3GP9A

Crystal structure of the mimivirus ndk complexed with gdp
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
133
structure length
133
Chain Sequence
AGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
total genus 43
structure length 133
sequence length 133
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2009-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3gp9A00
1JXVA 1BE4A 1NSQA 1NSPA 3EMTA 1NB2A 3ZTQA 3FBFA 1ZS6A 2HVDA 3BH6B 3EE3A 1MN7A 1KDNA 1W7WA 3WX8A 4ANCA 3Q83A 4WBFA 1NDKA 4ANEA 1LEOA 3FCVA 3G2XA 2DY9A 3ZTOA 3NGRA 1XQIA 3VGTA 2DXDA 3FCWA 1NUEA 4UOHA 2ZUAA 3DDIA 1F6TA 3FC9A 5CABA 3FBCA 1NDCA 2CWKA 2B8PA 1NPKA 2HVEA 1S5ZA 3NGTA 3BBBA 4CP5A 4C6AA 3ZTSA 3EJMA 3Q86A 2AZ1A 3VVTA 3EICA 1HLWA 3FKBA 1B99A 2BEFA 3BH7B 3VGUA 1S57A 4S0MA 2HURA 1XIQA 3L7UA 1MN9A 1PKUA 1NDPA 1HHQA 3EVOA 1BHNA 3ETMA 3B6BA 3ENAA 1HIYA 1B4SA 2VU5A 1NSKL 3GPAA 2NCKL 4DUTA 2AZ3A 3PJ9A 4F4AA 2BX6A 4DI6A 1BUXA 2DYAA 3ZTPA 3Q89A 3FBBA 1VYAA 4UOGA 1NHKL 3EVWA 5C7PA 3VVUA 3GP9A 1PAEX 3BBFA 3NGUA 2B8QA 4KPCA 3Q8YA 4FKXA 3JS9A 1EHWA 1U8WA 3BBCA 3PRVA 3ELHA 1NLKL 4UOFA 5BXIA 4EK2A 1NCLA 1UCNA 2DXEA 3Q8VA 3VGSA 3NGSA 1F3FA 1K44A 1S59A 3MPDA 4O0NA 1WKKA 3DKDA 3EVMA 1LWXA 4FKYA 3B54A 4DZ6A 4ANDA 3ZTRA 4ENOA 3EM1A 3R9LA 5CAAA 3VGVA 2DXFA 1WKLA 4HR2A 4W98A 4F36A 5IOLA 1NDLA 3FBEA 3Q8UA 1WKJA
chains in the Genus database with same CATH superfamily
2BM1A 3IXQA 1RZMA 3QWPA 5IC6B 4DR4J 5D0RA 1NDKA 2HHTA 1Q81T 1FHTA 1F1BB 3VZHA 1TV6A 1Q79A 2B9YA 2NZ4A 3QWUA 3QJLA 2CJBA 1Q7LB 2DEJA 2OUGA 5RUBA 3SDEB 1RHQB 4YR0A 2UXBJ 2VBWA 2XY5A 1IVZA 4F04B 4P6QA 3M8QB 4LRBA 5L1IA 1UVIA 2C2OB 1ZA2B 3G6XA 2WBRA 2AEJA 2WSFC 2CPFA 3DRPB 3BQ1A 1VIOA 4DPYA 2V9WA 4RW8A 4CLYA 4PZVA 3PYGA 4OHWA 3RB6A 1AUDA 3TAPA 2ROEA 3OSPA 2JDJA 4TU9A 1U7LA 5FDLA 2OEMA 1NJIT 2FHJA 3W62A 1UWAA 2CJKA 3DNCA 4C98A 1AXQA 2FVCA 3N5FA 6FDRA 3JQKA 4Y28C 1S1UB 3PVXA 5T7LB 1S1WB 2PI5A 1CS4A 4KV8B 4OX6A 1TKDA 1B7YB 3I96A 2HGMA 1OO0B 5HQ8A 3K8WA 2OPPA 2VBZA 2J76E 4DU8A 1YBAA 1S48A 4PRFA 4YEAA 4DSKA 4OLOA 1WC0A 4TQRA 5KFNA 3MPYA 4CWBA 4S0MA 2HHHF 1X4EA 1VRUB 3PRDA 4LSNB 2XO7A 1VISA 2JH3A 4C3MA 2NYIA 1RABB 2HK2A 5L39A 2ZD1B 4DL3A 4OL8A 4J9VA 3CD7A 3MECA 4JV5J 4B3OA 1JJHA 1DQ9A 1VQ5S 2GQ2A 2CNLB 1V5IB 1U1KA 2PC6A 1X4DA 2DNGA 1VMBA 4JI1J 2RNEA 2HQCA 3CCES 1U47A 4CLKA 3TAMB 4KIAA 1IBKF 3FVYA 4J9MA 3FRZA 1JWWA 1U1LA 3BH6B 4ED5A 1ZPVA 3SDEA 2GMLA 2BZ2A 2ZITA 4F4YA 1YJRA 2F4FA 2F8EX 2Y1LB 3KJVA 3KDNA 4A8WA 4M95A 2KH9A 2V2ZA 2DNRA 2XHWA 3EICA 3BZQA 3PG9A 1D9AA 3K89A 1I6JA 3FFIB 1WD6A 4C0HA 5K8NA 3VWSA 4FBUA 2NR0A 2QA2A 2OELA 4IRCA 2P2CB 3MUTP 3DHXA 4CQ1A 2IA0A 4J9UE 3R5DA 3TA1A 1FRIA 4G65A 3M2RB 2W9CA 2DHHA 1LWEA 1A7GE 3QGIA 4QW8A 4LF8J 1RT5A 2BVZA 3Q23A 2YNGB 2E9TA 2OTLS 3E2EA 1QSLA 3R1HA 2FHKA 4W98A 3TW0A 3ZZZA 2X1BA 3RGIA 3JSYA 1UFWA 3S8SA 5IQQA 1HI0P 1PJ6A 4O4GA 4NEYA 1B0PA 1HW9A 1OIAA 1ULRA 5LXYA 2PE8A 4JI7F 1TL3B 3DYAA 3QT6A 2MGZB 2GAHC 2J8AA 3IWLA 3LO3A 4P2XA 3T1YF 1S6QB 4WP8A 5H9EJ 4HKQA 2ZD1A 1BQMA 2RHSB 1Q5YA 3D3CJ 2C2KB 4AQYF 2KT2A 1J5EJ 2AJ4A 2VOPA 5LL6d 3GPAA 4I56A 4PG4A 2ATLA 1NHKL 3DLHA 4LRCA 3W66A 1U8WA 1S7HA 2DIUA 1RDRA 4NCBA 2VA2A 4UY85 1HBNA 2WW8A 1DTTA 5ETPA 3ZZUA 4I64A 1HPZA 1XTZA 3VAHA 1RHJB 4DV5F 3M32B 4O3RA 2LFVA 5DGAA 1S1VB 3CIZA 4GMKA 2LMIA 3VCDA 1K0TA 1VQLS 1YZ6A 1ZETA 2A10A 2VB6A 4NLUA 3THPA 2XSFA 4KKOB 3RBEA 2I8EA 1QE1A 2B43A 3L3CA 2L41A 3D6FB 2M2BA 4OYMA 4ZLLA 3RAXA 1LWCB 3ZXWA 1T05A 4K0KJ 4IDKA 3FFIA 1QUPA 2XNRA 4B3MJ 5HQLA 2A18A 5K8OA 3PY8A 2GQCA 3A8IA 3SBMA 1YJ7A 4USHA 4WU2A 3CDWA 3H98A 3W60A 3NBPB 3D66A 3TEHB 1XWLA 3SYZA 2HMIA 4I1TA 3OR2A 3HJVA 2J7WA 2D74B 3K5MA 3LP0A 5KFIA 2Y8YA 5HMXA 1EHWA 5GAHI 3DLJA 2ZH2A 2XY6A 1YK9A 1FWKA 4F0HA 1PYTA 1AYEA 1SC4B 3PDNA 2CVIA 2HHXA 2DB1A 3QO9A 2HFZA 4HL9A 3MXHP 3N4WA 4ZVPB 3K5PA 2X1GA 5IXUA 1ICEB 4C48A 3OR1B 1NHVA 4MMOA 1V3ZA 3CJ2A 5EWGA 5J2QB 2MGZA 4RBVA 1RCXB 4ED3A 3FZBA 3SCLE 5CABA 3CDEA 3G6YA 1KQFB 4ZOSA 1BXNA 1I3OB 4QW9A 3QAUA 2HWTA 2WSEC 3BSOA 3L9ZA 4ZPBA 4AL5A 3DHWC 2I6WA 4PYAA 3WHIA 1PJ7A 4KGVB 4TXSA 4B9LA 2O67A 3BO3A 2UXBF 1CVJA 3IS9B 4X66F 5DLFA 4DWIA 3QT8A 3A8JA 3M32A 3V4IB 1Y00A 1S1VA 1T95A 1SUQA 1RSCA 4L3NA 4KKOA 4EYIB 2JEIA 4PG8A 4RW4B 2H51B 1D8ZA 4H4KA 3UN5A 2F4VJ 4PXEA 1BE4A 1LWCA 1Y11A 3QSYB 3CE8A 4JI8J 1U1PA 2D1CA 1MN7A 4YN3B 3IA0A 3IRXA 1TKZB 3DLGA 2BACA 3UI3A 2NXEA 3HFZB 5CYQB 2U2FA 4RUBA 5DM7Q 1EAYC 1R0CB 3G71S 3I6PA 5B7WA 1CQNA 2MKYA 3FGVA 4RW6A 1VC0A 2V4JB 2H54B 2IIHA 2OD4A 1OPZA 1XNQF 4Q8FA 4XK8C 3CC4S 3DOKA 3CPWR 3CJKB 3BV8A 3GIMA 3X3UA 4FNIA 4B02A 2MQLA 3AOAA 3CO9A 2OPSB 4PXCA 2E9RX 1JLBB 5ADZA 1WOPA 4YS2A 1REGX 3RRGA 4PQUA 2CRLA 2P8IA 4QWEA 3FQKA 1U1MA 3OR1A 3MPDA 2JEFA 5J2QA 2CDQA 1Y9OA 2N82B 4DQPA 3I5CA 4C11B 4Q44A 1LOUA 4JI1F 2CA9A 2ZDPA 1ZM9A 5B0AA 8ATCB 5J2MA 5HMWA 3OV7A 3RRHA 5HLFB 4NLWA 4CH0S 4EGLA 2R7RA 2PDAA 3QJPA 2B7CB 5L1JA 4MFBB 4G6VB 7FDRA 4FNHA 3H40A 2BE9B 1HNWJ 2D3OR 3W3SA 4DOZA 1RWNB 3VVTA 3TYTA 1C4CA 3I0SB 5ETVA 6FD1A 1S6OA 3R3TA 4WJBA 3H4BA 3Q2TC 4Z7YA 4XTTA 2B9EA 3V4IA 2FD2A 2NCKL 3SI8A 2IJRA 2RRAA 1RU2A 3W8GA 3H2UB 4RW4A 1NPRA 1JJCB 2F1FA 3QYYA 3U1LA 1NLKL 1RAHB 2JLEA 3M2VA 4TYAA 2VPXB 2DNPA 5EDWA 1IJFB 4RBTA 1CULB 4PKDB 5D4OA 2RD5C 1UJ4A 4C3LA 5CYQA 1L5UA 2HHQA 1M90T 3IG1B 4P2FA 4B08A 4ZVRB 2E44A 2V4JA 4LVNP 5KG6A 1T7PA 3CCTA 4F0KA 1A9NB 3GYXB 1LEOA 3RG6A 2CVEA 5G0RA 1V3SA 2ACMA 3RYLA 4OZNA 3BR8A 2FLPA 1U0HB 3D68A 3ULHA 4Q2LA 3ZZRA 4DF4A 2XEXA 2L48A 3GJRB 2DRAA 4EBCA 4IOAQ 2IVYA 2O01C 2YVSA 2LQ5A 4OI3A 1X4FA 2MEWA 3HSDA 2XYGB 2E7XA 3T19A 3L7UA 1NDPA 2P6SA 1T03B 4LF6J 3WX4A 1B4SA 4ZJQA 2R8JA 1RTJB 4G3IA 4C8ZA 2MQNA 2LYVA 3NLCA 2E7VA 3I82A 1J5EF 4J5OA 3PRVA 3NNHA 3L95X 2J6TA 1WEZA 3KLHB 5LJ5Y 3ISND 3KNGA 2G13A 4F67A 3EX7B 4PYDA 1M5SA 3VGVA 1OQ6A 3HFVA 3BKFA 1OSCA 2DXFA 2CDRB 2R8HA 3A3PB 3CW2C 2EWHA 1FEEA 3Q8UA 2MKIA 4CNYA 4MFBA 1YVFA 3BPSP 2XB2D 4NLYA 2VQFF 4BCAA 2E9ZA 4F2RA 1EZZB 4KB7A 4Y2KA 4HI1A 4QU7A 2R7XA 3I0SA 3T1HF 2YWFA 5KT2A 1NM2A 1ACMB 5KFWA 3V81B 5AXKA 1HI8A 2KN4A 3DRYA 3OL8A 2R8IA 4EI2A 3UPFA 3M2UB 4X84A 2NXUA 3TUJC 2YWHA 2C3YA 1WORA 1RWPB 5KFYA 2KI2A 2WW4A 1VOMA 2CQ0A 3D54A 3X1LB 3M1VA 2BRKA 5KFCA 2UUCF 2KHDA 1CULA 1X8DA 4EZ6A 3IRWP 2AJ0A 3ETOA 4YHHJ 4Q0BB 7AT1B 4BHQA 4DR3J 5J2NB 2PA3A 1Q1KA 1BD6A 4L73A 2KXNB 1SH3A 1JLQA 3IG1A 1R31A 4KGZB 3KJNB 3KNAA 3VQTA 4NXNF 2VQEF 3PW5A 2IBKA 1S9GA 1XEZA 2OPQB 1TZ0A 2GFFA 2G1DA 4DR2J 3R5GA 5E5NA 2DNMA 3KUHA 1JXVA 3W5ZA 5E3PA 4ZVUB 4PWWA 4ZPDA 3CULA 3U1MA 1N5TA 1D9FA 3FSYA 1FERA 1S4EA 4P71A 4WTYA 2KDOA 4QYZJ 5CZVA 5I3PA 1MMLA 4TU7A 1X5OA 3IM8A 3A13A 5KT3A 1RTJA 5E41A 3HKZD 2GQQA 2M8HA 2HHSA 4RW9B 2DR7A 3EVOA 1PC5A 1VQMS 4I4BA 3KLHA 4RU9A 3MR5A 1HNXF 1MROB 4QIWD 3NEKA 3NWRA 4U95A 3R7SB 3HPOA 4H4KC 3MM5B 2ALZA 3DLLQ 2MKHA 3C16B 1YX2A 1VFJA 2VV5A 4J37A 2RDDA 3IWXA 5J2PA 3OVSA 3NCQA 3K5NA 1K44A 5C25A 2NSBA 1RTIA 3C46A 1LWXA 3H2VE 2DKOB 2DCUB 1JLAB 2B6AB 4OZ2A 4F3QA 2R7TA 1GX6A 4W90B 2WONA 2V4RA 3FSXA 4IFVA 4L3KA 3V81A 1FESA 4K4TA 1AW0A 5CQGA 4LF5J 3A3NB 2FPHX 4IUFA 3M2UA 2F4VF 1PC4A 3BR9A 4FZVA 4JI8F 3KMQA 3W9HA 4TY8B 2XMMA 5EX3A 3ILJA 3M9NB 1U1NA 2FJBB 3I4PA 5D4LA 2D7SA 3R6LB 2IMWP 3HMJG 2OPRA 4NLTA 3BGUA 4RL1A 4O3QA 2AGPA 5D0GA 1WOOA 1FXLA 3FMBA 2RF2A 4KE5A 3KLEA 4OHYA 2B0GA 5DDPC 1S6PB 1S77D 1JKHB 2HNZB 2NS1B 3W5XA 2HW3A 5FJ4A 4DCJB 5BR8J 2OSQA 2OFGX 2ZH6A 5D4PA 2V8VA 6AT1B 1HHSA 1HWUA 3AXMA 1F3FA 5LMNJ 2QN6B 4FVMA 4Q45A 2UVWA 2GVZB 2XSJB 4Q5VA 3G86A 5I42B 1YSJA 4R0JA 1KONA 1LNQA 3GE9A 1NKEA 4HACB 1O51A 5A8KB 3V4MA 4WF9Q 2RHQB 5DQIA 2VODA 2IYIA 2VDHA 4WBFA 5KFQA 4Q2MA 3BQ2A 3CMQA 2FLLA 4RW9A 3HZGA 1SJ1A 2IJFA 3ZFVA 2DNKA 2NZCA 1L3UA 2M52A 4K7QA 3KUGA 2WSCC 2XMKA 1TK5A 3J7AN 1HNWF 2X1AA 3NRBA 3H20A 5B08A 2EG1A 3BREA 1HD0A 4FXWA 1M5KC 3P49B 5HP1B 1RT6B 5AJ3F 2B6AA 2ZH4A 3WIVA 4KFBB 2ZJPQ 2W2MP 2PFFB 3M8WA 3POTB 2CQBA 2MTLA 4NMXA 4OYPA 4JI3J 1TELA 5CAAA 5GAEU 4DQSA 2B9XA 2W2NP 2G0JA 1I94J 2QJ3A 1FT8A 2MDAA 1RGVA 4ILLA 1URNA 1C0TA 4TY8A 2YWEA 2UUAF 1HMVA 2EKNA 2VFRA 3F73A 1XR7A 2ACYA 2NPFA 2APOA 4AL6A 3D3BJ 2DHAA 2C42A 3TQEA 2MKCA 4YB5A 3UR3C 4DUYJ 4RO0A 2M70A 4Y3CA 2OTJS 1GMVA 5DDQC 2HNZA 2C2DA 4ELUA 3VGUA 2YKMB 4F4WA 1Q8BA 1SQFA 4RNNA 4TLRA 4CO5A 3P5BP 4KSEB 1NK9A 1IWGA 1HARA 2VD3A 5DG8A 5GAGU 3CD5A 3RB0A 3BBFA 2R7QA 2KFYA 3ILLA 1EETB 5EUHA 1JJ4A 1HR0J 2W01A 2CZ9A 3PEJA 4HACA 3CD6S 4KGMA 2VJUA 1B0VA 2XMUA 1T9YA 3OFFA 3GJTB 2CQ3A 3MCSA 3PKMA 2UZAA 5E7OB 2ASJA 1FKPA 3SIPB 3GIJA 1KSPA 1VRTA 5THWA 4CT9A 4GVLA 2C3MA 1NKCA 3MUVP 4DV4J 3MZIA 3FMWA 1ZAWA 5GADI 4LF2A 1JLGA 3NNAA 2N3OA 2E5HA 4ZPTR 2RUSA 4I67A 5ETLA 2EK6A 3DRSB 4K4UA 1N5YB 3PIOQ 1SKUB 3BGOP 1S57A 3DRRA 2FB0A 2V9KA 5B0GA 1DTQA 2HEKA 2YWKA 1OYEA 3LAMA 2J0QD 4KFBA 3HULA 1OQ3A 2FVPA 1NMEB 3POTA 1N48A 2GJFA 4ZVQB 2OJ3A 4IG0A 4K4VA 1MW7A 2L08A 1U2CA 1HNIA 1HQUA 3R27A 4B9VA 1TK8A 4XO0A 2CQCA 3UNYA 1MWYA 5HO4A 1X9SA 1N34J 1SIZA 3E3XA 5LSLA 4EYHB 3MOZA 4OV1A 3TVYA 3W61A 3WC0A 2C3PA 3MAQA 4DV2J 1T0TV 3VGTA 1Q4RA 2YNIB 2QSWA 1FDDA 2VA3A 3I31A 1WOSA 2ZH3A 3HZEA 4ZHRB 1XMBA 3UD3P 5HJXA 1GMUA 1G2EA 3EXCX 4RUAA 3SZ2A 3OXGA 1SV5B 4DR6J 1S12A 2BJ8A 3MM8B 4AXIA 4Y2CA 1RWKB 3B6BA 1EETA 4ES3A 3BJYA 1BGXT 1WSRA 1APSA 3FK4A 4HDGA 3OTEA 3H4DA 3GYNA 1KOOA 2V67A 1MMNA 2PGCA 1RAFB 2EFPA 2JRSA 3IGNA 4NYOA 2HYIB 4PPZA 3KK2B 3Q8VA 1DFDA 5A8RB 1MU2A 1VDHA 1M1GA 1WUUA 2CAJA 1SKSA 1NZ8A 3M8YA 5D0HA 2ZBIA 1LW0A 2V34A 1V6HA 4ZLPA 2DR5A 2B7BB 1NSAA 5LXRA 2YKPA 5BJRA 3W2WB 3MM6B 4KHRA 2DY9A 1WF1A 3LOUA 3DDKA 3DLEA 4ZLJA 3OVBA 4OJGA 3O8WA 5F0UA 3VV2B 5EWEA 3IWNC 3NMRA 1YKWA 4MYTA 1U45A 3ETMA 1Y5LB 4QWCA 4DL4A 2R8GA 1RUSA 3HP6A 5KFZA 5ITHA 2CADA 3SEOA 4F25A 3CCRS 4WU3A 2XO6A 2YWGA 2VASA 4AD6A 4ZIVA 1QY7A 1ZM3A 3L4BC 4TQSA 4JV2A 1TKXB 1SQEA 1DBDA 2CPDA 4BLGA 1NB2A 4I2PB 4M5GA 2XLKA 3QZ7A 4MKAA 3NXZA 3I5AA 1MNEA 3H5YA 1KQKA 2WTFA 3FJ2A 3GFXA 5KFOA 3MM8A 1PBUA 1IR0A 3JSMB 1SC6A 5DETA 2Q3PA 4C3KA 3ZTSA 1FD8A 2HNDA 1F5BA 4NCAA 4CO2A 1M5HA 2UVUA 3EDRB 2LVWA 1U1RA 1PKUA 2KU7A 1TUVA 2W8KA 4KHPF 2QO3A 1N33J 2G4BA 3D0HE 3UD5A 1UWBA 3MMCB 4RNHA 1OY9A 5K9FA 2DGTA 4OHZA 3HHKA 4CO0A 3SQGA 5A6WA 2ZOFA 1RA7A 2XMVA 3AB2B 3BBCA 4CM2A 4OZ5A 3BSCA 3JTNA 2PSZA 1X0PA 2XS2A 1JLEB 3GFHA 1ZZFA 5L8RC 3NCRA 4XPEA 2ZFHA 5IOLA 5JVHQ 4DLGA 4RU2A 4W92B 2V63A 1UJ5A 2MB0B 4USUA 4JI3F 4GVBA 4B9SA 4WP9A 1IKWB 4ZVFA 4O0IA 2KXFA 1URRA 3I55S 1B64A 2DR6A 4OIXA 3TUIC 3OLAA 2KL8A 3FBCA 2ZBQA 1NPKA 1X0FA 3PACA 1IKXA 3Q2SC 2IYGA 1WG1A 3T6JA 4DQIA 2EC0A 2MZ1A 3TANA 3UCGA 1XIQA 4NZ7A 1UEKA 4IH7A 2V8GA 4OX9J 3NNCA 3ZTPA 1TKXA 1F2HA 4Y2IA 3W64A 2GHPA 1FRLA 2FYXA 1UEUA 4DN9A 1FJ7A 3Q8YA 1FNXH 5K8MA 2FDNA 4J91A 4PABA 1B7FA 1HQEB 2VKRA 3AA9A 1DZ5A 2IDEA 1KP6A 2XZWA 4NLSA 4IO1A 4PXBA 1JJ2R 2W25A 1F5CA 1V5VA 4CLSA 4BWJA 2KT3A 3M6VA 4HHHA 4XDCA 3FEZA 4ZCMA 3P45B 2D3O1 3GONA 5F0WA 1N56A 3UN3A 1VRQC 1VBZA 1RBAA 2MXYA 2V4QA 4FS1A 2DNHA 2YTCA 3S1TA 1U1OA 1XR6A 3UFCX 2Z8QA 3IR7B 2NSCA 3CSKA 2A2CA 5E3CA 3FEYB 4CDIA 1UETA 1BWVA 1RACB 5L9XA 1NJYA 3R5BA 3N6LA 3AFGA 3SFGA 1TUWA 4ZS6A 4ZPVR 5HANA 3NGDA 4C8MA 2I1RA 4ZMMA 4UT4A 1JLEA 4HT5A 3DU6A 3BYPA 2FGOA 4W4MA 1GFWB 2QT7A 1C1CB 2CNNB 2Z57B 4U9RA 5CZXA 4NCGB 2JLGA 2QL5B 2VG7A 1KVJA 3T6BA 2UU9F 3IC1A 5CCLA 3W63A 4WK3A 1HNZJ 2XWXA 3BDEA 4JP8A 2QLWA 1S9EA 3KTQA 3N9UC 3LGNA 2IC3B 3HKWA 2A0FB 2WB1D 4YY3F 3PR4A 4DFMA 2AF6A 5HAOA 1SPBP 2ZNYA 3LP1A 3U02A 2AJ1A 3WQPA 2HQFA 1JXEA 1SXLA 3QMQA 3C14B 1OYDA 1XR5A 3WBZA 1KS2A 3NAIA 3D28A 4NI2B 4P72A 3ILIA 1DQAA 1JNRB 1PAUB 4EUVA 3AJ2A 5H9FJ 1DLOB 3C66A 1LW2B 2B4OA 2XMJA 4D3GA 5L1KA 2R2UA 3UCZP 2LCWA 4NLOA 4J9SA 1E6VB 1XERA 1NAQA 3UD4P 1HQEA 2VG6B 1D8YA 1RT1A 2RE1A 2NYHA 4C0OC 4CTAB 4FF3A 3J81j 2RAQA 2CPYA 4C8YA 2HHVA 2DXEA 2HRUA 2OAUA 2KJVA 4V1Ak 2ILYA 4YUDA 3O2IA 1CJVB 2JL9A 1LXNA 4ES1A 1YRXA 2Z0GA 2JSXA 4RWXA 5IM0B 2XQCA 1BQNB 3MGJA 1Y0HA 4O3OA 1KR4A 2W2PP 4V19J 4G1IA 1X7VA 1RAOA 1LK7A 2QA4G 1HKAA 5KFTA 4R5PB 4NA2A 1R0AB 3H0PA 4CP5A 3R6GB 5KFBA 3EPGA 2JC1A 1UZDA 3AT1B 3DU5A 1YJWS 3EGNA 3AOBA 3ZZYA 3IN5A 3QLHB 3GJSB 4O44A 4M5NA 2QLJB 3GV5B 2M4MA 2CJ9A 4DL7A 3ZO7A 4ZJLA 3I32A 1BLUA 1KQSR 3ZZTA 1NEEA 2ZJRQ 1S0MA 3G4SS 4TY9A 2VG5A 1H6KX 3OTDA 3JS9A 4EK2A 1SB6A 4WFXA 2A2DA 1S59A 2DY1A 5KFXA 4IR9A 3B8HA 4ANDA 1C1BA 5BYSA 5IFMA 3C14A 4CZCA 3KLFA 4H4OA 3SCKE 4LF9J 2FJEB 3UDEA 3KXDA 2GCFA 4YDDB 1T9XA 1IUJA 2C3OA 4ANEA 2QA1A 4ID5A 4KAIA 1LQ9A 3B82A 4HHJA 1VIXA 2Q6CA 4FYYB 2BABA 2IPOB 3OUYB 4YQWA 2CIMA 1FNMA 4QPTA 2KJWA 1E6VA 3W2VB 3NS6A 3JTPA 2GA7A 1AA1B 4DR1F 1VJQA 2LA6A 1N54B 2OH2A 2KM8B 1GTHA 4QCLA 3LUYA 3KLIB 1Z2ZA 1BUXA 4U96A 2VIHA 3PW7A 4WFAQ 4B3RJ 2NUUG 2R8KA 4WFBQ 4KC5A 4RWWA 3W9JA 1BQNA 1C0UB 1IWAA 4XIUA 3K5OA 2HAFA 3AXKA 1A0OB 3BKUA 1X9WA 4K59A 7FD1A 3LALA 2BXJA 2Z56B 3NY0A 2Y8WA 5C42B 1PGZA 4QR1A 2LU2A 4UUWA 2VJVA 2IFXA 1R0AA 2HAIA 1UW4A 3CJ4A 5KFVA 3BN4A 4IH5A 1IQZA 4QWAA 4DSEA 3VAMA 3CT9A 3MI7X 5DDRC 3QGPA 2R9LA 3DM2A 3QLHA 1F60B 2CQ1A 4DN0A 3HVTA 2BUNA 1KC8T 4P2MA 2GGPB 1N36J 1DHMA 1ELOA 3DLKA 1FDNA 2DGWA 4F4ZA 2BEFA 3SMZA 5IWAF 2HLTA 4LFBJ 3H7HB 2CQPA 4NE9C 2W1BA 4A48A 1NK6A 3V6HA 4WZMA 1CPZA 1Y3KA 4IFYA 2HFNA 2MJNA 1CJTA 4OV6A 2AZ3A 3V6KA 3A12A 1N6QB 3D6HB 1YTYA 1IKVB 3GB0A 1D1UA 2BJ1A 4G1QA 2WVEA 2MSTA 4X65F 1F3VA 4K2XA 4HVZA 3QGHA 2SXLA 3Q0AA 2IRXA 4TKTA 1L3VA 4NLQA 5K14B 3V6DA 1RTDA 4Q43A 1RWOB 1DURA 2XG8A 1RE1B 2IM3A 1N0VC 4DQQA 2IVMA 4DMZA 3BSNA 1OY6A 3SFUA 2OP5A 3Q24A 4DSFA 2YBVA 3OUYA 1HBMB 3PTWA 2VFSA 4ZDNA 1AUSL 2VUGA 4KY3A 3DI6B 3W2VA 1IBLJ 4DV7F 1S10A 3FC9A 1NDCA 3U27A 1GT8A 4AL7A 1T9UA 3OTBA 4KH0B 1L3KA 3E01B 4A8FA 3FKBA 4HHUA 5LM7E 1MN9A 1IKYA 2DPJA 1TL1B 2D3ZA 4Z2XA 4IOCQ 3TX8A 4X2BA 2VF3A 2XTJP 1NHUA 1YQHA 5D8HB 1YI2S 3MDFA 2OIHA 2EI5A 4USIA 1S1TA 2YKAA 1DY3A 2FVRA 2CYYA 1FFSB 5HATA 4DR7J 1S49A 2JOQA 2GS8A 1HWKA 2V8HA 4DPOA 3WX8A 1QVFR 4DR5J 3MTJA 3MPVA 2R7WA 1N5VA 3BPDA 2IDLA 3KDOA 4CT8A 5KFEA 2F63A 2H3EB 2EFGA 3O6QA 2FC8A 3GG0A 5HSPA 3HO1A 3M30B 5HVHA 2BA9A 1N6QA 4R25A 3DGPB 1IKVA 1O6XA 2YNHB 5GMDA 3C19A 4X4PA 5F8GA 2MHNA 5K14A 4DI6A 1HNVB 1SI9A 4M5DA 1Q8LA 4WFYA 1RT4B 2E1AA 4MIAA 2DGXA 2KHCA 3LF0A 2M9KA 2ZE2B 4ECYA 2DGUA 2H5EA 2IMOA 4K5RA 2UXCJ 4LSLB 2A6MA 4X64F 3CGIA 1KN6A 3DI6A 4FYXB 3DOLA 2QL9B 1HBUB 5KG0A 2NQPA 1GQEA 1H3DA 3M05A 4DF8A 2F40A 1FXDA 4JI6F 4WP3A 1PYSB 3T41A 5KFKA 2HQGA 1FKOA 4A46A 4J9LA 4FF4A 1RT7B 1NJWA 1R43A 3D6MB 1E6YB 1VHIA 2VHGA 4I6WA 4ZCLA 3HXMA 2GIRA 1U8SA 2VBYA 2W2QP 3QT5A 3VAJA 1VQ9S 4MK9A 3HX9A 2ZC4A 3OW2R 2GHWA 3BQ0A 5HI7A 3SXLA 3CDBA 1NK8A 1HYSA 4DV3J 2VC0A 4G1PA 5F9LA 4Y2MA 2X7IA 3N28A 3T9ZA 2FZGB 2YPZA 1IBMJ 2FIUA 1HBOA 2C2ZB 1RP5A 3CEDA 5KFRA 3K17A 4E0DA 3C6UB 2QLXA 3CNQP 5J1EB 4CYUA 5KFLA 3HSJA 4DQRA 5D0EA 4LF9F 3GV8B 5HMYA 2WOMB 1HWJA 4UOHA 2V2VA 3BN7A 1I51B 3MAAA 5BYQA 1F9FA 1J5OB 1TU0B 1KOHA 1WG4A 1CJKB 4NYPA 2AJQA 1SL2A 2CPHA 4B9UA 1TKTA 3OBIA 4ZP7A 2DBBA 4MTPA 3OHAA 3OL6A 1BHNA 5LOQA 4DFPA 3KKFA 3J7A1 1HD1A 2F8MA 1Q8KA 1QAJA 3OTOJ 4MJKA 3H90A 1RU1A 2EEYA 4DG1A 1IQTA 3CCSS 2E5JA 4KPCA 3FSIA 1RT2A 1FVQA 4RNOA 1M5PC 1HBUA 3IR5B 4RNMA 3ITHB 1H74A 1CC7A 1RWMB 3TJ9A 3C6TB 3CCLS 2X3DA 2ZM6J 5IZHA 2GHVC 4LR8A 3ZTQA 1RYSA 4J7CA 1N32J 1YIJS 2J7UA 3F0NA 1VJWA 2RQCA 2GMJA 2HBZB 1S4FA 2BQUA 8RUCA 1XBWA 4DBQA 4EEYA 1N52B 2MKJA 3PRBA 3AOCA 4DV1J 2FZCB 4ZVTB 2JEGA 2N7YA 2VFVA 3AODA 4ICLB 2AX1A 4WXWA 4NWBA 1Q8IA 2DNNA 2HG4A 1N36F 3IMQJ 5KOXA 4NA1A 5JJBA 3ONQA 1UW9A 2E5IA 2YKNB 5B0FA 4ED4A 1U4BA 4K50A 1UVKA 2C1EB 1PJ5A 2M88A 4K4ZA 4GO5X 1RHKB 1PSDA 5L9NA 2G0CA 5D3GB 4AFFA 2KRBA 3D1QA 3MM7B 2ZUGA 3VAFA 2GO8A 2B56A 5DLGA 3RBDA 2KB2A 1WKLA 4X62F 5IT0A 1NDLA 4M94A 1HHTP 8AT1B 2M5YA 3M8QA 1P9QC 2BMBA 3KG0A 2DHSA 4YDXA 1VK8A 1GAOA 2J0XA 3PXGa 4FS2A 1VQOS 2FHMA 4NRUA 3DRPA 3RBZA 1VQYA 2O1PA 2ZUAA 3DDIA 3LWLA 2KYXA 4RBUA 4NXMF 2DTJA 2Y9HA 4BC9A 1WWHA 1IBLF 3AJDA 4WIIA 4DV0J 2AGOA 3FNNA 2D69A 3QIDA 3DMJB 3NAHA 2DGVA 1RISA 4J9OA 1RBOB 1S1UA 4FF1A 3C6TA 5T7LA 4EMDA 4DUZF 2N4DA 1S1WA 3HVRA 4H4MB 3O44A 4KV8A 4ZITA 4KGKA 1HFEL 4N41A 3TVZA 3GR1A 3I87A 2F7VA 2XMTA 4AE5A 1FJGF 3BGRB 3ISNC 4WPAA 4M5MA 3C2PA 3TO8A 4E8UA 2EVZA 1KVIA 4F36A 3PM9A 2QV6A 2LXFA 3AD7C 1FRMA 5ETQA 1VRUA 4LSNA 1Z1ZA 1W25A 1GXTA 1UPMB 5K5MA 4ANCA 4L75A 3TP2A 1VLOA 2B9WA 1YJVA 5LSOA 2HVHA 4DR7F 1XQIA 4NPOA 2CWKA 2C28A 2W4DA 2CPEA 1X4CA 2YKNA 2RU9A 5ETRA 5HROB 2R7SA 1TL7B 2C2NA 3CJ3A 3TAMA 1T3NA 2KKHA 5B0BA 4QOTA 4JI0J 4A8SA 5LJ3Y 3IAM9 1TR0A 4NLXA 5IV4A 3PJ9A 2HNYB 2R7VA 1J27A 3CC2S 3PHTA 4FXDA 4OI0A 3P96A 3DC2A 2W4CA 4KGXB 3V5RA 1SQGA 4O0NA 1S1XB 1WF2A 1Q82T 3CJ8A 1CQMA 1QM9A 2KXHA 4WXOA 3DOMB 4UTGA 1YRTA 2LXIA 3NP5A 1FX2A 1WDDA 1KHWA 3R7NB 1KWMA 1B0TA 5I4MA 3HSZA 2JWNA 3J80Y 2W9BB 2BOPA 5ETTA 1RI7A 3ISZA 3RB4A 2PMZD 5D77A 3M2RA 4YR2A 3DMJA 3TR5A 2DNLA 4YMEA 1N0UA 2YNGA 2FC9A 2J9DE 4CO1A 2OLWA 2DNOA 2JJ4D 3J80U 3IBWA 3B4MA 2G1HA 3HD1A 4RUCA 4DJBA 3HHNB 3L09A 3W7BA 3LA0A 4DFKA 1FFGB 5DGBA 4ECZA 4GKKJ 3MM9B 3IGVA 4RW7B 4M5JA 2QRRA 1TL3A 4ECXA 3K59A 3OL7A 3RUBL 2V2QA 2P6TA 1G7CB 1FRXA 3SCJE 1S6QA 4DV3F 3HFKA 1M5OC 1Q78A 4HH1A 1TMJA 1WC1A 1WACA 4DR4F 4OFZA 3PW2A 1IBMF 4ZN3A 4Q8EA 3GIRA 3NG8A 2IBOA 3MFIA 1X5PA 2BBEA 3H8YA 2ZBRA 4OZLA 1SBRA 1U48A 4U67Q 5IT9U 3CDAA 4M1KA 4DSIA 2P9EA 3AD9C 5HBMB 2HVEA 5F8IA 4QQBA 5A8WB 4KQZA 3LP2B 1IR1A 4FYVB 5KFUA 3E51A 4LT6A 1IBCB 2UUBJ 2V2KA 2DGSA 2XI2A 1YZ7A 3H2LA 5H9EK 1S1XA 2AYEA 3FBBA 3DOMA 4U8YA 3MMBB 1CEZA 4C7QA 2DH8A 5GAEI 2F3JA 1PO6A 2FJAB 4DX7A 2HVIA 3OTOF 1RHRB 1WC4A 2UUTA 3MEEB 2MPUA 1WHWA 4ZP8A 1JLCB 4GO7X 2F9JA 1XN9A 4B9TA 2W9BA 3LPYA 3NBPA 1GNKA 2CZVC 1F5AA 2GC8A 3CUNA 3MD3A 4DPWA 3I0RB 3QRPA 2ILZA 1X5SA 5K8PA 2HK3A 3GR0A 2Y1IA 4KYZA 2HBYB 3HHDA 1CSJA 4FPIA 1N32F 1VGYA 5M2PA 2K1RB 4JI5J 4F3OA 2DCLA 3PW4A 1RTHB 2D9PA 2ZH9A 2Z2ZA 1EX8A 3R97A 1PYOB 5FLXY 4DV1F 2BANB 2HZCA 2PEHA 3IAS9 5F8LA 2XMWA 3MEGB 4ES2A 4KRWA 2RDJA 1SKRA 3W5YA 5GAGI 2GMHA 3MM9A 4ECUA 2DYAA 3HHLD 4JV1A 4JV5F 1WC5A 2W7PA 3JB9k 3CCUS 3DCAA 2YH0A 2L9WA 3JTOA 1YRUA 5FLXU 1M5VC 4NASA 5J1PA 4K8RA 3VGSA 3TUZC 4U6PA 2CNOB 3MMAB 1R3NA 1RB0A 3SCIE 3VALA 2HS0A 4ENOA 3R9LA 2QFIA 3OXLA 2FLOA 4AUKA 4ECRA 2GIFA 3EMTA 1SC1B 1IBKJ 3KLGB 5A8WA 4OX7A 4ZPCA 1QTNB 4FF2A 3LP2A 1KEKA 4L74A 3W65A 2LQJA 3IS9A 5CYMB 4WFZA 3H25A 3D67A 2E1PA 2DK2A 2IAJB 2I5JB 1WEYA 3JSRA 2XMAA 3MURP 4ZVEA 3PEHA 2GZOA 2YKOA 4DV0F 2YQ1A 3MEEA 2OFHX 5AE2A 3VAKA 2AYBA 2QYGA 1TKZA 3RU0A 4J9NA 1FJCA 4LF8F 2H9ZA 3MCNA 1RAGB 1UVJA 4PWDB 2V68A 2BKPA 4WKRA 3CJSA 3H5SA 3TZWA 4TYBA 1G6BA 1OY8A 4ZCIA 3CJKA 4USMA 2WK4A 3Q8PB 2V8PA 2HVDA 1F9EB 1HA1A 3UDCA 1VQ7S 4IR1A 1RTHA 1S76D 2OPSA 3HD2A 3ZZPA 1JLBA 3OQ2A 3NOGA 3B4DA 3GCWP 3LGMA 1P27B 2YH1A 2HQ3A 2RB7A 3OHBA 1SJFA 1MG7A 3CCZA 5A0YB 2H4YB 2RKIB 3GV7B 5D6GA 1FO1A 3T1YJ 4ZVHA 4C11A 2CQIA 4MIBA 4L76A 4ECQA 4NZ6A 4OZ3A 3F41A 2MY8A 1NSKL 3OFEA 3IR6B 4LUBA 3H5UA 5KT7A 4ELVA 3M6WA 3QRQA 4EO6A 5HLFA 1Z4UA 5CD4A 1TV6B 4LQ9A 1N8RT 4PAAA 4X4RA 3NGSA 2ERRA 1EQMA 5F3TA 3KLGA 2JVOA 3IO1A 2P9GA 4DPUA 1IM6A 2QX0A 1YJ9S 2MZSA 3LQVA 4QWDA 1SJQA 4A8MP 1H72C 3QSIA 4U8VA 4DV5J 4C0BA 4K4YA 1FK9B 2RUGA 2ZZTA 3CCMS 4RW8B 1WI6A 4K0KF 4O3NA 5CXTA 3J7YU 1LKZA 4B3MF 5L46A 2XCAA 3QNWB 4ZN1A 1RHUB 1TAUA 4BWMA 4K4XA 3MR2A 2K2PA 2VZ9A 3O5TB 1JX4A 4DCPB 1WTBA 4O3PA 2W7OA 3T9NA 5B0EA 1CS4B 3OFGA 2CQDA 4EBEA 5J1NA 2O66A 3NGUA 3AB4B 3C3LA 1U0HA 1CJUB 4ERDA 1JQGA 2DO4A 2HS3A 2RDIA 1SCJB 2DHGA 4KBIA 3TRGA 5EWFA 1CG2A 2QC3A 4ZPAA 4OI4A 1T03A 4ZIWA 4OLPA 4PPDA 3QFHA 3CMES 4OZ1A 5JVGQ 2RILA 1D09B 5A0YA 1TP7A 1LV5A 2VPYB 3MECB 2DXDA 4DPXA 4B3OB 4LRAA 3TAQA 1R8PA 2ASYA 2H5IB 4J9QA 4PEOA 5KT5A 1QUVA 4QPXA 3OVAA 4J9KA 3Q86A 4N47A 2HZAA 2R2RA 4OYXA 4WE1B 2HHUA 4N76A 3KG1A 2G2OA 5DO2A 3I9V9 1LWFB 3UW1A 2Y1JA 1QAXA 4FN5A 2UUBF 1NB7A 2DIVA 5DQGA 3KJVB 1ZBTA 4X66J 4QIVA 2M7SA 4OQJA 2C2RA 1U6FA 2LA4A 2Y0BB 4C8NA 1FK9A 3VQSA 3ENQA 3MMJA 3THTA 3SSSA 4P73A 5KAKA 4Z7CA 2B4VA 2GJIA 2WVDA 3N6NA 3Q8SB 2ZHBA 4MK7A 3QRRA 3PYDA 4I2QB 1SH2A 4Q0BA 3D7SB 2W9CB 2LQBA 2WRMA 1LWEB 5J2NA 3K2YA 2DVIA 1RT5B 1S0OA 2WVFA 2EG2A 4A4JA 2LU1A 1FI4A 3EWGA 1V3RA 2OPQA 2R7OA 1XNQJ 4JI5F 1U02A 2BV3A 3KHHA 3MOJB 5IC4B 1CJUA 3KOAA 2ZC3A 4N8NA 4IG3B 4Q7AA 2KT5A 4IYQA 3KJFB 2G9OA 2QLBB 4EO8A 4O4GB 4F8RA 1SJ4P 1CBKA 2RMLA 4U7UK 3DYAB 3RRKA 2RQMA 1NU4A 2BW2A 1SJ3P 3DKDA 4JUZA 2MZQA 4EZ9A 2C2MB 1DAXA 1X60A 3FDSA 1BQMB 2ZDOA 3R1LA 1PCAA 3CJRA 3NOCA 1A6LA 1XMOJ 2ZKTA 4GC7A 1S99A 1ZS6A 1BQXA 2CPZA 3EZ5A 3CWJA 1MROA 4NRTA 4DX5A 1U09A 1RK8A 3MM5A 3I56S 3NS5A 2HGLA 3C16A 2VKZG 1KKHA 4NOHA 4WE1A 3I5BA 3UVJB 3J7Z5 1S5ZA 2IM0A 1H7WA 1HBNB 2CJXB 1DTTB 1UZHA 4E2FB 1LWFA 1JLAA 2WAQD 2ADBA 1HPZB 4QYZK 1X5TA 5SUHA 4IOBA 1KQGB 2NXJA 4K4SA 3N01A 4C8KA 4X4VA 2R4FA 3SSRA 4DUTA 3OSNA 3S7RA 1QE1B 4ZLNA 3UO0A 3CDUA 4A8OA 2EFNA 1R0BG 1FA0A 1FF2A 3C15B 1JB0C 1YITS 1T05B 4IDKB 3Q8QB 4BDPA 3T5LA 3KG4A 2MZTA 3JXOA 2K3IA 3RJMB 2IRYA 1Y3JA 2R42A 2YPYA 3P6YC 4USWA 3BF4A 2HMIB 4I2QA 2E66A 3IFEA 3OR2B 5KFDA 4OYIA 1IR2A 2VDIA 3R5AA 2UUWA 4OJ1A 1S6PA 4FPRA 1JKHA 2QMXA 4CH7A 1M1HA 1NK4A 4B17A 3LP0B 3G2XA 3LGHA 4XDDA 5DDOC 5AE3A 1NUEA 5T41A 2D41A 4YFUA 3GMGA 3GZ7A 5CA5A 3BGFA 5EGYA 2CZ4A 4IG3A 1Q86T 1KLNA 2MQQA 5E3QA 3JSBA 3QO9B 1P1TA 4LF6F 3RBXA 2GVZA 3AQPA 2XSJA 4ZP6A 1TAQA 5I42A 3A1YG 2DPIA 3TWZA 1M1KT 1T9WA 4L6V3 5A8KA 2LDIA 3HT3A 2QEXS 4A8KA 2ZKUA 5F8JA 3VVUA 4OMFG 2UVRA 3BM7A 1KFDA 2B8QA 4FKXA 2E7WA 5U47A 1FX4A 3WZ0A 1Y5NB 1MWQA 5CYJA 1YJUA 3GIKA 4O23A 3T5JA 3ZTRA 4JB8B 3MF5A 2YWWA 4A47A 1Q95G 2WCXA 1G4CA 3VR1A 3G9CA 2GVDB 3PFEA 2E1CA 3UVJA 3CF5Q 1ZZNA 1NK5A 1VBXA 4F7VA 5A6PA 2VONA 5HP1A 2FLNA 1RT6A 2CKWA 4NEZA 2VQFJ 4ED7A 1IXKA 2W7AA 1S0VA 2UV8G 2BJ9A 3AY0A 5DZ7A 3T1HJ 4DEZA 3NGTA 1SUQB 2FTRA 4K2JA 3VAIA 1PG5B 4B3SJ 3BYRA 4NLPA 2DO0A 2E1RA 4QWBA 3C15A 3PR5B 2DITA 1X4AA 4NLDA 5A2QY 4UY8T 2Y1RI 1YJNS 4RKUC 2CWXA 1VYAA 4YHHF 3IRXB 2WVBA 2OSRA 3DLGB 3KLVA 4DR3F 3NCPA 2B5JB 1PAEX 3RR7A 2UUCJ 2J9CA 2ZWOA 4DV6J 4RW6B 2CQHA 3JQJA 1YLXA 4ZPWR 1Z2LA 3MAHA 4KJIA 2PA8D 2W24A 3NMAA 3EUNA 4LVOP 3DOKB 4DR2F 4URSA 2CPIA 5A2QU 2QG9B 4NXNJ 2VQEJ 3CIMA 2XCPA 2YKMA 1HQ2A 2EK1A 4BBYA 4AYBD 2P5VA 4BS2A 2PFDA 3L7PA 3NGRA 2OKQA 2N4CA 3R2CJ 2HS4A 3UE2A 4ECTA 4PQUB 4M63A 3TOQA 5F8NA 1KTQA 3PNIA 1FE0A 4Y2AA 1WI8A 3VHQA 2I0XA 4DS5A 4NLRA 3P8BB 9RUBA 2YX4A 2DR8A 4WWSA 3K57A 4M5IA 2HKEA 5MLCV 4ATNA 5EN1A 1N5QA 2CJYB 2HQDA 5J2MB 4ECSA 1H2UX 4HDHA 2VBXA 1HNXJ 4R8UB 2EPIA 3MPWA 3SQOP 3TJAA 4OHXA 2XY7A 1Q0NA 1N88A 1QTMA 3A3OB 2GVDA 2IVFB 3CMAS 5C2CA 2J9DA 3MWBA 4HH0A 1RWWB 2GNKA 2BQRA 1FRJA 3DRSA 2D9OA 1N5YA 4GKJJ 2ZBPA 1UFLA 5F8HA 4F4KA 1CC8A 4LF5F 2M8DB 3PX4A 3D1OA 1T02A 3PYFA 1ZA1B 4DZDA 5KFMA 1GMWD 5GMKa 2FZKB 4KTQA 2QA4S 3N79A 1FD2A 1YDLA 2B4PA 3PHEA 3M2VB 3SV4A 4ITSA 1TQLA 4PXDA 1ITPA 2RIJA 4KH1B 2XS7A 1DQ8A 2B5JA 1B3TA 1TFWA 1VQPS 4MK8A 2MY7A 1S72S 2HQIA 4I6YA 4YB7A 3N6MA 3D1HA 3DXSX 5BR8F 2VH7A 3M8ZA 5G0RB 5SZTA 2QE5A 4NYZA 1P1LA 1QSYA 2AHOB 1U6BA 2YNIA 3NL0A 5LMNF 3ENVA 2A3JA 4USTA 1QAYA 4ZHRA 1UVMA 4OHVA 2OO4A 4RX6A 3SV3A 5HVFA 1RKIA 4DX6A 1SV5A 1UJ6A 4Y6IA 1RLCL 2H5JB 3H59A 3ZZ0A 1ZYQA 1WJ9A 3TZXA 2ALYB 4F50A 2GJ2A 3LW5C 3EPIA 2LECA 3P4UB 1XMOF 2EXUA 3IBCB 2MKSA 5A76A 2HIYA 2JX2A 3SSQA 1VQ6S 3KK2A 1SL1A 3M4XA 5A8RA 2OI2A 2BOAA 1U25A 4CM0A 1L3TA 3EGWB 4JBCA 2LEAA 4ZCKA 4R8UA 2PN6A 2Y0SD 4OI1A 2NXCA 4B9MA 3GIIA 2UV8A 4WTOB 3TX0A 4V19X 2EFVA 4HT7A 2AKWB 3AJ1A 3W9IA 1L3SA 3W2WA 1TMMA 4ZA1A 3MM6A 4UOGA 2ZOMA 4CCHA 1FRHA 1VQ8S 3FEXB 2JHEA 1EJ7L 2BR0A 1BC6A 2YQ3A 5AJ3J 4PWUA 3CD0A 1G1XA 1Y5IB 1I94F 3QJJA 3GJQB 1X4GA 5AXMA 4IRDA 2HVZA 2RVJA 2CG8A 1LXJA 1I5OB 3VTIA 4A8QA 1KBRA 3M1VB 2RS2A 1JNZB 4CNZA 2J6SA 1PBAA 1ZM2A 2UUAJ 2Q66A 3MCOA 1UAWA 2O5DA 3WDOA 4DUYF 4WYLA 4PR6A 2Q1LA 4EWTA 5L38A 4RZRA 5E33A 4KR0B 3GCXP 1JLQB 4CO4A 4CI0B 2XS5A 2LKZA 3CJTA 1GEHA 1S9GB 2ZBCA 4NLGA 1NRKA 2JVRA 4JI2J 1O5JA 1HHQA 3W8PA 2DEIA 2HRYA 2AD9A 2ZNZA 2PMWA 1VHFA 2D3UA 3G8TA 4OJHA 4I2PA 5I3UB 1WC6A 2EBGA 3OTCA 4IO9Q 1NO8A 3N5BA 1VR6A 1HR0F 3M6UA 4D3HA 4WFNQ 2AP6A 2DGOA 4UOFA 3JSMA 3EZUA 2B4UA 1EIYB 4X4UA 2KFNA 4ZK7M 3D0GE 4FKYA 2ZVSA 4P74A 4WZQA 3DRXA 2BE2B 3L7OA 4KHMA 2UP1A 2QTWA 4U7CA 2JZ5A 5DZ6A 1GXUA 3KK3B 3FBFA 3Q8RB 2Z2LA 5CH7B 2FGCA 3ADAC 1RHMB 4C2MA 2FY8A 3T5HA 4DV4F 2GW8A 5I3QA 2FY1A 3MMCA 3N0VA 2MQ8A 2HBQB 2W9AA 3AD8C 3ZNJ1 4CLFA 2DNQA 5J2PB 4LRDA 2RRBA 5C25B 3D6TB 2MLXA 1RTIB 1S97A 3ILOA 1RYRA 3GFZA 3US5A 4JYAJ 1B99A 3K7RA 3R7BB 4MT1A 2WONB 5AT1B 3M7VA 4IFVB 3UDVA 1KD1T 2CQ4A 4B3SF 3Q89A 4PG6A 1X4HA 1IKWA 1J2VA 4M5KA 2CJAA 2BE7D 3UNGC 1ROFA 1GXLA 1NZAA 4LF7J 3CB4A 1RQ0A 3EGZA 4M5LA 3TA0A 4QR0A 4NA3A 2AMCB 1N34F 1SVDA 4YB1P 2OPRB 3M8SA 4Z37A 1Q5VA 4DV6F 2KRRA 4TVAB 3GU0A 4LBHA 1MMDA 2RF2B 1OPIA 3KLEB 3CCWA 3BO2A 4DV2F 4MKVA 4FBTA 2GO9A 5DRKA 5KT4A 5E0OA 2ZEJA 1Y7PA 1FXRA 1F9HA 2QMWA 1GTEA 2J6UA 1S6UA 4DR6F 4LR7A 5I3UA 1QD1A 1U0SA 5IV3A 2IJNA 2KYZA 4FYWB 1QVGR 1AROP 5HL7Q 2UXDJ 4DDFA 4LIWA 5B09A 1FEHA 4YOEA 2XNQA 3MPUB 2LDYA 3BO4A 1R8BA 2AT1B 4Y0FA 1OS5A 2PMHA 2BE2A 2ZOGA 2XHCA 1KHVA 5KG4A 1PILA 4USJC 4RR5A 1KVKA 3ELHA 2E29A 3KHRA 4UZCA 3ZNUA 1FWLA 5KFHA 2ZWPA 3KK3A 2HGNA 1RBLA 3I4HX 3B54A 4WK1A 4A8YA 3TJ8A 1RWVB 2CQGA 1RAEB 3QPIA 4N56A 2XGQA 2XZDB 1UL3A 1QAIA 1LK5A 2W2OP 1K8AT 4KPYA 2AWZA 4GKJF 1T11A 1W7WA 3UQSA 1T94A 5HJYA 4LRFA 1C1CA 2XGPA 3HHLB 4OYAA 1H2TZ 5HVGA 3MEKA 1F6TA 3G8SA 4X4QA 4NCGA 1RLDA 4DL6A 5ETOA 3CO0P 4M5HA 2R2TA 2JFDA 1S79A 2RS8A 2V5HG 2H48B 1WTFA 2POKA 3GSDA 4YP3A 3WIUA 4F02A 1FDAA 5F41A 2IC3A 2EC2A 4FDFA 1AFJA 1C0TB 3LANA 1HIYA 1HMVB 2FHJD 3CJQA 2BX6A 3I9ZA 3M8RA 2DJWA 5IS2A 5KFGA 5LSRA 3PCOB 3PJWA 1P8GA 1VQSA 2WHOA 5KG1A 2AGQA 4NI2A 3NGKA 3ICLA 2HLUA 5HN0A 3QQCD 4P10A 5GAHU 1DLOA 4DHVA 2ASLA 1LW2A 4Y65A 2Q79A 2V50A 1XJWB 2GV1A 3TNVA 3VAGA 4J90A 5FD1A 5DQHA 4QU6A 2VG6A 4DFJA 4Y34A 3KJQB 4CTAA 1WELA 4CLLA 2AYMA 1TFYA 2ZH1A 3LWMA 3D5MA 5KG2A 3IBFB 3KMSA 2MQOA 4C6AA 4X4OA 4X4NA 1CJVA 4HLBA 1D3WA 1N33F 5B0CA 4OYBA 3OLBA 1RAJA 4LMZA 3PV8A 1FKPB 1JK9B 1VRTB 3F44A 5IM0A 2AX0A 2CG4A 4KHPJ 5H9FK 3HI9A 3CCJS 1FRKA 2WZ1A 3HK2A 1JLGB 3BDPA 2VC1A 5DM6Q 4R5PA 2FQQB 1HWLA 1W26A 2K8GA 2ZH5A 2CQ2A 3DRRB 2J7KA 3TEGA 1DTQB 1RAAB 5KFPA 1NK0A 3HHLA 3UN2A 2BRLA 2VPWB 2OD6A 3K8VA 3VF0B 2HRTA 2WB4A 2MKKA 2L9DA 1R8AA 4PG7A 4IG0B 5M2UA 3KWMA 2EFQA 2AEMA 3G87A 1HNIB 3J7ZT 1HQUB 2R3VA 4UOCA 2KTQA 1X4BA 3TVKA 2HIQA 1HWIA 3ENWA 2YXLA 3BGLA 5E3RA 1K0VA 1JIHA 3NWGA 3RTVA 3D2WA 5C2GA 1X31C 5AXLA 2LP4A 1K9MT 3U1NA 1WHVA 3THVA 4ED0A 3GWCA 4OX9F 5D15A 2NUHA 3MEDB 4F26A 2VU5A 2V8DA 4ZVGA 3HLUA 3R2DJ 3S6EA 4U7UD 2I9SA 4JI2F 2DR9A 5CHCB 3OD2A 4LSZB 3OPKA 2CJQA 3FUYA 2JLFA 1AB8A 2HFVA 1UMJA 2LQ8A 3R5JB 3K58A 4ILRA 2BJEA 5IQ6A 1DJ0A 1U2FA 2PI4A 1KTVA 1VC6A 1C2PA 1V9OA 3PO5A 3CVKA 2VL1A 3KLIA 2E5GA 4DX8H 3Q83A 3QFWA 2CPJA 3DGVA 1SKWA 1IJEB 2OGUA 5KG3A 1UTAA 5G4DA 2X51A 1MU2B 2AIRB 4DXLA 4JV0A 4ZVSB 2HWHA 2BYCA 1C0UA 5AXNA 5DG7A 2AZ1A 2F8HA 1K47A 1LW0B 3HVAA 4F3MA 4PQAA 2AQ4A 5C42A 2ABYA 4CLWA 1OWXA 2V0NA 3GG1A 2DISA 4JYAF 3EZOA 2KVIA 2IY5B 4OYOA 4DLEA 5HK4A 2DHXA 1K1SA 1UFKA 3TZYA 5JUMA 1TTHB 2ZHOA 3RR8A 2Z2MA 1ZAXA 5BXIA 2Z30B 4F4XA 1UCNA 1HNZF 2FJVA 1H98A 4USKA 3DLEB 2GGPA 2AU0A 2RU3A 2ROGA 2UU9J 1WC3A 1RWXB 2VFTA 3EM1A 4LF7F 2OEKA 4I0WA 2G0IA 4FP9A 1UVNA 1IM4A 2CXEA 2EKYA 5KFFA 3GQCA 2E5LJ 4YY3J 4ALZA 2DD8S 4N8OA 2HHPA 3EYZA 1S7IA 1XMQJ 2JEJA 4KT0C 1P9YA 2NLWA 2FJWA 2HFOA 3EGVA 5M2RA 3MEDA 2MHEA 1N5SA 5C24B 3Q22A 1SIWB 1EKSA 3KFWX 2I2YA 1JXLA 4CLPA 4DS4A 2BJ3A 2Q6BA 2ZZMA 1HBMA 9ATCB 1FFWB 2GIQA 4CLZA 2FVSA 2DH7A 3E8OA 2UXDF 3G82B 2BKOA 5T14A 4LR9A 1U6ZA 4ECWA 1EP4B 4PUOB 4PCQA 2L9NA 1H0HB 5KFJA 3J81Y 3NS7B 4DZ6A 1S0NA 2HNDB 4HI2A 5LMUJ 2F65A 2NREA 3E01A 3JAMY 2XYPB 3UWTA 2VFUA 2BW7A 1TL1A 4LFCJ 2Q43A 4ER8A 4PG5A 1UWBB 3CXCR 5ETKA 1D9DA 3SQGB 3J81U 4L72B 3QT7A 3AHPA 1BMQB 4J9PA 3JAMU 3CCQS 2HBRB 3CJ0A 2B3TB 1XC9A 1U2RA 3R5CA 2GX8A 2Z58B 3O3LA 2AJ2A 1T9TA 3BKTA 3B78A 4QBUA 4GRSA 5BYRA 1Q53A 1NXIA 1ZM4A 4YR3A 4GVBB 1X9MA 4ED1A 4IRKA 2MMYA 1ZH5A 1RJJA 2IA6A 2ZH7A 3IP0A 1TL4A 1H38A 1TL5A 2K06A 2DRBA 1IKXB 3M30A 4J9RA 2IM1A 1F0XA 3PKYA 2XULA 1GK8A 2O3DA 3DGPA 3MR7A 4HR2A 4C8LA 2YNHA 1EB0A 4UQTA 4E98A 4MH8A 4O4RA 4X4TA 1RA6A 1HNVA 4TNOA 2V6AA 1FVSA 1G3OA 1UPPA 1RT4A 1R6YA 5C24A 2N7CA 3TQ1A 1FNOA 4I6AA 1YBUA 2RQ4A 4Y00A 2MLZA 2ZE2A 4N5SA 2Z2YB 2AV5A 4LSLA 4WYWA 1HLWA 3G82A 5EHHA 3RAQA 4K4WA 1EP4A 4PUOA 2V94A 4DR1J 2MSSA 5KFSA 2M0GB 2IRUA 1NJXA 2AW0A 3FRYA 4B3RF 2K3KA 3EVWA 3HHLC 4RUHA 1OSDA 4MAKA 5KG7A 1RT7A 4QJVA 4FXVA 1E6YA 3DFEA 4USVA 4FYDA 3ZZOA 1P6TA 1ZPWX 4MIWA 4YB6A 4P75A 1YGYA 2KO1A 3JQMA 3AH6A 2ZVIA 5AE1A 3D0IE 1Y10A 3KK1B 1UA0A 3JYTB 1NSPA 4H54A 4RLEA 1T9VA 2A6OA 1KDNA 3PYEA 3TARA 3WC2A 3ZTOA 1FKAF 5DG9A 4RPFA 1ZOTA 2PEBA 1NH8A 4DSLA 3C8YA 2EBEA 1O8BA 1WHYA 4HEA9 2CPXA 1OJ4A 4LQ3A 3KHGA 4OYWA 4O3SA 2VG7B 4EFAC 3QATA 2JNJA 1NKBA 2MLYA 3S01A 1XK8A 2PIIA 1S9EB 4LFBF 3PX0A 3QZ8A 1MSWD 3C6UA 2HFSA 2AYGA 4NX9A 1Y4ZB 1SL0A 5J1EA 4P9SA 4IQXA 2I38A 1OMSA 5IWAJ 4I7FB 4F4AA 3LP1B 1HL6A 1RTZA 1R6VA 2KVQE 3BSAA 2P9CA 1HW8A 4JI4J 1RAIB 3HSGA 4B3TJ 2WVCA 5E3AA 1DARA 1VCTA 2VICA 3PW0A 2WOMA 3VZIA 2MJUA 2KM8C 1J5OA 4X65J 2BDPA 1CJKA 4URQU 3AAWB 4ED8A 3MD1A 3MTKA 3G96A 1KNZA 4AXJA 2HZVA 2WBMA 4WKYA 3J7YI 3A8KA 3K0JA 4XPCA 2XI3A 3EDQB 5KTQA 1ZTTA 3LH2S 2X1FA 1RT1B 3OFHA 2OHDA 4TU8A 4FVCA 4NZ0A 4ILMA 4TN2A 3ITHA 4GC6A 3NKYA 4LF1A 5KFAA 4DV7J 2CFXA 5B0DA 2YY3A 5D4NA 1QDUB 4MKYA 5ETNA 1WSVA 4ID8A 4LF4J 4ZKAA 1YHQS 5GVQA 1TUGB 1JLFB 4AT1B 4ETXA 2J9EA 3H5XA 2Y3YA 4LBIA 1XNRJ 1NNDA 3KK1A 1TVRB 3JYTA 3TUPA 2DT9A 4ZJOA 3P3DA 4ICLA 3T5KA 2E1MC 4O44B 5KOWA 1RCOB 1KRPA 1NSQA 1UVLA 4DR5F 5ETMA 5KT6A 2XWYA 2ZJQQ 2VG5B 2VOOA 3FCWA 5MAOA 1NPPA 3TA2A 1FE4A 2E5LF 4ED2A 2X3GA 5HQMA 1U1QA 2F9DA 5D3GA 3M9MB 3MM7A 4I7FA 3U7JA 2OEJA 1C1BB 1XMQF 3R8YA 3PX6A 4LFAJ 3KLFB 4LJMA 2HURA 4H4OB 1Q16B 4IH6A 1GH8A 4ZP9A 2DRDA 2LLZA 2MQMA 4C97A 1R27B 2N3LA 4ID5B 2COLA 3CC7S 3CCVS 5C7PA 2YX7A 2A1BA 1EARA 4B9NA 5CD4H 2ADCA 2L3MA 2F5GA 3BEGB 2UXCF 3D9BA 3GYGA 4HTJA 5IT4A 3FCHA 3T1AA 1GX5A 3TI0A 1UA1A 2RT3A 3GSIA 1NH7A 2G2ZA 4KO0B 3QGGA 3HM9A 4X64J 3PJXA 2DNYA 2H65B 2RJZA 1R89A 5F3ZA 4BC7A 3IM9A 5GMEA 3HVWA 5LMUF 3EE3A 1S9FA 2FVQA 1T3OA 4P52A 3O1LA 1VQNS 5F9NA 4JI6J 4H4MA 2JFKA 5JMNA 4LFCF 1BY9A 2V69A 1JMTA 4CO3A 4ETZA 1F2GA 3OJUA 5K20B 4LBPA 2XBPA 3BGRA 1JLFA 1R8HA 5GADU 2XM3A 2KZMA 2KZZA 3ENAA 1C4AA 1MLAA 1TVRA 4QR2A 5IT9Y 3DXBA 2NPIA 3M9OB 1EQ0A 1R8CA 5DS7A 1H73A 1W2BR 3DM2B 4RNFA 4UUXA 2ASDA 3HVTB 5L1LA 2CUYA 4NLVA 5FIIA 1QJHA 1M0SA 5ETSA 3DLKB 1WF0A 3T3FA 4ELTA 4IQMA 3PIPQ 5HROA 1SC3B 1TL7A 2YX1A 3FBEA 3FZ2A 1WG5A 5H1SV 2UVVA 4IFYB 3G6ES 4P7TA 1VK3A 1CJTB 1ZAVA 3KHLA 1KFSA 4OX8A 2HNYA 3A8EA 4DL2A 2HFUA 1ZTWA 4G1QB 3OJSA 4N7TA 1VBYA 2XLJA 1H7XA 2K7JA 1FDBA 1KLMB 2QZ8A 3ZC4A 2B8PA 4HYKA 1BWEA 4UF4A 3V6DB 3HJFA 1RTDB 1AT1B 3OL9A 3GLJA 3EJMA 4N77A 3BH7B 4OJ3A 1NJZA 3MR6A 1RXOB 4CLTA 3GILA 1QSSA 1SJRA 5JXSA 1GMWA 2K7KA 3P5TL 1YG0A 2QL7B 4QIFA 4OYZA 3DLBA 1YWXA 2C2EA 2HPUA 2RH3A 3MUMP 1SH0A 3GP9A 4KO0A 1I1GA 4P7VA 1NCLA 2ROPA 3GTYX 5LT5A 2ZM6F 1WDTA 3HCXA 1VBKA 2OMOA 1HI1A 5DJBA 3DN9A 2BM0A 2GAGC 4EBDA 5F8MA 3LAKA 3FQLA 2PT0A 1IKYB 3AQOA 4QIEA 1FJEB 2ZZNA 2RSQA 3ET6B 2AJFE 3MHYA 3GFYA 2H4WB 3QBCA 1DRZA 2QMUB 4XAKA 1K73T 4JOUA 2B51A 2QYCA 1CLFA 4K5SA 3UDLA 2QIFA 1MWZA 4RW7A 2AEFA 2HHHJ 2C3UA 4QIGA 1S1TB 1W2IA 3PFOA 3A4TA 1VLYA 1RWUA 3D4JA 3CTRA 3W1YC 1B70B 3RW7A 2HWIA 3HT0A 5KG5A 3HF5A 4ZVOB 2ZH8A 3RW6A 1QLNA 3F56A 4ECVA 4CH1A 2W4PA 3RZAA 4I68A 4UW2A 5HBMA 1VI7A 1UP1A 2YQ0A 3G6VA 3UR0A 4M8LA 4RJVA 3KUEA 2LXUA 2LQ9A 4JI4F 4B3TF 5HMZA 4NMLA 1O0PA 3V6JA 2FJXA 1WHXA 2W8LA 4NL5A 3KYLA 4QZVB 2VPZB 3OT9A 4X62J 1T8EA 1KLMA 2PD1A 5E2QA 4EU0A 1AFIA 2BKNA 2YNFB 2J0WA 4M5DB 3OXFA 4MKBA 4I69A 4URGA 2DGQA 3MMBA 2ATCB 4OZ0A 1EKRA 3M8PB 4DSJA 3PZPA 1UKUA 2HHWA 3BBBA 1U24A 4NXMJ 4R0EA 1JLCA 2EW9A 2MQPA 2LEPA 3DOLB 3K5LA 3M6XA 1WEXA 1REVB 3RAMA 1VS3A 1AZSB 3I0RA 2JC0A 2DH9A 2M3DA 4CLUA 4LF4F 1FKOB 2G2YA 1VC5A 5CCMA 4DUZJ 2BQ3A 1FTCA 2K1RA 2YKQA 1D0EA 3EXYA 3QIPB 1RT3B 1WKKA 1FTRA 2BJDA 3ET6A 1FJGJ 4MYUA 4WIQA 2BANA 3MEGA 1Q7YT 1XNRF 3HHEA 1VQ4S 1N4LA 1K1QA 1RADB 4JI7J 3HDSA 4DCOB 3FCVA 2BJ7A 4C4WA 1YBTA 3BB5A 3MR3A 1FWPA 1HYSB 1NBEB 4F2SA 4OI2A 5EX0A 4AQYJ 2J5AA 3MMAA 1HBOB 4WCEQ 4C8OA 4CRJA 3AA8A 4DL5A 1FCAA 3UCUP 4UZBA 1VQKS 4OI6A 4JI0F 2MYFA 3TZZA 1UEVA 2ZHAA 1PIEA 4CYUB 2QLFB 4X4SA 2J0SD 2FUG9 2RQKA 4OZJA 2H1YA 4LFAF 2XLIA 1IN0A 5C5JA 4QYRA 5CYMA 3CJ5A 3MAAB 2XZTB 4F0MA 2MZRA 4DPTA 4TLQA 2IAJA 1U49A 2I5JA 1LFPA 1TKTB 1R7IA 2YNFA 5D78A 2KG0A 2EFOA 3H42A 4IKAA 2KG1A 2CNKB 3M8PA 1U26A 2PO4A 1NK7A 3G8QA 2RRNA 2HSEB 2DNZA 2QSFA 2R2SA 5FDLB 4A8XA 2IM2A 4DG1B 2Z4PA 1RT2B 1YJTA 1REVA 4PWDA 3LTOA 4DU7A 2R7UA 4LREA 1AZSA 1LFWA 3MCMA 2FJDB 4LIRA 4CIOA 1WNEA 2QFJA 1H2VZ 2OMLA 2OPPB 3RB3A 3LPEA 3MFHA 2KFZA 3QIPA 1RT3A 1TK0A 2J8SA 4GKKF 3PO4A 1RKJA 4DL0C 2QGFB 3QAEA 2XC9A 2U1AA 3EVMA 3V2UC 4ED6A 4P2SA 4HTIA 2RKIA 2XYHB 2C22A 2FHOB 2NXNA 2IHR1 3DDNA 2MZJA 2LEBA 4UQGA 4C9DA 3BS9A 1WKJA
chains in the Genus database with same CATH topology
1JXVA 1BE4A 1NSQA 1NSPA 3EMTA 1NB2A 3ZTQA 3FBFA 1ZS6A 2HVDA 3BH6B 3EE3A 1MN7A 1KDNA 1W7WA 3WX8A 4ANCA 3Q83A 4WBFA 1NDKA 4ANEA 1LEOA 3FCVA 3G2XA 2DY9A 3ZTOA 3NGRA 1XQIA 3VGTA 2DXDA 3FCWA 1NUEA 4UOHA 2ZUAA 3DDIA 1F6TA 3FC9A 5CABA 3FBCA 1NDCA 2CWKA 2B8PA 1NPKA 2HVEA 1S5ZA 3NGTA 3BBBA 4CP5A 4C6AA 3ZTSA 3EJMA 3Q86A 2AZ1A 3VVTA 3EICA 1HLWA 3FKBA 1B99A 2BEFA 3BH7B 3VGUA 1S57A 4S0MA 2HURA 1XIQA 3L7UA 1MN9A 1PKUA 1NDPA 1HHQA 3EVOA 1BHNA 3ETMA 3B6BA 3ENAA 1HIYA 1B4SA 2VU5A 1NSKL 3GPAA 2NCKL 4DUTA 2AZ3A 3PJ9A 4F4AA 2BX6A 4DI6A 1BUXA 2DYAA 3ZTPA 3Q89A 3FBBA 1VYAA 4UOGA 1NHKL 3EVWA 5C7PA 3VVUA 3GP9A 1PAEX 3BBFA 3NGUA 2B8QA 4KPCA 3Q8YA 4FKXA 3JS9A 1EHWA 1U8WA 3BBCA 3PRVA 3ELHA 1NLKL 4UOFA 5BXIA 4EK2A 1NCLA 1UCNA 2DXEA 3Q8VA 3VGSA 3NGSA 1F3FA 1K44A 1S59A 3MPDA 4O0NA 1WKKA 3DKDA 3EVMA 1LWXA 4FKYA 3B54A 4DZ6A 4ANDA 3ZTRA 4ENOA 3EM1A 3R9LA 5CAAA 3VGVA 2DXFA 1WKLA 4HR2A 4W98A 4F36A 5IOLA 1NDLA 3FBEA 3Q8UA 1WKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JXV A;  1BE4 A;  1NSQ A;  1NSP A;  3EMT A;  1NB2 A;  3ZTQ A;  3FBF A;  1ZS6 A;  2HVD A;  3BH6 B;  3EE3 A;  1MN7 A;  1KDN A;  1W7W A;  3WX8 A;  4ANC A;  3Q83 A;  4WBF A;  1NDK A;  4ANE A;  1LEO A;  3FCV A;  3G2X A;  2DY9 A;  3ZTO A;  3NGR A;  1XQI A;  3VGT A;  2DXD A;  3FCW A;  1NUE A;  4UOH A;  2ZUA A;  3DDI A;  1F6T A;  3FC9 A;  5CAB A;  3FBC A;  1NDC A;  2CWK A;  2B8P A;  1NPK A;  2HVE A;  1S5Z A;  3NGT A;  3BBB A;  4CP5 A;  4C6A A;  3ZTS A;  3EJM A;  3Q86 A;  2AZ1 A;  3VVT A;  3EIC A;  1HLW A;  3FKB A;  1B99 A;  2BEF A;  3BH7 B;  3VGU A;  1S57 A;  4S0M A;  2HUR A;  1XIQ A;  3L7U A;  1MN9 A;  1PKU A;  1NDP A;  1HHQ A;  3EVO A;  1BHN A;  3ETM A;  3B6B A;  3ENA A;  1HIY A;  1B4S A;  2VU5 A;  1NSK L;  3GPA A;  2NCK L;  4DUT A;  2AZ3 A;  3PJ9 A;  4F4A A;  2BX6 A;  4DI6 A;  1BUX A;  2DYA A;  3ZTP A;  3Q89 A;  3FBB A;  1VYA A;  4UOG A;  1NHK L;  3EVW A;  5C7P A;  3VVU A;  3GP9 A;  1PAE X;  3BBF A;  3NGU A;  2B8Q A;  4KPC A;  3Q8Y A;  4FKX A;  3JS9 A;  1EHW A;  1U8W A;  3BBC A;  3PRV A;  3ELH A;  1NLK L;  4UOF A;  5BXI A;  4EK2 A;  1NCL A;  1UCN A;  2DXE A;  3Q8V A;  3VGS A;  3NGS A;  1F3F A;  1K44 A;  1S59 A;  3MPD A;  4O0N A;  1WKK A;  3DKD A;  3EVM A;  1LWX A;  4FKY A;  3B54 A;  4DZ6 A;  4AND A;  3ZTR A;  4ENO A;  3EM1 A;  3R9L A;  5CAA A;  3VGV A;  2DXF A;  1WKL A;  4HR2 A;  4W98 A;  4F36 A;  5IOL A;  1NDL A;  3FBE A;  3Q8U A;  1WKJ A; 
#chains in the Genus database with same CATH topology
 2BM1 A;  3IXQ A;  1RZM A;  3QWP A;  5IC6 B;  4DR4 J;  5D0R A;  1NDK A;  2HHT A;  1Q81 T;  1FHT A;  1F1B B;  3VZH A;  1TV6 A;  1Q79 A;  2B9Y A;  2NZ4 A;  3QWU A;  3QJL A;  2CJB A;  1Q7L B;  2DEJ A;  2OUG A;  5RUB A;  3SDE B;  1RHQ B;  4YR0 A;  2UXB J;  2VBW A;  2XY5 A;  1IVZ A;  4F04 B;  4P6Q A;  3M8Q B;  4LRB A;  5L1I A;  1UVI A;  2C2O B;  1ZA2 B;  3G6X A;  2WBR A;  2AEJ A;  2WSF C;  2CPF A;  3DRP B;  3BQ1 A;  1VIO A;  4DPY A;  2V9W A;  4RW8 A;  4CLY A;  4PZV A;  3PYG A;  4OHW A;  3RB6 A;  1AUD A;  3TAP A;  2ROE A;  3OSP A;  2JDJ A;  4TU9 A;  1U7L A;  5FDL A;  2OEM A;  1NJI T;  2FHJ A;  3W62 A;  1UWA A;  2CJK A;  3DNC A;  4C98 A;  1AXQ A;  2FVC A;  3N5F A;  6FDR A;  3JQK A;  4Y28 C;  1S1U B;  3PVX A;  5T7L B;  1S1W B;  2PI5 A;  1CS4 A;  4KV8 B;  4OX6 A;  1TKD A;  1B7Y B;  3I96 A;  2HGM A;  1OO0 B;  5HQ8 A;  3K8W A;  2OPP A;  2VBZ A;  2J76 E;  4DU8 A;  1YBA A;  1S48 A;  4PRF A;  4YEA A;  4DSK A;  4OLO A;  1WC0 A;  4TQR A;  5KFN A;  3MPY A;  4CWB A;  4S0M A;  2HHH F;  1X4E A;  1VRU B;  3PRD A;  4LSN B;  2XO7 A;  1VIS A;  2JH3 A;  4C3M A;  2NYI A;  1RAB B;  2HK2 A;  5L39 A;  2ZD1 B;  4DL3 A;  4OL8 A;  4J9V A;  3CD7 A;  3MEC A;  4JV5 J;  4B3O A;  1JJH A;  1DQ9 A;  1VQ5 S;  2GQ2 A;  2CNL B;  1V5I B;  1U1K A;  2PC6 A;  1X4D A;  2DNG A;  1VMB A;  4JI1 J;  2RNE A;  2HQC A;  3CCE S;  1U47 A;  4CLK A;  3TAM B;  4KIA A;  1IBK F;  3FVY A;  4J9M A;  3FRZ A;  1JWW A;  1U1L A;  3BH6 B;  4ED5 A;  1ZPV A;  3SDE A;  2GML A;  2BZ2 A;  2ZIT A;  4F4Y A;  1YJR A;  2F4F A;  2F8E X;  2Y1L B;  3KJV A;  3KDN A;  4A8W A;  4M95 A;  2KH9 A;  2V2Z A;  2DNR A;  2XHW A;  3EIC A;  3BZQ A;  3PG9 A;  1D9A A;  3K89 A;  1I6J A;  3FFI B;  1WD6 A;  4C0H A;  5K8N A;  3VWS A;  4FBU A;  2NR0 A;  2QA2 A;  2OEL A;  4IRC A;  2P2C B;  3MUT P;  3DHX A;  4CQ1 A;  2IA0 A;  4J9U E;  3R5D A;  3TA1 A;  1FRI A;  4G65 A;  3M2R B;  2W9C A;  2DHH A;  1LWE A;  1A7G E;  3QGI A;  4QW8 A;  4LF8 J;  1RT5 A;  2BVZ A;  3Q23 A;  2YNG B;  2E9T A;  2OTL S;  3E2E A;  1QSL A;  3R1H A;  2FHK A;  4W98 A;  3TW0 A;  3ZZZ A;  2X1B A;  3RGI A;  3JSY A;  1UFW A;  3S8S A;  5IQQ A;  1HI0 P;  1PJ6 A;  4O4G A;  4NEY A;  1B0P A;  1HW9 A;  1OIA A;  1ULR A;  5LXY A;  2PE8 A;  4JI7 F;  1TL3 B;  3DYA A;  3QT6 A;  2MGZ B;  2GAH C;  2J8A A;  3IWL A;  3LO3 A;  4P2X A;  3T1Y F;  1S6Q B;  4WP8 A;  5H9E J;  4HKQ A;  2ZD1 A;  1BQM A;  2RHS B;  1Q5Y A;  3D3C J;  2C2K B;  4AQY F;  2KT2 A;  1J5E J;  2AJ4 A;  2VOP A;  5LL6 d;  3GPA A;  4I56 A;  4PG4 A;  2ATL A;  1NHK L;  3DLH A;  4LRC A;  3W66 A;  1U8W A;  1S7H A;  2DIU A;  1RDR A;  4NCB A;  2VA2 A;  4UY8 5;  1HBN A;  2WW8 A;  1DTT A;  5ETP A;  3ZZU A;  4I64 A;  1HPZ A;  1XTZ A;  3VAH A;  1RHJ B;  4DV5 F;  3M32 B;  4O3R A;  2LFV A;  5DGA A;  1S1V B;  3CIZ A;  4GMK A;  2LMI A;  3VCD A;  1K0T A;  1VQL S;  1YZ6 A;  1ZET A;  2A10 A;  2VB6 A;  4NLU A;  3THP A;  2XSF A;  4KKO B;  3RBE A;  2I8E A;  1QE1 A;  2B43 A;  3L3C A;  2L41 A;  3D6F B;  2M2B A;  4OYM A;  4ZLL A;  3RAX A;  1LWC B;  3ZXW A;  1T05 A;  4K0K J;  4IDK A;  3FFI A;  1QUP A;  2XNR A;  4B3M J;  5HQL A;  2A18 A;  5K8O A;  3PY8 A;  2GQC A;  3A8I A;  3SBM A;  1YJ7 A;  4USH A;  4WU2 A;  3CDW A;  3H98 A;  3W60 A;  3NBP B;  3D66 A;  3TEH B;  1XWL A;  3SYZ A;  2HMI A;  4I1T A;  3OR2 A;  3HJV A;  2J7W A;  2D74 B;  3K5M A;  3LP0 A;  5KFI A;  2Y8Y A;  5HMX A;  1EHW A;  5GAH I;  3DLJ A;  2ZH2 A;  2XY6 A;  1YK9 A;  1FWK A;  4F0H A;  1PYT A;  1AYE A;  1SC4 B;  3PDN A;  2CVI A;  2HHX A;  2DB1 A;  3QO9 A;  2HFZ A;  4HL9 A;  3MXH P;  3N4W A;  4ZVP B;  3K5P A;  2X1G A;  5IXU A;  1ICE B;  4C48 A;  3OR1 B;  1NHV A;  4MMO A;  1V3Z A;  3CJ2 A;  5EWG A;  5J2Q B;  2MGZ A;  4RBV A;  1RCX B;  4ED3 A;  3FZB A;  3SCL E;  5CAB A;  3CDE A;  3G6Y A;  1KQF B;  4ZOS A;  1BXN A;  1I3O B;  4QW9 A;  3QAU A;  2HWT A;  2WSE C;  3BSO A;  3L9Z A;  4ZPB A;  4AL5 A;  3DHW C;  2I6W A;  4PYA A;  3WHI A;  1PJ7 A;  4KGV B;  4TXS A;  4B9L A;  2O67 A;  3BO3 A;  2UXB F;  1CVJ A;  3IS9 B;  4X66 F;  5DLF A;  4DWI A;  3QT8 A;  3A8J A;  3M32 A;  3V4I B;  1Y00 A;  1S1V A;  1T95 A;  1SUQ A;  1RSC A;  4L3N A;  4KKO A;  4EYI B;  2JEI A;  4PG8 A;  4RW4 B;  2H51 B;  1D8Z A;  4H4K A;  3UN5 A;  2F4V J;  4PXE A;  1BE4 A;  1LWC A;  1Y11 A;  3QSY B;  3CE8 A;  4JI8 J;  1U1P A;  2D1C A;  1MN7 A;  4YN3 B;  3IA0 A;  3IRX A;  1TKZ B;  3DLG A;  2BAC A;  3UI3 A;  2NXE A;  3HFZ B;  5CYQ B;  2U2F A;  4RUB A;  5DM7 Q;  1EAY C;  1R0C B;  3G71 S;  3I6P A;  5B7W A;  1CQN A;  2MKY A;  3FGV A;  4RW6 A;  1VC0 A;  2V4J B;  2H54 B;  2IIH A;  2OD4 A;  1OPZ A;  1XNQ F;  4Q8F A;  4XK8 C;  3CC4 S;  3DOK A;  3CPW R;  3CJK B;  3BV8 A;  3GIM A;  3X3U A;  4FNI A;  4B02 A;  2MQL A;  3AOA A;  3CO9 A;  2OPS B;  4PXC A;  2E9R X;  1JLB B;  5ADZ A;  1WOP A;  4YS2 A;  1REG X;  3RRG A;  4PQU A;  2CRL A;  2P8I A;  4QWE A;  3FQK A;  1U1M A;  3OR1 A;  3MPD A;  2JEF A;  5J2Q A;  2CDQ A;  1Y9O A;  2N82 B;  4DQP A;  3I5C A;  4C11 B;  4Q44 A;  1LOU A;  4JI1 F;  2CA9 A;  2ZDP A;  1ZM9 A;  5B0A A;  8ATC B;  5J2M A;  5HMW A;  3OV7 A;  3RRH A;  5HLF B;  4NLW A;  4CH0 S;  4EGL A;  2R7R A;  2PDA A;  3QJP A;  2B7C B;  5L1J A;  4MFB B;  4G6V B;  7FDR A;  4FNH A;  3H40 A;  2BE9 B;  1HNW J;  2D3O R;  3W3S A;  4DOZ A;  1RWN B;  3VVT A;  3TYT A;  1C4C A;  3I0S B;  5ETV A;  6FD1 A;  1S6O A;  3R3T A;  4WJB A;  3H4B A;  3Q2T C;  4Z7Y A;  4XTT A;  2B9E A;  3V4I A;  2FD2 A;  2NCK L;  3SI8 A;  2IJR A;  2RRA A;  1RU2 A;  3W8G A;  3H2U B;  4RW4 A;  1NPR A;  1JJC B;  2F1F A;  3QYY A;  3U1L A;  1NLK L;  1RAH B;  2JLE A;  3M2V A;  4TYA A;  2VPX B;  2DNP A;  5EDW A;  1IJF B;  4RBT A;  1CUL B;  4PKD B;  5D4O A;  2RD5 C;  1UJ4 A;  4C3L A;  5CYQ A;  1L5U A;  2HHQ A;  1M90 T;  3IG1 B;  4P2F A;  4B08 A;  4ZVR B;  2E44 A;  2V4J A;  4LVN P;  5KG6 A;  1T7P A;  3CCT A;  4F0K A;  1A9N B;  3GYX B;  1LEO A;  3RG6 A;  2CVE A;  5G0R A;  1V3S A;  2ACM A;  3RYL A;  4OZN A;  3BR8 A;  2FLP A;  1U0H B;  3D68 A;  3ULH A;  4Q2L A;  3ZZR A;  4DF4 A;  2XEX A;  2L48 A;  3GJR B;  2DRA A;  4EBC A;  4IOA Q;  2IVY A;  2O01 C;  2YVS A;  2LQ5 A;  4OI3 A;  1X4F A;  2MEW A;  3HSD A;  2XYG B;  2E7X A;  3T19 A;  3L7U A;  1NDP A;  2P6S A;  1T03 B;  4LF6 J;  3WX4 A;  1B4S A;  4ZJQ A;  2R8J A;  1RTJ B;  4G3I A;  4C8Z A;  2MQN A;  2LYV A;  3NLC A;  2E7V A;  3I82 A;  1J5E F;  4J5O A;  3PRV A;  3NNH A;  3L95 X;  2J6T A;  1WEZ A;  3KLH B;  5LJ5 Y;  3ISN D;  3KNG A;  2G13 A;  4F67 A;  3EX7 B;  4PYD A;  1M5S A;  3VGV A;  1OQ6 A;  3HFV A;  3BKF A;  1OSC A;  2DXF A;  2CDR B;  2R8H A;  3A3P B;  3CW2 C;  2EWH A;  1FEE A;  3Q8U A;  2MKI A;  4CNY A;  4MFB A;  1YVF A;  3BPS P;  2XB2 D;  4NLY A;  2VQF F;  4BCA A;  2E9Z A;  4F2R A;  1EZZ B;  4KB7 A;  4Y2K A;  4HI1 A;  4QU7 A;  2R7X A;  3I0S A;  3T1H F;  2YWF A;  5KT2 A;  1NM2 A;  1ACM B;  5KFW A;  3V81 B;  5AXK A;  1HI8 A;  2KN4 A;  3DRY A;  3OL8 A;  2R8I A;  4EI2 A;  3UPF A;  3M2U B;  4X84 A;  2NXU A;  3TUJ C;  2YWH A;  2C3Y A;  1WOR A;  1RWP B;  5KFY A;  2KI2 A;  2WW4 A;  1VOM A;  2CQ0 A;  3D54 A;  3X1L B;  3M1V A;  2BRK A;  5KFC A;  2UUC F;  2KHD A;  1CUL A;  1X8D A;  4EZ6 A;  3IRW P;  2AJ0 A;  3ETO A;  4YHH J;  4Q0B B;  7AT1 B;  4BHQ A;  4DR3 J;  5J2N B;  2PA3 A;  1Q1K A;  1BD6 A;  4L73 A;  2KXN B;  1SH3 A;  1JLQ A;  3IG1 A;  1R31 A;  4KGZ B;  3KJN B;  3KNA A;  3VQT A;  4NXN F;  2VQE F;  3PW5 A;  2IBK A;  1S9G A;  1XEZ A;  2OPQ B;  1TZ0 A;  2GFF A;  2G1D A;  4DR2 J;  3R5G A;  5E5N A;  2DNM A;  3KUH A;  1JXV A;  3W5Z A;  5E3P A;  4ZVU B;  4PWW A;  4ZPD A;  3CUL A;  3U1M A;  1N5T A;  1D9F A;  3FSY A;  1FER A;  1S4E A;  4P71 A;  4WTY A;  2KDO A;  4QYZ J;  5CZV A;  5I3P A;  1MML A;  4TU7 A;  1X5O A;  3IM8 A;  3A13 A;  5KT3 A;  1RTJ A;  5E41 A;  3HKZ D;  2GQQ A;  2M8H A;  2HHS A;  4RW9 B;  2DR7 A;  3EVO A;  1PC5 A;  1VQM S;  4I4B A;  3KLH A;  4RU9 A;  3MR5 A;  1HNX F;  1MRO B;  4QIW D;  3NEK A;  3NWR A;  4U95 A;  3R7S B;  3HPO A;  4H4K C;  3MM5 B;  2ALZ A;  3DLL Q;  2MKH A;  3C16 B;  1YX2 A;  1VFJ A;  2VV5 A;  4J37 A;  2RDD A;  3IWX A;  5J2P A;  3OVS A;  3NCQ A;  3K5N A;  1K44 A;  5C25 A;  2NSB A;  1RTI A;  3C46 A;  1LWX A;  3H2V E;  2DKO B;  2DCU B;  1JLA B;  2B6A B;  4OZ2 A;  4F3Q A;  2R7T A;  1GX6 A;  4W90 B;  2WON A;  2V4R A;  3FSX A;  4IFV A;  4L3K A;  3V81 A;  1FES A;  4K4T A;  1AW0 A;  5CQG A;  4LF5 J;  3A3N B;  2FPH X;  4IUF A;  3M2U A;  2F4V F;  1PC4 A;  3BR9 A;  4FZV A;  4JI8 F;  3KMQ A;  3W9H A;  4TY8 B;  2XMM A;  5EX3 A;  3ILJ A;  3M9N B;  1U1N A;  2FJB B;  3I4P A;  5D4L A;  2D7S A;  3R6L B;  2IMW P;  3HMJ G;  2OPR A;  4NLT A;  3BGU A;  4RL1 A;  4O3Q A;  2AGP A;  5D0G A;  1WOO A;  1FXL A;  3FMB A;  2RF2 A;  4KE5 A;  3KLE A;  4OHY A;  2B0G A;  5DDP C;  1S6P B;  1S77 D;  1JKH B;  2HNZ B;  2NS1 B;  3W5X A;  2HW3 A;  5FJ4 A;  4DCJ B;  5BR8 J;  2OSQ A;  2OFG X;  2ZH6 A;  5D4P A;  2V8V A;  6AT1 B;  1HHS A;  1HWU A;  3AXM A;  1F3F A;  5LMN J;  2QN6 B;  4FVM A;  4Q45 A;  2UVW A;  2GVZ B;  2XSJ B;  4Q5V A;  3G86 A;  5I42 B;  1YSJ A;  4R0J A;  1KON A;  1LNQ A;  3GE9 A;  1NKE A;  4HAC B;  1O51 A;  5A8K B;  3V4M A;  4WF9 Q;  2RHQ B;  5DQI A;  2VOD A;  2IYI A;  2VDH A;  4WBF A;  5KFQ A;  4Q2M A;  3BQ2 A;  3CMQ A;  2FLL A;  4RW9 A;  3HZG A;  1SJ1 A;  2IJF A;  3ZFV A;  2DNK A;  2NZC A;  1L3U A;  2M52 A;  4K7Q A;  3KUG A;  2WSC C;  2XMK A;  1TK5 A;  3J7A N;  1HNW F;  2X1A A;  3NRB A;  3H20 A;  5B08 A;  2EG1 A;  3BRE A;  1HD0 A;  4FXW A;  1M5K C;  3P49 B;  5HP1 B;  1RT6 B;  5AJ3 F;  2B6A A;  2ZH4 A;  3WIV A;  4KFB B;  2ZJP Q;  2W2M P;  2PFF B;  3M8W A;  3POT B;  2CQB A;  2MTL A;  4NMX A;  4OYP A;  4JI3 J;  1TEL A;  5CAA A;  5GAE U;  4DQS A;  2B9X A;  2W2N P;  2G0J A;  1I94 J;  2QJ3 A;  1FT8 A;  2MDA A;  1RGV A;  4ILL A;  1URN A;  1C0T A;  4TY8 A;  2YWE A;  2UUA F;  1HMV A;  2EKN A;  2VFR A;  3F73 A;  1XR7 A;  2ACY A;  2NPF A;  2APO A;  4AL6 A;  3D3B J;  2DHA A;  2C42 A;  3TQE A;  2MKC A;  4YB5 A;  3UR3 C;  4DUY J;  4RO0 A;  2M70 A;  4Y3C A;  2OTJ S;  1GMV A;  5DDQ C;  2HNZ A;  2C2D A;  4ELU A;  3VGU A;  2YKM B;  4F4W A;  1Q8B A;  1SQF A;  4RNN A;  4TLR A;  4CO5 A;  3P5B P;  4KSE B;  1NK9 A;  1IWG A;  1HAR A;  2VD3 A;  5DG8 A;  5GAG U;  3CD5 A;  3RB0 A;  3BBF A;  2R7Q A;  2KFY A;  3ILL A;  1EET B;  5EUH A;  1JJ4 A;  1HR0 J;  2W01 A;  2CZ9 A;  3PEJ A;  4HAC A;  3CD6 S;  4KGM A;  2VJU A;  1B0V A;  2XMU A;  1T9Y A;  3OFF A;  3GJT B;  2CQ3 A;  3MCS A;  3PKM A;  2UZA A;  5E7O B;  2ASJ A;  1FKP A;  3SIP B;  3GIJ A;  1KSP A;  1VRT A;  5THW A;  4CT9 A;  4GVL A;  2C3M A;  1NKC A;  3MUV P;  4DV4 J;  3MZI A;  3FMW A;  1ZAW A;  5GAD I;  4LF2 A;  1JLG A;  3NNA A;  2N3O A;  2E5H A;  4ZPT R;  2RUS A;  4I67 A;  5ETL A;  2EK6 A;  3DRS B;  4K4U A;  1N5Y B;  3PIO Q;  1SKU B;  3BGO P;  1S57 A;  3DRR A;  2FB0 A;  2V9K A;  5B0G A;  1DTQ A;  2HEK A;  2YWK A;  1OYE A;  3LAM A;  2J0Q D;  4KFB A;  3HUL A;  1OQ3 A;  2FVP A;  1NME B;  3POT A;  1N48 A;  2GJF A;  4ZVQ B;  2OJ3 A;  4IG0 A;  4K4V A;  1MW7 A;  2L08 A;  1U2C A;  1HNI A;  1HQU A;  3R27 A;  4B9V A;  1TK8 A;  4XO0 A;  2CQC A;  3UNY A;  1MWY A;  5HO4 A;  1X9S A;  1N34 J;  1SIZ A;  3E3X A;  5LSL A;  4EYH B;  3MOZ A;  4OV1 A;  3TVY A;  3W61 A;  3WC0 A;  2C3P A;  3MAQ A;  4DV2 J;  1T0T V;  3VGT A;  1Q4R A;  2YNI B;  2QSW A;  1FDD A;  2VA3 A;  3I31 A;  1WOS A;  2ZH3 A;  3HZE A;  4ZHR B;  1XMB A;  3UD3 P;  5HJX A;  1GMU A;  1G2E A;  3EXC X;  4RUA A;  3SZ2 A;  3OXG A;  1SV5 B;  4DR6 J;  1S12 A;  2BJ8 A;  3MM8 B;  4AXI A;  4Y2C A;  1RWK B;  3B6B A;  1EET A;  4ES3 A;  3BJY A;  1BGX T;  1WSR A;  1APS A;  3FK4 A;  4HDG A;  3OTE A;  3H4D A;  3GYN A;  1KOO A;  2V67 A;  1MMN A;  2PGC A;  1RAF B;  2EFP A;  2JRS A;  3IGN A;  4NYO A;  2HYI B;  4PPZ A;  3KK2 B;  3Q8V A;  1DFD A;  5A8R B;  1MU2 A;  1VDH A;  1M1G A;  1WUU A;  2CAJ A;  1SKS A;  1NZ8 A;  3M8Y A;  5D0H A;  2ZBI A;  1LW0 A;  2V34 A;  1V6H A;  4ZLP A;  2DR5 A;  2B7B B;  1NSA A;  5LXR A;  2YKP A;  5BJR A;  3W2W B;  3MM6 B;  4KHR A;  2DY9 A;  1WF1 A;  3LOU A;  3DDK A;  3DLE A;  4ZLJ A;  3OVB A;  4OJG A;  3O8W A;  5F0U A;  3VV2 B;  5EWE A;  3IWN C;  3NMR A;  1YKW A;  4MYT A;  1U45 A;  3ETM A;  1Y5L B;  4QWC A;  4DL4 A;  2R8G A;  1RUS A;  3HP6 A;  5KFZ A;  5ITH A;  2CAD A;  3SEO A;  4F25 A;  3CCR S;  4WU3 A;  2XO6 A;  2YWG A;  2VAS A;  4AD6 A;  4ZIV A;  1QY7 A;  1ZM3 A;  3L4B C;  4TQS A;  4JV2 A;  1TKX B;  1SQE A;  1DBD A;  2CPD A;  4BLG A;  1NB2 A;  4I2P B;  4M5G A;  2XLK A;  3QZ7 A;  4MKA A;  3NXZ A;  3I5A A;  1MNE A;  3H5Y A;  1KQK A;  2WTF A;  3FJ2 A;  3GFX A;  5KFO A;  3MM8 A;  1PBU A;  1IR0 A;  3JSM B;  1SC6 A;  5DET A;  2Q3P A;  4C3K A;  3ZTS A;  1FD8 A;  2HND A;  1F5B A;  4NCA A;  4CO2 A;  1M5H A;  2UVU A;  3EDR B;  2LVW A;  1U1R A;  1PKU A;  2KU7 A;  1TUV A;  2W8K A;  4KHP F;  2QO3 A;  1N33 J;  2G4B A;  3D0H E;  3UD5 A;  1UWB A;  3MMC B;  4RNH A;  1OY9 A;  5K9F A;  2DGT A;  4OHZ A;  3HHK A;  4CO0 A;  3SQG A;  5A6W A;  2ZOF A;  1RA7 A;  2XMV A;  3AB2 B;  3BBC A;  4CM2 A;  4OZ5 A;  3BSC A;  3JTN A;  2PSZ A;  1X0P A;  2XS2 A;  1JLE B;  3GFH A;  1ZZF A;  5L8R C;  3NCR A;  4XPE A;  2ZFH A;  5IOL A;  5JVH Q;  4DLG A;  4RU2 A;  4W92 B;  2V63 A;  1UJ5 A;  2MB0 B;  4USU A;  4JI3 F;  4GVB A;  4B9S A;  4WP9 A;  1IKW B;  4ZVF A;  4O0I A;  2KXF A;  1URR A;  3I55 S;  1B64 A;  2DR6 A;  4OIX A;  3TUI C;  3OLA A;  2KL8 A;  3FBC A;  2ZBQ A;  1NPK A;  1X0F A;  3PAC A;  1IKX A;  3Q2S C;  2IYG A;  1WG1 A;  3T6J A;  4DQI A;  2EC0 A;  2MZ1 A;  3TAN A;  3UCG A;  1XIQ A;  4NZ7 A;  1UEK A;  4IH7 A;  2V8G A;  4OX9 J;  3NNC A;  3ZTP A;  1TKX A;  1F2H A;  4Y2I A;  3W64 A;  2GHP A;  1FRL A;  2FYX A;  1UEU A;  4DN9 A;  1FJ7 A;  3Q8Y A;  1FNX H;  5K8M A;  2FDN A;  4J91 A;  4PAB A;  1B7F A;  1HQE B;  2VKR A;  3AA9 A;  1DZ5 A;  2IDE A;  1KP6 A;  2XZW A;  4NLS A;  4IO1 A;  4PXB A;  1JJ2 R;  2W25 A;  1F5C A;  1V5V A;  4CLS A;  4BWJ A;  2KT3 A;  3M6V A;  4HHH A;  4XDC A;  3FEZ A;  4ZCM A;  3P45 B;  2D3O 1;  3GON A;  5F0W A;  1N56 A;  3UN3 A;  1VRQ C;  1VBZ A;  1RBA A;  2MXY A;  2V4Q A;  4FS1 A;  2DNH A;  2YTC A;  3S1T A;  1U1O A;  1XR6 A;  3UFC X;  2Z8Q A;  3IR7 B;  2NSC A;  3CSK A;  2A2C A;  5E3C A;  3FEY B;  4CDI A;  1UET A;  1BWV A;  1RAC B;  5L9X A;  1NJY A;  3R5B A;  3N6L A;  3AFG A;  3SFG A;  1TUW A;  4ZS6 A;  4ZPV R;  5HAN A;  3NGD A;  4C8M A;  2I1R A;  4ZMM A;  4UT4 A;  1JLE A;  4HT5 A;  3DU6 A;  3BYP A;  2FGO A;  4W4M A;  1GFW B;  2QT7 A;  1C1C B;  2CNN B;  2Z57 B;  4U9R A;  5CZX A;  4NCG B;  2JLG A;  2QL5 B;  2VG7 A;  1KVJ A;  3T6B A;  2UU9 F;  3IC1 A;  5CCL A;  3W63 A;  4WK3 A;  1HNZ J;  2XWX A;  3BDE A;  4JP8 A;  2QLW A;  1S9E A;  3KTQ A;  3N9U C;  3LGN A;  2IC3 B;  3HKW A;  2A0F B;  2WB1 D;  4YY3 F;  3PR4 A;  4DFM A;  2AF6 A;  5HAO A;  1SPB P;  2ZNY A;  3LP1 A;  3U02 A;  2AJ1 A;  3WQP A;  2HQF A;  1JXE A;  1SXL A;  3QMQ A;  3C14 B;  1OYD A;  1XR5 A;  3WBZ A;  1KS2 A;  3NAI A;  3D28 A;  4NI2 B;  4P72 A;  3ILI A;  1DQA A;  1JNR B;  1PAU B;  4EUV A;  3AJ2 A;  5H9F J;  1DLO B;  3C66 A;  1LW2 B;  2B4O A;  2XMJ A;  4D3G A;  5L1K A;  2R2U A;  3UCZ P;  2LCW A;  4NLO A;  4J9S A;  1E6V B;  1XER A;  1NAQ A;  3UD4 P;  1HQE A;  2VG6 B;  1D8Y A;  1RT1 A;  2RE1 A;  2NYH A;  4C0O C;  4CTA B;  4FF3 A;  3J81 j;  2RAQ A;  2CPY A;  4C8Y A;  2HHV A;  2DXE A;  2HRU A;  2OAU A;  2KJV A;  4V1A k;  2ILY A;  4YUD A;  3O2I A;  1CJV B;  2JL9 A;  1LXN A;  4ES1 A;  1YRX A;  2Z0G A;  2JSX A;  4RWX A;  5IM0 B;  2XQC A;  1BQN B;  3MGJ A;  1Y0H A;  4O3O A;  1KR4 A;  2W2P P;  4V19 J;  4G1I A;  1X7V A;  1RAO A;  1LK7 A;  2QA4 G;  1HKA A;  5KFT A;  4R5P B;  4NA2 A;  1R0A B;  3H0P A;  4CP5 A;  3R6G B;  5KFB A;  3EPG A;  2JC1 A;  1UZD A;  3AT1 B;  3DU5 A;  1YJW S;  3EGN A;  3AOB A;  3ZZY A;  3IN5 A;  3QLH B;  3GJS B;  4O44 A;  4M5N A;  2QLJ B;  3GV5 B;  2M4M A;  2CJ9 A;  4DL7 A;  3ZO7 A;  4ZJL A;  3I32 A;  1BLU A;  1KQS R;  3ZZT A;  1NEE A;  2ZJR Q;  1S0M A;  3G4S S;  4TY9 A;  2VG5 A;  1H6K X;  3OTD A;  3JS9 A;  4EK2 A;  1SB6 A;  4WFX A;  2A2D A;  1S59 A;  2DY1 A;  5KFX A;  4IR9 A;  3B8H A;  4AND A;  1C1B A;  5BYS A;  5IFM A;  3C14 A;  4CZC A;  3KLF A;  4H4O A;  3SCK E;  4LF9 J;  2FJE B;  3UDE A;  3KXD A;  2GCF A;  4YDD B;  1T9X A;  1IUJ A;  2C3O A;  4ANE A;  2QA1 A;  4ID5 A;  4KAI A;  1LQ9 A;  3B82 A;  4HHJ A;  1VIX A;  2Q6C A;  4FYY B;  2BAB A;  2IPO B;  3OUY B;  4YQW A;  2CIM A;  1FNM A;  4QPT A;  2KJW A;  1E6V A;  3W2V B;  3NS6 A;  3JTP A;  2GA7 A;  1AA1 B;  4DR1 F;  1VJQ A;  2LA6 A;  1N54 B;  2OH2 A;  2KM8 B;  1GTH A;  4QCL A;  3LUY A;  3KLI B;  1Z2Z A;  1BUX A;  4U96 A;  2VIH A;  3PW7 A;  4WFA Q;  4B3R J;  2NUU G;  2R8K A;  4WFB Q;  4KC5 A;  4RWW A;  3W9J A;  1BQN A;  1C0U B;  1IWA A;  4XIU A;  3K5O A;  2HAF A;  3AXK A;  1A0O B;  3BKU A;  1X9W A;  4K59 A;  7FD1 A;  3LAL A;  2BXJ A;  2Z56 B;  3NY0 A;  2Y8W A;  5C42 B;  1PGZ A;  4QR1 A;  2LU2 A;  4UUW A;  2VJV A;  2IFX A;  1R0A A;  2HAI A;  1UW4 A;  3CJ4 A;  5KFV A;  3BN4 A;  4IH5 A;  1IQZ A;  4QWA A;  4DSE A;  3VAM A;  3CT9 A;  3MI7 X;  5DDR C;  3QGP A;  2R9L A;  3DM2 A;  3QLH A;  1F60 B;  2CQ1 A;  4DN0 A;  3HVT A;  2BUN A;  1KC8 T;  4P2M A;  2GGP B;  1N36 J;  1DHM A;  1ELO A;  3DLK A;  1FDN A;  2DGW A;  4F4Z A;  2BEF A;  3SMZ A;  5IWA F;  2HLT A;  4LFB J;  3H7H B;  2CQP A;  4NE9 C;  2W1B A;  4A48 A;  1NK6 A;  3V6H A;  4WZM A;  1CPZ A;  1Y3K A;  4IFY A;  2HFN A;  2MJN A;  1CJT A;  4OV6 A;  2AZ3 A;  3V6K A;  3A12 A;  1N6Q B;  3D6H B;  1YTY A;  1IKV B;  3GB0 A;  1D1U A;  2BJ1 A;  4G1Q A;  2WVE A;  2MST A;  4X65 F;  1F3V A;  4K2X A;  4HVZ A;  3QGH A;  2SXL A;  3Q0A A;  2IRX A;  4TKT A;  1L3V A;  4NLQ A;  5K14 B;  3V6D A;  1RTD A;  4Q43 A;  1RWO B;  1DUR A;  2XG8 A;  1RE1 B;  2IM3 A;  1N0V C;  4DQQ A;  2IVM A;  4DMZ A;  3BSN A;  1OY6 A;  3SFU A;  2OP5 A;  3Q24 A;  4DSF A;  2YBV A;  3OUY A;  1HBM B;  3PTW A;  2VFS A;  4ZDN A;  1AUS L;  2VUG A;  4KY3 A;  3DI6 B;  3W2V A;  1IBL J;  4DV7 F;  1S10 A;  3FC9 A;  1NDC A;  3U27 A;  1GT8 A;  4AL7 A;  1T9U A;  3OTB A;  4KH0 B;  1L3K A;  3E01 B;  4A8F A;  3FKB A;  4HHU A;  5LM7 E;  1MN9 A;  1IKY A;  2DPJ A;  1TL1 B;  2D3Z A;  4Z2X A;  4IOC Q;  3TX8 A;  4X2B A;  2VF3 A;  2XTJ P;  1NHU A;  1YQH A;  5D8H B;  1YI2 S;  3MDF A;  2OIH A;  2EI5 A;  4USI A;  1S1T A;  2YKA A;  1DY3 A;  2FVR A;  2CYY A;  1FFS B;  5HAT A;  4DR7 J;  1S49 A;  2JOQ A;  2GS8 A;  1HWK A;  2V8H A;  4DPO A;  3WX8 A;  1QVF R;  4DR5 J;  3MTJ A;  3MPV A;  2R7W A;  1N5V A;  3BPD A;  2IDL A;  3KDO A;  4CT8 A;  5KFE A;  2F63 A;  2H3E B;  2EFG A;  3O6Q A;  2FC8 A;  3GG0 A;  5HSP A;  3HO1 A;  3M30 B;  5HVH A;  2BA9 A;  1N6Q A;  4R25 A;  3DGP B;  1IKV A;  1O6X A;  2YNH B;  5GMD A;  3C19 A;  4X4P A;  5F8G A;  2MHN A;  5K14 A;  4DI6 A;  1HNV B;  1SI9 A;  4M5D A;  1Q8L A;  4WFY A;  1RT4 B;  2E1A A;  4MIA A;  2DGX A;  2KHC A;  3LF0 A;  2M9K A;  2ZE2 B;  4ECY A;  2DGU A;  2H5E A;  2IMO A;  4K5R A;  2UXC J;  4LSL B;  2A6M A;  4X64 F;  3CGI A;  1KN6 A;  3DI6 A;  4FYX B;  3DOL A;  2QL9 B;  1HBU B;  5KG0 A;  2NQP A;  1GQE A;  1H3D A;  3M05 A;  4DF8 A;  2F40 A;  1FXD A;  4JI6 F;  4WP3 A;  1PYS B;  3T41 A;  5KFK A;  2HQG A;  1FKO A;  4A46 A;  4J9L A;  4FF4 A;  1RT7 B;  1NJW A;  1R43 A;  3D6M B;  1E6Y B;  1VHI A;  2VHG A;  4I6W A;  4ZCL A;  3HXM A;  2GIR A;  1U8S A;  2VBY A;  2W2Q P;  3QT5 A;  3VAJ A;  1VQ9 S;  4MK9 A;  3HX9 A;  2ZC4 A;  3OW2 R;  2GHW A;  3BQ0 A;  5HI7 A;  3SXL A;  3CDB A;  1NK8 A;  1HYS A;  4DV3 J;  2VC0 A;  4G1P A;  5F9L A;  4Y2M A;  2X7I A;  3N28 A;  3T9Z A;  2FZG B;  2YPZ A;  1IBM J;  2FIU A;  1HBO A;  2C2Z B;  1RP5 A;  3CED A;  5KFR A;  3K17 A;  4E0D A;  3C6U B;  2QLX A;  3CNQ P;  5J1E B;  4CYU A;  5KFL A;  3HSJ A;  4DQR A;  5D0E A;  4LF9 F;  3GV8 B;  5HMY A;  2WOM B;  1HWJ A;  4UOH A;  2V2V A;  3BN7 A;  1I51 B;  3MAA A;  5BYQ A;  1F9F A;  1J5O B;  1TU0 B;  1KOH A;  1WG4 A;  1CJK B;  4NYP A;  2AJQ A;  1SL2 A;  2CPH A;  4B9U A;  1TKT A;  3OBI A;  4ZP7 A;  2DBB A;  4MTP A;  3OHA A;  3OL6 A;  1BHN A;  5LOQ A;  4DFP A;  3KKF A;  3J7A 1;  1HD1 A;  2F8M A;  1Q8K A;  1QAJ A;  3OTO J;  4MJK A;  3H90 A;  1RU1 A;  2EEY A;  4DG1 A;  1IQT A;  3CCS S;  2E5J A;  4KPC A;  3FSI A;  1RT2 A;  1FVQ A;  4RNO A;  1M5P C;  1HBU A;  3IR5 B;  4RNM A;  3ITH B;  1H74 A;  1CC7 A;  1RWM B;  3TJ9 A;  3C6T B;  3CCL S;  2X3D A;  2ZM6 J;  5IZH A;  2GHV C;  4LR8 A;  3ZTQ A;  1RYS A;  4J7C A;  1N32 J;  1YIJ S;  2J7U A;  3F0N A;  1VJW A;  2RQC A;  2GMJ A;  2HBZ B;  1S4F A;  2BQU A;  8RUC A;  1XBW A;  4DBQ A;  4EEY A;  1N52 B;  2MKJ A;  3PRB A;  3AOC A;  4DV1 J;  2FZC B;  4ZVT B;  2JEG A;  2N7Y A;  2VFV A;  3AOD A;  4ICL B;  2AX1 A;  4WXW A;  4NWB A;  1Q8I A;  2DNN A;  2HG4 A;  1N36 F;  3IMQ J;  5KOX A;  4NA1 A;  5JJB A;  3ONQ A;  1UW9 A;  2E5I A;  2YKN B;  5B0F A;  4ED4 A;  1U4B A;  4K50 A;  1UVK A;  2C1E B;  1PJ5 A;  2M88 A;  4K4Z A;  4GO5 X;  1RHK B;  1PSD A;  5L9N A;  2G0C A;  5D3G B;  4AFF A;  2KRB A;  3D1Q A;  3MM7 B;  2ZUG A;  3VAF A;  2GO8 A;  2B56 A;  5DLG A;  3RBD A;  2KB2 A;  1WKL A;  4X62 F;  5IT0 A;  1NDL A;  4M94 A;  1HHT P;  8AT1 B;  2M5Y A;  3M8Q A;  1P9Q C;  2BMB A;  3KG0 A;  2DHS A;  4YDX A;  1VK8 A;  1GAO A;  2J0X A;  3PXG a;  4FS2 A;  1VQO S;  2FHM A;  4NRU A;  3DRP A;  3RBZ A;  1VQY A;  2O1P A;  2ZUA A;  3DDI A;  3LWL A;  2KYX A;  4RBU A;  4NXM F;  2DTJ A;  2Y9H A;  4BC9 A;  1WWH A;  1IBL F;  3AJD A;  4WII A;  4DV0 J;  2AGO A;  3FNN A;  2D69 A;  3QID A;  3DMJ B;  3NAH A;  2DGV A;  1RIS A;  4J9O A;  1RBO B;  1S1U A;  4FF1 A;  3C6T A;  5T7L A;  4EMD A;  4DUZ F;  2N4D A;  1S1W A;  3HVR A;  4H4M B;  3O44 A;  4KV8 A;  4ZIT A;  4KGK A;  1HFE L;  4N41 A;  3TVZ A;  3GR1 A;  3I87 A;  2F7V A;  2XMT A;  4AE5 A;  1FJG F;  3BGR B;  3ISN C;  4WPA A;  4M5M A;  3C2P A;  3TO8 A;  4E8U A;  2EVZ A;  1KVI A;  4F36 A;  3PM9 A;  2QV6 A;  2LXF A;  3AD7 C;  1FRM A;  5ETQ A;  1VRU A;  4LSN A;  1Z1Z A;  1W25 A;  1GXT A;  1UPM B;  5K5M A;  4ANC A;  4L75 A;  3TP2 A;  1VLO A;  2B9W A;  1YJV A;  5LSO A;  2HVH A;  4DR7 F;  1XQI A;  4NPO A;  2CWK A;  2C28 A;  2W4D A;  2CPE A;  1X4C A;  2YKN A;  2RU9 A;  5ETR A;  5HRO B;  2R7S A;  1TL7 B;  2C2N A;  3CJ3 A;  3TAM A;  1T3N A;  2KKH A;  5B0B A;  4QOT A;  4JI0 J;  4A8S A;  5LJ3 Y;  3IAM 9;  1TR0 A;  4NLX A;  5IV4 A;  3PJ9 A;  2HNY B;  2R7V A;  1J27 A;  3CC2 S;  3PHT A;  4FXD A;  4OI0 A;  3P96 A;  3DC2 A;  2W4C A;  4KGX B;  3V5R A;  1SQG A;  4O0N A;  1S1X B;  1WF2 A;  1Q82 T;  3CJ8 A;  1CQM A;  1QM9 A;  2KXH A;  4WXO A;  3DOM B;  4UTG A;  1YRT A;  2LXI A;  3NP5 A;  1FX2 A;  1WDD A;  1KHW A;  3R7N B;  1KWM A;  1B0T A;  5I4M A;  3HSZ A;  2JWN A;  3J80 Y;  2W9B B;  2BOP A;  5ETT A;  1RI7 A;  3ISZ A;  3RB4 A;  2PMZ D;  5D77 A;  3M2R A;  4YR2 A;  3DMJ A;  3TR5 A;  2DNL A;  4YME A;  1N0U A;  2YNG A;  2FC9 A;  2J9D E;  4CO1 A;  2OLW A;  2DNO A;  2JJ4 D;  3J80 U;  3IBW A;  3B4M A;  2G1H A;  3HD1 A;  4RUC A;  4DJB A;  3HHN B;  3L09 A;  3W7B A;  3LA0 A;  4DFK A;  1FFG B;  5DGB A;  4ECZ A;  4GKK J;  3MM9 B;  3IGV A;  4RW7 B;  4M5J A;  2QRR A;  1TL3 A;  4ECX A;  3K59 A;  3OL7 A;  3RUB L;  2V2Q A;  2P6T A;  1G7C B;  1FRX A;  3SCJ E;  1S6Q A;  4DV3 F;  3HFK A;  1M5O C;  1Q78 A;  4HH1 A;  1TMJ A;  1WC1 A;  1WAC A;  4DR4 F;  4OFZ A;  3PW2 A;  1IBM F;  4ZN3 A;  4Q8E A;  3GIR A;  3NG8 A;  2IBO A;  3MFI A;  1X5P A;  2BBE A;  3H8Y A;  2ZBR A;  4OZL A;  1SBR A;  1U48 A;  4U67 Q;  5IT9 U;  3CDA A;  4M1K A;  4DSI A;  2P9E A;  3AD9 C;  5HBM B;  2HVE A;  5F8I A;  4QQB A;  5A8W B;  4KQZ A;  3LP2 B;  1IR1 A;  4FYV B;  5KFU A;  3E51 A;  4LT6 A;  1IBC B;  2UUB J;  2V2K A;  2DGS A;  2XI2 A;  1YZ7 A;  3H2L A;  5H9E K;  1S1X A;  2AYE A;  3FBB A;  3DOM A;  4U8Y A;  3MMB B;  1CEZ A;  4C7Q A;  2DH8 A;  5GAE I;  2F3J A;  1PO6 A;  2FJA B;  4DX7 A;  2HVI A;  3OTO F;  1RHR B;  1WC4 A;  2UUT A;  3MEE B;  2MPU A;  1WHW A;  4ZP8 A;  1JLC B;  4GO7 X;  2F9J A;  1XN9 A;  4B9T A;  2W9B A;  3LPY A;  3NBP A;  1GNK A;  2CZV C;  1F5A A;  2GC8 A;  3CUN A;  3MD3 A;  4DPW A;  3I0R B;  3QRP A;  2ILZ A;  1X5S A;  5K8P A;  2HK3 A;  3GR0 A;  2Y1I A;  4KYZ A;  2HBY B;  3HHD A;  1CSJ A;  4FPI A;  1N32 F;  1VGY A;  5M2P A;  2K1R B;  4JI5 J;  4F3O A;  2DCL A;  3PW4 A;  1RTH B;  2D9P A;  2ZH9 A;  2Z2Z A;  1EX8 A;  3R97 A;  1PYO B;  5FLX Y;  4DV1 F;  2BAN B;  2HZC A;  2PEH A;  3IAS 9;  5F8L A;  2XMW A;  3MEG B;  4ES2 A;  4KRW A;  2RDJ A;  1SKR A;  3W5Y A;  5GAG I;  2GMH A;  3MM9 A;  4ECU A;  2DYA A;  3HHL D;  4JV1 A;  4JV5 F;  1WC5 A;  2W7P A;  3JB9 k;  3CCU S;  3DCA A;  2YH0 A;  2L9W A;  3JTO A;  1YRU A;  5FLX U;  1M5V C;  4NAS A;  5J1P A;  4K8R A;  3VGS A;  3TUZ C;  4U6P A;  2CNO B;  3MMA B;  1R3N A;  1RB0 A;  3SCI E;  3VAL A;  2HS0 A;  4ENO A;  3R9L A;  2QFI A;  3OXL A;  2FLO A;  4AUK A;  4ECR A;  2GIF A;  3EMT A;  1SC1 B;  1IBK J;  3KLG B;  5A8W A;  4OX7 A;  4ZPC A;  1QTN B;  4FF2 A;  3LP2 A;  1KEK A;  4L74 A;  3W65 A;  2LQJ A;  3IS9 A;  5CYM B;  4WFZ A;  3H25 A;  3D67 A;  2E1P A;  2DK2 A;  2IAJ B;  2I5J B;  1WEY A;  3JSR A;  2XMA A;  3MUR P;  4ZVE A;  3PEH A;  2GZO A;  2YKO A;  4DV0 F;  2YQ1 A;  3MEE A;  2OFH X;  5AE2 A;  3VAK A;  2AYB A;  2QYG A;  1TKZ A;  3RU0 A;  4J9N A;  1FJC A;  4LF8 F;  2H9Z A;  3MCN A;  1RAG B;  1UVJ A;  4PWD B;  2V68 A;  2BKP A;  4WKR A;  3CJS A;  3H5S A;  3TZW A;  4TYB A;  1G6B A;  1OY8 A;  4ZCI A;  3CJK A;  4USM A;  2WK4 A;  3Q8P B;  2V8P A;  2HVD A;  1F9E B;  1HA1 A;  3UDC A;  1VQ7 S;  4IR1 A;  1RTH A;  1S76 D;  2OPS A;  3HD2 A;  3ZZP A;  1JLB A;  3OQ2 A;  3NOG A;  3B4D A;  3GCW P;  3LGM A;  1P27 B;  2YH1 A;  2HQ3 A;  2RB7 A;  3OHB A;  1SJF A;  1MG7 A;  3CCZ A;  5A0Y B;  2H4Y B;  2RKI B;  3GV7 B;  5D6G A;  1FO1 A;  3T1Y J;  4ZVH A;  4C11 A;  2CQI A;  4MIB A;  4L76 A;  4ECQ A;  4NZ6 A;  4OZ3 A;  3F41 A;  2MY8 A;  1NSK L;  3OFE A;  3IR6 B;  4LUB A;  3H5U A;  5KT7 A;  4ELV A;  3M6W A;  3QRQ A;  4EO6 A;  5HLF A;  1Z4U A;  5CD4 A;  1TV6 B;  4LQ9 A;  1N8R T;  4PAA A;  4X4R A;  3NGS A;  2ERR A;  1EQM A;  5F3T A;  3KLG A;  2JVO A;  3IO1 A;  2P9G A;  4DPU A;  1IM6 A;  2QX0 A;  1YJ9 S;  2MZS A;  3LQV A;  4QWD A;  1SJQ A;  4A8M P;  1H72 C;  3QSI A;  4U8V A;  4DV5 J;  4C0B A;  4K4Y A;  1FK9 B;  2RUG A;  2ZZT A;  3CCM S;  4RW8 B;  1WI6 A;  4K0K F;  4O3N A;  5CXT A;  3J7Y U;  1LKZ A;  4B3M F;  5L46 A;  2XCA A;  3QNW B;  4ZN1 A;  1RHU B;  1TAU A;  4BWM A;  4K4X A;  3MR2 A;  2K2P A;  2VZ9 A;  3O5T B;  1JX4 A;  4DCP B;  1WTB A;  4O3P A;  2W7O A;  3T9N A;  5B0E A;  1CS4 B;  3OFG A;  2CQD A;  4EBE A;  5J1N A;  2O66 A;  3NGU A;  3AB4 B;  3C3L A;  1U0H A;  1CJU B;  4ERD A;  1JQG A;  2DO4 A;  2HS3 A;  2RDI A;  1SCJ B;  2DHG A;  4KBI A;  3TRG A;  5EWF A;  1CG2 A;  2QC3 A;  4ZPA A;  4OI4 A;  1T03 A;  4ZIW A;  4OLP A;  4PPD A;  3QFH A;  3CME S;  4OZ1 A;  5JVG Q;  2RIL A;  1D09 B;  5A0Y A;  1TP7 A;  1LV5 A;  2VPY B;  3MEC B;  2DXD A;  4DPX A;  4B3O B;  4LRA A;  3TAQ A;  1R8P A;  2ASY A;  2H5I B;  4J9Q A;  4PEO A;  5KT5 A;  1QUV A;  4QPX A;  3OVA A;  4J9K A;  3Q86 A;  4N47 A;  2HZA A;  2R2R A;  4OYX A;  4WE1 B;  2HHU A;  4N76 A;  3KG1 A;  2G2O A;  5DO2 A;  3I9V 9;  1LWF B;  3UW1 A;  2Y1J A;  1QAX A;  4FN5 A;  2UUB F;  1NB7 A;  2DIV A;  5DQG A;  3KJV B;  1ZBT A;  4X66 J;  4QIV A;  2M7S A;  4OQJ A;  2C2R A;  1U6F A;  2LA4 A;  2Y0B B;  4C8N A;  1FK9 A;  3VQS A;  3ENQ A;  3MMJ A;  3THT A;  3SSS A;  4P73 A;  5KAK A;  4Z7C A;  2B4V A;  2GJI A;  2WVD A;  3N6N A;  3Q8S B;  2ZHB A;  4MK7 A;  3QRR A;  3PYD A;  4I2Q B;  1SH2 A;  4Q0B A;  3D7S B;  2W9C B;  2LQB A;  2WRM A;  1LWE B;  5J2N A;  3K2Y A;  2DVI A;  1RT5 B;  1S0O A;  2WVF A;  2EG2 A;  4A4J A;  2LU1 A;  1FI4 A;  3EWG A;  1V3R A;  2OPQ A;  2R7O A;  1XNQ J;  4JI5 F;  1U02 A;  2BV3 A;  3KHH A;  3MOJ B;  5IC4 B;  1CJU A;  3KOA A;  2ZC3 A;  4N8N A;  4IG3 B;  4Q7A A;  2KT5 A;  4IYQ A;  3KJF B;  2G9O A;  2QLB B;  4EO8 A;  4O4G B;  4F8R A;  1SJ4 P;  1CBK A;  2RML A;  4U7U K;  3DYA B;  3RRK A;  2RQM A;  1NU4 A;  2BW2 A;  1SJ3 P;  3DKD A;  4JUZ A;  2MZQ A;  4EZ9 A;  2C2M B;  1DAX A;  1X60 A;  3FDS A;  1BQM B;  2ZDO A;  3R1L A;  1PCA A;  3CJR A;  3NOC A;  1A6L A;  1XMO J;  2ZKT A;  4GC7 A;  1S99 A;  1ZS6 A;  1BQX A;  2CPZ A;  3EZ5 A;  3CWJ A;  1MRO A;  4NRT A;  4DX5 A;  1U09 A;  1RK8 A;  3MM5 A;  3I56 S;  3NS5 A;  2HGL A;  3C16 A;  2VKZ G;  1KKH A;  4NOH A;  4WE1 A;  3I5B A;  3UVJ B;  3J7Z 5;  1S5Z A;  2IM0 A;  1H7W A;  1HBN B;  2CJX B;  1DTT B;  1UZH A;  4E2F B;  1LWF A;  1JLA A;  2WAQ D;  2ADB A;  1HPZ B;  4QYZ K;  1X5T A;  5SUH A;  4IOB A;  1KQG B;  2NXJ A;  4K4S A;  3N01 A;  4C8K A;  4X4V A;  2R4F A;  3SSR A;  4DUT A;  3OSN A;  3S7R A;  1QE1 B;  4ZLN A;  3UO0 A;  3CDU A;  4A8O A;  2EFN A;  1R0B G;  1FA0 A;  1FF2 A;  3C15 B;  1JB0 C;  1YIT S;  1T05 B;  4IDK B;  3Q8Q B;  4BDP A;  3T5L A;  3KG4 A;  2MZT A;  3JXO A;  2K3I A;  3RJM B;  2IRY A;  1Y3J A;  2R42 A;  2YPY A;  3P6Y C;  4USW A;  3BF4 A;  2HMI B;  4I2Q A;  2E66 A;  3IFE A;  3OR2 B;  5KFD A;  4OYI A;  1IR2 A;  2VDI A;  3R5A A;  2UUW A;  4OJ1 A;  1S6P A;  4FPR A;  1JKH A;  2QMX A;  4CH7 A;  1M1H A;  1NK4 A;  4B17 A;  3LP0 B;  3G2X A;  3LGH A;  4XDD A;  5DDO C;  5AE3 A;  1NUE A;  5T41 A;  2D41 A;  4YFU A;  3GMG A;  3GZ7 A;  5CA5 A;  3BGF A;  5EGY A;  2CZ4 A;  4IG3 A;  1Q86 T;  1KLN A;  2MQQ A;  5E3Q A;  3JSB A;  3QO9 B;  1P1T A;  4LF6 F;  3RBX A;  2GVZ A;  3AQP A;  2XSJ A;  4ZP6 A;  1TAQ A;  5I42 A;  3A1Y G;  2DPI A;  3TWZ A;  1M1K T;  1T9W A;  4L6V 3;  5A8K A;  2LDI A;  3HT3 A;  2QEX S;  4A8K A;  2ZKU A;  5F8J A;  3VVU A;  4OMF G;  2UVR A;  3BM7 A;  1KFD A;  2B8Q A;  4FKX A;  2E7W A;  5U47 A;  1FX4 A;  3WZ0 A;  1Y5N B;  1MWQ A;  5CYJ A;  1YJU A;  3GIK A;  4O23 A;  3T5J A;  3ZTR A;  4JB8 B;  3MF5 A;  2YWW A;  4A47 A;  1Q95 G;  2WCX A;  1G4C A;  3VR1 A;  3G9C A;  2GVD B;  3PFE A;  2E1C A;  3UVJ A;  3CF5 Q;  1ZZN A;  1NK5 A;  1VBX A;  4F7V A;  5A6P A;  2VON A;  5HP1 A;  2FLN A;  1RT6 A;  2CKW A;  4NEZ A;  2VQF J;  4ED7 A;  1IXK A;  2W7A A;  1S0V A;  2UV8 G;  2BJ9 A;  3AY0 A;  5DZ7 A;  3T1H J;  4DEZ A;  3NGT A;  1SUQ B;  2FTR A;  4K2J A;  3VAI A;  1PG5 B;  4B3S J;  3BYR A;  4NLP A;  2DO0 A;  2E1R A;  4QWB A;  3C15 A;  3PR5 B;  2DIT A;  1X4A A;  4NLD A;  5A2Q Y;  4UY8 T;  2Y1R I;  1YJN S;  4RKU C;  2CWX A;  1VYA A;  4YHH F;  3IRX B;  2WVB A;  2OSR A;  3DLG B;  3KLV A;  4DR3 F;  3NCP A;  2B5J B;  1PAE X;  3RR7 A;  2UUC J;  2J9C A;  2ZWO A;  4DV6 J;  4RW6 B;  2CQH A;  3JQJ A;  1YLX A;  4ZPW R;  1Z2L A;  3MAH A;  4KJI A;  2PA8 D;  2W24 A;  3NMA A;  3EUN A;  4LVO P;  3DOK B;  4DR2 F;  4URS A;  2CPI A;  5A2Q U;  2QG9 B;  4NXN J;  2VQE J;  3CIM A;  2XCP A;  2YKM A;  1HQ2 A;  2EK1 A;  4BBY A;  4AYB D;  2P5V A;  4BS2 A;  2PFD A;  3L7P A;  3NGR A;  2OKQ A;  2N4C A;  3R2C J;  2HS4 A;  3UE2 A;  4ECT A;  4PQU B;  4M63 A;  3TOQ A;  5F8N A;  1KTQ A;  3PNI A;  1FE0 A;  4Y2A A;  1WI8 A;  3VHQ A;  2I0X A;  4DS5 A;  4NLR A;  3P8B B;  9RUB A;  2YX4 A;  2DR8 A;  4WWS A;  3K57 A;  4M5I A;  2HKE A;  5MLC V;  4ATN A;  5EN1 A;  1N5Q A;  2CJY B;  2HQD A;  5J2M B;  4ECS A;  1H2U X;  4HDH A;  2VBX A;  1HNX J;  4R8U B;  2EPI A;  3MPW A;  3SQO P;  3TJA A;  4OHX A;  2XY7 A;  1Q0N A;  1N88 A;  1QTM A;  3A3O B;  2GVD A;  2IVF B;  3CMA S;  5C2C A;  2J9D A;  3MWB A;  4HH0 A;  1RWW B;  2GNK A;  2BQR A;  1FRJ A;  3DRS A;  2D9O A;  1N5Y A;  4GKJ J;  2ZBP A;  1UFL A;  5F8H A;  4F4K A;  1CC8 A;  4LF5 F;  2M8D B;  3PX4 A;  3D1O A;  1T02 A;  3PYF A;  1ZA1 B;  4DZD A;  5KFM A;  1GMW D;  5GMK a;  2FZK B;  4KTQ A;  2QA4 S;  3N79 A;  1FD2 A;  1YDL A;  2B4P A;  3PHE A;  3M2V B;  3SV4 A;  4ITS A;  1TQL A;  4PXD A;  1ITP A;  2RIJ A;  4KH1 B;  2XS7 A;  1DQ8 A;  2B5J A;  1B3T A;  1TFW A;  1VQP S;  4MK8 A;  2MY7 A;  1S72 S;  2HQI A;  4I6Y A;  4YB7 A;  3N6M A;  3D1H A;  3DXS X;  5BR8 F;  2VH7 A;  3M8Z A;  5G0R B;  5SZT A;  2QE5 A;  4NYZ A;  1P1L A;  1QSY A;  2AHO B;  1U6B A;  2YNI A;  3NL0 A;  5LMN F;  3ENV A;  2A3J A;  4UST A;  1QAY A;  4ZHR A;  1UVM A;  4OHV A;  2OO4 A;  4RX6 A;  3SV3 A;  5HVF A;  1RKI A;  4DX6 A;  1SV5 A;  1UJ6 A;  4Y6I A;  1RLC L;  2H5J B;  3H59 A;  3ZZ0 A;  1ZYQ A;  1WJ9 A;  3TZX A;  2ALY B;  4F50 A;  2GJ2 A;  3LW5 C;  3EPI A;  2LEC A;  3P4U B;  1XMO F;  2EXU A;  3IBC B;  2MKS A;  5A76 A;  2HIY A;  2JX2 A;  3SSQ A;  1VQ6 S;  3KK2 A;  1SL1 A;  3M4X A;  5A8R A;  2OI2 A;  2BOA A;  1U25 A;  4CM0 A;  1L3T A;  3EGW B;  4JBC A;  2LEA A;  4ZCK A;  4R8U A;  2PN6 A;  2Y0S D;  4OI1 A;  2NXC A;  4B9M A;  3GII A;  2UV8 A;  4WTO B;  3TX0 A;  4V19 X;  2EFV A;  4HT7 A;  2AKW B;  3AJ1 A;  3W9I A;  1L3S A;  3W2W A;  1TMM A;  4ZA1 A;  3MM6 A;  4UOG A;  2ZOM A;  4CCH A;  1FRH A;  1VQ8 S;  3FEX B;  2JHE A;  1EJ7 L;  2BR0 A;  1BC6 A;  2YQ3 A;  5AJ3 J;  4PWU A;  3CD0 A;  1G1X A;  1Y5I B;  1I94 F;  3QJJ A;  3GJQ B;  1X4G A;  5AXM A;  4IRD A;  2HVZ A;  2RVJ A;  2CG8 A;  1LXJ A;  1I5O B;  3VTI A;  4A8Q A;  1KBR A;  3M1V B;  2RS2 A;  1JNZ B;  4CNZ A;  2J6S A;  1PBA A;  1ZM2 A;  2UUA J;  2Q66 A;  3MCO A;  1UAW A;  2O5D A;  3WDO A;  4DUY F;  4WYL A;  4PR6 A;  2Q1L A;  4EWT A;  5L38 A;  4RZR A;  5E33 A;  4KR0 B;  3GCX P;  1JLQ B;  4CO4 A;  4CI0 B;  2XS5 A;  2LKZ A;  3CJT A;  1GEH A;  1S9G B;  2ZBC A;  4NLG A;  1NRK A;  2JVR A;  4JI2 J;  1O5J A;  1HHQ A;  3W8P A;  2DEI A;  2HRY A;  2AD9 A;  2ZNZ A;  2PMW A;  1VHF A;  2D3U A;  3G8T A;  4OJH A;  4I2P A;  5I3U B;  1WC6 A;  2EBG A;  3OTC A;  4IO9 Q;  1NO8 A;  3N5B A;  1VR6 A;  1HR0 F;  3M6U A;  4D3H A;  4WFN Q;  2AP6 A;  2DGO A;  4UOF A;  3JSM A;  3EZU A;  2B4U A;  1EIY B;  4X4U A;  2KFN A;  4ZK7 M;  3D0G E;  4FKY A;  2ZVS A;  4P74 A;  4WZQ A;  3DRX A;  2BE2 B;  3L7O A;  4KHM A;  2UP1 A;  2QTW A;  4U7C A;  2JZ5 A;  5DZ6 A;  1GXU A;  3KK3 B;  3FBF A;  3Q8R B;  2Z2L A;  5CH7 B;  2FGC A;  3ADA C;  1RHM B;  4C2M A;  2FY8 A;  3T5H A;  4DV4 F;  2GW8 A;  5I3Q A;  2FY1 A;  3MMC A;  3N0V A;  2MQ8 A;  2HBQ B;  2W9A A;  3AD8 C;  3ZNJ 1;  4CLF A;  2DNQ A;  5J2P B;  4LRD A;  2RRB A;  5C25 B;  3D6T B;  2MLX A;  1RTI B;  1S97 A;  3ILO A;  1RYR A;  3GFZ A;  3US5 A;  4JYA J;  1B99 A;  3K7R A;  3R7B B;  4MT1 A;  2WON B;  5AT1 B;  3M7V A;  4IFV B;  3UDV A;  1KD1 T;  2CQ4 A;  4B3S F;  3Q89 A;  4PG6 A;  1X4H A;  1IKW A;  1J2V A;  4M5K A;  2CJA A;  2BE7 D;  3UNG C;  1ROF A;  1GXL A;  1NZA A;  4LF7 J;  3CB4 A;  1RQ0 A;  3EGZ A;  4M5L A;  3TA0 A;  4QR0 A;  4NA3 A;  2AMC B;  1N34 F;  1SVD A;  4YB1 P;  2OPR B;  3M8S A;  4Z37 A;  1Q5V A;  4DV6 F;  2KRR A;  4TVA B;  3GU0 A;  4LBH A;  1MMD A;  2RF2 B;  1OPI A;  3KLE B;  3CCW A;  3BO2 A;  4DV2 F;  4MKV A;  4FBT A;  2GO9 A;  5DRK A;  5KT4 A;  5E0O A;  2ZEJ A;  1Y7P A;  1FXR A;  1F9H A;  2QMW A;  1GTE A;  2J6U A;  1S6U A;  4DR6 F;  4LR7 A;  5I3U A;  1QD1 A;  1U0S A;  5IV3 A;  2IJN A;  2KYZ A;  4FYW B;  1QVG R;  1ARO P;  5HL7 Q;  2UXD J;  4DDF A;  4LIW A;  5B09 A;  1FEH A;  4YOE A;  2XNQ A;  3MPU B;  2LDY A;  3BO4 A;  1R8B A;  2AT1 B;  4Y0F A;  1OS5 A;  2PMH A;  2BE2 A;  2ZOG A;  2XHC A;  1KHV A;  5KG4 A;  1PIL A;  4USJ C;  4RR5 A;  1KVK A;  3ELH A;  2E29 A;  3KHR A;  4UZC A;  3ZNU A;  1FWL A;  5KFH A;  2ZWP A;  3KK3 A;  2HGN A;  1RBL A;  3I4H X;  3B54 A;  4WK1 A;  4A8Y A;  3TJ8 A;  1RWV B;  2CQG A;  1RAE B;  3QPI A;  4N56 A;  2XGQ A;  2XZD B;  1UL3 A;  1QAI A;  1LK5 A;  2W2O P;  1K8A T;  4KPY A;  2AWZ A;  4GKJ F;  1T11 A;  1W7W A;  3UQS A;  1T94 A;  5HJY A;  4LRF A;  1C1C A;  2XGP A;  3HHL B;  4OYA A;  1H2T Z;  5HVG A;  3MEK A;  1F6T A;  3G8S A;  4X4Q A;  4NCG A;  1RLD A;  4DL6 A;  5ETO A;  3CO0 P;  4M5H A;  2R2T A;  2JFD A;  1S79 A;  2RS8 A;  2V5H G;  2H48 B;  1WTF A;  2POK A;  3GSD A;  4YP3 A;  3WIU A;  4F02 A;  1FDA A;  5F41 A;  2IC3 A;  2EC2 A;  4FDF A;  1AFJ A;  1C0T B;  3LAN A;  1HIY A;  1HMV B;  2FHJ D;  3CJQ A;  2BX6 A;  3I9Z A;  3M8R A;  2DJW A;  5IS2 A;  5KFG A;  5LSR A;  3PCO B;  3PJW A;  1P8G A;  1VQS A;  2WHO A;  5KG1 A;  2AGQ A;  4NI2 A;  3NGK A;  3ICL A;  2HLU A;  5HN0 A;  3QQC D;  4P10 A;  5GAH U;  1DLO A;  4DHV A;  2ASL A;  1LW2 A;  4Y65 A;  2Q79 A;  2V50 A;  1XJW B;  2GV1 A;  3TNV A;  3VAG A;  4J90 A;  5FD1 A;  5DQH A;  4QU6 A;  2VG6 A;  4DFJ A;  4Y34 A;  3KJQ B;  4CTA A;  1WEL A;  4CLL A;  2AYM A;  1TFY A;  2ZH1 A;  3LWM A;  3D5M A;  5KG2 A;  3IBF B;  3KMS A;  2MQO A;  4C6A A;  4X4O A;  4X4N A;  1CJV A;  4HLB A;  1D3W A;  1N33 F;  5B0C A;  4OYB A;  3OLB A;  1RAJ A;  4LMZ A;  3PV8 A;  1FKP B;  1JK9 B;  1VRT B;  3F44 A;  5IM0 A;  2AX0 A;  2CG4 A;  4KHP J;  5H9F K;  3HI9 A;  3CCJ S;  1FRK A;  2WZ1 A;  3HK2 A;  1JLG B;  3BDP A;  2VC1 A;  5DM6 Q;  4R5P A;  2FQQ B;  1HWL A;  1W26 A;  2K8G A;  2ZH5 A;  2CQ2 A;  3DRR B;  2J7K A;  3TEG A;  1DTQ B;  1RAA B;  5KFP A;  1NK0 A;  3HHL A;  3UN2 A;  2BRL A;  2VPW B;  2OD6 A;  3K8V A;  3VF0 B;  2HRT A;  2WB4 A;  2MKK A;  2L9D A;  1R8A A;  4PG7 A;  4IG0 B;  5M2U A;  3KWM A;  2EFQ A;  2AEM A;  3G87 A;  1HNI B;  3J7Z T;  1HQU B;  2R3V A;  4UOC A;  2KTQ A;  1X4B A;  3TVK A;  2HIQ A;  1HWI A;  3ENW A;  2YXL A;  3BGL A;  5E3R A;  1K0V A;  1JIH A;  3NWG A;  3RTV A;  3D2W A;  5C2G A;  1X31 C;  5AXL A;  2LP4 A;  1K9M T;  3U1N A;  1WHV A;  3THV A;  4ED0 A;  3GWC A;  4OX9 F;  5D15 A;  2NUH A;  3MED B;  4F26 A;  2VU5 A;  2V8D A;  4ZVG A;  3HLU A;  3R2D J;  3S6E A;  4U7U D;  2I9S A;  4JI2 F;  2DR9 A;  5CHC B;  3OD2 A;  4LSZ B;  3OPK A;  2CJQ A;  3FUY A;  2JLF A;  1AB8 A;  2HFV A;  1UMJ A;  2LQ8 A;  3R5J B;  3K58 A;  4ILR A;  2BJE A;  5IQ6 A;  1DJ0 A;  1U2F A;  2PI4 A;  1KTV A;  1VC6 A;  1C2P A;  1V9O A;  3PO5 A;  3CVK A;  2VL1 A;  3KLI A;  2E5G A;  4DX8 H;  3Q83 A;  3QFW A;  2CPJ A;  3DGV A;  1SKW A;  1IJE B;  2OGU A;  5KG3 A;  1UTA A;  5G4D A;  2X51 A;  1MU2 B;  2AIR B;  4DXL A;  4JV0 A;  4ZVS B;  2HWH A;  2BYC A;  1C0U A;  5AXN A;  5DG7 A;  2AZ1 A;  2F8H A;  1K47 A;  1LW0 B;  3HVA A;  4F3M A;  4PQA A;  2AQ4 A;  5C42 A;  2ABY A;  4CLW A;  1OWX A;  2V0N A;  3GG1 A;  2DIS A;  4JYA F;  3EZO A;  2KVI A;  2IY5 B;  4OYO A;  4DLE A;  5HK4 A;  2DHX A;  1K1S A;  1UFK A;  3TZY A;  5JUM A;  1TTH B;  2ZHO A;  3RR8 A;  2Z2M A;  1ZAX A;  5BXI A;  2Z30 B;  4F4X A;  1UCN A;  1HNZ F;  2FJV A;  1H98 A;  4USK A;  3DLE B;  2GGP A;  2AU0 A;  2RU3 A;  2ROG A;  2UU9 J;  1WC3 A;  1RWX B;  2VFT A;  3EM1 A;  4LF7 F;  2OEK A;  4I0W A;  2G0I A;  4FP9 A;  1UVN A;  1IM4 A;  2CXE A;  2EKY A;  5KFF A;  3GQC A;  2E5L J;  4YY3 J;  4ALZ A;  2DD8 S;  4N8O A;  2HHP A;  3EYZ A;  1S7I A;  1XMQ J;  2JEJ A;  4KT0 C;  1P9Y A;  2NLW A;  2FJW A;  2HFO A;  3EGV A;  5M2R A;  3MED A;  2MHE A;  1N5S A;  5C24 B;  3Q22 A;  1SIW B;  1EKS A;  3KFW X;  2I2Y A;  1JXL A;  4CLP A;  4DS4 A;  2BJ3 A;  2Q6B A;  2ZZM A;  1HBM A;  9ATC B;  1FFW B;  2GIQ A;  4CLZ A;  2FVS A;  2DH7 A;  3E8O A;  2UXD F;  3G82 B;  2BKO A;  5T14 A;  4LR9 A;  1U6Z A;  4ECW A;  1EP4 B;  4PUO B;  4PCQ A;  2L9N A;  1H0H B;  5KFJ A;  3J81 Y;  3NS7 B;  4DZ6 A;  1S0N A;  2HND B;  4HI2 A;  5LMU J;  2F65 A;  2NRE A;  3E01 A;  3JAM Y;  2XYP B;  3UWT A;  2VFU A;  2BW7 A;  1TL1 A;  4LFC J;  2Q43 A;  4ER8 A;  4PG5 A;  1UWB B;  3CXC R;  5ETK A;  1D9D A;  3SQG B;  3J81 U;  4L72 B;  3QT7 A;  3AHP A;  1BMQ B;  4J9P A;  3JAM U;  3CCQ S;  2HBR B;  3CJ0 A;  2B3T B;  1XC9 A;  1U2R A;  3R5C A;  2GX8 A;  2Z58 B;  3O3L A;  2AJ2 A;  1T9T A;  3BKT A;  3B78 A;  4QBU A;  4GRS A;  5BYR A;  1Q53 A;  1NXI A;  1ZM4 A;  4YR3 A;  4GVB B;  1X9M A;  4ED1 A;  4IRK A;  2MMY A;  1ZH5 A;  1RJJ A;  2IA6 A;  2ZH7 A;  3IP0 A;  1TL4 A;  1H38 A;  1TL5 A;  2K06 A;  2DRB A;  1IKX B;  3M30 A;  4J9R A;  2IM1 A;  1F0X A;  3PKY A;  2XUL A;  1GK8 A;  2O3D A;  3DGP A;  3MR7 A;  4HR2 A;  4C8L A;  2YNH A;  1EB0 A;  4UQT A;  4E98 A;  4MH8 A;  4O4R A;  4X4T A;  1RA6 A;  1HNV A;  4TNO A;  2V6A A;  1FVS A;  1G3O A;  1UPP A;  1RT4 A;  1R6Y A;  5C24 A;  2N7C A;  3TQ1 A;  1FNO A;  4I6A A;  1YBU A;  2RQ4 A;  4Y00 A;  2MLZ A;  2ZE2 A;  4N5S A;  2Z2Y B;  2AV5 A;  4LSL A;  4WYW A;  1HLW A;  3G82 A;  5EHH A;  3RAQ A;  4K4W A;  1EP4 A;  4PUO A;  2V94 A;  4DR1 J;  2MSS A;  5KFS A;  2M0G B;  2IRU A;  1NJX A;  2AW0 A;  3FRY A;  4B3R F;  2K3K A;  3EVW A;  3HHL C;  4RUH A;  1OSD A;  4MAK A;  5KG7 A;  1RT7 A;  4QJV A;  4FXV A;  1E6Y A;  3DFE A;  4USV A;  4FYD A;  3ZZO A;  1P6T A;  1ZPW X;  4MIW A;  4YB6 A;  4P75 A;  1YGY A;  2KO1 A;  3JQM A;  3AH6 A;  2ZVI A;  5AE1 A;  3D0I E;  1Y10 A;  3KK1 B;  1UA0 A;  3JYT B;  1NSP A;  4H54 A;  4RLE A;  1T9V A;  2A6O A;  1KDN A;  3PYE A;  3TAR A;  3WC2 A;  3ZTO A;  1FKA F;  5DG9 A;  4RPF A;  1ZOT A;  2PEB A;  1NH8 A;  4DSL A;  3C8Y A;  2EBE A;  1O8B A;  1WHY A;  4HEA 9;  2CPX A;  1OJ4 A;  4LQ3 A;  3KHG A;  4OYW A;  4O3S A;  2VG7 B;  4EFA C;  3QAT A;  2JNJ A;  1NKB A;  2MLY A;  3S01 A;  1XK8 A;  2PII A;  1S9E B;  4LFB F;  3PX0 A;  3QZ8 A;  1MSW D;  3C6U A;  2HFS A;  2AYG A;  4NX9 A;  1Y4Z B;  1SL0 A;  5J1E A;  4P9S A;  4IQX A;  2I38 A;  1OMS A;  5IWA J;  4I7F B;  4F4A A;  3LP1 B;  1HL6 A;  1RTZ A;  1R6V A;  2KVQ E;  3BSA A;  2P9C A;  1HW8 A;  4JI4 J;  1RAI B;  3HSG A;  4B3T J;  2WVC A;  5E3A A;  1DAR A;  1VCT A;  2VIC A;  3PW0 A;  2WOM A;  3VZI A;  2MJU A;  2KM8 C;  1J5O A;  4X65 J;  2BDP A;  1CJK A;  4URQ U;  3AAW B;  4ED8 A;  3MD1 A;  3MTK A;  3G96 A;  1KNZ A;  4AXJ A;  2HZV A;  2WBM A;  4WKY A;  3J7Y I;  3A8K A;  3K0J A;  4XPC A;  2XI3 A;  3EDQ B;  5KTQ A;  1ZTT A;  3LH2 S;  2X1F A;  1RT1 B;  3OFH A;  2OHD A;  4TU8 A;  4FVC A;  4NZ0 A;  4ILM A;  4TN2 A;  3ITH A;  4GC6 A;  3NKY A;  4LF1 A;  5KFA A;  4DV7 J;  2CFX A;  5B0D A;  2YY3 A;  5D4N A;  1QDU B;  4MKY A;  5ETN A;  1WSV A;  4ID8 A;  4LF4 J;  4ZKA A;  1YHQ S;  5GVQ A;  1TUG B;  1JLF B;  4AT1 B;  4ETX A;  2J9E A;  3H5X A;  2Y3Y A;  4LBI A;  1XNR J;  1NND A;  3KK1 A;  1TVR B;  3JYT A;  3TUP A;  2DT9 A;  4ZJO A;  3P3D A;  4ICL A;  3T5K A;  2E1M C;  4O44 B;  5KOW A;  1RCO B;  1KRP A;  1NSQ A;  1UVL A;  4DR5 F;  5ETM A;  5KT6 A;  2XWY A;  2ZJQ Q;  2VG5 B;  2VOO A;  3FCW A;  5MAO A;  1NPP A;  3TA2 A;  1FE4 A;  2E5L F;  4ED2 A;  2X3G A;  5HQM A;  1U1Q A;  2F9D A;  5D3G A;  3M9M B;  3MM7 A;  4I7F A;  3U7J A;  2OEJ A;  1C1B B;  1XMQ F;  3R8Y A;  3PX6 A;  4LFA J;  3KLF B;  4LJM A;  2HUR A;  4H4O B;  1Q16 B;  4IH6 A;  1GH8 A;  4ZP9 A;  2DRD A;  2LLZ A;  2MQM A;  4C97 A;  1R27 B;  2N3L A;  4ID5 B;  2COL A;  3CC7 S;  3CCV S;  5C7P A;  2YX7 A;  2A1B A;  1EAR A;  4B9N A;  5CD4 H;  2ADC A;  2L3M A;  2F5G A;  3BEG B;  2UXC F;  3D9B A;  3GYG A;  4HTJ A;  5IT4 A;  3FCH A;  3T1A A;  1GX5 A;  3TI0 A;  1UA1 A;  2RT3 A;  3GSI A;  1NH7 A;  2G2Z A;  4KO0 B;  3QGG A;  3HM9 A;  4X64 J;  3PJX A;  2DNY A;  2H65 B;  2RJZ A;  1R89 A;  5F3Z A;  4BC7 A;  3IM9 A;  5GME A;  3HVW A;  5LMU F;  3EE3 A;  1S9F A;  2FVQ A;  1T3O A;  4P52 A;  3O1L A;  1VQN S;  5F9N A;  4JI6 J;  4H4M A;  2JFK A;  5JMN A;  4LFC F;  1BY9 A;  2V69 A;  1JMT A;  4CO3 A;  4ETZ A;  1F2G A;  3OJU A;  5K20 B;  4LBP A;  2XBP A;  3BGR A;  1JLF A;  1R8H A;  5GAD U;  2XM3 A;  2KZM A;  2KZZ A;  3ENA A;  1C4A A;  1MLA A;  1TVR A;  4QR2 A;  5IT9 Y;  3DXB A;  2NPI A;  3M9O B;  1EQ0 A;  1R8C A;  5DS7 A;  1H73 A;  1W2B R;  3DM2 B;  4RNF A;  4UUX A;  2ASD A;  3HVT B;  5L1L A;  2CUY A;  4NLV A;  5FII A;  1QJH A;  1M0S A;  5ETS A;  3DLK B;  1WF0 A;  3T3F A;  4ELT A;  4IQM A;  3PIP Q;  5HRO A;  1SC3 B;  1TL7 A;  2YX1 A;  3FBE A;  3FZ2 A;  1WG5 A;  5H1S V;  2UVV A;  4IFY B;  3G6E S;  4P7T A;  1VK3 A;  1CJT B;  1ZAV A;  3KHL A;  1KFS A;  4OX8 A;  2HNY A;  3A8E A;  4DL2 A;  2HFU A;  1ZTW A;  4G1Q B;  3OJS A;  4N7T A;  1VBY A;  2XLJ A;  1H7X A;  2K7J A;  1FDB A;  1KLM B;  2QZ8 A;  3ZC4 A;  2B8P A;  4HYK A;  1BWE A;  4UF4 A;  3V6D B;  3HJF A;  1RTD B;  1AT1 B;  3OL9 A;  3GLJ A;  3EJM A;  4N77 A;  3BH7 B;  4OJ3 A;  1NJZ A;  3MR6 A;  1RXO B;  4CLT A;  3GIL A;  1QSS A;  1SJR A;  5JXS A;  1GMW A;  2K7K A;  3P5T L;  1YG0 A;  2QL7 B;  4QIF A;  4OYZ A;  3DLB A;  1YWX A;  2C2E A;  2HPU A;  2RH3 A;  3MUM P;  1SH0 A;  3GP9 A;  4KO0 A;  1I1G A;  4P7V A;  1NCL A;  2ROP A;  3GTY X;  5LT5 A;  2ZM6 F;  1WDT A;  3HCX A;  1VBK A;  2OMO A;  1HI1 A;  5DJB A;  3DN9 A;  2BM0 A;  2GAG C;  4EBD A;  5F8M A;  3LAK A;  3FQL A;  2PT0 A;  1IKY B;  3AQO A;  4QIE A;  1FJE B;  2ZZN A;  2RSQ A;  3ET6 B;  2AJF E;  3MHY A;  3GFY A;  2H4W B;  3QBC A;  1DRZ A;  2QMU B;  4XAK A;  1K73 T;  4JOU A;  2B51 A;  2QYC A;  1CLF A;  4K5S A;  3UDL A;  2QIF A;  1MWZ A;  4RW7 A;  2AEF A;  2HHH J;  2C3U A;  4QIG A;  1S1T B;  1W2I A;  3PFO A;  3A4T A;  1VLY A;  1RWU A;  3D4J A;  3CTR A;  3W1Y C;  1B70 B;  3RW7 A;  2HWI A;  3HT0 A;  5KG5 A;  3HF5 A;  4ZVO B;  2ZH8 A;  3RW6 A;  1QLN A;  3F56 A;  4ECV A;  4CH1 A;  2W4P A;  3RZA A;  4I68 A;  4UW2 A;  5HBM A;  1VI7 A;  1UP1 A;  2YQ0 A;  3G6V A;  3UR0 A;  4M8L A;  4RJV A;  3KUE A;  2LXU A;  2LQ9 A;  4JI4 F;  4B3T F;  5HMZ A;  4NML A;  1O0P A;  3V6J A;  2FJX A;  1WHX A;  2W8L A;  4NL5 A;  3KYL A;  4QZV B;  2VPZ B;  3OT9 A;  4X62 J;  1T8E A;  1KLM A;  2PD1 A;  5E2Q A;  4EU0 A;  1AFI A;  2BKN A;  2YNF B;  2J0W A;  4M5D B;  3OXF A;  4MKB A;  4I69 A;  4URG A;  2DGQ A;  3MMB A;  2ATC B;  4OZ0 A;  1EKR A;  3M8P B;  4DSJ A;  3PZP A;  1UKU A;  2HHW A;  3BBB A;  1U24 A;  4NXM J;  4R0E A;  1JLC A;  2EW9 A;  2MQP A;  2LEP A;  3DOL B;  3K5L A;  3M6X A;  1WEX A;  1REV B;  3RAM A;  1VS3 A;  1AZS B;  3I0R A;  2JC0 A;  2DH9 A;  2M3D A;  4CLU A;  4LF4 F;  1FKO B;  2G2Y A;  1VC5 A;  5CCM A;  4DUZ J;  2BQ3 A;  1FTC A;  2K1R A;  2YKQ A;  1D0E A;  3EXY A;  3QIP B;  1RT3 B;  1WKK A;  1FTR A;  2BJD A;  3ET6 A;  1FJG J;  4MYU A;  4WIQ A;  2BAN A;  3MEG A;  1Q7Y T;  1XNR F;  3HHE A;  1VQ4 S;  1N4L A;  1K1Q A;  1RAD B;  4JI7 J;  3HDS A;  4DCO B;  3FCV A;  2BJ7 A;  4C4W A;  1YBT A;  3BB5 A;  3MR3 A;  1FWP A;  1HYS B;  1NBE B;  4F2S A;  4OI2 A;  5EX0 A;  4AQY J;  2J5A A;  3MMA A;  1HBO B;  4WCE Q;  4C8O A;  4CRJ A;  3AA8 A;  4DL5 A;  1FCA A;  3UCU P;  4UZB A;  1VQK S;  4OI6 A;  4JI0 F;  2MYF A;  3TZZ A;  1UEV A;  2ZHA A;  1PIE A;  4CYU B;  2QLF B;  4X4S A;  2J0S D;  2FUG 9;  2RQK A;  4OZJ A;  2H1Y A;  4LFA F;  2XLI A;  1IN0 A;  5C5J A;  4QYR A;  5CYM A;  3CJ5 A;  3MAA B;  2XZT B;  4F0M A;  2MZR A;  4DPT A;  4TLQ A;  2IAJ A;  1U49 A;  2I5J A;  1LFP A;  1TKT B;  1R7I A;  2YNF A;  5D78 A;  2KG0 A;  2EFO A;  3H42 A;  4IKA A;  2KG1 A;  2CNK B;  3M8P A;  1U26 A;  2PO4 A;  1NK7 A;  3G8Q A;  2RRN A;  2HSE B;  2DNZ A;  2QSF A;  2R2S A;  5FDL B;  4A8X A;  2IM2 A;  4DG1 B;  2Z4P A;  1RT2 B;  1YJT A;  1REV A;  4PWD A;  3LTO A;  4DU7 A;  2R7U A;  4LRE A;  1AZS A;  1LFW A;  3MCM A;  2FJD B;  4LIR A;  4CIO A;  1WNE A;  2QFJ A;  1H2V Z;  2OML A;  2OPP B;  3RB3 A;  3LPE A;  3MFH A;  2KFZ A;  3QIP A;  1RT3 A;  1TK0 A;  2J8S A;  4GKK F;  3PO4 A;  1RKJ A;  4DL0 C;  2QGF B;  3QAE A;  2XC9 A;  2U1A A;  3EVM A;  3V2U C;  4ED6 A;  4P2S A;  4HTI A;  2RKI A;  2XYH B;  2C22 A;  2FHO B;  2NXN A;  2IHR 1;  3DDN A;  2MZJ A;  2LEB A;  4UQG A;  4C9D A;  3BS9 A;  1WKJ A; 
#chains in the Genus database with same CATH homology
 1JXV A;  1BE4 A;  1NSQ A;  1NSP A;  3EMT A;  1NB2 A;  3ZTQ A;  3FBF A;  1ZS6 A;  2HVD A;  3BH6 B;  3EE3 A;  1MN7 A;  1KDN A;  1W7W A;  3WX8 A;  4ANC A;  3Q83 A;  4WBF A;  1NDK A;  4ANE A;  1LEO A;  3FCV A;  3G2X A;  2DY9 A;  3ZTO A;  3NGR A;  1XQI A;  3VGT A;  2DXD A;  3FCW A;  1NUE A;  4UOH A;  2ZUA A;  3DDI A;  1F6T A;  3FC9 A;  5CAB A;  3FBC A;  1NDC A;  2CWK A;  2B8P A;  1NPK A;  2HVE A;  1S5Z A;  3NGT A;  3BBB A;  4CP5 A;  4C6A A;  3ZTS A;  3EJM A;  3Q86 A;  2AZ1 A;  3VVT A;  3EIC A;  1HLW A;  3FKB A;  1B99 A;  2BEF A;  3BH7 B;  3VGU A;  1S57 A;  4S0M A;  2HUR A;  1XIQ A;  3L7U A;  1MN9 A;  1PKU A;  1NDP A;  1HHQ A;  3EVO A;  1BHN A;  3ETM A;  3B6B A;  3ENA A;  1HIY A;  1B4S A;  2VU5 A;  1NSK L;  3GPA A;  2NCK L;  4DUT A;  2AZ3 A;  3PJ9 A;  4F4A A;  2BX6 A;  4DI6 A;  1BUX A;  2DYA A;  3ZTP A;  3Q89 A;  3FBB A;  1VYA A;  4UOG A;  1NHK L;  3EVW A;  5C7P A;  3VVU A;  3GP9 A;  1PAE X;  3BBF A;  3NGU A;  2B8Q A;  4KPC A;  3Q8Y A;  4FKX A;  3JS9 A;  1EHW A;  1U8W A;  3BBC A;  3PRV A;  3ELH A;  1NLK L;  4UOF A;  5BXI A;  4EK2 A;  1NCL A;  1UCN A;  2DXE A;  3Q8V A;  3VGS A;  3NGS A;  1F3F A;  1K44 A;  1S59 A;  3MPD A;  4O0N A;  1WKK A;  3DKD A;  3EVM A;  1LWX A;  4FKY A;  3B54 A;  4DZ6 A;  4AND A;  3ZTR A;  4ENO A;  3EM1 A;  3R9L A;  5CAA A;  3VGV A;  2DXF A;  1WKL A;  4HR2 A;  4W98 A;  4F36 A;  5IOL A;  1NDL A;  3FBE A;  3Q8U A;  1WKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...