3GP9A

Crystal structure of the mimivirus ndk complexed with gdp
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
133
structure length
133
Chain Sequence
AGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 43
structure length 133
sequence length 133
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2009-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3gp9A00
3BBBA 3DDIA 4F36A 3WX8A 1NDLA 3VGTA 3NGTA 3Q83A 3ZTSA 3BH7B 1B4SA 4ENOA 1BE4A 3EE3A 3PRVA 2CWKA 1F6TA 3FCWA 5CAAA 1UCNA 3Q8VA 3ELHA 3EICA 3ZTOA 1NLKL 1JXVA 3FBFA 3ZTQA 1NPKA 3EVOA 4UOHA 4HR2A 3VVUA 2B8QA 3EM1A 4F4AA 1NDCA 3FC9A 1HLWA 4FKXA 3Q8UA 2BX6A 4CP5A 1W7WA 1HIYA 2DXFA 4DZ6A 3VGVA 3ENAA 1MN7A 4S0MA 5C7PA 4ANCA 1BUXA 1XQIA 4WBFA 4C6AA 3EMTA 4DI6A 2ZUAA 4FKYA 3FKBA 1B99A 5BXIA 3PJ9A 1WKLA 4ANDA 3VGSA 3B54A 3FBEA 5IOLA 2DXEA 3Q8YA 2DY9A 3Q89A 2AZ3A 2DXDA 3Q86A 2HVEA 3FBCA 1VYAA 3R9LA 4EK2A 3VGUA 2HVDA 1S59A 3DKDA 1WKJA 4W98A 1NCLA 1ZS6A 2VU5A 4ANEA 1F3FA 1MN9A 1NSKL 3ETMA 2DYAA 4O0NA 3BBFA 3ZTPA 1LWXA 1EHWA 3NGUA 3MPDA 4KPCA 3B6BA 1U8WA 4UOGA 3EVWA 3VVTA 3ZTRA 2AZ1A 1NUEA 3NGSA 3EVMA 1NDPA 1S57A 1K44A 3GP9A 3EJMA 1NHKL 3FCVA 1HHQA 3GPAA 2BEFA 1S5ZA 1XIQA 3G2XA 1LEOA 2HURA 4UOFA 1PAEX 1NB2A 3FBBA 1PKUA 1NDKA 1BHNA 4DUTA 1WKKA 2NCKL 1KDNA 3BBCA 3JS9A 2B8PA 3L7UA 3BH6B 5CABA 3NGRA 1NSPA 1NSQA
chains in the Genus database with same CATH superfamily
1NSAA 1VRTB 2XY5A 1UMJA 1RT6A 3WX8A 1R0AA 1YLXA 3UW1A 5A8RB 3CJSA 1FEEA 4OX9F 2CJBA 2NR0A 4Y2CA 4PR6A 3GJQB 6AT1B 3BQ0A 3D0GE 4WFYA 3ILOA 1OMSA 4HACA 4O3SA 2XULA 4XDCA 2XYPB 4NLRA 5HQMA 3DDNA 2Q79A 4JBCA 4PPDA 4DU7A 5J2PA 5F0WA 1NMEB 5DO2A 1NJYA 3W8GA 4I1TA 3OLAA 4ATNA 4OYWA 4BC7A 2V2ZA 1ZZFA 2LCWA 1HBUA 1WHVA 2FJBB 2HZAA 3G8TA 5GMDA 5LMNJ 3PKMA 3B4DA 4CI0B 1KFDA 4F4AA 2XZTB 5CA5A 1Y10A 2Y1LB 2QSFA 2W01A 1CULA 5HN0A 2HIQA 2XCAA 1ZM4A 3BR9A 3HVTB 1IUJA 3QIPA 4XK8C 5DQHA 3KHLA 1VBZA 2N82B 4N8OA 4YDXA 3J80U 1MSWD 3A12A 3QT7A 5ETPA 4QWBA 1KTQA 4QW8A 2HRTA 1Q95G 2CIMA 3EMTA 4LT6A 2GVDB 1HNVB 4WFNQ 3TZWA 2DNGA 5C24A 1X60A 4NCAA 2Y9HA 3E2EA 4DR6F 3CCES 4ZLJA 4TLQA 1JLFB 3UPFA 3J7A1 4ANDA 2QYCA 1RP5A 1GX6A 2ATCB 3H8YA 3IBWA 5KFFA 1IM4A 2D9OA 3IMQJ 3OR2B 3ZZ0A 9RUBA 1R43A 3MCNA 1SBRA 2CWXA 5D8HB 2CDQA 5IFMA 1AYEA 4BS2A 1UJ4A 1KS2A 3CDWA 3UDLA 4LFAF 3DHXA 4CT9A 4PQUB 1U25A 3KLVA 2YKPA 2ZWOA 1OPIA 1NO8A 2FPHX 3M2VA 3U7JA 2DGSA 1VBKA 2VG7B 3PYFA 3TUIC 2RDJA 1VBYA 3JAMY 1AW0A 4ZMMA 3PX4A 2EEYA 3CDUA 5JXSA 1WNEA 3BGFA 1YJWS 3ENWA 1R27B 2M2BA 2V34A 2H5JB 4ZA1A 2FY1A 3H5XA 3D0HE 1T11A 4F50A 1U1NA 4F8RA 2Z2LA 4YHHJ 2VBWA 1JLCB 1IKVB 3FVYA 3KKFA 1TKTA 1FTRA 5KFGA 2LEBA 1N5SA 4NEYA 1RISA 4JI3J 1UVNA 4F67A 3MCOA 1T9VA 4RW7B 4QWEA 1YG0A 3OTDA 3DLBA 1N52B 3N9UC 2RIJA 2VKZG 3N6NA 3M9OB 4A8MP 2B3TB 3MOZA 1U1OA 2PE8A 2O5DA 5KFEA 4TU7A 1TK0A 1QUVA 2LP4A 4J9UE 1UTAA 1WF1A 3TR5A 3PW5A 4FXVA 3SCLE 3M6XA 4ECVA 1NKEA 2Y0BB 1VQ7S 2BOPA 4LFBJ 3C3LA 3T1HF 1Y11A 4CT8A 4K4VA 1RLDA 2IVFB 1WEYA 1WC1A 2ZITA 2JLFA 1F9FA 1KQGB 4ILMA 4USTA 5MLCV 1KVIA 2LA6A 1MMNA 2E1PA 3SBMA 3IBFB 1NUEA 2O01C 4ZN3A 1SJRA 2WCXA 2ATLA 3CD0A 1SC1B 2C2KB 3IRXA 4ZP6A 1DY3A 4C8NA 2Y1RI 2KH9A 2C28A 5K5MA 4DUZJ 2ZH6A 1WHYA 4MKVA 5J2NA 2MKIA 4LF8F 2I2YA 2ADBA 1NJZA 3I0SB 2GQQA 2RRAA 2NQPA 3HHLA 4U7UK 5A8KB 4GC6A 1PAEX 2XMTA 2LKZA 3S6EA 3UN2A 1Y5NB 4KY3A 1BQNA 4RW9A 4PCQA 1HARA 4X4QA 4KTQA 1KDNA 2CADA 1S99A 2GCFA 1HBNA 1X4DA 4ZPVR 5GADU 4PWDA 3G6YA 3QPIA 2FLNA 3DOKA 2IM3A 3HVRA 2BQRA 3Q2TC 1OPZA 2VG6B 5K8OA 1FFWB 1NDLA 2P9EA 4ELUA 2K1RA 2MZSA 4BWMA 3QFHA 3TJ8A 2OAUA 2ILZA 3IR6B 2IJNA 1KSPA 3ZTSA 1H72C 2VJUA 3AA9A 2GJFA 1JLGB 4Q7AA 1KTVA 2CZ4A 2HNYB 3FEYB 3GIRA 3UWTA 4CH0S 5J2QA 1FJEB 5AXNA 2IM0A 4Y2AA 4ZLLA 3T1YF 4LQ9A 1F6TA 3MAHA 2C3MA 4J9RA 1U2FA 3H5UA 2L08A 5F8LA 4K59A 2GJ2A 4DFKA 1HL6A 4AL5A 1Y0HA 4OYOA 4USJC 4Y6IA 3G82B 3BKUA 4JI3F 1IXKA 1RUSA 3EZOA 1HWLA 1BXNA 2AYMA 4I64A 1NH7A 1PG5B 2B8QA 2GHPA 5L39A 2HNDA 5HO4A 1T03B 4JI8J 5L8RC 4IOAQ 1WELA 2VBYA 2VFRA 3M1VB 1ZBTA 3IM9A 3JSRA 1N32J 4NXNF 5LXYA 2HNYA 2G13A 4DL6A 4OJGA 3TA2A 2XGQA 5J2QB 2HFNA 1D9FA 1ZA1B 4Y34A 1M5HA 4K50A 2ZKUA 2FGCA 1KFSA 3ISNC 1N33J 2J6UA 1X9WA 2B7CB 1TKZB 2IRXA 2RQMA 2ZNYA 1C1BA 2O3DA 3VGSA 3DN9A 2RUGA 4UF4A 2NREA 1T9WA 1XNRF 3CJQA 1IBCB 1WG4A 2MLZA 4ECYA 1RWPB 2HS4A 3FEZA 2XHCA 4LRFA 1FRXA 5KG3A 4BBYA 4ZHRB 5KT7A 3C46A 3R5DA 3KUGA 2YWHA 3OXFA 4X64F 1FKAF 2HHUA 4ITSA 5A8KA 5HBMB 2F40A 3W2VB 1VYAA 5KT5A 1W25A 4H54A 3T19A 5KFZA 4N56A 2RSQA 4DV7J 1NBEB 1SJQA 1Z2ZA 3PG9A 3VGUA 3RAMA 5RUBA 2M88A 2YNIB 3DLEA 3TZYA 3G6XA 5KFIA 3BGRB 4Y3CA 1X8DA 3GZ7A 4PXBA 4EO8A 5KFQA 3TQ1A 3PW0A 3OXLA 2VU5A 4PRFA 2J8AA 2N4CA 3HVAA 4NLVA 4F0MA 1KRPA 3ULHA 1JLEB 4AFFA 2DISA 3OVSA 1F3FA 1MN9A 1WHWA 1U7LA 1TFYA 1S7IA 3PX6A 3TA1A 1RA7A 3MCSA 4EYHB 1HNIA 4NCBA 5ETSA 2LA4A 3MAQA 3QWPA 4DL2A 1CQMA 4N77A 1XR5A 1R8AA 1RT5A 2VG5A 3DOLA 2HFSA 1R0AB 4WZMA 2B43A 2N3OA 4JI2F 4RW7A 2R8JA 1LWCA 3EVWA 1XWLA 4H4KC 4A8FA 1WG1A 1KD1T 1F1BB 2JEFA 1HWUA 4AE5A 3GFHA 2YH0A 4P71A 4NLGA 4PG8A 4RW9B 4LVNP 5L1LA 2DGQA 1FO1A 4KGZB 3P4UB 3HK2A 4K4ZA 3HHLB 4AUKA 3R5CA 3IG1B 1R8CA 1WOOA 3UD4P 1A7GE 1DLOB 2V8VA 4QJVA 1R0CB 1HHQA 3A8KA 2HW3A 4NYOA 1TL4A 1DTTB 5IQ6A 3DRRB 4AL6A 2AJ1A 3R3TA 4OLOA 1IJEB 2PMWA 1H73A 1KQFB 3TEGA 5KFXA 3ZZTA 3Q8SB 1YITS 3KG1A 4DHVA 2WTFA 2L9WA 1FVQA 4M5MA 4N47A 4J9NA 3M6WA 2LXFA 3H0PA 4KGXB 2MLXA 4LBPA 2RU9A 1TUVA 2I38A 4K7QA 1KOOA 3NGRA 5IS2A 3K2YA 1OYDA 2ZOGA 4JB8B 1NSPA 1URRA 2AMCB 2GV1A 1RE1B 4RUCA 2W7PA 3R1HA 1RYRA 2E7WA 3ZFVA 4ZIVA 3CJ4A 4ER8A 2VONA 1KNZA 4RNOA 3NAHA 4KKOB 4F3MA 2HBYB 3RW7A 3AFGA 2ZUGA 2ZZTA 1IBKF 4FBUA 1HNWJ 1N8RT 1O8BA 2R7VA 2N7YA 4IO1A 5F0UA 1HNXF 1LXNA 2JJ4D 1OQ3A 3ELHA 1WC6A 4UQTA 1SXLA 4DF4A 5EN1A 1RU2A 3T1YJ 1WC3A 2G0IA 4M5KA 4M5DB 5GVQA 3T9ZA 4CZCA 3V4MA 3KG4A 1Q0NA 5HATA 3T5JA 3NWRA 2DY1A 2DGWA 1DARA 2GO8A 4RW6B 4Q2LA 3DGVA 2WVBA 2V2KA 1PYOB 3GG0A 2QL7B 1HLWA 2U1AA 2KM8C 5F8GA 4O23A 3TRGA 3CCQS 5BR8F 1Q16B 2A2DA 2DB1A 2ZC3A 5HQ8A 2ROGA 5HMYA 5B09A 1MLAA 1MNEA 2OEJA 3MM8A 4DPOA 3QO9B 1FWKA 2MQNA 2JNJA 4RW8B 5IM0B 2FZCB 2XBPA 4URQU 2VQEJ 4P7VA 2C3PA 4F4YA 4C8OA 4C6AA 2GMLA 1Q8BA 1FI4A 4IFVB 4MAKA 3G6VA 3M8PB 3MTJA 1VRTA 4ES3A 4U8VA 5L1KA 1AXQA 1U1QA 3IWXA 4IQMA 3KOAA 2DIVA 2V63A 1RKIA 1ZA2B 3AD9C 3M1VA 3NS7B 2QFJA 4O3RA 4X4NA 3N01A 4X2BA 1CULB 2P9CA 4ZP9A 2VASA 4ZPCA 4CLZA 3U27A 3ZNUA 5GAGU 4HYKA 3RBDA 4C8LA 2E5HA 4NLYA 1TV6A 1NK4A 3RUBL 3W62A 1SC6A 2M7SA 6FD1A 1VK8A 2JC0A 2CQDA 3D28A 4ALZA 2UUCJ 3NOGA 2QA4G 3ILIA 1TFWA 3R9LA 1AZSB 2KYXA 2W4PA 1YIJS 2MJNA 4RBTA 1K47A 1D09B 2GGPA 1B7YB 2DTJA 2EFQA 2GHWA 2QIFA 2X1BA 3H42A 5FDLB 4C48A 3W63A 2N7CA 2KG1A 2HWTA 3EZ5A 2E5LJ 2HHHF 1HYSA 4MK9A 4AQYF 2WVCA 5J1NA 1PILA 4WTOB 1XN9A 3MPVA 3PTWA 1KLMB 2VFTA 3MEDA 2MPUA 3FZ2A 1W26A 4Q45A 3UD3P 2Z2ZA 3KHHA 2L3MA 5G4DA 4RU2A 5I3QA 1RT6B 1PJ6A 4LF1A 1PJ5A 4NXMF 1XTZA 2CQ3A 4OZ1A 3SCKE 4V19J 1ELOA 4MMOA 3CJTA 2CPFA 2DNQA 2YX7A 4UTGA 5GAHU 2GS8A 2D69A 2Q43A 4FNHA 1EHWA 4IG0A 1T3NA 2GO9A 3A8EA 4KIAA 4MIWA 3GCWP 4O4GB 4QYRA 5A8WB 1LFPA 1RAIB 3MAAA 1CPZA 4O44B 3SQOP 4PZVA 4TY8B 3KJFB 4LSLB 3A3PB 1FE0A 5JVGQ 2JH3A 2BJDA 2WVDA 4D3HA 1S4EA 5C2CA 1GXTA 1T9TA 1UWBA 2DR6A 4XIUA 3SCJE 5CCLA 4LREA 1CSJA 5D4NA 2JEIA 2NPIA 2OFGX 4WJBA 1JB0C 2X3GA 1LK5A 2YPYA 3T6JA 2J7WA 2V0NA 3OJUA 5KT4A 2IIHA 1LW2B 1XMBA 1BQMB 4CH7A 4UOFA 4CNYA 5A2QU 2YNGA 2VIHA 5HMWA 4PPZA 4NLTA 4DL0C 3CXCR 1TL1A 4DUTA 2Y1JA 1LK7A 4HACB 1PGZA 1BGXT 4ES1A 1NK9A 4FXDA 2ACYA 2HS0A 4A46A 3CD5A 4IYQA 5HQLA 2A3JA 1S6PA 4M5HA 1LOUA 2F9DA 2J8SA 3V4IA 2HYIB 2V68A 2UUTA 4NLDA 3MMAB 2HVIA 4FYXB 5A8RA 2VL1A 5D0RA 1XNQF 2W7OA 2KG0A 1JLAB 3Q22A 3J7YU 5IV4A 4FS1A 3QT8A 5GAHI 1QLNA 4OYZA 3DMJB 1E6YB 2DBBA 2HAFA 1QVFR 2JC1A 1YBTA 4ED0A 3CMQA 3QJJA 1U49A 4DR7J 3V2UC 3W8PA 4ZCKA 4X84A 1K1SA 2DNHA 4OI4A 3VWSA 4WFAQ 1JXVA 1FJCA 1S9EA 2CQHA 2KL8A 1L5UA 1S1TA 5LSRA 1QTNB 2H3EB 3UNYA 2Z2YB 3VVUA 1CJTB 2K2PA 4CO2A 3TARA 1DZ5A 1B0VA 1H6KX 5FD1A 4CLLA 2MYFA 2FVCA 4FKXA 2P2CB 5LMUF 4DSKA 3I4HX 1W7WA 1HIYA 4M63A 4QIEA 4J9LA 1P9YA 3NNCA 3FJ2A 1MN7A 4DR6J 1FDNA 4S0MA 1VQOS 1KVKA 1SI9A 1F9EB 3OFFA 1RLCL 1D3WA 1U8SA 1SKRA 4B17A 1S1VA 5U47A 4HVZA 1GT8A 1RHRB 4NMXA 4WK1A 4WFZA 3V6JA 3M6UA 2IVMA 4DQIA 2C2MB 2J9CA 4UW2A 2D1CA 2W4DA 4RX6A 3KHGA 1N36F 1RT1B 3MEGA 1X4GA 1H98A 3HPOA 2AT1B 2B4PA 2DO0A 3NAIA 1Q53A 3K17A 3C8YA 4WYWA 4C8YA 4IFYA 5DDPC 1BQMA 4KE5A 2CRLA 4F26A 1X5TA 3K5OA 3NL0A 1SQGA 4OL8A 1RTDA 4FF1A 2E7XA 1R6VA 2C3UA 1UKUA 4K8RA 3K5PA 4M5LA 3SMZA 3BKFA 1JNZB 1R8PA 5DG8A 3T5KA 3HHNB 3GJSB 3CJ2A 4NA1A 3OVBA 1SH3A 3PFEA 3CUNA 4B3TF 1S1XA 1E6VB 3L95X 3OTOF 2XNQA 2VV5A 5D77A 2B56A 4J9SA 1B70B 3TAMA 4I67A 3V4IB 5KFRA 4RUAA 1EB0A 4O4GA 5D4OA 1QAJA 5AXKA 1S6PB 3W66A 3POTB 5ETMA 4ZVPB 1IBKJ 3PIOQ 1BWEA 3F41A 3NGUA 4LRBA 1X5PA 4JUZA 2OELA 2FY8A 4DR4F 3D6HB 1RBLA 1C4AA 3KK1A 4DS5A 3OL6A 3RU0A 2YNGB 5K8MA 4XPCA 1TVRB 2XYHB 1UVLA 4L74A 3BSCA 4F25A 1YX2A 1ZAVA 3FDSA 4MFBB 5A0YA 3JSMB 4ECRA 3FQKA 1RBOB 3UNGC 2LMIA 3ZTRA 1YBUA 3NKYA 4DR1F 2E1AA 3EGNA 3NGSA 2M4MA 1FNMA 1HPZA 1RWUA 1ZAWA 3DYAA 1F2HA 2BJEA 5HVFA 1VJWA 2QL9B 5CXTA 2VZ9A 3D67A 1GMWD 2IBOA 1VQPS 3M8QB 1UZDA 1XBWA 4NCGA 2CZ9A 2CDRB 3T1AA 2XGPA 3T5HA 4UUWA 3MECB 3TVYA 4K4YA 2HQGA 1P8GA 4DPWA 3K89A 3ONQA 2Y0SD 1IKYA 3JAMU 1K0TA 2MXYA 1MW7A 3AODA 3MR7A 4HKQA 1P6TA 2J9EA 3ILLA 1X5OA 2V4RA 5LMUJ 3US5A 2GX8A 2KDOA 3A3NB 1VC6A 2CA9A 3CJ8A 4OZ0A 5DDQC 2ZH4A 3CSKA 1QSLA 1HNWF 1FFGB 1VMBA 3PYEA 1TAQA 4ECWA 2MQ8A 3IC1A 1UETA 2VPZB 3TUZC 4X4PA 2OPPB 4O3NA 1YJVA 3G87A 4L73A 3KLIB 3H2LA 3K0JA 3KG0A 5IC4B 4DPUA 3IS9A 4YFUA 1NJIT 2LQBA 2IHR1 2PGCA 1NB7A 3C2PA 3AJ2A 3M2UA 2BM1A 2PEHA 4ZJLA 3D9BA 3MPUB 2E44A 3B4MA 2B9YA 3N28A 4QCLA 3LW5C 3MPYA 3MURP 2WBMA 1RJJA 3LPYA 3DGPB 1NNDA 2ADCA 5F3ZA 2UXDF 1HBMB 1LFWA 4OHYA 3HSJA 4DV7F 3BYPA 4USVA 5DDRC 4DF8A 1N0UA 1C4CA 1X4EA 2EFNA 2R42A 3A8IA 3DI6A 4DZ6A 4X4OA 1SVDA 2IRYA 4KPYA 1KHVA 2VICA 1B0PA 2J0WA 2X1GA 3D1HA 1UEKA 1WDDA 2R7SA 3ADAC 2DIUA 1RSCA 4DZDA 2DPIA 4OI3A 1C0UA 4DQPA 2R7QA 5CCMA 2R9LA 3QO9A 3MMCA 4RW8A 2D74B 5KG4A 3NGDA 3PVXA 1QE1A 1YVFA 4V1Ak 5K20B 2DHAA 2ZM6J 3NRBA 4KSEB 4PG7A 3DNCA 3F56A 2DXEA 2BDPA 2ASDA 3BN7A 4HDHA 2RAQA 3VAMA 2D3ZA 3I31A 5AT1B 4NL5A 3MR3A 1N0VC 1T9UA 4OZ2A 3BPSP 3Q86A 2LDYA 3OXGA 4NRTA 1JLQB 3HVWA 1S9EB 1I94J 1CG2A 1F0XA 2LEPA 3GV8B 2KFNA 1ZM9A 2HZVA 2DH7A 1RWWB 5HSPA 1I6JA 3BGLA 1JXEA 2B9XA 2FHJD 2HHPA 2IFXA 3EDQB 3CO0P 3LUYA 3R5BA 5HK4A 3FQLA 2FLOA 3E01B 3KK2A 1SH2A 4R5PB 2UV8A 1LWCB 2ZHAA 2CQ1A 4DR5J 5KFWA 4WXOA 3H4BA 2YH1A 2BM0A 2W24A 3GFXA 4IG3A 1M5VC 4B9MA 3BM7A 3O44A 4YMEA 1KLMA 1OY6A 4B9NA 2BYCA 1EQ0A 2ZOFA 3AJDA 1DTQA 4FPRA 1G1XA 1AUDA 3OT9A 3IO1A 3SV4A 3UQSA 2CQBA 2MZJA 2Z57B 3B6BA 5BJRA 2E5LF 2M8DB 5KFCA 2PI5A 4P52A 3SDEA 3NCPA 1X0FA 4ZJQA 4WFBQ 3H4DA 2V4JA 3W5XA 2VQFJ 5H9EK 2F8EX 3DRRA 3GYGA 2CPEA 3VVTA 2IDLA 1EJ7L 3KJQB 2QV6A 3GJRB 3U1LA 4DG1A 5C42B 4UT4A 2KJVA 3EVMA 5C2GA 1LQ9A 2DKOB 4R8UB 4YY3F 1R6YA 4HTIA 3WQPA 4A8YA 1U4BA 1HNZJ 4H4MB 3EJMA 4KB7A 2HIYA 4A48A 2CYYA 1NHKL 1S1UA 4O4RA 2DJWA 2OIHA 2K7JA 3FCHA 3TUPA 3RRHA 4RR5A 3BQ1A 2I6WA 4IKAA 1T95A 3UDCA 1ZTTA 1TKXB 2XTJP 3UCUP 1KKHA 3BS9A 4KHMA 5ETRA 3RB3A 3HD1A 1HR0F 2DNRA 4IFVA 2HGLA 3A4TA 2WSEC 1HWKA 3DFEA 3UN3A 3I0RB 4ZIWA 1S10A 1UJ5A 1DBDA 3BH6B 2YWFA 1V5VA 4DS4A 4IH7A 1NM2A 1W2BR 2R7UA 2EFOA 2HZCA 2EG2A 1MMLA 3DLGB 1PSDA 3QLHB 2CNOB 2K3KA 4JV0A 2BQUA 4Q8EA 4CO5A 1H74A 5ETVA 4JI5F 4MTPA 3GV5B 1KQSR 1Q78A 2ZH8A 3M30B 3M8WA 2ZBPA 3W9HA 1FVSA 1S49A 2EFGA 3CCLS 1UL3A 4U96A 4F04B 2YXLA 2QLWA 1UCNA 2HFVA 3DLEB 2DITA 3JSBA 4N8NA 4TXSA 2KFZA 3D2WA 3THTA 1T03A 4P2FA 4C98A 2V2VA 2AGPA 5DQGA 4MYTA 3GR1A 2UUAF 3SIPB 1ACMB 4RZRA 1GH8A 2Y8YA 4RKUC 1JLBA 1U02A 3P96A 4NLPA 3MD1A 2BV3A 1QAYA 4RNHA 3RBXA 4WPAA 4HL9A 5DDOC 2BMBA 1V9OA 1TR0A 4PG6A 5DQIA 4ILLA 2RILA 4ZS6A 3LPEA 5ETQA 2EK6A 1TUWA 3CNQP 3ENAA 1PO6A 1XJWB 3FGVA 3NG8A 4L75A 5DETA 1BUXA 2RDIA 3A13A 2PMZD 4DR2F 2RKIB 3D3CJ 4OV1A 4LFAJ 2VQEF 4RBUA 2ZNZA 3QAEA 4EU0A 3AB4B 4K4WA 1XR6A 4NMLA 2JZ5A 4QR2A 1JMTA 1O6XA 1ZYQA 2D3UA 4O3PA 2XMVA 4R0EA 4OJ3A 1P1LA 4X62J 4XTTA 4ED6A 3PY8A 1OY8A 2CFXA 2HQFA 2XNRA 5E33A 1BMQB 2KZZA 2H9ZA 3EX7B 1RAHB 4J9OA 1KC8T 4KRWA 1TUGB 3KLFA 4OX7A 3HZEA 3HHEA 4M5DA 1NPRA 4IG3B 3TJ9A 3I0SA 2OMLA 3IWNC 3Q24A 1TP7A 3HHKA 2BOAA 1HWIA 2W4CA 2R3VA 4I6AA 2YKNB 1RADB 4KAIA 3DOMA 1H0HB 2ZD1A 3MEKA 4WP9A 2M3DA 5KFAA 4ZCMA 1D8YA 2FJWA 2HKEA 2B4OA 1S79A 2HMIA 3N79A 2AD9A 1WUUA 4QIGA 1NCLA 3CDBA 4KGKA 2FVQA 2IA6A 1L3KA 2P8IA 3BR8A 2RRBA 2Z0GA 3M8ZA 1T05B 2VBZA 4OZ3A 1V6HA 2W7AA 2Q1LA 2VG6A 2MHEA 3FFIB 3UVJA 1T94A 1O0PA 2J0SD 1QD1A 3RR8A 4WU3A 4L3NA 3PRBA 4EBEA 1VGYA 3MR5A 4C8KA 3LP2A 5ETOA 1Y00A 3LGHA 2IM1A 2LXIA 3R7BB 4WKYA 2LQ5A 2Z8QA 4PWDB 4X4UA 2IBKA 1KQKA 3HSDA 4PKDB 3FSXA 3QFWA 4A4JA 3BGRA 8RUCA 4ES2A 2ERRA 1QM9A 2G2YA 3G8QA 4OHZA 2ZJRQ 4DR3F 4A8QA 5LL6d 5EWGA 1CLFA 3TW0A 2DNZA 4ZN1A 4B9SA 3HM9A 3DU5A 4DX8H 1IKVA 2FC8A 1YRTA 4HHUA 2OMOA 3IG1A 3N6LA 4ID8A 3W2VA 3KWMA 2COLA 1NJWA 3CMAS 4B9VA 5M2PA 1U24A 5HL7Q 3OW2R 4ED1A 2PC6A 1WOSA 3W9IA 2KU7A 1FJ7A 3PEHA 4FN5A 3UR3C 2BANB 3MM6B 3BF4A 1S5ZA 2D7SA 2VD3A 3OR1B 3R7NB 4W90B 1RI7A 3GMGA 2UXDJ 2NXNA 2JEJA 1BLUA 1NDKA 3QRRA 3P45B 1BHNA 2EI5A 1X4HA 2W25A 1MROB 4ZVUB 5AE3A 2XC9A 3M05A 2DRAA 2OGUA 3JS9A 4DV3J 1WTBA 4P9SA 4DR1J 3GIIA 1WSVA 4B3RF 2ZDOA 5IWAF 4DFJA 1RTIA 4OIXA 1KBRA 3D1QA 2XWXA 3Q0AA 1VBXA 3RG6A 4KFBA 2I0XA 2MY7A 1QUPA 2OH2A 4C8ZA 2CNNB 2MTLA 1SKUB 1G2EA 3O5TB 1JLEA 2AJFE 3Q83A 1KONA 1HQEB 2DHXA 4C3LA 1KN6A 5B0EA 4AYBD 3PIPQ 1VQ5S 2YNFB 4DV6J 1JNRB 2A18A 3TWZA 3BJYA 2AGOA 4ZPBA 1SL0A 4LF4J 2YBVA 4I69A 5BYQA 4OFZA 3OD2A 4TKTA 2FZGB 4P7TA 5I4MA 4WP8A 2YQ0A 3EICA 1YWXA 2AHOB 3HFKA 3KUHA 1FD8A 5D15A 1TL3B 5AE2A 1V3ZA 2G0CA 3VQSA 3ZTQA 1CC7A 1MG7A 4ZLPA 4OYMA 2QYGA 2YKAA 2BRKA 4JI5J 2DNKA 4DL3A 2HFOA 1LWFA 3MEEB 5CQGA 3VCDA 3EGWB 4ZHRA 4X62F 2K1RB 4A8WA 3BGOP 3FC9A 4RJVA 5KFSA 2MSSA 2FLLA 4NASA 5LSLA 4CP5A 1C1BB 4FZVA 4QR1A 2KRRA 3CULA 2AQ4A 4KHRA 3CWJA 4M5GA 2M8HA 1JLFA 3T6BA 4P10A 4G1QB 5B0BA 4TLRA 3KXDA 4A47A 2AWZA 3IN5A 3CB4A 2AJ0A 1FE4A 3GV7B 4CLTA 2KT2A 4O3OA 1G7CB 3UDEA 4KH0B 1VCTA 3I5AA 3KTQA 2D41A 2KJWA 4ECUA 4Y28C 4U7UD 2F63A 1FJGF 2H54B 3C6TA 4DCJB 5J2NB 4R0JA 3LAMA 4ZVRB 1NK0A 4UUXA 5DZ7A 2MQMA 2MLYA 1HNZF 4JI6J 2XSJA 4CWBA 3ILJA 2ZJPQ 4EBCA 2GNKA 1NZAA 3K59A 1U1PA 4C4WA 3QRQA 4Q0BA 3BKTA 4OQJA 1AT1B 3KJNB 2FVRA 2GQ2A 2FHMA 2CQCA 4RNFA 5G0RB 2VH7A 2HHQA 1S59A 1RWVB 1WF2A 5J2PB 2KXFA 4ZVTB 2VA2A 4AT1B 1TMJA 1DQ8A 2EC0A 2E1RA 2GFFA 3K58A 2MQLA 4J9KA 3TX0A 3MPWA 3PO4A 1VR6A 3HO1A 2DNMA 2HS3A 1CEZA 5D0GA 1HFEL 1BD6A 4KC5A 2AF6A 2HBRB 2YKMA 2M70A 4WP3A 4U8YA 5KG7A 1U1MA 1N5YB 4DEZA 1YI2S 2XSFA 2RH3A 2K7KA 1TU0B 1JLCA 1VJQA 4U67Q 4CDIA 2M0GB 2AYEA 4Z7YA 3TNVA 3P49B 4ZVFA 1IR1A 3LGMA 4I2PA 4CIOA 1BQXA 4DQQA 4Y2KA 1S0MA 2HRUA 4IDKA 1RB0A 3P6YC 1LNQA 4RW4B 2BBEA 4P2XA 3NEKA 3Q2SC 3JTPA 3F44A 4KBIA 2JLGA 2IA0A 4OI2A 2A10A 4IUFA 2G1DA 3L4BC 3KLGB 3TVZA 2DNYA 2KHDA 1FK9B 1CJKA 2NYIA 3HZGA 2ZM6F 2MY8A 1IQZA 2ZC4A 2VODA 1T02A 2XEXA 2DGOA 4DV1F 1HI8A 2DH9A 1GXLA 3VV2B 1XC9A 1SKSA 1FKPB 4ECTA 2CQPA 3T1HJ 4CLFA 4RWXA 3M8SA 1GTHA 3DC2A 5F41A 4IRCA 5GAGI 2VOOA 1GK8A 1VQLS 4EYIB 1J5EJ 4YQWA 1RYSA 3PNIA 4F3OA 2H51B 4Z37A 4OHWA 1NHUA 2N3LA 1VRUA 4JOUA 3FBFA 1NSQA 1N6QB 2RQCA 3CCMS 1I5OB 3MM5B 2L48A 2OHDA 4HI2A 3OV7A 2HBZB 2QLBB 3ZNJ1 1E6YA 2V9WA 1S7HA 3TA0A 3UFCX 4CLWA 3DLLQ 1HBMA 2FJAB 5D0EA 2PA8D 4QIWD 2E5GA 4J7CA 4YHHF 1QTMA 4OHXA 4YR2A 3D7SB 4J37A 1BE4A 5E3AA 1J2VA 4ZVHA 1H2VZ 3VALA 2QGFB 3CGIA 3UN5A 2CWKA 2MZTA 5CAAA 2ZH2A 1RWMB 4J5OA 3BSNA 3HP6A 5DLFA 4XDDA 4P75A 1JJ4A 1ULRA 3Q23A 2K8GA 1Q82T 4PXCA 4P2MA 5KFTA 4LF9F 1TMMA 2UUWA 1ZPVA 5FIIA 3SSSA 1YHQS 1OY9A 5I3PA 2VBXA 4TN2A 4ZITA 3QGGA 3ZC4A 1B3TA 1UVKA 2Q66A 2W1BA 3W64A 5C25B 2GAGC 3LO3A 4LR9A 1IM6A 1Q8LA 2OPSB 4ZVSB 5KFOA 1M90T 5K8PA 7AT1B 4DPTA 3J81Y 3MUTP 4WK3A 4LRAA 2Z56B 3H5YA 2UUCF 5HVGA 4JYAJ 2XB2D 1HBOA 4OYIA 2NSBA 1XQIA 1WORA 2XSJB 3FNNA 3D1OA 5E41A 3EPIA 1CVJA 1CJUA 5DS7A 5KTQA 3OQ2A 3MECA 4CCHA 4C11A 4DX5A 2E29A 3BZQA 4LSLA 2QEXS 1U1LA 4TY8A 4O44A 3HVTA 3QIPB 4B3SF 5A76A 1GMUA 2ALYB 2BW7A 1Y7PA 5ADZA 4I7FB 3V81B 3TZXA 3CCWA 3EGZA 3L7PA 5LMNF 3SSQA 3D68A 2C42A 2EFVA 2GC8A 2FB0A 1IKXA 4CRJA 3N5BA 3JYTB 5KFVA 3CCRS 4QU6A 2HHTA 2SXLA 3Q8QB 1FNOA 1OYEA 2HVEA 2YKMB 3FBCA 3LP0A 1VIXA 3R2DJ 3KFWX 1ZAXA 1H3DA 1RXOB 2H4WB 1C1CA 1FD2A 2MKYA 2XY6A 4ZJOA 3AHPA 1OO0B 1WACA 2BJ8A 2B4VA 1FESA 3OJSA 3CPWR 2B5JB 2BE2A 2FHJA 2HVDA 1S4FA 2XYGB 3C14A 1UW9A 4G1IA 2W9CB 3KK1B 4WYLA 3CC2S 1S97A 1Z1ZA 2L9NA 2MB0B 4BLGA 4IRDA 2QMWA 1U0HB 3LAKA 3JYTA 2RUSA 3KHRA 3QMQA 2GGPB 3GWCA 1N5QA 5G0RA 5MAOA 4J91A 2LYVA 2HEKA 4JI1J 1HKAA 2DD8S 5KFMA 2IC3B 1SPBP 3BBFA 3MMJA 4NLXA 4QYZJ 2FQQB 2VF3A 5IC6B 3PHTA 4K4TA 4P74A 3UR0A 2UUBF 1IVZA 2HLTA 3MFHA 1HQEA 1UFLA 1C0TA 2NXCA 3HFZB 2GMHA 1CJUB 2ZBIA 4I6WA 4KV8A 3C6TB 4NA3A 1R0BG 3KYLA 1S1WA 1RQ0A 2CUYA 4KR0B 1D9AA 3PKYA 3BEGB 1IBLF 2HNZB 2C2OB 1FXLA 3C6UA 1BY9A 2V8DA 4ILRA 4N7TA 3TP2A 1KLNA 1WOPA 3J80Y 3AD8C 2UVVA 2WHOA 4FF4A 1F5CA 1P9QC 3WC0A 1UWAA 4DBQA 3W2WA 1N34J 3A3OB 3ZZOA 2FVSA 2V8GA 2EK1A 5F8JA 2KYZA 3S8SA 5HJYA 5AXMA 3RBZA 4FYDA 3UDVA 3GPAA 1RTHA 5BR8J 4K0KJ 1FKOA 3T41A 3P5TL 4B3MJ 1LWFB 3MEEA 3K5MA 4CM0A 2JEGA 5D3GB 3BN4A 3VAHA 1FNXH 3G9CA 1SH0A 1WC0A 2DK2A 4I4BA 1VQ4S 3E8OA 1NK6A 1Q86T 3D66A 4JI1F 1TL7A 1WI8A 3BBBA 4JP8A 1MU2B 4Q8FA 3SQGA 2V2QA 4DV0F 3I6PA 1SQEA 4NI2A 5SUHA 1CS4B 1RK8A 3H59A 1UVMA 2X1FA 5K14A 3CEDA 4F4WA 2XMWA 2JRSA 3H2UB 1N5YA 3DLHA 2YTCA 5B7WA 5CYQB 2X7IA 1RTJA 2H48B 1YRXA 2K06A 3F73A 2GAHC 3OHAA 1JX4A 1TTHB 2MSTA 1IN0A 1H7XA 1WF0A 1FK9A 2C2ZB 3R5GA 5THWA 1S6UA 4LRCA 4DX7A 1M1HA 3DXSX 4KGMA 3HT3A 3MM9B 3V6KA 2J5AA 3ET6B 3OR1A 4F2RA 3QRPA 4Y0FA 3CJRA 4LQ3A 3M2RB 2UVUA 2ZVSA 3PR5B 2XLKA 3CO9A 3NNAA 2CVEA 4C8MA 3E51A 2CJQA 5CYJA 1DQAA 2WB1D 3VGVA 4QWDA 2JOQA 2AW0A 1X4CA 2MJUA 4YP3A 5HVHA 3CT9A 4ETXA 4AXIA 2A1BA 1TL1B 4FKYA 5DRKA 5ETTA 4DV5J 3W1YC 4EZ6A 5L1JA 1FWPA 1WKLA 1REVB 2CQ0A 3OTBA 4ED8A 4X65F 3O6QA 3VZIA 2KVQE 4C0OC 4ED4A 4DR3J 2E7VA 1QDUB 3HI9A 4CLKA 1VC5A 5HMZA 3I96A 3ZZPA 1M5PC 4JI4J 2RHQB 1N33F 2RKIA 2DGUA 4DQSA 1IR2A 2ZE2B 4WE1B 2OD4A 4URSA 1RAGB 2QZ8A 1SJ4P 2I1RA 1D1UA 1V3RA 4DV4J 5CH7B 3A8JA 1EIYB 3S7RA 1N32F 4DR7F 1SUQA 3RRKA 6FDRA 4IH5A 3GU0A 4I2QA 4PEOA 2NPFA 2WVEA 1M1GA 3T9NA 4USMA 2DGVA 1UFKA 1NKCA 5AE1A 5A8WA 3TZZA 1ZS6A 2QSWA 3ZXWA 3MF5A 1GFWB 1S6QA 1SQFA 4IR9A 1UP1A 1FERA 2QC3A 3DOMB 2XQCA 3I4PA 2J9DA 2ROEA 1FRIA 2U2FA 2CXEA 3WIUA 5JJBA 2ZDPA 1L3VA 1HMVA 2APOA 4FP9A 4K5SA 3KMQA 3O8WA 3TJAA 4URGA 1R89A 2H5EA 4ED2A 3IRWP 3KLFB 1RWNB 4LSNB 3IWLA 4TYAA 4B3OA 3VZHA 3O3LA 4YEAA 1IKWB 4GRSA 4TY9A 4E98A 1EETB 4PABA 1SL2A 4Q44A 2WB4A 2OTJS 1WWHA 4B3RJ 3M8RA 2AJ2A 2DGXA 2JX2A 2RF2A 3C16A 1O51A 3B82A 4OHVA 4P73A 3KJVA 3EWGA 3IBCB 2DHSA 4OI6A 1VRQC 1OSDA 2X3DA 1ZM2A 1OSCA 4LUBA 2G9OA 4JI0J 3DM2A 4O3QA 1TKXA 1UFWA 5KG5A 1RA6A 1LW0A 1RT4B 2ASYA 3CCTA 4ID5A 2XZWA 3CF5Q 3CC4S 1XMQF 4NXNJ 5H9FJ 1VQ9S 3R97A 2ILYA 2OPQA 1JLBB 1GNKA 3FMBA 4F0HA 3PJWA 2EW9A 2R4FA 1NB2A 3PM9A 3M8PA 2HQDA 4R8UA 2OJ3A 4TNOA 1FWLA 3X1LB 4F4KA 1CJVB 2B4UA 2RD5C 2R8IA 3FMWA 1WJ9A 2YNHB 1UVJA 4IOCQ 5HI7A 1YQHA 2PDAA 2WOMA 2WVFA 5IM0A 2BQ3A 1TK5A 5CYMA 3L09A 2KO1A 3SFGA 3RBEA 2NUHA 2QFIA 4H4OB 4HH0A 4MIAA 4WWSA 4RNMA 3SYZA 2IY5B 1RTZA 3QYYA 2NZCA 5FLXU 2FLPA 3LP2B 4AQYJ 4YUDA 4B3OB 1B4SA 1PBUA 3HD2A 3QATA 1IWGA 5ETNA 4ENOA 2VC0A 1PBAA 2R7RA 1TK8A 2R7XA 5H9EJ 2ZOMA 1RAOA 2B51A 5L9XA 4LF2A 3R8YA 2WK4A 4C97A 1FA0A 8AT1B 3G71S 3ZTOA 2I5JB 2IJFA 2UZAA 1Z4UA 4LF7J 2HVHA 5HP1A 4MKYA 2EXUA 2R8HA 1HBNB 1H7WA 3CTRA 2R2RA 1CC8A 1DRZA 4KT0C 3NNHA 7FD1A 1RAEB 4JV5F 1CBKA 2BKOA 1H2TZ 5GAEU 5KFUA 5LJ5Y 4MIBA 1X4BA 2C2DA 4KKOA 2QA4S 4ZVEA 3EM1A 5E2QA 4M94A 2CQIA 3MMBA 4X66J 2W9BA 2IAJA 1NDCA 1T0TV 4NX9A 2UVRA 1N88A 1NU4A 4QOTA 3TYTA 5I3UA 4WKRA 2M9KA 3QBCA 3KLHA 3CCZA 4CYUB 5B0CA 2DXFA 4DV4F 1JLQA 3CIZA 4LF8J 3ZO7A 5M2RA 2G2ZA 1IR0A 2MKSA 4WE1A 4CLYA 2ZE2A 2GMJA 3U1MA 3GLJA 3LP1A 4D3GA 2OI2A 2ZH5A 4ICLA 1Y3KA 1F60B 4NZ6A 1B99A 2V8HA 1XMOJ 2CPIA 4KGVB 4LVOP 1U47A 5CYMB 5BYSA 3DRXA 4DUYJ 2WOMB 2VFUA 4CQ1A 3EYZA 4HH1A 4CYUA 4DSEA 1P1TA 2BJ9A 1GMWA 1HQUB 1JXLA 1RT3B 2ZH3A 2IAJB 4WIIA 5KOXA 3Q89A 5T41A 3T3FA 1H38A 5IT9Y 4HDGA 1JKHA 3KK3B 3PW4A 2QE5A 4FF3A 2XI2A 5I42B 1B64A 1FFSB 2GZOA 2J7KA 3D5MA 3V5RA 5HP1B 1Y5IB 2I5JA 5J1EA 2YPZA 1GQEA 3MM9A 5SZTA 1NK8A 4DWIA 1RHMB 1RBAA 1WKJA 2HQCA 2K3IA 2ROPA 3BSAA 1Y5LB 4W98A 3TI0A 3T5LA 2CVIA 2UXBJ 2PEBA 3FSYA 3PCOB 2D3O1 3MUMP 3X3UA 5B0DA 2BJ7A 1I3OB 2J9DE 5DG7A 4A8KA 5L46A 5LJ3Y 3KJVB 1M5OC 4I0WA 2FHOB 1EKSA 2V67A 4O0NA 1IKWA 2LQ9A 3KLIA 3QGHA 1YJUA 2RDDA 4MJKA 1I94F 3RR7A 3M30A 1EAYC 5K14B 1RAFB 1UAWA 2UP1A 1N5TA 4X4RA 2NXJA 3LP1B 1IQTA 2JVOA 3GSIA 3D6MB 2YNIA 4DR4J 3G4SS 4NLWA 1S0NA 3W9JA 1HHSA 3VR1A 4CLUA 3CJ0A 4QIFA 1WDTA 1YJ7A 2RT3A 2FJVA 1S76D 3C66A 3GB0A 4QZVB 1UJ6A 4PQAA 1IKYB 2HBQB 3FRYA 1LW0B 1LWEA 1RT4A 2BW2A 2V69A 4Y2MA 1W2IA 3NS5A 3GP9A 3RYLA 3WZ0A 3QJLA 2ZVIA 2XMJA 2GIFA 3HFVA 3RTVA 4GVLA 1VOMA 2E5JA 2ZEJA 3FCVA 4DFPA 3PXGa 7FDRA 2AKWB 4F4XA 2BR0A 1JJ2R 1XNRJ 3I5CA 1KP6A 1VISA 9ATCB 1WEZA 5KT2A 1JWWA 4H4MA 1Q7LB 4U95A 3GFYA 1XMOF 1M5SA 5LSOA 3TO8A 3THPA 4B9LA 4LR8A 1WKKA 4DR2J 4QR0A 4DN9A 4X4VA 4NA2A 5A6WA 1LXJA 3HJVA 5CABA 2XO6A 1FDDA 2KI2A 2W2OP 4AD6A 4YS2A 3QT5A 4AXJA 1PAUB 4Y2IA 1D9DA 1PCAA 2MMYA 2NUUG 2WONA 3DDIA 4IOBA 2OEKA 5KOWA 2CG8A 4CH1A 2IDEA 4AL7A 3PV8A 1JIHA 1WG5A 1WHXA 2HGNA 3OFEA 2XS5A 2ZZMA 1YJRA 2B9WA 3BH7B 1CJVA 1SC3B 2CZVC 4LSNA 4Y00A 1LV5A 2GIQA 4OX9J 3PRVA 3MM7B 4B02A 2QT7A 4DV0J 4DN0A 2CJAA 4ECQA 3L3CA 3QSYB 2BRLA 1U6FA 2CG4A 3IA0A 3G6ES 3PZPA 2CQ4A 2OTLS 3WX4A 1ITPA 3L7OA 2B7BB 3DRPA 1OQ6A 2AEMA 2CJXB 3W7BA 2GVZB 2GHVC 1FRKA 4J9VA 2ZH9A 3DLKA 3SZ2A 4DFMA 2DR5A 3DLJA 4X64J 1D0EA 4OZNA 2EBGA 4ETZA 2AIRB 4UOHA 1U1RA 1HW8A 3DM2B 3MR2A 4I2QB 4NCGB 4QIVA 2Z30B 4ZPWR 2XLIA 3LH2S 2V6AA 1RDRA 3C15A 1J5OA 4IRKA 1WTFA 3Q8UA 4OYBA 4K0KF 3PW7A 2OPRB 2PN6A 1WD6A 4BC9A 1SL1A 3TAQA 2GA7A 3AH6A 1FHTA 1Q5VA 3SDEB 3HHLC 2W9AA 2AU0A 4J9MA 1REGX 1QY7A 2IRUA 5JVHQ 2KKHA 1RKJA 5F9NA 4EUVA 1DTQB 4I7FA 3QQCD 5BXIA 3VAGA 4YB5A 2XMMA 4M95A 3H20A 2E9ZA 1T3OA 2VPYB 3AOAA 3GCXP 5GMEA 3B54A 3HSZA 5I3UB 2O1PA 2QLXA 1S1VB 3R6LB 3M2RA 5D4PA 3I87A 3KK2B 3Q8YA 3MCMA 2VDIA 2DY9A 2IYIA 4DXLA 4C9DA 2V5HG 4USKA 4JI0F 2ZH7A 2OP5A 3HULA 3D54A 4WCEQ 5L38A 4JV5J 1YZ6A 4K4SA 2ZBCA 1WSRA 2LQ8A 3GIJA 1I51B 2OSQA 3CDAA 2DRDA 5E3PA 4U7CA 4NLUA 2DCUB 4CM2A 1FRJA 3BDEA 3MUVP 5F8NA 2F4FA 2OUGA 3RRGA 4NRUA 2F4VJ 1U26A 2V9KA 5HJXA 1ICEB 2J76E 2NXEA 3A1YG 1G3OA 3CW2C 4G6VB 4CLPA 1HD1A 1VI7A 4LMZA 1M1KT 3C6UB 4ANEA 5CZXA 5KG2A 3PJXA 1JQGA 4GVBB 4H4OA 3Q8RB 1YTYA 1YBAA 3AY0A 3SQGB 1T7PA 4N76A 4WZQA 4RNNA 1G6BA 2WSCC 2Z2MA 2L41A 4LF6J 2OPPA 1RAJA 1TKTB 1JLAA 1LWXA 4ECSA 5M2UA 3MPDA 4KPCA 2DT9A 1ZETA 3HT0A 1U8WA 2IC3A 1AUSL 3DHWC 5D3GA 4A8SA 2AP6A 1FEHA 3I56S 1F5AA 1WI6A 2XM3A 1YJTA 4NLQA 1XMQJ 4OI0A 1U0SA 4G1PA 3OUYA 1J5EF 2VG7A 2XMKA 2ASJA 5CD4A 3M2VB 4FYYB 5DGBA 1K44A 2ZZNA 2FJXA 3DGPA 1RT7A 1Q4RA 1U09A 3IR7B 3LTOA 4LRDA 3ZZRA 4QPXA 5DM6Q 4KHPF 3TQEA 5DLGA 1YKWA 2LQJA 1NAQA 3EDRB 4ZPAA 2DRBA 4LFCJ 2BABA 2F8HA 3WBZA 1M5KC 2KRBA 3EZUA 4LFCF 2WZ1A 3KLGA 4Z2XA 1PKUA 4KYZA 3DRSB 2R8KA 1AFIA 2HQIA 4EMDA 4PYAA 1S0VA 4EBDA 4F02A 4LFBF 5J1PA 2HHXA 3BBCA 1SIWB 3IXQA 2B8PA 2WW4A 2CAJA 5DJBA 4LF9J 1VS3A 3M6VA 5CZVA 2ZWPA 1T9XA 2EBEA 5EUHA 1M0SA 3M7VA 3N6MA 4NYZA 3U02A 2B6AA 4C11B 2R2UA 4HHHA 4KV8B 4F36A 2YX4A 4OJHA 1IWAA 5JMNA 2B9EA 3KDOA 4EWTA 4B9UA 1C0TB 4LIRA 3GSDA 4IG0B 1S77D 3B78A 1SV5B 2XWYA 2IMOA 1RHUB 5E3RA 1TQLA 3VQTA 3ZZUA 2MKHA 2D9PA 1SJ1A 2YWEA 2W9CA 2F9JA 2J0XA 5IT0A 4KO0A 3BO2A 1SUQB 4JI2J 4UQGA 2QA2A 2PT0A 4I6YA 3OL9A 3RJMB 2EVZA 4YB6A 2MZQA 4DLEA 1S9FA 1S1XB 3TEHB 1L3UA 4C2MA 3ENVA 2NXUA 4OYAA 4UOCA 4ZOSA 3C14B 1WC5A 4OYXA 2I8EA 3GJTB 3HHLD 3W65A 4F3QA 3SCIE 2FJEB 2M5YA 3RB6A 3LOUA 2LVWA 1FF2A 3J7ZT 3BO4A 4PG4A 1HI1A 3K7RA 3P3DA 5T14A 1IKXB 1MWYA 2VJVA 1HI0P 4KHPJ 2F5GA 2HK2A 1A6LA 1S1WB 3VF0B 1RT2B 2OFHX 3QGPA 4DCOB 1APSA 4JI6F 1FT8A 2GQCA 3PYDA 3QWUA 3MOJB 2A0FB 3LA0A 1HW9A 2VB6A 3V81A 3GR0A 4X4TA 4UY85 4OMFG 1VQYA 3AXKA 4MK7A 1MWQA 5IT4A 2F3JA 4NPOA 2W8LA 2OPSA 5IOLA 5GADI 4FNIA 5LXRA 2X1AA 3THVA 2MDAA 3ET6A 1MMDA 2BJ1A 4OJ1A 4CTAA 1QSYA 4DU8A 1XEZA 1K9MT 2CPDA 3VAJA 1NHVA 1E6VA 1K8AT 2DPJA 2E5IA 2RS8A 3UCZP 2H4YB 1YSJA 2C1EB 1VQMS 4LF6F 4HI1A 4EK2A 2FGOA 1R8HA 3W61A 4PWUA 2P6SA 3JSYA 4ED5A 1RTJB 3N5FA 4KO0B 5D0HA 3BDPA 3R7SB 1KOHA 4PWWA 1S1TB 3K5NA 1PC4A 5AJ3F 4IFYB 2UXCF 3OBIA 3R2CJ 2BVZA 2A2CA 2YWKA 5EDWA 3ETOA 4NI2B 2MKKA 2Y1IA 1AFJA 2UU9J 2CNKB 1Q79A 2FD2A 3BB5A 1FRMA 3TX8A 4I2PB 2B6AB 3CJ3A 3DMJA 4K5RA 3NMAA 3ZZYA 3M9MB 2AEFA 4DV2F 3GE9A 2HHVA 5KFBA 1GXUA 1YRUA 2PFFB 3EPGA 1RWXB 3AA8A 4UOGA 2GW8A 4B3MF 1EQMA 1UW4A 2LLZA 3VHQA 3DDKA 1FKOB 2CJ9A 2EWHA 4GVBA 2ACMA 3M32B 4ZK7M 3CD6S 3AT1B 2DHGA 1RTHB 3W3SA 1AA1B 4ZVGA 2R8GA 1F2GA 5KG6A 2QMUB 3IGVA 3ISND 4I56A 4RWWA 1F5BA 1FKPA 2XG8A 1FXRA 3OL8A 1LW2A 3Q8PB 4MT1A 2CPXA 3MFIA 2QLJB 3H40A 3VAFA 1L3TA 4RW4A 3IP0A 1X31C 3GQCA 4QYZK 1N48A 2KFYA 4G3IA 2DH8A 1XIQA 2G0JA 2OEMA 4OZLA 3GG1A 1LEOA 1WEXA 2HNZA 4IDKB 5T7LA 3HJFA 1UVIA 4BCAA 2IYGA 1VQ6S 4E2FB 5B0GA 3OFHA 3P5BP 2KT5A 4CO0A 2UUBJ 2OLWA 1B7FA 1FX2A 2EKNA 1QAXA 3ICLA 2CQ2A 4IQXA 2VKRA 1OS5A 3WHIA 3H98A 5F3TA 3GIMA 2F4VF 4ERDA 2JFDA 2F65A 2BA9A 3M4XA 2M52A 5E5NA 2MZ1A 3FUYA 3QT6A 3OTOJ 2IMWP 3DOLB 3BQ2A 4DV6F 2W2QP 1RT5B 2VG5B 2YKOA 3OL7A 4FS2A 5B08A 1F9HA 2HAIA 3FK4A 4WFXA 2FYXA 3LANA 1X9MA 1R8BA 2ZKTA 2B5JA 2BE2B 5KFHA 3C15B 4DPXA 5IZHA 3HLUA 2WBRA 1PYTA 3J7AN 1C1CB 5E0OA 4C0HA 3HHDA 1VQ8S 3LP0B 4DCPB 4DV3F 1HD0A 1VC0A 1Q8IA 1BC6A 2XO7A 1RHJB 1SV5A 2UXBF 3U1NA 5GAEI 1S0OA 2GVZA 3MDFA 5FDLA 1TL5A 1RACB 3OPKA 3DRPB 4HT7A 1GMVA 4KQZA 1DAXA 3IGNA 3W5YA 1DJ0A 1DTTA 2BUNA 3GYNA 4OZJA 1SKWA 1N36J 5J2MB 1HHTP 1ZTWA 3MM7A 3NGKA 4ZP7A 4ZKAA 4EEYA 1X0PA 1TV6B 5C7PA 3MAAB 3G86A 1VHFA 4DI6A 1KHWA 1UEVA 2PMHA 3MWBA 5JUMA 3DRSA 1EZZB 4EGLA 1VHIA 3QIDA 1VQNS 1S6OA 2EPIA 1RTIB 4DV1J 4M5JA 1WC4A 3GONA 3GILA 4DUYF 3OHBA 2CQGA 3CDEA 5C25A 1F3VA 1RZMA 2C22A 1NK7A 3ZZZA 2AYGA 3GYXB 4G1QA 4OV6A 2YY3A 1RT7B 3SSRA 3R1LA 4DX6A 4GKJF 4M5IA 1HNIB 3N4WA 2CKWA 2ZHOA 4F4ZA 1DHMA 4OZ5A 2BANA 3DLKB 1UPPA 3MM6A 2RHSB 3LQVA 1S48A 1YK9A 2MGZA 2RVJA 2XCPA 2IPOB 5EWFA 2UVWA 2KTQA 2QN6B 3IAM9 1UA0A 2BXJA 3DKDA 3CE8A 2A6OA 4Q0BB 5A6PA 2OSRA 3J7YI 2E9RX 3BREA 5B0AA 2X51A 3RB0A 2UUAJ 1TL3A 1V5IB 4PXDA 3G82A 2BKNA 2A6MA 1B0TA 2OO4A 1XNQJ 3QAUA 3D6TB 3ETMA 3HF5A 2XS2A 4C3KA 2P5VA 1EARA 3BYRA 2QMXA 2WONB 3OVAA 4PYDA 2JHEA 3TANA 5HBMA 2YKQA 2VDHA 3AQPA 2IVYA 2H1YA 1DURA 4ZPDA 3TUJC 2WRMA 3G8SA 4B9TA 3UO0A 1GX5A 1HQ2A 3RW6A 4YR0A 2Y8WA 5EX0A 5ITHA 2VOPA 3UE2A 2HK3A 4J9PA 2ZHBA 2FUG9 3AXMA 1CJKB 2RE1A 3V6HA 4ZVQB 3D4JA 2VPXB 3NWGA 4K4XA 1RU1A 2DO4A 3J7Z5 2LDIA 5KFKA 4U6PA 1Q1KA 5KFNA 3OUYB 2AGQA 3EXCX 3UI3A 2ZH1A 2YWGA 3G2XA 3HKZD 3IAS9 3PR4A 3SI8A 2CPJA 1JKHB 3RGIA 5I42A 2HLUA 2MKJA 1S72S 4WIQA 5E3QA 5F8HA 2RS2A 2E9TA 4XPEA 2JFKA 3R6GB 4USWA 1HWJA 4TYBA 5LM7E 8ATCB 4YY3J 2DR7A 2J6SA 2KN4A 2YNFA 3PACA 4ZLNA 4DQRA 1HQUA 5IT9U 2R7OA 2CPZA 2LU2A 4CNZA 4DJBA 5L1IA 1NJXA 3BSOA 1VQKS 4NXMJ 4P6QA 4E8UA 2HWHA 2J0QD 2J7UA 3JQMA 3HMJG 4GKKF 3JQJA 5KFYA 3VGTA 5H1SV 1U2CA 3FZBA 5D4LA 3PO5A 4PG5A 1T05A 1NZ8A 2JWNA 1ZM3A 2DR9A 2RJZA 4BWJA 1KWMA 4DMZA 1TAUA 2F8MA 4MKAA 3OSNA 1MROA 3LGNA 4NLSA 3PYGA 4PXEA 2HHHJ 3CC7S 1X9SA 3DOKB 1YZ7A 2HG4A 1SC4B 2POKA 2YQ3A 2ZD1B 3LWLA 3VAKA 2YKNA 4WU2A 3RAQA 4RO0A 4YB1P 3LWMA 3FEXB 4LF4F 2VFSA 3CCJS 2RU3A 3I32A 3JXOA 1DLOA 2HHWA 4GMKA 4LJMA 1QVGR 4RUHA 1L3SA 2LECA 2DVIA 4RUBA 4RU9A 2QTWA 3PW2A 1HYSB 2YWWA 4K2JA 2W2NP 5AXLA 4TU8A 4YOEA 4O0IA 2BJ3A 2GJIA 4HTJA 2BX6A 2LXUA 1IBMJ 4DSIA 4LF5J 3K8VA 4N41A 2G4BA 1K0VA 3MR6A 3EXYA 3MI7X 1KVJA 1I1GA 3E3XA 2BACA 5HANA 4ANCA 4EI2A 3CIMA 4R25A 3IR5B 2RNEA 2BKPA 4NWBA 2P9GA 1JK9B 2KVIA 1FXDA 1QJHA 4P2SA 1EKRA 1FCAA 3DLGA 3OFGA 4MKBA 3DXBA 3NXZA 1D8ZA 2VQFF 1Q5YA 3H7HB 2OPRA 3C19A 4QPTA 3SEOA 2XLJA 3FBEA 3SFUA 1U45A 4NEZA 2QLFB 1XK8A 5C24B 4YB7A 3PDNA 2JL9A 4QW9A 1BWVA 2AJQA 2XY7A 1NK5A 3ITHA 3AAWB 2JLEA 1VLYA 1LWEB 4USHA 4F7VA 4BDPA 2WSFC 4EZ9A 1N4LA 4U9RA 1RAAB 1QSSA 3DCAA 1U48A 4ELVA 3NLCA 2R7TA 1GTEA 1HNXJ 3PRDA 1ZH5A 2W2MP 2GIRA 3SV3A 2DEJA 1TELA 4NOHA 3QJPA 1HBUB 4K4UA 1NH8A 4G65A 2KHCA 3AOCA 1N56A 5KFDA 2O67A 2MQPA 3V6DA 4J90A 2V4QA 2EFPA 4C7QA 4E0DA 4Y65A 1IJFB 1H2UX 2MGZB 3WC2A 4ECZA 4KFBB 2QG9B 2VA3A 4IR1A 3QLHA 3MHYA 1TKDA 1JLGA 2IJRA 1ZPWX 1TKZA 3GIKA 2E66A 3V6DB 1ZZNA 2PIIA 5IQQA 3I9V9 2L9DA 3NMRA 1VFJA 1AROP 1TZ0A 3M9NB 4EFAC 3OR2A 2Z4PA 2F7VA 5E7OB 2EC2A 4CLSA 4R5PA 5ETLA 4FXWA 2G2OA 4FPIA 1PJ7A 2DNPA 3DU6A 1K73T 4JI7F 1Y3JA 4XAKA 2PA3A 1BQNB 3ITHB 1S57A 2HNDB 3CD7A 3PFOA 3NS6A 1V3SA 1X7VA 2W2PP 4ZP8A 4CO1A 5KFPA 1U6ZA 3VTIA 3QZ8A 5DM7Q 2RRNA 4JI7J 4BHQA 4YDDB 5J2MA 4DSJA 2BEFA 2Q6BA 2XMUA 1GEHA 1VIOA 2HURA 5H9FK 4L72B 1PC5A 2RF2B 1FRHA 3BPDA 3IRXB 3FBBA 5K8NA 5DZ6A 3F0NA 1VK3A 2HWIA 1VQSA 4HLBA 4ICLB 1FDAA 4DG1B 5C42A 3NBPB 1NKBA 2NCKL 4LSZB 2DR8A 4ECXA 2O66A 2ZFHA 2WW8A 3L7UA 1URNA 4CO3A 2PO4A 1RHQB 4M5NA 3RAXA 2R2TA 3MMCB 5HAOA 1REVA 2RMLA 2D3OR 4LF5F 3FFIA 3UVJB 2AV5A 4KH1B 4MYUA 5KAKA 1KR4A 2MKCA 4RLEA 1A0OB 1OIAA 3BO3A 3I82A 5LOQA 1YJ9S 2PD1A 4F2SA 1Q81T 2JSXA 3I5BA 5HMXA 1Y9OA 4DV2J 3I0RA 2HFZA 1SIZA 2HMIB 4RPFA 1J27A 4RL1A 2YVSA 2Z58B 3FCWA 3MGJA 3S01A 2UV8G 3MZIA 3Q8VA 5J1EB 5F8IA 2E1CA 1NRKA 2XS7A 3CCUS 3MXHP 4DL5A 2LU1A 3D0IE 3KLEB 4XO0A 5L9NA 2J6TA 2JDJA 2XI3A 1S1UB 3KK3A 5AJ3J 2KXNB 2DHHA 4C0BA 1RT3A 3WIVA 5T7LB 3IFEA 3GFZA 3O1LA 3G96A 2HSEB 2I9SA 1RGVA 3CJ5A 3L9ZA 5D6GA 1ROFA 3I9ZA 3KUEA 4W92B 4M1KA 3MTKA 2YNHA 4PQUA 5EHHA 2RQKA 1N34F 1PIEA 3J81j 2QO3A 4HEA9 4LBIA 1RT1A 1NPPA 3MEGB 3FKBA 4A8OA 4Q43A 2CNLB 2KZMA 2FDNA 4H4KA 3NY0A 3CCVS 2HHSA 3M32A 4B3SJ 1UPMB 1IBMF 3M8YA 2C3OA 2ZBQA 3RZAA 3KLHB 5A2QY 3DI6B 3JB9k 2ALZA 4TQRA 4X66F 1IBLJ 4ID5B 2DNOA 3MMBB 4OX8A 2W9BB 4M8LA 3JTOA 1Y4ZB 2NS1B 4JI8F 1XR7A 2HFUA 3KMSA 3CJKB 2AZ3A 5HROB 2XMAA 2MHNA 3QGIA 5KG1A 3W60A 1RHKB 2DEIA 3B8HA 4LF7F 3M2UB 3DYAB 5IXUA 2KB2A 2FZKB 1MWZA 2UU9F 5B0FA 2V50A 4JV2A 2N4DA 1EETA 3IS9B 4RBVA 4Q2MA 4W4MA 4J9QA 2UXCJ 4FVMA 2VHGA 3H25A 2FJDB 2VUGA 4GO7X 2XHWA 1SB6A 4MFBA 4C3MA 5A0YB 3JSMA 1CS4A 4GKKJ 4KJIA 2F1FA 3CCSS 4NE9C 1X5SA 3KNGA 2YQ1A 4FYVB 2NZ4A 4ZDNA 4HHJA 3JQKA 1OJ4A 2VPWB 1K1QA 2R2SA 2H65B 2W8KA 1S6QB 3HX9A 1R7IA 2PFDA 1HNVA 2GVDA 2DCLA 2P6TA 4WXWA 1HR0J 2ZJQQ 2BZ2A 2QRRA 1A9NB 5KFLA 1T9YA 5GMKa 4UZCA 4OI1A 1EP4A 1T8EA 2OPQB 2RQ4A 3D3BJ 3D6FB 2QJ3A 4Z7CA 2AEJA 2CJKA 3RB4A 4PUOB 4DUZF 2LFVA 3J81U 2MEWA 3S1TA 4DL4A 2E1MC 3CMES 5KT3A 3LALA 5E3CA 2AX1A 5DGAA 4JYAF 2EG1A 4LR7A 4FBTA 4ZVOB 1HA1A 1CQNA 2HPUA 4DOZA 1FTCA 4X65J 2V4JB 4ELTA 3QZ7A 3C16B 5EX3A 5HLFA 1C2PA 2MZRA 2NLWA 3NCQA 4QBUA 4X4SA 4QWAA 3H5SA 3MD3A 3QNWB 4MK8A 4L6V3 1R3NA 3FRZA 1UWBB 2BE9B 4L76A 4ED7A 4PUOA 4USIA 1FX4A 3POTA 5DG9A 1PYSB 4PAAA 4UZBA 1FRLA 1S9GA 2PSZA 1LKZA 4DR5F 1HMVB 3R27A 4WF9Q 2FC9A 3TAMB 2CPHA 2PI4A 1U2RA 1YGYA 3NGTA 4FF2A 3E01A 2Q6CA 4IH6A 2AYBA 5CHCB 2ASLA 3VAIA 2JVRA 1G4CA 3HDSA 3NCRA 3EE3A 1VDHA 1P27B 3QSIA 2ZBRA 3EUNA 4QQBA 1KEKA 1OWXA 1S9GB 1U1KA 4EO6A 2KT3A 1NLKL 3LF0A 4K2XA 1QAIA 3PEJA 4GC7A 1R31A 3P8BB 5CYQA 1SJ3P 1NPKA 4ZCIA 2FVPA 4GKJJ 3EVOA 3ENQA 1HPZB 4HR2A 1FDBA 4UY8T 4JI4F 4NYPA 3HXMA 1YDLA 1X4AA 3DRYA 2YX1A 4DDFA 1RWKB 3KDNA 2EKYA 1QE1B 1DQ9A 2HQ3A 3H90A 4YN3B 3TAPA 4I68A 2DGTA 3AJ1A 5CD4H 4DSFA 1C0UB 1UEUA 2QA1A 4ZPTR 4DL7A 3CJKA 5HROA 4DV5F 4YR3A 1VLOA 4TU9A 1NXIA 3PHEA 4WBFA 3OSPA 4WTYA 2ZUAA 3MMAA 3W5ZA 1S12A 3N0VA 3AD7C 3PJ9A 1EX8A 4FVCA 4TVAB 3WDOA 3AOBA 1FJGJ 4FDFA 1EP4B 1N6QA 1JJCB 2DNNA 2CPYA 2V8PA 3O2IA 2WAQD 2DNLA 3R5JB 1X4FA 4OX6A 2XZDB 1N5VA 4DSLA 4TQSA 2BE7D 2IM2A 1Z2LA 2DXDA 3W2WB 2AJ4A 2C2NA 3MM8B 2VFVA 2MQOA 3I55S 4JV1A 2CJYB 4DLGA 3K57A 1UZHA 4ZCLA 1GAOA 1DFDA 3UD5A 3K8WA 3NP5A 2B0GA 3AB2B 3ISZA 4GO5X 4RW6A 5ETKA 1RTDB 2NSCA 3EGVA 3OTCA 5KFJA 3PX0A 1JJHA 1RCOB 2MQQA 3KLEA 2R7WA 4MH8A 2ABYA 5K9FA 4LIWA 1NSKL 3UCGA 1MU2A 2DYAA 2Y3YA 4HT5A 1TL7B 3BGUA 1N54B 2HRYA 4L3KA 3MM5A 4NLOA 4NZ0A 4OYPA 2FIUA 2HVZA 1O5JA 4DPYA 5KT6A 5EWEA 1VRUB 3ZTPA 1SJFA 4USUA 5F8MA 2NYHA 4B08A 1Q7YT 3K5LA 1AB8A 1U0HA 1XERA 3OTEA 4A8XA 4B3TJ 1ZOTA 2OKQA 3TOQA 4CO4A 1YJNS 5C5JA 3H2VE 3BV8A 5FJ4A 2C2EA 1RABB 2V94A 2VC1A 4FYWB 3TVKA 3M8QA 1U6BA 4OLPA 3MEDB 5BYRA 3AQOA 3HKWA 2LEAA 5IWAJ 4N5SA 2Q3PA 2HGMA 1RCXB 2AZ1A 2C3YA 4F0KA 3NBPA 4Q5VA 1NDPA 1CJTA 2FHKA 2AX0A 1Q8KA 5EGYA 5HLFB 4CTAB 1RWOB 5F9LA 5D78A 1NEEA 4ED3A 1AZSA 3JTNA 1SCJB 2QX0A 3GTYX 3HSGA 3SXLA 1J5OB 1UA1A 4QU7A 1TVRA 2OD6A 2FTRA 4NZ7A 5IV3A 5LT5A 3FSIA 4IO9Q 2C2RA 4QWCA 5FLXY 3KNAA 5KG0A 4V19X 3IM8A 3NOCA 3CVKA 4LBHA 2RB7A 3R5AA 1RT2A 2G1HA 2QL5B 1HBOB 2KM8B 4P72A 3OLBA 2H5IB 3HCXA 2KXHA
chains in the Genus database with same CATH topology
3BBBA 3DDIA 4F36A 3WX8A 1NDLA 3VGTA 3NGTA 3Q83A 3ZTSA 3BH7B 1B4SA 4ENOA 1BE4A 3EE3A 3PRVA 2CWKA 1F6TA 3FCWA 5CAAA 1UCNA 3Q8VA 3ELHA 3EICA 3ZTOA 1NLKL 1JXVA 3FBFA 3ZTQA 1NPKA 3EVOA 4UOHA 4HR2A 3VVUA 2B8QA 3EM1A 4F4AA 1NDCA 3FC9A 1HLWA 4FKXA 3Q8UA 2BX6A 4CP5A 1W7WA 1HIYA 2DXFA 4DZ6A 3VGVA 3ENAA 1MN7A 4S0MA 5C7PA 4ANCA 1BUXA 1XQIA 4WBFA 4C6AA 3EMTA 4DI6A 2ZUAA 4FKYA 3FKBA 1B99A 5BXIA 3PJ9A 1WKLA 4ANDA 3VGSA 3B54A 3FBEA 5IOLA 2DXEA 3Q8YA 2DY9A 3Q89A 2AZ3A 2DXDA 3Q86A 2HVEA 3FBCA 1VYAA 3R9LA 4EK2A 3VGUA 2HVDA 1S59A 3DKDA 1WKJA 4W98A 1NCLA 1ZS6A 2VU5A 4ANEA 1F3FA 1MN9A 1NSKL 3ETMA 2DYAA 4O0NA 3BBFA 3ZTPA 1LWXA 1EHWA 3NGUA 3MPDA 4KPCA 3B6BA 1U8WA 4UOGA 3EVWA 3VVTA 3ZTRA 2AZ1A 1NUEA 3NGSA 3EVMA 1NDPA 1S57A 1K44A 3GP9A 3EJMA 1NHKL 3FCVA 1HHQA 3GPAA 2BEFA 1S5ZA 1XIQA 3G2XA 1LEOA 2HURA 4UOFA 1PAEX 1NB2A 3FBBA 1PKUA 1NDKA 1BHNA 4DUTA 1WKKA 2NCKL 1KDNA 3BBCA 3JS9A 2B8PA 3L7UA 3BH6B 5CABA 3NGRA 1NSPA 1NSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BBB A;  3DDI A;  4F36 A;  3WX8 A;  1NDL A;  3VGT A;  3NGT A;  3Q83 A;  3ZTS A;  3BH7 B;  1B4S A;  4ENO A;  1BE4 A;  3EE3 A;  3PRV A;  2CWK A;  1F6T A;  3FCW A;  5CAA A;  1UCN A;  3Q8V A;  3ELH A;  3EIC A;  3ZTO A;  1NLK L;  1JXV A;  3FBF A;  3ZTQ A;  1NPK A;  3EVO A;  4UOH A;  4HR2 A;  3VVU A;  2B8Q A;  3EM1 A;  4F4A A;  1NDC A;  3FC9 A;  1HLW A;  4FKX A;  3Q8U A;  2BX6 A;  4CP5 A;  1W7W A;  1HIY A;  2DXF A;  4DZ6 A;  3VGV A;  3ENA A;  1MN7 A;  4S0M A;  5C7P A;  4ANC A;  1BUX A;  1XQI A;  4WBF A;  4C6A A;  3EMT A;  4DI6 A;  2ZUA A;  4FKY A;  3FKB A;  1B99 A;  5BXI A;  3PJ9 A;  1WKL A;  4AND A;  3VGS A;  3B54 A;  3FBE A;  5IOL A;  2DXE A;  3Q8Y A;  2DY9 A;  3Q89 A;  2AZ3 A;  2DXD A;  3Q86 A;  2HVE A;  3FBC A;  1VYA A;  3R9L A;  4EK2 A;  3VGU A;  2HVD A;  1S59 A;  3DKD A;  1WKJ A;  4W98 A;  1NCL A;  1ZS6 A;  2VU5 A;  4ANE A;  1F3F A;  1MN9 A;  1NSK L;  3ETM A;  2DYA A;  4O0N A;  3BBF A;  3ZTP A;  1LWX A;  1EHW A;  3NGU A;  3MPD A;  4KPC A;  3B6B A;  1U8W A;  4UOG A;  3EVW A;  3VVT A;  3ZTR A;  2AZ1 A;  1NUE A;  3NGS A;  3EVM A;  1NDP A;  1S57 A;  1K44 A;  3GP9 A;  3EJM A;  1NHK L;  3FCV A;  1HHQ A;  3GPA A;  2BEF A;  1S5Z A;  1XIQ A;  3G2X A;  1LEO A;  2HUR A;  4UOF A;  1PAE X;  1NB2 A;  3FBB A;  1PKU A;  1NDK A;  1BHN A;  4DUT A;  1WKK A;  2NCK L;  1KDN A;  3BBC A;  3JS9 A;  2B8P A;  3L7U A;  3BH6 B;  5CAB A;  3NGR A;  1NSP A;  1NSQ A; 
#chains in the Genus database with same CATH topology
 1NSA A;  1VRT B;  2XY5 A;  1UMJ A;  1RT6 A;  3WX8 A;  1R0A A;  1YLX A;  3UW1 A;  5A8R B;  3CJS A;  1FEE A;  4OX9 F;  2CJB A;  2NR0 A;  4Y2C A;  4PR6 A;  3GJQ B;  6AT1 B;  3BQ0 A;  3D0G E;  4WFY A;  3ILO A;  1OMS A;  4HAC A;  4O3S A;  2XUL A;  4XDC A;  2XYP B;  4NLR A;  5HQM A;  3DDN A;  2Q79 A;  4JBC A;  4PPD A;  4DU7 A;  5J2P A;  5F0W A;  1NME B;  5DO2 A;  1NJY A;  3W8G A;  4I1T A;  3OLA A;  4ATN A;  4OYW A;  4BC7 A;  2V2Z A;  1ZZF A;  2LCW A;  1HBU A;  1WHV A;  2FJB B;  2HZA A;  3G8T A;  5GMD A;  5LMN J;  3PKM A;  3B4D A;  4CI0 B;  1KFD A;  4F4A A;  2XZT B;  5CA5 A;  1Y10 A;  2Y1L B;  2QSF A;  2W01 A;  1CUL A;  5HN0 A;  2HIQ A;  2XCA A;  1ZM4 A;  3BR9 A;  3HVT B;  1IUJ A;  3QIP A;  4XK8 C;  5DQH A;  3KHL A;  1VBZ A;  2N82 B;  4N8O A;  4YDX A;  3J80 U;  1MSW D;  3A12 A;  3QT7 A;  5ETP A;  4QWB A;  1KTQ A;  4QW8 A;  2HRT A;  1Q95 G;  2CIM A;  3EMT A;  4LT6 A;  2GVD B;  1HNV B;  4WFN Q;  3TZW A;  2DNG A;  5C24 A;  1X60 A;  4NCA A;  2Y9H A;  3E2E A;  4DR6 F;  3CCE S;  4ZLJ A;  4TLQ A;  1JLF B;  3UPF A;  3J7A 1;  4AND A;  2QYC A;  1RP5 A;  1GX6 A;  2ATC B;  3H8Y A;  3IBW A;  5KFF A;  1IM4 A;  2D9O A;  3IMQ J;  3OR2 B;  3ZZ0 A;  9RUB A;  1R43 A;  3MCN A;  1SBR A;  2CWX A;  5D8H B;  2CDQ A;  5IFM A;  1AYE A;  4BS2 A;  1UJ4 A;  1KS2 A;  3CDW A;  3UDL A;  4LFA F;  3DHX A;  4CT9 A;  4PQU B;  1U25 A;  3KLV A;  2YKP A;  2ZWO A;  1OPI A;  1NO8 A;  2FPH X;  3M2V A;  3U7J A;  2DGS A;  1VBK A;  2VG7 B;  3PYF A;  3TUI C;  2RDJ A;  1VBY A;  3JAM Y;  1AW0 A;  4ZMM A;  3PX4 A;  2EEY A;  3CDU A;  5JXS A;  1WNE A;  3BGF A;  1YJW S;  3ENW A;  1R27 B;  2M2B A;  2V34 A;  2H5J B;  4ZA1 A;  2FY1 A;  3H5X A;  3D0H E;  1T11 A;  4F50 A;  1U1N A;  4F8R A;  2Z2L A;  4YHH J;  2VBW A;  1JLC B;  1IKV B;  3FVY A;  3KKF A;  1TKT A;  1FTR A;  5KFG A;  2LEB A;  1N5S A;  4NEY A;  1RIS A;  4JI3 J;  1UVN A;  4F67 A;  3MCO A;  1T9V A;  4RW7 B;  4QWE A;  1YG0 A;  3OTD A;  3DLB A;  1N52 B;  3N9U C;  2RIJ A;  2VKZ G;  3N6N A;  3M9O B;  4A8M P;  2B3T B;  3MOZ A;  1U1O A;  2PE8 A;  2O5D A;  5KFE A;  4TU7 A;  1TK0 A;  1QUV A;  2LP4 A;  4J9U E;  1UTA A;  1WF1 A;  3TR5 A;  3PW5 A;  4FXV A;  3SCL E;  3M6X A;  4ECV A;  1NKE A;  2Y0B B;  1VQ7 S;  2BOP A;  4LFB J;  3C3L A;  3T1H F;  1Y11 A;  4CT8 A;  4K4V A;  1RLD A;  2IVF B;  1WEY A;  1WC1 A;  2ZIT A;  2JLF A;  1F9F A;  1KQG B;  4ILM A;  4UST A;  5MLC V;  1KVI A;  2LA6 A;  1MMN A;  2E1P A;  3SBM A;  3IBF B;  1NUE A;  2O01 C;  4ZN3 A;  1SJR A;  2WCX A;  2ATL A;  3CD0 A;  1SC1 B;  2C2K B;  3IRX A;  4ZP6 A;  1DY3 A;  4C8N A;  2Y1R I;  2KH9 A;  2C28 A;  5K5M A;  4DUZ J;  2ZH6 A;  1WHY A;  4MKV A;  5J2N A;  2MKI A;  4LF8 F;  2I2Y A;  2ADB A;  1NJZ A;  3I0S B;  2GQQ A;  2RRA A;  2NQP A;  3HHL A;  4U7U K;  5A8K B;  4GC6 A;  1PAE X;  2XMT A;  2LKZ A;  3S6E A;  3UN2 A;  1Y5N B;  4KY3 A;  1BQN A;  4RW9 A;  4PCQ A;  1HAR A;  4X4Q A;  4KTQ A;  1KDN A;  2CAD A;  1S99 A;  2GCF A;  1HBN A;  1X4D A;  4ZPV R;  5GAD U;  4PWD A;  3G6Y A;  3QPI A;  2FLN A;  3DOK A;  2IM3 A;  3HVR A;  2BQR A;  3Q2T C;  1OPZ A;  2VG6 B;  5K8O A;  1FFW B;  1NDL A;  2P9E A;  4ELU A;  2K1R A;  2MZS A;  4BWM A;  3QFH A;  3TJ8 A;  2OAU A;  2ILZ A;  3IR6 B;  2IJN A;  1KSP A;  3ZTS A;  1H72 C;  2VJU A;  3AA9 A;  2GJF A;  1JLG B;  4Q7A A;  1KTV A;  2CZ4 A;  2HNY B;  3FEY B;  3GIR A;  3UWT A;  4CH0 S;  5J2Q A;  1FJE B;  5AXN A;  2IM0 A;  4Y2A A;  4ZLL A;  3T1Y F;  4LQ9 A;  1F6T A;  3MAH A;  2C3M A;  4J9R A;  1U2F A;  3H5U A;  2L08 A;  5F8L A;  4K59 A;  2GJ2 A;  4DFK A;  1HL6 A;  4AL5 A;  1Y0H A;  4OYO A;  4USJ C;  4Y6I A;  3G82 B;  3BKU A;  4JI3 F;  1IXK A;  1RUS A;  3EZO A;  1HWL A;  1BXN A;  2AYM A;  4I64 A;  1NH7 A;  1PG5 B;  2B8Q A;  2GHP A;  5L39 A;  2HND A;  5HO4 A;  1T03 B;  4JI8 J;  5L8R C;  4IOA Q;  1WEL A;  2VBY A;  2VFR A;  3M1V B;  1ZBT A;  3IM9 A;  3JSR A;  1N32 J;  4NXN F;  5LXY A;  2HNY A;  2G13 A;  4DL6 A;  4OJG A;  3TA2 A;  2XGQ A;  5J2Q B;  2HFN A;  1D9F A;  1ZA1 B;  4Y34 A;  1M5H A;  4K50 A;  2ZKU A;  2FGC A;  1KFS A;  3ISN C;  1N33 J;  2J6U A;  1X9W A;  2B7C B;  1TKZ B;  2IRX A;  2RQM A;  2ZNY A;  1C1B A;  2O3D A;  3VGS A;  3DN9 A;  2RUG A;  4UF4 A;  2NRE A;  1T9W A;  1XNR F;  3CJQ A;  1IBC B;  1WG4 A;  2MLZ A;  4ECY A;  1RWP B;  2HS4 A;  3FEZ A;  2XHC A;  4LRF A;  1FRX A;  5KG3 A;  4BBY A;  4ZHR B;  5KT7 A;  3C46 A;  3R5D A;  3KUG A;  2YWH A;  3OXF A;  4X64 F;  1FKA F;  2HHU A;  4ITS A;  5A8K A;  5HBM B;  2F40 A;  3W2V B;  1VYA A;  5KT5 A;  1W25 A;  4H54 A;  3T19 A;  5KFZ A;  4N56 A;  2RSQ A;  4DV7 J;  1NBE B;  1SJQ A;  1Z2Z A;  3PG9 A;  3VGU A;  3RAM A;  5RUB A;  2M88 A;  2YNI B;  3DLE A;  3TZY A;  3G6X A;  5KFI A;  3BGR B;  4Y3C A;  1X8D A;  3GZ7 A;  4PXB A;  4EO8 A;  5KFQ A;  3TQ1 A;  3PW0 A;  3OXL A;  2VU5 A;  4PRF A;  2J8A A;  2N4C A;  3HVA A;  4NLV A;  4F0M A;  1KRP A;  3ULH A;  1JLE B;  4AFF A;  2DIS A;  3OVS A;  1F3F A;  1MN9 A;  1WHW A;  1U7L A;  1TFY A;  1S7I A;  3PX6 A;  3TA1 A;  1RA7 A;  3MCS A;  4EYH B;  1HNI A;  4NCB A;  5ETS A;  2LA4 A;  3MAQ A;  3QWP A;  4DL2 A;  1CQM A;  4N77 A;  1XR5 A;  1R8A A;  1RT5 A;  2VG5 A;  3DOL A;  2HFS A;  1R0A B;  4WZM A;  2B43 A;  2N3O A;  4JI2 F;  4RW7 A;  2R8J A;  1LWC A;  3EVW A;  1XWL A;  4H4K C;  4A8F A;  1WG1 A;  1KD1 T;  1F1B B;  2JEF A;  1HWU A;  4AE5 A;  3GFH A;  2YH0 A;  4P71 A;  4NLG A;  4PG8 A;  4RW9 B;  4LVN P;  5L1L A;  2DGQ A;  1FO1 A;  4KGZ B;  3P4U B;  3HK2 A;  4K4Z A;  3HHL B;  4AUK A;  3R5C A;  3IG1 B;  1R8C A;  1WOO A;  3UD4 P;  1A7G E;  1DLO B;  2V8V A;  4QJV A;  1R0C B;  1HHQ A;  3A8K A;  2HW3 A;  4NYO A;  1TL4 A;  1DTT B;  5IQ6 A;  3DRR B;  4AL6 A;  2AJ1 A;  3R3T A;  4OLO A;  1IJE B;  2PMW A;  1H73 A;  1KQF B;  3TEG A;  5KFX A;  3ZZT A;  3Q8S B;  1YIT S;  3KG1 A;  4DHV A;  2WTF A;  2L9W A;  1FVQ A;  4M5M A;  4N47 A;  4J9N A;  3M6W A;  2LXF A;  3H0P A;  4KGX B;  2MLX A;  4LBP A;  2RU9 A;  1TUV A;  2I38 A;  4K7Q A;  1KOO A;  3NGR A;  5IS2 A;  3K2Y A;  1OYD A;  2ZOG A;  4JB8 B;  1NSP A;  1URR A;  2AMC B;  2GV1 A;  1RE1 B;  4RUC A;  2W7P A;  3R1H A;  1RYR A;  2E7W A;  3ZFV A;  4ZIV A;  3CJ4 A;  4ER8 A;  2VON A;  1KNZ A;  4RNO A;  3NAH A;  4KKO B;  4F3M A;  2HBY B;  3RW7 A;  3AFG A;  2ZUG A;  2ZZT A;  1IBK F;  4FBU A;  1HNW J;  1N8R T;  1O8B A;  2R7V A;  2N7Y A;  4IO1 A;  5F0U A;  1HNX F;  1LXN A;  2JJ4 D;  1OQ3 A;  3ELH A;  1WC6 A;  4UQT A;  1SXL A;  4DF4 A;  5EN1 A;  1RU2 A;  3T1Y J;  1WC3 A;  2G0I A;  4M5K A;  4M5D B;  5GVQ A;  3T9Z A;  4CZC A;  3V4M A;  3KG4 A;  1Q0N A;  5HAT A;  3T5J A;  3NWR A;  2DY1 A;  2DGW A;  1DAR A;  2GO8 A;  4RW6 B;  4Q2L A;  3DGV A;  2WVB A;  2V2K A;  1PYO B;  3GG0 A;  2QL7 B;  1HLW A;  2U1A A;  2KM8 C;  5F8G A;  4O23 A;  3TRG A;  3CCQ S;  5BR8 F;  1Q16 B;  2A2D A;  2DB1 A;  2ZC3 A;  5HQ8 A;  2ROG A;  5HMY A;  5B09 A;  1MLA A;  1MNE A;  2OEJ A;  3MM8 A;  4DPO A;  3QO9 B;  1FWK A;  2MQN A;  2JNJ A;  4RW8 B;  5IM0 B;  2FZC B;  2XBP A;  4URQ U;  2VQE J;  4P7V A;  2C3P A;  4F4Y A;  4C8O A;  4C6A A;  2GML A;  1Q8B A;  1FI4 A;  4IFV B;  4MAK A;  3G6V A;  3M8P B;  3MTJ A;  1VRT A;  4ES3 A;  4U8V A;  5L1K A;  1AXQ A;  1U1Q A;  3IWX A;  4IQM A;  3KOA A;  2DIV A;  2V63 A;  1RKI A;  1ZA2 B;  3AD9 C;  3M1V A;  3NS7 B;  2QFJ A;  4O3R A;  4X4N A;  3N01 A;  4X2B A;  1CUL B;  2P9C A;  4ZP9 A;  2VAS A;  4ZPC A;  4CLZ A;  3U27 A;  3ZNU A;  5GAG U;  4HYK A;  3RBD A;  4C8L A;  2E5H A;  4NLY A;  1TV6 A;  1NK4 A;  3RUB L;  3W62 A;  1SC6 A;  2M7S A;  6FD1 A;  1VK8 A;  2JC0 A;  2CQD A;  3D28 A;  4ALZ A;  2UUC J;  3NOG A;  2QA4 G;  3ILI A;  1TFW A;  3R9L A;  1AZS B;  2KYX A;  2W4P A;  1YIJ S;  2MJN A;  4RBT A;  1K47 A;  1D09 B;  2GGP A;  1B7Y B;  2DTJ A;  2EFQ A;  2GHW A;  2QIF A;  2X1B A;  3H42 A;  5FDL B;  4C48 A;  3W63 A;  2N7C A;  2KG1 A;  2HWT A;  3EZ5 A;  2E5L J;  2HHH F;  1HYS A;  4MK9 A;  4AQY F;  2WVC A;  5J1N A;  1PIL A;  4WTO B;  1XN9 A;  3MPV A;  3PTW A;  1KLM B;  2VFT A;  3MED A;  2MPU A;  3FZ2 A;  1W26 A;  4Q45 A;  3UD3 P;  2Z2Z A;  3KHH A;  2L3M A;  5G4D A;  4RU2 A;  5I3Q A;  1RT6 B;  1PJ6 A;  4LF1 A;  1PJ5 A;  4NXM F;  1XTZ A;  2CQ3 A;  4OZ1 A;  3SCK E;  4V19 J;  1ELO A;  4MMO A;  3CJT A;  2CPF A;  2DNQ A;  2YX7 A;  4UTG A;  5GAH U;  2GS8 A;  2D69 A;  2Q43 A;  4FNH A;  1EHW A;  4IG0 A;  1T3N A;  2GO9 A;  3A8E A;  4KIA A;  4MIW A;  3GCW P;  4O4G B;  4QYR A;  5A8W B;  1LFP A;  1RAI B;  3MAA A;  1CPZ A;  4O44 B;  3SQO P;  4PZV A;  4TY8 B;  3KJF B;  4LSL B;  3A3P B;  1FE0 A;  5JVG Q;  2JH3 A;  2BJD A;  2WVD A;  4D3H A;  1S4E A;  5C2C A;  1GXT A;  1T9T A;  1UWB A;  2DR6 A;  4XIU A;  3SCJ E;  5CCL A;  4LRE A;  1CSJ A;  5D4N A;  2JEI A;  2NPI A;  2OFG X;  4WJB A;  1JB0 C;  2X3G A;  1LK5 A;  2YPY A;  3T6J A;  2J7W A;  2V0N A;  3OJU A;  5KT4 A;  2IIH A;  1LW2 B;  1XMB A;  1BQM B;  4CH7 A;  4UOF A;  4CNY A;  5A2Q U;  2YNG A;  2VIH A;  5HMW A;  4PPZ A;  4NLT A;  4DL0 C;  3CXC R;  1TL1 A;  4DUT A;  2Y1J A;  1LK7 A;  4HAC B;  1PGZ A;  1BGX T;  4ES1 A;  1NK9 A;  4FXD A;  2ACY A;  2HS0 A;  4A46 A;  3CD5 A;  4IYQ A;  5HQL A;  2A3J A;  1S6P A;  4M5H A;  1LOU A;  2F9D A;  2J8S A;  3V4I A;  2HYI B;  2V68 A;  2UUT A;  4NLD A;  3MMA B;  2HVI A;  4FYX B;  5A8R A;  2VL1 A;  5D0R A;  1XNQ F;  2W7O A;  2KG0 A;  1JLA B;  3Q22 A;  3J7Y U;  5IV4 A;  4FS1 A;  3QT8 A;  5GAH I;  1QLN A;  4OYZ A;  3DMJ B;  1E6Y B;  2DBB A;  2HAF A;  1QVF R;  2JC1 A;  1YBT A;  4ED0 A;  3CMQ A;  3QJJ A;  1U49 A;  4DR7 J;  3V2U C;  3W8P A;  4ZCK A;  4X84 A;  1K1S A;  2DNH A;  4OI4 A;  3VWS A;  4WFA Q;  1JXV A;  1FJC A;  1S9E A;  2CQH A;  2KL8 A;  1L5U A;  1S1T A;  5LSR A;  1QTN B;  2H3E B;  3UNY A;  2Z2Y B;  3VVU A;  1CJT B;  2K2P A;  4CO2 A;  3TAR A;  1DZ5 A;  1B0V A;  1H6K X;  5FD1 A;  4CLL A;  2MYF A;  2FVC A;  4FKX A;  2P2C B;  5LMU F;  4DSK A;  3I4H X;  1W7W A;  1HIY A;  4M63 A;  4QIE A;  4J9L A;  1P9Y A;  3NNC A;  3FJ2 A;  1MN7 A;  4DR6 J;  1FDN A;  4S0M A;  1VQO S;  1KVK A;  1SI9 A;  1F9E B;  3OFF A;  1RLC L;  1D3W A;  1U8S A;  1SKR A;  4B17 A;  1S1V A;  5U47 A;  4HVZ A;  1GT8 A;  1RHR B;  4NMX A;  4WK1 A;  4WFZ A;  3V6J A;  3M6U A;  2IVM A;  4DQI A;  2C2M B;  2J9C A;  4UW2 A;  2D1C A;  2W4D A;  4RX6 A;  3KHG A;  1N36 F;  1RT1 B;  3MEG A;  1X4G A;  1H98 A;  3HPO A;  2AT1 B;  2B4P A;  2DO0 A;  3NAI A;  1Q53 A;  3K17 A;  3C8Y A;  4WYW A;  4C8Y A;  4IFY A;  5DDP C;  1BQM A;  4KE5 A;  2CRL A;  4F26 A;  1X5T A;  3K5O A;  3NL0 A;  1SQG A;  4OL8 A;  1RTD A;  4FF1 A;  2E7X A;  1R6V A;  2C3U A;  1UKU A;  4K8R A;  3K5P A;  4M5L A;  3SMZ A;  3BKF A;  1JNZ B;  1R8P A;  5DG8 A;  3T5K A;  3HHN B;  3GJS B;  3CJ2 A;  4NA1 A;  3OVB A;  1SH3 A;  3PFE A;  3CUN A;  4B3T F;  1S1X A;  1E6V B;  3L95 X;  3OTO F;  2XNQ A;  2VV5 A;  5D77 A;  2B56 A;  4J9S A;  1B70 B;  3TAM A;  4I67 A;  3V4I B;  5KFR A;  4RUA A;  1EB0 A;  4O4G A;  5D4O A;  1QAJ A;  5AXK A;  1S6P B;  3W66 A;  3POT B;  5ETM A;  4ZVP B;  1IBK J;  3PIO Q;  1BWE A;  3F41 A;  3NGU A;  4LRB A;  1X5P A;  4JUZ A;  2OEL A;  2FY8 A;  4DR4 F;  3D6H B;  1RBL A;  1C4A A;  3KK1 A;  4DS5 A;  3OL6 A;  3RU0 A;  2YNG B;  5K8M A;  4XPC A;  1TVR B;  2XYH B;  1UVL A;  4L74 A;  3BSC A;  4F25 A;  1YX2 A;  1ZAV A;  3FDS A;  4MFB B;  5A0Y A;  3JSM B;  4ECR A;  3FQK A;  1RBO B;  3UNG C;  2LMI A;  3ZTR A;  1YBU A;  3NKY A;  4DR1 F;  2E1A A;  3EGN A;  3NGS A;  2M4M A;  1FNM A;  1HPZ A;  1RWU A;  1ZAW A;  3DYA A;  1F2H A;  2BJE A;  5HVF A;  1VJW A;  2QL9 B;  5CXT A;  2VZ9 A;  3D67 A;  1GMW D;  2IBO A;  1VQP S;  3M8Q B;  1UZD A;  1XBW A;  4NCG A;  2CZ9 A;  2CDR B;  3T1A A;  2XGP A;  3T5H A;  4UUW A;  3MEC B;  3TVY A;  4K4Y A;  2HQG A;  1P8G A;  4DPW A;  3K89 A;  3ONQ A;  2Y0S D;  1IKY A;  3JAM U;  1K0T A;  2MXY A;  1MW7 A;  3AOD A;  3MR7 A;  4HKQ A;  1P6T A;  2J9E A;  3ILL A;  1X5O A;  2V4R A;  5LMU J;  3US5 A;  2GX8 A;  2KDO A;  3A3N B;  1VC6 A;  2CA9 A;  3CJ8 A;  4OZ0 A;  5DDQ C;  2ZH4 A;  3CSK A;  1QSL A;  1HNW F;  1FFG B;  1VMB A;  3PYE A;  1TAQ A;  4ECW A;  2MQ8 A;  3IC1 A;  1UET A;  2VPZ B;  3TUZ C;  4X4P A;  2OPP B;  4O3N A;  1YJV A;  3G87 A;  4L73 A;  3KLI B;  3H2L A;  3K0J A;  3KG0 A;  5IC4 B;  4DPU A;  3IS9 A;  4YFU A;  1NJI T;  2LQB A;  2IHR 1;  2PGC A;  1NB7 A;  3C2P A;  3AJ2 A;  3M2U A;  2BM1 A;  2PEH A;  4ZJL A;  3D9B A;  3MPU B;  2E44 A;  3B4M A;  2B9Y A;  3N28 A;  4QCL A;  3LW5 C;  3MPY A;  3MUR P;  2WBM A;  1RJJ A;  3LPY A;  3DGP B;  1NND A;  2ADC A;  5F3Z A;  2UXD F;  1HBM B;  1LFW A;  4OHY A;  3HSJ A;  4DV7 F;  3BYP A;  4USV A;  5DDR C;  4DF8 A;  1N0U A;  1C4C A;  1X4E A;  2EFN A;  2R42 A;  3A8I A;  3DI6 A;  4DZ6 A;  4X4O A;  1SVD A;  2IRY A;  4KPY A;  1KHV A;  2VIC A;  1B0P A;  2J0W A;  2X1G A;  3D1H A;  1UEK A;  1WDD A;  2R7S A;  3ADA C;  2DIU A;  1RSC A;  4DZD A;  2DPI A;  4OI3 A;  1C0U A;  4DQP A;  2R7Q A;  5CCM A;  2R9L A;  3QO9 A;  3MMC A;  4RW8 A;  2D74 B;  5KG4 A;  3NGD A;  3PVX A;  1QE1 A;  1YVF A;  4V1A k;  5K20 B;  2DHA A;  2ZM6 J;  3NRB A;  4KSE B;  4PG7 A;  3DNC A;  3F56 A;  2DXE A;  2BDP A;  2ASD A;  3BN7 A;  4HDH A;  2RAQ A;  3VAM A;  2D3Z A;  3I31 A;  5AT1 B;  4NL5 A;  3MR3 A;  1N0V C;  1T9U A;  4OZ2 A;  3BPS P;  3Q86 A;  2LDY A;  3OXG A;  4NRT A;  1JLQ B;  3HVW A;  1S9E B;  1I94 J;  1CG2 A;  1F0X A;  2LEP A;  3GV8 B;  2KFN A;  1ZM9 A;  2HZV A;  2DH7 A;  1RWW B;  5HSP A;  1I6J A;  3BGL A;  1JXE A;  2B9X A;  2FHJ D;  2HHP A;  2IFX A;  3EDQ B;  3CO0 P;  3LUY A;  3R5B A;  5HK4 A;  3FQL A;  2FLO A;  3E01 B;  3KK2 A;  1SH2 A;  4R5P B;  2UV8 A;  1LWC B;  2ZHA A;  2CQ1 A;  4DR5 J;  5KFW A;  4WXO A;  3H4B A;  2YH1 A;  2BM0 A;  2W24 A;  3GFX A;  4IG3 A;  1M5V C;  4B9M A;  3BM7 A;  3O44 A;  4YME A;  1KLM A;  1OY6 A;  4B9N A;  2BYC A;  1EQ0 A;  2ZOF A;  3AJD A;  1DTQ A;  4FPR A;  1G1X A;  1AUD A;  3OT9 A;  3IO1 A;  3SV4 A;  3UQS A;  2CQB A;  2MZJ A;  2Z57 B;  3B6B A;  5BJR A;  2E5L F;  2M8D B;  5KFC A;  2PI5 A;  4P52 A;  3SDE A;  3NCP A;  1X0F A;  4ZJQ A;  4WFB Q;  3H4D A;  2V4J A;  3W5X A;  2VQF J;  5H9E K;  2F8E X;  3DRR A;  3GYG A;  2CPE A;  3VVT A;  2IDL A;  1EJ7 L;  3KJQ B;  2QV6 A;  3GJR B;  3U1L A;  4DG1 A;  5C42 B;  4UT4 A;  2KJV A;  3EVM A;  5C2G A;  1LQ9 A;  2DKO B;  4R8U B;  4YY3 F;  1R6Y A;  4HTI A;  3WQP A;  4A8Y A;  1U4B A;  1HNZ J;  4H4M B;  3EJM A;  4KB7 A;  2HIY A;  4A48 A;  2CYY A;  1NHK L;  1S1U A;  4O4R A;  2DJW A;  2OIH A;  2K7J A;  3FCH A;  3TUP A;  3RRH A;  4RR5 A;  3BQ1 A;  2I6W A;  4IKA A;  1T95 A;  3UDC A;  1ZTT A;  1TKX B;  2XTJ P;  3UCU P;  1KKH A;  3BS9 A;  4KHM A;  5ETR A;  3RB3 A;  3HD1 A;  1HR0 F;  2DNR A;  4IFV A;  2HGL A;  3A4T A;  2WSE C;  1HWK A;  3DFE A;  3UN3 A;  3I0R B;  4ZIW A;  1S10 A;  1UJ5 A;  1DBD A;  3BH6 B;  2YWF A;  1V5V A;  4DS4 A;  4IH7 A;  1NM2 A;  1W2B R;  2R7U A;  2EFO A;  2HZC A;  2EG2 A;  1MML A;  3DLG B;  1PSD A;  3QLH B;  2CNO B;  2K3K A;  4JV0 A;  2BQU A;  4Q8E A;  4CO5 A;  1H74 A;  5ETV A;  4JI5 F;  4MTP A;  3GV5 B;  1KQS R;  1Q78 A;  2ZH8 A;  3M30 B;  3M8W A;  2ZBP A;  3W9H A;  1FVS A;  1S49 A;  2EFG A;  3CCL S;  1UL3 A;  4U96 A;  4F04 B;  2YXL A;  2QLW A;  1UCN A;  2HFV A;  3DLE B;  2DIT A;  3JSB A;  4N8N A;  4TXS A;  2KFZ A;  3D2W A;  3THT A;  1T03 A;  4P2F A;  4C98 A;  2V2V A;  2AGP A;  5DQG A;  4MYT A;  3GR1 A;  2UUA F;  3SIP B;  1ACM B;  4RZR A;  1GH8 A;  2Y8Y A;  4RKU C;  1JLB A;  1U02 A;  3P96 A;  4NLP A;  3MD1 A;  2BV3 A;  1QAY A;  4RNH A;  3RBX A;  4WPA A;  4HL9 A;  5DDO C;  2BMB A;  1V9O A;  1TR0 A;  4PG6 A;  5DQI A;  4ILL A;  2RIL A;  4ZS6 A;  3LPE A;  5ETQ A;  2EK6 A;  1TUW A;  3CNQ P;  3ENA A;  1PO6 A;  1XJW B;  3FGV A;  3NG8 A;  4L75 A;  5DET A;  1BUX A;  2RDI A;  3A13 A;  2PMZ D;  4DR2 F;  2RKI B;  3D3C J;  4OV1 A;  4LFA J;  2VQE F;  4RBU A;  2ZNZ A;  3QAE A;  4EU0 A;  3AB4 B;  4K4W A;  1XR6 A;  4NML A;  2JZ5 A;  4QR2 A;  1JMT A;  1O6X A;  1ZYQ A;  2D3U A;  4O3P A;  2XMV A;  4R0E A;  4OJ3 A;  1P1L A;  4X62 J;  4XTT A;  4ED6 A;  3PY8 A;  1OY8 A;  2CFX A;  2HQF A;  2XNR A;  5E33 A;  1BMQ B;  2KZZ A;  2H9Z A;  3EX7 B;  1RAH B;  4J9O A;  1KC8 T;  4KRW A;  1TUG B;  3KLF A;  4OX7 A;  3HZE A;  3HHE A;  4M5D A;  1NPR A;  4IG3 B;  3TJ9 A;  3I0S A;  2OML A;  3IWN C;  3Q24 A;  1TP7 A;  3HHK A;  2BOA A;  1HWI A;  2W4C A;  2R3V A;  4I6A A;  2YKN B;  1RAD B;  4KAI A;  3DOM A;  1H0H B;  2ZD1 A;  3MEK A;  4WP9 A;  2M3D A;  5KFA A;  4ZCM A;  1D8Y A;  2FJW A;  2HKE A;  2B4O A;  1S79 A;  2HMI A;  3N79 A;  2AD9 A;  1WUU A;  4QIG A;  1NCL A;  3CDB A;  4KGK A;  2FVQ A;  2IA6 A;  1L3K A;  2P8I A;  3BR8 A;  2RRB A;  2Z0G A;  3M8Z A;  1T05 B;  2VBZ A;  4OZ3 A;  1V6H A;  2W7A A;  2Q1L A;  2VG6 A;  2MHE A;  3FFI B;  3UVJ A;  1T94 A;  1O0P A;  2J0S D;  1QD1 A;  3RR8 A;  4WU3 A;  4L3N A;  3PRB A;  4EBE A;  1VGY A;  3MR5 A;  4C8K A;  3LP2 A;  5ETO A;  1Y00 A;  3LGH A;  2IM1 A;  2LXI A;  3R7B B;  4WKY A;  2LQ5 A;  2Z8Q A;  4PWD B;  4X4U A;  2IBK A;  1KQK A;  3HSD A;  4PKD B;  3FSX A;  3QFW A;  4A4J A;  3BGR A;  8RUC A;  4ES2 A;  2ERR A;  1QM9 A;  2G2Y A;  3G8Q A;  4OHZ A;  2ZJR Q;  4DR3 F;  4A8Q A;  5LL6 d;  5EWG A;  1CLF A;  3TW0 A;  2DNZ A;  4ZN1 A;  4B9S A;  3HM9 A;  3DU5 A;  4DX8 H;  1IKV A;  2FC8 A;  1YRT A;  4HHU A;  2OMO A;  3IG1 A;  3N6L A;  4ID8 A;  3W2V A;  3KWM A;  2COL A;  1NJW A;  3CMA S;  4B9V A;  5M2P A;  1U24 A;  5HL7 Q;  3OW2 R;  4ED1 A;  2PC6 A;  1WOS A;  3W9I A;  2KU7 A;  1FJ7 A;  3PEH A;  4FN5 A;  3UR3 C;  2BAN B;  3MM6 B;  3BF4 A;  1S5Z A;  2D7S A;  2VD3 A;  3OR1 B;  3R7N B;  4W90 B;  1RI7 A;  3GMG A;  2UXD J;  2NXN A;  2JEJ A;  1BLU A;  1NDK A;  3QRR A;  3P45 B;  1BHN A;  2EI5 A;  1X4H A;  2W25 A;  1MRO B;  4ZVU B;  5AE3 A;  2XC9 A;  3M05 A;  2DRA A;  2OGU A;  3JS9 A;  4DV3 J;  1WTB A;  4P9S A;  4DR1 J;  3GII A;  1WSV A;  4B3R F;  2ZDO A;  5IWA F;  4DFJ A;  1RTI A;  4OIX A;  1KBR A;  3D1Q A;  2XWX A;  3Q0A A;  1VBX A;  3RG6 A;  4KFB A;  2I0X A;  2MY7 A;  1QUP A;  2OH2 A;  4C8Z A;  2CNN B;  2MTL A;  1SKU B;  1G2E A;  3O5T B;  1JLE A;  2AJF E;  3Q83 A;  1KON A;  1HQE B;  2DHX A;  4C3L A;  1KN6 A;  5B0E A;  4AYB D;  3PIP Q;  1VQ5 S;  2YNF B;  4DV6 J;  1JNR B;  2A18 A;  3TWZ A;  3BJY A;  2AGO A;  4ZPB A;  1SL0 A;  4LF4 J;  2YBV A;  4I69 A;  5BYQ A;  4OFZ A;  3OD2 A;  4TKT A;  2FZG B;  4P7T A;  5I4M A;  4WP8 A;  2YQ0 A;  3EIC A;  1YWX A;  2AHO B;  3HFK A;  3KUH A;  1FD8 A;  5D15 A;  1TL3 B;  5AE2 A;  1V3Z A;  2G0C A;  3VQS A;  3ZTQ A;  1CC7 A;  1MG7 A;  4ZLP A;  4OYM A;  2QYG A;  2YKA A;  2BRK A;  4JI5 J;  2DNK A;  4DL3 A;  2HFO A;  1LWF A;  3MEE B;  5CQG A;  3VCD A;  3EGW B;  4ZHR A;  4X62 F;  2K1R B;  4A8W A;  3BGO P;  3FC9 A;  4RJV A;  5KFS A;  2MSS A;  2FLL A;  4NAS A;  5LSL A;  4CP5 A;  1C1B B;  4FZV A;  4QR1 A;  2KRR A;  3CUL A;  2AQ4 A;  4KHR A;  3CWJ A;  4M5G A;  2M8H A;  1JLF A;  3T6B A;  4P10 A;  4G1Q B;  5B0B A;  4TLR A;  3KXD A;  4A47 A;  2AWZ A;  3IN5 A;  3CB4 A;  2AJ0 A;  1FE4 A;  3GV7 B;  4CLT A;  2KT2 A;  4O3O A;  1G7C B;  3UDE A;  4KH0 B;  1VCT A;  3I5A A;  3KTQ A;  2D41 A;  2KJW A;  4ECU A;  4Y28 C;  4U7U D;  2F63 A;  1FJG F;  2H54 B;  3C6T A;  4DCJ B;  5J2N B;  4R0J A;  3LAM A;  4ZVR B;  1NK0 A;  4UUX A;  5DZ7 A;  2MQM A;  2MLY A;  1HNZ F;  4JI6 J;  2XSJ A;  4CWB A;  3ILJ A;  2ZJP Q;  4EBC A;  2GNK A;  1NZA A;  3K59 A;  1U1P A;  4C4W A;  3QRQ A;  4Q0B A;  3BKT A;  4OQJ A;  1AT1 B;  3KJN B;  2FVR A;  2GQ2 A;  2FHM A;  2CQC A;  4RNF A;  5G0R B;  2VH7 A;  2HHQ A;  1S59 A;  1RWV B;  1WF2 A;  5J2P B;  2KXF A;  4ZVT B;  2VA2 A;  4AT1 B;  1TMJ A;  1DQ8 A;  2EC0 A;  2E1R A;  2GFF A;  3K58 A;  2MQL A;  4J9K A;  3TX0 A;  3MPW A;  3PO4 A;  1VR6 A;  3HO1 A;  2DNM A;  2HS3 A;  1CEZ A;  5D0G A;  1HFE L;  1BD6 A;  4KC5 A;  2AF6 A;  2HBR B;  2YKM A;  2M70 A;  4WP3 A;  4U8Y A;  5KG7 A;  1U1M A;  1N5Y B;  4DEZ A;  1YI2 S;  2XSF A;  2RH3 A;  2K7K A;  1TU0 B;  1JLC A;  1VJQ A;  4U67 Q;  4CDI A;  2M0G B;  2AYE A;  4Z7Y A;  3TNV A;  3P49 B;  4ZVF A;  1IR1 A;  3LGM A;  4I2P A;  4CIO A;  1BQX A;  4DQQ A;  4Y2K A;  1S0M A;  2HRU A;  4IDK A;  1RB0 A;  3P6Y C;  1LNQ A;  4RW4 B;  2BBE A;  4P2X A;  3NEK A;  3Q2S C;  3JTP A;  3F44 A;  4KBI A;  2JLG A;  2IA0 A;  4OI2 A;  2A10 A;  4IUF A;  2G1D A;  3L4B C;  3KLG B;  3TVZ A;  2DNY A;  2KHD A;  1FK9 B;  1CJK A;  2NYI A;  3HZG A;  2ZM6 F;  2MY8 A;  1IQZ A;  2ZC4 A;  2VOD A;  1T02 A;  2XEX A;  2DGO A;  4DV1 F;  1HI8 A;  2DH9 A;  1GXL A;  3VV2 B;  1XC9 A;  1SKS A;  1FKP B;  4ECT A;  2CQP A;  3T1H J;  4CLF A;  4RWX A;  3M8S A;  1GTH A;  3DC2 A;  5F41 A;  4IRC A;  5GAG I;  2VOO A;  1GK8 A;  1VQL S;  4EYI B;  1J5E J;  4YQW A;  1RYS A;  3PNI A;  4F3O A;  2H51 B;  4Z37 A;  4OHW A;  1NHU A;  2N3L A;  1VRU A;  4JOU A;  3FBF A;  1NSQ A;  1N6Q B;  2RQC A;  3CCM S;  1I5O B;  3MM5 B;  2L48 A;  2OHD A;  4HI2 A;  3OV7 A;  2HBZ B;  2QLB B;  3ZNJ 1;  1E6Y A;  2V9W A;  1S7H A;  3TA0 A;  3UFC X;  4CLW A;  3DLL Q;  1HBM A;  2FJA B;  5D0E A;  2PA8 D;  4QIW D;  2E5G A;  4J7C A;  4YHH F;  1QTM A;  4OHX A;  4YR2 A;  3D7S B;  4J37 A;  1BE4 A;  5E3A A;  1J2V A;  4ZVH A;  1H2V Z;  3VAL A;  2QGF B;  3CGI A;  3UN5 A;  2CWK A;  2MZT A;  5CAA A;  2ZH2 A;  1RWM B;  4J5O A;  3BSN A;  3HP6 A;  5DLF A;  4XDD A;  4P75 A;  1JJ4 A;  1ULR A;  3Q23 A;  2K8G A;  1Q82 T;  4PXC A;  4P2M A;  5KFT A;  4LF9 F;  1TMM A;  2UUW A;  1ZPV A;  5FII A;  3SSS A;  1YHQ S;  1OY9 A;  5I3P A;  2VBX A;  4TN2 A;  4ZIT A;  3QGG A;  3ZC4 A;  1B3T A;  1UVK A;  2Q66 A;  2W1B A;  3W64 A;  5C25 B;  2GAG C;  3LO3 A;  4LR9 A;  1IM6 A;  1Q8L A;  2OPS B;  4ZVS B;  5KFO A;  1M90 T;  5K8P A;  7AT1 B;  4DPT A;  3J81 Y;  3MUT P;  4WK3 A;  4LRA A;  2Z56 B;  3H5Y A;  2UUC F;  5HVG A;  4JYA J;  2XB2 D;  1HBO A;  4OYI A;  2NSB A;  1XQI A;  1WOR A;  2XSJ B;  3FNN A;  3D1O A;  5E41 A;  3EPI A;  1CVJ A;  1CJU A;  5DS7 A;  5KTQ A;  3OQ2 A;  3MEC A;  4CCH A;  4C11 A;  4DX5 A;  2E29 A;  3BZQ A;  4LSL A;  2QEX S;  1U1L A;  4TY8 A;  4O44 A;  3HVT A;  3QIP B;  4B3S F;  5A76 A;  1GMU A;  2ALY B;  2BW7 A;  1Y7P A;  5ADZ A;  4I7F B;  3V81 B;  3TZX A;  3CCW A;  3EGZ A;  3L7P A;  5LMN F;  3SSQ A;  3D68 A;  2C42 A;  2EFV A;  2GC8 A;  2FB0 A;  1IKX A;  4CRJ A;  3N5B A;  3JYT B;  5KFV A;  3CCR S;  4QU6 A;  2HHT A;  2SXL A;  3Q8Q B;  1FNO A;  1OYE A;  2HVE A;  2YKM B;  3FBC A;  3LP0 A;  1VIX A;  3R2D J;  3KFW X;  1ZAX A;  1H3D A;  1RXO B;  2H4W B;  1C1C A;  1FD2 A;  2MKY A;  2XY6 A;  4ZJO A;  3AHP A;  1OO0 B;  1WAC A;  2BJ8 A;  2B4V A;  1FES A;  3OJS A;  3CPW R;  2B5J B;  2BE2 A;  2FHJ A;  2HVD A;  1S4F A;  2XYG B;  3C14 A;  1UW9 A;  4G1I A;  2W9C B;  3KK1 B;  4WYL A;  3CC2 S;  1S97 A;  1Z1Z A;  2L9N A;  2MB0 B;  4BLG A;  4IRD A;  2QMW A;  1U0H B;  3LAK A;  3JYT A;  2RUS A;  3KHR A;  3QMQ A;  2GGP B;  3GWC A;  1N5Q A;  5G0R A;  5MAO A;  4J91 A;  2LYV A;  2HEK A;  4JI1 J;  1HKA A;  2DD8 S;  5KFM A;  2IC3 B;  1SPB P;  3BBF A;  3MMJ A;  4NLX A;  4QYZ J;  2FQQ B;  2VF3 A;  5IC6 B;  3PHT A;  4K4T A;  4P74 A;  3UR0 A;  2UUB F;  1IVZ A;  2HLT A;  3MFH A;  1HQE A;  1UFL A;  1C0T A;  2NXC A;  3HFZ B;  2GMH A;  1CJU B;  2ZBI A;  4I6W A;  4KV8 A;  3C6T B;  4NA3 A;  1R0B G;  3KYL A;  1S1W A;  1RQ0 A;  2CUY A;  4KR0 B;  1D9A A;  3PKY A;  3BEG B;  1IBL F;  2HNZ B;  2C2O B;  1FXL A;  3C6U A;  1BY9 A;  2V8D A;  4ILR A;  4N7T A;  3TP2 A;  1KLN A;  1WOP A;  3J80 Y;  3AD8 C;  2UVV A;  2WHO A;  4FF4 A;  1F5C A;  1P9Q C;  3WC0 A;  1UWA A;  4DBQ A;  3W2W A;  1N34 J;  3A3O B;  3ZZO A;  2FVS A;  2V8G A;  2EK1 A;  5F8J A;  2KYZ A;  3S8S A;  5HJY A;  5AXM A;  3RBZ A;  4FYD A;  3UDV A;  3GPA A;  1RTH A;  5BR8 J;  4K0K J;  1FKO A;  3T41 A;  3P5T L;  4B3M J;  1LWF B;  3MEE A;  3K5M A;  4CM0 A;  2JEG A;  5D3G B;  3BN4 A;  3VAH A;  1FNX H;  3G9C A;  1SH0 A;  1WC0 A;  2DK2 A;  4I4B A;  1VQ4 S;  3E8O A;  1NK6 A;  1Q86 T;  3D66 A;  4JI1 F;  1TL7 A;  1WI8 A;  3BBB A;  4JP8 A;  1MU2 B;  4Q8F A;  3SQG A;  2V2Q A;  4DV0 F;  3I6P A;  1SQE A;  4NI2 A;  5SUH A;  1CS4 B;  1RK8 A;  3H59 A;  1UVM A;  2X1F A;  5K14 A;  3CED A;  4F4W A;  2XMW A;  2JRS A;  3H2U B;  1N5Y A;  3DLH A;  2YTC A;  5B7W A;  5CYQ B;  2X7I A;  1RTJ A;  2H48 B;  1YRX A;  2K06 A;  3F73 A;  2GAH C;  3OHA A;  1JX4 A;  1TTH B;  2MST A;  1IN0 A;  1H7X A;  1WF0 A;  1FK9 A;  2C2Z B;  3R5G A;  5THW A;  1S6U A;  4LRC A;  4DX7 A;  1M1H A;  3DXS X;  4KGM A;  3HT3 A;  3MM9 B;  3V6K A;  2J5A A;  3ET6 B;  3OR1 A;  4F2R A;  3QRP A;  4Y0F A;  3CJR A;  4LQ3 A;  3M2R B;  2UVU A;  2ZVS A;  3PR5 B;  2XLK A;  3CO9 A;  3NNA A;  2CVE A;  4C8M A;  3E51 A;  2CJQ A;  5CYJ A;  1DQA A;  2WB1 D;  3VGV A;  4QWD A;  2JOQ A;  2AW0 A;  1X4C A;  2MJU A;  4YP3 A;  5HVH A;  3CT9 A;  4ETX A;  4AXI A;  2A1B A;  1TL1 B;  4FKY A;  5DRK A;  5ETT A;  4DV5 J;  3W1Y C;  4EZ6 A;  5L1J A;  1FWP A;  1WKL A;  1REV B;  2CQ0 A;  3OTB A;  4ED8 A;  4X65 F;  3O6Q A;  3VZI A;  2KVQ E;  4C0O C;  4ED4 A;  4DR3 J;  2E7V A;  1QDU B;  3HI9 A;  4CLK A;  1VC5 A;  5HMZ A;  3I96 A;  3ZZP A;  1M5P C;  4JI4 J;  2RHQ B;  1N33 F;  2RKI A;  2DGU A;  4DQS A;  1IR2 A;  2ZE2 B;  4WE1 B;  2OD4 A;  4URS A;  1RAG B;  2QZ8 A;  1SJ4 P;  2I1R A;  1D1U A;  1V3R A;  4DV4 J;  5CH7 B;  3A8J A;  1EIY B;  3S7R A;  1N32 F;  4DR7 F;  1SUQ A;  3RRK A;  6FDR A;  4IH5 A;  3GU0 A;  4I2Q A;  4PEO A;  2NPF A;  2WVE A;  1M1G A;  3T9N A;  4USM A;  2DGV A;  1UFK A;  1NKC A;  5AE1 A;  5A8W A;  3TZZ A;  1ZS6 A;  2QSW A;  3ZXW A;  3MF5 A;  1GFW B;  1S6Q A;  1SQF A;  4IR9 A;  1UP1 A;  1FER A;  2QC3 A;  3DOM B;  2XQC A;  3I4P A;  2J9D A;  2ROE A;  1FRI A;  2U2F A;  2CXE A;  3WIU A;  5JJB A;  2ZDP A;  1L3V A;  1HMV A;  2APO A;  4FP9 A;  4K5S A;  3KMQ A;  3O8W A;  3TJA A;  4URG A;  1R89 A;  2H5E A;  4ED2 A;  3IRW P;  3KLF B;  1RWN B;  4LSN B;  3IWL A;  4TYA A;  4B3O A;  3VZH A;  3O3L A;  4YEA A;  1IKW B;  4GRS A;  4TY9 A;  4E98 A;  1EET B;  4PAB A;  1SL2 A;  4Q44 A;  2WB4 A;  2OTJ S;  1WWH A;  4B3R J;  3M8R A;  2AJ2 A;  2DGX A;  2JX2 A;  2RF2 A;  3C16 A;  1O51 A;  3B82 A;  4OHV A;  4P73 A;  3KJV A;  3EWG A;  3IBC B;  2DHS A;  4OI6 A;  1VRQ C;  1OSD A;  2X3D A;  1ZM2 A;  1OSC A;  4LUB A;  2G9O A;  4JI0 J;  3DM2 A;  4O3Q A;  1TKX A;  1UFW A;  5KG5 A;  1RA6 A;  1LW0 A;  1RT4 B;  2ASY A;  3CCT A;  4ID5 A;  2XZW A;  3CF5 Q;  3CC4 S;  1XMQ F;  4NXN J;  5H9F J;  1VQ9 S;  3R97 A;  2ILY A;  2OPQ A;  1JLB B;  1GNK A;  3FMB A;  4F0H A;  3PJW A;  2EW9 A;  2R4F A;  1NB2 A;  3PM9 A;  3M8P A;  2HQD A;  4R8U A;  2OJ3 A;  4TNO A;  1FWL A;  3X1L B;  4F4K A;  1CJV B;  2B4U A;  2RD5 C;  2R8I A;  3FMW A;  1WJ9 A;  2YNH B;  1UVJ A;  4IOC Q;  5HI7 A;  1YQH A;  2PDA A;  2WOM A;  2WVF A;  5IM0 A;  2BQ3 A;  1TK5 A;  5CYM A;  3L09 A;  2KO1 A;  3SFG A;  3RBE A;  2NUH A;  2QFI A;  4H4O B;  4HH0 A;  4MIA A;  4WWS A;  4RNM A;  3SYZ A;  2IY5 B;  1RTZ A;  3QYY A;  2NZC A;  5FLX U;  2FLP A;  3LP2 B;  4AQY J;  4YUD A;  4B3O B;  1B4S A;  1PBU A;  3HD2 A;  3QAT A;  1IWG A;  5ETN A;  4ENO A;  2VC0 A;  1PBA A;  2R7R A;  1TK8 A;  2R7X A;  5H9E J;  2ZOM A;  1RAO A;  2B51 A;  5L9X A;  4LF2 A;  3R8Y A;  2WK4 A;  4C97 A;  1FA0 A;  8AT1 B;  3G71 S;  3ZTO A;  2I5J B;  2IJF A;  2UZA A;  1Z4U A;  4LF7 J;  2HVH A;  5HP1 A;  4MKY A;  2EXU A;  2R8H A;  1HBN B;  1H7W A;  3CTR A;  2R2R A;  1CC8 A;  1DRZ A;  4KT0 C;  3NNH A;  7FD1 A;  1RAE B;  4JV5 F;  1CBK A;  2BKO A;  1H2T Z;  5GAE U;  5KFU A;  5LJ5 Y;  4MIB A;  1X4B A;  2C2D A;  4KKO A;  2QA4 S;  4ZVE A;  3EM1 A;  5E2Q A;  4M94 A;  2CQI A;  3MMB A;  4X66 J;  2W9B A;  2IAJ A;  1NDC A;  1T0T V;  4NX9 A;  2UVR A;  1N88 A;  1NU4 A;  4QOT A;  3TYT A;  5I3U A;  4WKR A;  2M9K A;  3QBC A;  3KLH A;  3CCZ A;  4CYU B;  5B0C A;  2DXF A;  4DV4 F;  1JLQ A;  3CIZ A;  4LF8 J;  3ZO7 A;  5M2R A;  2G2Z A;  1IR0 A;  2MKS A;  4WE1 A;  4CLY A;  2ZE2 A;  2GMJ A;  3U1M A;  3GLJ A;  3LP1 A;  4D3G A;  2OI2 A;  2ZH5 A;  4ICL A;  1Y3K A;  1F60 B;  4NZ6 A;  1B99 A;  2V8H A;  1XMO J;  2CPI A;  4KGV B;  4LVO P;  1U47 A;  5CYM B;  5BYS A;  3DRX A;  4DUY J;  2WOM B;  2VFU A;  4CQ1 A;  3EYZ A;  4HH1 A;  4CYU A;  4DSE A;  1P1T A;  2BJ9 A;  1GMW A;  1HQU B;  1JXL A;  1RT3 B;  2ZH3 A;  2IAJ B;  4WII A;  5KOX A;  3Q89 A;  5T41 A;  3T3F A;  1H38 A;  5IT9 Y;  4HDG A;  1JKH A;  3KK3 B;  3PW4 A;  2QE5 A;  4FF3 A;  2XI2 A;  5I42 B;  1B64 A;  1FFS B;  2GZO A;  2J7K A;  3D5M A;  3V5R A;  5HP1 B;  1Y5I B;  2I5J A;  5J1E A;  2YPZ A;  1GQE A;  3MM9 A;  5SZT A;  1NK8 A;  4DWI A;  1RHM B;  1RBA A;  1WKJ A;  2HQC A;  2K3I A;  2ROP A;  3BSA A;  1Y5L B;  4W98 A;  3TI0 A;  3T5L A;  2CVI A;  2UXB J;  2PEB A;  3FSY A;  3PCO B;  2D3O 1;  3MUM P;  3X3U A;  5B0D A;  2BJ7 A;  1I3O B;  2J9D E;  5DG7 A;  4A8K A;  5L46 A;  5LJ3 Y;  3KJV B;  1M5O C;  4I0W A;  2FHO B;  1EKS A;  2V67 A;  4O0N A;  1IKW A;  2LQ9 A;  3KLI A;  3QGH A;  1YJU A;  2RDD A;  4MJK A;  1I94 F;  3RR7 A;  3M30 A;  1EAY C;  5K14 B;  1RAF B;  1UAW A;  2UP1 A;  1N5T A;  4X4R A;  2NXJ A;  3LP1 B;  1IQT A;  2JVO A;  3GSI A;  3D6M B;  2YNI A;  4DR4 J;  3G4S S;  4NLW A;  1S0N A;  3W9J A;  1HHS A;  3VR1 A;  4CLU A;  3CJ0 A;  4QIF A;  1WDT A;  1YJ7 A;  2RT3 A;  2FJV A;  1S76 D;  3C66 A;  3GB0 A;  4QZV B;  1UJ6 A;  4PQA A;  1IKY B;  2HBQ B;  3FRY A;  1LW0 B;  1LWE A;  1RT4 A;  2BW2 A;  2V69 A;  4Y2M A;  1W2I A;  3NS5 A;  3GP9 A;  3RYL A;  3WZ0 A;  3QJL A;  2ZVI A;  2XMJ A;  2GIF A;  3HFV A;  3RTV A;  4GVL A;  1VOM A;  2E5J A;  2ZEJ A;  3FCV A;  4DFP A;  3PXG a;  7FDR A;  2AKW B;  4F4X A;  2BR0 A;  1JJ2 R;  1XNR J;  3I5C A;  1KP6 A;  1VIS A;  9ATC B;  1WEZ A;  5KT2 A;  1JWW A;  4H4M A;  1Q7L B;  4U95 A;  3GFY A;  1XMO F;  1M5S A;  5LSO A;  3TO8 A;  3THP A;  4B9L A;  4LR8 A;  1WKK A;  4DR2 J;  4QR0 A;  4DN9 A;  4X4V A;  4NA2 A;  5A6W A;  1LXJ A;  3HJV A;  5CAB A;  2XO6 A;  1FDD A;  2KI2 A;  2W2O P;  4AD6 A;  4YS2 A;  3QT5 A;  4AXJ A;  1PAU B;  4Y2I A;  1D9D A;  1PCA A;  2MMY A;  2NUU G;  2WON A;  3DDI A;  4IOB A;  2OEK A;  5KOW A;  2CG8 A;  4CH1 A;  2IDE A;  4AL7 A;  3PV8 A;  1JIH A;  1WG5 A;  1WHX A;  2HGN A;  3OFE A;  2XS5 A;  2ZZM A;  1YJR A;  2B9W A;  3BH7 B;  1CJV A;  1SC3 B;  2CZV C;  4LSN A;  4Y00 A;  1LV5 A;  2GIQ A;  4OX9 J;  3PRV A;  3MM7 B;  4B02 A;  2QT7 A;  4DV0 J;  4DN0 A;  2CJA A;  4ECQ A;  3L3C A;  3QSY B;  2BRL A;  1U6F A;  2CG4 A;  3IA0 A;  3G6E S;  3PZP A;  2CQ4 A;  2OTL S;  3WX4 A;  1ITP A;  3L7O A;  2B7B B;  3DRP A;  1OQ6 A;  2AEM A;  2CJX B;  3W7B A;  2GVZ B;  2GHV C;  1FRK A;  4J9V A;  2ZH9 A;  3DLK A;  3SZ2 A;  4DFM A;  2DR5 A;  3DLJ A;  4X64 J;  1D0E A;  4OZN A;  2EBG A;  4ETZ A;  2AIR B;  4UOH A;  1U1R A;  1HW8 A;  3DM2 B;  3MR2 A;  4I2Q B;  4NCG B;  4QIV A;  2Z30 B;  4ZPW R;  2XLI A;  3LH2 S;  2V6A A;  1RDR A;  3C15 A;  1J5O A;  4IRK A;  1WTF A;  3Q8U A;  4OYB A;  4K0K F;  3PW7 A;  2OPR B;  2PN6 A;  1WD6 A;  4BC9 A;  1SL1 A;  3TAQ A;  2GA7 A;  3AH6 A;  1FHT A;  1Q5V A;  3SDE B;  3HHL C;  2W9A A;  2AU0 A;  4J9M A;  1REG X;  1QY7 A;  2IRU A;  5JVH Q;  2KKH A;  1RKJ A;  5F9N A;  4EUV A;  1DTQ B;  4I7F A;  3QQC D;  5BXI A;  3VAG A;  4YB5 A;  2XMM A;  4M95 A;  3H20 A;  2E9Z A;  1T3O A;  2VPY B;  3AOA A;  3GCX P;  5GME A;  3B54 A;  3HSZ A;  5I3U B;  2O1P A;  2QLX A;  1S1V B;  3R6L B;  3M2R A;  5D4P A;  3I87 A;  3KK2 B;  3Q8Y A;  3MCM A;  2VDI A;  2DY9 A;  2IYI A;  4DXL A;  4C9D A;  2V5H G;  4USK A;  4JI0 F;  2ZH7 A;  2OP5 A;  3HUL A;  3D54 A;  4WCE Q;  5L38 A;  4JV5 J;  1YZ6 A;  4K4S A;  2ZBC A;  1WSR A;  2LQ8 A;  3GIJ A;  1I51 B;  2OSQ A;  3CDA A;  2DRD A;  5E3P A;  4U7C A;  4NLU A;  2DCU B;  4CM2 A;  1FRJ A;  3BDE A;  3MUV P;  5F8N A;  2F4F A;  2OUG A;  3RRG A;  4NRU A;  2F4V J;  1U26 A;  2V9K A;  5HJX A;  1ICE B;  2J76 E;  2NXE A;  3A1Y G;  1G3O A;  3CW2 C;  4G6V B;  4CLP A;  1HD1 A;  1VI7 A;  4LMZ A;  1M1K T;  3C6U B;  4ANE A;  5CZX A;  5KG2 A;  3PJX A;  1JQG A;  4GVB B;  4H4O A;  3Q8R B;  1YTY A;  1YBA A;  3AY0 A;  3SQG B;  1T7P A;  4N76 A;  4WZQ A;  4RNN A;  1G6B A;  2WSC C;  2Z2M A;  2L41 A;  4LF6 J;  2OPP A;  1RAJ A;  1TKT B;  1JLA A;  1LWX A;  4ECS A;  5M2U A;  3MPD A;  4KPC A;  2DT9 A;  1ZET A;  3HT0 A;  1U8W A;  2IC3 A;  1AUS L;  3DHW C;  5D3G A;  4A8S A;  2AP6 A;  1FEH A;  3I56 S;  1F5A A;  1WI6 A;  2XM3 A;  1YJT A;  4NLQ A;  1XMQ J;  4OI0 A;  1U0S A;  4G1P A;  3OUY A;  1J5E F;  2VG7 A;  2XMK A;  2ASJ A;  5CD4 A;  3M2V B;  4FYY B;  5DGB A;  1K44 A;  2ZZN A;  2FJX A;  3DGP A;  1RT7 A;  1Q4R A;  1U09 A;  3IR7 B;  3LTO A;  4LRD A;  3ZZR A;  4QPX A;  5DM6 Q;  4KHP F;  3TQE A;  5DLG A;  1YKW A;  2LQJ A;  1NAQ A;  3EDR B;  4ZPA A;  2DRB A;  4LFC J;  2BAB A;  2F8H A;  3WBZ A;  1M5K C;  2KRB A;  3EZU A;  4LFC F;  2WZ1 A;  3KLG A;  4Z2X A;  1PKU A;  4KYZ A;  3DRS B;  2R8K A;  1AFI A;  2HQI A;  4EMD A;  4PYA A;  1S0V A;  4EBD A;  4F02 A;  4LFB F;  5J1P A;  2HHX A;  3BBC A;  1SIW B;  3IXQ A;  2B8P A;  2WW4 A;  2CAJ A;  5DJB A;  4LF9 J;  1VS3 A;  3M6V A;  5CZV A;  2ZWP A;  1T9X A;  2EBE A;  5EUH A;  1M0S A;  3M7V A;  3N6M A;  4NYZ A;  3U02 A;  2B6A A;  4C11 B;  2R2U A;  4HHH A;  4KV8 B;  4F36 A;  2YX4 A;  4OJH A;  1IWA A;  5JMN A;  2B9E A;  3KDO A;  4EWT A;  4B9U A;  1C0T B;  4LIR A;  3GSD A;  4IG0 B;  1S77 D;  3B78 A;  1SV5 B;  2XWY A;  2IMO A;  1RHU B;  5E3R A;  1TQL A;  3VQT A;  3ZZU A;  2MKH A;  2D9P A;  1SJ1 A;  2YWE A;  2W9C A;  2F9J A;  2J0X A;  5IT0 A;  4KO0 A;  3BO2 A;  1SUQ B;  4JI2 J;  4UQG A;  2QA2 A;  2PT0 A;  4I6Y A;  3OL9 A;  3RJM B;  2EVZ A;  4YB6 A;  2MZQ A;  4DLE A;  1S9F A;  1S1X B;  3TEH B;  1L3U A;  4C2M A;  3ENV A;  2NXU A;  4OYA A;  4UOC A;  4ZOS A;  3C14 B;  1WC5 A;  4OYX A;  2I8E A;  3GJT B;  3HHL D;  3W65 A;  4F3Q A;  3SCI E;  2FJE B;  2M5Y A;  3RB6 A;  3LOU A;  2LVW A;  1FF2 A;  3J7Z T;  3BO4 A;  4PG4 A;  1HI1 A;  3K7R A;  3P3D A;  5T14 A;  1IKX B;  1MWY A;  2VJV A;  1HI0 P;  4KHP J;  2F5G A;  2HK2 A;  1A6L A;  1S1W B;  3VF0 B;  1RT2 B;  2OFH X;  3QGP A;  4DCO B;  1APS A;  4JI6 F;  1FT8 A;  2GQC A;  3PYD A;  3QWU A;  3MOJ B;  2A0F B;  3LA0 A;  1HW9 A;  2VB6 A;  3V81 A;  3GR0 A;  4X4T A;  4UY8 5;  4OMF G;  1VQY A;  3AXK A;  4MK7 A;  1MWQ A;  5IT4 A;  2F3J A;  4NPO A;  2W8L A;  2OPS A;  5IOL A;  5GAD I;  4FNI A;  5LXR A;  2X1A A;  3THV A;  2MDA A;  3ET6 A;  1MMD A;  2BJ1 A;  4OJ1 A;  4CTA A;  1QSY A;  4DU8 A;  1XEZ A;  1K9M T;  2CPD A;  3VAJ A;  1NHV A;  1E6V A;  1K8A T;  2DPJ A;  2E5I A;  2RS8 A;  3UCZ P;  2H4Y B;  1YSJ A;  2C1E B;  1VQM S;  4LF6 F;  4HI1 A;  4EK2 A;  2FGO A;  1R8H A;  3W61 A;  4PWU A;  2P6S A;  3JSY A;  4ED5 A;  1RTJ B;  3N5F A;  4KO0 B;  5D0H A;  3BDP A;  3R7S B;  1KOH A;  4PWW A;  1S1T B;  3K5N A;  1PC4 A;  5AJ3 F;  4IFY B;  2UXC F;  3OBI A;  3R2C J;  2BVZ A;  2A2C A;  2YWK A;  5EDW A;  3ETO A;  4NI2 B;  2MKK A;  2Y1I A;  1AFJ A;  2UU9 J;  2CNK B;  1Q79 A;  2FD2 A;  3BB5 A;  1FRM A;  3TX8 A;  4I2P B;  2B6A B;  3CJ3 A;  3DMJ A;  4K5R A;  3NMA A;  3ZZY A;  3M9M B;  2AEF A;  4DV2 F;  3GE9 A;  2HHV A;  5KFB A;  1GXU A;  1YRU A;  2PFF B;  3EPG A;  1RWX B;  3AA8 A;  4UOG A;  2GW8 A;  4B3M F;  1EQM A;  1UW4 A;  2LLZ A;  3VHQ A;  3DDK A;  1FKO B;  2CJ9 A;  2EWH A;  4GVB A;  2ACM A;  3M32 B;  4ZK7 M;  3CD6 S;  3AT1 B;  2DHG A;  1RTH B;  3W3S A;  1AA1 B;  4ZVG A;  2R8G A;  1F2G A;  5KG6 A;  2QMU B;  3IGV A;  3ISN D;  4I56 A;  4RWW A;  1F5B A;  1FKP A;  2XG8 A;  1FXR A;  3OL8 A;  1LW2 A;  3Q8P B;  4MT1 A;  2CPX A;  3MFI A;  2QLJ B;  3H40 A;  3VAF A;  1L3T A;  4RW4 A;  3IP0 A;  1X31 C;  3GQC A;  4QYZ K;  1N48 A;  2KFY A;  4G3I A;  2DH8 A;  1XIQ A;  2G0J A;  2OEM A;  4OZL A;  3GG1 A;  1LEO A;  1WEX A;  2HNZ A;  4IDK B;  5T7L A;  3HJF A;  1UVI A;  4BCA A;  2IYG A;  1VQ6 S;  4E2F B;  5B0G A;  3OFH A;  3P5B P;  2KT5 A;  4CO0 A;  2UUB J;  2OLW A;  1B7F A;  1FX2 A;  2EKN A;  1QAX A;  3ICL A;  2CQ2 A;  4IQX A;  2VKR A;  1OS5 A;  3WHI A;  3H98 A;  5F3T A;  3GIM A;  2F4V F;  4ERD A;  2JFD A;  2F65 A;  2BA9 A;  3M4X A;  2M52 A;  5E5N A;  2MZ1 A;  3FUY A;  3QT6 A;  3OTO J;  2IMW P;  3DOL B;  3BQ2 A;  4DV6 F;  2W2Q P;  1RT5 B;  2VG5 B;  2YKO A;  3OL7 A;  4FS2 A;  5B08 A;  1F9H A;  2HAI A;  3FK4 A;  4WFX A;  2FYX A;  3LAN A;  1X9M A;  1R8B A;  2ZKT A;  2B5J A;  2BE2 B;  5KFH A;  3C15 B;  4DPX A;  5IZH A;  3HLU A;  2WBR A;  1PYT A;  3J7A N;  1C1C B;  5E0O A;  4C0H A;  3HHD A;  1VQ8 S;  3LP0 B;  4DCP B;  4DV3 F;  1HD0 A;  1VC0 A;  1Q8I A;  1BC6 A;  2XO7 A;  1RHJ B;  1SV5 A;  2UXB F;  3U1N A;  5GAE I;  1S0O A;  2GVZ A;  3MDF A;  5FDL A;  1TL5 A;  1RAC B;  3OPK A;  3DRP B;  4HT7 A;  1GMV A;  4KQZ A;  1DAX A;  3IGN A;  3W5Y A;  1DJ0 A;  1DTT A;  2BUN A;  3GYN A;  4OZJ A;  1SKW A;  1N36 J;  5J2M B;  1HHT P;  1ZTW A;  3MM7 A;  3NGK A;  4ZP7 A;  4ZKA A;  4EEY A;  1X0P A;  1TV6 B;  5C7P A;  3MAA B;  3G86 A;  1VHF A;  4DI6 A;  1KHW A;  1UEV A;  2PMH A;  3MWB A;  5JUM A;  3DRS A;  1EZZ B;  4EGL A;  1VHI A;  3QID A;  1VQN S;  1S6O A;  2EPI A;  1RTI B;  4DV1 J;  4M5J A;  1WC4 A;  3GON A;  3GIL A;  4DUY F;  3OHB A;  2CQG A;  3CDE A;  5C25 A;  1F3V A;  1RZM A;  2C22 A;  1NK7 A;  3ZZZ A;  2AYG A;  3GYX B;  4G1Q A;  4OV6 A;  2YY3 A;  1RT7 B;  3SSR A;  3R1L A;  4DX6 A;  4GKJ F;  4M5I A;  1HNI B;  3N4W A;  2CKW A;  2ZHO A;  4F4Z A;  1DHM A;  4OZ5 A;  2BAN A;  3DLK B;  1UPP A;  3MM6 A;  2RHS B;  3LQV A;  1S48 A;  1YK9 A;  2MGZ A;  2RVJ A;  2XCP A;  2IPO B;  5EWF A;  2UVW A;  2KTQ A;  2QN6 B;  3IAM 9;  1UA0 A;  2BXJ A;  3DKD A;  3CE8 A;  2A6O A;  4Q0B B;  5A6P A;  2OSR A;  3J7Y I;  2E9R X;  3BRE A;  5B0A A;  2X51 A;  3RB0 A;  2UUA J;  1TL3 A;  1V5I B;  4PXD A;  3G82 A;  2BKN A;  2A6M A;  1B0T A;  2OO4 A;  1XNQ J;  3QAU A;  3D6T B;  3ETM A;  3HF5 A;  2XS2 A;  4C3K A;  2P5V A;  1EAR A;  3BYR A;  2QMX A;  2WON B;  3OVA A;  4PYD A;  2JHE A;  3TAN A;  5HBM A;  2YKQ A;  2VDH A;  3AQP A;  2IVY A;  2H1Y A;  1DUR A;  4ZPD A;  3TUJ C;  2WRM A;  3G8S A;  4B9T A;  3UO0 A;  1GX5 A;  1HQ2 A;  3RW6 A;  4YR0 A;  2Y8W A;  5EX0 A;  5ITH A;  2VOP A;  3UE2 A;  2HK3 A;  4J9P A;  2ZHB A;  2FUG 9;  3AXM A;  1CJK B;  2RE1 A;  3V6H A;  4ZVQ B;  3D4J A;  2VPX B;  3NWG A;  4K4X A;  1RU1 A;  2DO4 A;  3J7Z 5;  2LDI A;  5KFK A;  4U6P A;  1Q1K A;  5KFN A;  3OUY B;  2AGQ A;  3EXC X;  3UI3 A;  2ZH1 A;  2YWG A;  3G2X A;  3HKZ D;  3IAS 9;  3PR4 A;  3SI8 A;  2CPJ A;  1JKH B;  3RGI A;  5I42 A;  2HLU A;  2MKJ A;  1S72 S;  4WIQ A;  5E3Q A;  5F8H A;  2RS2 A;  2E9T A;  4XPE A;  2JFK A;  3R6G B;  4USW A;  1HWJ A;  4TYB A;  5LM7 E;  8ATC B;  4YY3 J;  2DR7 A;  2J6S A;  2KN4 A;  2YNF A;  3PAC A;  4ZLN A;  4DQR A;  1HQU A;  5IT9 U;  2R7O A;  2CPZ A;  2LU2 A;  4CNZ A;  4DJB A;  5L1I A;  1NJX A;  3BSO A;  1VQK S;  4NXM J;  4P6Q A;  4E8U A;  2HWH A;  2J0Q D;  2J7U A;  3JQM A;  3HMJ G;  4GKK F;  3JQJ A;  5KFY A;  3VGT A;  5H1S V;  1U2C A;  3FZB A;  5D4L A;  3PO5 A;  4PG5 A;  1T05 A;  1NZ8 A;  2JWN A;  1ZM3 A;  2DR9 A;  2RJZ A;  4BWJ A;  1KWM A;  4DMZ A;  1TAU A;  2F8M A;  4MKA A;  3OSN A;  1MRO A;  3LGN A;  4NLS A;  3PYG A;  4PXE A;  2HHH J;  3CC7 S;  1X9S A;  3DOK B;  1YZ7 A;  2HG4 A;  1SC4 B;  2POK A;  2YQ3 A;  2ZD1 B;  3LWL A;  3VAK A;  2YKN A;  4WU2 A;  3RAQ A;  4RO0 A;  4YB1 P;  3LWM A;  3FEX B;  4LF4 F;  2VFS A;  3CCJ S;  2RU3 A;  3I32 A;  3JXO A;  1DLO A;  2HHW A;  4GMK A;  4LJM A;  1QVG R;  4RUH A;  1L3S A;  2LEC A;  2DVI A;  4RUB A;  4RU9 A;  2QTW A;  3PW2 A;  1HYS B;  2YWW A;  4K2J A;  2W2N P;  5AXL A;  4TU8 A;  4YOE A;  4O0I A;  2BJ3 A;  2GJI A;  4HTJ A;  2BX6 A;  2LXU A;  1IBM J;  4DSI A;  4LF5 J;  3K8V A;  4N41 A;  2G4B A;  1K0V A;  3MR6 A;  3EXY A;  3MI7 X;  1KVJ A;  1I1G A;  3E3X A;  2BAC A;  5HAN A;  4ANC A;  4EI2 A;  3CIM A;  4R25 A;  3IR5 B;  2RNE A;  2BKP A;  4NWB A;  2P9G A;  1JK9 B;  2KVI A;  1FXD A;  1QJH A;  4P2S A;  1EKR A;  1FCA A;  3DLG A;  3OFG A;  4MKB A;  3DXB A;  3NXZ A;  1D8Z A;  2VQF F;  1Q5Y A;  3H7H B;  2OPR A;  3C19 A;  4QPT A;  3SEO A;  2XLJ A;  3FBE A;  3SFU A;  1U45 A;  4NEZ A;  2QLF B;  1XK8 A;  5C24 B;  4YB7 A;  3PDN A;  2JL9 A;  4QW9 A;  1BWV A;  2AJQ A;  2XY7 A;  1NK5 A;  3ITH A;  3AAW B;  2JLE A;  1VLY A;  1LWE B;  4USH A;  4F7V A;  4BDP A;  2WSF C;  4EZ9 A;  1N4L A;  4U9R A;  1RAA B;  1QSS A;  3DCA A;  1U48 A;  4ELV A;  3NLC A;  2R7T A;  1GTE A;  1HNX J;  3PRD A;  1ZH5 A;  2W2M P;  2GIR A;  3SV3 A;  2DEJ A;  1TEL A;  4NOH A;  3QJP A;  1HBU B;  4K4U A;  1NH8 A;  4G65 A;  2KHC A;  3AOC A;  1N56 A;  5KFD A;  2O67 A;  2MQP A;  3V6D A;  4J90 A;  2V4Q A;  2EFP A;  4C7Q A;  4E0D A;  4Y65 A;  1IJF B;  1H2U X;  2MGZ B;  3WC2 A;  4ECZ A;  4KFB B;  2QG9 B;  2VA3 A;  4IR1 A;  3QLH A;  3MHY A;  1TKD A;  1JLG A;  2IJR A;  1ZPW X;  1TKZ A;  3GIK A;  2E66 A;  3V6D B;  1ZZN A;  2PII A;  5IQQ A;  3I9V 9;  2L9D A;  3NMR A;  1VFJ A;  1ARO P;  1TZ0 A;  3M9N B;  4EFA C;  3OR2 A;  2Z4P A;  2F7V A;  5E7O B;  2EC2 A;  4CLS A;  4R5P A;  5ETL A;  4FXW A;  2G2O A;  4FPI A;  1PJ7 A;  2DNP A;  3DU6 A;  1K73 T;  4JI7 F;  1Y3J A;  4XAK A;  2PA3 A;  1BQN B;  3ITH B;  1S57 A;  2HND B;  3CD7 A;  3PFO A;  3NS6 A;  1V3S A;  1X7V A;  2W2P P;  4ZP8 A;  4CO1 A;  5KFP A;  1U6Z A;  3VTI A;  3QZ8 A;  5DM7 Q;  2RRN A;  4JI7 J;  4BHQ A;  4YDD B;  5J2M A;  4DSJ A;  2BEF A;  2Q6B A;  2XMU A;  1GEH A;  1VIO A;  2HUR A;  5H9F K;  4L72 B;  1PC5 A;  2RF2 B;  1FRH A;  3BPD A;  3IRX B;  3FBB A;  5K8N A;  5DZ6 A;  3F0N A;  1VK3 A;  2HWI A;  1VQS A;  4HLB A;  4ICL B;  1FDA A;  4DG1 B;  5C42 A;  3NBP B;  1NKB A;  2NCK L;  4LSZ B;  2DR8 A;  4ECX A;  2O66 A;  2ZFH A;  2WW8 A;  3L7U A;  1URN A;  4CO3 A;  2PO4 A;  1RHQ B;  4M5N A;  3RAX A;  2R2T A;  3MMC B;  5HAO A;  1REV A;  2RML A;  2D3O R;  4LF5 F;  3FFI A;  3UVJ B;  2AV5 A;  4KH1 B;  4MYU A;  5KAK A;  1KR4 A;  2MKC A;  4RLE A;  1A0O B;  1OIA A;  3BO3 A;  3I82 A;  5LOQ A;  1YJ9 S;  2PD1 A;  4F2S A;  1Q81 T;  2JSX A;  3I5B A;  5HMX A;  1Y9O A;  4DV2 J;  3I0R A;  2HFZ A;  1SIZ A;  2HMI B;  4RPF A;  1J27 A;  4RL1 A;  2YVS A;  2Z58 B;  3FCW A;  3MGJ A;  3S01 A;  2UV8 G;  3MZI A;  3Q8V A;  5J1E B;  5F8I A;  2E1C A;  1NRK A;  2XS7 A;  3CCU S;  3MXH P;  4DL5 A;  2LU1 A;  3D0I E;  3KLE B;  4XO0 A;  5L9N A;  2J6T A;  2JDJ A;  2XI3 A;  1S1U B;  3KK3 A;  5AJ3 J;  2KXN B;  2DHH A;  4C0B A;  1RT3 A;  3WIV A;  5T7L B;  3IFE A;  3GFZ A;  3O1L A;  3G96 A;  2HSE B;  2I9S A;  1RGV A;  3CJ5 A;  3L9Z A;  5D6G A;  1ROF A;  3I9Z A;  3KUE A;  4W92 B;  4M1K A;  3MTK A;  2YNH A;  4PQU A;  5EHH A;  2RQK A;  1N34 F;  1PIE A;  3J81 j;  2QO3 A;  4HEA 9;  4LBI A;  1RT1 A;  1NPP A;  3MEG B;  3FKB A;  4A8O A;  4Q43 A;  2CNL B;  2KZM A;  2FDN A;  4H4K A;  3NY0 A;  3CCV S;  2HHS A;  3M32 A;  4B3S J;  1UPM B;  1IBM F;  3M8Y A;  2C3O A;  2ZBQ A;  3RZA A;  3KLH B;  5A2Q Y;  3DI6 B;  3JB9 k;  2ALZ A;  4TQR A;  4X66 F;  1IBL J;  4ID5 B;  2DNO A;  3MMB B;  4OX8 A;  2W9B B;  4M8L A;  3JTO A;  1Y4Z B;  2NS1 B;  4JI8 F;  1XR7 A;  2HFU A;  3KMS A;  3CJK B;  2AZ3 A;  5HRO B;  2XMA A;  2MHN A;  3QGI A;  5KG1 A;  3W60 A;  1RHK B;  2DEI A;  3B8H A;  4LF7 F;  3M2U B;  3DYA B;  5IXU A;  2KB2 A;  2FZK B;  1MWZ A;  2UU9 F;  5B0F A;  2V50 A;  4JV2 A;  2N4D A;  1EET A;  3IS9 B;  4RBV A;  4Q2M A;  4W4M A;  4J9Q A;  2UXC J;  4FVM A;  2VHG A;  3H25 A;  2FJD B;  2VUG A;  4GO7 X;  2XHW A;  1SB6 A;  4MFB A;  4C3M A;  5A0Y B;  3JSM A;  1CS4 A;  4GKK J;  4KJI A;  2F1F A;  3CCS S;  4NE9 C;  1X5S A;  3KNG A;  2YQ1 A;  4FYV B;  2NZ4 A;  4ZDN A;  4HHJ A;  3JQK A;  1OJ4 A;  2VPW B;  1K1Q A;  2R2S A;  2H65 B;  2W8K A;  1S6Q B;  3HX9 A;  1R7I A;  2PFD A;  1HNV A;  2GVD A;  2DCL A;  2P6T A;  4WXW A;  1HR0 J;  2ZJQ Q;  2BZ2 A;  2QRR A;  1A9N B;  5KFL A;  1T9Y A;  5GMK a;  4UZC A;  4OI1 A;  1EP4 A;  1T8E A;  2OPQ B;  2RQ4 A;  3D3B J;  3D6F B;  2QJ3 A;  4Z7C A;  2AEJ A;  2CJK A;  3RB4 A;  4PUO B;  4DUZ F;  2LFV A;  3J81 U;  2MEW A;  3S1T A;  4DL4 A;  2E1M C;  3CME S;  5KT3 A;  3LAL A;  5E3C A;  2AX1 A;  5DGA A;  4JYA F;  2EG1 A;  4LR7 A;  4FBT A;  4ZVO B;  1HA1 A;  1CQN A;  2HPU A;  4DOZ A;  1FTC A;  4X65 J;  2V4J B;  4ELT A;  3QZ7 A;  3C16 B;  5EX3 A;  5HLF A;  1C2P A;  2MZR A;  2NLW A;  3NCQ A;  4QBU A;  4X4S A;  4QWA A;  3H5S A;  3MD3 A;  3QNW B;  4MK8 A;  4L6V 3;  1R3N A;  3FRZ A;  1UWB B;  2BE9 B;  4L76 A;  4ED7 A;  4PUO A;  4USI A;  1FX4 A;  3POT A;  5DG9 A;  1PYS B;  4PAA A;  4UZB A;  1FRL A;  1S9G A;  2PSZ A;  1LKZ A;  4DR5 F;  1HMV B;  3R27 A;  4WF9 Q;  2FC9 A;  3TAM B;  2CPH A;  2PI4 A;  1U2R A;  1YGY A;  3NGT A;  4FF2 A;  3E01 A;  2Q6C A;  4IH6 A;  2AYB A;  5CHC B;  2ASL A;  3VAI A;  2JVR A;  1G4C A;  3HDS A;  3NCR A;  3EE3 A;  1VDH A;  1P27 B;  3QSI A;  2ZBR A;  3EUN A;  4QQB A;  1KEK A;  1OWX A;  1S9G B;  1U1K A;  4EO6 A;  2KT3 A;  1NLK L;  3LF0 A;  4K2X A;  1QAI A;  3PEJ A;  4GC7 A;  1R31 A;  3P8B B;  5CYQ A;  1SJ3 P;  1NPK A;  4ZCI A;  2FVP A;  4GKJ J;  3EVO A;  3ENQ A;  1HPZ B;  4HR2 A;  1FDB A;  4UY8 T;  4JI4 F;  4NYP A;  3HXM A;  1YDL A;  1X4A A;  3DRY A;  2YX1 A;  4DDF A;  1RWK B;  3KDN A;  2EKY A;  1QE1 B;  1DQ9 A;  2HQ3 A;  3H90 A;  4YN3 B;  3TAP A;  4I68 A;  2DGT A;  3AJ1 A;  5CD4 H;  4DSF A;  1C0U B;  1UEU A;  2QA1 A;  4ZPT R;  4DL7 A;  3CJK A;  5HRO A;  4DV5 F;  4YR3 A;  1VLO A;  4TU9 A;  1NXI A;  3PHE A;  4WBF A;  3OSP A;  4WTY A;  2ZUA A;  3MMA A;  3W5Z A;  1S12 A;  3N0V A;  3AD7 C;  3PJ9 A;  1EX8 A;  4FVC A;  4TVA B;  3WDO A;  3AOB A;  1FJG J;  4FDF A;  1EP4 B;  1N6Q A;  1JJC B;  2DNN A;  2CPY A;  2V8P A;  3O2I A;  2WAQ D;  2DNL A;  3R5J B;  1X4F A;  4OX6 A;  2XZD B;  1N5V A;  4DSL A;  4TQS A;  2BE7 D;  2IM2 A;  1Z2L A;  2DXD A;  3W2W B;  2AJ4 A;  2C2N A;  3MM8 B;  2VFV A;  2MQO A;  3I55 S;  4JV1 A;  2CJY B;  4DLG A;  3K57 A;  1UZH A;  4ZCL A;  1GAO A;  1DFD A;  3UD5 A;  3K8W A;  3NP5 A;  2B0G A;  3AB2 B;  3ISZ A;  4GO5 X;  4RW6 A;  5ETK A;  1RTD B;  2NSC A;  3EGV A;  3OTC A;  5KFJ A;  3PX0 A;  1JJH A;  1RCO B;  2MQQ A;  3KLE A;  2R7W A;  4MH8 A;  2ABY A;  5K9F A;  4LIW A;  1NSK L;  3UCG A;  1MU2 A;  2DYA A;  2Y3Y A;  4HT5 A;  1TL7 B;  3BGU A;  1N54 B;  2HRY A;  4L3K A;  3MM5 A;  4NLO A;  4NZ0 A;  4OYP A;  2FIU A;  2HVZ A;  1O5J A;  4DPY A;  5KT6 A;  5EWE A;  1VRU B;  3ZTP A;  1SJF A;  4USU A;  5F8M A;  2NYH A;  4B08 A;  1Q7Y T;  3K5L A;  1AB8 A;  1U0H A;  1XER A;  3OTE A;  4A8X A;  4B3T J;  1ZOT A;  2OKQ A;  3TOQ A;  4CO4 A;  1YJN S;  5C5J A;  3H2V E;  3BV8 A;  5FJ4 A;  2C2E A;  1RAB B;  2V94 A;  2VC1 A;  4FYW B;  3TVK A;  3M8Q A;  1U6B A;  4OLP A;  3MED B;  5BYR A;  3AQO A;  3HKW A;  2LEA A;  5IWA J;  4N5S A;  2Q3P A;  2HGM A;  1RCX B;  2AZ1 A;  2C3Y A;  4F0K A;  3NBP A;  4Q5V A;  1NDP A;  1CJT A;  2FHK A;  2AX0 A;  1Q8K A;  5EGY A;  5HLF B;  4CTA B;  1RWO B;  5F9L A;  5D78 A;  1NEE A;  4ED3 A;  1AZS A;  3JTN A;  1SCJ B;  2QX0 A;  3GTY X;  3HSG A;  3SXL A;  1J5O B;  1UA1 A;  4QU7 A;  1TVR A;  2OD6 A;  2FTR A;  4NZ7 A;  5IV3 A;  5LT5 A;  3FSI A;  4IO9 Q;  2C2R A;  4QWC A;  5FLX Y;  3KNA A;  5KG0 A;  4V19 X;  3IM8 A;  3NOC A;  3CVK A;  4LBH A;  2RB7 A;  3R5A A;  1RT2 A;  2G1H A;  2QL5 B;  1HBO B;  2KM8 B;  4P72 A;  3OLB A;  2H5I B;  3HCX A;  2KXH A; 
#chains in the Genus database with same CATH homology
 3BBB A;  3DDI A;  4F36 A;  3WX8 A;  1NDL A;  3VGT A;  3NGT A;  3Q83 A;  3ZTS A;  3BH7 B;  1B4S A;  4ENO A;  1BE4 A;  3EE3 A;  3PRV A;  2CWK A;  1F6T A;  3FCW A;  5CAA A;  1UCN A;  3Q8V A;  3ELH A;  3EIC A;  3ZTO A;  1NLK L;  1JXV A;  3FBF A;  3ZTQ A;  1NPK A;  3EVO A;  4UOH A;  4HR2 A;  3VVU A;  2B8Q A;  3EM1 A;  4F4A A;  1NDC A;  3FC9 A;  1HLW A;  4FKX A;  3Q8U A;  2BX6 A;  4CP5 A;  1W7W A;  1HIY A;  2DXF A;  4DZ6 A;  3VGV A;  3ENA A;  1MN7 A;  4S0M A;  5C7P A;  4ANC A;  1BUX A;  1XQI A;  4WBF A;  4C6A A;  3EMT A;  4DI6 A;  2ZUA A;  4FKY A;  3FKB A;  1B99 A;  5BXI A;  3PJ9 A;  1WKL A;  4AND A;  3VGS A;  3B54 A;  3FBE A;  5IOL A;  2DXE A;  3Q8Y A;  2DY9 A;  3Q89 A;  2AZ3 A;  2DXD A;  3Q86 A;  2HVE A;  3FBC A;  1VYA A;  3R9L A;  4EK2 A;  3VGU A;  2HVD A;  1S59 A;  3DKD A;  1WKJ A;  4W98 A;  1NCL A;  1ZS6 A;  2VU5 A;  4ANE A;  1F3F A;  1MN9 A;  1NSK L;  3ETM A;  2DYA A;  4O0N A;  3BBF A;  3ZTP A;  1LWX A;  1EHW A;  3NGU A;  3MPD A;  4KPC A;  3B6B A;  1U8W A;  4UOG A;  3EVW A;  3VVT A;  3ZTR A;  2AZ1 A;  1NUE A;  3NGS A;  3EVM A;  1NDP A;  1S57 A;  1K44 A;  3GP9 A;  3EJM A;  1NHK L;  3FCV A;  1HHQ A;  3GPA A;  2BEF A;  1S5Z A;  1XIQ A;  3G2X A;  1LEO A;  2HUR A;  4UOF A;  1PAE X;  1NB2 A;  3FBB A;  1PKU A;  1NDK A;  1BHN A;  4DUT A;  1WKK A;  2NCK L;  1KDN A;  3BBC A;  3JS9 A;  2B8P A;  3L7U A;  3BH6 B;  5CAB A;  3NGR A;  1NSP A;  1NSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...