3PJ9A

Crystal structure of a nucleoside diphosphate kinase from campylobacter jejuni
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
137
structure length
137
Chain Sequence
MEKTLSIIKPDAVKKGVIGKILDRFESNGLRIAAMKKVQLSKEQAENFYAVHKERPFFKDLVEFMISGPVVVSILEGEGAVLKNRDLMGATNPKEAKAGTIRADFAESIDANAVHGSDSLENAKIEIEFFFKPNEIC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Crystal structure of a Nucleoside Diphosphate Kinase from Campylobacter jejuni
rcsb
source organism Campylobacter jejuni subsp. jejuni
total genus 42
structure length 137
sequence length 137
chains with identical sequence B, C, D
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2010-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3pj9A00
1EHWA 3ENAA 4S0MA 1NSPA 1S59A 1LWXA 2VU5A 4UOGA 2HVEA 1B99A 3BBBA 4O0NA 1HHQA 3EM1A 2AZ1A 4FKYA 1VYAA 3BBCA 4WBFA 1NPKA 1NDPA 2BEFA 1WKJA 3FKBA 3EVMA 3BBFA 1NLKL 3Q89A 3FCWA 5BXIA 1W7WA 3EE3A 3GP9A 5C7PA 4DUTA 1XQIA 2ZUAA 4HR2A 1WKKA 4C6AA 4KPCA 1S5ZA 3DKDA 4ANEA 3PRVA 1U8WA 3ZTOA 3EVOA 4ANDA 1MN7A 1LEOA 1BUXA 1UCNA 3EMTA 2DXFA 1NSKL 1BE4A 2HURA 1NB2A 3BH6B 3Q83A 3MPDA 3FC9A 3B6BA 1NSQA 3FBEA 3NGSA 4DZ6A 3JS9A 1NDCA 1B4SA 1K44A 1HIYA 3NGRA 3ETMA 4F4AA 3EICA 1NHKL 3EJMA 1KDNA 3FBBA 3NGTA 1BHNA 3WX8A 2NCKL 4F36A 3Q86A 3FCVA 5CAAA 1NCLA 3ELHA 1PKUA 2DYAA 3ZTPA 2BX6A 3ZTRA 1S57A 4ANCA 3VGVA 3VVUA 4DI6A 3BH7B 1WKLA 3R9LA 3ZTSA 1JXVA 3Q8VA 3Q8UA 1PAEX 1MN9A 5IOLA 2DXEA 2DY9A 2HVDA 3NGUA 4W98A 3Q8YA 4UOFA 2DXDA 4EK2A 3VGSA 1NUEA 3DDIA 3B54A 3EVWA 3VGUA 3G2XA 3FBCA 3PJ9A 1F6TA 3GPAA 5CABA 3VVTA 4CP5A 3L7UA 2B8PA 1ZS6A 2CWKA 2B8QA 4FKXA 4ENOA 3VGTA 3ZTQA 1NDKA 1F3FA 1NDLA 3FBFA 4UOHA 1XIQA 1HLWA 2AZ3A
chains in the Genus database with same CATH superfamily
2DCUB 2HFOA 1WSRA 3AJ2A 1RHJB 4DL4A 2FVSA 4F4KA 1TKZA 3QNWB 2R7WA 1S1WB 2QA1A 3NAHA 3B82A 2YKAA 4CTAA 1URNA 3NNHA 5GMEA 3VWSA 2D69A 5KFIA 3MPDA 4E98A 4UZCA 5C42B 1VBKA 1N33J 2Z2LA 4ZHRB 2W2MP 2O1PA 2UUWA 2RMLA 3R5AA 4I7FB 4IRKA 2DPIA 3DYAB 3D6MB 2HWIA 2KXHA 2R2SA 3FZBA 5IT9Y 1BGXT 2HK2A 4V19J 1X5OA 3FZ2A 5GADU 3I4PA 1WTFA 4NLPA 3C19A 4DUYJ 4Y0FA 1ZOTA 3KNAA 4JI4J 3W5ZA 3K8WA 2W9BB 3O2IA 1YBTA 4J9LA 1R43A 3IN5A 2MTLA 5B0GA 4ZN3A 1DARA 3CEDA 5M2UA 1DRZA 3FBFA 1HD0A 5HK4A 2V34A 5DQHA 2CPYA 4WXOA 3L7OA 1P9YA 3F0NA 3C16A 3MM8B 4OI6A 2BKPA 4RWXA 1R6YA 2YPYA 3HSJA 5IQQA 2PSZA 1HI0P 1VR6A 4U67Q 2XMJA 2ZHAA 1UJ6A 2PGCA 1BUXA 3IAM9 2G0JA 1L3SA 1RHMB 1RYSA 3KLVA 3R2DJ 1VOMA 2GO8A 2AYEA 5I3UB 1REGX 4NCGB 5EWFA 1WELA 3SFUA 3EPIA 4PG4A 3H8YA 1JLEB 4ZVRB 2HNDB 2W25A 1LW2B 3LP0A 1VLYA 4DV4J 4MFBB 3IBFB 1VRUA 4CM0A 3QLHA 3M30B 1S79A 2Q79A 1U8SA 2LP4A 4IH6A 4PG7A 1Q8LA 1HYSA 3HVRA 3LOUA 3ZO7A 2KM8C 4K0KF 2MQOA 4TU7A 2AJFE 5C25A 1BQMB 3CIZA 1UJ4A 4QR2A 2DJWA 4KGXB 4FF4A 3CD0A 1HHSA 1PJ7A 3EM1A 2ZH7A 3LPYA 4WE1A 2V8DA 2XMWA 3GP9A 2E5IA 4RW6B 2P9EA 5CH7B 5K20B 2W8KA 1Q8KA 3GJRB 5ETSA 5ETKA 2K1RB 1D1UA 2C3PA 2E1AA 3MM5B 3OL6A 4CNYA 3F73A 3SSSA 4K4SA 3EICA 4TN2A 5L1IA 1FK9B 5L1JA 2OUGA 1Y11A 3MEEA 3HZEA 4CO3A 3LALA 4DEZA 2DRBA 2YVSA 3RZAA 1RAHB 4H4KA 1TL5A 4H4MB 4DS4A 1RT1B 3D67A 3W65A 4KFBA 3T19A 2HVIA 3FUYA 5A2QY 1NK4A 2XG8A 2KTQA 1C0UB 4ED0A 3OBIA 4X64J 4ED2A 4XAKA 3CPWR 4MYUA 4F2RA 3OTBA 3DRPB 1REVB 1E6VB 2OPQB 3D3CJ 4J5OA 4DX8H 1S6QB 4E0DA 2R42A 2W9CA 4R0JA 4NA3A 2E7WA 4KSEB 3G6VA 4DV1F 1KEKA 2YKMB 2AEFA 2UU9F 2RIJA 1X9MA 4DR2F 1T95A 2AEJA 3E01B 3NG8A 5KT7A 3MCMA 1XNQJ 2YNHA 1YZ6A 1S1UA 3FRYA 2B6AA 5K8NA 3IP0A 4L6V3 2GW8A 4X4SA 1EETB 3MFHA 4F4AA 2RAQA 2V9WA 2GAHC 3VAFA 1HNIA 4MK9A 5HATA 4A8SA 2RU3A 1WOSA 2DXEA 1A7GE 5B09A 3OFHA 5KFVA 3BO4A 2ROEA 1H6KX 2XS5A 5G0RB 3TEGA 4ZCLA 2VA2A 2DHAA 2VASA 5HVHA 1AB8A 3BGUA 3W2WA 1QTMA 2F63A 4DJBA 3GCWP 3QO9A 3BB5A 1BQNB 1VK3A 4PKDB 1KOHA 4DQIA 4RUAA 1I3OB 2HVHA 4CDIA 2J6UA 4P7TA 4R5PB 1TUGB 1VBXA 5J1PA 1QAYA 3DYAA 2YNFA 3THTA 3T3FA 1T03A 3UR0A 1X31C 3CCMS 1F5CA 1TV6A 1FX2A 3TARA 4ES2A 3MF5A 2M88A 2F4VF 4RW4A 5F8NA 2HHQA 3HJFA 3DLEA 3IS9B 2YKQA 2J0QD 2QZ8A 3J80Y 1HHTP 1Q4RA 3QPIA 3OPKA 4C3MA 2KFNA 3AQPA 3GFXA 1L3VA 1BLUA 1HBUB 2JSXA 2BJ9A 4OJHA 2V68A 3HVAA 4HH1A 2VICA 1RAGB 3M1VB 1CS4B 2MJNA 2NYIA 1ELOA 2WCXA 1M1HA 3QAUA 2ZJPQ 2CXEA 4I2QA 5LSRA 1D9AA 2XYGB 3RYLA 4C8NA 1HQ2A 3JTNA 5F41A 3HHKA 2XSFA 2OTLS 1FDNA 3DI6A 2VBZA 5BR8J 3GIKA 3FSIA 2FJEB 4DR5F 3KDOA 2CPJA 2HVEA 1TVRB 3M4XA 2H65B 1RHRB 3BJYA 1S1XB 3ZZZA 2GX8A 5DS7A 2V2KA 3OUYB 2HNDA 2V6AA 3S8SA 4RU2A 1LW2A 1LEOA 4RBTA 4C9DA 4MFBA 3CD7A 3BEGB 3FK4A 5FLXU 2F1FA 1RHQB 1RT7A 3PX6A 1GMWA 3FRZA 3NMAA 4M95A 3DXBA 2Q43A 4XDDA 3GFYA 4F4ZA 2KXFA 4DV2J 4OI0A 3M8SA 4DPWA 4NLXA 3PACA 1MSWD 2Z8QA 4JV0A 1VQ9S 5E3AA 3PEJA 3PIOQ 4CLZA 4L75A 2DRDA 3DRRB 4UQTA 4GC7A 1R8CA 1FKOA 3TZYA 3BPSP 2YKOA 1GTEA 5K5MA 1CSJA 1VYAA 1RCOB 3W3SA 3PR5B 3GYXB 3DMJB 3EVOA 3N5FA 3LPEA 3W63A 2H51B 5A8RB 3I5AA 3C6UB 3PRDA 2N4DA 3DLGB 4KGVB 5FJ4A 3CCVS 1GMVA 1YJVA 3W9HA 4EWTA 1PIEA 2J7UA 3K2YA 3TZWA 2J7WA 4L76A 2HFSA 1WHVA 2VQEJ 3LH2S 4DL5A 2F4FA 1Y4ZB 2X1GA 1LKZA 1E6VA 3ENQA 4ILMA 2IYGA 4ECUA 5EX3A 2B51A 1LK7A 1FXLA 2QL5B 2JHEA 2YKMA 4M5HA 1AROP 3OR1B 1UAWA 2YKNB 4JV2A 1FWLA 3D6TB 1L3TA 3X1LB 3DHXA 2HNYA 1RAJA 1S59A 3D66A 2GQQA 3J7YU 4TLQA 4DQRA 2ZH2A 3BBCA 1JWWA 4QIWD 2A0FB 1QY7A 4CI0B 3V81B 3ISND 1U7LA 5BJRA 3QAEA 2IMOA 2AX1A 5KFAA 2RHQB 5KFLA 1EP4B 1SKUB 4C8MA 3CD6S 2DNZA 4CLYA 2VL1A 5F9LA 3JB9k 5CA5A 4K4UA 2CRLA 4UF4A 2QG9B 4DI6A 1UFLA 4LR7A 2JWNA 1WHWA 1F0XA 5DGAA 3BO2A 3TI0A 4QU7A 3AQOA 3PNIA 3QT5A 3V6DB 2FJXA 4NLWA 1IJEB 2MQLA 1NAQA 2V8GA 3MAQA 4DV7F 2B8QA 1VFJA 2RE1A 3JSBA 4EMDA 1EHWA 3NOGA 4MKAA 4DX5A 1U1RA 2CQBA 3D7SB 4JV5J 3MOJB 1U1QA 1H38A 1S1VB 3AJ1A 3CDWA 2EI5A 2MKHA 3H5YA 4EBDA 3IS9A 1E6YA 4PXBA 5A6WA 1FJGF 3JQJA 4AE5A 3P6YC 4EZ6A 2CG4A 2LXFA 5F8JA 1U1PA 5B0EA 3PW7A 1QLNA 3D6FB 4M5GA 3W64A 2D9PA 1MW7A 1KQFB 2PIIA 3LAKA 2BA9A 1LQ9A 4LF6J 5D0EA 3R27A 9ATCB 3KLIB 3CMQA 3IGNA 1C1CB 3TA1A 4Q43A 2CWXA 3DOKB 1TK8A 2VQFJ 1GT8A 3H42A 3Q8SB 1U26A 2B4UA 2MKSA 1DTTA 4TY9A 4CLFA 2JC0A 4CLSA 4ILRA 2OPRA 3HFZB 2FHKA 1RT5B 4KYZA 1GQEA 1NEEA 4LF4J 3OD2A 3NXZA 2LDIA 2RRBA 1FWKA 2P9CA 1UKUA 4HACA 1WF1A 3LQVA 4ZVPB 5KOWA 2X7IA 3AA9A 2MKYA 4CZCA 1Q81T 4IFYA 1OYDA 1EIYB 3IBCB 3LANA 5DQIA 1W2IA 5B0CA 1HNWF 1ZH5A 5GAHU 4DSLA 3RR8A 2FLOA 2D9OA 4K7QA 4IDKB 5L46A 3U7JA 1SQFA 2K3IA 1WHYA 1YJRA 2BJ8A 4NCBA 4PZVA 1HR0F 2QLXA 5DGBA 4NX9A 4F3QA 3I31A 1RAEB 5AXMA 1UZDA 1OO0B 3C46A 3DRRA 4TXSA 1G6BA 3K59A 3CMES 2DNMA 3POTB 1WG4A 3FSXA 3CF5Q 3C14B 1VS3A 4ED3A 3H4BA 4KR0B 2ZJQQ 2KFYA 2ILZA 2DH7A 4M5DB 3CJRA 3DMJA 1XTZA 5C2CA 4O44B 2RS8A 2YY3A 1XIQA 1IBLJ 5L38A 5A8RA 2YNGA 1S6OA 2DR5A 4PCQA 1OY8A 4XPCA 2ZH5A 2JVOA 2VC1A 1J5OA 2B4PA 1MN7A 1B7YB 3I9ZA 1UVIA 1RAOA 2F40A 5KFBA 3I55S 1EZZB 5HROB 1HPZB 3MM6B 3GR0A 4ZPDA 4CLTA 1Y5LB 4P2SA 4Y2CA 5KFKA 5LSLA 2DEJA 3QRRA 5JMNA 2MGZA 2QFJA 2YPZA 1LV5A 3ILJA 3NS5A 2OJ3A 1JJHA 4FYVB 2QMXA 2VDIA 3M2RB 5BYSA 2IVMA 4YDDB 1FRLA 1S6PA 3L09A 1WC4A 3L4BC 1VQ4S 4IUFA 4ZCKA 2GAGC 4LSLA 3B8HA 3KLFB 1AT1B 2DHXA 4QQBA 2OEKA 3D54A 1N5VA 4F25A 3KK1B 3KK2B 4DV5F 4ES3A 2BOPA 4QU6A 1FESA 5B0BA 2DISA 3FEYB 3UN2A 3JQMA 4P52A 4PWUA 2KL8A 3H5UA 5KFRA 3UW1A 3ZFVA 3CCRS 4K4TA 3THPA 3OLBA 4HL9A 4DR4J 3QIPB 1B4SA 1QVFR 3A8JA 2D74B 2NSBA 1XJWB 2LEPA 4M5NA 3D0IE 1NCLA 5L9XA 4WZMA 2VBYA 4EYIB 3GYNA 4OX9F 3Q8UA 2CPFA 2VC0A 1RBOB 4KTQA 4X62F 4JI1J 1S1VA 1ZM4A 3CMAS 3AXMA 4ZJOA 2C2RA 1RCXB 2MQMA 1A0OB 2P5VA 2C2MB 4DFMA 1PSDA 4E2FB 3K5LA 4V1Ak 3EDQB 1X4GA 2U1AA 2HLUA 2DRAA 3FFIB 3WHIA 2K3KA 4YB6A 1UPPA 4JI3J 1HQUA 2DGWA 4AYBD 1O6XA 2XEXA 2ZEJA 4EBCA 2LKZA 2BQUA 2B4VA 3UI3A 3K5OA 3QFWA 1BWVA 4OJGA 2HEKA 4NYZA 3HXMA 1OWXA 2OLWA 2WZ1A 3IG1B 3BDEA 4PQAA 3PIPQ 4TU9A 3SYZA 3KKFA 1QE1B 3HO1A 2BJEA 1MN9A 1RT5A 3T1YF 4W98A 3CJSA 3NL0A 1DFDA 4PG8A 5IV4A 2HHHJ 3BKTA 4WYLA 3NMRA 5A2QU 2MZRA 4A8MP 1HWUA 4ZVOB 1N8RT 1U1NA 3HLUA 3TOQA 2MLYA 1QDUB 4YY3F 5JVGQ 3R7SB 5F0UA 2QL7B 1S99A 2IY5B 2IRXA 3TZXA 4NEYA 3DC2A 2DT9A 2R8KA 4DF4A 1KN6A 2QO3A 1FKPB 4O3QA 4KPYA 4CO5A 1DQAA 4MT1A 4DUZF 1KHWA 1VC5A 2F9JA 1EQ0A 2B9EA 3V6KA 4M5DA 3BR8A 2AYMA 3QT6A 3BGFA 1GFWB 2N82B 3VVUA 1FO1A 2G2YA 1N4LA 2UXCF 2ZM6F 1YJUA 4CCHA 3O6QA 3U1NA 2MKKA 2X1BA 3R5DA 3OLAA 2BJDA 4DX6A 2C2ZB 1Y5NB 6AT1B 4YFUA 2QC3A 3CW2C 4YR2A 1C4AA 1WF0A 5HL7Q 2QL9B 4OZJA 4UUXA 3LWLA 1NDPA 1M5KC 1XEZA 4TLRA 4AUKA 4IG0B 2ZC3A 4R0EA 5B0FA 2I5JA 2Y1IA 2DGTA 2FGOA 1YZ7A 3HJVA 1Y3JA 1BE4A 2GHVC 5K14A 2XLIA 4BC9A 1LFPA 5KG4A 3M2RA 1RKIA 3C66A 3BGLA 1IWAA 3JS9A 4KV8B 2W7PA 1FNOA 4ZVHA 1S72S 3CB4A 2HRUA 4R8UA 4ZITA 2QT7A 2ZHOA 2BANB 3TUIC 4IOAQ 5EWGA 4MK7A 4Y28C 1T94A 1PAEX 4Q5VA 2OH2A 1VC0A 3J80U 1XNRF 2FY8A 1IUJA 2CPZA 2W01A 3DDIA 2KYXA 4ECZA 3BS9A 5J2MB 4F67A 3PFEA 3MAAA 2FYXA 2I6WA 3AHPA 4C0OC 1U6FA 2HIYA 3Q24A 3DLKA 4WIIA 1OPIA 3D2WA 4CLKA 2HFZA 3KK3B 1LFWA 3G6YA 3EDRB 1N88A 4X4NA 1VDHA 2HQDA 4DCPB 4ID8A 4CM2A 3M9MB 4NYOA 2Q6CA 1FD8A 1LWCB 1S7IA 1ZZNA 2MQNA 3DGPB 3MTJA 2J0SD 4K4VA 3HHLA 5LMUJ 1JIHA 2WHOA 1JLFA 4QWBA 2HK3A 4P75A 3H7HB 1FRJA 1C0TB 1N32J 4C3LA 3UDEA 4KGZB 4AL6A 4XO0A 2Z30B 3ZTRA 1S57A 4ZPBA 5LL6d 3QRPA 2OTJS 4JI6F 2E44A 1YJTA 3M8PA 2HZAA 4I56A 1M1GA 4IR9A 1UVMA 4C0HA 2JOQA 1IKWB 4IQXA 4O3NA 3GPAA 3V5RA 4OFZA 2ZZNA 4Y2KA 2XHWA 3RGIA 3VAKA 5RUBA 4ECSA 2XCAA 1NJYA 3HHDA 3ILLA 3D0GE 2K06A 2DGSA 3LTOA 4LR8A 1TUWA 2BEFA 2HBQB 1FERA 3MMBA 1FFSB 4XIUA 1U1KA 3TQ1A 3MM9B 2VD3A 4O3SA 3ZZUA 2ERRA 3MMCA 4RZRA 2UXDF 2VG5B 5CHCB 1WEYA 3PXGa 3J81j 3NBPB 1MWYA 4DN0A 3PY8A 3CJ2A 4DV0J 3MMAA 2Q3PA 5AE1A 4RNMA 4A8WA 2XS2A 4Q8EA 2RKIA 3A3PB 1JX4A 2ZDOA 2HHUA 1FKAF 2J0WA 2DO4A 4WZQA 4U6PA 4ICLA 1IBMF 2VKZG 1HBMB 2UUBF 4F3OA 3QMQA 3AD7C 3V4MA 2KVQE 1U49A 7FDRA 4ED8A 1F2HA 2AHOB 2E5JA 1S1TB 2IJFA 5A0YB 2UXBF 2HHPA 3LP2A 1F9FA 1Y10A 2VUGA 2AZ3A 1RHUB 1FRKA 3DM2B 3MXHP 4PR6A 4BCAA 2BM0A 3LA0A 2E9RX 3TRGA 3K7RA 3W60A 3FCHA 4LUBA 5H1SV 3D3BJ 1RT3A 4K4YA 5DZ6A 2KHDA 1Q5YA 4QYZJ 3LO3A 4DF8A 5A8WB 2RVJA 5KFFA 4J9NA 4BLGA 2LU1A 2V69A 1TK0A 2N3LA 3TA2A 3DOMB 2KG1A 4JI7F 4DL3A 1S76D 2EKNA 1PO6A 3O1LA 5KAKA 2FC9A 2BE9B 2GIRA 3UDLA 1KFDA 2ZITA 2NR0A 1RTDA 4LVOP 1Y00A 2JLFA 3ZZTA 3T5JA 5LOQA 3V4IB 4PWDB 1HL6A 5H9EJ 1GMUA 1TL3B 1YKWA 3N6MA 2IJRA 1P1TA 3SCJE 2XYPB 3MM7B 4NLYA 5DG7A 1HNVA 1BC6A 3HMJG 3OFEA 5J2NB 1K1QA 1NPKA 1HBNB 3EVMA 2LFVA 4HHJA 4L3KA 1J5EF 1X0FA 2BANA 1YJ9S 3VAMA 3ZTOA 2F9DA 1YIJS 2IC3B 1LWFA 3N6NA 2HYIB 2HQFA 4WYWA 3I0RB 1WOPA 5IZHA 3I82A 4HKQA 2NUHA 4FS1A 3ETMA 3HD2A 2YBVA 3NNCA 4ED6A 3AOBA 4NZ6A 3TX8A 3N4WA 3MECA 1NO8A 3IWXA 1OYEA 3DLBA 4LFAJ 1N5QA 4F04B 2FJDB 3GQCA 2BUNA 1U45A 4YB1P 4OV1A 5ETTA 1KC8T 1SC3B 2IMWP 4BWJA 3KMSA 1U47A 1XN9A 4JI0J 5J1EB 4B3RJ 1VJWA 1IBCB 1SJFA 2VG7A 2ZE2B 1LWCA 4USVA 2V5HG 3M8QB 1VBZA 4F4YA 2VG6B 1UVJA 3TUJC 4GVLA 3MR6A 1RT2A 4DV1J 5ETOA 2UU9J 1S9EB 4RKUC 4X65F 3A3OB 5KG7A 1NSQA 2VV5A 4FXWA 3TJ8A 4LF1A 2QE5A 1WG5A 3KHLA 2OELA 3NGRA 2KH9A 5CYMA 2FD2A 3S1TA 2F3JA 3NGTA 1IM4A 3NGDA 3NWRA 2KKHA 2WAQD 3ZTSA 5ITHA 4B9VA 2BKNA 4Y6IA 3ZZPA 1JLBA 3OSNA 3VZIA 2N3OA 2BYCA 1UEUA 3JAMU 5KFCA 3D1QA 4P9SA 2B8PA 3EGVA 4ENOA 2QTWA 1NDKA 4L74A 1JLAA 2MHEA 1FE4A 3UCUP 3OQ2A 4C11A 4DV3J 1TKXB 1HHQA 3B4DA 2DNHA 3NBPA 4ECQA 3GIRA 1V9OA 1WORA 2B5JA 5CZXA 2WOMA 4CLUA 4BBYA 2CQ4A 2RRNA 4O3PA 3UO0A 3FC9A 3IR6B 2VBXA 1RKJA 4ATNA 3SIPB 2P9GA 1F1BB 2ZBQA 4IRDA 1RT6B 2Z0GA 3C2PA 3IR7B 1ZM3A 5KG2A 2M3DA 3H2VE 1G7CB 3RRKA 5KFDA 3KJVA 2GFFA 3HCXA 1FVQA 4KO0B 2NXJA 1YRTA 4ECTA 4P72A 3C6TB 1C1BA 2HZCA 2ZFHA 3VGTA 1AZSA 2K8GA 3MHYA 3GSIA 4OYXA 2XGQA 5JUMA 1UA1A 2E9ZA 5A8WA 1RI7A 4X66F 5KOXA 4DQSA 3BBBA 3WC2A 3KLHA 4FKYA 4DR7F 1F60B 3EGZA 3QATA 1S0OA 4C8ZA 4HI2A 4BS2A 4A8KA 1QM9A 3EE3A 1FFGB 3M6VA 2GCFA 2DNLA 1S6UA 1Q16B 4QYZK 4OI3A 3ITHB 2WSCC 1N6QA 3EMTA 2LCWA 4X2BA 3J81U 3VHQA 1AYEA 2MLXA 2KRRA 5D77A 1TR0A 1RWVB 2FC8A 2ADBA 2KRBA 4FNIA 1EKSA 1MMLA 1KQSR 3S01A 2UVVA 4QIFA 1PCAA 2D3ZA 2LLZA 3I4HX 1YI2S 4PWDA 4QR1A 3WQPA 1Q53A 1N33F 3G6XA 2WW4A 5C2GA 1Q95G 4I2PA 3BKFA 4F50A 4J9QA 2HNZA 4RLEA 4B9MA 1HBNA 5F8HA 5H9EK 4CO4A 1R0AA 1VBYA 1CJVB 3SV4A 1VISA 4EFAC 4JI4F 4DBQA 5HP1B 4DG1B 2GVZB 4OYAA 3T5LA 4DU8A 3ENWA 5A6PA 2DPJA 2HGNA 3I0RA 4RW8A 4DZDA 3ILOA 1L3KA 4X4QA 2WONB 2AJ0A 4FYXB 4N8NA 2GA7A 2CJAA 4ANEA 2PT0A 5L9NA 2UUAJ 2VPWB 1ZAVA 2G2OA 4Z2XA 2QEXS 5KG3A 2CQ0A 4Z7YA 1DLOB 2RF2B 1UFWA 3PHTA 4NLTA 4WTOB 1R8PA 2RU9A 5HMXA 3Q86A 1H74A 4PXEA 3MEGA 5J1EA 2BX6A 3VAHA 5DDPC 3VAGA 4N8OA 1F2GA 1WSVA 4YUDA 3U02A 3PJXA 4KHPJ 2VB6A 2ZE2A 1X5TA 1QD1A 2FGCA 2LQ8A 4EK2A 2LA4A 2VG6A 4KC5A 4HYKA 4FNHA 3MPVA 4OYZA 3DGVA 1WOOA 2R2TA 4PABA 4IQMA 3BF4A 3WDOA 4YOEA 4ECYA 3I32A 4XTTA 1S9EA 2G1DA 3P96A 2BW7A 3LUYA 3M2VA 1S0NA 3P3DA 3X3UA 4YB5A 2RQMA 3MR3A 2DGXA 2W1BA 3FKBA 1K73T 3FEXB 2AJ2A 3MPUB 4USUA 1EARA 2AEMA 1NHVA 2CQIA 4N7TA 4NPOA 2W2PP 2OFHX 3IAS9 2JEGA 2AV5A 1N54B 5BYRA 2VF3A 2LEAA 2ATCB 1VHIA 3I56S 1TTHB 1DBDA 4G1IA 4U9RA 3MD3A 2FUG9 2XTJP 1Y9OA 4DL6A 2KN4A 2EC2A 1OSCA 4B3SF 2JZ5A 1RSCA 1H2UX 3QSYB 2GGPB 2Z4PA 4NASA 4CO1A 3CO9A 4FS2A 1YQHA 4AQYJ 2V94A 1ROFA 2M4MA 5ETNA 5A8KA 3NEKA 5F8GA 4Y2IA 3CDBA 1CEZA 4DV7J 1IR1A 2AGOA 1KWMA 3IMQJ 1KFSA 1HKAA 4UOGA 5CXTA 1URRA 4X64F 4DX7A 2CJBA 4MIWA 1L5UA 3KJFB 4MKYA 3EGNA 1W25A 3GILA 1M90T 4DOZA 3DU5A 2YQ0A 3C16B 4ZVFA 4USIA 2J8AA 2A1BA 4RW9A 1OQ6A 4P2MA 3QFHA 1WNEA 4USTA 5CCMA 3GU0A 3K5MA 3PKYA 4OHWA 3SSQA 3Q2TC 2Z2YB 4QIVA 1XNQF 2HQIA 2R8GA 2ZH4A 1GMWD 4ZLLA 1LWEA 2Z2MA 2DYAA 2Z57B 3MEDA 2A2CA 4J9OA 3W2VA 4UY8T 4HVZA 1FX4A 2CQPA 2QLFB 3R5BA 3SQOP 2DH9A 3LP0B 4WFAQ 3QWUA 3UD5A 2QGFB 1VRUB 1KTVA 1RGVA 2H3EB 2V8VA 3QLHB 2NQPA 3I6PA 2M5YA 1SL0A 1MMDA 1HYSB 2XLKA 1S10A 2XY5A 2O67A 3ZTQA 1UJ5A 5C25B 2MQ8A 3D28A 5KFNA 2ZJRQ 4LIWA 3EGWB 5F3TA 1RTIA 3SQGA 2XULA 4GC6A 1PBAA 3H5XA 1SJ3P 4WE1B 3NGKA 3A8IA 4IOBA 2HFNA 3KJNB 4CQ1A 3GV7B 3DLLQ 2DCLA 3A4TA 5D8HB 4HTIA 1EJ7L 3BH6B 1TFYA 1FXRA 1HFEL 4U7UD 4WTYA 1HI1A 1HNWJ 1U0SA 2KI2A 2H5IB 4QOTA 3PW0A 2Q66A 1IQTA 3VV2B 5CYQB 4PXDA 1CJVA 5KG1A 1SH2A 4QBUA 5K8OA 1HR0J 3AXKA 4DPOA 2W7AA 2GVZA 3BH7B 4TQSA 3V6JA 3N28A 2HVDA 2B7BB 4CH7A 2FJAB 1H7XA 2BMBA 2IRUA 2ZZTA 1F9EB 1YSJA 2BDPA 3K89A 3UE2A 1X8DA 4KFBB 5EDWA 3G82A 2VONA 4ZVSB 5E3PA 4F4XA 3KLEB 4OLPA 2GQCA 2ZH1A 1AUDA 1RAFB 1DLOA 3TVYA 2PFDA 3TR5A 4OQJA 1ZM9A 2HW3A 4I69A 2HG4A 2BQ3A 1NB7A 2W9CB 2V2VA 1G1XA 5IV3A 4RNOA 2G1HA 2ALZA 3VAIA 2ZDPA 2BW2A 4ZVUB 4ZKAA 2VJUA 2R3VA 5D4NA 2AYGA 4Q0BA 5BYQA 1S1UB 3K17A 1HIYA 3RRGA 1I51B 2B6AB 1KDNA 4GO5X 2ZVSA 5KG5A 1RB0A 2OGUA 4PUOA 1T3NA 2NXCA 4X4UA 1HNIB 4QJVA 5FIIA 2L08A 1UW4A 1V5IB 2HHSA 4DV2F 4PYDA 3GSDA 2XCPA 4ETZA 1HQEB 2L9NA 1DJ0A 2K7JA 4Q7AA 4QPXA 3OVAA 1JLQA 4USKA 2D3O1 2CUYA 3PKMA 3W2WB 3PW2A 2DY1A 2E5GA 4OZLA 4KJIA 4HDGA 4OV6A 1P8GA 2KM8B 1K8AT 3QO9B 3BBFA 3FCWA 1VLOA 3GTYX 5C7PA 2GHPA 1YHQS 2H5EA 2A6OA 1HA1A 4WU2A 4K4WA 4ZVTB 1X4HA 1NK9A 4IG3A 2G9OA 1JK9B 4B9UA 2YNFB 1NB2A 4M5IA 4ZN1A 2FVPA 2GGPA 4N76A 3CTRA 4USMA 3NCQA 1T03B 1TV6B 5HQMA 5I42A 4DXLA 5J2QA 4FF2A 2X51A 3AB2B 2VBWA 3TP2A 1RXOB 4RW4B 1XMBA 2JFDA 1SJ4P 3DLEB 1VQYA 2RS2A 4GO7X 2EKYA 3LGHA 9RUBA 1NNDA 3I96A 5IM0A 4A48A 2G0CA 1D8YA 4J91A 3KUHA 4OX9J 1KD1T 5KFZA 1HW8A 4UTGA 2DGQA 3OXGA 1DZ5A 1NJIT 2EFGA 2DNRA 4NOHA 3OW2R 1R6VA 4Z7CA 3DRYA 4OI2A 2CNLB 4ZLPA 4NLQA 4I2QB 2YX1A 5LMNF 3DI6B 3CULA 2RHSB 2C3UA 1R3NA 2WSFC 4FBUA 1IWGA 1KRPA 4QWEA 3BSNA 2H5JB 1R0BG 5KFOA 3BSOA 1KLMB 1EKRA 1YBAA 2R7RA 2IM3A 2B7CB 3OTOF 3HT3A 1RT7B 4FYYB 4U8YA 3MD1A 4G1QA 1S48A 2IRYA 3ET6A 4B3MF 3IA0A 2GS8A 5HJYA 1FXDA 2EFVA 3MEKA 2I2YA 3OT9A 1ZZFA 2Y0BB 5HI7A 1FRXA 2PE8A 3OV7A 3CJ0A 4XPEA 2DVIA 5KFYA 5DLGA 4FXVA 2UP1A 3DFEA 3T1YJ 4ZPTR 1SJ1A 1V3RA 5DRKA 2MY7A 1V3ZA 3W61A 2OSRA 3M2UB 5T7LB 1SKSA 2HAIA 3TYTA 3HZGA 3MFIA 1FKOB 3LGMA 1KOOA 1VQMS 1VQ8S 5CYQA 2FVCA 3IRXB 1WKKA 1XERA 2HWHA 2OIHA 4JV5F 3EYZA 5KFHA 1FI4A 3CJ3A 1S97A 4YQWA 3EZ5A 4F8RA 2OSQA 2DH8A 4ES1A 5KFJA 1Q86T 3M6WA 4EO6A 3TVKA 2YXLA 1UEVA 1A9NB 4M5KA 3AD8C 2E66A 4X4VA 3KLEA 4KE5A 2C22A 1CBKA 4CO0A 3M8WA 4B9TA 3AT1B 1HD1A 1T7PA 2QIFA 2EWHA 3TUPA 3T1HF 1U2FA 2GNKA 1VMBA 2BKOA 4ETXA 5IT4A 1KONA 4LQ9A 1MG7A 1B7FA 2COLA 4GVBA 1F3FA 2OO4A 2MJUA 2C2EA 3HD1A 3DCAA 2W4CA 1SBRA 3ETOA 3O5TB 3MURP 2HNYB 2H9ZA 4ED7A 3C15A 4LR9A 4LF4F 2LVWA 1YK9A 2M9KA 4YB7A 4OZ5A 4ECVA 4QZVB 5IC4B 3Q83A 1ITPA 3TNVA 1DTQA 1VI7A 2OFGX 4F0KA 3ZXWA 1U1MA 3R5GA 1HQEA 4NLOA 2P6SA 3MGJA 4ZJQA 4ANCA 3T1AA 3IXQA 5ETVA 4JI5J 4RR5A 1RLCL 3L95X 4ILLA 4EU0A 3Q8YA 1OMSA 1N56A 1RWUA 2DNKA 3GG0A 3KXDA 3NLCA 2M70A 1N48A 1GEHA 1VGYA 2V4JA 3PCOB 3OHBA 2YWHA 4LF9F 2AGPA 1MROA 6FD1A 2DNGA 2ZBCA 2DIVA 4WWSA 1UWBA 3L9ZA 5DM7Q 2Z58B 4KB7A 2YWGA 3CD5A 5E3CA 1N36F 1Q82T 1N34J 2OMOA 1IBLF 2ZC4A 3I0SB 4X84A 1SUQB 2DR7A 3RB4A 1N5SA 2JNJA 1APSA 1OY9A 1E6YB 4ZPWR 3HSGA 2RDDA 1QAIA 3SCLE 1OQ3A 2J76E 1FRIA 2AT1B 4K2JA 3NS6A 1CQMA 3WBZA 1VIOA 4F36A 1ZTTA 4KKOA 4OL8A 1T8EA 1IKXA 2YX4A 2CAJA 1ZA1B 2BZ2A 1WC1A 3MPWA 2VFRA 1KVKA 2E7XA 4F26A 4JI6J 1RADB 3OTDA 3R6GB 1F6TA 2MZQA 2GHWA 3L3CA 4KT0C 4FYWB 3MR2A 1I94J 2QSWA 1KLMA 1RWKB 2Y1RI 1DTTB 2C1EB 2CPHA 2OPRB 4NXNJ 5KG6A 2FJVA 2I38A 3QGHA 1MMNA 3HT0A 1CJKA 1SV5A 1U0HA 1VQNS 1DQ9A 1MU2B 1S4FA 4O3RA 2POKA 4HACB 2QMWA 2QFIA 4NLRA 2AJQA 2DGVA 4ER8A 2F65A 3Q8PB 4IFYB 1S0VA 1I5OB 4ZK7M 5FD1A 2JLEA 3W5YA 1PYSB 2YWKA 1Z1ZA 3D9BA 1GAOA 2UXDJ 5FLXY 1FF2A 3T6BA 2DKOB 1U48A 3M2UA 4IFVA 4KHMA 5T7LA 3H20A 1R27B 3KDNA 4RU9A 1AA1B 2FVQA 1JJ4A 1R8HA 1JXLA 1D0EA 1IBMJ 2UUBJ 3PM9A 4RWWA 3TA0A 3IRXA 3PO4A 3W9IA 2GV1A 4J9PA 4JI1F 1GK8A 3EPGA 5K8MA 2HPUA 4QW9A 2UXBJ 4TY8B 4TKTA 4RUCA 1ZAWA 2VU5A 2R8IA 2DO0A 2YNGB 1BQXA 5GMDA 2FZGB 5HANA 2GJFA 3MWBA 2WVEA 1AW0A 3Q0AA 3PW5A 1X5PA 4A47A 1J5OB 1FDAA 4JI3F 1N0VC 1BY9A 1V3SA 4RL1A 3BYRA 4YMEA 4DMZA 3UPFA 1PYOB 2EVZA 5KFSA 1S7HA 4DV6J 2B9YA 2NZCA 2MZTA 4HHUA 4MAKA 5CAAA 2XS7A 1JKHA 1W2BR 1F5AA 2LYVA 3PVXA 4JI7J 4A46A 3KG0A 2MGZB 1JXEA 1T11A 3RAQA 4YEAA 4LIRA 2FHMA 4DR1J 2HHVA 3R6LB 4O0IA 3K0JA 3BSCA 1S6PB 3G96A 2OEJA 5F3ZA 5B7WA 4UQGA 2ACYA 5HBMA 2R7QA 4LSLB 3RU0A 2HHHF 3H0PA 4LJMA 2UUCJ 2HKEA 5AJ3F 1L3UA 3W8GA 1NK6A 1RBAA 2X3GA 3BZQA 4OI4A 2KYZA 4N77A 2ACMA 4ANDA 5SZTA 4B3TJ 2BQRA 5D6GA 1NK7A 4YR3A 3BN7A 4X4PA 3PFOA 3OHAA 2XWXA 4EZ9A 3KG4A 2N7YA 2WVBA 4IRCA 2QLBB 4NEZA 3M8YA 3B78A 3HHLD 1FTCA 4J7CA 1TL1A 4NXMF 1LW0B 1XMOJ 2CDRB 1TL7B 2CQDA 1M0SA 3JSMA 4OX7A 3U1MA 2HBYB 3I0SA 3M6UA 3G71S 4URQU 3P5BP 1SUQA 2IPOB 4K8RA 2E1PA 5ADZA 4LFCF 1Q79A 1PYTA 1QTNB 2OPPA 3N0VA 4B3OA 3NRBA 1FVSA 5CD4A 1UL3A 2W24A 2Y3YA 2BE2B 3CT9A 1SH3A 1IBKF 2K2PA 4ZA1A 3M9NB 2MDAA 1IJFB 5EGYA 4HR2A 3ZZRA 4ZVGA 3HSDA 1HQUB 3BGOP 4ZCMA 4KIAA 2OPSA 2HQCA 3GR1A 3DLJA 5HVGA 3QRQA 2ADCA 5GAGU 2OD4A 1U2RA 3CGIA 1VHFA 5IWAJ 4D3HA 4N56A 2RD5C 4AXIA 3T6JA 2JH3A 4M8LA 1TKTA 3KHRA 4WU3A 3K5NA 4I1TA 3HHNB 1J27A 2CIMA 1VRTA 4TVAB 3QT7A 2J9CA 2HZVA 3BGRA 4UOFA 2DXDA 2EEYA 5KFUA 3FBCA 1MU2A 1RUSA 2ROGA 1FA0A 1Q7YT 3EXYA 2X3DA 2GC8A 5KFEA 2LDYA 4EBEA 3PJWA 3KNGA 2CPIA 4UUWA 1TQLA 4PQUB 2V4RA 4WFXA 3S6EA 1SPBP 1SJQA 3TAPA 4ZJLA 2CQGA 5C24A 5D3GA 4Z37A 2W9AA 4M5JA 2ZNYA 2A3JA 3U1LA 4DZ6A 1IR0A 2A18A 4NA2A 2VFTA 3ZZ0A 3WX4A 2HBZB 1Z4UA 1IQZA 5DG8A 3K5PA 2C2NA 4JYAJ 2CZ9A 2EXUA 2RUGA 2R4FA 4ZVQB 4NMXA 3PG9A 1I6JA 4WF9Q 1CJUA 4TY8A 4LF5J 1N32F 2PI5A 4RUHA 2CKWA 4W4MA 3PJ9A 5ETMA 2WTFA 1B0PA 4KBIA 2KT5A 1EB0A 1RZMA 3KWMA 4DFPA 2CFXA 1IR2A 2GMHA 3H4DA 3QBCA 3M05A 3MCOA 2XGPA 4YHHJ 2NLWA 5MAOA 4KRWA 2I9SA 4X66J 4QW8A 4LQ3A 4DR6F 1WC0A 2XNQA 4DR7J 4DDFA 4Q2MA 2CPEA 3CCUS 2I5JB 5CCLA 4LBPA 3B6BA 3CVKA 4ECXA 3CCWA 3CDAA 1X4BA 5K14B 3UFCX 2H54B 2VPZB 5DDRC 2WRMA 5IT9U 3TAMA 1KNZA 4P73A 2FHJA 1B0VA 2LQ5A 2E1RA 3CJKA 3ZTPA 4R8UB 4KY3A 3RAXA 2XI2A 4WKRA 4DV0F 3J7A1 4LRBA 1RTJA 4H4KC 2WSEC 2IIHA 3DRSA 4NCAA 4NLUA 2QYCA 3LGNA 3NWGA 3A13A 2QJ3A 4ZS6A 5DETA 1ZS6A 4I6AA 2CWKA 4NYPA 2KVIA 2KZZA 1VJQA 1QSYA 4CT9A 1HLWA 4USHA 4P7VA 3RB0A 3MAAB 4QPTA 1NSPA 2BVZA 1F3VA 2Q1LA 5DDOC 4LF7F 1P27B 3DLKB 4JI2F 4ZIWA 4JI8J 4UT4A 3T41A 3TZZA 3OR2A 4C7QA 1FRHA 1Q8IA 4J9SA 3CJTA 5J2PA 4NI2B 2LU2A 2DNNA 1LW0A 1TL7A 2FLPA 1S9GB 3GIJA 2CNOB 4OHZA 2DEIA 4A8YA 4Y34A 3CDUA 4YDXA 3WX8A 3HHLB 4BC7A 1X7VA 7AT1B 2X1FA 4GKKJ 1JLFB 1J2VA 3V2UC 3G4SS 3M6XA 4DPYA 2V2QA 3A8KA 5D4PA 2QX0A 1RAAB 4EUVA 1TMJA 2BE2A 1NUEA 4RW7A 3M8PB 4P2FA 3R5CA 3SCIE 1N5TA 4P2XA 1U2CA 4WP3A 1IN0A 5KFGA 3IWNC 2SXLA 4H4OB 4DS5A 1NPPA 3OVBA 3JYTA 1FTRA 3PEHA 3FEZA 2OMLA 2IA6A 1QUPA 3GG1A 4DLGA 2EG1A 1XMQJ 1RAIB 1T0TV 1SB6A 1NLKL 3VCDA 1ZAXA 1S5ZA 5U47A 4CYUA 1RWNB 3MMBB 4ZPCA 3KG1A 2HS3A 4DL2A 2DIUA 2P8IA 1BXNA 4F3MA 5EUHA 2A10A 3MMCB 5ETLA 2H48B 3OL7A 3FBBA 5AXNA 1ULRA 1UA0A 3MMAB 2IVFB 1P6TA 2ASYA 2RKIB 4LSNA 2V4QA 4K5SA 5KT5A 2R2UA 4P71A 4JV1A 3TQEA 4PQUA 4ICLB 3BQ0A 4B3SJ 3RW7A 3B54A 3IM9A 2HBRB 3QIDA 3W66A 1KSPA 3IM8A 4ERDA 1T9XA 2R7VA 2QLJB 4LFAF 3TEHB 4F7VA 1IKYA 3JQKA 2XZDB 2NXNA 2HFVA 1GXTA 2MPUA 4FF3A 1CPZA 3LP2B 2ZKTA 5DZ7A 3R3TA 1K9MT 4OZ2A 1S77D 5I3PA 2IAJA 4JI0F 1HWKA 4B3RF 4TYAA 3MAHA 3AD9C 3TAQA 5ETRA 1FDBA 5LM7E 2QA4G 2PMHA 3BQ2A 2ASLA 1RT3B 4DQQA 2AU0A 4CH1A 5AE2A 1WF2A 2IA0A 1NM2A 2KXNB 4LMZA 1JB0C 3FBEA 3R97A 5C5JA 4TU8A 2PA3A 2CADA 2F8EX 1FJEB 4LF8J 2HHWA 2Q6BA 2HS0A 3FNNA 1U6ZA 3SXLA 5E0OA 2D41A 3MMJA 3QQCD 3VQTA 3QZ8A 1VCTA 2XI3A 1JXVA 1HBOA 2YWEA 3FQKA 3PZPA 1IKVA 2DGOA 1S9FA 4EYHB 1N5YA 4NZ7A 3TJAA 4NWBA 4CWBA 1RTDB 1TP7A 1KLNA 2JJ4D 5FDLB 3CO0P 1WC6A 2ZH6A 4DFJA 5E3RA 3ISZA 4AL5A 1HNXJ 2EC0A 1HWJA 1S4EA 1S1WA 3I87A 4O0NA 3RBXA 1ZM2A 2FY1A 4KQZA 3ZZYA 3MTKA 4IH5A 3MR5A 1PJ5A 1FT8A 2C2DA 1RWWB 1WI6A 2YNIB 1HNVB 1NKBA 3J7AN 4USJC 1AXQA 4ED1A 4DV3F 5GVQA 2NXUA 5I4MA 2W4DA 1Q0NA 5T41A 1R89A 2DXFA 3H2LA 4LFBJ 4J9VA 1R8AA 5C42A 4KH0B 3A12A 2LECA 2QV6A 2V50A 2VIHA 2RUSA 2G4BA 3HKZD 4I0WA 1LWFB 4ZHRA 3HX9A 1RWOB 4I7FA 4OMFG 3BQ1A 3UN3A 3ZNJ1 4K4XA 2O5DA 2PI4A 3A1YG 2JFKA 5LT5A 4RPFA 3WZ0A 2DTJA 2YWWA 4A8FA 3NAIA 1U24A 3G8QA 4QWDA 1S49A 2JLGA 2D7SA 1LXNA 3UDCA 2W9BA 2VOPA 2MSTA 3MECB 4DPTA 3NNAA 4GKJJ 2EPIA 2CPDA 3RB3A 5L8RC 5D0RA 4U95A 4NI2A 4LVNP 2G2ZA 1QUVA 3PW4A 1UZHA 3SBMA 3MM8A 1S9GA 3M9OB 3RUBL 2EK6A 4J37A 2EFQA 2VJVA 3Q8QB 2VG7B 1XC9A 3FVYA 2LA6A 2CYYA 2KG0A 3DHWC 1NPRA 5IC6B 3OXLA 1WHXA 3UR3C 1HNZJ 1FJ7A 1RT2B 2I1RA 2VFSA 2K7KA 2RQCA 5I3UA 4MYTA 3MCSA 3QJPA 4NCGA 3G8TA 2LQJA 3R7BB 1JLEA 4H4OA 5GAEU 5CYMB 3WC0A 3QZ7A 2MB0B 3OL9A 4PG6A 2XMKA 3IFEA 3M30A 3Q8VA 3OXFA 2CJ9A 2XC9A 2JVRA 2Y1LB 4C2MA 1PC5A 1BQMA 1JLBB 1GX5A 1SCJB 5HMZA 3GE9A 4OHXA 4ZLJA 2WVFA 3LP1B 3MR7A 2NZ4A 3W1YC 4DCOB 4K4ZA 2M52A 2VPYB 1T9YA 3N01A 4UOHA 1X4DA 3KYLA 4I64A 2GJIA 2DHGA 1NH7A 2JEIA 4UOCA 2PMZD 1JLAB 4QR0A 2YWFA 2VFUA 2XMMA 2OKQA 4C11B 4RW6A 4WBFA 3SDEB 4J9UE 1V6HA 4AFFA 2K1RA 1YTYA 1NJWA 3HK2A 1H2TZ 2CNNB 2BOAA 3MM5A 1UETA 2IM2A 2B5JB 2ZUGA 2C42A 2CVIA 2WOMB 3QJLA 4M94A 2B4OA 1FK9A 2UUAF 2W4PA 3PTWA 3NOCA 2WBMA 3ZNUA 4ZPAA 4H4MA 1V5VA 2EBEA 1RT1A 3UCGA 2V8HA 4GRSA 2RH3A 5HMWA 1SXLA 1CQNA 2GO9A 5CD4H 1RP5A 1QSSA 3OFGA 2J7KA 5KFPA 2APOA 2MMYA 3OJUA 3KJVB 2FLNA 5HQ8A 1C0UA 1CG2A 5E2QA 1MWQA 2VA3A 5CABA 3SZ2A 4KHPF 5L39A 3VF0B 4JB8B 4CNZA 2UV8G 1SC4B 1NK5A 1C1BB 3DRPA 1REVA 1B3TA 3CCJS 2OPQA 1AZSB 1S6QA 3QGGA 1X4EA 2KFZA 1FEHA 5HN0A 3PYEA 5K8PA 2RDIA 4MKBA 2QN6B 1Z2ZA 4MTPA 1P9QC 2R7OA 3HVWA 2XQCA 2DD8S 3KLHB 5LMNJ 3E01A 2AGQA 2ZUAA 3RW6A 5KFXA 1X5SA 2HGMA 1XR7A 2PDAA 2WK4A 2HSEB 4C4WA 3PYGA 2QA4S 4EO8A 1N6QB 1XWLA 2AF6A 2A2DA 1EETA 4U8VA 2NXEA 1D9FA 2HIQA 3H59A 2WVCA 3T9NA 2AW0A 5FDLA 3BV8A 3OTOJ 3PO5A 3AAWB 4ZPVR 4OHYA 6FDRA 1VK8A 2YQ3A 3DOLB 2QA2A 1T9TA 2YQ1A 1SIZA 5K9FA 4K0KJ 4B3MJ 3RBZA 5G0RA 2AX0A 2C3YA 5THWA 2YNIA 4I2PB 2XMUA 4L3NA 3SCKE 1H72C 2HNZB 4RBUA 2XWYA 3E8OA 2IBOA 2XB2D 2EFPA 1S12A 5D4OA 1R0AB 1PJ6A 2AKWB 2JX2A 1RU2A 4AQYF 2XMTA 1BQNA 1UP1A 2PO4A 2PEHA 2RB7A 4M1KA 1CC7A 4DPXA 4C8OA 1HWIA 2HGLA 4BWMA 4C8KA 3HVTB 2ZD1B 3GJTB 4B9NA 4R5PA 4RW8B 1XQIA 1Q78A 4XDCA 2R2RA 2FJBB 2LQ9A 4USWA 1OS5A 1ZBTA 1Q7LB 4CIOA 1VQKS 1SL1A 2CA9A 2M0GB 1QVGR 4M5LA 3D1HA 2HRTA 2AD9A 1TMMA 1TAUA 2D3OR 4O4GB 3CCQS 1WC5A 1FNXH 1SKWA 1HBUA 3ZZOA 1NJXA 3CNQP 3MEGB 1GX6A 4OIXA 2DY9A 4QIEA 2W2QP 2ZBRA 2VKRA 4C97A 3M1VA 1AUSL 1CS4A 3F44A 2XNRA 2MZSA 3WIUA 3T1HJ 2JRSA 1FCAA 2JDJA 2UZAA 4HT7A 4B17A 4CP5A 5KT2A 2R7SA 2E5LF 3M7VA 4TNOA 2R8JA 1BWEA 1TVRA 1KTQA 4OZ3A 4DR2J 1S1XA 3GB0A 3M2VB 2FZCB 2LXIA 4IR1A 1OJ4A 3Q8RB 2KJWA 2QMUB 4OYIA 3OUYA 5LSOA 2B43A 4FPIA 2H4WB 3DRXA 3SV3A 1D3WA 2O66A 1U4BA 1O0PA 1CJTB 1HWLA 1WTBA 3NY0A 4JBCA 5AXKA 2UV8A 4OYOA 3LF0A 8AT1B 3IO1A 1G2EA 3LP1A 1C4CA 5KFQA 4TQRA 4ZP9A 4YR0A 1YRXA 5EHHA 3CC7S 1TKDA 3CSKA 5ETPA 2WW8A 3VR1A 3UD3P 4DQPA 3SDEA 3HKWA 1IVZA 2B3TB 1RDRA 1RT4B 3TJ9A 3PRBA 3JAMY 1R31A 2XSJB 5LJ5Y 3ENAA 5A8KB 2FJWA 1X9WA 3CWJA 4P6QA 2ZH9A 4LF9J 4C8LA 2CZVC 4H54A 5DG9A 3TVZA 2P6TA 4WPAA 2IM1A 3EWGA 4TYBA 3V6HA 4X4OA 2ZKUA 1N36J 2RNEA 4J90A 1U8WA 4ZDNA 1JMTA 2F4VJ 3OTEA 2B9XA 3C6UA 4RW9B 1VQ6S 1RA7A 3DLGA 4RNHA 3AH6A 1U6BA 4A8XA 1CULB 5JXSA 4KHRA 3TANA 2OI2A 3N9UC 4DFKA 4ID5B 1WG1A 4OHVA 1YDLA 1FFWB 2J0XA 2MKIA 4ELTA 2O3DA 4MIAA 1LWEB 4DR3F 2JC1A 3FGVA 1NH8A 3MEDB 2M2BA 3W2VB 1B70B 2BJ7A 2I0XA 2ZNZA 4G3IA 4IO1A 3OR1A 4PXCA 2YKNA 1KP6A 5GADI 3VVTA 5IS2A 3H25A 4DR5J 3C3LA 3RRHA 2UUTA 2OEMA 2Y0SD 3ICLA 3KTQA 3EXCX 4K50A 4UZBA 4C8YA 1M5PC 4S0MA 3Q23A 1SQEA 1ZPVA 1KVIA 4QIGA 3V81A 2BM1A 3KJQB 3CE8A 1ICEB 5H9FJ 2FB0A 3VTIA 4FXDA 2XBPA 1RTIB 4PEOA 1EP4A 3DN9A 3SQGB 1FE0A 1H0HB 1T9UA 1KQKA 3DOLA 1RU1A 1PGZA 4C3KA 3HFVA 3JSYA 1JNRB 3GJSB 4MIBA 3ADAC 1MNEA 3CC2S 3RB6A 2ZHBA 8ATCB 3RTVA 4QCLA 3FSYA 4X4TA 2XLJA 1DY3A 4OX6A 1JJCB 3J81Y 1NDCA 5E7OB 3O8WA 2KB2A 2RJZA 3N79A 4Q2LA 3CUNA 3EJMA 2DGUA 1M1KT 1NHUA 1YRUA 4Y65A 3FCVA 1ZPWX 4PPDA 1WEZA 2IYIA 5F8LA 3OSPA 3JTPA 4DUYF 4KGKA 2M8HA 3V6DA 1B0TA 2QYGA 1RWMB 3E3XA 3HVTA 4DHVA 2ZD1A 2ASDA 1K1SA 2F5GA 3G82B 2KHCA 2MXYA 4KH1B 1QSLA 2AZ1A 4ALZA 2L41A 5AE3A 5E5NA 3H5SA 4J9KA 1GXUA 1R7IA 1N52B 4YN3B 1HARA 4C6AA 4O4GA 1WC3A 1TELA 2J9DE 1UCNA 5A76A 2HWTA 3UNYA 5CQGA 4RNNA 5ETQA 1K47A 2M7SA 3GIIA 4Q0BB 2Z56B 2C2OB 4E8UA 1PAUB 3UNGC 1YWXA 4DV4F 2OAUA 3KLIA 1KS2A 4EI2A 1C1CA 3LWMA 2YX7A 3US5A 3DOKA 3R9LA 2EFNA 3MUVP 2PN6A 1WEXA 4PUOB 4J9RA 5AT1B 3M32B 2KT3A 1UW9A 1U09A 2G0IA 3GJQB 1X9SA 1NXIA 1Z2LA 3ISNC 4UY85 2XHCA 3PV8A 4FKXA 3GV8B 1H73A 2GMLA 5KT6A 2V63A 3AOAA 1GH8A 4W92B 2L48A 2V9KA 2ASJA 1CJTA 1T9VA 4B02A 2J8SA 5DLFA 2CQ2A 4FZVA 2GZOA 2QSFA 1JLQB 1NBEB 3HFKA 2P2CB 1WKJA 2DNQA 3W7BA 2C2KB 2BRKA 1WD6A 5E33A 3K58A 5AJ3J 2HVZA 4NMLA 2H4YB 2IDLA 1F5BA 1PG5B 4D3GA 1NKEA 3HSZA 2J5AA 3CJ4A 1ZETA 4IDKA 3W9JA 3OJSA 1WDDA 2HURA 4OZ1A 4WCEQ 4IG3B 2XYHB 1I1GA 5LJ3Y 1JLGB 2O01C 3GIMA 3OFFA 3P5TL 5KG0A 2U2FA 1NZAA 2VH7A 3TX0A 4Y3CA 2H1YA 2GJ2A 2Y8YA 3RBEA 3GWCA 3K8VA 3HHLC 2X1AA 2PEBA 2J9EA 5I42B 5J2QB 1RT4A 3RAMA 2B56A 3POTA 2XSJA 3W8PA 2EW9A 3C14A 3KLGB 1RTZA 2HQ3A 3IR5B 8RUCA 3GMGA 1SH0A 4ZLNA 1VC6A 1UPMB 5IM0B 4NXMJ 2GMJA 1GTHA 1ZYQA 4NRUA 4O44A 1HMVB 4CLPA 4WFBQ 3AA8A 1K0TA 1OPZA 2DNYA 2JEFA 4QWCA 2HS4A 2E5HA 1N0UA 2AMCB 2EFOA 1EAYC 3D4JA 3N6LA 4LFCJ 1PBUA 3HI9A 4MK8A 4DU7A 3FDSA 1CULA 1FJGJ 2KT2A 2BV3A 2IFXA 3LW5C 1M5HA 4WFYA 4ELUA 3M8ZA 4ID5A 4KPCA 1LNQA 1IBKJ 2F8MA 2V0NA 1Y7PA 4GMKA 3AODA 2DNPA 2ZBPA 5HROA 2ZBIA 1HPZA 3MM6A 4RBVA 5E41A 4FF1A 4MH8A 1UVKA 4I68A 1K44A 2AP6A 3BDPA 4AT1B 2E9TA 1BHNA 2GVDB 1SC1B 3MUTP 1X0PA 3TWZA 4G1QB 4LT6A 2ABYA 4B08A 1FJCA 4AL7A 2AJ1A 1GXLA 3ET6B 4I6YA 1YBUA 3RG6A 3DNCA 3UWTA 3CCSS 4JI5F 1CVJA 3FMWA 5HLFB 4FN5A 4DCJB 2M8DB 3NS7B 2CQHA 4ED4A 3KLFA 1QJHA 4ZIVA 4J9MA 4ZP6A 3I5CA 2W8LA 2KDOA 4FP9A 2BRLA 2BJ1A 4QWAA 3ZC4A 3KK1A 5D15A 3KK2A 1M5OC 2C3MA 4LRCA 2XO7A 5H9FK 2FPHX 2HHTA 4JUZA 4FPRA 5HQLA 1DAXA 1Y3KA 3R8YA 3ENVA 4NLDA 2MQPA 3MDFA 1N34F 3HM9A 4ZCIA 3FQLA 4WK3A 3QIPA 4G6VB 5EN1A 4URSA 4N47A 1KHVA 4P10A 4RX6A 3U27A 5EWEA 1TU0B 4M63A 2CJKA 4U7UK 1YJNS 3Q22A 4YS2A 2IBKA 2E7VA 4WKYA 2Y8WA 4LF2A 3D0HE 1YVFA 3Q2SC 3VAJA 4PAAA 3JSRA 3A3NB 2IHR1 2IVYA 3IRWP 2HQGA 4MJKA 4FYDA 3R2CJ 3UN5A 1EQMA 1G4CA 1XR6A 5BR8F 5CZVA 1NDLA 2HMIB 1NZ8A 3PR4A 3AOCA 3T5KA 4GVBB 5I3QA 3FFIA 1LOUA 1MLAA 2CJXB 4LBHA 1I94F 3UD4P 4JOUA 2RT3A 1FHTA 2MEWA 3AFGA 5B0AA 1MWZA 3C15B 4NXNF 3DDNA 4K59A 2L9WA 5AXLA 4DR6J 4AXJA 2A6MA 2CDQA 3D1OA 1NSKL 2ZZMA 3UDVA 1X4FA 2MKJA 3J7Z5 5DO2A 3NGSA 3NCRA 3M32A 3MCNA 2VFVA 3F41A 3GFHA 3HP6A 1DTQB 3IG1A 3PDNA 1Q8BA 2KJVA 1QE1A 1G3OA 3VZHA 4IO9Q 1H3DA 1UFKA 1WKLA 4CO2A 1JQGA 1FDDA 2XZWA 4WJBA 3HPOA 4ECWA 4PYAA 2IJNA 2XY7A 2WB4A 1U02A 4BHQA 1TAQA 1XBWA 1RK8A 2VZ9A 4DV5J 2V4JB 2JEJA 5D4LA 1Q1KA 5GMKa 1D09B 3MUMP 1JLGA 4ZP8A 1MROB 1NK8A 4DPUA 1UWBB 3HDSA 2W7OA 3KUEA 3GV5B 3NCPA 2R7TA 3J7YI 2B0GA 1T05B 4LF7J 2EK1A 4JI2J 3PHEA 1FKPA 1DQ8A 3PX0A 5KFTA 5IQ6A 3KLGA 3NP5A 5KFWA 3H98A 3G86A 4O3OA 1X4AA 2VQEF 1O8BA 5HMYA 1HI8A 1HMVA 4FDFA 3MOZA 1QAJA 5D78A 1RTHB 4X62J 1WWHA 4ZOSA 2ZH8A 4DV6F 4FVMA 2E29A 1UVLA 4KKOB 2MHNA 4DL7A 2FZKB 1IKXB 2C28A 4DSIA 1TFWA 2FLLA 2PC6A 2CQ1A 3J7ZT 3CCLS 3QWPA 4A8QA 3KMQA 2QRRA 3N5BA 4I4BA 1DURA 5LXYA 2LXUA 1UVNA 3P45B 2DB1A 2KO1A 4DR1F 2HAFA 5HO4A 2PFFB 2J9DA 2RILA 3I9V9 3W62A 1KR4A 1AFIA 4WIQA 1VIXA 5F0WA 4IG0A 1W7WA 1YLXA 3GYGA 2BACA 2L3MA 4WK1A 1JJ2R 1CJKB 1RA6A 2GVDA 1SV5B 1U0HB 4NLVA 1IM6A 3QT8A 2UUCF 5LXRA 3PYFA 3IGVA 4DL0C 4PWWA 2VOOA 3DU6A 4PG5A 1VQ5S 4F2SA 4KV8A 3FMBA 3OTCA 1RJJA 5EX0A 3IBWA 2XZTB 2CVEA 4B3TF 5HLFA 1SIWB 3CDEA 4N5SA 5JVHQ 1X60A 3GLJA 5D0HA 3BR9A 4WP8A 1FRMA 3KHGA 1M5VC 3O44A 4IFVB 4R25A 2NSCA 1TK5A 4IH7A 1ZA2B 5J2MA 2OP5A 5JJBA 5GAGI 2ALYB 4V19X 1M5SA 2E1CA 1XMOF 3NKYA 2R9LA 4B9LA 1SI9A 4YY3J 3HHEA 1NK0A 4OI1A 3O3LA 3BO3A 4IKAA 3KK3A 1OSDA 1SJRA 4BDPA 1ZTWA 2HLTA 4DSEA 3MI7X 4W90B 5BXIA 1H98A 1NRKA 2DHSA 4DLEA 2V67A 4DUZJ 2ZOMA 3W5XA 1NU4A 2ATLA 3CJQA 1JLCB 3DGPA 3QGPA 2DNOA 2VDHA 5DM6Q 4EEYA 2DBBA 1TL4A 5GAHI 1C0TA 1IXKA 2UXCJ 2ZM6J 3CJ5A 4LF6F 4F02A 4OZ0A 2HMIA 4NRTA 5M2RA 1KBRA 5IWAF 2AQ4A 2ILYA 5CYJA 1JKHB 2EG2A 2FHJD 2VQFF 1OIAA 1IKWA 4RJVA 4N41A 2XY6A 4Q44A 2WVDA 1TUVA 4EGLA 1UMJA 3D6HB 2LEBA 1LK5A 1W26A 2J6TA 3G6ES 3R5JB 2HFUA 1YG0A 1VQPS 2CG8A 4OYBA 2BBEA 1WACA 2IDEA 4OX8A 2HRYA 2CQ3A 5HBMB 3EZOA 2PMWA 4G1PA 4OYMA 3UQSA 1Y0HA 3GCXP 3MM9A 2J6SA 2QLWA 1UEKA 3I5BA 2MLZA 4L72B 2VG5A 3MZIA 1DHMA 3SI8A 5SUHA 2PA8D 5M2PA 1FEEA 1O5JA 4NE9C 1S0MA 4LSZB 3BSAA 4IOCQ 2BJ3A 1PKUA 5E3QA 1PC4A 2RRAA 1XNRJ 2BXJA 3E2EA 1HBMA 2YH1A 4NA1A 4JYAF 4WFZA 3TO8A 1YJWS 5IOLA 1SVDA 1YITS 2RSQA 1TL1B 2NYHA 1S1TA 4U96A 4KAIA 5A0YA 2MQQA 1ACMB 3JSMB 4HDHA 2FIUA 3CXCR 1T05A 4LF5F 4Y2MA 4CT8A 3JXOA 1XK8A 1RBLA 2RQ4A 4F0MA 3TUZC 1KVJA 3H2UB 5D0GA 2ZH3A 3DM2A 1B64A 3BYPA 2R7UA 4WXWA 2NREA 2OPPB 4B3OB 2XM3A 1CC8A 4DWIA 3QYYA 1YGYA 1TZ0A 2AYBA 2R8HA 1RTHA 3PRVA 4YHHF 2GIQA 1Q5VA 3UVJB 3PYDA 4HT5A 1SL2A 4ED5A 2DHHA 2XMVA 5F8MA 3PX4A 3AJDA 2BR0A 1VRQC 3ONQA 3R1LA 4DN9A 4F4WA 1RWXB 2OPSB 3DOMA 2YH0A 3T5HA 5HJXA 1RWPB 4LRFA 3SFGA 2C3OA 5KFMA 1KQGB 3GONA 4PPZA 2XO6A 4RNFA 1TKTB 4OYWA 5B08A 3NGUA 3A8EA 1RISA 2FVRA 2ZOFA 1SKRA 2YKPA 4ZMMA 1VRTB 3V4IA 2MSSA 2AJ4A 1K0VA 1TL3A 3BGRB 3BN4A 4JP8A 2OHDA 4ELVA 3H90A 5MLCV 3F56A 3D5MA 3MM7A 5J2NA 1U1LA 1NJZA 3CC4S 3CCZA 4DSJA 3KHHA 2ROPA 4DUTA 1WUUA 5IXUA 4MKVA 2N7CA 3AB4B 2IC3A 1NMEB 2GQ2A 3E51A 3DDKA 3JTOA 5F8IA 4JI8F 3RR7A 4DR4F 5C24B 4LRAA 5D3GB 1KKHA 4ZP7A 4F0HA 5J1NA 4MMOA 1LXJA 2DR8A 2YTCA 2UVRA 2RDJA 4RO0A 3KFWX 4G65A 1F9HA 1RHKB 4CRJA 2DK2A 2V8PA 1A6LA 1YX2A 4AD6A 2MY8A 3C8YA 5L1LA 1VQSA 3M8RA 4GKKF 3K57A 5L1KA 1CJUB 3QSIA 1YJ7A 1T02A 4HHHA 2FDNA 4LREA 1QAXA 2F8HA 2VPXB 4ZVEA 3CCTA 1OY6A 4LRDA 2FHOB 3CIMA 1JLCA 3M8QA 3HULA 4K2XA 3VALA 4FBTA 4CH0S 4Q45A 2W2OP 4FVCA 3DXSX 5T14A 2CJQA 4OJ1A 1XMQF 2FQQB 3G87A 4C48A 4C98A 1BMQB 3WIVA 1GNKA 1U25A 4ECRA 3GZ7A 4URGA 2R7XA 1FD2A 2CJYB 3G8SA 3EX7B 3T9ZA 3SMZA 2CPXA 3IC1A 1TKZB 2HHXA 2D3UA 2D1CA 1U1OA 5KT3A 1NKCA 4IYQA 1PILA 1RLDA 4CTAB 3OL8A 3TAMB 1O51A 4I6WA 2E1MC 1C2PA 3UCZP 3CJKB 2KU7A 3QJJA 3SSRA 3LAMA 3EVWA 3KUGA 1RTJB 1NSAA 3DRSB 2I8EA 3G9CA 5F9NA 4Y00A 2VHGA 1TKXA 2GIFA 1P1LA 4OLOA 3P4UB 1J5EJ 1LWXA 1B99A 5B0DA 4OJ3A 4X4RA 2MZJA 4DSFA 7FD1A 4HI1A 1UTAA 1VQLS 1BD6A 3OR2B 3CCES 2NPIA 5J2PB 5IFMA 3EUNA 4NL5A 3TW0A 2WBRA 2NS1B 3L7PA 1RT6A 1Y5IB 5KTQA 2XMAA 1RABB 3EZUA 3QGIA 4HLBA 2ZWPA 3GFZA 3S7RA 3BREA 1WDTA 3ELHA 2CNKB 4CLLA 4NLGA 2BABA 2CZ4A 4Q8FA 4LF8F 4KO0A 4RUBA 3C6TA 3VGSA 2VODA 4OZNA 2N4CA 1D9DA 1UWAA 2BE7D 4RW7B 1T3OA 3L7UA 4A8OA 3ULHA 3UVJA 4UW2A 2V2ZA 3JYTB 2E5LJ 3THVA 1X4CA 4CLWA 3AY0A 4PRFA 4L73A 1HNXF 2DR9A 1R0CB 3ITHA 4X65J 3ILIA 2UVUA 1FNMA 3R7NB 2WB1D 2LQBA 2L9DA 2MKCA 4M5MA 1H2VZ 1D8ZA 4XK8C 4CYUB 2Z2ZA 1HW9A 4O4RA 2ZVIA 4Y2AA 2ZOGA 3KOAA 3SEOA 4LFBF 1WI8A 5IT0A 3VQSA 4U7CA 2ZWOA 4O23A 4WP9A 4A4JA 2OD6A 2UVWA 4HH0A 3VGVA 4I67A 3IWLA 4K5RA 4NZ0A 4HEA9 4LSNB 1VQOS 5KT4A 3D68A 4HTJA 2LMIA 4YP3A 5DJBA 3H40A 2CQCA 5HP1A 4DG1A 5GAEI 2AIRB 4KGMA 3MEEB 3DLHA 4GKJF 1IKYB 1RE1B 5HSPA 3OVSA 2JL9A 2WONA 1VQ7S 1EX8A 4DSKA 3Q89A 3P8BB 2IAJB 2KZMA 5HAOA 3RBDA 3DKDA 4B9SA 2MZ1A 2PD1A 3FJ2A 2NPFA 2F7VA 5DQGA 5HVFA 3RJMB 1H7WA 2RF2A 4P74A 1FWPA 5LMUF 4ITSA 1SQGA 2Y1JA 3B4MA 4QYRA 2IM0A 4C0BA 2DITA 1HNZF 1SC6A 2B9WA 3BKUA 3MPYA 1NHKL 1RQ0A 2Y9HA 2NCKL 2FTRA 3BM7A 1CLFA 2AWZA 3CJ8A 4NLSA 1RYRA 1JNZB 4OYPA 2YNHB 2DR6A 4WFNQ 1RACB 1WJ9A 4DR3J 1HBOB 1IKVB 2NUUG 3VGUA 3G2XA 1AFJA 3R1HA 5G4DA 1N5YB 1R8BA 3HF5A 5DDQC 2G13A 2EBGA 3P49B 2RQKA 2MYFA 2W2NP 4LBIA 3BPDA 1XR5A 1T9WA
chains in the Genus database with same CATH topology
1EHWA 3ENAA 4S0MA 1NSPA 1S59A 1LWXA 2VU5A 4UOGA 2HVEA 1B99A 3BBBA 4O0NA 1HHQA 3EM1A 2AZ1A 4FKYA 1VYAA 3BBCA 4WBFA 1NPKA 1NDPA 2BEFA 1WKJA 3FKBA 3EVMA 3BBFA 1NLKL 3Q89A 3FCWA 5BXIA 1W7WA 3EE3A 3GP9A 5C7PA 4DUTA 1XQIA 2ZUAA 4HR2A 1WKKA 4C6AA 4KPCA 1S5ZA 3DKDA 4ANEA 3PRVA 1U8WA 3ZTOA 3EVOA 4ANDA 1MN7A 1LEOA 1BUXA 1UCNA 3EMTA 2DXFA 1NSKL 1BE4A 2HURA 1NB2A 3BH6B 3Q83A 3MPDA 3FC9A 3B6BA 1NSQA 3FBEA 3NGSA 4DZ6A 3JS9A 1NDCA 1B4SA 1K44A 1HIYA 3NGRA 3ETMA 4F4AA 3EICA 1NHKL 3EJMA 1KDNA 3FBBA 3NGTA 1BHNA 3WX8A 2NCKL 4F36A 3Q86A 3FCVA 5CAAA 1NCLA 3ELHA 1PKUA 2DYAA 3ZTPA 2BX6A 3ZTRA 1S57A 4ANCA 3VGVA 3VVUA 4DI6A 3BH7B 1WKLA 3R9LA 3ZTSA 1JXVA 3Q8VA 3Q8UA 1PAEX 1MN9A 5IOLA 2DXEA 2DY9A 2HVDA 3NGUA 4W98A 3Q8YA 4UOFA 2DXDA 4EK2A 3VGSA 1NUEA 3DDIA 3B54A 3EVWA 3VGUA 3G2XA 3FBCA 3PJ9A 1F6TA 3GPAA 5CABA 3VVTA 4CP5A 3L7UA 2B8PA 1ZS6A 2CWKA 2B8QA 4FKXA 4ENOA 3VGTA 3ZTQA 1NDKA 1F3FA 1NDLA 3FBFA 4UOHA 1XIQA 1HLWA 2AZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EHW A;  3ENA A;  4S0M A;  1NSP A;  1S59 A;  1LWX A;  2VU5 A;  4UOG A;  2HVE A;  1B99 A;  3BBB A;  4O0N A;  1HHQ A;  3EM1 A;  2AZ1 A;  4FKY A;  1VYA A;  3BBC A;  4WBF A;  1NPK A;  1NDP A;  2BEF A;  1WKJ A;  3FKB A;  3EVM A;  3BBF A;  1NLK L;  3Q89 A;  3FCW A;  5BXI A;  1W7W A;  3EE3 A;  3GP9 A;  5C7P A;  4DUT A;  1XQI A;  2ZUA A;  4HR2 A;  1WKK A;  4C6A A;  4KPC A;  1S5Z A;  3DKD A;  4ANE A;  3PRV A;  1U8W A;  3ZTO A;  3EVO A;  4AND A;  1MN7 A;  1LEO A;  1BUX A;  1UCN A;  3EMT A;  2DXF A;  1NSK L;  1BE4 A;  2HUR A;  1NB2 A;  3BH6 B;  3Q83 A;  3MPD A;  3FC9 A;  3B6B A;  1NSQ A;  3FBE A;  3NGS A;  4DZ6 A;  3JS9 A;  1NDC A;  1B4S A;  1K44 A;  1HIY A;  3NGR A;  3ETM A;  4F4A A;  3EIC A;  1NHK L;  3EJM A;  1KDN A;  3FBB A;  3NGT A;  1BHN A;  3WX8 A;  2NCK L;  4F36 A;  3Q86 A;  3FCV A;  5CAA A;  1NCL A;  3ELH A;  1PKU A;  2DYA A;  3ZTP A;  2BX6 A;  3ZTR A;  1S57 A;  4ANC A;  3VGV A;  3VVU A;  4DI6 A;  3BH7 B;  1WKL A;  3R9L A;  3ZTS A;  1JXV A;  3Q8V A;  3Q8U A;  1PAE X;  1MN9 A;  5IOL A;  2DXE A;  2DY9 A;  2HVD A;  3NGU A;  4W98 A;  3Q8Y A;  4UOF A;  2DXD A;  4EK2 A;  3VGS A;  1NUE A;  3DDI A;  3B54 A;  3EVW A;  3VGU A;  3G2X A;  3FBC A;  3PJ9 A;  1F6T A;  3GPA A;  5CAB A;  3VVT A;  4CP5 A;  3L7U A;  2B8P A;  1ZS6 A;  2CWK A;  2B8Q A;  4FKX A;  4ENO A;  3VGT A;  3ZTQ A;  1NDK A;  1F3F A;  1NDL A;  3FBF A;  4UOH A;  1XIQ A;  1HLW A;  2AZ3 A; 
#chains in the Genus database with same CATH topology
 2DCU B;  2HFO A;  1WSR A;  3AJ2 A;  1RHJ B;  4DL4 A;  2FVS A;  4F4K A;  1TKZ A;  3QNW B;  2R7W A;  1S1W B;  2QA1 A;  3NAH A;  3B82 A;  2YKA A;  4CTA A;  1URN A;  3NNH A;  5GME A;  3VWS A;  2D69 A;  5KFI A;  3MPD A;  4E98 A;  4UZC A;  5C42 B;  1VBK A;  1N33 J;  2Z2L A;  4ZHR B;  2W2M P;  2O1P A;  2UUW A;  2RML A;  3R5A A;  4I7F B;  4IRK A;  2DPI A;  3DYA B;  3D6M B;  2HWI A;  2KXH A;  2R2S A;  3FZB A;  5IT9 Y;  1BGX T;  2HK2 A;  4V19 J;  1X5O A;  3FZ2 A;  5GAD U;  3I4P A;  1WTF A;  4NLP A;  3C19 A;  4DUY J;  4Y0F A;  1ZOT A;  3KNA A;  4JI4 J;  3W5Z A;  3K8W A;  2W9B B;  3O2I A;  1YBT A;  4J9L A;  1R43 A;  3IN5 A;  2MTL A;  5B0G A;  4ZN3 A;  1DAR A;  3CED A;  5M2U A;  1DRZ A;  3FBF A;  1HD0 A;  5HK4 A;  2V34 A;  5DQH A;  2CPY A;  4WXO A;  3L7O A;  1P9Y A;  3F0N A;  3C16 A;  3MM8 B;  4OI6 A;  2BKP A;  4RWX A;  1R6Y A;  2YPY A;  3HSJ A;  5IQQ A;  2PSZ A;  1HI0 P;  1VR6 A;  4U67 Q;  2XMJ A;  2ZHA A;  1UJ6 A;  2PGC A;  1BUX A;  3IAM 9;  2G0J A;  1L3S A;  1RHM B;  1RYS A;  3KLV A;  3R2D J;  1VOM A;  2GO8 A;  2AYE A;  5I3U B;  1REG X;  4NCG B;  5EWF A;  1WEL A;  3SFU A;  3EPI A;  4PG4 A;  3H8Y A;  1JLE B;  4ZVR B;  2HND B;  2W25 A;  1LW2 B;  3LP0 A;  1VLY A;  4DV4 J;  4MFB B;  3IBF B;  1VRU A;  4CM0 A;  3QLH A;  3M30 B;  1S79 A;  2Q79 A;  1U8S A;  2LP4 A;  4IH6 A;  4PG7 A;  1Q8L A;  1HYS A;  3HVR A;  3LOU A;  3ZO7 A;  2KM8 C;  4K0K F;  2MQO A;  4TU7 A;  2AJF E;  5C25 A;  1BQM B;  3CIZ A;  1UJ4 A;  4QR2 A;  2DJW A;  4KGX B;  4FF4 A;  3CD0 A;  1HHS A;  1PJ7 A;  3EM1 A;  2ZH7 A;  3LPY A;  4WE1 A;  2V8D A;  2XMW A;  3GP9 A;  2E5I A;  4RW6 B;  2P9E A;  5CH7 B;  5K20 B;  2W8K A;  1Q8K A;  3GJR B;  5ETS A;  5ETK A;  2K1R B;  1D1U A;  2C3P A;  2E1A A;  3MM5 B;  3OL6 A;  4CNY A;  3F73 A;  3SSS A;  4K4S A;  3EIC A;  4TN2 A;  5L1I A;  1FK9 B;  5L1J A;  2OUG A;  1Y11 A;  3MEE A;  3HZE A;  4CO3 A;  3LAL A;  4DEZ A;  2DRB A;  2YVS A;  3RZA A;  1RAH B;  4H4K A;  1TL5 A;  4H4M B;  4DS4 A;  1RT1 B;  3D67 A;  3W65 A;  4KFB A;  3T19 A;  2HVI A;  3FUY A;  5A2Q Y;  1NK4 A;  2XG8 A;  2KTQ A;  1C0U B;  4ED0 A;  3OBI A;  4X64 J;  4ED2 A;  4XAK A;  3CPW R;  4MYU A;  4F2R A;  3OTB A;  3DRP B;  1REV B;  1E6V B;  2OPQ B;  3D3C J;  4J5O A;  4DX8 H;  1S6Q B;  4E0D A;  2R42 A;  2W9C A;  4R0J A;  4NA3 A;  2E7W A;  4KSE B;  3G6V A;  4DV1 F;  1KEK A;  2YKM B;  2AEF A;  2UU9 F;  2RIJ A;  1X9M A;  4DR2 F;  1T95 A;  2AEJ A;  3E01 B;  3NG8 A;  5KT7 A;  3MCM A;  1XNQ J;  2YNH A;  1YZ6 A;  1S1U A;  3FRY A;  2B6A A;  5K8N A;  3IP0 A;  4L6V 3;  2GW8 A;  4X4S A;  1EET B;  3MFH A;  4F4A A;  2RAQ A;  2V9W A;  2GAH C;  3VAF A;  1HNI A;  4MK9 A;  5HAT A;  4A8S A;  2RU3 A;  1WOS A;  2DXE A;  1A7G E;  5B09 A;  3OFH A;  5KFV A;  3BO4 A;  2ROE A;  1H6K X;  2XS5 A;  5G0R B;  3TEG A;  4ZCL A;  2VA2 A;  2DHA A;  2VAS A;  5HVH A;  1AB8 A;  3BGU A;  3W2W A;  1QTM A;  2F63 A;  4DJB A;  3GCW P;  3QO9 A;  3BB5 A;  1BQN B;  1VK3 A;  4PKD B;  1KOH A;  4DQI A;  4RUA A;  1I3O B;  2HVH A;  4CDI A;  2J6U A;  4P7T A;  4R5P B;  1TUG B;  1VBX A;  5J1P A;  1QAY A;  3DYA A;  2YNF A;  3THT A;  3T3F A;  1T03 A;  3UR0 A;  1X31 C;  3CCM S;  1F5C A;  1TV6 A;  1FX2 A;  3TAR A;  4ES2 A;  3MF5 A;  2M88 A;  2F4V F;  4RW4 A;  5F8N A;  2HHQ A;  3HJF A;  3DLE A;  3IS9 B;  2YKQ A;  2J0Q D;  2QZ8 A;  3J80 Y;  1HHT P;  1Q4R A;  3QPI A;  3OPK A;  4C3M A;  2KFN A;  3AQP A;  3GFX A;  1L3V A;  1BLU A;  1HBU B;  2JSX A;  2BJ9 A;  4OJH A;  2V68 A;  3HVA A;  4HH1 A;  2VIC A;  1RAG B;  3M1V B;  1CS4 B;  2MJN A;  2NYI A;  1ELO A;  2WCX A;  1M1H A;  3QAU A;  2ZJP Q;  2CXE A;  4I2Q A;  5LSR A;  1D9A A;  2XYG B;  3RYL A;  4C8N A;  1HQ2 A;  3JTN A;  5F41 A;  3HHK A;  2XSF A;  2OTL S;  1FDN A;  3DI6 A;  2VBZ A;  5BR8 J;  3GIK A;  3FSI A;  2FJE B;  4DR5 F;  3KDO A;  2CPJ A;  2HVE A;  1TVR B;  3M4X A;  2H65 B;  1RHR B;  3BJY A;  1S1X B;  3ZZZ A;  2GX8 A;  5DS7 A;  2V2K A;  3OUY B;  2HND A;  2V6A A;  3S8S A;  4RU2 A;  1LW2 A;  1LEO A;  4RBT A;  4C9D A;  4MFB A;  3CD7 A;  3BEG B;  3FK4 A;  5FLX U;  2F1F A;  1RHQ B;  1RT7 A;  3PX6 A;  1GMW A;  3FRZ A;  3NMA A;  4M95 A;  3DXB A;  2Q43 A;  4XDD A;  3GFY A;  4F4Z A;  2KXF A;  4DV2 J;  4OI0 A;  3M8S A;  4DPW A;  4NLX A;  3PAC A;  1MSW D;  2Z8Q A;  4JV0 A;  1VQ9 S;  5E3A A;  3PEJ A;  3PIO Q;  4CLZ A;  4L75 A;  2DRD A;  3DRR B;  4UQT A;  4GC7 A;  1R8C A;  1FKO A;  3TZY A;  3BPS P;  2YKO A;  1GTE A;  5K5M A;  1CSJ A;  1VYA A;  1RCO B;  3W3S A;  3PR5 B;  3GYX B;  3DMJ B;  3EVO A;  3N5F A;  3LPE A;  3W63 A;  2H51 B;  5A8R B;  3I5A A;  3C6U B;  3PRD A;  2N4D A;  3DLG B;  4KGV B;  5FJ4 A;  3CCV S;  1GMV A;  1YJV A;  3W9H A;  4EWT A;  1PIE A;  2J7U A;  3K2Y A;  3TZW A;  2J7W A;  4L76 A;  2HFS A;  1WHV A;  2VQE J;  3LH2 S;  4DL5 A;  2F4F A;  1Y4Z B;  2X1G A;  1LKZ A;  1E6V A;  3ENQ A;  4ILM A;  2IYG A;  4ECU A;  5EX3 A;  2B51 A;  1LK7 A;  1FXL A;  2QL5 B;  2JHE A;  2YKM A;  4M5H A;  1ARO P;  3OR1 B;  1UAW A;  2YKN B;  4JV2 A;  1FWL A;  3D6T B;  1L3T A;  3X1L B;  3DHX A;  2HNY A;  1RAJ A;  1S59 A;  3D66 A;  2GQQ A;  3J7Y U;  4TLQ A;  4DQR A;  2ZH2 A;  3BBC A;  1JWW A;  4QIW D;  2A0F B;  1QY7 A;  4CI0 B;  3V81 B;  3ISN D;  1U7L A;  5BJR A;  3QAE A;  2IMO A;  2AX1 A;  5KFA A;  2RHQ B;  5KFL A;  1EP4 B;  1SKU B;  4C8M A;  3CD6 S;  2DNZ A;  4CLY A;  2VL1 A;  5F9L A;  3JB9 k;  5CA5 A;  4K4U A;  2CRL A;  4UF4 A;  2QG9 B;  4DI6 A;  1UFL A;  4LR7 A;  2JWN A;  1WHW A;  1F0X A;  5DGA A;  3BO2 A;  3TI0 A;  4QU7 A;  3AQO A;  3PNI A;  3QT5 A;  3V6D B;  2FJX A;  4NLW A;  1IJE B;  2MQL A;  1NAQ A;  2V8G A;  3MAQ A;  4DV7 F;  2B8Q A;  1VFJ A;  2RE1 A;  3JSB A;  4EMD A;  1EHW A;  3NOG A;  4MKA A;  4DX5 A;  1U1R A;  2CQB A;  3D7S B;  4JV5 J;  3MOJ B;  1U1Q A;  1H38 A;  1S1V B;  3AJ1 A;  3CDW A;  2EI5 A;  2MKH A;  3H5Y A;  4EBD A;  3IS9 A;  1E6Y A;  4PXB A;  5A6W A;  1FJG F;  3JQJ A;  4AE5 A;  3P6Y C;  4EZ6 A;  2CG4 A;  2LXF A;  5F8J A;  1U1P A;  5B0E A;  3PW7 A;  1QLN A;  3D6F B;  4M5G A;  3W64 A;  2D9P A;  1MW7 A;  1KQF B;  2PII A;  3LAK A;  2BA9 A;  1LQ9 A;  4LF6 J;  5D0E A;  3R27 A;  9ATC B;  3KLI B;  3CMQ A;  3IGN A;  1C1C B;  3TA1 A;  4Q43 A;  2CWX A;  3DOK B;  1TK8 A;  2VQF J;  1GT8 A;  3H42 A;  3Q8S B;  1U26 A;  2B4U A;  2MKS A;  1DTT A;  4TY9 A;  4CLF A;  2JC0 A;  4CLS A;  4ILR A;  2OPR A;  3HFZ B;  2FHK A;  1RT5 B;  4KYZ A;  1GQE A;  1NEE A;  4LF4 J;  3OD2 A;  3NXZ A;  2LDI A;  2RRB A;  1FWK A;  2P9C A;  1UKU A;  4HAC A;  1WF1 A;  3LQV A;  4ZVP B;  5KOW A;  2X7I A;  3AA9 A;  2MKY A;  4CZC A;  1Q81 T;  4IFY A;  1OYD A;  1EIY B;  3IBC B;  3LAN A;  5DQI A;  1W2I A;  5B0C A;  1HNW F;  1ZH5 A;  5GAH U;  4DSL A;  3RR8 A;  2FLO A;  2D9O A;  4K7Q A;  4IDK B;  5L46 A;  3U7J A;  1SQF A;  2K3I A;  1WHY A;  1YJR A;  2BJ8 A;  4NCB A;  4PZV A;  1HR0 F;  2QLX A;  5DGB A;  4NX9 A;  4F3Q A;  3I31 A;  1RAE B;  5AXM A;  1UZD A;  1OO0 B;  3C46 A;  3DRR A;  4TXS A;  1G6B A;  3K59 A;  3CME S;  2DNM A;  3POT B;  1WG4 A;  3FSX A;  3CF5 Q;  3C14 B;  1VS3 A;  4ED3 A;  3H4B A;  4KR0 B;  2ZJQ Q;  2KFY A;  2ILZ A;  2DH7 A;  4M5D B;  3CJR A;  3DMJ A;  1XTZ A;  5C2C A;  4O44 B;  2RS8 A;  2YY3 A;  1XIQ A;  1IBL J;  5L38 A;  5A8R A;  2YNG A;  1S6O A;  2DR5 A;  4PCQ A;  1OY8 A;  4XPC A;  2ZH5 A;  2JVO A;  2VC1 A;  1J5O A;  2B4P A;  1MN7 A;  1B7Y B;  3I9Z A;  1UVI A;  1RAO A;  2F40 A;  5KFB A;  3I55 S;  1EZZ B;  5HRO B;  1HPZ B;  3MM6 B;  3GR0 A;  4ZPD A;  4CLT A;  1Y5L B;  4P2S A;  4Y2C A;  5KFK A;  5LSL A;  2DEJ A;  3QRR A;  5JMN A;  2MGZ A;  2QFJ A;  2YPZ A;  1LV5 A;  3ILJ A;  3NS5 A;  2OJ3 A;  1JJH A;  4FYV B;  2QMX A;  2VDI A;  3M2R B;  5BYS A;  2IVM A;  4YDD B;  1FRL A;  1S6P A;  3L09 A;  1WC4 A;  3L4B C;  1VQ4 S;  4IUF A;  4ZCK A;  2GAG C;  4LSL A;  3B8H A;  3KLF B;  1AT1 B;  2DHX A;  4QQB A;  2OEK A;  3D54 A;  1N5V A;  4F25 A;  3KK1 B;  3KK2 B;  4DV5 F;  4ES3 A;  2BOP A;  4QU6 A;  1FES A;  5B0B A;  2DIS A;  3FEY B;  3UN2 A;  3JQM A;  4P52 A;  4PWU A;  2KL8 A;  3H5U A;  5KFR A;  3UW1 A;  3ZFV A;  3CCR S;  4K4T A;  3THP A;  3OLB A;  4HL9 A;  4DR4 J;  3QIP B;  1B4S A;  1QVF R;  3A8J A;  2D74 B;  2NSB A;  1XJW B;  2LEP A;  4M5N A;  3D0I E;  1NCL A;  5L9X A;  4WZM A;  2VBY A;  4EYI B;  3GYN A;  4OX9 F;  3Q8U A;  2CPF A;  2VC0 A;  1RBO B;  4KTQ A;  4X62 F;  4JI1 J;  1S1V A;  1ZM4 A;  3CMA S;  3AXM A;  4ZJO A;  2C2R A;  1RCX B;  2MQM A;  1A0O B;  2P5V A;  2C2M B;  4DFM A;  1PSD A;  4E2F B;  3K5L A;  4V1A k;  3EDQ B;  1X4G A;  2U1A A;  2HLU A;  2DRA A;  3FFI B;  3WHI A;  2K3K A;  4YB6 A;  1UPP A;  4JI3 J;  1HQU A;  2DGW A;  4AYB D;  1O6X A;  2XEX A;  2ZEJ A;  4EBC A;  2LKZ A;  2BQU A;  2B4V A;  3UI3 A;  3K5O A;  3QFW A;  1BWV A;  4OJG A;  2HEK A;  4NYZ A;  3HXM A;  1OWX A;  2OLW A;  2WZ1 A;  3IG1 B;  3BDE A;  4PQA A;  3PIP Q;  4TU9 A;  3SYZ A;  3KKF A;  1QE1 B;  3HO1 A;  2BJE A;  1MN9 A;  1RT5 A;  3T1Y F;  4W98 A;  3CJS A;  3NL0 A;  1DFD A;  4PG8 A;  5IV4 A;  2HHH J;  3BKT A;  4WYL A;  3NMR A;  5A2Q U;  2MZR A;  4A8M P;  1HWU A;  4ZVO B;  1N8R T;  1U1N A;  3HLU A;  3TOQ A;  2MLY A;  1QDU B;  4YY3 F;  5JVG Q;  3R7S B;  5F0U A;  2QL7 B;  1S99 A;  2IY5 B;  2IRX A;  3TZX A;  4NEY A;  3DC2 A;  2DT9 A;  2R8K A;  4DF4 A;  1KN6 A;  2QO3 A;  1FKP B;  4O3Q A;  4KPY A;  4CO5 A;  1DQA A;  4MT1 A;  4DUZ F;  1KHW A;  1VC5 A;  2F9J A;  1EQ0 A;  2B9E A;  3V6K A;  4M5D A;  3BR8 A;  2AYM A;  3QT6 A;  3BGF A;  1GFW B;  2N82 B;  3VVU A;  1FO1 A;  2G2Y A;  1N4L A;  2UXC F;  2ZM6 F;  1YJU A;  4CCH A;  3O6Q A;  3U1N A;  2MKK A;  2X1B A;  3R5D A;  3OLA A;  2BJD A;  4DX6 A;  2C2Z B;  1Y5N B;  6AT1 B;  4YFU A;  2QC3 A;  3CW2 C;  4YR2 A;  1C4A A;  1WF0 A;  5HL7 Q;  2QL9 B;  4OZJ A;  4UUX A;  3LWL A;  1NDP A;  1M5K C;  1XEZ A;  4TLR A;  4AUK A;  4IG0 B;  2ZC3 A;  4R0E A;  5B0F A;  2I5J A;  2Y1I A;  2DGT A;  2FGO A;  1YZ7 A;  3HJV A;  1Y3J A;  1BE4 A;  2GHV C;  5K14 A;  2XLI A;  4BC9 A;  1LFP A;  5KG4 A;  3M2R A;  1RKI A;  3C66 A;  3BGL A;  1IWA A;  3JS9 A;  4KV8 B;  2W7P A;  1FNO A;  4ZVH A;  1S72 S;  3CB4 A;  2HRU A;  4R8U A;  4ZIT A;  2QT7 A;  2ZHO A;  2BAN B;  3TUI C;  4IOA Q;  5EWG A;  4MK7 A;  4Y28 C;  1T94 A;  1PAE X;  4Q5V A;  2OH2 A;  1VC0 A;  3J80 U;  1XNR F;  2FY8 A;  1IUJ A;  2CPZ A;  2W01 A;  3DDI A;  2KYX A;  4ECZ A;  3BS9 A;  5J2M B;  4F67 A;  3PFE A;  3MAA A;  2FYX A;  2I6W A;  3AHP A;  4C0O C;  1U6F A;  2HIY A;  3Q24 A;  3DLK A;  4WII A;  1OPI A;  3D2W A;  4CLK A;  2HFZ A;  3KK3 B;  1LFW A;  3G6Y A;  3EDR B;  1N88 A;  4X4N A;  1VDH A;  2HQD A;  4DCP B;  4ID8 A;  4CM2 A;  3M9M B;  4NYO A;  2Q6C A;  1FD8 A;  1LWC B;  1S7I A;  1ZZN A;  2MQN A;  3DGP B;  3MTJ A;  2J0S D;  4K4V A;  3HHL A;  5LMU J;  1JIH A;  2WHO A;  1JLF A;  4QWB A;  2HK3 A;  4P75 A;  3H7H B;  1FRJ A;  1C0T B;  1N32 J;  4C3L A;  3UDE A;  4KGZ B;  4AL6 A;  4XO0 A;  2Z30 B;  3ZTR A;  1S57 A;  4ZPB A;  5LL6 d;  3QRP A;  2OTJ S;  4JI6 F;  2E44 A;  1YJT A;  3M8P A;  2HZA A;  4I56 A;  1M1G A;  4IR9 A;  1UVM A;  4C0H A;  2JOQ A;  1IKW B;  4IQX A;  4O3N A;  3GPA A;  3V5R A;  4OFZ A;  2ZZN A;  4Y2K A;  2XHW A;  3RGI A;  3VAK A;  5RUB A;  4ECS A;  2XCA A;  1NJY A;  3HHD A;  3ILL A;  3D0G E;  2K06 A;  2DGS A;  3LTO A;  4LR8 A;  1TUW A;  2BEF A;  2HBQ B;  1FER A;  3MMB A;  1FFS B;  4XIU A;  1U1K A;  3TQ1 A;  3MM9 B;  2VD3 A;  4O3S A;  3ZZU A;  2ERR A;  3MMC A;  4RZR A;  2UXD F;  2VG5 B;  5CHC B;  1WEY A;  3PXG a;  3J81 j;  3NBP B;  1MWY A;  4DN0 A;  3PY8 A;  3CJ2 A;  4DV0 J;  3MMA A;  2Q3P A;  5AE1 A;  4RNM A;  4A8W A;  2XS2 A;  4Q8E A;  2RKI A;  3A3P B;  1JX4 A;  2ZDO A;  2HHU A;  1FKA F;  2J0W A;  2DO4 A;  4WZQ A;  4U6P A;  4ICL A;  1IBM F;  2VKZ G;  1HBM B;  2UUB F;  4F3O A;  3QMQ A;  3AD7 C;  3V4M A;  2KVQ E;  1U49 A;  7FDR A;  4ED8 A;  1F2H A;  2AHO B;  2E5J A;  1S1T B;  2IJF A;  5A0Y B;  2UXB F;  2HHP A;  3LP2 A;  1F9F A;  1Y10 A;  2VUG A;  2AZ3 A;  1RHU B;  1FRK A;  3DM2 B;  3MXH P;  4PR6 A;  4BCA A;  2BM0 A;  3LA0 A;  2E9R X;  3TRG A;  3K7R A;  3W60 A;  3FCH A;  4LUB A;  5H1S V;  3D3B J;  1RT3 A;  4K4Y A;  5DZ6 A;  2KHD A;  1Q5Y A;  4QYZ J;  3LO3 A;  4DF8 A;  5A8W B;  2RVJ A;  5KFF A;  4J9N A;  4BLG A;  2LU1 A;  2V69 A;  1TK0 A;  2N3L A;  3TA2 A;  3DOM B;  2KG1 A;  4JI7 F;  4DL3 A;  1S76 D;  2EKN A;  1PO6 A;  3O1L A;  5KAK A;  2FC9 A;  2BE9 B;  2GIR A;  3UDL A;  1KFD A;  2ZIT A;  2NR0 A;  1RTD A;  4LVO P;  1Y00 A;  2JLF A;  3ZZT A;  3T5J A;  5LOQ A;  3V4I B;  4PWD B;  1HL6 A;  5H9E J;  1GMU A;  1TL3 B;  1YKW A;  3N6M A;  2IJR A;  1P1T A;  3SCJ E;  2XYP B;  3MM7 B;  4NLY A;  5DG7 A;  1HNV A;  1BC6 A;  3HMJ G;  3OFE A;  5J2N B;  1K1Q A;  1NPK A;  1HBN B;  3EVM A;  2LFV A;  4HHJ A;  4L3K A;  1J5E F;  1X0F A;  2BAN A;  1YJ9 S;  3VAM A;  3ZTO A;  2F9D A;  1YIJ S;  2IC3 B;  1LWF A;  3N6N A;  2HYI B;  2HQF A;  4WYW A;  3I0R B;  1WOP A;  5IZH A;  3I82 A;  4HKQ A;  2NUH A;  4FS1 A;  3ETM A;  3HD2 A;  2YBV A;  3NNC A;  4ED6 A;  3AOB A;  4NZ6 A;  3TX8 A;  3N4W A;  3MEC A;  1NO8 A;  3IWX A;  1OYE A;  3DLB A;  4LFA J;  1N5Q A;  4F04 B;  2FJD B;  3GQC A;  2BUN A;  1U45 A;  4YB1 P;  4OV1 A;  5ETT A;  1KC8 T;  1SC3 B;  2IMW P;  4BWJ A;  3KMS A;  1U47 A;  1XN9 A;  4JI0 J;  5J1E B;  4B3R J;  1VJW A;  1IBC B;  1SJF A;  2VG7 A;  2ZE2 B;  1LWC A;  4USV A;  2V5H G;  3M8Q B;  1VBZ A;  4F4Y A;  2VG6 B;  1UVJ A;  3TUJ C;  4GVL A;  3MR6 A;  1RT2 A;  4DV1 J;  5ETO A;  2UU9 J;  1S9E B;  4RKU C;  4X65 F;  3A3O B;  5KG7 A;  1NSQ A;  2VV5 A;  4FXW A;  3TJ8 A;  4LF1 A;  2QE5 A;  1WG5 A;  3KHL A;  2OEL A;  3NGR A;  2KH9 A;  5CYM A;  2FD2 A;  3S1T A;  2F3J A;  3NGT A;  1IM4 A;  3NGD A;  3NWR A;  2KKH A;  2WAQ D;  3ZTS A;  5ITH A;  4B9V A;  2BKN A;  4Y6I A;  3ZZP A;  1JLB A;  3OSN A;  3VZI A;  2N3O A;  2BYC A;  1UEU A;  3JAM U;  5KFC A;  3D1Q A;  4P9S A;  2B8P A;  3EGV A;  4ENO A;  2QTW A;  1NDK A;  4L74 A;  1JLA A;  2MHE A;  1FE4 A;  3UCU P;  3OQ2 A;  4C11 A;  4DV3 J;  1TKX B;  1HHQ A;  3B4D A;  2DNH A;  3NBP A;  4ECQ A;  3GIR A;  1V9O A;  1WOR A;  2B5J A;  5CZX A;  2WOM A;  4CLU A;  4BBY A;  2CQ4 A;  2RRN A;  4O3P A;  3UO0 A;  3FC9 A;  3IR6 B;  2VBX A;  1RKJ A;  4ATN A;  3SIP B;  2P9G A;  1F1B B;  2ZBQ A;  4IRD A;  1RT6 B;  2Z0G A;  3C2P A;  3IR7 B;  1ZM3 A;  5KG2 A;  2M3D A;  3H2V E;  1G7C B;  3RRK A;  5KFD A;  3KJV A;  2GFF A;  3HCX A;  1FVQ A;  4KO0 B;  2NXJ A;  1YRT A;  4ECT A;  4P72 A;  3C6T B;  1C1B A;  2HZC A;  2ZFH A;  3VGT A;  1AZS A;  2K8G A;  3MHY A;  3GSI A;  4OYX A;  2XGQ A;  5JUM A;  1UA1 A;  2E9Z A;  5A8W A;  1RI7 A;  4X66 F;  5KOX A;  4DQS A;  3BBB A;  3WC2 A;  3KLH A;  4FKY A;  4DR7 F;  1F60 B;  3EGZ A;  3QAT A;  1S0O A;  4C8Z A;  4HI2 A;  4BS2 A;  4A8K A;  1QM9 A;  3EE3 A;  1FFG B;  3M6V A;  2GCF A;  2DNL A;  1S6U A;  1Q16 B;  4QYZ K;  4OI3 A;  3ITH B;  2WSC C;  1N6Q A;  3EMT A;  2LCW A;  4X2B A;  3J81 U;  3VHQ A;  1AYE A;  2MLX A;  2KRR A;  5D77 A;  1TR0 A;  1RWV B;  2FC8 A;  2ADB A;  2KRB A;  4FNI A;  1EKS A;  1MML A;  1KQS R;  3S01 A;  2UVV A;  4QIF A;  1PCA A;  2D3Z A;  2LLZ A;  3I4H X;  1YI2 S;  4PWD A;  4QR1 A;  3WQP A;  1Q53 A;  1N33 F;  3G6X A;  2WW4 A;  5C2G A;  1Q95 G;  4I2P A;  3BKF A;  4F50 A;  4J9Q A;  2HNZ A;  4RLE A;  4B9M A;  1HBN A;  5F8H A;  5H9E K;  4CO4 A;  1R0A A;  1VBY A;  1CJV B;  3SV4 A;  1VIS A;  4EFA C;  4JI4 F;  4DBQ A;  5HP1 B;  4DG1 B;  2GVZ B;  4OYA A;  3T5L A;  4DU8 A;  3ENW A;  5A6P A;  2DPJ A;  2HGN A;  3I0R A;  4RW8 A;  4DZD A;  3ILO A;  1L3K A;  4X4Q A;  2WON B;  2AJ0 A;  4FYX B;  4N8N A;  2GA7 A;  2CJA A;  4ANE A;  2PT0 A;  5L9N A;  2UUA J;  2VPW B;  1ZAV A;  2G2O A;  4Z2X A;  2QEX S;  5KG3 A;  2CQ0 A;  4Z7Y A;  1DLO B;  2RF2 B;  1UFW A;  3PHT A;  4NLT A;  4WTO B;  1R8P A;  2RU9 A;  5HMX A;  3Q86 A;  1H74 A;  4PXE A;  3MEG A;  5J1E A;  2BX6 A;  3VAH A;  5DDP C;  3VAG A;  4N8O A;  1F2G A;  1WSV A;  4YUD A;  3U02 A;  3PJX A;  4KHP J;  2VB6 A;  2ZE2 A;  1X5T A;  1QD1 A;  2FGC A;  2LQ8 A;  4EK2 A;  2LA4 A;  2VG6 A;  4KC5 A;  4HYK A;  4FNH A;  3MPV A;  4OYZ A;  3DGV A;  1WOO A;  2R2T A;  4PAB A;  4IQM A;  3BF4 A;  3WDO A;  4YOE A;  4ECY A;  3I32 A;  4XTT A;  1S9E A;  2G1D A;  3P96 A;  2BW7 A;  3LUY A;  3M2V A;  1S0N A;  3P3D A;  3X3U A;  4YB5 A;  2RQM A;  3MR3 A;  2DGX A;  2W1B A;  3FKB A;  1K73 T;  3FEX B;  2AJ2 A;  3MPU B;  4USU A;  1EAR A;  2AEM A;  1NHV A;  2CQI A;  4N7T A;  4NPO A;  2W2P P;  2OFH X;  3IAS 9;  2JEG A;  2AV5 A;  1N54 B;  5BYR A;  2VF3 A;  2LEA A;  2ATC B;  1VHI A;  3I56 S;  1TTH B;  1DBD A;  4G1I A;  4U9R A;  3MD3 A;  2FUG 9;  2XTJ P;  1Y9O A;  4DL6 A;  2KN4 A;  2EC2 A;  1OSC A;  4B3S F;  2JZ5 A;  1RSC A;  1H2U X;  3QSY B;  2GGP B;  2Z4P A;  4NAS A;  4CO1 A;  3CO9 A;  4FS2 A;  1YQH A;  4AQY J;  2V94 A;  1ROF A;  2M4M A;  5ETN A;  5A8K A;  3NEK A;  5F8G A;  4Y2I A;  3CDB A;  1CEZ A;  4DV7 J;  1IR1 A;  2AGO A;  1KWM A;  3IMQ J;  1KFS A;  1HKA A;  4UOG A;  5CXT A;  1URR A;  4X64 F;  4DX7 A;  2CJB A;  4MIW A;  1L5U A;  3KJF B;  4MKY A;  3EGN A;  1W25 A;  3GIL A;  1M90 T;  4DOZ A;  3DU5 A;  2YQ0 A;  3C16 B;  4ZVF A;  4USI A;  2J8A A;  2A1B A;  4RW9 A;  1OQ6 A;  4P2M A;  3QFH A;  1WNE A;  4UST A;  5CCM A;  3GU0 A;  3K5M A;  3PKY A;  4OHW A;  3SSQ A;  3Q2T C;  2Z2Y B;  4QIV A;  1XNQ F;  2HQI A;  2R8G A;  2ZH4 A;  1GMW D;  4ZLL A;  1LWE A;  2Z2M A;  2DYA A;  2Z57 B;  3MED A;  2A2C A;  4J9O A;  3W2V A;  4UY8 T;  4HVZ A;  1FX4 A;  2CQP A;  2QLF B;  3R5B A;  3SQO P;  2DH9 A;  3LP0 B;  4WFA Q;  3QWU A;  3UD5 A;  2QGF B;  1VRU B;  1KTV A;  1RGV A;  2H3E B;  2V8V A;  3QLH B;  2NQP A;  3I6P A;  2M5Y A;  1SL0 A;  1MMD A;  1HYS B;  2XLK A;  1S10 A;  2XY5 A;  2O67 A;  3ZTQ A;  1UJ5 A;  5C25 B;  2MQ8 A;  3D28 A;  5KFN A;  2ZJR Q;  4LIW A;  3EGW B;  5F3T A;  1RTI A;  3SQG A;  2XUL A;  4GC6 A;  1PBA A;  3H5X A;  1SJ3 P;  4WE1 B;  3NGK A;  3A8I A;  4IOB A;  2HFN A;  3KJN B;  4CQ1 A;  3GV7 B;  3DLL Q;  2DCL A;  3A4T A;  5D8H B;  4HTI A;  1EJ7 L;  3BH6 B;  1TFY A;  1FXR A;  1HFE L;  4U7U D;  4WTY A;  1HI1 A;  1HNW J;  1U0S A;  2KI2 A;  2H5I B;  4QOT A;  3PW0 A;  2Q66 A;  1IQT A;  3VV2 B;  5CYQ B;  4PXD A;  1CJV A;  5KG1 A;  1SH2 A;  4QBU A;  5K8O A;  1HR0 J;  3AXK A;  4DPO A;  2W7A A;  2GVZ A;  3BH7 B;  4TQS A;  3V6J A;  3N28 A;  2HVD A;  2B7B B;  4CH7 A;  2FJA B;  1H7X A;  2BMB A;  2IRU A;  2ZZT A;  1F9E B;  1YSJ A;  2BDP A;  3K89 A;  3UE2 A;  1X8D A;  4KFB B;  5EDW A;  3G82 A;  2VON A;  4ZVS B;  5E3P A;  4F4X A;  3KLE B;  4OLP A;  2GQC A;  2ZH1 A;  1AUD A;  1RAF B;  1DLO A;  3TVY A;  2PFD A;  3TR5 A;  4OQJ A;  1ZM9 A;  2HW3 A;  4I69 A;  2HG4 A;  2BQ3 A;  1NB7 A;  2W9C B;  2V2V A;  1G1X A;  5IV3 A;  4RNO A;  2G1H A;  2ALZ A;  3VAI A;  2ZDP A;  2BW2 A;  4ZVU B;  4ZKA A;  2VJU A;  2R3V A;  5D4N A;  2AYG A;  4Q0B A;  5BYQ A;  1S1U B;  3K17 A;  1HIY A;  3RRG A;  1I51 B;  2B6A B;  1KDN A;  4GO5 X;  2ZVS A;  5KG5 A;  1RB0 A;  2OGU A;  4PUO A;  1T3N A;  2NXC A;  4X4U A;  1HNI B;  4QJV A;  5FII A;  2L08 A;  1UW4 A;  1V5I B;  2HHS A;  4DV2 F;  4PYD A;  3GSD A;  2XCP A;  4ETZ A;  1HQE B;  2L9N A;  1DJ0 A;  2K7J A;  4Q7A A;  4QPX A;  3OVA A;  1JLQ A;  4USK A;  2D3O 1;  2CUY A;  3PKM A;  3W2W B;  3PW2 A;  2DY1 A;  2E5G A;  4OZL A;  4KJI A;  4HDG A;  4OV6 A;  1P8G A;  2KM8 B;  1K8A T;  3QO9 B;  3BBF A;  3FCW A;  1VLO A;  3GTY X;  5C7P A;  2GHP A;  1YHQ S;  2H5E A;  2A6O A;  1HA1 A;  4WU2 A;  4K4W A;  4ZVT B;  1X4H A;  1NK9 A;  4IG3 A;  2G9O A;  1JK9 B;  4B9U A;  2YNF B;  1NB2 A;  4M5I A;  4ZN1 A;  2FVP A;  2GGP A;  4N76 A;  3CTR A;  4USM A;  3NCQ A;  1T03 B;  1TV6 B;  5HQM A;  5I42 A;  4DXL A;  5J2Q A;  4FF2 A;  2X51 A;  3AB2 B;  2VBW A;  3TP2 A;  1RXO B;  4RW4 B;  1XMB A;  2JFD A;  1SJ4 P;  3DLE B;  1VQY A;  2RS2 A;  4GO7 X;  2EKY A;  3LGH A;  9RUB A;  1NND A;  3I96 A;  5IM0 A;  4A48 A;  2G0C A;  1D8Y A;  4J91 A;  3KUH A;  4OX9 J;  1KD1 T;  5KFZ A;  1HW8 A;  4UTG A;  2DGQ A;  3OXG A;  1DZ5 A;  1NJI T;  2EFG A;  2DNR A;  4NOH A;  3OW2 R;  1R6V A;  4Z7C A;  3DRY A;  4OI2 A;  2CNL B;  4ZLP A;  4NLQ A;  4I2Q B;  2YX1 A;  5LMN F;  3DI6 B;  3CUL A;  2RHS B;  2C3U A;  1R3N A;  2WSF C;  4FBU A;  1IWG A;  1KRP A;  4QWE A;  3BSN A;  2H5J B;  1R0B G;  5KFO A;  3BSO A;  1KLM B;  1EKR A;  1YBA A;  2R7R A;  2IM3 A;  2B7C B;  3OTO F;  3HT3 A;  1RT7 B;  4FYY B;  4U8Y A;  3MD1 A;  4G1Q A;  1S48 A;  2IRY A;  3ET6 A;  4B3M F;  3IA0 A;  2GS8 A;  5HJY A;  1FXD A;  2EFV A;  3MEK A;  2I2Y A;  3OT9 A;  1ZZF A;  2Y0B B;  5HI7 A;  1FRX A;  2PE8 A;  3OV7 A;  3CJ0 A;  4XPE A;  2DVI A;  5KFY A;  5DLG A;  4FXV A;  2UP1 A;  3DFE A;  3T1Y J;  4ZPT R;  1SJ1 A;  1V3R A;  5DRK A;  2MY7 A;  1V3Z A;  3W61 A;  2OSR A;  3M2U B;  5T7L B;  1SKS A;  2HAI A;  3TYT A;  3HZG A;  3MFI A;  1FKO B;  3LGM A;  1KOO A;  1VQM S;  1VQ8 S;  5CYQ A;  2FVC A;  3IRX B;  1WKK A;  1XER A;  2HWH A;  2OIH A;  4JV5 F;  3EYZ A;  5KFH A;  1FI4 A;  3CJ3 A;  1S97 A;  4YQW A;  3EZ5 A;  4F8R A;  2OSQ A;  2DH8 A;  4ES1 A;  5KFJ A;  1Q86 T;  3M6W A;  4EO6 A;  3TVK A;  2YXL A;  1UEV A;  1A9N B;  4M5K A;  3AD8 C;  2E66 A;  4X4V A;  3KLE A;  4KE5 A;  2C22 A;  1CBK A;  4CO0 A;  3M8W A;  4B9T A;  3AT1 B;  1HD1 A;  1T7P A;  2QIF A;  2EWH A;  3TUP A;  3T1H F;  1U2F A;  2GNK A;  1VMB A;  2BKO A;  4ETX A;  5IT4 A;  1KON A;  4LQ9 A;  1MG7 A;  1B7F A;  2COL A;  4GVB A;  1F3F A;  2OO4 A;  2MJU A;  2C2E A;  3HD1 A;  3DCA A;  2W4C A;  1SBR A;  3ETO A;  3O5T B;  3MUR P;  2HNY B;  2H9Z A;  4ED7 A;  3C15 A;  4LR9 A;  4LF4 F;  2LVW A;  1YK9 A;  2M9K A;  4YB7 A;  4OZ5 A;  4ECV A;  4QZV B;  5IC4 B;  3Q83 A;  1ITP A;  3TNV A;  1DTQ A;  1VI7 A;  2OFG X;  4F0K A;  3ZXW A;  1U1M A;  3R5G A;  1HQE A;  4NLO A;  2P6S A;  3MGJ A;  4ZJQ A;  4ANC A;  3T1A A;  3IXQ A;  5ETV A;  4JI5 J;  4RR5 A;  1RLC L;  3L95 X;  4ILL A;  4EU0 A;  3Q8Y A;  1OMS A;  1N56 A;  1RWU A;  2DNK A;  3GG0 A;  3KXD A;  3NLC A;  2M70 A;  1N48 A;  1GEH A;  1VGY A;  2V4J A;  3PCO B;  3OHB A;  2YWH A;  4LF9 F;  2AGP A;  1MRO A;  6FD1 A;  2DNG A;  2ZBC A;  2DIV A;  4WWS A;  1UWB A;  3L9Z A;  5DM7 Q;  2Z58 B;  4KB7 A;  2YWG A;  3CD5 A;  5E3C A;  1N36 F;  1Q82 T;  1N34 J;  2OMO A;  1IBL F;  2ZC4 A;  3I0S B;  4X84 A;  1SUQ B;  2DR7 A;  3RB4 A;  1N5S A;  2JNJ A;  1APS A;  1OY9 A;  1E6Y B;  4ZPW R;  3HSG A;  2RDD A;  1QAI A;  3SCL E;  1OQ3 A;  2J76 E;  1FRI A;  2AT1 B;  4K2J A;  3NS6 A;  1CQM A;  3WBZ A;  1VIO A;  4F36 A;  1ZTT A;  4KKO A;  4OL8 A;  1T8E A;  1IKX A;  2YX4 A;  2CAJ A;  1ZA1 B;  2BZ2 A;  1WC1 A;  3MPW A;  2VFR A;  1KVK A;  2E7X A;  4F26 A;  4JI6 J;  1RAD B;  3OTD A;  3R6G B;  1F6T A;  2MZQ A;  2GHW A;  3L3C A;  4KT0 C;  4FYW B;  3MR2 A;  1I94 J;  2QSW A;  1KLM A;  1RWK B;  2Y1R I;  1DTT B;  2C1E B;  2CPH A;  2OPR B;  4NXN J;  5KG6 A;  2FJV A;  2I38 A;  3QGH A;  1MMN A;  3HT0 A;  1CJK A;  1SV5 A;  1U0H A;  1VQN S;  1DQ9 A;  1MU2 B;  1S4F A;  4O3R A;  2POK A;  4HAC B;  2QMW A;  2QFI A;  4NLR A;  2AJQ A;  2DGV A;  4ER8 A;  2F65 A;  3Q8P B;  4IFY B;  1S0V A;  1I5O B;  4ZK7 M;  5FD1 A;  2JLE A;  3W5Y A;  1PYS B;  2YWK A;  1Z1Z A;  3D9B A;  1GAO A;  2UXD J;  5FLX Y;  1FF2 A;  3T6B A;  2DKO B;  1U48 A;  3M2U A;  4IFV A;  4KHM A;  5T7L A;  3H20 A;  1R27 B;  3KDN A;  4RU9 A;  1AA1 B;  2FVQ A;  1JJ4 A;  1R8H A;  1JXL A;  1D0E A;  1IBM J;  2UUB J;  3PM9 A;  4RWW A;  3TA0 A;  3IRX A;  3PO4 A;  3W9I A;  2GV1 A;  4J9P A;  4JI1 F;  1GK8 A;  3EPG A;  5K8M A;  2HPU A;  4QW9 A;  2UXB J;  4TY8 B;  4TKT A;  4RUC A;  1ZAW A;  2VU5 A;  2R8I A;  2DO0 A;  2YNG B;  1BQX A;  5GMD A;  2FZG B;  5HAN A;  2GJF A;  3MWB A;  2WVE A;  1AW0 A;  3Q0A A;  3PW5 A;  1X5P A;  4A47 A;  1J5O B;  1FDA A;  4JI3 F;  1N0V C;  1BY9 A;  1V3S A;  4RL1 A;  3BYR A;  4YME A;  4DMZ A;  3UPF A;  1PYO B;  2EVZ A;  5KFS A;  1S7H A;  4DV6 J;  2B9Y A;  2NZC A;  2MZT A;  4HHU A;  4MAK A;  5CAA A;  2XS7 A;  1JKH A;  1W2B R;  1F5A A;  2LYV A;  3PVX A;  4JI7 J;  4A46 A;  3KG0 A;  2MGZ B;  1JXE A;  1T11 A;  3RAQ A;  4YEA A;  4LIR A;  2FHM A;  4DR1 J;  2HHV A;  3R6L B;  4O0I A;  3K0J A;  3BSC A;  1S6P B;  3G96 A;  2OEJ A;  5F3Z A;  5B7W A;  4UQG A;  2ACY A;  5HBM A;  2R7Q A;  4LSL B;  3RU0 A;  2HHH F;  3H0P A;  4LJM A;  2UUC J;  2HKE A;  5AJ3 F;  1L3U A;  3W8G A;  1NK6 A;  1RBA A;  2X3G A;  3BZQ A;  4OI4 A;  2KYZ A;  4N77 A;  2ACM A;  4AND A;  5SZT A;  4B3T J;  2BQR A;  5D6G A;  1NK7 A;  4YR3 A;  3BN7 A;  4X4P A;  3PFO A;  3OHA A;  2XWX A;  4EZ9 A;  3KG4 A;  2N7Y A;  2WVB A;  4IRC A;  2QLB B;  4NEZ A;  3M8Y A;  3B78 A;  3HHL D;  1FTC A;  4J7C A;  1TL1 A;  4NXM F;  1LW0 B;  1XMO J;  2CDR B;  1TL7 B;  2CQD A;  1M0S A;  3JSM A;  4OX7 A;  3U1M A;  2HBY B;  3I0S A;  3M6U A;  3G71 S;  4URQ U;  3P5B P;  1SUQ A;  2IPO B;  4K8R A;  2E1P A;  5ADZ A;  4LFC F;  1Q79 A;  1PYT A;  1QTN B;  2OPP A;  3N0V A;  4B3O A;  3NRB A;  1FVS A;  5CD4 A;  1UL3 A;  2W24 A;  2Y3Y A;  2BE2 B;  3CT9 A;  1SH3 A;  1IBK F;  2K2P A;  4ZA1 A;  3M9N B;  2MDA A;  1IJF B;  5EGY A;  4HR2 A;  3ZZR A;  4ZVG A;  3HSD A;  1HQU B;  3BGO P;  4ZCM A;  4KIA A;  2OPS A;  2HQC A;  3GR1 A;  3DLJ A;  5HVG A;  3QRQ A;  2ADC A;  5GAG U;  2OD4 A;  1U2R A;  3CGI A;  1VHF A;  5IWA J;  4D3H A;  4N56 A;  2RD5 C;  4AXI A;  3T6J A;  2JH3 A;  4M8L A;  1TKT A;  3KHR A;  4WU3 A;  3K5N A;  4I1T A;  3HHN B;  1J27 A;  2CIM A;  1VRT A;  4TVA B;  3QT7 A;  2J9C A;  2HZV A;  3BGR A;  4UOF A;  2DXD A;  2EEY A;  5KFU A;  3FBC A;  1MU2 A;  1RUS A;  2ROG A;  1FA0 A;  1Q7Y T;  3EXY A;  2X3D A;  2GC8 A;  5KFE A;  2LDY A;  4EBE A;  3PJW A;  3KNG A;  2CPI A;  4UUW A;  1TQL A;  4PQU B;  2V4R A;  4WFX A;  3S6E A;  1SPB P;  1SJQ A;  3TAP A;  4ZJL A;  2CQG A;  5C24 A;  5D3G A;  4Z37 A;  2W9A A;  4M5J A;  2ZNY A;  2A3J A;  3U1L A;  4DZ6 A;  1IR0 A;  2A18 A;  4NA2 A;  2VFT A;  3ZZ0 A;  3WX4 A;  2HBZ B;  1Z4U A;  1IQZ A;  5DG8 A;  3K5P A;  2C2N A;  4JYA J;  2CZ9 A;  2EXU A;  2RUG A;  2R4F A;  4ZVQ B;  4NMX A;  3PG9 A;  1I6J A;  4WF9 Q;  1CJU A;  4TY8 A;  4LF5 J;  1N32 F;  2PI5 A;  4RUH A;  2CKW A;  4W4M A;  3PJ9 A;  5ETM A;  2WTF A;  1B0P A;  4KBI A;  2KT5 A;  1EB0 A;  1RZM A;  3KWM A;  4DFP A;  2CFX A;  1IR2 A;  2GMH A;  3H4D A;  3QBC A;  3M05 A;  3MCO A;  2XGP A;  4YHH J;  2NLW A;  5MAO A;  4KRW A;  2I9S A;  4X66 J;  4QW8 A;  4LQ3 A;  4DR6 F;  1WC0 A;  2XNQ A;  4DR7 J;  4DDF A;  4Q2M A;  2CPE A;  3CCU S;  2I5J B;  5CCL A;  4LBP A;  3B6B A;  3CVK A;  4ECX A;  3CCW A;  3CDA A;  1X4B A;  5K14 B;  3UFC X;  2H54 B;  2VPZ B;  5DDR C;  2WRM A;  5IT9 U;  3TAM A;  1KNZ A;  4P73 A;  2FHJ A;  1B0V A;  2LQ5 A;  2E1R A;  3CJK A;  3ZTP A;  4R8U B;  4KY3 A;  3RAX A;  2XI2 A;  4WKR A;  4DV0 F;  3J7A 1;  4LRB A;  1RTJ A;  4H4K C;  2WSE C;  2IIH A;  3DRS A;  4NCA A;  4NLU A;  2QYC A;  3LGN A;  3NWG A;  3A13 A;  2QJ3 A;  4ZS6 A;  5DET A;  1ZS6 A;  4I6A A;  2CWK A;  4NYP A;  2KVI A;  2KZZ A;  1VJQ A;  1QSY A;  4CT9 A;  1HLW A;  4USH A;  4P7V A;  3RB0 A;  3MAA B;  4QPT A;  1NSP A;  2BVZ A;  1F3V A;  2Q1L A;  5DDO C;  4LF7 F;  1P27 B;  3DLK B;  4JI2 F;  4ZIW A;  4JI8 J;  4UT4 A;  3T41 A;  3TZZ A;  3OR2 A;  4C7Q A;  1FRH A;  1Q8I A;  4J9S A;  3CJT A;  5J2P A;  4NI2 B;  2LU2 A;  2DNN A;  1LW0 A;  1TL7 A;  2FLP A;  1S9G B;  3GIJ A;  2CNO B;  4OHZ A;  2DEI A;  4A8Y A;  4Y34 A;  3CDU A;  4YDX A;  3WX8 A;  3HHL B;  4BC7 A;  1X7V A;  7AT1 B;  2X1F A;  4GKK J;  1JLF B;  1J2V A;  3V2U C;  3G4S S;  3M6X A;  4DPY A;  2V2Q A;  3A8K A;  5D4P A;  2QX0 A;  1RAA B;  4EUV A;  1TMJ A;  2BE2 A;  1NUE A;  4RW7 A;  3M8P B;  4P2F A;  3R5C A;  3SCI E;  1N5T A;  4P2X A;  1U2C A;  4WP3 A;  1IN0 A;  5KFG A;  3IWN C;  2SXL A;  4H4O B;  4DS5 A;  1NPP A;  3OVB A;  3JYT A;  1FTR A;  3PEH A;  3FEZ A;  2OML A;  2IA6 A;  1QUP A;  3GG1 A;  4DLG A;  2EG1 A;  1XMQ J;  1RAI B;  1T0T V;  1SB6 A;  1NLK L;  3VCD A;  1ZAX A;  1S5Z A;  5U47 A;  4CYU A;  1RWN B;  3MMB B;  4ZPC A;  3KG1 A;  2HS3 A;  4DL2 A;  2DIU A;  2P8I A;  1BXN A;  4F3M A;  5EUH A;  2A10 A;  3MMC B;  5ETL A;  2H48 B;  3OL7 A;  3FBB A;  5AXN A;  1ULR A;  1UA0 A;  3MMA B;  2IVF B;  1P6T A;  2ASY A;  2RKI B;  4LSN A;  2V4Q A;  4K5S A;  5KT5 A;  2R2U A;  4P71 A;  4JV1 A;  3TQE A;  4PQU A;  4ICL B;  3BQ0 A;  4B3S J;  3RW7 A;  3B54 A;  3IM9 A;  2HBR B;  3QID A;  3W66 A;  1KSP A;  3IM8 A;  4ERD A;  1T9X A;  2R7V A;  2QLJ B;  4LFA F;  3TEH B;  4F7V A;  1IKY A;  3JQK A;  2XZD B;  2NXN A;  2HFV A;  1GXT A;  2MPU A;  4FF3 A;  1CPZ A;  3LP2 B;  2ZKT A;  5DZ7 A;  3R3T A;  1K9M T;  4OZ2 A;  1S77 D;  5I3P A;  2IAJ A;  4JI0 F;  1HWK A;  4B3R F;  4TYA A;  3MAH A;  3AD9 C;  3TAQ A;  5ETR A;  1FDB A;  5LM7 E;  2QA4 G;  2PMH A;  3BQ2 A;  2ASL A;  1RT3 B;  4DQQ A;  2AU0 A;  4CH1 A;  5AE2 A;  1WF2 A;  2IA0 A;  1NM2 A;  2KXN B;  4LMZ A;  1JB0 C;  3FBE A;  3R97 A;  5C5J A;  4TU8 A;  2PA3 A;  2CAD A;  2F8E X;  1FJE B;  4LF8 J;  2HHW A;  2Q6B A;  2HS0 A;  3FNN A;  1U6Z A;  3SXL A;  5E0O A;  2D41 A;  3MMJ A;  3QQC D;  3VQT A;  3QZ8 A;  1VCT A;  2XI3 A;  1JXV A;  1HBO A;  2YWE A;  3FQK A;  3PZP A;  1IKV A;  2DGO A;  1S9F A;  4EYH B;  1N5Y A;  4NZ7 A;  3TJA A;  4NWB A;  4CWB A;  1RTD B;  1TP7 A;  1KLN A;  2JJ4 D;  5FDL B;  3CO0 P;  1WC6 A;  2ZH6 A;  4DFJ A;  5E3R A;  3ISZ A;  4AL5 A;  1HNX J;  2EC0 A;  1HWJ A;  1S4E A;  1S1W A;  3I87 A;  4O0N A;  3RBX A;  1ZM2 A;  2FY1 A;  4KQZ A;  3ZZY A;  3MTK A;  4IH5 A;  3MR5 A;  1PJ5 A;  1FT8 A;  2C2D A;  1RWW B;  1WI6 A;  2YNI B;  1HNV B;  1NKB A;  3J7A N;  4USJ C;  1AXQ A;  4ED1 A;  4DV3 F;  5GVQ A;  2NXU A;  5I4M A;  2W4D A;  1Q0N A;  5T41 A;  1R89 A;  2DXF A;  3H2L A;  4LFB J;  4J9V A;  1R8A A;  5C42 A;  4KH0 B;  3A12 A;  2LEC A;  2QV6 A;  2V50 A;  2VIH A;  2RUS A;  2G4B A;  3HKZ D;  4I0W A;  1LWF B;  4ZHR A;  3HX9 A;  1RWO B;  4I7F A;  4OMF G;  3BQ1 A;  3UN3 A;  3ZNJ 1;  4K4X A;  2O5D A;  2PI4 A;  3A1Y G;  2JFK A;  5LT5 A;  4RPF A;  3WZ0 A;  2DTJ A;  2YWW A;  4A8F A;  3NAI A;  1U24 A;  3G8Q A;  4QWD A;  1S49 A;  2JLG A;  2D7S A;  1LXN A;  3UDC A;  2W9B A;  2VOP A;  2MST A;  3MEC B;  4DPT A;  3NNA A;  4GKJ J;  2EPI A;  2CPD A;  3RB3 A;  5L8R C;  5D0R A;  4U95 A;  4NI2 A;  4LVN P;  2G2Z A;  1QUV A;  3PW4 A;  1UZH A;  3SBM A;  3MM8 A;  1S9G A;  3M9O B;  3RUB L;  2EK6 A;  4J37 A;  2EFQ A;  2VJV A;  3Q8Q B;  2VG7 B;  1XC9 A;  3FVY A;  2LA6 A;  2CYY A;  2KG0 A;  3DHW C;  1NPR A;  5IC6 B;  3OXL A;  1WHX A;  3UR3 C;  1HNZ J;  1FJ7 A;  1RT2 B;  2I1R A;  2VFS A;  2K7K A;  2RQC A;  5I3U A;  4MYT A;  3MCS A;  3QJP A;  4NCG A;  3G8T A;  2LQJ A;  3R7B B;  1JLE A;  4H4O A;  5GAE U;  5CYM B;  3WC0 A;  3QZ7 A;  2MB0 B;  3OL9 A;  4PG6 A;  2XMK A;  3IFE A;  3M30 A;  3Q8V A;  3OXF A;  2CJ9 A;  2XC9 A;  2JVR A;  2Y1L B;  4C2M A;  1PC5 A;  1BQM A;  1JLB B;  1GX5 A;  1SCJ B;  5HMZ A;  3GE9 A;  4OHX A;  4ZLJ A;  2WVF A;  3LP1 B;  3MR7 A;  2NZ4 A;  3W1Y C;  4DCO B;  4K4Z A;  2M52 A;  2VPY B;  1T9Y A;  3N01 A;  4UOH A;  1X4D A;  3KYL A;  4I64 A;  2GJI A;  2DHG A;  1NH7 A;  2JEI A;  4UOC A;  2PMZ D;  1JLA B;  4QR0 A;  2YWF A;  2VFU A;  2XMM A;  2OKQ A;  4C11 B;  4RW6 A;  4WBF A;  3SDE B;  4J9U E;  1V6H A;  4AFF A;  2K1R A;  1YTY A;  1NJW A;  3HK2 A;  1H2T Z;  2CNN B;  2BOA A;  3MM5 A;  1UET A;  2IM2 A;  2B5J B;  2ZUG A;  2C42 A;  2CVI A;  2WOM B;  3QJL A;  4M94 A;  2B4O A;  1FK9 A;  2UUA F;  2W4P A;  3PTW A;  3NOC A;  2WBM A;  3ZNU A;  4ZPA A;  4H4M A;  1V5V A;  2EBE A;  1RT1 A;  3UCG A;  2V8H A;  4GRS A;  2RH3 A;  5HMW A;  1SXL A;  1CQN A;  2GO9 A;  5CD4 H;  1RP5 A;  1QSS A;  3OFG A;  2J7K A;  5KFP A;  2APO A;  2MMY A;  3OJU A;  3KJV B;  2FLN A;  5HQ8 A;  1C0U A;  1CG2 A;  5E2Q A;  1MWQ A;  2VA3 A;  5CAB A;  3SZ2 A;  4KHP F;  5L39 A;  3VF0 B;  4JB8 B;  4CNZ A;  2UV8 G;  1SC4 B;  1NK5 A;  1C1B B;  3DRP A;  1REV A;  1B3T A;  3CCJ S;  2OPQ A;  1AZS B;  1S6Q A;  3QGG A;  1X4E A;  2KFZ A;  1FEH A;  5HN0 A;  3PYE A;  5K8P A;  2RDI A;  4MKB A;  2QN6 B;  1Z2Z A;  4MTP A;  1P9Q C;  2R7O A;  3HVW A;  2XQC A;  2DD8 S;  3KLH B;  5LMN J;  3E01 A;  2AGQ A;  2ZUA A;  3RW6 A;  5KFX A;  1X5S A;  2HGM A;  1XR7 A;  2PDA A;  2WK4 A;  2HSE B;  4C4W A;  3PYG A;  2QA4 S;  4EO8 A;  1N6Q B;  1XWL A;  2AF6 A;  2A2D A;  1EET A;  4U8V A;  2NXE A;  1D9F A;  2HIQ A;  3H59 A;  2WVC A;  3T9N A;  2AW0 A;  5FDL A;  3BV8 A;  3OTO J;  3PO5 A;  3AAW B;  4ZPV R;  4OHY A;  6FDR A;  1VK8 A;  2YQ3 A;  3DOL B;  2QA2 A;  1T9T A;  2YQ1 A;  1SIZ A;  5K9F A;  4K0K J;  4B3M J;  3RBZ A;  5G0R A;  2AX0 A;  2C3Y A;  5THW A;  2YNI A;  4I2P B;  2XMU A;  4L3N A;  3SCK E;  1H72 C;  2HNZ B;  4RBU A;  2XWY A;  3E8O A;  2IBO A;  2XB2 D;  2EFP A;  1S12 A;  5D4O A;  1R0A B;  1PJ6 A;  2AKW B;  2JX2 A;  1RU2 A;  4AQY F;  2XMT A;  1BQN A;  1UP1 A;  2PO4 A;  2PEH A;  2RB7 A;  4M1K A;  1CC7 A;  4DPX A;  4C8O A;  1HWI A;  2HGL A;  4BWM A;  4C8K A;  3HVT B;  2ZD1 B;  3GJT B;  4B9N A;  4R5P A;  4RW8 B;  1XQI A;  1Q78 A;  4XDC A;  2R2R A;  2FJB B;  2LQ9 A;  4USW A;  1OS5 A;  1ZBT A;  1Q7L B;  4CIO A;  1VQK S;  1SL1 A;  2CA9 A;  2M0G B;  1QVG R;  4M5L A;  3D1H A;  2HRT A;  2AD9 A;  1TMM A;  1TAU A;  2D3O R;  4O4G B;  3CCQ S;  1WC5 A;  1FNX H;  1SKW A;  1HBU A;  3ZZO A;  1NJX A;  3CNQ P;  3MEG B;  1GX6 A;  4OIX A;  2DY9 A;  4QIE A;  2W2Q P;  2ZBR A;  2VKR A;  4C97 A;  3M1V A;  1AUS L;  1CS4 A;  3F44 A;  2XNR A;  2MZS A;  3WIU A;  3T1H J;  2JRS A;  1FCA A;  2JDJ A;  2UZA A;  4HT7 A;  4B17 A;  4CP5 A;  5KT2 A;  2R7S A;  2E5L F;  3M7V A;  4TNO A;  2R8J A;  1BWE A;  1TVR A;  1KTQ A;  4OZ3 A;  4DR2 J;  1S1X A;  3GB0 A;  3M2V B;  2FZC B;  2LXI A;  4IR1 A;  1OJ4 A;  3Q8R B;  2KJW A;  2QMU B;  4OYI A;  3OUY A;  5LSO A;  2B43 A;  4FPI A;  2H4W B;  3DRX A;  3SV3 A;  1D3W A;  2O66 A;  1U4B A;  1O0P A;  1CJT B;  1HWL A;  1WTB A;  3NY0 A;  4JBC A;  5AXK A;  2UV8 A;  4OYO A;  3LF0 A;  8AT1 B;  3IO1 A;  1G2E A;  3LP1 A;  1C4C A;  5KFQ A;  4TQR A;  4ZP9 A;  4YR0 A;  1YRX A;  5EHH A;  3CC7 S;  1TKD A;  3CSK A;  5ETP A;  2WW8 A;  3VR1 A;  3UD3 P;  4DQP A;  3SDE A;  3HKW A;  1IVZ A;  2B3T B;  1RDR A;  1RT4 B;  3TJ9 A;  3PRB A;  3JAM Y;  1R31 A;  2XSJ B;  5LJ5 Y;  3ENA A;  5A8K B;  2FJW A;  1X9W A;  3CWJ A;  4P6Q A;  2ZH9 A;  4LF9 J;  4C8L A;  2CZV C;  4H54 A;  5DG9 A;  3TVZ A;  2P6T A;  4WPA A;  2IM1 A;  3EWG A;  4TYB A;  3V6H A;  4X4O A;  2ZKU A;  1N36 J;  2RNE A;  4J90 A;  1U8W A;  4ZDN A;  1JMT A;  2F4V J;  3OTE A;  2B9X A;  3C6U A;  4RW9 B;  1VQ6 S;  1RA7 A;  3DLG A;  4RNH A;  3AH6 A;  1U6B A;  4A8X A;  1CUL B;  5JXS A;  4KHR A;  3TAN A;  2OI2 A;  3N9U C;  4DFK A;  4ID5 B;  1WG1 A;  4OHV A;  1YDL A;  1FFW B;  2J0X A;  2MKI A;  4ELT A;  2O3D A;  4MIA A;  1LWE B;  4DR3 F;  2JC1 A;  3FGV A;  1NH8 A;  3MED B;  2M2B A;  3W2V B;  1B70 B;  2BJ7 A;  2I0X A;  2ZNZ A;  4G3I A;  4IO1 A;  3OR1 A;  4PXC A;  2YKN A;  1KP6 A;  5GAD I;  3VVT A;  5IS2 A;  3H25 A;  4DR5 J;  3C3L A;  3RRH A;  2UUT A;  2OEM A;  2Y0S D;  3ICL A;  3KTQ A;  3EXC X;  4K50 A;  4UZB A;  4C8Y A;  1M5P C;  4S0M A;  3Q23 A;  1SQE A;  1ZPV A;  1KVI A;  4QIG A;  3V81 A;  2BM1 A;  3KJQ B;  3CE8 A;  1ICE B;  5H9F J;  2FB0 A;  3VTI A;  4FXD A;  2XBP A;  1RTI B;  4PEO A;  1EP4 A;  3DN9 A;  3SQG B;  1FE0 A;  1H0H B;  1T9U A;  1KQK A;  3DOL A;  1RU1 A;  1PGZ A;  4C3K A;  3HFV A;  3JSY A;  1JNR B;  3GJS B;  4MIB A;  3ADA C;  1MNE A;  3CC2 S;  3RB6 A;  2ZHB A;  8ATC B;  3RTV A;  4QCL A;  3FSY A;  4X4T A;  2XLJ A;  1DY3 A;  4OX6 A;  1JJC B;  3J81 Y;  1NDC A;  5E7O B;  3O8W A;  2KB2 A;  2RJZ A;  3N79 A;  4Q2L A;  3CUN A;  3EJM A;  2DGU A;  1M1K T;  1NHU A;  1YRU A;  4Y65 A;  3FCV A;  1ZPW X;  4PPD A;  1WEZ A;  2IYI A;  5F8L A;  3OSP A;  3JTP A;  4DUY F;  4KGK A;  2M8H A;  3V6D A;  1B0T A;  2QYG A;  1RWM B;  3E3X A;  3HVT A;  4DHV A;  2ZD1 A;  2ASD A;  1K1S A;  2F5G A;  3G82 B;  2KHC A;  2MXY A;  4KH1 B;  1QSL A;  2AZ1 A;  4ALZ A;  2L41 A;  5AE3 A;  5E5N A;  3H5S A;  4J9K A;  1GXU A;  1R7I A;  1N52 B;  4YN3 B;  1HAR A;  4C6A A;  4O4G A;  1WC3 A;  1TEL A;  2J9D E;  1UCN A;  5A76 A;  2HWT A;  3UNY A;  5CQG A;  4RNN A;  5ETQ A;  1K47 A;  2M7S A;  3GII A;  4Q0B B;  2Z56 B;  2C2O B;  4E8U A;  1PAU B;  3UNG C;  1YWX A;  4DV4 F;  2OAU A;  3KLI A;  1KS2 A;  4EI2 A;  1C1C A;  3LWM A;  2YX7 A;  3US5 A;  3DOK A;  3R9L A;  2EFN A;  3MUV P;  2PN6 A;  1WEX A;  4PUO B;  4J9R A;  5AT1 B;  3M32 B;  2KT3 A;  1UW9 A;  1U09 A;  2G0I A;  3GJQ B;  1X9S A;  1NXI A;  1Z2L A;  3ISN C;  4UY8 5;  2XHC A;  3PV8 A;  4FKX A;  3GV8 B;  1H73 A;  2GML A;  5KT6 A;  2V63 A;  3AOA A;  1GH8 A;  4W92 B;  2L48 A;  2V9K A;  2ASJ A;  1CJT A;  1T9V A;  4B02 A;  2J8S A;  5DLF A;  2CQ2 A;  4FZV A;  2GZO A;  2QSF A;  1JLQ B;  1NBE B;  3HFK A;  2P2C B;  1WKJ A;  2DNQ A;  3W7B A;  2C2K B;  2BRK A;  1WD6 A;  5E33 A;  3K58 A;  5AJ3 J;  2HVZ A;  4NML A;  2H4Y B;  2IDL A;  1F5B A;  1PG5 B;  4D3G A;  1NKE A;  3HSZ A;  2J5A A;  3CJ4 A;  1ZET A;  4IDK A;  3W9J A;  3OJS A;  1WDD A;  2HUR A;  4OZ1 A;  4WCE Q;  4IG3 B;  2XYH B;  1I1G A;  5LJ3 Y;  1JLG B;  2O01 C;  3GIM A;  3OFF A;  3P5T L;  5KG0 A;  2U2F A;  1NZA A;  2VH7 A;  3TX0 A;  4Y3C A;  2H1Y A;  2GJ2 A;  2Y8Y A;  3RBE A;  3GWC A;  3K8V A;  3HHL C;  2X1A A;  2PEB A;  2J9E A;  5I42 B;  5J2Q B;  1RT4 A;  3RAM A;  2B56 A;  3POT A;  2XSJ A;  3W8P A;  2EW9 A;  3C14 A;  3KLG B;  1RTZ A;  2HQ3 A;  3IR5 B;  8RUC A;  3GMG A;  1SH0 A;  4ZLN A;  1VC6 A;  1UPM B;  5IM0 B;  4NXM J;  2GMJ A;  1GTH A;  1ZYQ A;  4NRU A;  4O44 A;  1HMV B;  4CLP A;  4WFB Q;  3AA8 A;  1K0T A;  1OPZ A;  2DNY A;  2JEF A;  4QWC A;  2HS4 A;  2E5H A;  1N0U A;  2AMC B;  2EFO A;  1EAY C;  3D4J A;  3N6L A;  4LFC J;  1PBU A;  3HI9 A;  4MK8 A;  4DU7 A;  3FDS A;  1CUL A;  1FJG J;  2KT2 A;  2BV3 A;  2IFX A;  3LW5 C;  1M5H A;  4WFY A;  4ELU A;  3M8Z A;  4ID5 A;  4KPC A;  1LNQ A;  1IBK J;  2F8M A;  2V0N A;  1Y7P A;  4GMK A;  3AOD A;  2DNP A;  2ZBP A;  5HRO A;  2ZBI A;  1HPZ A;  3MM6 A;  4RBV A;  5E41 A;  4FF1 A;  4MH8 A;  1UVK A;  4I68 A;  1K44 A;  2AP6 A;  3BDP A;  4AT1 B;  2E9T A;  1BHN A;  2GVD B;  1SC1 B;  3MUT P;  1X0P A;  3TWZ A;  4G1Q B;  4LT6 A;  2ABY A;  4B08 A;  1FJC A;  4AL7 A;  2AJ1 A;  1GXL A;  3ET6 B;  4I6Y A;  1YBU A;  3RG6 A;  3DNC A;  3UWT A;  3CCS S;  4JI5 F;  1CVJ A;  3FMW A;  5HLF B;  4FN5 A;  4DCJ B;  2M8D B;  3NS7 B;  2CQH A;  4ED4 A;  3KLF A;  1QJH A;  4ZIV A;  4J9M A;  4ZP6 A;  3I5C A;  2W8L A;  2KDO A;  4FP9 A;  2BRL A;  2BJ1 A;  4QWA A;  3ZC4 A;  3KK1 A;  5D15 A;  3KK2 A;  1M5O C;  2C3M A;  4LRC A;  2XO7 A;  5H9F K;  2FPH X;  2HHT A;  4JUZ A;  4FPR A;  5HQL A;  1DAX A;  1Y3K A;  3R8Y A;  3ENV A;  4NLD A;  2MQP A;  3MDF A;  1N34 F;  3HM9 A;  4ZCI A;  3FQL A;  4WK3 A;  3QIP A;  4G6V B;  5EN1 A;  4URS A;  4N47 A;  1KHV A;  4P10 A;  4RX6 A;  3U27 A;  5EWE A;  1TU0 B;  4M63 A;  2CJK A;  4U7U K;  1YJN S;  3Q22 A;  4YS2 A;  2IBK A;  2E7V A;  4WKY A;  2Y8W A;  4LF2 A;  3D0H E;  1YVF A;  3Q2S C;  3VAJ A;  4PAA A;  3JSR A;  3A3N B;  2IHR 1;  2IVY A;  3IRW P;  2HQG A;  4MJK A;  4FYD A;  3R2C J;  3UN5 A;  1EQM A;  1G4C A;  1XR6 A;  5BR8 F;  5CZV A;  1NDL A;  2HMI B;  1NZ8 A;  3PR4 A;  3AOC A;  3T5K A;  4GVB B;  5I3Q A;  3FFI A;  1LOU A;  1MLA A;  2CJX B;  4LBH A;  1I94 F;  3UD4 P;  4JOU A;  2RT3 A;  1FHT A;  2MEW A;  3AFG A;  5B0A A;  1MWZ A;  3C15 B;  4NXN F;  3DDN A;  4K59 A;  2L9W A;  5AXL A;  4DR6 J;  4AXJ A;  2A6M A;  2CDQ A;  3D1O A;  1NSK L;  2ZZM A;  3UDV A;  1X4F A;  2MKJ A;  3J7Z 5;  5DO2 A;  3NGS A;  3NCR A;  3M32 A;  3MCN A;  2VFV A;  3F41 A;  3GFH A;  3HP6 A;  1DTQ B;  3IG1 A;  3PDN A;  1Q8B A;  2KJV A;  1QE1 A;  1G3O A;  3VZH A;  4IO9 Q;  1H3D A;  1UFK A;  1WKL A;  4CO2 A;  1JQG A;  1FDD A;  2XZW A;  4WJB A;  3HPO A;  4ECW A;  4PYA A;  2IJN A;  2XY7 A;  2WB4 A;  1U02 A;  4BHQ A;  1TAQ A;  1XBW A;  1RK8 A;  2VZ9 A;  4DV5 J;  2V4J B;  2JEJ A;  5D4L A;  1Q1K A;  5GMK a;  1D09 B;  3MUM P;  1JLG A;  4ZP8 A;  1MRO B;  1NK8 A;  4DPU A;  1UWB B;  3HDS A;  2W7O A;  3KUE A;  3GV5 B;  3NCP A;  2R7T A;  3J7Y I;  2B0G A;  1T05 B;  4LF7 J;  2EK1 A;  4JI2 J;  3PHE A;  1FKP A;  1DQ8 A;  3PX0 A;  5KFT A;  5IQ6 A;  3KLG A;  3NP5 A;  5KFW A;  3H98 A;  3G86 A;  4O3O A;  1X4A A;  2VQE F;  1O8B A;  5HMY A;  1HI8 A;  1HMV A;  4FDF A;  3MOZ A;  1QAJ A;  5D78 A;  1RTH B;  4X62 J;  1WWH A;  4ZOS A;  2ZH8 A;  4DV6 F;  4FVM A;  2E29 A;  1UVL A;  4KKO B;  2MHN A;  4DL7 A;  2FZK B;  1IKX B;  2C28 A;  4DSI A;  1TFW A;  2FLL A;  2PC6 A;  2CQ1 A;  3J7Z T;  3CCL S;  3QWP A;  4A8Q A;  3KMQ A;  2QRR A;  3N5B A;  4I4B A;  1DUR A;  5LXY A;  2LXU A;  1UVN A;  3P45 B;  2DB1 A;  2KO1 A;  4DR1 F;  2HAF A;  5HO4 A;  2PFF B;  2J9D A;  2RIL A;  3I9V 9;  3W62 A;  1KR4 A;  1AFI A;  4WIQ A;  1VIX A;  5F0W A;  4IG0 A;  1W7W A;  1YLX A;  3GYG A;  2BAC A;  2L3M A;  4WK1 A;  1JJ2 R;  1CJK B;  1RA6 A;  2GVD A;  1SV5 B;  1U0H B;  4NLV A;  1IM6 A;  3QT8 A;  2UUC F;  5LXR A;  3PYF A;  3IGV A;  4DL0 C;  4PWW A;  2VOO A;  3DU6 A;  4PG5 A;  1VQ5 S;  4F2S A;  4KV8 A;  3FMB A;  3OTC A;  1RJJ A;  5EX0 A;  3IBW A;  2XZT B;  2CVE A;  4B3T F;  5HLF A;  1SIW B;  3CDE A;  4N5S A;  5JVH Q;  1X60 A;  3GLJ A;  5D0H A;  3BR9 A;  4WP8 A;  1FRM A;  3KHG A;  1M5V C;  3O44 A;  4IFV B;  4R25 A;  2NSC A;  1TK5 A;  4IH7 A;  1ZA2 B;  5J2M A;  2OP5 A;  5JJB A;  5GAG I;  2ALY B;  4V19 X;  1M5S A;  2E1C A;  1XMO F;  3NKY A;  2R9L A;  4B9L A;  1SI9 A;  4YY3 J;  3HHE A;  1NK0 A;  4OI1 A;  3O3L A;  3BO3 A;  4IKA A;  3KK3 A;  1OSD A;  1SJR A;  4BDP A;  1ZTW A;  2HLT A;  4DSE A;  3MI7 X;  4W90 B;  5BXI A;  1H98 A;  1NRK A;  2DHS A;  4DLE A;  2V67 A;  4DUZ J;  2ZOM A;  3W5X A;  1NU4 A;  2ATL A;  3CJQ A;  1JLC B;  3DGP A;  3QGP A;  2DNO A;  2VDH A;  5DM6 Q;  4EEY A;  2DBB A;  1TL4 A;  5GAH I;  1C0T A;  1IXK A;  2UXC J;  2ZM6 J;  3CJ5 A;  4LF6 F;  4F02 A;  4OZ0 A;  2HMI A;  4NRT A;  5M2R A;  1KBR A;  5IWA F;  2AQ4 A;  2ILY A;  5CYJ A;  1JKH B;  2EG2 A;  2FHJ D;  2VQF F;  1OIA A;  1IKW A;  4RJV A;  4N41 A;  2XY6 A;  4Q44 A;  2WVD A;  1TUV A;  4EGL A;  1UMJ A;  3D6H B;  2LEB A;  1LK5 A;  1W26 A;  2J6T A;  3G6E S;  3R5J B;  2HFU A;  1YG0 A;  1VQP S;  2CG8 A;  4OYB A;  2BBE A;  1WAC A;  2IDE A;  4OX8 A;  2HRY A;  2CQ3 A;  5HBM B;  3EZO A;  2PMW A;  4G1P A;  4OYM A;  3UQS A;  1Y0H A;  3GCX P;  3MM9 A;  2J6S A;  2QLW A;  1UEK A;  3I5B A;  2MLZ A;  4L72 B;  2VG5 A;  3MZI A;  1DHM A;  3SI8 A;  5SUH A;  2PA8 D;  5M2P A;  1FEE A;  1O5J A;  4NE9 C;  1S0M A;  4LSZ B;  3BSA A;  4IOC Q;  2BJ3 A;  1PKU A;  5E3Q A;  1PC4 A;  2RRA A;  1XNR J;  2BXJ A;  3E2E A;  1HBM A;  2YH1 A;  4NA1 A;  4JYA F;  4WFZ A;  3TO8 A;  1YJW S;  5IOL A;  1SVD A;  1YIT S;  2RSQ A;  1TL1 B;  2NYH A;  1S1T A;  4U96 A;  4KAI A;  5A0Y A;  2MQQ A;  1ACM B;  3JSM B;  4HDH A;  2FIU A;  3CXC R;  1T05 A;  4LF5 F;  4Y2M A;  4CT8 A;  3JXO A;  1XK8 A;  1RBL A;  2RQ4 A;  4F0M A;  3TUZ C;  1KVJ A;  3H2U B;  5D0G A;  2ZH3 A;  3DM2 A;  1B64 A;  3BYP A;  2R7U A;  4WXW A;  2NRE A;  2OPP B;  4B3O B;  2XM3 A;  1CC8 A;  4DWI A;  3QYY A;  1YGY A;  1TZ0 A;  2AYB A;  2R8H A;  1RTH A;  3PRV A;  4YHH F;  2GIQ A;  1Q5V A;  3UVJ B;  3PYD A;  4HT5 A;  1SL2 A;  4ED5 A;  2DHH A;  2XMV A;  5F8M A;  3PX4 A;  3AJD A;  2BR0 A;  1VRQ C;  3ONQ A;  3R1L A;  4DN9 A;  4F4W A;  1RWX B;  2OPS B;  3DOM A;  2YH0 A;  3T5H A;  5HJX A;  1RWP B;  4LRF A;  3SFG A;  2C3O A;  5KFM A;  1KQG B;  3GON A;  4PPZ A;  2XO6 A;  4RNF A;  1TKT B;  4OYW A;  5B08 A;  3NGU A;  3A8E A;  1RIS A;  2FVR A;  2ZOF A;  1SKR A;  2YKP A;  4ZMM A;  1VRT B;  3V4I A;  2MSS A;  2AJ4 A;  1K0V A;  1TL3 A;  3BGR B;  3BN4 A;  4JP8 A;  2OHD A;  4ELV A;  3H90 A;  5MLC V;  3F56 A;  3D5M A;  3MM7 A;  5J2N A;  1U1L A;  1NJZ A;  3CC4 S;  3CCZ A;  4DSJ A;  3KHH A;  2ROP A;  4DUT A;  1WUU A;  5IXU A;  4MKV A;  2N7C A;  3AB4 B;  2IC3 A;  1NME B;  2GQ2 A;  3E51 A;  3DDK A;  3JTO A;  5F8I A;  4JI8 F;  3RR7 A;  4DR4 F;  5C24 B;  4LRA A;  5D3G B;  1KKH A;  4ZP7 A;  4F0H A;  5J1N A;  4MMO A;  1LXJ A;  2DR8 A;  2YTC A;  2UVR A;  2RDJ A;  4RO0 A;  3KFW X;  4G65 A;  1F9H A;  1RHK B;  4CRJ A;  2DK2 A;  2V8P A;  1A6L A;  1YX2 A;  4AD6 A;  2MY8 A;  3C8Y A;  5L1L A;  1VQS A;  3M8R A;  4GKK F;  3K57 A;  5L1K A;  1CJU B;  3QSI A;  1YJ7 A;  1T02 A;  4HHH A;  2FDN A;  4LRE A;  1QAX A;  2F8H A;  2VPX B;  4ZVE A;  3CCT A;  1OY6 A;  4LRD A;  2FHO B;  3CIM A;  1JLC A;  3M8Q A;  3HUL A;  4K2X A;  3VAL A;  4FBT A;  4CH0 S;  4Q45 A;  2W2O P;  4FVC A;  3DXS X;  5T14 A;  2CJQ A;  4OJ1 A;  1XMQ F;  2FQQ B;  3G87 A;  4C48 A;  4C98 A;  1BMQ B;  3WIV A;  1GNK A;  1U25 A;  4ECR A;  3GZ7 A;  4URG A;  2R7X A;  1FD2 A;  2CJY B;  3G8S A;  3EX7 B;  3T9Z A;  3SMZ A;  2CPX A;  3IC1 A;  1TKZ B;  2HHX A;  2D3U A;  2D1C A;  1U1O A;  5KT3 A;  1NKC A;  4IYQ A;  1PIL A;  1RLD A;  4CTA B;  3OL8 A;  3TAM B;  1O51 A;  4I6W A;  2E1M C;  1C2P A;  3UCZ P;  3CJK B;  2KU7 A;  3QJJ A;  3SSR A;  3LAM A;  3EVW A;  3KUG A;  1RTJ B;  1NSA A;  3DRS B;  2I8E A;  3G9C A;  5F9N A;  4Y00 A;  2VHG A;  1TKX A;  2GIF A;  1P1L A;  4OLO A;  3P4U B;  1J5E J;  1LWX A;  1B99 A;  5B0D A;  4OJ3 A;  4X4R A;  2MZJ A;  4DSF A;  7FD1 A;  4HI1 A;  1UTA A;  1VQL S;  1BD6 A;  3OR2 B;  3CCE S;  2NPI A;  5J2P B;  5IFM A;  3EUN A;  4NL5 A;  3TW0 A;  2WBR A;  2NS1 B;  3L7P A;  1RT6 A;  1Y5I B;  5KTQ A;  2XMA A;  1RAB B;  3EZU A;  3QGI A;  4HLB A;  2ZWP A;  3GFZ A;  3S7R A;  3BRE A;  1WDT A;  3ELH A;  2CNK B;  4CLL A;  4NLG A;  2BAB A;  2CZ4 A;  4Q8F A;  4LF8 F;  4KO0 A;  4RUB A;  3C6T A;  3VGS A;  2VOD A;  4OZN A;  2N4C A;  1D9D A;  1UWA A;  2BE7 D;  4RW7 B;  1T3O A;  3L7U A;  4A8O A;  3ULH A;  3UVJ A;  4UW2 A;  2V2Z A;  3JYT B;  2E5L J;  3THV A;  1X4C A;  4CLW A;  3AY0 A;  4PRF A;  4L73 A;  1HNX F;  2DR9 A;  1R0C B;  3ITH A;  4X65 J;  3ILI A;  2UVU A;  1FNM A;  3R7N B;  2WB1 D;  2LQB A;  2L9D A;  2MKC A;  4M5M A;  1H2V Z;  1D8Z A;  4XK8 C;  4CYU B;  2Z2Z A;  1HW9 A;  4O4R A;  2ZVI A;  4Y2A A;  2ZOG A;  3KOA A;  3SEO A;  4LFB F;  1WI8 A;  5IT0 A;  3VQS A;  4U7C A;  2ZWO A;  4O23 A;  4WP9 A;  4A4J A;  2OD6 A;  2UVW A;  4HH0 A;  3VGV A;  4I67 A;  3IWL A;  4K5R A;  4NZ0 A;  4HEA 9;  4LSN B;  1VQO S;  5KT4 A;  3D68 A;  4HTJ A;  2LMI A;  4YP3 A;  5DJB A;  3H40 A;  2CQC A;  5HP1 A;  4DG1 A;  5GAE I;  2AIR B;  4KGM A;  3MEE B;  3DLH A;  4GKJ F;  1IKY B;  1RE1 B;  5HSP A;  3OVS A;  2JL9 A;  2WON A;  1VQ7 S;  1EX8 A;  4DSK A;  3Q89 A;  3P8B B;  2IAJ B;  2KZM A;  5HAO A;  3RBD A;  3DKD A;  4B9S A;  2MZ1 A;  2PD1 A;  3FJ2 A;  2NPF A;  2F7V A;  5DQG A;  5HVF A;  3RJM B;  1H7W A;  2RF2 A;  4P74 A;  1FWP A;  5LMU F;  4ITS A;  1SQG A;  2Y1J A;  3B4M A;  4QYR A;  2IM0 A;  4C0B A;  2DIT A;  1HNZ F;  1SC6 A;  2B9W A;  3BKU A;  3MPY A;  1NHK L;  1RQ0 A;  2Y9H A;  2NCK L;  2FTR A;  3BM7 A;  1CLF A;  2AWZ A;  3CJ8 A;  4NLS A;  1RYR A;  1JNZ B;  4OYP A;  2YNH B;  2DR6 A;  4WFN Q;  1RAC B;  1WJ9 A;  4DR3 J;  1HBO B;  1IKV B;  2NUU G;  3VGU A;  3G2X A;  1AFJ A;  3R1H A;  5G4D A;  1N5Y B;  1R8B A;  3HF5 A;  5DDQ C;  2G13 A;  2EBG A;  3P49 B;  2RQK A;  2MYF A;  2W2N P;  4LBI A;  3BPD A;  1XR5 A;  1T9W A; 
#chains in the Genus database with same CATH homology
 1EHW A;  3ENA A;  4S0M A;  1NSP A;  1S59 A;  1LWX A;  2VU5 A;  4UOG A;  2HVE A;  1B99 A;  3BBB A;  4O0N A;  1HHQ A;  3EM1 A;  2AZ1 A;  4FKY A;  1VYA A;  3BBC A;  4WBF A;  1NPK A;  1NDP A;  2BEF A;  1WKJ A;  3FKB A;  3EVM A;  3BBF A;  1NLK L;  3Q89 A;  3FCW A;  5BXI A;  1W7W A;  3EE3 A;  3GP9 A;  5C7P A;  4DUT A;  1XQI A;  2ZUA A;  4HR2 A;  1WKK A;  4C6A A;  4KPC A;  1S5Z A;  3DKD A;  4ANE A;  3PRV A;  1U8W A;  3ZTO A;  3EVO A;  4AND A;  1MN7 A;  1LEO A;  1BUX A;  1UCN A;  3EMT A;  2DXF A;  1NSK L;  1BE4 A;  2HUR A;  1NB2 A;  3BH6 B;  3Q83 A;  3MPD A;  3FC9 A;  3B6B A;  1NSQ A;  3FBE A;  3NGS A;  4DZ6 A;  3JS9 A;  1NDC A;  1B4S A;  1K44 A;  1HIY A;  3NGR A;  3ETM A;  4F4A A;  3EIC A;  1NHK L;  3EJM A;  1KDN A;  3FBB A;  3NGT A;  1BHN A;  3WX8 A;  2NCK L;  4F36 A;  3Q86 A;  3FCV A;  5CAA A;  1NCL A;  3ELH A;  1PKU A;  2DYA A;  3ZTP A;  2BX6 A;  3ZTR A;  1S57 A;  4ANC A;  3VGV A;  3VVU A;  4DI6 A;  3BH7 B;  1WKL A;  3R9L A;  3ZTS A;  1JXV A;  3Q8V A;  3Q8U A;  1PAE X;  1MN9 A;  5IOL A;  2DXE A;  2DY9 A;  2HVD A;  3NGU A;  4W98 A;  3Q8Y A;  4UOF A;  2DXD A;  4EK2 A;  3VGS A;  1NUE A;  3DDI A;  3B54 A;  3EVW A;  3VGU A;  3G2X A;  3FBC A;  3PJ9 A;  1F6T A;  3GPA A;  5CAB A;  3VVT A;  4CP5 A;  3L7U A;  2B8P A;  1ZS6 A;  2CWK A;  2B8Q A;  4FKX A;  4ENO A;  3VGT A;  3ZTQ A;  1NDK A;  1F3F A;  1NDL A;  3FBF A;  4UOH A;  1XIQ A;  1HLW A;  2AZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...