1FDAA

Crystal structures of oxidized and reduced azotobacter vinelandii ferredoxin at ph 8 and ph 6
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of oxidized and reduced Azotobacter vinelandii ferredoxin at pH 8 and 6.
pubmed rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport(iron-sulfur)
molecule keywords FERREDOXIN
total genus 34
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1993-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fdaA00
3MM7A 1Y5NB 4RKUC 2C3UA 4XDDA 1FTCA 1DURA 5BYSA 3EXYA 1FERA 4KT0C 1FDDA 2WSEC 2FDNA 2PMZD 4L6V3 3C8YA 1B0PA 2FJDB 1IR0A 2VKRA 1G6BA 1Y5IB 2C3OA 1F5BA 1FEHA 1FRJA 2WSCC 1FXRA 5CH7B 2FJEB 1H7XA 2ZVSA 1CLFA 1BD6A 1D3WA 2V4JA 3MMBB 1PC5A 3MM5A 1ROFA 1FRLA 3HKZD 1H7WA 2VPWB 1B0TA 3EUNA 4AYBD 1F2GA 1JNRB 1GTEA 4ID8A 1XERA 2O01C 1PC4A 3MM6A 3PNIA 4OV1A 2C42A 1FRKA 2FGOA 2C3MA 3IR5B 3MM8A 5BYQA 1GAOA 4YDDB 2FD2A 4XK8C 3MMAA 1FRXA 6FDRA 2WB1D 1KQFB 7FDRA 2UZAA 1SJ1A 2FJBB 1BC6A 1K0TA 1FDAA 3MM7B 1FF2A 1G3OA 1SIZA 2Z8QA 1DAXA 2GMHA 3MM5B 1VJWA 2GMJA 1F5CA 3MMBA 3MM9B 3MM8B 1FDNA 3OR2A 2PA8D 1FRHA 3MM9A 1B0VA 1GT8A 1C4AA 1RGVA 5CHCB 2VPYB 4Y28C 1SIWB 2V2KA 2C3YA 1FRIA 2Y0SD 3IR6B 3OR1B 2XSJA 4CI0B 1DFDA 1A6LA 1JB0C 1FXDA 3MM6B 3MMAB 1C4CA 2PDAA 1KQGB 1WTFA 1JNZB 1FDBA 3MMCB 1Y5LB 2WSFC 5E7OB 1H98A 7FD1A 1HFEL 3GYXB 1H0HB 2WAQD 1R27B 2XSJB 3OR1A 4OMFG 1BQXA 1KEKA 1AXQA 4DHVA 1FRMA 3MMCA 5L8RC 1Y4ZB 2V4JB 1GTHA 2VPZB 3LW5C 1BWEA 1FD2A 3IR7B 3OR2B 3EGWB 2C3PA 4XDCA 1IQZA 1FCAA 2IVFB 2VPXB 5BYRA 6FD1A 1BLUA 1Q16B 5FD1A 2FJAB
chains in the Genus database with same CATH superfamily
1V3ZA 3ILOA 4RKUC 1TKXA 2HBZB 2CPHA 3QPIA 1MMNA 3HHLD 1JLAB 2X51A 4YS2A 2Z57B 4FS1A 4Q45A 2B56A 3IFEA 4N8NA 4KO0B 1DURA 3M05A 3A8KA 5EDWA 1LW0B 1FERA 3EXYA 3MEKA 1NSQA 3UDEA 1O5JA 5I4MA 1SC6A 4DUYJ 1D0EA 1IKWB 1Q8BA 3LP1A 2N7CA 4LSZB 3KJVA 5MLCV 4B9NA 1O0PA 3C8YA 4O23A 2HHPA 1NPKA 2XMWA 4AUKA 4WKYA 4YR3A 1TL3B 3RTVA 2QL5B 1RBLA 2VKRA 3CMES 1T03B 3ELHA 4UW2A 1YSJA 4K4YA 2ASLA 3RR8A 1NJYA 2ZC3A 3CJKB 1X31C 4Q0BB 2Z2ZA 5HBMA 4Q5VA 3RAXA 2ZH8A 1UAWA 1RWWB 1VRTB 2W24A 3CDWA 5IFMA 2GFFA 2BRKA 1PC5A 4O3SA 3D6TB 3V81B 3M9MB 3ISZA 1DTTA 1UJ6A 2M88A 3I5CA 3CC2S 3M8ZA 4DPWA 4IOBA 3RZAA 3H90A 3IWXA 3EGVA 4ZP6A 5LMNJ 3GLJA 4B3OB 2E9RX 4DV3J 1CULB 1FJGF 3C16A 1QSSA 1HBUB 3R5BA 4NE9C 2C2DA 4NYZA 4UY8T 4QU7A 2IY5B 4C8MA 1VQ4S 1J5EF 4NZ7A 2MKHA 2LQ8A 3BSNA 4L3KA 5CXTA 1S9GB 1FI4A 3GSIA 5HAOA 4B3OA 1OSCA 2EKYA 5KFCA 3NBPB 1KLMA 4HLBA 5AJ3J 3BS9A 4ZDNA 2E5JA 3CJKA 4FS2A 4PG6A 2C22A 2RU3A 3KLEA 1T8EA 3N6LA 3SYZA 1IKVB 1R8CA 1A0OB 2GMHA 4DF8A 2ZNYA 2Q43A 2C2KB 3OPKA 1OS5A 1VRTA 3MMBA 1VIOA 5HL7Q 1QTMA 1FDNA 1UEVA 3EGNA 1N6QB 2OEJA 5DZ7A 2NREA 1AFJA 3AB2B 3MM9A 4IO9Q 1R0BG 2DR5A 1ZA2B 3JSRA 3UCZP 3J7Z5 4B3SJ 2VOPA 2U2FA 3GONA 1WI6A 1KC8T 1D09B 1FWPA 3UR0A 1YI2S 2DIUA 2E5GA 4RO0A 5GAEU 1WF1A 2ZH4A 2Z0GA 4Y65A 1Q79A 1VBKA 3KG0A 2H48B 4DUYF 3L7OA 2DNNA 2WB4A 2QLWA 2KDOA 1RAIB 4RNMA 1DQ8A 2ZZTA 4OX8A 3NKYA 2N3LA 3VGVA 1KQKA 3PJXA 4LIWA 4ED5A 2BRLA 2WTFA 1C4CA 1X5SA 4JOUA 1OYEA 4C2MA 3MD3A 4RWXA 2YQ0A 1OPZA 3ISNC 4CO1A 1JNZB 3L4BC 4H4MB 1KNZA 5D78A 3H7HB 2ALYB 3PJ9A 4TLQA 1S6UA 1QSYA 1S1TA 3TUZC 2AJ2A 4JV1A 2HGLA 3T1HJ 3W2VA 1BQXA 1SKSA 3IWLA 4DHVA 2XGPA 1IJFB 1UMJA 2GMLA 3MMCA 4DR5F 1Q5YA 1VQNS 2HHUA 2DNMA 3DNCA 3DRYA 4RR5A 3U1MA 3VWSA 1MMDA 4WFBQ 5F9NA 4ZCMA 1NJWA 1SJ3P 4ECUA 4NXMF 1RHJB 3LA0A 4PWDB 3OR2B 1S97A 3EGZA 1VS3A 4FYYB 1EP4B 2XMJA 4F36A 1EKRA 2YNFA 4DPUA 4FKYA 3I5BA 2HAIA 1HBOA 5J2QB 4F2SA 2WVBA 4WU3A 2PEHA 3UFCX 1VHFA 1YBTA 1LK7A 4UF4A 1AROP 3AOBA 4K5SA 2MKKA 3Q8RB 1YJRA 3D54A 2C28A 2CPFA 2EFGA 2G2YA 1BXNA 2YQ1A 3L7UA 2IHR1 4H4OB 2CQBA 1RTZA 3RRKA 3M30B 2KKHA 3GSDA 4I2QA 4DS4A 4BWJA 2E9TA 1YLXA 1SVDA 1K47A 5KFIA 3PKMA 2UP1A 4RPFA 4PWWA 4QOTA 2B51A 3PYEA 2V2VA 2IJFA 2GO9A 4KR0B 5E3CA 2ZH9A 1K1QA 1FHTA 4MT1A 3AOAA 1SUQB 3R5DA 4WWSA 3U1NA 4YP3A 2KVQE 2V8DA 4ICLA 3PFEA 4OYIA 3ZTRA 4PKDB 3G6VA 3US5A 1YGYA 3DLKA 1CSJA 1VYAA 1RDRA 3UDCA 1T94A 4F0KA 1RTJB 2R2SA 2JHEA 1X9MA 4C3MA 4IRKA 4J9MA 5ETSA 3DGPB 2E9ZA 3QAEA 4NLQA 4DXLA 1A7GE 3UNGC 5ETRA 2RNEA 3P5TL 2CQCA 1NPRA 2EFNA 3J80Y 5HO4A 3DLKB 1JNRB 2FLLA 2B9YA 4ELVA 2VC0A 2LLZA 1S5ZA 1T0TV 3EDRB 3LH2S 1XERA 2BKNA 1JLFA 2GJFA 2JFKA 4MIAA 3U1LA 2DPIA 2DGSA 4ZJQA 1QAXA 4DV6F 3CDAA 4KIAA 4C8ZA 5GADI 3TEGA 2F8HA 4AT1B 2XQCA 2R2RA 1NRKA 1RT4A 3G87A 5LT5A 4AL7A 1GXLA 3AJDA 3KK3B 4WP8A 1TFWA 4V1Ak 1NKBA 2WBMA 3OUYA 3ENAA 3ETMA 4QQBA 3C3LA 3TZZA 1HQ2A 2DIVA 5LM7E 4P71A 2QX0A 1K0TA 1S57A 2QMXA 1WI8A 3HHDA 4LF8F 2HIQA 2JFDA 4RNNA 4MKVA 4WP3A 3CCLS 2R7TA 4TU8A 5T14A 1CQNA 2XSFA 5HLFA 3EE3A 2F9JA 3Q22A 2BQRA 3GJRB 4W90B 3MDFA 4EGLA 5DG7A 1N6QA 4ANCA 3EZOA 3WIUA 3IBFB 4KGZB 1UETA 2WVDA 3EPIA 1C4AA 1FVSA 4OZJA 2OP5A 3CDUA 4GMKA 4TY9A 2I9SA 5HLFB 3T3FA 3V6DA 5F0WA 2JEGA 1FO1A 3CD0A 3JTNA 4CYUB 5A6PA 2IDEA 2JLGA 3C14B 3QQCD 3VTIA 1HNZF 2JVRA 3IRWP 1VQOS 2P6SA 1U0HB 1LW0A 3NS5A 4GRSA 3HULA 5T41A 4LF2A 3R97A 2GHVC 3IM8A 4KKOA 3SBMA 1ZTTA 1ZM9A 1HWUA 1FX4A 1PG5B 3HD2A 2GVZA 1TKZB 4NCGB 4WE1B 1WDDA 2DCLA 5F8IA 3TI0A 1UZHA 3B4MA 5G0RA 2QA4S 1U45A 4TXSA 1HBUA 2ZOMA 3D4JA 1KQGB 1RU2A 2BMBA 4GKJJ 2UVWA 2DGQA 3FMWA 1YG0A 5AE2A 1VCTA 4WBFA 1LV5A 1FDBA 2OI2A 1Y5LB 2F4FA 4MK7A 1PJ5A 2UUAJ 3IS9A 4C4WA 4USTA 1XN9A 4RLEA 4ED0A 4TQSA 2KM8C 3VAIA 3OFGA 3R8YA 4AXJA 5HJYA 3HHEA 1AZSB 3VR1A 4LF5J 2LYVA 2PGCA 3KHRA 4LR9A 2MYFA 1X5OA 1YRXA 1NK6A 2AMCB 2FLOA 2HNYB 2CG8A 2ZBIA 3LGHA 1SH0A 3LW5C 3QMQA 3THTA 4DL5A 4CO0A 3IR7B 5D4OA 3QAUA 3DI6B 1S76D 2KJWA 2CQ4A 3CVKA 1Q53A 1XTZA 2P5VA 3MZIA 3PG9A 2RT3A 1F3FA 2JOQA 1YITS 2MJUA 2W8LA 2HNYA 1RWPB 4ZJLA 3GR1A 5JJBA 4AL6A 4LF5F 5EGYA 1NH7A 4HL9A 2F63A 1FJGJ 2B0GA 3H4BA 5DJBA 4OZLA 2BDPA 4YR0A 4URQU 4ZPBA 3A8IA 5LMNF 4GKKJ 3EICA 2OPQB 4OYOA 9ATCB 4C8LA 4P2XA 3WDOA 1IM4A 4NLTA 1X0PA 5F41A 2M8HA 1FDDA 2R4FA 3OLAA 3QYYA 4ED2A 2D7SA 3OBIA 5IWAF 3Q8PB 3HI9A 2QLFB 3G8QA 4OYXA 3BR8A 1WHWA 2HQIA 2KN4A 3DXSX 4DX6A 1UVJA 1GMWA 4FYDA 2CIMA 3MF5A 4JI6J 1F5BA 3BV8A 4ES1A 1M1KT 1R6VA 2M7SA 1J5OA 3N6MA 1T03A 2OH2A 4G1IA 5LJ3Y 1RBOB 3M8PB 4PG8A 2VU5A 5A8RB 4NXMJ 4RUBA 1N5YA 4DJBA 1QUVA 4CDIA 1RT3B 2X3DA 2GV1A 3FBEA 1TK5A 1MWYA 4QWCA 3I0SA 1RK8A 4KGVB 4DCJB 2OKQA 2W25A 4P52A 2KFYA 3H5SA 4L72B 1LWFA 1TV6B 4HH1A 3HSJA 4XTTA 3ZZOA 3R2CJ 2VBZA 4YN3B 1NB7A 1M5KC 1U7LA 2MQLA 2CWXA 4LFAJ 1GEHA 2MQQA 3KLGB 2C3MA 4MKAA 2CJKA 3C2PA 4QU6A 2AT1B 5KG7A 2UXBJ 3G86A 3M2UB 1VQ5S 1NHUA 2XNRA 1Q7YT 6FDRA 3DRRA 3FCVA 2UV8A 4PG7A 2DY9A 3GG0A 5IT9Y 3ZZ0A 3MR6A 3QZ7A 3OVAA 1SJ1A 3SFUA 1HQUA 9RUBA 4R5PA 1VC0A 1ZM4A 2HQGA 2DNRA 1RQ0A 2IJRA 3DLGA 4OHVA 1F9HA 1WKKA 1IR1A 1VQYA 4ZCIA 2AD9A 1RAEB 3A3NB 3CW2C 4OI1A 2E1CA 3W1YC 5A8RA 1F5CA 2B7CB 3RAMA 2W7AA 2J7KA 2YWFA 2VKZG 4Z7CA 3W9IA 3W60A 2IM1A 4C8KA 2H54B 4Y00A 3MUTP 2J8AA 3KNGA 2IMOA 2W2MP 4MMOA 4DV2F 4YDXA 4PXBA 2R8JA 3D5MA 2KZMA 4ANEA 1QD1A 2YWEA 5KTQA 2NYIA 2YTCA 3CNQP 5KG3A 4RNFA 2UXCF 2DTJA 1NKCA 3OR1B 4ZPTR 2HVHA 2GJIA 1ULRA 3UD4P 2ZM6F 3NGSA 2DNOA 2LKZA 2SXLA 3H5UA 4NOHA 2CRLA 4RW7A 4EZ6A 5LSLA 1YTYA 3AQPA 3CC4S 3EWGA 1KLNA 3OT9A 2DD8S 3HHLB 3E01A 4IG3B 1HIYA 1RU1A 4F2RA 2MKYA 2VFVA 2CG4A 2A1BA 1D8ZA 2MZRA 3FMBA 4DQPA 3VV2B 4F67A 4YB7A 4CLUA 2L9NA 2IM0A 2MZ1A 1IBLF 4K2JA 2J7WA 1H98A 4ECVA 1S1WA 4AFFA 4KHPJ 1PBUA 3TVKA 1HR0F 2X3GA 4PUOB 3DRSA 2R7XA 3EXCX 2JEFA 2FVRA 3CGIA 3OLBA 1QDUB 3NMAA 3LP0B 3BO4A 4EBCA 4DL7A 2QSFA 1FRMA 1LW2B 3BF4A 3DOMB 3VZHA 3WIVA 2NSCA 1N5VA 5BXIA 5EHHA 2G4BA 3R7BB 2AX0A 4J9SA 2M0GB 2YX4A 4F25A 4PUOA 4OV6A 5F8HA 2ZJPQ 5I42A 3DU6A 4QIVA 4XDCA 1T05A 3SSQA 4A4JA 3FC9A 2D9PA 1HR0J 2Y0BB 1S0VA 3A13A 5F9LA 4LBPA 2UVRA 3HP6A 1L3UA 1S7HA 1Q16B 1EJ7L 1EB0A 4EU0A 3FJ2A 2N82B 1IBLJ 4LQ3A 3O44A 1U8WA 3LWMA 2LA4A 3C14A 1Q1KA 1Y5NB 2BW2A 3E01B 3F44A 4F0MA 5B09A 1HNXJ 2L9WA 3MPDA 2EK6A 1MW7A 4LFAF 4X84A 1SV5A 2HWHA 3CMAS 2GNKA 1X4FA 3CJ0A 3G2XA 3OTEA 4KKOB 5JUMA 2VOOA 1RT2A 4X4OA 1WC5A 2NZCA 5EN1A 3AXKA 4IUFA 1HNIB 1U0SA 3MAAA 4YQWA 3TAQA 3CC7S 3VQTA 1WJ9A 1RWOB 1Q95G 4DL0C 1J2VA 5F8LA 1ZETA 1NBEB 2AJQA 2V69A 1WF2A 3RB4A 3QJJA 2WVFA 2XNQA 3FBBA 4YB5A 1ITPA 4MYTA 2JH3A 3VGTA 1C0TA 1H7XA 2ZVSA 4I1TA 4I64A 5ETQA 3SCIE 3S6EA 1X4GA 3AXMA 2CNKB 1NK7A 2DB1A 1SKUB 3MTJA 2FY1A 1KFSA 3HSZA 1IWAA 1RT3A 5L9XA 4M5DA 5B7WA 4RBTA 3CCMS 4B3SF 3TVYA 5IWAJ 1AYEA 2W9BA 1BQMB 2BABA 2XZWA 4U95A 1N56A 4KJIA 4BLGA 1SBRA 4DPYA 2WVEA 2J9DE 3DFEA 5FIIA 2QRRA 1RCXB 3KK1A 3MM6A 2IJNA 3UVJB 3U7JA 3GIJA 1O51A 2WOMB 5D4NA 4PPDA 5KFOA 5DRKA 1B99A 3T19A 2U1AA 4EWTA 2Y1RI 1ACMB 3Q8UA 1RE1B 4J91A 2K7KA 4RW4A 5ETPA 4CLWA 2C2RA 2C2ZB 2G13A 2WB1D 3M6UA 5F3TA 2EFVA 5KFJA 5I42B 2FZGB 1VQ9S 4ZHRA 1UWBA 1T7PA 2APOA 5KFWA 1HNVB 1PBAA 1EAYC 2BE9B 2CJQA 3FSYA 4MFBB 4WYLA 3RU0A 5L1LA 1M5VC 2I2YA 4NI2B 3TUPA 5CYQA 4C8NA 2JX2A 1S6QB 1XNQJ 2Z2MA 3MMJA 3K57A 1WEZA 1GK8A 4LQ9A 5K14A 2EBEA 3GZ7A 1NJZA 2PEBA 2PO4A 4FYXB 2H51B 4B3TJ 3NLCA 1UFWA 2HG4A 1J5OB 2BE7D 3M32A 4ZLLA 4IH7A 2MEWA 1Y0HA 3NXZA 4DPTA 1UVMA 4ENOA 2ZDOA 3LAMA 5E3AA 1VI7A 4OX9F 1IXKA 3R7SB 2VICA 1LWEB 3PACA 4GKJF 3PX0A 3D1HA 3WQPA 3OVSA 4JV5F 1RP5A 4Q2LA 2CQ2A 2D41A 2W2NP 4NMLA 3KLFA 3M1VB 2WOMA 4ECXA 1A6LA 1IKXA 3MPYA 4X66F 2MSTA 4QW9A 1N8RT 4RW4B 1X5PA 4WTOB 2HFVA 4QJVA 1WSRA 3ZZTA 1RA7A 5B0DA 4ED6A 1TMMA 1X9WA 1VQLS 1MG7A 2E29A 3S7RA 2OSRA 2OPRB 4E0DA 4C97A 2B6AB 3B82A 5K8OA 2VHGA 3DM2B 1U1QA 4FF1A 4JI1J 1M90T 1QM9A 1R8PA 3R3TA 1RT1A 3PW5A 1TUGB 2ZM6J 4DR6J 3OR1A 1KEKA 5L38A 3Q24A 3SDEA 4DUZF 4G65A 2HHSA 1GNKA 2OPRA 3NWGA 4KPYA 4DUTA 1PYSB 1N34J 4U6PA 3D0GE 3FBFA 3W8PA 2EW9A 3GJTB 1RT5B 2QTWA 3FQKA 1S1UB 8RUCA 4KYZA 4BS2A 2LFVA 2HNDA 2V68A 3MCOA 2UV8G 1Y00A 4KH1B 3SFGA 3H25A 3QIDA 3EX7B 2ZH3A 4CLTA 1SKRA 2ADCA 1VOMA 5A8WB 2LQ9A 2MMYA 3MAQA 3HF5A 1X5TA 4K7QA 4MJKA 5K20B 2MKIA 3C15B 5CYJA 3TJ8A 2W2QP 3I82A 4KHMA 1RHUB 3C6UA 1PO6A 3AAWB 1S7IA 3LP0A 4JI7F 2BA9A 4FXVA 5A8WA 1WKJA 4AL5A 3T1AA 4GO5X 3HX9A 1TL5A 4KT0C 1P9YA 5H1SV 1UWAA 5KT6A 3BR9A 2B6AA 3RW7A 2FPHX 1NEEA 4IH6A 4OZ3A 4UUWA 4MTPA 1OYDA 1Y9OA 4J9RA 3VQSA 4MIBA 4M5LA 4OI3A 2QFJA 2UU9J 4I4BA 4TQRA 1HL6A 2XB2D 4RU2A 1WG1A 1R3NA 2QL7B 4ELUA 1FRJA 2RMLA 2ASJA 3BBBA 4DI6A 3JAMY 2RHQB 4YB1P 5CH7B 1Q81T 2LQBA 2KYZA 1TKDA 2PIIA 5D3GA 4ILMA 1FJ7A 2FUG9 4OX6A 1NK0A 3FRYA 1ZOTA 2I38A 5M2UA 4X4PA 2AWZA 4B9LA 1RHRB 1JJ4A 3DHWC 2J0QD 1B3TA 1BMQB 1CJVB 5D0HA 4R8UA 1AFIA 1WOPA 3GIIA 1RLCL 3OW2R 4NMXA 1JLCA 4UQTA 5H9FJ 1ZYQA 1MWQA 1OWXA 2JNJA 3QT7A 2BJ3A 1F1BB 3N79A 5HI7A 2G9OA 2KFNA 4R8UB 5E3RA 5DQIA 4NEYA 4K0KJ 3BB5A 1IKYB 2UUTA 4HVZA 2VA3A 3VVUA 4K0KF 3QGPA 1O6XA 2DGTA 4NLUA 4F50A 2JZ5A 4JI5F 4B17A 3NCQA 2AJ1A 4B3MJ 4LRCA 5EX3A 2DGOA 3CDBA 2BANA 2RD5C 4BC7A 3NWRA 2NCKL 2CPZA 2CWKA 2G1DA 3UN5A 4EYIB 1JLEA 2XZDB 4LSLA 3S01A 4JP8A 3GMGA 1HBOB 3WZ0A 5K14B 3RAQA 2GMJA 2O5DA 2E1RA 1FESA 1SL1A 1NDKA 2YWHA 3PM9A 4ZP7A 1RAFB 5M2RA 4ES2A 4O44A 2DHHA 4ZCLA 2HHHJ 1HW9A 2ILYA 2GVZB 4NCGA 3PO4A 3POTA 2YKNB 3QATA 5CZXA 1HI8A 1XBWA 2ACMA 3ISND 3ILIA 2LEPA 3FGVA 3ITHA 1KHWA 4ZS6A 4EYHB 4LFCJ 4E8UA 3UW1A 3WC0A 3LPEA 1FNOA 3GWCA 5L1KA 4WZMA 4ILLA 1G7CB 4QR0A 2CQ0A 3EZ5A 4DSFA 2ZZMA 3A8EA 4DMZA 4IG0A 2ZE2A 3W62A 1K73T 3CIZA 5CYMB 3GTYX 4NWBA 4CLZA 3QIPB 3MM6B 3M8QA 3MMAB 4P9SA 3TQEA 2LECA 1YJ9S 3PXGa 2G2OA 5JXSA 5ADZA 2H4YB 3EYZA 2PDAA 3MR7A 3H4DA 3SSRA 4ZLPA 5IZHA 2CDQA 1WELA 3K59A 1OIAA 2P9CA 4WFAQ 4N76A 2XMAA 3NNAA 3TA1A 3O1LA 4PWDA 1CC7A 1HFEL 2MGZA 2KT2A 4DLEA 1SC1B 2WONB 1UTAA 1ZM2A 2ZUAA 1LFWA 1PJ7A 5A2QY 1EHWA 3D1QA 4EEYA 2F4VJ 3J81j 4IFYB 3MXHP 5F8NA 2DEIA 2IVYA 2BJ7A 2GQ2A 4DPXA 1AUDA 2V4JB 3D3BJ 1YK9A 1X4CA 2VPZB 3DDNA 3H42A 4LR8A 4JI4J 3THPA 4LIRA 5HVGA 5KFXA 2Q3PA 2W9BB 3V4IA 2CVEA 2HKEA 4IR1A 3OUYB 2OD6A 3I87A 3I9ZA 4QYZJ 2ROEA 1VHIA 2VPXB 1SH3A 3DOLA 2XGQA 5ETMA 3WX8A 1GT8A 3BO2A 1HNXF 3UD5A 4N56A 1PIEA 2XEXA 1TL1A 1JLBA 2VH7A 1LOUA 1U6FA 2HZVA 3RBXA 4DEZA 5KFLA 3KHHA 2RE1A 2ZFHA 1FXLA 3CJRA 5B0AA 3C6TB 4W4MA 4OYAA 3EDQB 1Q8IA 1S1XB 1U1MA 1Q5VA 2DRBA 2V6AA 4B9SA 3UCGA 1U2RA 3JXOA 4JI2F 2CAJA 1ZAWA 4YMEA 2RRAA 2H3EB 4ED1A 1Y5IB 5EX0A 1AW0A 5AE3A 3RBEA 4P75A 5CQGA 4WFNQ 2R7UA 1FEHA 5L46A 5GAHU 2FIUA 2QT7A 2VBYA 3BQ1A 3ZC4A 2VDIA 3DLLQ 4QIGA 3TZXA 3NL0A 5KFEA 2RIJA 2FZCB 3LGMA 5C5JA 4X62J 4C3KA 3KTQA 1RT7B 2J0XA 2V67A 3AY0A 4JI2J 1T9VA 2HGMA 4NI2A 4QYRA 4TU7A 2HHTA 3BGLA 3CCQS 4RW9A 5ETVA 4CM0A 1JMTA 2DNQA 2B7BB 3E51A 3IXQA 4HEA9 5HVFA 5DDRC 1R8HA 1RAAB 2IC3A 2GHPA 3BYPA 3CJ8A 3PNIA 2JLEA 2QYGA 4OV1A 1FFGB 5KFPA 1WEXA 5AXLA 1CJKA 2G0CA 2KHDA 2F5GA 4Y2IA 5IT9U 4CCHA 3UDLA 4YDDB 1XK8A 5DS7A 3ZZRA 5KG2A 3ILLA 1N5TA 2FJWA 3ZTQA 2IM2A 2XCPA 3DLEB 3G82B 4LR7A 5KAKA 3V4IB 1JWWA 3DXBA 5HN0A 3HPOA 2D3OR 3AHPA 4HKQA 3PJWA 3FDSA 3ZZYA 1VBZA 3M2RB 2I5JA 3MM7B 1G3OA 1U48A 3IG1B 1FJEB 1ZTWA 1Y7PA 2GS8A 2XWXA 3W3SA 4DBQA 2PC6A 1VJWA 3B54A 3ZFVA 5D4LA 5C7PA 1RTDA 1XNRF 3D1OA 3HXMA 5IOLA 3OR2A 5U47A 4F4WA 5J2MA 1NK9A 1FNMA 4RUAA 4X4RA 1APSA 1WDTA 3SQGA 2V8GA 4H4MA 1UCNA 5IQQA 4Y28C 2OTLS 2E5LJ 1FK9A 2HWTA 3MEEB 1N54B 1IR2A 3I96A 3W2VB 2RJZA 2ZBPA 1HWKA 3EPGA 1SB6A 4CLYA 4IG0B 1I3OB 1X4EA 1WOOA 1RZMA 3K2YA 4JI0F 4O3NA 4WK3A 2K2PA 2WHOA 2KU7A 2COLA 3FK4A 3FZBA 2MQNA 3BO3A 3X3UA 3PO5A 2LA6A 2HYIB 4O44B 1CQMA 4M5GA 4DR2F 3RB6A 1AZSA 5B0GA 3TAMA 4UUXA 3TX8A 1N5QA 3WC2A 2NUHA 2NLWA 1HBMB 1PJ6A 2RB7A 4G6VB 3HVRA 1T05B 1H74A 2MKSA 3SXLA 3NP5A 3M8RA 2DGVA 4PAAA 4D3HA 1P27B 4Q43A 2E7VA 3OSNA 2JJ4D 3RRGA 1TFYA 2J5AA 2MLXA 2YKMA 3JSMA 2XO6A 4FBUA 2A2CA 1KWMA 1IWGA 1UEUA 5L8RC 1IJEB 3SDEB 2J6TA 1EETA 1VRQC 1H2UX 2E1PA 4DR4J 4ECRA 2IYIA 2Y3YA 2VG5B 2DXFA 1RAJA 2HFSA 1P1LA 3NEKA 2DNKA 1UJ4A 3AA9A 3NY0A 1EP4A 1U1KA 5F8JA 3NNHA 4UOCA 4WTYA 2OPQA 1RWVB 2BYCA 3OQ2A 1H72C 1JQGA 5J1PA 1HHSA 1HWIA 3D0IE 3OV7A 2XC9A 2HLUA 4P10A 1TL1B 2AW0A 5HROB 3G71S 1XMQF 1E6VA 2F3JA 4M5HA 4H4OA 5H9EJ 1KR4A 5AJ3F 4ECTA 5HJXA 2ATCB 4P7VA 4USJC 5MAOA 3OHAA 2D9OA 2HIYA 4I6YA 3Q83A 3NG8A 4K59A 2VQEJ 2LU1A 3H0PA 4F7VA 3CCWA 5DLGA 3HFKA 2KG1A 3CPWR 2R2TA 1NJIT 1ICEB 2BJ1A 4M63A 5BR8F 1VQ6S 3ZO7A 1C0UA 2BACA 2CQ1A 2H5JB 1W26A 3BKUA 1FXRA 1NZ8A 3KUGA 2FJEB 5G4DA 1V9OA 4ZA1A 4DN0A 2UXDF 1KTQA 3EZUA 4DL3A 4KFBA 3DRXA 3FKBA 3FRZA 3PX6A 1WEYA 3C46A 3TJAA 3P45B 1FRLA 4U9RA 4ZVOB 3RRHA 4F02A 2VPWB 2DITA 2EEYA 3F41A 1PYTA 3A8JA 5CCLA 2UUCF 3LO3A 4X4NA 1DARA 4M95A 4Q0BA 4M1KA 2CNNB 2RRNA 4CQ1A 1WG4A 1JLFB 2E44A 2FHKA 1UA1A 3CCZA 3DU5A 1W2BR 3HK2A 2HHVA 3UQSA 2NXEA 1JXVA 1VJQA 4OX7A 2IIHA 3KMQA 3Q8YA 3U27A 2HFNA 3RG6A 3VGUA 2XY6A 3ETOA 4OYZA 1I5OB 1TUWA 2HK2A 2J9CA 3PRBA 1KQFB 3K5NA 3T5JA 2VONA 5KFSA 4DQIA 2OO4A 2OEKA 3CO9A 3ZZUA 5KOXA 5GAGI 2EKNA 4LRDA 5K8PA 1XR6A 3B8HA 2FJBB 2JL9A 3PV8A 3D3CJ 1J5EJ 2BE2A 1C0UB 3PCOB 4FBTA 4NYOA 2RQMA 5ITHA 4DSKA 1HMVA 4DCPB 1KFDA 2FC9A 4ZP8A 1NZAA 3R6LB 4KRWA 4CZCA 1OY9A 2DO0A 3GIMA 2MXYA 2AHOB 2CQDA 4LSLB 1T95A 3K8VA 2DGWA 4DV3F 2BEFA 2UUWA 2MDAA 3H2LA 5J2PA 2ZKUA 4M8LA 4BCAA 4G1PA 3PR5B 4A8XA 4IFVB 4USKA 1M5SA 2XI3A 2X1GA 3RYLA 2NS1B 5I3UA 1HQEB 2EFOA 1NCLA 1RACB 3UI3A 2FQQB 1FRIA 2Q6BA 1XWLA 4DOZA 3OTOF 3W66A 4J9QA 4OX9J 1DHMA 5GMDA 4K4SA 4CH1A 4CLLA 3NCRA 2ZH6A 3DYAB 2ZH2A 3NS6A 3O2IA 5KT5A 3BSOA 3GJSB 5HQMA 3A12A 4B3MF 1HNWJ 1ZPVA 2ASYA 2YWWA 2AF6A 4DX8H 3BM7A 2N3OA 1WSVA 4P73A 4CH0S 2H9ZA 2JWNA 4FNHA 5FLXU 3EJMA 3KG4A 5KG1A 1ZM3A 3CB4A 3QFWA 4F0HA 3SV4A 1YJ7A 3MMCB 4X65J 1DTQB 4HT5A 3BGOP 5KOWA 2YPYA 4LF7J 4R0JA 1IKXB 3P4UB 4Z37A 3KK2A 5D15A 4MKYA 3DHXA 4URGA 4JB8B 2MSSA 3PIPQ 2LXFA 1U1LA 2QA4G 4PG4A 3JSMB 2GHWA 5HMXA 1NSAA 4OJ1A 5I3UB 2Z2LA 4Q8EA 3AD9C 1J27A 2BX6A 3KJNB 3CMQA 3HT0A 3BBCA 1QAYA 3ENQA 4DV2J 2B3TB 3TZWA 4LVOP 2Z56B 1FTRA 1JKHB 3NMRA 2ZBQA 4LRFA 1FCAA 4ZITA 3PKYA 3CJSA 2E66A 5BYRA 2UUBJ 5J2NB 1LFPA 2QMWA 3T1YJ 1L3SA 1FVQA 2X1AA 3PW4A 4EO6A 1HNIA 4DU7A 3W63A 2DK2A 4IDKB 2C3UA 2YWKA 4KC5A 5T7LB 4DFPA 3JQMA 3CTRA 4ECSA 1QVGR 1EQMA 4USHA 1Q4RA 1WD6A 3DMJB 1VBXA 4N47A 2FVQA 1YBAA 3GIKA 4ECZA 5EWGA 3I0SB 1S1TB 3LALA 1KVJA 2L48A 4FN5A 1WG5A 2R3VA 3D6FB 2FLNA 1V6HA 1Q86T 2IBOA 3KDOA 1IR0A 4L3NA 2GQQA 2VBXA 1PAEX 2WRMA 3ZTSA 4O3RA 4QPXA 3CXCR 3GE9A 2EPIA 4ECYA 1N33J 3HHKA 4HDHA 1L3VA 1YHQS 1ZAXA 4O4RA 3FCHA 5ETLA 2J6SA 2Y1JA 1YWXA 2DYAA 2PFDA 3FSIA 4UOFA 1JLAA 2FC8A 4X4QA 3IAS9 4ETXA 1F60B 4F4XA 3D68A 1F2GA 1NSKL 2GAGC 1XR5A 3B6BA 4I6WA 3AJ2A 1GX6A 2DY1A 2ZVIA 3MCNA 1FD8A 5M2PA 3LUYA 3TX0A 3OJSA 2KRRA 3BGFA 2DRAA 2ZOFA 4ZPCA 3Q8VA 4G1QB 3TA0A 1IBMJ 2C42A 2UXBF 2ZBCA 1N0VC 2FGOA 2LDYA 3K5PA 1DZ5A 2BJDA 2ABYA 2NYHA 3Q2SC 4DF4A 4NZ0A 1CJKB 5IXUA 3TUIC 4X4SA 2FGCA 4C98A 5IT0A 4CM2A 4I69A 3M9OB 4DG1A 2HQFA 2AEMA 4CT9A 1JJCB 3L95X 2CQGA 5IQ6A 2RILA 2CJ9A 1SC3B 2L3MA 1R43A 3OFHA 3GFYA 1HLWA 3DRSB 4DFJA 4JI5J 2GX8A 4IKAA 3V6JA 4GO7X 1FF2A 2HZCA 1F9FA 5DDOC 1DAXA 3TUJC 1JJHA 1XNQF 3BSCA 3I55S 4E2FB 1PILA 3J7AN 1RTIB 1UVKA 1CC8A 2DJWA 3WX4A 4A8KA 1IBMF 3MM8B 5CABA 2HHXA 1FEEA 4NA3A 1M1GA 3TYTA 3DLJA 2PA8D 1FRHA 4HACA 2QL9B 4I2QB 3FFIA 3T6BA 2A2DA 2HHQA 1VLOA 3KKFA 4L76A 2AZ1A 1AUSL 5I3QA 4ATNA 1RABB 2CNLB 1Q7LB 1HI0P 2WW4A 2Y0SD 4KV8B 4DQQA 1WC0A 3VHQA 4CI0B 3PR4A 2KFZA 1SKWA 1M5HA 3DYAA 3NOCA 4IR9A 5IM0A 5D8HB 1RA6A 2XBPA 3J81U 3PVXA 1R6YA 2Q1LA 2CQPA 2RRBA 2K3KA 2PA3A 2WZ1A 1WWHA 3JTPA 4CYUA 1Y3KA 4F3MA 2CJAA 3S8SA 5KT3A 2BJEA 2V5HG 4ANDA 1WTFA 1RT6A 2WSFC 3MGJA 5E7OB 3UN3A 1NDPA 2KHCA 3AB4B 3CT9A 2AJ0A 1HYSB 3MFHA 3MOZA 4RW6B 4IOAQ 2FHOB 2AYEA 3GILA 3LAKA 4F3OA 1N36F 3N4WA 4OMFG 4DFKA 3LTOA 2MKJA 4M5DB 4RJVA 3RUBL 3CE8A 4HTJA 3Q89A 1FFWB 2HSEB 2QA1A 4GVBA 4TYBA 2KTQA 1T02A 4RNOA 5E41A 2HPUA 2GIQA 4RNHA 2CA9A 2QC3A 4OI0A 4CIOA 1IM6A 4NA2A 1CVJA 1FE0A 2B4VA 4CO2A 5J2PB 4Y0FA 3NAHA 2R8IA 2IA6A 4IQXA 1D1UA 1Q8KA 3R6GB 3M9NB 3G8TA 1MU2A 2XYHB 5IM0B 5AXMA 4JV2A 3TO8A 2R7VA 4FNIA 1C1CA 5C2GA 1LWFB 1TV6A 2MLYA 4TU9A 4DLGA 2HFOA 3QT8A 4UOHA 2IPOB 2W4PA 1KQSR 5CZVA 3HO1A 1MNEA 4O3QA 3C66A 3JYTA 3D2WA 4PXEA 3ZTPA 4X2BA 3DMJA 4DQRA 4ZPAA 3GQCA 1E6VB 3FFIB 2VF3A 2XG8A 3OD2A 5BYSA 3CF5Q 3Q2TC 4USVA 1VC6A 4ZKAA 2VJUA 2BM1A 3PIOQ 2V34A 1S79A 2GCFA 4CH7A 1CJTA 2W9CA 4XPCA 2BUNA 1HBNB 2B8QA 4QW8A 3E8OA 4EBEA 1AB8A 4C0OC 2YH0A 2P6TA 5HK4A 2IA0A 2PMHA 1HNWF 2V94A 2W4CA 1I94J 1UPMB 1HD0A 2HBYB 4NLRA 2JC0A 1WF0A 2AKWB 3S1TA 5B0EA 4J9KA 4DR1J 2FLPA 3ZZPA 1U1OA 1UVLA 1Z1ZA 3GP9A 3HVAA 4TVAB 2M4MA 3GJQB 3QT5A 1CJUB 1QE1A 3SEOA 2CZ4A 2FTRA 4DV5J 2O66A 3QNWB 2QLJB 2K7JA 4F4AA 4JI1F 4FPRA 1P6TA 2LQ5A 4B3TF 2XLKA 2WCXA 3O6QA 4JYAF 4S0MA 4MK9A 4DL6A 4OJHA 2QV6A 4QR2A 4HYKA 2BOAA 3BGUA 1TKZA 2MQMA 4WE1A 2GVDA 2GIFA 4M5MA 4FVCA 3VVTA 3KLVA 5C2CA 3H59A 4NRTA 3KHGA 5AE1A 2ZJQQ 4Y2AA 1HNVA 2C1EB 3CCVS 2KVIA 2IYGA 3AT1B 3QGGA 4PYDA 5LOQA 3H20A 2W8KA 4DL4A 3PEHA 2VDHA 3LF0A 1FKAF 1SCJB 1JX4A 2DT9A 2EG1A 4NPOA 3W5ZA 2Z8QA 1U02A 4N41A 1S12A 2PI4A 4XPEA 3LQVA 1HMVB 1QVFR 2MJNA 4I6AA 2MPUA 4F4YA 3UD3P 1RAHB 2R42A 3DLGB 4IRCA 2M52A 5CHCB 5BJRA 3MPVA 2V2KA 3MUVP 3IG1A 1CJTB 1UJ5A 2W9CB 3OTOJ 2FVSA 2RF2A 1G1XA 4QWBA 4MIWA 2W7OA 2OPPB 2XYGB 3SCLE 2R8HA 4OQJA 2NPFA 1KP6A 3CDEA 3FEYB 4HI2A 2KG0A 2ATLA 2MY8A 5HMZA 2ZOGA 4DQSA 5HP1B 4B9TA 3PW7A 4V19J 1B7FA 1JB0C 4BDPA 1VRUA 4K4XA 3HJFA 5DDPC 2LEAA 1DQ9A 2RF2B 2HZAA 1FA0A 3N6NA 3L3CA 2ZH7A 3KLHA 3L9ZA 5A2QU 3R7NB 5KFKA 2VD3A 2OIHA 1ZZNA 2KYXA 5KG5A 2J9EA 1EIYB 4MK8A 3M8WA 2F7VA 1L3TA 4O4GB 4WF9Q 3MR5A 4C9DA 1RHKB 1RT1B 1IN0A 1RI7A 3Q23A 3R1LA 2A3JA 2N4CA 1EX8A 2XSJB 2AJ4A 3FSXA 3OXFA 4F26A 4X65F 1N33F 3BH7B 4WIIA 3GU0A 2LXIA 1U47A 1PCAA 3KUEA 4RUHA 1UPPA 3EVWA 1V3RA 4FXWA 4I56A 1V5IB 2BXJA 1BWEA 2Y1LB 3QO9B 5KFNA 2NPIA 1EKSA 1SUQA 5KFQA 3K5MA 3CJ2A 4CLPA 4ED3A 2HURA 2VUGA 2HQCA 1YVFA 4QIWD 4RW7B 2M8DB 1XNRJ 3RW6A 4ZVHA 4P6QA 5FD1A 2AGOA 3BKFA 3VAJA 3M2RA 3MM7A 1F9EB 2CNOB 4PXCA 4XDDA 1FWKA 2I6WA 1D9DA 1T9TA 2OMOA 2CZ9A 2B8PA 2BANB 3IBWA 3VAMA 2UUBF 3IC1A 3KNAA 1H73A 2CFXA 1TR0A 3M1VA 3N28A 4NLSA 4CO3A 3BSAA 1S1WB 3OL6A 4LF6J 3W8GA 4ED8A 2PMZD 4B9VA 5A8KA 2BV3A 4WFXA 1C2PA 4Y3CA 2W2OP 2JSXA 4WFYA 2XS7A 1RWMB 5ETKA 2HRYA 2OAUA 4PXDA 4R25A 5KFHA 2OSQA 1KDNA 5IC6B 4QIEA 2M3DA 4HHHA 1I6JA 4C8OA 3ILJA 2YKMB 4OHWA 2PI5A 1UVIA 1XMOF 4K4UA 1HI1A 1RB0A 2EG2A 3GCWP 5LSRA 2R8KA 1T9YA 3AODA 2ZUGA 1CEZA 3CJQA 3BPDA 2CPIA 1ZA1B 4DX5A 1WNEA 1S1VA 1UFKA 2M2BA 3I0RB 2UU9F 4PEOA 2RDJA 3DLHA 5A0YA 1H7WA 2WONA 3OL9A 3T5HA 4Y2CA 3W65A 1TVRB 1TK0A 3P96A 1Q8LA 3M30A 3R27A 3O3LA 4O4GA 4ERDA 5KT4A 1BUXA 1KVKA 4KAIA 2J7UA 4DV7J 1PC4A 5DM7Q 1RSCA 4AE5A 1Q78A 5D6GA 2RKIB 1NXIA 2BZ2A 1LK5A 3V5RA 3CCES 1JJ2R 1YBUA 2DEJA 1WC3A 4OZ1A 1BQMA 3RJMB 2V4RA 4PR6A 5A8KB 4LFBF 4PYAA 4O3PA 5GAGU 4UY85 1B4SA 3IRXA 4BBYA 1VR6A 4YFUA 3KWMA 2WVCA 1YZ6A 2ZWOA 3L09A 3O5TB 2F40A 3QO9A 1U0HA 1KOHA 1X60A 4PQAA 4K4TA 2AV5A 1SJFA 4NL5A 2MGZB 4J9NA 1NSPA 4OJGA 2EK1A 4DU8A 3DLBA 2A0FB 2G2ZA 3KHLA 4DV1F 4TYAA 1SIZA 4WFZA 1U09A 1LEOA 3BGRB 1NUEA 1YDLA 5GADU 1SJRA 4F4ZA 4B9MA 3FCWA 2HVZA 2Q6CA 2FVCA 1M5PC 1YQHA 2DNGA 2E5HA 4NEZA 5L1IA 2XHWA 4CLKA 2WW8A 3BGRA 4ALZA 5FDLA 4FYWB 3KFWX 4ZLNA 2XM3A 4JI4F 2C3YA 3VAFA 5DGBA 2CJXB 2YKOA 4L73A 2LU2A 3OTDA 4UZBA 3OFEA 2MY7A 3NGUA 3BYRA 3QFHA 2MB0B 3RBDA 1G4CA 3HSDA 1KSPA 4KY3A 5HMWA 4ZP9A 4X4TA 2C2MB 1RWUA 2CPJA 2V9KA 8ATCB 1M0SA 2IC3B 1LWEA 1ZH5A 2KT5A 2YNHB 3R5JB 4I2PA 1X9SA 4UOGA 3BN4A 2L41A 3V4MA 1Z2LA 2AJFE 2R7WA 4W92B 3POTB 4LF9F 4FYVB 3J80U 4DV6J 4LSNB 4HI1A 3CJ5A 5KG4A 3I5AA 3KLEB 2EWHA 1U1PA 3MOJB 3BN7A 2YQ3A 5IV3A 4ER8A 1EQ0A 4ZN1A 2BJ9A 1QLNA 2G0JA 3IS9B 4A8FA 4NXNJ 3W2WB 2D3ZA 3Q8SB 3QJLA 1TL7A 3H40A 1WC6A 2B4PA 2NXJA 3QWUA 4OLPA 4DV7F 2FJVA 1HHTP 4HHUA 3IGNA 1NO8A 3JB9k 2EC0A 2EBGA 2HAFA 2BQ3A 4NLXA 5GAHI 4DV5F 2AU0A 1HW8A 4OYWA 3F0NA 3FUYA 4CO4A 2KZZA 2J0WA 3LP1B 3P6YC 3MTKA 1RWKB 4H4KC 1JLBB 4JV0A 4UQGA 4UTGA 3CO0P 2XS5A 4O0NA 2RAQA 3DGPA 4U67Q 2ZHOA 3ZTOA 7AT1B 3GG1A 1NK8A 4JI3J 2HS0A 1CJUA 3IM9A 1MLAA 1I94F 2CJBA 2OMLA 4USMA 2VFTA 4IQMA 4OI2A 4KE5A 4ZVSB 2IDLA 3N5FA 2HVDA 3HM9A 1X4AA 1R89A 2DR8A 2XHCA 1G6BA 5E2QA 2POKA 2D3UA 2F1FA 4DFMA 1NB2A 6AT1B 2WSCC 1GFWB 1UEKA 3MCSA 2IRUA 4EUVA 3T1HF 1OQ3A 1FKOB 1IKWA 2V2ZA 1ZS6A 2RQKA 4ZPVR 2FJXA 1LWCB 3MCMA 5F3ZA 2H5EA 3TW0A 4P2FA 2AGQA 5KFZA 2ZH1A 5SZTA 3HKZD 1FX2A 4DCOB 2AP6A 1U6ZA 2C2OB 4DDFA 2LXUA 2K8GA 2YNGA 4WXOA 4Y2KA 3CSKA 4AYBD 4F4KA 4G3IA 1FKPA 3O8WA 1XQIA 3DM2A 2F9DA 3GR0A 2W1BA 1HWLA 2GJ2A 2MZJA 1K44A 3C6UB 3HMJG 1S0OA 4IDKA 2DXDA 4X64J 3D67A 3FNNA 3M2UA 3GB0A 4TN2A 2R7SA 1S9EA 4XO0A 1X4HA 4M5IA 5DDQC 1LNQA 3KLGA 4IRDA 3M8QB 3MMAA 1IKVA 4QR1A 2QLXA 3DDKA 2HNDB 2H4WB 4A8WA 1RT7A 4CWBA 1SI9A 1KKHA 1S1UA 3T9NA 1YZ7A 2KB2A 4M5JA 4QIFA 3TNVA 1VISA 3V6HA 1RCOB 2KO1A 3I31A 2O67A 3HZGA 2O3DA 1XR7A 1S4FA 5KFGA 2ASDA 1NK4A 1FKOA 4NZ6A 2AYBA 1BC6A 3D9BA 3MEDA 1H6KX 1FJCA 3PHTA 1SL0A 2UUCJ 2K06A 3NCPA 2QZ8A 3B4DA 2IM3A 4RX6A 3H2VE 1QY7A 5J2NA 3W7BA 4C0BA 2NZ4A 4Q7AA 1NU4A 1RWNB 1N4LA 1DLOB 1RAOA 3MI7X 3NGRA 1JIHA 3ONQA 1JLCB 4QWDA 5DGAA 2PMWA 5CYMA 2DHSA 3SQOP 2BVZA 4ZVUB 5KG0A 2BQUA 4DX7A 2VIHA 4ZVEA 5HROA 3K58A 3IN5A 1TU0B 3VAKA 3MHYA 1DY3A 2RVJA 4U8VA 1M5OC 2FYXA 3CD5A 5L1JA 4CLSA 1TKTB 2YNFB 1OJ4A 1VK8A 3W64A 1IBKF 1OY8A 2MQPA 2CYYA 2HK3A 2VV5A 1DJ0A 3E3XA 3JQKA 2Z58B 4IH5A 5K8MA 2ZJRQ 1MMLA 1JLGB 2BW7A 4QWAA 3H5YA 4YOEA 3KUHA 1XMQJ 2XMKA 5AT1B 2DGUA 2D69A 4FDFA 4LBHA 3HHLA 3CULA 1CJVA 2WBRA 2LEBA 3PTWA 3ULHA 4ETZA 2VFRA 3U02A 2AYGA 4ZVFA 2JRSA 4C7QA 1H0HB 5HANA 3DCAA 4A8OA 1DTTB 4F04B 4DSJA 2ERRA 3FEZA 3HHNB 2YNIA 1NKEA 4PQUB 2EI5A 2X1BA 3KJFB 2CXEA 4P74A 4YHHJ 3OXGA 3BEGB 3VALA 1S0MA 2R7OA 1FWLA 4IO1A 4WZQA 3HVTB 3J7YI 1TP7A 3DDIA 3PEJA 3NNCA 1OMSA 2DH9A 2OPSA 3QZ8A 1CULA 1E6YA 1VQKS 3TAMB 5IV4A 2ZHAA 4RBUA 3C6TA 1BLUA 1HNZJ 4K4ZA 2DR9A 3A3PB 2GZOA 1KHVA 1ZZFA 2LQJA 4HH0A 4WPAA 3MEEA 4DUZJ 5H9FK 2KT3A 2FHMA 2RUGA 5DG9A 4YUDA 1UL3A 1OPIA 4ZOSA 2RDIA 3TZYA 1WHVA 4GVLA 1BWVA 2DHGA 1TZ0A 2PE8A 2RH3A 3HDSA 3K5OA 2F8MA 1RT5A 3MECA 3NS7B 4KPCA 2MQOA 3T9ZA 2V2QA 3KYLA 2J0SD 1F3VA 2HRUA 3J7ZT 2M70A 2OELA 2VG6B 4ED4A 3I6PA 1KD1T 2I5JB 4MYUA 5E3PA 4X4VA 3T41A 3G8SA 3MECB 4J7CA 2AZ3A 3HVWA 1QJHA 3QIPA 2DNYA 5HQ8A 3PY8A 4EO8A 4K4WA 3EM1A 2A6OA 4B02A 4OYMA 4U7UK 2GGPA 5AXKA 3UCUP 3QRQA 4NLPA 5C42A 1AA1B 5DLFA 4PCQA 2YKAA 2QEXS 3J7A1 4QCLA 1C1CB 3P8BB 3M2VB 4OI6A 2P8IA 2NXCA 4CTAB 2IMWP 2OUGA 1RT6B 2EFPA 4RWWA 2HVEA 4B9UA 1W7WA 3M32B 4BC9A 3AD8C 1FRKA 1JXEA 3H8YA 3M8YA 4HTIA 3RGIA 4B3RJ 2ZE2B 5B08A 3M8SA 3W5YA 3AFGA 1YX2A 4O0IA 2KXHA 2GAHC 2VL1A 2VB6A 4ZJOA 2FD2A 4XK8C 4LFCF 5ETOA 3H5XA 1Y10A 1VLYA 5DM6Q 4NLVA 2HS3A 1KLMB 2D3O1 1PKUA 2YNGB 4ZHRB 2C2EA 2UVUA 3IAM9 5ETTA 3OJUA 4PZVA 3SMZA 1IUJA 4I2PB 4WJBA 5EUHA 5CA5A 2DNHA 1SL2A 2VC1A 3N01A 4L75A 4QBUA 3M8PA 4TY8A 4A8YA 3L7PA 1S6QA 3GFHA 3C16B 3OXLA 1QTNB 4U7CA 4LSNA 1REVA 3J81Y 3CEDA 1RGVA 1PAUB 2QO3A 2ADBA 2DHXA 1UZDA 1S10A 1NM2A 4FPIA 5J1EA 1XEZA 5G0RB 4OHYA 1IVZA 3I4PA 5D0RA 2O1PA 1B7YB 4FP9A 2ROPA 1KBRA 1UWBB 1RHMB 3ADAC 1TKTA 2FY8A 4EI2A 3OFFA 3JAMU 2MZTA 3SV3A 3LOUA 4Q44A 2AIRB 4JI3F 2KI2A 4DZDA 1HARA 3PHEA 5I3PA 1S9EB 1DLOA 2ZDPA 3OSPA 1VBYA 4KH0B 5L39A 4WYWA 4ZK7M 5C42B 4IFVA 1PGZA 2OEMA 1G2EA 5KFFA 3CJ3A 7FD1A 4CTAA 1U26A 2QGFB 2CPEA 2PD1A 1RTDB 4ZN3A 3HT3A 4NA1A 2QA2A 3FQLA 1P8GA 3LPYA 4KBIA 3SCJE 2XI2A 5KFBA 2QMUB 1SV5B 3LANA 4K2XA 3W61A 5EWEA 2IAJA 5FJ4A 1RTHB 1Z4UA 2BE2B 2HNZA 2XTJP 3FZ2A 5KG6A 3P5BP 4DV4J 1UVNA 1TAQA 1S77D 4Q8FA 3OTBA 3VF0B 4B3RF 2ZNZA 1VQPS 1XJWB 3DLEA 3G82A 4LF4F 2DBBA 2V8PA 3DRRB 4ITSA 3AH6A 4URSA 4N7TA 1RADB 1URRA 2JDJA 3D7SB 4ZIVA 2VQFF 4JI7J 1RT4B 2YWGA 4ES3A 4ECWA 4JV5J 2VA2A 3MR3A 1OQ6A 3OVBA 1KVIA 1JLQA 5KFTA 2RQCA 4J90A 1MSWD 4EZ9A 5T7LA 3NGKA 2B9XA 2XS2A 3R5CA 1N36J 4FVMA 2OHDA 2QN6B 2KRBA 5GMKa 2GA7A 2GO8A 2E7XA 1CBKA 2AX1A 2DNPA 5DO2A 1TMJA 3TANA 3M6VA 4I7FB 1HPZA 3AA8A 3UPFA 2KH9A 2XULA 2QYCA 5KFVA 2FDNA 4DPOA 3E2EA 4HHJA 3I0RA 3HVTA 4A8QA 1BY9A 3LGNA 5H9EK 1NHKL 1LQ9A 1N34F 4KGXB 1OY6A 2C2NA 2FJDB 2FHJA 3P3DA 2Z30B 3TJ9A 2HNZB 2C3OA 4NLGA 4LBIA 4ILRA 3DKDA 3AOCA 2IAJB 2I1RA 3IO1A 3QT6A 1Y11A 1SJ4P 3RB0A 1GQEA 3A4TA 3B78A 3WBZA 1BD6A 3PYDA 5KFDA 4KTQA 5EWFA 1NMEB 3HKWA 4JUZA 3QWPA 3MM5A 4EMDA 3V6KA 1ROFA 2CADA 3OHBA 4K8RA 4C0HA 4A47A 4KV8A 2KL8A 3EUNA 2YX1A 2KJVA 3GV7B 3TEHB 5GVQA 3Q8QB 4NXNF 2HMIA 1HD1A 2YXLA 3NGTA 3TA2A 2X1FA 1SH2A 2VODA 1R31A 2DR7A 4X66J 3G96A 1PYOB 3T5LA 1UA0A 3KK1B 1IKYA 4V19X 3IR5B 1C1BA 3MM8A 1SQEA 5A6WA 1RKJA 1K9MT 4YHHF 5CD4A 2DGXA 5J2QA 2BJ8A 3QGIA 2RS2A 3ET6B 4R0EA 3MEGB 1EETB 2NXNA 1T3NA 4O3OA 3HD1A 2XO7A 4RUCA 1U1NA 3CJTA 4KSEB 5B0CA 1GXUA 1D9AA 1B64A 4J37A 1R8BA 4GKKF 5D0EA 3PYGA 4A8MP 2HRTA 1TUVA 5E5NA 2KXFA 4C11B 3KOAA 1H38A 3BKTA 2E7WA 3MM5B 5DZ6A 1LXJA 4AD6A 4WCEQ 4DR2J 4HR2A 5THWA 4K4VA 2QJ3A 5C25B 2MZSA 4LVNP 4K50A 2CPYA 4JI8F 4ICLB 2V63A 1IBKJ 3CCJS 2H65B 1TL3A 4DG1B 1FE4A 1U25A 1AT1B 5KFUA 2IRYA 5JMNA 3QSYB 4NRUA 2V0NA 2R7QA 1REGX 1XIQA 4DR7J 2DNLA 1N5SA 1BE4A 2DR6A 1SJQA 2XMTA 3M6WA 4ID5B 5RUBA 3M7VA 1RYSA 1GXTA 1DFDA 1Z2ZA 2ILZA 3TOQA 2H1YA 1N48A 4DWIA 1C0TB 4NLDA 2XMMA 1TKXB 4OYBA 5CCMA 2J76E 4ZVPB 4LF1A 3K8WA 1R7IA 3DOKB 4NLWA 4ZVRB 3Q0AA 2MZQA 2VG6A 5SUHA 3I4HX 5D0GA 4J9LA 1YRUA 5DQHA 2BKOA 4GC6A 4CLFA 3VAHA 3SQGB 2XMVA 1BGXT 1MU2B 3M4XA 3BJYA 3F73A 5LJ5Y 2VZ9A 1F5AA 1URNA 3C19A 3ZNUA 1S6PA 1WOSA 2VFSA 5C25A 5D77A 4ZVGA 1S99A 2RSQA 2B43A 4J9PA 3MAHA 4GC7A 2VASA 1FT8A 5GAEI 2EXUA 2DPJA 4FF2A 4OIXA 3NOGA 4GVBB 1XC9A 2Y9HA 4OL8A 1T11A 3MFIA 3BQ2A 4KFBB 1NAQA 2F65A 1ZPWX 2ZEJA 3NBPA 1OO0B 2CPXA 3R9LA 4X64F 1FD2A 2Z4PA 4KHRA 3EGWB 3FEXB 1X4DA 4H4KA 4USIA 2PN6A 1BQNA 1GMVA 2CQ3A 1RT2B 6FD1A 2HHHF 4ZCKA 5JVGQ 2HW3A 3T6JA 2EFQA 3DOKA 3TARA 1TL7B 3IP0A 3EVMA 8AT1B 1WTBA 3QBCA 4LF8J 2FZKB 1S49A 2ZD1A 1N5YB 2E1MC 2Q79A 1JXLA 2I0XA 2ROGA 1L3KA 1LWCA 3D6MB 4CP5A 5F8GA 3R5AA 3GYGA 3KK2B 3G6XA 3V81A 2MHNA 1RXOB 4TY8B 1LWXA 3CJ4A 1IBCB 2J9DA 3CCTA 4ECQA 2RU9A 1N88A 4X62F 2OFHX 1X7VA 1REVB 1YRTA 3KG1A 1LW2A 1O8BA 3W2WA 3G4SS 3M6XA 3EMTA 4KHPF 2BR0A 1CLFA 3JS9A 1KONA 1RHQB 3MMBB 2D1CA 2NSBA 1RAGB 2PFFB 1TQLA 5B0FA 4EK2A 5IT4A 1SC4B 4QPTA 3HFVA 3UDVA 4DR5J 3CUNA 3UO0A 2R9LA 2RUSA 4I7FA 3R1HA 1Q82T 4U96A 2RDDA 1S9FA 3PX4A 1HQEA 1S6PB 1U24A 4IOCQ 4NYPA 4ID8A 4B08A 3RR7A 4LUBA 3JTOA 1WORA 2QSWA 1T9UA 2B9EA 2NR0A 3QJPA 2GQCA 2DXEA 3IA0A 4CT8A 1GAOA 1VQ7S 2B4UA 2CVIA 2ZH5A 2M9KA 1WHXA 4A48A 2CPDA 3K0JA 1X4BA 1GMUA 4QZVB 5F0UA 2YBVA 4DN9A 2YY3A 4LF6F 2UZAA 1RYRA 2CQHA 5J1NA 2ZKTA 1A9NB 5LXRA 4HT7A 3DC2A 3VGSA 1DQAA 1W25A 1HQUB 3N5BA 4P7TA 3ZNJ1 4JI6F 2YPZA 4R5PB 1L5UA 1QUPA 4OYPA 4Y2MA 2BM0A 3KDNA 3A1YG 4I0WA 4DR3F 2WK4A 5FDLB 2VG7B 3GIRA 4NX9A 1XMBA 4L74A 3BDPA 4A8SA 3HSGA 3UN2A 2HFZA 4XAKA 3KLHB 2J6UA 1RBAA 3PDNA 4MAKA 3RBZA 4EBDA 2VFUA 4OZ5A 2W9AA 2EC2A 3CCRS 4OHZA 3BBFA 4CNZA 1TAUA 1VFJA 4LF4J 2VG7A 4H54A 1VGYA 1FKPB 3JYTB 3CIMA 3GFZA 2Q66A 1LXNA 3PYFA 2OPPA 3T1YF 3IR6B 1VQSA 2XSJA 4ELTA 3PRVA 1V5VA 4DSLA 5HP1A 2UXDJ 4USUA 3MURP 1FXDA 3SSSA 3D0HE 3PRDA 3HHLC 3OL8A 1QSLA 1SPBP 4JI8J 5BR8J 1NHVA 1VIXA 1TELA 3TR5A 5DETA 2VBWA 4U7UD 2LDIA 2JEIA 4RZRA 2VQEF 2D74B 1UFLA 2P9GA 2ZC4A 1MN9A 4OZ2A 2XY5A 1JLEB 2OGUA 2OPSB 4KGKA 4LREA 1F0XA 3WHIA 2E5IA 4I68A 2IVMA 3GYXB 1R27B 1HBMA 3I9V9 4LT6A 3ZXWA 2LP4A 4CO5A 1V3SA 2NXUA 4DZ6A 5A0YB 4C11A 2YH1A 2R8GA 3DOMA 4LRBA 3IMQJ 1MWZA 1Y4ZB 3I56S 5L9NA 2JLFA 2BOPA 1WKLA 1YKWA 2A18A 5D3GB 4IG3A 4PG5A 3VAGA 4A46A 3N0VA 2YX7A 3UR3C 3W5XA 1IQZA 2CZVC 2RQ4A 1EARA 2RKIA 3MD1A 3N9UC 3SIPB 3W9JA 2AGPA 1K0VA 3HJVA 2IVFB 4C3LA 2ZZNA 4DR4F 3CD7A 5A76A 5C24B 3MPWA 3NAIA 1GX5A 5KT7A 3ICLA 4G1QA 4RBVA 4PRFA 1FFSB 2QG9B 1S1VB 2ZD1B 3DRPA 5C24A 4DL2A 4RU9A 1NNDA 1KOOA 3GV8B 3G9CA 2N4DA 4W98A 2GVDB 2WSEC 4YY3F 3MWBA 3SCKE 4P2SA 4RW8A 3TVZA 1OSDA 1YJUA 4WKRA 1IQTA 2HBQB 3IGVA 5IS2A 2XY7A 1N32J 2OJ3A 2RS8A 1TK8A 3UVJA 2NQPA 4JYAJ 1WHYA 1YIJS 5CD4H 5LL6d 3DN9A 2OFGX 3PFOA 5HMYA 1QE1B 4HDGA 2HFUA 3LWLA 2V4JA 1RTIA 3LP2A 4OZNA 1VMBA 1MROA 2B5JB 4ID5A 1WACA 2DH8A 2IFXA 4WIQA 5FLXY 1B0TA 3ENWA 5GMEA 3KK3A 1WC4A 3QSIA 2E5LF 2W7PA 2CJYB 3QRPA 3AJ1A 2QE5A 4RW6A 4KO0A 5HQLA 1GTEA 2DO4A 4M5KA 1HYSA 3W9HA 4ED7A 2O01C 2NUUG 4PQUA 1W2IA 1BQNB 4BWMA 4Y34A 2B4OA 3BZQA 2K3IA 5F8MA 2MQ8A 4WP9A 2GIRA 1T9WA 5LXYA 5BYQA 1RJJA 2XYPB 2CUYA 4DR7F 4DR3J 1NDCA 1D8YA 1FRXA 2F8EX 3TRGA 2ZBRA 2ZWPA 4BHQA 4IFYA 1S48A 5ETNA 4DSIA 4N77A 1FK9B 4OLOA 2PSZA 3M2VA 3TP2A 2FHJD 1D9FA 3PW2A 2IRXA 1P1TA 1I1GA 4C6AA 2N7YA 2ZHBA 4PABA 1FDAA 5K8NA 1QAIA 4OI4A 5J1EB 4NLYA 3DGVA 3Q86A 4C48A 5E33A 3V6DB 4YEAA 1S59A 3NGDA 3LP2B 5IC4B 1NK5A 3KXDA 2H5IB 3MM9B 4LJMA 4Q2MA 2UVVA 4DR6F 1TL4A 1BHNA 2YKQA 1DTQA 1R8AA 3FVYA 1M1HA 4ZVTB 1B0VA 1DBDA 1S1XA 2E1AA 3KJQB 5KFRA 3UNYA 2ALZA 5KT2A 3JQJA 1SIWB 3KLIB 4JBCA 1YJNS 2HBRB 4RW8B 1KRPA 1JLGA 1Y3JA 5K9FA 4N5SA 3R2DJ 1VQ8S 4NASA 2R7RA 3JSYA 4KGMA 1MN7A 1K1SA 2DHAA 4TKTA 5HATA 1QAJA 3GYNA 1S6OA 5E0OA 4FF4A 2YKNA 1CG2A 3TWZA 1EZZB 4OZ0A 4AQYJ 1R0AA 4M94A 2QIFA 2LVWA 2VG5A 1CS4B 4DS5A 4NLOA 4C8YA 3H98A 3ZZZA 2V4QA 1RISA 4KQZA 2VJVA 1VK3A 2P9EA 1UW9A 3IWNC 3BQ0A 3HFZB 4ZLJA 1B70B 2HWIA 1X8DA 2EVZA 3GCXP 3MUMP 2BBEA 2DVIA 2HLTA 2HQDA 3DI6A 3K7RA 3BREA 1ELOA 2V50A 2DCUB 5KFMA 3MR2A 2A10A 3THVA 1F2HA 2W2PP 4MFBA 2G0IA 4E98A 2WAQD 2ACYA 3K17A 5HBMB 3KLFB 5DG8A 2AQ4A 5AXNA 1YJWS 2HHWA 5CYQB 1WC1A 4DV0J 1X0FA 3D6HB 3MPUB 1I51B 2GC8A 3KLIA 5K5MA 2KM8B 3G6YA 4JI0J 4QYZK 2UXCJ 1GTHA 4J9VA 2R2UA 4K5RA 1U6BA 3V2UC 3KJVB 3HCXA 1SQGA 1ZBTA 2YKPA 4PPZA 3UE2A 3VZIA 3BPSP 1RUSA 1YJVA 1YJTA 1HPZB 4ZPWR 1H2VZ 3UWTA 3HLUA 2IBKA 2XMUA 1KTVA 3ENVA 4LF9J 1JK9B 3QLHA 1CS4A 1F6TA 3C15A 4U8YA 1R0AB 4J5OA 4X4UA 1FTCA 2XCAA 2AYMA 1NLKL 1H2TZ 1KS2A 1N0UA 3JSBA 3DOLB 4NCAA 1KN6A 5DQGA 5J2MB 4Z2XA 4DSEA 4J9UE 1VC5A 4AXIA 4L6V3 4ZMMA 1B0PA 1RLDA 1SXLA 3OTCA 1Q0NA 3J7YU 1NJXA 2Y8YA 1N52B 4USWA 5LMUJ 4FXDA 4F3QA 3R5GA 3SZ2A 1JKHA 2QLBB 4OFZA 2OTJS 4ZIWA 3A3OB 2L9DA 1VRUB 4CNYA 2JEJA 2ZITA 1D3WA 1UP1A 4I67A 2V8HA 1S9GA 3BDEA 2HGNA 3EVOA 3VCDA 4D3GA 4J9OA 2KXNB 1MROB 1VDHA 2B5JA 2GW8A 4KB7A 4IYQA 1K8AT 3MEGA 1NPPA 4YY3J 1U4BA 1SQFA 1U2CA 1U1RA 2DRDA 3QLHB 2OLWA 4DV1J 2Y8WA 3TAPA 2PT0A 2OD4A 5HSPA 4UZCA 4LF7F 1UW4A 3IRXB 4Z7YA 4CRJA 3AD7C 3PW0A 4M5NA 2QFIA 1T3OA 4RW9B 3P49B 1TVRA 4LFBJ 2LCWA 1DRZA 3X1LB 2K1RA 2HQ3A 3TQ1A 4AQYF 4QWEA 4EFAC 7FDRA 1VQMS 2XWYA 3ITHB 1GMWD 3DRPB 3CCSS 1RTJA 3SI8A 4LMZA 3K5LA 2V9WA 2HVIA 3CD6S 2XLIA 2DH7A 2BKPA 2P2CB 2DNZA 2YNIB 2MTLA 4TLRA 4Y6IA 4UT4A 5LSOA 1U8SA 3ET6A 3RB3A 3D28A 3GFXA 2J8SA 4HACB 4F8RA 1E6YB 4ZPDA 2AEFA 2YVSA 3GV5B 3IBCB 4RL1A 3CCUS 3I32A 2M5YA 1XMOJ 3K89A 3CWJA 2VPYB 4ZVQB 2X7IA 2CDRB 2A6MA 4NCBA 1RWXB 2Y1IA 2HMIB 4WU2A 1N32F 1HWJA 1ZAVA 4DV0F 1S4EA 2W4DA 4PWUA 5JVHQ 2B9WA 4TNOA 1C1BB 2HEKA 2RHSB 1HKAA 5CAAA 4XIUA 2L08A 1NH8A 1RKIA 2G1HA 3BH6B 2HS4A 2MHEA 4WK1A 5LMUF 2UUAF 2I8EA 3G6ES 3QRRA 2V8VA 4P72A 3F56A 2FVPA 2FB0A 2F4VF 2MKCA 2MLZA 1WUUA 1TTHB 1RTHA 2DISA 3FBCA 4P2MA 1H3DA 5B0BA 4DR1F 1NDLA 1T9XA 3GPAA 3MAAB 2CKWA 3KMSA 2AEJA 5KFAA 1U2FA 3NRBA 5KFYA 4FF3A 4YB6A 4FZVA 4OJ3A 2DKOB 5D4PA 1AXQA 1UKUA 2Z2YB 4LRAA 3QGHA 3AQOA 2GGPB 4MH8A 4WXWA 1CPZA 1GH8A 1PSDA 3MEDB 2K1RB 1JLQB 4FKXA 4N8OA 1HBNA 3OL7A 2VQFJ 3H2UB 5E3QA 2W01A 2XLJA 1U49A 3T5KA 3PZPA 2LMIA 5HVHA 2C3PA 4OHXA 2XZTB 1P9QC 2JVOA 1LKZA 1HHQA 4YR2A 1S72S 4MKBA 2CQIA 1S0NA 3D66A 2FJAB 2JC1A 3HZEA 4DV4F 1FNXH 1HA1A 1R0CB 2YNHA
chains in the Genus database with same CATH topology
1V3ZA 4RKUC 1TKXA 3QPIA 2CPHA 1MMNA 3HHLD 1JLAB 2X51A 4FS1A 4Q45A 2B56A 3IFEA 4N8NA 4KO0B 1DURA 3M05A 5EDWA 4DQPA 1LW0B 1FERA 3EXYA 3MEKA 5I4MA 1O5JA 1D0EA 1SC6A 1IKWB 1Q8BA 3LP1A 2N7CA 3KJVA 5MLCV 4B9NA 1O0PA 3C8YA 4O23A 2HHPA 2XMWA 4AUKA 4WKYA 4YR3A 3RTVA 1TL3B 2VKRA 3CMES 1T03B 4UW2A 1YSJA 4K4YA 2ASLA 3RR8A 1NJYA 2ZC3A 3CJKB 4Q0BB 5HBMA 4Q5VA 3RAXA 2ZH8A 1UAWA 1VRTB 2W24A 3CDWA 4O3SA 5IFMA 2GFFA 2BRKA 1PC5A 3V81B 3ISZA 1DTTA 1UJ6A 2M88A 3I5CA 3CC2S 4IOBA 3RZAA 3IWXA 4ZP6A 4B3OB 2E9RX 1FJGF 1HBUB 3R5BA 2C2DA 4NYZA 4UY8T 4C8MA 1VQ4S 1J5EF 4NZ7A 2MKHA 3BSNA 5CXTA 4B3OA 1S9GB 1OSCA 2EKYA 5KFCA 3NBPB 1KLMA 4HLBA 3BS9A 4ZDNA 2E5JA 3CJKA 4FS2A 4PG6A 2C22A 2RU3A 3KLEA 1T8EA 3N6LA 3SYZA 1IKVB 1R8CA 2GMHA 4DF8A 2ZNYA 2Q43A 3OPKA 1OS5A 1VRTA 3MMBA 1VIOA 5HL7Q 1QTMA 1FDNA 1UEVA 3EGNA 1N6QB 2NREA 1AFJA 3AB2B 3MM9A 4IO9Q 2DR5A 3JSRA 3UCZP 3J7Z5 2VOPA 2U2FA 1WI6A 1KC8T 3UR0A 1YI2S 2DIUA 2E5GA 5GAEU 1WF1A 2ZH4A 2Z0GA 4Y65A 1Q79A 4DUYF 3KG0A 3L7OA 2DNNA 2WB4A 2QLWA 2KDOA 4RNMA 2RS2A 1DQ8A 4OX8A 3NKYA 2N3LA 1KQKA 3PJXA 4LIWA 4ED5A 2BRLA 2WTFA 1C4CA 1X5SA 4JOUA 4C2MA 3MD3A 4RWXA 1OPZA 3ISNC 4CO1A 1JNZB 4H4MB 1KNZA 5D78A 4TLQA 1S6UA 1QSYA 1S1TA 3TUZC 4JV1A 2HGLA 3W2VA 1BQXA 3IWLA 4DHVA 2XGPA 1IJFB 1UMJA 2GMLA 3MMCA 4DR5F 2HHUA 1VQNS 2DNMA 3DNCA 3DRYA 3U1MA 3VWSA 1NJWA 1MMDA 4WFBQ 5F9NA 4ZCMA 1SJ3P 4ECUA 4NXMF 4PWDB 3OR2B 1S97A 3EGZA 1VS3A 1EP4B 2XMJA 2YNFA 3I5BA 2HAIA 1HBOA 5J2QB 4F2SA 4WU3A 2PEHA 3UFCX 1VHFA 2MKKA 1LK7A 1AROP 4K5SA 3Q8RB 1YJRA 3D54A 2C28A 2CPFA 2EFGA 2IHR1 4H4OB 2CQBA 3RRKA 3M30B 2KKHA 3GSDA 4I2QA 4DS4A 4BWJA 2E9TA 5KFIA 3PKMA 2UP1A 4QOTA 2B51A 2IJFA 2GO9A 4KR0B 5E3CA 2ZH9A 1K1QA 1FHTA 1SUQB 3R5DA 3U1NA 4YP3A 2V8DA 4ICLA 3PFEA 3G6VA 4PKDB 3US5A 1YGYA 3DLKA 1CSJA 1RDRA 3UDCA 1T94A 1X9MA 1RTJB 2R2SA 2JHEA 4IRKA 4C3MA 4J9MA 2E9ZA 3QAEA 4NLQA 1A7GE 3UNGC 2RNEA 3P5TL 2CQCA 2EFNA 3J80Y 5HO4A 3DLKB 1JNRB 2FLLA 2B9YA 2VC0A 2LLZA 3LH2S 1XERA 1JLFA 2JFKA 2DPIA 4MIAA 3U1LA 2DGSA 4DV6F 1QAXA 4C8ZA 3CDAA 4KIAA 5GADI 2F8HA 2R2RA 1NRKA 1RT4A 5LT5A 4AL7A 1GXLA 3KK3B 1TFWA 1NKBA 2WBMA 3OUYA 3C3LA 4QQBA 2DIVA 1K0TA 2QMXA 1WI8A 3HHDA 4LF8F 2HIQA 2JFDA 4RNNA 2R7TA 5IT9Y 3CCLS 4TU8A 5T14A 1CQNA 2XSFA 5HLFA 2BQRA 2F9JA 3Q22A 4W90B 3MDFA 4EGLA 5DG7A 1N6QA 1UETA 3EPIA 1C4AA 1FVSA 4OZJA 2OP5A 3CDUA 4GMKA 4TY9A 2I9SA 5HLFB 3T3FA 2JEGA 5F0WA 1FO1A 3CD0A 3JTNA 5A6PA 2JLGA 1HNZF 3VTIA 2JVRA 3IRWP 1VQOS 2P6SA 3NS5A 1LW0A 5T41A 1ZTTA 2GHVC 4KKOA 1ZM9A 1HWUA 3TI0A 4NCGB 1TKZB 4WE1B 5F8IA 2DCLA 1U45A 3B4MA 5G0RA 2QA4S 4TXSA 1HBUA 2ZOMA 1KQGB 2UVWA 2DGQA 3FMWA 1YG0A 5AE2A 1LV5A 1FDBA 1Y5LB 4MK7A 3IS9A 4C4WA 4ED0A 1XN9A 4RLEA 4TQSA 2KM8C 3VAIA 3OFGA 4AXJA 3HHEA 3VR1A 2LYVA 2PGCA 3KHRA 1NK6A 2MYFA 1X5OA 1YRXA 2FLOA 2HNYB 2ZBIA 3QMQA 3LW5C 1SH0A 3THTA 4DL5A 4CO0A 3IR7B 5D4OA 3QAUA 3DI6B 1S76D 2KJWA 2CQ4A 3CVKA 1Q53A 1XTZA 2P5VA 3MZIA 2RT3A 2JOQA 1YITS 2MJUA 2W8LA 2HNYA 4LF5F 3GR1A 5JJBA 4AL6A 5EGYA 1NH7A 4HL9A 2B0GA 3H4BA 5DJBA 4OZLA 2BDPA 4YR0A 4URQU 4ZPBA 5LMNF 2OPQB 4C8LA 3WDOA 3OLAA 1IM4A 4NLTA 1X0PA 5F41A 2M8HA 1FDDA 2R4FA 2W9BB 3QYYA 4ED2A 2D7SA 3OBIA 5IWAF 3Q8PB 3HI9A 3G8QA 3BR8A 1WHWA 2HQIA 2KN4A 3DXSX 1UVJA 4FYDA 2CIMA 3MF5A 1F5BA 4ES1A 1M1KT 1J5OA 2M7SA 3N6MA 1T03A 2OH2A 4G1IA 5LJ3Y 3M8PB 4PG8A 5A8RB 1N5YA 4DJBA 1QUVA 1RT3B 2GV1A 1TK5A 1MWYA 4QWCA 3I0SA 1RK8A 2OKQA 2W25A 2KFYA 3H5SA 4L72B 1LWFA 1TV6B 4HH1A 3ZZOA 2VBZA 1M5KC 1NB7A 1U7LA 2MQLA 2MQQA 3KLGB 2C3MA 4MKAA 2CJKA 3C2PA 4QU6A 5KG7A 3G86A 3M2UB 1VQ5S 1NHUA 2XNRA 1Q7YT 6FDRA 3DRRA 2UV8A 4PG7A 3GG0A 3ZZ0A 3MR6A 3QZ7A 3OVAA 1SJ1A 3SFUA 1HQUA 4R5PA 1VC0A 1ZM4A 2DNRA 1RQ0A 3DLGA 4OHVA 4ZCIA 1VQYA 2AD9A 4OI1A 2E1CA 5A8RA 1F5CA 2B7CB 3RAMA 2W7AA 2J7KA 2YWFA 2VKZG 2IM1A 4C8KA 4Y00A 3MUTP 2J8AA 3KNGA 2IMOA 4MMOA 4DV2F 4YDXA 4PXBA 2R8JA 3D5MA 2KZMA 2YWEA 5KTQA 2NYIA 2YTCA 5KG3A 4RNFA 2UXCF 2DTJA 1NKCA 3OR1B 4ZPTR 2HVHA 2GJIA 1ULRA 3UD4P 2ZM6F 4NOHA 2DNOA 2LKZA 2SXLA 3H5UA 4RW7A 2CRLA 4EZ6A 5LSLA 1YTYA 3AQPA 3CC4S 1KLNA 2DD8S 3HHLB 3E01A 4IG3B 4F2RA 2VFVA 2CG4A 2A1BA 1D8ZA 2MZRA 3FMBA 4F67A 4YB7A 2L9NA 2IM0A 2MZ1A 1IBLF 2J7WA 1H98A 4ECVA 1S1WA 4AFFA 3TVKA 1HR0F 2X3GA 4PUOB 3DRSA 2R7XA 3EXCX 2JEFA 2FVRA 3CGIA 3OLBA 3NMAA 3LP0B 3BO4A 4EBCA 4DL7A 2QSFA 1FRMA 1LW2B 3BF4A 3VZHA 2NSCA 1N5VA 5EHHA 2G4BA 2AX0A 4J9SA 2M0GB 2YX4A 4F25A 4PUOA 5F8HA 2ZJPQ 5I42A 3DU6A 4QIVA 4XDCA 1T05A 3SSQA 4A4JA 2D9PA 1S0VA 5F9LA 2UVRA 3HP6A 1L3UA 1S7HA 1Q16B 4EU0A 2N82B 4LQ3A 3FJ2A 3O44A 3LWMA 2LA4A 3E01B 1Q1KA 1Y5NB 2BW2A 3F44A 5B09A 2L9WA 2EK6A 1MW7A 4LFAF 4X84A 1SV5A 2HWHA 3CMAS 2GNKA 1X4FA 3CJ0A 3OTEA 4KKOB 5JUMA 2VOOA 1RT2A 4X4OA 5EN1A 4IUFA 1HNIB 4YQWA 3TAQA 3CC7S 3VQTA 4DL0C 1J2VA 5F8LA 1ZETA 2AJQA 1WF2A 3RB4A 3QJJA 2XNQA 4YB5A 4MYTA 2JH3A 1C0TA 1H7XA 2ZVSA 4I1TA 4I64A 3SCIE 3S6EA 1X4GA 1NK7A 2DB1A 3MTJA 2FY1A 1KFSA 1RT3A 5L9XA 4M5DA 5B7WA 4RBTA 3CCMS 4B3SF 3TVYA 2W9BA 1BQMB 2BABA 2XZWA 1N56A 4KJIA 1SBRA 2J9DE 3DFEA 5FIIA 2QRRA 3KK1A 3MM6A 2IJNA 3U7JA 3GIJA 1O51A 2WOMB 5D4NA 4PPDA 5KFOA 5DRKA 3T19A 3PKYA 2U1AA 4EWTA 2Y1RI 2ZHAA 4RW4A 2K7KA 2C2RA 2G13A 2WB1D 3M6UA 5F3TA 2EFVA 5KFJA 5I42B 1VQ9S 4ZHRA 1UWBA 1T7PA 2APOA 5KFWA 1HNVB 3RU0A 4MFBB 2CJQA 3FSYA 4WYLA 5L1LA 1M5VC 2I2YA 5CYQA 4C8NA 2JX2A 1S6QB 2Z2MA 3MMJA 3K57A 1WEZA 5K14A 4LQ9A 2EBEA 3GZ7A 1NJZA 2PO4A 3NLCA 1UFWA 2HG4A 1J5OB 3M32A 4IH7A 1Y0HA 1UVMA 2ZDOA 3LAMA 5E3AA 1VI7A 4OX9F 1IXKA 1LWEB 3PACA 4GKJF 3PX0A 3D1HA 3OVSA 4JV5F 1RP5A 4Q2LA 2CQ2A 2D41A 4NMLA 3KLFA 3M1VB 2WOMA 4ECXA 1A6LA 1IKXA 3MPYA 4X66F 2MSTA 4QW9A 1N8RT 4RW4B 1X5PA 4QJVA 3ZZTA 1RA7A 5B0DA 4ED6A 1X9WA 1VQLS 2E29A 3S7RA 2OSRA 2OPRB 4E0DA 4C97A 2B6AB 3B82A 5K8OA 4FF1A 3DM2B 1U1QA 1QM9A 1R8PA 3R3TA 1RT1A 3PW5A 3OR1A 1KEKA 5L38A 3Q24A 3SDEA 4DUZF 2HHSA 1GNKA 2OPRA 3NWGA 4KPYA 4U6PA 3D0GE 2EW9A 1RT5B 3FQKA 1S1UB 4BS2A 3H25A 2HNDA 2UV8G 2ZH3A 3SFGA 1Y00A 3EX7B 1SKRA 4ELVA 3QIDA 2ADCA 1VOMA 5A8WB 2LQ9A 2MMYA 3MAQA 3HF5A 1X5TA 4MJKA 2MKIA 5CYJA 3I82A 4KHMA 3C6UA 1PO6A 3AAWB 4JI7F 3LP0A 2BA9A 4FXVA 5A8WA 4AL5A 3T1AA 4GO5X 3HX9A 1TL5A 4KT0C 5H1SV 5KT6A 3BR9A 2B6AA 3RW7A 2FPHX 1NEEA 4IH6A 4UUWA 4MTPA 1Y9OA 4J9RA 3VQSA 4MIBA 4OI3A 2QFJA 2XB2D 4I4BA 4TQRA 1HL6A 4RU2A 1WG1A 1R3NA 4ELUA 1FRJA 2RMLA 2ASJA 4YB1P 3JAMY 1Q81T 5CH7B 5D3GA 2LQBA 2KYZA 1TKDA 2PIIA 4ILMA 1FJ7A 2FUG9 4OX6A 1NK0A 3FRYA 1ZOTA 2I38A 5M2UA 4X4PA 2AWZA 4B9LA 1JJ4A 3DHWC 2J0QD 4R8UA 1AFIA 3GIIA 3OW2R 1JLCA 4UQTA 5H9FJ 1ZYQA 1OWXA 3N79A 5HI7A 2G9OA 2KFNA 4R8UB 5E3RA 5DQIA 3BB5A 1IKYB 2UUTA 4HVZA 2VA3A 4K0KF 3QGPA 2DGTA 4NLUA 4F50A 2JZ5A 4JI5F 4B17A 3NCQA 2AJ1A 5EX3A 2DGOA 3CDBA 2BANA 2RD5C 4BC7A 2CPZA 2G1DA 4EYIB 1JLEA 4LSLA 3S01A 3GMGA 1HBOB 3WZ0A 5K14B 3RAQA 2GMJA 2O5DA 2E1RA 1FESA 1SL1A 5M2RA 2YWHA 3PM9A 4ZP7A 4ES2A 4O44A 4ZCLA 1HW9A 2ILYA 4NCGA 3PO4A 3POTA 2YKNB 5CZXA 3V6DA 1HI8A 1XBWA 3ISND 3ITHA 1NJXA 2LEPA 3FGVA 4ZS6A 1KHWA 4EYHB 4E8UA 3UW1A 3WC0A 1FNOA 3GWCA 5L1KA 4ILLA 1G7CB 4QR0A 2CQ0A 3EZ5A 4DSFA 2ZZMA 3A8EA 4DMZA 4IG0A 2ZE2A 1K73T 3CIZA 5CYMB 4NWBA 3QIPB 3MM6B 3M8QA 3MMAB 2LECA 1YJ9S 3PXGa 5JXSA 5ADZA 3EYZA 2PDAA 3H4DA 3SSRA 4ZLPA 5IZHA 2CDQA 1WELA 3K59A 1OIAA 2P9CA 4WFAQ 4N76A 3NNAA 3TA1A 3O1LA 4PWDA 1CC7A 1HFEL 2MGZA 2KT2A 4DLEA 2WONB 1ZM2A 5A2QY 1LFWA 3D1QA 4EEYA 4IFYB 3MXHP 5F8NA 2IVYA 1AUDA 2GQ2A 2V4JB 1X4CA 2VPZB 3DDNA 3THPA 4LIRA 5KFXA 2Q3PA 3V4IA 2CVEA 4IR1A 3OUYB 2OD6A 3I87A 3I9ZA 4QYZJ 2ROEA 2VPXB 1SH3A 3DOLA 2XGQA 1GT8A 3BO2A 1HNXF 4N56A 2XEXA 1TL1A 1JLBA 2VH7A 1LOUA 1U6FA 4DEZA 5KFLA 3KHHA 2RE1A 2ZFHA 1FXLA 5B0AA 3C6TB 1U1MA 1Q8IA 1S1XB 2DRBA 4B9SA 3UCGA 1U2RA 4JI2F 4YMEA 1ZAWA 2RRAA 4ED1A 1Y5IB