1XTZA

Crystal structure of the s. cerevisiae d-ribose-5-phosphate isomerase: comparison with the archeal and bacterial enzymes
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
246
structure length
246
Chain Sequence
EDAKRAAAYRAVDENLKFDDHKIIGIGSGSTVVYVAERIGQYLHDPKFYEVASKFICIPTGFQSRNLILDNKLQLGSIEQYPRIDIAFDGADEVDENLQLIKGGGACLFQEKLVSTSAKTFIVVADSRKKSPKHLGKNWRQGVPIEIVPSSYVRVKNDLLEQLHAEKVDIRQGGSAKAGPVVTDNNNFIIDADFGEISDPRKLHREIKLLVGVVETGLFIDNASKAYFGNSDGSVEVTEKHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the S. cerevisiae D-ribose-5-phosphate isomerase: comparison with the archaeal and bacterial enzymes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
molecule keywords Ribose-5-phosphate isomerase
total genus 77
structure length 246
sequence length 246
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2004-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xtzA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xtzA01
2BKVA 5IT4A 1ZPVA 4OQQA 4GO7X 4M8LA 4PWUA 1YBAA 1SC6A 3IXQA 3K5PA 3EFBA 3BXGA 1RWUA 5HJ5A 3CSSA 2QSWA 3TUZC 4LUBA 3AAWB 2PC6A 1FRZA 3TUIC 3AB4B 2MDAA 2ZHOA 3ENQA 1FS6A 2RQKA 3W7BA 4L4YA 1Y7PA 1PSDA 3P96A 1U8SA 2J0WA 3IBWA 3MAHA 1FS5A 1PBTA 3HHEA 3DC2A 1NE7A 4GO1A 3L7OA 1FSFA 2J0EA 3UW1A 2F1FA 2O0MA 2P9CA 3N0VA 1HORA 3MTJA 3ENVA 5T41A 3OFEA 1YGYA 4IO1A 2WU1A 4L4ZA 1LK5A 1O8BA 1JT9A 3E7FA 3DDNA 1FQOA 3DHXA 4X84A 4NMLA 4TM8A 2W48A 2P9GA 3OBIA 2P9EA 2RQMA 2JHEA 3LUYA 2NYIA 3DHWC 4L51A 4GO5X 3NZEA 1UJ5A 2QMWA 3S1TA 2R5FA 3NRBA 2RI1A 1UJ6A 3LWDA 2I9SA 4L50A 4R9NA 2DTJA 3BXFA 3E15A 2CDQA 1CD5A 2J0XA 2PA3A 2OKGA 4R7TA 2LVWA 4L5JA 1XTZA 3AB2B 3BXEA 2DT9A 3NWPA 1M0SA 3LOUA 1VL1A 1Y89A 4L5IA 3OC6A 3EB9A 1DEAA 3KV1A 3LHIA 3HN6A 2RE1A 4GMKA 5FIIA 1KS2A 2QRRA 3OFGA 3U7JA 4TM7A 2QMXA 3OFFA 4OQPA 2BKXA 2GNPA 1UJ4A 3BXHA 3OFHA 3ENWA 2F8MA 1LKZA 3MWBA 3TX2A 2RI0A 2JOQA 3ICOA 1HOTA 3O1LA 5IS2A 2FGCA 2H9ZA 5IT0A 1LK7A 2LQJA 3TUJC 5JJBA 3KWMA 2KO1A 3CEDA 3CH7A
chains in the Genus database with same CATH superfamily
2C2NA 3ZJVA 2IH4A 3B6JA 3LP0B 1Y48E 3D6TB 3QWHA 2QG9B 2V6IA 2UU9B 3TK1A 3P9CA 2ZS9A 1JQDA 1N2IA 2C96A 4IUFA 3VSAA 4HNTA 4I1RA 5DHRA 1NKVA 2Y1LA 1D1UA 1RCUA 3H0KA 1JQAA 3HXPA 5K0EA 1CP3A 3WQBA 1G0NA 2DH8A 4Z7CA 4W7SA 3LIPA 2BSQA 1IONA 3DXYA 4FWBA 1M5VC 1UJ6A 4D25A 1MA3A 3FVRA 2DTDA 2HRYA 5CX4A 4GMDA 4R1NA 1ZQ1A 3IOMA 3VAZA 3G3EA 1NVBA 4POOA 3EQ7A 2Q1WA 3KWLA 3E2PA 2W6JA 4IINA 1UDCA 1FJGB 2DCMA 1N6RA 4HPWA 3W9JA 2H3EB 1QPBA 4NXMJ 4OH1A 1QIKA 2WCXA 2QRVA 3TTYA 4F9FA 4UUBA 2PZLA 2E48A 2YZNA 5TGDA 1JVSA 3DZIA 4A47A 4CTOA 1EUCA 4BGEA 3A4IA 3VR5D 1H23A 3BH6A 4FXPA 2CJAA 3L4KA 1UJBA 1D8AA 3G5LA 4HACA 5DYGA 1Z63A 3NHAA 4IIYA 1MB9A 3RYFA 3MTJA 2XB6A 2G1AA 2XE4A 4I68A 4NZZA 2MLZA 4LC9A 4Y2QA 3DRPB 3QBDA 4B3HA 4F7DA 1FDWA 4IDPA 2PFGA 4C8MA 3F3MA 1NSKL 2MY8A 2GEDA 5HZHA 4U2GA 5CNMA 4YJHA 2BYTA 4YT2A 1K8YB 2C3YA 1FA9A 1BX0A 3N07A 4M1YA 4GVXA 4X62F 2AZTA 4CCWA 3EXG2 3SE0A 1YA8A 2JCGA 3P0IA 5K0FA 4UMVA 2Y1GA 3F67A 4XOUA 4I9UA 3VO9A 4ZITA 4YJGB 2VJLA 5JJCA 1KZ1A 1EFPA 1XWWA 2K2QB 2IY7A 5E6UA 3IHTA 4KE5A 4LF4J 2FEXA 3QYPA 2PUHA 2CNKB 1JP7A 4NXNJ 4MDEA 5A05A 2A7QA 1HD0A 3LDFA 4WXOA 3WADA 1FRKA 3QKTA 4Q03A 1UC5B 4MRRA 1VRCA 2ZAOA 1YTUA 2HDWA 2FZLA 4JJAA 4EFNA 2ZSFA 3BK2A 1HW9A 4YMGA 4ZYYA 3HV0A 4E3WA 4CM3A 4A8WA 1DX6A 3NRCA 2W01A 1Q1NA 3C3AA 3VR3D 3RVNA 2GJSA 1YBTA 2RHJA 1YOBA 2BJEA 2ZJFA 2E5WA 4CO5A 2H92A 1RAHB 1OXBB 2ZJZA 3M6VA 3FKSD 5KINB 3MUNA 2ASJA 3OL7A 5CTAA 4IG3A 1JLKA 3DE0X 2V98A 3JS5A 3VC7A 1WCIB 5E0OA 3GP9A 5HF6A 4B5KA 3UQZA 3OWHA 3IBCB 1DAEA 3OTCA 3CJSA 4K4TA 1DIHA 3HFRA 2G6BA 2DKFA 2PFKA 1I6MA 3G87A 1XEWX 1YZNA 3NTOA 4MPJA 1OPZA 2XLBA 2J5QA 2NSYA 1KQ3A 4HRYA 2I4RA 4UULA 2IHKA 3QRPA 1YONA 1Z2EA 5TRTA 1L5HA 1E6LA 1FNBA 3LQ4A 2G9ZA 1WPRA 5I51A 3P5BA 4F4CA 3HUDA 5C1OA 3M8QA 1RWWA 3D8SA 5BUZA 5DVZA 1L3CA 1E77A 2CNLB 2P4QA 1W73A 4DNQA 5KMGA 4DLYA 2ZI6A 5CB4A 4KV8B 1W2HA 3L6DA 3CG0A 3QTBA 3R0JA 3DH0A 3LWMA 5LYJF 4KGVA 3NV9A 1NRKA 2O8CB 4DHEA 3C14C 1RBZA 1S7CA 3KZMA 3I0SB 2VDWB 3M4JA 4IHJF 1JKJA 2V7WA 2UXDF 4DR3B 4RZRA 2WINI 1R8YA 1C2PA 2YVQA 5IJ9B 2G7MC 1WZIA 3EWIA 3FDSA 5D0HA 4QU9A 3TLGB 4XDDA 4ZMBA 3EGXA 3TKLA 4ND8B 3A9WA 3SYTA 5EFZA 4LKRA 5EGNA 2JLBA 2R47A 3PI7A 1USIA 2H1CA 4BNFA 3TJZA 3DUWA 4YK7A 3PR5B 2IKSA 4ENTA 5K8PA 3SI8A 2CL6X 4OU4A 3OUYB 3GUHA 9ATCB 1YQEA 1FDNA 4HFRA 1AN9A 1TC1A 1EA7A 1Y8RB 4JI7F 1PCXA 1VGRA 4WYLA 4PTZA 3RB6A 2VPPA 4EB6B 2PMFA 2DNQA 2O3RA 3F8WA 2KT2A 2EU8A 2B34A 1RTIA 5EZYA 4DR7J 1C81A 2LQ9A 1QRUA 1VK8A 2BFBB 1P1KA 1WKLA 1L4HA 4IR7A 5BN4B 3AB3A 3T41A 4A8TA 2ZM5A 3MMXA 1ZNQO 1AV7A 4NJEA 3ROXA 5AVUA 1Z08A 4DL9A 5IASA 4I4NA 1QY7A 5CDGA 4DCUA 3U7JA 3WOVA 1NW3A 1XRMA 4CTKA 4UUXA 3PKYA 2BOAA 3TIVA 1KYQA 3OY7A 1F1BB 4RJ2A 5JISA 3HLTA 1BXRB 2DLCX 3UCEA 4II3A 2P8IA 2C4UA 3PICA 1JQJC 3LT4A 5JAUA 4BP9A 2BHSA 3GIKA 2GJAA 3QIVA 2XGMA 4JR0A 4DLNA 3M0EA 4GGMX 3SJCA 1XU9A 2QTGA 4HDKB 1KI1A 2CMFA 3OOSA 1YV9A 3O1HB 4GICA 5KSOA 1NMQA 4H4KC 1E96A 3OQNA 5BV2P 2BDPA 5K0ZA 1HTBA 5JNRA 1RYZA 2WM9B 3T7DA 5KIAA 2YYYA 2VR1A 1JB1A 3T52A 4DV7F 4MV8A 2B3TB 5LMUF 4QVKA 1R27B 3PTZA 2HW3A 3MTDA 4CR8A 4JJEA 4H4DA 3PVZA 3PFCA 5LXYA 1YFJA 1J49A 5D3GA 5EUMA 2O23A 3WLLA 1HNVA 3NEPX 3EOAI 4BLTA 3O38A 2H0AA 2V1UA 2C54A 4YJ3B 2DR5A 2KN4A 3W5DA 3F9IA 1YIOA 2OQRA 3V4IA 5CA0A 3WDSA 2QJOA 4IILA 1YG0A 3UF0A 3DMYA 5I7VA 3C3JA 2IYEA 4ARZA 1AUXA 3U56A 1LF5A 5DBEX 1PAEX 4P93A 1SGWA 5EPOA 1KDPA 2V8PA 3ASUA 5IMSA 2IWHA 5JJKA 1UP7A 3CVUA 2IEYA 2XH8A 4Y34A 3VR1A 2E85A 3JQEA 4YIHA 1RT7A 2OO4A 4M36A 3ZIUA 4MW4A 4WE1A 4RKEA 4R71A 2FQYA 5AI6A 3ADAC 3ETCA 4LF4F 3UAVA 1ZK4A 2W6MA 1CUWA 2G9RA 4CODB 5ALEA 5JV5A 1B74A 3QWAA 4YRPA 2WA1A 1H5UA 3F6SA 3MTIA 4W82A 4INJA 5DBGA 4NBKA 2O1WA 1KQSR 2YNMA 5TGZA 1P4AA 3QM1A 4MAMA 1SJFA 2VJYA 4BFUA 4ZARA 3F6BX 3TNDA 2W6IA 1JNZB 5DBHX 1IZ9A 1ZUNB 4FC6A 4XWOA 2OCLA 3PJGA 4CKYA 5HQMA 4B3OB 1ESMA 4FDFA 2O0LA 1OXXK 4HQFA 4O29A 1SVOA 1XQVA 2YOFA 3QO9B 4R51A 2YKPA 1S6QB 3AUAA 1UDWA 5FYDA 5IF9A 1FE4A 4CHGA 5KTMA 3WY9A 2F1JA 1GQRA 8RUCA 1CSEE 5BQPA 2MSDB 3L95X 2FJWA 1HORA 2PJZA 2IP1A 5G40A 3BYZA 4B7CA 2VWPA 1WDKA 1GNQA 5DETA 3EPLA 2UXBB 4E6EA 1AVTA 2IITA 1IG3A 3B6MA 4F6RA 3U5ZB 1WHSA 1UKBA 5JUWA 3HT0A 4EYHB 4WXEA 1H93A 4HDNB 5CHEA 2KG1A 4Q1FA 3U48A 3PRVA 1ZZEA 3VH3A 4JB8A 1NXPA 1P7ZA 1YJQA 3QEBZ 2R9LA 5G3ZA 2BTOA 3EBPA 4EW2A 5IM0A 2FPRA 2DJWA 4KSYA 3IMQJ 1ZMOA 1KE2A 3DAYA 4D4LA 1Q1EA 4O3MA 1M6YA 4DF8A 4C0OC 3OQBA 2PSFA 4WQMA 3UT0A 4LYGA 3QEJA 4AKHA 2LQ5A 4M0EA 1LVHA 1WW2A 4ID9A 4C5BA 1J5XA 1UBKS 2JAPA 3SDBA 4YS6A 1DO8A 1YFZA 2JZCA 1QHHB 2I03A 4I66A 1VPDA 4GLFA 2QAGA 3D9QX 4P84A 3DW3X 3LHDA 4UCFA 3M4ZA 1RT1A 4X24A 5CUQA 5ALJA 3MR6A 1V0JA 3NOQA 1OWOA 3Q8QB 2GUGA 4L8GA 1K9MT 5E1BA 3NJ8A 2AJDA 3TQHA 4G56A 5JSKA 2AMJA 1U6FA 4B0OA 4I55B 4A1FA 4OMUA 4I6EA 4QR2A 2W8BB 1E2QA 3OZIA 5LDHA 1LWFA 2WVBA 1Y9EA 2WOJA 3BRWD 3BVPA 2I8AA 1NF2A 4DPLA 4LHWA 4PYMA 3MJVA 2GEVA 2VF5X 4O5AA 4ARVA 5A04A 5HW0A 3D9BA 3PWKA 1DQNA 1JI3A 3LPCA 2AG0A 4M1ZA 1HOTA 1N5OX 3MAAB 2DBQA 3LZDA 4C0QC 4J6EA 3A1DA 1N2HA 2E5HA 3KUGA 4PO9A 3KKEA 4Q9LA 5JH7B 2OBNA 3DUFB 3ZJ4A 2BW7A 4JOSA 1F3VA 3PNVA 3GH3A 5SUHA 1FWKA 4N8SA 1IWBB 3VAYA 3BKXA 4QELA 3FTNA 4ZJYA 1O0PA 1OA1A 2A8YA 2ZSBA 2VHTA 1F2UB 4OM8A 4XFJA 1SZPA 1XZFA 2ZS8A 2PTHA 1UKVY 2QLMA 1DJ0A 3JQJA 3KXDA 2QGZA 4ALJA 1CYDA 6Q21A 1H2WA 5IV4A 5EDWA 3I4PA 3OMWA 4ED1A 3WC0A 4LAFA 2CWWA 3L7CA 3N6XA 4YGXB 3WWDA 2F3SA 3WE7A 4CJXA 5J5VA 5JNTA 1V37A 3E3MA 5CLLA 1E2UA 5CMLA 4R0JA 3LWNA 3MGBA 3BORA 2J6BA 2CZQA 3HD1A 3F6RA 1ECCA 3NGUA 4BAUA 2PUVA 4MW6A 3D8NA 2WSEC 1NBHA 1PV2A 4KGDA 1VPWA 4DZDA 1TAGA 1ZWKA 3C15C 2HHWA 3W1EA 3RU3A 3UD4P 1UETA 3H97A 1CLEA 4WXPA 3O8QB 3GLRA 2OBBA 2FK8A 3TX6A 1ONBA 1N9GA 4IV0A 5AXCA 5B7NA 3SC6A 4R01A 2GBFA 1TZ2A 1KRHA 1MG0A 1DOZA 3PRJA 2AEEA 3P4UA 1XAGA 3K73O 4H1UA 4OHMA 4L6V3 3GT0A 4RHYA 3QNWB 3I5XA 3ELYA 1Q8BA 4DHWA 2OO7A 2RC6A 2XKBA 3BBLA 3NNDA 4B6QA 4KXLA 4EABA 2ETVA 4L5JA 2JBAB 1BGWA 4RUKA 5G0TA 1B73A 3LPYA 4MUMA 2HJWA 3D4JA 1VRVA 2YHAA 2GX8A 3V7YA 4EKEA 4C7JA 4UOGA 1GEEA 1TUVA 2H2DA 2DHDA 2GBIA 3PUIA 3L93A 2P0EA 3ZHXA 1TAUA 4M9ZA 2QX9A 1NL3A 1LBTA 1ZPVA 2FLNA 3QK7A 3MCVA 4PXDA 1P39A 3N0WA 3MJ4A 1KEWA 3F41A 2RH4A 3JU3A 2DPYA 4BLUA 3DKIA 1GMWA 1BNCA 1RE0A 4RZ3A 4A3SA 5JZVA 3N2KA 1GGKA 4CNQA 3RHZA 1R0RE 4DPOA 2QA2A 3TZQA 3VFDA 3PW0A 4AXXA 4LF6F 4KE9A 1JA0A 5FLKA 2F3QA 3WIEA 1ZZGA 4TTIA 4DV7B 2V34A 2V8HA 4MCAA 1HOXA 1X9WA 3FYCA 1HNZB 1IOZA 2QJFA 2IOFK 2YV1A 3AF4A 1VR6A 3JASB 2ZCVA 2JATA 1YACA 2XUPA 1PYDA 4XYBA 4MYHA 2NVUB 1X42A 2VDVE 4JI0J 2BOVA 3RVKA 2GM9A 2NO0A 1ULAA 1ZSNA 2OV4A 4Q7QA 3VVUA 2ECFA 4BNYA 1P80A 5A5FA 5A6VA 4IIXA 3DB1A 3FMFA 1QKKA 2C1XA 1P1BA 5FLXU 1R5OA 4EGJA 1FRVA 1UTAA 4J1TA 4GKAA 1A7AA 4YP3A 3C1AA 3CT4A 2VP6A 5L3VA 3B70A 4F45A 5CITA 2JDIA 4KPFC 3KT8A 2JLCA 4UFOA 5EKUA 1JXEA 3UW1A 3OSUA 4LOLA 1CDOA 2BKUA 1E5DA 4ZFNA 5LP6B 4ES3A 3IT0A 5IZCC 3H8WA 2V54A 2V6JA 3PR2B 4QQFA 3FRZA 3AJAA 4UQGA 1PGPA 4WGGA 1QTQA 3KKPA 1X9SA 2DETA 4B6JA 4ZGGA 3NKLA 3TF5A 2HMIB 4RZUA 3FNNA 1PJ3A 2FRXA 2OPSA 2CLCX 4AKTA 8MHTA 2P75A 2DF8A 2CJ9A 5E38A 3WJ1A 3B53X 2IIBA 3WMEA 4K1LA 4R2MA 1IOWA 1HL7A 2ZT7A 2I2YA 3A4VA 1PR4A 3IP1A 3QWIA 3QUBA 2OEKA 1QP0A 1B41A 5ICMA 4RGBA 2BM8A 5CYPA 2RAVA 2ZH7A 1VQ7S 2NSHA 1XP5A 1H38A 2LEPA 1M0EA 2W2LA 4UD6A 4G0QA 4B3TJ 3CY6A 2H59A 4KFBA 1S1CA 3A3NA 2HY7A 3EC1A 4PONA 5IKOA 1PI3A 4MWTA 2GPNA 1MW7A 2P79A 2R8IA 2X1MA 4F7VA 5I3UA 1ICIA 3N5BA 1U5BA 2YMPA 4JEHA 4ARUA 3ON5A 3L9ZA 1Z4JA 2O1XA 5I9BA 1QWSA 1JA1A 4IHJB 1AE1A 2AE2A 4RGQA 5JY1A 3HVKA 3LUKA 4WADA 1G3RA 3LRTA 4UUQA 2XXJA 4M3NA 2OILA 3DZGA 2VPQA 1NRWA 2IYYA 5LQRA 4GX0A 2H85A 3VVTA 1WDMA 3HT3A 1AF7A 1Z16A 5J3JA 4L27A 3NNAA 5HF8A 2COUA 2RE1A 1H2XA 5REQB 1LPSA 1SC9A 1U80A 4TKMA 3CUYA 2P3OA 1ZUNA 3BSAA 1N6KA 3DT8A 1QHIA 1JDJA 1DBQA 4DCJB 4FMDF 4FYHA 4KYTA 1L5NA 1GL3A 1K8AT 1IPFA 4BVJA 4HZUA 4FMDB 1I6KA 2UUOA 1JPUA 2RDMA 1VJ5A 3K5LA 2VKQA 1E94E 1R3NA 2GPSA 2Q9AA 2H57A 4PLWA 4ZD6A 1M2NA 1SKQA 3LX8A 2HGNA 1FHTA 3UT6A 1YKSA 1F0NA 1E64A 1IN7A 3HGQA 2ZJ5A 4Z1MD 2JAUA 2X6RA 1SVDA 3ICWA 4ZXFA 4JI3B 4YQWA 1I0LA 1QC5A 1CVLA 2RGBA 2CVZA 5GAJA 4U7UK 5ADWA 1MW8X 3FUCA 1VIDA 4C06A 1KO8A 3D8BA 2GPYA 2GJIA 3MR2A 3W6UA 1ZRHA 1NZJA 5H9VA 3UENA 1QG0A 1ADGA 1GTHA 3BE6A 1LTHR 4GDMA 4I81A 3NVDA 5K20B 2LR0A 1E7MA 1T0JB 3RRMA 4INPA 4I4TA 4QBGB 1WZEA 2D3O1 1YQGA 3MCTA 2HNYB 1B0PA 3TGPA 2IBKA 3MMAA 4ZOLB 2BVZA 4NNPA 1ZN2A 1U0EA 1LXNA 2P2GA 4Y65A 4M8LA 4HAUA 4U5XA 3RRXA 4CQMD 5AP9A 2QJWA 4QBKA 3RUAA 4X62B 4QEZA 3MECB 4OL9A 4S35A 5COAA 3GGGA 5KFJA 4Y0FA 3IAM1 5KNCD 1EP4A 1RWXA 1TRKA 1Q82T 4IQXA 1C1BA 3BGVA 1F4LA 4OHZA 4Q93A 4ALNA 2H9IA 3DDIA 3N3AC 3OIVA 3RVJA 1S4MA 2VSOA 2QN2A 4LHYA 2XQGA 3SSMA 2V3VA 1WJ9A 1A95A 1J0DA 1T8YA 1HRKA 2GPJA 1ZI9A 4NLSA 3STXA 2NADA 2WWXA 3PFHA 2NSBA 5KQSA 1TB4A 4OXXA 1HT3A 2FSVC 4F3TA 2RQ4A 4DV4J 1GRRA 2BM9A 1NWHA 1SCUB 1KI6A 4GF5A 5F41A 1GEGA 4H7HA 2C78A 1X0XA 4BRSA 3BZQA 1Y3BE 1K9VF 1VE7A 3H8SA 2JGNA 1LPMA 1YZQA 4LSMA 5BWOA 1JWWA 1BE8A 4FVCA 1PEYA 2YXDA 1Y80A 4PHHA 1UEKA 4B7XA 1YQQA 3WLEA 1MG5A 2VHVA 2FW9A 1O9BA 1PVOA 4QNNA 4GRIA 2QL5B 2LWIA 3VPSA 5ES4B 3M4YA 4HAZA 1MF7A 4DMMA 3UANA 2AVNA 2HD4A 5FDLB 1GRNA 4ZK2A 4BMSA 3HZRA 4O3SA 3LGAA 4M7PA 4V03A 1ZM3A 2AJQA 4Y0NA 4B3CA 4C8YA 2ZB4A 5GMOA 4Q6WA 1B15A 4GIBA 1CG6A 2Y1KA 4OLOA 2B94A 5F12A 2I62A 3DFIA 4DJ5X 1BXRA 3IKVA 2Z1NA 2RT3A 2D6FA 1HHTP 3C39A 2D13A 1A50B 3WNVA 2EP8A 5HM8A 2JFDA 1FX0B 5M04A 4OX9Y 4KTVE 1OY1A 2HJSA 1XCPA 3LQVA 1N0HA 5CVEA 4O4HA 2DPGA 2NV6A 4YDXA 1OGIA 1JLBB 4B3RF 3W6OA 1RKVA 1ACMA 4NZ0A 4A36A 3LSTA 2MSSA 2WFAA 4LCBA 3RYHA 1Q2UA 4XPZA 3IR6A 3WHPA 2DNHA 1QV6A 2IOFA 5AVSA 1DXOA 4R81A 4Q2LA 2FUEA 1BW9B 2ZJ8A 3H84A 4PPYA 4KPYA 4BQSA 1E3LA 5B0CA 1JPNA 1ZOOA 5GWXA 1QORA 3E7DA 4FNOA 5FNVF 1NE7A 1AFIA 4QQBA 3RSZA 3OJOA 4JSTA 3CLUD 5GGYA 2Y2UA 4ZJOA 1CDDA 1ZH6A 4UW2A 1X1RA 2AW0A 4EA7A 3UOGA 3LPLA 5KOHA 3F4KA 1JEQB 3UCFA 4TZTA 2P30A 1NNEA 3LKDA 1B8NA 5IAKA 3I8XA 3UMGA 3OX4A 1YUNA 2HRCA 3CF6R 4NYPA 1DCTA 4F0KA 5TS3A 3K8OE 4MKZA 3SYKA 3O95A 2ZPAA 4K9MA 4X4PA 2EJWA 1YCGA 4EYIB 3JYHA 5JU6A 1FXUA 3CX3A 2JIRA 4GH5A 4NOHA 3CCMS 4DS3A 4ZJUA 2CG4A 3SFTA 3N6LA 4JLBA 4QFDA 2HZCA 4YR9A 1JLLB 2K3IA 3D3KA 4H4MB 3IAAA 1N3LA 2RFLA 2RQKA 1SU8A 1PKEA 3M9XA 2BM0A 2I80A 3GUYA 1BQNB 4DZ6A 2O9JA 1YZVA 2VBCA 1NHWA 2YRWA 2PG3A 1XYGA 3L7DA 2I7DA 3ZQKA 4NG5A 1BJTA 5KFBA 1Y7LA 1A9NB 2Q0QA 5AJ3J 5CG1A 2N3OA 3TQ1A 1Z4QA 1V7CA 4EBDA 3KLEA 1EP3B 4YP0A 4UZSA 4DIBA 4HYEA 3LC0A 4UJ5A 1FC0A 3ZC3A 3HJGA 5K6RA 2BKNA 3HDHA 4X3OA 2IUUA 2OKGA 4G24A 2GETA 3PI6A 4C30A 3PF9A 2OYSA 3WFJA 1GTVA 1B6TA 3CMAS 2OXEA 4M0KA 4DNOA 4LRWA 1E2IA 3RTEA 5GONF 2REOA 2WOMA 5AE3A 4QJBA 4HNGA 2QN6B 4LJ7A 1QR6A 3SIWA 4F4XA 4ALMA 1GG5A 4NARA 4G0OA 1AF4A 1VQLS 1CF2O 1TTTA 4IVPA 1QP8A 1QIDA 2HFKA 2VHJA 1GILA 3PE6A 1C4OA 2JHCA 4IOKA 5TS2A 4MDFA 2E4WA 3WNBA 3D6AA 1L4BA 1RWKB 1QYXA 3T1NA 3RC3A 2ZUWA 5DI9A 2XUJA 4MLDA 2B83A 4J0QA 4Q9AA 2A5GA 3SP1A 1T43A 3PUXA 4BBJA 4IX9A 4ENQA 2V4JB 5TNXA 3TTSA 3I9LA 2NZUG 4I50A 2AE1A 3PR3A 4Y6SA 1IAVA 4YJ3A 5KDDA 4JXJA 4I55F 3MUVP 4Q0BA 2ZOFA 5IZHA 3T3PB 2XNHA 5A3VA 4IYQA 3QMVA 3IMCA 4C0HA 4MKGA 4UNIA 1EFTA 2PUGA 4ZZ1A 4OHKA 3ULHA 5HQ8A 2VJMB 4TXMA 1DC8A 5IJWA 2P5YA 1YS9A 5IG2A 3UMCA 4H4EA 3REQB 1PZNA 3X43A 3WYCA 4R5HA 1B23P 2GO7A 2ZE2A 1O08A 4BVEA 2W9BB 2WAXA 1TGVA 1CDZA 4LA4A 5HTOA 9MHTA 3TOSA 2PKQP 1QIHA 4C7BA 4JASB 2GFQA 2AF4C 3ENKA 1D5CA 4J5OA 2CQBA 4AE5A 3QMPA 1SELA 5JJIA 1W1WA 3EPPA 1VLHA 2XYPA 2M32A 1M6VA 1N1EA 4AXBA 5KTYA 2MQLA 3AH8A 2G1PA 1US8B 1P74A 2FEWB 2Q2OA 5TPWA 4F2WA 4DV5F 4CO1A 2I91A 7AT1B 4ZCIA 1LEOA 2HYIB 3VR4H 5K8VA 1X1EA 1SD5A 2FUKA 3H9EO 1OH8A 4GKKB 3V81B 1R0BA 1WOPA 5BUQA 4DR5J 4B9TA 2X1VA 4B3SB 2QMHA 2XNRA 2YWXA 5F5NA 1JALA 1R9GA 5JD3A 5BSUA 5SZKB 4BFLA 4DX7A 3ISJA 1RYBA 4R7GA 3VKWA 3LNTA 4MUXA 3PW7A 2Z0GA 1Q77A 1U28A 3PVCA 3CLSC 4BVHA 2DFKB 2HNKA 3HBFA 2VPWB 3TQFA 2FZ4A 3QVSA 3LV8A 4JFAA 3WO1A 5DBFA 1TDJA 3NXZA 4OY3A 1PO6A 2ZXEA 4URGA 2GKGA 3UWKA 4BFVA 2E6KA 1V3UA 1JHMA 4AY4A 4WZMA 1O54A 521PA 4OO3A 2F2TA 3AJ1A 3VZCA 4GNRA 1ZR2A 3L09A 3I5YA 2OKQA 3TI9A 1URPA 1M5SA 1S10A 1RACB 3KUHA 4IDOA 3GX1A 4ZI7F 1L5VA 3QRQA 3DOLA 2PGAA 2NTYC 2ODBA 1WKCA 3TBHA 3HHLB 2XUDA 4ZK7M 5JZ9A 1PP4A 2G25A 3D54D 2NX2A 3SWWA 1MQ9A 4BO8A 4E2FA 2GJ4A 4X65F 3H2UB 3G82C 4WNCA 3KKKA 3OEED 1E2HA 5FJJA 5G0RA 4DPUA 1VKZA 4W5RA 5A9SA 4YALA 2NREA 2CNOB 5CB4B 3NAZA 4Q1EA 4P2GA 2VUTA 4HWRA 3KHKA 4DY6A 3DDSA 3NWOA 5ARBA 5EKXA 1Z25A 1KZ7B 3QX8A 3VX3A 1YRHA 1NQXA 3TUIC 3EEYA 1NPDA 5DYIA 3IRUA 1W6UA 2LE0A 2ZITA 4RL6A 1NM2A 3WLKX 1FJXA 1Z68A 4B34A 4C5AA 3R5FA 2WOOA 1WSBA 2DFNA 2JWNA 4D9KA 2HJ9A 2J7KA 3OPQA 2HSEB 2HSDA 5CAEB 3MILA 3GRVA 4BE9A 3GSIA 3ND6A 3EEBA 1NFRA 3EE3A 3MWLA 2RF2B 4ZEMA 4PXSA 2BCGY 1UODA 1EKSA 3BD6A 3Q3CA 1UM8A 3VPCA 3M6LA 1KONA 3R77A 3RUHA 1KETA 4CG3A 1BLUA 1BOOA 2H31A 3LWBA 2FPKA 4KJXA 4DR6J 3H1AA 5ENZA 3JALA 4ZT2A 5CH5A 1XVUA 2PSDA 4YRZA 4MR7A 4J0CA 2GRJA 5CB8A 1RXWA 3IUYA 3PEVA 3PJRA 2Q5HA 1EX9A 5DYNA 1N32J 3AR7A 4DMZA 3MB5A 4LWPA 1UZNA 4CGYA 1SKMA 1R4AA 1NBME 2DSTA 3SQDA 2GVNA 4XFDA 1LS1A 1LSSA 3F0NA 1FZTA 5C42B 2Y1RI 1KSPA 1EAYC 2NG1A 2PMDA 1W36B 2ZRHA 4LRCA 3AUXA 3Q9LA 1J7KA 1HRDA 4YAUA 3JVEA 4MR8A 1JG2A 3AEKA 2V2QA 2ZETA 2W58A 1RT2B 1EUDB 3L7YA 3VNRA 2JI4A 2IRYA 1VL5A 2E9RX 1TMYA 5CW1A 3ZE1B 4EHAA 2QORA 1J1ZA 1XF9A 4X6UA 2DO0A 1Z0AA 1XA3A 1LW7A 5K3DA 3WQSB 3ZS8A 1DO0A 3NAMA 4D9MA 1W5BA 4QYTA 1KBZA 1EZ1A 3VNUA 3NHZA 3NGKA 4IXTA 4F12A 4DCJA 1Y7TA 2M4MA 2B1GA 3B6KA 2QRPA 2AR9A 3UZUA 3RAEC 1A8PA 1G2PA 2YZMA 1UVNA 4MQFB 4YRMA 5JTTA 4P32A 4CI9A 4YLYA 1ZH5A 3NBZC 2RRNA 4LZOA 2UV8A 5FRDA 5BY2A 1U8XX 1Z62A 1PSWA 4ARAA 3UK2A 5CFRA 2NM0A 3EZ2A 5IH7A 3F7MA 3PQ7A 3VSCA 4B3BA 5C4MA 5JFTA 4PWWA 4KHMA 3GFVA 4HBGA 3LI2A 1R8BA 3OZAA 3R9IA 4LZLA 5B7PA 4Y1RA 2BBEA 3J80U 1DC5A 2VG6A 4GYJA 5HFNA 4ZJLA 4M89A 4A7PA 4N8NA 1TL3B 5COBA 2ZT8A 1X19A 1KRWA 3SKYA 4E2FB 4DNXA 2Z1MA 3P1JA 4FR5A 4KB7A 2LVBA 3WP0A 1RI3A 4ZQBA 2E4YA 2H4WB 5ED0A 2ZXFA 1F38A 4MTCA 4MLPA 4XUCA 2V7QA 1Q95G 1KFDA 4GSKA 3SYMA 4UOEA 5K9ZA 1QB7A 4NZNA 2I3AA 3R3SA 3STVA 2FVYA 3VSEA 1TW2A 4MK9A 4JP3A 5E4YA 3AFIA 4LDNA 4U9HS 2L9NA 1DRUA 2H07A 4N6GA 3H59A 4MUJA 3JSRA 3GEIA 5PGMA 3I6ZA 3SQGA 2B9VA 4ZZ3A 3AB4B 4I5IA 3H3FA 3IB6A 2IBOA 3KWJA 3GLIE 1K7YA 2KM1A 2C2WA 1FESA 3BE8A 3CD6S 3KKZA 4AZ3A 4EOGA 4X00A 421PA 1KHTA 1R9JA 3E3LA 3TSYA 2OGSA 1K6IA 1V43A 3OBIA 2BZGA 1IJKA 2JCBA 5H68A 2ZVIA 4NZPA 4EJSA 5K5EA 5BN5A 4KQIA 2F7SA 3IKJA 2FSFA 1IEWA 1IBMF 2VB6A 4YR2A 1KQGA 3ITEA 2D5AA 3DTTA 4BLRA 4XIGS 3CGIA 3P20A 1JDPA 1HGXA 4JL8A 1ADBA 1G2EA 4DLSA 4RIEA 5T14A 4UCXA 2CDAA 3R5XA 4K4SA 3H65A 2O2HA 3DXBA 1XR5A 3O82A 1WS6A 5U4QA 4A92A 3CCQS 1D0VA 5JXJA 1NQ5A 3THWA 5IS2A 1GQYA 4C6RA 4DXAA 3LECA 1POWA 5DDIP 3ZD7A 2FI1A 2HWIA 3ZGXA 1DSSG 3DJYA 5ILOA 3TTTA 1U1IA 3NKFA 2B0JA 2RB4A 1FRZA 2VC1A 3GZ7A 1V11A 2ASVA 4PLZA 2FJUA 3M8KA 1JLEA 1VQ8S 1JT2A 4DA0A 1FZQA 3DOHA 1NN0A 4BRZA 3SD7A 1NTOA 5JNWA 5E1MA 1FP7A 5DTJA 1YRBA 5GADI 2EP7A 1E1NA 4Z4CA 3LOPA 3BXFA 4JYAB 1C0PA 2FVXA 4MIAA 5JO0A 4JBXA 4V24A 2UZAA 2JJ4D 3GG2A 1UINA 3RAJA 3LA0A 3HB7A 4OZ1A 4UBOA 2QLWA 2M9KA 4NYIR 3LK7A 2C5BA 2WWIA 2JBHA 3EIHA 1ZY2A 2DQKA 3U7HB 3U1TA 5E3PA 2G63A 4FGLA 1ZW1A 3N2NA 3Q6NA 4I8DA 1T2EA 2YKNB 2JGFA 3AEYA 5CZVA 4A27A 4TTAA 1SOUA 2RMKA 2B6NA 1IKVA 4TN5A 2YS6A 4MQ5A 4AICA 1QYDA 3ZZZA 2Z43A 2WUFA 4E09A 2A1TR 1YB1A 5ALRA 4YCCA 2BEJA 1WZ2A 4ZVQB 2I8CA 3DOJA 1EJ7L 4Z37A 3DXXA 4B48A 4B6GA 2IY9A 2X9GA 4EFKA 4PBSA 1B3TA 1E99A 2VAVA 1FJGF 4AN0A 1CVJA 5HG0A 3R0IA 4G67A 4RW9B 3AGQA 5TF4A 1KH1A 1AUSL 5DPMA 4X84A 2JFUA 3JRXA 2CLKB 5B3AA 2IU3A 4FDTA 3M9WA 4FLFA 3E9NA 1Z5ZA 1IZYA 3O8QA 5JMTA 3ZWBA 4PAQA 3K0FB 4JXXA 4ND2A 1RZMA 4IDCA 5M2QA 2DH9A 1CCWA 2WVAA 1DV1A 3HJFA 4JUCA 5KOXA 1DCFA 2A5LA 1KS2A 1VI7A 5FJ4A 2FLVA 4M9UA 1JKMA 1E1QD 3OX2A 3AUTA 2NUPA 4LXYA 2GAHC 3F6EX 4M9XA 3BQ1A 4XX0B 1XTIA 1QIJA 3DYIA 1ZVMA 1XROA 3I83A 3PYEA 4DV0J 3MJEA 4D4JA 3T61A 3DXZA 1BGXT 1QX3A 3INTA 3BE5A 2PIDA 3ZWDA 4DM4A 2O8CA 2UXCB 3L40A 1DBDA 4TLCA 4RPJA 2VXYA 3L5KA 1GLNA 3SQLA 3EZNA 1M1YE 2DWPA 3CJRA 1MROA 3DVRX 5FIUA 2GIRA 1FDOA 4LY3A 3DMTC 8ABPA 3Q12A 1FVFA 1G1AA 3FN4A 1WC3A 1SOWA 2NW6A 4IEFB 4YV1A 2FQXA 5J4LA 4ID3A 2V7QD 1K89A 5KJFA 3SCKE 4D7AA 3ZJ5A 1KEPA 121PA 2ACYA 4ZICA 3P9YA 2JS7A 4FD3A 5DLFA 3SBOA 5G53C 4G0MA 4CDNA 4X4RA 3IOBA 1JAXA 2FHJA 5C18A 5IWAF 4HLBA 2J3JA 3GAFA 2X5XA 3VCDA 5A0YB 2Y99A 3KJIA 3WGYA 2EL9A 4DCPA 3UJ7A 4S1PA 1HBOA 1U2ZA 1C0TA 3IM8A 4GXRA 2XYHB 3E8OA 2XNQA 4NECA 3VR0A 4BMNA 1M67A 2AGOA 4NCAA 1W4BA 4BP3A 1OT3A 1PGQA 1YI2S 3HZZA 4IHJA 1AY0A 3GJSA 4KI0A 2V9CA 1GQFA 2N82B 5B58T 1T03A 5BYSA 4QOSA 3QFCA 3UUEA 3EZUA 4UTXA 3I9V9 4FOPA 4TL8A 1OT5A 3B5IA 3OETA 3G5TA 1WOOA 1TL7B 1TKZA 4EK2A 1LDEA 4OZLA 2QDKA 3X1MA 3IVAA 1NYTA 1S02A 2DGUA 2YFYA 1TTHB 5HKKA 2UZ1B 2PH7A 3K30A 4UCQA 4YRKA 3PXAA 1S8FA 4HT5A 5CH8A 2WD8A 3D6FB 1XGKA 1U8WA 1GXSA 2EFOA 1RRFA 2OSQA 3PIOQ 2AW3A 3T7KA 2X19A 3TA0A 4ZP8A 3RWMB 3U1LA 3IUEA 3K0HA 5C7IO 4NLQA 4TLDA 1DU4A 3EW9A 1EUDA 2C31A 4G23A 3ZHVA 1C2TA 4YO7A 4NLVA 3DQZA 3W9SA 4RW4B 4WD3A 5JR3A 4MVYA 1X4FA 1J21A 1LBEA 1XPOA 2WD7B 4QTTB 5AIAA 3OF3A 1C4XA 5H16A 2SHKA 4M55A 1J8QA 1ZH4A 2LXFA 5CVCA 5FCDA 4XI9A 4US0R 5CA0B 4M37A 1OPIA 1I0ZA 1T2UA 4HQOA 5AVRA 5ETKA 3PHIA 1SOVA 3TVZA 3ZOKA 1JB9A 4YJKA 5HQ3A 2XB8A 4CM4B 3PD0A 3MYRA 4O4IF 4OLJA 3LHIA 4RVOA 4LY9A 5AKKA 5JYDA 4X1OA 4EWTA 3W1VA 1EX8A 3EGEA 1N36B 3IE1A 4FGSA 2PLWA 3MT8A 3WB0A 2B61A 3OE5A 4FEGA 1P1TA 4D9IA 1DDOA 2AN9A 5KBYA 3B9RA 1Z13A 2DFDA 2FX5A 1P2SA 4DLXA 4JDPA 3L8MA 3WYBA 3QI2A 2JI9A 1N2CA 3FJYA 5M29A 1C9JA 4OF4A 3UN5A 1RYMA 5EXTA 2GLTA 2ZC3A 4OX9B 1XMJA 4FHDA 3SE7A 1XFDA 1KDVA 3I56S 3MMBA 2AXEA 2JZNA 3SCLE 5HIJA 2CNWD 2C95A 2IYOA 4RO0A 3OPNA 4FKBA 2C7PA 3AF6A 2B7CA 2NNWB 3FFWA 5J2PB 3T12A 2CUZA 4PS0A 3SC3A 1JJ2R 3PW2A 3BWDD 2WHYA 3IEUA 1COWA 2CHUA 3TQRA 4QLAA 1X4EA 2JVRA 3TLYA 3N86A 4N54A 4AP5A 1RAGB 1WPQA 1YJAA 5AK0A 2BFCA 3EARA 1SI9A 3JWEA 1ZA2B 3H4VA 5HVHA 3OT4A 1UPCA 4ZMMA 2KI5A 3SZLA 2BR4A 3F5MA 1Z07A 5CHCB 2IA5A 5BW6B 3AXKA 3IRXB 3PYDA 2FSHA 4JI5B 2L18A 4GAEA 1PR5A 3UEOA 2IXEA 3U19A 1P45A 4ZRDA 4DHVA 1MORA 1K63A 3TUJC 3RTBA 1Y5IB 1FFSA 1CJBA 3KG0A 5HJEA 5JDIC 4M98A 3NM6B 4IJQA 1D1TA 4DLLA 5K05A 5I4MA 1U1FA 3GNQA 4XXHA 2IEIA 4FILA 3IFSA 1DLOA 1HMYA 5C4IA 2M5YA 3HSYA 2L41A 3KUDA 5ENDA 5AKGA 4HL6A 2F7VA 1W49A 4R5MA 4ZU6X 1DIBA 4EHFA 3IR7B 4MYCA 5EHZA 4FBUA 2NPOA 3A1FA 3NG8A 4X45A 2W8LA 4E5UA 2P6SA 5F3TA 2G2OA 1CWUA 4GSLA 3PFBA 1AKNA 2ZYRA 1T11A 3CZRA 3W0LB 3FPEA 2IVFA 3B9QA 4ETWA 3L0YA 5KFAA 1GZ4A 1GCGA 4WOPA 2BEVB 2Z6QA 4NA1A 4HGNA 3FPAA 4QJ5A 4KRWA 4K3VA 4MRVA 2BP7B 3FZQA 4EENA 4QYRA 4WPAA 4Q7MB 1CJVA 4A8JC 4DVGA 4H4OB 4IIHA 1NH7A 4NOMA 4TTJA 2QE7D 3L7LA 5AH0A 1ETHA 3QPCA 3K3PA 1K7SN 3VBCA 1GQOA 4BV9A 3VJMA 1XN9A 3KQWA 2HBZB 1D9AA 4QW8A 3QMMA 1LU9A 3USCS 3EFBA 5HVFA 2AJ0A 1E62A 1I4TD 4DV3B 1NKBA 1IKWA 2DNOA 2YNIA 2D1QA 3N53A 3LT2A 1OXMA 4QC2A 1TKXB 5HWSA 2D5CA 4RQUA 3BBFA 4MTPA 1C29B 1AMNA 4U2EA 1ESDA 5ERGB 4AQ7A 4Y28C 1W0KD 4NCBA 1S8AA 1L7PA 2W2LD 2NU6A 2PMZD 5KVSA 1BWRA 5AOAA 5DWQA 2PEHA 2EFDB 3WLAA 4JI4J 4MMZB 3I2IA 1VQYA 2OFHX 4BO7A 4IZOA 5T4EA 3VRHA 2ADBA 4IBOA 2EATA 2Z2MA 5GV8A 3KL4A 3WVNA 3KBOA 4QPNA 1AQLA 3GMDA 4PGMA 1FK8A 3L8FA 4HO1X 1DKMA 3UWTA 5C52B 3WWEA 2ZUSA 3VDRA 2Q5LA 3GYXB 2APOA 1TZCA 5EJ2A 3TM5A 3MPUA 4B45A 2H9AA 1BYIA 2F6RA 2QM3A 3A3OB 2VLIA 4J03A 1BA2A 2R8RA 4BKUA 2C42A 5ICEA 4E5KA 3O91A 4AYWA 2OCPA 2FW1A 4USIA 3FYUA 3BDAA 4OHBA 2XUQA 4JB0A 4QODA 2W9CA 2FF5A 1Z15A 2XBMA 5HMLA 2P4HX 1VSBA 2P2LA 1VG8A 2CL7X 1K5PA 5G02A 1DBSA 4YXFA 5L95A 1C8BA 3GP8A 1P2UA 2Z83A 4I50B 3AY0A 4DOZA 1FT8A 5KFRA 3HFVA 2D1SA 1Q86T 4QXPA 3NOCA 1U3TA 4UM5A 5D00A 4XUDA 3QWUA 2A0YA 2OSBA 3DLIA 4E5NA 4G36A 4F04B 1QRSA 2QT1A 2QL9A 4KQKA 1S9GA 3IMKA 3ACDA 2NZXA 2HQ3A 3A7EA 4M1WA 3D2BA 4B4VA 4P4UA 3CWZA 4ZCLA 2RJOA 2SKDA 2HHUA 2UUCF 3CJTA 2ZEJA 3VTIA 2IYRA 3BH0A 2VPXA 3KHRA 5HR5A 2QLNA 3HLYA 3IMFA 4FCTA 3BXEA 4PRKA 4GQBA 1UMBB 3N58A 2PXCA 1VL6A 1UIRA 1GLVA 3KK1B 5KSZA 5EX3A 4L0MA 2FKAA 2HBYB 2VA9A 3IAM6 1AXQA 4BNXA 4MQ4A 2C94A 4AJ9A 2VTEA 1U0HB 3UQSA 2I6GA 4EEZA 3QFSA 5EJ4A 2WFLA 2EI5A 1ATZA 4KDEA 4AXJA 1KO7A 3SBMA 4ERNA 4LRBA 1D8YA 2ECPA 1S3SA 1VGVA 4FI3C 1G7TA 3N2IA 1FRHA 2F3PA 4HQRA 1JZQA 2QIOA 4NEYA 2FLPA 1EQMA 1J8FA 1N2XA 4EO9A 3H42A 4L1KA 1ES9A 2PWZA 4KOEC 1JEQA 4OJQA 4AJ2A 1G5TA 1OUMA 5JCJD 5IBRA 2AWZA 4QXMA 4FYWA 1N2CE 4B3RJ 4J7CA 5GVQA 2VL7A 1Z3IX 2GFIA 721PA 1WMDA 2C9ZA 4Z0NA 2VT3A 2B5WA 1OXKB 1EVQA 1PX2A 4YRIA 3P5SA 1LGYA 2BMJA 4BQOA 4Q34A 2PQ2A 3M33A 1IWGA 1ZVVA 3W3SA 1MH1A 1RWMA 4W9NA 5HTKA 2O0KA 5E2IA 4FQ8A 3QE2A 3CHYA 4AJHA 1P2DA 3HBMA 4DFKA 4I1TA 1P0QA 3MOJB 5GMDA 3HCDA 2PFSA 3KTQA 3NEJA 5IT0A 2WSLA 1NYLA 4EHKA 1TIBA 1S2NA 1ABFA 2GAGC 3D2LA 3LL7A 2HQBA 4GOLD 4KR7A 1N9KA 4TS9A 2CF5A 1ZUIA 1RRMA 3WLPA 2KB0A 4KO8A 4KQ9A 1RB0A 1N3YA 2P6TA 1V41E 3J81k 2ASDA 4KK3A 5F7OA 4CT5A 3M70A 1VFJA 1C1YA 2HNYA 1XVIA 2X51A 4B46A 2J0QD 2GHRA 5ETVA 4U0KA 4ZAYA 3W5ZA 4UAVA 4ZVLA 3ESAA 2J4CA 1UWAA 3NOOA 3B7PA 1V3VA 1Z7WA 4K6KA 3RIGA 5CB0A 2DHHA 1UDAA 3SSOA 2V2KA 1VI5A 4EY8A 2D8MA 2VQ6A 3R7AA 3AG6A 2FW0A 5ALFA 1H2HA 1RYRA 3CUNA 4FIDA 4ZQFA 3THVA 5HRCA 1XMQB 1QTRA 1N2GA 1G6HA 5JALA 5FWYB 4BNZA 2GQQA 5CFOA 3OTWA 3QI7A 3CC7S 1TEHA 3VUEA 3LAMA 4PSKA 4JOQA 5CXQA 4OEHA 2RAPA 3TO5A 4E1BA 1T1JA 2YZGA 2Z9DA 1NXXA 2IVMA 2HV8A 2KM8B 3MM7A 1I2CA 4DCPB 1OHHA 4DDMA 1G4CA 3PD1A 1QTNB 2BZSA 5IVIA 1NVVR 2UUPA 1I94B 2X41A 2QVGA 3OW2R 4B82A 3OTQA 3MEDA 3AJ8A 3JY6A 2CCKA 5CJ2A 3S40A 3ZTRA 4J0FA 2XB4A 4CLYA 2ILZA 4DPXA 2P2SA 2QB5A 4GPAA 1IXRC 2BJ1A 4MT1A 4IH1A 4O4JF 5DN6A 2B4OA 4AK9A 2VJQA 4UXIA 2B35A 2XOKA 1GR1A 8LDHA 2NSCA 4RVNA 5EWLB 2J5AA 3VR2D 4LDJA 2JPDA 3I9FA 4QNMA 1U6ZA 5DIFA 4JWTA 3VC2A 4G1FA 4DDWA 3KJHA 1R6XA 4EMTA 4RIIA 3DOFA 5ADVA 3AEXA 4UAGA 4ER8A 5CVUA 1I5OB 3LUHA 2BEWA 1ZMBA 5DNEA 4WLVA 2XMKA 3W9UA 3BPSA 4RL1A 1TCAA 4I36A 4PSCA 1JHOA 1UM9B 3C6XA 1O9HA 2AMLA 3AT1A 2H54A 2EIXA 4ZIWA 5FTLA 4XJTA 4UPEA 3TUZC 4S0ZA 1FUKA 3TLKA 1M8KA 3VAJA 4X1YA 3K32A 4R8VA 3OCVA 2PCJA 4ZP7A 1TA4A 3DQPA 4H3VA 4JBWA 3SQOA 3MOSA 1GXUA 1NNUA 2G7ZA 1ECPA 3T9BA 4KLRA 1JR6A 2CPFA 3QKSA 3EZ5A 2PL3A 3GV5B 2WFZA 3R5HA 5T4FA 4KH0A 2F63A 2XYQA 1GD1O 4PM4A 1RPJA 2M3DA 2B82A 1RM3A 3PNOA 2UZ3A 5K0JA 3R7DA 1V7PC 2H6EA 2X42A 3KK0A 4EI2A 1Y89A 1QHYA 2IXGA 4PC1A 3CB2A 4PYQA 1N8NA 3EPGA 4QFCA 3EY4A 3HUUA 3EHDA 4NFYA 3DAOA 1YS7A 1NX9A 1X7YA 1K7EB 2EKNA 3P2OA 4CO3A 2AG5A 3WGOA 1NNI1 2ZVJA 1VIAA 2YPYA 2P9HA 4I7FA 2XI4A 3JQAA 4C8NA 3KQQA 5I9IA 4HXEB 3ORRA 2CPEA 4CG1A 3O2IA 2QE7A 1OMOA 3M1IA 4RD0A 1DQYA 2AEFA 1SBIA 2PJRA 4H31A 4OA5A 3H8VA 2Z9CA 1XL0A 5CJPA 1AS0A 1QYIA 4TY8B 3RBEA 5L9XA 1T1SA 2ICAA 2WY2D 2VPZB 5L3RA 1E59A 4PG4A 3MGGA 1UQRA 3HVTA 3HL0A 5DE3A 2VNAA 4TMFA 4JEIA 2UYGA 3TJRA 4KFBB 4RIHA 3RJ5A 2WSBA 2I33A 5D7BA 3AOAA 4LRQA 4HEQA 3QXGA 2VQEF 1Q81T 1WY5A 5GONB 4P7FA 2PX6A 4EO4A 1OC2A 4TKUA 3A9CA 1PIEA 2ZH2A 4PIVA 2IIHA 4IJ6A 4DSOA 4RTRA 5KKCA 1FP6A 2X86A 4AL4A 4WXYB 3PO4A 1EHWA 4TL9A 3AERA 1FE8A 3OXGA 2VIIA 4XWWA 5DDRC 1XD9A 1OFVA 1JQEA 3R4CA 4WE1B 2PYDA 1WNFA 1X7VA 5CD9A 3ZZMA 1MOQA 3H5AA 2FZWA 4IRMA 4W1QA 2R1VA 2P65A 1NVGA 3HNRA 2GJFA 4JV5F 2J3QA 4M83A 2HNDB 4NBLA 1TM5E 3HZHA 5DSXA 3ESZA 2YOHA 4P53A 4NXNB 2PRKA 1AKMA 1SD1A 1CZUA 2A59A 5C24A 2XSJB 3WLOA 1XMSA 1YU9A 3I31A 3QVTA 3PNYA 1N33B 3HP7A 5KNLA 2ADFA 1Y7IA 4K9PA 1XT6A 1JXAA 4PYDA 2PGXA 1N5JA 5GZ1A 4IQGA 4JSRA 1R6VA 3DV0A 5LPNA 1Z37A 4BXOB 4D2IA 2MZJA 3JAKB 5G2OA 3UAXA 1O51A 2FFHA 3PFWO 4MWEA 1FSGA 5DZSA 4RLQA 2DNLA 1K73T 1NYRA 2O19A 1QTMA 1UMCA 3GJZA 3KYJB 4QU0A 5E7QA 2OCAA 1OTHA 2VC0A 4IH5A 4NBWA 1J06A 3A13A 2XDYA 3OD2A 4ZODA 1QKIA 1H9CA 3G82B 1WG5A 3ZLUA 4N47A 1A8SA 1A4IA 2J48A 2BISA 2OK7A 1KMIY 3ZTWA 3OM8A 2I8LA 2GV1A 3HDJA 4N9QA 2V7PA 4BFWA 4UVDA 2WW8A 2HMWA 3CVJA 1WXGA 2Q7OE 3VKUA 3UAZA 1C3JA 1T4CB 3RS9A 4EYSA 2C2OA 1ZD8A 1LWOA 4RLSA 2Y1JA 1JQGA 1Z5NA 1NUTA 1E0KA 1YHNA 3RQIA 1PG0A 2K7ZA 3M1VB 4NP6A 4X4VA 3DYVA 1SIWB 3DXSX 2ZT5A 2QA1A 1PYOA 3M5WA 3QKUA 3V1TC 1XMOJ 1HYSA 4L9SA 1H6AA 5AUOB 4P4SB 3C0KA 3QVKA 2HVDA 4ALZA 1YS2X 4F2HA 2GS8A 2R5WA 4YHHJ 4WESB 3QYJA 1UXOA 2OORA 3SHWA 2IXTA 4WACA 1J56A 2FC8A 2OV1A 2ZH3A 9ATCA 4JENA 2PUBA 1FU4A 4Y2JA 1VGYA 4X20B 5E3HA 2QXYA 1IYZA 4BZXA 2HQDA 4AQDA 3C16B 1ZFNA 4JI7B 2OZLB 1M3SA 3GFTA 1PC4A 4DM7A 1YAHA 2Y0CA 2FW8A 3FNQA 1FQOA 5LR6A 5LL6d 2J7PA 2LXUA 1T29A 5KWSA 1NBIA 1VIVA 1DLOB 3PV8A 4WBNA 1RRCA 3DM5A 5INTA 4JA2A 4CM7A 4UCWA 4OIXA 1BE4A 1NMZA 3CJ0A 5JS8A 3G96A 3FPSA 1UH5A 1VL1A 2CEKA 4LF9B 1GU7A 2E3JA 1R0YA 1X87A 3DL0A 1VHQA 2XPCA 4IYJA 1N5RA 2OWEA 5CBKA 5KC9A 2JCXA 1HNXF 3UR0A 1LTQA 3W5CA 1BUXA 2Z5GA 4M5MA 5CEEA 1CJTB 3BO4A 3U44A 5ALMA 5KUTA 1GUFA 4WY8A 1CB7A 4IOCQ 3O8RA 4IO9Q 1HO3A 4MUHA 2WMYA 5IT5A 4WECA 3HMJG 4UEWA 4GC6A 3KAJA 4MI3A 1NH8A 4Y2KA 4U95A 3PF8A 3QU9A 5DTQA 4HK4A 3TD6A 2LQBA 3SLGA 3CZ4A 4AZ0B 1S1WB 1A88A 3QT5A 5AI0A 4USUA 2VP2A 4WERA 1MV5A 5JYCA 4QWCA 3OM0A 1XELA 4JYPA 4FS3A 5JRDS 3QGHA 4B79A 2MZRA 3NAIA 4GM0A 3U7FB 3SXJA 3EJ6A 2GPBA 3S2ZA 3MUMP 3USZA 1P1CA 2XWSA 3WA7A 2W8KA 1F4PA 1BTOA 3BMQB 4IQ8A 1M5TA 5DHPA 3NNNA 5IVPA 1B2LA 4GKVA 5BW5A 1R0AB 3ZIAD 5ELLA 4DCTA 5L3QB 3QJPA 2C5HA 2RH8A 4H0CA 4D3YA 4EF4A 5GAEI 1DZ5A 2GB4A 3BRQA 3DLJA 4D3FA 3QNMA 1Q8IA 2QA5A 2OMOA 4XGQA 2OCDA 1WF2A 2HR1A 3GFFA 3G9UA 3S1AB 2RRBA 2WJYA 2BGKA 4GO7X 3GK3A 3LBAA 4G89A 3TAXA 1LH0A 3H5UA 3OCZA 1QLHA 5JBNA 1I2ZA 1S97A 1F5CA 4G37A 4M88A 3MMSA 4K40A 5B3KA 5B1IA 1NE2A 1ZGCA 4LXTA 3JWPA 4ZHQF 1YRQA 3PWSA 3RODA 1NN3A 1TQ6A 2XVYA 3KSRA 4CMBA 4H1VA 1QF7A 4HUTA 4O0MA 2I99A 4J9KA 3AY7A 3DE6X 4DRXA 3I72A 4BLWA 4EATA 2JI6A 4CLUA 4UHHA 2P2YA 5K8JB 4DBZA 3K0CA 1S2GA 1NW8A 2F1HA 2NUTB 1EQ2A 2V45A 4MX8A 4U3JA 3GR0A 1YE5A 2TS1A 3QF4A 3PEHA 3QE3A 1E6CA 4D3SA 2C2GA 3UCGA 4B6RA 1G4HA 4D3DA 4YCBA 2HQIA 5F2NA 4C4XA 4HDGA 3KDAA 3K0CC 2P5VA 3W60A 1ESZA 3DYAA 2Y76A 2QYTA 1WLSA 3L04A 1CPZA 1DE0A 1RT3B 2CJWB 4I3HA 1UADA 2O2XA 5DWDA 2BFPA 4TYYA 2NQ2C 4F96A 1T6NA 4DABA 4CXMA 2VODA 1KEKA 5H4GA 3P0FA 1FVXA 1VCNA 4NZOA 1CF4A 1LSJA 4I2QB 3KSAC 5PNTA 4UTVA 2DH7A 5T57A 2EHJA 4P5DA 2QP9X 5F7ZA 3B13B 4NATA 3V3KA 1ADCA 2GA7A 4G63A 4C7OA 4C6TA 4RW6B 4D8YA 5K4GA 3COWA 4TUYA 4YCAA 3OT5A 3GIDA 3A6EA 1MU2B 2GK6A 2AKYA 2DQ4A 3OTGA 3KQLA 1FFCA 1QS0B 4U7HA 1J99A 1MJNA 3LXMA 3R1IA 1KNXA 4YQYA 3LKZA 3KUEA 2XMWA 4FBMA 2H48B 5JDCC 1HBOB 1U7UA 2ODTX 1YZUA 3BGWA 4HLDA 4Q19A 5L53A 3GZNB 3SHOA 2C2MA 2Q3CA 3LS2A 5C3MA 1UJ4A 1I7LA 1REVA 1NPPA 2VFRA 4KBYA 1PV4A 4NTZA 2QW8A 2H2FA 5D3QA 1KYIA 4ATNA 4QRHA 3TRIA 5CEJA 3H6HA 2ZYDA 5AXDA 1ECGA 3GSDA 1E9EA 2QUAA 4LVOP 3GN2A 3JQKA 1NI4B 4L8FA 4JGGA 2WD9A 1G6Q1 5SV2A 4HR2A 3CD7A 3JXOA 1R6TA 1YUBA 3AODA 1QRRA 2HPAA 4ITRC 5HEKA 4Y3UA 1S01A 4JNCA 2NTEA 4EG8A 1PR3A 4PYIA 4AAYA 3Q86A 4Q7EA 4ECTA 2QIFA 4NCNA 5IPFA 2FPLA 2KT5A 621PA 5IUJC 4MAKA 3LFUA 2OK8A 4BWMA 4KUEA 5C8YB 4A03A 1RT7B 1CERA 3TZ6A 3LDAA 4YMIA 2FRDA 2YFQA 3GLTA 4IR1A 1TEVA 3CX4A 3EEQA 1JFTA 4F4WA 2C4WA 4DW8A 1KI2A 1XTZA 2Y67A 4D92A 3KOYA 4JY7A 4L6AA 1L8QA 2O2ZA 2R8YA 2JGKA 1RWNA 4HAYA 4R2KA 4KIUA 1ND6A 4DA4A 1H69A 3R9KA 3L9WA 5IC6B 3LQ1A 4U7GA 3ZXUB 5BSRA 5KYYA 2ZG6A 3TXXA 4TV8B 3E1SA 1RD4A 1UMDA 1RZUA 1AGNA 1ZRMA 1B0UA 1C8KA 1PBUA 3CLUC 2FN4A 4MIEA 1LEHA 5JJBA 3VZHA 1T5DX 1N56A 1T5IA 2QTMA 3QU4A 4LRFA 5L6MB 3O3NB 1W2BR 2YCLA 2XDQB 1HV8A 3L07A 4FOSA 3I09A 3BB3A 5CD1A 2F40A 2RHWA 1WJGA 2IJNA 3MAAC 3SX2A 3KKFA 2WSSA 1SBYA 1DQPA 2DX7A 3OJXA 4EIWA 4BLQA 2Q6IA 1ENYA 4IIFA 1T24A 4NENB 3MI7X 4ESEA 3R7BA 1PYSB 3H0EA 5A2GA 2GA8A 3NIBA 3I55S 3K9HA 4MI6A 2YY3A 2OIHA 1VIOA 3H05A 2ZR9A 2YVKA 2I87A 3D7NA 4AUKA 4N01A 1BQ4A 2Q6CA 1ZG3A 2EKZA 2QN8A 2RKBA 1D2GA 5BYBA 1PWXA 2C4TA 2O6HA 4HL9A 4CCYA 1YC5A 2PX2A 2O2EA 4DQ0A 2CQ4A 1VLMA 4YB6A 3L0PA 4HX5A 2ALZA 4Z4FA 2OQIA 2FC9A 4NOJA 3LGSA 1HI1A 3Q8WA 3GNLA 3NUGA 5F7XA 4ZN1A 1P77A 4AKEA 4KGXA 1WF3A 1NM5A 2WJ3A 4DUTA 1AB5A 3R6WA 3S8MA 3V8RA 3DWFA 2Y0EA 2OXIA 3E9QA 1N9ZA 5F0UA 4NFLA 1NXVA 3E58A 1Q7EA 3FZYA 2WDZA 5FTJA 1RAAB 2G0AA 1GDHA 1JR3E 1JXQA 1JFFA 2Q6KA 2GCFA 2ODQA 4AULA 2QL5A 3E61A 4RSGA 4D80A 4A2QA 2W2PA 2J30A 3GIWA 1MABB 3J7TA 2XUFA 1HETA 2QZZA 4NEGA 1Z4NA 1QMPA 4FS1A 4P74A 5T6BA 5EZYF 4IKPA 5IMBA 4KODA 4TYAA 3NEKA 3FWYA 3ND8A 2XX3A 4KV7A 2HGMA 3J80A 3VTAA 3FPLA 1JGTA 1EUQA 1XPRA 1OXSC 3WS7A 5KFIA 1ZNWA 3A14A 1E1CA 3ESCA 1ZAKA 1RKBA 1Z0JA 1IOVA 1BMTA 1N5IA 3VHRA 1MAUA 3H5WA 5JNSA 4LSWA 3RIEA 4OFZA 2O7SA 3VNSA 2CZCA 1QIIA 3PFKA 1AO3A 1D1SA 5FWXB 2UYOA 5J2MB 3D8UA 4Y9DA 1BGVA 5CDFA 5C5JA 4RVGA 1CJKB 3MAHA 2TMDA 1PQUA 5AM4A 3SC4A 1AUVA 3K89A 2JLAA 2V4RA 2P8JA 2ALJA 3V4MA 1UOPA 4FBLA 2FRVA 4M5JA 3KUXA 1R4ZA 2AI3A 1T1IA 3CB4A 1QVVA 4UHJA 2MYNA 3WGIA 4JJFA 5AJYA 4JI1F 4QWWA 3ZFVA 1MB0A 4ANDA 2WF6A 4XPIA 2PIAA 3I5CA 1EYZA 3ACBA 2Y93A 1R31A 4K4WA 3PKIA 1YZHA 1GAWA 5HILA 2VCYA 2BMWA 2PSJA 4ZQIA 4DYHA 2J8SA 1YRXA 1ORRA 2QENA 2NV0A 1SBCA 2RAQA 2MJUA 3QVLA 1PT6A 1S9GB 1G3OA 4LNUA 4BFCA 5KG3A 4Q5VA 3DDHA 3T6JA 4F04A 4OHUA 3SXPA 4JOUA 3IXMA 1M5RA 1FDUA 2DIVA 1N5LA 3BGSA 2P40A 5CX1A 1V16B 3E2EA 2CVPA 3INGA 3NIWA 4XVHA 1JAZA 3IP0A 1BS2A 3K35A 3ZGLA 1A9RA 3KU4A 4BX9A 5HKLA 2P9CA 4HLUA 4WK1A 1UOEA 2HCBA 1S4EA 1ZHOA 1QDUB 2CQPA 3QV1A 8AT1B 2NZWA 2ZPUA 3AP1A 3OE1A 4RUBA 4ZYTA 2WWGA 3LYLA 4EPXA 1OH7A 2ZH1A 3E27A 1DEKA 1K97A 4AZTA 1GSOA 4IDFA 2FJDB 4PR3A 2ZVDA 5IDQA 3IT2A 3RSSA 1CUYA 4C22A 1LF0A 2OPHA 3QUTA 1HFEL 2FETA 3ELUA 4HCJA 2FF7A 3GFPA 4QRDA 5B0DA 3HCBA 1NJ6A 3EDRA 1D1QA 3VJRA 2OV2A 2VDRB 1H6DA 2CUKA 2AN5A 2W7TA 1CR0A 3GGDA 4C2BA 3VR3A 3IQHX 1UBEA 4OYBA 1I01A 3UK0A 1SV5A 2XSFA 4W1SA 4BWJA 3E1KA 2GAJA 3FBCA 1CR4A 4AJOA 4MW1A 2G9NA 2B2NA 1C7ZA 3R6DA 3BAFA 3GRFA 2JLWA 2VFTA 3PHLA 5BNFA 2W7OA 3OSZA 4NDNE 3IQXA 3HVTB 3E8SA 4P2XA 3C3WA 4KW7A 1F7VA 5F73A 3V9AA 4DJFC 3OIDA 3D43A 1DAOA 2CVQA 4H1WA 2OQ2A 5IN5A 3GQBA 3LM8A 1XKXA 2ZRGA 2HMUA 4Z4IA 4EWLA 3MNFA 1UVKA 4XR4A 1X80B 2JFBA 1KYXA 3CF4G 2VK2A 4LJSA 1INLA 4LKOA 1YLXA 3NDJA 6CHYA 1GVHA 1CS0A 2DBYA 1L3BA 4PG6A 3BGLA 2FPUA 1W26A 3I0RA 4B2PA 1R7RA 2PGCA 2J31A 2IUTA 3GWCA 4Q3EA 3GBPA 3EXCX 2P6MA 3ZK9A 4GVLA 3IEVA 2LDYA 3ZW9A 4AU1A 3UWPA 4BB6A 4C9DA 4LJ8A 1N7HA 3CULA 3T1YF 2FE4A 1CUXA 3ZK8A 4KR2A 4C8LA 2W2TA 4YLEA 3HRKA 2YWGA 1JJAA 1RYDA 1QJ4A 4BCDA 1C30A 1P91A 1QDLB 2R8HA 1CJUB 2DBZA 4CM9D 2J5BA 2B8NA 1R0KA 4BNVA 3GA7A 4R5PA 4YP1A 3SHTA 1NPRA 3EGWB 3LDGA 1ONPA 3KR0A 4CM9A 2BKAA 4XQCA 4JQCA 2V2VA 3CC8A 2QAGC 4F11A 5AK6A 4IDEA 3LBHA 1X7ZA 2OAEA 3I6YA 3OLXA 5LKRA 2RI1A 4EHNA 3J81j 1KXJA 4CKCB 3TWZA 3NBQA 3GRCA 3HVAA 3TQOA 3P97A 4LDAA 5LP6F 1IMJA 3RO7A 2BE9A 2WF9A 1UWBA 4R3UC 3GEBA 1J0CA 2Z8QA 4GBED 4C11A 2FCAA 4ED7A 3ROZA 3E23A 2IJGX 2JIQA 2A7XA 3BH7A 3QVOA 2GGPB 1JEJA 2CLHB 1LWNA 2C1ZA 1V16A 3ZDAA 5GJCA 4CR7A 1JFVA 4D3GA 1XEFA 1C0EA 1EB9A 3MN1A 1H74A 2LNDA 4NU5A 1VTKA 2P6OA 3KB2A 2ZFUA 3AVQA 1N8KA 2JBAA 3D4NA 1DJOA 4U8GA 5KFEA 2DRBA 1YIDA 3O8NA 1YNSA 1D5WA 3CV3A 1HWKA 5JXHA 1NDQA 3ZKAA 5GJWC 2H1WA 5KT5A 3K8WA 4FCVA 1MOSA 4MS4B 5KFVA 2IA6A 1VPLA 1Q1GA 1B43A 2E6UX 2YRFA 2YN4A 3TB4A 4U7UD 3IUQA 5KNDH 4CU2A 2VJMA 1YR7A 2VBYA 2LV8A 3Q2KA 3C3XA 3ZQUA 4D8XA 1QGAA 3A10A 5BR8F 1YS1X 2HRTA 1I1HA 1FDDA 2YX7A 2AX1A 1BDHA 1TZ0A 4EMUA 5CR9A 3RBXA 3OC0A 2JRLA 4GNKA 2VUSA 1TKBA 3V5NA 1L4UA 3OQ2A 4WZ6A 2BKLA 5FULA 1ZC3A 1HA1A 3ZI7A 4I6WA 4LTDA 4IICA 1WX1A 4K9OA 2JA2A 1T91A 3ESDA 1XZLA 2C3MA 3LTOA 4IIGA 3NTXA 5IBPA 2I2BA 1GG9A 1MGOA 2NOAA 3EVWA 1E9RA 2WJVA 3GJRA 1UDRA 2XE6A 3LANA 2G04A 2JJYA 4W6QA 5CFPA 4WW0A 1S9HA 3TDKA 2CJBA 1Y8CA 3GEGA 1U28C 4FR2A 3DFMA 1GNTA 3PFIA 2ERXA 4YHHB 3HA2A 1OD6A 1G8JA 2G82A 4ZO6A 3IEKA 4DIOA 3FCHA 3UD3P 2CQIA 3M1LA 1E0AA 1G42A 2JZ5A 1M2WA 2WWYA 4OJ1A 1FIUA 4IXMA 1HTWA 1MMLA 4UD2A 3AY3A 3I9KA 5GQSA 4F93B 1PZXA 2VL1A 3SYZA 4PHFA 1F2TA 4IDHA 2XNSA 4JT4A 1SUDA 2QMZA 2FX2A 3T5PA 4R9RA 2GJ8A 4R9UC 1E5VA 4F6RB 4M63A 4LREA 2GUWA 4CUZA 3U27A 3TD9A 3PO5A 4ZAGA 1QU2A 3HKBB 3K8ZA 5CYMB 3Q41A 2QGFA 3JYQA 1DOHA 4NA3A 2JAHA 1E2LA 1LQTA 3V97A 5JMPA 2NU9B 3IRVA 2ABYA 2D5IA 2RGWA 3GG1A 1GNVA 4G81A 2MKJA 2VI5A 4JGIA 3CO5A 4QBUA 1PZFA 3ESYA 5IXYA 1U81A 1X3SA 2CVHA 3L6OO 4I7FB 1KO4A 4OI3A 4OYAA 2C3PA 4ZOBA 4XX1A 4FXOA 2D0OB 4EG0A 4FGKA 3JQ8A 3U1NA 2WAYA 2VOJA 1K6JA 1ILEA 2NXUA 1F2VA 2JJ2D 1SC1A 3PM9A 3J81U 1T36B 4B3DA 3TRDA 2WTEA 4EUKA 2P2CA 4EUFA 1WP9A 1ZNXA 1N8TA 4GZMA 3ZH9B 4AFNA 3FI9A 1AHIA 2X15A 1Q7CA 821PA 4F5ZA 4TVSA 1FMFA 1REVB 1MC4A 2O3DA 2L42A 1FJEB 3VTFA 2IYLD 2G0NA 1H94A 4HLCA 4PIMA 3GILA 4RZSA 2Q3MA 3RSOA 1TUGB 1QGYA 4UHFA 3KELA 1GT8A 3OLVA 4FXVA 4F21A 4AT1A 3RUIA 3WLIA 4A8PA 2DLNA 3DEZA 5DXFA 5BT9A 4MV7A 2VBIA 2IEGA 2ZDOA 2BF7A 4I1SA 4Z2AA 1C4AA 3UKJA 4O4LA 4Y7CA 2QLBA 2A0KA 2VPXB 1QXSA 2H5LA 2MPUA 4FQ5A 1KKLA 3GPLA 3L6EA 1I4EB 4RBNA 1M10A 4TYWA 1IHDA 2CWXA 2D74A 1FVSA 4YI5A 3NJ4A 3V4OA 4J9OA 4HYKA 4DKXA 1YZFA 3BCSA 4J1SA 2P4EA 4FSHA 3BREA 3CGWA 4YT5A 2AWNA 1F0XA 1CZRA 5M3BA 4N18A 2FFQA 4IVRA 1SHJA 1E2DA 3OEHA 3NP7A 3TCKA 3W34A 2I6QA 2FIUA 4U63A 1RXCA 1WZCA 4HYTA 4RYLA 4XDZA 2GBLA 4XARA 5BV7A 5F1KA 2DR7A 1KQPA 1D2RA 2LDIA 1FTNA 1WOMA 3NBAA 4OQMA 4N9WA 2I3ZA 1KFSA 4EVSA 4CKBB 3R7NB 2OECA 5EWMB 4BX3A 4K9DA 1XCGB 1IBMJ 4Q1BA 4ECEA 1KWGA 4P7KA 1SIOA 3SJAA 5KNBA 2ADMA 3FDJA 5JXWA 3C14A 3B85A 4HUQB 4KN9S 1DTQB 1MO2A 2HFZA 3OTHA 5CAEA 4MW2A 2FV8A 4HRAA 2VF7A 1IK6A 1MFZA 5AW4A 4C4SA 4Q9IA 3JVDA 2ATXA 4AS3A 4ZVFA 1OO0B 4U67Q 2NUBA 4MO9A 1OQ6A 5L39A 1OI4A 1J90A 1V3SA 2EFGA 1UT6A 4YPOA 1LWEB 1Y3CE 4IDNA 4CEIB 1QDEA 3N9UC 4G3XA 5A1JA 2V96A 4HEA9 2CMGA 3H99A 9GPBA 5K8NA 3CW8X 5TV2A 1X1DA 5BN5B 1WETA 1W5TA 3OTBA 2DH6A 2J7UA 2A9KA 2B4UA 3AEKB 4DWOA 2F4VB 4DS5A 1CJTA 3ZKWB 3OE4A 3KP1A 2JSXA 2YV3A 3VGPA 3RGIA 4QWDA 3W7VA 2NUPB 2RSQA 1GWNA 4GKJJ 5T4BA 3L8EA 1JV2B 5JZSA 1T1RA 2DT5A 5DHFA 1XJCA 4CKWB 3DV2A 2RKOA 3TYTA 5BMVB 2WTMA 2NZCA 2ZBIA 2COKA 2ZI4A 2IJRA 4CEJA 2YV5A 4CTMA 1UZLA 5LUAA 1QGED 4HOYA 4ZVUB 2QX7A 5GV7A 5FL7A 1BEZA 4YGYA 3THSA 2PSSA 4V0QA 1EETA 4DSJA 2PQ0A 3TPCA 5FEMA 4E2ZA 3AR3A 3T5KA 5LMZA 3O6QA 1F60A 5CGZA 4R9NA 1QMGA 3K0SA 3WK4A 4UY8T 4LF7F 2OYCA 1T3HA 1JSXA 3BTVA 5KNDD 3MM7B 4O4IB 2LA6A 1FNSA 4M5IA 5DHTA 5KX5A 5LL6P 4N5DA 3LNCA 3BQNB 1A72A 4CKEA 3OHBA 2ZZNA 1HNIA 4CMHA 3L7KA 1HDXA 1AOXA 1Z36A 1WELA 5CLHA 2P3LA 4M99A 2OXCA 2C7QA 2YTCA 4M9RA 2AOVA 2ASEA 3L46A 1KVRA 1QZUA 3LXUX 2GO8A 2LEAA 4ACAA 1GTJ1 1K7XB 4KGKA 3VOTA 1ZK3A 1II8B 3VR6H 3T9AA 3H4BA 4JP8A 2W2PP 1M8GA 1AXEA 4IL5A 1YVEI 1M1ZA 1EXMA 1V6SA 3EXHA 4I2PA 3QHPA 2ZNZA 2DBBA 3A1VA 3TA2A 3N3BC 2VFSA 3PHHA 5TR9A 2QF7A 3STUA 5K1ZA 1NC1A 2WSYB 2GM5A 3NIFB 3ZDYB 1E2PA 2WKSA 1USUA 5ETMA 1GZ3A 2FWPA 1SVUA 3BMNA 1IUOA 1BRTA 1CY1A 4Y6LA 3N2YA 1MA0A 3OU6A 4YMVA 2HPHA 3KVOA 2IS6A 4TMTA 3PNPA 5F3DA 2ZBEA 4B3TF 4YN3B 3O3OB 5D1NA 1R0XA 4DA7A 4OYMA 2O67A 3AKYA 3AEQA 5BYAA 2AI1A 2XEDA 4CT8A 3X1WA 2UU9J 2P5UA 5H3CA 3M1VA 1BCSB 4C11B 1X5PA 3K5NA 1EFRA 2QV6A 5CW2A 2FGKA 3VVMA 4BBZA 2ZRFA 2B8EA 3AYZB 4BMPB 1U2TA 1KY3A 4LXXA 1X4BA 3W79A 2VDWA 4GKKJ 3ONEA 3MJSA 5AI9A 2O5CA 3NRJA 4KYZA 2QN9A 5NLLA 3PQ2A 3TTXA 2Q9CA 4P9SA 2UXCF 2VYVD 3EPKA 4G4SO 4KVFA 4YYEA 4IRXA 3BFVA 1SZJG 2VLBA 1DTWA 2CQ0A 5LT5A 4J9RA 2OHFA 1HQ2A 3NBKA 3RS7A 3JWHA 1BXKA 3AM5A 1QCZA 5HMYA 1C50A 4X4UA 3IWXA 1PJZA 5GGXA 2CHEA 2XCAA 1RT9A 5JCPA 3OUYA 4JVMA 5H9FJ 5BR4A 2IYIA 1ZXXA 4I5GA 1RUSA 4RD1A 1XWIA 1EFLA 2IHTA 1KP2A 2KI2A 2HCJB 3OTOB 2QT0A 4D4MA 1HD1A 5HRUA 2DFLA 2QUZA 2L48A 3H7HB 1AXGA 3MMJA 3UN1A 2VH7A 2PX8A 4DADA 1H1LA 1DHMA 1WDWB 5JAPA 2IY8A 3DHYA 4QU7A 2I54A 3BWBA 3LRPA 2KKHA 1M2OA 3RU0A 4MCHA 1NVFA 4D99A 1PJQA 1GPBA 2YVSA 5KCZA 1RKQA 3G2JA 5HNKA 4YUYA 3AEUB 2Y9PB 2WJPA 1SM4A 4Z99A 2EW8A 4W63A 3PU6A 4JIGA 1O03A 4OK6A 2JJ2A 5E3CA 1EK0A 1T9VA 4JI8B 2AK3A 1BEUB 3P9NA 1NBWB 4P86A 1G5RA 3VR6D 4M1EA 4H7IA 4CMCA 2QJ3A 1SBNE 3D8RA 1AW0A 3KHLA 3ISTA 4PPQA 4NE2A 3W64A 3W5AA 1R00A 3V4PB 3E22A 3KLBA 4DIEA 3FZGA 1QAOA 1LBSA 1Z4OA 3FDXA 1LDYA 1JG1A 2GYWA 4PZAA 2BABA 2XKJE 4OI4A 5D86A 4CR6A 1Z4IA 2CKDA 4DJTA 4EI8A 5ILGA 3IO3A 3ULKA 1U3DA 2QUJA 4RQAA 3JQMA 4RCYA 4YEDA 4UARA 2FTRA 4ETZA 3HYRA 3VR4D 4IDDA 1GY8A 2G2ZA 1LLCA 4HF7A 4ZOLF 1IAQA 1YA4A 2W2QA 3DGFC 4DCOA 1IY9A 2WHOA 1O8CA 3HKCA 1E9SA 3NJRA 3P9IA 3SFGA 3RUDA 5F1PA 1RU2A 1RAHA 5CFLA 4RKWA 1CZOA 2GYVA 4R2WA 4ZHQB 4S24A 1TM7E 1Z2CA 1K4KA 4C08A 3MIIA 2K8GA 2XF2A 5IT9Y 3U60B 5K45A 3DLPX 2GMHA 3DMFA 2ZS7A 4GPIB 3BBBA 1EFAA 3KFWX 1KRXA 4OYZA 3D4LA 2PJUA 3IV7A 2UXBF 1Y33E 1B70B 3QYAA 1C8LA 1XCJA 2IKQA 4OG2A 3IP6A 3ND5A 1IVYA 4PYNA 1HXHA 5I8PA 1AU9A 4KJZA 3GCXA 2B98A 2QVXX 3QHAA 1JE0A 4OJTA 1ZTTA 2MKHA 1RT5B 2EBWA 5FO0A 4LOJA 3DGVA 1P3DA 1XXLA 3H2LA 4O0LA 3PGLA 1Y1PA 4R8MA 1U8EA 5JVDB 2GN1A 3K2BA 3LW8A 2FY8A 3JASA 3V2UA 4E8UA 4X65J 3FJOA 1QUVA 1I4OA 1FPQA 1XRQA 1V4NA 1FX2A 3B3JA 2IYGA 3Q2TC 2I4TA 1VRQC 4W98A 2BFNA 2Q62A 1SA0A 5CFZA 1NT2A 1S7IA 2Y1DA 2YXEA 1XALA 2B8JA 5FPYA 4K59A 4AN1A 1L3IA 1UZAA 1Z88A 1TK0A 2RKWA 5K0NA 3FAZA 4OOFA 2E5JA 3KHHA 1P6TA 1QVAA 1O97C 3PKJA 2HSEA 5FUMA 3DLEA 2ZM6B 3WYAA 5B64A 4F7WA 5J58A 3MMCA 5IXJA 4MIKA 4BB0A 1RW4A 3AT1B 2JLEA 1UL1X 2RJ3A 1HDRA 1GFWA 4Z9XA 1MWZA 2A1UA 2D5BA 1KMHA 1V3RA 3CNQS 2AOWA 4ZI2A 4OXKA 2BE7D 2WG0A 1KEZA 5LZ9A 4CMGA 1QVRA 8OHMA 2OHVA 2QMOA 2ID9A 1NQAO 1DUVG 3VNVA 3WV5A 5JXSA 3DDCA 5BWMA 4MS1A 2ZAYA 3NWGA 2IHNA 1PL0A 5AQEA 3SZ3A 3QRWA 4ZQGA 4FOOA 2ZROA 3WYEA 3WGZA 2X13A 2BJ7A 2HIHA 4Z86A 3EZ9A 1UBOS 1DAHA 4L95C 3LH2S 5K2OA 3UQYS 3AOEA 3HJBA 4D6YA 3ENQA 6FDRA 1L7XA 1DJQA 4EO8A 2Z57B 4NYIQ 1M34A 4KTTE 3CDUA 5CT5A 5EUCA 1CUCA 1R37A 3FCUB 4ER0A 1IQTA 1ENZA 1L7DA 4EZIA 4CWAA 3ZWMA 4PS1A 1U1MA 4LQ3A 4TSFD 2W2XA 4YWJA 4NMXA 4YT4A 3E7FA 2C7VA 5LBUA 4FF2A 4KVAA 5JATA 2R11A 3TD2A 3OLAA 4PFQA 5FR2A 2BM1A 4EGCB 3HFKA 1NJYA 2LW7A 5CDSA 4TTQA 3H5SA 4KHRA 1RQGA 3O7WA 1O95D 3MEEB 3H9CA 4BWFB 1JHXA 4KR3A 5C2JB 1O5JA 4P71A 5TPZD 1H66A 4AJJA 4HI1A 1QK3A 3JRWA 4JELA 4AM8A 1ZL2A 1P2TA 1T8TA 2IP4A 1Z2AA 2Q5OA 3CH4B 4CIXA 2OBFA 3P0HA 4DG1A 4H7FA 1L3VA 1YVDA 2I1RA 5DO2A 4N49A 4CLKA 5J2UB 3WK7A 3FNGA 1N2SA 2R4QA 3JRNA 3CD5A 4L0QA 1G5FA 3KOZA 3W5UA 1W2IA 1A8IA 2PDAA 4RWXA 1NX6A 1JDZA 4DVJA 3QEOA 1WUIS 2AL7A 2XA9A 4M2LA 2IGTA 1TKTA 3E03A 2ZJPQ 3HP1A 3RYIB 1JEYA 3GFXA 1G5PA 5TF0A 4P73A 3R09A 3S8YA 4GOJA 3UT5B 2H7YA 5E0KB 4RNNA 3CF0A 5KG7A 3A4NA 3KTAA 3DPUA 2G71A 1QCCA 2OZVA 1JYEA 3OZDA 3GLGB 4MZDA 3HR4A 3EVBA 2POCA 1JQKA 4AF8A 2VTKA 4I0WB 1ROFA 1D9DA 2MZSA 1L4MA 4PRLA 1IN6A 2VYND 2I38A 1PR6A 4IG0A 5JRZA 1PW5A 4N0QA 1NYQA 5AKEA 5DLDA 4Q01A 2PLFA 3PX0A 3KLGA 3FOZA 4ZPBA 3DBLA 4G1UC 3E9MA 1HHSA 1GH8A 4NBSA 1RLOA 3B6ZA 1TEXA 1BQMB 2G0TA 1EEXB 2M0GB 2X4IA 2J32A 4DDFA 2JIZD 2UAGA 3AH6A 5D3KA 1CY4A 4RTKA 4YB1P 2RHBA 1S1XA 4ZC8A 4J9NA 3NIDB 1KZ4A 1SIBE 3P9RA 5HAOA 3ILLA 3SIXA 1HI0P 3DEIA 4RPFA 5LJ3Y 1KAGA 4H27A 3MJFA 1J07A 3R5GA 1Q15A 4JUBA 5B1EA 4EQ6A 3AU8A 1PJ5A 1S76D 3N5CA 5J2NB 1MQ8B 1T5OA 1E1QA 1QH8B 1HQYE 2OUGA 3BHJA 3PRDA 4L9AA 3NC0C 4LJLA 3QJLA 3CLTC 3DG9A 3PPIA 1ML4A 4BQNA 1I7PA 1SG6A 2NXNA 1U6KA 3I2KA 3UH0A 4OGLA 5FA8A 1P81A 2HRQA 2DT8A 3GUZA 2X0NA 1R7IA 1MN7A 3K2EA 1QQ6A 3IKLA 3ZUPA 4BMCA 2B7BA 3N9IA 2OFPA 5L40A 2IP2A 2IDJA 3U3JA 3HB1A 4Q15A 1I80A 2E37A 3KV3O 4UE3S 1UA0A 4TVOA 5LMNF 3WNQA 1DL5A 1F1JA 1TV6A 4INOA 6REQA 4GX2A 4EP1A 3KWFA 1ZM9A 1OIAA 5J2NA 3KQSA 3T3DA 1AK2A 5I7WA 2HV9A 1FQKA 2F8EX