3PJ9A

Crystal structure of a nucleoside diphosphate kinase from campylobacter jejuni
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
137
structure length
137
Chain Sequence
MEKTLSIIKPDAVKKGVIGKILDRFESNGLRIAAMKKVQLSKEQAENFYAVHKERPFFKDLVEFMISGPVVVSILEGEGAVLKNRDLMGATNPKEAKAGTIRADFAESIDANAVHGSDSLENAKIEIEFFFKPNEIC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Crystal structure of a Nucleoside Diphosphate Kinase from Campylobacter jejuni
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Transferase
total genus 42
structure length 137
sequence length 137
chains with identical sequence B, C, D
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2010-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3pj9A00
3ZTSA 1F3FA 1NLKL 1MN9A 1WKLA 3PRVA 2HURA 2HVEA 3VGUA 1HIYA 2B8PA 3EVMA 3G2XA 2BEFA 1UCNA 2HVDA 3Q89A 4W98A 3GP9A 3NGTA 3FBCA 1PAEX 3ELHA 5BXIA 3BBBA 1S59A 1PKUA 2AZ1A 4S0MA 1LEOA 4EK2A 1XIQA 1BE4A 2DY9A 3VVTA 3Q83A 1NB2A 2DXDA 3NGSA 2AZ3A 3EM1A 2CWKA 4F4AA 3FBFA 3FCVA 3DDIA 2B8QA 1NDKA 4DZ6A 3R9LA 2DXEA 2DYAA 2DXFA 3VGVA 3JS9A 3VGSA 3ENAA 1NSPA 3VVUA 1NCLA 3BBCA 3EE3A 5CABA 1NDCA 3DKDA 1BHNA 4ANDA 4O0NA 1NDLA 3ETMA 1W7WA 3FBEA 4UOHA 2VU5A 1XQIA 2BX6A 1NSQA 1JXVA 5IOLA 1WKJA 2ZUAA 4ENOA 4FKYA 4HR2A 3BBFA 4KPCA 4C6AA 3ZTOA 5C7PA 1WKKA 3VGTA 3EJMA 4UOGA 1BUXA 1NPKA 1VYAA 1EHWA 3FC9A 3B6BA 3PJ9A 3MPDA 3EICA 4FKXA 4F36A 4CP5A 1HHQA 1KDNA 1NSKL 3BH7B 1NUEA 1B4SA 3EVOA 1MN7A 1HLWA 1B99A 4ANCA 3FCWA 3FBBA 1NDPA 3BH6B 3Q86A 1S57A 1K44A 4DI6A 2NCKL 3Q8VA 4WBFA 3WX8A 3ZTRA 1U8WA 3NGRA 1NHKL 3B54A 4UOFA 3ZTPA 3EMTA 3GPAA 3ZTQA 1F6TA 1S5ZA 3FKBA 1LWXA 3Q8UA 3NGUA 4DUTA 3Q8YA 4ANEA 3L7UA 5CAAA 1ZS6A 3EVWA
chains in the Genus database with same CATH superfamily
1VRQC 4YR2A 4B3RJ 2JVRA 3AOAA 2B9EA 4LF8F 4B3TF 5CQGA 4ED4A 3CCUS 1RTHB 3E2EA 4C9DA 4WXWA 2BV3A 3BKFA 2OD6A 3MM9A 1S6PA 2XMKA 1N5YB 1XMBA 3EPIA 2E9RX 4LBIA 2VD3A 5A2QY 2MHNA 4IQXA 2KYZA 2HRYA 3G4SS 1OQ3A 3U27A 2J8SA 3PIOQ 1X4EA 2J6SA 2YKMB 1RT7B 1XJWB 1RHJB 4CI0B 4P73A 3I9ZA 1O6XA 1OY8A 2DHSA 2Y9HA 1U1LA 3GSIA 2NPIA 2NUUG 4IOAQ 3KJFB 1RTJB 1Y5IB 1IM6A 1BD6A 4GKKJ 3M4XA 4RBVA 1B4SA 3SYZA 3MOZA 4YEAA 4ERDA 1C4CA 1TUWA 1U8WA 2BJ9A 2OELA 1EARA 4B9VA 1RUSA 2E66A 3CJRA 1HQ2A 4IUFA 4CLYA 2NXUA 1S1WB 1LOUA 4CZCA 4X62F 1YJTA 1L3SA 4YY3F 3J80U 1HHSA 2BBEA 2QMXA 4K4WA 5DG7A 3LF0A 1RP5A 3W61A 2AEJA 4DOZA 4DV0F 4E0DA 3QIPB 4OYPA 2QFIA 2DHHA 3I31A 3M8QA 3LAMA 4AL7A 4DR7J 1NK8A 2Y0SD 2G9OA 3I0SB 1AFIA 1FJGF 2VICA 7FD1A 2XMTA 3RRKA 4B3OA 5ADZA 2OMLA 2ZDPA 2DPJA 3NGDA 4JV1A 3K8WA 2QMUB 2HHWA 2AJ2A 3HO1A 3SDEA 2XCAA 2HQFA 3KJVB 1S4EA 5LXRA 4P9SA 1M1KT 3MR2A 3IS9A 5ETLA 4X4NA 1WC6A 4WP9A 1YTYA 3NBPB 3R1HA 4RUCA 2MQNA 3FQKA 2W9BA 8AT1B 2BKOA 2LU1A 2OMOA 4KJIA 5IT0A 1EP4A 2FIUA 1IBKJ 2CNOB 2MKYA 3CDEA 1HI0P 1YX2A 1CC7A 1RAGB 5KFBA 2O66A 4Y3CA 3T1HJ 1UPPA 5J1NA 2ZC4A 2QYCA 1LFPA 1RU2A 4DU7A 1FEHA 2CJQA 2HWTA 1SUQA 3K0JA 4NCGA 2R7WA 2BJ1A 1KVIA 4NA2A 2IIHA 5IV4A 4TQRA 1PJ6A 2DYAA 1DBDA 3MXHP 2ROPA 5AJ3J 5ETVA 3C6UA 4M8LA 5GAEU 4PXEA 1XQIA 1JXVA 1LKZA 1Y0HA 4DSFA 5KFHA 2BKNA 4IG3B 4C4WA 3CO9A 1HBUB 4LSLA 4DFKA 2FHOB 4I2QB 3HULA 1KONA 3GTYX 4RUAA 3CJTA 3ZZTA 5J2MA 4I7FA 3P96A 4MKVA 4FF3A 3CCQS 3LWMA 3UCGA 4UY8T 2JLEA 4KAIA 2DGWA 3QT5A 1VBXA 3TZZA 1SL2A 1S4FA 4J9OA 1R6YA 3M8PA 3R7BB 2YKQA 4LR7A 4OZLA 4DL4A 2HURA 1WNEA 1VC0A 2K3KA 2FHKA 3C16B 4K2XA 1SJQA 4CNYA 4F3OA 3T5JA 1LWCA 1U1NA 4LRFA 2AZ1A 3MZIA 4M5KA 2ZEJA 3TZXA 3UW1A 2OP5A 4ZCLA 1NSAA 4WTOB 4NX9A 3AODA 3BR9A 5DJBA 5K14B 5DLFA 1FJCA 2R9LA 3UDCA 3CC2S 3CD5A 4RZRA 2BRKA 3CCSS 5C2GA 4X4VA 2H4WB 5EWGA 3LP1A 1UETA 2R8GA 3GONA 3DM2A 3HHLB 3SI8A 3HHKA 4NOHA 1FRJA 3AT1B 4CRJA 3ITHB 4U6PA 4K5SA 3MURP 2F7VA 4Y28C 3SZ2A 1DY3A 2VBZA 2EKNA 1WOPA 4F36A 5AE2A 1J5OB 3TVKA 1N5QA 3G8QA 2RU3A 1SIWB 1U1OA 4HYKA 2M8HA 2DGXA 1CPZA 1L3TA 1IBMF 4CM2A 2QLWA 4DV5J 1QVFR 5B0DA 3Q8YA 2RRBA 1JJHA 5ITHA 4YUDA 3DOLB 4C3MA 2LA4A 3O44A 1RAEB 1AUSL 3GIJA 4EU0A 2XWYA 4L73A 3JSMB 1SCJB 2KFZA 3RAMA 1RTDA 2HAFA 3HI9A 4QJVA 4C8LA 2K7KA 2EFNA 2MKKA 3LGMA 2EBEA 5ETPA 2PFFB 3VALA 1JX4A 3DLEB 1HQEA 2DPIA 2OSRA 3R2DJ 1VLYA 4NPOA 3OFHA 3QLHA 2E1MC 3HM9A 3MM8A 4GRSA 5C7PA 1CEZA 3FC9A 3AB2B 4LF1A 4R8UB 4ZPWR 2HNDB 2F8MA 3B82A 4Z7CA 2KVQE 4DPTA 1T05A 3J7A1 4IFVB 1Q8IA 1MLAA 3U1LA 4Y2MA 2MKHA 3FGVA 2VG7A 1VHFA 1VQSA 4Y6IA 1NKBA 3AD7C 4KH1B 3K7RA 1T8EA 5GAHU 1SXLA 3IAS9 3F44A 5CYQB 2GV1A 7AT1B 2WVEA 4JI0J 3VQSA 1UJ6A 3KNGA 2VFTA 3D2WA 1IKWA 1S10A 5C25B 4L72B 4DPWA 4KGXB 3VQTA 2FPHX 2DT9A 1VGYA 4CO0A 4X66F 1BLUA 4OI3A 1HR0J 4LF7J 1U0SA 3QZ7A 4P7VA 4BC7A 3GYXB 4YP3A 2RRAA 3MMBA 3H8YA 3TUJC 2EFGA 4U95A 4WK1A 3DLKA 2GO9A 1UL3A 5B08A 4C11B 4FS2A 4OYIA 5IV3A 2E1RA 1Q5VA 1V3SA 2DD8S 3VGTA 3POTB 1SQEA 2ZVSA 3M30A 2WHOA 1NHVA 4DR5J 3RYLA 3KLFA 3CDUA 4C2MA 1VR6A 4ZCIA 4URGA 3UNGC 4RW9A 4B9UA 1XNQF 1VRTA 5FDLB 2XQCA 3DGVA 1S1UB 1N0UA 4LQ3A 3TA2A 2Q1LA 4DV2J 5BYQA 3EGVA 2WW4A 1TUVA 4HACA 2FYXA 5K8PA 3UFCX 1HD1A 4JI3J 3FBCA 1PJ7A 1Q8KA 2R8HA 5HMZA 4S0MA 4RNHA 5A2QU 2XB2D 2RQKA 1K9MT 3KUEA 2ZE2B 2V68A 3AY0A 3DYAB 4HDGA 2UXCF 2XI3A 1WC0A 4EMDA 1RADB 3HLUA 4JI1F 5IT9Y 4WK3A 2B5JB 2Y8YA 3GYGA 5F8NA 1ELOA 2CQHA 3TVZA 1T95A 4PEOA 1LQ9A 2Z4PA 1RHRB 1NH7A 3TX8A 3CCRS 4NLUA 2KH9A 3QYYA 2AHOB 3I4PA 4IG0B 2DGVA 2KN4A 2J7WA 4U7UK 4WWSA 3SIPB 4OLPA 2CQBA 3I32A 3CJKA 2JHEA 1XWLA 4OJGA 5DG9A 4B02A 1RHMB 1JLFB 1F2HA 1JK9B 2R42A 3BSOA 4OHVA 3SSQA 3KK2A 4A47A 2ZDOA 2FHJA 4DLGA 4F3QA 1IVZA 3BKUA 3Q83A 4YQWA 1BGXT 1UA0A 1S9EB 1Q0NA 1KFSA 2G0JA 1XC9A 1TK5A 5DM7Q 1U48A 3HJFA 5ETKA 5E5NA 1FDAA 3C6TB 1I3OB 1IKYA 5IT4A 1ZTTA 5C2CA 3OV7A 1RWNB 5DLGA 1AFJA 3GJTB 2V69A 2V50A 5FJ4A 2DH7A 4WFNQ 3QGHA 4ED2A 5J2NA 4I2PA 4P7TA 1U1QA 5HL7Q 2UU9J 2OEJA 4ZK7M 2YPYA 3MMCB 1HWLA 1UEVA 4DMZA 4TLQA 3I5BA 2POKA 2B4OA 1MMDA 2ZOFA 2HRUA 4K4TA 2FVRA 2M2BA 4DV6J 2LKZA 4X84A 1EKSA 1ICEB 3OJUA 4EK2A 1PGZA 1FESA 2J76E 4EYHB 4B3SF 5KFEA 1HI1A 1REVB 5A6PA 4M5NA 5KFSA 4UT4A 3W63A 3ZZRA 4O3PA 5A8RA 2GJIA 1S1XB 1EETB 5LJ3Y 3VGVA 3H90A 4RW8A 4J9SA 3HK2A 4IYQA 4ZHRA 5AXKA 1F9HA 4FYXB 3OTBA 3FVYA 4HHHA 2RQCA 6FDRA 4X4RA 4GC7A 4PG6A 2QV6A 5E3QA 4FKXA 2RF2A 2DNLA 4U7UD 2HNYB 4KRWA 4YN3B 2J0QD 3TUIC 3W7BA 4FP9A 1VJQA 2AGPA 4AQYF 2L9WA 2MMYA 4DS5A 3MPWA 5KOWA 3MUTP 5HLFA 4DV4F 2XGPA 3ZTPA 3AXMA 4KY3A 4LFBJ 2OPPA 1EB0A 2ACMA 1WJ9A 2CNNB 1BWVA 3UR0A 2H54B 1ZZNA 1UVMA 2L9NA 2W4CA 5LMNJ 4DUYF 3QSIA 2Z2ZA 2YNFB 5BR8J 2OSQA 1CG2A 2W9CB 4MIAA 4KHPJ 5DRKA 1CJUB 1U2CA 4LF9F 5J2PA 2QZ8A 1K1SA 2HHPA 3IRXA 4GKJF 4ED7A 2C3PA 2VG5B 3CJ3A 1Y00A 2BE9B 3DLGA 3RGIA 1A0OB 1VC5A 4PG5A 4I56A 1XR5A 1SC3B 1X4FA 3FRYA 3M1VA 1KOOA 3GCWP 3KTQA 3ZZZA 4OI1A 4EO6A 2W2MP 4NEYA 2GVZB 2VBXA 1XR6A 3W2WB 2KRRA 1MG7A 1RBAA 2LMIA 2ZOMA 4DV1F 2E5IA 4WU3A 1DTQB 2CDRB 4KGKA 2BQUA 1SBRA 4ED3A 2UUAJ 4I0WA 2D9PA 4QBUA 3UD3P 1MW7A 4RJVA 3ZNJ1 2RS2A 4URSA 4DR6J 4RPFA 2BOAA 2EEYA 4KH0B 4NL5A 2UXBF 3ILIA 1SJ3P 4JV5F 2BRLA 3GV7B 2LEBA 3NMRA 1JLQB 3MAAB 1X9SA 4EUVA 2MLZA 4MIBA 4WJBA 3EYZA 4UOGA 2ZHAA 4Q0BB 3TOQA 4N56A 2LDIA 1FWPA 3DRSB 2RDJA 5JMNA 3R97A 1NSKL 4N77A 2OFHX 4CTAB 4PR6A 2HIQA 2DIVA 3DRXA 2IDEA 2NREA 4ELTA 3DMJA 1YDLA 1HBOB 5BYRA 4J9MA 5CD4H 4GVBB 4CYUA 2OHDA 3W66A 4OHZA 3QWPA 2LQ8A 4W92B 1RT3B 2UUTA 1IWAA 2KT2A 2QE5A 2KT3A 4USUA 2Z57B 3BS9A 2ACYA 2FUG9 1GTHA 1QD1A 3PO4A 3DLBA 1RT1B 1AUDA 2AP6A 3H2UB 1YJVA 3TZWA 3OHBA 3QGPA 2HSEB 3AOBA 1GFWB 1SV5B 2CADA 5E3PA 3BEGB 3TW0A 2LDYA 2QSWA 1GQEA 2IAJB 4UOHA 1FJ7A 5DZ7A 4PQUA 2V2ZA 2YWKA 2JOQA 3CULA 3CIZA 4G1PA 3KDNA 1T7PA 5GMDA 1RTIB 1WACA 5G4DA 4UY85 3OTEA 1QAIA 5KT7A 2VPYB 5A6WA 2KKHA 3DI6A 2DK2A 4DQQA 2J6TA 2ZBIA 3R6GB 2HS3A 1PYOB 2MZ1A 4B3MJ 3RBZA 3KLIB 1YGYA 2R2TA 2VBWA 4MYTA 4P72A 1TAUA 1NKEA 3SCLE 3NY0A 5GMEA 2Q6BA 2O5DA 1RAHB 3DN9A 1HWJA 1UEUA 2W8KA 1PIEA 5L1LA 2W2OP 3K17A 2BOPA 1KVJA 2Z2YB 4R5PB 3Q2SC 1JKHB 4OZJA 4QZVB 3BN4A 1YRXA 2D3ZA 1SQGA 2M3DA 2W24A 3JQKA 5ETQA 2A3JA 1V3ZA 1TL1B 1FFGB 3H2LA 4JI2F 2EFOA 1U8SA 2V4JB 4PXDA 1S6QB 4JUZA 2AQ4A 5D4LA 3LP2A 1TKTA 5HROB 3TZYA 3OTCA 3WC2A 2GMLA 3M9OB 4LFAF 4O0IA 1T02A 3I4HX 4NZ7A 2A1BA 4NA3A 4ZN3A 2MQ8A 1WC1A 3OSPA 2I0XA 3QRQA 4NI2A 3KWMA 1FFSB 1JLGB 4WP8A 4JI7J 4RWXA 2D1CA 2V2KA 2HVDA 1TL5A 4J9RA 1KBRA 3S6EA 3O2IA 3CGIA 1C0TA 2VDHA 2ZKUA 4OI6A 3D28A 1F5AA 3V5RA 3CJQA 1XR7A 1UFLA 1MROA 2XMJA 3V6DA 1HBNA 3UDLA 3HF5A 2DHAA 2Y8WA 4L3NA 2HHSA 2OPSB 1XMQF 4F0HA 1UVNA 4Q2LA 4PKDB 4OI0A 4ILRA 4RX6A 3R2CJ 4NXNF 1MWZA 4MYUA 1PAUB 5HMYA 1C4AA 3H20A 3JQJA 3SMZA 5B0EA 3EXCX 3NP5A 3OTDA 2R8JA 4DR3F 3K5NA 3PR4A 5LT5A 4DDFA 3EZ5A 4OI2A 2IM3A 3N5FA 1RWKB 4J37A 3EWGA 1X9WA 1HHQA 1GEHA 2UUBF 1APSA 3MFHA 2XY5A 2CZVC 2FY1A 5HBMA 1FK9A 4G3IA 3KLEB 2B43A 4NMLA 2MKCA 4NXMJ 1Z2ZA 4N47A 4G6VB 1YBTA 4JI8J 3PRVA 4EZ9A 2B3TB 1QTNB 3HKZD 1UWAA 4ZCKA 4CIOA 3M9NB 1MWYA 1FRMA 4O4RA 2IBOA 1NJXA 5I42B 1WWHA 1QUPA 3DRPB 2BW7A 2J7KA 4OI4A 1KHVA 1IXKA 1K73T 3CCWA 3L95X 3Q24A 3DHXA 1FRKA 5B0FA 1S1TB 5CD4A 3CCTA 5F8LA 4N76A 2WZ1A 2VOOA 4XAKA 2ZOGA 3D0HE 4HTJA 3OFEA 4DR4J 1B3TA 2DNKA 1FO1A 1UKUA 1NK0A 2DR7A 3JYTA 5DM6Q 4YS2A 5DGBA 1SB6A 1HNIA 1DZ5A 2WSFC 2A6OA 3UN2A 3FCWA 1IBCB 3UN3A 2AD9A 3PRBA 3RZAA 2NCKL 4UOCA 3MECA 6FD1A 5THWA 1N32F 3GLJA 1BC6A 1R0AB 3C15A 1RT6B 2B4UA 3R5DA 1RCOB 2I5JA 2XS7A 1T94A 1HA1A 3SQGB 2H1YA 4CQ1A 1A6LA 3BO4A 1LNQA 4EGLA 3IO1A 1NB7A 4USHA 4J9LA 2EK1A 4ZLPA 2VHGA 1Q81T 4ILLA 1I1GA 5DDPC 1M1HA 2MKJA 1N8RT 3PKMA 2F4VJ 2DO0A 3QJJA 4DQIA 1RHKB 2ZH7A 2WSCC 1C1CB 1VQYA 2NUHA 2DRDA 4FPRA 3VAIA 1H7XA 2NSBA 3W65A 3LP0B 2G1HA 4M5JA 3OL8A 3GV5B 4NLVA 2YNGA 2C3UA 2M7SA 3IAM9 1GMWD 2LU2A 3CPWR 2VODA 2CRLA 1BQNA 4HVZA 2W25A 2HFSA 4DSEA 2R2UA 3KDOA 2R7QA 4X4TA 4MIWA 3IR5B 4GKKF 2YX7A 1TQLA 1AT1B 4ZKAA 1VQ4S 5F9LA 3BGOP 2MQQA 2LVWA 5D6GA 2BE2A 2C22A 2DEIA 4WFXA 1TL4A 4ZVEA 3W3SA 2EFPA 2UVVA 3OL9A 2E1PA 3MM9B 3ZZYA 1S0VA 2ZUGA 1S6PB 1FXRA 4C7QA 2H5JB 2IM1A 1RBOB 3PACA 2IRXA 2L9DA 4WU2A 2L41A 2EG1A 1H3DA 4ZVGA 2VQEJ 4NWBA 4Y00A 3GJRB 2YKNA 1SC1B 2CJKA 5JXSA 2FJDB 1R8PA 4DR7F 3M32A 1DRZA 3W2VA 2R8IA 3IM9A 1JQGA 1TKZA 2MLXA 1PSDA 2KI2A 4QIWD 1VQMS 2H5IB 3K5MA 2R2RA 1HFEL 4F0KA 3GG0A 1R7IA 4OX9F 1NK4A 3BN7A 4IOCQ 4NRTA 2YY3A 3QGIA 4AUKA 2QC3A 1M1GA 1R8CA 3PKYA 4EBDA 2BR0A 1L3VA 2MSSA 1IBKF 3THVA 5L38A 2G4BA 3RW6A 3RTVA 3PX6A 4ECSA 3CO0P 2AF6A 3M8QB 3CXCR 3N79A 4QWCA 4DL7A 1H7WA 2MLYA 3C2PA 4K4XA 4K4YA 2U2FA 5L39A 1R8BA 4B3OB 1GXUA 4Y2KA 4G1QA 2PMZD 3OL6A 5KFPA 1D8ZA 4C0BA 3EMTA 3BGRB 1S97A 1U47A 2AEFA 1QTMA 1RQ0A 5AJ3F 1E6VA 3V81A 3QIDA 5G0RA 1AZSA 2E5HA 3SDEB 1SKUB 5HVHA 2CQ0A 2QG9B 3IS9B 1X7VA 1R8HA 3R5BA 2WB4A 2QA2A 5A0YA 4W98A 2GVDA 2D3OR 2FZCB 3PYEA 4H4KC 2XZTB 5CZVA 2W9BB 4OJ3A 3FMBA 2UXDF 1VQOS 1T03B 1EP4B 4YDXA 3JTOA 1MU2A 3NGSA 1FI4A 5L1JA 4DPOA 3D3BJ 4YHHF 1HNXJ 1RAOA 4K0KF 1VK8A 3SV4A 3BF4A 1KEKA 2IC3A 4BCAA 2OO4A 2HMIA 2XSFA 3IM8A 2LXFA 1SUQB 2GA7A 3GCXP 4KGVB 3OLAA 1GNKA 4NCGB 1EQMA 5EUHA 1S0OA 1VK3A 3L9ZA 1WDDA 4WZQA 4L75A 2BANA 3G6YA 2CXEA 3C6UB 4MKBA 1LXNA 3FSYA 2FZKB 4AXJA 1UTAA 2PSZA 2RE1A 1FWKA 2Z56B 4PUOA 3TYTA 1Q7LB 1M5KC 4LSLB 4LQ9A 1F6TA 4XPEA 3NCQA 5J2MB 3PZPA 9RUBA 4I7FB 3UVJA 4X4PA 2V6AA 2ABYA 1QAXA 4KC5A 3I82A 1XMOJ 4X4UA 5B7WA 4J90A 3QMQA 2XMVA 3A8IA 4KV8A 3M8PB 2CVEA 1UAWA 2M88A 3R5AA 4DCJB 5KG5A 3ADAC 1NDKA 3KLGA 4OYOA 3R9LA 4DV5F 1LWCB 3D5MA 5AE3A 5EX3A 2AU0A 2LP4A 4PYDA 5D15A 3TQ1A 3DKDA 4DR1J 1B70B 4DJBA 1WF1A 1WSRA 3T41A 2W2QP 4HH1A 2P2CB 4WE1A 2ZBRA 3LP1B 1Q1KA 4DF4A 3GQCA 4V1Ak 1I6JA 1DQ8A 3NXZA 2W4PA 3DM2B 1S1VA 2RAQA 2Z2LA 1X4GA 2RHSB 2GIFA 2N4DA 2VJUA 1IM4A 4IO1A 2WB1D 2F5GA 2OEKA 4YDDB 4DHVA 2KXNB 4QYZK 2HW3A 2HS0A 3OXGA 2EK6A 2QGFB 2P9GA 2JEGA 2A2DA 1Q8LA 3KLHA 4F26A 1VRUA 1F3FA 3WZ0A 3N0VA 2VFVA 5CHCB 3DXSX 1RAIB 3D6TB 1FT8A 1R0BG 3NOGA 4HHUA 3IFEA 5B0AA 4N8NA 4PWUA 5EDWA 4PPZA 3PEHA 4FDFA 4DV3J 3PYGA 2H51B 5F8JA 1Y5NB 2E29A 1H2VZ 2CPFA 3P49B 3H4DA 3ENAA 2XHCA 3I5CA 1X0FA 1VQ5S 4PXCA 3SV3A 1WG4A 4TY8A 1U0HA 3M2UA 3ETMA 4OV1A 2RDDA 2VG6A 2BX6A 4FXWA 4JI0F 1RTDB 3G8SA 5A76A 5GAGU 1HNWJ 1Z1ZA 3H42A 3I5AA 3Q8PB 4K4VA 2HS4A 1TZ0A 3FJ2A 5DDQC 1HQEB 3NRBA 1HR0F 4LF7F 3PW5A 1MWQA 1O5JA 3QLHB 3MM8B 2VL1A 5KG0A 5KFWA 4RNFA 5JJBA 2GW8A 4ZITA 2JEJA 2M9KA 1T05B 4FF1A 4WXOA 2F9DA 2QLBB 4MMOA 3RG6A 1YVFA 2VG7B 2DR8A 1HBMA 2E1CA 5I3UB 1FVSA 3CDBA 4DR5F 1FKOA 4LF6J 1YJNS 1WTFA 2EFQA 3O6QA 3P5TL 2DH9A 1IKWB 4A8FA 4PZVA 4B9LA 1WEYA 4N5SA 3CCJS 2HGLA 4NLWA 2M8DB 1BHNA 2QLJB 1X4HA 4HT7A 1WKJA 1X8DA 4QYRA 3IBCB 3NGKA 2C2MB 2BKPA 5KT5A 3UE2A 1XK8A 3D7SB 1N34J 2DITA 3DLKB 3C46A 3BQ0A 4OZ1A 2QA4G 3N5BA 3WX8A 3X3UA 1YQHA 1Y4ZB 4B3TJ 2EKYA 3NGRA 3B54A 3AB4B 3GIMA 1WG5A 3M30B 3IRWP 4FYYB 4WPAA 1N33F 3KLFB 1RI7A 2F4FA 2CNLB 4A8OA 2YQ0A 2G0IA 1FF2A 1QSLA 4RW9B 4M5GA 3HHEA 3J80Y 1FNXH 2WVDA 4MKYA 1VRTB 3TJ9A 3NGTA 5IC6B 4DL5A 5HQ8A 4FPIA 2D9OA 2M5YA 4I67A 3PYFA 2XZDB 4EWTA 3KFWX 2L3MA 3QZ8A 1EQ0A 3W5YA 1B64A 3E51A 2FGOA 4HH0A 2DGOA 2DNMA 2IYIA 2MEWA 1BWEA 1URNA 5D0RA 1NSQA 4B08A 3PIPQ 4NZ6A 2FVPA 4RW4A 2V2VA 3C14A 4OHYA 2HAIA 3ISNC 1JJ2R 2HZCA 3PFOA 2K7JA 4WYWA 3GILA 3PY8A 3M6VA 4M5IA 2CZ9A 5I3PA 1HMVA 3A1YG 4ZP9A 3SCJE 2Q43A 2M70A 4BWJA 2CUYA 2KJVA 4GMKA 2ZHOA 2APOA 2BJEA 2PN6A 2EI5A 4EO8A 4AYBD 5KFLA 1LXJA 4DL0C 2V34A 3VAFA 4GC6A 2LLZA 4A8SA 4LSNA 1TMJA 1WUUA 2Y1LB 3KMQA 2G0CA 3T6BA 2LQBA 3CJKB 3DRYA 1UFWA 2B6AA 1FJGJ 2OKQA 4WFBQ 5K8NA 4LUBA 3B4MA 4LT6A 3RBXA 3UNYA 4ZJQA 2RIJA 3OTOF 2UU9F 4DSKA 1RCXB 2AKWB 3KK2B 4WIQA 4FVCA 3WC0A 3VGSA 2CPIA 3PHTA 3H5XA 3GG1A 3IC1A 2W7OA 2ATLA 2VUGA 3L7OA 3OR2A 2W2NP 4FYVB 4IRCA 5HJYA 2N4CA 3OQ2A 4Q43A 3B6BA 2OEMA 1S7HA 2V63A 3AD9C 3IG1A 2CPDA 3FZBA 1IKYB 1WI6A 2CPHA 2CDQA 5M2UA 5ETTA 2CQGA 1XERA 3ZTRA 3S01A 3G86A 3KUHA 3TP2A 3VV2B 5J2NB 4I2PB 4CLZA 1FRIA 4CH0S 3F73A 3EUNA 1PILA 3SEOA 2KZZA 4C3KA 1GMWA 3RR8A 1YRUA 2CNKB 2V4QA 4IFYA 1LW0A 4CLWA 4FVMA 3K5LA 1SC6A 4YB6A 3H5YA 3CWJA 3H25A 3LOUA 2C2OB 3GFYA 2AYGA 3FEZA 4LFBF 3J7ZT 3R6LB 2EFVA 4PG7A 2N7CA 2W9AA 3OVBA 1WC4A 3PW4A 3UO0A 5DETA 1NJZA 3Q8QB 4C6AA 5A8RB 2VQFJ 3GFXA 4KKOA 1H98A 4DWIA 1V5IB 5LSOA 3HMJG 2DCLA 2PIIA 2XEXA 3CD6S 4ZN1A 4F3MA 1A9NB 2ZM6F 4RW8B 2MPUA 4ZHRB 2RUGA 2OPRB 5U47A 4TU9A 2HHTA 1WOSA 3QGGA 3K89A 4LFCJ 2YPZA 4ZP6A 3E01A 4DUTA 3PX0A 2RF2B 4PG8A 2PDAA 2GHWA 3NL0A 3H40A 8RUCA 2MQLA 3GP9A 5HLFB 4CLPA 1FKPA 2ZBCA 2DO4A 3HFKA 2OPPB 3PR5B 2VKRA 5K8OA 2X7IA 4RBTA 2DXDA 2OPQA 2HFZA 4TYAA 2ROEA 2ZNZA 3W60A 5GVQA 1U1PA 2KXHA 1C2PA 2AJ0A 4DL6A 3RW7A 2VA2A 4A8YA 3DLEA 4NLDA 4JYAF 5IOLA 5J2PB 4ED5A 3LGHA 5T7LB 3TO8A 2AT1B 2J9EA 5IM0A 2RDIA 3IRXB 1YJUA 4LIWA 2FHJD 1DJ0A 2CPXA 4ZLLA 2HNDA 5HMWA 3G87A 3DLGB 4F4YA 2MYFA 5SUHA 2UUAF 2AEMA 1QY7A 3HVTA 4LVNP 2W7AA 3T1YF 2E5GA 1S77D 5EN1A 1TVRB 2G1DA 1GXTA 3M1VB 1RSCA 1WI8A 3CE8A 4X64F 3SSSA 2X3DA 2E44A 2IHR1 4MAKA 5HJXA 2I9SA 1IN0A 1S6OA 2B9WA 1ZM2A 2CPJA 3FCVA 2J9DE 3D1QA 3G71S 5E3AA 4QWDA 1QE1A 1JLBA 3FDSA 2HEKA 3GU0A 1SL1A 4UZCA 4KB7A 3TJ8A 5CABA 3WIUA 3PDNA 1TL7A 4AL6A 3M8RA 1YJ9S 3OPKA 2HFOA 2RKIA 3FFIA 4RBUA 2BM1A 3GIRA 4KGMA 3OHAA 3BV8A 2Y1JA 2BDPA 4V19J 2K3IA 3FBBA 2UVWA 3BKTA 3PG9A 1KKHA 1WD6A 2ASYA 3HSZA 4QIVA 1U09A 2JLFA 2WVBA 4Y65A 3OXLA 2HHUA 1RBLA 2LA6A 3HJVA 5ETSA 2R7UA 3DMJB 1MSWD 2NSCA 1HD0A 4R0EA 4ALZA 3A8JA 4LBPA 5DZ6A 1L3KA 2WK4A 4CYUB 1V5VA 4ZVTB 4RLEA 2FJEB 3VVTA 4RUBA 2W01A 3AJ2A 4NCAA 3FBFA 1X0PA 4QWBA 3ZC4A 1X9MA 1M90T 2EG2A 2ZH8A 4RL1A 1K8AT 4OMFG 1M5VC 3ZO7A 2C2RA 1RWMB 1JIHA 4ANDA 4K4SA 1JJCB 3UPFA 1XNQJ 2PE8A 2KTQA 2FVCA 5C42A 5AXLA 2F1FA 4FKYA 4B3MF 1Y11A 3CEDA 3CUNA 1JLCA 4WZMA 2CQ2A 1EHWA 2IMOA 3MUMP 4DL2A 2COLA 5H9FK 4PQUB 1H74A 2CQ1A 5K8MA 4PYAA 1LWXA 3ET6A 3OVAA 3LPEA 4EBEA 4CO1A 1W26A 1H2UX 2AX0A 4QU6A 2QFJA 4F2SA 2WRMA 3DI6B 2PGCA 1ZETA 2HQ3A 2X1FA 2VPZB 1YRTA 4KSEB 2CQ3A 2EXUA 1PKUA 4XIUA 4WKYA 4JI4F 3SBMA 1FVQA 3US5A 3NNCA 1VQ8S 4QOTA 2E1AA 1Q16B 1HYSA 2HLTA 2DR6A 1KLMA 1QAJA 1SH2A 3RB4A 2HQGA 3NS7B 2U1AA 5HN0A 1SPBP 2HHHF 4WYLA 3WQPA 1TFWA 3DLHA 2NXCA 1D9DA 1R8AA 1C0UA 3V2UC 2HYIB 1LWFA 4HTIA 2UVUA 1W2BR 4JI7F 3HSJA 5KFFA 1NJIT 3CJ5A 3M2VA 1DLOA 3VAKA 4ZPTR 1VQKS 3GIKA 1UJ5A 3EVOA 4NLQA 1FXLA 2VONA 1HWKA 3DRRA 2OJ3A 4CH7A 2JDJA 2C2DA 2DGQA 1RT4A 3OVSA 1KSPA 2CQDA 3LP2B 1CJTA 2VA3A 4M63A 5KFTA 4O3RA 2PI5A 4NLSA 1P8GA 1VS3A 1ZM4A 1R27B 2DHGA 4A8WA 2AW0A 2HFVA 1G7CB 4TN2A 5ETRA 2R4FA 5A8WA 4TU8A 5H1SV 1FDNA 5IZHA 1NB2A 4NI2B 3WBZA 4KPYA 5KFVA 1T9XA 3GZ7A 1HI8A 2FLOA 1RT2A 1DQAA 3JS9A 4QWEA 1CS4A 5IQQA 2OUGA 2ZWOA 1C0TB 2Z2MA 3ZZUA 1QJHA 3P4UB 1B7YB 4JI8F 1MROB 1D8YA 1R31A 3V6DB 1HBNB 4ENOA 2P6SA 1VIXA 3J7YI 2CA9A 3UR3C 1V3RA 3N01A 2VJVA 3W8PA 1TV6A 3HFVA 4XDCA 1F0XA 1T9WA 2WVFA 4DSJA 4KIAA 4X65J 3DC2A 3G8TA 4BS2A 1F1BB 4NLPA 2ZH2A 4DR4F 4U67Q 1I5OB 4CLKA 3EGNA 1T11A 3C66A 3DXBA 1UP1A 4ES3A 5HBMB 1FK9B 4RR5A 4LR9A 3Q2TC 3PO5A 3FUYA 2W9CA 1JMTA 3PVXA 5L8RC 1D09B 5T41A 1GX6A 2FGCA 5I3QA 4Y34A 4MFBA 4O23A 1KQFB 3AHPA 3UD5A 1N48A 3T5HA 2E9TA 1UMJA 2QRRA 2PA8D 3D9BA 1RDRA 4AQYJ 2NQPA 2NLWA 3T3FA 3LALA 4CO4A 3U02A 4J9QA 4DS4A 3W62A 1NO8A 3THTA 2RH3A 3E8OA 4RO0A 2UP1A 3KHGA 3QNWB 1FD2A 3CF5Q 4ECUA 5KG4A 3W9HA 4UOFA 3NNHA 3JYTB 3GWCA 4ANEA 3R1LA 1RWOB 1HNIB 4LR8A 2DJWA 2WOMA 4TU7A 3WHIA 4LF9J 2Y1IA 2HK3A 3RBEA 3MECB 5ETOA 2F4VF 4B9SA 4GKJJ 1HQUA 3J81U 1U7LA 5L46A 2YKPA 2B4VA 3MEGB 3NNAA 2XGQA 2KDOA 3C15B 3H2VE 3EXYA 2I6WA 1M5PC 3NS5A 4C8OA 1C1BA 4PAAA 4YMEA 4ZCMA 2EC2A 2I5JB 4I1TA 1DTTA 1NK7A 1NK6A 4DXLA 2V8GA 4H4OA 4LF5J 3HZGA 4ID5A 1RA6A 2IRYA 2Q66A 2UUCJ 2ZZMA 2IVFB 2XS5A 1LWEA 3A8KA 3BBFA 2XMWA 1J2VA 4CCHA 2DISA 2N3LA 3Q8SB 2Z30B 2NZ4A 3CT9A 2RHQB 3VAMA 4DV1J 4CT8A 2LQ5A 2OI2A 2XNRA 2IMWP 4NLYA 4ES2A 4JOUA 2OTJS 2GX8A 1KQKA 2DGSA 2E5JA 3IR6B 1IWGA 2ALYB 4DPXA 2R2SA 4DUZJ 3M8ZA 4WIIA 4H4MA 3NAHA 3DNCA 4CLSA 5IC4B 5F8IA 2YNGB 5D0EA 2QL7B 2EVZA 2UXBJ 4USJC 3KHHA 4KYZA 4JV5J 1BQNB 4ED8A 3DDIA 3RAQA 4IDKA 4KBIA 1IKXA 1Q78A 4J91A 1VISA 4TLRA 1RA7A 1YJ7A 1B0VA 1E6YA 2MHEA 4QPXA 3UWTA 3AOCA 3JTNA 4QIEA 3DHWC 5MAOA 1ZPWX 4K59A 2BE2B 5D3GA 1FNMA 4CWBA 3OSNA 4LRBA 2CQIA 4OX6A 2M52A 1TKXA 2YBVA 3QRPA 2OFGX 3D67A 4R0JA 5D8HB 1VFJA 3ZXWA 4ZVUB 2HWIA 2RQ4A 3DOMA 4LRAA 1NXIA 4QYZJ 1FE4A 4EFAC 4KO0A 2IVYA 1X31C 2FLNA 2K8GA 2YKNB 2W4DA 2G2ZA 4CDIA 2R7SA 3GYNA 3M32B 2HBYB 4C3LA 3W2VB 2PMHA 2HFNA 1TKZB 2IA0A 1KP6A 5FLXY 4Q8EA 4FXDA 4UUWA 3J7Z5 4X4OA 1FDDA 2GQQA 3R5CA 2BE7D 2C28A 2DRAA 4N8OA 3Q8RB 1SKRA 1OIAA 1CQNA 4K2JA 2HIYA 3S1TA 2KFYA 3LPYA 4OQJA 2LFVA 1F60B 3UDEA 1UW4A 1WHYA 2VFUA 1VJWA 3L09A 4FYDA 4CO3A 1HKAA 3WX4A 2YX1A 2N3OA 5HVFA 5HROA 1VMBA 2JLGA 5F8HA 5EWFA 1OJ4A 2OD4A 1HNXF 4ZJOA 3FSIA 2FLLA 3FKBA 3G6VA 2I8EA 2AWZA 1ZS6A 2NYHA 4NLOA 4DPYA 4ED0A 3LA0A 1KWMA 1NBEB 2Q79A 4G1QB 2V67A 5JUMA 3ELHA 2FC8A 5HANA 3VWSA 3EX7B 2LYVA 4OIXA 1E6VB 2GJFA 3V81B 5G0RB 3CMES 1AZSB 3CB4A 2YWGA 5DO2A 3FQLA 4LJMA 4P10A 3P45B 5GAEI 1Q82T 5A0YB 2GVDB 3G82A 4YB7A 4JI2J 3ZNUA 5J1EA 2P9CA 2BW2A 4G1IA 2YWFA 4AL5A 1CQMA 3TJAA 1MU2B 2C2KB 4LFAJ 4JI5J 2Y3YA 5F0UA 1FKAF 4DF8A 1X4BA 1XMOF 4CP5A 2IC3B 2HMIB 1RHUB 2XM3A 4O3QA 2OGUA 3FSXA 1LFWA 1K44A 4URQU 2VPWB 4ECVA 2KL8A 1YSJA 3QJPA 1H0HB 5F3TA 4ZP8A 4Y2AA 1D1UA 1WF0A 3KLEA 2BANB 5LM7E 2P9EA 4R25A 3CDWA 3WIVA 1ZPVA 4F4WA 1SC4B 4U8YA 3D0IE 2BJ8A 4PUOB 2DNRA 1P9YA 1XMQJ 4Q44A 1GH8A 4NEZA 1FTRA 4NXNJ 4I6YA 2AJ4A 3ONQA 3OR1A 1FWLA 3UVJB 3HZEA 1FX2A 3MWBA 4MT1A 5LJ5Y 3AH6A 1B7FA 2GZOA 4DR3J 4XTTA 1WTBA 1VQ9S 2HPUA 3VVUA 1NSPA 3WDOA 1B0PA 5HATA 4KV8B 2E5LJ 4OZ5A 1NMEB 7FDRA 2GAGC 3A3PB 1Y7PA 5L1KA 3DLJA 1ZOTA 2QL5B 1R89A 3KLGB 1Y10A 1Q8BA 1RB0A 2BQRA 2XYPB 3CD0A 2HFUA 1HPZA 5DDRC 2VV5A 2KJWA 4DV3F 2JEIA 4C48A 2IDLA 3T5KA 1P1TA 4WE1B 3TX0A 3M6UA 2L08A 4DQSA 1S1VB 2J5AA 1FNOA 2WCXA 4OX8A 4ATNA 3CJ2A 4ECRA 3G2XA 1HNWF 2WONA 4P2SA 4RW6A 3R27A 4RUHA 1GXLA 1K1QA 5B0BA 4ETXA 3KLHB 3CSKA 1YBAA 1LW2A 1VRUB 1S72S 2GQ2A 4JV2A 1FE0A 2AYMA 2DXFA 5CA5A 4CO2A 3GJSB 3TAMA 4X2BA 2JX2A 1X5TA 1EJ7L 4YB5A 4DV7F 1WHVA 2H9ZA 4I68A 3RJMB 3D6HB 1RWWB 4ECQA 2VPXB 1HNZJ 3DCAA 5KAKA 5KG6A 4LIRA 1D0EA 3D4JA 1ZH5A 1H72C 1PJ5A 2GGPA 4LF6F 1C1CA 4TY8B 1U0HB 3M2UB 1N6QA 1U6FA 2VG6B 1NH8A 4OYZA 3CMQA 1U2RA 4PABA 2WBMA 3VAJA 4LRDA 1SKWA 3K5OA 3TRGA 2EWHA 1NHUA 2Y0BB 2XZWA 3RRGA 5KFXA 5DQIA 4EEYA 2BJ7A 4OYBA 2C1EB 4TXSA 2YXLA 3DGPA 2PI4A 2WBRA 1N34F 1ZAWA 4ECYA 3PW2A 1S48A 1HBMB 4DZDA 1FKOB 4LBHA 4N41A 4BLGA 4OYMA 2IYGA 1FHTA 3O8WA 3OJSA 1HW8A 3PXGa 3P3DA 4LREA 1N36J 2FY8A 3IGVA 1DARA 2YX4A 4X4QA 2WTFA 1VLOA 1XEZA 3N6LA 1NDPA 4DL3A 2DR9A 5IWAJ 4WBFA 5KFQA 4ZVPB 1IR1A 2AJQA 2MZRA 3O1LA 4MH8A 2F9JA 1IJEB 3MCMA 5CAAA 3BDPA 1AB8A 3MM7A 5KFGA 3SXLA 5BJRA 3QBCA 1OYEA 4CLUA 3EVMA 4WFZA 3QJLA 3V6KA 3MM5A 2HGNA 3EDQB 4CNZA 5KG1A 5CYMA 2QO3A 2AYBA 1HNVA 4DZ6A 3RB6A 5KFRA 1N56A 2RMLA 4BDPA 1TELA 3H5SA 3IMQJ 4U9RA 4F02A 2CVIA 3MCOA 3Q23A 4WF9Q 1YZ6A 4QPTA 3I0RA 4ES1A 5JVGQ 3PX4A 3SCIE 1OS5A 1PCAA 5B0CA 3KJQB 1IBLJ 1HLWA 3L3CA 3I9V9 2DCUB 1U1RA 2MJNA 2AJ1A 1CSJA 2PC6A 4NASA 4FBUA 1SQFA 4RW4B 3C14B 1J27A 4EI2A 3KMSA 1WC5A 4JB8B 3PJXA 3BGRA 3MR6A 3K8VA 2GS8A 2N82B 5CYJA 3AXKA 5KFCA 3LUYA 2JC1A 1ZA1B 5D0HA 1HMVB 5DS7A 4E98A 4OX9J 3K2YA 4XK8C 3JSBA 4C0OC 4QR0A 5FLXU 1JXEA 3RB3A 1KTQA 4B17A 5JVHQ 2DNOA 2FJVA 2LQ9A 1T03A 2AZ3A 4F4AA 2WW8A 3D3CJ 1OY6A 3HX9A 3MM6A 4LSNB 1HW9A 2XWXA 1T0TV 3KG1A 2B6AB 2LQJA 5DDOC 2DH8A 3M9MB 4ZIWA 1ZAVA 1F2GA 2OAUA 4BWMA 3MEEA 5FD1A 2QT7A 2ZHBA 1RKJA 5EGYA 3OR2B 4O3SA 2RRNA 4DSLA 3CMAS 1UVLA 4U8VA 3IG1B 3PEJA 4LVOP 3K57A 5KG7A 4DQPA 1J5EJ 2UXDJ 5LOQA 3N4WA 4GVLA 2RS8A 2SXLA 5KFJA 4YHHJ 3V4IA 1MMLA 4K0KJ 1FTCA 2VQFF 1YJRA 1OSCA 3P6YC 1X5SA 3RAXA 2W7PA 3FCHA 4ZP7A 5LXYA 6AT1B 2CWKA 3W9IA 2A0FB 2M0GB 4USMA 5F0WA 2FJXA 3R5JB 4LFCF 2GHPA 4RW7A 3QT8A 4ITSA 5F41A 2FB0A 3CC4S 4OHXA 5C24A 4C98A 4ED1A 2QTWA 2EBGA 4IFYB 1LW0B 2QJ3A 2CPEA 3W1YC 4HR2A 4TY9A 2RNEA 2KYXA 3K59A 2HKEA 2HK2A 5KFIA 1UWBA 2RU9A 5LMUJ 3UDVA 2BZ2A 2YNHA 1VQPS 1S9FA 2J9CA 2IM0A 2IA6A 2HVHA 4KKOB 5H9FJ 5KG2A 4PWDA 1BQMA 3G6ES 2KFNA 3HDSA 5AXNA 3NCPA 2YNIA 3A3OB 3K5PA 4FXVA 4Y2CA 2DGUA 2ZBQA 4NCBA 3MR5A 3QFWA 1PAEX 1S7IA 1AXQA 2QLXA 3E01B 1RWVB 1N4LA 2HNZA 3TA0A 1YZ7A 3H59A 3JSRA 3FMWA 4ZPVR 4DCPB 1FRLA 2AGOA 1WDTA 1NKCA 2K06A 2MDAA 5KFZA 1RT5A 1FKPB 3VAGA 4ZVSB 4IR1A 3PCOB 2DVIA 3TANA 4IOBA 4Z7YA 2OPQB 4JI6J 1D9FA 2QA4S 2HVIA 3HSGA 1EZZB 2R7TA 1P6TA 4AFFA 3MI7X 1OY9A 3VCDA 2F40A 4Q2MA 1MN7A 3ENWA 2V8PA 2DHXA 3P5BP 3BR8A 3HHLC 1PBAA 4KFBA 4QW9A 4C0HA 3ILJA 3MAHA 1P9QC 5IM0B 3GPAA 3EGZA 2HBRB 2DNZA 2ZD1A 2Q3PA 4A4JA 1MN9A 4DX8H 4KGZB 1JLEA 2MXYA 2BEFA 2W2PP 2IPOB 1CULA 5IQ6A 2MZQA 3HVTB 5KFMA 2AV5A 5I3UA 2GIRA 4F25A 1BE4A 3ZZ0A 3EPGA 3OFGA 5SZTA 4B3RF 3CCVS 2FDNA 2C2EA 4Z2XA 1PYSB 3AJDA 2XSJB 3KG4A 3NEKA 3TEHB 4L76A 5K9FA 2CPYA 3OXFA 2LXUA 2UV8G 3ZTOA 2DY1A 2MZTA 1QE1B 1JLBB 3EICA 4UW2A 1CJVA 2YKOA 5IS2A 1YITS 2VC0A 3J81j 2DBBA 4KT0C 2DRBA 1TL7B 3K58A 2MGZA 1IKVA 1CJKA 2RKIB 3H98A 4DSIA 4OZ0A 2W8LA 3FFIB 3MD3A 2BM0A 1AW0A 4F4ZA 2P5VA 3HHLD 3JAMU 2X51A 1KTVA 4IH5A 2YQ1A 3MCSA 1NLKL 3D6FB 5J1PA 3QAUA 3MPVA 4Q45A 2H3EB 4J9NA 2J0WA 1TP7A 4F8RA 3T9ZA 5H9EK 3ZZPA 4GO5X 5HQLA 1AROP 2X3GA 4FNHA 2DY9A 3M2RA 1HL6A 5E3RA 2MB0B 2RD5C 1RJJA 5LSLA 1F3VA 2H5EA 2HRTA 4PXBA 2VZ9A 2YH1A 3HVWA 1IJFB 1V6HA 1ZYQA 1RAJA 3L7PA 4B9TA 3QATA 1U1MA 4U7CA 4M5MA 3HSDA 4L3KA 3D6MB 1RWPB 4YB1P 4J7CA 1ZZFA 4PCQA 1S6UA 3UN5A 4DLEA 2WVCA 2FVQA 4O44A 1WKKA 2DNNA 1VYAA 1NNDA 4Q5VA 2ZH9A 4DR2J 1N33J 2ASJA 3G9CA 2H65B 3BZQA 3EZOA 4EZ6A 3CJ4A 5C42B 2KRBA 4ETZA 1FRXA 1JLCB 3AA8A 1YI2S 3KG0A 1TFYA 1VQ6S 2R7OA 4NYPA 2DNHA 3EDRB 5J2QA 1SL0A 4CLTA 1QVGR 4H54A 3W64A 4L74A 3QO9A 3ET6B 2X1BA 1PBUA 2J0SD 2FVSA 3MEDA 2RQMA 4P74A 4M5DA 3DOKA 1N5VA 4HHJA 1VBKA 4EBCA 2E7VA 5KFDA 3T1HF 2GJ2A 5GADI 1XNRJ 4DG1A 3KK3A 3MMAA 4I64A 1HYSB 3FBEA 2UZAA 3BPDA 3CW2C 1TL3A 1WELA 1KLMB 1H2TZ 5M2RA 4PQAA 3H0PA 2PEHA 4NRUA 3IA0A 3HKWA 3H7HB 4RNNA 1Q7YT 2Z58B 2XYGB 1YLXA 1G3OA 1C0UB 2CIMA 3MAQA 1LWFB 2VH7A 1L3UA 2YQ3A 2LCWA 1KD1T 4NYOA 3ZTQA 3M2VB 1DLOB 4LF4J 2KM8B 3PFEA 2CPZA 5M2PA 1I94J 2HG4A 5HMXA 3OTOJ 3DRRB 2HVEA 4DFMA 3DU6A 1EAYC 3D1OA 4MKAA 4NA1A 1RT4B 1CJTB 1FFWB 4ELVA 1BY9A 5HP1A 2XLIA 3ULHA 5KT2A 2DEJA 4MK8A 4USKA 4X65F 5A8WB 5IXUA 4DX6A 2K1RA 4FNIA 3TARA 3HVAA 5IFMA 1U6BA 3ILOA 4Q7AA 3MPYA 2AIRB 1W2IA 3KK1A 1YK9A 2I38A 1H38A 1RT2B 3PJ9A 1N54B 1CS4B 3GR1A 1NK5A 4FBTA 2ALZA 5F3ZA 2KT5A 3BO2A 3PYDA 2OPRA 2C3MA 1XN9A 5LL6d 2XMAA 4UQGA 4DEZA 2QYGA 1Z4UA 4KR0B 1IR0A 3TUPA 1TV6B 4PWWA 4UF4A 3M8SA 2IFXA 4ICLA 1SIZA 2EC0A 5DQGA 5DQHA 2KO1A 1SH0A 1XIQA 3A12A 3BQ2A 1JLAA 1Z2LA 4B9MA 4NYZA 5L9NA 1ULRA 4OLOA 1TKDA 2KB2A 1URRA 3MTKA 3GFZA 3GFHA 3OUYA 2ZM6J 4DFPA 5A8KA 3N28A 2VU5A 4PG4A 5T7LA 4QU7A 5E41A 2MZSA 1EKRA 4MFBB 4OV6A 3TWZA 2CG8A 2J0XA 1NUEA 2ZZTA 4J9PA 3LGNA 3DFEA 1RE1B 2DGTA 3PJWA 2J6UA 2XYHB 1TK0A 1U49A 2HHQA 2DB1A 3Q8UA 1TVRA 4A46A 4LF5F 3LAKA 4ZVFA 4QW8A 1WEZA 4DPUA 3LWLA 2YWHA 2UUCF 2V8VA 1GX5A 2YWEA 4QCLA 2RUSA 1NPPA 3BB5A 3LQVA 3V6HA 4ZPAA 4XO0A 5KFAA 2J8AA 4WFYA 5E33A 2NPFA 2WOMB 3R7SB 4JYAJ 4TQSA 4HDHA 5HI7A 3IR7B 1SH3A 3MCNA 4NZ0A 1HQUB 1S9GA 1T9TA 2RJZA 1QLNA 2GAHC 2UV8A 1AYEA 1TU0B 4I69A 1NDLA 2I1RA 2HZAA 3MF5A 4HKQA 2CAJA 4DUZF 5L9XA 1C1BB 3IGNA 4O4GA 1NK9A 2ASLA 4WP3A 2NXNA 1DTTB 2ZWPA 3T1YJ 3BJYA 2HQCA 2E7XA 2PA3A 3C3LA 4ZJLA 4H4OB 2DR5A 4ID5B 3R8YA 3KKFA 4DI6A 4FF2A 1LWEB 4X64J 2ILZA 4GO7X 1RTHA 4Y0FA 1UPMB 2G2OA 2YTCA 1N52B 2ZC3A 3CCMS 1FA0A 3HHDA 4QWAA 5CZXA 3CJ8A 4CM0A 1AA1B 3TNVA 2ZBPA 1N5YA 3OLBA 2F65A 5DG8A 1U1KA 3Q89A 1SJ1A 3D54A 4FF4A 1NM2A 4DV2F 3JTPA 1PC4A 3T1AA 2C2ZB 2YKMA 2FJWA 2BVZA 3BPSP 2MTLA 1RT7A 3EM1A 4ZLNA 2V5HG 3KNAA 1N0VC 4H4MB 4C8YA 3MMBB 1X5OA 4JI3F 2XBPA 2PFDA 1RTJA 4Q8FA 4DN0A 1VC6A 3BBCA 4F67A 3QWUA 3BGLA 4X4SA 3TQEA 1JNZB 1DHMA 4C97A 4AT1B 1IR2A 4IDKB 4LF8J 2R3VA 3G6XA 1IKXB 4QIFA 3EJMA 3MPDA 3NOCA 1UFKA 1E6YB 4NLXA 4K4ZA 1IUJA 3PW7A 1KDNA 4MK7A 1XTZA 2BMBA 1OYDA 1S57A 1S1WA 4RWWA 5D3GB 4ER8A 4ZOSA 3RB0A 1Q79A 4N7TA 1YHQS 3UCZP 1TKXB 5RUBA 2G13A 2UVRA 3UD4P 1KR4A 4HACB 3TEGA 1UVJA 2QN6B 3HPOA 2O67A 1KOHA 1M5SA 4USWA 3QIPA 2J9DA 1ITPA 1VBZA 1FD8A 2CZ4A 3BBBA 4TVAB 4D3GA 4WCEQ 3DOMB 4RU9A 2MJUA 3I0SA 3T9NA 4P6QA 1RAFB 1KLNA 3B78A 1TTHB 3A4TA 4KO0B 1GTEA 2KHDA 2YVSA 1PC5A 3G96A 2V9WA 4FS1A 4ECZA 3O3LA 4OJHA 1SKSA 3KJVA 5E7OB 3MTJA 4X62J 5IT9U 1L5UA 3NBPA 3FEXB 3HFZB 2K2PA 4YY3J 2OH2A 4F4XA 2E7WA 5D4NA 1VOMA 1JJ4A 2VF3A 2V4RA 4J5OA 2H4YB 4TKTA 3JQMA 2F8HA 4LMZA 2B9XA 3MPUB 4DV0J 5GADU 3CTRA 3EZUA 1KS2A 2YKAA 3QAEA 4JI4J 2BXJA 3M6WA 3ZTSA 1Y3JA 3CNQP 3VGUA 3MMJA 4F2RA 4JI5F 5BXIA 3ISZA 2XMUA 5E0OA 5F8MA 3KLVA 2HHHJ 5CH7B 3PTWA 1N5TA 2ERRA 1R0CB 4DV6F 3GSDA 1I51B 3CD7A 4IG3A 1HBUA 1Q53A 1VHIA 2V8HA 4I2QA 2PT0A 4ZS6A 1RHQB 2VDIA 2HQIA 3ISND 1RK8A 4M94A 3A13A 2X1AA 4HI1A 2JH3A 3G82B 4OYAA 1BUXA 1D9AA 3QT6A 2QMWA 2XHWA 2HBQB 2FLPA 1F9FA 5J1EB 1Y5LB 2ZNYA 2DNQA 5LSRA 2MY7A 2JFDA 2XTJP 3IXQA 3Q86A 3C16A 3NWRA 4ZVHA 4CO5A 3BGUA 5HK4A 5KFUA 3PM9A 1RWUA 2E5LF 3EVWA 1T9VA 2GQCA 5K14A 3RU0A 3VTIA 3OL7A 2CJ9A 1TMMA 1S59A 1QSSA 3Q22A 3HHLA 4ELUA 1WG1A 2WSEC 1OO0B 5DGAA 4CH1A 3ITHA 1RWXB 4LSZB 1FXDA 2A6MA 2I2YA 1NJYA 1YJWS 4HEA9 3KHRA 5LMNF 3EE3A 1J5OA 4ZVQB 5KTQA 5BR8F 4KHPF 3OR1B 2Q6CA 1B0TA 4HT5A 3MEKA 4CLFA 4CLLA 5KG3A 3NAIA 5C5JA 1GAOA 4P2XA 1FDBA 5B0GA 1JWWA 3BYPA 2RSQA 2EPIA 3W9JA 2ROGA 4ANCA 3NCRA 3ETOA 4Y2IA 3BSCA 4BHQA 3M7VA 3DOLA 2B7CB 2GFFA 1S99A 2ZH4A 2DIUA 3JSMA 1VDHA 4USTA 4OX7A 2F63A 2ADCA 1HPZB 2B51A 3GR0A 4LF2A 2MKSA 3J81Y 4ED6A 3VR1A 2DNYA 1RGVA 5K5MA 1HNZF 2DNGA 2MQOA 3MEGA 1U25A 2B7BB 3HXMA 3D1HA 1IBMJ 2GIQA 2WONB 4K8RA 4R8UA 4RW6B 2BA9A 3HT3A 5GAGI 1ZM3A 2CJXB 3FNNA 3MR3A 1LW2B 4KE5A 4IFVA 2ZUAA 3DDNA 3NWGA 3IP0A 3X1LB 1F5BA 3NS6A 1FX4A 2O1PA 4DR6F 2HHXA 2GMHA 5T14A 3IWXA 3TAMB 5CYQA 1U02A 3RUBL 1TAQA 3U7JA 3NLCA 5C25A 1HWIA 3VZIA 1X60A 3B4DA 2P6TA 2OIHA 3HT0A 4K7QA 3DDKA 4FYWB 3RR7A 3A8EA 2GGPB 2W1BA 1N6QB 4O3NA 1LK7A 4AE5A 2D74B 5GMKa 2CFXA 1UVKA 4RU2A 3FRZA 4RNMA 2EW9A 4M5HA 1N36F 2CKWA 4F04B 3M05A 4C11A 2ZZNA 4OZ3A 1QUVA 1YKWA 2BYCA 2AX1A 4MJKA 3ILLA 2HLUA 5IWAF 4EYIB 4OYWA 5HVGA 2Z0GA 3POTA 2KHCA 5KT6A 2XMMA 3DGPB 1VBYA 2E9ZA 2ZJPQ 3RBDA 3R7NB 2D7SA 3CJ0A 3J7AN 3GE9A 4IO9Q 2GNKA 1SJFA 5FDLA 1FCAA 1T3OA 1S1UA 1IQTA 4ILMA 9ATCB 5D0GA 4DN9A 3LO3A 3MUVP 1NEEA 4HLBA 4X66J 2AMCB 1CBKA 1ZM9A 1CLFA 3BSAA 3I55S 1RAAB 3KJNB 2JEFA 1O51A 1WSVA 2JWNA 3L7UA 2CQPA 2WAQD 4E2FB 4P71A 4OZNA 1KQGB 2R8KA 2ZE2A 3DYAA 2O01C 1U45A 3DU5A 4I6WA 3KUGA 1YBUA 2VC1A 2ZFHA 3HD2A 2KZMA 5B09A 2B5JA 4H4KA 3D66A 3MM7B 1IBLF 3GB0A 1X4CA 5CCMA 3S8SA 3T5LA 2FJBB 1RACB 3MM5B 2FC9A 4DX5A 1R43A 4IG0A 3AA9A 2CQCA 3QPIA 1ACMB 2JL9A 4HL9A 1GT8A 2H48B 3R5GA 2KG1A 5CYMB 2FZGB 2JSXA 4ZMMA 4YFUA 1VQLS 1HNVB 4F7VA 2BABA 1GMUA 2ZVIA 2FJAB 4USIA 3U1MA 2P8IA 5KFNA 3PNIA 2UUWA 3P8BB 4NE9C 4YOEA 1MNEA 1Q95G 1XBWA 1KC8T 4C8NA 4PPDA 2IRUA 1JLFA 2C42A 1WC3A 2PEBA 3VF0B 2CJAA 2UXCJ 2GO8A 5I4MA 1LK5A 4AD6A 3IWNC 1WEXA 4JI1J 4QR2A 2NXJA 3I0RB 1LV5A 3BDEA 1RABB 4OYXA 1S9EA 1KQSR 4ZPBA 4KTQA 3VAHA 3M8YA 1O8BA 4YR0A 1U4BA 2QL9B 3C6TA 1M0SA 4XDDA 4ID8A 2V8DA 1WOOA 4IH6A 4XPCA 1K0TA 1D3WA 3TAPA 1CC8A 2O3DA 3JB9k 2CQ4A 1OSDA 3O5TB 1RZMA 3AJ1A 1J5EF 1UZHA 3MFIA 2M4MA 3OW2R 3MMCA 3MM6B 4WKRA 1SJ4P 4ZVOB 2CYYA 1TKTB 5L1IA 2DKOB 4J9UE 2XLJA 4MK9A 2FTRA 3W8GA 3LANA 1NHKL 2MY8A 5K20B 3MEEB 5HSPA 1REVA 4KQZA 2MKIA 2HBZB 3W5ZA 2Z8QA 1UW9A 2XNQA 1KVKA 1T9UA 2HHVA 2B8PA 1Q4RA 1S1XA 2LEPA 1EETA 4UUXA 5ETMA 5AE1A 1U24A 1U6ZA 5KFYA 5LMUF 4NXMF 4KHMA 1R3NA 4DX7A 2MSTA 4ECTA 5H9EJ 2C2NA 1QM9A 3V4IB 2ZH6A 1NU4A 5KFKA 3SQOP 3T6JA 3H5UA 3R3TA 2B0GA 2HNYA 2XCPA 4RKUC 3U1NA 4O0NA 3HCXA 3GIIA 2R7RA 2XG8A 4C8ZA 2ZKTA 4AXIA 2KM8C 2XY7A 3HD1A 4K5RA 4RW7B 2JNJA 4B3SJ 3L4BC 1OPZA 5AT1B 4OFZA 3OFFA 5C24B 1BQXA 4OHWA 3C19A 3EGWB 4PRFA 4ZVRB 3KYLA 4YR3A 2CJBA 4ZDNA 1S5ZA 1G2EA 4USVA 1N5SA 1S49A 1UWBB 3QSYB 2OTLS 2YNFA 2YNHB 1P27B 2D3O1 1PG5B 1CJUA 1Q5YA 1WORA 4BC9A 4C8MA 4JI6F 1P1LA 2OLWA 4RNOA 4ZPDA 2FHMA 3GMGA 1DAXA 1Q86T 2QX0A 2VG5A 1NZ8A 4PWDB 3BM7A 1BQMB 3ZZOA 2YNIB 2VFSA 3NG8A 4DV4J 3OBIA 2IM2A 4ECXA 2HNZB 2BQ3A 1OWXA 1G4CA 1H73A 4K50A 3TAQA 1VCTA 1MMNA 4MTPA 3CJSA 1HARA 3VHQA 2C3OA 1RT5B 1VI7A 2GVZA 1N88A 3QFHA 4DUYJ 1RYSA 1OMSA 1WHXA 3LW5C 3W2WA 5CXTA 2AYEA 1TR0A 1RISA 2G2YA 1KRPA 3SFUA 5D4PA 2GHVC 5HO4A 2XC9A 1DTQA 3T19A 4OL8A 3CCZA 1RU1A 4LRCA 2MZJA 1PYTA 2KVIA 3ICLA 3IN5A 2ZH1A 4NLRA 3MGJA 4IRKA 4KFBB 4L6V3 1NJWA 2VASA 2ZD1B 4V19X 2D3UA 3AQPA 1IQZA 4D3HA 3MD1A 4DV7J 4F4KA 2HWHA 3I56S 1JLQA 3MAAA 1OPIA 1JLEB 1ZAXA 3BSNA 4NLGA 1CULB 3OT9A 4DU8A 2BJ3A 3TR5A 4Q0BA 1GMVA 4ECWA 4O3OA 3FK4A 3DRSA 3I87A 2PMWA 4J9VA 4CTAA 2V2QA 1A7GE 2LXIA 1HBOA 2V9KA 2DTJA 4DBQA 2NYIA 1QSYA 4GVBA 1GK8A 2Y1RI 4P2FA 1RT3A 2IJFA 1B99A 3TA1A 2HZVA 1Y3KA 2GCFA 3JSYA 1YG0A 2B56A 1KNZA 4NLTA 1UZDA 1NPRA 3NKYA 3Q0AA 4IQMA 3D0GE 1CJVB 1RT1A 2IJNA 4A8MP 2GC8A 1F9EB 5D77A 3GV8B 5F8GA 3UCUP 2FQQB 2F8EX 3BGFA 2MGZB 1IKVB 1HHTP 1CJKB 3AFGA 4ZPCA 2VQEF 1SV5A 2VFRA 1LEOA 2XLKA 2B9YA 4ZLJA 1FERA 4DR2F 1FEEA 4ZA1A 3TI0A 2L48A 2IAJA 2GMJA 4A8QA 2R7XA 2HGMA 5CCLA 2YWWA 2RB7A 1DFDA 3E3XA 3SCKE 2RILA 2DXEA 1RTIA 5EX0A 2ZH3A 4W90B 1NDCA 3M2RB 3V6JA 4IKAA 4JBCA 3CCES 2BJDA 2VB6A 3ENVA 4I4BA 1S79A 1FRHA 2LECA 2X1GA 1ZTWA 2MQPA 3M6XA 2J7UA 3BQ1A 3N6MA 1HWUA 3B8HA 4B9NA 3KHLA 2VBYA 4O44B 1KN6A 3KLIA 1RXOB 2PD1A 1XNRF 5ETNA 8ATCB 4I6AA 2HQDA 1YIJS 3TUZC 2JC0A 4QR1A 4K4UA 5FIIA 3LTOA 5F9NA 4KHRA 3DLLQ 4P75A 1DQ9A 4UQTA 2N7YA 3BYRA 3N6NA 3VZHA 2ILYA 2ATCB 4QQBA 4R5PA 1JKHA 5HQMA 3QRRA 3GJQB 4FZVA 1JXLA 3KOAA 5J2QB 1EX8A 1RLDA 2NS1B 1TL1A 2DNPA 5D78A 4WTYA 2V4JA 4WFAQ 3D68A 1S6QA 3QO9B 4LF4F 4JV0A 3F0NA 1RKIA 2JZ5A 1I94F 3N9UC 3LH2S 2B4PA 5MLCV 1X4AA 3MEDB 1ROFA 2CWXA 4A8KA 1SVDA 1T3NA 3IBFB 4KPCA 4M5DB 3DOKB 2HVZA 2V94A 4TYBA 3CDAA 1KFDA 1NRKA 3W5XA 4DG1B 3KK3B 3FZ2A 4F0MA 2JFKA 3MMAB 4A48A 1JLGA 1TL3B 2QA1A 4QIGA 4HI2A 3NMAA 4IR9A 3SSRA 2AGQA 3MOJB 5EWEA 4NMXA 1K47A 4A8XA 4FN5A 3S7RA 2QEXS 2VOPA 1ZA2B 1X4DA 2OPSA 4W4MA 1UEKA 1BMQB 1QAYA 4M1KA 3M8WA 3F41A 3PHEA 1TK8A 2A18A 3UQSA 5KFOA 2ZJQQ 3HVRA 3H4BA 1W25A 3RRHA 2ZJRQ 3JXOA 2XI2A 2BUNA 3FEYB 3IWLA 1UVIA 5HP1B 4E8UA 1CVJA 3KXDA 1SI9A 2KG0A 1QDUB 1VQNS 2K1RB 3BH7B 1NAQA 1G1XA 2YH0A 4DR1F 4UTGA 2PO4A 3TVYA 3J7YU 4F50A 4P52A 3KK1B 1K0VA 2A10A 5I42A 4BBYA 1X5PA 3SFGA 1R6VA 4U96A 3DRPA 3BREA 4OZ2A 1WKLA 5E2QA 3THPA 2CG4A 1HIYA 2QLFB 3F56A 1UCNA 4JP8A 3MDFA 1S1TA 1JB0C 3I6PA 3MR7A 1F5CA 2QIFA 4C8KA 3ZFVA 3AAWB 1WF2A 2IVMA 2RVJA 2UUBJ 5AXMA 2JRSA 2LEAA 1SJRA 2B8QA 4M5LA 5KT4A 4ICLB 2JVOA 4J9KA 3CIMA 2QSFA 1G6BA 2D69A 4IH7A 1NCLA 1WHWA 4ZIVA 4TNOA 5KT3A 3UI3A 1FJEB 1UJ4A 1JLAB 1VQ7S 1W7WA 1O0PA 2MQMA 2F3JA 2RT3A 1U26A 5HAOA 1S0NA 2KXFA 3OUYB 3HP6A 1OQ6A 2XO6A 5A8KB 1S0MA 1R0AA 1RT6A 3AQOA 4P2MA 1REGX 5BYSA 2ZITA 3BO3A 1V9OA 4DFJA 3V4MA 1TUGB 5EHHA 3NGUA 2V0NA 3QQCD 1KHWA 3SQGA 1S76D 3CCLS 3CVKA 3OD2A 3CC7S 2XY6A 3ENQA 2FD2A 2D41A 5D4OA 1DURA 3QT7A 4DCOB 2C3YA 1YWXA 1S12A 2BACA 1M5OC 2VKZG 5KOXA 1U2FA 3A3NB 3PRDA 4DQRA 3PW0A 5E3CA 1BXNA 2AJFE 2ADBA 1NZAA 4IRDA 2XSJA 1N32J 2IBKA 1T9YA 4G65A 1M5HA 1EIYB 3MHYA 1ZBTA 5GAHI 1RYRA 2NR0A 1Y9OA 3LP0A 2ASDA 2JJ4D 2XULA 2ZH5A 1RTZA 1NPKA 2CJYB 4OJ1A 2NXEA 1UA1A 1S9GB 4Z37A 1JNRB 2VIHA 3HHNB 3AD8C 2IY5B 3IBWA 1VIOA 3I96A 1H6KX 2NZCA 4UZBA 3BH6B 2IJRA 3Q8VA 2XS2A 2R7VA 2KU7A 4CT9A 4O4GB 3JAMY 1PO6A 1RLCL 2A2CA 3C8YA 3PV8A 4M95A 2XO7A
chains in the Genus database with same CATH topology
3ZTSA 1F3FA 1NLKL 1MN9A 1WKLA 3PRVA 2HURA 2HVEA 3VGUA 1HIYA 2B8PA 3EVMA 3G2XA 2BEFA 1UCNA 2HVDA 3Q89A 4W98A 3GP9A 3NGTA 3FBCA 1PAEX 3ELHA 5BXIA 3BBBA 1S59A 1PKUA 2AZ1A 4S0MA 1LEOA 4EK2A 1XIQA 1BE4A 2DY9A 3VVTA 3Q83A 1NB2A 2DXDA 3NGSA 2AZ3A 3EM1A 2CWKA 4F4AA 3FBFA 3FCVA 3DDIA 2B8QA 1NDKA 4DZ6A 3R9LA 2DXEA 2DYAA 2DXFA 3VGVA 3JS9A 3VGSA 3ENAA 1NSPA 3VVUA 1NCLA 3BBCA 3EE3A 5CABA 1NDCA 3DKDA 1BHNA 4ANDA 4O0NA 1NDLA 3ETMA 1W7WA 3FBEA 4UOHA 2VU5A 1XQIA 2BX6A 1NSQA 1JXVA 5IOLA 1WKJA 2ZUAA 4ENOA 4FKYA 4HR2A 3BBFA 4KPCA 4C6AA 3ZTOA 5C7PA 1WKKA 3VGTA 3EJMA 4UOGA 1BUXA 1NPKA 1VYAA 1EHWA 3FC9A 3B6BA 3PJ9A 3MPDA 3EICA 4FKXA 4F36A 4CP5A 1HHQA 1KDNA 1NSKL 3BH7B 1NUEA 1B4SA 3EVOA 1MN7A 1HLWA 1B99A 4ANCA 3FCWA 3FBBA 1NDPA 3BH6B 3Q86A 1S57A 1K44A 4DI6A 2NCKL 3Q8VA 4WBFA 3WX8A 3ZTRA 1U8WA 3NGRA 1NHKL 3B54A 4UOFA 3ZTPA 3EMTA 3GPAA 3ZTQA 1F6TA 1S5ZA 3FKBA 1LWXA 3Q8UA 3NGUA 4DUTA 3Q8YA 4ANEA 3L7UA 5CAAA 1ZS6A 3EVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZTS A;  1F3F A;  1NLK L;  1MN9 A;  1WKL A;  3PRV A;  2HUR A;  2HVE A;  3VGU A;  1HIY A;  2B8P A;  3EVM A;  3G2X A;  2BEF A;  1UCN A;  2HVD A;  3Q89 A;  4W98 A;  3GP9 A;  3NGT A;  3FBC A;  1PAE X;  3ELH A;  5BXI A;  3BBB A;  1S59 A;  1PKU A;  2AZ1 A;  4S0M A;  1LEO A;  4EK2 A;  1XIQ A;  1BE4 A;  2DY9 A;  3VVT A;  3Q83 A;  1NB2 A;  2DXD A;  3NGS A;  2AZ3 A;  3EM1 A;  2CWK A;  4F4A A;  3FBF A;  3FCV A;  3DDI A;  2B8Q A;  1NDK A;  4DZ6 A;  3R9L A;  2DXE A;  2DYA A;  2DXF A;  3VGV A;  3JS9 A;  3VGS A;  3ENA A;  1NSP A;  3VVU A;  1NCL A;  3BBC A;  3EE3 A;  5CAB A;  1NDC A;  3DKD A;  1BHN A;  4AND A;  4O0N A;  1NDL A;  3ETM A;  1W7W A;  3FBE A;  4UOH A;  2VU5 A;  1XQI A;  2BX6 A;  1NSQ A;  1JXV A;  5IOL A;  1WKJ A;  2ZUA A;  4ENO A;  4FKY A;  4HR2 A;  3BBF A;  4KPC A;  4C6A A;  3ZTO A;  5C7P A;  1WKK A;  3VGT A;  3EJM A;  4UOG A;  1BUX A;  1NPK A;  1VYA A;  1EHW A;  3FC9 A;  3B6B A;  3PJ9 A;  3MPD A;  3EIC A;  4FKX A;  4F36 A;  4CP5 A;  1HHQ A;  1KDN A;  1NSK L;  3BH7 B;  1NUE A;  1B4S A;  3EVO A;  1MN7 A;  1HLW A;  1B99 A;  4ANC A;  3FCW A;  3FBB A;  1NDP A;  3BH6 B;  3Q86 A;  1S57 A;  1K44 A;  4DI6 A;  2NCK L;  3Q8V A;  4WBF A;  3WX8 A;  3ZTR A;  1U8W A;  3NGR A;  1NHK L;  3B54 A;  4UOF A;  3ZTP A;  3EMT A;  3GPA A;  3ZTQ A;  1F6T A;  1S5Z A;  3FKB A;  1LWX A;  3Q8U A;  3NGU A;  4DUT A;  3Q8Y A;  4ANE A;  3L7U A;  5CAA A;  1ZS6 A;  3EVW A; 
#chains in the Genus database with same CATH topology
 1VRQ C;  4YR2 A;  4B3R J;  2JVR A;  3AOA A;  2B9E A;  4LF8 F;  4B3T F;  5CQG A;  4ED4 A;  3CCU S;  1RTH B;  3E2E A;  4C9D A;  4WXW A;  2BV3 A;  3BKF A;  2OD6 A;  3MM9 A;  1S6P A;  2XMK A;  1N5Y B;  1XMB A;  3EPI A;  2E9R X;  4LBI A;  2VD3 A;  5A2Q Y;  2MHN A;  4IQX A;  2KYZ A;  2HRY A;  3G4S S;  1OQ3 A;  3U27 A;  2J8S A;  3PIO Q;  1X4E A;  2J6S A;  2YKM B;  1RT7 B;  1XJW B;  1RHJ B;  4CI0 B;  4P73 A;  3I9Z A;  1O6X A;  1OY8 A;  2DHS A;  2Y9H A;  1U1L A;  3GSI A;  2NPI A;  2NUU G;  4IOA Q;  3KJF B;  1RTJ B;  1Y5I B;  1IM6 A;  1BD6 A;  4GKK J;  3M4X A;  4RBV A;  1B4S A;  3SYZ A;  3MOZ A;  4YEA A;  4ERD A;  1C4C A;  1TUW A;  1U8W A;  2BJ9 A;  2OEL A;  1EAR A;  4B9V A;  1RUS A;  2E66 A;  3CJR A;  1HQ2 A;  4IUF A;  4CLY A;  2NXU A;  1S1W B;  1LOU A;  4CZC A;  4X62 F;  1YJT A;  1L3S A;  4YY3 F;  3J80 U;  1HHS A;  2BBE A;  2QMX A;  4K4W A;  5DG7 A;  3LF0 A;  1RP5 A;  3W61 A;  2AEJ A;  4DOZ A;  4DV0 F;  4E0D A;  3QIP B;  4OYP A;  2QFI A;  2DHH A;  3I31 A;  3M8Q A;  3LAM A;  4AL7 A;  4DR7 J;  1NK8 A;  2Y0S D;  2G9O A;  3I0S B;  1AFI A;  1FJG F;  2VIC A;  7FD1 A;  2XMT A;  3RRK A;  4B3O A;  5ADZ A;  2OML A;  2ZDP A;  2DPJ A;  3NGD A;  4JV1 A;  3K8W A;  2QMU B;  2HHW A;  2AJ2 A;  3HO1 A;  3SDE A;  2XCA A;  2HQF A;  3KJV B;  1S4E A;  5LXR A;  4P9S A;  1M1K T;  3MR2 A;  3IS9 A;  5ETL A;  4X4N A;  1WC6 A;  4WP9 A;  1YTY A;  3NBP B;  3R1H A;  4RUC A;  2MQN A;  3FQK A;  2W9B A;  8AT1 B;  2BKO A;  2LU1 A;  2OMO A;  4KJI A;  5IT0 A;  1EP4 A;  2FIU A;  1IBK J;  2CNO B;  2MKY A;  3CDE A;  1HI0 P;  1YX2 A;  1CC7 A;  1RAG B;  5KFB A;  2O66 A;  4Y3C A;  3T1H J;  1UPP A;  5J1N A;  2ZC4 A;  2QYC A;  1LFP A;  1RU2 A;  4DU7 A;  1FEH A;  2CJQ A;  2HWT A;  1SUQ A;  3K0J A;  4NCG A;  2R7W A;  2BJ1 A;  1KVI A;  4NA2 A;  2IIH A;  5IV4 A;  4TQR A;  1PJ6 A;  2DYA A;  1DBD A;  3MXH P;  2ROP A;  5AJ3 J;  5ETV A;  3C6U A;  4M8L A;  5GAE U;  4PXE A;  1XQI A;  1JXV A;  1LKZ A;  1Y0H A;  4DSF A;  5KFH A;  2BKN A;  4IG3 B;  4C4W A;  3CO9 A;  1HBU B;  4LSL A;  4DFK A;  2FHO B;  4I2Q B;  3HUL A;  1KON A;  3GTY X;  4RUA A;  3CJT A;  3ZZT A;  5J2M A;  4I7F A;  3P96 A;  4MKV A;  4FF3 A;  3CCQ S;  3LWM A;  3UCG A;  4UY8 T;  2JLE A;  4KAI A;  2DGW A;  3QT5 A;  1VBX A;  3TZZ A;  1SL2 A;  1S4F A;  4J9O A;  1R6Y A;  3M8P A;  3R7B B;  2YKQ A;  4LR7 A;  4OZL A;  4DL4 A;  2HUR A;  1WNE A;  1VC0 A;  2K3K A;  2FHK A;  3C16 B;  4K2X A;  1SJQ A;  4CNY A;  4F3O A;  3T5J A;  1LWC A;  1U1N A;  4LRF A;  2AZ1 A;  3MZI A;  4M5K A;  2ZEJ A;  3TZX A;  3UW1 A;  2OP5 A;  4ZCL A;  1NSA A;  4WTO B;  4NX9 A;  3AOD A;  3BR9 A;  5DJB A;  5K14 B;  5DLF A;  1FJC A;  2R9L A;  3UDC A;  3CC2 S;  3CD5 A;  4RZR A;  2BRK A;  3CCS S;  5C2G A;  4X4V A;  2H4W B;  5EWG A;  3LP1 A;  1UET A;  2R8G A;  3GON A;  3DM2 A;  3HHL B;  3SI8 A;  3HHK A;  4NOH A;  1FRJ A;  3AT1 B;  4CRJ A;  3ITH B;  4U6P A;  4K5S A;  3MUR P;  2F7V A;  4Y28 C;  3SZ2 A;  1DY3 A;  2VBZ A;  2EKN A;  1WOP A;  4F36 A;  5AE2 A;  1J5O B;  3TVK A;  1N5Q A;  3G8Q A;  2RU3 A;  1SIW B;  1U1O A;  4HYK A;  2M8H A;  2DGX A;  1CPZ A;  1L3T A;  1IBM F;  4CM2 A;  2QLW A;  4DV5 J;  1QVF R;  5B0D A;  3Q8Y A;  2RRB A;  1JJH A;  5ITH A;  4YUD A;  3DOL B;  4C3M A;  2LA4 A;  3O44 A;  1RAE B;  1AUS L;  3GIJ A;  4EU0 A;  2XWY A;  4L73 A;  3JSM B;  1SCJ B;  2KFZ A;  3RAM A;  1RTD A;  2HAF A;  3HI9 A;  4QJV A;  4C8L A;  2K7K A;  2EFN A;  2MKK A;  3LGM A;  2EBE A;  5ETP A;  2PFF B;  3VAL A;  1JX4 A;  3DLE B;  1HQE A;  2DPI A;  2OSR A;  3R2D J;  1VLY A;  4NPO A;  3OFH A;  3QLH A;  2E1M C;  3HM9 A;  3MM8 A;  4GRS A;  5C7P A;  1CEZ A;  3FC9 A;  3AB2 B;  4LF1 A;  4R8U B;  4ZPW R;  2HND B;  2F8M A;  3B82 A;  4Z7C A;  2KVQ E;  4DPT A;  1T05 A;  3J7A 1;  4IFV B;  1Q8I A;  1MLA A;  3U1L A;  4Y2M A;  2MKH A;  3FGV A;  2VG7 A;  1VHF A;  1VQS A;  4Y6I A;  1NKB A;  3AD7 C;  4KH1 B;  3K7R A;  1T8E A;  5GAH U;  1SXL A;  3IAS 9;  3F44 A;  5CYQ B;  2GV1 A;  7AT1 B;  2WVE A;  4JI0 J;  3VQS A;  1UJ6 A;  3KNG A;  2VFT A;  3D2W A;  1IKW A;  1S10 A;  5C25 B;  4L72 B;  4DPW A;  4KGX B;  3VQT A;  2FPH X;  2DT9 A;  1VGY A;  4CO0 A;  4X66 F;  1BLU A;  4OI3 A;  1HR0 J;  4LF7 J;  1U0S A;  3QZ7 A;  4P7V A;  4BC7 A;  3GYX B;  4YP3 A;  2RRA A;  3MMB A;  3H8Y A;  3TUJ C;  2EFG A;  4U95 A;  4WK1 A;  3DLK A;  2GO9 A;  1UL3 A;  5B08 A;  4C11 B;  4FS2 A;  4OYI A;  5IV3 A;  2E1R A;  1Q5V A;  1V3S A;  2DD8 S;  3VGT A;  3POT B;  1SQE A;  2ZVS A;  3M30 A;  2WHO A;  1NHV A;  4DR5 J;  3RYL A;  3KLF A;  3CDU A;  4C2M A;  1VR6 A;  4ZCI A;  4URG A;  3UNG C;  4RW9 A;  4B9U A;  1XNQ F;  1VRT A;  5FDL B;  2XQC A;  3DGV A;  1S1U B;  1N0U A;  4LQ3 A;  3TA2 A;  2Q1L A;  4DV2 J;  5BYQ A;  3EGV A;  2WW4 A;  1TUV A;  4HAC A;  2FYX A;  5K8P A;  3UFC X;  1HD1 A;  4JI3 J;  3FBC A;  1PJ7 A;  1Q8K A;  2R8H A;  5HMZ A;  4S0M A;  4RNH A;  5A2Q U;  2XB2 D;  2RQK A;  1K9M T;  3KUE A;  2ZE2 B;  2V68 A;  3AY0 A;  3DYA B;  4HDG A;  2UXC F;  2XI3 A;  1WC0 A;  4EMD A;  1RAD B;  3HLU A;  4JI1 F;  5IT9 Y;  4WK3 A;  2B5J B;  2Y8Y A;  3GYG A;  5F8N A;  1ELO A;  2CQH A;  3TVZ A;  1T95 A;  4PEO A;  1LQ9 A;  2Z4P A;  1RHR B;  1NH7 A;  3TX8 A;  3CCR S;  4NLU A;  2KH9 A;  3QYY A;  2AHO B;  3I4P A;  4IG0 B;  2DGV A;  2KN4 A;  2J7W A;  4U7U K;  4WWS A;  3SIP B;  4OLP A;  2CQB A;  3I32 A;  3CJK A;  2JHE A;  1XWL A;  4OJG A;  5DG9 A;  4B02 A;  1RHM B;  1JLF B;  1F2H A;  1JK9 B;  2R42 A;  3BSO A;  4OHV A;  3SSQ A;  3KK2 A;  4A47 A;  2ZDO A;  2FHJ A;  4DLG A;  4F3Q A;  1IVZ A;  3BKU A;  3Q83 A;  4YQW A;  1BGX T;  1UA0 A;  1S9E B;  1Q0N A;  1KFS A;  2G0J A;  1XC9 A;  1TK5 A;  5DM7 Q;  1U48 A;  3HJF A;  5ETK A;  5E5N A;  1FDA A;  3C6T B;  1I3O B;  1IKY A;  5IT4 A;  1ZTT A;  5C2C A;  3OV7 A;  1RWN B;  5DLG A;  1AFJ A;  3GJT B;  2V69 A;  2V50 A;  5FJ4 A;  2DH7 A;  4WFN Q;  3QGH A;  4ED2 A;  5J2N A;  4I2P A;  4P7T A;  1U1Q A;  5HL7 Q;  2UU9 J;  2OEJ A;  4ZK7 M;  2YPY A;  3MMC B;  1HWL A;  1UEV A;  4DMZ A;  4TLQ A;  3I5B A;  2POK A;  2B4O A;  1MMD A;  2ZOF A;  2HRU A;  4K4T A;  2FVR A;  2M2B A;  4DV6 J;  2LKZ A;  4X84 A;  1EKS A;  1ICE B;  3OJU A;  4EK2 A;  1PGZ A;  1FES A;  2J76 E;  4EYH B;  4B3S F;  5KFE A;  1HI1 A;  1REV B;  5A6P A;  4M5N A;  5KFS A;  4UT4 A;  3W63 A;  3ZZR A;  4O3P A;  5A8R A;  2GJI A;  1S1X B;  1EET B;  5LJ3 Y;  3VGV A;  3H90 A;  4RW8 A;  4J9S A;  3HK2 A;  4IYQ A;  4ZHR A;  5AXK A;  1F9H A;  4FYX B;  3OTB A;  3FVY A;  4HHH A;  2RQC A;  6FDR A;  4X4R A;  4GC7 A;  4PG6 A;  2QV6 A;  5E3Q A;  4FKX A;  2RF2 A;  2DNL A;  4U7U D;  2HNY B;  4KRW A;  4YN3 B;  2J0Q D;  3TUI C;  3W7B A;  4FP9 A;  1VJQ A;  2AGP A;  4AQY F;  2L9W A;  2MMY A;  4DS5 A;  3MPW A;  5KOW A;  3MUT P;  5HLF A;  4DV4 F;  2XGP A;  3ZTP A;  3AXM A;  4KY3 A;  4LFB J;  2OPP A;  1EB0 A;  2ACM A;  1WJ9 A;  2CNN B;  1BWV A;  3UR0 A;  2H54 B;  1ZZN A;  1UVM A;  2L9N A;  2W4C A;  5LMN J;  4DUY F;  3QSI A;  2Z2Z A;  2YNF B;  5BR8 J;  2OSQ A;  1CG2 A;  2W9C B;  4MIA A;  4KHP J;  5DRK A;  1CJU B;  1U2C A;  4LF9 F;  5J2P A;  2QZ8 A;  1K1S A;  2HHP A;  3IRX A;  4GKJ F;  4ED7 A;  2C3P A;  2VG5 B;  3CJ3 A;  1Y00 A;  2BE9 B;  3DLG A;  3RGI A;  1A0O B;  1VC5 A;  4PG5 A;  4I56 A;  1XR5 A;  1SC3 B;  1X4F A;  3FRY A;  3M1V A;  1KOO A;  3GCW P;  3KTQ A;  3ZZZ A;  4OI1 A;  4EO6 A;  2W2M P;  4NEY A;  2GVZ B;  2VBX A;  1XR6 A;  3W2W B;  2KRR A;  1MG7 A;  1RBA A;  2LMI A;  2ZOM A;  4DV1 F;  2E5I A;  4WU3 A;  1DTQ B;  2CDR B;  4KGK A;  2BQU A;  1SBR A;  4ED3 A;  2UUA J;  4I0W A;  2D9P A;  4QBU A;  3UD3 P;  1MW7 A;  4RJV A;  3ZNJ 1;  2RS2 A;  4URS A;  4DR6 J;  4RPF A;  2BOA A;  2EEY A;  4KH0 B;  4NL5 A;  2UXB F;  3ILI A;  1SJ3 P;  4JV5 F;  2BRL A;  3GV7 B;  2LEB A;  3NMR A;  1JLQ B;  3MAA B;  1X9S A;  4EUV A;  2MLZ A;  4MIB A;  4WJB A;  3EYZ A;  4UOG A;  2ZHA A;  4Q0B B;  3TOQ A;  4N56 A;  2LDI A;  1FWP A;  3DRS B;  2RDJ A;  5JMN A;  3R97 A;  1NSK L;  4N77 A;  2OFH X;  4CTA B;  4PR6 A;  2HIQ A;  2DIV A;  3DRX A;  2IDE A;  2NRE A;  4ELT A;  3DMJ A;  1YDL A;  1HBO B;  5BYR A;  4J9M A;  5CD4 H;  4GVB B;  4CYU A;  2OHD A;  3W66 A;  4OHZ A;  3QWP A;  2LQ8 A;  4W92 B;  1RT3 B;  2UUT A;  1IWA A;  2KT2 A;  2QE5 A;  2KT3 A;  4USU A;  2Z57 B;  3BS9 A;  2ACY A;  2FUG 9;  1GTH A;  1QD1 A;  3PO4 A;  3DLB A;  1RT1 B;  1AUD A;  2AP6 A;  3H2U B;  1YJV A;  3TZW A;  3OHB A;  3QGP A;  2HSE B;  3AOB A;  1GFW B;  1SV5 B;  2CAD A;  5E3P A;  3BEG B;  3TW0 A;  2LDY A;  2QSW A;  1GQE A;  2IAJ B;  4UOH A;  1FJ7 A;  5DZ7 A;  4PQU A;  2V2Z A;  2YWK A;  2JOQ A;  3CUL A;  3CIZ A;  4G1P A;  3KDN A;  1T7P A;  5GMD A;  1RTI B;  1WAC A;  5G4D A;  4UY8 5;  3OTE A;  1QAI A;  5KT7 A;  2VPY B;  5A6W A;  2KKH A;  3DI6 A;  2DK2 A;  4DQQ A;  2J6T A;  2ZBI A;  3R6G B;  2HS3 A;  1PYO B;  2MZ1 A;  4B3M J;  3RBZ A;  3KLI B;  1YGY A;  2R2T A;  2VBW A;  4MYT A;  4P72 A;  1TAU A;  1NKE A;  3SCL E;  3NY0 A;  5GME A;  2Q6B A;  2O5D A;  1RAH B;  3DN9 A;  1HWJ A;  1UEU A;  2W8K A;  1PIE A;  5L1L A;  2W2O P;  3K17 A;  2BOP A;  1KVJ A;  2Z2Y B;  4R5P B;  3Q2S C;  1JKH B;  4OZJ A;  4QZV B;  3BN4 A;  1YRX A;  2D3Z A;  1SQG A;  2M3D A;  2W24 A;  3JQK A;  5ETQ A;  2A3J A;  1V3Z A;  1TL1 B;  1FFG B;  3H2L A;  4JI2 F;  2EFO A;  1U8S A;  2V4J B;  4PXD A;  1S6Q B;  4JUZ A;  2AQ4 A;  5D4L A;  3LP2 A;  1TKT A;  5HRO B;  3TZY A;  3OTC A;  3WC2 A;  2GML A;  3M9O B;  4LFA F;  4O0I A;  1T02 A;  3I4H X;  4NZ7 A;  2A1B A;  4NA3 A;  4ZN3 A;  2MQ8 A;  1WC1 A;  3OSP A;  2I0X A;  3QRQ A;  4NI2 A;  3KWM A;  1FFS B;  1JLG B;  4WP8 A;  4JI7 J;  4RWX A;  2D1C A;  2V2K A;  2HVD A;  1TL5 A;  4J9R A;  1KBR A;  3S6E A;  3O2I A;  3CGI A;  1C0T A;  2VDH A;  2ZKU A;  4OI6 A;  3D28 A;  1F5A A;  3V5R A;  3CJQ A;  1XR7 A;  1UFL A;  1MRO A;  2XMJ A;  3V6D A;  1HBN A;  3UDL A;  3HF5 A;  2DHA A;  2Y8W A;  4L3N A;  2HHS A;  2OPS B;  1XMQ F;  4F0H A;  1UVN A;  4Q2L A;  4PKD B;  4OI0 A;  4ILR A;  4RX6 A;  3R2C J;  4NXN F;  1MWZ A;  4MYU A;  1PAU B;  5HMY A;  1C4A A;  3H20 A;  3JQJ A;  3SMZ A;  5B0E A;  3EXC X;  3NP5 A;  3OTD A;  2R8J A;  4DR3 F;  3K5N A;  3PR4 A;  5LT5 A;  4DDF A;  3EZ5 A;  4OI2 A;  2IM3 A;  3N5F A;  1RWK B;  4J37 A;  3EWG A;  1X9W A;  1HHQ A;  1GEH A;  2UUB F;  1APS A;  3MFH A;  2XY5 A;  2CZV C;  2FY1 A;  5HBM A;  1FK9 A;  4G3I A;  3KLE B;  2B43 A;  4NML A;  2MKC A;  4NXM J;  1Z2Z A;  4N47 A;  4G6V B;  1YBT A;  4JI8 J;  3PRV A;  4EZ9 A;  2B3T B;  1QTN B;  3HKZ D;  1UWA A;  4ZCK A;  4CIO A;  3M9N B;  1MWY A;  1FRM A;  4O4R A;  2IBO A;  1NJX A;  5I42 B;  1WWH A;  1QUP A;  3DRP B;  2BW7 A;  2J7K A;  4OI4 A;  1KHV A;  1IXK A;  1K73 T;  3CCW A;  3L95 X;  3Q24 A;  3DHX A;  1FRK A;  5B0F A;  1S1T B;  5CD4 A;  3CCT A;  5F8L A;  4N76 A;  2WZ1 A;  2VOO A;  4XAK A;  2ZOG A;  3D0H E;  4HTJ A;  3OFE A;  4DR4 J;  1B3T A;  2DNK A;  1FO1 A;  1UKU A;  1NK0 A;  2DR7 A;  3JYT A;  5DM6 Q;  4YS2 A;  5DGB A;  1SB6 A;  1HNI A;  1DZ5 A;  2WSF C;  2A6O A;  3UN2 A;  3FCW A;  1IBC B;  3UN3 A;  2AD9 A;  3PRB A;  3RZA A;  2NCK L;  4UOC A;  3MEC A;  6FD1 A;  5THW A;  1N32 F;  3GLJ A;  1BC6 A;  1R0A B;  3C15 A;  1RT6 B;  2B4U A;  3R5D A;  1RCO B;  2I5J A;  2XS7 A;  1T94 A;  1HA1 A;  3SQG B;  2H1Y A;  4CQ1 A;  1A6L A;  3BO4 A;  1LNQ A;  4EGL A;  3IO1 A;  1NB7 A;  4USH A;  4J9L A;  2EK1 A;  4ZLP A;  2VHG A;  1Q81 T;  4ILL A;  1I1G A;  5DDP C;  1M1H A;  2MKJ A;  1N8R T;  3PKM A;  2F4V J;  2DO0 A;  3QJJ A;  4DQI A;  1RHK B;  2ZH7 A;  2WSC C;  1C1C B;  1VQY A;  2NUH A;  2DRD A;  4FPR A;  3VAI A;  1H7X A;  2NSB A;  3W65 A;  3LP0 B;  2G1H A;  4M5J A;  3OL8 A;  3GV5 B;  4NLV A;  2YNG A;  2C3U A;  2M7S A;  3IAM 9;  1GMW D;  2LU2 A;  3CPW R;  2VOD A;  2CRL A;  1BQN A;  4HVZ A;  2W25 A;  2HFS A;  4DSE A;  2R2U A;  3KDO A;  2R7Q A;  4X4T A;  4MIW A;  3IR5 B;  4GKK F;  2YX7 A;  1TQL A;  1AT1 B;  4ZKA A;  1VQ4 S;  5F9L A;  3BGO P;  2MQQ A;  2LVW A;  5D6G A;  2BE2 A;  2C22 A;  2DEI A;  4WFX A;  1TL4 A;  4ZVE A;  3W3S A;  2EFP A;  2UVV A;  3OL9 A;  2E1P A;  3MM9 B;  3ZZY A;  1S0V A;  2ZUG A;  1S6P B;  1FXR A;  4C7Q A;  2H5J B;  2IM1 A;  1RBO B;  3PAC A;  2IRX A;  2L9D A;  4WU2 A;  2L41 A;  2EG1 A;  1H3D A;  4ZVG A;  2VQE J;  4NWB A;  4Y00 A;  3GJR B;  2YKN A;  1SC1 B;  2CJK A;  5JXS A;  2FJD B;  1R8P A;  4DR7 F;  3M32 A;  1DRZ A;  3W2V A;  2R8I A;  3IM9 A;  1JQG A;  1TKZ A;  2MLX A;  1PSD A;  2KI2 A;  4QIW D;  1VQM S;  2H5I B;  3K5M A;  2R2R A;  1HFE L;  4F0K A;  3GG0 A;  1R7I A;  4OX9 F;  1NK4 A;  3BN7 A;  4IOC Q;  4NRT A;  2YY3 A;  3QGI A;  4AUK A;  2QC3 A;  1M1G A;  1R8C A;  3PKY A;  4EBD A;  2BR0 A;  1L3V A;  2MSS A;  1IBK F;  3THV A;  5L38 A;  2G4B A;  3RW6 A;  3RTV A;  3PX6 A;  4ECS A;  3CO0 P;  2AF6 A;  3M8Q B;  3CXC R;  3N79 A;  4QWC A;  4DL7 A;  1H7W A;  2MLY A;  3C2P A;  4K4X A;  4K4Y A;  2U2F A;  5L39 A;  1R8B A;  4B3O B;  1GXU A;  4Y2K A;  4G1Q A;  2PMZ D;  3OL6 A;  5KFP A;  1D8Z A;  4C0B A;  3EMT A;  3BGR B;  1S97 A;  1U47 A;  2AEF A;  1QTM A;  1RQ0 A;  5AJ3 F;  1E6V A;  3V81 A;  3QID A;  5G0R A;  1AZS A;  2E5H A;  3SDE B;  1SKU B;  5HVH A;  2CQ0 A;  2QG9 B;  3IS9 B;  1X7V A;  1R8H A;  3R5B A;  2WB4 A;  2QA2 A;  5A0Y A;  4W98 A;  2GVD A;  2D3O R;  2FZC B;  3PYE A;  4H4K C;  2XZT B;  5CZV A;  2W9B B;  4OJ3 A;  3FMB A;  2UXD F;  1VQO S;  1T03 B;  1EP4 B;  4YDX A;  3JTO A;  1MU2 A;  3NGS A;  1FI4 A;  5L1J A;  4DPO A;  3D3B J;  4YHH F;  1HNX J;  1RAO A;  4K0K F;  1VK8 A;  3SV4 A;  3BF4 A;  1KEK A;  2IC3 A;  4BCA A;  2OO4 A;  2HMI A;  2XSF A;  3IM8 A;  2LXF A;  1SUQ B;  2GA7 A;  3GCX P;  4KGV B;  3OLA A;  1GNK A;  4NCG B;  1EQM A;  5EUH A;  1S0O A;  1VK3 A;  3L9Z A;  1WDD A;  4WZQ A;  4L75 A;  2BAN A;  3G6Y A;  2CXE A;  3C6U B;  4MKB A;  1LXN A;  3FSY A;  2FZK B;  4AXJ A;  1UTA A;  2PSZ A;  2RE1 A;  1FWK A;  2Z56 B;  4PUO A;  3TYT A;  1Q7L B;  1M5K C;  4LSL B;  4LQ9 A;  1F6T A;  4XPE A;  3NCQ A;  5J2M B;  3PZP A;  9RUB A;  4I7F B;  3UVJ A;  4X4P A;  2V6A A;  2ABY A;  1QAX A;  4KC5 A;  3I82 A;  1XMO J;  4X4U A;  5B7W A;  4J90 A;  3QMQ A;  2XMV A;  3A8I A;  4KV8 A;  3M8P B;  2CVE A;  1UAW A;  2M88 A;  3R5A A;  4DCJ B;  5KG5 A;  3ADA C;  1NDK A;  3KLG A;  4OYO A;  3R9L A;  4DV5 F;  1LWC B;  3D5M A;  5AE3 A;  5EX3 A;  2AU0 A;  2LP4 A;  4PYD A;  5D15 A;  3TQ1 A;  3DKD A;  4DR1 J;  1B70 B;  4DJB A;  1WF1 A;  1WSR A;  3T41 A;  2W2Q P;  4HH1 A;  2P2C B;  4WE1 A;  2ZBR A;  3LP1 B;  1Q1K A;  4DF4 A;  3GQC A;  4V1A k;  1I6J A;  1DQ8 A;  3NXZ A;  2W4P A;  3DM2 B;  1S1V A;  2RAQ A;  2Z2L A;  1X4G A;  2RHS B;  2GIF A;  2N4D A;  2VJU A;  1IM4 A;  4IO1 A;  2WB1 D;  2F5G A;  2OEK A;  4YDD B;  4DHV A;  2KXN B;  4QYZ K;  2HW3 A;  2HS0 A;  3OXG A;  2EK6 A;  2QGF B;  2P9G A;  2JEG A;  2A2D A;  1Q8L A;  3KLH A;  4F26 A;  1VRU A;  1F3F A;  3WZ0 A;  3N0V A;  2VFV A;  5CHC B;  3DXS X;  1RAI B;  3D6T B;  1FT8 A;  1R0B G;  3NOG A;  4HHU A;  3IFE A;  5B0A A;  4N8N A;  4PWU A;  5EDW A;  4PPZ A;  3PEH A;  4FDF A;  4DV3 J;  3PYG A;  2H51 B;  5F8J A;  1Y5N B;  2E29 A;  1H2V Z;  2CPF A;  3P49 B;  3H4D A;  3ENA A;  2XHC A;  3I5C A;  1X0F A;  1VQ5 S;  4PXC A;  3SV3 A;  1WG4 A;  4TY8 A;  1U0H A;  3M2U A;  3ETM A;  4OV1 A;  2RDD A;  2VG6 A;  2BX6 A;  4FXW A;  4JI0 F;  1RTD B;  3G8S A;  5A76 A;  5GAG U;  1HNW J;  1Z1Z A;  3H42 A;  3I5A A;  3Q8P B;  4K4V A;  2HS4 A;  1TZ0 A;  3FJ2 A;  5DDQ C;  1HQE B;  3NRB A;  1HR0 F;  4LF7 F;  3PW5 A;  1MWQ A;  1O5J A;  3QLH B;  3MM8 B;  2VL1 A;  5KG0 A;  5KFW A;  4RNF A;  5JJB A;  2GW8 A;  4ZIT A;  2JEJ A;  2M9K A;  1T05 B;  4FF1 A;  4WXO A;  2F9D A;  2QLB B;  4MMO A;  3RG6 A;  1YVF A;  2VG7 B;  2DR8 A;  1HBM A;  2E1C A;  5I3U B;  1FVS A;  3CDB A;  4DR5 F;  1FKO A;  4LF6 J;  1YJN S;  1WTF A;  2EFQ A;  3O6Q A;  3P5T L;  2DH9 A;  1IKW B;  4A8F A;  4PZV A;  4B9L A;  1WEY A;  4N5S A;  3CCJ S;  2HGL A;  4NLW A;  2M8D B;  1BHN A;  2QLJ B;  1X4H A;  4HT7 A;  1WKJ A;  1X8D A;  4QYR A;  3IBC B;  3NGK A;  2C2M B;  2BKP A;  5KT5 A;  3UE2 A;  1XK8 A;  3D7S B;  1N34 J;  2DIT A;  3DLK B;  3C46 A;  3BQ0 A;  4OZ1 A;  2QA4 G;  3N5B A;  3WX8 A;  3X3U A;  1YQH A;  1Y4Z B;  4B3T J;  2EKY A;  3NGR A;  3B54 A;  3AB4 B;  3GIM A;  1WG5 A;  3M30 B;  3IRW P;  4FYY B;  4WPA A;  1N33 F;  3KLF B;  1RI7 A;  2F4F A;  2CNL B;  4A8O A;  2YQ0 A;  2G0I A;  1FF2 A;  1QSL A;  4RW9 B;  4M5G A;  3HHE A;  3J80 Y;  1FNX H;  2WVD A;  4MKY A;  1VRT B;  3TJ9 A;  3NGT A;  5IC6 B;  4DL5 A;  5HQ8 A;  4FPI A;  2D9O A;  2M5Y A;  4I67 A;  3PYF A;  2XZD B;  4EWT A;  3KFW X;  2L3M A;  3QZ8 A;  1EQ0 A;  3W5Y A;  1B64 A;  3E51 A;  2FGO A;  4HH0 A;  2DGO A;  2DNM A;  2IYI A;  2MEW A;  1BWE A;  1URN A;  5D0R A;  1NSQ A;  4B08 A;  3PIP Q;  4NZ6 A;  2FVP A;  4RW4 A;  2V2V A;  3C14 A;  4OHY A;  2HAI A;  3ISN C;  1JJ2 R;  2HZC A;  3PFO A;  2K7J A;  4WYW A;  3GIL A;  3PY8 A;  3M6V A;  4M5I A;  2CZ9 A;  5I3P A;  1HMV A;  3A1Y G;  4ZP9 A;  3SCJ E;  2Q43 A;  2M70 A;  4BWJ A;  2CUY A;  2KJV A;  4GMK A;  2ZHO A;  2APO A;  2BJE A;  2PN6 A;  2EI5 A;  4EO8 A;  4AYB D;  5KFL A;  1LXJ A;  4DL0 C;  2V34 A;  3VAF A;  4GC6 A;  2LLZ A;  4A8S A;  4LSN A;  1TMJ A;  1WUU A;  2Y1L B;  3KMQ A;  2G0C A;  3T6B A;  2LQB A;  3CJK B;  3DRY A;  1UFW A;  2B6A A;  1FJG J;  2OKQ A;  4WFB Q;  5K8N A;  4LUB A;  3B4M A;  4LT6 A;  3RBX A;  3UNY A;  4ZJQ A;  2RIJ A;  3OTO F;  2UU9 F;  4DSK A;  1RCX B;  2AKW B;  3KK2 B;  4WIQ A;  4FVC A;  3WC0 A;  3VGS A;  2CPI A;  3PHT A;  3H5X A;  3GG1 A;  3IC1 A;  2W7O A;  2ATL A;  2VUG A;  3L7O A;  3OR2 A;  2W2N P;  4FYV B;  4IRC A;  5HJY A;  2N4C A;  3OQ2 A;  4Q43 A;  3B6B A;  2OEM A;  1S7H A;  2V63 A;  3AD9 C;  3IG1 A;  2CPD A;  3FZB A;  1IKY B;  1WI6 A;  2CPH A;  2CDQ A;  5M2U A;  5ETT A;  2CQG A;  1XER A;  3ZTR A;  3S01 A;  3G86 A;  3KUH A;  3TP2 A;  3VV2 B;  5J2N B;  4I2P B;  4CLZ A;  1FRI A;  4CH0 S;  3F73 A;  3EUN A;  1PIL A;  3SEO A;  2KZZ A;  4C3K A;  1GMW A;  3RR8 A;  1YRU A;  2CNK B;  2V4Q A;  4IFY A;  1LW0 A;  4CLW A;  4FVM A;  3K5L A;  1SC6 A;  4YB6 A;  3H5Y A;  3CWJ A;  3H25 A;  3LOU A;  2C2O B;  3GFY A;  2AYG A;  3FEZ A;  4LFB F;  3J7Z T;  3R6L B;  2EFV A;  4PG7 A;  2N7C A;  2W9A A;  3OVB A;  1WC4 A;  3PW4 A;  3UO0 A;  5DET A;  1NJZ A;  3Q8Q B;  4C6A A;  5A8R B;  2VQF J;  3GFX A;  4KKO A;  1H98 A;  4DWI A;  1V5I B;  5LSO A;  3HMJ G;  2DCL A;  2PII A;  2XEX A;  3CD6 S;  4ZN1 A;  4F3M A;  1A9N B;  2ZM6 F;  4RW8 B;  2MPU A;  4ZHR B;  2RUG A;  2OPR B;  5U47 A;  4TU9 A;  2HHT A;  1WOS A;  3QGG A;  3K89 A;  4LFC J;  2YPZ A;  4ZP6 A;  3E01 A;  4DUT A;  3PX0 A;  2RF2 B;  4PG8 A;  2PDA A;  2GHW A;  3NL0 A;  3H40 A;  8RUC A;  2MQL A;  3GP9 A;  5HLF B;  4CLP A;  1FKP A;  2ZBC A;  2DO4 A;  3HFK A;  2OPP B;  3PR5 B;  2VKR A;  5K8O A;  2X7I A;  4RBT A;  2DXD A;  2OPQ A;  2HFZ A;  4TYA A;  2ROE A;  2ZNZ A;  3W60 A;  5GVQ A;  1U1P A;  2KXH A;  1C2P A;  2AJ0 A;  4DL6 A;  3RW7 A;  2VA2 A;  4A8Y A;  3DLE A;  4NLD A;  4JYA F;  5IOL A;  5J2P B;  4ED5 A;  3LGH A;  5T7L B;  3TO8 A;  2AT1 B;  2J9E A;  5IM0 A;  2RDI A;  3IRX B;  1YJU A;  4LIW A;  2FHJ D;  1DJ0 A;  2CPX A;  4ZLL A;  2HND A;  5HMW A;  3G87 A;  3DLG B;  4F4Y A;  2MYF A;  5SUH A;  2UUA F;  2AEM A;  1QY7 A;  3HVT A;  4LVN P;  2W7A A;  3T1Y F;  2E5G A;  1S77 D;  5EN1 A;  1TVR B;  2G1D A;  1GXT A;  3M1V B;  1RSC A;  1WI8 A;  3CE8 A;  4X64 F;  3SSS A;  2X3D A;  2E44 A;  2IHR 1;  4MAK A;  5HJX A;  2I9S A;  1IN0 A;  1S6O A;  2B9W A;  1ZM2 A;  2CPJ A;  3FCV A;  2J9D E;  3D1Q A;  3G71 S;  5E3A A;  4QWD A;  1QE1 A;  1JLB A;  3FDS A;  2HEK A;  3GU0 A;  1SL1 A;  4UZC A;  4KB7 A;  3TJ8 A;  5CAB A;  3WIU A;  3PDN A;  1TL7 A;  4AL6 A;  3M8R A;  1YJ9 S;  3OPK A;  2HFO A;  2RKI A;  3FFI A;  4RBU A;  2BM1 A;  3GIR A;  4KGM A;  3OHA A;  3BV8 A;  2Y1J A;  2BDP A;  4V19 J;  2K3I A;  3FBB A;  2UVW A;  3BKT A;  3PG9 A;  1KKH A;  1WD6 A;  2ASY A;  3HSZ A;  4QIV A;  1U09 A;  2JLF A;  2WVB A;  4Y65 A;  3OXL A;  2HHU A;  1RBL A;  2LA6 A;  3HJV A;  5ETS A;  2R7U A;  3DMJ B;  1MSW D;  2NSC A;  1HD0 A;  4R0E A;  4ALZ A;  3A8J A;  4LBP A;  5DZ6 A;  1L3K A;  2WK4 A;  4CYU B;  1V5V A;  4ZVT B;  4RLE A;  2FJE B;  3VVT A;  4RUB A;  2W01 A;  3AJ2 A;  4NCA A;  3FBF A;  1X0P A;  4QWB A;  3ZC4 A;  1X9M A;  1M90 T;  2EG2 A;  2ZH8 A;  4RL1 A;  1K8A T;  4OMF G;  1M5V C;  3ZO7 A;  2C2R A;  1RWM B;  1JIH A;  4AND A;  4K4S A;  1JJC B;  3UPF A;  1XNQ J;  2PE8 A;  2KTQ A;  2FVC A;  5C42 A;  5AXL A;  2F1F A;  4FKY A;  4B3M F;  1Y11 A;  3CED A;  3CUN A;  1JLC A;  4WZM A;  2CQ2 A;  1EHW A;  2IMO A;  3MUM P;  4DL2 A;  2COL A;  5H9F K;  4PQU B;  1H74 A;  2CQ1 A;  5K8M A;  4PYA A;  1LWX A;  3ET6 A;  3OVA A;  3LPE A;  4EBE A;  4CO1 A;  1W26 A;  1H2U X;  2AX0 A;  4QU6 A;  2QFJ A;  4F2S A;  2WRM A;  3DI6 B;  2PGC A;  1ZET A;  2HQ3 A;  2X1F A;  2VPZ B;  1YRT A;  4KSE B;  2CQ3 A;  2EXU A;  1PKU A;  4XIU A;  4WKY A;  4JI4 F;  3SBM A;  1FVQ A;  3US5 A;  3NNC A;  1VQ8 S;  4QOT A;  2E1A A;  1Q16 B;  1HYS A;  2HLT A;  2DR6 A;  1KLM A;  1QAJ A;  1SH2 A;  3RB4 A;  2HQG A;  3NS7 B;  2U1A A;  5HN0 A;  1SPB P;  2HHH F;  4WYL A;  3WQP A;  1TFW A;  3DLH A;  2NXC A;  1D9D A;  1R8A A;  1C0U A;  3V2U C;  2HYI B;  1LWF A;  4HTI A;  2UVU A;  1W2B R;  4JI7 F;  3HSJ A;  5KFF A;  1NJI T;  3CJ5 A;  3M2V A;  1DLO A;  3VAK A;  4ZPT R;  1VQK S;  3GIK A;  1UJ5 A;  3EVO A;  4NLQ A;  1FXL A;  2VON A;  1HWK A;  3DRR A;  2OJ3 A;  4CH7 A;  2JDJ A;  2C2D A;  2DGQ A;  1RT4 A;  3OVS A;  1KSP A;  2CQD A;  3LP2 B;  1CJT A;  2VA3 A;  4M63 A;  5KFT A;  4O3R A;  2PI5 A;  4NLS A;  1P8G A;  1VS3 A;  1ZM4 A;  1R27 B;  2DHG A;  4A8W A;  2AW0 A;  2HFV A;  1G7C B;  4TN2 A;  5ETR A;  2R4F A;  5A8W A;  4TU8 A;  5H1S V;  1FDN A;  5IZH A;  1NB2 A;  4NI2 B;  3WBZ A;  4KPY A;  5KFV A;  1T9X A;  3GZ7 A;  1HI8 A;  2FLO A;  1RT2 A;  1DQA A;  3JS9 A;  4QWE A;  1CS4 A;  5IQQ A;  2OUG A;  2ZWO A;  1C0T B;  2Z2M A;  3ZZU A;  1QJH A;  3P4U B;  1B7Y B;  4JI8 F;  1MRO B;  1D8Y A;  1R31 A;  3V6D B;  1HBN B;  4ENO A;  2P6S A;  1VIX A;  3J7Y I;  2CA9 A;  3UR3 C;  1V3R A;  3N01 A;  2VJV A;  3W8P A;  1TV6 A;  3HFV A;  4XDC A;  1F0X A;  1T9W A;  2WVF A;  4DSJ A;  4KIA A;  4X65 J;  3DC2 A;  3G8T A;  4BS2 A;  1F1B B;  4NLP A;  2ZH2 A;  4DR4 F;  4U67 Q;  1I5O B;  4CLK A;  3EGN A;  1T11 A;  3C66 A;  3DXB A;  1UP1 A;  4ES3 A;  5HBM B;  1FK9 B;  4RR5 A;  4LR9 A;  3Q2T C;  3PO5 A;  3FUY A;  2W9C A;  1JMT A;  3PVX A;  5L8R C;  1D09 B;  5T41 A;  1GX6 A;  2FGC A;  5I3Q A;  4Y34 A;  4MFB A;  4O23 A;  1KQF B;  3AHP A;  3UD5 A;  1N48 A;  3T5H A;  2E9T A;  1UMJ A;  2QRR A;  2PA8 D;  3D9B A;  1RDR A;  4AQY J;  2NQP A;  2NLW A;  3T3F A;  3LAL A;  4CO4 A;  3U02 A;  4J9Q A;  4DS4 A;  3W62 A;  1NO8 A;  3THT A;  2RH3 A;  3E8O A;  4RO0 A;  2UP1 A;  3KHG A;  3QNW B;  1FD2 A;  3CF5 Q;  4ECU A;  5KG4 A;  3W9H A;  4UOF A;  3NNH A;  3JYT B;  3GWC A;  4ANE A;  3R1L A;  1RWO B;  1HNI B;  4LR8 A;  2DJW A;  2WOM A;  4TU7 A;  3WHI A;  4LF9 J;  2Y1I A;  2HK3 A;  3RBE A;  3MEC B;  5ETO A;  2F4V F;  4B9S A;  4GKJ J;  1HQU A;  3J81 U;  1U7L A;  5L46 A;  2YKP A;  2B4V A;  3MEG B;  3NNA A;  2XGQ A;  2KDO A;  3C15 B;  3H2V E;  3EXY A;  2I6W A;  1M5P C;  3NS5 A;  4C8O A;  1C1B A;  4PAA A;  4YME A;  4ZCM A;  2EC2 A;  2I5J B;  4I1T A;  1DTT A;  1NK7 A;  1NK6 A;  4DXL A;  2V8G A;  4H4O A;  4LF5 J;  3HZG A;  4ID5 A;  1RA6 A;  2IRY A;  2Q66 A;  2UUC J;  2ZZM A;  2IVF B;  2XS5 A;  1LWE A;  3A8K A;  3BBF A;  2XMW A;  1J2V A;  4CCH A;  2DIS A;  2N3L A;  3Q8S B;  2Z30 B;  2NZ4 A;  3CT9 A;  2RHQ B;  3VAM A;  4DV1 J;  4CT8 A;  2LQ5 A;  2OI2 A;  2XNR A;  2IMW P;  4NLY A;  4ES2 A;  4JOU A;  2OTJ S;  2GX8 A;  1KQK A;  2DGS A;  2E5J A;  3IR6 B;  1IWG A;  2ALY B;  4DPX A;  2R2S A;  4DUZ J;  3M8Z A;  4WII A;  4H4M A;  3NAH A;  3DNC A;  4CLS A;  5IC4 B;  5F8I A;  2YNG B;  5D0E A;  2QL7 B;  2EVZ A;  2UXB J;  4USJ C;  3KHH A;  4KYZ A;  4JV5 J;  1BQN B;  4ED8 A;  3DDI A;  3RAQ A;  4IDK A;  4KBI A;  1IKX A;  1Q78 A;  4J91 A;  1VIS A;  4TLR A;  1RA7 A;  1YJ7 A;  1B0V A;  1E6Y A;  2MHE A;  4QPX A;  3UWT A;  3AOC A;  3JTN A;  4QIE A;  3DHW C;  5MAO A;  1ZPW X;  4K59 A;  2BE2 B;  5D3G A;  1FNM A;  4CWB A;  3OSN A;  4LRB A;  2CQI A;  4OX6 A;  2M52 A;  1TKX A;  2YBV A;  3QRP A;  2OFG X;  3D67 A;  4R0J A;  5D8H B;  1VFJ A;  3ZXW A;  4ZVU B;  2HWI A;  2RQ4 A;  3DOM A;  4LRA A;  1NXI A;  4QYZ J;  1FE4 A;  4EFA C;  4KO0 A;  2IVY A;  1X31 C;  2FLN A;  2K8G A;  2YKN B;  2W4D A;  2G2Z A;  4CDI A;  2R7S A;  3GYN A;  3M32 B;  2HBY B;  4C3L A;  3W2V B;  2PMH A;  2HFN A;  1TKZ B;  2IA0 A;  1KP6 A;  5FLX Y;  4Q8E A;  4FXD A;  4UUW A;  3J7Z 5;  4X4O A;  1FDD A;  2GQQ A;  3R5C A;  2BE7 D;  2C28 A;  2DRA A;  4N8O A;  3Q8R B;  1SKR A;  1OIA A;  1CQN A;  4K2J A;  2HIY A;  3S1T A;  2KFY A;  3LPY A;  4OQJ A;  2LFV A;  1F60 B;  3UDE A;  1UW4 A;  1WHY A;  2VFU A;  1VJW A;  3L09 A;  4FYD A;  4CO3 A;  1HKA A;  3WX4 A;  2YX1 A;  2N3O A;  5HVF A;  5HRO A;  1VMB A;  2JLG A;  5F8H A;  5EWF A;  1OJ4 A;  2OD4 A;  1HNX F;  4ZJO A;  3FSI A;  2FLL A;  3FKB A;  3G6V A;  2I8E A;  2AWZ A;  1ZS6 A;  2NYH A;  4NLO A;  4DPY A;  4ED0 A;  3LA0 A;  1KWM A;  1NBE B;  2Q79 A;  4G1Q B;  2V67 A;  5JUM A;  3ELH A;  2FC8 A;  5HAN A;  3VWS A;  3EX7 B;  2LYV A;  4OIX A;  1E6V B;  2GJF A;  3V81 B;  5G0R B;  3CME S;  1AZS B;  3CB4 A;  2YWG A;  5DO2 A;  3FQL A;  4LJM A;  4P10 A;  3P45 B;  5GAE I;  1Q82 T;  5A0Y B;  2GVD B;  3G82 A;  4YB7 A;  4JI2 J;  3ZNU A;  5J1E A;  2P9C A;  2BW2 A;  4G1I A;  2YWF A;  4AL5 A;  1CQM A;  3TJA A;  1MU2 B;  2C2K B;  4LFA J;  4JI5 J;  2Y3Y A;  5F0U A;  1FKA F;  4DF8 A;  1X4B A;  1XMO F;  4CP5 A;  2IC3 B;  2HMI B;  1RHU B;  2XM3 A;  4O3Q A;  2OGU A;  3FSX A;  1LFW A;  1K44 A;  4URQ U;  2VPW B;  4ECV A;  2KL8 A;  1YSJ A;  3QJP A;  1H0H B;  5F3T A;  4ZP8 A;  4Y2A A;  1D1U A;  1WF0 A;  3KLE A;  2BAN B;  5LM7 E;  2P9E A;  4R25 A;  3CDW A;  3WIV A;  1ZPV A;  4F4W A;  1SC4 B;  4U8Y A;  3D0I E;  2BJ8 A;  4PUO B;  2DNR A;  1P9Y A;  1XMQ J;  4Q44 A;  1GH8 A;  4NEZ A;  1FTR A;  4NXN J;  4I6Y A;  2AJ4 A;  3ONQ A;  3OR1 A;  1FWL A;  3UVJ B;  3HZE A;  1FX2 A;  3MWB A;  4MT1 A;  5LJ5 Y;  3AH6 A;  1B7F A;  2GZO A;  4DR3 J;  4XTT A;  1WTB A;  1VQ9 S;  2HPU A;  3VVU A;  1NSP A;  3WDO A;  1B0P A;  5HAT A;  4KV8 B;  2E5L J;  4OZ5 A;  1NME B;  7FDR A;  2GAG C;  3A3P B;  1Y7P A;  5L1K A;  3DLJ A;  1ZOT A;  2QL5 B;  1R89 A;  3KLG B;  1Y10 A;  1Q8B A;  1RB0 A;  2BQR A;  2XYP B;  3CD0 A;  2HFU A;  1HPZ A;  5DDR C;  2VV5 A;  2KJW A;  4DV3 F;  2JEI A;  4C48 A;  2IDL A;  3T5K A;  1P1T A;  4WE1 B;  3TX0 A;  3M6U A;  2L08 A;  4DQS A;  1S1V B;  2J5A A;  1FNO A;  2WCX A;  4OX8 A;  4ATN A;  3CJ2 A;  4ECR A;  3G2X A;  1HNW F;  2WON A;  4P2S A;  4RW6 A;  3R27 A;  4RUH A;  1GXL A;  1K1Q A;  5B0B A;  4ETX A;  3KLH B;  3CSK A;  1YBA A;  1LW2 A;  1VRU B;  1S72 S;  2GQ2 A;  4JV2 A;  1FE0 A;  2AYM A;  2DXF A;  5CA5 A;  4CO2 A;  3GJS B;  3TAM A;  4X2B A;  2JX2 A;  1X5T A;  1EJ7 L;  4YB5 A;  4DV7 F;  1WHV A;  2H9Z A;  4I68 A;  3RJM B;  3D6H B;  1RWW B;  4ECQ A;  2VPX B;  1HNZ J;  3DCA A;  5KAK A;  5KG6 A;  4LIR A;  1D0E A;  3D4J A;  1ZH5 A;  1H72 C;  1PJ5 A;  2GGP A;  4LF6 F;  1C1C A;  4TY8 B;  1U0H B;  3M2U B;  1N6Q A;  1U6F A;  2VG6 B;  1NH8 A;  4OYZ A;  3CMQ A;  1U2R A;  4PAB A;  2WBM A;  3VAJ A;  4LRD A;  1SKW A;  3K5O A;  3TRG A;  2EWH A;  1NHU A;  2Y0B B;  2XZW A;  3RRG A;  5KFX A;  5DQI A;  4EEY A;  2BJ7 A;  4OYB A;  2C1E B;  4TXS A;  2YXL A;  3DGP A;  2PI4 A;  2WBR A;  1N34 F;  1ZAW A;  4ECY A;  3PW2 A;  1S48 A;  1HBM B;  4DZD A;  1FKO B;  4LBH A;  4N41 A;  4BLG A;  4OYM A;  2IYG A;  1FHT A;  3O8W A;  3OJS A;  1HW8 A;  3PXG a;  3P3D A;  4LRE A;  1N36 J;  2FY8 A;  3IGV A;  1DAR A;  2YX4 A;  4X4Q A;  2WTF A;  1VLO A;  1XEZ A;  3N6L A;  1NDP A;  4DL3 A;  2DR9 A;  5IWA J;  4WBF A;  5KFQ A;  4ZVP B;  1IR1 A;  2AJQ A;  2MZR A;  3O1L A;  4MH8 A;  2F9J A;  1IJE B;  3MCM A;  5CAA A;  3BDP A;  1AB8 A;  3MM7 A;  5KFG A;  3SXL A;  5BJR A;  3QBC A;  1OYE A;  4CLU A;  3EVM A;  4WFZ A;  3QJL A;  3V6K A;  3MM5 A;  2HGN A;  3EDQ B;  4CNZ A;  5KG1 A;  5CYM A;  2QO3 A;  2AYB A;  1HNV A;  4DZ6 A;  3RB6 A;  5KFR A;  1N56 A;  2RML A;  4BDP A;  1TEL A;  3H5S A;  3IMQ J;  4U9R A;  4F02 A;  2CVI A;  3MCO A;  3Q23 A;  4WF9 Q;  1YZ6 A;  4QPT A;  3I0R A;  4ES1 A;  5JVG Q;  3PX4 A;  3SCI E;  1OS5 A;  1PCA A;  5B0C A;  3KJQ B;  1IBL J;  1HLW A;  3L3C A;  3I9V 9;  2DCU B;  1U1R A;  2MJN A;  2AJ1 A;  1CSJ A;  2PC6 A;  4NAS A;  4FBU A;  1SQF A;  4RW4 B;  3C14 B;  1J27 A;  4EI2 A;  3KMS A;  1WC5 A;  4JB8 B;  3PJX A;  3BGR A;  3MR6 A;  3K8V A;  2GS8 A;  2N82 B;  5CYJ A;  3AXK A;  5KFC A;  3LUY A;  2JC1 A;  1ZA1 B;  5D0H A;  1HMV B;  5DS7 A;  4E98 A;  4OX9 J;  3K2Y A;  4XK8 C;  3JSB A;  4C0O C;  4QR0 A;  5FLX U;  1JXE A;  3RB3 A;  1KTQ A;  4B17 A;  5JVH Q;  2DNO A;  2FJV A;  2LQ9 A;  1T03 A;  2AZ3 A;  4F4A A;  2WW8 A;  3D3C J;  1OY6 A;  3HX9 A;  3MM6 A;  4LSN B;  1HW9 A;  2XWX A;  1T0T V;  3KG1 A;  2B6A B;  2LQJ A;  5DDO C;  2DH8 A;  3M9M B;  4ZIW A;  1ZAV A;  1F2G A;  2OAU A;  4BWM A;  3MEE A;  5FD1 A;  2QT7 A;  2ZHB A;  1RKJ A;  5EGY A;  3OR2 B;  4O3S A;  2RRN A;  4DSL A;  3CMA S;  1UVL A;  4U8V A;  3IG1 B;  3PEJ A;  4LVO P;  3K57 A;  5KG7 A;  4DQP A;  1J5E J;  2UXD J;  5LOQ A;  3N4W A;  4GVL A;  2RS8 A;  2SXL A;  5KFJ A;  4YHH J;  3V4I A;  1MML A;  4K0K J;  1FTC A;  2VQF F;  1YJR A;  1OSC A;  3P6Y C;  1X5S A;  3RAX A;  2W7P A;  3FCH A;  4ZP7 A;  5LXY A;  6AT1 B;  2CWK A;  3W9I A;  2A0F B;  2M0G B;  4USM A;  5F0W A;  2FJX A;  3R5J B;  4LFC F;  2GHP A;  4RW7 A;  3QT8 A;  4ITS A;  5F41 A;  2FB0 A;  3CC4 S;  4OHX A;  5C24 A;  4C98 A;  4ED1 A;  2QTW A;  2EBG A;  4IFY B;  1LW0 B;  2QJ3 A;  2CPE A;  3W1Y C;  4HR2 A;  4TY9 A;  2RNE A;  2KYX A;  3K59 A;  2HKE A;  2HK2 A;  5KFI A;  1UWB A;  2RU9 A;  5LMU J;  3UDV A;  2BZ2 A;  2YNH A;  1VQP S;  1S9F A;  2J9C A;  2IM0 A;  2IA6 A;  2HVH A;  4KKO B;  5H9F J;  5KG2 A;  4PWD A;  1BQM A;  3G6E S;  2KFN A;  3HDS A;  5AXN A;  3NCP A;  2YNI A;  3A3O B;  3K5P A;  4FXV A;  4Y2C A;  2DGU A;  2ZBQ A;  4NCB A;  3MR5 A;  3QFW A;  1PAE X;  1S7I A;  1AXQ A;  2QLX A;  3E01 B;  1RWV B;  1N4L A;  2HNZ A;  3TA0 A;  1YZ7 A;  3H59 A;  3JSR A;  3FMW A;  4ZPV R;  4DCP B;  1FRL A;  2AGO A;  1WDT A;  1NKC A;  2K06 A;  2MDA A;  5KFZ A;  1RT5 A;  1FKP B;  3VAG A;  4ZVS B;  4IR1 A;  3PCO B;  2DVI A;  3TAN A;  4IOB A;  4Z7Y A;  2OPQ B;  4JI6 J;  1D9F A;  2QA4 S;  2HVI A;  3HSG A;  1EZZ B;  2R7T A;  1P6T A;  4AFF A;  3MI7 X;  1OY9 A;  3VCD A;  2F40 A;  4Q2M A;  1MN7 A;  3ENW A;  2V8P A;  2DHX A;  3P5B P;  3BR8 A;  3HHL C;  1PBA A;  4KFB A;  4QW9 A;  4C0H A;  3ILJ A;  3MAH A;  1P9Q C;  5IM0 B;  3GPA A;  3EGZ A;  2HBR B;  2DNZ A;  2ZD1 A;  2Q3P A;  4A4J A;  1MN9 A;  4DX8 H;  4KGZ B;  1JLE A;  2MXY A;  2BEF A;  2W2P P;  2IPO B;  1CUL A;  5IQ6 A;  2MZQ A;  3HVT B;  5KFM A;  2AV5 A;  5I3U A;  2GIR A;  4F25 A;  1BE4 A;  3ZZ0 A;  3EPG A;  3OFG A;  5SZT A;  4B3R F;  3CCV S;  2FDN A;  2C2E A;  4Z2X A;  1PYS B;  3AJD A;  2XSJ B;  3KG4 A;  3NEK A;  3TEH B;  4L76 A;  5K9F A;  2CPY A;  3OXF A;  2LXU A;  2UV8 G;  3ZTO A;  2DY1 A;  2MZT A;  1QE1 B;  1JLB B;  3EIC A;  4UW2 A;  1CJV A;  2YKO A;  5IS2 A;  1YIT S;  2VC0 A;  3J81 j;  2DBB A;  4KT0 C;  2DRB A;  1TL7 B;  3K58 A;  2MGZ A;  1IKV A;  1CJK A;  2RKI B;  3H98 A;  4DSI A;  4OZ0 A;  2W8L A;  3FFI B;  3MD3 A;  2BM0 A;  1AW0 A;  4F4Z A;  2P5V A;  3HHL D;  3JAM U;  2X51 A;  1KTV A;  4IH5 A;  2YQ1 A;  3MCS A;  1NLK L;  3D6F B;  5J1P A;  3QAU A;  3MPV A;  4Q45 A;  2H3E B;  4J9N A;  2J0W A;  1TP7 A;  4F8R A;  3T9Z A;  5H9E K;  3ZZP A;  4GO5 X;  5HQL A;  1ARO P;  2X3G A;  4FNH A;  2DY9 A;  3M2R A;  1HL6 A;  5E3R A;  2MB0 B;  2RD5 C;  1RJJ A;  5LSL A;  1F3V A;  2H5E A;  2HRT A;  4PXB A;  2VZ9 A;  2YH1 A;  3HVW A;  1IJF B;  1V6H A;  1ZYQ A;  1RAJ A;  3L7P A;  4B9T A;  3QAT A;  1U1M A;  4U7C A;  4M5M A;  3HSD A;  4L3K A;  3D6M B;  1RWP B;  4YB1 P;  4J7C A;  1ZZF A;  4PCQ A;  1S6U A;  3UN5 A;  4DLE A;  2WVC A;  2FVQ A;  4O44 A;  1WKK A;  2DNN A;  1VYA A;  1NND A;  4Q5V A;  2ZH9 A;  4DR2 J;  1N33 J;  2ASJ A;  3G9C A;  2H65 B;  3BZQ A;  3EZO A;  4EZ6 A;  3CJ4 A;  5C42 B;  2KRB A;  4ETZ A;  1FRX A;  1JLC B;  3AA8 A;  1YI2 S;  3KG0 A;  1TFY A;  1VQ6 S;  2R7O A;  4NYP A;  2DNH A;  3EDR B;  5J2Q A;  1SL0 A;  4CLT A;  1QVG R;  4H54 A;  3W64 A;  4L74 A;  3QO9 A;  3ET6 B;  2X1B A;  1PBU A;  2J0S D;  2FVS A;  3MED A;  2RQM A;  4P74 A;  4M5D A;  3DOK A;  1N5V A;  4HHJ A;  1VBK A;  4EBC A;  2E7V A;  5KFD A;  3T1H F;  2GJ2 A;  5GAD I;  1XNR J;  4DG1 A;  3KK3 A;  3MMA A;  4I64 A;  1HYS B;  3FBE A;  2UZA A;  3BPD A;  3CW2 C;  1TL3 A;  1WEL A;  1KLM B;  1H2T Z;  5M2R A;  4PQA A;  3H0P A;  2PEH A;  4NRU A;  3IA0 A;  3HKW A;  3H7H B;  4RNN A;  1Q7Y T;  2Z58 B;  2XYG B;  1YLX A;  1G3O A;  1C0U B;  2CIM A;  3MAQ A;  1LWF B;  2VH7 A;  1L3U A;  2YQ3 A;  2LCW A;  1KD1 T;  4NYO A;  3ZTQ A;  3M2V B;  1DLO B;  4LF4 J;  2KM8 B;  3PFE A;  2CPZ A;  5M2P A;  1I94 J;  2HG4 A;  5HMX A;  3OTO J;  3DRR B;  2HVE A;  4DFM A;  3DU6 A;  1EAY C;  3D1O A;  4MKA A;  4NA1 A;  1RT4 B;  1CJT B;  1FFW B;  4ELV A;  1BY9 A;  5HP1 A;  2XLI A;  3ULH A;  5KT2 A;  2DEJ A;  4MK8 A;  4USK A;  4X65 F;  5A8W B;  5IXU A;  4DX6 A;  2K1R A;  4FNI A;  3TAR A;  3HVA A;  5IFM A;  1U6B A;  3ILO A;  4Q7A A;  3MPY A;  2AIR B;  1W2I A;  3KK1 A;  1YK9 A;  2I38 A;  1H38 A;  1RT2 B;  3PJ9 A;  1N54 B;  1CS4 B;  3GR1 A;  1NK5 A;  4FBT A;  2ALZ A;  5F3Z A;  2KT5 A;  3BO2 A;  3PYD A;  2OPR A;  2C3M A;  1XN9 A;  5LL6 d;  2XMA A;  4UQG A;  4DEZ A;  2QYG A;  1Z4U A;  4KR0 B;  1IR0 A;  3TUP A;  1TV6 B;  4PWW A;  4UF4 A;  3M8S A;  2IFX A;  4ICL A;  1SIZ A;  2EC0 A;  5DQG A;  5DQH A;  2KO1 A;  1SH0 A;  1XIQ A;  3A12 A;  3BQ2 A;  1JLA A;  1Z2L A;  4B9M A;  4NYZ A;  5L9N A;  1ULR A;  4OLO A;  1TKD A;  2KB2 A;  1URR A;  3MTK A;  3GFZ A;  3GFH A;  3OUY A;  2ZM6 J;  4DFP A;  5A8K A;  3N28 A;  2VU5 A;  4PG4 A;  5T7L A;  4QU7 A;  5E41 A;  2MZS A;  1EKR A;  4MFB B;  4OV6 A;  3TWZ A;  2CG8 A;  2J0X A;  1NUE A;  2ZZT A;  4J9P A;  3LGN A;  3DFE A;  1RE1 B;  2DGT A;  3PJW A;  2J6U A;  2XYH B;  1TK0 A;  1U49 A;  2HHQ A;  2DB1 A;  3Q8U A;  1TVR A;  4A46 A;  4LF5 F;  3LAK A;  4ZVF A;  4QW8 A;  1WEZ A;  4DPU A;  3LWL A;  2YWH A;  2UUC F;  2V8V A;  1GX5 A;  2YWE A;  4QCL A;  2RUS A;  1NPP A;  3BB5 A;  3LQV A;  3V6H A;  4ZPA A;  4XO0 A;  5KFA A;  2J8A A;  4WFY A;  5E33 A;  2NPF A;  2WOM B;  3R7S B;  4JYA J;  4TQS A;  4HDH A;  5HI7 A;  3IR7 B;  1SH3 A;  3MCN A;  4NZ0 A;  1HQU B;  1S9G A;  1T9T A;  2RJZ A;  1QLN A;  2GAH C;  2UV8 A;  1AYE A;  1TU0 B;  4I69 A;  1NDL A;  2I1R A;  2HZA A;  3MF5 A;  4HKQ A;  2CAJ A;  4DUZ F;  5L9X A;  1C1B B;  3IGN A;  4O4G A;  1NK9 A;  2ASL A;  4WP3 A;  2NXN A;  1DTT B;  2ZWP A;  3T1Y J;  3BJY A;  2HQC A;  2E7X A;  2PA3 A;  3C3L A;  4ZJL A;  4H4O B;  2DR5 A;  4ID5 B;  3R8Y A;  3KKF A;  4DI6 A;  4FF2 A;  1LWE B;  4X64 J;  2ILZ A;  4GO7 X;  1RTH A;  4Y0F A;  1UPM B;  2G2O A;  2YTC A;  1N52 B;  2ZC3 A;  3CCM S;  1FA0 A;  3HHD A;  4QWA A;  5CZX A;  3CJ8 A;  4CM0 A;  1AA1 B;  3TNV A;  2ZBP A;  1N5Y A;  3OLB A;  2F65 A;  5DG8 A;  1U1K A;  3Q89 A;  1SJ1 A;  3D54 A;  4FF4 A;  1NM2 A;  4DV2 F;  3JTP A;  1PC4 A;  3T1A A;  2C2Z B;  2YKM A;  2FJW A;  2BVZ A;  3BPS P;  2MTL A;  1RT7 A;  3EM1 A;  4ZLN A;  2V5H G;  3KNA A;  1N0V C;  4H4M B;  4C8Y A;  3MMB B;  1X5O A;  4JI3 F;  2XBP A;  2PFD A;  1RTJ A;  4Q8F A;  4DN0 A;  1VC6 A;  3BBC A;  4F67 A;  3QWU A;  3BGL A;  4X4S A;  3TQE A;  1JNZ B;  1DHM A;  4C97 A;  4AT1 B;  1IR2 A;  4IDK B;  4LF8 J;  2R3V A;  3G6X A;  1IKX B;  4QIF A;  3EJM A;  3MPD A;  3NOC A;  1UFK A;  1E6Y B;  4NLX A;  4K4Z A;  1IUJ A;  3PW7 A;  1KDN A;  4MK7 A;  1XTZ A;  2BMB A;  1OYD A;  1S57 A;  1S1W A;  4RWW A;  5D3G B;  4ER8 A;  4ZOS A;  3RB0 A;  1Q79 A;  4N7T A;  1YHQ S;  3UCZ P;  1TKX B;  5RUB A;  2G13 A;  2UVR A;  3UD4 P;  1KR4 A;  4HAC B;  3TEG A;  1UVJ A;  2QN6 B;  3HPO A;  2O67 A;  1KOH A;  1M5S A;  4USW A;  3QIP A;  2J9D A;  1ITP A;  1VBZ A;  1FD8 A;  2CZ4 A;  3BBB A;  4TVA B;  4D3G A;  4WCE Q;  3DOM B;  4RU9 A;  2MJU A;  3I0S A;  3T9N A;  4P6Q A;  1RAF B;  1KLN A;  3B78 A;  1TTH B;  3A4T A;  4KO0 B;  1GTE A;  2KHD A;  2YVS A;  1PC5 A;  3G96 A;  2V9W A;  4FS1 A;  4ECZ A;  3O3L A;  4OJH A;  1SKS A;  3KJV A;  5E7O B;  3MTJ A;  4X62 J;  5IT9 U;  1L5U A;  3NBP A;  3FEX B;  3HFZ B;  2K2P A;  4YY3 J;  2OH2 A;  4F4X A;  2E7W A;  5D4N A;  1VOM A;  1JJ4 A;  2VF3 A;  2V4R A;  4J5O A;  2H4Y B;  4TKT A;  3JQM A;  2F8H A;  4LMZ A;  2B9X A;  3MPU B;  4DV0 J;  5GAD U;  3CTR A;  3EZU A;  1KS2 A;  2YKA A;  3QAE A;  4JI4 J;  2BXJ A;  3M6W A;  3ZTS A;  1Y3J A;  3CNQ P;  3VGU A;  3MMJ A;  4F2R A;  4JI5 F;  5BXI A;  3ISZ A;  2XMU A;  5E0O A;  5F8M A;  3KLV A;  2HHH J;  5CH7 B;  3PTW A;  1N5T A;  2ERR A;  1R0C B;  4DV6 F;  3GSD A;  1I51 B;  3CD7 A;  4IG3 A;  1HBU A;  1Q53 A;  1VHI A;  2V8H A;  4I2Q A;  2PT0 A;  4ZS6 A;  1RHQ B;  2VDI A;  2HQI A;  3ISN D;  1RK8 A;  4M94 A;  3A13 A;  2X1A A;  4HI1 A;  2JH3 A;  3G82 B;  4OYA A;  1BUX A;  1D9A A;  3QT6 A;  2QMW A;  2XHW A;  2HBQ B;  2FLP A;  1F9F A;  5J1E B;  1Y5L B;  2ZNY A;  2DNQ A;  5LSR A;  2MY7 A;  2JFD A;  2XTJ P;  3IXQ A;  3Q86 A;  3C16 A;  3NWR A;  4ZVH A;  4CO5 A;  3BGU A;  5HK4 A;  5KFU A;  3PM9 A;  1RWU A;  2E5L F;  3EVW A;  1T9V A;  2GQC A;  5K14 A;  3RU0 A;  3VTI A;  3OL7 A;  2CJ9 A;  1TMM A;  1S59 A;  1QSS A;  3Q22 A;  3HHL A;  4ELU A;  1WG1 A;  2WSE C;  1OO0 B;  5DGA A;  4CH1 A;  3ITH A;  1RWX B;  4LSZ B;  1FXD A;  2A6M A;  2I2Y A;  1NJY A;  1YJW S;  4HEA 9;  3KHR A;  5LMN F;  3EE3 A;  1J5O A;  4ZVQ B;  5KTQ A;  5BR8 F;  4KHP F;  3OR1 B;  2Q6C A;  1B0T A;  4HT5 A;  3MEK A;  4CLF A;  4CLL A;  5KG3 A;  3NAI A;  5C5J A;  1GAO A;  4P2X A;  1FDB A;  5B0G A;  1JWW A;  3BYP A;  2RSQ A;  2EPI A;  3W9J A;  2ROG A;  4ANC A;  3NCR A;  3ETO A;  4Y2I A;  3BSC A;  4BHQ A;  3M7V A;  3DOL A;  2B7C B;  2GFF A;  1S99 A;  2ZH4 A;  2DIU A;  3JSM A;  1VDH A;  4UST A;  4OX7 A;  2F63 A;  2ADC A;  1HPZ B;  2B51 A;  3GR0 A;  4LF2 A;  2MKS A;  3J81 Y;  4ED6 A;  3VR1 A;  2DNY A;  1RGV A;  5K5M A;  1HNZ F;  2DNG A;  2MQO A;  3MEG A;  1U25 A;  2B7B B;  3HXM A;  3D1H A;  1IBM J;  2GIQ A;  2WON B;  4K8R A;  4R8U A;  4RW6 B;  2BA9 A;  3HT3 A;  5GAG I;  1ZM3 A;  2CJX B;  3FNN A;  3MR3 A;  1LW2 B;  4KE5 A;  4IFV A;  2ZUA A;  3DDN A;  3NWG A;  3IP0 A;  3X1L B;  1F5B A;  3NS6 A;  1FX4 A;  2O1P A;  4DR6 F;  2HHX A;  2GMH A;  5T14 A;  3IWX A;  3TAM B;  5CYQ A;  1U02 A;  3RUB L;  1TAQ A;  3U7J A;  3NLC A;  5C25 A;  1HWI A;  3VZI A;  1X60 A;  3B4D A;  2P6T A;  2OIH A;  3HT0 A;  4K7Q A;  3DDK A;  4FYW B;  3RR7 A;  3A8E A;  2GGP B;  2W1B A;  1N6Q B;  4O3N A;  1LK7 A;  4AE5 A;  2D74 B;  5GMK a;  2CFX A;  1UVK A;  4RU2 A;  3FRZ A;  4RNM A;  2EW9 A;  4M5H A;  1N36 F;  2CKW A;  4F04 B;  3M05 A;  4C11 A;  2ZZN A;  4OZ3 A;  1QUV A;  1YKW A;  2BYC A;  2AX1 A;  4MJK A;  3ILL A;  2HLU A;  5IWA F;  4EYI B;  4OYW A;  5HVG A;  2Z0G A;  3POT A;  2KHC A;  5KT6 A;  2XMM A;  3DGP B;  1VBY A;  2E9Z A;  2ZJP Q;  3RBD A;  3R7N B;  2D7S A;  3CJ0 A;  3J7A N;  3GE9 A;  4IO9 Q;  2GNK A;  1SJF A;  5FDL A;  1FCA A;  1T3O A;  1S1U A;  1IQT A;  4ILM A;  9ATC B;  5D0G A;  4DN9 A;  3LO3 A;  3MUV P;  1NEE A;  4HLB A;  4X66 J;  2AMC B;  1CBK A;  1ZM9 A;  1CLF A;  3BSA A;  3I55 S;  1RAA B;  3KJN B;  2JEF A;  1O51 A;  1WSV A;  2JWN A;  3L7U A;  2CQP A;  2WAQ D;  4E2F B;  4P71 A;  4OZN A;  1KQG B;  2R8K A;  2ZE2 A;  3DYA A;  2O01 C;  1U45 A;  3DU5 A;  4I6W A;  3KUG A;  1YBU A;  2VC1 A;  2ZFH A;  3HD2 A;  2KZM A;  5B09 A;  2B5J A;  4H4K A;  3D66 A;  3MM7 B;  1IBL F;  3GB0 A;  1X4C A;  5CCM A;  3S8S A;  3T5L A;  2FJB B;  1RAC B;  3MM5 B;  2FC9 A;  4DX5 A;  1R43 A;  4IG0 A;  3AA9 A;  2CQC A;  3QPI A;  1ACM B;  2JL9 A;  4HL9 A;  1GT8 A;  2H48 B;  3R5G A;  2KG1 A;  5CYM B;  2FZG B;  2JSX A;  4ZMM A;  4YFU A;  1VQL S;  1HNV B;  4F7V A;  2BAB A;  1GMU A;  2ZVI A;  2FJA B;  4USI A;  3U1M A;  2P8I A;  5KFN A;  3PNI A;  2UUW A;  3P8B B;  4NE9 C;  4YOE A;  1MNE A;  1Q95 G;  1XBW A;  1KC8 T;  4C8N A;  4PPD A;  2IRU A;  1JLF A;  2C42 A;  1WC3 A;  2PEB A;  3VF0 B;  2CJA A;  2UXC J;  2GO8 A;  5I4M A;  1LK5 A;  4AD6 A;  3IWN C;  1WEX A;  4JI1 J;  4QR2 A;  2NXJ A;  3I0R B;  1LV5 A;  3BDE A;  1RAB B;  4OYX A;  1S9E A;  1KQS R;  4ZPB A;  4KTQ A;  3VAH A;  3M8Y A;  1O8B A;  4YR0 A;  1U4B A;  2QL9 B;  3C6T A;  1M0S A;  4XDD A;  4ID8 A;  2V8D A;  1WOO A;  4IH6 A;  4XPC A;  1K0T A;  1D3W A;  3TAP A;  1CC8 A;  2O3D A;  3JB9 k;  2CQ4 A;  1OSD A;  3O5T B;  1RZM A;  3AJ1 A;  1J5E F;  1UZH A;  3MFI A;  2M4M A;  3OW2 R;  3MMC A;  3MM6 B;  4WKR A;  1SJ4 P;  4ZVO B;  2CYY A;  1TKT B;  5L1I A;  2DKO B;  4J9U E;  2XLJ A;  4MK9 A;  2FTR A;  3W8G A;  3LAN A;  1NHK L;  2MY8 A;  5K20 B;  3MEE B;  5HSP A;  1REV A;  4KQZ A;  2MKI A;  2HBZ B;  3W5Z A;  2Z8Q A;  1UW9 A;  2XNQ A;  1KVK A;  1T9U A;  2HHV A;  2B8P A;  1Q4R A;  1S1X A;  2LEP A;  1EET A;  4UUX A;  5ETM A;  5AE1 A;  1U24 A;  1U6Z A;  5KFY A;  5LMU F;  4NXM F;  4KHM A;  1R3N A;  4DX7 A;  2MST A;  4ECT A;  5H9E J;  2C2N A;  1QM9 A;  3V4I B;  2ZH6 A;  1NU4 A;  5KFK A;  3SQO P;  3T6J A;  3H5U A;  3R3T A;  2B0G A;  2HNY A;  2XCP A;  4RKU C;  3U1N A;  4O0N A;  3HCX A;  3GII A;  2R7R A;  2XG8 A;  4C8Z A;  2ZKT A;  4AXI A;  2KM8 C;  2XY7 A;  3HD1 A;  4K5R A;  4RW7 B;  2JNJ A;  4B3S J;  3L4B C;  1OPZ A;  5AT1 B;  4OFZ A;  3OFF A;  5C24 B;  1BQX A;  4OHW A;  3C19 A;  3EGW B;  4PRF A;  4ZVR B;  3KYL A;  4YR3 A;  2CJB A;  4ZDN A;  1S5Z A;  1G2E A;  4USV A;  1N5S A;  1S49 A;  1UWB B;  3QSY B;  2OTL S;  2YNF A;  2YNH B;  1P27 B;  2D3O 1;  1PG5 B;  1CJU A;  1Q5Y A;  1WOR A;  4BC9 A;  4C8M A;  4JI6 F;  1P1L A;  2OLW A;  4RNO A;  4ZPD A;  2FHM A;  3GMG A;  1DAX A;  1Q86 T;  2QX0 A;  2VG5 A;  1NZ8 A;  4PWD B;  3BM7 A;  1BQM B;  3ZZO A;  2YNI B;  2VFS A;  3NG8 A;  4DV4 J;  3OBI A;  2IM2 A;  4ECX A;  2HNZ B;  2BQ3 A;  1OWX A;  1G4C A;  1H73 A;  4K50 A;  3TAQ A;  1VCT A;  1MMN A;  4MTP A;  3CJS A;  1HAR A;  3VHQ A;  2C3O A;  1RT5 B;  1VI7 A;  2GVZ A;  1N88 A;  3QFH A;  4DUY J;  1RYS A;  1OMS A;  1WHX A;  3LW5 C;  3W2W A;  5CXT A;  2AYE A;  1TR0 A;  1RIS A;  2G2Y A;  1KRP A;  3SFU A;  5D4P A;  2GHV C;  5HO4 A;  2XC9 A;  1DTQ A;  3T19 A;  4OL8 A;  3CCZ A;  1RU1 A;  4LRC A;  2MZJ A;  1PYT A;  2KVI A;  3ICL A;  3IN5 A;  2ZH1 A;  4NLR A;  3MGJ A;  4IRK A;  4KFB B;  4L6V 3;  1NJW A;  2VAS A;  2ZD1 B;  4V19 X;  2D3U A;  3AQP A;  1IQZ A;  4D3H A;  3MD1 A;  4DV7 J;  4F4K A;  2HWH A;  3I56 S;  1JLQ A;  3MAA A;  1OPI A;  1JLE B;  1ZAX A;  3BSN A;  4NLG A;  1CUL B;  3OT9 A;  4DU8 A;  2BJ3 A;  3TR5 A;  4Q0B A;  1GMV A;  4ECW A;  4O3O A;  3FK4 A;  3DRS A;  3I87 A;  2PMW A;  4J9V A;  4CTA A;  2V2Q A;  1A7G E;  2LXI A;  1HBO A;  2V9K A;  2DTJ A;  4DBQ A;  2NYI A;  1QSY A;  4GVB A;  1GK8 A;  2Y1R I;  4P2F A;  1RT3 A;  2IJF A;  1B99 A;  3TA1 A;  2HZV A;  1Y3K A;  2GCF A;  3JSY A;  1YG0 A;  2B56 A;  1KNZ A;  4NLT A;  1UZD A;  1NPR A;  3NKY A;  3Q0A A;  4IQM A;  3D0G E;  1CJV B;  1RT1 A;  2IJN A;  4A8M P;  2GC8 A;  1F9E B;  5D77 A;  3GV8 B;  5F8G A;  3UCU P;  2FQQ B;  2F8E X;  3BGF A;  2MGZ B;  1IKV B;  1HHT P;  1CJK B;  3AFG A;  4ZPC A;  2VQE F;  1SV5 A;  2VFR A;  1LEO A;  2XLK A;  2B9Y A;  4ZLJ A;  1FER A;  4DR2 F;  1FEE A;  4ZA1 A;  3TI0 A;  2L48 A;  2IAJ A;  2GMJ A;  4A8Q A;  2R7X A;  2HGM A;  5CCL A;  2YWW A;  2RB7 A;  1DFD A;  3E3X A;  3SCK E;  2RIL A;  2DXE A;  1RTI A;  5EX0 A;  2ZH3 A;  4W90 B;  1NDC A;  3M2R B;  3V6J A;  4IKA A;  4JBC A;  3CCE S;  2BJD A;  2VB6 A;  3ENV A;  4I4B A;  1S79 A;  1FRH A;  2LEC A;  2X1G A;  1ZTW A;  2MQP A;  3M6X A;  2J7U A;  3BQ1 A;  3N6M A;  1HWU A;  3B8H A;  4B9N A;  3KHL A;  2VBY A;  4O44 B;  1KN6 A;  3KLI A;  1RXO B;  2PD1 A;  1XNR F;  5ETN A;  8ATC B;  4I6A A;  2HQD A;  1YIJ S;  3TUZ C;  2JC0 A;  4QR1 A;  4K4U A;  5FII A;  3LTO A;  5F9N A;  4KHR A;  3DLL Q;  4P75 A;  1DQ9 A;  4UQT A;  2N7Y A;  3BYR A;  3N6N A;  3VZH A;  2ILY A;  2ATC B;  4QQB A;  4R5P A;  1JKH A;  5HQM A;  3QRR A;  3GJQ B;  4FZV A;  1JXL A;  3KOA A;  5J2Q B;  1EX8 A;  1RLD A;  2NS1 B;  1TL1 A;  2DNP A;  5D78 A;  4WTY A;  2V4J A;  4WFA Q;  3D68 A;  1S6Q A;  3QO9 B;  4LF4 F;  4JV0 A;  3F0N A;  1RKI A;  2JZ5 A;  1I94 F;  3N9U C;  3LH2 S;  2B4P A;  5MLC V;  1X4A A;  3MED B;  1ROF A;  2CWX A;  4A8K A;  1SVD A;  1T3N A;  3IBF B;  4KPC A;  4M5D B;  3DOK B;  2HVZ A;  2V94 A;  4TYB A;  3CDA A;  1KFD A;  1NRK A;  3W5X A;  4DG1 B;  3KK3 B;  3FZ2 A;  4F0M A;  2JFK A;  3MMA B;  4A48 A;  1JLG A;  1TL3 B;  2QA1 A;  4QIG A;  4HI2 A;  3NMA A;  4IR9 A;  3SSR A;  2AGQ A;  3MOJ B;  5EWE A;  4NMX A;  1K47 A;  4A8X A;  4FN5 A;  3S7R A;  2QEX S;  2VOP A;  1ZA2 B;  1X4D A;  2OPS A;  4W4M A;  1UEK A;  1BMQ B;  1QAY A;  4M1K A;  3M8W A;  3F41 A;  3PHE A;  1TK8 A;  2A18 A;  3UQS A;  5KFO A;  2ZJQ Q;  3HVR A;  3H4B A;  1W25 A;  3RRH A;  2ZJR Q;  3JXO A;  2XI2 A;  2BUN A;  3FEY B;  3IWL A;  1UVI A;  5HP1 B;  4E8U A;  1CVJ A;  3KXD A;  1SI9 A;  2KG0 A;  1QDU B;  1VQN S;  2K1R B;  3BH7 B;  1NAQ A;  1G1X A;  2YH0 A;  4DR1 F;  4UTG A;  2PO4 A;  3TVY A;  3J7Y U;  4F50 A;  4P52 A;  3KK1 B;  1K0V A;  2A10 A;  5I42 A;  4BBY A;  1X5P A;  3SFG A;  1R6V A;  4U96 A;  3DRP A;  3BRE A;  4OZ2 A;  1WKL A;  5E2Q A;  3THP A;  2CG4 A;  1HIY A;  2QLF B;  3F56 A;  1UCN A;  4JP8 A;  3MDF A;  1S1T A;  1JB0 C;  3I6P A;  3MR7 A;  1F5C A;  2QIF A;  4C8K A;  3ZFV A;  3AAW B;  1WF2 A;  2IVM A;  2RVJ A;  2UUB J;  5AXM A;  2JRS A;  2LEA A;  1SJR A;  2B8Q A;  4M5L A;  5KT4 A;  4ICL B;  2JVO A;  4J9K A;  3CIM A;  2QSF A;  1G6B A;  2D69 A;  4IH7 A;  1NCL A;  1WHW A;  4ZIV A;  4TNO A;  5KT3 A;  3UI3 A;  1FJE B;  1UJ4 A;  1JLA B;  1VQ7 S;  1W7W A;  1O0P A;  2MQM A;  2F3J A;  2RT3 A;  1U26 A;  5HAO A;  1S0N A;  2KXF A;  3OUY B;  3HP6 A;  1OQ6 A;  2XO6 A;  5A8K B;  1S0M A;  1R0A A;  1RT6 A;  3AQO A;  4P2M A;  1REG X;  5BYS A;  2ZIT A;  3BO3 A;  1V9O A;  4DFJ A;  3V4M A;  1TUG B;  5EHH A;  3NGU A;  2V0N A;  3QQC D;  1KHW A;  3SQG A;  1S76 D;  3CCL S;  3CVK A;  3OD2 A;  3CC7 S;  2XY6 A;  3ENQ A;  2FD2 A;  2D41 A;  5D4O A;  1DUR A;  3QT7 A;  4DCO B;  2C3Y A;  1YWX A;  1S12 A;  2BAC A;  1M5O C;  2VKZ G;  5KOX A;  1U2F A;  3A3N B;  3PRD A;  4DQR A;  3PW0 A;  5E3C A;  1BXN A;  2AJF E;  2ADB A;  1NZA A;  4IRD A;  2XSJ A;  1N32 J;  2IBK A;  1T9Y A;  4G65 A;  1M5H A;  1EIY B;  3MHY A;  1ZBT A;  5GAH I;  1RYR A;  2NR0 A;  1Y9O A;  3LP0 A;  2ASD A;  2JJ4 D;  2XUL A;  2ZH5 A;  1RTZ A;  1NPK A;  2CJY B;  4OJ1 A;  2NXE A;  1UA1 A;  1S9G B;  4Z37 A;  1JNR B;  2VIH A;  3HHN B;  3AD8 C;  2IY5 B;  3IBW A;  1VIO A;  3I96 A;  1H6K X;  2NZC A;  4UZB A;  3BH6 B;  2IJR A;  3Q8V A;  2XS2 A;  2R7V A;  2KU7 A;  4CT9 A;  4O4G B;  3JAM Y;  1PO6 A;  1RLC L;  2A2C A;  3C8Y A;  3PV8 A;  4M95 A;  2XO7 A; 
#chains in the Genus database with same CATH homology
 3ZTS A;  1F3F A;  1NLK L;  1MN9 A;  1WKL A;  3PRV A;  2HUR A;  2HVE A;  3VGU A;  1HIY A;  2B8P A;  3EVM A;  3G2X A;  2BEF A;  1UCN A;  2HVD A;  3Q89 A;  4W98 A;  3GP9 A;  3NGT A;  3FBC A;  1PAE X;  3ELH A;  5BXI A;  3BBB A;  1S59 A;  1PKU A;  2AZ1 A;  4S0M A;  1LEO A;  4EK2 A;  1XIQ A;  1BE4 A;  2DY9 A;  3VVT A;  3Q83 A;  1NB2 A;  2DXD A;  3NGS A;  2AZ3 A;  3EM1 A;  2CWK A;  4F4A A;  3FBF A;  3FCV A;  3DDI A;  2B8Q A;  1NDK A;  4DZ6 A;  3R9L A;  2DXE A;  2DYA A;  2DXF A;  3VGV A;  3JS9 A;  3VGS A;  3ENA A;  1NSP A;  3VVU A;  1NCL A;  3BBC A;  3EE3 A;  5CAB A;  1NDC A;  3DKD A;  1BHN A;  4AND A;  4O0N A;  1NDL A;  3ETM A;  1W7W A;  3FBE A;  4UOH A;  2VU5 A;  1XQI A;  2BX6 A;  1NSQ A;  1JXV A;  5IOL A;  1WKJ A;  2ZUA A;  4ENO A;  4FKY A;  4HR2 A;  3BBF A;  4KPC A;  4C6A A;  3ZTO A;  5C7P A;  1WKK A;  3VGT A;  3EJM A;  4UOG A;  1BUX A;  1NPK A;  1VYA A;  1EHW A;  3FC9 A;  3B6B A;  3PJ9 A;  3MPD A;  3EIC A;  4FKX A;  4F36 A;  4CP5 A;  1HHQ A;  1KDN A;  1NSK L;  3BH7 B;  1NUE A;  1B4S A;  3EVO A;  1MN7 A;  1HLW A;  1B99 A;  4ANC A;  3FCW A;  3FBB A;  1NDP A;  3BH6 B;  3Q86 A;  1S57 A;  1K44 A;  4DI6 A;  2NCK L;  3Q8V A;  4WBF A;  3WX8 A;  3ZTR A;  1U8W A;  3NGR A;  1NHK L;  3B54 A;  4UOF A;  3ZTP A;  3EMT A;  3GPA A;  3ZTQ A;  1F6T A;  1S5Z A;  3FKB A;  1LWX A;  3Q8U A;  3NGU A;  4DUT A;  3Q8Y A;  4ANE A;  3L7U A;  5CAA A;  1ZS6 A;  3EVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...