3GP9A

Crystal structure of the mimivirus ndk complexed with gdp
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
133
structure length
133
Chain Sequence
AGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 43
structure length 133
sequence length 133
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2009-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3gp9A00
3BBCA 3JS9A 2CWKA 3DKDA 2DXFA 1BHNA 2HURA 3EE3A 3VGSA 3MPDA 1PKUA 3EVWA 3VGTA 2HVDA 1UCNA 1ZS6A 3DDIA 1PAEX 3NGTA 3GPAA 3ENAA 4KPCA 2DY9A 1HIYA 2DYAA 5IOLA 1NDPA 3Q8YA 1NPKA 1WKKA 3ZTQA 4ANEA 4DZ6A 3FBCA 2VU5A 5C7PA 3VVTA 3FBEA 3FCVA 4FKYA 4ENOA 3Q86A 4UOFA 4UOGA 1NB2A 1XQIA 1NCLA 3Q8VA 3ZTSA 1XIQA 4W98A 2AZ3A 3GP9A 1BUXA 1LEOA 3PJ9A 3FC9A 4ANCA 1S59A 1W7WA 3EJMA 4WBFA 1NSPA 1BE4A 1KDNA 2B8QA 1MN7A 3ZTPA 3ETMA 4FKXA 4UOHA 3Q8UA 1NDLA 4DUTA 3B6BA 1B99A 1S57A 3VVUA 1NDKA 3G2XA 3EVOA 3NGRA 1WKLA 4C6AA 5CAAA 2BX6A 1U8WA 1F6TA 1HHQA 3WX8A 5CABA 1NLKL 4F36A 3ZTRA 4EK2A 1HLWA 2HVEA 3PRVA 1NDCA 5BXIA 3VGVA 1VYAA 3EMTA 3ZTOA 2B8PA 4F4AA 3BBFA 3FKBA 3B54A 3Q83A 2AZ1A 3NGSA 3NGUA 3R9LA 3EM1A 1EHWA 2NCKL 2DXEA 1WKJA 3VGUA 1LWXA 3EVMA 1NSQA 1F3FA 3Q89A 3BBBA 1JXVA 3ELHA 3FBFA 1NUEA 3L7UA 1S5ZA 1B4SA 4HR2A 4DI6A 3FCWA 1NSKL 1MN9A 4CP5A 1K44A 2DXDA 1NHKL 4ANDA 4S0MA 3FBBA 4O0NA 3EICA 3BH7B 2ZUAA 3BH6B 2BEFA
chains in the Genus database with same CATH superfamily
4ECRA 1F1BB 1X0PA 3OVSA 5HL7Q 4RNNA 2FVRA 5D3GA 3VGSA 3QRQA 4FYDA 2X3GA 5FDLA 2KVQE 1CBKA 2VFVA 3OL7A 4LBIA 5IFMA 3MWBA 4URGA 4ERDA 4DJBA 5KFGA 4AL7A 1E6YA 5AJ3J 4P7TA 2VFUA 3DRRA 3CT9A 4CLLA 1PAEX 4AYBD 4ZVHA 3HVRA 4P75A 2OPSB 3NP5A 2MKKA 1XNRF 1SUQB 2VV5A 1E6VA 2ZBQA 2N82B 3KLHA 4JI3J 5DS7A 4L75A 5DM6Q 1YKWA 5JXSA 3N28A 5LL6d 2QL5B 3CD7A 3M8QA 5D3GB 3PHEA 5IT9Y 4ECSA 1EKSA 1VK8A 1Z2ZA 4QOTA 1TK8A 4QCLA 2RVJA 1TL1B 3M8ZA 1WF0A 1IM4A 2GVZA 4IQMA 3RBDA 5B0AA 3KLEA 4A48A 1R0BG 4DV3F 5CCLA 1AA1B 2OHDA 5E3PA 5BYSA 3BSAA 2A18A 1U1RA 1RHJB 1HBMA 1TK0A 2RS8A 4MTPA 1NCLA 1WC3A 1X31C 3OT9A 2VF3A 4NZ7A 4OI2A 3ZTSA 3SDEB 2KTQA 2RDJA 3DGPA 4KGMA 4FZVA 4DPXA 1ZM9A 3R7BB 5LMNJ 3DLGA 4B9NA 1QAXA 2AU0A 4GRSA 2ZNYA 3M32B 4DX8H 1RCXB 1T11A 3A13A 4NYPA 3RAMA 1W2BR 1NSPA 4F3MA 3MMCA 5J1EA 4ZIWA 3D2WA 2OSRA 3QIDA 1JLBA 1XTZA 2DH7A 3GV5B 1KQSR 1X4HA 2NPIA 1G3OA 3E3XA 1RADB 3GILA 1UP1A 2CQ2A 2DB1A 4DZDA 2CYYA 4OHYA 3H59A 3HSDA 3NBPA 1N36F 1U8WA 1KOHA 2QC3A 1Q95G 2J6UA 3VAFA 2ZC3A 4JB8B 3HMJG 5HK4A 5HN0A 2VC1A 5D0HA 3ZTRA 4Y2CA 1FCAA 1Y3JA 3W7BA 2KI2A 2ZVIA 4QYZK 2R3VA 2VKZG 4K4UA 2DO0A 2CUYA 1OQ6A 3RZAA 4DR7F 2Y0SD 4ECYA 5HBMA 3UR3C 2H5IB 2CDRB 3CVKA 3D6HB 1FNMA 2CPEA 3FKBA 2K7JA 3HX9A 2BANB 4B02A 5I4MA 2RQCA 3HFZB 2C3YA 1OSCA 3AQPA 3O44A 4USJC 4OX9F 2CJKA 2IJNA 1AFIA 2Y1LB 1DQAA 4R0JA 3TYTA 1UVLA 4NEZA 4FXVA 1H73A 5M2PA 2EKYA 5LMNF 2YX1A 3FEZA 3RAXA 4DF8A 2WONA 2P6TA 4DL5A 1NSQA 2Z4PA 2FJWA 1VJWA 2V5HG 2KM8C 1F3FA 4ZPCA 1HBUB 4MYTA 4K0KF 4CRJA 3ELHA 3CJ0A 4I6YA 1N52B 1FF2A 1NUEA 2MB0B 1RT1A 2MLXA 5AE3A 3X3UA 3A4TA 2D69A 1RT2B 2CZVC 3PEJA 2HS3A 1KRPA 8ATCB 2J6TA 4YB7A 4DUYJ 2AEFA 2AV5A 2BJ1A 2E9TA 2WOMB 4F02A 1SIZA 1S97A 4LR9A 1JLCB 3MGJA 1JK9B 3UO0A 3HHLA 2DD8S 2UVRA 3QO9B 3N5BA 1FWPA 1HARA 2QLXA 2AYEA 3BH6B 3M2RB 4I2QA 5DQIA 3BBCA 3TJAA 1KP6A 1YZ6A 5G0RA 3OSPA 4DL6A 5C42A 2H48B 4M94A 1S12A 3G6XA 3KHRA 2K3KA 1NH8A 1HNZF 4WYWA 1AT1B 2QIFA 4YMEA 4KV8B 4Q7AA 4RU2A 3MMAA 4DX6A 3NGKA 4JI4J 2PMWA 4OYOA 4U6PA 1A6LA 2RHSB 2U2FA 1RA6A 5GAHI 2FZGB 2QYCA 4QIVA 4CCHA 1HW9A 2ZUGA 3O3LA 4UTGA 1BQMA 2G0JA 3CW2C 3DM2A 1UL3A 2GO9A 3H5XA 1JLAB 3DRYA 2R2TA 5IXUA 5KG6A 2FIUA 2FZKB 4KYZA 4YQWA 2IBOA 2WVDA 3VVTA 1IR0A 1T9VA 2DH8A 1V3RA 3V4IA 3I82A 4I2PB 1FT8A 2B4VA 4X62F 3SDEA 2HHUA 2HGLA 2OMOA 2YNFA 2MQOA 2ZD1B 2HNZB 4IKAA 4QIGA 1VLOA 3SMZA 5GAGI 3LH2S 3OUYB 4LF5F 2F4VF 1S1TB 3KLGB 1FKPB 3D1OA 3CCMS 1RZMA 1H3DA 4DLEA 1UA1A 1WC0A 2I5JB 4KHPF 1V3ZA 5KG3A 1SC6A 4CLKA 2BM1A 4KH0B 1C1BA 1K1SA 1SV5B 5CYMA 2BXJA 3NMAA 1Q8BA 1VRTA 2D3UA 2QL7B 1UW9A 2YWEA 3VQTA 1HKAA 2VBYA 3RRKA 3FZ2A 3IWLA 3MM8A 4L3KA 5A8KA 4ZJLA 4Q5VA 3ZTPA 1JJ4A 3M9NB 3KNGA 4FKXA 1C4AA 3BGRA 3Q8UA 2JOQA 4UOHA 3LWMA 1SL1A 4DR6F 1NDKA 2RF2A 2ALYB 1RT4B 1TZ0A 4WE1A 3TW0A 3ZFVA 2PI4A 3ZNJ1 3CDBA 4ILMA 3Q8PB 1FEHA 1R6VA 2KKHA 4OV1A 5D4OA 2XSJA 1UTAA 2VBWA 4ETZA 4AQYJ 2XY5A 5HROA 4WPAA 1R8BA 4CIOA 2WB4A 2R2UA 3I4PA 2QMXA 2R7OA 2DHHA 1S9EB 4LF8F 3DOLB 2YKOA 4USKA 5LMUF 3ZC4A 2HMIB 3L3CA 1S6QB 2XY6A 1S77D 4FXDA 2CVIA 4WFYA 3PZPA 3NS7B 1RUSA 4GKKJ 1VC0A 3KXDA 4RNHA 4K8RA 3MM5B 2DHSA 3W8PA 2DPJA 2AJ1A 5DETA 2PO4A 2M9KA 3NWRA 4NLSA 3V6DB 1QTMA 4PG6A 1D0EA 3GR1A 2QRRA 2VIHA 6FDRA 1YX2A 1AUSL 1P9YA 1GFWB 4IDKA 2JWNA 3PDNA 1S4EA 2RS2A 3G71S 4X64J 1VQYA 3GIIA 2UXCJ 1K1QA 2V50A 1RT2A 4TXSA 3UCGA 4CT9A 4DX7A 1SJFA 4RJVA 4HACB 2VONA 1HPZB 5HI7A 3GFXA 2LQBA 4RW9A 2XB2D 2IRYA 2XULA 1HBOA 2OUGA 3K59A 1P1LA 4IG3B 4NLYA 1LWEB 1N5TA 2LVWA 4MYUA 2C2DA 2A3JA 3OTDA 2C3OA 2CG4A 2OI2A 2ZNZA 1NU4A 2QFIA 2BW2A 2W4DA 2LMIA 2GW8A 3I5CA 3WC2A 4DCPB 4O3OA 2J9CA 3LAKA 2QLFB 3DLJA 2DO4A 4PG5A 4U9RA 1T3OA 2MQLA 2Y8WA 3OR2B 1K0TA 3BS9A 1T9TA 3CSKA 4ZVUB 2HWTA 3CCRS 2UUBJ 2ZOMA 1BHNA 3ISNC 4BDPA 4MK8A 5EGYA 3RRHA 2KB2A 5K8MA 3L7OA 1PKUA 3CCZA 1EQMA 1IKYB 2V6AA 1B7YB 1Y5IB 2EC2A 2EFNA 1PILA 3OVBA 4X4OA 2WRMA 4JV0A 3OFHA 3BM7A 1YBTA 1Q1KA 3PHTA 1NK5A 1TKDA 3R7NB 1RT6A 5DRKA 1X5SA 3EZ5A 2IM3A 4FYVB 2QX0A 3BDPA 4PUOA 1O6XA 1U8SA 5KFRA 4JI1F 3SXLA 1RT5B 1YBAA 3VWSA 4C8KA 1U2FA 3ILJA 4QZVB 3HULA 3IFEA 4H4MA 2R8IA 2V8PA 5KOXA 2ZD1A 3ZZ0A 3GZ7A 4LF7J 1MWQA 2PEHA 3WX4A 1X9SA 3FBEA 4CLFA 2IRXA 2QGFB 3DFEA 2XSJB 5D77A 2HBZB 1NHVA 3LP2A 5C2GA 3K5LA 4LF6J 3LP1A 3WQPA 4TU9A 4NOHA 5C25A 5ETKA 5K5MA 5KFSA 4DL7A 4H4OA 2OJ3A 2H9ZA 1TUVA 3GV8B 2WCXA 5I3UA 3D54A 1T0TV 1WI6A 1RWOB 3LGNA 1C0UA 2YQ3A 2BVZA 2G2ZA 1KFSA 1CJUA 2M52A 1LW0B 3C6UB 4JI6F 3O1LA 2IDLA 1RT4A 3GFHA 1IBCB 4ZVOB 1U2RA 3TJ8A 4EZ6A 2DK2A 1V6HA 4R8UB 2LDIA 3K17A 2G0CA 2QA4G 2DR8A 1M5KC 2JC1A 4Y2KA 1VJQA 1D8ZA 5L9NA 2BQRA 1C0TA 2HEKA 3MPYA 4OYBA 2UUTA 3W63A 2YKMA 1RAOA 2DNLA 1XMOJ 1S6PA 4USTA 3OLAA 4RNMA 3D67A 1L3TA 4DFPA 2JLEA 4WU3A 2HVZA 1I1GA 1JLEB 3L9ZA 2W2PP 3QJLA 1T9WA 1FK9A 2QYGA 3QFHA 2FJEB 3L09A 3K89A 4DBQA 2P5VA 2E66A 3MECB 1FTRA 2FQQB 1BXNA 2DNQA 3MPWA 4NMXA 1NDCA 1S9GA 4OZ3A 4DG1B 1RTDA 3SFGA 4JI7J 2CQHA 1UFWA 2JNJA 3WIUA 3RU0A 1XMOF 1R8PA 3IAS9 3AHPA 2WVEA 2BE2A 5HMWA 3I32A 1QDUB 2J8SA 1RXOB 4CT8A 3P6YC 5IT9U 2HNDB 2HHHF 5E41A 4YP3A 1B0PA 3K8WA 3WC0A 1U45A 5IQQA 4B3TF 4EBEA 4DV7J 2BKNA 3THTA 2ZITA 1YRXA 1CVJA 2WK4A 1SL0A 1WKJA 4NWBA 5ETOA 4D3HA 3TA0A 1WI8A 4LR8A 1HNXF 2MKYA 4KBIA 4OZ0A 1IBKJ 4CNZA 4MIWA 3FDSA 5SUHA 2MQPA 1JXVA 3GJQB 4U7CA 2F4VJ 3LOUA 1KKHA 3FJ2A 3JYTB 3KHHA 4O3RA 4B3OB 3PJXA 1F60B 1O5JA 2OEMA 3CWJA 3E01A 1S6UA 3U27A 4YY3J 5KFJA 3BO4A 1UJ5A 4NLDA 1N88A 2DNKA 3CULA 1Y5NB 4E98A 1HNVA 3HHLB 2ZH5A 4CLUA 2EBGA 2Y1IA 2O3DA 3VALA 4LSZB 4L73A 1C1CB 1PJ6A 3T5JA 2E44A 3KK1A 4KFBA 3QRRA 4MAKA 1SBRA 3DKDA 1IBMJ 4BLGA 4F4KA 2HURA 1H7WA 2JZ5A 1M5VC 3DLKB 1YG0A 1WOOA 2W7AA 3TR5A 4A8OA 2XLJA 5KT3A 1NJYA 4NX9A 4PG4A 4F3QA 1HNXJ 1HHTP 3IM8A 2Y9HA 2AJ4A 3CJ2A 4DOZA 1IWGA 3DRPA 4RWWA 4L74A 3T9ZA 2B9YA 3GE9A 5HMXA 1WACA 1XK8A 3CCSS 1HNIB 2GAGC 1OY8A 4KKOB 2UUBF 2N4CA 2YNIA 1GAOA 5D6GA 1FJGF 5DM7Q 2VFRA 2J0WA 1DLOB 3DRRB 5L8RC 2WW4A 1N6QB 1TMMA 1KS2A 3OFFA 6AT1B 3CC4S 3OQ2A 4RBVA 4B17A 2GHWA 4M95A 4NI2A 5D4NA 3BN7A 5DDOC 4EYIB 2EFGA 1WG4A 2LXUA 4N41A 4P2MA 5KFLA 4DQIA 1PSDA 4LIWA 1Z1ZA 5DLFA 1RKJA 4JV1A 3G8SA 2VOOA 5DQGA 4ZPTR 2GVZB 2GIQA 2WVCA 2O66A 2Z2MA 1JJCB 2YH0A 4Z2XA 4JI8J 1ZM3A 4LF4J 1SV5A 3EXYA 3QIPB 5CYMB 5DQHA 3AXMA 5T7LA 2QA4S 5H9EK 1VRTB 3H5UA 1BGXT 5D8HB 4QWBA 1Y0HA 4F2SA 3JAMY 4JYAF 3GIRA 4WFAQ 2YKQA 2QMWA 1UW4A 4WBFA 5KFNA 4EEYA 4J91A 2DGWA 1QAJA 4Y2AA 1WHVA 2MTLA 3MHYA 4K2XA 2ZOGA 3GWCA 3HKZD 3MM6B 5EX3A 5A6WA 3MM8B 3UW1A 3DLEB 2ROPA 4L6V3 4LRBA 1T8EA 4ZP7A 3AH6A 4NZ0A 2F1FA 3G82B 1T9YA 2Q79A 2D9PA 2BMBA 5J1PA 2DR5A 1DTQA 3HO1A 2I8EA 2MEWA 2IA6A 4FS2A 4DR7J 4KO0B 4MMOA 1IKXB 1RU1A 3GB0A 5GMKa 4Q8FA 2HHWA 4USHA 5F8GA 4DSLA 4B9VA 1R8HA 5AXMA 2ERRA 2AJFE 3DLBA 2HMIA 1RLCL 4LF8J 2R8JA 1RLDA 1S9EA 4NLXA 4DMZA 4ZLPA 3PYGA 1LW2A 5KFWA 2HGNA 2UV8G 3KDNA 1FFSB 3DLHA 4LFBF 1H2VZ 4Q44A 4QU6A 1FJ7A 3KJVB 4IO1A 3GIMA 4CYUB 1YJWS 4PQUB 1N5VA 2C3PA 4DR6J 4Q2MA 3NAHA 3AB2B 2VOPA 4AT1B 2Y8YA 4JI4F 4XDDA 4ED2A 1UMJA 3I9V9 2C2NA 2B4OA 4RW4B 1HNZJ 4B9UA 4Y34A 1FFWB 4K2JA 2EG1A 1J27A 2YNHB 1NB7A 1ICEB 2EEYA 2HFVA 4N56A 4LSNB 3BF4A 1JLFB 1EAYC 1VK3A 1SH0A 2XHCA 3VGUA 3T5HA 4J9OA 2EFPA 3AT1B 2C3UA 4URQU 3W62A 4C3MA 5KFBA 4DUZJ 2DNOA 3BSOA 1T95A 1U0HB 4OYMA 3P49B 7FDRA 4RU9A 2NXCA 5KFXA 1FWLA 3MEDA 1IQZA 1LWFA 3UDCA 4EO6A 2D1CA 3KLVA 1JNRB 1S1UB 1Q8LA 1R0AB 4X62J 4TLQA 1EP4B 3T3FA 1L3SA 3CNQP 2MMYA 2DR9A 3K0JA 4P10A 1TL3B 3FMWA 3ZNUA 5CD4A 4L72B 3CE8A 2E1RA 2LYVA 4NCGA 4X84A 4ECVA 3CCQS 4KTQA 2W2MP 4PUOB 1P6TA 4X2BA 5KTQA 3M6VA 3NS5A 1KQFB 1ZETA 2ACMA 1XNRJ 2APOA 5K8OA 4ELUA 4F25A 3P3DA 3R5CA 1S0MA 3QO9A 3HI9A 3VGTA 4BHQA 1UCNA 5E7OB 1IKYA 2MZSA 1B3TA 3IWNC 4FYXB 3SSSA 4QW8A 1M90T 2JFDA 2KXHA 2CQ4A 4HT7A 4ES2A 4HKQA 2EI5A 2GFFA 4MK9A 1FERA 3NXZA 4OHZA 4OZ1A 1LQ9A 3AOBA 3EWGA 4CTAB 4BCAA 2DRBA 2D74B 5L1KA 2AEMA 2FY8A 4CLSA 4DXLA 2QMUB 1JX4A 4WJBA 1XNQF 2WOMA 2H5EA 2PMHA 3IA0A 4ZLLA 4X66J 4EMDA 3DU5A 3W9IA 1JLCA 3KK2B 2QFJA 4B3RJ 1AFJA 1Y4ZB 1NK9A 3C6UA 4ECXA 4FKYA 1NK6A 1IN0A 1KQKA 4PWDB 1KLMB 5LM7E 3CJKB 3TAMA 2YPZA 4ICLB 3RJMB 3VZHA 2ZHOA 3TZZA 1S0OA 1C1BB 3SCJE 1FVQA 1S0NA 2YKNB 2O5DA 3B82A 2PEBA 3TRGA 3SZ2A 1YJNS 4NCAA 1VQSA 2J9DA 1NBEB 2L9DA 3BR8A 1TTHB 2VPXB 2B43A 4HT5A 2HNZA 4OX8A 3RB4A 2M70A 2IVFB 2XS5A 1HWIA 4IRKA 1S1TA 4D3GA 3KLGA 1BC6A 1WSRA 2K1RB 5E33A 1ZM2A 2DGTA 1IR1A 3G8QA 3HZGA 3QSYB 1CSJA 1S9GB 5LOQA 3AD8C 1W26A 4RW4A 3MR6A 4U8VA 2VPWB 3JTNA 2RU3A 4PXCA 5EUHA 5JUMA 3OL6A 4DCOB 3G87A 2DISA 4DQPA 3H2LA 4RLEA 4UY85 1WKLA 1WHXA 4OYWA 4C8OA 2HZCA 4JP8A 4X4QA 1LW2B 2E5JA 3MTKA 5KFFA 4DV4J 3I0SA 4C2MA 3BGRB 1N33J 1EARA 4G1IA 2CNNB 1DAXA 3C16A 3MECA 2V8GA 3N4WA 4RW7B 5IZHA 1GMWA 4ETXA 3PW7A 2VB6A 2CQGA 2CPXA 1S1XA 3J81j 2VD3A 4C8MA 4HI1A 2O1PA 3MD1A 1DTTA 2B7BB 2ZH4A 1RQ0A 1MU2B 4Z7YA 3HHEA 4R5PB 2E9ZA 2OSQA 3BBFA 1DQ9A 3KJFB 2D3ZA 2A2CA 1Q0NA 3B78A 4TY8A 1YJ7A 2F8HA 2J7WA 1GMWD 5SZTA 2BQ3A 1T03B 1WOSA 3IRXA 2HHXA 2ZZTA 1NXIA 3MXHP 1TUGB 2CPYA 1PG5B 3BEGB 3LP0A 3PJWA 2KYZA 4WE1B 5THWA 3PR4A 2N3LA 4B3SJ 1FEEA 1IJFB 1TKXA 2L9WA 3TP2A 4CH0S 4WKYA 1X4DA 5B0DA 5IT0A 2R2RA 1SKWA 5T41A 4IG3A 4DSJA 1N4LA 2HAFA 3M8WA 4OX7A 2GMHA 3GSIA 5IWAF 4PRFA 2JEJA 1VI7A 5KFAA 1UVNA 1CLFA 1DQ8A 4QWAA 3HVAA 3DLKA 1I3OB 2OPRB 3HJVA 3HM9A 1OO0B 2ZFHA 3NNAA 4DV3J 4HH0A 1T94A 2VHGA 3ILIA 4EZ9A 4H4KA 4NXMF 4J9PA 4MK7A 3DOMB 3T1YF 3HVTB 1WG1A 4YB1P 4WTYA 1B0TA 3FBBA 1H2TZ 4KC5A 5CYQB 2EFVA 2NR0A 1WD6A 2U1AA 1NZ8A 3GR0A 2E5LJ 2ZBIA 4C0BA 2XC9A 4JI3F 2WBMA 1IKWB 3QFWA 3PW2A 2XYHB 4NE9C 1WTBA 2CADA 3BDEA 4WIIA 3JSMB 2BDPA 3ET6A 4RBTA 1FRLA 3EE3A 2GJ2A 1PYTA 2JL9A 3JSYA 3S1TA 1U49A 1TKTB 2N7YA 2O01C 4J9QA 4ELVA 1RT7A 4KV8A 4NI2B 4P2SA 3UDLA 3BKTA 4K4VA 2HK3A 3D1HA 2FVSA 3AJ1A 4G3IA 4EGLA 4AL5A 1OYDA 3GPAA 3UR0A 1TFWA 3R97A 1TKZA 1GEHA 1ZAVA 2V63A 3P4UB 3QNWB 4DL3A 1KHVA 3BB5A 4U8YA 3BYRA 3A3OB 4YFUA 2BOPA 2KL8A 2CPHA 3Q8YA 1NPKA 1CC8A 3OD2A 2ZWPA 4GMKA 1N6QA 2E1CA 4O4RA 1JKHA 2RKIB 2XZDB 4ECTA 2PGCA 3K2YA 4DPUA 5F8IA 4K59A 2R7RA 5HP1A 3TZWA 4MH8A 1RYSA 3MI7X 2IJFA 2BR0A 4K4TA 2CQBA 1UETA 4UOFA 1N48A 4J9RA 4MKBA 2IVMA 2P8IA 4FPIA 1VHFA 1U09A 2GZOA 4AE5A 2R4FA 3AAWB 3G82A 5KFUA 1I94F 2QSWA 3MD3A 2ALZA 3CJQA 1Q82T 3SSRA 1OPZA 2N3OA 3N01A 4ECUA 4P9SA 1ITPA 4OYPA 1T9XA 3M8SA 1LK7A 1MU2A 4JYAJ 3QLHB 4I6AA 5F8JA 4R0EA 2Z56B 3VAMA 2HYIB 4DR4F 2K8GA 3GJSB 2VICA 4PEOA 2ZC4A 3M2UB 3KUEA 1AYEA 1HW8A 1FKOB 2B8QA 2ZWOA 3KK3A 3OR1A 4WK1A 4AXJA 4JI0F 2FHJA 2HW3A 5F8HA 1CC7A 2AEJA 2F4FA 3Q8RB 2KJVA 3Q2TC 1KHWA 1HHQA 4HH1A 3MEEA 3B4DA 2FLLA 4KO0A 2XS2A 2KHCA 1RCOB 3M6UA 3AODA 4EI2A 1YJ9S 2R8KA 4O4GA 2YVSA 4ED5A 3THVA 3CD0A 3PRBA 1GXLA 3MZIA 4CO3A 1ZA2B 1S6QA 4DDFA 3DRSA 3ITHA 1O0PA 2BE2B 3FEYB 1Q53A 5LSOA 2CZ9A 2LU1A 3J80Y 2V4RA 2HS0A 2AIRB 1B70B 2X1BA 1VYAA 3M8YA 2BACA 3D6TB 3ZTOA 4CQ1A 3ZZZA 5M2UA 5BJRA 3QZ7A 2PDAA 1JLGA 2YNGA 3PM9A 3R3TA 1HWJA 2Q6BA 3R1LA 2R8GA 1WDTA 3C46A 4DG1A 1NJWA 4C98A 2C2OB 4LF9F 4JI5J 1APSA 2DHAA 5F3ZA 3M9OB 4KQZA 2VZ9A 2J9DE 4P74A 5AE1A 2LKZA 1TV6B 1RWPB 3HD2A 4C11B 3GFYA 1VCTA 1QVFR 5KFDA 3ETOA 2XM3A 3MR2A 3IR7B 4PQAA 3CCUS 1PGZA 3TA1A 4O3SA 5KG1A 5B09A 4B9LA 4LFAF 3V81B 4O44B 4PWUA 1WORA 2B4PA 1SPBP 2NZ4A 1JLQB 5KFZA 3CJRA 4TYAA 4NYOA 3H4BA 1GH8A 2NPFA 1RP5A 3QAEA 1RGVA 2R7TA 3DOMA 1KVIA 4F4YA 5ITHA 1VQPS 5HLFA 1NJIT 1B4SA 3BQ2A 1TKZB 2HFNA 2W24A 2W25A 2ZH1A 2E5LF 3JAMU 1MN9A 4DV1F 1YGYA 1EKRA 4DR1F 2L41A 3ISND 3CDAA 3M6XA 2J9EA 3LWLA 1RHMB 1E6YB 1OY9A 2OKQA 2VBZA 1N5YA 3H0PA 3PACA 4CO0A 4MIBA 2W01A 5K14B 2F63A 1B64A 3A12A 2EVZA 1UZHA 1UVJA 1E6VB 2NUHA 2YBVA 3F56A 4U7UK 5HATA 1P1TA 3M7VA 3CCLS 3UCZP 2VQFJ 2JEFA 2OPQA 2DGUA 2M88A 3EGNA 1VDHA 2DBBA 2RU9A 1FRXA 1HA1A 1S48A 1YZ7A 4LIRA 2LEPA 3DRPB 4RUCA 4RUAA 3H5YA 1HBOB 2LLZA 2FHOB 4F50A 4B3TJ 2RUGA 3G9CA 2J7KA 2IBKA 2QTWA 2CJQA 4PWWA 4OI6A 2VASA 1QUVA 2MKCA 4KB7A 4CLPA 3QT7A 3HT3A 2VA2A 5F8NA 2N4DA 3W2WB 1MMLA 2LA6A 4IG0B 4O0IA 4NRTA 3G6ES 4QIFA 1TQLA 2Q1LA 3D9BA 3K57A 4J9LA 1HIYA 3M8RA 3SIPB 1VQ6S 2P2CB 5U47A 1JWWA 4X4UA 2RRBA 1G7CB 4PCQA 1D9DA 2I1RA 1NSAA 3CDWA 1KWMA 3W2VB 4LF2A 3GU0A 1HFEL 4TKTA 3R6LB 3KK2A 4IQXA 4IOAQ 1WDDA 1U1PA 3EUNA 5KT7A 3M32A 3M2RA 3LP2B 2B0GA 4UT4A 3OXFA 4XAKA 9ATCB 3LP1B 1SVDA 3TANA 4PPZA 2GHPA 1KLMA 2F3JA 2OELA 3DNCA 4DN9A 1U6BA 3LQVA 1FDAA 1NPRA 1XQIA 3DOKA 1VQLS 3DDNA 2OGUA 4HDGA 4KT0C 4LRAA 1LNQA 1M1GA 4NLRA 3QZ8A 4ECWA 3RB0A 2HIQA 3KUGA 5ETLA 1KC8T 3TVKA 4IFVA 2WW8A 4ZPWR 4J9NA 2UUAJ 1U1KA 2DHXA 2HPUA 1X4EA 2CQ3A 1S59A 1DARA 4X4RA 1T7PA 1QJHA 5B0CA 1EETB 1VQ9S 2F8EX 1S10A 1FESA 4ZVTB 1UVIA 2AT1B 5L46A 2FC9A 2MSTA 4DUTA 2QLJB 2VQEF 3GTYX 4NA1A 4H4OB 3W3SA 4HI2A 3BGFA 2ADCA 4AFFA 2ZVSA 3MM9B 1EB0A 1X8DA 4MIAA 1F6TA 2LU2A 4QQBA 1T9UA 2AX1A 3B4MA 3EDRB 3P8BB 4CLYA 4LF7F 1FD2A 1FK9B 3V6HA 4GKKF 4LFCF 1NAQA 4NZ6A 3NG8A 4I1TA 3VHQA 1F9HA 1P8GA 4M5HA 2V2QA 2CJBA 3MM7B 4XDCA 5KFQA 1FJEB 4JI1J 3D5MA 2GQCA 2ASYA 3GV7B 2NSCA 4ES3A 5KFHA 1WEYA 2YQ1A 1DTTB 4NA2A 2YH1A 1SH2A 4OFZA 4TN2A 3FFIA 5M2RA 4NMLA 4ZVGA 2EKNA 4DL0C 5LSLA 1FHTA 2J8AA 4ZVEA 1RWUA 2OP5A 4WP8A 2ZZMA 1KTVA 1J5EF 5HVGA 1HQUB 1QY7A 2IM1A 2PE8A 2W9BB 2AQ4A 3UN2A 3J80U 1UWBA 3S7RA 1H6KX 4WP9A 2CPFA 3MEDB 3NCPA 2IY5B 3RB6A 4IUFA 4LR7A 3ZZUA 4LBHA 4TLRA 5DDRC 5ETNA 1EP4A 1IKVA 2UUWA 1IKWA 1KVKA 1R43A 2MDAA 5JMNA 4FVMA 2ZJQQ 1QLNA 3BN4A 1YJVA 3TZYA 3BQ0A 5I42A 1FKAF 1ROFA 3MEKA 5T14A 3HP6A 1RKIA 1SCJB 3GYNA 3PCOB 2AD9A 2KXNB 3OW2R 1HWKA 1TVRA 5L39A 3HVWA 2WTFA 2HAIA 4DLGA 4QBUA 1SQEA 3KLHB 2RT3A 4LMZA 1S0VA 1DFDA 1DURA 1U0HA 3MM5A 2GGPA 3QWPA 4LRCA 4CYUA 1VLYA 5MAOA 1ZTTA 1JXLA 4DQRA 4FBTA 2N7CA 1L3VA 1NKCA 2VG7B 4CWBA 4ED1A 3W2VA 4ID5A 1TL1A 4PXBA 5L38A 2D3O1 4P6QA 2DVIA 1RAHB 1FJCA 2A6OA 5DZ7A 4K4WA 5DGAA 3PEHA 4LSLB 5GMDA 4KGZB 4QJVA 3WHIA 4DL4A 2FUG9 1K0VA 3VZIA 4J9SA 2IJRA 4HLBA 3T1HF 2BQUA 4PZVA 4QWDA 1CEZA 2VFTA 1MMDA 3G6VA 1N36J 2BKPA 3WDOA 2R9LA 2PC6A 4TU8A 3I0RB 1YJTA 1Z4UA 4CO2A 1S49A 1BWVA 1I51B 3GQCA 2G4BA 2HRUA 2YNIB 4NRUA 4RZRA 5BR8F 2YQ0A 4RR5A 3MCMA 3R1HA 4N76A 2IC3A 2R7VA 3CO0P 1K47A 3MMCB 2I9SA 4LBPA 4NLVA 3HFVA 3SQGB 2J0XA 2QLBB 4CM0A 1HWUA 1LXJA 1V3SA 1YRTA 1MNEA 2A0FB 5C24A 3NOGA 3TUIC 3TJ9A 4DS4A 1YTYA 3PO4A 3AY0A 2C42A 1FRMA 4QYZJ 1DJ0A 2RNEA 2AP6A 3G8TA 1OMSA 2MKSA 2OPPB 4ZN3A 3KK3B 1ACMB 2BUNA 2HQ3A 2HQCA 1K73T 1HNIA 3UCUP 2AX0A 2VKRA 1ZPVA 1CG2A 1OYEA 3O2IA 1Q4RA 5HJYA 3GYXB 1S99A 4C48A 2FLPA 3R27A 2HHVA 4J90A 2NXUA 4QWEA 1SKSA 2AZ3A 5T7LB 5KFYA 2MKJA 3QLHA 3OHBA 2R7WA 2OTLS 2DGQA 3CCVS 4DR3J 3BPDA 3PNIA 3Q0AA 1TFYA 1T02A 1UEKA 4O23A 3IRWP 4A8XA 3ITHB 3L7PA 3OTEA 1HR0F 1RHQB 3IGNA 3T1AA 4ZK7M 3TOQA 1B0VA 1Y7PA 5FLXY 4EYHB 1NDLA 2GA7A 4EBCA 2C2ZB 2Q3PA 2K1RA 2W4PA 3EVOA 4PG7A 3T6JA 2W8LA 1EIYB 3H5SA 2B7CB 1FI4A 2DIUA 2G13A 3WX8A 4PABA 2HLUA 1H74A 1BQNB 3NEKA 3FMBA 2M4MA 5CZXA 3MOZA 4WP3A 4X4TA 3MR5A 4O4GB 1IM6A 2QA1A 3OFEA 2CJAA 2MY8A 2F40A 5EWEA 4CO4A 3EPGA 4ALZA 2F9JA 3DXBA 4LREA 3PRVA 4N7TA 3S01A 1XERA 1KSPA 2XSFA 4TNOA 3C6TA 3VQSA 3T1YJ 4E8UA 3A8IA 4N5SA 4HDHA 2E9RX 2H54B 2CNLB 1VIXA 3AOAA 3C16B 4L3NA 5A76A 2W9BA 2BYCA 1RAIB 2QN6B 2EC0A 1NMEB 3ZZTA 1CQMA 1FD8A 2HNYA 3K8VA 4DL2A 1ZPWX 3WBZA 1TV6A 2PN6A 3NGSA 1KTQA 4ZVPB 4K7QA 5A0YA 5LXRA 4MKYA 1N5YB 4OJHA 2AGPA 3KG1A 4NL5A 2V4JA 3DXSX 4KH1B 4ZVRB 3UD5A 1AXQA 3Q2SC 4YDDB 3FUYA 3VAKA 3Q23A 4LF1A 3HVTA 4CO1A 2CA9A 2ZKUA 1QUPA 3I0RA 3J7YI 4ECZA 5I3PA 3ADAC 1R89A 3GIKA 4Q2LA 3IWXA 4ZHRB 2KZZA 4F4WA 3OVAA 2MGZB 4DU7A 2WBRA 2IC3B 4EO8A 2UVUA 3CGIA 2MHNA 4DPYA 4I7FB 1W2IA 1NHUA 1YWXA 3BJYA 1AB8A 3P5BP 1I6JA 2MJNA 4YR2A 2JDJA 3A3NB 2NUUG 3EICA 3UQSA 2OTJS 1RT7B 2P9GA 1NKEA 2DCUB 1QSSA 1X5PA 2IIHA 2BEFA 4WFBQ 1WUUA 1K9MT 2HBQB 1UVKA 4DV4F 4YDXA 3JSBA 3CUNA 3M6WA 4HYKA 2X51A 1TAUA 4M5IA 2FTRA 4M5LA 5HSPA 1WEXA 2OO4A 2QJ3A 4XK8C 3EZOA 4WFNQ 1HNWJ 4K4ZA 3GG1A 3CCTA 3BGOP 3BR9A 5KFTA 4ZCIA 2F5GA 2I6WA 1KQGB 4O3QA 3I5AA 3NNCA 1U2CA 2DR6A 2CFXA 2E7XA 2FHMA 2GJFA 2JVOA 3T9NA 1DZ5A 2DPIA 1F0XA 1XR6A 2EPIA 3D3BJ 1MLAA 1BMQB 4M5DB 3MFIA 5HP1B 4PG8A 2GS8A 3TVZA 4U7UD 2CAJA 3DU6A 1MSWD 3QT8A 1URRA 3BGUA 5CYQA 1NPPA 3LTOA 1J5OB 4C4WA 2XBPA 2WAQD 1Q7YT 1Q5YA 2OMLA 2MQ8A 2J7UA 1FRHA 5LSRA 1EETA 2QSFA 1N54B 2IRUA 3HD1A 4KFBB 2BE7D 4OJ1A 3PYDA 1QE1B 4UW2A 4PPDA 4JUZA 2W1BA 4DV5J 3TVYA 5GVQA 5KOWA 4XPEA 3LPEA 4TU7A 5EWFA 2QEXS 4UOGA 1NJXA 1NB2A 2HHTA 2BV3A 1VRUA 3DOKB 4URSA 1HBNA 1SIWB 1UJ6A 1U1MA 4CTAA 1R8CA 1FNOA 1S6OA 1XIQA 2J76E 2ASJA 2KFNA 1IQTA 3HKWA 2OD4A 3OXGA 2LXFA 3PRDA 4RW8B 1P27B 2VUGA 4ITSA 2ZH8A 2KH9A 1F2GA 3ZZYA 5I3QA 3DLGB 1D9FA 4KKOA 4W4MA 2X7IA 3T41A 3DMJA 2RH3A 5D15A 1TAQA 3QSIA 1U1NA 5H9FJ 4GKJF 3IC1A 1CULB 3G96A 3I6PA 4FVCA 4FF3A 2P9CA 1HNWF 1UFLA 1Q16B 3BO2A 1PC4A 1T05A 1FE4A 2HSEB 4G1QB 1F2HA 3ENWA 2DNPA 1SQFA 3OTOJ 1X4AA 4BS2A 1S76D 1MWZA 2G2YA 4CO5A 1ZZFA 4J5OA 2IDEA 4Z37A 1FRJA 4CNYA 4OL8A 1U1LA 1FX2A 3QGPA 1RHRB 2MZTA 1BD6A 4ZOSA 5FLXU 3CMES 4YR0A 4K4YA 2B9XA 1SJQA 3OTOF 2RRAA 2RMLA 3BSNA 1LKZA 4N77A 1O51A 1R8AA 4G6VB 4I7FA 3Q22A 1KEKA 3DYAA 3SI8A 1WF1A 1FA0A 2R2SA 4ZIVA 3C8YA 3FQLA 2YWWA 2C22A 1OJ4A 2JEGA 3TQ1A 3CC7S 3E01B 2IFXA 4QPTA 2H4YB 1Y11A 4A8YA 2CWXA 2DY1A 2OEJA 3H40A 1HR0J 3MCOA 5KG2A 1UVMA 3EXCX 2IHR1 5F0WA 2BOAA 3X1LB 2G1HA 4WF9Q 1YLXA 4V19X 1LWXA 3M9MB 3EVMA 2LEBA 2WSEC 4IOCQ 1JNZB 2YWFA 4I2QB 5F0UA 8AT1B 1HL6A 4NPOA 4OLPA 5KFOA 2CNKB 2CQ1A 2JX2A 3FBFA 2RHQB 5E3RA 2VFSA 3QGGA 4YHHF 5DDQC 4HR2A 4DV5F 1JLQA 3RG6A 1R3NA 1RT1B 2VG6B 4GVLA 3HLUA 2DXDA 1NHKL 2CQCA 1TL7A 3HF5A 4B9TA 3Q8SB 3LP0B 4P7VA 2ZOFA 3C3LA 4RPFA 4FYWB 4ID5B 4DR2F 3C15A 3IBCB 3HXMA 4UZBA 1NRKA 3V2UC 2GQQA 4OYXA 2ZUAA 1NJZA 4IYQA 4CH1A 2MY7A 4FYYB 2JRSA 2ZM6J 3PV8A 1TP7A 2AF6A 2GIRA 4LSNA 4EUVA 4DV0F 5C42B 4I67A 2KO1A 3HPOA 3IR5B 3J7ZT 1HBNB 4Q45A 2L48A 2Q43A 1ZS6A 1L5UA 4ID8A 2KT2A 2DNYA 4ECQA 2UUAF 1UZDA 4C8NA 1RTZA 2DEIA 3CXCR 4C8LA 2VG5A 3UN3A 3W8GA 1D1UA 1CJUB 1RDRA 3W5XA 1J5OA 3UDVA 4P73A 3W5ZA 4EFAC 2IAJB 1RE1B 4ED0A 1X4FA 2PSZA 4QIWD 4DR5F 1WG5A 1JXEA 1CULA 3W2WA 1UA0A 2HQIA 1RWMB 2DKOB 3US5A 4ANEA 2XNQA 4JI2J 1SJ3P 2YWKA 4KE5A 1SUQA 1UAWA 4M5MA 5C7PA 4LRDA 3CF5Q 1K8AT 2HRTA 4G1QA 2K3IA 1EX8A 1RAFB 2QT7A 4ZVQB 1XWLA 5A8WA 2CPIA 1Q86T 4X65J 2OPPA 1GT8A 2ADBA 2W2OP 4QU7A 3DLEA 4B9SA 2UU9J 1C0UB 3UWTA 1X4BA 1M5PC 3OUYA 5ETSA 4NYZA 3RTVA 2J6SA 3ZZOA 1Q7LB 1VGYA 1X4CA 1RWWB 2H51B 1FKPA 1H72C 4CZCA 3PXGa 1RU2A 3N79A 1VBXA 2DTJA 2CXEA 2I5JA 5BR8J 3FC9A 3DYAB 3OJSA 1W7WA 1UEUA 4WFZA 4ILLA 3TUJC 3OTBA 3VAJA 2RIJA 5A8KB 1WHYA 2Y1RI 2HFZA 3HK2A 3OR1B 3C6TB 2AYBA 5KT2A 3HJFA 2P9EA 2XG8A 1AZSA 4E0DA 2IA0A 2MYFA 2Y3YA 3J81Y 5B08A 3VAHA 1XBWA 2EWHA 1LV5A 3C19A 3EGZA 1U4BA 2J5AA 3SQOP 4NLPA 1XJWB 5KG5A 3MEEB 5EX0A 1ZM4A 2CPJA 2W4CA 4DPTA 2ROGA 3HSJA 3RAQA 5LJ3Y 2RDIA 5AXLA 5KFIA 1SC4B 2EXUA 2UXDF 5J2PA 4J9UE 1FVSA 3HFKA 2AMCB 2H3EB 2XMAA 3TZXA 5KFKA 1VQNS 3QBCA 4QR1A 3KJNB 3KKFA 3W5YA 4JV5J 5F41A 4QWCA 4GC6A 5BYRA 1U6FA 3C15B 4RW6B 2GHVC 3V4MA 2Y1JA 2QZ8A 1FTCA 2W2NP 2VDIA 2FJDB 5CZVA 1B7FA 3FZBA 1V5VA 4OZ2A 2FDNA 3VAIA 3NWGA 3T6BA 1YVFA 4C8ZA 1SL2A 3M30B 4JOUA 3HCXA 4UQGA 3QT6A 3NBPB 2EK6A 3SV3A 1JB0C 3JB9k 1A7GE 4DV7F 2HKEA 1VHIA 2KVIA 1UFKA 2HBRB 2LFVA 4HHHA 4P71A 4YN3B 4RW9B 4F2RA 2WVFA 4C97A 5HVHA 1MG7A 1SC1B 5CA5A 3CD6S 1H0HB 1D9AA 2MGZA 5IV3A 1VBZA 2KYXA 2ZBCA 4I69A 2QG9B 2OFHX 4QR0A 3MAAB 3TEGA 1U25A 2EBEA 1RTJA 3DI6A 4KGKA 5KG7A 1IUJA 4S0MA 3I55S 3NKYA 2XYGB 2ZH3A 2MJUA 3F41A 4TY8B 4UY8T 1HQEA 2ZDPA 1X4GA 1RK8A 4NLOA 1GMUA 3WIVA 4F4XA 3V6KA 5IT4A 4B3MJ 1OWXA 3FK4A 3N5FA 3SV4A 3DLLQ 3FVYA 2A6MA 1S7IA 2DXFA 2M7SA 2XCAA 2XEXA 3AJDA 4IH7A 3I5BA 5H1SV 3OPKA 4OMFG 2BRKA 5KFMA 1RSCA 3UNGC 3EVWA 2BJDA 3NY0A 2XZWA 2WSFC 2RD5C 2VQEJ 4IRDA 3D7SB 5CD4H 2G0IA 5H9EJ 3SSQA 1TU0B 2XMUA 1UPPA 3DDIA 2IAJA 2RDDA 5KG0A 2DGSA 2JLGA 3CCWA 3PG9A 4FNIA 4W92B 1G2EA 4ICLA 2W7OA 4ED3A 2AGOA 4JI6J 1RT6B 1GX5A 5DG8A 3ENAA 2F9DA 1XMQJ 3KLIB 4A4JA 4DWIA 3I96A 5LXYA 2VQFF 2P6SA 2OPQB 2V94A 4I68A 4JBCA 3KMQA 2DYAA 1X5TA 2UV8A 1CJVB 5B0GA 1NDPA 1U6ZA 2LQ8A 1FRKA 1WKKA 2ZEJA 2JHEA 3GSDA 1TUWA 4ZVSB 3F44A 3QGIA 2MSSA 5KFVA 2UU9F 3ENQA 4KPYA 3CB4A 1N0VC 1RYRA 1F5AA 3ET6B 5L1IA 4IG0A 4LJMA 1RBOB 5JVHQ 2KFZA 2ASLA 3TAQA 1C0TB 1SKUB 1SQGA 2F65A 5CCMA 3ICLA 3PTWA 2EFQA 4USWA 2YKPA 3K7RA 3DDKA 1RT5A 3JQMA 1M1KT 3UN5A 4RW8A 4UF4A 3CPWR 2M3DA 1ZAXA 3KJVA 2J0SD 3QATA 1LW0A 5GAGU 2F8MA 5GAEI 3MUMP 3ZXWA 1FFGB 3BGLA 1WJ9A 1Y5LB 2M5YA 1CS4B 4K5RA 1GX6A 5CH7B 5KFCA 3G4SS 2HFSA 2ZJRQ 3J81U 2BABA 1PIEA 2MLYA 3NOCA 9RUBA 2M0GB 1S1XB 1MROA 3NS6A 2B6AA 1U26A 3R6GB 5HO4A 1FWKA 2E1AA 3AFGA 3FRZA 3T5KA 3TX8A 5KT4A 4OI0A 1BLUA 3VVUA 2VJVA 3AB4B 3KMSA 5E2QA 4YEAA 5F9LA 5C24B 3KTQA 4JV5F 1T05B 1M0SA 1A0OB 3V4IB 1U24A 1IBLF 3HHDA 3R5JB 4FP9A 1TR0A 4LUBA 1G4CA 4OJ3A 4ZVFA 6FD1A 2YKAA 4UUXA 4V1Ak 5J2MA 3EDQB 1HMVB 2HVHA 2HWHA 3VGVA 4KR0B 3PX0A 2UUCF 4NXNF 1HQ2A 2YNHA 1RAEB 3KHLA 4EBDA 4JI0J 4DFKA 1VQMS 4ZITA 2WZ1A 3N6MA 2LQ5A 3S8SA 4FF2A 2MZRA 1AROP 2AHOB 1RTIA 2Y0BB 2YX4A 3H98A 3Q83A 1FKOA 2BRLA 1BQXA 4CLTA 4WKRA 3GCXP 1KN6A 1RJJA 4ZJQA 3QQCD 2FJBB 4GVBB 5GADI 4F8RA 1UWBB 2UXCF 4P2XA 2ZZNA 3CIZA 3PIOQ 3HDSA 3O5TB 3D0IE 5DZ6A 2YPYA 4AUKA 1LWFB 2JLFA 5EN1A 2XO7A 2C2EA 1RTDB 2KDOA 3Q8QB 1R0AA 3GMGA 3MMBA 4TVAB 1RTJB 3DI6B 1N56A 2COLA 4ZPBA 2CIMA 1BY9A 2V4JB 3LO3A 5D78A 4JI5F 4LF9J 2BANA 2UZAA 2KRBA 2CPDA 4RUBA 3VR1A 2KG1A 4B3OA 4X65F 1VISA 2K06A 2DGVA 4J37A 2VG6A 5ETRA 1HPZA 1FXLA 2HHPA 3E8OA 1H98A 1QM9A 1S1WB 2LP4A 3H7HB 4KHMA 2DITA 3FSYA 1FDDA 2XQCA 1RABB 3LGHA 1X5OA 1HBUA 4USUA 3W61A 2CWKA 3H2UB 5A0YB 3R5AA 1XMQF 2G1DA 3RGIA 3CJ8A 3V81A 1XC9A 2FVQA 1SJ4P 1ZZNA 3HHLD 1JKHB 2LECA 3CJSA 4DV6J 3T5LA 1RT3B 4P52A 4QW9A 3EX7B 1S7HA 5BYQA 1H2UX 4HHUA 4NLTA 2V4QA 1U1QA 2EG2A 1EZZB 4EU0A 2VG7A 1Y00A 2V69A 4IO9Q 3V6JA 1Q81T 4X4VA 4KRWA 4DPOA 1R31A 3LUYA 2CDQA 1LWEA 3LPYA 2KHDA 4I6WA 2VBXA 4ZP9A 5FD1A 4MFBB 2KG0A 1VMBA 4M5GA 5E5NA 1WF2A 4F3OA 5AE2A 1PJ5A 1D8YA 2DHGA 2I2YA 2PI5A 2NSBA 3D66A 2FPHX 3ILLA 3SCLE 4LF5J 2VU5A 5E0OA 1CQNA 2DNRA 1I94J 1QSLA 4QYRA 4CLZA 3IG1B 1VRUB 4BC9A 3CMAS 4B9MA 5A8WB 4DR1J 4Q0BB 4J9VA 5J2NA 1O8BA 3AXKA 1YRUA 3Q86A 4FNHA 1HYSA 1WELA 4ATNA 2XO6A 2C1EB 3PR5B 3RW6A 3O6QA 5F8LA 2BJ9A 3R7SB 1N32J 2Z2LA 4LRFA 2DNMA 1Q78A 1XEZA 5ETQA 1NK0A 2E7WA 5ETPA 5IWAJ 2XGQA 3Q8VA 1RWVB 1FNXH 1PJ7A 4M5NA 1CJTB 2YXLA 3C66A 3GP9A 3M1VB 5GMEA 4BBYA 3IMQJ 4QIEA 2E1MC 4WIQA 3PJ9A 5C25B 2IMOA 2W2QP 1KONA 3FEXB 3GFZA 1WOPA 4DCJB 1KLNA 2V9KA 4G1PA 4NEYA 1T03A 4F67A 2XS7A 1SB6A 1WC4A 1BE4A 2PIIA 3JXOA 3MPVA 3MCSA 3Q24A 2R7UA 4PAAA 5RUBA 4GO5X 2KFYA 3U1LA 4M5JA 4YB6A 4C6AA 5CAAA 4WTOB 2BX6A 3OV7A 2V8VA 4M63A 1OS5A 3TUPA 1ELOA 3MTJA 2C2MB 4P72A 2FB0A 1VQKS 3HHLC 2JFKA 2CJYB 5HMZA 4JI2F 5J2PB 2YKMB 2NZCA 3HSZA 1NM2A 3ENVA 1N34J 1HLWA 4C0HA 4FF4A 4I56A 1YJUA 4DR5J 4CH7A 1V9OA 2L9NA 4CLWA 2C2RA 1N33F 1NNDA 2I0XA 1REGX 2K2PA 4DUYF 1GTEA 4OYZA 4A8WA 3R2DJ 2IPOB 3CCJS 4GVBA 5B7WA 2RSQA 4KIAA 1LFWA 1RAJA 1UEVA 4I0WA 3NGDA 2JC0A 3R8YA 2HRYA 4Y2IA 1S1UA 5KAKA 2FLNA 1IKXA 1RWXB 3IBFB 4K0KJ 2AZ1A 2ZBRA 4GKJJ 1BWEA 1BQNA 2Z0GA 3D28A 3B8HA 3W60A 1VQ5S 2E1PA 3BKFA 3UD4P 5K20B 3IS9B 1EHWA 4FBUA 4FPRA 4Y6IA 3RBZA 1LFPA 2KZMA 3AOCA 2MHEA 2H5JB 3GCWP 3TX0A 3LANA 2NXEA 2ZHBA 1MMNA 2NYHA 4HHJA 3GJTB 4Y00A 3UPFA 2RQKA 2BA9A 4AD6A 3ZO7A 1PCAA 4EWTA 2VC0A 2VPZB 4UQTA 3QGHA 3QJJA 5FDLB 5A8RB 4A46A 2FLOA 2RAQA 3MURP 3U02A 1GK8A 1YSJA 2V8DA 3M2VB 4KGXB 4ANDA 2QL9B 4FN5A 4YB5A 5IM0B 2ZH2A 4A8QA 4WZMA 2ILZA 4NCGB 7AT1B 4X66F 4DF4A 2J0QD 2HNDA 4IFYA 4TQRA 1YQHA 2LQJA 1RT3A 2E5HA 2V8HA 2BJ7A 4N47A 5EDWA 2PA3A 2BE9B 3R5BA 4U95A 3OL8A 3H25A 2UVWA 4QR2A 4ZHRA 1FRIA 1RAGB 4DSFA 1EQ0A 4F26A 2HVDA 2HFOA 2XI3A 4OV6A 5HANA 5HJXA 3KK1B 4DV2F 4MFBA 2FHKA 4G65A 4M1KA 1VBYA 2XCPA 4B3RF 3NGTA 3W65A 4DV0J 5GADU 4NLUA 2ZM6F 4NLWA 1KBRA 1Q5VA 3TO8A 4KPCA 3P45B 3OR2A 3MAQA 1IJEB 1JMTA 2YTCA 4F0MA 2WSCC 1ZH5A 2GMJA 1NH7A 4CDIA 5J2QA 5EHHA 1CJVA 4DZ6A 3A3PB 5CQGA 3OJUA 4DSKA 5F3TA 1PAUB 4GO7X 2D41A 4MKVA 3HHNB 1SXLA 2VODA 1VOMA 3BPSP 2D7SA 2V9WA 3FCVA 4J7CA 3GLJA 2KT5A 4OZJA 4ENOA 3BSCA 3OSNA 4NXMJ 5H9FK 1VQ4S 1JLBB 3G6YA 2JVRA 3KJQB 1SH3A 1Y3KA 1I5OB 5F8MA 4A8MP 3NMRA 2AYMA 2X1GA 1VQ8S 3MM9A 3M2UA 4DUZF 3VTIA 3PX4A 1QAIA 1BUXA 1RTHA 1R27B 1WC1A 2GV1A 1SJRA 3DGPB 4KAIA 4ZPAA 5DO2A 3RUBL 1JLGB 1GNKA 1N0UA 2NXNA 2YNGB 3H2VE 3LW5C 2CQDA 4MJKA 4WXOA 3TEHB 1UPMB 4RBUA 5AJ3F 3FRYA 1DLOA 3CJTA 3QWUA 2DGXA 5J1EB 1REVB 2DCLA 1MROB 3QYYA 2ZBPA 4BWMA 4CM2A 2BJEA 3KNAA 1KNZA 2H4WB 2YKNA 4C0OC 2LDYA 3D4JA 1KOOA 5IC4B 2PA8D 3CD5A 1FX4A 2AW0A 2E29A 1R7IA 3PFEA 4OX6A 3QAUA 3WZ0A 1AZSB 3MMJA 1RWNB 2IVYA 3IAM9 2ABYA 1HQUA 1QAYA 1FDNA 4TY9A 4UZCA 5ETMA 4RO0A 3RW7A 1PYSB 2BJ8A 2B56A 2ZE2A 2V68A 4F4ZA 3VCDA 5HLFB 4KSEB 4OYAA 2GMLA 3AD9C 1U02A 1ZBTA 2KRRA 3W9HA 3TARA 2F7VA 3TNVA 5IM0A 4DFJA 4NLQA 3JTPA 5ETVA 1KVJA 3PFOA 1S6PB 3KG0A 2ACYA 2HG4A 1Z2LA 2CJ9A 1D09B 4F7VA 3OLBA 1FXRA 4DU8A 2A10A 1YDLA 2ZHAA 4DV2J 3DRXA 2HGMA 4OZLA 2A1BA 2DNHA 2PD1A 2RUSA 1IR2A 4ER8A 4WK3A 4C3KA 2CRLA 3AJ2A 3EM1A 4DPWA 4ED7A 1S79A 2DXEA 1DTQB 3IN5A 3MPUB 2JSXA 2W8KA 4B3SF 4JI8F 2V0NA 3HSGA 1RB0A 1RHKB 2Z2YB 3S6EA 3BBBA 2RJZA 3UD3P 1IWAA 3FQKA 3HT0A 4KJIA 3VV2B 2DIVA 3DCAA 3R5DA 4HVZA 3U1NA 2MZJA 2UP1A 1HD0A 2GAHC 3FSXA 1N5QA 1U7LA 2Z8QA 1NSKL 1QTNB 2RQ4A 1RWKB 3E51A 3FCWA 3KDOA 1RBAA 4CP5A 5A2QU 5KG4A 4IOBA 2H1YA 2IYGA 1ULRA 2LA4A 4TQSA 3GG0A 2NS1B 1NKBA 5CHCB 1HI8A 2EW9A 4O0NA 4RW6A 5HQ8A 3BH7B 1S1WA 1XNQJ 3A8EA 2CG8A 2MQQA 3CEDA 2KN4A 3D6MB 4OI1A 5GAHU 1VQ7S 5KFEA 4AXIA 3JS9A 3D1QA 3UVJB 3RRGA 2WB1D 2QO3A 3J7Z5 2R42A 3TQEA 3JYTA 1TKTA 3KHGA 2FY1A 1JLFA 4N8OA 3IBWA 3SQGA 1D3WA 1HWLA 3N9UC 1FO1A 3TWZA 5DDPC 5GAEU 4WCEQ 4YOEA 1RISA 4X4NA 2VJUA 4DSIA 3CO9A 4J9KA 3MUVP 4ZLJA 2AJ2A 1TL7B 4NA3A 1PO6A 3QJPA 4IH6A 3ZZPA 1PBAA 1U47A 4C3LA 5FIIA 5A8RA 3CTRA 2XI2A 5AT1B 3H42A 1Y9OA 3KWMA 2BM0A 3QMQA 2IYIA 1YI2S 4IH5A 2IM0A 3H8YA 1M5OC 2M2BA 3OL9A 1LWCB 5ETTA 1N34F 4J9MA 3M8PA 3BV8A 3M4XA 3OFGA 2PMZD 2RKIA 3ZTQA 4OI3A 5LT5A 3D3CJ 3A8KA 5EWGA 2NREA 2VL1A 3BYPA 3MR7A 2ZJPQ 4FS1A 2UVVA 2B5JB 1F9EB 4LT6A 4Q0BA 2HQDA 4LVNP 2XWXA 2VG5B 2ZH7A 1HYSB 4H4KC 4RUHA 1FXDA 2DGOA 2V67A 4B08A 3N6NA 2HHQA 2XWYA 3MM7A 2CQ0A 4ZJOA 1OY6A 3CJKA 2FGCA 3CJ5A 3TAMB 4IR1A 1XMBA 1A9NB 2ZH9A 3E2EA 3MEGB 1WTFA 2XHWA 1R0CB 5HQMA 4K50A 2FVCA 4PKDB 4YR3A 4USMA 2AJQA 2KU7A 2V2ZA 3DRSB 3RR7A 2XYPB 1PC5A 2MKIA 3W66A 1N32F 2DEJA 2YWHA 4ZLNA 4WWSA 4IR9A 2UXBJ 1S57A 2V2KA 2LCWA 1CS4A 2E5IA 3G2XA 3O8WA 5B0FA 3KLFA 3LALA 3RR8A 4Q8EA 2D9OA 2ZKTA 3VAGA 3A1YG 4OIXA 1L3KA 1GXUA 1IBMF 3PW5A 4ELTA 2WHOA 1X60A 3DGVA 1F5CA 4A47A 4DX5A 4OHXA 4ZN1A 5CABA 4WZQA 4IDKB 3GJRB 5AXKA 4N8NA 4OYIA 3QRPA 1VQOS 4I4BA 1VR6A 2AKWB 3G86A 2HVEA 5E3CA 5K8NA 1QVGR 4LFCJ 3BZQA 2GC8A 2XTJP 1S1VA 2GVDB 4RWXA 2C3MA 1NK7A 4DHVA 2B8PA 3CJ3A 4WYLA 4F4AA 4QPXA 2GCFA 2XY7A 2CNOB 2GO8A 1OPIA 4ZA1A 1W25A 2V2VA 1J2VA 4DV6F 4OX9J 2B6AB 5HMYA 4JV2A 3T1HJ 5DG7A 2G9OA 2QLWA 3UVJA 3R5GA 2BW7A 3NGUA 4A8SA 1SC3B 1Q8IA 4Y3CA 2NCKL 1N5SA 4DR3F 1S9FA 2IMWP 4O44A 4LF4F 1RBLA 2C2KB 5ADZA 1NK4A 3MDFA 3N6LA 4ZS6A 2MZ1A 4M8LA 2OFGX 2HHHJ 2OH2A 2X1FA 5C2CA 2GGPB 3W9JA 1TKXB 3LA0A 2WONB 2KJWA 3POTB 5D0GA 2BZ2A 4LF6F 4A8FA 3NCQA 4GC7A 1G1XA 3IP0A 4OZ5A 4F0HA 2HIYA 4UUWA 4R5PA 3K5OA 5KFPA 4Z7CA 1YITS 2NYIA 3NL0A 3D0HE 3P96A 1HQEB 1GQEA 1PYOB 1KFDA 2W9CA 4HL9A 5K9FA 5K14A 1QD1A 1WHWA 2X3DA 2XMKA 1DRZA 3DHWC 3IRXB 5KT6A 2XLIA 3KYLA 2FJXA 1FJGJ 1CJKA 4C9DA 3D6FB 4Q43A 1RA7A 2DR7A 2L08A 4USVA 3H20A 1H38A 2FYXA 5IC6B 3R2CJ 2XMJA 3A8JA 1OQ3A 3M05A 1JQGA 3NAIA 5G4DA 2YX7A 3JQJA 7FD1A 5LJ5Y 1J5EJ 4TYBA 1BQMB 3DM2B 1YJRA 3F0NA 3SBMA 3U1MA 1QE1A 2MXYA 2VDHA 1LWCA 1T3NA 3UDEA 3I31A 5HAOA 2OPSA 2UUCJ 2HWIA 4NXNJ 2XLKA 2PFFB 3KLIA 2OPRA 3BKUA 2LEAA 1C2PA 1Y10A 2CZ4A 1UJ4A 2M8DB 2DY9A 3IG1A 1QSYA 4WU2A 3PX6A 3PW4A 3OBIA 3D68A 4NCBA 3MM6A 4PR6A 4ZP6A 4E2FB 3UFCX 3M8QB 5JJBA 4H4MB 3RBXA 8RUCA 2EK1A 1IBLJ 1R6YA 3IO1A 2PFDA 1HD1A 3KUHA 2HZVA 2GQ2A 3DMJB 1TL4A 4L76A 4DV1J 1L3UA 2M8HA 4YY3F 3JSMA 1CJTA 3M1VA 4PYAA 4K4XA 2XZTB 2HQGA 3PIPQ 3DOLA 5DJBA 3THPA 2KM8B 1RAAB 2HHSA 3F73A 1HBMB 2W7PA 2D3OR 2Q6CA 4W98A 1SKRA 1IBKF 4LQ9A 1RTHB 1HI0P 1URNA 2XMTA 4BWJA 4BC7A 1F3VA 4OJGA 4X64F 2B51A 3ULHA 3LGMA 4YS2A 4DQQA 3NNHA 4PQUA 3EJMA 3HHKA 2HLTA 2RF2B 4Y2MA 3CDUA 2Z57B 3IM9A 4LFAJ 3KLFB 4WFXA 3KLEB 2HBYB 4FDFA 3K5NA 1NK8A 2NLWA 2ATLA 1MWYA 2B9WA 5MLCV 4IRCA 2FJVA 3D0GE 2OEKA 3NCRA 3NLCA 2L3MA 4U67Q 1WC5A 2HQFA 5L1LA 4DSEA 1TK5A 3FFIB 3W1YC 2VA3A 3PY8A 4W90B 3CDEA 1TELA 1GXTA 3GIJA 2FHJD 3HZEA 5DGBA 4DFMA 4Y0FA 3TI0A 4IFVB 1MW7A 2QV6A 4JI7F 2FC8A 2B4UA 3EGVA 1S1VB 2GVDA 3PYEA 2FZCB 5J2MB 2AYGA 4F36A 1JLEA 1ZYQA 4DN0A 4EK2A 3CJ4A 1FDBA 1UKUA 2MQNA 1U1OA 3ISZA 1M5SA 2BJ3A 3V6DA 2DRDA 4V19J 4AQYF 4NLGA 2R8HA 5D4LA 1N8RT 1IKVB 4OZNA 5HBMB 3EMTA 4K4SA 4DQSA 3AA8A 1F9FA 4Y28C 2ZH6A 4DS5A 1RI7A 3IS9A 3K58A 4XPCA 4ZMMA 1NZAA 3B54A 1P9QC 2Z58B 3I0SB 3I9ZA 2AJ0A 4FXWA 2RB7A 1NEEA 2XMWA 4HACA 2GIFA 4DR4J 4PXDA 1RACB 2ATCB 5IV4A 4ZCMA 1HMVA 2SXLA 3I4HX 4H54A 3J7YU 4O3NA 4R25A 3MOJB 1WC6A 3N0VA 4B3MF 3LAMA 4USIA 4C11A 2RQMA 5K8PA 3TAPA 2ZDOA 1C1CA 3Q89A 3RBEA 1VC5A 3NRBA 1PBUA 2G2OA 3FGVA 4OI4A 4XTTA 3PKYA 1KD1T 1DBDA 3EZUA 2HFUA 3L4BC 5I42B 1S72S 4O3PA 3UNYA 1TVRB 3DHXA 1S5ZA 1LOUA 3IR6B 3L7UA 5D4PA 3SCKE 5A6PA 1VC6A 1XR5A 2MZQA 4IFYB 3T19A 4M5DA 4RL1A 3RYLA 3UI3A 4ED4A 4XO0A 5JVGQ 1CJKB 4RNOA 3FNNA 1UWAA 3J7AN 4FF1A 2YY3A 4ZPVR 3U7JA 5LMUJ 2QA2A 3K5MA 4ED8A 2HVIA 4LVOP 5CYJA 1H7XA 3SYZA 2CPZA 4U96A 2BKOA 3MMBB 4ANCA 4ZPDA 5DG9A 1OIAA 1LK5A 2PT0A 3BO3A 3C14B 4LQ3A 3JQKA 5IS2A 5D0EA 2R7QA 4PWDA 2CQPA 4LSLA 5C5JA 3C2PA 1X9WA 1WNEA 1LXNA 3M30A 3M8PB 1M5HA 2E5GA 3DN9A 3MPDA 4OLOA 3AD7C 1YIJS 1GMVA 2RILA 4X4PA 4HEA9 3MMAB 3CIMA 1ZOTA 2UXBF 1DY3A 3FCHA 3CC2S 2MLZA 3BREA 4OHVA 3OTCA 2Z2ZA 2ILYA 5DLGA 3H4DA 1DHMA 3L95X 4C8YA 3QT5A 5FJ4A 1SI9A 1X7VA 1HHSA 3I87A 2GJIA 3PYFA 4F04B 5AXNA 2XGPA 3DC2A 3EGWB 5E3QA 5G0RB 2XNRA 4OQJA 4KHPJ 5F9NA 5IOLA 3H90A 2K7KA 4LFBJ 3QIPA 3PKMA 2OIHA 2UXDJ 1JLAA 3FBCA 5E3AA 1AUDA 2GX8A 1X9MA 5L9XA 4I64A 2HK2A 1ZAWA 3EYZA 2VH7A 1U0SA 1ZTWA 2B5JA 2DT9A 5KT5A 2DNZA 3I56S 2MKHA 2YNFB 4YUDA 2KT3A 3MAHA 4ZKAA 2CVEA 1S4FA 4I2PA 1NO8A 2VPYB 5HQLA 4RW7A 1VS3A 2OLWA 2AWZA 2RE1A 3CMQA 3MF5A 3IXQA 4HTIA 4HTJA 5CXTA 2HZAA 1V5IB 4PYDA 1Q8KA 2HS4A 4R8UA 3KFWX 2FVPA 1FE0A 1M1HA 1EJ7L 2X1AA 3OXLA 1LEOA 1WWHA 4UOCA 3CCES 3RB3A 2DH9A 2H65B 3ILOA 3MEGA 4K5SA 2YWGA 1YBUA 4WXWA 5D0RA 3PW0A 4DEZA 5I3UB 2DNGA 2MPUA 1IVZA 5HVFA 5J2NB 3FSIA 3MUTP 3MCNA 4ZCKA 5B0EA 1VFJA 1KDNA 2XMVA 2FGOA 2C28A 1MN7A 2IM2A 2JH3A 3AA9A 3ETMA 3KOAA 4RKUC 3ONQA 5J2QB 1HI1A 1TMJA 2MQMA 1B99A 2POKA 3B6BA 4NASA 4ES1A 3PO5A 2NQPA 3GONA 3NGRA 2O67A 4F0KA 1WSVA 2B9EA 1RHUB 2ASDA 2FD2A 3JSRA 2LXIA 2HNYB 2OAUA 4CI0B 1CPZA 1OSDA 1NLKL 3KG4A 1Q79A 2DRAA 2LQ9A 2EFOA 5HROB 1XR7A 1C4CA 2ROEA 3VF0B 2R7SA 2Z30B 5A2QY 4RX6A 3TA2A 1JJ2R 1VRQC 1GTHA 5BXIA 2QE5A 1WEZA 4A8KA 4MT1A 3AQOA 4ILRA 4XIUA 2FJAB 2E7VA 1G6BA 1IXKA 3SCIE 2ZE2B 3BQ1A 1KR4A 1HNVB 3OHAA 3JTOA 4PXEA 5J1NA 3QPIA 2Q66A 4P2FA 3EPIA 1VIOA 1REVA 4ZP8A 3SEOA 2WVBA 3MAAA 4OHWA 4RNFA 5IQ6A 1F5BA 1ZA1B 3J7A1 1U48A 2R7XA 1TL3A 4ZCLA 3IGVA 2I38A 3P5TL 3R9LA 3V5RA 1JIHA 1JJHA 1XN9A 4Y65A 4X4SA 2W9CB 5B0BA 2AGQA 2B3TB 3MR3A 3LF0A 2CQIA 2OD6A 4ZDNA 4MKAA 1TL5A 3PVXA 4AL6A 2XMMA 4DR2J 1X0FA 2RRNA 2NXJA 4DI6A 1SJ1A 2A2DA 4C7QA 2CKWA 2DNNA 2V34A 1VBKA 3POTA 2GNKA 2JJ4D 3M2VA 3SFUA 2DJWA 4KGVB 3ZZRA 2CJXB 1K44A 3K5PA 3C14A 2KXFA 4KHRA 3UE2A 3TUZC 4YHHJ 4KY3A 2W9AA 4ED6A 1YHQS 3GYGA 5L1JA 4M5KA 3MFHA 3W64A 2BBEA 1YK9A 1AW0A 2JEIA 1RTIB
chains in the Genus database with same CATH topology
3BBCA 3JS9A 2CWKA 3DKDA 2DXFA 1BHNA 2HURA 3EE3A 3VGSA 3MPDA 1PKUA 3EVWA 3VGTA 2HVDA 1UCNA 1ZS6A 3DDIA 1PAEX 3NGTA 3GPAA 3ENAA 4KPCA 2DY9A 1HIYA 2DYAA 5IOLA 1NDPA 3Q8YA 1NPKA 1WKKA 3ZTQA 4ANEA 4DZ6A 3FBCA 2VU5A 5C7PA 3VVTA 3FBEA 3FCVA 4FKYA 4ENOA 3Q86A 4UOFA 4UOGA 1NB2A 1XQIA 1NCLA 3Q8VA 3ZTSA 1XIQA 4W98A 2AZ3A 3GP9A 1BUXA 1LEOA 3PJ9A 3FC9A 4ANCA 1S59A 1W7WA 3EJMA 4WBFA 1NSPA 1BE4A 1KDNA 2B8QA 1MN7A 3ZTPA 3ETMA 4FKXA 4UOHA 3Q8UA 1NDLA 4DUTA 3B6BA 1B99A 1S57A 3VVUA 1NDKA 3G2XA 3EVOA 3NGRA 1WKLA 4C6AA 5CAAA 2BX6A 1U8WA 1F6TA 1HHQA 3WX8A 5CABA 1NLKL 4F36A 3ZTRA 4EK2A 1HLWA 2HVEA 3PRVA 1NDCA 5BXIA 3VGVA 1VYAA 3EMTA 3ZTOA 2B8PA 4F4AA 3BBFA 3FKBA 3B54A 3Q83A 2AZ1A 3NGSA 3NGUA 3R9LA 3EM1A 1EHWA 2NCKL 2DXEA 1WKJA 3VGUA 1LWXA 3EVMA 1NSQA 1F3FA 3Q89A 3BBBA 1JXVA 3ELHA 3FBFA 1NUEA 3L7UA 1S5ZA 1B4SA 4HR2A 4DI6A 3FCWA 1NSKL 1MN9A 4CP5A 1K44A 2DXDA 1NHKL 4ANDA 4S0MA 3FBBA 4O0NA 3EICA 3BH7B 2ZUAA 3BH6B 2BEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BBC A;  3JS9 A;  2CWK A;  3DKD A;  2DXF A;  1BHN A;  2HUR A;  3EE3 A;  3VGS A;  3MPD A;  1PKU A;  3EVW A;  3VGT A;  2HVD A;  1UCN A;  1ZS6 A;  3DDI A;  1PAE X;  3NGT A;  3GPA A;  3ENA A;  4KPC A;  2DY9 A;  1HIY A;  2DYA A;  5IOL A;  1NDP A;  3Q8Y A;  1NPK A;  1WKK A;  3ZTQ A;  4ANE A;  4DZ6 A;  3FBC A;  2VU5 A;  5C7P A;  3VVT A;  3FBE A;  3FCV A;  4FKY A;  4ENO A;  3Q86 A;  4UOF A;  4UOG A;  1NB2 A;  1XQI A;  1NCL A;  3Q8V A;  3ZTS A;  1XIQ A;  4W98 A;  2AZ3 A;  3GP9 A;  1BUX A;  1LEO A;  3PJ9 A;  3FC9 A;  4ANC A;  1S59 A;  1W7W A;  3EJM A;  4WBF A;  1NSP A;  1BE4 A;  1KDN A;  2B8Q A;  1MN7 A;  3ZTP A;  3ETM A;  4FKX A;  4UOH A;  3Q8U A;  1NDL A;  4DUT A;  3B6B A;  1B99 A;  1S57 A;  3VVU A;  1NDK A;  3G2X A;  3EVO A;  3NGR A;  1WKL A;  4C6A A;  5CAA A;  2BX6 A;  1U8W A;  1F6T A;  1HHQ A;  3WX8 A;  5CAB A;  1NLK L;  4F36 A;  3ZTR A;  4EK2 A;  1HLW A;  2HVE A;  3PRV A;  1NDC A;  5BXI A;  3VGV A;  1VYA A;  3EMT A;  3ZTO A;  2B8P A;  4F4A A;  3BBF A;  3FKB A;  3B54 A;  3Q83 A;  2AZ1 A;  3NGS A;  3NGU A;  3R9L A;  3EM1 A;  1EHW A;  2NCK L;  2DXE A;  1WKJ A;  3VGU A;  1LWX A;  3EVM A;  1NSQ A;  1F3F A;  3Q89 A;  3BBB A;  1JXV A;  3ELH A;  3FBF A;  1NUE A;  3L7U A;  1S5Z A;  1B4S A;  4HR2 A;  4DI6 A;  3FCW A;  1NSK L;  1MN9 A;  4CP5 A;  1K44 A;  2DXD A;  1NHK L;  4AND A;  4S0M A;  3FBB A;  4O0N A;  3EIC A;  3BH7 B;  2ZUA A;  3BH6 B;  2BEF A; 
#chains in the Genus database with same CATH topology
 4ECR A;  1F1B B;  1X0P A;  3OVS A;  5HL7 Q;  4RNN A;  2FVR A;  5D3G A;  3VGS A;  3QRQ A;  4FYD A;  2X3G A;  5FDL A;  2KVQ E;  1CBK A;  2VFV A;  3OL7 A;  4LBI A;  5IFM A;  3MWB A;  4URG A;  4ERD A;  4DJB A;  5KFG A;  4AL7 A;  1E6Y A;  5AJ3 J;  4P7T A;  2VFU A;  3DRR A;  3CT9 A;  4CLL A;  1PAE X;  4AYB D;  4ZVH A;  3HVR A;  4P75 A;  2OPS B;  3NP5 A;  2MKK A;  1XNR F;  1SUQ B;  2VV5 A;  1E6V A;  2ZBQ A;  2N82 B;  3KLH A;  4JI3 J;  5DS7 A;  4L75 A;  5DM6 Q;  1YKW A;  5JXS A;  3N28 A;  5LL6 d;  2QL5 B;  3CD7 A;  3M8Q A;  5D3G B;  3PHE A;  5IT9 Y;  4ECS A;  1EKS A;  1VK8 A;  1Z2Z A;  4QOT A;  1TK8 A;  4QCL A;  2RVJ A;  1TL1 B;  3M8Z A;  1WF0 A;  1IM4 A;  2GVZ A;  4IQM A;  3RBD A;  5B0A A;  3KLE A;  4A48 A;  1R0B G;  4DV3 F;  5CCL A;  1AA1 B;  2OHD A;  5E3P A;  5BYS A;  3BSA A;  2A18 A;  1U1R A;  1RHJ B;  1HBM A;  1TK0 A;  2RS8 A;  4MTP A;  1NCL A;  1WC3 A;  1X31 C;  3OT9 A;  2VF3 A;  4NZ7 A;  4OI2 A;  3ZTS A;  3SDE B;  2KTQ A;  2RDJ A;  3DGP A;  4KGM A;  4FZV A;  4DPX A;  1ZM9 A;  3R7B B;  5LMN J;  3DLG A;  4B9N A;  1QAX A;  2AU0 A;  4GRS A;  2ZNY A;  3M32 B;  4DX8 H;  1RCX B;  1T11 A;  3A13 A;  4NYP A;  3RAM A;  1W2B R;  1NSP A;  4F3M A;  3MMC A;  5J1E A;  4ZIW A;  3D2W A;  2OSR A;  3QID A;  1JLB A;  1XTZ A;  2DH7 A;  3GV5 B;  1KQS R;  1X4H A;  2NPI A;  1G3O A;  3E3X A;  1RAD B;  3GIL A;  1UP1 A;  2CQ2 A;  2DB1 A;  4DZD A;  2CYY A;  4OHY A;  3H59 A;  3HSD A;  3NBP A;  1N36 F;  1U8W A;  1KOH A;  2QC3 A;  1Q95 G;  2J6U A;  3VAF A;  2ZC3 A;  4JB8 B;  3HMJ G;  5HK4 A;  5HN0 A;  2VC1 A;  5D0H A;  3ZTR A;  4Y2C A;  1FCA A;  1Y3J A;  3W7B A;  2KI2 A;  2ZVI A;  4QYZ K;  2R3V A;  2VKZ G;  4K4U A;  2DO0 A;  2CUY A;  1OQ6 A;  3RZA A;  4DR7 F;  2Y0S D;  4ECY A;  5HBM A;  3UR3 C;  2H5I B;  2CDR B;  3CVK A;  3D6H B;  1FNM A;  2CPE A;  3FKB A;  2K7J A;  3HX9 A;  2BAN B;  4B02 A;  5I4M A;  2RQC A;  3HFZ B;  2C3Y A;  1OSC A;  3AQP A;  3O44 A;  4USJ C;  4OX9 F;  2CJK A;  2IJN A;  1AFI A;  2Y1L B;  1DQA A;  4R0J A;  3TYT A;  1UVL A;  4NEZ A;  4FXV A;  1H73 A;  5M2P A;  2EKY A;  5LMN F;  2YX1 A;  3FEZ A;  3RAX A;  4DF8 A;  2WON A;  2P6T A;  4DL5 A;  1NSQ A;  2Z4P A;  2FJW A;  1VJW A;  2V5H G;  2KM8 C;  1F3F A;  4ZPC A;  1HBU B;  4MYT A;  4K0K F;  4CRJ A;  3ELH A;  3CJ0 A;  4I6Y A;  1N52 B;  1FF2 A;  1NUE A;  2MB0 B;  1RT1 A;  2MLX A;  5AE3 A;  3X3U A;  3A4T A;  2D69 A;  1RT2 B;  2CZV C;  3PEJ A;  2HS3 A;  1KRP A;  8ATC B;  2J6T A;  4YB7 A;  4DUY J;  2AEF A;  2AV5 A;  2BJ1 A;  2E9T A;  2WOM B;  4F02 A;  1SIZ A;  1S97 A;  4LR9 A;  1JLC B;  3MGJ A;  1JK9 B;  3UO0 A;  3HHL A;  2DD8 S;  2UVR A;  3QO9 B;  3N5B A;  1FWP A;  1HAR A;  2QLX A;  2AYE A;  3BH6 B;  3M2R B;  4I2Q A;  5DQI A;  3BBC A;  3TJA A;  1KP6 A;  1YZ6 A;  5G0R A;  3OSP A;  4DL6 A;  5C42 A;  2H48 B;  4M94 A;  1S12 A;  3G6X A;  3KHR A;  2K3K A;  1NH8 A;  1HNZ F;  4WYW A;  1AT1 B;  2QIF A;  4YME A;  4KV8 B;  4Q7A A;  4RU2 A;  3MMA A;  4DX6 A;  3NGK A;  4JI4 J;  2PMW A;  4OYO A;  4U6P A;  1A6L A;  2RHS B;  2U2F A;  1RA6 A;  5GAH I;  2FZG B;  2QYC A;  4QIV A;  4CCH A;  1HW9 A;  2ZUG A;  3O3L A;  4UTG A;  1BQM A;  2G0J A;  3CW2 C;  3DM2 A;  1UL3 A;  2GO9 A;  3H5X A;  1JLA B;  3DRY A;  2R2T A;  5IXU A;  5KG6 A;  2FIU A;  2FZK B;  4KYZ A;  4YQW A;  2IBO A;  2WVD A;  3VVT A;  1IR0 A;  1T9V A;  2DH8 A;  1V3R A;  3V4I A;  3I82 A;  4I2P B;  1FT8 A;  2B4V A;  4X62 F;  3SDE A;  2HHU A;  2HGL A;  2OMO A;  2YNF A;  2MQO A;  2ZD1 B;  2HNZ B;  4IKA A;  4QIG A;  1VLO A;  3SMZ A;  5GAG I;  3LH2 S;  3OUY B;  4LF5 F;  2F4V F;  1S1T B;  3KLG B;  1FKP B;  3D1O A;  3CCM S;  1RZM A;  1H3D A;  4DLE A;  1UA1 A;  1WC0 A;  2I5J B;  4KHP F;  1V3Z A;  5KG3 A;  1SC6 A;  4CLK A;  2BM1 A;  4KH0 B;  1C1B A;  1K1S A;  1SV5 B;  5CYM A;  2BXJ A;  3NMA A;  1Q8B A;  1VRT A;  2D3U A;  2QL7 B;  1UW9 A;  2YWE A;  3VQT A;  1HKA A;  2VBY A;  3RRK A;  3FZ2 A;  3IWL A;  3MM8 A;  4L3K A;  5A8K A;  4ZJL A;  4Q5V A;  3ZTP A;  1JJ4 A;  3M9N B;  3KNG A;  4FKX A;  1C4A A;  3BGR A;  3Q8U A;  2JOQ A;  4UOH A;  3LWM A;  1SL1 A;  4DR6 F;  1NDK A;  2RF2 A;  2ALY B;  1RT4 B;  1TZ0 A;  4WE1 A;  3TW0 A;  3ZFV A;  2PI4 A;  3ZNJ 1;  3CDB A;  4ILM A;  3Q8P B;  1FEH A;  1R6V A;  2KKH A;  4OV1 A;  5D4O A;  2XSJ A;  1UTA A;  2VBW A;  4ETZ A;  4AQY J;  2XY5 A;  5HRO A;  4WPA A;  1R8B A;  4CIO A;  2WB4 A;  2R2U A;  3I4P A;  2QMX A;  2R7O A;  2DHH A;  1S9E B;  4LF8 F;  3DOL B;  2YKO A;  4USK A;  5LMU F;  3ZC4 A;  2HMI B;  3L3C A;  1S6Q B;  2XY6 A;  1S77 D;  4FXD A;  2CVI A;  4WFY A;  3PZP A;  3NS7 B;  1RUS A;  4GKK J;  1VC0 A;  3KXD A;  4RNH A;  4K8R A;  3MM5 B;  2DHS A;  3W8P A;  2DPJ A;  2AJ1 A;  5DET A;  2PO4 A;  2M9K A;  3NWR A;  4NLS A;  3V6D B;  1QTM A;  4PG6 A;  1D0E A;  3GR1 A;  2QRR A;  2VIH A;  6FDR A;  1YX2 A;  1AUS L;  1P9Y A;  1GFW B;  4IDK A;  2JWN A;  3PDN A;  1S4E A;  2RS2 A;  3G71 S;  4X64 J;  1VQY A;  3GII A;  2UXC J;  1K1Q A;  2V50 A;  1RT2 A;  4TXS A;  3UCG A;  4CT9 A;  4DX7 A;  1SJF A;  4RJV A;  4HAC B;  2VON A;  1HPZ B;  5HI7 A;  3GFX A;  2LQB A;  4RW9 A;  2XB2 D;  2IRY A;  2XUL A;  1HBO A;  2OUG A;  3K59 A;  1P1L A;  4IG3 B;  4NLY A;  1LWE B;  1N5T A;  2LVW A;  4MYU A;  2C2D A;  2A3J A;  3OTD A;  2C3O A;  2CG4 A;  2OI2 A;  2ZNZ A;  1NU4 A;  2QFI A;  2BW2 A;  2W4D A;  2LMI A;  2GW8 A;  3I5C A;  3WC2 A;  4DCP B;  4O3O A;  2J9C A;  3LAK A;  2QLF B;  3DLJ A;  2DO4 A;  4PG5 A;  4U9R A;  1T3O A;  2MQL A;  2Y8W A;  3OR2 B;  1K0T A;  3BS9 A;  1T9T A;  3CSK A;  4ZVU B;  2HWT A;  3CCR S;  2UUB J;  2ZOM A;  1BHN A;  3ISN C;  4BDP A;  4MK8 A;  5EGY A;  3RRH A;  2KB2 A;  5K8M A;  3L7O A;  1PKU A;  3CCZ A;  1EQM A;  1IKY B;  2V6A A;  1B7Y B;  1Y5I B;  2EC2 A;  2EFN A;  1PIL A;  3OVB A;  4X4O A;  2WRM A;  4JV0 A;  3OFH A;  3BM7 A;  1YBT A;  1Q1K A;  3PHT A;  1NK5 A;  1TKD A;  3R7N B;  1RT6 A;  5DRK A;  1X5S A;  3EZ5 A;  2IM3 A;  4FYV B;  2QX0 A;  3BDP A;  4PUO A;  1O6X A;  1U8S A;  5KFR A;  4JI1 F;  3SXL A;  1RT5 B;  1YBA A;  3VWS A;  4C8K A;  1U2F A;  3ILJ A;  4QZV B;  3HUL A;  3IFE A;  4H4M A;  2R8I A;  2V8P A;  5KOX A;  2ZD1 A;  3ZZ0 A;  3GZ7 A;  4LF7 J;  1MWQ A;  2PEH A;  3WX4 A;  1X9S A;  3FBE A;  4CLF A;  2IRX A;  2QGF B;  3DFE A;  2XSJ B;  5D77 A;  2HBZ B;  1NHV A;  3LP2 A;  5C2G A;  3K5L A;  4LF6 J;  3LP1 A;  3WQP A;  4TU9 A;  4NOH A;  5C25 A;  5ETK A;  5K5M A;  5KFS A;  4DL7 A;  4H4O A;  2OJ3 A;  2H9Z A;  1TUV A;  3GV8 B;  2WCX A;  5I3U A;  3D54 A;  1T0T V;  1WI6 A;  1RWO B;  3LGN A;  1C0U A;  2YQ3 A;  2BVZ A;  2G2Z A;  1KFS A;  1CJU A;  2M52 A;  1LW0 B;  3C6U B;  4JI6 F;  3O1L A;  2IDL A;  1RT4 A;  3GFH A;  1IBC B;  4ZVO B;  1U2R A;  3TJ8 A;  4EZ6 A;  2DK2 A;  1V6H A;  4R8U B;  2LDI A;  3K17 A;  2G0C A;  2QA4 G;  2DR8 A;  1M5K C;  2JC1 A;  4Y2K A;  1VJQ A;  1D8Z A;  5L9N A;  2BQR A;  1C0T A;  2HEK A;  3MPY A;  4OYB A;  2UUT A;  3W63 A;  2YKM A;  1RAO A;  2DNL A;  1XMO J;  1S6P A;  4UST A;  3OLA A;  4RNM A;  3D67 A;  1L3T A;  4DFP A;  2JLE A;  4WU3 A;  2HVZ A;  1I1G A;  1JLE B;  3L9Z A;  2W2P P;  3QJL A;  1T9W A;  1FK9 A;  2QYG A;  3QFH A;  2FJE B;  3L09 A;  3K89 A;  4DBQ A;  2P5V A;  2E66 A;  3MEC B;  1FTR A;  2FQQ B;  1BXN A;  2DNQ A;  3MPW A;  4NMX A;  1NDC A;  1S9G A;  4OZ3 A;  4DG1 B;  1RTD A;  3SFG A;  4JI7 J;  2CQH A;  1UFW A;  2JNJ A;  3WIU A;  3RU0 A;  1XMO F;  1R8P A;  3IAS 9;  3AHP A;  2WVE A;  2BE2 A;  5HMW A;  3I32 A;  1QDU B;  2J8S A;  1RXO B;  4CT8 A;  3P6Y C;  5IT9 U;  2HND B;  2HHH F;  5E41 A;  4YP3 A;  1B0P A;  3K8W A;  3WC0 A;  1U45 A;  5IQQ A;  4B3T F;  4EBE A;  4DV7 J;  2BKN A;  3THT A;  2ZIT A;  1YRX A;  1CVJ A;  2WK4 A;  1SL0 A;  1WKJ A;  4NWB A;  5ETO A;  4D3H A;  3TA0 A;  1WI8 A;  4LR8 A;  1HNX F;  2MKY A;  4KBI A;  4OZ0 A;  1IBK J;  4CNZ A;  4MIW A;  3FDS A;  5SUH A;  2MQP A;  1JXV A;  3GJQ B;  4U7C A;  2F4V J;  3LOU A;  1KKH A;  3FJ2 A;  3JYT B;  3KHH A;  4O3R A;  4B3O B;  3PJX A;  1F60 B;  1O5J A;  2OEM A;  3CWJ A;  3E01 A;  1S6U A;  3U27 A;  4YY3 J;  5KFJ A;  3BO4 A;  1UJ5 A;  4NLD A;  1N88 A;  2DNK A;  3CUL A;  1Y5N B;  4E98 A;  1HNV A;  3HHL B;  2ZH5 A;  4CLU A;  2EBG A;  2Y1I A;  2O3D A;  3VAL A;  4LSZ B;  4L73 A;  1C1C B;  1PJ6 A;  3T5J A;  2E44 A;  3KK1 A;  4KFB A;  3QRR A;  4MAK A;  1SBR A;  3DKD A;  1IBM J;  4BLG A;  4F4K A;  2HUR A;  1H7W A;  2JZ5 A;  1M5V C;  3DLK B;  1YG0 A;  1WOO A;  2W7A A;  3TR5 A;  4A8O A;  2XLJ A;  5KT3 A;  1NJY A;  4NX9 A;  4PG4 A;  4F3Q A;  1HNX J;  1HHT P;  3IM8 A;  2Y9H A;  2AJ4 A;  3CJ2 A;  4DOZ A;  1IWG A;  3DRP A;  4RWW A;  4L74 A;  3T9Z A;  2B9Y A;  3GE9 A;  5HMX A;  1WAC A;  1XK8 A;  3CCS S;  1HNI B;  2GAG C;  1OY8 A;  4KKO B;  2UUB F;  2N4C A;  2YNI A;  1GAO A;  5D6G A;  1FJG F;  5DM7 Q;  2VFR A;  2J0W A;  1DLO B;  3DRR B;  5L8R C;  2WW4 A;  1N6Q B;  1TMM A;  1KS2 A;  3OFF A;  6AT1 B;  3CC4 S;  3OQ2 A;  4RBV A;  4B17 A;  2GHW A;  4M95 A;  4NI2 A;  5D4N A;  3BN7 A;  5DDO C;  4EYI B;  2EFG A;  1WG4 A;  2LXU A;  4N41 A;  4P2M A;  5KFL A;  4DQI A;  1PSD A;  4LIW A;  1Z1Z A;  5DLF A;  1RKJ A;  4JV1 A;  3G8S A;  2VOO A;  5DQG A;  4ZPT R;  2GVZ B;  2GIQ A;  2WVC A;  2O66 A;  2Z2M A;  1JJC B;  2YH0 A;  4Z2X A;  4JI8 J;  1ZM3 A;  4LF4 J;  1SV5 A;  3EXY A;  3QIP B;  5CYM B;  5DQH A;  3AXM A;  5T7L A;  2QA4 S;  5H9E K;  1VRT B;  3H5U A;  1BGX T;  5D8H B;  4QWB A;  1Y0H A;  4F2S A;  3JAM Y;  4JYA F;  3GIR A;  4WFA Q;  2YKQ A;  2QMW A;  1UW4 A;  4WBF A;  5KFN A;  4EEY A;  4J91 A;  2DGW A;  1QAJ A;  4Y2A A;  1WHV A;  2MTL A;  3MHY A;  4K2X A;  2ZOG A;  3GWC A;  3HKZ D;  3MM6 B;  5EX3 A;  5A6W A;  3MM8 B;  3UW1 A;  3DLE B;  2ROP A;  4L6V 3;  4LRB A;  1T8E A;  4ZP7 A;  3AH6 A;  4NZ0 A;  2F1F A;  3G82 B;  1T9Y A;  2Q79 A;  2D9P A;  2BMB A;  5J1P A;  2DR5 A;  1DTQ A;  3HO1 A;  2I8E A;  2MEW A;  2IA6 A;  4FS2 A;  4DR7 J;  4KO0 B;  4MMO A;  1IKX B;  1RU1 A;  3GB0 A;  5GMK a;  4Q8F A;  2HHW A;  4USH A;  5F8G A;  4DSL A;  4B9V A;  1R8H A;  5AXM A;  2ERR A;  2AJF E;  3DLB A;  2HMI A;  1RLC L;  4LF8 J;  2R8J A;  1RLD A;  1S9E A;  4NLX A;  4DMZ A;  4ZLP A;  3PYG A;  1LW2 A;  5KFW A;  2HGN A;  2UV8 G;  3KDN A;  1FFS B;  3DLH A;  4LFB F;  1H2V Z;  4Q44 A;  4QU6 A;  1FJ7 A;  3KJV B;  4IO1 A;  3GIM A;  4CYU B;  1YJW S;  4PQU B;  1N5V A;  2C3P A;  4DR6 J;  4Q2M A;  3NAH A;  3AB2 B;  2VOP A;  4AT1 B;  2Y8Y A;  4JI4 F;  4XDD A;  4ED2 A;  1UMJ A;  3I9V 9;  2C2N A;  2B4O A;  4RW4 B;  1HNZ J;  4B9U A;  4Y34 A;  1FFW B;  4K2J A;  2EG1 A;  1J27 A;  2YNH B;  1NB7 A;  1ICE B;  2EEY A;  2HFV A;  4N56 A;  4LSN B;  3BF4 A;  1JLF B;  1EAY C;  1VK3 A;  1SH0 A;  2XHC A;  3VGU A;  3T5H A;  4J9O A;  2EFP A;  3AT1 B;  2C3U A;  4URQ U;  3W62 A;  4C3M A;  5KFB A;  4DUZ J;  2DNO A;  3BSO A;  1T95 A;  1U0H B;  4OYM A;  3P49 B;  7FDR A;  4RU9 A;  2NXC A;  5KFX A;  1FWL A;  3MED A;  1IQZ A;  1LWF A;  3UDC A;  4EO6 A;  2D1C A;  3KLV A;  1JNR B;  1S1U B;  1Q8L A;  1R0A B;  4X62 J;  4TLQ A;  1EP4 B;  3T3F A;  1L3S A;  3CNQ P;  2MMY A;  2DR9 A;  3K0J A;  4P10 A;  1TL3 B;  3FMW A;  3ZNU A;  5CD4 A;  4L72 B;  3CE8 A;  2E1R A;  2LYV A;  4NCG A;  4X84 A;  4ECV A;  3CCQ S;  4KTQ A;  2W2M P;  4PUO B;  1P6T A;  4X2B A;  5KTQ A;  3M6V A;  3NS5 A;  1KQF B;  1ZET A;  2ACM A;  1XNR J;  2APO A;  5K8O A;  4ELU A;  4F25 A;  3P3D A;  3R5C A;  1S0M A;  3QO9 A;  3HI9 A;  3VGT A;  4BHQ A;  1UCN A;  5E7O B;  1IKY A;  2MZS A;  1B3T A;  3IWN C;  4FYX B;  3SSS A;  4QW8 A;  1M90 T;  2JFD A;  2KXH A;  2CQ4 A;  4HT7 A;  4ES2 A;  4HKQ A;  2EI5 A;  2GFF A;  4MK9 A;  1FER A;  3NXZ A;  4OHZ A;  4OZ1 A;  1LQ9 A;  3AOB A;  3EWG A;  4CTA B;  4BCA A;  2DRB A;  2D74 B;  5L1K A;  2AEM A;  2FY8 A;  4CLS A;  4DXL A;  2QMU B;  1JX4 A;  4WJB A;  1XNQ F;  2WOM A;  2H5E A;  2PMH A;  3IA0 A;  4ZLL A;  4X66 J;  4EMD A;  3DU5 A;  3W9I A;  1JLC A;  3KK2 B;  2QFJ A;  4B3R J;  1AFJ A;  1Y4Z B;  1NK9 A;  3C6U A;  4ECX A;  4FKY A;  1NK6 A;  1IN0 A;  1KQK A;  4PWD B;  1KLM B;  5LM7 E;  3CJK B;  3TAM A;  2YPZ A;  4ICL B;  3RJM B;  3VZH A;  2ZHO A;  3TZZ A;  1S0O A;  1C1B B;  3SCJ E;  1FVQ A;  1S0N A;  2YKN B;  2O5D A;  3B82 A;  2PEB A;  3TRG A;  3SZ2 A;  1YJN S;  4NCA A;  1VQS A;  2J9D A;  1NBE B;  2L9D A;  3BR8 A;  1TTH B;  2VPX B;  2B43 A;  4HT5 A;  2HNZ A;  4OX8 A;  3RB4 A;  2M70 A;  2IVF B;  2XS5 A;  1HWI A;  4IRK A;  1S1T A;  4D3G A;  3KLG A;  1BC6 A;  1WSR A;  2K1R B;  5E33 A;  1ZM2 A;  2DGT A;  1IR1 A;  3G8Q A;  3HZG A;  3QSY B;  1CSJ A;  1S9G B;  5LOQ A;  3AD8 C;  1W26 A;  4RW4 A;  3MR6 A;  4U8V A;  2VPW B;  3JTN A;  2RU3 A;  4PXC A;  5EUH A;  5JUM A;  3OL6 A;  4DCO B;  3G87 A;  2DIS A;  4DQP A;  3H2L A;  4RLE A;  4UY8 5;  1WKL A;  1WHX A;  4OYW A;  4C8O A;  2HZC A;  4JP8 A;  4X4Q A;  1LW2 B;  2E5J A;  3MTK A;  5KFF A;  4DV4 J;  3I0S A;  4C2M A;  3BGR B;  1N33 J;  1EAR A;  4G1I A;  2CNN B;  1DAX A;  3C16 A;  3MEC A;  2V8G A;  3N4W A;  4RW7 B;  5IZH A;  1GMW A;  4ETX A;  3PW7 A;  2VB6 A;  2CQG A;  2CPX A;  1S1X A;  3J81 j;  2VD3 A;  4C8M A;  4HI1 A;  2O1P A;  3MD1 A;  1DTT A;  2B7B B;  2ZH4 A;  1RQ0 A;  1MU2 B;  4Z7Y A;  3HHE A;  4R5P B;  2E9Z A;  2OSQ A;  3BBF A;  1DQ9 A;  3KJF B;  2D3Z A;  2A2C A;  1Q0N A;  3B78 A;  4TY8 A;  1YJ7 A;  2F8H A;  2J7W A;  1GMW D;  5SZT A;  2BQ3 A;  1T03 B;  1WOS A;  3IRX A;  2HHX A;  2ZZT A;  1NXI A;  3MXH P;  1TUG B;  2CPY A;  1PG5 B;  3BEG B;  3LP0 A;  3PJW A;  2KYZ A;  4WE1 B;  5THW A;  3PR4 A;  2N3L A;  4B3S J;  1FEE A;  1IJF B;  1TKX A;  2L9W A;  3TP2 A;  4CH0 S;  4WKY A;  1X4D A;  5B0D A;  5IT0 A;  2R2R A;  1SKW A;  5T41 A;  4IG3 A;  4DSJ A;  1N4L A;  2HAF A;  3M8W A;  4OX7 A;  2GMH A;  3GSI A;  5IWA F;  4PRF A;  2JEJ A;  1VI7 A;  5KFA A;  1UVN A;  1CLF A;  1DQ8 A;  4QWA A;  3HVA A;  3DLK A;  1I3O B;  2OPR B;  3HJV A;  3HM9 A;  1OO0 B;  2ZFH A;  3NNA A;  4DV3 J;  4HH0 A;  1T94 A;  2VHG A;  3ILI A;  4EZ9 A;  4H4K A;  4NXM F;  4J9P A;  4MK7 A;  3DOM B;  3T1Y F;  3HVT B;  1WG1 A;  4YB1 P;  4WTY A;  1B0T A;  3FBB A;  1H2T Z;  4KC5 A;  5CYQ B;  2EFV A;  2NR0 A;  1WD6 A;  2U1A A;  1NZ8 A;  3GR0 A;  2E5L J;  2ZBI A;  4C0B A;  2XC9 A;  4JI3 F;  2WBM A;  1IKW B;  3QFW A;  3PW2 A;  2XYH B;  4NE9 C;  1WTB A;  2CAD A;  3BDE A;  4WII A;  3JSM B;  2BDP A;  3ET6 A;  4RBT A;  1FRL A;  3EE3 A;  2GJ2 A;  1PYT A;  2JL9 A;  3JSY A;  3S1T A;  1U49 A;  1TKT B;  2N7Y A;  2O01 C;  4J9Q A;  4ELV A;  1RT7 A;  4KV8 A;  4NI2 B;  4P2S A;  3UDL A;  3BKT A;  4K4V A;  2HK3 A;  3D1H A;  2FVS A;  3AJ1 A;  4G3I A;  4EGL A;  4AL5 A;  1OYD A;  3GPA A;  3UR0 A;  1TFW A;  3R97 A;  1TKZ A;  1GEH A;  1ZAV A;  2V63 A;  3P4U B;  3QNW B;  4DL3 A;  1KHV A;  3BB5 A;  4U8Y A;  3BYR A;  3A3O B;  4YFU A;  2BOP A;  2KL8 A;  2CPH A;  3Q8Y A;  1NPK A;  1CC8 A;  3OD2 A;  2ZWP A;  4GMK A;  1N6Q A;  2E1C A;  4O4R A;  1JKH A;  2RKI B;  2XZD B;  4ECT A;  2PGC A;  3K2Y A;  4DPU A;  5F8I A;  4K59 A;  2R7R A;  5HP1 A;  3TZW A;  4MH8 A;  1RYS A;  3MI7 X;  2IJF A;  2BR0 A;  4K4T A;  2CQB A;  1UET A;  4UOF A;  1N48 A;  4J9R A;  4MKB A;  2IVM A;  2P8I A;  4FPI A;  1VHF A;  1U09 A;  2GZO A;  4AE5 A;  2R4F A;  3AAW B;  3G82 A;  5KFU A;  1I94 F;  2QSW A;  3MD3 A;  2ALZ A;  3CJQ A;  1Q82 T;  3SSR A;  1OPZ A;  2N3O A;  3N01 A;  4ECU A;  4P9S A;  1ITP A;  4OYP A;  1T9X A;  3M8S A;  1LK7 A;  1MU2 A;  4JYA J;  3QLH B;  4I6A A;  5F8J A;  4R0E A;  2Z56 B;  3VAM A;  2HYI B;  4DR4 F;  2K8G A;  3GJS B;  2VIC A;  4PEO A;  2ZC4 A;  3M2U B;  3KUE A;  1AYE A;  1HW8 A;  1FKO B;  2B8Q A;  2ZWO A;  3KK3 A;  3OR1 A;  4WK1 A;  4AXJ A;  4JI0 F;  2FHJ A;  2HW3 A;  5F8H A;  1CC7 A;  2AEJ A;  2F4F A;  3Q8R B;  2KJV A;  3Q2T C;  1KHW A;  1HHQ A;  4HH1 A;  3MEE A;  3B4D A;  2FLL A;  4KO0 A;  2XS2 A;  2KHC A;  1RCO B;  3M6U A;  3AOD A;  4EI2 A;  1YJ9 S;  2R8K A;  4O4G A;  2YVS A;  4ED5 A;  3THV A;  3CD0 A;  3PRB A;  1GXL A;  3MZI A;  4CO3 A;  1ZA2 B;  1S6Q A;  4DDF A;  3DRS A;  3ITH A;  1O0P A;  2BE2 B;  3FEY B;  1Q53 A;  5LSO A;  2CZ9 A;  2LU1 A;  3J80 Y;  2V4R A;  2HS0 A;  2AIR B;  1B70 B;  2X1B A;  1VYA A;  3M8Y A;  2BAC A;  3D6T B;  3ZTO A;  4CQ1 A;  3ZZZ A;  5M2U A;  5BJR A;  3QZ7 A;  2PDA A;  1JLG A;  2YNG A;  3PM9 A;  3R3T A;  1HWJ A;  2Q6B A;  3R1L A;  2R8G A;  1WDT A;  3C46 A;  4DG1 A;  1NJW A;  4C98 A;  2C2O B;  4LF9 F;  4JI5 J;  1APS A;  2DHA A;  5F3Z A;  3M9O B;  4KQZ A;  2VZ9 A;  2J9D E;  4P74 A;  5AE1 A;  2LKZ A;  1TV6 B;  1RWP B;  3HD2 A;  4C11 B;  3GFY A;  1VCT A;  1QVF R;  5KFD A;  3ETO A;  2XM3 A;  3MR2 A;  3IR7 B;  4PQA A;  3CCU S;  1PGZ A;  3TA1 A;  4O3S A;  5KG1 A;  5B09 A;  4B9L A;  4LFA F;  3V81 B;  4O44 B;  4PWU A;  1WOR A;  2B4P A;  1SPB P;  2NZ4 A;  1JLQ B;  5KFZ A;  3CJR A;  4TYA A;  4NYO A;  3H4B A;  1GH8 A;  2NPF A;  1RP5 A;  3QAE A;  1RGV A;  2R7T A;  3DOM A;  1KVI A;  4F4Y A;  5ITH A;  1VQP S;  5HLF A;  1NJI T;  1B4S A;  3BQ2 A;  1TKZ B;  2HFN A;  2W24 A;  2W25 A;  2ZH1 A;  2E5L F;  3JAM U;  1MN9 A;  4DV1 F;  1YGY A;  1EKR A;  4DR1 F;  2L41 A;  3ISN D;  3CDA A;  3M6X A;  2J9E A;  3LWL A;  1RHM B;  1E6Y B;  1OY9 A;  2OKQ A;  2VBZ A;  1N5Y A;  3H0P A;  3PAC A;  4CO0 A;  4MIB A;  2W01 A;  5K14 B;  2F63 A;  1B64 A;  3A12 A;  2EVZ A;  1UZH A;  1UVJ A;  1E6V B;  2NUH A;  2YBV A;  3F56 A;  4U7U K;  5HAT A;  1P1T A;  3M7V A;  3CCL S;  3UCZ P;  2VQF J;  2JEF A;  2OPQ A;  2DGU A;  2M88 A;  3EGN A;  1VDH A;  2DBB A;  2RU9 A;  1FRX A;  1HA1 A;  1S48 A;  1YZ7 A;  4LIR A;  2LEP A;  3DRP B;  4RUC A;  4RUA A;  3H5Y A;  1HBO B;  2LLZ A;  2FHO B;  4F50 A;  4B3T J;  2RUG A;  3G9C A;  2J7K A;  2IBK A;  2QTW A;  2CJQ A;  4PWW A;  4OI6 A;  2VAS A;  1QUV A;  2MKC A;  4KB7 A;  4CLP A;  3QT7 A;  3HT3 A;  2VA2 A;  5F8N A;  2N4D A;  3W2W B;  1MML A;  2LA6 A;  4IG0 B;  4O0I A;  4NRT A;  3G6E S;  4QIF A;  1TQL A;  2Q1L A;  3D9B A;  3K57 A;  4J9L A;  1HIY A;  3M8R A;  3SIP B;  1VQ6 S;  2P2C B;  5U47 A;  1JWW A;  4X4U A;  2RRB A;  1G7C B;  4PCQ A;  1D9D A;  2I1R A;  1NSA A;  3CDW A;  1KWM A;  3W2V B;  4LF2 A;  3GU0 A;  1HFE L;  4TKT A;  3R6L B;  3KK2 A;  4IQX A;  4IOA Q;  1WDD A;  1U1P A;  3EUN A;  5KT7 A;  3M32 A;  3M2R A;  3LP2 B;  2B0G A;  4UT4 A;  3OXF A;  4XAK A;  9ATC B;  3LP1 B;  1SVD A;  3TAN A;  4PPZ A;  2GHP A;  1KLM A;  2F3J A;  2OEL A;  3DNC A;  4DN9 A;  1U6B A;  3LQV A;  1FDA A;  1NPR A;  1XQI A;  3DOK A;  1VQL S;  3DDN A;  2OGU A;  4HDG A;  4KT0 C;  4LRA A;  1LNQ A;  1M1G A;  4NLR A;  3QZ8 A;  4ECW A;  3RB0 A;  2HIQ A;  3KUG A;  5ETL A;  1KC8 T;  3TVK A;  4IFV A;  2WW8 A;  4ZPW R;  4J9N A;  2UUA J;  1U1K A;  2DHX A;  2HPU A;  1X4E A;  2CQ3 A;  1S59 A;  1DAR A;  4X4R A;  1T7P A;  1QJH A;  5B0C A;  1EET B;  1VQ9 S;  2F8E X;  1S10 A;  1FES A;  4ZVT B;  1UVI A;  2AT1 B;  5L46 A;  2FC9 A;  2MST A;  4DUT A;  2QLJ B;  2VQE F;  3GTY X;  4NA1 A;  4H4O B;  3W3S A;  4HI2 A;  3BGF A;  2ADC A;  4AFF A;  2ZVS A;  3MM9 B;  1EB0 A;  1X8D A;  4MIA A;  1F6T A;  2LU2 A;  4QQB A;  1T9U A;  2AX1 A;  3B4M A;  3EDR B;  3P8B B;  4CLY A;  4LF7 F;  1FD2 A;  1FK9 B;  3V6H A;  4GKK F;  4LFC F;  1NAQ A;  4NZ6 A;  3NG8 A;  4I1T A;  3VHQ A;  1F9H A;  1P8G A;  4M5H A;  2V2Q A;  2CJB A;  3MM7 B;  4XDC A;  5KFQ A;  1FJE B;  4JI1 J;  3D5M A;  2GQC A;  2ASY A;  3GV7 B;  2NSC A;  4ES3 A;  5KFH A;  1WEY A;  2YQ1 A;  1DTT B;  4NA2 A;  2YH1 A;  1SH2 A;  4OFZ A;  4TN2 A;  3FFI A;  5M2R A;  4NML A;  4ZVG A;  2EKN A;  4DL0 C;  5LSL A;  1FHT A;  2J8A A;  4ZVE A;  1RWU A;  2OP5 A;  4WP8 A;  2ZZM A;  1KTV A;  1J5E F;  5HVG A;  1HQU B;  1QY7 A;  2IM1 A;  2PE8 A;  2W9B B;  2AQ4 A;  3UN2 A;  3J80 U;  1UWB A;  3S7R A;  1H6K X;  4WP9 A;  2CPF A;  3MED B;  3NCP A;  2IY5 B;  3RB6 A;  4IUF A;  4LR7 A;  3ZZU A;  4LBH A;  4TLR A;  5DDR C;  5ETN A;  1EP4 A;  1IKV A;  2UUW A;  1IKW A;  1KVK A;  1R43 A;  2MDA A;  5JMN A;  4FVM A;  2ZJQ Q;  1QLN A;  3BN4 A;  1YJV A;  3TZY A;  3BQ0 A;  5I42 A;  1FKA F;  1ROF A;  3MEK A;  5T14 A;  3HP6 A;  1RKI A;  1SCJ B;  3GYN A;  3PCO B;  2AD9 A;  2KXN B;  3OW2 R;  1HWK A;  1TVR A;  5L39 A;  3HVW A;  2WTF A;  2HAI A;  4DLG A;  4QBU A;  1SQE A;  3KLH B;  2RT3 A;  4LMZ A;  1S0V A;  1DFD A;  1DUR A;  1U0H A;  3MM5 A;  2GGP A;  3QWP A;  4LRC A;  4CYU A;  1VLY A;  5MAO A;  1ZTT A;  1JXL A;  4DQR A;  4FBT A;  2N7C A;  1L3V A;  1NKC A;  2VG7 B;  4CWB A;  4ED1 A;  3W2V A;  4ID5 A;  1TL1 A;  4PXB A;  5L38 A;  2D3O 1;  4P6Q A;  2DVI A;  1RAH B;  1FJC A;  2A6O A;  5DZ7 A;  4K4W A;  5DGA A;  3PEH A;  4LSL B;  5GMD A;  4KGZ B;  4QJV A;  3WHI A;  4DL4 A;  2FUG 9;  1K0V A;  3VZI A;  4J9S A;  2IJR A;  4HLB A;  3T1H F;  2BQU A;  4PZV A;  4QWD A;  1CEZ A;  2VFT A;  1MMD A;  3G6V A;  1N36 J;  2BKP A;  3WDO A;  2R9L A;  2PC6 A;  4TU8 A;  3I0R B;  1YJT A;  1Z4U A;  4CO2 A;  1S49 A;  1BWV A;  1I51 B;  3GQC A;  2G4B A;  2HRU A;  2YNI B;  4NRU A;  4RZR A;  5BR8 F;  2YQ0 A;  4RR5 A;  3MCM A;  3R1H A;  4N76 A;  2IC3 A;  2R7V A;  3CO0 P;  1K47 A;  3MMC B;  2I9S A;  4LBP A;  4NLV A;  3HFV A;  3SQG B;  2J0X A;  2QLB B;  4CM0 A;  1HWU A;  1LXJ A;  1V3S A;  1YRT A;  1MNE A;  2A0F B;  5C24 A;  3NOG A;  3TUI C;  3TJ9 A;  4DS4 A;  1YTY A;  3PO4 A;  3AY0 A;  2C42 A;  1FRM A;  4QYZ J;  1DJ0 A;  2RNE A;  2AP6 A;  3G8T A;  1OMS A;  2MKS A;  2OPP B;  4ZN3 A;  3KK3 B;  1ACM B;  2BUN A;  2HQ3 A;  2HQC A;  1K73 T;  1HNI A;  3UCU P;  2AX0 A;  2VKR A;  1ZPV A;  1CG2 A;  1OYE A;  3O2I A;  1Q4R A;  5HJY A;  3GYX B;  1S99 A;  4C48 A;  2FLP A;  3R27 A;  2HHV A;  4J90 A;  2NXU A;  4QWE A;  1SKS A;  2AZ3 A;  5T7L B;  5KFY A;  2MKJ A;  3QLH A;  3OHB A;  2R7W A;  2OTL S;  2DGQ A;  3CCV S;  4DR3 J;  3BPD A;  3PNI A;  3Q0A A;  1TFY A;  1T02 A;  1UEK A;  4O23 A;  3IRW P;  4A8X A;  3ITH B;  3L7P A;  3OTE A;  1HR0 F;  1RHQ B;  3IGN A;  3T1A A;  4ZK7 M;  3TOQ A;  1B0V A;  1Y7P A;  5FLX Y;  4EYH B;  1NDL A;  2GA7 A;  4EBC A;  2C2Z B;  2Q3P A;  2K1R A;  2W4P A;  3EVO A;  4PG7 A;  3T6J A;  2W8L A;  1EIY B;  3H5S A;  2B7C B;  1FI4 A;  2DIU A;  2G13 A;  3WX8 A;  4PAB A;  2HLU A;  1H74 A;  1BQN B;  3NEK A;  3FMB A;  2M4M A;  5CZX A;  3MOZ A;  4WP3 A;  4X4T A;  3MR5 A;  4O4G B;  1IM6 A;  2QA1 A;  3OFE A;  2CJA A;  2MY8 A;  2F40 A;  5EWE A;  4CO4 A;  3EPG A;  4ALZ A;  2F9J A;  3DXB A;  4LRE A;  3PRV A;  4N7T A;  3S01 A;  1XER A;  1KSP A;  2XSF A;  4TNO A;  3C6T A;  3VQS A;  3T1Y J;  4E8U A;  3A8I A;  4N5S A;  4HDH A;  2E9R X;  2H54 B;  2CNL B;  1VIX A;  3AOA A;  3C16 B;  4L3N A;  5A76 A;  2W9B A;  2BYC A;  1RAI B;  2QN6 B;  2EC0 A;  1NME B;  3ZZT A;  1CQM A;  1FD8 A;  2HNY A;  3K8V A;  4DL2 A;  1ZPW X;  3WBZ A;  1TV6 A;  2PN6 A;  3NGS A;  1KTQ A;  4ZVP B;  4K7Q A;  5A0Y A;  5LXR A;  4MKY A;  1N5Y B;  4OJH A;  2AGP A;  3KG1 A;  4NL5 A;  2V4J A;  3DXS X;  4KH1 B;  4ZVR B;  3UD5 A;  1AXQ A;  3Q2S C;  4YDD B;  3FUY A;  3VAK A;  3Q23 A;  4LF1 A;  3HVT A;  4CO1 A;  2CA9 A;  2ZKU A;  1QUP A;  3I0R A;  3J7Y I;  4ECZ A;  5I3P A;  3ADA C;  1R89 A;  3GIK A;  4Q2L A;  3IWX A;  4ZHR B;  2KZZ A;  4F4W A;  3OVA A;  2MGZ B;  4DU7 A;  2WBR A;  2IC3 B;  4EO8 A;  2UVU A;  3CGI A;  2MHN A;  4DPY A;  4I7F B;  1W2I A;  1NHU A;  1YWX A;  3BJY A;  1AB8 A;  3P5B P;  1I6J A;  2MJN A;  4YR2 A;  2JDJ A;  3A3N B;  2NUU G;  3EIC A;  3UQS A;  2OTJ S;  1RT7 B;  2P9G A;  1NKE A;  2DCU B;  1QSS A;  1X5P A;  2IIH A;  2BEF A;  4WFB Q;  1WUU A;  1K9M T;  2HBQ B;  1UVK A;  4DV4 F;  4YDX A;  3JSB A;  3CUN A;  3M6W A;  4HYK A;  2X51 A;  1TAU A;  4M5I A;  2FTR A;  4M5L A;  5HSP A;  1WEX A;  2OO4 A;  2QJ3 A;  4XK8 C;  3EZO A;  4WFN Q;  1HNW J;  4K4Z A;  3GG1 A;  3CCT A;  3BGO P;  3BR9 A;  5KFT A;  4ZCI A;  2F5G A;  2I6W A;  1KQG B;  4O3Q A;  3I5A A;  3NNC A;  1U2C A;  2DR6 A;  2CFX A;  2E7X A;  2FHM A;  2GJF A;  2JVO A;  3T9N A;  1DZ5 A;  2DPI A;  1F0X A;  1XR6 A;  2EPI A;  3D3B J;  1MLA A;  1BMQ B;  4M5D B;  3MFI A;  5HP1 B;  4PG8 A;  2GS8 A;  3TVZ A;  4U7U D;  2CAJ A;  3DU6 A;  1MSW D;  3QT8 A;  1URR A;  3BGU A;  5CYQ A;  1NPP A;  3LTO A;  1J5O B;  4C4W A;  2XBP A;  2WAQ D;  1Q7Y T;  1Q5Y A;  2OML A;  2MQ8 A;  2J7U A;  1FRH A;  5LSR A;  1EET A;  2QSF A;  1N54 B;  2IRU A;  3HD1 A;  4KFB B;  2BE7 D;  4OJ1 A;  3PYD A;  1QE1 B;  4UW2 A;  4PPD A;  4JUZ A;  2W1B A;  4DV5 J;  3TVY A;  5GVQ A;  5KOW A;  4XPE A;  3LPE A;  4TU7 A;  5EWF A;  2QEX S;  4UOG A;  1NJX A;  1NB2 A;  2HHT A;  2BV3 A;  1VRU A;  3DOK B;  4URS A;  1HBN A;  1SIW B;  1UJ6 A;  1U1M A;  4CTA A;  1R8C A;  1FNO A;  1S6O A;  1XIQ A;  2J76 E;  2ASJ A;  2KFN A;  1IQT A;  3HKW A;  2OD4 A;  3OXG A;  2LXF A;  3PRD A;  4RW8 B;  1P27 B;  2VUG A;  4ITS A;  2ZH8 A;  2KH9 A;  1F2G A;  3ZZY A;  5I3Q A;  3DLG B;  1D9F A;  4KKO A;  4W4M A;  2X7I A;  3T41 A;  3DMJ A;  2RH3 A;  5D15 A;  1TAQ A;  3QSI A;  1U1N A;  5H9F J;  4GKJ F;  3IC1 A;  1CUL B;  3G96 A;  3I6P A;  4FVC A;  4FF3 A;  2P9C A;  1HNW F;  1UFL A;  1Q16 B;  3BO2 A;  1PC4 A;  1T05 A;  1FE4 A;  2HSE B;  4G1Q B;  1F2H A;  3ENW A;  2DNP A;  1SQF A;  3OTO J;  1X4A A;  4BS2 A;  1S76 D;  1MWZ A;  2G2Y A;  4CO5 A;  1ZZF A;  4J5O A;  2IDE A;  4Z37 A;  1FRJ A;  4CNY A;  4OL8 A;  1U1L A;  1FX2 A;  3QGP A;  1RHR B;  2MZT A;  1BD6 A;  4ZOS A;  5FLX U;  3CME S;  4YR0 A;  4K4Y A;  2B9X A;  1SJQ A;  3OTO F;  2RRA A;  2RML A;  3BSN A;  1LKZ A;  4N77 A;  1O51 A;  1R8A A;  4G6V B;  4I7F A;  3Q22 A;  1KEK A;  3DYA A;  3SI8 A;  1WF1 A;  1FA0 A;  2R2S A;  4ZIV A;  3C8Y A;  3FQL A;  2YWW A;  2C22 A;  1OJ4 A;  2JEG A;  3TQ1 A;  3CC7 S;  3E01 B;  2IFX A;  4QPT A;  2H4Y B;  1Y11 A;  4A8Y A;  2CWX A;  2DY1 A;  2OEJ A;  3H40 A;  1HR0 J;  3MCO A;  5KG2 A;  1UVM A;  3EXC X;  2IHR 1;  5F0W A;  2BOA A;  3X1L B;  2G1H A;  4WF9 Q;  1YLX A;  4V19 X;  1LWX A;  3M9M B;  3EVM A;  2LEB A;  2WSE C;  4IOC Q;  1JNZ B;  2YWF A;  4I2Q B;  5F0U A;  8AT1 B;  1HL6 A;  4NPO A;  4OLP A;  5KFO A;  2CNK B;  2CQ1 A;  2JX2 A;  3FBF A;  2RHQ B;  5E3R A;  2VFS A;  3QGG A;  4YHH F;  5DDQ C;  4HR2 A;  4DV5 F;  1JLQ A;  3RG6 A;  1R3N A;  1RT1 B;  2VG6 B;  4GVL A;  3HLU A;  2DXD A;  1NHK L;  2CQC A;  1TL7 A;  3HF5 A;  4B9T A;  3Q8S B;  3LP0 B;  4P7V A;  2ZOF A;  3C3L A;  4RPF A;  4FYW B;  4ID5 B;  4DR2 F;  3C15 A;  3IBC B;  3HXM A;  4UZB A;  1NRK A;  3V2U C;  2GQQ A;  4OYX A;  2ZUA A;  1NJZ A;  4IYQ A;  4CH1 A;  2MY7 A;  4FYY B;  2JRS A;  2ZM6 J;  3PV8 A;  1TP7 A;  2AF6 A;  2GIR A;  4LSN A;  4EUV A;  4DV0 F;  5C42 B;  4I67 A;  2KO1 A;  3HPO A;  3IR5 B;  3J7Z T;  1HBN B;  4Q45 A;  2L48 A;  2Q43 A;  1ZS6 A;  1L5U A;  4ID8 A;  2KT2 A;  2DNY A;  4ECQ A;  2UUA F;  1UZD A;  4C8N A;  1RTZ A;  2DEI A;  3CXC R;  4C8L A;  2VG5 A;  3UN3 A;  3W8G A;  1D1U A;  1CJU B;  1RDR A;  3W5X A;  1J5O A;  3UDV A;  4P73 A;  3W5Z A;  4EFA C;  2IAJ B;  1RE1 B;  4ED0 A;  1X4F A;  2PSZ A;  4QIW D;  4DR5 F;  1WG5 A;  1JXE A;  1CUL A;  3W2W A;  1UA0 A;  2HQI A;  1RWM B;  2DKO B;  3US5 A;  4ANE A;  2XNQ A;  4JI2 J;  1SJ3 P;  2YWK A;  4KE5 A;  1SUQ A;  1UAW A;  4M5M A;  5C7P A;  4LRD A;  3CF5 Q;  1K8A T;  2HRT A;  4G1Q A;  2K3I A;  1EX8 A;  1RAF B;  2QT7 A;  4ZVQ B;  1XWL A;  5A8W A;  2CPI A;  1Q86 T;  4X65 J;  2OPP A;  1GT8 A;  2ADB A;  2W2O P;  4QU7 A;  3DLE A;  4B9S A;  2UU9 J;  1C0U B;  3UWT A;  1X4B A;  1M5P C;  3OUY A;  5ETS A;  4NYZ A;  3RTV A;  2J6S A;  3ZZO A;  1Q7L B;  1VGY A;  1X4C A;  1RWW B;  2H51 B;  1FKP A;  1H72 C;  4CZC A;  3PXG a;  1RU2 A;  3N79 A;  1VBX A;  2DTJ A;  2CXE A;  2I5J A;  5BR8 J;  3FC9 A;  3DYA B;  3OJS A;  1W7W A;  1UEU A;  4WFZ A;  4ILL A;  3TUJ C;  3OTB A;  3VAJ A;  2RIJ A;  5A8K B;  1WHY A;  2Y1R I;  2HFZ A;  3HK2 A;  3OR1 B;  3C6T B;  2AYB A;  5KT2 A;  3HJF A;  2P9E A;  2XG8 A;  1AZS A;  4E0D A;  2IA0 A;  2MYF A;  2Y3Y A;  3J81 Y;  5B08 A;  3VAH A;  1XBW A;  2EWH A;  1LV5 A;  3C19 A;  3EGZ A;  1U4B A;  2J5A A;  3SQO P;  4NLP A;  1XJW B;  5KG5 A;  3MEE B;  5EX0 A;  1ZM4 A;  2CPJ A;  2W4C A;  4DPT A;  2ROG A;  3HSJ A;  3RAQ A;  5LJ3 Y;  2RDI A;  5AXL A;  5KFI A;  1SC4 B;  2EXU A;  2UXD F;  5J2P A;  4J9U E;  1FVS A;  3HFK A;  2AMC B;  2H3E B;  2XMA A;  3TZX A;  5KFK A;  1VQN S;  3QBC A;  4QR1 A;  3KJN B;  3KKF A;  3W5Y A;  4JV5 J;  5F41 A;  4QWC A;  4GC6 A;  5BYR A;  1U6F A;  3C15 B;  4RW6 B;  2GHV C;  3V4M A;  2Y1J A;  2QZ8 A;  1FTC A;  2W2N P;  2VDI A;  2FJD B;  5CZV A;  1B7F A;  3FZB A;  1V5V A;  4OZ2 A;  2FDN A;  3VAI A;  3NWG A;  3T6B A;  1YVF A;  4C8Z A;  1SL2 A;  3M30 B;  4JOU A;  3HCX A;  4UQG A;  3QT6 A;  3NBP B;  2EK6 A;  3SV3 A;  1JB0 C;  3JB9 k;  1A7G E;  4DV7 F;  2HKE A;  1VHI A;  2KVI A;  1UFK A;  2HBR B;  2LFV A;  4HHH A;  4P71 A;  4YN3 B;  4RW9 B;  4F2R A;  2WVF A;  4C97 A;  5HVH A;  1MG7 A;  1SC1 B;  5CA5 A;  3CD6 S;  1H0H B;  1D9A A;  2MGZ A;  5IV3 A;  1VBZ A;  2KYX A;  2ZBC A;  4I69 A;  2QG9 B;  2OFH X;  4QR0 A;  3MAA B;  3TEG A;  1U25 A;  2EBE A;  1RTJ A;  3DI6 A;  4KGK A;  5KG7 A;  1IUJ A;  4S0M A;  3I55 S;  3NKY A;  2XYG B;  2ZH3 A;  2MJU A;  3F41 A;  4TY8 B;  4UY8 T;  1HQE A;  2ZDP A;  1X4G A;  1RK8 A;  4NLO A;  1GMU A;  3WIV A;  4F4X A;  3V6K A;  5IT4 A;  4B3M J;  1OWX A;  3FK4 A;  3N5F A;  3SV4 A;  3DLL Q;  3FVY A;  2A6M A;  1S7I A;  2DXF A;  2M7S A;  2XCA A;  2XEX A;  3AJD A;  4IH7 A;  3I5B A;  5H1S V;  3OPK A;  4OMF G;  2BRK A;  5KFM A;  1RSC A;  3UNG C;  3EVW A;  2BJD A;  3NY0 A;  2XZW A;  2WSF C;  2RD5 C;  2VQE J;  4IRD A;  3D7S B;  5CD4 H;  2G0I A;  5H9E J;  3SSQ A;  1TU0 B;  2XMU A;  1UPP A;  3DDI A;  2IAJ A;  2RDD A;  5KG0 A;  2DGS A;  2JLG A;  3CCW A;  3PG9 A;  4FNI A;  4W92 B;  1G2E A;  4ICL A;  2W7O A;  4ED3 A;  2AGO A;  4JI6 J;  1RT6 B;  1GX5 A;  5DG8 A;  3ENA A;  2F9D A;  1XMQ J;  3KLI B;  4A4J A;  4DWI A;  3I96 A;  5LXY A;  2VQF F;  2P6S A;  2OPQ B;  2V94 A;  4I68 A;  4JBC A;  3KMQ A;  2DYA A;  1X5T A;  2UV8 A;  1CJV B;  5B0G A;  1NDP A;  1U6Z A;  2LQ8 A;  1FRK A;  1WKK A;  2ZEJ A;  2JHE A;  3GSD A;  1TUW A;  4ZVS B;  3F44 A;  3QGI A;  2MSS A;  5KFV A;  2UU9 F;  3ENQ A;  4KPY A;  3CB4 A;  1N0V C;  1RYR A;  1F5A A;  3ET6 B;  5L1I A;  4IG0 A;  4LJM A;  1RBO B;  5JVH Q;  2KFZ A;  2ASL A;  3TAQ A;  1C0T B;  1SKU B;  1SQG A;  2F65 A;  5CCM A;  3ICL A;  3PTW A;  2EFQ A;  4USW A;  2YKP A;  3K7R A;  3DDK A;  1RT5 A;  3JQM A;  1M1K T;  3UN5 A;  4RW8 A;  4UF4 A;  3CPW R;  2M3D A;  1ZAX A;  3KJV A;  2J0S D;  3QAT A;  1LW0 A;  5GAG U;  2F8M A;  5GAE I;  3MUM P;  3ZXW A;  1FFG B;  3BGL A;  1WJ9 A;  1Y5L B;  2M5Y A;  1CS4 B;  4K5R A;  1GX6 A;  5CH7 B;  5KFC A;  3G4S S;  2HFS A;  2ZJR Q;  3J81 U;  2BAB A;  1PIE A;  2MLY A;  3NOC A;  9RUB A;  2M0G B;  1S1X B;  1MRO A;  3NS6 A;  2B6A A;  1U26 A;  3R6G B;  5HO4 A;  1FWK A;  2E1A A;  3AFG A;  3FRZ A;  3T5K A;  3TX8 A;  5KT4 A;  4OI0 A;  1BLU A;  3VVU A;  2VJV A;  3AB4 B;  3KMS A;  5E2Q A;  4YEA A;  5F9L A;  5C24 B;  3KTQ A;  4JV5 F;  1T05 B;  1M0S A;  1A0O B;  3V4I B;  1U24 A;  1IBL F;  3HHD A;  3R5J B;  4FP9 A;  1TR0 A;  4LUB A;  1G4C A;  4OJ3 A;  4ZVF A;  6FD1 A;  2YKA A;  4UUX A;  4V1A k;  5J2M A;  3EDQ B;  1HMV B;  2HVH A;  2HWH A;  3VGV A;  4KR0 B;  3PX0 A;  2UUC F;  4NXN F;  1HQ2 A;  2YNH A;  1RAE B;  3KHL A;  4EBD A;  4JI0 J;  4DFK A;  1VQM S;  4ZIT A;  2WZ1 A;  3N6M A;  2LQ5 A;  3S8S A;  4FF2 A;  2MZR A;  1ARO P;  2AHO B;  1RTI A;  2Y0B B;  2YX4 A;  3H98 A;  3Q83 A;  1FKO A;  2BRL A;  1BQX A;  4CLT A;  4WKR A;  3GCX P;  1KN6 A;  1RJJ A;  4ZJQ A;  3QQC D;  2FJB B;  4GVB B;  5GAD I;  4F8R A;  1UWB B;  2UXC F;  4P2X A;  2ZZN A;  3CIZ A;  3PIO Q;  3HDS A;  3O5T B;  3D0I E;  5DZ6 A;  2YPY A;  4AUK A;  1LWF B;  2JLF A;  5EN1 A;  2XO7 A;  2C2E A;  1RTD B;  2KDO A;  3Q8Q B;  1R0A A;  3GMG A;  3MMB A;  4TVA B;  1RTJ B;  3DI6 B;  1N56 A;  2COL A;  4ZPB A;  2CIM A;  1BY9 A;  2V4J B;  3LO3 A;  5D78 A;  4JI5 F;  4LF9 J;  2BAN A;  2UZA A;  2KRB A;  2CPD A;  4RUB A;  3VR1 A;  2KG1 A;  4B3O A;  4X65 F;  1VIS A;  2K06 A;  2DGV A;  4J37 A;  2VG6 A;  5ETR A;  1HPZ A;  1FXL A;  2HHP A;  3E8O A;  1H98 A;  1QM9 A;  1S1W B;  2LP4 A;  3H7H B;  4KHM A;  2DIT A;  3FSY A;  1FDD A;  2XQC A;  1RAB B;  3LGH A;  1X5O A;  1HBU A;  4USU A;  3W61 A;  2CWK A;  3H2U B;  5A0Y B;  3R5A A;  1XMQ F;  2G1D A;  3RGI A;  3CJ8 A;  3V81 A;  1XC9 A;  2FVQ A;  1SJ4 P;  1ZZN A;  3HHL D;  1JKH B;  2LEC A;  3CJS A;  4DV6 J;  3T5L A;  1RT3 B;  4P52 A;  4QW9 A;  3EX7 B;  1S7H A;  5BYQ A;  1H2U X;  4HHU A;  4NLT A;  2V4Q A;  1U1Q A;  2EG2 A;  1EZZ B;  4EU0 A;  2VG7 A;  1Y00 A;  2V69 A;  4IO9 Q;  3V6J A;  1Q81 T;  4X4V A;  4KRW A;  4DPO A;  1R31 A;  3LUY A;  2CDQ A;  1LWE A;  3LPY A;  2KHD A;  4I6W A;  2VBX A;  4ZP9 A;  5FD1 A;  4MFB B;  2KG0 A;  1VMB A;  4M5G A;  5E5N A;  1WF2 A;  4F3O A;  5AE2 A;  1PJ5 A;  1D8Y A;  2DHG A;  2I2Y A;  2PI5 A;  2NSB A;  3D66 A;  2FPH X;  3ILL A;  3SCL E;  4LF5 J;  2VU5 A;  5E0O A;  1CQN A;  2DNR A;  1I94 J;  1QSL A;  4QYR A;  4CLZ A;  3IG1 B;  1VRU B;  4BC9 A;  3CMA S;  4B9M A;  5A8W B;  4DR1 J;  4Q0B B;  4J9V A;  5J2N A;  1O8B A;  3AXK A;  1YRU A;  3Q86 A;  4FNH A;  1HYS A;  1WEL A;  4ATN A;  2XO6 A;  2C1E B;  3PR5 B;  3RW6 A;  3O6Q A;  5F8L A;  2BJ9 A;  3R7S B;  1N32 J;  2Z2L A;  4LRF A;  2DNM A;  1Q78 A;  1XEZ A;  5ETQ A;  1NK0 A;  2E7W A;  5ETP A;  5IWA J;  2XGQ A;  3Q8V A;  1RWV B;  1FNX H;  1PJ7 A;  4M5N A;  1CJT B;  2YXL A;  3C66 A;  3GP9 A;  3M1V B;  5GME A;  4BBY A;  3IMQ J;  4QIE A;  2E1M C;  4WIQ A;  3PJ9 A;  5C25 B;  2IMO A;  2W2Q P;  1KON A;  3FEX B;  3GFZ A;  1WOP A;  4DCJ B;  1KLN A;  2V9K A;  4G1P A;  4NEY A;  1T03 A;  4F67 A;  2XS7 A;  1SB6 A;  1WC4 A;  1BE4 A;  2PII A;  3JXO A;  3MPV A;  3MCS A;  3Q24 A;  2R7U A;  4PAA A;  5RUB A;  4GO5 X;  2KFY A;  3U1L A;  4M5J A;  4YB6 A;  4C6A A;  5CAA A;  4WTO B;  2BX6 A;  3OV7 A;  2V8V A;  4M63 A;  1OS5 A;  3TUP A;  1ELO A;  3MTJ A;  2C2M B;  4P72 A;  2FB0 A;  1VQK S;  3HHL C;  2JFK A;  2CJY B;  5HMZ A;  4JI2 F;  5J2P B;  2YKM B;  2NZC A;  3HSZ A;  1NM2 A;  3ENV A;  1N34 J;  1HLW A;  4C0H A;  4FF4 A;  4I56 A;  1YJU A;  4DR5 J;  4CH7 A;  1V9O A;  2L9N A;  4CLW A;  2C2R A;  1N33 F;  1NND A;  2I0X A;  1REG X;  2K2P A;  4DUY F;  1GTE A;  4OYZ A;  4A8W A;  3R2D J;  2IPO B;  3CCJ S;  4GVB A;  5B7W A;  2RSQ A;  4KIA A;  1LFW A;  1RAJ A;  1UEV A;  4I0W A;  3NGD A;  2JC0 A;  3R8Y A;  2HRY A;  4Y2I A;  1S1U A;  5KAK A;  2FLN A;  1IKX A;  1RWX B;  3IBF B;  4K0K J;  2AZ1 A;  2ZBR A;  4GKJ J;  1BWE A;  1BQN A;  2Z0G A;  3D28 A;  3B8H A;  3W60 A;  1VQ5 S;  2E1P A;  3BKF A;  3UD4 P;  5K20 B;  3IS9 B;  1EHW A;  4FBU A;  4FPR A;  4Y6I A;  3RBZ A;  1LFP A;  2KZM A;  3AOC A;  2MHE A;  2H5J B;  3GCW P;  3TX0 A;  3LAN A;  2NXE A;  2ZHB A;  1MMN A;  2NYH A;  4HHJ A;  3GJT B;  4Y00 A;  3UPF A;  2RQK A;  2BA9 A;  4AD6 A;  3ZO7 A;  1PCA A;  4EWT A;  2VC0 A;  2VPZ B;  4UQT A;  3QGH A;  3QJJ A;  5FDL B;  5A8R B;  4A46 A;  2FLO A;  2RAQ A;  3MUR P;  3U02 A;  1GK8 A;  1YSJ A;  2V8D A;  3M2V B;  4KGX B;  4AND A;  2QL9 B;  4FN5 A;  4YB5 A;  5IM0 B;  2ZH2 A;  4A8Q A;  4WZM A;  2ILZ A;  4NCG B;  7AT1 B;  4X66 F;  4DF4 A;  2J0Q D;  2HND A;  4IFY A;  4TQR A;  1YQH A;  2LQJ A;  1RT3 A;  2E5H A;  2V8H A;  2BJ7 A;  4N47 A;  5EDW A;  2PA3 A;  2BE9 B;  3R5B A;  4U95 A;  3OL8 A;  3H25 A;  2UVW A;  4QR2 A;  4ZHR A;  1FRI A;  1RAG B;  4DSF A;  1EQ0 A;  4F26 A;  2HVD A;  2HFO A;  2XI3 A;  4OV6 A;  5HAN A;  5HJX A;  3KK1 B;  4DV2 F;  4MFB A;  2FHK A;  4G65 A;  4M1K A;  1VBY A;  2XCP A;  4B3R F;  3NGT A;  3W65 A;  4DV0 J;  5GAD U;  4NLU A;  2ZM6 F;  4NLW A;  1KBR A;  1Q5V A;  3TO8 A;  4KPC A;  3P45 B;  3OR2 A;  3MAQ A;  1IJE B;  1JMT A;  2YTC A;  4F0M A;  2WSC C;  1ZH5 A;  2GMJ A;  1NH7 A;  4CDI A;  5J2Q A;  5EHH A;  1CJV A;  4DZ6 A;  3A3P B;  5CQG A;  3OJU A;  4DSK A;  5F3T A;  1PAU B;  4GO7 X;  2D41 A;  4MKV A;  3HHN B;  1SXL A;  2VOD A;  1VOM A;  3BPS P;  2D7S A;  2V9W A;  3FCV A;  4J7C A;  3GLJ A;  2KT5 A;  4OZJ A;  4ENO A;  3BSC A;  3OSN A;  4NXM J;  5H9F K;  1VQ4 S;  1JLB B;  3G6Y A;  2JVR A;  3KJQ B;  1SH3 A;  1Y3K A;  1I5O B;  5F8M A;  4A8M P;  3NMR A;  2AYM A;  2X1G A;  1VQ8 S;  3MM9 A;  3M2U A;  4DUZ F;  3VTI A;  3PX4 A;  1QAI A;  1BUX A;  1RTH A;  1R27 B;  1WC1 A;  2GV1 A;  1SJR A;  3DGP B;  4KAI A;  4ZPA A;  5DO2 A;  3RUB L;  1JLG B;  1GNK A;  1N0U A;  2NXN A;  2YNG B;  3H2V E;  3LW5 C;  2CQD A;  4MJK A;  4WXO A;  3TEH B;  1UPM B;  4RBU A;  5AJ3 F;  3FRY A;  1DLO A;  3CJT A;  3QWU A;  2DGX A;  5J1E B;  1REV B;  2DCL A;  1MRO B;  3QYY A;  2ZBP A;  4BWM A;  4CM2 A;  2BJE A;  3KNA A;  1KNZ A;  2H4W B;  2YKN A;  4C0O C;  2LDY A;  3D4J A;  1KOO A;  5IC4 B;  2PA8 D;  3CD5 A;  1FX4 A;  2AW0 A;  2E29 A;  1R7I A;  3PFE A;  4OX6 A;  3QAU A;  3WZ0 A;  1AZS B;  3MMJ A;  1RWN B;  2IVY A;  3IAM 9;  2ABY A;  1HQU A;  1QAY A;  1FDN A;  4TY9 A;  4UZC A;  5ETM A;  4RO0 A;  3RW7 A;  1PYS B;  2BJ8 A;  2B56 A;  2ZE2 A;  2V68 A;  4F4Z A;  3VCD A;  5HLF B;  4KSE B;  4OYA A;  2GML A;  3AD9 C;  1U02 A;  1ZBT A;  2KRR A;  3W9H A;  3TAR A;  2F7V A;  3TNV A;  5IM0 A;  4DFJ A;  4NLQ A;  3JTP A;  5ETV A;  1KVJ A;  3PFO A;  1S6P B;  3KG0 A;  2ACY A;  2HG4 A;  1Z2L A;  2CJ9 A;  1D09 B;  4F7V A;  3OLB A;  1FXR A;  4DU8 A;  2A10 A;  1YDL A;  2ZHA A;  4DV2 J;  3DRX A;  2HGM A;  4OZL A;  2A1B A;  2DNH A;  2PD1 A;  2RUS A;  1IR2 A;  4ER8 A;  4WK3 A;  4C3K A;  2CRL A;  3AJ2 A;  3EM1 A;  4DPW A;  4ED7 A;  1S79 A;  2DXE A;  1DTQ B;  3IN5 A;  3MPU B;  2JSX A;  2W8K A;  4B3S F;  4JI8 F;  2V0N A;  3HSG A;  1RB0 A;  1RHK B;  2Z2Y B;  3S6E A;  3BBB A;  2RJZ A;  3UD3 P;  1IWA A;  3FQK A;  3HT0 A;  4KJI A;  3VV2 B;  2DIV A;  3DCA A;  3R5D A;  4HVZ A;  3U1N A;  2MZJ A;  2UP1 A;  1HD0 A;  2GAH C;  3FSX A;  1N5Q A;  1U7L A;  2Z8Q A;  1NSK L;  1QTN B;  2RQ4 A;  1RWK B;  3E51 A;  3FCW A;  3KDO A;  1RBA A;  4CP5 A;  5A2Q U;  5KG4 A;  4IOB A;  2H1Y A;  2IYG A;  1ULR A;  2LA4 A;  4TQS A;  3GG0 A;  2NS1 B;  1NKB A;  5CHC B;  1HI8 A;  2EW9 A;  4O0N A;  4RW6 A;  5HQ8 A;  3BH7 B;  1S1W A;  1XNQ J;  3A8E A;  2CG8 A;  2MQQ A;  3CED A;  2KN4 A;  3D6M B;  4OI1 A;  5GAH U;  1VQ7 S;  5KFE A;  4AXI A;  3JS9 A;  3D1Q A;  3UVJ B;  3RRG A;  2WB1 D;  2QO3 A;  3J7Z 5;  2R42 A;  3TQE A;  3JYT A;  1TKT A;  3KHG A;  2FY1 A;  1JLF A;  4N8O A;  3IBW A;  3SQG A;  1D3W A;  1HWL A;  3N9U C;  1FO1 A;  3TWZ A;  5DDP C;  5GAE U;  4WCE Q;  4YOE A;  1RIS A;  4X4N A;  2VJU A;  4DSI A;  3CO9 A;  4J9K A;  3MUV P;  4ZLJ A;  2AJ2 A;  1TL7 B;  4NA3 A;  1PO6 A;  3QJP A;  4IH6 A;  3ZZP A;  1PBA A;  1U47 A;  4C3L A;  5FII A;  5A8R A;  3CTR A;  2XI2 A;  5AT1 B;  3H42 A;  1Y9O A;  3KWM A;  2BM0 A;  3QMQ A;  2IYI A;  1YI2 S;  4IH5 A;  2IM0 A;  3H8Y A;  1M5O C;  2M2B A;  3OL9 A;  1LWC B;  5ETT A;  1N34 F;  4J9M A;  3M8P A;  3BV8 A;  3M4X A;  3OFG A;  2PMZ D;  2RKI A;  3ZTQ A;  4OI3 A;  5LT5 A;  3D3C J;  3A8K A;  5EWG A;  2NRE A;  2VL1 A;  3BYP A;  3MR7 A;  2ZJP Q;  4FS1 A;  2UVV A;  2B5J B;  1F9E B;  4LT6 A;  4Q0B A;  2HQD A;  4LVN P;  2XWX A;  2VG5 B;  2ZH7 A;  1HYS B;  4H4K C;  4RUH A;  1FXD A;  2DGO A;  2V67 A;  4B08 A;  3N6N A;  2HHQ A;  2XWY A;  3MM7 A;  2CQ0 A;  4ZJO A;  1OY6 A;  3CJK A;  2FGC A;  3CJ5 A;  3TAM B;  4IR1 A;  1XMB A;  1A9N B;  2ZH9 A;  3E2E A;  3MEG B;  1WTF A;  2XHW A;  1R0C B;  5HQM A;  4K50 A;  2FVC A;  4PKD B;  4YR3 A;  4USM A;  2AJQ A;  2KU7 A;  2V2Z A;  3DRS B;  3RR7 A;  2XYP B;  1PC5 A;  2MKI A;  3W66 A;  1N32 F;  2DEJ A;  2YWH A;  4ZLN A;  4WWS A;  4IR9 A;  2UXB J;  1S57 A;  2V2K A;  2LCW A;  1CS4 A;  2E5I A;  3G2X A;  3O8W A;  5B0F A;  3KLF A;  3LAL A;  3RR8 A;  4Q8E A;  2D9O A;  2ZKT A;  3VAG A;  3A1Y G;  4OIX A;  1L3K A;  1GXU A;  1IBM F;  3PW5 A;  4ELT A;  2WHO A;  1X60 A;  3DGV A;  1F5C A;  4A47 A;  4DX5 A;  4OHX A;  4ZN1 A;  5CAB A;  4WZQ A;  4IDK B;  3GJR B;  5AXK A;  4N8N A;  4OYI A;  3QRP A;  1VQO S;  4I4B A;  1VR6 A;  2AKW B;  3G86 A;  2HVE A;  5E3C A;  5K8N A;  1QVG R;  4LFC J;  3BZQ A;  2GC8 A;  2XTJ P;  1S1V A;  2GVD B;  4RWX A;  2C3M A;  1NK7 A;  4DHV A;  2B8P A;  3CJ3 A;  4WYL A;  4F4A A;  4QPX A;  2GCF A;  2XY7 A;  2CNO B;  2GO8 A;  1OPI A;  4ZA1 A;  1W25 A;  2V2V A;  1J2V A;  4DV6 F;  4OX9 J;  2B6A B;  5HMY A;  4JV2 A;  3T1H J;  5DG7 A;  2G9O A;  2QLW A;  3UVJ A;  3R5G A;  2BW7 A;  3NGU A;  4A8S A;  1SC3 B;  1Q8I A;  4Y3C A;  2NCK L;  1N5S A;  4DR3 F;  1S9F A;  2IMW P;  4O44 A;  4LF4 F;  1RBL A;  2C2K B;  5ADZ A;  1NK4 A;  3MDF A;  3N6L A;  4ZS6 A;  2MZ1 A;  4M8L A;  2OFG X;  2HHH J;  2OH2 A;  2X1F A;  5C2C A;  2GGP B;  3W9J A;  1TKX B;  3LA0 A;  2WON B;  2KJW A;  3POT B;  5D0G A;  2BZ2 A;  4LF6 F;  4A8F A;  3NCQ A;  4GC7 A;  1G1X A;  3IP0 A;  4OZ5 A;  4F0H A;  2HIY A;  4UUW A;  4R5P A;  3K5O A;  5KFP A;  4Z7C A;  1YIT S;  2NYI A;  3NL0 A;  3D0H E;  3P96 A;  1HQE B;  1GQE A;  1PYO B;  1KFD A;  2W9C A;  4HL9 A;  5K9F A;  5K14 A;  1QD1 A;  1WHW A;  2X3D A;  2XMK A;  1DRZ A;  3DHW C;  3IRX B;  5KT6 A;  2XLI A;  3KYL A;  2FJX A;  1FJG J;  1CJK A;  4C9D A;  3D6F B;  4Q43 A;  1RA7 A;  2DR7 A;  2L08 A;  4USV A;  3H20 A;  1H38 A;  2FYX A;  5IC6 B;  3R2C J;  2XMJ A;  3A8J A;  1OQ3 A;  3M05 A;  1JQG A;  3NAI A;  5G4D A;  2YX7 A;  3JQJ A;  7FD1 A;  5LJ5 Y;  1J5E J;  4TYB A;  1BQM B;  3DM2 B;  1YJR A;  3F0N A;  3SBM A;  3U1M A;  1QE1 A;  2MXY A;  2VDH A;  1LWC A;  1T3N A;  3UDE A;  3I31 A;  5HAO A;  2OPS A;  2UUC J;  2HWI A;  4NXN J;  2XLK A;  2PFF B;  3KLI A;  2OPR A;  3BKU A;  2LEA A;  1C2P A;  1Y10 A;  2CZ4 A;  1UJ4 A;  2M8D B;  2DY9 A;  3IG1 A;  1QSY A;  4WU2 A;  3PX6 A;  3PW4 A;  3OBI A;  3D68 A;  4NCB A;  3MM6 A;  4PR6 A;  4ZP6 A;  4E2F B;  3UFC X;  3M8Q B;  5JJB A;  4H4M B;  3RBX A;  8RUC A;  2EK1 A;  1IBL J;  1R6Y A;  3IO1 A;  2PFD A;  1HD1 A;  3KUH A;  2HZV A;  2GQ2 A;  3DMJ B;  1TL4 A;  4L76 A;  4DV1 J;  1L3U A;  2M8H A;  4YY3 F;  3JSM A;  1CJT A;  3M1V A;  4PYA A;  4K4X A;  2XZT B;  2HQG A;  3PIP Q;  3DOL A;  5DJB A;  3THP A;  2KM8 B;  1RAA B;  2HHS A;  3F73 A;  1HBM B;  2W7P A;  2D3O R;  2Q6C A;  4W98 A;  1SKR A;  1IBK F;  4LQ9 A;  1RTH B;  1HI0 P;  1URN A;  2XMT A;  4BWJ A;  4BC7 A;  1F3V A;  4OJG A;  4X64 F;  2B51 A;  3ULH A;  3LGM A;  4YS2 A;  4DQQ A;  3NNH A;  4PQU A;  3EJM A;  3HHK A;  2HLT A;  2RF2 B;  4Y2M A;  3CDU A;  2Z57 B;  3IM9 A;  4LFA J;  3KLF B;  4WFX A;  3KLE B;  2HBY B;  4FDF A;  3K5N A;  1NK8 A;  2NLW A;  2ATL A;  1MWY A;  2B9W A;  5MLC V;  4IRC A;  2FJV A;  3D0G E;  2OEK A;  3NCR A;  3NLC A;  2L3M A;  4U67 Q;  1WC5 A;  2HQF A;  5L1L A;  4DSE A;  1TK5 A;  3FFI B;  3W1Y C;  2VA3 A;  3PY8 A;  4W90 B;  3CDE A;  1TEL A;  1GXT A;  3GIJ A;  2FHJ D;  3HZE A;  5DGB A;  4DFM A;  4Y0F A;  3TI0 A;  4IFV B;  1MW7 A;  2QV6 A;  4JI7 F;  2FC8 A;  2B4U A;  3EGV A;  1S1V B;  2GVD A;  3PYE A;  2FZC B;  5J2M B;  2AYG A;  4F36 A;  1JLE A;  1ZYQ A;  4DN0 A;  4EK2 A;  3CJ4 A;  1FDB A;  1UKU A;  2MQN A;  1U1O A;  3ISZ A;  1M5S A;  2BJ3 A;  3V6D A;  2DRD A;  4V19 J;  4AQY F;  4NLG A;  2R8H A;  5D4L A;  1N8R T;  1IKV B;  4OZN A;  5HBM B;  3EMT A;  4K4S A;  4DQS A;  3AA8 A;  1F9F A;  4Y28 C;  2ZH6 A;  4DS5 A;  1RI7 A;  3IS9 A;  3K58 A;  4XPC A;  4ZMM A;  1NZA A;  3B54 A;  1P9Q C;  2Z58 B;  3I0S B;  3I9Z A;  2AJ0 A;  4FXW A;  2RB7 A;  1NEE A;  2XMW A;  4HAC A;  2GIF A;  4DR4 J;  4PXD A;  1RAC B;  2ATC B;  5IV4 A;  4ZCM A;  1HMV A;  2SXL A;  3I4H X;  4H54 A;  3J7Y U;  4O3N A;  4R25 A;  3MOJ B;  1WC6 A;  3N0V A;  4B3M F;  3LAM A;  4USI A;  4C11 A;  2RQM A;  5K8P A;  3TAP A;  2ZDO A;  1C1C A;  3Q89 A;  3RBE A;  1VC5 A;  3NRB A;  1PBU A;  2G2O A;  3FGV A;  4OI4 A;  4XTT A;  3PKY A;  1KD1 T;  1DBD A;  3EZU A;  2HFU A;  3L4B C;  5I42 B;  1S72 S;  4O3P A;  3UNY A;  1TVR B;  3DHX A;  1S5Z A;  1LOU A;  3IR6 B;  3L7U A;  5D4P A;  3SCK E;  5A6P A;  1VC6 A;  1XR5 A;  2MZQ A;  4IFY B;  3T19 A;  4M5D A;  4RL1 A;  3RYL A;  3UI3 A;  4ED4 A;  4XO0 A;  5JVG Q;  1CJK B;  4RNO A;  3FNN A;  1UWA A;  3J7A N;  4FF1 A;  2YY3 A;  4ZPV R;  3U7J A;  5LMU J;  2QA2 A;  3K5M A;  4ED8 A;  2HVI A;  4LVO P;  5CYJ A;  1H7X A;  3SYZ A;  2CPZ A;  4U96 A;  2BKO A;  3MMB B;  4ANC A;  4ZPD A;  5DG9 A;  1OIA A;  1LK5 A;  2PT0 A;  3BO3 A;  3C14 B;  4LQ3 A;  3JQK A;  5IS2 A;  5D0E A;  2R7Q A;  4PWD A;  2CQP A;  4LSL A;  5C5J A;  3C2P A;  1X9W A;  1WNE A;  1LXN A;  3M30 A;  3M8P B;  1M5H A;  2E5G A;  3DN9 A;  3MPD A;  4OLO A;  3AD7 C;  1YIJ S;  1GMV A;  2RIL A;  4X4P A;  4HEA 9;  3MMA B;  3CIM A;  1ZOT A;  2UXB F;  1DY3 A;  3FCH A;  3CC2 S;  2MLZ A;  3BRE A;  4OHV A;  3OTC A;  2Z2Z A;  2ILY A;  5DLG A;  3H4D A;  1DHM A;  3L95 X;  4C8Y A;  3QT5 A;  5FJ4 A;  1SI9 A;  1X7V A;  1HHS A;  3I87 A;  2GJI A;  3PYF A;  4F04 B;  5AXN A;  2XGP A;  3DC2 A;  3EGW B;  5E3Q A;  5G0R B;  2XNR A;  4OQJ A;  4KHP J;  5F9N A;  5IOL A;  3H90 A;  2K7K A;  4LFB J;  3QIP A;  3PKM A;  2OIH A;  2UXD J;  1JLA A;  3FBC A;  5E3A A;  1AUD A;  2GX8 A;  1X9M A;  5L9X A;  4I64 A;  2HK2 A;  1ZAW A;  3EYZ A;  2VH7 A;  1U0S A;  1ZTW A;  2B5J A;  2DT9 A;  5KT5 A;  2DNZ A;  3I56 S;  2MKH A;  2YNF B;  4YUD A;  2KT3 A;  3MAH A;  4ZKA A;  2CVE A;  1S4F A;  4I2P A;  1NO8 A;  2VPY B;  5HQL A;  4RW7 A;  1VS3 A;  2OLW A;  2AWZ A;  2RE1 A;  3CMQ A;  3MF5 A;  3IXQ A;  4HTI A;  4HTJ A;  5CXT A;  2HZA A;  1V5I B;  4PYD A;  1Q8K A;  2HS4 A;  4R8U A;  3KFW X;  2FVP A;  1FE0 A;  1M1H A;  1EJ7 L;  2X1A A;  3OXL A;  1LEO A;  1WWH A;  4UOC A;  3CCE S;  3RB3 A;  2DH9 A;  2H65 B;  3ILO A;  3MEG A;  4K5S A;  2YWG A;  1YBU A;  4WXW A;  5D0R A;  3PW0 A;  4DEZ A;  5I3U B;  2DNG A;  2MPU A;  1IVZ A;  5HVF A;  5J2N B;  3FSI A;  3MUT P;  3MCN A;  4ZCK A;  5B0E A;  1VFJ A;  1KDN A;  2XMV A;  2FGO A;  2C28 A;  1MN7 A;  2IM2 A;  2JH3 A;  3AA9 A;  3ETM A;  3KOA A;  4RKU C;  3ONQ A;  5J2Q B;  1HI1 A;  1TMJ A;  2MQM A;  1B99 A;  2POK A;  3B6B A;  4NAS A;  4ES1 A;  3PO5 A;  2NQP A;  3GON A;  3NGR A;  2O67 A;  4F0K A;  1WSV A;  2B9E A;  1RHU B;  2ASD A;  2FD2 A;  3JSR A;  2LXI A;  2HNY B;  2OAU A;  4CI0 B;  1CPZ A;  1OSD A;  1NLK L;  3KG4 A;  1Q79 A;  2DRA A;  2LQ9 A;  2EFO A;  5HRO B;  1XR7 A;  1C4C A;  2ROE A;  3VF0 B;  2R7S A;  2Z30 B;  5A2Q Y;  4RX6 A;  3TA2 A;  1JJ2 R;  1VRQ C;  1GTH A;  5BXI A;  2QE5 A;  1WEZ A;  4A8K A;  4MT1 A;  3AQO A;  4ILR A;  4XIU A;  2FJA B;  2E7V A;  1G6B A;  1IXK A;  3SCI E;  2ZE2 B;  3BQ1 A;  1KR4 A;  1HNV B;  3OHA A;  3JTO A;  4PXE A;  5J1N A;  3QPI A;  2Q66 A;  4P2F A;  3EPI A;  1VIO A;  1REV A;  4ZP8 A;  3SEO A;  2WVB A;  3MAA A;  4OHW A;  4RNF A;  5IQ6 A;  1F5B A;  1ZA1 B;  3J7A 1;  1U48 A;  2R7X A;  1TL3 A;  4ZCL A;  3IGV A;  2I38 A;  3P5T L;  3R9L A;  3V5R A;  1JIH A;  1JJH A;  1XN9 A;  4Y65 A;  4X4S A;  2W9C B;  5B0B A;  2AGQ A;  2B3T B;  3MR3 A;  3LF0 A;  2CQI A;  2OD6 A;  4ZDN A;  4MKA A;  1TL5 A;  3PVX A;  4AL6 A;  2XMM A;  4DR2 J;  1X0F A;  2RRN A;  2NXJ A;  4DI6 A;  1SJ1 A;  2A2D A;  4C7Q A;  2CKW A;  2DNN A;  2V34 A;  1VBK A;  3POT A;  2GNK A;  2JJ4 D;  3M2V A;  3SFU A;  2DJW A;  4KGV B;  3ZZR A;  2CJX B;  1K44 A;  3K5P A;  3C14 A;  2KXF A;  4KHR A;  3UE2 A;  3TUZ C;  4YHH J;  4KY3 A;  2W9A A;  4ED6 A;  1YHQ S;  3GYG A;  5L1J A;  4M5K A;  3MFH A;  3W64 A;  2BBE A;  1YK9 A;  1AW0 A;  2JEI A;  1RTI B; 
#chains in the Genus database with same CATH homology
 3BBC A;  3JS9 A;  2CWK A;  3DKD A;  2DXF A;  1BHN A;  2HUR A;  3EE3 A;  3VGS A;  3MPD A;  1PKU A;  3EVW A;  3VGT A;  2HVD A;  1UCN A;  1ZS6 A;  3DDI A;  1PAE X;  3NGT A;  3GPA A;  3ENA A;  4KPC A;  2DY9 A;  1HIY A;  2DYA A;  5IOL A;  1NDP A;  3Q8Y A;  1NPK A;  1WKK A;  3ZTQ A;  4ANE A;  4DZ6 A;  3FBC A;  2VU5 A;  5C7P A;  3VVT A;  3FBE A;  3FCV A;  4FKY A;  4ENO A;  3Q86 A;  4UOF A;  4UOG A;  1NB2 A;  1XQI A;  1NCL A;  3Q8V A;  3ZTS A;  1XIQ A;  4W98 A;  2AZ3 A;  3GP9 A;  1BUX A;  1LEO A;  3PJ9 A;  3FC9 A;  4ANC A;  1S59 A;  1W7W A;  3EJM A;  4WBF A;  1NSP A;  1BE4 A;  1KDN A;  2B8Q A;  1MN7 A;  3ZTP A;  3ETM A;  4FKX A;  4UOH A;  3Q8U A;  1NDL A;  4DUT A;  3B6B A;  1B99 A;  1S57 A;  3VVU A;  1NDK A;  3G2X A;  3EVO A;  3NGR A;  1WKL A;  4C6A A;  5CAA A;  2BX6 A;  1U8W A;  1F6T A;  1HHQ A;  3WX8 A;  5CAB A;  1NLK L;  4F36 A;  3ZTR A;  4EK2 A;  1HLW A;  2HVE A;  3PRV A;  1NDC A;  5BXI A;  3VGV A;  1VYA A;  3EMT A;  3ZTO A;  2B8P A;  4F4A A;  3BBF A;  3FKB A;  3B54 A;  3Q83 A;  2AZ1 A;  3NGS A;  3NGU A;  3R9L A;  3EM1 A;  1EHW A;  2NCK L;  2DXE A;  1WKJ A;  3VGU A;  1LWX A;  3EVM A;  1NSQ A;  1F3F A;  3Q89 A;  3BBB A;  1JXV A;  3ELH A;  3FBF A;  1NUE A;  3L7U A;  1S5Z A;  1B4S A;  4HR2 A;  4DI6 A;  3FCW A;  1NSK L;  1MN9 A;  4CP5 A;  1K44 A;  2DXD A;  1NHK L;  4AND A;  4S0M A;  3FBB A;  4O0N A;  3EIC A;  3BH7 B;  2ZUA A;  3BH6 B;  2BEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...