1FDAA

Crystal structures of oxidized and reduced azotobacter vinelandii ferredoxin at ph 8 and ph 6
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of oxidized and reduced Azotobacter vinelandii ferredoxin at pH 8 and 6.
pubmed rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport(iron-sulfur)
molecule keywords FERREDOXIN
total genus 34
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1993-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fdaA00
1Y5IB 1B0TA 1KQGB 2WSEC 2FDNA 3MM9B 1IQZA 2VPZB 7FD1A 1Y5LB 2C3MA 1FRIA 1GAOA 2WAQD 2XSJB 3MMBA 6FDRA 2C3PA 1VJWA 1FEHA 2WSFC 3EGWB 1DAXA 1Q16B 1H7WA 2V2KA 3EXYA 1FDNA 3EUNA 2V4JA 2VPXB 3MMCA 2FD2A 1PC4A 1FRHA 3IR6B 1FTCA 4XDCA 3C8YA 3MM6A 1FXDA 1R27B 1XERA 2FJBB 5CHCB 1KQFB 1F5BA 2C3OA 1FERA 3MM7A 1SJ1A 1FRMA 4OV1A 2FJAB 1H98A 2UZAA 4KT0C 1B0VA 1C4CA 2FJDB 2VPYB 2ZVSA 2V4JB 4ID8A 1CLFA 1A6LA 4L6V3 2WB1D 1GTHA 1FXRA 2C3YA 2GMJA 1BD6A 3IR7B 1FRJA 1FDAA 2FGOA 3MMBB 1FDDA 1D3WA 3MM9A 2C42A 4OMFG 1GTEA 3OR1A 3MM7B 1H0HB 1BLUA 1G3OA 2WSCC 3LW5C 2Z8QA 3MM6B 1PC5A 3OR2A 2PA8D 3MMAB 5E7OB 6FD1A 1WTFA 3MM5A 3MMCB 3MM8A 4RKUC 1BWEA 1H7XA 1G6BA 1FRLA 2VKRA 4DHVA 1FCAA 5L8RC 2GMHA 1FRKA 3MM5B 1RGVA 4AYBD 1F2GA 5BYQA 3MMAA 1FD2A 2XSJA 1Y5NB 7FDRA 1AXQA 4Y28C 1IR0A 5FD1A 2PMZD 1F5CA 4XDDA 2O01C 1BC6A 3OR1B 4CI0B 1FRXA 1KEKA 1GT8A 1DFDA 3GYXB 1JNRB 1JB0C 3IR5B 4XK8C 1C4AA 2FJEB 1JNZB 3PNIA 4YDDB 2C3UA 1BQXA 3HKZD 2PDAA 5CH7B 1Y4ZB 5BYRA 1HFEL 2IVFB 1SIWB 3MM8B 1FF2A 1FDBA 1K0TA 3OR2B 5BYSA 2VPWB 1SIZA 2Y0SD 1DURA 1ROFA 1B0PA
chains in the Genus database with same CATH superfamily
3CJKB 2ZUGA 1RK8A 2HGMA 4DU8A 3TZWA 1TKDA 1JLAB 1LW2B 4P9SA 2ZFHA 1RHJB 2WRMA 1RBOB 4HHHA 1ZOTA 2VPZB 3BDEA 4USWA 4DL3A 1FRIA 2HMIB 3AQOA 3OQ2A 2F4VJ 3H5UA 3GSDA 4ZHRA 2DISA 3OTCA 4C7QA 2C3PA 4LR9A 3IMQJ 3SCKE 2BMBA 1HBOB 3ULHA 4OYBA 2GC8A 3DCAA 3DN9A 1DQ8A 4RO0A 1E6VB 1DAXA 1QJHA 5IWAF 2PD1A 4Y34A 4MK9A 3G71S 1SH0A 2DR7A 1DJ0A 2V4JA 4U8VA 2E5IA 4NCGB 1X31C 4ZVUB 4F0HA 4TU9A 5ETLA 4PABA 1OO0B 4U67Q 2UV8G 2HNZA 2KZZA 3T9ZA 3KUGA 4R5PB 4FP9A 3OL8A 2RF2A 2AGQA 1FFSB 1AA1B 5ETMA 1TK5A 5A6WA 3MR7A 5KFWA 3DU5A 2DKOB 1F3VA 2HHUA 1NEEA 1ZPVA 3HSGA 4ZJOA 3FK4A 3I9ZA 4BWJA 4P52A 3BGUA 3R5AA 4PXDA 2K3KA 4FS2A 5KFZA 3T1YF 1DTTA 2H48B 4C4WA 1BWVA 3VVUA 3DLKB 1H2UX 3DI6A 1T05B 3CJQA 2CQ3A 3FBFA 4YB6A 3BSNA 4JI5J 2KFNA 5HVFA 1GTHA 1FWPA 2AF6A 3BQ1A 4QCLA 3MPWA 2QT7A 2V8VA 4WFZA 3CF5Q 3GR1A 2NREA 2W9CB 3K58A 2JOQA 1NRKA 2F8EX 4DFMA 3AD8C 3FUYA 3BBBA 3KHHA 4YB5A 1OY8A 3RB0A 1NJYA 1N6QA 4KBIA 1SKUB 4JP8A 4OZLA 5L38A 3G96A 3VAMA 1SPBP 1UEKA 5HJXA 2EKNA 3DMJB 3DNCA 1GTEA 2CPEA 3HKWA 2QMUB 2XYPB 4Y2KA 5K14B 4NYZA 4QWAA 1C2PA 2OSQA 2F8HA 1RZMA 2GJ2A 1FXLA 2JRSA 2YKNA 4Q2MA 4RW4A 4U7UD 3T9NA 2LCWA 1RTHA 4C6AA 1FKPB 3VAKA 3KDOA 1MMLA 2ABYA 5CYQA 1ICEB 1NJIT 3K2YA 3PW0A 5HQLA 3H5SA 2HHWA 2E5GA 4HACB 1GNKA 1FK9A 1WACA 4Y2AA 4DR6F 3SQOP 1TL7A 2GVDB 3RBZA 4YB7A 2V63A 1S6QB 5A8KB 2YWEA 1LW0A 1ZYQA 3J7YU 2W2MP 5C42B 4NLVA 4KPYA 2J7UA 2GZOA 2KT3A 3T5JA 3A4TA 3SYZA 3ZO7A 4I7FA 2CZ4A 4DR3F 1IBLJ 3DXBA 2WCXA 2CJQA 3KLIB 4IH6A 3DMJA 3TEHB 3GIIA 2P9CA 2F4VF 2CQPA 4PR6A 1JB0C 5T7LA 4I6WA 3DRRA 3MECA 4P2SA 4CYUA 2DT9A 4X4SA 2D1CA 4ZVEA 2EFNA 3UR3C 4ED7A 1OYEA 4G1QB 1U8SA 3HKZD 1S59A 3PRBA 3QIDA 3DLLQ 1V3ZA 3PW7A 4G65A 4DV0F 4HACA 5KG0A 2VZ9A 2B3TB 4LFBF 1RT6B 3D0HE 1RWKB 3W9HA 5FLXU 1F9FA 2I8EA 5GAHI 2ZHBA 1K0TA 4MIWA 2XO6A 2JLGA 2AMCB 4F0MA 4WFNQ 4RU9A 2ZD1B 2BQRA 2EK1A 1YJTA 3G87A 1FJCA 2RU3A 2VH7A 4JV2A 2KXFA 3M05A 1A0OB 5KFNA 2HWIA 3PR5B 5F0WA 1W2IA 2NXNA 3CT9A 1X4DA 2DITA 5HMYA 4LFAJ 5K8MA 5F8LA 4Q44A 4ECVA 3OFFA 4MFBB 3UE2A 1QE1A 3CWJA 3HHLB 2DNLA 2XSJB 3I5AA 3M9MB 4WPAA 1Q86T 3OBIA 1GQEA 4X2BA 5F8HA 1S97A 4LR7A 3SIPB 1CC7A 4IKAA 1U4BA 3C66A 4DPXA 1GMUA 4PUOB 4WCEQ 1FFWB 5C24B 4PPZA 1S1UA 4A47A 3GJSB 4WIIA 4X66J 2D3OR 5C25A 3UWTA 1URNA 5JUMA 4UQTA 1NDKA 1SJRA 3M8PB 3GIJA 1WC3A 3UN3A 4CH0S 1SC3B 1Z2LA 4N5SA 3G82A 3TAPA 3W63A 3D5MA 2ADBA 1VK3A 1XQIA 3KK2B 1RAOA 1KTVA 1T8EA 1SUQB 1NK8A 3GJTB 5L1LA 4PXEA 4DN9A 1HQEA 5EX3A 4PYDA 4HR2A 3M2RA 1GEHA 2B56A 2YWHA 3QYYA 2RDJA 3T5HA 4ZPAA 1JXLA 3MR3A 3POTA 3SSSA 3CMES 2GAGC 3BN4A 2AWZA 3S6EA 2HVHA 1NHKL 3V4IB 1GMWD 2KXHA 4XTTA 3TVYA 1JLCA 1UVMA 4WYWA 5A8RB 3WC2A 1WSRA 2QA1A 2HNYB 2JDJA 2KRRA 2WONA 5KG1A 3V5RA 4WIQA 3R7SB 2E1AA 4LRBA 1YI2S 1S0MA 4KH0B 2ZDOA 3OR1A 1TKZB 4OYAA 3C16B 2HHQA 4ILRA 5DG7A 2J0QD 2ZVIA 3MEGA 5E33A 1HHTP 1H0HB 2HNYA 3G8SA 4DR7J 5KFRA 3UPFA 3KXDA 3HP6A 1L3SA 3GYGA 5DGBA 5AE3A 1T95A 1PC5A 4USHA 1PAEX 4J9SA 1Q8BA 3OL9A 3V4IA 2DRBA 1U02A 1QAYA 3PJWA 5CA5A 5LMNJ 4FS1A 1LK7A 2VA3A 3DRXA 1EQMA 4UUXA 2EBEA 1U2RA 3KLFA 3SV3A 3CGIA 2GVDA 1G6BA 2V2ZA 4XPEA 4DQSA 1Q82T 2ZDPA 3VAJA 4A8WA 2DD8S 2HVIA 2HLTA 1ZAVA 3SQGA 1T02A 2QLBB 1Q5YA 5GADI 4MJKA 1HNIA 1RTDA 3R2DJ 1FD2A 1R0CB 3JQMA 2J8AA 1NMEB 1FX2A 1VQ4S 4Y28C 1IR0A 5JVGQ 1V5VA 2R3VA 1XK8A 5A76A 1F5CA 2GX8A 3TUZC 1RHMB 2HGLA 2MMYA 2OO4A 2P6SA 1NPKA 5M2UA 1IBMF 5G0RB 3IBFB 4DQPA 3EGZA 4TQSA 2CADA 5HSPA 2GQQA 3PNIA 4K4UA 5KOWA 2DB1A 2ZBRA 3QAUA 5BR8F 1N48A 4I68A 1NK6A 1N54B 3I5BA 2K7KA 4UQGA 3CC7S 1FE0A 1X4GA 1YHQS 3FFIA 1RAIB 3QRQA 2NZ4A 5E5NA 1SC6A 4FYXB 1TUVA 4KKOB 1VBKA 3W2WA 4QU7A 1H3DA 2J0WA 1JJ4A 1AT1B 2VU5A 3MUVP 5D78A 4EZ6A 4JI6F 2JC1A 4MT1A 5HI7A 4IG0B 4K4TA 5HN0A 4ZVTB 1CULA 4OYOA 4QBUA 3TVKA 2VG6A 3EZUA 5GAGI 1VBXA 4KY3A 1PYSB 3J7ZT 4Y6IA 2WVDA 3DM2B 4LQ9A 2UXBF 3R27A 4IG0A 4M5NA 3THPA 1KR4A 2E44A 3E01A 4ZLPA 1BXNA 5KG2A 4FBUA 4OHZA 4FVCA 1BQNA 2D74B 4F3MA 4JI2F 2AZ1A 4QWBA 2OUGA 4PWDB 2IHR1 3DYAB 4NLPA 4O3QA 5HQ8A 4RPFA 1Q16B 2HSEB 1RE1B 2JC0A 2OGUA 2HFUA 3M6VA 4W98A 3Q8PB 3CPWR 2BOPA 1ZM9A 1S9EB 1GX6A 5AXLA 1V9OA 4ZP7A 1RXOB 2E9TA 1JLFB 4USMA 4L72B 3JAMU 2RQMA 3TEGA 3BGRB 4JI1J 1U6BA 4K2XA 1CS4B 2YVSA 2ZUAA 2FB0A 3KLIA 4U95A 4DFJA 3OSPA 1HNXF 4LF4J 2MKIA 1HBUA 2DBBA 4IFVA 1KQFB 3NP5A 1RHQB 2C2DA 5KFSA 2VA2A 4R8UB 3TX0A 2ZZNA 4KHRA 3FQKA 4Q7AA 2FVQA 4BC7A 4E2FB 5DETA 1OQ6A 3GYNA 2V0NA 4JV5F 1ZM3A 3HD1A 3I0SB 2AGPA 5EWEA 3ISZA 1KWMA 4C8ZA 1S1VB 4IOBA 1P1LA 3M2UB 4CO1A 1S1XB 3T5KA 3HFKA 1NDPA 1ZAXA 2MZQA 3BS9A 3IR7B 1RJJA 4ZPCA 4BBYA 3W3SA 1KQKA 1VOMA 2E29A 2RSQA 2LDIA 3DGPB 2IMOA 1BQNB 3MMBB 4KV8B 3AB2B 4DR2J 1HA1A 3M2RB 4F7VA 3UN2A 1FDDA 3QRRA 1G4CA 2VC1A 3GLJA 1IKXA 3PY8A 1MG7A 3DOMA 1TL1B 3ZTRA 5K14A 1IBKF 2OTLS 3IXQA 1CJUA 5CAAA 2V50A 5KG6A 3M32B 2LA6A 1PKUA 2Z2LA 1DQAA 3D66A 5G4DA 3PR4A 1B3TA 4O3RA 2YWKA 2XB2D 2Q6CA 3TQ1A 1YRTA 4OYPA 5J2NB 5F9NA 1S9FA 3CB4A 4O0NA 5F8NA 4CWBA 1RT3B 3HHEA 2CXEA 3Q24A 2NXUA 4ITSA 4TXSA 3M8SA 3OJUA 1GXLA 3TA2A 2XMJA 1H7XA 3EMTA 1WF2A 2X3DA 1C0UB 3BJYA 3R5GA 5JMNA 3NGDA 5J2MA 3JS9A 1NH8A 2QSFA 4NA1A 2Y9HA 1Y00A 3BGLA 2HS0A 2C2KB 1QVFR 2XCAA 1RAAB 3QZ7A 1HD0A 2QN6B 2XSJA 1UTAA 1IKWB 3NS5A 4QYRA 3M7VA 2R2TA 1VC6A 1VK8A 4DS5A 2WTFA 4DUTA 2ILZA 4WFAQ 4YOEA 2GAHC 3OW2R 5LXRA 1Q95G 1S4EA 4F0KA 4YB1P 4XPCA 1DARA 4FYWB 1QAIA 3OXLA 4MIAA 4X64F 4NOHA 1HNZJ 1JNZB 1NM2A 2ZD1A 4DQQA 2ILYA 1LOUA 4QW9A 2BR0A 1NKBA 4M8LA 2C2OB 5IOLA 1N4LA 2PI4A 2PEBA 3OVSA 3DLGA 2L08A 3PTWA 3TANA 4NRUA 4F3QA 2ZJQQ 2R8GA 3W5YA 1QTNB 1WF0A 3UQSA 2AJ0A 3IN5A 5KFOA 2X7IA 3R5BA 3AD7C 1XC9A 1L5UA 4YFUA 4J9RA 5GAGU 2HAFA 2F4FA 4NLOA 2YKMB 2BV3A 2YNGB 1RWXB 3FEYB 3VGUA 1RT7A 2M70A 4P7VA 5BYSA 3OUYA 3CUNA 3RAQA 1F6TA 1U1KA 2MKJA 1IXKA 1YDLA 1PGZA 5D3GA 3ILIA 5KG4A 3HVTB 2CZVC 3M32A 4QIVA 1RP5A 4BS2A 4GRSA 1N5YA 2A0FB 3R97A 4OJGA 2J9DA 3N6LA 4O4GB 4ATNA 7FD1A 5D3GB 3NL0A 4X4RA 2ERRA 4H4OB 3FDSA 3ENQA 3DDKA 2WAQD 3B54A 3HULA 3MEKA 3R6LB 3VGVA 1RISA 1JLQA 2XLJA 4K0KJ 2UVRA 3NRBA 2CPHA 4YHHJ 2ZM6J 1R3NA 2CQBA 4DJBA 3PV8A 2FY1A 4ZLLA 3CDBA 1LWEB 2NXEA 1WG5A 2P9EA 3W65A 5K9FA 1ZBTA 3LAKA 3MPDA 1J2VA 1MWQA 1WG1A 1NSQA 4MYTA 2LA4A 3GG0A 1OPIA 3IC1A 4EWTA 3LWLA 1S0OA 2G2OA 2P9GA 2HBYB 4UUWA 2G1DA 3W2VB 4L3KA 1TAUA 2IA6A 1XERA 1HW9A 4R0JA 4UTGA 4I2PB 2RHQB 5ETOA 4ZJLA 3KK2A 5GVQA 2GO8A 1U47A 1WDDA 4OI0A 4CLYA 5L9NA 4ED2A 3D6HB 1IKWA 4D3HA 4OL8A 3JSBA 3HDSA 4PEOA 4E8UA 1RWNB 2O1PA 3I32A 4KT0C 1NKEA 1B70B 1KLNA 2RS2A 2HVEA 2XNQA 4LVOP 3RW7A 2W9CA 2BJDA 2PSZA 1A6LA 3FBEA 1AYEA 2CQIA 4ZITA 4AE5A 3HMJG 3F73A 5DQHA 4ECYA 2FQQB 1K1SA 1U0SA 1XEZA 3TAQA 4ZN3A 5H9FK 2F1FA 1IR2A 2IVYA 4LF9F 1ACMB 1RT1A 2CG8A 5KT6A 4FF1A 4GC6A 2EG2A 4WP3A 3GCWP 3C14B 1FDAA 4DSFA 4HH1A 4DMZA 4G6VB 1OJ4A 4PG7A 8AT1B 2F7VA 3NCQA 4P2MA 2QFIA 1YG0A 4RW6B 4RW4B 1TAQA 3GQCA 3CCWA 1CPZA 1RT2A 1UVIA 1S6OA 3NXZA 2C28A 2DNNA 2Q3PA 2UUWA 1FT8A 3MGJA 4IFYA 2YH0A 4ZPBA 2ACYA 3MM7B 3T41A 4C98A 3UDLA 1BY9A 1KKHA 4I2PA 2WVCA 4AL5A 5JJBA 2KZMA 5J1EA 2ROEA 4HKQA 2JNJA 1T3OA 4ED6A 2XY6A 1M5SA 2Z8QA 3OR2A 5KFAA 1HNZF 2AJ1A 3BSOA 1NDLA 3A3OB 4F4KA 1N5SA 2E66A 2XI3A 4EEYA 2UXBJ 3ZZPA 3RTVA 1YJ7A 1T9UA 3BGOP 3I0RA 4H4MA 2RKIB 2W2NP 2MLYA 3ZZYA 1KOOA 2LDYA 2KFZA 2ASDA 3J81Y 2GIFA 3L09A 2VG5A 1ZZFA 1E6YA 2PGCA 4M5KA 4JI6J 4CLUA 2COLA 4EI2A 2JLFA 5C2CA 3CXCR 1S10A 2QC3A 4RUAA 2RHSB 4ZIVA 2LU1A 3GV7B 4M5GA 1VS3A 5DG9A 2KJVA 2QE5A 3VHQA 4J9LA 3BZQA 3GJRB 4LF5J 4LMZA 2K1RA 1TELA 2HRTA 2MY7A 1KEKA 1KONA 4N7TA 4DUZJ 3RR7A 4QWEA 4K0KF 1LXNA 4ZJQA 3FMBA 2BJ7A 2F65A 2N4DA 1YJRA 4FYYB 4HDHA 4DF8A 4CO0A 4Q8FA 2Q66A 3JSMB 1WKKA 4FZVA 2OD4A 3GFYA 5B0CA 1UVNA 3KLGA 4DV7F 1LEOA 1NBEB 5KAKA 4FNHA 5F8IA 4R0EA 2IDLA 2XHCA 4DSEA 2GV1A 3C46A 3VAGA 2KM8B 2Y8YA 1CJTA 4RUBA 3QRPA 3OR2B 4RUCA 1YGYA 1WOPA 1VRTA 2MQQA 1EAYC 4M95A 5IV3A 3B4MA 1T0TV 5RUBA 3C19A 3K5MA 2BJ1A 5F8GA 1X5OA 2MZTA 5GAHU 2XLIA 3G6ES 2B4PA 2FDNA 4IQMA 1HYSA 4LRAA 1GXUA 5ETKA 4RW6A 1UVKA 2CNLB 2JX2A 2E9ZA 2EFQA 3OUYB 2LXIA 2V68A 1R0BG 2MTLA 4F2SA 4DV4F 5C24A 1FEHA 4HVZA 2WSFC 4M5JA 2KYZA 3T1YJ 1EP4B 5AXKA 2XM3A 1G1XA 4U7UK 4DL2A 4ZKAA 4RW8B 2V2KA 3M8YA 2H5IB 3GIMA 1VQPS 1HD1A 1RABB 1VRUB 4CO3A 3J81U 1PC4A 4H4KC 2M3DA 4AL7A 2RS8A 2J7KA 1MU2A 1HWUA 4WFXA 5J2NA 2DXDA 1XR6A 4ZOSA 2CNNB 2BX6A 5EHHA 2WB4A 2ZC3A 4OZ0A 1JXEA 2H5EA 3KK3B 4OI6A 4CO4A 1T03A 5KFKA 3WQPA 2DO0A 4YUDA 3MEDA 3TAMA 1PBUA 1SH3A 4M1KA 5D15A 3TYTA 1T7PA 4L74A 2YPZA 3H5YA 1VRTB 4I4BA 1C4CA 3VGTA 4DUYJ 2Z4PA 3O44A 1SI9A 4FVMA 4OV6A 1VGYA 1I5OB 1IKVB 1WI6A 4IOAQ 1U45A 2AZ3A 2BJ3A 2J5AA 4ZDNA 2CWXA 4CQ1A 5DM7Q 3MDFA 3EYZA 5HBMB 1EJ7L 1U25A 2D9PA 2GVZA 2QYGA 4FF3A 3JSMA 2D41A 1U49A 2FGOA 2FZKB 3VZIA 2NLWA 1AB8A 2D3UA 3T19A 4B9UA 4AXJA 3DOKB 1CJVB 5MLCV 2OI2A 3THTA 1HNWJ 1R43A 1SQGA 2YQ0A 2XMMA 3BF4A 4QIFA 3RJMB 2OPPB 2B9EA 4RWWA 2YQ3A 3G9CA 1HLWA 2QJ3A 2IJFA 2W01A 4QWCA 2XS5A 3N4WA 3OTOJ 3HHDA 1LWXA 4DR6J 1LWFA 3MAQA 1PBAA 1RAGB 2WBMA 2Y1RI 3ET6B 5CD4A 1HBNA 2YKMA 2DTJA 1FEEA 2WOMA 1T11A 2YNGA 4MKAA 2IC3A 3PKMA 2GVZB 4UZCA 2JZ5A 3ZNJ1 5D8HB 2GGPA 4K4WA 4N76A 1PCAA 4ETXA 5C7PA 1L3UA 1RDRA 1HNXJ 2V5HG 1BUXA 3IFEA 4PQUB 2CAJA 4LSZB 3I9V9 2GMHA 1NO8A 3LOUA 4KO0B 4JYAF 3RBXA 2I2YA 4GKKJ 2OELA 2RUSA 3BPSP 1RTJA 1S6PB 2VOOA 1ITPA 2C2ZB 2OPQA 3NGRA 4ETZA 3TJAA 3HJFA 2NS1B 3IGNA 5FD1A 1G2EA 1FVQA 4NLDA 2IJNA 3PYEA 1NJZA 2LQ8A 2NCKL 2O01C 3DM2A 3JQKA 4FKYA 2DGVA 2VUGA 2XY7A 2UVWA 1BC6A 2H9ZA 1N52B 1NDCA 2ZBIA 3QO9B 1UPPA 3BQ0A 2HFSA 4DR5J 1WC1A 3RU0A 2DH9A 1N32F 4ID5B 4RW9A 2CQGA 2XWXA 4ZVGA 2M9KA 3L95X 4TKTA 4ECTA 1X5TA 2DHHA 3BO2A 3V81A 3HT0A 4GKJJ 4RBUA 2FIUA 2RE1A 2K06A 5EDWA 1U6ZA 2KJWA 1U1OA 1HMVA 1FF2A 4NXNJ 1NPPA 1RACB 2CQCA 3ENWA 3BEGB 4GVBB 4X4PA 4P74A 5B7WA 3A8KA 3D4JA 4DN0A 2AYBA 3A3PB 3HHLA 4LF7F 2BM0A 5KFMA 3K0JA 2BJ8A 3LWMA 1HPZA 1RYRA 3NGSA 1LWCA 4Y0FA 2UUBF 3AJ2A 4KJIA 3P3DA 3QNWB 3ILJA 4A8YA 1IQZA 3RAXA 2N3LA 3VQTA 1HPZB 3ZZZA 2B0GA 3ETMA 1UJ6A 3R6GB 1RCXB 3PW2A 1ZH5A 1UWAA 2ZOMA 5B0GA 4YN3B 4K7QA 1RADB 3BBFA 6FDRA 5HVHA 2MJNA 2PFDA 1TL3B 4Y65A 3PXGa 3L4BC 4LF5F 2M8HA 3V6DB 2NSCA 4WXOA 4WXWA 3CIZA 1WI8A 2BVZA 1R8PA 4C3LA 1S1XA 3SV4A 2CKWA 2V94A 3NNAA 3C15A 1ZS6A 4L75A 4PQUA 4J9MA 4ANCA 1IUJA 4RUHA 1WUUA 3EDQB 2LYVA 1HBOA 3P8BB 2JEIA 1S9GB 2ZH1A 3I6PA 4Q43A 2VBWA 3IM9A 1UEUA 2HQ3A 1VQ7S 3U27A 3CJ3A 4QIEA 2F63A 4IQXA 3OVBA 2FJBB 3OXGA 1LXJA 5CHCB 2EW9A 4RZRA 1VBYA 1KRPA 3MPVA 5HVGA 4OX9J 3VWSA 5SUHA 1YBUA 3GONA 2HRYA 1VRQC 2CPZA 4BC9A 3W62A 4N56A 2VQFJ 4PAAA 2VODA 2Z57B 2CQ1A 1TK0A 2MZSA 5DGAA 2VPYB 1W25A 1RT7B 2ZVSA 4TY8A 4WTYA 4OI4A 3D1OA 3W5ZA 3AOBA 5KFQA 4NMXA 3GFZA 4L6V3 4ZVFA 1P27B 4C0BA 4HEA9 3QGPA 1ZA1B 2C3YA 2GMJA 3ETOA 4U9RA 5EN1A 3CC2S 2NR0A 4LF4F 3K8WA 1WD6A 1C0TA 2CJ9A 2IJRA 2KFYA 2Z58B 2HHHF 2BW7A 1VQMS 3BREA 2G9OA 4DBQA 4N8OA 1WTBA 5EWGA 1SJFA 2AJQA 4FDFA 1D3WA 5DO2A 4C8NA 2CZ9A 4DOZA 2AQ4A 1TTHB 4OYIA 2APOA 2BRKA 2DYAA 3H5XA 2IDEA 1J5EF 3U02A 2F9JA 2RDDA 4BDPA 1EQ0A 1Y0HA 2W24A 2O67A 3E8OA 4MKVA 4MK8A 5K5MA 3MTKA 1U2CA 2WSCC 4NCAA 1G7CB 1X4FA 2EVZA 3VTIA 4KGVB 1WWHA 2M7SA 1N5QA 1RTIB 4IDKB 3R5DA 4DL0C 2DPJA 1Q1KA 1H38A 1X60A 4WK3A 3MM8A 1IBKJ 1A9NB 2ZKUA 1TMJA 3RBDA 1YITS 1WEYA 2E1RA 4A46A 1NZ8A 4NXMF 1FCAA 3C6TA 4DR1F 2HQFA 1H73A 3CJRA 3MHYA 3V6DA 4MMOA 5LXYA 3CMAS 4F2RA 1XNQJ 2FVCA 2EWHA 2Y1LB 3VCDA 5L1IA 4CNYA 3LP2B 2OPSA 3HSZA 3P96A 1JLBB 5A2QY 3FCVA 4CP5A 2CPFA 2CJYB 1N8RT 4CT8A 1CJUB 1NK9A 3TUJC 2BDPA 1SV5B 3FZ2A 1DFDA 1HWIA 2B4VA 1EKSA 3A8EA 1RBAA 3DHWC 2L9NA 1RTJB 2KG1A 3N0VA 3QSIA 2KTQA 5A8WA 2YNFA 2R7OA 4X84A 4U96A 1OQ3A 2AT1B 2DRAA 5IT9U 2B9XA 1SC1B 1HI1A 4DV1J 1NB7A 2FC8A 3A8JA 6AT1B 4ECSA 1LWEA 4JI4J 2J6TA 3MFIA 2IVFB 1IM4A 2ZWOA 2KT2A 3O1LA 2BQ3A 3AA8A 2KXNB 1RA6A 2FJWA 1WDTA 1MNEA 4DL7A 4ICLB 5IV4A 2V9WA 4W92B 2R7VA 1TK8A 1N34J 4QOTA 2R2UA 3H8YA 5H9EK 5CYJA 3CD5A 2GA7A 3R5JB 4AFFA 1VIOA 5KFYA 2BA9A 4DWIA 3KJVA 3GFXA 4KRWA 1N88A 1Q8KA 4URGA 1RWMB 4YMEA 1O6XA 2WONB 3W61A 3T6BA 5AXNA 4HT7A 2RB7A 3GB0A 3TNVA 2BEFA 1WOOA 3FBBA 1YIJS 1XMOF 2OPQB 3D9BA 2NYHA 2ZE2A 4L73A 3SCIE 4ANDA 1FESA 1N5VA 5KG7A 2Z30B 1VJWA 1FNMA 1JLFA 2LMIA 1RT6A 4ZPDA 5H1SV 3S1TA 1CG2A 1KVJA 2VFRA 3VZHA 3CJ5A 3EGWB 4NLWA 4C8LA 1TVRB 2KVIA 4URQU 3HJVA 2GHPA 3H2LA 4WP8A 4HH0A 1RLCL 2L3MA 3H4BA 2VPXB 4Q45A 3MCSA 2D3ZA 4NLYA 1YRUA 3DRRB 3MECB 2W8KA 1SL1A 1HBNB 3FNNA 1R27B 1SBRA 2V8DA 2DH8A 1LK5A 1H72C 3HF5A 3H2UB 2C3OA 1PSDA 2HFZA 2RJZA 2RT3A 3M4XA 4P6QA 2JEJA 2FUG9 2H3EB 2JH3A 3H42A 2XO7A 4MYUA 2VASA 1TKXA 4NLRA 2XS2A 3BGRA 1U1RA 3TZYA 1XIQA 1F9EB 2VG5B 3UVJB 1FKOA 2VBYA 5HMWA 2KM8C 2PIIA 3PX0A 4X4UA 3C14A 5HP1B 1AFJA 3VAIA 2VF3A 1YRXA 3KDNA 2UXDF 3ILOA 1RQ0A 2QL7B 1VIXA 2XMVA 1YJUA 4Q2LA 2XMWA 3CCTA 3DKDA 2VKZG 3EVWA 1OMSA 2IYGA 2H1YA 2AHOB 4OJ3A 5I3UB 4DR2F 1SQEA 5KFBA 4CO2A 2CYYA 2JJ4D 4DV3J 3KOAA 4LRCA 3I96A 3VVTA 2AW0A 3UD5A 3MCMA 1F2HA 1TP7A 4LBIA 4S0MA 3Q8UA 1SV5A 4A8SA 1RI7A 4M5DB 2LFVA 4X4NA 5DS7A 4OQJA 3D28A 5LMUF 2DEIA 2OSRA 2GS8A 3NGKA 2BZ2A 4ZP8A 1U1PA 1T03B 1R0AA 3IA0A 1JLBA 2M52A 4DV5J 4LQ3A 1G3OA 1AZSA 3P5TL 1XJWB 2HFNA 5ETQA 4YR3A 2UVUA 1RWVB 1S6PA 4KTQA 4AT1B 5CZXA 1LV5A 2Y8WA 5EUHA 2KHDA 2J6SA 3S7RA 4C3KA 2IBOA 1OSDA 1UEVA 4ES2A 3J80Y 3DLEB 4V19J 3IWLA 4B3OA 1K0VA 2J6UA 3P5BP 5A6PA 2E7XA 1OY6A 2OPRA 5CYMA 1I3OB 1WHXA 1SB6A 3M2VB 4IH7A 3PW5A 1MW7A 2KN4A 1JXVA 3CE8A 2VFTA 4LSLB 4B08A 3EVOA 2Z56B 3OV7A 1M1HA 1ULRA 4OI2A 4LFBJ 2FPHX 2HZVA 3WC0A 3R9LA 1D8ZA 1WSVA 4USTA 1FFGB 2UUCJ 4JI2J 3OR1B 2CNKB 2DNHA 4B9SA 2W1BA 4A8MP 2XLKA 3D54A 4K2JA 4ED3A 2BE2A 1KSPA 1LW0B 2XS7A 2FJEB 3HFVA 4NCGA 2BRLA 5E3RA 4RR5A 2JVRA 3AJ1A 2DNMA 1BQXA 2UVVA 2M4MA 1Y7PA 3BPDA 2I38A 4ZPWR 3ZTQA 7AT1B 4IOCQ 4DLEA 2XHWA 2QMXA 1IR1A 4EBCA 2EFPA 3MEEA 2VBXA 3W66A 5D0GA 4JI7J 1HYSB 2HG4A 1ZTTA 1K47A 3QGIA 4DU7A 1FKPA 1KBRA 3RB6A 1GFWB 2H4YB 1I51B 2QL9B 5DDPC 3HVRA 3GWCA 3CJTA 3BSAA 4JV5J 3G8QA 3KNAA 4X4VA 1TKZA 2RQ4A 4DPWA 1SUQA 2WSEC 3OFEA 3MEDB 3TAMB 4WFYA 3LTOA 2N3OA 5IZHA 4GVLA 4K4YA 1X0FA 1YTYA 5L1KA 1JLGA 2MPUA 2OPSB 2NYIA 4HL9A 1I94F 3EJMA 3H90A 5ETSA 3E3XA 1GK8A 3TJ9A 2R7WA 3W8GA 2CJKA 3AXKA 2W7AA 1FWKA 4PZVA 3POTB 2R7TA 3C6TB 1B7FA 2JLEA 1S57A 1VHIA 4OZJA 3ZZTA 3MOZA 1S5ZA 2BANA 5LMUJ 1VQ5S 4QR0A 3GR0A 2KVQE 1HBMB 3JYTB 2YNFB 1S79A 2J0XA 1S1TA 2H65B 2XSFA 1RU2A 2KHCA 2MHEA 3L9ZA 3Q2SC 4NZ0A 4USVA 1FTCA 1H6KX 1QVGR 1JX4A 2CPYA 2UP1A 4DV3F 4IG3B 3CO0P 2QA2A 4QWDA 3K57A 2EXUA 1NU4A 3Q8YA 4JV0A 4LF8J 2ZKTA 2EC0A 1SJ1A 2ZITA 2FTRA 4JI5F 5EX0A 2OKQA 4Q8EA 2ZJPQ 1I1GA 4DV6F 2GHVC 2ZZTA 1SL0A 1HNIB 1RTDB 1R6VA 5H9EJ 3OT9A 3PVXA 5B0FA 2HIQA 3N28A 1N36F 3V6JA 3SCLE 3IAM9 3PM9A 3OLAA 2B4UA 3R5CA 2K2PA 2XULA 4B9TA 5ETNA 1X9MA 1KFDA 1FXRA 1EP4A 4AQYF 3GILA 2LQBA 1X5PA 2N7YA 5DQIA 4J9VA 2MKCA 3I0SA 1F60B 4LUBA 4LIWA 4C9DA 1MROA 2W9BB 4CTAB 2YKPA 3FC9A 2XMAA 2RQCA 1NH7A 3EICA 1H2VZ 1YZ6A 3IS9A 2JFKA 2W8LA 3MAHA 2YXLA 3DOLB 1QUPA 1PG5B 4OMFG 3VF0B 2B43A 3TI0A 1B7YB 3NMRA 4NXNF 3CJ4A 3ZZ0A 2CJBA 4Q0BA 2BKPA 3KWMA 4KFBB 1WF1A 2PMHA 3QWPA 3W2VA 1KFSA 1JLCB 3DGVA 1WJ9A 5E2QA 1VQNS 1S9GA 1ZTWA 1CJTB 4XAKA 3O5TB 5E7OB 3VR1A 4JI0J 4MTPA 4ZVPB 3MM5A 1R8AA 4WK1A 5DRKA 5U47A 3GV5B 4ECUA 2D3O1 2RRAA 4Y2CA 1TL7B 3QT7A 2XEXA 2HFVA 3C15B 4M5IA 3I5CA 3LO3A 3QFHA 3PRDA 4DHVA 2ZH5A 1C1CA 3MM5B 4KE5A 4OX8A 3W64A 2DGUA 3PJXA 2N82B 1RAHB 1UFKA 1RKIA 4NZ6A 2QLXA 1S7HA 1JMTA 4ZLJA 1JJCB 4I7FB 4UT4A 2R7RA 1D9DA 4JYAJ 2AEFA 3AXMA 3CD7A 3SXLA 5FJ4A 3DOLA 3WBZA 1IM6A 5DLGA 2HWHA 2DXEA 3M2VA 4USUA 3AA9A 3TP2A 4EYIB 4LF7J 3P49B 2UUAF 4DX6A 1BE4A 4LFAF 2V67A 3K5OA 2CFXA 2C3UA 5C2GA 1Q53A 2D69A 2PE8A 4USJC 3H4DA 5AE2A 2PI5A 2DNOA 1HFEL 2AJFE 2R8JA 2P2CB 1SIWB 1HI8A 4PRFA 4MKYA 3F0NA 3GU0A 1UVLA 2G2YA 2VONA 3SZ2A 1NSAA 3AHPA 3I87A 3FSXA 4ELTA 3HVWA 1X4HA 2YKNB 1QSSA 3QJLA 1RA7A 1Q0NA 1XBWA 3BGFA 2LECA 2DVIA 2HVDA 4PG6A 4DX5A 1LWCB 3BB5A 2MQLA 1RT2B 2NPFA 4B3MJ 2DNYA 2IAJB 2C3MA 3EDRB 3GFHA 2CUYA 2XCPA 4NX9A 2W2QP 4Z7YA 2KKHA 1YJVA 4R25A 1TQLA 1Q5VA 4ZVQB 2RH3A 4ECXA 3TARA 1TZ0A 2DHGA 3J81j 2ZWPA 2HK3A 4LRDA 4DUYF 2XI2A 3RRHA 4G3IA 2FHKA 3ENAA 2DNZA 1LFWA 3CCZA 5FIIA 4O3OA 4K4SA 3TR5A 1VISA 1WC0A 1CJKB 3NLCA 4KH1B 4K50A 3KLFB 4OX7A 1HR0F 2DGXA 4ED4A 4J90A 2UUBJ 1QLNA 4OYZA 3HHNB 2BE9B 2EK6A 3MM6A 3IAS9 3H40A 4KHPJ 1LWFB 1V3RA 3MWBA 4K5RA 2M88A 3CD0A 3FMWA 2FLOA 4H4OA 3CCMS 2R7UA 1UETA 4QR1A 4LSNA 3BSCA 4NLTA 4CH7A 1FO1A 4HTIA 2B8PA 3CCES 3CC4S 3VQSA 2QMWA 3CEDA 3UFCX 3MPUB 1TKTA 2R8HA 2IMWP 3Q0AA 2O5DA 1EARA 3ELHA 1X8DA 2JFDA 3LA0A 5E0OA 4ES3A 1QSYA 2V4JB 4HTJA 1QM9A 1UA0A 2JEGA 1YK9A 2WVEA 2FZGB 3JTNA 2C1EB 4NI2A 3TA1A 1ZZNA 1SC4B 1N5TA 3L3CA 3DLHA 1JKHB 1MMNA 4DI6A 4DR5F 4C8MA 3M8RA 3KTQA 2KU7A 2EG1A 1FRJA 3D1QA 1SKRA 3ZZUA 4LF8F 4NI2B 3RRGA 3G2XA 3WZ0A 1R8BA 4PWWA 1NB2A 3KG1A 1R31A 5KFIA 4B3TJ 3AFGA 4EZ9A 1UVJA 4KR0B 3LP0A 3KJVB 2ZZMA 4X62J 4IH5A 3GSIA 2BACA 1XMBA 4DL4A 5B0DA 2KO1A 2OD6A 3WIUA 5HMZA 1XMQJ 1CJVA 3TUPA 4DV7J 1MROB 3QJPA 1Q8IA 3MM6B 2ZH6A 3FVYA 2OFGX 2RNEA 3ZTSA 2WW8A 4B3SF 5DDOC 2MSSA 2KI2A 1I6JA 4K4ZA 2B5JA 1HBMA 3EM1A 4F4AA 1ZAWA 2PC6A 2RKIA 3IGVA 3GIRA 3KKFA 4NLGA 4RU2A 2E7WA 2F5GA 5L8RC 1MSWD 1EKRA 1FRKA 2B5JB 3QGGA 4V19X 3M8WA 4F4ZA 3V6KA 1L3VA 2W4CA 3M8QB 3PJ9A 5A0YA 4RL1A 1VC0A 1Q7LB 4QW8A 1AXQA 2X1BA 2Y1IA 4JI7F 5J1EB 2PMWA 2OAUA 4DR1J 4DS4A 1P9QC 1EETA 3ADAC 3LF0A 4F3OA 4NXMJ 2G0CA 3PKYA 1NSPA 2HAIA 3JAMY 1GT8A 2B9YA 2CPXA 4R5PA 1NJXA 2R2RA 1X0PA 3CJ0A 3GZ7A 5D6GA 4DV6J 2CVIA 4KSEB 3TZXA 3EX7B 1Z4UA 5L1JA 4B3MF 2E5JA 3MD3A 5D0EA 3D68A 1S76D 3EE3A 2PDAA 4ZIWA 3KHGA 5BYRA 2MKSA 3NOGA 3SCJE 4DFPA 3QLHA 1RBLA 5IC6B 1CQMA 2RU9A 4OYWA 3TRGA 3CJSA 4Y3CA 1W7WA 2B8QA 5KT3A 1YBTA 1N34F 2AV5A 4FPIA 1SIZA 3UVJA 4NLUA 4CNZA 4WJBA 2IVMA 1RT5B 1OS5A 5KFTA 1B0TA 1DLOB 3W60A 2VOPA 1JLAA 1LW2A 3HSJA 5ETRA 2GCFA 4ZMMA 2XZWA 2FHJA 4X4TA 4DV1F 1T3NA 2UUAJ 4DCPB 5J1NA 1Z1ZA 3O2IA 2XZDB 2GIRA 4NA2A 4TVAB 4FBTA 2OEJA 3U7JA 4UOGA 2VJVA 3W5XA 1C0TB 5F0UA 4NE9C 1SVDA 3OD2A 2NQPA 4KO0A 1NCLA 1IWAA 2MZ1A 3PIOQ 3I0RB 2QA4G 4CLKA 2LU2A 4OX9F 3MCOA 1KOHA 2C2NA 4IRCA 4WFBQ 1RCOB 3QZ8A 1VQKS 1HQ2A 1MMDA 2V8PA 4I1TA 2DIUA 3UNGC 1XNQF 2HS3A 2A3JA 4KGZB 5E3QA 3J7YI 2GJIA 3V6HA 1OWXA 3E01B 3EGVA 2VC0A 4URSA 1AUDA 1DBDA 3AH6A 3V2UC 1M0SA 4V1Ak 4TQRA 3MOJB 1FRMA 1PIEA 2BKOA 3K89A 1KVKA 5IXUA 2XY5A 4J9QA 3GP9A 5C42A 1TL5A 3NCRA 3NWRA 4QYZJ 1LNQA 2BABA 2BXJA 2DEJA 4PCQA 4Z2XA 5CYMB 5KG5A 3HVAA 2PN6A 3H25A 2ZM6F 1HWJA 4DCOB 3B82A 1JLEA 2I9SA 4P7TA 4C0HA 5DDRC 2N7CA 4EBDA 4KKOA 2KH9A 2IM3A 1M5OC 4ICLA 5KOXA 2QL5B 3OL6A 2HMIA 2ASYA 2PEHA 1DHMA 1VHFA 2WK4A 1HNVB 3GMGA 3KHLA 4E0DA 1TL3A 4H54A 2DH7A 1VQ9S 5K8PA 4Z7CA 1C1BB 1VQ6S 4UOCA 5K20B 2BJ9A 1UFWA 1WHYA 2W25A 3BYPA 3D0IE 3AB4B 3NGTA 3N01A 4AQYJ 1R0AB 1KVIA 4OYXA 2G2ZA 3AAWB 3NAIA 2NXCA 3M30B 1IJFB 1KC8T 4ED5A 4FXWA 3BDPA 2IBKA 1AROP 2FGCA 2LVWA 3IBWA 3UO0A 4GKJF 2VDHA 4RX6A 2MQPA 4RNOA 3MUMP 5EGYA 2CQ2A 3ICLA 1B99A 3PYDA 5MAOA 3W2WB 3RB4A 2XBPA 1XMOJ 5KFUA 1Q8LA 1J27A 2X1GA 3IO1A 1REVA 1SH2A 3VGSA 3KK1B 1HKAA 1KD1T 3MMCB 2O3DA 4X64J 2MQOA 4L76A 2CA9A 4RKUC 3FEXB 5E3PA 3JB9k 2DPIA 2H51B 1EB0A 5LSRA 4J91A 4G1QA 5HJYA 2D9OA 3I31A 4EYHB 3JXOA 4ID5A 4RW9B 5AT1B 4AYBD 1F2GA 3HM9A 1UW4A 4DPTA 3MMAA 1YQHA 2BM1A 2WHOA 2WW4A 4TNOA 5DG8A 1GXTA 2HZCA 1TU0B 3T3FA 4K8RA 1VJQA 4DV2F 1NK7A 3AOAA 2YNIA 4MFBA 5DDQC 1B4SA 3ENVA 4JI4F 1TV6B 1UZDA 4MKBA 4XO0A 1M5HA 3A3NB 3ISND 4H4KA 4CI0B 1MWYA 5KFDA 2UV8A 5BXIA 1TL1A 3MTJA 2Q1LA 4DDFA 3MR2A 2XNRA 3HT3A 1QUVA 4F36A 1T9TA 4O44A 4QQBA 3VAFA 1XNRF 5KFPA 1O51A 3BM7A 4U8YA 1DRZA 2R2SA 2W4DA 3OHAA 3Q8QB 2ZH9A 5GMEA 2F3JA 1E6VA 2MGZA 1T9VA 2AEMA 3WIVA 2BYCA 5DLFA 3CMQA 3HHLD 3MUTP 2HS4A 2LQ9A 4DPUA 1S1VA 4CLWA 1KLMA 4DZ6A 2JSXA 4JI8J 3TWZA 5AJ3F 1PJ6A 3PO5A 4PQAA 3ET6A 1HWKA 3EZ5A 4WZMA 3NG8A 3E2EA 1KTQA 2CPJA 3L7PA 4UY8T 3A13A 3NNHA 2IPOB 3KNGA 1RT4B 1PYOB 3IM8A 3DFEA 4B9LA 1N5YB 1HW8A 2Q79A 5IFMA 5KT5A 1U0HB 2CVEA 2OHDA 4N47A 4OJ1A 2Z2ZA 2QV6A 1YWXA 2AIRB 4MAKA 1BGXT 2BJEA 3TA0A 4OZ2A 2LQ5A 3BR8A 5E3CA 5F41A 3CSKA 2FVSA 3MR6A 4B9NA 1KLMB 1RLDA 4GC7A 3AQPA 2C2RA 2LEPA 5AXMA 4TU7A 3S8SA 4LRFA 8RUCA 1P1TA 1CJKA 1VI7A 3IRWP 2A2DA 2W7PA 2V34A 3N5BA 4IUFA 4OZ3A 1DTTB 4NCBA 1S1WB 1VQYA 2H54B 1WKJA 2LQJA 5JXSA 3TUIC 1JLGB 3FRYA 5D4LA 1LKZA 1GMWA 1RAJA 2YWGA 4KGXB 1HHQA 3CNQP 1X4EA 3H7HB 3QIPB 4F4WA 4ES1A 4HYKA 1FERA 2YH1A 1AW0A 1OSCA 2FZCB 2VG6B 2FHOB 2RRBA 3WHIA 3SSQA 2K3IA 2DY9A 3G8TA 4CZCA 1HHSA 1IKXB 2FJAB 2HNZB 4CLZA 3ZXWA 1X7VA 4N77A 2E1MC 5IT4A 2XC9A 4ZP9A 3JYTA 3F56A 4C0OC 4O3SA 4DZDA 3EPGA 1RHRB 5B08A 3HZEA 3GJQB 2DNKA 4JI3J 2DNGA 1ZM2A 3DU6A 3HZGA 4N8NA 3M9NB 2YPYA 1TUGB 3T6JA 3N79A 1REVB 3KLGB 4LJMA 1RTIA 2P8IA 2MZJA 2KT5A 1CC8A 1U8WA 5HQMA 1JLEB 1T9XA 2H4WB 1VDHA 5KT2A 2MKKA 3D3CJ 3RBEA 4CYUB 1DTQA 2V9KA 1N33J 4UOFA 4QYZK 2QTWA 2BE2B 1QDUB 2HBZB 5FDLB 3R7NB 4DX8H 1RU1A 4ELVA 3FRZA 5G0RA 2UXDJ 2C42A 2JVOA 2LEBA 4KC5A 4HDGA 3KG4A 2DHXA 3QT8A 2DGWA 5CZVA 2HNDA 4JI8F 1U1MA 2O66A 4C8KA 2XWYA 1HBUB 4IFVB 3PFEA 4X65F 4A8FA 3KUEA 1UJ4A 4USIA 2ATCB 1SCJB 2ATLA 2BBEA 2MSTA 1E6YB 2IFXA 1OPZA 2OPRB 2G0JA 2GIQA 2B7BB 1RHKB 3MAAA 4O4RA 4ZCMA 4X65J 3LANA 4DSJA 2VKRA 4PYAA 4WTOB 2HHHJ 2J76E 1RGVA 3MPYA 5BJRA 5CYQB 2CQ0A 2WOMB 3SFUA 2V4QA 1K9MT 2E5LJ 4FF2A 1NHUA 2B6AA 3H2VE 2Z2MA 3UCUP 4MIBA 2Z2YB 4OHVA 2G13A 3HFZB 3MZIA 1DQ9A 2HIYA 3EPIA 2M5YA 5HAOA 1VYAA 3IG1A 4NYPA 1VLYA 2IRXA 5I42A 1Y11A 4I2QB 4OHXA 3CJKA 4EK2A 1QAJA 3HVTA 3GPAA 1QTMA 3IWXA 4ZCKA 2E5HA 1DTQB 1N32J 3B4DA 1X5SA 3KLHA 1N6QB 1U1LA 4YDDB 2EPIA 1YZ7A 2L9DA 1UFLA 1Q4RA 2RMLA 2RQKA 1UAWA 5T14A 5I3UA 4DSLA 2A1BA 1RWOB 2FHMA 3EZOA 5ETTA 4EO6A 4ECQA 1RYSA 1UWBA 3FFIB 3NS7B 2IM1A 2AX0A 3P45B 2M2BA 3OTEA 3K7RA 3K5PA 3QT6A 2ZC4A 3DLGB 2FY8A 5L46A 4PG5A 4C97A 3HPOA 4HHUA 2VIHA 2LXUA 4I67A 5D0HA 1RTHB 3DDIA 3QBCA 2VICA 3OPKA 1UA1A 1ROFA 1Y3JA 5B0EA 2KB2A 4F26A 5IT0A 3BO4A 2QG9B 3DRPB 4P71A 5CD4H 1KQGB 1ZETA 3PZPA 3UW1A 3DRSB 1KHVA 1M5PC 2ROPA 5KG3A 1NK5A 4LF9J 5D77A 4ED0A 2AP6A 1SKSA 4ZCIA 4DXLA 1Y5LB 1RWUA 3K8VA 2ALZA 4WBFA 2YBVA 4YDXA 2EFVA 4Z37A 1R8CA 9ATCB 3SI8A 1NAQA 4CLFA 1NHVA 2IM2A 4IO1A 2HQGA 1X4CA 2XG8A 2I1RA 2FVPA 1Z2ZA 2J9DE 5J2MB 2EBGA 1YLXA 1ELOA 5EWFA 1VBZA 2FJXA 1H7WA 4RW8A 3K59A 3THVA 4DL6A 2V4RA 4CT9A 1X4AA 2DK2A 2MEWA 3DLKA 3FBCA 4KB7A 5J1PA 1T05A 1FKOB 2NUUG 3KMSA 3KMQA 1EHWA 3O3LA 1QY7A 3FCWA 3OHBA 3OJSA 1REGX 1T9WA 1U6FA 1UCNA 3TX8A 5GADU 2MJUA 5LSOA 4DQRA 2XGQA 1FD8A 1U2FA 3BV8A 4WE1A 3RYLA 2P5VA 3C16A 4PXBA 3EVMA 1U7LA 3HK2A 3AY0A 3AD9C 2HWTA 4LFCF 1Q79A 2J8SA 3NCPA 1B0VA 2CQDA 3LQVA 4ILLA 3D7SB 3RAMA 1C1CB 3FEZA 3D1HA 3UR0A 1VC5A 1FJEB 3C6UB 2CJXB 3FGVA 3OFHA 4RLEA 4PKDB 2VD3A 3HHLC 5IM0A 2VQEJ 1WC6A 2EC2A 1BD6A 4JBCA 1FJ7A 2G0IA 3O6QA 2HBQB 2ZOGA 3QJJA 5CCMA 4DR4F 1U1QA 5DZ7A 4KFBA 3PACA 5ETPA 2E7VA 4F02A 1WHVA 1RAEB 2V8HA 3C3LA 4I69A 3N9UC 3Q2TC 3ZTOA 3U1NA 4DSKA 2HVZA 3D3BJ 5AE1A 1DLOA 4Y2IA 1NNDA 1URRA 4LSNB 4ZA1A 4DQIA 4J9NA 5D0RA 2VQFF 1NK0A 2W9BA 5A8RA 3UCZP 2AKWB 5DQGA 5HMXA 3UD4P 3I4HX 3MMAB 2DCLA 3NBPA 1CQNA 1KS2A 1YSJA 2RVJA 3Q86A 4HLBA 5KFEA 4LF6J 1S9EA 1WC5A 3QLHB 3Q8SB 3KLEA 2V2QA 2CIMA 2MLXA 3CJ8A 1FRLA 2XYHB 3LGMA 4O3PA 4ENOA 4C48A 4WWSA 5I3PA 3J80U 9RUBA 3X1LB 2A6MA 3D67A 3GE9A 4DR3J 1S77D 1LFPA 4OZNA 5J2PB 1WHWA 2EEYA 3KJFB 4EMDA 1HQEB 4I56A 5BYQA 2E5LF 3PHEA 1H74A 3BH6B 4DX7A 2MB0B 1W26A 2YWFA 4F4YA 5THWA 2WVFA 1PILA 1KN6A 3L7UA 2QRRA 4F04B 4CIOA 2YX4A 1V5IB 3M8ZA 1CEZA 4LVNP 2A2CA 3TOQA 1JNRB 1FX4A 3CCJS 1VFJA 2NZCA 2AJ4A 2XMTA 2ZBQA 3LP1B 3NGUA 2MYFA 1C4AA 2YKAA 4XK8C 2W9AA 1FNOA 4ZVRB 2DHSA 3VV2B 1F5AA 3ZC4A 3DLBA 1HQUA 2RIJA 4I0WA 4TN2A 5CH7B 5K8OA 3K17A 4P75A 4X4QA 1D9AA 3Q23A 2F9DA 5M2RA 1QD1A 3I82A 2Z0GA 4X62F 1UKUA 2YNHA 4DCJB 4G1PA 1X9WA 3SFGA 2DCUB 2POKA 3KLVA 1AFIA 2Y0SD 2AGOA 1DURA 5T7LB 2KG0A 2V8GA 1P9YA 2ZNZA 3DC2A 3DRSA 2HQCA 4DV4J 1FWLA 1N0VC 2V2VA 5IQ6A 4WU2A 1HWLA 1MN9A 1NLKL 4JI3F 1MLAA 4DFKA 1WEXA 2RILA 2DGQA 2XTJP 3QATA 2JWNA 4JB8B 3MMBA 4KV8A 4TYBA 3RZAA 3UN5A 3BKTA 4AL6A 1BMQB 4CO5A 4NPOA 3ITHB 4DR7F 2DHAA 2ZNYA 4RNMA 1JJHA 1L3KA 1LQ9A 3N5FA 2VDIA 3EXYA 2ZJRQ 3GV8B 4DSIA 3WX8A 3CTRA 2FJVA 3KLHB 3ZNUA 2FD2A 5HROA 4JI1F 4XDCA 4CCHA 1V3SA 4CRJA 1SL2A 1UW9A 1J5OA 2V6AA 5I42B 5LJ3Y 2HQDA 3UDCA 2YNIB 1JJ2R 1HR0J 3T5LA 2OMLA 4C11B 3T1HJ 2DR9A 2J0SD 4OV1A 1J5OB 2R7QA 2AEJA 3BQ2A 4WKYA 4DV0J 3CDEA 2UZAA 3CO9A 4LT6A 2AU0A 1K44A 3OTOF 3K5LA 3HD2A 3FSIA 3PO4A 4A4JA 3MF5A 4GVBA 4DG1A 2BQUA 1CLFA 2VG7A 5CABA 2YKQA 3PFOA 2HURA 4WZQA 2IRYA 5LSLA 5HLFA 4B17A 3M9OB 1S0NA 1HNWF 1IWGA 1WC4A 3QPIA 1V6HA 1NK4A 5HATA 1VQ8S 1IKVA 3KUHA 1HQUB 1EX8A 1VCTA 3UCGA 2J7WA 4CLLA 1AUSL 4QIWD 1XR5A 1BQMA 1FI4A 3VALA 3HCXA 4OX6A 5IT9Y 3UNYA 3ZZRA 3G6YA 4GKKF 3WDOA 3TVZA 3NKYA 3NS6A 4NA3A 4LF6F 3QO9A 3QQCD 3TW0A 5ITHA 5KFJA 4YQWA 2QIFA 1F9HA 2AJ2A 1TL4A 4CDIA 3PEJA 5L9XA 5I4MA 3KK3A 3RR8A 2RF2B 3EGNA 3W8PA 2M0GB 2PFFB 1P6TA 4UY85 2XYGB 1S1WA 4FPRA 3T1HF 1DY3A 4RWXA 3SQGB 3B78A 1S99A 3H98A 3PEHA 4UF4A 1VLOA 3Q83A 3U1LA 4ZK7M 2HPUA 4EGLA 2I0XA 2QEXS 3TZZA 2OEKA 1GMVA 3NAHA 4OHWA 4W4MA 5KTQA 2P6TA 3EWGA 3MURP 4DR4J 2HGNA 2LKZA 1IVZA 2GGPB 3HLUA 4G1IA 1JK9B 2R8IA 1RT3A 2EI5A 1PO6A 1BHNA 2WZ1A 4HI1A 3D2WA 3OFGA 2VFUA 3G6VA 3H59A 1T9YA 2N4CA 5F8MA 1VQSA 4M5LA 5KFCA 4NEZA 4ZCLA 4C11A 3NWGA 1Y9OA 1KQSR 3IG1B 4YEAA 4ZN1A 1D0EA 2FYXA 3QIPA 1EZZB 2BKNA 3CVKA 3GTYX 3M1VB 4B3RF 1SQFA 1Q78A 2OPPA 4NRTA 2Q43A 2C2EA 2ZHOA 5DM6Q 4LBHA 3KJQB 4LFCJ 1S6UA 3A8IA 1XWLA 5E41A 4A8QA 2QLFB 2HFOA 2L48A 4JI0F 2A10A 1FTRA 4DPYA 4X4OA 1WORA 4NLXA 4KYZA 2BANB 1H2TZ 1Y4ZB 1WOSA 4EUVA 4IR1A 2EKYA 2CG4A 1F3FA 1UPMB 3M2UA 2CRLA 2MGZB 3Q8RB 1F0XA 2I5JB 2R9LA 1FDBA 4FF4A 4A8KA 3B8HA 1DZ5A 3CDUA 2OMOA 2ACMA 2E1PA 2R7XA 1O5JA 4J37A 3S01A 3QT5A 4F25A 2V69A 3R1HA 3MEGB 4N41A 1O0PA 4IYQA 1Y5IB 2PA3A 3I55S 5KFVA 4R8UA 1KHWA 4YHHF 1M90T 3DXSX 1RT4A 3MM9B 4JOUA 2ZH4A 2EFOA 2RD5C 3PX4A 3G82B 1QSLA 3ILLA 5BR8J 5IWAJ 4J9KA 1GX5A 1KNZA 1XNRJ 2CWKA 4NEYA 2R7SA 4DUZF 4ZVOB 5KFXA 1Y3KA 2I5JA 1S1UB 5KFLA 2HBRB 1NPRA 8ATCB 2AYGA 2MKHA 3L7OA 4LF2A 3SBMA 3F44A 2CNOB 3H0PA 3RGIA 1S7IA 3MMJA 3EUNA 3UD3P 2GW8A 1NUEA 3AOCA 3MMCA 4JV1A 1APSA 2WVBA 1VR6A 1QAXA 4IR9A 3HO1A 3IR6B 4X66F 2AYMA 2PO4A 3C8YA 1FXDA 3HI9A 4I6AA 4CH1A 2QA4S 1B64A 3PDNA 1UJ5A 1EIYB 1IKYB 4WE1B 5A2QU 2FVRA 3BN7A 2F40A 2HHXA 2VHGA 3MM7A 2VFSA 3T1AA 4CLSA 5I3QA 2DGOA 3SSRA 2HYIB 3SEOA 1S4FA 2DY1A 3IP0A 4WP9A 4O23A 3KHRA 1SXLA 4BHQA 5J2QA 2AD9A 2I6WA 4P72A 3ZFVA 5J2PA 2DR8A 4ANEA 4ID8A 2ROGA 4RNHA 1I94J 1ZPWX 5CCLA 2HHVA 4HT5A 3KLEB 1ZM4A 2ZH3A 4C3MA 3LAMA 2GO9A 4P2FA 3DI6B 3LGHA 2QX0A 3U1MA 2IM0A 3B6BA 4F67A 4YR0A 1HI0P 3RW6A 1AZSB 2K7JA 2FC9A 4ILMA 4DPOA 4KHPF 5D4PA 4FYDA 1S49A 3MI7X 4OI3A 4B02A 5HK4A 3HXMA 2ZH8A 3CCVS 4ELUA 3MM9A 4QIGA 4BWMA 5B0BA 2BOAA 2L9WA 2ZH7A 2OLWA 5LJ5Y 2OP5A 5L39A 2Y0BB 1TUWA 3OTDA 5K8NA 4O0IA 1CSJA 1X9SA 2GJFA 2FLPA 2L41A 1S0VA 3G4SS 1UL3A 3SDEB 1IJEB 3OTBA 3BO3A 2CJAA 4BLGA 1M1KT 1D8YA 2X1FA 4A48A 3CDAA 3M6XA 4AUKA 4LF1A 1GH8A 1SJ3P 1BWEA 4OZ1A 2HRUA 4CLPA 4H4MB 1M1GA 5GMKa 1K1QA 1N33F 4C8OA 5HP1A 4OIXA 3R1LA 1Q7YT 3ISNC 4CLTA 2Q6BA 1IBLF 2DO4A 2XZTB 3UDEA 2UUCF 4IRDA 3QGHA 1FJGF 2MQMA 3N6NA 2DXFA 2IC3B 5FLXY 1RB0A 3TO8A 1JLQB 2IYIA 2U2FA 5AJ3J 2HK2A 2ZE2B 1TKXB 3D6TB 5DJBA 3UI3A 4YR2A 3HX9A 1Q81T 4P73A 1IBCB 4ECZA 1KDNA 1RTZA 2RAQA 2PMZD 3LPYA 4XDDA 4RNNA 4DLGA 3QSYB 2UUTA 1NJWA 4M94A 4IO9Q 2W2OP 3OL7A 2HLUA 3VAHA 3QMQA 1CS4A 1CULB 2HW3A 1WNEA 1U48A 4CTAA 5HROB 4TLRA 4RNFA 4YY3F 3BH7B 1PAUB 2HHTA 4B3OB 1S6QA 5A8KA 2JHEA 2E9RX 5HBMA 2Y1JA 3V4MA 1VQOS 4K5SA 2KL8A 4M63A 2X51A 4RBTA 5D4OA 5ETVA 5H9FJ 2DGSA 3OLBA 2U1AA 2K8GA 2XQCA 1RKJA 1UMJA 4Y00A 4W90B 3JTPA 2G1HA 3GG1A 2VPWB 4OLPA 4B9VA 4OI1A 2EFGA 2MLZA 4KQZA 2DNQA 4O3NA 3SMZA 4D3GA 3HSDA 1IQTA 2A6OA 4AD6A 1CVJA 1RHUB 3R2CJ 2MXYA 3DRPA 1JQGA 3BKFA 3IS9B 4WU3A 5DZ6A 3CCSS 5FDLA 5LMNF 3QAEA 2YWWA 3QFWA 1XTZA 1GAOA 1WG4A 2BUNA 4NZ7A 2XGPA 2QSWA 3PW4A 2HEKA 3M8PA 2NXJA 2RRNA 2RUGA 3DRYA 1MU2B 1TFWA 1RAFB 2CPIA 4YP3A 1YVFA 2HQIA 3NOCA 2UXCF 2ZEJA 3ZZOA 3CW2C 2E1CA 3CULA 3E51A 4KGMA 4KAIA 1FDNA 2DIVA 1NXIA 4FXVA 1NKCA 2YTCA 2CQHA 2MKYA 4NLSA 3X3UA 4ZHRB 5LM7E 2VBZA 2LP4A 3JTOA 2QLWA 4TY9A 5GMDA 5HL7Q 3LH2S 3US5A 2J9EA 1XR7A 1UZHA 1P8GA 3I56S 4K4XA 1QE1B 4WYLA 1MN7A 1FA0A 4NASA 2XMKA 1UP1A 2VV5A 3LUYA 2QO3A 2SXLA 4ZVSB 2G4BA 2ZH2A 3IWNC 3DOMB 3LP2A 4B3SJ 1VQLS 1S12A 1FKAF 2UXCJ 1H98A 5A0YB 2OFHX 4ECWA 4A8OA 1N36J 1BQMB 2FJDB 4OFZA 1XMQF 4U7CA 4TLQA 5T41A 2GQ2A 3ZTPA 1ZA2B 2W4PA 2HZAA 1K73T 2WB1D 4KPCA 3DDNA 3FKBA 3ITHA 3N6MA 4EBEA 5IM0B 2IRUA 4J7CA 2NUHA 4JUZA 2F8MA 2VQEF 1XN9A 2NPIA 4WKRA 4AXIA 2B7CB 2DNPA 2B51A 3G86A 1NSKL 3MD1A 2C2MB 3RG6A 3UDVA 3R7BB 4ZPTR 4OJHA 2W7OA 3LALA 4MH8A 1R6YA 2KDOA 4HI2A 4O4GA 4P2XA 5LOQA 4B9MA 4K59A 3LP0B 2DGTA 1O8BA 5F3ZA 3JSYA 4RBVA 5HANA 3GCXP 2JEFA 1R8HA 4ED1A 3DOKA 1RSCA 1RWWB 4NYOA 3W1YC 3NMAA 3EXCX 1WELA 3KFWX 5C25B 4F50A 3OXFA 2QGFB 5KFHA 1N0UA 1TMMA 1RWPB 2MQNA 3DHXA 2DNRA 1WTFA 4KGKA 2YX1A 5IC4B 1W2BR 3MEEB 5F8JA 1FHTA 1U09A 5CQGA 3D6MB 1JKHA 4LREA 4M5MA 4DV5F 4PUOA 4J9OA 4Y2MA 1YKWA 4GO7X 4TYAA 3PX6A 4J9UE 4PWDA 4PPDA 2YX7A 4TY8B 2OIHA 1OIAA 3KK1A 1D9FA 3BYRA 2QLJB 3BKUA 1Y5NB 7FDRA 2CDQA 2M8DB 4CM2A 4GMKA 5JVHQ 2OTJS 4K4VA 3M30A 4IFYB 2YQ1A 3PCOB 4LSLA 3GYXB 2LEAA 4OZ5A 4C2MA 2UU9J 3CJ2A 3IRXA 3IR5B 4L3NA 4MK7A 3M8QA 4OLOA 2IA0A 4F4XA 1S1TB 2GHWA 2KRBA 3GIKA 3K5NA 1U1NA 4HHJA 3ONQA 2QZ8A 2YKOA 4QPTA 3R8YA 4FYVB 1C0UA 2B4OA 3DGPA 2HHPA 4DL5A 4TU8A 2H5JB 1HNVA 1HMVB 2ZBPA 3Q22A 1OYDA 5HLFB 2AYEA 2BE7D 4LR8A 4RW7B 2GMLA 4IDKA 2OJ3A 2HKEA 2XMUA 4PG4A 5CXTA 2ALYB 2FLNA 1B0PA 3IRXB 4GO5X 1U0HA 4I2QA 3WX4A 4ECRA 1A7GE 1U24A 3DLJA 5KFGA 4EU0A 4PG8A 4NWBA 1FE4A 3BR9A 3OSNA 3CIMA 1SJQA 3H20A 4QZVB 3JQJA 4ZLNA 1NZAA 3I4PA 2KYXA 5IS2A 1M5VC 3CCRS 1D1UA 4NL5A 4QPXA 3FSYA 3QWUA 4Q5VA 1YJ9S 1IBMJ 2ADCA 3OVAA 3P4UB 4QU6A 3PHTA 4OYMA 2VL1A 3BBCA 1N56A 4RJVA 3FJ2A 4DV2J 3NNCA 2AX1A 1R7IA 1TR0A 1OY9A 2A18A 3V81B 4C8YA 3C6UA 3PYFA 3RRKA 4DG1B 1L3TA 1FK9B 3KJNB 3MAAB 3PG9A 4B3TF 3CD6S 2HHSA 5M2PA 4P10A 4ED8A 4O44B 1FRHA 1TKTB 2W2PP 3PIPQ 2VB6A 3MXHP 3M6UA 3KYLA 3IBCB 1YX2A 2ZHAA 2K1RB 2MQ8A 4PWUA 3LPEA 3J7AN 4OHYA 1TV6A 3AJDA 3TQEA 2ASLA 1FNXH 3CCLS 1F5BA 2DJWA 4DEZA 4Q0BB 4XIUA 2FLLA 4CM0A 2X3GA 4KIAA 3FZBA 2VJUA 3NY0A 4KHMA 3F41A 4ZP6A 4YS2A 4ER8A 1S72S 3W9IA 5KFFA 4J9PA 2J9CA 2R4FA 1Y10A 5E3AA 4YY3J 4DF4A 3DLEA 5D4NA 3M6WA 2B9WA 4RW7A 5KT4A 2IIHA 2R42A 3DYAA 1JWWA 4FXDA 2QYCA 4QJVA 3CCUS 3KG0A 4E98A 5F3TA 4FNIA 3A1YG 5B09A 3PYGA 1IN0A 1JIHA 3D6FB 2OH2A 3SDEA 4A8XA 2JL9A 5A8WB 2IAJA 1F1BB 1HARA 1VMBA 2LLZA 2OEMA 1PJ5A 3LP1A 4PXCA 3PRVA 2HNDB 2MDAA 2DRDA 3R3TA 3AT1B 4UZBA 4M5DA 4F8RA 4WF9Q 3M1VA 2MY8A 4J5OA 1R89A 3MCNA 2MZRA 1PJ7A 3Q8VA 1RT5A 2NSBA 2CDRB 2IY5B 4UW2A 5LT5A 5GAEI 1BLUA 4IRKA 3LW5C 1C1BA 2PT0A 2PA8D 1MWZA 2YNHB 4USKA 3W9JA 2FHJD 1D09B 4EO8A 6FD1A 2WBRA 1RT1B 1YBAA 2YY3A 2ASJA 2DR6A 4U6PA 2UU9F 1UWBB 1M5KC 4FN5A 4FKXA 3O8WA 5KT7A 5LL6d 2CPDA 2R8KA 4B3RJ 1KP6A 3FQLA 4LBPA 1J5EJ 1PYTA 3W7BA 2D7SA 4BCAA 3LGNA 5J2QB 3JSRA 2CQ4A 4UOHA 3RB3A 3Q89A 4NMLA 3FCHA 3J7Z5 5B0AA 1HIYA 2C22A 4ERDA 2VFVA 2Y3YA 1SJ4P 4ZPVR 3HHKA 2GNKA 1WKLA 1EETB 5ADZA 1IKYA 1RUSA 3TJ8A 1FRXA 4NLQA 3G6XA 4ALZA 4IG3A 2B6AB 1YJWS 2BW2A 3MR5A 4LIRA 4M5HA 3J7A1 5GAEU 1TFYA 5HO4A 3AODA 1VRUA 4QR2A 4I64A 1WEZA 2X1AA 2ZOFA 3CDWA 2LXFA 1TVRA 2ZBCA 1X4BA 1FVSA 4I6YA 3CCQS 3MM8B 4ZS6A 1YJNS 1CBKA 1T94A 5IQQA 5F9LA 1SKWA 1HL6A 3D0GE 2RDIA 3A12A 1K8AT 2MHNA 2VG7B 3NBPB 3C2PA 3P6YC 5SZTA 2DR5A 2GQCA 5C5JA 2QFJA 1U26A 4EFAC 1S48A 2GFFA 4ZVHA 3NEKA 3MFHA 1FJGJ 3RUBL
chains in the Genus database with same CATH topology
3CJKB 2ZUGA 1RK8A 2HGMA 1TKDA 1JLAB 1LW2B 2ZFHA 2WRMA 1ZOTA 3BDEA 2VPZB 4DL3A 1FRIA 3AQOA 3OQ2A 3H5UA 3GSDA 4ZHRA 2DISA 3OTCA 4C7QA 2C3PA 3SCKE 1HBOB 3ULHA 2GC8A 3DCAA 3DN9A 1DQ8A 1E6VB 1DAXA 1QJHA 5IWAF 2PD1A 4Y34A 4MK9A 3G71S 1SH0A 2DR7A 1DJ0A 2V4JA 2E5IA 4NCGB 4TU9A 4U67Q 1OO0B 2UV8G 2HNZA 2KZZA 3T9ZA 4R5PB 4FP9A 3OL8A 2RF2A 2AGQA 1TK5A 5A6WA 5KFWA 3DU5A 1NEEA 1ZPVA 3I9ZA 4BWJA 3BGUA 3R5AA 4PXDA 2K3KA 4FS2A 5KFZA 3T1YF 1DTTA 4C4WA 3DLKB 1H2UX 3DI6A 1T05B 2CQ3A 4YB6A 2KFNA 3BSNA 3BQ1A 1GTHA 2AF6A 4QCLA 3MPWA 2QT7A 2V8VA 4WFZA 3CF5Q 3GR1A 2NREA 2W9CB 3K58A 2JOQA 1NRKA 2F8EX 4DFMA 3KHHA 1N6QA 3HK2A 4YB5A 3RB0A 1NJYA 4KBIA 5L38A 3G96A 4OZLA 3VAMA 3DMJB 3DNCA 1GTEA 2CPEA 3HKWA 4Y2KA 5K14B 4NYZA 4QWAA 1C2PA 2OSQA 2F8HA 2GJ2A 1FXLA 2JRSA 2YKNA 4Q2MA 4RW4A 3T9NA 2LCWA 1RTHA 1FKPB 3VAKA 1MMLA 2ABYA 5CYQA 1NJIT 3K2YA 3PW0A 2HHWA 3H5SA 2E5GA 1GNKA 1FK9A 1WACA 4Y2AA 4DR6F 4YB7A 1S6QB 5A8KB 2YWEA 1LW0A 1ZYQA 3J7YU 5C42B 4NLVA 4KPYA 2J7UA 2KT3A 3T5JA 3SYZA 4I7FA 2CZ4A 4DR3F 3DXBA 2WCXA 2CJQA 3KLIB 4IH6A 3DMJA 3GIIA 2P9CA 2F4VF 2CQPA 4PR6A 1JB0C 5T7LA 4I6WA 3DRRA 3MECA 4P2SA 2DT9A 4X4SA 2D1CA 4ZVEA 2EFNA 3UR3C 4ED7A 4G1QB 1U8SA 3HKZD 3PRBA 3QIDA 3DLLQ 1V3ZA 3PW7A 4DV0F 5KG0A 2VZ9A 2B3TB 4LFBF 1RT6B 3D0HE 5GAHI 1F9FA 2I8EA 1K0TA 4MIWA 2JLGA 4WFNQ 4RU9A 2ZD1B 2EK1A 1YJTA 1FJCA 2RU3A 2VH7A 4JV2A 2KXFA 3M05A 5KFNA 2HWIA 3PR5B 5F0WA 3CT9A 1W2IA 5HMYA 1X4DA 2DITA 5K8MA 4Q44A 5F8LA 4ECVA 3OFFA 4MFBB 3UE2A 1QE1A 3CWJA 3HHLB 2DNLA 2XSJB 3I5AA 3M9MB 1Q86T 3OBIA 1GQEA 4X2BA 5F8HA 1S97A 1CC7A 4IKAA 1U4BA 3C66A 4PUOB 4WCEQ 5C24B 4PPZA 1S1UA 4A47A 4WIIA 5C25A 3UWTA 1URNA 5JUMA 4UQTA 3M8PB 1SJRA 3GIJA 3TAPA 4CH0S 4N5SA 1Z2LA 3D5MA 2ADBA 1VK3A 3KK2B 1KTVA 1T8EA 1SUQB 1NK8A 5L1LA 4PXEA 4DN9A 1HQEA 5EX3A 3M2RA 2B56A 2YWHA 3QYYA 2RDJA 3T5HA 4ZPAA 1JXLA 3MR3A 3POTA 3SSSA 3CMES 3BN4A 2AWZA 3S6EA 2HVHA 3V4IB 2KXHA 3TVYA 1JLCA 1UVMA 4WYWA 5A8RB 3WC2A 2QA1A 2HNYB 2JDJA 2KRRA 2WONA 5KG1A 3V5RA 1YI2S 2E1AA 2ZDOA 3OR1A 1TKZB 2HHQA 4ILRA 5DG7A 2J0QD 3MEGA 5E33A 1HHTP 1H0HB 2HNYA 3G8SA 5KFRA 3UPFA 3HP6A 1L3SA 5DGBA 5AE3A 1T95A 1PC5A 4USHA 4J9SA 1Q8BA 3OL9A 3V4IA 2DRBA 1QAYA 3PJWA 5CA5A 4FS1A 2VA3A 1LK7A 3DRXA 3KLFA 4UUXA 2EBEA 1U2RA 3SV3A 3CGIA 1G6BA 4XPEA 4DQSA 1Q82T 2ZDPA 3VAJA 4A8WA 2DD8S 2HVIA 2HLTA 1ZAVA 3SQGA 1T02A 5GADI 4MJKA 1HNIA 1RTDA 1FD2A 2J8AA 1VQ4S 4Y28C 1IR0A 5JVGQ 1XK8A 1F5CA 2GX8A 3TUZC 2MMYA 2HGLA 1IBMF 2OO4A 2P6SA 5M2UA 5G0RB 4DQPA 3EGZA 4TQSA 2GQQA 3PNIA 4K4UA 5KOWA 2DB1A 3QAUA 5BR8F 1N48A 1NK6A 4I68A 3RR7A 1N54B 3I5BA 2K7KA 4UQGA 3CC7S 1FE0A 1X4GA 1YHQS 3FFIA 2NZ4A 5E5NA 1SC6A 1TUVA 4KKOB 4QU7A 3W2WA 1H3DA 2J0WA 1JJ4A 3MUVP 5D78A 4EZ6A 4JI6F 2JC1A 5HI7A 4IG0B 4K4TA 5HN0A 4QBUA 5GAGI 1VBXA 3TVKA 2VG6A 3EZUA 3J7ZT 4Y6IA 2UXBF 3DM2B 4LQ9A 3R27A 4IG0A 3THPA 1KR4A 2E44A 3E01A 4ZLPA 5KG2A 4FBUA 4OHZA 4FVCA 1BQNA 2D74B 4F3MA 4JI2F 4QWBA 4PWDB 2IHR1 3DYAB 4NLPA 4O3QA 5HQ8A 1Q16B 2JC0A 3Q8PB 3CPWR 3M6VA 2BOPA 1ZM9A 1S9EB 1GX6A 5AXLA 1V9OA 4ZP7A 2E9TA 1JLFB 4L72B 2RQMA 1U6BA 3BGRB 4K2XA 2YVSA 4DFJA 3OSPA 2FB0A 3KLIA 1HNXF 2MKIA 1HBUA 2DBBA 4IFVA 1KQFB 3NP5A 2C2DA 5KFSA 2VA2A 4R8UB 2ZZNA 4KHRA 3FQKA 4Q7AA 2FVQA 4BC7A 5DETA 1OQ6A 3GYNA 2V0NA 4JV5F 1ZM3A 3I0SB 2AGPA 5EWEA 3ISZA 4C8ZA 1S1VB 4IOBA 1P1LA 3M2UB 4CO1A 1S1XB 3T5KA 3HFKA 1ZAXA 2MZQA 3BS9A 3IR7B 1RJJA 4ZPCA 4BBYA 3W3SA 1KQKA 2RSQA 1VOMA 2E29A 2LDIA 2IMOA 1BQNB 3MMBB 4KV8B 3AB2B 1HA1A 3M2RB 1FDDA 2VC1A 1IKXA 3PY8A 3DOMA 1TL1B 2OTLS 5K14A 1IBKF 3IXQA 5KG6A 3M32B 2LA6A 2Z2LA 1DQAA 5G4DA 3PR4A 4O3RA 2XB2D 2YWKA 2Q6CA 3TQ1A 1YRTA 5F9NA 5J2NB 1S9FA 3CB4A 5F8NA 1RT3B 3HHEA 3Q24A 2NXUA 4ITSA 4TXSA 3M8SA 3OJUA 1GXLA 3TA2A 2XMJA 1H7XA 1WF2A 1C0UB 3BJYA 3NGDA 5J2MA 1NH8A 2QSFA 4NA1A 1Y00A 3BGLA 2HS0A 1QVFR 2XCAA 3QZ7A 1HD0A 2XSJA 1IKWB 3NS5A 4QYRA 2R2TA 1VC6A 1VK8A 4DS5A 2WTFA 2ILZA 4WFAQ 4YOEA 3OW2R 5LXRA 4YB1P 4XPCA 1DARA 1QAIA 3OXLA 4MIAA 4X64F 4NOHA 1JNZB 4DQQA 2ZD1A 2BR0A 2ILYA 1LOUA 4QW9A 1NKBA 4M8LA 1N4LA 2PI4A 3OVSA 3DLGA 2L08A 3TANA 4NRUA 4F3QA 2ZJQQ 2R8GA 1WF0A 3UQSA 2AJ0A 3IN5A 5KFOA 3R5BA 1L5UA 1XC9A 4YFUA 4J9RA 5GAGU 4NLOA 2YKMB 2BV3A 2YNGB 3FEYB 5BYSA 3CUNA 1RT7A 2M70A 4P7VA 3OUYA 3RAQA 1U1KA 2MKJA 1IXKA 1PGZA 5D3GA 5KG4A 3HVTB 2CZVC 3M32A 4QIVA 1RP5A 1N5YA 4OJGA 2J9DA 3N6LA 4O4GB 4ATNA 7FD1A 5D3GB 3NL0A 4X4RA 2ERRA 4H4OB 3FDSA 3ENQA 3DDKA 2WAQD 3MEKA 4F02A 2XLJA 1RISA 1JLQA 2UVRA 3NRBA 2CPHA 1R3NA 2CQBA 4DJBA 3PV8A 2FY1A 3CDBA 1LWEB 1WG5A 2P9EA 5K9FA 1ZBTA 3LAKA 1J2VA 1WG1A 4MYTA 2LA4A 3GG0A 1OPIA 3IC1A 4EWTA 3LWLA 1S0OA 4UUWA 2P9GA 2G1DA 3W2VB 1TAUA 2IA6A 1XERA 1HW9A 4R0JA 3KK2A 4I2PB 5GVQA 2GO8A 1U47A 4OI0A 5L9NA 4ED2A 1IKWA 4D3HA 3JSBA 3HDSA 4E8UA 2O1PA 3I32A 4KT0C 1NKEA 1KLNA 2RS2A 2XNQA 4LVOP 3RW7A 2W9CA 2BJDA 2PSZA 1A6LA 2CQIA 3HMJG 3F73A 4AE5A 4A8SA 4ECYA 5DQHA 1KC8T 1K1SA 1XEZA 3TAQA 2F1FA 4LF9F 2IVYA 1RT1A 4FF1A 5KT6A 4GC6A 2EG2A 1FDAA 4DSFA 4HH1A 4DMZA 4G6VB 4PG7A 2F7VA 3NCQA 1CPZA 1YG0A 4RW6B 4RW4B 1TAQA 3GQCA 3CCWA 1RT2A 1S6OA 2C28A 2UUWA 2DNNA 2Q3PA 1FT8A 3MGJA 4IFYA 2YH0A 4ZPBA 2ACYA 3MM7B 4C98A 3UDLA 1BY9A 4AL5A 4I2PA 2KZMA 5JJBA 5J1EA 2ROEA 4HKQA 2XY6A 1T3OA 4ED6A 1M5SA 2Z8QA 3OR2A 5KFAA 1HNZF 2AJ1A 3BSOA 4F4KA 1N5SA 2E66A 2XI3A 4EEYA 3ZZPA 3RTVA 4H4MA 3I0RA 3ZZYA 2ZHBA 2RKIB 2KFZA 1KOOA 2LDYA 2ASDA 3J81Y 3L09A 2VG5A 1ZZFA 1E6YA 2PGCA 2COLA 2JLFA 3CXCR 1S10A 4RUAA 2LU1A 3GV7B 1VS3A 5DG9A 2KJVA 2QE5A 4J9LA 3BZQA 4LMZA 2K1RA 2MY7A 1KEKA 1KONA 4QWEA 4K0KF 1LXNA 3FMBA 2N4DA 4Q8FA 1YJRA 4HDHA 4DF8A 2Q66A 4CO0A 3JSMB 4FZVA 2OD4A 3GFYA 5B0CA 1UVNA 3KLGA 4DV7F 5KAKA 4FNHA 5F8IA 4R0EA 4DSEA 3C46A 2GV1A 3VAGA 2KM8B 3OR2B 4RUCA 1YGYA 1VRTA 2MQQA 4M95A 3B4MA 3K5MA 5F8GA 1X5OA 2MZTA 5GAHU 2XLIA 3G6ES 2B4PA 2FDNA 4IQMA 1GXUA 4RW6A 1UVKA 2E9ZA 2JX2A 2EFQA 3OUYB 2LXIA 4F2SA 4DV4F 5C24A 1FEHA 4HVZA 2WSFC 2KYZA 1EP4B 5AXKA 1G1XA 4U7UK 4DL2A 4ZKAA 4RW8B 2V2KA 3GIMA 1HD1A 1VQPS 1VRUB 4CO3A 1PC4A 4H4KC 2M3DA 4AL7A 2RS8A 2J7KA 1MU2A 1HWUA 4WFXA 5J2NA 1XR6A 4ZOSA 5EHHA 2WB4A 2ZC3A 4OZ0A 1JXEA 2H5EA 3KK3B 4OI6A 4CO4A 1T03A 5KFKA 2DO0A 4YUDA 3MEDA 3TAMA 1SH3A 4M1KA 3TYTA 1T7PA 3H5YA 1VRTB 4I4BA 1C4CA 2Z4PA 3O44A 1SI9A 4FVMA 1VGYA 1WI6A 1IKVB 4IOAQ 1U45A 2J5AA 4ZDNA 4CQ1A 5DM7Q 3MDFA 3EYZA 5HBMB 4FF3A 1U25A 2D9PA 3JSMA 2D41A 1U49A 2FGOA 3VZIA 2NLWA 2D3UA 3T19A 4B9UA 4AXJA 3DOKB 5MLCV 3THTA 1R43A 2XMMA 3BF4A 4QIFA 2OPPB 4RWWA 2YQ3A 3G9CA 2IJFA 4QWCA 3N4WA 3HHDA 1LWFA 3MAQA 2WBMA 2Y1RI 1HBNA 2YNGA 2DTJA 1FEEA 2WOMA 2YKMA 4MKAA 3PKMA 2IC3A 5D8HB 2JZ5A 2GGPA 4K4WA 4N76A 4ETXA 1L3UA 1RDRA 2V5HG 4PQUB 3IFEA 4JYAF 3I9V9 2GMHA 1NO8A 3LOUA 4KO0B 2I2YA 2VOOA 1RTJA 1S6PB 2OPQA 3HJFA 4ETZA 2NS1B 3IGNA 5FD1A 1G2EA 1FVQA 4NLDA 2IJNA 1NJZA 3DM2A 2O01C 2UVWA 1BC6A 2DGVA 2VUGA 2XY7A 2H9ZA 1N52B 2ZBIA 3QO9B 3BQ0A 3RU0A 2DH9A 1N32F 4ID5B 4RW9A 2CQGA 2XWXA 4ZVGA 2M9KA 3L95X 4TKTA 4ECTA 1X5TA 3BO2A 3V81A 4RBUA 2FIUA 2RE1A 5EDWA 1U6ZA 2KJWA 1U1OA 1HMVA 1FF2A 2CQCA 3ENWA 3BEGB 4X4PA 5B7WA 4DN0A 2AYBA 3HHLA 2BM0A 5KFMA 3K0JA 3LWMA 1HPZA 1RYRA 1LWCA 4Y0FA 2UUBF 3AJ2A 4KJIA 3P3DA 4A8YA 3RAXA 1IQZA 2N3LA 3VQTA 1HPZB 3ZZZA 2B0GA 1UJ6A 3PW2A 1ZH5A 2ZOMA 5B0GA 6FDRA 2MJNA 3PXGa 1TL3B 4Y65A 4LF5F 2M8HA 3V6DB 2NSCA 4WXOA 4WXWA 3CIZA 1WI8A 2BVZA 1R8PA 4C3LA 1S1XA 3SV4A 2CKWA 2V94A 3NNAA 4PQUA 4J9MA 1IUJA 4RUHA 2LYVA 1HBOA 2JEIA 1S9GB 2ZH1A 3I6PA 4Q43A 2VBWA 1UEUA 2HQ3A 1VQ7S 3U27A 3CJ3A 4QIEA 3OVBA 4IQXA 2FJBB 3OXGA 1LXJA 5CHCB 2EW9A 4RZRA 1VBYA 1KRPA 3MPVA 3VWSA 5SUHA 2HRYA 2CPZA 4BC9A 4N56A 2VODA 2CQ1A 1TK0A 2MZSA 5DGAA 2VPYB 1W25A 1RT7B 2ZVSA 4TY8A 4WTYA 4OI4A 3D1OA 5KFQA 3GFZA 4L6V3 4ZVFA 1P27B 4C0BA