1XTZA

Crystal structure of the s. cerevisiae d-ribose-5-phosphate isomerase: comparison with the archeal and bacterial enzymes
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
246
structure length
246
Chain Sequence
b'EDAKRAAAYRAVDENLKFDDHKIIGIGSGSTVVYVAERIGQYLHDPKFYEVASKFICIPTGFQSRNLILDNKLQLGSIEQYPRIDIAFDGADEVDENLQLIKGGGACLFQEKLVSTSAKTFIVVADSRKKSPKHLGKNWRQGVPIEIVPSSYVRVKNDLLEQLHAEKVDIRQGGSAKAGPVVTDNNNFIIDADFGEISDPRKLHREIKLLVGVVETGLFIDNASKAYFGNSDGSVEVTEKHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-5-phosphate isomerase
molecule tags Isomerase
source organism Saccharomyces cerevisiae
publication title Crystal structure of the S. cerevisiae D-ribose-5-phosphate isomerase: comparison with the archaeal and bacterial enzymes
pubmed doi rcsb
total genus 77
structure length 246
sequence length 246
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2004-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xtzA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xtzA01
1FQOA 2P9EA 3TUIC 2RQMA 1PBTA 5IT4A 2BKXA 4NMLA 2RI0A 4L4ZA 2F8MA 2QMWA 2QRRA 1DEAA 3EB9A 2RE1A 3OBIA 3LOUA 4GMKA 1FSFA 3HN6A 1LK7A 3AAWB 3TUZC 4L5JA 1PSDA 1ZPVA 4OQPA 4R9NA 1Y89A 1UJ6A 2LQJA 5IS2A 2JOQA 1XTZA 2QMXA 3EFBA 2WU1A 2P9CA 1M0SA 1NE7A 3ENVA 3S1TA 3BXFA 1SC6A 3BXHA 3LWDA 1O8BA 3NRBA 3AB2B 2ZHOA 3LUYA 3KV1A 3ENQA 3CSSA 1FRZA 3NZEA 3CEDA 4TM8A 4OQQA 3ICOA 2P9GA 4GO7X 5JJBA 3MAHA 3P96A 1YBAA 3OC6A 3HHEA 1HOTA 2GNPA 2W48A 3IXQA 1JT9A 2FGCA 3E7FA 3O1LA 3OFFA 1LKZA 3E15A 3N0VA 3NWPA 4R7TA 2CDQA 3OFHA 3KWMA 3L7OA 2R5FA 3U7JA 4PWUA 3DC2A 1Y7PA 2LVWA 2DT9A 2MDAA 1LK5A 2F1FA 4X84A 3K5PA 1UJ4A 2OKGA 3TX2A 2RQKA 5FIIA 3TUJC 1FS5A 3IBWA 2DTJA 2BKVA 2J0WA 1YGYA 4IO1A 3BXGA 4LUBA 3OFEA 3UW1A 2KO1A 3DDNA 1RWUA 4L5IA 3AB4B 4L50A 2J0XA 3MWBA 2RI1A 4L4YA 4GO1A 4M8LA 5T41A 1FS6A 2JHEA 4GO5X 3DHXA 4L51A 2O0MA 5IT0A 2J0EA 1CD5A 5HJ5A 3ENWA 3MTJA 3OFGA 3LHIA 2NYIA 3W7BA 2I9SA 1VL1A 1U8SA 1HORA 3BXEA 2H9ZA 3CH7A 2PA3A 2PC6A 1UJ5A 2QSWA 1KS2A 3DHWC 4TM7A
chains in the Genus database with same CATH superfamily
5AP9A 3HD2A 2AOTB 3CVJA 4MHOA 3QUBA 4TMVA 1B93A 4PLVA 4ZCSA 4WBNB 4BWYA 2ATLA 1DIGA 5KOWA 2WU3A 1V43A 2E4VA 1XTZA 1J5OB 1FMCA 4FINA 2JJQA 3OP1A 3PEEA 3C3LA 1QAJA 1H0KA 2FEWB 5KWVA 5AI5A 1VXRA 2BW7A 2VTKA 3DAPA 1F9FA 2FFBA 3HKDB 2OBYA 4K1LA 4EW6A 4Q82A 1XNRF 7REQA 2NUTA 2H4JA 2BGRA 3L7OA 3RUEA 3BXXA 1XVTA 2BOAA 3T4EA 1DXQA 1I5OB 4GKJF 4QXOA 3MJFA 3GA7A 3PTAA 4R8UA 2KI5A 1GILA 2O07A 4YPOA 4JWTA 4UOGA 1V7PC 1WXHA 2WM8A 1C3VA 5AXMA 3SLKA 1D5WA 2CJAA 4W5OA 1FU8A 1RWNB 1R4MA 5F8JA 3BF8A 1SOAA 3K8WA 3RU9A 4OF4A 1N2JA 4DV2B 4EBDA 4BZZA 4IDKB 2BKXA 1XP5A 3UVEA 3L0CA 5BT9A 2P4UA 2CJWB 3BA1A 3U02A 4F86A 2PUCA 4B3GA 2JOQA 4ZC1A 3K5NA 4D3YA 2DKNA 4UDNA 1X8DA 2Q6OA 3CUEF 3BK1A 2LW7A 1XLWA 2I9PA 4LV5B 3FLBA 3HDJA 3KHKA 2X8BA 2Y8EA 1NG9A 1V3QE 4GFDA 2QR2A 4BE7B 3DS8A 4E14A 4PTZA 4L75A 2IYUA 4CIXA 4UMEA 1C8BA 2IXAA 5KNDA 1E6YA 5DYIA 3WISA 3IP5A 1DJPA 2DNNA 1MO2A 1EAMA 5EWEA 1CJTC 3HO8A 4ZJOA 2RGXA 3RJTA 4G37A 2AUNA 3THXA 2CPDA 3H5IA 4YI5A 5AXAA 2DXDA 3K71B 3DP7A 4N9QA 1PYSB 3MQ2A 3JY6A 1F5BA 5DH9A 2HPHA 4WZAA 2GTIA 2YNIA 5ALVA 4EEYA 2V7QD 4GZ5A 4ANCA 1STOA 5GPBA 2RILA 1LPBB 3PV8A 1VI5A 4UBIA 5A3RA 4O3MA 1XKTA 3KAQA 2GEJA 1VLQA 3LLSA 2IV2X 4Z9FA 3DQPA 1TKZB 5I3CA 4BNFA 3GGJA 1NHKL 4R41A 1XMOF 4KIUA 5DW3A 4BEWA 5EIHA 4I7FB 2G80A 2WHXA 3OVMA 3QHPA 5CM9C 3IRXB 3TJ8A 1BVHA 2MMCA 1WF1A 1FTCA 1MUUA 1RTIB 5HBGA 4GVLA 5I9SA 5I01A 2XZDA 3HZZA 5DTQA 3ZWNA 1VMEA 4BV3A 1JDBB 3BSWA 1MENA 3LS2A 2WD7B 4IHJF 1T10A 1BFDA 3NHUA 3QG1A 2HFUA 5J4YA 4RD1A 3FYUC 1T29A 3NHJA 3H6GA 1LLQA 1HLGA 2JLQA 3FHOA 3I9FA 1E79D 2BFOA 2P0EA 4R01A 1NVGA 1PJ3A 1FX0A 2IYPA 4D0SA 5CFQA 3WL7A 3K8VA 1YZYA 3T3OA 3MCSA 1Z6ZA 2M88A 1YJXA 4MCJA 3TRJA 5CLGA 3K6JA 3TP2A 4UHHA 3GAZA 5BMVA 1EU1A 4P72A 3F98A 4E5DA 4WGFA 4TQRA 2AYEA 3ZGLA 4X85A 3VR3A 2Y2VA 5J59A 4A9AA 3G8YA 3F9CA 2NXCA 1QH0A 2B1RA 4R1NA 2ZIXA 3GCXP 1G21E 5BY2A 2JAHA 1EETA 3WGQA 1NVMB 2YV3A 1CBKA 2TRSB 3GLHA 1A88A 3Q85A 5EJFA 1Y3BE 2D2FA 4LMBA 3DRXA 2WIAA 4B0PA 3DYIA 5CXQA 3R8FA 2Q5CA 2RBEA 3MTQA 1X70A 3N0RA 4FHGA 1XB2A 2PRZA 3IA7A 5KNCH 2R7KA 1ZPDA 3HCRA 1ENPA 2H2IA 2HG4A 3L7LA 1QZ3A 3CUWA 3PJEA 3WYGA 3MUFA 5KG0A 2H1FA 1B73A 5IZCA 2C5LA 4TYYA 1S1CA 4NDAA 1JALA 1G8SA 1W8DA 3D6FB 2WQ7A 5JCOC 2OORC 1E0SA 3I2KA 2M1XA 3M83A 1QV6A 3CG0A 4O4JA 3O7MA 4U3JA 1N5SA 1DXOA 2IUYA 3OQIA 4KT0C 4LE1A 2J7PD 4IIEA 4HNVA 3SJZA 1LDBA 1AGPA 4PM4A 4BGUA 4EPYA 3L8MA 2NUAA 5I48A 2ID4A 4AQYJ 2BHSA 2Q6VA 1BJKA 2I2DA 4B02A 2G1UA 2B82A 2JBAB 1E66A 4ZPVR 5HCUA 2BSXA 4JJIA 1S48A 2IITA 1URNA 1I94F 1SIWB 4N41A 2QE7A 2C9OA 4WOKA 4NP6A 2MKCA 3V1TC 1H2UX 1DOAA 4GO1A 4LYAA 2OEPA 6PFKA 2CL7X 5BN4B 4WXHA 5B1SA 5IX8A 2IIVA 3W2IA 1NDHA 2DH8A 1R0RE 4BVLA 1N2EA 5CP8A 2AW0A 2GBLC 3UV6A 3VZSA 3AVOA 2B6AA 3CMCO 3MJHA 3CUTA 5HCNA 2BJDA 3H13A 1PSWA 1YSJA 1KQSR 4NFLA 3H2GA 3II6X 4F46A 4QDXA 4HAZA 3GPIA 3KTOA 4RBTA 5HN0A 2FGOA 1R4MB 2HWWA 1KZ1A 1M7HA 1SRQA 1ZU4A 2CEAA 4HDAA 4FFMA 4MQ5A 4RZUA 3G2KA 4D9JA 4CTOA 4Y1RA 4NY1A 3WWEA 3AQIA 2Y1WA 2BEUA 5ALSA 5JI2E 4DV6B 5I5EA 2QN8A 1L8QA 1JQ3A 5BURA 3GJ3A 5T7LB 3DV9A 1TCUA 1D0SA 1N0IA 4IIJF 1NASA 1NZJA 1SVWA 2AR9A 3F3MA 5EQFA 1YB2A 3P9CA 4JCCA 2MJUA 3OVBA 1IBRA 3FG9A 3RRZA 4MGKR 2GMWA 3C19A 5DXFA 1Q74A 3NRCA 1N0HA 1XBWA 2W0SA 3ELBA 3Q5GA 1MLAA 1JLKA 4UZFA 3MEEA 1BMFA 1QHXA 3K6RA 1J0EA 1A4XA 4C7KA 1T11A 2JCGA 1P1RA 1ILEA 1COZA 1XJCA 1CUYA 3HGTA 1WQ3A 2BZ0A 5IJWA 2R8KA 2VF7A 3LY7A 3CVVA 2B9VA 1GZDA 2L41A 4RHUA 2Z57A 2ZBIA 3KZXA 3RNOA 4HHJA 3P27A 1N8TA 1JL3A 5IAKA 3HWX1 3JWGA 2E7ZA 4HGNA 2QZ4A 2IHR1 2GRJA 4UOQA 5KT5A 3KKKA 2J45A 4CT9A 2IUEA 3HA2A 4H7EA 5DEOA 3TW0A 1F60A 3HKCB 3HY3A 1VRWA 5KJCA 2C5HA 3VU1A 4JI6F 3GFYA 1HOXA 3IMCA 3N0VA 1O96A 3GB9A 4ONEA 4L3VA 4JYMA 3TKYA 5BQFA 5M2PA 3J80U 2BFPA 2M2BA 2D62A 3QKRB 1VBKA 1DTQA 3SMVA 3N70A 3IKMB 3NDIA 3FMIA 2OPQA 1C2YA 1SVMA 1O94D 4CR8A 1L5UA 4LFBJ 2VEOA 1QKJA 1THMA 4ECQA 1DC7A 3BICA 1TLLA 1VQ1A 2LDBA 1B8PA 4Q0BA 5AKEA 1GX5A 4M7OA 2VR1A 3K09C 2YWGA 5DCUA 2RH5A 2CNOB 1C0TA 2GAAA 3FUCA 4PXSA 1P0FA 4KK3A 4NU6A 1JR3A 3ISND 1R5OA 2A5FA 4KQEA 2IVYA 1D1QA 3OEWA 3H3FA 3S81A 1RKJA 1B3TA 4EVRA 3BORA 2R7OA 3R7NB 5AHOA 5CPFA 3DV0B 1JFLA 4ZT3A 4R1OA 1DPGA 4ZJLA 3D2WA 4MPTA 4CH0S 1TKZA 3NBMA 1Y42X 1WO8A 1GD1O 3MR2A 3R3VA 5AM1A 1PYDA 5IZ4A 3D8SA 2FPLA 5C2CA 2J59A 2J1LA 1C9NA 3H25A 1RLMA 3PNMA 4XIIA 1V96A 5LL6d 3MA0A 3PQCA 2Z58B 1EE2A 1QIMA 1D7OA 4UOCA 1ZK3A 1SKUA 3UPDA 1T9HA 2ZB4A 5ALGA 3LHSA 2Y1KA 4PLGA 4KYVA 4C3LA 5ALHA 2NNWB 4RWEA 4MUXA 1SJ1A 3VKWA 3L1KA 1S1TB 2RAPA 2W7OA 1ZS6A 4J1TA 2ASLA 1QOPB 2OENG 4OI2A 3Q11A 2DBYA 3ZEAA 1RC8A 1HNWF 2WONA 1NULA 2VPXA 2HHHJ 1J2TA 1T1SA 5GV8A 1U8FO 4OQFA 3CLHA 3Q0AA 1KSGA 5DNUA 2HDHA 4HAOA 1X3SA 1CLFA 3OL9A 5KZMB 1Y9OA 3DV2A 2B8JA 2FZEA 3LT2A 2YY5A 5I9IA 4RF2A 2GEKA 4JEUA 4Q45A 4Y2HA 1S6YA 1FDIA 1Z5NA 3PE4A 1XD8A 5DASA 3W7AA 3BSAA 2JEFA 2Q3FA 5KQRA 1ZM9A 1AX9A 4AMVA 4DF8A 3FHLA 4Q9IA 1SXJD 3KEOA 3VZBA 3SHVA 1ZG3A 2ZR0A 1YLXA 2NYAA 2QL6A 3Q7QA 3QENA 4DV0J 3BH6A 1ZGCA 3EXIB 3F49S 4YUXA 1NXWA 5CDFA 1TPZA 5D15A 1E7WA 1GAEO 4MV5A 4RA6B 1HDXA 3KNZA 4X64B 1F6BA 3CF4A 1W87A 3FCWA 1WEKA 5B30A 3Q22A 2F4VB 4MEJA 4CM9D 3NR2A 4A0SA 1WKLA 3BMXA 3C7KA 5CG1A 1ZN9A 1GPAA 3KUEA 4B2YA 2I03A 2C97A 5LMZA 4K3UA 5ICSA 3PHCA 4H08A 3EDQB 1DC8A 3PJWA 2YZ7A 3R1HA 2LXFA 3FZBA 5EL0A 2ZPAA 4IXTA 2G5TA 5DLYA 2NZUG 1M5VC 4BYMA 3SKVA 4DWJA 2OBNA 4KSYA 4MCHA 1W73A 3INGA 4J0GA 1OFHA 5GJCA 1FRNA 1H2ZA 1F4PA 1YR9A 3V48A 4YHHF 1ADYA 5BRJA 4YB6A 2QZZA 5JSQA 3RFCA 3F2VA 1BMTA 1WCIB 1Z34A 1Z7EA 4WZ6A 4LOKA 1WUKS 1X4AA 3E9EA 1Z4LA 4YJGB 4RD2A 2JSXA 3M89A 3DEKA 3S1AB 4JBYA 4RTLA 2VTBB 2QLFB 1JDVA 3QXJA 4A91A 4EZBA 2BDTA 4WFQA 3A1NA 3NHLA 3QLTA 3FWNA 1UJMA 4MPJA 2IHYA 8ATCB 1LNSA 3MB8A 4A0FA 4GGMX 2JFWA 3BXHA 4HH3C 4Z3DA 3Q2SC 4DNQA 2DRBA 4LRBA 2RHQB 2CNBA 2DD8S 5JJBA 2GUGA 1T6ZA 3WB2A 4UQPA 4JBIA 7ABPA 3K30A 3UDVA 3C4VA 5DT9A 2MZSA 2W4PA 4J6FA 3CCZA 2W8KA 1N33J 4MFBA 4WL0A 5FOUA 2ODAA 5KSZA 2YXDA 3EIWA 4PX5A 2PX3A 2XVXA 2OHDA 1CJKA 4US2R 2PN1A 2CQIA 1M9NA 3V8VA 3I92A 3NV9A 2PMZD 3UMGA 1JNYA 4ECXA 3N2KB 5HW0A 3BBPA 3ZK7A 4Y2CA 5DBIA 1PIEA 3LLMA 2D8AA 3IDQA 4I9NA 1YBHA 4CU5A 4HZUB 1MOQA 4B3TJ 1RWBA 3PJDA 2XUPA 2QMWA 3OBBA 3QT7A 1F48A 1JYFA 2HWIA 3EIQA 9LDTA 1VYUA 1ID8A 4QDOA 2CNLA 2A0KA 4KQJA 4C43A 3DT8A 2YKOA 3QBCA 3BREA 5BN4A 1C1YA 1KDZA 3LA8A 2XMMA 1V95A 2Q2WA 1OH7A 4ENWA 3K0HA 3RSOA 3I01A 2HMVA 1S77D 1W6RA 1IE3A 1XA4A 1ZICA 2C58A 1ECGA 2FW0A 4MRRA 3M6IA 5J2NA 1W4RA 5DGTA 3TD6A 4MS3A 1T8WA 2BFBB 5L1KA 3TAPA 4GIBA 4GYKA 3HHDA 4ZJZA 4RMNA 2IYRA 2M8DB 2P6TA 2BJ3A 1RW4A 4IHQA 1ZOTA 4CKZA 2EW1A 2E5HA 1NBWB 4BDPA 1A5ZA 2G17A 2CJYB 4B9TA 3TECE 3NCHA 3PX7A 5IBPA 2Q28A 1NW3A 1T94A 1VDZA 4LJKA 3KLIB 4BJHB 1P7PA 3MBOA 4X44A 4L8GA 2W83A 4XWAA 1Z18A 2WBLC 2J9EA 1J7JA 1X80A 3AR5A 3TLZA 1FT8A 1DB3A 4B6PA 2A5GA 2RCYA 4JSRA 4QATA 1PT5A 4JLDA 4NFHA 4DT1A 3D31A 3BTUA 4PYLA 1L7AA 3WWZA 3C6TA 2A67A 3RANA 2JL1A 1UEUA 4Z3KA 1KRWA 5COAA 1UEIA 2HA2A 2JIZD 4PO8A 1P4HA 2MQQA 2IV7A 5HVGA 4BX8A 2WLTA 5DOVA 4YP3A 2YFYA 3AO0B 2H5IA 2VYCA 3HHNB 1VXOA 1N33F 5H0IA 2WSIA 1NBME 3FKSA 3GT0A 2ZR9A 4YT4A 4LXHA 5GADI 1E9EA 4JLUA 1LB1B 2DECA 3OFGA 4WFBQ 1KP9A 4Z5XA 3H5LA 3T3FA 5BXIA 1N32J 2I8LA 5AW5A 2EG5A 3T7TA 3UMYA 4RY8A 1PDOA 4PO3X 3ILIA 1ZTWA 3C7DB 1K6JA 1X4BA 4E8UA 4C04A 3S1LA 2C4UA 1XRLA 4XR9A 4YO8A 3LW8A 3SEAA 1SZJG 4X93A 1LXJA 2YY7A 4MQ6A 1X4EA 4ZODA 3C4QA 3SFVA 1WUJS 5FD8A 4QQBA 4UHBA 3R5FA 1I0LA 4DMHA 3GJTB 3LQRA 2QW8A 2EFGA 2FE1A 2Z30A 2B51A 2IYSA 1YD7A 4CLPA 2HDWA 1O51A 1NDQA 1Y1QA 3KWMA 2HF8A 4IAOA 3Q8QB 3MTKA 4ZZ0A 3CF5Q 5FUMA 3X44A 5DMHA 3K5PA 2NU7A 2IUFA 1XZGA 4P0PB 3ECCA 2DTXA 3P94A 3HUTA 2GVDC 1IJKA 1HKHA 1NF2A 1A7KA 1HO3A 4L50A 1LEOA 2MSDB 1RFGE 1YCFA 5FBRB 1DC6A 3WX8A 2REOA 1ZM2A 2OFGX 4X4TA 5U1PA 2E3JA 4GXNA 4BO0A 1JX6A 1EFCA 5J5CA 3X1YA 1SCBA 4BFSA 2FPGA 3TA0A 4CCAA 3Q8SB 3KZNA 5EUMA 5EE9A 1HFWA 4TM7A 1GXSB 3ADBA 5FBKA 4GLJA 3IX7A 3PF8A 5CVEA 2H65B 6LDHA 3MJDA 4IXMA 4QUIA 3IOBA 4Z51A 5B4VA 3RVKA 4S0ZA 1N6OA 2IY8A 1NAQA 5JAQA 1VCIA 4TQGA 1F06A 2HPUA 3BN3A 1SUFA 1T3LA 2P6PA 2HVEA 3GIDA 4BXOB 1WZEA 4KVFA 4MQEA 2ZYTX 3LC2O 4RWXA 1SVKA 4J0JA 1XCLA 4I68A 3KL4A 4UTRA 4TY8A 1OPIA 5AJUA 1UINA 4CIWA 3MPWA 4ENOA 3P32A 4QWAA 5EMMA 3SYNA 2Y0CA 2VBFA 5D4OA 1PU2A 5ILQA 4OLHA 3WKDA 1KEVA 4JHXA 1B1CA 2VICA 2AJCA 3WGGA 1NRWA 1N5DA 3A6GA 4R0JA 3SWWA 2BE9A 4KXXA 3EE6A 5LIRA 2AJ0A 1P1HA 2ZRJA 3RE1A 4ZVGA 3HN7A 4R5PB 2ZTHA 4DPOA 3MGJA 4O4RA 2RRBA 3SZ3A 1SUPA 4I66A 4ZFNA 2ZIUB 3DOIA 2C5AA 4UDOA 2N3ZA 4NENB 5EWJA 2LUOA 1DXYA 1TC1A 4HAXA 3AUAA 5EWMA 4DLZA 2Q8QA 4V0MA 5LBUA 1AVTA 1LPAB 4O2RA 2C2GA 2FC8A 2J9XB 1ULBA 5KTOA 1VHQA 4BNDB 1YDGA 4L5CA 3WWYA 4F4AA 1Y5NA 5DG7A 2RJOA 1T3GA 5HKBA 4ROTA 2JLWA 3I5YA 1Q0PA 1FU7A 3D9QX 3VZQA 3CA8A 1U4OA 4EG5A 4M9QA 4ZI7A 1M34E 3UK1A 3BMOB 2IS4A 4R69A 4LJAA 4MUFA 4QOHA 5BSUA 2HHLA 1VOMA 5CM8B 3WGKA 3WL8A 2EFVA 3E2MA 4QASA 4A1OA 2PWBA 2V7UA 3VNVA 3G9UA 5EN4A 2V8HA 2NSCA 3H5UA 3ZVNA 3K0AB 3RUFA 5IZHA 4NFYA 3T5PA 2H4ZA 5M7EA 1NQAO 3Q2OA 1Q0QA 4YLYA 3KKNA 1G7TA 5B7GA 1LOUA 1GAOA 5BVHA 4DUGA 1W52X 1PZHA 2P3SA 2JFKA 2V4UA 1GZHB 1H0RA 4ENTA 3WL3A 2ORIA 2DH5A 1P2GA 3DVAA 2VXCA 2I3DA 4P86A 2RB7A 2WLSA 2GCGA 2VDOB 4HLCA 4MR7B 3LWLA 2VP0A 4Y2XA 1SUWA 1G7RA 4C7VA 3F9IA 1TVKA 5HDQA 1Y5IA 1SUDA 2ZAMA 4ZPDA 4H7KA 1RAGA 2HLNA 4U7UK 3LUDA 1CY0A 1ODLA 4UZBA 2CLDX 1KJQA 1ZMTA 1U2PA 1ZR4A 2A5DA 2W90A 2CQ0A 4X65J 2QRLA 3T7AA 5LOVF 1CX9B 2MKIA 3ZDFA 4XLTA 1AHNA 2GMLA 3RT9A 2IVZA 4MQLA 4Y3UA 3WOVA 5CVTA 4PQRA 1OI3A 1PYOA 1ZI6A 1CJVA 4AQ7A 2RHSB 4PX2A 3EW7A 1LTKA 2XCTB 2ZYUX 1OAAA 3W2GA 1H2VZ 1G3RA 2XY4A 1NCLA 1E7QA 2A9PA 3VVMA 3U61B 1WG5A 2EFPA 2BKPA 2PKEA 1GFZA 2XB2D 5D3GB 1RLCL 4PG8A 5GWXA 3WGJA 1X1RA 5KFAA 2ZRKA 2UVDA 3GZTB 3G85A 5E7OB 4NABA 5JCJA 2G70A 2C00A 2C2ZB 1AJEA 4PC6A 1PGQA 2EGGA 4DABA 1LBQA 2MHCA 4DBZA 1T26A 2YW2A 3ENVA 3BEDA 4LR8A 4QYXA 4WTOA 2CLOB 3IPLA 1FX1A 3N6VA 4FW8A 5T7BA 3P52A 2OXRA 4YV0A 2C2MA 5B1DA 1EZZA 3G5AA 5ICEA 4QXQA 3IXQA 4DWVA 2ZDGA 3B89A 1H9BA 1JI0A 2OCGA 2AC4A 1TIKA 3B12A 4WKNA 2XKAA 4ZYYA 2ZU0C 2XQVA 2UXDB 2OECA 5IDWA 3LYUA 4F04B 3TG8A 3EDOA 5M04A 3PCRB 3PGVA 2R00C 2C61A 3D0GE 3ILYA 3AT1B 1MV5A 3IS9A 3L0IB 2PJUA 3NG1A 4Y9RA 2B6HA 4F4WA 3K4HA 1HY3A 3K16A 4Z3OA 2YKNB 3HS3A 5JTUA 1PUXA 5KVQA 2KWIA 5TQVA 1TUIA 3QGMA 1SUAA 1EUQA 2AUMA 2JLXA 4OGLA 2C2XA 4OJNA 2QYOA 4Q21A 1ZA2B 5D3MA 3GLIB 1K0FA 4ELTA 5CITA 5LQSA 2B9YA 4N01A 2VCEA 4E5YA 4K88A 1L7XA 4D92A 2LIVA 4KXFB 1TKAA 1YQHA 1G9TA 1JIUA 2YS6A 4EYHB 1RQPA 3VQTA 3PNOA 3KKFA 4OSEA 4Y9UA 1ZCFA 4J7XA 2RU3A 5IHXA 1Y63A 2RD5C 1Q0UA 3G89A 3D0IE 1YTYA 2D2EA 2LVWA 2JZ5A 3E23A 2QWXA 5EGNA 1UPCA 3KVRA 4DDUA 1FS5A 2WNHA 4KFBB 1S02A 1YJCA 2OQ2A 2BRUC 3OE7A 5AW2A 4GMFA 1O7JA 3W2TA 2YPZA 4TXNA 4I6WA 1P1TA 5JS8A 4FPXA 3H83A 1KO5A 4C0BA 1Y0HA 2FMHA 2ZWMA 3KJQB 1FBNA 1DPFA 4EB6B 3I9OA 4YDRA 1YVPA 4LVUA 3U3ZA 1GNQA 1Z2EA 1UT5A 4HB2A 3HKWA 3SPXA 1HLFA 3N9UC 4TKTA 2O66A 4JYZA 4Q34A 4CW7A 1PGPA 3M3DA 1T02A 3UWTA 4ZXFA 3WA7A 3EG9B 1FP7A 3IVGA 3DI6A 1LFWA 1KSPA 3OUUA 1D2NA 5BXQC 3FOBA 4OHPA 2HJ9A 2J67A 1ZH5A 4P31A 1PJSA 1TUGA 1BEEA 1EP4B 5AOVA 1ZH0A 2QI9C 2WFAA 4M89A 3LV8A 1FKOB 5BN3A 5AQEA 1QFSA 3S29A 1EPUA 1VRTB 1MX1A 3EWGA 2VB6A 5JVGQ 3TR0A 1OLUB 3FVQA 1USWA 2EW9A 1DRZA 2E1MC 4P52A 4CT8A 3FTFA 4CLLA 1XXHE 1N6LA 3L79A 4YMTA 2WUFA 1JXQA 3PR4A 2H1OA 5ALRA 3WFJA 3AD8C 3D28A 3R09A 5JCXA 4RLHA 4B3MB 3M6VA 1JLSA 2KLBA 5ERYA 2QLJB 1RZ3A 1U0EA 3D6JA 2L0XA 3MIIA 2COEA 4PZZA 4MRNA 3EYWA 1MH1A 5B0FA 3CCTA 5AW6A 3U7RA 5DNYB 5LZ7A 3VGJA 1GARA 5HP1B 2VG6A 5ETRA 2D06A 2YVQA 2G8LA 2B92A 3DLLQ 5AQ1A 2ZZTA 2YDXA 4IGAA 3ENAA 4KUHA 3B9QA 3FCVA 4PRKA 4FCTA 5HTKA 3I9KA 5TT0A 3K15A 5KNBH 3GCDA 1X7VA 2YJ3A 3R6LB 2OHVA 4B40A 3IPRA 1UDAA 5KYXA 5J1SB 5B3LA 3LSTA 4KKVA 5D2CA 4LDJA 1XJ0A 1F3VA 1THGA 4LBIA 4G0VA 2NXNA 3TEJA 3OX3A 1DC5A 1TJ4A 3IKVA 2HMIB 1MROB 1QY7A 4PZPA 1H65A 5HMMA 5FO0A 1ZHHA 3STVA 2HQIA 2N9UA 1RWPA 4M0PA 3NCTA 3IBFB 3DM2B 3QVTA 3DBHB 3PW0A 5FIIA 5LQMA 2R6GA 5HZKA 3CJQA 1QH8A 1X7WA 2FUEA 5HJ2A 1N7IA 3VH1A 1JUDA 4UE6A 4DR1J 1G98A 3SYRA 2O9JA 2QORA 2Z04A 5KQLA 2FQYA 2PFDA 2YNHB 4D8VA 4LOLA 5EKSA 3WI7A 1S1WB 3UJAA 2BZ1A 2XCUA 3HY6A 2NP6A 2GO1A 4WACA 3LOQA 3IO3A 2B2XA 2V7PA 4G5FA 2FEOA 1QIKA 3LOUA 4BEJA 4DUYJ 2E89A 2IE8A 1RRPA 2GDZA 4AN1A 2WSFC 1A9XA 3A27A 2Z6QA 5J2PB 3NIBA 4C7OA 2G9ZA 1P1BA 4MHSA 4DEZA 2BI4A 3R7WA 4AYBD 1PJQA 2OAQ1 2BBOA 5ECYA 3UJ8A 3QG5A 2CV2A 5HM6A 5I7AA 3WBJA 3C6XA 1Y5MA 4P8RA 4L3OA 2V45A 2ZSIA 1N3LA 4QTXA 3PIOQ 3M6MD 4XH9B 4ID5A 4DCJA 1RXCA 2O50A 1Y1RA 2HNBA 5CIQA 2XS2A 3KQVA 2JFDA 5G2OA 4PFQA 1RGVA 4FC7A 4PTLA 3EVDA 4AO8A 4ECYA 2WJZB 2XNSA 4JA0A 1DBSA 2ODEA 3ZIDA 3C6TB 2GAOA 2BGLA 3MMSA 2HHHB 3B5JA 3PIRA 2F4FA 5DN9A 4PLHA 2G6BA 3N79A 1A72A 1F2VA 5SICE 1VDHA 1VLHA 3QYYA 3FWKA 4MOWA 1MB9A 3R97A 3G6WA 2I3BA 3PX2A 5HF6A 4Q9KA 2XKKA 1P1IA 4BDTA 2FPUA 4EABA 3STYA 4NFSA 2IOHA 2LCIA 4G41A 4PS0A 3EQ2A 4OXRA 1ZJWA 1MU0A 3U7GA 4RGQA 4Z4FA 4CH7A 2NW6A 5CA0B 1UFRA 2DRIA 3K9GA 2H63A 3AOBA 3NBXX 4TRNA 5TPWB 1KLMA 4EA6A 3SQGA 2UUCF 4ZVOB 3V42A 1X9GA 1ZSVA 3GZNB 1NT4A 3ZH9B 3HXMA 3R9XB 3GLTA 1BW9A 2RJ3A 4INAA 3RU7A 4LNUA 1WXWA 1JDNA 1UCFA 4RM3A 3S2EA 5K3CA 2V6BA 3CCSS 2XNRA 1RYEA 2XKBA 5CXXA 1G6BA 5B0EA 3J7TA 4JIGA 5SUHA 4FS3A 4RJVA 1NYRA 2Y93A 2Z1MA 1DQSA 2YJ4A 3LKDA 2UZ1A 3D4LA 5J2UA 4RLFA 1JA1A 2CLSA 3UN3A 1DJ0A 4NNJA 3UHJA 2WZ1A 3AA9A 3V4IA 2ZU6A 1X80B 4WVLA 4KXYA 3DM9B 3TPCA 2FPKA 1A9XB 1SPBS 4Q4AA 3H17A 5C1DA 3VJRA 1QU3A 2VHVA 4HF7A 2Y0SD 5T4BA 3U3OA 3UBTA 3ECAA 1K7CA 3R7AA 2V6AA 2AXPA 4CQMB 4KN8A 1ITPA 3HT3A 1IXZA 4HZUA 1GGKA 1CZKA 2D2XA 4L3NA 2J0UB 4ZGBA 3ROTA 3QPBA 4NF2A 1UMDA 1SB9A 2XE4A 1K98A 3AILA 4KY3A 1XYVA 2ZJRQ 1WBJB 4OJGA 1DRJA 4XAKA 4ENUA 1VSVA 3NHRA 3JATA 1IQPA 4WZMA 2VK4A 1Q4RA 3L7DA 2YFKA 4ZCMA 2DWQA 5ALDA 5I4IA 2OAP1 3DTTA 5E3PA 1QTIA 4NJOA 4IIJA 4B4UA 4YR2A 1XRRA 3OZVA 5ARBA 2QUJA 5HTOA 2MR6A 3REFA 5A5GA 4R9RA 4FP9A 3IXLA 1Q6ZA 3DWGA 2WKWA 4UHEA 1VYAA 3WB0A 5HS6A 1NMZA 5KFLA 3ONDA 5KG3A 4ZCIA 4US0R 1AW0A 3O21A 2HW8A 4NE9C 4PUOA 3LXRA 3OJEA 3JAMU 8ATCA 1PR4A 1JTEA 3IEKA 4RCZA 1UT8A 5HQJA 5KYVA 4TYPA 2N42A 3KLHA 4ZPTR 1FF9A 1RT7B 2P9GA 2YHIA 4ID8A 1YJWS 5D8DA 3EH2A 4RXMA 3WNCA 3PJRA 4W9MC 5KDDA 4X1YA 1GEGA 1N5YB 2QUAA 4RV9A 4U9HS 4A0RA 2JEYA 1LVGA 4U00A 3DOJA 1D0VA 3OL6A 2G4CA 2OZKA 4X66B 1KE1A 5JNWA 3OA2A 2RQCA 3OV7A 3D64A 2AV6A 2VSYA 2VJBA 1UMDB 2VHXA 2Q0QA 5EJ9A 3KLGB 1DBPA 1VHWA 4ZQGA 1TCVA 2GN9A 4KWTA 4UPVA 3LY9A 3A10A 1OLXA 4Z9AA 2ZOSA 2FN9A 3D4BA 2MZJA 2HD4A 1Y5RA 1Y98A 3UICA 3UKJA 2NWQA 4D4GA 2I80A 4O2AB 4H7DA 1KNXA 3RJ5A 1KDNA 2H6EA 4DCNA 3DDOA 1YKGA 2QPTA 5F8MA 3RC2A 1CCWA 4CKCA 1HT0A 5JFGA 2A2DA 1V1RA 1PVOA 5J2UB 1KRXA 3CUVA 2R6CA 3VR0A 2QJTA 2QTWA 4LZWA 4E98A 1JIQA 4WU2A 2HSEB 3GJ5A 5CFRA 5K03A 5JVHQ 5BR4A 4C78A 4GLOA 4WFJA 2GHPA 4JFRA 4KVZA 3FCEA 1NMYA 4ZQEA 2H11A 3FRJA 4XASA 3SEFA 1D2RA 2JJ2D 4NH0A 5TEWA 2AZXA 4J9SA 4XIYA 3PNBA 1XHLA 1KI4A 3GP3A 2BISA 1DIRA 4DSLA 1KEEB 4C89A 3IQWA 2QM8A 1RAOA 2P67A 5ESWA 4HDKA 3NBPB 5HKOA 3BIFA 4JMLA 4KVGA 4M9ZA 2GN0A 4F2SA 4G0XA 1FXDA 4U6NA 3PWTA 2WF9A 1K97A 4C0HA 1AK2A 2LDIA 2WDPA 4WXPA 4G97A 1GQQA 3LUGA 1R37A 3L8HA 1DQ9A 3QVWA 1T24A 1N56A 3T7DA 2DR0A 5L95A 1YK1A 2Q9CA 2LE0A 3I6YA 3M0EA 4KE5A 5HK8A 3PI7A 1QQTA 1F7VA 1RLJA 5ADHA 4J0KA 2W9CB 3FNBA 3FZEA 4LNAA 3MM7B 3TWOA 1J23A 1Y34E 4HDMB 1C0LA 1WZ2A 4CN8A 3PPXA 2VSNA 4A47A 1ORDA 2XUZA 3T9CA 2GHQA 3BGOP 5G0UA 1E2PA 2XRFA 5J2MA 1NM5A 1N75A 2Y0EA 1Y6ZA 4FFLA 1GGHA 3K9BA 4PC3A 2WHOA 3MWYW 2XGQA 3RASA 3I64A 1T2NA 2EFYA 1G17A 2PS9A 2I71A 2Q5HA 3HB4X 3L01A 1JEYB 1CF2O 2R1TB 3N01A 3MS2A 2PGXA 4AM8A 4OZ1A 3OA0A 4COKA 3KV3O 3EMKA 5K3AA 3TZHA 3SZRA 4RTOA 4WCFB 1HQYE 4JI8J 2DTDA 2VJDA 3BJZA 2JG3A 4PRYA 3QIPB 1GTVA 1XRSB 3ZDXB 2NZJA 3G0GA 3I39X 5ALLA 2IZ7A 1AF4A 3W3ZB 2XO7A 2N75A 1FNCA 4HN2A 3N6XA 1JLAA 1L3BA 2YUTA 2O1PA 1NPTO 1HPZB 4RTJA 2UVUA 1QIHA 2F4VF 1AUPA 3WGMA 3UEOA 1QRDA 4UMDA 3JQJA 3O82A 1YI8A 3H8SA 2XXJA 1YFKA 3ZZPA 5JYCA 4YUAA 2XRYA 1LDNA 2AVDA 1CDOA 2QYTA 3A3OA 3TZ6A 4PEOA 3I4CA 4NCGA 2EX0A 4GAEA 1K1EA 1SB8A 3ETOA 1X8XA 3VTKA 2GZMA 4R8KA 1E9RA 2KJWA 2I4LA 2GPJA 3JAKA 4YYZA 4YQEA 2HNKA 2ZOMA 3CKYA 4TT3A 1MV8A 3C7AA 4BP1A 3MD3A 4F5ZA 3G87A 3N2IA 3FSXA 2V98A 3IO1A 3TEMA 3ZDQA 1T9UA 4NL5A 2DR6A 4ZIRB 1V6CA 2WCXA 1QH1A 2QNIA 2XZWA 1R9JA 1KY5A 2WUVA 4B3TB 4WI1A 3S99A 4CL3A 2QZ8A 2BR0A 1J56A 5DE3A 4MKHA 4LNHA 2AH5A 3U4IA 3M32A 2ZDPA 1JJBA 1XVVA 3O3CA 3ZDEA 1REQB 1IR0A 3KKQA 3P20A 1K8ZB 4DCOB 5FP0A 4F1JA 5AM2A 5JISA 2KZZA 4MK4A 1FTNA 3BIJA 1FDRA 1KJJA 3PTZA 4EPTA 4CL0A 1M5HA 1UFLA 1Q21A 3GLHE 1B26A 4OI4A 1QUEA 2QD5A 3HXQA 2HK6A 5KX5A 2PANA 5E3CA 1E3MA 2EZTA 2E5JA 1VLYA 3HDYA 1PKXA 3UWDA 2FUG9 1SVSA 4Y98A 1OU4A 2QD4A 4ZAZA 4MYSA 1NOJA 4HTIA 2WILA 4GG1A 3L7BA 1OXUA 1XA0A 4B8ZA 5HMXA 5TVGA 4HGYA 1RT3A 3UCGA 2MMYA 2NO0A 4PAGA 1UAWA 3G7NA 2F3QA 3ZU6A 2OXEA 4KCGA 2O6LA 3FHTA 3MGGA 4XSGA 2Q43A 3ILOA 1N78A 5KNBA 1ZK2A 4RVCA 4ZVHA 3TUZC 5EA2A 1S1UB 5DI3B 3H1PA 2Q46A 4BGIA 4W5QA 1EWVA 3A3YA 4O3PA 1E6EA 3KQOA 4DWWA 4OI0A 4HDGA 3CD0A 1M6WA 2MXYA 4Q12A 3F46A 4XB6B 4LJRA 4YMHA 3F6BX 5TRTA 3D6HB 3GPCA 5AVRA 2P65A 1M1HA 1MFZA 3CZQA 3WLEA 3D1VA 3QRPA 1WF0A 1WKCA 2HBRB 1KOJA 4OBEA 1UWLA 2NTVA 1ICEA 3WLQA 4Q00A 4OY3A 2WWTA 4X91A 3PXDA 1X8LA 1U3UA 3UWSA 2XMJA 4Q1VA 4WESB 2VZ8A 3BGLA 1R0BA 1MW9X 3KT3A 2CLEB 2GYVA 1GPWB 4URZR 2WOOA 4DCMA 5M3BA 4YS6A 1CE8B 3RG6A 4RUAA 2G5CA 5ICCA 1OS5A 1HNNA 1JB0C 4JI7J 2Z98A 6AT1A 3BB5A 4QGFA 2UVWA 4O4IB 1JILA 3DFEA 4HBGA 3U3RA 2C2HA 4B82A 5E3HA 3N74A 2GKSA 4FONA 3U62A 3RKSA 3INNA 4J9RA 3LUAA 1GU1A 2ZJFA 1QRTA 1IBMJ 2MY8A 1KDPA 1P91A 3O4HA 4C88A 3E8MA 3QX8A 5D3MB 1YA8A 4QO8A 1YA4A 4QLOA 2VQEB 3V4PB 3B1WA 2PO4A 1U9ZA 4WTYA 4CYUB 4GLFA 3AYXB 2PFGA 4ZZ1A 5LB4A 5EE5B 4EGCB 4G1QB 1KMCA 1FTGA 5IAEA 2OL4A 4LHZA 4D9CA 3LHKA 1T5IA 4I08A 2BTOA 3PQDA 1B7GO 5H16A 1ORWA 1OSNA 1TL1A 2J30A 4R2HA 2BBWA 2QTFA 1F2UA 3T1NA 2FN3A 3O47A 3K59A 1UFWA 1QP4A 2OSRA 3TAUA 2OBLA 3TR6A 1CJCA 3IRVA 5A3VA 1UC4B 5A0VA 1FK9B 4BTEA 3KE8A 4FI3F 1DG1G 8ABPA 3DE2X 1Z38A 1SJFA 5J5VA 1UMCB 2ET6A 1P5JA 3ZU4A 1XU9A 1R74A 1IPHA 3PO4A 1RABA 1X0VA 3DZ8A 4C3ZA 2VYVA 4MA4A 2I5JA 3VHRA 4X3OA 2KH9A 4GZLA 1VRUB 1N2XA 1LBIA 5B1EA 1VYTA 2H07A 4NYPA 1XXLA 2P9EA 5C52B 5ILGA 1AS0A 2I6UA 3RB8A 4FOPA 1C0KA 4ES1A 4PW0A 4JVSB 3M2VA 2IDJA 4YY3B 2BR4A 2AN3A 1ZUHA 1CR0A 3HUUA 1N33B 1GGFA 5BSTA 2QG6A 2EDAA 3D6FA 1TQ8A 5A3QA 3KLFA 1LXCA 4M8KA 4W8HA 1DFDA 4YP9A 5AVZA 3ZU3A 1SD1A 1EEXB 4UUPA 1DLOA 1V5GA 4BX0A 1ESMA 1Y3KA 3GARA 3L7YA 4TUYB 1SIZA 4Q3KA 4RH3A 4KRWA 1J33A 2MOKA 1ZJZA 2JL9A 3JZIA 5A8WB 5BSVA 2VBXA 3WJ2A 5E2IA 2YCBA 4O5OA 1QZUA 4NRTA 5K3EA 5HDBB 2O2EA 3BKWA 3VAJA 2APJA 5JADA 3UF0A 1JECA 3IG1B 5BOVA 4YY3J 4ID9A 3MOSA 4ILLA 4JJKA 5L40A 1S6QA 3G79A 5FWYB 5KAKA 2ILYA 2VSXA 3KYDB 1E8MA 1WCV1 2NZYA 3DLPX 3DYVA 3FYUA 4USWA 2V8GA 4MDYA 3ZQJA 4JP3A 5RUBA 1WBBA 3O94A 5J63A 4KWEA 3L05A 4F7WA 2ST1A 3TTSA 4L5AA 5EJ4A 3BQ2A 5COBA 1R50A 1VJCA 3AVWA 4IDBA 3G3EA 1DJOA 3OLBA 2GJ4A 1RT1B 5IXYA 5FLYA 3AJAA 1C4AA 2ZI3A 3TO5A 5G0TA 4F8RA 3I9JA 3E7DA 3THWA 4N18A 1SMKA 5JNUA 3O4RA 2C5FA 3TZCA 4LYGA 2C3UA 5I3QA 4M7PA 3DZJA 4MPRA 3I34X 2Q21A 1G8MA 1WDWB 1EWTA 2R3SA 1ANKA 3CCJS 3HSZA 1Z83A 2DNOA 2OUGA 3FZGA 2QPOA 2PHZA 1JDPA 1E0DA 3MM8B 4A7PA 5HMLA 2PMWA 4F4YA 1KHTA 4QFBA 1EYZA 2QVBA 5HATA 4CO5A 5EYPA 4ZVPB 1TO1E 2I78A 1RAJA 4NLQA 1W9MA 1I3MA 3DGVA 2PO7A 3E2PA 1ZL2A 1Y1KE 4NLDA 4BWVA 1X4DA 1E7MA 2Y2UA 3GV5B 3SQLA 3SAJA 3GLFB 1XXHB 4X60A 4I50B 3OU7A 2OXFA 1MG7A 2J41A 2QRUA 4HNTA 2J3LA 1Y8QB 3B1ZA 4R2MA 4RMGA 3PEJA 3I05A 2LP4Y 1NSYA 1OFUA 1OIVA 4PWUA 3GVIA 1A69A 1MNQA 1UKUA 3K5LA 2VIHA 4B3DA 3ELUA 3KJNA 3BR8A 4Q1BA 3BUSA 2XB6A 4G24A 5F2EA 1XVIA 2DU8A 4YFYA 3ZD7A 1CUHA 3OTDA 2VYND 3C3CA 3EVWA 3S01A 3JWIA 5AE1A 3KG2A 1J70A 1G0OA 1MNAA 4CIDA 1D2GA 2R47A 4NLLA 1ISRA 4O1IA 3JATB 3BYPA 2CDRB 3BTOA 3KU1A 3L3CA 2JJMA 4J1SA 1NBIA 3H4DA 5DHAA 2B2CA 3ZTPA 4FKMA 1X9WA 1D2CA 1NVWQ 3W1YC 3GNLA 3U7QB 3VYRB 4HUQA 2AN9A 3GQVA 2R7MA 3EXEB 1FNSA 1T03A 2QTHA 1OHHD 1C4OA 2F8LA 4TMTA 3OY2A 4K3VA 4Y8VA 4YCDA 3BJIC 3ZTTA 1QCCA 3QNWB 3DL0A 4GC9A 5EMHA 4NBWA 4NIMA 1WCIA 2GFQA 4HNSA 2OD9A 3D3KA 1OMSA 3H7AA 4R0MA 5KTSA 3E53A 4DL2A 1V6AA 1UZHA 2DY1A 4UCQA 3JAWB 5IJZA 1IBKJ 2Z2XA 4RORA 4DTIA 3QGHA 3BQNB 4DR3B 5E0OA 3IVCA 4XOUA 3AY7A 4HLUA 1X4GA 2EV9A 4WKYA 1BCRA 4U95A 3ZE8A 3LUBA 1DTWB 4B84A 2OHXA 1FFCA 2KFZA 3RRHA 1TKXA 1JJ7A 1R0AB 2VG8A 2K1RB 3PD0A 5B6PA 1J25A 4R1LA 1XL0A 1R8HA 4GW3A 1XEXA 2A6OA 5CUQA 4R7ZA 4DIMA 4DZRA 3IDZA 3NGLA 5KG7A 5A5FA 1YZHA 2DBQA 2FP3A 4AS1A 1X0XA 3MJRA 4RW9A 1X86B 4DOZA 1T8YA 4HX5A 3SQOA 4MIOA 3IC1A 1HYEA 2W2QP 5LJ3Y 2BEVB 1MABA 3BRSA 2CDRA 3TZKA 5CIWA 4CI9A 2UXCJ 3QOXA 2Q45A 4LMPA 4ZVLA 3MRSA 3HABA 3EXYA 1S8FA 1CEXA 1Q5PA 1DJMA 1TMYA 4NBUA 2IC3B 3HWWA 2VA3A 1WOMA 2FEKA 4Q7EA 4CM7A 421PA 3MUTP 1JH9A 3F96A 3OIUA 3IODA 3K0FA 3L8DA 4DGSA 2B34A 3T5BA 4B3RB 1J2YA 2UKDA 4Q37A 3ZXSA 3PYGA 3QIAA 1OXKB 1ECLA 3HYLA 4G1MB 4EA9A 1D1UA 4RO0A 4GO5X 1SCUB 621PA 2RJZA 4Q18A 2NAFA 1ZH2A 2X7HA 1IG3A 2CYAA 4HI0E 2NVWA 5F2OA 3AUKA 4RYLA 3I5MA 1MN9A 3TMYA 1K8YB 4YRAA 3ANYB 2JNJA 5TMDA 4PSUA 3W60A 3NP5A 5CEEA 3MBIA 1LDEA 1BHJA 1GAXA 4RJ2A 1GO2A 3X1LB 1N5OX 3V6DA 3MPYA 3AEXA 3DCNA 3GA5A 3EVMA 2X9LA 3JQKA 4PRFA 1RU3A 2DOKA 4PNEA 3LGMA 3SEOA 3GQBA 3ROZA 2RH4A 4IVRA 1UDCA 3IHTA 3W64A 3B6EA 1VJQA 2Z1DA 2VQFB 3HJBA 1NY5A 1Z0ZA 1S2OA 3AF0A 2E0IA 1IMOA 2PMEA 3G96A 2O52A 3KKZA 4DBVO 4JAVC 3W3AA 4MJLA 1QLNA 1YNSA 1T1RA 4D0GA 1WD6A 5B57C 4DSFA 4BMPB 4F4FA 2OV8A 4IHKA 4K87A 2GRUA 3HJCA 4IHJB 3IN5A 3EGWA 5L3SB 2EHDA 2BGGA 2E6UX 2AZ1A 3P2YA 1GZUA 1WJGA 1YACA 1I3CA 2V9PA 2IDKA 1RRVA 3IAEA 1NMQA 4TZTA 2NVUA 3ZZRA 4ZOLA 2B6NA 3R3YA 2C88A 5F9LA 6REQA 3PEWA 4BFCA 2Q3PA 4DR4F 2V34A 1PFKA 3FYUB 4B3IA 5KQPA 1EFHA 3PUHA 2OGTA 3S0JA 3CPSA 3I0ZA 4KSBA 1EFDN 2HV9A 1KI7A 3W66A 2NZ8A 4MYRA 4FE7A 5FWYA 4NWIA 2ZUSA 1KVUA 4Y18A 2A57A 3CIFA 1XHEA 2Y1IA 1HRDA 4I19A 3BDPA 3ANNA 3KXPA 4HCJA 3G1UA 2E37A 3VJMA 2MKHA 2IH5A 1DAGA 3RSLA 1KO4A 1JK9B 3BMNB 4V0KA 1HIYA 3QGGA 1A97A 5CLHA 1R9NA 4C4PA 1VECA 1OY6A 2DLNA 3PR2B 4AF6A 4RANA 3KLEB 1M33A 2YN2A 5DS7A 3GUCA 4R0VA 4RKEA 3L8EA 1NU6A 3GJ6A 4OZ2A 1YOVB 1W5EA 1WC5A 2J9YB 4TS9A 3ER9A 2P6OA 1WZUA 4L07A 2C99A 2QPLA 3BSFA 4WKPA 1GFSA 2D5IA 3HPOA 3CPWR 4X94A 1CRWG 3W6PA 5G0SA 4UASA 2C96A 3Q3EA 5ADVA 1VMIA 3S68A 2W6OA 2CN1A 5I3UA 1B16A 3PDIA 4M7RA 2B78A 2CC2A 3H4VA 4DUYF 4LW8A 2CXPA 5FBQB 2CNNA 3K9NA 4IEFB 5DYYA 1FJHA 3EGOA 1VMDA 4JOBA 4JH0A 4W5HA 2X0RA 5GGYA 4NYJQ 1T05A 3OT5A 3GX1A 5IS2A 3U4AA 1LY1A 4NLPA 2OESA 1XMOJ 1BCSB 2ZRHA 4JP8A 3RRXA 5I4CA 1E2GA 4DI6A 1XQ6A 5EJGA 1U2ZA 1J24A 3FFWA 5L4LA 4QOJA 3TNVA 4JROA 2BUAA 2I8AA 4LYJA 4MV4A 3WNZA 2JHFA 1GEHA 1MMLA 4YIKA 1Z6PA 2XF2A 4P71A 1QXSA 2MDAA 1IUJA 5LDDC 3GG9A 4EB6A 2J5QA 4JBLA 1TK8A 2AJ8A 3QLHA 4TTAA 3TFOA 1MGOA 3QUCA 1QORA 3E35A 4QUBA 2XCQA 2C5GA 4D79A 4DR5F 4LZAA 4GOOD 4HL6A 2XDAA 4UUAA 2D1YA 3BVPA 2E1RA 1OHHA 5JXHA 1QZTA 4Q3NA 4MIYA 2BGMA 2CQBA 3BMCA 5ITSA 1F0XA 3VHXB 5DXAA 1UVJA 3M4XA 3QFWA 1XROA 1B0PA 1RA6A 3TQQA 1HRKA 3Q40A 4O0IA 1XJ5A 2NO6A 3I58A 3GFFA 4ZYTA 3SYZA 4V3CA 4PYQA 4IJKA 1BGWA 5LD2C 4GL4A 3VZHA 1WHTB 2GW8A 3K9CA 1PD1A 1SXIA 3DLAA 3V6MA 3F0NA 1NJ6A 3OQ6A 4M46A 4H4DA 1NK7A 3N05A 3RFVA 6AT1B 2J4FA 2RBKA 4URSA 5DM6Q 3H2HA 1LPOA 2WVBA 3G8AA 4ZHQB 4KSCA 3UUEA 4OYRA 1WW3A 2YKQA 2YTCA 4WSOA 1YT5A 4F9EA 3N2YA 4M38A 2AMJA 2XTMA 3NP9A 3TD2A 1C9KA 3RROA 2WVFA 4JLAA 4L6V3 5BW8A 3QKWA 2EFEB 1L5HA 3G82B 2RAFA 2COKA 1AG9A 3LK6A 3PL5A 4YJ2A 4IR7A 5IMBA 1IBLF 3K5OA 4U7GA 1ULAA 1EE1A 5AVYA 3JYPA 4OQNA 3NBAA 1YS7A 2XQIA 4FMCF 3KLMX 4LSZB 1O5JA 2BANB 2BTQA 1KJIA 1DBWA 2F65A 5BSRA 2CL6X 3VJLA 4OSOA 4F6RA 2DB1A 1E2DA 2HY7A 1IN6A 2O1EA 1QK3A 4X6LA 4TMXA 2JDID 3QZ7A 1TUWA 2HGNA 4LT6A 4R1MA 2PBLA 4RL6A 2PYDA 1FJ7A 4HQOA 1YJRA 1ONOA 4OX9Y 2XG8A 2GUWA 2PUGA 2DEIA 1NDKA 1FE8A 5DEIA 4JDPA 2B94A 3HUDA 4AB1A 3V97A 3W8PA 4PR3A 2CW5A 3VI4B 4PSAA 2F3TA 2R5FA 3NETA 2MZ1A 4XM0A 7GPBA 2LEBA 1ABFA 1B2LA 2IYWA 3A3NB 2KYXA 3V33A 4H6XA 5C24B 2ZVDA 3BOSA 3R20A 3FUYA 5DG8A 1E96A 4ZO7A 1XEFA 3B78A 5K0CA 2H5IB 3ECSA 1FMTA 4UHJA 1UKYA 2XECA 1V26A 2OJ3A 1WPGA 1FPMA 1LW2B 2FSUA 5K7SA 2H5JB 1ZESA 3QX3A 1UEXC 5B08A 2P0AA 5E4YA 1O77A 1BJRE 4HVTA 3OL8A 2O3QA 4AAYA 4U8VA 1UFOA 3TVTA 5FNVF 2CXOA 1AO3A 3SYLA 3DOFA 3B13B 1S4FA 1M8GA 3K5WA 2XCAA 2KVIA 4NZZA 4LCEA 1K86A 1TW3A 2DVMA 1PTKA 1V0JA 2IIHA 4DV4J 3K1JA 4ERNA 1BRTA 3C14B 1TRHA 5JWHA 3JAKB 1VL0A 4AJPA 1SK9A 4GM0A 1XJWB 1AF7A 1Q77A 1UXJA 3AU9A 4MGYR 3JZFA 1NQTA 3EWAA 1LW2A 4U2GA 2AL7A 3HCEA 1J99A 4RDCA 1XRQA 2VU5A 4XQ9A 1LW0A 1KEUA 4H4OA 4HEHA 5EUHA 2MZQA 2ZRMA 2HFSA 1BN6A 3JV7A 2QXYA 1PP4A 1KFKB 3VCDA 2RE8A 3KKLA 4EFKA 3HCAA 3O0DA 3G49A 1CQZA 4Q6BA 2FCRA 2K2PA 2R751 4G63A 4U9RA 1PQUA 1KNQA 3GPAA 3N5CA 3V1YA 5E6RB 5AFSA 2I2AA 3BXZA 3ZLTA 1Y8RA 3RIXA 2XLBA 1VC0A 3JRWA 4ZOEA 2ZJYA 3OTOB 4IGKA 4RH1A 1K89A 1SCDA 2HZBA 4ES2A 4GC7A 1Z5UA 2BKAA 4UAJA 2X1VA 2CMDA 4C01A 2GHTA 4R2LA 2IYAA 2VXOA 1S6QB 1USKA 5EZQA 4U5XA 1G2EA 1M66A 1XV5A 1Y5NB 4DMFA 2ZNYA 4LYYA 4NI5A 1PR5A 1AQ6A 3W4IA 2AEMA 1DIHA 3K0KA 1C9DB 2BEWB 2CDCA 4S2EA 2IH2A 1FUIA 1CQJB 1JA9A 4CU2A 5CYGA 4BATA 3Q89A 2MY7A 4ZVRB 1SKAA 3Q3GE 1HHTP 1JJAA 2W9CA 3LPCA 1TD1A 1ZLXA 1I2BA 3FRHA 3RJMA 4RPLA 3UG6A 3A4LA 3B1XA 3AB8A 4PYIA 2NQ2C 4GPD1 3KEGA 1TECE 3T41A 3RYIA 3J80Y 4GI7A 3KK3B 3JYLA 2QYSA 2XMUA 3I0SA 1EP9A 1RTHA 3TJRA 1SC1B 5ICFA 4MW6A 2I7CA 2H29A 1KBZA 3FCSB 3IWLA 4JSTA 1VC2A 2G13A 3EC7A 5BUSA 3X0DA 5I7WA 1YQWA 3LUYA 5TPZA 3NHPA 4N7JA 3X3UA 2NV0A 2D1RA 4F26A 3OR2A 5A0YB 1J20A 3T15A 5B2FA 3SC3A 1YZ6A 3QUTA 4B09A 4UTVA 3FI0A 3IBFA 1E20A 5HZHA 2FC9A 2WAYA 2V55B 1U9CA 1N2SA 2DHHA 3RC1A 5AW8A 3L7KA 5KNCD 3P0JA 2X6QA 1RYYA 3BN7A 1DE0A 5I45A 2R6DA 4XVHA 4B3RJ 1RAGB 3D2AA 3B3JA 4NASA 3KJFA 1Y7LA 4Q9HA 4BZXA 2F1JA 2E9RX 3IALA 3NGXA 1FC0A 1EB0A 1A8PA 4W8OA 1X15A 3IGFA 2BMWA 1HDCA 1FXWA 4NZ7A 5J2UF 2YQ1A 3OSPA 1QBGA 5I9BA 3FDJA 3JSRA 3R0XA 4EJ0A 4X00A 4CL8A 3V8NA 1G5HA 2NX2A 2ZBRA 3HDHA 4TLMB 2QTLA 1XPOA 1YAJA 4OQPA 3RU0A 2XTZA 1PT7A 5SYAA 2QTBA 5CLJA 3A1EA 1CE8A 3OM8A 1SKSA 1KOFA 4II2A 3KK2A 4DS5A 3VMMA 5AJ3J 2DNHA 1SJ3P 3VKGA 1K68A 5LP6B 1S89A 5E3JA 1OTYA 1NSKL 3D3WA 4K1XA 2AZ3A 2AF4C 1FDSA 3QPVA 1SCAA 2DGVA 4KDFA 2UYCA 3KLEA 5HLFA 4XLZA 3TG2A 1U04A 3TLJA 1EKXA 3O6VA 3UCZP 2YWHA 2R8JA 3V2HA 5CX1A 1TT7A 3C3KA 4X4SA 1SCJB 4LWQA 5TX7A 4LEIA 2V8VA 3PNSA 3V9AA 2VL1A 4DFKA 2O2JA 4XVUA 1R3NA 4H7JA 1G7CB 1JVSA 4BC1A 1GGJA 1I1NA 3ZY4A 3PRYA 2QMEA 2Q2NA 2YJ5A 5G0WA 3SEQA 1PX2A 3JQQA 4BX9A 4Q66C 4BC0A 4HNRA 5HA5A 2D0IA 3KG4A 2JLAA 4B5KA 3L9ZA 4LRSB 4J0DA 4TYWA 2P9JA 1A5BB 2NVUB 3GE9A 1T2CA 3BTVA 3T1VA 3IJRA 1HR0F 4DA8A 3N2EA 4YRQA 4IO0A 4LN1A 2BN4A 1YRBA 4EHFA 2YYSA 3PR5B 1IDN1 1UA1A 2ATVA 3IDFA 4F56A 3TE7A 5HBMA 1JLMA 4X7PA 1G41A 3CT9A 2A1BA 3A8TA 4JVLA 2R44A 3EN0A 2GVZB 1OF1A 2FPSA 3RB3A 4OEHA 1EX7A 4X6UA 1H4SA 1EX8A 1E89A 1P39A 3DZHA 1SXJB 2HNAA 2BI7A 4TX1A 3IOMA 2RU9A 4KTQA 3JD4A 4OFBA 4TV8B 3DWFA 2L69A 2WVEA 4O4IF 5DHQA 4Y1EA 1VB5A 4E11A 3KTQA 1VHJA 3D1QA 2LGJA 1V3TA 1U48A 1TIBA 4JI4B 1XYYA 2PT0A 1DUSA 2IJFA 4EHKA 3QK7A 3TSOA 3EWNA 4YNBA 2N4DA 2C94A 4B9AA 4HVLA 1RCFA 4I5IA 5DRTA 2IK8A 4EY7A 4V38A 1W30A 1MO6A 4LJ9A 5EHQA 1S59A 2WU1A 5E2QA 3AT1A 2FQ1A 2YHUA 2EWHA 2KMLA 1F6DA 1WXEA 3OECA 3QZUA 2DNQA 2YNIB 4PBTA 4GZ6A 1JFVA 2EKLA 4X20A 3HCPA 2AK2A 5KQSA 1TVRB 5FADA 1HUQA 3ZV3A 4EVQA 4ASUD 4FDUA 4H9GA 3BX1A 4FXVA 4IZIA 1H6KX 4RW8B 4UBMA 2AV5A 3ZWBA 3K17A 4QXAA 4YRMA 3WC4A 4M5KA 4GU5A 4DUTA 5JZVA 2GQCA 2QX0A 2ZKTA 3H5TA 4PU0A 2H3EB 4L4SA 1V41E 4D46A 5F8NA 4NLTA 4XVRA 3AF5A 4P7KA 4FF1A 1VMKA 2DZDA 3PC3A 3PFHA 4QHYA 2WM9B 3NWJA 2DH7A 4URQU 3I73A 3RUIA 2IUTA 4V03A 4CTKA 2R7AA 3HKCA 2UUWA 2VC2B 1IM2A 2OORA 4CYMA 5BV1A 4NCJA 1FX2A 1PSZA 4Y6SA 4K9NA 2D41A 5ER9A 4G25A 1RWXA 5DPMA 3KD3A 5LM3A 2NN3C 5JAOA 2E7XA 1L3TA 2CYCA 5I47A 3ZWYA 4MPPA 1XEXB 3ILSA 1GV0A 3L6UA 5AOCA 3LA0A 3TX8A 4WOPA 2XTAA 3WB9A 2OZPA 5KKAA 2VCYA 1M6YA 4YRTA 2H1CA 1PAEX 1DKQA 3UH0A 2VK2A 3NTOA 1FXSA 3IMKA 4YV2A 3PX4A 4KWCA 1N1MA 5GJVC 1H6BA 1KVJA 1QGED 4ZVTB 3UANA 5BR8F 2QLBB 2PUWA 3UH1A 2WWVD 3U6BA 3W5ZA 4BNWA 2QTWB 4CRWB 2EERA 4WA7A 2HO4A 3C5VA 1UPTA 5I51A 2ZSJA 3IAM6 4UFPA 1T3NA 3NO4A 3E1SA 2HQGA 4AJNA 2J3QA 3AM4A 2GZHA 3ELYA 1T95A 4TWBA 1T8RA 4WJZA 4RD3A 1U1GA 1DV2A 3EUAA 4EZ9A 3PM9A 3NVMB 1XK6A 3EHDA 1WAMA 2QSZA 2XYHA 1J6UA 2OC4A 4PYRA 4A36A 1VYVA 4FS1A 4FE3A 3PENA 4TL9A 2ISCA 2LXNA 3V8MA 4OLPA 5J3JA 3JSYA 9ATCB 1C4KA 4XFDA 1Q0SA 1HV8A 2B0GA 1NXQA 2XSZD 3T9FA 2OEMA 1KVKA 3ZI7A 1EVYA 4IQ8A 2BABA 2ABYA 3I0SB 4GWGA 4K6HA 5IVHA 1ZUIA 2GPTA 3BGSA 5K3SA 1QWOA 2C7QA 1NP7A 3R6WA 3MSCA 1W1IA 4IDPA 3FBFA 1GJRA 2ZSAA 1L8LA 5LA6F 3UOGA 2XQFA 2BJWA 4OCZA 1KKHA 4TS3A 4R51A 1OB5A 2W01A 4D41A 2ZUDA 4BNTA 3A1FA 3GR6A 1SUQA 4JI0B 2C9ZA 5EZYF 3VISA 5ELMA 4CZ2A 1I4WA 4PG7A 4ZDKA 3BJYA 2JHEA 1MG5A 1AKRA 3CLRC 3GNTA 2HT1A 1AO0A 4KQ1A 3PICA 5A9RA 4BV8A 4G0OA 5D4PA 3GGPA 2JI6A 2WHYA 2G2ZA 4X8HA 5TPZD 4M0UA 4OVKA 3ZW8A 1V8BA 1GZSA 2I8CA 3EVBA 1HI9A 1CFZA 1YJ7A 4TKMA 3UHPA 4RIEA 1W36C 4B47A 2Q2QA 1E1RD 4Q2LA 1EUZA 1I24A 3BM7A 1L4KA 1AA1B 3K2YA 3TQSA 3U4DA 1ZD1A 4DQIA 1LPNA 3T4UA 2ZE2A 2L3MA 3OXGA 1L5RA 3P19A 3NWPA 3V2UC 2JGLA 1CHDA 2JCBA 3D1OA 5TT1A 4OLOA 5BN5A 4TLAA 5HE9A 3B7WA 3JYOA 5B4TA 2Y1XA 3OFSA 3H2KA 4C8YA 1T9BA 3FSGA 3I61A 4WDQA 4CQJA 5GAJA 2ZHAA 4INPA 1I51B 4WT7A 3DLKB 3KSRA 5ALQA 1GU0A 4AWXA 4DSAA 1QR6A 3BF4A 2PC6A 1EDDA 5D5HA 4LDRA 5EUQB 1LWEB 5KJ6A 2AG8A 5FRDA 1W2GA 4BO3A 4EKIA 2GAIA 3G8DA 5ILOA 1P6TA 4L5JA 1NGSA 4PLCA 3W61A 1UBHS 1R7RA 3Q1KA 2FI1A 2O3SA 4DV5J 1L1FA 4X2BA 1QS0A 4HXGA 1NG1A 3LKBA 1X42A 3MLEA 1U2DC 4KQWA 1CQIB 1E1QD 4Q7KA 2QRZA 1DKMA 3GIKA 5AXCA 1VKJA 4ARVA 1KIAA 3GWZA 4HDNB 1P2VA 1DQYA 5EINA 1KI8A 2FV8A 4E46A 5F9MA 4JBCA 2HBQA 5I7HA 4JI1B 3LQFA 3NVDA 1D2HA 4IRUB 1QPGA 2JD0A 5IF9A 1A7AA 3UUFA 3C5EA 2QUIA 3ASUA 2O2ZA 2RAVA 1VISA 3LVBA 1L5LA 4ZOAA 3MFHA 1CIVA 3A6PC 3HXTA 3D0QA 3SQGB 2DPJA 4PCVA 4DYHA 4HDHA 2G08A 2UXBF 1BXGB 4Y9TA 3KUHA 2ZI7A 3O91A 2YHSA 3VR2A 1J09A 3ILHA 3R44A 2RHDA 4L6AA 3LC7O 4AKGA 1UADA 3GRKA 2BJHA 4EWTA 1J8YF 5DGBA 3EBLA 4PAWA 4FF4A 3VOAA 3DOKB 5LPNA 4AWAA 3U6KA 3A32A 4X1OA 521PA 3OEED 4GM1A 3CNHA 1OJ7A 2E1PA 4LS3A 2W6IA 3LDHA 4KLAA 3VR2D 3EEBA 4C21A 3MFQA 2X5NA 3UAXA 3ZCRA 1UPAA 1Y1LA 2F1IA 3H7IA 1PKUA 1UPMB 2BFNA 5LJLA 4Q8EA 4DQQA 1JKJB 5D77A 3KQMA 4F04A 3IHWA 3P6YC 1EDEA 2L42A 3HUFA 4RM2A 1M10A 4DJAA 2DKFA 3EIEA 1W0KD 5IU6A 2IYXA 4EGQA 2R7VA 3PQ2A 3F1LA 4J7UA 2HAEA 1QNFA 4CG3A 4CH1A 2HLTA 4LVOA 4KV8A 4DILA 3K9QO 1Q78A 2HIQA 1J1ZA 2EARA 3G7UA 2PM8A 1XWLA 4GMXA 1AS2A 1FSSA 1W581 5J2PA 1UK7A 3KHLA 2A9RA 2IRXA 3UWMA 4QYWA 2P62A 2OEJA 4Y1RB 3THOA 1HE2A 5F21A 4JJ7A 1EFRD 3KSZO 1H22A 3LWBA 5KHLB 3FFTA 2BMBA 1LWFA 1G8PA 2YS7A 4JI2J 1M6EX 4DL6A 3KFLA 3Q9UA 4NI2B 3CN7A 2R2AA 3FGZA 2Y3IA 4M21A 5BW6B 2BP7A 3C15A 1J0AA 4NCHA 4P0TA 2QJOA 4WE1B 4X65B 1N5JA 4CKBB 4B9SA 3JQDA 2J32A 5HMZA 2FDRA 2AEJA 5B36A 4P53A 4UU0A 5CB4F 1MC4A 4DL0C 5I5GA 5L7WA 5CYMA 5F3ZA 3KPJA 3PW7A 1K4KA 2ZJBA 2IA0A 1HTBA 2Q3DA 2RNEA 1SKRA 1T9TA 1Q0TA 1TEHA 3DRSA 3SQXA 3H0PA 2E87A 2ABWA 3GF4A 3R7DA 4PZYA 3MCAA 1NK8A 4XUCA 5EJ8A 3KK0A 2MINB 4KPYA 4ZC8A 2FXVA 2QMQA 3EX7C 2DUUA 3LVQE 4W9NA 4WZBA 3IT2A 1QYVA 2XOXA 4DIBA 3DHVA 3SFUA 2E5IA 1R89A 2WI8A 5EEHA 4BWFB 1B0ZA 4Q01A 1Q8LA 4C6HA 3GJ0A 4DPYA 2I0FA 2WD9A 3PGLA 1APBA 3EXHC 3R74A 4RL4A 4YP5A 1ELOA 5A4MS 4DV4F 1S2DA 4NYIR 3ER6A 1ZOOA 3U39A 3PY8A 2PT5A 4D8YA 8AT1B 4HSGA 5EQJB 1GTJ1 3BSYA 4QDKA 4LBZA 1RZMA 1R0XA 4QTTB 3PXAA 3UT5B 4MFBB 2W7TA 1S7GA 2EWMA 3TX6A 3BERA 2YIJA 1XR3A 3EPKA 4L15A 2QIOA 2HRUA 2HMUA 1Z8HA 2VPWA 1MT0A 2PKRA 2Z2JA 1AXRA 4CM9A 5I7VA 1YIAA 1TF7A 4LFBB 1NH7A 1JHXA 1IY2A 1G5TA 1KP6A 3H18A 3DOUA 1FRQA 2BE2A 4TLRA 3SXLA 3GLHB 4AMUA 4JZKA 2PK3A 1ZDMA 1YONA 4PAAA 1C3OA 4K6GA 2PA8D 1JDUA 2Z8ZA 1FQOA 3LFHA 1NOIA 4CLOB 1YRAA 4K40A 2ZIXB 5AHWA 4CQLB 4AUKA 1Q2XA 2G4VA 2SCUA 3P1JA 2NU8B 1YHYA 3QLEA 2J0SA 4JITA 1DFHA 2Z3VA 5KC8A 1SBIA 5HM8A 2MCFA 4ED7A 4RZSA 2R25B 4M1WA 3MEEB 1J2VA 4RW6A 2BZSA 4L28A 4MGHA 4BRSA 4FCCA 2QVGA 1S72S 1N9ZA 1PR1A 5JAIA 4Q05A 2I8EA 1OV4A 2PWYA 2WJ6A 1VB3A 1WRBA 4N03A 1LLCA 2FGCA 3W2WB 2A4KA 4PLTA 3CX6A 5AE2A 3V8PA 1IZZA 4A82A 1YUMA 2M6SA 3D54A 1YUNA 4KV9A 2J5KA 2FSHA 1Z0UA 2Q6LA 3JARB 2GJ9A 1T43A 1DRVA 4QT0A 4OQXA 1U7OA 5ADWA 1GT91 1LTQA 3KOYA 3HCBA 3R5GA 3RG2A 3DE1X 4QYMA 2FR8C 2DNZA 2A84A 1ZJ5A 3THSA 1FFWA 3FROA 2BJ7A 1NAIA 1GNTA 1IM6A 1C1DA 2EBWA 1CUCA 5ECDA 3D3NA 2IQ5A 4WY2A 5KJ1A 1WACA 1LLUA 3M2RA 2FZCA 4BXOA 4G5SA 4H2DA 5EAIA 4KR2A 5AJTA 4LF4J 4ZP8A 3F3KA 4DCSA 2PUBA 4OGFA 4GVBA 1M5OC 1VQ9S 3D4PA 3Q5DA 2WIDA 4NZMA 3SX2A 3IRXA 3Q72A 5C5IA 3HHLD 3GFBA 4E7OA 3EGEA 1NM2A 5FWXA 2V4QA 1JBEA 1ESNA 3T9BA 2POCA 2Q4RA 3OUZA 2DHAA 2BCJQ 1Q7EA 5LOVA 2QAGC 4GC5A 3BL8A 3V55A 2B4TO 1QHEA 2D0PB 2GJIA 2C9YA 2LFVA 4IINA 3IQDB 1CETA 3W5XA 4ESVA 3M6WA 2CFOA 3MCZA 3NOOA 3ZLJA 4EYIB 3TBHA 4EKEA 1Q7TA 3AUFA 3SR0A 3GGDA 4RW8A 5I6DA 2WR8A 2RB4A 2G8NA 1E8DA 4KGVA 3GR1A 2V4JB 3HB1A 3SSSA 5AE3A 3QVVA 3O3NB 1H2HA 3BDVA 5C81A 1NHVA 3ZGOA 2C7GA 4KGZB 4ZVMA 3WNVA 1SPBP 1S99A 4O3OA 2WTAA 4HK4A 2VOEA 4GOLD 4YB1P 1XZEA 5JS1A 2UAGA 3E3MA 3GJTA 2CFSA 4LQCA 4BFVA 3L0DA 4EW2A 2W24A 2B8PA 4PQGA 4GVXA 3UATA 1HORA 3UB4A 4DM3A 2FPRA 3ETCA 3P9NA 5CAEB 1RLTA 2ECPA 3TANA 2DP4E 4FFBA 2OQVA 1WHVA 5HMYA 2XCRB 4H1WA 2P7HA 2ZWIA 2PKXA 2I6XA 2AK3A 3ETLA 3PS9A 1GAQA 2OHOA 4BNUA 2WMYA 1WSRA 3HXLA 3OPYI 4U6PA 3WQHA 5TS2A 2GCOB 3KUUA 4QICA 3ISVA 3JYTB 5CHYA 3ZXYA 1U1KA 3LUKA 3WGOA 4F3CA 1Z0SA 2O7VA 2C82A 4ISCA 4TT8A 1CUEA 2R6HA 5CK5A 1X9MA 4O5AA 3BJMA 4BU0A 1HBUA 3GD5A 3H9EO 4RSRA 4CM8B 3HYCA 3ROGA 4FNMA 3UFXB 2D0OB 1IAVA 1SVUA 2JFFA 3OPNA 3HCOA 3I83A 2AI2A 3P4XA 3T3MB 3SOZA 1QYXA 2F62A 3N2LA 2E9TA 3MAAC 3P2JA 3AUSA 2VDRB 3K3PA 1ENOA 1UJBA 3GFGA 1E4VA 3T3PB 3EAGA 5ECGC 4A26A 2NPOA 2GPNA 4ZPBA 3AR6A 1XZFA 3FCYA 2HT6A 4CNZA 4ARIA 3EGVA 1QJ4A 1EJ2A 3SXJA 4PWZA 1MPTA 4FJ1A 1C0TB 1OGYA 1WC0A 3ZYCA 1E5VA 3N9IA 1GFWA 1G60A 1JP7A 2XLCA 4JL6A 1IKWA 1LWCB 1UC8A 1PUIA 3S1TA 4CMJA 3ESYA 1BE6A 3G6XA 4AXJA 2REXB 1NJZA 2Y66A 4FYVB 4JI4F 3GCWA 3COPA 5HE8A 3JWEA 1G20A 3QKRA 3PQFA 3RRJA 4NG4A 3DVSX 4DDHA 1JYEA 1QJHA 3PFGA 4XWWA 4KZPA 5D7BA 1EA7A 1H4VB 3EJMA 1WB6A 2QQFA 2DM6A 2HHCA 4C06A 1U4BA 2ID8A 4RUKA 3DBRB 2FH5B 5B3JC 1CS4C 4DREA 1P1FA 3FI9A 3QI7A 4QLBA 3IEVA 4PX9A 1M6VA 1I94J 2WUWE 2JC0A 3OQMA 1F0PA 3KK2B 1WTBA 3LFTA 1PCXA 1OWNA 3OE4A 3HJRA 1YR1A 2DR8A 4C8ZA 4IDAA 3DQQA 2OHHA 6FDRA 1Z6AA 3TOZA 3RSZA 1LA2A 4B35A 3ITDA 1S3FA 5GM2A 1GLGA 1UBOS 5HPYB 2H48A 1KEWA 3JQ9C 2FEXA 4A6PA 1LW7A 3V4SA 3LCJA 5TMBA 1UPPA 3HKBB 3R7BA 2VA9A 3W4KA 4MLDA 1Z2LA 2XB4A 3ZXWA 3QEOA 2OCYC 3RWBA 2C4HA 3HNOA 4P2SA 2HBYA 3JX9A 4R9SA 4YP6A 2IDLA 4WEOA 3CX8A 4Q4CA 1QV9A 5AVSA 5ALUA 1XRJA 4X95A 3T3DA 4M8IA 4G36A 5JNSA 5KFMA 1MQ8B 5BSMA 5F4ZA 5BT8A 4IKAA 1IATA 1E5LA 4JB0A 2B20A 3S8EA 2CQ3A 3TSZA 3GRPA 3WQSB 2DGTA 4HQNA 3GLFE 1H0SA 4F4CA 4H0FA 1OYYA 4XQ0A 5FUWA 4RK7A 5A0YA 3KMSA 5JQGA 4U5QA 1FZTA 2E85A 1KOGA 1SBQA 3DBOB 1VBFA 5TQ0A 4JVOA 2OHGA 1UBUS 1D8AA 1AT1B 4B7XA 2L2QA 4NK4A 2DEUA 4F0HA 3QWPA 4HACA 5KFTA 2WZDA 2KI2A 3H86A 2H65A 4HEJA 1ZINA 1OW3B 4X8LA 3D7LA 1VCNA 3L4BA 1FSPA 5KPDA 2CKWA 2XUKA 1V11A 4J0IA 1U5BB 5IN4A 4Z2XA 1I5OA 4TLDA 2D0DA 2CHGA 1NJ2A 2CK3D 2QTVA 5JD3A 5DQHA 2H00A 4R0EA 3GUZA 3RD5A 2ZS7A 4IRKA 3KDPA 2CZ4A 4LV6A 1BIFA 3T54A 4FCWA 4CF7A 3ILXA 3G0IA 4IH5A 3S2UA 1GTMA 3KXLA 3FWHA 2J33A 1WHYA 1PNTA 3W9IA 3AYZB 5EJMA 1MRNA 3L6EA 3I5UA 3VNUA 4X6XA 3KAJA 1E7RA 3ONVA 5CGQB 1ESCA 5IXJA 4JFAA 1WMFA 4K59A 3KU4A 3TJZA 1GPYA 1LK7A 3PFWO 2I67A 3GJZA 2O8DA 3W9JA 1C1XA 2Q3LA 1Y3DE 3OJOA 1K8XB 1QDEA 8OHMA 3DCYA 5A4DA 4N3CA 3NHYA 2LNDA 4KXWA 1IY1A 4UFNA 5BSHA 1QLJA 1AQLA 1RTKA 1L4LA 4UNNA 5DHRA 5TSDA 3QMMA 1C9EA 5E1BA 4UF4A 4C8KA 2IEZA 4UUMA 1RBQA 4FGUA 3FDFA 4KO2S 3KVVA 4KKXB 1JEQA 1QF6A 3EXFA 2RT3A 1VPEA 2IYOA 4RFVA 4A8JA 2ZBPA 4ILRA 1JVNA 1WORA 3H97A 1HKUA 2GZOA 3UN5A 4Q6WA 2MGZA 2B9WA 4EG7A 5LKAA 2HH9A 2PIIA 1YHNA 2H1RA 5BORA 2H51B 4K9RA 2AXQA 2VHEA 1ECCA 2PKQO 2V0NA 2DUJA 1S0OA 5TMEA 3ZHXA 1GFWB 1ZGBA 5CW2A 2RIRA 3TDKA 2UUTA 3IRWP 5BSKA 2LR0A 3IKLA 2K7KA 5JCPA 4D5EA 3RV3A 4P93A 3FW1A 2M6KA 1I2AA 1AUDA 1F14A 5DGAA 1DRKA 1E2BA 2YWCA 4TSRA 2XIQA 5JMNA 4F60A 3PUIA 1UPXA 5FD1A 2G0NA 4YMIA 2RD2A 4K9SA 5E2BA 1JHAA 2WK4A 2C9BA 2Q1LA 5CA1A 1NXTA 3KZOA 1I3KA 3PI6A 1VPTA 3JVDA 1UDWA 1LSSA 4KAFA 3CJTA 3IP9A 3DLKA 4EMUA 4AG5A 4ND1A 2GKOA 1AB6A 1BX3A 5AR1A 1S49A 2WIGA 5K0LA 1F0YA 4KR9A 1NBEA 5DB4A 4D1YA 3TNYA 4M5IA 1WIWA 1R8CA 2J9DA 3FYDA 1PLLA 3HVTA 2VS1A 3NVAA 3GV0A 6Q21A 4EHNA 3P97A 4UUNA 1RI2A 3K9WA 4QU5A 5KTMA 1Z17A 4ARZA 3IMFA 3RVOA 4CYUA 1NR7A 3VM6A 5IEJA 2ZIGA 4AXBA 4Z9BA 1GYRA 3TE6A 4IG3A 1E1CB 2Y9HA 4DV1B 1WSAA 1L9XA 5C35A 4BFYA 3QQ5A 3M7IA 1HF3A 2BFCB 3RW6A 3GB0A 2DR5A 5A4JA 1ZIYA 1LBEA 4ZANA 2R8YA 3HLTA 3OI7A 2B4RO 4U6SA 2OFWA 1DG9A 3E9CA 1OFVA 2WKRA 5B2EA 5ETLA 2GVNA 4HN4B 4IILA 1TEZA 2IRUA 3W34A 2PMCA 1TKRA 2VH1A 5EESA 3QYJA 4X65F 4O0NA 3PNYA 1LK5A 4INZA 3SCJE 4G4SP 5A8KB 2DTJA 1B4SA 1U5BA 2O2IA 3M8PA 1WOYA 2TSYB 2Z3WA 3I5AA 5HROA 2W4IA 2PL9A 4A8HA 2IHJA 4BJ1A 4I3HA 3H2ZA 3CULA 4X4QA 2CNLB 4J0FA 2AN5A 2RUGA 4QBHA 4GPBA 3SS8A 3G2NA 4JB8A 3OZXA 4WNIA 4UKDA 4QQRA 2WM2A 3OMWA 1W2WB 2CPEA 1NYQA 2E5FA 2JCYA 2AMFA 4B3MF 3MWLA 2BMDA 1VZ2A 1C1CB 3O44A 4EKNB 3CMMA 4I1VA 1FRKA 2FPIB 1CZRA 1KYTA 5FR1A 2R7UA 3SMQA 3QXHA 3ZW7A 4IGFA 2G9UA 3F5SA 2G76A 4LJMA 3REQB 1C29B 1RPNA 2AVNA 3JQ8B 3MG9A 5CDYA 4QZVA 3M7VA 4GOXA 4QA9A 1E1RA 4EJ6A 3L4BC 3COVA 4RAOA 1MG0A 4JZYA 4TL6A 10MHA 3CFYA 4DAOA 1ENYA 4G1PA 1GCAA 2J6UA 3IVAA 1XN9A 2W2KA 1FE0A 3D3WB 4AQDA 3K70D 3RU2A 2C07A 1E59A 2I4NA 1TD9A 4MV3A 2HZAA 4ZQHA 1HYSA 2VFAA 2W6ZA 1DEHA 3DXYA 3ZCUA 1HNZB 4FT2A 5C8YA 3RVPA 3T99A 4C4YA 1QAIA 5GVQA 1QNLA 2AQIA 5C7PA 2DR7A 1J8FA 4P2MA 4IDHA 1IZ0A 1VE6A 1OGJA 3OY7A 3R0QA 5HVHA 5A0TA 4C11B 2HYIB 4FOSA 4QRDA 2CZGA 3A13A 4YMSA 4EI8A 3HI9A 2IX9A 2F9MA 5JALA 2VJKA 3CZMA 4DR3F 1MBZA 4UEWA 3CINA 1MFPA 1H0HB 3KSAC 3C87A 2EYUA 4PG6A 4D6YA 2CMHA 1DIOB 4I9HA 4EELA 2XJ4A 2MINA 2ZRBA 3WX4A 4E31A 5AJXA 4EW3A 4Y65A 5FI5A 5TQ2A 3HYRA 1UKBA 1OZGA 4PPGA 2HZVA 3PEVA 3KM0A 3CVOA 1G38A 4DQKA 1RSZA 3A6DA 1DC4A 4MR8A 5DNAA 3H5WA 4JQOA 2DFVA 1M2OA 1D4ZA 4CV3A 1CNEA 2TYSB 2O8BB 4RKFA 1T5BA 1RAAB 4Y2MA 2PX0A 1N3IA 4A23A 3UM9A 2F8EX 1E6LA 2QD1A 1XGKA 2AW5A 3KHUA 2H0QA 3QV1A 4WE1A 2RS2A 2W58A 1TMKA 1WPXA 4MVCA 4U0KA 4G0ZA 5KYUB 3T95A 4PG5A 1EFKA 4CR7A 4FEGA 4RABA 4ZI5A 4JOQA 1HPLA 1PJTA 2BA9A 2BGJA 1E18A 1UP1A 3I0MA 3CNNA 2QVZX 1HI1A 4OYMA 4ENSA 1ZPVA 1HE3A 2BFWA 4GXTA 1K75A 1PAUA 1RRKA 4TZ0A 1CZUA 4LRUA 4KLRA 4OK5A 2ZBVA 1GZ4A 5ED4A 1PK7A 3CBQA 5J1NA 1Q0NA 1NXSA 3NYQA 4WV3A 1NRXA 4BP9A 5FI0B 4FMBB 1XWFA 3ZJ4A 1X5TA 4K0KB 5BYAA 1V8PA 5DKFA 1YQEA 5JHGB 4ECUA 2IZ5A 1ICIA 4HH1A 1Q1NA 1RLIA 4USVA 3ZXIA 1T3OA 3TOXA 2A9KA 1RAAA 3DTYA 3BGDA 3OLQA 2O0JA 1VG0B 1ZGAA 2HAIA 4QJ4A 1M1ZA 3IAS9 3B6ZA 2AI1A 5IW8A 2VF8A 1S7IA 4M8LA 5CH7B 4HFNA 1AUSL 3ND6A 3ROEA 2G3YA 2BMAA 1Y5LB 4JXKA 2VFSA 5AWFC 2GQ2A 4AD6A 4A8KA 4QKQA 4JR0A 1REVB 2BMFA 1WULS 4G5QA 1L7RA 5C7IO 3TI7A 1FKPB 4JI7F 3BHMA 1XDUA 4E3WA 2F9FA 4W63A 1C9YA 3PFEA 3CF0A 5GJWC 2JLUA 2UUBB