3PJ9A

Crystal structure of a nucleoside diphosphate kinase from campylobacter jejuni
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
137
structure length
137
Chain Sequence
MEKTLSIIKPDAVKKGVIGKILDRFESNGLRIAAMKKVQLSKEQAENFYAVHKERPFFKDLVEFMISGPVVVSILEGEGAVLKNRDLMGATNPKEAKAGTIRADFAESIDANAVHGSDSLENAKIEIEFFFKPNEIC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Nucleoside Diphosphate Kinase from Campylobacter jejuni
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 42
structure length 137
sequence length 137
chains with identical sequence B, C, D
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2010-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3pj9A00
1S5ZA 3Q86A 1B4SA 4DUTA 3B54A 2DYAA 4F4AA 3ZTOA 2BX6A 1NDPA 4HR2A 1B99A 2DXFA 1NSPA 1BHNA 2ZUAA 1ZS6A 2B8QA 3EE3A 3VGUA 3VGTA 3WX8A 4S0MA 3NGTA 3EICA 4UOGA 3FBFA 1LWXA 1W7WA 5C7PA 3Q8VA 3R9LA 1XIQA 1NLKL 1NDKA 1NSKL 3EM1A 4W98A 4ANCA 3NGSA 3G2XA 3BBCA 3Q8YA 1MN7A 2NCKL 1EHWA 1MN9A 3BH7B 1KDNA 1WKJA 2HVDA 1U8WA 1NSQA 1S59A 3FBEA 3EVMA 2DXEA 1F3FA 1HHQA 1LEOA 2AZ3A 1NUEA 3FBCA 1K44A 3ELHA 4CP5A 3FBBA 1VYAA 1S57A 3EVWA 3Q8UA 4WBFA 3EVOA 3ZTSA 3GPAA 3EMTA 1WKKA 1NDCA 1NDLA 2B8PA 1PAEX 3DKDA 3VGSA 1HLWA 1BUXA 2CWKA 3FKBA 4O0NA 4DI6A 2AZ1A 1F6TA 5CAAA 3MPDA 3BBFA 1NB2A 1JXVA 1UCNA 3DDIA 1NCLA 3JS9A 4EK2A 4C6AA 4FKYA 1XQIA 3Q89A 3VVTA 4F36A 3ETMA 4ENOA 3BBBA 3VVUA 2DY9A 4DZ6A 4ANEA 3ENAA 3VGVA 3ZTQA 3NGRA 4KPCA 2VU5A 4FKXA 3L7UA 3PJ9A 3FCWA 3BH6B 4ANDA 3FCVA 4UOFA 3NGUA 2HVEA 1BE4A 3FC9A 5IOLA 1PKUA 3EJMA 1WKLA 5CABA 3Q83A 3ZTRA 2BEFA 1NPKA 5BXIA 1HIYA 1NHKL 3PRVA 3B6BA 2DXDA 3GP9A 4UOHA 3ZTPA 2HURA
chains in the Genus database with same CATH superfamily
2ZJRQ 4DCJB 4M5KA 2DISA 2FC9A 4HYKA 2Q6BA 3RYLA 2EFOA 1VRUB 1RTZA 4DV3F 2C3PA 1TL7B 1WC1A 2LXFA 4MYTA 2QTWA 2DXFA 2PI4A 1B64A 4LF2A 3R6GB 1BHNA 1SUQA 1LV5A 1FDNA 2MTLA 2KDOA 2ZBRA 4KH1B 3EXYA 4CO4A 2DJWA 3V6JA 4UOGA 2FJDB 2PDAA 4FYVB 2RHQB 1Y11A 1RTHA 4A8KA 4N41A 4CTAA 4C8OA 1ZPVA 5A8RA 3OVBA 2AIRB 4CT8A 1SL0A 4GC7A 4M95A 1KN6A 4P9SA 2CQ4A 4LF9J 3SCJE 1Y5NB 4OZ2A 2E5LF 4E8UA 1H6KX 3QFWA 2H65B 4B3TF 2VIHA 1LWCA 3B8HA 4ID5B 3M30A 4NRUA 1WORA 4XDDA 2R2TA 1VC5A 2C28A 3UCUP 1N6QA 1MN9A 4I2PB 4DPOA 1CG2A 2IVYA 1H74A 4PG5A 4X4SA 3W9JA 2HBZB 3B4DA 2Q6CA 4ECUA 3AA9A 1WKJA 2VA2A 3PW2A 1GK8A 2J9DA 4PQUB 4CLLA 4JI0J 1OQ6A 5L9NA 3T6JA 1MROA 2MHNA 2KXFA 4DLGA 1N5YB 4KHPF 2DXEA 1Q4RA 4ZP6A 3RW7A 2FLLA 4YB5A 4EU0A 3HHLB 3VF0B 1LEOA 5D77A 2N7YA 1VDHA 4OYBA 3H8YA 4P75A 3HHLD 1S1WA 4NLXA 4D3HA 1K1SA 4NLYA 2IAJB 3T19A 3DOLA 2D74B 3Q8UA 1VOMA 4CI0B 1WD6A 3QNWB 2MKHA 1ZZNA 1NO8A 2WSEC 2OAUA 3DU5A 3SFGA 1PGZA 4X4NA 2B5JA 1RU2A 1T05A 2GHWA 4Y34A 1FEHA 5DGAA 1FTCA 1V3SA 1PAUB 3US5A 2ASJA 4V19X 3HSZA 2AJ0A 3LH2S 2CPJA 3QRRA 2J7UA 4KFBA 2QO3A 5GMKa 4PG4A 1SJ1A 1R0AA 3QZ8A 4TXSA 3T5LA 2RUGA 2BR0A 4JI6J 1P1TA 1KFDA 1VK8A 2P9GA 3LF0A 4DPYA 2DNZA 3PYDA 5GAGI 3Q89A 2V4QA 3ZC4A 4F3MA 5A2QY 2DGQA 3M9OB 2FJXA 1Q1KA 5KFKA 4LFBJ 4QYZK 2VFUA 3CIMA 2EFNA 5IT4A 2HAFA 3C15A 3D3CJ 1JMTA 3BEGB 3MR7A 3GIRA 5IWAJ 2F8MA 3HT0A 2UXCJ 2AF6A 2WSFC 3JAMU 4IFYB 1PG5B 1CJTA 3DYAB 3QGHA 3S6EA 1S6QB 1RCOB 2UV8G 4ECZA 1CULA 1OO0B 2OPPA 2VC1A 3HKZD 4RUBA 5HVFA 3PEHA 5B0DA 4FF2A 2GV1A 2ERRA 1TKDA 4CCHA 3GFHA 3PJ9A 2QGFB 1U1PA 4L73A 1UW9A 1NK7A 1IBLF 2CQGA 2HHHF 3IWLA 1UJ6A 5IFMA 2ZOMA 1O6XA 9ATCB 2LKZA 4XO0A 2KG0A 3BJYA 3CD0A 4DX7A 1NB7A 1TQLA 4L6V3 5LMNJ 1MU2A 1RAFB 4KY3A 2HVEA 2R7OA 1S0MA 2B51A 3FC9A 4PR6A 3MOZA 3DFEA 4RW9A 3GSDA 3TRGA 3THVA 2DRAA 3NWRA 1AXQA 4TKTA 3AT1B 4OV6A 1R8BA 2WW4A 4V1Ak 4ZVQB 3ZTRA 3V6HA 3FCHA 1MW7A 1HWUA 1R43A 4FZVA 4IFVB 1J2VA 1R6VA 4Y6IA 4YR0A 5HP1A 5IT9Y 2N4CA 3HSGA 1UVMA 4WE1A 3KLGA 1F9FA 4LR9A 2EW9A 3GLJA 2V50A 4ECTA 2PIIA 3DLEB 4YN3B 4XPCA 3RRHA 1ZZFA 2F4VF 3P8BB 2QL5B 3PKYA 4OZLA 1TUWA 4I2QA 3WX4A 3KG0A 5HP1B 1FRMA 3NAIA 1IBCB 3GFZA 1H98A 1ZA1B 4HVZA 3MECB 3KG4A 2UUCF 3BREA 4K4SA 4U8VA 1H72C 1J27A 2IA6A 1TELA 1ZTTA 2GS8A 4DS5A 1URNA 2HMIB 1HW8A 1DY3A 3G8TA 5KFFA 4G3IA 2ATLA 1TKXB 1XIQA 4OYAA 1RYSA 1HPZB 3GZ7A 3CJ3A 3N6LA 5GADU 4H4KA 1IR2A 3RAQA 5EDWA 4LSLB 3KJVB 3HULA 3UCGA 3P6YC 4P2MA 1KQKA 3PR5B 3O5TB 2H3EB 2EPIA 4NXMF 1S1UB 4X65F 3QAEA 1IKYA 3Q2SC 2KTQA 3SDEB 5KFGA 1RA7A 1UKUA 2HNDB 5LL6d 1M90T 2A2DA 2B7BB 1UFLA 3ONQA 1GQEA 4DZDA 4Z7CA 1DQAA 4P71A 4ELTA 2QC3A 4ED1A 1EETA 4KYZA 1YJVA 5HI7A 1VQ8S 3KTQA 2ZOFA 4X84A 3M4XA 3JQMA 3OVAA 4C9DA 3SV3A 2KT2A 1VHFA 3FBCA 3H25A 2C2KB 2QYGA 2PA8D 3H0PA 4FF1A 5DS7A 5ETTA 1EKRA 4U96A 3KOAA 1HWLA 2O1PA 1NDCA 2PT0A 4MK8A 3BQ1A 1X0PA 5E7OB 1FK9A 1Q0NA 4ICLA 3WQPA 1KWMA 4LF4J 1RU1A 5KFCA 1FXDA 1SH0A 3NLCA 4IDKA 1JLQA 4LRAA 1U1KA 3CJ4A 1Q82T 1DARA 3G82B 3IBFB 3OV7A 2AT1B 1ZYQA 1NK5A 3POTA 2R7WA 4B9UA 4ID8A 5KFQA 1CC7A 1S7IA 3MPDA 5IC6B 5HAOA 4RLEA 2ADCA 2M9KA 2QMWA 2M7SA 2Q79A 2R42A 2WBMA 3KJQB 5JUMA 5IV3A 2ZM6J 3EYZA 4ED4A 4YOEA 2E1RA 4J9VA 4I2QB 2ASLA 3M2RA 4GVLA 2ZVIA 4I68A 3O1LA 3R8YA 4JI5F 3ENVA 4DV7F 2XS2A 4M5DA 5AT1B 3MEGA 1HBNB 5F0WA 4YQWA 3LWLA 3LUYA 2DB1A 3EXCX 2EKNA 3BGFA 4DV4J 2DY9A 4OLPA 4DR5J 3JQKA 5KFLA 3FEXB 4DV0J 2V9KA 1X7VA 2RD5C 1UEVA 4OYWA 2H4YB 4P73A 4LF5J 2VPWB 3FQLA 5D4NA 1SJQA 4WTYA 4LR8A 4MIAA 4ALZA 3UR0A 3OT9A 4DUZJ 1CS4B 2MZTA 5C24A 5HQ8A 2OD4A 2MGZA 4QBUA 2FVPA 4K4ZA 2VFTA 4PQAA 1O8BA 1LW0B 5F0UA 1HHSA 4KV8B 1IBMF 4DR6J 1LWEA 3I4HX 1RGVA 4NA3A 5GAGU 4ZP9A 2J6TA 3A3OB 2MZJA 1PKUA 1RJJA 1JJ2R 2DGXA 2HIYA 1T8EA 1EQMA 2CJXB 1TK5A 3MAAA 4RU2A 1SIZA 3HI9A 3T1YF 5MAOA 3DM2B 1NRKA 2QA2A 3HSDA 2YKPA 4IOAQ 2W01A 4WFAQ 1HIYA 2I0XA 1CJUB 2J8AA 1SQFA 1S6QA 4PAAA 2YKNB 2MQOA 1CJTB 1FFWB 1HQUB 3DYAA 5F3TA 1R3NA 4ZCMA 2E9RX 2ATCB 3L7PA 1FF2A 4B3OB 4ETZA 3AHPA 3BYRA 5ETSA 3M32A 1QTNB 3D2WA 4DR4F 4WKRA 2OEJA 2UU9J 3V4IB 2DGVA 3LP2B 2DRDA 3HX9A 5T7LA 3V4MA 3TQ1A 3ZXWA 2BE2A 5CD4A 1FKPB 2J5AA 1ZS6A 2CYYA 2XHCA 4UUXA 3SV4A 2R8KA 4GO7X 3TA1A 1RT5A 1VJQA 2COLA 2FY1A 4CDIA 2YTCA 4I6WA 4NEYA 4G1QB 1YBAA 4P2XA 2PFDA 3B82A 2CUYA 2LQBA 5G4DA 3CC2S 1YHQS 1U0HA 5DLFA 2DGUA 2OFGX 3H7HB 4P7VA 2B5JB 2ZD1A 4C8YA 3D7SB 4DF4A 2XZDB 2HBQB 1RHUB 1H0HB 1X5OA 2WW8A 2CJYB 2YQ1A 3TX8A 2MLXA 2R7RA 3VAFA 4DQRA 1QSYA 2E1CA 1Y7PA 2CQCA 1LWFB 1RWVB 1REGX 5T41A 1N34J 2OFHX 3I0SB 4C3LA 1B3TA 1FNMA 1YX2A 3DRSB 2ROEA 2NXNA 3MD1A 4CIOA 1Q79A 2LYVA 3IM8A 3HFVA 2D7SA 3FZBA 2QX0A 3IS9B 3MM5B 3PYFA 3SXLA 4CLTA 1NK9A 4WJBA 1KSPA 3CDAA 2WB4A 4URSA 4CLWA 3PVXA 2RUSA 3HFZB 2CAJA 2BJ8A 3ELHA 3MURP 2HQ3A 3MMJA 2KG1A 1VYAA 2MZRA 1PC4A 3BSNA 5GADI 4QWEA 1RAEB 4GRSA 4USHA 3ILIA 1TV6B 4ZLLA 1HNWJ 3TI0A 2FJAB 3CE8A 4DR4J 4AUKA 1YVFA 2O67A 1R0CB 3DOMA 2FHJD 3M05A 3NP5A 4Z7YA 4TNOA 5CYQA 3GYGA 1NNDA 4N47A 3BGRA 4IOBA 4EBDA 2K7KA 2FIUA 4LIRA 1MWYA 2DCLA 1D8ZA 2AZ1A 2HEKA 6AT1B 2BM1A 3JSYA 1GMWA 3D6HB 2ZOGA 1U1QA 1SL2A 1M5KC 3PTWA 2HS0A 2CQ3A 2YNHA 3D6FB 2GNKA 3PJXA 4K2XA 1FRIA 3S1TA 3MM8B 1KD1T 4X4PA 3R5CA 4RW7B 4DSIA 4F50A 1LKZA 1RACB 3VZIA 3G6YA 5LT5A 3UD3P 5LSOA 1TL4A 2VG6B 5KFDA 4PWDB 1WELA 5E3RA 1IKVA 1X60A 4TU7A 1IQTA 4G1QA 2CJAA 5HBMA 3H2UB 2H5JB 4WFXA 2R2UA 2VDHA 3AXMA 2AJ2A 3Q8RB 2RDJA 1X4FA 3CW2C 4WKYA 2AX0A 4CH0S 1UVIA 2G2OA 3MCMA 4TQRA 3CPWR 3M8PA 4DQPA 4Z2XA 1TU0B 4ES3A 4DV5F 1Y5IB 3GG1A 1APSA 1DJ0A 3C6TA 3UW1A 3UVJB 3FVYA 4CYUA 1BWVA 1VQNS 2HPUA 1NKCA 4R8UB 4DF8A 4UY85 1SC1B 3FEYB 3HD2A 3W63A 2HGLA 2XO6A 5CABA 3BN4A 3D0HE 2X7IA 1Q8BA 3R5DA 4UF4A 3G6VA 4LMZA 3LANA 4NYPA 4WF9Q 3BO3A 2D3ZA 3OLAA 2OMOA 3H40A 2W2PP 2XNQA 5CZXA 3DI6A 1R7IA 5EHHA 3GG0A 6FDRA 1HMVB 3M9MB 4BDPA 2B9EA 4F3OA 2JEIA 1RTJB 4KKOB 2ZZMA 2GHVC 3B54A 4IRDA 1IKWB 2BABA 3DMJA 4PXBA 2M4MA 4FYWB 1UPPA 2RKIA 1YITS 2VBZA 1QTMA 4YY3F 1NSAA 5B0EA 5HN0A 2X3GA 2UP1A 3BSAA 3EE3A 3QT8A 2OUGA 4GO5X 3GIKA 4J9NA 1N5YA 1UFKA 2DEJA 2NS1B 2DNQA 4KHMA 1W7WA 1S1TB 4GKJF 3IBWA 2W1BA 2V8PA 2L48A 3K5PA 4P74A 3U27A 4X64F 2AHOB 1NDKA 3H2LA 2XEXA 4YFUA 2ZITA 3M2RB 2VPYB 4AXJA 1QDUB 5K20B 4NZ7A 3QMQA 5KT3A 2L3MA 1EHWA 2MKCA 3OFGA 4HH1A 2R7SA 3FUYA 2F1FA 1S9EA 1VJWA 3MMBB 3N9UC 3VR1A 1TKZB 3C6UA 1VR6A 3TUIC 1WTBA 1HNWF 2AGOA 2G0JA 3CB4A 4F4ZA 2PC6A 5J1NA 4DR1J 3P49B 3O3LA 1AFIA 5EWGA 2HVDA 4LSLA 1EKSA 2G1HA 2LDYA 1NSQA 2H9ZA 2XNRA 4Q0BA 4L3NA 2Z30B 5KG3A 3CULA 3LP2A 4K59A 1RBAA 3UN3A 4AL7A 1LXJA 1RISA 2AZ3A 1JLEB 1GAOA 2CRLA 5J2NB 2HRUA 3UN5A 4X62J 2MY7A 2V2QA 4CH7A 2GO9A 3CJSA 1FXLA 3TQEA 2HFZA 4KAIA 1YK9A 4U6PA 4UQGA 1WF2A 1SJRA 2VG5B 3GPAA 3DRPB 4OX8A 5CYMA 3CCZA 4PXEA 4KR0B 2QMUB 1NZAA 2F4VJ 1JLCB 2PEHA 3D6MB 3IWXA 2IM0A 2ZUGA 1RP5A 4DR7F 4NXNF 5HK4A 2OJ3A 1W26A 4QR1A 5D78A 1N32F 2AMCB 4FXWA 3HSJA 4JP8A 1OYEA 3T6BA 1EIYB 2JWNA 5HL7Q 1LWEB 3R5GA 2HLUA 3NGKA 2HNYB 3BSCA 2CJQA 1HYSA 3UO0A 3D6TB 3KK2A 5HSPA 4JV1A 1U25A 4WFNQ 1RT2A 3CCUS 5M2PA 2F9JA 1QAYA 2G2YA 3J7ZT 4E0DA 1HBUA 3CCRS 1WOSA 1SKUB 3SEOA 3OFHA 2V69A 3KK2B 4OYIA 2EFPA 3AJ1A 5LMNF 1RAJA 3M8PB 3E2EA 2BJ7A 4L76A 4DUYF 3GILA 1WHYA 2EG1A 2HS4A 3CMES 3Q2TC 5AJ3J 4KH0B 4DV2J 2PMHA 3NGRA 2BA9A 1UVLA 4I64A 1WHXA 1G6BA 4PWUA 4Q43A 2J0QD 4DPWA 1IWGA 2OSQA 1FRJA 2PSZA 4QZVB 3MMAA 5D3GB 4LF7F 4J9KA 1KHVA 4NLWA 2BQ3A 1UJ4A 2BW2A 2KU7A 4MKVA 5FDLA 1RT3A 1OS5A 1UEKA 5KG0A 4IOCQ 3TJ9A 1WTFA 3CCQS 1XNRJ 1P1LA 1RWXB 2B9YA 4WTOB 4OZ1A 1S6OA 3J7YU 1C0TB 2Z0GA 2DHHA 1GMVA 2XYPB 3KDOA 4P2FA 4C48A 3J7YI 2WVCA 3Q8QB 1RT1B 3G6XA 1XR5A 3CJ5A 1NHKL 1QAXA 5D0EA 3S7RA 2GIQA 3B6BA 1OY6A 4DUZF 4F8RA 2QLBB 2N4DA 4ZITA 2HURA 1RLCL 3KK1A 4LFAJ 1UVKA 5H9EJ 3BO2A 2PE8A 2FVQA 1FRKA 3KXDA 1NHVA 3WC2A 4DV0F 2HRYA 1T94A 2DCUB 3KJFB 5ADZA 5EWFA 2ZH7A 4A8QA 1L3UA 1H2TZ 1S6PA 4HHUA 4DDFA 1TV6A 4C2MA 1FD8A 2BBEA 2OH2A 3R2CJ 3CT9A 4NI2B 4O3QA 4JI5J 3QO9B 5GAHU 2WZ1A 2ZNYA 3SCKE 2N7CA 3G8QA 3DOLB 3I0RA 4TN2A 4DL3A 3JSMB 1YJTA 2P6TA 1UPMB 3AQOA 4WFBQ 4DSJA 2OGUA 2ZM6F 3CJTA 2IBKA 4LVNP 1ROFA 3GFYA 1I3OB 3SCLE 4USIA 2QEXS 1TMJA 3BR9A 3HLUA 4I1TA 3WZ0A 5E41A 1OY8A 3I96A 1UETA 1YJRA 3CCWA 3FEZA 3NBPA 3W66A 4X62F 1X9WA 1AYEA 1XR7A 4RBVA 2VKZG 3W2WB 1SKSA 4LF4F 1NMEB 1RCXB 1VCTA 2GO8A 4F7VA 3BGOP 1EARA 3QGPA 2BJ1A 2IRYA 5KFBA 3KLEB 4B3TJ 4JUZA 1HBMB 3ZZRA 3PX6A 4WP8A 3GIJA 3RB4A 2DK2A 3R7NB 2XTJP 4ECXA 3CNQP 5KOXA 2YPYA 3THPA 4QW8A 2QLJB 4DV1F 2VPZB 1HBMA 2J0XA 1FXRA 2FZKB 2QL7B 5ETLA 4MFBB 5J2QA 2D3O1 2DR7A 1XMBA 4F0KA 1YBTA 2VFVA 3OUYB 3CJKB 2BM0A 1U8SA 3EWGA 3DXBA 1S97A 2HWTA 3EVOA 4DQSA 2A3JA 2ZWOA 4IH6A 1NU4A 5A0YA 4EWTA 5A6PA 3LO3A 1NDLA 2GAHC 3FQKA 2WTFA 4Y2AA 1J5OA 1S9EB 2EK6A 4C98A 2HHQA 1YQHA 3TX0A 3JYTB 4L74A 2W7PA 4ED7A 4OI0A 2W24A 4X4OA 1S77D 5C2GA 1H2VZ 2PMZD 3CJ0A 5I4MA 4MMOA 1CJVA 1U2CA 1REVB 5H9FJ 4CLZA 4W90B 1E6YA 1WF1A 1NH7A 2MLZA 2FYXA 3A1YG 3AOCA 2V8GA 3DI6B 5HJXA 4C6AA 1F5AA 1XQIA 2GW8A 2HFUA 2MZSA 2X1GA 4NOHA 3ULHA 2ZHAA 1YTYA 2GMLA 3EGVA 1Y4ZB 3GTYX 4I4BA 3MXHP 1FKOB 2FHOB 3WIVA 2IJFA 2VQFJ 5KFVA 3UNGC 4QIFA 1CJKB 4FVMA 1HNIB 2KVIA 4A8FA 4FBTA 2JEGA 2DH7A 2PO4A 1KVIA 4FYXB 4B9TA 3SSQA 4A8XA 1EB0A 1DAXA 1KNZA 2GZOA 4TQSA 1VQ6S 3NS5A 4HKQA 1TTHB 4M5HA 5HATA 3UPFA 5T7LB 2R3VA 5B08A 2EFQA 3TAPA 2AEMA 1NPPA 1SH3A 2KJWA 2W7AA 3BGRB 2V9WA 3C8YA 2FC8A 4IR1A 3L7OA 1XNQJ 2OPQA 1BE4A 5AXMA 3TUPA 1EQ0A 3IRXA 2ZE2B 3P96A 4O3NA 1WACA 4ZVSB 1FJEB 3Q22A 4C8LA 3ET6A 2ZKTA 5IZHA 1FFSB 4YEAA 3R2DJ 3RR7A 3Q83A 1N5QA 2Y0BB 4TVAB 4TYAA 1VQKS 1UFWA 2DGTA 3NEKA 3SQOP 3A12A 3V6DA 1CQMA 3PRVA 4JI7F 4CLYA 2M52A 2BMBA 5L38A 3M9NB 1RBLA 2DXDA 1PJ7A 3OR2B 1QD1A 1HD0A 3I0SA 2M2BA 3IM9A 1D3WA 4OI1A 1NJWA 1B4SA 1RWWB 2DNRA 4WPAA 4QYZJ 2YBVA 1OYDA 2GJFA 4JOUA 5B0GA 4DXLA 2LLZA 4HR2A 1JK9B 2IPOB 1VQLS 2JEFA 2O5DA 1HL6A 3HKWA 4I7FA 2IJRA 4IQXA 3D4JA 4GVBA 4YHHF 1Q7YT 2RMLA 1XNRF 4X2BA 4F0MA 2VG6A 1V6HA 1HARA 3P3DA 2F7VA 4ES2A 2FDNA 1NJIT 1N33F 1SC3B 1KOHA 2R7TA 4O0IA 1S9GA 4K2JA 4B3RJ 2CG8A 4OL8A 3C19A 2WVDA 3X3UA 3AJDA 3W9HA 3HHKA 4Y65A 2GA7A 5T14A 3EM1A 4AXIA 2J6UA 1Y3JA 1FDAA 1XEZA 2ZHOA 3G2XA 2C1EB 2J0WA 1AT1B 2LDIA 3HVTB 4D3GA 3EPGA 4DOZA 3HHLC 2GHPA 2RH3A 3VALA 3NNAA 3BDPA 4QYRA 3PO4A 4J9OA 4OI6A 2I9SA 2HHWA 4FDFA 3VCDA 3VZHA 4N76A 1T9XA 2DHSA 4HACB 2R7XA 3KHHA 4LRFA 4EO6A 3AH6A 2XLJA 1NBEB 3N28A 3UD5A 4DEZA 3DN9A 5IS2A 1X4DA 3KLFA 3JSMA 1P8GA 1UVNA 2IHR1 3UWTA 2GJ2A 1Q5YA 2AGPA 1RBOB 3QO9A 1JNZB 1BD6A 1ELOA 2AEFA 1TKXA 3DOKA 4U8YA 5L1JA 2JEJA 1IKVB 4CNYA 5CHCB 1VMBA 1OSCA 1JIHA 1K44A 1SC6A 3AFGA 1HI8A 1FFGB 3TOQA 2BE9B 5F41A 5DM6Q 1K8AT 4KJIA 4KGKA 2IYIA 3QATA 3J80Y 1J5OB 4B9LA 3WDOA 1O0PA 5EX0A 1U6BA 1BY9A 2PMWA 4YB6A 3QFHA 1MMNA 2W2QP 3AD7C 2UUWA 4USTA 1VRTB 3OTBA 3IG1A 5CQGA 3GMGA 2V2KA 5J2MB 1BC6A 1X4HA 4HL9A 2KZZA 1LK5A 2NXCA 4O4RA 4N56A 2YX4A 1S0OA 3SBMA 1QAIA 3NNHA 4DV6F 1S1UA 2WONB 3AXKA 3BKUA 3BPDA 3E3XA 2I6WA 4LF9F 5LSLA 2FGOA 4EEYA 1UCNA 2FHJA 3PEJA 3AJ2A 1IWAA 2DNKA 3M8QB 3PW4A 1QLNA 1X31C 1TL1A 3X1LB 1F9EB 2XSJB 4AQYJ 3CD6S 4DPTA 2GGPA 3CXCR 1C1CA 4ENOA 4EZ9A 1GX5A 2LA4A 2HHSA 4UTGA 4KGXB 2B7CB 5L9XA 4XK8C 2YX1A 4F4WA 2KL8A 2D3OR 1VQMS 1XMOF 1S10A 2AW0A 3MCNA 5E5NA 3P5TL 4X4TA 5ETNA 2JLFA 2Q43A 2VD3A 3DRSA 3T5JA 1NK8A 4Y2KA 3QWUA 4KV8A 4RNFA 3A8IA 5KFOA 1JLBB 3G82A 3R5JB 3TR5A 4Q44A 2MQQA 5J2NA 1JX4A 2XCAA 3CJ2A 5H9EK 1B0VA 3FCVA 5HLFB 3D54A 1HWKA 3LPYA 2C3UA 4WYWA 4NI2A 3FK4A 4RBTA 4CQ1A 4ZVOB 3JB9k 2VFSA 3DM2A 2XI2A 5IT0A 5GMDA 4EO8A 4FYDA 4R5PB 2WONA 1TK0A 2ZWPA 4LF5F 1VQSA 2Z2YB 4NLPA 5EX3A 2RIJA 4URGA 4LREA 3CCVS 1HBNA 3RBDA 1X4BA 2POKA 2KRBA 2HFOA 1CC8A 2W9AA 3TAQA 2CKWA 1WC4A 5KFYA 4MK7A 3PIOQ 3GP9A 2KKHA 4M8LA 1S5ZA 1IQZA 4TLRA 3K57A 4J9PA 1AROP 2CJKA 1HNVA 1HA1A 2RF2B 4RW6A 1C0TA 4WIIA 5K8PA 1O51A 3TZYA 3DU6A 4A8YA 3RJMB 3MR5A 1VS3A 2MQPA 1S4EA 2ZH6A 1T05B 2BDPA 3EGZA 2RRBA 4J5OA 3DLKB 4ZIWA 1DBDA 1RT6B 3UFCX 2ZUAA 3MR3A 3AB2B 2AV5A 2AYMA 2F9DA 2G2ZA 3CJRA 3TAMB 3VGTA 1FK9B 2BUNA 4C0HA 4YP3A 4YR3A 4JI1F 1TR0A 2V8HA 2J8SA 1VRQC 4FVCA 2VJVA 4EMDA 5KFRA 1DQ9A 3PKMA 4DG1A 3M8YA 2ZH3A 1D9FA 2FVSA 2ZC4A 3KKFA 3LGHA 2HFNA 4W98A 3RGIA 3TZXA 3MR2A 1VK3A 2K1RB 4A8OA 3KLVA 1OIAA 4A48A 2H5IB 2ROPA 3FMWA 3GCXP 2NXEA 5ITHA 2CZ9A 5BR8J 4OYZA 4Q2LA 5HO4A 4PYDA 4H4MA 2PA3A 2ABYA 2RS2A 3NS6A 3TJAA 3RB6A 2K06A 3TVYA 4WFYA 1GTHA 4ECRA 4CO2A 4A8MP 1OY9A 1RADB 4ILRA 4NLTA 2C2RA 4U9RA 4CLKA 1F3VA 2VG7B 4RW4B 2HNYA 3OXFA 5HJYA 1HYSB 2DIVA 2ZH5A 2CJBA 4O4GA 1SV5A 3FBEA 4PCQA 1KVJA 2Q66A 2EKYA 1T02A 4NZ0A 1T9WA 3KG1A 2BJDA 2WRMA 5HROB 1P27B 3ISZA 1FRLA 3ILJA 3EDRB 1G3OA 2V0NA 5KFHA 1VC0A 1S57A 2BRLA 4ER8A 4WBFA 2UUAF 2R7QA 4TY8B 4PRFA 4DR2J 1GT8A 2DRBA 3BDEA 2W7OA 5AE2A 2M3DA 4PPZA 2YKQA 4K5RA 4X66F 4RUHA 2QN6B 1EZZB 2B56A 4EGLA 2ZH4A 3T5HA 1HI0P 1RTDB 2D3UA 1T3NA 3PY8A 5D0HA 3MAQA 2HZVA 1IKYB 3W2VA 1RTIA 1FT8A 1KVKA 1BUXA 4RW8A 3ZZYA 1FE0A 4JV5J 5GAEU 2DEIA 1YRXA 2H48B 4MK9A 4O3PA 4A46A 5GAEI 5CAAA 3W8GA 4NWBA 4FS2A 2J9DE 2OPQB 2V2VA 4IFYA 2QSWA 5KTQA 1X4EA 2MSSA 3PHTA 1FO1A 1QY7A 1YLXA 3M2VA 3UVJA 4K4UA 4HH0A 2WHOA 3VQTA 4F36A 5J1EA 3HP6A 2CJ9A 3HD1A 1TKZA 1VIXA 3C6UB 3L9ZA 4Q8FA 4EZ6A 2FZCB 2J6SA 3J81Y 3UQSA 2JX2A 1M0SA 2OO4A 2ZDPA 2F8EX 2C2MB 1MLAA 5B0AA 4O3OA 1XJWB 3DRXA 4Q2MA 4ZP8A 5I3PA 2HGNA 4QWDA 3CJ8A 2DIUA 4ZJLA 2ZBPA 1S99A 2XBPA 3DRYA 4F67A 3OSPA 2VA3A 1PC5A 1G4CA 1F1BB 1WHVA 3BR8A 3L7UA 4RNHA 2HKEA 3HMJG 2A6OA 3MPWA 5M2UA 4FPIA 3R6LB 1IM4A 1JKHB 4ANDA 5KFNA 1DZ5A 2ILZA 2AYBA 2U2FA 1FJGF 3CIZA 2E5IA 2UVVA 4W92B 1N52B 1R8CA 2HGMA 2HSEB 2NYIA 3A13A 3NGUA 4F2RA 2KVQE 1N36J 2P5VA 2XULA 4OZNA 3W64A 3W3SA 1L3KA 4AQYF 3KLFB 5KFTA 3QJPA 2BXJA 2FGCA 2RRNA 2DGWA 5KFZA 3JYTA 1VC6A 4HACA 1Q53A 5IM0A 1NPKA 1YI2S 2AJFE 2IMWP 2ZVSA 1RWNB 2XO7A 5J1EB 1R8AA 3KMSA 1EX8A 2DH9A 5D4LA 3VAKA 3M7VA 3V6KA 1DFDA 2OI2A 3RB0A 1JKHA 4UOHA 5KFPA 1NK4A 4Q45A 3IGNA 2E29A 4WXWA 4OJHA 3THTA 3W5YA 3C66A 3W60A 2FPHX 2HS3A 4I2PA 2DY1A 1D09B 2BX6A 4A8SA 2V94A 3M30B 4OQJA 5K9FA 4DS4A 1FA0A 1NSPA 2CPXA 1RWOB 4J7CA 3WC0A 5J2PA 3PDNA 1PBUA 4P6QA 2F4FA 2UUTA 3W2VB 3C6TB 2AKWB 4CYUB 2KM8B 3WX8A 2ZBIA 4QJVA 1K73T 2AP6A 3DLGA 5L39A 2AU0A 4NMLA 5DLGA 3ZNJ1 4JYAJ 3OJSA 4HHJA 4U67Q 1RYRA 3FGVA 4DR3J 4DR5F 3RUBL 2HIQA 4J9QA 2KRRA 1K1QA 4Y2IA 4B3SF 1LWFA 4N5SA 2FJVA 3A3PB 2E7WA 4WU3A 5CZVA 4C4WA 4MKYA 1HQ2A 2XYHB 3OL7A 4LF6J 4DL5A 2ZDOA 1LOUA 1ZM2A 1T9YA 2IRXA 2VG7A 2IMOA 1S48A 2OPRB 3KFWX 4FPRA 4DN0A 3IWNC 3NRBA 3LWMA 1RT7A 3KLHA 1W2BR 4DSKA 3H5XA 4M1KA 3OXGA 3KMQA 1D9AA 1KDNA 1TZ0A 2EBEA 3F56A 2MKKA 1REVA 4Y2MA 1U8WA 4F0HA 2EXUA 2OMLA 3LP1B 1Q86T 5C5JA 5DRKA 2ZHBA 1YDLA 2JL9A 2CADA 2LQJA 1F3FA 2MQMA 5DZ6A 4ECQA 1HQEB 3E01B 2R8IA 4DL0C 2QA4G 1FNXH 3C15B 1P9QC 5AE3A 1GMUA 3FBBA 4CP5A 3AOBA 1MROB 3N4WA 4ZVEA 4FS1A 3CCES 3H90A 3MTKA 2OIHA 1U1NA 3G86A 4DLEA 4ZVPB 3OTCA 2O66A 3PJWA 3KJVA 1WKKA 2R9LA 2HK2A 4JBCA 4BC7A 3TUJC 4WK3A 1RWUA 2B8PA 2DNYA 2I1RA 3N5BA 5D4OA 2X1AA 4ZPAA 3OUYA 4X4VA 2ZZNA 1Q95G 1NHUA 3BN7A 3CSKA 3FKBA 2GVDA 2RQMA 4I56A 3C14B 1S1XB 4O0NA 3SSRA 2NPIA 3UDCA 3WIUA 4C11A 5F9LA 2XWYA 2Q1LA 4PXCA 2RSQA 3TARA 2WVBA 3D66A 1WSVA 3MM5A 4FNHA 4X65J 5L1IA 2XZWA 2M8DB 2CQIA 2KM8C 4DCOB 5KG7A 4PG7A 2YWGA 3K8WA 4F04B 5I42B 2K3KA 2LVWA 3M6XA 1M5HA 3GJRB 4KGVB 4JI1J 2DNGA 1DLOB 2V5HG 1YJ9S 2JLGA 4ZLPA 1T9TA 2RAQA 2VQEJ 4N7TA 2Y9HA 2XSFA 4DL6A 4LRDA 2EFGA 3OR2A 1Q5VA 3F73A 1X4GA 5HROA 1U2FA 1XN9A 2CNKB 2V4RA 3KLGB 2YNGA 3ENAA 3KUHA 3VGVA 3FZ2A 3KJNB 3MM7B 3IAM9 1U0SA 2CQDA 1U02A 3VHQA 4EYHB 1B7FA 1TMMA 3MPUB 1QJHA 3NY0A 2P9CA 2DHGA 3MEGB 4ZA1A 4BLGA 2I5JA 1QUPA 2R2RA 1SC4B 3W5ZA 1GEHA 2UUBF 1WEZA 2QZ8A 4QOTA 1R31A 2YKAA 1Z2LA 5K14A 2UXBF 4YB1P 1CLFA 1YJNS 4EYIB 5IOLA 4NCAA 5HVHA 2ZH8A 1R0BG 3MCOA 2OD6A 3KHLA 3F41A 1MG7A 1T9VA 5K8OA 3M32B 4KPYA 2BEFA 2VKRA 1KS2A 3BGLA 5KG1A 2N3LA 4IDKB 1FE4A 1SH2A 3QAUA 3QGIA 5C42A 2ALZA 5KG2A 2Z4PA 2LQ5A 1HPZA 3NCQA 3ZTPA 3RTVA 4DSEA 1CVJA 2KJVA 3DXSX 1KQFB 3D0IE 1SJ3P 2HYIB 1L3SA 2C3MA 1XMOJ 3MAAB 3RBXA 2DD8S 2KFYA 1M5SA 2JDJA 2KN4A 5HQLA 1B99A 1U48A 1VQ4S 3TEGA 3M6WA 3RB3A 5K14B 1HNZJ 1PIEA 3GCWP 4ZK7M 3EICA 1IM6A 3ZO7A 4ZLNA 1C0UB 1FERA 2WCXA 1GMWD 1Y0HA 3AQPA 5C7PA 2XS5A 3DLEA 4WYLA 2B4OA 5A8KB 1GFWB 2GFFA 2LEBA 3KYLA 3I9ZA 1JLGB 1NLKL 2VBYA 4ED8A 1RHJB 1U6FA 5A0YB 2EC0A 2KXNB 3TANA 3M2VB 5KFWA 3K0JA 3ZZZA 4EFAC 2DVIA 4CLPA 1URRA 1Y00A 2MDAA 4F3QA 3A8JA 2MB0B 3OTDA 4NYOA 2BE7D 2NXJA 5JVHQ 4JI4J 1NM2A 2WOMB 2JVOA 4IG0B 1FWPA 2NUUG 3MEEA 2YQ3A 3JAMY 2V8VA 5DG9A 3ZZUA 1YWXA 2BVZA 2K1RA 3GR0A 4X4RA 4TYBA 5KOWA 3CCSS 3OFEA 3NMRA 1FWLA 1RHRB 4WU2A 3PW5A 3EDQB 1X9MA 2OELA 3R5AA 4LF6F 2A18A 1OJ4A 4NRTA 4KRWA 2N82B 2XMVA 4ED0A 1C1CB 4WFZA 1YKWA 4ZVFA 9RUBA 2JLEA 4FNIA 4NE9C 2XSJA 4IO9Q 3HDSA 2E1PA 4J37A 3FNNA 3JSBA 4DR3F 3NAHA 3CO9A 2ALYB 2P2CB 4ZCLA 2PI5A 1PAEX 1H2UX 3CDBA 2X3DA 3H59A 5E3QA 4WCEQ 3GB0A 4ZPVR 4JI4F 5ETKA 3VAGA 1UL3A 4H4OB 4A47A 3BBFA 4USUA 2YWWA 4DX6A 1VBXA 1JXVA 5IQ6A 3TZWA 4B3RF 1N48A 2DHXA 4J91A 4DL4A 3OLBA 2F8HA 1S6PB 3NS7B 4DCPB 4B02A 2FHMA 3TA0A 4K4YA 4ELVA 2ZFHA 3H20A 3HM9A 3D1QA 3ETMA 4CWBA 3M6UA 3BBBA 1D1UA 2R8HA 4M5JA 1C0UA 1QE1A 1S79A 2O01C 4Q5VA 3KNGA 2MEWA 1EP4A 2ILYA 1JB0C 2CQ1A 2J7WA 2IVMA 3A8EA 3MAHA 3O6QA 3OTEA 3QIPA 4LF7J 3R1HA 3O44A 1NK0A 2VG5A 3GV5B 4C7QA 1RT6A 3ZZOA 1Y3KA 3I4PA 4C8MA 1GTEA 4J9RA 1BQXA 2UVRA 4B9SA 1FJGJ 4ILLA 1HNVB 1E6VB 3TEHB 4NA2A 1SCJB 3IAS9 3KUGA 4OX7A 4Y3CA 2KT5A 2DGOA 2DNMA 3QYYA 3D67A 4JV0A 3PV8A 1VLYA 1L3VA 1KRPA 2RDDA 2OSRA 3BPSP 3K2YA 4ZHRB 4JV2A 1WNEA 3OJUA 1RTJA 1VQYA 2E1AA 1F5CA 1VFJA 2VB6A 4KKOA 3G4SS 1S9GB 2JZ5A 3I82A 2HVIA 1GXUA 3Q0AA 5H1SV 5L46A 1FVQA 2Y0SD 1JLAB 1LQ9A 4GC6A 2HBRB 3BF4A 4WXOA 4X4QA 4F25A 1AUDA 1KLMA 1UJ5A 3DRRB 3HK2A 2A10A 3K5MA 1U7LA 3T1AA 4GKKJ 2RS8A 3FFIA 2HHUA 3QT5A 1DQ8A 3RRKA 2XC9A 1H38A 4NXNJ 1N8RT 2CZ4A 4KGZB 1T03B 3MF5A 5EGYA 4LIWA 5IC4B 4NLGA 2HWIA 2XY6A 2VUGA 2Q3PA 2LECA 3PNIA 1XR6A 3G9CA 1IKXB 4F02A 1AZSB 2YKOA 4UZBA 2HG4A 3NBPB 3IS9A 4MAKA 2B6AA 4ZVTB 3ZZPA 4URQU 4KE5A 1H73A 2QA1A 2V34A 5DQGA 1HQEA 3E01A 3NG8A 4IYQA 2VOOA 2RJZA 5KG4A 1RHKB 2MLYA 3Q8VA 1A7GE 2VQEF 1TUVA 3DOKB 4UY8T 1UW4A 2JJ4D 1KOOA 4DMZA 2JH3A 5KT6A 5KT2A 2ADBA 1CJVB 2D1CA 2FQQB 4DR1F 2HK3A 2KI2A 1M5VC 3WHIA 3GIMA 2ZH9A 4DL7A 3J7AN 2BOAA 3CCTA 1I94J 2BJ9A 1OPIA 1HD1A 2Z2MA 2F40A 1I51B 2GVDB 1VQOS 3MM9A 3KK1B 2YNHB 2LU2A 1UP1A 2W8LA 1QVGR 1FJ7A 2BJEA 5BYRA 3PR4A 1ITPA 2QA4S 3J81j 2W4PA 3MM6A 3MEDA 2RHSB 1ZH5A 1IJFB 3SMZA 1S59A 2VH7A 2HFVA 2M8HA 3OVSA 4O44A 2UXDF 3MTJA 5F8HA 3OL9A 4GKJJ 4CO3A 4KHRA 4NCGA 4LF8F 4NZ6A 5BJRA 1UWBA 4F4XA 2WBRA 4DFPA 3EVWA 1BLUA 4QR2A 2H4WB 3PW7A 4C8KA 2JOQA 3OFFA 3SQGA 1S6UA 2KFNA 2IYGA 2EK1A 3F0NA 3GONA 5FLXY 5BYQA 2XHWA 1E6YB 2QV6A 1OWXA 4ETXA 4RU9A 1ZM4A 4DSFA 3G71S 1WC3A 4TY8A 2IDLA 1HBOA 3R3TA 3CDEA 5A8WA 2FZGB 4KC5A 3IR5B 2M88A 2KFZA 2XB2D 1TK8A 1FD2A 2B43A 2RNEA 2VC0A 4DI6A 5CA5A 4HDHA 3OR1A 3K17A 2YWFA 3BO4A 3GYXB 4JI2F 4DJBA 1ZM3A 5I3UB 3T41A 3PRDA 2C42A 4K0KJ 3K5NA 2HBYB 1CPZA 2EVZA 1RT4A 3QQCD 5JJBA 2OTJS 2BRKA 4FXVA 2CG4A 1TKTB 1F0XA 4QPTA 4IH5A 4TU9A 1FX4A 2L9WA 3OD2A 2C2ZB 2LQ8A 2VL1A 4KO0B 4OYXA 1FDBA 3SYZA 2ZEJA 2FUG9 3O8WA 3KNAA 2NSBA 1SL1A 4LFAF 2XLKA 5AXNA 4U7UD 2CZVC 5A8KA 4LJMA 4RNOA 2QJ3A 3EPIA 5A8RB 1NJZA 2XS7A 2CNLB 3PG9A 4CLUA 3RR8A 1P9YA 3HCXA 2HQDA 2BKOA 5DDOC 2K8GA 2IC3A 3MHYA 5LXYA 5KFEA 1WI8A 4U7UK 3W2WA 1JLFB 4DFMA 2EC2A 1VQ7S 2VFRA 1YGYA 5F8IA 2W4DA 5I3UA 3MDFA 1YBUA 2IM1A 2YNFA 2YPZA 3LALA 4R0EA 3DLKA 2V68A 4FN5A 3SCIE 1HWIA 5ETRA 4ECWA 1ZETA 1S49A 2BACA 1U1MA 4IUFA 1VI7A 2YKMA 5DZ7A 2C3OA 1JWWA 4ZLJA 1Q78A 1LFWA 2GX8A 4Y2CA 3SZ2A 3NCRA 3UCZP 1CSJA 4M94A 1TFYA 2HNZA 2VF3A 3QIPB 4CM2A 1MWZA 1B70B 4M5IA 3IA0A 3U1LA 2LEAA 4MH8A 4DFKA 3NWGA 2PD1A 2CDQA 3J7A1 4UOCA 2DYAA 2B9WA 2QT7A 3MMBA 3ZTOA 2HW3A 1RUSA 4KBIA 2E5JA 3TA2A 1SJFA 2R8JA 2ACYA 4LUBA 3SFUA 4IG3B 3KK3A 3LTOA 2NUHA 2IVFB 4DV6J 4B9VA 4F2SA 4XTTA 4KHPJ 2YH0A 2LQ9A 3F44A 4ZP7A 3PZPA 1A0OB 7FD1A 4LQ3A 4Q8EA 1V9OA 1DHMA 1LWXA 1I6JA 4UUWA 3P5BP 3CWJA 4USMA 1WEXA 3CDUA 2Y3YA 3TVZA 3OTOJ 3DLBA 2BZ2A 3OXLA 3U1NA 3MM7A 4CLFA 3GSIA 4TY9A 2HZAA 3TVKA 2CDRB 4OHYA 2A1BA 4ANCA 2MYFA 2CQPA 3RBZA 1JLAA 1FVSA 3UDEA 3HZEA 4TU8A 5F9NA 1MN7A 4MYUA 4ECSA 1YZ6A 3U1MA 1JQGA 1N88A 2JC0A 4WIQA 1RT3B 2YWKA 4B3MJ 1F9HA 5DQIA 1WOOA 2IM3A 1YRTA 4QQBA 2XZTB 5DDPC 4AL6A 1KBRA 3ICLA 4WK1A 1WC0A 2YQ0A 1AW0A 4B9NA 4H54A 1RHQB 3ENWA 2W9CA 2F5GA 2NZ4A 4OZJA 1RSCA 2KHDA 4USJC 5HANA 2BANA 2V8DA 2XWXA 4IR9A 1R6YA 2XI3A 3NOCA 4GMKA 1IKXA 1HHQA 2UZAA 2L41A 1LK7A 1N0UA 1X0FA 5L1KA 1HBUB 2RU9A 3CVKA 1CS4A 2MGZB 1XMQJ 3RAXA 2VODA 2VV5A 4NYZA 2UUAJ 1SJ4P 1QM9A 4OYOA 3MGJA 1IVZA 3ZTSA 1SKRA 4OJGA 4YS2A 2I38A 3Q24A 3H2VE 1K9MT 1Q16B 1IBKJ 4RNMA 2W2NP 3HJVA 1IN0A 1U0HB 2JFKA 2NYHA 3PYGA 3IMQJ 4IFVA 4WWSA 2DR5A 1N33J 5G0RB 5B0CA 2C2OB 1ACMB 1RB0A 4C0OC 4ZN3A 3VAMA 2C2DA 2EI5A 4OI4A 3RU0A 1N0VC 4NPOA 3CF5Q 4QCLA 3T9NA 2BKPA 4H4MB 4DN9A 1NKEA 1OPZA 5DDQC 2IY5B 1EETB 3DHWC 2HNZB 4C8NA 4ZCIA 3JS9A 1NCLA 4LSNB 5E3AA 1AUSL 2Z2ZA 1KLNA 2RB7A 3GWCA 5KFAA 5ETVA 5BYSA 4MT1A 4ZPTR 4XIUA 4O3RA 1T0TV 2AQ4A 2LEPA 1NJXA 4ES1A 3IO1A 2MKYA 5GVQA 1IJEB 4ZJOA 2YVSA 1SXLA 1VGYA 3VVUA 2AWZA 1IBMJ 1T95A 4OI2A 2Y8WA 2CPFA 3HHEA 2NSCA 2ZBCA 2RRAA 4ZPDA 4UQTA 2OPSB 1J5EF 1SQGA 2IC3B 1YIJS 1O5JA 3HF5A 2XM3A 3RBEA 1OSDA 2G0CA 4I0WA 4PWWA 4AL5A 2B3TB 1ICEB 2F3JA 1U09A 4JI3J 3DOMB 1MWQA 2IJNA 2VBXA 2XMMA 5CXTA 2VOPA 3DDNA 1FI4A 3BV8A 5LJ5Y 3ZFVA 1X4AA 2Z8QA 2BOPA 3PW0A 4DQIA 2KYXA 1KTVA 3EZ5A 8AT1B 2CPZA 3DGPA 1S7HA 2QG9B 1G2EA 4RR5A 2WK4A 1RT4B 4NLOA 3Q8PB 2HNDA 2CQ2A 4ZIVA 1IR0A 2MMYA 4PWDA 4OX9J 3P4UB 3JTOA 1S1TA 3K8VA 4DX8H 4HTIA 2QMXA 3WBZA 3W7BA 1RWMB 1ZA2B 2J9EA 2DNOA 4K8RA 4RKUC 3KDNA 3V2UC 5IM0B 4X4UA 1C1BA 5HLFA 3N6NA 2QLWA 1F2HA 1JLFA 4F4AA 4PXDA 1DLOA 3MI7X 3BZQA 1L3TA 1HMVA 1Q8LA 1KONA 4IH7A 5FLXU 2AYEA 3PM9A 2V6AA 4MKAA 1X4CA 2H51B 2RU3A 2VPXB 4J9MA 3QSYB 2XCPA 1UZDA 4NX9A 4P72A 1BQNA 1KHWA 2K3IA 3FBFA 4K7QA 5LXRA 3KLIB 4OHVA 1B7YB 2PEBA 3LOUA 2W4CA 5E3CA 8ATCB 2F65A 4RWWA 2P8IA 1ZM9A 5HMZA 2U1AA 3HVRA 1TAQA 3PX0A 2ACMA 1NSKL 1TL1B 3DDKA 5C25B 2CNOB 3MM6B 3MCSA 2CPDA 5KFXA 4QIWD 4DV1J 2E7XA 1UAWA 5CYJA 1VQ9S 3D3BJ 4IO1A 4OI3A 3VAHA 4QWAA 1I94F 1Q8KA 3RRGA 2QFJA 4IRCA 2G4BA 4N8NA 4PPDA 5C2CA 4QU7A 5F8MA 1WG4A 2G0IA 1X9SA 4AYBD 4KIAA 1XMQF 2KZMA 4PABA 2VBWA 1DTTB 4MIWA 1NK6A 3IR7B 3KK3B 3Q23A 1SVDA 2J7KA 1V5VA 3O2IA 3KLIA 3DRPA 2IA0A 4IQMA 4L72B 4NLSA 4OJ1A 3DLJA 3AODA 3K7RA 4QR0A 2CPIA 2EG2A 4WZMA 1UA1A 2MKSA 3PCOB 3HVAA 1H3DA 4I7FB 3A8KA 2NPFA 2XMWA 1N34F 4BC9A 1CULB 2V63A 3T1HJ 4B3MF 2YKMB 3PXGa 3DKDA 1HNXJ 2DTJA 3TNVA 5DM7Q 3LQVA 2AX1A 3CJKA 1T7PA 4J90A 2XY5A 3D5MA 3I55S 5F8JA 4NLDA 3QT7A 2X1FA 1SV5B 2IM2A 4DPUA 3NL0A 2LA6A 3GYNA 3JXOA 4RW4A 3M1VA 4AFFA 1VIOA 4WP9A 5DG7A 3NMAA 2FHKA 3B78A 3DDIA 3C16A 2GAGC 3MUMP 3C14A 4QIGA 4ED3A 2V2ZA 5J2PB 2MHEA 1Q8IA 5CH7B 1WOPA 2OP5A 4PG8A 2HZCA 2HVHA 2CNNB 3FRZA 1PCAA 3IRXB 1LWCB 4ID5A 4CRJA 4IRKA 2VZ9A 4N77A 2BE2B 5U47A 1WG1A 4K4WA 1QAJA 2DO0A 3GJSB 3UR3C 1MMDA 4WE1B 4ANEA 4E98A 1RTDA 4L3KA 1NPRA 4RPFA 3K89A 3LAMA 4DG1B 3MPVA 2E1MC 2MJUA 2B4UA 4ECVA 5FIIA 3LW5C 1TL5A 3ISNC 4NLVA 1IBLJ 1NEEA 1XK8A 3FCWA 3N5FA 1DTQA 4ZN1A 3V81B 2MPUA 1S1WB 2DKOB 4ZOSA 2E5GA 2E7VA 2ZC3A 2DNNA 3I0RB 2AJ4A 2CFXA 2WVFA 4DX5A 1OMSA 3GR1A 4MIBA 3T1YJ 3AD8C 4M63A 2BV3A 4LSZB 4C97A 1XERA 3S8SA 2JSXA 4OYPA 1W2IA 3DGVA 2KT3A 2MXYA 3ILLA 2W8KA 2OPRA 2CVEA 2WB1D 3N01A 1BXNA 5KG5A 2BQRA 1R8HA 3IC1A 4DUYJ 5EUHA 2K7JA 4F4KA 3MM8A 5A8WB 3H4BA 3ILOA 1U2RA 1RLDA 2NLWA 4UZCA 4ZHRA 3PIPQ 4YDDB 3QGGA 4EI2A 1K0VA 3QPIA 4KGMA 4ED2A 3V81A 1Y9OA 4LQ9A 4YMEA 2QE5A 4KTQA 1RT1A 1CBKA 1NZ8A 2CA9A 4CT9A 3TP2A 3TWZA 1XNQF 3D1OA 3SDEA 1ZPWX 2Y1JA 1EAYC 2X51A 4LBHA 1VISA 2XYGB 5KT4A 4DSLA 3RAMA 4DV4F 4KB7A 4CH1A 1U45A 1RTHB 3DHXA 1S0NA 2YNIA 1S72S 2B8QA 3ZZTA 1HQUA 3MEDB 3VGUA 3K5LA 4DV7J 4B9MA 3NGTA 1I1GA 3FRYA 5E33A 5FDLB 1HNIA 3DC2A 4HEA9 1BGXT 4RW8B 2OLWA 4B08A 3MUVP 2XMUA 3R9LA 4Z37A 1VBKA 3M8WA 2VQFF 1Z4UA 3C16B 3BSOA 5KT5A 2MQNA 2OHDA 1YZ7A 2XLIA 3MZIA 3M1VB 3IR6B 2KH9A 4RW7A 3BBCA 3MECA 1RDRA 4RNNA 2W2MP 1FNOA 2E5HA 3GFXA 1DTTA 3MEEB 2H1YA 3HT3A 1S1VA 1LW0A 1T9UA 2MSTA 4MJKA 2HQIA 1EJ7L 4RWXA 2O3DA 2CWXA 4NA1A 1S12A 2C3YA 3N6MA 2PGCA 4UW2A 5E2QA 4M5LA 3IRWP 1TP7A 3HFKA 3M8QA 2W2OP 5ETMA 5FD1A 4F4YA 1U1OA 4P7TA 2ZD1B 1UEUA 5M2RA 4ZJQA 4LF8J 3UD4P 5D15A 1SI9A 4HHHA 1RZMA 1JLGA 1RK8A 4ZVGA 4XDCA 1U1LA 2UXDJ 2ASYA 1NUEA 4ZS6A 4M5DB 3R97A 1H7WA 1YSJA 3U7JA 5F3ZA 2JHEA 3W61A 2OEKA 2RVJA 1S1VB 4X64J 1QUVA 4NL5A 1PSDA 2ZH1A 1C4CA 1FKPA 3E51A 4K4TA 5H9FK 4G1PA 1R27B 5E0OA 4DPXA 1ZOTA 4CO0A 4PZVA 2ZNZA 3V4IA 3GJQB 4ZPWR 4NXMJ 2SXLA 3GJTB 4PEOA 3VGSA 1KQSR 1D0EA 2DR9A 2VONA 1XTZA 5FJ4A 2HHPA 4NCBA 3MD3A 2CWKA 3QJLA 5HMWA 4KQZA 5I3QA 4NEZA 3OQ2A 4YY3J 3M8RA 1PBAA 2B9XA 2CVIA 4ICLB 1N56A 3OL8A 3M2UA 1E6VA 3EGNA 4ZPBA 3W8PA 5A76A 5D0GA 1IXKA 3CC4S 2JC1A 1IR1A 2QL9B 1Q7LB 3TZZA 1RABB 2MKJA 2YWHA 4EUVA 1VRUA 3OSNA 1S9FA 3P45B 2UUCJ 3PFOA 3VV2B 3FSIA 2XY7A 2HLTA 3C2PA 2UXBJ 3EUNA 3DLLQ 1VBZA 3VTIA 4OHZA 4OX9F 3BKFA 3FJ2A 2W9BA 2G1DA 3LA0A 4K5SA 4DBQA 5D8HB 2JNJA 7AT1B 2A6MA 4AE5A 2KYZA 2RQKA 3W9IA 3ZTQA 3T3FA 3QBCA 3CD7A 1UWAA 1YJUA 4KFBB 3TW0A 4IG3A 1QSLA 4FKXA 4GKKF 1GH8A 4P2SA 3BH6B 2HHVA 2EWHA 4H4KC 1HI1A 2JVRA 1KEKA 3MEKA 1NH8A 4DL2A 4OHWA 2DR8A 4LFCF 3GQCA 2R4FA 4GVBB 1UVJA 1S0VA 4A4JA 3JQJA 1M5PC 5KFUA 1R8PA 4H4OA 4C3KA 4G65A 3PHEA 5L8RC 1D8YA 4K0KF 1FJCA 5C42B 1HWJA 2RDIA 1RT2B 3LP0A 1WKLA 4K4VA 1K0TA 5F8LA 2LCWA 3NKYA 3L4BC 1GX6A 2GMHA 4C0BA 5I42A 2AD9A 4PYAA 3VWSA 3UDLA 1RTIB 4LT6A 4MKBA 1R89A 3E8OA 2CIMA 3GU0A 2IRUA 2VDIA 5BXIA 3K59A 4FXDA 3NCPA 3SSSA 5K5MA 5DG8A 2HHHJ 2DNPA 2P9EA 3D9BA 1SKWA 2Z56B 4CO5A 2IFXA 3ZZ0A 4OZ0A 2OPPB 2HHTA 3QLHA 3J80U 2ZBQA 4YDXA 1BMQB 2ZKUA 4OV1A 1JXEA 4ATNA 5KT7A 1Q81T 5AE1A 3LGNA 2V67A 4UT4A 3EZOA 4P52A 1NKBA 2D69A 2R8GA 3CTRA 3IP0A 4O4GB 1B0TA 4S0MA 2E9TA 5AJ3F 1UWBB 4DV2F 3A4TA 1S76D 4LFBF 2FVRA 1RWPB 3BQ2A 2HAIA 1JLEA 2APOA 3DNCA 2CPHA 2RF2A 2HWHA 4RW6B 3G6ES 1KKHA 2G9OA 1IBKF 4JI6F 1UMJA 1PILA 4PG6A 2FY8A 2QFIA 4QW9A 4ECYA 3IG1B 5J2MA 2MQ8A 3H98A 6FD1A 2XGQA 3FSYA 1NJYA 3NGSA 1VBYA 4ILMA 2AJ1A 4V19J 5L1LA 1AFJA 2GCFA 4ITSA 3ISND 4DU8A 3QRPA 5G0RA 2GQQA 1RAHB 2D9PA 4XAKA 4RUCA 1T3OA 1LNQA 2UVUA 1S1XA 4C11B 1X5PA 4RO0A 3POTB 4R5PA 1N32J 1HBOB 4BCAA 1JLQB 1LXNA 4IKAA 2XMTA 1HNXF 2WSCC 1RXOB 4Y28C 5GAHI 2IAJA 4B3SJ 3T1HF 3CDWA 1XWLA 4ELUA 2P6SA 3SQGB 3T9ZA 2E9ZA 3MOJB 4J9UE 4BWJA 1PO6A 2VASA 5SZTA 1FRHA 4JI0F 1D9DA 1SB6A 2ZH2A 2B6AB 4HI1A 3PX4A 4ZVHA 1FESA 3NOGA 5F8GA 2J76E 2VHGA 2NREA 1CEZA 1M1GA 2XG8A 5DETA 4O44B 2ZZTA 3UI3A 1TVRB 4CTAB 4I69A 5A6WA 3R7SB 3OTOF 1AB8A 3I32A 3TUZC 2XGPA 4Q0BB 5C25A 3Q8SB 2RKIB 4USKA 4PKDB 3U02A 3OHBA 3EGWB 3CUNA 5B0FA 4G1IA 5ETPA 2RILA 4L75A 3AB4B 3BM7A 3L3CA 2M70A 4NLQA 3TO8A 2RT3A 4P10A 4YB7A 1FKOA 5J1PA 3DRRA 4C8ZA 1YRUA 1F6TA 3AY0A 2UU9F 4ZKAA 4ZVUB 5B09A 1NB2A 1U24A 5B0BA 1C4AA 3BB5A 3CMQA 2NZCA 1QVFR 1U47A 4MTPA 4FP9A 2GQ2A 4LVOP 3IXQA 2EEYA 3L09A 1A6LA 2HRTA 5KG6A 5EN1A 3PO5A 4RBUA 4CM0A 1TAUA 3OBIA 4AD6A 1WG5A 2V4JA 1ZBTA 3CCLS 1DTQB 1N36F 4ED5A 5EWEA 2NQPA 1JJCB 1ZAXA 3HHLA 1GNKA 3PYEA 2HFSA 4LRBA 1FCAA 4AT1B 2HMIA 3C3LA 1PYOB 4DV3J 3W1YC 3ZNUA 2AGQA 4LRCA 4KPCA 3MPYA 4CZCA 2VU5A 5DJBA 3M8SA 1YJWS 3IGVA 1DURA 1SIWB 2J9CA 1X5SA 3FSXA 1UTAA 2GMJA 2WAQD 3MWBA 5THWA 1TUGB 1V5IB 1VLOA 3ITHB 1FTRA 4DR6F 1IKWA 2GC8A 4M5GA 3KUEA 4DWIA 2HHXA 4PUOB 2B4PA 5ETOA 1U49A 1KR4A 3R5BA 3R1LA 1N6QB 2HQFA 2J0SD 2I2YA 4O3SA 4ZDNA 1FX2A 2A0FB 4Y00A 1WI6A 3CGIA 3TYTA 1M1HA 2RQCA 4OYMA 4J9SA 3ENQA 2AJQA 2BQUA 4USVA 3R27A 3QRQA 1HFEL 3I9V9 4O23A 2M0GB 3VAJA 3T5KA 1TKTA 2LXIA 1SPBP 2UUBJ 2KB2A 4B3OA 3H5SA 2HQGA 1X8DA 3IN5A 3G96A 2ROGA 2I8EA 2Z58B 4F26A 1YJ7A 1WWHA 1M1KT 3RW6A 1V3ZA 2OTLS 4OZ3A 3KWMA 4BHQA 4JV5F 2MJNA 2UV8A 3MMCB 3BS9A 4OHXA 1CJKA 3W65A 5HMYA 5SUHA 5IXUA 3Q86A 2EBGA 1AA1B 4DV5J 1N4LA 4DUTA 4HDGA 5DDRC 5LOQA 4JI2J 2DGSA 2GJIA 4YR2A 3KHGA 2VICA 2R7UA 2B4VA 1WC5A 1NDPA 3NXZA 4X66J 4OX6A 3HPOA 4JI3F 1WHWA 2KO1A 2Z57B 4FBUA 3I31A 5CCLA 5KFJA 4HT5A 2IIHA 3LP1A 5KFMA 2C22A 4PUOA 1J5EJ 5D6GA 2E44A 4CO1A 3H5YA 1U1RA 3JTPA 4QIVA 2Y1IA 5D4PA 4ZVRB 2B0GA 3AOAA 4NASA 1X5TA 1HR0F 5CCMA 2ZJQQ 1LW2B 2QIFA 2JRSA 3UN2A 2QYCA 3AD9C 1MNEA 2H54B 4R25A 3EX7B 2MZQA 4PQUA 3HJFA 2DNLA 2LP4A 1FKAF 3FDSA 1LFPA 3NGDA 1WDDA 5JXSA 5K8MA 2ASDA 2FTRA 2Y1RI 1T03A 2YWEA 1PYSB 3BH7B 3J81U 3FFIB 4FF4A 3H4DA 2IBOA 2L9DA 5LJ3Y 4ZPCA 1UA0A 3UDVA 4U95A 1KC8T 4I67A 4DR7J 2AEJA 1HR0J 5RUBA 5LM7E 3W5XA 5B7WA 3RG6A 2YXLA 5IV4A 3KLEA 4KSEB 3K58A 5HQMA 1RT5B 3PACA 1Y10A 1Z1ZA 5AXKA 4CNZA 2OPSA 4JI8J 4RX6A 1HW9A 1BQMB 2XMAA 4DFJA 1MMLA 1WEYA 5HMXA 3MM9B 3I56S 3OW2R 2C2EA 4DQQA 3OR1B 1K47A 2EFVA 1FHTA 3BGUA 3V6DB 1HLWA 3N0VA 2XMKA 1U4BA 4KT0C 2V4JB 2FD2A 3CO0P 1U6ZA 4OMFG 4E2FB 1G1XA 2Z2LA 1CJUA 2DPJA 3DGPB 4G6VB 4QIEA 1EP4B 4Y0FA 2UVWA 1JNRB 2DITA 2KXHA 2FJBB 3CJQA 5HVGA 3MFIA 4BBYA 5DO2A 2OKQA 4JYAF 2L08A 4A8WA 2X1BA 3PFEA 3VVTA 1XBWA 5LMUJ 4QPXA 3D28A 4JB8B 3RZAA 3HZGA 2JFDA 1AZSA 2FLOA 4TLQA 5JMNA 3VAIA 3HHDA 2FB0A 5LSRA 5C24B 3R7BB 1RKIA 3I5CA 1RKJA 1DRZA 2C2NA 1RQ0A 4OZ5A 1TFWA 1TVRA 2BYCA 4B17A 2DHAA 2GVZB 3L95X 3UE2A 5E3PA 4MFBA 5J2QB 2DR6A 3A3NB 2L9NA 2GQCA 1N5TA 3LAKA 1XC9A 4USWA 2YNGB 1TL7A 2E66A 5ETQA 2XMJA 4OJ3A 1BQNB 2YH1A 2RE1A 4UOFA 4RUAA 4EBEA 2GVZA 3G8SA 1PJ6A 3M2UB 4LSNA 2YKNA 3M6VA 2F63A 4R0JA 3LGMA 3JTNA 2FLPA 1S4FA 1RA6A 1CQNA 2D41A 4ZMMA 3BYPA 3D1HA 1JJHA 3EJMA 2MZ1A 3MMAB 5D3GA 3CC7S 4WP3A 4Q7AA 2UXCF 2FJEB 1C1BB 5IWAF 3MFHA 3GV7B 4HLBA 5MLCV 4M5NA 5CD4H 2W25A 3MR6A 3UNYA 5AXLA 3TJ8A 2WOMA 3D68A 4IG0A 2M5YA 4HI2A 3CCMS 3IFEA 5A2QU 5KFIA 3AAWB 1RI7A 1Y5LB 3PRBA 3SIPB 1PJ5A 4NLRA 2R2SA 4FF3A 1VRTA 3GE9A 2R7VA 2DH8A 3DCAA 2YY3A 1JLBA 3CEDA 1QE1B 1ULRA 3D0GE 2RQ4A 2MY8A 3QT6A 3LPEA 1KLMB 1RAAB 1MU2B 2LXUA 3AA8A 3ETOA 3I87A 2N3OA 5LMUF 2GIRA 1C2PA 3HXMA 1KFSA 2YX7A 3W62A 3NNCA 1FWKA 3JSRA 3VQSA 4RZRA 1ZAVA 3ADAC 4QU6A 2CQBA 3QLHB 3QWPA 1VHIA 2NR0A 1RAIB 1TL3B 1U26A 3GV8B 5DQHA 1JLCA 1N54B 4U7CA 4K4XA 3BKTA 2BW7A 1RHMB 3Q8YA 4LBIA 3H42A 7FDRA 5CYMB 2QSFA 2DO4A 2IDEA 2NCKL 3HVWA 1FDDA 2DNHA 1WC6A 4C3MA 2BKNA 4BS2A 2K2PA 3CCJS 3B4MA 4NCGB 1A9NB 2MQLA 1M5OC 1N5VA 2KHCA 1NAQA 4DR2F 1PYTA 4JI8F 3LP0B 2D9OA 4I6YA 3CMAS 1QSSA 1BQMA 4ZCKA 1ZAWA 2QRRA 1WSRA 1YG0A 3QIDA 3TAMA 3HHNB 5IT9U 3EVMA 1GXTA 4HTJA 3G87A 1TL3A 4EBCA 2FJWA 3I6PA 1RAGB 1GXLA 1SBRA 3K5OA 4I6AA 4NMXA 4HT7A 1W25A 3MUTP 2E5LJ 2ZJPQ 3DLGB 1LW2A 4QWCA 2QLXA 1L5UA 4YHHJ 4CLSA 1WDTA 1VQPS 4KO0A 1IUJA 1V3RA 3C46A 3N79A 4FYYB 1HKAA 3EMTA 3J7Z5 1N5SA 1WF0A 1F60B 1OQ3A 4LR7A 4QWBA 5JVGQ 5DGBA 2I5JB 3QJJA 2CXEA 2W9BB 5BR8F 1H7XA 1JJ4A 3ITHA 1HNZF 1WJ9A 3DLHA 1RT7B 1SQEA 5K8NA 3KLHB 2VJUA 4LBPA 5D0RA 2AYGA 2DBBA 4JI7J 2BJ3A 3IBCB 4N8OA 5GMEA 2BANB 3QSIA 2FLNA 2YNFB 3H5UA 4EK2A 1KTQA 3MMCA 2NXUA 2PN6A 2CPEA 4FKYA 8RUCA 2W9CB 1I5OB 2Y8YA 3HVTA 4RW9B 3CD5A 3DMJB 4OIXA 3OPKA 2CPYA 3OL6A 4DHVA 1RWKB 4RL1A 3GIIA 4NLUA 3QZ7A 3KHRA 4OFZA 1WUUA 4LFCJ 5CYQB 1JXLA 1F2GA 4OLOA 4DZ6A 1NXIA 4DU7A 5IQQA 1F5BA 2A2CA 3M8ZA 2WVEA 5KFSA 4XPEA 2GGPB 1B0PA 1RE1B 1P6TA 1UZHA 2CQHA 2G13A 1FRXA 2LU1A 4R8UA 4RJVA 2LMIA 1MSWD 4J9LA 1T11A 1RAOA 3V5RA 2YNIB 1G7CB 3HO1A 4YUDA 3EZUA 1KP6A 4K50A 3I5AA 1FEEA 1Z2ZA 4WZQA 4M5MA 1SUQB 2FVCA 5KAKA 2HVZA 4W4MA 3OHAA 1ZTWA 3BQ0A 2HQCA 1VQ5S 4ED6A 4ERDA 2Y1LB 1BWEA 3SI8A 2CQ0A 2H5EA 3FMBA 3S01A 2LFVA 3I5BA 2MKIA 3ET6B 1R0AB 1HHTP 5HBMB 2XQCA 4LF1A 4BWMA 5F8NA 2OEMA 2ZE2A 2DPIA 1KQGB 2PFFB 2QLFB 2DT9A 2GIFA
chains in the Genus database with same CATH topology
1S5ZA 3Q86A 1B4SA 4DUTA 3B54A 2DYAA 4F4AA 3ZTOA 2BX6A 1NDPA 4HR2A 1B99A 2DXFA 1NSPA 1BHNA 2ZUAA 1ZS6A 2B8QA 3EE3A 3VGUA 3VGTA 3WX8A 4S0MA 3NGTA 3EICA 4UOGA 3FBFA 1LWXA 1W7WA 5C7PA 3Q8VA 3R9LA 1XIQA 1NLKL 1NDKA 1NSKL 3EM1A 4W98A 4ANCA 3NGSA 3G2XA 3BBCA 3Q8YA 1MN7A 2NCKL 1EHWA 1MN9A 3BH7B 1KDNA 1WKJA 2HVDA 1U8WA 1NSQA 1S59A 3FBEA 3EVMA 2DXEA 1F3FA 1HHQA 1LEOA 2AZ3A 1NUEA 3FBCA 1K44A 3ELHA 4CP5A 3FBBA 1VYAA 1S57A 3EVWA 3Q8UA 4WBFA 3EVOA 3ZTSA 3GPAA 3EMTA 1WKKA 1NDCA 1NDLA 2B8PA 1PAEX 3DKDA 3VGSA 1HLWA 1BUXA 2CWKA 3FKBA 4O0NA 4DI6A 2AZ1A 1F6TA 5CAAA 3MPDA 3BBFA 1NB2A 1JXVA 1UCNA 3DDIA 1NCLA 3JS9A 4EK2A 4C6AA 4FKYA 1XQIA 3Q89A 3VVTA 4F36A 3ETMA 4ENOA 3BBBA 3VVUA 2DY9A 4DZ6A 4ANEA 3ENAA 3VGVA 3ZTQA 3NGRA 4KPCA 2VU5A 4FKXA 3L7UA 3PJ9A 3FCWA 3BH6B 4ANDA 3FCVA 4UOFA 3NGUA 2HVEA 1BE4A 3FC9A 5IOLA 1PKUA 3EJMA 1WKLA 5CABA 3Q83A 3ZTRA 2BEFA 1NPKA 5BXIA 1HIYA 1NHKL 3PRVA 3B6BA 2DXDA 3GP9A 4UOHA 3ZTPA 2HURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5Z A;  3Q86 A;  1B4S A;  4DUT A;  3B54 A;  2DYA A;  4F4A A;  3ZTO A;  2BX6 A;  1NDP A;  4HR2 A;  1B99 A;  2DXF A;  1NSP A;  1BHN A;  2ZUA A;  1ZS6 A;  2B8Q A;  3EE3 A;  3VGU A;  3VGT A;  3WX8 A;  4S0M A;  3NGT A;  3EIC A;  4UOG A;  3FBF A;  1LWX A;  1W7W A;  5C7P A;  3Q8V A;  3R9L A;  1XIQ A;  1NLK L;  1NDK A;  1NSK L;  3EM1 A;  4W98 A;  4ANC A;  3NGS A;  3G2X A;  3BBC A;  3Q8Y A;  1MN7 A;  2NCK L;  1EHW A;  1MN9 A;  3BH7 B;  1KDN A;  1WKJ A;  2HVD A;  1U8W A;  1NSQ A;  1S59 A;  3FBE A;  3EVM A;  2DXE A;  1F3F A;  1HHQ A;  1LEO A;  2AZ3 A;  1NUE A;  3FBC A;  1K44 A;  3ELH A;  4CP5 A;  3FBB A;  1VYA A;  1S57 A;  3EVW A;  3Q8U A;  4WBF A;  3EVO A;  3ZTS A;  3GPA A;  3EMT A;  1WKK A;  1NDC A;  1NDL A;  2B8P A;  1PAE X;  3DKD A;  3VGS A;  1HLW A;  1BUX A;  2CWK A;  3FKB A;  4O0N A;  4DI6 A;  2AZ1 A;  1F6T A;  5CAA A;  3MPD A;  3BBF A;  1NB2 A;  1JXV A;  1UCN A;  3DDI A;  1NCL A;  3JS9 A;  4EK2 A;  4C6A A;  4FKY A;  1XQI A;  3Q89 A;  3VVT A;  4F36 A;  3ETM A;  4ENO A;  3BBB A;  3VVU A;  2DY9 A;  4DZ6 A;  4ANE A;  3ENA A;  3VGV A;  3ZTQ A;  3NGR A;  4KPC A;  2VU5 A;  4FKX A;  3L7U A;  3PJ9 A;  3FCW A;  3BH6 B;  4AND A;  3FCV A;  4UOF A;  3NGU A;  2HVE A;  1BE4 A;  3FC9 A;  5IOL A;  1PKU A;  3EJM A;  1WKL A;  5CAB A;  3Q83 A;  3ZTR A;  2BEF A;  1NPK A;  5BXI A;  1HIY A;  1NHK L;  3PRV A;  3B6B A;  2DXD A;  3GP9 A;  4UOH A;  3ZTP A;  2HUR A; 
#chains in the Genus database with same CATH topology
 2ZJR Q;  4DCJ B;  4M5K A;  2DIS A;  2FC9 A;  4HYK A;  2Q6B A;  3RYL A;  2EFO A;  1VRU B;  1RTZ A;  4DV3 F;  2C3P A;  1TL7 B;  1WC1 A;  2LXF A;  4MYT A;  2QTW A;  2DXF A;  2PI4 A;  1B64 A;  4LF2 A;  3R6G B;  1BHN A;  1SUQ A;  1LV5 A;  1FDN A;  2MTL A;  2KDO A;  2ZBR A;  4KH1 B;  3EXY A;  4CO4 A;  2DJW A;  3V6J A;  4UOG A;  2FJD B;  2PDA A;  4FYV B;  2RHQ B;  1Y11 A;  1RTH A;  4A8K A;  4N41 A;  4CTA A;  4C8O A;  1ZPV A;  5A8R A;  3OVB A;  2AIR B;  4CT8 A;  1SL0 A;  4GC7 A;  4M95 A;  1KN6 A;  4P9S A;  2CQ4 A;  4LF9 J;  3SCJ E;  1Y5N B;  4OZ2 A;  2E5L F;  4E8U A;  1H6K X;  3QFW A;  2H65 B;  4B3T F;  2VIH A;  1LWC A;  3B8H A;  4ID5 B;  3M30 A;  4NRU A;  1WOR A;  4XDD A;  2R2T A;  1VC5 A;  2C28 A;  3UCU P;  1N6Q A;  1MN9 A;  4I2P B;  4DPO A;  1CG2 A;  2IVY A;  1H74 A;  4PG5 A;  4X4S A;  3W9J A;  2HBZ B;  3B4D A;  2Q6C A;  4ECU A;  3AA9 A;  1WKJ A;  2VA2 A;  3PW2 A;  1GK8 A;  2J9D A;  4PQU B;  4CLL A;  4JI0 J;  1OQ6 A;  5L9N A;  3T6J A;  1MRO A;  2MHN A;  2KXF A;  4DLG A;  1N5Y B;  4KHP F;  2DXE A;  1Q4R A;  4ZP6 A;  3RW7 A;  2FLL A;  4YB5 A;  4EU0 A;  3HHL B;  3VF0 B;  1LEO A;  5D77 A;  2N7Y A;  1VDH A;  4OYB A;  3H8Y A;  4P75 A;  3HHL D;  1S1W A;  4NLX A;  4D3H A;  1K1S A;  4NLY A;  2IAJ B;  3T19 A;  3DOL A;  2D74 B;  3Q8U A;  1VOM A;  4CI0 B;  1WD6 A;  3QNW B;  2MKH A;  1ZZN A;  1NO8 A;  2WSE C;  2OAU A;  3DU5 A;  3SFG A;  1PGZ A;  4X4N A;  2B5J A;  1RU2 A;  1T05 A;  2GHW A;  4Y34 A;  1FEH A;  5DGA A;  1FTC A;  1V3S A;  1PAU B;  3US5 A;  2ASJ A;  4V19 X;  3HSZ A;  2AJ0 A;  3LH2 S;  2CPJ A;  3QRR A;  2J7U A;  4KFB A;  2QO3 A;  5GMK a;  4PG4 A;  1SJ1 A;  1R0A A;  3QZ8 A;  4TXS A;  3T5L A;  2RUG A;  2BR0 A;  4JI6 J;  1P1T A;  1KFD A;  1VK8 A;  2P9G A;  3LF0 A;  4DPY A;  2DNZ A;  3PYD A;  5GAG I;  3Q89 A;  2V4Q A;  3ZC4 A;  4F3M A;  5A2Q Y;  2DGQ A;  3M9O B;  2FJX A;  1Q1K A;  5KFK A;  4LFB J;  4QYZ K;  2VFU A;  3CIM A;  2EFN A;  5IT4 A;  2HAF A;  3C15 A;  3D3C J;  1JMT A;  3BEG B;  3MR7 A;  3GIR A;  5IWA J;  2F8M A;  3HT0 A;  2UXC J;  2AF6 A;  2WSF C;  3JAM U;  4IFY B;  1PG5 B;  1CJT A;  3DYA B;  3QGH A;  3S6E A;  1S6Q B;  1RCO B;  2UV8 G;  4ECZ A;  1CUL A;  1OO0 B;  2OPP A;  2VC1 A;  3HKZ D;  4RUB A;  5HVF A;  3PEH A;  5B0D A;  4FF2 A;  2GV1 A;  2ERR A;  1TKD A;  4CCH A;  3GFH A;  3PJ9 A;  2QGF B;  1U1P A;  4L73 A;  1UW9 A;  1NK7 A;  1IBL F;  2CQG A;  2HHH F;  3IWL A;  1UJ6 A;  5IFM A;  2ZOM A;  1O6X A;  9ATC B;  2LKZ A;  4XO0 A;  2KG0 A;  3BJY A;  3CD0 A;  4DX7 A;  1NB7 A;  1TQL A;  4L6V 3;  5LMN J;  1MU2 A;  1RAF B;  4KY3 A;  2HVE A;  2R7O A;  1S0M A;  2B51 A;  3FC9 A;  4PR6 A;  3MOZ A;  3DFE A;  4RW9 A;  3GSD A;  3TRG A;  3THV A;  2DRA A;  3NWR A;  1AXQ A;  4TKT A;  3AT1 B;  4OV6 A;  1R8B A;  2WW4 A;  4V1A k;  4ZVQ B;  3ZTR A;  3V6H A;  3FCH A;  1MW7 A;  1HWU A;  1R43 A;  4FZV A;  4IFV B;  1J2V A;  1R6V A;  4Y6I A;  4YR0 A;  5HP1 A;  5IT9 Y;  2N4C A;  3HSG A;  1UVM A;  4WE1 A;  3KLG A;  1F9F A;  4LR9 A;  2EW9 A;  3GLJ A;  2V50 A;  4ECT A;  2PII A;  3DLE B;  4YN3 B;  4XPC A;  3RRH A;  1ZZF A;  2F4V F;  3P8B B;  2QL5 B;  3PKY A;  4OZL A;  1TUW A;  4I2Q A;  3WX4 A;  3KG0 A;  5HP1 B;  1FRM A;  3NAI A;  1IBC B;  3GFZ A;  1H98 A;  1ZA1 B;  4HVZ A;  3MEC B;  3KG4 A;  2UUC F;  3BRE A;  4K4S A;  4U8V A;  1H72 C;  1J27 A;  2IA6 A;  1TEL A;  1ZTT A;  2GS8 A;  4DS5 A;  1URN A;  2HMI B;  1HW8 A;  1DY3 A;  3G8T A;  5KFF A;  4G3I A;  2ATL A;  1TKX B;  1XIQ A;  4OYA A;  1RYS A;  1HPZ B;  3GZ7 A;  3CJ3 A;  3N6L A;  5GAD U;  4H4K A;  1IR2 A;  3RAQ A;  5EDW A;  4LSL B;  3KJV B;  3HUL A;  3UCG A;  3P6Y C;  4P2M A;  1KQK A;  3PR5 B;  3O5T B;  2H3E B;  2EPI A;  4NXM F;  1S1U B;  4X65 F;  3QAE A;  1IKY A;  3Q2S C;  2KTQ A;  3SDE B;  5KFG A;  1RA7 A;  1UKU A;  2HND B;  5LL6 d;  1M90 T;  2A2D A;  2B7B B;  1UFL A;  3ONQ A;  1GQE A;  4DZD A;  4Z7C A;  1DQA A;  4P71 A;  4ELT A;  2QC3 A;  4ED1 A;  1EET A;  4KYZ A;  1YJV A;  5HI7 A;  1VQ8 S;  3KTQ A;  2ZOF A;  4X84 A;  3M4X A;  3JQM A;  3OVA A;  4C9D A;  3SV3 A;  2KT2 A;  1VHF A;  3FBC A;  3H25 A;  2C2K B;  2QYG A;  2PA8 D;  3H0P A;  4FF1 A;  5DS7 A;  5ETT A;  1EKR A;  4U96 A;  3KOA A;  1HWL A;  2O1P A;  1NDC A;  2PT0 A;  4MK8 A;  3BQ1 A;  1X0P A;  5E7O B;  1FK9 A;  1Q0N A;  4ICL A;  3WQP A;  1KWM A;  4LF4 J;  1RU1 A;  5KFC A;  1FXD A;  1SH0 A;  3NLC A;  4IDK A;  1JLQ A;  4LRA A;  1U1K A;  3CJ4 A;  1Q82 T;  1DAR A;  3G82 B;  3IBF B;  3OV7 A;  2AT1 B;  1ZYQ A;  1NK5 A;  3POT A;  2R7W A;  4B9U A;  4ID8 A;  5KFQ A;  1CC7 A;  1S7I A;  3MPD A;  5IC6 B;  5HAO A;  4RLE A;  2ADC A;  2M9K A;  2QMW A;  2M7S A;  2Q79 A;  2R42 A;  2WBM A;  3KJQ B;  5JUM A;  5IV3 A;  2ZM6 J;  3EYZ A;  4ED4 A;  4YOE A;  2E1R A;  4J9V A;  4I2Q B;  2ASL A;  3M2R A;  4GVL A;  2ZVI A;  4I68 A;  3O1L A;  3R8Y A;  4JI5 F;  3ENV A;  4DV7 F;  2XS2 A;  4M5D A;  5AT1 B;  3MEG A;  1HBN B;  5F0W A;  4YQW A;  3LWL A;  3LUY A;  2DB1 A;  3EXC X;  2EKN A;  3BGF A;  4DV4 J;  2DY9 A;  4OLP A;  4DR5 J;  3JQK A;  5KFL A;  3FEX B;  4DV0 J;  2V9K A;  1X7V A;  2RD5 C;  1UEV A;  4OYW A;  2H4Y B;  4P73 A;  4LF5 J;  2VPW B;  3FQL A;  5D4N A;  1SJQ A;  4WTY A;  4LR8 A;  4MIA A;  4ALZ A;  3UR0 A;  3OT9 A;  4DUZ J;  1CS4 B;  2MZT A;  5C24 A;  5HQ8 A;  2OD4 A;  2MGZ A;  4QBU A;  2FVP A;  4K4Z A;  2VFT A;  4PQA A;  1O8B A;  1LW0 B;  5F0U A;  1HHS A;  4KV8 B;  1IBM F;  4DR6 J;  1LWE A;  3I4H X;  1RGV A;  4NA3 A;  5GAG U;  4ZP9 A;  2J6T A;  3A3O B;  2MZJ A;  1PKU A;  1RJJ A;  1JJ2 R;  2DGX A;  2HIY A;  1T8E A;  1EQM A;  2CJX B;  1TK5 A;  3MAA A;  4RU2 A;  1SIZ A;  3HI9 A;  3T1Y F;  5MAO A;  3DM2 B;  1NRK A;  2QA2 A;  3HSD A;  2YKP A;  4IOA Q;  2W01 A;  4WFA Q;  1HIY A;  2I0X A;  1CJU B;  2J8A A;  1SQF A;  1S6Q A;  4PAA A;  2YKN B;  2MQO A;  1CJT B;  1FFW B;  1HQU B;  3DYA A;  5F3T A;  1R3N A;  4ZCM A;  2E9R X;  2ATC B;  3L7P A;  1FF2 A;  4B3O B;  4ETZ A;  3AHP A;  3BYR A;  5ETS A;  3M32 A;  1QTN B;  3D2W A;  4DR4 F;  4WKR A;  2OEJ A;  2UU9 J;  3V4I B;  2DGV A;  3LP2 B;  2DRD A;  3HX9 A;  5T7L A;  3V4M A;  3TQ1 A;  3ZXW A;  2BE2 A;  5CD4 A;  1FKP B;  2J5A A;  1ZS6 A;  2CYY A;  2XHC A;  4UUX A;  3SV4 A;  2R8K A;  4GO7 X;  3TA1 A;  1RT5 A;  1VJQ A;  2COL A;  2FY1 A;  4CDI A;  2YTC A;  4I6W A;  4NEY A;  4G1Q B;  1YBA A;  4P2X A;  2PFD A;  3B82 A;  2CUY A;  2LQB A;  5G4D A;  3CC2 S;  1YHQ S;  1U0H A;  5DLF A;  2DGU A;  2OFG X;  3H7H B;  4P7V A;  2B5J B;  2ZD1 A;  4C8Y A;  3D7S B;  4DF4 A;  2XZD B;  2HBQ B;  1RHU B;  1H0H B;  1X5O A;  2WW8 A;  2CJY B;  2YQ1 A;  3TX8 A;  2MLX A;  2R7R A;  3VAF A;  4DQR A;  1QSY A;  2E1C A;  1Y7P A;  2CQC A;  1LWF B;  1RWV B;  1REG X;  5T41 A;  1N34 J;  2OFH X;  3I0S B;  4C3L A;  1B3T A;  1FNM A;  1YX2 A;  3DRS B;  2ROE A;  2NXN A;  3MD1 A;  4CIO A;  1Q79 A;  2LYV A;  3IM8 A;  3HFV A;  2D7S A;  3FZB A;  2QX0 A;  3IS9 B;  3MM5 B;  3PYF A;  3SXL A;  4CLT A;  1NK9 A;  4WJB A;  1KSP A;  3CDA A;  2WB4 A;  4URS A;  4CLW A;  3PVX A;  2RUS A;  3HFZ B;  2CAJ A;  2BJ8 A;  3ELH A;  3MUR P;  2HQ3 A;  3MMJ A;  2KG1 A;  1VYA A;  2MZR A;  1PC4 A;  3BSN A;  5GAD I;  4QWE A;  1RAE B;  4GRS A;  4USH A;  3ILI A;  1TV6 B;  4ZLL A;  1HNW J;  3TI0 A;  2FJA B;  3CE8 A;  4DR4 J;  4AUK A;  1YVF A;  2O67 A;  1R0C B;  3DOM A;  2FHJ D;  3M05 A;  3NP5 A;  4Z7Y A;  4TNO A;  5CYQ A;  3GYG A;  1NND A;  4N47 A;  3BGR A;  4IOB A;  4EBD A;  2K7K A;  2FIU A;  4LIR A;  1MWY A;  2DCL A;  1D8Z A;  2AZ1 A;  2HEK A;  6AT1 B;  2BM1 A;  3JSY A;  1GMW A;  3D6H B;  2ZOG A;  1U1Q A;  1SL2 A;  1M5K C;  3PTW A;  2HS0 A;  2CQ3 A;  2YNH A;  3D6F B;  2GNK A;  3PJX A;  4K2X A;  1FRI A;  3S1T A;  3MM8 B;  1KD1 T;  4X4P A;  3R5C A;  4RW7 B;  4DSI A;  4F50 A;  1LKZ A;  1RAC B;  3VZI A;  3G6Y A;  5LT5 A;  3UD3 P;  5LSO A;  1TL4 A;  2VG6 B;  5KFD A;  4PWD B;  1WEL A;  5E3R A;  1IKV A;  1X60 A;  4TU7 A;  1IQT A;  4G1Q A;  2CJA A;  5HBM A;  3H2U B;  2H5J B;  4WFX A;  2R2U A;  2VDH A;  3AXM A;  2AJ2 A;  3Q8R B;  2RDJ A;  1X4F A;  3CW2 C;  4WKY A;  2AX0 A;  4CH0 S;  1UVI A;  2G2O A;  3MCM A;  4TQR A;  3CPW R;  3M8P A;  4DQP A;  4Z2X A;  1TU0 B;  4ES3 A;  4DV5 F;  1Y5I B;  3GG1 A;  1APS A;  1DJ0 A;  3C6T A;  3UW1 A;  3UVJ B;  3FVY A;  4CYU A;  1BWV A;  1VQN S;  2HPU A;  1NKC A;  4R8U B;  4DF8 A;  4UY8 5;  1SC1 B;  3FEY B;  3HD2 A;  3W63 A;  2HGL A;  2XO6 A;  5CAB A;  3BN4 A;  3D0H E;  2X7I A;  1Q8B A;  3R5D A;  4UF4 A;  3G6V A;  4LMZ A;  3LAN A;  4NYP A;  4WF9 Q;  3BO3 A;  2D3Z A;  3OLA A;  2OMO A;  3H40 A;  2W2P P;  2XNQ A;  5CZX A;  3DI6 A;  1R7I A;  5EHH A;  3GG0 A;  6FDR A;  1HMV B;  3M9M B;  4BDP A;  2B9E A;  4F3O A;  2JEI A;  1RTJ B;  4KKO B;  2ZZM A;  2GHV C;  3B54 A;  4IRD A;  1IKW B;  2BAB A;  3DMJ A;  4PXB A;  2M4M A;  4FYW B;  1UPP A;  2RKI A;  1YIT S;  2VBZ A;  1QTM A;  4YY3 F;  1NSA A;  5B0E A;  5HN0 A;  2X3G A;  2UP1 A;  3BSA A;  3EE3 A;  3QT8 A;  2OUG A;  4GO5 X;  3GIK A;  4J9N A;  1N5Y A;  1UFK A;  2DEJ A;  2NS1 B;  2DNQ A;  4KHM A;  1W7W A;  1S1T B;  4GKJ F;  3IBW A;  2W1B A;  2V8P A;  2L48 A;  3K5P A;  4P74 A;  3U27 A;  4X64 F;  2AHO B;  1NDK A;  3H2L A;  2XEX A;  4YFU A;  2ZIT A;  3M2R B;  2VPY B;  4AXJ A;  1QDU B;  5K20 B;  4NZ7 A;  3QMQ A;  5KT3 A;  2L3M A;  1EHW A;  2MKC A;  3OFG A;  4HH1 A;  2R7S A;  3FUY A;  2F1F A;  1S9E A;  1VJW A;  3MMB B;  3N9U C;  3VR1 A;  1TKZ B;  3C6U A;  1VR6 A;  3TUI C;  1WTB A;  1HNW F;  2AGO A;  2G0J A;  3CB4 A;  4F4Z A;  2PC6 A;  5J1N A;  4DR1 J;  3P49 B;  3O3L A;  1AFI A;  5EWG A;  2HVD A;  4LSL A;  1EKS A;  2G1H A;  2LDY A;  1NSQ A;  2H9Z A;  2XNR A;  4Q0B A;  4L3N A;  2Z30 B;  5KG3 A;  3CUL A;  3LP2 A;  4K59 A;  1RBA A;  3UN3 A;  4AL7 A;  1LXJ A;  1RIS A;  2AZ3 A;  1JLE B;  1GAO A;  2CRL A;  5J2N B;  2HRU A;  3UN5 A;  4X62 J;  2MY7 A;  2V2Q A;  4CH7 A;  2GO9 A;  3CJS A;  1FXL A;  3TQE A;  2HFZ A;  4KAI A;  1YK9 A;  4U6P A;  4UQG A;  1WF2 A;  1SJR A;  2VG5 B;  3GPA A;  3DRP B;  4OX8 A;  5CYM A;  3CCZ A;  4PXE A;  4KR0 B;  2QMU B;  1NZA A;  2F4V J;  1JLC B;  2PEH A;  3D6M B;  3IWX A;  2IM0 A;  2ZUG A;  1RP5 A;  4DR7 F;  4NXN F;  5HK4 A;  2OJ3 A;  1W26 A;  4QR1 A;  5D78 A;  1N32 F;  2AMC B;  4FXW A;  3HSJ A;  4JP8 A;  1OYE A;  3T6B A;  1EIY B;  2JWN A;  5HL7 Q;  1LWE B;  3R5G A;  2HLU A;  3NGK A;  2HNY B;  3BSC A;  2CJQ A;  1HYS A;  3UO0 A;  3D6T B;  3KK2 A;  5HSP A;  4JV1 A;  1U25 A;  4WFN Q;  1RT2 A;  3CCU S;  5M2P A;  2F9J A;  1QAY A;  2G2Y A;  3J7Z T;  4E0D A;  1HBU A;  3CCR S;  1WOS A;  1SKU B;  3SEO A;  3OFH A;  2V69 A;  3KK2 B;  4OYI A;  2EFP A;  3AJ1 A;  5LMN F;  1RAJ A;  3M8P B;  3E2E A;  2BJ7 A;  4L76 A;  4DUY F;  3GIL A;  1WHY A;  2EG1 A;  2HS4 A;  3CME S;  3Q2T C;  5AJ3 J;  4KH0 B;  4DV2 J;  2PMH A;  3NGR A;  2BA9 A;  1UVL A;  4I64 A;  1WHX A;  1G6B A;  4PWU A;  4Q43 A;  2J0Q D;  4DPW A;  1IWG A;  2OSQ A;  1FRJ A;  2PSZ A;  4QZV B;  3MMA A;  5D3G B;  4LF7 F;  4J9K A;  1KHV A;  4NLW A;  2BQ3 A;  1UJ4 A;  2BW2 A;  2KU7 A;  4MKV A;  5FDL A;  1RT3 A;  1OS5 A;  1UEK A;  5KG0 A;  4IOC Q;  3TJ9 A;  1WTF A;  3CCQ S;  1XNR J;  1P1L A;  1RWX B;  2B9Y A;  4WTO B;  4OZ1 A;  1S6O A;  3J7Y U;  1C0T B;  2Z0G A;  2DHH A;  1GMV A;  2XYP B;  3KDO A;  4P2F A;  4C48 A;  3J7Y I;  2WVC A;  3Q8Q B;  1RT1 B;  3G6X A;  1XR5 A;  3CJ5 A;  1NHK L;  1QAX A;  5D0E A;  3S7R A;  2GIQ A;  3B6B A;  1OY6 A;  4DUZ F;  4F8R A;  2QLB B;  2N4D A;  4ZIT A;  2HUR A;  1RLC L;  3KK1 A;  4LFA J;  1UVK A;  5H9E J;  3BO2 A;  2PE8 A;  2FVQ A;  1FRK A;  3KXD A;  1NHV A;  3WC2 A;  4DV0 F;  2HRY A;  1T94 A;  2DCU B;  3KJF B;  5ADZ A;  5EWF A;  2ZH7 A;  4A8Q A;  1L3U A;  1H2T Z;  1S6P A;  4HHU A;  4DDF A;  1TV6 A;  4C2M A;  1FD8 A;  2BBE A;  2OH2 A;  3R2C J;  3CT9 A;  4NI2 B;  4O3Q A;  4JI5 J;  3QO9 B;  5GAH U;  2WZ1 A;  2ZNY A;  3SCK E;  2N7C A;  3G8Q A;  3DOL B;  3I0R A;  4TN2 A;  4DL3 A;  3JSM B;  1YJT A;  2P6T A;  1UPM B;  3AQO A;  4WFB Q;  4DSJ A;  2OGU A;  2ZM6 F;  3CJT A;  2IBK A;  4LVN P;  1ROF A;  3GFY A;  1I3O B;  3SCL E;  4USI A;  2QEX S;  1TMJ A;  3BR9 A;  3HLU A;  4I1T A;  3WZ0 A;  5E41 A;  1OY8 A;  3I96 A;  1UET A;  1YJR A;  3CCW A;  3FEZ A;  3NBP A;  3W66 A;  4X62 F;  1X9W A;  1AYE A;  1XR7 A;  4RBV A;  2VKZ G;  3W2W B;  1SKS A;  4LF4 F;  1NME B;  1RCX B;  1VCT A;  2GO8 A;  4F7V A;  3BGO P;  1EAR A;  3QGP A;  2BJ1 A;  2IRY A;  5KFB A;  3KLE B;  4B3T J;  4JUZ A;  1HBM B;  3ZZR A;  3PX6 A;  4WP8 A;  3GIJ A;  3RB4 A;  2DK2 A;  3R7N B;  2XTJ P;  4ECX A;  3CNQ P;  5KOX A;  2YPY A;  3THP A;  4QW8 A;  2QLJ B;  4DV1 F;  2VPZ B;  1HBM A;  2J0X A;  1FXR A;  2FZK B;  2QL7 B;  5ETL A;  4MFB B;  5J2Q A;  2D3O 1;  2DR7 A;  1XMB A;  4F0K A;  1YBT A;  2VFV A;  3OUY B;  3CJK B;  2BM0 A;  1U8S A;  3EWG A;  3DXB A;  1S97 A;  2HWT A;  3EVO A;  4DQS A;  2A3J A;  2ZWO A;  4IH6 A;  1NU4 A;  5A0Y A;  4EWT A;  5A6P A;  3LO3 A;  1NDL A;  2GAH C;  3FQK A;  2WTF A;  4Y2A A;  1J5O A;  1S9E B;  2EK6 A;  4C98 A;  2HHQ A;  1YQH A;  3TX0 A;  3JYT B;  4L74 A;  2W7P A;  4ED7 A;  4OI0 A;  2W24 A;  4X4O A;  1S77 D;  5C2G A;  1H2V Z;  2PMZ D;  3CJ0 A;  5I4M A;  4MMO A;  1CJV A;  1U2C A;  1REV B;  5H9F J;  4CLZ A;  4W90 B;  1E6Y A;  1WF1 A;  1NH7 A;  2MLZ A;  2FYX A;  3A1Y G;  3AOC A;  2V8G A;  3DI6 B;  5HJX A;  4C6A A;  1F5A A;  1XQI A;  2GW8 A;  2HFU A;  2MZS A;  2X1G A;  4NOH A;  3ULH A;  2ZHA A;  1YTY A;  2GML A;  3EGV A;  1Y4Z B;  3GTY X;  4I4B A;  3MXH P;  1FKO B;  2FHO B;  3WIV A;  2IJF A;  2VQF J;  5KFV A;  3UNG C;  4QIF A;  1CJK B;  4FVM A;  1HNI B;  2KVI A;  4A8F A;  4FBT A;  2JEG A;  2DH7 A;  2PO4 A;  1KVI A;  4FYX B;  4B9T A;  3SSQ A;  4A8X A;  1EB0 A;  1DAX A;  1KNZ A;  2GZO A;  4TQS A;  1VQ6 S;  3NS5 A;  4HKQ A;  1TTH B;  4M5H A;  5HAT A;  3UPF A;  5T7L B;  2R3V A;  5B08 A;  2EFQ A;  3TAP A;  2AEM A;  1NPP A;  1SH3 A;  2KJW A;  2W7A A;  3BGR B;  2V9W A;  3C8Y A;  2FC8 A;  4IR1 A;  3L7O A;  1XNQ J;  2OPQ A;  1BE4 A;  5AXM A;  3TUP A;  1EQ0 A;  3IRX A;  2ZE2 B;  3P96 A;  4O3N A;  1WAC A;  4ZVS B;  1FJE B;  3Q22 A;  4C8L A;  3ET6 A;  2ZKT A;  5IZH A;  1FFS B;  4YEA A;  3R2D J;  3RR7 A;  3Q83 A;  1N5Q A;  2Y0B B;  4TVA B;  4TYA A;  1VQK S;  1UFW A;  2DGT A;  3NEK A;  3SQO P;  3A12 A;  3V6D A;  1CQM A;  3PRV A;  4JI7 F;  4CLY A;  2M52 A;  2BMB A;  5L38 A;  3M9N B;  1RBL A;  2DXD A;  1PJ7 A;  3OR2 B;  1QD1 A;  1HD0 A;  3I0S A;  2M2B A;  3IM9 A;  1D3W A;  4OI1 A;  1NJW A;  1B4S A;  1RWW B;  2DNR A;  4WPA A;  4QYZ J;  2YBV A;  1OYD A;  2GJF A;  4JOU A;  5B0G A;  4DXL A;  2LLZ A;  4HR2 A;  1JK9 B;  2IPO B;  1VQL S;  2JEF A;  2O5D A;  1HL6 A;  3HKW A;  4I7F A;  2IJR A;  4IQX A;  3D4J A;  4GVB A;  4YHH F;  1Q7Y T;  2RML A;  1XNR F;  4X2B A;  4F0M A;  2VG6 A;  1V6H A;  1HAR A;  3P3D A;  2F7V A;  4ES2 A;  2FDN A;  1NJI T;  1N33 F;  1SC3 B;  1KOH A;  2R7T A;  4O0I A;  1S9G A;  4K2J A;  4B3R J;  2CG8 A;  4OL8 A;  3C19 A;  2WVD A;  3X3U A;  3AJD A;  3W9H A;  3HHK A;  4Y65 A;  2GA7 A;  5T14 A;  3EM1 A;  4AXI A;  2J6U A;  1Y3J A;  1FDA A;  1XEZ A;  2ZHO A;  3G2X A;  2C1E B;  2J0W A;  1AT1 B;  2LDI A;  3HVT B;  4D3G A;  3EPG A;  4DOZ A;  3HHL C;  2GHP A;  2RH3 A;  3VAL A;  3NNA A;  3BDP A;  4QYR A;  3PO4 A;  4J9O A;  4OI6 A;  2I9S A;  2HHW A;  4FDF A;  3VCD A;  3VZH A;  4N76 A;  1T9X A;  2DHS A;  4HAC B;  2R7X A;  3KHH A;  4LRF A;  4EO6 A;  3AH6 A;  2XLJ A;  1NBE B;  3N28 A;  3UD5 A;  4DEZ A;  3DN9 A;  5IS2 A;  1X4D A;  3KLF A;  3JSM A;  1P8G A;  1UVN A;  2IHR 1;  3UWT A;  2GJ2 A;  1Q5Y A;  2AGP A;  1RBO B;  3QO9 A;  1JNZ B;  1BD6 A;  1ELO A;  2AEF A;  1TKX A;  3DOK A;  4U8Y A;  5L1J A;  2JEJ A;  1IKV B;  4CNY A;  5CHC B;  1VMB A;  1OSC A;  1JIH A;  1K44 A;  1SC6 A;  3AFG A;  1HI8 A;  1FFG B;  3TOQ A;  2BE9 B;  5F41 A;  5DM6 Q;  1K8A T;  4KJI A;  4KGK A;  2IYI A;  3QAT A;  3J80 Y;  1J5O B;  4B9L A;  3WDO A;  1O0P A;  5EX0 A;  1U6B A;  1BY9 A;  2PMW A;  4YB6 A;  3QFH A;  1MMN A;  2W2Q P;  3AD7 C;  2UUW A;  4UST A;  1VRT B;  3OTB A;  3IG1 A;  5CQG A;  3GMG A;  2V2K A;  5J2M B;  1BC6 A;  1X4H A;  4HL9 A;  2KZZ A;  1LK5 A;  2NXC A;  4O4R A;  4N56 A;  2YX4 A;  1S0O A;  3SBM A;  1QAI A;  3NNH A;  4DV6 F;  1S1U A;  2WON B;  3AXK A;  3BKU A;  3BPD A;  3E3X A;  2I6W A;  4LF9 F;  5LSL A;  2FGO A;  4EEY A;  1UCN A;  2FHJ A;  3PEJ A;  3AJ2 A;  1IWA A;  2DNK A;  3M8Q B;  3PW4 A;  1QLN A;  1X31 C;  1TL1 A;  3X1L B;  1F9E B;  2XSJ B;  4AQY J;  3CD6 S;  4DPT A;  2GGP A;  3CXC R;  1C1C A;  4ENO A;  4EZ9 A;  1GX5 A;  2LA4 A;  2HHS A;  4UTG A;  4KGX B;  2B7C B;  5L9X A;  4XK8 C;  2YX1 A;  4F4W A;  2KL8 A;  2D3O R;  1VQM S;  1XMO F;  1S10 A;  2AW0 A;  3MCN A;  5E5N A;  3P5T L;  4X4T A;  5ETN A;  2JLF A;  2Q43 A;  2VD3 A;  3DRS A;  3T5J A;  1NK8 A;  4Y2K A;  3QWU A;  4KV8 A;  4RNF A;  3A8I A;  5KFO A;  1JLB B;  3G82 A;  3R5J B;  3TR5 A;  4Q44 A;  2MQQ A;  5J2N A;  1JX4 A;  2XCA A;  3CJ2 A;  5H9E K;  1B0V A;  3FCV A;  5HLF B;  3D54 A;  1HWK A;  3LPY A;  2C3U A;  4WYW A;  4NI2 A;  3FK4 A;  4RBT A;  4CQ1 A;  4ZVO B;  3JB9 k;  2VFS A;  3DM2 A;  2XI2 A;  5IT0 A;  5GMD A;  4EO8 A;  4FYD A;  4R5P B;  2WON A;  1TK0 A;  2ZWP A;  4LF5 F;  1VQS A;  2Z2Y B;  4NLP A;  5EX3 A;  2RIJ A;  4URG A;  4LRE A;  3CCV S;  1HBN A;  3RBD A;  1X4B A;  2POK A;  2KRB A;  2HFO A;  1CC8 A;  2W9A A;  3TAQ A;  2CKW A;  1WC4 A;  5KFY A;  4MK7 A;  3PIO Q;  3GP9 A;  2KKH A;  4M8L A;  1S5Z A;  1IQZ A;  4TLR A;  3K57 A;  4J9P A;  1ARO P;  2CJK A;  1HNV A;  1HA1 A;  2RF2 B;  4RW6 A;  1C0T A;  4WII A;  5K8P A;  1O51 A;  3TZY A;  3DU6 A;  4A8Y A;  3RJM B;  3MR5 A;  1VS3 A;  2MQP A;  1S4E A;  2ZH6 A;  1T05 B;  2BDP A;  3EGZ A;  2RRB A;  4J5O A;  3DLK B;  4ZIW A;  1DBD A;  1RT6 B;  3UFC X;  2ZUA A;  3MR3 A;  3AB2 B;  2AV5 A;  2AYM A;  2F9D A;  2G2Z A;  3CJR A;  3TAM B;  3VGT A;  1FK9 B;  2BUN A;  4C0H A;  4YP3 A;  4YR3 A;  4JI1 F;  1TR0 A;  2V8H A;  2J8S A;  1VRQ C;  4FVC A;  2VJV A;  4EMD A;  5KFR A;  1DQ9 A;  3PKM A;  4DG1 A;  3M8Y A;  2ZH3 A;  1D9F A;  2FVS A;  2ZC4 A;  3KKF A;  3LGH A;  2HFN A;  4W98 A;  3RGI A;  3TZX A;  3MR2 A;  1VK3 A;  2K1R B;  4A8O A;  3KLV A;  1OIA A;  4A48 A;  2H5I B;  2ROP A;  3FMW A;  3GCX P;  2NXE A;  5ITH A;  2CZ9 A;  5BR8 J;  4OYZ A;  4Q2L A;  5HO4 A;  4PYD A;  4H4M A;  2PA3 A;  2ABY A;  2RS2 A;  3NS6 A;  3TJA A;  3RB6 A;  2K06 A;  3TVY A;  4WFY A;  1GTH A;  4ECR A;  4CO2 A;  4A8M P;  1OY9 A;  1RAD B;  4ILR A;  4NLT A;  2C2R A;  4U9R A;  4CLK A;  1F3V A;  2VG7 B;  4RW4 B;  2HNY A;  3OXF A;  5HJY A;  1HYS B;  2DIV A;  2ZH5 A;  2CJB A;  4O4G A;  1SV5 A;  3FBE A;  4PCQ A;  1KVJ A;  2Q66 A;  2EKY A;  1T02 A;  4NZ0 A;  1T9W A;  3KG1 A;  2BJD A;  2WRM A;  5HRO B;  1P27 B;  3ISZ A;  1FRL A;  3ILJ A;  3EDR B;  1G3O A;  2V0N A;  5KFH A;  1VC0 A;  1S57 A;  2BRL A;  4ER8 A;  4WBF A;  2UUA F;  2R7Q A;  4TY8 B;  4PRF A;  4DR2 J;  1GT8 A;  2DRB A;  3BDE A;  2W7O A;  5AE2 A;  2M3D A;  4PPZ A;  2YKQ A;  4K5R A;  4X66 F;  4RUH A;  2QN6 B;  1EZZ B;  2B56 A;  4EGL A;  2ZH4 A;  3T5H A;  1HI0 P;  1RTD B;  2D3U A;  1T3N A;  3PY8 A;  5D0H A;  3MAQ A;  2HZV A;  1IKY B;  3W2V A;  1RTI A;  1FT8 A;  1KVK A;  1BUX A;  4RW8 A;  3ZZY A;  1FE0 A;  4JV5 J;  5GAE U;  2DEI A;  1YRX A;  2H48 B;  4MK9 A;  4O3P A;  4A46 A;  5GAE I;  5CAA A;  3W8G A;  4NWB A;  4FS2 A;  2J9D E;  2OPQ B;  2V2V A;  4IFY A;  2QSW A;  5KTQ A;  1X4E A;  2MSS A;  3PHT A;  1FO1 A;  1QY7 A;  1YLX A;  3M2V A;  3UVJ A;  4K4U A;  4HH0 A;  2WHO A;  3VQT A;  4F36 A;  5J1E A;  3HP6 A;  2CJ9 A;  3HD1 A;  1TKZ A;  1VIX A;  3C6U B;  3L9Z A;  4Q8F A;  4EZ6 A;  2FZC B;  2J6S A;  3J81 Y;  3UQS A;  2JX2 A;  1M0S A;  2OO4 A;  2ZDP A;  2F8E X;  2C2M B;  1MLA A;  5B0A A;  4O3O A;  1XJW B;  3DRX A;  4Q2M A;  4ZP8 A;  5I3P A;  2HGN A;  4QWD A;  3CJ8 A;  2DIU A;  4ZJL A;  2ZBP A;  1S99 A;  2XBP A;  3DRY A;  4F67 A;  3OSP A;  2VA3 A;  1PC5 A;  1G4C A;  1F1B B;  1WHV A;  3BR8 A;  3L7U A;  4RNH A;  2HKE A;  3HMJ G;  2A6O A;  3MPW A;  5M2U A;  4FPI A;  3R6L B;  1IM4 A;  1JKH B;  4AND A;  5KFN A;  1DZ5 A;  2ILZ A;  2AYB A;  2U2F A;  1FJG F;  3CIZ A;  2E5I A;  2UVV A;  4W92 B;  1N52 B;  1R8C A;  2HGM A;  2HSE B;  2NYI A;  3A13 A;  3NGU A;  4F2R A;  2KVQ E;  1N36 J;  2P5V A;  2XUL A;  4OZN A;  3W64 A;  3W3S A;  1L3K A;  4AQY F;  3KLF B;  5KFT A;  3QJP A;  2BXJ A;  2FGC A;  2RRN A;  2DGW A;  5KFZ A;  3JYT A;  1VC6 A;  4HAC A;  1Q53 A;  5IM0 A;  1NPK A;  1YI2 S;  2AJF E;  2IMW P;  2ZVS A;  1RWN B;  2XO7 A;  5J1E B;  1R8A A;  3KMS A;  1EX8 A;  2DH9 A;  5D4L A;  3VAK A;  3M7V A;  3V6K A;  1DFD A;  2OI2 A;  3RB0 A;  1JKH A;  4UOH A;  5KFP A;  1NK4 A;  4Q45 A;  3IGN A;  2E29 A;  4WXW A;  4OJH A;  3THT A;  3W5Y A;  3C66 A;  3W60 A;  2FPH X;  2HS3 A;  4I2P A;  2DY1 A;  1D09 B;  2BX6 A;  4A8S A;  2V94 A;  3M30 B;  4OQJ A;  5K9F A;  4DS4 A;  1FA0 A;  1NSP A;  2CPX A;  1RWO B;  4J7C A;  3WC0 A;  5J2P A;  3PDN A;  1PBU A;  4P6Q A;  2F4F A;  2UUT A;  3W2V B;  3C6T B;  2AKW B;  4CYU B;  2KM8 B;  3WX8 A;  2ZBI A;  4QJV A;  1K73 T;  2AP6 A;  3DLG A;  5L39 A;  2AU0 A;  4NML A;  5DLG A;  3ZNJ 1;  4JYA J;  3OJS A;  4HHJ A;  4U67 Q;  1RYR A;  3FGV A;  4DR3 J;  4DR5 F;  3RUB L;  2HIQ A;  4J9Q A;  2KRR A;  1K1Q A;  4Y2I A;  4B3S F;  1LWF A;  4N5S A;  2FJV A;  3A3P B;  2E7W A;  4WU3 A;  5CZV A;  4C4W A;  4MKY A;  1HQ2 A;  2XYH B;  3OL7 A;  4LF6 J;  4DL5 A;  2ZDO A;  1LOU A;  1ZM2 A;  1T9Y A;  2IRX A;  2VG7 A;  2IMO A;  1S48 A;  2OPR B;  3KFW X;  4FPR A;  4DN0 A;  3IWN C;  3NRB A;  3LWM A;  1RT7 A;  3KLH A;  1W2B R;  4DSK A;  3H5X A;  4M1K A;  3OXG A;  3KMQ A;  1D9A A;  1KDN A;  1TZ0 A;  2EBE A;  3F56 A;  2MKK A;  1REV A;  4Y2M A;  1U8W A;  4F0H A;  2EXU A;  2OML A;  3LP1 B;  1Q86 T;  5C5J A;  5DRK A;  2ZHB A;  1YDL A;  2JL9 A;  2CAD A;  2LQJ A;  1F3F A;  2MQM A;  5DZ6 A;  4ECQ A;  1HQE B;  3E01 B;  2R8I A;  4DL0 C;  2QA4 G;  1FNX H;  3C15 B;  1P9Q C;  5AE3 A;  1GMU A;  3FBB A;  4CP5 A;  3AOB A;  1MRO B;  3N4W A;  4ZVE A;  4FS1 A;  3CCE S;  3H90 A;  3MTK A;  2OIH A;  1U1N A;  3G86 A;  4DLE A;  4ZVP B;  3OTC A;  2O66 A;  3PJW A;  3KJV A;  1WKK A;  2R9L A;  2HK2 A;  4JBC A;  4BC7 A;  3TUJ C;  4WK3 A;  1RWU A;  2B8P A;  2DNY A;  2I1R A;  3N5B A;  5D4O A;  2X1A A;  4ZPA A;  3OUY A;  4X4V A;  2ZZN A;  1Q95 G;  1NHU A;  3BN7 A;  3CSK A;  3FKB A;  2GVD A;  2RQM A;  4I56 A;  3C14 B;  1S1X B;  4O0N A;  3SSR A;  2NPI A;  3UDC A;  3WIU A;  4C11 A;  5F9L A;  2XWY A;  2Q1L A;  4PXC A;  2RSQ A;  3TAR A;  2WVB A;  3D66 A;  1WSV A;  3MM5 A;  4FNH A;  4X65 J;  5L1I A;  2XZW A;  2M8D B;  2CQI A;  2KM8 C;  4DCO B;  5KG7 A;  4PG7 A;  2YWG A;  3K8W A;  4F04 B;  5I42 B;  2K3K A;  2LVW A;  3M6X A;  1M5H A;  3GJR B;  4KGV B;  4JI1 J;  2DNG A;  1DLO B;  2V5H G;  1YJ9 S;  2JLG A;  4ZLP A;  1T9T A;  2RAQ A;  2VQE J;  4N7T A;  2Y9H A;  2XSF A;  4DL6 A;  4LRD A;  2EFG A;  3OR2 A;  1Q5V A;  3F73 A;  1X4G A;  5HRO A;  1U2F A;  1XN9 A;  2CNK B;  2V4R A;  3KLG B;  2YNG A;  3ENA A;  3KUH A;  3VGV A;  3FZ2 A;  3KJN B;  3MM7 B;  3IAM 9;  1U0S A;  2CQD A;  1U02 A;  3VHQ A;  4EYH B;  1B7F A;  1TMM A;  3MPU B;  1QJH A;  3NY0 A;  2P9C A;  2DHG A;  3MEG B;  4ZA1 A;  4BLG A;  2I5J A;  1QUP A;  2R2R A;  1SC4 B;  3W5Z A;  1GEH A;  2UUB F;  1WEZ A;  2QZ8 A;  4QOT A;  1R31 A;  2YKA A;  1Z2L A;  5K14 A;  2UXB F;  4YB1 P;  1CLF A;  1YJN S;  4EYI B;  5IOL A;  4NCA A;  5HVH A;  2ZH8 A;  1R0B G;  3MCO A;  2OD6 A;  3KHL A;  3F41 A;  1MG7 A;  1T9V A;  5K8O A;  3M32 B;  4KPY A;  2BEF A;  2VKR A;  1KS2 A;  3BGL A;  5KG1 A;  2N3L A;  4IDK B;  1FE4 A;  1SH2 A;  3QAU A;  3QGI A;  5C42 A;  2ALZ A;  5KG2 A;  2Z4P A;  2LQ5 A;  1HPZ A;  3NCQ A;  3ZTP A;  3RTV A;  4DSE A;  1CVJ A;  2KJV A;  3DXS X;  1KQF B;  3D0I E;  1SJ3 P;  2HYI B;  1L3S A;  2C3M A;  1XMO J;  3MAA B;  3RBX A;  2DD8 S;  2KFY A;  1M5S A;  2JDJ A;  2KN4 A;  5HQL A;  1B99 A;  1U48 A;  1VQ4 S;  3TEG A;  3M6W A;  3RB3 A;  5K14 B;  1HNZ J;  1PIE A;  3GCW P;  4ZK7 M;  3EIC A;  1IM6 A;  3ZO7 A;  4ZLN A;  1C0U B;  1FER A;  2WCX A;  1GMW D;  1Y0H A;  3AQP A;  5C7P A;  2XS5 A;  3DLE A;  4WYL A;  2B4O A;  5A8K B;  1GFW B;  2GFF A;  2LEB A;  3KYL A;  3I9Z A;  1JLG B;  1NLK L;  2VBY A;  4ED8 A;  1RHJ B;  1U6F A;  5A0Y B;  2EC0 A;  2KXN B;  3TAN A;  3M2V B;  5KFW A;  3K0J A;  3ZZZ A;  4EFA C;  2DVI A;  4CLP A;  1URR A;  1Y00 A;  2MDA A;  4F3Q A;  3A8J A;  2MB0 B;  3OTD A;  4NYO A;  2BE7 D;  2NXJ A;  5JVH Q;  4JI4 J;  1NM2 A;  2WOM B;  2JVO A;  4IG0 B;  1FWP A;  2NUU G;  3MEE A;  2YQ3 A;  3JAM Y;  2V8V A;  5DG9 A;  3ZZU A;  1YWX A;  2BVZ A;  2K1R A;  3GR0 A;  4X4R A;  4TYB A;  5KOW A;  3CCS S;  3OFE A;  3NMR A;  1FWL A;  1RHR B;  4WU2 A;  3PW5 A;  3EDQ B;  1X9M A;  2OEL A;  3R5A A;  4LF6 F;  2A18 A;  1OJ4 A;  4NRT A;  4KRW A;  2N82 B;  2XMV A;  4ED0 A;  1C1C B;  4WFZ A;  1YKW A;  4ZVF A;  9RUB A;  2JLE A;  4FNI A;  4NE9 C;  2XSJ A;  4IO9 Q;  3HDS A;  2E1P A;  4J37 A;  3FNN A;  3JSB A;  4DR3 F;  3NAH A;  3CO9 A;  2ALY B;  2P2C B;  4ZCL A;  2PI5 A;  1PAE X;  1H2U X;  3CDB A;  2X3D A;  3H59 A;  5E3Q A;  4WCE Q;  3GB0 A;  4ZPV R;  4JI4 F;  5ETK A;  3VAG A;  1UL3 A;  4H4O B;  4A47 A;  3BBF A;  4USU A;  2YWW A;  4DX6 A;  1VBX A;  1JXV A;  5IQ6 A;  3TZW A;  4B3R F;  1N48 A;  2DHX A;  4J91 A;  4DL4 A;  3OLB A;  2F8H A;  1S6P B;  3NS7 B;  4DCP B;  4B02 A;  2FHM A;  3TA0 A;  4K4Y A;  4ELV A;  2ZFH A;  3H20 A;  3HM9 A;  3D1Q A;  3ETM A;  4CWB A;  3M6U A;  3BBB A;  1D1U A;  2R8H A;  4M5J A;  1C0U A;  1QE1 A;  1S79 A;  2O01 C;  4Q5V A;  3KNG A;  2MEW A;  1EP4 A;  2ILY A;  1JB0 C;  2CQ1 A;  2J7W A;  2IVM A;  3A8E A;  3MAH A;  3O6Q A;  3OTE A;  3QIP A;  4LF7 J;  3R1H A;  3O44 A;  1NK0 A;  2VG5 A;  3GV5 B;  4C7Q A;  1RT6 A;  3ZZO A;  1Y3K A;  3I4P A;  4C8M A;  1GTE A;  4J9R A;  1BQX A;  2UVR A;  4B9S A;  1FJG J;  4ILL A;  1HNV B;  1E6V B;  3TEH B;  4NA2 A;  1SCJ B;  3IAS 9;  3KUG A;  4OX7 A;  4Y3C A;  2KT5 A;  2DGO A;  2DNM A;  3QYY A;  3D67 A;  4JV0 A;  3PV8 A;  1VLY A;  1L3V A;  1KRP A;  2RDD A;  2OSR A;  3BPS P;  3K2Y A;  4ZHR B;  4JV2 A;  1WNE A;  3OJU A;  1RTJ A;  1VQY A;  2E1A A;  1F5C A;  1VFJ A;  2VB6 A;  4KKO A;  3G4S S;  1S9G B;  2JZ5 A;  3I82 A;  2HVI A;  1GXU A;  3Q0A A;  5H1S V;  5L46 A;  1FVQ A;  2Y0S D;  1JLA B;  1LQ9 A;  4GC6 A;  2HBR B;  3BF4 A;  4WXO A;  4X4Q A;  4F25 A;  1AUD A;  1KLM A;  1UJ5 A;  3DRR B;  3HK2 A;  2A10 A;  3K5M A;  1U7L A;  3T1A A;  4GKK J;  2RS8 A;  3FFI A;  2HHU A;  3QT5 A;  1DQ8 A;  3RRK A;  2XC9 A;  1H38 A;  4NXN J;  1N8R T;  2CZ4 A;  4KGZ B;  1T03 B;  3MF5 A;  5EGY A;  4LIW A;  5IC4 B;  4NLG A;  2HWI A;  2XY6 A;  2VUG A;  2Q3P A;  2LEC A;  3PNI A;  1XR6 A;  3G9C A;  1IKX B;  4F02 A;  1AZS B;  2YKO A;  4UZB A;  2HG4 A;  3NBP B;  3IS9 A;  4MAK A;  2B6A A;  4ZVT B;  3ZZP A;  4URQ U;  4KE5 A;  1H73 A;  2QA1 A;  2V34 A;  5DQG A;  1HQE A;  3E01 A;  3NG8 A;  4IYQ A;  2VOO A;  2RJZ A;  5KG4 A;  1RHK B;  2MLY A;  3Q8V A;  1A7G E;  2VQE F;  1TUV A;  3DOK B;  4UY8 T;  1UW4 A;  2JJ4 D;  1KOO A;  4DMZ A;  2JH3 A;  5KT6 A;  5KT2 A;  2ADB A;  1CJV B;  2D1C A;  2FQQ B;  4DR1 F;  2HK3 A;  2KI2 A;  1M5V C;  3WHI A;  3GIM A;  2ZH9 A;  4DL7 A;  3J7A N;  2BOA A;  3CCT A;  1I94 J;  2BJ9 A;  1OPI A;  1HD1 A;  2Z2M A;  2F40 A;  1I51 B;  2GVD B;  1VQO S;  3MM9 A;  3KK1 B;  2YNH B;  2LU2 A;  1UP1 A;  2W8L A;  1QVG R;  1FJ7 A;  2BJE A;  5BYR A;  3PR4 A;  1ITP A;  2QA4 S;  3J81 j;  2W4P A;  3MM6 A;  3MED A;  2RHS B;  1ZH5 A;  1IJF B;  3SMZ A;  1S59 A;  2VH7 A;  2HFV A;  2M8H A;  3OVS A;  4O44 A;  2UXD F;  3MTJ A;  5F8H A;  3OL9 A;  4GKJ J;  4CO3 A;  4KHR A;  4NCG A;  4LF8 F;  4NZ6 A;  5BJR A;  1UWB A;  4F4X A;  2WBR A;  4DFP A;  3EVW A;  1BLU A;  4QR2 A;  2H4W B;  3PW7 A;  4C8K A;  2JOQ A;  3OFF A;  3SQG A;  1S6U A;  2KFN A;  2IYG A;  2EK1 A;  3F0N A;  3GON A;  5FLX Y;  5BYQ A;  2XHW A;  1E6Y B;  2QV6 A;  1OWX A;  4ETX A;  4RU9 A;  1ZM4 A;  4DSF A;  3G71 S;  1WC3 A;  4TY8 A;  2IDL A;  1HBO A;  3R3T A;  3CDE A;  5A8W A;  2FZG B;  4KC5 A;  3IR5 B;  2M88 A;  2KFZ A;  2XB2 D;  1TK8 A;  1FD2 A;  2B43 A;  2RNE A;  2VC0 A;  4DI6 A;  5CA5 A;  4HDH A;  3OR1 A;  3K17 A;  2YWF A;  3BO4 A;  3GYX B;  4JI2 F;  4DJB A;  1ZM3 A;  5I3U B;  3T41 A;  3PRD A;  2C42 A;  4K0K J;  3K5N A;  2HBY B;  1CPZ A;  2EVZ A;  1RT4 A;  3QQC D;  5JJB A;  2OTJ S;  2BRK A;  4FXV A;  2CG4 A;  1TKT B;  1F0X A;  4QPT A;  4IH5 A;  4TU9 A;  1FX4 A;  2L9W A;  3OD2 A;  2C2Z B;  2LQ8 A;  2VL1 A;  4KO0 B;  4OYX A;  1FDB A;  3SYZ A;  2ZEJ A;  2FUG 9;  3O8W A;  3KNA A;  2NSB A;  1SL1 A;  4LFA F;  2XLK A;  5AXN A;  4U7U D;  2CZV C;  5A8K A;  4LJM A;  4RNO A;  2QJ3 A;  3EPI A;  5A8R B;  1NJZ A;  2XS7 A;  2CNL B;  3PG9 A;  4CLU A;  3RR8 A;  1P9Y A;  3HCX A;  2HQD A;  2BKO A;  5DDO C;  2K8G A;  2IC3 A;  3MHY A;  5LXY A;  5KFE A;  1WI8 A;  4U7U K;  3W2W A;  1JLF B;  4DFM A;  2EC2 A;  1VQ7 S;  2VFR A;  1YGY A;  5F8I A;  2W4D A;  5I3U A;  3MDF A;  1YBU A;  2IM1 A;  2YNF A;  2YPZ A;  3LAL A;  4R0E A;  3DLK A;  2V68 A;  4FN5 A;  3SCI E;  1HWI A;  5ETR A;  4ECW A;  1ZET A;  1S49 A;  2BAC A;  1U1M A;  4IUF A;  1VI7 A;  2YKM A;  5DZ7 A;  2C3O A;  1JWW A;  4ZLJ A;  1Q78 A;  1LFW A;  2GX8 A;  4Y2C A;  3SZ2 A;  3NCR A;  3UCZ P;  1CSJ A;  4M94 A;  1TFY A;  2HNZ A;  2VF3 A;  3QIP B;  4CM2 A;  1MWZ A;  1B70 B;  4M5I A;  3IA0 A;  3U1L A;  2LEA A;  4MH8 A;  4DFK A;  3NWG A;  2PD1 A;  2CDQ A;  3J7A 1;  4UOC A;  2DYA A;  2B9W A;  2QT7 A;  3MMB A;  3ZTO A;  2HW3 A;  1RUS A;  4KBI A;  2E5J A;  3TA2 A;  1SJF A;  2R8J A;  2ACY A;  4LUB A;  3SFU A;  4IG3 B;  3KK3 A;  3LTO A;  2NUH A;  2IVF B;  4DV6 J;  4B9V A;  4F2S A;  4XTT A;  4KHP J;  2YH0 A;  2LQ9 A;  3F44 A;  4ZP7 A;  3PZP A;  1A0O B;  7FD1 A;  4LQ3 A;  4Q8E A;  1V9O A;  1DHM A;  1LWX A;  1I6J A;  4UUW A;  3P5B P;  3CWJ A;  4USM A;  1WEX A;  3CDU A;  2Y3Y A;  3TVZ A;  3OTO J;  3DLB A;  2BZ2 A;  3OXL A;  3U1N A;  3MM7 A;  4CLF A;  3GSI A;  4TY9 A;  2HZA A;  3TVK A;  2CDR B;  4OHY A;  2A1B A;  4ANC A;  2MYF A;  2CQP A;  3RBZ A;  1JLA A;  1FVS A;  3UDE A;  3HZE A;  4TU8 A;  5F9N A;  1MN7 A;  4MYU A;  4ECS A;  1YZ6 A;  3U1M A;  1JQG A;  1N88 A;  2JC0 A;  4WIQ A;  1RT3 B;  2YWK A;  4B3M J;  1F9H A;  5DQI A;  1WOO A;  2IM3 A;  1YRT A;  4QQB A;  2XZT B;  5DDP C;  4AL6 A;  1KBR A;  3ICL A;  4WK1 A;  1WC0 A;  2YQ0 A;  1AW0 A;  4B9N A;  4H54 A;  1RHQ B;  3ENW A;  2W9C A;  2F5G A;  2NZ4 A;  4OZJ A;  1RSC A;  2KHD A;  4USJ C;  5HAN A;  2BAN A;  2V8D A;  2XWX A;  4IR9 A;  1R6Y A;  2XI3 A;  3NOC A;  4GMK A;  1IKX A;  1HHQ A;  2UZA A;  2L41 A;  1LK7 A;  1N0U A;  1X0F A;  5L1K A;  1HBU B;  2RU9 A;  3CVK A;  1CS4 A;  2MGZ B;  1XMQ J;  3RAX A;  2VOD A;  2VV5 A;  4NYZ A;  2UUA J;  1SJ4 P;  1QM9 A;  4OYO A;  3MGJ A;  1IVZ A;  3ZTS A;  1SKR A;  4OJG A;  4YS2 A;  2I38 A;  3Q24 A;  3H2V E;  1K9M T;  1Q16 B;  1IBK J;  4RNM A;  2W2N P;  3HJV A;  1IN0 A;  1U0H B;  2JFK A;  2NYH A;  3PYG A;  3IMQ J;  4IFV A;  4WWS A;  2DR5 A;  1N33 J;  5G0R B;  5B0C A;  2C2O B;  1ACM B;  1RB0 A;  4C0O C;  4ZN3 A;  3VAM A;  2C2D A;  2EI5 A;  4OI4 A;  3RU0 A;  1N0V C;  4NPO A;  3CF5 Q;  4QCL A;  3T9N A;  2BKP A;  4H4M B;  4DN9 A;  1NKE A;  1OPZ A;  5DDQ C;  2IY5 B;  1EET B;  3DHW C;  2HNZ B;  4C8N A;  4ZCI A;  3JS9 A;  1NCL A;  4LSN B;  5E3A A;  1AUS L;  2Z2Z A;  1KLN A;  2RB7 A;  3GWC A;  5KFA A;  5ETV A;  5BYS A;  4MT1 A;  4ZPT R;  4XIU A;  4O3R A;  1T0T V;  2AQ4 A;  2LEP A;  1NJX A;  4ES1 A;  3IO1 A;  2MKY A;  5GVQ A;  1IJE B;  4ZJO A;  2YVS A;  1SXL A;  1VGY A;  3VVU A;  2AWZ A;  1IBM J;  1T95 A;  4OI2 A;  2Y8W A;  2CPF A;  3HHE A;  2NSC A;  2ZBC A;  2RRA A;  4ZPD A;  4UQT A;  2OPS B;  1J5E F;  1SQG A;  2IC3 B;  1YIJ S;  1O5J A;  3HF5 A;  2XM3 A;  3RBE A;  1OSD A;  2G0C A;  4I0W A;  4PWW A;  4AL5 A;  2B3T B;  1ICE B;  2F3J A;  1U09 A;  4JI3 J;  3DOM B;  1MWQ A;  2IJN A;  2VBX A;  2XMM A;  5CXT A;  2VOP A;  3DDN A;  1FI4 A;  3BV8 A;  5LJ5 Y;  3ZFV A;  1X4A A;  2Z8Q A;  2BOP A;  3PW0 A;  4DQI A;  2KYX A;  1KTV A;  3EZ5 A;  8AT1 B;  2CPZ A;  3DGP A;  1S7H A;  2QG9 B;  1G2E A;  4RR5 A;  2WK4 A;  1RT4 B;  4NLO A;  3Q8P B;  2HND A;  2CQ2 A;  4ZIV A;  1IR0 A;  2MMY A;  4PWD A;  4OX9 J;  3P4U B;  3JTO A;  1S1T A;  3K8V A;  4DX8 H;  4HTI A;  2QMX A;  3WBZ A;  3W7B A;  1RWM B;  1ZA2 B;  2J9E A;  2DNO A;  4K8R A;  4RKU C;  3KDN A;  3V2U C;  5IM0 B;  4X4U A;  1C1B A;  5HLF A;  3N6N A;  2QLW A;  1F2H A;  1JLF A;  4F4A A;  4PXD A;  1DLO A;  3MI7 X;  3BZQ A;  1L3T A;  1HMV A;  1Q8L A;  1KON A;  4IH7 A;  5FLX U;  2AYE A;  3PM9 A;  2V6A A;  4MKA A;  1X4C A;  2H51 B;  2RU3 A;  2VPX B;  4J9M A;  3QSY B;  2XCP A;  1UZD A;  4NX9 A;  4P72 A;  1BQN A;  1KHW A;  2K3I A;  3FBF A;  4K7Q A;  5LXR A;  3KLI B;  4OHV A;  1B7Y B;  2PEB A;  3LOU A;  2W4C A;  5E3C A;  8ATC B;  2F65 A;  4RWW A;  2P8I A;  1ZM9 A;  5HMZ A;  2U1A A;  3HVR A;  1TAQ A;  3PX0 A;  2ACM A;  1NSK L;  1TL1 B;  3DDK A;  5C25 B;  2CNO B;  3MM6 B;  3MCS A;  2CPD A;  5KFX A;  4QIW D;  4DV1 J;  2E7X A;  1UAW A;  5CYJ A;  1VQ9 S;  3D3B J;  4IO1 A;  4OI3 A;  3VAH A;  4QWA A;  1I94 F;  1Q8K A;  3RRG A;  2QFJ A;  4IRC A;  2G4B A;  4N8N A;  4PPD A;  5C2C A;  4QU7 A;  5F8M A;  1WG4 A;  2G0I A;  1X9S A;  4AYB D;  4KIA A;  1XMQ F;  2KZM A;  4PAB A;  2VBW A;  1DTT B;  4MIW A;  1NK6 A;  3IR7 B;  3KK3 B;  3Q23 A;  1SVD A;  2J7K A;  1V5V A;  3O2I A;  3KLI A;  3DRP A;  2IA0 A;  4IQM A;  4L72 B;  4NLS A;  4OJ1 A;  3DLJ A;  3AOD A;  3K7R A;  4QR0 A;  2CPI A;  2EG2 A;  4WZM A;  1UA1 A;  2MKS A;  3PCO B;  3HVA A;  1H3D A;  4I7F B;  3A8K A;  2NPF A;  2XMW A;  1N34 F;  4BC9 A;  1CUL B;  2V63 A;  3T1H J;  4B3M F;  2YKM B;  3PXG a;  3DKD A;  1HNX J;  2DTJ A;  3TNV A;  5DM7 Q;  3LQV A;  2AX1 A;  3CJK A;  1T7P A;  4J90 A;  2XY5 A;  3D5M A;  3I55 S;  5F8J A;  4NLD A;  3QT7 A;  2X1F A;  1SV5 B;  2IM2 A;  4DPU A;  3NL0 A;  2LA6 A;  3GYN A;  3JXO A;  4RW4 A;  3M1V A;  4AFF A;  1VIO A;  4WP9 A;  5DG7 A;  3NMA A;  2FHK A;  3B78 A;  3DDI A;  3C16 A;  2GAG C;  3MUM P;  3C14 A;  4QIG A;  4ED3 A;  2V2Z A;  5J2P B;  2MHE A;  1Q8I A;  5CH7 B;  1WOP A;  2OP5 A;  4PG8 A;  2HZC A;  2HVH A;  2CNN B;  3FRZ A;  1PCA A;  3IRX B;  1LWC B;  4ID5 A;  4CRJ A;  4IRK A;  2VZ9 A;  4N77 A;  2BE2 B;  5U47 A;  1WG1 A;  4K4W A;  1QAJ A;  2DO0 A;  3GJS B;  3UR3 C;  1MMD A;  4WE1 B;  4ANE A;  4E98 A;  1RTD A;  4L3K A;  1NPR A;  4RPF A;  3K89 A;  3LAM A;  4DG1 B;  3MPV A;  2E1M C;  2MJU A;  2B4U A;  4ECV A;  5FII A;  3LW5 C;  1TL5 A;  3ISN C;  4NLV A;  1IBL J;  1NEE A;  1XK8 A;  3FCW A;  3N5F A;  1DTQ A;  4ZN1 A;  3V81 B;  2MPU A;  1S1W B;  2DKO B;  4ZOS A;  2E5G A;  2E7V A;  2ZC3 A;  2DNN A;  3I0R B;  2AJ4 A;  2CFX A;  2WVF A;  4DX5 A;  1OMS A;  3GR1 A;  4MIB A;  3T1Y J;  3AD8 C;  4M63 A;  2BV3 A;  4LSZ B;  4C97 A;  1XER A;  3S8S A;  2JSX A;  4OYP A;  1W2I A;  3DGV A;  2KT3 A;  2MXY A;  3ILL A;  2W8K A;  2OPR A;  2CVE A;  2WB1 D;  3N01 A;  1BXN A;  5KG5 A;  2BQR A;  1R8H A;  3IC1 A;  4DUY J;  5EUH A;  2K7J A;  4F4K A;  3MM8 A;  5A8W B;  3H4B A;  3ILO A;  1U2R A;  1RLD A;  2NLW A;  4UZC A;  4ZHR A;  3PIP Q;  4YDD B;  3QGG A;  4EI2 A;  1K0V A;  3QPI A;  4KGM A;  4ED2 A;  3V81 A;  1Y9O A;  4LQ9 A;  4YME A;  2QE5 A;  4KTQ A;  1RT1 A;  1CBK A;  1NZ8 A;  2CA9 A;  4CT9 A;  3TP2 A;  3TWZ A;  1XNQ F;  3D1O A;  3SDE A;  1ZPW X;  2Y1J A;  1EAY C;  2X51 A;  4LBH A;  1VIS A;  2XYG B;  5KT4 A;  4DSL A;  3RAM A;  4DV4 F;  4KB7 A;  4CH1 A;  1U45 A;  1RTH B;  3DHX A;  1S0N A;  2YNI A;  1S72 S;  2B8Q A;  3ZZT A;  1HQU A;  3MED B;  3VGU A;  3K5L A;  4DV7 J;  4B9M A;  3NGT A;  1I1G A;  3FRY A;  5E33 A;  5FDL B;  1HNI A;  3DC2 A;  4HEA 9;  1BGX T;  4RW8 B;  2OLW A;  4B08 A;  3MUV P;  2XMU A;  3R9L A;  4Z37 A;  1VBK A;  3M8W A;  2VQF F;  1Z4U A;  3C16 B;  3BSO A;  5KT5 A;  2MQN A;  2OHD A;  1YZ7 A;  2XLI A;  3MZI A;  3M1V B;  3IR6 B;  2KH9 A;  4RW7 A;  3BBC A;  3MEC A;  1RDR A;  4RNN A;  2W2M P;  1FNO A;  2E5H A;  3GFX A;  1DTT A;  3MEE B;  2H1Y A;  3HT3 A;  1S1V A;  1LW0 A;  1T9U A;  2MST A;  4MJK A;  2HQI A;  1EJ7 L;  4RWX A;  2O3D A;  2CWX A;  4NA1 A;  1S12 A;  2C3Y A;  3N6M A;  2PGC A;  4UW2 A;  5E2Q A;  4M5L A;  3IRW P;  1TP7 A;  3HFK A;  3M8Q A;  2W2O P;  5ETM A;  5FD1 A;  4F4Y A;  1U1O A;  4P7T A;  2ZD1 B;  1UEU A;  5M2R A;  4ZJQ A;  4LF8 J;  3UD4 P;  5D15 A;  1SI9 A;  4HHH A;  1RZM A;  1JLG A;  1RK8 A;  4ZVG A;  4XDC A;  1U1L A;  2UXD J;  2ASY A;  1NUE A;  4ZS6 A;  4M5D B;  3R97 A;  1H7W A;  1YSJ A;  3U7J A;  5F3Z A;  2JHE A;  3W61 A;  2OEK A;  2RVJ A;  1S1V B;  4X64 J;  1QUV A;  4NL5 A;  1PSD A;  2ZH1 A;  1C4C A;  1FKP A;  3E51 A;  4K4T A;  5H9F K;  4G1P A;  1R27 B;  5E0O A;  4DPX A;  1ZOT A;  4CO0 A;  4PZV A;  2ZNZ A;  3V4I A;  3GJQ B;  4ZPW R;  4NXM J;  2SXL A;  3GJT B;  4PEO A;  3VGS A;  1KQS R;  1D0E A;  2DR9 A;  2VON A;  1XTZ A;  5FJ4 A;  2HHP A;  4NCB A;  3MD3 A;  2CWK A;  3QJL A;  5HMW A;  4KQZ A;  5I3Q A;  4NEZ A;  3OQ2 A;  4YY3 J;  3M8R A;  1PBA A;  2B9X A;  2CVI A;  4ICL B;  1N56 A;  3OL8 A;  3M2U A;  1E6V A;  3EGN A;  4ZPB A;  3W8P A;  5A76 A;  5D0G A;  1IXK A;  3CC4 S;  2JC1 A;  1IR1 A;  2QL9 B;  1Q7L B;  3TZZ A;  1RAB B;  2MKJ A;  2YWH A;  4EUV A;  1VRU A;  3OSN A;  1S9F A;  3P45 B;  2UUC J;  3PFO A;  3VV2 B;  3FSI A;  2XY7 A;  2HLT A;  3C2P A;  2UXB J;  3EUN A;  3DLL Q;  1VBZ A;  3VTI A;  4OHZ A;  4OX9 F;  3BKF A;  3FJ2 A;  2W9B A;  2G1D A;  3LA0 A;  4K5S A;  4DBQ A;  5D8H B;  2JNJ A;  7AT1 B;  2A6M A;  4AE5 A;  2KYZ A;  2RQK A;  3W9I A;  3ZTQ A;  3T3F A;  3QBC A;  3CD7 A;  1UWA A;  1YJU A;  4KFB B;  3TW0 A;  4IG3 A;  1QSL A;  4FKX A;  4GKK F;  1GH8 A;  4P2S A;  3BH6 B;  2HHV A;  2EWH A;  4H4K C;  1HI1 A;  2JVR A;  1KEK A;  3MEK A;  1NH8 A;  4DL2 A;  4OHW A;  2DR8 A;  4LFC F;  3GQC A;  2R4F A;  4GVB B;  1UVJ A;  1S0V A;  4A4J A;  3JQJ A;  1M5P C;  5KFU A;  1R8P A;  4H4O A;  4C3K A;  4G65 A;  3PHE A;  5L8R C;  1D8Y A;  4K0K F;  1FJC A;  5C42 B;  1HWJ A;  2RDI A;  1RT2 B;  3LP0 A;  1WKL A;  4K4V A;  1K0T A;  5F8L A;  2LCW A;  3NKY A;  3L4B C;  1GX6 A;  2GMH A;  4C0B A;  5I42 A;  2AD9 A;  4PYA A;  3VWS A;  3UDL A;  1RTI B;  4LT6 A;  4MKB A;  1R89 A;  3E8O A;  2CIM A;  3GU0 A;  2IRU A;  2VDI A;  5BXI A;  3K59 A;  4FXD A;  3NCP A;  3SSS A;  5K5M A;  5DG8 A;  2HHH J;  2DNP A;  2P9E A;  3D9B A;  1SKW A;  2Z56 B;  4CO5 A;  2IFX A;  3ZZ0 A;  4OZ0 A;  2OPP B;  2HHT A;  3QLH A;  3J80 U;  2ZBQ A;  4YDX A;  1BMQ B;  2ZKU A;  4OV1 A;  1JXE A;  4ATN A;  5KT7 A;  1Q81 T;  5AE1 A;  3LGN A;  2V67 A;  4UT4 A;  3EZO A;  4P52 A;  1NKB A;  2D69 A;  2R8G A;  3CTR A;  3IP0 A;  4O4G B;  1B0T A;  4S0M A;  2E9T A;  5AJ3 F;  1UWB B;  4DV2 F;  3A4T A;  1S76 D;  4LFB F;  2FVR A;  1RWP B;  3BQ2 A;  2HAI A;  1JLE A;  2APO A;  3DNC A;  2CPH A;  2RF2 A;  2HWH A;  4RW6 B;  3G6E S;  1KKH A;  2G9O A;  1IBK F;  4JI6 F;  1UMJ A;  1PIL A;  4PG6 A;  2FY8 A;  2QFI A;  4QW9 A;  4ECY A;  3IG1 B;  5J2M A;  2MQ8 A;  3H98 A;  6FD1 A;  2XGQ A;  3FSY A;  1NJY A;  3NGS A;  1VBY A;  4ILM A;  2AJ1 A;  4V19 J;  5L1L A;  1AFJ A;  2GCF A;  4ITS A;  3ISN D;  4DU8 A;  3QRP A;  5G0R A;  2GQQ A;  1RAH B;  2D9P A;  4XAK A;  4RUC A;  1T3O A;  1LNQ A;  2UVU A;  1S1X A;  4C11 B;  1X5P A;  4RO0 A;  3POT B;  4R5P A;  1N32 J;  1HBO B;  4BCA A;  1JLQ B;  1LXN A;  4IKA A;  2XMT A;  1HNX F;  2WSC C;  1RXO B;  4Y28 C;  5GAH I;  2IAJ A;  4B3S J;  3T1H F;  3CDW A;  1XWL A;  4ELU A;  2P6S A;  3SQG B;  3T9Z A;  2E9Z A;  3MOJ B;  4J9U E;  4BWJ A;  1PO6 A;  2VAS A;  5SZT A;  1FRH A;  4JI0 F;  1D9D A;  1SB6 A;  2ZH2 A;  2B6A B;  4HI1 A;  3PX4 A;  4ZVH A;  1FES A;  3NOG A;  5F8G A;  2J76 E;  2VHG A;  2NRE A;  1CEZ A;  1M1G A;  2XG8 A;  5DET A;  4O44 B;  2ZZT A;  3UI3 A;  1TVR B;  4CTA B;  4I69 A;  5A6W A;  3R7S B;  3OTO F;  1AB8 A;  3I32 A;  3TUZ C;  2XGP A;  4Q0B B;  5C25 A;  3Q8S B;  2RKI B;  4USK A;  4PKD B;  3U02 A;  3OHB A;  3EGW B;  3CUN A;  5B0F A;  4G1I A;  5ETP A;  2RIL A;  4L75 A;  3AB4 B;  3BM7 A;  3L3C A;  2M70 A;  4NLQ A;  3TO8 A;  2RT3 A;  4P10 A;  4YB7 A;  1FKO A;  5J1P A;  3DRR A;  4C8Z A;  1YRU A;  1F6T A;  3AY0 A;  2UU9 F;  4ZKA A;  4ZVU B;  5B09 A;  1NB2 A;  1U24 A;  5B0B A;  1C4A A;  3BB5 A;  3CMQ A;  2NZC A;  1QVF R;  1U47 A;  4MTP A;  4FP9 A;  2GQ2 A;  4LVO P;  3IXQ A;  2EEY A;  3L09 A;  1A6L A;  2HRT A;  5KG6 A;  5EN1 A;  3PO5 A;  4RBU A;  4CM0 A;  1TAU A;  3OBI A;  4AD6 A;  1WG5 A;  2V4J A;  1ZBT A;  3CCL S;  1DTQ B;  1N36 F;  4ED5 A;  5EWE A;  2NQP A;  1JJC B;  1ZAX A;  3HHL A;  1GNK A;  3PYE A;  2HFS A;  4LRB A;  1FCA A;  4AT1 B;  2HMI A;  3C3L A;  1PYO B;  4DV3 J;  3W1Y C;  3ZNU A;  2AGQ A;  4LRC A;  4KPC A;  3MPY A;  4CZC A;  2VU5 A;  5DJB A;  3M8S A;  1YJW S;  3IGV A;  1DUR A;  1SIW B;  2J9C A;  1X5S A;  3FSX A;  1UTA A;  2GMJ A;  2WAQ D;  3MWB A;  5THW A;  1TUG B;  1V5I B;  1VLO A;  3ITH B;  1FTR A;  4DR6 F;  1IKW A;  2GC8 A;  4M5G A;  3KUE A;  4DWI A;  2HHX A;  4PUO B;  2B4P A;  5ETO A;  1U49 A;  1KR4 A;  3R5B A;  3R1L A;  1N6Q B;  2HQF A;  2J0S D;  2I2Y A;  4O3S A;  4ZDN A;  1FX2 A;  2A0F B;  4Y00 A;  1WI6 A;  3CGI A;  3TYT A;  1M1H A;  2RQC A;  4OYM A;  4J9S A;  3ENQ A;  2AJQ A;  2BQU A;  4USV A;  3R27 A;  3QRQ A;  1HFE L;  3I9V 9;  4O23 A;  2M0G B;  3VAJ A;  3T5K A;  1TKT A;  2LXI A;  1SPB P;  2UUB J;  2KB2 A;  4B3O A;  3H5S A;  2HQG A;  1X8D A;  3IN5 A;  3G96 A;  2ROG A;  2I8E A;  2Z58 B;  4F26 A;  1YJ7 A;  1WWH A;  1M1K T;  3RW6 A;  1V3Z A;  2OTL S;  4OZ3 A;  3KWM A;  4BHQ A;  4JV5 F;  2MJN A;  2UV8 A;  3MMC B;  3BS9 A;  4OHX A;  1CJK A;  3W65 A;  5HMY A;  5SUH A;  5IXU A;  3Q86 A;  2EBG A;  1AA1 B;  4DV5 J;  1N4L A;  4DUT A;  4HDG A;  5DDR C;  5LOQ A;  4JI2 J;  2DGS A;  2GJI A;  4YR2 A;  3KHG A;  2VIC A;  2R7U A;  2B4V A;  1WC5 A;  1NDP A;  3NXZ A;  4X66 J;  4OX6 A;  3HPO A;  4JI3 F;  1WHW A;  2KO1 A;  2Z57 B;  4FBU A;  3I31 A;  5CCL A;  5KFJ A;  4HT5 A;  2IIH A;  3LP1 A;  5KFM A;  2C22 A;  4PUO A;  1J5E J;  5D6G A;  2E44 A;  4CO1 A;  3H5Y A;  1U1R A;  3JTP A;  4QIV A;  2Y1I A;  5D4P A;  4ZVR B;  2B0G A;  3AOA A;  4NAS A;  1X5T A;  1HR0 F;  5CCM A;  2ZJQ Q;  1LW2 B;  2QIF A;  2JRS A;  3UN2 A;  2QYC A;  3AD9 C;  1MNE A;  2H54 B;  4R25 A;  3EX7 B;  2MZQ A;  4PQU A;  3HJF A;  2DNL A;  2LP4 A;  1FKA F;  3FDS A;  1LFP A;  3NGD A;  1WDD A;  5JXS A;  5K8M A;  2ASD A;  2FTR A;  2Y1R I;  1T03 A;  2YWE A;  1PYS B;  3BH7 B;  3J81 U;  3FFI B;  4FF4 A;  3H4D A;  2IBO A;  2L9D A;  5LJ3 Y;  4ZPC A;  1UA0 A;  3UDV A;  4U95 A;  1KC8 T;  4I67 A;  4DR7 J;  2AEJ A;  1HR0 J;  5RUB A;  5LM7 E;  3W5X A;  5B7W A;  3RG6 A;  2YXL A;  5IV4 A;  3KLE A;  4KSE B;  3K58 A;  5HQM A;  1RT5 B;  3PAC A;  1Y10 A;  1Z1Z A;  5AXK A;  4CNZ A;  2OPS A;  4JI8 J;  4RX6 A;  1HW9 A;  1BQM B;  2XMA A;  4DFJ A;  1MML A;  1WEY A;  5HMX A;  3MM9 B;  3I56 S;  3OW2 R;  2C2E A;  4DQQ A;  3OR1 B;  1K47 A;  2EFV A;  1FHT A;  3BGU A;  3V6D B;  1HLW A;  3N0V A;  2XMK A;  1U4B A;  4KT0 C;  2V4J B;  2FD2 A;  3CO0 P;  1U6Z A;  4OMF G;  4E2F B;  1G1X A;  2Z2L A;  1CJU A;  2DPJ A;  3DGP B;  4G6V B;  4QIE A;  1EP4 B;  4Y0F A;  2UVW A;  1JNR B;  2DIT A;  2KXH A;  2FJB B;  3CJQ A;  5HVG A;  3MFI A;  4BBY A;  5DO2 A;  2OKQ A;  4JYA F;  2L08 A;  4A8W A;  2X1B A;  3PFE A;  3VVT A;  1XBW A;  5LMU J;  4QPX A;  3D28 A;  4JB8 B;  3RZA A;  3HZG A;  2JFD A;  1AZS A;  2FLO A;  4TLQ A;  5JMN A;  3VAI A;  3HHD A;  2FB0 A;  5LSR A;  5C24 B;  3R7B B;  1RKI A;  3I5C A;  1RKJ A;  1DRZ A;  2C2N A;  1RQ0 A;  4OZ5 A;  1TFW A;  1TVR A;  2BYC A;  4B17 A;  2DHA A;  2GVZ B;  3L95 X;  3UE2 A;  5E3P A;  4MFB A;  5J2Q B;  2DR6 A;  3A3N B;  2L9N A;  2GQC A;  1N5T A;  3LAK A;  1XC9 A;  4USW A;  2YNG B;  1TL7 A;  2E66 A;  5ETQ A;  2XMJ A;  4OJ3 A;  1BQN B;  2YH1 A;  2RE1 A;  4UOF A;  4RUA A;  4EBE A;  2GVZ A;  3G8S A;  1PJ6 A;  3M2U B;  4LSN A;  2YKN A;  3M6V A;  2F63 A;  4R0J A;  3LGM A;  3JTN A;  2FLP A;  1S4F A;  1RA6 A;  1CQN A;  2D41 A;  4ZMM A;  3BYP A;  3D1H A;  1JJH A;  3EJM A;  2MZ1 A;  3MMA B;  5D3G A;  3CC7 S;  4WP3 A;  4Q7A A;  2UXC F;  2FJE B;  1C1B B;  5IWA F;  3MFH A;  3GV7 B;  4HLB A;  5MLC V;  4M5N A;  5CD4 H;  2W25 A;  3MR6 A;  3UNY A;  5AXL A;  3TJ8 A;  2WOM A;  3D68 A;  4IG0 A;  2M5Y A;  4HI2 A;  3CCM S;  3IFE A;  5A2Q U;  5KFI A;  3AAW B;  1RI7 A;  1Y5L B;  3PRB A;  3SIP B;  1PJ5 A;  4NLR A;  2R2S A;  4FF3 A;  1VRT A;  3GE9 A;  2R7V A;  2DH8 A;  3DCA A;  2YY3 A;  1JLB A;  3CED A;  1QE1 B;  1ULR A;  3D0G E;  2RQ4 A;  2MY8 A;  3QT6 A;  3LPE A;  1KLM B;  1RAA B;  1MU2 B;  2LXU A;  3AA8 A;  3ETO A;  3I87 A;  2N3O A;  5LMU F;  2GIR A;  1C2P A;  3HXM A;  1KFS A;  2YX7 A;  3W62 A;  3NNC A;  1FWK A;  3JSR A;  3VQS A;  4RZR A;  1ZAV A;  3ADA C;  4QU6 A;  2CQB A;  3QLH B;  3QWP A;  1VHI A;  2NR0 A;  1RAI B;  1TL3 B;  1U26 A;  3GV8 B;  5DQH A;  1JLC A;  1N54 B;  4U7C A;  4K4X A;  3BKT A;  2BW7 A;  1RHM B;  3Q8Y A;  4LBI A;  3H42 A;  7FDR A;  5CYM B;  2QSF A;  2DO4 A;  2IDE A;  2NCK L;  3HVW A;  1FDD A;  2DNH A;  1WC6 A;  4C3M A;  2BKN A;  4BS2 A;  2K2P A;  3CCJ S;  3B4M A;  4NCG B;  1A9N B;  2MQL A;  1M5O C;  1N5V A;  2KHC A;  1NAQ A;  4DR2 F;  1PYT A;  4JI8 F;  3LP0 B;  2D9O A;  4I6Y A;  3CMA S;  1QSS A;  1BQM A;  4ZCK A;  1ZAW A;  2QRR A;  1WSR A;  1YG0 A;  3QID A;  3TAM A;  3HHN B;  5IT9 U;  3EVM A;  1GXT A;  4HTJ A;  3G87 A;  1TL3 A;  4EBC A;  2FJW A;  3I6P A;  1RAG B;  1GXL A;  1SBR A;  3K5O A;  4I6A A;  4NMX A;  4HT7 A;  1W25 A;  3MUT P;  2E5L J;  2ZJP Q;  3DLG B;  1LW2 A;  4QWC A;  2QLX A;  1L5U A;  4YHH J;  4CLS A;  1WDT A;  1VQP S;  4KO0 A;  1IUJ A;  1V3R A;  3C46 A;  3N79 A;  4FYY B;  1HKA A;  3EMT A;  3J7Z 5;  1N5S A;  1WF0 A;  1F60 B;  1OQ3 A;  4LR7 A;  4QWB A;  5JVG Q;  5DGB A;  2I5J B;  3QJJ A;  2CXE A;  2W9B B;  5BR8 F;  1H7X A;  1JJ4 A;  3ITH A;  1HNZ F;  1WJ9 A;  3DLH A;  1RT7 B;  1SQE A;  5K8N A;  3KLH B;  2VJU A;  4LBP A;  5D0R A;  2AYG A;  2DBB A;  4JI7 J;  2BJ3 A;  3IBC B;  4N8O A;  5GME A;  2BAN B;  3QSI A;  2FLN A;  2YNF B;  3H5U A;  4EK2 A;  1KTQ A;  3MMC A;  2NXU A;  2PN6 A;  2CPE A;  4FKY A;  8RUC A;  2W9C B;  1I5O B;  2Y8Y A;  3HVT A;  4RW9 B;  3CD5 A;  3DMJ B;  4OIX A;  3OPK A;  2CPY A;  3OL6 A;  4DHV A;  1RWK B;  4RL1 A;  3GII A;  4NLU A;  3QZ7 A;  3KHR A;  4OFZ A;  1WUU A;  4LFC J;  5CYQ B;  1JXL A;  1F2G A;  4OLO A;  4DZ6 A;  1NXI A;  4DU7 A;  5IQQ A;  1F5B A;  2A2C A;  3M8Z A;  2WVE A;  5KFS A;  4XPE A;  2GGP B;  1B0P A;  1RE1 B;  1P6T A;  1UZH A;  2CQH A;  2G13 A;  1FRX A;  2LU1 A;  4R8U A;  4RJV A;  2LMI A;  1MSW D;  4J9L A;  1T11 A;  1RAO A;  3V5R A;  2YNI B;  1G7C B;  3HO1 A;  4YUD A;  3EZU A;  1KP6 A;  4K50 A;  3I5A A;  1FEE A;  1Z2Z A;  4WZQ A;  4M5M A;  1SUQ B;  2FVC A;  5KAK A;  2HVZ A;  4W4M A;  3OHA A;  1ZTW A;  3BQ0 A;  2HQC A;  1VQ5 S;  4ED6 A;  4ERD A;  2Y1L B;  1BWE A;  3SI8 A;  2CQ0 A;  2H5E A;  3FMB A;  3S01 A;  2LFV A;  3I5B A;  2MKI A;  3ET6 B;  1R0A B;  1HHT P;  5HBM B;  2XQC A;  4LF1 A;  4BWM A;  5F8N A;  2OEM A;  2ZE2 A;  2DPI A;  1KQG B;  2PFF B;  2QLF B;  2DT9 A;  2GIF A; 
#chains in the Genus database with same CATH homology
 1S5Z A;  3Q86 A;  1B4S A;  4DUT A;  3B54 A;  2DYA A;  4F4A A;  3ZTO A;  2BX6 A;  1NDP A;  4HR2 A;  1B99 A;  2DXF A;  1NSP A;  1BHN A;  2ZUA A;  1ZS6 A;  2B8Q A;  3EE3 A;  3VGU A;  3VGT A;  3WX8 A;  4S0M A;  3NGT A;  3EIC A;  4UOG A;  3FBF A;  1LWX A;  1W7W A;  5C7P A;  3Q8V A;  3R9L A;  1XIQ A;  1NLK L;  1NDK A;  1NSK L;  3EM1 A;  4W98 A;  4ANC A;  3NGS A;  3G2X A;  3BBC A;  3Q8Y A;  1MN7 A;  2NCK L;  1EHW A;  1MN9 A;  3BH7 B;  1KDN A;  1WKJ A;  2HVD A;  1U8W A;  1NSQ A;  1S59 A;  3FBE A;  3EVM A;  2DXE A;  1F3F A;  1HHQ A;  1LEO A;  2AZ3 A;  1NUE A;  3FBC A;  1K44 A;  3ELH A;  4CP5 A;  3FBB A;  1VYA A;  1S57 A;  3EVW A;  3Q8U A;  4WBF A;  3EVO A;  3ZTS A;  3GPA A;  3EMT A;  1WKK A;  1NDC A;  1NDL A;  2B8P A;  1PAE X;  3DKD A;  3VGS A;  1HLW A;  1BUX A;  2CWK A;  3FKB A;  4O0N A;  4DI6 A;  2AZ1 A;  1F6T A;  5CAA A;  3MPD A;  3BBF A;  1NB2 A;  1JXV A;  1UCN A;  3DDI A;  1NCL A;  3JS9 A;  4EK2 A;  4C6A A;  4FKY A;  1XQI A;  3Q89 A;  3VVT A;  4F36 A;  3ETM A;  4ENO A;  3BBB A;  3VVU A;  2DY9 A;  4DZ6 A;  4ANE A;  3ENA A;  3VGV A;  3ZTQ A;  3NGR A;  4KPC A;  2VU5 A;  4FKX A;  3L7U A;  3PJ9 A;  3FCW A;  3BH6 B;  4AND A;  3FCV A;  4UOF A;  3NGU A;  2HVE A;  1BE4 A;  3FC9 A;  5IOL A;  1PKU A;  3EJM A;  1WKL A;  5CAB A;  3Q83 A;  3ZTR A;  2BEF A;  1NPK A;  5BXI A;  1HIY A;  1NHK L;  3PRV A;  3B6B A;  2DXD A;  3GP9 A;  4UOH A;  3ZTP A;  2HUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...