1XTZA

Crystal structure of the s. cerevisiae d-ribose-5-phosphate isomerase: comparison with the archeal and bacterial enzymes
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
246
structure length
246
Chain Sequence
EDAKRAAAYRAVDENLKFDDHKIIGIGSGSTVVYVAERIGQYLHDPKFYEVASKFICIPTGFQSRNLILDNKLQLGSIEQYPRIDIAFDGADEVDENLQLIKGGGACLFQEKLVSTSAKTFIVVADSRKKSPKHLGKNWRQGVPIEIVPSSYVRVKNDLLEQLHAEKVDIRQGGSAKAGPVVTDNNNFIIDADFGEISDPRKLHREIKLLVGVVETGLFIDNASKAYFGNSDGSVEVTEKHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the S. cerevisiae D-ribose-5-phosphate isomerase: comparison with the archaeal and bacterial enzymes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
molecule keywords Ribose-5-phosphate isomerase
total genus 77
structure length 246
sequence length 246
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2004-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xtzA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xtzA01
2QMXA 1LKZA 1YBAA 3IXQA 4NMLA 2DT9A 4L50A 2JOQA 1M0SA 4OQPA 2MDAA 3DHWC 3U7JA 2JHEA 2LQJA 3AAWB 1LK5A 3ICOA 3OBIA 3O1LA 2P9GA 3LWDA 3KWMA 5JJBA 4L4ZA 1KS2A 3E7FA 3BXGA 5IT4A 3TUIC 4TM8A 3CSSA 3BXEA 3HN6A 1JT9A 2PC6A 2LVWA 4GO7X 5HJ5A 2J0XA 2NYIA 1Y7PA 2ZHOA 4GO5X 3TUJC 5IT0A 2F1FA 2P9CA 4X84A 4M8LA 3E15A 4L4YA 3OC6A 3MAHA 3IBWA 3AB4B 2FGCA 1FS6A 1VL1A 1U8SA 2BKVA 3CEDA 2H9ZA 3TUZC 1O8BA 1UJ4A 3NWPA 4GO1A 2RE1A 2GNPA 1XTZA 2J0WA 2P9EA 2QRRA 1DEAA 4R7TA 1PSDA 3OFFA 1NE7A 4OQQA 3CH7A 1FSFA 4IO1A 3EFBA 3LHIA 2RQMA 3P96A 1YGYA 3DC2A 2DTJA 5FIIA 1PBTA 3OFEA 2QSWA 2RI0A 4GMKA 3OFGA 2RI1A 4L51A 1HORA 3L7OA 3DDNA 4L5IA 3TX2A 3ENQA 2KO1A 2O0MA 2RQKA 2I9SA 4LUBA 3LOUA 3MWBA 2PA3A 4PWUA 2J0EA 2WU1A 4R9NA 1FRZA 3S1TA 3EB9A 3MTJA 2BKXA 3KV1A 4TM7A 3DHXA 1UJ5A 3N0VA 1Y89A 3BXFA 5T41A 4L5JA 1ZPVA 3HHEA 3W7BA 1UJ6A 3NZEA 3K5PA 1LK7A 3OFHA 1SC6A 2QMWA 3UW1A 3BXHA 2R5FA 3AB2B 1FS5A 1RWUA 3NRBA 3ENWA 2W48A 5IS2A 2CDQA 2F8MA 1CD5A 1FQOA 3ENVA 3LUYA 1HOTA 2OKGA
chains in the Genus database with same CATH superfamily
2DLDA 3NDBB 2HHHF 4PFSA 2BY4A 4YTEA 4BRUA 1H38A 2UXDB 2OSQA 4RELA 3LH5A 5K3SA 3INYA 3AOEC 3K4HA 1MIOA 1WO8A 3MFIA 1GPMA 3KWFA 2V7WA 3FBTA 2BF7A 2ZBDA 2W2LA 5ENVA 3O8WA 2WT4A 5KFHA 1M5HA 2LYVA 3MWLA 3QWFA 3D0OA 4PLTA 1X1QA 2F3TA 3WRXC 2PHZA 2WP8J 3HWX1 1EK5A 1N5JA 1IR0A 2VBIA 1WEYA 2VJMB 2K1RB 2PAFA 5ALMA 2JGEA 4MP8A 5B58T 1Y1TA 4G6ZA 4REMA 2AVDA 3IT2A 3VSCA 2RVJA 2AFHB 1CTQA 1I80A 1ZA1B 3DLEA 3L8FA 2XSZA 3USES 2HS4A 1DDIA 2Z5VA 1VL0A 3ECCA 1U6JA 4RL1A 2ATXA 2LQ9A 1F4PA 3CO5A 3ZVRA 4BUCA 4IS3A 1I6MA 2PX5A 1RE1A 4ND8A 1GVNB 3B6BA 3TZZA 2NUTB 4UOZA 4JJAA 4E2WA 1QV7A 5JSKA 2H5IB 2MGZB 4NJMA 3TBHA 1QAXA 3IPYA 2OZLA 3D5EA 2IEBA 3GB9A 4RJIA 2EKNA 1K73T 4OI3A 2Z30B 3LY9A 1SPBS 4GPD1 1DS6A 1YK9A 3WMEA 5C35A 5D7NA 1E6LA 1W29A 4F1KA 3DJYA 1QFZA 1T9GS 1WDDA 1KDPA 3TF5A 3PVZA 3TP2A 3JZMA 5KNBA 3G82A 4Y0NA 3GWGA 3E9EA 2AK2A 3DEFA 3KAJA 2RHDA 3Q72A 2FHPA 1KDRA 2RKIA 2Y77A 3P0RA 1LXNA 1STOA 5JROA 4R1OA 4DLTA 1XJCA 3ORRA 5J1PA 4JN6B 5FDLB 5C5JA 3AKYA 3AIMA 3CJQA 1OCEA 2DPYA 1UJ5A 4TYAA 4MWCA 1KZYC 1T5BA 3CCRS 2H2HA 1LV7A 1OIVA 4RTKA 1KZ9A 3S5UA 3JAWA 2XG8A 1Q1GA 4B48A 4FINA 2ZDOA 2YYAA 3GEIA 2WIJA 4Q9LA 3IX7A 2Q4DA 4UNRA 4CFSA 3B1KA 3K8YA 4LZOA 3OUZA 4FF3A 4QDZA 1J22A 3HB5X 2G1UA 4URUR 1W7WA 3GRPA 4BGIA 3DHNA 1BJKA 2WSMA 5HQLA 3TL3A 2Q8PA 3HDHA 4FNGA 16PKA 1QHHA 4QEKA 2MKSA 1R0CB 1YBTA 1PRYA 4KVAA 3TX2A 1WDWB 3OZ7A 2WY2D 3U13A 2L08A 3W8EA 2QDXA 2CFOA 2VCEA 3W5UA 4NKRA 1EDOA 3J81U 3JAKB 4KPUB 2VL1A 3SJZA 1WL8A 3IEIA 2PO7A 2J9DE 1NJSA 3ZDRA 3NHPA 1ZSVA 3X1JA 1FYDA 3WV5A 5HPYB 2G40A 3FGPA 5J1EA 2SCUA 3DDOA 3MXHP 4DTIA 1J39A 1AGYA 5KNDD 2OBYA 3BWVA 3EZ5A 5CX1A 2I7CA 5K5EA 1YZUA 1S77D 2C9CA 4YIHA 2XMSA 1WXDA 1XU4A 3ASUA 1P1KA 5DGHA 1NHKL 1XJ5A 2I5PO 3CCJS 3QUTA 3LK7A 3QJYA 4B47A 3S28A 2B51A 3K0HA 1YH3A 4MYDA 4HLCA 4BP1A 4BVHA 4ZHQF 1XN9A 1FS6A 1MW7A 4RHUA 3TJ9A 1EYZA 5ALVA 5M3BA 5EIXA 4PYIA 2WU0A 1U4OA 1K27A 3R4VA 4MRAA 1BS1A 3MLEA 4CLOA 4LV5B 1E9EA 1HW9A 3CY6A 1P19A 5D4PA 1CJTA 4R31A 3DLEB 1ZA1A 4C7XA 1U04A 2OLKA 1PYDA 5AHRA 1TUEA 4Q93A 1E20A 4YWJA 4FFBB 1I4LD 2PL3A 5K4HA 2OMLA 4UTZA 1Q50A 4I2PA 3CB2A 2ZOSA 1Q78A 2GJ2A 1MU2A 4LUCA 4RPHA 2QE7A 4K88A 3ZV3A 3EIOA 3MR5A 1KAEA 3F6PA 4JGBA 2A92A 5E1DA 3LHKA 3VCDA 4IIBA 2OZLB 5A04A 1XVTA 2H48A 3NRCA 1OIAA 2VA9A 2B7CA 3JQFA 3EVAA 4HR7A 1PW7A 2JB9A 4UPVA 5E6SA 4I5GA 1BDJA 3V2GA 2P5YA 2GCOA 2PRKA 4HT5A 4NICA 1HBMB 5E4FA 1S1MA 2JBAA 4IBOA 4XLZA 4NXNF 6ABPA 5LP1A 3UJ9A 4KFSA 2IYYA 1RZUA 3BGLA 3HL0A 4DJ5X 2B98A 1RAGB 1ZJYA 3PC8C 2LR0A 3CRNA 4O4RA 1DIHA 4IEFB 2FMKA 4WKRA 1L5NA 2NQTA 4Z4GA 2O7RA 2BW2A 3ZCRA 1I4OA 4OXIA 3ESCA 1YL5A 3ZXUB 2O06A 4PPFA 4ZQFA 2F3RA 1A7AA 1Z9BA 3M70A 3TMKA 1F2UA 3ESAA 1RFLA 3HDVA 4KWCA 1VB5A 3IVXA 4IDKB 5HJYA 4YJ3A 3IUJA 5AR1A 3OVAA 2VRCD 3UWSA 1QS0A 1G41A 3IT1A 2ZREA 4KOAA 3G9ZA 4L8GA 4PO9A 3OZUA 1SD2A 4MMZB 4Q7EA 3WWZA 1GEEA 4CGZA 4UM7A 3OTEA 1C1XA 4YN3A 5DTEA 4FZJA 5JNUA 5DX1A 4OH7A 3L7KA 3L9XA 1NPRA 3NJRA 1JEYB 4WJLA 4P58A 4X65J 2NP6A 1UODA 4JV2A 1L5HB 1YSCA 5CH5A 2F8SA 5DEOA 3FYCA 4GE3A 3LSTA 1KKMA 3EC1A 2C1EB 1JA0A 4L4RA 3RW7A 3TD9A 4C29A 4OEHA 3EARA 3P0EA 2GS8A 4YRDA 3FD8A 1EWQA 4JIMA 1YRUA 4RNCA 5EJ7A 2FUG6 1FFGB 3PFEA 4D96A 4FOLA 1K6EA 5M29A 1OI2A 4N5LA 4CQNA 4LXIA 4BC1A 1D3AA 5A0YB 4NLTA 1RRGA 4L74A 2YZ7A 1SCAA 4Y2UA 2P2YA 2J6TA 4GPEA 1Z5UA 3JSMA 2N82B 3GIDA 1U9IC 1KEZA 2V2VA 5CX1B 4MKHA 4C48A 3K35A 4DREA 3M6MD 5G0WA 3EXHC 3OICA 1G4HA 3UF0A 5H9VA 2CG8A 3ENAA 1YC5A 3D0IE 5TSDA 3OSNA 1VI2A 4KOEC 4E5PA 4KGKA 5L1IA 5D77A 1TO2E 4MGIR 2Z8YA 3K8WA 2XVXA 3MZ0A 3V8VA 1KVKA 4O4JB 1Z29A 1L9KA 4EHHA 3RGIA 2AOUA 1GZ6A 1BXGA 2X15A 1F2VA 3D8RA 4UVEA 1J7KA 1P3Y1 3O92A 4KV8B 1KVQA 4OSEA 4DCVA 1LJ8A 4TTAA 1Q7EA 2B37A 1E3IA 5A4JA 5A0TA 1G59A 7REQA 1D0SA 2X5XA 4YI3A 5ETVA 1S5ZA 3FKQA 1ZP6A 1YI2S 3PEEA 2NT3A 1LRLA 1D07A 4QDUA 2Q6KA 4V1CB 3DH0A 4JUAA 3E9RA 1H2XA 5KG7A 2WVHA 3UHPA 2BBSA 3NHMA 1I3LA 2EK6A 1NPTO 3PFHA 4QARA 1CHDA 3TJMA 2P6RA 2HHVA 2E9SA 4OSPA 3GHYA 2PT0A 1FX0B 1N5IA 4K2XA 3ELHA 1OFVA 3NIDB 1LLFA 3IBFA 4KRWA 1YX2A 3T1QA 1RQNA 1RRCA 1NLKL 2WF5A 2J8AA 2D06A 5JXHA 4U8GA 4DT1B 4PGMA 4L3VA 4MPPA 5K2MA 4P2MA 1FK9B 4UBKA 2R7MA 4TTQA 4WVLA 2OP5A 3PKYA 2F5GA 1FRMA 3GQVA 3K05A 4ENTA 3HYCA 3IAS9 1ZIOA 2C31A 4HEHA 3A1WA 3VH2A 3MOSA 3JWPA 2FQQA 1UVNA 4E88A 2C7GA 1JXEA 1RYHA 4ARZB 3RUHA 1LVUA 2DULA 1JXLA 4Q6WA 3M30B 5AJ3J 2H5JA 1M54A 1NC1A 4Q45A 5EC8A 5BWMA 4JV5B 1HR0F 1Z0AA 3B1ZA 3CTMA 3E9MA 3SC4A 1KGDA 4ZVTB 2JHCA 2BF4A 4AJ2A 2CNNB 1UANA 4UDXX 3HHLB 3MERA 3CBQA 3NUGA 1RYBA 5EPEA 1NVAA 3RS3A 4NLLA 4QLBA 1FQJA 3HJFA 3ITDA 3S99A 4EVIA 4GZ6A 3ZV7A 3W5ZA 3UENA 1GWNA 5HNKA 4LMBA 2V7VA 4ZDIA 1MWQA 1Y00A 1ZISA 1H6DA 3UGKA 4CKBB 1O51A 4RW6B 3IFEA 2QUJA 3THXB 4WECA 3JPYA 4CEHB 1O0BA 2QE5A 2P6TA 3DXFA 2CNKA 4X8OA 3AVUA 4EBCA 4DZRA 4EEXA 1DINA 3K5WA 3OKCA 2J3DA 1HFKA 4M0MA 1NFRA 1PZGA 2L2QA 3WY9A 2VUGA 4WXYB 1EGAA 1XJ0A 1FFGA 4TKVB 1ZOPA 5CA5A 5LJ5Y 4JK3A 2MKCA 4DR1F 4LMPA 2JAQA 4URHA 2GDJA 1CDEA 1KAOA 1RPNA 2CVQA 4ABTA 5KT6A 2IE8A 2AF6A 1FT8A 3E9ZA 1RC8A 4ETXA 1YC2A 3R5CA 4R8KA 3RZAA 5JXGA 5LMZA 3CD0A 3MPUA 1PG2A 1RTHA 4Y2IA 4E11A 5A3SA 3W5CA 4FT4A 1T2NA 2QA5A 4LYJA 3S6EA 1JWLA 2R7LA 3CTRA 3D3EA 2AXQA 4F86A 1NU8A 1Q2UA 3O21A 1S2IA 4N7TA 1VP3A 3L7CA 3FUCA 4E2FB 1L4FA 1Q6YA 1RWXA 2NQPA 1JSXA 4B6FA 3FTDA 4AI6A 4DNFA 2FWNA 1BXGB 2QV7A 1AK1A 3IESA 3OQIA 2MLZA 3HD2A 2BH9A 3O4FA 2WU8A 4WN9B 1QAYA 2B4QA 4CM6A 4PYNA 2V3CC 2PL9A 4BBYA 4JY7A 5KB3A 4NAHA 1ND5A 1QVRA 5HGXA 2G9RA 1P2SA 2C2YA 2C5LA 3HR8A 1EBBA 3GTYX 3U4IA 2PKEA 2GK4A 2UYHA 3HZGA 3GNQA 1NK5A 5E1MA 4MO2A 1VPWA 1V1JA 4QJ5A 4DUGD 1YR9A 3EEQA 2HU8A 5JJCA 2CQPA 3A4IA 1EZZB 5T4HA 2VYFA 2MYNA 4E30A 1NBEA 3KOUA 4H7FA 3M2UA 2PVCA 4MUYA 2JH3A 2VZ0A 2DRBA 1KSGA 2HEIA 1DV2A 1I4WA 4KQ9A 3QGPA 5CB6A 3GP8A 2QLNA 1QRRA 1KIFA 3FC9A 5ICSA 3PF9A 3USZA 5K51A 1K8ZB 5BMVB 1HTTA 1IQRA 1ST3A 4RBVA 4EPYA 1IEQA 5E7IA 3NP5A 1FU7A 4A6DA 3ZEIA 4OP3A 2Z56B 1T9KA 1SC6A 4Z53A 3U4QB 1QLNA 4S1VA 1CULB 2IDEA 2VK2A 3JTMA 1ULHA 1D2RA 1RT7B 5H5JA 5KTYA 1T4DA 5IDWA 3FBFA 2GIRA 3FDFA 4AB1A 1U2GC 3PHCA 1BVRA 1S4EA 2C2GA 4UMFA 3FPGA 4UU0A 1DRUA 2B99A 4CT5A 4CH7A 4H2DA 3GUZA 5DM60 1F2GA 2R66A 3OF5A 4MZDA 3CW8X 1TXGA 4ZPJA 3OWOA 4HGNA 1HBUA 3MNFA 1XKLA 5B09A 2QV0A 5ELXA 1Q20A 1U0FA 4CKBA 1X4DA 3UCGA 2B69A 7GPBA 1I10A 3HI9A 2A1TR 2O2CA 3EEBA 1P9RA 3T5LA 3PEJA 2YN2A 3H4DA 1N5LA 4Y2VA 4W9NA 4TWJA 3I9LA 1VOTA 1U0JA 3F98A 2O1PA 2A9JA 2CMHA 4I50F 3GGPA 4Z4IA 5THXA 5ETTA 3FSRA 2A4MA 4Q8FA 2W5UA 4IOCQ 1FWKA 3VVTA 3WLLA 1TKAA 3U9TA 4B9AA 4IFVA 3EWSA 4OYWA 4HB4A 3NHZA 2YRXA 3KDOA 4Z2XA 1Q3TA 4KFCA 3EG9A 4BDTA 1YRHA 4ZLNA 4DLWA 4JT2A 4RGYA 5JHGB 1YQXA 5C3UA 2A9OA 3UWOA 1U1OA 4EJSB 3SDBA 3SKVA 3ZY3A 2PSFA 5HO4A 3A70A 1ZRHA 3E3NA 1TZKA 4USUA 4YQZA 3CFYA 3TGPA 4D45A 4QVIA 2ZD1B 2FFBA 4DLKA 2N7CA 1VLZA 2X8JB 3DDHA 2W9BB 2P2LA 1DFHA 4B80A 5KO2A 5IYZA 4PZPA 3W6OA 5GJCA 4AZ0A 4LKOA 2BJWA 2UYQA 2FR8C 3OL9A 1Z5WA 1HPLA 3HJAA 1VPLA 2P35A 1JQGA 5C2GA 1FFXA 2GFIA 4ZOBA 2CL7X 5D4OA 4GKJF 1N8SA 5EIFA 4OL8A 1GPAA 1RA7A 2BRLA 3QELB 1A96A 3IBSA 2RS8A 3UFCX 2WILA 1E3TA 4LX8A 3QSYA 2MSNA 2ZBQA 4B79A 1WI8A 2NSDA 5JSQA 3KJFA 3CMQA 5D5PA 4YA6A 5I51A 4OK5A 2HK6A 1MPTA 3K1YA 2R25B 2K2PA 4DA0A 4D9NA 4NLOA 4ZODA 4ZOLB 4UUAA 3KOWA 3CEJA 2GEUA 3NH6A 2JASA 3U44A 1H2HA 1Z17A 4JBWA 5AI8A 3D1JA 3L07A 4F2DA 4YQFA 1GIAA 1H2BA 1Y4SA 3DDWA 1P45A 5E3JA 4ILEA 2YJ4A 4KO2S 3WL3A 3A12A 1FRVA 1WX1A 3LW7A 3I4PA 4DSTA 2Z56A 2NAFA 3EVTA 4BUJA 3MOZA 4NBNA 1NDPA 1KOGA 1VHFA 4R40A 1V3VA 4XDGA 1ZD4A 3CNEA 4MV7A 5YASA 4QDXA 3R5DA 2XMMA 4EHBA 2OGWA 5BUQA 4MGHA 4HN2A 3UJ6A 1IBLF 2J9FA 5JMPA 4UHHA 4XM2A 4OQ4A 4RYLA 4XLLA 2AFHA 1GYPA 3KU4A 4GI1A 2IDKA 2HZBA 4ZANA 2DHHA 3OTOB 1ZWKA 2E3JA 3LA0A 3BZUA 4ALKA 2XZWA 2E9ZA 2X22A 3I9V6 1CZHA 3QVWA 4BVEA 4X7PA 1KI4A 1KFCB 2MSLA 1GU7A 2QT7A 2QF7A 1M34A 3NKVA 2ERYA 2W4DA 3IKVA 2QYOA 4DMKA 5B4UA 2AI1A 3JW8A 4K3VA 2BM9A 4G5YA 2HRQA 2NYIA 1GY8A 1HFEL 2ZTMA 1QOZA 3EDCA 4Q4LA 4DV0J 2OCIA 1XR6A 4WKBA 1MP0A 3WMFA 2IH4A 3HJVA 1G8JA 5CGQB 2FCAA 1BX3A 4UREA 4Y28C 4LR9A 3RTCA 4DDWA 2COLA 3OZRA 5CURA 3DV0A 3Q88A 2DLNA 2WVFA 2I67A 2MSCB 4LHXA 5GAEU 3FBWA 4A8WA 5ITZB 4OB6A 5DGXA 1FFAA 2J5BA 4OLFA 1IK6A 2OKQA 4Q03A 5AKEA 3GG9A 4PONA 2YIMA 3MAAC 1C8BA 1MO5A 2MYTA 4E0DA 1S4MA 5J2UF 3M32B 4EJSA 3CDWA 4M8NE 4TWRA 3LUJA 4NYPA 5E38A 5J2NA 4HLUC 2XA2A 3PXGa 3JAWB 3DWEX 2PL1A 3WA6A 2GZ2A 4RLQA 4Q15A 4UCXA 4ZDNA 2EXXA 1XQYA 4A0GA 2ID4A 4ZU3A 3SZRA 1WUJS 2NTYC 3MWKA 2QN7A 1XZHA 1Z74A 1OW3B 5KQLA 2KBEA 1KNZA 1UINA 3D0HE 4ERNA 3VKWA 1L8OA 2FGCA 4LVUA 4C3VA 4O3QA 5IWAB 1YK1A 3ETGA 1RQGA 4FXDA 1PQWA 3P9KA 1N33B 3MILA 2DKOA 3U5ZB 4WRRA 3ECSA 4M5KA 2RDJA 4MV8A 4OREX 2AGPA 3U27A 3UAZA 1K0FA 4KW7A 4RNNA 2FW8A 3E61A 5DOVA 2H5LA 3RODA 2DGOA 1KSHA 4W1RA 3V33A 4MS3A 3JAKA 1V2GA 5DQGA 4O3SA 2OCLA 2CXOA 4EY8A 3NW9A 3O4HA 2XUPA 3FF4A 3BBFA 4TX1A 4A8SA 1T0TV 1A5BB 4ZYZA 2B8WA 4KLZA 5HDBB 4KPUA 4KTTE 4JBHA 3FSGD 3KT8A 4JU9A 2B2XA 4DSZA 2SCUB 1ZUNB 4TWAA 4C5BA 3TIGA 1PV4A 2WTFA 1DPGA 4G3IA 1PP4A 1T34A 4TWIA 5DIFA 2ZR9A 4FDAA 1R9MA 2A8YA 3TLZA 3P1JA 2V8BA 1OXKB 1EFLA 2R60A 3E35A 4WU3A 1ML4A 3US5A 4O2AB 5TQ0B 4UARA 1BWVA 1CS4B 4ZT3A 1BEZA 2QPAA 1LPSA 3IP1A 3OX2A 4CLSA 3LLSA 1OWNA 2AX4A 4ZOCA 2AWOA 2I76A 1OV4A 3LNCA 2E4YA 3V4IB 4MK7A 2Y4OA 1EKXA 3QXJA 3VPDA 5CZVA 1VBZA 5JSZA 1OYEA 2QTHA 3AHCA 4RZUA 4HBGA 4AAYA 2VHVA 4KH0A 4N0MA 3NHBA 5CIQA 4DG1A 3VTZA 1SG0A 4PEOA 2D1QA 2ASYA 5I5EA 3MWBA 4MKXA 3DOMA 1SKWA 2VQ6A 3KKZA 4X1YA 2FN9A 4GKKB 2K7FA 4ZVVA 5J2PB 1MU2B 1O94A 2YL2A 2DB1A 3BCUA 3RUBL 4DR3B 3FPFA 4KNWA 3EGZA 2JIPA 4NC9A 3R3ZA 1NTRA 3QAUA 4FM9A 3S44A 2J9YB 1V8OA 2M6SA 1WXQA 1RXVA 1HBMA 2GPWA 4BFZA 3FBEA 2B8JA 4PG6A 4P4UA 3UNXA 1LBTA 5SYMA 2RF2A 1C9EA 4LQ3A 4JI6B 1VQYA 1HLFA 4BYMA 3HRHA 2QW0X 2J7WA 5K14B 4IH1A 3NHAA 4U5XA 3JVVA 4TYWA 4D3ZA 1OYYA 3KSRA 1RS0A 4TTSA 3BMCB 3VKFA 5B1DA 4ZVGA 3GLIA 2G0AA 4LOIA 3OFEA 3R2JA 3Q3HA 4OXXA 3QWHA 2C4VA 1VKRA 1T8SA 1QBKC 1DTEA 2W6JA 3LM8A 1U3TA 3C4QA 4CN8A 2IIVA 1M6WA 4IVNA 1W30A 1E7WA 3BORA 4EGLA 1D8AA 4HUJA 4EHKA 2PGAA 3KLNA 2CL0X 3MJDA 1L5HA 4INAA 1WSRA 4S12A 4CV2A 4HXFB 3ILIA 3CE8A 1QOPB 4DV7B 1LWXA 3OFSA 2VFVA 1LSOA 2CLMB 2ZSBA 4AURA 5KNCA 4DL7A 1SUBA 3WP1B 3UC5A 5JIBA 1FW8A 3MLAA 1PK8A 5C4MA 2RAQA 4A47A 9LDTA 4R1MA 3ONFA 5FTJA 2ZRKA 1WVMA 4KXQA 3CVJA 3F47A 3T3MB 4RLHA 1M2JA 3WA7A 2CV0A 4UEKA 2HRYA 5G0VA 1BX0A 4AYXA 4DQIA 1II0A 3D68A 1VJQA 2P2CB 5A5EA 4HB2A 4HPXB 4XJSA 2D3WA 4CLXA 1OFTA 4BLPA 2HK8A 1U6IA 4WY2A 5H0IA 4NCKA 3DOKA 2QZ8A 3PHTA 1C50A 4F5YA 1C1HA 1UBHS 4TQ9A 1TJ5A 3EGEA 3PVCA 4N8EA 4ED7A 3Q7TA 2A1UB 3HXQA 3T3OA 4BQOA 4D02A 2ZUUA 1B8PA 3G9UA 3W2IA 3OTCA 4V3BA 4ZLLA 3CMES 1PUJA 2Z2YB 2OO3A 4BZXA 4WIIA 3Q8PB 3AKEA 1CS4A 4JUIA 4I55B 4KFBA 1RMYA 2OENG 1KFKB 1VHQA 3KXKA 2VD3A 3IHTA 1FNSA 1NK6A 1X19A 1NPYA 5AE2A 5FTWA 1XPOA 3SKYA 3UOGA 4DN9A 2VONA 1CUUA 2DWCA 1ILWA 3KQYA 3M82A 5LLDA 1ACJA 2JEJA 3D67A 7REQB 3GLIE 2PYIA 1MROB 3TQTA 4WH0A 5IQ6A 3IBCA 4NBWA 3ZWOA 1ISIA 2D62A 3PKMA 2YKNB 3EXCX 2QL5B 4X4SA 1JKMA 3V8EA 1WZ2A 2WFAA 4C88A 1R6UA 4M99A 2PVSA 3L6BA 5DTRA 2OCXA 1PUXA 5AOAA 4Q48A 1SIUA 4FGWA 3MWDA 4S0XA 1ZL2A 5BRNA 5A6WA 2ZS9A 1BVYF 3O3LA 3OVMA 5FWNA 1UKVY 4DDKA 3V9AA 3QUCA 3Q89A 4X6UA 5T7LB 1VP9A 5LU9A 3C3KA 3GLHA 5CP8A 1G8AA 4LJ9A 3CKMA 4ZRMA 2N4DA 6AT1B 1AB5A 4OGKA 2ZRNA 3AAWB 1UMDB 4N77A 4BO6A 2W0SA 2X1FA 4YX9A 2HSDA 3AFOA 2EQ5A 1T8YA 3BMCA 2FSFA 2ZPAA 5JNWA 4LS3A 1W25A 3UV7A 4N6OA 2QY9A 3KTAB 3K57A 4BCCA 1XZIA 5EA2A 4USTA 3A7DA 1W5BA 3CZPA 5B0FA 4DN0A 4KYUA 4OI4A 2JGMA 2ZS8A 1Z3IX 2AW5A 5HVGA 2H00A 1XBWA 4DX8H 1ZZGA 4ZVTA 2X51A 2C2RA 2BMJA 2QPTA 4P8RA 1OLXB 5HX7A 4LQLA 2XCQA 3R5AA 1E0AA 5LWHA 3OTOJ 5JSFA 4NH4A 2G1JA 4DLUA 1TU4A 3I4HX 2IOFA 2PYDA 4KXMA 4RW6A 2PSZA 2GK3A 3IP0A 2B21A 1HI0P 2YVUA 3UCXA 1NJIT 1RRPA 2BGRA 3VTKA 1TKTA 4R2WA 1V6HA 4RZIA 1RP7A 2GEKA 3D2AA 5FO1A 4KQ2A 2IE0A 4JWTA 5DE3A 2B6AB 2IBSA 3CG0A 4TV9F 3PX2A 1PNTA 1BJRE 3AFIA 3C2QA 2G0CA 3LP8A 5JRJA 1TT5A 1NQTA 2HWKA 3L0DA 1T03A 1H5QA 2XIJA 3J7AC 3AQIA 4UCWA 1FLAA 1R18A 2B3DA 1NQWA 4FTWA 5DIZA 4OI6A 1Z68A 4D9FA 5LSRA 2PK3A 4QOEA 3WIDA 2W9CB 2V0CA 1U2DC 1VE7A 3C3BA 1ORWA 4OMCA 4URXR 4D3SA 1P6TA 5HF9A 3SZGA 3GONA 3S1SA 2XYQA 2WYHA 5EIWA 1JMKC 3PRJA 3ADKA 3GEDA 5FUYA 2RD5C 3W8PA 4Z4CA 4ZK7M 4PYRA 1T9DA 4HKTA 2EFQA 1K68A 3TOXA 4MRSA 3AHJA 3B1VA 4G9GA 4U9UA 1P8AA 2Q07A 1PO6A 3TE7A 2FJBB 4UVGA 2PMWB 4F0MA 1ZOTA 2C61A 4PICA 1S1TA 2OQRA 1FXDA 1ZM7A 4MK4A 3LQQA 3DT6A 4ZAXA 1BQEA 1S59A 2MB0B 1B1CA 1P0CA 1MROA 2WUDA 1TQ4A 4LYHA 2DJWA 2ID7A 2PX0A 2YKNA 3N70A 3WLQA 1JN0A 4URQU 3GEHA 2IYTA 3KQMA 1IKVB 3FVRA 1L4NA 1ZUHA 1FTNA 2GQ0A 4KQFA 4IOAQ 1Z5VA 1NKTA 2G67A 2HVIA 2DNOA 3WKBA 2L82A 2W6NA 4GMHA 4G0WA 2RHHA 4CM4B 3UA3A 1HTWA 4JYZA 4E2YA 3OFFA 3C14B 4R2LA 2R8KA 3I6PA 1WETA 3AIKA 4FWBA 4MIYA 3M2UB 1D1UA 4FDLA 1B3RA 1E7MA 3O5TB 3ZDEA 3ZXIA 1YCDA 2QGFB 5AUOB 2XVZA 2BA9A 1D0VA 1UMDA 1F1JA 2VNHA 4ZPBA 3TYTA 2ZE5A 2VPYB 4LDNA 4FR5A 4F6RA 1M72A 4DQ0A 4BO9A 5L3QB 4E51A 3U1MA 1WHSB 3EXIA 1IQ0A 1XAHA 2B5JB 2R4TA 1QVWA 1L7PA 2X3GA 5CB4A 4L4SA 1PT7A 2FPHX 4HP8A 2XZLA 2ZBUA 2PPLA 1K9MT 4FHFA 5ETMA 1H9CA 1Z15A 5GZ3A 2C3PA 5KFZA 2ZHOA 3LZDA 4Q7MB 3RIMA 2VT7A 1D2GA 1GT6A 2Y71A 4MKZA 3C66A 1HL3A 5JCPA 3A2KA 1OTXA 9RUBA 3PNOA 4XTRA 3NWOA 3ZVKA 3VOAA 1YQGA 2VZ8A 3YASA 5BW4A 1THMA 1CYEA 3VV3A 4MJLA 3EGNA 4YB1P 2W24A 4NA2A 1SHTX 3SXLA 5CJPA 5FULA 2XB4A 3M8YA 5JWOA 5ED0A 4YDRA 3WZ0A 1H7XA 2VPZB 2EG1A 1A8SA 3L7AA 4IFVB 1YVFA 3S40A 1XDSA 4UUBA 2MZ1A 1CB0A 2G9QA 1SKUA 3BZBA 4W4MA 1U8AA 3V4VB 5DSXA 4KXLA 3W06A 4GXTA 3CF2A 4AF7A 2IRXA 4IJWA 3DQPA 2E2WA 4J9SA 3DE0X 1T25A 4EOGA 3D3BJ 3LT1A 1GNTA 4R7GA 3B9QA 2ORED 3O82A 1PSWA 4LHSA 2OCPA 3M8ZA 3N75A 4WLVA 3KQKA 1BQNB 5FI1B 4OVKA 2B1GA 3VISA 2X8JA 4DWWA 1N75A 1PNOA 3CSUA 4O02B 3FOZA 2B4OA 2OQ2A 1FFXB 3GL9A 3OQPA 3WK6A 1GPUA 1T5LA 4J6EA 2VDVE 4BFXA 4PLFA 2IJGX 4EENA 3H7HB 3F1KA 1HYHA 1Y6RA 5ITWA 4IXNA 4FBTA 2JCXA 5BV7A 2J67A 3K0FA 4MQFA 3D8NA 5CFQA 1GNRA 4M1ZA 1V4BA 2LKDA 4XIGS 1NN1A 4HDQB 2FLWA 4P33A 2ADCA 4YJDA 2FJDB 4JQOA 1H1LA 5GMDA 1R37A 4I1OA 2IQ5A 3KL4A 2DH9A 4ZOLA 3JV7A 1P7ZA 3CUSA 2Z0GA 4TT3A 1CXZA 3G0DA 1PT5A 2X4GA 4ZI7F 1NDKA 2VK4A 4E14A 3QLJA 1S72S 4RF4A 2HCBA 2W6ID 3CWZA 3GILA 3RKUA 1OLUA 4QICA 1RB0A 4TYMA 1DWOA 4J0HA 2BC9A 1Z2DA 5IC5A 4S04A 1FDTA 4Y2MA 2DD8S 1NOKA 3WLAA 1UK7A 3OCXA 1FRIA 5I7AA 1QE1A 1XTSA 1VR6A 4EI9A 2B5JA 2H07A 5BYKA 4C78A 4Q1BA 3WJ7A 2KRRA 4ZN6A 2F8LA 1HNXF 3KOXA 1Q19A 4HQNA 3PD1A 1Y3AA 1CUZA 1KK3A 3EISA 2GEFA 2WJ3A 3TNLA 1KKHA 5LBIA 5HK4A 4FFBA 5LFAA 4EFMA 1ZUWA 4JT9A 1EKRA 4I2PB 4J2TA 1W93A 2AI3A 3FH0A 2SKEA 3KYDA 4J4HA 2XMTA 1W4AA 3QVGA 3ABQB 4RS4A 5K03A 3CEMA 2PUFA 5IKMA 1N2GA 1OFHA 3FCOA 3GNSA 3J7YU 4EG4A 2WAYA 5G3ZA 3A58B 3TAMB 3Q8QB 2WJZB 3N5FA 4NK4A 4COKA 2NPIA 3L93A 2KXNB 4HNHA 4QYWA 3DWFA 2CPFA 2W8BA 2R6CA 4ZVOA 1E1DA 1YJBA 3WJ2A 4RVDA 1ZAYA 1HQUA 3CLVA 3DTTA 2ZE2B 1W5TA 3Q7QA 2CFXA 5L3ZA 3WBKA 2PWBA 4LHZA 3RU3A 2V7EA 5KYKA 5FBWB 5E9WA 2AN1A 3G6VA 4HMPA 1TCCA 4OYOA 1GN8A 4JR1A 1OH5A 4Q1DA 3O94A 3T5DA 3M32A 3NXSA 5IC4B 2CHFA 3ZTPA 3PNQA 5FUVA 2AVNA 2C9DA 2UXCF 1N54B 4V2UA 2QM8A 4NU6A 5F98A 1ORDA 4MIWA 2DUMA 5AVOA 5EHGA 2Q4BA 1T6ZA 1NYRA 2P2ZA 2ATVA 6Q21A 2R8OA 3NT2A 2VBZA 1XJQA 3HU5A 4HVZA 1A77A 3WQSB 2ET6A 3ONVA 4Q0BB 1EWVA 4M9QA 1PUIA 2R47A 5CFNA 4MKGA 2VWPA 3EG5A 5J2MB 3JQ8A 5HCNA 4C8YA 1SO8A 2QXUA 3HCDA 1RNLA 3QP9A 2AUTA 2GLXA 4JJZA 5KFYA 1P0MA 3DBLA 5KQMA 3ASVA 4JXZA 1JU9A 2X7HA 2O0MA 4RD6A 4BJ1A 3LUHA 4B7CA 5JALA 5AJ3F 3AJ1A 4N0DA 2X3UA 2DCUB 4HVAA 1P73A 3HZEA 4W5TA 4CU2A 3EIEA 3KSBC 2OPQA 1G66A 4RXUA 4XCVA 3EPLA 5CG2A 5EZQA 4IZ6A 1X7DA 3B52X 1KAGA 3DI6A 5KOHA 2I4NA 1CWUA 4YHHJ 1LDEA 2IOHA 4FE3A 4MRVA 4UE2A 4NLWA 4TRRA 5AM1A 4ALIA 3ZHRA 3OT4A 3OP4A 3GMSA 3NS7B 1ODCA 4NI5A 2Q4OA 4TN1A 1JIUA 1KKLA 4QPJC 1PJ4A 1W4CA 5J23A 2GBLC 3LUGA 1M5UA 2PSSA 3L1KA 2XXBA 3QXCA 1R8BA 1MVLA 1QDLB 4ZXFA 4YRCA 4GZ5A 3QFFA 5GGXA 4ZP1A 2BR0A 4GKKJ 1U7ZA 3EFBA 3SV3A 2WHQA 4QO8A 1OXBB 2R7VA 3ROZA 1YB4A 2RRBA 4L51A 2VT6A 4F5WA 3I4LA 1RWBA 2QB5A 4AG3A 4Y7CA 3CD5A 4R54A 3S8YA 4MQEA 5LB2A 1VZ2A 2YJ3A 4A0RA 3GFYA 3MFQA 4PSCA 1PR6A 4IL5A 5FO0A 4X1YB 3INRA 3SQXA 2F67A 2QA1A 2BFEB 1OYVA 2NXJA 2XQGA 2B8PA 1FTQA 1EJ6A 2PSEA 2ZYHA 4K5RA 5LSOA 2XNCA 3PLAE 2XSZD 2BM0A 4AULA 2VDWA 4TTVA 4LBYA 4C8NA 2ERRA 4GE0A 3P4UA 3BOSA 4GS5A 2PN6A 4E5SA 5C0OE 2VH7A 2WWHA 2VH5R 3LY8A 4B7ZA 3KC2A 4OL0A 3WJ1A 4BYGA 1PE0A 3WC0A 4BMXA 4DMUB 5LD2B 4YCJA 1P8GA 2X4LA 2EDCA 3OTDA 4PLVA 5IEJA 2CDCA 2ZRLA 3O3MB 2QZJA 3RKRA 2ORVA 1DC5A 2WYVA 3NTUA 1RT2B 3PGMA 2BJ7A 1K2VN 5KNBD 4P73A 4TQAA 3HHEA 3C0KA 4LF4J 3PQ3A 3DD5A 4GWKA 2EFOA 1OMSA 1QK3A 1V8FA 2JGIA 2W0MA 4QYMA 3GDWA 3TVDA 4Q01A 1M1GA 4RA6A 2OHIA 4ZVMA 3VPSA 4OJYA 2R00A 5LQDA 2IYXA 1QTIA 4RJLA 2H65B 3L0BA 1Y5MA 1R6DA 2Z9CA 2J0QD 1CUSA 3LX4A 2ZRGA 4ZWNA 3TCKA 1QYWA 2Z2XA 5HZHA 2VBGA 2H1RA 4R71A 2YNGB 2BEFA 2E49A 5J58A 3NOGA 1V39A 4NHEA 3QZUA 1N2CB 1NHUA 1F6DA 2AR7A 2Z8ZA 1QHIA 3C41J 2P2CA 1JZQA 2MYFA 5AXDA 5F9MA 2CXPA 1G3UA 4BMNA 5CLHA 4Q7AA 4LVCA 3BJEA 4LF4B 4RTPA 2GPTA 5GY7A 5DNCA 4DPYA 1HORA 2R9LA 5JISA 1AZSA 2IEZA 2C9OA 3Q8LA 1H74A 1ABFA 4H17A 2CYAA 2VF8A 3WP0A 1NNLA 5FJ4A 1O6ZA 4LW8A 1RTHB 1QGZA 4A48A 3X1YA 2VHUA 3N3BC 2IXBA 2DAPA 3FHTA 1L4UA 1TF7A 3KUHA 4EHLA 5C1BA 1RYZA 3QVOA 3CNBA 2CWKA 4FEGA 2XE6A 2GA9A 3L6OO 4JQSA 1H0HA 3I58A 5FNVA 3LUBA 2BBTA 3CH6A 5BV1A 3GRVA 3Q23A 1MB2A 3RREA 1TK8A 1FTWA 4DDUA 2R1VA 1YRYE 1U2GA 3FB4A 4G84A 5B30A 5JEEA 4JI7F 4ED6A 1HURA 2AQKA 1HI9A 3ASYA 2AZTA 1UPPA 2KT3A 1Y1PA 3QPIA 1A3CA 3VYUB 1SJFA 2CVEA 2EKDA 4ZC8A 2HW8A 3HBLA 1L6IA 2Q6TA 5JMTA 3OF3A 3GEBA 5C1DA 1U1RA 3QW2A 5EJGA 4Z1MD 4ECVA 3WADA 3K5LA 4L5IA 5HTKA 2O9JA 3N6RA 1IK4A 4R01A 4YAJA 1B15A 1HE5A 3VU8A 4Y2KA 2CYCA 2VS1A 3BWYA 4YFYA 3D3NA 3FZ2A 3C19A 4AL5A 3IMFA 3MRXA 4DRXA 1PD1A 2AS0A 2WTAA 4DLEA 3GV8B 3GLHB 2GNOA 3CZAA 2DHRA 3PFKA 5I48A 2IUTA 3ZD7A 2R5FA 2YKMA 5ESRA 3R9IA 1N5OX 4QC2A 2P3SA 1RHMA 3BJYA 2B4YA 3BGOP 2OB2A 2E5LJ 1O54A 3Q4GA 4J0IA 2WU3A 5JRDS 1TFRA 3LW5C 3M5CA 4Y9RA 5DM4A 3KTAA 4PSVA 4DDHA 2UV8G 4XE5A 5I7UA 3SV4A 4J0JA 3A4MA 2AB0A 3WLIA 4Q9JA 1MHPA 2KM8C 2HLUA 3K5HA 2E7XA 5DTQA 1AK2A 3EPPA 1EB0A 1QWOA 3UMGA 3NOXA 5ES4B 1ZSNA 2BUCA 2WTXA 4Q9AA 4MWZA 1TK5A 2GHVC 1QGDA 3UICA 1BDHA 1TUBA 5AFSA 3U1BA 5AK6A 4X6YA 1ZRNA 1O57A 4K2JA 1NMEB 1ZM3A 3AL0C 4KC0A 4XASA 5DBGA 3AT1A 2VA8A 4QECA 5CA0A 3KPJA 3LWZA 4YHHF 1F0PA 4GI5A 3I4FA 3MPVA 1S4FA 1S6QB 5JBIA 2G04A 2IUYA 3A6EA 1NQVA 3PVSA 5BR1A 3A1FA 5H9FJ 3ZE8A 4KHMA 4TL9A 5IBQA 2I2WA 1PJ2A 2C3UA 3OOYA 1IH8A 1UDWA 1Q0ZA 3VR2D 1ETHA 4N56A 4MHTA 2RU9A 5CDFE 4JV5J 2EARA 4YB5A 3UGQA 1SK8A 3LE8A 2QRJA 2YVLA 1B7GO 4D6XA 2P9EA 1SHUX 4HWGA 2WSEC 3KFWX 3U4AA 3WNCA 1CUBA 1D1SA 3DXZA 1QLHA 2VT2A 4RESA 2ES4A 3GGGA 3U7EB 3O8CA 5EFZA 5C31A 2JJQA 3HY6A 5L53A 3CRRA 4KPFC 4DV0F 1EFCA 5FUBA 2IHVA 1X9IA 2YVSA 2JC3A 1RJGA 2ZBEA 4Y1FA 2KU7A 1YA8A 4OA5A 1GGNA 1MEEA 1URPA 1E59A 4L22A 3NIFB 2A1IA 2VKZG 4YAKA 4A0SA 5DYTA 4GSKA 2PMDA 1RVDA 2XWJI 3PR2B 4YP7A 2PMWA 1G0NA 3KVVA 1DKRA 5IWCA 4UDYX 3A10A 1BEEA 5KFVA 4R9SA 4IG9A 3RVSA 2B3TB 3HFSA 1UKUA 1MMLA 2DQKA 3O3CA 5HJ5A 3HKBB 4PBRA 3G6ES 1DEOA 2G83A 3TRDA 5K99A 4X84A 2XWBF 3QTLA 2WBMA 4IYJA 1KMNA 3R5BA 1J70A 2WWFA 4ZRNA 3V6DA 2I6TA 2R7KA 2FW0A 2J3QA 2QRKA 3C14A 1GSAA 1QSLA 2XR1A 2V6IA 1NQAO 2BZ1A 2DGDA 2YHIA 2QX7A 3ZZNA 4CTNA 3ZIDA 2HZVA 2OBLA 4QUAA 3W1VA 2DQZA 3AVQA 5AVQA 3QMVA 1N34F 3QE0A 1QYIA 4F6RB 3NNNA 4DC1A 1KWMA 2CJ9A 2WFLB 4TKMA 4F45A 4D4IA 1Z73A 2VHXA 3DLHA 5A7FA 4DARA 5DNYB 1GCGA 4FBLA 1I94J 1YQHA 4LPSA 2BFFB 1NRJB 2P0YA 2E5JA 5A1JA 1UJBA 3I52A 1KZ7B 1B76A 4Y9DA 2WDPA 2HMAA 3BB3A 5CDYA 5EMKA 5SV2A 3K1TA 4UM9D 1TZ0A 4FHDA 3R2DJ 3ZDXB 1PTJA 1VGQA 1XC7A 2EG5A 2PCLA 3UE2A 3NM6B 3JWGA 3ZW8A 5IM5A 3WL4A 5F0UA 4JCOA 3CNOA 2DQSA 5HXAA 1B6GA 3CJ8A 1NJ6A 5KWVA 5EXEA 2ZVIA 4OG2A 2VBYA 5FIUA 1LV8A 3HB7A 3CCFA 2REBA 1CY7A 3PUVA 1OIXA 3CZQA 2WSIA 2ZUCA 4BN5A 5BWOA 4TKUB 2FVRA 3VZIA 3N8HA 4LDPA 1DKOA 1KMQA 1F7VA 2DGUA 4BAUA 5FDFA 3R0QA 5HQ3B 2CVOA 3PR1A 1NW9B 3VAHA 1THGA 4IUDS 2B5WA 4Q47A 5ITZA 2F90A 2ROEA 3T12A 3I3SR 1X4EA 2XTNA 3CN7A 3Q3VA 3RNLA 4QIEA 1QVGR 4P38A 3ZKWB 5EZ6B 4QZVB 3K32A 1EI9A 3KP1A 2AHRA 3MIZA 4YT4A 4C7MA 2FA9A 1PV2A 4M9SA 3MG9A 3KFLA 5IFKA 3DLBA 3RFXA 3KZKA 4L5YA 3SXUA 1UZAA 4AP5A 4YRJA 2G71A 3D4OA 4L2IA 4EKDA 5F3DA 5AVWA 1NJFA 2XGOA 4IDFA 1RAIB 4M4SA 1UH5A 1IM2A 2NO4A 4NRDA 5BR8B 2ZBIA 3SS7X 1PLLA 1U9ZA 3M83A 4V1Ak 3D7NA 1LCIA 3ERCA 4BLUA 2WIGA 1TR0A 1R12A 4I3FA 1XDBA 2G06A 3W3SA 2X0NA 1SVOA 4O0IA 4MLZA 4Y2SA 3IUNA 2IRWA 4Q37A 3N0VA 5NLLA 2BJEA 1RHQB 3GLGE 4BGEA 3KXPA 1G5RA 2J0QA 5G1OA 1A2KC 2GHTA 4DV3B 3RYHA 2DNGA 3AP3A 5BYAA 4FLFA 1JHPA 1IBSA 3UDLA 2CPJA 4FMPA 3L1VA 5U4QA 1KYTA 1K4KA 5BORA 4M1QA 3TR0A 2R62A 4MV3A 2F43A 4YLEA 1DQRA 3D4LA 4RBUA 1EBFA 3KUUA 4AX8A 3WBFA 2BMBA 3JTPA 2DM6A 3CURA 3NCHA 4DUTA 1YIJS 2ZM6F 3UO8B 4DJTA 1A1VA 1HBNB 3NEPX 1OLUB 1E2IA 1Q1ZA 4GR5A 3KT0A 2PMCA 2CG4A 3ZHBA 4G56A 1RU1A 3JR3A 3KPYA 2WFLA 5K4GA 3WLMA 2IPNA 3F6EX 4IXDA 3DXSX 2XRYA 2B6HA 2JLYA 2QN2A 1QV9A 1QIMA 1P1RA 2EEZA 4XCQA 1BS9A 3D4PA 4UJ5A 1QQ6A 1XDZA 4ZKDA 1HE4A 5I9IA 4LR8A 3AODA 2LCQA 4L7QA 5LM3A 5TGDA 4LF1A 3TLJA 1RWMB 3PP8A 1W85A 2OY0A 1ABBA 5BYBA 2QUAA 4KH0B 3R09A 4HMQA 3LOPA 2JC1A 2XIQA 1S02A 1HTBA 3DS8A 4OLAA 2X6QA 2HZAA 1U5BA 4D0RA 1CNEA 1CY2A 3RBAA 3HN6A 2V7QD 4U8VA 2P2GA 2W2VA 1ODKA 3QITA 1X15A 3ABSB 1BIFA 1F5AA 5JJLA 3B4DA 5ETOA 3VC3A 4B8YA 4TL8A 2ZB4A 3TAMA 1EU1A 4LHVA 4LIRA 1PQYA 2XADA 4Q7LA 3OMXA 3CMMA 5IH7A 1IHOA 3V1MA 1AQJA 3HABA 4G5RA 4M7OA 2W8BB 3QX3A 3DGVA 4H35A 3UKJA 8ATCB 4C7OB 4BAGA 2ZE2A 1U1DA 3RVPA 1QAIA 3MVEA 5K14A 3BJIC 5ERXA 2HGNA 4QUIA 1UBUS 3SR4A 1YZVA 1DXOA 3QLUC 2O07A 3VR5D 4YY3F 4QWCA 1E79D 2K7JA 1JR3D 3K72B 3QATA 2Z6QA 2C07A 3PEWA 1FNNA 3KQWA 4DCGA 4Z2AA 2HA3A 5LNK1 3C1UA 1M6YA 2WHEA 1A2QA 2VHCA 2QE7D 1X8JA 2CPIA 3ONEA 1I9CA 1TKBA 3IBGA 3M6XA 2G70A 3F3SA 3QRWA 2FQYA 1WWHA 2BR3A 3NXKA 2VCYA 2MKKA 4LZLA 1L3KA 1NRXA 1UADA 3FFIA 4JQZA 4WXHA 4QLOA 4PTLA 4DR7J 3KLGB 1O1YA 5FI0B 2HCJB 4L27A 2QQ5A 3OEHA 1W4BA 3D9BA 4EUSA 1NVVQ 2ZNYA 5BQXA 1YR3A 3FNIA 3P8ZA 4BDPA 2GILA 4X54A 1WABA 4OHPA 4UAVA 4ZIRA 3ZU2A 3OR1A 2WPNA 1ULSA 5DLQC 2YKQA 1QNFA 3DOFA 3QI2A 1T1EA 4FB5A 3HDQA 3KPUA 4D9CA 4Y18A 4MWBA 4RUBA 2GA7A 4LF9F 2CPZA 3EX7B 2HAEA 4WFKA 4OIFA 3AF5A 5AD1A 4LRUA 1UMKA 2MCFA 1JB1A 4BQRA 2KJVA 3DDIA 1CFZA 3DOKB 3QUQA 4L57A 1N3YA 2AOXA 3VX3A 1U90A 5ELMA 3Q2IA 3HBMA 1PJSA 3N59A 2R3VA 2DY9A 3VC2A 4NPAA 1QPZA 2GASA 3AHIA 3T61A 5LMCA 3CLUC 4GI7A 3DONA 5EWJA 2AG0A 5DO9A 3NS7A 4WNIA 4FFPA 4DL3A 1G2OA 3LIPA 1DRWA 3J80A 4X7RA 4DR7F 4CM2A 2KB0A 4GX0A 2V97A 5EYPA 3T7EA 4WEQA 3L95X 4FLMA 3X2SA 2ZXUA 3T9DA 1SJRA 3LWNA 2OILA 3ZE6A 2NSCA 1Z5ZA 3KWJA 1JKJB 2GSDA 2IF2A 5C81A 1SC1B 2DB3A 4QRIA 2PEBA 5F35A 3QTBA 1BYIA 3MRTA 1W85B 1DO2A 3KD3A 3NBAA 3K4PA 5I42B 3H4IA 4KO8A 3QG5A 2FSVC 5GV8A 3E1KA 3CISA 4AN0A 4UTRA 3W9JA 4HNUA 1BDIA 1K1SA 1ADCA 3I01M 3OURA 1FKPA 5KNDH 2FWBA 3M2VA 4XYMA 1YRAA 3AJRA 2X0RA 3KHUA 3G2IA 3H5WA 3M8PB 1YI0A 4A92A 3TNDA 4MPTA 3MQ4A 4QYIB 2BFEA 3KV3O 2DNNA 4OZNA 5TMEA 5AVYA 3N74A 2XM3A 4XDHA 3BYPA 1TT7A 3IUSA 4DJAA 1EFKA 1JLEB 2FD2A 5L1JA 3LPNA 3R3UA 2YV3A 3CXCR 4NCAA 1VIVA 3P9RA 4EYQA 3NAGA 3EVEA 1P2BA 2VPIA 2B1QA 1L3BA 1SEPA 2DYKA 4G0ZA 1CQXA 5CIWA 3DLPX 1IUJA 3UWTA 1N57A 3DBRB 4YCNA 5FTMA 1XDDA 4TS9A 5E33A 1EUCA 3HULA 2O2GA 4NG4A 1YONA 3C6XA 1JZTA 1LDNA 1S8AA 3FCWA 4J8PA 3OLCX 5KYXA 1KYYA 2FPKA 5DX0A 2MDTA 4M1OA 5FLXU 2O8FA 4KJIA 2FN3A 5F8HA 4KHRA 1C0LA 1I94B 1RAAB 3ND8A 5BSMA 3IR6A 1D1PA 3V2IA 3N5BA 5KU1A 2AYMA 3LOUA 1JF8A 3BZQA 5D85A 1NVWQ 2BE9A 3PQFA 1BFDA 2VC0A 3ZBUA 5IDYA 1TMOA 3KYIB 3RSZA 2ENWA 1NMYA 4MYHA 4TXJA 4A26A 4U3JB 1U0BB 3MFHA 2XNDA 5LLTA 3ADPA 5F76A 1LRKA 1KEPA 5K3BA 4FNHA 2DJIA 3G85A 4LF2A 1RJWA 1ZXBA 3DKDA 1YB7A 3EUEA 1FE0A 2AGQA 1G20E 3PCRB 5DXAA 3X1XA 5JMOA 1FRLA 1KD1T 1KIAA 2C0QA 4OM8A 2IF0A 2IUEA 5D3MB 4MA5A 4AECA 3PUXA 1WU7A 2IWHA 1RXSA 4NF2A 2U1AA 1TLTA 2GPAA 3DMJA 4W99A 1DC3A 2GYYA 3PFCA 1A9NB 1JJAA 2JFZA 3FLEA 5K3EA 4JLMA 1RPJA 3GJ7A 3V1NA 2XULA 3KJQA 4MV0A 5C18A 1E4EB 3PSAA 3UMJA 1EFRD 1YMVA 3NWEA 2IUFA 3LLCA 3GOQA 4NS1A 4ZZ3A 1Y37A 2UUAB 4RW9A 3E2IA 1E98A 1JTFA 3KM0A 1RADA 1MN6A 3BREA 4BZWA 3A6DA 5SZIA 4X20B 1GOTA 2I66A 1RBMA 2P8SA 4P08A 4LSWA 4ZAWA 3KDNA 2X19A 1JKHB 3N2GB 3IG1A 1GPH1 4FPIA 2EWHA 4ND3A 1WD6A 4J0KA 4WP3A 1L5WA 4ZP6A 2FPSA 3KEGA 4GMGA 1K06A 5I7WA 3KJXA 3QY0A 3GGOA 1S6YA 5DFAA 1P7WA 4QJBA 5ALEA 3KZXA 3JAMY 3M6AA 4WKOA 1VHWA 1ZGCA 1RT5B 3KHLA 2H17A 2IYAA 5IC6B 3UK0A 4Q3EA 1RTIB 2OUGA 2QTAA 3AR4A 5CLQA 1RTDA 2FLLA 1L7NA 2UUAJ 3I92A 2XV1A 5CPBA 1HBOB 2VTKA 3ESZA 3SYZA 1L7OA 1RFGE 4PNPA 2V5AA 3KYCB 1Z34A 2R42A 3LFTA 2W01A 4A8TA 5A62A 3PFGA 2YS7A 4DV5F 4OJKA 5AW4A 3M8SA 1ZZFA 1BHQ1 4PHHA 4C0KA 2AX0A 2V67A 3VYRB 3ROPA 1HNWB 3MMCB 4CMGA 2KRBA 3OOWA 2W8ZA 1F4VA 4FMDF 4X63A 4B7XA 4K9NA 4H6VA 1GFIA 2AA3A 1OSDA 5EXPA 5JZOA 5AKJA 2LCWA 1XZEA 5JOQA 2UU9B 2V98A 2HF9A 3LLVA 4PSKA 3GYGA 1MH9A 1FFCA 4I7FA 5FPKA 5C32A 5JD6A 1FF9A 4OQPA 4B7AA 1QO0D 1W73A 2J87A 2WJHA 4NEQA 3ZZZA 3PRHA 5IVDA 4ENWA 5C8YF 5L3QA 3F5QA 2O3QA 4TKTA 3O8LA 4EG7A 4P5PA 3HXLA 3SBDA 3H7AA 4G1QB 1HKUA 1NVVR 1VK8A 1WY7A 3SP1A 3CIMA 1Z0FA 4HHJA 3PLNA 5CB4B 3CPSA 2DEIA 4IMRA 2HFKA 3U7IA 1GPYA 2IOQA 2ZG6A 2IL1A 4BFSA 2BE9B 1NZFA 3T4XA 5IM0A 3CX7A 3TQIA 4NZYA 5WRFA 3W5HA 4AWBA 5BSWA 4QT0A 4PG8A 4A8JB 2B61A 1TUBB 4MAMA 4ZT5A 5JFOA 1HGXA 4KC5A 1A9TA 2AJLI 3TBFA 4JUDX 2Z2IA 2UUCB 2B4KA 5KCZA 2NZ8A 2HK3A 1P2UA 5HQ8A 2PFFB 2ZH3A 4D3DA 3IRUA 1AA1B 1SWVA 2CDQA 2Q7DA 4LGCA 3IQGX 1E1QA 3BWMA 4N65A 1CJVB 4G6VB 4N40A 4JI5J 3WYDA 1DJOA 1WOYA 4MEBA 4CV0A 3TA2A 2XE7A 5IV4A 4MR8B 2QUIA 2IY9A 2XAAA 4K4SA 3SZUA 3KVRA 5FOWA 2WJWA 4OYRA 3IP8A 3ICLA 3QPAA 4B6QA 5A2QU 1VDMA 1H2WA 2QAGA 4LG1A 2X3DA 1BW9B 3M3DA 1GKLA 3MCMA 3OC6A 5DT9A 1IVNA 1HYGA 4ENRA 4X4OA 3TDMA 4L3KA 3EF1A 2HYDA 1JNRB 1JXMA 2UUCJ 1YS2X 1GTJ1 4KB7A 5IF3A 4DSLA 2MQQA 1RHJB 5LKAA 4DCPB 2CLFB 3NQ41 2FWMX 5EJ9A 3K7RA 3C8UA 2XMPA 1EXMA 1H0KA 1HNIB 4O59O 1H1DA 3NO4A 2AEEA 2Y93A 2AJTA 3URMA 4MRMA 5AM2A 2VJBA 1JIQA 3LCCA 2GPNA 2A6MA 3ITKA 1R8PA 3LCJA 1RKIA 4B9MA 3TWOA 3BMOB 3FJ2A 3TRJA 4OJNA 2BGLA 2ZJQQ 1Z18A 3GAAA 1TMJA 5BW5A 5IG2A 1OY9A 1FMLA 2J31A 4M89A 2N75A 1NUTA 4Z7QB 2YKOA 3UDCA 4C98A 3PXUA 3UK2A 4AKIA 4B9EA 1ESMA 1FNCA 4PLHA 2PN1A 4HCJA 3W65A 3OCYA 1JWAB 3F7MA 3G2PA 2J30A 1IC6A 3W7VA 3PW2A 3VOBA 4N18A 5JPIA 5HSPA 3V6DB 1UJ4A 4C5CA 3HA2A 1YF3A 4RK0A 2QQ0A 5AVJA 2AR9A 3NP7A 3OHSX 3ZFVA 2XWXA 1A5ZA 2WPDA 5HJ7A 1QRAA 3GDFA 1TEZA 3RSLA 4O3PA 4F4WA 2XMUA 2JFBA 3UKOA 5JG7A 4G5XA 1GG8A 2Q9CA 1Z7WA 3A1NA 2AZDA 2B92A 2GDZA 3V1UA 2PUWA 4E6PA 2Y27A 1T8PA 1V11A 4PSUA 4KSBA 2HYIC 4FQ8A 1I2CA 1TFWA 3W9BA 3N9UC 3MN1A 1TU0A 2CVFA 1RQ0A 1E6WA 1R5OA 1QZZA 3KUXA 2HGMA 4MIAA 3BAZA 3KETA 2BABA 2Y1IA 4GIBA 1UEUA 1YQ9A 5C5EA 4N0PA 4WLEA 1JLGA 4CT0A 1XR3A 3JRXA 3VAFA 4P36A 5K6TA 4FS3A 4BX8A 1OXXK 2CUKA 1PJ5A 1RLDA 3MSCA 4KU4A 4U2KA 1NASA 3FMWA 1WZUA 1U8FO 2Z1DA 3T99A 2HR1A 2L3MA 4OM7A 3W8NA 1G18A 2JI7A 2A3JA 3F67A 3TZBA 5HILA 4J94A 2J3EA 2X1LA 1Y7PA 1QAMA 2Q29A 4Q4HA 3NC4A 5FYQA 2Q1SA 1QO7A 3CEDA 3HMJG 2BDUA 4MROA 1W5EA 3D7MA 2Z5GA 4PQAA 4R7TA 3B1WA 3KYDB 2PUDA 3CU5A 1UWAA 1GQOA 1VDHA 2G4BA 3RVQA 2PAAA 6LDHA 2I78A 3OQHA 2AOTB 1DKLA 4WYLA 4KO1S 1RWQA 4ISCA 5LP6B 3WSWA 5AIBA 1ZXLA 1DX6A 3FB1A 2WMNB 1Y3FE 2BMVA 3QKIA 4PG7A 1ZH5A 1JE0A 4G0QA 3LH2S 3BCRA 1B0TA 3CB4A 3QJJA 1FKOA 5L1LA 4MW5A 3LX6A 2AFIE 1SUEA 5K8LA 1VHJA 1DBSA 1QE3A 4EWLA 4O3RA 3L7IA 4IIJF 3U4DA 5CDGA 4J9LA 3QQCD 5IXUA 4DZDA 2QUZA 5TEWA 1URRA 1NZDA 3SXUB 4I4IA 4FQ7A 1PYSB 2IBKA 5AWFC 3SS8A 1G20A 1Q0UA 1RT6B 2VWGA 3HA5A 1J07A 1JEJA 4HNVA 2C8LA 3ZJUA 4DV5J 2F2TA 5KU7A 4MGEA 1V37A 3O44A 2ZYWX 2KFYA 1N6QA 5SYAA 5BO5A 3RLFA 5D78A 1QLWA 5H80A 4KR6A 3IE2A 2FZWA 3NTVA 5LZ7A 1M1NB 4ER6A 2WE8A 1XNRF 2ZZKA 2GKOA 2XYVA 2B2CA 4P98A 1OX4B 2WSCC 3SI7A 1DSSG 4ED4A 1JYSA 2D0IA 3JB9k 4E5MA 3C70A 4DQXA 2EBFX 5AI9A 4EB3A 3REQB 1CULC 3PE6A 2MKHA 1I6KA 3DLLQ 1VGVA 2E21A 4QGAA 2H92A 4HJXA 1DTSA 1UC9A 2V3WA 4JLOA 4C7QA 2BHLA 3R97A 1CSEE 1PN3A 3ZWVA 4PZVA 3AESB 1GUZA 3LT5A 2MZJA 2YJ5A 1CDZA 3BQNB 2HA7A 3G1UA 5EUQB 3DE1X 3JYTA 1MJNA 1ODFA 2H1VA 4H4EA 1PG5B 3PJWA 3FMVA 4DEZA 3P9NA 3FNBA 1H3DA 3T4UA 4DR1J 3GAZA 3RW9A 4HDKA 5HKAA 4QR0A 3BSSA 1N5DA 3TD2A 2K2QB 1FNDA 4KIJA 3PJDA 1OAOA 5DDPC 3FPSA 2KVIA 4PR3A 3DLKB 2AW0A 4DNOA 2CCKA 2Q9AA 4CYMA 1E2GA 5B53A 5T5QA 4ARCA 2WV9A 2Y3IA 3VI3B 4DM3A 4J1NA 4FFVA 2JK0A 3V1KA 1B16A 1HWUA 4RZQA 2BM8A 1Q7RA 2X0KA 2Z4TA 4IDHA 3IN5A 2FFQA 4XKJA 1IXSB 2WWRA 3CLTC 4XSGA 3QPCA 2APJA 1L4MA 2B6NA 3FI9A 4AIRA 2R7TA 3MMZA 3WS7A 5BXQC 3CGIA 1U28A 3PWKA 2QX9A 2ZJ0A 2QVYX 3F41A 3ZWXA 3DDSA 4I0WB 3WK7A 3NRBA 5C8DA 3OZFA 1KE1A 2IP4A 2IZ7A 5U1PA 4C5AA 3PE3A 2C5GA 5FRDA 4IMJB 3ZHSA 3HNRA 2NTVA 1ZRMA 3KG4A 2OCKA 1UC5B 1IATA 4K5QA 3WX0A 4CFZA 4EY6A 1VPDA 3X1LB 3MD9A 4WTOB 1EFUA 2GPYA 3FTCA 5C1PA 4RAQA 1AQ6A 1PYGA 4ZOQI 3RSOA 3K92A 4S0MA 1KXJA 1E66A 3W1YC 3ZNUA 4AJ1A 3FEYB 2PFGA 2VK8A 4CR7A 4XD7D 1I7LA 5GONA 2WVAA 3MJTA 8ATCA 2A5FA 2FFHA 3DU6A 3GWZA 3IB6A 2MJUA 5CFLA 1VQMS 3DFUA 3P4UB 2FEPA 2H7VA 5H16A 4A23A 4O2LA 3A9VA 1ZICA 1SBCA 3V2UA 4V0OA 2R6GA 4PYDA 2G1HA 2IM0A 4G25A 2WJ6A 5GJWC 2ORIA 1Y5RA 1Z5PA 3DCIA 2QS9A 4PZ0A 2AYBA 1JXVA 3TZXA 1ZD2P 4KQJA 3JYQA 4Y2HA 5M2QA 2IHNA 2GQCA 1SVKA 3W5JA 4OF4A 2E6UX 1AYEA 4RTRA 2CBGA 3CUTA 2NZWA 2QI9C 3ZWWA 3T1HJ 2JGKA 2OV6A 3EA4A 4G63A 5CYJA 5DWDA 2FK8A 3C5VA 5AKHA 1T9BA 4H4KA 4RAOA 5FPQA 1M1NA 2E82A 3A3NB 3PYDA 1YDMA 4K0KF 2FC9A 3ZCVA 3BEOA 2E7VA 2A84A 3MZIA 4OZ3A 1ZDMA 2GBFA 3IIIA 3KLHB 3QFTA 4L8VA 3W3AA 1SVWA 1W49A 4AMUA 2QV6A 4Y1GA 4ZIRB 1CR1A 1IZ0A 4B3GA 3EM1A 1PJRA 4O44A 3EYAA 4C8LA 3EWNA 3FUYA 4UY8T 1SKYB 3ZH9B 4CYUB 5EL0A 2PS3A 2EJWA 1NK8A 1JRLA 4NXMB 3K2IA 2ZKUA 3BQ0A 4XWAA 3HEMA 2X0JA 1KI1A 4YV0A 2KS6A 2H2WA 1VXOA 1L3VA 2JHGA 4OJQA 4DV4B 3ZX4A 2Q2QA 5AOBA 4LJ7A 3QV1A 2P4SA 5E5NA 2W22A 3EZ7A 3MR6A 2P6OA 4PQEA 1ZCFA 3RU9A 1GXTA 3JD3A 4CI9A 2ZWIA 5A9RA 3FR8A 1BKSB 3NVDA 4FZVA 2OOKA 2CQ3A 1BO6A 3PEVA 5FNVB 2E44A 2AH5A 3OSZA 4ACAA 4DSNA 3ROXA 3RUCA 4YJHB 3HCFA 3ZVMA 4NBKA 4P54A 1Z63A 3UHFA 2YJ6A 1SC1A 1RLTA 2ECQA 5TDHA 1R0RE 4B3MF 4KKOB 1ADFA 4WINA 3SF0A 3EUNA 4M49A 4R8LA 5I42A 4N41A 4BVFA 2JFDA 4XARA 2BMWA 3OU2A 5ITSA 2FGJA 3PY8A 3EUFA 3VBCA 5HOQA 5D4NA 3ICEA 2RI6A 1FKPB 1VGRA 4GF5A 4YCSA 5CQGA 1BEUB 3H8SA 4DCSA 3GQBB 4I4LA 1E4VA 2FVYA 3IL2A 1KO5A 3KKQA 3ZY4A 1OO0B 3TOVA 3ELUA 3DHWC 3KVOA 2VAVA 5SY4A 3UO0A 1F8FA 1G21A 3ISZA 4C03A 1KQFB 4CKCB 1KS2A 4WA7A 1J09A 1PX0A 1ONNA 3U3MA 4IDAA 1Y5NA 2ZSKA 2VDJA 1QJ4A 2C5FA 1OAOC 2G2OA 1M5TA 1SCDA 1B1AA 3VKVA 1RCTE 3ELYA 3QGGA 1EUCB 4KXWA 3CVXA 4LZWA 5IN4A 3PEUA 1KRPA 3DBRA 3F8WA 3SVZA 1O3YA 3C4VA 2FX2A 1NA5A 3T9CA 5HBMB 1XF1A 1CFJA 2HK9A 3IP6A 3L6DA 4W8OA 3IR6B 1BH2A 3Q2SC 5ETQA 2I5JB 1OASA 1OI3A 1JHDA 5AJWA 2OCDA 2HNDB 2AF4C 4OZ5A 4ZAGA 2W71A 2BJ1A 5HL7Q 2XI3A 4F8YA 4X97A 2A3NA 5BR4A 5EINA 1EK2A 3CKKA 2QRPA 4QREA 4AYTA 1E6CA 4G5OA 3T0FA 3A3NA 2OAEA 1E58A 2JA2A 4ZVSA 2DPGA 2UYCA 2MT9A 1MJHA 4KCGA 4EW1A 1TZMA 2IZ1A 3UOWA 2POKA 2W9AA 3OTWA 2Q6VA 2Y1DA 4W6QA 3G2HA 3NBYC 1A8IA 3LYLA 2GAAA 3AT1B 1HZZA 3M7IA 1NJ1A 5GMEA 2A30A 4P80A 3QO9B 1E1MA 5EGYA 3Q0EA 5C24B 3G6KA 5DZ7A 3R7LA 3J80U 2CIMA 2ALJA 2GJSA 4O4HB 4A5OA 5FAKA 4M1EA 1NP7A 4TLQA 4DQLA 2YHBA 1E4EA 4J3JA 5EPUA 2LBPA 1N25A 4ZVEA 3FHLA 1E94E 1P0IA 4F2WA 1HD0A 1PLJA 4UJ3A 2Q0XA 4ML3A 4ZIVA 1ZLXA 3ZZRA 3BJMA 2LEPA 1NVGA 1OZAA 4OLJA 4CTKA 2Z8QA 3R7FA 3RU0A 3MCVA 1F5NA 1IXRC 2WOJA 1BA2A 4JVMA 3ZK7A 4RW9B 1FBTA 1QIFA 5BYRA 2CL6X 2GEBA 3ZC4A 4IS2A 2CNWA 1S1WB 2WKWA 1Y10A 1HDIA 5ALIA 5C5CA 1QPBA 2G8LA 4W8GA 4DLLA 1C80A 3E2EA 2RKOA 1HNZJ 1AUVA 5TGZA 4TU8A 3I2JA 5HK8A 2XBLA 4KTQA 3LQ4A 4IM7A 2CXNA 2H3EA 3MMBA 4IGEA 2I2DA 3BPDA 4AM8A 3O9MA 4RQUA 2CQDA 3UD4P 4MI3A 4R83A 1RTIA 4XPEA 2WW4A 1RTDB 5EX0A 4R5PB 2DJ5A 5IC6A 5BYSA 3SSSA 3TRIA 4LT6A 2J59A 5K7SA 1U25A 3EFOA 4DR6B 3VR6A 4M94A 3QXXA 2PUBA 3CT4A 1MT0A 1Q8KA 3RYIA 2F3SA 1MXHA 1IWOA 5F41A 4CCHA 1WCXA 3L8EA 3LS2A 5DT2A 3HKBA 2YYYA 1ONBA 5HFJA 1DIOB 2YJGA 1NT4A 5ABPA 4RVNA 3VGVA 3RUPA 2WF6A 4PAGA 3KHTA 5TVGA 4N7RA 1USWA 4DCOB 3GQBA 1AQNA 2ZUBA 4PBTA 4O4LB 1WSAA 1YMUA 1YVEI 4Q19A 2XGPA 3E6AA 1SC4B 1ORIA 2Q3EA 4I7FB 2QIFA 1JU3A 4HAOA 1IVYA 2BSAA 4PFJA 3OY7A 5A8KB 4NARA 3NS6A 2IP2A 3SE7A 1DUIA 1SV5A 4JUZA 4ZQHA 5I7VA 3LZ6A 4ENPA 2ETVA 3NFYA 2VJAA 3I8OA 3PL1A 3UOAB 2CLCX 5C80A 1NKSA 4DLRA 2YIJA 3P2OA 4J1QA 3MEGA 2CQ2A 5HDQA 4XI9A 1U65A 4NCNA 4EYGA 1M5VC 5KFMA 4OGLA 1FFSB 1ANKA 4JJIA 1LC3A 2UXBJ 4IMIB 1M8JA 3NATA 3MUEA 4NBLA 1EHYA 4DPLA 3SCJE 1NMZA 3FFAA 1RJEA 3L04A 1NTOA 2XX3A 1XRMA 1HKAA 2E5LF 3PA8A 2XTZA 3O5AA 3FOEC 1JAYA 5HJXA 1EK1A 3FSYA 2C2BA 2VBXA 3MQ2A 2FWJA 4MJ3A 3L49A 1Z39A 1DOHA 5H81A 1N7GA 4YQYA 1ZPVA 4QIHA 4JROA 3OV7A 1HLGA 1NUHA 2EX0A 1EDEA 5DNUA 3KUCA 1M1YB 3TKAA 3QRPA 2ZSAA 3F7NA 3PRVA 1ONPA 3GY0A 1AKTA 4FFWA 4GW3A 2JH9A 4Q7QA 3EIWA 2Y9HA 4PC1A 2XDAA 3F73A 4ENQA 1YT5A 5ETPA 3FKSD 1DJNA 2V0GA 5LOVF 1B8NA 3W77A 5KMGA 1Y7TA 1NURA 5E4TA 2ZT8A 3KYLA 1MLAA 4KX5A 1N36F 1JI3A 4E4YA 5DM70 4E3WA 1JQBA 3LKVA 2EZ9A 4I3HA 3GDOA 2C42A 2ANBA 3FLBA 4PW0A 2HDHA 1W2HA 1DEAA 4PPQA 1QM9A 3A4TA 3U7HB 3L2OB 2PX8A 3PFIA 1UKEA 4ZGWA 4ED8A 4OJMX 1GRCA 1X0VA 4B4OA 4UOCA 1X7WA 3K0AB 3SIRA 3D6HA 5M04A 4H6PA 1HHTP 4DCPA 4LQ4A 4R6XA 4CLLA 5K20A 3HO8A 3WLSA 2PX3A 2GFFA 1O95A 2VF7A 1D6JA 3OZGA 3R9WA 5HMLA 1TZJA 2IEGA 3ADBA 5KQRA 3WDLA 4MRMB 2CJWA 5TJ9A 1T36A 3HP6A 4RD4A 5M2PA 1ENOA 3ZDBA 1XTVA 1GRRA 2YWEA 4WY5A 4K1XA 4A0FA 4CCSA 1WR8A 3HDYA 1DCFA 2WJJA 5IAKA 3ONWA 4UOHA 3PIDA 4JODA 3DFMA 5ILOA 4ERXA 5JT1A 5ILQA 4KNVA 4DNPA 4OQYA 1U3UA 3FCHA 1M2WA 5BJRA 1J1UA 2VWQA 5KJ1A 2Q6LA 2A78A 1QQ5A 1QSSA 4GOLD 3CVYA 1DJQA 3VM6A 1K3FA 5AQEA 2VQFB 1S10A 2F43B 3ED1A 1SXQA 4K28A 3LL7A 4AT1B 5C2JB 2GBGA 5K8NA 5EKUA 4CL2A 3EXEB 1HBNA 1X8LA 4IAOA 1P0PA 3DRPA 1YS6A 2ZLBA 2P68A 2QE6A 5KT5A 4LUBA 1RJ9A 3EJ6A 3BSWA 3SX2A 4KE6A 1LFAA 1X86B 3T6KA 3ZK9A 2EHJA 3OT1B 2MLYA 2ZOGA 1QRTA 2J3HA 3P9IA 1BXZA 4G5HA 1H4TA 4G85A 1SCJA 3LQVA 4YMWA 3E9QA 1CVLA 1FDOA 3HO6A 3X3HA 4LHYA 4DDFA 5DISB 3A4YA 1Q8LA 4HI0E 1DBIA 4B3JA 4XGKA 3LUPA 4YJKA 3HKCB 2NNLD 1S0UA 1U2SA 2W00A 1QFXA 3CJ2A 3TQEA 1YQTA 3DKIA 4KGZB 4TKLA 1GL9B 5LQRA 3AUSA 3A05A 2QBYA 5GZ6A 3W2GA 4P1ZA 4NBTA 1GA4A 1S6OA 2WIBA 5TF0A 3VZPA 4YS6A 2XNKA 3GZ7A 2EC5A 3BO3A 2W7TA 5HOEA 3RUDA 1NNEA 5EDWA 5IKOA 2HQIA 2C99A 3PV8A 3DO6A 5SZHB 1YITS 5JMWA 4ED0A 1OXUA 3TQRA 3R7WA 2XQJA 3P45B 3LY5A 4AY5A 5FLEX 4KQWA 4HVLA 2G1PA 3ESYA 2J6HA 4Z9BA 3OD1A 1OBVA 3GUYA 1GTZA 5SZTA 2HPUA 2QAJA 2QWXA 3CUWA 2PT7A 4QRDA 3WGQA 3TZYA 1Y63A 2ATEA 1GPNA 2R84A 4OAOA 4P22A 1WB6A 3EZLA 3P6YC 4J2HA 4RVFA 2B9WA 5L6MB 2WZCA 1Q77A 2IVFB 4P52A 4L9AA 4GGMX 1FKOB 1QONA 4YRGA 5HUQA 1ZMXA 3K6SB 1A9XA 1P74A 1V96A 3GD5A 3TQCA 3RRBA 4RX6A 2WG1A 3SZ2A 1G20B 2LPMA 3KZOA 4DDTA 2DO4A 4J0CA 2MKYA 5RUBA 2QQGA 3G89A 1J8DA 3AEKB 3VA7A 2DT5A 4CIWA 4ZJUA 2SBTA 4KH1B 4HAYA 1GGJA 3ADAC 1Z16A 1VKZA 3I9JA 2ADBA 2KHCA 1RT1A 3DMRA 1Y9EA 2G9OA 4I6GA 5DGCA 2COEA 5MAOA 1MN9A 3N8DA 2NYHA 3IOCA 4HRVA 3UIEA 1RYRA 3GP9A 1O9GA 2OPPA 2HC9A 3T9NA 3GLSA 4O1IA 5IT9U 4K4WA 3PX6A 2ZITA 2HWYA 3OPYA 5BRAA 2B1JA 3HHLC 4DAEA 4IPTA 4OU5A 1JXOA 2D6FA 3GFTA 4M1MA 3PU6A 1E7RA 2A0FA 3A3PB 5KFRA 4D6YA 3REQA 6REQA 1V6AA 4MKYA 5KNBH 4LK3A 3AG6A 1TD1A 3N2IA 5KSZA 2PH1A 1IN8A 2QYTA 3O83A 4O3FA 3G5MA 3KK1A 4CLYA 3L0CA 5J2TF 1JLMA 3ZBTA 2BTQA 1ESDA 3OR2A 5GMKa 4NLXA 3FHJA 5ALQA 4HY3A 3ZXWA 1OLOA 3AF0A 4EI7A 2BCEA 1NAHA 2MQPA 4O0NA 5D84A 4J07A 3CCLS 1Z45A 1U63A 4KAXA 4B82A 1H42A 4XSVA 4FDVA 3IUBA 1DXHA 1J8FA 3DRPB 2WSBA 1I3NA 4IFIA 4EY4A 4KVGA 4R05A 1KK0A 1Z36A 3NDIA 1B2RA 1E5VA 4GLOA 2OT3B 3ENZA 3KLIA 1ZNWA 1FP1D 2VDKB 4JKOA 1L5RA 1O5TA 4P3OA 5K3OA 1DG1G 2HAIA 1UBKS 1FD8A 2QGNA 2GXQA 5HATA 1GRQA 3CDEA 5CYGA 4KSEB 1L4BA 1WNFA 3GLHE 1G291 3BG5A 3HFVA 2ESRA 3RB3A 3FYHA 4RQTA 1UBCA 2Y0BB 3KHHA 1RACA 4NZ7A 1VK3A 3W34A 1MF7A 4HUQB 1JSLA 4YLGA 3KK3B 5JVHQ 5HUJA 4LSLA 3ITNA 2H4ZA 1ZOIA 2XE4A 2LD4A 4PZAA 5DBIA 4R5HA 5EZYA 2ZB3A 3NEAA 3AR5A 4V38A 2H54B 3SNHA 1NK4A 1GFWB 1AN9A 3N0WA 3SVLA 3EAFA 4F6CA 4U2FA 2BFAA 1AUPA 3WC4A 2GZOA 4P92A 2GLUA 3P45A 2ZYTX 2Q1YA 1TL1B 2QLXA 1VE9A 5IJ9A 3EUWA 4RSGA 2EGGA 1YGYA 5GONB 2CEAA 3L0YA 4QAJA 2O52A 2O5EA 5EN4A 4Y2AA 3HKDB 4QD3A 4RU9A 3KLFA 1Z26A 5E41A 3H2YA 1U0HB 4UZBA 1EUZA 3T1HF 3QYJA 5KSPA 2VQ3A 3OZAA 2YWWA 2F9JA 2VPWB 2PEHA 1CG6A 4RMHA 1RGVA 3DE7X 3RTDA 4OHOA 4FFNA 1U7PA 2BZGA 1VTKA 3N53A 3JQRA 2DHCA 4R2XA 5EP4A 3WB2A 4C4RA 2C9YA 1ZESA 4MYCA 3SHFA 5ADHA 4K50A 3HN2A 3FNEA 1CVRA 3X1ZA 3G2QA 2UXBB 1HNZB 1K5PA 1PD0A 2CVPA 2OWEA 1IUKA 4A8HA 5JDIC 2MSKA 4A2QA 1H94A 4DV6J 1U4SA 2Z6VA 1KOLA 2GWHA 3C5WP 3F7TA 3G79A 3I5XA 4D8YA 1ENYA 2DG2A 3TGWA 5KYUA 3F2IA 4BWJA 3NC1C 2ZCJA 5MHTA 3EPHA 3A3PA 5KYYB 5D3MA 6REQB 4JV1A 3QJLA 4CYUA 4O44B 3GLFE 2PD6A 2ZRMA 4CT4B 3V8MA 4R0NA 2A14A 2RK4A 3PIIA 3B5JA 1YU6A 2H18A 3H84A 1SNYA 3F4LA 3KJQB 1JJ4A 1VRUA 3STWA 2AI2A 2KH9A 2Z8YM 2JK1A 2YXLA 4FX2A 1GLGA 2X1AA 1K3TA 5GADl 1M2GA 2VZ9A 2HYIB 2R85A 3ZBPA 5JJBA 1HWIA 1PR4A 1GQSA 2PKYX 1V1RA 1ULAA 3IS3A 2Q66A 3U4MA 4HGZA 4MOWA 2RRNA 2ZI3A 2RGEA 5SY6A 3AEUB 3PUZA 1IBMJ 1FLDA 4BNIA 3TZHA 3TOZA 4RXMA 4FILA 4PPYA 2O1SA 1AXQA 3HP7A 1IBKF 1X80A 1MW8X 2WYOA 1JIIA 3CC4S 4OLOA 3UK7A 4YC7A 3MJ4A 3KFXA 3IM8A 1W1WA 2Q5CA 1ZEJA 4H1VA 4CO1A 3PM9A 4IO9Q 3K96A 5THKA 3UATA 1R7IA 5FD8A 3DOCA 5JD4A 4YO8A 5IVPA 3MTJA 2HRTA 1PZHA 3H0PA 1XK6A 2PY6A 5JYEA 3VZQA 3A1YG 1B41A 2QMWA 2WD7A 2VRBA 2H54A 1PVDA 2PXAA 2AJBA 2A2CA 4P75A 2EJCA 1CRZA 2PYZA 4UBMA 4RKRA 4Q4DA 4YJ2B 2DBZA 3AHDA 3UYKA 5LJLA 2CKDA 4B75A 3AI2A 4ZU1X 3IJ5A 3P32A 4LRWA 3AMVA 5HN0A 4ESOA 3O8QA 2NZVG 5ETNA 4M8LA 4JUBA 3PC4A 3MF4A 4B9NA 4XWTA 4MUFA 4QDOA 3IEVA 3EQ7A 4G9EA 2A1TS 2GO7A 4MYRA 3OTQA 1VC0A 4L85A 1P5HA 4URFA 4GOXA 4U6SA 1PBTA 4X4QA 3UJBA 4C20A 1I7PA 2PJRA 4G1QA 1PGQA 1EB8A 3C43A 4C2AA 1Z28A 5BNFA 2GEJA 2HA5A 1DLJA 1NIPA 4IRMA 2D1TA 3QEMB 2I87A 2RGXA 1C3JA 3I0RB 2OUIA 5F3WB 2H1FA 3OOHA 4II7A 4Q12A 3VJKA 3ND6A 1ECCA 2CWXA 1MAUA 3M3PA 5IJZA 2RK3A 5CXSA 2Q27A 4XLTA 3SQGA 3DFEA 5D0RA 4F9TA 4QUGA 2HNZB 4ESHA 5I6DA 3U3KA 1JH8A 1N5KA 3ZBQA 2OHHA 2P6MA 1Z2NX 2IYRA 5BV2P 1AU9A 3GSIA 5C24A 1V45E 2ABYA 2UUWA 4HXGA 4Q8EA 2MQ8A 3HYTA 1A88A 4UUPA 3IUEA 3LA8A 3BC1A 4JI8J 1JUDA 5DYGA 3QO9A 1K8XB 2DRAA 4WNAA 3BE8A 1XEAA 1TTTA 4YUZA 4QT4A 4ER8A 4MWEA 3KXDA 5SUHA 5CLFA 1QD1A 2GVZA 1EGVB 2GFQA 3UAVA 2HRUA 2B7BB 3ZNPA 4C6TB 3BXPA 1WV1A 4JKYA 2HSGA 1N1DA 2ZI5A 3VHLB 5K0GA 2Y8EA 1KL7A 4CL3A 2IRUA 4HEA1 1U1GA 4FNAA 5KT3A 2V63A 2NUPB 2HWUA 4N3CA 2GERA 4DNQA 2PUVA 1S1WA 4WZAB 4RTLA 5FWXA 1V4VA 1T9XA 2FLVA 1NHGA 3Q3IA 2EFNA 2DISA 3BJRA 4OQLA 1NQXA 3DNMA 1FMTA 4MYSA 4XWYA 5I9MA 2JDID 5F5NA 3LECA 3AY3A 4GG1A 3BH7A 1DTTB 3O90A 1E6MA 4LI0A 3NP9A 3EFOB 1ZIXA 1US8B 4GWLA 1DAIA 3RABA 5A4AA 3JSBA 3A2LA 1WAMA 3GE9A 1Z08A 4CL0A 1AO3A 4PNZA 2WSYB 5JMNA 2UUPA 4EHJA 1G1XA 4LC1A 1LEOA 1P2DA 1W6RA 2XQFA 4KRYA 2A6PA 4UNPA 2HHHJ 3WK5A 3G0OA 2OZPA 3OPMA 4A46A 2YMQA 2CXUA 3RSHA 2GAIA 4L0QA 2N3ZA 3WGZA 3D59A 1LWEB 5KFCA 2Q3PA 1HX7A 2HKEA 1KHVA 1R4AA 2V8GA 1A71A 2CWDA 5EP3A 4KREA 3E5NA 1H66A 1Q16A 3R8FA 3C5CA