1FDAA

Crystal structures of oxidized and reduced azotobacter vinelandii ferredoxin at ph 8 and ph 6
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport(iron-sulfur)
molecule keywords FERREDOXIN
publication title Crystal structures of oxidized and reduced Azotobacter vinelandii ferredoxin at pH 8 and 6.
pubmed rcsb
source organism Azotobacter vinelandii
total genus 34
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1993-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fdaA00
1GTEA 1R27B 1G3OA 2PDAA 3PNIA 2V4JB 5E7OB 1F5BA 1H7WA 1BLUA 1K0TA 1B0PA 4CI0B 2C42A 1FXRA 3OR1B 6FDRA 3IR6B 7FDRA 1FEHA 1G6BA 1WTFA 1FD2A 4XK8C 1B0VA 2FDNA 2PMZD 1PC4A 4XDDA 2VPXB 4OV1A 2C3PA 3HKZD 1Y5LB 3MMCA 1FRJA 5BYRA 2Y0SD 2WAQD 3MMAB 1FRXA 1Y5NB 3EXYA 5BYQA 2FJEB 3IR5B 1IQZA 1AXQA 1DAXA 1FTCA 2V4JA 1Q16B 3MMBB 2FD2A 2FJAB 1GAOA 2C3MA 1PC5A 4KT0C 2O01C 1ROFA 1F2GA 2PA8D 1FRIA 1BWEA 1SIZA 3GYXB 2VKRA 3MM6B 5FD1A 4AYBD 1D3WA 3MM9B 1C4CA 2XSJB 4DHVA 2VPZB 3MM5B 3MM8B 1HFEL 1FCAA 2C3UA 4YDDB 3MM7B 1H0HB 1BC6A 1JNZB 1FDAA 3IR7B 2FJDB 1H98A 1Y5IB 1C4AA 3EUNA 1FRMA 2C3OA 2WSFC 1RGVA 2C3YA 1FRHA 3OR1A 1DFDA 1A6LA 1F5CA 2UZAA 5CHCB 1BQXA 4Y28C 3OR2B 2IVFB 5BYSA 2ZVSA 1SIWB 1KQFB 6FD1A 3EGWB 1Y4ZB 1FDNA 2VPYB 3MM8A 1IR0A 1FXDA 3MMCB 1FRLA 2GMJA 3MMAA 4L6V3 2WB1D 2WSEC 1JB0C 5L8RC 2GMHA 2FGOA 1FDBA 2WSCC 2FJBB 7FD1A 1FRKA 3MMBA 1FERA 1XERA 1H7XA 1VJWA 3C8YA 4XDCA 1B0TA 1CLFA 4RKUC 1GT8A 1FF2A 3OR2A 1FDDA 3MM6A 4ID8A 5CH7B 1BD6A 3LW5C 2VPWB 3MM9A 4OMFG 1KQGB 2XSJA 2V2KA 1SJ1A 3MM5A 2Z8QA 3MM7A 1DURA 1KEKA 1JNRB 1GTHA
chains in the Genus database with same CATH superfamily
1SC1B 1VC6A 2ZH6A 4C7QA 2ZZTA 1VI7A 2VG6B 3S7RA 3D66A 5EUHA 2V2ZA 5AJ3F 2IM1A 3KJFB 1VR6A 4NZ7A 1YJTA 2MGZB 2ADCA 3D5MA 1WEXA 4BC7A 2RKIA 2DBBA 1Q81T 4ZVOB 4KKOA 4K4VA 4NLQA 1C4CA 4C6AA 4ERDA 1D1UA 3EYZA 2FHOB 3N01A 2V2VA 1VQLS 1IBLF 1TKDA 3HD2A 4PAAA 2VBXA 5FJ4A 3TQEA 3DRXA 2YWFA 1RAHB 4A8WA 3F73A 4NA3A 1UWBB 2G2ZA 1YJRA 2XS2A 2DR7A 1RWUA 4LFBJ 2OGUA 4TLRA 1RB0A 2VPWB 4X66F 5HQLA 4LBPA 1S5ZA 3TO8A 3EMTA 1S57A 5J2NB 4X84A 2HGNA 2MB0B 5DDRC 4DR5J 1R8HA 1JJ2R 2EG1A 4V19X 1PYSB 2X1BA 3P49B 4ZOSA 3RBXA 2B56A 1S7HA 2XQCA 1RAJA 4UY85 3GIJA 5A8RB 4WZMA 4GO7X 1M90T 3RW6A 1TU0B 1F2GA 5IM0A 2RHSB 3KHHA 3HVTA 1KRPA 2IRXA 4IOBA 1IXKA 4YMEA 2PEHA 1HWIA 4A4JA 3W9HA 3E3XA 2QA2A 1YHQS 2HRTA 2XSFA 1X4BA 4JOUA 2Q3PA 3NGDA 4F4KA 1MNEA 4K5SA 1HARA 1ZPVA 1Z2LA 3CCTA 4ZVRB 3D6FB 2VG6A 2HIQA 2J0SD 4UY8T 5EN1A 2MGZA 5B0GA 2HFVA 1HQUB 1TKTB 1KWMA 3UD5A 1MN7A 3G4SS 1H6KX 2XMKA 4TQSA 5K14B 1HNIB 4XIUA 2RS8A 4IG3B 1LXNA 3GJTB 2J6TA 1EETB 1VQKS 4CO3A 3NRBA 3GILA 2ZE2B 4HI1A 2ZWOA 1UWBA 2FIUA 4DV6F 3SEOA 3MDFA 2M52A 2BW2A 2VHGA 3CJTA 3HT3A 1X0FA 3IM9A 2J76E 2DH7A 1H72C 4EBCA 2GO8A 2APOA 4U67Q 2Q6CA 3J81j 1MU2B 3CJSA 4ZK7M 2R7UA 5I4MA 4USHA 2V9WA 1X5TA 4F4ZA 3G6ES 3WC2A 2J6UA 4RW4B 2IC3B 1ZM3A 5A8RA 1NK9A 3FBEA 4CLWA 4ZJLA 2GJ2A 3SI8A 3L3CA 2YWKA 1SKUB 2R2TA 4OJGA 2NUUG 1RWXB 4USIA 3HHNB 4ZVHA 2DY9A 5HJYA 2UVWA 2V4JB 3OVAA 3PO4A 3R3TA 2HGMA 5D4PA 5F3TA 4C8KA 2W2NP 5HP1B 2UVVA 3HVWA 3FCWA 1HQUA 1JXLA 1BQMB 3G71S 1TKTA 3MEGB 2N3OA 1R31A 3V6HA 3IAS9 3ULHA 3AD7C 2DO4A 4F04B 2VPZB 2Y9HA 5K14A 1HNIA 4IG3A 1EP4B 2PC6A 1RE1B 1FNMA 1S97A 3PTWA 1EETA 2CNKB 4DV1F 4PXEA 1UZHA 1SKRA 2WVBA 4U96A 1FESA 3KLFB 3DRRA 2ZE2A 1RWWB 2D3O1 5KFMA 2EK1A 5T14A 1HHSA 2KG0A 4XDCA 1NKEA 4F0MA 4IH6A 3VQTA 1REGX 5DS7A 1HYSB 4QR2A 1FFGB 1MU2A 2GC8A 5ETRA 4TY8B 1VHFA 4K4YA 3SCJE 5ETTA 1PAEX 4AL7A 4RW4A 1SKSA 1Y5LB 4NYPA 2IC3A 1EB0A 4EEYA 4MFBA 3IBFB 1B99A 3N9UC 1DRZA 1Q4RA 2V0NA 4LF7F 2G1HA 3DCAA 3RRKA 4NLWA 2W01A 1N33F 1L3SA 2Z57B 2HW3A 2F40A 3O3LA 4FBUA 3UD4P 5F0WA 2FJVA 3VWSA 4DN9A 3SCIE 3PCOB 3HK2A 5HP1A 1SIWB 2H5JB 2B4OA 2J9DA 3B6BA 4NYZA 3CIZA 1S59A 2MKCA 4ES2A 5L8RC 4LF8F 2R7TA 1GH8A 3J7AN 1VQ9S 5AT1B 1T9XA 1BQMA 3MEGA 1KVKA 4DWIA 1HNVB 1KOHA 2RILA 2KVIA 1LNQA 3G86A 1D8YA 2HHQA 4URGA 1EP4A 3SCKE 1Q7YT 3ISNC 5AE1A 1EHWA 1UTAA 2BM1A 3UVJB 1FXRA 2KB2A 1R8BA 2VQEJ 3QNWB 1G6BA 3KLFA 3CE8A 5B0EA 4R25A 3T5HA 1PCAA 4Q43A 1PO6A 2L3MA 3HLUA 1S6PA 2KVQE 3AB2B 1WG4A 3D3CJ 5F8JA 1HYSA 3NBPB 4AQYJ 3M4XA 3QFHA 4UQGA 4JI4F 4FNHA 1NZAA 4C97A 1FI4A 1TP7A 3D6TB 5DG7A 4TY8A 1UFWA 3FK4A 1GX5A 5K8NA 5BYSA 3SFUA 4QPXA 5CCMA 3WDOA 4MIWA 2EEYA 4CH0S 1JLBB 4IO9Q 4J37A 1F60B 4OX9F 1REVB 3HX9A 3KJQB 5I3PA 4QIEA 1B7YB 4IQXA 1T05B 3GV8B 3D0IE 2ATCB 2EVZA 2HG4A 3DC2A 1LW0B 3QSYB 1HD0A 2D74B 2DHXA 4LFAF 4C8YA 4H4OB 3A8IA 3ILIA 4RR5A 3VGVA 2YX7A 1CJKB 4CTAB 2Z2YB 4XK8C 4LF6F 3C16B 1S79A 5KG2A 1B4SA 3QIPB 2IJRA 2DGSA 4J9OA 4NLOA 1HNVA 3OTEA 4QU6A 4DV7J 4C98A 1Y10A 3W66A 2AYMA 3ELHA 2BACA 4WK1A 2IY5B 1NKCA 2EFQA 1WD6A 3PX6A 3MTKA 2BE7D 3D54A 3KLEB 3UVJA 1BQXA 3OR2B 4P7VA 6FD1A 3QLHB 4J90A 1HI0P 2GO9A 2VQFJ 1CJVB 2R3VA 4JI7J 4QIWD 3PXGa 2HQ3A 1RU2A 4ZA1A 1RTDB 1RLCL 1GT8A 5SUHA 3T9NA 3NBPA 3V5RA 2MLXA 2CG4A 3PFOA 3TUZC 2BDPA 1YG0A 3IC1A 3HVRA 2JWNA 1X4DA 4IG0B 1QAJA 3QJPA 4JI6J 4ZPDA 4JI5F 2DR8A 2F4FA 2JDJA 1TELA 1S99A 3JS9A 1YRXA 4B3OB 2V6AA 3ILOA 1JLBA 2N7CA 2W2QP 2DCLA 3CPWR 3OLAA 2MJNA 1REVA 4O3NA 4CLSA 5EWGA 2LU2A 4A8FA 3GIMA 4NXNF 3MM9B 3V6DB 4KHPJ 3TW0A 1LW0A 2D41A 1N54B 2DY1A 4H4OA 3M8PB 2CJQA 2HWHA 4DQPA 2DGWA 3WC0A 1CJKA 4CM0A 4LRDA 4CTAA 3C16A 2R7OA 4WZQA 3IWXA 2KKHA 1RT5B 4NASA 1GXUA 4IYQA 5GADI 2CQIA 2AGPA 3QIPA 1AT1B 3H7HB 4DUYF 1WOSA 1VQNS 3BV8A 5DM6Q 3ET6B 4WYLA 1MROB 2LA4A 3KDNA 3N5BA 3PR5B 4TXSA 3TARA 1H2UX 1VHIA 2DGVA 3EVMA 2YQ0A 5HMWA 1HW9A 4PG6A 3PV8A 4F0KA 3KLEA 2GQ2A 4QBUA 2NSCA 2MQOA 4N5SA 4M5KA 1M5PC 5HQ8A 1NH7A 1CJVA 1FNOA 4ZJOA 3UDLA 4I6AA 1NM2A 3VGUA 1Q86T 2HVHA 5HI7A 3OVSA 1RTDA 1XBWA 4C2MA 1PC5A 4A8QA 1HW8A 4USTA 3F41A 2PA3A 4EZ9A 4PWWA 3BQ2A 2PFDA 2ZZNA 4BCAA 4MK9A 2R7QA 3GU0A 3G87A 1APSA 4IG0A 4AL5A 5KFNA 4U6PA 3TJAA 1RGVA 2OEMA 4WCEQ 1TL5A 2ZJQQ 5DQIA 1OQ6A 4B3OA 3PJ9A 1Q53A 2HHHJ 4LF1A 2JFKA 2OFGX 2G0CA 1NPKA 1XNQF 3EXCX 1U0HA 4O4GB 7AT1B 5CABA 3PYFA 2B4UA 2MKYA 5KFKA 3LGMA 2LQJA 4QU7A 3MM9A 3V6DA 1RAIB 2DEIA 3SDEB 3VR1A 3GSDA 1RBLA 2HWIA 1LWCB 5D15A 4B3SJ 3M8PA 4GO5X 3C6UB 3VV2B 2AP6A 1YLXA 2R7SA 3DGPB 4EU0A 1QAIA 1RT5A 1S1XB 1HHTP 1ZPWX 3BSNA 5E5NA 4YFUA 4PWDB 2DRAA 5GADU 4PR6A 1HBOA 5KFQA 2ACYA 3ET6A 2XGPA 2O01C 1ROFA 4NMXA 1MROA 2Y3YA 1ZETA 2QA1A 2H4WB 2UVRA 4OX8A 3CUNA 3D67A 1Q82T 5J2MB 2DTJA 2V8VA 2PIIA 1UETA 4UZCA 2QA4S 1X5SA 1U25A 4CO2A 1UJ4A 5THWA 4LFBF 2RAQA 2A1BA 2HS3A 3QQCD 3R1LA 3M6WA 2XLJA 2LXIA 4PYDA 3KG0A 2GCFA 3T6BA 3NOGA 3AXMA 4NX9A 4DR5F 3QATA 3THTA 4DR6J 3B82A 4W90B 2PEBA 2YX1A 2IM3A 3B4DA 2GNKA 2QRRA 3OTBA 1KS2A 2HHSA 4J9KA 3BGOP 4CI0B 2VASA 5LSOA 2E66A 3DNCA 3DHXA 3KTQA 2IYGA 1Q8KA 4DZDA 3J81U 3OV7A 2VDIA 3OSNA 2LQ9A 4ED0A 2OKQA 2GAHC 1VBKA 3Q89A 1S0NA 4O4GA 4Q5VA 4OI6A 1KFDA 8RUCA 3I9ZA 5IFMA 3KLHB 3M9NB 1T9YA 2W24A 4E2FB 2ILZA 3EGNA 2OIHA 4FVMA 1F0XA 4DMZA 3SDEA 3TZYA 4IO1A 2HAIA 1LWCA 3JAMU 5E3CA 3NLCA 3ENVA 1FD8A 4OZ2A 3C6UA 3KLIB 4QWEA 1IBKJ 1S6QA 2IVFB 3FEZA 4K2XA 3DGPA 5GVQA 4UTGA 2M0GB 2DHHA 1S1XA 2DR5A 3HXMA 3N28A 4PWDA 3MR2A 5A8KB 1FEEA 1O6XA 4OI4A 2CQ4A 1WNEA 4AT1B 2YNGB 2KO1A 2AJQA 3KUGA 5F8IA 3BGUA 5J2MA 2I1RA 4PYAA 4PKDB 2B0GA 4Y2MA 3ZTRA 2D9PA 4DSEA 2LP4A 2CPIA 2YKQA 2IMWP 4HVZA 2H5EA 1B3TA 1NJWA 1GFWB 4UOGA 5F8GA 2F1FA 2BR0A 2NSBA 3ZC4A 3MM5B 4X4QA 1RT1B 4ZPVR 2XY6A 2HBYB 4QQBA 2ASJA 1Y3KA 3FRYA 2PFFB 4O44A 2JLGA 2CWXA 2G4BA 4U7UK 4ELUA 3EGWB 5DQHA 1YI2S 4KPYA 2OELA 4J9UE 2GMHA 1FDBA 1SJQA 4LBIA 2BUNA 2K3KA 3KLHA 3IM8A 5H1SV 4F3OA 1SQEA 2KJVA 4F3MA 2BQUA 3R7NB 3KLIA 4CLYA 1NPPA 4RUHA 2ZHAA 1HNZJ 5AXLA 5KFJA 3WIUA 4G6VB 4NLVA 3FBBA 2XLKA 3G9CA 5AE2A 2QFJA 3RAXA 4C3KA 1J27A 5A8KA 4B3MJ 2FD2A 1GAOA 1NSAA 4KGZB 2QL5B 4ED5A 4OZJA 4EK2A 3KNGA 2YNGA 3FDSA 4NI2A 3NNCA 4ILLA 2HZCA 4JV0A 3FUYA 2FC9A 1SC6A 1U8SA 1S1WB 1G1XA 1U1LA 3G2XA 3ZNJ1 4BWJA 3PRBA 4ICLB 1MWQA 1F9FA 2J8AA 1VCTA 1TQLA 4P7TA 4NLYA 3TYTA 1V5IB 2Y8YA 1MMDA 4R5PB 2HQIA 4OYXA 4RUCA 4DFPA 3J80Y 3FNNA 3MM5A 1GX6A 4DOZA 1RT1A 1Q78A 3ZZTA 4DBQA 1IKVB 2LYVA 3QZ7A 3I31A 4RW7B 1UPPA 4WP3A 3K8VA 3K7RA 3ZTQA 4X4TA 1V6HA 5BYQA 3A4TA 3PW5A 5KT6A 2V50A 1JXEA 3K5LA 5EHHA 3IAM9 1ZM4A 1SL1A 4I0WA 1M5VC 1SIZA 5GMKa 2CRLA 1FWLA 1D3WA 4J9RA 1HLWA 5ITHA 4X62J 1NRKA 2QLFB 3MUMP 2E29A 4FPIA 3T41A 4EWTA 1S0VA 1RAOA 4EMDA 4CLPA 4LIWA 2B9YA 3ZFVA 1DJ0A 1VYAA 5AXMA 1IVZA 7FD1A 3OL9A 3GFZA 1MG7A 4X2BA 3MR7A 2VQEF 2P2CB 1LK7A 3RBZA 1BGXT 3MZIA 4IRKA 3W5ZA 1AYEA 4DR7J 1ZH5A 2Y8WA 5F0UA 2A6OA 4L3KA 3W2WB 2FJXA 7FDRA 3TVZA 2KYXA 2R8HA 3QMQA 4ICLA 3BS9A 5KFRA 4AQYF 5A76A 4DXLA 2GJIA 3R5AA 4DV0J 5RUBA 4B9VA 2OSQA 2MHEA 3GB0A 2KXHA 3W62A 2W7OA 2M8DB 4KGKA 5JXSA 3BF4A 5KG3A 2MKIA 1IKVA 3OXFA 2LXUA 1I94J 4RNHA 3QIDA 2LLZA 1ZZNA 5LMNJ 4RW7A 4WKYA 2DPIA 4ECYA 3KG1A 4J91A 2OO4A 3CDWA 4MKVA 4DSLA 4RPFA 3NNAA 1AB8A 4PWUA 5ETOA 2VFVA 2ZFHA 3G6YA 1VLOA 4TNOA 4F4XA 1HI1A 1P27B 4ECQA 1JK9B 2I5JB 4PRFA 4JYAJ 1JQGA 4J9QA 1UCNA 1VBXA 2F7VA 2PDAA 3H40A 1QSYA 1QVGR 3VGSA 3VHQA 1L5UA 2HHPA 1NZ8A 5JJBA 1FJEB 3Q86A 2FZGB 3MUVP 1FJCA 4DV7F 3O6QA 3SSQA 2C2EA 3S1TA 1VQOS 3QRRA 4DZ6A 2LKZA 1AXQA 5HL7Q 3EDRB 2ROGA 4K4WA 4NWBA 4OYPA 2RU3A 2FLOA 4EFAC 2BABA 3E01B 3AXKA 1IWAA 2AQ4A 2VQFF 4PPDA 2L48A 4PXCA 4FVCA 4JI7F 3WIVA 2N4DA 3MF5A 3W2WA 1NHVA 1GMVA 5IT9Y 2MQLA 3NAHA 2WSEC 3I56S 1JXVA 4YY3J 2B6AB 1X4EA 3NAIA 4U9RA 3BJYA 2ZH1A 5HMXA 3JYTB 1TFYA 4JI6F 2QSWA 4BHQA 4I64A 2GVZB 3RU0A 1XEZA 2G2OA 3GSIA 3QPIA 2Q79A 1JLEB 4DQRA 5B0DA 3LP1B 1QM9A 2CXEA 4A8XA 4M8LA 1FTRA 2ZKUA 2A2CA 2XBPA 2BEFA 3G8QA 4PG4A 4Q0BA 3DM2B 4KHPF 5HATA 3RW7A 2AWZA 4G3IA 2OPRB 2BKPA 1URRA 5IV4A 4ER8A 2I5JA 3MI7X 2L08A 2C2DA 1OO0B 1Q5VA 1LWEB 1Y7PA 4NLTA 2KZMA 4IR1A 3CJ3A 1FRHA 4CO5A 2V9KA 2B4VA 1NBEB 2FVCA 2XYPB 3CW2C 1RKJA 4TN2A 2BOPA 4NCAA 5L1JA 1Y4ZB 3R6LB 3Q24A 2VF3A 2V8DA 1FRKA 1L3VA 2HHXA 4A46A 2RE1A 3DXSX 1MN9A 3DRPB 1CBKA 3P4UB 2EFGA 3QT6A 3GFXA 1AA1B 1H2TZ 2CWKA 1YJ7A 4DUTA 1YBUA 2E5JA 4B9UA 4OI1A 4ZLPA 4B02A 1D0EA 1ZYQA 3TAMB 3BKFA 3QGIA 1U1NA 1QY7A 1EQ0A 3DYAB 4RWWA 3OQ2A 2QL7B 1VRTA 4Y34A 2WAQD 4NLDA 2X1GA 2B6AA 4NMLA 4O3SA 2B3TB 3M8QB 2QX0A 3CJ5A 2BM0A 1N0VC 3BR8A 5DDOC 1V3SA 3N5FA 3JYTA 2RMLA 4B9LA 4ZVQB 2B8PA 1WWHA 3MCNA 2GVZA 6AT1B 2HHHF 3MM7B 3W5YA 4YP3A 1NK0A 5E3PA 2XY7A 1FK9B 1NK7A 1JLEA 5LL6d 3EUNA 4LREA 3LP1A 3KLGB 2CPYA 4K50A 4C8LA 2VU5A 2ZHOA 3DM2A 1S9GA 4FXVA 1EKRA 4KO0B 4DL2A 5CAAA 4QZVB 1S0OA 1BHNA 3OFEA 5DDPC 2OPRA 4B3SF 3OL8A 3ENAA 3WQPA 5IOLA 3R1HA 1LWEA 1OSCA 2FVSA 4G1QB 2VG7B 1B0PA 2RRNA 2QMXA 3H2UB 3H42A 3DLEA 2IBOA 4X4RA 3TX8A 1NSQA 2NYIA 1I3OB 4GKJJ 1Q16B 2VFUA 2EBEA 2HRUA 3PDNA 1R0BG 5D0RA 4IRDA 3OFGA 2DISA 4HTJA 1DQ9A 2OI2A 2HSEB 3WZ0A 3IWNC 2FJDB 1H98A 1H73A 4LUBA 2HURA 3TAMA 1EQMA 2NXUA 3MHYA 4ZCKA 4BS2A 3DYAA 3VVUA 3HFZB 1TTHB 4KV8B 4F4YA 4DR6F 1RABB 5DLGA 3M8QA 1UW4A 3OTDA 1WG1A 2I38A 4RBVA 1URNA 2VONA 4I2QB 2RF2B 1Y00A 1N6QB 3MM7A 1DQ8A 2JVOA 2W25A 4B9NA 1FK9A 4GMKA 5M2UA 2HEKA 3KLGA 2ALZA 5KG6A 1N56A 3FQLA 3FZBA 1NB7A 2P6TA 3US5A 4RUAA 2MTLA 4LF9J 3CDAA 2GS8A 2XZTB 4KO0A 4PG7A 3W9IA 4DG1B 2MQQA 4CLTA 1T7PA 1F9HA 4OZ1A 2RSQA 3O8WA 1IBKF 5K8OA 2MZJA 3GIIA 4MYUA 2GJFA 2HNYB 2VG7A 1OQ3A 3A3OB 4CH7A 4FS1A 2XTJP 2XWYA 4NE9C 2HQCA 3TZWA 2CVIA 3JTOA 1HBMB 3G6XA 2OPSB 2PMHA 2HFNA 2N4CA 3OTOJ 1S0MA 3DXBA 2G13A 2MZ1A 2PGCA 3R7BB 1DTQB 5K9FA 4ZP7A 1N5YB 3LGNA 1N88A 2ZBCA 1TZ0A 1XIQA 2HS0A 2XS5A 3PVXA 4KV8A 5HO4A 3CD0A 2VOOA 2XMUA 1XK8A 1FJ7A 1FTCA 2E5IA 1Y3JA 4MMOA 2BQRA 2C1EB 1RISA 4PCQA 3TI0A 2J8SA 2XO7A 2ZH4A 1X9SA 4DX5A 2MLZA 4I2QA 3DU5A 2RF2A 2LFVA 1N6QA 3CC7S 3KJVB 3DLHA 2FUG9 4KBIA 3MD3A 3TUPA 4KY3A 4OZ0A 2M7SA 4DEZA 3SMZA 2IJNA 3MMJA 4U7UD 1OY9A 2QO3A 1VQSA 1VGYA 3AQOA 2DHAA 4O4RA 3ETOA 1CC8A 2WW8A 1WF1A 4MYTA 4DG1A 1HL6A 1ICEB 3RJMB 4OYWA 2PI4A 1HNZF 1FO1A 1NDLA 3G82B 3MCSA 4RBTA 1L3TA 3FKBA 2OSRA 4ZMMA 4M1KA 2P9CA 4B3MF 2HS4A 1TUWA 4F4AA 2BANB 1FX2A 2X1FA 1HBMA 2OPSA 2X51A 5DRKA 2HK2A 2YY3A 3ICLA 3C3LA 4I6WA 4MH8A 3GZ7A 2ROPA 3WX8A 2LEBA 2YPZA 1RZMA 3L9ZA 4B9MA 1N5YA 1SL2A 3W9JA 3RGIA 2V4QA 2CQBA 4ZP6A 1YJWS 3QJJA 1IKXB 5H9EJ 1E6YB 5B0FA 4WK3A 5HBMB 2IVYA 2QLBB 2CQ3A 1NJIT 2BJ8A 1LFWA 1XC9A 3KFWX 3HJFA 4YR3A 4FYYB 1PGZA 3OVBA 4WJBA 3T1HJ 2HQGA 4DV4J 4DLGA 1MSWD 2JHEA 3JSMB 2CVEA 1SV5B 3LAMA 4OMFG 3CCRS 4FYVB 3H5SA 3KJVA 3D1QA 1T0TV 3Q8QB 4OLPA 1BXNA 1Q95G 3HO1A 4QW9A 2W4PA 3EZ5A 4B3TJ 3PIOQ 1X60A 4OZ5A 4PXDA 2W9CA 4FDFA 1R6YA 5KOWA 3MEEB 2YX4A 4KHMA 2FJEB 3HZGA 2W8KA 4OHVA 3R5DA 4ETXA 3RB4A 3I5BA 3OW2R 2JEIA 4X62F 5JVGQ 4NL5A 3G82A 3MURP 3K8WA 4ZPCA 4IR9A 1TKXB 5E41A 4X4UA 1U2FA 1IBCB 3LGHA 2NUHA 2AEMA 3FEYB 5IS2A 2BANA 2DNYA 4ZIWA 1R8CA 3PRVA 4X65J 2KM8B 3IBWA 1X7VA 1N5VA 4H54A 4OI0A 1HPZB 2EKNA 4DR7F 5C2CA 3GPAA 1EJ7L 5LXYA 3S8SA 1VMBA 1QD1A 1QJHA 1GMWA 2WK4A 4MJKA 5L1IA 1SBRA 1IKXA 3IG1B 3KYLA 1E6YA 2KI2A 5HBMA 1KTQA 5KT3A 4WXWA 1OS5A 4DV0F 2DGQA 4XDDA 5KFLA 1BMQB 2JEGA 1SH3A 2PE8A 2PMWA 3VF0B 4DSJA 3IS9B 3IR5B 4NEYA 1LV5A 4K0KJ 2PN6A 3FBCA 3ISZA 2E9TA 3MTJA 3D4JA 2RB7A 5M2RA 1H74A 1I94F 1SV5A 1FFSB 5LMNF 5L39A 2AT1B 2E1RA 3CGIA 4WWSA 5EGYA 1HFEL 5K8MA 5IT0A 2X7IA 4CLLA 3P6YC 1TK0A 2XULA 1LWFA 4ZP8A 1TL3B 3OHAA 4Y28C 1EKSA 2ZDPA 3MEEA 2AJ0A 2P6SA 2XI3A 4CLUA 4DCJB 2FGOA 4JYAF 3VAJA 2WSCC 1JLGB 4UQTA 4WTYA 3LP0B 3IXQA 4QWAA 4WFNQ 4LSZB 1J5OB 4M5LA 1UVKA 4CLZA 4LR8A 2FGCA 4XO0A 5J2PB 5D78A 4AUKA 1KONA 1TKXA 3UNYA 2F8MA 5CYMB 4P71A 2DIVA 3THPA 1LQ9A 2C2KB 3PHEA 2UUWA 5HMZA 3TZXA 2YXLA 1YBTA 2QMWA 2NXNA 2BE9B 1UVIA 3EE3A 1ZZFA 2DNZA 2HVIA 2NXJA 3HM9A 4ED4A 2HVZA 2BJ9A 3GR0A 3A8JA 1HPZA 2YH0A 4RO0A 1WC0A 2Z58B 4LF2A 3Q8VA 2CNNB 3WX4A 1UVNA 4DR2J 2EKYA 3A12A 3D9BA 1NJYA 2MY7A 3IG1A 4YY3F 4HHUA 2AF6A 3CJRA 1UVMA 4DV2J 1C0TA 3M05A 3GFYA 3AJDA 2L9NA 3TA2A 2OUGA 3HDSA 4J9VA 2CZVC 1KLNA 2SXLA 3C2PA 3CXCR 3I4PA 3IS9A 4LFCJ 1WDTA 2YKMB 3NY0A 1FERA 1ULRA 4ZHRB 2WVDA 4BWMA 3VALA 4ZJQA 3HD1A 4NEZA 3QZ8A 3NXZA 1DZ5A 1S1TA 1RAAB 2XHCA 2NQPA 2WHOA 2CPJA 5SZTA 3OFFA 4WTOB 3W3SA 4C8NA 2E1MC 1OSDA 3QWUA 4KH0B 4KFBB 3BEGB 4RW6B 1TL3A 5BJRA 1WEZA 2CQGA 4I67A 4F3QA 3P3DA 2CPZA 1UVLA 2NLWA 3PEHA 2YQ3A 1UA0A 1JLGA 2JEJA 4HI2A 3MCOA 3DGVA 1J5OA 1U47A 2E1CA 1QUPA 4NYOA 5J2PA 2X3DA 2F5GA 1GMWD 1KC8T 1O51A 1RWMB 4A8OA 2Z56B 5CYMA 4RU9A 2PD1A 5H9FJ 3NL0A 5L38A 2DKOB 2FJWA 3ZZZA 4A8MP 5KG4A 2ZH3A 1NJXA 3B4MA 3JB9k 4YB1P 3GCWP 4FP9A 2ASYA 4ECVA 2VA3A 2BYCA 3H25A 4ED6A 1RWKB 1HR0J 4WKRA 3UQSA 3VTIA 4E0DA 4OHZA 3KJNB 3ITHB 2J9EA 2BX6A 2RT3A 3BSAA 3FCHA 3LANA 2IFXA 4Y3CA 1S77D 2CNOB 1SQGA 1TL7A 1NAQA 2DCUB 3KHGA 1YVFA 2DNNA 2OTJS 2IAJB 2RVJA 2R2UA 2YKMA 4F8RA 4ZHRA 3AJ2A 4EBEA 3OJSA 4L74A 1M5KC 4TYAA 1HA1A 1FVSA 3CTRA 3TWZA 1WORA 3E8OA 1S6UA 1DY3A 4LBHA 4QIGA 2JZ5A 4KFBA 4RW6A 2CKWA 2GW8A 4JI2J 5JUMA 3TP2A 1NUEA 5IQQA 2ROEA 2WW4A 1RT4B 1EX8A 1O5JA 3BO4A 4P74A 4OYIA 5J2QB 3CCVS 1LFPA 2EWHA 2DVIA 5K8PA 5IT9U 4R8UB 4L73A 1SI9A 2HFUA 4F26A 4PPZA 3NS5A 4UOFA 1T3OA 2ZH8A 4N77A 3AODA 3M1VB 1P6TA 1H7WA 4HT7A 1BLUA 2DNRA 5CD4H 2CQ1A 4GKJF 1ACMB 3CC4S 2KM8C 4O0IA 3UR3C 1SQFA 1S9EB 3Q83A 1SPBP 3TNVA 4DPOA 3TQ1A 2RU9A 2DEJA 2PO4A 3Q8UA 2O66A 1WEYA 3MEKA 3UR0A 2WBRA 4OL8A 4P2FA 1M1KT 4LSNB 1S7IA 2DH8A 2RS2A 3QRPA 2VDHA 2R2RA 2BJDA 1VOMA 3ITHA 3W65A 3UDEA 1NK4A 2L9DA 3GMGA 2WZ1A 1XR5A 1W26A 4ECSA 4NCGB 1HHQA 1M5OC 3ZZRA 2HKEA 5D6GA 3HCXA 4QWBA 1KTVA 2WVCA 3AHPA 1H3DA 2MQ8A 1UJ6A 4X64J 1LKZA 3R5JB 1Y11A 1M1GA 3BQ1A 4LF9F 5CQGA 4V19J 3P5BP 3K57A 3Q2TC 3L7PA 3LOUA 3FZ2A 1OY8A 3KK2B 2UXDJ 4RU2A 3CULA 1RT4A 1ZBTA 5DJBA 3OSPA 4HEA9 2B7BB 3GYGA 5J2QA 3RBEA 1JLAB 5G4DA 4MKYA 3KMQA 3NP5A 4R8UA 2XYGB 4M5NA 4CP5A 2MSTA 3DOKB 2GAGC 2F3JA 1WC6A 1YRTA 4C0BA 2W9AA 5GAEI 3M1VA 3IR7B 1T3NA 5AE3A 3B78A 3VVTA 3OTOF 2IMOA 1KKHA 3R2CJ 1A6LA 4IOAQ 2OD6A 3NMRA 1RAFB 1S12A 4MK8A 4ED2A 1UMJA 3QWPA 1B64A 4C8MA 2HFZA 1AUSL 4M5JA 2BMBA 4LSNA 2H65B 4YOEA 1VK3A 1WSVA 3VAFA 4DV3J 2EC2A 1OY6A 4KPCA 1YRUA 1UEVA 5A8WB 3I6PA 1NK5A 5LXRA 1TUGB 3GE9A 1FE4A 2FQQB 5KFPA 2KDOA 1F2HA 3LPYA 2ATLA 3OL7A 2RDDA 4NCGA 3NCRA 4I7FB 2ZOMA 3BN4A 2XMWA 1PC4A 2AW0A 2QL9B 4PXBA 1UP1A 1Y5NB 5J2NA 3L7OA 1CJUB 1YTYA 5FIIA 4ECRA 2KXNB 2GHPA 1RUSA 1BWEA 4JI1J 3BBBA 1V5VA 3K5MA 2IRUA 4DQSA 2Q6BA 3Q8SB 3PW2A 1S1VB 3MM8B 3LTOA 2V63A 4NCBA 1NSKL 3B54A 1HIYA 2X1AA 3KK2A 2YQ1A 2W1BA 3SXLA 4A8SA 1I51B 2FPHX 4O3PA 2DJWA 1T02A 4OJ1A 3DLLQ 1JLAA 2XG8A 4FF3A 3THVA 1IJFB 4P75A 3HMJG 2HHVA 3OUYB 1WHWA 1ZTTA 4FBTA 3DOKA 2XZWA 2O1PA 1WKLA 2MLYA 3HHEA 4A8KA 4IDKB 1KEKA 4Q44A 2DYAA 4DL5A 1U24A 5GAEU 4LJMA 4ED8A 4AD6A 3TANA 2DGTA 2QA4G 3BH6B 3ZZUA 1W2BR 5ETQA 2V69A 1WKKA 3CD6S 5C7PA 1DARA 4PEOA 1VLYA 2ZH2A 2KT2A 1YWXA 2VBYA 3GV5B 3SYZA 2N3LA 3JSRA 2JNJA 4HDHA 2E1PA 4LRFA 3TEGA 1L3KA 3KUHA 1OYDA 4I7FA 3T1HF 4DV4F 2YPYA 2QJ3A 1CVJA 1FHTA 4U95A 1FJGJ 1RA6A 1RT7B 1CJUA 3DLBA 5KFVA 2NR0A 2UU9J 5A6PA 1NDCA 4RNMA 1RACB 4B9SA 4I1TA 4B3TF 3K0JA 1S1VA 5E3RA 5F41A 1TFWA 4HH0A 4YDXA 1JX4A 3QRQA 3P45B 4DFMA 1UKUA 4O23A 4I4BA 2P5VA 1Q7LB 2Y0SD 4N8OA 3ZZYA 1N5TA 2V4JA 3ZXWA 2GMLA 4RUBA 5M2PA 3OUYA 2DNQA 3ISND 1FXLA 1GK8A 2H5IB 3QFWA 4IDKA 2ZHBA 5DDQC 4X65F 2CQ0A 5F8NA 2KRBA 4EI2A 2MZQA 3PX4A 3T19A 1U6ZA 4W4MA 4TQRA 1ZM9A 3HFVA 4L3NA 1CQNA 1FDNA 4Q8FA 3ENWA 3GJRB 3PX0A 2HRYA 4J9LA 1FVQA 5DO2A 1LWXA 4USUA 4CT9A 3HI9A 1FDDA 2IJFA 9ATCB 1IR1A 1MWZA 3F44A 1Y9OA 2NXCA 1VDHA 2EPIA 4PQUB 1R0CB 2XMVA 3O2IA 2CQCA 4F67A 2KZZA 5F3ZA 3C66A 4K0KF 2P9EA 4HHJA 4KYZA 2QGFB 3JSBA 1NDKA 3M6VA 1RT7A 1KD1T 2LQ5A 5LOQA 2R42A 3F56A 4P2XA 4DJBA 1HMVB 1WI8A 4QYZK 2Z2MA 3EVWA 2HLUA 4EBDA 2V67A 2R9LA 1RHMB 4HR2A 2U2FA 3PHTA 1FKOB 2G1DA 2XY5A 2YKOA 3LF0A 3SSRA 3CSKA 3ILJA 2DNMA 2WSFC 2MHNA 2VZ9A 2KXFA 3E2EA 4O3QA 2DGOA 5ETKA 3FEXB 2DITA 4L6V3 1WOOA 2D3OR 2J7KA 5LT5A 4C48A 4IRCA 2QMUB 1HWLA 1XMQJ 1GEHA 2V8GA 3NWRA 1SJRA 4F36A 1TAUA 1YGYA 1DHMA 3MD1A 1P9YA 5KOXA 1JLCB 3W8PA 2F9JA 1RQ0A 2FYXA 3CF5Q 4DR2F 2FJAB 3FC9A 4B3RJ 2R7VA 5ETVA 2J5AA 1T9TA 3ZNUA 2A0FB 3W7BA 3JQMA 1CQMA 4DV2F 4KTQA 4M5GA 4YDDB 4PQUA 2AX0A 2DNOA 2LECA 3ZTOA 1PSDA 2FHJA 4LFCF 1AROP 4ECXA 3BPDA 3CCES 1DFDA 1JLQB 3DFEA 2AU0A 5MAOA 3OD2A 1T11A 2M8HA 4WFXA 1I6JA 2I6WA 5D4OA 3MWBA 1HMVA 4RNOA 2RHQB 2YWGA 2DGUA 1KFSA 1YZ6A 4D3HA 5GMEA 1VIXA 1FKOA 5EDWA 4EYIB 4ZVTB 5KFOA 3KWMA 4GVBB 3CVKA 3ETMA 2YTCA 5LMUJ 3AAWB 2UUTA 1NKBA 2H48B 3CCSS 2V4RA 1RDRA 1SC3B 1T05A 2FDNA 2E44A 2FC8A 3BN7A 5HN0A 2C2OB 4J7CA 5F8LA 1EARA 1MWYA 4OHXA 1NHUA 3UCGA 1WF2A 2OHDA 4WIIA 4J9SA 2WBMA 3C6TB 4DX7A 3I5CA 2Z2ZA 3ILLA 2R8IA 5ETMA 4CDIA 1JLCA 5KFCA 2J7WA 2H54B 4ZVEA 1HR0F 3EDQB 3MXHP 1NLKL 1AFJA 2AX1A 3RRGA 1WSRA 2NS1B 3GV7B 2CQ2A 3OR2A 4U8VA 4JP8A 3QLHA 2HMIB 3UN2A 1FKAF 4P72A 1JNRB 1G3OA 2P9GA 2VODA 4KSEB 1W25A 2OAUA 3R97A 3CWJA 4MT1A 1RT3B 3L95X 5IV3A 5EX3A 4J9PA 4KH1B 4EZ6A 3H2VE 3MOZA 1ZA2B 4NLPA 5T7LB 1Q1KA 1CPZA 5AXKA 1Z1ZA 4E98A 4FS2A 2A2DA 1HWKA 2G2YA 4KT0C 1RXOB 1WI6A 1UL3A 2KTQA 2COLA 2CUYA 2O67A 4JI2F 2I0XA 4TU9A 3GWCA 2YNIB 1U45A 1NK8A 4GVBA 2LXFA 1OWXA 1GXTA 5I3QA 2DPJA 5B7WA 1WC4A 2DGXA 3L4BC 1PKUA 1IN0A 2HIYA 4TVAB 4Y00A 2FVQA 2AMCB 1JB0C 3FBFA 2DNHA 3V2UC 3Q0AA 3HJVA 3DOLB 1VJWA 3IWLA 1KN6A 4BLGA 5BXIA 4HYKA 1RWPB 3JTPA 4USVA 1RHQB 2UXCJ 1VQ7S 3JTNA 2LMIA 1IBMJ 2FHJD 4Q7AA 5A2QY 3Q8YA 3C6TA 1R27B 3M2RB 4Q2LA 1WKJA 5HVHA 4ZLLA 4A48A 2JEFA 1OMSA 1TR0A 4YEAA 2VC0A 3Q8PB 3BREA 1FKPB 3MMBB 3BYPA 1UAWA 3VAHA 3KHRA 2QFIA 3EGVA 4TU7A 5ADZA 2HMIA 4QOTA 1KP6A 2F63A 1RTIB 1VQYA 4FNIA 4KGMA 2VJUA 3JAMY 1R0AB 2V34A 2BJ7A 4LR9A 3BQ0A 2VA2A 1Q8LA 1RT3A 3CEDA 3D0HE 3NGUA 2R7WA 3BGFA 4X64F 4EGLA 4HACB 1QE1B 3M32B 5T7LA 4M5MA 1RA7A 2AYBA 1RBOB 1HQ2A 2J6SA 2XZDB 2YNIA 2CJBA 1G4CA 3T5KA 2UXDF 1P1LA 2H1YA 1DURA 3GQCA 1K8AT 1F5AA 1GTHA 3ENQA 3IFEA 4K4TA 3U1NA 4DI6A 3RRHA 2MDAA 3JSYA 4AL6A 1ZA1B 4QCLA 1FD2A 2VD3A 1UWAA 4NLRA 3P96A 4OV1A 4NLSA 5HANA 5KT2A 5JVHQ 3DOLA 4UUWA 5J1PA 1GMUA 2OH2A 1PG5B 5KFDA 1FRIA 4PZVA 5MLCV 4ZS6A 4NZ0A 1A0OB 4F0HA 4HDGA 3IN5A 3M2UB 5EX0A 3M2RA 1C4AA 5U47A 1U6FA 4ECUA 1NB2A 2DHSA 4EO8A 3CD5A 2IIHA 1WJ9A 4JI3J 1VIOA 4R0EA 4DV3F 4URSA 4FXDA 1KVIA 3V4IB 4EO6A 1UA1A 1FKPA 3MMBA 3X1LB 2C28A 2Y1RI 4OYBA 4LR7A 1WTBA 3D6MB 3N4WA 1RK8A 2A18A 5ETPA 1AZSB 2JC1A 3TAPA 2CJXB 1QAYA 2V2KA 1RTIA 3DKDA 1VQ6S 2DRBA 4DL4A 3H4BA 1R0AA 1VRUB 2RQKA 1QTMA 4XTTA 5HAOA 1NH8A 1B0VA 4JI1F 3CJ2A 4HACA 1QE1A 3M32A 2B4PA 1QSLA 4X4NA 5AXNA 2ZJRQ 4IQMA 1ZM2A 3MAAB 3ONQA 2G0JA 3FSIA 2XNRA 1V3RA 3GTYX 3M6UA 4WFZA 3I55S 3QT7A 3RTVA 1OYEA 2C2RA 3R6GB 4NZ6A 2GA7A 4RWXA 1FRLA 1X9MA 1HQEB 2XMJA 5LSLA 4LRBA 5DGBA 4OFZA 2ZJPQ 1PJ5A 4OHWA 2DXDA 2M88A 3M2UA 2XCAA 1N32J 2ERRA 1KNZA 5GAGI 2KHDA 4K4XA 4WP8A 4MTPA 4EYHB 4G65A 4XPEA 1Q5YA 2O5DA 4I56A 1LXJA 2CAJA 1NSPA 1YJ9S 2VUGA 5HLFB 2VG5B 3V4IA 2FY8A 3CCMS 3O44A 3K2YA 1AZSA 3C46A 1YITS 3T5LA 5IWAJ 2R8GA 4LVNP 2MQMA 4C11B 3DRRB 3CNQP 4LF4J 2CJYB 1FJGF 3DMJB 2ZM6J 3DDIA 2QTWA 3QSIA 1FRMA 1A7GE 1VRUA 2CPEA 1X4FA 2UU9F 3CCZA 3RB6A 3CIMA 4Y0FA 2OP5A 3DDNA 2VIHA 4KJIA 9RUBA 1U1MA 2B5JB 1WHYA 4ZVPB 3AA8A 1YJNS 2I8EA 2RIJA 1H7XA 5GMDA 4LT6A 3HVAA 4ID8A 2YWHA 4CRJA 5CH7B 4ZVGA 3MAAA 4FPRA 1N5SA 1SJ1A 4QPTA 2OPQB 1RADB 2OLWA 4ITSA 5KFSA 2FLNA 2I2YA 4MFBB 2ZWPA 1NPRA 5E7OB 4ZCLA 3C19A 4FF2A 1U2CA 2WONB 4KB7A 5J1EB 3PJWA 3W60A 3AD8C 2ZEJA 4MIBA 3RAMA 2W2PP 4WU2A 3EZOA 1HQEA 3RZAA 4ECZA 3KK1B 2GIFA 3HSZA 3X3UA 5A0YB 4DV5J 2C2NA 2ZBPA 5C24B 2JSXA 4DR4J 1NJZA 5IXUA 4USWA 3EJMA 2HVEA 5HVGA 2Z30B 1F3VA 3BPSP 1B7FA 3GFHA 1H2VZ 3PYDA 5HVFA 4OX6A 4ELTA 5C2GA 3QAUA 5GAGU 1PIEA 5JMNA 5HLFA 2VG5A 3GP9A 3KOAA 1IUJA 3MR6A 3NWGA 2FJBB 2AHOB 2J0XA 3M9OB 1R43A 3LPEA 3SQGB 1LEOA 3RR7A 4BDPA 2H51B 1S1WA 2D3UA 2ZC3A 4NOHA 3SFGA 4C0HA 4C11A 2R8KA 4ED7A 3GJQB 3DMJA 1U02A 3AA9A 2B8QA 4ZVSB 3GIRA 3CCWA 4LQ9A 1KLMB 3D2WA 1NO8A 3SZ2A 4FYDA 4KAIA 2UUBF 2K2PA 1IWGA 2LQ8A 4K7QA 4R5PA 4XPCA 3LWLA 3RB3A 2XGQA 3NS7B 1CULB 1S6PB 2J7UA 2GHVC 3U7JA 5E2QA 1T9UA 4ECWA 2B5JA 3DDKA 3FMWA 4ECTA 4QIFA 2R7XA 2Q66A 2LEPA 4DPTA 2ZKTA 3H8YA 2BA9A 2CQPA 2W9BB 3H59A 1IJEB 2OPQA 4CLKA 3TVYA 1GNKA 4WFAQ 3L7UA 2P8IA 2HAFA 5B0AA 4DX6A 1IKWB 3I0SB 2WONA 5J1EA 2Y1IA 2R2SA 4NA1A 3R5BA 3BR9A 4DFKA 1LK5A 2BE2B 2IDEA 2XLIA 1U1KA 1ZOTA 3H4DA 2JX2A 1RCOB 4C3MA 3KK1A 5E3QA 3K58A 5A0YA 1XMOJ 1XMQF 4RW9B 2N82B 1NHKL 1KOOA 3HSJA 1DQAA 2VFSA 5C24A 2FLLA 3VCDA 1YIJS 3IP0A 3R2DJ 2BW7A 4H4MB 1UZDA 1N48A 2KU7A 4DL3A 4DSFA 5A6WA 5KTQA 5F9NA 3VAIA 4DCPB 1TK5A 4B3RF 4LSLB 2LCWA 2DRDA 2B9XA 4UZBA 2VKZG 5K5MA 1P9QC 4GC6A 4F25A 3SQGA 1RTHB 1O0PA 2HLTA 3GYXB 5FD1A 2RDJA 5D0HA 4UF4A 5HSPA 5F8MA 4O0NA 4BC9A 1H0HB 8AT1B 3BKUA 1S1UB 1KLMA 5CCLA 1CULA 3PYGA 1KVJA 5LM7E 2AJ2A 1V9OA 4ANDA 4OYOA 2MXYA 3MMCB 1QVFR 1R8AA 3KHLA 3AH6A 5D0EA 1JJCB 2LDYA 3H2LA 5B08A 3C8YA 2W2OP 3HP6A 5L9XA 3M6XA 5LMUF 4KGXB 3ZZPA 5DZ7A 4AE5A 1K0VA 3T9ZA 2W9BA 1I5OB 2MZRA 3T3FA 3M7VA 4WF9Q 4PABA 3NEKA 3V6KA 1IKWA 3I0SA 4RX6A 4LQ3A 1K0TA 3OBIA 4TYBA 3M8WA 4Q45A 2BE2A 1YQHA 4NLGA 3PW7A 5C25B 2HYIB 4LF5J 1WG5A 4ENOA 3PACA 1UW9A 4RW9A 2YWWA 4I68A 2QN6B 1ZAVA 1NDPA 2W7AA 4RBUA 2XO6A 1IM6A 2F8HA 4GC7A 2WTFA 3QT5A 3TA1A 2MEWA 3EX7B 4C4WA 4F7VA 4H4MA 1FE0A 2V5HG 2K3IA 5KFBA 1M5HA 1FT8A 4K4UA 5KFWA 2E7WA 2WOMB 2CIMA 3LALA 3BO3A 1F3FA 3J7YI 3CC2S 3LQVA 1XNRJ 4LSLA 3E01A 2XCPA 4A47A 4NXMJ 1RBAA 1RTHA 1U6BA 4V1Ak 2HBZB 2VV5A 2RJZA 1PILA 1R89A 1U2RA 3N0VA 2KJWA 4DR3J 2MQPA 2GFFA 2MZTA 1S1UA 2HHWA 2A10A 1K44A 2C42A 4KE5A 2K06A 4UOHA 1FEHA 4C8OA 2ZZMA 2CPFA 2AYEA 3N6LA 3S01A 3MMCA 1VK8A 2B43A 2XEXA 4OI2A 4TKTA 2BOAA 4B9TA 3RB0A 2DD8S 4ZVFA 3A1YG 3OXLA 3CCQS 2VICA 2NCKL 3JXOA 4OIXA 2EK6A 1U0HB 4WYWA 2UP1A 3FJ2A 1SXLA 3D6HB 1Q79A 5C25A 4OQJA 1S4FA 2C2MB 3R9LA 1IKYB 2EFPA 8ATCB 2UXCF 1IBMF 1FF2A 4GRSA 3RUBL 1XN9A 2QLJB 3LW5C 3HULA 3HT0A 3RYLA 1SKWA 5KT7A 4K2JA 3GIKA 2OTLS 1GTEA 5FDLB 1XTZA 2WOMA 1HBOB 2GV1A 4G1PA 3DRPA 4QIVA 1N52B 3KDOA 3D7SB 2NXEA 3G96A 1BY9A 1S48A 4F2SA 5CYQB 3J7YU 3AY0A 2KHCA 1X4HA 1YJVA 3UWTA 1KBRA 4DPYA 4HT5A 3R27A 2HNDB 1KDNA 4M5DB 2BJEA 2VBZA 4Y2IA 4K4SA 4N8NA 3IRXB 2CNLB 4DPXA 4JI0J 2B7CB 4YHHJ 4FKYA 3TRGA 2DHGA 2GMJA 5D3GB 1D9FA 3MAQA 2DR9A 5B09A 1RAEB 3W5XA 3MUTP 1FWKA 3T6JA 2UUAJ 2DNGA 1TKZB 4ANCA 4USKA 1R8PA 3S6EA 1Q8IA 4CWBA 2ZH9A 2HZAA 1Y0HA 3CMQA 2ZD1B 4ZIVA 4YR0A 1RHJB 1CJTB 3PNIA 3FMBA 1GXLA 5HROB 3SV4A 2M2BA 2EG2A 3UNGC 5IZHA 4QWCA 4MIAA 2VFRA 1N8RT 4UT4A 1IKYA 4G1QA 2ZBRA 1VQ5S 1KQSR 3HFKA 1PJ7A 2IM0A 1SH0A 1S6QB 3KK3B 2E7XA 2EFNA 5KFEA 3SV3A 4NA2A 1NMEB 1TL4A 5DM7Q 4JI3F 1HNXJ 2UV8G 3IO1A 2Q1LA 5FDLA 3QGHA 2E9RX 1TK8A 4IFVB 3V4MA 2UUCJ 4K8RA 1RAGB 5CYQA 2EI5A 3UN3A 4X4PA 2B9WA 5IT4A 1C1BB 1WHVA 1XERA 2CJ9A 1XJWB 4RKUC 4DU7A 4CLFA 4K4ZA 2HNDA 5L9NA 4M5DA 5E3AA 2E1AA 2FZKB 3UDCA 4GKKJ 1RT2B 3FFIB 4ZLJA 4DF8A 3CO9A 3IRXA 3Q8RB 1U4BA 1U09A 1UJ5A 1WTFA 3DI6B 2PMZD 2VPXB 3PYEA 2IA0A 3PR4A 5D3GA 4LIRA 2YKNB 1FRXA 3EXYA 5A2QU 5CZXA 3SCLE 4HLBA 4Z37A 4O44B 1SH2A 1TKZA 3TA0A 3NGRA 4F02A 1VS3A 2OPPB 1N5QA 2CZ9A 2ZD1A 2C3UA 3HHDA 2HVDA 1CJTA 3C14B 3IRWP 5HROA 4OLOA 1ZAXA 4CQ1A 3QO9B 4DPWA 3I96A 4DL7A 4YB5A 2AJFE 2E7VA 4NRTA 1HKAA 2AGOA 1WC5A 2GX8A 2HNYA 1B0TA 1HWJA 5KG7A 1X31C 3KK3A 1N32F 4OYMA 4J9MA 4RW8B 2YNFB 1FWPA 4OV6A 3QT8A 4RL1A 2BZ2A 5D4NA 1ZS6A 2OJ3A 3V81B 3KKFA 3OT9A 1DTQA 4IFVA 4HL9A 2GVDB 4NRUA 1D9DA 3MEDB 2LVWA 4D3GA 5J1NA 5IWAF 3DLJA 2C3PA 4NI2B 2EXUA 2XMAA 1MMLA 4ZPTR 2HQFA 4AXJA 5KFUA 1C1BA 2GQCA 3O1LA 4LF4F 2N7YA 1ITPA 1SL0A 2ZM6F 3W1YC 2VKRA 5DLFA 3UE2A 1RYSA 1MLAA 1YX2A 4ATNA 1RT2A 3FFIA 5ETSA 4PG5A 4WFYA 4HHHA 1PYTA 2U1AA 2WVEA 1S4EA 4TLQA 2XHWA 5E0OA 1SB6A 3M30B 2ZVSA 3DI6A 1U26A 3NGTA 1ELOA 1IR0A 2YKNA 2HBRB 4ED1A 3A8KA 2OEKA 2MJUA 5DG8A 2IVMA 5KFHA 2HFOA 5G0RB 4E8UA 4FYXB 1C0UB 4R0JA 4FF1A 2EW9A 4URQU 2OPPA 4USJC 3H20A 2HBQB 1L3UA 1U7LA 2GZOA 2JRSA 3WHIA 1F1BB 2F9DA 3C14A 3MPYA 4DR1J 3W63A 1U49A 1RLDA 3QO9A 3O5TB 4ZN3A 2B51A 2ILYA 5EWFA 2EC0A 4DV5F 4X4SA 3QBCA 4DR4F 4CT8A 3D1OA 4DX8H 2VJVA 3VQSA 2RNEA 5KG0A 4FXWA 3CJ8A 2AJ1A 1JJ4A 2LU1A 2ADBA 3G8SA 1IR2A 3QGGA 5F9LA 5BR8J 3MM6B 3UI3A 4GVLA 4RW8A 3HZEA 5DZ6A 2YNFA 1RP5A 3DU6A 3QGPA 1T9WA 3OHBA 1D8ZA 2QLWA 3Q23A 3V81A 2GVDA 2C3YA 2CJKA 3MEDA 5B0CA 4OYAA 4LRAA 3B8HA 3K89A 2MYFA 4C3LA 3MPDA 2QE5A 2IDLA 4Y65A 3OJUA 1ZTWA 2VB6A 1WC1A 5F8HA 3GG1A 3W61A 2Q43A 1X0PA 4DUZJ 1VQMS 1S10A 4CIOA 1N36J 1RT6B 3FSYA 4Y2CA 1E6VB 3TEHB 4YN3B 3BSOA 2V68A 5KFYA 3JSMA 3PFEA 3M30A 3M8YA 4DF4A 1EAYC 4ALZA 3BYRA 2ZDOA 5G0RA 2DB1A 3DRYA 2PA8D 4ANEA 1C0UA 1RWNB 1RHUB 1NNDA 2CYYA 3EVOA 2QYCA 1TL1B 1K1QA 4AFFA 5D8HB 3MCMA 4CZCA 4DFJA 1F6TA 1J5EJ 1XMOF 4Y2KA 4K5RA 3TZZA 1V3ZA 2ZNYA 2CPHA 4M5HA 1T9VA 4KQZA 3M8SA 3T1YJ 1D09B 1T94A 2YNHB 1VQ8S 2XM3A 2BBEA 2BRKA 1YSJA 1FX4A 3MM6A 4Z2XA 2XNQA 1AW0A 3J80U 3AOAA 1BE4A 1K1SA 1LOUA 2HHUA 5E33A 5B0BA 2HQDA 1JJHA 2PI5A 2CDRB 1TV6B 4DPUA 5KFZA 4CO0A 4Y2AA 1HNWJ 1HD1A 3R5CA 4UOCA 3SQOP 3PRDA 4KR0B 4KC5A 5D77A 2YWEA 3U1MA 2UXBJ 1WACA 1QLNA 1R3NA 4L76A 2ZBIA 5FLXY 4P6QA 1T95A 2QSFA 4ZLNA 2JLFA 3FVYA 3FQKA 2CJAA 2GGPB 3T5JA 2RQ4A 3M2VB 4DHVA 1RT6A 2JC0A 1E6VA 2QLXA 1BC6A 2ALYB 3OLBA 2WCXA 1CG2A 4YB6A 2DNKA 1G7CB 1QDUB 3G6VA 2ZUGA 2RRBA 3RG6A 4B17A 2AV5A 1VISA 3BKTA 4YS2A 1TMJA 4WPAA 3I5AA 4O3OA 3CJKB 1JWWA 2PSZA 1TL1A 1OIAA 1S49A 2DH9A 4LF5F 1I1GA 1TUVA 3LP0A 3H0PA 4OZLA 4Q0BB 2XB2D 1JIHA 3ADAC 2ZNZA 2KRRA 4JV5J 4G1IA 3I82A 2D3ZA 3A3PB 5LSRA 3NS6A 4DS4A 2CG8A 1CS4B 2V2QA 3HPOA 1YZ7A 3HHLB 2YNHA 2FHMA 4TU8A 2M5YA 1X4GA 1NU4A 1DBDA 4P2MA 2JOQA 5KAKA 3G8TA 3ZTPA 2IM2A 4JBCA 4K59A 1XQIA 5LJ5Y 3K5OA 1K47A 2ZITA 1FCAA 3FGVA 1XNRF 4JV2A 4ID5B 5CD4A 1TV6A 1N34J 4NXMF 1OJ4A 3CCJS 1HI8A 3LUYA 3GR1A 1U8WA 4JV1A 1KQFB 2QZ8A 4ZCMA 4DN0A 4DR3F 2RD5C 4IUFA 3CB4A 1JLFB 2GGPA 5IQ6A 4Y6IA 4ZPWR 3AOBA 3M2VA 1UFKA 3NCQA 1RU1A 4NLXA 5D0GA 2GQQA 2C2ZB 4ES3A 2F8EX 1VRTB 2PT0A 1U1OA 3GONA 1F5BA 1NXIA 3MAHA 3P8BB 4QWDA 2GHWA 2FVPA 4PUOB 1S76D 4OJHA 2OEJA 3VAGA 4DSIA 3UDVA 1TAQA 2ZBQA 1SCJB 5IC6B 1CEZA 3AB4B 3CJQA 2YH1A 1J2VA 4OI3A 4AXIA 1N4LA 3NG8A 4N56A 4USMA 5DG9A 3CJKA 3TJ8A 4JB8B 2IBKA 1C1CB 3TAQA 5LJ3Y 4UUXA 2E5LJ 1S9GB 4P73A 4PQAA 2IA6A 1T03B 4QW8A 4KRWA 3ZZOA 1PYOB 1CS4A 3D0GE 4JI8J 2W7PA 3HHLA 2MY8A 2CFXA 2KYZA 1T8EA 3FCVA 1XMBA 1SUQB 2OMOA 3K5PA 2XMMA 3BGRB 3DLEB 3U02A 3RBDA 5KFTA 4EUVA 5D4LA 3TUJC 1WUUA 3H90A 4ID5A 1QUVA 4OHYA 2RDIA 3OPKA 2JH3A 5GAHI 3KXDA 2FY1A 3Q22A 3MMAB 1CC7A 3I87A 3KMSA 1DAXA 4N7TA 5KFIA 3CJ0A 1JLFA 4B08A 1XR6A 4YB7A 1F9EB 3C15B 3BH7B 3UCZP 2MMYA 2Y0BB 2IAJA 4JI0F 4YHHF 3I0RB 2DXEA 4WIQA 1FFWB 4N76A 2XYHB 3PW0A 4CO4A 3AFGA 1DLOB 4PUOA 1F5CA 5KG5A 3TUIC 2UUAF 3NNHA 2VPYB 2MKKA 5DGAA 1K73T 2WB1D 3PW4A 3PIPQ 3FRZA 3IA0A 4OX7A 4N41A 1VC0A 1CLFA 2K7KA 3MECB 2F4VJ 4PG8A 4S0MA 3MFIA 3TJ9A 2ZVIA 1C1CA 5KFFA 4UW2A 3KLVA 2KH9A 4ZDNA 3BB5A 2AZ3A 4QR0A 3UW1A 1RHKB 3NGSA 4F2RA 4U8YA 3DLKB 2MPUA 2AEJA 4FKXA 2VC1A 1T03A 1YJUA 1QAXA 4HH1A 2VOPA 4FYWB 4NLUA 3NCPA 4CM2A 2VBWA 2OD4A 2W2MP 4QYRA 4TY9A 3TR5A 2RUGA 1SUQA 1HNXF 2AGQA 3PO5A 2WRMA 3MPUB 3CCLS 1S9EA 5AJ3J 1QTNB 3BGRA 3LP2B 2RQMA 2HFSA 2NYHA 4YQWA 2UUCF 3CO0P 2AZ1A 3V6JA 1A9NB 4KGVB 4ZPBA 3CDUA 5KFXA 1NK6A 2FZCB 1FDAA 4CNZA 3M9MB 4WU3A 2E9ZA 1VC5A 1WELA 1SVDA 5GAHU 2XMTA 3MMAA 3GYNA 2HNZB 2JL9A 5H9EK 1IBLJ 2CDQA 4GKKF 2JLEA 3TVKA 3C15A 3NGKA 3PJXA 2GIRA 3I0RA 1VRQC 1UVJA 4M95A 2XI2A 2BV3A 1QSSA 1KHWA 1DLOA 3HKWA 1X8DA 3LWMA 2JFDA 4X66J 1IQTA 1BQNB 3BBCA 3TOQA 3HHLD 2QYGA 1RI7A 2LQBA 2AKWB 1OPIA 1B70B 2KL8A 4FF4A 1G2EA 3QAEA 3VZHA 2J0QD 2M9KA 3PEJA 3MECA 2ZOFA 3IBCB 4MKBA 4IFYB 3TX0A 1VJQA 2BKNA 4DLEA 1S9FA 2YVSA 2XSJB 2M3DA 3DOMB 1RTJB 3DLKA 5CYJA 3VGTA 3H98A 3R8YA 2W8LA 3HHLC 1KQKA 2DR6A 2CPDA 1YKWA 3I9V9 3DRSB 2RH3A 3OTCA 4P10A 1VQPS 3GJSB 4JUZA 2XC9A 2Z4PA 4MKAA 4C0OC 2IHR1 2WVFA 3LP2A 4DU8A 3UO0A 2KT5A 1XWLA 4DCOB 2K1RB 2DK2A 2Z2LA 5CZVA 1C2PA 4U7CA 2AEFA 3IMQJ 1VQ4S 4Q8EA 3CJ4A 1RCXB 2R4FA 3UCUP 1RTZA 2D69A 3EICA 3GG0A 4BBYA 3IR6B 2ACMA 1X4AA 4W98A 1HBNB 3A8EA 1Z2ZA 5A8WA 2MKSA 3RR8A 2HNZA 4M5IA 4O3RA 2WB4A 5HK4A 1YK9A 2DT9A 2QC3A 3SBMA 2QIFA 4YUDA 4OYZA 3AQPA 3UPFA 4Z7YA 1AUDA 3AD9C 4DV6J 1YBAA 1FNXH 3W8GA 5L46A 5KT5A 5HJXA 1Y5IB 1X4CA 2HK3A 2IYIA 2UZAA 3K59A 5CHCB 4M94A 1BQNA 2MZSA 3VAMA 3MM8A 4DQQA 4ILMA 2QG9B 3CCUS 2HHTA 3KUEA 2J9CA 4CYUB 4DR1F 5EWEA 4IFYA 3HF5A 3Q2SC 2KFYA 4FZVA 2MKJA 5L1LA 2XSJA 4DS5A 2FVRA 3DOMA 4WP9A 2W9CB 1WC3A 3LA0A 2IPOB 3BO2A 4RJVA 1RTJA 3EWGA 2XS7A 3HHKA 4OZNA 2A6MA 1ZAWA 1UPMB 1WDDA 3ZTSA 2ZH7A 3M8ZA 2HWTA 2MSSA 3I32A 3N6NA 4WE1B 1SJFA 5BR8F 2D7SA 4HKQA 5BYRA 3D1HA 4Z7CA 2CZ4A 4ED3A 3VZIA 4ZPAA 3DRSA 4L75A 4DSKA 3HSGA 4ILRA 2K8GA 3EGZA 3PY8A 2JJ4D 3N6MA 1GQEA 3J7Z5 3VAKA 4RNFA 4M63A 2K1RA 4I69A 3CMAS 2Y1JA 4MK7A 3OFHA 4LMZA 2ABYA 3W2VB 1PBUA 2MKHA 3T1AA 1IM4A 3P5TL 1WHXA 1BUXA 1HBNA 5DETA 4OZ3A 2QV6A 4IH7A 5L1KA 2YBVA 1FXDA 2QEXS 3QYYA 2EFVA 2LDIA 4CO1A 4DUZF 1N36F 4QJVA 2M4MA 4DV1J 1X5PA 2W4DA 3J7ZT 1AFIA 2CA9A 2AD9A 2O3DA 1KQGB 1PJ6A 2J9DE 1W2IA 3AJ1A 2R7RA 1P1TA 2V94A 2UUBJ 1WF0A 4HTIA 3DN9A 1Q0NA 3MGJA 3R5GA 1EZZB 2CQHA 2AYGA 2DNLA 3DLGB 2G0IA 2HZVA 3PKMA 3K5NA 2EFOA 5HQMA 1M0SA 4CYUA 3I4HX 3BDEA 1JKHB 1LWFB 1CSJA 4A8YA 4AYBD 1J5EF 3MOJB 1RHRB 3K17A 2H9ZA 2HPUA 5KFAA 1X9WA 1P8GA 4LF7J 3WBZA 3T1YF 4W92B 4ETZA 2UVUA 5ETLA 4RNNA 1EIYB 5ETNA 1N33J 4WE1A 5C5JA 2C22A 5CA5A 2FTRA 1RJJA 1M5SA 2ASLA 2VH7A 1U48A 3M8RA 2DIUA 2D1CA 1RKIA 4MAKA 5H9FK 4WBFA 3EPGA 1VFJA 4OJ3A 2RUSA 2B9EA 3GLJA 3HSDA 4LF8J 2VFTA 1UFLA 4H4KA 1HNWF 4WFBQ 1S72S 2BXJA 2UXBF 1NEEA 1U1RA 3W2VA 2FHKA 1M1HA 2NPIA 4CCHA 2X3GA 3CT9A 2A3JA 1TVRB 1UEUA 5KG1A 2RQCA 3J7A1 2GIQA 2KFZA 4WXOA 1KSPA 1HWUA 3AT1B 4ZCIA 1OPZA 1C0TB 3FSXA 1UEKA 4P52A 3OXGA 4QR1A 3IGVA 1H38A 2E5GA 2BQ3A 3PKYA 3N79A 3BSCA 2UV8A 3UN5A 5C42B 3POTB 3LAKA 1U0SA 4JI4J 4J9NA 1MMNA 4ELVA 3DLGA 1U1QA 3JQJA 1S1TB 2M70A 2FLPA 1KHVA 3W64A 3D68A 4IH5A 1LW2B 4XAKA 1JKHA 4ZP9A 2CQDA 2YKPA 1R6VA 4DL0C 4L72B 4JV5F 3BM7A 2Z8QA 1RSCA 4OX9J 2H3EB 4ZITA 4LVOP 2V8PA 4C9DA 1WOPA 4I6YA 2ZOGA 4J5OA 4I2PB 3OR1B 2NPFA 2XWXA 4Q2MA 3MR3A 5IC4B 2AIRB 4F4WA 4LFAJ 3E51A 2QT7A 1VBZA 1KR4A 1D9AA 4LF6J 2W4CA 3MR5A 1N34F 1TMMA 2LEAA 3U27A 5CXTA 1DTTB 4LRCA 3NKYA 1Z4UA 2YKAA 4P9SA 2C3OA 1HBUB 3MFHA 4P2SA 1NCLA 4CH1A 1PBAA 5I3UB 2BJ1A 3D3BJ 1U1PA 3KG4A 1TVRA 3CDBA 2KFNA 2V8HA 5KFGA 1JLQA 4CNYA 2POKA 1BD6A 2ZUAA 1PAUB 1TL7B 3BBFA 4ZKAA 3UD3P 5I42B 3U1LA 1W7WA 4QYZJ 3JQKA 4KHRA 4RLEA 5C42A 2D9OA 3POTA 2NZCA 3NMAA 3F0NA 4X4VA 2Y1LB 1LW2A 1YDLA 2E5LF 4JI5J 2ASDA 3PG9A 2H4YB 2ZC4A 2I9SA 5T41A 3CDEA 4F50A 1S6OA 3KNAA 4ES1A 1SC4B 2AJ4A 3A13A 2G9OA 2Z0GA 2MQNA 5FLXU 4JI8F 4KIAA 2RRAA 1R7IA 3IGNA 4I2PA 2BKOA 3OR1A 4NXNJ 4IOCQ 2CPXA 1SJ4P 5K20B 2K7JA 2KN4A 2NREA 3MPVA 3CMES 1O8BA 2OFHX 3RAQA 3LO3A 1RWOB 3H5XA 2RKIB 3SIPB 2DXFA 4H4KC 2BJ3A 4DQIA 2LA6A 4C8ZA 1RWVB 4FN5A 4KKOB 2DO0A 1JMTA 1DTTA 4DUYJ 1RYRA 2KG1A 3J81Y 2J0WA 1BWVA 1HBUA 6FDRA 3EM1A 2BVZA 1MW7A 2VL1A 2F65A 3CD7A 5I3UA 1N0UA 3A3NB 3R7SB 3HKZD 2IRYA 2L41A 1FRJA 4X4OA 3SSSA 2EBGA 4YR2A 1IQZA 3AOCA 1X5OA 5KT4A 4ZVUB 2C3MA 2JVRA 4DL6A 4N47A 3PZPA 1SJ3P 3PM9A 3ZZ0A 1XR7A 1VBYA 5I42A 2R8JA 2L9WA 1JNZB 3NOCA 3MPWA 1K9MT 2ZH5A 4ZN1A 3GCXP 3LH2S 1FA0A 3BZQA 4IKAA 3H5YA 2F4VF 4RZRA 2CADA 3OL6A 3EZUA 4DDFA 2BRLA 2DNPA 2HGLA 3ZO7A 5IM0B 3L09A 3H5UA 3QJLA 2KT3A 2OMLA 3BDPA 1Q8BA 3DHWC 3HVTB 3BGLA 1XNQJ 3UFCX 2E5HA 3EPIA 3D28A 4NPOA 5DQGA 2NZ4A 2FB0A 5HMYA
chains in the Genus database with same CATH topology
1XEZA 5D4NA 3O2IA 2CQCA 4F67A 2KZZA 1VC6A 3QPIA 2ZH6A 2Q79A 5F3ZA 1JLEB 3C66A 4C7QA 2OJ3A 4K0KF 2P9EA 4HHJA 3KKFA 3V81B 1DTQA 4IFVA 4HL9A 4NRUA 5B0DA 3LP1B 4DQRA 1QM9A 1VI7A 1D9DA 3MEDB 2LVWA 2VG6B 3JSBA 4A8XA 4M8LA 4D3GA 3M6VA 5J1NA 3S7RA 1FTRA 1RT7A 2ZKUA 2C3PA 2LQ5A 2A2CA 3DLJA 2IM1A 5EUHA 2XBPA 5IWAF 5AJ3F 3G8QA 3F56A 4NZ7A 4PG4A 1MMLA 4ZPTR 1YJTA 1HMVB 4DJBA 4AXJA 3DM2B 5KFUA 1WI8A 2MGZB 4KHPF 1C1BA 2ADCA 4Q0BA 2Z2MA 3RW7A 2GQCA 2HLUA 3D5MA 3O1LA 2AWZA 4LF4F 2N7YA 1WEXA 4BC7A 1SL0A 2RKIA 4G3IA 2ZM6F 4EBDA 2OPRB 2DBBA 2VKRA 5DLFA 2R9LA 1URRA 2U2FA 3UE2A 1Q81T 4KKOA 1RYSA 4K4VA 2I5JA 4NLQA 1FKOB 1C4CA 2G1DA 3MI7X 2L08A 2C2DA 2XY5A 4ERDA 1D1UA 2YKOA 1OO0B 3LF0A 3EYZA 2FHOB 1LWEB 4ATNA 1RT2A 3FFIA 3SSRA 1Y7PA 3CSKA 3N01A 4PG5A 4NLTA 4WFYA 2KZMA 4IR1A 2DNMA 2WSFC 3CJ3A 1VQLS 1FRHA 2U1AA 1IBLF 2MHNA 4CO5A 4TLQA 2V9KA 2KXFA 2B4VA 2XHWA 2VZ9A 5E0OA 1TKDA 2FVCA 3E2EA 1SB6A 2VBXA 1RKJA 5FJ4A 3M30B 2ZVSA 3DI6A 4TN2A 1U26A 2DGOA 4O3QA 2BOPA 4NCAA 5L1JA 1Y4ZB 1ELOA 3DRXA 3FEXB 1IR0A 2YWFA 2YKNA 2DITA 4L6V3 4ED1A 3Q24A 4A8WA 2MJUA 3F73A 4NA3A 5DG8A 2IVMA 1FRKA 2V8DA 1UWBB 2HFOA 5KFHA 1L3VA 2HHXA 1YJRA 2XS2A 2D3OR 2DR7A 2J7KA 5LT5A 1RWUA 5G0RB 4E8UA 4A46A 2RE1A 4IRCA 3DXSX 4TLRA 1C0UB 4R0JA 3DRPB 4FF1A 2EW9A 2VPWB 2EFGA 4URQU 2OPPA 4USJC 3GFXA 4X66F 3H20A 1H2TZ 1L3UA 1U7LA 1HWLA 3TO8A 2JRSA 2F9DA 2V8GA 3MPYA 5J2NB 4X84A 2HGNA 2MB0B 5DDRC 2E5JA 1U49A 4B9UA 4OI1A 4ZLPA 4B02A 1D0EA 1R8HA 1ZYQA 1JJ2R 3QO9A 1SJRA 3O5TB 3TAMB 1TAUA 2B51A 1YGYA 2EG1A 4V19X 2ILYA 1DHMA 3QGIA 3MD1A 5EWFA 2EC0A 4DV5F 2X1BA 3P49B 4ZOSA 2B56A 1U1NA 1QY7A 1S7HA 3DYAB 5KOXA 4RWWA 4X4SA 3OQ2A 1RAJA 1JLCB 4UY85 1VRTA 4Y34A 2WAQD 4CT8A 4DR4F 4NLDA 3GIJA 3D1OA 2X1GA 4DX8H 2B6AA 5A8RB 2F9JA 4NMLA 4WZMA 3VQSA 4O3SA 1RQ0A 2RNEA 2B3TB 4GO7X 5KG0A 1M90T 4FXWA 3RW6A 2AJ1A 3CF5Q 1JJ4A 2LU1A 4DR2F 3M8QB 2FJAB 2ADBA 3CJ5A 3G8SA 1F2GA 5IM0A 2BM0A 2R7VA 3QGGA 5F9LA 1N0VC 2J5AA 3BR8A 3MM6B 1V3SA 3UI3A 3N5FA 5DDOC 3JYTA 3KHHA 3W7BA 3HVTA 2RMLA 1CQMA 4RW8A 1KRPA 4DV2F 3HZEA 2IRXA 4B9LA 2YNFA 1RP5A 3DU6A 4KTQA 1WWHA 4IOBA 3QGPA 1IXKA 4YMEA 4YDDB 2HHHF 4PQUA 2PEHA 3MM7B 1HWIA 2AX0A 4A4JA 2DNOA 3E3XA 2QA2A 4YP3A 2LECA 1YHQS 1NK0A 2XSFA 1X4BA 3OHBA 5E3PA 1D8ZA 2Q3PA 4JOUA 1PSDA 3NGDA 2FHJA 4LFCF 2XY7A 1AROP 1FK9B 4ECXA 1NK7A 1JLEA 2QLWA 4F4KA 5LL6d 3EUNA 3Q23A 1MNEA 4K5SA 1HARA 3V81A 3CCES 1ZPVA 1Z2LA 2C3YA 3LP1A 1DFDA 3CCTA 2CJKA 3MEDA 5B0CA 3KLGB 1JLQB 2VG6A 3DFEA 2AU0A 5MAOA 2CPYA 3B8HA 2HIQA 4K50A 2J0SD 2MYFA 4UY8T 4C8LA 2M8HA 4WFXA 1I6JA 5D4OA 2ZHOA 3MWBA 4C3LA 5EN1A 1HMVA 4RNOA 3DM2A 2MGZA 1S9GA 2YWGA 2QE5A 4FXVA 5B0GA 4KO0B 4DL2A 4QZVB 1S0OA 3OFEA 5DDPC 2DGUA 1KFSA 4Y65A 1HQUB 3OJUA 1ZTWA 2OPRA 1TKTB 4D3HA 4B3SF 2VB6A 5F8HA 1VIXA 3GG1A 3G4SS 1FKOA 3OL8A 5EDWA 4EYIB 1H6KX 2Q43A 2XMKA 1X0PA 1VQMS 1S10A 4CIOA 5KFOA 3KWMA 1RT6B 3FSYA 4Y2CA 4TQSA 3R1HA 3CVKA 1E6VB 5K14B 1LWEA 1OSCA 2YTCA 3BSOA 2FVSA 1HNIB 4XIUA 3AAWB 2RS8A 4G1QB 4IG3B 1LXNA 2UUTA 1NKBA 3CCSS 5KFYA 2V4RA 2J6TA 2VG7B 3JSMA 1B0PA 2RRNA 1EETB 1RDRA 2QMXA 3H2UB 3PFEA 3M30A 1VQKS 3DLEA 1T05A 4DF4A 4CO3A 2FDNA 3NRBA 3GILA 2IBOA 2ZE2B 2E44A 2FC8A 3BN7A 5HN0A 4X4RA 3TX8A 4HI1A 2NYIA 5F8LA 1Q16B 1UWBA 4ALZA 2VFUA 2FIUA 2ZDOA 4DV6F 2EBEA 1MWYA 5G0RA 2DB1A 3SEOA 4OHXA 3MDFA 3DRYA 2HRUA 2M52A 2PA8D 2BW2A 3PDNA 1C0UA 1NHUA 4IRDA 3HT3A 1X0FA 1NNDA 2J76E 2CYYA 2DH7A 3OFGA 2QYCA 3UCGA 4EBCA 2DISA 2GO8A 4HTJA 2APOA 1DQ9A 1TL1B 2Q6CA 1K1QA 4U67Q 1WF2A 1MU2B 4WIIA 3WZ0A 4J9SA 3IWNC 2WBMA 4ZK7M 2FJDB 1H98A 3C6TB 4AFFA 2R7UA 5D8HB 4CZCA 4DFJA 4LUBA 3TAMA 3I5CA 1XMOF 5I4MA 2NXUA 4Y2KA 3MHYA 4USHA 2V9WA 1X5TA 4K5RA 4F4ZA 1V3ZA 3G6ES 4ZCKA 3WC2A 4BS2A 2ZNYA 2CPHA 3DYAA 2R8IA 2J6UA 4KV8B 4KQZA 4F4YA 1JLCA 5KFCA 4DR6F 2J7WA 4ZVEA 1HR0F 4RW4B 3M8SA 2IC3B 1ZM3A 5A8RA 1NK9A 3MXHP 1AFJA 5DLGA 2GJ2A 1T94A 3SI8A 3M8QA 3L3CA 2YWKA 2AX1A 1UW4A 2YNHB 3RRGA 1VQ8S 3GV7B 2NS1B 3OTDA 2BBEA 1WG1A 2CQ2A 2R2TA 2BRKA 2I38A 3OR2A 1YSJA 3MM6A 4Z2XA 2XNQA 1AW0A 4RBVA 1URNA 3QLHA 2VONA 2HMIB 1K1SA 1LOUA 4I2QB 2HHUA 4OJGA 2RF2B 2NUUG 5E33A 1Y00A 1N6QB 4USIA 1FKAF 5B0BA 3HHNB 3MM7A 4ZVHA 1DQ8A 2JVOA 2W25A 1JNRB 4B9NA 2UVWA 1JJHA 1G3OA 1FK9A 4GMKA 2PI5A 2V4JB 5M2UA 3OVAA 3PO4A 1TV6B 5KFZA 3KLGA 2P9GA 2VODA 3R3TA 2HGMA 4KSEB 5D4PA 2ALZA 5KG6A 1N56A 1W25A 5F3TA 3FQLA 2OAUA 4CO0A 4C8KA 3FZBA 1NB7A 2P6TA 4Y2AA 3CWJA 5HP1B 1RT3B 1HD1A 3L95X 3R5CA 3US5A 4RUAA 4UOCA 5EX3A 3PRDA 4KR0B 4KC5A 5D77A 2YWEA 3U1MA 4J9PA 1WACA 3CDAA 1QLNA 2UVVA 4EZ6A 3H2VE 1R3NA 3MOZA 4NLPA 3HVWA 5T7LB 2ZBIA 4KO0A 1Q1KA 4PG7A 5AXKA 1CPZA 1Z1ZA 5FLXY 4E98A 4P6QA 4FS2A 1T95A 2A2DA 2QSFA 1HQUA 2JLFA 3FQKA 3FVYA 1BQMB 1HWKA 3G71S 1JXLA 4KT0C 4DG1B 1TKTA 2CJAA 1WI6A 3MEGB 2N3OA 2MQQA 2GGPB 1T7PA 3T5JA 1UL3A 4OZ1A 1R31A 2RQ4A 3IAS9 3V6HA 2RSQA 3O8WA 2COLA 3ULHA 2KTQA 3M2VB 1IBKF 2O67A 4JI2F 2I0XA 4TU9A 3GWCA 2DO4A 4DHVA 2YNIB 1RT6A 1U45A 1NK8A 5K8OA 2VPZB 2LXFA 2MZJA 1OWXA 1GXTA 2JC0A 1E6VA 5K14A 5I3QA 5B7WA 3GIIA 2DPJA 2DGXA 2QLXA 1HNIA 4MYUA 1BC6A 4IG3A 1EP4B 2PC6A 3OLBA 1IN0A 2HNYB 2WCXA 2VG7A 1OQ3A 1FNMA 1CG2A 1S97A 4CH7A 4FS1A 1EETA 4YB6A 2DNKA 1G7CB 2XWYA 4DV1F 4PXEA 4Y00A 3G6VA 1SKRA 2FVQA 2ZUGA 2RRBA 3KLFB 1FESA 2CVIA 2ZE2A 3DRRA 3JTOA 4B17A 1HBMB 2AV5A 3G6XA 5KFMA 2OPSB 2PMHA 2HFNA 1JB0C 2N4CA 1S0MA 2EK1A 5T14A 2DNHA 3V2UC 3Q0AA 3DOLB 1HHSA 2KG0A 1VJWA 4XDCA 3DXBA 1NKEA 2G13A 2MZ1A 3IWLA 1KN6A 2PGCA 3I5AA 4IH6A 1KD1T 1DTQB 4O3OA 3CJKB 3VQTA 1JWWA 5K9FA 5DS7A 4HYKA 2PSZA 1HYSB 3JTPA 4QR2A 1TL1A 4ZP7A 1OIAA 1VQ7S 1N5YB 1MU2A 1S49A 3JTNA 2DH9A 2LMIA 3LGNA 2FHJD 1N88A 4LF5F 1I1GA 1TUVA 3LP0A 4Q7AA 5A2QY 2GC8A 3C6TA 4OZLA 1R27B 4Q0BB 2XB2D 2ZBCA 1TZ0A 1JIHA 3M2RB 2ZNZA 2KRRA 4TY8B 2HS0A 1VHFA 4Q2LA 4K4YA 4G1IA 3I82A 2D3ZA 2XS5A 3SCJE 5LSRA 3PVXA 3NS6A 4DS4A 4KV8A 4A48A 5HO4A 4AL7A 2JEFA 4RW4A 1SKSA 1Y5LB 3CD0A 4NYPA 3HPOA 2VOOA 1TR0A 2IC3A 2XMUA 4YEAA 4EEYA 4MFBA 1XK8A 2VC0A 3HHLB 3Q8PB 1FJ7A 3N9UC 1FTCA 2E5IA 1Y3JA 3BREA 4MMOA 2BQRA 1RISA 4PCQA 1FKPB 2FHMA 2YNHA 3MMBB 4TU8A 1DRZA 1UAWA 1Q4RA 3VAHA 2M5YA 1X4GA 1NU4A 3KHRA 3TI0A 1DBDA 2JOQA 2V0NA 5KAKA 3G8TA 4LF7F 2XO7A 4TU7A 5ADZA 2HMIA 4QOTA 2ZH4A 3DCAA 3RRKA 2IM2A 4I2QA 4NLWA 1X9SA 3DU5A 2RF2A 4JBCA 1N6QA 4K59A 3CC7S 5LJ5Y 3K5OA 1RTIB 3KJVB 1N33F 3DLHA 1L3SA 2ZITA 1FCAA 2FUG9 3FGVA 2HW3A 1XNRF 4KBIA 4JV2A 2F40A 4ID5B 1VQYA 4FNIA 3MD3A 3O3LA 4KGMA 4FBUA 3UD4P 5F0WA 1TV6A 4NXMF 2FJVA 3VWSA 3JAMY 3CCJS 4DN9A 3SCIE 1R0AB 1HI8A 4OZ0A 3LUYA 3GR1A 2M7SA 4DEZA 4JV1A 3HK2A 3SMZA 2IJNA 3BQ0A 3MMJA 2VA2A 1Q8LA 5HP1A 1RT3A 3CEDA 3D0HE 1SIWB 1KQFB 2B4OA 2R7WA 2J9DA 3BGFA 2QZ8A 4NYZA 4ZCMA 3CIZA 4X64F 2QO3A 4EGLA 4DN0A 2MKCA 4ES2A 1VQSA 1QE1B 1VGYA 3AQOA 5L8RC 3M32B 2DHAA 5T7LA 4O4RA 4DR3F 4LF8F 3ETOA 2R7TA 1CC8A 2RD5C 1GH8A 1VQ9S 1RA7A 4IUFA 2WW8A 2AYBA 1WF1A 4MYTA 1BQMA 3CB4A 4DG1A 1JLFB 3MEGA 1HL6A 2J6SA 4DWIA 2GGPA 1HNVB 5IQ6A 1KOHA 4Y6IA 4ZPWR 2RILA 3M2VA 3NCQA 4NLXA 2PI4A 2KVIA 2YNIA 3G86A 1HNZF 2CJBA 1D8YA 2GQQA 2HHQA 1FO1A 3T5KA 2UXDF 1P1LA 4ES3A 2F8EX 1DURA 3GQCA 1K8AT 1VRTB 4URGA 1EP4A 1F5AA 1GTHA 2PT0A 3ENQA 3MCSA 3IFEA 3SCKE 1U1OA 1Q7YT 4RBTA 3ISNC 5AE1A 4K4TA 3U1NA 1F5BA 1L3TA 2OSRA 4ZMMA 4M1KA 3MAHA 3RRHA 2BM1A 2MDAA 2P9CA 3JSYA 4B3MF 1FXRA 4QWDA 2GHWA 2KB2A 1R8BA 4AL6A 2HS4A 2FVPA 4PUOB 1S76D 4OJHA 1G6BA 4QCLA 1FD2A 2VD3A 3KLFA 2BANB 2X1FA 3CE8A 4NLRA 3VAGA 3P96A 5B0EA 4OV1A 4R25A 3T5HA 4DSIA 1HBMA 1TAQA 4NLSA 2OPSA 2X51A 1CEZA 5DRKA 3AB4B 5KT2A 2YY3A 5JVHQ 3ICLA 2YH1A 3C3LA 4Q43A 1J2VA 4OI3A 3DOLA 1PO6A 4I6WA 4MH8A 4UUWA 4AXIA 5J1PA 2L3MA 1N4LA 3GZ7A 2OH2A 3NG8A 5KFDA 3HLUA 2ROPA 4N56A 1S6PA 1FRIA 5DG9A 2LEBA