3PJ9A

Crystal structure of a nucleoside diphosphate kinase from campylobacter jejuni
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
137
structure length
137
Chain Sequence
MEKTLSIIKPDAVKKGVIGKILDRFESNGLRIAAMKKVQLSKEQAENFYAVHKERPFFKDLVEFMISGPVVVSILEGEGAVLKNRDLMGATNPKEAKAGTIRADFAESIDANAVHGSDSLENAKIEIEFFFKPNEIC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Nucleoside Diphosphate Kinase from Campylobacter jejuni
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 42
structure length 137
sequence length 137
chains with identical sequence B, C, D
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2010-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3pj9A00
3BH6B 1S57A 4ANEA 1MN9A 4F4AA 1WKJA 3EVOA 3EJMA 1HIYA 3L7UA 1WKLA 2AZ3A 1NB2A 1NDPA 5C7PA 3MPDA 1XQIA 3BBCA 1K44A 3PJ9A 2DYAA 4WBFA 3ZTRA 3FBFA 1NSQA 5IOLA 3ETMA 1PAEX 3FBBA 5CABA 3DKDA 1NDCA 3FC9A 4UOHA 1S5ZA 1XIQA 3NGTA 1WKKA 3FCWA 4O0NA 3PRVA 1KDNA 3ENAA 3G2XA 3Q8VA 1S59A 1F3FA 3GP9A 3FKBA 2VU5A 4DUTA 1NSPA 1NPKA 4ENOA 3EE3A 3BH7B 1HHQA 2BEFA 3VVUA 2CWKA 1BHNA 3B6BA 1NLKL 1NDKA 2B8QA 1UCNA 1JXVA 3B54A 3Q83A 3EICA 2HVEA 3VGUA 3VVTA 2BX6A 3DDIA 3ZTSA 3Q8UA 4DI6A 1NSKL 1B4SA 2B8PA 3NGRA 5BXIA 1EHWA 4S0MA 2DY9A 4FKXA 3WX8A 4KPCA 1MN7A 2HURA 1NCLA 3FBEA 2DXDA 1NUEA 1LWXA 3NGSA 2NCKL 4HR2A 1W7WA 1HLWA 3Q89A 3ZTPA 3NGUA 3EMTA 4C6AA 1PKUA 3EVWA 4F36A 1BUXA 3EM1A 3VGTA 3ZTQA 4ANDA 3FCVA 4DZ6A 3ELHA 1NHKL 1BE4A 4CP5A 2ZUAA 3VGSA 4UOGA 3VGVA 1LEOA 3GPAA 1F6TA 3EVMA 3R9LA 3ZTOA 3Q86A 4UOFA 4W98A 3BBBA 3Q8YA 1B99A 5CAAA 2HVDA 3JS9A 1NDLA 1ZS6A 4FKYA 2DXEA 4EK2A 1VYAA 2DXFA 1U8WA 3FBCA 2AZ1A 4ANCA 3BBFA
chains in the Genus database with same CATH superfamily
4A47A 3OTBA 3IGVA 2MQQA 1VFJA 4O3PA 5KFWA 3V4MA 5F8MA 2B43A 2H1YA 1YRTA 2HZAA 1E6YA 5AJ3F 5J2QA 2N4DA 1CQMA 4Q44A 1SJFA 3R2CJ 3GIIA 1TK0A 1NDPA 3MDFA 4WFNQ 2RKIA 4HT5A 4C8YA 2QFJA 4ZS6A 2GAGC 2FJBB 3JTNA 1TL4A 3K59A 4JI3J 3M32B 3FJ2A 4LR9A 1CSJA 1DAXA 4M63A 3LP1B 1XEZA 1S5ZA 1UEVA 1XIQA 3L09A 1N5TA 1L3TA 2CQDA 4K0KF 2B4PA 2PEHA 3HFVA 2V5HG 2BE9B 1F9FA 4OHWA 3FZ2A 1WKKA 4QW9A 3RBDA 2E9TA 5D0HA 5JVGQ 4F67A 3HCXA 3M8PB 4Z7CA 4X4OA 4OI0A 4NXMF 4OYBA 1M5KC 2V34A 1YBUA 3GFHA 3NP5A 3P3DA 1CJTA 4RNOA 5KG4A 3DXSX 2FGOA 4ZJOA 2DH8A 5J2MB 2MKYA 2PMZD 4DL3A 1RTDA 2M52A 3R7SB 2XHCA 2GHPA 4B3TJ 3KHLA 3N01A 1UFLA 3O2IA 2E9RX 5A0YA 3QFWA 3T1HF 2ZWOA 1LW2A 5LSLA 3VVUA 4JI8J 1Y5IB 3ZNJ1 3DHXA 3B6BA 5C42A 8RUCA 4KJIA 2FZGB 3K2YA 2AMCB 3W8GA 3M6VA 3QAEA 2C3PA 3G6XA 2UUAJ 3MR7A 3M2UB 5E2QA 1Z2ZA 1CS4B 4ZKAA 6FDRA 3Q24A 1X0FA 1AFIA 5IV4A 2GGPB 1LWEB 3A8KA 3ZTSA 1JWWA 3Q8UA 2RNEA 4DI6A 4FXDA 4Q2MA 2DGSA 4J9UE 4YR3A 2V8HA 5ETNA 1HQEB 2AGPA 2JC0A 3THPA 5IT4A 2YNFA 4NCGB 5KFOA 4ZP6A 4ETZA 3FNNA 2KXFA 2H4WB 4QIEA 4NXNF 5LMUF 3M8SA 3Q8SB 3GMGA 3OL9A 4RW9B 1VJWA 4O3QA 4HH0A 4JI7J 3FBEA 1MLAA 4KHRA 1HD0A 3VALA 1R8HA 4EZ9A 2JHEA 1RT5B 3HHLA 4NI2A 5HATA 5DLGA 4ED2A 2MJUA 1RTHB 1GK8A 2MKHA 2NCKL 2IAJB 1P27B 1IJEB 2O1PA 3BB5A 1U0SA 4WXOA 3DHWC 5A6WA 4Q45A 1RABB 3CCVS 1RT3A 2NUHA 5ETRA 2GVDB 4DS4A 4KSEB 3TAMA 1SH0A 2J5AA 3CT9A 4L3NA 2QG9B 3U27A 4DLEA 2DGTA 1NRKA 1VOMA 2W7AA 4I4BA 2XYPB 3I4HX 4OYZA 4O44A 4LVNP 5HK4A 4CYUB 4F8RA 2QA4S 1MU2B 5LM7E 3CE8A 1YQHA 1RBAA 3CCES 2XMWA 3BM7A 2IJNA 3EZOA 2QV6A 3F56A 2LA6A 4AL7A 5J2NA 2YWWA 1KSPA 1LOUA 3GILA 3DLHA 1N5SA 3MM6B 3UI3A 4YB5A 5DG9A 3RZAA 1IXKA 3GSDA 1U2CA 3H4DA 4ECYA 1IQZA 1WORA 2XNRA 4LQ9A 4ZCIA 3LO3A 4JBCA 2KXHA 5ETKA 2Q66A 4PQUB 2AYEA 3A8IA 3MM8A 5HLFA 3KJQB 1AXQA 1CS4A 3N5FA 7FD1A 2V69A 4NZ0A 4P72A 2PC6A 4LFBF 1P6TA 1VBYA 2ZOFA 1S0NA 4C3MA 5HJYA 2KFNA 2ERRA 1X60A 5L1JA 5K9FA 4HHHA 2ZJPQ 2Y9HA 5KG7A 4DV7J 2LFVA 1C4CA 4ZLPA 2IJFA 3IS9B 2FJWA 3TYTA 2FDNA 2ZUGA 5GAHU 3FSIA 5M2UA 1RHQB 1U6FA 3BR8A 3OFFA 4KRWA 1KFDA 1I3OB 2HBRB 2WOMB 3HMJG 1YG0A 3OTOF 3KLGB 3EJMA 3ZZRA 2J8AA 1S97A 2E5LJ 1YJNS 3QO9B 1TL7B 2AZ3A 2NSBA 5C7PA 2HS4A 1S7IA 1IJFB 2ZC3A 3MR3A 1MROA 3UNYA 3DMJB 4H4OA 3IBWA 3AB4B 4RW4B 5F9NA 2V50A 3H5SA 2OFGX 2VQEF 3KK1A 4ZLJA 5D8HB 3GCXP 3MZIA 3SIPB 1X9WA 1WG4A 3NGDA 4I6WA 4P2SA 5T41A 2UUCJ 1N5YA 2Z8QA 3MTJA 4U6PA 1URRA 1C1CA 4CO0A 4QQBA 2GIQA 3C19A 4ES1A 4CM2A 7FDRA 5H9FJ 3OJSA 4LRCA 1WEXA 4IO1A 4AUKA 3GYGA 4ZCMA 1TL1A 2ZBIA 5HSPA 4WFAQ 3CCLS 1JK9B 2FHMA 3F44A 2ROPA 4D3HA 1TAUA 3AD9C 3AAWB 1WC5A 2WSEC 3GIKA 1WI8A 3I5CA 4X62F 4ED7A 1OS5A 4IKAA 5KFGA 5K20B 1KQSR 5DJBA 4M5IA 2BQ3A 1UFKA 2ZKTA 3RU0A 4ED6A 2EFNA 2MHNA 4L73A 1K47A 2O66A 3M8PA 2PGCA 3BGLA 3JQJA 4LT6A 5E3RA 1KOHA 4TQRA 5MLCV 5GAHI 3EICA 5B0FA 2AJFE 4M5DB 4KGVB 2LP4A 1YJVA 3QSIA 3VQTA 2FVRA 1IKYB 1D1UA 4PUOB 3J81j 1RWXB 5HBMB 2VG6B 4MYUA 2W9BB 3D5MA 3U1LA 2HHUA 2R7SA 2NSCA 1NSKL 2B8PA 2WB4A 3C6TA 3RGIA 2G1DA 5DM6Q 4HH1A 4J9OA 4DV1J 1UPMB 1WHYA 2YBVA 3OBIA 4WK1A 4JI6F 3RAQA 1U1QA 1RJJA 2MZSA 4ILLA 2KZMA 2FYXA 4PXEA 1Y3KA 4N56A 3MMBA 2H5EA 3BN4A 3MEDB 4ED4A 4ZPBA 1RT1B 4UY85 2FGCA 4BWMA 3ET6A 3QGIA 3NMAA 4RL1A 1C0TB 3G8QA 3H2VE 3MFIA 1SC1B 5DG7A 1TK8A 3HHNB 3QJLA 2HWHA 4QYZK 4UOCA 5A8KA 3TOQA 4DMZA 3L9ZA 3BYPA 4HR2A 2CPZA 4H54A 2Q3PA 1M5HA 3M6WA 1RAOA 4R5PA 4I6YA 4A48A 3AXKA 3EMTA 2LQBA 5G4DA 4NLOA 2NPFA 1X5SA 1GMWD 1NJWA 2RDDA 1U8SA 3ZTQA 4HHUA 1KHVA 1PSDA 1G1XA 3FCVA 2OPQB 2M8DB 2HNDB 1YJ9S 2Z4PA 2V68A 2B4VA 2O5DA 3DOKB 3HULA 4OYAA 4AXIA 4F0KA 5K8PA 2RIJA 4LFCJ 1T9WA 4NXNJ 2ZD1A 1FX2A 2IDEA 4O3NA 3W62A 4CP5A 3W61A 1CQNA 3ZNUA 1LK7A 2KJVA 3BR9A 4NCBA 5D78A 3K5MA 4OHZA 2ADBA 5H1SV 1VISA 1IWGA 1KQFB 3DM2A 3EVMA 3SCJE 3V2UC 4JI5F 1FKPB 1FTRA 1U02A 3HSDA 2VIHA 4K4YA 1Y9OA 2CVEA 1RT6B 2LXIA 2O01C 4OZ3A 1CG2A 3H2LA 1FTCA 1SKWA 1J5EJ 3TZZA 5IT0A 4C97A 4IG3B 5GMDA 3B4DA 3Q8YA 3LP0B 4OYMA 3G87A 3HHLD 3D4JA 1HL6A 1RGVA 2DK2A 4D3GA 1YJRA 2CQ2A 1HQUB 1U26A 3QNWB 2AX0A 1WI6A 3HD1A 1DURA 3RTVA 3T5HA 2AZ1A 1YIJS 3WQPA 1F9HA 2CADA 4ANEA 3QAUA 1HPZA 3PY8A 2G9OA 5H9FK 4USWA 4ZVGA 2GW8A 3LA0A 4QIVA 3I55S 5LMNJ 2R2SA 2R7WA 4ECZA 1S6UA 4CIOA 3O8WA 1QAIA 3KXDA 1JLAA 2E5GA 1HQUA 3PJ9A 1SXLA 3DLKB 4OI1A 1H0HB 1K1QA 2C2NA 4CH0S 3G6YA 5A8KB 4DL5A 1RAFB 3T9NA 4JI3F 4NEYA 2RKIB 1S99A 1JJ4A 3MGJA 4F4XA 2YKPA 2X3DA 3K8VA 3SQGA 1YJWS 1PO6A 1UL3A 1NK7A 1DTQB 5THWA 3PRVA 1XERA 4AYBD 3K58A 2VJUA 1VRTA 4GO5X 1TR0A 1S1TB 3JAMY 3CWJA 5A8RB 4IH6A 3BSNA 3NLCA 4P6QA 2YVSA 1WG1A 1F3FA 2P8IA 3KHGA 1FRXA 1S12A 5HBMA 1NBEB 1RHMB 5D4NA 2B9WA 1SB6A 4ZOSA 3EE3A 5IWAF 2ZE2A 5J2NB 1UFWA 1QTMA 3QGHA 5E0OA 2HSEB 5G0RB 2U2FA 2IA6A 4OZJA 1S76D 3TARA 1RAAB 4JI1F 4ZPCA 5GADI 1HR0F 5AXKA 2E1RA 4BC9A 4JV0A 4EO8A 2HVEA 4A4JA 2WBRA 4G65A 3DDNA 2V2KA 1MMLA 4N77A 5FIIA 1KVKA 2HQFA 2K7KA 4KV8A 2R8HA 4DL0C 2V94A 3TZYA 1FHTA 3DRPA 5ETLA 3TNVA 1D8ZA 2WRMA 2IM2A 1TKTA 1YKWA 4ITSA 4ZPAA 5J2PB 3L7OA 3VWSA 4C0BA 4DL4A 4MIWA 4NCAA 3UDEA 1XR7A 2AD9A 1EX8A 2R9LA 1AA1B 5HMXA 4X4SA 3SI8A 1RCOB 1FESA 2DXDA 5LSOA 1X4FA 5KFCA 4XO0A 1VRUB 1T9VA 3M9NB 3PW7A 3P5BP 3OHBA 3NGKA 3NGSA 4C11A 1IKYA 1A7GE 4ZVRB 1VS3A 4RUBA 5K8OA 1WWHA 3CCUS 1S48A 1S77D 3K5NA 1VQSA 1SQEA 3Q89A 3DMJA 1TFYA 3ZTPA 2OO4A 4WWSA 3E01A 2BE2B 2EG2A 3PDNA 3T19A 3OJUA 1RUSA 4IOAQ 1GTHA 1HBUB 3ISZA 4PEOA 3VGTA 3WZ0A 3ULHA 1XMQJ 1PGZA 2MDAA 2OPPB 2W4PA 3CSKA 4MYTA 4K4TA 3RJMB 4DV6F 3R7NB 2HQDA 5EWGA 3ENWA 1M5PC 3GV8B 4UUXA 3IS9A 1T94A 2B7BB 4ZCKA 3GJSB 3VGSA 1S72S 2HHXA 2HFUA 5HMYA 3LPYA 1X4BA 3KK2B 1IBCB 1RT4B 1DY3A 2ZFHA 1Q4RA 5JXSA 4GKKJ 2Y3YA 4X65F 2EC2A 3CDEA 1GX6A 4X66J 2BACA 1NZ8A 2XMTA 2OPPA 4IH5A 4CM0A 2V9KA 1V9OA 3H40A 2WW8A 1CJKB 4KC5A 3PKYA 3R5JB 5L9XA 5KT5A 1NPRA 4W98A 1VLOA 3CC4S 1QAXA 2L41A 3GG0A 4NLQA 2JLFA 1S4EA 3KK1B 4Y2MA 3MM6A 4X64J 2IYGA 2ZM6J 2JFKA 1X4EA 3MEEA 2E7VA 4EFAC 2G0IA 2CG8A 1X9MA 3NNCA 3T9ZA 5KAKA 1F9EB 3JXOA 1CC8A 3MM9B 1IKXA 1PC4A 2WK4A 2GHVC 4ICLB 3SYZA 2FLPA 5B08A 5DDQC 3LTOA 1XNRF 2LQ5A 2ILZA 3MMJA 5L8RC 3UN3A 4CLPA 4WZQA 2PT0A 1GNKA 1PYSB 1VBKA 3U1MA 1JJHA 4B3MF 4ILMA 3MPDA 3KHHA 1YDLA 1J2VA 1HNZJ 2ZOMA 1AB8A 5E7OB 1XNQF 1Q5YA 2KM8B 2ZZNA 1ZAXA 4KKOB 3J7A1 5IV3A 1Q8IA 4DQQA 3M4XA 1HR0J 1FK9A 4FZVA 3R1HA 2XB2D 4I67A 1X8DA 3DXBA 1RT5A 2EFQA 4NI2B 2MQLA 4TLRA 5DO2A 3QZ7A 2UV8A 4FYYB 3M2RB 2VDHA 1KOOA 5K14A 2MHEA 2WVBA 3SZ2A 1XMOF 5G0RA 4NLGA 2G1HA 4EEYA 5ETTA 3IM8A 4NRTA 4MH8A 3OL7A 3ENAA 4N8NA 4YS2A 1KLMA 2ZE2B 4MK8A 4PXDA 1Q53A 3PVXA 3C46A 1WC0A 1HNWF 5BR8J 1HQEA 3X3UA 1M5OC 1RHRB 2HNYB 1VIXA 2GHWA 2QN6B 2B51A 4UTGA 1NSPA 2QMWA 4YB6A 4DF4A 2XEXA 2W8LA 1YBAA 5KG3A 2UVUA 1SH2A 4O44B 7AT1B 4Y00A 4TXSA 3UVJA 3CJ5A 1TKZA 5B0CA 1WTFA 5C2CA 2QLWA 3TUZC 3D1QA 3PR5B 3CCJS 1FFSB 2KVQE 2IHR1 2D69A 2CXEA 5HO4A 4F2SA 2BMBA 2J7KA 1LW2B 3JSBA 3HVAA 4NA1A 2HHHF 3GE9A 1U6BA 2AV5A 3TZWA 4E98A 5EHHA 3OL8A 4K59A 2CQBA 1FEEA 2OD4A 2L3MA 2JH3A 1LXJA 1YJUA 3CIZA 5IQ6A 4LRAA 1EB0A 2H4YB 2V8DA 1BQNB 3KFWX 2DIVA 4GVBB 5J2MA 1N36J 1IBKJ 2WONA 3I5AA 5LJ5Y 3PX6A 2JZ5A 3RAXA 3Q22A 2QO3A 1HI8A 1DQ9A 1YZ7A 4P10A 4DV0F 4WTYA 2WVFA 2HFOA 4ZVTB 1J5OB 4ZVQB 4QIFA 1M1HA 4DSKA 4FNIA 2K1RA 2XYGB 2XBPA 2A3JA 3K8WA 3LP1A 2KHDA 1FRMA 2GGPA 1TZ0A 5D4PA 3BO2A 2OTLS 3NKYA 4DOZA 1QY7A 5KT2A 4C0OC 1J5EF 2AEMA 1Y5NB 3FDSA 1BQXA 5KFYA 1PKUA 2VPXB 5D3GA 3OTDA 2E5HA 1RT6A 4ID5A 2F7VA 3HVRA 2LA4A 4MKYA 2ZC4A 4V19J 4OX9J 4XPEA 3BS9A 5DQGA 1ZM9A 2ZDOA 2I5JB 3DN9A 2A6OA 3CJTA 2H3EB 1MSWD 2GQ2A 5HP1A 4QR1A 2HLUA 2JOQA 3HF5A 2OLWA 4HL9A 4HVZA 4DF8A 2POKA 2ZUAA 3AOCA 3OV7A 5RUBA 5GMEA 3OLBA 1LEOA 1FJCA 3Q2TC 3TANA 3G82A 4M8LA 1VK3A 1RHUB 3CDUA 1MG7A 2CPJA 4FP9A 3BSAA 1VI7A 3JQKA 4HHJA 1N52B 2HVZA 1HHTP 4HI2A 5HVHA 3ZC4A 3Q86A 2JX2A 4TQSA 3TI0A 2D1CA 5EWEA 1L3VA 3D0GE 3I0RB 1TL3A 4LR7A 2BOAA 2PN6A 4CH1A 3H0PA 3QMQA 3KG1A 2KB2A 2APOA 1WD6A 1SJQA 2KYXA 2M3DA 1XNQJ 3HK2A 2DCUB 1N4LA 3PCOB 4JV2A 1X7VA 3P5TL 3W64A 2AWZA 3SBMA 2EXUA 2C42A 2NYHA 3MMAA 1CJVB 1RT1A 4I0WA 2UU9J 3CULA 4XPCA 4PWWA 1HYSB 3EVOA 2QA2A 4LF1A 2HAFA 2DKOB 4HT7A 1CBKA 1H2UX 2JFDA 2LXFA 4TYBA 2C2ZB 4CZCA 2G0CA 4EBCA 4G3IA 4USHA 5HQMA 4X64F 5H9EK 4F26A 1RBOB 1IKVB 1K44A 2V6AA 1EIYB 4O3RA 4F4ZA 2LQ9A 4B3OB 1GFWB 2FHJA 2DISA 2IPOB 2GJFA 2XI2A 3FEXB 5D3GB 2M88A 3ZTRA 2AU0A 2XULA 2EWHA 4MKVA 1IKWB 2OUGA 4OZ5A 1S1XB 3A3PB 1KC8T 2IRYA 4QZVB 3R5CA 1H72C 2ROGA 2BABA 2FJDB 1M1GA 2MEWA 4J37A 1EETA 1VBXA 1KDNA 2QSWA 3NWRA 2LU2A 3N5BA 1SJRA 1OPZA 2MKCA 2QLXA 3OVAA 5A2QY 3LP2B 1T3NA 4EU0A 2ZH6A 6FD1A 1RTIB 1QUVA 2B4UA 3FKBA 4LF8F 3UR0A 2RUGA 5J1EB 3KLHB 5IT9U 1Q8LA 3OXLA 3MAAA 5DQIA 1FD2A 4ID8A 4LR8A 3AOAA 4OV1A 2H5IB 1VK8A 3HO1A 3P45B 5KFTA 3E51A 4UUWA 3R27A 1I94F 2P9CA 3MEKA 4IFYB 3R8YA 3BDPA 3N6NA 4AQYF 2CPEA 3T6BA 2FJEB 2G13A 3M30A 1WEYA 2LQ8A 3M8ZA 4K2XA 4OX8A 3RB0A 3OXGA 4R8UA 3IO1A 2D74B 5CH7B 4CNYA 3M2VB 2M4MA 4CLLA 4PABA 2NR0A 2X7IA 2YH0A 3JSYA 3QO9A 4DPWA 3QGPA 3KLGA 2ROEA 3VCDA 2CNLB 5KFIA 3VAJA 1NK6A 5FDLB 4DR2F 1GXLA 1JLEA 3RRGA 3OTEA 1P9QC 4A8WA 1JLCA 1KTVA 2BJ1A 3F73A 1LWXA 3DC2A 2KXNB 1FX4A 2MSSA 2V4JB 2I38A 3T5LA 4WU3A 1ZH5A 1VQ4S 4ZJQA 3NNHA 4LFBJ 3KTQA 3MM7B 1RADB 2CPHA 4IDKB 2A2DA 1HI1A 3WHIA 1Y7PA 4ZVUB 4ZDNA 4NLVA 4K50A 1R7IA 1OYDA 5LT5A 1WSVA 3W1YC 4B02A 2VHGA 4FYVB 2XZWA 3AQPA 4F50A 2DR6A 4B3SJ 3CMAS 1U48A 2I8EA 1QSSA 1VJQA 2ILYA 5HJXA 4QWCA 1RLDA 1UPPA 2ZVSA 1VQMS 4E0DA 2VOPA 3BGFA 2Q6CA 5C25B 1B64A 4LSNB 5CYMB 2MXYA 1RZMA 1HWJA 4PG7A 4CO5A 1JJCB 4DX7A 1MU2A 2NYIA 2KH9A 3NBPA 2B6AA 5KFXA 4PYDA 4Y2IA 2HPUA 5ADZA 1SPBP 2HNZB 2KJWA 2XLIA 4EYHB 3OFHA 4DG1A 2RDIA 3TAMB 2M0GB 2P6SA 3AH6A 5DETA 4UOFA 3G71S 3NL0A 1N33J 2XSJA 4CTAA 3QIPA 4IG0A 2JLGA 3OR1B 1N56A 3D68A 4LRFA 3SV3A 1QAJA 2CQCA 2RRNA 1ZS6A 3R5BA 4OZLA 2B9XA 2VV5A 3CIMA 4P73A 3VAFA 1VQ6S 2VODA 2YKQA 2C2KB 3MD1A 3J80Y 2YNIA 2DXFA 2YX7A 4NLYA 3GYNA 4DQSA 1LXNA 5LMNF 1S1VA 2F8HA 4DR2J 5E3PA 1FWLA 4DBQA 1IBMF 2BDPA 4M5JA 2V4JA 3T5KA 1RAGB 4RW9A 1OWXA 3CPWR 1U1LA 1MN9A 4F4AA 4DR3F 1JLCB 3IAM9 3PZPA 4RU9A 4K5RA 2WZ1A 2IC3B 4Y0FA 1HBNB 3GJQB 4B9UA 2K7JA 4UZCA 1OY6A 2XO6A 3PYEA 1LV5A 1UTAA 3CDWA 4RPFA 1WG5A 1REGX 3FBFA 4LMZA 4GKKF 5E3CA 5B0AA 2C28A 1MWYA 2CQ3A 2JWNA 1WDTA 1NDCA 1HBNA 4J9MA 4JYAF 1R31A 4ZPDA 2YY3A 3KDOA 2MQPA 2OMOA 2PE8A 4JI8F 1C2PA 3LAMA 5C42B 2OEMA 4EMDA 2I1RA 1OMSA 2F8EX 2YQ0A 5CA5A 1TKDA 2OSQA 4HDGA 4IFYA 3D2WA 4I1TA 5HLFB 1VGYA 1ZETA 4X4PA 2E1CA 1VQKS 2AIRB 4B08A 2YNHB 3AOBA 2VBWA 2VKZG 3G8TA 1ZPWX 2AYBA 1NPKA 5ITHA 3TP2A 3IR7B 3LUYA 1X4CA 1HNVA 1DBDA 5E5NA 2CNNB 4Q0BB 1CEZA 3WDOA 1QE1B 2E5IA 3TO8A 2XSJB 1NEEA 3Q8PB 4ECUA 2E66A 4JI2J 2XMJA 3CJKB 1JNZB 2FVPA 4ETXA 3W2VA 3IC1A 2RS8A 3VVTA 2Y0BB 3MR6A 3QWPA 2XWXA 1S1UA 3DRSA 4YY3F 1JJ2R 1OQ3A 2RQMA 5B09A 4TU8A 4NMLA 2DNKA 3KMSA 1U24A 4A8YA 1N0UA 2ZHAA 4LSNA 4RJVA 5CYMA 2PA8D 4CNZA 1E6YB 4FKXA 4J9VA 4XTTA 4B3MJ 1WELA 2OSRA 4USIA 2EEYA 2DTJA 3EYZA 4RW6B 2WSCC 2L9DA 4P2FA 5F8NA 3BKUA 4W4MA 2DITA 4M95A 2RE1A 4OJ1A 3N79A 2F8MA 2OTJS 2JLEA 2W2OP 3TW0A 1X9SA 1A9NB 4RUAA 3MOZA 3ZZTA 1U0HB 3MHYA 1TUGB 3CCQS 2IVFB 2DIUA 4KB7A 2ZM6F 3OR2B 3GB0A 3IG1B 1Q7LB 5E3QA 4CLFA 1BLUA 4GVLA 5E33A 4C6AA 2GMJA 4QBUA 2UUBJ 3RRHA 2YKMA 3PM9A 2QL5B 5J1PA 1QTNB 3F41A 4K4VA 8AT1B 5FDLA 1RT7A 5AXMA 3SFGA 4E2FB 2FJXA 4K4SA 2QTWA 1AZSB 4NLDA 4ECVA 1YHQS 3PO5A 2FHOB 3D7SB 2VBYA 3ETOA 3L7PA 1D0EA 1F0XA 2MLYA 4UW2A 1ITPA 4Q0BA 5CCLA 3M2VA 2R7XA 4HTIA 4LF6F 2WONB 3WC2A 1DTTA 2Z58B 1ZA1B 4DV5J 3THVA 1JB0C 1RSCA 3MUVP 4YFUA 2Z2LA 3ITHB 1K1SA 1RHJB 5F3TA 4IFVB 5HI7A 2LQJA 3NNAA 1H74A 3B82A 4TKTA 3GFXA 5CAAA 2XTJP 3TZXA 3KLVA 2UUCF 4EZ6A 1TKZB 3GIJA 4DL7A 1RAJA 4EK2A 1RISA 2F4VF 1VYAA 4FYDA 2KTQA 1U4BA 2OMLA 3VZHA 2MQOA 4PR6A 1FRHA 1TKXB 4H4KC 4M5NA 4NA3A 2DRAA 1RU2A 2N3OA 1QSYA 5KFAA 2PI4A 2K1RB 4LJMA 2AX1A 2UUWA 1PG5B 4MFBA 5L46A 4NX9A 1SL2A 3DRRA 1XJWB 1TKXA 1R8PA 2OKQA 3I5BA 2HGMA 1NB2A 1UJ4A 3R5DA 4NYPA 4NLRA 2QX0A 3TUJC 1RKJA 2F40A 1V3RA 5K14B 3RW7A 4KIAA 5AXLA 1TL5A 3GZ7A 1RWPB 2EVZA 2QA1A 1TFWA 2EC0A 4F02A 2ZH1A 1S4FA 5E3AA 2VG5A 3T41A 2VA3A 3NAHA 3J80U 1EJ7L 2FIUA 2LEPA 4TYAA 2XS5A 2ADCA 2CJ9A 2MGZA 2FVQA 1MW7A 5T7LA 5FLXU 1U47A 2AF6A 3QIPB 4IG0B 3FK4A 2IBKA 3LH2S 4Q43A 3MFHA 2L48A 3CCRS 4DR7J 1HARA 4R0EA 4OZ1A 2CJKA 1WHWA 2C3UA 2MLZA 4I6AA 3HX9A 4ZCLA 3W3SA 1FJ7A 4KO0A 4NL5A 1FT8A 2DHGA 3GP9A 3LW5C 3NBPB 2AEJA 2CZ4A 2HWIA 3PEHA 4KR0B 2FTRA 1HNWJ 2J6TA 2UVWA 2MSTA 2OPSB 2RHQB 3ZXWA 1RWMB 4DDFA 2DO0A 4ZIVA 2HG4A 2HS3A 2XGPA 2XY6A 2BEFA 1BHNA 1NHVA 1T7PA 5EUHA 5CZVA 4HACA 1UA1A 2YKMB 2D3UA 2ASJA 1VHFA 2DVIA 4DQIA 2V0NA 1RACB 2FHJD 4OHVA 1QM9A 2CPYA 1CJKA 4K4UA 2BRLA 2KRRA 3D1OA 3OR2A 4UQGA 5KFHA 4FS1A 1E6VA 3KLFA 5A8WB 1YRUA 1CJUA 3KK2A 2FZKB 4S0MA 3H2UB 1KRPA 3IAS9 3KLIB 1T9UA 4M94A 2DNNA 2DD8S 4NZ6A 3SCIE 3K57A 1TTHB 1X4DA 4UY8T 1TL1B 4XDCA 1UVLA 2J9EA 2Y1LB 5D6GA 4ED0A 2KFZA 2CPDA 4IRKA 4YB7A 4RBTA 2VUGA 3MM9A 2BW7A 4QWAA 4RU2A 1OO0B 2NXJA 1ZYQA 2P9GA 4LQ3A 1N8RT 2A1BA 4NA2A 4C4WA 4ERDA 4KGZB 4WYLA 2VFUA 2CQHA 4USTA 2CDQA 3UQSA 3US5A 1KVIA 4R25A 3EM1A 4C11B 3MEGA 4DSIA 1MROB 3FSYA 4MJKA 4DN0A 4X65J 4C9DA 2RUSA 3KG4A 4YMEA 3BO4A 4NE9C 1P9YA 1RA6A 5DZ6A 3W9JA 3DLEB 3T6JA 4DSLA 2L9WA 1R6YA 3KJFB 2E29A 2HGLA 2W25A 4GVBA 1S7HA 2GQQA 2PMHA 3CNQP 3A8EA 4DR3J 1VC6A 3AJ2A 4ELUA 1UVNA 3HVTA 4Y28C 4CO4A 5J1EA 4QWDA 2VL1A 2FC8A 1G3OA 2K3KA 3IBFB 2CVIA 3M9OB 2EI5A 3DGPA 4ED5A 1TUVA 2AEFA 3MEGB 4LSZB 2QYGA 2VONA 4KPYA 2R7VA 1UAWA 2HQ3A 4Q8EA 2D9OA 1G6BA 3BYRA 4O0IA 2ASDA 3PEJA 1B99A 2CZ9A 4J9RA 5KFVA 1T02A 4CLWA 4DU8A 1H38A 4CLUA 3O1LA 1S1XA 1N33F 4P7VA 2N82B 3ZFVA 2J9DE 3R97A 4DPXA 3CJ0A 2ZKUA 4DS5A 1RLCL 4KGMA 2RT3A 4IH7A 4O4GB 2J6UA 2HMIA 2QJ3A 4DZDA 1KLMB 3M8RA 3ILOA 4NYOA 3ZZUA 4ZPWR 2GMLA 1FF2A 3KLIA 1GXTA 1REVA 1S9EB 3LANA 5BJRA 5AE3A 4M5KA 4DFJA 3G6ES 1WHXA 4IRDA 2YKNB 1FRJA 1T03A 1X4GA 2R8JA 4RUCA 2YX4A 2VPWB 3ISND 4JI1J 1U2RA 1DJ0A 3I6PA 4J5OA 1QUPA 5J1NA 4PCQA 4CH7A 4LUBA 4M5HA 4C8KA 2IAJA 2GFFA 1YJ7A 4JV5J 5CQGA 2V4RA 2LCWA 1WF2A 2B5JA 2Y0SD 1TK5A 2DR5A 1TL3B 1OYEA 4O0NA 1FFGB 3JSMB 2KYZA 2MQMA 2Z56B 3SCKE 2AW0A 3EWGA 3IRXA 2XI3A 4I2PA 1KWMA 3QRQA 3FVYA 1LFWA 5B7WA 1U45A 2AJ4A 5ETOA 2VU5A 2VBZA 3I96A 4MK9A 2N7CA 4ZP7A 3LGNA 3RB4A 4UT4A 4AT1B 3J81Y 3TA1A 4DN9A 5L38A 2QMUB 2BANB 3C15B 3G8SA 5HP1B 4YY3J 1WOOA 3G4SS 3LAKA 5T7LB 1A6LA 4LVOP 3QJPA 1IBLJ 1CLFA 2MKIA 4B9TA 1UCNA 2C1EB 1BQMA 3R6GB 4OX7A 4RWWA 3TAQA 3OXFA 3QPIA 3CD6S 2HHVA 2PMWA 2XCPA 1X4AA 4C3LA 2ZHBA 1JX4A 2N3LA 3HXMA 3VAIA 4DR4J 4OI2A 5IZHA 4U95A 1X0PA 3CCWA 4WE1B 1TP7A 2R8KA 2Z2MA 3BREA 3FZBA 2BM0A 1PYOB 3P96A 3RB3A 2DGQA 3NGRA 3H8YA 1X5PA 1FNOA 4MFBB 1G2EA 2Y1RI 4AL5A 4OLOA 5IXUA 3BGOP 2VPZB 3V6JA 2UZAA 2HURA 1N36F 3NOGA 1HHSA 3D6FB 1XK8A 3QWUA 2V67A 2QGFB 1HPZB 1RT2B 4WKYA 2W24A 4EYIB 1U1NA 1IKWA 2FY1A 2R42A 2UVVA 2GCFA 4WXWA 4DR5J 3LGMA 4P52A 1YLXA 3CD7A 2C2MB 3PJWA 3WC0A 1FNMA 3H5XA 1AT1B 5KFMA 2MZRA 4IQMA 4IFVA 4DCJB 3V4IA 3ZZZA 2MZQA 3FQKA 5DS7A 1F1BB 5IFMA 1FXRA 3W9HA 3ZZPA 2DR8A 3LWLA 3TQ1A 2BKPA 3TJ8A 5J2QB 1JLFA 3MCSA 4DL2A 1N32J 4DFPA 1PJ7A 2VKRA 2H5JB 1S49A 2DNHA 3PFEA 1YBTA 3VZIA 2CZVC 2DNZA 1V3ZA 2IVYA 3CMQA 3IA0A 1AZSA 1FWKA 3CXCR 4QU7A 4AXJA 4OL8A 2QA4G 1FERA 2ZD1B 3EXYA 4WJBA 5EWFA 3OVSA 1B7YB 3ZTOA 2DNQA 1S6PA 1VQOS 5IS2A 1HI0P 1R8AA 4QOTA 1UEKA 4MIBA 3AB2B 4H4KA 4WPAA 4ZA1A 5KFQA 1U1PA 3NAIA 1RXOB 4FKYA 2YQ1A 2NQPA 3IG1A 1HNZF 3MM5A 4ZHRA 2KKHA 1UVJA 2IVMA 3GU0A 4FF2A 5HAOA 2P5VA 1JKHB 1FK9B 2C2OB 1PJ6A 1SL1A 4BS2A 3PHEA 1UVMA 3BGRB 3FC9A 4RW8A 4DR4F 1XNRJ 5IWAJ 2HEKA 1JLQA 2EG1A 1PC5A 3BH6B 3DCAA 5I42A 2A18A 1C0TA 1WKJA 3DDKA 1NJIT 2M5YA 3MAHA 3L4BC 4NLXA 4DCOB 3MMAB 1R0AA 1NKBA 3O44A 1BMQB 2J76E 2C22A 5I3PA 2PO4A 2COLA 2DO4A 3CJ2A 3IRWP 1N5QA 5CXTA 4DR7F 1NU4A 1BD6A 1C1CB 2JDJA 2ZHOA 3IM9A 4DQRA 4OIXA 2V9WA 1BWEA 2K2PA 1SL0A 1SQFA 2F4FA 1U7LA 5B0EA 2ZZMA 5CZXA 1M1KT 3W2VB 3H7HB 2OD6A 2MKJA 3NCPA 2GC8A 4H4OB 4UZBA 4DR5F 1OSCA 4RBUA 1D8YA 3FCWA 8ATCB 5KFFA 1RBLA 3EGNA 1PBAA 2O3DA 3IMQJ 1UA0A 2RDJA 5DZ7A 2IMOA 1UWBB 3HVWA 2V2VA 3DI6A 2A6MA 5MAOA 4L75A 2BE7D 2CPFA 4CDIA 1T05A 4OMFG 4DV0J 2JEJA 1XC9A 3MTKA 4WIIA 1V6HA 4IOBA 3ENVA 4F4YA 1O8BA 2FJAB 3HJVA 2XMUA 2CWKA 3U7JA 3VHQA 2NXCA 1Q86T 3GV5B 2F1FA 2ZWPA 3AY0A 4L3KA 3ISNC 3UD5A 4YOEA 4Q7AA 1ULRA 4ALZA 4O3SA 3DRYA 2L08A 4FYXB 1X31C 2AGOA 3M05A 3AODA 2MPUA 5L9NA 1SBRA 2BE2A 3N6LA 4CLZA 4YHHJ 4FF4A 4Z37A 3T3FA 4A8OA 1P8GA 3MPUB 1LWFA 3OUYB 1L5UA 1IR1A 4KPCA 2W7OA 1VRUA 4KH1B 4LF6J 2DH7A 2Z2YB 1S6QA 3EZ5A 3RUBL 4G6VB 1SJ3P 2RU9A 2DBBA 2YKOA 1EP4B 1S0VA 2WOMA 1NUEA 1U1OA 3CCTA 4LF2A 3KK3A 2X51A 2IM1A 3GJRB 4CI0B 1YTYA 4YR2A 2HS0A 1U1KA 2UUBF 4KTQA 4LF5F 5I4MA 3OVBA 4RUHA 2HHSA 2NXNA 2PFDA 4KV8B 2Q79A 1KD1T 4QCLA 2IDLA 2VFSA 2LECA 1LQ9A 3SEOA 4Y6IA 5DRKA 4URSA 3HHLC 4F36A 2OP5A 4KGXB 4ELVA 1BUXA 1RTHA 3QYYA 4L72B 5F0WA 4ANDA 1AROP 3IWXA 4DG1B 4QW8A 1NHUA 3MEDA 1B3TA 5EX0A 5F9LA 1EP4A 2WCXA 4OYWA 3H59A 1XBWA 2B0GA 1REVB 1S9EA 1DARA 1WSRA 3W63A 1WNEA 2UXDF 2P9EA 1Q16B 4ZJLA 3FMWA 1I51B 1TAQA 1RWUA 1T95A 2CDRB 3ILJA 3M8YA 4RX6A 3VGVA 1K0VA 3CJ3A 2PDAA 2ZJRQ 1P1TA 4K8RA 5U47A 1VC0A 1M90T 2DR7A 4QYRA 4JI6J 4U7CA 1QDUB 2GVZA 2AJ1A 3SDEB 5HQ8A 3MUTP 4DV1F 3EGZA 2AYMA 3H20A 1T0TV 4B17A 1BGXT 4WFYA 3OW2R 1VQYA 3FMBA 3EX7B 1HQ2A 3VAGA 4Y65A 4CYUA 4CLSA 1RQ0A 2JVRA 2NUUG 1DTQA 1Y10A 2NXEA 1QVGR 2QT7A 3QRRA 4KHPJ 3AQOA 2DHXA 4WKRA 2HFVA 3RRKA 5DGBA 4NASA 3I9V9 4KBIA 4X66F 2CG4A 3UDLA 3KJNB 1FI4A 3MXHP 1OQ6A 2HHPA 4ILRA 3S6EA 5HVFA 3Q0AA 3JB9k 1TMMA 3PW2A 2KT5A 3CCSS 1HBMA 4B3RJ 2PFFB 4AFFA 1R3NA 1QAYA 1HIYA 3L7UA 3W66A 5GAGU 1UZDA 4OX9F 3U02A 4DJBA 5JMNA 1FCAA 5FJ4A 5KTQA 3CD0A 3BO3A 2YPZA 3E01B 4QWEA 3KDNA 4CO2A 1S6OA 2RQ4A 1B0VA 1KR4A 1FE4A 2CNKB 3TEHB 3H25A 4JYAJ 4NMXA 1ACMB 2HBZB 5KFBA 2E7XA 2WVCA 1PAEX 3I4PA 5AE1A 2BJDA 3OSPA 2E1AA 1R89A 1ZBTA 1YX2A 1Q8BA 1NK0A 3NGTA 2LLZA 2DHHA 1WJ9A 2VFTA 2YWFA 1FXLA 2FQQB 1ZA2B 2D9PA 3MPWA 4RKUC 2MQ8A 4KHMA 5KFLA 1MWQA 1RT4A 2FVCA 2QLFB 3QGGA 4PWDA 3MI7X 3TR5A 5L39A 3GSIA 1NK4A 2A0FB 3IWLA 1IWAA 4Q8FA 4HEA9 4RW8B 4Q2LA 2ZH8A 3KMQA 1ZPVA 2ZBQA 2OEJA 1NO8A 1NH8A 1CJTB 1GMVA 2IRUA 4FPRA 5KG2A 2V2ZA 1IBMJ 3K5PA 2UV8G 4FDFA 1BXNA 2KU7A 1HBUA 3G96A 3MM8B 3GIRA 2BA9A 4OZNA 2OPQA 5CCMA 3GV7B 3QATA 3KYLA 2ZVIA 1GX5A 1S6PB 3M8WA 1HWIA 4NLUA 4WU2A 1AYEA 1YITS 1KN6A 3UN2A 1RTJB 4CRJA 3FRYA 1O6XA 3JTOA 5M2PA 2W2MP 1OY9A 3R5GA 3RAMA 4DXLA 1TQLA 2AJ0A 2VQFF 2DPJA 3QRPA 3AXMA 4KT0C 4ED8A 5HROA 4DSJA 1QLNA 3LPEA 1PIEA 4DWIA 4N76A 4IQXA 4J9NA 3D6MB 1JLFB 1R0AB 4LRDA 3BPSP 3GTYX 3I82A 5A76A 2KZZA 1A0OB 2I0XA 4Y2AA 1X5OA 3DRPB 3KNAA 4FPIA 1RYRA 4LF7F 1GH8A 5ETVA 4W92B 2KG0A 2ABYA 1DQ8A 1NSAA 2ACMA 2WVEA 4NOHA 1Q0NA 3LQVA 4OX6A 1U49A 2OH2A 3R3TA 3HHDA 3AJDA 3NY0A 5CHCB 4JI0J 2J8SA 5BYRA 3BKFA 1RCXB 2XM3A 3QZ8A 1UETA 4H4MA 1UWAA 4PUOA 1I5OB 2J0XA 1UEUA 2VB6A 4C8LA 3A12A 2C3YA 4X4VA 3ADAC 1X5TA 3UO0A 2W9AA 2DGVA 4JI4J 3FQLA 1SV5B 3SSQA 3BZQA 2C3MA 4Z7YA 3R1LA 4HKQA 2HQIA 3TA2A 2MZ1A 3H5YA 1HNXJ 2NS1B 1D9DA 2HW3A 5CYJA 3I0SA 1F3VA 3DRRB 3G82B 4WFZA 3J7Z5 4QPTA 2VG7B 4ZN1A 1VIOA 2DH9A 2XG8A 5DGAA 1D9FA 2XMMA 2OI2A 4UOGA 2QSFA 1FKOA 3AA9A 1GTEA 5AT1B 4FF3A 4NEZA 1D09B 3TVZA 3CVKA 4YHHF 1NK5A 3LP0A 5CYQA 3D6TB 3PNIA 2IFXA 4IG3A 3POTA 1J27A 5D15A 3VF0B 1DRZA 5I3UB 2V63A 4KYZA 2CUYA 3GFZA 2XNQA 3SQGB 5JUMA 2BVZA 2HVIA 1EZZB 2YKAA 1I94J 3BF4A 3DM2B 3JS9A 2AJ2A 5A0YB 3I32A 2DEJA 3AD8C 4DPUA 3M8QA 4AQYJ 4OV6A 2RAQA 3EDQB 3V6HA 1FKOB 2KT3A 2XO7A 4DR1J 2RB7A 1DTTB 1RAEB 1U6ZA 1WUUA 2W1BA 3A4TA 2UXBF 3HP6A 2VF3A 4C3KA 1S57A 4NRUA 4GO7X 3W60A 2FPHX 2HNDA 3MOJB 4I2PB 1WC4A 2HFNA 2DPIA 5D4LA 2C2EA 1EKSA 1Q95G 1WKLA 2RSQA 1UW4A 3BSCA 3C6UB 2KDOA 3BQ1A 4GC7A 4LF8J 4X4QA 2M7SA 2GAHC 3AA8A 3KWMA 2CPXA 2AP6A 3BBCA 4WFXA 3M7VA 4DPTA 5GAGI 1Q1KA 4M5GA 5GMKa 3CCZA 3M8QB 3QT8A 3C66A 1FJEB 1B7FA 5CABA 3FBBA 1FFWB 2OGUA 1WACA 3IP0A 4LIRA 2V8VA 4HDHA 1MMNA 4DX5A 4ZIWA 4DEZA 1JLBA 4K4XA 1F5AA 2B3TB 4CT8A 2C2RA 2ASLA 3A8JA 2EPIA 3R7BB 4DUZJ 4FBTA 2R4FA 3PX4A 2JRSA 3MMBB 1Q78A 3DOLA 4ZITA 4M5LA 3L3CA 1O51A 3THTA 4RZRA 3Q8VA 2GJIA 3SQOP 2JSXA 3W5XA 2RD5C 3HHEA 2E7WA 1IR2A 1H7XA 3MWBA 2RJZA 2BANA 3C6TB 2GVZB 4WK3A 3SDEA 5AJ3J 2UU9F 1JKHA 2VG6A 2W9BA 5F0UA 1R8BA 4URGA 3FUYA 4O4GA 2GQCA 3UFCX 1UMJA 2HAIA 2GV1A 2QC3A 3DOKA 3M6UA 5KT3A 3VAHA 3RBXA 3V81A 1RHKB 1RDRA 3I56S 4IRCA 4WP3A 1HWKA 4EGLA 1JXLA 1GT8A 3Q83A 2GA7A 4YDDB 2IMWP 2QRRA 1O0PA 3DDIA 3O5TB 1H2VZ 3CD5A 3KHRA 5D0RA 5DG8A 4LBPA 2WTFA 2M9KA 3NOCA 3ZZ0A 1PYTA 1HNIA 4QIWD 1FJGJ 2YXLA 4TVAB 3P6YC 3RBZA 4ZLNA 3ET6B 3UNGC 3E2EA 2DY9A 2H51B 4FXWA 3CUNA 3LGHA 4HYKA 1N34J 3HHLB 3NS6A 4A8KA 2RH3A 4ZLLA 4ECTA 3D3CJ 3PW5A 4KAIA 4ICLA 1VBZA 4OYXA 4TY8B 1KQGB 1JLGB 4C98A 2IIHA 1M0SA 4FS2A 1N5YB 2IBOA 2BV3A 4K7QA 1SIWB 2NPIA 2UXBJ 3SXLA 3D6HB 3T1AA 2IRXA 4DHVA 2CA9A 4WFBQ 5A2QU 1SIZA 3BEGB 1TV6A 1M5SA 3B4MA 4NZ7A 2U1AA 2ZH2A 4DR1F 1APSA 3IN5A 3PHTA 4FXVA 1R6VA 2HK3A 4IYQA 4WYWA 2BJ3A 2HWTA 4P71A 1RT2A 4Y34A 1LWEA 3LWMA 2CFXA 4DL6A 3D0HE 1T9XA 4USJC 1BWVA 2ALYB 3H90A 2A2CA 4DZ6A 1HBMB 4OFZA 3TUIC 3MPYA 5D0EA 3S8SA 1NB7A 2HFSA 2EFPA 4OQJA 1M5VC 2X1GA 2NLWA 1WOSA 1V5IB 2YWEA 2DJWA 2Z2ZA 3PRDA 4M1KA 3TRGA 4A8MP 4F4KA 3HDSA 5DM7Q 2E5LF 1XWLA 3V6KA 1FD8A 1RAHB 4C8OA 4PWDB 1U25A 3W7BA 1S1VB 2KI2A 1IBKF 3VV2B 4TNOA 3PKMA 3DI6B 3VAMA 2VASA 1UWBA 1HNXF 4K0KJ 4DV4F 2VD3A 3Q2SC 1IR0A 4G1PA 2BKNA 2EKNA 2M8HA 4P75A 1KEKA 1U1RA 4PQUA 1AUSL 1F2HA 3UDCA 2HVDA 2FY8A 3JTPA 2QIFA 2J0QD 4L74A 2DNYA 2DCLA 2HQCA 1FXDA 3M1VB 4KE5A 2I6WA 3FBCA 4ZVSB 4RNFA 4C7QA 3M32A 3R6LB 4DPOA 3HT0A 1TL7A 1JLGA 1T9TA 3DRXA 1TU0B 4Z2XA 1YJTA 1HW8A 2FZCB 3GFYA 1FA0A 3PFOA 1KTQA 1VR6A 1Q82T 1YSJA 1TKTB 2NXUA 4LFAJ 3PXGa 1FWPA 1GEHA 2QLBB 2W9CB 5J2PA 2D3OR 3CTRA 3MCNA 1ZOTA 1RT3B 2YNGA 4MKBA 4WCEQ 1L3UA 1JXEA 1JLQB 1XQIA 4DUYF 3TAPA 1T8EA 2XLKA 2HZVA 4JV5F 3P4UB 3UCGA 4Y3CA 5T14A 4DV3F 1VQNS 2XSFA 3MD3A 1E6VB 4TN2A 2H65B 4I68A 3KLFB 3KK3B 2YKNA 2E1MC 3EZUA 1F60B 2K06A 3RG6A 5LXRA 5DLFA 2KM8C 3UN5A 2VFVA 1FE0A 3GCWP 1NJYA 2XHWA 2J9CA 2WSFC 5L1KA 2BYCA 4OI4A 4R0JA 4LF4J 2RF2B 1EARA 4L76A 1LWFB 3GR0A 3OUYA 2Y8WA 4CLYA 2GX8A 1N6QB 5LMUJ 5KG1A 1NJXA 4J9QA 3DFEA 3F0NA 4A8QA 2ATLA 2G2YA 4TLQA 4MK7A 1RAIB 1N88A 3M2UA 4RNNA 3MCOA 3TEGA 4PG8A 3DLGB 1NLKL 3H4BA 2GVDA 1QJHA 2WVDA 4RWXA 1SUQA 3D1HA 3DGPB 3MUMP 3P49B 4GMKA 4JI2F 3TX8A 1Y11A 1ZM4A 3W2WA 3JYTB 1GAOA 4J91A 2ZEJA 2UUAF 2X1FA 2R7OA 3KOAA 4IR1A 1RE1B 1RTDB 2QL7B 2VG5B 5SZTA 1T05B 3D54A 1IN0A 3ENQA 3S01A 3W65A 2B4OA 4X62J 1NJZA 5EGYA 4U7UD 2ZNYA 3OFEA 4OHXA 4ES2A 5BXIA 3DOMB 3I9ZA 3KLHA 3M9MB 1R8CA 9ATCB 5KFZA 3PV8A 1LWCA 1OPIA 3GG1A 1DFDA 2KRBA 5BYSA 2HGNA 4F25A 3TVKA 2X1AA 2DGOA 2AKWB 2KO1A 2CQPA 2MKSA 4KFBA 4NYZA 4J9LA 5CD4A 3X1LB 2IJRA 1KBRA 3NMRA 2DNLA 4RNHA 3S7RA 4NLPA 1GMUA 1YGYA 3CEDA 2B9EA 2Z0GA 4ZVHA 5ETPA 5HANA 1HLWA 4ECSA 1YRXA 2DHSA 4DSFA 3RBEA 1AUDA 1JQGA 3HSZA 2GO9A 5HN0A 1SCJB 4Y2KA 2ZH9A 4KHPF 2XZTB 4OI3A 4ZK7M 1WTBA 2CQ0A 2XMVA 4X4TA 4DV2F 2J6SA 4ELTA 1WC6A 2CJXB 1YVFA 4PYAA 2DR9A 2I9SA 5EN1A 3QT5A 5LJ3Y 3H42A 3KNGA 3KJVB 3EGWB 3ZZYA 1RYSA 3GR1A 3FSXA 3K89A 2HBYB 5EX3A 3BGRA 4RBVA 4ECXA 1BE4A 3IFEA 3B8HA 5A8WA 1W2BR 2RRAA 2OHDA 1PJ5A 1HA1A 1RWNB 4MTPA 1KVJA 3I87A 4I69A 2ZH3A 1RK8A 3GPAA 2KHCA 3HT3A 4IR9A 3I0SB 3OPKA 4F3OA 2HLTA 3EDRB 3MF5A 3OLAA 3W5ZA 2FB0A 1SV5A 3R9LA 3O3LA 1S1UB 1Z2LA 2PD1A 3DRSB 3KG0A 3QSYB 3HFKA 1TUWA 4I2QA 4DV3J 1D9AA 2R2RA 3KUHA 3ILLA 1G4CA 4JI0F 2DNRA 5GAEI 4DUYJ 1W25A 3EPGA 2IM3A 1QE1A 4E8UA 3T1YJ 4X2BA 3ZO7A 3MMCB 2KL8A 1DLOB 4OI6A 4P2XA 4PRFA 2FC9A 2D3O1 4LFAF 3DNCA 4ANCA 1RWOB 2CNOB 1C1BA 2JC1A 3NCRA 1RP5A 4F3MA 2HHTA 2W7PA 2DNGA 1SC4B 2PSZA 4U67Q 3SV4A 4JOUA 2V8PA 3WIUA 2ZH4A 3Q8QB 5FLXY 1N48A 1EQ0A 2ZITA 2VQFJ 3HZGA 2GZOA 5KFNA 4J9PA 1R0BG 5D4OA 3G6VA 1F5BA 3D28A 4IUFA 1CC7A 1MMDA 1LKZA 2PEBA 3J7ZT 4ZHRB 2GS8A 3BV8A 4I56A 1BC6A 4LIWA 4M5DA 4QIGA 1NSQA 1OIAA 3CDAA 4KY3A 4J9KA 2LU1A 4U8VA 3DKDA 4RW7A 3V6DA 3HI9A 2VDIA 4RR5A 2B9YA 2Y8YA 2Z57B 5IM0B 4P2MA 1F5CA 3LOUA 4MT1A 2XY7A 3UCUP 1U09A 2VPYB 3Q8RB 1FKAF 1I6JA 3DYAA 2BQUA 3CJKA 3OL6A 3BQ0A 4EBDA 4A46A 4IO9Q 1J5OA 1V3SA 2XS2A 3N28A 2F9DA 3AHPA 4LSLA 1SQGA 3BN7A 2OPRB 4YQWA 3PO4A 2P6TA 4ECRA 2F3JA 3B78A 3E3XA 2ZNZA 4YR0A 1Y5LB 3RW6A 1XTZA 2FLLA 2F4VJ 2R8IA 2X1BA 4DR6J 2Q1LA 1RU1A 4UQTA 4U9RA 4W90B 1MWZA 2R2UA 3V4IB 4N5SA 2XLJA 2W8KA 1EQMA 3H98A 2EFOA 1MNEA 3IBCB 5C5JA 2XC9A 5JVHQ 4X4UA 2YWGA 3C15A 5ETMA 1WC1A 4QR2A 4N47A 1KHWA 4PZVA 3BJYA 2NREA 3DLGA 4PAAA 4JI5J 4RW4A 3UVJB 3C16B 5FD1A 4BHQA 4BLGA 3TQEA 2XS7A 2GJ2A 2ZH5A 4ZVPB 4B3TF 1RI7A 2H48B 3HSJA 3K5LA 4XK8C 1L3SA 2RVJA 3WX8A 1KFSA 3DU6A 1KS2A 3CO9A 2R2TA 1VRQC 3JSMA 4JP8A 4RLEA 2DNMA 2IC3A 2VC0A 2W2QP 1IM6A 5BYQA 3J81U 1TELA 2QEXS 1ZZFA 1NCLA 1NMEB 2LYVA 1S79A 3NCQA 4DLGA 1N34F 3QQCD 3TJAA 4DQPA 4LFCF 4N7TA 3CB4A 4J7CA 4PG6A 4OYOA 4WE1A 4RNMA 4WP8A 4F0HA 1W7WA 1H3DA 3KKFA 1CJUB 4NPOA 4OZ0A 2BR0A 1T03B 2G2ZA 4I7FA 3LF0A 2YNIB 2YQ3A 3N9UC 1FNXH 1U0HA 4NWBA 1Z1ZA 3GYXB 2EBEA 3EVWA 1Q81T 1D3WA 3HSGA 2JEGA 4KKOA 1HD1A 2CKWA 1I1GA 5KG5A 4DPYA 3G86A 3GQCA 3OD2A 3OFGA 1S9GB 3CJSA 5F8HA 4C0HA 3ELHA 4DFKA 1FDDA 1FDNA 3DLLQ 2JNJA 2LEAA 4CLTA 2JEIA 1NAQA 4KQZA 5DQHA 3GLJA 4GKJJ 3UCZP 1Q5VA 4LF9F 2HRUA 2VJVA 3D9BA 4KGKA 3UR3C 2RRBA 1R43A 2BUNA 1UJ5A 4ES3A 5AXNA 1IKXB 4HI1A 2V4QA 2PI5A 1S1WA 1XMQF 1SVDA 3KLEA 2BW2A 1EKRA 2HK2A 3IRXB 3FFIB 2VBXA 2WAQD 1DHMA 1NH7A 5DDPC 4X4NA 1GXUA 1Y3JA 2OEKA 1OSDA 2QFIA 1S10A 2ACYA 4DUZF 4U96A 4MAKA 4QYZJ 3C8YA 3AJ1A 1PILA 3C14B 5I3QA 2F63A 4K5SA 4ZN3A 4U7UK 3PX0A 4GC6A 2MJNA 3RR7A 3D0IE 1VQ9S 2PA3A 4YP3A 4QWBA 1UVKA 2QLJB 3MM7A 2BJ8A 4LBHA 4EO6A 1F2GA 2FVSA 4OYPA 3LALA 3VQSA 3MAAB 4TU9A 2CPIA 3JAMU 2FUG9 3GJTB 4DX6A 4XAKA 1S6QB 1XMBA 2CQ1A 3PYDA 5AE2A 4WIQA 5LSRA 3C3LA 1HBOB 1ZZNA 2HFZA 3HPOA 3HLUA 4USKA 2BQRA 3TWZA 1LK5A 1VHIA 3MECA 4NCGA 2HMIB 2MMYA 5L1LA 3FRZA 4YUDA 1C4AA 2X3GA 3D67A 4PKDB 4ZMMA 3J7YI 4I64A 1PAUB 1RA7A 2MZTA 4UF4A 1ZTTA 1JIHA 2E44A 1T9YA 1SKRA 2HHQA 3ETMA 2CJQA 5SUHA 1H98A 1TVRA 4DCPB 2AHOB 4B9SA 5HQLA 1XR6A 5LOQA 4GKJF 1Z4UA 1FEHA 1Y4ZB 4KH0B 4DR6F 1FRKA 1UKUA 2VQEJ 4YEAA 1IBLF 1HBOA 2OFHX 5GAEU 2R7QA 3SSRA 3G2XA 3WX4A 4DV5F 4V19X 2RMLA 3DGVA 1HYSA 5CD4H 2Y1IA 4AL6A 2ZOGA 3PJXA 2F65A 1YK9A 4DUTA 1FO1A 3NS7B 5F8JA 2YX1A 3OTOJ 1GMWA 2HYIB 2DB1A 1C1BB 4ZPVR 4B9LA 2OIHA 3ILIA 2F9JA 2VZ9A 4DV7F 4FVMA 3BH7B 3K5OA 3P8BB 4LSLB 1URNA 1NKEA 1B70B 2BM1A 2ZZTA 2DEIA 4CTAB 5K8NA 4ECWA 2FD2A 2RQKA 3IXQA 1YZ6A 2ZBRA 4JI4F 1ZAVA 2B8QA 1FDBA 2HRTA 2L9NA 1JXVA 2MZJA 1RT7B 3CW2C 1KNZA 3PW4A 2VC1A 5LXYA 2AT1B 3VGUA 2WHOA 2B6AB 2OELA 2BX6A 4O4RA 5ETQA 4L6V3 1WC3A 1FVSA 1RKIA 4WTOB 1C0UA 3HKWA 4KO0B 4USMA 1YI2S 2HHWA 4LF7J 4WF9Q 2QYCA 3DLJA 5D77A 4RO0A 1RTZA 4BWJA 1CPZA 3PIOQ 1S9GA 5I42B 4ZP8A 1S1TA 5A8RA 2VA2A 2I5JA 2CJYB 2GMHA 1ZAWA 3EPIA 2EFVA 5K8MA 5KFSA 3CJ4A 1JMTA 2AQ4A 1XMOJ 3U1NA 1CJVA 2DGWA 4AD6A 2R7TA 2R8GA 3SCLE 5HVGA 1JLBB 2CAJA 1H73A 1C0UB 1QSLA 2DNPA 1EAYC 2C2DA 3MMCA 2XZDB 3NXZA 3D66A 4G1IA 5GVQA 3W8PA 1N0VC 1LNQA 2G2OA 2Z30B 5C24B 3FEZA 3DLKA 4YB1P 4P9SA 2MKKA 4ED3A 1NK9A 2XYHB 4FYWB 1JLEB 4P74A 1SJ4P 4DV4J 4OHYA 2B7CB 4JI7F 3AFGA 4I2QB 4OJHA 3UE2A 3OSNA 4KFBB 2HVHA 1NHKL 4V1Ak 3C6UA 2OPSA 3CF5Q 3N6MA 1KONA 3CC7S 3CMES 2HRYA 3CJQA 2BOPA 9RUBA 2RQCA 2HKEA 4F0MA 2OJ3A 3MCMA 2MYFA 1O5JA 1CULA 2AYGA 3JQMA 2DT9A 1GQEA 2M70A 2PIIA 3PRBA 1G7CB 4B9MA 3TUPA 4K4ZA 3HKZD 3CJRA 3UD3P 2RHSB 3AT1B 3J7YU 5LL6d 1HMVB 2BJEA 4ZP9A 2MGZB 3JYTA 4FF1A 3CCMS 3KJVA 2GIRA 2LDYA 1UP1A 1V5VA 4PWUA 1DZ5A 4ID5B 1VCTA 4B9NA 3HJFA 4YDXA 4C8ZA 1FRLA 2XWYA 3AD7C 1SI9A 1WF1A 3NG8A 2CWXA 4MIAA 5I3UA 2RILA 4PG5A 4C8NA 1WDDA 1U8WA 2OPRA 2D7SA 1RTIA 2W4DA 3KUEA 5B0GA 3VAKA 4A8SA 2BZ2A 5HMZA 2LMIA 4FVCA 4A8XA 3JSRA 3TX0A 4M5MA 3GIMA 1NKCA 2YWKA 5JJBA 2FLOA 2CQGA 2RF2A 4AE5A 5KT6A 3NS5A 3SSSA 2D3ZA 5C24A 3MAQA 2EKYA 3EXCX 4ZVFA 5L1IA 1B0PA 3DOMA 2LKZA 2W4CA 1HW9A 2XMKA 2IY5B 1VLYA 5KFKA 3M2RA 2DYAA 4ATNA 2MB0B 2I2YA 4J9SA 2XY5A 1K9MT 3A3OB 2N4CA 1UW9A 1BQMB 1FDAA 4NLTA 2ALZA 1SKUB 3PW0A 3ITHA 4JV1A 1X4HA 2DGXA 3QT7A 4BCAA 4EBEA 2CJBA 3D3BJ 2N7YA 3HFZB 2Q43A 4N8OA 4RW6A 4F04B 1RWVB 4CCHA 2W9CA 2QMXA 3QT6A 1H6KX 3G9CA 1CULB 1S59A 3FEYB 2IYIA 1BY9A 2EFGA 4JB8B 1FJGF 3BKTA 2ZBCA 1DLOA 4LF4F 2H54B 2MLXA 1AW0A 1FVQA 4XIUA 1RWKB 3QBCA 3UW1A 4ENOA 2VFRA 4IOCQ 5M2RA 3SMZA 2IM0A 3OTCA 4ZVOB 1FRIA 5HMWA 1S0OA 3UD4P 2CRLA 1HHQA 3HD2A 3V5RA 3GWCA 4F7VA 3QIDA 5IT9Y 4B3SF 2MTLA 1R0CB 2KN4A 3QLHB 4G1QB 2FJVA 2B5JB 3A3NB 3QJJA 4LRBA 2EBGA 3PTWA 1UVIA 2QL9B 1IUJA 3EUNA 6AT1B 3B54A 2EW9A 2W2PP 3T5JA 4OJGA 4DX8H 4PQAA 1HNVB 2P2CB 5KG0A 2ZH7A 1LW0B 3IR5B 2BRKA 3RR8A 1JNRB 2JVOA 4CLKA 4K2JA 1Q7YT 2AJQA 4K4WA 4I7FB 3CC2S 4OLPA 1B4SA 1H2TZ 2BJ9A 1EHWA 4CT9A 2D41A 3BPDA 1MN7A 2XCAA 3PYGA 2YNGB 1TMJA 3RYLA 2F5GA 2UUTA 1OJ4A 3NWGA 2W2NP 2WBMA 4DSEA 1Q79A 1TVRB 3EGVA 4PPDA 2UP1A 5A6PA 1U1MA 1YWXA 3K17A 3IGNA 4NLWA 5KFDA 4CO3A 1KKHA 4PXBA 2J0SD 3M1VA 4DV2J 1WEZA 1W2IA 4R8UB 5KFJA 1VQ7S 2VOOA 2R7RA 2EK6A 2JL9A 3KUGA 4OYIA 2MY7A 4QPXA 1TV6B 4TU7A 2UXCJ 2J7WA 5F8GA 2J0WA 3VR1A 1VMBA 2HZCA 1P1LA 3GONA 2BKOA 1ICEB 4TY8A 4DU7A 3HVTB 2CQIA 3FCHA 4NLSA 4PG4A 3HZEA 5KT7A 4BC7A 1SKSA 1BQNA 2HIYA 1WHVA 2CJAA 3A13A 3ZZOA 2YNHA 1VQPS 1HFEL 2FHKA 3DLEA 2G4BA 5F41A 5C2GA 2XMAA 3OR1A 3W2WB 3C14A 3WIVA 1VQ8S 1NNDA 4A8FA 1SUQB 2WB1D 4ER8A 3H5UA 2LVWA 5F8LA 3PYFA 3HM9A 1EETB 1UZHA 1AFJA 3N4WA 3PR4A 5KOWA 2HNZA 1B0TA 3NEKA 3FFIA 2ZJQQ 3CGIA 1NDLA 5B0BA 3CDBA 2R3VA 1T3OA 3OT9A 4XDDA 3W9IA 5DDOC 1N6QA 2J7UA 4JUZA 5C25A 1RWWB 3BBFA 3NRBA 3OQ2A 1QD1A 3MECB 5KT4A 5IC4B 4X4RA 3OHAA 1IKVA 4MMOA 1VC5A 4B3OA 4HTJA 2FLNA 2A10A 4C2MA 5EDWA 2Y1JA 3DU5A 2BJ7A 1ROFA 4TY9A 1VRTB 4QU6A 2KVIA 4LF9J 1T11A 2R7UA 2RS2A 4EUVA 1Q8KA 3UDVA 5KFRA 4EWTA 4IDKA 2KFYA 3CO0P 2M2BA 4USVA 5HL7Q 1LW0A 2E1PA 2IA0A 4WBFA 1H7WA 5KFUA 5IOLA 1W26A 1UJ6A 4F3QA 2ASYA 1NK8A 4J90A 1K8AT 5H9EJ 4UOHA 1HWLA 5F3ZA 2XGQA 3MPVA 1QVFR 1KP6A 4HACB 3S1TA 2HQGA 3QLHA 4G1QA 2LEBA 2WW4A 5ETSA 2QE5A 3I0RA 1DQAA 2H9ZA 3R2DJ 4F2RA 2ZBPA 2C3OA 2VH7A 1VQLS 3E8OA 2KT2A 1KLNA 2HIQA 4X84A 5E41A 2NZCA 1S1WB 3KLEB 3BSOA 2YH1A 3RB6A 2E9ZA 3MEEB 1IM4A 5D0GA 2YNFB 1HKAA 1Y0HA 1N32F 4O23A 1WOPA 3M30B 4ECQA 1Y00A 3O6QA 3W5YA 1XR5A 1U2FA 4OJ3A 4WP9A 5KG6A 3VTIA 1SH3A 2KG1A 4EI2A 2GIFA 1NDKA 3Q23A 3DOLB 1PCAA 1L3KA 2ATCB 4USUA 4ED1A 2O67A 1N54B 3BGUA 5IQQA 3TJ9A 3MR2A 4Y2CA 1VQ5S 4LBIA 2YTCA 4HLBA 3MR5A 1NM2A 2SXLA 3I31A 3POTB 3QFHA 1NXIA 4FNHA 2AGQA 3IWNC 1NZAA 2BBEA 3MURP 3UWTA 4O3OA 2YWHA 1N5VA 3T1HJ 1IQTA 1SC6A 1JLAB 3BDEA 3TVYA 5KFPA 1ZM3A 1S0MA 3IR6B 2MQNA 5KOXA 3DYAB 3ONQA 4QJVA 4CQ1A 5F8IA 2VG7A 3C2PA 2VICA 4BBYA 1ELOA 2DY1A 2ZDPA 4C48A 4FBUA 5DDRC 4DV6J 4B3RF 5KFEA 3HHKA 2DGUA 4B9VA 1LWCB 5IC6B 2YPYA 2DRBA 4RW7B 3V6DB 4NXMJ 2K8GA 2RU3A 1ZM2A 2GNKA 2LXUA 2W01A 2UXCF 2OAUA 4F4WA 3C16A 2XQCA 4BDPA 1PBUA 3UPFA 4N41A 4U8YA 3NGUA 4YN3B 2CQ4A 3A1YG 1R27B 1K73T 2HHHJ 2UVRA 1CVJA 2DHAA 4QR0A 1HMVA 1SC3B 2Q6BA 4ZPTR 2K3IA 2CYYA 2EK1A 2GO8A 2E5JA 2QZ8A 2CIMA 3CJ8A 3N0VA 1VDHA 2V8GA 4MKAA 4PPZA 4C8MA 3SFUA 2DNOA 3J7AN 4P7TA 4LREA 3K7RA 5K5MA 1FKPA 4CWBA 5CYQB 3TA0A 3PACA 1HNIB 4WZMA 1XN9A 3LP2A 1SJ1A 3L95X 1WF0A 2J9DA 5HROB 2UXDJ 4PXCA 1K0TA 2JJ4D 5BR8F 5GADU 4DFMA 1S9FA 1HWUA 1F6TA 2HNYA 3PIPQ 1RTJA 4URQU 2G0JA 3MM5B 2BXJA 2MY8A 1RB0A 3FGVA 3ICLA 4GRSA 4OZ2A 2DRDA 3T1YF 5IM0A 2B56A 4FN5A 3BBBA 1KQKA 3WBZA 3V81B 2V2QA 3PG9A 4ZVEA 3K0JA 1OY8A 2NZ4A 4Q5VA 2DXEA 1NPPA 1LFPA 4H4MB 4R5PB 3R5AA 1ZTWA 4CO1A 4LF5J 5B0DA 1IVZA 3BQ2A 3DLBA 2JEFA 2LDIA 3M6XA 2HBQB
chains in the Genus database with same CATH topology
3BH6B 1S57A 4ANEA 1MN9A 4F4AA 1WKJA 3EVOA 3EJMA 1HIYA 3L7UA 1WKLA 2AZ3A 1NB2A 1NDPA 5C7PA 3MPDA 1XQIA 3BBCA 1K44A 3PJ9A 2DYAA 4WBFA 3ZTRA 3FBFA 1NSQA 5IOLA 3ETMA 1PAEX 3FBBA 5CABA 3DKDA 1NDCA 3FC9A 4UOHA 1S5ZA 1XIQA 3NGTA 1WKKA 3FCWA 4O0NA 3PRVA 1KDNA 3ENAA 3G2XA 3Q8VA 1S59A 1F3FA 3GP9A 3FKBA 2VU5A 4DUTA 1NSPA 1NPKA 4ENOA 3EE3A 3BH7B 1HHQA 2BEFA 3VVUA 2CWKA 1BHNA 3B6BA 1NLKL 1NDKA 2B8QA 1UCNA 1JXVA 3B54A 3Q83A 3EICA 2HVEA 3VGUA 3VVTA 2BX6A 3DDIA 3ZTSA 3Q8UA 4DI6A 1NSKL 1B4SA 2B8PA 3NGRA 5BXIA 1EHWA 4S0MA 2DY9A 4FKXA 3WX8A 4KPCA 1MN7A 2HURA 1NCLA 3FBEA 2DXDA 1NUEA 1LWXA 3NGSA 2NCKL 4HR2A 1W7WA 1HLWA 3Q89A 3ZTPA 3NGUA 3EMTA 4C6AA 1PKUA 3EVWA 4F36A 1BUXA 3EM1A 3VGTA 3ZTQA 4ANDA 3FCVA 4DZ6A 3ELHA 1NHKL 1BE4A 4CP5A 2ZUAA 3VGSA 4UOGA 3VGVA 1LEOA 3GPAA 1F6TA 3EVMA 3R9LA 3ZTOA 3Q86A 4UOFA 4W98A 3BBBA 3Q8YA 1B99A 5CAAA 2HVDA 3JS9A 1NDLA 1ZS6A 4FKYA 2DXEA 4EK2A 1VYAA 2DXFA 1U8WA 3FBCA 2AZ1A 4ANCA 3BBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BH6 B;  1S57 A;  4ANE A;  1MN9 A;  4F4A A;  1WKJ A;  3EVO A;  3EJM A;  1HIY A;  3L7U A;  1WKL A;  2AZ3 A;  1NB2 A;  1NDP A;  5C7P A;  3MPD A;  1XQI A;  3BBC A;  1K44 A;  3PJ9 A;  2DYA A;  4WBF A;  3ZTR A;  3FBF A;  1NSQ A;  5IOL A;  3ETM A;  1PAE X;  3FBB A;  5CAB A;  3DKD A;  1NDC A;  3FC9 A;  4UOH A;  1S5Z A;  1XIQ A;  3NGT A;  1WKK A;  3FCW A;  4O0N A;  3PRV A;  1KDN A;  3ENA A;  3G2X A;  3Q8V A;  1S59 A;  1F3F A;  3GP9 A;  3FKB A;  2VU5 A;  4DUT A;  1NSP A;  1NPK A;  4ENO A;  3EE3 A;  3BH7 B;  1HHQ A;  2BEF A;  3VVU A;  2CWK A;  1BHN A;  3B6B A;  1NLK L;  1NDK A;  2B8Q A;  1UCN A;  1JXV A;  3B54 A;  3Q83 A;  3EIC A;  2HVE A;  3VGU A;  3VVT A;  2BX6 A;  3DDI A;  3ZTS A;  3Q8U A;  4DI6 A;  1NSK L;  1B4S A;  2B8P A;  3NGR A;  5BXI A;  1EHW A;  4S0M A;  2DY9 A;  4FKX A;  3WX8 A;  4KPC A;  1MN7 A;  2HUR A;  1NCL A;  3FBE A;  2DXD A;  1NUE A;  1LWX A;  3NGS A;  2NCK L;  4HR2 A;  1W7W A;  1HLW A;  3Q89 A;  3ZTP A;  3NGU A;  3EMT A;  4C6A A;  1PKU A;  3EVW A;  4F36 A;  1BUX A;  3EM1 A;  3VGT A;  3ZTQ A;  4AND A;  3FCV A;  4DZ6 A;  3ELH A;  1NHK L;  1BE4 A;  4CP5 A;  2ZUA A;  3VGS A;  4UOG A;  3VGV A;  1LEO A;  3GPA A;  1F6T A;  3EVM A;  3R9L A;  3ZTO A;  3Q86 A;  4UOF A;  4W98 A;  3BBB A;  3Q8Y A;  1B99 A;  5CAA A;  2HVD A;  3JS9 A;  1NDL A;  1ZS6 A;  4FKY A;  2DXE A;  4EK2 A;  1VYA A;  2DXF A;  1U8W A;  3FBC A;  2AZ1 A;  4ANC A;  3BBF A; 
#chains in the Genus database with same CATH topology
 4A47 A;  3OTB A;  3IGV A;  2MQQ A;  1VFJ A;  4O3P A;  5KFW A;  3V4M A;  5F8M A;  2B43 A;  2H1Y A;  1YRT A;  2HZA A;  1E6Y A;  5AJ3 F;  5J2Q A;  2N4D A;  1CQM A;  4Q44 A;  1SJF A;  3R2C J;  3GII A;  1TK0 A;  1NDP A;  3MDF A;  4WFN Q;  2RKI A;  4HT5 A;  4C8Y A;  2QFJ A;  4ZS6 A;  2GAG C;  2FJB B;  3JTN A;  1TL4 A;  3K59 A;  4JI3 J;  3M32 B;  3FJ2 A;  4LR9 A;  1CSJ A;  1DAX A;  4M63 A;  3LP1 B;  1XEZ A;  1S5Z A;  1UEV A;  1XIQ A;  3L09 A;  1N5T A;  1L3T A;  2CQD A;  4K0K F;  2B4P A;  2PEH A;  3HFV A;  2V5H G;  2BE9 B;  1F9F A;  4OHW A;  3FZ2 A;  1WKK A;  4QW9 A;  3RBD A;  2E9T A;  5D0H A;  5JVG Q;  4F67 A;  3HCX A;  3M8P B;  4Z7C A;  4X4O A;  4OI0 A;  4NXM F;  4OYB A;  1M5K C;  2V34 A;  1YBU A;  3GFH A;  3NP5 A;  3P3D A;  1CJT A;  4RNO A;  5KG4 A;  3DXS X;  2FGO A;  4ZJO A;  2DH8 A;  5J2M B;  2MKY A;  2PMZ D;  4DL3 A;  1RTD A;  2M52 A;  3R7S B;  2XHC A;  2GHP A;  4B3T J;  3KHL A;  3N01 A;  1UFL A;  3O2I A;  2E9R X;  5A0Y A;  3QFW A;  3T1H F;  2ZWO A;  1LW2 A;  5LSL A;  3VVU A;  4JI8 J;  1Y5I B;  3ZNJ 1;  3DHX A;  3B6B A;  5C42 A;  8RUC A;  4KJI A;  2FZG B;  3K2Y A;  2AMC B;  3W8G A;  3M6V A;  3QAE A;  2C3P A;  3G6X A;  2UUA J;  3MR7 A;  3M2U B;  5E2Q A;  1Z2Z A;  1CS4 B;  4ZKA A;  6FDR A;  3Q24 A;  1X0F A;  1AFI A;  5IV4 A;  2GGP B;  1LWE B;  3A8K A;  3ZTS A;  1JWW A;  3Q8U A;  2RNE A;  4DI6 A;  4FXD A;  4Q2M A;  2DGS A;  4J9U E;  4YR3 A;  2V8H A;  5ETN A;  1HQE B;  2AGP A;  2JC0 A;  3THP A;  5IT4 A;  2YNF A;  4NCG B;  5KFO A;  4ZP6 A;  4ETZ A;  3FNN A;  2KXF A;  2H4W B;  4QIE A;  4NXN F;  5LMU F;  3M8S A;  3Q8S B;  3GMG A;  3OL9 A;  4RW9 B;  1VJW A;  4O3Q A;  4HH0 A;  4JI7 J;  3FBE A;  1MLA A;  4KHR A;  1HD0 A;  3VAL A;  1R8H A;  4EZ9 A;  2JHE A;  1RT5 B;  3HHL A;  4NI2 A;  5HAT A;  5DLG A;  4ED2 A;  2MJU A;  1RTH B;  1GK8 A;  2MKH A;  2NCK L;  2IAJ B;  1P27 B;  1IJE B;  2O1P A;  3BB5 A;  1U0S A;  4WXO A;  3DHW C;  5A6W A;  4Q45 A;  1RAB B;  3CCV S;  1RT3 A;  2NUH A;  5ETR A;  2GVD B;  4DS4 A;  4KSE B;  3TAM A;  1SH0 A;  2J5A A;  3CT9 A;  4L3N A;  2QG9 B;  3U27 A;  4DLE A;  2DGT A;  1NRK A;  1VOM A;  2W7A A;  4I4B A;  2XYP B;  3I4H X;  4OYZ A;  4O44 A;  4LVN P;  5HK4 A;  4CYU B;  4F8R A;  2QA4 S;  1MU2 B;  5LM7 E;  3CE8 A;  1YQH A;  1RBA A;  3CCE S;  2XMW A;  3BM7 A;  2IJN A;  3EZO A;  2QV6 A;  3F56 A;  2LA6 A;  4AL7 A;  5J2N A;  2YWW A;  1KSP A;  1LOU A;  3GIL A;  3DLH A;  1N5S A;  3MM6 B;  3UI3 A;  4YB5 A;  5DG9 A;  3RZA A;  1IXK A;  3GSD A;  1U2C A;  3H4D A;  4ECY A;  1IQZ A;  1WOR A;  2XNR A;  4LQ9 A;  4ZCI A;  3LO3 A;  4JBC A;  2KXH A;  5ETK A;  2Q66 A;  4PQU B;  2AYE A;  3A8I A;  3MM8 A;  5HLF A;  3KJQ B;  1AXQ A;  1CS4 A;  3N5F A;  7FD1 A;  2V69 A;  4NZ0 A;  4P72 A;  2PC6 A;  4LFB F;  1P6T A;  1VBY A;  2ZOF A;  1S0N A;  4C3M A;  5HJY A;  2KFN A;  2ERR A;  1X60 A;  5L1J A;  5K9F A;  4HHH A;  2ZJP Q;  2Y9H A;  5KG7 A;  4DV7 J;  2LFV A;  1C4C A;  4ZLP A;  2IJF A;  3IS9 B;  2FJW A;  3TYT A;  2FDN A;  2ZUG A;  5GAH U;  3FSI A;  5M2U A;  1RHQ B;  1U6F A;  3BR8 A;  3OFF A;  4KRW A;  1KFD A;  1I3O B;  2HBR B;  2WOM B;  3HMJ G;  1YG0 A;  3OTO F;  3KLG B;  3EJM A;  3ZZR A;  2J8A A;  1S97 A;  2E5L J;  1YJN S;  3QO9 B;  1TL7 B;  2AZ3 A;  2NSB A;  5C7P A;  2HS4 A;  1S7I A;  1IJF B;  2ZC3 A;  3MR3 A;  1MRO A;  3UNY A;  3DMJ B;  4H4O A;  3IBW A;  3AB4 B;  4RW4 B;  5F9N A;  2V50 A;  3H5S A;  2OFG X;  2VQE F;  3KK1 A;  4ZLJ A;  5D8H B;  3GCX P;  3MZI A;  3SIP B;  1X9W A;  1WG4 A;  3NGD A;  4I6W A;  4P2S A;  5T41 A;  2UUC J;  1N5Y A;  2Z8Q A;  3MTJ A;  4U6P A;  1URR A;  1C1C A;  4CO0 A;  4QQB A;  2GIQ A;  3C19 A;  4ES1 A;  4CM2 A;  7FDR A;  5H9F J;  3OJS A;  4LRC A;  1WEX A;  4IO1 A;  4AUK A;  3GYG A;  4ZCM A;  1TL1 A;  2ZBI A;  5HSP A;  4WFA Q;  3CCL S;  1JK9 B;  2FHM A;  3F44 A;  2ROP A;  4D3H A;  1TAU A;  3AD9 C;  3AAW B;  1WC5 A;  2WSE C;  3GIK A;  1WI8 A;  3I5C A;  4X62 F;  4ED7 A;  1OS5 A;  4IKA A;  5KFG A;  5K20 B;  1KQS R;  5DJB A;  4M5I A;  2BQ3 A;  1UFK A;  2ZKT A;  3RU0 A;  4ED6 A;  2EFN A;  2MHN A;  4L73 A;  1K47 A;  2O66 A;  3M8P A;  2PGC A;  3BGL A;  3JQJ A;  4LT6 A;  5E3R A;  1KOH A;  4TQR A;  5MLC V;  5GAH I;  3EIC A;  5B0F A;  2AJF E;  4M5D B;  4KGV B;  2LP4 A;  1YJV A;  3QSI A;  3VQT A;  2FVR A;  1IKY B;  1D1U A;  4PUO B;  3J81 j;  1RWX B;  5HBM B;  2VG6 B;  4MYU A;  2W9B B;  3D5M A;  3U1L A;  2HHU A;  2R7S A;  2NSC A;  1NSK L;  2B8P A;  2WB4 A;  3C6T A;  3RGI A;  2G1D A;  5DM6 Q;  4HH1 A;  4J9O A;  4DV1 J;  1UPM B;  1WHY A;  2YBV A;  3OBI A;  4WK1 A;  4JI6 F;  3RAQ A;  1U1Q A;  1RJJ A;  2MZS A;  4ILL A;  2KZM A;  2FYX A;  4PXE A;  1Y3K A;  4N56 A;  3MMB A;  2H5E A;  3BN4 A;  3MED B;  4ED4 A;  4ZPB A;  1RT1 B;  4UY8 5;  2FGC A;  4BWM A;  3ET6 A;  3QGI A;  3NMA A;  4RL1 A;  1C0T B;  3G8Q A;  3H2V E;  3MFI A;  1SC1 B;  5DG7 A;  1TK8 A;  3HHN B;  3QJL A;  2HWH A;  4QYZ K;  4UOC A;  5A8K A;  3TOQ A;  4DMZ A;  3L9Z A;  3BYP A;  4HR2 A;  2CPZ A;  4H54 A;  2Q3P A;  1M5H A;  3M6W A;  1RAO A;  4R5P A;  4I6Y A;  4A48 A;  3AXK A;  3EMT A;  2LQB A;  5G4D A;  4NLO A;  2NPF A;  1X5S A;  1GMW D;  1NJW A;  2RDD A;  1U8S A;  3ZTQ A;  4HHU A;  1KHV A;  1PSD A;  1G1X A;  3FCV A;  2OPQ B;  2M8D B;  2HND B;  1YJ9 S;  2Z4P A;  2V68 A;  2B4V A;  2O5D A;  3DOK B;  3HUL A;  4OYA A;  4AXI A;  4F0K A;  5K8P A;  2RIJ A;  4LFC J;  1T9W A;  4NXN J;  2ZD1 A;  1FX2 A;  2IDE A;  4O3N A;  3W62 A;  4CP5 A;  3W61 A;  1CQN A;  3ZNU A;  1LK7 A;  2KJV A;  3BR9 A;  4NCB A;  5D78 A;  3K5M A;  4OHZ A;  2ADB A;  5H1S V;  1VIS A;  1IWG A;  1KQF B;  3DM2 A;  3EVM A;  3SCJ E;  3V2U C;  4JI5 F;  1FKP B;  1FTR A;  1U02 A;  3HSD A;  2VIH A;  4K4Y A;  1Y9O A;  2CVE A;  1RT6 B;  2LXI A;  2O01 C;  4OZ3 A;  1CG2 A;  3H2L A;  1FTC A;  1SKW A;  1J5E J;  3TZZ A;  5IT0 A;  4C97 A;  4IG3 B;  5GMD A;  3B4D A;  3Q8Y A;  3LP0 B;  4OYM A;  3G87 A;  3HHL D;  3D4J A;  1HL6 A;  1RGV A;  2DK2 A;  4D3G A;  1YJR A;  2CQ2 A;  1HQU B;  1U26 A;  3QNW B;  2AX0 A;  1WI6 A;  3HD1 A;  1DUR A;  3RTV A;  3T5H A;  2AZ1 A;  1YIJ S;  3WQP A;  1F9H A;  2CAD A;  4ANE A;  3QAU A;  1HPZ A;  3PY8 A;  2G9O A;  5H9F K;  4USW A;  4ZVG A;  2GW8 A;  3LA0 A;  4QIV A;  3I55 S;  5LMN J;  2R2S A;  2R7W A;  4ECZ A;  1S6U A;  4CIO A;  3O8W A;  1QAI A;  3KXD A;  1JLA A;  2E5G A;  1HQU A;  3PJ9 A;  1SXL A;  3DLK B;  4OI1 A;  1H0H B;  1K1Q A;  2C2N A;  4CH0 S;  3G6Y A;  5A8K B;  4DL5 A;  1RAF B;  3T9N A;  4JI3 F;  4NEY A;  2RKI B;  1S99 A;  1JJ4 A;  3MGJ A;  4F4X A;  2YKP A;  2X3D A;  3K8V A;  3SQG A;  1YJW S;  1PO6 A;  1UL3 A;  1NK7 A;  1DTQ B;  5THW A;  3PRV A;  1XER A;  4AYB D;  3K58 A;  2VJU A;  1VRT A;  4GO5 X;  1TR0 A;  1S1T B;  3JAM Y;  3CWJ A;  5A8R B;  4IH6 A;  3BSN A;  3NLC A;  4P6Q A;  2YVS A;  1WG1 A;  1F3F A;  2P8I A;  3KHG A;  1FRX A;  1S12 A;  5HBM A;  1NBE B;  1RHM B;  5D4N A;  2B9W A;  1SB6 A;  4ZOS A;  3EE3 A;  5IWA F;  2ZE2 A;  5J2N B;  1UFW A;  1QTM A;  3QGH A;  5E0O A;  2HSE B;  5G0R B;  2U2F A;  2IA6 A;  4OZJ A;  1S76 D;  3TAR A;  1RAA B;  4JI1 F;  4ZPC A;  5GAD I;  1HR0 F;  5AXK A;  2E1R A;  4BC9 A;  4JV0 A;  4EO8 A;  2HVE A;  4A4J A;  2WBR A;  4G65 A;  3DDN A;  2V2K A;  1MML A;  4N77 A;  5FII A;  1KVK A;  2HQF A;  2K7K A;  4KV8 A;  2R8H A;  4DL0 C;  2V94 A;  3TZY A;  1FHT A;  3DRP A;  5ETL A;  3TNV A;  1D8Z A;  2WRM A;  2IM2 A;  1TKT A;  1YKW A;  4ITS A;  4ZPA A;  5J2P B;  3L7O A;  3VWS A;  4C0B A;  4DL4 A;  4MIW A;  4NCA A;  3UDE A;  1XR7 A;  2AD9 A;  1EX8 A;  2R9L A;  1AA1 B;  5HMX A;  4X4S A;  3SI8 A;  1RCO B;  1FES A;  2DXD A;  5LSO A;  1X4F A;  5KFC A;  4XO0 A;  1VRU B;  1T9V A;  3M9N B;  3PW7 A;  3P5B P;  3OHB A;  3NGK A;  3NGS A;  4C11 A;  1IKY A;  1A7G E;  4ZVR B;  1VS3 A;  4RUB A;  5K8O A;  1WWH A;  3CCU S;  1S48 A;  1S77 D;  3K5N A;  1VQS A;  1SQE A;  3Q89 A;  3DMJ A;  1TFY A;  3ZTP A;  2OO4 A;  4WWS A;  3E01 A;  2BE2 B;  2EG2 A;  3PDN A;  3T19 A;  3OJU A;  1RUS A;  4IOA Q;  1GTH A;  1HBU B;  3ISZ A;  4PEO A;  3VGT A;  3WZ0 A;  3ULH A;  1XMQ J;  1PGZ A;  2MDA A;  2OPP B;  2W4P A;  3CSK A;  4MYT A;  4K4T A;  3RJM B;  4DV6 F;  3R7N B;  2HQD A;  5EWG A;  3ENW A;  1M5P C;  3GV8 B;  4UUX A;  3IS9 A;  1T94 A;  2B7B B;  4ZCK A;  3GJS B;  3VGS A;  1S72 S;  2HHX A;  2HFU A;  5HMY A;  3LPY A;  1X4B A;  3KK2 B;  1IBC B;  1RT4 B;  1DY3 A;  2ZFH A;  1Q4R A;  5JXS A;  4GKK J;  2Y3Y A;  4X65 F;  2EC2 A;  3CDE A;  1GX6 A;  4X66 J;  2BAC A;  1NZ8 A;  2XMT A;  2OPP A;  4IH5 A;  4CM0 A;  2V9K A;  1V9O A;  3H40 A;  2WW8 A;  1CJK B;  4KC5 A;  3PKY A;  3R5J B;  5L9X A;  5KT5 A;  1NPR A;  4W98 A;  1VLO A;  3CC4 S;  1QAX A;  2L41 A;  3GG0 A;  4NLQ A;  2JLF A;  1S4E A;  3KK1 B;  4Y2M A;  3MM6 A;  4X64 J;  2IYG A;  2ZM6 J;  2JFK A;  1X4E A;  3MEE A;  2E7V A;  4EFA C;  2G0I A;  2CG8 A;  1X9M A;  3NNC A;  3T9Z A;  5KAK A;  1F9E B;  3JXO A;  1CC8 A;  3MM9 B;  1IKX A;  1PC4 A;  2WK4 A;  2GHV C;  4ICL B;  3SYZ A;  2FLP A;  5B08 A;  5DDQ C;  3LTO A;  1XNR F;  2LQ5 A;  2ILZ A;  3MMJ A;  5L8R C;  3UN3 A;  4CLP A;  4WZQ A;  2PT0 A;  1GNK A;  1PYS B;  1VBK A;  3U1M A;  1JJH A;  4B3M F;  4ILM A;  3MPD A;  3KHH A;  1YDL A;  1J2V A;  1HNZ J;  2ZOM A;  1AB8 A;  5E7O B;  1XNQ F;  1Q5Y A;  2KM8 B;  2ZZN A;  1ZAX A;  4KKO B;  3J7A 1;  5IV3 A;  1Q8I A;  4DQQ A;  3M4X A;  1HR0 J;  1FK9 A;  4FZV A;  3R1H A;  2XB2 D;  4I67 A;  1X8D A;  3DXB A;  1RT5 A;  2EFQ A;  4NI2 B;  2MQL A;  4TLR A;  5DO2 A;  3QZ7 A;  2UV8 A;  4FYY B;  3M2R B;  2VDH A;  1KOO A;  5K14 A;  2MHE A;  2WVB A;  3SZ2 A;  1XMO F;  5G0R A;  4NLG A;  2G1H A;  4EEY A;  5ETT A;  3IM8 A;  4NRT A;  4MH8 A;  3OL7 A;  3ENA A;  4N8N A;  4YS2 A;  1KLM A;  2ZE2 B;  4MK8 A;  4PXD A;  1Q53 A;  3PVX A;  3C46 A;  1WC0 A;  1HNW F;  5BR8 J;  1HQE A;  3X3U A;  1M5O C;  1RHR B;  2HNY B;  1VIX A;  2GHW A;  2QN6 B;  2B51 A;  4UTG A;  1NSP A;  2QMW A;  4YB6 A;  4DF4 A;  2XEX A;  2W8L A;  1YBA A;  5KG3 A;  2UVU A;  1SH2 A;  4O44 B;  7AT1 B;  4Y00 A;  4TXS A;  3UVJ A;  3CJ5 A;  1TKZ A;  5B0C A;  1WTF A;  5C2C A;  2QLW A;  3TUZ C;  3D1Q A;  3PR5 B;  3CCJ S;  1FFS B;  2KVQ E;  2IHR 1;  2D69 A;  2CXE A;  5HO4 A;  4F2S A;  2BMB A;  2J7K A;  1LW2 B;  3JSB A;  3HVA A;  4NA1 A;  2HHH F;  3GE9 A;  1U6B A;  2AV5 A;  3TZW A;  4E98 A;  5EHH A;  3OL8 A;  4K59 A;  2CQB A;  1FEE A;  2OD4 A;  2L3M A;  2JH3 A;  1LXJ A;  1YJU A;  3CIZ A;  5IQ6 A;  4LRA A;  1EB0 A;  2H4Y B;  2V8D A;  1BQN B;  3KFW X;  2DIV A;  4GVB B;  5J2M A;  1N36 J;  1IBK J;  2WON A;  3I5A A;  5LJ5 Y;  3PX6 A;  2JZ5 A;  3RAX A;  3Q22 A;  2QO3 A;  1HI8 A;  1DQ9 A;  1YZ7 A;  4P10 A;  4DV0 F;  4WTY A;  2WVF A;  2HFO A;  4ZVT B;  1J5O B;  4ZVQ B;  4QIF A;  1M1H A;  4DSK A;  4FNI A;  2K1R A;  2XYG B;  2XBP A;  2A3J A;  3K8W A;  3LP1 A;  2KHD A;  1FRM A;  2GGP A;  1TZ0 A;  5D4P A;  3BO2 A;  2OTL S;  3NKY A;  4DOZ A;  1QY7 A;  5KT2 A;  4C0O C;  1J5E F;  2AEM A;  1Y5N B;  3FDS A;  1BQX A;  5KFY A;  1PKU A;  2VPX B;  5D3G A;  3OTD A;  2E5H A;  1RT6 A;  4ID5 A;  2F7V A;  3HVR A;  2LA4 A;  4MKY A;  2ZC4 A;  4V19 J;  4OX9 J;  4XPE A;  3BS9 A;  5DQG A;  1ZM9 A;  2ZDO A;  2I5J B;  3DN9 A;  2A6O A;  3CJT A;  2H3E B;  1MSW D;  2GQ2 A;  5HP1 A;  4QR1 A;  2HLU A;  2JOQ A;  3HF5 A;  2OLW A;  4HL9 A;  4HVZ A;  4DF8 A;  2POK A;  2ZUA A;  3AOC A;  3OV7 A;  5RUB A;  5GME A;  3OLB A;  1LEO A;  1FJC A;  3Q2T C;  3TAN A;  3G82 A;  4M8L A;  1VK3 A;  1RHU B;  3CDU A;  1MG7 A;  2CPJ A;  4FP9 A;  3BSA A;  1VI7 A;  3JQK A;  4HHJ A;  1N52 B;  2HVZ A;  1HHT P;  4HI2 A;  5HVH A;  3ZC4 A;  3Q86 A;  2JX2 A;  4TQS A;  3TI0 A;  2D1C A;  5EWE A;  1L3V A;  3D0G E;  3I0R B;  1TL3 A;  4LR7 A;  2BOA A;  2PN6 A;  4CH1 A;  3H0P A;  3QMQ A;  3KG1 A;  2KB2 A;  2APO A;  1WD6 A;  1SJQ A;  2KYX A;  2M3D A;  1XNQ J;  3HK2 A;  2DCU B;  1N4L A;  3PCO B;  4JV2 A;  1X7V A;  3P5T L;  3W64 A;  2AWZ A;  3SBM A;  2EXU A;  2C42 A;  2NYH A;  3MMA A;  1CJV B;  1RT1 A;  4I0W A;  2UU9 J;  3CUL A;  4XPC A;  4PWW A;  1HYS B;  3EVO A;  2QA2 A;  4LF1 A;  2HAF A;  2DKO B;  4HT7 A;  1CBK A;  1H2U X;  2JFD A;  2LXF A;  4TYB A;  2C2Z B;  4CZC A;  2G0C A;  4EBC A;  4G3I A;  4USH A;  5HQM A;  4X64 F;  5H9E K;  4F26 A;  1RBO B;  1IKV B;  1K44 A;  2V6A A;  1EIY B;  4O3R A;  4F4Z A;  2LQ9 A;  4B3O B;  1GFW B;  2FHJ A;  2DIS A;  2IPO B;  2GJF A;  2XI2 A;  3FEX B;  5D3G B;  2M88 A;  3ZTR A;  2AU0 A;  2XUL A;  2EWH A;  4MKV A;  1IKW B;  2OUG A;  4OZ5 A;  1S1X B;  3A3P B;  1KC8 T;  2IRY A;  4QZV B;  3R5C A;  1H72 C;  2ROG A;  2BAB A;  2FJD B;  1M1G A;  2MEW A;  4J37 A;  1EET A;  1VBX A;  1KDN A;  2QSW A;  3NWR A;  2LU2 A;  3N5B A;  1SJR A;  1OPZ A;  2MKC A;  2QLX A;  3OVA A;  5A2Q Y;  3LP2 B;  1T3N A;  4EU0 A;  2ZH6 A;  6FD1 A;  1RTI B;  1QUV A;  2B4U A;  3FKB A;  4LF8 F;  3UR0 A;  2RUG A;  5J1E B;  3KLH B;  5IT9 U;  1Q8L A;  3OXL A;  3MAA A;  5DQI A;  1FD2 A;  4ID8 A;  4LR8 A;  3AOA A;  4OV1 A;  2H5I B;  1VK8 A;  3HO1 A;  3P45 B;  5KFT A;  3E51 A;  4UUW A;  3R27 A;  1I94 F;  2P9C A;  3MEK A;  4IFY B;  3R8Y A;  3BDP A;  3N6N A;  4AQY F;  2CPE A;  3T6B A;  2FJE B;  2G13 A;  3M30 A;  1WEY A;  2LQ8 A;  3M8Z A;  4K2X A;  4OX8 A;  3RB0 A;  3OXG A;  4R8U A;  3IO1 A;  2D74 B;  5CH7 B;  4CNY A;  3M2V B;  2M4M A;  4CLL A;  4PAB A;  2NR0 A;  2X7I A;  2YH0 A;  3JSY A;  3QO9 A;  4DPW A;  3QGP A;  3KLG A;  2ROE A;  3VCD A;  2CNL B;  5KFI A;  3VAJ A;  1NK6 A;  5FDL B;  4DR2 F;  1GXL A;  1JLE A;  3RRG A;  3OTE A;  1P9Q C;  4A8W A;  1JLC A;  1KTV A;  2BJ1 A;  3F73 A;  1LWX A;  3DC2 A;  2KXN B;  1FX4 A;  2MSS A;  2V4J B;  2I38 A;  3T5L A;  4WU3 A;  1ZH5 A;  1VQ4 S;  4ZJQ A;  3NNH A;  4LFB J;  3KTQ A;  3MM7 B;  1RAD B;  2CPH A;  4IDK B;  2A2D A;  1HI1 A;  3WHI A;  1Y7P A;  4ZVU B;  4ZDN A;  4NLV A;  4K50 A;  1R7I A;  1OYD A;  5LT5 A;  1WSV A;  3W1Y C;  4B02 A;  2VHG A;  4FYV B;  2XZW A;  3AQP A;  4F50 A;  2DR6 A;  4B3S J;  3CMA S;  1U48 A;  2I8E A;  1QSS A;  1VJQ A;  2ILY A;  5HJX A;  4QWC A;  1RLD A;  1UPP A;  2ZVS A;  1VQM S;  4E0D A;  2VOP A;  3BGF A;  2Q6C A;  5C25 B;  1B64 A;  4LSN B;  5CYM B;  2MXY A;  1RZM A;  1HWJ A;  4PG7 A;  4CO5 A;  1JJC B;  4DX7 A;  1MU2 A;  2NYI A;  2KH9 A;  3NBP A;  2B6A A;  5KFX A;  4PYD A;  4Y2I A;  2HPU A;  5ADZ A;  1SPB P;  2HNZ B;  2KJW A;  2XLI A;  4EYH B;  3OFH A;  4DG1 A;  2RDI A;  3TAM B;  2M0G B;  2P6S A;  3AH6 A;  5DET A;  4UOF A;  3G71 S;  3NL0 A;  1N33 J;  2XSJ A;  4CTA A;  3QIP A;  4IG0 A;  2JLG A;  3OR1 B;  1N56 A;  3D68 A;  4LRF A;  3SV3 A;  1QAJ A;  2CQC A;  2RRN A;  1ZS6 A;  3R5B A;  4OZL A;  2B9X A;  2VV5 A;  3CIM A;  4P73 A;  3VAF A;  1VQ6 S;  2VOD A;  2YKQ A;  2C2K B;  3MD1 A;  3J80 Y;  2YNI A;  2DXF A;  2YX7 A;  4NLY A;  3GYN A;  4DQS A;  1LXN A;  5LMN F;  1S1V A;  2F8H A;  4DR2 J;  5E3P A;  1FWL A;  4DBQ A;  1IBM F;  2BDP A;  4M5J A;  2V4J A;  3T5K A;  1RAG B;  4RW9 A;  1OWX A;  3CPW R;  1U1L A;  1MN9 A;  4F4A A;  4DR3 F;  1JLC B;  3IAM 9;  3PZP A;  4RU9 A;  4K5R A;  2WZ1 A;  2IC3 B;  4Y0F A;  1HBN B;  3GJQ B;  4B9U A;  2K7J A;  4UZC A;  1OY6 A;  2XO6 A;  3PYE A;  1LV5 A;  1UTA A;  3CDW A;  4RPF A;  1WG5 A;  1REG X;  3FBF A;  4LMZ A;  4GKK F;  5E3C A;  5B0A A;  2C28 A;  1MWY A;  2CQ3 A;  2JWN A;  1WDT A;  1NDC A;  1HBN A;  4J9M A;  4JYA F;  1R31 A;  4ZPD A;  2YY3 A;  3KDO A;  2MQP A;  2OMO A;  2PE8 A;  4JI8 F;  1C2P A;  3LAM A;  5C42 B;  2OEM A;  4EMD A;  2I1R A;  1OMS A;  2F8E X;  2YQ0 A;  5CA5 A;  1TKD A;  2OSQ A;  4HDG A;  4IFY A;  3D2W A;  4I1T A;  5HLF B;  1VGY A;  1ZET A;  4X4P A;  2E1C A;  1VQK S;  2AIR B;  4B08 A;  2YNH B;  3AOB A;  2VBW A;  2VKZ G;  3G8T A;  1ZPW X;  2AYB A;  1NPK A;  5ITH A;  3TP2 A;  3IR7 B;  3LUY A;  1X4C A;  1HNV A;  1DBD A;  5E5N A;  2CNN B;  4Q0B B;  1CEZ A;  3WDO A;  1QE1 B;  2E5I A;  3TO8 A;  2XSJ B;  1NEE A;  3Q8P B;  4ECU A;  2E66 A;  4JI2 J;  2XMJ A;  3CJK B;  1JNZ B;  2FVP A;  4ETX A;  3W2V A;  3IC1 A;  2RS8 A;  3VVT A;  2Y0B B;  3MR6 A;  3QWP A;  2XWX A;  1S1U A;  3DRS A;  4YY3 F;  1JJ2 R;  1OQ3 A;  2RQM A;  5B09 A;  4TU8 A;  4NML A;  2DNK A;  3KMS A;  1U24 A;  4A8Y A;  1N0U A;  2ZHA A;  4LSN A;  4RJV A;  5CYM A;  2PA8 D;  4CNZ A;  1E6Y B;  4FKX A;  4J9V A;  4XTT A;  4B3M J;  1WEL A;  2OSR A;  4USI A;  2EEY A;  2DTJ A;  3EYZ A;  4RW6 B;  2WSC C;  2L9D A;  4P2F A;  5F8N A;  3BKU A;  4W4M A;  2DIT A;  4M95 A;  2RE1 A;  4OJ1 A;  3N79 A;  2F8M A;  2OTJ S;  2JLE A;  2W2O P;  3TW0 A;  1X9S A;  1A9N B;  4RUA A;  3MOZ A;  3ZZT A;  1U0H B;  3MHY A;  1TUG B;  3CCQ S;  2IVF B;  2DIU A;  4KB7 A;  2ZM6 F;  3OR2 B;  3GB0 A;  3IG1 B;  1Q7L B;  5E3Q A;  4CLF A;  1BLU A;  4GVL A;  5E33 A;  4C6A A;  2GMJ A;  4QBU A;  2UUB J;  3RRH A;  2YKM A;  3PM9 A;  2QL5 B;  5J1P A;  1QTN B;  3F41 A;  4K4V A;  8AT1 B;  5FDL A;  1RT7 A;  5AXM A;  3SFG A;  4E2F B;  2FJX A;  4K4S A;  2QTW A;  1AZS B;  4NLD A;  4ECV A;  1YHQ S;  3PO5 A;  2FHO B;  3D7S B;  2VBY A;  3ETO A;  3L7P A;  1D0E A;  1F0X A;  2MLY A;  4UW2 A;  1ITP A;  4Q0B A;  5CCL A;  3M2V A;  2R7X A;  4HTI A;  4LF6 F;  2WON B;  3WC2 A;  1DTT A;  2Z58 B;  1ZA1 B;  4DV5 J;  3THV A;  1JB0 C;  1RSC A;  3MUV P;  4YFU A;  2Z2L A;  3ITH B;  1K1S A;  1RHJ B;  5F3T A;  4IFV B;  5HI7 A;  2LQJ A;  3NNA A;  1H74 A;  3B82 A;  4TKT A;  3GFX A;  5CAA A;  2XTJ P;  3TZX A;  3KLV A;  2UUC F;  4EZ6 A;  1TKZ B;  3GIJ A;  4DL7 A;  1RAJ A;  4EK2 A;  1RIS A;  2F4V F;  1VYA A;  4FYD A;  2KTQ A;  1U4B A;  2OML A;  3VZH A;  2MQO A;  4PR6 A;  1FRH A;  1TKX B;  4H4K C;  4M5N A;  4NA3 A;  2DRA A;  1RU2 A;  2N3O A;  1QSY A;  5KFA A;  2PI4 A;  2K1R B;  4LJM A;  2AX1 A;  2UUW A;  1PG5 B;  4MFB A;  5L46 A;  4NX9 A;  1SL2 A;  3DRR A;  1XJW B;  1TKX A;  1R8P A;  2OKQ A;  3I5B A;  2HGM A;  1NB2 A;  1UJ4 A;  3R5D A;  4NYP A;  4NLR A;  2QX0 A;  3TUJ C;  1RKJ A;  2F40 A;  1V3R A;  5K14 B;  3RW7 A;  4KIA A;  5AXL A;  1TL5 A;  3GZ7 A;  1RWP B;  2EVZ A;  2QA1 A;  1TFW A;  2EC0 A;  4F02 A;  2ZH1 A;  1S4F A;  5E3A A;  2VG5 A;  3T41 A;  2VA3 A;  3NAH A;  3J80 U;  1EJ7 L;  2FIU A;  2LEP A;  4TYA A;  2XS5 A;  2ADC A;  2CJ9 A;  2MGZ A;  2FVQ A;  1MW7 A;  5T7L A;  5FLX U;  1U47 A;  2AF6 A;  3QIP B;  4IG0 B;  3FK4 A;  2IBK A;  3LH2 S;  4Q43 A;  3MFH A;  2L48 A;  3CCR S;  4DR7 J;  1HAR A;  4R0E A;  4OZ1 A;  2CJK A;  1WHW A;  2C3U A;  2MLZ A;  4I6A A;  3HX9 A;  4ZCL A;  3W3S A;  1FJ7 A;  4KO0 A;  4NL5 A;  1FT8 A;  2DHG A;  3GP9 A;  3LW5 C;  3NBP B;  2AEJ A;  2CZ4 A;  2HWI A;  3PEH A;  4KR0 B;  2FTR A;  1HNW J;  2J6T A;  2UVW A;  2MST A;  2OPS B;  2RHQ B;  3ZXW A;  1RWM B;  4DDF A;  2DO0 A;  4ZIV A;  2HG4 A;  2HS3 A;  2XGP A;  2XY6 A;  2BEF A;  1BHN A;  1NHV A;  1T7P A;  5EUH A;  5CZV A;  4HAC A;  1UA1 A;  2YKM B;  2D3U A;  2ASJ A;  1VHF A;  2DVI A;  4DQI A;  2V0N A;  1RAC B;  2FHJ D;  4OHV A;  1QM9 A;  2CPY A;  1CJK A;  4K4U A;  2BRL A;  2KRR A;  3D1O A;  3OR2 A;  4UQG A;  5KFH A;  4FS1 A;  1E6V A;  3KLF A;  5A8W B;  1YRU A;  1CJU A;  3KK2 A;  2FZK B;  4S0M A;  3H2U B;  1KRP A;  3IAS 9;  3KLI B;  1T9U A;  4M94 A;  2DNN A;  2DD8 S;  4NZ6 A;  3SCI E;  3K57 A;  1TTH B;  1X4D A;  4UY8 T;  1TL1 B;  4XDC A;  1UVL A;  2J9E A;  2Y1L B;  5D6G A;  4ED0 A;  2KFZ A;  2CPD A;  4IRK A;  4YB7 A;  4RBT A;  2VUG A;  3MM9 A;  2BW7 A;  4QWA A;  4RU2 A;  1OO0 B;  2NXJ A;  1ZYQ A;  2P9G A;  4LQ3 A;  1N8R T;  2A1B A;  4NA2 A;  4C4W A;  4ERD A;  4KGZ B;  4WYL A;  2VFU A;  2CQH A;  4UST A;  2CDQ A;  3UQS A;  3US5 A;  1KVI A;  4R25 A;  3EM1 A;  4C11 B;  3MEG A;  4DSI A;  1MRO B;  3FSY A;  4MJK A;  4DN0 A;  4X65 J;  4C9D A;  2RUS A;  3KG4 A;  4YME A;  3BO4 A;  4NE9 C;  1P9Y A;  1RA6 A;  5DZ6 A;  3W9J A;  3DLE B;  3T6J A;  4DSL A;  2L9W A;  1R6Y A;  3KJF B;  2E29 A;  2HGL A;  2W25 A;  4GVB A;  1S7H A;  2GQQ A;  2PMH A;  3CNQ P;  3A8E A;  4DR3 J;  1VC6 A;  3AJ2 A;  4ELU A;  1UVN A;  3HVT A;  4Y28 C;  4CO4 A;  5J1E A;  4QWD A;  2VL1 A;  2FC8 A;  1G3O A;  2K3K A;  3IBF B;  2CVI A;  3M9O B;  2EI5 A;  3DGP A;  4ED5 A;  1TUV A;  2AEF A;  3MEG B;  4LSZ B;  2QYG A;  2VON A;  4KPY A;  2R7V A;  1UAW A;  2HQ3 A;  4Q8E A;  2D9O A;  1G6B A;  3BYR A;  4O0I A;  2ASD A;  3PEJ A;  1B99 A;  2CZ9 A;  4J9R A;  5KFV A;  1T02 A;  4CLW A;  4DU8 A;  1H38 A;  4CLU A;  3O1L A;  1S1X A;  1N33 F;  4P7V A;  2N82 B;  3ZFV A;  2J9D E;  3R97 A;  4DPX A;  3CJ0 A;  2ZKU A;  4DS5 A;  1RLC L;  4KGM A;  2RT3 A;  4IH7 A;  4O4G B;  2J6U A;  2HMI A;  2QJ3 A;  4DZD A;  1KLM B;  3M8R A;  3ILO A;  4NYO A;  3ZZU A;  4ZPW R;  2GML A;  1FF2 A;  3KLI A;  1GXT A;  1REV A;  1S9E B;  3LAN A;  5BJR A;  5AE3 A;  4M5K A;  4DFJ A;  3G6E S;  1WHX A;  4IRD A;  2YKN B;  1FRJ A;  1T03 A;  1X4G A;  2R8J A;  4RUC A;  2YX4 A;  2VPW B;  3ISN D;  4JI1 J;  1U2R A;  1DJ0 A;  3I6P A;  4J5O A;  1QUP A;  5J1N A;  4PCQ A;  4CH7 A;  4LUB A;  4M5H A;  4C8K A;  2IAJ A;  2GFF A;  1YJ7 A;  4JV5 J;  5CQG A;  2V4R A;  2LCW A;  1WF2 A;  2B5J A;  2Y0S D;  1TK5 A;  2DR5 A;  1TL3 B;  1OYE A;  4O0N A;  1FFG B;  3JSM B;  2KYZ A;  2MQM A;  2Z56 B;  3SCK E;  2AW0 A;  3EWG A;  3IRX A;  2XI3 A;  4I2P A;  1KWM A;  3QRQ A;  3FVY A;  1LFW A;  5B7W A;  1U45 A;  2AJ4 A;  5ETO A;  2VU5 A;  2VBZ A;  3I96 A;  4MK9 A;  2N7C A;  4ZP7 A;  3LGN A;  3RB4 A;  4UT4 A;  4AT1 B;  3J81 Y;  3TA1 A;  4DN9 A;  5L38 A;  2QMU B;  2BAN B;  3C15 B;  3G8S A;  5HP1 B;  4YY3 J;  1WOO A;  3G4S S;  3LAK A;  5T7L B;  1A6L A;  4LVO P;  3QJP A;  1IBL J;  1CLF A;  2MKI A;  4B9T A;  1UCN A;  2C1E B;  1BQM A;  3R6G B;  4OX7 A;  4RWW A;  3TAQ A;  3OXF A;  3QPI A;  3CD6 S;  2HHV A;  2PMW A;  2XCP A;  1X4A A;  4C3L A;  2ZHB A;  1JX4 A;  2N3L A;  3HXM A;  3VAI A;  4DR4 J;  4OI2 A;  5IZH A;  4U95 A;  1X0P A;  3CCW A;  4WE1 B;  1TP7 A;  2R8K A;  2Z2M A;  3BRE A;  3FZB A;  2BM0 A;  1PYO B;  3P96 A;  3RB3 A;  2DGQ A;  3NGR A;  3H8Y A;  1X5P A;  1FNO A;  4MFB B;  1G2E A;  2Y1R I;  4AL5 A;  4OLO A;  5IXU A;  3BGO P;  2VPZ B;  3V6J A;  2UZA A;  2HUR A;  1N36 F;  3NOG A;  1HHS A;  3D6F B;  1XK8 A;  3QWU A;  2V67 A;  2QGF B;  1HPZ B;  1RT2 B;  4WKY A;  2W24 A;  4EYI B;  1U1N A;  1IKW A;  2FY1 A;  2R42 A;  2UVV A;  2GCF A;  4WXW A;  4DR5 J;  3LGM A;  4P52 A;  1YLX A;  3CD7 A;  2C2M B;  3PJW A;  3WC0 A;  1FNM A;  3H5X A;  1AT1 B;  5KFM A;  2MZR A;  4IQM A;  4IFV A;  4DCJ B;  3V4I A;  3ZZZ A;  2MZQ A;  3FQK A;  5DS7 A;  1F1B B;  5IFM A;  1FXR A;  3W9H A;  3ZZP A;  2DR8 A;  3LWL A;  3TQ1 A;  2BKP A;  3TJ8 A;  5J2Q B;  1JLF A;  3MCS A;  4DL2 A;  1N32 J;  4DFP A;  1PJ7 A;  2VKR A;  2H5J B;  1S49 A;  2DNH A;  3PFE A;  1YBT A;  3VZI A;  2CZV C;  2DNZ A;  1V3Z A;  2IVY A;  3CMQ A;  3IA0 A;  1AZS A;  1FWK A;  3CXC R;  4QU7 A;  4AXJ A;  4OL8 A;  2QA4 G;  1FER A;  2ZD1 B;  3EXY A;  4WJB A;  5EWF A;  3OVS A;  1B7Y B;  3ZTO A;  2DNQ A;  1S6P A;  1VQO S;  5IS2 A;  1HI0 P;  1R8A A;  4QOT A;  1UEK A;  4MIB A;  3AB2 B;  4H4K A;  4WPA A;  4ZA1 A;  5KFQ A;  1U1P A;  3NAI A;  1RXO B;  4FKY A;  2YQ1 A;  2NQP A;  3IG1 A;  1HNZ F;  3MM5 A;  4ZHR A;  2KKH A;  1UVJ A;  2IVM A;  3GU0 A;  4FF2 A;  5HAO A;  2P5V A;  1JKH B;  1FK9 B;  2C2O B;  1PJ6 A;  1SL1 A;  4BS2 A;  3PHE A;  1UVM A;  3BGR B;  3FC9 A;  4RW8 A;  4DR4 F;  1XNR J;  5IWA J;  2HEK A;  1JLQ A;  2EG1 A;  1PC5 A;  3BH6 B;  3DCA A;  5I42 A;  2A18 A;  1C0T A;  1WKJ A;  3DDK A;  1NJI T;  2M5Y A;  3MAH A;  3L4B C;  4NLX A;  4DCO B;  3MMA B;  1R0A A;  1NKB A;  3O44 A;  1BMQ B;  2J76 E;  2C22 A;  5I3P A;  2PO4 A;  2COL A;  2DO4 A;  3CJ2 A;  3IRW P;  1N5Q A;  5CXT A;  4DR7 F;  1NU4 A;  1BD6 A;  1C1C B;  2JDJ A;  2ZHO A;  3IM9 A;  4DQR A;  4OIX A;  2V9W A;  1BWE A;  2K2P A;  1SL0 A;  1SQF A;  2F4F A;  1U7L A;  5B0E A;  2ZZM A;  5CZX A;  1M1K T;  3W2V B;  3H7H B;  2OD6 A;  2MKJ A;  3NCP A;  2GC8 A;  4H4O B;  4UZB A;  4DR5 F;  1OSC A;  4RBU A;  1D8Y A;  3FCW A;  8ATC B;  5KFF A;  1RBL A;  3EGN A;  1PBA A;  2O3D A;  3IMQ J;  1UA0 A;  2RDJ A;  5DZ7 A;  2IMO A;  1UWB B;  3HVW A;  2V2V A;  3DI6 A;  2A6M A;  5MAO A;  4L75 A;  2BE7 D;  2CPF A;  4CDI A;  1T05 A;  4OMF G;  4DV0 J;  2JEJ A;  1XC9 A;  3MTK A;  4WII A;  1V6H A;  4IOB A;  3ENV A;  4F4Y A;  1O8B A;  2FJA B;  3HJV A;  2XMU A;  2CWK A;  3U7J A;  3VHQ A;  2NXC A;  1Q86 T;  3GV5 B;  2F1F A;  2ZWP A;  3AY0 A;  4L3K A;  3ISN C;  3UD5 A;  4YOE A;  4Q7A A;  1ULR A;  4ALZ A;  4O3S A;  3DRY A;  2L08 A;  4FYX B;  1X31 C;  2AGO A;  3M05 A;  3AOD A;  2MPU A;  5L9N A;  1SBR A;  2BE2 A;  3N6L A;  4CLZ A;  4YHH J;  4FF4 A;  4Z37 A;  3T3F A;  4A8O A;  1P8G A;  3MPU B;  1LWF A;  3OUY B;  1L5U A;  1IR1 A;  4KPC A;  2W7O A;  1VRU A;  4KH1 B;  4LF6 J;  2DH7 A;  2Z2Y B;  1S6Q A;  3EZ5 A;  3RUB L;  4G6V B;  1SJ3 P;  2RU9 A;  2DBB A;  2YKO A;  1EP4 B;  1S0V A;  2WOM A;  1NUE A;  1U1O A;  3CCT A;  4LF2 A;  3KK3 A;  2X51 A;  2IM1 A;  3GJR B;  4CI0 B;  1YTY A;  4YR2 A;  2HS0 A;  1U1K A;  2UUB F;  4KTQ A;  4LF5 F;  5I4M A;  3OVB A;  4RUH A;  2HHS A;  2NXN A;  2PFD A;  4KV8 B;  2Q79 A;  1KD1 T;  4QCL A;  2IDL A;  2VFS A;  2LEC A;  1LQ9 A;  3SEO A;  4Y6I A;  5DRK A;  4URS A;  3HHL C;  4F36 A;  2OP5 A;  4KGX B;  4ELV A;  1BUX A;  1RTH A;  3QYY A;  4L72 B;  5F0W A;  4AND A;  1ARO P;  3IWX A;  4DG1 B;  4QW8 A;  1NHU A;  3MED A;  1B3T A;  5EX0 A;  5F9L A;  1EP4 A;  2WCX A;  4OYW A;  3H59 A;  1XBW A;  2B0G A;  1REV B;  1S9E A;  1DAR A;  1WSR A;  3W63 A;  1WNE A;  2UXD F;  2P9E A;  1Q16 B;  4ZJL A;  3FMW A;  1I51 B;  1TAQ A;  1RWU A;  1T95 A;  2CDR B;  3ILJ A;  3M8Y A;  4RX6 A;  3VGV A;  1K0V A;  3CJ3 A;  2PDA A;  2ZJR Q;  1P1T A;  4K8R A;  5U47 A;  1VC0 A;  1M90 T;  2DR7 A;  4QYR A;  4JI6 J;  4U7C A;  1QDU B;  2GVZ A;  2AJ1 A;  3SDE B;  5HQ8 A;  3MUT P;  4DV1 F;  3EGZ A;  2AYM A;  3H20 A;  1T0T V;  4B17 A;  1BGX T;  4WFY A;  3OW2 R;  1VQY A;  3FMB A;  3EX7 B;  1HQ2 A;  3VAG A;  4Y65 A;  4CYU A;  4CLS A;  1RQ0 A;  2JVR A;  2NUU G;  1DTQ A;  1Y10 A;  2NXE A;  1QVG R;  2QT7 A;  3QRR A;  4KHP J;  3AQO A;  2DHX A;  4WKR A;  2HFV A;  3RRK A;  5DGB A;  4NAS A;  3I9V 9;  4KBI A;  4X66 F;  2CG4 A;  3UDL A;  3KJN B;  1FI4 A;  3MXH P;  1OQ6 A;  2HHP A;  4ILR A;  3S6E A;  5HVF A;  3Q0A A;  3JB9 k;  1TMM A;  3PW2 A;  2KT5 A;  3CCS S;  1HBM A;  4B3R J;  2PFF B;  4AFF A;  1R3N A;  1QAY A;  1HIY A;  3L7U A;  3W66 A;  5GAG U;  1UZD A;  4OX9 F;  3U02 A;  4DJB A;  5JMN A;  1FCA A;  5FJ4 A;  5KTQ A;  3CD0 A;  3BO3 A;  2YPZ A;  3E01 B;  4QWE A;  3KDN A;  4CO2 A;  1S6O A;  2RQ4 A;  1B0V A;  1KR4 A;  1FE4 A;  2CNK B;  3TEH B;  3H25 A;  4JYA J;  4NMX A;  1ACM B;  2HBZ B;  5KFB A;  2E7X A;  2WVC A;  1PAE X;  3I4P A;  5AE1 A;  2BJD A;  3OSP A;  2E1A A;  1R89 A;  1ZBT A;  1YX2 A;  1Q8B A;  1NK0 A;  3NGT A;  2LLZ A;  2DHH A;  1WJ9 A;  2VFT A;  2YWF A;  1FXL A;  2FQQ B;  1ZA2 B;  2D9P A;  3MPW A;  4RKU C;  2MQ8 A;  4KHM A;  5KFL A;  1MWQ A;  1RT4 A;  2FVC A;  2QLF B;  3QGG A;  4PWD A;  3MI7 X;  3TR5 A;  5L39 A;  3GSI A;  1NK4 A;  2A0F B;  3IWL A;  1IWA A;  4Q8F A;  4HEA 9;  4RW8 B;  4Q2L A;  2ZH8 A;  3KMQ A;  1ZPV A;  2ZBQ A;  2OEJ A;  1NO8 A;  1NH8 A;  1CJT B;  1GMV A;  2IRU A;  4FPR A;  5KG2 A;  2V2Z A;  1IBM J;  3K5P A;  2UV8 G;  4FDF A;  1BXN A;  2KU7 A;  1HBU A;  3G96 A;  3MM8 B;  3GIR A;  2BA9 A;  4OZN A;  2OPQ A;  5CCM A;  3GV7 B;  3QAT A;  3KYL A;  2ZVI A;  1GX5 A;  1S6P B;  3M8W A;  1HWI A;  4NLU A;  4WU2 A;  1AYE A;  1YIT S;  1KN6 A;  3UN2 A;  1RTJ B;  4CRJ A;  3FRY A;  1O6X A;  3JTO A;  5M2P A;  2W2M P;  1OY9 A;  3R5G A;  3RAM A;  4DXL A;  1TQL A;  2AJ0 A;  2VQF F;  2DPJ A;  3QRP A;  3AXM A;  4KT0 C;  4ED8 A;  5HRO A;  4DSJ A;  1QLN A;  3LPE A;  1PIE A;  4DWI A;  4N76 A;  4IQX A;  4J9N A;  3D6M B;  1JLF B;  1R0A B;  4LRD A;  3BPS P;  3GTY X;  3I82 A;  5A76 A;  2KZZ A;  1A0O B;  2I0X A;  4Y2A A;  1X5O A;  3DRP B;  3KNA A;  4FPI A;  1RYR A;  4LF7 F;  1GH8 A;  5ETV A;  4W92 B;  2KG0 A;  2ABY A;  1DQ8 A;  1NSA A;  2ACM A;  2WVE A;  4NOH A;  1Q0N A;  3LQV A;  4OX6 A;  1U49 A;  2OH2 A;  3R3T A;  3HHD A;  3AJD A;  3NY0 A;  5CHC B;  4JI0 J;  2J8S A;  5BYR A;  3BKF A;  1RCX B;  2XM3 A;  3QZ8 A;  1UET A;  4H4M A;  1UWA A;  4PUO A;  1I5O B;  2J0X A;  1UEU A;  2VB6 A;  4C8L A;  3A12 A;  2C3Y A;  4X4V A;  3ADA C;  1X5T A;  3UO0 A;  2W9A A;  2DGV A;  4JI4 J;  3FQL A;  1SV5 B;  3SSQ A;  3BZQ A;  2C3M A;  4Z7Y A;  3R1L A;  4HKQ A;  2HQI A;  3TA2 A;  2MZ1 A;  3H5Y A;  1HNX J;  2NS1 B;  1D9D A;  2HW3 A;  5CYJ A;  3I0S A;  1F3V A;  3DRR B;  3G82 B;  4WFZ A;  3J7Z 5;  4QPT A;  2VG7 B;  4ZN1 A;  1VIO A;  2DH9 A;  2XG8 A;  5DGA A;  1D9F A;  2XMM A;  2OI2 A;  4UOG A;  2QSF A;  1FKO A;  3AA9 A;  1GTE A;  5AT1 B;  4FF3 A;  4NEZ A;  1D09 B;  3TVZ A;  3CVK A;  4YHH F;  1NK5 A;  3LP0 A;  5CYQ A;  3D6T B;  3PNI A;  2IFX A;  4IG3 A;  3POT A;  1J27 A;  5D15 A;  3VF0 B;  1DRZ A;  5I3U B;  2V63 A;  4KYZ A;  2CUY A;  3GFZ A;  2XNQ A;  3SQG B;  5JUM A;  2BVZ A;  2HVI A;  1EZZ B;  2YKA A;  1I94 J;  3BF4 A;  3DM2 B;  3JS9 A;  2AJ2 A;  5A0Y B;  3I32 A;  2DEJ A;  3AD8 C;  4DPU A;  3M8Q A;  4AQY J;  4OV6 A;  2RAQ A;  3EDQ B;  3V6H A;  1FKO B;  2KT3 A;  2XO7 A;  4DR1 J;  2RB7 A;  1DTT B;  1RAE B;  1U6Z A;  1WUU A;  2W1B A;  3A4T A;  2UXB F;  3HP6 A;  2VF3 A;  4C3K A;  1S57 A;  4NRU A;  4GO7 X;  3W60 A;  2FPH X;  2HND A;  3MOJ B;  4I2P B;  1WC4 A;  2HFN A;  2DPI A;  5D4L A;  2C2E A;  1EKS A;  1Q95 G;  1WKL A;  2RSQ A;  1UW4 A;  3BSC A;  3C6U B;  2KDO A;  3BQ1 A;  4GC7 A;  4LF8 J;  4X4Q A;  2M7S A;  2GAH C;  3AA8 A;  3KWM A;  2CPX A;  2AP6 A;  3BBC A;  4WFX A;  3M7V A;  4DPT A;  5GAG I;  1Q1K A;  4M5G A;  5GMK a;  3CCZ A;  3M8Q B;  3QT8 A;  3C66 A;  1FJE B;  1B7F A;  5CAB A;  3FBB A;  1FFW B;  2OGU A;  1WAC A;  3IP0 A;  4LIR A;  2V8V A;  4HDH A;  1MMN A;  4DX5 A;  4ZIW A;  4DEZ A;  1JLB A;  4K4X A;  1F5A A;  2B3T B;  4CT8 A;  2C2R A;  2ASL A;  3A8J A;  2EPI A;  3R7B B;  4DUZ J;  4FBT A;  2R4F A;  3PX4 A;  2JRS A;  3MMB B;  1Q78 A;  3DOL A;  4ZIT A;  4M5L A;  3L3C A;  1O51 A;  3THT A;  4RZR A;  3Q8V A;  2GJI A;  3SQO P;  2JSX A;  3W5X A;  2RD5 C;  3HHE A;  2E7W A;  1IR2 A;  1H7X A;  3MWB A;  2RJZ A;  2BAN A;  3C6T B;  2GVZ B;  4WK3 A;  3SDE A;  5AJ3 J;  2UU9 F;  1JKH A;  2VG6 A;  2W9B A;  5F0U A;  1R8B A;  4URG A;  3FUY A;  4O4G A;  2GQC A;  3UFC X;  1UMJ A;  2HAI A;  2GV1 A;  2QC3 A;  3DOK A;  3M6U A;  5KT3 A;  3VAH A;  3RBX A;  3V81 A;  1RHK B;  1RDR A;  3I56 S;  4IRC A;  4WP3 A;  1HWK A;  4EGL A;  1JXL A;  1GT8 A;  3Q83 A;  2GA7 A;  4YDD B;  2IMW P;  2QRR A;  1O0P A;  3DDI A;  3O5T B;  1H2V Z;  3CD5 A;  3KHR A;  5D0R A;  5DG8 A;  4LBP A;  2WTF A;  2M9K A;  3NOC A;  3ZZ0 A;  1PYT A;  1HNI A;  4QIW D;  1FJG J;  2YXL A;  4TVA B;  3P6Y C;  3RBZ A;  4ZLN A;  3ET6 B;  3UNG C;  3E2E A;  2DY9 A;  2H51 B;  4FXW A;  3CUN A;  3LGH A;  4HYK A;  1N34 J;  3HHL B;  3NS6 A;  4A8K A;  2RH3 A;  4ZLL A;  4ECT A;  3D3C J;  3PW5 A;  4KAI A;  4ICL A;  1VBZ A;  4OYX A;  4TY8 B;  1KQG B;  1JLG B;  4C98 A;  2IIH A;  1M0S A;  4FS2 A;  1N5Y B;  2IBO A;  2BV3 A;  4K7Q A;  1SIW B;  2NPI A;  2UXB J;  3SXL A;  3D6H B;  3T1A A;  2IRX A;  4DHV A;  2CA9 A;  4WFB Q;  5A2Q U;  1SIZ A;  3BEG B;  1TV6 A;  1M5S A;  3B4M A;  4NZ7 A;  2U1A A;  2ZH2 A;  4DR1 F;  1APS A;  3IN5 A;  3PHT A;  4FXV A;  1R6V A;  2HK3 A;  4IYQ A;  4WYW A;  2BJ3 A;  2HWT A;  4P71 A;  1RT2 A;  4Y34 A;  1LWE A;  3LWM A;  2CFX A;  4DL6 A;  3D0H E;  1T9X A;  4USJ C;  1BWV A;  2ALY B;  3H90 A;  2A2C A;  4DZ6 A;  1HBM B;  4OFZ A;  3TUI C;  3MPY A;  5D0E A;  3S8S A;  1NB7 A;  2HFS A;  2EFP A;  4OQJ A;  1M5V C;  2X1G A;  2NLW A;  1WOS A;  1V5I B;  2YWE A;  2DJW A;  2Z2Z A;  3PRD A;  4M1K A;  3TRG A;  4A8M P;  4F4K A;  3HDS A;  5DM7 Q;  2E5L F;  1XWL A;  3V6K A;  1FD8 A;  1RAH B;  4C8O A;  4PWD B;  1U25 A;  3W7B A;  1S1V B;  2KI2 A;  1IBK F;  3VV2 B;  4TNO A;  3PKM A;  3DI6 B;  3VAM A;  2VAS A;  1UWB A;  1HNX F;  4K0K J;  4DV4 F;  2VD3 A;  3Q2S C;  1IR0 A;  4G1P A;  2BKN A;  2EKN A;  2M8H A;  4P75 A;  1KEK A;  1U1R A;  4PQU A;  1AUS L;  1F2H A;  3UDC A;  2HVD A;  2FY8 A;  3JTP A;  2QIF A;  2J0Q D;  4L74 A;  2DNY A;  2DCL A;  2HQC A;  1FXD A;  3M1V B;  4KE5 A;  2I6W A;  3FBC A;  4ZVS B;  4RNF A;  4C7Q A;  3M32 A;  3R6L B;  4DPO A;  3HT0 A;  1TL7 A;  1JLG A;  1T9T A;  3DRX A;  1TU0 B;  4Z2X A;  1YJT A;  1HW8 A;  2FZC B;  3GFY A;  1FA0 A;  3PFO A;  1KTQ A;  1VR6 A;  1Q82 T;  1YSJ A;  1TKT B;  2NXU A;  4LFA J;  3PXG a;  1FWP A;  1GEH A;  2QLB B;  2W9C B;  5J2P A;  2D3O R;  3CTR A;  3MCN A;  1ZOT A;  1RT3 B;  2YNG A;  4MKB A;  4WCE Q;  1L3U A;  1JXE A;  1JLQ B;  1XQI A;  4DUY F;  3TAP A;  1T8E A;  2XLK A;  2HZV A;  4JV5 F;  3P4U B;  3UCG A;  4Y3C A;  5T14 A;  4DV3 F;  1VQN S;  2XSF A;  3MD3 A;  1E6V B;  4TN2 A;  2H65 B;  4I68 A;  3KLF B;  3KK3 B;  2YKN A;  2E1M C;  3EZU A;  1F60 B;  2K06 A;  3RG6 A;  5LXR A;  5DLF A;  2KM8 C;  3UN5 A;  2VFV A;  1FE0 A;  3GCW P;  1NJY A;  2XHW A;  2J9C A;  2WSF C;  5L1K A;  2BYC A;  4OI4 A;  4R0J A;  4LF4 J;  2RF2 B;  1EAR A;  4L76 A;  1LWF B;  3GR0 A;  3OUY A;  2Y8W A;  4CLY A;  2GX8 A;  1N6Q B;  5LMU J;  5KG1 A;  1NJX A;  4J9Q A;  3DFE A;  3F0N A;  4A8Q A;  2ATL A;  2G2Y A;  4TLQ A;  4MK7 A;  1RAI B;  1N88 A;  3M2U A;  4RNN A;  3MCO A;  3TEG A;  4PG8 A;  3DLG B;  1NLK L;  3H4B A;  2GVD A;  1QJH A;  2WVD A;  4RWX A;  1SUQ A;  3D1H A;  3DGP B;  3MUM P;  3P49 B;  4GMK A;  4JI2 F;  3TX8 A;  1Y11 A;  1ZM4 A;  3W2W A;  3JYT B;  1GAO A;  4J91 A;  2ZEJ A;  2UUA F;  2X1F A;  2R7O A;  3KOA A;  4IR1 A;  1RE1 B;  1RTD B;  2QL7 B;  2VG5 B;  5SZT A;  1T05 B;  3D54 A;  1IN0 A;  3ENQ A;  3S01 A;  3W65 A;  2B4O A;  4X62 J;  1NJZ A;  5EGY A;  4U7U D;  2ZNY A;  3OFE A;  4OHX A;  4ES2 A;  5BXI A;  3DOM B;  3I9Z A;  3KLH A;  3M9M B;  1R8C A;  9ATC B;  5KFZ A;  3PV8 A;  1LWC A;  1OPI A;  3GG1 A;  1DFD A;  2KRB A;  5BYS A;  2HGN A;  4F25 A;  3TVK A;  2X1A A;  2DGO A;  2AKW B;  2KO1 A;  2CQP A;  2MKS A;  4KFB A;  4NYZ A;  4J9L A;  5CD4 A;  3X1L B;  2IJR A;  1KBR A;  3NMR A;  2DNL A;  4RNH A;  3S7R A;  4NLP A;  1GMU A;  1YGY A;  3CED A;  2B9E A;  2Z0G A;  4ZVH A;  5ETP A;  5HAN A;  1HLW A;  4ECS A;  1YRX A;  2DHS A;  4DSF A;  3RBE A;  1AUD A;  1JQG A;  3HSZ A;  2GO9 A;  5HN0 A;  1SCJ B;  4Y2K A;  2ZH9 A;  4KHP F;  2XZT B;  4OI3 A;  4ZK7 M;  1WTB A;  2CQ0 A;  2XMV A;  4X4T A;  4DV2 F;  2J6S A;  4ELT A;  1WC6 A;  2CJX B;  1YVF A;  4PYA A;  2DR9 A;  2I9S A;  5EN1 A;  3QT5 A;  5LJ3 Y;  3H42 A;  3KNG A;  3KJV B;  3EGW B;  3ZZY A;  1RYS A;  3GR1 A;  3FSX A;  3K89 A;  2HBY B;  5EX3 A;  3BGR A;  4RBV A;  4ECX A;  1BE4 A;  3IFE A;  3B8H A;  5A8W A;  1W2B R;  2RRA A;  2OHD A;  1PJ5 A;  1HA1 A;  1RWN B;  4MTP A;  1KVJ A;  3I87 A;  4I69 A;  2ZH3 A;  1RK8 A;  3GPA A;  2KHC A;  3HT3 A;  4IR9 A;  3I0S B;  3OPK A;  4F3O A;  2HLT A;  3EDR B;  3MF5 A;  3OLA A;  3W5Z A;  2FB0 A;  1SV5 A;  3R9L A;  3O3L A;  1S1U B;  1Z2L A;  2PD1 A;  3DRS B;  3KG0 A;  3QSY B;  3HFK A;  1TUW A;  4I2Q A;  4DV3 J;  1D9A A;  2R2R A;  3KUH A;  3ILL A;  1G4C A;  4JI0 F;  2DNR A;  5GAE I;  4DUY J;  1W25 A;  3EPG A;  2IM3 A;  1QE1 A;  4E8U A;  3T1Y J;  4X2B A;  3ZO7 A;  3MMC B;  2KL8 A;  1DLO B;  4OI6 A;  4P2X A;  4PRF A;  2FC9 A;  2D3O 1;  4LFA F;  3DNC A;  4ANC A;  1RWO B;  2CNO B;  1C1B A;  2JC1 A;  3NCR A;  1RP5 A;  4F3M A;  2HHT A;  2W7P A;  2DNG A;  1SC4 B;  2PSZ A;  4U67 Q;  3SV4 A;  4JOU A;  2V8P A;  3WIU A;  2ZH4 A;  3Q8Q B;  5FLX Y;  1N48 A;  1EQ0 A;  2ZIT A;  2VQF J;  3HZG A;  2GZO A;  5KFN A;  4J9P A;  1R0B G;  5D4O A;  3G6V A;  1F5B A;  3D28 A;  4IUF A;  1CC7 A;  1MMD A;  1LKZ A;  2PEB A;  3J7Z T;  4ZHR B;  2GS8 A;  3BV8 A;  4I56 A;  1BC6 A;  4LIW A;  4M5D A;  4QIG A;  1NSQ A;  1OIA A;  3CDA A;  4KY3 A;  4J9K A;  2LU1 A;  4U8V A;  3DKD A;  4RW7 A;  3V6D A;  3HI9 A;  2VDI A;  4RR5 A;  2B9Y A;  2Y8Y A;  2Z57 B;  5IM0 B;  4P2M A;  1F5C A;  3LOU A;  4MT1 A;  2XY7 A;  3UCU P;  1U09 A;  2VPY B;  3Q8R B;  1FKA F;  1I6J A;  3DYA A;  2BQU A;  3CJK A;  3OL6 A;  3BQ0 A;  4EBD A;  4A46 A;  4IO9 Q;  1J5O A;  1V3S A;  2XS2 A;  3N28 A;  2F9D A;  3AHP A;  4LSL A;  1SQG A;  3BN7 A;  2OPR B;  4YQW A;  3PO4 A;  2P6T A;  4ECR A;  2F3J A;  3B78 A;  3E3X A;  2ZNZ A;  4YR0 A;  1Y5L B;  3RW6 A;  1XTZ A;  2FLL A;  2F4V J;  2R8I A;  2X1B A;  4DR6 J;  2Q1L A;  1RU1 A;  4UQT A;  4U9R A;  4W90 B;  1MWZ A;  2R2U A;  3V4I B;  4N5S A;  2XLJ A;  2W8K A;  1EQM A;  3H98 A;  2EFO A;  1MNE A;  3IBC B;  5C5J A;  2XC9 A;  5JVH Q;  4X4U A;  2YWG A;  3C15 A;  5ETM A;  1WC1 A;  4QR2 A;  4N47 A;  1KHW A;  4PZV A;  3BJY A;  2NRE A;  3DLG A;  4PAA A;  4JI5 J;  4RW4 A;  3UVJ B;  3C16 B;  5FD1 A;  4BHQ A;  4BLG A;  3TQE A;  2XS7 A;  2GJ2 A;  2ZH5 A;  4ZVP B;  4B3T F;  1RI7 A;  2H48 B;  3HSJ A;  3K5L A;  4XK8 C;  1L3S A;  2RVJ A;  3WX8 A;  1KFS A;  3DU6 A;  1KS2 A;  3CO9 A;  2R2T A;  1VRQ C;  3JSM A;  4JP8 A;  4RLE A;  2DNM A;  2IC3 A;  2VC0 A;  2W2Q P;  1IM6 A;  5BYQ A;  3J81 U;  1TEL A;  2QEX S;  1ZZF A;  1NCL A;  1NME B;  2LYV A;  1S79 A;  3NCQ A;  4DLG A;  1N34 F;  3QQC D;  3TJA A;  4DQP A;  4LFC F;  4N7T A;  3CB4 A;  4J7C A;  4PG6 A;  4OYO A;  4WE1 A;  4RNM A;  4WP8 A;  4F0H A;  1W7W A;  1H3D A;  3KKF A;  1CJU B;  4NPO A;  4OZ0 A;  2BR0 A;  1T03 B;  2G2Z A;  4I7F A;  3LF0 A;  2YNI B;  2YQ3 A;  3N9U C;  1FNX H;  1U0H A;  4NWB A;  1Z1Z A;  3GYX B;  2EBE A;  3EVW A;  1Q81 T;  1D3W A;  3HSG A;  2JEG A;  4KKO A;  1HD1 A;  2CKW A;  1I1G A;  5KG5 A;  4DPY A;  3G86 A;  3GQC A;  3OD2 A;  3OFG A;  1S9G B;  3CJS A;  5F8H A;  4C0H A;  3ELH A;  4DFK A;  1FDD A;  1FDN A;  3DLL Q;  2JNJ A;  2LEA A;  4CLT A;  2JEI A;  1NAQ A;  4KQZ A;  5DQH A;  3GLJ A;  4GKJ J;  3UCZ P;  1Q5V A;  4LF9 F;  2HRU A;  2VJV A;  3D9B A;  4KGK A;  3UR3 C;  2RRB A;  1R43 A;  2BUN A;  1UJ5 A;  4ES3 A;  5AXN A;  1IKX B;  4HI1 A;  2V4Q A;  2PI5 A;  1S1W A;  1XMQ F;  1SVD A;  3KLE A;  2BW2 A;  1EKR A;  2HK2 A;  3IRX B;  3FFI B;  2VBX A;  2WAQ D;  1DHM A;  1NH7 A;  5DDP C;  4X4N A;  1GXU A;  1Y3J A;  2OEK A;  1OSD A;  2QFI A;  1S10 A;  2ACY A;  4DUZ F;  4U96 A;  4MAK A;  4QYZ J;  3C8Y A;  3AJ1 A;  1PIL A;  3C14 B;  5I3Q A;  2F63 A;  4K5S A;  4ZN3 A;  4U7U K;  3PX0 A;  4GC6 A;  2MJN A;  3RR7 A;  3D0I E;  1VQ9 S;  2PA3 A;  4YP3 A;  4QWB A;  1UVK A;  2QLJ B;  3MM7 A;  2BJ8 A;  4LBH A;  4EO6 A;  1F2G A;  2FVS A;  4OYP A;  3LAL A;  3VQS A;  3MAA B;  4TU9 A;  2CPI A;  3JAM U;  2FUG 9;  3GJT B;  4DX6 A;  4XAK A;  1S6Q B;  1XMB A;  2CQ1 A;  3PYD A;  5AE2 A;  4WIQ A;  5LSR A;  3C3L A;  1HBO B;  1ZZN A;  2HFZ A;  3HPO A;  3HLU A;  4USK A;  2BQR A;  3TWZ A;  1LK5 A;  1VHI A;  3MEC A;  4NCG A;  2HMI B;  2MMY A;  5L1L A;  3FRZ A;  4YUD A;  1C4A A;  2X3G A;  3D67 A;  4PKD B;  4ZMM A;  3J7Y I;  4I64 A;  1PAU B;  1RA7 A;  2MZT A;  4UF4 A;  1ZTT A;  1JIH A;  2E44 A;  1T9Y A;  1SKR A;  2HHQ A;  3ETM A;  2CJQ A;  5SUH A;  1H98 A;  1TVR A;  4DCP B;  2AHO B;  4B9S A;  5HQL A;  1XR6 A;  5LOQ A;  4GKJ F;  1Z4U A;  1FEH A;  1Y4Z B;  4KH0 B;  4DR6 F;  1FRK A;  1UKU A;  2VQE J;  4YEA A;  1IBL F;  1HBO A;  2OFH X;  5GAE U;  2R7Q A;  3SSR A;  3G2X A;  3WX4 A;  4DV5 F;  4V19 X;  2RML A;  3DGV A;  1HYS A;  5CD4 H;  2Y1I A;  4AL6 A;  2ZOG A;  3PJX A;  2F65 A;  1YK9 A;  4DUT A;  1FO1 A;  3NS7 B;  5F8J A;  2YX1 A;  3OTO J;  1GMW A;  2HYI B;  2DB1 A;  1C1B B;  4ZPV R;  4B9L A;  2OIH A;  3ILI A;  2F9J A;  2VZ9 A;  4DV7 F;  4FVM A;  3BH7 B;  3K5O A;  3P8B B;  4LSL B;  1URN A;  1NKE A;  1B70 B;  2BM1 A;  2ZZT A;  2DEI A;  4CTA B;  5K8N A;  4ECW A;  2FD2 A;  2RQK A;  3IXQ A;  1YZ6 A;  2ZBR A;  4JI4 F;  1ZAV A;  2B8Q A;  1FDB A;  2HRT A;  2L9N A;  1JXV A;  2MZJ A;  1RT7 B;  3CW2 C;  1KNZ A;  3PW4 A;  2VC1 A;  5LXY A;  2AT1 B;  3VGU A;  2WHO A;  2B6A B;  2OEL A;  2BX6 A;  4O4R A;  5ETQ A;  4L6V 3;  1WC3 A;  1FVS A;  1RKI A;  4WTO B;  1C0U A;  3HKW A;  4KO0 B;  4USM A;  1YI2 S;  2HHW A;  4LF7 J;  4WF9 Q;  2QYC A;  3DLJ A;  5D77 A;  4RO0 A;  1RTZ A;  4BWJ A;  1CPZ A;  3PIO Q;  1S9G A;  5I42 B;  4ZP8 A;  1S1T A;  5A8R A;  2VA2 A;  2I5J A;  2CJY B;  2GMH A;  1ZAW A;  3EPI A;  2EFV A;  5K8M A;  5KFS A;  3CJ4 A;  1JMT A;  2AQ4 A;  1XMO J;  3U1N A;  1CJV A;  2DGW A;  4AD6 A;  2R7T A;  2R8G A;  3SCL E;  5HVG A;  1JLB B;  2CAJ A;  1H73 A;  1C0U B;  1QSL A;  2DNP A;  1EAY C;  2C2D A;  3MMC A;  2XZD B;  3NXZ A;  3D66 A;  4G1I A;  5GVQ A;  3W8P A;  1N0V C;  1LNQ A;  2G2O A;  2Z30 B;  5C24 B;  3FEZ A;  3DLK A;  4YB1 P;  4P9S A;  2MKK A;  4ED3 A;  1NK9 A;  2XYH B;  4FYW B;  1JLE B;  4P74 A;  1SJ4 P;  4DV4 J;  4OHY A;  2B7C B;  4JI7 F;  3AFG A;  4I2Q B;  4OJH A;  3UE2 A;  3OSN A;  4KFB B;  2HVH A;  1NHK L;  4V1A k;  3C6U A;  2OPS A;  3CF5 Q;  3N6M A;  1KON A;  3CC7 S;  3CME S;  2HRY A;  3CJQ A;  2BOP A;  9RUB A;  2RQC A;  2HKE A;  4F0M A;  2OJ3 A;  3MCM A;  2MYF A;  1O5J A;  1CUL A;  2AYG A;  3JQM A;  2DT9 A;  1GQE A;  2M70 A;  2PII A;  3PRB A;  1G7C B;  4B9M A;  3TUP A;  4K4Z A;  3HKZ D;  3CJR A;  3UD3 P;  2RHS B;  3AT1 B;  3J7Y U;  5LL6 d;  1HMV B;  2BJE A;  4ZP9 A;  2MGZ B;  3JYT A;  4FF1 A;  3CCM S;  3KJV A;  2GIR A;  2LDY A;  1UP1 A;  1V5V A;  4PWU A;  1DZ5 A;  4ID5 B;  1VCT A;  4B9N A;  3HJF A;  4YDX A;  4C8Z A;  1FRL A;  2XWY A;  3AD7 C;  1SI9 A;  1WF1 A;  3NG8 A;  2CWX A;  4MIA A;  5I3U A;  2RIL A;  4PG5 A;  4C8N A;  1WDD A;  1U8W A;  2OPR A;  2D7S A;  1RTI A;  2W4D A;  3KUE A;  5B0G A;  3VAK A;  4A8S A;  2BZ2 A;  5HMZ A;  2LMI A;  4FVC A;  4A8X A;  3JSR A;  3TX0 A;  4M5M A;  3GIM A;  1NKC A;  2YWK A;  5JJB A;  2FLO A;  2CQG A;  2RF2 A;  4AE5 A;  5KT6 A;  3NS5 A;  3SSS A;  2D3Z A;  5C24 A;  3MAQ A;  2EKY A;  3EXC X;  4ZVF A;  5L1I A;  1B0P A;  3DOM A;  2LKZ A;  2W4C A;  1HW9 A;  2XMK A;  2IY5 B;  1VLY A;  5KFK A;  3M2R A;  2DYA A;  4ATN A;  2MB0 B;  2I2Y A;  4J9S A;  2XY5 A;  1K9M T;  3A3O B;  2N4C A;  1UW9 A;  1BQM B;  1FDA A;  4NLT A;  2ALZ A;  1SKU B;  3PW0 A;  3ITH A;  4JV1 A;  1X4H A;  2DGX A;  3QT7 A;  4BCA A;  4EBE A;  2CJB A;  3D3B J;  2N7Y A;  3HFZ B;  2Q43 A;  4N8O A;  4RW6 A;  4F04 B;  1RWV B;  4CCH A;  2W9C A;  2QMX A;  3QT6 A;  1H6K X;  3G9C A;  1CUL B;  1S59 A;  3FEY B;  2IYI A;  1BY9 A;  2EFG A;  4JB8 B;  1FJG F;  3BKT A;  2ZBC A;  1DLO A;  4LF4 F;  2H54 B;  2MLX A;  1AW0 A;  1FVQ A;  4XIU A;  1RWK B;  3QBC A;  3UW1 A;  4ENO A;  2VFR A;  4IOC Q;  5M2R A;  3SMZ A;  2IM0 A;  3OTC A;  4ZVO B;  1FRI A;  5HMW A;  1S0O A;  3UD4 P;  2CRL A;  1HHQ A;  3HD2 A;  3V5R A;  3GWC A;  4F7V A;  3QID A;  5IT9 Y;  4B3S F;  2MTL A;  1R0C B;  2KN4 A;  3QLH B;  4G1Q B;  2FJV A;  2B5J B;  3A3N B;  3QJJ A;  4LRB A;  2EBG A;  3PTW A;  1UVI A;  2QL9 B;  1IUJ A;  3EUN A;  6AT1 B;  3B54 A;  2EW9 A;  2W2P P;  3T5J A;  4OJG A;  4DX8 H;  4PQA A;  1HNV B;  2P2C B;  5KG0 A;  2ZH7 A;  1LW0 B;  3IR5 B;  2BRK A;  3RR8 A;  1JNR B;  2JVO A;  4CLK A;  4K2J A;  1Q7Y T;  2AJQ A;  4K4W A;  4I7F B;  3CC2 S;  4OLP A;  1B4S A;  1H2T Z;  2BJ9 A;  1EHW A;  4CT9 A;  2D41 A;  3BPD A;  1MN7 A;  2XCA A;  3PYG A;  2YNG B;  1TMJ A;  3RYL A;  2F5G A;  2UUT A;  1OJ4 A;  3NWG A;  2W2N P;  2WBM A;  4DSE A;  1Q79 A;  1TVR B;  3EGV A;  4PPD A;  2UP1 A;  5A6P A;  1U1M A;  1YWX A;  3K17 A;  3IGN A;  4NLW A;  5KFD A;  4CO3 A;  1KKH A;  4PXB A;  2J0S D;  3M1V A;  4DV2 J;  1WEZ A;  1W2I A;  4R8U B;  5KFJ A;  1VQ7 S;  2VOO A;  2R7R A;  2EK6 A;  2JL9 A;  3KUG A;  4OYI A;  2MY7 A;  4QPX A;  1TV6 B;  4TU7 A;  2UXC J;  2J7W A;  5F8G A;  2J0W A;  3VR1 A;  1VMB A;  2HZC A;  1P1L A;  3GON A;  2BKO A;  1ICE B;  4TY8 A;  4DU7 A;  3HVT B;  2CQI A;  3FCH A;  4NLS A;  4PG4 A;  3HZE A;  5KT7 A;  4BC7 A;  1SKS A;  1BQN A;  2HIY A;  1WHV A;  2CJA A;  3A13 A;  3ZZO A;  2YNH A;  1VQP S;  1HFE L;  2FHK A;  3DLE A;  2G4B A;  5F41 A;  5C2G A;  2XMA A;  3OR1 A;  3W2W B;  3C14 A;  3WIV A;  1VQ8 S;  1NND A;  4A8F A;  1SUQ B;  2WB1 D;  4ER8 A;  3H5U A;  2LVW A;  5F8L A;  3PYF A;  3HM9 A;  1EET B;  1UZH A;  1AFJ A;  3N4W A;  3PR4 A;  5KOW A;  2HNZ A;  1B0T A;  3NEK A;  3FFI A;  2ZJQ Q;  3CGI A;  1NDL A;  5B0B A;  3CDB A;  2R3V A;  1T3O A;  3OT9 A;  4XDD A;  3W9I A;  5DDO C;  1N6Q A;  2J7U A;  4JUZ A;  5C25 A;  1RWW B;  3BBF A;  3NRB A;  3OQ2 A;  1QD1 A;  3MEC B;  5KT4 A;  5IC4 B;  4X4R A;  3OHA A;  1IKV A;  4MMO A;  1VC5 A;  4B3O A;  4HTJ A;  2FLN A;  2A10 A;  4C2M A;  5EDW A;  2Y1J A;  3DU5 A;  2BJ7 A;  1ROF A;  4TY9 A;  1VRT B;  4QU6 A;  2KVI A;  4LF9 J;  1T11 A;  2R7U A;  2RS2 A;  4EUV A;  1Q8K A;  3UDV A;  5KFR A;  4EWT A;  4IDK A;  2KFY A;  3CO0 P;  2M2B A;  4USV A;  5HL7 Q;  1LW0 A;  2E1P A;  2IA0 A;  4WBF A;  1H7W A;  5KFU A;  5IOL A;  1W26 A;  1UJ6 A;  4F3Q A;  2ASY A;  1NK8 A;  4J90 A;  1K8A T;  5H9E J;  4UOH A;  1HWL A;  5F3Z A;  2XGQ A;  3MPV A;  1QVF R;  1KP6 A;  4HAC B;  3S1T A;  2HQG A;  3QLH A;  4G1Q A;  2LEB A;  2WW4 A;  5ETS A;  2QE5 A;  3I0R A;  1DQA A;  2H9Z A;  3R2D J;  4F2R A;  2ZBP A;  2C3O A;  2VH7 A;  1VQL S;  3E8O A;  2KT2 A;  1KLN A;  2HIQ A;  4X84 A;  5E41 A;  2NZC A;  1S1W B;  3KLE B;  3BSO A;  2YH1 A;  3RB6 A;  2E9Z A;  3MEE B;  1IM4 A;  5D0G A;  2YNF B;  1HKA A;  1Y0H A;  1N32 F;  4O23 A;  1WOP A;  3M30 B;  4ECQ A;  1Y00 A;  3O6Q A;  3W5Y A;  1XR5 A;  1U2F A;  4OJ3 A;  4WP9 A;  5KG6 A;  3VTI A;  1SH3 A;  2KG1 A;  4EI2 A;  2GIF A;  1NDK A;  3Q23 A;  3DOL B;  1PCA A;  1L3K A;  2ATC B;  4USU A;  4ED1 A;  2O67 A;  1N54 B;  3BGU A;  5IQQ A;  3TJ9 A;  3MR2 A;  4Y2C A;  1VQ5 S;  4LBI A;  2YTC A;  4HLB A;  3MR5 A;  1NM2 A;  2SXL A;  3I31 A;  3POT B;  3QFH A;  1NXI A;  4FNH A;  2AGQ A;  3IWN C;  1NZA A;  2BBE A;  3MUR P;  3UWT A;  4O3O A;  2YWH A;  1N5V A;  3T1H J;  1IQT A;  1SC6 A;  1JLA B;  3BDE A;  3TVY A;  5KFP A;  1ZM3 A;  1S0M A;  3IR6 B;  2MQN A;  5KOX A;  3DYA B;  3ONQ A;  4QJV A;  4CQ1 A;  5F8I A;  2VG7 A;  3C2P A;  2VIC A;  4BBY A;  1ELO A;  2DY1 A;  2ZDP A;  4C48 A;  4FBU A;  5DDR C;  4DV6 J;  4B3R F;  5KFE A;  3HHK A;  2DGU A;  4B9V A;  1LWC B;  5IC6 B;  2YPY A;  2DRB A;  4RW7 B;  3V6D B;  4NXM J;  2K8G A;  2RU3 A;  1ZM2 A;  2GNK A;  2LXU A;  2W01 A;  2UXC F;  2OAU A;  4F4W A;  3C16 A;  2XQC A;  4BDP A;  1PBU A;  3UPF A;  4N41 A;  4U8Y A;  3NGU A;  4YN3 B;  2CQ4 A;  3A1Y G;  1R27 B;  1K73 T;  2HHH J;  2UVR A;  1CVJ A;  2DHA A;  4QR0 A;  1HMV A;  1SC3 B;  2Q6B A;  4ZPT R;  2K3I A;  2CYY A;  2EK1 A;  2GO8 A;  2E5J A;  2QZ8 A;  2CIM A;  3CJ8 A;  3N0V A;  1VDH A;  2V8G A;  4MKA A;  4PPZ A;  4C8M A;  3SFU A;  2DNO A;  3J7A N;  4P7T A;  4LRE A;  3K7R A;  5K5M A;  1FKP A;  4CWB A;  5CYQ B;  3TA0 A;  3PAC A;  1HNI B;  4WZM A;  1XN9 A;  3LP2 A;  1SJ1 A;  3L95 X;  1WF0 A;  2J9D A;  5HRO B;  2UXD J;  4PXC A;  1K0T A;  2JJ4 D;  5BR8 F;  5GAD U;  4DFM A;  1S9F A;  1HWU A;  1F6T A;  2HNY A;  3PIP Q;  1RTJ A;  4URQ U;  2G0J A;  3MM5 B;  2BXJ A;  2MY8 A;  1RB0 A;  3FGV A;  3ICL A;  4GRS A;  4OZ2 A;  2DRD A;  3T1Y F;  5IM0 A;  2B56 A;  4FN5 A;  3BBB A;  1KQK A;  3WBZ A;  3V81 B;  2V2Q A;  3PG9 A;  4ZVE A;  3K0J A;  1OY8 A;  2NZ4 A;  4Q5V A;  2DXE A;  1NPP A;  1LFP A;  4H4M B;  4R5P B;  3R5A A;  1ZTW A;  4CO1 A;  4LF5 J;  5B0D A;  1IVZ A;  3BQ2 A;  3DLB A;  2JEF A;  2LDI A;  3M6X A;  2HBQ B; 
#chains in the Genus database with same CATH homology
 3BH6 B;  1S57 A;  4ANE A;  1MN9 A;  4F4A A;  1WKJ A;  3EVO A;  3EJM A;  1HIY A;  3L7U A;  1WKL A;  2AZ3 A;  1NB2 A;  1NDP A;  5C7P A;  3MPD A;  1XQI A;  3BBC A;  1K44 A;  3PJ9 A;  2DYA A;  4WBF A;  3ZTR A;  3FBF A;  1NSQ A;  5IOL A;  3ETM A;  1PAE X;  3FBB A;  5CAB A;  3DKD A;  1NDC A;  3FC9 A;  4UOH A;  1S5Z A;  1XIQ A;  3NGT A;  1WKK A;  3FCW A;  4O0N A;  3PRV A;  1KDN A;  3ENA A;  3G2X A;  3Q8V A;  1S59 A;  1F3F A;  3GP9 A;  3FKB A;  2VU5 A;  4DUT A;  1NSP A;  1NPK A;  4ENO A;  3EE3 A;  3BH7 B;  1HHQ A;  2BEF A;  3VVU A;  2CWK A;  1BHN A;  3B6B A;  1NLK L;  1NDK A;  2B8Q A;  1UCN A;  1JXV A;  3B54 A;  3Q83 A;  3EIC A;  2HVE A;  3VGU A;  3VVT A;  2BX6 A;  3DDI A;  3ZTS A;  3Q8U A;  4DI6 A;  1NSK L;  1B4S A;  2B8P A;  3NGR A;  5BXI A;  1EHW A;  4S0M A;  2DY9 A;  4FKX A;  3WX8 A;  4KPC A;  1MN7 A;  2HUR A;  1NCL A;  3FBE A;  2DXD A;  1NUE A;  1LWX A;  3NGS A;  2NCK L;  4HR2 A;  1W7W A;  1HLW A;  3Q89 A;  3ZTP A;  3NGU A;  3EMT A;  4C6A A;  1PKU A;  3EVW A;  4F36 A;  1BUX A;  3EM1 A;  3VGT A;  3ZTQ A;  4AND A;  3FCV A;  4DZ6 A;  3ELH A;  1NHK L;  1BE4 A;  4CP5 A;  2ZUA A;  3VGS A;  4UOG A;  3VGV A;  1LEO A;  3GPA A;  1F6T A;  3EVM A;  3R9L A;  3ZTO A;  3Q86 A;  4UOF A;  4W98 A;  3BBB A;  3Q8Y A;  1B99 A;  5CAA A;  2HVD A;  3JS9 A;  1NDL A;  1ZS6 A;  4FKY A;  2DXE A;  4EK2 A;  1VYA A;  2DXF A;  1U8W A;  3FBC A;  2AZ1 A;  4ANC A;  3BBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...