3GP9A

Crystal structure of the mimivirus ndk complexed with gdp
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
133
structure length
133
Chain Sequence
b'AGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
total genus 43
structure length 133
sequence length 133
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2009-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3gp9A00
4UOHA 4UOFA 3Q89A 1WKLA 1UCNA 3FCWA 4EK2A 1XQIA 2CWKA 3PJ9A 2DXDA 1S5ZA 1S59A 3BBFA 4DUTA 2ZUAA 1B4SA 1BHNA 3G2XA 3WX8A 3VGTA 1EHWA 3FBEA 3PRVA 2B8QA 1BE4A 1F6TA 3EICA 4DZ6A 3NGTA 3ZTPA 3Q8YA 3B6BA 3EVOA 1NDKA 1HIYA 5BXIA 1B99A 4ANDA 2DY9A 4ANCA 3BBBA 4DI6A 1NPKA 1S57A 3ZTQA 4FKXA 1HLWA 1ZS6A 2DXEA 1PAEX 3JS9A 4O0NA 4WBFA 3ZTOA 4UOGA 3ETMA 5C7PA 3EVMA 3Q8VA 3ZTSA 3FBFA 2DYAA 2AZ3A 1NB2A 1F3FA 1NSPA 1NCLA 1HHQA 3VGUA 3L7UA 1JXVA 3ZTRA 1NDPA 3Q8UA 1VYAA 3FKBA 3ENAA 2AZ1A 3NGRA 4HR2A 3FC9A 1NDLA 1KDNA 2VU5A 1XIQA 1LWXA 3FBCA 1LEOA 1W7WA 4S0MA 4F36A 1BUXA 3EJMA 3DDIA 3EVWA 4C6AA 1NSKL 3VVUA 4W98A 3BBCA 1NDCA 1WKKA 3VGVA 4CP5A 2HVDA 2NCKL 2HVEA 3GP9A 1NLKL 2B8PA 2BX6A 3FBBA 4KPCA 4ENOA 3BH6B 5CAAA 1MN7A 2DXFA 2HURA 3B54A 3FCVA 3NGUA 1NHKL 3MPDA 1WKJA 1PKUA 3VGSA 1MN9A 3EM1A 3EE3A 2BEFA 3ELHA 3Q86A 3DKDA 1K44A 3EMTA 5IOLA 3Q83A 1U8WA 4F4AA 5CABA 4ANEA 1NSQA 3R9LA 3NGSA 3VVTA 1NUEA 4FKYA 3GPAA 3BH7B
chains in the Genus database with same CATH superfamily
2HLTA 5D15A 4ZVPB 3TEGA 3QJJA 1GEHA 1AUDA 1UWAA 4NE9C 2JL9A 2JFDA 1VDHA 1U6BA 3TARA 3KJQB 3GFHA 3F56A 3MHYA 2J0QD 1FT8A 2EK1A 3EGVA 4DI6A 4X64F 3R6GB 2AV5A 4DXLA 2QN6B 1EX8A 2QL7B 3A3OB 2OMLA 2F8EX 2UVVA 4X2BA 2ZJRQ 2XTJP 2QA4G 2FHJD 1R8PA 5KT5A 1K9MT 4JI4F 1P6TA 2ZNYA 3GV7B 3D28A 4M5MA 1EQMA 1Q8LA 3H20A 1JLBA 1TL3A 3LP1B 2DHAA 4JV0A 4HDGA 5AT1B 2BM0A 1F0XA 3IAM9 3P45B 3MMBB 2HNYA 3WDOA 3T5KA 2UUCJ 1HW9A 2E7VA 1HMVB 1VQPS 3DXBA 2VFUA 3PNIA 2JEIA 3UW1A 2I9SA 2PEHA 1Q5YA 1OQ3A 1NK9A 1HARA 1AFIA 1L3TA 4ZA1A 1V3RA 2YKPA 3L9ZA 3CCTA 3SSSA 3MM9A 3KLHA 1TTHB 4JV2A 3AT1B 1B64A 2BJDA 2GIFA 3HXMA 2VKZG 5LSOA 2IM3A 4MK8A 1JB0C 4BWJA 7AT1B 1REVB 4WFYA 1RWKB 1PC4A 4DX5A 4LR8A 4DV5J 1IJFB 3OTCA 4YHHJ 2YQ1A 5DO2A 2K3IA 2YVSA 3PDNA 3SSQA 4X4TA 2AYBA 2FVPA 1U1NA 2P9GA 5KFLA 3W63A 2ZBCA 1TV6B 3Q24A 1HD0A 2RDJA 5K8OA 3DNCA 1LFPA 2MZRA 3GFZA 2C28A 4Y6IA 3LTOA 3US5A 2K2PA 1FE0A 2A2CA 4DG1B 1KRPA 1T8EA 3I6PA 3QT6A 2FDNA 4TNOA 4X4NA 1WHYA 5KFRA 3DM2B 3O5TB 2CAJA 3OSPA 4B08A 2W2PP 2W24A 2LMIA 4JI0J 5JMNA 4QIEA 1M5SA 1RT5A 3QIDA 4DSEA 4DR4F 2K8GA 3GYGA 3MTJA 2F4VJ 4K4ZA 5IWAF 3FKBA 1H74A 2FVQA 2DGSA 4OJGA 4QR2A 2KYXA 3I87A 1MMNA 1TELA 3AB2B 1RHQB 1IQTA 4P7VA 2DGQA 3MMBA 1TP7A 5D4NA 1LWXA 3GONA 2Q43A 4DV7F 2EPIA 4RBVA 2ZH8A 2HVEA 2FZKB 5KFQA 1TUWA 3C15B 3AB4B 1WC4A 3JTOA 1RAEB 3BF4A 3Q8PB 2DY1A 2YQ0A 1RWOB 1GTHA 1G6BA 3N4WA 3CT9A 3PY8A 1K1QA 1B7FA 2YKMB 4OX8A 2XMKA 3EGNA 1NZAA 3RYLA 4RW8B 3KJVA 3MPVA 3P5TL 2MGZA 4H4KA 5DRKA 4C3MA 1UPPA 4ANCA 4CLWA 3QT8A 3S6EA 1RT3B 4ZKAA 4OZ1A 4MH8A 4MT1A 1DTTA 4UOGA 5K14B 3D3BJ 3Q8VA 1QUVA 4Q2LA 1R8CA 3BQ0A 1ELOA 1I1GA 1VQOS 5IT9Y 1ZM2A 2GVDB 4ZPAA 2KDOA 1FTCA 3M9OB 3KJNB 4YP3A 4P6QA 4C6AA 1H6KX 5G0RB 1YQHA 5C25A 3X3UA 2HAFA 3QJLA 1C0UB 2DNZA 5CH7B 1EKRA 4XAKA 4DWIA 1H98A 5THWA 1Z4UA 3HHLC 1KD1T 2HSEB 1OQ6A 2CQ0A 4ID5B 4UY8T 5F8MA 4LQ9A 1FK9A 3TWZA 1TKXA 3D68A 2B9EA 4ZCKA 1IBLF 1GXTA 2EEYA 1WC5A 4P2XA 2WAQD 2QRRA 1QDUB 4XIUA 4V19X 1NSQA 2R7SA 1YX2A 5CZVA 3R7BB 2IDLA 4K2JA 1QAJA 1UTAA 3LP2B 4R5PA 2HGLA 4PXCA 4MIBA 1HI0P 3N79A 3IR5B 3GIJA 1FRLA 5ETSA 1F5CA 1D9AA 4ZVTB 4CYUA 4R25A 1SJ3P 3V2UC 1PAEX 4K2XA 4L75A 1UJ5A 2VD3A 2YNFB 3C15A 1IKYA 1PBAA 2M4MA 1RKIA 3BGRA 5B0AA 1WHVA 3ZFVA 4ICLB 4I6AA 4X62F 4RUHA 5LSLA 3J81U 3MPYA 3FDSA 1OJ4A 1CJTB 4AFFA 2VG6A 3MMCA 4Z2XA 2V6AA 4FPRA 2GQCA 3TVYA 2OD6A 2DB1A 2ZM6F 4CNYA 2WRMA 4DL4A 3M1VB 2YKMA 3GP9A 3GWCA 4J91A 3TO8A 5AJ3J 3LO3A 4RW8A 2RF2B 4AQYJ 3FCVA 1AYEA 1VQKS 2PT0A 2FHMA 3FFIB 5FLXY 2VOOA 4DV1F 2WBMA 3IC1A 2YKOA 1RT3A 4BWMA 4OYOA 3W65A 1TVRA 2ASLA 3GCWP 2BDPA 3IS9B 2ZZNA 3PIPQ 2AWZA 4CM0A 3D2WA 2AX1A 3AJ2A 1WKLA 1SH2A 1RWXB 3H42A 1R0BG 3PW5A 4MAKA 3OFGA 3BKUA 2R7OA 3LAKA 3L09A 2KHCA 3BR9A 2DR8A 1C0UA 3CJ8A 2X3GA 1TUVA 2CQ3A 1Y7PA 4FVMA 4WU2A 3KHGA 2VFTA 1WNEA 2WONA 3LW5C 1YI2S 3TVKA 2HNZB 1RLCL 4CDIA 1I51B 4MFBB 3NGRA 1KHVA 4LF2A 4ILMA 1BY9A 3BO4A 4UT4A 4JI2J 2NSCA 4FYWB 4JP8A 4F36A 2IVFB 5I42B 5CYJA 2RQKA 1VQ9S 5KFEA 2GZOA 5B0BA 4IG0B 4ED0A 5E3CA 4M5HA 3C16B 3GQCA 4UF4A 4J90A 3UDLA 3NMRA 1U1PA 2CQ2A 2O67A 1TKDA 3DLHA 4NI2A 4DFJA 4DV4J 3CCZA 2WBRA 2HHPA 1QE1B 1ULRA 1RTJB 1GXLA 2GO8A 2G0CA 2HQCA 5DQHA 3SZ2A 4TQRA 1T11A 1DURA 3PRVA 5LOQA 3MZIA 4RZRA 2BMBA 2HQDA 4LRCA 4NYPA 4ICLA 3TQ1A 1FRKA 5KFIA 4NA1A 1RWWB 1HQ2A 5HMZA 3DDNA 2HGMA 3M2VB 3UR0A 2XS2A 4NLDA 3HSJA 2Y3YA 5D4LA 2MLZA 3DLEB 1SH3A 2RF2A 4LF7F 1RI7A 1RB0A 5HROA 3L7OA 1AZSB 5DJBA 2R2UA 3D6FB 1FE4A 4LBIA 5EWGA 3UO0A 2MHNA 3TZWA 2GO9A 2ZH4A 1AT1B 1KVJA 2OPSB 3TUIC 5EHHA 4U7CA 2HVIA 2B6AB 1ROFA 2VASA 4ED2A 2LFVA 1L3KA 5I3PA 1NKCA 4CLPA 4PPZA 4RW7B 2O66A 4L3KA 2ZBPA 2C3MA 4CO5A 1MU2B 4LSNB 3CCRS 1A9NB 2DHXA 3KK1B 2ZKUA 2IM2A 4NLVA 3NY0A 4C8NA 1B3TA 3QSIA 1IVZA 2HWHA 1X9MA 1R3NA 1K0TA 2IA0A 2ATCB 2UVRA 2QSFA 1S1XB 1RT1B 3ENQA 5BR8J 4ECVA 1CEZA 4Q7AA 1VQSA 4NLGA 2N4CA 4FKXA 3MCNA 3D1HA 3R7SB 2GGPB 1U8SA 5FJ4A 2DYAA 1OY6A 5GAGU 3MWBA 3HO1A 5SZTA 2MMYA 1UJ6A 2B9WA 2LXIA 4S0MA 4ZP8A 1RWMB 5KFSA 3PYEA 1RU1A 1X5OA 5BYQA 5GADU 4WK1A 1WHWA 1UKUA 1KFSA 5B7WA 1TL1B 3B54A 3SBMA 4ED6A 1RISA 4FYYB 4OJ3A 4NXMF 2ZZMA 3TI0A 3RUBL 2VQFF 3F41A 3DLEA 2WHOA 4CT8A 4WFZA 3GSDA 4GVLA 5E41A 1GMUA 1N34F 2E1RA 2B9XA 2RS2A 2LQBA 4OI1A 3M8ZA 4ZN3A 2DT9A 3R1HA 2JOQA 1FKOB 1EJ7L 3MR2A 3DRPB 3NGTA 4EO6A 4PXEA 2EKYA 3V6HA 2CNLB 1XNRF 1XNQF 2WVFA 2VICA 1WTFA 2E5GA 2I38A 4RW7A 3OVAA 1NSPA 3HHEA 1VYAA 2DR7A 4X84A 4M1KA 4NCAA 2MQ8A 5L8RC 4UUXA 3QSYB 1GTEA 5DZ7A 3R8YA 4TYBA 9RUBA 3KG1A 4ECQA 2W2OP 4A8KA 1ZETA 2IA6A 1RK8A 4GKKF 2W1BA 5ETPA 1BMQB 3DYAA 1H2VZ 1I6JA 1VRTB 1BXNA 1O6XA 1EP4B 3ZC4A 4DR6F 5LMNF 2HS4A 4C11A 2D3UA 4ES3A 3OJSA 4FZVA 3QYYA 2R2TA 5HLFB 1HNVB 2IY5B 3FBEA 5AXNA 4P2FA 2PA8D 1NDKA 2AD9A 4CI0B 4ZJQA 2GQ2A 1TAUA 2RRNA 2RU3A 4OV6A 3R2CJ 2X3DA 3M8PA 5EDWA 3GLJA 3JSBA 2IM0A 2HMIA 2Z56B 3H90A 2I5JB 1S9EA 4PXDA 3AD7C 4JYAF 2FC9A 2UVWA 4ZPVR 1XMOF 1S10A 3HVWA 3PFOA 4TLQA 3CIMA 4YB1P 1BC6A 2OPQB 2GS8A 1H73A 5KTQA 3CCQS 2DRDA 3AFGA 3M32B 2AJ0A 4HHUA 1XN9A 1ZM9A 3KG4A 1FCAA 4ZVOB 3KLFA 3R5BA 2NXJA 3W9IA 1FDAA 1KQKA 2WCXA 1TL7A 5A6WA 1EETB 1DQ9A 1JJHA 1S59A 2HRUA 3OL8A 4UW2A 3PW2A 1NH7A 1HWJA 1FRIA 1BGXT 1RA7A 3BDEA 3CO0P 2IBKA 2RDDA 1KQSR 3TA2A 4DX8H 1Y3JA 2MZSA 2XMAA 3QQCD 1F2HA 2QIFA 1S7IA 3THTA 3ISND 2ALZA 2V9KA 3I0RB 3FBCA 5J2PA 4M94A 2AW0A 1RBAA 2XEXA 3K2YA 4FF2A 2E7WA 4O44A 1AA1B 1P1LA 3VAIA 4QIGA 4Y3CA 5H9FJ 4USKA 3DLLQ 5KG0A 2OEJA 2B4VA 4C8ZA 4RL1A 3THPA 4I2PB 2MJUA 2QTWA 3C46A 1ZTTA 3CULA 3P5BP 1RWNB 3WC2A 4LF4F 4FKYA 1SB6A 1TZ0A 2CQGA 4UTGA 1YHQS 4EK2A 2IJFA 2BE9B 1T9XA 2HGNA 3T41A 2W9BA 4DLEA 4DZ6A 4AL7A 3OSNA 2GHWA 4KHMA 3V81B 4OYIA 3TJAA 4ETXA 3ZO7A 2MDAA 2ROGA 2MY7A 2P9EA 2EFQA 4HH0A 3BV8A 2OPQA 3MCOA 4GKJJ 1QJHA 3NG8A 3M32A 4YHHF 1JXVA 4XK8C 3S8SA 4QJVA 1Z2LA 1YJWS 3QGPA 2R7XA 3PTWA 2XLKA 5HJYA 1WC0A 1FHTA 2VDHA 3TEHB 3PVXA 1URNA 2I1RA 3AD9C 1KWMA 4K4WA 4NEYA 2B8PA 4WYLA 5KFKA 1HD1A 2MTLA 2YX1A 4O23A 1ITPA 1S1VA 3TQEA 2C2DA 2DH9A 1S4EA 3GE9A 1FXLA 2F8HA 4LFBJ 4MKBA 1Z2ZA 2YKQA 2KVIA 3RAQA 1CS4B 5T7LB 5L38A 3TAMB 4B02A 1S97A 4ZLNA 2RQ4A 4ALZA 1O0PA 1TL4A 1AB8A 1KTVA 4I1TA 4MKYA 2ZDPA 4H4OA 4USIA 2F4VF 4NYZA 2FTRA 3HULA 4G3IA 2VPYB 5EUHA 3HHLA 2V9WA 3BB5A 3HFVA 2E1MC 2WB1D 5IQ6A 2FY8A 1RTDB 3P4UB 2CPHA 3PFEA 3EXYA 4F4YA 1HW8A 3D0IE 1ZAWA 2J9DE 1NKEA 3EXCX 2VG7B 2EWHA 1KLNA 2VHGA 4RU9A 3AD8C 3LA0A 1NHUA 1Y5IB 5KFDA 1M0SA 1XMQJ 1S76D 2DR9A 5KFXA 1VBZA 4TXSA 4B3MF 4GC6A 5JVHQ 2VBXA 3M8QA 4CTAA 5CXTA 1TU0B 2MY8A 3H4BA 2FUG9 1RWUA 3OR1B 2CVIA 5M2RA 4DZDA 2HS3A 1A7GE 2V2KA 4K50A 3QLHB 4UOFA 1D09B 4HH1A 4N76A 3BBFA 3RB3A 5ADZA 2DGVA 3WIUA 3HVRA 2NR0A 2JZ5A 3R5AA 1KS2A 1VQ6S 3CCWA 2HFZA 2RDIA 3VZIA 3GMGA 5HP1A 2EFGA 2ZVSA 3QFWA 3VR1A 5ETNA 4QR1A 2G0IA 4LSLA 2CFXA 4W92B 2ABYA 2XB2D 2UXDF 4XDDA 3CMAS 1UEUA 4USUA 2P8IA 5E7OB 1J5EF 1ZBTA 1IR1A 2LXFA 3GJTB 2CYYA 4KPCA 1FF2A 2AJ4A 4KKOA 4O4RA 2CZVC 3KLVA 5F8LA 1Y00A 2BJ3A 2JHEA 4RW4A 3MOJB 1JLQA 3MEKA 3TJ9A 5KFVA 2GVZB 4BC7A 5D0GA 2ZH6A 4TLRA 2F4FA 2VJUA 3NNCA 2IHR1 1IM4A 3AOCA 2OKQA 3J7YI 3CWJA 4DSIA 4IFVB 1JKHB 1N88A 5EN1A 1IWGA 1HKAA 3CD6S 4OIXA 5J1EB 4O3QA 3CD5A 4U7UK 3EWGA 2FZGB 3H5XA 2QLJB 3CCUS 2KFNA 5L39A 1N32F 2RKIA 1GMWD 4N8NA 5GAEU 4I6WA 4BCAA 5D3GA 4Q45A 1FXDA 1PILA 1ZZNA 5HBMB 4FBUA 4PPDA 4PAAA 2LQJA 5AJ3F 3O8WA 5CD4A 2X1AA 3V6DA 3VAMA 2A18A 3J80Y 4RBUA 3BSAA 2WOMB 4F0MA 1HBMA 3QLHA 3FK4A 2BUNA 1IR2A 2V0NA 3HD1A 1D8ZA 2YWWA 1RHUB 4KH1B 1SIZA 5IV4A 1MWZA 3DGPB 2HHQA 4USVA 4C2MA 1CC7A 2EBGA 1V3ZA 2HIQA 4JV1A 1ZAXA 3LQVA 2Q3PA 1D3WA 2A10A 5I4MA 2D3ZA 1RCXB 2HFNA 4F3MA 3CJTA 2UUTA 3T1HF 2BRKA 3CF5Q 3BKTA 2ERRA 3DLKA 4Q5VA 2F9DA 3PO4A 2K7JA 2PEBA 3IFEA 4PZVA 5A2QU 4TYAA 2BZ2A 3K5NA 1TR0A 2LEBA 4P10A 3DOMA 3C6TA 3UCUP 4N5SA 4ECSA 1FWPA 2ROEA 1D9DA 2G1DA 3BO2A 3X1LB 3NNHA 4C0HA 4B3SJ 1PAUB 4JI2F 2MZJA 3ETMA 2VG5A 1ZAVA 2FQQB 4UQGA 1FRXA 2LDYA 3FMBA 3K57A 3I32A 1KFDA 1FFSB 5T41A 1WC1A 3FC9A 4D3HA 5EGYA 2QGFB 5E3PA 4EBDA 3EGZA 1JLEA 2KM8B 1VHFA 2R7QA 1JLCB 2YWGA 1RQ0A 4CH1A 3RR7A 4DV4F 4LBHA 2H5IB 3CIZA 1CG2A 2L9NA 3LH2S 2IMWP 1JKHA 2AU0A 4DFPA 4YY3J 1FI4A 3DHXA 4OZLA 3POTA 3CD7A 4ZP6A 3P3DA 4JI5J 2HZCA 3TX8A 2DVIA 3N01A 2BEFA 1Q53A 3GIRA 1DARA 5IT9U 2VFRA 2DEJA 1VQ5S 1YWXA 2ASJA 2XG8A 4P2SA 4CLTA 2JFKA 2HBRB 3BSOA 1WEYA 1OIAA 2NZ4A 3M8WA 4FXDA 1HIYA 2WOMA 3SDEB 3PJWA 2AHOB 2LA4A 2K7KA 1GH8A 2IFXA 3L95X 4LRAA 3CC7S 3M2RB 1R0AB 3ENVA 4P74A 2MHEA 3NAIA 3KLGB 4KHPJ 4RUAA 2MJNA 1YTYA 2NSBA 1G3OA 5MLCV 4ZCLA 2MZQA 4AL5A 2BJ9A 1X4BA 1WG5A 2H4YB 3I4HX 1UETA 1YZ6A 4RUCA 2HHHJ 3TW0A 2KJWA 4Y2CA 3EPIA 3D6MB 1RTHA 1FDDA 3I82A 1VC6A 4K0KJ 1DLOB 4DV0J 3MEEB 4B3OB 2E9RX 2DCLA 3TOQA 3OFHA 2RB7A 2AEJA 5D0HA 3AA9A 1HQUA 5J1NA 4DR5J 2LCWA 4YOEA 2BW2A 2KZZA 5DDPC 2E29A 4OI3A 3IXQA 4NZ0A 5KG7A 1ZM3A 4WKYA 1IM6A 5IM0B 4L73A 4IO1A 2EG2A 3HI9A 2E1AA 4GVBA 3CJQA 4X64J 2A0FB 2Z2LA 5H9EJ 1YBAA 5FLXU 1FDNA 3TR5A 2CUYA 3ULHA 2LLZA 1SC1B 4MYTA 4NZ6A 4DL7A 5IZHA 2RD5C 3M8YA 2ATLA 3L7UA 3MAAB 2MB0B 4AUKA 3CDUA 2DNNA 2BXJA 4ECYA 2IJNA 4Q0BA 4EZ9A 4JI4J 2SXLA 4ECZA 5KFHA 3KK3B 2CZ4A 2CQHA 4KGXB 4KQZA 2J9DA 2HIYA 1WI6A 3A8EA 2R8HA 1KOHA 3T19A 4MTPA 3M4XA 4IR9A 1Q86T 2FD2A 4RW6B 2C3YA 1X8DA 3AXKA 3HFZB 3TYTA 4WIIA 2B4PA 4QPXA 3UD3P 4QQBA 2U2FA 1YVFA 3KLGA 1R43A 2R4FA 3ZZOA 2KFYA 4ZDNA 4P52A 5ITHA 4PEOA 1X4AA 1QY7A 5BJRA 5DM7Q 1G7CB 1BWEA 3K89A 1HYSB 3ZTPA 1CVJA 4GMKA 1Q16B 2G1HA 4P7TA 4HYKA 1P1TA 1FRJA 2FJWA 2RH3A 2NXUA 2B5JA 2OFGX 2UV8A 1NDPA 4K8RA 2AZ1A 2OGUA 3C19A 3PO5A 4QPTA 3OVSA 2CJQA 2V2QA 2XNRA 5C24A 2J7WA 3I55S 1D9FA 4R0EA 2NXCA 2O01C 1MROA 3D67A 2KH9A 5IM0A 4ZHRA 2PN6A 2DGWA 2RJZA 5CHCB 2JLGA 1T9YA 1MNEA 2C2MB 3UPFA 4PYAA 3RGIA 3MMAA 3JQMA 4LVOP 3IM8A 2UP1A 1IBKF 1S6PA 2HBQB 1SKSA 2VA2A 3KMQA 1RT2B 5IOLA 4GRSA 1BQNA 3R9LA 3VVTA 4OYWA 3MAAA 5IT0A 1NNDA 4DN9A 2AMCB 1T3NA 1B4SA 5DQGA 4B3TJ 4QBUA 3G87A 4FBTA 4KPYA 2I2YA 2XULA 1CJUB 1R6VA 2DNMA 3TUJC 1SJFA 4IRDA 4HL9A 1PYSB 5JVGQ 1WF0A 2VONA 2V69A 1RT4A 3JB9k 5LL6d 3CUNA 5KT7A 4DV2J 1UPMB 2CJKA 3D66A 5IWAJ 1UA0A 4O0IA 3GIKA 1VC0A 1RGVA 2M9KA 2KT3A 4CLFA 3QGGA 1YJNS 2PFFB 1JMTA 5DDQC 5KOXA 4DV7J 2E44A 4NMLA 4USHA 2OSRA 4HT7A 4QWEA 3Q8QB 4M63A 2UUWA 5HMYA 3R3TA 2QZ8A 1NK8A 3ILIA 1HBNB 1GX6A 3MECA 5ETOA 2QA1A 1OSDA 4I64A 4OHXA 4G1QB 1F2GA 4OZ0A 3G6ES 3HX9A 2FYXA 1CJVB 3RBXA 5AXKA 4B9SA 2BJEA 2PA3A 5A6PA 2HK2A 2AX0A 4QW9A 2I0XA 3H0PA 3GFXA 1OY9A 3PXGa 1JLAA 2AT1B 5ETMA 1RAJA 4X4RA 4AD6A 3CJSA 4LMZA 2DD8S 1HLWA 3M05A 4O0NA 1VLOA 2BACA 1RT6A 2IRXA 3OL7A 1LV5A 4HT5A 3K5OA 4DPXA 3BPSP 3G4SS 1HFEL 4LRDA 4GC7A 3T5JA 2ZC3A 5LSRA 4Q8EA 2HHUA 1SL2A 3G8QA 1SCJB 3KLEA 2DO0A 2QEXS 2CNNB 1PJ7A 1IBLJ 2H3EB 4TU8A 4U67Q 4I56A 1DTQB 3ADAC 3BZQA 3R5JB 4NCGA 5T14A 3BSCA 3I5CA 3QZ7A 4B3RJ 4M95A 1KR4A 2B51A 4Q8FA 4MKVA 3VGTA 1S1WA 1SC6A 3C6UB 3IWNC 3G8TA 3V4IA 3A1YG 3RAMA 1VHIA 1H7XA 3HJFA 2O3DA 4ZPCA 1HBNA 1EQ0A 1LWCB 2BANB 1LXNA 3W2VA 5HATA 4IKAA 3CDWA 1VLYA 3M9NB 3BR8A 3PX4A 3HVTB 1RYSA 1NU4A 2LKZA 2XI3A 2ZM6J 3MXHP 3EVWA 2HVZA 4IH7A 2YNGA 1QAIA 3ITHA 4Y28C 2DPJA 2BJ7A 2D41A 1LNQA 1S72S 2IAJA 1T9UA 2W7AA 2W01A 4F4XA 2D9PA 2BQRA 3W3SA 3KUHA 1N5QA 1OSCA 1Y4ZB 4NCBA 4Y2KA 1F3VA 2HZAA 4IDKA 3OUYA 1C1CB 4NLPA 2ZD1B 4J9PA 4PUOB 2A6MA 1PBUA 2XNQA 3QGHA 5DGAA 1EIYB 4XDCA 1WI8A 6AT1B 2L48A 9ATCB 4M5NA 3PJ9A 1F9EB 2VKRA 1BWVA 2E7XA 3NP5A 1V5VA 1PG5B 3SEOA 3GJSB 3W2WA 5A8RA 4IRCA 5SUHA 3PM9A 4HACB 5C7PA 2DNOA 2RQMA 5DDRC 1XMQF 4CZCA 3J7Z5 1FNMA 2OPPB 2L9DA 1S9GB 5KFGA 2MZ1A 4PKDB 5CYQA 3OBIA 4DFKA 2V4RA 2J6TA 1U0HB 1VR6A 4DSFA 3HHKA 5AE2A 3MM5B 2CIMA 1WACA 2VIHA 2GJIA 4QR0A 1SC4B 2U1AA 4RNOA 1HPZA 1PSDA 3GV8B 5EWFA 4RR5A 1KN6A 2DNHA 2C1EB 1RT7B 3NRBA 1KVIA 4JUZA 1HNIB 3DLGB 1U8WA 4USWA 3EDRB 4ED5A 3E51A 4IR1A 3ICLA 1SPBP 5MAOA 2E5IA 3O6QA 3VAFA 3GJQB 4ANDA 3RRGA 5EX3A 5DLGA 2B9YA 2N82B 2F8MA 1U1KA 2FGOA 4O3PA 2LXUA 1RKJA 4M5LA 4MYUA 2MQOA 4AXJA 2ZNZA 1G4CA 1X0PA 4BLGA 1KDNA 2PI5A 4KY3A 1PJ6A 3ENWA 2ZFHA 2DCUB 4PUOA 2ZVIA 1F60B 3LPYA 3W5XA 2KTQA 2ZKTA 5ETLA 3JSMA 1LWFB 3CCLS 5KT6A 3G86A 4WTOB 4ECUA 4PWDA 2AEFA 3FBBA 4NASA 4P73A 1IKVB 4Z7YA 4ZLLA 3NNAA 4ZOSA 2HS0A 4L76A 4OFZA 1MN9A 4IYQA 3R5DA 4A8SA 3KOAA 5C2GA 4F4AA 4QWCA 4CH7A 4Y2IA 2YKNB 1CQNA 1QAYA 1NM2A 2CVEA 1U24A 1TL5A 2M52A 2E66A 3SFGA 2DNQA 1NZ8A 4DEZA 2FC8A 4X4PA 1T03A 2Q6CA 1HBUB 1R0CB 4QYZJ 3MR3A 5LMUJ 3HT3A 5GAHI 2OHDA 4F0HA 4ETZA 2V8DA 1NPRA 5I3UA 4WP8A 3DOKB 3ET6A 5ETKA 2ZBRA 1X4DA 3I5BA 2BABA 2HEKA 3HF5A 4LR9A 1HNIA 2X1GA 2WSCC 3HZEA 1FJ7A 1WHXA 1FFWB 4TKTA 5L9XA 4M5JA 2DIVA 4H4MB 1A0OB 5B0EA 4OYMA 2YNHA 3VQSA 2WVDA 3PZPA 2UUAJ 2VQFJ 4OI0A 4HEA9 1VGYA 2R42A 3DKDA 3OTBA 4G65A 2HBZB 2RAQA 3DOLA 3T9NA 1N34J 4ZCIA 2CDRB 1DQ8A 4QIWD 2UUBF 5KT3A 4DDFA 4P9SA 1KBRA 3QIPB 4E8UA 5GADI 2Z0GA 4B3SF 4PQUB 1ZPVA 6FD1A 3MEDB 5IC4B 1XR6A 3G2XA 3FSIA 4USJC 2EC2A 4WXOA 3N5FA 1XNRJ 4G1IA 5KAKA 2QG9B 1VIOA 3OW2R 4C0OC 4MK7A 3MURP 1X4CA 2F9JA 1Y9OA 2YBVA 4A8XA 3EYZA 2XMWA 4F67A 2J76E 2HFVA 3MR6A 1GMVA 3GG1A 3UD4P 3A8IA 4YY3F 1S48A 1IKWA 2XCPA 3D9BA 1BLUA 1S0VA 2FHJA 4GKKJ 1VJQA 4W4MA 1NJXA 1B70B 5CA5A 5CAAA 4KV8A 1SJ4P 3D54A 2E1CA 1B7YB 5D4OA 4CNZA 1SI9A 4LREA 1JLBB 3HMJG 3EGWB 3OFFA 2DJWA 3TA0A 4YFUA 5KG5A 3CCES 4Y0FA 3LPEA 2HG4A 2Z2MA 4L6V3 2HNYB 4LFAJ 2CWKA 5L1LA 1FVQA 1EKSA 3SYZA 3Q8SB 4KHPF 3UE2A 3A13A 3K8WA 2OFHX 2CQDA 2EW9A 5E33A 3CEDA 4K4TA 2AZ3A 2BV3A 3MM9B 1HHQA 4DU7A 2VQEF 3KLHB 5DG7A 3SSRA 4RNFA 1F9HA 4EMDA 1RDRA 3DDIA 2FGCA 2FLNA 2IIHA 5J2MA 3CCVS 1N6QB 2XCAA 3T3FA 1T05A 2YX7A 4X65F 2XY7A 4PRFA 3AHPA 2P6TA 4ENOA 3AQPA 1N8RT 1NO8A 3QRRA 3MR7A 3NL0A 2AYGA 5ETQA 4YEAA 2DH7A 4F4KA 1DBDA 2HQGA 1YBUA 3ILOA 3S7RA 1C0TA 1X0FA 3IA0A 2BBEA 3W9JA 3SI8A 2H54B 3UN2A 1ZTWA 2VA3A 2XMVA 4DSJA 4OYPA 3FNNA 1NK0A 1NAQA 1U1MA 2XYHB 3H40A 1YZ7A 2MEWA 2D7SA 3WX4A 4O3SA 1VQYA 4X4SA 2DITA 4DR1F 2WK4A 3VQTA 3Q0AA 1UFWA 4HR2A 1RT5B 4CH0S 1M5PC 5DGBA 1W7WA 3BN4A 4BBYA 5J2QB 2EFPA 2P5VA 3VVUA 5F3ZA 1YK9A 4NWBA 2VOPA 4Q43A 2DNYA 1FA0A 5KFOA 1S12A 3W8GA 1FJEB 1SQEA 1CULA 3CJ2A 4OX6A 4LF9F 3OLBA 4LF4J 2KXHA 5U47A 4I4BA 3U1NA 5CABA 4ANEA 4MK9A 3NXZA 1TKZA 3NLCA 2W2QP 4FN5A 1V5IB 3A4TA 5D78A 4V19J 5LJ5Y 1N6QA 3KJVB 4NLTA 2MGZB 1ICEB 3QMQA 1SL0A 2IMOA 5LXYA 3BREA 4MIAA 1XJWB 3SMZA 2PO4A 5KFBA 2FLPA 1DTTB 4B9MA 1K8AT 4JI8J 4F50A 3GB0A 4A4JA 5F9LA 3NAHA 4LR7A 1CSJA 3L7PA 4W98A 3EZOA 2ZITA 1OYDA 3BEGB 2K06A 3BGLA 2XM3A 5JJBA 4ES1A 5C25B 2GFFA 3FGVA 2APOA 3WBZA 3PCOB 3PHEA 3RBZA 1G1XA 4DQIA 3AOBA 1FK9B 1TKXB 1M1GA 4B3TF 5AXMA 2FHKA 3NGSA 3G6YA 4LQ3A 4ZK7M 3UCGA 4FF4A 1DY3A 2QLWA 2QA4S 1Q7LB 2AKWB 2QLBB 2PMWA 4DV2F 1G2EA 3CJ5A 1Q5VA 3TUPA 5J2QA 2IRYA 3OQ2A 1L5UA 4R5PB 2N3LA 4FYVB 2J6SA 4CYUB 4LF6F 2N7YA 4TQSA 3Q2TC 3EZ5A 1IKYB 5DS7A 3K59A 5F9NA 4K4UA 2R7WA 3BGRB 2YWEA 2XSJA 3F44A 2ZHAA 4RUBA 3KKFA 4DF8A 1CQMA 1QTMA 2VG6B 2BKOA 2ZDOA 1VOMA 3MMCB 4B3MJ 1WSRA 3TJ8A 1NK7A 3HPOA 1A6LA 1ZM4A 2MKCA 2RRBA 2GJ2A 2X1BA 1W25A 4NLRA 1OYEA 2RHSB 4P2MA 4ED1A 1YRTA 1JJ2R 1CC8A 1TVRB 4UOHA 1WOPA 3D6HB 2IVMA 2ZC4A 2QA2A 3MDFA 1U4BA 4ER8A 3IBWA 5H1SV 4ZCMA 1GFWB 4F3OA 3VHQA 3T1YF 2ZBQA 1JJ4A 4KGKA 4QOTA 1K0VA 4YB7A 4LUBA 4OQJA 3MM7A 2DXEA 2YPYA 4PABA 3RZAA 4DLGA 3DDKA 1QSLA 5F8IA 2XO7A 4WE1A 2UXDJ 2WONB 4DL6A 4RW9A 2ZH5A 2YXLA 5A8WB 1J5EJ 4M5KA 3QRQA 2R8KA 2DBBA 4MIWA 1RJJA 2ALYB 1BQMA 3HLUA 2V8VA 1YBTA 3IGNA 3V6KA 1S6OA 2QJ3A 3TA1A 1C1BB 3KNGA 2JH3A 5ETRA 4B3RF 3JSRA 4NYOA 3UFCX 1CJKA 1T9WA 4X4QA 4DS5A 1KOOA 3PR4A 1CPZA 3OFEA 4NI2B 5F0WA 4ATNA 5HMXA 4PYDA 1T94A 1ZYQA 3DGVA 3GCXP 3W7BA 1S4FA 1YJRA 2W2NP 4OYBA 2ZH7A 1U09A 4FYDA 1EHWA 1SKWA 4FPIA 2DNPA 2FVRA 2XHWA 4ILLA 3KHRA 4LIWA 2AF6A 5D4PA 5FDLA 1N32J 4J9UE 2CJBA 4U8VA 4C8OA 1P9YA 1GX5A 3DRRA 4DL3A 3ONQA 5HROB 2WVBA 2C2KB 4CWBA 2HWIA 4CLZA 1OY8A 3BDPA 4ZVEA 4ZITA 3N5BA 2GV1A 2DR6A 2BX6A 2B3TB 2BJ8A 1N5YA 4LF5F 4FXVA 3MEGA 5GAEI 2ACMA 4HI1A 3C2PA 4F7VA 3OTOF 3T1HJ 4KGVB 4GO7X 2H5EA 2MKIA 1QAXA 2QMWA 3GIIA 2QL5B 2GNKA 3ZZ0A 1JJCB 1K47A 3WX8A 1JLGA 5A8WA 3BGFA 1L3SA 2QV6A 4F25A 7FD1A 1N36F 3GZ7A 2Z58B 1WC6A 3QO9A 1S57A 2LVWA 3S1TA 4F4WA 2YQ3A 2YNIA 1HNWF 4DPWA 1M1HA 4CLKA 1IBMJ 4UQTA 3CVKA 3BGOP 1C1BA 2HVHA 3JSYA 1VK3A 2C22A 4KO0A 4U6PA 1H72C 4DMZA 5K8MA 1APSA 4DQSA 2GHVC 1KONA 4JI3J 4KAIA 2NYHA 5IXUA 1LW2A 2C3UA 2G4BA 2F63A 2N7CA 2JC0A 2R2SA 3M6UA 2Q6BA 4F02A 4BHQA 1L3UA 3WHIA 1X5PA 4M5GA 3HD2A 4J9LA 2E9ZA 1RADB 4J9MA 2R8JA 2PD1A 2POKA 3MF5A 3VAHA 3KTQA 1U2CA 1E6VA 3NS5A 2XZWA 1QSSA 1W2IA 4ZJLA 1ZZFA 2IC3B 2CDQA 3KWMA 5F8JA 4CCHA 3DRXA 2PIIA 1XR5A 3RR8A 2Z30B 4U96A 1S77D 5A0YA 3U7JA 3FRYA 5HQLA 1S0MA 2LQ8A 3C14B 1NB2A 3ZTRA 4F2RA 2HQIA 4OHWA 4I67A 2H65B 4LJMA 2W9AA 5H9FK 4WYWA 2AGQA 4QW8A 4IOBA 1BUXA 1YSJA 4J5OA 2V50A 3JYTA 1WUUA 2KL8A 2W9CB 3IR7B 3E01A 3H98A 3I0SA 5IS2A 3NBPA 2GCFA 4NRUA 1LW0A 3SQGA 2EFNA 1NHVA 3UR3C 3T1AA 2I6WA 4R8UB 4PG7A 5ETVA 4A8OA 4DV6J 3KG0A 1QUPA 2MLYA 1XBWA 2BQUA 1PJ5A 2QT7A 3DYAB 3SQOP 5LMUF 2GAHC 4I7FA 2LQ5A 2G9OA 2RUGA 1R31A 4C11B 2WTFA 3LGNA 1KLMA 5E5NA 4UUWA 5KFYA 2Z2ZA 3SCIE 4I2QA 5A76A 1FKPA 1RYRA 1S7HA 3SV4A 4UZBA 2DIUA 2MPUA 5B0FA 2ZE2A 2FIUA 3QT5A 4OYZA 3M8PB 1T7PA 1YDLA 3PW0A 5BYRA 2HMIB 3DLBA 2OI2A 1QTNB 1S9EB 1RHJB 1F5AA 4CRJA 2M0GB 2EBEA 1NMEB 1D8YA 2UUAF 2RSQA 3CJ3A 4KBIA 1NJZA 1U26A 2IC3A 2AJ1A 2JVOA 3A3NB 3D3CJ 4TY9A 1TKTA 4DR7F 3DFEA 1ACMB 1NRKA 1DZ5A 3QWUA 1SIWB 2COLA 2CRLA 3ELHA 1PYOB 3FQKA 5DQIA 2A2DA 1U1LA 3C14A 2KT5A 1XTZA 3CGIA 3W60A 3FVYA 3KLFB 4AYBD 3W5ZA 2M2BA 1S1UA 1K73T 3CMQA 1C4CA 1TL7B 2FVSA 2NREA 2B7CB 5CYMB 1PIEA 1RLDA 4DSLA 1N5VA 2CJYB 3KLIB 3M6XA 2OH2A 3JAMU 3AH6A 1B0PA 2W9CA 3VAGA 3DXSX 1VK8A 5E3AA 3AJ1A 3FBFA 1KQFB 3CJ0A 3MM8B 2D9OA 1NKBA 2QLXA 5KFNA 4DOZA 5A8KB 3OT9A 4IG3A 2RRAA 1FXRA 4R8UA 2XY6A 1U2FA 3KFWX 3ZZPA 2E5HA 4CM2A 3OTEA 5KFZA 4ZS6A 1B0TA 1X4EA 2MZTA 3MI7X 4X4VA 2J6UA 1V6HA 3ETOA 5KFPA 3I31A 1BD6A 4A8MP 4A48A 4NLXA 5LM7E 3W9HA 1T9VA 5J2PB 4N8OA 3MPWA 1VRUA 4DCOB 1U02A 3K5LA 3MM6A 4LFAF 4RX6A 3HSDA 4O44B 1IBKJ 4C8LA 2PMZD 2OSQA 3T6BA 2QLFB 1SL1A 3Q86A 4A8WA 2VFSA 4QWDA 2HRTA 3HCXA 4DUTA 4YR2A 4QCLA 4ZN1A 4XO0A 4U8YA 1NK5A 3CSKA 4KSEB 3UN3A 2RNEA 3J7AN 1DQAA 2DISA 4J37A 4F2SA 1IUJA 1TFWA 3DHWC 1S0NA 1LK7A 2W9BB 4ZP9A 2O5DA 3N6LA 2OPRA 1RAGB 1N0UA 1WOOA 4C48A 5C42A 2J0WA 4F26A 1F3FA 3BS9A 3Q8UA 1KKHA 3ZZZA 2D69A 2G2OA 4O3RA 2V8GA 4WF9Q 1Y10A 4C4WA 3GILA 2XMJA 4ZPBA 2VUGA 3HHDA 3H5YA 1S1TA 1LOUA 4N56A 3QATA 1UJ4A 3CCJS 3A12A 3PEHA 5M2UA 4AL6A 3IBFB 4C3LA 1SJQA 5EX0A 5CYMA 2FJXA 2UU9F 3KLIA 4NA3A 3M30A 2XS5A 1R6YA 3RU0A 3TAQA 2HAIA 1S1VB 2FHOB 3EUNA 1SUQA 3MM8A 4HTJA 1REGX 4CT9A 2UXCJ 1FRMA 3TNVA 5A8KA 3QAEA 2AIRB 2CADA 3DRSA 5D0RA 3CC2S 4J9VA 4OX9F 4NLWA 3OTDA 3ILLA 3OHBA 3EICA 2DTJA 4LT6A 4K4XA 3DMJA 1KQGB 1MMDA 4H4OB 2M70A 3JS9A 4WBFA 4HLBA 1HNZJ 2V67A 3HHLB 1WELA 4Y34A 4ZIWA 3OR2A 5JUMA 2EFOA 2V4JB 3TZYA 1YGYA 1RWPB 1FX2A 2CQCA 2MKYA 4NZ7A 1UWBA 2MSSA 1UA1A 2JVRA 3IO1A 1LWEA 1NH8A 2CNKB 4NXNF 4C8KA 4M5DA 3PR5B 2B56A 4DV3J 2RE1A 3HSGA 2K1RA 2ZOGA 3HVAA 4DR2J 5L1JA 4DF4A 4KRWA 1M5KC 1OO0B 3M8QB 3DC2A 4CTAB 3R97A 1UVNA 2EC0A 1MW7A 4W90B 3N9UC 2HLUA 5B0DA 2Y0BB 4K5SA 2H1YA 5AE3A 2BYCA 1EAYC 2YX4A 1E6YA 4JI8F 1NPKA 3V4MA 1VBKA 3CPWR 2YWHA 1X4HA 2R7VA 1U1QA 4B9VA 4J9NA 3AOAA 3CB4A 5HP1B 4LFCF 2GW8A 1AXQA 5LJ3Y 1U7LA 6FDRA 1NDLA 1P8GA 2GX8A 4OI2A 1XIQA 2VJVA 1SQGA 2W7PA 4LSLB 1S6QA 2Z4PA 2ZOMA 4XTTA 3M6WA 4QIFA 2CPEA 4CO3A 4WPAA 1IKXA 2XMMA 3M7VA 2VFVA 3G71S 4TN2A 1UEVA 2OELA 4J9SA 2D74B 4FF1A 3I9ZA 3KUEA 1J27A 3ZNJ1 1UL3A 2A6OA 1HBOA 1MSWD 1M1KT 4KKOB 4MMOA 4IFYB 4YUDA 1K44A 2MSTA 3PV8A 4E98A 4RW4B 1JLQB 1RXOB 3QNWB 2W25A 3GPAA 4LBPA 2CPIA 3NS7B 1N33J 2ZZTA 3JQKA 2V4JA 3DI6B 1N5SA 4WFBQ 2C2OB 4Q2MA 1ZH5A 2E5LJ 1Y5NB 5HVGA 3BN7A 2XLIA 3PJXA 4MKAA 1FFGB 1Q1KA 3BPDA 1H3DA 3H4DA 2GMLA 1Z1ZA 4YR0A 2L9WA 2RKIB 1GMWA 3HP6A 4B9LA 4HKQA 5D3GB 2MQMA 2VH7A 1Q8KA 3IM9A 3LP1A 3V6DB 3LUYA 2Z57B 4RKUC 1R8AA 4ZPWR 1HBMB 2J9EA 2RHQB 4ZVQB 1HMVA 4EWTA 1FESA 4RJVA 5A2QY 3SCJE 1KVKA 1DHMA 4I69A 1M5OC 1DFDA 4HVZA 4JV5F 3HT0A 4DCPB 5H9EK 3IBCB 2GIRA 2RT3A 3PRBA 3H2UB 3HJVA 2MXYA 2Y1RI 2AEMA 3DLKB 2ZEJA 2D3O1 1I5OB 2ZH9A 3DOMB 4Y2MA 3W61A 3C6TB 5HSPA 1Y5LB 4ELUA 2QYGA 2KN4A 1WDDA 4OX7A 1REVA 2DO4A 3NKYA 2VG5B 3E8OA 4IFYA 2UXBJ 1I94J 2DNRA 4K4VA 2CWXA 1YLXA 4P71A 1Q78A 3W5YA 1MLAA 1RACB 3GJRB 1JLEB 1TV6A 5GMEA 2E1PA 1NLKL 3DI6A 3ZZYA 1QVGR 2H48B 1J2VA 4EYHB 3G8SA 1GAOA 2NS1B 4DG1A 3H5SA 2BW7A 3B8HA 8RUCA 3EM1A 3VAKA 1U0SA 4IH5A 4ZMMA 3NWRA 3POTB 2CQIA 2NXEA 2ADCA 4OL8A 4B9UA 1YJ9S 2BM1A 3BSNA 3DM2A 3CD0A 3W66A 5HQ8A 3MD3A 2VBWA 4Y65A 1BHNA 4FDFA 3TVZA 2YPZA 3BKFA 4OZNA 2XWYA 2G2YA 1IR0A 1VS3A 4OYXA 1FEHA 2AP6A 2GC8A 1YJUA 3BGUA 3TAPA 1F5BA 3PX6A 1GNKA 2JJ4D 3D6TB 2EXUA 4E2FB 1YJVA 5J1PA 4QIVA 4OI4A 4ES2A 3HDSA 1HR0F 1RWVB 3OVBA 4FNIA 4OLOA 2ASDA 4YN3B 2HURA 1KHWA 4ED8A 2HYIB 1RTHB 4I6YA 4C8YA 4DUYF 8AT1B 1NBEB 3MMJA 2V2ZA 3VZHA 2PDAA 3Q8RB 3EE3A 1EARA 4ZVFA 3D4JA 2LP4A 2UUBJ 3BH7B 4IUFA 1HQUB 1MWQA 1HA1A 4NEZA 3B4MA 1Q79A 3GTYX 3T9ZA 2G13A 4DBQA 1IBMF 2JSXA 1IBCB 5K14A 4KC5A 1KNZA 2MQNA 3BBBA 2VB6A 5KOWA 4GVBB 1RAOA 2WSFC 3MCSA 2GVDA 4JI3F 3IWXA 1UEKA 3I9V9 3MOZA 2VC1A 3E3XA 3I4PA 5G0RA 2G2ZA 4ELTA 2XWXA 2QMXA 1VQ8S 4OLPA 2JEJA 4ID5A 4Q0BB 3IWLA 1Q81T 1TK8A 2V4QA 3KHLA 4ZIVA 5CD4H 1C2PA 3OJUA 3CDBA 1VFJA 2GJFA 2DHSA 4DHVA 2L3MA 4FYXB 2N3OA 3LP2A 3LP0B 3DN9A 2OUGA 1N52B 2HFUA 2VL1A 2CPYA 1WWHA 3S01A 4CIOA 4JOUA 2BQ3A 2CJXB 1S5ZA 2KXFA 4J7CA 2F5GA 3C8YA 4NRTA 2YNFA 2VODA 4O3NA 3ZTQA 2AQ4A 4EBCA 5D0EA 3NCQA 2YWFA 4KGMA 4X66J 2M3DA 2VQEJ 1CJTA 1HQEB 2XSFA 2ZWPA 5DG8A 3W62A 2XMTA 2BE2B 2B5JB 2ZBIA 4WIQA 4ED7A 1WF1A 3A3PB 3M1VA 1U45A 2GHPA 2UV8G 1UP1A 3M8SA 1D0EA 4KGZB 1UZHA 4U7UD 1JNRB 2RMLA 2NUUG 4X65J 4ZVUB 3FFIA 1UVLA 4DV6F 2VZ9A 1UFKA 2E9TA 5C24B 1RBLA 4RPFA 5IV3A 2CPJA 3NGUA 3IS9A 2WZ1A 1Q8BA 1MROB 1M5HA 3DLJA 4ZHRB 4PCQA 4KR0B 3PEJA 2JNJA 4IQXA 3SIPB 3I5AA 3MMAB 3VCDA 2RU9A 3QT7A 2R9LA 3D1QA 2L08A 1S6PB 2JEFA 5GAHU 2WVCA 2DXDA 3MPUB 1BQNB 3NEKA 4FXWA 3W8PA 2GMHA 2HNZA 2DNGA 3D0HE 4JI1J 4MFBA 4DR1J 4TU9A 4BDPA 3CC4S 1QVFR 5DM6Q 1RT4B 3CE8A 1XC9A 5I42A 2PFDA 2VU5A 1QM9A 4FS1A 5KFWA 3LP0A 4B9NA 4IG0A 2ILYA 2QO3A 2YWKA 2D3OR 3C16A 5KFAA 3LWMA 2C2NA 4N41A 2ZH3A 2MLXA 4ZVGA 1QE1A 4WTYA 3T5HA 1RBOB 3RG6A 1RTJA 3TX0A 4DFMA 3MECB 4B9TA 3FUYA 4PQAA 3O3LA 4LF9J 4YMEA 4RO0A 2BR0A 1FKAF 3TZXA 1MMLA 3D1OA 1EB0A 2XLJA 2V94A 1HQEA 4WKRA 4CO1A 1U6ZA 2YKAA 2BE2A 3M2VA 5GVQA 2MKSA 4DSKA 1K1SA 2IYGA 4LVNP 2MKHA 2R2RA 5F8NA 4OMFG 3GR1A 1AZSA 1JLAB 3NOCA 2VPZB 2OEMA 2RIJA 1BQXA 1QD1A 3CDEA 1NCLA 2B4UA 4JI7F 4XPEA 2OPSA 2B6AA 5LXRA 2EKNA 4Z7CA 2HKEA 3OPKA 1SJ1A 1RT6B 3LANA 3B78A 2DGUA 2Y1IA 4HDHA 2DGXA 4DX6A 4J9OA 1H0HB 3DCAA 2C2EA 2QC3A 2LDIA 1MU2A 4LSNA 4DR3F 4JI6J 3KLEB 3KK1A 2KM8C 4C7QA 3RRHA 4DL2A 4IOCQ 3GU0A 5GMDA 5KT2A 2HHTA 2FB0A 3NOGA 1S1XA 2KXNB 1RT1A 2XHCA 2C42A 3WQPA 1VBXA 2WB4A 5DLFA 2AJQA 2FVCA 2HFOA 5E2QA 2OIHA 4NCGB 5KFUA 4HI2A 2RVJA 2M88A 2C2ZB 3Q8YA 2F65A 2GGPA 1X31C 1Q0NA 1NJYA 1KP6A 2YY3A 1S1WB 3V4IB 2HHWA 1UMJA 4LF6J 3EDQB 2FJEB 3R7NB 4A47A 5KFTA 3RAXA 3W2VB 1VMBA 4RNNA 4ZVHA 4D3GA 2F40A 5AE1A 1CLFA 1DRZA 4TVAB 1TL1A 4FNHA 3VV2B 4N47A 4NLQA 3BYRA 2ZUGA 2BJ1A 4WFXA 1OWXA 1WG1A 2ACYA 1SKUB 3C3LA 2YNGB 3ITHB 2UXCF 2HNDB 2IAJB 1F9FA 2XYPB 3VGSA 3ZZRA 4OZ2A 3RRKA 4C3KA 2MQPA 2M5YA 3BQ2A 4QYZK 4N7TA 1UVMA 4B17A 1O8BA 1LKZA 5KFCA 3OLAA 4IDKB 4ED3A 1FKOA 3OUYB 2P9CA 3DRPA 3JQJA 3KYLA 4IRKA 3T1YJ 1HNZF 2GIQA 1R8BA 3CMES 4YB6A 1FJGJ 4NLYA 2R7UA 5LT5A 4KE5A 5F3TA 2FJBB 3W2WB 5A8RB 1ZA1B 1FNXH 3MAQA 1HHSA 2IBOA 1YIJS 1M90T 4DV3F 3QAUA 1T02A 3MR5A 2C2RA 2ZJQQ 2QFJA 4DR2F 2JWNA 5CYQB 2OD4A 3IRXB 4ECWA 1TMJA 1AFJA 1VRTA 1F1BB 4ERDA 1EP4A 2HZVA 2W4PA 3KJFB 2LU1A 4WWSA 4DCJB 3UDVA 1PC5A 1HPZB 3F73A 1H2UX 3EMTA 5HLFA 1HNVA 2UUCF 3A8JA 3Q89A 4CO2A 2QFIA 2HHXA 1RSCA 2KRRA 2B8QA 3OXGA 4CLUA 1HWIA 4NLUA 2R8GA 4E0DA 4G1PA 2CJ9A 4FF3A 5HN0A 2I5JA 3CJKB 3D0GE 3CO9A 1FRHA 3OV7A 4WXWA 4ED4A 3MGJA 5HVHA 2Y9HA 2HNDA 4WCEQ 4IOAQ 1U6FA 1U2RA 3UWTA 3UCZP 2G0JA 4DV5F 3JXOA 3PX0A 1S99A 1WSVA 1OPIA 1T95A 2V68A 3RBDA 4LF5J 3NCPA 3PKYA 4P72A 3JSMB 2CA9A 2WW8A 2J0XA 2HQFA 4PWDB 1N33F 4DL5A 1PO6A 3OTOJ 3T6JA 3H2VE 1EETA 1X7VA 4CQ1A 4DJBA 1SH0A 2OEKA 2ROPA 1PYTA 3LF0A 2E5LF 3FQLA 3OL6A 2NYIA 2VF3A 1SXLA 1JWWA 4QU7A 5D6GA 4ECTA 2PI4A 1N36J 3EPGA 2PGCA 4QWBA 2JLEA 1T03B 3R5CA 3IRXA 4ID8A 4LF1A 1O5JA 3V5RA 4JI0F 3DU5A 1HNWJ 3ZTOA 3QPIA 2W8KA 3FZBA 3O2IA 1MWYA 1GT8A 3I0RA 4USMA 5I3UB 1Y3KA 3ET6B 3IP0A 3UI3A 3QBCA 5RUBA 3ILJA 1UFLA 2BRLA 5K8NA 3NWGA 1S49A 2W2MP 4TU7A 3WZ0A 2W7OA 3BYPA 3QGIA 4EFAC 1Q7YT 1XR7A 2J7UA 4I2PA 4H54A 2K3KA 5F0UA 1T0TV 2GA7A 2KVQE 3HSZA 3CJKA 4I0WA 2YNHB 4ZPDA 4PG5A 1RHKB 3J7A1 1PCAA 3G82B 4C98A 2KRBA 3G9CA 4WZMA 2XGPA 3G6VA 2NQPA 2F7VA 2VV5A 3V81A 3DOLB 5K20B 2KU7A 4KH0B 4YS2A 3UD5A 2JEGA 3P6YC 2UXBF 1I94F 2NPFA 2RS8A 1L3VA 4RLEA 2FJVA 2IPOB 5GMKa 2BKPA 2CQ1A 4NPOA 2PSZA 2DPIA 3HKWA 2FJDB 4F04B 1Y0HA 4DS4A 4F0KA 1N0VC 4LRFA 1KC8T 4PR6A 1NSKL 4DPTA 4URGA 2FLOA 1VQ4S 4C97A 3V6JA 2NCKL 2H51B 1IKWB 2M8HA 3KDNA 1WEZA 4DQPA 1Q8IA 1AUSL 1CS4A 5T7LA 4KV8B 5E0OA 3TAMA 4J9QA 3R6LB 5L1KA 1DAXA 4WP3A 2JDJA 1HWKA 4A8QA 3IR6B 2PMHA 2Z2YB 3H59A 2O1PA 2NXNA 1HNXJ 1X4FA 4LF8J 1VQNS 3HHLD 2W4CA 3PYGA 3K8VA 2EG1A 3A8KA 1RTDA 5F8GA 3RW7A 4J9RA 1JXLA 3NS6A 1ZS6A 3I56S 1VJWA 3IG1B 1T3OA 1LQ9A 2B0GA 1GK8A 2VG7A 3ENAA 4DPOA 2R8IA 1SVDA 4BS2A 5GAGI 1RTIB 2QMUB 2X7IA 2ZOFA 2BOPA 3G82A 1WKKA 4PXBA 1V3SA 1YJ7A 3M2UB 1QLNA 1I3OB 5KG1A 2UZAA 4QZVB 4DR7J 2MKKA 5J2MB 1HHTP 1LFWA 2HHSA 2B7BB 3OR1A 4AQYF 3HFKA 1T05B 1UVKA 3N6NA 2BKNA 4PWUA 1WEXA 2MQQA 1TUGB 2CQBA 1P9QC 1NUEA 2W4DA 3N28A 2WVEA 3IAS9 1VQ7S 3UDEA 4KFBB 2IJRA 4ZLJA 5KG6A 3OXFA 1C0TB 1FO1A 5D77A 1N56A 3P49B 1UVJA 2BOAA 3R5GA 1RCOB 1N4LA 4KTQA 2KHDA 4XPCA 4OHVA 2FLLA 1NJIT 5FIIA 1RUSA 2DGTA 2J9CA 2EVZA 3GYXB 1TFYA 4EGLA 4KJIA 3I96A 1UW9A 1JIHA 5HVFA 5DZ6A 2JLFA 1B0VA 1VI7A 2CNOB 1RAIB 1NSAA 3OXLA 2LA6A 2Y1LB 2Q79A 2GVZA 1WC3A 1WDTA 1SV5B 2Y0SD 1NB7A 2DNKA 1U25A 2Y8WA 3IG1A 3K17A 2XI2A 4IFVA 1CULB 2DH8A 2DRAA 3KDOA 2KG1A 3RBEA 3HZGA 1FWKA 2H9ZA 4DPUA 5D8HB 3UNYA 1KTQA 4X66F 4ECRA 5J1EA 3N6MA 4DUZJ 3M6VA 1TKZB 3RW6A 1RTIA 3AJDA 4WFNQ 3EVOA 1URRA 2XMUA 5L9NA 3MCMA 3G6XA 3CJRA 2R3VA 3M2UA 2ASYA 4K4SA 5HBMA 3IRWP 5HI7A 1FEEA 2QSWA 3ZZTA 3AODA 2MYFA 4N77A 2XBPA 1DJ0A 1XERA 3QWPA 5BYSA 1VQMS 4QU6A 4QWAA 4CLLA 5HANA 3Q23A 2FZCB 4NMXA 3DGPA 5B0CA 2R7TA 4KFBA 3K5PA 2OTJS 4ZPTR 2M7SA 2NUHA 4A8FA 3ISNC 2UU9J 3J80U 5KG4A 5CQGA 5G4DA 3RB6A 1RHRB 1NHKL 5KFJA 4DX7A 1HWUA 3VTIA 4FVCA 2NZCA 4CO4A 3H25A 3KMSA 1CBKA 5HJXA 2HHVA 1Q95G 1NJWA 3D7SB 4JI1F 4OX9J 1FVSA 1VISA 5F8HA 1UW4A 3B4DA 3SCLE 1X4GA 3GYNA 3GV5B 4C0BA 5BR8F 2V2VA 1JXEA 3CW2C 3ZTSA 1SKRA 1RAAB 5KFMA 5HO4A 3AQOA 3PHTA 4OV1A 2CQPA 1WG4A 3RTVA 1UAWA 5CZXA 1JLCA 1SV5A 3K5MA 4PG8A 4EUVA 3VWSA 1R89A 1VQLS 2QX0A 1TK5A 2W8LA 3BBCA 3N0VA 4NXNJ 5KT4A 2XSJB 3CCSS 2HFSA 2KT2A 3ZZUA 3Q22A 5IQQA 3FSYA 4ILRA 1YRXA 2XGQA 4DPYA 4WZQA 2ZH2A 4CLYA 2MQLA 1W2BR 3DRYA 3PG9A 4F3QA 2QYCA 3K7RA 3LGHA 1S0OA 3FEYB 2M8DB 2OP5A 3SDEA 2DHGA 4K7QA 3M2RA 4UZCA 1BE4A 2B43A 4K5RA 1R0AA 3MAHA 3KXDA 2ZWOA 4OZ5A 2JC1A 2VC0A 1HI8A 2PE8A 4OJ1A 3TUZC 4LFCJ 3TANA 4ZJOA 3MM7B 3OD2A 3U27A 5C5JA 5K9FA 4L72B 3U1LA 3PW4A 2ADBA 5M2PA 2KO1A 5L1IA 3MTKA 3GG0A 2AJFE 4NA2A 1O51A 1JQGA 4WE1B 4JI6F 4RW9B 5F41A 1DLOA 1YJTA 1NDCA 3MEEA 1IN0A 4CP5A 4B3OA 2HVDA 2F1FA 5E3QA 1X5TA 2IDEA 1U47A 1MN7A 2R7RA 1HI1A 3HHNB 1RA6A 2GQQA 1BQMB 1OMSA 4PWWA 3CDAA 2AYEA 5KFFA 3LOUA 1M5VC 2DRBA 2JRSA 4ELVA 4NOHA 3J81Y 1CJKB 2OLWA 5IT4A 1XQIA 1NPPA 4V1Ak 2HQ3A 5IC6B 3EZUA 1W26A 3P96A 2EI5A 1FJCA 1B99A 2KFZA 3NCRA 4KHRA 3KHHA 2C3OA 1X9SA 4IQMA 2Z8QA 1ZPWX 2HRYA 1J5OB 2KKHA 2VPXB 2XY5A 5E3RA 1RAHB 2P6SA 4EO8A 2YTCA 2RILA 2YH0A 3KK2B 5FDLB 3IN5A 3GFYA 2WW4A 3KK3A 4OZJA 5CCMA 3RB0A 3SV3A 3LALA 2DEIA 4DR4J 3DRRB 3PRDA 4YDDB 4Y00A 2YH1A 2H4WB 4RW6A 1YG0A 3H2LA 1HL6A 3AA8A 1N5TA 1IXKA 3C66A 1Q82T 4A8YA 2X1FA 1QSYA 2HWTA 1U49A 4C9DA 3MPDA 1N5YB 2CJAA 3EX7B 4LRBA 5B08A 2XC9A 4IO9Q 3MEGB 2GAGC 4K59A 4JV5J 1FJGF 4X4OA 1C4AA 2J7KA 4HHJA 2VDIA 3OHAA 1RU2A 1HYSA 5HMWA 1NXIA 3J81j 1U48A 2CXEA 1U1OA 4P75A 1H2TZ 4AE5A 3IGVA 1FX4A 1SQFA 2DY9A 2ILZA 3U02A 3HKZD 4F4ZA 1JLGB 3RB4A 4DQQA 1ZA2B 3QO9B 2AGPA 1FERA 4ZVSB 1VCTA 2YNIB 3GIMA 4DN0A 4DU8A 2H5JB 1VC5A 2JX2A 2Y8YA 4KO0B 3J7ZT 3F0NA 4O3OA 4RNMA 3B82A 1X5SA 3UDCA 2MKJA 4PG4A 2LEAA 2N4DA 4M5IA 1FDBA 1X9WA 5B0GA 1LW2B 2Q66A 1RT2A 1JNZB 3OL9A 4EU0A 4WP9A 1J5OA 5K5MA 1V9OA 2V8PA 2DR5A 4EYIB 2XS7A 3QJPA 2XZTB 2CZ9A 4NLOA 3ZNUA 3KK2A 4LSZB 4A46A 3VF0B 3K0JA 1CJUA 2HK3A 4KIAA 1IJEB 5HAOA 4OZ3A 1E6VB 2CPFA 1LXJA 1S79A 1EZZB 2BVZA 3W64A 1WOSA 1XK8A 3BQ1A 2NPIA 2KJVA 2KG0A 3VALA 3UNGC 3EVMA 3CXCR 4GKJF 5A0YB 4F8RA 2P2CB 1HR0J 2LQ9A 3MFIA 2KB2A 2OTLS 3GR0A 4HTIA 2CKWA 1VRQC 4H4KC 4G1QA 1WORA 1PGZA 4X62J 4OYAA 4ZLPA 3JYTB 4OHYA 4DUYJ 2IRUA 1CJVA 3E01B 3ZXWA 1RZMA 3I0SB 4RNHA 3NBPB 1WKJA 1LW0B 3SQGB 1D1UA 5I3QA 2RUSA 1SJRA 4LFBF 1T9TA 4IH6A 3Q83A 3W1YC 1UZDA 4DV1J 1IWAA 2OAUA 1TK0A 3VAJA 3UN5A 3MUVP 4I7FB 4NX9A 2CPXA 1WJ9A 1F6TA 7FDRA 2FPHX 3B6BA 1VBYA 5BXIA 2EFVA 1KLMB 3CTRA 2X51A 1OPZA 4UY85 3HK2A 2EK6A 1GXUA 4I2QB 1P27B 3JTPA 3LAMA 1FKPB 2C3PA 3K58A 2KI2A 1SC3B 4L74A 2ZE2B 2CPDA 1RP5A 2DKOB 4AT1B 3UQSA 1Y11A 3DU6A 3VGVA 2V8HA 4CLSA 2AGOA 4ZP7A 3CJ4A 4URSA 1H38A 3JTNA 1DTQA 2E5JA 4RWXA 4WK3A 1JX4A 1WF2A 2DNLA 1RHMB 5FD1A 1PKUA 3BM7A 1SBRA 1FNOA 1TKTB 3FMWA 3NMAA 3L4BC 4M8LA 3D5MA 3C6UA 4OJHA 2IVYA 3JAMY 3FCWA 4U9RA 3UVJB 2CQ4A 2AYMA 4WJBA 5DDOC 4JB8B 2XO6A 1S1UB 3FJ2A 2A1BA 3RJMB 2D1CA 1WTBA 4FP9A 1LWCA 2BANA 5KG2A 2ZJPQ 3SCKE 2XZDB 4YR3A 3MD1A 3O1LA 1GQEA 3R1LA 3MUMP 5C2CA 3HVTA 4RWWA 5HK4A 2PC6A 2IYIA 1KEKA 3CNQP 4ZVRB 4URQU 4GO5X 1WD6A 2OMOA 4IG3B 4LF7J 3AXMA 4AXIA 3PYDA 2A3JA 2V34A 3IMQJ 3J7YU 3NGDA 1TAQA 4U95A 1R8HA 3R27A 2DK2A 5CCLA 1C1CA 5JXSA 3TRGA 1HNXF 1RE1B 2ZD1A 3TZZA 3O44A 4LF8F 3QRPA 1FWLA 1N54B 2VPWB 3U1MA 3HM9A 1VRUB 2I8EA 2CG8A 3MM6B 1Q4RA 8ATCB 2LU2A 1UCNA 4WU3A 2ZUAA 1YITS 4K4YA 1MG7A 1AW0A 2QL9B 2F3JA 4TY8B 3QZ8A 4FS2A 4HACA 1FTRA 4KB7A 4YDXA 1ZOTA 2RQCA 3THVA 4OI6A 2XYGB 1NEEA 4DQRA 4EBEA 2OPPA 4PG6A 1XEZA 4L3NA 3PW7A 3PYFA 1S9GA 5EWEA 4O4GB 3VGUA 3Q2SC 2OPRB 1U0HA 3R2DJ 4LIRA 4NL5A 1JLFB 3FEXB 5C42B 1TQLA 4G6VB 4ECXA 3MM5A 2VBYA 3NGKA 3EJMA 1S6UA 1RAFB 4WFAQ 3QFHA 3PKMA 4R0JA 1S9FA 1JK9B 3UVJA 4KT0C 2KYZA 1NK4A 1X60A 1TMMA 2DGOA 3BH6B 2HW3A 1RT7A 2UVUA 5KG3A 3FEZA 1S1TB 2KZMA 3DLGA 3LGMA 1UVIA 5HQMA 2BA9A 2OJ3A 4HHHA 1OS5A 3M30B 5J2NB 1KSPA 3SFUA 4RBTA 4NXMJ 3T5LA 1SUQB 4CO0A 3LWLA 2Y1JA 2DHHA 3PACA 4QYRA 2V63A 3H8YA 2GMJA 3DRSB 2AJ2A 3FRZA 1NK6A 1N48A 2L41A 1FD2A 4KYZA 3M9MB 1VIXA 2LECA 4JI7J 3DMJB 4Q44A 4I68A 4OHZA 1XWLA 5DG9A 3AAWB 1XNQJ 1LWFA 1LEOA 4C8MA 3OR2B 3H5UA 4YB5A 4EI2A 4MJKA 2BE7D 1IKVA 3CCMS 3AY0A 2Q1LA 5IFMA 4X4UA 1UWBB 2DXFA 4DR3J 1LWEB 2WSEC 4TY8A 4YQWA 4ITSA 2VBZA 4M5DB 1RABB 1HWLA 2YKNA 4Y2AA 3MUTP 2ZH1A 2FY1A 4JI5F 3L3CA 2K1RB 3ISZA 4DUZF 1YRUA 1AROP 2J0SD 3TP2A 1HBUA 4O4GA 3H7HB 5DETA 2NLWA 5AXLA 5L46A 2J5AA 2LYVA 1RTZA 5B09A 1U1RA 1JLFA 4DR6J 2HBYB 5LMNJ 4J9KA 3FCHA 2V5HG 1TL3B 4EEYA 3DOKA 4DL0C 1H7WA 3SXLA 3BO3A 4UOCA 1IQZA 3E2EA 3WIVA 5ETTA 3BJYA 3KUGA 3M8RA 3WC0A 4BC9A 2OO4A 1E6YB 1FD8A 1YKWA 2LEPA 2FJAB 3P8BB 4Z37A 4NLSA 4USTA 2QE5A 4JBCA 3G96A 4H4MA 2IM1A 1R27B 2CG4A 2XQCA 5J2NA 2HHHF 5HL7Q 2ZHBA 3FZ2A 3MFHA 1LK5A 1S6QB 3FSXA 4RU2A 1XMBA 3GSIA 4JYAJ 4K0KF 2CPZA 1R7IA 2HPUA 4DV0F 1IKXB 1XMOJ 5K8PA 2J8SA 3PIOQ 4EZ6A 3QIPA 2B4OA 1HBOB 4PQUA 3MEDA 3KNAA 2ZHOA 2J8AA 4DR5F
chains in the Genus database with same CATH topology
4UOHA 4UOFA 3Q89A 1WKLA 1UCNA 3FCWA 4EK2A 1XQIA 2CWKA 3PJ9A 2DXDA 1S5ZA 1S59A 3BBFA 4DUTA 2ZUAA 1B4SA 1BHNA 3G2XA 3WX8A 3VGTA 1EHWA 3FBEA 3PRVA 2B8QA 1BE4A 1F6TA 3EICA 4DZ6A 3NGTA 3ZTPA 3Q8YA 3B6BA 3EVOA 1NDKA 1HIYA 5BXIA 1B99A 4ANDA 2DY9A 4ANCA 3BBBA 4DI6A 1NPKA 1S57A 3ZTQA 4FKXA 1HLWA 1ZS6A 2DXEA 1PAEX 3JS9A 4O0NA 4WBFA 3ZTOA 4UOGA 3ETMA 5C7PA 3EVMA 3Q8VA 3ZTSA 3FBFA 2DYAA 2AZ3A 1NB2A 1F3FA 1NSPA 1NCLA 1HHQA 3VGUA 3L7UA 1JXVA 3ZTRA 1NDPA 3Q8UA 1VYAA 3FKBA 3ENAA 2AZ1A 3NGRA 4HR2A 3FC9A 1NDLA 1KDNA 2VU5A 1XIQA 1LWXA 3FBCA 1LEOA 1W7WA 4S0MA 4F36A 1BUXA 3EJMA 3DDIA 3EVWA 4C6AA 1NSKL 3VVUA 4W98A 3BBCA 1NDCA 1WKKA 3VGVA 4CP5A 2HVDA 2NCKL 2HVEA 3GP9A 1NLKL 2B8PA 2BX6A 3FBBA 4KPCA 4ENOA 3BH6B 5CAAA 1MN7A 2DXFA 2HURA 3B54A 3FCVA 3NGUA 1NHKL 3MPDA 1WKJA 1PKUA 3VGSA 1MN9A 3EM1A 3EE3A 2BEFA 3ELHA 3Q86A 3DKDA 1K44A 3EMTA 5IOLA 3Q83A 1U8WA 4F4AA 5CABA 4ANEA 1NSQA 3R9LA 3NGSA 3VVTA 1NUEA 4FKYA 3GPAA 3BH7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UOH A;  4UOF A;  3Q89 A;  1WKL A;  1UCN A;  3FCW A;  4EK2 A;  1XQI A;  2CWK A;  3PJ9 A;  2DXD A;  1S5Z A;  1S59 A;  3BBF A;  4DUT A;  2ZUA A;  1B4S A;  1BHN A;  3G2X A;  3WX8 A;  3VGT A;  1EHW A;  3FBE A;  3PRV A;  2B8Q A;  1BE4 A;  1F6T A;  3EIC A;  4DZ6 A;  3NGT A;  3ZTP A;  3Q8Y A;  3B6B A;  3EVO A;  1NDK A;  1HIY A;  5BXI A;  1B99 A;  4AND A;  2DY9 A;  4ANC A;  3BBB A;  4DI6 A;  1NPK A;  1S57 A;  3ZTQ A;  4FKX A;  1HLW A;  1ZS6 A;  2DXE A;  1PAE X;  3JS9 A;  4O0N A;  4WBF A;  3ZTO A;  4UOG A;  3ETM A;  5C7P A;  3EVM A;  3Q8V A;  3ZTS A;  3FBF A;  2DYA A;  2AZ3 A;  1NB2 A;  1F3F A;  1NSP A;  1NCL A;  1HHQ A;  3VGU A;  3L7U A;  1JXV A;  3ZTR A;  1NDP A;  3Q8U A;  1VYA A;  3FKB A;  3ENA A;  2AZ1 A;  3NGR A;  4HR2 A;  3FC9 A;  1NDL A;  1KDN A;  2VU5 A;  1XIQ A;  1LWX A;  3FBC A;  1LEO A;  1W7W A;  4S0M A;  4F36 A;  1BUX A;  3EJM A;  3DDI A;  3EVW A;  4C6A A;  1NSK L;  3VVU A;  4W98 A;  3BBC A;  1NDC A;  1WKK A;  3VGV A;  4CP5 A;  2HVD A;  2NCK L;  2HVE A;  3GP9 A;  1NLK L;  2B8P A;  2BX6 A;  3FBB A;  4KPC A;  4ENO A;  3BH6 B;  5CAA A;  1MN7 A;  2DXF A;  2HUR A;  3B54 A;  3FCV A;  3NGU A;  1NHK L;  3MPD A;  1WKJ A;  1PKU A;  3VGS A;  1MN9 A;  3EM1 A;  3EE3 A;  2BEF A;  3ELH A;  3Q86 A;  3DKD A;  1K44 A;  3EMT A;  5IOL A;  3Q83 A;  1U8W A;  4F4A A;  5CAB A;  4ANE A;  1NSQ A;  3R9L A;  3NGS A;  3VVT A;  1NUE A;  4FKY A;  3GPA A;  3BH7 B; 
#chains in the Genus database with same CATH topology
 2HLT A;  5D15 A;  4ZVP B;  3TEG A;  3QJJ A;  1GEH A;  1AUD A;  1UWA A;  4NE9 C;  2JL9 A;  2JFD A;  1VDH A;  1U6B A;  3TAR A;  3KJQ B;  3GFH A;  3F56 A;  3MHY A;  2J0Q D;  1FT8 A;  2EK1 A;  3EGV A;  4DI6 A;  4X64 F;  3R6G B;  2AV5 A;  4DXL A;  2QN6 B;  1EX8 A;  2QL7 B;  3A3O B;  2OML A;  2F8E X;  2UVV A;  4X2B A;  2ZJR Q;  2XTJ P;  2QA4 G;  2FHJ D;  1R8P A;  5KT5 A;  1K9M T;  4JI4 F;  1P6T A;  2ZNY A;  3GV7 B;  3D28 A;  4M5M A;  1EQM A;  1Q8L A;  3H20 A;  1JLB A;  1TL3 A;  3LP1 B;  2DHA A;  4JV0 A;  4HDG A;  5AT1 B;  2BM0 A;  1F0X A;  3IAM 9;  3P45 B;  3MMB B;  2HNY A;  3WDO A;  3T5K A;  2UUC J;  1HW9 A;  2E7V A;  1HMV B;  1VQP S;  3DXB A;  2VFU A;  3PNI A;  2JEI A;  3UW1 A;  2I9S A;  2PEH A;  1Q5Y A;  1OQ3 A;  1NK9 A;  1HAR A;  1AFI A;  1L3T A;  4ZA1 A;  1V3R A;  2YKP A;  3L9Z A;  3CCT A;  3SSS A;  3MM9 A;  3KLH A;  1TTH B;  4JV2 A;  3AT1 B;  1B64 A;  2BJD A;  2GIF A;  3HXM A;  2VKZ G;  5LSO A;  2IM3 A;  4MK8 A;  1JB0 C;  4BWJ A;  7AT1 B;  1REV B;  4WFY A;  1RWK B;  1PC4 A;  4DX5 A;  4LR8 A;  4DV5 J;  1IJF B;  3OTC A;  4YHH J;  2YQ1 A;  5DO2 A;  2K3I A;  2YVS A;  3PDN A;  3SSQ A;  4X4T A;  2AYB A;  2FVP A;  1U1N A;  2P9G A;  5KFL A;  3W63 A;  2ZBC A;  1TV6 B;  3Q24 A;  1HD0 A;  2RDJ A;  5K8O A;  3DNC A;  1LFP A;  2MZR A;  3GFZ A;  2C28 A;  4Y6I A;  3LTO A;  3US5 A;  2K2P A;  1FE0 A;  2A2C A;  4DG1 B;  1KRP A;  1T8E A;  3I6P A;  3QT6 A;  2FDN A;  4TNO A;  4X4N A;  1WHY A;  5KFR A;  3DM2 B;  3O5T B;  2CAJ A;  3OSP A;  4B08 A;  2W2P P;  2W24 A;  2LMI A;  4JI0 J;  5JMN A;  4QIE A;  1M5S A;  1RT5 A;  3QID A;  4DSE A;  4DR4 F;  2K8G A;  3GYG A;  3MTJ A;  2F4V J;  4K4Z A;  5IWA F;  3FKB A;  1H74 A;  2FVQ A;  2DGS A;  4OJG A;  4QR2 A;  2KYX A;  3I87 A;  1MMN A;  1TEL A;  3AB2 B;  1RHQ B;  1IQT A;  4P7V A;  2DGQ A;  3MMB A;  1TP7 A;  5D4N A;  1LWX A;  3GON A;  2Q43 A;  4DV7 F;  2EPI A;  4RBV A;  2ZH8 A;  2HVE A;  2FZK B;  5KFQ A;  1TUW A;  3C15 B;  3AB4 B;  1WC4 A;  3JTO A;  1RAE B;  3BF4 A;  3Q8P B;  2DY1 A;  2YQ0 A;  1RWO B;  1GTH A;  1G6B A;  3N4W A;  3CT9 A;  3PY8 A;  1K1Q A;  1B7F A;  2YKM B;  4OX8 A;  2XMK A;  3EGN A;  1NZA A;  3RYL A;  4RW8 B;  3KJV A;  3MPV A;  3P5T L;  2MGZ A;  4H4K A;  5DRK A;  4C3M A;  1UPP A;  4ANC A;  4CLW A;  3QT8 A;  3S6E A;  1RT3 B;  4ZKA A;  4OZ1 A;  4MH8 A;  4MT1 A;  1DTT A;  4UOG A;  5K14 B;  3D3B J;  3Q8V A;  1QUV A;  4Q2L A;  1R8C A;  3BQ0 A;  1ELO A;  1I1G A;  1VQO S;  5IT9 Y;  1ZM2 A;  2GVD B;  4ZPA A;  2KDO A;  1FTC A;  3M9O B;  3KJN B;  4YP3 A;  4P6Q A;  4C6A A;  1H6K X;  5G0R B;  1YQH A;  5C25 A;  3X3U A;  2HAF A;  3QJL A;  1C0U B;  2DNZ A;  5CH7 B;  1EKR A;  4XAK A;  4DWI A;  1H98 A;  5THW A;  1Z4U A;  3HHL C;  1KD1 T;  2HSE B;  1OQ6 A;  2CQ0 A;  4ID5 B;  4UY8 T;  5F8M A;  4LQ9 A;  1FK9 A;  3TWZ A;  1TKX A;  3D68 A;  2B9E A;  4ZCK A;  1IBL F;  1GXT A;  2EEY A;  1WC5 A;  4P2X A;  2WAQ D;  2QRR A;  1QDU B;  4XIU A;  4V19 X;  1NSQ A;  2R7S A;  1YX2 A;  5CZV A;  3R7B B;  2IDL A;  4K2J A;  1QAJ A;  1UTA A;  3LP2 B;  4R5P A;  2HGL A;  4PXC A;  4MIB A;  1HI0 P;  3N79 A;  3IR5 B;  3GIJ A;  1FRL A;  5ETS A;  1F5C A;  1D9A A;  4ZVT B;  4CYU A;  4R25 A;  1SJ3 P;  3V2U C;  1PAE X;  4K2X A;  4L75 A;  1UJ5 A;  2VD3 A;  2YNF B;  3C15 A;  1IKY A;  1PBA A;  2M4M A;  1RKI A;  3BGR A;  5B0A A;  1WHV A;  3ZFV A;  4ICL B;  4I6A A;  4X62 F;  4RUH A;  5LSL A;  3J81 U;  3MPY A;  3FDS A;  1OJ4 A;  1CJT B;  4AFF A;  2VG6 A;  3MMC A;  4Z2X A;  2V6A A;  4FPR A;  2GQC A;  3TVY A;  2OD6 A;  2DB1 A;  2ZM6 F;  4CNY A;  2WRM A;  4DL4 A;  3M1V B;  2YKM A;  3GP9 A;  3GWC A;  4J91 A;  3TO8 A;  5AJ3 J;  3LO3 A;  4RW8 A;  2RF2 B;  4AQY J;  3FCV A;  1AYE A;  1VQK S;  2PT0 A;  2FHM A;  3FFI B;  5FLX Y;  2VOO A;  4DV1 F;  2WBM A;  3IC1 A;  2YKO A;  1RT3 A;  4BWM A;  4OYO A;  3W65 A;  1TVR A;  2ASL A;  3GCW P;  2BDP A;  3IS9 B;  2ZZN A;  3PIP Q;  2AWZ A;  4CM0 A;  3D2W A;  2AX1 A;  3AJ2 A;  1WKL A;  1SH2 A;  1RWX B;  3H42 A;  1R0B G;  3PW5 A;  4MAK A;  3OFG A;  3BKU A;  2R7O A;  3LAK A;  3L09 A;  2KHC A;  3BR9 A;  2DR8 A;  1C0U A;  3CJ8 A;  2X3G A;  1TUV A;  2CQ3 A;  1Y7P A;  4FVM A;  4WU2 A;  3KHG A;  2VFT A;  1WNE A;  2WON A;  3LW5 C;  1YI2 S;  3TVK A;  2HNZ B;  1RLC L;  4CDI A;  1I51 B;  4MFB B;  3NGR A;  1KHV A;  4LF2 A;  4ILM A;  1BY9 A;  3BO4 A;  4UT4 A;  4JI2 J;  2NSC A;  4FYW B;  4JP8 A;  4F36 A;  2IVF B;  5I42 B;  5CYJ A;  2RQK A;  1VQ9 S;  5KFE A;  2GZO A;  5B0B A;  4IG0 B;  4ED0 A;  5E3C A;  4M5H A;  3C16 B;  3GQC A;  4UF4 A;  4J90 A;  3UDL A;  3NMR A;  1U1P A;  2CQ2 A;  2O67 A;  1TKD A;  3DLH A;  4NI2 A;  4DFJ A;  4DV4 J;  3CCZ A;  2WBR A;  2HHP A;  1QE1 B;  1ULR A;  1RTJ B;  1GXL A;  2GO8 A;  2G0C A;  2HQC A;  5DQH A;  3SZ2 A;  4TQR A;  1T11 A;  1DUR A;  3PRV A;  5LOQ A;  3MZI A;  4RZR A;  2BMB A;  2HQD A;  4LRC A;  4NYP A;  4ICL A;  3TQ1 A;  1FRK A;  5KFI A;  4NA1 A;  1RWW B;  1HQ2 A;  5HMZ A;  3DDN A;  2HGM A;  3M2V B;  3UR0 A;  2XS2 A;  4NLD A;  3HSJ A;  2Y3Y A;  5D4L A;  2MLZ A;  3DLE B;  1SH3 A;  2RF2 A;  4LF7 F;  1RI7 A;  1RB0 A;  5HRO A;  3L7O A;  1AZS B;  5DJB A;  2R2U A;  3D6F B;  1FE4 A;  4LBI A;  5EWG A;  3UO0 A;  2MHN A;  3TZW A;  2GO9 A;  2ZH4 A;  1AT1 B;  1KVJ A;  2OPS B;  3TUI C;  5EHH A;  4U7C A;  2HVI A;  2B6A B;  1ROF A;  2VAS A;  4ED2 A;  2LFV A;  1L3K A;  5I3P A;  1NKC A;  4CLP A;  4PPZ A;  4RW7 B;  2O66 A;  4L3K A;  2ZBP A;  2C3M A;  4CO5 A;  1MU2 B;  4LSN B;  3CCR S;  1A9N B;  2DHX A;  3KK1 B;  2ZKU A;  2IM2 A;  4NLV A;  3NY0 A;  4C8N A;  1B3T A;  3QSI A;  1IVZ A;  2HWH A;  1X9M A;  1R3N A;  1K0T A;  2IA0 A;  2ATC B;  2UVR A;  2QSF A;  1S1X B;  1RT1 B;  3ENQ A;  5BR8 J;  4ECV A;  1CEZ A;  4Q7A A;  1VQS A;  4NLG A;  2N4C A;  4FKX A;  3MCN A;  3D1H A;  3R7S B;  2GGP B;  1U8S A;  5FJ4 A;  2DYA A;  1OY6 A;  5GAG U;  3MWB A;  3HO1 A;  5SZT A;  2MMY A;  1UJ6 A;  2B9W A;  2LXI A;  4S0M A;  4ZP8 A;  1RWM B;  5KFS A;  3PYE A;  1RU1 A;  1X5O A;  5BYQ A;  5GAD U;  4WK1 A;  1WHW A;  1UKU A;  1KFS A;  5B7W A;  1TL1 B;  3B54 A;  3SBM A;  4ED6 A;  1RIS A;  4FYY B;  4OJ3 A;  4NXM F;  2ZZM A;  3TI0 A;  3RUB L;  2VQF F;  3F41 A;  3DLE A;  2WHO A;  4CT8 A;  4WFZ A;  3GSD A;  4GVL A;  5E41 A;  1GMU A;  1N34 F;  2E1R A;  2B9X A;  2RS2 A;  2LQB A;  4OI1 A;  3M8Z A;  4ZN3 A;  2DT9 A;  3R1H A;  2JOQ A;  1FKO B;  1EJ7 L;  3MR2 A;  3DRP B;  3NGT A;  4EO6 A;  4PXE A;  2EKY A;  3V6H A;  2CNL B;  1XNR F;  1XNQ F;  2WVF A;  2VIC A;  1WTF A;  2E5G A;  2I38 A;  4RW7 A;  3OVA A;  1NSP A;  3HHE A;  1VYA A;  2DR7 A;  4X84 A;  4M1K A;  4NCA A;  2MQ8 A;  5L8R C;  4UUX A;  3QSY B;  1GTE A;  5DZ7 A;  3R8Y A;  4TYB A;  9RUB A;  3KG1 A;  4ECQ A;  2W2O P;  4A8K A;  1ZET A;  2IA6 A;  1RK8 A;  4GKK F;  2W1B A;  5ETP A;  1BMQ B;  3DYA A;  1H2V Z;  1I6J A;  1VRT B;  1BXN A;  1O6X A;  1EP4 B;  3ZC4 A;  4DR6 F;  5LMN F;  2HS4 A;  4C11 A;  2D3U A;  4ES3 A;  3OJS A;  4FZV A;  3QYY A;  2R2T A;  5HLF B;  1HNV B;  2IY5 B;  3FBE A;  5AXN A;  4P2F A;  2PA8 D;  1NDK A;  2AD9 A;  4CI0 B;  4ZJQ A;  2GQ2 A;  1TAU A;  2RRN A;  2RU3 A;  4OV6 A;  3R2C J;  2X3D A;  3M8P A;  5EDW A;  3GLJ A;  3JSB A;  2IM0 A;  2HMI A;  2Z56 B;  3H90 A;  2I5J B;  1S9E A;  4PXD A;  3AD7 C;  4JYA F;  2FC9 A;  2UVW A;  4ZPV R;  1XMO F;  1S10 A;  3HVW A;  3PFO A;  4TLQ A;  3CIM A;  4YB1 P;  1BC6 A;  2OPQ B;  2GS8 A;  1H73 A;  5KTQ A;  3CCQ S;  2DRD A;  3AFG A;  3M32 B;  2AJ0 A;  4HHU A;  1XN9 A;  1ZM9 A;  3KG4 A;  1FCA A;  4ZVO B;  3KLF A;  3R5B A;  2NXJ A;  3W9I A;  1FDA A;  1KQK A;  2WCX A;  1TL7 A;  5A6W A;  1EET B;  1DQ9 A;  1JJH A;  1S59 A;  2HRU A;  3OL8 A;  4UW2 A;  3PW2 A;  1NH7 A;  1HWJ A;  1FRI A;  1BGX T;  1RA7 A;  3BDE A;  3CO0 P;  2IBK A;  2RDD A;  1KQS R;  3TA2 A;  4DX8 H;  1Y3J A;  2MZS A;  2XMA A;  3QQC D;  1F2H A;  2QIF A;  1S7I A;  3THT A;  3ISN D;  2ALZ A;  2V9K A;  3I0R B;  3FBC A;  5J2P A;  4M94 A;  2AW0 A;  1RBA A;  2XEX A;  3K2Y A;  4FF2 A;  2E7W A;  4O44 A;  1AA1 B;  1P1L A;  3VAI A;  4QIG A;  4Y3C A;  5H9F J;  4USK A;  3DLL Q;  5KG0 A;  2OEJ A;  2B4V A;  4C8Z A;  4RL1 A;  3THP A;  4I2P B;  2MJU A;  2QTW A;  3C46 A;  1ZTT A;  3CUL A;  3P5B P;  1RWN B;  3WC2 A;  4LF4 F;  4FKY A;  1SB6 A;  1TZ0 A;  2CQG A;  4UTG A;  1YHQ S;  4EK2 A;  2IJF A;  2BE9 B;  1T9X A;  2HGN A;  3T41 A;  2W9B A;  4DLE A;  4DZ6 A;  4AL7 A;  3OSN A;  2GHW A;  4KHM A;  3V81 B;  4OYI A;  3TJA A;  4ETX A;  3ZO7 A;  2MDA A;  2ROG A;  2MY7 A;  2P9E A;  2EFQ A;  4HH0 A;  3BV8 A;  2OPQ A;  3MCO A;  4GKJ J;  1QJH A;  3NG8 A;  3M32 A;  4YHH F;  1JXV A;  4XK8 C;  3S8S A;  4QJV A;  1Z2L A;  1YJW S;  3QGP A;  2R7X A;  3PTW A;  2XLK A;  5HJY A;  1WC0 A;  1FHT A;  2VDH A;  3TEH B;  3PVX A;  1URN A;  2I1R A;  3AD9 C;  1KWM A;  4K4W A;  4NEY A;  2B8P A;  4WYL A;  5KFK A;  1HD1 A;  2MTL A;  2YX1 A;  4O23 A;  1ITP A;  1S1V A;  3TQE A;  2C2D A;  2DH9 A;  1S4E A;  3GE9 A;  1FXL A;  2F8H A;  4LFB J;  4MKB A;  1Z2Z A;  2YKQ A;  2KVI A;  3RAQ A;  1CS4 B;  5T7L B;  5L38 A;  3TAM B;  4B02 A;  1S97 A;  4ZLN A;  2RQ4 A;  4ALZ A;  1O0P A;  1TL4 A;  1AB8 A;  1KTV A;  4I1T A;  4MKY A;  2ZDP A;  4H4O A;  4USI A;  2F4V F;  4NYZ A;  2FTR A;  3HUL A;  4G3I A;  2VPY B;  5EUH A;  3HHL A;  2V9W A;  3BB5 A;  3HFV A;  2E1M C;  2WB1 D;  5IQ6 A;  2FY8 A;  1RTD B;  3P4U B;  2CPH A;  3PFE A;  3EXY A;  4F4Y A;  1HW8 A;  3D0I E;  1ZAW A;  2J9D E;  1NKE A;  3EXC X;  2VG7 B;  2EWH A;  1KLN A;  2VHG A;  4RU9 A;  3AD8 C;  3LA0 A;  1NHU A;  1Y5I B;  5KFD A;  1M0S A;  1XMQ J;  1S76 D;  2DR9 A;  5KFX A;  1VBZ A;  4TXS A;  4B3M F;  4GC6 A;  5JVH Q;  2VBX A;  3M8Q A;  4CTA A;  5CXT A;  1TU0 B;  2MY8 A;  3H4B A;  2FUG 9;  1RWU A;  3OR1 B;  2CVI A;  5M2R A;  4DZD A;  2HS3 A;  1A7G E;  2V2K A;  4K50 A;  3QLH B;  4UOF A;  1D09 B;  4HH1 A;  4N76 A;  3BBF A;  3RB3 A;  5ADZ A;  2DGV A;  3WIU A;  3HVR A;  2NR0 A;  2JZ5 A;  3R5A A;  1KS2 A;  1VQ6 S;  3CCW A;  2HFZ A;  2RDI A;  3VZI A;  3GMG A;  5HP1 A;  2EFG A;  2ZVS A;  3QFW A;  3VR1 A;  5ETN A;  4QR1 A;  2G0I A;  4LSL A;  2CFX A;  4W92 B;  2ABY A;  2XB2 D;  2UXD F;  4XDD A;  3CMA S;  1UEU A;  4USU A;  2P8I A;  5E7O B;  1J5E F;  1ZBT A;  1IR1 A;  2LXF A;  3GJT B;  2CYY A;  4KPC A;  1FF2 A;  2AJ4 A;  4KKO A;  4O4R A;  2CZV C;  3KLV A;  5F8L A;  1Y00 A;  2BJ3 A;  2JHE A;  4RW4 A;  3MOJ B;  1JLQ A;  3MEK A;  3TJ9 A;  5KFV A;  2GVZ B;  4BC7 A;  5D0G A;  2ZH6 A;  4TLR A;  2F4F A;  2VJU A;  3NNC A;  2IHR 1;  1IM4 A;  3AOC A;  2OKQ A;  3J7Y I;  3CWJ A;  4DSI A;  4IFV B;  1JKH B;  1N88 A;  5EN1 A;  1IWG A;  1HKA A;  3CD6 S;  4OIX A;  5J1E B;  4O3Q A;  3CD5 A;  4U7U K;  3EWG A;  2FZG B;  3H5X A;  2QLJ B;  3CCU S;  2KFN A;  5L39 A;  1N32 F;  2RKI A;  1GMW D;  4N8N A;  5GAE U;  4I6W A;  4BCA A;  5D3G A;  4Q45 A;  1FXD A;  1PIL A;  1ZZN A;  5HBM B;  4FBU A;  4PPD A;  4PAA A;  2LQJ A;  5AJ3 F;  3O8W A;  5CD4 A;  2X1A A;  3V6D A;  3VAM A;  2A18 A;  3J80 Y;  4RBU A;  3BSA A;  2WOM B;  4F0M A;  1HBM A;  3QLH A;  3FK4 A;  2BUN A;  1IR2 A;  2V0N A;  3HD1 A;  1D8Z A;  2YWW A;  1RHU B;  4KH1 B;  1SIZ A;  5IV4 A;  1MWZ A;  3DGP B;  2HHQ A;  4USV A;  4C2M A;  1CC7 A;  2EBG A;  1V3Z A;  2HIQ A;  4JV1 A;  1ZAX A;  3LQV A;  2Q3P A;  1D3W A;  2A10 A;  5I4M A;  2D3Z A;  1RCX B;  2HFN A;  4F3M A;  3CJT A;  2UUT A;  3T1H F;  2BRK A;  3CF5 Q;  3BKT A;  2ERR A;  3DLK A;  4Q5V A;  2F9D A;  3PO4 A;  2K7J A;  2PEB A;  3IFE A;  4PZV A;  5A2Q U;  4TYA A;  2BZ2 A;  3K5N A;  1TR0 A;  2LEB A;  4P10 A;  3DOM A;  3C6T A;  3UCU P;  4N5S A;  4ECS A;  1FWP A;  2ROE A;  1D9D A;  2G1D A;  3BO2 A;  3X1L B;  3NNH A;  4C0H A;  4B3S J;  1PAU B;  4JI2 F;  2MZJ A;  3ETM A;  2VG5 A;  1ZAV A;  2FQQ B;  4UQG A;  1FRX A;  2LDY A;  3FMB A;  3K57 A;  3I32 A;  1KFD A;  1FFS B;  5T41 A;  1WC1 A;  3FC9 A;  4D3H A;  5EGY A;  2QGF B;  5E3P A;  4EBD A;  3EGZ A;  1JLE A;  2KM8 B;  1VHF A;  2R7Q A;  1JLC B;  2YWG A;  1RQ0 A;  4CH1 A;  3RR7 A;  4DV4 F;  4LBH A;  2H5I B;  3CIZ A;  1CG2 A;  2L9N A;  3LH2 S;  2IMW P;  1JKH A;  2AU0 A;  4DFP A;  4YY3 J;  1FI4 A;  3DHX A;  4OZL A;  3POT A;  3CD7 A;  4ZP6 A;  3P3D A;  4JI5 J;  2HZC A;  3TX8 A;  2DVI A;  3N01 A;  2BEF A;  1Q53 A;  3GIR A;  1DAR A;  5IT9 U;  2VFR A;  2DEJ A;  1VQ5 S;  1YWX A;  2ASJ A;  2XG8 A;  4P2S A;  4CLT A;  2JFK A;  2HBR B;  3BSO A;  1WEY A;  1OIA A;  2NZ4 A;  3M8W A;  4FXD A;  1HIY A;  2WOM A;  3SDE B;  3PJW A;  2AHO B;  2LA4 A;  2K7K A;  1GH8 A;  2IFX A;  3L95 X;  4LRA A;  3CC7 S;  3M2R B;  1R0A B;  3ENV A;  4P74 A;  2MHE A;  3NAI A;  3KLG B;  4KHP J;  4RUA A;  2MJN A;  1YTY A;  2NSB A;  1G3O A;  5MLC V;  4ZCL A;  2MZQ A;  4AL5 A;  2BJ9 A;  1X4B A;  1WG5 A;  2H4Y B;  3I4H X;  1UET A;  1YZ6 A;  4RUC A;  2HHH J;  3TW0 A;  2KJW A;  4Y2C A;  3EPI A;  3D6M B;  1RTH A;  1FDD A;  3I82 A;  1VC6 A;  4K0K J;  1DLO B;  4DV0 J;  3MEE B;  4B3O B;  2E9R X;  2DCL A;  3TOQ A;  3OFH A;  2RB7 A;  2AEJ A;  5D0H A;  3AA9 A;  1HQU A;  5J1N A;  4DR5 J;  2LCW A;  4YOE A;  2BW2 A;  2KZZ A;  5DDP C;  2E29 A;  4OI3 A;  3IXQ A;  4NZ0 A;  5KG7 A;  1ZM3 A;  4WKY A;  1IM6 A;  5IM0 B;  4L73 A;  4IO1 A;  2EG2 A;  3HI9 A;  2E1A A;  4GVB A;  3CJQ A;  4X64 J;  2A0F B;  2Z2L A;  5H9E J;  1YBA A;  5FLX U;  1FDN A;  3TR5 A;  2CUY A;  3ULH A;  2LLZ A;  1SC1 B;  4MYT A;  4NZ6 A;  4DL7 A;  5IZH A;  2RD5 C;  3M8Y A;  2ATL A;  3L7U A;  3MAA B;  2MB0 B;  4AUK A;  3CDU A;  2DNN A;  2BXJ A;  4ECY A;  2IJN A;  4Q0B A;  4EZ9 A;  4JI4 J;  2SXL A;  4ECZ A;  5KFH A;  3KK3 B;  2CZ4 A;  2CQH A;  4KGX B;  4KQZ A;  2J9D A;  2HIY A;  1WI6 A;  3A8E A;  2R8H A;  1KOH A;  3T19 A;  4MTP A;  3M4X A;  4IR9 A;  1Q86 T;  2FD2 A;  4RW6 B;  2C3Y A;  1X8D A;  3AXK A;  3HFZ B;  3TYT A;  4WII A;  2B4P A;  4QPX A;  3UD3 P;  4QQB A;  2U2F A;  1YVF A;  3KLG A;  1R43 A;  2R4F A;  3ZZO A;  2KFY A;  4ZDN A;  4P52 A;  5ITH A;  4PEO A;  1X4A A;  1QY7 A;  5BJR A;  5DM7 Q;  1G7C B;  1BWE A;  3K89 A;  1HYS B;  3ZTP A;  1CVJ A;  4GMK A;  1Q16 B;  2G1H A;  4P7T A;  4HYK A;  1P1T A;  1FRJ A;  2FJW A;  2RH3 A;  2NXU A;  2B5J A;  2OFG X;  2UV8 A;  1NDP A;  4K8R A;  2AZ1 A;  2OGU A;  3C19 A;  3PO5 A;  4QPT A;  3OVS A;  2CJQ A;  2V2Q A;  2XNR A;  5C24 A;  2J7W A;  3I55 S;  1D9F A;  4R0E A;  2NXC A;  2O01 C;  1MRO A;  3D67 A;  2KH9 A;  5IM0 A;  4ZHR A;  2PN6 A;  2DGW A;  2RJZ A;  5CHC B;  2JLG A;  1T9Y A;  1MNE A;  2C2M B;  3UPF A;  4PYA A;  3RGI A;  3MMA A;  3JQM A;  4LVO P;  3IM8 A;  2UP1 A;  1IBK F;  1S6P A;  2HBQ B;  1SKS A;  2VA2 A;  3KMQ A;  1RT2 B;  5IOL A;  4GRS A;  1BQN A;  3R9L A;  3VVT A;  4OYW A;  3MAA A;  5IT0 A;  1NND A;  4DN9 A;  2AMC B;  1T3N A;  1B4S A;  5DQG A;  4B3T J;  4QBU A;  3G87 A;  4FBT A;  4KPY A;  2I2Y A;  2XUL A;  1CJU B;  1R6V A;  2DNM A;  3TUJ C;  1SJF A;  4IRD A;  4HL9 A;  1PYS B;  5JVG Q;  1WF0 A;  2VON A;  2V69 A;  1RT4 A;  3JB9 k;  5LL6 d;  3CUN A;  5KT7 A;  4DV2 J;  1UPM B;  2CJK A;  3D66 A;  5IWA J;  1UA0 A;  4O0I A;  3GIK A;  1VC0 A;  1RGV A;  2M9K A;  2KT3 A;  4CLF A;  3QGG A;  1YJN S;  2PFF B;  1JMT A;  5DDQ C;  5KOX A;  4DV7 J;  2E44 A;  4NML A;  4USH A;  2OSR A;  4HT7 A;  4QWE A;  3Q8Q B;  4M63 A;  2UUW A;  5HMY A;  3R3T A;  2QZ8 A;  1NK8 A;  3ILI A;  1HBN B;  1GX6 A;  3MEC A;  5ETO A;  2QA1 A;  1OSD A;  4I64 A;  4OHX A;  4G1Q B;  1F2G A;  4OZ0 A;  3G6E S;  3HX9 A;  2FYX A;  1CJV B;  3RBX A;  5AXK A;  4B9S A;  2BJE A;  2PA3 A;  5A6P A;  2HK2 A;  2AX0 A;  4QW9 A;  2I0X A;  3H0P A;  3GFX A;  1OY9 A;  3PXG a;  1JLA A;  2AT1 B;  5ETM A;  1RAJ A;  4X4R A;  4AD6 A;  3CJS A;  4LMZ A;  2DD8 S;  1HLW A;  3M05 A;  4O0N A;  1VLO A;  2BAC A;  1RT6 A;  2IRX A;  3OL7 A;  1LV5 A;  4HT5 A;  3K5O A;  4DPX A;  3BPS P;  3G4S S;  1HFE L;  4LRD A;  4GC7 A;  3T5J A;  2ZC3 A;  5LSR A;  4Q8E A;  2HHU A;  1SL2 A;  3G8Q A;  1SCJ B;  3KLE A;  2DO0 A;  2QEX S;  2CNN B;  1PJ7 A;  1IBL J;  2H3E B;  4TU8 A;  4U67 Q;  4I56 A;  1DTQ B;  3ADA C;  3BZQ A;  3R5J B;  4NCG A;  5T14 A;  3BSC A;  3I5C A;  3QZ7 A;  4B3R J;  4M95 A;  1KR4 A;  2B51 A;  4Q8F A;  4MKV A;  3VGT A;  1S1W A;  1SC6 A;  3C6U B;  3IWN C;  3G8T A;  3V4I A;  3A1Y G;  3RAM A;  1VHI A;  1H7X A;  3HJF A;  2O3D A;  4ZPC A;  1HBN A;  1EQ0 A;  1LWC B;  2BAN B;  1LXN A;  3W2V A;  5HAT A;  4IKA A;  3CDW A;  1VLY A;  3M9N B;  3BR8 A;  3PX4 A;  3HVT B;  1RYS A;  1NU4 A;  2LKZ A;  2XI3 A;  2ZM6 J;  3MXH P;  3EVW A;  2HVZ A;  4IH7 A;  2YNG A;  1QAI A;  3ITH A;  4Y28 C;  2DPJ A;  2BJ7 A;  2D41 A;  1LNQ A;  1S72 S;  2IAJ A;  1T9U A;  2W7A A;  2W01 A;  4F4X A;  2D9P A;  2BQR A;  3W3S A;  3KUH A;  1N5Q A;  1OSC A;  1Y4Z B;  4NCB A;  4Y2K A;  1F3V A;  2HZA A;  4IDK A;  3OUY A;  1C1C B;  4NLP A;  2ZD1 B;  4J9P A;  4PUO B;  2A6M A;  1PBU A;  2XNQ A;  3QGH A;  5DGA A;  1EIY B;  4XDC A;  1WI8 A;  6AT1 B;  2L48 A;  9ATC B;  4M5N A;  3PJ9 A;  1F9E B;  2VKR A;  1BWV A;  2E7X A;  3NP5 A;  1V5V A;  1PG5 B;  3SEO A;  3GJS B;  3W2W A;  5A8R A;  4IRC A;  5SUH A;  3PM9 A;  4HAC B;  5C7P A;  2DNO A;  2RQM A;  5DDR C;  1XMQ F;  4CZC A;  3J7Z 5;  1FNM A;  2OPP B;  2L9D A;  1S9G B;  5KFG A;  2MZ1 A;  4PKD B;  5CYQ A;  3OBI A;  4DFK A;  2V4R A;  2J6T A;  1U0H B;  1VR6 A;  4DSF A;  3HHK A;  5AE2 A;  3MM5 B;  2CIM A;  1WAC A;  2VIH A;  2GJI A;  4QR0 A;  1SC4 B;  2U1A A;  4RNO A;  1HPZ A;  1PSD A;  3GV8 B;  5EWF A;  4RR5 A;  1KN6 A;  2DNH A;  2C1E B;  1RT7 B;  3NRB A;  1KVI A;  4JUZ A;  1HNI B;  3DLG B;  1U8W A;  4USW A;  3EDR B;  4ED5 A;  3E51 A;  4IR1 A;  3ICL A;  1SPB P;  5MAO A;  2E5I A;  3O6Q A;  3VAF A;  3GJQ B;  4AND A;  3RRG A;  5EX3 A;  5DLG A;  2B9Y A;  2N82 B;  2F8M A;  1U1K A;  2FGO A;  4O3P A;  2LXU A;  1RKJ A;  4M5L A;  4MYU A;  2MQO A;  4AXJ A;  2ZNZ A;  1G4C A;  1X0P A;  4BLG A;  1KDN A;  2PI5 A;  4KY3 A;  1PJ6 A;  3ENW A;  2ZFH A;  2DCU B;  4PUO A;  2ZVI A;  1F60 B;  3LPY A;  3W5X A;  2KTQ A;  2ZKT A;  5ETL A;  3JSM A;  1LWF B;  3CCL S;  5KT6 A;  3G86 A;  4WTO B;  4ECU A;  4PWD A;  2AEF A;  3FBB A;  4NAS A;  4P73 A;  1IKV B;  4Z7Y A;  4ZLL A;  3NNA A;  4ZOS A;  2HS0 A;  4L76 A;  4OFZ A;  1MN9 A;  4IYQ A;  3R5D A;  4A8S A;  3KOA A;  5C2G A;  4F4A A;  4QWC A;  4CH7 A;  4Y2I A;  2YKN B;  1CQN A;  1QAY A;  1NM2 A;  2CVE A;  1U24 A;  1TL5 A;  2M52 A;  2E66 A;  3SFG A;  2DNQ A;  1NZ8 A;  4DEZ A;  2FC8 A;  4X4P A;  1T03 A;  2Q6C A;  1HBU B;  1R0C B;  4QYZ J;  3MR3 A;  5LMU J;  3HT3 A;  5GAH I;  2OHD A;  4F0H A;  4ETZ A;  2V8D A;  1NPR A;  5I3U A;  4WP8 A;  3DOK B;  3ET6 A;  5ETK A;  2ZBR A;  1X4D A;  3I5B A;  2BAB A;  2HEK A;  3HF5 A;  4LR9 A;  1HNI A;  2X1G A;  2WSC C;  3HZE A;  1FJ7 A;  1WHX A;  1FFW B;  4TKT A;  5L9X A;  4M5J A;  2DIV A;  4H4M B;  1A0O B;  5B0E A;  4OYM A;  2YNH A;  3VQS A;  2WVD A;  3PZP A;  2UUA J;  2VQF J;  4OI0 A;  4HEA 9;  1VGY A;  2R42 A;  3DKD A;  3OTB A;  4G65 A;  2HBZ B;  2RAQ A;  3DOL A;  3T9N A;  1N34 J;  4ZCI A;  2CDR B;  1DQ8 A;  4QIW D;  2UUB F;  5KT3 A;  4DDF A;  4P9S A;  1KBR A;  3QIP B;  4E8U A;  5GAD I;  2Z0G A;  4B3S F;  4PQU B;  1ZPV A;  6FD1 A;  3MED B;  5IC4 B;  1XR6 A;  3G2X A;  3FSI A;  4USJ C;  2EC2 A;  4WXO A;  3N5F A;  1XNR J;  4G1I A;  5KAK A;  2QG9 B;  1VIO A;  3OW2 R;  4C0O C;  4MK7 A;  3MUR P;  1X4C A;  2F9J A;  1Y9O A;  2YBV A;  4A8X A;  3EYZ A;  2XMW A;  4F67 A;  2J76 E;  2HFV A;  3MR6 A;  1GMV A;  3GG1 A;  3UD4 P;  3A8I A;  4YY3 F;  1S48 A;  1IKW A;  2XCP A;  3D9B A;  1BLU A;  1S0V A;  2FHJ A;  4GKK J;  1VJQ A;  4W4M A;  1NJX A;  1B70 B;  5CA5 A;  5CAA A;  4KV8 A;  1SJ4 P;  3D54 A;  2E1C A;  1B7Y B;  5D4O A;  4CNZ A;  1SI9 A;  4LRE A;  1JLB B;  3HMJ G;  3EGW B;  3OFF A;  2DJW A;  3TA0 A;  4YFU A;  5KG5 A;  3CCE S;  4Y0F A;  3LPE A;  2HG4 A;  2Z2M A;  4L6V 3;  2HNY B;  4LFA J;  2CWK A;  5L1L A;  1FVQ A;  1EKS A;  3SYZ A;  3Q8S B;  4KHP F;  3UE2 A;  3A13 A;  3K8W A;  2OFH X;  2CQD A;  2EW9 A;  5E33 A;  3CED A;  4K4T A;  2AZ3 A;  2BV3 A;  3MM9 B;  1HHQ A;  4DU7 A;  2VQE F;  3KLH B;  5DG7 A;  3SSR A;  4RNF A;  1F9H A;  4EMD A;  1RDR A;  3DDI A;  2FGC A;  2FLN A;  2IIH A;  5J2M A;  3CCV S;  1N6Q B;  2XCA A;  3T3F A;  1T05 A;  2YX7 A;  4X65 F;  2XY7 A;  4PRF A;  3AHP A;  2P6T A;  4ENO A;  3AQP A;  1N8R T;  1NO8 A;  3QRR A;  3MR7 A;  3NL0 A;  2AYG A;  5ETQ A;  4YEA A;  2DH7 A;  4F4K A;  1DBD A;  2HQG A;  1YBU A;  3ILO A;  3S7R A;  1C0T A;  1X0F A;  3IA0 A;  2BBE A;  3W9J A;  3SI8 A;  2H54 B;  3UN2 A;  1ZTW A;  2VA3 A;  2XMV A;  4DSJ A;  4OYP A;  3FNN A;  1NK0 A;  1NAQ A;  1U1M A;  2XYH B;  3H40 A;  1YZ7 A;  2MEW A;  2D7S A;  3WX4 A;  4O3S A;  1VQY A;  4X4S A;  2DIT A;  4DR1 F;  2WK4 A;  3VQT A;  3Q0A A;  1UFW A;  4HR2 A;  1RT5 B;  4CH0 S;  1M5P C;  5DGB A;  1W7W A;  3BN4 A;  4BBY A;  5J2Q B;  2EFP A;  2P5V A;  3VVU A;  5F3Z A;  1YK9 A;  4NWB A;  2VOP A;  4Q43 A;  2DNY A;  1FA0 A;  5KFO A;  1S12 A;  3W8G A;  1FJE B;  1SQE A;  1CUL A;  3CJ2 A;  4OX6 A;  4LF9 F;  3OLB A;  4LF4 J;  2KXH A;  5U47 A;  4I4B A;  3U1N A;  5CAB A;  4ANE A;  4MK9 A;  3NXZ A;  1TKZ A;  3NLC A;  2W2Q P;  4FN5 A;  1V5I B;  3A4T A;  5D78 A;  4V19 J;  5LJ5 Y;  1N6Q A;  3KJV B;  4NLT A;  2MGZ B;  1ICE B;  3QMQ A;  1SL0 A;  2IMO A;  5LXY A;  3BRE A;  4MIA A;  1XJW B;  3SMZ A;  2PO4 A;  5KFB A;  2FLP A;  1DTT B;  4B9M A;  1K8A T;  4JI8 J;  4F50 A;  3GB0 A;  4A4J A;  5F9L A;  3NAH A;  4LR7 A;  1CSJ A;  3L7P A;  4W98 A;  3EZO A;  2ZIT A;  1OYD A;  3BEG B;  2K06 A;  3BGL A;  2XM3 A;  5JJB A;  4ES1 A;  5C25 B;  2GFF A;  3FGV A;  2APO A;  3WBZ A;  3PCO B;  3PHE A;  3RBZ A;  1G1X A;  4DQI A;  3AOB A;  1FK9 B;  1TKX B;  1M1G A;  4B3T F;  5AXM A;  2FHK A;  3NGS A;  3G6Y A;  4LQ3 A;  4ZK7 M;  3UCG A;  4FF4 A;  1DY3 A;  2QLW A;  2QA4 S;  1Q7L B;  2AKW B;  2QLB B;  2PMW A;  4DV2 F;  1G2E A;  3CJ5 A;  1Q5V A;  3TUP A;  5J2Q A;  2IRY A;  3OQ2 A;  1L5U A;  4R5P B;  2N3L A;  4FYV B;  2J6S A;  4CYU B;  4LF6 F;  2N7Y A;  4TQS A;  3Q2T C;  3EZ5 A;  1IKY B;  5DS7 A;  3K59 A;  5F9N A;  4K4U A;  2R7W A;  3BGR B;  2YWE A;  2XSJ A;  3F44 A;  2ZHA A;  4RUB A;  3KKF A;  4DF8 A;  1CQM A;  1QTM A;  2VG6 B;  2BKO A;  2ZDO A;  1VOM A;  3MMC B;  4B3M J;  1WSR A;  3TJ8 A;  1NK7 A;  3HPO A;  1A6L A;  1ZM4 A;  2MKC A;  2RRB A;  2GJ2 A;  2X1B A;  1W25 A;  4NLR A;  1OYE A;  2RHS B;  4P2M A;  4ED1 A;  1YRT A;  1JJ2 R;  1CC8 A;  1TVR B;  4UOH A;  1WOP A;  3D6H B;  2IVM A;  2ZC4 A;  2QA2 A;  3MDF A;  1U4B A;  4ER8 A;  3IBW A;  5H1S V;  4ZCM A;  1GFW B;  4F3O A;  3VHQ A;  3T1Y F;  2ZBQ A;  1JJ4 A;  4KGK A;  4QOT A;  1K0V A;  4YB7 A;  4LUB A;  4OQJ A;  3MM7 A;  2DXE A;  2YPY A;  4PAB A;  3RZA A;  4DLG A;  3DDK A;  1QSL A;  5F8I A;  2XO7 A;  4WE1 A;  2UXD J;  2WON B;  4DL6 A;  4RW9 A;  2ZH5 A;  2YXL A;  5A8W B;  1J5E J;  4M5K A;  3QRQ A;  2R8K A;  2DBB A;  4MIW A;  1RJJ A;  2ALY B;  1BQM A;  3HLU A;  2V8V A;  1YBT A;  3IGN A;  3V6K A;  1S6O A;  2QJ3 A;  3TA1 A;  1C1B B;  3KNG A;  2JH3 A;  5ETR A;  4B3R F;  3JSR A;  4NYO A;  3UFC X;  1CJK A;  1T9W A;  4X4Q A;  4DS5 A;  1KOO A;  3PR4 A;  1CPZ A;  3OFE A;  4NI2 B;  5F0W A;  4ATN A;  5HMX A;  4PYD A;  1T94 A;  1ZYQ A;  3DGV A;  3GCX P;  3W7B A;  1S4F A;  1YJR A;  2W2N P;  4OYB A;  2ZH7 A;  1U09 A;  4FYD A;  1EHW A;  1SKW A;  4FPI A;  2DNP A;  2FVR A;  2XHW A;  4ILL A;  3KHR A;  4LIW A;  2AF6 A;  5D4P A;  5FDL A;  1N32 J;  4J9U E;  2CJB A;  4U8V A;  4C8O A;  1P9Y A;  1GX5 A;  3DRR A;  4DL3 A;  3ONQ A;  5HRO B;  2WVB A;  2C2K B;  4CWB A;  2HWI A;  4CLZ A;  1OY8 A;  3BDP A;  4ZVE A;  4ZIT A;  3N5B A;  2GV1 A;  2DR6 A;  2BX6 A;  2B3T B;  2BJ8 A;  1N5Y A;  4LF5 F;  4FXV A;  3MEG A;  5GAE I;  2ACM A;  4HI1 A;  3C2P A;  4F7V A;  3OTO F;  3T1H J;  4KGV B;  4GO7 X;  2H5E A;  2MKI A;  1QAX A;  2QMW A;  3GII A;  2QL5 B;  2GNK A;  3ZZ0 A;  1JJC B;  1K47 A;  3WX8 A;  1JLG A;  5A8W A;  3BGF A;  1L3S A;  2QV6 A;  4F25 A;  7FD1 A;  1N36 F;  3GZ7 A;  2Z58 B;  1WC6 A;  3QO9 A;  1S57 A;  2LVW A;  3S1T A;  4F4W A;  2YQ3 A;  2YNI A;  1HNW F;  4DPW A;  1M1H A;  4CLK A;  1IBM J;  4UQT A;  3CVK A;  3BGO P;  1C1B A;  2HVH A;  3JSY A;  1VK3 A;  2C22 A;  4KO0 A;  4U6P A;  1H72 C;  4DMZ A;  5K8M A;  1APS A;  4DQS A;  2GHV C;  1KON A;  4JI3 J;  4KAI A;  2NYH A;  5IXU A;  1LW2 A;  2C3U A;  2G4B A;  2F63 A;  2N7C A;  2JC0 A;  2R2S A;  3M6U A;  2Q6B A;  4F02 A;  4BHQ A;  1L3U A;  3WHI A;  1X5P A;  4M5G A;  3HD2 A;  4J9L A;  2E9Z A;  1RAD B;  4J9M A;  2R8J A;  2PD1 A;  2POK A;  3MF5 A;  3VAH A;  3KTQ A;  1U2C A;  1E6V A;  3NS5 A;  2XZW A;  1QSS A;  1W2I A;  4ZJL A;  1ZZF A;  2IC3 B;  2CDQ A;  3KWM A;  5F8J A;  4CCH A;  3DRX A;  2PII A;  1XR5 A;  3RR8 A;  2Z30 B;  4U96 A;  1S77 D;  5A0Y A;  3U7J A;  3FRY A;  5HQL A;  1S0M A;  2LQ8 A;  3C14 B;  1NB2 A;  3ZTR A;  4F2R A;  2HQI A;  4OHW A;  4I67 A;  2H65 B;  4LJM A;  2W9A A;  5H9F K;  4WYW A;  2AGQ A;  4QW8 A;  4IOB A;  1BUX A;  1YSJ A;  4J5O A;  2V50 A;  3JYT A;  1WUU A;  2KL8 A;  2W9C B;  3IR7 B;  3E01 A;  3H98 A;  3I0S A;  5IS2 A;  3NBP A;  2GCF A;  4NRU A;  1LW0 A;  3SQG A;  2EFN A;  1NHV A;  3UR3 C;  3T1A A;  2I6W A;  4R8U B;  4PG7 A;  5ETV A;  4A8O A;  4DV6 J;  3KG0 A;  1QUP A;  2MLY A;  1XBW A;  2BQU A;  1PJ5 A;  2QT7 A;  3DYA B;  3SQO P;  5LMU F;  2GAH C;  4I7F A;  2LQ5 A;  2G9O A;  2RUG A;  1R31 A;  4C11 B;  2WTF A;  3LGN A;  1KLM A;  5E5N A;  4UUW A;  5KFY A;  2Z2Z A;  3SCI E;  4I2Q A;  5A76 A;  1FKP A;  1RYR A;  1S7H A;  3SV4 A;  4UZB A;  2DIU A;  2MPU A;  5B0F A;  2ZE2 A;  2FIU A;  3QT5 A;  4OYZ A;  3M8P B;  1T7P A;  1YDL A;  3PW0 A;  5BYR A;  2HMI B;  3DLB A;  2OI2 A;  1QTN B;  1S9E B;  1RHJ B;  1F5A A;  4CRJ A;  2M0G B;  2EBE A;  1NME B;  1D8Y A;  2UUA F;  2RSQ A;  3CJ3 A;  4KBI A;  1NJZ A;  1U26 A;  2IC3 A;  2AJ1 A;  2JVO A;  3A3N B;  3D3C J;  4TY9 A;  1TKT A;  4DR7 F;  3DFE A;  1ACM B;  1NRK A;  1DZ5 A;  3QWU A;  1SIW B;  2COL A;  2CRL A;  3ELH A;  1PYO B;  3FQK A;  5DQI A;  2A2D A;  1U1L A;  3C14 A;  2KT5 A;  1XTZ A;  3CGI A;  3W60 A;  3FVY A;  3KLF B;  4AYB D;  3W5Z A;  2M2B A;  1S1U A;  1K73 T;  3CMQ A;  1C4C A;  1TL7 B;  2FVS A;  2NRE A;  2B7C B;  5CYM B;  1PIE A;  1RLD A;  4DSL A;  1N5V A;  2CJY B;  3KLI B;  3M6X A;  2OH2 A;  3JAM U;  3AH6 A;  1B0P A;  2W9C A;  3VAG A;  3DXS X;  1VK8 A;  5E3A A;  3AJ1 A;  3FBF A;  1KQF B;  3CJ0 A;  3MM8 B;  2D9O A;  1NKB A;  2QLX A;  5KFN A;  4DOZ A;  5A8K B;  3OT9 A;  4IG3 A;  2RRA A;  1FXR A;  4R8U A;  2XY6 A;  1U2F A;  3KFW X;  3ZZP A;  2E5H A;  4CM2 A;  3OTE A;  5KFZ A;  4ZS6 A;  1B0T A;  1X4E A;  2MZT A;  3MI7 X;  4X4V A;  2J6U A;  1V6H A;  3ETO A;  5KFP A;  3I31 A;  1BD6 A;  4A8M P;  4A48 A;  4NLX A;  5LM7 E;  3W9H A;  1T9V A;  5J2P B;  4N8O A;  3MPW A;  1VRU A;  4DCO B;  1U02 A;  3K5L A;  3MM6 A;  4LFA F;  4RX6 A;  3HSD A;  4O44 B;  1IBK J;  4C8L A;  2PMZ D;  2OSQ A;  3T6B A;  2QLF B;  1SL1 A;  3Q86 A;  4A8W A;  2VFS A;  4QWD A;  2HRT A;  3HCX A;  4DUT A;  4YR2 A;  4QCL A;  4ZN1 A;  4XO0 A;  4U8Y A;  1NK5 A;  3CSK A;  4KSE B;  3UN3 A;  2RNE A;  3J7A N;  1DQA A;  2DIS A;  4J37 A;  4F2S A;  1IUJ A;  1TFW A;  3DHW C;  1S0N A;  1LK7 A;  2W9B B;  4ZP9 A;  2O5D A;  3N6L A;  2OPR A;  1RAG B;  1N0U A;  1WOO A;  4C48 A;  5C42 A;  2J0W A;  4F26 A;  1F3F A;  3BS9 A;  3Q8U A;  1KKH A;  3ZZZ A;  2D69 A;  2G2O A;  4O3R A;  2V8G A;  4WF9 Q;  1Y10 A;  4C4W A;  3GIL A;  2XMJ A;  4ZPB A;  2VUG A;  3HHD A;  3H5Y A;  1S1T A;  1LOU A;  4N56 A;  3QAT A;  1UJ4 A;  3CCJ S;  3A12 A;  3PEH A;  5M2U A;  4AL6 A;  3IBF B;  4C3L A;  1SJQ A;  5EX0 A;  5CYM A;  2FJX A;  2UU9 F;  3KLI A;  4NA3 A;  3M30 A;  2XS5 A;  1R6Y A;  3RU0 A;  3TAQ A;  2HAI A;  1S1V B;  2FHO B;  3EUN A;  1SUQ A;  3MM8 A;  4HTJ A;  1REG X;  4CT9 A;  2UXC J;  1FRM A;  3TNV A;  5A8K A;  3QAE A;  2AIR B;  2CAD A;  3DRS A;  5D0R A;  3CC2 S;  4J9V A;  4OX9 F;  4NLW A;  3OTD A;  3ILL A;  3OHB A;  3EIC A;  2DTJ A;  4LT6 A;  4K4X A;  3DMJ A;  1KQG B;  1MMD A;  4H4O B;  2M70 A;  3JS9 A;  4WBF A;  4HLB A;  1HNZ J;  2V67 A;  3HHL B;  1WEL A;  4Y34 A;  4ZIW A;  3OR2 A;  5JUM A;  2EFO A;  2V4J B;  3TZY A;  1YGY A;  1RWP B;  1FX2 A;  2CQC A;  2MKY A;  4NZ7 A;  1UWB A;  2MSS A;  1UA1 A;  2JVR A;  3IO1 A;  1LWE A;  1NH8 A;  2CNK B;  4NXN F;  4C8K A;  4M5D A;  3PR5 B;  2B56 A;  4DV3 J;  2RE1 A;  3HSG A;  2K1R A;  2ZOG A;  3HVA A;  4DR2 J;  5L1J A;  4DF4 A;  4KRW A;  1M5K C;  1OO0 B;  3M8Q B;  3DC2 A;  4CTA B;  3R97 A;  1UVN A;  2EC0 A;  1MW7 A;  4W90 B;  3N9U C;  2HLU A;  5B0D A;  2Y0B B;  4K5S A;  2H1Y A;  5AE3 A;  2BYC A;  1EAY C;  2YX4 A;  1E6Y A;  4JI8 F;  1NPK A;  3V4M A;  1VBK A;  3CPW R;  2YWH A;  1X4H A;  2R7V A;  1U1Q A;  4B9V A;  4J9N A;  3AOA A;  3CB4 A;  5HP1 B;  4LFC F;  2GW8 A;  1AXQ A;  5LJ3 Y;  1U7L A;  6FDR A;  1NDL A;  1P8G A;  2GX8 A;  4OI2 A;  1XIQ A;  2VJV A;  1SQG A;  2W7P A;  4LSL B;  1S6Q A;  2Z4P A;  2ZOM A;  4XTT A;  3M6W A;  4QIF A;  2CPE A;  4CO3 A;  4WPA A;  1IKX A;  2XMM A;  3M7V A;  2VFV A;  3G71 S;  4TN2 A;  1UEV A;  2OEL A;  4J9S A;  2D74 B;  4FF1 A;  3I9Z A;  3KUE A;  1J27 A;  3ZNJ 1;  1UL3 A;  2A6O A;  1HBO A;  1MSW D;  1M1K T;  4KKO B;  4MMO A;  4IFY B;  4YUD A;  1K44 A;  2MST A;  3PV8 A;  4E98 A;  4RW4 B;  1JLQ B;  1RXO B;  3QNW B;  2W25 A;  3GPA A;  4LBP A;  2CPI A;  3NS7 B;  1N33 J;  2ZZT A;  3JQK A;  2V4J A;  3DI6 B;  1N5S A;  4WFB Q;  2C2O B;  4Q2M A;  1ZH5 A;  2E5L J;  1Y5N B;  5HVG A;  3BN7 A;  2XLI A;  3PJX A;  4MKA A;  1FFG B;  1Q1K A;  3BPD A;  1H3D A;  3H4D A;  2GML A;  1Z1Z A;  4YR0 A;  2L9W A;  2RKI B;  1GMW A;  3HP6 A;  4B9L A;  4HKQ A;  5D3G B;  2MQM A;  2VH7 A;  1Q8K A;  3IM9 A;  3LP1 A;  3V6D B;  3LUY A;  2Z57 B;  4RKU C;  1R8A A;  4ZPW R;  1HBM B;  2J9E A;  2RHQ B;  4ZVQ B;  1HMV A;  4EWT A;  1FES A;  4RJV A;  5A2Q Y;  3SCJ E;  1KVK A;  1DHM A;  4I69 A;  1M5O C;  1DFD A;  4HVZ A;  4JV5 F;  3HT0 A;  4DCP B;  5H9E K;  3IBC B;  2GIR A;  2RT3 A;  3PRB A;  3H2U B;  3HJV A;  2MXY A;  2Y1R I;  2AEM A;  3DLK B;  2ZEJ A;  2D3O 1;  1I5O B;  2ZH9 A;  3DOM B;  4Y2M A;  3W61 A;  3C6T B;  5HSP A;  1Y5L B;  4ELU A;  2QYG A;  2KN4 A;  1WDD A;  4OX7 A;  1REV A;  2DO4 A;  3NKY A;  2VG5 B;  3E8O A;  4IFY A;  2UXB J;  1I94 J;  2DNR A;  4K4V A;  2CWX A;  1YLX A;  4P71 A;  1Q78 A;  3W5Y A;  1MLA A;  1RAC B;  3GJR B;  1JLE B;  1TV6 A;  5GME A;  2E1P A;  1NLK L;  3DI6 A;  3ZZY A;  1QVG R;  2H48 B;  1J2V A;  4EYH B;  3G8S A;  1GAO A;  2NS1 B;  4DG1 A;  3H5S A;  2BW7 A;  3B8H A;  8RUC A;  3EM1 A;  3VAK A;  1U0S A;  4IH5 A;  4ZMM A;  3NWR A;  3POT B;  2CQI A;  2NXE A;  2ADC A;  4OL8 A;  4B9U A;  1YJ9 S;  2BM1 A;  3BSN A;  3DM2 A;  3CD0 A;  3W66 A;  5HQ8 A;  3MD3 A;  2VBW A;  4Y65 A;  1BHN A;  4FDF A;  3TVZ A;  2YPZ A;  3BKF A;  4OZN A;  2XWY A;  2G2Y A;  1IR0 A;  1VS3 A;  4OYX A;  1FEH A;  2AP6 A;  2GC8 A;  1YJU A;  3BGU A;  3TAP A;  1F5B A;  3PX6 A;  1GNK A;  2JJ4 D;  3D6T B;  2EXU A;  4E2F B;  1YJV A;  5J1P A;  4QIV A;  4OI4 A;  4ES2 A;  3HDS A;  1HR0 F;  1RWV B;  3OVB A;  4FNI A;  4OLO A;  2ASD A;  4YN3 B;  2HUR A;  1KHW A;  4ED8 A;  2HYI B;  1RTH B;  4I6Y A;  4C8Y A;  4DUY F;  8AT1 B;  1NBE B;  3MMJ A;  2V2Z A;  3VZH A;  2PDA A;  3Q8R B;  3EE3 A;  1EAR A;  4ZVF A;  3D4J A;  2LP4 A;  2UUB J;  3BH7 B;  4IUF A;  1HQU B;  1MWQ A;  1HA1 A;  4NEZ A;  3B4M A;  1Q79 A;  3GTY X;  3T9Z A;  2G13 A;  4DBQ A;  1IBM F;  2JSX A;  1IBC B;  5K14 A;  4KC5 A;  1KNZ A;  2MQN A;  3BBB A;  2VB6 A;  5KOW A;  4GVB B;  1RAO A;  2WSF C;  3MCS A;  2GVD A;  4JI3 F;  3IWX A;  1UEK A;  3I9V 9;  3MOZ A;  2VC1 A;  3E3X A;  3I4P A;  5G0R A;  2G2Z A;  4ELT A;  2XWX A;  2QMX A;  1VQ8 S;  4OLP A;  2JEJ A;  4ID5 A;  4Q0B B;  3IWL A;  1Q81 T;  1TK8 A;  2V4Q A;  3KHL A;  4ZIV A;  5CD4 H;  1C2P A;  3OJU A;  3CDB A;  1VFJ A;  2GJF A;  2DHS A;  4DHV A;  2L3M A;  4FYX B;  2N3O A;  3LP2 A;  3LP0 B;  3DN9 A;  2OUG A;  1N52 B;  2HFU A;  2VL1 A;  2CPY A;  1WWH A;  3S01 A;  4CIO A;  4JOU A;  2BQ3 A;  2CJX B;  1S5Z A;  2KXF A;  4J7C A;  2F5G A;  3C8Y A;  4NRT A;  2YNF A;  2VOD A;  4O3N A;  3ZTQ A;  2AQ4 A;  4EBC A;  5D0E A;  3NCQ A;  2YWF A;  4KGM A;  4X66 J;  2M3D A;  2VQE J;  1CJT A;  1HQE B;  2XSF A;  2ZWP A;  5DG8 A;  3W62 A;  2XMT A;  2BE2 B;  2B5J B;  2ZBI A;  4WIQ A;  4ED7 A;  1WF1 A;  3A3P B;  3M1V A;  1U45 A;  2GHP A;  2UV8 G;  1UP1 A;  3M8S A;  1D0E A;  4KGZ B;  1UZH A;  4U7U D;  1JNR B;  2RML A;  2NUU G;  4X65 J;  4ZVU B;  3FFI A;  1UVL A;  4DV6 F;  2VZ9 A;  1UFK A;  2E9T A;  5C24 B;  1RBL A;  4RPF A;  5IV3 A;  2CPJ A;  3NGU A;  3IS9 A;  2WZ1 A;  1Q8B A;  1MRO B;  1M5H A;  3DLJ A;  4ZHR B;  4PCQ A;  4KR0 B;  3PEJ A;  2JNJ A;  4IQX A;  3SIP B;  3I5A A;  3MMA B;  3VCD A;  2RU9 A;  3QT7 A;  2R9L A;  3D1Q A;  2L08 A;  1S6P B;  2JEF A;  5GAH U;  2WVC A;  2DXD A;  3MPU B;  1BQN B;  3NEK A;  4FXW A;  3W8P A;  2GMH A;  2HNZ A;  2DNG A;  3D0H E;  4JI1 J;  4MFB A;  4DR1 J;  4TU9 A;  4BDP A;  3CC4 S;  1QVF R;  5DM6 Q;  1RT4 B;  3CE8 A;  1XC9 A;  5I42 A;  2PFD A;  2VU5 A;  1QM9 A;  4FS1 A;  5KFW A;  3LP0 A;  4B9N A;  4IG0 A;  2ILY A;  2QO3 A;  2YWK A;  2D3O R;  3C16 A;  5KFA A;  3LWM A;  2C2N A;  4N41 A;  2ZH3 A;  2MLX A;  4ZVG A;  1QE1 A;  4WTY A;  3T5H A;  1RBO B;  3RG6 A;  1RTJ A;  3TX0 A;  4DFM A;  3MEC B;  4B9T A;  3FUY A;  4PQA A;  3O3L A;  4LF9 J;  4YME A;  4RO0 A;  2BR0 A;  1FKA F;  3TZX A;  1MML A;  3D1O A;  1EB0 A;  2XLJ A;  2V94 A;  1HQE A;  4WKR A;  4CO1 A;  1U6Z A;  2YKA A;  2BE2 A;  3M2V A;  5GVQ A;  2MKS A;  4DSK A;  1K1S A;  2IYG A;  4LVN P;  2MKH A;  2R2R A;  5F8N A;  4OMF G;  3GR1 A;  1AZS A;  1JLA B;  3NOC A;  2VPZ B;  2OEM A;  2RIJ A;  1BQX A;  1QD1 A;  3CDE A;  1NCL A;  2B4U A;  4JI7 F;  4XPE A;  2OPS A;  2B6A A;  5LXR A;  2EKN A;  4Z7C A;  2HKE A;  3OPK A;  1SJ1 A;  1RT6 B;  3LAN A;  3B78 A;  2DGU A;  2Y1I A;  4HDH A;  2DGX A;  4DX6 A;  4J9O A;  1H0H B;  3DCA A;  2C2E A;  2QC3 A;  2LDI A;  1MU2 A;  4LSN A;  4DR3 F;  4JI6 J;  3KLE B;  3KK1 A;  2KM8 C;  4C7Q A;  3RRH A;  4DL2 A;  4IOC Q;  3GU0 A;  5GMD A;  5KT2 A;  2HHT A;  2FB0 A;  3NOG A;  1S1X A;  2KXN B;  1RT1 A;  2XHC A;  2C42 A;  3WQP A;  1VBX A;  2WB4 A;  5DLF A;  2AJQ A;  2FVC A;  2HFO A;  5E2Q A;  2OIH A;  4NCG B;  5KFU A;  4HI2 A;  2RVJ A;  2M88 A;  2C2Z B;  3Q8Y A;  2F65 A;  2GGP A;  1X31 C;  1Q0N A;  1NJY A;  1KP6 A;  2YY3 A;  1S1W B;  3V4I B;  2HHW A;  1UMJ A;  4LF6 J;  3EDQ B;  2FJE B;  3R7N B;  4A47 A;  5KFT A;  3RAX A;  3W2V B;  1VMB A;  4RNN A;  4ZVH A;  4D3G A;  2F40 A;  5AE1 A;  1CLF A;  1DRZ A;  4TVA B;  1TL1 A;  4FNH A;  3VV2 B;  4N47 A;  4NLQ A;  3BYR A;  2ZUG A;  2BJ1 A;  4WFX A;  1OWX A;  1WG1 A;  2ACY A;  1SKU B;  3C3L A;  2YNG B;  3ITH B;  2UXC F;  2HND B;  2IAJ B;  1F9F A;  2XYP B;  3VGS A;  3ZZR A;  4OZ2 A;  3RRK A;  4C3K A;  2MQP A;  2M5Y A;  3BQ2 A;  4QYZ K;  4N7T A;  1UVM A;  4B17 A;  1O8B A;  1LKZ A;  5KFC A;  3OLA A;  4IDK B;  4ED3 A;  1FKO A;  3OUY B;  2P9C A;  3DRP A;  3JQJ A;  3KYL A;  4IRK A;  3T1Y J;  1HNZ F;  2GIQ A;  1R8B A;  3CME S;  4YB6 A;  1FJG J;  4NLY A;  2R7U A;  5LT5 A;  4KE5 A;  5F3T A;  2FJB B;  3W2W B;  5A8R B;  1ZA1 B;  1FNX H;  3MAQ A;  1HHS A;  2IBO A;  1YIJ S;  1M90 T;  4DV3 F;  3QAU A;  1T02 A;  3MR5 A;  2C2R A;  2ZJQ Q;  2QFJ A;  4DR2 F;  2JWN A;  5CYQ B;  2OD4 A;  3IRX B;  4ECW A;  1TMJ A;  1AFJ A;  1VRT A;  1F1B B;  4ERD A;  1EP4 A;  2HZV A;  2W4P A;  3KJF B;  2LU1 A;  4WWS A;  4DCJ B;  3UDV A;  1PC5 A;  1HPZ B;  3F73 A;  1H2U X;  3EMT A;  5HLF A;  1HNV A;  2UUC F;  3A8J A;  3Q89 A;  4CO2 A;  2QFI A;  2HHX A;  1RSC A;  2KRR A;  2B8Q A;  3OXG A;  4CLU A;  1HWI A;  4NLU A;  2R8G A;  4E0D A;  4G1P A;  2CJ9 A;  4FF3 A;  5HN0 A;  2I5J A;  3CJK B;  3D0G E;  3CO9 A;  1FRH A;  3OV7 A;  4WXW A;  4ED4 A;  3MGJ A;  5HVH A;  2Y9H A;  2HND A;  4WCE Q;  4IOA Q;  1U6F A;  1U2R A;  3UWT A;  3UCZ P;  2G0J A;  4DV5 F;  3JXO A;  3PX0 A;  1S99 A;  1WSV A;  1OPI A;  1T95 A;  2V68 A;  3RBD A;  4LF5 J;  3NCP A;  3PKY A;  4P72 A;  3JSM B;  2CA9 A;  2WW8 A;  2J0X A;  2HQF A;  4PWD B;  1N33 F;  4DL5 A;  1PO6 A;  3OTO J;  3T6J A;  3H2V E;  1EET A;  1X7V A;  4CQ1 A;  4DJB A;  1SH0 A;  2OEK A;  2ROP A;  1PYT A;  3LF0 A;  2E5L F;  3FQL A;  3OL6 A;  2NYI A;  2VF3 A;  1SXL A;  1JWW A;  4QU7 A;  5D6G A;  4ECT A;  2PI4 A;  1N36 J;  3EPG A;  2PGC A;  4QWB A;  2JLE A;  1T03 B;  3R5C A;  3IRX A;  4ID8 A;  4LF1 A;  1O5J A;  3V5R A;  4JI0 F;  3DU5 A;  1HNW J;  3ZTO A;  3QPI A;  2W8K A;  3FZB A;  3O2I A;  1MWY A;  1GT8 A;  3I0R A;  4USM A;  5I3U B;  1Y3K A;  3ET6 B;  3IP0 A;  3UI3 A;  3QBC A;  5RUB A;  3ILJ A;  1UFL A;  2BRL A;  5K8N A;  3NWG A;  1S49 A;  2W2M P;  4TU7 A;  3WZ0 A;  2W7O A;  3BYP A;  3QGI A;  4EFA C;  1Q7Y T;  1XR7 A;  2J7U A;  4I2P A;  4H54 A;  2K3K A;  5F0U A;  1T0T V;  2GA7 A;  2KVQ E;  3HSZ A;  3CJK A;  4I0W A;  2YNH B;  4ZPD A;  4PG5 A;  1RHK B;  3J7A 1;  1PCA A;  3G82 B;  4C98 A;  2KRB A;  3G9C A;  4WZM A;  2XGP A;  3G6V A;  2NQP A;  2F7V A;  2VV5 A;  3V81 A;  3DOL B;  5K20 B;  2KU7 A;  4KH0 B;  4YS2 A;  3UD5 A;  2JEG A;  3P6Y C;  2UXB F;  1I94 F;  2NPF A;  2RS8 A;  1L3V A;  4RLE A;  2FJV A;  2IPO B;  5GMK a;  2BKP A;  2CQ1 A;  4NPO A;  2PSZ A;  2DPI A;  3HKW A;  2FJD B;  4F04 B;  1Y0H A;  4DS4 A;  4F0K A;  1N0V C;  4LRF A;  1KC8 T;  4PR6 A;  1NSK L;  4DPT A;  4URG A;  2FLO A;  1VQ4 S;  4C97 A;  3V6J A;  2NCK L;  2H51 B;  1IKW B;  2M8H A;  3KDN A;  1WEZ A;  4DQP A;  1Q8I A;  1AUS L;  1CS4 A;  5T7L A;  4KV8 B;  5E0O A;  3TAM A;  4J9Q A;  3R6L B;  5L1K A;  1DAX A;  4WP3 A;  2JDJ A;  1HWK A;  4A8Q A;  3IR6 B;  2PMH A;  2Z2Y B;  3H59 A;  2O1P A;  2NXN A;  1HNX J;  1X4F A;  4LF8 J;  1VQN S;  3HHL D;  2W4C A;  3PYG A;  3K8V A;  2EG1 A;  3A8K A;  1RTD A;  5F8G A;  3RW7 A;  4J9R A;  1JXL A;  3NS6 A;  1ZS6 A;  3I56 S;  1VJW A;  3IG1 B;  1T3O A;  1LQ9 A;  2B0G A;  1GK8 A;  2VG7 A;  3ENA A;  4DPO A;  2R8I A;  1SVD A;  4BS2 A;  5GAG I;  1RTI B;  2QMU B;  2X7I A;  2ZOF A;  2BOP A;  3G82 A;  1WKK A;  4PXB A;  1V3S A;  1YJ7 A;  3M2U B;  1QLN A;  1I3O B;  5KG1 A;  2UZA A;  4QZV B;  4DR7 J;  2MKK A;  5J2M B;  1HHT P;  1LFW A;  2HHS A;  2B7B B;  3OR1 A;  4AQY F;  3HFK A;  1T05 B;  1UVK A;  3N6N A;  2BKN A;  4PWU A;  1WEX A;  2MQQ A;  1TUG B;  2CQB A;  1P9Q C;  1NUE A;  2W4D A;  3N28 A;  2WVE A;  3IAS 9;  1VQ7 S;  3UDE A;  4KFB B;  2IJR A;  4ZLJ A;  5KG6 A;  3OXF A;  1C0T B;  1FO1 A;  5D77 A;  1N56 A;  3P49 B;  1UVJ A;  2BOA A;  3R5G A;  1RCO B;  1N4L A;  4KTQ A;  2KHD A;  4XPC A;  4OHV A;  2FLL A;  1NJI T;  5FII A;  1RUS A;  2DGT A;  2J9C A;  2EVZ A;  3GYX B;  1TFY A;  4EGL A;  4KJI A;  3I96 A;  1UW9 A;  1JIH A;  5HVF A;  5DZ6 A;  2JLF A;  1B0V A;  1VI7 A;  2CNO B;  1RAI B;  1NSA A;  3OXL A;  2LA6 A;  2Y1L B;  2Q79 A;  2GVZ A;  1WC3 A;  1WDT A;  1SV5 B;  2Y0S D;  1NB7 A;  2DNK A;  1U25 A;  2Y8W A;  3IG1 A;  3K17 A;  2XI2 A;  4IFV A;  1CUL B;  2DH8 A;  2DRA A;  3KDO A;  2KG1 A;  3RBE A;  3HZG A;  1FWK A;  2H9Z A;  4DPU A;  5D8H B;  3UNY A;  1KTQ A;  4X66 F;  4ECR A;  5J1E A;  3N6M A;  4DUZ J;  3M6V A;  1TKZ B;  3RW6 A;  1RTI A;  3AJD A;  4WFN Q;  3EVO A;  1URR A;  2XMU A;  5L9N A;  3MCM A;  3G6X A;  3CJR A;  2R3V A;  3M2U A;  2ASY A;  4K4S A;  5HBM A;  3IRW P;  5HI7 A;  1FEE A;  2QSW A;  3ZZT A;  3AOD A;  2MYF A;  4N77 A;  2XBP A;  1DJ0 A;  1XER A;  3QWP A;  5BYS A;  1VQM S;  4QU6 A;  4QWA A;  4CLL A;  5HAN A;  3Q23 A;  2FZC B;  4NMX A;  3DGP A;  5B0C A;  2R7T A;  4KFB A;  3K5P A;  2OTJ S;  4ZPT R;  2M7S A;  2NUH A;  4A8F A;  3ISN C;  2UU9 J;  3J80 U;  5KG4 A;  5CQG A;  5G4D A;  3RB6 A;  1RHR B;  1NHK L;  5KFJ A;  4DX7 A;  1HWU A;  3VTI A;  4FVC A;  2NZC A;  4CO4 A;  3H25 A;  3KMS A;  1CBK A;  5HJX A;  2HHV A;  1Q95 G;  1NJW A;  3D7S B;  4JI1 F;  4OX9 J;  1FVS A;  1VIS A;  5F8H A;  1UW4 A;  3B4D A;  3SCL E;  1X4G A;  3GYN A;  3GV5 B;  4C0B A;  5BR8 F;  2V2V A;  1JXE A;  3CW2 C;  3ZTS A;  1SKR A;  1RAA B;  5KFM A;  5HO4 A;  3AQO A;  3PHT A;  4OV1 A;  2CQP A;  1WG4 A;  3RTV A;  1UAW A;  5CZX A;  1JLC A;  1SV5 A;  3K5M A;  4PG8 A;  4EUV A;  3VWS A;  1R89 A;  1VQL S;  2QX0 A;  1TK5 A;  2W8L A;  3BBC A;  3N0V A;  4NXN J;  5KT4 A;  2XSJ B;  3CCS S;  2HFS A;  2KT2 A;  3ZZU A;  3Q22 A;  5IQQ A;  3FSY A;  4ILR A;  1YRX A;  2XGQ A;  4DPY A;  4WZQ A;  2ZH2 A;  4CLY A;  2MQL A;  1W2B R;  3DRY A;  3PG9 A;  4F3Q A;  2QYC A;  3K7R A;  3LGH A;  1S0O A;  3FEY B;  2M8D B;  2OP5 A;  3SDE A;  2DHG A;  4K7Q A;  3M2R A;  4UZC A;  1BE4 A;  2B43 A;  4K5R A;  1R0A A;  3MAH A;  3KXD A;  2ZWO A;  4OZ5 A;  2JC1 A;  2VC0 A;  1HI8 A;  2PE8 A;  4OJ1 A;  3TUZ C;  4LFC J;  3TAN A;  4ZJO A;  3MM7 B;  3OD2 A;  3U27 A;  5C5J A;  5K9F A;  4L72 B;  3U1L A;  3PW4 A;  2ADB A;  5M2P A;  2KO1 A;  5L1I A;  3MTK A;  3GG0 A;  2AJF E;  4NA2 A;  1O51 A;  1JQG A;  4WE1 B;  4JI6 F;  4RW9 B;  5F41 A;  1DLO A;  1YJT A;  1NDC A;  3MEE A;  1IN0 A;  4CP5 A;  4B3O A;  2HVD A;  2F1F A;  5E3Q A;  1X5T A;  2IDE A;  1U47 A;  1MN7 A;  2R7R A;  1HI1 A;  3HHN B;  1RA6 A;  2GQQ A;  1BQM B;  1OMS A;  4PWW A;  3CDA A;  2AYE A;  5KFF A;  3LOU A;  1M5V C;  2DRB A;  2JRS A;  4ELV A;  4NOH A;  3J81 Y;  1CJK B;  2OLW A;  5IT4 A;  1XQI A;  1NPP A;  4V1A k;  2HQ3 A;  5IC6 B;  3EZU A;  1W26 A;  3P96 A;  2EI5 A;  1FJC A;  1B99 A;  2KFZ A;  3NCR A;  4KHR A;  3KHH A;  2C3O A;  1X9S A;  4IQM A;  2Z8Q A;  1ZPW X;  2HRY A;  1J5O B;  2KKH A;  2VPX B;  2XY5 A;  5E3R A;  1RAH B;  2P6S A;  4EO8 A;  2YTC A;  2RIL A;  2YH0 A;  3KK2 B;  5FDL B;  3IN5 A;  3GFY A;  2WW4 A;  3KK3 A;  4OZJ A;  5CCM A;  3RB0 A;  3SV3 A;  3LAL A;  2DEI A;  4DR4 J;  3DRR B;  3PRD A;  4YDD B;  4Y00 A;  2YH1 A;  2H4W B;  4RW6 A;  1YG0 A;  3H2L A;  1HL6 A;  3AA8 A;  1N5T A;  1IXK A;  3C66 A;  1Q82 T;  4A8Y A;  2X1F A;  1QSY A;  2HWT A;  1U49 A;  4C9D A;  3MPD A;  1N5Y B;  2CJA A;  3EX7 B;  4LRB A;  5B08 A;  2XC9 A;  4IO9 Q;  3MEG B;  2GAG C;  4K59 A;  4JV5 J;  1FJG F;  4X4O A;  1C4A A;  2J7K A;  4HHJ A;  2VDI A;  3OHA A;  1RU2 A;  1HYS A;  5HMW A;  1NXI A;  3J81 j;  1U48 A;  2CXE A;  1U1O A;  4P75 A;  1H2T Z;  4AE5 A;  3IGV A;  1FX4 A;  1SQF A;  2DY9 A;  2ILZ A;  3U02 A;  3HKZ D;  4F4Z A;  1JLG B;  3RB4 A;  4DQQ A;  1ZA2 B;  3QO9 B;  2AGP A;  1FER A;  4ZVS B;  1VCT A;  2YNI B;  3GIM A;  4DN0 A;  4DU8 A;  2H5J B;  1VC5 A;  2JX2 A;  2Y8Y A;  4KO0 B;  3J7Z T;  3F0N A;  4O3O A;  4RNM A;  3B82 A;  1X5S A;  3UDC A;  2MKJ A;  4PG4 A;  2LEA A;  2N4D A;  4M5I A;  1FDB A;  1X9W A;  5B0G A;  1LW2 B;  2Q66 A;  1RT2 A;  1JNZ B;  3OL9 A;  4EU0 A;  4WP9 A;  1J5O A;  5K5M A;  1V9O A;  2V8P A;  2DR5 A;  4EYI B;  2XS7 A;  3QJP A;  2XZT B;  2CZ9 A;  4NLO A;  3ZNU A;  3KK2 A;  4LSZ B;  4A46 A;  3VF0 B;  3K0J A;  1CJU A;  2HK3 A;  4KIA A;  1IJE B;  5HAO A;  4OZ3 A;  1E6V B;  2CPF A;  1LXJ A;  1S79 A;  1EZZ B;  2BVZ A;  3W64 A;  1WOS A;  1XK8 A;  3BQ1 A;  2NPI A;  2KJV A;  2KG0 A;  3VAL A;  3UNG C;  3EVM A;  3CXC R;  4GKJ F;  5A0Y B;  4F8R A;  2P2C B;  1HR0 J;  2LQ9 A;  3MFI A;  2KB2 A;  2OTL S;  3GR0 A;  4HTI A;  2CKW A;  1VRQ C;  4H4K C;  4G1Q A;  1WOR A;  1PGZ A;  4X62 J;  4OYA A;  4ZLP A;  3JYT B;  4OHY A;  4DUY J;  2IRU A;  1CJV A;  3E01 B;  3ZXW A;  1RZM A;  3I0S B;  4RNH A;  3NBP B;  1WKJ A;  1LW0 B;  3SQG B;  1D1U A;  5I3Q A;  2RUS A;  1SJR A;  4LFB F;  1T9T A;  4IH6 A;  3Q83 A;  3W1Y C;  1UZD A;  4DV1 J;  1IWA A;  2OAU A;  1TK0 A;  3VAJ A;  3UN5 A;  3MUV P;  4I7F B;  4NX9 A;  2CPX A;  1WJ9 A;  1F6T A;  7FDR A;  2FPH X;  3B6B A;  1VBY A;  5BXI A;  2EFV A;  1KLM B;  3CTR A;  2X51 A;  1OPZ A;  4UY8 5;  3HK2 A;  2EK6 A;  1GXU A;  4I2Q B;  1P27 B;  3JTP A;  3LAM A;  1FKP B;  2C3P A;  3K58 A;  2KI2 A;  1SC3 B;  4L74 A;  2ZE2 B;  2CPD A;  1RP5 A;  2DKO B;  4AT1 B;  3UQS A;  1Y11 A;  3DU6 A;  3VGV A;  2V8H A;  4CLS A;  2AGO A;  4ZP7 A;  3CJ4 A;  4URS A;  1H38 A;  3JTN A;  1DTQ A;  2E5J A;  4RWX A;  4WK3 A;  1JX4 A;  1WF2 A;  2DNL A;  1RHM B;  5FD1 A;  1PKU A;  3BM7 A;  1SBR A;  1FNO A;  1TKT B;  3FMW A;  3NMA A;  3L4B C;  4M8L A;  3D5M A;  3C6U A;  4OJH A;  2IVY A;  3JAM Y;  3FCW A;  4U9R A;  3UVJ B;  2CQ4 A;  2AYM A;  4WJB A;  5DDO C;  4JB8 B;  2XO6 A;  1S1U B;  3FJ2 A;  2A1B A;  3RJM B;  2D1C A;  1WTB A;  4FP9 A;  1LWC A;  2BAN A;  5KG2 A;  2ZJP Q;  3SCK E;  2XZD B;  4YR3 A;  3MD1 A;  3O1L A;  1GQE A;  3R1L A;  3MUM P;  5C2C A;  3HVT A;  4RWW A;  5HK4 A;  2PC6 A;  2IYI A;  1KEK A;  3CNQ P;  4ZVR B;  4URQ U;  4GO5 X;  1WD6 A;  2OMO A;  4IG3 B;  4LF7 J;  3AXM A;  4AXI A;  3PYD A;  2A3J A;  2V34 A;  3IMQ J;  3J7Y U;  3NGD A;  1TAQ A;  4U95 A;  1R8H A;  3R27 A;  2DK2 A;  5CCL A;  1C1C A;  5JXS A;  3TRG A;  1HNX F;  1RE1 B;  2ZD1 A;  3TZZ A;  3O44 A;  4LF8 F;  3QRP A;  1FWL A;  1N54 B;  2VPW B;  3U1M A;  3HM9 A;  1VRU B;  2I8E A;  2CG8 A;  3MM6 B;  1Q4R A;  8ATC B;  2LU2 A;  1UCN A;  4WU3 A;  2ZUA A;  1YIT S;  4K4Y A;  1MG7 A;  1AW0 A;  2QL9 B;  2F3J A;  4TY8 B;  3QZ8 A;  4FS2 A;  4HAC A;  1FTR A;  4KB7 A;  4YDX A;  1ZOT A;  2RQC A;  3THV A;  4OI6 A;  2XYG B;  1NEE A;  4DQR A;  4EBE A;  2OPP A;  4PG6 A;  1XEZ A;  4L3N A;  3PW7 A;  3PYF A;  1S9G A;  5EWE A;  4O4G B;  3VGU A;  3Q2S C;  2OPR B;  1U0H A;  3R2D J;  4LIR A;  4NL5 A;  1JLF B;  3FEX B;  5C42 B;  1TQL A;  4G6V B;  4ECX A;  3MM5 A;  2VBY A;  3NGK A;  3EJM A;  1S6U A;  1RAF B;  4WFA Q;  3QFH A;  3PKM A;  4R0J A;  1S9F A;  1JK9 B;  3UVJ A;  4KT0 C;  2KYZ A;  1NK4 A;  1X60 A;  1TMM A;  2DGO A;  3BH6 B;  2HW3 A;  1RT7 A;  2UVU A;  5KG3 A;  3FEZ A;  1S1T B;  2KZM A;  3DLG A;  3LGM A;  1UVI A;  5HQM A;  2BA9 A;  2OJ3 A;  4HHH A;  1OS5 A;  3M30 B;  5J2N B;  1KSP A;  3SFU A;  4RBT A;  4NXM J;  3T5L A;  1SUQ B;  4CO0 A;  3LWL A;  2Y1J A;  2DHH A;  3PAC A;  4QYR A;  2V63 A;  3H8Y A;  2GMJ A;  3DRS B;  2AJ2 A;  3FRZ A;  1NK6 A;  1N48 A;  2L41 A;  1FD2 A;  4KYZ A;  3M9M B;  1VIX A;  2LEC A;  4JI7 J;  3DMJ B;  4Q44 A;  4I68 A;  4OHZ A;  1XWL A;  5DG9 A;  3AAW B;  1XNQ J;  1LWF A;  1LEO A;  4C8M A;  3OR2 B;  3H5U A;  4YB5 A;  4EI2 A;  4MJK A;  2BE7 D;  1IKV A;  3CCM S;  3AY0 A;  2Q1L A;  5IFM A;  4X4U A;  1UWB B;  2DXF A;  4DR3 J;  1LWE B;  2WSE C;  4TY8 A;  4YQW A;  4ITS A;  2VBZ A;  4M5D B;  1RAB B;  1HWL A;  2YKN A;  4Y2A A;  3MUT P;  2ZH1 A;  2FY1 A;  4JI5 F;  3L3C A;  2K1R B;  3ISZ A;  4DUZ F;  1YRU A;  1ARO P;  2J0S D;  3TP2 A;  1HBU A;  4O4G A;  3H7H B;  5DET A;  2NLW A;  5AXL A;  5L46 A;  2J5A A;  2LYV A;  1RTZ A;  5B09 A;  1U1R A;  1JLF A;  4DR6 J;  2HBY B;  5LMN J;  4J9K A;  3FCH A;  2V5H G;  1TL3 B;  4EEY A;  3DOK A;  4DL0 C;  1H7W A;  3SXL A;  3BO3 A;  4UOC A;  1IQZ A;  3E2E A;  3WIV A;  5ETT A;  3BJY A;  3KUG A;  3M8R A;  3WC0 A;  4BC9 A;  2OO4 A;  1E6Y B;  1FD8 A;  1YKW A;  2LEP A;  2FJA B;  3P8B B;  4Z37 A;  4NLS A;  4UST A;  2QE5 A;  4JBC A;  3G96 A;  4H4M A;  2IM1 A;  1R27 B;  2CG4 A;  2XQC A;  5J2N A;  2HHH F;  5HL7 Q;  2ZHB A;  3FZ2 A;  3MFH A;  1LK5 A;  1S6Q B;  3FSX A;  4RU2 A;  1XMB A;  3GSI A;  4JYA J;  4K0K F;  2CPZ A;  1R7I A;  2HPU A;  4DV0 F;  1IKX B;  1XMO J;  5K8P A;  2J8S A;  3PIO Q;  4EZ6 A;  3QIP A;  2B4O A;  1HBO B;  4PQU A;  3MED A;  3KNA A;  2ZHO A;  2J8A A;  4DR5 F; 
#chains in the Genus database with same CATH homology
 4UOH A;  4UOF A;  3Q89 A;  1WKL A;  1UCN A;  3FCW A;  4EK2 A;  1XQI A;  2CWK A;  3PJ9 A;  2DXD A;  1S5Z A;  1S59 A;  3BBF A;  4DUT A;  2ZUA A;  1B4S A;  1BHN A;  3G2X A;  3WX8 A;  3VGT A;  1EHW A;  3FBE A;  3PRV A;  2B8Q A;  1BE4 A;  1F6T A;  3EIC A;  4DZ6 A;  3NGT A;  3ZTP A;  3Q8Y A;  3B6B A;  3EVO A;  1NDK A;  1HIY A;  5BXI A;  1B99 A;  4AND A;  2DY9 A;  4ANC A;  3BBB A;  4DI6 A;  1NPK A;  1S57 A;  3ZTQ A;  4FKX A;  1HLW A;  1ZS6 A;  2DXE A;  1PAE X;  3JS9 A;  4O0N A;  4WBF A;  3ZTO A;  4UOG A;  3ETM A;  5C7P A;  3EVM A;  3Q8V A;  3ZTS A;  3FBF A;  2DYA A;  2AZ3 A;  1NB2 A;  1F3F A;  1NSP A;  1NCL A;  1HHQ A;  3VGU A;  3L7U A;  1JXV A;  3ZTR A;  1NDP A;  3Q8U A;  1VYA A;  3FKB A;  3ENA A;  2AZ1 A;  3NGR A;  4HR2 A;  3FC9 A;  1NDL A;  1KDN A;  2VU5 A;  1XIQ A;  1LWX A;  3FBC A;  1LEO A;  1W7W A;  4S0M A;  4F36 A;  1BUX A;  3EJM A;  3DDI A;  3EVW A;  4C6A A;  1NSK L;  3VVU A;  4W98 A;  3BBC A;  1NDC A;  1WKK A;  3VGV A;  4CP5 A;  2HVD A;  2NCK L;  2HVE A;  3GP9 A;  1NLK L;  2B8P A;  2BX6 A;  3FBB A;  4KPC A;  4ENO A;  3BH6 B;  5CAA A;  1MN7 A;  2DXF A;  2HUR A;  3B54 A;  3FCV A;  3NGU A;  1NHK L;  3MPD A;  1WKJ A;  1PKU A;  3VGS A;  1MN9 A;  3EM1 A;  3EE3 A;  2BEF A;  3ELH A;  3Q86 A;  3DKD A;  1K44 A;  3EMT A;  5IOL A;  3Q83 A;  1U8W A;  4F4A A;  5CAB A;  4ANE A;  1NSQ A;  3R9L A;  3NGS A;  3VVT A;  1NUE A;  4FKY A;  3GPA A;  3BH7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...