1XTZA

Crystal structure of the s. cerevisiae d-ribose-5-phosphate isomerase: comparison with the archeal and bacterial enzymes
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
246
structure length
246
Chain Sequence
EDAKRAAAYRAVDENLKFDDHKIIGIGSGSTVVYVAERIGQYLHDPKFYEVASKFICIPTGFQSRNLILDNKLQLGSIEQYPRIDIAFDGADEVDENLQLIKGGGACLFQEKLVSTSAKTFIVVADSRKKSPKHLGKNWRQGVPIEIVPSSYVRVKNDLLEQLHAEKVDIRQGGSAKAGPVVTDNNNFIIDADFGEISDPRKLHREIKLLVGVVETGLFIDNASKAYFGNSDGSVEVTEKHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-5-phosphate isomerase
publication title Crystal structure of the S. cerevisiae D-ribose-5-phosphate isomerase: comparison with the archaeal and bacterial enzymes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 77
structure length 246
sequence length 246
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2004-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xtzA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xtzA01
2F1FA 4OQQA 3CSSA 3DHXA 3ENVA 2R5FA 3DC2A 5JJBA 4OQPA 2MDAA 3BXHA 3OFEA 2F8MA 1HORA 3KWMA 3MAHA 4M8LA 2H9ZA 3TUZC 2RI1A 2ZHOA 2OKGA 1SC6A 1LK7A 1DEAA 1U8SA 3OFHA 1YBAA 3MWBA 2DT9A 3TX2A 2RE1A 1PBTA 3K5PA 1RWUA 2JOQA 4TM7A 3OFFA 4GMKA 1FQOA 1Y89A 3HN6A 2P9GA 3S1TA 5IS2A 3IBWA 4IO1A 3LOUA 1O8BA 4L50A 1PSDA 3E7FA 3DHWC 4LUBA 4GO5X 1NE7A 3KV1A 1FS6A 1JT9A 2QMWA 3O1LA 1VL1A 2PA3A 5FIIA 2FGCA 1Y7PA 2J0EA 2DTJA 2O0MA 2CDQA 1LK5A 2QRRA 3DDNA 1LKZA 3LUYA 3OBIA 1UJ4A 1FS5A 1YGYA 4TM8A 2KO1A 3CH7A 3ENQA 3TUJC 3NWPA 1XTZA 3UW1A 4R7TA 2JHEA 3U7JA 3CEDA 4PWUA 4X84A 2BKXA 4L4YA 4NMLA 1ZPVA 3ENWA 3AB4B 2RI0A 2J0XA 3E15A 2LQJA 3TUIC 4R9NA 1FRZA 4GO7X 2P9EA 3P96A 5HJ5A 3IXQA 2QMXA 3AB2B 4GO1A 3N0VA 1CD5A 2NYIA 2PC6A 3OFGA 3EB9A 2WU1A 1UJ6A 5T41A 5IT0A 2QSWA 3MTJA 2I9SA 2RQKA 2GNPA 1KS2A 3L7OA 4L5JA 4L4ZA 3BXFA 1HOTA 3AAWB 3OC6A 1UJ5A 3NRBA 2P9CA 3LHIA 3BXEA 3EFBA 4L51A 2RQMA 2J0WA 1M0SA 2BKVA 3LWDA 3ICOA 3BXGA 5IT4A 3NZEA 3HHEA 3W7BA 2LVWA 1FSFA 2W48A 4L5IA
chains in the Genus database with same CATH superfamily
1JDBB 1VFPA 4IHJA 4B6PA 4GKKB 1QO0D 2Y1OA 4LT6A 2HA0A 4Q9AA 3M8RA 4Q15A 1K4YA 1VBYA 1DQPA 2JFUA 5CYMB 1X8DA 2BGWA 1A9ZA 1T8WA 3GAZA 1FXSA 4Q93A 4DV4B 5FA8A 2R7OA 2F43B 3NWRA 1X14A 1IKWB 2E4XA 2X4DA 3J80Y 2Z9CA 4R7ZA 3WA6A 3U5TA 2YMMA 2BLNA 5HOEA 3LZ6A 3NS7A 2PRIA 4EWTA 3PUYA 1O87A 3OQOA 3DV9A 4IIJF 4N9QA 1KYQA 4DV2J 3TOQA 2GNOA 2IAJB 4DSEA 1K44A 4E5VA 3JQ7B 2DHRA 2XZWA 4MTPA 4RA6B 4RSGA 2QSFA 4MPJA 2EP5A 1KXZA 5HQ3B 4GI2A 3DVQX 3UR3C 3VAHA 1JLKA 4PICA 5F77A 1VCNA 3G6VA 1V4VA 3DMRA 2HW8A 3L8DA 3T7RA 2GYYA 3RF7A 3M7IA 4FDUA 1L7OA 2IYQA 4S04A 1LW7A 4P3PA 2I0FA 1W5EA 4RY9A 2HSEB 1Z74A 3AH8A 3LU1A 4KGVA 4HHUA 1WMBA 5G0UA 1OBOA 4R0VA 1XDZA 2LP4A 2QROA 5F2EA 1IEXA 5T64A 4BNYA 2XSFA 5K3BA 2OV8A 4V3BA 4ND7A 3WFJA 1TM4E 4Y6IA 3VNAA 2L42A 4J9KA 3MPWA 4YOEA 2MINB 2H0AA 4JI8J 1GKUB 1U7HA 3FPJA 4MMYB 3K2YA 3QH4A 2ZS7A 2BYCA 2BPOA 1UWCA 2BM1A 5T4EA 2FHSA 2OCXA 4CG0A 2Y1CA 2BZ2A 2C2ZB 2CUTA 4QICA 2Y1LB 3SYTA 2D74B 1M5OC 3E8SA 1AMNA 4DBLE 2XMZA 4U4AA 3ZBPA 3N59A 1OHHA 2CE2X 1FMTA 3ACDA 3QV2A 1CY2A 3SBMA 2DNGA 1LWXA 5IJAA 3DYAA 3DYIA 1Z88A 5ETOA 2JKZA 2HRDA 1EX7A 2EC0A 5GVQA 1LLCA 2NTYC 2I5PO 5K4GA 5KOWA 2VZ8A 3HFSA 1XMOF 4ZRMA 1I2DA 3UMRA 3PTAA 2ZBCA 4BO6A 1GEHA 2WZ1A 3FRIA 1P19A 4PWYA 4I9HA 4RD1A 4I5GA 2FGJA 1QIDA 2WM3A 1G6OA 4A3SA 2O8FB 4ZQBA 1U7UA 2C4VA 1Q1KA 4ZJLA 3IM8A 2GS9A 2HIMA 1RXIA 3VPCA 1HYSA 2QTZA 3GB9A 1PUJA 3Q98A 5AE3A 4F3YA 1P1CA 4P3YA 2N46A 3E22A 1QAMA 2QL5A 2WSMA 1JALA 1Z7BA 2X3FA 1Y1QA 1C8KA 4LJRA 4GOLD 1F5NA 4BMZA 1SJ1A 2YX7A 2WWRA 1PS8A 4HZGA 2VNAA 4MK4A 1H1DA 3U61B 5KTKA 4PZVA 3IJPA 1QDUA 1QFXA 1XZ8A 2RQKA 3D8RA 3NNDA 3RHSA 5FADA 1Y1RA 1KBRA 3A6HA 1VBFA 1VBNA 1GGJA 3V9AA 1JKJB 5IF3A 2JI8A 2CLSA 1U49A 4RJLA 3AEKA 3ZOZA 2JEJA 4KKXB 2QLWA 3W7BA 4HDKB 4CF7A 3KSMA 3ISNC 1Z13A 1RWKB 3H1TA 4R9SA 4WBFA 4R31A 2OVFA 4LRAA 5DYTA 3AU9A 1NBEA 4X00A 5KO2A 4BB5A 3DM2B 3GN2A 2C5AA 2I3ZA 2HO4A 2PSEA 5CX4A 3BMXA 1B70B 3ZDRA 2E5HA 3LLMA 1OSNA 3QE0A 4OQMA 4CO4A 2KXFA 1WC6A 2P2NA 4XDGA 1R3NA 1C30B 4CWAA 3D28A 1JEAA 4M0KA 1XC7A 3I2JA 3LHSA 4ZDKA 4ITRC 4BFCA 1CZRA 3CVUA 5EE5B 2FHJD 3OZIA 4OHYA 5TDHA 1Z0SA 1O0SA 2X4IA 1TZKA 5KG3A 5DYNA 3FWYA 3GT7A 5KQMA 1U2PA 1RWPA 2RI0A 3FVQA 2I8LA 2R4FA 2WUVA 3A4YA 3ACBA 1XCJA 4KG7A 4KQKA 4ND4A 2CNNB 2KS6A 4Y7CA 3I5UA 5TQ2A 4HQ6A 3P32A 1EGVB 2J5AA 3JTMA 1ZPDA 1DAFA 4Y0AA 1NWHA 3AONB 3EGCA 2I6QA 2ORIA 3NGXA 2R65A 2YH2A 2D9OA 3DEIA 4BV8A 1V9CA 4RJ2A 1KEVA 3RW6A 3FNRA 4L4UA 4H4KA 5FBWB 3FPEA 3OU7A 3GWCA 3D7LA 2XKAA 4WCVA 1YUNA 3MFYA 4FYKA 2QBYA 4MW1A 2R6GA 1AHIA 5I7VA 3Q11A 1YTUA 2EW2A 4NK4A 1WO8A 4LBPA 3JQCA 2COUA 4COKA 2ES4A 3DOKA 3GUVA 4CETA 2QSZA 3BIOA 3W2IA 1BY9A 5DCYA 5T7LB 5HE9A 1HBMA 5AVSA 3ROEA 3LP2A 2VUSA 1Y3KA 2FN3A 1QHGA 1RADA 2IUTA 4GDMA 2GD6A 1WB4A 1XMOB 4B6RA 2BFCA 4B6JA 2BCEA 1ZG3A 5KG1A 1CJKA 2GVDC 1V6CA 3LC2O 2F1RA 1JQBA 3S70A 1YA6A 2KLBA 4CKCA 1XTSA 4O59O 5D84A 5PGMA 2GB4A 1GZVA 1X1SA 1W26A 1GGMA 1NBIA 3A4VA 1T8RA 2D06A 4DCPA 2A67A 5G53C 2O54A 3KQOA 2O5EA 3M1VB 1RBAA 1T9XA 3GFVA 1ZCJA 4ZPVR 4FMDB 1ZWLA 4UEWA 3UZUA 1SCAA 1RYBA 2V7UA 3ESZA 1Q7YT 3T5AA 1U8EA 4MCAA 4Z9BA 4P80A 3PYLA 1UKEA 2WVCA 3T1VA 1PIWA 1H4TA 1PZNA 5JIBA 2VL1A 3RW7A 2AEFA 3L8ZA 4ALZA 4IRUB 1WSAA 4R8SA 3CVOA 3BSCA 3CHYA 1U04A 1EFLA 2FVQA 2B2CA 1WHWA 1XQYA 1AKNA 1FDBA 3ZVLA 3PXDA 2ZJ7A 3EJWA 3M9WA 3LANA 2ZUWA 3W3ZB 1NMZA 5F9NA 4FFOA 4BNZA 5A0VA 2JW5A 4MDHA 3MURP 4X92A 3HLKA 1H2ZA 4QWWA 3L05A 4IVQA 4FYIA 1DQSA 4GG1A 3QFTA 4IKEA 1XALA 5C1DA 1TUWA 4KIGA 3MI7X 2OAUA 1OQAA 5LXTF 1JLBA 4CEIB 1JG6A 3AHGA 3GFFA 3TRGA 4MUEA 4WY8A 4UHCA 4LCJA 4ZQGA 5CW2A 4B83A 4CNYA 1FJHA 4IJ6A 1RVV1 3A37A 3JQ9C 1L8QA 3SDZA 4LS3A 3KB8A 4BO9A 2C92A 2V4JA 3RYIA 1Q44A 2YV1A 4C9BA 1S72S 2GRUA 2OCKA 3VX4A 4Z4HA 5EYPA 1OYDA 2J76E 3HHEA 5TMDA 1USVA 4FSHA 1ITZA 4C3VA 9MHTA 1BX0A 8ATCB 3KLGA 3FOEC 3D8UA 4P7FA 2FSIA 4ALLA 1KZYC 2XZDB 2Z6UA 3DMDA 2O6HA 1JS1X 2A6MA 3GCWA 2P4SA 3OL6A 2ZIAA 3AI1A 4UAGA 1BFKA 4C76A 1RQNA 5E4FA 1OH7A 1WKVA 2YNIA 4ZKEA 2WONB 3PEJA 1TYZA 2JB9A 5HQJA 1DWOA 1ZVQA 2EDCA 4EBBA 4DWWA 2JAXA 1XO1A 2I0XA 2VT3A 3UCUP 1GARA 2IHZA 3RE1A 1TCUA 1DZ3A 4ALMA 1MOZA 3WLKX 5BYSA 1FA9A 4F0HA 4EY3A 3SVLA 4TTSA 4Y0VA 1VJTA 3E9QA 1SQ5A 2VP4A 4C43A 1U8FO 3J81Y 4B0OA 3LBAA 4X1YB 4RKWA 1VGQA 4IDCA 1OHHD 2EKNA 1N34F 3PNSA 2UXBJ 1SG9A 5KWIA 3KEQA 2M3DA 2PMEA 2DJWA 5EJFA 5I7UA 4BNFA 3L43A 2PE5A 3HKEA 1EVEA 4PABA 4P75A 2WK4A 1V71A 3GZNA 5L1JA 1FRXA 3SLKA 5DPMA 4HUQA 4ACAA 2GQ2A 2QRNA 4I99A 4R8MA 1NSKL 4M8LA 3BL6A 1XEWY 5IJZA 5IV3A 1B64A 4D6YA 1GFSA 2F9JA 3K9WA 4I56A 2Q1WA 3ZHUA 3TINA 2AIRB 1FVQA 1I6WA 5T6MA 1UEKA 1L8XA 3M4NA 1HYEA 3AHEA 4BECA 2ZSFA 2AE1A 4F04B 5CLHA 1V7ZA 4HWKA 3SYNA 5E9JA 1HDZA 1VIMA 4OREX 1R00A 1ZW1A 3MD1A 1OGYA 4JELA 4R1PA 3TTVA 4GKBA 2Q6OA 2CLMB 4JGIA 4YV2A 1S4EA 1RJ9A 4UNRA 4YECA 3OEWA 4RV9A 4A0RA 1CUUA 1H0KA 1DC5A 5K8LA 2Q5QA 1Q16B 4WY2A 4LRWA 3CT6A 2D1CA 2Q5CA 4BXOB 1BD3A 4UY8T 3CUKA 3P9RA 3M6UA 1T8YA 2FEPA 5TQ0A 5J1SB 1ZD9A 5EUBA 4F5YA 1Y3IA 1LSSA 1NI3A 5B64A 1ZICA 3QMQA 1V48A 5D86A 4XVHA 4F4DA 1Y7IA 3HUUA 4F9GA 5F23A 3AEUB 3TLZA 4C48A 4ITVA 3QU7A 4QFDA 4LSNA 3WFZA 3SOZA 3DULA 2F8EX 4ID9A 3LX8A 4DEYA 2WFMA 2H9IA 3HR4A 5A1TA 2M6KA 3PVZA 3DLKB 1HFJA 2GVDA 1XQVA 1DQAA 1PS0A 3IBCB 4KXFB 5LMUJ 3CRVA 2PYIA 4P8RA 3PVSA 4OYBA 3D54A 5AP9A 2C97A 4U00A 2VA2A 4JI2B 1I5RA 2OTJS 2C96A 1LNZA 1Q19A 4WOJA 2E29A 1T4BA 5C80A 3E61A 4IEFB 4K03A 3NWEA 2QM8A 2M7SA 2IRWA 1SUDA 1C41A 2R1ZA 3AFOA 4K6MA 4EG6A 1CRLA 1X94A 4FEAA 5P8WA 1LK7A 5DYGA 4XOIA 3OI7A 4ES3A 2QLJA 1RWMB 1JRLA 1JLGA 1E9VA 1MN9A 2JD1A 3HN7A 1N34B 1RABB 3C3XA 4ED8A 4B1FA 1UZUA 2BBSA 2X0KA 1UVJA 4XVRA 4G6VB 1YVFA 1GCAA 4V19X 1NOKA 4X71A 2I2XB 3AWDA 2XYPB 5BSRA 2EFQA 1Y6JA 3IP9A 4L3WA 1GNSA 3M8PB 4MS3A 3PRDA 1CR6A 3ZEAA 4G36A 1ZTTA 3W9SA 1V9SA 1IY1A 1GGHA 3BDEA 3CURA 4PO8A 2V7PA 4QNNA 3TSYA 3CF0A 3UOGA 2E66A 4EQ6B 4J9PA 2XGOA 4L9AA 2JCXA 3EDYA 2I1LA 1A7JA 2BFDB 3ET4A 2ZU6A 3A2NA 4B73A 2R84A 2A0FA 3CH5A 4QPTA 2YJ6A 4US1R 4I0WB 3HCXA 4IVNA 3KRTA 1SQ0A 3ZK9A 1N56A 2Q6BA 2H7VA 2XS5A 2BX6A 1ABFA 3HMKA 1JI0A 3I4HX 2C98A 2JANA 2P11A 3O84A 1Q0NA 4Y2PA 3AEZA 1UFQA 1MWYA 1VIOA 2BEUB 4IIJA 1EIWA 2HMVA 2BGNA 5CGZA 7GPBA 3FNIA 2UUBB 4LXHA 2R1TA 4UNIA 2AG5A 3BQNB 3P5SA 1NRIA 2GJ2A 2B5VA 1U1CA 3P6YC 4X1IA 5CEFA 3U7JA 1EDZA 4FE3A 1KS9A 3LKBA 1S10A 3LL7A 3W79A 2XDQA 1ESZA 3USES 2OESA 4UHKA 2QG9A 1F4LA 3M5CA 3D64A 1XEWX 4I69A 3C85A 2OIHA 5JMTA 5FPTA 2CPJA 1VP9A 3HZGA 3L7JA 3OZEA 1ZRMA 1ZA2A 2CNLA 3R5SA 4NVRA 3DL2A 3RNOA 3M3HA 4CO3A 3QY0A 4ELVA 4LOIA 5FKJA 4DDTA 5E33A 4Z49A 2W98A 4RD2A 3CZCA 3TUZC 1LJUA 2C5LA 4QDOA 13PKA 2NXUA 3JWPA 4UVEA 5I7WA 1BQNB 1IOWA 1HLGA 7ADHA 1FLNA 4TLMB 2YC4C 2Q6CA 4J9LA 4WLUA 2VNSA 1YJCA 3N39C 1TCBA 1T36A 2Y1XA 2ZTVA 1NMEB 2DNZA 2HXSA 4WW0A 2RG7A 1DRWA 6FDRA 4UTOA 4EHFA 1RT9A 5L3SB 1RPTA 4X65B 4QPXA 2EG2A 1DIGA 3IAHA 1T2EA 4B40A 2QORA 4ZZ3A 4YRZA 3NHBA 1NF3A 1NNEA 3G8CA 3CH6A 1F6WA 1AKYA 1PUIA 2FLLA 3E84A 4MLCA 3NTVA 3ZD9A 1GQSA 3H9EO 1CPYA 3MD0A 4ENPA 5L46A 3O9MA 4OMUA 4K26A 3RZAA 1GXUA 2G5CA 3AY3A 3KR0A 3MTJA 2X41A 4NLYA 2NO6A 1HT2E 4ZO7A 1PO7A 1IKVB 2AW3A 1WOMA 4TLDA 4EYOA 3MECB 1KHWA 4ZYXA 2VDJA 4Y2TA 4EDHA 3U4DA 2IHKA 4PBSA 4LFCJ 3JALA 3IV6A 2WV9A 5IOLA 1VPWA 1D6JA 3QGGA 1YVDA 3ZTTA 5EZ5A 1YDGA 4OKIA 4BMSA 3FZEA 4E7PA 3NNCA 1GX5A 1S97A 1OX5A 2G72A 4G67A 3OQMA 3QRWA 2WWYA 1ISRA 2B4YA 2CXUA 4CCYA 1UWKA 1G8GA 2J30A 3WYFA 4M7OA 4AX4A 3EE3A 4X91A 1SKWA 5K7SA 4W5WA 2FD2A 3HBLA 2G77B 1PJZA 2EBWA 4FT4A 3M2VA 1SHZA 2QRKA 5J23A 1WXXA 3R23A 3NASA 1XZHA 4RKEA 4WCFB 5L3ZA 4LZZA 4YAWA 4RGQA 2G9VA 2B6AA 3QF4B 3F1LA 1XR3A 3DOFA 1FP7A 2XXAB 1NVTA 3GMIA 1T0JB 3KE8A 5TNXA 1RYSA 1V37A 1JR3D 2VPZA 4LZPA 5LSRA 4DR6F 4CEIA 3SV4A 4KSBA 3WC2A 4PHFA 1V1MB 5AXKA 4JR2A 4JBNA 5CJJA 3LKDA 3PQ3A 1C1CB 2DWCA 4CN8A 3S28A 4XTCS 5MN4A 5TVKA 1A3CA 1T2DA 3ZDAA 4KXUA 5K5EA 1FJCA 2KM1A 2CN1A 3S2IA 4MICA 1C1YA 1L1QA 4HPWA 4X9XA 4G5GA 2VHZA 3ADDA 1WNEA 2DHCA 4TZ0A 3AUJB 4NMXA 4IR7A 2F48A 4HWOA 3Q3CA 2JZOA 2HPZA 4I8XA 1YRQA 4U0KA 2WVFA 1R88A 1Z7WA 3HVUA 3BS4A 2ZYSA 3ZHZA 2XF2A 2HHHJ 3SE0A 2DERA 4N5NA 4IH9A 1KMHB 3HE3A 2OHOA 3KG1A 5HQTA 1KZHA 1C0UA 4IMJB 1S0MA 1JIJA 4GH5A 1G7RA 2AZXA 4UTRA 1RWWB 5LZ8A 4ZEOA 4ZVTB 2MYUA 4C98A 1T9WA 3NAQA 1Q2UA 1MB2A 2KJWA 3ZN2A 5KYKA 4H4MB 5F3TA 1QSLA 2HA3A 5FR1A 5JG7A 3V1MA 2VOJA 4OBEA 2JVOA 1IPHA 1RQXA 4V24A 3UMFA 2JGMA 3DFIA 4D25A 4TVOA 4X1YA 4DG8A 4NV3A 2ZUDA 4G65A 1XTRA 2PMHA 3ZY2A 4QW8A 3BO2A 1PJ4A 2LLZA 3C1OA 4TU9A 5J2PB 2XYQA 4B8YA 2UZ3A 1K0UA 4PYAA 1UC4B 4TYPA 2HMAA 1KTIA 5TMBA 2Z4RA 1J0AA 4PS0A 4JMPA 3T95A 2NO0A 2QD5A 2OOKA 3RROA 2D4HA 3UH0A 3CJRA 2FPIB 2HGNA 3ZJTA 2J9DE 1OPRA 4EI8A 3IXQA 1UKUA 3ETEA 1ROFA 3HYRA 1TU3A 2EX4A 1JZSA 3DAFA 1KC3A 2GDZA 2H00A 2HMSA 2V7QA 2RGXA 3STUA 3A3KA 4TROA 3UBMA 2OOSA 3H0EA 5PNTA 5EIOA 5REQA 3V2UC 3NV7A 5FLEX 2LU2A 1FTRA 1FEZA 1MORA 4ZHRA 1YAJA 2HQCA 1CYDA 3SCJE 5DM70 2WJAA 3NFYA 2A3JA 1ZD2P 3RADC 1E9DA 5HRAA 1QIHA 3A06A 5C8DA 2H85A 3UV6A 2PR2A 3V81B 2AL7A 3IQZA 4ILKA 3ZNQA 5EXPA 3H5LA 3I53A 3MZ0A 4EJSA 3A1FA 3N2EA 3NHWA 1UM9B 3DVSX 4J1NA 4Q3BA 4K9NA 1WBDA 2AA3A 3K1AA 3A8EA 3DDUA 5LXTA 1TKTB 1V8PA 3I73A 1LKZA 1XE3A 5HHTA 1ORHA 3UHFA 4EW2A 4FYYB 4OLOA 4USWA 2PZJA 5H9FJ 2BKXA 1S4QA 2ECQA 3A3YA 1W9MA 5EDWA 2MHEA 2MZQA 2V1XA 3NNNA 3U7IA 5E9QA 3V4RA 1FKAF 4FGUA 4JB2A 4K9MA 4BZZA 3G2OA 2PMCA 2DCUB 2A0XA 1V1JA 1FDDA 1P27B 3DAYA 3VAZA 3VPBA 4Q1AA 2J0QA 3RQSA 4D0RA 2ZPUA 1IN0A 3SJAA 1IZ7A 1ENZA 4XLTA 3PNIA 2BFOA 3K3PA 3GV5B 5E41A 4M8IA 4R3WA 3WK7A 1SNYA 5LMNJ 2DUMA 1Q7EA 2VK4A 2A4KA 1JSCA 1GPH1 2G1UA 1LW2A 5EQDA 6AT1B 4MJ7A 1S89A 1B26A 2AJDA 3PO4A 2FF5A 4S1TA 4GICA 3BE6A 3L4KA 3PFKA 3KHUA 1VL0A 3WMEA 1A5BB 2CL6X 3IAFA 4GU5A 3DDIA 2O8VA 1Z2DA 2ZBVA 3LQVA 4PSAA 4BNLA 3BVPA 1OYEA 4BDPA 4BNWA 4TQGA 4N7RA 3GGDA 1F8YA 2HBZA 4XCXA 2OVBA 3MSXA 3P2YA 3P9XA 4TL8A 3U27A 3AEQA 3A8IA 3S99A 2IYPA 3JSAA 4L2IA 1YR9A 4X24A 1GIAA 3RS2A 3NPAA 4EGCB 1I94J 4MQ6A 3VZPA 4QD3A 2QTMA 2KT5A 1QANA 3TBKA 4GI1A 1K89A 4TY8B 2JHFA 4Q44A 5C0OE 2OMOA 5LUBA 4TQRA 2F90A 1LWEA 5KOIA 1GILA 4I7EA 1A5AB 5KYUA 1LDBA 5B3JC 3HCWA 4OPMA 4F0KA 2Q9BA 5GV7A 4DFKA 3VO8A 1JILA 2ZTMA 3BPSP 4ZVSB 5JMPA 4TLAA 2G04A 3HBNA 4ZICA 2CY0A 4JI7F 4UFNA 1TA4A 3QYPA 4IWYA 4JYAJ 1I4TD 4H6VA 2RB7A 2RHDA 4DCNA 3SSAA 1ZIOA 1E1QD 3NMRA 4MOWA 4NFHA 2CFRA 4OXRA 1YFZA 4LA4A 2DR2A 4LZWA 2L17A 1M2WA 3TZYA 4I0WA 5JDIA 5A5VA 4OIXA 4LFAF 2B61A 1XQIA 1RC1A 4LXYA 3WLOA 2BZGA 4YRDA 3STYA 2JLRA 2EXUA 4RXUA 3VI3B 1L4EA 1CZKA 2R87A 3PKJA 4YV0A 4RR5A 4KRXA 821PA 2FRVA 1KETA 4L1KA 2VPWA 3TM4A 1SHTX 1EAYC 4GUAA 1D7OA 3U62A 5AO9A 5C2JB 3MBKA 4P1ZA 1AXGA 1GCIA 4X7MA 1TVKB 5K51A 1KQFA 4F0MA 5B0DA 3KZNA 1RAAB 3M05A 5JXIA 4O3OA 4L51A 3RVQA 3GJ3A 3A4IA 3MGAA 1A9XA 1VBZA 4I6YA 2R8EA 3IQIX 2PRZA 4F9EA 4LHZA 2CJYA 3EXG2 5HKKA 2JLGA 3ILHA 3TWOA 2IYWA 3PYFA 5ALEA 1EETA 1KSJA 3QKWA 1NSPA 1M76A 1EHIA 3TZ6A 1ZI8A 3HTXA 2WBMA 3HQ4O 2VUTA 1WSDA 1W76A 3RAFC 1A98A 2PFDA 4YMIA 4IJWA 2V97A 1PT7A 3D8NA 4DQLA 3A9SA 2FC9A 1UFWA 2XMKA 2HSZA 4CL3A 2ID4A 4K50A 1BQNA 1L3VA 4HQRA 4XEHA 1R4NA 3H5TA 2XGJA 3KPYA 5JYCA 2P27A 3UPFA 4AECA 3QT5A 3GJ8A 3S44A 1IU9A 1PFKA 3UK2A 5TJHA 1EHWA 1RM3A 3RANA 1P3DA 1N88A 1HQUB 1XQ6A 1Z4QA 1SUWA 4LSLA 5B3LA 4K2XA 4JFAA 4KI7A 4H7EA 4OQZA 4UPVA 1P73A 2TRSB 5HCUA 1JLCA 2FEXA 1DX9A 3V2UA 2LXIA 4C8ZA 2PG3A 2QV7A 4DV2F 3I1FA 5EGSA 1REGX 3QJGA 5LA6B 3CRNA 2OM6A 4B6OA 2QNBA 4TXSA 1R6TA 1M1UA 2EF0A 4YHBA 3D1OA 1NVKA 3WIDA 4ZK6A 2PUTA 2X1LA 2BUCA 1PG5A 1LBQA 2K7ZA 3HZZA 1EQAA 1ZU5A 3ILXA 4L3VA 4C1NA 3D3KA 1GN8A 5L8VA 1PGZA 5CFQA 1EG2A 2PS0A 3I83A 4G0NA 4IHJB 5D3QA 5L40A 2XDYA 3BFJA 2MTLA 2PUAA 2BJ7A 5AVKA 4M2LA 3CH7A 4AFFA 1D5CA 3W9JA 4RH3A 3R5HA 2XWPA 1SN7A 1XI2A 1T05A 5J1TB 4JI7B 1WAMA 5IX8A 3NS7B 1VDZA 2XUPA 1JJHA 3K0CC 4MROA 3ET5A 1P6QA 1CS4A 2CEAA 1QVRA 4QREA 4LFAB 4RZUA 1VJ5A 5K6AC 5I6DA 4DNXA 4N8NA 1WB5A 4LECA 5D78A 2H18A 4TWZA 3KFWX 2EFYA 3UMGA 3TK1A 1GSIA 1LX6A 3BERA 3EHDA 4J1QA 2RKWA 3W2EA 5D3KA 1RT2A 3L4JA 1TZ0A 3O21A 3QIVA 4MQ4A 1N8SA 3HSDA 3GNQA 4DY6A 1HFKA 1U3TA 2XXAA 5IC4A 4JI5F 5B1EA 3IL2A 3AHFA 2QSYA 1QOQB 4JJ6A 1D2AA 4C0JA 1XC9A 4KGVB 1IBKB 5TPZA 3EBPA 2R7QA 4X66B 1QQ7A 4JKIA 3SC4A 1MW7A 4U2FA 4MYDA 3AFIA 1C1CA 1F7UA 2FWRA 4K5RA 3M70A 3GNLA 3POTA 1RWQA 1EE9A 4L0CA 1TO6A 2ZJ3A 4G0XA 3M8QA 5F35A 4Y1EA 1T5OA 1HIYA 2HGMA 4BNUA 3RJTA 2GNPA 3L7OA 2YQZA 4Z51A 1A2BA 1IM5A 4Q1FA 2V2VA 2CBXA 3B3AA 3UJNA 1Z2LA 1UVNA 1Q95A 5TS3A 2AMCB 2WSFC 2IE0A 1EFVA 4BEBA 4CGYA 5B3JA 1RPJA 4KR2A 1S7IA 1YBFA 3DYAB 1QYRA 1V0JA 4HMQA 5A5FA 1RPZA 2X2FA 3FR7A 1TL7C 4C4XA 1CQMA 2IY9A 4JR1A 2XIJA 2FLPA 3C3PA 2VDOB 2ZKLA 3Q8WA 2WJ4A 5D3GA 2Z2YA 4WKGA 2XMUA 4JN6B 4OSPA 1JKHA 5CBKA 3UNGC 5C53B 1YCHA 1ZRSA 1T11A 2XUDA 2RNEA 3SQGA 1D2RA 1LWFA 3WISA 1JB9A 1XHFA 3PDWA 3T54A 3AQ4A 4KR3A 4MFBB 3CEAA 2RI6A 1T4CA 4IMPA 4AS3A 3OQ6A 4MEBA 4IIVA 1XTZA 4G1MB 3DCIA 3DOCA 3GLGA 4XTTA 1QFJA 1HYGA 4R5PA 3N7TA 2JLYA 3SQLA 1XTVA 4F72A 3LL4A 5DZ6A 4Z2YA 3HI9A 4QEZA 1HYSB 3S8YA 3ESXA 2Y76A 4BS2A 4I4NA 5DM1A 5J2PA 1VI6A 4BNXA 1EAYA 1IM4A 4I4TF 3G87A 3KKKA 3RVPA 1N4DA 4YJHA 3NO4A 1HG1A 3E22B 2QL5B 2AZ1A 2IX3A 1LPNA 5GIPE 4B45A 4B7ZA 5AW0A 3C3DA 1F8UA 2BFEA 3JYLA 2F4FA 4RHEA 1B8OA 3W62A 4FSDA 4D3YA 3FGOA 3FAZA 1QDUB 5C81A 3DB2A 3AR6A 3E51A 1HNXJ 4ALIA 1WDKA 1N5YA 2A18A 3MB8A 5G4KA 1GDDA 5KREA 3FUYA 3WYNA 2IUUA 2A6OA 4B9UA 3AEKB 2VP0A 2M8HA 2Q3BA 2V6JA 1FJEB 2I6UA 3USCS 4EYEA 1NBEB 1N6LA 1NRXA 3UQSA 5I9TA 1OASA 4LMPA 1SFRA 4LJ4A 1Q0UA 3IO3A 5HAOA 3NEJA 2WWTA 1GX6A 2R68A 2CB9A 2KO1A 3V1LA 3DAPA 1EFUA 1T2VA 5E3CA 4C78A 5LBTA 1RRPA 2IW1A 3R4VA 4FDFA 4UUWA 3MUFA 4R1TA 3WYGA 1V39A 2WYIA 3TRKA 4M9CA 5ETLA 3SC6A 1A2QA 2XVMA 2PWAA 2MQQA 3B52X 4IGFA 1R0RE 2BW7A 1CERA 1HDOA 4DPWA 3WDSA 1S12A 2OFGX 1E59A 4ZREA 1RWPB 2OH2A 2J9RA 3G6XA 1DKUA 1FDIA 3PQ5A 4FGJA 2CGEA 3B5JA 5TQ2B 4GGMX 3WGZA 2WG0A 1FQKA 1JXMA 1I5EA 4ECAA 1NPPA 4AK9A 5ITZA 3ETGA 1QYWA 4A23A 4B48A 3LX5A 1Y3DE 1EGAA 5HKKD 3VYTB 3WSVA 3INTA 4C87A 1IWBB 4MQEA 1KZ9A 2HGSA 2JLAA 4HDRA 3W8DA 1AKMA 1AKEA 4C11A 1DAGA 2XQCA 4TGLA 4A73A 3PJDA 5E7JA 2J6UA 3ZLTA 1QFMA 2POQX 3AUTA 3UFCX 4CTKA 1GGKA 2ZM6B 5IQQA 2QBYB 1JI3A 4RTJA 1X9WA 4OL9A 1KDVA 4OSOA 3AW9A 3W2HA 4HQKA 3A2KA 2IMWP 4QQ8A 3ZZUA 3DOKB 2I78A 2F62A 1HBMB 5COBA 3LP2B 1RADB 5HMLA 2VP6A 3UJPA 2BFCB 2FQXA 3SFVA 10MHA 5BNZA 1MQ9A 1CJKB 1RXCA 3KSAC 2Q3LA 3I9V9 1HF3A 3MMNA 4CKCB 1KJIA 3UJBA 3KTAA 1EFTA 1WEHA 1VKJA 4AUMA 1J99A 2KB0A 3LAMA 5K6AA 4DCPB 2AU0A 3U56A 1F2UA 3LUJA 5I8WA 3LVBA 3D6HA 1C3JA 1ZUIA 5AJVB 3NI2A 2BRUC 3BN3A 1VCHA 1EJ0A 721PA 2LA4A 2O67A 1FBNA 4I4TB 2RH8A 3WIOA 3C16A 5LB2A 3U1NA 2PS9A 1UMCA 3GNSA 1J21A 1SMKA 4LF4J 2WMOB 4XR9A 1AF4A 3TLMA 4XD7D 2AG6A 3HV2A 1SD5A 5T4BA 1T6XA 8RUCA 2R2UA 3PYGA 3PHGA 4MI9A 4U7UK 4ZI7F 4Y28C 1VQKS 1K8RA 1LV8A 5JJLA 4C2TA 3RI3A 1KEPA 4JLJA 4FW8A 3BA6A 4IG9A 3P0IA 4RVUA 4HDSB 3WIVA 2ZE8A 2IYUA 3U3OA 3G9XA 4Q9HA 3A3OA 5CX1A 1SR8A 2W24A 4G24A 1HE4A 1FFDA 4FUQA 1RRFA 1VE5A 2OZLA 1B23P 3E1SA 4TLQA 1MO4A 2CQPA 1N6HA 1YVUA 3QHQA 1MSWD 1Q7CA 3NTRA 2Y1EA 3FTCA 2YYYA 5J40A 3UF0A 4O1IA 2QYCA 4NG5A 2GFIA 2M70A 3TTYA 4P22A 2OHJA 1FNCA 2A8YA 3A3NA 4WBNF 1CJBA 2RHJA 3WLNA 1EDEA 5M3BA 1QKJA 3I9FA 3OQIA 3RFFA 2V4JB 3RYIB 1V8BA 3STHA 4HWRA 3PHLA 2HQOA 5KG4A 4PS1A 1E3TA 3RODA 4IGIA 1X0PA 5FT9A 2ODPA 4CT4B 1FY2A 3CUYA 3UA4A 1GT8A 3CZMA 4UHFA 1Y81A 2ONCA 1QZ3A 3KLGB 3Q8RB 2FPSA 4PF1A 3ADKA 4MV0A 4ZT3A 3ROKA 2HJGA 2QZZA 4JV2A 1V5GA 1W8DA 1NFRA 5TPZD 1TYBE 1FUUA 3LGNA 4A1FA 1L3SA 1H6AA 3PIRA 2ZSDA 4GAEA 2AMVA 2G9UA 1LSOA 4KPYA 3KD2A 4X3CA 4PR6A 2ZWMA 5SZKB 4LVNP 3VCDA 3GRUA 9RUBA 1Z7YA 3GZ4A 3QXGA 3CJTA 3GVPA 1RWOA 1WD5A 2HQRA 4MAFA 4RL4A 2CJFA 1PR4A 3DXBA 4W92B 4D4JA 3PHCA 1DIAA 2B9XA 2XJ9A 3IT2A 4NLUA 3H5SA 2DX7A 4OXIA 4C3LA 4HNVA 3KKPA 1BHNA 4D9GA 4E21A 4PQUA 1CWUA 2B8WA 1X9SA 4DAOA 3RVKA 1N0UA 1L7DA 5HM8A 4QWEA 1TELA 4D8YA 3FFTA 4YUWA 3CE8A 1Y33E 3HKEB 1GPJA 2UVUA 2X7HA 1ZDMA 1KI8A 4ER5A 2BUAA 3GZNB 4J0DA 2P3OA 1BS2A 5KWSA 2ZDGA 1MTOA 3TIXB 5DDQC 1H2UX 4DA9A 3S5JA 4HUQB 2X5JO 1O5OA 3INYA 5K0ZA 2EVWX 2ZVQX 4M1ZA 4GVXA 5GJBA 4FFWA 1U80A 2UUAF 4NQRA 2IEYA 1IBMJ 5WRFA 5IN5A 2DO4A 4ZCSA 4Y65A 3G8AA 4QLAA 3PXXA 2Y27A 1SAYA 4LHVA 2WYVA 2ZRDA 4RJKA 3EQ9A 2GAHC 1P7VA 5H9FK 3UYKA 3ZTSA 5F2OA 5CURA 4F85A 3NUZA 3K5WA 3TLAA 3NOOA 4ED4A 1NBME 1KVTA 3BXGA 5EJ7A 1BDMA 3M6FA 4Q3AA 4PCVA 1PN3A 1RJ9B 3TNJA 1KDTA 2F55A 3VTFA 3ZX5A 1A8HA 2MZTA 1ECJA 3UOAB 2YWFA 1CZUA 5DW3A 5LMUF 4F8YA 3DXSX 4MH8A 3JQQA 1MQ8B 1QJCA 5J59A 4Y6SA 5FPHA 4RNCA 2PZAA 2CHUA 4D1YA 4KGKA 3GCDA 4LUCA 3LSYA 5FIIA 2FG7C 1XJ5A 1H66A 5TQ0B 4RVNA 3NBYC 1KFBB 3OQBA 3GZ7A 5GMDA 3CRW1 5C35A 4KYZA 4I1UA 2JIRA 3GLKA 4U5QA 2C7OA 2I22A 2L9NA 3TEGA 2WHRA 4OQ4A 4NESA 3V6KA 1UJ6A 2G07A 3S8MA 5F41A 2W7OA 5F9LA 4LSNB 1JLSA 3WL3A 5CIYA 4DA0A 3ILLA 1UT8A 2FCRA 2WA2A 3O03A 2RGCA 2GVDB 4X4TA 1EWTA 4KBGA 4KBIA 2FPPA 5TSDA 4N65A 1TI7A 2PX5A 3NBMA 4QSMA 3G8DA 1P80A 4EUKA 4LIRA 4BMPB 1S6YA 3LWLA 3C2QA 5DNDA 2BRUA 3LH5A 3NBQA 2BFPA 4NU6A 3K5MA 1UKYA 3KT6A 2WU8A 2X40A 1VJRA 4LPSA 4FLEA 5CLIA 3TR6A 3UMJA 4AN1A 121PA 4YAJA 4C8KA 1Y80A 3KJEA 4LKRA 3ZGLA 3SWWA 3P9SA 4B31A 2OUKA 3VPDA 4KPEC 2WF5A 1D7AA 2W2NA 3FZQA 2QLJB 4XB1A 4KV8A 3DR3A 3K1TA 1HG0A 1JLGB 4BVHA 2I91A 5DEOA 4URHA 3WRYC 2H63A 2DFTA 2C1XA 2VDHA 4DG1A 2JGFA 4C22A 5J1EA 2B4TO 4A4JA 3RH0A 4OQYA 4P5DA 4UOQA 4MFBA 4FF4A 3W65A 3PR5B 4KO4S 1ZONA 2ZUVA 3ECAA 4O33A 4G0WA 5HO4A 4EB0A 3MINA 3M83A 4AMGA 5IZ4A 3ABRB 4MS3B 3H1FA 2UUAB 2JLUA 2V4UA 3KG4A 5H59A 4ETIA 2O4UX 4O0NA 2DXEA 5F8GA 5DN9A 3MM9A 2EBHX 3IA2A 4KR6A 2EJWA 3DEAA 3ETCA 3LY9A 2A0FB 2V7VA 2OFFA 1OOEA 1XMVA 1FFSA 1H1LA 3AR7A 5TV2A 1AHPA 1KORA 1XN4A 4OYIA 4KGXA 4KOEC 3CNOA 1YNSA 3A9RA 1JAIA 2Y1JA 2BN4A 2E21A 5HMYA 1B16A 3GBSA 3TQEA 4PSDA 3TDMA 4KHRA 1NNI1 4MCIA 3FTEA 5C37A 4BO1A 4QBKA 3FCSB 4IIJB 4DDWA 1BQMA 1B3TA 2Q1SA 4RFSB 3ZV6A 2AJ0A 2J7WA 4MR7A 5TT1A 2ERRA 4DRZA 4PXAA 2FWAA 2FOXA 4YROA 2AMJA 3W7AA 3BQ1A 2R1TB 3PW0A 3IQXA 2CQ1A 1KOOA 4M0UA 4DWJA 3R40A 4HLUC 1XZEA 4X1IB 3ONEA 1LDNA 3RC3A 1HHSA 4X93A 4NPOA 1H22A 1QS0A 4II2A 1T9YA 1MOQA 2YUTA 2XDQB 3E01A 1NX9A 5E1OA 2QG9B 1NRWA 4BJ3A 3CCSS 2MY7A 1NAQA 1GPAA 1WPRA 3UNXA 3I28A 4MVJI 3SS9X 2H1LA 1YRHA 2QENA 4IJUA 5DTMA 1W0KA 3B3JA 1IRIA 2C5GA 5DWDA 2XSJA 1H93A 5H80A 1ZA2B 2CNLB 4Z3DA 1CUCA 4JJZA 2I6XA 3JAMA 2NPIA 2AW0A 1ECPA 2PIAA 1USIA 4UOZA 1VHFA 2AFRA 3C24A 1Y00A 1MA0A 3VR6D 1Q50A 4QOSA 2GK3A 8GPBA 2W8KA 2WTUA 2YMQA 3TYTA 3MUVP 2UVPA 4P2SA 4PINA 3JWGA 3BGRA 1C9JA 1XP8A 4UNNA 3VR4D 4ZCRA 3TBFA 1T36B 2VA9A 4DMGA 2KT2A 4IKAA 4EUHA 4CTMA 1U45A 3E3XA 4B3XA 1R0BG 3KQYA 4BFWA 4UBNA 3HU5A 4KQ9A 2G9QA 1KKUA 1U1LA 5DOZA 3KFXA 1CUDA 5KU7A 2C8JA 4MPRA 3WGLA 4O08A 1BHJA 4P4NA 3NDJA 1Z47A 4MT1A 2GLXA 4AP5A 2RJOA 4PCQA 3KYIB 2GRJA 2BBWA 4MKFA 1SKRA 4K6HA 3OQJA 4WE1A 3CLSC 5LZ9A 3P5TL 1ZNQO 2WHQA 3E8MA 1EP1B 1I6KA 3ENKA 3UBTA 1WVMA 4B9VA 1NLYA 1QHYA 2XGMA 4ENVA 1Z34A 3UK1A 1WG4A 3JALB 2EATA 3M9XA 4P0QB 1MX9A 1VJCA 2QMWA 2WK1A 2BOAA 4NQZA 3BJRA 3TZKA 2YPZA 4ERNA 2CKDA 4IS3A 1JJBA 2JASA 3PEEA 5BT9A 5ALOA 1JMTA 1XBWA 4QX6A 3URKA 4I4TA 4AG6A 4TL6A 4NYIQ 4EJ2A 1MH1A 4L15A 4CCYB 3P0RA 621PA 3KSRA 1EXWA 1M2VA 1N3LA 2DTEA 1T1GA 3CMMA 3B3FA 4Q7AA 4E2XA 3KJZA 2OSBA 2W2PA 1YZHA 1EFAA 2O3RA 4E4RA 3E7WA 3O6VA 3ZU6A 3BSAA 1NN1A 2CJPA 4YX9A 1WWHA 1WMAA 3Q6MA 3M2VB 2DPLA 3N2YA 1T5TA 1L5ZA 1TKCA 5CRIA 5KSWB 4FFVA 3RC9A 5KC9A 4UAJA 1RXUA 4HDSA 1P3Y1 2YOFA 3ZDQA 2B6AB 4IQGA 4MUFA 3SSOA 1QUFA 1T26A 3GOQA 1RP1A 2FQQA 4B6FA 1RNLA 4NG4A 2W42A 2VI5A 3ILIA 1Q82T 3CJ3A 3P8BB 2VPZB 2X1GA 4FYDA 3AEXA 3ICLA 3HF5A 3U7EB 4AMVA 5ELMA 5EGNA 2OUIA 1R2QA 4RSHA 4V39A 1RKXA 2EWWA 3N76A 4LF2A 4GNKA 4OYRA 4GBED 3F7TA 3FFBA 5HF9A 2PVSA 3MJCA 2VRCA 5HVHA 3AB2B 1Y3CE 2IHBA 4HRVA 2C0CA 2IYTA 4KVFA 1FP1D 4NMXB 3R5JB 3IVGA 2PGXA 2A3RA 1N8NA 3ZTYA 1QVFR 3ZXIA 2CXXA 5BSVA 4UBOA 4OLHA 1AUSL 3BZUA 3CDBA 2FDCA 2QTBA 4ZCQA 5KOYA 3FOFC 1C0UB 1S2DA 2ORYA 3PSAA 2IUEA 1R7RA 2G0NA 2QA5A 1YZUA 3QVUA 1YZ3A 3H9UA 1E6WA 3WDLA 3MOGA 3NHYA 1ULBA 1G2OA 1Y1KE 1PU2A 5KFVA 5JCZA 1T6ZA 2FW1A 4G9GA 3RRBA 5CYFA 2VODA 1V43A 3JQAA 4CH1A 3H0PA 4URSA 3WK8A 1RCTE 2V9ZA 4HMPA 4D45A 3SFGA 3B5IA 1T5DX 1U3UA 3GZJA 4YDXA 3MPYA 4EFLA 2MKSA 2AGQA 4BLUA 4RPIA 4C0OC 4DUGA 2PZEA 1FMCA 2W2TA 1J5EJ 5JSQA 3G2HA 1IUKA 3OR2A 1J1ZA 4AUEA 2ADFA 2VF3A 4HLUA 2GETA 2HRBA 3MK31 1AQIA 3EEBA 4XWTA 3G88A 2CKWA 3RVJA 4B09A 3VH1A 2GARA 2BIFA 3C3JA 3QIAA 3OL7A 1X0XA 4EGJA 3NIBA 4FS1A 1X8XA 1TMJA 4OA8A 3O94A 5REQB 3JAWA 3GPAA 4A0SA 1SD2A 2F4VF 4ZHRB 4RAOA 4FXPA 4AXJA 4ZI7A 1U2QA 3G7UA 1NBOA 2VIIA 1Z25A 4HR7A 3L0DA 3TXAA 2BOPA 1SXJC 4OGWA 1GDHA 4KL8S 2H2FA 1JKMA 5LMNF 3ENWA 4DQXA 3W9YA 4EJSB 3GVCA 4P33A 2P75A 4CKYA 1GEEA 1VE7A 3UUGA 2P4EA 3GLIA 1URNA 1X4DA 3FMOB 5HIAA 3K1AB 2OTLS 4BGDA 5LXTB 2H16A 3CG4A 3TLJA 3W7VA 4CF6A 3LSTA 4NYMQ 3ZK7A 1DIHA 3CGIA 2J41A 3I1IA 3K1ZA 1K27A 4PZLA 1W47A 1TADA 2RONA 5J2MA 3MIIA 4DLUA 5HDQA 3J7YU 4ZGWA 3B12A 4WBNA 4BWJA 3ID6C 5F7JA 4MMXB 4GQIA 3OSUA 3EG9A 4L5YA 4WXHA 3BXPA 4DPLA 1ULSA 2IP1A 2Q2VA 2VWQA 3PGA1 4H1TA 4OLBA 4R9UC 1ZOSA 2QX8A 1TFUA 1SURA 1P8AA 3OXFA 4ZT4A 3AM4A 3OWOA 4QDKA 1NVWQ 1E0JA 4CHGA 3K2BA 1XZIA 1LW2B 3OOHA 4EGFA 3OU6A 4V1CI 1OPXA 4MARA 1LC3A 1W0KD 2HAEA 4M8SA 4TVKA 5KWJA 2Q1YA 1YGYA 1D1TA 1IXSB 3ILYA 4LJ7A 3TAXA 1QDLB 4HKQA 2DNOA 3V7NA 4Z3KA 1KJ9A 4MIBA 4WN3A 2P40A 2GO9A 4U7HA 4Y2VA 2YPYA 2Z5LA 1WQ3A 2IZ6A 3QLHA 4K4YA 2WHOA 4OHVA 1N4AA 1FYXA 1N5OX 3L4SO 2HBZB 1C2YA 3LPYA 1BYIA 2Z98A 2P9QA 3AEQB 4CL8A 2DVMA 5AKEA 2GW8A 3MTQA 2BBTA 4L2IB 4B4VA 1XXHE 4DN6A 1CEYA 2XNHA 4AG3A 3TLXA 1NK0A 4QIWD 1REQA 2H52A 4Q9JA 4E88A 2B4KA 4X2BA 4R81A 3ZBQA 4YR3A 4X3OA 1QIIA 5BO5A 3PENA 2W37A 1CZHA 1NXIA 4BBYA 3ZS9A 1YDHA 4NCKA 4S2EA 5J5VA 2OGZA 1LWEB 4IMRA 1RU3A 5KYUB 2QVBA 2W43A 1R0WA 3NKYA 1V6AA 4A0GA 3ETHA 4Q9IA 1E2HA 3X1DA 1L7QA 5JAOA 1JAYA 1TUIA 4GM1A 1MG7A 3EULA 4LY0A 3G89A 4IICA 2HHLA 2QNRA 1SZJG 3RK0A 1JDSA 1YQQA 2R3SA 4ZMBA 1UFRA 2I38A 1YKFA 3RIHA 2AKWB 3FVYA 1A7AA 3JQ9A 2WINI 3GLRA 4F38A 4RVSA 2ZYDA 1YB5A 1U2DC 3MS4A 3SMQA 5CLFA 4OYOA 5AVTA 1T4MA 2RGYA 3D4JA 4A15A 3THYA 1TJNA 2XY7A 1BS9A 5A3JA 2F4VB 2PGCA 5DBOA 5JSFA 2OD9A 1ESEA 3IEIA 4KLZA 5AW3A 4UPEA 4C20A 1UJBA 4ED6A 4YP5A 3LTNC 3TSWA 1P2BA 3VGJA 2VPWB 1Q22A 1T5HX 3R0QA 4UHJA 2MYTA 1PL0A 4RFSA 4O0IA 2IC5A 4K5SA 5BRNA 4WXWA 4G1CA 1FPQA 4MUHA 4XCQA 3AJ1A 1BMTA 1KQFB 3VSDA 2MJLA 4IH5A 5C7OO 1J9ZA 2XXJA 3FNEA 1CDZA 1HNNA 5CH7B 5KYXA 2Z6AA 5DTQA 1KRPA 2ZRQA 1A9XB 5HK4A 4LJSA 3U6KA 5GOZA 2WY2D 2G2OA 3MAJA 1N1EA 2AI1A 3HA3A 1KWKA 2CJYB 1SCBA 4PYOA 2DY1A 4ZOLF 3VZDA 3C14C 4MHTA 2PA8D 2I3BA 1Z5PA 4WK4B 4OUKX 1EETB 3I6QA 2H7XA 3K0SA 1R9NA 4UULA 2J08A 3QVVA 2IV2X 4BY9E 3HCPA 3NGRA 1Y42X 2LQBA 4WKOA 4JUIA 3RB0A 5EZ6B 4PTYA 1U5CA 1TEXA 1IWOA 1JF8A 2QDKA 3BGOP 4KXWA 4PLYA 1WMEA 3HFGA 1T0IA 4K3VA 3N05A 5DG7A 3PXEA 2GNKA 2QA2A 1Q0HA 1R4NB 1MFPA 4UM8B 1WXIA 2EVZA 5FUWA 4L8WB 2YOGA 3RJMA 3EMKA 1GQEA 4REMA 2OAQ1 3L7LA 3P2MA 3R5AA 4DMZA 2CHVA 4YN3A 3C4JA 4YDRA 2FJPA 4LSLB 3CZ5A 4PZ9A 3B9PA 5HF5A 2G0AA 1N1MA 1TTHA 4TMTA 5DCUA 2YCBA 1JLCB 5HRUA 1AX9A 5JROA 4ZJPA 5A7HA 1LBTA 5ICEA 3GVIA 2ILVA 5LC1A 4UBIA 4TM8A 1JIQA 3OLCX 3D31A 4A8TA 3REQA 1OBVA 1RS0A 1HT3A 3JQAD 1PG5B 1QZTA 5AKGA 4WIIA 5MDHA 4DEVA 3G6WA 1NP6A 2BELA 3RS8A 4A10A 3OECA 4AJIA 4HI1A 1FZQA 1QTNA 1BXGA 1FWLA 3QHAA 4KGDA 1LDGA 1X38A 3MYRA 3R7WA 1Y9ZA 1Q12A 3CX3A 3GXOA 4QU0A 4X8MA 4P2MA 2OD2A 3CPSA 1C7JA 1F14A 3I04M 4BKUA 2ONYA 4FR0A 2C4KA 3FLMA 2VF5X 1T05B 1CQJA 1JGTA 1DGQA 4TS4A 1U8CB 3ISND 3CUTA 2X8AA 3ELUA 1S2MA 1TK8A 1YJ9S 4TYBA 3P4UA 3KHKA 5FEMA 1CS4B 4Y9DA 4KXYA 1P60A 3AG5A 5IT9Y 5L6LB 2QN6A 2A9FA 5HILA 1KFCB 4PNPA 4DCTA 2D1YA 2UZ1A 2OQRA 1OZAA 1SXIA 2DETA 2A10A 1OILA 1VHDA 5DP2A 3E1GA 1BDIA 3WB0A 1DRKA 1NPYA 1T3HA 4FF2A 3NIWA 1RT2B 4XTRA 5HQ8A 3R1HA 1B3RA 4Q1VA 1Z17A 3NNHA 2CL5A 3HRIA 4FEEA 4YJDA 3ZIDA 2WOJA 3U7QA 5IC4B 4LV6A 1WSRA 3NWGA 5BXQC 1Y3HA 3CJ8A 3QNUA 2A5YB 1XELA 3EASA 3VV2A 4IEEA 4S05A 2A9JA 3WRVA 5LB4A 4UC0A 2WVHA 1G3UA 4HGQA 6ADHA 1HNIA 1V6HA 1ESDA 2DF8A 3Q3GE 3POTB 3DDSA 4RTNA 4ES6A 2AYGA 2BM0A 1D8ZA 3R9LA 5JFGA 3M8QB 4RZ3A 3R5TA 2XMDA 4QM7A 5A9TA 4DL7A 1ECCA 1FUKA 3DZBA 2X51A 3AO0B 1UKBA 1BE4A 3IUQA 3R5JA 4DSUA 2ZE6A 3ZBTA 4AXBA 1EFVB 1M2FA 1WI8A 3JZFA 1MJHA 3I72A 3ON5A 4BVFA 1L3UA 2ENWA 1VGYA 4JI1F 2HTEA 4EYHB 4DLRA 2LPMA 2V2KA 1B76A 4YREA 3VNUA 2EW9A 3BO4A 4G5YA 1USKA 1PF7E 5EUMA 1P7PA 3G2MA 1X8JA 1HKHA 3D0QA 4B6EA 3DCJA 3SY8A 2G28A 2VJPA 4HWTA 5E38A 5D3GB 1XVUA 1J2VA 1UZHA 2Z2YB 3IRUA 1L7XA 3C6MA 1JKHB 3D54D 1YFLA 1HNXF 3SQGB 1LWFB 4CMKA 1LLFA 4DV7F 4DARA 2IIVA 3K92A 1T4CB 4E30A 1JB1A 1P5HA 2VH1A 3EGZA 2Q45A 3GPIA 4AY4A 3GLGB 5CK5A 2PHZA 5D0HA 3DH0A 4R5PB 2YVQA 4NU8X 4PXDA 4BB6A 3EOZA 1TFWA 3L41A 3ORSA 4L7VA 3L4BC 2CNOA 4KUEA 4F60A 3AF1A 1N2IA 5CFLA 4YJHB 4MP6A 1IJFA 1VB5A 4EM6A 1TKBA 3R6LA 4YCSA 3RIMA 3ZE9A 2DNHA 4HNSA 4TN1A 2YVSA 1HDIA 2BFEB 5E1BA 5H16A 5FBZA 3CB4A 1Q92A 2VPPA 2V0GA 1DBRA 1FMLA 5K8JB 1KI1A 4RU2A 4ZZIA 3ZH9B 1FFHA 1EYZA 5CIWA 3RT7A 2PX0A 2C2NA 2MKHA 3DLGA 1N5YB 4EATA 2HN9A 3F71A 5G4KB 4Y2XA 4ZS6A 3WWDA 4HQNA 3L0PA 3G1UA 5KQSA 3PC4A 1P29A 5GAEU 2D2EA 4ZVGA 3A70A 4LF5J 4BNTA 2W83A 4FJ1A 1RZRA 2JIZA 3NVKI 3BQ9A 1HSZA 1TAQA 1FDOA 3N58A 4TXNA 3VZIA 4PXYA 4II3A 1D0EA 1G6KA 2NS1B 3K70C 1RWXA 3HYSA 1BU8A 2VYQA 4A7PA 2PTHA 2XVYA 1E3SA 1UWAA 3F6YA 1L6IA 3NETA 4UUOA 4CTAA 2BQUA 3N6VA 4JU8A 4DMKA 2OGTA 3H6GA 1ONBA 1W4ZA 2ZTUA 5HROA 2O23A 4DR6B 1KI2A 2WCXA 1YUBA 2FPMA 3MRTA 3OQVA 1RKJA 1PQWA 3P0JA 3RQIA 2E3JA 5CAAA 4B47A 4B4DA 3OETA 1JVBA 2VHGA 2AOUA 4FNGA 3TAMA 3NT4A 1EI9A 4B4UA 3AINA 4KK3A 4CMIA 3HBJA 5ITZB 5I7HA 1IAVA 3NEPX 1V8OA 3MWEA 1N7JA 4YDSA 3ODPA 4TKVA 4GO7X 2BE9A 5KTSA 2NZ4A 2PCLA 1YJ7A 4FLMA 2P41A 4FB4A 1AKQA 1N33J 5JBNA 4MQEB 1CFZA 4HDRB 4D8TA 4C11B 1ONPA 2N0SA 3AB8A 2DUUA 2AN5A 2H5JA 3TDKA 2D00A 3AVXA 2FEWB 1NB7A 4DX7A 2WP0A 1JU3A 4B80A 3L1HA 5EJ2A 1PZXA 1KFSA 4KTTE 1WOPA 2PT0A 3ZGOA 2XB8A 3IQWA 4DIOA 2WB4A 3V8RA 3LF2A 1TL5A 4MKIA 1XZPA 3PZBA 5ESDA 5CVEA 1PC4A 2LXUA 3T5KA 2BGUA 2PQMA 5DGIA 3SZOA 3OJFA 5ETRA 5BWMA 1UBMS 3SR4A 5JNVA 2C5EA 4DV7B 3KTAB 1US8A 5C7IO 4EO8A 2XW6A 4JWKA 4AMYA 2XHWA 3KKOA 5E3RA 1T8SA 4FPRA 16PKA 1Y10A 1F2UB 4RGBA 2M6RA 3D6HB 3I42A 4DDKA 5JSUA 5CDHA 4BQFA 3C16B 2IUSA 1UMCB 1DQNA 4F7DA 5ETQA 3D02A 4GLLA 4NE7A 1O94C 3LUGA 3U80A 2XAAA 1EK6A 3THXB 4YEDA 2EGUA 2BBOA 2DQYA 5H68A 2J33A 4E0DA 2LV8A 4QUIA 4L27A 2FKNA 4LJ8A 4Q47A 2RGDA 3T5TA 1B6TA 3ICPA 1XZQA 4GXRA 2C00A 3A3OB 3RSSA 4R2JA 5ICFA 3EY9A 5CX1B 1LXJA 1MPXA 2OZLB 4C2UA 3CW9A 2BT4A 4X1KA 1UH5A 4KE6A 1GNKA 4J9UE 2HHAA 4HEA1 3EVCA 5BN4A 5ISMA 1UKZA 2V4MA 4EFNA 2CJQA 2HEIA 3GQBA 3A3NB 2YIDA 2CVFA 2P3SA 4HGRA 2JZNA 1B7YB 2A2DA 3OQIB 2GZ1A 5F8MA 4IDHA 5LSLA 5IK2A 2ZT6A 5IKMA 4FB5A 2QD3A 3QFFA 3HLUA 1X5PA 1BN7A 1C3EA 1TUVA 2FG5A 5AJZA 1YBHA 5EX0A 4ANEA 2B4VA 2CQHA 3UJ3X 4QO7A 2BJ1A 1T2UA 3KLHA 4IRKA 3BH7A 4DG9A 4HRXA 1ML3A 4MRVA 5JVDF 5GZ1A 1XMQJ 3LQYA 4JYMA 4O1MA 4ROTA 4C30A 2I29A 4ZEXA 5JPDA 2WLSA 1WETA 5E4TA 3GFSA 2DY9A 4Q6BA 2H1FA 1IBMF 4S35A 1RWOB 3IELA 2CLEB 1Z5ZA 3OZ7A 5DGBA 2QUIA 2C77A 1NPDA 4QUHA 4E15A 2YW2A 3H3XA 2GJAA 3NTXA 3ND5A 3V6JA 2TMYA 4AJHA 5D1HA 3OAAA 4BQSA 4O02B 1M6HA 3ED5A 3R74A 3PEYA 221PA 4PSVA 3QPAA 4PQUB 3O8WA 4ZRNA 1QB7A 4K0KJ 4TT3A 4DA4A 3OT5A 2R8JA 2P7HA 3U19A 3RC2A 4Z7OB 3TUJC 3TVYA 3CTPA 1Q7LB 2WPDA 4R9NA 3SBDA 1CLUA 5CFRA 2R8IA 3KYDA 4ZVRA 1P9NA 3F9IA 3R97A 2ZAYA 4UVIA 4M0MA 1LQTA 5K8OA 1MO3A 4JENA 3YASA 2BGLA 3A04A 3VA7A 5LT5A 1NU6A 1JJAA 1J09A 4OK6A 4HVAA 2PKCA 1P62B 5AHWA 2VUIB 3QWIA 5I3UA 1SXPA 2DMRA 4DDVA 2RGAA 5CA1A 2G0IA 2BWJA 2MSDB 1IIRA 4O2RA 4OZ0A 1Z6AA 2FP3A 5E8RA 3FMPB 3FOZA 2IL1A 1BX3A 4UE3S 5JDCC 3RUCA 5AKLA 4HN2A 1FRFS 1CB0A 1AGXA 2JFQA 2OAGA 2HZCA 1AW0A 1QYVA 4QIHA 3MOIA 3ZNPA 3EGWA 2GZMA 1FI4A 2Q0QA 4AJ1A 2QUHA 2HCFA 4UM5A 4TYYA 1V11A 1SPBP 4N7BA 3GFZA 2MR5A 1EEHA 1UP1A 3CC7S 3L8GA 2HMUA 4JI8F 2OMKA 1GTHA 1P9LA 5LOVF 1KE1A 1M2NA 2OPPA 1U9ZA 3H2UB 2V7QD 4IG0B 4M49A 1AC5A 3U7FB 2RHQB 1XFDA 2PKRA 2HIHA 3BXEA 4QELA 1QG4A 1ISGA 2XNCA 1UJMA 1F12A 3B89A 2QO3A 1R8XA 1KMNA 4BC1A 3RSQA 2JAOA 3K9CA 3STWA 2GN0A 3KIPA 1P5ZB 4I8DA 2J7KA 3QU9A 4IFIA 3MCSA 3ASZA 2E1MC 5EE1A 4R2IA 3FRYA 4NV1A 2Y0PA 1GH8A 4LJMA 1ZX1A 2WSLA 3CUSA 1P0CA 4CWBA 1TTQB 3FGZA 4F50A 2C94A 4ZOLA 5KAMA 4HQ0A 4FS3A 2FPPB 2V5AA 1RWBA 3R76A 2P9YA 5TE9A 4XVQA 2GA7A 1E7MA 4D3FA 1TD1A 1U0HC 4GR5A 1BEEA 2W25A 3RSGA 4IHKA 1D0SA 1NJ6A 4DYHA 3O3NB 3FJ1A 3M1YA 2D7DA 1J2EA 1HMYA 4RIHA 1UBOS 3IEKA 4PXEA 3D1HA 3NR2A 4ZV4A 1TA9A 1Y0HA 5B0AA 4NYPA 3IDFA 1QBKC 4EAAA 5DK6A 4E12A 2LEBA 3A6ZA 2A92A 2J0QD 4ZARA 3ZG6A 3M2UA 4M0CA 4F4CA 3KEOA 3VNQA 3PU6A 4HDHA 2VZ0A 4QUAA 4US2R 3BEOA 5KOJA 4NULA 3ESCA 1DJQA 1RA7A 3CIFA 4MVJP 4KV8B 4YMHA 5LU9A 4G1UC 2XZTA 3NQ41 3RFXA 2EKLA 4AZVA 2DJ5A 4IR9A 3AUXA 2VSNA 1IR2A 5C1IA 4QO8A 2Q0SA 5BQPA 2Y0EA 4DG1B 1BOOA 2O0KA 4J91A 5TF4A 4BO8A 5J1EB 4QBHA 2YJ4A 3ER9A 3C7TA 4UUMA 3C3EA 2H59A 3D8BA 4DV2B 1QV6A 3A1WA 2D3WA 1MT3A 3C3KA 4RJVA 4AM8A 3HK2A 2PH1A 5ICGA 5KT5A 5JQGF 3MINB 4P98A 2PQ0A 4OHPA 4PLHA 1S8AA 3ET6A 2RH3A 4WH0A 5EPUA 2H7YA 2WJZB 5AOAA 2ODQA 3WBJA 1NAIA 2YXEA 2ZVPX 3T7IA 1KO8A 3LHKA 1X7DA 2AKEA 1RM0A 1T6YA 2AB0A 3MWKA 3MM9B 1XN1A 3EW7A 3DB1A 3B1JA 3DS8A 1KI9A 3WGKA 4R71A 4YBZA 2WMDA 1FFSB 1H1LB 1U5AA 3L4EA 1JG2A 1O03A 3T6BA 4KGXB 2ZROA 3EXEB 3RJ5A 4DNOA 1FYDA 2CWKA 3U7HB 3UVJA 1RHKA 1UDBA 1T5BA 2WZCA 4D4KA 1UFVA 1WXWA 4BJ5A 3RYCA 5J4HA 2IYAA 1BQMB 4MR7B 1PQUA 1IBSA 2BCJQ 2NXCA 3NC1C 3DE6X 1LZLA 3AG6A 4X63A 5JOQA 5MN5A 3BXZA 2B4QA 4JI8B 4TN2A 1V3UA 3M6MD 2OL4A 5EUCA 5A03A 2PKEA 2SCUA 3EWGA 1Q21A 1QRDA 1ILEA 2WJ3A 1SWWA 4RV4A 1XA0A 5JQWA 3UAVA 4C6AA 5FNVF 1QS0B 3HCBA 1JU4A 3RVOA 3E01B 2DU8A 1LU9A 3E2PA 3AVPA 1L5WA 4JI5B 3MOZA 2EHDA 4Y0FA 4RWXA 2VG7A 1XTJA 1Y37A 5BQXA 1XJWA 2XSJB 4NU0A 3W63A 5K05A 5L95A 1BE0A 3O4VA 4JP8A 4KGZA 2DBBA 1VE3A 1BCSA 4X90A 1S1CA 4OYWA 3HZRA 3LYHA 1J8YF 5IK2D 2B3DA 4JLBA 1P1IA 3QVXA 1JPUA 2DSNA 4EECA 3RHZA 2UVPB 5DWQA 4IDKA 2VWHA 2DC1A 3K71B 3BGRB 2UVVA 2YUIA 3L79A 5LU8A 2JRCA 5KFWA 1R16A 2ETVA 1BQ3A 4XPZA 1HE3A 2VZLA 2X0FA 3PJ9A 1FDVA 4J0HA 3FDJA 1GQ2A 3G6KA 1G8PA 1VGVA 4HEA6 1SA0A 1PYSB 3L8CA 3ZZZA 1MNEA 2XNDA 4RHUA 3BWYA 3VAIA 1Y8QA 3RC1A 2YZGA 2WHPA 4QR2A 4M1WA 3WQPA 4IGEA 4M60A 2O0MA 3HY3A 1VIVA 3BHJA 1N0IA 1FRJA 3LECA 5IMSA 4WE1B 1EU1A 3K0CA 4Y2JA 1IK6A 1X19A 4KWEA 4S0MA 4P81A 3VZBA 2M32A 1JFRA 1JQEA 3NNAA 2BRLA 2H4HA 5HKLA 5JE8A 3M9MB 2LP4Y 3DTNA 5IC6A 4DYDA 5DTEA 5B1YA 1G4UR 1PDWA 1Y6QA 1KZ4A 1I3KA 3GR0A 1HDXA 1LFAA 2WPDD 4FW9A 5IDWA 1A5SB 3K9BA 5DDPC 1H8HA 3THOA 1FTSA 1M2VB 2MHCA 3U3ZA 3OIWA 1QRTA 3AB7A 2PD4A 3THXA 1LI7A 2AGOA 3EOAI 3ZC3A 1DDIA 2BUBA 2PR7A 4FE4A 1A9NB 4EKGA 2WW8A 4R3NA 1P6XA 5C51B 4E6PA 4RZIA 1MXFA 1V25A 2EEPA 1HLDA 3TRJA 2WDPA 4N77A 2DRAA 5C25A 1PJTA 3VQTA 3KCNA 5C1OA 4NA3A 3ZDZB 3IOEA 3Q40A 1U0HA 1B7GO 2F9MA 1KEUA 4KZKA 1GTZA 2QYGA 3MUEA 1R0LA 2FOIA 2EWVA 2XMRA 2FQQB 3S7ZA 5EX3A 4YAOA 4BZPA 3FUWA 3T5BA 1RK8A 2OXFA 3IOYA 3AVYA 1HZZC 1M1NA 3TJ8A 3SHVA 1UAAA 2ST1A 4OGLA 3T7EA 4DF3A 1JTEA 1RTKA 4J43A 2IRUA 4MIWA 1B4DA 2VOEA 2ZBEA 4I6AA 1NHWA 3QWFA 4PQFA 3UMCA 1TL7A 2O3JA 3PUZA 2YHUA 4DHEA 2FCAA 2BFMA 4QJ3A 1NKTA 4UU8A 1PO6A 5JSZA 2OCBA 3Q22A 4OI2A 3UO8B 4HYKA 2F9DA 2UXBF 1CJUC 1C0KA 2WM9B 1V8ZA 2A88A 2GOYA 4XSVA 2Q7DA 1MT0A 2BYTA 5T7BA 1H69A 3FJYA 4ER3A 3HO1A 1ONSA 1SK9A 3ZDXB 3FUXA 2O7SA 1E2UA 4RHCA 3NHRA 4MTLA 3LUDA 1J5EF 1GA4A 3GMDA 2C1EA 1BFUA 4FMCF 1NXPA 4P7JA 3QEOA 3AIMA 2RHLA 2JH8A 2QR5A 3FEYB 4DKJA 2YMLA 3AHIA 3NOQA 1MMNA 4OV6A 2O8NA 2C2GA 2PL9A 5KTYA 1LEOA 4MR8A 4B3OA 2IMOA 1FRZA 1V5VA 1B42A 4ZAGA 5C31A 3JQAB 2V3CC 3OF5A 3FY4A 4O5AA 5FD1A 4EYIB 3T4XA 1QRAA 1RTTA 4MGHA 3HJVA 4G37A 4F86A 3HLTA 2K7FA 2FXIA 1H3NA 2Q62A 1DRUA 2XMCA 4DLNA 1KYTA 1C3VA 3UK6A 1N5VA 3OO0A 4EVQA 1I51B 2DNMA 3GFTA 4RL6A 4QOJA 4BBPA 1MTZA 4B4OA 3OR2B 3Q0TA 4OHZA 2CUNA 4F1WA 4J8PA 4MA4A 4A8WA 1E32A 5A71A 5AM3A 1PSDA 2K4MA 3AUUA 2G5PA 2C58A 1FESA 1JP7A 4HHEA 3PX4A 4OLFA 2X6RA 4C4ZA 1I30A 1I7PA 1EE2A 2GO8A 1K4MA 2CQ0A 1IVSA 4R25A 3CZRA 4FXOA 1VL6A 1UF9A 1BKSB 3DL0A 5I7FA 2OBMA 4EK9A 5D6GA 1T5IA 4CUZA 3JAWB 1CQNA 3W5IA 2X0RA 1BW9A 1F38A 3I3OA 2R4UA 4ZI7B 3PKIA 3F7NA 3ICWA 3KE9A 1ZJ4A 2PYDA 1LTKA 3EPRA 3VISA 3O1HB 3D2LA 3U9LA 4PX3A 5B1SA 3IUBA 3N07A 2DCMA 2JGEA 2QTWA 3ETMA 2WNHA 1MHPA 2E44A 3V8PA 3FNNA 1I5OA 2A30A 4PXSA 4LFBJ 1C8LA 4HT5A 1FX2A 2G7ZA 3GLIB 2EJTA 3E2EA 2ISQA 3FMWA 4IG0A 2W2XA 4F4UA 3E0QA 2NU6B 5F1PA 2VPXA 4YUXA 5KTTA 3HBMA 3SSQA 1MX5A 4LI0A 4V38A 4BFLA 1WBBA 1HFEL 4PAAA 4RV5A 4IP0A 4OM8A 2RKIB 2C29D 2B92A 2ID8A 5J2MB 1OYOA 3SNKA 5JVHQ 4FHCA 2NTVA 4WBNB 2ASEA 2HKIA 1KP2A 4YK7A 2CZVC 4M7PA 3AVQA 5EZYA 4Q37A 2LBPA 3EG9B 3F0TA 2CSUA 2UYGA 3GJ0A 3ZGXA 1JK9B 3D7KA 1YG0A 4X61A 4DSJA 4IJQA 1EB9A 1RLIA 4BZWA 3CMES 5BPHA 4JI0J 4QUGA 4JSRA 2UXBB 3NBXX 3K9LA 4EHJA 5T41A 1IOVA 1J42A 5JVDA 1M2EA 4M5DA 1E5DA 4WZZA 2QUZA 4YRLA 1SUQA 3DLIA 5ALMA 3WJAA 2V5VA 2RDJA 4F3TA 4G01B 3DRPA 3KDPA 2JEZA 4DY4A 3ZYZA 5K99A 4PQGA 2CADA 3QLHB 4Z37A 2XCUA 3V7UA 1M5VC 1HPLA 2J6CA 2W6OA 3TS1A 4K7QA 1NJ8A 3T3OA 2K2QB 4IHQA 4V2IA 3GFRA 5IHXA 4K4VA 1HQKA 1NEEA 2WE7A 1REQB 2W6QA 2NU9B 5I8ZA 2XXBA 1I14A 4LNAA 4M83A 4LDAA 4C2BA 2RKBA 2FVYA 3ICEA 2XNDD 2IM2A 3CCFA 2W4IA 1LVGA 1A76A 2V58A 4JA0A 1KZ6A 3DTVA 3E2IA 5KOHA 1U28C 2YFKA 3E15A 1SV5A 4Q12A 3V4ZA 1KRXA 4JI4J 4LZOA 5FLYA 4YJFA 4AF6A 1HZZA 3O2QB 4URYR 2JIMA 1C0IA 1WEXA 3G3EA 4QYMA 1DY3A 1UBUS 1WE2A 1CY4A 1SCKA 5K9FA 2UU9J 2ZSUA 2RFLA 2GM9A 3W0LB 3INRA 2PWPA 3PPYA 1O6BA 4AO6A 4BMDA 2P2DA 4HFRA 5DNWA 3KQPA 4Z86A 3PFCA 2BOVA 3THYB 3AUKA 3EXEA 1DEAA 3LT1A 4ECWA 2QV6A 1JIVA 1P33A 3NCTA 2AD5A 1CJUA 3ESYA 3EZ6A 4F4ZA 2YYZA 5TB5A 3RS7A 3OHPA 4ZN3A 3T7CA 2C31A 5GJCA 5A6WA 1W4RA 4NBVA 2A1UA 2QQ0A 4MKHA 4BQIA 5LMUB 1N54B 1QQTA 6YASA 1Z6YA 1KVRA 3GCXP 5LOVA 4CLUA 4I55F 2J5KA 4FILA 5E2IA 2JEGA 3RR2A 5M7EA 4DB2A 5KYXB 2HCTA 2GHWA 3OFKA 3FMVA 3JYQA 4DSKA 5EMHA 3CVWA 1L8AA 4PXBA 3LGHA 1QR2A 5THKA 1DEHA 1EVQA 3FB4A 1ID8A 2ROGA 3OQ1A 1KFEB 1UJ5A 1BE8A 2XHZA 2QFIA 3QFRA 4DL6A 2H3HA 3PPWA 2R6AA 1I8TA 5F3ZA 3GIKA 5LIRA 4OHCA 1ZNZA 4EYQA 1S7CA 3ASVA 2ZUEA 3ZZPA 1VSUA 2IHTA 3U4HA 5KYGA 1U8UA 2AC4A 2XOXA 2P2CA 3OE4A 2WT9A 2VXOA 1FTYA 5HATA 2OAP1 4XGRA 2ZWAA 2B2NA 3E7PA 4DUPA 2XUGA 4QG7A 2HMIA 5FYQA 1WBJB 1QGZA 1JPJA 1DG1G 1VGRA 3H5UA 3DL4A 4LFCF 5ALKA 5C2CA 4Q82A 4XH9B 4JL6A 3RJMB 1EVJA 5LNK1 1ZQ1A 4HFJA 2QPOA 2QV0A 4KZPA 4RUAA 1S9HA 2I99A 4YN3B 3DLJA 2KHDA 3BQ0A 4GD3Q 4LV8B 4C6SA 4QDUA 2I4TA 1TTHB 2WWGA 3OOJA 3OEHA 4W5QA 5KJCA 3VU9A 3IWXA 1DAEA 4Q03A 3PIDA 1ES9A 4PX2A 5JY6A 4U6PA 5HA5A 1KOGA 2Q5OA 2QW0X 4DMFA 3ADPA 3L5KA 4MINA 3R3VA 1PAUB 1J33A 1SXJB 1X74A 3REQB 2X4GA 3IVXA 2HREA 4KIWA 5E6SA 1OMOA 1QMPA 4UAVA 3ZGYA 1YB4A 5IYZA 4JSTA 3WQBA 1DJNA 4CM4A 5I3CA 3P0EA 3OTWA 1P6TA 2GDJA 2HEGA 1QTNB 1BXGB 2X1FA 5HF8A 2F8MA 2REXB 3VAAA 1U6BA 3C6QA 1OAAA 1HTWA 5CT6A 3R7WB 5JXWA 4DR5J 4FCWA 3DWIA 4ERXA 4ZLJA 5JQGA 3MEDA 4DL0C 3M8SA 2LGJA 4RY8A 1PS9A 1N75A 3V3KA 1CQJB 3HJFA 1RLJA 1XA3A 5HVGA 4BFVA 3PFWO 4FDAA 4ZXPA 1X2BA 1U48A 4YAKA 1RTHA 2AR0A 2PEYA 3P4UB 2HAFA 1GOTA 1SVNA 3BN4A 2NT4A 4KOAA 1DTEA 2M52A 3NWPA 5KFDA 2J07A 2BE7A 3H86A 3E53A 2QN6B 4LRSB 4NNOA 1WG8A 3IHLA 1P72A 4B44A 2UZ1B 1CNMA 4XYMA 3RT9A 1P45A 1RQ2A 2KPOA 3CMQA 3ZHSA 3JATA 4E5SA 3MILA 4II7A 4C14A 1HOXA 1UDCA 4BMYA 4TTVA 3ZW8A 4C5BA 3T3DA 4WNIA 3L92A 4CYUA 4CM6A 4UM7A 4AY5A 3U7QB 2HHHF 2MGZA 1MVLA 2YFHA 3S40A 5KT7A 1NA5A 3GLTA 4YFYA 1SB6A 2NLOA 2C4WA 3TQRA 3NGDA 4OQPA 1KJNA 2KVQE 1TVMA 3M9LA 5E3JA 3U48A 5EJ6A 2FSPA 3VV2B 4FM9A 3B1VA 5F7OA 2OD6A 1ZGGA 3M49A 4FD2A 3BYRA 5FNVA 4F92B 1HNIB 4MKYA 5AM5A 2IH5A 1NAHA 3HD1A 1BXNA 1IZZA 3HJBA 3M6AA 4BP8A 1QK3A 4WY5A 5DM0A 5KFCA 1M8JA 3AF4A 3DDZX 3F9RA 1IUNA 4YJ2F 3C6XA 3OF3A 1M0TA 1IOZA 5THWA 1DZIA 1E9RA 5F9FA 3WRYA 1U1NA 4MWGA 3C98A 3MGGA 2E0IA 3SZUA 1CE8A 4QHTA 4WFBQ 1H2BA 2JFNA 1KQ3A 1X4FA 1UVMA 3UYLA 4HB3A 1OW3B 3HXOA 4DE5A 5HMXA 2YX4A 3I32A 2J3DA 4EK2A 4EBDA 1IBCA 5I9IA 2PWBA 3DE1X 4L3NA 2GR9A 1TT7A 2VC2B 4U8GA 2HKEA 1FNBA 2QTHA 4XWKA 2PK3A 3V2HA 2H6EA 3VU3A 2GPNA 4P58A 2QN1A 4MQFA 4LJAA 2QP9X 2GTPA 3RLIA 4H4CA 1DOZA 2B8EA 2ZVJA 4LYDA 1NPRA 4DPOA 1J0XO 3WQRA 1N5MA 3S29A 4LF5F 2HBRA 4JOUA 1S9GA 2O1SA 5FOVA 1Y6FA 4ZCKA 2CNOB 1K9SA 4D0SA 4QOFA 1Y3AA 3EMTA 2CXOA 2GZOA 5JNLA 3MMPA 5ILQA 3AUFA 2EHJA 1I51A 4E1AA 4BO2A 2DBVO 3WKAA 1KSGA 1IJFB 3AJ2A 2XX3A 4MHOA 3R6LB 1EFDN 1YIDA 1RXOB 1NP7A 4BC7A 3C7CB 5JBQA 2JL9A 2FPXA 4O3FA 5CDGA 1WKJA 3MM7A 3WNDA 4CM9A 5BUCA 4B8ZA 2ADOA 3GDWA 5IT0A 4ZVPA 2Q9AA 2BONA 3QE4A 2B0GA 2DM6A 2FQWA 1JIHA 2P9CA 2ET6A 4PGGA 3C0KA 3DLGB 5HANA 2F8TA 4QXQA 3JSRA 1SZPA 2PUFA 3QI2A 4HVZA 1JJ2R 1YS7A 1YL7A 2ZUAA 2FW7A 4Y00A 3NBZC 1E7QA 1OXTA 5JZSA 3K5LA 1R0XA 1GZ3A 5DRYA 3CNNA 2GD2A 3FMIA 5B58C 1YHQS 3T7TA 2H0QA 1CF9A 1RWXB 3L8HA 3OJCA 1ZC4A 3LRPA 1AKTA 4D6XA 2HDHA 2EZ9A 3B1XA 3ICVA 4PAMA 4CTAB 2HHHB 4IQXA 3D3BJ 4M98A 4AYXA 3PITA 1FA0A 2BAGA 1JHVA 3RR8A 5LQNA 2NU6A 3OC0A 4XWAA 5HROB 2WSBA 2WR8A 1W4LA 2EQAA 1PKUA 4Q5IA 3IVAA 3PC2A 2RKIA 4WZMA 2RGWA 3VZRA 2PS1A 3OLXA 1U0NA 2AOUB 3TAMB 3PR4A 1O54A 1E9BA 4CMIB 5KJEA 3DMPA 3MWEB 4TKVB 1I94F 2VTVA 2BE9B 3JZAA 3BTVA 1M6NA 4NXMJ 3SMVA 3BB1A 2R85A 3NAMA 4QPDA 4C7XA 2Y1FA 5B09A 3OCZA 3OKFA 4YWJA 4DL9A 2H5JB 3I6PA 1E94E 4BVGA 2ISSD 4QR0A 2VHYA 1THGA 3KKQA 1OE0A 3WE7A 3EARA 2B34A 1VQMS 4XFDA 4OOEA 4E07A 1UJNA 1T9TA 1ZUHA 4E32A 3TUPA 1AUXA 3L0OA 2DRDA 1LWOA 4R2MA 4L75A 1DVRA 2Z9BA 3HB5X 3M2PA 2NU8A 3QLUC 4EJMA 1FS5A 3I2YX 4JYAF 1T24A 4BO7A 5I7RA 5JD3A 4GVPA 2B37A 1O5JA 1T3ZA 3UD4P 2F1KA 2QEQA 1L3BA 3NHSA 1PP4A 1KJ8A 1FRIA 3I45A 1US8B 4MRRA 1H2TZ 2WU1A 4EW1A 5TQJA 4LGMA 1FE0A 2NSCA 1C4CA 2NU9A 3P9QA 4OATA 3ZE0B 4NCGA 1D6SA 4TT8A 3S2SA 2UAGA 2WU0A 1QLWA 3AYZB 4OY3A 4UDNA 5CA1F 5B2EA 3TNFA 1PBAA 2MYNA 3HZOA 4LDQA 3TMYA 2EP7A 1PJ8A 1ZH5A 3LX4A 5LJLA 4WKRA 2CVEA 3PQDA 2HGLA 3J7YI 3RBAA 2WTBA 2HQGA 2P5TB 2CPHA 3T41A 1M10A 1NW6A 2AYZA 3GJTA 4D82A 3VSAA 1PBTA 1NE2A 4YR9A 2C2BA 1RC8A 4RFLA 1KH1A 1P0QA 5ELXA 3GOHA 3BGLA 2F40A 1G3MA 3EGIA 5I5EA 1Y7PA 1ZMBA 2GILA 1IMJA 4UTVA 2KI5A 4W9MC 3TRDA 3AM1A 1T9VA 3LC0A 3KQTA 1XMQF 1UVLA 1NU8A 4X1KB 3ZJUA 3T3PB 1YSJA 1HWLA 4HF7A 2CNBA 5BN4B 3FDXA 3IMGA 3Q83A 5KFAA 1WUIS 2E5IA 1A72A 1EWRA 2PEZA 3AIOA 2CPXA 3KYBA 2C3UA 1RW4A 1HETA 2OGWA 5LMNB 1VA4A 2HWUA 5AI8A 3GQBB 1C7FA 1D2EA 1R0BA 5AOBA 1Q0QA 5JARA 4H59A 4H54A 2PGLA 5CCEA 3SQOA 1JBQA 4MJLA 4HVLA 4IHAA 1GFIA 4NHEA 5JWHA 5IVDA 5J9FA 2WABA 2OECA 1M0SA 3FBFA 1X86B 2E4UA 3ZY5A 2O2SA 3I8XA 4NPHA 4I67A 5KFUA 1QX4A 4FBTA 3QXCA 4K0KF 4C8LA 2CFSA 3FK4A 1WCWA 3EUWA 1PQYA 2EDAA 4PX9A 4C89A 2CXQA 4MV1A 3KLHB 1KU0A 2W4CA 3BH7B 4J4HA 2G7MC 1QP7A 1FMFA 1RI3A 1ZJ5A 5IBRA 1F3VA 3CO0S 3ZWWA 3QKTA 2QA4S 3H16A 5DTIA 3M8WA 3Q2TC 4R1OA 3E6AA 3NGKA 5H0IA 1U2SA 2NN3C 4AJ9A 1GZ4A 2YFQA 1TF5A 1KJQA 1I94B 2P4HX 2DLDA 1DKOA 5KKNB 1DX4A 2Q41A 4XJTA 3D1QA 4PYJA 3CKKA 4NP6A 2D13A 2PCJA 2CHQA 2VRCD 4PEOA 3WX4A 5ED0A 6REQA 3LALA 5DDOC 3O4FA 2ZWIA 3FKQA 2PMDA 1DEOA 2QHXA 4JWTA 1U6KA 2NU7A 1QVGR 1TCVA 4C0XA 3MERA 2XGQA 5A0YA 3TAHA 3H18A 2A9OA 3LP8A 2LECA 3KNAA 3OZBA 1WIWA 2DPMA 3KYDB 4ZVRB 1ZO8A 1RYFA 5EWLA 4OJTA 3KBOA 4HY3A 4K0RA 2C2OA 3VKUA 4N0PA 3ZWDA 3OPYA