1FDAA

Crystal structures of oxidized and reduced azotobacter vinelandii ferredoxin at ph 8 and ph 6
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of oxidized and reduced Azotobacter vinelandii ferredoxin at pH 8 and 6.
pubmed rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport(iron-sulfur)
molecule keywords FERREDOXIN
total genus 34
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1993-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fdaA00
1FEHA 1H7WA 1FDNA 1FD2A 1FRJA 1FRLA 1GAOA 7FD1A 3MM8A 5E7OB 4RKUC 1Y4ZB 2PA8D 2C42A 2C3MA 2V4JA 2PDAA 5CH7B 1PC5A 2FDNA 3HKZD 1B0TA 1F2GA 3C8YA 1F5CA 2WB1D 1B0PA 1IR0A 3MM6B 1FF2A 2Y0SD 1PC4A 2XSJB 3MM5A 1D3WA 1GTHA 1FXDA 1FRIA 2FGOA 6FD1A 1CLFA 5CHCB 1JNZB 4XDCA 2VPWB 2VKRA 4DHVA 2Z8QA 3LW5C 3MMBB 3MM9B 1VJWA 5BYQA 1SIWB 4XDDA 1JB0C 1BC6A 1F5BA 1K0TA 1FRXA 4Y28C 1SJ1A 1C4CA 1B0VA 1DAXA 1Q16B 1AXQA 1WTFA 3OR2B 1Y5LB 2VPXB 4XK8C 1GT8A 1H98A 3EGWB 1A6LA 1Y5NB 1R27B 1C4AA 3EXYA 1H7XA 3PNIA 1FERA 3MM8B 1DFDA 1FRMA 3MMBA 1Y5IB 1KQGB 2C3UA 4CI0B 1BD6A 2FJEB 2GMJA 2FJAB 1ROFA 5FD1A 1FTCA 4OV1A 2GMHA 5BYSA 5BYRA 1KQFB 3MM6A 2VPZB 1HFEL 2V2KA 3GYXB 2XSJA 2O01C 1JNRB 2VPYB 3MMCB 2UZAA 3MMAB 7FDRA 2WSCC 4ID8A 5L8RC 1FRHA 2PMZD 4KT0C 4AYBD 3IR5B 1FDBA 4OMFG 4YDDB 3OR1A 3EUNA 3MM7A 1FDAA 1H0HB 2WSFC 3IR6B 1DURA 2WAQD 3IR7B 2C3OA 1G6BA 3MM5B 2C3PA 1SIZA 1BLUA 2ZVSA 4L6V3 1FCAA 1FRKA 3MMCA 2FD2A 6FDRA 3MMAA 1FDDA 1FXRA 1GTEA 3MM9A 1G3OA 2FJBB 1XERA 2V4JB 2FJDB 1RGVA 3OR1B 1KEKA 3MM7B 2WSEC 1BQXA 2C3YA 1IQZA 3OR2A 2IVFB 1BWEA
chains in the Genus database with same CATH superfamily
2PSZA 2NPIA 4XAKA 5HROB 3KHHA 2QGFB 1VQ6S 4DG1B 3QZ7A 2Y9HA 1P6TA 2PT0A 4OX9F 5KFWA 2EWHA 4C0OC 3M2UA 1G7CB 2DTJA 4RNFA 1G4CA 3E2EA 4KIAA 2F9JA 4C97A 2IA0A 3HJVA 1V9OA 1S77D 4ECYA 1L3KA 3U1MA 2GHPA 5EX0A 1NK7A 5CXTA 2AZ3A 2Y3YA 5E33A 3FJ2A 2OFGX 4LQ3A 2POKA 2JHEA 5D78A 2MKHA 3R1HA 3UD5A 4ECWA 2MDAA 3IRWP 3QT8A 3EWGA 4C98A 3H25A 4LF9F 5LMUF 4JI1F 1FF2A 3DDIA 1N0VC 2KN4A 2KKHA 5E3AA 3J7Z5 2RU9A 5I42B 2XB2D 4G6VB 2FGOA 5DDRC 1VBYA 1B70B 2D41A 2VG7A 1GMUA 1SC4B 1VDHA 3EZUA 4PAAA 5D0HA 1KQSR 1JNZB 4PG5A 4JI6F 1SXLA 3DI6A 4ETZA 4DV1J 4DV5F 5KG7A 1T7PA 4DU7A 3NAHA 1N4LA 5ADZA 1NKCA 4B3TJ 4TYBA 3KDOA 4AT1B 4N5SA 3RAQA 4FYWB 3HJFA 2DY1A 2DR6A 2K3KA 1RYSA 1XNQF 2VUGA 2BE2A 2KRBA 1Q0NA 3BH6B 1K1QA 4RU2A 2ABYA 4F0MA 2IY5B 3MCSA 1Y10A 1Q5YA 2G13A 3OFEA 3MOZA 5SUHA 4DQQA 2YKPA 4NEZA 5HROA 1NB2A 2CFXA 4ES1A 3QAEA 1HNIA 4DR3F 1XWLA 4DR6F 2ZH4A 1TZ0A 3OFFA 1N52B 4ZCMA 1JMTA 4J9NA 4NXNF 3AD9C 4NPOA 5IC6B 1SL2A 4CLSA 2XEXA 3DOKA 1HBNA 1KD1T 4EGLA 2X1AA 1YTYA 3ENQA 2HW3A 1TL1B 1Y5IB 2G0JA 2R4FA 3MF5A 5FDLA 1KONA 2XC9A 4K4UA 4RUBA 2ZNYA 1RP5A 1X7VA 2EG2A 1YZ7A 5DJBA 4QBUA 1UW4A 1PJ5A 2JJ4D 3GJSB 2NS1B 5DLGA 1H38A 1AFJA 5BYSA 2GJ2A 2ZHBA 2MGZB 1N5YB 1HD0A 4F7VA 3W9HA 2FHMA 2NPFA 5KG3A 4ALZA 4UOFA 3QGIA 5U47A 3DLLQ 4CCHA 3ILIA 4C4WA 5LJ5Y 2WVEA 5EX3A 1MMLA 2O01C 2DRAA 4DFKA 1EX8A 5IT0A 7FDRA 3RGIA 2RAQA 2J9DE 3I6PA 2B43A 2MYFA 5A8RA 1TUGB 2MEWA 4FZVA 4N56A 3KUEA 4AYBD 1UWBB 4ELVA 2DT9A 1REGX 1P9YA 5DG9A 3Q86A 3OR1A 4Y2KA 2RF2A 3C6UB 1FFWB 1OPIA 3MM7A 4ZS6A 4MFBA 3MXHP 1A9NB 3Q8UA 2R8IA 5D4LA 1G6BA 2JC1A 4MJKA 4O4RA 1R6YA 3NXZA 2DNNA 3RG6A 2AJQA 1DY3A 2VQFF 3M8PA 3VGTA 3RW6A 5KFGA 3JSBA 2BJ9A 3PR5B 3MR2A 3KJNB 2AJ2A 4PKDB 5DDPC 3HF5A 2XNQA 2FTRA 4TLRA 1VLOA 5LOQA 2OAUA 4LF5J 4WP9A 1HBNB 5HK4A 3RB0A 1TKXB 2QLBB 3UDLA 5GAHI 2MLYA 3IBCB 3KJFB 4X66F 4FS1A 3OSPA 4O3NA 1KEKA 2RF2B 3C6UA 3JSYA 1VR6A 2OMOA 1ZOTA 3MM7B 3T9ZA 1T9UA 3NWRA 3UQSA 4WKYA 3Q8SB 2UXBJ 3EVWA 3ZZPA 1KWMA 2P9CA 2OSQA 4H4OA 4UW2A 5HLFA 4BDPA 3H40A 1FDNA 3V2UC 2GW8A 1FD2A 1S59A 2MY7A 1JLGA 1XEZA 3BQ1A 1H6KX 1XR6A 3HLUA 1KSPA 3CMES 1H2VZ 4MKBA 1AZSA 3A8KA 2RSQA 4RKUC 3G8QA 1Q4RA 4DV4J 4FS2A 1RHUB 1JLBA 1TR0A 3E3XA 3PX4A 3NWGA 4U67Q 4C8LA 1DTQA 3V6DA 3HHEA 1M5HA 1PC5A 2EPIA 4B9TA 1WHXA 2OD4A 2OKQA 3NLCA 4KO0A 1OY8A 1T95A 4IKAA 4MH8A 2J8SA 3UNYA 4DPOA 2I1RA 5KG1A 2CQPA 5C24A 3T41A 1RHQB 5I3UB 1IR0A 3DHWC 3OTBA 3RB4A 1K9MT 4EWTA 3PW0A 1C1BA 2XHCA 1N34F 2MMYA 4O3RA 3G71S 4OYBA 5LSRA 1LW2B 1NU4A 4QW8A 1NBEB 3U1NA 1VC5A 1CLFA 5CHCB 4DL3A 3N9UC 3NL0A 3G9CA 2ZDOA 3KXDA 4DCJB 2LCWA 3DMJA 3ZTSA 3MM9B 2W9CB 1U09A 2OPRA 4CO5A 3DYAB 4X4SA 2GHVC 1XMQJ 2ALZA 3L9ZA 3GJQB 2VDHA 2CPHA 1I94J 1RHRB 1WF1A 4B9UA 4TY8B 4DLEA 5C24B 4NLUA 3QO9B 2I38A 2XGPA 2FC9A 2UV8G 5DRKA 1N33J 3B78A 2VQEF 3AJ1A 4FYXB 3CJ0A 3BKTA 3JSRA 3VWSA 1S10A 4OI1A 2BKNA 4H4MB 4QIFA 1CQMA 2A0FB 4NMXA 2XZTB 5IZHA 5HP1B 3HVWA 2YX4A 3JQMA 4LSLB 1FNXH 1NHVA 3ITHB 2DCUB 2Z58B 4WYWA 1VBXA 1Y0HA 1BD6A 1Z4UA 2E7WA 2IIHA 2GMJA 3CULA 1CJTB 2E1CA 2Y8YA 2XZWA 4X4VA 3EDRB 1JJCB 5A2QY 5CD4H 4FF3A 4CTAA 3I56S 3NS6A 2YQ1A 3LP0A 4IG3A 4TU8A 3GYXB 4ANCA 1LV5A 2HRTA 4JI1J 5D3GB 2M88A 2ZBPA 1UPPA 3CIMA 2HHHJ 2UP1A 2FHJA 3JYTA 2KZZA 3MEEB 1FJCA 4DSJA 5D0RA 2ZC4A 1HYSA 2DK2A 3LPEA 3MWBA 4HH1A 2IRXA 2QRRA 2UUCJ 1U8SA 4OX8A 3M8QA 2HFZA 5L1KA 1RU2A 1TTHB 2DYAA 3WC2A 1LWEA 2PEHA 3FVYA 4JI3F 5CYMB 3G82A 2FHJD 1P1TA 2WOMA 1OQ3A 4MK8A 4YHHJ 1WACA 3D66A 2UUBJ 4LFBJ 3WHIA 4DPXA 2XO6A 3L09A 4RW8B 3D9BA 3EZOA 4KGVB 2OPSA 4CYUB 4KFBB 1JLFB 2CWKA 2IM3A 3IS9A 3P49B 4HHUA 2AF6A 1TKTA 5F3TA 1VQYA 3OXLA 3KJQB 3MPDA 3PCOB 2DNYA 4WCEQ 3DLKB 4NLSA 5KFLA 5KG0A 1TL5A 2J0QD 1VRQC 4LBPA 3QJPA 5IV4A 4ZVEA 4CO2A 1S79A 5HMWA 5IXUA 1TELA 1HBOB 5AE1A 1ZH5A 4CLUA 3IG1A 3QFHA 4JYAJ 4DR6J 2W8LA 2ZEJA 3KK1B 3FBCA 4HKQA 3PRVA 2OPSB 1O6XA 3UD3P 1YGYA 2YWEA 4NLWA 4ERDA 1S6PB 1H74A 2R2TA 3CXCR 3VAJA 4A48A 1FI4A 4LF4J 2JC0A 1RTZA 3SI8A 5KFFA 2CPDA 1CS4B 1K44A 1Q53A 2BKPA 4LF1A 4WP3A 2MSTA 3WX4A 5AJ3F 5F9NA 2CQDA 4F3QA 2FZKB 1RT2A 2VBXA 1N34J 1RT3B 4ITSA 4P71A 4HDGA 4JI8F 4ER8A 3MOJB 4DR7J 1WI6A 4ZLJA 2C2NA 2NYHA 5CYMA 5IM0B 4EBEA 3U27A 3MM6B 3CCLS 5LMNF 2HG4A 3PYFA 1B3TA 1MROB 4BWJA 1RU1A 1NRKA 1GMVA 2HVZA 4H4KA 3ZZOA 5J1EB 2XMJA 3TZXA 2W9AA 2F7VA 2I6WA 1T8EA 3RRGA 4IH6A 2CPFA 4WTOB 1U45A 3HSDA 2KFYA 1KP6A 2B5JB 1NNDA 4JUZA 4ZDNA 2ZJPQ 5BYQA 1IBKJ 3ONQA 3C14B 4NMLA 3T5KA 4LSZB 1F5BA 4OHVA 5A0YA 1RTIA 3VHQA 4LF6J 2XS2A 3MHYA 3H0PA 1YHQS 1UW9A 1KLMB 5F8GA 4HACB 1IKWA 3M1VB 3HCXA 4X62J 4OV6A 1CC8A 4OZ2A 4UOCA 3J7YU 3PV8A 1H98A 3J80U 4X62F 3VVTA 3Q2TC 3DHXA 1A6LA 2HWTA 1KVJA 3SCKE 1T03A 1VQ8S 5FJ4A 2VA2A 2KDOA 4A8MP 3DN9A 4ZVOB 1HBMB 4L76A 1QJHA 3MMBA 3KLFB 3KLVA 3D6FB 1HBUA 3DYAA 5JVGQ 2VG5A 3ADAC 4QR1A 3NGKA 5DLFA 3QZ8A 2J0WA 2ASJA 5A0YB 1ROFA 5IT4A 3MEDA 3I4PA 1YBUA 2ZH2A 1HNXF 2IFXA 1IN0A 2D74B 1RT4A 5HQLA 2MQOA 2BOPA 5T41A 1Q8LA 3T5JA 2OEMA 1NSAA 2JZ5A 2BBEA 4C3LA 4DLGA 2LQJA 1RT7B 1JLQA 2DO4A 1U24A 5B0GA 3SYZA 3PKMA 1HWIA 3W65A 3NGSA 1RHMB 3SQGA 2H4YB 1YJNS 3OJSA 1FJ7A 1VS3A 2F40A 3PIPQ 3I9V9 2F8MA 5HMZA 4OZ0A 5D77A 1FRHA 1M5OC 5IQQA 2HRYA 2VICA 4ES2A 4FDFA 4CM2A 1APSA 4AL6A 1M90T 2BJ3A 1OSCA 1J5EF 1QSSA 3R97A 1V3SA 3TWZA 1C1CA 5GMEA 3L7UA 3DLGB 4WK3A 4JI0J 4HI1A 3WBZA 1YWXA 2LDIA 2YNIA 5AT1B 5DETA 2P6TA 5EWFA 2R8KA 3HK2A 5IC4B 3DLJA 2WB4A 5KT4A 2JEIA 2V8PA 2HBYB 8RUCA 2FVPA 1Y7PA 2CQHA 2LVWA 3A1YG 4ECTA 2FQQB 1RT5B 1S72S 4WE1A 4JI3J 2KVIA 1FK9A 1TK0A 4URSA 2E9TA 3IBWA 3POTB 2UUAJ 4JP8A 4PG4A 4X64J 1E6YA 2IAJA 4LQ9A 5BR8F 1NJZA 4WXOA 4R5PA 2DGOA 4GC7A 2F1FA 1CJUA 4I56A 4X4UA 1GNKA 2MHNA 1NH7A 4RO0A 1C0TB 1KC8T 4ZLPA 2UU9F 1FJGJ 1H7WA 4AL5A 2DNMA 2PMWA 1TV6B 3ULHA 4OHYA 4QPTA 3GSDA 3U1LA 4YB5A 3W5XA 1X5SA 3CWJA 1WHVA 2JLGA 1LK5A 3RR7A 2YBVA 4F50A 5FDLB 4YUDA 4W92B 3RW7A 1T9YA 2V8HA 3V4IB 1YJWS 4NLOA 3HVRA 2ILYA 5BJRA 2OUGA 4KY3A 2R8HA 5F9LA 3A12A 4YR2A 2V68A 2AX0A 1F5CA 3N01A 1FFGB 2VKZG 4BCAA 1HL6A 3EICA 4J5OA 1IJFB 3SQOP 4CDIA 4XPEA 4N41A 3IWNC 5J2NA 4DV3F 1B99A 2AZ1A 4DJBA 3VTIA 2J9CA 2IBKA 3ILJA 3AQPA 1UEVA 3HSGA 3M32B 3MD1A 3LF0A 8ATCB 2HEKA 1K0VA 2J9DA 3V6HA 2C28A 2BQRA 5KT3A 4I2QA 4NCGA 1UP1A 1QUPA 1EP4B 2RE1A 3BF4A 3N79A 4QOTA 1RWXB 4DMZA 2L9NA 4EFAC 3MR6A 4G65A 4ZPBA 2C2DA 2CDRB 1J5OA 1WOSA 2ALYB 1HIYA 1SI9A 3ZTRA 5J2PA 5LL6d 1IBMF 4A4JA 2Y0BB 3FBFA 4MIWA 2DGWA 4EBCA 3OTDA 3HP6A 1HNZF 1Y5LB 1QAJA 4DV2J 4P2MA 4C11A 2WZ1A 3IP0A 3M8PB 5J1EA 1YJTA 3BBFA 2AIRB 2M5YA 1F0XA 2CNNB 3AT1B 2EKNA 1QTNB 3IBFB 4CNYA 5GAGI 4IH7A 1FWLA 1RWVB 2HFVA 2HHTA 2DGQA 2DPIA 2GX8A 4EYIB 1PKUA 5E0OA 2XQCA 3CCWA 5B08A 4KHPF 1KQGB 2VFSA 2KFNA 5C2GA 3V4MA 2FC8A 2QLWA 2ATLA 1JLAB 1RDRA 1RCXB 1PO6A 2QLXA 2A2CA 1G1XA 2FJAB 3B4DA 3EGNA 3ZTPA 1RAGB 1VQOS 4EYHB 1VIXA 2V6AA 2JFKA 3F0NA 4HACA 1T3NA 4IO1A 2RDIA 4ECZA 3DLHA 1NPKA 2OHDA 1KQKA 3D0IE 4B3RJ 2O3DA 1ZA1B 2ZOMA 2AJFE 2CQ4A 3DKDA 1T9TA 2B51A 4WFZA 2B7CB 3FQKA 4C48A 4Z2XA 3MR5A 2CJKA 3NOGA 2V4RA 2HMIB 3N6NA 3BO4A 5IWAJ 5LXYA 2J6TA 4DR1J 1HBMA 2CZ9A 3AD8C 5IWAF 1ZPVA 2EBGA 4FP9A 2KU7A 4ED4A 3OJUA 5KT6A 1D09B 3TVKA 3KLGA 4PUOB 1YG0A 4PEOA 4QYZJ 2EI5A 1S1VA 4LBHA 3QSYB 2ZJRQ 2O1PA 3GLJA 4WFAQ 2LQ9A 2BE7D 4U96A 9RUBA 3HD1A 2MQQA 2AJ4A 2VBZA 1S7HA 2BZ2A 3IR7B 4U7UK 4LBIA 4ZIWA 2Y1IA 1PCAA 2MKSA 3IN5A 1RWUA 1K1SA 1SIZA 5AE3A 2BR0A 4C11B 2YXLA 5L39A 3CCES 1NK9A 1QLNA 2QTWA 3AA8A 2NREA 4YFUA 2V34A 3H8YA 3MMAA 2ZH6A 1GTEA 4DSKA 3K5PA 3D6TB 3FRZA 4RZRA 4DPUA 4LFCJ 4LMZA 2HVIA 1N0UA 1CSJA 4EO6A 3DFEA 2AU0A 1H72C 1O51A 2M3DA 4DL0C 4NZ7A 5CYJA 2HYIB 4LF8J 1DBDA 4P7VA 2OH2A 3HVTB 2IJFA 3Q8YA 3Q89A 3J7ZT 3CDAA 2XMWA 4N47A 4B3OA 3A3OB 3FZ2A 3CJ5A 4HH0A 1V5IB 5MLCV 1HW9A 2CNKB 2VF3A 3HSZA 1M5VC 2Q43A 3T19A 1H73A 1IBLF 4YEAA 4ECVA 4LFAF 2B4UA 3RB6A 2E9RX 2AWZA 1YIJS 1T05B 1GAOA 4OYOA 3MM8A 4J7CA 4IYQA 2BXJA 3C16B 5L1LA 5I3PA 2JEJA 2K1RA 2AHOB 1WF2A 1FA0A 2FHKA 2CVEA 2D3OR 1SJ3P 4JI5J 2IHR1 3BSAA 5ETKA 1KVIA 5C25B 3DOMB 1DJ0A 3DOLA 2DR8A 4K50A 1S1VB 3QT7A 1HNZJ 2MKJA 1GEHA 4WFYA 4ED6A 3TAMA 3SEOA 1GH8A 1B0PA 3TO8A 2W01A 1KOOA 4NE9C 4PXCA 1NMEB 2Y0SD 3S7RA 3SSRA 2QMWA 3G8SA 1KHVA 2PA3A 3PFOA 4IDKA 2Y1JA 1FRIA 4TXSA 4ZK7M 4Q8FA 3V6JA 1WUUA 3P4UB 1RTDA 1VC6A 4KSEB 4X4TA 2HZCA 4ZP6A 3LGHA 3NBPB 3NY0A 3EZ5A 4J91A 1HPZA 5HBMA 1S0MA 2R9LA 5GADI 1RAAB 3NOCA 4O3SA 3KLFA 2DGTA 2DH8A 3FNNA 3OXFA 4QYRA 3TP2A 2H5JB 4V1Ak 5JJBA 2CRLA 3JS9A 3MEGA 1TMJA 2R2UA 4EZ9A 2HBZB 3DRXA 2R8JA 4ZLLA 1B7FA 2J5AA 3RRKA 2P9EA 2J8AA 2KL8A 4IG0B 3T6JA 3CCJS 4I6YA 1V6HA 2ZOFA 4H4KC 4B9NA 4ES3A 1F9FA 3IMQJ 1X0FA 3FC9A 4IDKB 2UVRA 5IOLA 1XIQA 4UQGA 1RAIB 4PCQA 5H9FK 4GKKF 3E01A 3IA0A 4KBIA 1UJ6A 4JV5F 2V8DA 3DRPB 1ULRA 3BGUA 4CT8A 4I64A 4ED7A 5KFRA 2V9WA 2UXCF 2XTJP 4MIBA 2YWGA 4OLOA 2E1AA 1NZAA 3DXBA 1HKAA 2F9DA 3HFKA 5DS7A 2Z2LA 2W2PP 3N5FA 1HBOA 1R8BA 2FJEB 4USHA 2UU9J 1BWVA 3I55S 4LF8F 3BR9A 3OTEA 3US5A 4FF2A 3ZZUA 3LP1A 4QWDA 1VYAA 3H2UB 3P45B 3JAMY 1U49A 1Q7LB 5D4NA 4WZQA 3GMGA 2DNGA 4P2XA 1U8WA 3AA9A 1A7GE 3CCSS 4A8YA 1IR2A 3HZGA 4DI6A 9ATCB 2YNIB 3MPVA 4JI7J 3DU5A 4O0NA 1X4DA 1X4EA 5EGYA 5LSLA 3W9JA 5F8LA 5KFQA 2X1FA 4ID5B 1FWKA 4LIWA 1LXNA 1YX2A 1SC6A 2WSCC 3DLEA 2KRRA 4P73A 5L8RC 4KT0C 3GIJA 2HHXA 4PXEA 1LWFB 3BZQA 2J6UA 3POTA 3FUYA 2H9ZA 3GE9A 3N4WA 3M9NB 2XYGB 3GIMA 2FVRA 4E2FB 4JI5F 2CPXA 4WU2A 3SXLA 1A0OB 2LMIA 2QLJB 2WVCA 3QO9A 4CP5A 1TUVA 3CJ2A 1HNWF 2C3PA 3B4MA 1WKJA 3R5GA 4DR5J 3R27A 2IVYA 2IA6A 1LXJA 1UWAA 1BQMA 3MMCA 2FD2A 2JVRA 3O5TB 2ZE2B 3IWLA 1R8HA 2MKKA 2MJUA 1KBRA 2E1MC 4NL5A 1VQ7S 4C8OA 3BGOP 5K14A 2ROGA 3SV4A 3C14A 2PEBA 5F41A 1TL1A 1UJ4A 4NRUA 4YB7A 2EFGA 1YSJA 1BY9A 3I5AA 3OPKA 4DN9A 3VAMA 4DV4F 3D28A 1IVZA 3IWXA 3ZNJ1 2G0CA 2DNQA 1IKWB 1WC3A 2R42A 3M1VA 1ACMB 5BR8J 1XBWA 1FX4A 3PHTA 1S7IA 3GU0A 2W2MP 5A6WA 4EI2A 2DR5A 4IFVA 1BWEA 2VU5A 1NDPA 1RACB 3K5MA 2KJVA 2IPOB 3BDPA 1NJYA 2XGQA 4I7FA 3I0SB 4BS2A 1NDCA 3AY0A 2ZOGA 2ZE2A 5KT7A 1XK8A 2PI4A 4N8NA 5K8OA 5KG2A 2AMCB 3OL6A 2GAGC 3ZNUA 1ZTTA 3DLBA 3SCLE 5D6GA 4FKYA 3O1LA 5ETTA 4X4OA 2A10A 1EAYC 2XM3A 1SJRA 2FDNA 4RPFA 4Y2IA 1F3VA 1LNQA 3J81Y 1Q7YT 1D8YA 3ETOA 1PYTA 1WDDA 3K58A 3HMJG 1IBMJ 3UO0A 4LFBF 3R1LA 1U4BA 2HIYA 1QAIA 2LYVA 3DRYA 2L48A 4ECUA 4ECSA 2XULA 2M7SA 3GV7B 2CKWA 4TKTA 4ZN1A 4LRFA 2BJ7A 4X2BA 2O5DA 2EC2A 3Q24A 3IS9B 2VPWB 4I1TA 2EKYA 1S57A 2K1RB 3GFZA 3TEHB 3HT3A 4FBUA 4KPYA 3K5LA 1RB0A 2YNGB 2VBYA 3FSYA 5HO4A 1HI0P 2J6SA 2VONA 1VQLS 5K14B 5AXLA 1F60B 3DOLB 4OYIA 2CZ4A 4USJC 3G96A 3D6MB 2E5LF 4X4NA 4DR4F 3NKYA 2JNJA 2R3VA 3QIPB 4I2PB 4DFJA 1AXQA 3T1HJ 1IBLJ 1HI8A 4JYAF 4ILLA 1UFKA 4KAIA 1JKHA 4ZJOA 3MUVP 3HXMA 4F4KA 1S9EB 2J0SD 2JEFA 5KFYA 3OXGA 2ZHAA 1YRXA 5C7PA 1U7LA 4D3HA 3VAKA 2VODA 2DKOB 4HDHA 4LRAA 3CPWR 2R7UA 3A4TA 4QR2A 4WZMA 5D8HB 3DXSX 3QLHB 2IJRA 1F9EB 2W7AA 1VQ4S 2FJVA 3M8SA 1FRMA 2AYMA 2OPRB 2YKAA 3FFIA 1CJVA 3ISNC 1ZTWA 4UZCA 2QV6A 1QY7A 4P75A 3UR3C 4KHPJ 4FXDA 3UE2A 1K73T 1DLOA 3GWCA 4M5KA 5FD1A 3PX0A 3SZ2A 2CG4A 2ZJQQ 1OMSA 2VQEJ 1LWCB 1N88A 1NHKL 1RT6A 3BEGB 3MPYA 4GRSA 4IQMA 3OBIA 3TA0A 5IM0A 4HLBA 4OFZA 1C2PA 1TK5A 1RYRA 4C8KA 2QX0A 4DCPB 4HR2A 1YITS 2NUHA 4G1QB 1RE1B 3OV7A 4NCAA 1HQUB 2OD6A 1X4CA 3FDSA 3K8WA 2CJXB 4GO7X 2KHCA 2ZWPA 2BRKA 3ILLA 1R8PA 3GYGA 1SKSA 1D0EA 1NPRA 1FK9B 3UR0A 4XTTA 2D3O1 3GILA 3M2RA 2LXUA 5KFZA 2HNDA 1F1BB 2Q6BA 2B7BB 1X0PA 2WSFC 3ZFVA 3BSNA 2X7IA 3IFEA 2HS0A 2DHSA 2DIUA 3CJTA 1SKRA 1JX4A 3L4BC 2G2OA 1WNEA 7AT1B 2NZ4A 2VG7B 5EDWA 3ILOA 4IOAQ 1X5OA 4ICLA 3M6VA 2ZVIA 4PR6A 4C0HA 4TQRA 1T05A 1WF0A 4ANDA 3QPIA 4M5IA 3BPDA 4UY8T 5KFIA 8AT1B 2DBBA 2FLNA 3K5NA 3UFCX 1R0AB 1JLBB 4HHHA 4USTA 2XSFA 3AQOA 4L72B 1NSQA 3ZTQA 5A8KB 2JEGA 2BE2B 3PYEA 4LFCF 2R7XA 1W7WA 3CJKB 1BQXA 3SMZA 1VGYA 3LWLA 1O5JA 2I8EA 4OHWA 3Q23A 1S1WA 1VC0A 4KGZB 4U7UD 4WKRA 2ACMA 4OYMA 3I96A 4O3QA 2LECA 3L95X 1N6QB 2Z56B 1DQ9A 3OQ2A 1BUXA 2YH0A 3EVMA 3D54A 4KC5A 5L9XA 4DPWA 4DL2A 1T3OA 2PGCA 2OJ3A 1OYDA 3LP0B 2LXIA 4IG3B 2YX7A 2MKIA 3KLEB 4B3SJ 4C3KA 2ZNZA 3D6HB 4RWXA 4XPCA 1ELOA 1PBAA 3SQGB 4NA1A 5DM6Q 1M5KC 2VB6A 1EP4A 3IXQA 3O3LA 4DX6A 3Q8PB 4F2SA 1KOHA 2HS3A 3F73A 2PDAA 3CDBA 4OZLA 1LOUA 2NQPA 1NK8A 2CNLB 4WJBA 2XLIA 3M8QB 2K8GA 2FLOA 3R5AA 3C8YA 3QQCD 4LF9J 4G3IA 1HNWJ 2HVEA 5C5JA 2CG8A 4USVA 3M7VA 1R6VA 4PYAA 4B3RF 1D3WA 2XWYA 2Z57B 2AGQA 4EUVA 2RQCA 4NX9A 4XO0A 1PYSB 1S6PA 1SUQB 3R6GB 4NI2B 1F9HA 3PZPA 4FPRA 2H65B 1KHWA 1NCLA 2IYIA 4KHMA 2BMBA 4AFFA 5K8MA 1WKLA 1FVQA 1X8DA 1NLKL 2KI2A 1HI1A 2QN6B 2LEAA 3TOQA 4K8RA 2N3OA 5CD4A 2OFHX 2DISA 5A8KA 1CBKA 4Y28C 4RR5A 1SJ1A 3KOAA 4N8OA 1B0VA 3HI9A 1T9VA 1NH8A 2DVIA 3PTWA 2I9SA 1FKOA 4P10A 3W8GA 2RB7A 5H9EJ 2AGPA 1VRTB 3TEGA 2XS5A 2VPXB 1HD1A 1RWPB 3CIZA 1QM9A 4WFXA 1JLEA 4OHZA 3GJRB 3TVYA 2RH3A 4ZVTB 1S12A 2D9PA 2XO7A 2KYXA 2VFVA 1RXOB 1Y5NB 2YX1A 3NCPA 2R2RA 5EUHA 1VRUB 2RRNA 2JOQA 3R5JB 4HEA9 2L3MA 4MT1A 4QIGA 3VALA 4K0KF 5KFPA 5B0FA 3KLGB 2W9BB 1CS4A 1IJEB 2ZBIA 1HMVB 2V94A 3GB0A 4M5JA 3KNGA 3OTOF 5T14A 3N0VA 2B9EA 3QIPA 4I2PA 1KLMA 5KFVA 3BB5A 4DBQA 1EETB 4URQU 2OI2A 2RNEA 4A47A 2A6OA 2VOOA 1VOMA 4DQRA 1S6UA 4FNHA 1H2TZ 1WEXA 2BQ3A 3GR0A 2XSJA 3LP2A 4TN2A 4DPYA 2RS2A 1AFIA 4JI7F 1BQMB 3MMCB 3CVKA 5CCMA 3GIIA 4IRKA 3QLHA 2HRUA 3FMWA 2QIFA 5L9NA 2N82B 3VF0B 3OHAA 1U2FA 2ZKUA 1N56A 1UJ5A 3F41A 4DQIA 1BGXT 2YTCA 3PO5A 4LF7F 4YDXA 4L3NA 4Y34A 4LRBA 4MKAA 4JI6J 2DRBA 4KO0B 5HQ8A 4IQXA 2XLJA 3KYLA 1Q82T 2RU3A 2H51B 2ADBA 3C3LA 4Q43A 3IG1B 5JMNA 3IR6B 1LWCA 2WAQD 3KLIB 1C1BB 3KUGA 4USUA 3ICLA 5D4OA 4K4XA 1HW8A 2V8GA 5I42A 2KM8B 4FF4A 4WF9Q 2C2OB 3TQ1A 2VJVA 5A2QU 1RTDB 1FRKA 2RHQB 5LMNJ 3M8YA 1KTVA 6AT1B 2G2YA 4NYPA 3NNAA 1Q86T 3LALA 4DWIA 1CULB 2XI3A 4OX6A 1JJ4A 3KLHB 4PQAA 4M5GA 1TAUA 1HLWA 1X5PA 3DGVA 1E6VB 1KRPA 3H5XA 1VQ9S 1U48A 4ZKAA 2FJDB 4O4GA 3EXCX 4F3OA 2Z30B 1YK9A 3DOMA 3IGVA 2RILA 3R7NB 3TA1A 3N6MA 3Q22A 3CCUS 4ZPAA 2I0XA 1WSRA 3M6XA 2W24A 4NLTA 2UXDF 1FVSA 2DXFA 2M4MA 1F6TA 1FEHA 3ENAA 2CADA 2UXDJ 5KFBA 2LEBA 1RWNB 1SPBP 3TJ8A 1SCJB 2QMXA 3PR4A 1S9GA 4B08A 3CTRA 2GFFA 5GAGU 3DRPA 2BW2A 4U6PA 3FSXA 1WD6A 3NCQA 1RISA 3SBMA 2DNHA 3KLHA 3GZ7A 3MR3A 4I0WA 1Y4ZB 2PA8D 4C6AA 4X64F 2UUCF 3DMJB 2ZBRA 2BM0A 5F8MA 1OJ4A 1QE1A 1RADB 1IKVA 1V5VA 2CJ9A 3CJSA 2OEKA 3CB4A 3PRDA 3W7BA 4OIXA 4R0JA 1F2GA 1FNOA 1NPPA 2E5LJ 1PSDA 3KK2A 5F8IA 3PVXA 1N6QA 3OHBA 1NSKL 2KXNB 4UT4A 1L3SA 4HHJA 5KFKA 1S0OA 3CC7S 5D15A 1REVA 2WVFA 3QAUA 3LPYA 5F0UA 3WDOA 3MPUB 1B7YB 1TL3B 4WWSA 1M5PC 1HYSB 2R7RA 4AE5A 2KT5A 4NXMJ 4F26A 3BYPA 2A1BA 4LJMA 3CCQS 5HVGA 1MU2B 1PJ7A 2XCPA 4B9MA 3EGZA 4RW7B 3MMBB 2QE5A 3RUBL 4M95A 1VJWA 5FLXU 1RJJA 5J1PA 3AODA 2E29A 4K59A 5J2MA 1C0UA 2IM0A 1R0BG 3UN3A 4X4QA 4O4GB 2CWXA 2HPUA 3MEDB 2DD8S 3HULA 3R5CA 4MKVA 2OEJA 1RBAA 2YNFA 2RKIA 3OR2B 4MIAA 1YRTA 2PN6A 2LQ8A 1QUVA 3UNGC 5LXRA 2GVDA 1ZBTA 2CQIA 4KGXB 5CAAA 2R8GA 4TY9A 2BUNA 3PW5A 4WBFA 4I4BA 2FIUA 4ZLNA 2C2MB 2CVIA 3C19A 2KH9A 1SQFA 4DFMA 3CD6S 2HHQA 1R3NA 2X3DA 1H7XA 3DLKA 2G9OA 3CDEA 3TR5A 3CJ8A 1TKDA 2EK6A 4NLVA 4MTPA 4NLYA 4OYAA 1NJIT 1AA1B 2YKMB 1WHYA 5J2PB 2QFJA 4KKOA 3V81B 1AUDA 2CYYA 4K4WA 1TL7B 4ECRA 2DHGA 4A8XA 2H3EB 4WP8A 2HNDB 2YWKA 4F0KA 4YN3B 4IFVB 1FKOB 4OZ1A 3JTOA 1NDLA 1RBLA 1HQEA 2XLKA 4PQUB 5E2QA 1HWLA 4FXVA 4QU6A 3GP9A 1OY6A 1U6ZA 4Y6IA 3UDEA 3CF5Q 4CH7A 2GO8A 3R2CJ 1MWQA 3KMQA 5HLFB 4WPAA 4KE5A 4C3MA 1EIYB 2OSRA 3CDUA 3TW0A 1WEZA 3ZZZA 1YBTA 4UOHA 3DGPB 1IBKF 2YKMA 4RNMA 4RW7A 5D0EA 1WI8A 4LVNP 1V3ZA 1GFWB 3H59A 2HQIA 4OMFG 4RW6A 4YDDB 2YH1A 4PZVA 2DHHA 4DSLA 1IKXB 1KFDA 2KG0A 2MZ1A 2DR9A 3BKUA 2KO1A 1CJUB 4OQJA 3OUYB 1RKIA 2G2ZA 3MM5B 3BBCA 1IKYA 3GFHA 1I1GA 4OJHA 2E7XA 2GVDB 2ZVSA 3CO9A 4LR8A 4F4XA 3KKFA 4A8OA 6FDRA 1VHIA 2JFDA 3ZZTA 4QWBA 3C15A 1S1TB 3M2VA 2HFSA 5ETPA 4X4PA 4MYUA 5CYQB 4PXDA 2OPPA 2HFNA 2XBPA 1WWHA 3MTJA 4A8SA 3GV5B 1IBCB 2VBWA 3QBCA 4LR7A 5B0BA 3FCVA 3RAXA 5KOWA 2P9GA 1S97A 3FBBA 1S48A 2MXYA 4RNHA 4USIA 2IBOA 3GCXP 1AROP 1XMBA 2NXJA 5F8HA 1ZZNA 3BN7A 1UEKA 2UUWA 3WC0A 3JSMB 3PACA 2E1PA 1CJKB 1I5OB 5L46A 2C2EA 4ZJLA 3MAAA 5JXSA 4LRDA 1TUWA 1N36J 1LW0A 2QL9B 3DLEB 3JTNA 2UVUA 2RQMA 2CPIA 3HFZB 3OLAA 1K47A 1DHMA 2COLA 4ED2A 2DCLA 4LRCA 1SJQA 2NYIA 2XHWA 3BQ0A 3QGHA 1U1MA 1LWEB 1R7IA 3K2YA 4M94A 4I6AA 1H2UX 2EEYA 4MFBB 2CPEA 3W8PA 4H54A 2B3TB 2NUUG 2I2YA 1VRTA 2FHOB 3OUYA 3PM9A 2AEFA 1OWXA 3VQSA 1WSVA 1XNRJ 3R6LB 1CJKA 5IV3A 3K5OA 4DV1F 1JK9B 1NZ8A 2DNLA 3MCNA 5ETSA 3H90A 4PPDA 3KHGA 2VFUA 1UZDA 4CO1A 2E44A 3MFHA 1MG7A 3OT9A 4KJIA 1NM2A 4OI4A 1M1KT 1PIEA 1IKVB 2N7YA 1HWJA 1JIHA 2C2ZB 1U0HA 2CZVC 2PD1A 2G0IA 2WOMB 2E5GA 3D0HE 4LSNA 4ZVSB 1C4CA 3G4SS 4C2MA 1DAXA 1Q16B 4CLLA 4DL7A 2KJWA 3I4HX 2W7OA 2YWHA 1RAFB 3QIDA 1Q5VA 2Y1LB 2IMOA 3OTOJ 3QT6A 3T1YJ 2YY3A 1NDKA 5CQGA 4RLEA 1FX2A 4G1QA 2KT2A 1U2CA 2JVOA 1RA6A 2M70A 4RJVA 1U1QA 4OX9J 4Q8EA 4P52A 3PNIA 3IRXA 2L9DA 1IWGA 1HPZB 3KG0A 3MAHA 4F25A 5HBMB 2E66A 3RR8A 3NNHA 3NMAA 2F5GA 3EDQB 3TZWA 2W8KA 2ZZNA 2GZOA 1ZM2A 2HNZA 4UOGA 1HHTP 1KLNA 1GXUA 4RW9A 3T3FA 1S9FA 2ASLA 1FTCA 3IM9A 4J90A 1NK5A 2FVSA 3KK1A 4M5MA 4O3PA 4JV0A 2UUBF 3H5SA 4NRTA 1S6OA 5ETLA 1LFWA 3T9NA 1TV6A 1PYOB 2YQ3A 4J9SA 5CZXA 1Z2ZA 3H42A 4J9LA 1VI7A 4NXMF 4RUHA 2X3GA 2OMLA 4CLYA 4MAKA 1SH3A 2PFDA 4ATNA 4GO5X 4PWDA 4MMOA 4ZVQB 5I3QA 1MLAA 3S6EA 3IRXB 5KAKA 3JAMU 4QIWD 3CJ3A 1XR7A 4FVMA 4O23A 4NEYA 5THWA 4F36A 4OHXA 3PY8A 1S6QB 1WELA 4P6QA 4RW9B 2HNYA 3K59A 3MFIA 1N48A 1CQNA 4BC7A 1H0HB 4J9UE 1ZM3A 4ZCKA 2KT3A 5ETQA 4M8LA 2UVWA 1V3RA 2EW9A 1N32F 3GIRA 2ZH8A 1S0NA 1RTHA 5J2QA 2XMMA 5F8JA 4ZA1A 2GIFA 1VIOA 3AH6A 3BREA 3HHLD 1IR1A 1TK8A 5DQIA 2HZAA 4DF4A 2XY5A 2HAIA 2XCAA 1U25A 2C22A 3RBDA 4CH0S 4DQPA 2MZQA 1BE4A 3VR1A 4N76A 3QWUA 1IM4A 2M2BA 3H7HB 3CT9A 3FCWA 2WSEC 2ZUGA 4IFYA 5HANA 1N33F 4N77A 1UTAA 4ANEA 4GKJF 1N5TA 3L3CA 4G1PA 2ZDPA 1GMWA 2I5JA 4ZVHA 3PW2A 4FXWA 1LWXA 2LQ5A 3BKFA 4NLRA 4DFPA 3M32A 1X9SA 3TARA 3TQEA 3R8YA 2RQ4A 1FFSB 3FCHA 3HT0A 1TL3A 1T03B 1AYEA 1RAOA 1HQUA 3MCOA 3GONA 3TZZA 4NCGB 3MEEA 4DSIA 2GIQA 4ZPCA 4B3TF 2X51A 1I94F 5KFAA 1P27B 1EKSA 2ZWOA 5CH7B 4K5SA 4X4RA 5T7LB 5JVHQ 2U2FA 1B0TA 4YHHF 1UPMB 3W2WB 3UD4P 3GR1A 4ZP7A 2FY1A 4IR9A 2IM2A 3FQLA 4NOHA 2HHUA 2GQQA 4RNNA 2Q6CA 3KUHA 1FXDA 1RUSA 4NWBA 1KN6A 1SQEA 2F63A 3D3BJ 2BYCA 2BV3A 3IC1A 2CJAA 1R0CB 3VAIA 1WJ9A 2PO4A 1ZZFA 1HHQA 4PWWA 2HQDA 3UPFA 4USWA 2ZUAA 5KT5A 1NK4A 4F2RA 1U6BA 2DEIA 1XC9A 1C1CB 3BV8A 3HFVA 5EWEA 1QTMA 1TQLA 3BO3A 2AEJA 4ED1A 4UY85 5HATA 5DG8A 3EX7B 2DHXA 3LWMA 5ETVA 3CC4S 2ZC3A 2GVZA 3KHLA 3UCUP 3PEJA 4NYOA 3W5YA 4ZHRA 2DNPA 3NNCA 4GKJJ 1D8ZA 4YQWA 4ETXA 5D4PA 2DGXA 1FJGF 4B3SF 4YR3A 4LF4F 3O44A 2CNOB 2LA4A 2LKZA 4WE1B 3PJXA 3ET6B 3BSOA 3ZO7A 4DV5J 2G1DA 4DU8A 3PHEA 2AD9A 4LF5F 2JSXA 1U26A 2E1RA 1UL3A 5AXMA 2DB1A 2YPZA 3O8WA 1ZAXA 5CZVA 4RW6B 5DGBA 4JV1A 1X60A 3ZTOA 4B3OB 3BN4A 1HARA 2CQ0A 3SSSA 3PJ9A 4TU7A 3OVSA 1C0TA 1S1UA 2C2KB 2GMHA 2RHSB 2VD3A 2AYBA 3W2WA 3Q8VA 5G0RB 3PX6A 4QU7A 3P3DA 3GTYX 3GPAA 1QSLA 5HMYA 1I3OB 2CQ2A 3EPIA 2HHHF 4NCBA 2ZITA 3M6UA 1PBUA 1TVRA 1JNRB 4RW4B 4IUFA 3SDEA 3MUMP 4I68A 1YLXA 3AD7C 2DH7A 3MMAB 3W66A 4U95A 5A6PA 2M8DB 2IRUA 1RTJB 4FVCA 4WTYA 1WG1A 3M2VB 4C8YA 4F67A 2F8EX 1L5UA 2JDJA 2HQGA 4ZVPB 4J9QA 4HI2A 2QLFB 2XI2A 4PG8A 2O66A 3WX8A 2ASDA 2DGSA 3KJVB 2HLUA 1U1RA 3BBBA 3N5BA 2DNOA 4QCLA 5GAEU 4RX6A 4KR0B 4HT7A 3TZYA 4NZ6A 3GV8B 4IOCQ 2UVVA 3I9ZA 4NA3A 1NXIA 2HLTA 4JI2J 3NEKA 4L6V3 4NYZA 2VFTA 4DV3J 1YJRA 4LUBA 3RBEA 1RKJA 2AJ1A 3SDEB 1XR5A 4JV5J 3VV2B 1MU2A 1Q95G 2GJIA 5K9FA 3MM9A 3K7RA 2W9CA 4ZVUB 2GC8A 3OVAA 1W2BR 2QO3A 5FIIA 3A3PB 2VA3A 1WOPA 1XERA 1WC0A 3K89A 1R43A 1VRUA 4RL1A 5GAHU 3BJYA 4FKXA 4GMKA 2ZH9A 3BO2A 4DF8A 2YKQA 1HNXJ 3HO1A 3CGIA 1IQZA 1YJ9S 2C2RA 1URRA 2V2ZA 4NLQA 1RA7A 4Q44A 3DLGA 2QA2A 2W7PA 5DDOC 5E3PA 1HNIB 2EFPA 4JI0F 4CH1A 3MZIA 2N4CA 2RQKA 5HP1A 1RT7A 3OVBA 2UUTA 4DR5F 4BC9A 1N54B 3W2VA 1NKEA 1L3TA 4OZJA 2MJNA 2FB0A 3KTQA 3VGSA 3G87A 3OL8A 4C8MA 2DPJA 1S0VA 2DHAA 3IGNA 4IH5A 3HPOA 2KVQE 1M0SA 4PUOA 5B7WA 1C0UB 1UWBA 2GS8A 5EHHA 5HJYA 1TFYA 2OELA 1FT8A 5IFMA 4ENOA 4BWMA 3JB9k 2JLEA 5HL7Q 4JI4J 5B0CA 2RKIB 2RUGA 3QJLA 3L7PA 4ELUA 3BH7B 2RUSA 3J7YI 2HURA 2WW8A 1ZAWA 3OW2R 1LKZA 5G4DA 4RUCA 2MZRA 5E3RA 1FTRA 3RBZA 3MMJA 3NGDA 4URGA 2V2QA 2FUG9 4Q2LA 2VL1A 5GMDA 4DHVA 1X4GA 3UCGA 4WFNQ 4IR1A 2VZ9A 2MLXA 5HMXA 1Q79A 2FYXA 2JWNA 4LF7J 3F44A 1VQPS 3M6WA 3D2WA 3H5UA 1MW7A 4LIRA 3CNQP 4JOUA 2BE9B 1WHWA 2LDYA 3DDKA 4P2FA 2BJDA 1FWPA 3M05A 4F04B 1RABB 1RT6B 4TQSA 3R5DA 1DQ8A 5DZ6A 1FHTA 1EARA 2CJBA 3G6ES 4DL6A 1JLFA 4U8YA 1AT1B 1F3FA 3M9OB 4J9MA 1SH0A 1WC5A 2LXFA 4DL4A 3EVOA 2P8IA 4J9RA 2AJ0A 2LU1A 4B9VA 2ERRA 1R27B 2P6SA 1JQGA 4F4YA 1DFDA 3KNAA 4ECQA 4Y00A 2C3UA 2N3LA 1NJWA 3EJMA 3V6KA 1MN9A 2M0GB 4DUZJ 1O0PA 2B4VA 3BPSP 4O0IA 2BEFA 1S1XB 3BGRA 3HHLA 2HK2A 3KFWX 4OYXA 4ZPTR 5GVQA 3W9IA 3PIOQ 1VHFA 2QYGA 3MPWA 3TX0A 3WIUA 2MTLA 3NGUA 4DR2F 2Q66A 5KFOA 4V19J 3V5RA 1S99A 2VPZB 4ZHRB 2XMAA 1IKYB 2Z2YB 4RBTA 3ZC4A 4F4AA 2XMTA 1PGZA 4Y2AA 1SVDA 4ZP9A 1S4FA 1VFJA 1XTZA 5KFCA 3W64A 2GGPA 2VC1A 3DI6B 3PJWA 2VDIA 2D7SA 2H54B 2ZD1A 2Q3PA 5A8WA 1R0AA 4KGMA 2CQCA 4Y65A 1P9QC 5IT9U 5AXNA 5L1JA 2IRYA 1UVKA 2PMHA 1NB7A 1ITPA 1S1XA 3BGRB 2GV1A 3HHLB 3B82A 2NXNA 3QATA 4L3KA 3OD2A 3QNWB 1MMNA 4TY8A 1MROA 2YKNA 3O2IA 5LM7E 1TMMA 4XIUA 2Z0GA 2L41A 2HHWA 3HDSA 1D9FA 2EXUA 3CJ4A 1YQHA 3PFEA 4U7CA 2CQGA 4WFBQ 3TUJC 3FSIA 2V4QA 4WU3A 4ED8A 1FDDA 2MKYA 4A8FA 5DQHA 2JL9A 1FD8A 1N5VA 2CAJA 1DRZA 1G3OA 2DR7A 1RAEB 3ZZYA 2HFOA 2HGMA 3CCTA 3TA2A 4DL5A 4MKYA 4K4YA 5RUBA 2DNKA 2B6AB 4V19X 3AXMA 3B8HA 2HK3A 4P72A 4ZVRB 4X66J 1XNQJ 1U1KA 1Y3JA 2NXCA 1TKZB 2R7WA 4LVOP 4CLFA 3T1YF 4WIQA 1FJEB 4ILRA 3R9LA 4J9VA 1S9EA 2J9EA 4YY3J 3E8OA 1FESA 3E01B 1PILA 1RLCL 3I5BA 4YR0A 2QA4G 1MWZA 3QSIA 2EG1A 4ED5A 2B9YA 5ETMA 4L74A 3SCIE 2XG8A 4OI3A 3C6TB 1Z2LA 3GIKA 1XMOJ 1X5TA 4QW9A 2KHDA 3QGGA 5D0GA 2M9KA 1GK8A 4ID5A 3W62A 3AOCA 5DGAA 2MZTA 3AAWB 3H98A 1H3DA 4CRJA 2EC0A 4FYDA 1FE4A 1GQEA 3QMQA 3D67A 3V4IA 2ZD1B 5A8WB 1KFSA 3HKZD 3KDNA 1M1HA 1VISA 1XMQF 3DDNA 4F8RA 2KB2A 3GJTB 3CJQA 4GVLA 2Q79A 5KFJA 5HVHA 5CA5A 3CUNA 2OP5A 1HR0J 3PW7A 4Q7AA 4YB6A 1ZM4A 2F4FA 4DR2J 3QRQA 2YWFA 3GSIA 1TL4A 4LFAJ 6FD1A 2HAFA 2VASA 3JXOA 5A76A 4A8WA 4KTQA 4B3MF 1FKPA 1J27A 2FPHX 4CNZA 1CVJA 2WRMA 5M2RA 2PIIA 1ZA2B 1NHUA 5HI7A 4KH0B 4ZP8A 1D1UA 1UVJA 5AJ3J 3LH2S 1KS2A 5B0DA 3RTVA 1VBZA 4PG6A 4CLWA 2CUYA 1JB0C 1Q1KA 2BANB 3DM2A 1NO8A 1FRXA 2FVQA 1VQKS 1VJQA 3A3NB 4M5NA 1JWWA 1K0TA 4K2JA 4TYAA 3X1LB 3G8TA 5HJXA 2QL7B 3HX9A 1SV5A 2GNKA 1S76D 3VAHA 1X31C 2RS8A 1JLQB 1GT8A 3Q0AA 3J7A1 3RJMB 5F8NA 1FKPB 2DY9A 2H48B 1NK6A 3SFUA 3EXYA 1BMQB 1C4AA 2CXEA 1FERA 1RWWB 4R8UA 3K0JA 1AZSB 4W4MA 2H5IB 1BXNA 3LUYA 3X3UA 3PO4A 1LW0B 2E5JA 2WK4A 4Z37A 3R7BB 4R5PB 2E7VA 3GG0A 2FJXA 2UXBF 2B8PA 2AT1B 5HSPA 1HWKA 3LTOA 1BHNA 1MMDA 3DCAA 1UVMA 4YS2A 5HQMA 1TFWA 2BKOA 3C66A 2B9XA 3D1OA 5I3UA 1SV5B 3K8VA 5F0WA 2CQBA 2WCXA 2B4OA 2CA9A 3CSKA 3PXGa 4DSEA 2BACA 3FEXB 3MI7X 4K5RA 4J9KA 4MYTA 3RBXA 2DITA 3VVUA 4YMEA 4ZITA 5KFUA 2UZAA 3AJ2A 3BYRA 3DOKB 1OPZA 1CULA 1X4HA 2E5IA 1P8GA 4A8QA 2A2DA 3W5ZA 2BDPA 2AV5A 3I87A 2PMZD 3NBPA 1DTTB 2IC3B 3BGLA 3FEYB 4ZPWR 3OLBA 2VG6B 1OIAA 1PG5B 2CPJA 4KB7A 2QA4S 1RLDA 3HVAA 2W4CA 4DDFA 2MY8A 1KVKA 1R8CA 1UFWA 3MEGB 1SB6A 1ZS6A 1QVFR 5C2CA 1DURA 1G2EA 1NEEA 3TJ9A 2W4PA 5L38A 2X1BA 1URNA 4J9PA 4PQUA 4HTIA 2KM8C 3AB4B 4NXNJ 2BJ1A 4DG1A 3D5MA 3ELHA 1B64A 1S9GB 2IDLA 4LREA 2V8VA 4FYVB 4UZBA 3B6BA 4RBVA 2GA7A 2PI5A 3GFYA 2U1AA 5DZ7A 5KFTA 2BVZA 4K0KJ 1QD1A 3TX8A 5EN1A 3A8EA 5K5MA 5KFHA 3SSQA 2V4JB 4CLPA 1RGVA 1RTIB 2ZFHA 1PAEX 3OR1B 2P2CB 1EHWA 2HSEB 1Q8BA 1UAWA 2CJYB 4OX7A 3A8IA 1LK7A 2B8QA 2QSFA 3D4JA 4X84A 2K06A 4CWBA 5ITHA 3CCVS 3CCZA 1YDLA 3DRSA 2K7KA 4QPXA 4KV8B 1ZAVA 1RHKB 1JLEB 3VZHA 1PAUB 1HQEB 3PYDA 3WZ0A 3KHRA 1FRLA 3I5CA 3OSNA 4DV0J 3T1HF 2G1HA 3P5BP 4DZDA 1OQ6A 1X4FA 2YNHB 3NGTA 7FD1A 1R89A 3PDNA 4W98A 4DQSA 4I2QB 1GXLA 3ISND 2J7UA 1LEOA 2C42A 4M5HA 4C7QA 3KG1A 3QRRA 3M8RA 2C3MA 1SKWA 2ASYA 2HVHA 1X9MA 1W26A 2J7WA 4CZCA 3C46A 3VZIA 3I0RB 1SJFA 2EK1A 2F8HA 2HNYB 1Q81T 3M2RB 3S1TA 4JI8J 2WB1D 1S49A 1GX6A 2VH7A 2ACYA 1D9DA 5J1NA 4ED0A 2ILZA 2R7TA 2WW4A 1PC4A 3OTCA 3T1AA 3W61A 1ICEB 1LQ9A 5E5NA 2HQCA 3QJJA 1XJWB 2FJWA 2YNHA 3PRBA 4Q0BA 1CEZA 1KTQA 3TYTA 2YPYA 4RUAA 1XMOF 1RTJA 2WONB 3PKYA 3Q8RB 5F3ZA 2PE8A 2AGOA 4DUTA 1YRUA 1F5AA 3Q8QB 3KJVA 2L9WA 4HL9A 2OTLS 4XDDA 5CCLA 3ZXWA 3CO0P 1SL0A 2VIHA 4E0DA 2LQBA 4GVBA 1WORA 1WTFA 2DEJA 5K8PA 4YY3F 1L3VA 2GO9A 3P6YC 2E9ZA 1M1GA 1S1UB 3LGMA 1EETA 2GIRA 4B9LA 5I4MA 2WBMA 3S01A 2HFUA 3BS9A 1B4SA 4XK8C 2I5JB 1MSWD 4KHRA 1EZZB 5GAEI 5HVFA 3EGWB 3FZBA 3O6QA 3EPGA 1YI2S 1NK0A 4W90B 4OI2A 1RT5A 2WONA 2AP6A 1W25A 4BHQA 1KKHA 1E6VA 2QMUB 2ZM6F 2YNGA 2NCKL 3P96A 2BX6A 4Y2CA 4DV7J 4M5DA 3FRYA 1RWMB 2ZHOA 4P9SA 2N7CA 1HNVA 2ROEA 4MK9A 4AD6A 4Y0FA 2BANA 3DM2B 1GX5A 4QR0A 4LSNB 4NLDA 4RWWA 2V69A 1QDUB 3HHKA 4E8UA 4H4OB 1JXLA 1RT3A 5HN0A 4IRCA 2DNRA 4IRDA 1ZETA 1T02A 3LQVA 2RRAA 2HWHA 2ZBCA 4CLTA 4JI2F 1KQFB 4ZJQA 2ROPA 1JLGB 2C1EB 2DNZA 4Q2MA 5H1SV 3W3SA 1Q78A 2JH3A 3NP5A 3CCMS 1FKAF 2F3JA 2QSWA 3CD0A 3BR8A 3C16A 2R7SA 2XS7A 3GG1A 3NS7B 2KFZA 4P74A 3RAMA 1WKKA 4CLZA 4QYZK 1S1TA 1EQ0A 2HS4A 1I51B 3IAM9 1QE1B 1I6JA 1M5SA 1RQ0A 2B5JA 2GHWA 4TLQA 3K57A 1UVNA 1EB0A 2KG1A 3IR5B 1FDBA 1Y9OA 2HVDA 2QL5B 4HTJA 4K7QA 5KG4A 3W63A 4B02A 3J80Y 1UCNA 2K2PA 2VFRA 3CJRA 3H5YA 1U1LA 2HQFA 3AOBA 5SZTA 1TP7A 5DQGA 1MNEA 2B56A 4UTGA 2V67A 2GMLA 4DV0F 4DX5A 4D3GA 2IJNA 2IMWP 1F2HA 1QVGR 4HVZA 3H4BA 2B9WA 2LA6A 4ELTA 3QRPA 1SUQA 1JXEA 2HBRB 4NI2A 5LMUJ 2CJQA 4CT9A 2V9KA 2M8HA 4DS4A 3JSMA 5M2UA 5D3GA 1LFPA 1D9AA 1UVLA 3PG9A 4ZN3A 2J0XA 1GMWD 2HHPA 4OZ3A 1KR4A 1JLCB 2QJ3A 5KOXA 3HHNB 2FJBB 3M8ZA 4FN5A 5KFNA 3UCZP 1CJVB 2Z2ZA 3FEZA 4DOZA 2VG5B 2RVJA 4OZ5A 1HNVB 4PABA 2ZM6J 1NUEA 2ZBQA 1R31A 3THVA 2BJEA 4ZMMA 5DG7A 4FBTA 3N6LA 4M1KA 3KK3B 1PJ6A 1U0SA 4RW8A 3BDEA 2ZZTA 4PWUA 5G0RA 4CYUA 5J2QB 2VOPA 4ICLB 3OFGA 5KFXA 4YP3A 1JJ2R 2DH9A 4QJVA 4EEYA 4TNOA 4RW4A 4LR9A 2HMIA 4WXWA 1XN9A 2QFIA 2YWWA 3A8JA 3ITHA 3LANA 4K2XA 4OJGA 5E7OB 5HAOA 4C9DA 3NAIA 2BOAA 2IVMA 2NSBA 3R7SB 2V4JA 2R2SA 1TL7A 2FLPA 3RU0A 3CJKA 4USKA 4IO9Q 5KFMA 1IXKA 4X65J 2W2QP 3GFXA 1N8RT 2OPQA 1NSPA 3KWMA 5KFEA 3TUPA 2HWIA 4I6WA 5DDQC 5L1IA 4OI6A 2VJUA 1VQ5S 1J2VA 2BJ8A 3HZEA 4QIEA 2HKEA 4DZ6A 5E41A 3G86A 4HYKA 4KH1B 1RAHB 5A8RB 2RDDA 3CEDA 1NKBA 1HQ2A 2VKRA 2XZDB 4OJ3A 3TJAA 4B3MJ 2Q1LA 3DGPA 5K8NA 3CCRS 2KXHA 2VV5A 2XWXA 2BRLA 2HNZB 3D7SB 2IM1A 4AUKA 3ISZA 1VK8A 2WVDA 1BC6A 3PW4A 4OYZA 1E6YB 3KLIA 3WIVA 5IT9Y 2R7QA 3VGVA 4RBUA 2EBEA 3OFHA 3G6YA 2V0NA 4QZVB 3RRHA 1UFLA 2JLFA 4GC6A 2N4DA 1VK3A 2UV8A 1QSYA 1MN7A 3R3TA 3D3CJ 5H9FJ 1CC7A 3Q83A 1Y3KA 4TU9A 1ZYQA 5DO2A 2W2NP 3DRRB 4M63A 1BQNA 2OPPB 4FNIA 2QG9B 2UUAF 3NG8A 2ZH7A 2PC6A 4NASA 1L3UA 4PG7A 3I31A 4USMA 3T5LA 3AFGA 4KPCA 2B0GA 1Y00A 2MZSA 2VC0A 5C25A 1VQNS 3UN5A 3JTPA 4UUWA 4F4WA 2D9OA 2NXEA 2LEPA 2NLWA 1SH2A 3M30A 2LLZA 1WEYA 2YKNB 3TRGA 3WQPA 3KK2B 2EFQA 3TAPA 4RNOA 2AEMA 2V2KA 3LO3A 3J81U 1QAYA 4KFBA 2ZKTA 2AX1A 4CLKA 3M9MB 5H9EK 1Q8IA 1VQMS 4F0HA 2HQ3A 1GXTA 4Y2MA 4Y3CA 5E3CA 2NXUA 3C2PA 3MUTP 1BQNB 1FNMA 1SJ4P 2XY7A 3MEKA 4PXBA 3UDCA 5KFSA 1J5OB 2BQUA 3E51A 3TVZA 4IFYB 1FDAA 3R5BA 1S4EA 3T6BA 3VQTA 2EFOA 3NGRA 1TKZA 2HGNA 1RWOB 1NJXA 1WOOA 1O8BA 2GAHC 4CQ1A 4KV8A 3QGPA 1UMJA 1T0TV 2XYHB 1BLUA 2CPYA 2Z2MA 4I7FB 1WC1A 3AXKA 4WK1A 2PFFB 2RDJA 5KTQA 4OYPA 4DV7F 2CDQA 1R8AA 4Z7CA 1U1NA 3UN2A 3ETMA 4UF4A 3W60A 4Q45A 3DC2A 5IS2A 3HKWA 2G4BA 3EGVA 4O44A 1Q8KA 1SBRA 2MQMA 2Y1RI 4QWEA 2XMKA 5K20B 1U2RA 3FKBA 4IG0A 1OO0B 2ATCB 3I0RA 1XQIA 2IVFB 4CM0A 3EE3A 5LT5A 4EMDA 1YJVA 4PPZA 4I69A 3LP1B 3UDVA 4NA2A 5EWGA 4QWAA 4DV2F 2MB0B 1EJ7L 3QYYA 2X1GA 4DEZA 5M2PA 3AHPA 2MGZA 1ZPWX 3H4DA 3VAFA 4KQZA 4HT5A 1VMBA 4I67A 1VLYA 2A3JA 1MWYA 1SQGA 3CD5A 4F3MA 1YBAA 2VQFJ 4DXLA 3I82A 2W2OP 2QZ8A 2OTJS 3K17A 2CQ3A 3MECB 5B0AA 3OL7A 1RCOB 2ZH1A 1UA0A 1HA1A 1SC1B 5KG6A 4KKOB 4O44B 4DX7A 1TU0B 4K4TA 3V81A 2H1YA 2Y8WA 4AXJA 3J81j 1LWFA 4DN0A 2RT3A 2EFNA 2ZH5A 1J5EJ 2OLWA 2IDEA 4CTAB 5GADU 2F4VF 2D69A 2K7JA 1N32J 2BM1A 2RRBA 3RYLA 1WDTA 2O67A 5KT2A 2VHGA 1UEUA 4NLGA 4QIVA 3OL9A 5ETNA 2R7VA 2D3UA 1NAQA 4ZVGA 1RZMA 4UUXA 5AE2A 4K4SA 1DZ5A 3BQ2A 1KNZA 2J76E 3N28A 4DR1F 2WTFA 2GQ2A 3MD3A 3MECA 4ZCIA 3G6XA 4B9SA 3ET6A 3CMQA 3C15B 2A18A 3SV3A 2YKOA 1WG4A 4ZIVA 2D1CA 2L08A 2MQNA 2NSCA 3SFGA 4DS5A 4ILMA 3M4XA 1YKWA 3G82B 4L75A 2GCFA 2B6AA 1N5SA 2LU2A 4WIIA 1KDNA 3EMTA 2QC3A 1YVFA 2BABA 4ZCLA 1IUJA 2Z4PA 3H20A 3L7OA 2FVCA 2R7OA 3FMBA 2M52A 1REVB 2MKCA 1RWKB 2WBRA 1YJUA 3CDWA 4QQBA 2EFVA 5MAOA 3EM1A 5JUMA 2AQ4A 2ZH3A 1ZM9A 1TVRB 3MAQA 4GKKJ 2MQ8A 4OLPA 3UWTA 1TAQA 1AB8A 3CE8A 3MM8B 3TANA 4UQTA 1RK8A 3VGUA 4JV2A 1DTTA 1UZHA 2IC3A 4AL7A 4FYYB 1DTQB 2D3ZA 4F4ZA 3V6DB 1SKUB 4OV1A 1DQAA 3BM7A 3DRSB 4FPIA 5KG5A 4YOEA 1VBKA 3MCMA 3TAMB 2MHEA 4K4VA 1T9WA 3VAGA 3LOUA 3PYGA 1HR0F 1RT1B 1HFEL 3KMSA 3KLEA 1RTHB 4NLPA 2F4VJ 1U1PA 1AUSL 2ZZMA 2CPZA 4H4MA 1LW2A 4OYWA 2VPYB 3MR7A 3THPA 2XNRA 2APOA 3P5TL 4AXIA 1IQTA 3U02A 3ENWA 2NR0A 2J7KA 4QWCA 1WC6A 4X65F 3GQCA 4G1IA 3JQJA 4R25A 1K8AT 2DJWA 3EUNA 4JBCA 1HHSA 2IAJB 4LT6A 4DR7F 2FZCB 1RI7A 2KYZA 1S5ZA 2MQPA 1WC4A 1EKRA 2C3OA 3QT5A 4BBYA 5LJ3Y 3LA0A 2LFVA 1HWUA 5AXKA 4ZOSA 1RT1A 4EO8A 1CPZA 3ENVA 3UVJA 2MLZA 4Q0BB 2KTQA 1VCTA 2WHOA 4WYLA 2YQ0A 1X4AA 3JYTB 3IAS9 4Q5VA 2WVBA 1YJ7A 2HIQA 3W2VB 2GGPB 4Z7YA 2MSSA 2FZGB 1N36F 3SCJE 3DNCA 4LSLA 3TNVA 1FE0A 3MTKA 3BGFA 2KXFA 1AW0A 5IQ6A 1IKXA 5T7LA 2BW7A 2AYGA 5ETRA 2W1BA 3LAKA 4DX8H 1CJTA 4C8NA 1FXLA 2OPQB 2IYGA 2OGUA 3NRBA 4M5LA 2GVZB 1U1OA 2ADCA 2RIJA 1FRJA 3UVJB 3CMAS 4OL8A 2HHVA 2GQCA 4J9OA 4ECXA 3FGVA 4F02A 3EYZA 3CD7A 2LP4A 4DR3J 1TKTB 5BXIA 4PYDA 4CO3A 2XY6A 3RZAA 1U6FA 4EK2A 3T5HA 1DLOB 1RHJB 3U7JA 2VG6A 2XMVA 4DV6J 1S6QA 3IO1A 3GCWP 1OS5A 2XMUA 2W25A 1QAXA 2DGUA 4DUYF 4DV6F 2V2VA 3F56A 3GYNA 1EQMA 2AKWB 4CO4A 4DR4J 4ZPDA 2KZMA 1X4BA 2XSJB 3LP2B 3MM5A 3I0SA 1GTHA 1T11A 1IM6A 2MZJA 3FK4A 3UI3A 2SXLA 3HM9A 3D1HA 1CG2A 2CQ1A 2DIVA 2OO4A 3MAAB 4XDCA 3HSJA 2Z8QA 3LW5C 2QEXS 4P2SA 3DRRA 3NCRA 4S0MA 3D0GE 3LGNA 2K3IA 2QYCA 2W4DA 4IOBA 4M5DB 4N7TA 5CYQA 1SIWB 1JLAA 3MURP 2W9BA 3NMRA 1P1LA 1OYEA 2V5HG 2QT7A 3I32A 5C42A 4K4ZA 2XYPB 2QA1A 4C0BA 1UVIA 3VCDA 2FLLA 3CC2S 4ED3A 2DXDA 3BSCA 1SC3B 1UKUA 5DM7Q 2RD5C 3HHDA 1W2IA 5B09A 1OY9A 3M30B 2MPUA 4EBDA 1N5YA 3THTA 1FEEA 4OJ1A 4KRWA 2DO0A 3A13A 4L73A 4EU0A 1JLCA 3Q2SC 4NZ0A 2OIHA 2H5EA 1RBOB 3C6TA 4DCOB 3M8WA 3TUIC 1UETA 2YVSA 1U02A 2AW0A 4EZ6A 1RAJA 2F65A 2DRDA 3AB2B 3JQKA 4MK7A 4CI0B 1U0HB 2BA9A 2H4WB 3D1QA 4CIOA 3R2DJ 3MDFA 3KG4A 3PEHA 1RT2B 1S1WB 3NS5A 3QWPA 4OZNA 2P5VA 1VQSA 2JRSA 3MGJA 5LSOA 4JI4F 5BYRA 4LF6F 1JKHB 1FO1A 2FGCA 2RJZA 3DU6A 3RB3A 3MM6A 1N5QA 4RU9A 1SL1A 2HZVA 2FY8A 4LF2A 4AQYF 4JB8B 4DPTA 1UA1A 1XNRF 5GMKa 1WG5A 4AQYJ 3TUZC 1RSCA 3CW2C 5E3QA 4PRFA 3H2VE 4KYZA 2B4PA 2JX2A 2NZCA 3S8SA 5B0EA 4O3OA 4ID8A 3QFWA 4ZVFA 5CABA 1WTBA 2DGVA 4ZPVR 4OI0A 4A8KA 4DSFA 1TKXA 4U8VA 2RMLA 1T94A 3HD2A 3UW1A 3ZZRA 2EVZA 1IWAA 2MQLA 3AJDA 1T9XA 5ETOA 4FF1A 2E5HA 2V50A 3AOAA 3HHLC 2HBQB 4TVAB 1RT4B 3HVTA 3TAQA 3H2LA 4DUZF 5C42B 5J2NB 3G2XA 4DUYJ 1Z1ZA 4GVBB 3B54A 4YB1P 4A46A 3KK3A 1YZ6A 1X9WA 3G6VA 5FLXY 1JJHA 3J7AN 2HHSA 4C8ZA 4R0EA 1FCAA 2HGLA 4BLGA 3M2UB 3P8BB 2V63A 4P7TA 4PWDB 3LAMA 1U47A 1FXRA 4U9RA 2AYEA 3IM8A 4B17A 1JXVA 3SIPB 1OSDA 4KGKA 2UXCJ 2GJFA 2A6MA 4J37A 3ZZ0A 4R8UB 5J2MB 3FFIB 5KFDA 1HBUB 1Y11A 3D68A 4CO0A 3FBEA 3TI0A 3W1YC 1HMVA 2CIMA 2C3YA 4NLXA 2YNFB 3OR2A 4E98A 2DXEA 1DARA
chains in the Genus database with same CATH topology
2PSZA 2NPIA 4XAKA 5HROB 3KHHA 1VQ6S 4DG1B 3QZ7A 1P6TA 2PT0A 4OX9F 5KFWA 2EWHA 4C0OC 3M2UA 1G7CB 2DTJA 4RNFA 3E2EA 4KIAA 2F9JA 4C97A 2IA0A 1V9OA 1S77D 4ECYA 1L3KA 3U1MA 2GHPA 5EX0A 1NK7A 5CXTA 5E33A 3FJ2A 2OFGX 4LQ3A 2POKA 2JHEA 5D78A 2MKHA 3R1HA 4ECWA 2MDAA 3IRWP 4C98A 3H25A 4LF9F 5LMUF 1FF2A 3J7Z5 1N0VC 2KN4A 2KKHA 5E3AA 2XB2D 2RU9A 5I42B 4G6VB 2FGOA 5DDRC 1VBYA 2D41A 2VG7A 3EZUA 1KQSR 1JNZB 4PG5A 4JI6F 1SXLA 3DI6A 4ETZA 4DV5F 1T7PA 1N4LA 3NAHA 5ADZA 1NKCA 4TYBA 3RAQA 4N5SA 3HJFA 2K3KA 1RYSA 1XNQF 2VUGA 2BE2A 2KRBA 1K1QA 4RU2A 2ABYA 3MCSA 2G13A 3OFEA 3MOZA 5SUHA 4DQQA 2YKPA 5HROA 2CFXA 4ES1A 3QAEA 1HNIA 4DR3F 1XWLA 4DR6F 2ZH4A 1TZ0A 3OFFA 1N52B 4ZCMA 1JMTA 4J9NA 4NXNF 4NPOA 1SL2A 2XEXA 3DOKA 1HBNA 1KD1T 4EGLA 2X1AA 1YTYA 3ENQA 2HW3A 1TL1B 1Y5IB 2R4FA 3MF5A 5FDLA 1KONA 4K4UA 2ZNYA 1RP5A 1X7VA 2EG2A 5DJBA 4QBUA 1UW4A 5DLGA 2JJ4D 2NS1B 1H38A 1AFJA 5BYSA 2GJ2A 2ZHBA 2MGZB 1N5YB 1HD0A 2FHMA 2NPFA 5KG3A 4ALZA 4CCHA 3QGIA 5U47A 3DLLQ 4C4WA 5LJ5Y 5EX3A 2DRAA 1MMLA 2O01C 4DFKA 5IT0A 7FDRA 5A8RA 2J9DE 3I6PA 2B43A 2MYFA 4FZVA 4N56A 4AYBD 1UWBB 4ELVA 2DT9A 5DG9A 3OR1A 4Y2KA 2RF2A 3C6UB 3MM7A 1OPIA 4ZS6A 4MFBA 3MXHP 1A9NB 2R8IA 5D4LA 1G6BA 2JC1A 4MJKA 4O4RA 1R6YA 2DNNA 2AJQA 2VQFF 3M8PA 3RW6A 5KFGA 3JSBA 3MR2A 3PR5B 4PKDB 5DDPC 3HF5A 2XNQA 2FTRA 4TLRA 2OAUA 1HBNB 3RB0A 1TKXB 3UDLA 5GAHI 3OSPA 4X66F 4FS1A 4O3NA 1KEKA 2RF2B 3C6UA 3JSYA 2OMOA 3MM7B 1ZOTA 3UQSA 3T9ZA 4WKYA 5KG7A 3Q8SB 3ZZPA 2P9CA 4H4OA 2OSQA 4UW2A 5HLFA 4BDPA 3H40A 1FDNA 3V2UC 2GW8A 1FD2A 2MY7A 1JLGA 1XEZA 3BQ1A 1H6KX 1XR6A 3HLUA 1KSPA 3CMES 1H2VZ 4MKBA 2RSQA 4RKUC 3G8QA 1Q4RA 4FS2A 1TR0A 1JLBA 3E3XA 3PX4A 4C8LA 3NWGA 4U67Q 1DTQA 3V6DA 3HHEA 1M5HA 1PC5A 2EPIA 4B9TA 1WHXA 2OD4A 2OKQA 3NLCA 4KO0A 4MH8A 1T95A 4IKAA 2DR7A 4DPOA 2I1RA 5KG1A 2CQPA 5C24A 5I3UB 3RB4A 1K9MT 1IR0A 3DHWC 3OTBA 4EWTA 3PW0A 1C1BA 2MMYA 4O3RA 3G71S 5LSRA 1LW2B 1NU4A 4QW8A 3U1NA 1VC5A 1CLFA 5CHCB 4DL3A 3N9UC 3NL0A 3G9CA 2ZDOA 2LCWA 3DMJA 3MM9B 2W9CB 1U09A 2OPRA 4CO5A 3DYAB 4X4SA 2GHVC 2ALZA 2CPHA 1WF1A 4B9UA 4TY8B 4DLEA 5C24B 4NLUA 3QO9B 2I38A 2XGPA 2FC9A 2UV8G 5DRKA 3B78A 2VQEF 3AJ1A 3CJ0A 3JSRA 3VWSA 1S10A 4OI1A 4H4MB 4QIFA 1CQMA 5HP1B 5IZHA 3HVWA 2YX4A 4LSLB 1FNXH 1NHVA 3ITHB 2DCUB 1VBXA 4WYWA 1Y0HA 1BD6A 1Z4UA 2E7WA 2GMJA 3CULA 2E1CA 2XZWA 4X4VA 5CD4H 5A2QY 4FF3A 4CTAA 3I56S 3NS6A 3LP0A 4IG3A 4TU8A 3GYXB 5D3GB 2M88A 3CIMA 2FHJA 3JYTA 1FJCA 3MEEB 4DSJA 2ZC4A 1HYSA 2DK2A 4HH1A 3MWBA 2IRXA 2QRRA 1U8SA 4OX8A 3M8QA 2HFZA 5L1KA 4JI3F 3WC2A 1LWEA 2PEHA 3FVYA 5CYMB 2FHJD 1P1TA 2WOMA 1OQ3A 4MK8A 1WACA 3L09A 4RW8B 2OPSA 4KFBB 1JLFB 2IM3A 3IS9A 3P49B 2AF6A 1TKTA 5F3TA 1VQYA 3OXLA 2DNYA 4WCEQ 3DLKB 4NLSA 5KFLA 5KG0A 1TL5A 2J0QD 3QJPA 4ZVEA 4CO2A 1S79A 5HMWA 5IXUA 5AE1A 1HBOB 1ZH5A 3IG1A 2W8LA 3KK1B 4HKQA 2OPSB 3UD3P 1YGYA 2YWEA 4NLWA 4ERDA 1S6PB 2R2TA 3CXCR 3VAJA 4A48A 2JC0A 3SI8A 5KFFA 2CPDA 1Q53A 2MSTA 3WX4A 5AJ3F 5F9NA 2CQDA 4F3QA 1RT2A 2VBXA 1RT3B 4ITSA 4JI8F 4HDGA 3MOJB 1WI6A 5CYMA 5IM0B 4EBEA 3U27A 3MM6B 3CCLS 5LMNF 2HG4A 1MROB 4BWJA 1NRKA 2HVZA 3ZZOA 4H4KA 5J1EB 2W9AA 2XMJA 2F7VA 1T8EA 3RRGA 4IH6A 2CPFA 1U45A 2KFYA 2B5JB 1NNDA 4JUZA 4ZDNA 2ZJPQ 5BYQA 3ONQA 3T5KA 4NMLA 1F5BA 4OHVA 5A0YA 1RTIA 2XS2A 3MHYA 1YHQS 1KLMB 5F8GA 1IKWA 3M1VB 4UOCA 1CC8A 3J7YU 3PV8A 1H98A 4X62F 3Q2TC 3DHXA 1A6LA 2HWTA 1KVJA 3SCKE 1T03A 1VQ8S 5FJ4A 2VA2A 2KDOA 4A8MP 3DN9A 1HBMB 1QJHA 3MMBA 3KLFB 3KLVA 1HBUA 3DYAA 5JVGQ 2VG5A 4QR1A 3NGKA 5DLFA 3QZ8A 2J0WA 2ASJA 5A0YB 1ROFA 5IT4A 3MEDA 3I4PA 2ZH2A 1HNXF 2IFXA 1IN0A 2D74B 1RT4A 2MQOA 2BOPA 5T41A 1Q8LA 3T5JA 2JZ5A 2BBEA 4C3LA 4DLGA 2LQJA 1RT7B 1JLQA 2DO4A 1U24A 5B0GA 3PKMA 1HWIA 1YJNS 3SQGA 3OJSA 1FJ7A 1VS3A 2F40A 3PIPQ 3I9V9 2F8MA 5HMZA 4OZ0A 5D77A 1FRHA 1M5OC 5IQQA 2HRYA 4ES2A 1APSA 4AL6A 1M90T 1OSCA 1J5EF 1QSSA 1V3SA 1C1CA 3DLGB 4WK3A 4HI1A 3WBZA 1YWXA 2LDIA 2YNIA 3HK2A 5DETA 2P6TA 5EWFA 2R8KA 3DLJA 2WB4A 5KT4A 2JEIA 2FVPA 1Y7PA 2CQHA 2LVWA 3A1YG 4ECTA 1RT5B 1S72S 4WE1A 2KVIA 1FK9A 1TK0A 4URSA 2E9TA 3IBWA 3POTB 4PG4A 1E6YA 2IAJA 4LQ9A 5BR8F 1NJZA 4WXOA 4R5PA 2DGOA 4GC7A 2F1FA 4I56A 4X4UA 1GNKA 2MHNA 1NH7A 1C0TB 1KC8T 4ZLPA 2UU9F 1H7WA 4AL5A 2DNMA 3ULHA 1TV6B 4OHYA 4QPTA 3GSDA 3U1LA 4YB5A 1X5SA 3CWJA 1WHVA 2JLGA 1LK5A 3RR7A 4F50A 5FDLB 4YUDA 4W92B 3RW7A 2V8HA 3V4IB 1YJWS 4NLOA 3HVRA 2ILYA 5BJRA 2R8HA 5F9LA 4YR2A 3V6KA 2AX0A 1F5CA 3N01A 2VKZG 4BCAA 4N41A 1HL6A 4WZMA 4J5OA 1IJFB 4XPEA 3IWNC 5J2NA 4DV3F 4DJBA 3VTIA 2J9CA 2IBKA 3AQPA 1UEVA 3M32B 3MD1A 3LF0A 1K0VA 2J9DA 3V6HA 2C28A 2BQRA 5KT3A 4I2QA 4NCGA 1UP1A 1QUPA 1EP4B 2RE1A 3BF4A 3N79A 4QOTA 4DMZA 4EFAC 2L9NA 4QWDA 3MR6A 4ZPBA 2C2DA 1J5OA 1SI9A 5J2PA 5LL6d 1IBMF 4A4JA 4EBCA 4MIWA 2DGWA 1HNZF 3OTDA 3HP6A 1Y5LB 1QAJA 4C11A 3M8PB 5J1EA 1YJTA 4CNYA 2M5YA 1F0XA 5GAGI 4IH7A 2HHTA 2DGQA 2DPIA 2GX8A 4EYIB 5E0OA 3CCWA 5B08A 4KHPF 1KQGB 2VFSA 2KFNA 3V4MA 2FC8A 2QLWA 2ATLA 1JLAB 1RDRA 1PO6A 1G1XA 2QLXA 2A2CA 2FJAB 3B4DA 3EGNA 1VQOS 4EYHB 1VIXA 2JFKA 1T3NA 4IO1A 2RDIA 4ECZA 3DLHA 1KQKA 3D0IE 2O3DA 2ZOMA 2AJFE 2CQ4A 2B51A 4WFZA 2B7CB 3FQKA 4Z2XA 3MR5A 2V4RA 2HMIB 3N6NA 3BO4A 5LXYA 2J6TA 1HBMA 5IWAF 1ZPVA 2EBGA 4FP9A 2KU7A 3OJUA 5KT6A 3TVKA 3KLGA 4PUOB 4QYZJ 1YG0A 2EI5A 1S1VA 2ZJRQ 2O1PA 4WFAQ 2LQ9A 2MQQA 2AJ4A 2VBZA 1S7HA 2BZ2A 3IR7B 4U7UK 2Y1IA 2MKSA 3IN5A 1RWUA 1K1SA 1SIZA 5AE3A 2BR0A 4C11B 5L39A 3CCES 1NK9A 1QLNA 3AA8A 2NREA 4YFUA 3H8YA 3MMAA 2ZH6A 1GTEA 4DSKA 3K5PA 3FRZA 4RZRA 4LMZA 2HVIA 1N0UA 1CSJA 4EO6A 3DFEA 2AU0A 4DL0C 1O51A 2M3DA 2HYIB 4NZ7A 5CYJA 1DBDA 4P7VA 2OH2A 3HVTB 2IJFA 3J7ZT 3CDAA 2XMWA 4N47A 4B3OA 3FZ2A 3CJ5A 4HH0A 5MLCV 1HW9A 1M5VC 2Q43A 3T19A 1IBLF 4YEAA 4ECVA 4LFAF 2B4UA 3RB6A 2E9RX 2AWZA 1YIJS 1T05B 1GAOA 3MM8A 4IYQA 2BXJA 5L1LA 5I3PA 2JEJA 2K1RA 1WF2A 1FA0A 2FHKA 2CVEA 2D3OR 1SJ3P 2IHR1 3BSAA 1KVIA 5C25B 1DJ0A 3DOLA 2DR8A 4K50A 1S1VB 2MKJA 4WFYA 4ED6A 3TAMA 3SEOA 1GH8A 1B0PA 3TO8A 1KOOA 4PXCA 3G8SA 2Y0SD 3S7RA 3SSRA 2QMWA 1SKSA 1KHVA 2PA3A 3PFOA 4IDKA 2Y1JA 1FRIA 4TXSA 4ZK7M 4Q8FA 3V6JA 1RTDA 1VC6A 4KSEB 4X4TA 2HZCA 4ZP6A 3NBPB 3EZ5A 1HPZA 5HBMA 1S0MA 2R9LA 5GADI 4O3SA 3KLFA 2DGTA 2DH8A 3FNNA 3OXFA 4QYRA 3TP2A 5JJBA 2CRLA 2R2UA 3MEGA 4EZ9A 3DRXA 2R8JA 1B7FA 2J5AA 3RRKA 2P9EA 2J8AA 4IG0B 3T6JA 3CCJS 4I6YA 1V6HA 2ZOFA 4H4KC 4B9NA 4ES3A 1F9FA 1X0FA 4IDKB 2UVRA 4UQGA 4PCQA 4GKKF 3E01A 3IA0A 4KBIA 1UJ6A 4JV5F 2V8DA 3DRPB 1ULRA 3BGUA 4CT8A 4I64A 4ED7A 5KFRA 2V9WA 2UXCF 4MIBA 2YWGA 4OLOA 2E1AA 1NZAA 3DXBA 2F9DA 3HFKA 5DS7A 2Z2LA 3N5FA 1HBOA 1R8BA 2FJEB 4USHA 3I55S 4LF8F 4FF2A 3BR9A 3OTEA 3US5A 3ZZUA 3LP1A 3H2UB 3JAMY 1U49A 1Q7LB 5D4NA 4WZQA 3GMGA 2DNGA 3AA9A 1A7GE 3CCSS 4A8YA 3HZGA 2YNIB 3MPVA 3DU5A 1X4DA 1X4EA 5EGYA 5LSLA 5F8LA 5KFQA 2X1FA 4ID5B 4LIWA 4RWXA 1LXNA 3DLEA 1SC6A 2WSCC 2KRRA 5L8RC 4KT0C 3GIJA 2HHXA 4PXEA 1LWFB 3BZQA 2J6UA 3POTA 3GIMA 2H9ZA 3GE9A 3N4WA 3M9NB 4JI5F 2FVRA 2CPXA 4WU2A 3SXLA 2LMIA 3QO9A 1TUVA 3CJ2A 1HNWF 2C3PA 3B4MA 3R27A 2IVYA 2IA6A 1LXJA 3O5TB 1BQMA 3MMCA 2FD2A 2JVRA 2MKKA 2ZE2B 3IWLA 1R8HA 2MJUA 4NL5A 2E1MC 1VQ7S 5K14A 2ROGA 3SV4A 5F41A 1TL1A 1UJ4A 4NRUA 4YB7A 2EFGA 1YSJA 1BY9A 3I5AA 3OPKA 4DN9A 3VAMA 4DV4F 3D28A 3IWXA 2G0CA 2DNQA 1IKWB 3M1VA 4YP3A 2DR5A 1XBWA 1BWEA 5A6WA 4IFVA 3K5MA 2KJVA 3BDPA 1NJYA 2XGQA 4I7FA 3I0SB 4BS2A 3AY0A 2ZOGA 2ZE2A 5KT7A 1XK8A 2PI4A 4N8NA 5K8OA 5KG2A 3OL6A 1ZTTA 3DLBA 3SCLE 5D6GA 4X4OA 3O1LA 2A10A 1SJRA 2FDNA 4Y2IA 3J81Y 1Q7YT 1D8YA 3ETOA 3K58A 3HMJG 4LFBF 3R1LA 1U4BA 1QAIA 2LYVA 3DRYA 2L48A 4ECUA 4ECSA 2XULA 2M7SA 3GV7B 2CKWA 4TKTA 4X2BA 2O5DA 3Q24A 3IS9B 2VPWB 4I1TA 2EKYA 2K1RB 3GFZA 3HT3A 4FBUA 4KPYA 3K5LA 2YNGB 3FSYA 2VBYA 5HO4A 1HI0P 2J6SA