3GP9A

Crystal structure of the mimivirus ndk complexed with gdp
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
133
structure length
133
Chain Sequence
AGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
total genus 43
structure length 133
sequence length 133
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2009-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3gp9A00
2B8PA 1PAEX 1LWXA 3FBBA 3PJ9A 1S57A 3VGVA 1MN7A 1VYAA 3ELHA 3FCVA 3BBBA 1NPKA 3FC9A 4F4AA 4UOHA 1F3FA 1PKUA 3B54A 3EICA 4FKXA 4UOGA 3DDIA 3FBCA 2BEFA 1B99A 3ETMA 3BBCA 4HR2A 1UCNA 1NSQA 5CAAA 1JXVA 1F6TA 5IOLA 3DKDA 3VGUA 3NGSA 3ZTQA 1NB2A 1NDPA 3EJMA 4KPCA 3FCWA 1NSPA 3VGTA 2CWKA 1HIYA 3ZTOA 3VVTA 1BHNA 1NCLA 3EVMA 3Q8VA 2DXDA 1S59A 3BH6B 1MN9A 4C6AA 4ENOA 4DUTA 3PRVA 3Q83A 1WKJA 4WBFA 3EE3A 3VGSA 3VVUA 3NGTA 2DXFA 3ZTSA 2B8QA 3Q86A 4O0NA 3Q8UA 3Q8YA 1ZS6A 1NDKA 5BXIA 3Q89A 5CABA 3R9LA 1B4SA 1NLKL 3GP9A 3ZTPA 2AZ1A 1S5ZA 1NUEA 4DI6A 4ANEA 4FKYA 1U8WA 1XIQA 3EMTA 3G2XA 1WKKA 1HHQA 4CP5A 5C7PA 2BX6A 3ENAA 3ZTRA 3GPAA 3B6BA 4F36A 1NDCA 1BUXA 2HVDA 3NGRA 2DY9A 1LEOA 4DZ6A 2DYAA 3FKBA 1NSKL 1NDLA 3BH7B 2ZUAA 3L7UA 3EM1A 1K44A 2NCKL 3EVWA 4ANDA 1BE4A 3JS9A 4S0MA 1KDNA 4W98A 1EHWA 2AZ3A 2HVEA 3EVOA 1W7WA 1XQIA 2VU5A 3WX8A 3MPDA 3FBEA 1HLWA 4EK2A 3FBFA 4UOFA 2HURA 3NGUA 1NHKL 4ANCA 2DXEA 1WKLA 3BBFA
chains in the Genus database with same CATH superfamily
5A6WA 4IH7A 3UN5A 4WYLA 1N5VA 3ZZRA 2H4YB 5I4MA 1HWJA 2IA6A 1S7HA 3M2UA 3KLGA 3H5UA 1SKSA 3G6XA 1O8BA 4MJKA 3K8WA 3GMGA 2NS1B 4I2PA 2YPYA 4X64F 1SL0A 4ZVUB 1RCXB 1N32J 2RF2B 1KQGB 1CJTA 2VPXB 2LQBA 1M5VC 5E7OB 4A8FA 1RT2B 4AQYJ 4DV3J 1DLOA 2VPYB 4CLTA 1C1CA 3IAS9 3ONQA 1S6PB 2YNGA 2B0GA 2V94A 1X5TA 3QAUA 3ILIA 3MM9B 4X4TA 1OY9A 3P6YC 4X4VA 4OLOA 1RT6A 1T0TV 3M4XA 2BQUA 2LFVA 4NMXA 2C2ZB 1RTIA 3LAKA 1GMWD 5KFXA 5J2QA 2B6AB 2XMKA 5IFMA 4LF7F 1P27B 1QSSA 2RB7A 2MLXA 3CJ0A 2IYIA 3DRXA 4N41A 3I0SA 5L8RC 2HNDA 5A2QU 2RQ4A 4DSIA 2LEBA 2B4UA 3X3UA 3M32A 3HM9A 2O5DA 2HBQB 1JLBA 1LFPA 1I5OB 4PQUA 4HDHA 4UUXA 4HHUA 4ZPAA 3RW7A 2R42A 2QZ8A 2QGFB 2QA2A 2MQOA 2EXUA 4QQBA 2GAGC 4DU7A 4M95A 1WACA 1RTHA 2MY8A 1NUEA 1SC1B 4ID8A 4MMOA 1FVQA 3WX4A 1AFIA 2E9RX 5D15A 3LP2A 2Z58B 2DH7A 4GO7X 2UVRA 3CJRA 3D0GE 3HVRA 4MYUA 2W2MP 3H2LA 2C1EB 1I6JA 1ZZFA 5KFQA 2CYYA 1MWZA 5LMUF 3D3CJ 4MFBB 1VRQC 2J6UA 2BYCA 1X8DA 5E3AA 2IA0A 1LQ9A 3DDNA 2V4RA 1B7FA 2MQPA 3R1HA 2ZHOA 4OYIA 3NAIA 1VC6A 4K4VA 1GXUA 2G4BA 3KK3B 1N36F 4ED2A 3HLUA 1AROP 4ZN1A 2GCFA 2ZDPA 1QTMA 2DEIA 3N0VA 1VS3A 2Y0BB 1IBLJ 1NSPA 2OMLA 3LGMA 4MK9A 1FT8A 3C14B 4O4GA 2ILYA 1MN9A 2GJIA 2BKNA 5LOQA 5CD4H 4M5JA 1ITPA 4HH0A 4KJIA 1DJ0A 2L9NA 1DZ5A 5KG6A 4F4YA 1XK8A 1SV5B 2ACMA 3EPGA 1H73A 5CZVA 1YJVA 4JI8F 2ZWOA 2IYGA 4HH1A 3QRRA 2GAHC 3BREA 3BGUA 1R6VA 1RHRB 2ATCB 2B5JA 3FQLA 4LIWA 3Q23A 5K14B 4UOFA 1U02A 1DTQB 4CLPA 3M2VB 1QD1A 2MQMA 3QFHA 3GONA 1U48A 3BBBA 3UI3A 3R1LA 4IFVB 1VQOS 3C8YA 3AQOA 4A8MP 3JAMY 2KZZA 5IXUA 2GVDA 3W66A 1FVSA 7FDRA 3BO3A 2J0XA 1KRPA 4LF2A 3FCWA 4J9RA 3BO4A 5J1EA 2OFGX 1CJVA 2ZC4A 4XO0A 2BE9B 1N88A 4WXOA 4RNFA 3AOBA 2F8HA 1S4FA 4DX8H 3CCRS 2PI5A 3BGFA 3CD0A 5DJBA 2OMOA 3CE8A 2VF3A 5D0RA 1Y00A 2NXUA 2HHTA 4IO1A 1UTAA 3R5GA 3NBPB 3RR8A 3EZUA 4ZP7A 1GK8A 2R7TA 4RW4B 3UCUP 2RDJA 2W1BA 3MR6A 3POTA 2ZH2A 1CG2A 4ED3A 3D1OA 2WK4A 1JLEA 1HBUB 3CDBA 1CS4A 2MTLA 2AYMA 4KC5A 3Q0AA 4LVNP 4LUBA 4TNOA 1S79A 2DB1A 4NI2B 1R8HA 2HVZA 2JWNA 2A6MA 3J81U 4O44A 1FJCA 2VFRA 4Y3CA 3TZZA 2X1AA 4P74A 4GKKF 3RB3A 1FRXA 3OPKA 2AW0A 2QRRA 3PYGA 3ZZUA 1Q7LB 2HRTA 2BJ8A 5E2QA 1TMMA 4ZVFA 4A8KA 4LFBF 1B0PA 2BANB 1IKWA 4R5PB 2OJ3A 4K5SA 4J9UE 3Q8UA 1LWCA 1RLCL 3TUPA 4IOAQ 1F3VA 2RRAA 4K0KJ 4ID5A 4DX7A 3CO9A 1NHUA 4DPOA 1FDDA 1PG5B 3I0RB 4WTOB 3SSSA 1SIWB 4YR3A 5KFWA 1Y0HA 3WC2A 2FJAB 4WPAA 3N6LA 3MMCA 1JJ2R 3WIVA 2J7UA 1L3UA 4X84A 4OI1A 2DNMA 4LFCF 1XNQJ 3NNHA 2XY7A 1DARA 3ET6A 4NZ0A 2ADCA 2FVQA 5HMWA 5IT0A 2G2ZA 4ZLPA 4C48A 4N47A 1WKLA 1HPZA 1FDBA 4ECSA 3C66A 2HS3A 1HWLA 1IXKA 1TL5A 4YHHF 4YN3B 1NB7A 4OJHA 3DDIA 3FVYA 3TVZA 1HR0F 2GIFA 2EFVA 5DETA 2EK6A 2BE2B 4PG5A 4ZP9A 1VBZA 2JDJA 4OYPA 1Q53A 4X62F 4KFBB 4ZDNA 2HQGA 3DM2A 2E5IA 2CNNB 1EZZB 2VOPA 3HF5A 2DPIA 3CCJS 5L38A 4OYMA 4ZHRA 3K17A 2MHNA 2EG1A 3R3TA 1C0UB 4RU9A 1RKJA 1RBAA 5J1PA 2HWIA 3QWPA 3A1YG 4FBTA 4XDCA 1VC0A 2GMJA 4IOBA 3Q2SC 1WUUA 2JC0A 2MGZB 4YEAA 5C25A 2YWHA 2UUCJ 2CQ0A 5AXMA 5HANA 1NK7A 3I56S 3LO3A 4JI1F 1WF0A 4Y00A 4ELTA 1FXLA 1ZM4A 2YNHA 1CVJA 1DQAA 4C9DA 3UDCA 2HBYB 1SJ4P 4RZRA 4QIGA 1BQMB 1NPKA 3QZ7A 2GX8A 2UUBJ 1WC0A 4OJ1A 3M2UB 3KLGB 1DAXA 3NGSA 1I51B 3K5MA 2L48A 3EYZA 3OVSA 3GIKA 1KQFB 1YQHA 1KOHA 1RHMB 1WTBA 1U1MA 1C4CA 4K4SA 5U47A 2HHSA 1CULA 4I2PB 1I3OB 4NA1A 2LQJA 1SC4B 3BB5A 1VISA 2KFNA 4F02A 3UD4P 5KFMA 1DLOB 2XYGB 1Q81T 1N33J 5GAEI 2CKWA 5F8JA 1C1CB 4ED7A 2YNGB 2LYVA 2IPOB 1FXDA 1UPPA 1K44A 2CZVC 1RT6B 3OJSA 1FRIA 2Q1LA 3TARA 1UVMA 3HHKA 2UV8A 3OTBA 1A0OB 1CJUB 5DZ7A 4KV8A 5J2QB 5GADU 4Y2KA 4LF4F 2XQCA 3DCAA 2KG0A 2PEHA 3DGPA 1RYSA 5E3PA 3I0SB 4HACB 1TUVA 2HNDB 4OZ3A 4YY3F 1VFJA 3PV8A 4LT6A 2COLA 5KG4A 5L1JA 3TAQA 1S97A 3QWUA 3SEOA 4ED1A 1MSWD 4O3PA 4D3GA 2V63A 1UWAA 2OO4A 3CDEA 2OH2A 1JLBB 4F67A 1ZBTA 4A8YA 3B4MA 3D0IE 3Q83A 4M94A 2FLPA 5DLFA 2OPQA 3LANA 1U2CA 2GC8A 5ETRA 4W4MA 1T7PA 1RTHB 1UZDA 3G2XA 5KAKA 3ZTRA 3BQ0A 1VBKA 2I1RA 1Q0NA 1ROFA 3LP2B 1NKEA 4USHA 2ALYB 3LP1A 4DR7J 1E6YA 3QFWA 3BSCA 1RABB 2AWZA 5DDQC 5HATA 3M6VA 2IFXA 4DR4J 2FHKA 5KT7A 4OHVA 1YITS 4ECWA 4DPXA 2AYBA 4KH0B 2IRXA 5EWGA 5BYQA 1RAOA 3PVXA 2F63A 4PXBA 1XWLA 3UO0A 5CYJA 4U7CA 5I3QA 1UP1A 1V6HA 1GNKA 1TV6A 5KFUA 1AA1B 4EEYA 2UXBF 4CO4A 5B0EA 2FC9A 3SCLE 2Z2ZA 4NLDA 2G0IA 4DQPA 4O4GB 5HLFB 5ETVA 2P6TA 2QJ3A 4B3TJ 2DRBA 4LF8F 2F8EX 2Y8YA 2XGPA 3MTKA 2JC1A 3OL6A 1ACMB 2VIHA 2HHXA 2OLWA 2UU9J 5SUHA 5T41A 2F1FA 4DCJB 5KG0A 4DQQA 3DLJA 1EKRA 2CDRB 4RJVA 1SUQB 2W4CA 2J7WA 5IV3A 1SJFA 2UXDF 1ULRA 3K5NA 3SCIE 3IXQA 1U1OA 1VQMS 2MDAA 3KG0A 1VMBA 3PZPA 1C4AA 1LXJA 4IG0B 3WX8A 3KLHA 2AP6A 1S1VB 4DV6F 4B3SJ 2ZFHA 4U7UD 2B5JB 2XLJA 2HK2A 1ZYQA 5JVHQ 2UV8G 3SSQA 1UL3A 2KFZA 1Q86T 3GFHA 1UW9A 3D9BA 4U8VA 1QM9A 4ED4A 4CDIA 5EHHA 3BSOA 4KTQA 3GV5B 2ZITA 4ENOA 2CJYB 4USKA 5J1EB 1CJVB 2XHWA 3LH2S 2BBEA 2XO7A 3B8HA 1VOMA 2C3YA 2P5VA 1RZMA 4NLVA 5DM6Q 2ZE2B 1K47A 3S01A 5L46A 2W9BA 2W24A 1S76D 1YZ6A 4F4ZA 3AXKA 3UD5A 2J0SD 2V8GA 4LBHA 1PJ7A 3J7Z5 2MZSA 4R25A 4U7UK 3SYZA 2Z8QA 1QSYA 2ZOMA 2HQFA 2R9LA 1HWKA 1EAYC 1BMQB 3FUYA 4WYWA 4ITSA 1CS4B 2KT3A 4C8LA 4QIWD 4M1KA 2JL9A 4FKXA 1DY3A 1KTQA 3MECA 4UOGA 2JH3A 3D6HB 3M6WA 1EETA 3ETMA 2WHOA 4ZOSA 2IIHA 4OFZA 1JXVA 1Q16B 3GJSB 4O44B 5CA5A 2D7SA 3NG8A 2M52A 2R8JA 1WHVA 3V81A 1UPMB 4KPCA 2YQ3A 4DL4A 3G71S 2OELA 3W64A 1IN0A 2P9GA 3RG6A 5AT1B 4NZ7A 5L1IA 3CDAA 1D1UA 1TL1A 3OTCA 4DLEA 3C15A 1IKWB 1FKOA 3M1VA 2JFKA 5IWAJ 1LWCB 4K2JA 1T9YA 4FVMA 4B9MA 2RKIA 1WEXA 3J7A1 3HHDA 4QYZK 2LEPA 3MI7X 1RA7A 1FF2A 2E1MC 2ADBA 1M5KC 4DV0J 4RLEA 3MMCB 3TUIC 5HROA 1QVFR 3JTOA 2W4PA 4RW7A 1S10A 2UXCF 1N5YA 1T9WA 3EXCX 3ZNJ1 4ZVPB 4BBYA 3ET6B 1B0TA 2DGQA 3VCDA 3MFHA 2YKNA 1HPZB 5ETQA 3AHPA 2QC3A 3IFEA 1Y7PA 2E1AA 4CLKA 1N5QA 3KUEA 3PW0A 3I32A 2HS4A 2KJWA 4C0HA 1G1XA 4NLWA 2IVFB 4IQMA 4QOTA 5DRKA 1YKWA 4ZVGA 1KKHA 4FS2A 3DLBA 1WNEA 4DUZJ 3DM2B 3TJ8A 1TL7A 2IDLA 4NYOA 4KY3A 2HAFA 3TA2A 4JI3J 4USTA 4ZHRB 3EXYA 2UVVA 1RJJA 3HSJA 3THPA 1M5OC 2IMOA 3NAHA 5EUHA 3MUVP 1LWFA 3W5YA 5D8HB 2UUTA 3NS7B 3CB4A 4JI4F 2FJXA 4IH5A 1N34F 5C25B 4O4RA 3BGLA 3KLIA 4DUYF 4L6V3 1HQUA 3JSYA 2FZCB 2C2MB 2ZBQA 1RCOB 2YNHB 2J9EA 5GVQA 3G8SA 2BUNA 4E2FB 4M5GA 1URRA 4X4PA 1IR2A 2D3ZA 1VQYA 3RB0A 5ETNA 2HVIA 3MUMP 1TL4A 1BHNA 3SZ2A 3H8YA 4ILMA 2MKCA 1KQSR 2XMUA 4I6WA 5JMNA 2FJDB 4NPOA 1CULB 3SDEA 4V19J 2KKHA 1IJFB 4E98A 3M8QA 3I9V9 4OI6A 4PCQA 2XLKA 4K4XA 2HS0A 4KKOA 4OZ1A 3FQKA 4IFYB 1AT1B 1RT3A 3DU6A 2EFNA 3MMBA 2LVWA 2GIQA 3K5OA 1VQ8S 1TAQA 2HHVA 2J8AA 3M8RA 2D69A 2AZ3A 3WZ0A 2GHVC 3HHEA 1T11A 1REGX 4G1IA 3MF5A 1JJ4A 2OSRA 4DX6A 3PTWA 4KV8B 2WW4A 5T7LB 2BJDA 3UFCX 2V8PA 3QZ8A 4NLUA 1TU0B 3NL0A 3DGPB 4KHMA 2XMVA 4RW9A 3HULA 3JSBA 3FJ2A 4OHYA 1U6FA 3C6UA 2MQ8A 1U1LA 1MW7A 4ZCKA 2H5EA 2AJ2A 1VIXA 3C6TA 1FEEA 1ZPVA 2K7KA 3PW7A 1K73T 3H5XA 4K4ZA 1TP7A 1Y5IB 3HVTA 4BHQA 4U9RA 4K4YA 3GYNA 3PR4A 2W7OA 2C3UA 2OPQB 4M5LA 4ZLJA 2J9DA 4LREA 2QA4S 2LEAA 3V6HA 1S6QA 1BGXT 3KDNA 1K0TA 1RT7A 1TELA 4I6YA 4ZVTB 1PCAA 2VQEF 4CLLA 2FZKB 1WDDA 4GKJF 2DIUA 3LP1B 2R7UA 1HA1A 2RE1A 1E6YB 1WC3A 3ISZA 1YI2S 3GJTB 4LR9A 4ED5A 4LF6F 3MWBA 1KVIA 1J5EF 3FBBA 2VB6A 2AEJA 1NK6A 2FJVA 1NH7A 1TUGB 3T1HF 3GTYX 3H59A 1NSQA 2XI2A 2EFQA 5GMKa 1X5OA 2DNLA 1SB6A 2YKOA 1TV6B 1DURA 5GMDA 4XIUA 1EQ0A 3JXOA 1RWOB 4RUAA 1SKRA 2MJUA 2HFVA 3RB6A 2QX0A 2I5JA 2DTJA 2K7JA 3QGIA 2CJAA 1VK8A 3EMTA 4Q7AA 2MQLA 1HD0A 2H4WB 2HIQA 1ZZNA 1RHKB 2DVIA 4JI7J 4DV5F 1XMQF 4ANDA 3KLFA 2AIRB 1TKTB 4UZBA 2B7CB 1XJWB 4NMLA 8RUCA 3PX0A 3O8WA 2OP5A 2DCLA 3NWGA 1B7YB 3OL8A 4LSZB 4L3KA 4A8WA 2L41A 3KLHB 3A8IA 1L3KA 3UD3P 3HSGA 4NXMJ 4DR1J 1Y5LB 3UWTA 4XTTA 4TYAA 2HMIA 3DLKA 3PX6A 3US5A 4V19X 1GX5A 4B08A 5KG2A 2EC0A 1S1UB 4CIOA 2DNRA 4QPXA 2GHWA 3TAMA 2HVHA 4M5IA 4TU9A 4M5MA 3TEGA 1IWAA 3R27A 1RISA 4O0NA 1YJRA 4Z7YA 4ECVA 2FQQB 4MIBA 4M5DA 1XC9A 1OMSA 2HSEB 5D0HA 2QLFB 2BX6A 4CNZA 4C7QA 2H1YA 2W9BB 4X64J 3TX0A 3GWCA 1S7IA 3C16A 2JEFA 2VUGA 1ZPWX 4ETXA 4USUA 4BWJA 5HMZA 2CNOB 1RHQB 2R2UA 3CULA 2EEYA 3CCTA 3CNQP 4LRDA 2GV1A 4G6VB 2KT2A 2B4VA 5B0DA 1T94A 5KFBA 4USVA 4RR5A 2VDHA 1NO8A 4X66F 1N8RT 3MECB 3TVKA 3TEHB 2FVPA 1RHJB 1HIYA 4ETZA 3K7RA 3TOQA 2HNZA 2QEXS 4CI0B 1TL1B 3C15B 3ZTPA 3I87A 1FKOB 3CMQA 4ECTA 3M1VB 5D4NA 1EX8A 1SH0A 3IG1A 3M7VA 3BYRA 2AD9A 2RKIB 3K58A 1DQ8A 2UP1A 1FKAF 4FYWB 3BPSP 3M30A 2DR7A 3KYLA 3L9ZA 5HROB 4WFBQ 3HX9A 4KGXB 4RW7B 1N5YB 3GG1A 1UETA 3F73A 3V6KA 3RTVA 3ELHA 4RUBA 2MB0B 4UOHA 1KLMA 4W92B 2QMUB 1FEHA 4IRDA 4FDFA 2Z2YB 2G9OA 5IOLA 3R6LB 1OPIA 1BLUA 2NYIA 2Q43A 5IQQA 3SFGA 5LMUJ 5B0FA 1YGYA 2DXFA 2KRBA 3SQOP 1U24A 1TL7B 2RAQA 3BGOP 1LXNA 2I8EA 3HZGA 4WU2A 2MQQA 2ZD1A 4UOCA 3GFYA 1N36J 4NA2A 5ETMA 4CP5A 3BPDA 3ENQA 4CO3A 4F2SA 2VC0A 3CCES 1HWIA 5F41A 3A8EA 4OYAA 2IRYA 2ZWPA 1LWFB 4F50A 5AE2A 2YPZA 3EZ5A 2ASJA 2C3PA 5F8MA 2KU7A 2CPIA 3VAIA 3KLIB 3FDSA 1EP4B 1UFWA 1HQUB 2VJUA 3LA0A 3LF0A 2EBEA 3S7RA 2JZ5A 1WJ9A 2Z4PA 2UVWA 3QAEA 1SXLA 4JI8J 5LSOA 4NCAA 4HI1A 4KO0A 5C24A 2X1BA 3KTQA 4DR5F 1RAHB 1VCTA 2HQDA 3VVTA 1S0OA 1UMJA 3MM7A 3RGIA 3WC0A 1Q8IA 3NGTA 4C0OC 4ZA1A 3OFHA 3CC4S 2APOA 3SDEB 5E3CA 2FLOA 3QIPB 4DMZA 4ZN3A 3M8QB 1JKHA 1HHQA 2WCXA 3SMZA 1NDCA 1Q78A 5DZ6A 2CIMA 1QAIA 3MMBB 3CCVS 3DI6B 1KSPA 3MMAA 5F8HA 3M8PA 2BZ2A 3IO1A 1WC6A 5HBMA 4JI6F 2ZH1A 3N6NA 2RH3A 2R8GA 4FF1A 4J9VA 2OPSB 2R8KA 1F9EB 1DHMA 4H4KA 3FSIA 4ED0A 2J0QD 3NS5A 5GAGU 2W2NP 4X65F 3OVAA 3OFEA 2IJFA 3A3PB 5HVHA 2ZH8A 4LIRA 2E7WA 3DRRA 2HYIB 4KIAA 4KHPF 2AX0A 3M8YA 5LXYA 2ERRA 3C6UB 4A8SA 2FHJD 1GT8A 4NLYA 1KN6A 3F44A 2RUGA 1PYOB 5BR8F 1U4BA 2IY5B 3QNWB 3C6TB 4C8KA 4WIQA 4QIFA 1HQEA 3HVTB 5IT9Y 1VJQA 4RWXA 2AYEA 1LW2B 1OYDA 3SIPB 1WSVA 4GKKJ 3PG9A 4DDFA 3IRWP 4IKAA 5A8WA 4DR2F 4KE5A 1S6QB 3QJPA 1JLAA 4NOHA 2H9ZA 4LFBJ 1RT7B 1M5SA 4WXWA 1TTHB 1WG1A 4F4XA 4Y0FA 1W25A 1IKXB 1WF1A 4CLSA 4DPUA 2ZBRA 4FF3A 2EW9A 4Q45A 3IA0A 4R0EA 1MMLA 3IR7B 4P2XA 3RYLA 1KVKA 3HK2A 5JVGQ 2R7VA 3QJJA 2XYHB 1FDNA 5HMXA 2FLNA 3D66A 1VLOA 4TY9A 3NP5A 1R43A 4LFCJ 1SC3B 2Y1IA 1SVDA 5B0GA 1RU1A 2K3IA 2JLFA 3QO9A 1XR7A 5D3GA 3TVYA 2BOAA 2BJ9A 2A0FB 4YHHJ 2OEKA 4M5NA 2IVYA 1QE1A 2I5JB 3BF4A 3GILA 1HNZF 4GO5X 1D3WA 4Q0BA 2O3DA 3DMJA 4X62J 2ZHAA 3T6BA 2DGWA 3J7YU 3WDOA 3NCRA 3BKTA 2F5GA 3VHQA 3BQ1A 3KLFB 3M6XA 2WB4A 2F4VF 2DR8A 3R7BB 4MKBA 1TAUA 3BS9A 1VQ6S 2AKWB 3CC2S 1S4EA 2N7YA 1FRLA 4QJVA 1RT2A 4HYKA 1U47A 3CCUS 3V2UC 2VA2A 2CQBA 4DX5A 2HMIB 2KHDA 2YBVA 1GAOA 5L9XA 1S0MA 2VD3A 1R8CA 3NY0A 3C2PA 2G0CA 4JI1J 4WCEQ 3ZTOA 3QYYA 4G1QA 2O1PA 1TKXA 1KBRA 2HG4A 2KI2A 3TAMB 2HWHA 4DR6F 4DG1A 1S1TA 2JOQA 1VRUB 4F7VA 2Q66A 4DSEA 4NLSA 1YLXA 4ZIWA 4FNHA 1WOSA 2D9PA 3MOZA 3SFUA 4M5DB 1VBXA 1RT5A 4Y34A 4UZCA 2IJNA 2NUUG 3TANA 2NPIA 2VL1A 3C16B 2KXNB 2A1BA 3QSYB 3PIPQ 4USMA 4C8OA 1Y4ZB 5LJ3Y 1HBOA 2LA6A 1FWPA 1RE1B 1NHVA 4LRBA 4OX9F 3RAMA 2O67A 1JJHA 2LDYA 4F8RA 2JSXA 4ZCLA 2VDIA 1RAJA 1BD6A 3HD2A 2AT1B 5KG3A 3KG1A 3H98A 3MCMA 1KFDA 2BMBA 2YNIB 1DQ9A 4HL9A 1RUSA 2FY8A 2JRSA 3H25A 2C28A 3OTDA 2YY3A 1G3OA 4DN9A 1JXLA 4LF4J 4F26A 4YOEA 3QIDA 5KT2A 2DHSA 3JTPA 3I5CA 2HW3A 2M88A 3TUZC 1FK9A 4NCGB 4YY3J 3HVWA 2QG9B 2E5GA 2MKIA 1EIYB 2R7XA 1UFKA 3IG1B 2RMLA 2ZZTA 1GXTA 4EFAC 1EARA 1TUWA 2A2DA 2I2YA 3KK3A 5KOXA 4Y2IA 3QSIA 3M30B 3I4HX 4LF9F 3HJFA 4NX9A 3HI9A 1Z1ZA 4DR3F 2NPFA 1H7XA 3UN2A 2M2BA 4BLGA 3C14A 5F8LA 2V8DA 3CGIA 1RGVA 1MN7A 3G82A 2QV6A 1KLMB 1WI6A 1WTFA 5K9FA 4NLGA 4ZJLA 2Q6CA 2ZH6A 1OY8A 3BZQA 2BR0A 2WOMB 2AYGA 4NXNF 1R0BG 4EWTA 2KM8B 3RB4A 4FF2A 1LOUA 2ZUGA 6AT1B 1MU2A 1FTCA 4WKYA 1HI1A 5K14A 4ZCIA 1DTQA 4KHRA 3M9MB 5A8RA 3UR3C 3OR1A 3OT9A 3G8QA 4N5SA 2HBRB 2UXBJ 3HFVA 3BN4A 1U6ZA 3UNYA 5KFEA 2XS2A 1H72C 3PACA 1AUSL 5ETPA 4LF8J 4RUCA 3HT3A 3N79A 3MPDA 1R27B 1JWWA 1T95A 4ZPVR 3ZNUA 4MK8A 3CCQS 2YWFA 4FS1A 3KMQA 4B3RF 3J81j 3Q2TC 2Z57B 4JV0A 2E5LF 5FIIA 2N7CA 1R89A 4A47A 1T9VA 3ISNC 2UXDJ 1NJYA 2KJVA 2W8LA 3MPWA 4FVCA 4TKTA 2OTLS 2BRLA 1NDPA 4KO0B 2VONA 7FD1A 2CQIA 5C24B 5CYQA 3NBPA 3FK4A 1RBOB 4DV6J 1VQPS 4FP9A 3KDOA 3MM7B 3ZTSA 2KO1A 3QGHA 4CLUA 2DR9A 4RX6A 1RBLA 3CJ2A 2IAJA 3GR0A 4WP9A 3M9OB 1CBKA 1FX2A 1JKHB 4DV1F 3LP0A 4J9PA 4TLRA 1D8ZA 3DYAB 2M5YA 2EFGA 4OZ5A 3MMAB 3HKZD 3HO1A 1WC1A 4C2MA 3RAQA 5FLXU 3M8PB 3CJKA 1QTNB 3T3FA 3FBFA 3BEGB 1PYSB 5HBMB 3G6VA 8AT1B 2ROEA 2DNZA 5LM7E 5KFNA 3NOCA 2PE8A 4B9SA 2NYHA 3HHLA 4H4OA 2XLIA 2VOOA 3H2UB 1F0XA 3BBCA 4J91A 1UCNA 5GMEA 2VG7A 3HP6A 2KRRA 3BR9A 1JLGB 1WORA 2RSQA 3DRPB 4PWUA 3N6MA 3DRRB 3ENWA 1R6YA 4EZ6A 2C3OA 2YKMA 4C8NA 2CPXA 1I94F 2ILZA 1RWVB 3GFXA 3Q89A 5CABA 4C98A 3KHRA 3PM9A 2BACA 2BJ7A 2OHDA 2X7IA 4ES2A 2C42A 3F56A 3TJAA 1HQEB 4YMEA 2V5HG 3DXBA 4Q8FA 4JB8B 1PJ6A 2XZTB 1RAEB 1L3VA 1N6QB 2KVQE 3PO5A 1X4GA 4HHJA 1QVGR 1BE4A 5ETSA 1JLAB 2IHR1 3G9CA 3AB4B 2DT9A 2VU5A 3N5FA 2AU0A 3Q24A 2XMJA 1VHIA 4D3HA 3O3LA 2M70A 3ZO7A 4NE9C 2EWHA 5GAHU 3O44A 2J0WA 5LJ5Y 3OVBA 2OPRA 2AGOA 1N52B 4O23A 2XZDB 3D6MB 2UXCJ 2H3EB 2IM0A 2OIHA 3GU0A 3LGHA 2Z0GA 3R2DJ 4N77A 4CYUA 2AF6A 4DU8A 3CMAS 3PRBA 1VK3A 5F3ZA 3JYTA 1WC4A 5D3GB 2RNEA 5K8OA 3ZFVA 4RUHA 2XY6A 1PSDA 2F8MA 1RWWB 4DL6A 3J81Y 1QE1B 4Y28C 5AXLA 1S77D 4Q0BB 3TUJC 3W8GA 2QL5B 3DMJB 1BQMA 1QUPA 1TL3A 5HP1A 3OR2B 2MY7A 3AOCA 1FRKA 3EWGA 2HRUA 2AV5A 3IS9B 2YWGA 2FDNA 1FX4A 1CC8A 5IQ6A 3GCWP 3I5BA 4TU8A 2MXYA 3DOKB 3B54A 1GFWB 3PHEA 2FB0A 2E9TA 3J7AN 1HARA 2W7PA 5IM0B 4N8OA 4ED8A 4JI4J 1N34J 1W2IA 4Y6IA 1VIOA 1F9HA 4DUYJ 4OX6A 2RRNA 3AXMA 2L3MA 2SXLA 4G1QB 1TKXB 4B9TA 3Q8YA 4N76A 3VALA 4EYHB 2DK2A 2MJNA 5AXNA 3M05A 2K06A 4B9LA 4DG1B 1S1TB 1H74A 5EX3A 1XERA 3PKMA 2ZZMA 1CJUA 2ZJQQ 3H4DA 5DQGA 1QDUB 4F36A 1UA0A 2GMLA 2FVCA 2JJ4D 4RW6A 4LFAF 1RT5B 4MKAA 3KK2A 1OO0B 2ZM6F 4HACA 4HHHA 3KLEB 2FVSA 2OAUA 1REVA 2IM2A 2LECA 4C8MA 3TX8A 3PJXA 1HBOB 4DPWA 1NRKA 4NZ6A 3T5HA 1U1NA 5EN1A 1S0VA 4ZVQB 2DHGA 2H5IB 5D77A 2LLZA 3M8SA 4YS2A 1G2EA 3DKDA 3HDSA 3AAWB 5HAOA 4GC7A 3BM7A 4DS5A 2VBYA 5CHCB 4DSFA 5KFJA 1LK7A 2CQCA 1RP5A 3TJ9A 2QFIA 1NK4A 1Q82T 4LF1A 5GAEU 3UDEA 4C3MA 2HZVA 3W9IA 1T03B 1FK9B 4L76A 5E3QA 3HVAA 1C1BA 1RAFB 1YVFA 4U95A 2VFUA 4EGLA 5ETKA 1VDHA 2XMWA 5HJYA 2XHCA 4P10A 5KT5A 3CJ8A 1H38A 2XMTA 4O3RA 3KG4A 4ER8A 4WZMA 2KFYA 5F0UA 3J80U 4AL5A 3PYEA 1X0FA 4ED6A 2N3LA 2ZH9A 3UVJA 1SCJB 5HLFA 3JSMB 4RNMA 3G82B 3R5DA 4X4SA 2QTWA 4J37A 1PBUA 2ZBCA 4HR2A 1FJGF 2D9OA 3DXSX 3DN9A 2VQEJ 2OPPA 1NJZA 5KFRA 4GKJJ 1T8EA 4M8LA 3BDEA 2HBZB 2WVDA 1NCLA 1SUQA 1RTDA 1NU4A 4LF6J 1J5EJ 2VC1A 5I42B 3W5ZA 2QLJB 2X3DA 2ZBIA 2MMYA 4LRAA 1DRZA 1IBCB 3T1HJ 4IG0A 2F65A 1S1VA 4WJBA 1MU2B 3ENAA 3CPWR 2CPFA 3PY8A 4PXCA 1NSAA 1HI8A 5HQLA 1IBKF 5A8RB 3OR1B 4F3MA 3C19A 4FN5A 4RW8A 1LW0B 1L5UA 4CO5A 3TR5A 4X4QA 1Q95G 2V6AA 2AJ0A 2W2QP 3HFKA 1UWBA 3EICA 3P96A 1GX6A 1Z2ZA 4ZIVA 2HZCA 4DV5J 5CZXA 1XMQJ 1RQ0A 3KUHA 4OX8A 2V4QA 3TZXA 2ZE2A 3ZTQA 4NLQA 3R6GB 1FKPA 4FPRA 4QPTA 1RWXB 3OV7A 2AEMA 2DR5A 3AD8C 2XMAA 5CYQB 1T3OA 1Z4UA 2QA4G 1EB0A 5CYMA 1HYSA 1IQTA 3CMES 2XMMA 4QWBA 3P5TL 3DC2A 5D4LA 2LU2A 2IAJB 5FDLB 2ZKUA 2M4MA 3MD3A 4KGVB 1V5IB 3H42A 3NMAA 2HQIA 3LGNA 1MROA 3LP0B 3GIJA 1ZA1B 4OI0A 2V68A 3SI8A 1SQEA 2X1GA 3W2VA 3P45B 1R8PA 1TK0A 3IC1A 1O5JA 5K5MA 1U1PA 2IBKA 3M2RA 3IWNC 3CJKB 1R8AA 5J2NA 2DGUA 3O1LA 3KJVA 3TA1A 1HL6A 3CSKA 3HHLB 4QR1A 4H4OB 4BCAA 5IT4A 1YJNS 2DHXA 4KPYA 4WF9Q 1LKZA 1U1KA 2CWXA 2HFUA 5HVGA 2VG7B 1HNWF 2F7VA 4YB7A 1NEEA 4KB7A 3ADAC 3QRPA 4LRCA 1MMNA 5ADZA 2YXLA 2XS7A 2YKMB 2MLYA 3KHLA 3R9LA 2MZJA 2OEMA 1S5ZA 4WP3A 1KC8T 4X66J 4DL2A 2KXHA 3K2YA 3T5LA 3Q22A 2R8HA 3G6YA 3VAFA 2W9AA 3R7NB 3MUTP 3SBMA 5H9FJ 3TO8A 3V4IB 4JV5F 4Q2MA 4ERDA 1S9GA 2HHHF 4KSEB 4AUKA 3E8OA 1YBTA 4LQ9A 2B4OA 4URSA 4DSKA 3G6ES 5J2MA 4Y2CA 2F9JA 1URNA 2E9ZA 2P8IA 4DCOB 4EO8A 4URQU 5F0WA 2W9CA 4RU2A 2KTQA 2DO0A 1JIHA 2XB2D 3IGNA 3NKYA 3CTRA 3NCQA 2JEGA 4TLQA 2RQCA 3PEJA 2I38A 4PPDA 2BJ1A 2JFDA 1HNVA 1KEKA 4ECXA 1G7CB 3LW5C 2LXFA 3CD6S 2OPRB 3OL7A 2XZWA 1HBNA 4CO0A 3I4PA 1U6BA 3MDFA 2HQ3A 1T05B 1Q1KA 4RPFA 4CYUB 4HTJA 1CEZA 4F3QA 4PWDA 1RWPB 3P4UB 3JYTB 1GTHA 3TA0A 2DHHA 5C2GA 3SV3A 1B64A 3EDRB 4OL8A 1S6UA 4UTGA 4YFUA 4FPIA 3GIMA 4PQAA 1RB0A 2Z2MA 4RBUA 4J9SA 2G0JA 4C3KA 3D3BJ 1TL3B 5HP1B 5HI7A 3TI0A 1NMEB 4HTIA 4LR7A 3GZ7A 2QFJA 4C8YA 3RUBL 1ZM2A 2LXIA 1S48A 3H5YA 2Q6BA 4I69A 2N3OA 1SQFA 1ZM3A 4PG8A 2WTFA 3EGVA 4MH8A 4DL7A 3CJSA 2IM3A 1TQLA 1RSCA 5DQIA 4IFYA 4HI2A 4FYYB 3PKYA 2BE7D 4ZJQA 4WBFA 1X4CA 3ZZOA 1VR6A 2W25A 5KFZA 2C2EA 2PMHA 3N5BA 4BC9A 3T9NA 1F2GA 3GYXB 1ZA2B 2EFPA 3M9NB 2VASA 2GQCA 4ECZA 3CIMA 3VQSA 1C0TA 1M1HA 4ZMMA 3Q8QB 5A0YA 4UT4A 4NYZA 4ZLLA 3BO2A 5T7LA 2CPYA 4DR5J 1SBRA 2QLXA 4CT8A 4RW6B 3M6UA 1ZOTA 5KFLA 3KK2B 3CD7A 4CTAB 3NRBA 3T1YF 4Q8EA 3LUYA 1REVB 1RXOB 2D41A 4I4BA 1FXRA 2LCWA 2CRLA 3EGZA 5KFIA 4DBQA 4I64A 3MURP 2ZHBA 6FD1A 3D0HE 1FE0A 2DJWA 1YJUA 3B78A 3S6EA 1HHTP 3U1MA 3BYPA 1N0UA 5KG7A 4JI5F 5LSRA 5KT3A 4JI6J 2WSCC 3CJ4A 4OYBA 1ZTWA 4HEA9 2D3OR 4H54A 3ULHA 3D54A 2PGCA 4CT9A 1YX2A 1FI4A 2C2OB 2V2KA 3G86A 1NLKL 2DH9A 3R5BA 2LA4A 3D1HA 3DLGB 4X65J 5K8MA 2CG4A 1VQ5S 4QIVA 1HW8A 1O0PA 4KHPJ 2XG8A 1C1BB 3QPIA 3C46A 2PEBA 2ZUAA 5DQHA 4DV7F 5H9EJ 5HO4A 1VHFA 1T3NA 4EYIB 1H2VZ 5D0EA 4G3IA 2YNFA 5BR8J 3CDWA 2WVFA 1JLFA 1KOOA 4AXJA 2LU1A 9RUBA 2GFFA 2F9DA 4KBIA 4EZ9A 3BSNA 4OJ3A 1PAEX 4RNNA 2GJFA 3JSRA 4EBEA 1Y9OA 3VV2B 3AODA 1XNRF 4PUOB 3E01A 3UVJB 2ZH7A 4DR2J 4X4UA 3UE2A 3MM5A 3EZOA 2MZ1A 3W8PA 3A8JA 4WZQA 1V9OA 5ETLA 1CLFA 3THTA 4TY8A 3LOUA 2X1FA 2RUSA 2OPPB 3AFGA 1U49A 2AMCB 1VC5A 2JEJA 1RTDB 5HVFA 5IV4A 1S1WB 1WHYA 1TKTA 6FDRA 3IRXA 4IUFA 2MEWA 2I9SA 2UUAF 4UY8T 4FF4A 5JJBA 3I31A 1UVIA 1M1GA 4IH6A 4CZCA 1LV5A 2CQHA 2FHOB 1BUXA 2HFZA 4QW8A 2BJEA 4LF5J 5K20B 2J6SA 2ATLA 4J5OA 1F5CA 2NCKL 2CQGA 1PGZA 3TRGA 4ZITA 2HHWA 3CEDA 4RW8B 1S1UA 3D7SB 3MPYA 4LMZA 3OJUA 1HNZJ 1P1TA 2CPHA 3VGVA 5DDPC 4CM2A 1NBEB 4PAAA 4WE1A 5DS7A 2HLUA 3K8VA 3L7OA 2VKZG 1UWBB 4QU7A 1TZ0A 2WONB 2AJ4A 4LVOP 4Q43A 2F4VJ 1SL1A 3RRGA 1IVZA 4UF4A 3WQPA 2CWKA 2CJQA 1TMJA 1FKPB 2VJVA 4I1TA 4DUTA 2P9CA 3ICLA 4M63A 4IRCA 4FYXB 2XSJB 5CYMB 1HYSB 3I55S 4MIWA 4RNHA 4FXWA 5I3PA 4MKVA 4ELUA 4JUZA 3CWJA 1RWUA 2B3TB 3NGKA 4AFFA 1FD2A 3HT0A 5BYRA 3V6DB 4QWCA 1Q8KA 4B9NA 4DXLA 4DQIA 1MROB 1HBMB 4DR6J 2XI3A 3N28A 2DNOA 1V3ZA 3W2VB 1XQIA 2DKOB 2V2ZA 2A10A 3FMBA 1NJWA 3IAM9 2FLLA 3W62A 2HHUA 4MAKA 3M2RB 1NJIT 1KFSA 1L3TA 3PIOQ 1FCAA 5J2NB 2DNYA 4ZVHA 4DHVA 1SQGA 3KJVB 5K8NA 4DL5A 4RL1A 1QSLA 1F6TA 4JOUA 5SZTA 2FJBB 1X7VA 1AXQA 5A76A 2VODA 4OX9J 4OHZA 4QWAA 3W60A 3MPUB 1VLYA 3GJRB 3V5RA 4OHWA 5J1NA 1J2VA 2HK3A 2F40A 3PO4A 2BDPA 3TZYA 1WHXA 2BJ3A 1Q79A 4JI0F 2WBMA 3UDVA 2CVEA 1JLCB 4M5KA 4PYAA 5IS2A 2JX2A 5C7PA 4J7CA 3AY0A 4DEZA 2Y3YA 2HAIA 4CO1A 3D1QA 2A6OA 3FEXB 2G1DA 2QMWA 3PRDA 5KG1A 4ECQA 1S9GB 4MTPA 1OYEA 3LWLA 3SQGA 2RIJA 2KZMA 1X31C 2NLWA 3LPYA 5J2MB 4OI3A 4TVAB 4ZKAA 4CWBA 1HWUA 2VBZA 1S12A 2W9CB 2ZH5A 3S8SA 3ENVA 4ICLA 4P52A 4BDPA 2VBWA 4WK3A 2LQ8A 2KDOA 1IKVA 4FXDA 4W90B 2CQDA 3VGUA 3CJ5A 4IR9A 4JI2F 4LF9J 2KN4A 1HNVB 4DR3J 4PG6A 4JV1A 3IN5A 2CQ2A 5L1LA 4TQRA 3MCSA 3NCPA 3EDQB 2DNQA 1HBNB 1K8AT 4DF4A 1YRTA 4RBVA 4K4TA 1NZAA 3EGNA 3HSZA 1L3SA 3V6JA 4PWDB 1FRMA 1X4BA 3NEKA 5KG5A 2M3DA 2DBBA 2E5HA 1EP4A 3PJWA 2V2QA 1A9NB 1JMTA 4JYAF 2V50A 4NXNJ 3Q8RB 1RT4A 3VAHA 2K1RB 4P72A 1WOOA 3EUNA 5DM7Q 2AJQA 3CDUA 4I7FB 3MOJB 3QLHA 5FD1A 4DV2F 3AT1B 2RHSB 4QIEA 4CQ1A 1CJKA 3NLCA 3MPVA 4G65A 5KFOA 2RDDA 5JUMA 1UVLA 3QIPA 2M0GB 3MCNA 4OZNA 4ES1A 5KFPA 2D3O1 2R7RA 3CO0P 1GXLA 1SPBP 3DI6A 4TN2A 4B3RJ 1UEVA 1UZHA 4F25A 3R7SB 5E5NA 2BXJA 3GP9A 2E5LJ 4B3MJ 3KJNB 3VWSA 4ATNA 3PYDA 2QA1A 1WI8A 2FGOA 2CJBA 2QO3A 2CZ9A 2OPSA 2ROPA 2QSWA 2ZH3A 4LJMA 1C0TB 2N82B 2H5JB 2C2KB 1H2UX 2MSTA 5A0YB 1F2HA 3W9JA 2NZ4A 1H2TZ 4TQSA 3T6JA 4K59A 3DLEA 3BQ2A 1NH8A 3F0NA 1X5SA 1KD1T 3FNNA 2C2RA 1FD8A 3PFEA 4P6QA 3VF0B 1OS5A 3ISND 4DV1J 3ETOA 5HL7Q 4OZ2A 2ZDOA 1Q7YT 4QYRA 2E44A 3HXMA 2JHEA 4UW2A 1LW2A 1IBMF 2KHCA 3IGVA 1U7LA 1FRHA 5E3RA 3S1TA 1T9TA 1TKZA 4P73A 4R0JA 4F2RA 4Z2XA 2VPZB 1QJHA 1M5HA 1QAYA 1B4SA 4OLPA 3MM6A 2ZJPQ 3OUYA 3IBWA 3TQ1A 4LBPA 4J9QA 1IKXA 2K8GA 1XN9A 2LQ5A 5KFAA 3TQEA 3RJMB 3HKWA 1RACB 1FERA 2XEXA 3R97A 2V4JA 2BA9A 2VQFF 1XBWA 1ZTTA 2PA3A 1WOPA 4W98A 2PFDA 2RS2A 1K1QA 1I94J 2CJ9A 1GMWA 2CZ4A 4NWBA 1R31A 2YNFB 1R0AA 1JLFB 1D9AA 3BBFA 5DG7A 2PIIA 2W7AA 5EDWA 3PJ9A 5B08A 5AJ3F 1NPPA 1X9MA 3DLLQ 4CH7A 4DFPA 2MKSA 1S9EA 4P7VA 1IWGA 1N5TA 2BM1A 3CW2C 2QYCA 5C42A 2AQ4A 2HWTA 2HZAA 4A8OA 3E01B 1WELA 4PR6A 1U09A 3MM5B 2KYZA 2YWEA 4FNIA 4AT1B 4TY8B 2Y1LB 4OYOA 5GAHI 3NNCA 1B3TA 5LMNF 3K59A 2HRYA 1X4HA 2W8KA 2CADA 1ZAVA 5E33A 3IRXB 3QGPA 3I9ZA 4CLYA 5CD4A 3KHGA 1P8GA 2QSFA 1LEOA 2Z56B 2B9YA 1OSCA 1UEUA 1ZM9A 2DNHA 1YJWS 1FDAA 1ZH5A 1JX4A 2P9EA 5LT5A 1X5PA 1K1SA 3DOMA 2JVOA 1OIAA 2FUG9 1Q5VA 2Y8WA 3DRSA 5F8GA 5AE1A 1LWXA 4K7QA 2A2CA 4P7TA 5I3UA 4U6PA 5L9NA 1BQNB 1F3FA 4F0HA 4WE1B 4PWWA 5B0BA 1HD1A 1Y11A 2WZ1A 3P5BP 1GMVA 1HW9A 2NSCA 1VRUA 1PIEA 1UJ4A 4ZPCA 2FC8A 5KOWA 2NUHA 1YBUA 3T41A 2RILA 1X4EA 4C0BA 1APSA 4OJGA 1JXEA 2XSFA 2AJFE 2A18A 5E41A 4FKYA 1D8YA 1WG4A 4HDGA 2JLGA 2HHQA 1YBAA 1N56A 1YZ7A 3AQPA 2YKPA 1NM2A 2RQMA 1X9SA 2E7VA 2YNIA 3A13A 3GCXP 4ZVEA 1XMOF 1WG5A 3L3CA 2IMWP 1VBYA 2CQ1A 3SSRA 3IMQJ 4ZPWR 3W9HA 3R5AA 2VG5A 4PXDA 2G13A 4PYDA 1U1RA 4I2QB 4NYPA 4LF7J 2ZOFA 3DU5A 1AZSB 2H65B 1NZ8A 4LFAJ 5DG9A 1KONA 2RT3A 1KQKA 3QT5A 2ZM6J 2CUYA 4NCGA 4F0KA 3VAKA 2UZAA 3G96A 3EVMA 4EBCA 1F5AA 4C6AA 5KFTA 1VJWA 2B9WA 5BYSA 1HQ2A 3MXHP 3F41A 2P6SA 4OQJA 3DOLA 3U7JA 5HSPA 2WSEC 3N01A 4L74A 5M2PA 5L1KA 4YR0A 3DHWC 4Q5VA 3OHAA 3VTIA 4DPYA 1X9WA 2GIRA 1NK5A 1CJTB 1UJ5A 4AD6A 1PAUB 2Y1JA 3PW2A 4LSLA 2XULA 1ZETA 2R7SA 2QIFA 3SQGB 2DR6A 2BRKA 2WOMA 3CCZA 2JEIA 2LDIA 1RTJA 2E29A 4Q2LA 3FCVA 3H40A 1F9FA 4ICLB 4EUVA 8ATCB 1RTIB 3E3XA 2AX1A 4EI2A 3CJ3A 3H2VE 2R7WA 4JBCA 1IKVB 1U45A 2MKKA 2Q3PA 3H4BA 2B51A 1Y5NB 2C2NA 3B4DA 2PFFB 4DV4F 2LKZA 1OY6A 4U8YA 5G0RA 4RWWA 4WP8A 2YX1A 2WW8A 5CXTA 1QUVA 2AGQA 4CLWA 2E1PA 3D6TB 1MNEA 5F8IA 1VQKS 1IJEB 2VICA 3M32B 3ILOA 3R5JB 1YRXA 3HPOA 4PQUB 1FJGJ 2YKQA 4NLXA 4YQWA 3FSXA 2ZVSA 2B9XA 1YJ7A 3TNVA 1N5SA 3JAMU 1Y3KA 5B0AA 3EVWA 4KGMA 4K50A 5HK4A 2AJ1A 1RT4B 4X4OA 3CUNA 1NAQA 4F04B 2B8PA 3MHYA 4CLZA 3FRZA 1S57A 4OZ0A 3A4TA 3T9ZA 1XMBA 4EU0A 5A6PA 3E2EA 3QLHB 1R0CB 1IBKJ 3AD7C 4OZJA 1CJKB 4UQTA 2RQKA 1BXNA 1Q8BA 1B0VA 1CQMA 1RADB 1MWYA 5DDOC 1O51A 1LWEA 3D4JA 2MPUA 1JLQA 1FA0A 3IM8A 5M2RA 2R7OA 4K5RA 2OD4A 3DYAA 3T1AA 2ZZNA 1D9DA 2RHQB 4I68A 1X0PA 1ZS6A 4WWSA 4DSLA 2IDEA 3TZWA 3HZEA 7AT1B 1YDLA 1PBAA 5J2PA 2DCUB 1GH8A 3CC7S 2KVIA 4E0DA 2CPZA 2ASDA 4ZPDA 3JQJA 3KLVA 3D28A 2PDAA 2QLWA 2XWYA 2DNNA 1K9MT 2YQ0A 4ZPBA 1EHWA 2B43A 2E66A 4L73A 2GO9A 3VAJA 1RWMB 1JLGA 3A12A 3UN3A 3DRPA 1TVRA 3OXLA 5KT6A 3RZAA 3DLEB 4DQRA 4C4WA 2HNYA 3ILJA 2W4DA 2PO4A 3QQCD 3IR5B 1FJ7A 5EGYA 3UCGA 4WTYA 3ZZPA 3CCLS 4KAIA 4CO2A 4Z37A 4AE5A 4QW9A 2GHPA 1N6QA 4BC7A 3P8BB 4Y2AA 3R2CJ 4RBTA 1FFSB 1X4AA 1TKZB 2BKPA 2GVDB 4DI6A 2J9DE 1FNOA 3MM6B 2MLZA 2NXNA 1H7WA 3OUYB 3D6FB 4MYTA 1NSKL 1HNWJ 2V9KA 3W7BA 4BWMA 3DRYA 2V4JB 3E51A 1VQNS 3SCKE 2B7BB 2CFXA 2Y0SD 2HKEA 2WRMA 4A4JA 4YB6A 1VQ4S 4J9KA 1R0AB 2G2OA 1Q4RA 3UW1A 2ZC3A 3HSDA 2LXUA 4QWDA 1B70B 5HN0A 1PKUA 3GB0A 2RD5C 2OKQA 1M1KT 3POTB 1S9EB 4JV5J 1U0HA 1HNIA 4Y2MA 2CAJA 2FJWA 2HHHJ 1JLEB 5C42B 1KR4A 3KFWX 3FEYB 2EBGA 3GYGA 2XO6A 4HLBA 1HR0J 5FLXY 1NNDA 2CNLB 3VR1A 2XCAA 1WKJA 3OR2A 3ITHA 2KB2A 3W65A 2PI4A 1X60A 1TK5A 1MMDA 2CVIA 2MKJA 3UQSA 1TFWA 2V2VA 4J90A 5IC6B 1PC4A 2MKYA 4G1PA 3IS9A 4GRSA 3K5LA 2IJRA 2L9WA 2W01A 2L08A 4XPEA 2BABA 4H4MA 2DIVA 3DOKA 2GGPA 3L7UA 1QAXA 4S0MA 2MZQA 2RVJA 3D68A 3MEEA 1HNXF 4ID5B 5IM0A 2A3JA 1SC6A 3FBEA 3DOMB 3GIRA 4NCBA 3DRSB 4OZLA 2V0NA 4DF8A 1Q8LA 3OTOF 4K4WA 4QZVB 3KHHA 4AYBD 5I3UB 1ZAWA 3PDNA 3CT9A 4A8QA 1GQEA 2ASYA 4DL0C 3AJDA 2OD6A 2C2DA 3RAXA 1O6XA 4USWA 1PJ5A 2ZJRQ 3LALA 2J7KA 1D09B 4USJC 2NSBA 1RAAB 2YWWA 3KLEA 1VRTA 2GJ2A 4MIAA 4K8RA 4DL3A 2E1RA 4RNOA 2KG1A 3IWLA 3AB2B 2OEJA 5L39A 4BS2A 1EQMA 3JQMA 3G4SS 2DYAA 3FKBA 4IG3A 4J9NA 1CC7A 4QWEA 2NXEA 4IR1A 5CQGA 3LWMA 4Y65A 2IVMA 3A3NB 1U0SA 1TKDA 1N32F 2CJXB 1LK5A 1HMVA 3C3LA 3FZ2A 3KJQB 2XNQA 4LR8A 4AQYF 4DV3F 5GADI 3QRQA 3HHLD 3QATA 4YB5A 1A6LA 5THWA 2VG5B 4URGA 1E6VA 5AXKA 4HT5A 3N9UC 2M9KA 4FYVB 1T03A 2H51B 5IZHA 3T1YJ 1PO6A 2O66A 1YRUA 2CQ3A 2MKHA 3PW5A 2ZBPA 1G4CA 3B82A 3VVUA 4CH0S 2KH9A 4IRKA 3K57A 4XK8C 1YWXA 2DRDA 2QN6B 2K2PA 3DOLB 2YH0A 3MEGA 3RBEA 2U1AA 5KFVA 5F8NA 4PXEA 3WHIA 3GV8B 4JI5J 3L09A 5KFSA 1RHUB 2XGQA 1TK8A 4C3LA 3JSMA 4B3OA 1SJ3P 3HCXA 1F5BA 2MZRA 3PYFA 9ATCB 1V5VA 2HVEA 4LSLB 1FTRA 2DXEA 1CPZA 2CQPA 4FZVA 5I42A 1SJ1A 1RTJB 2DNGA 1B99A 3QMQA 5HQMA 4DV7J 2F3JA 1VGYA 2D74B 1IUJA 4CNYA 4P9SA 1M0SA 5H9FK 5G0RB 1BQXA 4KQZA 1XNRJ 1KNZA 1RAIB 1LW0A 2RRBA 2X3GA 4HT7A 2EVZA 1H0HB 3OFGA 1UA1A 1IQZA 3GPAA 4ZVOB 3TYTA 3B6BA 3MFIA 5LSLA 2CPDA 3FZBA 3A8KA 4DWIA 1WHWA 2QL9B 3FMWA 1RTZA 5B09A 3IR6B 1OQ6A 3L7PA 4GC6A 4C11A 3MR7A 3MR3A 3HD1A 2G1HA 1IBLF 3H20A 4N56A 2UUAJ 2ABYA 4GVBA 3MAAA 5E0OA 4EMDA 1YHQS 2AHOB 1NXIA 1GMUA 3OLBA 2CJKA 2QLBB 4ILLA 2QE5A 4NRTA 3BGRA 5CAAA 2IM1A 4GVLA 1YTYA 3IWXA 2WVCA 5FDLA 1RKIA 1FJEB 3MD1A 3J80Y 2ZOGA 2DEJA 1TR0A 1LWEB 1JLQB 2CPEA 1CQNA 3P49B 3H5SA 2YH1A 1J5OA 1DBDA 4ZVRB 2VG6A 1PILA 4F0MA 1DTTA 3MTJA 3KK1A 4C97A 1SJRA 2DISA 1IR0A 3D67A 1IM6A 2GZOA 1XR6A 2OGUA 3OHBA 3OW2R 1MG7A 3U1NA 5J2PB 2HEKA 3ZZ0A 1AUDA 1UW4A 1UFLA 2H48B 1I1GA 1SH3A 3EVOA 2HIYA 4NLTA 3PXGa 3OLAA 2J6TA 2EKYA 2HURA 2J8SA 3NGUA 4GMKA 2FTRA 3ZZZA 4PPZA 1TVRB 2R2RA 2GQ2A 4CLFA 4ECRA 4XPCA 3Q8PB 2KM8C 2ZKTA 2HNYB 3EGWB 2Y1RI 4QCLA 4PZVA 3KNGA 2XYPB 3CVKA 4PEOA 4DCPB 1S9FA 1FNMA 4ZS6A 2QMXA 4B02A 2FPHX 4ES3A 3RR7A 3K89A 4DFMA 3BH6B 2K3KA 3KOAA 3V4IA 3EE3A 4XDDA 2FGCA 4V1Ak 2DITA 4X4RA 4UY85 2H54B 4N8NA 4J9OA 4DOZA 1OSDA 4ANEA 4EO6A 2NREA 1WKKA 4K2XA 3QT7A 4Z7CA 1UVJA 4DJBA 3IM9A 3RW6A 4JV2A 3WIUA 4ECUA 3DFEA 4NEZA 3AJ2A 3MGJA 4JI0J 4TU7A 2V69A 2VHGA 3P3DA 3PX4A 1J27A 4F4AA 4ZP6A 1T05A 1RDRA 2J76E 4K0KF 1K0VA 2ROGA 2PMWA 4HKQA 3SV4A 1U0HB 1HNIB 2DHAA 4R8UA 2U2FA 3FFIA 3EJMA 1U8SA 2EPIA 3KXDA 1H98A 5DO2A 2QL7B 3PNIA 1LNQA 1XNQF 4HVZA 1C2PA 1NDKA 3ITHB 1EETB 1W26A 1NK9A 5H9EK 3IP0A 3CJTA 1S72S 3MCOA 4ZK7M 4LRFA 2YX7A 3V81B 4JI2J 2C3MA 2ZNYA 3ZZYA 2DGVA 2WAQD 4DZ6A 4B9UA 4B17A 1JJCB 5DGAA 4X4NA 4H4MB 2YVSA 3IBCB 1VQLS 2GGPB 1G6BA 4H4KC 3OD2A 4ZP8A 4MT1A 3GJQB 1AYEA 2NXJA 3MEEB 4PG7A 2EK1A 3GSDA 3W63A 4J9LA 2GNKA 4AXIA 1NHKL 4CCHA 2NQPA 3AA8A 2VV5A 2HGNA 4OYZA 2VA3A 5H1SV 1RLDA 1T9XA 4IDKA 3NNAA 4JYAJ 2WBRA 1RI7A 2MYFA 2KL8A 2VBXA 4YB1P 4WFXA 3KWMA 2WVEA 3UNGC 1N48A 2DGTA 2GA7A 2YKNB 1RK8A 1KTVA 2UUCF 1JK9B 2B8QA 3CD5A 2HGLA 4ELVA 4XAKA 3K5PA 4DV2J 5DDRC 3WBZA 1NJXA 2MHEA 4CTAA 2VFTA 5EX0A 2R4FA 2EFOA 1VRTB 1UAWA 2DGSA 2WB1D 1KLNA 3I82A 1YIJS 2BW7A 1U25A 4P2FA 2DGOA 4ECYA 1HHSA 2ACYA 2UUBF 3CXCR 4IO9Q 4IG3B 3JS9A 2M8HA 3ILLA 1FFGB 3NGDA 4KT0C 3GG0A 1S0NA 4FBUA 4DPTA 4AL6A 3ZZTA 1KHWA 2XY5A 2R2TA 1A7GE 2WSFC 1HMVB 1HKAA 4DFKA 4OX7A 1WWHA 2YKAA 5DGBA 2JVRA 1N33F 5HQ8A 4WU3A 4I56A 1PYTA 3M8ZA 2PSZA 3DLGA 4B9VA 4A46A 1E6VB 1U2RA 1VQ9S 1SKWA 3VGTA 2Q79A 1Y10A 3CCSS 2FYXA 2JLEA 2HQCA 3VGSA 3W2WA 2M7SA 2RS8A 4I0WA 4P71A 1FO1A 1FWKA 1Z2LA 1SH2A 3GE9A 1FRJA 3QT6A 4ALZA 4O3OA 5D6GA 2BKOA 2P2CB 2YWKA 2KXFA 4WFNQ 4C8ZA 2BOPA 3MEGB 4A48A 1V3SA 1IBMJ 1NKBA 4PUOA 2IBOA 3CJQA 1WDTA 2Z2LA 4KH1B 1P6TA 2BVZA 4B3OB 4KKOB 4AL7A 2RU9A 2PA8D 1HFEL 2E7XA 4QYZJ 1RT3B 1HLWA 1LFWA 5CCLA 2DH8A 2I0XA 1VQ7S 3JTNA 1F1BB 2XCPA 5KTQA 5RUBA 3PW4A 1RAGB 1S1WA 3D2WA 1KWMA 4M5HA 2DGXA 4WIIA 1BC6A 2VQFJ 4RO0A 5DG8A 1NB2A 2AGPA 2CA9A 2QYGA 4NEYA 4QU6A 4MKYA 2MSSA 5KFDA 2LP4A 1M90T 3BKFA 3MM8A 2VFSA 2B9EA 2FJEB 2Z30B 1S6OA 2RJZA 2Y9HA 1X4FA 4DR7F 3W3SA 1SIZA 2GVZA 3TP2A 5AJ3J 5KFKA 1RYRA 4ZPTR 2RDIA 4DR4F 5A8KA 4RW9B 3VAMA 5B0CA 3X1LB 1UVNA 4NASA 3LTOA 4LBIA 2FIUA 1W2BR 1XTZA 1S1XA 3NGRA 1N4LA 1H6KX 3W1YC 2HLTA 3MEDA 2D1CA 1KHVA 1X4DA 4DLGA 2KT5A 3EM1A 4OHXA 4NLPA 1UVKA 3J7ZT 2JNJA 4DS4A 2OI2A 1XEZA 2WONA 2YQ1A 3TAPA 5LMNJ 2VZ9A 4C11B 1VQSA 3PR5B 1NKCA 1EJ7L 2XC9A 3QJLA 1H3DA 3NS6A 3H0PA 4U67Q 1RWKB 1S99A 4B3TF 2GMHA 3MAAB 4GVBB 3RBDA 5D78A 1F60B 2I6WA 3O2IA 1FESA 2XSJA 2MZTA 2UU9F 3IBFB 2DRAA 1WF2A 2XBPA 4TYBA 3JB9k 3KJFB 1DFDA 1XR5A 3KKFA 2HPUA 3BGRB 3CIZA 5HJXA 5ETOA 3Q8VA 2HGMA 3V6DA 4NLRA 4YDXA 4FYDA 2OFHX 2ALZA 3DLHA 2VH7A 4PKDB 2XS5A 4X2BA 3SCJE 1TFYA 4NRUA 5C5JA 1Y3JA 2CG8A 1HBMA 1IKYA 4B3SF 1YJTA 3G87A 1J5OB 4LF5F 5B7WA 2VG6B 3MR5A 2IC3A 1DTTB 3KK1B 1GTEA 3BDPA 3V4MA 2DNPA 5T14A 3OXFA 4L72B 3OL9A 2DY1A 5EWFA 3OFFA 1YSJA 1RT1A 2MQNA 4U96A 5KFHA 2J9CA 4LSNA 1QLNA 2BM0A 3QT8A 3JQKA 4IOCQ 2C22A 2CPJA 3RRHA 2VPWB 1OPZA 1YG0A 4OYWA 4ZCMA 1FHTA 4FXVA 3HJVA 5BJRA 2CXEA 2HFOA 3K0JA 4O3SA 4O0IA 5K8PA 1JLCA 4KGZB 2RF2A 2NR0A 2FD2A 2D3UA 1D0EA 4ZVSB 1XMOJ 2UVUA 3VZIA 2ZH4A 2DPJA 3BSAA 3DLKB 4I6AA 3AJ1A 1ICEB 3FRYA 1S49A 1S6PA 2XTJP 1FWLA 3KMSA 3R5CA 3MM9A 3PCOB 4F4WA 1XIQA 4WKRA 4YR2A 3OBIA 3MMJA 3O5TB 1KS2A 3OQ2A 4PRFA 1RA6A 4OMFG 1NPRA 3R8YA 2EC2A 1KDNA 1M5PC 3NWRA 1BY9A 3D5MA 4N7TA 2B6AA 5CH7B 3T5JA 1WD6A 2ZNZA 2ZEJA 5IWAF 1FNXH 3FBCA 3MEKA 3GR1A 4KYZA 3G8TA 3AH6A 2G2YA 5D4PA 2BQ3A 2E1CA 3NOGA 1SJQA 2UUWA 2FZGB 2HFSA 4R8UB 3OXGA 3FFIB 4DV0F 3U02A 3O6QA 2HHPA 3PRVA 2FY1A 3GIIA 2FHJA 4KGKA 2EI5A 4KRWA 3MR2A 4IYQA 2K1RA 2V9WA 3RBZA 4ILRA 5KFCA 4QR0A 4ZLNA 2GQQA 4QR2A 3HFZB 4QBUA 1GEHA 4CM0A 4I7FA 1T9UA 4DV4J 2RU3A 5ETTA 1NDLA 3BJYA 4OI4A 5MLCV 3VAGA 1U1QA 3QBCA 2HNZB 3ZC4A 2OUGA 4OYXA 3W5XA 3HHLC 4USIA 4MFBA 2FVRA 2W2OP 1ZAXA 4OIXA 3MZIA 4DUZF 3MAHA 1IM4A 2R2SA 3L4BC 2ZVIA 4JI3F 2DD8S 3FC9A 3FCHA 4PG4A 1VI7A 4IDKB 3FGVA 4I67A 3TW0A 1UJ6A 4L75A 3M8WA 2PC6A 2N4DA 1P9QC 3BR8A 2XWXA 1HI0P 4E8UA 5LXRA 2WVBA 1JB0C 3UR0A 1SKUB 3RBXA 3UCZP 3GQCA 3Q86A 4K4UA 2ASLA 3CCMS 2AZ1A 1QY7A 4MK7A 1N54B 1SV5A 3DGVA 1MWQA 3RU0A 5F3TA 3QGGA 1OWXA 4P2MA 3I96A 2DY9A 4LQ3A 2CNKB 1WEYA 5A2QY 2GW8A 4OI2A 2M8DB 3PFOA 3EPIA 2ZD1B 1OJ4A 4NLOA 2E5JA 2PD1A 3AA9A 3T5KA 2V8HA 1Q5YA 4NA3A 3M2VA 2LQ9A 1UEKA 3CCWA 3HMJG 3A3OB 2R8IA 1UKUA 5F9NA 5EWEA 4IFVA 4TXSA 1R8BA 2DO4A 4O3NA 4P75A 4L3NA 1T02A 5IT9U 2PN6A 4OV6A 3PEHA 4P2SA 4F3OA 5LL6d 2CQ4A 2BEFA 5GAGI 4RKUC 1YK9A 2EKNA 1IR1A 2V67A 2V8VA 3BV8A 5D4OA 5JXSA 3FEZA 2DXDA 4B3MF 1V3RA 3KUGA 3TWZA 1KVJA 4YP3A 2XM3A 1AFJA 5CCMA 3SXLA 2CDQA 5BXIA 3LAMA 3OTEA 3W2WB 5KT4A 3DNCA 4CRJA 1U8WA 5ITHA 2NZCA 3UDLA 3AD9C 1BWVA 4RW4A 3EX7B 2YTCA 1SL2A 1HBUA 1NK0A 5G4DA 5FJ4A 4O3QA 3OSPA 3H90A 2DNKA 5F9LA 3ZXWA 1YJ9S 4ANCA 1OQ3A 4NI2A 4YDDB 2N4CA 2FHMA 2IRUA 2V34A 5DLGA 2BQRA 1NK8A 3W61A 1U26A 3DHXA 2R3VA 3PHTA 3UPFA 2HFNA 4DN0A 1U2FA 4DSJA 3BN7A 3GV7B 1RU2A 3CF5Q 1JNRB 1P1LA 4Q44A 2OSQA 2BANA 5D0GA 4R5PA 2BV3A 5MAOA 5IC4B 2BW2A 1WEZA 1S59A 4A8XA 1RWNB 4F4KA 5KFFA 4IQXA 3MM8B 3OSNA 3VZHA 5C2CA 2KYXA 3KNAA 4WFZA 2GVZB 2J5AA 3I0RA 2B56A 5A8KB 1EKSA 2VFVA 3I6PA 2VKRA 1MLAA 1FFWB 2HVDA 3U1LA 2X51A 2GO8A 3DDKA 1S1XB 2QT7A 1BQNA 1JQGA 3L95X 3MEDB 2XNRA 1KP6A 3LPEA 4WK1A 1BWEA 3J7YI 4WFYA 3VQTA 5M2UA 2L9DA 4YUDA 3NXZA 2F4FA 2LMIA 1D9FA 3I5AA 1AB8A 4UUWA 4EK2A 3AOAA 3HHNB 1R7IA 5A8WB 4PABA 2B4PA 1VYAA 5KFGA 3GSIA 5AE3A 1PC5A 1SI9A 4EBDA 2BE2A 3T19A 1FE4A 3NMRA 1JNZB 4DFJA 2GS8A 4KFBA 4UQGA 1R3NA 4CH1A 4DQSA 1HNXJ 2O01C 2EG2A 2AEFA 4JI7F 4J9MA 1N0VC 4WFAQ 1CSJA 1WC5A 4ZJOA 4DZDA 2YX4A 2R7QA 3H7HB 2POKA 3RRKA 1C0UA 3OTOJ 2NXCA 3N4WA 5KFYA 1AW0A 3BKUA 2PMZD 3GLJA 3LQVA 3MAQA 1IKYB 1WSRA 4KR0B 1P9YA 4NXMF 4DR1F 3U27A 2IC3B 2MGZA 2OTJS 3QO9B 3THVA 3BH7B 4I2QA 2W2PP 1AZSA 3FSYA 4JP8A 3GFZA 3Q8SB 1W7WA 4OV1A 5HMYA 1QAJA 1RT1B 4NL5A 2PT0A 4LSNB 1ELOA
chains in the Genus database with same CATH topology
2B8PA 1PAEX 1LWXA 3FBBA 3PJ9A 1S57A 3VGVA 1MN7A 1VYAA 3ELHA 3FCVA 3BBBA 1NPKA 3FC9A 4F4AA 4UOHA 1F3FA 1PKUA 3B54A 3EICA 4FKXA 4UOGA 3DDIA 3FBCA 2BEFA 1B99A 3ETMA 3BBCA 4HR2A 1UCNA 1NSQA 5CAAA 1JXVA 1F6TA 5IOLA 3DKDA 3VGUA 3NGSA 3ZTQA 1NB2A 1NDPA 3EJMA 4KPCA 3FCWA 1NSPA 3VGTA 2CWKA 1HIYA 3ZTOA 3VVTA 1BHNA 1NCLA 3EVMA 3Q8VA 2DXDA 1S59A 3BH6B 1MN9A 4C6AA 4ENOA 4DUTA 3PRVA 3Q83A 1WKJA 4WBFA 3EE3A 3VGSA 3VVUA 3NGTA 2DXFA 3ZTSA 2B8QA 3Q86A 4O0NA 3Q8UA 3Q8YA 1ZS6A 1NDKA 5BXIA 3Q89A 5CABA 3R9LA 1B4SA 1NLKL 3GP9A 3ZTPA 2AZ1A 1S5ZA 1NUEA 4DI6A 4ANEA 4FKYA 1U8WA 1XIQA 3EMTA 3G2XA 1WKKA 1HHQA 4CP5A 5C7PA 2BX6A 3ENAA 3ZTRA 3GPAA 3B6BA 4F36A 1NDCA 1BUXA 2HVDA 3NGRA 2DY9A 1LEOA 4DZ6A 2DYAA 3FKBA 1NSKL 1NDLA 3BH7B 2ZUAA 3L7UA 3EM1A 1K44A 2NCKL 3EVWA 4ANDA 1BE4A 3JS9A 4S0MA 1KDNA 4W98A 1EHWA 2AZ3A 2HVEA 3EVOA 1W7WA 1XQIA 2VU5A 3WX8A 3MPDA 3FBEA 1HLWA 4EK2A 3FBFA 4UOFA 2HURA 3NGUA 1NHKL 4ANCA 2DXEA 1WKLA 3BBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B8P A;  1PAE X;  1LWX A;  3FBB A;  3PJ9 A;  1S57 A;  3VGV A;  1MN7 A;  1VYA A;  3ELH A;  3FCV A;  3BBB A;  1NPK A;  3FC9 A;  4F4A A;  4UOH A;  1F3F A;  1PKU A;  3B54 A;  3EIC A;  4FKX A;  4UOG A;  3DDI A;  3FBC A;  2BEF A;  1B99 A;  3ETM A;  3BBC A;  4HR2 A;  1UCN A;  1NSQ A;  5CAA A;  1JXV A;  1F6T A;  5IOL A;  3DKD A;  3VGU A;  3NGS A;  3ZTQ A;  1NB2 A;  1NDP A;  3EJM A;  4KPC A;  3FCW A;  1NSP A;  3VGT A;  2CWK A;  1HIY A;  3ZTO A;  3VVT A;  1BHN A;  1NCL A;  3EVM A;  3Q8V A;  2DXD A;  1S59 A;  3BH6 B;  1MN9 A;  4C6A A;  4ENO A;  4DUT A;  3PRV A;  3Q83 A;  1WKJ A;  4WBF A;  3EE3 A;  3VGS A;  3VVU A;  3NGT A;  2DXF A;  3ZTS A;  2B8Q A;  3Q86 A;  4O0N A;  3Q8U A;  3Q8Y A;  1ZS6 A;  1NDK A;  5BXI A;  3Q89 A;  5CAB A;  3R9L A;  1B4S A;  1NLK L;  3GP9 A;  3ZTP A;  2AZ1 A;  1S5Z A;  1NUE A;  4DI6 A;  4ANE A;  4FKY A;  1U8W A;  1XIQ A;  3EMT A;  3G2X A;  1WKK A;  1HHQ A;  4CP5 A;  5C7P A;  2BX6 A;  3ENA A;  3ZTR A;  3GPA A;  3B6B A;  4F36 A;  1NDC A;  1BUX A;  2HVD A;  3NGR A;  2DY9 A;  1LEO A;  4DZ6 A;  2DYA A;  3FKB A;  1NSK L;  1NDL A;  3BH7 B;  2ZUA A;  3L7U A;  3EM1 A;  1K44 A;  2NCK L;  3EVW A;  4AND A;  1BE4 A;  3JS9 A;  4S0M A;  1KDN A;  4W98 A;  1EHW A;  2AZ3 A;  2HVE A;  3EVO A;  1W7W A;  1XQI A;  2VU5 A;  3WX8 A;  3MPD A;  3FBE A;  1HLW A;  4EK2 A;  3FBF A;  4UOF A;  2HUR A;  3NGU A;  1NHK L;  4ANC A;  2DXE A;  1WKL A;  3BBF A; 
#chains in the Genus database with same CATH topology
 5A6W A;  4IH7 A;  3UN5 A;  4WYL A;  1N5V A;  3ZZR A;  2H4Y B;  5I4M A;  1HWJ A;  2IA6 A;  1S7H A;  3M2U A;  3KLG A;  3H5U A;  1SKS A;  3G6X A;  1O8B A;  4MJK A;  3K8W A;  3GMG A;  2NS1 B;  4I2P A;  2YPY A;  4X64 F;  1SL0 A;  4ZVU B;  1RCX B;  1N32 J;  2RF2 B;  1KQG B;  1CJT A;  2VPX B;  2LQB A;  1M5V C;  5E7O B;  4A8F A;  1RT2 B;  4AQY J;  4DV3 J;  1DLO A;  2VPY B;  4CLT A;  1C1C A;  3IAS 9;  3ONQ A;  1S6P B;  2YNG A;  2B0G A;  2V94 A;  1X5T A;  3QAU A;  3ILI A;  3MM9 B;  4X4T A;  1OY9 A;  3P6Y C;  4X4V A;  4OLO A;  1RT6 A;  1T0T V;  3M4X A;  2BQU A;  2LFV A;  4NMX A;  2C2Z B;  1RTI A;  3LAK A;  1GMW D;  5KFX A;  5J2Q A;  2B6A B;  2XMK A;  5IFM A;  4LF7 F;  1P27 B;  1QSS A;  2RB7 A;  2MLX A;  3CJ0 A;  2IYI A;  3DRX A;  4N41 A;  3I0S A;  5L8R C;  2HND A;  5A2Q U;  2RQ4 A;  4DSI A;  2LEB A;  2B4U A;  3X3U A;  3M32 A;  3HM9 A;  2O5D A;  2HBQ B;  1JLB A;  1LFP A;  1I5O B;  4PQU A;  4HDH A;  4UUX A;  4HHU A;  4ZPA A;  3RW7 A;  2R42 A;  2QZ8 A;  2QGF B;  2QA2 A;  2MQO A;  2EXU A;  4QQB A;  2GAG C;  4DU7 A;  4M95 A;  1WAC A;  1RTH A;  2MY8 A;  1NUE A;  1SC1 B;  4ID8 A;  4MMO A;  1FVQ A;  3WX4 A;  1AFI A;  2E9R X;  5D15 A;  3LP2 A;  2Z58 B;  2DH7 A;  4GO7 X;  2UVR A;  3CJR A;  3D0G E;  3HVR A;  4MYU A;  2W2M P;  3H2L A;  2C1E B;  1I6J A;  1ZZF A;  5KFQ A;  2CYY A;  1MWZ A;  5LMU F;  3D3C J;  4MFB B;  1VRQ C;  2J6U A;  2BYC A;  1X8D A;  5E3A A;  2IA0 A;  1LQ9 A;  3DDN A;  2V4R A;  1B7F A;  2MQP A;  3R1H A;  2ZHO A;  4OYI A;  3NAI A;  1VC6 A;  4K4V A;  1GXU A;  2G4B A;  3KK3 B;  1N36 F;  4ED2 A;  3HLU A;  1ARO P;  4ZN1 A;  2GCF A;  2ZDP A;  1QTM A;  2DEI A;  3N0V A;  1VS3 A;  2Y0B B;  1IBL J;  1NSP A;  2OML A;  3LGM A;  4MK9 A;  1FT8 A;  3C14 B;  4O4G A;  2ILY A;  1MN9 A;  2GJI A;  2BKN A;  5LOQ A;  5CD4 H;  4M5J A;  1ITP A;  4HH0 A;  4KJI A;  1DJ0 A;  2L9N A;  1DZ5 A;  5KG6 A;  4F4Y A;  1XK8 A;  1SV5 B;  2ACM A;  3EPG A;  1H73 A;  5CZV A;  1YJV A;  4JI8 F;  2ZWO A;  2IYG A;  4HH1 A;  3QRR A;  2GAH C;  3BRE A;  3BGU A;  1R6V A;  1RHR B;  2ATC B;  2B5J A;  3FQL A;  4LIW A;  3Q23 A;  5K14 B;  4UOF A;  1U02 A;  1DTQ B;  4CLP A;  3M2V B;  1QD1 A;  2MQM A;  3QFH A;  3GON A;  1U48 A;  3BBB A;  3UI3 A;  3R1L A;  4IFV B;  1VQO S;  3C8Y A;  3AQO A;  4A8M P;  3JAM Y;  2KZZ A;  5IXU A;  2GVD A;  3W66 A;  1FVS A;  7FDR A;  3BO3 A;  2J0X A;  1KRP A;  4LF2 A;  3FCW A;  4J9R A;  3BO4 A;  5J1E A;  2OFG X;  1CJV A;  2ZC4 A;  4XO0 A;  2BE9 B;  1N88 A;  4WXO A;  4RNF A;  3AOB A;  2F8H A;  1S4F A;  4DX8 H;  3CCR S;  2PI5 A;  3BGF A;  3CD0 A;  5DJB A;  2OMO A;  3CE8 A;  2VF3 A;  5D0R A;  1Y00 A;  2NXU A;  2HHT A;  4IO1 A;  1UTA A;  3R5G A;  3NBP B;  3RR8 A;  3EZU A;  4ZP7 A;  1GK8 A;  2R7T A;  4RW4 B;  3UCU P;  2RDJ A;  2W1B A;  3MR6 A;  3POT A;  2ZH2 A;  1CG2 A;  4ED3 A;  3D1O A;  2WK4 A;  1JLE A;  1HBU B;  3CDB A;  1CS4 A;  2MTL A;  2AYM A;  4KC5 A;  3Q0A A;  4LVN P;  4LUB A;  4TNO A;  1S79 A;  2DB1 A;  4NI2 B;  1R8H A;  2HVZ A;  2JWN A;  2A6M A;  3J81 U;  4O44 A;  1FJC A;  2VFR A;  4Y3C A;  3TZZ A;  2X1A A;  4P74 A;  4GKK F;  3RB3 A;  1FRX A;  3OPK A;  2AW0 A;  2QRR A;  3PYG A;  3ZZU A;  1Q7L B;  2HRT A;  2BJ8 A;  5E2Q A;  1TMM A;  4ZVF A;  4A8K A;  4LFB F;  1B0P A;  2BAN B;  1IKW A;  4R5P B;  2OJ3 A;  4K5S A;  4J9U E;  3Q8U A;  1LWC A;  1RLC L;  3TUP A;  4IOA Q;  1F3V A;  2RRA A;  4K0K J;  4ID5 A;  4DX7 A;  3CO9 A;  1NHU A;  4DPO A;  1FDD A;  1PG5 B;  3I0R B;  4WTO B;  3SSS A;  1SIW B;  4YR3 A;  5KFW A;  1Y0H A;  3WC2 A;  2FJA B;  4WPA A;  3N6L A;  3MMC A;  1JJ2 R;  3WIV A;  2J7U A;  1L3U A;  4X84 A;  4OI1 A;  2DNM A;  4LFC F;  1XNQ J;  3NNH A;  2XY7 A;  1DAR A;  3ET6 A;  4NZ0 A;  2ADC A;  2FVQ A;  5HMW A;  5IT0 A;  2G2Z A;  4ZLP A;  4C48 A;  4N47 A;  1WKL A;  1HPZ A;  1FDB A;  4ECS A;  3C66 A;  2HS3 A;  1HWL A;  1IXK A;  1TL5 A;  4YHH F;  4YN3 B;  1NB7 A;  4OJH A;  3DDI A;  3FVY A;  3TVZ A;  1HR0 F;  2GIF A;  2EFV A;  5DET A;  2EK6 A;  2BE2 B;  4PG5 A;  4ZP9 A;  1VBZ A;  2JDJ A;  4OYP A;  1Q53 A;  4X62 F;  4KFB B;  4ZDN A;  2HQG A;  3DM2 A;  2E5I A;  2CNN B;  1EZZ B;  2VOP A;  3HF5 A;  2DPI A;  3CCJ S;  5L38 A;  4OYM A;  4ZHR A;  3K17 A;  2MHN A;  2EG1 A;  3R3T A;  1C0U B;  4RU9 A;  1RKJ A;  1RBA A;  5J1P A;  2HWI A;  3QWP A;  3A1Y G;  4FBT A;  4XDC A;  1VC0 A;  2GMJ A;  4IOB A;  3Q2S C;  1WUU A;  2JC0 A;  2MGZ B;  4YEA A;  5C25 A;  2YWH A;  2UUC J;  2CQ0 A;  5AXM A;  5HAN A;  1NK7 A;  3I56 S;  3LO3 A;  4JI1 F;  1WF0 A;  4Y00 A;  4ELT A;  1FXL A;  1ZM4 A;  2YNH A;  1CVJ A;  1DQA A;  4C9D A;  3UDC A;  2HBY B;  1SJ4 P;  4RZR A;  4QIG A;  1BQM B;  1NPK A;  3QZ7 A;  2GX8 A;  2UUB J;  1WC0 A;  4OJ1 A;  3M2U B;  3KLG B;  1DAX A;  3NGS A;  1I51 B;  3K5M A;  2L48 A;  3EYZ A;  3OVS A;  3GIK A;  1KQF B;  1YQH A;  1KOH A;  1RHM B;  1WTB A;  1U1M A;  1C4C A;  4K4S A;  5U47 A;  2HHS A;  1CUL A;  4I2P B;  1I3O B;  4NA1 A;  2LQJ A;  1SC4 B;  3BB5 A;  1VIS A;  2KFN A;  4F02 A;  3UD4 P;  5KFM A;  1DLO B;  2XYG B;  1Q81 T;  1N33 J;  5GAE I;  2CKW A;  5F8J A;  1C1C B;  4ED7 A;  2YNG B;  2LYV A;  2IPO B;  1FXD A;  1UPP A;  1K44 A;  2CZV C;  1RT6 B;  3OJS A;  1FRI A;  2Q1L A;  3TAR A;  1UVM A;  3HHK A;  2UV8 A;  3OTB A;  1A0O B;  1CJU B;  5DZ7 A;  4KV8 A;  5J2Q B;  5GAD U;  4Y2K A;  4LF4 F;  2XQC A;  3DCA A;  2KG0 A;  2PEH A;  3DGP A;  1RYS A;  5E3P A;  3I0S B;  4HAC B;  1TUV A;  2HND B;  4OZ3 A;  4YY3 F;  1VFJ A;  3PV8 A;  4LT6 A;  2COL A;  5KG4 A;  5L1J A;  3TAQ A;  1S97 A;  3QWU A;  3SEO A;  4ED1 A;  1MSW D;  4O3P A;  4D3G A;  2V63 A;  1UWA A;  2OO4 A;  3CDE A;  2OH2 A;  1JLB B;  4F67 A;  1ZBT A;  4A8Y A;  3B4M A;  3D0I E;  3Q83 A;  4M94 A;  2FLP A;  5DLF A;  2OPQ A;  3LAN A;  1U2C A;  2GC8 A;  5ETR A;  4W4M A;  1T7P A;  1RTH B;  1UZD A;  3G2X A;  5KAK A;  3ZTR A;  3BQ0 A;  1VBK A;  2I1R A;  1Q0N A;  1ROF A;  3LP2 B;  1NKE A;  4USH A;  2ALY B;  3LP1 A;  4DR7 J;  1E6Y A;  3QFW A;  3BSC A;  1RAB B;  2AWZ A;  5DDQ C;  5HAT A;  3M6V A;  2IFX A;  4DR4 J;  2FHK A;  5KT7 A;  4OHV A;  1YIT S;  4ECW A;  4DPX A;  2AYB A;  4KH0 B;  2IRX A;  5EWG A;  5BYQ A;  1RAO A;  3PVX A;  2F63 A;  4PXB A;  1XWL A;  3UO0 A;  5CYJ A;  4U7C A;  5I3Q A;  1UP1 A;  1V6H A;  1GNK A;  1TV6 A;  5KFU A;  1AA1 B;  4EEY A;  2UXB F;  4CO4 A;  5B0E A;  2FC9 A;  3SCL E;  2Z2Z A;  4NLD A;  2G0I A;  4DQP A;  4O4G B;  5HLF B;  5ETV A;  2P6T A;  2QJ3 A;  4B3T J;  2DRB A;  4LF8 F;  2F8E X;  2Y8Y A;  2XGP A;  3MTK A;  2JC1 A;  3OL6 A;  1ACM B;  2VIH A;  2HHX A;  2OLW A;  2UU9 J;  5SUH A;  5T41 A;  2F1F A;  4DCJ B;  5KG0 A;  4DQQ A;  3DLJ A;  1EKR A;  2CDR B;  4RJV A;  1SUQ B;  2W4C A;  2J7W A;  5IV3 A;  1SJF A;  2UXD F;  1ULR A;  3K5N A;  3SCI E;  3IXQ A;  1U1O A;  1VQM S;  2MDA A;  3KG0 A;  1VMB A;  3PZP A;  1C4A A;  1LXJ A;  4IG0 B;  3WX8 A;  3KLH A;  2AP6 A;  1S1V B;  4DV6 F;  4B3S J;  2ZFH A;  4U7U D;  2B5J B;  2XLJ A;  2HK2 A;  1ZYQ A;  5JVH Q;  2UV8 G;  3SSQ A;  1UL3 A;  2KFZ A;  1Q86 T;  3GFH A;  1UW9 A;  3D9B A;  4U8V A;  1QM9 A;  4ED4 A;  4CDI A;  5EHH A;  3BSO A;  4KTQ A;  3GV5 B;  2ZIT A;  4ENO A;  2CJY B;  4USK A;  5J1E B;  1CJV B;  2XHW A;  3LH2 S;  2BBE A;  2XO7 A;  3B8H A;  1VOM A;  2C3Y A;  2P5V A;  1RZM A;  4NLV A;  5DM6 Q;  2ZE2 B;  1K47 A;  3S01 A;  5L46 A;  2W9B A;  2W24 A;  1S76 D;  1YZ6 A;  4F4Z A;  3AXK A;  3UD5 A;  2J0S D;  2V8G A;  4LBH A;  1PJ7 A;  3J7Z 5;  2MZS A;  4R25 A;  4U7U K;  3SYZ A;  2Z8Q A;  1QSY A;  2ZOM A;  2HQF A;  2R9L A;  1HWK A;  1EAY C;  1BMQ B;  3FUY A;  4WYW A;  4ITS A;  1CS4 B;  2KT3 A;  4C8L A;  4QIW D;  4M1K A;  2JL9 A;  4FKX A;  1DY3 A;  1KTQ A;  3MEC A;  4UOG A;  2JH3 A;  3D6H B;  3M6W A;  1EET A;  3ETM A;  2WHO A;  4ZOS A;  2IIH A;  4OFZ A;  1JXV A;  1Q16 B;  3GJS B;  4O44 B;  5CA5 A;  2D7S A;  3NG8 A;  2M52 A;  2R8J A;  1WHV A;  3V81 A;  1UPM B;  4KPC A;  2YQ3 A;  4DL4 A;  3G71 S;  2OEL A;  3W64 A;  1IN0 A;  2P9G A;  3RG6 A;  5AT1 B;  4NZ7 A;  5L1I A;  3CDA A;  1D1U A;  1TL1 A;  3OTC A;  4DLE A;  3C15 A;  1IKW B;  1FKO A;  3M1V A;  2JFK A;  5IWA J;  1LWC B;  4K2J A;  1T9Y A;  4FVM A;  4B9M A;  2RKI A;  1WEX A;  3J7A 1;  3HHD A;  4QYZ K;  2LEP A;  3MI7 X;  1RA7 A;  1FF2 A;  2E1M C;  2ADB A;  1M5K C;  4DV0 J;  4RLE A;  3MMC B;  3TUI C;  5HRO A;  1QVF R;  3JTO A;  2W4P A;  4RW7 A;  1S10 A;  2UXC F;  1N5Y A;  1T9W A;  3EXC X;  3ZNJ 1;  4ZVP B;  4BBY A;  3ET6 B;  1B0T A;  2DGQ A;  3VCD A;  3MFH A;  2YKN A;  1HPZ B;  5ETQ A;  3AHP A;  2QC3 A;  3IFE A;  1Y7P A;  2E1A A;  4CLK A;  1N5Q A;  3KUE A;  3PW0 A;  3I32 A;  2HS4 A;  2KJW A;  4C0H A;  1G1X A;  4NLW A;  2IVF B;  4IQM A;  4QOT A;  5DRK A;  1YKW A;  4ZVG A;  1KKH A;  4FS2 A;  3DLB A;  1WNE A;  4DUZ J;  3DM2 B;  3TJ8 A;  1TL7 A;  2IDL A;  4NYO A;  4KY3 A;  2HAF A;  3TA2 A;  4JI3 J;  4UST A;  4ZHR B;  3EXY A;  2UVV A;  1RJJ A;  3HSJ A;  3THP A;  1M5O C;  2IMO A;  3NAH A;  5EUH A;  3MUV P;  1LWF A;  3W5Y A;  5D8H B;  2UUT A;  3NS7 B;  3CB4 A;  4JI4 F;  2FJX A;  4IH5 A;  1N34 F;  5C25 B;  4O4R A;  3BGL A;  3KLI A;  4DUY F;  4L6V 3;  1HQU A;  3JSY A;  2FZC B;  2C2M B;  2ZBQ A;  1RCO B;  2YNH B;  2J9E A;  5GVQ A;  3G8S A;  2BUN A;  4E2F B;  4M5G A;  1URR A;  4X4P A;  1IR2 A;  2D3Z A;  1VQY A;  3RB0 A;  5ETN A;  2HVI A;  3MUM P;  1TL4 A;  1BHN A;  3SZ2 A;  3H8Y A;  4ILM A;  2MKC A;  1KQS R;  2XMU A;  4I6W A;  5JMN A;  2FJD B;  4NPO A;  1CUL B;  3SDE A;  4V19 J;  2KKH A;  1IJF B;  4E98 A;  3M8Q A;  3I9V 9;  4OI6 A;  4PCQ A;  2XLK A;  4K4X A;  2HS0 A;  4KKO A;  4OZ1 A;  3FQK A;  4IFY B;  1AT1 B;  1RT3 A;  3DU6 A;  2EFN A;  3MMB A;  2LVW A;  2GIQ A;  3K5O A;  1VQ8 S;  1TAQ A;  2HHV A;  2J8A A;  3M8R A;  2D69 A;  2AZ3 A;  3WZ0 A;  2GHV C;  3HHE A;  1T11 A;  1REG X;  4G1I A;  3MF5 A;  1JJ4 A;  2OSR A;  4DX6 A;  3PTW A;  4KV8 B;  2WW4 A;  5T7L B;  2BJD A;  3UFC X;  2V8P A;  3QZ8 A;  4NLU A;  1TU0 B;  3NL0 A;  3DGP B;  4KHM A;  2XMV A;  4RW9 A;  3HUL A;  3JSB A;  3FJ2 A;  4OHY A;  1U6F A;  3C6U A;  2MQ8 A;  1U1L A;  1MW7 A;  4ZCK A;  2H5E A;  2AJ2 A;  1VIX A;  3C6T A;  1FEE A;  1ZPV A;  2K7K A;  3PW7 A;  1K73 T;  3H5X A;  4K4Z A;  1TP7 A;  1Y5I B;  3HVT A;  4BHQ A;  4U9R A;  4K4Y A;  3GYN A;  3PR4 A;  2W7O A;  2C3U A;  2OPQ B;  4M5L A;  4ZLJ A;  2J9D A;  4LRE A;  2QA4 S;  2LEA A;  3V6H A;  1S6Q A;  1BGX T;  3KDN A;  1K0T A;  1RT7 A;  1TEL A;  4I6Y A;  4ZVT B;  1PCA A;  2VQE F;  4CLL A;  2FZK B;  1WDD A;  4GKJ F;  2DIU A;  3LP1 B;  2R7U A;  1HA1 A;  2RE1 A;  1E6Y B;  1WC3 A;  3ISZ A;  1YI2 S;  3GJT B;  4LR9 A;  4ED5 A;  4LF6 F;  3MWB A;  1KVI A;  1J5E F;  3FBB A;  2VB6 A;  2AEJ A;  1NK6 A;  2FJV A;  1NH7 A;  1TUG B;  3T1H F;  3GTY X;  3H59 A;  1NSQ A;  2XI2 A;  2EFQ A;  5GMK a;  1X5O A;  2DNL A;  1SB6 A;  2YKO A;  1TV6 B;  1DUR A;  5GMD A;  4XIU A;  1EQ0 A;  3JXO A;  1RWO B;  4RUA A;  1SKR A;  2MJU A;  2HFV A;  3RB6 A;  2QX0 A;  2I5J A;  2DTJ A;  2K7J A;  3QGI A;  2CJA A;  1VK8 A;  3EMT A;  4Q7A A;  2MQL A;  1HD0 A;  2H4W B;  2HIQ A;  1ZZN A;  1RHK B;  2DVI A;  4JI7 J;  4DV5 F;  1XMQ F;  4AND A;  3KLF A;  2AIR B;  1TKT B;  4UZB A;  2B7C B;  1XJW B;  4NML A;  8RUC A;  3PX0 A;  3O8W A;  2OP5 A;  2DCL A;  3NWG A;  1B7Y B;  3OL8 A;  4LSZ B;  4L3K A;  4A8W A;  2L41 A;  3KLH B;  3A8I A;  1L3K A;  3UD3 P;  3HSG A;  4NXM J;  4DR1 J;  1Y5L B;  3UWT A;  4XTT A;  4TYA A;  2HMI A;  3DLK A;  3PX6 A;  3US5 A;  4V19 X;  1GX5 A;  4B08 A;  5KG2 A;  2EC0 A;  1S1U B;  4CIO A;  2DNR A;  4QPX A;  2GHW A;  3TAM A;  2HVH A;  4M5I A;  4TU9 A;  4M5M A;  3TEG A;  1IWA A;  3R27 A;  1RIS A;  4O0N A;  1YJR A;  4Z7Y A;  4ECV A;  2FQQ B;  4MIB A;  4M5D A;  1XC9 A;  1OMS A;  2HSE B;  5D0H A;  2QLF B;  2BX6 A;  4CNZ A;  4C7Q A;  2H1Y A;  2W9B B;  4X64 J;  3TX0 A;  3GWC A;  1S7I A;  3C16 A;  2JEF A;  2VUG A;  1ZPW X;  4ETX A;  4USU A;  4BWJ A;  5HMZ A;  2CNO B;  1RHQ B;  2R2U A;  3CUL A;  2EEY A;  3CCT A;  3CNQ P;  4LRD A;  2GV1 A;  4G6V B;  2KT2 A;  2B4V A;  5B0D A;  1T94 A;  5KFB A;  4USV A;  4RR5 A;  2VDH A;  1NO8 A;  4X66 F;  1N8R T;  3MEC B;  3TVK A;  3TEH B;  2FVP A;  1RHJ B;  1HIY A;  4ETZ A;  3K7R A;  3TOQ A;  2HNZ A;  2QEX S;  4CI0 B;  1TL1 B;  3C15 B;  3ZTP A;  3I87 A;  1FKO B;  3CMQ A;  4ECT A;  3M1V B;  5D4N A;  1EX8 A;  1SH0 A;  3IG1 A;  3M7V A;  3BYR A;  2AD9 A;  2RKI B;  3K58 A;  1DQ8 A;  2UP1 A;  1FKA F;  4FYW B;  3BPS P;  3M30 A;  2DR7 A;  3KYL A;  3L9Z A;  5HRO B;  4WFB Q;  3HX9 A;  4KGX B;  4RW7 B;  1N5Y B;  3GG1 A;  1UET A;  3F73 A;  3V6K A;  3RTV A;  3ELH A;  4RUB A;  2MB0 B;  4UOH A;  1KLM A;  4W92 B;  2QMU B;  1FEH A;  4IRD A;  4FDF A;  2Z2Y B;  2G9O A;  5IOL A;  3R6L B;  1OPI A;  1BLU A;  2NYI A;  2Q43 A;  5IQQ A;  3SFG A;  5LMU J;  5B0F A;  1YGY A;  2DXF A;  2KRB A;  3SQO P;  1U24 A;  1TL7 B;  2RAQ A;  3BGO P;  1LXN A;  2I8E A;  3HZG A;  4WU2 A;  2MQQ A;  2ZD1 A;  4UOC A;  3GFY A;  1N36 J;  4NA2 A;  5ETM A;  4CP5 A;  3BPD A;  3ENQ A;  4CO3 A;  4F2S A;  2VC0 A;  3CCE S;  1HWI A;  5F41 A;  3A8E A;  4OYA A;  2IRY A;  2ZWP A;  1LWF B;  4F50 A;  5AE2 A;  2YPZ A;  3EZ5 A;  2ASJ A;  2C3P A;  5F8M A;  2KU7 A;  2CPI A;  3VAI A;  3KLI B;  3FDS A;  1EP4 B;  1UFW A;  1HQU B;  2VJU A;  3LA0 A;  3LF0 A;  2EBE A;  3S7R A;  2JZ5 A;  1WJ9 A;  2Z4P A;  2UVW A;  3QAE A;  1SXL A;  4JI8 J;  5LSO A;  4NCA A;  4HI1 A;  4KO0 A;  5C24 A;  2X1B A;  3KTQ A;  4DR5 F;  1RAH B;  1VCT A;  2HQD A;  3VVT A;  1S0O A;  1UMJ A;  3MM7 A;  3RGI A;  3WC0 A;  1Q8I A;  3NGT A;  4C0O C;  4ZA1 A;  3OFH A;  3CC4 S;  2APO A;  3SDE B;  5E3C A;  2FLO A;  3QIP B;  4DMZ A;  4ZN3 A;  3M8Q B;  1JKH A;  1HHQ A;  2WCX A;  3SMZ A;  1NDC A;  1Q78 A;  5DZ6 A;  2CIM A;  1QAI A;  3MMB B;  3CCV S;  3DI6 B;  1KSP A;  3MMA A;  5F8H A;  3M8P A;  2BZ2 A;  3IO1 A;  1WC6 A;  5HBM A;  4JI6 F;  2ZH1 A;  3N6N A;  2RH3 A;  2R8G A;  4FF1 A;  4J9V A;  2OPS B;  2R8K A;  1F9E B;  1DHM A;  4H4K A;  3FSI A;  4ED0 A;  2J0Q D;  3NS5 A;  5GAG U;  2W2N P;  4X65 F;  3OVA A;  3OFE A;  2IJF A;  3A3P B;  5HVH A;  2ZH8 A;  4LIR A;  2E7W A;  3DRR A;  2HYI B;  4KIA A;  4KHP F;  2AX0 A;  3M8Y A;  5LXY A;  2ERR A;  3C6U B;  4A8S A;  2FHJ D;  1GT8 A;  4NLY A;  1KN6 A;  3F44 A;  2RUG A;  1PYO B;  5BR8 F;  1U4B A;  2IY5 B;  3QNW B;  3C6T B;  4C8K A;  4WIQ A;  4QIF A;  1HQE A;  3HVT B;  5IT9 Y;  1VJQ A;  4RWX A;  2AYE A;  1LW2 B;  1OYD A;  3SIP B;  1WSV A;  4GKK J;  3PG9 A;  4DDF A;  3IRW P;  4IKA A;  5A8W A;  4DR2 F;  4KE5 A;  1S6Q B;  3QJP A;  1JLA A;  4NOH A;  2H9Z A;  4LFB J;  1RT7 B;  1M5S A;  4WXW A;  1TTH B;  1WG1 A;  4F4X A;  4Y0F A;  1W25 A;  1IKX B;  1WF1 A;  4CLS A;  4DPU A;  2ZBR A;  4FF3 A;  2EW9 A;  4Q45 A;  3IA0 A;  4R0E A;  1MML A;  3IR7 B;  4P2X A;  3RYL A;  1KVK A;  3HK2 A;  5JVG Q;  2R7V A;  3QJJ A;  2XYH B;  1FDN A;  5HMX A;  2FLN A;  3D66 A;  1VLO A;  4TY9 A;  3NP5 A;  1R43 A;  4LFC J;  1SC3 B;  2Y1I A;  1SVD A;  5B0G A;  1RU1 A;  2K3I A;  2JLF A;  3QO9 A;  1XR7 A;  5D3G A;  3TVY A;  2BOA A;  2BJ9 A;  2A0F B;  4YHH J;  2OEK A;  4M5N A;  2IVY A;  1QE1 A;  2I5J B;  3BF4 A;  3GIL A;  1HNZ F;  4GO5 X;  1D3W A;  4Q0B A;  2O3D A;  3DMJ A;  4X62 J;  2ZHA A;  3T6B A;  2DGW A;  3J7Y U;  3WDO A;  3NCR A;  3BKT A;  2F5G A;  3VHQ A;  3BQ1 A;  3KLF B;  3M6X A;  2WB4 A;  2F4V F;  2DR8 A;  3R7B B;  4MKB A;  1TAU A;  3BS9 A;  1VQ6 S;  2AKW B;  3CC2 S;  1S4E A;  2N7Y A;  1FRL A;  4QJV A;  1RT2 A;  4HYK A;  1U47 A;  3CCU S;  3V2U C;  2VA2 A;  2CQB A;  4DX5 A;  2HMI B;  2KHD A;  2YBV A;  1GAO A;  5L9X A;  1S0M A;  2VD3 A;  1R8C A;  3NY0 A;  3C2P A;  2G0C A;  4JI1 J;  4WCE Q;  3ZTO A;  3QYY A;  4G1Q A;  2O1P A;  1TKX A;  1KBR A;  2HG4 A;  2KI2 A;  3TAM B;  2HWH A;  4DR6 F;  4DG1 A;  1S1T A;  2JOQ A;  1VRU B;  4F7V A;  2Q66 A;  4DSE A;  4NLS A;  1YLX A;  4ZIW A;  4FNH A;  1WOS A;  2D9P A;  3MOZ A;  3SFU A;  4M5D B;  1VBX A;  1RT5 A;  4Y34 A;  4UZC A;  2IJN A;  2NUU G;  3TAN A;  2NPI A;  2VL1 A;  3C16 B;  2KXN B;  2A1B A;  3QSY B;  3PIP Q;  4USM A;  4C8O A;  1Y4Z B;  5LJ3 Y;  1HBO A;  2LA6 A;  1FWP A;  1RE1 B;  1NHV A;  4LRB A;  4OX9 F;  3RAM A;  2O67 A;  1JJH A;  2LDY A;  4F8R A;  2JSX A;  4ZCL A;  2VDI A;  1RAJ A;  1BD6 A;  3HD2 A;  2AT1 B;  5KG3 A;  3KG1 A;  3H98 A;  3MCM A;  1KFD A;  2BMB A;  2YNI B;  1DQ9 A;  4HL9 A;  1RUS A;  2FY8 A;  2JRS A;  3H25 A;  2C28 A;  3OTD A;  2YY3 A;  1G3O A;  4DN9 A;  1JXL A;  4LF4 J;  4F26 A;  4YOE A;  3QID A;  5KT2 A;  2DHS A;  3JTP A;  3I5C A;  2HW3 A;  2M88 A;  3TUZ C;  1FK9 A;  4NCG B;  4YY3 J;  3HVW A;  2QG9 B;  2E5G A;  2MKI A;  1EIY B;  2R7X A;  1UFK A;  3IG1 B;  2RML A;  2ZZT A;  1GXT A;  4EFA C;  1EAR A;  1TUW A;  2A2D A;  2I2Y A;  3KK3 A;  5KOX A;  4Y2I A;  3QSI A;  3M30 B;  3I4H X;  4LF9 F;  3HJF A;  4NX9 A;  3HI9 A;  1Z1Z A;  4DR3 F;  2NPF A;  1H7X A;  3UN2 A;  2M2B A;  4BLG A;  3C14 A;  5F8L A;  2V8D A;  3CGI A;  1RGV A;  1MN7 A;  3G82 A;  2QV6 A;  1KLM B;  1WI6 A;  1WTF A;  5K9F A;  4NLG A;  4ZJL A;  2Q6C A;  2ZH6 A;  1OY8 A;  3BZQ A;  2BR0 A;  2WOM B;  2AYG A;  4NXN F;  1R0B G;  4EWT A;  2KM8 B;  3RB4 A;  4FF2 A;  1LOU A;  2ZUG A;  6AT1 B;  1MU2 A;  1FTC A;  4WKY A;  1HI1 A;  5K14 A;  4ZCI A;  1DTQ A;  4KHR A;  3M9M B;  5A8R A;  3UR3 C;  3OR1 A;  3OT9 A;  3G8Q A;  4N5S A;  2HBR B;  2UXB J;  3HFV A;  3BN4 A;  1U6Z A;  3UNY A;  5KFE A;  2XS2 A;  1H72 C;  3PAC A;  1AUS L;  5ETP A;  4LF8 J;  4RUC A;  3HT3 A;  3N79 A;  3MPD A;  1R27 B;  1JWW A;  1T95 A;  4ZPV R;  3ZNU A;  4MK8 A;  3CCQ S;  2YWF A;  4FS1 A;  3KMQ A;  4B3R F;  3J81 j;  3Q2T C;  2Z57 B;  4JV0 A;  2E5L F;  5FII A;  2N7C A;  1R89 A;  4A47 A;  1T9V A;  3ISN C;  2UXD J;  1NJY A;  2KJV A;  2W8L A;  3MPW A;  4FVC A;  4TKT A;  2OTL S;  2BRL A;  1NDP A;  4KO0 B;  2VON A;  7FD1 A;  2CQI A;  5C24 B;  5CYQ A;  3NBP A;  3FK4 A;  1RBO B;  4DV6 J;  1VQP S;  4FP9 A;  3KDO A;  3MM7 B;  3ZTS A;  2KO1 A;  3QGH A;  4CLU A;  2DR9 A;  4RX6 A;  1RBL A;  3CJ2 A;  2IAJ A;  3GR0 A;  4WP9 A;  3M9O B;  1CBK A;  1FX2 A;  1JKH B;  4DV1 F;  3LP0 A;  4J9P A;  4TLR A;  1D8Z A;  3DYA B;  2M5Y A;  2EFG A;  4OZ5 A;  3MMA B;  3HKZ D;  3HO1 A;  1WC1 A;  4C2M A;  3RAQ A;  5FLX U;  3M8P B;  3CJK A;  1QTN B;  3T3F A;  3FBF A;  3BEG B;  1PYS B;  5HBM B;  3G6V A;  8AT1 B;  2ROE A;  2DNZ A;  5LM7 E;  5KFN A;  3NOC A;  2PE8 A;  4B9S A;  2NYH A;  3HHL A;  4H4O A;  2XLI A;  2VOO A;  3H2U B;  1F0X A;  3BBC A;  4J91 A;  1UCN A;  5GME A;  2VG7 A;  3HP6 A;  2KRR A;  3BR9 A;  1JLG B;  1WOR A;  2RSQ A;  3DRP B;  4PWU A;  3N6M A;  3DRR B;  3ENW A;  1R6Y A;  4EZ6 A;  2C3O A;  2YKM A;  4C8N A;  2CPX A;  1I94 F;  2ILZ A;  1RWV B;  3GFX A;  3Q89 A;  5CAB A;  4C98 A;  3KHR A;  3PM9 A;  2BAC A;  2BJ7 A;  2OHD A;  2X7I A;  4ES2 A;  2C42 A;  3F56 A;  3TJA A;  1HQE B;  4YME A;  2V5H G;  3DXB A;  4Q8F A;  4JB8 B;  1PJ6 A;  2XZT B;  1RAE B;  1L3V A;  1N6Q B;  2KVQ E;  3PO5 A;  1X4G A;  4HHJ A;  1QVG R;  1BE4 A;  5ETS A;  1JLA B;  2IHR 1;  3G9C A;  3AB4 B;  2DT9 A;  2VU5 A;  3N5F A;  2AU0 A;  3Q24 A;  2XMJ A;  1VHI A;  4D3H A;  3O3L A;  2M70 A;  3ZO7 A;  4NE9 C;  2EWH A;  5GAH U;  3O44 A;  2J0W A;  5LJ5 Y;  3OVB A;  2OPR A;  2AGO A;  1N52 B;  4O23 A;  2XZD B;  3D6M B;  2UXC J;  2H3E B;  2IM0 A;  2OIH A;  3GU0 A;  3LGH A;  2Z0G A;  3R2D J;  4N77 A;  4CYU A;  2AF6 A;  4DU8 A;  3CMA S;  3PRB A;  1VK3 A;  5F3Z A;  3JYT A;  1WC4 A;  5D3G B;  2RNE A;  5K8O A;  3ZFV A;  4RUH A;  2XY6 A;  1PSD A;  2F8M A;  1RWW B;  4DL6 A;  3J81 Y;  1QE1 B;  4Y28 C;  5AXL A;  1S77 D;  4Q0B B;  3TUJ C;  3W8G A;  2QL5 B;  3DMJ B;  1BQM A;  1QUP A;  1TL3 A;  5HP1 A;  3OR2 B;  2MY7 A;  3AOC A;  1FRK A;  3EWG A;  2HRU A;  2AV5 A;  3IS9 B;  2YWG A;  2FDN A;  1FX4 A;  1CC8 A;  5IQ6 A;  3GCW P;  3I5B A;  4TU8 A;  2MXY A;  3DOK B;  3B54 A;  1GFW B;  3PHE A;  2FB0 A;  2E9T A;  3J7A N;  1HAR A;  2W7P A;  5IM0 B;  4N8O A;  4ED8 A;  4JI4 J;  1N34 J;  1W2I A;  4Y6I A;  1VIO A;  1F9H A;  4DUY J;  4OX6 A;  2RRN A;  3AXM A;  2L3M A;  2SXL A;  4G1Q B;  1TKX B;  4B9T A;  3Q8Y A;  4N76 A;  3VAL A;  4EYH B;  2DK2 A;  2MJN A;  5AXN A;  3M05 A;  2K06 A;  4B9L A;  4DG1 B;  1S1T B;  1H74 A;  5EX3 A;  1XER A;  3PKM A;  2ZZM A;  1CJU A;  2ZJQ Q;  3H4D A;  5DQG A;  1QDU B;  4F36 A;  1UA0 A;  2GML A;  2FVC A;  2JJ4 D;  4RW6 A;  4LFA F;  1RT5 B;  4MKA A;  3KK2 A;  1OO0 B;  2ZM6 F;  4HAC A;  4HHH A;  3KLE B;  2FVS A;  2OAU A;  1REV A;  2IM2 A;  2LEC A;  4C8M A;  3TX8 A;  3PJX A;  1HBO B;  4DPW A;  1NRK A;  4NZ6 A;  3T5H A;  1U1N A;  5EN1 A;  1S0V A;  4ZVQ B;  2DHG A;  2H5I B;  5D77 A;  2LLZ A;  3M8S A;  4YS2 A;  1G2E A;  3DKD A;  3HDS A;  3AAW B;  5HAO A;  4GC7 A;  3BM7 A;  4DS5 A;  2VBY A;  5CHC B;  4DSF A;  5KFJ A;  1LK7 A;  2CQC A;  1RP5 A;  3TJ9 A;  2QFI A;  1NK4 A;  1Q82 T;  4LF1 A;  5GAE U;  3UDE A;  4C3M A;  2HZV A;  3W9I A;  1T03 B;  1FK9 B;  4L76 A;  5E3Q A;  3HVA A;  1C1B A;  1RAF B;  1YVF A;  4U95 A;  2VFU A;  4EGL A;  5ETK A;  1VDH A;  2XMW A;  5HJY A;  2XHC A;  4P10 A;  5KT5 A;  3CJ8 A;  1H38 A;  2XMT A;  4O3R A;  3KG4 A;  4ER8 A;  4WZM A;  2KFY A;  5F0U A;  3J80 U;  4AL5 A;  3PYE A;  1X0F A;  4ED6 A;  2N3L A;  2ZH9 A;  3UVJ A;  1SCJ B;  5HLF A;  3JSM B;  4RNM A;  3G82 B;  3R5D A;  4X4S A;  2QTW A;  4J37 A;  1PBU A;  2ZBC A;  4HR2 A;  1FJG F;  2D9O A;  3DXS X;  3DN9 A;  2VQE J;  2OPP A;  1NJZ A;  5KFR A;  4GKJ J;  1T8E A;  4M8L A;  3BDE A;  2HBZ B;  2WVD A;  1NCL A;  1SUQ A;  1RTD A;  1NU4 A;  4LF6 J;  1J5E J;  2VC1 A;  5I42 B;  3W5Z A;  2QLJ B;  2X3D A;  2ZBI A;  2MMY A;  4LRA A;  1DRZ A;  1IBC B;  3T1H J;  4IG0 A;  2F65 A;  1S1V A;  4WJB A;  1MU2 B;  3ENA A;  3CPW R;  2CPF A;  3PY8 A;  4PXC A;  1NSA A;  1HI8 A;  5HQL A;  1IBK F;  5A8R B;  3OR1 B;  4F3M A;  3C19 A;  4FN5 A;  4RW8 A;  1LW0 B;  1L5U A;  4CO5 A;  3TR5 A;  4X4Q A;  1Q95 G;  2V6A A;  2AJ0 A;  2W2Q P;  3HFK A;  1UWB A;  3EIC A;  3P96 A;  1GX6 A;  1Z2Z A;  4ZIV A;  2HZC A;  4DV5 J;  5CZX A;  1XMQ J;  1RQ0 A;  3KUH A;  4OX8 A;  2V4Q A;  3TZX A;  2ZE2 A;  3ZTQ A;  4NLQ A;  3R6G B;  1FKP A;  4FPR A;  4QPT A;  1RWX B;  3OV7 A;  2AEM A;  2DR5 A;  3AD8 C;  2XMA A;  5CYQ B;  1T3O A;  1Z4U A;  2QA4 G;  1EB0 A;  5CYM A;  1HYS A;  1IQT A;  3CME S;  2XMM A;  4QWB A;  3P5T L;  3DC2 A;  5D4L A;  2LU2 A;  2IAJ B;  5FDL B;  2ZKU A;  2M4M A;  3MD3 A;  4KGV B;  1V5I B;  3H42 A;  3NMA A;  2HQI A;  3LGN A;  1MRO A;  3LP0 B;  3GIJ A;  1ZA1 B;  4OI0 A;  2V68 A;  3SI8 A;  1SQE A;  2X1G A;  3W2V A;  3P45 B;  1R8P A;  1TK0 A;  3IC1 A;  1O5J A;  5K5M A;  1U1P A;  2IBK A;  3M2R A;  3IWN C;  3CJK B;  1R8A A;  5J2N A;  2DGU A;  3O1L A;  3KJV A;  3TA1 A;  1HL6 A;  3CSK A;  3HHL B;  4QR1 A;  4H4O B;  4BCA A;  5IT4 A;  1YJN S;  2DHX A;  4KPY A;  4WF9 Q;  1LKZ A;  1U1K A;  2CWX A;  2HFU A;  5HVG A;  2VG7 B;  1HNW F;  2F7V A;  4YB7 A;  1NEE A;  4KB7 A;  3ADA C;  3QRP A;  4LRC A;  1MMN A;  5ADZ A;  2YXL A;  2XS7 A;  2YKM B;  2MLY A;  3KHL A;  3R9L A;  2MZJ A;  2OEM A;  1S5Z A;  4WP3 A;  1KC8 T;  4X66 J;  4DL2 A;  2KXH A;  3K2Y A;  3T5L A;  3Q22 A;  2R8H A;  3G6Y A;  3VAF A;  2W9A A;  3R7N B;  3MUT P;  3SBM A;  5H9F J;  3TO8 A;  3V4I B;  4JV5 F;  4Q2M A;  4ERD A;  1S9G A;  2HHH F;  4KSE B;  4AUK A;  3E8O A;  1YBT A;  4LQ9 A;  2B4O A;  4URS A;  4DSK A;  3G6E S;  5J2M A;  4Y2C A;  2F9J A;  1URN A;  2E9Z A;  2P8I A;  4DCO B;  4EO8 A;  4URQ U;  5F0W A;  2W9C A;  4RU2 A;  2KTQ A;  2DO0 A;  1JIH A;  2XB2 D;  3IGN A;  3NKY A;  3CTR A;  3NCQ A;  2JEG A;  4TLQ A;  2RQC A;  3PEJ A;  2I38 A;  4PPD A;  2BJ1 A;  2JFD A;  1HNV A;  1KEK A;  4ECX A;  1G7C B;  3LW5 C;  2LXF A;  3CD6 S;  2OPR B;  3OL7 A;  2XZW A;  1HBN A;  4CO0 A;  3I4P A;  1U6B A;  3MDF A;  2HQ3 A;  1T05 B;  1Q1K A;  4RPF A;  4CYU B;  4HTJ A;  1CEZ A;  4F3Q A;  4PWD A;  1RWP B;  3P4U B;  3JYT B;  1GTH A;  3TA0 A;  2DHH A;  5C2G A;  3SV3 A;  1B64 A;  3EDR B;  4OL8 A;  1S6U A;  4UTG A;  4YFU A;  4FPI A;  3GIM A;  4PQA A;  1RB0 A;  2Z2M A;  4RBU A;  4J9S A;  2G0J A;  4C3K A;  3D3B J;  1TL3 B;  5HP1 B;  5HI7 A;  3TI0 A;  1NME B;  4HTI A;  4LR7 A;  3GZ7 A;  2QFJ A;  4C8Y A;  3RUB L;  1ZM2 A;  2LXI A;  1S48 A;  3H5Y A;  2Q6B A;  4I69 A;  2N3O A;  1SQF A;  1ZM3 A;  4PG8 A;  2WTF A;  3EGV A;  4MH8 A;  4DL7 A;  3CJS A;  2IM3 A;  1TQL A;  1RSC A;  5DQI A;  4IFY A;  4HI2 A;  4FYY B;  3PKY A;  2BE7 D;  4ZJQ A;  4WBF A;  1X4C A;  3ZZO A;  1VR6 A;  2W25 A;  5KFZ A;  2C2E A;  2PMH A;  3N5B A;  4BC9 A;  3T9N A;  1F2G A;  3GYX B;  1ZA2 B;  2EFP A;  3M9N B;  2VAS A;  2GQC A;  4ECZ A;  3CIM A;  3VQS A;  1C0T A;  1M1H A;  4ZMM A;  3Q8Q B;  5A0Y A;  4UT4 A;  4NYZ A;  4ZLL A;  3BO2 A;  5T7L A;  2CPY A;  4DR5 J;  1SBR A;  2QLX A;  4CT8 A;  4RW6 B;  3M6U A;  1ZOT A;  5KFL A;  3KK2 B;  3CD7 A;  4CTA B;  3NRB A;  3T1Y F;  4Q8E A;  3LUY A;  1REV B;  1RXO B;  2D41 A;  4I4B A;  1FXR A;  2LCW A;  2CRL A;  3EGZ A;  5KFI A;  4DBQ A;  4I64 A;  3MUR P;  2ZHB A;  6FD1 A;  3D0H E;  1FE0 A;  2DJW A;  1YJU A;  3B78 A;  3S6E A;  1HHT P;  3U1M A;  3BYP A;  1N0U A;  5KG7 A;  4JI5 F;  5LSR A;  5KT3 A;  4JI6 J;  2WSC C;  3CJ4 A;  4OYB A;  1ZTW A;  4HEA 9;  2D3O R;  4H54 A;  3ULH A;  3D54 A;  2PGC A;  4CT9 A;  1YX2 A;  1FI4 A;  2C2O B;  2V2K A;  3G86 A;  1NLK L;  2DH9 A;  3R5B A;  2LA4 A;  3D1H A;  3DLG B;  4X65 J;  5K8M A;  2CG4 A;  1VQ5 S;  4QIV A;  1HW8 A;  1O0P A;  4KHP J;  2XG8 A;  1C1B B;  3QPI A;  3C46 A;  2PEB A;  2ZUA A;  5DQH A;  4DV7 F;  5H9E J;  5HO4 A;  1VHF A;  1T3N A;  4EYI B;  1H2V Z;  5D0E A;  4G3I A;  2YNF A;  5BR8 J;  3CDW A;  2WVF A;  1JLF A;  1KOO A;  4AXJ A;  2LU1 A;  9RUB A;  2GFF A;  2F9D A;  4KBI A;  4EZ9 A;  3BSN A;  4OJ3 A;  1PAE X;  4RNN A;  2GJF A;  3JSR A;  4EBE A;  1Y9O A;  3VV2 B;  3AOD A;  1XNR F;  4PUO B;  3E01 A;  3UVJ B;  2ZH7 A;  4DR2 J;  4X4U A;  3UE2 A;  3MM5 A;  3EZO A;  2MZ1 A;  3W8P A;  3A8J A;  4WZQ A;  1V9O A;  5ETL A;  1CLF A;  3THT A;  4TY8 A;  3LOU A;  2X1F A;  2RUS A;  2OPP B;  3AFG A;  1U49 A;  2AMC B;  1VC5 A;  2JEJ A;  1RTD B;  5HVF A;  5IV4 A;  1S1W B;  1WHY A;  1TKT A;  6FDR A;  3IRX A;  4IUF A;  2MEW A;  2I9S A;  2UUA F;  4UY8 T;  4FF4 A;  5JJB A;  3I31 A;  1UVI A;  1M1G A;  4IH6 A;  4CZC A;  1LV5 A;  2CQH A;  2FHO B;  1BUX A;  2HFZ A;  4QW8 A;  2BJE A;  4LF5 J;  5K20 B;  2J6S A;  2ATL A;  4J5O A;  1F5C A;  2NCK L;  2CQG A;  1PGZ A;  3TRG A;  4ZIT A;  2HHW A;  3CED A;  4RW8 B;  1S1U A;  3D7S B;  3MPY A;  4LMZ A;  3OJU A;  1HNZ J;  1P1T A;  2CPH A;  3VGV A;  5DDP C;  4CM2 A;  1NBE B;  4PAA A;  4WE1 A;  5DS7 A;  2HLU A;  3K8V A;  3L7O A;  2VKZ G;  1UWB B;  4QU7 A;  1TZ0 A;  2WON B;  2AJ4 A;  4LVO P;  4Q43 A;  2F4V J;  1SL1 A;  3RRG A;  1IVZ A;  4UF4 A;  3WQP A;  2CWK A;  2CJQ A;  1TMJ A;  1FKP B;  2VJV A;  4I1T A;  4DUT A;  2P9C A;  3ICL A;  4M63 A;  4IRC A;  4FYX B;  2XSJ B;  5CYM B;  1HYS B;  3I55 S;  4MIW A;  4RNH A;  4FXW A;  5I3P A;  4MKV A;  4ELU A;  4JUZ A;  3CWJ A;  1RWU A;  2B3T B;  3NGK A;  4AFF A;  1FD2 A;  3HT0 A;  5BYR A;  3V6D B;  4QWC A;  1Q8K A;  4B9N A;  4DXL A;  4DQI A;  1MRO B;  1HBM B;  4DR6 J;  2XI3 A;  3N28 A;  2DNO A;  1V3Z A;  3W2V B;  1XQI A;  2DKO B;  2V2Z A;  2A10 A;  3FMB A;  1NJW A;  3IAM 9;  2FLL A;  3W62 A;  2HHU A;  4MAK A;  3M2R B;  1NJI T;  1KFS A;  1L3T A;  3PIO Q;  1FCA A;  5J2N B;  2DNY A;  4ZVH A;  4DHV A;  1SQG A;  3KJV B;  5K8N A;  4DL5 A;  4RL1 A;  1QSL A;  1F6T A;  4JOU A;  5SZT A;  2FJB B;  1X7V A;  1AXQ A;  5A76 A;  2VOD A;  4OX9 J;  4OHZ A;  4QWA A;  3W60 A;  3MPU B;  1VLY A;  3GJR B;  3V5R A;  4OHW A;  5J1N A;  1J2V A;  2HK3 A;  2F40 A;  3PO4 A;  2BDP A;  3TZY A;  1WHX A;  2BJ3 A;  1Q79 A;  4JI0 F;  2WBM A;  3UDV A;  2CVE A;  1JLC B;  4M5K A;  4PYA A;  5IS2 A;  2JX2 A;  5C7P A;  4J7C A;  3AY0 A;  4DEZ A;  2Y3Y A;  2HAI A;  4CO1 A;  3D1Q A;  2A6O A;  3FEX B;  2G1D A;  2QMW A;  3PRD A;  5KG1 A;  4ECQ A;  1S9G B;  4MTP A;  1OYE A;  3LWL A;  3SQG A;  2RIJ A;  2KZM A;  1X31 C;  2NLW A;  3LPY A;  5J2M B;  4OI3 A;  4TVA B;  4ZKA A;  4CWB A;  1HWU A;  2VBZ A;  1S12 A;  2W9C B;  2ZH5 A;  3S8S A;  3ENV A;  4ICL A;  4P52 A;  4BDP A;  2VBW A;  4WK3 A;  2LQ8 A;  2KDO A;  1IKV A;  4FXD A;  4W90 B;  2CQD A;  3VGU A;  3CJ5 A;  4IR9 A;  4JI2 F;  4LF9 J;  2KN4 A;  1HNV B;  4DR3 J;  4PG6 A;  4JV1 A;  3IN5 A;  2CQ2 A;  5L1L A;  4TQR A;  3MCS A;  3NCP A;  3EDQ B;  2DNQ A;  1HBN B;  1K8A T;  4DF4 A;  1YRT A;  4RBV A;  4K4T A;  1NZA A;  3EGN A;  3HSZ A;  1L3S A;  3V6J A;  4PWD B;  1FRM A;  1X4B A;  3NEK A;  5KG5 A;  2M3D A;  2DBB A;  2E5H A;  1EP4 A;  3PJW A;  2V2Q A;  1A9N B;  1JMT A;  4JYA F;  2V50 A;  4NXN J;  3Q8R B;  1RT4 A;  3VAH A;  2K1R B;  4P72 A;  1WOO A;  3EUN A;  5DM7 Q;  2AJQ A;  3CDU A;  4I7F B;  3MOJ B;  3QLH A;  5FD1 A;  4DV2 F;  3AT1 B;  2RHS B;  4QIE A;  4CQ1 A;  1CJK A;  3NLC A;  3MPV A;  4G65 A;  5KFO A;  2RDD A;  5JUM A;  1UVL A;  3QIP A;  2M0G B;  3MCN A;  4OZN A;  4ES1 A;  5KFP A;  2D3O 1;  2R7R A;  3CO0 P;  1GXL A;  1SPB P;  3DI6 A;  4TN2 A;  4B3R J;  1UEV A;  1UZH A;  4F25 A;  3R7S B;  5E5N A;  2BXJ A;  3GP9 A;  2E5L J;  4B3M J;  3KJN B;  3VWS A;  4ATN A;  3PYD A;  2QA1 A;  1WI8 A;  2FGO A;  2CJB A;  2QO3 A;  2CZ9 A;  2OPS A;  2ROP A;  2QSW A;  2ZH3 A;  4LJM A;  1C0T B;  2N82 B;  2H5J B;  2C2K B;  1H2U X;  2MST A;  5A0Y B;  1F2H A;  3W9J A;  2NZ4 A;  1H2T Z;  4TQS A;  3T6J A;  4K59 A;  3DLE A;  3BQ2 A;  1NH8 A;  3F0N A;  1X5S A;  1KD1 T;  3FNN A;  2C2R A;  1FD8 A;  3PFE A;  4P6Q A;  3VF0 B;  1OS5 A;  3ISN D;  4DV1 J;  3ETO A;  5HL7 Q;  4OZ2 A;  2ZDO A;  1Q7Y T;  4QYR A;  2E44 A;  3HXM A;  2JHE A;  4UW2 A;  1LW2 A;  1IBM F;  2KHC A;  3IGV A;  1U7L A;  1FRH A;  5E3R A;  3S1T A;  1T9T A;  1TKZ A;  4P73 A;  4R0J A;  4F2R A;  4Z2X A;  2VPZ B;  1QJH A;  1M5H A;  1QAY A;  1B4S A;  4OLP A;  3MM6 A;  2ZJP Q;  3OUY A;  3IBW A;  3TQ1 A;  4LBP A;  4J9Q A;  1IKX A;  2K8G A;  1XN9 A;  2LQ5 A;  5KFA A;  3TQE A;  3RJM B;  3HKW A;  1RAC B;  1FER A;  2XEX A;  3R97 A;  2V4J A;  2BA9 A;  2VQF F;  1XBW A;  1ZTT A;  2PA3 A;  1WOP A;  4W98 A;  2PFD A;  2RS2 A;  1K1Q A;  1I94 J;  2CJ9 A;  1GMW A;  2CZ4 A;  4NWB A;  1R31 A;  2YNF B;  1R0A A;  1JLF B;  1D9A A;  3BBF A;  5DG7 A;  2PII A;  2W7A A;  5EDW A;  3PJ9 A;  5B08 A;  5AJ3 F;  1NPP A;  1X9M A;  3DLL Q;  4CH7 A;  4DFP A;  2MKS A;  1S9E A;  4P7V A;  1IWG A;  1N5T A;  2BM1 A;  3CW2 C;  2QYC A;  5C42 A;  2AQ4 A;  2HWT A;  2HZA A;  4A8O A;  3E01 B;  1WEL A;  4PR6 A;  1U09 A;  3MM5 B;  2KYZ A;  2YWE A;  4FNI A;  4AT1 B;  4TY8 B;  2Y1L B;  4OYO A;  5GAH I;  3NNC A;  1B3T A;  5LMN F;  3K59 A;  2HRY A;  1X4H A;  2W8K A;  2CAD A;  1ZAV A;  5E33 A;  3IRX B;  3QGP A;  3I9Z A;  4CLY A;  5CD4 A;  3KHG A;  1P8G A;  2QSF A;  1LEO A;  2Z56 B;  2B9Y A;  1OSC A;  1UEU A;  1ZM9 A;  2DNH A;  1YJW S;  1FDA A;  1ZH5 A;  1JX4 A;  2P9E A;  5LT5 A;  1X5P A;  1K1S A;  3DOM A;  2JVO A;  1OIA A;  2FUG 9;  1Q5V A;  2Y8W A;  3DRS A;  5F8G A;  5AE1 A;  1LWX A;  4K7Q A;  2A2C A;  4P7T A;  5I3U A;  4U6P A;  5L9N A;  1BQN B;  1F3F A;  4F0H A;  4WE1 B;  4PWW A;  5B0B A;  1HD1 A;  1Y11 A;  2WZ1 A;  3P5B P;  1GMV A;  1HW9 A;  2NSC A;  1VRU A;  1PIE A;  1UJ4 A;  4ZPC A;  2FC8 A;  5KOW A;  2NUH A;  1YBU A;  3T41 A;  2RIL A;  1X4E A;  4C0B A;  1APS A;  4OJG A;  1JXE A;  2XSF A;  2AJF E;  2A18 A;  5E41 A;  4FKY A;  1D8Y A;  1WG4 A;  4HDG A;  2JLG A;  2HHQ A;  1YBA A;  1N56 A;  1YZ7 A;  3AQP A;  2YKP A;  1NM2 A;  2RQM A;  1X9S A;  2E7V A;  2YNI A;  3A13 A;  3GCX P;  4ZVE A;  1XMO F;  1WG5 A;  3L3C A;  2IMW P;  1VBY A;  2CQ1 A;  3SSR A;  3IMQ J;  4ZPW R;  3W9H A;  3R5A A;  2VG5 A;  4PXD A;  2G13 A;  4PYD A;  1U1R A;  4I2Q B;  4NYP A;  4LF7 J;  2ZOF A;  3DU5 A;  1AZS B;  2H65 B;  1NZ8 A;  4LFA J;  5DG9 A;  1KON A;  2RT3 A;  1KQK A;  3QT5 A;  2ZM6 J;  2CUY A;  4NCG A;  4F0K A;  3VAK A;  2UZA A;  3G96 A;  3EVM A;  4EBC A;  1F5A A;  4C6A A;  5KFT A;  1VJW A;  2B9W A;  5BYS A;  1HQ2 A;  3MXH P;  3F41 A;  2P6S A;  4OQJ A;  3DOL A;  3U7J A;  5HSP A;  2WSE C;  3N01 A;  4L74 A;  5M2P A;  5L1K A;  4YR0 A;  3DHW C;  4Q5V A;  3OHA A;  3VTI A;  4DPY A;  1X9W A;  2GIR A;  1NK5 A;  1CJT B;  1UJ5 A;  4AD6 A;  1PAU B;  2Y1J A;  3PW2 A;  4LSL A;  2XUL A;  1ZET A;  2R7S A;  2QIF A;  3SQG B;  2DR6 A;  2BRK A;  2WOM A;  3CCZ A;  2JEI A;  2LDI A;  1RTJ A;  2E29 A;  4Q2L A;  3FCV A;  3H40 A;  1F9F A;  4ICL B;  4EUV A;  8ATC B;  1RTI B;  3E3X A;  2AX1 A;  4EI2 A;  3CJ3 A;  3H2V E;  2R7W A;  4JBC A;  1IKV B;  1U45 A;  2MKK A;  2Q3P A;  3H4B A;  2B51 A;  1Y5N B;  2C2N A;  3B4D A;  2PFF B;  4DV4 F;  2LKZ A;  1OY6 A;  4U8Y A;  5G0R A;  4RWW A;  4WP8 A;  2YX1 A;  2WW8 A;  5CXT A;  1QUV A;  2AGQ A;  4CLW A;  2E1P A;  3D6T B;  1MNE A;  5F8I A;  1VQK S;  1IJE B;  2VIC A;  3M32 B;  3ILO A;  3R5J B;  1YRX A;  3HPO A;  4PQU B;  1FJG J;  2YKQ A;  4NLX A;  4YQW A;  3FSX A;  2ZVS A;  2B9X A;  1YJ7 A;  3TNV A;  1N5S A;  3JAM U;  1Y3K A;  5B0A A;  3EVW A;  4KGM A;  4K50 A;  5HK4 A;  2AJ1 A;  1RT4 B;  4X4O A;  3CUN A;  1NAQ A;  4F04 B;  2B8P A;  3MHY A;  4CLZ A;  3FRZ A;  1S57 A;  4OZ0 A;  3A4T A;  3T9Z A;  1XMB A;  4EU0 A;  5A6P A;  3E2E A;  3QLH B;  1R0C B;  1IBK J;  3AD7 C;  4OZJ A;  1CJK B;  4UQT A;  2RQK A;  1BXN A;  1Q8B A;  1B0V A;  1CQM A;  1RAD B;  1MWY A;  5DDO C;  1O51 A;  1LWE A;  3D4J A;  2MPU A;  1JLQ A;  1FA0 A;  3IM8 A;  5M2R A;  2R7O A;  4K5R A;  2OD4 A;  3DYA A;  3T1A A;  2ZZN A;  1D9D A;  2RHQ B;  4I68 A;  1X0P A;  1ZS6 A;  4WWS A;  4DSL A;  2IDE A;  3TZW A;  3HZE A;  7AT1 B;  1YDL A;  1PBA A;  5J2P A;  2DCU B;  1GH8 A;  3CC7 S;  2KVI A;  4E0D A;  2CPZ A;  2ASD A;  4ZPD A;  3JQJ A;  3KLV A;  3D28 A;  2PDA A;  2QLW A;  2XWY A;  2DNN A;  1K9M T;  2YQ0 A;  4ZPB A;  1EHW A;  2B43 A;  2E66 A;  4L73 A;  2GO9 A;  3VAJ A;  1RWM B;  1JLG A;  3A12 A;  3UN3 A;  3DRP A;  1TVR A;  3OXL A;  5KT6 A;  3RZA A;  3DLE B;  4DQR A;  4C4W A;  2HNY A;  3ILJ A;  2W4D A;  2PO4 A;  3QQC D;  3IR5 B;  1FJ7 A;  5EGY A;  3UCG A;  4WTY A;  3ZZP A;  3CCL S;  4KAI A;  4CO2 A;  4Z37 A;  4AE5 A;  4QW9 A;  2GHP A;  1N6Q A;  4BC7 A;  3P8B B;  4Y2A A;  3R2C J;  4RBT A;  1FFS B;  1X4A A;  1TKZ B;  2BKP A;  2GVD B;  4DI6 A;  2J9D E;  1FNO A;  3MM6 B;  2MLZ A;  2NXN A;  1H7W A;  3OUY B;  3D6F B;  4MYT A;  1NSK L;  1HNW J;  2V9K A;  3W7B A;  4BWM A;  3DRY A;  2V4J B;  3E51 A;  1VQN S;  3SCK E;  2B7B B;  2CFX A;  2Y0S D;  2HKE A;  2WRM A;  4A4J A;  4YB6 A;  1VQ4 S;  4J9K A;  1R0A B;  2G2O A;  1Q4R A;  3UW1 A;  2ZC3 A;  3HSD A;  2LXU A;  4QWD A;  1B70 B;  5HN0 A;  1PKU A;  3GB0 A;  2RD5 C;  2OKQ A;  1M1K T;  3POT B;  1S9E B;  4JV5 J;  1U0H A;  1HNI A;  4Y2M A;  2CAJ A;  2FJW A;  2HHH J;  1JLE B;  5C42 B;  1KR4 A;  3KFW X;  3FEY B;  2EBG A;  3GYG A;  2XO6 A;  4HLB A;  1HR0 J;  5FLX Y;  1NND A;  2CNL B;  3VR1 A;  2XCA A;  1WKJ A;  3OR2 A;  3ITH A;  2KB2 A;  3W65 A;  2PI4 A;  1X60 A;  1TK5 A;  1MMD A;  2CVI A;  2MKJ A;  3UQS A;  1TFW A;  2V2V A;  4J90 A;  5IC6 B;  1PC4 A;  2MKY A;  4G1P A;  3IS9 A;  4GRS A;  3K5L A;  2IJR A;  2L9W A;  2W01 A;  2L08 A;  4XPE A;  2BAB A;  4H4M A;  2DIV A;  3DOK A;  2GGP A;  3L7U A;  1QAX A;  4S0M A;  2MZQ A;  2RVJ A;  3D68 A;  3MEE A;  1HNX F;  4ID5 B;  5IM0 A;  2A3J A;  1SC6 A;  3FBE A;  3DOM B;  3GIR A;  4NCB A;  3DRS B;  4OZL A;  2V0N A;  4DF8 A;  1Q8L A;  3OTO F;  4K4W A;  4QZV B;  3KHH A;  4AYB D;  5I3U B;  1ZAW A;  3PDN A;  3CT9 A;  4A8Q A;  1GQE A;  2ASY A;  4DL0 C;  3AJD A;  2OD6 A;  2C2D A;  3RAX A;  1O6X A;  4USW A;  1PJ5 A;  2ZJR Q;  3LAL A;  2J7K A;  1D09 B;  4USJ C;  2NSB A;  1RAA B;  2YWW A;  3KLE A;  1VRT A;  2GJ2 A;  4MIA A;  4K8R A;  4DL3 A;  2E1R A;  4RNO A;  2KG1 A;  3IWL A;  3AB2 B;  2OEJ A;  5L39 A;  4BS2 A;  1EQM A;  3JQM A;  3G4S S;  2DYA A;  3FKB A;  4IG3 A;  4J9N A;  1CC7 A;  4QWE A;  2NXE A;  4IR1 A;  5CQG A;  3LWM A;  4Y65 A;  2IVM A;  3A3N B;  1U0S A;  1TKD A;  1N32 F;  2CJX B;  1LK5 A;  1HMV A;  3C3L A;  3FZ2 A;  3KJQ B;  2XNQ A;  4LR8 A;  4AQY F;  4DV3 F;  5GAD I;  3QRQ A;  3HHL D;  3QAT A;  4YB5 A;  1A6L A;  5THW A;  2VG5 B;  4URG A;  1E6V A;  5AXK A;  4HT5 A;  3N9U C;  2M9K A;  4FYV B;  1T03 A;  2H51 B;  5IZH A;  3T1Y J;  1PO6 A;  2O66 A;  1YRU A;  2CQ3 A;  2MKH A;  3PW5 A;  2ZBP A;  1G4C A;  3B82 A;  3VVU A;  4CH0 S;  2KH9 A;  4IRK A;  3K57 A;  4XK8 C;  1YWX A;  2DRD A;  2QN6 B;  2K2P A;  3DOL B;  2YH0 A;  3MEG A;  3RBE A;  2U1A A;  5KFV A;  5F8N A;  4PXE A;  3WHI A;  3GV8 B;  4JI5 J;  3L09 A;  5KFS A;  1RHU B;  2XGQ A;  1TK8 A;  4C3L A;  3JSM A;  4B3O A;  1SJ3 P;  3HCX A;  1F5B A;  2MZR A;  3PYF A;  9ATC B;  1V5V A;  2HVE A;  4LSL B;  1FTR A;  2DXE A;  1CPZ A;  2CQP A;  4FZV A;  5I42 A;  1SJ1 A;  1RTJ B;  2DNG A;  1B99 A;  3QMQ A;  5HQM A;  4DV7 J;  2F3J A;  1VGY A;  2D74 B;  1IUJ A;  4CNY A;  4P9S A;  1M0S A;  5H9F K;  5G0R B;  1BQX A;  4KQZ A;  1XNR J;  1KNZ A;  1RAI B;  1LW0 A;  2RRB A;  2X3G A;  4HT7 A;  2EVZ A;  1H0H B;  3OFG A;  1UA1 A;  1IQZ A;  3GPA A;  4ZVO B;  3TYT A;  3B6B A;  3MFI A;  5LSL A;  2CPD A;  3FZB A;  3A8K A;  4DWI A;  1WHW A;  2QL9 B;  3FMW A;  1RTZ A;  5B09 A;  3IR6 B;  1OQ6 A;  3L7P A;  4GC6 A;  4C11 A;  3MR7 A;  3MR3 A;  3HD1 A;  2G1H A;  1IBL F;  3H20 A;  4N56 A;  2UUA J;  2ABY A;  4GVB A;  3MAA A;  5E0O A;  4EMD A;  1YHQ S;  2AHO B;  1NXI A;  1GMU A;  3OLB A;  2CJK A;  2QLB B;  4ILL A;  2QE5 A;  4NRT A;  3BGR A;  5CAA A;  2IM1 A;  4GVL A;  1YTY A;  3IWX A;  2WVC A;  5FDL A;  1RKI A;  1FJE B;  3MD1 A;  3J80 Y;  2ZOG A;  2DEJ A;  1TR0 A;  1LWE B;  1JLQ B;  2CPE A;  1CQN A;  3P49 B;  3H5S A;  2YH1 A;  1J5O A;  1DBD A;  4ZVR B;  2VG6 A;  1PIL A;  4F0M A;  1DTT A;  3MTJ A;  3KK1 A;  4C97 A;  1SJR A;  2DIS A;  1IR0 A;  3D67 A;  1IM6 A;  2GZO A;  1XR6 A;  2OGU A;  3OHB A;  3OW2 R;  1MG7 A;  3U1N A;  5J2P B;  2HEK A;  3ZZ0 A;  1AUD A;  1UW4 A;  1UFL A;  2H48 B;  1I1G A;  1SH3 A;  3EVO A;  2HIY A;  4NLT A;  3PXG a;  3OLA A;  2J6T A;  2EKY A;  2HUR A;  2J8S A;  3NGU A;  4GMK A;  2FTR A;  3ZZZ A;  4PPZ A;  1TVR B;  2R2R A;  2GQ2 A;  4CLF A;  4ECR A;  4XPC A;  3Q8P B;  2KM8 C;  2ZKT A;  2HNY B;  3EGW B;  2Y1R I;  4QCL A;  4PZV A;  3KNG A;  2XYP B;  3CVK A;  4PEO A;  4DCP B;  1S9F A;  1FNM A;  4ZS6 A;  2QMX A;  4B02 A;  2FPH X;  4ES3 A;  3RR7 A;  3K89 A;  4DFM A;  3BH6 B;  2K3K A;  3KOA A;  3V4I A;  3EE3 A;  4XDD A;  2FGC A;  4V1A k;  2DIT A;  4X4R A;  4UY8 5;  2H54 B;  4N8N A;  4J9O A;  4DOZ A;  1OSD A;  4ANE A;  4EO6 A;  2NRE A;  1WKK A;  4K2X A;  3QT7 A;  4Z7C A;  1UVJ A;  4DJB A;  3IM9 A;  3RW6 A;  4JV2 A;  3WIU A;  4ECU A;  3DFE A;  4NEZ A;  3AJ2 A;  3MGJ A;  4JI0 J;  4TU7 A;  2V69 A;  2VHG A;  3P3D A;  3PX4 A;  1J27 A;  4F4A A;  4ZP6 A;  1T05 A;  1RDR A;  2J76 E;  4K0K F;  1K0V A;  2ROG A;  2PMW A;  4HKQ A;  3SV4 A;  1U0H B;  1HNI B;  2DHA A;  4R8U A;  2U2F A;  3FFI A;  3EJM A;  1U8S A;  2EPI A;  3KXD A;  1H98 A;  5DO2 A;  2QL7 B;  3PNI A;  1LNQ A;  1XNQ F;  4HVZ A;  1C2P A;  1NDK A;  3ITH B;  1EET B;  1W26 A;  1NK9 A;  5H9E K;  3IP0 A;  3CJT A;  1S72 S;  3MCO A;  4ZK7 M;  4LRF A;  2YX7 A;  3V81 B;  4JI2 J;  2C3M A;  2ZNY A;  3ZZY A;  2DGV A;  2WAQ D;  4DZ6 A;  4B9U A;  4B17 A;  1JJC B;  5DGA A;  4X4N A;  4H4M B;  2YVS A;  3IBC B;  1VQL S;  2GGP B;  1G6B A;  4H4K C;  3OD2 A;  4ZP8 A;  4MT1 A;  3GJQ B;  1AYE A;  2NXJ A;  3MEE B;  4PG7 A;  2EK1 A;  3GSD A;  3W63 A;  4J9L A;  2GNK A;  4AXI A;  1NHK L;  4CCH A;  2NQP A;  3AA8 A;  2VV5 A;  2HGN A;  4OYZ A;  2VA3 A;  5H1S V;  1RLD A;  1T9X A;  4IDK A;  3NNA A;  4JYA J;  2WBR A;  1RI7 A;  2MYF A;  2KL8 A;  2VBX A;  4YB1 P;  4WFX A;  3KWM A;  2WVE A;  3UNG C;  1N48 A;  2DGT A;  2GA7 A;  2YKN B;  1RK8 A;  1KTV A;  2UUC F;  1JK9 B;  2B8Q A;  3CD5 A;  2HGL A;  4ELV A;  4XAK A;  3K5P A;  4DV2 J;  5DDR C;  3WBZ A;  1NJX A;  2MHE A;  4CTA A;  2VFT A;  5EX0 A;  2R4F A;  2EFO A;  1VRT B;  1UAW A;  2DGS A;  2WB1 D;  1KLN A;  3I82 A;  1YIJ S;  2BW7 A;  1U25 A;  4P2F A;  2DGO A;  4ECY A;  1HHS A;  2ACY A;  2UUB F;  3CXC R;  4IO9 Q;  4IG3 B;  3JS9 A;  2M8H A;  3ILL A;  1FFG B;  3NGD A;  4KT0 C;  3GG0 A;  1S0N A;  4FBU A;  4DPT A;  4AL6 A;  3ZZT A;  1KHW A;  2XY5 A;  2R2T A;  1A7G E;  2WSF C;  1HMV B;  1HKA A;  4DFK A;  4OX7 A;  1WWH A;  2YKA A;  5DGB A;  2JVR A;  1N33 F;  5HQ8 A;  4WU3 A;  4I56 A;  1PYT A;  3M8Z A;  2PSZ A;  3DLG A;  4B9V A;  4A46 A;  1E6V B;  1U2R A;  1VQ9 S;  1SKW A;  3VGT A;  2Q79 A;  1Y10 A;  3CCS S;  2FYX A;  2JLE A;  2HQC A;  3VGS A;  3W2W A;  2M7S A;  2RS8 A;  4I0W A;  4P71 A;  1FO1 A;  1FWK A;  1Z2L A;  1SH2 A;  3GE9 A;  1FRJ A;  3QT6 A;  4ALZ A;  4O3O A;  5D6G A;  2BKO A;  2P2C B;  2YWK A;  2KXF A;  4WFN Q;  4C8Z A;  2BOP A;  3MEG B;  4A48 A;  1V3S A;  1IBM J;  1NKB A;  4PUO A;  2IBO A;  3CJQ A;  1WDT A;  2Z2L A;  4KH1 B;  1P6T A;  2BVZ A;  4B3O B;  4KKO B;  4AL7 A;  2RU9 A;  2PA8 D;  1HFE L;  2E7X A;  4QYZ J;  1RT3 B;  1HLW A;  1LFW A;  5CCL A;  2DH8 A;  2I0X A;  1VQ7 S;  3JTN A;  1F1B B;  2XCP A;  5KTQ A;  5RUB A;  3PW4 A;  1RAG B;  1S1W A;  3D2W A;  1KWM A;  4M5H A;  2DGX A;  4WII A;  1BC6 A;  2VQF J;  4RO0 A;  5DG8 A;  1NB2 A;  2AGP A;  2CA9 A;  2QYG A;  4NEY A;  4QU6 A;  4MKY A;  2MSS A;  5KFD A;  2LP4 A;  1M90 T;  3BKF A;  3MM8 A;  2VFS A;  2B9E A;  2FJE B;  2Z30 B;  1S6O A;  2RJZ A;  2Y9H A;  1X4F A;  4DR7 F;  3W3S A;  1SIZ A;  2GVZ A;  3TP2 A;  5AJ3 J;  5KFK A;  1RYR A;  4ZPT R;  2RDI A;  4DR4 F;  5A8K A;  4RW9 B;  3VAM A;  5B0C A;  3X1L B;  1UVN A;  4NAS A;  3LTO A;  4LBI A;  2FIU A;  1W2B R;  1XTZ A;  1S1X A;  3NGR A;  1N4L A;  1H6K X;  3W1Y C;  2HLT A;  3MED A;  2D1C A;  1KHV A;  1X4D A;  4DLG A;  2KT5 A;  3EM1 A;  4OHX A;  4NLP A;  1UVK A;  3J7Z T;  2JNJ A;  4DS4 A;  2OI2 A;  1XEZ A;  2WON A;  2YQ1 A;  3TAP A;  5LMN J;  2VZ9 A;  4C11 B;  1VQS A;  3PR5 B;  1NKC A;  1EJ7 L;  2XC9 A;  3QJL A;  1H3D A;  3NS6 A;  3H0P A;  4U67 Q;  1RWK B;  1S99 A;  4B3T F;  2GMH A;  3MAA B;  4GVB B;  3RBD A;  5D78 A;  1F60 B;  2I6W A;  3O2I A;  1FES A;  2XSJ A;  2MZT A;  2UU9 F;  3IBF B;  2DRA A;  1WF2 A;  2XBP A;  4TYB A;  3JB9 k;  3KJF B;  1DFD A;  1XR5 A;  3KKF A;  2HPU A;  3BGR B;  3CIZ A;  5HJX A;  5ETO A;  3Q8V A;  2HGM A;  3V6D A;  4NLR A;  4YDX A;  4FYD A;  2OFH X;  2ALZ A;  3DLH A;  2VH7 A;  4PKD B;  2XS5 A;  4X2B A;  3SCJ E;  1TFY A;  4NRU A;  5C5J A;  1Y3J A;  2CG8 A;  1HBM A;  1IKY A;  4B3S F;  1YJT A;  3G87 A;  1J5O B;  4LF5 F;  5B7W A;  2VG6 B;  3MR5 A;  2IC3 A;  1DTT B;  3KK1 B;  1GTE A;  3BDP A;  3V4M A;  2DNP A;  5T14 A;  3OXF A;  4L72 B;  3OL9 A;  2DY1 A;  5EWF A;  3OFF A;  1YSJ A;  1RT1 A;  2MQN A;  4U96 A;  5KFH A;  2J9C A;  4LSN A;  1QLN A;  2BM0 A;  3QT8 A;  3JQK A;  4IOC Q;  2C22 A;  2CPJ A;  3RRH A;  2VPW B;  1OPZ A;  1YG0 A;  4OYW A;  4ZCM A;  1FHT A;  4FXV A;  3HJV A;  5BJR A;  2CXE A;  2HFO A;  3K0J A;  4O3S A;  4O0I A;  5K8P A;  1JLC A;  4KGZ B;  2RF2 A;  2NR0 A;  2FD2 A;  2D3U A;  1D0E A;  4ZVS B;  1XMO J;  2UVU A;  3VZI A;  2ZH4 A;  2DPJ A;  3BSA A;  3DLK B;  4I6A A;  3AJ1 A;  1ICE B;  3FRY A;  1S49 A;  1S6P A;  2XTJ P;  1FWL A;  3KMS A;  3R5C A;  3MM9 A;  3PCO B;  4F4W A;  1XIQ A;  4WKR A;  4YR2 A;  3OBI A;  3MMJ A;  3O5T B;  1KS2 A;  3OQ2 A;  4PRF A;  1RA6 A;  4OMF G;  1NPR A;  3R8Y A;  2EC2 A;  1KDN A;  1M5P C;  3NWR A;  1BY9 A;  3D5M A;  4N7T A;  2B6A A;  5CH7 B;  3T5J A;  1WD6 A;  2ZNZ A;  2ZEJ A;  5IWA F;  1FNX H;  3FBC A;  3MEK A;  3GR1 A;  4KYZ A;  3G8T A;  3AH6 A;  2G2Y A;  5D4P A;  2BQ3 A;  2E1C A;  3NOG A;  1SJQ A;  2UUW A;  2FZG B;  2HFS A;  4R8U B;  3OXG A;  3FFI B;  4DV0 F;  3U02 A;  3O6Q A;  2HHP A;  3PRV A;  2FY1 A;  3GII A;  2FHJ A;  4KGK A;  2EI5 A;  4KRW A;  3MR2 A;  4IYQ A;  2K1R A;  2V9W A;  3RBZ A;  4ILR A;  5KFC A;  4QR0 A;  4ZLN A;  2GQQ A;  4QR2 A;  3HFZ B;  4QBU A;  1GEH A;  4CM0 A;  4I7F A;  1T9U A;  4DV4 J;  2RU3 A;  5ETT A;  1NDL A;  3BJY A;  4OI4 A;  5MLC V;  3VAG A;  1U1Q A;  3QBC A;  2HNZ B;  3ZC4 A;  2OUG A;  4OYX A;  3W5X A;  3HHL C;  4USI A;  4MFB A;  2FVR A;  2W2O P;  1ZAX A;  4OIX A;  3MZI A;  4DUZ F;  3MAH A;  1IM4 A;  2R2S A;  3L4B C;  2ZVI A;  4JI3 F;  2DD8 S;  3FC9 A;  3FCH A;  4PG4 A;  1VI7 A;  4IDK B;  3FGV A;  4I67 A;  3TW0 A;  1UJ6 A;  4L75 A;  3M8W A;  2PC6 A;  2N4D A;  1P9Q C;  3BR8 A;  2XWX A;  1HI0 P;  4E8U A;  5LXR A;  2WVB A;  1JB0 C;  3UR0 A;  1SKU B;  3RBX A;  3UCZ P;  3GQC A;  3Q86 A;  4K4U A;  2ASL A;  3CCM S;  2AZ1 A;  1QY7 A;  4MK7 A;  1N54 B;  1SV5 A;  3DGV A;  1MWQ A;  3RU0 A;  5F3T A;  3QGG A;  1OWX A;  4P2M A;  3I96 A;  2DY9 A;  4LQ3 A;  2CNK B;  1WEY A;  5A2Q Y;  2GW8 A;  4OI2 A;  2M8D B;  3PFO A;  3EPI A;  2ZD1 B;  1OJ4 A;  4NLO A;  2E5J A;  2PD1 A;  3AA9 A;  3T5K A;  2V8H A;  1Q5Y A;  4NA3 A;  3M2V A;  2LQ9 A;  1UEK A;  3CCW A;  3HMJ G;  3A3O B;  2R8I A;  1UKU A;  5F9N A;  5EWE A;  4IFV A;  4TXS A;  1R8B A;  2DO4 A;  4O3N A;  4P75 A;  4L3N A;  1T02 A;  5IT9 U;  2PN6 A;  4OV6 A;  3PEH A;  4P2S A;  4F3O A;  5LL6 d;  2CQ4 A;  2BEF A;  5GAG I;  4RKU C;  1YK9 A;  2EKN A;  1IR1 A;  2V67 A;  2V8V A;  3BV8 A;  5D4O A;  5JXS A;  3FEZ A;  2DXD A;  4B3M F;  1V3R A;  3KUG A;  3TWZ A;  1KVJ A;  4YP3 A;  2XM3 A;  1AFJ A;  5CCM A;  3SXL A;  2CDQ A;  5BXI A;  3LAM A;  3OTE A;  3W2W B;  5KT4 A;  3DNC A;  4CRJ A;  1U8W A;  5ITH A;  2NZC A;  3UDL A;  3AD9 C;  1BWV A;  4RW4 A;  3EX7 B;  2YTC A;  1SL2 A;  1HBU A;  1NK0 A;  5G4D A;  5FJ4 A;  4O3Q A;  3OSP A;  3H90 A;  2DNK A;  5F9L A;  3ZXW A;  1YJ9 S;  4ANC A;  1OQ3 A;  4NI2 A;  4YDD B;  2N4C A;  2FHM A;  2IRU A;  2V34 A;  5DLG A;  2BQR A;  1NK8 A;  3W61 A;  1U26 A;  3DHX A;  2R3V A;  3PHT A;  3UPF A;  2HFN A;  4DN0 A;  1U2F A;  4DSJ A;  3BN7 A;  3GV7 B;  1RU2 A;  3CF5 Q;  1JNR B;  1P1L A;  4Q44 A;  2OSQ A;  2BAN A;  5D0G A;  4R5P A;  2BV3 A;  5MAO A;  5IC4 B;  2BW2 A;  1WEZ A;  1S59 A;  4A8X A;  1RWN B;  4F4K A;  5KFF A;  4IQX A;  3MM8 B;  3OSN A;  3VZH A;  5C2C A;  2KYX A;  3KNA A;  4WFZ A;  2GVZ B;  2J5A A;  3I0R A;  2B56 A;  5A8K B;  1EKS A;  2VFV A;  3I6P A;  2VKR A;  1MLA A;  1FFW B;  2HVD A;  3U1L A;  2X51 A;  2GO8 A;  3DDK A;  1S1X B;  2QT7 A;  1BQN A;  1JQG A;  3L95 X;  3MED B;  2XNR A;  1KP6 A;  3LPE A;  4WK1 A;  1BWE A;  3J7Y I;  4WFY A;  3VQT A;  5M2U A;  2L9D A;  4YUD A;  3NXZ A;  2F4F A;  2LMI A;  1D9F A;  3I5A A;  1AB8 A;  4UUW A;  4EK2 A;  3AOA A;  3HHN B;  1R7I A;  5A8W B;  4PAB A;  2B4P A;  1VYA A;  5KFG A;  3GSI A;  5AE3 A;  1PC5 A;  1SI9 A;  4EBD A;  2BE2 A;  3T19 A;  1FE4 A;  3NMR A;  1JNZ B;  4DFJ A;  2GS8 A;  4KFB A;  4UQG A;  1R3N A;  4CH1 A;  4DQS A;  1HNX J;  2O01 C;  2EG2 A;  2AEF A;  4JI7 F;  4J9M A;  1N0V C;  4WFA Q;  1CSJ A;  1WC5 A;  4ZJO A;  4DZD A;  2YX4 A;  2R7Q A;  3H7H B;  2POK A;  3RRK A;  1C0U A;  3OTO J;  2NXC A;  3N4W A;  5KFY A;  1AW0 A;  3BKU A;  2PMZ D;  3GLJ A;  3LQV A;  3MAQ A;  1IKY B;  1WSR A;  4KR0 B;  1P9Y A;  4NXM F;  4DR1 F;  3U27 A;  2IC3 B;  2MGZ A;  2OTJ S;  3QO9 B;  3THV A;  3BH7 B;  4I2Q A;  2W2P P;  1AZS A;  3FSY A;  4JP8 A;  3GFZ A;  3Q8S B;  1W7W A;  4OV1 A;  5HMY A;  1QAJ A;  1RT1 B;  4NL5 A;  2PT0 A;  4LSN B;  1ELO A; 
#chains in the Genus database with same CATH homology
 2B8P A;  1PAE X;  1LWX A;  3FBB A;  3PJ9 A;  1S57 A;  3VGV A;  1MN7 A;  1VYA A;  3ELH A;  3FCV A;  3BBB A;  1NPK A;  3FC9 A;  4F4A A;  4UOH A;  1F3F A;  1PKU A;  3B54 A;  3EIC A;  4FKX A;  4UOG A;  3DDI A;  3FBC A;  2BEF A;  1B99 A;  3ETM A;  3BBC A;  4HR2 A;  1UCN A;  1NSQ A;  5CAA A;  1JXV A;  1F6T A;  5IOL A;  3DKD A;  3VGU A;  3NGS A;  3ZTQ A;  1NB2 A;  1NDP A;  3EJM A;  4KPC A;  3FCW A;  1NSP A;  3VGT A;  2CWK A;  1HIY A;  3ZTO A;  3VVT A;  1BHN A;  1NCL A;  3EVM A;  3Q8V A;  2DXD A;  1S59 A;  3BH6 B;  1MN9 A;  4C6A A;  4ENO A;  4DUT A;  3PRV A;  3Q83 A;  1WKJ A;  4WBF A;  3EE3 A;  3VGS A;  3VVU A;  3NGT A;  2DXF A;  3ZTS A;  2B8Q A;  3Q86 A;  4O0N A;  3Q8U A;  3Q8Y A;  1ZS6 A;  1NDK A;  5BXI A;  3Q89 A;  5CAB A;  3R9L A;  1B4S A;  1NLK L;  3GP9 A;  3ZTP A;  2AZ1 A;  1S5Z A;  1NUE A;  4DI6 A;  4ANE A;  4FKY A;  1U8W A;  1XIQ A;  3EMT A;  3G2X A;  1WKK A;  1HHQ A;  4CP5 A;  5C7P A;  2BX6 A;  3ENA A;  3ZTR A;  3GPA A;  3B6B A;  4F36 A;  1NDC A;  1BUX A;  2HVD A;  3NGR A;  2DY9 A;  1LEO A;  4DZ6 A;  2DYA A;  3FKB A;  1NSK L;  1NDL A;  3BH7 B;  2ZUA A;  3L7U A;  3EM1 A;  1K44 A;  2NCK L;  3EVW A;  4AND A;  1BE4 A;  3JS9 A;  4S0M A;  1KDN A;  4W98 A;  1EHW A;  2AZ3 A;  2HVE A;  3EVO A;  1W7W A;  1XQI A;  2VU5 A;  3WX8 A;  3MPD A;  3FBE A;  1HLW A;  4EK2 A;  3FBF A;  4UOF A;  2HUR A;  3NGU A;  1NHK L;  4ANC A;  2DXE A;  1WKL A;  3BBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...