1XTZA

Crystal structure of the s. cerevisiae d-ribose-5-phosphate isomerase: comparison with the archeal and bacterial enzymes
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
246
structure length
246
Chain Sequence
EDAKRAAAYRAVDENLKFDDHKIIGIGSGSTVVYVAERIGQYLHDPKFYEVASKFICIPTGFQSRNLILDNKLQLGSIEQYPRIDIAFDGADEVDENLQLIKGGGACLFQEKLVSTSAKTFIVVADSRKKSPKHLGKNWRQGVPIEIVPSSYVRVKNDLLEQLHAEKVDIRQGGSAKAGPVVTDNNNFIIDADFGEISDPRKLHREIKLLVGVVETGLFIDNASKAYFGNSDGSVEVTEKHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-5-phosphate isomerase
publication title Crystal structure of the S. cerevisiae D-ribose-5-phosphate isomerase: comparison with the archaeal and bacterial enzymes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 77
structure length 246
sequence length 246
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2004-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xtzA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xtzA01
2QSWA 1FSFA 2RQKA 3CSSA 3NWPA 1XTZA 3ENWA 3K5PA 4OQQA 1PBTA 4GO7X 3P96A 4OQPA 3U7JA 2P9CA 1NE7A 3MAHA 1Y7PA 3EFBA 3BXFA 3EB9A 1U8SA 2DT9A 3ENQA 4GMKA 2J0XA 3AAWB 1O8BA 1PSDA 5T41A 3MWBA 4R9NA 3S1TA 3NZEA 2ZHOA 1M0SA 1HORA 1UJ4A 1LK5A 3DC2A 2JHEA 4L51A 2RI1A 2KO1A 1ZPVA 3IXQA 1YGYA 3AB4B 5FIIA 2F8MA 3LWDA 4L4YA 1Y89A 3DHWC 3E7FA 1HOTA 2RQMA 2OKGA 4L50A 4PWUA 2BKXA 1FS5A 3DDNA 3LHIA 2LQJA 3TUJC 3KV1A 3ENVA 1CD5A 3CH7A 3UW1A 4L5IA 2QRRA 4GO5X 2JOQA 3NRBA 1LK7A 3CEDA 2J0EA 2QMXA 2H9ZA 3AB2B 4GO1A 3BXHA 3ICOA 2QMWA 1VL1A 3O1LA 2GNPA 2P9GA 2R5FA 2J0WA 2CDQA 3OFFA 2PA3A 1RWUA 3OFHA 3OFEA 1LKZA 3W7BA 4L5JA 5IT4A 4TM7A 3TUZC 2DTJA 3N0VA 5JJBA 2RE1A 2BKVA 1FRZA 2I9SA 5HJ5A 1UJ6A 2RI0A 1UJ5A 4M8LA 3KWMA 3OFGA 4IO1A 3MTJA 3LUYA 3HN6A 2LVWA 3L7OA 1SC6A 3BXEA 5IS2A 3TUIC 3LOUA 1DEAA 1KS2A 2O0MA 5IT0A 2MDAA 2P9EA 3BXGA 3DHXA 3IBWA 1FQOA 3TX2A 3HHEA 3OBIA 2NYIA 3OC6A 2FGCA 4X84A 2PC6A 4L4ZA 1FS6A 1JT9A 2W48A 4LUBA 4TM8A 2WU1A 3E15A 2F1FA 1YBAA 4R7TA 4NMLA
chains in the Genus database with same CATH superfamily
1TFUA 3C16C 3IQFA 2HS4A 1ZGHA 2YVLA 2ZREA 1QX3A 3TN7A 1PQ4A 3K94A 1Z13A 3QVGB 3ZU3A 4KYVA 4WERA 5BMVA 1WQ4A 2R7SA 4QUIA 5KEIA 1FDVA 3LP6A 5P8WA 4IVNA 1V9LA 1S2LA 3RIGA 2GO7A 3BSFA 2XGJA 2QA1A 2QVCA 1E0AA 2GAFA 3N39C 4ALLA 4EYGA 4FR2A 1QTRA 2DB3A 4LZOA 2AYEA 4YMIA 1MU2A 3GG1A 1OSCA 2BQRA 5AKZA 2BGLA 3THSA 3HCDA 2HVDA 4GC9A 2ZOMA 5LQUA 4KU4A 4R1UA 2GCOA 1T94A 4XD2A 5IFLA 4QYMA 2Y1OA 2C03A 1NQTA 5GMOA 3RANA 4M1TA 2H06A 2VT2A 3VDMA 2Z57B 2JJQA 2FY8A 5HSPA 5BW6B 2XBLA 3NQ41 3CVYA 5D1NA 2IHYA 4HFNA 2CF5A 4DCMA 2J9YB 4H4DA 3DU5A 3OHMA 2ZSHA 4XB2A 2O5EA 3LIIA 4PC2A 2WLTA 4B8ZA 4MP6A 1YF3A 4Q66C 3GLGA 2AN1A 2B7BB 2FZKA 1P2FA 3MZ0A 1YO6A 2CNKB 2BKEA 1W2WB 2EWWA 2XMUA 1PNOA 5CPBA 4UUQA 4W4TA 1KBRA 2O2JA 1PAEX 4CEHB 5FJIA 2C9DA 4L4RA 3W63A 2EYUA 2WWIA 3OCZA 1M5UA 2E85A 2Q1UA 3W5HA 5L39A 4OLBA 1I51A 4ZHSA 2H48A 1DO8A 2GVZB 3IIEA 4BEBA 1Z88A 2G7MC 1SJ9A 1U45A 2V8DA 1VIOA 2I2XB 3TSAA 2RDDA 1EJ0A 3K1TA 2Z9DA 2ZK7A 4QPNA 3NOGA 1AKYA 1LKZA 3WGNA 5CTJA 4IDPA 5GAGU 1OBVA 4WBSA 4GSYA 1OU0A 2ANCA 1RRVA 2J0SD 2LKCA 3LYHA 2GS8A 1HKUA 3D8HA 4KC5A 3KOWA 4IKOA 2VK1A 4ZAWA 3FK4A 1PJZA 1R0XA 2AX1A 4B3FX 2BJ1A 4MUYA 2BFEB 1KGDA 2I8LA 5I4BA 3G3EA 4CMBA 5K14B 3BF7A 4XM1A 2HL6A 2F4VF 5DE3A 4D0LB 2K4MA 5BUSA 2JFFA 2QYSA 3FRIA 4BS2A 4ZI7F 4FMDB 1XZCA 2JDID 1HBNB 3OIWA 4MWSA 1J25A 2HA6A 3FTCA 3RWBA 1NASA 4EWTA 1BYIA 1HHSA 3HCPA 3BM7A 2GRAA 3M4NA 4PZ0A 3PTWA 3QFFA 4HPJB 2MSEB 5BYJA 4LSNB 4TN1A 5C1IA 1ONPA 2VAXA 3OZFA 1T9HA 4JT4A 2PX6A 4MGKR 2BUAA 1M1NA 4RELA 5FNVB 3OLXA 3KDNA 2QRVB 1NG9A 3RV4A 5L4SA 2H18A 2NZ8A 3AESB 2I34A 3KCQA 4U02A 3W9UA 3JASB 2V94A 2OK8A 2A18A 3BXGA 4HN2A 5F8NA 4RKWA 1TECE 2BOAA 3Q9LA 3EMKA 2BI7A 4PGAA 1HLWA 3EVTA 4RF5A 2XO7A 1L5FA 3IAXA 3DCJA 1AG9A 4MLZA 4DUTA 1WHWA 1ONBA 4B0OA 3U5ZB 4N6OA 4YRFA 5HVFA 4H77A 5B0CA 3GEBA 5J2QA 4XOIA 1S1WA 3IKMB 1X8XA 4ZHQB 4EG3A 5LXTF 3CNNA 3PR5B 2QRGA 3GDHA 3CGIA 3LYLA 4OYWA 4ICIA 5C4GB 1KMNA 3H11B 3A05A 1BW9A 1GWNA 4YQYA 5J4YA 2C1XA 3UJ6A 5ED4A 4PCQA 4YO7A 3HXMA 2XE6A 4J6FA 4DA6A 2WB4A 3MEEB 4L28A 5C2GA 4FHGA 4DLNA 1VQNS 2I3BA 1W88A 2BDEA 4X62J 1QZTA 1JVNA 3PXAA 1N54B 1WB4A 4FS1A 3Q86A 1ZM7A 3NV9A 4X97A 4CQLB 1F5CA 4M5DB 1DTQB 2KXFA 2PMKA 4Z0HO 4BVAA 3OIDA 1Z25A 3GFRA 5LZ9A 2J3DA 3EYWA 5DXJA 3B9QA 3SF0A 4TTPA 4W8OA 4LHVA 5EIXA 1CJCA 3MQ4A 3NGTA 3UA4A 2RC5A 3FYUB 3KLPX 3RF6A 4AQ7A 4CLRA 1FDSA 3LAMA 2P65A 2VTKA 2QNIA 1PGJA 2IYZA 3EZXA 2W2KA 2JJ1D 3W5ZA 4C78A 4WKRA 5BOSA 2CV1A 3I4PA 3G0BA 1T6XA 2AA3A 4L0CA 2QRKA 2Q9UA 5L6LB 3S7ZA 2XSJB 1E3TA 2GUGA 2BSQA 1RKVA 2CDNA 3VAAA 1XFAA 1KSPA 1CBUA 5K3FB 3X43A 2PXHA 3N0TA 1XEFA 2GEJA 4V0LA 2FPPB 4Z9BA 4AS2A 4D25A 2CL5A 3UUWA 2W2NP 1MPXA 2JJ2D 2QE7A 4B6GA 1I4DD 4NQRA 3KP1A 1M75A 4LPKA 1Y7TA 5H80A 1U1DA 4GL2A 2YQZA 3EDQB 3W3ZB 3VM6A 2RBKA 1Z62A 4LI3X 2R44A 4A4JA 1P0MA 1FFGB 3BMCA 3KWFA 1ZH5A 4L9RA 1B8UA 1YGPA 4C03A 3CU5A 4ZVPB 3ANLA 4WFQA 2RHOA 2DTEA 4I2NA 2EX4A 3R8YA 3RVLA 3DMYA 2QJFA 4EKIA 4H4MA 2E5LJ 5CT4A 1T25A 1L3TA 1MSWD 4UTXA 3R3YA 2H65B 3BEOA 1NVDA 4CT0A 1Y81A 4NFYA 2F8MA 1X7YB 2ZB7A 3J81j 1QIFA 4NWIA 1FSPA 3KD2A 1GHTA 3IAHA 1S3IA 3R20A 4IFVB 3EBLA 1P81A 3HZEA 2XY6A 4AY6A 1H38A 1UP1A 4OI1A 4HEA1 4MK8A 4DPUA 3ZJTA 4XARA 3CFYA 4R2IA 1Z36A 1KC8T 1USGA 3CF4A 3MSCA 2CNWD 2JPDA 5L1LA 1UWAA 2O5DA 1KMHA 3KQWA 4OY3A 3H25A 1ZZGA 4YCCA 1A4UA 3TTWA 2BFAA 2H2AA 3KTAB 1AKTA 4KNVA 3NLCA 2HRBA 2BM9A 3GP3A 2VRBA 3ZHUA 1ZOIA 1MN7A 2PT6A 4LFBJ 3OY7A 2JEGA 4W82A 4QPPA 2GD0A 4CQMA 3QK7A 4AK9A 4TS3A 1ZAXA 4BNVA 4RNFA 2V54A 1TL1A 3MD3A 4Q1BA 1M1UA 1EM6A 3SJ7A 1WNFA 2ODBA 1X5PA 5EQDA 3B3QA 4LF8F 4XKJA 2GQ0A 4DUZJ 5IYZA 3EIHA 2G0IA 1HTTA 2RQMA 4MICA 4BQRA 1ZMOA 2Z8QA 3UK6A 5C42A 5JZSA 5HIJA 4BLWA 2DBQA 2G40A 5AK6A 1V48A 4RQUA 1A8IA 2R8EA 2XQFA 4EY8A 2DHDA 1KDZA 2VZ0A 4OXNA 3LY9A 3DMNA 4LJYA 1LW0A 3UH0A 4EHNA 3CDBA 2MMGA 3H5IA 4IUYA 1U81A 4JI4J 1FCAA 2RGWA 1CJUB 1OYOA 2EEPA 4URWR 4LE2A 4CTAA 3QG1A 4ZKDA 1ENOA 2K87A 4DG1B 5DM0A 5HGJA 4HVCA 1Y42X 3F9IA 1ZL0A 4HJRA 4FDTA 1J8YF 1SH7A 3G71S 5CUQA 3B82A 2CXOA 4MIBA 5F4BA 2G25A 4XIFA 5J5VA 1QDUB 3VH2A 1GAOA 3UOAB 4OEHA 4R9VA 4U5QA 4UMFA 3A6FA 3C39A 4DLZA 4B9SA 4EB6B 5JFTA 1KL7A 1DIBA 4ETNA 1SBHA 1YHYA 5KG0A 4J8PA 4Y30A 2RE8A 1CV2A 2F63A 4F6CA 4QRDA 3G2HA 1Y1LA 3WWDA 2C5HA 4DV1J 3UMBA 4LZAA 1YAJA 2D9PA 4LQLA 4F3RA 3BHJA 4PR6A 4JBGA 3EIXA 4ISBA 2KFZA 3B20A 4HEJA 4TXLA 4QIWD 3L8MA 5EIHA 3VTZA 3M9MB 4DV6F 2JCXA 5CBPA 2J3MA 4QJ3A 2RK3A 2PMWB 2ICAA 1P5JA 1N8RT 1RPZA 5B1SA 4PYMA 2WTBA 3HHLA 3UATA 2I2AA 5G3YA 1F6BA 2WVCA 3LDHA 4X64J 4E5KA 4ZVSA 2FSVA 3FJYA 1GPWB 1TU3A 4KAJA 4I5DA 2P9FA 3ESBA 1GV0A 1RHQA 5JZ9A 4GOJA 1MWYA 1JXOA 1R8QA 4WNAA 5CCEA 4XQCA 2IA6A 1KOHA 3ZDRA 4MV7A 4IHQA 1LD3A 2K2QB 4RBVA 3JZMA 2QX7A 4LXYA 1RTHB 1D2RA 1FWLA 3GG2A 4XQ9A 1XMJA 2XZTB 2YZNA 3UWOA 3CZMA 2QT9A 2O8EA 3BQNB 3AB3A 2QTTA 1Q0UA 2I22A 4DN0A 1U02A 4H4OB 4L5AA 1JHAA 4G4JA 1I1GA 1XRRA 4DVGA 1CE8A 4E2FB 2VUIB 1FE4A 5K8CA 3MWYW 4NCIA 4XAKA 3ZCQA 4IHKA 1G3MA 2HM7A 1AV6A 4RX6A 4QICA 5B55A 3C4QA 3C15C 3T8YA 1X1SA 2XPCA 1QHGA 4KV8A 2H16A 5K6AC 2J4CA 1VLOA 5I3PA 2XTJA 4LJ8A 1YRUA 3PLRA 1JIXA 2PZBA 3L1IA 1T05B 1PR5A 3HNOA 5HQ8A 2EVWX 2PWYA 4AURA 2B5JB 2C7BA 2B6AA 3IHKA 4Q4LA 1LI5A 3PDHA 4AP9A 1AXGA 1MRZA 3T7DA 3W2VB 3G1WA 4L02A 3VYVA 1BQEA 2XNCA 1SVWA 3IPLA 3WAGA 1OQ3A 4Z2AA 1JHZA 2R4TA 3C6UB 3ILXA 1QGUB 4DR7J 1JXMA 1YQGA 5B36A 4UKDA 1G21A 4XGNA 2DKOA 4HH1A 2PZGA 1FUEA 4H3KB 4L3NA 3KLVA 1T9GR 3DZGA 2DPLA 3ELWA 4NU5A 1MFZA 5E6RA 3FVYA 1PYSB 3LP8A 3NT4A 1HTBA 2BHNA 4JMLA 2EARA 5H4GA 2C96A 1FNNA 1QYRA 5E6UB 2GBIA 5AXBA 2XT6A 1CD5A 4H15A 1B15A 2J3IA 2UUPA 1QZUA 3PK0A 1G5QA 4RPCA 5DM60 1HNVB 4ETWA 4C4YA 3JQ7A 2QZJA 4L2IB 3B48A 3DFEA 2P5YA 4M6WB 3CUUA 2P9QA 1X9SA 4M0CA 4PC3A 1PR9A 2IT1A 1V8ZA 4FE4A 4PZUA 4DRZA 1XV5A 5JUMA 1DFIA 1NLYA 3CCTA 4KE9A 1G20E 5JVDB 3GQBB 4LYFA 1P44A 1KDNA 4FVTA 3R9WA 2PT5A 1OBOA 2GZ3A 2CQ4A 3ROFA 3UB3A 1F5BA 3QUQA 5FP0A 4X4SA 3KKLA 5H83A 1DINA 1G2PA 1DIHA 4ZPCA 3GFGA 2CD9A 1TGVA 1P1CA 421PA 3FI9A 2LCFA 3BZUA 4PYKA 1RIFA 4CQNA 2V6MA 5D00A 2QE5A 4KSEB 1EYZA 2P3OA 1H0KA 1RU2A 2FA9A 3A12A 4AS1A 4K4WA 2I80A 1R00A 4LZWA 4P2XA 1AGNA 3HLYA 2W6MA 2UXBB 2GQQA 3PXGa 1NV9A 5IC6B 3EUFA 3I5YA 1TUBB 4C04A 1Z7BA 4XFDA 3OQVA 1ZTTA 3QU9A 4IKAA 4NYMQ 4F84A 3ZDAA 3SZ3A 3KSMA 2JVRA 1MLAA 3D0GE 5KKAA 2A1BA 2ZYIA 2Q07A 2Q7OE 1O4WA 3OJWA 3DTVD 2QL9A 3E9RA 5KNDA 3TJ8A 1DJPA 2AK2A 1I5OA 1TUGA 4MDYA 4K28A 3TM5A 3AI3A 4DUGA 3AZPA 1CZKA 2Q9AA 2RJZA 3P4YA 3Q4GA 1H0HA 3GJ5A 3LT4A 5DFAA 4D9IA 1JMYA 3ETOA 3CB2A 5FQOA 5REQA 4X1KB 4YYZA 1E2DA 2B4UA 5EJEA 1LI7A 5DO9A 1VBXA 3ZJYA 2KB0A 4D4KA 5FLXY 1RAGB 4XLZA 5KOHB 4LOKA 4LF4B 4G24A 2XR1A 5DM70 2JFKA 4L6V3 4CLKA 2VAVA 5A71A 2NG1A 3R23A 5LM7E 4FIZA 4UZCA 3G2OA 4KVAA 1UQRA 2V2QA 2C8KA 2RI1A 2CDAA 1UWKA 4FOPA 4OI2A 1GITA 3E5HA 2RFLA 5C2CA 3NBKA 3UJAA 3HWSA 4TQAA 4G5YA 3GARA 3MCNA 4ECQA 1Y4ZA 3FBWA 3BGLA 4ZVOB 2HBYB 8ADHA 1JE1A 1JMVA 4D81A 3M33A 2UUAJ 2PO5A 1UIMA 3HBMA 5C32A 1W73A 2JF0A 5F77A 3VR5A 4WCFC 4KXVA 1K5HA 1PYGA 3QLVC 2I5JA 1M1YB 2CQ0A 3IAS6 4MQUA 4ER6A 5LDGA 2C2MA 3ZDDA 3LPCA 3EGIA 1NYQA 3HDVA 2E87A 2IY8A 1B8PA 4B3GA 4MGYR 2ZH5A 1OIXA 4G5OA 2O50A 4RL6A 2Z2MA 3UJPA 3DPUA 1XELA 4BLPA 3WA7A 4MKVA 1WZCA 1HLDA 2Q43A 1CFJA 3H2JA 2WT9A 1SNYA 2IGBA 2VNSA 4Q9HA 4OBXA 1OXUA 4EQ6B 3R9XA 4IGEA 4I8DA 4DMRA 4WKOA 1OD6A 2GO1A 4CW7A 4DR6B 1EFPB 2FN8A 2OXRA 2HWTA 2KHDA 1EQ2A 2DFVA 1TL7A 2JEOA 3C6BA 4J7UA 1WW3A 4GLOA 2B4AA 4HV4A 4OM8A 4KO2S 1J2RA 4JH0A 1AYEA 1P61B 3UAXA 1HHTP 1KOJA 1W0JD 3GE9A 4KXNA 4YCNA 3B2NA 1GILA 5J59A 4ZDWA 3WQBA 1EA7A 5A76A 1WZEA 1BEEA 1A0OA 1GDTA 4LPSA 1Q0TA 1UOOA 5EERA 2MSKA 3U0BA 3ZOZA 2WJVA 4ZEMA 3WGGA 4Y0AA 1VHQA 2EKLA 3WC0A 2VUSA 4W5OA 2BE7D 1FSFA 1YKGA 2XMGA 4NLWA 1WMSA 4QZVB 1C1XB 1UEIA 1N2JA 4I0WB 3PWZA 1QU2A 1Z5WA 2ZUAA 4DPYA 1M34E 1ILWA 3OG9A 4EG0A 2HWXA 3GLVA 2D5IA 5F7JA 3WK8A 2W43A 2Y3YA 1L5LA 3KJNB 3SCLE 3O03A 5KWSA 1NBMD 2V2ZA 2HF9A 1YRWA 4KSCA 3ZX4A 4V3BA 2EX1A 1KDTA 4DMHA 4NJMB 1V35A 3GRVA 4IG3A 3QV2A 2VQEJ 1VRVA 1MP0A 3IVCA 1FW8A 4TSFA 3SN6A 1QJ4A 4UM7A 2LR0A 5WRFA 3FHCB 3D8BA 3D8RA 1RE1A 4C0SA 4BCDA 3BH0A 2OBMA 4JBHA 1U49A 4BE7B 3W8PA 1OFHA 3PNYA 5D87A 3DHXA 2C4NA 2BZ2A 3U61B 4HX5A 5IARA 2A0XA 5K3OA 1UJMA 2RRAA 3OETA 3VC1A 1O03A 3E53A 3T1VA 5BMVB 1D1SA 1GGJA 5GM2A 3KOYA 7FD1A 1QGED 1I3OA 4KB5A 2MQ8A 5HKKA 2P67A 4JAVC 4DSEA 4D3HA 3QPBA 3A9UA 1AMOA 5L4NA 3L0OA 1FJCA 3K0KA 3O8DA 3AHGA 1MU2B 2OP5A 2E5WA 2F64A 4G0VA 1C0TA 3O82A 3BO2A 3G6VA 2BMDA 3PZRA 1WXDA 4CNZA 2GCOB 2C78A 4Z4IA 3VH1A 2P6TA 2JLFA 2IZZA 1GZUA 4N8NA 2IPNA 3GIKA 4ZI3A 1H0RA 3ISND 2WYWA 1WS6A 1VJ1A 3DRRB 3EEYA 3K3PA 4EJ0A 5H9EK 4UNPA 3GEPA 3E3LA 2YJ6A 2FEMA 5AOAA 4QUKA 1Q8BA 1UFVA 3WRVA 3GLGB 1NVBA 4M0LA 3PNBA 2FZKB 2C2RA 4NLGA 4E5UA 3X1YA 2VDHA 1UW9A 2ZIZA 4ZREA 4BV9A 4RLHA 1K2VN 2R65A 3OWXA 1YS2X 4O3SA 3VQSA 4ZI2A 4IRMA 4MRPA 1TK5A 1WMDA 1YS6A 1ULZA 1DQYA 4QGBA 4OQQA 2KJQA 4CI9A 4AXJA 1W6RA 4BGVA 2H48B 4GD3Q 2ZUTA 3VGPA 3QIPA 3Q8XB 3PRHA 5LDHA 3WX0A 1T5TA 2F8SA 4QJVA 1DKUA 5F33A 3ILSA 3W6ZA 3QZUA 1O87A 1JQ3A 1GSAA 2G63A 3AUFA 1EWQA 3H99A 1KJNA 3AZQA 4EA6A 3LKDA 1IY9A 1NJ6A 1E4EA 1J49A 4K59A 2X14A 3RAGA 4KKOA 5KYGA 3WWOA 4A2QA 3KVVA 5H3HA 5A3SA 5KZMB 3R0VA 4KO4S 3FPAA 3DZ8A 3P49B 3UHPA 2WG1A 4BNDB 2PZ8A 4BO8A 2BFCA 3UPDA 5CHCB 4FCTA 4RQTA 1J0XO 1WX1A 4D9BA 5DGXA 5JD5A 2JZ5A 3W8GA 3CKLA 4BJHB 3C8HA 1JT9A 2OYCA 3VTKA 1SKAA 4OKIA 1X5TA 2IDKA 1Q53A 5BJRA 4B4VA 3BIFA 1SMKA 4EHLA 3CC4S 1AF7A 2ZR0A 3CNEA 2YR0A 1MX9A 1W36D 1BXKA 5LDDC 1Z4JA 5I7FA 3PX4A 1LRKA 1R0AA 2JLUA 4TGLA 2QLFA 5HROA 1PAUA 2XYRA 3HBFA 5KX5A 4RHYA 3MEGA 4D0RA 3VTAA 1M1NB 3PC3A 2ZETA 1N5DA 4QWBA 2R8XA 4BMSA 4S2EA 4CMCA 3H4DA 4MKIA 3B7GA 4YIHA 4LCEA 1EDDA 2X41A 4QR1A 4B6FA 3PXBA 2DH7A 2JHAA 4JA0A 4ER5A 4TXMA 3NBUA 4DDHA 4IQ0A 3C7CB 5AK4A 3QYAA 3LE8A 1OB5A 4S1VA 4OJTA 3EVDA 2DTJA 3USZA 4QYWA 2B7LA 1MW8X 1S4EA 3R5CA 4OGKA 4R68A 2KXNB 3EFEA 5KC9A 3SFTA 4DI6A 1PT7A 3VX4A 4Y2YA 5J2QB 5MN5A 1S1WB 3WQSB 4NRUA 1NVVR 4QBTA 5LZ7A 3ROXA 3MEKA 4OYAA 3FFIA 4GMHA 2BYCA 1VOMA 2DJIA 1Q6YA 4CMEA 3W1WA 3ESDA 1BW9B 5JI2E 3PCTA 1YBFA 3UAVA 1A7UA 2ZXEA 3DM5A 3DYIA 3T1TA 3U4QA 4LOHA 5KWIA 3KU4A 4W5QA 2RBGA 6FDRA 5IVHA 2LKZA 2RHGB 1KDRA 1JW9B 2QM0A 2BV3A 2P35A 1ZZNA 4U2BA 5CK5A 3RB4A 3O3NB 2P40A 3NASA 1W88B 3CZ9A 5C1BA 3WGUA 3ZVKA 4DPTA 1WP9A 3EWAA 2PKRA 4P35A 5K03A 1Y10A 3BGVA 5JSFA 3EXIA 2PLNA 4B9MA 3NDPA 2Q5HA 1G8FA 4DIKA 4QOIA 3SCZA 5B0EA 1GYRA 4ZOLA 1MAHA 3K0SA 5I9LA 1HZJA 2HUNA 2ZDGA 2XMQA 4HYKA 3KJEA 3ZU2A 4XI9A 4AWBA 4O59O 4G5GA 1E99A 1ZH0A 4BNLA 4E46A 4DBQA 1XDZA 1E5VA 4AQYJ 3AUTA 1R5BA 3GFHA 3GFSA 1EFCA 4EAAA 4KNYA 3U3DA 5KU7A 1I2DA 2XB2A 4AKEA 3PJGA 3KNGA 2JGKA 1BKYA 1Q50A 3DEAA 4FM9A 3JD1A 2KLHA 3FLMA 4WWHA 2WQ7A 5KFGA 4JELA 5DBEX 3TLEA 2VZ9A 3M1IA 3OQBA 2W2KB 3FKSA 5BOSB 3O7MA 3SDEA 1IB6A 3M8YA 1Z6AA 4AROA 5HSGA 4F36A 3ZV4A 4URFA 4RTKA 4J6EA 1SCBA 3A1EA 4YB6A 2EFCB 3CH6A 4GI2A 1JK9B 5HM6A 1TMJA 3JS9A 2AOVA 2J0QD 2ZATA 1QHEA 4UTGA 5GJVC 4G09A 4GGMX 4C0BA 3CJTA 4ND6A 1E9FA 2PEYA 2X5OA 4B6PA 5AHOA 4C8NA 4TUYB 2XMAA 2ODWA 3O4HA 4YHHB 2QT0A 1P9OA 1WJGA 1Y4UA 3TLKA 5EWEA 3BXHA 4OZNA 5TVGA 4HGRA 4NH0A 1MX1A 4Q03A 3KKQA 5LMUJ 1R5OA 2W2VA 3GEEA 4EFAC 3Q3VA 1DHTA 4OQZA 2GM3A 4AD8A 1NK9A 3QBEA 3ZHTA 3BMCB 1IFXA 1JX6A 2VDNB 4MQ6A 2DIVA 3VV3A 3H16A 3GLSA 1PJ5A 2MDTA 3UB4A 1W5FA 3OPYB 4UATA 4H4MB 1FUUA 4QU5A 2GAGC 3VHLB 2JLEA 4KQHA 1Q0QA 3DL2A 3IVRA 3WQRA 2O8CA 4JV5B 1A96A 1K0VA 3G02A 1QCZA 2CQBA 4HSEA 4MP3A 3GFZA 1M0TA 4ND1A 3U19A 4CF5A 5KYXB 5DDQC 1OGIA 3ROTA 4QJBA 5T5QA 2Q2NA 4FNMA 4YVFA 2GFFA 4OYXA 3U3KA 1IM8A 3Q0IA 3FBTA 5EL0A 4RESA 2PGLA 5DP1A 4DV3B 2YOGA 1Y1QA 3TSZA 2EIXA 1KMHB 2C1ZA 4WZMA 2IXEA 3ZHYA 1JGTA 4ZP6A 4URVR 3VH3A 3N2EA 3MS7A 1I1QB 2NXWA 2RH8A 5B1EA 2V7BA 4A4DA 3MUEA 4MVCA 1GMUA 3AOAA 1FP1D 2BEKA 4AY3A 1C14A 1P45A 3BGWA 1GSOA 3LLCA 3OQHA 5KJEA 3D2LA 4CQMB 1GPDG 2ZTHA 4CF4A 1C29B 4R3UC 2EI5A 1E3DA 5CDYA 4OL8A 1TL1B 1Z8DA 1PEYA 1SBZA 4Q9LA 3CBQA 3M6MD 5CFRA 3EIOA 2IFXA 1BXGA 3SSOA 1MJNA 1DQ8A 2ZH1A 3RUIA 5IYZB 3HGQA 1PL8A 3PIIA 2IC5A 2GVZC 1IC6A 4UVGA 5C42B 3HPQA 2LCIA 3OD1A 1H2WA 3E8XA 1P9NA 3INNA 2PT0A 4QWCA 4D0GA 3CMCO 4NCJA 4V1Ak 1BMFA 5AIAA 2KMLA 3KEMA 3E9ZA 5F0WA 1CHDA 1G7CA 3T9DA 3UJDA 4MKGA 4INJA 3GVCA 2HF2A 1NJFA 2QRUA 4K40A 3FTEA 4CTAB 5FBZA 4I8XA 3HFSA 2ZITA 1AGXA 1WF2A 1J42A 4BB9A 5I7UA 3O91A 4LBYA 3Q7IA 1EARA 2UYYA 2CYCA 1GEGA 3MMJA 1KI3A 1YA6A 1QHNA 4MLCA 4R2LA 2HF7A 1GQYA 3EXG2 3KKPA 2GW8A 4UCWA 3D7MA 4CUKA 3LAKA 4OYZA 2B30A 5FUBA 3OP1A 4HDGA 1FMFA 3EYZA 5THWA 5KS2A 1T2EA 3GONA 3CXUA 5DIFA 5I3UA 4O3QA 2ADFA 1E9RA 2J9XB 5HF6A 1DRWA 1A95A 5FXMA 5CBPB 1QKKA 3ESZA 2ZC4A 2C3PA 5FIIA 3HHLB 2AR0A 1P6TA 3QPVA 2ZJ8A 3B12A 2YKMA 3QXSA 4ZVSB 1VSVA 4C8ZA 5C80A 3VZBA 2XS7A 4Q7LA 1YNSA 1VL5A 1E5XA 2GNPA 3LY5A 2Z5GA 2XG8A 1RHQB 3KX2A 5I4CA 4EY5A 4WNAB 2PXXA 2YKPA 1T2AA 3EWIA 5LB2A 2XQJA 3QLJA 1U0RA 4LF5F 1WW8A 4KJZA 3TL6A 4XR4A 1ZNZA 3OD2A 3W8EA 4GI3A 3EWSA 2VDJA 3ENZA 3ORFA 4IUBS 2Y9PB 2J1LA 4X84A 1FS6A 4K9NA 4DLAA 1IN4A 1VIAA 1UVIA 1WOYA 4NMLA 2C1EA 1CE8B 1OWPA 3V2UA 4X2BA 5JAMA 1HFKA 1A9QA 1FQKA 3IUYA 3PW4A 4LQCA 3RIEA 3AVPA 3KKFA 5KAMA 4TXNA 1RYHA 3Q3JB 1Q14A 3H7AA 2DHXA 3ZCRA 4KV8B 3SKXA 4XYLA 4GKKB 3A1NA 3ELYA 3JALA 2RGBA 4F8RA 1ZPVA 3PW5A 4ZYXA 2O1XA 1HNXB 1BH2A 2VKQA 1TZ0A 5L53A 1KJQA 5LBUA 3WHIA 3ZZ0A 2GBFA 2ZH9A 1C7JA 4MR7A 2B6AB 4FSHA 3D54A 3RJMA 3TEHB 2JI9A 2HWYA 4PX2A 2WA1A 4AL5A 1DUVG 1YZTA 5JAOA 1X5OA 1SO8A 3VALA 3ZV3A 4MQEA 4RD2A 3FYUC 4I9FA 2O3RA 4RD1A 2FHPA 3FNHA 1KC1A 3UAOA 3PE3A 2DKOB 2AOUB 4DABA 1DCTA 4K9OA 2EGUA 1CUCA 1WD6A 2BFOA 3WZ0A 5E6RB 2B7CB 1T0TV 3WRXC 3BIXA 3BWVA 3BBLA 5T7LA 1F8GA 1RE0A 3HXOA 5F1PA 3TEMA 1JEYA 4HTJA 2C2ZA 4AF8A 1KI2A 3JAKB 4OFXA 1NVKA 1RWVA 2FWBA 1V2GA 1XA3A 1F9HA 4ZS6A 2VOJA 4PWWA 3O4RA 3DXXA 5A2QY 4JCOA 3FMGA 2K3KA 4UARA 2CMKA 3C1UA 2JHEA 5ALRA 1JKIA 4LYJA 3JQ7B 3L09A 2Y66A 4PRYA 5HFNA 3WLLA 1IIRA 2DNYA 1L5RA 1P8AA 3H9EO 3FR7A 4WN9A 2GESA 3F4KA 3DOEA 4UNIA 4ZOQI 3I1FA 4IXDA 4OXXA 4E7OA 2IZ6A 1OFTA 2EERA 5IAJA 3C3PA 4J2HA 5A3JA 2WDZA 3FJ1A 4YXWD 3R9IA 1GKYA 3NYIA 2IYNA 1Z7GA 4UPVA 3KJQA 2AW3A 4TYMA 1KQFA 3HUDA 3MWFA 4BZXA 4ZQEA 4X4QA 5AI0A 4YDXA 1N56A 4QHTA 2W2PP 2ZJYA 3ND8A 3ZKWA 4O2AF 2Q2OA 1IXRC 4M38A 3JQBA 3IPXA 1QLJA 3TYXA 3FBFA 4Y2XA 821PA 1OXXK 3FCXA 1BS9A 4BCAA 1M6YA 3CX4A 4DF8A 1E5DA 3I76A 1FUYB 1D07A 2PO7A 3X1WA 4HB0A 1W25A 1EP9A 5BRJA 3MMCA 4BWMA 1HDZA 2V67A 3L6DA 2KBEA 2CDCA 3SBMA 2X8JA 1NNSA 1N6IA 1NQVA 4KHPB 2ZUDA 1RMTA 3ZGZA 5IULC 3LDAA 5JRZA 1SUCA 3QEBZ 1BD3A 1VLLA 4U96A 1I5OB 3ZY6A 1QHFA 1NQXA 3FLEA 4R2XA 1L8OA 4IOJA 3R5AA 2Q3MA 4IQXA 3GL9A 2WHYA 3AJDA 4MUBA 2IKSA 3H2YA 2D0PB 1G60A 4IDAA 4MCIA 3OLZA 1PT9A 5AHKA 1EX7A 1PQUA 4HMQA 5REQB 5B7QA 4BC1A 2F6RA 1FXWF 1IDN1 2D0IA 4KPCA 1XF9A 3G2LA 3TE6A 2XWXA 3GFVA 2OV4A 2FUG9 1QUFA 1PW5A 3KNAA 2Z3WA 2YHIA 2X2PA 4JGGA 3MR3A 2OCBA 4IOLA 1EQ0A 1B4SA 3I9V1 5J5CA 5K4AA 1CJVA 4IUFA 5FPSA 4DLLA 4RD3A 4CF7A 5EIBD 2O2SA 4ZVQA 3P71T 4A7PA 5IF3A 1Y80A 1CZNA 1X4EA 4URXR 4BNNA 2ZJBA 3PXUA 1O8BA 2ERXA 3IRVA 3UFBA 3K09C 1M66A 4MROA 1RT5B 1Y4ZB 1JLFA 2GAIA 1IOZA 4E11A 4EFKA 1DJMA 4R5MA 4YLYA 3GIIA 5EMMA 1CJUC 2YH1A 4GL4A 2XNQA 3D8NA 4S12A 2U1AA 2NW6A 4RBTA 2GBGA 5U4QA 3TWZA 2EKNA 4QUEA 4MYRA 1DAFA 1XX6A 2I5JB 3QFSA 5AI8A 5D5QA 1P9WA 3VGTA 2C2MB 3DLTA 1DC7A 5KQLA 2CXTA 2R3VA 1NG1A 1XMOB 3HVIA 4D1YA 5LLDA 1OKKA 4JSTA 3QQ5A 3OT5A 3CW2C 1HOXA 3Q41A 4QHSA 3WLPA 4RX1A 3B51X 5M5BA 3V5RA 1T0HB 2DNQA 5LLTA 3ZCXA 1NEEA 5EPEA 3R9XB 4M8SA 4FJ0A 4RD0A 2AI1A 1L7EA 1JR2A 4ILMA 4QU0A 1BVUA 1J2YA 3SS8A 4LTMA 3NZEA 4OYOA 3HL4A 1TL7B 2IW3A 1CQPA 3OAAA 4LKOA 1IBLF 5HIKA 1NXSA 4I4IA 4LECA 3M34A 4CQ1A 1RLOA 2CLMB 3OO0A 5AI5A 2AHRA 4FGLA 1L7NA 1NSPA 2O20A 1P1RA 2WVAA 3T94A 4PY2A 1A0OB 2QC3A 4F4YA 2HA3A 4BRUA 5G4KA 5ES3A 4CDMA 4P2GA 3CT4A 2ZJ1A 1NUQA 2EZ8A 5SY6A 4H3VA 3N53A 2A2CA 2ZE8A 3IESA 5TJ9A 1CG2A 1YR8A 4G23A 2L42A 3VJMA 1S7HA 4G2NA 3QVOA 5IVIA 3VVLA 5IWCA 3BE4A 2WT4A 3GCGA 4EBFA 4RFLA 1TLLA 2V8OA 3I3OA 3B1KA 1G8KA 3DEKA 4M1EA 5T4BA 4BP1A 4U6NA 2QRJA 4DIEA 1M2OB 5LXYA 4O4HF 1IK4A 2NXEA 1KTQA 2ZXUA 4B35A 4GYKA 3K7RA 3VU9A 4IG3B 1HI8A 1C3LA 1PP4A 1FX4A 2JFOA 4U95A 1DX9A 2R79A 1DEOA 4X71A 1LFPA 5GZ1A 1XAIA 4ARUA 1PT6A 4AL7A 3TJ9A 1RE1B 1CIVA 1GNRA 4Y9SA 4K0RA 2L48A 1QCDA 1NTRA 4PLFA 4DPWA 2FJVA 2IXBA 3LTNC 4RABA 4Q9KA 5C5EA 2D13A 3PV8A 4UXJA 2KVQE 2IS1A 5AJ3J 1I3OB 4DV2F 1GXSA 4BDPA 3M3DA 3SD7A 1RBLA 2V45A 2YZKA 2VI5A 3BGOS 3NEYA 4OK6A 2L9WA 3C14A 1R89A 4EG5A 1C0TB 2Q5LA 3IBTA 4PPGA 1KTVA 3VO2A 4JI5J 2PV0A 5GP1A 2FGJA 2E6KA 3T4UA 3DE7X 3OPNA 5A2QA 3OZEA 3W9BA 5GPBA 4ACBA 1F0NA 4EZ6A 3HI9A 2AOWA 3CUYA 3L5OA 3G2NA 1NUEA 1CETA 5LIPA 2CLIB 3KV3O 4KDRA 2ZI4A 2R7VA 3BJYA 1ZA1A 2V9PA 1FO1A 2Z4PA 2E6UX 3NGMA 4NMMA 3DFFA 4FFPA 1T9XA 4PZ9A 1SKBA 2RIPA 3WGJA 3CIMA 3QKIA 5EP2A 1QH9A 3HUFA 5AESA 4JI3J 1ONSA 2VTVA 3D5MA 1UOQA 3M8QA 3ZDZB 4J1SA 5IQQA 3Q6NA 3L93A 1IM4A 3HP4A 5ITHA 2RAVA 4AJPA 3QIPB 1G8MA 1HWUA 4FONA 3TRFA 3PNIA 2WMOB 3I1IA 5KNLA 1H8ED 2DEUA 1ZH8A 3MM6A 2L9NA 4FBUA 3SXPA 2O1EA 3MQFA 1E4EB 4PSKA 4KKOB 4IIFA 3R5DA 3T52A 2W71A 1JLMA 2IVYA 1Q1AA 3TH5A 1O4VA 4RUHA 3C2PA 2WBMA 1GQ2A 3DHYA 4K9SA 3AB4B 2BFCB 3E6AA 1SJQA 3SQMA 5KNBD 2KXHA 2PA8D 2EK6A 4K5SA 2QVYX 2G77B 4GM4A 3WB0A 1L4LA 2VS1A 3N86A 2CFSA 3DR3A 2VP3A 3D3KA 3ENKA 4BAZA 2NP6A 5EWFA 5HQJA 3KKEA 4QJIA 1QY7A 1JLQA 1L7OA 4WEQA 3A1SA 4HNRA 4M0DA 4QOGA 3ZWMA 1F8YA 3GDGA 1CUZA 3D02A 2FC8A 4LJSA 3QVWA 1R0AB 1E2EA 3VU3A 2D1QA 1USUA 1EBBA 2QLFB 3ND5A 5HROB 3QLUC 1PAUB 2XLIA 1HLPA 2UYHA 1VQMS 5KX5B 3MEGB 1CUYA 5IM5A 1I9GA 3DG9A 3ZIAD 2DULA 4F56A 3SEQA 4Z4GA 3UE2A 1KFDA 2NPOA 2RRNA 3IRUA 4OX9F 3TA2A 5TT1A 1OFGA 4BO9A 5KFCA 1SC3A 2YNIB 2AHOA 2G8NA 4IQ8A 1P1JA 3LQVA 1X8LA 1AF4A 1UZMA 2AJTA 4MAFA 4PFJA 4P7JA 3NFRA 1VC2A 3G5UA 4A6EA 4H7EA 4DU7A 3O75A 5FRDA 4KV9A 4G4SP 1CVJA 3LT1A 3TLZA 4EBDA 3HFJA 1KP3A 3IILA 4FYVA 3EMBA 4CE6A 4HGNA 2LRHA 4WTOA 1PYDA 2AOTA 5EIAA 2UP1A 3GNTA 1NVXQ 3ACDA 3FFIB 3W78A 2BGIA 2IX9A 3HLUA 2BFBA 1DOAA 2Q4TA 1FRXA 4KFCA 1ZD9A 3UZUA 3W3SA 4XUEA 1N6LA 4JVOA 2I1WA 3MIIA 3U4QB 2FW9A 4G5RA 4RC9A 1KH2A 2D1SA 4RGQA 1LUAA 4RA6A 4MK9A 3OCYA 3ZVLA 4B02A 1IOVA 3WLFA 1CHNA 4RHUA 3KG4A 3ZC3A 4RW4A 1B76A 1RZRD 1EAMA 4CCYA 4KUGA 4CG1A 2OPSB 2PFGA 2QU8A 3GDOA 3EXIB 4K0KF 2APOA 5BOVA 3L6EA 4ZOLB 2G9OA 1DWUA 1YKFA 4CEJA 1W5EA 5C35A 2JJYA 2QKYA 3PS9A 4EHDA 3HRHA 1RWOA 5GIPE 1VLZA 3PXXA 1UAGA 1C0LA 5ETSA 3M3HA 4C0WA 1KORA 5BNFA 3PX3A 1PW7A 4GO5X 1P62B 2AJQA 5I4MA 1QLNA 4GO1A 4H6PA 1GFIA 4ZTZB 2ENWA 3NAGA 2QJ3A 3SVLA 4O4JF 3RH0A 4YY3B 3EZUA 3FZYA 4M9QA 3JSXA 1Y4SA 3SDEB 2VNHA 3B36A 3SJBA 2QE6A 1UM9A 2I3GA 4KFRA 3WGKA 1G2OA 2W2MP 1XPOA 3WHKA 4TL6A 2C88A 1DLOA 3NANA 4MV5A 4F2GA 5IFMA 2O01C 1W1UA 3EDCA 3WGLA 1N9KA 4ROSA 5KT5A 2B9YA 4IKPA 2CQCA 2BL4A 1ZJJA 1N3YA 2RHTA 4X1YA 3K9WA 4ANEA 4E4RA 3C1TA 2B4YA 2X3DA 1A2BA 5KJ6A 2VSQA 4I55F 2KG0A 4AMZA 1EMDA 2IOHA 4GKBA 2CPEA 1YULA 5BQPA 2O5RA 1JLHA 1XVIA 4YJHA 3NV7A 2V3VA 4MV0A 5D4OA 2B8NA 1PEKE 3MPWA 3W5BA 1QHHB 4IDBA 5LMNB 3AB2B 1TAHA 1FRIA 1NATA 1C9DB 1Q1ZA 1Q3TA 2ZRDA 4BQEA 3CY6A 2G1KA 3R6LB 1E6VA 1COWA 2IYAA 3T0GA 2FPMA 1JECA 4RUCA 1KXZA 1N5IA 1DXQA 2QYHA 2VH7A 3KZNA 4FWBA 1WTCA 2FMXA 5BV0A 2O8CB 3H65A 2MDAA 1E94E 1NRJB 5G0RA 1CPZA 1TC2A 4DSOA 1B8VA 4L4ZA 1XRQA 4CKZA 3OTWA 5ER6A 3OZ7A 1GRCA 2ZRQA 2G6BA 1YONA 4Q7AA 2YWBA 5CEJA 3Q22A 1NIPA 4OHKA 5JD6A 2YOFA 4JEIA 4NEHB 4DX7A 1DY3A 3A58B 4EFNA 1I1NA 4FQ8A 3AR6A 1U7LA 4MUKA 1FDIA 1I6LA 2AQ8A 3DP9A 1T3GA 5CNKA 1FEHA 3HSGA 1PR1A 1V3UA 1IU9A 2XMTA 3WFIA 2AK3A 4PPZA 3IX7A 2V98A 2XUJA 2QNRA 2BEFA 3I2YX 1HNWF 1E9DA 1CJSA 2CD7A 4RWXA 2J3JA 2H1YA 5JZVA 2OV3A 4QYZJ 4TVBA 1QD1A 4AAYA 4YFVA 5DN6D 4FHZA 3J7Z5 4QPTA 1LLCA 4P4NA 1ZC4A 4MK7A 2FDCA 2GF9A 1BXGB 5EIWA 3G68A 2XCOA 1HKAA 3WFJA 4LXIA 4AUKA 3IJ5A 2YY3A 2ROEA 3I9KA 1II8A 3PHLA 3F5QA 3TQOA 2QV0A 4N5MA 3RDPA 5HVNA 4F5ZA 4HH3C 1ORTA 5DNDA 1S1VA 4DG8A 2HQBA 4D56A 1G7CB 3BRSA 3SEOA 4PYNA 1HQCA 4DKXA 2VBYA 2QLBA 4RTSA 4WDQA 4JL5A 4L6AA 1IXSB 2BHRA 4FQ7A 2XGOA 2DD8S 1CLUA 3GGPA 3WI7A 5MAOA 2EFOA 1CC1S 2Y2UA 1XMBA 3NAQA 3N8NA 5K0LA 1RRFA 5D84A 5L51A 3FFXA 3UM9A 4B5LA 2X9GA 3TPZA 4LXTA 2QZPA 4H16A 1PJ6A 4QDUA 3UGJA 4G1QA 4BX8A 4NZYA 2XCLA 1JYEA 3SS7X 1W5TA 1OZ0A 2WIBA 1AVTA 2RT3A 1GEEA 4FHFA 3CRQA 3SIPA 4KIFA 5H4HA 3VR4A 2N1MA 1E66A 2XNDA 4N82A 2QPTA 3TLXA 2OLEA 1FK9A 1EGMB 4ID3A 5I3UB 3HSKA 2R86A 4V0MA 4D7AA 1DBWA 2Y9MB 2FK7A 3PIPQ 1Q1KA 2PTGA 5ILGA 2P4SA 3O1JC 3RIYA 5C4IA 2Z2KA 5U1PA 4G1MB 1ADGA 3SLRA 4RZ2A 3I8XA 4K2XA 2Q5OA 4ECUA 5DBGA 1KYQA 5B0BA 3WGQA 2YKMB 2WRMA 3HPRA 5KOYA 4JBCA 3PP8A 2RK4A 1ZHOA 3QITA 4PTLA 2HQFA 4NZNA 2IYVA 1G3IA 3EE3A 2AI2A 2O6LA 4ZICA 3RAQA 4TPKA 5LPNA 5DEIA 4AMBA 1BQXA 3M8PA 5ECDA 1AKVA 4PCLA 5F5XA 1YBVA 3O73A 1NJXA 5DVZA 3TTUA 3IPAA 4YUZA 3CNHA 1F2GA 1GAQA 4IRDA 3R75A 2M88A 2NO7A 2IOQA 7GPBA 3V1MA 4D0NA 2BEUA 2C1EB 2W2OA 4CH1A 4BE9A 4ZD6A 3USES 2OCXA 3EUEA 1TXGA 3DO6A 2CNNA 1NI4A 1YRTA 3D59A 4EATA 2B1RA 1Y3JA 1TCUA 4XYBA 2G4BA 1GPLA 1ISGA 4Y2MA 3JALB 1G2IA 1NUHA 4ENTA 5HVHA 2JSXA 4W9NA 1YS1X 4RPHA 1IKVA 3GUUA 2GBPA 3GPDG 2Y9HA 1XEWY 1P3Y1 3M05A 4MR7B 4R9NA 2CLSA 2QENA 3UO8B 1D2EA 2CHFA 2GJSA 2HFVA 5B0FA 4EHKA 4KJIA 1H42A 3RHTA 3RJMB 3U4HA 3ESQA 4IBOA 4RS3A 1Q7YT 3VPXA 3COSA 1BA3A 4IHJA 3OFVA 4R1LA 3LT5A 1L7MA 3BFJA 3UMCA 4MQEB 3FPCA 3PQFA 2R4FA 2VPPA 2XXAA 1Z07A 1TM2A 1NJYA 2VDQB 3FFBA 2NAFA 1H05A 1RRPA 4LFCJ 1G66A 1ITPA 2OBYA 5JO0A 3OTHA 3ZZNA 3GR6A 5I9SA 1KJZA 1SUQA 1WCIA 1Y3AA 5JD3A 3J80A 4IV5A 2PIDA 4YV0A 4HB3A 3HRIA 2ZRAA 2LGJA 4Y6LA 4OZJA 5T7LB 1XXHB 4MP8A 4F5WA 5LQJA 2E7ZA 1JEYB 2C2ZB 3JSAA 4UBOA 3DBHA 1RWVB 2R1UA 4CYUA 5CH5A 4LXQA 3FWPA 5LYYA 1EGQA 1CJMA 4DBZA 2VQ6A 4BZPA 3G1UA 4CFSA 4JQOA 3ZV5A 3OOJA 5K4HA 3EPJA 4DS4A 5F8LA 4H08A 4NATA 3RUDA 3VOAA 1SM4A 1TEXA 1WXWA 4GC7A 3IV6A 4QKQA 4WN9B 1K3UB 3QWHA 4I6WA 1OXVA 3RB0A 5FWNA 1C3JA 4WA7A 2DR5A 4CL8A 3TSWA 5JXGA 4MMYB 1QANA 4ZTBA 2QG9A 3D9QX 2D5CA 3SJZA 1KJIA 2ZGVA 4G97A 3QHAA 1AN0A 1Z74A 3LXXA 4XDYA 3UBTA 1KQFB 2UZ1A 5KVQA 1UXJA 2AYZA 5LJLA 1E2IA 5C52B 1JEOA 1W9MA 3R5HA 4I46A 4FT4A 4EBEA 4G5XA 2GYWA 3ZKWB 4BPRA 4QTXA 4DR1B 5SZJA 1O08A 5FH9A 4RXMA 1T5BA 1E9AA 4MUMA 2NUPA 3PSAA 4Y0NA 4UUOA 5DRTA 4PFSA 4TU8A 4TKVA 4QGAA 2QMZA 4A03A 5IANA 1AUSL 4PLZA 5AVTA 3MMCB 3TNJA 1U0OC 1N7HA 1QFZA 2P2NA 4MIKA 1LH0A 5ITVA 2AR9A 1QAOA 1QSLA 5C5DA 3HBJA 4QFBA 1Y1RA 4FGZA 3AI7A 3KZMA 1I2CA 2JBWA 4DV0B 1S2NA 1PVOA 4QO7A 4YDHB 4X4VA 1YR3A 4O2LA 4DQKA 2RHWA 2X23A 5IN4A 2VNAA 3KHHA 3H7IA 3PFKA 1OA1A 1KZ9A 3V32A 1LWCA 5HPYB 1HYHA 2CGEA 2BJ3A 5EZYF 2YHIB 4QGFA 4F4HA 1JIKA 3IRWP 5C25A 2PD6A 3ZGOA 5G41A 3CJQA 5JE8A 3PXEA 1CJVB 3ROZA 2CVIA 4ZVQB 1Y7LA 1EG7A 1RLDA 4PQRA 4KUEA 1NVWQ 2UZ4A 3QA9A 3O8QB 4JI7J 3FE2A 1O6CA 1NYTA 1NP3A 2YCBA 4WFZA 2CMGA 5JUWA 3HSDA 4I50F 1YSJA 2HK8A 2I4TA 1F3OA 3PITA 1C8BA 5GAGI 2G6TA 3FCYA 2BPOA 2FW8A 2Q2QA 1LQ2A 1ZPDA 3A7EA 3C7AA 1M3SA 3WMXA 1GM5A 2RGEA 4L4XA 3RPEA 4H7PA 1NNEA 4RTNA 3I6MA 2YCLA 3BD8A 2C4TA 5B7WA 1XIQA 1DZIA 3TD2A 4X66F 5JAHA 4UHCA 5TC4A 2QRQA 3F5DA 3RKSA 4XWTA 4ER0A 2ZRBA 2ZRIA 1H9BA 1ZYQA 4Y6PA 3DDSA 3U1TA 2PI5A 3FOZA 2B6NA 2F1OA 3VNUA 3VNRA 3C87A 1E9VA 4IUCS 3MCUA 2ADBA 4MIYA 2CUTA 3R2JA 2XJ4A 1JBQA 1FNCA 3PC4A 3C3WA 4MO2A 1FD2A 1C3OA 2FKAA 4P81A 1FERA 3M5PA 1VI7A 4A2WA 2DPIA 1S76D 1XVLA 5DW0A 2OTLS 4GRIA 3DT6A 3KK0A 2VJKA 4KJXA 2I1QA 4LI0A 4YP3A 3I9JA 2W6NA 4ED6A 2PPLA 4IXTA 3V6LA 1A76A 4YS6A 3HHLC 1H72C 3NWBA 3H8VA 4ARZA 3U62A 5CA0A 1Y3HA 4I3GA 4ZT2A 4GX0A 2LQBA 4GOMD 4JP1A 2R5WA 4HEA9 1FJGJ 3QU5A 3CUKA 2D7SA 4Q1VA 1SHLA 3SKYA 5G4KB 3RGIA 3U7QA 4HHUA 3ZHZA 2O3QA 3B9PA 2AJDA 4OD0A 1IWOA 4WFXA 1CQXA 1VE7A 2HWUA 2WWFA 2PAFA 2FR1A 4KDEA 3M1YA 4E32A 3DAYA 1TFRA 1M5HA 4FDVA 2GSWA 3STTA 3CIOA 3GJ4A 1H65A 5FBHA 3LALA 3KUUA 3RS0A 2C99A 3DCYA 3SDSA 1PWZA 4IIXA 1XZDA 1QRTA 4G8JA 5BR8F 4U8YA 4HWKA 1IPFA 4A73A 2M6KA 4M1WA 2NO0A 1MC4A 1QGZA 2JHCA 2VZLA 3VU9B 4M7WA 3BXXA 2XTZA 5HJYA 2AYBA 3O4JA 4UBIA 1GT6A 5CDFA 3MEDA 2UKDA 1AOXA 1K8QA 1T35A 2C0PA 1FZQA 3ESCA 3B7PA 4PXBA 4IP0A 9LDTA 3FPEA 2BMBA 1JG1A 4G1CA 5FWXA 1T1SA 2W7AA 3IAFA 4NCKA 2W6ID 1Y4DE 5CGQB 2AJ2A 2AKWB 4GI5A 3H83A 3R7WA 3Q12A 4IPTA 5LR6A 2Q6TA 3BJZA 5FHRA 1DX4A 4B9NA 5E9WA 3BD7A 5K3SA 5BSTA 1LJUA 1NL3A 3P5BP 4PS0A 4DY4A 2HIHA 5CHEA 1SB6A 4PHCA 1NZDA 2W4QA 1XKQA 1GXSB 1GYPA 2Y1WA 1UVLA 4BQIA 1MG0A 1WC4A 5EMJA 3COPA 4DUYB 1NP6A 3PCRB 4PBTA 3KFXA 2H1HA 3QMQA 2QDXA 1Y8CA 4ZARA 4JJ8A 2FOLA 1SA0A 3SBXA 3KQHA 1I51B 3I45A 1R3NA 1M2EA 3CPHA 4BAUA 2HSWA 1F17A 4AJLA 4Z7CA 2FGOA 4AWXA 1EKRA 4JY7A 2HHHJ 5JJLA 4L0QA 4HDCA 2C8VA 2JKZA 1ZA1B 1P6XA 1UBCA 3KSBC 2BDUA 1L8AA 2F3JA 2OHGA 1WCXA 3M4XA 1SHUX 1JA9A 4NS4A 5A7HA 3OKPA 2AX4A 2PFSA 1C0UA 4PAOA 4K2HA 2UU9B 1RTTA 3M8QB 2GTPA 3ZD7A 2K1RA 3D7LA 4E12A 1C9KA 4C1BA 2JRCA 4CT4B 1YK9A 4RL1A 3VVMA 5KDOA 4JB3A 4Q47A 4HMPA 4OXYA 2J07A 3E4DA 3MM6B 1A50B 4JUZA 4HVAA 4ZK7M 3KHRA 4Q19A 1NMEA 4PABA 2OB2A 3RJ9A 3NO4A 3CVXA 1D6MA 2DHAA 3Q2KA 1U3GA 4EOGA 3H59A 1IM6A 1KEUA 3ADCA 5J2MA 4IFTA 3L4KA 1QAQA 1WWKA 2BTQA 1T9CA 2Z8ZA 5A4KA 5D6OA 3IE0A 4ZITA 3LW7A 1GY8A 3BBCA 2EC5A 2AF3C 3TIFA 3IP7A 4Q16A 2FK8A 1JLQB 2W6PA 4EA8A 1KVUA 1UBRS 2YYYA 4KSYA 4KE7A 2KL8A 2OMOA 5KTNA 4BN4A 2A9RA 2X4GA 3Q8RB 2O8NA 3WP1B 1JLBA 1Q17A 1TA0A 4OQFA 1RT6A 1DXHA 2DC1A 1TM1E 3O90A 2WU8A 1X8JA 3IUPA 3HXQA 1EG2A 3GLUA 4DLKA 2AG8A 4YRKA 2MHCA 1RBAA 2EBUA 3N8KA 5HS6A 3QU4A 2ZAOA 1RPNA 4Q7EA 1FBTA 1Z06A 3N3BC 5EEGA 1RT7A 2EIHA 2HHXA 1SC3B 2ASDA 2FEKA 2UDPA 2AHOB 2ACVA 4K6CA 5BSMA 4QBGB 3ZD8A 1JZQA 4Q82A 3WA6A 3EVMA 2JK0A 3RTAA 3G86A 5LQDA 3W04A 3PUKA 2Q29A 4QWMA 5ALXA 4WTOB 5FL7D 2XX3A 2AOTB 5HZHA 4OQMA 3GPIA 1VK8A 4BN5A 4OL9A 3H13A 2YNFA 1G8JA 2BFBB 2QN2A 4IH4A 5B0GA 1G5PA 4CEIA 1S9FA 4ZT5A 1PDVA 1SVSA 1E6MA 2FEAA 1D9DA 4CLRB 2ASJA 5ETPA 4O1IA 5KNCD 1E96A 3UDEA 4RA6B 1P80A 5KFWA 1V8FA 4NY1A 3L02A 2ORVA 1SUFA 2WK1A 3LWLA 4M99A 2GYYA 1PJLA 4RW4B 2PWPA 3AHPA 1ZNXA 3ANSA 2YICA 4CCYB 4P10A 5JS7A 2R47A 1RM5A 1EJ2A 4DWIA 1TL7C 1ZN9A 1IYZA 5EE5B 2QY9A 3FAZA 4ZI5A 4CEJB 3RHZA 2MZTA 2V6IA 1FF9A 1RQGA 1Y9EA 4DCTA 1OWNA 5DGCA 3W5XA 1UPBA 1RWOB 5F3TA 1XZHA 2X0NA 2QZ8A 1TCBA 3H9BA 3A31A 1UBOS 2AYYA 4CKYA 4KDCA 1T6NA 3A4LA 5D0RA 1JF8A 2IXFA 2C5EA 3PTAA 1XZKA 1SIOA 2DCMA 5KT3A 3AFNA 3SICE 1NMYA 1ULBA 3O5AA 1VJWA 1HA1A 1DV1A 4XM0A 2R48A 3O8NA 4Y6RA 5K5MA 3U7GA 3WLEA 1UM9B 3W2HA 1M2GA 4IGAA 5B3KA 1UBUS 4KGXA 3GG0A 1SG0A 2OTJS 4DIUA 1DLOB 2RILA 2Q62A 4RV9A 3JXEA 3IL2A 4UUAA 1W19A 3ILVA 4MHSA 5K8PA 3K2EA 1K4YA 4Q0BA 3ETMA 1U3WA 5CD1A 2FF5A 1QSSA 4TVAB 4LW8A 5K8JB 3WLRA 4NA1A 5CFNA 2A3RA 4JI0B 2BBEA 2J33A 1E5QA 3F9CA 3V3KA 1YU9A 5A3VA 1VQLS 4A9AA 4XGRA 2EKPA 2MSSA 2H54A 2E5GA 2UXCB 3IM9A 3RVKA 2NZWA 3UICA 3AVUA 9LDBA 4YJHB 3QXGA 1B93A 3HABA 4OOFA 1SPBP 1R37A 1NIJA 3T1YB 3Q11A 4RPKA 4KY3A 1EJ6A 4PAWA 2CV2A 4OZ0A 5BRAA 5ETQA 2HADA 2X5XA 2ZR8A 1E6VB 3G5AA 1W48A 5HJXA 3WTBA 1K7YA 3F3SA 4LISA 3FNRA 2J59A 3ER6A 2B56A 4R1QA 4A2CA 1NPKA 4AYBD 1YTUA 3FDIA 4PHGA 1KP6A 4BP8A 5G0RB 1S0NA 1ISIA 1N5LA 2XMWA 3SX4A 4BWFB 4OQYA 2W6JD 3CH5A 3WNCA 4CKCA 3E35A 3RROA 4D3ZA 1B7GO 5EGSA 4BMCA 1TPYA 3FBBA 1E2HA 3LA0A 3TQSA 3V7UA 3WGOA 4GQBA 4NH4A 1YG0A 1SZJG 4LDZA 4L5YA 1VYUA 3T6KA 5JFOA 2GHRA 3ASZA 2XE8A 2VC0A 1ZONA 1IUKA 2R7NA 2W0SA 3O84A 3RC7A 2RQ4A 3JRNA 2ZIAA 3MJRA 3WKDA 2ATXA 1M6WA 2I2BA 4DQXA 4I1VA 1RU1A 1LW0B 1EIZA 3VZDA 3B6BA 1GTVA 1AZTA 3GMIA 3M5WA 1QPGA 3ZHSA 3W61A 3IQHX 2QA5A 1KD1T 2P1DA 1Q21A 1HI9A 1JQJC 2WBRA 2HJSA 2Y1CA 5F78A 1V26A 4KFTA 5AM3A 1ABEA 1RJFA 4F9TA 2EC0A 3NTVA 2JEJA 3SCJE 1YB4A 2PXCA 2OHXA 3PFIA 2KWIA 2CVOA 4LZLA 2IUSA 4DNXA 3LF2A 4BVKA 2Z95A 4G5QA 3KHTA 2I2FA 1CUXA 1SXQA 2YWWA 1JA0A 2QSYA 1KH3A 3H5XA 2XGMA 5JCJD 1II8B 2HH9A 4R51A 3B1FA 1Y5IA 1CEQA 3TA1A 2ZAYA 3BAFA 1PBNA 3T9EA 2MZ1A 4ZGWA 3FMIA 3TOZA 3U1MA 5ADZA 1S1VB 2P79A 3ZI4A 4I5IA 2VT7A 4CDGA 1JDJA 5T6BA 4FFRA 1M2WA 2AN9A 1YACA 5EJ9A 2QLBB 4ESEA 4ER8A 2FGCA 2QP9X 4EJ6A 5E1BA 2FN3A 1T1JA 3P0EA 5H3CA 5KWEA 3MCZA 2Z8YM 5CCBA 1UPTA 5AW0A 2JLCA 1ZM9A 1DQSA 1ZMTA 4F1JA 2OKCA 2YINC 3AILA 4DJBA 3QX3A 3G23A 4G1QB 1O96A 3QYPA 4CMKA 3TVDA 2WJYA 1YJQA 3K8WA 2YTCA 4LJ9A 3BWDD 3SIPB 2IOFA 2R66A 1RISA 2R2SA 2R8YA 4E15A 1M0WA 1SVDA 1B99A 2EU8A 2WKRA 2D5AA 2M2BA 2B4OA 1FK9B 1ZOTA 1MH1A 4LVUA 1F6DA 3GC6A 2GA8A 1H2VZ 2INGX 3OEED 2O8EB 3U4DA 3LSTA 3TEFA 1M0EA 1YZ6A 4Q12A 3LP2A 1NZJA 1ODJA 4JI1F 2VJNA 3U39A 2HO4A 5L6MB 1KP9A 5LOVA 4K9RA 4ZVVA 2XCUA 2V96A 1DQZA 2FPXA 4P86A 4L3VA 3F3MA 3R40A 1IQPA 3V1TC 3TOSA 3UJ3X 1MBZA 4IG0A 3ZZPA 2CCKA 1VLYA 3KLNA 5F2NA 2GASA 2XVYA 3ZI7A 3DRXA 1HXHA 4KDFA 2VL1A 2BVZA 5D8HB 3DXYA 4WYWA 1SXJE 3O3CA 4KK4A 2QTVA 4NVRA 3JS5A 3M8PB 3PEVA 3G7UA 1F0YA 5F5LA 2B4KA 4WV3A 2APJA 5LIRA 2Y0SD 3NRCA 4DQIA 2ZYDA 4AT1A 1X60A 1II0A 2G72A 1G17A 3M6FA 4ECEA 3ZDEA 4CMEC 2BW2A 1Z6XA 3HB1A 4RK0A 4MCJA 2BEUB 3RS4A 1AKNA 1YMUA 3COVA 4LEIA 2JFVA 5CDHA 2CNNB 1IEXA 1G21B 1NI4B 4Q4HA 4Q1EA 3I32A 5BT8A 2XMSA 1FTSA 1HNZB 1ITZA 3CRMA 2ODQA 2QX6A 3KDOA 2EQBA 1L7QA 1Q0LA 5HA5A 1N78A 1DO0A 3OBIA 1QZXA 1IKVB 2HHVA 2N42A 2BGMA 2D3OR 2G76A 3LYAA 3NFYA 1ICEA 5I8PA 1THTA 1U6JA 1WF1A 1IN7A 2O19A 3CLHA 3SK0A 4NLVA 4IHJB 4J3NA 4B32A 1VRUA 3T95A 5AJTA 3SFVA 2AZMA 5MFPA 4JYAF 3KQOA 2XXAB 3EF3A 2CIMA 4DMFA 4NEQA 1RXSA 1UPPA 1YQEA 2Y6UA 2FJ0A 1SUQB 1PG2A 1CY0A 4XWOA 1WCIB 4IYRA 1P9LA 1D9FA 4Y2RA 3BIWA 1SHTX 4G1PA 4XD7A 3MMAA 3DBHB 1JLEA 4CYUB 1N1MA 4D9NA 4QTYA 2PJRA 1OFUX 2HVIA 4M1SA 1U48A 2I55A 1EFUA 3TRIA 1KOFA 3LUCA 4M9ZA 4G4IA 5L46A 2JEYA 3QM1A 4ZN3A 1Z2LA 3QI2A 2YDYA 4TT3D 2I6UA 5A7FA 1RBQA 2YVAA 5I7OA 2EG2A 4EGLA 2JJMA 3Q9NA 4D8WA 3PD0A 4IZIA 3JQMA 2Z3VA 4QG3A 2QG9B 1CZHA 5EN1A 1L5WA 2UXDB 2QL9B 3W9HA 2FE4A 1S6OA 1LU9A 2ZVDA 3SYNA 1TUGB 3FCEA 3RI3A 4AZ0A 2IS4A 3BHMA 2UZ1B 1PIWA 2JZCA 2GJ4A 4N41A 2PIAA 2VHWA 3NIGB 1UEUA 1IPHA 3OPKA 1XO1A 4HLNA 3CCMS 4IH1A 3EEBA 3I4LA 1H0HB 1DQRA 2VDOB 4YCAA 2CWDA 5A0YA 1BGWA 1YR9A 1SVNA 4RKQA 1BKSB 5IUNC 1TYBE 1RZUA 2NUPB 4IQGA 2P3LA 3L95X 4DCCA 4TKVB 2VIHA 3SIWA 4UAGA 1VQOS 4ERNA 4MTPA 1JWWA 3Q6IA 3PGJA 3HXKA 3V00A 1Z39A 3SU8A 1Y1TA 1JB1A 2PBLA 3K2QA 3KLHA 3CIFA 4JLUA 4E1AA 1N5KA 4NV0A 2PI4A 1PK9A 2BLLA 1W8IA 4ODIA 1MTZA 3QHPA 5F2OA 5KG6A 3NG8A 2L2QA 3KKNA 2YY7A 2F3PA 3V8VA 4ZGGA 3PPIA 4MJ7A 4RZUA 3JAMY 1EJBA 5FOTA 4MIWA 3AUYA 1NK5A 3KSRA 1XPRA 3ZH2A 2ZM6F 4LFAJ 3K2YA 3IE2A 2QSFA 4KR6A 4FYMA 3CVVA 5J1EA 5FLXU 2XO6A 1LWCB 3GNQA 4JT8A 4P7FA 1V3TA 2ONZA 1MB9A 4BNMA 2PV7A 1R0ZA 3MM9A 2WAAA 2B98A 5C25B 2CPFA 4DOZA 1IBMB 2CPYA 1E1DA 3OQNA 4P3YA 3RK4A 5C5JA 1PWEA 2J76E 2XGSA 3OZXA 1YQHA 4FGWA 3RT9A 1FTYA 4RF3A 4O3RA 2GUWA 3R3TA 4CG3A 1QX4A 2AXPA 3NB0A 3REFA 2PRJA 2J0WA 4LZZA 2IYEA 4QDZA 2WF6A 3DTNA 4UD6A 2QP3A 3Q2IA 1EFVA 1B6SA 5HDBB 3GLHE 1TK8A 4QL3A 4Z49A 3DHNA 1D4FA 4YECA 3RTGA 1BE0A 1KE2A 2SHKA 4NCBA 2AW0A 3EZNA 3ZTRA 3K1JA 5AUOB 3UXHA 3C45A 1G9SA 4I1TA 4BVBA 4QR2A 3ND9A 2YBDA 3VNQA 1XZPA 3TXYA 1PFWA 3LI2A 3F73A 1VYVA 2P9TA 3H5RA 2W7PA 4JV2A 1M2HA 2OELA 4Z86A 3RVOA 4QSMA 2JS7A 3L0SA 4CT9A 4E08A 4CO1A 3C6ZA 3LLMA 4LGVA 3D5EA 1ACLA 3AVOA 3CULA 1EQUA 2HV9A 2UZIR 4IDHA 2Q1SA 3E9QA 4YNBA 1VHFA 4KO8A 3UYKA 5E9AA 5LMZA 1QF6A 1S6PA 3HFRA 2ORYA 4H1HA 4D3XA 1N34J 3OLWA 3ELBA 4DMZA 3RFUA 4WPAA 2W70A 2H31A 1RFLA 1RC0A 2R8PA 2BEJA 1MDFA 1YJBA 3N5BA 5KTOA 3HH8A 1NDPA 3RK1A 1GKKA 4HZGA 3R9LA 4ARZB 3RBDA 5CA0B 1NDKA 3ZOKA 2NS1B 4CRWB 1RLCL 2V4QA 3AFIA 3W9JA 1RLMA 5FL3A 3ZQJA 5L9NA 3KTOA 5JC8A 1E64A 2W7TA 1T4GA 3IC5A 3QOWA 2ACKA 3E7DA 1YI8A 2ZEJA 3U7QB 3BSNA 1X38A 4HPWA 2UXBJ 3AB7A 3V9AA 5C81A 5KTTA 5HO4A 3IA0A 5ELLA 2OHOA 3C41J 3KFLA 4RKYA 2C5GA 3PKIA 3FCCA 4YONB 3ONEA 4A82A 3IBSA 4JKYA 5I9BA 4BMYA 4PSUA 5ITSA 1FRLA 4CLWA 1ZU4A 3MGCA 2MLZA 3M32A 3PC7A 2AMYA 3V2UC 4OLHA 4QQ8A 2R1VA 3RAEC 1RC8A 4H7IA 1JI3A 1JJFA 1FYXA 1OY9A 2DCLA 1LVHA 1B0PA 4HWTA 2XY5A 3VOSA 4TMFA 2PQ2A 4OLPA 2IU6A 4UVEA 3PX7A 1G8YA 4C2TA 3QBTA 4WH0A 1BXRA 3PNVA 1DRUA 2Z2XA 3EVAA 2O0JA 3MA0A 3OICA 3Q10A 3AY3A 2O0MA 1QVZA 3QFHA 1MEJA 1RWKA 4BJ1A 4BLSA 3WKBA 2EJWA 5FWXB 4RMJA 5C46F 3WJ2A 4OX6A 3V1KA 4DDTA 2HFNA 4BC0A 5FBVB 1PL6A 3QPIA 1FYDA 3FWZA 3R7WB 1NVVQ 3AR5A 3ER8A 1FWPA 4I6GA 3W9YA 1FTWA 5I3QA 5GJWC 5F21A 1HYSA 4GQIA 4K4ZA 3EIWA 3PHHA 1IL0A 4I4BA 1VYTA 1KSJA 3EDRA 2XWPA 4M8KA 4LREA 3EGEA 3E2PA 1Z7EA 1VB3A 4W99A 3MRTA 3DL4A 4Q02A 4B7UA 2ZB4A 3N0RA 4G1UC 3CF4G 1EXMA 3KOMA 4OYRA 1H2YA 1Q19A 1ICIA 3FPFA 4NQZA 4OYIA 2FW6A 3EM1A 4ENRA 5AW3A 3IOEA 1F1BA 1SA0B 1H2TZ 5MFZA 4O23A 3AFHA 1B16A 4ECRA 5GGYA 5JBNA 1R16A 3LPYA 4DLRA 2HUPA 3CRW1 3WICA 4ALZA 2BIFA 1VHJA 2V2KA 2YXEA 3HN6A 2ZPUA 4KHMA 2UVPA 4AU1A 4CM6A 3SFUA 1ESDA 3TZQA 4BVFA 4E22A 3VDRA 3LRTA 1HWIA 3HB0A 4GR4A 1AU9A 3DXZA 4WLOA 3TNDA 2I38A 2UZAA 3I2JA 1MQ9A 1ZGCA 1WF0A 4UHDA 2AMVA 4H27A 3MUVP 3K6RA 2E0IA 2FJXA 4AZWA 3FRZA 4A6PA 3RAFC 1WR8A 1E7WA 2ZD1A 5H1SV 1JKHA 1RLUA 3ZTSA 3CCCA 3TX8A 1C0UB 2CUYA 5CQGA 4IO0A 3VHRA 2X1AA 1F5AA 3M81A 2LVBA 4F5YA 4IWNA 3UUGA 2BKPA 3HB7A 1GFSA 2JLGA 2K1RB 2HGSA 1LLQA 2RKOA 5A2GA 3JQBC 1L7RA 3P5TL 4XDHA 2DBZA 4TSRA 3SZMA 4L9SA 4AJOA 5P21A 1Z3CA 4U7GA 5DBFA 1U6IA 2WHEA 4HDAA 3L7LA 3UPUA 4CIAA 4X62F 2GAAA 2VDRB 4DJDC 1KIAA 2VEOA 1NXPA 6ADHA 1ND6A 5H9FJ 1NMEB 2CXRA 5HE8A 4JSRA 2XUAA 3K5HA 4GE3A 3FHJA 3IMQJ 2ZRHA 4N5HX 1R3DA 3QQPA 4D4LA 3RG2A 5C51B 4M94A 1UKYA 4OUKX 1B42A 1HQKA 1DEXA 1Q7RA 2FWAA 2G80A 5J2MB 5LJ5Y 1O89A 5FUWA 4Z2YA 1KY2A 1CJBA 3G8TA 1EKXA 1QAIA 2BTQB 1L6RA 3JAMA 3P2KA 4MPPA 1H6CA 3HNPA 1A8QA 1M2FA 1IMJA 3QXHA 4DSJA 4V39A 4NXNB 1L4GA 5A1TA 1B0TA 1SUAA 1PT5A 3H6KA 4QU8A 4KW7A 3U1VA 2PUCA 1KHVA 3ZV6A 3V1NA 1KS9A 1CUIA 2D7DA 1JXAA 1JLBB 3PDNA 1RT6B 3IUEA 3H2VE 2ENUA 3MSXA 5L8VA 1CJVC 1MA3A 1M8FA 5JC1A 1U3TA 5A8WA 1U65A 1JMKC 3UR3C 3OJCA 4JHLA 1AQ6A 4F4CA 1LTHR 3O95A 1J33A 4K8OA 2Q6CA 4Q1CA 1CY8A 1L5UA 1QKJA 2HMUA 1ZCAA 4WFAQ 5CGZA 5DEOA 5EJ7A 1RT7B 3AUAA 5F4ZA 2WTMA 2GNOA 2WKQA 4J9QA 1NH8A 3VZQA 3TVTA 2P6RA 4Z9FA 5K8IA 2HXYA 2ZUFA 4B7ZA 1Z7WA 5ALOA 3QEMA 5B09A 2ZB3A 4NI5A 3KXDA 5A5GA 3F7NA 1VQ4S 5IEBA 3T0FA 1XDWA 4N0DA 1A9OA 4XGIA 3KQKA 4G5SA 1GPAA 4XVUA 1ZCJA 3F49S 1IXZA 3M8KA 4A8HA 2X13A 2IJRA 5G1NA 2XI3A 2BFFA 4G63A 3WMGA 4MVJD 4WKNA 3AHCA 3LZDA 3IBGA 3GW8A 1UWLA 2ZJZA 3BGSA 1G8SA 3F6CA 1EI9A 1EFKA 2YNFB 4B09A 2E5LF 4LBVA 4ANDA 4LY3A 2EAUA 4CEIB 2CZQA 2YWCA 1LEHA 1U4SA 4R1TA 3ZU6A 3VYUB 3GF4A 4JB2A 2FWPA 3GELA 2LQJA 5B08A 5EVCA 3O31A 4K1LA 1JL3A 1Z2EA 4PYQA 3FJ2A 3J80Y 2G5TA 4UQGA 2IVZA 5GOTA 4IJ5A 3P4XA 3ZFVA 4C0KA 1TEVA 3E84A 3G5TA 3M2VA 4FS2A 1O95A 3CKKA 1X92A 3INGA 2O2GA 3UTDA 4RH1A 3AOCA 3UGQA 1XOIA 1AS2A 2YRXA 4MWEA 3KKZA 4IF6A 3OTCA 5DULA 4LFBF 4PC1A 3KDSE 2UUTA 5HWSA 1TO2E 3BRQA 3VR6D 5KFOA 5CYPA 2FKNA 1DFDA 3FUXA 3SQDA 5BXYA 4EF5A 4P2MA 5L4LA 2CLDX 3Q2SC 2YBVA 5HOEA 4IXWA 4KO3S 1MT0A 4CL0A 5EI5A 1HR0B 3QRRA 4DUZF 5TQJA 5SYMA 2GOYA 1K97A 3UNGC 4NYIR 3ELHA 4KITB 3BERA 4NBTA 4KGXB 4FCWA 3NTRA 3IAUA 2W2XA 3C5WP 4Q0BB 3CE8A 2GBLA 3AXSA 1HG1A 4N56A 2AFHA 1IWGA 1ECFA 2R9LA 4C7MA 3L6CA 4NLLA 2WAOA 1ZM2A 4GXRA 4AJ9A 3GVIA 3ZEAA 1WCWA 3T1HJ 2OSBA 2VQSA 2G07A 5M2QA 3I9V9 5K6RA 4PRKA 4JI4F 3OEWA 1D5WA 4U5XA 5DDRC 3K92A 3TZKA 1NSFA 3A1TA 3T4PA 4KN8A 5KYVA 5CX1A 2YVUA 4E09A 2WNHA 3CO5A 1EFLA 3R9KA 4AJEA 4NP6A 2ZWMA 3LPLA 1QORA 2YQ0A 2P6MA 4JQYA 4PLVA 3TQRA 2W9CA 4LNHA 4CJXA 1DE0A 2PX4A 4QRHA 2XZOA 1T6YA 1YTYA 1L5MA 1N6OA 2BY4A 2EC2A 1WPGA 2XMDA 4PAAA 3A8JA 2EV9A 3EF1A 1GAXA 3G13A 1Y3KA 3I37X 4DV1F 1XF1A 4GVBA 3Q7TA 3WJ1A 2EDAA 3GXBA 4CKCB 2RGDA 3GU3A 2YIMA 1QB7A 5CFZA 1GUBA 3RU3A 4AN4A 1EFAA 4QO8A 2DERA 4S3MA 1L5SA 3QHQA 2XZPA 3D3WA 3K8OE 4LAFA 5A7GA 5IWAB 1UXKA 1G5TA 2WFMA 1I4EB 4X64F 5HKAA 3H1TA 3LPDA 2NTVA 1FZTA 1DGQA 2C4MA 4MPDA 1ENZA 1ZGJA 1V1JA 3UWDA 4NBWA 1DRZA 4QUJA 4GPD1 2Y1JA 2HSEA 4YCMA 1HQEA 1VKRA 4TM8A 5HYVA 5E3HA 4EGCB 4OG2A 1NUTA 3IA2A 1BVYF 5DLDA 5CNJA 3QVMA 3VSCA 2DLDA 3K0HA 3ANYB 2OHVA 4FS3A 1I30A 4MUAA 1TKBA 1U8UA 4BWYA 1X1EA 1CS0A 1KONA 3DM2A 3O0TA 3HFZB 1D0SA 2KRRA 5FCDA 1PJAA 4N8DA 1Y5IB 1HQDA 1M5VC 1CQWA 1UEXC 2QD3A 4OHOA 1I7PA 3R8CA 3NAIA 3AEKA 1WACA 1ZHFA 4ASUA 4DOMA 4UNNA 4WLVA 3QGMA 3ZXIA 4B31A 1F0PA 2SKDA 4IFIA 3HU3A 1W52X 3D1OA 1M67A 3N6RA 5D6GA 3V80A 2XUDA 5ETOA 4C05A 4M9XA 2PA0A 1QR6A 1Z08A 4KQJA 1DEAA 3OU2A 1BAPA 2OXTA 2J4FA 5AVVA 2OZVA 3CVWA 3MAJA 4WY5A 2P9BA 3GIDA 5BV7A 4IQFA 5CVJA 1TC1A 1VYAA 4DSKA 1ZR2A 2PUAA 5AMXA 4MKAA 4DC0A 1Q44A 4DR7F 3BG5A 5ALNA 1TD1A 1O96B 2GQ2A 1V25A 1IHPA 1NK4A 2W4MA 3MPOA 2XCRB 3PZBA 2C5AA 3LX5A 2KVIA 1U5CA 3A70A 5JNLA 1XZFA 5LU8A 3MYYA 4OA8A 3GRCA 5TARA 4DQSA 1J20A 1YITS 1GP2A 4PEVA 3GX1A 2QEQA 4LBPA 1L3IA 3OZCA 4CIVA 1ID1A 4ISCA 3BX1A 5LJIA 4FN5A 2WHQA 3LP2B 4OUDA 3I30X 4OQLA 1GU0A 1J2TA 5LOVB 1MJ5A 4LF9B 4NZMA 4XB6B 1WPRA 2R7MA 5JATA 4NZOA 1R2QA 2O9JA 4Y9UA 3LQYA 3K59A 4IG0B 3EIUA 5FWYA 2RDJA 5BSGA 3ITEA 4JV5J 1NULA 5KFIA 3JW8A 1S1UA 5ECYA 1G3RA 3T5HA 4KBYA 5CB4F 4B3SJ 2A4KA 2O23A 2QTVB 4GPBA 1K86A 3SJUA 3O1HB 1K0UA 4A3SA 3TOCA 3NNAA 2ODTX 1SPXA 1MAVA 4IDDA 2OBLA 2HSDA 3VPDA 4PZLA 4B83A 4AT1B 1ZISA 3O2NA 1U99A 4GIBA 4DBLC 2N47A 5HF9A 4DV3J 4DZTA 3H9JA 1N33B 1SIZA 3ZZTA 1PR4A 1AUXA 3TVZA 5BV1A 3MLAA 1B43A 4UHEA 3T7KA 2IL1A 1PSDA 3S2GA 3PL1A 1SQFA 3LO5A 3FN4A 3T7AA 3DZCA 1R88A 4DWVA 2A6PA 2V34A 1SBCA 4RHTA 3E1KA 1BRTA 4Q4HB 4N9QA 2YW2A 4XSVA 3SX2A 4BB5A 3M5DA 3H0EA 1R0BA 3QJ5A 1L5HA 4V0NA 1UCFA 4BMZA 2PA3A 1UPMB 5TMBA 2WJZB 1NTOA 4MTLA 3B9RA 2JJ4D 3TRHA 3OX1A 1LBIA 9ATCA 1ICEB 1B74A 2VJLA 4IIVA 2YKGA 5E9JA 2X9VA 1QCYA 3OZTA 1SVKA 3NHKA 3PNOA 5J9FA 2LUOA 1GLGA 4ZALA 5AYVA 1VRUB 5BN5A 5I3ZA 3IXLA 4BZWA 4RBUA 4UY85 1YOBA 4BUZA 5CB0A 2D3UA 3IAS1 4FW9A 1SK8A 1S79A 1E2LA 5FAXA 2FZWA 3TWOA 4ZTUB 1XTUA 3G2PA 2W98A 5CA1A 4RM2A 1L1EA 3K35A 4PQYA 4DPXA 4GH5A 2K6GA 4LSZA 2O57A 4ZZ0A 2SKEA 5J4LA 3KJQB 4ND3A 3KPWA 4WZ6A 3U56A 1PGQA 3W5YA 3AHFA 3MMAB 4UU1A 1YMVA 1JB9A 2JAXA 2PMEA 2Q3HA 1JLEB 2VZ8A 1SY7A 4IFEA 1FKOA 2EYQA 5KFPA 2R6CA 5A2QU 1PI3A 2V5AA 4UEWA 3OF5A 1SJ3P 1EK1A 4B6OA 1VLQA 5LA6A 3PICA 1X7VA 1FDNA 2CDQA 4A0RA 1UXOA 2UUAF 4U7FA 2BANA 1ZAKA 2KZMA 4MKHA 2MPUA 4DV5B 2XSFA 1Q95A 4LF2A 3ER9A 1J7KA 1BXNA 2X8JB 3T5DA 4MWDA 1O7JA 1ZWKA 4FYYA 4MB0A 2HNKA 3DFUA 4NABA 3DRSA 3OL7A 3N5CA 4JX8A 1NJIT 2QQGA 1E7SA 3OZIA 1NMSA 3KQPA 4I08A 2F65A 2Y99A 4FNGA 5G3ZA 1T10A 4CWAA 3T5CA 1WEZA 2PO4A 2GHWA 4AZ0B 4K9LA 4ZXPA 2Q3BA 1B3RA 2WQZA 1UCNA 3CX8A 4JI8J 2ZPAA 2WWTA 4YUYA 1R9GA 1TO1E 5EE3A 1FBNA 2PY6A 4FMCB 4UAJA 1XEAA 3QE2A 2JGFA 2HOQA 4ARIA 4AB1A 2HFOA 2DISA 1P1KA 4JEMA 3KQQA 3U40A 2Q3JA 1B0VA 3FAKA 3L7AA 1Q1BA 4YH1A 3WB9A 5B4VA 4CL3A 1I5RA 4JXZA 1FX1A 4WK3A 3KLHB 4YDRA 2CJYA 1UKEA 4RW0A 3CEDA 1P60A 4YROA 1OHHA 4AP5A 1VKOA 2VNKA 5JIBA 3EQ8A 4UMDA 5J2TF 5AW8A 1XYVA 1MN6A 4DSAA 2VFVA 2FLLA 4ZVHA 4D3YA 4ID9A 1E6UA 3S2FA 1P77A 4HRYA 2P7HA 4B3MB 4CT5A 2PFFB 4OHYA 4UW2A 4DR3B 4TWZA 3P45A 4UU0A 1TJNA 2AJCA 5DF1A 2X77A 1JLFB 3A3NA 3QA3E 1X7XA 2RJ3A 3Q3CA 5CXQA 5EZQA 1RAAA 3MFHA 3OM8A 4RIIA 1FIUA 1Z6YA 2W48A 3T5JA 5J1EB 1HNXJ 3ZJVA 1BXZA 1C4WA 3K1YA 4G9GA 5DP2A 1IUNA 1I4OA 5EESA 4DX6A 3MM9B 3UN1A 5MF6A 1DB3A 1ZVMA 1BE6A 1K5DA 5FT9A 3PR1A 2QT1A 2DJ5A 1OZAA 1A8PA 2BF4A 4PVDA 3TEGA 1PHRA 5TX7A 2IM0A 1SBTA 1F51E 4FYIA 1N2OA 1EHIA 2QVGA 3S55A 2GZOA 3PKYA 1EFVB 2R62A 2PRZA 4RNCA 2CZGA 3HZGA 5CDTA 2QE7D 2VQEF 2XYPA 1LS1A 5AW2A 5D3ZA 5GAEU 1OYVA 4AL4A