1XTZA

Crystal structure of the s. cerevisiae d-ribose-5-phosphate isomerase: comparison with the archeal and bacterial enzymes
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
246
structure length
246
Chain Sequence
EDAKRAAAYRAVDENLKFDDHKIIGIGSGSTVVYVAERIGQYLHDPKFYEVASKFICIPTGFQSRNLILDNKLQLGSIEQYPRIDIAFDGADEVDENLQLIKGGGACLFQEKLVSTSAKTFIVVADSRKKSPKHLGKNWRQGVPIEIVPSSYVRVKNDLLEQLHAEKVDIRQGGSAKAGPVVTDNNNFIIDADFGEISDPRKLHREIKLLVGVVETGLFIDNASKAYFGNSDGSVEVTEKHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Ribose-5-phosphate isomerase
publication title Crystal structure of the S. cerevisiae D-ribose-5-phosphate isomerase: comparison with the archaeal and bacterial enzymes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 77
structure length 246
sequence length 246
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2004-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xtzA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xtzA01
2F1FA 2R5FA 3EFBA 2BKXA 2J0WA 3LHIA 1UJ5A 3DHWC 3LUYA 1JT9A 3NRBA 3BXFA 5FIIA 5IT0A 3MTJA 3TUZC 3TX2A 5IT4A 1CD5A 2J0XA 3EB9A 1VL1A 4R7TA 1SC6A 2O0MA 1FS5A 2PC6A 3NZEA 3E7FA 3U7JA 3AAWB 3BXHA 2OKGA 2JOQA 2MDAA 4L51A 2DT9A 3DDNA 2P9CA 5JJBA 3CEDA 5T41A 1Y7PA 4GO5X 1PSDA 3N0VA 3ICOA 2RQMA 1FQOA 2RI1A 3P96A 2KO1A 4L4ZA 2QMXA 4GMKA 3LWDA 1Y89A 3TUJC 3KV1A 2QMWA 1O8BA 1UJ4A 2RE1A 4L5JA 3DC2A 2RQKA 4TM8A 2BKVA 3OFGA 3KWMA 1PBTA 1XTZA 3ENVA 4OQQA 1HORA 3O1LA 3AB4B 4NMLA 2I9SA 3TUIC 4LUBA 4PWUA 1FSFA 1LK5A 3CH7A 1LK7A 1DEAA 1YGYA 2J0EA 1M0SA 1UJ6A 3IXQA 2GNPA 2QRRA 3NWPA 2DTJA 2LVWA 4M8LA 1FS6A 3L7OA 2LQJA 4R9NA 3DHXA 4X84A 4L50A 3MAHA 2W48A 4L4YA 2F8MA 2FGCA 3AB2B 4TM7A 3OC6A 1KS2A 3S1TA 1FRZA 4IO1A 3HN6A 5IS2A 1HOTA 4OQPA 2NYIA 2QSWA 2ZHOA 3MWBA 1ZPVA 3K5PA 3BXGA 2H9ZA 2P9GA 2RI0A 2PA3A 4GO7X 2CDQA 3IBWA 4GO1A 3ENWA 3ENQA 3OFFA 5HJ5A 1LKZA 3OBIA 2WU1A 3W7BA 3CSSA 3OFEA 3BXEA 1U8SA 2JHEA 4L5IA 3UW1A 1YBAA 1NE7A 3HHEA 3OFHA 1RWUA 2P9EA 3LOUA 3E15A
chains in the Genus database with same CATH superfamily
1VCMA 2RIJA 5B7PA 3VAFA 1RJ9A 2FY8A 2DKOB 2HYIB 2H54B 4RZRA 4M95A 3C14B 1NBEB 3T3OA 3DEHA 4WK1A 1XN1A 1EWQA 4F25A 2Y0SD 1D09A 2CL5A 2ZFUA 1TOAA 5I47A 1I1HA 2JLRA 2HLDD 3FKSA 1HZZA 4B0PA 1A96A 1NE2A 5BMVF 1BUXA 4MVXA 4JLAA 5G4DA 3VH4A 3OTOF 2H1SA 2NU7B 2R48A 1EFHA 4BB6A 3C5WP 5K7SA 4YUYA 3D9BA 4DQRA 4PSKA 4CMKA 4NBRA 1NU4A 1S8NA 4FEGA 3U1NA 3EFOA 2FIUA 1QGDA 3OBBA 1FFGB 4QOIA 3DI6A 2DCLA 3VKGA 4B7ZA 1Y5MA 3GT0A 3EVTA 4HFNA 4V1CI 2V7VA 2P9GA 2JLBA 2AP6A 2R4UA 4RLEA 4CNQA 1EVIA 2AQIA 3JQAB 4QOSA 2YNIB 4QJIA 3PB3A 4E2XA 2FW0A 4JYAF 4HK4A 4POAA 2XSFA 3P3DA 2BBWA 3B1VA 4I1RA 4Z1MD 1WQ4A 4QHYA 3PYFA 2WHPB 3HO8A 4DQKA 1EFTA 4H1UA 2HAIA 3LY5A 1NF3A 1E77A 2AJBA 4F3YA 1NF9A 4JVOA 1FTRA 4F5EA 2RHSB 1UVMA 4XEHA 2NSCA 1P33A 3GJRA 1HA1A 3F7OA 1GFZA 5B3JC 1B1AA 2G08A 4XYMA 4EH1A 1OBVA 4MIOA 1FJGJ 1B3BA 3E9ZA 1GV0A 2VP4A 5C1PA 1WVIA 1M2OA 4KQWA 3H17A 1NRJB 5IABA 3ZHTA 1ML3A 3FMFA 4R2HA 2M1ZA 3DE2X 3F3SA 2CBGA 4BFLA 1ZBDA 4IXTA 3RWOA 1THTA 2JEYA 3G0GA 1P4AA 5IC4B 3VC3A 5AVVA 3RAFC 5IU6A 2PH1A 3ORRA 4KE9A 3IRXB 2C77A 2O19A 4OHZA 4ZU3A 3DM2B 3BGDA 2VNAA 4UUWA 4HKTA 4CH7A 4LOAA 4YJGB 3Q7QA 3ZY2A 4TWBA 4OHBA 4C2TA 5A6SA 1AD2A 4HI2A 3LPCA 3DWIA 1AUSL 3WVNA 1NU6A 2PK3A 5FWXB 2BI4A 4GQAA 3KLBA 4G0UA 3W8DA 2J0XA 3KQSA 1UVLA 2ERXA 5G0RB 4URQU 1OGIA 2W37A 2O1WA 4UC0A 1P2FA 3H7AA 1DAKA 5DM1A 2ABWA 1ZZFA 2GCGA 4FDVA 1JG3A 5B7WA 4F3RA 4CIOA 3TI9A 2PEYA 2BEFA 2FSPA 3O4HA 1NWCA 3IOMA 5B30A 1RHRA 3CF4A 2UVUA 1GUFA 5D2CA 3JS9A 1D2HA 2W6CX 4UOQA 2V4JB 4FS3A 4KQZA 1M1HA 5B0EA 4LHVA 2HI0A 2EKPA 5JQGF 2Q6OA 3CRW1 4FF4A 4NYMR 1VBYA 3ZE7A 3D81A 1BGVA 4IPTA 2BTEA 2QRJA 4ND8B 4MGYR 3DXSX 4TXNA 3I5UA 3ENQA 2WU1A 2PWPA 2Q07A 4YS2A 2AIRA 4UCXA 2I29A 3V8MA 1ZONA 1VK8A 1XLTA 2QVYX 3N5CA 4KBFA 1W87A 1OLSB 2FJEB 3B52X 1B00A 4WXOA 3IP6A 3UKOA 3CJ4A 4H9GA 1OU0A 2Q3BA 3KB8A 2FTRA 2EVWX 5E2BA 4DA6A 2I8LA 3HDTA 3R7SB 1XZHA 3HB9A 3DV0B 1CBUA 4QUHA 4JUAA 3NS5A 5F2OA 3VZSA 3HS3A 3U3RA 2P8SA 3KV1A 5TJHA 2J3DA 3M8QA 3EPIA 1NQVA 3GMGA 2GM5A 3UTCA 4G1QB 4ZVOB 1S7IA 4B3RF 4PZDA 4CM5A 1BD4A 4AZVA 2VDOB 3VALA 5ITSA 5DO2A 1H2UX 3RIEA 3F41A 4A8QA 3ZWWA 4UZSA 3Q85A 4PWZA 2HPHA 2X2PA 2J0UB 1NJ2A 3MJFA 3DGFC 2YINC 4B6OA 5G4KB 1EX8A 3I30X 4OOEA 4G65A 2Y66A 4ZI5A 3ZTTA 4RELA 4DR1J 4L5IA 5AW6A 1YRAA 2DT5A 4C0SA 4B31A 3L9ZA 3PC7A 3S7RA 3X2EA 4O3PA 1G98A 3NGTA 4MO2A 1A9XB 2R8OA 3RH0A 4NLRA 5JARA 5FCDA 3DMYA 2DM6A 2FPOA 2D0DA 2P27A 3QLVC 2L3MA 4MMXB 3E61A 1V6HA 1RAOA 4BS2A 3N6RA 3TW8A 1FQOA 3GIRA 3OPQA 3GONA 3LPLA 4XVHA 2RDJA 4DWJA 2Y71A 5AE2A 4FFMA 1HNZB 2F9MA 3LF0A 5E6RA 4BXOB 2NAPA 1XZQA 3ZJUA 5I5GA 1RTJA 1LC0A 1M34A 5H3HA 2Y0PA 2XCOA 1AV7A 4Y3UA 5HIIA 3SJAA 2B61A 1DFGA 4G1UC 4Z99A 3N4WA 1VLJA 3KPYA 5AW4A 4CMIA 4ILLA 4ZKAA 1TAGA 2GJAA 3L2OB 4EYSA 3MM7B 4KXFB 4YGYA 4EIWA 1E8NA 2PMHA 2RG7A 3D7KA 1C1CB 1I1QB 2BKLA 2PFFB 2W1BA 1Y4UA 3QWFA 3T54A 1S59A 3BMOB 2X8LA 3EQ8A 5A0VA 3ZWOA 5IVIA 3K8YA 2C2WA 3P9KA 2YJ3A 4MT1A 4R3UC 1GXLA 1TLLA 2X58A 4HT7A 1EVZA 4WY5A 4GKKB 4XOUA 3F5SA 5IULC 2D1RA 5BSGA 2VOJA 3QYPA 2VG5B 3UUEA 4FTWA 1HO3A 4V0NA 3IC1A 1XP5A 4NFHA 2JEZA 1VJCA 2JRLA 2UZ4A 4JI8F 2BJ3A 4WFJA 4LQ9A 5B1YA 2KHDA 1XYVA 1I3OB 1QGAA 4P4GA 3KJHA 2J3IA 4MA5A 3DRPB 2FV8A 3GA7A 4LKRA 2HQ1A 1YJ8A 3DFMA 4IBOA 2LD4A 2XCSB 2DWCA 1KI2A 5AXKA 2IRXA 4EO6A 4LF8F 5DEIA 2ZIAA 3J7YI 3VZRA 1HDRA 3DQQA 1DY3A 4N12A 1KAEA 4ZOQI 1JG2A 1M8JA 3S2ZA 1UDAA 3NEYA 2Z5FA 2QVCA 2JGJA 2XUAA 3K7EA 1N75A 3EPRA 3RIYA 5EJMA 1KE1A 3UMVA 2GPWA 5BNIA 4DJFC 1M5PC 1JKFA 5KINB 1EK1A 5E4TA 1IJFA 1IM8A 1ZQ9A 4CMAA 2QX4A 2NU9B 1GYPA 2IELA 3BGOS 4MEJA 4C0OC 1QGUB 5B2FA 3ONVA 3C1UA 2KKHA 2CJQA 2B69A 1TQHA 4L8VA 4UEQA 4S35A 1Q44A 2X86A 2WUGA 3UM9A 3WBBA 4N40A 3MTBA 3CJ5A 1CUWA 2K1RA 3H2YA 4KHMA 2O3JA 3QWUA 3ZHXA 3WLKX 1B7FA 2C2HA 1YB6A 3W5ZA 5FWDA 1KK2A 2R8ZA 4GBED 2RAPA 5AW3A 2SNIE 2W8BB 1NXOA 3OQIB 3S5UA 1AKTA 3TSZA 1QR2A 4JBGA 3CINA 1OCEA 4YHBA 3A37A 5EIFA 4KU4A 1E3TA 5JVDB 4R5MA 3TSYA 2RI6A 4UCQA 1S9GA 4U7JA 3QSGA 2V8DA 4UEKA 2GC8A 4FS2A 4EHBA 1XNQF 2BJDA 1E4EA 2VQFF 3OF5A 1QSLA 4YAJA 3AIKA 4N3CA 3BH6B 3HCDA 4NYIQ 3O8OB 3FMBA 3MEQA 1P6TA 3H98A 4OK5A 4F2GA 1R0ZA 5DGDA 3QRPA 121PA 1M6WA 2PKQO 2O2YA 2V8PA 5F2KA 4MO9A 1NZ8A 1JEYB 3WYCA 3NC4A 1FYFA 4UZEA 3PNSA 3HYCA 3SZ2A 4IH4A 4L02A 3F4KA 5IBQA 3OECA 2B9WA 3RG8A 5EZYB 2IA0A 4YDXA 5EQFA 4BNGA 4MW7A 2H5JA 4Q1AA 1YB7A 2IA6A 4G8DA 4NMXA 3K4HA 3U3ZA 2QY6A 3H42B 1E2FA 3K2EA 2Q1WA 3PVSA 3L93A 3TFOA 5C8YB 3GLIE 4OQ4A 2PO5A 3O83A 5CH7B 3GR6A 4DZDA 3WC2A 1P77A 3DV2A 4A8KA 1YRUA 2ZUVA 4Z49A 1RAFA 3MOZA 4L0CA 1ZUIA 4DNQA 1GRVA 2ZI3A 2WVBA 2DPMA 3FZ2A 1O51A 5G0TA 1LDGA 5BN4B 4GC5A 4M6WA 1DQPA 3GFXA 1AW0A 2P77A 3UDVA 1UVNA 2I7XA 4EHFA 4YFUA 4G5SA 1JAIA 1R89A 1K5DA 3RRJA 1CDEA 3I55S 5HQ3B 1W2WB 2XW6A 3KJGA 4R1LA 2F90A 1CJCA 3FNIA 3EA5A 4FMBB 3GJYA 5D6GA 4OJGA 4UBMA 5TC4A 3CW9A 3F0NA 1J21A 3FPKA 2QLLA 1R4ZA 1Q1AA 1OTXA 2CBXA 2W4CA 4NLXA 3FYSA 3OE5A 5IJWA 1ZOTA 2Q5CA 3UFBA 3C3LA 1A7GE 1P2UA 2VBGA 1FP4A 1A50B 1BHO1 4ECQA 2QLBB 4NDZA 2I7VA 4ED1A 3RK4A 1SQ0A 3US5A 3BREA 4JUCA 4CIAA 1ZJ4A 3S28A 3WLFA 3GGJA 3N2GA 4OYXA 2VRNA 1T1RA 4RIFA 2QZ9A 4QTYA 1KU6A 4A26A 2YMMA 5JJKA 3ISVA 1IHUA 1TQ6A 4CL2A 5EMLA 1FX0A 3SM9A 4CG1A 1E2BA 1TKRA 3G1TA 4B73A 2VJKA 2HAFA 4PM4A 3S44A 2G1PA 3FBFA 1XNRF 4OX9B 4R05A 2R25B 5DCWA 4HDMA 3EUWA 4GWKA 3ELWA 1U1OA 2JATA 3EVNA 4US2R 4MJKA 5ABPA 3U37A 2PMWB 3KQPA 4K9DA 4GG1A 1J1ZA 3VPFA 4EKIA 4R2MA 1EESA 1L5QA 5HF9A 2C5LA 1HNVA 2OXTA 4FQ5A 2RAVA 3LT1A 2JLAA 5A04A 1VKZA 3H1FA 3NHJA 3M32B 3DLBA 5A2QY 2RF2A 3D6JA 3K0JA 1KR5A 5FL7A 2C7RA 2Q5HA 4ND7A 3ZDBA 1E2DA 1E4OA 2FUG1 4V19X 1E3JA 3U6KA 4OJKA 5KC9A 3IS9B 1GL7A 4NLTA 3EDRB 4ALKA 2K2WA 1RAEB 2VP2A 1XOIA 4QU6A 1CRWG 2QUIA 1OY6A 4B3TB 2OXEA 1D6JA 3EZUA 1LRKA 3P71T 2J3QA 3TLGB 2OCBA 2W9XA 3M6WA 3ISND 2Z5VA 2VA9A 4DVGA 4JJKA 1PGJA 3SKVA 4BQEA 5C8VA 3EWIA 5DM4A 3KYCA 2B4PA 3M8WA 4F11A 3TD2A 4OP1A 2KXFA 3KDOA 3VPDA 5KUTA 5EJ5A 3RUPA 4P9NA 3ABQB 4KPCA 1KOOA 5GVSA 2TMDA 2D8AA 1SXQA 2GXAA 3MAQA 1O5IA 5ITZB 2MTBA 5EKXA 2HWXA 1FVHA 4XIIA 1Y82A 4HNTA 3K32A 1OLUB 4M9CA 4OZLA 5JRJA 1IN0A 1Y3DE 2GEDA 4JQOA 4PQFA 5LQCA 1Z8NA 1QF9A 2B0JA 2BE7A 1AJEA 4J9SA 3OA0A 4H4MA 4MKAA 3DLPX 1VGYA 3ZDEA 4CFSA 2GVZC 1YB5A 5AI6A 3A04A 1Y5LA 4BUJA 1RPZA 1V9CA 3HULA 3DG9A 5DW3A 4C2AA 4Q82A 1GM5A 3R7DA 3VPBA 2GBCA 5H9FJ 4Z7YA 2XDAA 1OYEA 1MD9A 4J0GA 4DV7J 3Q8RB 3QVTA 3HP6A 4HJXA 1HW8A 1QH1A 5CVUA 2R6HA 5JD4A 5H59A 3O8WA 2WAMA 2OAEA 2XUJA 2ZH1A 2QL6A 3OFEA 5LDGA 4Z7JA 1I80A 2H08A 2ZIXA 4Y0NA 1ZIOA 2ONYA 2C07A 3DI6B 3V8RA 3BHJA 2ONKA 1AY0A 4A2QA 2ZIVB 2WABA 1XMXA 1M2GA 2GF0A 5B0AA 2DHQA 4FOLA 3OJEA 1RADB 4IG4A 2BR5A 1PNOA 1L3CA 3I23A 4CVNA 1KRPA 3KAPA 4IDHA 2DBBA 1T03B 5D0GA 3UN2A 1SBNE 3D1VA 3Q8XB 3R0IA 4QARA 3RU3A 1YI1A 4WACA 4L0DA 2W01A 4WY2A 3UWMA 1HMPA 1G8AA 3N74A 2AJDA 3CJ2A 4RH3A 1GRNA 4TVAB 1T13A 5DLGA 3TJRA 4DBZA 4ID5B 4PRKA 2GM9A 4QXQA 3M2UA 4MAKA 3WA6A 5LJIA 1N36J 2KXNB 2Z43A 2I76A 3C3DA 2HSDA 1GARA 4J9PA 5DX0A 4WZAE 2V4RA 2JHGA 5K4HA 3CJ3A 3W77A 4GYWA 3W6OA 2XWYA 3JRNA 1O6BA 3MCOA 2PE5A 1C9KA 4Z8YA 4IG3B 3KKKA 1M2OB 1JU9A 3QKWA 1K8ZB 2QN7A 1VG9B 4A8XA 3TJZA 4EBDA 2IUEA 3B78A 5J4LA 2FX2A 3ORHA 5D7NA 5GOTA 4J3NA 3LCMA 4BLUA 4D99A 1DVRA 1QO0A 5BUCA 2OXRA 1UL3A 4CT5A 2V34A 2CA9A 3EIOA 3FGNA 5J4HA 3SFGA 1QDLB 3IEUA 4OL0A 4ZT7A 4PX3A 2J4CA 4QPNA 3RBEA 4XM1A 1G3UA 2HNZA 3RRZA 4TTSA 1UT5A 1JEOA 3ONFA 2B9VA 1DWPA 1XVVA 2HVEA 2VFAA 4DTIA 2Z57A 2HT6A 4D8UA 4XX0A 3U6BA 4ALMA 3K6JA 1RMYA 2GPTA 2DY0A 2E5LF 1RHRB 3OZEA 3I2YX 5T7LA 1APSA 4H7DA 1QFSA 3UNXA 3SFZA 3CO0S 1NVDA 3MLAA 2VJBA 4YUXA 2B51A 3LQRA 3OCWA 4ZMMA 3LQVA 1H2FA 1D8YA 3NGMA 5DTQA 2Q4DA 2IBKA 3SIPA 3CN7A 2RAUA 5FPKA 1WCXA 1MGOA 1WETA 4C2BA 1OYYA 3U19A 5JMOA 1N9KA 1C4KA 1ZAVA 5IK2D 2JGEA 5DISB 4FJ2A 3KFWX 3GA0A 2GO8A 2AIRB 5LA6F 1Z13A 1RPTA 3BWBA 1HARA 1ZIDA 2V4UA 3UPDA 1PU2A 4XQ0A 3S70A 4C4AA 3SJ7A 1FBNA 1T8WA 3RIHA 1K0TA 3CNQS 1BY9A 5ALKA 1L5FA 2WUDA 4F3CA 4BBJA 1IN8A 2IHBA 4CO4A 2PLWA 4C8YA 2OBFA 4TX1A 3A6GA 3PFCA 3PRDA 5BOSB 2DGUA 2VAXA 4J1NA 3BEGB 4OKIA 2QE7A 3NNAA 3KJXA 5I8ZA 1MG0A 1RBMA 1R6TA 4KE7A 5K5EA 2CEKA 3KAKA 3L4SO 3M8QB 3OP1A 3SG0A 2WW8A 2HRYA 4DCVA 4K87A 2M4MA 2G0TA 2FQ1A 1CZHA 5ILOA 3QEMB 1RYBA 3PPVA 1RWXA 4OM8A 2BEWB 1I4TD 3ADOA 3FYCA 2VJMA 1XGKA 1NW4A 2QVXX 3PFGA 3T1NA 5JC8A 1S5PA 3PW0A 3JW8A 5MN6A 4HP8A 4LHSA 2F43A 1YMVA 4TT8A 4RLFA 3DL0A 3IM8A 2XSJA 3TBHA 2NUTA 4X1OA 2YIMA 1G6OA 3AB3A 5D3MA 2JCGA 3E18A 3ENAA 1WXIA 1ISMA 3V46A 1RM0A 3MRXA 1WDTA 4B81A 4HLNA 2VZEA 3ZJ5A 1NLFA 2PUTA 4MPDA 1R8PA 3UKJA 2HNDB 1G5FA 2WJYA 1TF5A 2XMZA 3QYFA 5E9AA 3EMBA 4LNAA 1P2BA 1EJBA 5DBGA 5J2UA 1CG2A 2OO3A 1CIPA 1K2VN 2JAPA 1YBMA 4BFSA 1CQIA 3T9NA 1GSHA 2HGZA 2RH3A 3P9QA 4NZ7A 5E6RB 1UBNA 1XPJA 3QKSA 4XTTA 1NJYA 3BQ0A 2Y93A 3QSYA 3ZDYB 4XR9A 3G2JA 4Y2GA 4J1TC 3SDBA 4JI7F 3PG5A 2JKVA 2WG1A 2HJ9A 3UH1A 2MJUA 4X7MA 3HHLA 1QM5A 1YIDA 3C16C 4HXFB 4WF9Q 1NZDA 2O2JA 5JZSA 3ORSA 2MJLA 2M6RA 1JPVA 1BXRB 3UFXA 4QUJA 4Q7JB 1G5RA 2EW9A 4P4SB 1IJKA 3BTVA 1FYWA 4LMAA 1O9HA 2ZKTA 4MUJA 5JW6A 2ZANA 4LCEA 3R40A 5C42A 4TYWA 3Q7RA 4YB7A 4EFMA 1Q2UA 1R27B 3S2GA 1ZVVA 3VV3A 1MN6A 3N5BA 2WVGA 2I55A 1RQNA 4F6CA 4WP9A 1ZD8A 2DCUB 5JCOA 4KQKA 1Z28A 2QV6A 1X60A 1XLUA 1QE1A 1CDZA 4WRRA 3LUDA 5CEFA 4UTNA 4K6CA 3R1HA 2B5VA 4O63O 4A73A 3TRIA 1P0CA 1TQLA 1K8AT 3ICVA 5D6NA 5JNLA 3RQIA 3S2YA 1ZISA 3UCGA 3CUUA 4CF3A 4GVBB 3C2PA 3TWOA 5IWAJ 4FYXA 4MUEA 4NPCA 3IKVA 1Z4IA 5I51A 5L45A 3GEPA 5KO2A 3ZZPA 3HNPA 3AUYA 3V1MA 3NV9A 3IV7A 4C5CA 4W6ZA 2IXEA 4DR2J 1P3JA 4TTIA 1W30A 4O4IA 3U61B 4B3MB 4H1WA 5BYKA 5E3QA 1Q7BA 1CS0A 5ALUA 3PXGA 3LXMA 2YZ7A 5ETNA 2X5NA 3ZXYA 1VFNA 5HJ2A 1EQ0A 2Z2JA 1YJRA 4FN4A 2VQEB 3E2IA 4TWJA 5BYBA 4C4ZA 2H00A 4EQZA 1NYRA 1JSXA 2D74A 2C78A 2IA5A 3MM8B 1GNTA 3CCWA 1TJPB 2P6SA 4R83A 3W3ZB 1GA1A 2GW8A 3ICQB 3TZKA 2AUNA 1YS6A 1QV7A 2ZR9A 2RDDA 1HWIA 2CHVA 1WHTA 5T8KA 2K1RB 1XDUA 2F67A 5KYXB 1K3TA 1Q6ZA 2TSYB 1R0BA 2OE2A 1YDHA 5JADA 1BC6A 3GCWA 3AV3A 3AESA 2PCLA 4MAAA 4XDHA 1HM5A 2VDLB 3ZDCA 2JGNA 3E9MA 2I2DA 1E99A 2ROGA 1Z22A 2DY9A 3I6PA 3GARA 2AN5A 3JQPA 4WBFA 3O6QA 2DUWA 1NT4A 3F3MA 1KDNA 2QIFA 2RHCA 3C74A 3HU3A 1NBAA 1UVKA 1S9GB 3NHZA 1HXHA 3F9IA 2GYUA 5J5AA 2H1IA 1E4EB 3X1YA 3HX9A 1C1DA 4Z7CA 5JR3A 2XXJA 3QGGA 3T7CA 2XMTA 3BF8A 2RGNA 2XC9A 1T1IA 4HQKA 2BOAA 4LX8A 1WHVA 3BKTA 3U0BA 4LSNB 3ITHA 5K3FA 4N56A 1S3IA 1B2RA 4K6GA 2MY8A 1YK9A 1SVDA 2UZAA 5EUCA 5CYFA 1KC3A 1J2EA 1XHFA 1R0SA 1SB8A 1Z4UA 5DS7A 4NXNB 5KSOA 3UN5A 4WOCA 1GL9B 4Z7OB 2H5JB 3UVEA 3DF7A 3JXOA 1W36C 4IOMA 1SVUA 4LRSB 1NXTA 2DH6A 2G80A 3KFXA 3NXSA 5HK4A 3OPMA 2GCNA 5ALHA 1Z17A 3SJUA 1PILA 2K2PA 1RA6A 2WINI 2GYYA 4BN0A 2X2EA 2A4MA 4P5PA 2DWPA 4YJFB 4KR7A 4ELTA 3EODA 1F60A 4U2EA 2C2ZA 2E9SA 1C0UA 1NXQA 1ST2A 1SIUA 2Z98A 4G4SO 3U3XA 4BO8A 5EWJA 3B82A 5EIWA 4WGFA 2QMUB 4EAQA 5A5EA 1WOYA 5GAGU 2E4AA 4MTCA 3A3NA 1DAGA 4A03A 2KO1A 1EX9A 3EXHB 1Q83A 1A27A 3QVUA 4I1TA 5I42B 2JH8A 2GJ9A 5ETSA 4EI9A 4DL3A 1FRFS 1FU4A 3L49A 3REGA 4I55F 1IN6A 2QUJA 4FNHA 1SHKA 4NBLA 3M5WA 4BWMA 5ICFA 3EQZA 4DV6B 2FEMA 4FOOA 1N0WA 2ZCUA 3HT0A 1N8NA 3RS4A 3IQHX 5DNAA 5DN6A 4Z7QB 4YMTA 3JZMA 3T3MB 1QQ7A 1FP4B 3LQ2A 5CRIA 5BR8J 3GD5A 5HE9A 8ADHA 2KT5A 3NYWA 3IVXA 4HS9A 4UBJA 2QLJA 1NLZA 2ZBDA 3DEKA 2FSGA 4RSGA 3Q8YA 1XZIA 4GT1A 1PN3A 2AGPA 1TK5A 1FX0B 1NZFA 1Y48E 2ODNA 1U80A 2V6AA 3KUHA 5JEEA 4R9VA 1P4SA 1NZJA 4TS9A 2RJZA 2XTJP 5BRJA 4WKBA 5ADZA 2ILTA 4JOQA 3GJQA 4RLSA 2YWGA 4LYGA 2UVDA 4UF4A 2HU5A 5JD3A 5ALIA 1FJCA 3ZBTA 4YP0A 1JPUA 3FF1A 2ZH5A 3HCBA 5BW6B 4CLHA 3OO0A 2OV1A 2DULA 3P49B 3CPEA 1RPJA 2ZRBA 3QT7A 2FTKE 1CFZA 3W3AH 4B3OB 3OOHA 1AQJA 3WNDA 2F8EX 4EGFA 5I45A 4CL3A 2G1AA 2H9ZA 2DHXA 3OJSA 3IULA 2YN4A 4C7VA 3S1LA 2G5PA 4FHCA 3DL7A 2WA2A 4OL9A 4UFOA 3MAAC 2DHEA 4F0JA 1OBFO 2SECE 1E2UA 3ZBUA 3K96A 4A1FA 4U7CA 1O95D 3D54A 4V1Ak 2ZVPX 3RTBA 3OFND 3D6HB 4LR8A 1PBAA 1KF0A 4D8WA 4BBAA 3X44A 2DYAA 3PTLA 5CYGA 3IOBA 4HEA6 1YSJA 2GTHA 3AW8A 4H54A 1O08A 4OQXA 4ZVRB 4DCOB 5K09A 5A3SA 4QOFA 4CLXA 3WFJA 3L92A 1VCTA 2WYUA 2IOFK 4LFAF 4WX2B 4OIXA 2GN6A 4ZV9A 3KJEA 4HNHA 1F5SA 3AKEA 4JK3A 4V0MA 3W3AA 4OI1A 3NPAA 2PUDA 3ZPXA 2KI2A 1U4SA 2WVFA 2B9YA 1I13A 4IZOA 4QQKA 3PD0A 1YMQA 2ZJ5A 2V7GA 2YY7A 3NOXA 1CIVA 3ABIA 4H4MB 3BSCA 4JVNA 3ET6B 2Y2VA 3MTQA 2HPUA 4EG4A 5K8IA 3C6ZA 1F2GA 3FWNA 3RS9A 3WK7A 2QQ0A 1M1GA 1SUPA 3B5JA 4HBZA 5KFLA 3EZLA 4BNXA 1U2SA 1G4CA 4KXXA 1CJTB 4AP5A 4U5XA 3U2QA 1NW7A 1ZH4A 4ZCMA 2AMJA 1T9DA 5IEBA 1DTQA 4IGFA 2EIXA 4HPJB 2M32A 4BNMA 4USWA 5JXGA 1Z6AA 5KFYA 1NTOA 4LJ8A 5GAEU 3M4ZA 3CEDA 4HYQA 3C3WA 3DA8A 1JLAB 3SCLE 4IYRA 4RS3A 2EFQA 1FNBA 3NIFB 4FR5A 1G8HA 4MW5A 3M05A 4MK7A 1TL4A 2NZ4A 3QVMA 2V1UA 4DA4A 4M38A 5CB8A 1EVQA 2YXNA 4KAAA 1E62A 4YP7A 5E4JA 1G5IA 3HLTA 3KNAA 2NYAA 5A3JA 3LQ1A 2ZULA 2J08A 4ZP6A 1K4KA 1NIPA 4PBSA 1U0HC 1N32B 4RLQA 1G7CB 2LU2A 1LLFA 1DBSA 3A6LA 2V8GA 1FDSA 3BK7A 5F64A 4M8SA 3WL7A 4LRUA 1POWA 3TOQA 2BJ1A 4EKNB 1OXVA 1L5UA 4UE6A 3NEKA 3ISJA 4PWDB 1B0TA 3CZ5A 5KT2A 3ZZ1A 5CCLA 5AI5A 3V2UC 2HA3A 2BMAA 3PJ9A 1HT3A 5KWJA 2DFLA 4QW8A 2DR0A 4DMKA 1FX4A 4OHCA 3KYBA 4EHJA 3EF0A 2DR8A 3Q3JB 3KLEA 1NBOA 5IKEA 1VHTA 3VR6H 3PXUA 4HTAA 4WLVA 2MSEB 2XDYA 3D6FA 1WD6A 2CNDA 1QVZA 2BPOA 2YH1A 1CUEA 1AURA 1V43A 1MMLA 2WNSA 1QWSA 2GAOA 2ECQA 5BV2P 4MQFA 4RUKA 1LVGA 2A58A 2EJUA 4D46A 1QFYA 1EUQA 1K0UA 4FF1A 4NZMA 5EXSA 1EK5A 2BM8A 3KE8A 3RHZA 1DX4A 3SAJA 3M1AA 4KK4A 1R5OA 3ZU5A 1CULC 1KL7A 3G6KA 1FXDA 2IXTA 3WK5A 1DADA 2Y0BA 4RXMA 5SV2A 5ALGA 2VTEA 4GQBA 3MAHA 4I50F 2FGCA 3HJUA 3LPYA 4MWZA 1ZAXA 1FSSA 1JHXA 2W6PA 4ES3A 5TMPA 3KFVA 1OF1A 5K03A 4MUYA 2IHNA 1GHTA 1XTPA 4ANDA 2HNZB 3LGMA 3I4PA 3VR6A 1YASA 3NETA 1YOBA 3R9KA 5ALVA 4E4RA 4NBVA 2IHUA 1XVAA 5EZ6B 1MROA 2OY0A 2P9JA 3EZNA 2AOXA 1U8FO 3CMCO 2HJRA 5LMNJ 2HLUA 1DMSA 3AEZA 2Z57B 3EG9A 3VAMA 2WJAA 4C4SA 1NSTA 1NJ6A 2XUQA 5KT3A 4Y2KA 3NHWA 1OU4A 4R1SA 4DFPA 1Y63A 2QX9A 4IJUA 3VAHA 4K0KB 3A06A 4AZ0A 3CDEA 3O8DA 1LS6A 1RI7A 1H8HD 2F3JA 2LQ8A 1XMOB 1PEDA 2FSHA 1N7JA 1LC3A 4OQZA 1UM9B 4F04B 5TR9A 1TCBA 1IVZA 2J5BA 3PBKA 3SQDA 5ALYA 3CXCR 4RAOA 3SIPB 4YXWD 1ZOIA 4C8KA 3IHTA 2X23A 5K3SA 5CLIA 3I31A 2P0YA 1DBIA 3QWPA 4HDQB 2FA9A 2VPZB 3CCMS 1J8MF 2OHFA 1Y8ZA 4NXMJ 2ZVDA 3HKDA 2PKYX 3DZIA 1AA6A 1XROA 2I7CA 2HVZA 2EV9A 3LVBA 1KJNA 5JNUA 3CUNA 2KJVA 4DFKA 5JANA 1HBOA 5IARA 1Q95G 4YMWA 2E4WA 4DL5A 5CM8B 1US8B 3RASA 3FOFC 1RAAA 3M49A 4WP8A 1WM1A 4FYJA 5C5JA 1OPRA 4DWOA 3OHAA 4L22A 4UU0A 2XB4A 2JX2A 1RWPA 4B4OA 3NAZA 3DCYA 3EISA 4MLZA 3F1KA 3GBPA 1VQMS 5F1YA 1RWXB 1IEQA 1WU7A 2VJMB 4J9QA 3TAHA 1DI0A 1ZYQA 1I2DA 4MRPA 4JI3B 1WHSB 3WGNA 2QA5A 2QBYA 3GT4A 3MF4A 3RHSA 4E33A 2F8LA 1EM8A 4TUYA 4QR0A 3CIZA 2TRSB 4B3FX 1T0TV 1Q77A 3NXKA 4DUZJ 1M0SA 2XSJB 4NRUA 1V5GA 4FCVA 3ESZA 2YY5A 2RHRA 3FB4A 1XQIA 1P5HA 1D4OA 4JP5A 2G04A 4EJSA 2D1YA 3K09A 1YR7A 3OZAA 1J7JA 2KRRA 4OQLA 3NC1C 1OREA 3NGLA 1TKXA 1WKBA 1KR2A 4DJDC 4TWIA 2WTNA 4IJMA 1LDBA 3OHMA 2Z0GA 3EZ5A 1E64A 4CKCA 4BKUA 1OQ3A 1JKXA 3FJYA 4BMDA 1MTOA 9ATCB 5L4SA 3NCQA 3Q22A 4D9FA 4I4TB 1CQIB 5FEUA 5J2NA 3HF5A 4ZREA 3BJMA 1DRVA 1PQPA 5KSZA 3QKSB 4CO3A 2RHTA 4XFKA 3HE3A 1A8HA 2BFDA 4DM4A 3QSYB 2R9LA 3ADAC 2K87A 1KHHA 2IGTA 1NRXA 2VLBA 3G13A 4NSNA 4J75A 3ULKA 1A7JA 3IFEA 2C5GA 4A0SA 3AINA 1ECGA 2EHDA 5J1EB 2GO1A 1RWOB 5EAIA 3UFXB 4RPCA 3N5FA 1PL6A 1E5XA 2VQDA 1D8AA 3TDNA 2VBCA 2A5YB 2JC1A 3FCUB 2P9TA 4DT1A 2YC4C 3OTGA 4PTLA 5LWHA 5JAMA 2CQPA 4GX1A 3SX0A 4EA8A 5C42B 3L6UA 3TLJA 3BYRA 1RXUA 3H86A 5IBPA 4R16A 3VKFA 5BXQC 1N8SA 5L51A 5F9NA 4IFBA 4DR3J 3PHHA 4UTVA 4AUEA 2QS9A 2FN8A 4F4AA 3V1KA 3T9BA 3ZOKA 1PAUA 1Q1ZA 4EGQA 4Q0BA 2HZVA 1OH7A 4U6PA 1ECBA 3DOIA 3K8QA 3CMMA 3TOVA 2A0UA 2KB2A 3T3IA 4XDCA 1YOVB 4HEA1 3BXHA 1AGPA 1ZJ6A 4D8YA 4J90A 1SUFA 4DZRA 1GV1A 3GD7A 1VMKA 4C29A 1V5VA 3IMKA 1HNXJ 3OEHA 2YNGA 1SG0A 3DE3X 5KREA 2GMWA 1JDSA 5C25A 1JIQA 3SF8B 3HKWA 4NI2B 1BG6A 2N7YA 1YQDA 2DQYA 2FW7A 4I4LA 2QUBA 4O4IB 2ZVJA 3AR5A 4OBEA 1ZJ5A 4DJBA 2NQ8A 3ZK8A 3H1EA 1AK2A 1CS0B 2HS0A 2PZFA 3ZWXA 2ZQ5A 1J5EJ 3K70B 1C8KA 3WTCA 1TL7C 1JG4A 2MQPA 4R84A 3HM9A 3PCRB 3CR3C 3FYUA 4O0NA 1NR1A 3FI0A 4IKPA 1LA2A 1FEHA 4B7UA 1L5MA 2D74B 3L7JA 2J9EA 4ZEWA 3SIWA 4U67Q 2IKSA 1AB6A 2D0IA 3NHAA 3A1UA 2YVKA 1U9YA 3LYLA 2F1FA 2ZRGA 2ZT6A 3L8EA 2WWYA 4QTXA 4HLUC 1JLLB 2CC2A 4OF4A 4XOIA 3B6KA 3F73A 4DPLA 5JBNA 1LQTA 1JLFA 3UC9A 3AESB 3AHHA 2GGPB 4ERDA 1JKMA 1E9DA 4ETIA 1V3ZA 3ECAA 4Y98A 3D2CA 4ITRC 4N4AA 1RM3A 1X7WA 1IBMB 1Z38A 1XEAA 3NVAA 2HF2A 4KLCA 1S1WA 4UHJA 2HJSA 3W8RA 2GN4A 2I22A 3KLHB 5LQUA 4YB6A 2GLTA 3NKLA 4ZKEA 4CNBA 2YWKA 3GMTA 2GF2A 4Y30A 2R66A 5BVGB 3VU0A 4A8MP 4DBQA 1RCUA 3ISZA 1X0PA 4GQIA 4ED2A 3ESDA 3ITHB 4XSVA 4CRJA 3GFYA 5JD6A 4H60A 4BQOA 3TGWA 4NG5A 2IE0A 2JI8A 3SZGA 2HJWA 5LP6A 1ISHA 5E3CA 1P60A 5ALZA 1N1DA 2Q50A 2P9EA 4NBKA 3AHIA 4X7BA 2O20A 5J2MB 1JI0A 4PQUB 2IS4A 4KPYA 3B5IA 4Q24A 4Y2QA 4QULA 3D3CJ 1V6CA 1EGAA 1V8ZA 5D7BA 3EVBA 1P5FA 3AVPA 2FNAA 3CRZA 4BHTA 4L75A 1WNTA 1MX5A 1CUFA 4AJ2A 3BD6A 1J90A 2IWRA 3LT2A 4EFLA 1VP3A 5AOAA 5ITHA 4HTJA 3VRHA 5J9FA 2BDPA 1JSRA 3L1JA 1E7YA 4D43A 4F3TA 4TM8A 4L5CA 2MQ8A 1UPTA 2KFZA 2YNMC 4XPZA 2C2ZB 3AB4B 4P3KA 1U0OC 1C0UB 3LC7O 2E5GA 4OLOA 4B6FA 1G291 5TEVA 3D0RA 4YP5A 1EKXA 1U31A 2A2ZA 1L3TA 4QIVA 2OBLA 4A8FA 3O84A 1PEAA 4EGCB 1QOPB 5CBKA 1YR8A 3V2HA 1GZVA 5D6OA 2VP3A 3IRVA 2BE9A 7MDHA 4P6VF 1T9CA 3H59A 4WKPA 1IEVA 3E03A 3FWPA 4KPGA 2CVHA 4F72A 5B1EA 2GUWA 4YPVA 1K8QA 4DU7A 4MKFA 2ALZA 2DH7A 2ZU0C 2X40A 2YS6A 1G6HA 1L7XA 2C2KB 3I3SR 3RFCA 1RHUB 3IUNA 3IDQA 3I04M 1WLYA 1M67A 2HEIA 1KE2A 3LW7A 3NTUA 3U4GA 4LBVA 2H4YB 3PEFA 3BA6A 3TDMA 1R4AA 3PV0A 4EGLA 1U3CA 1QJHA 1XMPA 1JJAA 3G1WA 4G07A 1MXFA 2IXAA 4TN1A 2QLJB 2WJ3A 1L7EA 1Z5PA 3DO8A 4KP7A 5JUWA 4WOKA 4IWXA 3HUEA 3L7YA 1H23A 4AKGA 3SE0A 2HFJA 1I94J 1XKQA 1GYQA 4G0ZA 3RFTA 1YCHA 5HI7A 2OELA 1N8KA 1R12A 2IBSA 3FUVA 5E2IA 4YR0A 4CM1A 3IPRA 2RK6A 3WDMA 3P4XA 5HUHA 1GK8A 4DV0B 4LJSA 3GJQB 3ZXUB 3WQSB 4P2XA 4GX0A 5H1SV 5CCEA 2CYAA 4IIXA 2WVAA 1LDNA 1TAUA 4R1UA 3R3XA 4Q0MA 2X5JO 3AG6A 1C0LA 2BZ1A 4MFBA 3C3EA 2WOMA 1L7AA 2QOEA 2VQSA 4RABA 1TVCA 2ZSKA 4BQQA 1PR2A 1VQOS 1FK9A 3AF5A 2DPHA 1Q84A 3DGPA 3NBPA 3MCSA 4J9VA 4MULA 1KKMA 1NAIA 3MMPA 4Y2YA 4EF4A 2ORVA 2XGOA 4ZN6A 2FUG6 4P7JA 2KLHA 4ZVTA 1O5TA 3MZ0A 3AI3A 3EIUA 3H4DA 5F51A 4G56A 5B4VA 1PSZA 3BF7A 2CLSA 5EHQA 2O8DB 1P7PA 2YWCA 3P32A 3I2IA 1EFCA 4CDIA 2OP5A 1G9SA 1EHIA 2GLUA 2WEKA 1GQ2A 2XI2A 3A4YA 1SCIA 2WKPA 1AKRA 4PCVA 1W75A 3VTFA 5BRAA 2VDNB 5JSUA 3FCYA 3EXAA 2QLWA 2HFUA 5IM0B 1BHQ1 4DCNA 3KOUA 4IO0A 1IAQA 3L6CA 2W22A 4S3MA 3CNQP 4IL5A 5LNK6 3HGMA 4X94A 4HUTA 2YBEA 4F85A 1JQ5A 2QTVA 3SSQA 3AUJB 2A9QA 3MUMP 2UU9F 1OFHA 3KLFB 3O2IA 4MR9B 4A15A 1OWPA 1YI8A 5KNBH 1REGX 1SVOA 1D5WA 1AZLA 3GPLA 2W25A 1P27B 2MYNA 5K0SA 3ONNA 3U27A 1YZVA 4KIFA 3A9SA 3BS4A 3H04A 4M0LA 3QVKA 1RAGA 3LXUX 4DMUB 2V2KA 2BGNA 1CHNA 3NCTA 5MF6A 1DOHA 2FFRA 2RSLA 2E89A 2PUHA 1B4DA 1Y1PA 1L4HA 3T7RA 2RU3A 1KBQA 2FFAA 1DTQB 4CF7A 2D2FA 4MV3A 1YR6A 4UBNA 3JATA 4G85A 3BL6A 4F56A 3E9QA 3I2JA 3H9JA 2LLZA 1X87A 3SEFA 4M8LA 1MVNA 4UUNA 3H5IA 4DR4J 1I6KA 4X64J 2WD9A 5L9NA 1ADGA 2WWXA 3EYAA 1SXPA 2QZPA 3PDJA 3H4MA 3WBKA 5JBQA 3M9LA 4TKZA 5KNBA 2ZDGA 1D1QA 3D3QA 4BWYA 5E1DA 1A82A 2I4RA 3ESRA 5DETA 4OQMA 2B4OA 2CQ4A 4OYPA 2P2DA 4REQB 5BNZA 2O8BA 4MHTA 2F3RA 2WF7A 4EHAA 3HNOA 3SBMA 1GNKA 4OAQA 2DNOA 1L1FA 3T4PA 3DRSA 3H99A 5KFGA 4RGBA 2X0DA 5DHPA 2DTXA 5I7HA 3OAAD 2J3KA 1SI9A 4FWTA 3ZU3A 2ASVA 3KLEB 3R6WA 1D8TA 3OMXA 3W90A 1QX3A 3D6FB 2OO5A 2XHZA 1NX6A 4NHOA 5C7PA 1RWVA 2BW7A 2ODTX 2BEUA 2O6LA 2BRKA 4O4LA 3GH3A 4MQFB 4I5GA 1XBWA 5HXAA 1DZIA 3OTCA 2X7IA 2KL8A 1PYOA 3SQOP 2MEWA 2BHSA 1W4CA 3CC8A 2JW5A 1GMVA 3LT0A 4LVOA 4R40A 1Z7BA 4QUAA 3BH7A 3TD6A 3GCZA 1NP7A 2YNFA 1KK1A 1QAYA 5DEOA 1ZMTA 3SYTA 4NX2A 5IZCC 2X0EA 3I61A 5BYSA 2PFSA 1DMRA 2Y0BB 2RB7A 3LOQA 4ZDNA 3OT1B 2GK4A 1PFQA 5ECYA 1BVHA 2VF3A 2PWBA 4MUHA 3G7SA 2Z8YM 3AAWB 2GAJA 2A9KA 3G82C 3O91A 3LCVB 3I9MA 4FDTA 5EXEA 2I5JB 2VSOA 2Z6AA 4HT5A 4PCUA 2P9FA 4RTQA 4J0KA 3HC7A 4J0HA 1VQ5S 4FBTA 3GOHA 2JA1A 1D0IA 4LFCJ 1ISRA 1XCGB 2ZJZA 2PXCA 3C3KA 4UPDA 1VECA 4QW9A 1JJCB 1ZETA 1T2CA 1KWKA 1T9HA 3A2KA 4ECEA 1U8CB 4Q9NA 4NLUA 1QAQA 4CO5A 1NUTA 1X7DA 3MPVA 2LU1A 2BGMA 1LSSA 4HNAB 4Q3OA 2R6AA 3I9V9 2IYVA 2V5VA 4X85A 2NVUB 5LXTF 1JHOA 1MC8A 3NT4A 1H7WA 4LYDA 2BM9A 5DRTA 5HGJA 1RACA 2AUTA 2M88A 4BVBA 4FWIB 2BKAA 4IMRA 4FC6A 4QEZA 1CIJA 1Y4AE 2GSDA 3M9MB 3NMUF 2PS3A 2BRLA 1OIAA 2UUTA 1YDMA 4P86A 1DAXA 4LJRA 4PHFA 4P58A 1DJLA 2BOVA 3HKDB 3RC2A 4DRXA 4TLCA 3VDMA 4W1SA 4IIYA 3ABZA 3JYLA 3AEUA 3SCIE 3WDSA 2JEFA 1JZSA 4X45A 3N79A 4H18A 1RAAB 2QSUA 5FBLB 2AT1A 2JJ4D 3BAFA 2V1XA 1ODJA 4TYQA 4YRQA 2HNAA 2JAXA 1KQSR 3JQJA 2NZXA 2XTZA 4W8OA 4HAZA 4G36A 3D6AA 1DV2A 3BIWA 3DOFA 1V6SA 4CMGA 3DTVD 1L5RA 5JBIA 4PSCA 3T1YJ 3ZW7A 1AGYA 2KQUA 1KJ9A 3H8VA 4KQ1A 2ODWA 4BNWA 4DL4A 1F38A 3OY2A 1TF2A 4D02A 4L3KA 3RW9A 1PRYA 4NLGA 4Z7NB 3DM9B 4EJSB 1ODTC 4BAUA 5IYZB 5FPQA 2WUEA 1W7WA 1V41E 2B92A 3PQFA 3U44A 1SQGA 1ZCBA 1KO5A 4YR9A 2XF8A 1WF2A 2HW8A 3CZMA 1J33A 5JWOA 3BSNA 1WCIB 2Q5QA 1Y6RA 4GLLA 3HI9A 2AFHA 2BYTA 4YRDA 4NRTA 3CVVA 5E8RA 1LK5A 2YY6A 1YZYA 4JLKA 1FTQA 2V97A 1NDLA 1Z18A 1T5TA 4ZOLB 4PAOA 5LSRA 2Z5LA 4AJOA 4GKJB 5KYGA 3GPCA 1GPLA 4ZYTA 2BMWA 1SU7A 1PG2A 4IH6A 2G82A 1O4VA 5GIOE 4RFSA 4F0KA 1E9AA 5LR6A 1OXMA 3GG2A 4KBGA 5CLQA 2DIUA 2ZH3A 1KS9A 2IDMA 1L4EA 3QGHA 2XRFA 4EL0A 4LMZA 1C8LA 1ZVQA 5KYYB 1RTIA 2QLNA 4HEQA 4PZYA 4R1NA 2YHUA 4ZCPA 4LBPA 2O52A 3F3YA 1YRTA 1P2GA 1UOOA 2X2FA 4PU0A 5J2TF 3F8SA 3UAWA 3DKVA 4DT1B 3D4IA 5G40A 5JATA 2Z2YA 4EAAA 4OV6A 1CQJA 1E1NA 3USES 2PC6A 1JWWA 4NCGA 4QLAA 3PXDA 1N92A 5CCBA 2RBKA 1FE8A 4EVSA 3AEKA 1I2BA 4QGBA 3ZC3A 4WTYA 3ZWNA 1FDNA 2ATCB 3P9RA 4YV0A 2UUWA 2RE1A 3UT5B 1PAUB 3HLKA 2ZDHA 3H2HA 2BT4A 3JB9k 3U49A 4MW2A 2WWWA 2YTZA 2JLUA 2Q1UA 5D4LA 4DLTA 3MGJA 1V8BA 5LNK1 1N5LA 1NY6A 3DFIA 4DPXA 1CP2A 1PJ4A 2DMRA 3ACCA 3TRDA 4MIKA 2V7QD 3JWIA 1S6QA 4D80A 3IR6B 4IVRA 3L0PA 2E0IA 1B8UA 2WTUA 4B9SA 5CP8A 1TT7A 4ZVSA 3SHFA 2KTQA 4FMCB 4GWLA 2LUOA 4OQYA 4KO0A 4UTZA 2YKNA 2CUZA 1RJ9B 3VUFA 4PG6A 4C8ZA 3FYUB 3E7FA 5BPHA 4DUTA 2HIMA 3MB5A 2OSBA 2R6DA 4RKFA 1HRDA 2XOXA 2C94A 1D09B 5KHAA 2RI1A 1G4HA 2G72A 2P30A 1QK4A 3ANLA 4ZZ3A 4N0MA 5B3AA 3LUHA 2WUVA 4B2IA 1AA9A 3FBGA 1MMDA 3BSFA 4UXJA 2J5RA 1EA7A 4NCIA 2ACYA 4F60A 2IITA 2AZ4A 3R3TA 1UZAA 2YWXA 3TLEA 4P36A 1N6NA 1WC3A 1L9XA 3MCUA 3V4IA 3NKVA 4NLLA 8LDHA 3PC8C 3CZ9A 1XQ6A 3MAGA 3IUBA 3IIIA 1WPXA 3EFOB 1T8UA 1KI9A 4GKVA 3HR4A 2DPLA 4LV8B 2KZMA 1JAHA 3VFDA 2IBOA 3WB9A 3MCZA 3TX8A 2IM1A 1RPAA 3DWEX 3PE6A 2WSBA 3I12A 5B6JA 2XMSA 1FD8A 3LUYA 1EFPA 2A0YA 2J48A 1PG5A 1HDEA 3D2LA 4JXZA 4YT8A 2WE7A 2J46A 5K6AC 3GG9A 1KJ8A 4CETA 3G8BA 3MYRA 3NDRA 1BD6A 1AHHA 4WN9A 3OW2R 1GCUA 1R6VA 3GV5B 4Y67A 2G0IA 5BW5A 3ZJVA 2QD1A 1H0SA 2C2NA 5HIMA 4HXYA 1JZQA 1S0VA 3IMFA 4CEIA 3VVLA 2OMOA 1M7BA 4BX0A 3NS6A 1X1EA 5K8TA 3GJRB 5B7QA 3C8MA 2F4VB 1SQEA 2OCPA 1URNA 3FPGA 5LB2A 1T9UA 1QVFR 3D2WA 4L78A 2HHHJ 4RADA 2JGMA 3BX1A 2ALYB 3T3HA 3EOBI 3GMIA 5ESDA 3IILA 3BSYA 3R44A 4U2CA 2PVPA 2OESA 4YRLA 1IM5A 4XVCA 5J43A 1ZXXA 1OHHA 3WNBA 3V6JA 4H7KA 2CZ4A 1EG7A 4EPVA 1WU8A 5J1TB 4LOKA 1S2IA 5CB6A 4M55A 2PX0A 4BNZA 2GT1A 4OBBA 2NYUA 4WT7A 4J7CA 3D3NA 3MBKA 1MQAA 1S79A 2F9JA 1Y5IA 2GI4A 3UCFA 5A6SB 2ZKIA 1NASA 3EULA 1T3NA 4CMEA 2QPOA 3PW2A 1WV1A 4M9SA 2WIKA 2XRMA 5AUPB 3DTTA 3SMVA 3G1UA 3L5KA 1PFUA 6YASA 3K6KA 3P9PA 4YY3B 4UXHA 4FGJA 3OQOA 2OGSA 2QJOA 4WZZA 4TXJA 2Z2LA 4UD6A 1P1TA 1OXXK 4H6XA 5EOVA 2FZ5A 4MGEA 3NR2A 2XUGA 5FYDA 1X1TA 1FK8A 4Q5IA 5HFJA 4L08A 3LP1A 3LDUA 3SFVA 4R9NA 1JLHA 4Q47A 1MDBA 1N7HA 1UXHA 2Q7XA 4PG7A 2QA1A 1GJRA 1Y3BE 5CFRA 2V6GA 5UKDA 3WDKA 1C3JA 3LPAA 3FWYA 1DPGA 3TL6A 3ZZMA 3MCMA 3L7NA 2BCJQ 2OB2A 3M3HA 4JR1A 2P6NA 1HE1C 4LJAA 1SB9A 4J7AA 1TFYA 4DOZA 3UDLA 2KVQE 4MA0A 4EA7A 2O54A 5EHIA 3VGUA 5CUQA 3P19A 2PQ6A 4QBIA 2NG1A 4KMRA 3RRNA 1C0KA 5H02A 4HACA 3RT1A 1W36D 4R2WA 1VQ9S 3QWBA 3H4BA 5EN1A 1K44A 3Q15C 3B7PA 4C0JA 4P2GA 2J41A 3OT9A 4K8OA 4JLBA 4B74A 1ZCFA 1Z62A 4BEBA 2WOMB 3LP2A 2BRUC 1DBRA 2XKJE 2YRFA 3SMZA 3GUVA 4DL0C 3ILJA 2BHLA 3I9ZA 3GG0A 2VJVA 3DYVA 1WVMA 1QIGA 1I33A 4W90B 3WB0A 3LZCA 3BJIC 2F5GA 4TYAA 3QKIA 2VDUE 1U2TA 4KH1A 3ZHUA 621PA 2IM2A 4ZVTB 3JZFA 2IU0A 4C3OB 3CBQA 2JKYA 5T5QA 2XEXA 3GRRA 1LXCA 1XERA 1KY5A 5LL6P 2ZPTX 3TD9A 1IXYA 2P69A 1F9HA 1R0KA 3HFSA 2B94A 3EVAA 4ZJPA 2EF0A 4KFUA 1RTKA 4BKOA 1K47A 4NPHA 2PM8A 4TPKA 5T4EA 1JWAB 2RS8A 4Q1DA 4YUVA 2PJZA 1XZFA 4B3CA 2G2YA 3JAMA 1NVEA 1E58A 3VDQA 3RE1A 2Q6KA 3QPWA 5D8DA 1V5FA 4FN5A 3Q9SA 2HWUA 1LOUA 1JK9B 4RD4A 1OI3A 4K6FA 2GIQA 2QTVB 2O2ZA 2POKA 4MGKR 4YAFA 2QDKA 2VZ8A 3E3AA 3TW8B 3FA2A 4RAQA 2H4WA 3WWZA 3KOWA 1L7NA 1QGED 5FIUA 3WMGA 2CXRA 2WSSA 4ZJLA 1IB0A 4L15A 1LPOA 5EP4A 4KXVA 1S01A 3TLAA 2RJ3A 1W5FA 1WEXA 1RTJB 2ZUAA 1M34B 1RAGB 3GP3A 2JKZA 4DCJA 1RRVA 3AGQA 4F6LA 4KQIA 1G8PA 4DSFA 3HN6A 4LZJA 4USJC 4CMIB 4HN4B 2P2LA 3PYXA 2XMWA 5AJHA 2FSFA 5JT1A 2ZI6A 1TT5A 4TRRA 3GY0A 3JATB 3AWIA 3BXOA 3X2SA 2CE7A 1L7BA 1WUJS 1E9FA 4OGWA 1CF4A 3K89A 3ZU6A 2Y27A 2UV8A 2YHIA 2XO7A 5ESXA 2IEIA 2VHUA 4CQMD 4QLOA 1M74A 3L8FA 1JR3A 2J3MA 3JQ9A 1O4WA 3OD5A 4R2XA 4N3BA 3GEGA 4MJ7A 1XCLA 2BBOA 1JQ3A 1OYOA 3L07A 3I0MA 4MRRA 4YIKA 3CULA 1OZ0A 4TSKA 3Q98A 3NDBB 5BSUA 1KDVA 1GTJ1 1YULA 1HPLA 2EZ4A 1ZTTA 2CVEA 3QT6A 3DLJA 2HVHA 2HY7A 4IG0A 1EA5A 4P3XA 2HO5A 1OPXA 5K9ZA 4X97A 3QJPA 1L4FA 4LOIA 4QU5A 3DVLA 2K6GA 4HUQA 3IC5A 3DE6X 3Q72A 3GCGA 2FZKA 2P4SA 3QXSA 3NGUA 3KR0A 3DRSB 4AMVA 3FHTA 3UTDA 1P72A 1L3SA 4IGEA 2ZR8A 3TKAA 5H82A 1USVA 3H2VE 1X7HA 3ZZNA 2IYEA 1MAAA 5AW7A 3U4MA 2VPTA 3WSTA 2BBTA 2BEUB 3GIWA 2M9MA 3ICEA 1MIHA 4O4LB 4X54A 4RVCA 2CQ1A 1HDCA 3BZUA 1E1QA 1PJBA 4U7HA 1OOEA 1Q15A 1PYOB 1GUYA 3CPWR 3KHLA 2EF1A 1LWEA 1IJFB 3SI7A 1JAXA 1JDTA 3GO4A 4AL4A 3H8SA 2QW0X 3TUPA 4DMMA 4WUVA 2HMYB 5K0GA 2GZAA 2Z83A 3DPIA 4LK3A 3QGIA 4RK0A 1IBSA 2A35A 4J9NA 1VIXA 1DTWA 3D68A 4LC0A 2MOKA 4CR8A 1F1JA 5FLXU 4TTQA 5E3HA 3BGFA 2E4XA 4EUHA 3NUQA 2QJWA 1IUJA 3QBJA 2WBRA 1AHPA 1T2DA 2HHVA 2HWWA 1T1JA 5H4GA 2Z2IA 3EZYA 3GRAA 2WWRA 4IO1A 3E8SA 5EUBA 1HEIA 4BNTA 1SD5A 1U9ZA 3VZCA 4JC5A 5I9TA 3CD5A 5JQWA 3N07A 4MI9A 4FVCA 5BWLA 3IH5A 1ID8A 2N9UA 3OP4A 2VKZG 3JCZA 2GILA 3AZQA 3BIJA 2CNOA 3AM5A 3SV3A 5I9LA 3VR3A 3KR9A 1UWCA 3H90A 4S0ZA 1J5XA 1NLMA 3P4YA 1RLIA 5F98A 1CY1A 3VISA 3LX6A 5I7SA 1YR2A 4ETXA 4BJ6A 3BFPA 2V3WA 4UD2A 1RACB 1EAYC 1JLGA 3ZGOA 1SJFA 4YRKA 3ZFVA 2UVWA 1H5NA 1N54B 4NMXB 4G6ZA 1T4BA 2UZ3A 1WF6A 3GN1A 3FGVA 4B84A 4W1RA 2RG1A 4DFDA 1PS0A 3VYWA 3ZZUA 1TFRA 1NM2A 1SL2A 5DX1A 4RZ2A 4OLBA 3VPGA 4P3NA 3Q1KA 2GLXA 3WB2A 2Q43A 2QTWA 1G21A 2IXFA 3VGJA 1UC5B 2QN3A 4BIIA 1NFRA 3VOBA 1Z2EA 2IPOA 3AEUB 1RAFB 1FQKA 2XCQA 3IMEA 2VDJA 4FHZA 4TT3A 1EEXB 4DREA 2QT1A 2JFFA 4HN9A 1JP7A 1NK6A 5FUXA 2Y1CA 1RQRA 3MWYW 5IVHA 4DV4F 1K6EA 4M6WB 2VQ3A 3MFHA 3JYTA 5E4YA 3TNJA 3AIMA 1SD1A 1XTRA 5E0OA 3O8NA 3EVFA 3KKNA 3PHBE 2DNMA 1SFRA 1XMQJ 2UUCJ 3JQEA 2XB6A 3N0WA 1ULSA 4ZO7A 2QAJA 1MG7A 2VJPA 2XECA 3DPSA 2EFHB 1H2XA 4DCCA 2VB6A 3ZX5A 1F5AA 3GELA 2B1JA 1UQRA 4YGXB 1DHTA 3E82A 3L5OA 4W8HA 3CUYA 3R3YA 1GRQA 4DLBA 2QG4A 1HNZJ 2B34A 3HL4A 2QL7A 3Q8MA 2HCFA 2N7CA 3EBPA 4JI4F 2VBXA 2H1LA 4BTEA 1N8RT 1HT2E 3T5KA 4Y1RA 5JFGA 4AC9A 5AHOA 1N5SA 3FPEA 1YC2A 5DNCA 5JI2E 2IDLA 3WGGA 3N2GB 5JZMA 4G6VB 4YI3A 4BFUA 1ZTWA 5KFHA 4R2LA 2OSQA 3OLAA 2EG9A 3NONA 5CA1F 5C51B 3JU3A 7ABPA 4GKKJ 2HFZA 1TVMA 1G41A 4M5DA 1UKYA 3M4YA 4HDMB 4RFSB 1GL6A 1ES9A 3KP1A 3H2SA 4MVJP 5JZOA 2WPDA 2Q3HA 1EUYA 1AMNA 3H2GA 1B0PA 3UQZA 2WT9A 5TPZD 1C7QA 3VC7A 1VTKA 1RTIB 1HNVB 1YQGA 2W6IA 1S1TA 2IJFA 2LE0A 3UCXA 4CLYA 3NHSA 5BSTA 1BKYA 4LFBF 1NKEA 1Q1KA 4Y6RA 4B3JA 1U1KA 4TY9A 4DADA 2RF2B 3OU7A 3ILHA 2Z2YB 1CQJB 5E41A 3H20A 1TM2A 4NCGB 3DLHA 3GQCA 3J7A1 3EEQA 2XNQA 4ISBA 1RXVA 3O92A 4F86A 4OHRA 3AEKB 3OQPA 3HHDA 5AJ3J 2OA0A 1ULRA 5AO9A 3BWCA 4N47A 2VD3A 1VP9A 4LY0A 4G89A 1G7RA 5EKSA 3LUBA 4C4TA 2HYIC 1N8TA 4IQMA 3BGIA 2OENG 4UFNA 3C14C 4UQLA 2XMCA 3QW4B 4LSWA 4J0QA 2ZRNA 5F3RA 4LJMA 3E35A 5H80A 3NCPA 3LGNA 4IFIA 1DG9A 3KYCB 3C98A 2E3JA 2ZPAA 4PR6A 2RVJA 2YUIA 3UJ8A 2IXBA 5KJEA 1YG0A 1SHTX 2NX2A 3OQVA 3ADPA 1OAOC 1DARA 4TKTA 1S5ZA 1WXQA 3CZRA 3O21A 3E01A 2C2RA 1QHNA 2YVSA 2R7KA 1CB0A 3DDKA 4MUGA 4YAEA 1J2JA 4ZVSB 3ZUGA 1X92A 4Y6GB 2IEZA 3KG4A 1B1CA 4RUBA 3RRYA 3RB8A 1TCCA 2Z0MA 4KTQA 3QELA 4KGVA 1KLNA 1N56A 1YA6A 4TMKA 2M5YA 1Y5LB 4ZALA 1XZEA 2RH9B 1P9OA 3QRRA 1MHPA 3EIHA 4R81A 2XE7A 1NJIT 3M3PA 1Y1RA 4JC4A 1N2SA 2VRCA 3VZHA 4Q6WA 2QSWA 3V9PA 4GGOA 3RPEA 3WGTA 2GETA 1VL0A 2Q99A 1JHYA 1QH1B 2OK7A 1BE6A 5CK4A 2V7PA 3FB1A 5KTOA 3N8DA 4FR2A 2O3SA 2IYAA 3ZQJA 5EXPA 1J6UA 5J4VA 4NZYA 1GUDA 3HT3A 3ME5A 2EFJA 4JMPA 3CG0A 1JG1A 2PNFA 3V4IB 3MJVA 2YVAA 2J67A 2ZRAA 2ZIXB 4P35A 3AVTA 2Q0QA 1TTHA 4JR2A 1X9HA 4USHA 5HF6A 1U1CA 3VYTB 2DT9A 1SL1A 4I3FA 5EMJA 1NG9A 4HT3B 4I64A 1KH2A 3CH6A 2GK7A 3F98A 1TMYA 4EBEA 1NR7A 4TTRA 1T4CA 3N87A 4QBUA 1PG5B 2FR0A 2UUBJ 4PZUA 1UBRS 5ICCA 1BCSA 1DQNA 3G2IA 4AXBA 4GMDA 4BFWA 3VYSB 3ZNNA 1SJ1A 2VPPA 3L1UA 3NY0A 2VTBA 4E03A 1EUZA 2AYMA 4YRFA 2ZJ8A 3M2UB 4II2A 5EWGA 1V96A 4FC7A 3K0FA 4G1VA 2PMKA 3W6ZA 1QVGR 5I3CA 3S81A 1HDIA 1S7CA 4NBTA 4YRPA 2W6OA 2QGZA 3B1FA 2JHCA 4A91A 3TAXA 1YS1X 4QU8A 2A30A 3RYCA 2W7PA 3GYXB 2Y8WA 5AW5A 4PFJA 3EK2A 2WC1A 1GAOA 1UXOA 2CLOB 3AZPA 1XTSA 3CV3A 4U1RA 1RQ2A 4R6WA 2DR2A 2W6JA 5IVPA 1MDFA 1Q0TA 3OQNA 3L0IB 4U2KA 5ECGC 4CLWA 2PBLA 4DDMA 1W0KD 3E1SA 5EMNA 2IRWA 4DC9A 2CLDX 4F91B 3N7TA 3AOCA 3B20A 2G9OA 1ZUWA 2VK4A 2XNCA 4N3NA 4WN3A 5I9SA 3AT1A 5A05A 1CUHA 3LOPA 1RZRD 4LNUA 3DC2A 2MKCA 1Y5IB 5DX8A 1WACA 4PR0A 2PKWA 1CR2A 2FPMA 2QRKA 4S2EA 4F5DA 3PKIA 4R2IA 4HX9A 2HK7A 2FMIA 1YZ3A 1M1ZA 1DIGA 3FBEA 3S40A 5C8XA 5KCZA 4DJ5X 2DNKA 5HM8A 2FGOA 4RO0A 1C2TA 2RBEA 2JI9A 5CVTA 2YWFA 3CF2A 3S7TA 5CDFE 1UPPA 2FDCA 5L1IA 4XX0B 1ZRMA 4W4TA 4Y2JA 2MXYA 4FEAA 4PZ0A 3CD7A 1JR6A 1LBQA 2NAFA 4HH4A 4OX9J 2A3JA 2YFQA 3LP1B 5T7LB 4OGFA 5CAEA 3G9XA 1GTMA 4TLLB 1KY4A 1ZA1A 3M30A 1CUBA 2B25A 1EVYA 4J6EA 1OV6A 2QRQA 3HA3A 3U3OA 2AQHA 1MJNA 2C7VA 3BGOP 2KXHA 3ZNPA 2NZWA 3OMWA 4B8YA 3VH2A 2D41A 2QQ5A 4NZ6A 3L8HA 3FCHA 5KJ1A 1UJ4A 3LO5A 3B70A 3WDOA 1NF2A 5CM2Z 2JAOA 3RVRA 3A4VA 3TLMA 2ZS8A 3CUVA 5BNFA 1NY5A 2W2MA 2NVBA 3CNLA 4ZIRA 1OXUA 1H0KA 2G77B 2LXIA 2W7AA 3ZG6A 1BAPA 4B3TJ 3LP2B 5AI4A 1E9VA 4DR7B 3R75A 3WYBA 1Y42X 4KC0A 4JU8A 4J9LA 5EJ6A 3O5AA 4DQDA 4IOBA 4UM7A 3N28A 3AWDA 3F71A 4XTCS 3DZHA 2YNMD 4NYIR 5IFMA 2A5JA 5I4KA 2AF4C 4ZP1A 5BW8A 3EXIA 2I4OA 1PNRA 4ZCLA 4JT4A 1UXGA 3TKLA 3IP9A 4BHQA 1UFQA 3OLXA 3AYXB 4GX2A 3G87A 3RYFA 4NA2A 1NNUA 3RW7A 4Y2IA 5JDCC 2WRMA 3S5JA 1HDGO 3OPYA 2ZZKA 2F43B 1VLYA 3X1ZA 1FFDA 4HYTA 4KV9A 3LE8A 3PFIA 1EIZA 1CQWA 2OD4A 1XPRA 1Q16A 2NUTB 1ZVKA 1NQ5A 1HF3A 1QJCA 3PNLA 5D3MB 2W2QA 1YHYA 2J6BA 3GFSA 1RGVA 3O26A 1CEQA 4DPYA 4E0DA 3IX7A 1TKBA 1N9GA 3COYA 2RS2A 2E7ZA 3H9CA 2C83A 4KN9S 3PQEA 4W7HA 5KVQA 2R9VA 4X66B 5TQ2A 1Z4JA 2YCBA 1NO8A 2IBTA 3ZDRA 1M10A 1J70A 1AF7A 2PUCA 1Z73A 1NK5A 5J2UB 4R0VA 3HLYA 1IOWA 2CFCA 4XUCA 2O1SA 2ASLA 4XGKA 1C3LA 1SIOA 3UXHA 4AN0A 3SE7A 3TKYA 4CV2A 2DFTA 2O14A 3SHVA 4AQDA 1ZK2A 4U7PB 4BPRA 1CTQA 1VQYA 3A9CA 4DCJB 1VRWA 3PXBA 2GXSA 5KSPA 3L8GA 3HHLB 3KO8A 1U11A 3DD1A 4BX3A 2ZJAA 3IO1A 2H9YA 1JXMA 1TT5B 2JFPA 2LCWA 2UXDB 1KEWA 1V1RA 2Q46A 3PFKA 2OFFA 2PGXA 1H42A 4OQNA 2DZDA 3HA5A 1OH8A 2PKRA 1U0LA 4GWGA 4UVDA 2XLIA 3TAPA 1OT3A 4A47A 5HRCA 3QPDA 3LCUA 1PO6A 1VQ4S 4MARA 1NXIA 2EI5A 1C14A 2BN4A 2FMKA 2J9GA 1N77A 3DKPA 1IBKB 3UJDA 4ZVUA 3K0AA 3DHNA 4UTOA 3GRFA 4V38A 2LCIA 4E6EA 1U8TA 4RPIA 1QQ5A 2AN9A 2XSZD 1YBTA 2JIZD 3RBVA 1UWVA 4RPKA 4KFRA 1BO6A 2ZTSA 2ZVIA 2W5UA 1DUIA 2CPEA 1IVSA 4CKEA 3QUTA 1QE1B 4BWJA 5GWXA 1IIBA 1COWA 3ODGA 3OL9A 3V5NA 2EIHA 2GCOA 1W5EA 4ACAA 4BVHA 4H35A 3T8YA 1KIMA 1IIRA 4ENQA 4BP3A 2FZKB 2EWMA 3CONA 1CXZA 4FEYA 2V50A 2C3OA 4FYXB 1GY8A 1WTFA 3PFBA 2ZBFA 3O73A 1RRFA 5JCPA 5KVSA 2V8HA 4NZPA 1F14A 3NEPX 4FXVA 4LVNP 4IF6A 3PE4A 1M6VA 3QI7A 1N5DA 3WBZA 2VT2A 1W4ZA 3QRQA 5T14A 1N48A 2QUHA 3ZS8A 3SX2A 1Q7GA 3KYIB 2XMUA 4Y7CA 1K86A 4BE7B 4Z3KA 4YN3A 3NBYC 1NQOA 3OWHA 4CLUA 1KFSA 2BVZA 3WMEA 3ZCPA 4ZJQA 1LWEB 4IZHA 2CYCA 4JLMA 2BZGA 4HZGA 2PGJA 2J9XB 1OI4A 2EU8A 4ABYA 1H3EA 3HD1A 1NJ5A 2CXEA 3MQFA 3OT5A 2VJUA 5M2RA 1MV8A 4P7BA 2O67A 4LZAA 1LK0A 1DTWB 4L95C 1IDOA 2LEAA 2F7VA 3EJWA 2VHCA 3ZKWA 1WHTB 2ACEA 3F6YA 4Q4HA 3BJZA 3VO1A 2PLNA 1TMJA 1P0MA 3OX1A 4FP9A 4EDFA 1ZM4A 3IE1A 2PWAA 2E21A 1GUAA 3FCXA 3ILSA 4CP5A 1CJSA 1WZEA 4JNKA 1ZUNA 5BN1A 5IAGA 4J1QA 1QPBA 3PQCA 1VISA 5CNMA 1D1SA 3QU7A 3P20A 4HAWA 2C2OA 5EFOA 3OFKA 4TQGA 3R2DJ 2AR7A 3FETA 3D8SA 3KTAA 3ND9A 5F52A 1NULA 5BR4A 2CPZA 5CH3A 4B7AA 2HQSA 5E1BA 4ESVA 3N8NA 1C1DB 4LF4B 3NWGA 2JCVA 2CHFA 1SC1A 5AJWA 2WZCA 4PS0A 3KL4A 4JY7A 1K9MT 1DB3A 2XBLA 1OH5A 1T2EA 5K3FB 4B3SJ 3WMRA 5ED4A 4QQBA 2OHIA 2NPIA 1YVRA 1FJEB 3OSZA 2OCGA 4D81A 4LYAA 3KC2A 4WXYB 2CDNA 3CPSA 4G8BA 4OYWA 3PXAA 2CNLA 2PWYA 5G1OA 1CS4A 2XWBF 1RXYA 1BC5A 4ARUA 3OSNA 4WK4B 1D9FA 1MJHA 5C5DA 2X42A 3EXFA 3SEAA 2WSIA 4YCBA 2QI9C 2R751 2FR8A 2KM8C 3MHYA 2F17A 3MM6A 3DHWC 4KX3A 4PTYA 2N3OA 3ELBA 5ECDA 2JA2A 4F4ZA 1VKHA 1TP7A 3WYGA 1F60B 1VL2A 2DBVO 5HANA 3L7LA 3UMCA 5LYJF 4ED8A 4PC1A 3CR8A 2ZHBA 1Q1BA 2JK0A 5EWJB 1G1MA 5BQ3A 4OXNA 2ACWA 1WI6A 5FEMA 2ZRDA 3I5MA 1YR1A 3A3NB 3NNSA 5THWA 1MAWA 4IIJF 3DRRA 2XQJA 2CQDA 2P79A 4I8IA 1KARA 2FLNA 1TIPA 5BOVA 4ECSA 4KMMA 3RIMA 1FP6A 3EUNA 4DEXA 1ZSVA 1Z5WA 2GK6A 5U47A 2G8LA 1HNWJ 3DQPA 3NGSA 4P9SA 4PWWA 3HKCA 2ZC4A 3G2QA 1JJVA 2OQRA 3EMVA 2OZKA 2ZP1A 1YTUA 3CYFA 2JIDA 2C58A 1FIUA 1NAQA 1Q4RA 2E1PA 3A9RA 3UB2A 3QBCA 1B8OA 2NACA 4HYYA 1E3IA 4EK2A 5FA5A 5FIIA 5LPNA 1E7MA 4JI5B 3ZGNA 5ECWA 4JV5B 3BMQA 2DSNA 1W35A 3VPHA 1TK8A 4PBRA 4B0OA 5ALOA 4KZKA 4D4KA 3J7TA 3X3HA 5HJXA 1JV2B 4E07A 4OH1A 3DVQX 4XIUA 5JIBA 3A1EA 4JI2F 4GVLA 3GK3A 4TQRA 2DRDA 1U6FA 4KY3A 5KX5F 5TDHA 5I9MA 2MKSA 3W9HA 3OJCA 4G0QA 1N1EA 3IEPA 3TF5A 2NZVG 1S1TB 1F3LA 1JNXX 2Q6LA 2G0CA 3HCWA 4HLDA 4TOIA 3ZHCA 4AKHA 2R2SA 2EPIA 5CU7A 3ZU2A 3RG6A 1UCNA 3FG9A 1MQ9A 2LDYA 4NPOA 2HN9A 4BQNA 2JGFA 4JI1F 3CO0P 5K0EA 4V0KA 2V55B 4JIGA 1VG8A 3QQ5A 2GZHA 2VBYA 3DC7A 2F00A 3R8XA 1MO5A 4V0SA 4OHUA 3TVTA 3JD3A 1N0IA 2HMUA 3KM0A 1QHYA 4XIYA 3QHQA 4TS4A 3M1IA 5CJ2A 4DGSA 2P4EA 5EERA 1ZH5A 2VQEJ 2RHOA 5I7AA 4WCFA 2VT7A 5AHWA 3NUGA 3A1YG 5K0ZA 4MKYA 1AB8A 2FPSA 1DNPA 2YH2A 4YJHA 3T19A 4FGUA 3G9CA 2Z2ZA 3IVRA 4DB4A 2ZKLA 4YP1A 4L9WA 5KBYA 1LBHA 4HVAA 1UMBA 2J6CA 4NLDA 4MWGA 1VSQA 1Y7HA 4ZO9A 2O0JA 4YTEA 3OQBA 2GQ2A 3AOGA 1L6RA 5ILGA 2NO0A 2QTTA 1KYQA 3JD1A 1PG0A 1A9ZA 1FW6A 4IJVA 4O2BA 4KGVB 2H3EA 3IQZA 3B7WA 1NEEA 1EYZA 2WONA 4RFLA 4DGQA 3L46A 2HNBA 4IUCS 4OHXA 3ROZA 5JRDS 1K73T 1F2HA 1UP6A 2EFNA 1DL5A 3QZUA 4P73A 1XZPA 3QXXA 4R51A 2D2VA 2L82A 1VC0A 1FYVA 2PBRA 3L7DA 4CGYA 4QQFA 3RTGA 3H0PA 2Z4PA 1GLVA 3U02A 1JJBA 5IFLA 1MUUA 5JJIA 3I82A 1D2AA 3W8GA 1L3IA 4NPAA 3UV6A 2EAUA 4DXAA 2OP1A 1SKBA 1YVPA 1XTTA 1F3VA 4QYMA 2VSQA 2PIIA 4Q3AA 3D1QA 3NTOA 1RT3A 3OFGA 4E22A 3H1GA 5CA0A 2RGEA 3B2QA 4GPZA 1TTHB 2IKQA 1E6WA 1FDOA 1UFVA 1NHUA 4NXNJ 2BDUA 2R7LA 1E1RD 1RD4A 5L4NA 3CB4A 4BOYA 3ORQA 3PCXA 5CCMA 4RVNA 4K26A 3KUUA 1XLVA 2VHXA 2XZOA 5M2PA 2P9ZA 3NDPA 1U63A 5L3VA 1BCSB 4WFIA 1ZGCA 4RVSA 4BKRA 4C21A 4DILA 2CHUA 1II8A 5D77A 1EQMA 4OXIA 3EEYA 1OVGA 3I9KA 4Q05A 2F1JA 3W8PA 3ZVLA 2ROPA 4WDRA 2F2TA 4QUKA 2CVQA 3K0FB 1AGXA 5KWEA 3BUSA 1GSAA 1YFZA 4MVJE 3TAQA 4CT4B 1ICEA 5C7YA 2RGUA 3OTEA 1KMCA 4NY1A 1W4BA 1IHPA 1XA3A 4AO7A 3JWGA 3ZE1B 1PC4A 2I3DA 3PU6A 4IEIA 2RRNA 2FH5B 1YS7A 2CV1A 1HR0J 2GFQA 4D9IA 3LBIA 1OLXA 3ZGZA 3IV9A 1YIOA 2GHIA 2X8JA 1UVJA 2OPHA 4F1WA 4RJLA 3BRSA 5ALQA 3PFEA 5BYRA 5FUQA 1BOOA 4LA4A 4DV6J 4BVLA 3H97A 3KOYA 1D6SA 5K6RA 1SM4A 2HWYA 5TGTA 4W9RA 2OZLA 2VFRA 3GGCA 3W1YC 5LDDC 1NRIA 3N39C 3K9LA 1MC5A 3AT1B 1U1PA 1UJCA 4LNUB 1FJGF 1OWLA 4PPYA 2W9BA 2IMOA 5D3QA 4D9EA 3KB6A 4H0CA 1TZKA 4DPTA 4YHHB 3A1VA 1HH4A 5F7JA 4BO6A 1KYYA 1JYSA 4KW7A 3HCRA 2XD9A 4KRWA 4O4HF 1MROB 3LJKA 5K0BA 3ZV5A 2AYBA 1P7CA 5DRKA 1HQ2A 2P4HX 3KOAA 1VDZA 3EG9B 2W2LD 1Z33A 4Q1CA 4EG5A 1E2LA 1U2ZA 4JB2A 2AFVA 2C7GA 4IUBS 4IR7A 3WIBA 1GLNA 2HA2A 4WXRA 4G41A 1G8SA 4CPDA 3F7TA 5AVYA 4EY3A 4AZ0B 5HRUA 4UU1A 5E8JA 5CAEB 3WYEA 4ILMA 4E12A 1ZMOA 4HFMA 3M30B 1R6XA 4JJAA 3SKYA 4BZWA 1F6WA 3C1AA 3DKDA 1ULBA 3O9ZA 3KEQA 1BH2A 2VP9A 4A6PA 5DI3A 1QE0A 2WJZB 5FULA 1ZN2A 4DCGA 3B60A 3DZ8A 1VPEA 1JEEA 3PW5A 1Y0HA 1EM6A 1FDRA 4RIEA 5EWMA 3EMDA 1D1PA 1OFGA 1WPGA 3AYZB 4GGMX 2JJ1A 4I6GA 1Y11A 1I32A 1X1SA 3U4QA 3MAJA 2VYND 2JFUA 4QG7A 5A9SA 1M0EA 5LZ9A 3LQYA 1VLZA 4LY6A 1SV5A 4N5HX 4DIFA 4PIVA 1HBOB 2CJXA 3E8MA 1GCIA 4JCCA 3RC8A 1VHDA 1L8AA 4UXIA 1B0VA 5IBRA 1IY9A 3TBFA 1ZN7A 1EP9A 1ZU4A 5T57A 3MWDA 1RWPB 2GTIA 1M0TA 5JXWA 1PYSB 5CYMA 4UJ5A 3TZ6A 2O2HA 1PCXA 4DJTA 3EXIB 1T0HB 4NJMA 2PO4A 1PI3A 1BIFA 1D0SA 1IR2A 3RYFB 2QBYB 4EB0A 1EGQA 4XH9B 1A4XA 4IGKA 3FFBA 1M90T 1EM8B 4TUYB 4EW6A 3HRIA 1Z37A 3OPYB 1UZDA 3BWYA 3UB3A 4PLGA 4M1TA 5TB5A 1VXRA 3G6XA 1Q16B 4D4GA 1AQNA 3TSAA 4XSGA 3L6BA 3CO9A 1Z5ZA 3QPBA 1YNSA 4FFSA 5F0WA 5J23A 4EKEA 4WZBA 1MU2A 2CF5A 1E2MA 3ET5A 4UPEA 1PR5A 2BGWA 1U0GA 4OI3A 1A2KC 1G6Q1 2I2XB 3MMNA 1YBAA 1TKXB 1TPZA 3V5RA 1KTVA 4RXTA 5AK4A 4QXMA 2W2VA 1E5VA 2WU0A 1QCCA 4YO8A 3RFUA 1PFYA 4TQUS 2QSJA 4CKCB 4PXSA 3NTRA 1FRJA 1T05A 1N6QA 1VBXA 4IQ0A 3MMAA 2HLTA 4DR1F 3I01M 5AKEA 3RW6A 3A8EA 3SYMA 1R16A 2JZOA 3WQQA 5J2NB 4UEOA 4HRYA 1KI8A 4C9DA 4DA0A 4RTNA 5CCXA 3I9NA 4CM3A 3IODA 3ER9A 3WLAA 2BFDB 5FV4A 4JB8A 2FJVA 1EXDA 2Q2NA 2ZTUA 4YRCA 1SOAA 4KH0A 1GKIA 2IL1A 2QMYA 2JJMA 1N32J 2J33A 2VPQA 3PYLA 2ZBQA 1V1RB 1ZEJA 1JMKC 4IDEA 4LBZA 3P5TL 3TCXB 1TUIA 4IDNA 4RETA 3K9QO 1ACJA 2C1EA 3O7MA 4CIYA 5AJUA 1HQUA 5K1ZA 3RYTC 4X5OA 4AKSA 3BQ9A 1FESA 2YJTD 3DZGA 3K0AB 4EELA 2HU2A 1P5ZB 1RLUA 2DERA 1AS2A 2IYRA 5FTMA 2R11A 2Y4OA 4JXXA 4IDBA 3TTXA 3CGIA 1HBNA 1FDIA 3PQ6A 4TV8A 5BT8A 5E6UA 1DJPA 2OLEA 4QIHA 3TGPA 1QAXA 4Q0BB 1XEFA 1JNYA 2UYCA 2B1QA 3DDNA 3FUTA 1W9MA 1E60A 4HLCA 3L8ZA 4BNYA 1TJ5A 3PO4A 4DYVA 4Y9SA 3RRBA 5AQ1A 1JDJA 3DKRA 2YNGB 4QYRA 3EE6A 2XY5A 3IBFA 2C31A 3IPCA 5C25B 1WKLA 3WV5A 3E48A 2E2WA 3A7EA 3PVCA 3FAKA 1YACA 2H18A 4IICA 1ZNZA 4V19J 1O0CA 3PX6A 1VHJA 4LSLA 4HPWA 4LJ9A 1TEZA 1H4TA 3HSKA 2H8GA 4UHFA 3ZWDA 1KEPA 3DCJA 2B4KA 3QUQA 3A1SA 1YJ9S 1V3VA 1MVOA 2EGGA 2DSTA 4F2PA 3R8FA 5B6IA 2WZDA 1I4EB 3UZUA 5CEJA 2A9RA 4RGQA 4N5NA 1JQJC 5F9FA 4O3OA 1X3LA 5KNCD 3RVPA 3K4QA 2J0SA 3HCFA 2G9VA 3ZKWB 3PIPQ 4Q4HB 2BGUA 4YBZA 1USWA 3H87A 1TJNA 3IUJA 3QEAZ 4K0KJ 3SS9X 1DCMA 3T7AA 2O7SA 1JLFB 4LGCA 1ZVJA 3TMYA 3EQ7A 4TQAA 4N8DA 2PT6A 3D9QX 1WC5A 2YZMA 4AZSA 1JE1A 3RK1A 2OHDA 2C2OB 3IO5A 5G3ZA 1SUCA 1SXGA 3VKWA 1X7WB 4P34A 3KTAB 1XWFA 2UVQA 3V3KA 1S1WB 5DXFA 2VDKB 2A0XA 4DBVO 2C84A 1R0CA 2GFHA 5A4KA 1VZ2A 2NXCA 3CLSC 3M1YA 1UDWA 3WKCA 5JCXA 4K03A 5B4UA 2HM7A 4TZTA 1XL0A 2APOA 1MEOA 1O8CA 1BE4A 1UTAA 4ZDWA 2OEMA 3LVQE 4IZIA 3U81A 3GFRA 4AD6A 5LKRA 2AJCA 4F6RA 3W5UA 5LP6B 5ARDA 1VYVA 3CRVA 4PABA 2QX0A 3EXHC 3P5BA 4OTZA 3D02A 4COKA 2CNLB 4RZIA 2DY1A 2HRDA 4UBKA 1CS4B 1XYGA 4IUDS 2F7SA 4P75A 1WF1A 4ICIA 3UEOA 2WKSA 4TQ9A 4K4UA 3EXFB 1Y3FE 5F8GA 4LXIA 3HEBA 5MGBA 4Y2XA 4LQLA 2IYSA 1Z4OA 4JYPA 1KGSA 4ZTZB 4NMLA<