KFBA 2FHOB 4X4PA 4EU0A 2I6WA 4R5PB 1K0TA 2EPIA 2O01C 5CYMA 1RU2A 3I5CA 3TZZA 3J7Z5 3HHNB 2XHWA 3FBEA 3DFEA 1KWMA 4KH0B 4C8LA 1XNRF 2WRMA
chains in the Genus database with same CATH topology
1V5IB 1SCJB 2Z2ZA 4YN3B 2Z56B 3BGOP 2W2OP 2W2QP 3CNQP 3CO0P 4K8RA 2PMWA 4NMXA 3VV2B 2ZWOA 1SPBP 1ITPA 2W2NP 3WHIA 3P5BP 3T41A 1R6VA 3AFGA 4JP8A 2QTWA 2W2PP 2Z57B 2Z2YB 3A3NB 4NE9C 3VHQA 2Z30B 2ZWPA 3A3PB 3SQOP 2E1PA 4OV6A 2Z58B 3BPSP 2W2MP 2XTJP 3GCXP 3WIUA 3H42A 3GCWP 3QFHA 3A3OB 3WIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V5I B;  1SCJ B;  2Z2Z A;  4YN3 B;  2Z56 B;  3BGO P;  2W2O P;  2W2Q P;  3CNQ P;  3CO0 P;  4K8R A;  2PMW A;  4NMX A;  3VV2 B;  2ZWO A;  1SPB P;  1ITP A;  2W2N P;  3WHI A;  3P5B P;  3T41 A;  1R6V A;  3AFG A;  4JP8 A;  2QTW A;  2W2P P;  2Z57 B;  2Z2Y B;  3A3N B;  4NE9 C;  3VHQ A;  2Z30 B;  2ZWP A;  3A3P B;  3SQO P;  2E1P A;  4OV6 A;  2Z58 B;  3BPS P;  2W2M P;  2XTJ P;  3GCX P;  3WIU A;  3H42 A;  3GCW P;  3QFH A;  3A3O B;  3WIV A; 
#chains in the Genus database with same CATH topology
 2P9C A;  3M2V B;  3MUM P;  5IWA F;  5JVH Q;  2UUC J;  5A0Y B;  4N5S A;  3I6P A;  5KFF A;  2DXF A;  3QGH A;  3CJT A;  4FN5 A;  3D1Q A;  1D1U A;  3HD2 A;  4EBE A;  4HHJ A;  2KM8 B;  2ZKT A;  3G6V A;  3KK2 B;  1IBM J;  4FF4 A;  4DPY A;  4EMD A;  5DET A;  4OYI A;  3LP2 B;  3Q0A A;  3UN5 A;  3BRE A;  4KFB B;  2M7S A;  4UF4 A;  4Q8F A;  3FEY B;  5EWE A;  5ADZ A;  2L9D A;  1S7I A;  5CYM B;  1VQ9 S;  4DSI A;  1NPR A;  3ZFV A;  2X1G A;  3CT9 A;  3J7Y I;  3MEG B;  3HT0 A;  3VCD A;  5EGY A;  1DAX A;  3U02 A;  1Q7Y T;  1TP7 A;  1KQK A;  4PWD A;  2IBO A;  3OTE A;  3H5X A;  4F25 A;  4USI A;  1HMV A;  1UJ6 A;  4H4O A;  4N56 A;  2A6O A;  3UPF A;  1GTE A;  1TL5 A;  3PR4 A;  4I64 A;  4C8Y A;  3ZZT A;  3PY8 A;  2G2O A;  2GVZ A;  4NA2 A;  4UW2 A;  5DDP C;  3HT3 A;  1S1T A;  3N0V A;  2HHH F;  1U1M A;  4JI1 J;  1NSQ A;  2KHD A;  1XN9 A;  1NUE A;  2AZ3 A;  2HBZ B;  1NSK L;  1IR1 A;  3PW7 A;  2DHA A;  1XR7 A;  3OXF A;  3PX4 A;  1JX4 A;  1I94 F;  2HGN A;  2OGU A;  3H42 A;  3ZZ0 A;  1NK7 A;  3H0P A;  1T9Y A;  3KXD A;  3NXZ A;  3AH6 A;  2OSR A;  1R3N A;  1S97 A;  4PWD B;  5EDW A;  1ELO A;  5HI7 A;  1FDN A;  2F8M A;  1GXT A;  3J81 j;  2IDE A;  2CRL A;  4KSE B;  5DLF A;  1NK8 A;  1H74 A;  1HMV B;  4H4O B;  2VFU A;  4K0K F;  5M2P A;  2MXY A;  3D0G E;  2XMM A;  2GVZ B;  1FNX H;  2CUY A;  1S1T B;  2X7I A;  4DPT A;  3WIV A;  5A6P A;  5JJB A;  2K1R B;  1NXI A;  4DV2 F;  5KFM A;  3OVB A;  3ZTQ A;  3PZP A;  4RJV A;  2DNM A;  4CO3 A;  4QOT A;  2JVO A;  5K9F A;  1WC1 A;  2JWN A;  1IJF B;  1K0V A;  2GX8 A;  4YS2 A;  2LLZ A;  1RCX B;  1RSC A;  4QWA A;  1QTN B;  4OI2 A;  4DFM A;  3MM6 A;  1VRU A;  3DRR A;  3K8V A;  4O3P A;  2BAB A;  4WFX A;  2XQC A;  2HGL A;  2KVQ E;  4JI3 J;  2A3J A;  2CQ0 A;  1Q7L B;  5GAH U;  4EFA C;  2FLN A;  2CQH A;  3LTO A;  1TV6 A;  5H1S V;  4P2M A;  4DSE A;  3ZNJ 1;  5MLC V;  1XER A;  5I42 A;  2FDN A;  2V6A A;  4WII A;  3AD8 C;  4QCL A;  4M5G A;  4A8K A;  3CJ5 A;  2NCK L;  4I1T A;  4BC7 A;  2FVR A;  2JC1 A;  3W1Y C;  3AOA A;  1RAI B;  1RTZ A;  1UZD A;  2P6S A;  3TJA A;  4E0D A;  5E0O A;  3MM6 B;  1VRU B;  3DRR B;  3OLA A;  1NAQ A;  3CDA A;  3GSD A;  4FKY A;  3WX4 A;  2CAJ A;  2LVW A;  1REV A;  2BE7 D;  1RXO B;  1FRI A;  1VIX A;  1LW0 A;  3S8S A;  2LFV A;  4EEY A;  3G6E S;  1TV6 B;  5M2U A;  1HW9 A;  3TX0 A;  4DR5 F;  2DGS A;  5FII A;  3AA8 A;  2AJ2 A;  4M5H A;  4ECQ A;  5F9L A;  3GFH A;  5I42 B;  2ZBR A;  4NLY A;  2QEX S;  4WZQ A;  3WIU A;  2HBY B;  4HT7 A;  3OVA A;  3EGW B;  1T94 A;  4F3O A;  6AT1 B;  1HNI A;  3HM9 A;  3T5L A;  3IXQ A;  3OXG A;  1NLK L;  1UCN A;  1XBW A;  5LXY A;  2B8P A;  3DMJ A;  3BH6 B;  3R7B B;  1REV B;  1S9G A;  3ICL A;  4DQS A;  2BRK A;  3DLJ A;  1JXE A;  1LW0 B;  2DBB A;  4X4T A;  2BVZ A;  4P7T A;  2CPH A;  4OYZ A;  1YX2 A;  1U26 A;  4C2M A;  4K4Y A;  4AUK A;  3TNV A;  1WEY A;  2NXU A;  4Q2M A;  3P5B P;  1FVQ A;  4K5R A;  4KE5 A;  1NJX A;  4NYO A;  3BDE A;  3JTO A;  3I5A A;  1X0P A;  5KT4 A;  4DSJ A;  2VOP A;  2E29 A;  1HNI B;  3CME S;  1WI8 A;  1QTM A;  4P71 A;  2JEF A;  3M9M B;  2HFN A;  3MFH A;  3GII A;  1XNR J;  1XJW B;  3DMJ B;  1LOU A;  2VG7 A;  4GO5 X;  2HIY A;  4JB8 B;  1S9G B;  5IWA J;  5F8J A;  3ZC4 A;  3SEO A;  3QT6 A;  1EQ0 A;  5D3G A;  2AJ1 A;  1KP6 A;  1TAU A;  3IS9 A;  3HHL C;  5HSP A;  2XSF A;  3LWL A;  4TKT A;  5LL6 d;  3M32 A;  1FRK A;  2E1A A;  4ZCM A;  3B54 A;  5IV4 A;  3PJW A;  4IOB A;  1YBT A;  5B0E A;  1QE1 A;  4ES3 A;  2KFZ A;  1MN9 A;  4OZ5 A;  3ZO7 A;  4ZJQ A;  2IC3 A;  1VQN S;  1M5H A;  5F8G A;  2OPS A;  4J9N A;  1JLB A;  1PIL A;  2U1A A;  1PBU A;  3A8E A;  3M2U A;  1CC8 A;  3LAM A;  3V2U C;  1JLE B;  4ZP6 A;  2W4D A;  2J8S A;  5EX3 A;  3A8K A;  1VC5 A;  2VG7 B;  1LWC A;  1F5A A;  1V3R A;  2QRR A;  2F3J A;  2GNK A;  5D3G B;  4EZ9 A;  3C16 A;  4YB6 A;  4K4V A;  2EFG A;  1JLQ A;  1TTH B;  3IS9 B;  4ED2 A;  2HHH J;  1XR6 A;  3M32 B;  3M2R A;  4I4B A;  2V34 A;  1S77 D;  1IJE B;  2YNF A;  1RAE B;  3AXM A;  3UDL A;  4A47 A;  4WWS A;  1IQZ A;  4L3N A;  1I94 J;  2NXC A;  3W64 A;  2EG1 A;  3T1Y F;  2OPS B;  3KDN A;  1JLB B;  3FRY A;  3PAC A;  1MWQ A;  1UWA A;  1U24 A;  4C0O C;  3E2E A;  1NSA A;  3M2U B;  2W01 A;  4Q45 A;  3B8H A;  2GO9 A;  4FBU A;  3JTP A;  1LWC B;  1WDT A;  3C19 A;  2BKO A;  2CJK A;  2RML A;  1FFG B;  1ULR A;  4K0K J;  2KU7 A;  2HFU A;  4B9N A;  1JQG A;  1AA1 B;  3GTY X;  4J9S A;  5ETO A;  1TKT A;  2C3U A;  5KFC A;  1JLQ B;  4B02 A;  3M2R B;  2HPU A;  4DV2 J;  1YRU A;  2YNF B;  2GC8 A;  4ELU A;  3S6E A;  2V8H A;  4ATN A;  2ASJ A;  4LF4 F;  4DXL A;  3O2I A;  1ZAX A;  4YME A;  4OLO A;  4ITS A;  3DYA A;  1N0U A;  5L9N A;  1EB0 A;  5KFP A;  4CO0 A;  4P74 A;  4KYZ A;  4URS A;  1RAA B;  2F4F A;  3P4U B;  1FES A;  3A3O B;  4NLR A;  1SCJ B;  4RX6 A;  9RUB A;  4TXS A;  3ZZO A;  1Y3J A;  1MWY A;  2QV6 A;  3PJ9 A;  4DWI A;  5E41 A;  1MN7 A;  2MYF A;  2YNI A;  4QQB A;  2PEH A;  1P9Y A;  5AT1 B;  2B51 A;  2XMW A;  1TKT B;  5JXS A;  3IP0 A;  4RNM A;  4Z2X A;  2CNL B;  2VG5 A;  5LMU F;  2CQ4 A;  4NI2 A;  2W1B A;  1YJN S;  3EPG A;  2J9D E;  2Z2Y B;  3NEK A;  4LSN A;  4MK7 A;  4DV7 F;  4OZN A;  3EXY A;  3M30 A;  3DYA B;  5HRO A;  4B9M A;  3CSK A;  1JNZ B;  2CQ3 A;  3QSI A;  1YZ6 A;  4LRC A;  2YQ0 A;  2DHH A;  4GO7 X;  4IQX A;  5L38 A;  1PAE X;  3DU5 A;  2C2R A;  1UJ5 A;  3SMZ A;  4NXN F;  3J80 Y;  5J2P A;  3K5P A;  1F3F A;  3VAH A;  2YNI B;  1YVF A;  3KLE A;  4DR5 J;  5AJ3 F;  1RAD B;  1AT1 B;  2IVY A;  2OH2 A;  4Z37 A;  2XI3 A;  1LKZ A;  4KKO A;  2R7Q A;  1EJ7 L;  3PEJ A;  4JYA F;  4CNZ A;  3R6G B;  1WC4 A;  2VG5 B;  1S1W A;  4NI2 B;  2GQ2 A;  4N77 A;  1F6T A;  1U1Q A;  4ZHR A;  3SDE A;  3C46 A;  2E7V A;  4LSN B;  4PXC A;  2R7W A;  3GB0 A;  3O6Q A;  3M30 B;  1J27 A;  3OR2 A;  2NXJ A;  2RSQ A;  3TP2 A;  5HRO B;  4C3K A;  6FDR A;  4LVN P;  4M1K A;  3W2W A;  5DDO C;  4Y00 A;  2R7O A;  3UW1 A;  2L48 A;  2E9T A;  4JI6 F;  3RG6 A;  1LFW A;  3TA2 A;  4F7V A;  5LMN F;  3HJV A;  5J2P B;  1AUS L;  3KLE B;  2HQ3 A;  1KON A;  1R89 A;  2D3U A;  2BX6 A;  2HLT A;  4JP8 A;  1ZET A;  3W9H A;  2ZH1 A;  3FGV A;  4KKO B;  4DL0 C;  4X4Q A;  5K8M A;  1W7W A;  1YLX A;  1S1W B;  1YSJ A;  5E3A A;  3VZI A;  4ZHR B;  3IMQ J;  3SDE B;  2QL9 B;  3ZZP A;  2NR0 A;  4JUZ A;  2FIU A;  3Q8Q B;  1KKH A;  2G1H A;  1X0F A;  3I82 A;  3OR2 B;  2XB2 D;  2B4O A;  4DL5 A;  3W2W B;  2OD4 A;  2DYA A;  1M5S A;  4ZPA A;  1HHQ A;  3I31 A;  1VC6 A;  2HVZ A;  2U2F A;  3M8S A;  2AJF E;  2HQG A;  2G0I A;  1R0C B;  3HFK A;  4DL2 A;  2ZH4 A;  3CDB A;  3TAM A;  3AJ1 A;  4PYD A;  2Z8Q A;  2YKN A;  2PI4 A;  1X4A A;  3CE8 A;  2OI2 A;  2GHP A;  4ZCI A;  3MEE A;  1B0T A;  1UFK A;  2EVZ A;  3LQV A;  2WB1 D;  2RJZ A;  2GCF A;  3CCT A;  2A2D A;  1KTQ A;  3UFC X;  5IFM A;  2DNH A;  1YIJ S;  2A2C A;  1SUQ A;  3TAQ A;  2GHV C;  3GON A;  3EM1 A;  3P3D A;  5D78 A;  2R7T A;  3NCP A;  2KH9 A;  2YX4 A;  3SZ2 A;  3VGV A;  1FRM A;  3N6M A;  5L39 A;  4J9V A;  3OL9 A;  1U02 A;  3MFI A;  3Q24 A;  3CCL S;  4DX7 A;  2DVI A;  3HZE A;  2V2V A;  4Q7A A;  2MZQ A;  1DQ8 A;  2Z4P A;  3GCW P;  2VDH A;  3D6F B;  2QX0 A;  1WEZ A;  3H5Y A;  2VH7 A;  4F02 A;  2E5J A;  3TAM B;  4RW9 A;  4IH7 A;  3R6L B;  3THV A;  2MPU A;  4YB5 A;  4B17 A;  2ZM6 F;  3V6J A;  1NBE B;  2VJV A;  3MEE B;  3CDW A;  3BGO P;  3T1Y J;  4ZVO B;  2PN6 A;  1BE4 A;  3MR5 A;  5T14 A;  2YPZ A;  2ADC A;  2Y1L B;  1SUQ B;  1EKR A;  3IM9 A;  4C48 A;  1Y7P A;  5DM6 Q;  3KMS A;  2GJF A;  3MTJ A;  3NL0 A;  5KT7 A;  2XS5 A;  2QL7 B;  3LP0 B;  2BR0 A;  1FK9 A;  3MTK A;  3MR6 A;  2ZDO A;  3M8W A;  2CYY A;  4KAI A;  5BXI A;  3ZTP A;  5G0R A;  1RI7 A;  3L7P A;  1UVJ A;  3IC1 A;  1U1L A;  4DF4 A;  1QY7 A;  4OJG A;  4RW9 B;  5J2Q A;  3BR9 A;  2HQF A;  4Q43 A;  4LF4 J;  3T6B A;  1D9D A;  4KC5 A;  2MKJ A;  4YQW A;  2XGQ A;  3CC2 S;  4AYB D;  3UCG A;  4UTG A;  3CJK A;  2QIF A;  2K2P A;  1SV5 A;  4FPR A;  2V2K A;  4WJB A;  3SQO P;  1SKR A;  3NG8 A;  2D9P A;  1HQU A;  4HVZ A;  3UR3 C;  3BN7 A;  5DO2 A;  4ZK7 M;  1FK9 B;  2XYG B;  3ILJ A;  5DG9 A;  2CAD A;  4RW6 A;  5KG7 A;  1FFS B;  1CEZ A;  1KC8 T;  3NWG A;  5C24 A;  4X84 A;  1I1G A;  4CCH A;  1QJH A;  2DH9 A;  2V63 A;  1AUD A;  5LMU J;  4B9V A;  3TEG A;  5J2Q B;  3P96 A;  4PPD A;  1RK8 A;  5EUH A;  4ECZ A;  1H6K X;  1RDR A;  4GKK F;  1F5C A;  2ZDP A;  4DV7 J;  3QT8 A;  3C8Y A;  5C7P A;  3TVZ A;  3BZQ A;  4WTO B;  3IWX A;  4IG3 A;  4RU9 A;  3CJK B;  3WHI A;  1SV5 B;  2PT0 A;  1KQS R;  2IVM A;  1N34 F;  1OS5 A;  4WP9 A;  2WVB A;  1SQG A;  2FVQ A;  3W65 A;  4KR0 B;  1HQU B;  1WC3 A;  5MAO A;  1HKA A;  3QAT A;  4NXN J;  1NK4 A;  3IAM 9;  3L95 X;  1VBX A;  4RW6 B;  2KT3 A;  1QVG R;  1VIO A;  1QSS A;  3D0H E;  3KOA A;  1B7F A;  1RWO B;  2V5H G;  4R8U A;  5C24 B;  4JYA J;  1EX8 A;  4DLG A;  2BJ9 A;  3T5J A;  1Q8L A;  5HQL A;  4J37 A;  1Y9O A;  4ZCK A;  5KG2 A;  1LWE A;  1SJ1 A;  2OTL S;  3FCV A;  4LF8 F;  1Z2Z A;  3KHR A;  1EIY B;  3GFZ A;  2AMC B;  1IBL F;  2H65 B;  2HVE A;  2HK2 A;  4IG3 B;  2CPJ A;  3DRP B;  1VRT A;  3CIM A;  2B8Q A;  2GVD A;  3CCU S;  1KTV A;  2ZH8 A;  3DU6 A;  4JI6 J;  3A12 A;  2WBR A;  1T9U A;  1IBC B;  3LH2 S;  5HMY A;  3NY0 A;  5LMN J;  3OSN A;  3GYN A;  3GWC A;  4U9R A;  4U6P A;  3G9C A;  4PG7 A;  4WIQ A;  4DR4 F;  4HT5 A;  2RIL A;  1U2F A;  2XO7 A;  1FWK A;  3RB4 A;  4R8U B;  2V4R A;  2POK A;  3EZU A;  5DZ7 A;  2BKP A;  3G6X A;  2HS4 A;  4TQS A;  4DUT A;  3JSR A;  1LWE B;  2Q43 A;  3MM9 B;  3HHD A;  3DRS A;  5IT0 A;  2MLX A;  2DNR A;  2WVF A;  3C66 A;  2RRA A;  3RU0 A;  2DNZ A;  3GJQ B;  2H54 B;  1YJV A;  4CH7 A;  4DZ6 A;  2HAF A;  2QLB B;  1B64 A;  2GVD B;  4CLW A;  3TYT A;  5ETS A;  2X3G A;  3BKF A;  5GMK a;  2VBX A;  4I6Y A;  3KLH A;  1VMB A;  2KRB A;  3BV8 A;  5L8R C;  2CQ2 A;  3NNH A;  2BJE A;  2GV1 A;  2KDO A;  3M9N B;  2R4F A;  5CH7 B;  4YR0 A;  4ETZ A;  2HZC A;  4AFF A;  2AV5 A;  4ECY A;  2QFI A;  3HHL A;  1RTH A;  4ZOS A;  3H98 A;  1WTF A;  2K7J A;  4NLQ A;  2GHW A;  4K4Z A;  3NMA A;  4DV6 F;  3HCX A;  3H2L A;  1N32 J;  3DRS B;  4QWB A;  5K8P A;  3ITH A;  3ZZZ A;  2NRE A;  3W62 A;  2R8G A;  2BW7 A;  1ZBT A;  3HLU A;  4UUW A;  1F2H A;  1H73 A;  5SUH A;  5EN1 A;  3CED A;  4X4S A;  5KG3 A;  4C8N A;  4CLU A;  1RLC L;  4I68 A;  4CRJ A;  2V4J A;  3OL8 A;  5IOL A;  2ZJQ Q;  2FZK B;  3MMB B;  2BRL A;  5I4M A;  2E5G A;  3KLH B;  1N33 F;  3CJ4 A;  2HLU A;  2ROG A;  2VOO A;  2ZM6 J;  3VAG A;  2M3D A;  2BAC A;  5D8H B;  2ATC B;  5F8H A;  1UP1 A;  1N5Y A;  1RTH B;  1OPI A;  4PXB A;  3UNY A;  5IQQ A;  4BDP A;  1RAC B;  2KL8 A;  1U09 A;  2F4V J;  4DDF A;  4IH6 A;  1R8H A;  5A8W A;  2G2Z A;  3ITH B;  1W25 A;  2IM1 A;  1Q8K A;  2B0G A;  1M1H A;  4LRF A;  2OHD A;  1GAO A;  4QIW D;  4OZJ A;  3PEH A;  3QZ8 A;  4YN3 B;  5F8M A;  3AB4 B;  4JI7 F;  3KLG A;  1XNQ F;  3K59 A;  3UR0 A;  4IO9 Q;  1HR0 F;  3ELH A;  5K5M A;  1RUS A;  2V4J B;  1Q4R A;  3FRZ A;  3DRY A;  2FJD B;  2IM3 A;  4RUH A;  5L1L A;  4H4M A;  1HW8 A;  1M1G A;  4K4T A;  1OY9 A;  3BN4 A;  4R0E A;  2YWH A;  4BS2 A;  3D68 A;  1FD8 A;  2AYB A;  4YEA A;  3PTW A;  1N5Y B;  5KFE A;  3B78 A;  1SL0 A;  5D4L A;  1RKI A;  2C3O A;  4DQQ A;  4ZP7 A;  5A8W B;  3HHE A;  2IPO B;  1NND A;  2XYP B;  4UOF A;  2DIS A;  1CVJ A;  3QFH A;  2YWG A;  3KLG B;  2FYX A;  2VFV A;  4KHM A;  3UD4 P;  1TZ0 A;  1WHW A;  2BA9 A;  4LT6 A;  2PDA A;  5IT4 A;  3K5M A;  4YDD B;  2V2Z A;  2RB7 A;  4HL9 A;  5HLF A;  4H4M B;  3ISZ A;  1DUR A;  5B0D A;  1BXN A;  3CUL A;  1LFP A;  4K4X A;  1RT2 A;  4LRB A;  1ZZF A;  3FMW A;  4ILL A;  4GKK J;  1URN A;  3CO9 A;  4X64 F;  3FQL A;  3NBP A;  4WYW A;  1TQL A;  1IM6 A;  1F0X A;  2GO8 A;  3FZ2 A;  1EKS A;  3VAF A;  3H4B A;  5HMW A;  1N34 J;  4EI2 A;  5CHC B;  2WW8 A;  2A0F B;  3TA0 A;  4F4X A;  4LMZ A;  1BHN A;  3BSC A;  2JRS A;  3VQT A;  2LQJ A;  2QG9 B;  3W66 A;  5LOQ A;  5AXM A;  2DNY A;  1NJY A;  3HSG A;  1T95 A;  2W2P P;  3L7U A;  1RT2 B;  4MKB A;  4KT0 C;  1ZA2 B;  4LF8 J;  2BJ1 A;  1APS A;  4QZV B;  3BQ0 A;  3BGR B;  4IDK B;  1IXK A;  2UVV A;  1IBL J;  4ZVR B;  2PMZ D;  4RU2 A;  1RWM B;  4I0W A;  2GQQ A;  4LF2 A;  4DV4 F;  2Y1J A;  3QID A;  4RW4 A;  2XMJ A;  4KHR A;  1T3O A;  4UY8 5;  4KGV B;  1DQA A;  4JI0 F;  4C0B A;  5C25 A;  2AQ4 A;  1HHS A;  2KYX A;  4LFC F;  1UVL A;  5RUB A;  6FD1 A;  1K1S A;  3QIP A;  1HBO A;  4OZL A;  4DR4 J;  1SIZ A;  3GFX A;  4J9K A;  1H2U X;  4CNY A;  2AWZ A;  3OFG A;  5A8R A;  1S10 A;  3RTV A;  3LPE A;  3ILI A;  1YBA A;  2QGF B;  5FDL A;  1F60 B;  4F2S A;  3LP1 A;  4P10 A;  5KT3 A;  1S0M A;  1SIW B;  3CTR A;  4KPC A;  3KK1 A;  1T8E A;  2DGU A;  3AOC A;  4DHV A;  4ZVT B;  1G3O A;  2RIJ A;  3BH7 B;  3ENQ A;  1X60 A;  1DY3 A;  3FCW A;  3W9I A;  4RW4 B;  1UEV A;  2D7S A;  3EZ5 A;  1XMB A;  1EZZ B;  2Z0G A;  3FDS A;  4KGZ B;  1SBR A;  4CH0 S;  4Y65 A;  4KBI A;  5C25 B;  3EYZ A;  1RJJ A;  2CJQ A;  4CYU A;  3QIP B;  1HBO B;  3US5 A;  2WB4 A;  2H9Z A;  3HMJ G;  3T1A A;  1FO1 A;  4HI2 A;  1WHY A;  2XG8 A;  1H3D A;  1U1R A;  4F67 A;  4ELT A;  2KM8 C;  2UP1 A;  1MLA A;  1N56 A;  4A8Y A;  4PXE A;  5I3Q A;  5A8R B;  4PR6 A;  2JC0 A;  4DV6 J;  2ZBC A;  2W24 A;  5FDL B;  4DMZ A;  3LP1 B;  3N9U C;  1SJR A;  1WC6 A;  3GMG A;  1V3S A;  3KK1 B;  3AHP A;  3BO2 A;  2AIR B;  4O4G A;  1DFD A;  3HFV A;  3BB5 A;  3E8O A;  3V6H A;  3V4I A;  2HK3 A;  1KQG B;  1MNE A;  3CD7 A;  2YWK A;  2LMI A;  2MJU A;  5E2Q A;  1P1T A;  4OX8 A;  3KHH A;  3LF0 A;  4CYU B;  4L74 A;  1KVJ A;  2X1A A;  4OI4 A;  1K9M T;  4EWT A;  3FEX B;  1SKS A;  5HL7 Q;  1N33 J;  2IY5 B;  3HKW A;  4F3Q A;  4LQ3 A;  2BBE A;  1NDK A;  2Z2M A;  1AYE A;  2AEM A;  1Y5N B;  3I4H X;  2DGO A;  4DF8 A;  3IG1 A;  4OZ3 A;  4RR5 A;  2B5J A;  3V6K A;  4PQU A;  1X4B A;  1G2E A;  1LEO A;  1HWK A;  2D3Z A;  2RHS B;  2K8G A;  3KK3 A;  1U2R A;  1CC7 A;  2C2M B;  3QPI A;  2LQ9 A;  4WK3 A;  4O4G B;  7FD1 A;  1XNQ J;  2ZC4 A;  2MKY A;  4OJ1 A;  3V4I B;  1HR0 J;  1Q78 A;  3KLV A;  4X4V A;  3VGT A;  1FX4 A;  4KV8 A;  4P2F A;  4K4W A;  3TZY A;  3VVU A;  2OJ3 A;  2DXE A;  2W9C A;  3AJ2 A;  4C11 A;  1OSC A;  3A13 A;  3NGR A;  4ZVS B;  5BYS A;  3KUG A;  2WON A;  3NGD A;  2I9S A;  4UZB A;  3IG1 B;  2B5J B;  3CMA S;  3DLG B;  1HI0 P;  2H5E A;  4IOA Q;  3NS7 B;  3KK3 B;  1QUV A;  2ASY A;  3QGP A;  3D1H A;  1NJW A;  4N7T A;  2ERR A;  2LXU A;  3M8Q A;  4DV3 F;  4A46 A;  3PV8 A;  3J81 Y;  4LBH A;  4X65 F;  1N6Q A;  1QAX A;  4C0H A;  3N4W A;  2WTF A;  2CPE A;  2JDJ A;  1RLD A;  2K06 A;  4RWW A;  2W9C B;  3RR8 A;  3HF5 A;  1T03 B;  4C11 B;  4J90 A;  2ZC3 A;  3ETO A;  1JIH A;  2V8G A;  4X64 J;  2WON B;  1KOH A;  4X62 F;  1NK5 A;  1M90 T;  1MSW D;  3GJS B;  4J7C A;  1JXL A;  2XY7 A;  2ZNZ A;  4W92 B;  3D28 A;  3H5S A;  1TEL A;  3S7R A;  2PMW A;  4MFB A;  2G1D A;  3M8Q B;  4FXV A;  4OHW A;  2LU2 A;  5KFX A;  1B4S A;  3CXC R;  1D3W A;  2E7W A;  1VK8 A;  4ES2 A;  3EGN A;  4GMK A;  4F0H A;  3CD6 S;  1N6Q B;  1I3O B;  3D66 A;  3GJT B;  1BY9 A;  4CT9 A;  4AD6 A;  4FXW A;  4CLS A;  1BQM A;  2XS2 A;  1AW0 A;  3HJF A;  2IM0 A;  3B4M A;  4JI8 F;  3OTO F;  2M70 A;  2MQ8 A;  2RQM A;  4QIG A;  1HWL A;  3L4B C;  4N8N A;  3OR1 B;  1KVK A;  2CPZ A;  1DTQ A;  4DUY F;  2MLY A;  3FNN A;  2KFY A;  3MPV A;  3TJ8 A;  4DV4 J;  1FVS A;  2Z57 B;  3E3X A;  5KT2 A;  2IBK A;  2NYH A;  5FJ4 A;  4JI0 J;  2LXI A;  4O4R A;  1UAW A;  3D54 A;  4MFB B;  2B43 A;  4LFC J;  3QJJ A;  2HNY A;  3WX8 A;  2OPQ A;  5A6W A;  5B08 A;  1RBO B;  4ZIW A;  1FXD A;  2FJX A;  2G0C A;  1E6V A;  4M95 A;  1H7W A;  3GR0 A;  4FZV A;  4ECR A;  2JEI A;  4B3M F;  4DFJ A;  3EVM A;  1S6P B;  3HXM A;  3CCS S;  1TMJ A;  1S5Z A;  1BQM B;  2BYC A;  4BC9 A;  5JVG Q;  4WF9 Q;  5THW A;  1O8B A;  3WBZ A;  2YWW A;  4ECX A;  3NS5 A;  2LQB A;  3PRB A;  4IOC Q;  3RR7 A;  4MIA A;  2PE8 A;  2AKW B;  3BBC A;  1DTQ B;  4ZLN A;  3AY0 A;  2BE2 A;  2AGP A;  3MUT P;  5IC6 B;  2MMY A;  4I2P A;  2XO6 A;  2OML A;  1NJZ A;  3SFG A;  2XWY A;  1TK5 A;  2MQN A;  5A2Q Y;  1PGZ A;  1U45 A;  4B3R F;  2HNY B;  4ZP8 A;  1NSP A;  2OPQ B;  4GC7 A;  1M5K C;  5AXL A;  1E6V B;  2KG0 A;  2L9W A;  4FNI A;  2QZ8 A;  1VCT A;  2W2Q P;  3DCA A;  1ZAV A;  4K2J A;  2MKH A;  1TL3 A;  1TVR B;  2A18 A;  5B0G A;  5T7L A;  5J2M A;  3KWM A;  3Q8U A;  2QJ3 A;  3UQS A;  1CS4 A;  4CP5 A;  2EFP A;  4WZM A;  2YH1 A;  3MR3 A;  4KHP F;  4JI2 F;  2BE2 B;  4I2P B;  5H9E K;  1YRT A;  2HKE A;  2ZVI A;  4LIR A;  2DGQ A;  4XDD A;  2DH7 A;  2WW4 A;  4XDC A;  2HFV A;  3LGN A;  1V9O A;  4OHX A;  3BGF A;  3RZA A;  4NLU A;  5I3P A;  1C0U A;  3AXK A;  2PO4 A;  1KR4 A;  1RP5 A;  4LF9 F;  1NPP A;  4M5I A;  3G96 A;  3OJS A;  4F4Y A;  4CM0 A;  1NH8 A;  5KFZ A;  2DY1 A;  3KMQ A;  1TL3 B;  2XYH B;  3KHL A;  4DCP B;  4DV5 F;  3ILO A;  1A9N B;  2OLW A;  5T7L B;  5J2M B;  2KZZ A;  1TK8 A;  5IXU A;  1CS4 B;  1NHV A;  3HPO A;  3M9O B;  3VTI A;  1RWK B;  2IMO A;  1XEZ A;  2E5I A;  4DPU A;  2KG1 A;  3MMA A;  4NLP A;  1OQ3 A;  3OSP A;  3QRQ A;  2VD3 A;  3GYX B;  4LSL A;  4ZKA A;  5DDR C;  1YIT S;  3MM7 A;  2ZHA A;  2KRR A;  2XY6 A;  4M5K A;  4UZC A;  1FWL A;  3M7V A;  1VI7 A;  2M52 A;  1RB0 A;  1VC0 A;  4J9O A;  5KT6 A;  4DPX A;  3KHG A;  2E7X A;  5HAN A;  4HLB A;  2XHC A;  1C0U B;  1UA0 A;  1RT6 A;  2IIH A;  3DGP A;  3T9Z A;  4BCA A;  1RGV A;  4LR8 A;  3UN2 A;  3MOJ B;  2DGX A;  1G1X A;  3IRW P;  2EFO A;  3DLE A;  2M9K A;  3CIZ A;  8ATC B;  3ZTS A;  1BC6 A;  2W25 A;  2DCL A;  3G71 S;  5ETP A;  2RDJ A;  3L3C A;  4B9T A;  1BLU A;  4ZIV A;  3DXB A;  4ZCL A;  2EK1 A;  3CCM S;  5BJR A;  1ZPW X;  3S01 A;  2XI2 A;  5T41 A;  1F2G A;  4DPW A;  2R7X A;  3I87 A;  4OYW A;  3AA9 A;  1VQ4 S;  1R6V A;  3MM7 B;  2FJV A;  2BW2 A;  2BZ2 A;  4NE9 C;  4DV3 J;  1T9X A;  3I96 A;  4U8Y A;  3I5B A;  1HNW F;  2J6U A;  2V4Q A;  2C28 A;  4X65 J;  3PX0 A;  2V68 A;  4USH A;  5IZH A;  2AHO B;  5HP1 A;  1R8B A;  4OZ0 A;  1JJ4 A;  1RT6 B;  4XO0 A;  1J5E F;  3DGP B;  1AZS A;  3IRX A;  3M6X A;  4EK2 A;  2QA2 A;  3OJU A;  3ADA C;  5ETQ A;  4P72 A;  2V94 A;  3IO1 A;  2JEG A;  1WG1 A;  3DLE B;  5KFU A;  5E3R A;  4X62 J;  4TY8 A;  3FQK A;  3KJN B;  2CNN B;  3M1V A;  3TW0 A;  2UVU A;  2FY8 A;  4LF7 F;  1TUV A;  3CCW A;  2VF3 A;  1SJ3 P;  1YJR A;  4E8U A;  4DL6 A;  5AE3 A;  2D3O 1;  4GKJ F;  3P5T L;  2R3V A;  3AQP A;  4J9Q A;  2YWE A;  2VU5 A;  1H72 C;  1UVM A;  5ETT A;  2MY8 A;  2XMV A;  1DBD A;  2AF6 A;  2GZO A;  5DG7 A;  1BWE A;  4CLK A;  5B09 A;  2RNE A;  5HP1 B;  2HW3 A;  2ZNY A;  1AZS B;  2DH8 A;  5BR8 F;  4OI6 A;  2Y1I A;  1NKB A;  3IRX B;  3W7B A;  4OIX A;  4JI8 J;  2DHX A;  3OTO J;  3GV5 B;  1SVD A;  1O6X A;  2KJV A;  1FJ7 A;  4M63 A;  1WC5 A;  2VC0 A;  4B3T F;  4TY8 B;  4P2S A;  2HVI A;  4DUY J;  5KFT A;  3FK4 A;  5EWG A;  3M1V B;  3OT9 A;  1NDL A;  1RWN B;  3R5D A;  1MU2 A;  5GVQ A;  4USU A;  3T5H A;  3V5R A;  1ZOT A;  2FJB B;  4ZIT A;  4TU8 A;  3H7H B;  2EFQ A;  5D4N A;  2E1M C;  3KG0 A;  1HQE A;  4XAK A;  4P6Q A;  3X1L B;  4B3M J;  1PBA A;  5KFW A;  2PFD A;  2UXB J;  2F40 A;  4HTI A;  3DLL Q;  1EP4 A;  2H48 B;  2IYG A;  4DI6 A;  4YR3 A;  3MAA A;  5GAD I;  4Y3C A;  1UA1 A;  2VKR A;  1QAJ A;  3MCS A;  2PC6 A;  1FT8 A;  4C3L A;  3A4T A;  1Q79 A;  1SJ4 P;  2XY5 A;  2CZ4 A;  3AJD A;  1I6J A;  1I51 B;  4B3R J;  1Q1K A;  5HAO A;  1OYD A;  2QFJ A;  1P6T A;  4O0N A;  3I0S A;  4TN2 A;  2DNP A;  4RBT A;  4TVA B;  4P9S A;  2W8L A;  3POT A;  1FKP A;  3SSQ A;  4MK9 A;  4OMF G;  2W2N P;  2QL5 B;  1V5V A;  1B7Y B;  5SZT A;  1EP4 B;  4MKA A;  4I6W A;  3KG4 A;  1VQ8 S;  2UUA F;  2HRY A;  2UV8 G;  4GRS A;  4LQ9 A;  2RS8 A;  4NLV A;  2DRD A;  1SC4 B;  2J0S D;  3HX9 A;  3O8W A;  4J91 A;  4KHP J;  7AT1 B;  2CDR B;  3TVK A;  3M6W A;  3R1L A;  2DIU A;  3LP2 A;  3DDK A;  2VAS A;  1LXN A;  4JI4 F;  1F5B A;  3GG0 A;  1VOM A;  2OTJ S;  4HHU A;  5DM7 Q;  4CO5 A;  1WI6 A;  2BM1 A;  1M5O C;  1NK9 A;  4E2F B;  3MEG A;  5KG4 A;  4U7U K;  2C2O B;  1KHV A;  2FUG 9;  3RB0 A;  4LF9 J;  3I0S B;  2ROE A;  4WBF A;  3BEG B;  3POT B;  4OYB A;  1FKP B;  3V4M A;  2WBM A;  1JWW A;  3Q89 A;  4DV5 J;  4ZLP A;  2O5D A;  2VOD A;  2X1B A;  3GR1 A;  4ALZ A;  2FGC A;  4RW7 A;  4B3S F;  4ECS A;  1VBZ A;  1PO6 A;  3RB3 A;  1RBA A;  3FC9 A;  2AU0 A;  3QT5 A;  2IFX A;  2DR8 A;  3K0J A;  2MQQ A;  2YPY A;  3EDQ B;  5D0R A;  1IKW B;  3AB2 B;  4A8M P;  2IJF A;  4USK A;  4ZA1 A;  2EI5 A;  2J7K A;  1FKA F;  1Q8I A;  3NKY A;  3SBM A;  3K5N A;  4WXW A;  2DGW A;  1D9A A;  2W9B A;  5CAB A;  2KO1 A;  3SYZ A;  4ES1 A;  1RQ0 A;  3E01 A;  3CWJ A;  1ARO P;  3GIK A;  2JVR A;  4PAA A;  4NAS A;  1IR0 A;  1X4H A;  1VDH A;  1FRL A;  3LAK A;  4C98 A;  3DLH A;  1QAY A;  2XC9 A;  3KLF B;  2MZJ A;  2WSC C;  4RW7 B;  1U48 A;  1ZM3 A;  2CQG A;  3ZNU A;  2K1R A;  2DCU B;  4NYZ A;  5D4P A;  3PHE A;  3RAM A;  5D0G A;  3R9L A;  3JSB A;  3SXL A;  3IBW A;  3QJL A;  3EPI A;  2CPX A;  1N48 A;  3BR8 A;  1IKY A;  2ADB A;  3TJ9 A;  1PG5 B;  2V9K A;  1HNW J;  2FVC A;  1N54 B;  2FPH X;  1WHX A;  2KN4 A;  1NEE A;  5KFH A;  1J5E J;  1H7X A;  2ACY A;  2EKY A;  4WYL A;  2W9B B;  4RO0 A;  1NM2 A;  4G65 A;  4MH8 A;  1TFW A;  3E01 B;  3QFW A;  1GQE A;  1HBM A;  2IDL A;  3QYY A;  3MOZ A;  1GFW B;  2IM2 A;  2ZBI A;  3AD7 C;  1L3S A;  4ZPV R;  3DXS X;  3O1L A;  5FD1 A;  4LF7 J;  1RE1 B;  3Q83 A;  4RZR A;  2IRU A;  1R27 B;  4GKJ J;  3K8W A;  1IKY B;  2ACM A;  2GGP A;  2PA3 A;  4YY3 F;  1SC6 A;  2XCA A;  3DI6 A;  2JEJ A;  4W98 A;  2W2O P;  4RUB A;  2QN6 B;  2VC1 A;  2YKO A;  1NCL A;  1JLA A;  5BR8 J;  4ZN1 A;  2EC2 A;  2XCP A;  2EKN A;  3PO5 A;  3QNW B;  1T3N A;  1SH0 A;  1X9S A;  2BKN A;  2KT5 A;  4OYO A;  2EBG A;  2AW0 A;  1HBM B;  4V19 X;  1PCA A;  3R2C J;  4IO1 A;  1RYR A;  4B3T J;  4HKQ A;  3VAK A;  1VQM S;  2ATL A;  1MML A;  3PJX A;  1RHK B;  3H20 A;  2R9L A;  4DS4 A;  1LW2 A;  1H2T Z;  2GGP B;  5ETR A;  4WFY A;  5KFO A;  2Q1L A;  2RU3 A;  4DX8 H;  4RUA A;  3DI6 B;  4F3M A;  2UUB F;  5IT9 Y;  2VUG A;  2YX1 A;  2DR6 A;  4LBP A;  1JLA B;  2QSW A;  4NCG A;  2FLP A;  2FLO A;  3T5K A;  1O51 A;  1VBK A;  2UXC F;  3FBC A;  3R7N B;  3MXH P;  1CQM A;  3P6Y C;  1N88 A;  2B9Y A;  1T02 A;  1HD0 A;  2N3O A;  3F44 A;  4AE5 A;  1U47 A;  4QJV A;  4Y2K A;  4A8X A;  2PII A;  2RF2 A;  4RNH A;  1MMD A;  3ILL A;  3W60 A;  5GME A;  4ANE A;  1VRQ C;  1V6H A;  5LSL A;  1YK9 A;  4KGX B;  1HD1 A;  4KH1 B;  3PYF A;  1LW2 B;  2CNO B;  1ZM9 A;  2O1P A;  1TK0 A;  3PYG A;  1WEX A;  4OQJ A;  5C42 A;  1N36 F;  3R97 A;  2D9O A;  3LGM A;  4X66 F;  3BSO A;  1GMV A;  3N5B A;  4NCG B;  2KXN B;  5KAK A;  4QU6 A;  1SJF A;  1IM4 A;  5F8N A;  4A48 A;  2I38 A;  4H4K C;  2GJ2 A;  1JMT A;  2UUA J;  3SCL E;  4C7Q A;  2YKA A;  3CDU A;  4HH0 A;  4M8L A;  3L7O A;  1JNR B;  2OMO A;  2FC8 A;  4MIW A;  2CQD A;  2RF2 B;  3GIM A;  4FP9 A;  4IUF A;  2NQP A;  2KI2 A;  3I0R A;  2OSQ A;  4JI4 J;  1HWU A;  2VBY A;  2NS1 B;  1J5O B;  3MED A;  3R2D J;  2O66 A;  2ZIT A;  4P7V A;  2HWI A;  2J0X A;  2FHM A;  3CJS A;  2N7C A;  1JLE A;  4DJB A;  1R8C A;  4ED6 A;  2XTJ P;  3MPU B;  3G86 A;  5C42 B;  3IBF B;  2EK6 A;  4DX5 A;  4DR6 F;  3PW4 A;  2LQ5 A;  2PFF B;  3CJ2 A;  3TQE A;  3BO3 A;  1R6Y A;  4FS1 A;  5DZ6 A;  3ETM A;  2V9W A;  4ECV A;  3BBB A;  5IC4 B;  5DGB A;  2JNJ A;  1NPK A;  2BDP A;  2YVS A;  4B3S J;  4F36 A;  4QR0 A;  2W7P A;  3ZTR A;  1K1Q A;  4UY8 T;  3FJ2 A;  4OX6 A;  3I0R B;  1RA7 A;  2M4M A;  4CLY A;  2MQM A;  2QLF B;  2DNN A;  4I6A A;  2VG6 A;  1M1K T;  3MED B;  1VQO S;  1H2V Z;  1QDU B;  3OHB A;  4BLG A;  2EG2 A;  2RUG A;  4J9M A;  1KLM A;  4WP8 A;  2AX0 A;  3HP6 A;  3T19 A;  1TL7 A;  1FJC A;  3VV2 B;  2OEL A;  1TAQ A;  2C3P A;  3NAI A;  2XMA A;  5D0H A;  1X9W A;  3EDR B;  2BV3 A;  2AYM A;  5K20 B;  4J5O A;  1A6L A;  2LP4 A;  4CLP A;  3U1N A;  2C2D A;  4NZ6 A;  4DR7 F;  2QYC A;  1ZTW A;  2CQ1 A;  5HJX A;  2GIF A;  2AD9 A;  4PXD A;  2ZHB A;  2DB1 A;  1S1U A;  2COL A;  2J5A A;  4O23 A;  2VG6 B;  4FVC A;  4NLT A;  1SB6 A;  5HO4 A;  3ULH A;  2IMW P;  1FI4 A;  3OTD A;  1L3K A;  3IBC B;  3HUL A;  5LT5 A;  2Q6B A;  5M2R A;  3PO4 A;  3NMR A;  4D3H A;  2G2Y A;  2UUT A;  1KLM B;  5H9F J;  4PZV A;  2Y8Y A;  2K3K A;  3Q8R B;  3BDP A;  1TL7 B;  2V8V A;  4WXO A;  3DOM A;  3DKD A;  4RBU A;  2RKI A;  5GAG U;  3VF0 B;  4DR2 F;  1VR6 A;  2FGO A;  3JAM U;  4OHZ A;  3PNI A;  2JSX A;  3IN5 A;  1Y0H A;  3CVK A;  1RIS A;  2D41 A;  4MYU A;  3FBF A;  3VWS A;  1S1U B;  1UMJ A;  4TYA A;  3DN9 A;  4YY3 J;  1A7G E;  3PKY A;  2Z2Z A;  2Z56 B;  2L3M A;  2CIM A;  2AGO A;  4LFB F;  4G1I A;  1X4F A;  2RQK A;  4TY9 A;  3M8R A;  4NML A;  4KQZ A;  1KLN A;  3GCX P;  2BQR A;  3GFY A;  3DOM B;  2BM0 A;  3MUR P;  4A8O A;  4HI1 A;  4D3G A;  1XWL A;  2RKI B;  1N5Q A;  1UFW A;  3TRG A;  2IRX A;  4F4A A;  4DLE A;  4S0M A;  1U0H B;  4DOZ A;  2BQU A;  1YKW A;  4QWC A;  4WU2 A;  1TL4 A;  3M05 A;  3OW2 R;  2KT2 A;  2QA4 G;  2RH3 A;  4K8R A;  1TUG B;  4W4M A;  5J1E A;  1WF1 A;  4WFA Q;  2NUU G;  2M5Y A;  2VPY B;  3G82 A;  4ZLL A;  5KFR A;  2XMU A;  3IR7 B;  2ZZN A;  3TR5 A;  2E66 A;  2ZJR Q;  1JJH A;  4JI5 F;  1DAR A;  2VHG A;  4O44 A;  5KG6 A;  1WF2 A;  3UNG C;  3HVT A;  1SH2 A;  4AND A;  1L5U A;  2UXC J;  5KFG A;  1VHI A;  3H8Y A;  4ER8 A;  5HK4 A;  3DNC A;  3B6B A;  3SV3 A;  1MRO A;  5E3P A;  2P6T A;  3MAH A;  1S49 A;  1UTA A;  1GMW D;  4B3O A;  2DGV A;  1ZA1 B;  3W2V A;  5J1E B;  4NCB A;  4GVL A;  1U2C A;  3UO0 A;  1IQT A;  1N5S A;  3G82 B;  3K17 A;  1K47 A;  4TQR A;  2HEK A;  3CGI A;  2ZFH A;  2HGM A;  2V8P A;  2ZBP A;  5CQG A;  4CM2 A;  3LAL A;  2HFZ A;  2IA0 A;  3JXO A;  1U4B A;  1N36 J;  4HTJ A;  4EYH B;  1NB7 A;  4X66 J;  4O44 B;  4NLW A;  1S0O A;  1CQN A;  1FTC A;  3H2V E;  1KOO A;  3HVT B;  1S7H A;  4DFP A;  1WOS A;  3GLJ A;  2XSJ A;  3MZI A;  4L6V 3;  2J0W A;  4LUB A;  4OI3 A;  1NKE A;  3FZB A;  1UEK A;  2UUW A;  2C2K B;  1C1C A;  3C6T B;  1MRO B;  1Q0N A;  4EBC A;  1U8W A;  2DNQ A;  3EMT A;  2WZ1 A;  1UPP A;  5E7O B;  4B3O B;  4DQP A;  3W2V B;  4N76 A;  2HS0 A;  2E9R X;  3D3B J;  4UOG A;  4MYT A;  2ZE2 A;  1VHF A;  2YQ3 A;  4Y2M A;  2OKQ A;  2DNG A;  5DGA A;  1SXL A;  1IKV A;  4RNO A;  5CCM A;  4BWM A;  1W2I A;  4DR6 J;  1FE4 A;  4DCO B;  2AJQ A;  1B3T A;  3KG1 A;  1RT3 B;  3FUY A;  3HZG A;  2XSJ B;  4K7Q A;  4TNO A;  2J0Q D;  3EVO A;  1C1C B;  5HVF A;  1QAI A;  5KT5 A;  4Y28 C;  4ZVQ B;  1N5T A;  1UVI A;  4A8F A;  5GMD A;  2DT9 A;  2B56 A;  4ILR A;  1ACM B;  3Q2S C;  2ZE2 B;  5FLX U;  5B0B A;  1RT5 A;  3U1L A;  4AL5 A;  3Q8P B;  4IFY A;  1IKV B;  1WD6 A;  3K89 A;  4UQT A;  2LQ8 A;  5H9F K;  1WF0 A;  2W7A A;  4JV0 A;  3LP0 A;  4Z7Y A;  1PJ5 A;  4TU7 A;  4OJH A;  2CA9 A;  3I55 S;  3TO8 A;  3FMB A;  3H59 A;  1HNZ F;  4C8Z A;  1O0P A;  1NKC A;  4DR7 J;  4ED8 A;  4FS2 A;  4MMO A;  3UI3 A;  2ZH9 A;  2UXD F;  2M8D B;  3NWR A;  3J81 U;  3UDV A;  2PGC A;  4ED3 A;  1XK8 A;  1YZ7 A;  4X4R A;  3NOG A;  2KTQ A;  3D5M A;  1VIS A;  3N6L A;  3TUZ C;  1RT5 B;  1SC3 B;  5L1K A;  2J9D A;  3BF4 A;  4IFY B;  1CJU A;  3JQK A;  2F65 A;  3GIJ A;  4MAK A;  2CJ9 A;  5CD4 H;  2V50 A;  4LIW A;  4AQY F;  1R7I A;  3O5T B;  3HSD A;  2OEK A;  1UJ4 A;  3ONQ A;  5CZX A;  4J9L A;  4YP3 A;  3V81 A;  2V8D A;  1OO0 B;  4DR2 J;  3TAR A;  3NCQ A;  5D15 A;  3OQ2 A;  3K5L A;  1OQ6 A;  2LA6 A;  2OPP A;  1Z2L A;  3RYL A;  3GZ7 A;  5B0F A;  2CPD A;  3HSZ A;  3BQ1 A;  3QAE A;  1WTB A;  2JX2 A;  3NNA A;  3P49 B;  4OHY A;  4ZPD A;  4I56 A;  4OJ3 A;  4M5D B;  4LFB J;  3PKM A;  1VQL S;  4LR7 A;  3A3N B;  4ECT A;  1JXV A;  1GMW A;  1CJU B;  1VQS A;  4C3M A;  2GA7 A;  1RAH B;  1HI1 A;  1X4C A;  1NB2 A;  4FYY B;  3UDC A;  1ZH5 A;  3D3C J;  1RWX B;  1GTH A;  4YB1 P;  2DPJ A;  4M5L A;  3V81 B;  4NA1 A;  5CYJ A;  4EZ6 A;  3R5A A;  4JV2 A;  5IV3 A;  3UVJ A;  2HIQ A;  3R7S B;  2OPP B;  3SSS A;  3F0N A;  2KVI A;  2ZWP A;  4YOE A;  4CO1 A;  2CDQ A;  5KFB A;  5E33 A;  2CQB A;  3G4S S;  3W5Y A;  1RT1 A;  2M2B A;  4JI5 J;  3MPW A;  5DQH A;  3DRP A;  1XQI A;  1OIA A;  2XWX A;  2EC0 A;  2DIV A;  2JFD A;  4OYM A;  3BYP A;  4DU7 A;  4FPI A;  2C2N A;  2OFH X;  2GMH A;  2HHV A;  2QA1 A;  4Y2A A;  4QYZ J;  4PRF A;  4NPO A;  1DRZ A;  2H51 B;  1VQ7 S;  2ILZ A;  4CTA A;  5AJ3 J;  3T6J A;  3MD3 A;  5K14 A;  1D09 B;  5A2Q U;  4NRU A;  1UVK A;  2MKC A;  2XMT A;  3UVJ B;  4C8O A;  2FLL A;  1FXL A;  1FDB A;  1HPZ A;  4M94 A;  1VLO A;  1K73 T;  3C15 A;  2MLZ A;  3HHK A;  1RWP B;  2XZT B;  5ETK A;  4FNH A;  2W4P A;  1TUW A;  1HIY A;  3MM9 A;  3H90 A;  3P45 B;  2HBR B;  1RT1 B;  3OPK A;  4UQG A;  2VBW A;  4NEZ A;  2RAQ A;  3NCR A;  5DDQ C;  3R5C A;  1G7C B;  2RT3 A;  2R7S A;  3OLB A;  5DLG A;  3CCR S;  1QM9 A;  1X5T A;  3G6Y A;  2DY9 A;  3CJR A;  4CTA B;  4WE1 A;  4ZPC A;  2Y1R I;  1UVN A;  3W8P A;  1ZM4 A;  4QIF A;  5K14 B;  1NJI T;  2FHK A;  3C14 A;  4PQA A;  4LRD A;  4M5J A;  4H4K A;  1HPZ B;  5AE2 A;  3C15 B;  3OFH A;  3TUP A;  4HHH A;  1Q8B A;  4YB7 A;  3MR2 A;  2ROP A;  3LPY A;  2D74 B;  1JLG A;  3SFU A;  1T05 A;  2V0N A;  4F4Z A;  2MKI A;  4C8M A;  2ZH5 A;  1FJE B;  3EGZ A;  2RUS A;  2UV8 A;  4Z7C A;  3WC0 A;  1ZTT A;  3FSY A;  5CAA A;  3KNA A;  3VGS A;  2YH0 A;  4KGK A;  2Z58 B;  1CJT A;  3VAI A;  3MMB A;  4UOH A;  2H3E B;  1JB0 C;  3E51 A;  3FBB A;  3TEH B;  5KFL A;  4WE1 B;  4DL3 A;  3EX7 B;  2RE1 A;  5EHH A;  5HVG A;  1IBK F;  3C14 B;  2JFK A;  5HMX A;  2HNZ A;  2C2E A;  2VPZ B;  3UDE A;  3QZ7 A;  2NPI A;  1FER A;  1U49 A;  1X5P A;  5DG8 A;  2YXL A;  3VHQ A;  1L3U A;  2Q6C A;  2Y8W A;  1JLG B;  1T05 B;  3NGU A;  1PYS B;  1B0V A;  2K7K A;  3RRH A;  3RB6 A;  3MUV P;  1D8Z A;  4M5N A;  2F1F A;  1WKK A;  5C2C A;  3BBF A;  3MM8 A;  1CJT B;  2DNK A;  2LYV A;  2R8K A;  3BQ2 A;  1HNZ J;  4DFK A;  2YY3 A;  4FYD A;  2UXD J;  2HNZ B;  5E5N A;  4F4K A;  1EQM A;  3WZ0 A;  3SV4 A;  2APO A;  3D6M B;  4ENO A;  1ZS6 A;  1C4A A;  4WPA A;  3CUN A;  2CZV C;  2QE5 A;  3AT1 B;  5I3U A;  3OFE A;  4ZVU B;  3TA1 A;  3K58 A;  3PYD A;  1ZYQ A;  1S57 A;  4X4U A;  3PXG a;  3GIL A;  3KTQ A;  1WNE A;  1RAO A;  2DK2 A;  4AQY J;  2CZ9 A;  3BYR A;  1JKH A;  5LXR A;  2EFV A;  4PYA A;  1GNK A;  2NLW A;  2VQE F;  2OPR A;  3PHT A;  2LU1 A;  3MM8 B;  4CLF A;  1YJW S;  2HSE B;  2IJN A;  4HR2 A;  4Q5V A;  4RLE A;  5J2N A;  3QGI A;  2GS8 A;  4DN9 A;  4ECW A;  4F2R A;  3RBZ A;  2DIT A;  1DTT A;  2MZT A;  3VGU A;  3R5G A;  8AT1 B;  2R8J A;  4GVB A;  2V67 A;  2CPY A;  3BSN A;  3RRK A;  2MZS A;  3J7Z T;  4C8K A;  2JH3 A;  3MPD A;  4OYP A;  2CJX B;  1T9W A;  5I3U B;  3CCZ A;  3A1Y G;  4N47 A;  4N41 A;  2LCW A;  2P9E A;  3FCH A;  4DBQ A;  3LO3 A;  4PUO A;  3CCQ S;  1JKH B;  1G6B A;  1B99 A;  2PI5 A;  1X9M A;  1FEH A;  2VDI A;  2RHQ B;  4QYZ K;  4NZ0 A;  2OPR B;  1BWV A;  1Y4Z B;  1EAY C;  5GAG I;  3QWP A;  4LBI A;  5F3T A;  2IAJ A;  5J2N B;  4RW8 A;  3PVX A;  2HWH A;  3D7S B;  4L76 A;  3BPD A;  3BO4 A;  2AEF A;  1DTT B;  1UKU A;  1KBR A;  1C4C A;  5C2G A;  4GVB B;  2EBE A;  3JS9 A;  3ZXW A;  4F0K A;  3BGR A;  4HYK A;  4IDK A;  4CZC A;  3VAJ A;  2RD5 C;  1YJ9 S;  4E98 A;  4NRT A;  2HAI A;  4C6A A;  2HVD A;  2OEM A;  3JAM Y;  4QW8 A;  2R8I A;  1FWP A;  4LVO P;  1IR2 A;  4H54 A;  1YI2 S;  3SQG A;  3R3T A;  4NX9 A;  4PUO B;  2WOM A;  4JBC A;  1Q86 T;  1X4D A;  1RAF B;  1QE1 B;  2E5H A;  3TOQ A;  2IC3 B;  4ZVH A;  1VJW A;  2KXH A;  2IVF B;  4U7U D;  2GIQ A;  2IAJ B;  5HN0 A;  4RW8 B;  5B0A A;  3CD0 A;  4P75 A;  1OYE A;  4RUC A;  4J9R A;  4NZ7 A;  4FXD A;  5GAD U;  3MCM A;  5EX0 A;  3UCZ P;  2BJ8 A;  2HS3 A;  2HYI B;  2CQP A;  4YR2 A;  3D9B A;  1VGY A;  1PYT A;  3OL6 A;  3Q23 A;  4PG6 A;  2E1P A;  3C16 B;  1WG5 A;  2H1Y A;  4Y34 A;  2EXU A;  4KPY A;  1UZH A;  3SQG B;  4ZJO A;  2QSF A;  4NOH A;  5F8L A;  2PD1 A;  3QQC D;  2ASD A;  2WOM B;  2MHN A;  2K3I A;  4NLS A;  4IH5 A;  2EFN A;  4CIO A;  4DR3 F;  2GAH C;  1RWU A;  2BJ7 A;  2W8K A;  4OYX A;  1FJG F;  1RAB B;  1QVF R;  1NK0 A;  1FCA A;  2UZA A;  3N28 A;  4CQ1 A;  3UD5 A;  3RBE A;  2KFN A;  2VQF F;  2Z2L A;  2WHO A;  2WSF C;  4O3R A;  2J6S A;  2B4P A;  1Q81 T;  2MST A;  1U0S A;  5G4D A;  2DD8 S;  1KS2 A;  2R7U A;  3F56 A;  1DZ5 A;  4JOU A;  4QR1 A;  2OP5 A;  2BQ3 A;  4ANC A;  2A1B A;  5L46 A;  1D9F A;  3IR5 B;  4J9U E;  3UD3 P;  2JLG A;  1HNX F;  2DXD A;  1HLW A;  4AXI A;  5HQM A;  1FTR A;  2C2Z B;  3MGJ A;  2HZA A;  4GC6 A;  1FDD A;  4WP3 A;  3CB4 A;  2VZ9 A;  1IBK J;  3BGL A;  2VA2 A;  2ABY A;  4ZN3 A;  4B9S A;  2ILY A;  1NZA A;  2L41 A;  3W8G A;  4X4O A;  4DS5 A;  4CT8 A;  5F3Z A;  3IWL A;  4DU8 A;  1Z1Z A;  1HFE L;  4F50 A;  3FKB A;  4IRC A;  2B9E A;  1BMQ B;  1S0V A;  1P1L A;  3NOC A;  4TU9 A;  5DQI A;  4DL7 A;  1ZM2 A;  3B4D A;  3RW6 A;  3DHX A;  1ZZN A;  4A8Q A;  1YG0 A;  2HHU A;  1FRJ A;  5F0U A;  1S99 A;  2C42 A;  1GH8 A;  2AX1 A;  2NUH A;  2AJ0 A;  4QIV A;  2G13 A;  5KFI A;  3NGT A;  3N79 A;  1JLF A;  2HBQ B;  3UWT A;  2Q66 A;  1SKU B;  5J1P A;  3K57 A;  2ZOM A;  2OD6 A;  4PEO A;  2LA4 A;  2HFO A;  1F1B B;  2RQC A;  3DLG A;  1U1P A;  5HBM A;  2GAG C;  4OV1 A;  4ZVE A;  4RNF A;  1IUJ A;  2XLJ A;  3I32 A;  1RWW B;  1H98 A;  1KFD A;  3WDO A;  4JI7 J;  4NLO A;  4ED4 A;  4QR2 A;  5KG0 A;  3BSA A;  4EGL A;  4L75 A;  2HND A;  2CXE A;  2DKO B;  2OEJ A;  2VQE J;  1UPM B;  2E1C A;  4F04 B;  3ET6 A;  4ZDN A;  3R5B A;  3CCV S;  1KD1 T;  3CJ3 A;  2FJA B;  1YJU A;  1HL6 A;  5FLX Y;  1GXL A;  1T03 A;  2XUL A;  1JLF B;  1X7V A;  2VON A;  5KFA A;  4G3I A;  4KGM A;  3QJP A;  3PIO Q;  3EE3 A;  4P52 A;  2FHJ D;  2QLJ B;  3FVY A;  5HBM B;  3PW0 A;  2CFX A;  4LRE A;  1TKX A;  2HHW A;  2DHS A;  4FF3 A;  4K4S A;  3IA0 A;  1L3T A;  5A8K A;  2HND B;  4OYA A;  1OPZ A;  1REG X;  1S6O A;  3TWZ A;  4ECU A;  3ET6 B;  1BUX A;  2JJ4 D;  2QYG A;  1F9H A;  1GK8 A;  4LJM A;  2Y0S D;  3SCJ E;  1XMQ F;  2DNL A;  2N3L A;  2CKW A;  2OFG X;  1UEU A;  2F9J A;  3CD5 A;  1FRX A;  1N32 F;  2OIH A;  2IRY A;  2NZC A;  1S9F A;  1C2P A;  2Q3P A;  5BYQ A;  4WFZ A;  3OR1 A;  5IT9 U;  1QLN A;  3NP5 A;  4USV A;  2I0X A;  1OWX A;  1UFL A;  4UT4 A;  3HK2 A;  1TKX B;  3FFI A;  4NYP A;  3LUY A;  3PRD A;  2YNH A;  2NSB A;  5A8K B;  4URQ U;  2YKN B;  2YWF A;  1GX5 A;  4NA3 A;  1HWJ A;  5KFN A;  2CNK B;  4XK8 C;  2H5I B;  3ENV A;  5HQ8 A;  2F8H A;  2WCX A;  4QPX A;  2ALZ A;  4PG8 A;  3H5U A;  4NLX A;  3RAX A;  2MY7 A;  1XC9 A;  4G1P A;  2N4C A;  1SPB P;  2ZH7 A;  1S6P A;  1UW4 A;  4OZ2 A;  3D6H B;  2F4V F;  2JZ5 A;  1RAG B;  4PG5 A;  3TZW A;  3QT7 A;  3TVY A;  3M6V A;  2HHQ A;  2E5L F;  1CSJ A;  2MDA A;  2B6A A;  3HHL D;  3KUE A;  5HMZ A;  4OFZ A;  2VV5 A;  1WAC A;  2BE9 B;  1YWX A;  4M5M A;  4O3S A;  1KVI A;  4OHV A;  1YTY A;  3FFI B;  2YKQ A;  4J9P A;  4EUV A;  1EHW A;  1V5I B;  2YNH B;  4ZPT R;  3Q2T C;  1IVZ A;  1S72 S;  3OHA A;  4XIU A;  2C3M A;  3OTB A;  3PIP Q;  3G8Q A;  1U8S A;  2FB0 A;  1N0V C;  4DR3 J;  3R27 A;  1OSD A;  1HYS A;  4ED7 A;  1VQ6 S;  2DEI A;  4N8O A;  2DPI A;  5AXN A;  1FJG J;  2DO0 A;  2MB0 B;  4DEZ A;  1TVR A;  2Y9H A;  2YKP A;  3I4P A;  2VQF J;  3MR7 A;  2QO3 A;  2RDD A;  3OVS A;  2DRA A;  2FC9 A;  1K44 A;  3RJM B;  2JLF A;  2B6A B;  4I69 A;  3TAN A;  3THT A;  1T9T A;  1LV5 A;  1D0E A;  3KDO A;  5A76 A;  2FY1 A;  3DLK A;  2UVW A;  3RBX A;  5K8O A;  5G0R B;  1HNX J;  3TI0 A;  2FD2 A;  1PC5 A;  1FHT A;  2ZWO A;  2CG8 A;  3CJ0 A;  1L3V A;  1H0H B;  2VA3 A;  2LDY A;  5EWF A;  1HA1 A;  1HYS B;  3Q86 A;  2FVP A;  1TFY A;  3QWU A;  2V2Q A;  2L08 A;  4RWX A;  1UWB A;  4IG0 A;  2H4W B;  1QSY A;  1WSV A;  1Y10 A;  1N8R T;  4OX9 F;  4Y0F A;  4DN0 A;  3ZTO A;  5KG1 A;  4V1A k;  4DQI A;  2J9C A;  5GAH I;  3R1H A;  3CCJ S;  4I67 A;  2CQC A;  2I1R A;  4QWE A;  3HSJ A;  2JL9 A;  2RDI A;  4MTP A;  3DLK B;  2UU9 F;  2BXJ A;  5GAE U;  2FHJ A;  3CJQ A;  4IR1 A;  1GEH A;  1VQP S;  1TR0 A;  3PCO B;  1BQN A;  3LW5 C;  5BYR A;  1KQF B;  4DSF A;  3FSI A;  4DV1 F;  4NEY A;  4OI0 A;  2YQ1 A;  3OTC A;  1S59 A;  5CYQ A;  1UWB B;  4IG0 B;  1S48 A;  3W5Z A;  1HAR A;  3OV7 A;  2IYI A;  1F9F A;  1R8P A;  3C6U A;  2DGT A;  2C3Y A;  1KHW A;  3AOB A;  4WKY A;  5LSO A;  3RBD A;  3DOL A;  3HVA A;  4NL5 A;  5CXT A;  2MQL A;  2F9D A;  4LSZ B;  4ZMM A;  4DX6 A;  1U1O A;  1GXU A;  3DRX A;  1X31 C;  3FSX A;  1H38 A;  3JYT A;  1MW7 A;  1BQN B;  4TLQ A;  2MZR A;  2AEJ A;  4W90 B;  4OLP A;  2M0G B;  1LNQ A;  3HI9 A;  1MMN A;  5CYQ B;  2MKK A;  2R8H A;  2YX7 A;  1T11 A;  1R8A A;  3JB9 k;  4USJ C;  2QMW A;  4DQR A;  4CI0 B;  2F5G A;  1VRT B;  5D4O A;  3G2X A;  1NO8 A;  3O44 A;  3CC4 S;  3C6U B;  5ETM A;  2XEX A;  5CZV A;  1UL3 A;  3GYG A;  3U1M A;  3K2Y A;  5LJ5 Y;  2WAQ D;  3DOL B;  3P8B B;  2N82 B;  1P9Q C;  2ZBQ A;  1TKZ A;  3ISN C;  3I56 S;  1S6Q A;  2ZKU A;  4QW9 A;  5DS7 A;  4NXM F;  1PAU B;  2BOP A;  2JOQ A;  3W63 A;  1SJQ A;  4X2B A;  4IR9 A;  2XBP A;  2J7W A;  3H25 A;  5CA5 A;  3JYT B;  4ELV A;  4AL7 A;  3IFE A;  5CCL A;  3D4J A;  1XMQ J;  4OX7 A;  4DUZ F;  1Y5I B;  2CJY B;  1RHQ B;  2D69 A;  1FKO A;  4NWB A;  2LEC A;  3QRP A;  3U27 A;  1SH3 A;  3R5J B;  4PG4 A;  2QLW A;  2A10 A;  5HJY A;  4F0M A;  1W2B R;  4URG A;  4B9U A;  1EAR A;  1TKZ B;  2NXE A;  1S6Q B;  4IFV A;  3ZZY A;  3JTN A;  3ZZR A;  2FQQ B;  4QPT A;  1CJK A;  3DOK A;  2NXN A;  1Q16 B;  3RAQ A;  1RA6 A;  4ID8 A;  1SQE A;  3JSY A;  4UUX A;  3HHL B;  2W9A A;  4QWD A;  3HVR A;  1YDL A;  2B7B B;  3K5O A;  2Y3Y A;  1KNZ A;  5E3C A;  1PC4 A;  2HWT A;  3C3L A;  4FYV B;  3MD1 A;  2VFS A;  3PRV A;  4Y6I A;  2DHG A;  3RRG A;  1FKO B;  1R0A A;  5F9N A;  3KFW X;  3H4D A;  2A6M A;  1HWI A;  3HKZ D;  4LFA F;  3LAN A;  2E5L J;  3A8I A;  4G1Q A;  2WK4 A;  1WEL A;  3M4X A;  2R7R A;  5L1J A;  1FNM A;  2RQ4 A;  4IFV B;  5L9X A;  4NLG A;  3AFG A;  1CJK B;  3W5X A;  3DOK B;  4PPZ A;  1OY8 A;  1FE0 A;  3F73 A;  3PDN A;  2LEA A;  2FJW A;  1N52 B;  1NME B;  4CWB A;  1WJ9 A;  1J2V A;  1T0T V;  2GW8 A;  3PM9 A;  4QBU A;  1XMO F;  4AL6 A;  5LM7 E;  3Q22 A;  3MEK A;  3R8Y A;  3SCK E;  1WUU A;  4IQM A;  4O3O A;  4NCA A;  2O67 A;  1R0A B;  2BOA A;  3LWM A;  3BGU A;  4OZ1 A;  1G4C A;  5D0E A;  2BMB A;  4LR9 A;  3MMC A;  1O5J A;  4G1Q B;  1VBY A;  2CWX A;  3IM8 A;  2VPW B;  4R0J A;  2VL1 A;  4BBY A;  3OUY A;  3ZZU A;  4WFB Q;  2R2U A;  4YHH F;  5D77 A;  3MAQ A;  5JMN A;  1YJ7 A;  3I9Z A;  2RU9 A;  5J1N A;  2XNQ A;  3W61 A;  1RCO B;  1RAJ A;  5D6G A;  2JHE A;  2O3D A;  3H40 A;  3VQS A;  3KUH A;  1KFS A;  4A4J A;  3N6N A;  2G4B A;  2R42 A;  2B9X A;  1S1V A;  4ED5 A;  1PYO B;  4CLL A;  4O0I A;  3BKT A;  2BUN A;  5AE1 A;  4OX9 J;  1HNV A;  1A0O B;  1FD2 A;  3CO0 P;  1YBU A;  1RU1 A;  1GT8 A;  4HAC A;  4JI2 J;  4YFU A;  1AFI A;  1Q53 A;  3KJQ B;  3MMC B;  2VFR A;  3WC2 A;  3SI8 A;  1WDD A;  1C1B A;  3OUY B;  2XMK A;  2KB2 A;  1RBL A;  1TL1 A;  1DQ9 A;  4HDH A;  5HLF B;  2UU9 J;  1IKW A;  1HBU A;  2J6T A;  2OO4 A;  3HFZ B;  1NHU A;  4FDF A;  4F8R A;  4CLZ A;  1VQK S;  4CO4 A;  2Z30 B;  2PSZ A;  2LDI A;  4DV1 J;  1KDN A;  2ZZT A;  1RWV B;  2KJW A;  3NBP B;  3Q8S B;  2VIH A;  2F7V A;  2HUR A;  1YGY A;  2UVR A;  1S1V B;  1RTJ A;  1N4L A;  3GE9 A;  2ZVS A;  2HG4 A;  3KLF A;  2N4D A;  2HFS A;  3DM2 A;  1HNV B;  4RNN A;  2XLK A;  1WOR A;  1B70 B;  2ALY B;  4HAC B;  4QYR A;  4DPO A;  5LSR A;  1C1B B;  3A8J A;  3KJF B;  1RHJ B;  3IR6 B;  1TL1 B;  4ID5 A;  1M0S A;  3MEC A;  1PIE A;  3N01 A;  4UST A;  1JJ2 R;  3GQC A;  3FEZ A;  1HBU B;  1Z4U A;  4HH1 A;  3T1H F;  1U25 A;  1URR A;  3UN3 A;  7FDR A;  1LK5 A;  1QUP A;  5JUM A;  4U95 A;  3MI7 X;  1FXR A;  1ROF A;  4CDI A;  3C2P A;  2MEW A;  2P2C B;  3BS9 A;  3IGV A;  2KKH A;  3RGI A;  4OV6 A;  5B0C A;  4PCQ A;  3RUB L;  2QA4 S;  3QBC A;  3MM5 A;  1LXJ A;  3D1O A;  2YTC A;  1WKL A;  4NMX A;  3V6D A;  2VFT A;  2F8E X;  2VJU A;  5ITH A;  5HVH A;  4Q8E A;  1RTJ B;  1S4E A;  4FKX A;  9ATC B;  1U1K A;  3DM2 B;  2FZG B;  4RL1 A;  2NPF A;  2SXL A;  2XNR A;  1FDA A;  1PKU A;  5C5J A;  1I5O B;  5KG5 A;  2BJD A;  4JV5 F;  1D8Y A;  1NU4 A;  5DJB A;  2ZUG A;  1FA0 A;  4ZS6 A;  1U6F A;  2LEP A;  1HBN A;  4ID5 B;  4NXM J;  4RPF A;  3MEC B;  3CDE A;  4U8V A;  4DV0 F;  2P8I A;  1R43 A;  4KY3 A;  2AYG A;  5KFD A;  1SKW A;  3F41 A;  5KOX A;  1WKJ A;  3PW2 A;  5F0W A;  2OAU A;  3TUI C;  2B4U A;  4DUZ J;  2ZEJ A;  1HI8 A;  3MM5 B;  1F9E B;  5CD4 A;  3TX8 A;  4DSL A;  3V6D B;  4NLD A;  3UCU P;  1YHQ S;  2BEF A;  3EZO A;  5DRK A;  1C0T A;  3VAM A;  4EO6 A;  3QLH A;  1S9E A;  3TUJ C;  2IHR 1;  4IRD A;  1UW9 A;  4ZVP B;  4WK1 A;  4FBT A;  2ZZM A;  3J7Y U;  4FYX B;  1AFJ A;  2JLE A;  1JK9 B;  1KSP A;  3O3L A;  4ICL A;  1HBN B;  4BHQ A;  4QU7 A;  1KEK A;  2ZOG A;  2WVC A;  4FF2 A;  2ZJP Q;  3PX6 A;  2DNO A;  3TQ1 A;  2N7Y A;  2KYZ A;  3BKU A;  3L09 A;  1NK6 A;  2DR5 A;  2MKS A;  2FJE B;  4FYW B;  2VBZ A;  4ZPW R;  4O3Q A;  2VKZ G;  3DHW C;  2E44 A;  3D2W A;  3Q8Y A;  4FF1 A;  1TMM A;  5H9E J;  1IN0 A;  2F63 A;  3GV7 B;  2EWH A;  2G0J A;  1C0T B;  1V3Z A;  4LFA J;  1U7L A;  1YQH A;  3QLH B;  2RRB A;  1S9E B;  5KTQ A;  3ISN D;  4FVM A;  2ZOF A;  1OY6 A;  1NH7 A;  3W9J A;  3NLC A;  4ED0 A;  1S4F A;  1Y00 A;  1GMU A;  1KN6 A;  3A3P B;  4ICL B;  2GFF A;  1RTI A;  3J7A N;  2HQC A;  4R25 A;  2W2M P;  4DR1 F;  3NNC A;  4P2X A;  2PA8 D;  3BM7 A;  2NZ4 A;  3DC2 A;  3QSY B;  2YKM A;  3EIC A;  1XMO J;  2MQP A;  1ITP A;  4Q0B A;  4PQU B;  1RT4 A;  2J8A A;  2WSE C;  4WCE Q;  2R7V A;  2C22 A;  3AD9 C;  1NDP A;  2KHC A;  2ZH3 A;  2GJI A;  3MWB A;  5LJ3 Y;  2QTW A;  3SCI E;  4ILM A;  2LXF A;  1PJ6 A;  1TKD A;  4YHH J;  2MSS A;  3MCN A;  4KV8 B;  1J5O A;  4O3N A;  8RUC A;  2J76 E;  1ICE B;  3GIR A;  2XLI A;  2LEB A;  5L1I A;  3TAP A;  1RTI B;  4U96 A;  1N5V A;  2C1E B;  4Q2L A;  3GG1 A;  4L3K A;  4LF5 F;  4DCJ B;  3JSM A;  2YKM B;  2I8E A;  1B0P A;  4ERD A;  1RZM A;  3K7R A;  3LGH A;  4Q0B B;  3BJY A;  3B82 A;  2PMH A;  1Y11 A;  1VS3 A;  1RT4 B;  3QGG A;  1WWH A;  2CG4 A;  3GSI A;  2M88 A;  4F4W A;  1E6Y A;  2XZD B;  3OBI A;  3D67 A;  3MDF A;  2LKZ A;  2AGQ A;  2ZH2 A;  4P73 A;  2CPF A;  2GQC A;  1S76 D;  2EEY A;  4V19 J;  3ENA A;  3PYE A;  1WOP A;  2W4C A;  1ZPV A;  1MG7 A;  4LRA A;  3MCO A;  2HZV A;  1T7P A;  3G8S A;  1XTZ A;  4IRK A;  3JSM B;  3T3F A;  1SL1 A;  1VK3 A;  2QLX A;  3CMQ A;  1M5P C;  2RVJ A;  2BJ3 A;  2GIR A;  2I2Y A;  2AJ4 A;  4Y2I A;  4MJK A;  4CO2 A;  1VJQ A;  3H2U B;  5U47 A;  4WTY A;  3THP A;  1IWG A;  1E6Y B;  2NYI A;  4C9D A;  5B7W A;  4I7F A;  2D3O R;  2Q79 A;  2CJA A;  1CBK A;  2MZ1 A;  2FTR A;  2FZC B;  4LF6 F;  1FEE A;  4XTT A;  4TLR A;  1CJV A;  3IWN C;  2HQI A;  1S12 A;  3T1H J;  1FRH A;  2CWK A;  5HAT A;  5GAE I;  2PEB A;  3EVW A;  5AXK A;  2FVS A;  2UXB F;  2XM3 A;  1VLY A;  1UET A;  4KJI A;  4K4U A;  3OL7 A;  2NSC A;  1S0N A;  1HQ2 A;  1XIQ A;  2E1R A;  2I5J A;  4BWJ A;  4PWW A;  1R0B G;  4B08 A;  1Q5Y A;  3U7J A;  4F26 A;  3TZX A;  1YJT A;  2B3T B;  2DTJ A;  4ZLJ A;  4ZPB A;  1VQY A;  1X5S A;  2MJN A;  4I7F B;  3PR5 B;  4JV5 J;  2CJB A;  2EW9 A;  3AAW B;  3UE2 A;  3L9Z A;  1ZAW A;  4USM A;  4MT1 A;  3KKF A;  1BGX T;  1VYA A;  2XZW A;  1CJV B;  4DG1 A;  3HVW A;  4DV0 J;  4KO0 A;  1EET A;  4B9L A;  4ZP9 A;  2HHS A;  3I9V 9;  4ZVG A;  1DHM A;  1RHR B;  5KFS A;  2HQD A;  3VZH A;  2DJW A;  2E9Z A;  2AYE A;  2I5J B;  1FNO A;  1Y3K A;  3NRB A;  1KRP A;  4RBV A;  2WVE A;  2B4V A;  1RT7 A;  2BAN A;  3QO9 A;  2KXF A;  1AB8 A;  4YUD A;  5F41 A;  1IKX A;  4U7C A;  3VVT A;  1LQ9 A;  4MKV A;  1U0H A;  4K59 A;  2MTL A;  4X4N A;  1Y5L B;  3KJV A;  4OI1 A;  3CJ8 A;  2CQI A;  2P5V A;  3S1T A;  1U6B A;  3EJM A;  3D0I E;  2QMX A;  4DG1 B;  4DSK A;  4IYQ A;  4KO0 B;  3MPY A;  3CNQ P;  4OL8 A;  1EET B;  2MHE A;  3T9N A;  2VPX B;  2KZM A;  1OMS A;  2YNG A;  2UUC F;  3ENW A;  4JV1 A;  2X3D A;  4G6V B;  1WG4 A;  3QMQ A;  4RKU C;  3MMJ A;  4TYB A;  2ZH6 A;  2YBV A;  2QT7 A;  3KNG A;  5ETV A;  4EBD A;  1IBM F;  1RT7 B;  2BAN B;  3QO9 B;  3SIP B;  1NDC A;  3VR1 A;  1SQF A;  2ASL A;  4DZD A;  5E3Q A;  5F8I A;  1IKX B;  3HDS A;  2OUG A;  2HRU A;  5KOW A;  3M8P A;  4I2Q A;  4KRW A;  4ZVF A;  3KJV B;  4L72 B;  1VFJ A;  1W26 A;  2CVE A;  1JJC B;  2MGZ A;  1DLO A;  2DR9 A;  5K8N A;  3KYL A;  1OJ4 A;  2CPI A;  4IKA A;  2H5J B;  2XS7 A;  1RYS A;  1U6Z A;  3EWG A;  4DR1 J;  2HHT A;  5ETL A;  2IA6 A;  2UUB J;  2RRN A;  2YNG B;  1CLF A;  3T41 A;  4KIA A;  3OFF A;  1BD6 A;  2IJR A;  2ZD1 A;  4JI1 F;  1RHU B;  1QD1 A;  1X5O A;  4QIE A;  3MMA B;  5IM0 A;  1R31 A;  4LSL B;  2XGP A;  2VIC A;  3OXL A;  1F3V A;  3C6T A;  3GJR B;  1RKJ A;  3M8P B;  4I2Q B;  4C97 A;  3DLB A;  3AOD A;  3PFO A;  2G9O A;  2ZUA A;  1NRK A;  2ZHO A;  5DQG A;  1LWF A;  1NHK L;  3MHY A;  3IGN A;  1P8G A;  3M8Y A;  4YDX A;  2MGZ B;  1DLO B;  3CPW R;  4ED1 A;  2RS2 A;  3VAL A;  1FF2 A;  2DEJ A;  3NS6 A;  2P9G A;  3AQO A;  2HHP A;  3DDI A;  5KFY A;  4HEA 9;  2AP6 A;  4WU3 A;  1AXQ A;  5KFK A;  4LF5 J;  4EYI B;  1CPZ A;  1SI9 A;  1RT3 A;  2X51 A;  3M8Z A;  3JQM A;  2B9W A;  3BPS P;  2ZD1 B;  3HD1 A;  1QSL A;  3LA0 A;  3JQJ A;  5KFV A;  1WC0 A;  3J80 U;  5IM0 B;  4EO8 A;  1WOO A;  5ETN A;  1CUL A;  1PSD A;  1X4G A;  1Q5V A;  2HMI A;  1Q95 G;  3CW2 C;  1LWX A;  1FFW B;  3NGS A;  1NZ8 A;  4AT1 B;  2B7C B;  2R2S A;  4CH1 A;  3PG9 A;  1JLC A;  3NGK A;  1LWF B;  4ETX A;  3HO1 A;  2AZ1 A;  2X1F A;  4KB7 A;  1SL2 A;  3GP9 A;  4JI3 F;  2HHX A;  4MK8 A;  1S6U A;  4Y2C A;  5KFQ A;  3GPA A;  1MWZ A;  4XPE A;  5IS2 A;  1SC1 B;  3G87 A;  2QMU B;  3NAH A;  3LOU A;  3CC7 S;  4PAB A;  1P27 B;  4L73 A;  4C4W A;  1LK7 A;  4WKR A;  2HRT A;  4MKY A;  1X8D A;  1IWA A;  2D1C A;  3MF5 A;  4AXJ A;  3PW5 A;  1TU0 B;  1CUL B;  1CG2 A;  2W7O A;  2GMJ A;  3D6T B;  4WFN Q;  3RW7 A;  3Q8V A;  1U1N A;  2HMI B;  1YRX A;  1S1X A;  1VQ5 S;  4K2X A;  2DO4 A;  3W3S A;  4LF6 J;  2VB6 A;  1JLC B;  3KLI A;  2GML A;  2Y0B B;  3QRR A;  3DGV A;  2MQO A;  4PKD B;  2CVI A;  3CCE S;  1FX2 A;  1GX6 A;  1PJ7 A;  4A8W A;  3M6U A;  3IAS 9;  4ZJL A;  4CLT A;  1DJ0 A;  1HHT P;  2J9E A;  1Q82 T;  1RTD A;  3G8T A;  3EGV A;  1S79 A;  4Q44 A;  2R2T A;  2L9N A;  4MIB A;  3WQP A;  2M8H A;  1MU2 B;  4USW A;  4U67 Q;  3GV8 B;  4R5P A;  3X3U A;  2AT1 B;  4K5S A;  4UOC A;  3J7A 1;  3DDN A;  1XR5 A;  3OD2 A;  1T9V A;  1K8A T;  1S1X B;  3SSR A;  5IQ6 A;  3GU0 A;  2HVH A;  3KLI B;  2DR7 A;  1HQE B;  1BQX A;  3PFE A;  3N5F A;  4HDG A;  3CF5 Q;  5KFJ A;  2R2R A;  1M5V C;  3M2V A;  4M5D A;  3EXC X;  4K50 A;  3EUN A;  5A0Y A;  2QC3 A;  4KTQ A;  1WHV A;  1WSR A;  2DRB A;  4A8S A;  2WVD A;  1RHM B;  2H4Y B;  1RTD B;  3MAA B;  3KK2 A;  3QAU A;  4XPC A;  2J7U A;  2V69 A;  4DL4 A;  4LF1 A;  1X4E A;  4PWU A;  4KFB A;  2FHO B;  4X4P A;  4EU0 A;  2I6W A;  4R5P B;  1K0T A;  2EPI A;  2O01 C;  5CYM A;  1RU2 A;  3I5C A;  3TZZ A;  3J7Z 5;  3HHN B;  2XHW A;  3FBE A;  3DFE A;  1KWM A;  4KH0 B;  4C8L A;  1XNR F;  2WRM A; 
#chains in the Genus database with same CATH homology
 1V5I B;  1SCJ B;  2Z2Z A;  4YN3 B;  2Z56 B;  3BGO P;  2W2O P;  2W2Q P;  3CNQ P;  3CO0 P;  4K8R A;  2PMW A;  4NMX A;  3VV2 B;  2ZWO A;  1SPB P;  1ITP A;  2W2N P;  3WHI A;  3P5B P;  3T41 A;  1R6V A;  3AFG A;  4JP8 A;  2QTW A;  2W2P P;  2Z57 B;  2Z2Y B;  3A3N B;  4NE9 C;  3VHQ A;  2Z30 B;  2ZWP A;  3A3P B;  3SQO P;  2E1P A;  4OV6 A;  2Z58 B;  3BPS P;  2W2M P;  2XTJ P;  3GCX P;  3WIU A;  3H42 A;  3GCW P;  3QFH A;  3A3O B;  3WIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...