3GP9A

Crystal structure of the mimivirus ndk complexed with gdp
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
133
structure length
133
Chain Sequence
AGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
total genus 43
structure length 133
sequence length 133
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2009-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3gp9A00
4WBFA 1UCNA 4DUTA 5IOLA 5CABA 1HLWA 3Q86A 3B6BA 3ZTQA 4ANEA 1NLKL 3VGSA 3VVUA 4F36A 3ENAA 1WKLA 3EICA 1S59A 1VYAA 3Q83A 2HURA 2DXDA 1K44A 4ANDA 2DXEA 4S0MA 4ANCA 3BH6B 1EHWA 1NSQA 3ZTSA 3VVTA 3FCVA 1W7WA 3EVMA 1S57A 1F6TA 1HHQA 3BBBA 1WKJA 1WKKA 1NDLA 2B8PA 1NUEA 1U8WA 3NGUA 3Q8UA 1B99A 4F4AA 1BUXA 3Q89A 3R9LA 3BBFA 4UOFA 3FBFA 1PAEX 1S5ZA 3L7UA 3Q8YA 3VGTA 3G2XA 3EJMA 3NGRA 5CAAA 3FCWA 3FBCA 3BH7B 3PRVA 1LEOA 3BBCA 3ZTRA 4UOGA 1NPKA 5C7PA 3ETMA 1MN7A 2HVDA 1BE4A 1NCLA 3DKDA 4UOHA 1JXVA 3DDIA 1B4SA 1BHNA 2BX6A 3EMTA 4KPCA 3FC9A 3NGTA 2B8QA 2BEFA 1PKUA 2AZ1A 1NB2A 3EM1A 1XIQA 1NDKA 1XQIA 2AZ3A 3JS9A 3ZTOA 4ENOA 1MN9A 3WX8A 5BXIA 1HIYA 3ELHA 2CWKA 3EE3A 1NHKL 3FBEA 4C6AA 1NSKL 3EVOA 2DYAA 4EK2A 3VGVA 1F3FA 1ZS6A 4FKXA 3MPDA 2DXFA 4DI6A 3GP9A 3EVWA 2HVEA 3Q8VA 1NDPA 3NGSA 3FBBA 3ZTPA 4CP5A 2NCKL 1NSPA 4DZ6A 4FKYA 1KDNA 1NDCA 2VU5A 2ZUAA 3GPAA 4W98A 3B54A 2DY9A 4HR2A 1LWXA 3VGUA 3FKBA 3PJ9A 4O0NA
chains in the Genus database with same CATH superfamily
4YS2A 3DU5A 2WB4A 5DG8A 1TL7B 5L1KA 3HD2A 5KFGA 1S97A 1RQ0A 3SSRA 3KLFA 4OI6A 1RWVB 2VFUA 1HMVA 2GW8A 5C5JA 3K2YA 1VJQA 2QA1A 1EB0A 1DLOA 1U0SA 4USKA 5CZVA 4B3TF 2WHOA 4Q8FA 5CAAA 3W63A 3BGUA 3IS9A 1TUGB 3CCQS 1SJ4P 2CQ1A 2M3DA 1C4AA 3HHLD 5GMKa 3A3NB 4NLGA 1FHTA 3LGHA 3DLEB 3DRSA 1UVIA 1SI9A 3EE3A 1P9YA 3SZ2A 1T94A 3GG0A 2HLUA 3BN7A 3F73A 4I68A 2RE1A 1H7XA 4U8VA 1RGVA 4J9QA 1CJTB 4NPOA 5LSOA 3MPUB 2PI5A 2D41A 2FZGB 4R8UB 2EBEA 2HQFA 3U02A 2JH3A 5E41A 2A6OA 2CQIA 2UU9F 4EFAC 4EMDA 2MQLA 1TFYA 3X1LB 1PAUB 3NCRA 4KHPJ 1QAYA 3V6DA 2DTJA 3HI9A 1DTQA 1YSJA 3RRHA 4K4WA 5HSPA 5KFMA 2AJ0A 4M95A 4JYAJ 5DJBA 1TK0A 3IMQJ 1OWXA 4RW9A 2RAQA 4DFKA 4RBTA 3JSYA 3MMJA 5BJRA 2N4DA 5B0GA 1U2RA 4KKOB 1WC0A 5IM0A 2KU7A 1FKAF 3TNVA 2LDYA 1FKPB 4IKAA 4NA2A 4I6WA 3WIVA 3A8KA 4IFVB 5A8RA 2Z0GA 3X3UA 4LFAJ 1N5YA 4M94A 2ASYA 2PFDA 4ZPWR 2MKCA 2ZZMA 1JLQA 2FC8A 1VRUB 2HBQB 2VPZB 3AODA 1HQEB 2V8VA 4OI2A 2UUCJ 4NASA 5EN1A 3BGRA 1VK3A 2DXDA 1AT1B 2HBZB 5B0EA 1FJ7A 3MPVA 2RF2B 1XNQJ 1X5SA 2NSBA 1VQ8S 2B8PA 2OEMA 1B99A 1RAAB 4QPTA 1J27A 2CQCA 4UUXA 5A8WB 2ROPA 5KFYA 1IKVB 5K8OA 4QU6A 3UCZP 3K5PA 5HROA 3OLBA 4OV1A 5LMUJ 2BOAA 5HN0A 4C0HA 1T3NA 2W9AA 3MAHA 4RNOA 3R6GB 3RB3A 3GLJA 1RTJA 2V68A 2C2NA 3MTJA 2HQCA 1TR0A 4OYBA 2EG2A 1R3NA 1CJVA 2G1HA 5J1EB 1UA1A 4K8RA 1Q8IA 1GTHA 4FXVA 2NQPA 3W5YA 3PHEA 4C48A 3HFVA 3K8VA 4I2QB 2APOA 1T03A 3MUTP 3FMWA 1UVNA 4FYWB 2HW3A 5KFBA 2FQQB 3VAKA 2B9XA 3MM8A 2MGZB 2QO3A 2K8GA 1X4DA 4IG0A 4TN2A 2CG4A 2VKZG 1FI4A 4F4YA 1XNRF 3M8PA 2F4VJ 2M4MA 3PCOB 3H90A 1QE1A 1U02A 4WTOB 4YHHF 1FDAA 2Z56B 3G6XA 3AQOA 2YWKA 1QD1A 2JRSA 5HAOA 2X3GA 2ZD1A 1I6JA 1R31A 1S9GB 2VG7A 2Q79A 3BQ2A 3MR3A 3QGHA 5LOQA 3GJTB 3MEGB 2ZKUA 5E33A 4JI7F 1F5CA 1U1RA 1N0VC 1NB2A 5J1NA 2DNRA 5F3ZA 1RI7A 3ZZZA 1VQ7S 1YJRA 2OD4A 4CLWA 4YDDB 2YNGB 4YB7A 1GMWD 4A8SA 4C8ZA 4HH1A 1KDNA 5SUHA 2DO0A 3MURP 3M9MB 3UDEA 5ETNA 2MEWA 2J9CA 1VISA 4ANEA 4X2BA 1S1XA 2J9DE 3PDNA 1HQ2A 1T9YA 1KQGB 1NJIT 2OPRA 4IOAQ 5DQIA 4OYOA 1G2EA 5DGAA 3DOKB 2H4WB 1GMUA 3QGGA 4H54A 1X4CA 2EK6A 2M52A 1K1QA 2JDJA 2RRBA 1S4EA 3GONA 1Y3JA 3VAFA 1HD1A 1WKKA 2NXUA 2GQQA 4C3LA 4ZDNA 4WP8A 1RT6A 2V4RA 1QVGR 1CVJA 2NS1B 2OGUA 4MIBA 2IC3A 4DSEA 1R0BG 2B43A 3OR1A 4DR3J 3OL8A 2BABA 3TAMA 4A48A 1T7PA 2CJYB 1TKTB 5F0UA 5JUMA 2IFXA 5KFPA 2IMOA 4N8OA 3PZPA 2LDIA 3QFHA 2E9RX 4UT4A 2ABYA 1S4FA 5KOWA 3TUZC 2R42A 2GGPA 4BC7A 3N79A 5F0WA 2I8EA 3DOMA 2YPZA 1SQFA 1T8EA 1H6KX 2K7KA 2XMTA 4N41A 3HSJA 1GEHA 3HKWA 4YB6A 4Z37A 4ECWA 2MHNA 1PYSB 1HNIA 3UE2A 3MPYA 5SZTA 3CC4S 5D6GA 1BQNA 2MKIA 4Q8EA 2E1AA 1S6OA 1WC6A 5F41A 3UWTA 1Q0NA 3KK1B 3KK3A 4KPYA 1JLBB 3UN3A 2AGPA 1B0VA 3SQGA 3HZEA 2QLJB 3JSRA 4OV6A 3CJSA 2HFVA 4LJMA 7FD1A 5KOXA 2EW9A 2Y0BB 2V2KA 4JI5J 3C8YA 1S6PB 4B17A 4M5DA 1PBAA 2VICA 2HHWA 4JI0J 4J37A 2VQEF 4PG4A 4PZVA 1N5TA 2BDPA 4CIOA 4RNHA 3H98A 2AIRB 2CKWA 3TRGA 5KFFA 4FXWA 4ZCMA 4CLTA 4L72B 4I7FA 3QIDA 1NK8A 4MKYA 3IBWA 4I4BA 2B5JB 1RA6A 5K20B 1YVFA 4DWIA 3QJJA 4OI1A 2DGXA 2RIJA 4NLTA 4O4RA 3JXOA 3OSNA 4LF1A 2FLOA 4C8LA 3ZZUA 1FD2A 4AL7A 3TVKA 4H4OB 1RCOB 2GIQA 3EVMA 4TVAB 1YTYA 3ICLA 2WVDA 4I69A 3U27A 3MCOA 5D4PA 2V50A 3EJMA 1FTRA 4J90A 5HVHA 2QMWA 3MM7B 1Y5NB 3C3LA 4DV7J 3BSCA 1KR4A 1V9OA 3RZAA 4N47A 2ZH6A 3FSYA 1KHWA 2BW2A 1GX5A 3NGDA 3G6VA 4NLUA 4DX7A 1RKIA 3KHRA 2A3JA 1RTHA 4EK2A 2VG5A 4B02A 3H4DA 4P74A 1YZ7A 4CP5A 4FF4A 3EGVA 4V1Ak 2HZAA 4Q45A 3VF0B 3I4HX 1IVZA 1BMQB 2E9ZA 3M8RA 3OTCA 4C8MA 3PV8A 2NREA 4F0KA 1UWBA 5KFDA 1S1WA 2Q6CA 2ZDOA 4GRSA 4DZDA 1S1TB 2Y3YA 3PIOQ 3O8WA 5GAEU 1LW2A 3N6MA 4IQMA 4DV6J 2HGNA 1IBMJ 2BANB 2OELA 2RS8A 1SV5B 1U09A 2IRYA 1JXEA 2CPEA 2B56A 3M2VB 3IM8A 1R43A 2QFJA 2WSCC 5F8MA 2GAGC 1NK7A 5G4DA 2LQ8A 1TV6A 3DI6A 1ZTTA 2CUYA 3C16A 1JXLA 1RT4A 2W4CA 1ZS6A 1I94J 3IBCB 4ID5B 4P6QA 4LF6J 2QLXA 2VPYB 3RR7A 4LQ9A 3U1NA 4G1QA 1WSVA 5KT5A 3W9JA 3FEYB 3CJ3A 3UDLA 2PMZD 4DR4F 2FHMA 3GJRB 4CT9A 1RHRB 2XI3A 1F60B 3OTOJ 3I87A 2JEGA 1YRUA 4HHHA 4F26A 5HMZA 3S1TA 3CJKA 3QT6A 4LR8A 3PW4A 3JAMY 2WONB 5H9FJ 1HW8A 2HZCA 2YKMA 3J7YU 4H4MB 3Q0AA 1NKEA 3I96A 3PEJA 3K8WA 2HG4A 1O0PA 2ZH1A 1AXQA 1MROB 1RHMB 3AFGA 1F9HA 2CWXA 3BS9A 1NXIA 2HHHF 3MAQA 5H1SV 3NCQA 3ISND 3ZTOA 4PUOA 3F56A 1H72C 2W8KA 2BJ7A 1G1XA 1UVJA 2UXBJ 1EAYC 1DZ5A 1QY7A 3TARA 1M5PC 4XDCA 3MMAA 2BJEA 2YH0A 1PG5B 1XTZA 4F50A 3MCNA 4EBDA 3HD1A 2UUBJ 1UFKA 1RJJA 4CLPA 6FDRA 3POTB 4IO1A 1SIZA 1KC8T 3M8QB 4QWBA 4GKKJ 1AB8A 2DIUA 3KLHB 1Q7YT 1C1BB 1UW9A 4FBTA 4LR7A 2AX1A 3QSYB 1QSLA 3R7SB 3K5NA 4QYZJ 1WF0A 3R97A 1F6TA 2XG8A 3DYAB 1DY3A 1APSA 4DHVA 4DQSA 1YX2A 2LQBA 1JNZB 3K58A 4OHZA 1OPIA 4K5RA 2IM0A 3CGIA 3V4IA 2HVDA 1K8AT 2AMCB 1AZSA 4KPCA 3UO0A 4V19J 4M5JA 2XCAA 4PPZA 3H7HB 1K0VA 2VPWB 1Q5VA 2BQ3A 1RWNB 5ETMA 4LF5F 5EWFA 2Z2YB 2RKIB 4NE9C 4OJGA 4K7QA 2R8HA 4RW6B 4NXNF 1RZMA 4LF7F 4Y2IA 2DR9A 3AOAA 1TVRB 5D3GA 4FYXB 4L76A 2AJ2A 2GX8A 4OI3A 4ZCLA 4EYHB 2RDIA 2QL7B 2J0XA 1HNWJ 3PX0A 2QV6A 4O3RA 3CMES 2Y9HA 1K0TA 3UVJA 5GAHI 4KHMA 5D0RA 4WJBA 3M2UB 1S1VA 1QVFR 1N5VA 2AU0A 4W92B 2MQNA 4O3NA 2DNMA 2GMHA 5HQ8A 1FRXA 4KTQA 1BE4A 4F25A 4KH1B 2ZNYA 2JWNA 4O44B 1HBOB 5KFNA 2YPYA 1RAOA 3HP6A 1DQ9A 1X4AA 3DHXA 4DL4A 3L4BC 2C3PA 4DG1B 1KOOA 1F3FA 5L9NA 4F2RA 2CNKB 1OSDA 2XSJB 3CCLS 4Z2XA 4FYVB 3CMQA 1X5TA 5CYQA 3LALA 1HHSA 3H25A 3J7A1 1RT1B 2F9JA 3IN5A 3AB2B 3M6UA 1RXOB 3EGWB 3HHLA 4E98A 4XK8C 4NCAA 3DOLA 1TZ0A 1S9EA 1CC8A 1REVA 3AA8A 1G7CB 2JLFA 3E51A 1N54B 4ANDA 4DUZF 1S0NA 3WQPA 1Y10A 2GO9A 3DRPB 1EHWA 3E01A 3AHPA 4O4GA 2QIFA 2HAIA 2Z2MA 1JLFA 4X4UA 4CI0B 1IBLF 3M30A 2OIHA 2GV1A 3KLGA 1QAXA 4DR5J 1TKZA 2VQFF 2M9KA 4QR1A 4J9PA 5CXTA 5D0GA 2AEMA 2E1MC 4X4TA 3RW6A 4Y65A 3MEEB 4AE5A 1ZBTA 4Y2KA 1RTDB 4YQWA 2WTFA 4LRAA 4O3PA 1U7LA 2HYIB 2C22A 3A8JA 3R3TA 1OJ4A 2BEFA 1IN0A 1YJ7A 1XIQA 1RKJA 3FZ2A 3WX8A 2KFYA 3MM9B 4J9VA 2X1AA 4DV5J 3R6LB 1Q5YA 3MECB 1Z2LA 4A8FA 1VIXA 2ZVIA 5J2QA 1HWJA 1NLKL 2QMUB 2GJFA 5T14A 5KFLA 2GHVC 2OSRA 3GR1A 4ERDA 2E29A 3HSGA 3SXLA 3OVBA 4ECTA 5FLXU 2N3OA 4PQAA 3C14B 2MQMA 4RUAA 1U49A 3AJ2A 1VMBA 4NXMJ 1Y9OA 4HL9A 1EX8A 1JKHB 3GIRA 3EWGA 1HR0J 1AYEA 2Q6BA 2RU9A 1FFSB 3OHBA 3HHEA 2KDOA 5RUBA 2AJ4A 4X4NA 1LW0B 2YX7A 1F5BA 2FZCB 1RABB 4CYUB 5FIIA 2GS8A 1LWEB 2JOQA 1CJKB 4JI6F 4DXLA 1OSCA 3THTA 5DS7A 1JX4A 5DZ6A 3IG1A 4ZVRB 4HR2A 2DNZA 3AD7C 1RLCL 1UJ6A 1KOHA 3SI8A 5CABA 3PHTA 3QGIA 3OT9A 1KN6A 2VUGA 3VGSA 2I5JA 3HT0A 5DRKA 1DARA 4Q2LA 1R7IA 4RBUA 5KT2A 2XULA 3KJVA 5LSRA 2IVMA 3CT9A 4OJ1A 3TQEA 3QWPA 5K8PA 2ACYA 3O44A 4FNIA 4I56A 3PW2A 4FS1A 5KFIA 1TL7A 5K5MA 4GKJF 2J7WA 1RWMB 3PRBA 3I56S 3FEZA 1PAEX 1XMOJ 5I3UB 2CPYA 4Q44A 5BR8J 3DXSX 4LVOP 3AA9A 2R3VA 3OFEA 3ZZRA 4B3MJ 2EFQA 3R7NB 3OL6A 5BYQA 4LF2A 1YQHA 4DCJB 2JEJA 4KGZB 2RB7A 1VIOA 1S76D 4CO4A 2V2VA 4NYPA 2VJUA 4NLOA 1WC5A 2XYHB 5BXIA 1K9MT 4RX6A 4ZVEA 2N7CA 3DLEA 3T5LA 1OS5A 4WWSA 1U8SA 3BO2A 1NEEA 1QSYA 3BYRA 1RU1A 4C4WA 1MMLA 1D9AA 4NI2B 2VH7A 1CJTA 3OTEA 5IXUA 5LMNJ 1FD8A 3KHGA 4R8UA 4J5OA 2PO4A 1ICEB 3K89A 1GMWA 3HXMA 2QSFA 3SCIE 3FBFA 3VGTA 1VLOA 1P27B 4IH6A 3TI0A 2IVYA 5AE2A 4RW4B 3L95X 1N4LA 3GFYA 2QT7A 3VQTA 3CD6S 4LT6A 4PG7A 2YH1A 3PW7A 1U6BA 2DGWA 4TKTA 2XGPA 3LP0B 4ED4A 2VG6B 3TZXA 3MR5A 4F3QA 2VJVA 1NDPA 3MUVP 3WC0A 3HMJG 1O8BA 4KKOA 1YJNS 1TK5A 1IJFB 3NXZA 2R8KA 1FKPA 2PSZA 3PY8A 4IFVA 2H5EA 2BJ9A 5JXSA 4X64J 2E5JA 4RW9B 3MD3A 1PC5A 2UUAF 4WCEQ 3CCVS 1N8RT 2B7BB 1VRUA 1HQEA 4F3OA 3CCMS 1IUJA 4CM0A 4ZN3A 1PJ5A 3R1HA 1NJXA 2MQPA 1JJCB 1FVQA 5KFHA 3R9LA 5A6WA 4ED2A 4YEAA 4N8NA 1UFLA 3FUYA 3QT5A 3G8SA 4AQYF 4DR6F 1R8HA 4K2XA 4JI1F 1ZTWA 5A8WA 1CJUB 1IKVA 1G3OA 3K5OA 3M2RB 1RBLA 4C98A 2IRXA 3DC2A 4C6AA 5HVFA 2DH9A 1NMEB 1MSWD 3RBEA 4X4PA 2RS2A 3KUEA 1FJGF 1BY9A 3CJ5A 4KYZA 4TU9A 1I51B 4PXCA 4RJVA 3FKBA 5J1EA 1AFIA 4ZVUB 3I82A 4QU7A 2F63A 4AYBD 4I2QA 4ZLPA 1SC6A 3CTRA 4QIVA 4LF9F 2B4PA 2ZE2B 4K4YA 5DQGA 4RW7B 5LXRA 2CADA 4DUYF 4ED8A 1S7HA 4MYTA 3CO9A 2VA3A 1CG2A 2A1BA 2MGZA 4O3SA 3MM5B 4AXIA 2IDEA 2ADBA 4WYLA 1XK8A 2W2OP 2DNNA 3LGNA 3NAHA 3VQSA 3NG8A 2CQ0A 3PJXA 5KT6A 3RR8A 1Q53A 2VA2A 3J7AN 1LWCB 3DKDA 2FLLA 1HFEL 1BHNA 4CRJA 5E3AA 3KYLA 3AD9C 2GA7A 2U1AA 1S10A 3JS9A 2R8IA 1S9GA 2VL1A 3DXBA 1FO1A 5EWGA 2XHWA 2BE7D 1ZM3A 2D3OR 3MEGA 2YQ0A 4OZNA 1Z4UA 3NY0A 1XEZA 3ZTPA 9ATCB 1HBUB 1TL5A 2AYEA 3IR5B 4K4SA 2YNGA 3LTOA 2LXUA 4IR1A 2CZ4A 4Q5VA 5CD4A 3AB4B 2MLXA 3QAUA 1XMQJ 4DOZA 3R1LA 4X66J 4UZCA 2CPDA 2BBEA 1TKDA 1Q8BA 5HBMB 3DOKA 3CJQA 2XLKA 3TANA 4HEA9 3IFEA 1IR1A 1UFWA 2RHQB 4X4OA 1IKYA 3GFHA 1HBNB 2MDAA 4OX9F 4EZ9A 1L3KA 2EI5A 4DL0C 2JC1A 1JMTA 2HS3A 3FRZA 1VQYA 2AYBA 4TU7A 1UJ5A 3RW7A 4CCHA 1UVKA 2W2NP 3BO3A 5KG2A 1N34F 1E6VB 3PFOA 4JI4J 8RUCA 3P5BP 2QRRA 4FKXA 3DDKA 2FY1A 1TKTA 2G2YA 4PG5A 1X60A 2HVEA 2ALYB 1N33J 1RTZA 4UQGA 4P2MA 4K59A 1RYSA 2N7YA 2DKOB 4BBYA 2DISA 3OVSA 4NLWA 4P75A 4A8YA 3IGVA 3OXFA 1OQ6A 4WYWA 1IR0A 5FJ4A 1S77D 2RVJA 4KR0B 3N6LA 1UVMA 2RU3A 2HWIA 3MWBA 1XMBA 1N52B 1NM2A 4LVNP 5E5NA 2MQOA 2Y1IA 3VAIA 2BW7A 4L6V3 4QWDA 4ECSA 1B3TA 1M90T 1F9FA 1LXJA 1SUQB 3W3SA 2MHEA 3K7RA 2LLZA 2RQKA 4YMEA 3HKZD 5M2RA 2AT1B 2FD2A 1BQMB 2OPPB 1MN7A 2MJNA 3A3OB 4R0EA 3SDEB 2HFOA 3KK1A 1RHJB 1JLBA 2CNLB 4B3SJ 4TXSA 4IH5A 1D1UA 1Q79A 4GC7A 3MFHA 5IT9U 3D0IE 3L3CA 1R6YA 3IR6B 4WU2A 2HBRB 3ITHB 1S6PA 2FB0A 5EDWA 3R2DJ 4M5NA 4J9LA 2HVHA 1UA0A 2JX2A 1F2GA 3QZ8A 3T1HJ 4X4SA 4PYAA 1RLDA 2YQ3A 2V2ZA 3PVXA 4KFBA 3EGZA 4NLXA 5GADI 2B5JA 4A8QA 1L3UA 4IYQA 4UZBA 2MB0B 4TY8B 2YVSA 2Y8WA 3G6YA 3HULA 1QDUB 4URQU 3H5XA 4H4OA 4WP3A 4QBUA 1VJWA 4ZJOA 2I6WA 2UUTA 4JV0A 3B8HA 1NBEB 1KTVA 2NR0A 3VAJA 4KO0B 4PCQA 2V67A 4NLRA 2PDAA 2FJEB 3A3PB 3MM7A 1MN9A 2KO1A 2H5JB 2CQDA 2L3MA 3SCLE 1WSRA 3ONQA 2ATCB 3PTWA 4W4MA 3DU6A 1V3ZA 3CJ8A 2QA2A 1YIJS 1CPZA 3A13A 1UPPA 2GMLA 3G82B 1LWXA 3LW5C 3KHLA 2EFOA 2UVVA 2NXEA 4DCOB 3ZO7A 3PFEA 3W5ZA 2QMXA 4XO0A 2KN4A 3S7RA 5AJ3F 1O5JA 2XGQA 5H9FK 2XMKA 4UTGA 3BH6B 4NMXA 4A8OA 3D1OA 2HHTA 3TOQA 5ETVA 2AKWB 1U45A 4LREA 2DNHA 3BPDA 2GIRA 4IDKB 3ZZPA 2DBBA 1UEUA 2NSCA 3BEGB 2R7QA 2JFDA 5T41A 3MM6B 4ZLLA 1X9SA 1S1TA 5C42B 2R7WA 1TELA 1KWMA 2NYHA 3D6FB 3PKMA 2BANA 3HCXA 2G2OA 2E5HA 3D6HB 3LP1B 2ZH9A 2KFZA 1SV5A 2VC0A 2IRUA 4DL6A 5DDPC 2KM8C 2XSFA 1BGXT 3M2VA 2ZOMA 1ZPWX 5KFKA 3OLAA 2ZWOA 2NPFA 4NZ6A 2OHDA 2W9CB 4XTTA 1QSSA 3DHWC 5C25B 1F2HA 4TQSA 1JLCB 4PXBA 4ZP9A 1WI8A 3SSSA 3P45B 2X51A 2XZDB 3KDNA 3NEKA 3LO3A 1FJCA 4DDFA 1HLWA 1H73A 4ID5A 4B3TJ 3C6TB 4QYZK 1NH7A 2KXNB 3ILLA 5LSLA 2HHXA 1TMMA 1KTQA 2J5AA 4YDXA 4C0OC 2COLA 2H65B 5KFRA 4F02A 4OZ0A 3IP0A 3NS7B 4KV8B 4BCAA 1LFPA 2LMIA 3CD0A 1XERA 4MAKA 2XZTB 5FLXY 3THPA 2WONA 1WG5A 2C3UA 2IJNA 1KQFB 3W8GA 4Y2AA 4H4MA 6FD1A 4DMZA 4CLLA 2BUNA 1MROA 3JTPA 2W2PP 2UU9J 3DLLQ 1M1HA 1VR6A 1EZZB 2QZ8A 3RJMB 3PX4A 2B9WA 3V6HA 2KHDA 4NOHA 2XQCA 2XMMA 2E44A 3KLIB 1SL1A 1RB0A 3U1LA 2HIYA 1MWQA 1CS4B 1FWLA 2P5VA 1U24A 1S99A 2A6MA 1U0HB 1G6BA 4GO5X 2P6TA 3ZTSA 5ETLA 1HI0P 3POTA 2AGOA 1ZM4A 3C6UB 3D2WA 3M8QA 3KLHA 1URNA 1C1BA 5HQMA 1FWKA 3CDUA 4FVCA 4ECXA 4WZQA 9RUBA 4ZVOB 4F3MA 4N76A 1V6HA 1JWWA 2XY6A 1SL0A 3TUIC 3DYAA 2PIIA 3HHKA 4WXOA 2JSXA 2QTWA 4IOCQ 2ACMA 3T6BA 1QJHA 3ADAC 4EUVA 1U6ZA 4FYYB 2AHOB 1NHKL 4M5GA 5LJ5Y 4C0BA 2D7SA 4DFMA 2F8MA 1WD6A 5KTQA 1RACB 2BMBA 4BHQA 2FY8A 4USIA 2OMLA 3NGSA 1HWIA 5I42B 1AROP 4I67A 3CD7A 2ZUAA 4WU3A 2IBKA 3ZFVA 5KFXA 3AD8C 3D3BJ 3BYPA 2V4JB 1T9WA 4DSLA 3B6BA 4PAAA 5MAOA 2RKIA 1KQSR 3ENAA 3GILA 1VQOS 4RW6A 2B9EA 2B9YA 1TVRA 2QG9B 3MCMA 2ZWPA 4ZP6A 2FVRA 3H40A 1Z2ZA 1D3WA 2MKJA 2C3OA 4JV5F 2EWHA 1G4CA 3NRBA 3EDRB 1H0HB 1DTTB 3G87A 2KZMA 3PRVA 4YY3F 3TJ9A 4DV1F 3M2UA 3DLKB 3ZTRA 4Y3CA 2AX0A 4URSA 1MU2B 3M1VB 2YNFB 3LPEA 3W2VB 3W7BA 2KG1A 1AFJA 4U7UK 3OFGA 4F0HA 4JI2F 3US5A 2BRLA 4O44A 1HL6A 1XNRJ 4RUBA 2R2TA 4QWEA 2YWGA 2XWYA 1YITS 2YKAA 5GMEA 2PT0A 1SJRA 4DG1A 4YHHJ 3CIZA 2XSJA 3C19A 1SJQA 4RBVA 3EICA 2X1GA 4QJVA 5AT1B 4LSNB 1RT1A 5KFWA 3BSAA 2J0QD 2C3MA 2CFXA 3FK4A 3LF0A 2DPJA 2AW0A 2R8GA 4ED0A 3MFIA 1R89A 4USUA 2E1RA 4JI7J 3OD2A 5KG1A 3D6MB 2KFNA 1KKHA 3HO1A 3NCPA 4CH7A 4NRUA 5I3PA 3V6JA 3DRPA 3H0PA 2ZITA 4DQRA 3F41A 3M6WA 4F0MA 4M5LA 4NEYA 3PYEA 3KNAA 1KVKA 3NGTA 4WK3A 3NGKA 3LQVA 5JMNA 2BE9B 4E2FB 3MEEA 1RTDA 2IM1A 3P6YC 2B6AB 5EGYA 3LWLA 3G8TA 2J0SD 4LSLB 1HPZB 4ZHRB 3ET6B 1NPPA 1VCTA 4A4JA 1YKWA 2YKQA 3CW2C 2C2MB 1V3RA 1HQUB 2NXCA 3MM9A 4DUTA 1Y3KA 1CQNA 3MECA 4B3RF 3ULHA 2VBZA 2YQ1A 4CM2A 3P96A 5HANA 3LP2B 2EEYA 4ZCIA 1NSQA 2C2EA 2XYPB 4RW8B 4C7QA 2ZBQA 1JIHA 4URGA 1KSPA 5L1JA 3CC7S 3Q89A 4LBHA 3CSKA 1VC0A 4IFYB 4IUFA 3Q8YA 2W01A 3OTBA 2OMOA 1JJ2R 4TLQA 3C14A 4LIRA 5J2PB 1JJ4A 3FRYA 1SCJB 2R7SA 1JKHA 4ZVTB 4F7VA 4U96A 4V19X 4CLKA 1WOSA 3QPIA 1B7YB 2F1FA 2R4FA 3TA2A 2HEKA 1KVJA 1FESA 1LW0A 1YJVA 3OTDA 4QIFA 1C2PA 3HF5A 4CYUA 3KUGA 3BPSP 4IQXA 1LWEA 1M0SA 1CJKA 4F4ZA 4F36A 2OO4A 1JK9B 4YB1P 1F5AA 2CQ3A 3N0VA 1D8YA 2M5YA 2ZKTA 3V2UC 3W66A 2MLYA 3JSMB 4DV3F 2QFIA 3IRWP 3KK2B 5KT4A 2J8SA 2VQEJ 1KLNA 4FPRA 1FE4A 3RYLA 2QJ3A 4P2XA 1M5SA 3GFZA 1JLAA 2V4QA 4Q43A 2P2CB 5I3UA 3NS6A 4NLPA 3AT1B 4RNNA 3EPIA 1DBDA 2FGCA 4IOBA 3TX8A 3R8YA 4U6PA 5DZ7A 3OW2R 4OZ5A 5CCLA 3WX4A 3A4TA 3NWRA 1AUSL 1FFGB 4WBFA 2LQ5A 2ZEJA 2MYFA 3VVUA 1IBKF 2HQIA 4Z7CA 5A2QU 4ZLJA 3QMQA 3VZIA 3FSXA 1VDHA 3RBDA 5K8NA 2D74B 4DV4F 4NI2A 2N82B 2C2RA 3T6JA 1L3VA 2J9DA 5K14B 2M88A 1F1BB 4J7CA 1HARA 3FCWA 5D15A 1D0EA 2YX4A 2MZ1A 2WCXA 1PCAA 1VC5A 2FTRA 4KE5A 5MLCV 1VHIA 5C2CA 3KOAA 2LQJA 2WOMB 5ETSA 3H59A 1GXLA 3HHNB 3IWXA 1B0TA 3BGLA 5BYRA 4RW4A 2Q1LA 2HPUA 2XO6A 3LOUA 3TJAA 2CNNB 4DL2A 3I31A 2IM3A 2BR0A 1H2UX 1SPBP 4CO5A 4BS2A 3LP0A 3MCSA 2VG6A 2OPQB 3Q86A 1DQAA 3AH6A 2XLIA 5B7WA 2VOOA 5IT9Y 3JTNA 1M1GA 2HRYA 5DDOC 2RILA 3MTKA 3C46A 4FYDA 3HX9A 4I1TA 1HHQA 3VAGA 3C2PA 5KFZA 3O3LA 2AP6A 5DDRC 4UOCA 3OXGA 1S5ZA 4DPWA 1X8DA 2O5DA 2MMYA 2DCLA 1OY9A 1W2IA 1VRTB 4BWJA 1J5OB 3AQPA 4LRDA 1VQ9S 1SKSA 4LF8F 3FZBA 1ZAXA 3KJNB 2O67A 3KHHA 4DR4J 2KB2A 1N0UA 3UR0A 2XMJA 4LFBF 1CJUA 1UWAA 1FDDA 2QGFB 3KJQB 3M2RA 1TL1B 3IRXB 4N77A 4ZLNA 2YWFA 5IWAF 2HHUA 2NCKL 1S6UA 2DNLA 3HM9A 3H20A 4QIEA 4ECUA 1N6QB 2RH3A 1VBZA 1EP4A 5E3RA 4QYRA 3ZZOA 2ROGA 5FD1A 2FJVA 2IBOA 1XN9A 3KDOA 2B0GA 1CSJA 2Y1RI 2J7KA 2HS0A 5HI7A 3IGNA 1CC7A 2HHHJ 1WHXA 3G96A 2YWEA 3TVZA 2DB1A 4L3KA 4CO1A 2FUG9 2QC3A 4ZJLA 3DDNA 4Z7YA 3ENQA 2ZE2A 3EZOA 4RW7A 2EC2A 3EZUA 1RCXB 5A6PA 3QATA 3GMGA 2POKA 2GVZB 3EYZA 1NNDA 3MM5A 2D69A 1QLNA 4CH0S 3HJFA 3HLUA 2CVIA 2FJDB 4ED1A 1IQTA 2ZBCA 3IR7B 3WZ0A 2AD9A 2GJ2A 2DPIA 2UVUA 1RAJA 2B4OA 3JSBA 5CQGA 1LWCA 1K73T 3IBFB 4MH8A 2E1PA 4DBQA 1C0UB 4YB5A 4MK9A 3RAMA 2NYIA 1S9FA 4W98A 2ZC3A 5ETOA 1FCAA 1WC1A 4C11B 3SYZA 4O0NA 3RAXA 4PRFA 3W62A 2XS5A 3SBMA 3H4BA 1C1CB 4QQBA 4CWBA 1HBUA 4UY85 4A8WA 2OPSB 4J9KA 2VONA 1S79A 2HS4A 2G0JA 4EYIB 3UDCA 1S12A 3HVTB 4KRWA 4LBPA 5KG3A 1NDLA 3UDVA 2BV3A 2EK1A 4CLUA 2JEFA 4LF5J 4DSJA 2MSSA 1T9TA 1KVIA 2A18A 1KP6A 2MJUA 1NPKA 3P5TL 4U95A 4NXNJ 5HBMA 4LF7J 2R8JA 2RNEA 2CZVC 2XLJA 2D1CA 3RGIA 3PIPQ 5HK4A 3BV8A 2ZHOA 1S1UB 4Y00A 5L1IA 1HBNA 1FTCA 3SIPB 3VZHA 1U4BA 4Q0BA 5C24B 3BJYA 1EKSA 3FSIA 2KZZA 1XR5A 5DLGA 4ZITA 2E66A 1Q1KA 3C15B 3GP9A 2EVZA 1RWPB 2Z4PA 3ENWA 2DNOA 1U25A 2VDIA 1X4GA 1E6VA 4X4QA 1IKYB 3IM9A 2H9ZA 4WFXA 2H54B 4P9SA 5ETRA 5CYMB 3HDSA 2HURA 4OQJA 1FT8A 1B64A 3O2IA 1X4FA 3CE8A 4QIWD 2ZJRQ 3DLBA 3VALA 2P9EA 4Y28C 3V4MA 4QPXA 3CMAS 1TL4A 5AXKA 4OIXA 5GAGI 3GCWP 3N4WA 2ZM6F 1NZAA 3FCHA 3ZZ0A 3QRQA 4YFUA 4CTAB 4RR5A 2EFPA 1UETA 2KYZA 1HI8A 3I9ZA 4U67Q 1S6QB 4OYXA 2I9SA 5C2GA 2J8AA 1SH0A 1YZ6A 1SUQA 2YWWA 2KH9A 1H2TZ 2HQ3A 2SXLA 3HVAA 1BQMA 2OPPA 3GTYX 5IQ6A 5F8LA 3PR5B 3I32A 3SDEA 4ECYA 4DUZJ 4O0IA 4K0KJ 2C42A 5IS2A 1TMJA 3TUJC 1T95A 1KRPA 1JJHA 2FVQA 4KGVB 3QJPA 1GH8A 5D4NA 1IBLJ 4LRCA 4IRKA 3ITHA 4A46A 2VQFJ 5CCMA 1C4CA 2CA9A 2HQDA 1YGYA 2XC9A 1YWXA 2UVWA 3M4XA 3H5SA 5J1PA 1J5EF 4F4XA 2DNKA 2QLBB 3KFWX 4ATNA 1PC4A 5JVGQ 1C0TB 1AUDA 3TYTA 1UPMB 2CJ9A 2MZSA 3MMBB 1Q7LB 4KT0C 2R7VA 3OFHA 4B9TA 3CCJS 3TZWA 4CQ1A 5CHCB 4JI3F 3TX0A 3EGNA 2YWHA 4TY8A 2DVIA 3RUBL 4NLYA 2PE8A 4DL7A 2EPIA 4WFZA 4DS4A 4JI8F 5KG0A 5B08A 4I64A 2AEJA 2DGVA 4KFBB 2AGQA 3SFGA 3FJ2A 4KO0A 4RNMA 1FX2A 3W65A 3VR1A 1RHUB 5E0OA 2LP4A 3FGVA 2D3UA 5B0AA 5CYJA 5ITHA 5KG5A 3OUYB 1B7FA 3CPWR 2ZBRA 3MI7X 3GV7B 3KUHA 2G0IA 2LA4A 5K9FA 2IPOB 3G82A 3DM2B 1SH3A 1OPZA 2DGOA 3TR5A 1UZDA 4M1KA 2AEFA 1HNZF 1PIEA 4FPIA 2KTQA 3PX6A 2YKOA 4QW8A 4LUBA 1RA7A 4OYAA 5G0RB 4JI6J 2RSQA 3HK2A 2PMWA 4XPEA 1UW4A 2W2MP 4IDKA 1ZZNA 4WPAA 3AOBA 3B78A 1M5VC 2DEIA 3CDBA 3MM6A 3T5KA 2J9EA 2I38A 2HNYB 2HNZB 1B0PA 5C42A 4KIAA 3GCXP 5A0YB 4R25A 3NNCA 4ECRA 3DRYA 4HDHA 3GIJA 3UNGC 1K47A 4WE1B 3M9NB 2QA4S 3LP1A 4HYKA 3KG0A 5D4LA 4DN0A 2GNKA 4GKJJ 2VKRA 2I1RA 3L7OA 1IQZA 1S0OA 5KFCA 2W9CA 1NKBA 5C25A 5L46A 1JLCA 3ILJA 3GJQB 3Q24A 3HSZA 2CQGA 2ZOGA 1P8GA 2DH8A 4H4KA 2FHJD 2IJRA 3GIKA 4USJC 2KJWA 3HHLC 3C6TA 1JLEB 4UQTA 2BOPA 3K5LA 1WHYA 3L09A 4LFCF 2V8PA 4ZKAA 4ZIVA 1WWHA 5DM6Q 3VAHA 4OYPA 5HL7Q 4G6VB 4CZCA 4RWWA 4YP3A 5ETPA 3SFUA 4KV8A 3N01A 2IHR1 3D3CJ 3B4MA 3G4SS 2BA9A 2V8DA 4DPTA 4ENOA 1R8CA 2AV5A 2HK2A 3KG4A 4DI6A 2ERRA 3CD5A 3D5MA 3BQ0A 3JQMA 2D3ZA 1UVLA 1WELA 2XMVA 1KONA 2F8EX 1NJYA 1RT3B 1KNZA 4PWDB 2HFUA 3R5AA 3VWSA 3BKFA 1U2FA 4GC6A 4WZMA 2QL5B 3THVA 2CPHA 1LK7A 3D1QA 2VFTA 4ZMMA 3KLIA 1PJ7A 4C8YA 3S6EA 2Z8QA 2JVOA 2QLWA 1CS4A 5KG7A 1X4BA 1FFWB 2GO8A 1U0HA 2BE2B 4KAIA 3A8IA 4ECVA 3KLEB 4QW9A 3PXGa 5I4MA 2GVDB 1VQ5S 1XWLA 2B4VA 1M5KC 3I5BA 3PM9A 3C6UA 4X65F 4ER8A 5F8IA 4DPOA 4HHJA 1NJWA 3I5CA 4DPUA 5F8JA 2OEJA 1F9EB 3KG1A 1RADB 4F67A 1SQEA 3ENVA 3QIPB 5E7OB 4DFPA 2FYXA 2IYGA 2UUAJ 4EBEA 1YBAA 1RT2B 1MMNA 1LQ9A 4DV2F 3D7SB 2JNJA 1T9XA 4R5PB 1UEVA 4HACB 1SC1B 3UN2A 4DL5A 2HSEB 3ILOA 1VI7A 5I42A 2OSQA 4DR1F 1S59A 4NLSA 3LAKA 3PEHA 4K4ZA 1T05B 4AQYJ 2LECA 4DR6J 2HMIB 5HMWA 4JI1J 4CLYA 2V4JA 1VQSA 4ECQA 2RHSB 3VTIA 3GZ7A 1U48A 3CULA 3NBPB 3OR2B 2E7VA 3NGUA 2IJFA 2BJ1A 4NCGB 1O6XA 1EIYB 1FJEB 5GVQA 4ED6A 4B9NA 4PWWA 3GG1A 1FJGJ 3PYFA 2FVPA 2DGUA 2V94A 4NZ0A 5A2QY 3IWNC 2LYVA 4D3GA 1P6TA 1DTTA 3DDIA 2NZ4A 5KG4A 2HRTA 1O51A 1MG7A 1FA0A 1NK0A 4DL3A 3DLKA 3EPGA 2BJDA 3FBEA 2RMLA 4NEZA 2AWZA 3TEGA 2DNGA 1MU2A 4LF9J 2XMUA 3M1VA 3DLHA 1DRZA 4DUYJ 1RWWB 2YNFA 1WG4A 3W2VA 3KMSA 1AW0A 2IM2A 1YJWS 3QYYA 4B9LA 1YJUA 4PQUB 4OJ3A 3B82A 3M6XA 2OP5A 4PXEA 3R5BA 1PSDA 1RWKB 3TW0A 2AYGA 1RBOB 4AXJA 4ZN1A 1U2CA 2J76E 4AFFA 1IM6A 2ZC4A 5IC6B 2RQ4A 2ZZNA 1RWXB 1X9MA 1ROFA 1Y4ZB 4LSNA 3M7VA 3ZC4A 3CF5Q 3GV5B 4MTPA 8AT1B 3TQ1A 2F9DA 4FF3A 2WW4A 2GIFA 1ZOTA 2D3O1 2HVZA 1FK9B 3SV3A 2BKOA 4KSEB 1JB0C 2C2OB 3U1MA 4MFBB 4LF4F 2CQBA 3BO4A 2LFVA 4PABA 3EVOA 2VASA 4O23A 1HWKA 2C3YA 4MK8A 5KT7A 4QWCA 4YOEA 4HI2A 5EX0A 4JB8B 1Q8LA 1S0MA 2FLNA 2ZH5A 2R7TA 4OYWA 1WOPA 2B6AA 4K0KF 2WK4A 4LSLA 4L75A 1YK9A 1HPZA 1YBTA 4ZHRA 5IOLA 3ET6A 3D4JA 3NKYA 5B0BA 4OX9J 1U1QA 1HQUA 5ETKA 2FJAB 4ED3A 1D09B 1U1NA 2ATLA 1YG0A 3LUYA 5DDQC 1RT5B 1VQ6S 4ITSA 1BQXA 3FNNA 1NZ8A 2KVQE 4HH0A 5DM7Q 3NNAA 3A8EA 4LMZA 1LWFB 3OJUA 4X4RA 1N34J 2UXCF 3LP2A 1I5OB 3RAQA 3IO1A 4RW8A 2R7OA 3OQ2A 4L73A 4IFYA 1DJ0A 2BKNA 2J0WA 2O66A 3PW0A 1NU4A 3NS5A 2R7XA 2KRRA 3VAMA 2OUGA 4HDGA 5IT4A 5J2PA 3N9UC 4OX7A 2GQ2A 2LA6A 1EQMA 4KBIA 5DQHA 2RDDA 1YRXA 2MPUA 2GMJA 3PACA 2WB1D 3DCAA 3CJ2A 3KTQA 4WFNQ 3CCES 1GFWB 1BLUA 5F9LA 3BR8A 4C3MA 2CRLA 4D3HA 2IY5B 4RWXA 3DGPB 1SL2A 4DR7F 4C8NA 2W7AA 3JQKA 1Y5IB 4J9SA 2Q43A 1H7WA 4CT8A 2RT3A 5L1LA 2H1YA 1Q16B 3DN9A 5F8HA 3CUNA 2DO4A 2F8HA 2G4BA 1Q86T 3D67A 2XY7A 5D77A 1FXLA 2ASLA 1EQ0A 1RSCA 2R2RA 1V5IB 4DJBA 3JSMA 1LEOA 1R8PA 1WDDA 2YY3A 4X4VA 5J2NB 4YR0A 3KK2A 1CULB 3HT3A 2XI2A 2EC0A 3KKFA 4BWMA 4WFBQ 2O3DA 2ZJQQ 1N32F 3MZIA 4KH0B 5GAEI 5L38A 4M5HA 1P9QC 2DYAA 4MKVA 5HLFB 1RWOB 3HZGA 1R8AA 5ETTA 4DR2F 1FEHA 4L74A 5E3CA 4U7UD 3SQOP 1Q81T 1FNXH 4KGXB 3NWGA 5ADZA 5EWEA 4DLGA 1JLAB 1UTAA 4MMOA 4WIIA 2QYGA 3L7PA 1K44A 4TY9A 4IO9Q 5E2QA 1NH8A 4USMA 2GQCA 4ID8A 2L9WA 4QCLA 2X1BA 1KLMB 3GSDA 3A1YG 1ZA2B 2Z57B 2ROEA 2YNHB 5CD4H 3DLGB 3W2WB 4XDDA 2VBWA 1HNVA 2H48B 3T1YF 1VQ4S 5IV3A 4RU2A 3JQJA 5B0CA 2GC8A 3H2VE 1JLGB 1X5OA 1PYTA 4B3OA 2E7XA 5K14A 2G0CA 2CPXA 2OJ3A 1M5OC 4Y2CA 1T11A 1VGYA 4GVLA 1W2BR 3QLHB 4R0JA 4OZ1A 2HNDB 1RU2A 2XTJP 4WKYA 2HGLA 4MYUA 5AJ3J 2NXNA 2DT9A 4KY3A 2WOMA 1F0XA 3AAWB 5D4OA 2GCFA 2V2QA 3J7YI 2DR7A 2E7WA 3M8SA 2DY9A 2J6TA 3I0RB 1WEXA 3WDOA 2HFSA 3D66A 5KFAA 1FDBA 2YTCA 2QEXS 2ADCA 4XIUA 1FWPA 3QT7A 4AD6A 3IAS9 1WF2A 4F2SA 2UUWA 2IMWP 2OPQA 4Y6IA 1RE1B 3D0HE 2E5LF 2DGSA 3CDEA 1BWVA 2WBRA 3C66A 4DV0F 1YJ9S 2M0GB 2V63A 2LEPA 2ILZA 2W7PA 5KFQA 4ZIWA 2A2DA 3GIMA 1BXNA 2HIQA 2B3TB 3OFFA 1QTMA 4P71A 3OHAA 2JLEA 1NCLA 3R5JB 3P4UB 3KWMA 4DLEA 3K59A 2YNIB 2KG0A 1Y5LB 2GHPA 5EHHA 3BZQA 1SH2A 2XNRA 1FKOB 2VBXA 1VRTA 3W9HA 4ED7A 2D9PA 1WACA 3J7Z5 4F04B 1J5OA 1MMDA 4OYMA 2LXIA 3WHIA 4P7TA 1NSPA 5GAHU 3PKYA 1TL3B 5KT3A 2F5GA 2WBMA 3R5GA 1HW9A 4NZ7A 1RAEB 4ILLA 5M2PA 1TL1A 4B9VA 3IRXA 1YI2S 5CZXA 2FJXA 2DGTA 1HD0A 3QNWB 1N88A 1N6QA 1MW7A 5HATA 1FRKA 3D28A 1V5VA 2PFFB 3G86A 5FDLB 1E6YB 3DLJA 4ZS6A 4CLSA 2RQMA 1FERA 3DRXA 3I0SB 4ILMA 2DHGA 4NMLA 5GMDA 2MKSA 2RUSA 1X31C 3ISNC 2OTJS 4OZLA 1EETB 2VFVA 4ZVHA 3Q8QB 2NPIA 1N36F 3VCDA 3K57A 2ASJA 2LXFA 3M6VA 1WC3A 3BGFA 1EP4B 2CG8A 2L48A 2L08A 2D9OA 2IDLA 3EMTA 4UF4A 2GVZA 4FF2A 2BZ2A 2ZOFA 2MKYA 3NOGA 1U26A 1P1LA 3GB0A 2E9TA 3Q8RB 3UI3A 1ZPVA 2DR8A 3CO0P 4X62F 2IIHA 3K17A 3EXYA 2XS7A 2VBYA 4NLVA 1UL3A 3NOCA 4MT1A 3HHDA 1KFSA 1BD6A 3MEKA 1ZM2A 1VBYA 2G1DA 1VQLS 4RNFA 1C0UA 4NX9A 2MZJA 1Y7PA 3LAMA 2BRKA 4C11A 3M32B 2CJBA 3PR4A 2UXDF 3QO9B 2P8IA 3T5JA 3I55S 3BSNA 4DSKA 1C1CA 2BYCA 1IKWB 2QL9B 3OL9A 2A10A 2JZ5A 2OPSA 1HNXF 1U8WA 1H38A 3MUMP 1ELOA 1SJFA 4GVBB 1RISA 3JB9k 2CPIA 4EU0A 3OSPA 3OBIA 1ZM9A 5HJXA 4C97A 3HVTA 2ZJPQ 4NYZA 4O3QA 4CO3A 4DF4A 3ISZA 1I3OB 4A47A 1RWUA 5D78A 4YUDA 3TP2A 4K5SA 4IRDA 3MAAB 4RKUC 1S72S 3MMCB 1EARA 2HHSA 2PEHA 4U8YA 4PKDB 4OI4A 3IA0A 4MKBA 1S1UA 1A6LA 2LVWA 1N5SA 1X4EA 5C24A 4F4KA 4JV5J 1TTHB 1NPRA 4KGKA 4IH7A 2V8GA 4PWUA 5IQQA 2XNQA 3CJ4A 3IC1A 4C8OA 3C15A 4Y2MA 5IFMA 2HFNA 1GMVA 3R2CJ 4YY3J 4ICLB 4DV1J 4DF8A 3J81U 2ZZTA 3MDFA 1MLAA 2M2BA 4Q0BB 1SKRA 2Z30B 5KAKA 4OX8A 5CYMA 3Q2SC 2J7UA 4B9MA 7FDRA 2CPZA 3NMRA 1S49A 2BXJA 2KRBA 5KFJA 4JI2J 2Z2ZA 1NK4A 2R7RA 2KT3A 4RZRA 1RT7B 4DSFA 5HP1B 2AF6A 3H2UB 2U2FA 2RRNA 4CTAA 4OHYA 2FHJA 4KHPF 4C2MA 2A0FB 2CXEA 4EWTA 4CO2A 4P72A 1S6QA 3AXMA 3GYNA 2N3LA 1OYEA 3QT8A 2EFGA 2XM3A 1WG1A 3MPDA 1HYSB 3Q8VA 3L9ZA 4JYAF 5JJBA 3HFZB 4BDPA 3BSOA 2Z58B 2EKYA 1L3TA 2YXLA 3MXHP 2CDRB 3HFKA 3GU0A 1V3SA 4C3KA 3NNHA 2F40A 4ANCA 4P7VA 1VS3A 1W25A 4LFAF 4KGMA 1YRTA 3GYGA 1URRA 1QAIA 2NUUG 1T9UA 3LWMA 2XWXA 1MWYA 4OX6A 1C0TA 5T7LB 3QGPA 2UUCF 3MMBA 4PEOA 4AUKA 3AXKA 2DCUB 1ZAWA 3FQLA 3D0GE 3KMQA 5HMXA 4X84A 3FC9A 1XNQF 4IG3B 3HJVA 3FQKA 4CLZA 3FFIB 4B3RJ 2LKZA 2VF3A 5F9NA 1IKXB 3CIMA 3SCKE 2XS2A 4ZPCA 2IVFB 1U1PA 1LOUA 2MXYA 2YKPA 5LMUF 3K0JA 1NAQA 1WOOA 1KHVA 2ZVSA 1FXDA 4ES2A 3VHQA 3FEXB 1F3VA 4QIGA 3VGUA 2Y1LB 4F8RA 1CEZA 1GXUA 3UFCX 3OL7A 1VFJA 1I1GA 3OPKA 1U1OA 4CH1A 3H5YA 3OUYA 2W2QP 2OLWA 3CJTA 4P2SA 2OEKA 5KFUA 4Q7AA 1S48A 4P2FA 1GXTA 3J80Y 3GIIA 3DM2A 2IYIA 4UOFA 3CCTA 3SMZA 1LK5A 5L9XA 2WSFC 2P6SA 2M7SA 5G0RA 4ZK7M 4B9UA 1JNRB 3EZ5A 2KXHA 4J9RA 1SJ3P 1YJTA 2OKQA 2F4VF 1PKUA 2KVIA 1T9VA 3LGMA 1SXLA 4P73A 3DMJB 2DIVA 1WHVA 4LR9A 3T1AA 3MD1A 3TZYA 4HVZA 2HNYA 2HNZA 4YR2A 4DV3J 5A0YA 3UNYA 5DG9A 2M8DB 4DEZA 2RJZA 2Z2LA 2HBYB 4WE1A 4ETZA 2DNQA 2MLZA 5AXMA 2YX1A 1VYAA 2V9KA 3PYDA 4HHUA 4ZVGA 3FCVA 2Q3PA 3BKUA 5A8KB 2R2SA 3JYTB 2FJBB 4EO6A 2H5IB 2C2ZB 1GNKA 1JLEA 3GSIA 3DGVA 2E5IA 4CNYA 2W1BA 5B0FA 1RBAA 5B09A 2XHCA 4ZP7A 2HGMA 1D9FA 1TUVA 2CYYA 1IBKJ 3FDSA 2VODA 3RG6A 4LRBA 2C28A 2P9CA 1UJ4A 1WNEA 3PW5A 4DV4J 4DR3F 2HLTA 1ZYQA 3AJDA 4AT1B 3B54A 2OAUA 2UV8G 3EUNA 2DK2A 2DHXA 1M5HA 2JHEA 3CC2S 2EXUA 3RBXA 2MKKA 1GX6A 5K8MA 4J9MA 2OH2A 1IBCB 1RT3A 4PR6A 3HPOA 4PWDA 2KM8B 3UCUP 1WKJA 3SV4A 1SKUB 4I2PB 2DR6A 1NUEA 1RHQB 4M63A 1T0TV 4JV2A 1UP1A 2DRDA 3S01A 3I9V9 3MEDB 2DRAA 4W90B 1PYOB 1OMSA 1VHFA 3UW1A 2IAJB 4UOGA 3D6TB 1A0OB 3CB4A 4EGLA 2AJ1A 1YDLA 3Q8PB 2ZH4A 2JL9A 4ELTA 2BE2A 3GR0A 2HVIA 1U1LA 3KLEA 2GVDA 2AZ1A 3EM1A 2I2YA 2CVEA 2ZH7A 4J9NA 2HAFA 3R5CA 4YR3A 4PXDA 3E8OA 3DRRB 2ZHBA 1RDRA 2JLGA 1NDCA 3QIPA 1R0AB 1SBRA 4DS5A 1RT2A 3TZZA 3ZTQA 4EO8A 3F0NA 4K4UA 4JI5F 1UMJA 1WKLA 2GHWA 2K1RB 3V81B 2JC0A 4R5PA 4JI0F 1GTEA 4HACA 3NP5A 2YBVA 4S0MA 2CDQA 4N56A 4LF8J 2O01C 2V9WA 1T05A 1XC9A 2HMIA 1DAXA 3CWJA 1HHTP 3T5HA 4LFBJ 4LBIA 5LXYA 4G65A 3BKTA 4C9DA 4ED5A 1LV5A 5IWAJ 3QQCD 3NBPA 3OR2A 2VPXB 3ETMA 2YKNB 4NCGA 2CQ2A 3NAIA 2AQ4A 4PG6A 2O1PA 2DNYA 4ELVA 4N5SA 2EBGA 3RRGA 2E1CA 5IC4B 1NHUA 3S8SA 2W9BB 1HBMB 3RRKA 1TKXB 5KFTA 2F65A 4OJHA 1RTIB 4DFJA 4DV7F 4OMFG 2K3KA 1HWUA 2DJWA 2KI2A 1DHMA 4MJKA 4DX8H 2EG1A 1ZH5A 1WTFA 2H4YB 4MIWA 2E5GA 3M05A 1KQKA 2FVCA 4Q2MA 1D8ZA 4PQUA 3I4PA 3U7JA 2DNPA 2L9NA 3RBZA 4RU9A 3BDPA 5H9EJ 3BR9A 5J2MB 1VK8A 1N48A 1WORA 1X4HA 2M8HA 5E3QA 2QA4G 4P10A 2B51A 1NJZA 3BQ1A 4QOTA 4WFYA 2PN6A 4UOHA 2C2KB 1B4SA 2UP1A 4UY8T 3ZNJ1 3IAM9 4PG8A 4M5MA 1X9WA 3UQSA 4Y0FA 2CWKA 4DV6F 5EUHA 2MZQA 1IBMF 4P52A 1FK9A 2BJ8A 2ZDPA 5GADU 4MFBA 4ZA1A 4DQPA 4FF1A 1YHQS 2DHHA 2LCWA 3KLFB 3AOCA 4UW2A 5D0HA 1VBXA 1HMVB 1IJEB 5HQLA 4J91A 4U9RA 2FC9A 4FN5A 1WEZA 6AT1B 5E3PA 2CNOB 1I94F 1DLOB 4LF6F 1SIWB 4HTJA 3H8YA 1W7WA 2KJVA 3IS9B 1WF1A 3ZNUA 4USVA 1FRLA 3WC2A 4FBUA 1RT5A 3OV7A 1ZETA 3K5MA 3Q23A 3DRSB 2HHVA 3BBCA 1LWFA 4WF9Q 2R7UA 3CNQP 4YN3B 3OTOF 1HWLA 4XPCA 2HKEA 3I5AA 4ALZA 3QRRA 2AZ3A 2G13A 3TJ8A 4CNZA 2VB6A 4RLEA 3F44A 3G71S 1TK8A 1X0FA 3Q22A 1QAJA 3KXDA 2K2PA 1OQ3A 2UVRA 2JFKA 3LANA 1UEKA 2QYCA 4OYZA 1AA1B 2ZM6J 1UCNA 5DO2A 4DX6A 3VV2B 1Z1ZA 1FE0A 1VQKS 3Q8SB 3V6DB 1RK8A 2H51B 3Q83A 1DTQB 3WIUA 2UXBF 2DEJA 1RAHB 2FDNA 4N7TA 3OVAA 4ES3A 3CCSS 1U47A 3DGPA 1TU0B 4MIAA 1RP5A 2UUBF 4TLRA 1KD1T 2DHAA 3L7UA 2EFVA 2FGOA 2RRAA 1HKAA 5B0DA 3UPFA 2HRUA 2XO7A 3TO8A 1RAIB 5IM0B 4GKKF 5C7PA 2CJQA 1T3OA 4FDFA 2W4DA 2ZHAA 5KFEA 2V69A 3GJSB 5A8RB 3ETOA 3G6ES 4JV1A 1N5YB 1J5EJ 2RF2A 2XB2D 5F8GA 2BKPA 5J2NA 1H3DA 1CULA 3E3XA 1JLQB 3IXQA 1FX4A 2WAQD 4TQRA 3BB5A 4EZ6A 1U6FA 1SC4B 4O3OA 4B9SA 2LU1A 3ZXWA 1SQGA 3BGRB 4USHA 4EEYA 5HLFA 1L3SA 1SKWA 1KFDA 1OO0B 4JI3J 1WJ9A 3G8QA 4ZVSB 4AL5A 5AE3A 2ZNZA 2CQHA 3R5DA 4OFZA 1GQEA 1Q95G 5HROB 3MR2A 2G2ZA 2ZH8A 4JI8J 3IWLA 1X7VA 4HKQA 2PEBA 3BF4A 4OLPA 3RB6A 1RTJB 1X5PA 5LL6d 3J81Y 1KLMA 4RUHA 3T9NA 1HNWF 2PD1A 3CEDA 5DGBA 2WVEA 2XMAA 2YNHA 3DLGA 1CJVB 3W2WA 4OL8A 2DITA 2DHSA 3CJRA 2BM1A 3UN5A 4A8MP 3CXCR 2UV8A 1CLFA 1T03B 4ZPBA 1JLGA 3TWZA 2ILYA 3W60A 3RB4A 2MY8A 4OHWA 4OLOA 3MOJB 5KFOA 1Y0HA 3MM8B 2W8LA 1HNZJ 4IRCA 2GJIA 3QLHA 2PI4A 4IG0B 2HNDA 3UD4P 1HNVB 4TYAA 1TUWA 2CIMA 3M8PB 4OZ3A 4KJIA 4B3OB 1QE1B 2VIHA 3I0RA 3OJSA 2RD5C 4G3IA 2DY1A 2B7CB 4TYBA 2ZD1B 1N56A 2VG7B 1T02A 3WBZA 1K1SA 2KL8A 1A9NB 4DU8A 1MNEA 4DX5A 1CQMA 5DLFA 2BX6A 2DH7A 1WC4A 4RPFA 4DCPB 3QWUA 1R6VA 2BVZA 2W25A 3BN4A 2OI2A 2QN6B 4DR5F 1ZAVA 2YNIA 3FBBA 5F8NA 1S1XB 2NLWA 1FKOA 4DQQA 4PYDA 4BLGA 2OPRB 2JVRA 4LFCJ 1DQ8A 3PJWA 5U47A 3O5TB 5AXLA 3MR6A 3TAQA 1GT8A 2PA8D 3HSDA 3PYGA 4E0DA 4FZVA 4FNHA 1TL3A 2MY7A 2BQUA 4DV5F 1RT6B 5JVHQ 4MKAA 3I6PA 1WDTA 4FP9A 1KBRA 5IV4A 4Y34A 2DR5A 2IC3B 3D54A 2FZKB 4TU8A 3OR1B 4A8KA 2LEBA 3TAMB 3P8BB 3M8WA 5FDLA 1E6YA 3FBCA 5M2UA 2RUGA 2CZ9A 3I0SA 1MWZA 2CPFA 1J2VA 3O1LA 2F7VA 5THWA 2J6SA 1JXVA 2NZCA 4ZPTR 4ZCKA 2GAHC 3TEHB 2GFFA 3DNCA 5IT0A 1EETA 2XBPA 2HFZA 4QZVB 1VRQC 2NXJA 3GE9A 2GGPB 3UR3C 1UZHA 5D8HB 2PGCA 2ZFHA 4NXMF 2XMWA 3DOMB 4LSZB 1H98A 1A7GE 2GZOA 2WRMA 4NWBA 1HR0F 4FXDA 2ZBPA 3TAPA 1OIAA 4NYOA 2BJ3A 1XJWB 1VBKA 8ATCB 1HNIB 3CDAA 3PNIA 1BQNB 3MF5A 3SEOA 2XYGB 4K4VA 4OZ2A 4X65J 4JUZA 2CJAA 5ETQA 5LM7E 1FEEA 3T9ZA 1Q82T 5BYSA 2LQ9A 2HZVA 3KK3B 1ULRA 1VQMS 2HQGA 2DD8S 2B4UA 3BBBA 3BDEA 1SC3B 1WUUA 3SQGB 4M5KA 5HVGA 5KFVA 2HHQA 2F4FA 3UD3P 3M32A 3BBFA 1CBKA 3QO9A 1NK9A 3G9CA 3NGRA 2KT2A 4DV2J 4M5DB 1IKWA 1LXNA 3MR7A 3W8PA 4QR2A 5D0EA 1REGX 4GVBA 2AYMA 2ALZA 3R7BB 2HHPA 1PBUA 3N6NA 2V6AA 4NLDA 2FJWA 3CDWA 2MSTA 2AJFE 3NLCA 2CQ4A 3HVRA 2C2DA 4DR1J 4JOUA 2BM0A 4ZPVR 2J6UA 2MKHA 1NK6A 4I7FB 1XMOF 5BR8F 2KXFA 2L9DA 2IA0A 4C8KA 4B3MF 3CCUS 3MAAA 4FKYA 5F3TA 3MMCA 2DGQA 1WTBA 1VC6A 2H3EB 2VD3A 1FRMA 1TFWA 4K50A 2BQRA 3RB0A 2ZH3A 1S0VA 4HLBA 4B08A 1DURA 4ICLA 1NRKA 3BM7A 2I0XA 1W26A 4H4KC 5KG6A 1RYRA 2R9LA 1NK5A 3MOZA 2VFRA 3T19A 2Y0SD 5CA5A 1B70B 3R27A 3W64A 1FDNA 5LMNF 3D68A 4I6YA 4MK7A 1RTHB 3H42A 2VG5B 4TNOA 2KHCA 1YBUA 5HO4A 3EX7B 4DPXA 1RT7A 2RDJA 1XR7A 1SJ1A 5HP1A 4WP9A 1HIYA 3ELHA 2MQQA 2MQ8A 3ZZTA 1XR6A 3A12A 1QUVA 1PJ6A 2DXFA 2ZH2A 2V8HA 4GO7X 3SCJE 2VU5A 3EDQB 1UWBB 1S1WB 1HYSA 1FVSA 2ZUGA 3CCWA 1VLYA 1FXRA 1X0PA 1LW2B 3CCRS 5HMYA 1NO8A 4KQZA 1IWGA 3MHYA 2PMHA 4OHXA 1P1TA 1U1KA 5IZHA 2K3IA 4AL6A 1ZZFA 4LF4J 2FHOB 3Q8UA 1LNQA 4G1IA 2W7OA 1TAQA 1EJ7L 3GYXB 4NCBA 1FRIA 3TUPA 4X64F 4ES1A 4KHRA 1SVDA 1TV6B 4DN9A 3M8YA 3DI6B 4GMKA 1N5QA 1GAOA 2MZRA 3C16B 1RT4B 2R2UA 1NSAA 3FMBA 1FNMA 5T7LA 2HK3A 4ZPAA 1HA1A 4G1QB 1IR2A 3LA0A 2DRBA 1UKUA 3H5UA 4IG3A 2Y8YA 3FFIA 4U7CA 2KKHA 1VQPS 3O6QA 1IKXA 2UZAA 1IM4A 3N5FA 1IWAA 2UXCJ 2FHKA 4ECZA 3CJKB 3V6KA 3W61A 1BWEA 2X7IA 3FVYA 2EFNA 4WFAQ 1OY8A 2FLPA 2Y1JA 2YKMB 1GK8A 1EKRA 1KEKA 3QZ7A 2VZ9A 3P49B 4NLQA 2V5HG 4F4AA 3GFXA 2VV5A 4WTYA 3BH7B 1PO6A 2MTLA 3E2EA 4E8UA 4PUOB 4CO0A 1XBWA 2CJKA 1WHWA 4I6AA 3T41A 1XQIA 3MMAB 3RTVA 4ELUA 4DR7J 1FRJA 3GWCA 3VGVA 1QUPA 3LH2S 2AJQA 4KB7A 4RO0A 3W5XA 4DU7A 3ZZYA 3DMJA 3V5RA 3QFWA 4M8LA 1Q4RA 4I0WA 1TP7A 2CPJA 4K4TA 1PILA 2KYXA 3W1YC 3D1HA 3VVTA 1S57A 3NL0A 1N32J 1OYDA 3AY0A 1IXKA 4EI2A 3V4IB 2Q66A 2XY5A 1JQGA 2C1EB 3D9BA 2W24A 3RU0A 4NA1A 1AZSB 4CDIA 4OYIA 2V34A 1TQLA 4DR2J 3OXLA 5A8KA 3NMAA 2LU2A 3SSQA 1D9DA 3QRPA 1XMQF 3JYTA 2N4CA 3H2LA 3KLVA 4A8XA 4X66F 4RL1A 3JTOA 2OFHX 1Q78A 1SB6A 2QE5A 4NRTA 1WEYA 2OD6A 4ZOSA 4LQ3A 2VOPA 3MPWA 1NSKL 1ITPA 2JJ4D 4WIQA 5D3GB 3GQCA 2JEIA 4ZJQA 1WI6A 1HI1A 3QSIA 1QM9A 4FVMA 1UAWA 3PG9A 1VQNS 5LJ3Y 3LPYA 5L39A 2OFGX 4G1PA 4CLFA 4HTIA 3PRDA 2QLFB 3J81j 2A2CA 3UVJB 3T1YJ 1PGZA 4NL5A 3KJFB 1HBOA 3Q2TC 3N28A 5DG7A 1S1VB 5I3QA 2WVFA 3AJ1A 4JI4F 4DPYA 1QTNB 1L5UA 3M8ZA 2CJXB 1N33F 4KC5A 4DSIA 3QBCA 3N5BA 2HWTA 3QAEA 5AE1A 4ZP8A 1TAUA 3G2XA 1R8BA 3CJ0A 4I2PA 3KNGA 1LKZA 4FS2A 2XEXA 1FF2A 4NA3A 2FVSA 4USWA 2WW8A 3MEDA 4XAKA 2KT5A 1Y00A 2IAJA 2PC6A 5CYQB 4J9OA 1FNOA 3HHLB 4JP8A 4WKRA 4HI1A 1R27B 3P3DA 4ILRA 2VHGA 3EVWA 3DOLB 3M9OB 1BC6A 3BGOP 2VC1A 2E5LJ 1S9EB 1REVB 1Q8KA 4DV0J 2HWHA 1FRHA 4OI0A 2VFSA 1ZA1B 4QR0A 1YLXA 1KS2A 3E01B 4B3SF 3DRRA 2EKNA 4O4GB 2V0NA 1U1MA 5CH7B 5H9EK 1R0AA 1JLFB 2XZWA 3EXCX 3MGJA 4ZVQB 2DXEA 5HJYA 3W9IA 3M30B 3KLGB 4USTA 3ILIA 1TKZB 2K06A 5LT5A 2K1RA 2NUHA 2M70A 3V81A 2CQPA 2W4PA 3J7ZT 4F4WA 4LIWA 3TVYA 2LEAA 2QSWA 2QX0A 1BUXA 3BREA 2FIUA 2VDHA 2BACA 3T1HF 1RAGB 3PO4A 3CCZA 3DFEA 2P9GA 2K7JA 1NKCA 4ETXA 1NB7A 1VOMA 2WVBA 4DQIA 1NDKA 1R0CB 2MZTA 3HVWA 2YKNA 5J2QB 2X1FA 3UCGA 1S7IA 2CAJA 4UUWA 2WZ1A 5KFSA 2PA3A 4DZ6A 4OZJA 5GAGU 3T3FA 4K2JA 2W9BA 1Y11A 1HBMA 1TKXA 3TA0A 4WK1A 4K4XA 1LFWA 3JAMU 1DFDA 4QWAA 1RHKB 2X3DA 1N36J 2XCPA 1RTIA 4BC9A 1RAFB 1ACMB 4LRFA 2ASDA 1H74A 2L41A 4OHVA 2G9OA 4ZVPB 2RQCA 4RUCA 7AT1B 4ZPDA 1NHVA 4X62J 3TA1A 3B4DA 1OY6A 5L8RC 3CVKA 5J2MA 4PPDA 2WSEC 4M5IA 4L3NA 3QJLA 2B8QA 2FPHX 1RUSA 3J80U 3GV8B 3IG1B 5DETA 4HT5A 3UD5A 4IR9A 1M1KT 3PO5A 4ZVFA 2ZBIA 4WXWA 4HT7A 4JBCA 2UXDJ 2WVCA 4J9UE 2I5JB 4EBCA 2F3JA 5EX3A 5A76A 3GPAA 2IA6A 1HNXJ 2OTLS 5AXNA 1H2VZ 3PJ9A 3KJVB
chains in the Genus database with same CATH topology
4WBFA 1UCNA 4DUTA 5IOLA 5CABA 1HLWA 3Q86A 3B6BA 3ZTQA 4ANEA 1NLKL 3VGSA 3VVUA 4F36A 3ENAA 1WKLA 3EICA 1S59A 1VYAA 3Q83A 2HURA 2DXDA 1K44A 4ANDA 2DXEA 4S0MA 4ANCA 3BH6B 1EHWA 1NSQA 3ZTSA 3VVTA 3FCVA 1W7WA 3EVMA 1S57A 1F6TA 1HHQA 3BBBA 1WKJA 1WKKA 1NDLA 2B8PA 1NUEA 1U8WA 3NGUA 3Q8UA 1B99A 4F4AA 1BUXA 3Q89A 3R9LA 3BBFA 4UOFA 3FBFA 1PAEX 1S5ZA 3L7UA 3Q8YA 3VGTA 3G2XA 3EJMA 3NGRA 5CAAA 3FCWA 3FBCA 3BH7B 3PRVA 1LEOA 3BBCA 3ZTRA 4UOGA 1NPKA 5C7PA 3ETMA 1MN7A 2HVDA 1BE4A 1NCLA 3DKDA 4UOHA 1JXVA 3DDIA 1B4SA 1BHNA 2BX6A 3EMTA 4KPCA 3FC9A 3NGTA 2B8QA 2BEFA 1PKUA 2AZ1A 1NB2A 3EM1A 1XIQA 1NDKA 1XQIA 2AZ3A 3JS9A 3ZTOA 4ENOA 1MN9A 3WX8A 5BXIA 1HIYA 3ELHA 2CWKA 3EE3A 1NHKL 3FBEA 4C6AA 1NSKL 3EVOA 2DYAA 4EK2A 3VGVA 1F3FA 1ZS6A 4FKXA 3MPDA 2DXFA 4DI6A 3GP9A 3EVWA 2HVEA 3Q8VA 1NDPA 3NGSA 3FBBA 3ZTPA 4CP5A 2NCKL 1NSPA 4DZ6A 4FKYA 1KDNA 1NDCA 2VU5A 2ZUAA 3GPAA 4W98A 3B54A 2DY9A 4HR2A 1LWXA 3VGUA 3FKBA 3PJ9A 4O0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WBF A;  1UCN A;  4DUT A;  5IOL A;  5CAB A;  1HLW A;  3Q86 A;  3B6B A;  3ZTQ A;  4ANE A;  1NLK L;  3VGS A;  3VVU A;  4F36 A;  3ENA A;  1WKL A;  3EIC A;  1S59 A;  1VYA A;  3Q83 A;  2HUR A;  2DXD A;  1K44 A;  4AND A;  2DXE A;  4S0M A;  4ANC A;  3BH6 B;  1EHW A;  1NSQ A;  3ZTS A;  3VVT A;  3FCV A;  1W7W A;  3EVM A;  1S57 A;  1F6T A;  1HHQ A;  3BBB A;  1WKJ A;  1WKK A;  1NDL A;  2B8P A;  1NUE A;  1U8W A;  3NGU A;  3Q8U A;  1B99 A;  4F4A A;  1BUX A;  3Q89 A;  3R9L A;  3BBF A;  4UOF A;  3FBF A;  1PAE X;  1S5Z A;  3L7U A;  3Q8Y A;  3VGT A;  3G2X A;  3EJM A;  3NGR A;  5CAA A;  3FCW A;  3FBC A;  3BH7 B;  3PRV A;  1LEO A;  3BBC A;  3ZTR A;  4UOG A;  1NPK A;  5C7P A;  3ETM A;  1MN7 A;  2HVD A;  1BE4 A;  1NCL A;  3DKD A;  4UOH A;  1JXV A;  3DDI A;  1B4S A;  1BHN A;  2BX6 A;  3EMT A;  4KPC A;  3FC9 A;  3NGT A;  2B8Q A;  2BEF A;  1PKU A;  2AZ1 A;  1NB2 A;  3EM1 A;  1XIQ A;  1NDK A;  1XQI A;  2AZ3 A;  3JS9 A;  3ZTO A;  4ENO A;  1MN9 A;  3WX8 A;  5BXI A;  1HIY A;  3ELH A;  2CWK A;  3EE3 A;  1NHK L;  3FBE A;  4C6A A;  1NSK L;  3EVO A;  2DYA A;  4EK2 A;  3VGV A;  1F3F A;  1ZS6 A;  4FKX A;  3MPD A;  2DXF A;  4DI6 A;  3GP9 A;  3EVW A;  2HVE A;  3Q8V A;  1NDP A;  3NGS A;  3FBB A;  3ZTP A;  4CP5 A;  2NCK L;  1NSP A;  4DZ6 A;  4FKY A;  1KDN A;  1NDC A;  2VU5 A;  2ZUA A;  3GPA A;  4W98 A;  3B54 A;  2DY9 A;  4HR2 A;  1LWX A;  3VGU A;  3FKB A;  3PJ9 A;  4O0N A; 
#chains in the Genus database with same CATH topology
 4YS2 A;  3DU5 A;  2WB4 A;  5DG8 A;  1TL7 B;  5L1K A;  3HD2 A;  5KFG A;  1S97 A;  1RQ0 A;  3SSR A;  3KLF A;  4OI6 A;  1RWV B;  2VFU A;  1HMV A;  2GW8 A;  5C5J A;  3K2Y A;  1VJQ A;  2QA1 A;  1EB0 A;  1DLO A;  1U0S A;  4USK A;  5CZV A;  4B3T F;  2WHO A;  4Q8F A;  5CAA A;  3W63 A;  3BGU A;  3IS9 A;  1TUG B;  3CCQ S;  1SJ4 P;  2CQ1 A;  2M3D A;  1C4A A;  3HHL D;  5GMK a;  3A3N B;  4NLG A;  1FHT A;  3LGH A;  3DLE B;  3DRS A;  1UVI A;  1SI9 A;  3EE3 A;  1P9Y A;  3SZ2 A;  1T94 A;  3GG0 A;  2HLU A;  3BN7 A;  3F73 A;  4I68 A;  2RE1 A;  1H7X A;  4U8V A;  1RGV A;  4J9Q A;  1CJT B;  4NPO A;  5LSO A;  3MPU B;  2PI5 A;  2D41 A;  2FZG B;  4R8U B;  2EBE A;  2HQF A;  3U02 A;  2JH3 A;  5E41 A;  2A6O A;  2CQI A;  2UU9 F;  4EFA C;  4EMD A;  2MQL A;  1TFY A;  3X1L B;  1PAU B;  3NCR A;  4KHP J;  1QAY A;  3V6D A;  2DTJ A;  3HI9 A;  1DTQ A;  1YSJ A;  3RRH A;  4K4W A;  5HSP A;  5KFM A;  2AJ0 A;  4M95 A;  4JYA J;  5DJB A;  1TK0 A;  3IMQ J;  1OWX A;  4RW9 A;  2RAQ A;  4DFK A;  4RBT A;  3JSY A;  3MMJ A;  5BJR A;  2N4D A;  5B0G A;  1U2R A;  4KKO B;  1WC0 A;  5IM0 A;  2KU7 A;  1FKA F;  3TNV A;  2LDY A;  1FKP B;  4IKA A;  4NA2 A;  4I6W A;  3WIV A;  3A8K A;  4IFV B;  5A8R A;  2Z0G A;  3X3U A;  4LFA J;  1N5Y A;  4M94 A;  2ASY A;  2PFD A;  4ZPW R;  2MKC A;  2ZZM A;  1JLQ A;  2FC8 A;  1VRU B;  2HBQ B;  2VPZ B;  3AOD A;  1HQE B;  2V8V A;  4OI2 A;  2UUC J;  4NAS A;  5EN1 A;  3BGR A;  1VK3 A;  2DXD A;  1AT1 B;  2HBZ B;  5B0E A;  1FJ7 A;  3MPV A;  2RF2 B;  1XNQ J;  1X5S A;  2NSB A;  1VQ8 S;  2B8P A;  2OEM A;  1B99 A;  1RAA B;  4QPT A;  1J27 A;  2CQC A;  4UUX A;  5A8W B;  2ROP A;  5KFY A;  1IKV B;  5K8O A;  4QU6 A;  3UCZ P;  3K5P A;  5HRO A;  3OLB A;  4OV1 A;  5LMU J;  2BOA A;  5HN0 A;  4C0H A;  1T3N A;  2W9A A;  3MAH A;  4RNO A;  3R6G B;  3RB3 A;  3GLJ A;  1RTJ A;  2V68 A;  2C2N A;  3MTJ A;  2HQC A;  1TR0 A;  4OYB A;  2EG2 A;  1R3N A;  1CJV A;  2G1H A;  5J1E B;  1UA1 A;  4K8R A;  1Q8I A;  1GTH A;  4FXV A;  2NQP A;  3W5Y A;  3PHE A;  4C48 A;  3HFV A;  3K8V A;  4I2Q B;  2APO A;  1T03 A;  3MUT P;  3FMW A;  1UVN A;  4FYW B;  2HW3 A;  5KFB A;  2FQQ B;  3VAK A;  2B9X A;  3MM8 A;  2MGZ B;  2QO3 A;  2K8G A;  1X4D A;  4IG0 A;  4TN2 A;  2CG4 A;  2VKZ G;  1FI4 A;  4F4Y A;  1XNR F;  3M8P A;  2F4V J;  2M4M A;  3PCO B;  3H90 A;  1QE1 A;  1U02 A;  4WTO B;  4YHH F;  1FDA A;  2Z56 B;  3G6X A;  3AQO A;  2YWK A;  1QD1 A;  2JRS A;  5HAO A;  2X3G A;  2ZD1 A;  1I6J A;  1R31 A;  1S9G B;  2VG7 A;  2Q79 A;  3BQ2 A;  3MR3 A;  3QGH A;  5LOQ A;  3GJT B;  3MEG B;  2ZKU A;  5E33 A;  4JI7 F;  1F5C A;  1U1R A;  1N0V C;  1NB2 A;  5J1N A;  2DNR A;  5F3Z A;  1RI7 A;  3ZZZ A;  1VQ7 S;  1YJR A;  2OD4 A;  4CLW A;  4YDD B;  2YNG B;  4YB7 A;  1GMW D;  4A8S A;  4C8Z A;  4HH1 A;  1KDN A;  5SUH A;  2DO0 A;  3MUR P;  3M9M B;  3UDE A;  5ETN A;  2MEW A;  2J9C A;  1VIS A;  4ANE A;  4X2B A;  1S1X A;  2J9D E;  3PDN A;  1HQ2 A;  1T9Y A;  1KQG B;  1NJI T;  2OPR A;  4IOA Q;  5DQI A;  4OYO A;  1G2E A;  5DGA A;  3DOK B;  2H4W B;  1GMU A;  3QGG A;  4H54 A;  1X4C A;  2EK6 A;  2M52 A;  1K1Q A;  2JDJ A;  2RRB A;  1S4E A;  3GON A;  1Y3J A;  3VAF A;  1HD1 A;  1WKK A;  2NXU A;  2GQQ A;  4C3L A;  4ZDN A;  4WP8 A;  1RT6 A;  2V4R A;  1QVG R;  1CVJ A;  2NS1 B;  2OGU A;  4MIB A;  2IC3 A;  4DSE A;  1R0B G;  2B43 A;  3OR1 A;  4DR3 J;  3OL8 A;  2BAB A;  3TAM A;  4A48 A;  1T7P A;  2CJY B;  1TKT B;  5F0U A;  5JUM A;  2IFX A;  5KFP A;  2IMO A;  4N8O A;  3PZP A;  2LDI A;  3QFH A;  2E9R X;  4UT4 A;  2ABY A;  1S4F A;  5KOW A;  3TUZ C;  2R42 A;  2GGP A;  4BC7 A;  3N79 A;  5F0W A;  2I8E A;  3DOM A;  2YPZ A;  1SQF A;  1T8E A;  1H6K X;  2K7K A;  2XMT A;  4N41 A;  3HSJ A;  1GEH A;  3HKW A;  4YB6 A;  4Z37 A;  4ECW A;  2MHN A;  1PYS B;  1HNI A;  3UE2 A;  3MPY A;  5SZT A;  3CC4 S;  5D6G A;  1BQN A;  2MKI A;  4Q8E A;  2E1A A;  1S6O A;  1WC6 A;  5F41 A;  3UWT A;  1Q0N A;  3KK1 B;  3KK3 A;  4KPY A;  1JLB B;  3UN3 A;  2AGP A;  1B0V A;  3SQG A;  3HZE A;  2QLJ B;  3JSR A;  4OV6 A;  3CJS A;  2HFV A;  4LJM A;  7FD1 A;  5KOX A;  2EW9 A;  2Y0B B;  2V2K A;  4JI5 J;  3C8Y A;  1S6P B;  4B17 A;  4M5D A;  1PBA A;  2VIC A;  2HHW A;  4JI0 J;  4J37 A;  2VQE F;  4PG4 A;  4PZV A;  1N5T A;  2BDP A;  4CIO A;  4RNH A;  3H98 A;  2AIR B;  2CKW A;  3TRG A;  5KFF A;  4FXW A;  4ZCM A;  4CLT A;  4L72 B;  4I7F A;  3QID A;  1NK8 A;  4MKY A;  3IBW A;  4I4B A;  2B5J B;  1RA6 A;  5K20 B;  1YVF A;  4DWI A;  3QJJ A;  4OI1 A;  2DGX A;  2RIJ A;  4NLT A;  4O4R A;  3JXO A;  3OSN A;  4LF1 A;  2FLO A;  4C8L A;  3ZZU A;  1FD2 A;  4AL7 A;  3TVK A;  4H4O B;  1RCO B;  2GIQ A;  3EVM A;  4TVA B;  1YTY A;  3ICL A;  2WVD A;  4I69 A;  3U27 A;  3MCO A;  5D4P A;  2V50 A;  3EJM A;  1FTR A;  4J90 A;  5HVH A;  2QMW A;  3MM7 B;  1Y5N B;  3C3L A;  4DV7 J;  3BSC A;  1KR4 A;  1V9O A;  3RZA A;  4N47 A;  2ZH6 A;  3FSY A;  1KHW A;  2BW2 A;  1GX5 A;  3NGD A;  3G6V A;  4NLU A;  4DX7 A;  1RKI A;  3KHR A;  2A3J A;  1RTH A;  4EK2 A;  2VG5 A;  4B02 A;  3H4D A;  4P74 A;  1YZ7 A;  4CP5 A;  4FF4 A;  3EGV A;  4V1A k;  2HZA A;  4Q45 A;  3VF0 B;  3I4H X;  1IVZ A;  1BMQ B;  2E9Z A;  3M8R A;  3OTC A;  4C8M A;  3PV8 A;  2NRE A;  4F0K A;  1UWB A;  5KFD A;  1S1W A;  2Q6C A;  2ZDO A;  4GRS A;  4DZD A;  1S1T B;  2Y3Y A;  3PIO Q;  3O8W A;  5GAE U;  1LW2 A;  3N6M A;  4IQM A;  4DV6 J;  2HGN A;  1IBM J;  2BAN B;  2OEL A;  2RS8 A;  1SV5 B;  1U09 A;  2IRY A;  1JXE A;  2CPE A;  2B56 A;  3M2V B;  3IM8 A;  1R43 A;  2QFJ A;  2WSC C;  5F8M A;  2GAG C;  1NK7 A;  5G4D A;  2LQ8 A;  1TV6 A;  3DI6 A;  1ZTT A;  2CUY A;  3C16 A;  1JXL A;  1RT4 A;  2W4C A;  1ZS6 A;  1I94 J;  3IBC B;  4ID5 B;  4P6Q A;  4LF6 J;  2QLX A;  2VPY B;  3RR7 A;  4LQ9 A;  3U1N A;  4G1Q A;  1WSV A;  5KT5 A;  3W9J A;  3FEY B;  3CJ3 A;  3UDL A;  2PMZ D;  4DR4 F;  2FHM A;  3GJR B;  4CT9 A;  1RHR B;  2XI3 A;  1F60 B;  3OTO J;  3I87 A;  2JEG A;  1YRU A;  4HHH A;  4F26 A;  5HMZ A;  3S1T A;  3CJK A;  3QT6 A;  4LR8 A;  3PW4 A;  3JAM Y;  2WON B;  5H9F J;  1HW8 A;  2HZC A;  2YKM A;  3J7Y U;  4H4M B;  3Q0A A;  1NKE A;  3I96 A;  3PEJ A;  3K8W A;  2HG4 A;  1O0P A;  2ZH1 A;  1AXQ A;  1MRO B;  1RHM B;  3AFG A;  1F9H A;  2CWX A;  3BS9 A;  1NXI A;  2HHH F;  3MAQ A;  5H1S V;  3NCQ A;  3ISN D;  3ZTO A;  4PUO A;  3F56 A;  1H72 C;  2W8K A;  2BJ7 A;  1G1X A;  1UVJ A;  2UXB J;  1EAY C;  1DZ5 A;  1QY7 A;  3TAR A;  1M5P C;  4XDC A;  3MMA A;  2BJE A;  2YH0 A;  1PG5 B;  1XTZ A;  4F50 A;  3MCN A;  4EBD A;  3HD1 A;  2UUB J;  1UFK A;  1RJJ A;  4CLP A;  6FDR A;  3POT B;  4IO1 A;  1SIZ A;  1KC8 T;  3M8Q B;  4QWB A;  4GKK J;  1AB8 A;  2DIU A;  3KLH B;  1Q7Y T;  1C1B B;  1UW9 A;  4FBT A;  4LR7 A;  2AX1 A;  3QSY B;  1QSL A;  3R7S B;  3K5N A;  4QYZ J;  1WF0 A;  3R97 A;  1F6T A;  2XG8 A;  3DYA B;  1DY3 A;  1APS A;  4DHV A;  4DQS A;  1YX2 A;  2LQB A;  1JNZ B;  3K58 A;  4OHZ A;  1OPI A;  4K5R A;  2IM0 A;  3CGI A;  3V4I A;  2HVD A;  1K8A T;  2AMC B;  1AZS A;  4KPC A;  3UO0 A;  4V19 J;  4M5J A;  2XCA A;  4PPZ A;  3H7H B;  1K0V A;  2VPW B;  1Q5V A;  2BQ3 A;  1RWN B;  5ETM A;  4LF5 F;  5EWF A;  2Z2Y B;  2RKI B;  4NE9 C;  4OJG A;  4K7Q A;  2R8H A;  4RW6 B;  4NXN F;  1RZM A;  4LF7 F;  4Y2I A;  2DR9 A;  3AOA A;  1TVR B;  5D3G A;  4FYX B;  4L76 A;  2AJ2 A;  2GX8 A;  4OI3 A;  4ZCL A;  4EYH B;  2RDI A;  2QL7 B;  2J0X A;  1HNW J;  3PX0 A;  2QV6 A;  4O3R A;  3CME S;  2Y9H A;  1K0T A;  3UVJ A;  5GAH I;  4KHM A;  5D0R A;  4WJB A;  3M2U B;  1S1V A;  1QVF R;  1N5V A;  2AU0 A;  4W92 B;  2MQN A;  4O3N A;  2DNM A;  2GMH A;  5HQ8 A;  1FRX A;  4KTQ A;  1BE4 A;  4F25 A;  4KH1 B;  2ZNY A;  2JWN A;  4O44 B;  1HBO B;  5KFN A;  2YPY A;  1RAO A;  3HP6 A;  1DQ9 A;  1X4A A;  3DHX A;  4DL4 A;  3L4B C;  2C3P A;  4DG1 B;  1KOO A;  1F3F A;  5L9N A;  4F2R A;  2CNK B;  1OSD A;  2XSJ B;  3CCL S;  4Z2X A;  4FYV B;  3CMQ A;  1X5T A;  5CYQ A;  3LAL A;  1HHS A;  3H25 A;  3J7A 1;  1RT1 B;  2F9J A;  3IN5 A;  3AB2 B;  3M6U A;  1RXO B;  3EGW B;  3HHL A;  4E98 A;  4XK8 C;  4NCA A;  3DOL A;  1TZ0 A;  1S9E A;  1CC8 A;  1REV A;  3AA8 A;  1G7C B;  2JLF A;  3E51 A;  1N54 B;  4AND A;  4DUZ F;  1S0N A;  3WQP A;  1Y10 A;  2GO9 A;  3DRP B;  1EHW A;  3E01 A;  3AHP A;  4O4G A;  2QIF A;  2HAI A;  2Z2M A;  1JLF A;  4X4U A;  4CI0 B;  1IBL F;  3M30 A;  2OIH A;  2GV1 A;  3KLG A;  1QAX A;  4DR5 J;  1TKZ A;  2VQF F;  2M9K A;  4QR1 A;  4J9P A;  5CXT A;  5D0G A;  2AEM A;  2E1M C;  4X4T A;  3RW6 A;  4Y65 A;  3MEE B;  4AE5 A;  1ZBT A;  4Y2K A;  1RTD B;  4YQW A;  2WTF A;  4LRA A;  4O3P A;  1U7L A;  2HYI B;  2C22 A;  3A8J A;  3R3T A;  1OJ4 A;  2BEF A;  1IN0 A;  1YJ7 A;  1XIQ A;  1RKJ A;  3FZ2 A;  3WX8 A;  2KFY A;  3MM9 B;  4J9V A;  2X1A A;  4DV5 J;  3R6L B;  1Q5Y A;  3MEC B;  1Z2L A;  4A8F A;  1VIX A;  2ZVI A;  5J2Q A;  1HWJ A;  1NLK L;  2QMU B;  2GJF A;  5T14 A;  5KFL A;  2GHV C;  2OSR A;  3GR1 A;  4ERD A;  2E29 A;  3HSG A;  3SXL A;  3OVB A;  4ECT A;  5FLX U;  2N3O A;  4PQA A;  3C14 B;  2MQM A;  4RUA A;  1U49 A;  3AJ2 A;  1VMB A;  4NXM J;  1Y9O A;  4HL9 A;  1EX8 A;  1JKH B;  3GIR A;  3EWG A;  1HR0 J;  1AYE A;  2Q6B A;  2RU9 A;  1FFS B;  3OHB A;  3HHE A;  2KDO A;  5RUB A;  2AJ4 A;  4X4N A;  1LW0 B;  2YX7 A;  1F5B A;  2FZC B;  1RAB B;  4CYU B;  5FII A;  2GS8 A;  1LWE B;  2JOQ A;  1CJK B;  4JI6 F;  4DXL A;  1OSC A;  3THT A;  5DS7 A;  1JX4 A;  5DZ6 A;  3IG1 A;  4ZVR B;  4HR2 A;  2DNZ A;  3AD7 C;  1RLC L;  1UJ6 A;  1KOH A;  3SI8 A;  5CAB A;  3PHT A;  3QGI A;  3OT9 A;  1KN6 A;  2VUG A;  3VGS A;  2I5J A;  3HT0 A;  5DRK A;  1DAR A;  4Q2L A;  1R7I A;  4RBU A;  5KT2 A;  2XUL A;  3KJV A;  5LSR A;  2IVM A;  3CT9 A;  4OJ1 A;  3TQE A;  3QWP A;  5K8P A;  2ACY A;  3O44 A;  4FNI A;  4I56 A;  3PW2 A;  4FS1 A;  5KFI A;  1TL7 A;  5K5M A;  4GKJ F;  2J7W A;  1RWM B;  3PRB A;  3I56 S;  3FEZ A;  1PAE X;  1XMO J;  5I3U B;  2CPY A;  4Q44 A;  5BR8 J;  3DXS X;  4LVO P;  3AA9 A;  2R3V A;  3OFE A;  3ZZR A;  4B3M J;  2EFQ A;  3R7N B;  3OL6 A;  5BYQ A;  4LF2 A;  1YQH A;  4DCJ B;  2JEJ A;  4KGZ B;  2RB7 A;  1VIO A;  1S76 D;  4CO4 A;  2V2V A;  4NYP A;  2VJU A;  4NLO A;  1WC5 A;  2XYH B;  5BXI A;  1K9M T;  4RX6 A;  4ZVE A;  2N7C A;  3DLE A;  3T5L A;  1OS5 A;  4WWS A;  1U8S A;  3BO2 A;  1NEE A;  1QSY A;  3BYR A;  1RU1 A;  4C4W A;  1MML A;  1D9A A;  4NI2 B;  2VH7 A;  1CJT A;  3OTE A;  5IXU A;  5LMN J;  1FD8 A;  3KHG A;  4R8U A;  4J5O A;  2PO4 A;  1ICE B;  3K89 A;  1GMW A;  3HXM A;  2QSF A;  3SCI E;  3FBF A;  3VGT A;  1VLO A;  1P27 B;  4IH6 A;  3TI0 A;  2IVY A;  5AE2 A;  4RW4 B;  3L95 X;  1N4L A;  3GFY A;  2QT7 A;  3VQT A;  3CD6 S;  4LT6 A;  4PG7 A;  2YH1 A;  3PW7 A;  1U6B A;  2DGW A;  4TKT A;  2XGP A;  3LP0 B;  4ED4 A;  2VG6 B;  3TZX A;  3MR5 A;  4F3Q A;  2VJV A;  1NDP A;  3MUV P;  3WC0 A;  3HMJ G;  1O8B A;  4KKO A;  1YJN S;  1TK5 A;  1IJF B;  3NXZ A;  2R8K A;  1FKP A;  2PSZ A;  3PY8 A;  4IFV A;  2H5E A;  2BJ9 A;  5JXS A;  4X64 J;  2E5J A;  4RW9 B;  3MD3 A;  1PC5 A;  2UUA F;  4WCE Q;  3CCV S;  1N8R T;  2B7B B;  1VRU A;  1HQE A;  4F3O A;  3CCM S;  1IUJ A;  4CM0 A;  4ZN3 A;  1PJ5 A;  3R1H A;  1NJX A;  2MQP A;  1JJC B;  1FVQ A;  5KFH A;  3R9L A;  5A6W A;  4ED2 A;  4YEA A;  4N8N A;  1UFL A;  3FUY A;  3QT5 A;  3G8S A;  4AQY F;  4DR6 F;  1R8H A;  4K2X A;  4JI1 F;  1ZTW A;  5A8W A;  1CJU B;  1IKV A;  1G3O A;  3K5O A;  3M2R B;  1RBL A;  4C98 A;  2IRX A;  3DC2 A;  4C6A A;  5HVF A;  2DH9 A;  1NME B;  1MSW D;  3RBE A;  4X4P A;  2RS2 A;  3KUE A;  1FJG F;  1BY9 A;  3CJ5 A;  4KYZ A;  4TU9 A;  1I51 B;  4PXC A;  4RJV A;  3FKB A;  5J1E A;  1AFI A;  4ZVU B;  3I82 A;  4QU7 A;  2F63 A;  4AYB D;  4I2Q A;  4ZLP A;  1SC6 A;  3CTR A;  4QIV A;  4LF9 F;  2B4P A;  2ZE2 B;  4K4Y A;  5DQG A;  4RW7 B;  5LXR A;  2CAD A;  4DUY F;  4ED8 A;  1S7H A;  4MYT A;  3CO9 A;  2VA3 A;  1CG2 A;  2A1B A;  2MGZ A;  4O3S A;  3MM5 B;  4AXI A;  2IDE A;  2ADB A;  4WYL A;  1XK8 A;  2W2O P;  2DNN A;  3LGN A;  3NAH A;  3VQS A;  3NG8 A;  2CQ0 A;  3PJX A;  5KT6 A;  3RR8 A;  1Q53 A;  2VA2 A;  3J7A N;  1LWC B;  3DKD A;  2FLL A;  1HFE L;  1BHN A;  4CRJ A;  5E3A A;  3KYL A;  3AD9 C;  2GA7 A;  2U1A A;  1S10 A;  3JS9 A;  2R8I A;  1S9G A;  2VL1 A;  3DXB A;  1FO1 A;  5EWG A;  2XHW A;  2BE7 D;  1ZM3 A;  2D3O R;  3MEG A;  2YQ0 A;  4OZN A;  1Z4U A;  3NY0 A;  1XEZ A;  3ZTP A;  9ATC B;  1HBU B;  1TL5 A;  2AYE A;  3IR5 B;  4K4S A;  2YNG A;  3LTO A;  2LXU A;  4IR1 A;  2CZ4 A;  4Q5V A;  5CD4 A;  3AB4 B;  2MLX A;  3QAU A;  1XMQ J;  4DOZ A;  3R1L A;  4X66 J;  4UZC A;  2CPD A;  2BBE A;  1TKD A;  1Q8B A;  5HBM B;  3DOK A;  3CJQ A;  2XLK A;  3TAN A;  4HEA 9;  3IFE A;  1IR1 A;  1UFW A;  2RHQ B;  4X4O A;  1IKY A;  3GFH A;  1HBN B;  2MDA A;  4OX9 F;  4EZ9 A;  1L3K A;  2EI5 A;  4DL0 C;  2JC1 A;  1JMT A;  2HS3 A;  3FRZ A;  1VQY A;  2AYB A;  4TU7 A;  1UJ5 A;  3RW7 A;  4CCH A;  1UVK A;  2W2N P;  3BO3 A;  5KG2 A;  1N34 F;  1E6V B;  3PFO A;  4JI4 J;  8RUC A;  3P5B P;  2QRR A;  4FKX A;  3DDK A;  2FY1 A;  1TKT A;  2G2Y A;  4PG5 A;  1X60 A;  2HVE A;  2ALY B;  1N33 J;  1RTZ A;  4UQG A;  4P2M A;  4K59 A;  1RYS A;  2N7Y A;  2DKO B;  4BBY A;  2DIS A;  3OVS A;  4NLW A;  4P75 A;  4A8Y A;  3IGV A;  3OXF A;  1OQ6 A;  4WYW A;  1IR0 A;  5FJ4 A;  1S77 D;  2RVJ A;  4KR0 B;  3N6L A;  1UVM A;  2RU3 A;  2HWI A;  3MWB A;  1XMB A;  1N52 B;  1NM2 A;  4LVN P;  5E5N A;  2MQO A;  2Y1I A;  3VAI A;  2BW7 A;  4L6V 3;  4QWD A;  4ECS A;  1B3T A;  1M90 T;  1F9F A;  1LXJ A;  1SUQ B;  3W3S A;  2MHE A;  3K7R A;  2LLZ A;  2RQK A;  4YME A;  3HKZ D;  5M2R A;  2AT1 B;  2FD2 A;  1BQM B;  2OPP B;  1MN7 A;  2MJN A;  3A3O B;  4R0E A;  3SDE B;  2HFO A;  3KK1 A;  1RHJ B;  1JLB A;  2CNL B;  4B3S J;  4TXS A;  4IH5 A;  1D1U A;  1Q79 A;  4GC7 A;  3MFH A;  5IT9 U;  3D0I E;  3L3C A;  1R6Y A;  3IR6 B;  4WU2 A;  2HBR B;  3ITH B;  1S6P A;  2FB0 A;  5EDW A;  3R2D J;  4M5N A;  4J9L A;  2HVH A;  1UA0 A;  2JX2 A;  1F2G A;  3QZ8 A;  3T1H J;  4X4S A;  4PYA A;  1RLD A;  2YQ3 A;  2V2Z A;  3PVX A;  4KFB A;  3EGZ A;  4NLX A;  5GAD I;  2B5J A;  4A8Q A;  1L3U A;  4IYQ A;  4UZB A;  2MB0 B;  4TY8 B;  2YVS A;  2Y8W A;  3G6Y A;  3HUL A;  1QDU B;  4URQ U;  3H5X A;  4H4O A;  4WP3 A;  4QBU A;  1VJW A;  4ZJO A;  2I6W A;  2UUT A;  4JV0 A;  3B8H A;  1NBE B;  1KTV A;  2NR0 A;  3VAJ A;  4KO0 B;  4PCQ A;  2V67 A;  4NLR A;  2PDA A;  2FJE B;  3A3P B;  3MM7 A;  1MN9 A;  2KO1 A;  2H5J B;  2CQD A;  2L3M A;  3SCL E;  1WSR A;  3ONQ A;  2ATC B;  3PTW A;  4W4M A;  3DU6 A;  1V3Z A;  3CJ8 A;  2QA2 A;  1YIJ S;  1CPZ A;  3A13 A;  1UPP A;  2GML A;  3G82 B;  1LWX A;  3LW5 C;  3KHL A;  2EFO A;  2UVV A;  2NXE A;  4DCO B;  3ZO7 A;  3PFE A;  3W5Z A;  2QMX A;  4XO0 A;  2KN4 A;  3S7R A;  5AJ3 F;  1O5J A;  2XGQ A;  5H9F K;  2XMK A;  4UTG A;  3BH6 B;  4NMX A;  4A8O A;  3D1O A;  2HHT A;  3TOQ A;  5ETV A;  2AKW B;  1U45 A;  4LRE A;  2DNH A;  3BPD A;  2GIR A;  4IDK B;  3ZZP A;  2DBB A;  1UEU A;  2NSC A;  3BEG B;  2R7Q A;  2JFD A;  5T41 A;  3MM6 B;  4ZLL A;  1X9S A;  1S1T A;  5C42 B;  2R7W A;  1TEL A;  1KWM A;  2NYH A;  3D6F B;  3PKM A;  2BAN A;  3HCX A;  2G2O A;  2E5H A;  3D6H B;  3LP1 B;  2ZH9 A;  2KFZ A;  1SV5 A;  2VC0 A;  2IRU A;  4DL6 A;  5DDP C;  2KM8 C;  2XSF A;  1BGX T;  3M2V A;  2ZOM A;  1ZPW X;  5KFK A;  3OLA A;  2ZWO A;  2NPF A;  4NZ6 A;  2OHD A;  2W9C B;  4XTT A;  1QSS A;  3DHW C;  5C25 B;  1F2H A;  4TQS A;  1JLC B;  4PXB A;  4ZP9 A;  1WI8 A;  3SSS A;  3P45 B;  2X51 A;  2XZD B;  3KDN A;  3NEK A;  3LO3 A;  1FJC A;  4DDF A;  1HLW A;  1H73 A;  4ID5 A;  4B3T J;  3C6T B;  4QYZ K;  1NH7 A;  2KXN B;  3ILL A;  5LSL A;  2HHX A;  1TMM A;  1KTQ A;  2J5A A;  4YDX A;  4C0O C;  2COL A;  2H65 B;  5KFR A;  4F02 A;  4OZ0 A;  3IP0 A;  3NS7 B;  4KV8 B;  4BCA A;  1LFP A;  2LMI A;  3CD0 A;  1XER A;  4MAK A;  2XZT B;  5FLX Y;  3THP A;  2WON A;  1WG5 A;  2C3U A;  2IJN A;  1KQF B;  3W8G A;  4Y2A A;  4H4M A;  6FD1 A;  4DMZ A;  4CLL A;  2BUN A;  1MRO A;  3JTP A;  2W2P P;  2UU9 J;  3DLL Q;  1M1H A;  1VR6 A;  1EZZ B;  2QZ8 A;  3RJM B;  3PX4 A;  2B9W A;  3V6H A;  2KHD A;  4NOH A;  2XQC A;  2XMM A;  2E44 A;  3KLI B;  1SL1 A;  1RB0 A;  3U1L A;  2HIY A;  1MWQ A;  1CS4 B;  1FWL A;  2P5V A;  1U24 A;  1S99 A;  2A6M A;  1U0H B;  1G6B A;  4GO5 X;  2P6T A;  3ZTS A;  5ETL A;  1HI0 P;  3POT A;  2AGO A;  1ZM4 A;  3C6U B;  3D2W A;  3M8Q A;  3KLH A;  1URN A;  1C1B A;  5HQM A;  1FWK A;  3CDU A;  4FVC A;  4ECX A;  4WZQ A;  9RUB A;  4ZVO B;  4F3M A;  4N76 A;  1V6H A;  1JWW A;  2XY6 A;  1SL0 A;  3TUI C;  3DYA A;  2PII A;  3HHK A;  4WXO A;  2JSX A;  2QTW A;  4IOC Q;  2ACM A;  3T6B A;  1QJH A;  3ADA C;  4EUV A;  1U6Z A;  4FYY B;  2AHO B;  1NHK L;  4M5G A;  5LJ5 Y;  4C0B A;  2D7S A;  4DFM A;  2F8M A;  1WD6 A;  5KTQ A;  1RAC B;  2BMB A;  4BHQ A;  2FY8 A;  4USI A;  2OML A;  3NGS A;  1HWI A;  5I42 B;  1ARO P;  4I67 A;  3CD7 A;  2ZUA A;  4WU3 A;  2IBK A;  3ZFV A;  5KFX A;  3AD8 C;  3D3B J;  3BYP A;  2V4J B;  1T9W A;  4DSL A;  3B6B A;  4PAA A;  5MAO A;  2RKI A;  1KQS R;  3ENA A;  3GIL A;  1VQO S;  4RW6 A;  2B9E A;  2B9Y A;  1TVR A;  2QG9 B;  3MCM A;  2ZWP A;  4ZP6 A;  2FVR A;  3H40 A;  1Z2Z A;  1D3W A;  2MKJ A;  2C3O A;  4JV5 F;  2EWH A;  1G4C A;  3NRB A;  3EDR B;  1H0H B;  1DTT B;  3G87 A;  2KZM A;  3PRV A;  4YY3 F;  3TJ9 A;  4DV1 F;  3M2U A;  3DLK B;  3ZTR A;  4Y3C A;  2AX0 A;  4URS A;  1MU2 B;  3M1V B;  2YNF B;  3LPE A;  3W2V B;  3W7B A;  2KG1 A;  1AFJ A;  4U7U K;  3OFG A;  4F0H A;  4JI2 F;  3US5 A;  2BRL A;  4O44 A;  1HL6 A;  1XNR J;  4RUB A;  2R2T A;  4QWE A;  2YWG A;  2XWY A;  1YIT S;  2YKA A;  5GME A;  2PT0 A;  1SJR A;  4DG1 A;  4YHH J;  3CIZ A;  2XSJ A;  3C19 A;  1SJQ A;  4RBV A;  3EIC A;  2X1G A;  4QJV A;  5AT1 B;  4LSN B;  1RT1 A;  5KFW A;  3BSA A;  2J0Q D;  2C3M A;  2CFX A;  3FK4 A;  3LF0 A;  2DPJ A;  2AW0 A;  2R8G A;  4ED0 A;  3MFI A;  1R89 A;  4USU A;  2E1R A;  4JI7 J;  3OD2 A;  5KG1 A;  3D6M B;  2KFN A;  1KKH A;  3HO1 A;  3NCP A;  4CH7 A;  4NRU A;  5I3P A;  3V6J A;  3DRP A;  3H0P A;  2ZIT A;  4DQR A;  3F41 A;  3M6W A;  4F0M A;  4M5L A;  4NEY A;  3PYE A;  3KNA A;  1KVK A;  3NGT A;  4WK3 A;  3NGK A;  3LQV A;  5JMN A;  2BE9 B;  4E2F B;  3MEE A;  1RTD A;  2IM1 A;  3P6Y C;  2B6A B;  5EGY A;  3LWL A;  3G8T A;  2J0S D;  4LSL B;  1HPZ B;  4ZHR B;  3ET6 B;  1NPP A;  1VCT A;  4A4J A;  1YKW A;  2YKQ A;  3CW2 C;  2C2M B;  1V3R A;  1HQU B;  2NXC A;  3MM9 A;  4DUT A;  1Y3K A;  1CQN A;  3MEC A;  4B3R F;  3ULH A;  2VBZ A;  2YQ1 A;  4CM2 A;  3P96 A;  5HAN A;  3LP2 B;  2EEY A;  4ZCI A;  1NSQ A;  2C2E A;  2XYP B;  4RW8 B;  4C7Q A;  2ZBQ A;  1JIH A;  4URG A;  1KSP A;  5L1J A;  3CC7 S;  3Q89 A;  4LBH A;  3CSK A;  1VC0 A;  4IFY B;  4IUF A;  3Q8Y A;  2W01 A;  3OTB A;  2OMO A;  1JJ2 R;  4TLQ A;  3C14 A;  4LIR A;  5J2P B;  1JJ4 A;  3FRY A;  1SCJ B;  2R7S A;  1JKH A;  4ZVT B;  4F7V A;  4U96 A;  4V19 X;  4CLK A;  1WOS A;  3QPI A;  1B7Y B;  2F1F A;  2R4F A;  3TA2 A;  2HEK A;  1KVJ A;  1FES A;  1LW0 A;  1YJV A;  3OTD A;  4QIF A;  1C2P A;  3HF5 A;  4CYU A;  3KUG A;  3BPS P;  4IQX A;  1LWE A;  1M0S A;  1CJK A;  4F4Z A;  4F36 A;  2OO4 A;  1JK9 B;  4YB1 P;  1F5A A;  2CQ3 A;  3N0V A;  1D8Y A;  2M5Y A;  2ZKT A;  3V2U C;  3W66 A;  2MLY A;  3JSM B;  4DV3 F;  2QFI A;  3IRW P;  3KK2 B;  5KT4 A;  2J8S A;  2VQE J;  1KLN A;  4FPR A;  1FE4 A;  3RYL A;  2QJ3 A;  4P2X A;  1M5S A;  3GFZ A;  1JLA A;  2V4Q A;  4Q43 A;  2P2C B;  5I3U A;  3NS6 A;  4NLP A;  3AT1 B;  4RNN A;  3EPI A;  1DBD A;  2FGC A;  4IOB A;  3TX8 A;  3R8Y A;  4U6P A;  5DZ7 A;  3OW2 R;  4OZ5 A;  5CCL A;  3WX4 A;  3A4T A;  3NWR A;  1AUS L;  1FFG B;  4WBF A;  2LQ5 A;  2ZEJ A;  2MYF A;  3VVU A;  1IBK F;  2HQI A;  4Z7C A;  5A2Q U;  4ZLJ A;  3QMQ A;  3VZI A;  3FSX A;  1VDH A;  3RBD A;  5K8N A;  2D74 B;  4DV4 F;  4NI2 A;  2N82 B;  2C2R A;  3T6J A;  1L3V A;  2J9D A;  5K14 B;  2M88 A;  1F1B B;  4J7C A;  1HAR A;  3FCW A;  5D15 A;  1D0E A;  2YX4 A;  2MZ1 A;  2WCX A;  1PCA A;  1VC5 A;  2FTR A;  4KE5 A;  5MLC V;  1VHI A;  5C2C A;  3KOA A;  2LQJ A;  2WOM B;  5ETS A;  3H59 A;  1GXL A;  3HHN B;  3IWX A;  1B0T A;  3BGL A;  5BYR A;  4RW4 A;  2Q1L A;  2HPU A;  2XO6 A;  3LOU A;  3TJA A;  2CNN B;  4DL2 A;  3I31 A;  2IM3 A;  2BR0 A;  1H2U X;  1SPB P;  4CO5 A;  4BS2 A;  3LP0 A;  3MCS A;  2VG6 A;  2OPQ B;  3Q86 A;  1DQA A;  3AH6 A;  2XLI A;  5B7W A;  2VOO A;  5IT9 Y;  3JTN A;  1M1G A;  2HRY A;  5DDO C;  2RIL A;  3MTK A;  3C46 A;  4FYD A;  3HX9 A;  4I1T A;  1HHQ A;  3VAG A;  3C2P A;  5KFZ A;  3O3L A;  2AP6 A;  5DDR C;  4UOC A;  3OXG A;  1S5Z A;  4DPW A;  1X8D A;  2O5D A;  2MMY A;  2DCL A;  1OY9 A;  1W2I A;  1VRT B;  4BWJ A;  1J5O B;  3AQP A;  4LRD A;  1VQ9 S;  1SKS A;  4LF8 F;  3FZB A;  1ZAX A;  3KJN B;  2O67 A;  3KHH A;  4DR4 J;  2KB2 A;  1N0U A;  3UR0 A;  2XMJ A;  4LFB F;  1CJU A;  1UWA A;  1FDD A;  2QGF B;  3KJQ B;  3M2R A;  1TL1 B;  3IRX B;  4N77 A;  4ZLN A;  2YWF A;  5IWA F;  2HHU A;  2NCK L;  1S6U A;  2DNL A;  3HM9 A;  3H20 A;  4QIE A;  4ECU A;  1N6Q B;  2RH3 A;  1VBZ A;  1EP4 A;  5E3R A;  4QYR A;  3ZZO A;  2ROG A;  5FD1 A;  2FJV A;  2IBO A;  1XN9 A;  3KDO A;  2B0G A;  1CSJ A;  2Y1R I;  2J7K A;  2HS0 A;  5HI7 A;  3IGN A;  1CC7 A;  2HHH J;  1WHX A;  3G96 A;  2YWE A;  3TVZ A;  2DB1 A;  4L3K A;  4CO1 A;  2FUG 9;  2QC3 A;  4ZJL A;  3DDN A;  4Z7Y A;  3ENQ A;  2ZE2 A;  3EZO A;  4RW7 A;  2EC2 A;  3EZU A;  1RCX B;  5A6P A;  3QAT A;  3GMG A;  2POK A;  2GVZ B;  3EYZ A;  1NND A;  3MM5 A;  2D69 A;  1QLN A;  4CH0 S;  3HJF A;  3HLU A;  2CVI A;  2FJD B;  4ED1 A;  1IQT A;  2ZBC A;  3IR7 B;  3WZ0 A;  2AD9 A;  2GJ2 A;  2DPI A;  2UVU A;  1RAJ A;  2B4O A;  3JSB A;  5CQG A;  1LWC A;  1K73 T;  3IBF B;  4MH8 A;  2E1P A;  4DBQ A;  1C0U B;  4YB5 A;  4MK9 A;  3RAM A;  2NYI A;  1S9F A;  4W98 A;  2ZC3 A;  5ETO A;  1FCA A;  1WC1 A;  4C11 B;  3SYZ A;  4O0N A;  3RAX A;  4PRF A;  3W62 A;  2XS5 A;  3SBM A;  3H4B A;  1C1C B;  4QQB A;  4CWB A;  1HBU A;  4UY8 5;  4A8W A;  2OPS B;  4J9K A;  2VON A;  1S79 A;  2HS4 A;  2G0J A;  4EYI B;  3UDC A;  1S12 A;  3HVT B;  4KRW A;  4LBP A;  5KG3 A;  1NDL A;  3UDV A;  2BV3 A;  2EK1 A;  4CLU A;  2JEF A;  4LF5 J;  4DSJ A;  2MSS A;  1T9T A;  1KVI A;  2A18 A;  1KP6 A;  2MJU A;  1NPK A;  3P5T L;  4U95 A;  4NXN J;  5HBM A;  4LF7 J;  2R8J A;  2RNE A;  2CZV C;  2XLJ A;  2D1C A;  3RGI A;  3PIP Q;  5HK4 A;  3BV8 A;  2ZHO A;  1S1U B;  4Y00 A;  5L1I A;  1HBN A;  1FTC A;  3SIP B;  3VZH A;  1U4B A;  4Q0B A;  5C24 B;  3BJY A;  1EKS A;  3FSI A;  2KZZ A;  1XR5 A;  5DLG A;  4ZIT A;  2E66 A;  1Q1K A;  3C15 B;  3GP9 A;  2EVZ A;  1RWP B;  2Z4P A;  3ENW A;  2DNO A;  1U25 A;  2VDI A;  1X4G A;  1E6V A;  4X4Q A;  1IKY B;  3IM9 A;  2H9Z A;  4WFX A;  2H54 B;  4P9S A;  5ETR A;  5CYM B;  3HDS A;  2HUR A;  4OQJ A;  1FT8 A;  1B64 A;  3O2I A;  1X4F A;  3CE8 A;  4QIW D;  2ZJR Q;  3DLB A;  3VAL A;  2P9E A;  4Y28 C;  3V4M A;  4QPX A;  3CMA S;  1TL4 A;  5AXK A;  4OIX A;  5GAG I;  3GCW P;  3N4W A;  2ZM6 F;  1NZA A;  3FCH A;  3ZZ0 A;  3QRQ A;  4YFU A;  4CTA B;  4RR5 A;  2EFP A;  1UET A;  2KYZ A;  1HI8 A;  3I9Z A;  4U67 Q;  1S6Q B;  4OYX A;  2I9S A;  5C2G A;  2J8A A;  1SH0 A;  1YZ6 A;  1SUQ A;  2YWW A;  2KH9 A;  1H2T Z;  2HQ3 A;  2SXL A;  3HVA A;  1BQM A;  2OPP A;  3GTY X;  5IQ6 A;  5F8L A;  3PR5 B;  3I32 A;  3SDE A;  4ECY A;  4DUZ J;  4O0I A;  4K0K J;  2C42 A;  5IS2 A;  1TMJ A;  3TUJ C;  1T95 A;  1KRP A;  1JJH A;  2FVQ A;  4KGV B;  3QJP A;  1GH8 A;  5D4N A;  1IBL J;  4LRC A;  4IRK A;  3ITH A;  4A46 A;  2VQF J;  5CCM A;  1C4C A;  2CA9 A;  2HQD A;  1YGY A;  2XC9 A;  1YWX A;  2UVW A;  3M4X A;  3H5S A;  5J1P A;  1J5E F;  4F4X A;  2DNK A;  2QLB B;  3KFW X;  4ATN A;  1PC4 A;  5JVG Q;  1C0T B;  1AUD A;  3TYT A;  1UPM B;  2CJ9 A;  2MZS A;  3MMB B;  1Q7L B;  4KT0 C;  2R7V A;  3OFH A;  4B9T A;  3CCJ S;  3TZW A;  4CQ1 A;  5CHC B;  4JI3 F;  3TX0 A;  3EGN A;  2YWH A;  4TY8 A;  2DVI A;  3RUB L;  4NLY A;  2PE8 A;  4DL7 A;  2EPI A;  4WFZ A;  4DS4 A;  4JI8 F;  5KG0 A;  5B08 A;  4I64 A;  2AEJ A;  2DGV A;  4KFB B;  2AGQ A;  3SFG A;  3FJ2 A;  4KO0 A;  4RNM A;  1FX2 A;  3W65 A;  3VR1 A;  1RHU B;  5E0O A;  2LP4 A;  3FGV A;  2D3U A;  5B0A A;  5CYJ A;  5ITH A;  5KG5 A;  3OUY B;  1B7F A;  3CPW R;  2ZBR A;  3MI7 X;  3GV7 B;  3KUH A;  2G0I A;  2LA4 A;  5K9F A;  2IPO B;  3G82 A;  3DM2 B;  1SH3 A;  1OPZ A;  2DGO A;  3TR5 A;  1UZD A;  4M1K A;  2AEF A;  1HNZ F;  1PIE A;  4FPI A;  2KTQ A;  3PX6 A;  2YKO A;  4QW8 A;  4LUB A;  1RA7 A;  4OYA A;  5G0R B;  4JI6 J;  2RSQ A;  3HK2 A;  2PMW A;  4XPE A;  1UW4 A;  2W2M P;  4IDK A;  1ZZN A;  4WPA A;  3AOB A;  3B78 A;  1M5V C;  2DEI A;  3CDB A;  3MM6 A;  3T5K A;  2J9E A;  2I38 A;  2HNY B;  2HNZ B;  1B0P A;  5C42 A;  4KIA A;  3GCX P;  5A0Y B;  4R25 A;  3NNC A;  4ECR A;  3DRY A;  4HDH A;  3GIJ A;  3UNG C;  1K47 A;  4WE1 B;  3M9N B;  2QA4 S;  3LP1 A;  4HYK A;  3KG0 A;  5D4L A;  4DN0 A;  2GNK A;  4GKJ J;  2VKR A;  2I1R A;  3L7O A;  1IQZ A;  1S0O A;  5KFC A;  2W9C A;  1NKB A;  5C25 A;  5L46 A;  1JLC A;  3ILJ A;  3GJQ B;  3Q24 A;  3HSZ A;  2CQG A;  2ZOG A;  1P8G A;  2DH8 A;  4H4K A;  2FHJ D;  2IJR A;  3GIK A;  4USJ C;  2KJW A;  3HHL C;  3C6T A;  1JLE B;  4UQT A;  2BOP A;  3K5L A;  1WHY A;  3L09 A;  4LFC F;  2V8P A;  4ZKA A;  4ZIV A;  1WWH A;  5DM6 Q;  3VAH A;  4OYP A;  5HL7 Q;  4G6V B;  4CZC A;  4RWW A;  4YP3 A;  5ETP A;  3SFU A;  4KV8 A;  3N01 A;  2IHR 1;  3D3C J;  3B4M A;  3G4S S;  2BA9 A;  2V8D A;  4DPT A;  4ENO A;  1R8C A;  2AV5 A;  2HK2 A;  3KG4 A;  4DI6 A;  2ERR A;  3CD5 A;  3D5M A;  3BQ0 A;  3JQM A;  2D3Z A;  1UVL A;  1WEL A;  2XMV A;  1KON A;  2F8E X;  1NJY A;  1RT3 B;  1KNZ A;  4PWD B;  2HFU A;  3R5A A;  3VWS A;  3BKF A;  1U2F A;  4GC6 A;  4WZM A;  2QL5 B;  3THV A;  2CPH A;  1LK7 A;  3D1Q A;  2VFT A;  4ZMM A;  3KLI A;  1PJ7 A;  4C8Y A;  3S6E A;  2Z8Q A;  2JVO A;  2QLW A;  1CS4 A;  5KG7 A;  1X4B A;  1FFW B;  2GO8 A;  1U0H A;  2BE2 B;  4KAI A;  3A8I A;  4ECV A;  3KLE B;  4QW9 A;  3PXG a;  5I4M A;  2GVD B;  1VQ5 S;  1XWL A;  2B4V A;  1M5K C;  3I5B A;  3PM9 A;  3C6U A;  4X65 F;  4ER8 A;  5F8I A;  4DPO A;  4HHJ A;  1NJW A;  3I5C A;  4DPU A;  5F8J A;  2OEJ A;  1F9E B;  3KG1 A;  1RAD B;  4F67 A;  1SQE A;  3ENV A;  3QIP B;  5E7O B;  4DFP A;  2FYX A;  2IYG A;  2UUA J;  4EBE A;  1YBA A;  1RT2 B;  1MMN A;  1LQ9 A;  4DV2 F;  3D7S B;  2JNJ A;  1T9X A;  4R5P B;  1UEV A;  4HAC B;  1SC1 B;  3UN2 A;  4DL5 A;  2HSE B;  3ILO A;  1VI7 A;  5I42 A;  2OSQ A;  4DR1 F;  1S59 A;  4NLS A;  3LAK A;  3PEH A;  4K4Z A;  1T05 B;  4AQY J;  2LEC A;  4DR6 J;  2HMI B;  5HMW A;  4JI1 J;  4CLY A;  2V4J A;  1VQS A;  4ECQ A;  2RHS B;  3VTI A;  3GZ7 A;  1U48 A;  3CUL A;  3NBP B;  3OR2 B;  2E7V A;  3NGU A;  2IJF A;  2BJ1 A;  4NCG B;  1O6X A;  1EIY B;  1FJE B;  5GVQ A;  4ED6 A;  4B9N A;  4PWW A;  3GG1 A;  1FJG J;  3PYF A;  2FVP A;  2DGU A;  2V94 A;  4NZ0 A;  5A2Q Y;  3IWN C;  2LYV A;  4D3G A;  1P6T A;  1DTT A;  3DDI A;  2NZ4 A;  5KG4 A;  2HRT A;  1O51 A;  1MG7 A;  1FA0 A;  1NK0 A;  4DL3 A;  3DLK A;  3EPG A;  2BJD A;  3FBE A;  2RML A;  4NEZ A;  2AWZ A;  3TEG A;  2DNG A;  1MU2 A;  4LF9 J;  2XMU A;  3M1V A;  3DLH A;  1DRZ A;  4DUY J;  1RWW B;  2YNF A;  1WG4 A;  3W2V A;  3KMS A;  1AW0 A;  2IM2 A;  1YJW S;  3QYY A;  4B9L A;  1YJU A;  4PQU B;  4OJ3 A;  3B82 A;  3M6X A;  2OP5 A;  4PXE A;  3R5B A;  1PSD A;  1RWK B;  3TW0 A;  2AYG A;  1RBO B;  4AXJ A;  4ZN1 A;  1U2C A;  2J76 E;  4AFF A;  1IM6 A;  2ZC4 A;  5IC6 B;  2RQ4 A;  2ZZN A;  1RWX B;  1X9M A;  1ROF A;  1Y4Z B;  4LSN A;  3M7V A;  3ZC4 A;  3CF5 Q;  3GV5 B;  4MTP A;  8AT1 B;  3TQ1 A;  2F9D A;  4FF3 A;  2WW4 A;  2GIF A;  1ZOT A;  2D3O 1;  2HVZ A;  1FK9 B;  3SV3 A;  2BKO A;  4KSE B;  1JB0 C;  2C2O B;  3U1M A;  4MFB B;  4LF4 F;  2CQB A;  3BO4 A;  2LFV A;  4PAB A;  3EVO A;  2VAS A;  4O23 A;  1HWK A;  2C3Y A;  4MK8 A;  5KT7 A;  4QWC A;  4YOE A;  4HI2 A;  5EX0 A;  4JB8 B;  1Q8L A;  1S0M A;  2FLN A;  2ZH5 A;  2R7T A;  4OYW A;  1WOP A;  2B6A A;  4K0K F;  2WK4 A;  4LSL A;  4L75 A;  1YK9 A;  1HPZ A;  1YBT A;  4ZHR A;  5IOL A;  3ET6 A;  3D4J A;  3NKY A;  5B0B A;  4OX9 J;  1U1Q A;  1HQU A;  5ETK A;  2FJA B;  4ED3 A;  1D09 B;  1U1N A;  2ATL A;  1YG0 A;  3LUY A;  5DDQ C;  1RT5 B;  1VQ6 S;  4ITS A;  1BQX A;  3FNN A;  1NZ8 A;  2KVQ E;  4HH0 A;  5DM7 Q;  3NNA A;  3A8E A;  4LMZ A;  1LWF B;  3OJU A;  4X4R A;  1N34 J;  2UXC F;  3LP2 A;  1I5O B;  3RAQ A;  3IO1 A;  4RW8 A;  2R7O A;  3OQ2 A;  4L73 A;  4IFY A;  1DJ0 A;  2BKN A;  2J0W A;  2O66 A;  3PW0 A;  1NU4 A;  3NS5 A;  2R7X A;  2KRR A;  3VAM A;  2OUG A;  4HDG A;  5IT4 A;  5J2P A;  3N9U C;  4OX7 A;  2GQ2 A;  2LA6 A;  1EQM A;  4KBI A;  5DQH A;  2RDD A;  1YRX A;  2MPU A;  2GMJ A;  3PAC A;  2WB1 D;  3DCA A;  3CJ2 A;  3KTQ A;  4WFN Q;  3CCE S;  1GFW B;  1BLU A;  5F9L A;  3BR8 A;  4C3M A;  2CRL A;  4D3H A;  2IY5 B;  4RWX A;  3DGP B;  1SL2 A;  4DR7 F;  4C8N A;  2W7A A;  3JQK A;  1Y5I B;  4J9S A;  2Q43 A;  1H7W A;  4CT8 A;  2RT3 A;  5L1L A;  2H1Y A;  1Q16 B;  3DN9 A;  5F8H A;  3CUN A;  2DO4 A;  2F8H A;  2G4B A;  1Q86 T;  3D67 A;  2XY7 A;  5D77 A;  1FXL A;  2ASL A;  1EQ0 A;  1RSC A;  2R2R A;  1V5I B;  4DJB A;  3JSM A;  1LEO A;  1R8P A;  1WDD A;  2YY3 A;  4X4V A;  5J2N B;  4YR0 A;  3KK2 A;  1CUL B;  3HT3 A;  2XI2 A;  2EC0 A;  3KKF A;  4BWM A;  4WFB Q;  2O3D A;  2ZJQ Q;  1N32 F;  3MZI A;  4KH0 B;  5GAE I;  5L38 A;  4M5H A;  1P9Q C;  2DYA A;  4MKV A;  5HLF B;  1RWO B;  3HZG A;  1R8A A;  5ETT A;  4DR2 F;  1FEH A;  4L74 A;  5E3C A;  4U7U D;  3SQO P;  1Q81 T;  1FNX H;  4KGX B;  3NWG A;  5ADZ A;  5EWE A;  4DLG A;  1JLA B;  1UTA A;  4MMO A;  4WII A;  2QYG A;  3L7P A;  1K44 A;  4TY9 A;  4IO9 Q;  5E2Q A;  1NH8 A;  4USM A;  2GQC A;  4ID8 A;  2L9W A;  4QCL A;  2X1B A;  1KLM B;  3GSD A;  3A1Y G;  1ZA2 B;  2Z57 B;  2ROE A;  2YNH B;  5CD4 H;  3DLG B;  3W2W B;  4XDD A;  2VBW A;  1HNV A;  2H48 B;  3T1Y F;  1VQ4 S;  5IV3 A;  4RU2 A;  3JQJ A;  5B0C A;  2GC8 A;  3H2V E;  1JLG B;  1X5O A;  1PYT A;  4B3O A;  2E7X A;  5K14 A;  2G0C A;  2CPX A;  2OJ3 A;  1M5O C;  4Y2C A;  1T11 A;  1VGY A;  4GVL A;  1W2B R;  3QLH B;  4R0J A;  4OZ1 A;  2HND B;  1RU2 A;  2XTJ P;  4WKY A;  2HGL A;  4MYU A;  5AJ3 J;  2NXN A;  2DT9 A;  4KY3 A;  2WOM A;  1F0X A;  3AAW B;  5D4O A;  2GCF A;  2V2Q A;  3J7Y I;  2DR7 A;  2E7W A;  3M8S A;  2DY9 A;  2J6T A;  3I0R B;  1WEX A;  3WDO A;  2HFS A;  3D66 A;  5KFA A;  1FDB A;  2YTC A;  2QEX S;  2ADC A;  4XIU A;  1FWP A;  3QT7 A;  4AD6 A;  3IAS 9;  1WF2 A;  4F2S A;  2UUW A;  2IMW P;  2OPQ A;  4Y6I A;  1RE1 B;  3D0H E;  2E5L F;  2DGS A;  3CDE A;  1BWV A;  2WBR A;  3C66 A;  4DV0 F;  1YJ9 S;  2M0G B;  2V63 A;  2LEP A;  2ILZ A;  2W7P A;  5KFQ A;  4ZIW A;  2A2D A;  3GIM A;  1BXN A;  2HIQ A;  2B3T B;  3OFF A;  1QTM A;  4P71 A;  3OHA A;  2JLE A;  1NCL A;  3R5J B;  3P4U B;  3KWM A;  4DLE A;  3K59 A;  2YNI B;  2KG0 A;  1Y5L B;  2GHP A;  5EHH A;  3BZQ A;  1SH2 A;  2XNR A;  1FKO B;  2VBX A;  1VRT A;  3W9H A;  4ED7 A;  2D9P A;  1WAC A;  3J7Z 5;  4F04 B;  1J5O A;  1MMD A;  4OYM A;  2LXI A;  3WHI A;  4P7T A;  1NSP A;  5GAH U;  3PKY A;  1TL3 B;  5KT3 A;  2F5G A;  2WBM A;  3R5G A;  1HW9 A;  4NZ7 A;  1RAE B;  4ILL A;  5M2P A;  1TL1 A;  4B9V A;  3IRX A;  1YI2 S;  5CZX A;  2FJX A;  2DGT A;  1HD0 A;  3QNW B;  1N88 A;  1N6Q A;  1MW7 A;  5HAT A;  1FRK A;  3D28 A;  1V5V A;  2PFF B;  3G86 A;  5FDL B;  1E6Y B;  3DLJ A;  4ZS6 A;  4CLS A;  2RQM A;  1FER A;  3DRX A;  3I0S B;  4ILM A;  2DHG A;  4NML A;  5GMD A;  2MKS A;  2RUS A;  1X31 C;  3ISN C;  2OTJ S;  4OZL A;  1EET B;  2VFV A;  4ZVH A;  3Q8Q B;  2NPI A;  1N36 F;  3VCD A;  3K57 A;  2ASJ A;  2LXF A;  3M6V A;  1WC3 A;  3BGF A;  1EP4 B;  2CG8 A;  2L48 A;  2L08 A;  2D9O A;  2IDL A;  3EMT A;  4UF4 A;  2GVZ A;  4FF2 A;  2BZ2 A;  2ZOF A;  2MKY A;  3NOG A;  1U26 A;  1P1L A;  3GB0 A;  2E9T A;  3Q8R B;  3UI3 A;  1ZPV A;  2DR8 A;  3CO0 P;  4X62 F;  2IIH A;  3K17 A;  3EXY A;  2XS7 A;  2VBY A;  4NLV A;  1UL3 A;  3NOC A;  4MT1 A;  3HHD A;  1KFS A;  1BD6 A;  3MEK A;  1ZM2 A;  1VBY A;  2G1D A;  1VQL S;  4RNF A;  1C0U A;  4NX9 A;  2MZJ A;  1Y7P A;  3LAM A;  2BRK A;  4C11 A;  3M32 B;  2CJB A;  3PR4 A;  2UXD F;  3QO9 B;  2P8I A;  3T5J A;  3I55 S;  3BSN A;  4DSK A;  1C1C A;  2BYC A;  1IKW B;  2QL9 B;  3OL9 A;  2A10 A;  2JZ5 A;  2OPS A;  1HNX F;  1U8W A;  1H38 A;  3MUM P;  1ELO A;  1SJF A;  4GVB B;  1RIS A;  3JB9 k;  2CPI A;  4EU0 A;  3OSP A;  3OBI A;  1ZM9 A;  5HJX A;  4C97 A;  3HVT A;  2ZJP Q;  4NYZ A;  4O3Q A;  4CO3 A;  4DF4 A;  3ISZ A;  1I3O B;  4A47 A;  1RWU A;  5D78 A;  4YUD A;  3TP2 A;  4K5S A;  4IRD A;  3MAA B;  4RKU C;  1S72 S;  3MMC B;  1EAR A;  2HHS A;  2PEH A;  4U8Y A;  4PKD B;  4OI4 A;  3IA0 A;  4MKB A;  1S1U A;  1A6L A;  2LVW A;  1N5S A;  1X4E A;  5C24 A;  4F4K A;  4JV5 J;  1TTH B;  1NPR A;  4KGK A;  4IH7 A;  2V8G A;  4PWU A;  5IQQ A;  2XNQ A;  3CJ4 A;  3IC1 A;  4C8O A;  3C15 A;  4Y2M A;  5IFM A;  2HFN A;  1GMV A;  3R2C J;  4YY3 J;  4ICL B;  4DV1 J;  4DF8 A;  3J81 U;  2ZZT A;  3MDF A;  1MLA A;  2M2B A;  4Q0B B;  1SKR A;  2Z30 B;  5KAK A;  4OX8 A;  5CYM A;  3Q2S C;  2J7U A;  4B9M A;  7FDR A;  2CPZ A;  3NMR A;  1S49 A;  2BXJ A;  2KRB A;  5KFJ A;  4JI2 J;  2Z2Z A;  1NK4 A;  2R7R A;  2KT3 A;  4RZR A;  1RT7 B;  4DSF A;  5HP1 B;  2AF6 A;  3H2U B;  2U2F A;  2RRN A;  4CTA A;  4OHY A;  2FHJ A;  4KHP F;  4C2M A;  2A0F B;  2CXE A;  4EWT A;  4CO2 A;  4P72 A;  1S6Q A;  3AXM A;  3GYN A;  2N3L A;  1OYE A;  3QT8 A;  2EFG A;  2XM3 A;  1WG1 A;  3MPD A;  1HYS B;  3Q8V A;  3L9Z A;  4JYA F;  5JJB A;  3HFZ B;  4BDP A;  3BSO A;  2Z58 B;  2EKY A;  1L3T A;  2YXL A;  3MXH P;  2CDR B;  3HFK A;  3GU0 A;  1V3S A;  4C3K A;  3NNH A;  2F40 A;  4ANC A;  4P7V A;  1VS3 A;  1W25 A;  4LFA F;  4KGM A;  1YRT A;  3GYG A;  1URR A;  1QAI A;  2NUU G;  1T9U A;  3LWM A;  2XWX A;  1MWY A;  4OX6 A;  1C0T A;  5T7L B;  3QGP A;  2UUC F;  3MMB A;  4PEO A;  4AUK A;  3AXK A;  2DCU B;  1ZAW A;  3FQL A;  3D0G E;  3KMQ A;  5HMX A;  4X84 A;  3FC9 A;  1XNQ F;  4IG3 B;  3HJV A;  3FQK A;  4CLZ A;  3FFI B;  4B3R J;  2LKZ A;  2VF3 A;  5F9N A;  1IKX B;  3CIM A;  3SCK E;  2XS2 A;  4ZPC A;  2IVF B;  1U1P A;  1LOU A;  2MXY A;  2YKP A;  5LMU F;  3K0J A;  1NAQ A;  1WOO A;  1KHV A;  2ZVS A;  1FXD A;  4ES2 A;  3VHQ A;  3FEX B;  1F3V A;  4QIG A;  3VGU A;  2Y1L B;  4F8R A;  1CEZ A;  1GXU A;  3UFC X;  3OL7 A;  1VFJ A;  1I1G A;  3OPK A;  1U1O A;  4CH1 A;  3H5Y A;  3OUY A;  2W2Q P;  2OLW A;  3CJT A;  4P2S A;  2OEK A;  5KFU A;  4Q7A A;  1S48 A;  4P2F A;  1GXT A;  3J80 Y;  3GII A;  3DM2 A;  2IYI A;  4UOF A;  3CCT A;  3SMZ A;  1LK5 A;  5L9X A;  2WSF C;  2P6S A;  2M7S A;  5G0R A;  4ZK7 M;  4B9U A;  1JNR B;  3EZ5 A;  2KXH A;  4J9R A;  1SJ3 P;  1YJT A;  2OKQ A;  2F4V F;  1PKU A;  2KVI A;  1T9V A;  3LGM A;  1SXL A;  4P73 A;  3DMJ B;  2DIV A;  1WHV A;  4LR9 A;  3T1A A;  3MD1 A;  3TZY A;  4HVZ A;  2HNY A;  2HNZ A;  4YR2 A;  4DV3 J;  5A0Y A;  3UNY A;  5DG9 A;  2M8D B;  4DEZ A;  2RJZ A;  2Z2L A;  2HBY B;  4WE1 A;  4ETZ A;  2DNQ A;  2MLZ A;  5AXM A;  2YX1 A;  1VYA A;  2V9K A;  3PYD A;  4HHU A;  4ZVG A;  3FCV A;  2Q3P A;  3BKU A;  5A8K B;  2R2S A;  3JYT B;  2FJB B;  4EO6 A;  2H5I B;  2C2Z B;  1GNK A;  1JLE A;  3GSI A;  3DGV A;  2E5I A;  4CNY A;  2W1B A;  5B0F A;  1RBA A;  5B09 A;  2XHC A;  4ZP7 A;  2HGM A;  1D9F A;  1TUV A;  2CYY A;  1IBK J;  3FDS A;  2VOD A;  3RG6 A;  4LRB A;  2C28 A;  2P9C A;  1UJ4 A;  1WNE A;  3PW5 A;  4DV4 J;  4DR3 F;  2HLT A;  1ZYQ A;  3AJD A;  4AT1 B;  3B54 A;  2OAU A;  2UV8 G;  3EUN A;  2DK2 A;  2DHX A;  1M5H A;  2JHE A;  3CC2 S;  2EXU A;  3RBX A;  2MKK A;  1GX6 A;  5K8M A;  4J9M A;  2OH2 A;  1IBC B;  1RT3 A;  4PR6 A;  3HPO A;  4PWD A;  2KM8 B;  3UCU P;  1WKJ A;  3SV4 A;  1SKU B;  4I2P B;  2DR6 A;  1NUE A;  1RHQ B;  4M63 A;  1T0T V;  4JV2 A;  1UP1 A;  2DRD A;  3S01 A;  3I9V 9;  3MED B;  2DRA A;  4W90 B;  1PYO B;  1OMS A;  1VHF A;  3UW1 A;  2IAJ B;  4UOG A;  3D6T B;  1A0O B;  3CB4 A;  4EGL A;  2AJ1 A;  1YDL A;  3Q8P B;  2ZH4 A;  2JL9 A;  4ELT A;  2BE2 A;  3GR0 A;  2HVI A;  1U1L A;  3KLE A;  2GVD A;  2AZ1 A;  3EM1 A;  2I2Y A;  2CVE A;  2ZH7 A;  4J9N A;  2HAF A;  3R5C A;  4YR3 A;  4PXD A;  3E8O A;  3DRR B;  2ZHB A;  1RDR A;  2JLG A;  1NDC A;  3QIP A;  1R0A B;  1SBR A;  4DS5 A;  1RT2 A;  3TZZ A;  3ZTQ A;  4EO8 A;  3F0N A;  4K4U A;  4JI5 F;  1UMJ A;  1WKL A;  2GHW A;  2K1R B;  3V81 B;  2JC0 A;  4R5P A;  4JI0 F;  1GTE A;  4HAC A;  3NP5 A;  2YBV A;  4S0M A;  2CDQ A;  4N56 A;  4LF8 J;  2O01 C;  2V9W A;  1T05 A;  1XC9 A;  2HMI A;  1DAX A;  3CWJ A;  1HHT P;  3T5H A;  4LFB J;  4LBI A;  5LXY A;  4G65 A;  3BKT A;  4C9D A;  4ED5 A;  1LV5 A;  5IWA J;  3QQC D;  3NBP A;  3OR2 A;  2VPX B;  3ETM A;  2YKN B;  4NCG A;  2CQ2 A;  3NAI A;  2AQ4 A;  4PG6 A;  2O1P A;  2DNY A;  4ELV A;  4N5S A;  2EBG A;  3RRG A;  2E1C A;  5IC4 B;  1NHU A;  3S8S A;  2W9B B;  1HBM B;  3RRK A;  1TKX B;  5KFT A;  2F65 A;  4OJH A;  1RTI B;  4DFJ A;  4DV7 F;  4OMF G;  2K3K A;  1HWU A;  2DJW A;  2KI2 A;  1DHM A;  4MJK A;  4DX8 H;  2EG1 A;  1ZH5 A;  1WTF A;  2H4Y B;  4MIW A;  2E5G A;  3M05 A;  1KQK A;  2FVC A;  4Q2M A;  1D8Z A;  4PQU A;  3I4P A;  3U7J A;  2DNP A;  2L9N A;  3RBZ A;  4RU9 A;  3BDP A;  5H9E J;  3BR9 A;  5J2M B;  1VK8 A;  1N48 A;  1WOR A;  1X4H A;  2M8H A;  5E3Q A;  2QA4 G;  4P10 A;  2B51 A;  1NJZ A;  3BQ1 A;  4QOT A;  4WFY A;  2PN6 A;  4UOH A;  2C2K B;  1B4S A;  2UP1 A;  4UY8 T;  3ZNJ 1;  3IAM 9;  4PG8 A;  4M5M A;  1X9W A;  3UQS A;  4Y0F A;  2CWK A;  4DV6 F;  5EUH A;  2MZQ A;  1IBM F;  4P52 A;  1FK9 A;  2BJ8 A;  2ZDP A;  5GAD U;  4MFB A;  4ZA1 A;  4DQP A;  4FF1 A;  1YHQ S;  2DHH A;  2LCW A;  3KLF B;  3AOC A;  4UW2 A;  5D0H A;  1VBX A;  1HMV B;  1IJE B;  5HQL A;  4J91 A;  4U9R A;  2FC9 A;  4FN5 A;  1WEZ A;  6AT1 B;  5E3P A;  2CNO B;  1I94 F;  1DLO B;  4LF6 F;  1SIW B;  4HTJ A;  3H8Y A;  1W7W A;  2KJV A;  3IS9 B;  1WF1 A;  3ZNU A;  4USV A;  1FRL A;  3WC2 A;  4FBU A;  1RT5 A;  3OV7 A;  1ZET A;  3K5M A;  3Q23 A;  3DRS B;  2HHV A;  3BBC A;  1LWF A;  4WF9 Q;  2R7U A;  3CNQ P;  4YN3 B;  3OTO F;  1HWL A;  4XPC A;  2HKE A;  3I5A A;  4ALZ A;  3QRR A;  2AZ3 A;  2G13 A;  3TJ8 A;  4CNZ A;  2VB6 A;  4RLE A;  3F44 A;  3G71 S;  1TK8 A;  1X0F A;  3Q22 A;  1QAJ A;  3KXD A;  2K2P A;  1OQ3 A;  2UVR A;  2JFK A;  3LAN A;  1UEK A;  2QYC A;  4OYZ A;  1AA1 B;  2ZM6 J;  1UCN A;  5DO2 A;  4DX6 A;  3VV2 B;  1Z1Z A;  1FE0 A;  1VQK S;  3Q8S B;  3V6D B;  1RK8 A;  2H51 B;  3Q83 A;  1DTQ B;  3WIU A;  2UXB F;  2DEJ A;  1RAH B;  2FDN A;  4N7T A;  3OVA A;  4ES3 A;  3CCS S;  1U47 A;  3DGP A;  1TU0 B;  4MIA A;  1RP5 A;  2UUB F;  4TLR A;  1KD1 T;  2DHA A;  3L7U A;  2EFV A;  2FGO A;  2RRA A;  1HKA A;  5B0D A;  3UPF A;  2HRU A;  2XO7 A;  3TO8 A;  1RAI B;  5IM0 B;  4GKK F;  5C7P A;  2CJQ A;  1T3O A;  4FDF A;  2W4D A;  2ZHA A;  5KFE A;  2V69 A;  3GJS B;  5A8R B;  3ETO A;  3G6E S;  4JV1 A;  1N5Y B;  1J5E J;  2RF2 A;  2XB2 D;  5F8G A;  2BKP A;  5J2N A;  1H3D A;  1CUL A;  3E3X A;  1JLQ B;  3IXQ A;  1FX4 A;  2WAQ D;  4TQR A;  3BB5 A;  4EZ6 A;  1U6F A;  1SC4 B;  4O3O A;  4B9S A;  2LU1 A;  3ZXW A;  1SQG A;  3BGR B;  4USH A;  4EEY A;  5HLF A;  1L3S A;  1SKW A;  1KFD A;  1OO0 B;  4JI3 J;  1WJ9 A;  3G8Q A;  4ZVS B;  4AL5 A;  5AE3 A;  2ZNZ A;  2CQH A;  3R5D A;  4OFZ A;  1GQE A;  1Q95 G;  5HRO B;  3MR2 A;  2G2Z A;  2ZH8 A;  4JI8 J;  3IWL A;  1X7V A;  4HKQ A;  2PEB A;  3BF4 A;  4OLP A;  3RB6 A;  1RTJ B;  1X5P A;  5LL6 d;  3J81 Y;  1KLM A;  4RUH A;  3T9N A;  1HNW F;  2PD1 A;  3CED A;  5DGB A;  2WVE A;  2XMA A;  2YNH A;  3DLG A;  1CJV B;  3W2W A;  4OL8 A;  2DIT A;  2DHS A;  3CJR A;  2BM1 A;  3UN5 A;  4A8M P;  3CXC R;  2UV8 A;  1CLF A;  1T03 B;  4ZPB A;  1JLG A;  3TWZ A;  2ILY A;  3W60 A;  3RB4 A;  2MY8 A;  4OHW A;  4OLO A;  3MOJ B;  5KFO A;  1Y0H A;  3MM8 B;  2W8L A;  1HNZ J;  4IRC A;  2GJI A;  3QLH A;  2PI4 A;  4IG0 B;  2HND A;  3UD4 P;  1HNV B;  4TYA A;  1TUW A;  2CIM A;  3M8P B;  4OZ3 A;  4KJI A;  4B3O B;  1QE1 B;  2VIH A;  3I0R A;  3OJS A;  2RD5 C;  4G3I A;  2DY1 A;  2B7C B;  4TYB A;  2ZD1 B;  1N56 A;  2VG7 B;  1T02 A;  3WBZ A;  1K1S A;  2KL8 A;  1A9N B;  4DU8 A;  1MNE A;  4DX5 A;  1CQM A;  5DLF A;  2BX6 A;  2DH7 A;  1WC4 A;  4RPF A;  4DCP B;  3QWU A;  1R6V A;  2BVZ A;  2W25 A;  3BN4 A;  2OI2 A;  2QN6 B;  4DR5 F;  1ZAV A;  2YNI A;  3FBB A;  5F8N A;  1S1X B;  2NLW A;  1FKO A;  4DQQ A;  4PYD A;  4BLG A;  2OPR B;  2JVR A;  4LFC J;  1DQ8 A;  3PJW A;  5U47 A;  3O5T B;  5AXL A;  3MR6 A;  3TAQ A;  1GT8 A;  2PA8 D;  3HSD A;  3PYG A;  4E0D A;  4FZV A;  4FNH A;  1TL3 A;  2MY7 A;  2BQU A;  4DV5 F;  1RT6 B;  5JVH Q;  4MKA A;  3I6P A;  1WDT A;  4FP9 A;  1KBR A;  5IV4 A;  4Y34 A;  2DR5 A;  2IC3 B;  3D54 A;  2FZK B;  4TU8 A;  3OR1 B;  4A8K A;  2LEB A;  3TAM B;  3P8B B;  3M8W A;  5FDL A;  1E6Y A;  3FBC A;  5M2U A;  2RUG A;  2CZ9 A;  3I0S A;  1MWZ A;  2CPF A;  1J2V A;  3O1L A;  2F7V A;  5THW A;  2J6S A;  1JXV A;  2NZC A;  4ZPT R;  4ZCK A;  2GAH C;  3TEH B;  2GFF A;  3DNC A;  5IT0 A;  1EET A;  2XBP A;  2HFZ A;  4QZV B;  1VRQ C;  2NXJ A;  3GE9 A;  2GGP B;  3UR3 C;  1UZH A;  5D8H B;  2PGC A;  2ZFH A;  4NXM F;  2XMW A;  3DOM B;  4LSZ B;  1H98 A;  1A7G E;  2GZO A;  2WRM A;  4NWB A;  1HR0 F;  4FXD A;  2ZBP A;  3TAP A;  1OIA A;  4NYO A;  2BJ3 A;  1XJW B;  1VBK A;  8ATC B;  1HNI B;  3CDA A;  3PNI A;  1BQN B;  3MF5 A;  3SEO A;  2XYG B;  4K4V A;  4OZ2 A;  4X65 J;  4JUZ A;  2CJA A;  5ETQ A;  5LM7 E;  1FEE A;  3T9Z A;  1Q82 T;  5BYS A;  2LQ9 A;  2HZV A;  3KK3 B;  1ULR A;  1VQM S;  2HQG A;  2DD8 S;  2B4U A;  3BBB A;  3BDE A;  1SC3 B;  1WUU A;  3SQG B;  4M5K A;  5HVG A;  5KFV A;  2HHQ A;  2F4F A;  3UD3 P;  3M32 A;  3BBF A;  1CBK A;  3QO9 A;  1NK9 A;  3G9C A;  3NGR A;  2KT2 A;  4DV2 J;  4M5D B;  1IKW A;  1LXN A;  3MR7 A;  3W8P A;  4QR2 A;  5D0E A;  1REG X;  4GVB A;  2AYM A;  2ALZ A;  3R7B B;  2HHP A;  1PBU A;  3N6N A;  2V6A A;  4NLD A;  2FJW A;  3CDW A;  2MST A;  2AJF E;  3NLC A;  2CQ4 A;  3HVR A;  2C2D A;  4DR1 J;  4JOU A;  2BM0 A;  4ZPV R;  2J6U A;  2MKH A;  1NK6 A;  4I7F B;  1XMO F;  5BR8 F;  2KXF A;  2L9D A;  2IA0 A;  4C8K A;  4B3M F;  3CCU S;  3MAA A;  4FKY A;  5F3T A;  3MMC A;  2DGQ A;  1WTB A;  1VC6 A;  2H3E B;  2VD3 A;  1FRM A;  1TFW A;  4K50 A;  2BQR A;  3RB0 A;  2ZH3 A;  1S0V A;  4HLB A;  4B08 A;  1DUR A;  4ICL A;  1NRK A;  3BM7 A;  2I0X A;  1W26 A;  4H4K C;  5KG6 A;  1RYR A;  2R9L A;  1NK5 A;  3MOZ A;  2VFR A;  3T19 A;  2Y0S D;  5CA5 A;  1B70 B;  3R27 A;  3W64 A;  1FDN A;  5LMN F;  3D68 A;  4I6Y A;  4MK7 A;  1RTH B;  3H42 A;  2VG5 B;  4TNO A;  2KHC A;  1YBU A;  5HO4 A;  3EX7 B;  4DPX A;  1RT7 A;  2RDJ A;  1XR7 A;  1SJ1 A;  5HP1 A;  4WP9 A;  1HIY A;  3ELH A;  2MQQ A;  2MQ8 A;  3ZZT A;  1XR6 A;  3A12 A;  1QUV A;  1PJ6 A;  2DXF A;  2ZH2 A;  2V8H A;  4GO7 X;  3SCJ E;  2VU5 A;  3EDQ B;  1UWB B;  1S1W B;  1HYS A;  1FVS A;  2ZUG A;  3CCW A;  1VLY A;  1FXR A;  1X0P A;  1LW2 B;  3CCR S;  5HMY A;  1NO8 A;  4KQZ A;  1IWG A;  3MHY A;  2PMH A;  4OHX A;  1P1T A;  1U1K A;  5IZH A;  2K3I A;  4AL6 A;  1ZZF A;  4LF4 J;  2FHO B;  3Q8U A;  1LNQ A;  4G1I A;  2W7O A;  1TAQ A;  1EJ7 L;  3GYX B;  4NCB A;  1FRI A;  3TUP A;  4X64 F;  4ES1 A;  4KHR A;  1SVD A;  1TV6 B;  4DN9 A;  3M8Y A;  3DI6 B;  4GMK A;  1N5Q A;  1GAO A;  2MZR A;  3C16 B;  1RT4 B;  2R2U A;  1NSA A;  3FMB A;  1FNM A;  5T7L A;  2HK3 A;  4ZPA A;  1HA1 A;  4G1Q B;  1IR2 A;  3LA0 A;  2DRB A;  1UKU A;  3H5U A;  4IG3 A;  2Y8Y A;  3FFI A;  4U7C A;  2KKH A;  1VQP S;  3O6Q A;  1IKX A;  2UZA A;  1IM4 A;  3N5F A;  1IWA A;  2UXC J;  2FHK A;  4ECZ A;  3CJK B;  3V6K A;  3W61 A;  1BWE A;  2X7I A;  3FVY A;  2EFN A;  4WFA Q;  1OY8 A;  2FLP A;  2Y1J A;  2YKM B;  1GK8 A;  1EKR A;  1KEK A;  3QZ7 A;  2VZ9 A;  3P49 B;  4NLQ A;  2V5H G;  4F4A A;  3GFX A;  2VV5 A;  4WTY A;  3BH7 B;  1PO6 A;  2MTL A;  3E2E A;  4E8U A;  4PUO B;  4CO0 A;  1XBW A;  2CJK A;  1WHW A;  4I6A A;  3T41 A;  1XQI A;  3MMA B;  3RTV A;  4ELU A;  4DR7 J;  1FRJ A;  3GWC A;  3VGV A;  1QUP A;  3LH2 S;  2AJQ A;  4KB7 A;  4RO0 A;  3W5X A;  4DU7 A;  3ZZY A;  3DMJ A;  3V5R A;  3QFW A;  4M8L A;  1Q4R A;  4I0W A;  1TP7 A;  2CPJ A;  4K4T A;  1PIL A;  2KYX A;  3W1Y C;  3D1H A;  3VVT A;  1S57 A;  3NL0 A;  1N32 J;  1OYD A;  3AY0 A;  1IXK A;  4EI2 A;  3V4I B;  2Q66 A;  2XY5 A;  1JQG A;  2C1E B;  3D9B A;  2W24 A;  3RU0 A;  4NA1 A;  1AZS B;  4CDI A;  4OYI A;  2V34 A;  1TQL A;  4DR2 J;  3OXL A;  5A8K A;  3NMA A;  2LU2 A;  3SSQ A;  1D9D A;  3QRP A;  1XMQ F;  3JYT A;  2N4C A;  3H2L A;  3KLV A;  4A8X A;  4X66 F;  4RL1 A;  3JTO A;  2OFH X;  1Q78 A;  1SB6 A;  2QE5 A;  4NRT A;  1WEY A;  2OD6 A;  4ZOS A;  4LQ3 A;  2VOP A;  3MPW A;  1NSK L;  1ITP A;  2JJ4 D;  4WIQ A;  5D3G B;  3GQC A;  2JEI A;  4ZJQ A;  1WI6 A;  1HI1 A;  3QSI A;  1QM9 A;  4FVM A;  1UAW A;  3PG9 A;  1VQN S;  5LJ3 Y;  3LPY A;  5L39 A;  2OFG X;  4G1P A;  4CLF A;  4HTI A;  3PRD A;  2QLF B;  3J81 j;  2A2C A;  3UVJ B;  3T1Y J;  1PGZ A;  4NL5 A;  3KJF B;  1HBO A;  3Q2T C;  3N28 A;  5DG7 A;  1S1V B;  5I3Q A;  2WVF A;  3AJ1 A;  4JI4 F;  4DPY A;  1QTN B;  1L5U A;  3M8Z A;  2CJX B;  1N33 F;  4KC5 A;  4DSI A;  3QBC A;  3N5B A;  2HWT A;  3QAE A;  5AE1 A;  4ZP8 A;  1TAU A;  3G2X A;  1R8B A;  3CJ0 A;  4I2P A;  3KNG A;  1LKZ A;  4FS2 A;  2XEX A;  1FF2 A;  4NA3 A;  2FVS A;  4USW A;  2WW8 A;  3MED A;  4XAK A;  2KT5 A;  1Y00 A;  2IAJ A;  2PC6 A;  5CYQ B;  4J9O A;  1FNO A;  3HHL B;  4JP8 A;  4WKR A;  4HI1 A;  1R27 B;  3P3D A;  4ILR A;  2VHG A;  3EVW A;  3DOL B;  3M9O B;  1BC6 A;  3BGO P;  2VC1 A;  2E5L J;  1S9E B;  1REV B;  1Q8K A;  4DV0 J;  2HWH A;  1FRH A;  4OI0 A;  2VFS A;  1ZA1 B;  4QR0 A;  1YLX A;  1KS2 A;  3E01 B;  4B3S F;  3DRR A;  2EKN A;  4O4G B;  2V0N A;  1U1M A;  5CH7 B;  5H9E K;  1R0A A;  1JLF B;  2XZW A;  3EXC X;  3MGJ A;  4ZVQ B;  2DXE A;  5HJY A;  3W9I A;  3M30 B;  3KLG B;  4UST A;  3ILI A;  1TKZ B;  2K06 A;  5LT5 A;  2K1R A;  2NUH A;  2M70 A;  3V81 A;  2CQP A;  2W4P A;  3J7Z T;  4F4W A;  4LIW A;  3TVY A;  2LEA A;  2QSW A;  2QX0 A;  1BUX A;  3BRE A;  2FIU A;  2VDH A;  2BAC A;  3T1H F;  1RAG B;  3PO4 A;  3CCZ A;  3DFE A;  2P9G A;  2K7J A;  1NKC A;  4ETX A;  1NB7 A;  1VOM A;  2WVB A;  4DQI A;  1NDK A;  1R0C B;  2MZT A;  3HVW A;  2YKN A;  5J2Q B;  2X1F A;  3UCG A;  1S7I A;  2CAJ A;  4UUW A;  2WZ1 A;  5KFS A;  2PA3 A;  4DZ6 A;  4OZJ A;  5GAG U;  3T3F A;  4K2J A;  2W9B A;  1Y11 A;  1HBM A;  1TKX A;  3TA0 A;  4WK1 A;  4K4X A;  1LFW A;  3JAM U;  1DFD A;  4QWA A;  1RHK B;  2X3D A;  1N36 J;  2XCP A;  1RTI A;  4BC9 A;  1RAF B;  1ACM B;  4LRF A;  2ASD A;  1H74 A;  2L41 A;  4OHV A;  2G9O A;  4ZVP B;  2RQC A;  4RUC A;  7AT1 B;  4ZPD A;  1NHV A;  4X62 J;  3TA1 A;  3B4D A;  1OY6 A;  5L8R C;  3CVK A;  5J2M A;  4PPD A;  2WSE C;  4M5I A;  4L3N A;  3QJL A;  2B8Q A;  2FPH X;  1RUS A;  3J80 U;  3GV8 B;  3IG1 B;  5DET A;  4HT5 A;  3UD5 A;  4IR9 A;  1M1K T;  3PO5 A;  4ZVF A;  2ZBI A;  4WXW A;  4HT7 A;  4JBC A;  2UXD J;  2WVC A;  4J9U E;  2I5J B;  4EBC A;  2F3J A;  5EX3 A;  5A76 A;  3GPA A;  2IA6 A;  1HNX J;  2OTL S;  5AXN A;  1H2V Z;  3PJ9 A;  3KJV B; 
#chains in the Genus database with same CATH homology
 4WBF A;  1UCN A;  4DUT A;  5IOL A;  5CAB A;  1HLW A;  3Q86 A;  3B6B A;  3ZTQ A;  4ANE A;  1NLK L;  3VGS A;  3VVU A;  4F36 A;  3ENA A;  1WKL A;  3EIC A;  1S59 A;  1VYA A;  3Q83 A;  2HUR A;  2DXD A;  1K44 A;  4AND A;  2DXE A;  4S0M A;  4ANC A;  3BH6 B;  1EHW A;  1NSQ A;  3ZTS A;  3VVT A;  3FCV A;  1W7W A;  3EVM A;  1S57 A;  1F6T A;  1HHQ A;  3BBB A;  1WKJ A;  1WKK A;  1NDL A;  2B8P A;  1NUE A;  1U8W A;  3NGU A;  3Q8U A;  1B99 A;  4F4A A;  1BUX A;  3Q89 A;  3R9L A;  3BBF A;  4UOF A;  3FBF A;  1PAE X;  1S5Z A;  3L7U A;  3Q8Y A;  3VGT A;  3G2X A;  3EJM A;  3NGR A;  5CAA A;  3FCW A;  3FBC A;  3BH7 B;  3PRV A;  1LEO A;  3BBC A;  3ZTR A;  4UOG A;  1NPK A;  5C7P A;  3ETM A;  1MN7 A;  2HVD A;  1BE4 A;  1NCL A;  3DKD A;  4UOH A;  1JXV A;  3DDI A;  1B4S A;  1BHN A;  2BX6 A;  3EMT A;  4KPC A;  3FC9 A;  3NGT A;  2B8Q A;  2BEF A;  1PKU A;  2AZ1 A;  1NB2 A;  3EM1 A;  1XIQ A;  1NDK A;  1XQI A;  2AZ3 A;  3JS9 A;  3ZTO A;  4ENO A;  1MN9 A;  3WX8 A;  5BXI A;  1HIY A;  3ELH A;  2CWK A;  3EE3 A;  1NHK L;  3FBE A;  4C6A A;  1NSK L;  3EVO A;  2DYA A;  4EK2 A;  3VGV A;  1F3F A;  1ZS6 A;  4FKX A;  3MPD A;  2DXF A;  4DI6 A;  3GP9 A;  3EVW A;  2HVE A;  3Q8V A;  1NDP A;  3NGS A;  3FBB A;  3ZTP A;  4CP5 A;  2NCK L;  1NSP A;  4DZ6 A;  4FKY A;  1KDN A;  1NDC A;  2VU5 A;  2ZUA A;  3GPA A;  4W98 A;  3B54 A;  2DY9 A;  4HR2 A;  1LWX A;  3VGU A;  3FKB A;  3PJ9 A;  4O0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...