3BO2A

A relaxed active site following exon ligation by a group i intron
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Group I intron P9
publication title A relaxed active site after exon ligation by the group I intron
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein/rna
total genus 22
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bo2A00
4P6QA 4RU2A 1G2EA 2KFYA 1X5TA 5LJ3Y 2KRBA 1KD1T 2EK1A 3ULHA 5LXYA 3TP2A 4QPTA 4WCEQ 5DDQC 1SXLA 4IO9Q 2MQMA 4OZ1A 2XS7A 2X1GA 3UWTA 5GVQA 2M0GB 4TU7A 1PO6A 2CPXA 3CD6S 2GO9A 2CQ0A 1VQ4S 2A3JA 2RVJA 3HI9A 1H2TZ 2MKSA 4CIOA 3Q2TC 2N3OA 1KOHA 3L3CA 2DNNA 1VBZA 1S72S 5LSOA 1VQPS 2JWNA 3I55S 2VOPA 3VAKA 2RQ4A 3S8SA 1VBXA 2VOOA 2EK6A 1R8PA 1U6BA 1WTBA 2M8HA 1U1PA 2D3OR 4C4WA 2CJKA 3BS9A 1DBDA 3FEXB 2CQDA 1WEXA 2DHAA 2RS2A 2YWKA 2MY7A 1SJFA 2JRSA 2M52A 1DZ5A 2MXYA 2MZQA 5JVHQ 2F9DA 2LMIA 1UW4A 3MD1A 1URNA 1KQSR 2ERRA 2DHXA 2CPHA 1U1KA 1X5SA 5IM0B 2NLWA 2RRAA 1X0FA 2K8GA 4YUDA 4CH0S 2MSSA 3JB9k 1FHTA 2QEXS 1WWHA 1SJ3P 3PIPQ 3NNCA 2AYMA 1WELA 2MKKA 4IOAQ 4TU8A 2HGLA 2U2FA 3THPA 3H2VE 2MZTA 5DDOC 1DRZA 2DGQA 2DNYA 2X1FA 2DGUA 3EGZA 3ZZYA 2CPEA 2DH8A 3P6YC 2MQPA 2XB2D 5DM7Q 2LXIA 2CQ2A 2MMYA 1WI6A 3G96A 2AYBA 1VQ8S 2X1BA 2DNRA 2I38A 2KXNB 2OJ3A 4WIIA 4OZ0A 2KU7A 5IM0A 1VQNS 3UCUP 2DO0A 3CCJS 2LXUA 2MY8A 1UFWA 4LIRA 4BS2A 2KI2A 3MUMP 3BEGB 3CF5Q 1WG4A 3J7ZT 1QVFR 2MQNA 2DITA 2J76E 3G6ES 1WHYA 2UP1A 5IFMA 1WF0A 2MKIA 1U1MA 2RT3A 2DGVA 4F26A 3VALA 1DHMA 2RU3A 2U1AA 3CCES 1AUDA 3G4SS 3CCLS 2M4MA 2JVRA 1WG1A 1JJHA 3P3DA 2DK2A 5IQQA 2LA6A 2DO4A 4IUFA 2M88A 2NZ4A 1M90T 5DETA 3CPWR 4QQBA 4WFNQ 2DNMA 2I2YA 2N7CA 1FT8A 2YKAA 3MURP 3SDEB 4C0OC 2D9PA 1PGZA 4V19X 2OSQA 1WI8A 2CQHA 1SJ4P 1SJQA 2DGTA 5GAGU 2KYXA 2CPFA 2MJNA 1U1NA 1FJ7A 2HGMA 3OW2R 4WKRA 1U6FA 3V4MA 1YJWS 4QU6A 3B4MA 3VAFA 2MZJA 1X4FA 4PRFA 1K9MT 4LMZA 1VQ9S 1VC6A 2E5GA 2CPJA 1W2BR 1K8AT 1H2VZ 2JVOA 1FO1A 4Y0FA 3BO4A 1Q86T 2LQ5A 2L9WA 2F3JA 1H2UX 2CPZA 2DNPA 1NO8A 3MUTP 2L08A 2KXFA 3U1MA 2MB0B 1WEZA 3NNHA 1K73T 3CCQS 3MOJB 2XS5A 1WHVA 3VAIA 2KG0A 2QFJA 3BO3A 2DIVA 1YTYA 1ZZNA 3SDEA 5LXRA 1X4CA 1U1RA 1HL6A 1X5OA 2KRRA 3SXLA 4EGLA 5ITHA 1QVGR 3CCRS 3CMAS 1VQKS 2CQ1A 2WBRA 4W92B 2E5JA 5CYJA 4C7QA 2G1DA 2G4BA 2FPHX 3CC2S 3US5A 3CCSS 3SMZA 2ZJRQ 3S7RA 2DHSA 2KVIA 2ADBA 1WEYA 1NJIT 1OWXA 3P49B 2YH1A 3DLLQ 2LYVA 1X4AA 2D9OA 1M5OC 2CPDA 2VONA 2DNHA 1FXLA 4YB1P 3RW7A 3G8TA 2N82B 3EGNA 3NNAA 3BO2A 2CQCA 3TO8A 3CMES 2KH9A 2M7SA 2KM8B 3R1HA 1SJRA 1WF2A 2DGSA 2MJUA 3H2UB 2X1AA 2ZJPQ 2XNRA 2XNQA 1OPIA 3UCGA 1A7GE 2KN4A 4TLQA 1VQMS 1F9FA 4F25A 2AD9A 3VAHA 1IQTA 2N3LA 4Z2XA 2MGZA 3G9CA 2LEAA 4LJMA 1VBYA 4J5OA 3P5TL 1U1LA 4PR6A 1M1KT 3R27A 4Y00A 3PIOQ 3Q2SC 2L41A 2BOPA 2OIHA 3CCMS 2OTLS 2CQIA 1HA1A 1YJ9S 2AYEA 2LCWA 1X5PA 3UD3P 2MQLA 2O3DA 2FC9A 3IWNC 2ZJQQ 5MLCV 1X4HA 2HZCA 2DHGA 5LSLA 1JJ2R 2J8AA 4FXWA 1VQ5S 1X4GA 2DGOA 1A9NB 4U67Q 4A8XA 2XSFA 3MUVP 2V94A 1VQ7S 5FJ4A 5D77A 2HGNA 3UD4P 1UAWA 2BZ2A 1O0PA 1XN9A 2M8DB 3LQVA 2RNEA 2LKZA 2XS2A 3J7YU 3U1LA 3EX7B 1RK8A 2MSTA 4WFAQ 2OTJS 1N52B 3NMRA 2MPUA 3DXBA 2DISA 2MKCA 4FXVA 1VC0A 1D9AA 3N9UC 3ZZZA 2FY1A 1CVJA 2E5HA 2KT5A 3MDFA 1OIAA 2PE8A 2J0SD 1KC8T 1ZH5A 5H1SV 5CA5A 2RS8A 2E5IA 3LPYA 3UCZP 1D8ZA 1ZZFA 2LEBA 2SXLA 2QA4S 3VAMA 3CCVS 1P1TA 2M70A 2MKHA 4UY8T 3FEYB 3CTRA 1U1OA 2J0QD 2PEHA 3CXCR 3UE2A 1FNXH 2DGXA 3CCUS 1B7FA 1VQOS 1S79A 1YHQS 3MXHP 3S01A 4M5DB 4ERDA 4QU7A 2DNZA 2LA4A 1X4BA 3G8SA 1WG5A 1YJNS 2F9JA 2KXHA 2RQCA 2DNQA 1NU4A 1Q7YT 2EVZA 2MGZB 3VF0B 1X4EA 1M5PC 5CXTA 1N54B 4WF9Q 3MI7X 1BY9A 2CQPA 4ZKAA 2MQOA 2MYFA 2OSRA 4TU9A 3IRWP 1OO0B 2DH7A 1VC5A 1Q81T 2M9KA 2MZSA 3R1LA 2K3KA 2FC8A 2HVZA 2CQGA 3HHNB 1KOOA 3S6EA 1WF1A 2G0CA 2Q79A 5GAHU 4F02A 3CC7S 3B4DA 2DB1A 4PKDB 3I56S 5GMKa 1HD1A 1RKJA 2LECA 4IOCQ 4CQ1A 1WHWA 3CC4S 2YH0A 1YI2S 1L3KA 1YWXA 2DNLA 2CQ3A 2MHNA 5HO4A 2MZ1A 3NS5A 3THTA 2E44A 1H6KX 2DGWA 3MD3A 2MQQA 5HL7Q 2DNKA 5DDPC 5DM6Q 2AYGA 2RRBA 2KG1A 1YITS 2KHCA 2MZRA 5JVGQ 2DH9A 3CUNA 2KM8C 1R8HA 5BJRA 3CULA 4YOEA 2RUGA 3VAGA 1WHXA 1X4DA 2CQBA 5GAEU 3NS6A 5LJ5Y 1FJEB 1JJ4A 5DDRC 3RW6A 1QM9A 3K0JA 4WFBQ 2FHOB 4ED5A 1P27B 1N88A 1Q82T 2YTCA 5D78A 2GHPA 1YIJS 3VAJA 3D2WA 2ADCA 5EN1A 1UP1A 1VQLS 4W90B 2CQ4A 2DIUA 1U1QA 1VQ6S 2M2BA 3G71S 1U2FA 2DNOA 1N8RT 2VODA 1FJCA 3TYTA 2HYIB 2DNGA 2MKJA 2JX2A 5GADU 1M5KC 1HD0A 4UQTA 4CH1A 2CPYA 1M5VC 2CPIA 2B0GA 1JMTA
chains in the Genus database with same CATH superfamily
3OFEA 4NLDA 2APOA 2ZHBA 4CO1A 3EGVA 3DLKB 2M0GB 3JQMA 1GQEA 4DR1F 2ZH6A 3ISNC 5A8RB 4DCJB 3PO4A 5KFHA 3TUZC 5CYMB 2W4DA 3PFOA 3HHLC 5J2NA 1T8EA 1URNA 2WB1D 1UWBA 2GZOA 3WDOA 4KQZA 3V6HA 1BXNA 1S4FA 1ZTTA 1RHQB 3LALA 1HBUA 2DNYA 3CDBA 4IOBA 2CJQA 4TXSA 2HHXA 4Y2IA 1ULRA 1LWFA 4X4TA 2MQPA 4DJBA 1F2GA 1P8GA 3FMBA 1NBEB 1VQ8S 1IBKF 4WP8A 3EXCX 5MAOA 1J27A 4HL9A 3OTOJ 1VGYA 1S6QA 1N4LA 4YHHF 4DDFA 5E3CA 3BGOP 1AUSL 2PD1A 1WC6A 1WACA 2AW0A 1CC7A 4DUYJ 4ZVRB 1WKKA 3P3DA 4YMEA 3BSCA 5DGBA 2ZH9A 5KFPA 5B0DA 3HD1A 2CUYA 1PC5A 2MJNA 3TRGA 2HGMA 3HSDA 2BKNA 2RDIA 3V6DA 1VC6A 3ADAC 2VG6A 5KT7A 1K8AT 5EWFA 3BO4A 2V63A 4OHZA 4I2QB 4C9DA 2CG4A 1GX5A 2EKNA 3H25A 4LF9F 2FLLA 3BGUA 1PSDA 4BCAA 4L72B 1QLNA 3SDEA 3T5JA 4N8NA 4J9MA 2YKMA 4FF4A 3CJ0A 2CQ1A 1B0VA 4M1KA 2ZOFA 5KFWA 2Y1LB 4DR3F 4FP9A 4ICLB 1ZM3A 3OR1A 1NJIT 1OWXA 1X4AA 1X9WA 4G1QA 2VONA 3ZZ0A 2GV1A 2QZ8A 1CJTB 3D0IE 2CQCA 2FVSA 2M7SA 2VZ9A 2K3IA 2EBEA 5C2GA 5HQLA 4Q2MA 3GJRB 5B09A 4CTAB 3T1YJ 4UUWA 1O8BA 1KLMB 4DV2F 1PG5B 5EUHA 4TY8A 2BQUA 2CQIA 3FMWA 5IQ6A 4OMFG 1CS4B 2RSQA 2HIYA 3BKFA 4M95A 5E3AA 5MLCV 2DHGA 3HVTA 2F1FA 3F41A 1HBNB 2BKPA 4N47A 2C2NA 3GV5B 4PWUA 4AUKA 5HATA 4DN0A 2FUG9 1VRUA 3KYLA 2R2UA 4HHJA 2WHOA 4UF4A 3PJXA 1NEEA 2E5LF 2OTJS 1PKUA 2MPUA 3DXBA 2LDYA 3TVZA 1ZM2A 1G6BA 1Y3JA 3BKUA 2CWKA 5HLFB 5D4NA 2R7RA 2FHMA 3L7PA 4IH5A 3RYLA 2J0QD 3CVKA 1HLWA 4KYZA 2LLZA 3AQPA 2VF3A 4P10A 2FY8A 4A8QA 2GHVC 4ECRA 4F2RA 3BGLA 5A8KB 1NHVA 2PMZD 1DLOB 1PIEA 2RHQB 4DR4J 4ZVOB 5GAGI 4ZVTB 3ILJA 4A8OA 2BA9A 2E1MC 2JH3A 4IOCQ 4OI4A 4DV1J 1WHWA 5HMWA 2F4VF 1LWXA 5EGYA 2DNKA 3RU0A 1Y5NB 2HAFA 3A12A 2RRBA 2XSJA 2JEFA 4DL7A 2KHCA 2PMHA 4CRJA 4DR2J 1U47A 1YJ7A 5LT5A 4C3MA 1X0PA 3NS6A 5LJ5Y 2R7VA 2VQFF 1EX8A 3RW6A 4DG1A 3IC1A 2HLTA 2XG8A 4PG5A 1KN6A 4UOGA 2OPRB 4F4KA 2ZH8A 2L9NA 2M2BA 2E29A 2CJ9A 3Q8SB 2FB0A 3QSIA 5GADU 3FJ2A 1M5VC 5KG2A 1UVIA 2BV3A 4WPAA 2AIRB 1HNZJ 5D3GB 2GMHA 1RT6B 2HNZB 4CLTA 1HQUB 1UKUA 2HK2A 4A4JA 4ZVHA 2N7YA 3KDOA 4KGKA 2N3OA 2O01C 4ZITA 1IWGA 2VOPA 3TJAA 2PIIA 1WTBA 3MECB 2HPUA 4MFBA 1JJCB 4FYDA 3GV7B 4EO8A 4URQU 2J6UA 1MMNA 4FN5A 1HKAA 2BX6A 2XGQA 4LF5F 5LM7E 1Y5LB 4DLEA 5IM0B 2EI5A 1X0FA 3M2RB 3QRRA 3J80U 2Y3YA 3BB5A 2U2FA 1R6VA 5D0EA 1ROFA 3MF5A 3SSQA 3SEOA 4KJIA 2GO8A 3NAIA 2WSCC 4DX8H 4RWWA 4LFAJ 2ABYA 4DR7J 2J7WA 2IM0A 1U2RA 4FBUA 3UCUP 5J2PA 2KI2A 4GO7X 3J7ZT 2B5JB 4IH6A 2DITA 3G6ES 5HJYA 2DGVA 5AE3A 1W25A 1Z2ZA 2F5GA 5DETA 1FT8A 4ZCIA 2R8HA 1NSKL 1FJ7A 4NYZA 3RBXA 3GV8B 2BJDA 4N7TA 1NK5A 4ANDA 3H5XA 1Y00A 1W2BR 4DS5A 2JZ5A 3W8PA 5GAEI 2BJEA 1WC0A 2EFQA 1JLBB 4XK8C 2DRBA 5KFUA 3A4TA 3LOUA 3E2EA 2IA0A 1T9WA 2XO7A 2XY6A 3LGNA 1JLQA 3JSMA 2KVQE 1X8DA 4J90A 2ZJRQ 2IYIA 5FLXU 4CLFA 1FRKA 2XY7A 3P49B 1NB2A 4LT6A 3TAMB 4ZVGA 4JI2F 1U8WA 3TEGA 2FHJD 3FBCA 2AEMA 2R7UA 2ZH4A 1I94F 1FWKA 4DSLA 1WF2A 4RNOA 1PBAA 3VQSA 3MPDA 3TEHB 1M1KT 3R27A 3UPFA 1S0VA 3HSJA 3W5XA 4ZP7A 3P96A 2J7UA 2D41A 3UD3P 4GC6A 2MQLA 4K5SA 1RTJA 1UVLA 1TU0B 4I67A 4FXWA 1BWEA 1SKSA 2EC0A 2Q1LA 4OHYA 5GMDA 1VQ7S 3HT3A 2ZNZA 3OQ2A 2GIQA 4JI5F 3LQVA 2VD3A 2DR8A 1C0UB 2FDNA 3IBFB 4WZQA 7FDRA 3QFWA 1F5CA 1C0TA 3MCSA 2ZE2A 2VBYA 2AX1A 2AHOB 3BGRA 3B78A 1FNXH 2B3TB 2OPQB 2H65B 3MXHP 3W7BA 1T94A 2ZKTA 1AROP 2LA4A 1WG5A 4KKOA 3MM6B 1RWOB 2CNOB 3DRXA 2EVZA 4NLGA 2VA2A 1RLDA 3NMAA 1M5PC 5CXTA 3NWGA 3CJ3A 3MCNA 4M5KA 1BY9A 4DX6A 3DOKB 2OSRA 2IRUA 3HVRA 1WSVA 5AXLA 2VPWB 2YKNA 4EU0A 1UZDA 3I0RB 4NMLA 3PR5B 3AJ1A 2LFVA 2CVEA 3AJ2A 4DV5J 5HJXA 5HO4A 2ZWOA 3OXFA 4B17A 2R2RA 2ZBRA 2AYGA 3C66A 2IVYA 2P2CB 4C8MA 3W61A 4DR1J 3M1VA 3HM9A 4WP3A 2FZKB 1X4DA 3DU6A 1LV5A 5KFCA 1SBRA 4HT5A 4PG4A 2HZAA 3JAMY 2FHOB 1RU2A 3DI6B 2R8JA 2D69A 2W2QP 3NS7B 3D2WA 5EN1A 4QYZK 4K5RA 4RLEA 1HQ2A 1OS5A 4HACA 5IT0A 4EZ6A 2MKJA 2VIHA 1M5KC 2ZD1A 1NDKA 4J9LA 3PY8A 2XTJP 3Q2TC 3KUHA 3VZHA 5LJ3Y 1N36F 1AB8A 5ETPA 1TL3A 5KG0A 3H2LA 1LWCA 3JYTB 4DF4A 5J2MA 2MKSA 4FBTA 3UW1A 3TJ8A 3G82B 2VKRA 3SZ2A 1IBKJ 3GLJA 3B6BA 3BS9A 4YHHJ 2VJUA 1W2IA 2M52A 4X2BA 3CD0A 2F9DA 1S9GB 4CT8A 6AT1B 2V2QA 3DRRA 2ZC3A 3DLKA 2KYZA 2E9ZA 3JS9A 1S0OA 2ZH7A 5GADI 3T9ZA 4ECUA 3NY0A 2RMLA 1Z2LA 3GFZA 1MNEA 5F8LA 3N4WA 2OHDA 3P4UB 3EE3A 1SJ1A 2FLOA 3P6YC 2R7SA 1JNRB 4OZ0A 5HAOA 4ETXA 2ZVSA 2QL7B 4E98A 4PPZA 2GX8A 1KSPA 1WF0A 3ONQA 1DHMA 3CMQA 1DTQA 4DCPB 1FRXA 1JJHA 4BC9A 2OEJA 1NK9A 1T11A 5BR8F 4IH7A 2ASDA 2I2YA 4RBUA 3LW5C 4DPXA 4P72A 4MT1A 2GC8A 2Z2ZA 1MSWD 5A6WA 4HEA9 4PRFA 1UJ5A 1FKAF 3ZZRA 4IQMA 3VWSA 2H5IB 2XMMA 2K7JA 1QSSA 1SC1B 4ZHRB 1IXKA 1S9EA 1N0UA 2ZH5A 1YTYA 1HI8A 5DG8A 2RDJA 1C1CB 4J9UE 1T9YA 3CCSS 2ASJA 3A8KA 1JLFB 3FUYA 1TVRB 4DU8A 4LFCF 2WSEC 2YVSA 4DV0J 2W25A 4DL3A 2RJZA 2E5LJ 1RTIB 5SZTA 3C15A 3M6WA 3W65A 4ILMA 4ES2A 3VV2B 2ZUGA 2G13A 4XIUA 4FDFA 3CCWA 2NPFA 2DR5A 2VQEF 4LJMA 2LDIA 4Q45A 2GQCA 3Q2SC 1RYRA 4UZBA 2HS4A 1L3TA 3KLEB 4LFBF 1JLEB 3GFYA 4IFVA 1NJXA 1CJTA 1HWIA 1X4HA 1AZSB 4JI8F 1FTRA 2C3OA 1MU2B 2AGPA 3TA0A 4LF8F 4K7QA 5C25A 2GGPA 3IXQA 1FEHA 3GQCA 2M8DB 2KFZA 1NJZA 1ACMB 3D4JA 3K5OA 4DV6F 4LRFA 2DISA 2MKCA 1DURA 2J0SD 5AXMA 3LGMA 3D3BJ 3UCZP 1RABB 2XHCA 3VAMA 2VPXB 4IFYA 1JIHA 3EDRB 1N5YA 1P9YA 4PXBA 2ZHOA 4DQPA 2CVIA 2JLGA 1BMQB 1KHVA 1Q8BA 5K8NA 2VQFJ 4LF6F 1LK7A 2XMTA 3SIPB 1H74A 4B3SF 4CLYA 2MEWA 5HLFA 2HVDA 2LVWA 3R1LA 2MZSA 1RKIA 5KG3A 1T95A 4F36A 3HO1A 1KOOA 2Q79A 2G0CA 4NLSA 3MM9B 5GMKa 4C8KA 1OSCA 3AD7C 3H59A 2Z2LA 1B0TA 2MHNA 3K59A 1NCLA 4PABA 3VGSA 4UTGA 4NLXA 3OBIA 3VGUA 1DLOA 4KE5A 5BYQA 3UDVA 4TLRA 4ZJOA 1EKSA 3NCRA 4IO1A 2ZOMA 4Z37A 4ELVA 4CLLA 1K47A 1QD1A 4WP9A 4WU3A 3MR2A 1Q4RA 3D6FB 5HVHA 1X9SA 4LF5J 1R0BG 3OXLA 5EWGA 1RLCL 2JEJA 3OL7A 2DNGA 2QJ3A 2Z56B 2CPIA 1JMTA 3ULHA 2D7SA 2XS7A 2RKIB 3UWTA 3M7VA 3EZOA 1RHMB 5A2QU 1PO6A 2OPRA 2ZH1A 1RXOB 3ZTOA 4NYPA 4FVMA 5IV4A 1XEZA 2VUGA 4C4WA 4C8YA 1DBDA 3FEXB 3ISZA 1T9XA 2EFOA 1DZ5A 1EETB 2G2YA 3R7BB 5D0RA 1TMMA 2CPHA 3JSRA 5D3GA 1S7IA 1RT6A 1X5SA 1HQUA 4YUDA 1SIWB 5KFQA 1ZPVA 3MM8A 5A6PA 3PEJA 4FVCA 5H9FK 4NEYA 2W7AA 2YQ3A 1UTAA 3NGTA 2X1FA 1EP4B 2BVZA 1PAUB 2HWTA 2H48B 3Q22A 1KWMA 2JJ4D 2V4JB 2MMYA 2AF6A 3HDSA 2BQ3A 3O1LA 5KFYA 2X1BA 4WIIA 2OPSB 4FS1A 5IM0A 1UEKA 3MMAB 3M2RA 4USKA 3RGIA 3MHYA 1HQEA 3PHEA 2PSZA 2I8EA 5IFMA 4LVNP 4RNNA 4B02A 4F26A 3CWJA 1E6YB 3M9MB 3LWMA 1IR1A 2VFRA 3BM7A 1FEEA 3QT7A 2CJXB 5HMYA 2HS3A 1M90T 4N77A 2IBOA 1CJUB 5DQHA 2XCPA 1FESA 2OPPA 2BM1A 1M0SA 1SJ4P 2CQHA 4HI1A 4ELUA 2KYXA 3Q83A 1CC8A 2F8HA 4JI2J 1RBLA 1U6FA 1M5HA 5HVGA 3T9NA 1SCJB 2IA6A 5JMNA 3L9ZA 3FGVA 1HNVB 5B0BA 1I94J 2LQJA 2IBKA 5KFVA 1TR0A 1HNWF 2QT7A 2KXFA 3GIKA 2W7PA 4B3MJ 1CJVB 4RW4B 1LWEB 3BV8A 3BBBA 3ILIA 4WYWA 2BJ9A 3VAIA 2PA3A 1W26A 5LXRA 4LUBA 4KGZB 2JL9A 1NZAA 3KK1B 2ZM6F 5LMUJ 2YX1A 5ETRA 5IT9Y 2BRKA 3EICA 2G1DA 1NDPA 4IR9A 3HZGA 4C8LA 2I5JB 3L7OA 4R8UB 2YH1A 4I6WA 1VISA 4O3RA 4PQUB 1JLBA 3HHLA 1NLKL 3OVBA 2IPOB 3BO2A 1RJJA 1TP7A 2KM8B 3MEGB 1B4SA 3M8PB 1VQMS 4DQQA 5F8HA 1UFLA 3PRBA 1VQYA 2OO4A 2BOPA 5HBMA 2ZBIA 2COLA 2OD4A 4OYIA 3CD5A 4OQJA 4OHVA 5D4OA 4F7VA 4NCAA 3ZTQA 3W63A 2UUAJ 3BBCA 3P45B 1Q16B 3ZZPA 1NSPA 5HP1A 4WXOA 2YNGB 2HGNA 1UAWA 4AYBD 3DOLA 2Z0GA 4A46A 2RAQA 1ZETA 1YBTA 3J7YU 1SH0A 5F0WA 2X7IA 1VC0A 4ECQA 2E5HA 4DUZF 4L75A 2IDEA 2PE8A 3G2XA 2B6AB 1ZH5A 4ZPDA 2FVQA 1N5SA 1RA7A 1SKWA 1Q1KA 5CYQB 3WHIA 1S79A 1RBAA 4NCBA 1SI9A 1YHQS 2QA4G 1OSDA 1QUVA 1NU4A 1A0OB 3HLUA 3OT9A 5H9EJ 1GMUA 5DZ6A 2KO1A 2H3EB 3C19A 2JFDA 1CQNA 2UVVA 1R8CA 2CADA 2CQPA 2LU2A 2MQOA 1N56A 1LW2B 3W1YC 3U7JA 5F8MA 3G8QA 3B4DA 3MEEA 2OPQA 2MHEA 3D6HB 3BDEA 3SCKE 4KHMA 4I7FB 5KT2A 5IT4A 3WZ0A 1TL1B 2QSWA 5I42B 3MM6A 3Q89A 3TOQA 4DWIA 4OYWA 3MPWA 1N36J 4IR1A 5DDPC 3V6KA 4ED7A 1RAJA 1UWAA 4ZLJA 2DHHA 4RBTA 3OJSA 4O4RA 3DOKA 4WIQA 1CSJA 3CUNA 1YBAA 5ETQA 1TKTB 4WFBQ 4KC5A 1BUXA 1YJTA 3GFHA 1P27B 2ZEJA 3C8YA 2GHPA 5KT6A 3IRXB 3VTIA 5RUBA 1S7HA 4OZLA 3NBPB 3OD2A 1FJGF 2WCXA 5J2QA 2DNOA 2CNLB 2PT0A 4X4OA 4OYMA 1FJCA 1NH7A 1XMBA 4YB5A 2CPYA 1RI7A 2AJFE 3BGFA 3JSYA 3FDSA 2JDJA 3MCMA 1FK9B 4P2MA 2JSXA 4KR0B 3HFKA 1TAUA 2MQMA 3T41A 1K44A 1NDCA 1Z4UA 3DI6A 4OZ5A 3M2UB 2VL1A 3BN4A 1UVMA 2LQ9A 1KDNA 1VK8A 3LO3A 3I55S 4QIGA 2W4PA 4UOCA 2M8HA 4Q8EA 1F3VA 1WOPA 3DCAA 2YWKA 3LP2B 2MY7A 4NWBA 1UA1A 2CZ4A 3M32B 1KQSR 4X65F 3D1OA 1KVKA 1OY6A 2VC0A 1L3UA 1T9TA 3JYTA 3PIPQ 5BR8J 4QWBA 1WNEA 2MZTA 3R97A 2YXLA 4R0JA 3VCDA 4YFUA 2EBGA 1HMVA 2WVEA 4FYXB 4XDCA 2ASYA 1S9GA 1B3TA 1OQ3A 3U1NA 2JFKA 4YB6A 1R3NA 2MY8A 2O1PA 1IM6A 4J9PA 3ZO7A 3CJQA 4C3LA 3AD9C 2RT3A 1FX4A 1AA1B 1VS3A 3O6QA 1U0HB 2WVCA 1S1UB 1YRUA 1HNIB 2LQ8A 1N6QB 4P9SA 1B99A 1YZ6A 1NMEB 4X64J 2YKAA 2P9CA 4DCOB 5DLFA 4CLSA 4DL5A 2ACMA 4WKRA 2AJ2A 1JLAB 2YNFA 3KLGA 4HVZA 1KRPA 1NKEA 2KB2A 2DNPA 4YDXA 3U1MA 4ENOA 5KFMA 3KJFB 2VQEJ 1XNRF 4C48A 2DIVA 1U0SA 1VQSA 3CIZA 2CDQA 3H7HB 4L3NA 3R6GB 3SQGB 3SMZA 4JI8J 2OKQA 2Q3PA 1HWLA 1M1GA 3IAS9 4ID5B 1IR0A 4XPEA 3ITHB 1VIXA 2AZ3A 3G8TA 3D1QA 3PVXA 4WBFA 2YPZA 3NNAA 3KLHB 1D0EA 1NSQA 2W2OP 3FSIA 2BE7D 4X4QA 2WBMA 2KN4A 2AJ4A 4JB8B 3RTVA 2N3LA 2LEAA 1UPPA 2A1BA 4KH1B 1JLFA 3KK2A 1HA1A 1WC5A 2OEMA 1D09B 3OTDA 2CYYA 5G4DA 4Z7YA 4ZJQA 3C14B 2CIMA 1RTIA 3QLHB 2ZBQA 1PBUA 4LF6J 2GAHC 4NLUA 2A0FB 3KXDA 4B3SJ 1GTEA 1SVDA 3QWUA 3EDQB 4GRSA 1MROB 2RNEA 3A3OB 9ATCB 4UOFA 1J5OB 3EX7B 1N33J 2HKEA 4DUTA 2QLXA 5CD4H 1AZSA 2QA4S 4HTIA 2MLYA 5JJBA 2HFUA 2DXDA 3QIDA 1MU2A 5DRKA 3CCUS 1RWUA 5L9XA 1AW0A 1Q5YA 3ILLA 5D4LA 2HHSA 5HROA 3EGWB 4ELTA 2GJIA 2RQCA 4L73A 3N5FA 5KT5A 2MGZB 4I4BA 4NLOA 5ETNA 4Y2KA 2XHWA 2DH7A 1Q81T 2UXCF 1GK8A 1ZOTA 1IJEB 4W4MA 3GYNA 3TUPA 4WTOB 4CQ1A 5L1LA 4KV8B 2F8MA 1GMVA 3BREA 3LGHA 3RAMA 1YJVA 4C6AA 4R0EA 2ALYB 4LR9A 4OZNA 4BDPA 2MLXA 1JWWA 2NZCA 3AFGA 2YQ0A 4TNOA 3MAHA 3M8QB 3CJ4A 1JB0C 2BE2B 2DBBA 5D4PA 4DFKA 5B08A 4I2PB 1HBOA 2QX0A 3VAJA 1UVNA 1VQLS 3G71S 2AKWB 1RISA 1WJ9A 3X1LB 2NYIA 4LQ9A 8AT1B 1HWKA 2ZNYA 2KRBA 4RW7B 1D9DA 4WCEQ 1U25A 2J7KA 4M5GA 3ZFVA 3KG1A 2CQ0A 3MPUB 2A3JA 2QA2A 1YX2A 1S12A 3QIPB 3OTOF 2JWNA 3RAXA 2EK6A 1SC4B 1U1PA 5I4MA 2WW4A 2LMIA 4OI3A 4WE1B 2ERRA 4DUYF 5FLXY 2XBPA 2ZDPA 4U8YA 1HHSA 3PZPA 4ZLPA 1WWHA 2QMUB 1DRZA 5G0RA 1OQ6A 4KB7A 4DR5F 2QL5B 2DGQA 4N56A 4DSIA 1IM4A 2XMVA 4X4PA 2BANB 3CJSA 5K14B 1EETA 2G2OA 3EVMA 2I38A 2V8VA 2P9GA 1GMWA 3GYXB 2J76E 3QAEA 1SIZA 2VG7B 3QJPA 4HYKA 1N32F 1EP4A 3AD8C 3DDNA 1OY9A 3G4SS 2YQ1A 3CJ5A 5EX3A 4PG8A 3CPWR 4WFNQ 2I9SA 3PCOB 2J5AA 2D9PA 4CH7A 2OELA 2AX0A 4Y2CA 1R7IA 1KVJA 1R27B 4MKVA 1NM2A 2C42A 4KH0B 3ET6B 2EKYA 2UV8G 2QLBB 4OJHA 4YR2A 3CCQS 1U26A 5EDWA 2RF2B 1CJUA 3V4IB 1X4CA 4KFBA 1RCXB 4B9UA 2YNIA 2NR0A 2WVFA 2DR6A 3DM2B 3CC2S 1LK5A 3EWGA 1HNVA 3HX9A 4ZDNA 3BH6B 4NRUA 1RT1B 1TAQA 3FRZA 1G1XA 2J6SA 2YKQA 1P1LA 3HKZD 3PEHA 4ZMMA 3LUYA 2K1RB 2VG5A 4PXEA 1FXLA 4NLQA 2AJ0A 1ZAXA 4M5DA 4KPCA 4HLBA 4XAKA 1RT4B 3KK1A 2HVHA 3LTOA 3DRSA 4PYDA 2I5JA 3DRPA 3I5AA 3CD7A 4R8UA 1NK0A 3OTCA 3DMJA 2QMWA 3MPVA 3IWNC 3KHRA 1IKWB 4JI3J 3PW4A 3EJMA 1DAXA 2IM2A 3L7UA 3H42A 4EBDA 2C3YA 1QAJA 4OYOA 1KQFB 4IRKA 4KIAA 4LVOP 3Q23A 4XTTA 2KJWA 4DV1F 1CVJA 1D9AA 1I51B 2L3MA 2RHSB 3H5SA 2DYAA 4R25A 2E5IA 1TFWA 1D8ZA 3D9BA 1DQ9A 2QV6A 3AOAA 3NGDA 3FEYB 3PNIA 3BYPA 1FA0A 1BD6A 1RT2A 4NXNF 1Y5IB 4JV5F 2YNGA 3T19A 2XMWA 2AT1B 1X4BA 3S1TA 2UUWA 2CWXA 2DNQA 4LF4F 1RGVA 3EM1A 4N76A 5L1KA 1IUJA 2HW3A 4QWEA 3NL0A 2IY5B 3LWLA 1REVB 3IRWP 3J7Z5 1FJGJ 5E3RA 5CYQA 4WFYA 1CBKA 1JNZB 1RKJA 4C97A 1S1WB 4NA3A 4O3OA 3W3SA 1S4EA 2E44A 2ZZTA 4DPUA 4GVBB 4OV6A 3LPEA 3QMQA 2E7WA 1N5TA 5JUMA 1LW2A 3UR3C 5K9FA 5BJRA 2CFXA 3CULA 4I0WA 3IM8A 3D3CJ 3IS9B 3TUIC 2YNHB 5T14A 5HQMA 2V6AA 3NG8A 4QIVA 4ED4A 4NMXA 2MLZA 1TL1A 4LSNA 5I42A 2HFOA 5I3PA 1S6PB 4A8SA 5D78A 3MMCA 3RR8A 5CZVA 2AGQA 3VHQA 3FFIB 1S10A 2WRMA 2HAIA 1F1BB 1R8BA 2B0GA 1E6VB 3W5ZA 3K5PA 1NXIA 1EZZB 1SXLA 1TKTA 4IO9Q 2DXFA 5B0EA 5GVQA 1QY7A 1PJ7A 5J1PA 4PG6A 4C0BA 1EIYB 3IRXA 3DLGA 3GSDA 4MKYA 3NBPA 1VBZA 2QE5A 1KHWA 3VAKA 3UD5A 2FGCA 2JC1A 3TJ9A 1MG7A 2BEFA 4ZPVR 2XZTB 2UUBJ 1TK0A 3TUJC 1FK9A 2R8GA 1YZ7A 1YSJA 3HHKA 5I3UA 1S0MA 2WSFC 2WOMA 3HCXA 2H9ZA 4NL5A 3CGIA 3IGVA 1IKYB 3NRBA 2V0NA 1S6UA 3M2UA 2HGLA 4L74A 5T7LB 4JV0A 3LAMA 2DGUA 4FYVB 3DGPB 2LXIA 3M32A 4X4RA 3QNWB 1SQEA 3UQSA 3BEGB 2HBQB 2GVDB 1XNRJ 5DZ7A 3C3LA 5F41A 1JX4A 3VALA 3W64A 2FJAB 1REGX 1KBRA 5AE2A 1IQZA 1SV5A 1SH2A 5IQQA 4OJ3A 2Y1IA 2B7BB 2NZ4A 1L3VA 3W9JA 2V8DA 4URSA 3QT6A 4V19X 5F8JA 2DGTA 5GAGU 2VFUA 2R3VA 3D6MB 1BGXT 3OW2R 2Y8WA 4QIEA 2R42A 2V68A 3Q8VA 2WTFA 1NSAA 2IJNA 3D67A 5F8IA 2NXJA 2XZWA 1G4CA 3IA0A 4RUBA 2MB0B 1WEZA 3NCQA 3C6UB 3A1YG 3TA1A 4IDKB 1S1UA 1FDAA 1HNIA 1FVQA 4MJKA 4CYUB 2E1AA 1BQNA 1LW0A 3KG0A 3IP0A 4LRDA 2QG9B 4EGLA 1VI7A 2HHPA 2WBRA 4W92B 1KVIA 4O44B 4C7QA 1S6OA 3ZC4A 3OTEA 3US5A 2GQQA 4F3QA 4A8YA 2V50A 2CG8A 4F3OA 1SQGA 4FNIA 4PWDB 2D3ZA 2D3O1 2GIRA 1ZM4A 1U02A 1XIQA 1RT3A 2F8EX 2XM3A 1YK9A 1R0AB 1TKZB 3F56A 3MMJA 4PYAA 3ZNJ1 1GXTA 3SQGA 1YJUA 4J5OA 4BLGA 3MMBB 5CCMA 3R5CA 3KLVA 1QJHA 2B56A 1XR5A 2H4WB 4YQWA 4ED8A 3KK3A 4HKQA 3CO0P 1TKXA 2ZJQQ 2FJDB 2V2KA 2YPYA 5LSLA 1ZAWA 5KG7A 2Z58B 2UXDF 3KJVA 3K7RA 4ZIWA 2ZDOA 2N4DA 4JI1J 5D77A 2GFFA 3W9HA 3IWXA 4ECVA 1RTDA 3OFFA 3R8YA 2O67A 1FKPB 3KJQB 4ZPCA 2FY1A 3N9UC 2B7CB 2HNYB 3UN2A 4OYAA 1RHRB 5CA5A 3C6TB 1KFDA 2GA7A 1GXUA 3AOBA 5A2QY 3TX8A 3C14A 3QLHA 3D68A 3CTRA 2FZGB 4QW8A 3QO9B 1NPPA 3BH7B 3GE9A 4ERDA 4ZIVA 5B0CA 2UV8A 1MROA 2F9JA 1S1XA 3F44A 2JEGA 4BWJA 4PUOA 3TAQA 2VDHA 1J5OA 2V4RA 4O3NA 4ECYA 1XJWB 4L6V3 3W60A 4NLYA 5BXIA 2OFGX 3BPDA 1OO0B 4K50A 2K3KA 2N4CA 4PZVA 1NNDA 1NK8A 3A8EA 3CJ8A 2FJXA 3CC4S 2EG1A 4RNMA 1DARA 4YDDB 4DS4A 4PG7A 1XQIA 5ETLA 3MAQA 4DL4A 4F50A 5F3ZA 4FS2A 1R8HA 4ZVUB 4BBYA 4QJVA 5GAEU 4CO2A 3I9ZA 1BHNA 1Q82T 3V81A 1RZMA 2JLEA 4OI1A 1UP1A 4RPFA 1ZYQA 2EPIA 3GMGA 3F73A 3J7A1 3PYGA 1AFIA 2OMLA 4CH1A 2DY1A 3I9V9 4DR5J 1V5VA 1KD1T 3TP2A 2WZ1A 3M8QA 5DJBA 1HYSA 2BE2A 2QA1A 4RR5A 2CPXA 2EG2A 4H4MB 1XR7A 4Q43A 1JXVA 9RUBA 2X3GA 2DNNA 5C5JA 1S72S 2FJWA 3LH2S 4Q7AA 3LANA 2VOOA 3DGVA 4FKXA 3FZBA 4NLRA 1ZS6A 2GCFA 5KFNA 2VDIA 1UW4A 3MD1A 4P75A 3EVWA 1N32J 2Y8YA 4ALZA 1HI0P 3L4BC 1TL7A 2CAJA 4MIBA 4D3HA 2VFSA 4ZP9A 4WWSA 2QEXS 1YJRA 4K59A 4F3MA 1IKVA 2MKKA 4C8NA 2H1YA 3QIPA 1T03A 3OUYB 1YDLA 3PX6A 1TL4A 3EZ5A 3ZZYA 4MMOA 3TR5A 3BN7A 4TYAA 1LQ9A 4IG3A 4I6AA 2DNRA 3N0VA 3ENWA 1UFWA 1RACB 2R9LA 1T3NA 4KRWA 4M5MA 4P2SA 2C2OB 2MKIA 2FJEB 4LREA 2DT9A 4YR0A 2I6WA 1FF2A 2OH2A 2IVMA 3V6JA 4RW9A 2CNNB 2HHTA 2BANA 4DV0F 1I1GA 2ZITA 3HJFA 2UVWA 1QUPA 3K8WA 1UWBB 8ATCB 4MK8A 4DPTA 4LF7J 3OPKA 4ZS6A 1Q95G 5F0UA 1FX2A 1NO8A 2G2ZA 2C28A 4PQAA 3TA2A 2C1EB 2XI2A 1LWFB 2ZOGA 1C4CA 1VRTB 3GWCA 4F4XA 2FPHX 3S7RA 1S6QB 3VVTA 2RQMA 4OI6A 4DN9A 3G6XA 2D9OA 2FHKA 2OMOA 5KG6A 5E2QA 3HP6A 3RW7A 2N82B 3KLIB 1FD2A 4DQRA 3HPOA 4KHPF 2HWHA 2F63A 4DSFA 5HMXA 2ZH3A 4ZVSB 3PDNA 2XYPB 3JTNA 1V5IB 3G9CA 1AT1B 5KOXA 4Y00A 3PIOQ 3V6DB 1UETA 2DEIA 4CI0B 3R2CJ 3UDEA 4NXNJ 4JV5J 2K1RA 4UY85 4F4AA 2LU1A 2BJ3A 1U2CA 4ZN1A 3CJTA 4AQYF 1AXQA 4LF4J 2HFVA 4J9QA 1R0CB 4NXMJ 2BJ8A 1RT4A 3BPSP 3FQLA 2IHR1 3UD4P 5KFFA 3NKYA 1UEVA 4DZDA 3FBEA 3IFEA 2Y9HA 2MSTA 4MK9A 3EPGA 3PO5A 1RAEB 1C1BB 1FDDA 3IR5B 1KC8T 4P7TA 3OR1B 2FLNA 4LQ3A 4C8OA 2BUNA 1IJFB 2NYHA 2M70A 1T3OA 1GAOA 4OJGA 1FDNA 3HJVA 1B7FA 3S01A 4A47A 2DKOB 2A2CA 4KPYA 4CLWA 3G8SA 2BYCA 4DOZA 1WOSA 2IRYA 1D3WA 2V8HA 1RWPB 4QR0A 3GPAA 2R8KA 1LXJA 5THWA 3CDWA 4TY8B 3WC2A 4RW8B 1QAYA 2D74B 1YKWA 3HHNB 5GAHU 2W9CA 3PJWA 4DL6A 3M30A 3RRKA 1XMOF 4DEZA 3W2WA 3LP0A 2B9WA 3AXMA 3ZZTA 3THTA 2MQQA 5HL7Q 2HNDA 4CO0A 1FRLA 3R5JB 2QFIA 5JVGQ 3RB4A 4WFZA 3HZEA 2NXEA 2FVPA 3TZYA 3DC2A 3PTWA 1Y0HA 3NP5A 1D8YA 4C98A 1V3ZA 2CQ4A 2DIUA 1RDRA 1NB7A 1U2FA 4GVBA 3T5HA 3H4BA 2NS1B 4ZP6A 3Q86A 3IO1A 2GVZB 4AT1B 1T9UA 1WSRA 1FD8A 4USWA 1X7VA 2J0XA 4Y3CA 1MMLA 5E3QA 3QZ7A 3DLEA 1S6PA 1H2TZ 1KQKA 5IZHA 1KOHA 1VOMA 3TQEA 1H7XA 3FFIA 1IBMJ 1S1VA 2CJKA 3KWMA 2XSJB 4LSLB 2F65A 5EX0A 5JVHQ 3MFHA 1E6VA 1Q78A 3GB0A 2AZ1A 3JB9k 2CDRB 2RDDA 3UDLA 5KTQA 3NGRA 3QGGA 8RUCA 2QC3A 2RILA 4WXWA 5FD1A 3M9NB 4A8FA 2XB2D 1NJYA 4QWAA 2XYHB 2KXNB 4B3MF 2Q6CA 4LRBA 3R9LA 1F5BA 3CCJS 1XMQF 1HW9A 2Z2MA 1Y9OA 4NI2B 4ZVPB 5LMUF 3CJKA 3OHBA 1DFDA 1DY3A 4YR3A 4ZOSA 2H51B 3PR4A 2RB7A 2NPIA 2HWIA 3GIRA 1Y4ZB 3KHGA 4QYRA 3MEDA 2XLIA 4JI4J 1Q8KA 2IIHA 3I31A 2E7VA 3FBFA 3QBCA 3R7NB 2ZVIA 1GMWD 5KFZA 3N6LA 2K06A 2XULA 1UW9A 3NAHA 3M2VB 3U02A 3OLBA 4CLKA 2YY3A 3N28A 2XS5A 1QDUB 4FF3A 2HRUA 4CLUA 4DV7F 1C2PA 3ETMA 1VLYA 1HHQA 3UN3A 3R6LB 3OHAA 4RJVA 5E3PA 3LA0A 4DV4J 2DVIA 2POKA 2HQGA 3HULA 4X66F 2UUAF 2UXDJ 4GVLA 2KT3A 4K4ZA 3DLLQ 1VCTA 2LYVA 3K17A 3HFZB 2BABA 3C6UA 4YB1P 4DFJA 5AJ3J 3Q8RB 4CYUA 1FWLA 2ZUAA 3PKMA 4TY9A 1EKRA 2DGSA 3GP9A 3H2UB 2X3DA 2B4OA 1H7WA 4A8MP 3RRGA 3Q0AA 3VAHA 3W2VA 1RTZA 1U1LA 4B3OB 4PR6A 3ZNUA 3R5GA 1VJWA 4USIA 2F4FA 3MR3A 1H0HB 1YJ9S 4PWDA 2C2RA 2QIFA 4U6PA 3FQKA 1OYDA 1WOOA 1U45A 2KTQA 3DHWC 3HHDA 3MUVP 1FI4A 5IOLA 4NX9A 4MIWA 4QOTA 4USHA 4OZ2A 2FVRA 1HW8A 1YRXA 4ETZA 3JSMB 1FVSA 2DPIA 3MDFA 2R7OA 5H1SV 2KHDA 3LPYA 3KOAA 4OIXA 2ZZNA 2KZZA 4X62F 3FEZA 4ECZA 1U24A 1VQOS 1ZA1B 2B8QA 3P8BB 3FRYA 1XR6A 4KHRA 2KXHA 5FDLA 1DTTA 2QYGA 4TYBA 3DOMB 1G3OA 1VJQA 3KNGA 3GIIA 3M6VA 1S76D 5L1IA 2HQFA 1FRJA 2HNYA 1PJ5A 3GFXA 2O66A 4N41A 3AHPA 2H4YB 1EARA 4EUVA 2BM0A 4F4YA 3S6EA 1WF1A 1RTJB 4RKUC 3Q8UA 3GG1A 2IC3B 4ZK7M 3TWZA 2QLWA 3UDCA 2EFPA 1WC3A 5A8RA 2PO4A 3M05A 4JYAJ 2HBZB 1TK5A 3H4DA 5CYMA 3AT1B 1Q8IA 4ID8A 5DM6Q 2YWEA 2VJVA 1IVZA 2KM8C 4NZ7A 4YOEA 1C0TB 1HHTP 4K4UA 3T6JA 4C3KA 3JXOA 2NSCA 2ZE2B 4G6VB 3OL8A 1FJEB 4GKJF 1U7LA 1ZAVA 2XMKA 4JP8A 4J9SA 4QCLA 1N5VA 1KONA 1TELA 1IBCB 5GAHI 5HMZA 2CA9A 3QWPA 1RP5A 2VODA 3TYTA 1M5SA 4LR7A 2FVCA 3M8YA 2KFYA 3CT9A 2HVIA 1FCAA 1F3FA 1Y7PA 1NKCA 2YKNB 4TU7A 3QYYA 3HI9A 4NZ6A 1EAYC 1SKRA 3J81j 2W24A 3QJJA 4U9RA 5KFLA 1R8PA 3CNQP 1WEXA 3PW7A 3H8YA 4ILRA 2HZVA 3M1VB 2KJVA 4C0HA 3VGVA 5L8RC 4LSZB 4H4MA 4O23A 4X64F 1JLCB 5SUHA 4IOAQ 1GXLA 5DDOC 2GS8A 2IVFB 2ROGA 4I2QA 4YEAA 3KNAA 4ED3A 2MTLA 7AT1B 3FBBA 3D7SB 4ZPWR 4BHQA 4OFZA 2CPEA 2VICA 4HACB 4MKBA 1XBWA 1FRHA 3O3LA 2ZD1B 1N48A 3TARA 4ICLA 5DS7A 3RZAA 2MQNA 3N79A 4MIAA 2CRLA 5J2MB 3OUYA 3LAKA 4IQXA 3CCES 1KEKA 4EBEA 4C2MA 2JVRA 3PRDA 5J1NA 4IUFA 3JQJA 4BWMA 2DNMA 2ATCB 1UA0A 2ZZMA 4EK2A 1T9VA 1PGZA 1NK7A 3A8IA 2HEKA 4CTAA 3DRRB 2KZMA 1YJWS 1KLMA 1UEUA 3VAFA 3DYAB 1K9MT 5KFIA 3OJUA 1NPRA 1VQ9S 2E5GA 4XO0A 3JSBA 4KHPJ 2EC2A 1CS4A 1LOUA 1SC6A 2F3JA 4OV1A 3CW2C 2V2VA 2L08A 4ZPBA 2CJBA 3MOJB 1HBNA 3RBDA 3MM7B 1U1RA 1HL6A 2KRRA 1QVGR 4O0IA 3CCRS 1OMSA 4DPOA 5CYJA 1TFYA 4AQYJ 1T05B 3QRQA 4NRTA 2KKHA 1S99A 3DHXA 2DHSA 5A8WB 5FIIA 1C4AA 2KVIA 4RZRA 3J7AN 2DCUB 1M5OC 1XWLA 4OJ1A 3KHHA 2OGUA 3CEDA 3H5YA 1DTQB 2A10A 1JKHB 4GKKF 1N33F 4ED6A 1VRTA 3W62A 1OPIA 4NA2A 2LP4A 1KLNA 1UZHA 5A8KA 4Z2XA 4QYZJ 2XWYA 2V8PA 1FNMA 5DG7A 4K4YA 4V1Ak 3I32A 4DPYA 2PFDA 4ED2A 3KLIA 4I64A 3BQ2A 4Q5VA 3IM9A 4CP5A 5F9LA 1VQ5S 1X4GA 2DGOA 1S9EB 4WYLA 4I6YA 4Y65A 5A0YB 2HHWA 5EWEA 2PEBA 4KY3A 3C2PA 1KP6A 4WFAQ 3N5BA 1S97A 3RG6A 4Y28C 1XMOJ 4OLOA 4ZVQB 3HVAA 1ZM9A 3ZZOA 1H72C 4UY8T 2DRAA 1RSCA 2CNKB 3UE2A 2DGXA 3UNYA 3W9IA 3M9OB 4MK7A 3C15B 5U47A 3SFUA 5M2RA 2GJFA 3PRVA 2WW8A 5K5MA 4OYXA 1C1BA 4LRCA 1S9FA 4EZ9A 1IBLF 3MI7X 3GILA 1XK8A 4ZKAA 4TU9A 3HK2A 2M9KA 2W2NP 4IFVB 3NGKA 2CQGA 2HNZA 1FFGB 2BKOA 5J1EB 1HD1A 1FE4A 3D0HE 1EB0A 4MYUA 3I6PA 4YN3B 3R5AA 3DKDA 3NS5A 5C25B 2GGPB 1WKJA 4OX7A 1HR0J 3MECA 5B0GA 4CLPA 4RW8A 2W01A 4GO5X 5K8OA 1TK8A 2PMWA 5DG9A 4IFYB 4NASA 4DSKA 1N5YB 1UPMB 4EO6A 4DV3F 4ED5A 4J37A 2YTCA 3W66A 3AAWB 1RHJB 1U6ZA 4R5PB 4OZJA 3CDEA 3SSRA 4LIWA 4TQSA 1QSYA 4RUAA 3TVYA 1S57A 3QT8A 4USMA 2XCAA 5LXYA 4TN2A 5DDQC 1H98A 3KUEA 2B5JA 3FCWA 2HRTA 2LXFA 2GO9A 3OFHA 4CO5A 2RVJA 2W9AA 3MFIA 5K8MA 1RTHB 5L9NA 3RBEA 3S8SA 5HSPA 3D6TB 4RW6B 3HKWA 1U6BA 4Y34A 1HPZB 2QO3A 3RRHA 2GVZA 1XMQJ 2RS2A 3B82A 3PYDA 2EEYA 4DXLA 4PAAA 3QZ8A 1V3SA 4CH0S 3PHTA 4PCQA 1XNQF 1CEZA 2BQRA 4OL8A 2RUSA 1Q53A 3OVSA 3RR7A 1BQMB 2ZWPA 2R4FA 3GSIA 3T5LA 4LSLA 5C24B 2HVEA 3N01A 2HLUA 2ILYA 1KQGB 2AYBA 1N34F 4KGVB 1H38A 1RWNB 3AB4B 1VQNS 2LXUA 4X4VA 4B9SA 3WX8A 5D15A 1RCOB 1WG4A 3T1HJ 5ETSA 4DV7J 1IR2A 3TAMA 1CG2A 5CQGA 3A13A 1LNQA 2RU3A 2U1AA 1HNXF 1SB6A 3CCLS 1UVJA 2DRDA 2I1RA 4X66J 4QQBA 1QTMA 3TX0A 4WZMA 2QTWA 5M2PA 5E41A 3H40A 2VHGA 3B4MA 4NEZA 5KFTA 3SV3A 4NI2A 3MM8B 3BQ1A 1KKHA 3NOCA 4DBQA 4IRDA 2HHHJ 1K73T 3FVYA 1MWZA 1CULB 1RAIB 3CE8A 1H73A 3T3FA 4E2FB 2XMAA 4JV1A 4NE9C 2BW2A 4M94A 4JI3F 4QR2A 1C0UA 4L3KA 3I96A 4NCGB 2C3UA 5CCLA 1HQEB 2AP6A 5KOWA 3OTBA 3M2VA 4K4WA 4B9LA 2EFNA 3CMES 1S5ZA 3KJNB 4LRAA 4RBVA 4G1IA 1RWVB 3DNCA 2OPPB 1LFWA 4TLQA 3V2UC 4C8ZA 4X62J 3MTKA 4TKTA 5K8PA 4ZPTR 3KFWX 5AE1A 2G9OA 4JI7F 3H90A 2FC9A 4H4KA 1XC9A 3ELHA 4N8OA 4B3TF 2J8AA 3I0RA 3K2YA 2FGOA 1VDHA 3G87A 3HSZA 3A3PB 3B54A 2B9YA 2QGFB 3EZUA 2B4UA 2V67A 1QAIA 4JI0J 4DF8A 4O4GB 1RAFB 3HXMA 1J5EF 2D3UA 3GR1A 4B3OA 2WONB 4F4WA 1RK8A 3AA9A 4MAKA 3KKFA 4AD6A 2KT5A 2UXBF 2E1RA 3I5CA 1HWUA 1F9HA 2UZAA 1F9EB 1RWMB 2A6OA 3HHLB 2HRYA 4QU7A 3O5TB 3UFCX 1EQ0A 5H9FJ 3OVAA 2JNJA 1ITPA 1MWQA 4OHWA 4B9TA 2W7OA 4GKJJ 4M8LA 4F0MA 3MCOA 4M5LA 5HBMB 5KFSA 1VC5A 4ZVFA 4DZ6A 4FYWB 3I56S 3FCVA 4RX6A 3NLCA 1RT5B 1L3KA 4AE5A 3G82A 5HP1B 4E8UA 3DOMA 4Y2MA 3C16B 3DOLB 2MZ1A 1LKZA 2M5YA 1ZPWX 2BOAA 2H5JB 2YWFA 1RB0A 3NCPA 4ZVEA 3MGJA 3PXGa 3GYGA 3M8WA 5KFJA 1TV6B 1V6HA 2CQBA 3PW2A 3L09A 2UUCF 3PW5A 2B9XA 2IC3A 1QM9A 4ER8A 2HQIA 2DCLA 2UUBF 1N88A 2RRNA 5L39A 2YWHA 3GU0A 3MAAB 4P2FA 4WTYA 4CO3A 4A48A 1VQ6S 1V9OA 3OV7A 1O5JA 4B9NA 1Q7LB 3D54A 4ECSA 3M8SA 1DQ8A 5ETVA 3GIMA 2CZVC 2IM3A 4P6QA 4RU2A 2HQ3A 2F7VA 1G2EA 3BJYA 1X5TA 2J8SA 3O44A 4QPTA 3BSOA 5ETTA 3MEEB 2Q43A 4F0KA 1TUVA 3Q8YA 1S1TB 1SL2A 2HIQA 2UU9F 3QAUA 1NHKL 3G6VA 1FNOA 3SI8A 5LSRA 2W2PP 2FJBB 4DQIA 2JRSA 1H3DA 2D1CA 1R8AA 2ILZA 3HMJG 2V69A 4YY3F 2NLWA 3MR7A 4XPCA 5HI7A 1FHTA 3R7SB 1WC4A 4ANEA 1IWAA 2HHQA 2GMJA 5JXSA 4DLGA 5F9NA 1TQLA 3NWRA 3H2VE 3J81U 1RYSA 1DJ0A 2BBEA 4ZHRA 4ED0A 3HVWA 3QPIA 1NK6A 3CO9A 4CWBA 5J2QB 4FF1A 1PC4A 3I87A 4FPRA 4P71A 1WI6A 2OJ3A 2L9DA 1C1CA 2UUTA 4F4ZA 1APSA 2EWHA 2GHWA 5KFOA 2V8GA 1JLCA 1NRKA 2UP1A 1TVRA 2C2MB 2QN6B 4FKYA 5LOQA 3N6MA 2MQ8A 1OJ4A 3OSPA 2M4MA 2XLKA 3R2DJ 3RB3A 2NSBA 3G86A 1VHIA 3BR9A 3BYRA 2E7XA 1U1NA 3WQPA 5HK4A 1YG0A 3RB6A 4QU6A 1WC1A 2C2ZB 2BDPA 5CHCB 2WVDA 4GKKJ 3ETOA 3KDNA 2CPJA 3KLEA 1JLEA 3IMQJ 2LQ5A 3TVKA 5I3QA 1HWJA 3NNHA 2BACA 4QBUA 5K20B 4LBPA 2V9KA 1LFPA 1YLXA 1HMVB 5IC6B 1X5OA 4K8RA 4Q2LA 2E5JA 2ACYA 1M1HA 3TANA 3DYAA 3JTOA 4JI1F 4S0MA 5DQIA 3EXYA 3THVA 3EMTA 2AGOA 3AB2B 3J80Y 5IS2A 3K8VA 4J9OA 3MM7A 3O2IA 4QWCA 5DQGA 1RE1B 1SJRA 2MJUA 3PACA 3E01B 1U48A 2X1AA 4U7UD 2ZJPQ 1CPZA 1VFJA 4B3RF 1A7GE 4J7CA 4K2XA 3SCJE 1KNZA 2HHVA 1T05A 1VBYA 3P5TL 4NLPA 2LQBA 2FIUA 5A8WA 4LF9J 1U49A 4KTQA 2YNFB 1U4BA 3KLGB 2B51A 3IR7B 2UVRA 4DSEA 1WD6A 2HSEB 1BQXA 3SFGA 5DLGA 4ZLLA 3OL9A 1JKHA 3MM9A 1JJ2R 4U67Q 2XSFA 4DR3J 4NA1A 1IBLJ 4F0HA 2HBRB 5FJ4A 2BZ2A 3Q24A 1XN9A 1S49A 1N52B 1X60A 2HS0A 4FXVA 3ZZZA 1OY8A 2XGPA 5BYRA 2RS8A 4EYIB 2Q6BA 1HFEL 1X9MA 3CCVS 1G7CB 1JK9B 2XMJA 4DV2J 5A0YA 2AWZA 5B0FA 3QATA 2DEJA 5KG4A 3QSYB 2QLFB 2O5DA 3PYEA 3OFGA 5E5NA 3WC0A 3HT0A 2NXNA 3VGTA 1QE1B 5D0GA 2BW7A 3IR6B 1TUWA 4DV3J 3KK2B 2HG4A 6FD1A 4ILLA 3PX0A 2GIFA 3UNGC 2VBZA 1RHUB 2RKIA 4F02A 1PYSB 2DB1A 2JHEA 3QGIA 2IFXA 4DX5A 2G0JA 4WK1A 5KFEA 4OYZA 4CLZA 2DXEA 2DNLA 3QJLA 1H6KX 3I0SB 5DO2A 3E8OA 1F6TA 4YP3A 2NCKL 2V4QA 2CZ9A 1YITS 2IRXA 2XLJA 2Y1JA 2V34A 5IV3A 3I4PA 4EI2A 4LR8A 1F0XA 4WU2A 5J1EA 2E9TA 5DDRC 3PG9A 4FF2A 4QIFA 4JI6F 4KGXB 1YIJS 2B9EA 5HROB 2DR9A 2IAJB 1VHFA 1B70B 4DL0C 1F5AA 2V4JA 4MYTA 4LF2A 2OLWA 3DN9A 3E51A 2FYXA 4DSJA 1XNQJ 2OPSA 3GJQB 2F4VJ 3BZQA 2EK1A 3MMAA 2VC1A 3PM9A 2XO6A 1TTHB 3M6XA 2VU5A 4R5PA 1BLUA 1E6YA 1N34J 4MH8A 1MN9A 2KT2A 1VBXA 2BRLA 3N6NA 4UW2A 4I1TA 5AT1B 1JQGA 2HURA 2ZC4A 3AH6A 2MXYA 2MZQA 1F2HA 2ZHAA 4Q8FA 3K57A 4DX7A 2E1PA 2DTJA 3VZIA 1HNXJ 5F3TA 2MSSA 3NEKA 1WTFA 3NNCA 4DHVA 5EHHA 2ASLA 4X4UA 3I5BA 1RTHA 1CJVA 1HBOB 5T41A 4RW4A 1A6LA 1LWEA 1R89A 2OUGA 5H9EK 4RW6A 4HDHA 1HPZA 1AYEA 3KLFB 2C3MA 4LF7F 2HQCA 4JUZA 4ZP8A 2CQ2A 4UQGA 1PJ6A 4OX9F 1PILA 3K5NA 5CD4A 3MZIA 1SPBP 3UR0A 3BR8A 5HN0A 2RD5C 4BS2A 2IYGA 4HH0A 1S59A 1WHYA 4C11B 2GW8A 3BDPA 2UVUA 2QSFA 4PQUA 1BQMA 4K4VA 2JEIA 5C24A 3T6BA 4OZ3A 2AEFA 3MEGA 4C0OC 4F67A 5KT3A 2OSQA 3M8PA 2RQKA 1U09A 4WJBA 1L3SA 2OI2A 3PJ9A 3PW0A 2WAQD 1FO1A 3M4XA 4EMDA 1SC3B 2L9WA 4J9VA 3HFVA 2VBXA 5G0RB 2AQ4A 2GMLA 1NH8A 1CJKB 1HIYA 2J0WA 2KG0A 2QFJA 1FRIA 3SXLA 2BJ1A 2Z57B 4K4XA 3CMAS 3ZXWA 4JI7J 1KS2A 2J9DA 5D6GA 4B3TJ 2VPYB 2R8IA 4NXMF 2AEJA 4N5SA 1JXEA 2ADBA 3IN5A 2B6AA 3MOZA 2WK4A 1RADB 2CPDA 1J5EJ 3K5MA 4F8RA 3EGNA 4EWTA 4LBIA 2FLPA 2NUUG 1CULA 1RWXB 2KH9A 5D0HA 4GC7A 3AY0A 4G3IA 4DR6F 4HH1A 2PDAA 3OR2B 2UXBJ 3FC9A 3KMSA 4EBCA 4F25A 5BYSA 4CNZA 4NCGA 4FXDA 2OIHA 2OTLS 3UI3A 1X5PA 3UN5A 4DMZA 3DDIA 1Q0NA 2MKYA 3LP1B 5HQ8A 4I7FA 3M8RA 4V19J 3Q8QB 5KFBA 3QT5A 1VIOA 2ZH2A 3POTB 3HHEA 4LF1A 4DFPA 4KFBB 2FD2A 2YNIB 5CABA 3BF4A 1V3RA 4ES1A 3IAM9 1EJ7L 5LMNF 2YKPA 1FDBA 2VG5B 5KT4A 2NUHA 4IYQA 3P5BP 2HMIB 5IXUA 3FSYA 3BBFA 1QSLA 4M5DB 3FKBA 2IM1A 3I82A 4O4GA 3OSNA 1KTQA 4D3GA 4J91A 2WONA 4P52A 2HHUA 3WBZA 1Q7YT 1PAEX 2UUCJ 1TKDA 3DRSB 3VF0B 3DRPB 1FTCA 4KSEB 1N54B 5B7WA 4CT9A 2MYFA 2A2DA 5B0AA 3DMJB 2HVZA 5HANA 3TI0A 4JI5J 1R6YA 2HFNA 2A6MA 1MMDA 2P6TA 2Y0BB 1YI2S 1Y10A 3SV4A 5C42B 3NGUA 3D0GE 1NPKA 3D66A 1UJ4A 3FK4A 2Y0SD 3LP2A 5KFXA 2IJRA 3VQTA 5E0OA 4ZPAA 1FRMA 1IBMF 2UU9J 3A3NB 1YQHA 4USJC 1RT2B 1RT5A 3KMQA 3C16A 3O8WA 1TMJA 3H98A 2PGCA 1BE4A 1HI1A 4YY3J 1Q79A 1U1QA 1HBMB 1N8RT 4WKYA 5E7OB 1YGYA 2YBVA 1TV6A 3SBMA 2HBYB 4OZ1A 1TUGB 1OYEA 4AL7A 1R43A 3IG1B 1VK3A 4OLPA 1VQ4S 2V9WA 4OYPA 6FDRA 2WVBA 3FSXA 3ENQA 3MAAA 5LSOA 3GG0A 4O0NA 1U0HA 2VFTA 4M5JA 1NUEA 4FZVA 1N6QA 2E9RX 4K4TA 1D1UA 4IG0B 1LXNA 2PN6A 2DHXA 5AXKA 1JLAA 3DLHA 2EFGA 1N0VC 4IKAA 5A76A 1WDDA 4I56A 3NXZA 1SJ3P 4TU8A 4LSNB 1S1TA 3TW0A 4JI4F 1MLAA 3D28A 1Y3KA 3TZWA 1P9QC 5KFDA 3MMCB 3UVJB 1PCAA 2XEXA 2RE1A 3GZ7A 2XZDB 4M5IA 1S77D 3E3XA 1TZ0A 3TQ1A 3AXKA 4KBIA 7FD1A 4LIRA 3GIJA 4U7UK 3MUMP 1O51A 4ANCA 3FZ2A 4ID5A 4U7CA 1U1MA 3ITHA 3OLAA 2H54B 4Y2AA 4M5NA 3DLGB 3FNNA 4CDIA 3G6YA 4DV4F 1RT7B 3KLHA 4MTPA 1WG1A 2HQDA 2KDOA 2DO4A 2M88A 1U8SA 3NGSA 3IBCB 3DDKA 3GR0A 4RWXA 3MM5B 5AJ3F 3PKYA 4Q0BB 2XI3A 2W8LA 1UL3A 4RUCA 5I3UB 1QAXA 4DL2A 4F04B 2WOMB 1Q86T 3DLBA 3TNVA 2K2PA 1UCNA 2CKWA 3ZTSA 2CPZA 2YKOA 4B3RJ 2EXUA 4TQRA 1WKLA 3IBWA 4ES3A 4W98A 2H5EA 2ROPA 3WIVA 1VQKS 5HVFA 4KO0B 2HFZA 1GEHA 1PYTA 2Y1RI 3GCXP 3QFHA 5IWAF 2NQPA 1R31A 2AU0A 1RU1A 4H54A 4MKAA 4CO4A 4ATNA 1SV5B 3ILOA 3RJMB 1Q5VA 5CH7B 1NHUA 2XNRA 2XNQA 1RA6A 2R7QA 2DPJA 4URGA 1IQTA 2MGZA 3DXSX 2L41A 3CCMS 4K0KF 2DJWA 5ADZA 4M63A 1QTNB 5KFAA 4NZ0A 2NREA 4Q44A 2VV5A 1A9NB 3E01A 4KV8A 1JLGB 4A8KA 1BQNB 1LW0B 4HHHA 3MTJA 4LFCJ 5F8GA 1N5QA 2NXCA 3EYZA 3AQOA 5LL6d 1IKXB 2W9BB 4EFAC 4JYAF 5ETKA 1XTZA 1D9FA 1EQMA 1ZZFA 1NKBA 1YBUA 2W1BA 2WB4A 4CM2A 3KUGA 1FFSB 1U1OA 2PEHA 4P73A 4OHXA 1B7YB 4I2PA 1RT3B 2DNZA 3MPYA 4LFBJ 4E0DA 2R7WA 1SUQB 4H4OB 1FKOB 1WDTA 4UUXA 3VVUA 4B9VA 3UO0A 1X4EA 1RAOA 4JI6J 4WF9Q 5IC4B 4LF8J 3KK3B 3QGPA 4RW7A 4X84A 4ECWA 3BSNA 2FZCB 1TKXB 1JXLA 4PKDB 3K89A 4DV6J 3GTYX 3CDAA 3KJVB 4UZCA 2VB6A 2X51A 3MD3A 4BC7A 4CNYA 2OFHX 1RTDB 3R3TA 1VLOA 3KG4A 1QE1A 4H4KC 3ZTPA 5F8NA 1GFWB 2FQQB 1VYAA 4WE1A 3VAGA 1RUSA 1UMJA 1Z1ZA 1S48A 2J6TA 4HTJA 2KL8A 3BSAA 2BE9B 4AXJA 2OAUA 3K0JA 2GAGC 3RBZA 4J9RA 4FYYB 4NYOA 3ZTRA 4HDGA 2J9DE 3I0SA 1GH8A 1S1XB 1UFKA 4PUOB 2QYCA 1HD0A 5K14A 2VA3A 4PXDA 4G65A 5J2NB 2R2TA 3OXGA 3TZXA 4USTA 3LF0A 2VG7A 2XC9A 3EUNA 4QWDA 4CIOA 4OX9J 2IAJA 1J2VA 1HBUB 1VQPS 4NPOA 4YS2A 3GCWP 4HI2A 4UOHA 2CQDA 5KG1A 2DHAA 5AXNA 1SJFA 1K0TA 2VPZB 4J9KA 1K1QA 4DFMA 3PYFA 3DRYA 3J7YI 4PEOA 1Y11A 3ET6A 4ZJLA 1WELA 1RQ0A 1CLFA 3MR5A 3WIUA 2GQ2A 2MDAA 3V81B 1FERA 2RF2A 3QRPA 1VBKA 3JTPA 2PC6A 2ZFHA 3V4IA 5DM7Q 3B8HA 3RUBL 3G96A 1UJ6A 4QW9A 1KTVA 3DM2A 1GNKA 2FJVA 2VH7A 2DO0A 1T0TV 4RO0A 3CJRA 1CQMA 1RT1A 3CF5Q 1QVFR 1HYSB 1FXRA 2BJ7A 2IMWP 2Z30B 2VG6B 4L76A 4P7VA 2K7KA 2OD6A 3JAMU 3CCZA 4ECXA 4K2JA 4WFXA 3M6UA 1BWVA 3KLFA 2IMOA 2B8PA 1W7WA 1MW7A 1I6JA 2HFSA 1RAGB 3MURP 3SDEB 5ETOA 2RH3A 2YKMB 1SJQA 1GTHA 2CPFA 3HF5A 3Q8PB 3AJDA 2ZBCA 3V4MA 3C46A 3BKTA 2V2ZA 1TL7B 2MZJA 1DQAA 4USUA 4JOUA 4C11A 1XERA 4DR6J 4Y0FA 1IKVB 2FHJA 4G1QB 1NK4A 1IKWA 1T03B 3D5MA 1B0PA 3RAQA 3MWBA 1WHVA 3VR1A 2R2SA 3BO3A 1ZZNA 4NLTA 1UVKA 4QR1A 4IG3B 4F2SA 4NLVA 2G4BA 1LEOA 1WEYA 4KT0C 2ZKUA 3M8ZA 2DNHA 2JLFA 3DU5A 1CJKA 1K0VA 2F40A 3SSSA 2G1HA 3HVTB 1NAQA 2YX7A 3R1HA 2BR0A 2QRRA 4RW9B 3UCGA 1VRUB 1HNWJ 5LMNJ 4B08A 4FNHA 1F9FA 4ZCMA 1Q8LA 2B4PA 2IDLA 3QQCD 5CZXA 5E33A 4NOHA 1EHWA 5DGAA 4O3SA 4TVAB 1REVA 2LCWA 2OEKA 2RIJA 2O3DA 2ZM6J 2BMBA 3PFEA 4A8XA 3W8GA 1S1WA 3R5DA 1KFSA 3OR2A 4UT4A 4AFFA 2LKZA 2XS2A 4EYHB 1ZBTA 4KGMA 2FTRA 4OI0A 1OIAA 4LBHA 3IS9A 2LEBA 2SXLA 2XQCA 2YNHA 3T1YF 3IGNA 1P1TA 3LP1A 5L1JA 1HR0F 2KFNA 3D1HA 2M3DA 2VASA 2AJQA 3POTA 3ZZUA 2ZBPA 4CCHA 4JBCA 3HD2A 1SH3A 5KFGA 4OYBA 1GT8A 1L5UA 2R7TA 3DFEA 4U96A 4X4NA 3CB4A 3SCIE 2XY5A 2QL9B 1VRQC 4HT7A 2YWGA 3IWLA 2HMIA 3CC7S 2P5VA 3WX4A 3J81Y 5GMEA 4M5HA 4DG1B 2PA8D 1SL1A 1MWYA 1SQFA 4DUZJ 3A8JA 4ZA1A 1YWXA 4GMKA 2GNKA 4NLWA 5L46A 4RUHA 5KFRA 4KAIA 2VKZG 2J9CA 2KG1A 2LEPA 4EEYA 2RUGA 4PXCA 2EFVA 1WHXA 4DI6A 1JJ4A 1IKYA 1NZ8A 4RU9A 4DR4F 4ZCLA 2A18A 4PWWA 5T7LA 4RL1A 5C42A 3GJSB 2ADCA 2B43A 3EPIA 3I4HX 4I69A 3DGPA 4ECTA 2JX2A 4MFBB 1NDLA 3CIMA 4UQTA 4J9NA 3MR6A 2C2KB 4OI2A 4ZCKA 2X1GA 4ZN3A 2GVDA 1IN0A 2W9CB 4OX8A 2YX4A 4DR2F 3CD6S 1ICEB 3M30B 4RNHA 3W2WB 5M2UA 2IJFA 3L3CA 2QMXA 3LP0B 1HBMA 4Y6IA 2RQ4A 2HNDB 3T1HF 2D3OR 4ED1A 4AL5A 2GJ2A 1FWPA 1AFJA 1F60B 2EW9A 4U8VA 2YWWA 3KTQA 3X3UA 2AMCB 1U1KA 2RRAA 2K8GA 5J2PB 3IG1A 5L38A 4RNFA 4WK3A 4Z7CA 1URRA 1VR6A 2AYMA 1X31C 1ZA2B 3W5YA 3THPA 1P6TA 1FE0A 3CDUA 4HHUA 1HNZF 4IDKA 5KG5A 3EGZA 4P74A 2DH8A 2OP5A 2NXUA 4O3QA 4IG0A 2QLJB 1S0NA 1RBOB 4O44A 2HHHF 2KU7A 1YRTA 1ZTWA 1YVFA 4O3PA 4AXIA 4QZVB 2XMUA 1FXDA 2W8KA 2VBWA 3DLEB 1AUDA 4X65J 2JOQA 1HARA 3UVJA 2DK2A 2LA6A 5IWAJ 4K4SA 1S1VB 1R0AA 1BC6A 1TKZA 1ELOA 2N7CA 5ETMA 1KR4A 3BQ0A 3AODA 1WI8A 1B64A 4OX6A 2PFFB 1WORA 3MMBA 1JLQB 2Z8QA 4LFAF 2Z4PA 2C2DA 4DR7F 1X4FA 3K5LA 4LMZA 4QPXA 3U27A 2E66A 3H5UA 4ZLNA 3AA8A 3QGHA 1H2VZ 2JVOA 3ENVA 3GONA 3PX4A 2Q66A 4DQSA 1H2UX 4ITSA 3MUTP 1RT7A 3T1AA 4DU7A 4A8WA 4PPDA 3T5KA 4AL6A 4HR2A 2W4CA 4K0KJ 5ITHA 3MM5A 2PI4A 4Q0BA 1NJWA 1FKPA 2BXJA 3CCTA 4QIWD 2RU9A 2CXEA 4G1PA 2ALZA 3ENAA 4JI0F 3C6TA 4X4SA 3JQKA 3L95X 1T02A 5C7PA 2XWXA 3CJKB 3GJTB 3QO9A 3TO8A 3CJ2A 1T7PA 3R5BA 3SQOP 2CJAA 4KO0A 4P2XA 2Z2YB 2V5HG 2AD9A 3MEDB 4CM0A 2W2MP 2AJ1A 4B9MA 2J9EA 2AYEA 4IRCA 2HZCA 1WUUA 3BGRB 4XDDA 3F0NA 2V94A 3HSGA 1O0PA 1MN7A 4KKOB 1RWWB 3H0PA 3U1LA 3CSKA 1GX6A 2C2EA 1I5OB 3NMRA 2P6SA 3KHLA 4FPIA 5D8HB 1RAAB 1FFWB 1OPZA 3MEKA 2MKHA 2E1CA 4USVA 3CXCR 2ATLA 1JLGA 2P8IA 2HK3A 1K1SA 1SL0A 5KAKA 1YJNS 3NOGA 3EVOA 3AOCA 3W2VB 1IKXA 2W9BA 5KFKA 2B4VA 4YB7A 5IT9U 2P9EA 1O6XA 2I0XA 4CZCA 5C2CA 3K58A 2DY9A 2FC8A 2C3PA 4I68A 2CJYB 2JC0A 2XYGB 2LECA 2YH0A 3RB0A 1PYOB 2CQ3A 1RWKB 1SUQA 4H4OA 2DGWA 1FKOA 1RAHB 3SYZA 5CAAA 3DLJA 1SKUB 3H20A 3V5RA 2VFVA 2MZRA 2R7XA 1RHKB 2DH9A 3FCHA 3ISND 2C22A 3ICLA 3TZZA 4DPWA 1VMBA 2DR7A 2G0IA 1TL3B 2DD8S 2PI5A 3HHLD 1LWCB 2ROEA 4JV2A 2AV5A 3PV8A 2UXCJ 5FDLB 3OL6A 1DTTB 4U95A 4W90B 3SCLE 2HYIB 4DV5F 1I3OB 2L48A 1TL5A 3TAPA
chains in the Genus database with same CATH topology
4DSJA 1FD8A 2AJFE 3OFEA 2OPSA 1X7VA 2J0XA 3BGFA 3JSYA 2APOA 3FDSA 2JDJA 4NLDA 3BZQA 2EK1A 4CO1A 3MMAA 2ZHBA 1FK9B 4Y3CA 2JSXA 2VC1A 3PM9A 4KR0B 3HFKA 1MMLA 1TAUA 2MQMA 3DLKB 5E3QA 3QZ7A 2M0GB 3DLEA 1GQEA 1Z4UA 1S6PA 3DI6A 4DR1F 3M6XA 4OZ5A 2ZH6A 1H2TZ 3ISNC 3M2UB 1BLUA 2VL1A 3BN4A 1E6YA 1KQKA 5A8RB 1KOHA 1VOMA 5IZHA 1UVMA 3PO4A 2LQ9A 4MH8A 1H7XA 1VK8A 3LO3A 5KFHA 3I55S 4QIGA 3TUZC 3FFIA 2KT2A 1VBXA 2W4PA 2BRLA 5CYMB 2W4DA 4UOCA 3N6NA 2M8HA 1S1VA 4Q8EA 2CJKA 4UW2A 3DCAA 3PFOA 3HHLC 4I1TA 2YWKA 3KWMA 2XSJB 2MY7A 3LP2B 4LSLB 4NWBA 2ZC4A 5J2NA 3AH6A 5EX0A 2MXYA 2CZ4A 2MZQA 5JVHQ 1UA1A 3M32B 2ZHAA 4Q8FA 3MFHA 1E6VA 1T8EA 3K57A 1URNA 1KQSR 2WB1D 4X65F 3D1OA 1Q78A 1UWBA 3GB0A 2DTJA 3VZIA 3WDOA 4KQZA 2MSSA 5F3TA 3JB9k 3V6HA 1S4FA 2VC0A 1L3UA 1WTFA 3JYTA 3PIPQ 3NNCA 4QWBA 4DHVA 1WNEA 5EHHA 2ASLA 3UDLA 1ZTTA 5KTQA 3QGGA 2MZTA 4X4UA 3I5BA 4R0JA 1RTHA 3VCDA 3LALA 1HBUA 1HBOB 2DNYA 4RW4A 5T41A 4YFUA 3CDBA 1A6LA 1LWEA 4IOBA 1R89A 2CJQA 2RILA 4RW6A 4HDHA 4TXSA 4WXWA 1HPZA 2HHXA 2EBGA 3KLFB 5FD1A 4Y2IA 1ULRA 2C3MA 4LF7F 3M9NB 1LWFA 4JUZA 1HMVA 4ZP8A 4A8FA 4X4TA 2MQPA 4DJBA 2XB2D 2CQ2A 1F2GA 4XDCA 4UQGA 1NJYA 4OX9F 2ASYA 1S9GA 1OQ3A 1P8GA 2JFKA 3U1NA 4YB6A 4QWAA 3FMBA 1PILA 1VQ8S 3K5NA 1IBKF 2KXNB 3MZIA 4B3MF 2Q6CA 3EXCX 3UR0A 3BR8A 5MAOA 5HN0A 1F5BA 2RD5C 4HL9A 3CCJS 1R3NA 1VGYA 2MY8A 2O1PA 1S6QA 4BS2A 4J9PA 1N4LA 4YHHF 2IYGA 4DDFA 4HH0A 1XMQF 1HW9A 5E3CA 4C3LA 1WHYA 4C11B 2GW8A 2Z2MA 1Y9OA 2RT3A 3BDPA 2UVUA 2PD1A 5LMUF 3CJKA 2QSFA 1WACA 3OHBA 4PQUA 2AW0A 1DFDA 4YR3A 1BQMA 1CC7A 4ZOSA 4K4VA 3PR4A 1VS3A 3O6QA 3P3DA 4YMEA 2RB7A 3BSCA 2JEIA 1S1UB 1YRUA 1HNIB 2NPIA 5C24A 3T6BA 5DGBA 2ZH9A 2HWIA 1N6QB 1Y4ZB 3KHGA 3MEGA 2YKAA 2P9CA 5KFPA 4C0OC 4F67A 5KT3A 4QYRA 5B0DA 2OSQA 3M8PA 5DLFA 2RQKA 1PC5A 2MJNA 3MEDA 3TRGA 2HGMA 2XLIA 4DL5A 4WKRA 2RDIA 1U09A 3I31A 3V6DA 4WJBA 1JLAB 1L3SA 2YNFA 3KLGA 3PW0A 2WAQD 1VC6A 2VG6A 5KFZA 5KT7A 3N6LA 4HVZA 5EWFA 1K8AT 1KRPA 1FO1A 3M4XA 3BO4A 2XULA 1NKEA 2L9WA 3NAHA 3M2VB 2KB2A 2VBXA 5G0RB 2DNPA 2AQ4A 4OHZA 4YDXA 3U1MA 3U02A 3OLBA 2GMLA 1NH8A 4I2QB 4C9DA 2CG4A 5KFMA 2YY3A 1GX5A 3H25A 3N28A 2XS5A 4LF9F 2FLLA 4FF3A 2J0WA 3BGUA 2HRUA 1PSDA 4BCAA 1XNRF 4DV7F 1C2PA 2KG0A 2QFJA 2DIVA 1VQSA 4L72B 1QLNA 1VLYA 3SDEA 3CIZA 3T5JA 1FRIA 4N8NA 4J9MA 2YKMA 2CDQA 3SXLA 1DRZA 4K4XA 4FF4A 3CMAS 3CJ0A 2CQ1A 4L3NA 3OHAA 1KS2A 2J9DA 5E3PA 1B0VA 3SQGB 4M1KA 5D6GA 2ZOFA 2DVIA 2POKA 5KFWA 2VPYB 3SMZA 2R8IA 2OKQA 4X66F 2Q3PA 2UUAF 4NXMF 4DR3F 4FP9A 4ICLB 4N5SA 1JXEA 1ZM3A 2ADBA 3IN5A 2B6AA 1HWLA 3MOZA 2WK4A 2KT3A 3OR1A 3IAS9 4ID5B 1NJIT 4K4ZA 1IR0A 1OWXA 3DLLQ 2LYVA 4XPEA 1X4AA 1X9WA 4G1QA 2CPDA 3ITHB 2VONA 3ZZ0A 1VIXA 2BABA 2GV1A 3C6UA 4YB1P 3K5MA 2QZ8A 3G8TA 3D0IE 4DFJA 3D1QA 4F8RA 3EGNA 4EWTA 3PVXA 3Q8RB 3NNAA 3KLHB 2FLPA 2NUUG 2CQCA 1D0EA 2KH9A 2FVSA 2M7SA 4GC7A 3AY0A 4G3IA 3PKMA 4DR6F 4HH1A 3FSIA 2PDAA 2VZ9A 4TY9A 2DGSA 2K3IA 2EBEA 3H2UB 3OR2B 4X4QA 2B4OA 1H7WA 4Q2MA 3KMSA 2WBMA 2KN4A 2AJ4A 4A8MP 4EBCA 5B09A 3RTVA 4F25A 3RRGA 5BYSA 3Q0AA 2N3LA 3VAHA 3W2VA 4CNZA 2LEAA 4CTAB 4UUWA 1U1LA 4B3OB 2A1BA 4PR6A 1O8BA 1KLMB 4DV2F 4NCGA 5EUHA 1VJWA 4USIA 4FXDA 1JLFA 4TY8A 2BQUA 2OIHA 3KK2A 3MR3A 2OTLS 2CQIA 1HA1A 3FMWA 3UI3A 1H0HB 5IQ6A 1YJ9S 4PWDA 2C2RA 1X5PA 4OMFG 4DMZA 3OTDA 2CYYA 2QIFA 4U6PA 2RSQA 3FQKA 4M95A 5E3AA 5MLCV 5G4DA 2DHGA 3HVTA 3LP1B 2CIMA 1RTIA 2F1FA 3QLHB 3F41A 1U45A 5HQ8A 1HBNB 2KTQA 3DHWC 3HHDA 4N47A 3MUVP 4I7FA 3M8RA 3GV5B 4PWUA 4AUKA 4V19J 3Q8QB 4NLUA 4DN0A 2FUG9 5KFBA 1VRUA 1GTEA 1VIOA 4NX9A 3KYLA 2ZH2A 2R2UA 4MIWA 4QOTA 3POTB 3HHEA 4HHJA 4DFPA 4USHA 4KFBB 3QWUA 2FD2A 2WHOA 1MROB 2FVRA 3PJXA 2YNIB 1HW8A 2RNEA 1YRXA 1NEEA 3BF4A 4ETZA 1J5OB 2E5LF 3EX7B 2OTJS 3JSMB 1V3RA 1FVSA 2MPUA 2LDYA 3DXBA 3TVZA 2DPIA 4ES1A 1ZM2A 3IAM9 3MDFA 2R7OA 1G6BA 1Y3JA 5LMNF 5H1SV 5HLFB 2KHDA 2QLXA 3LPYA 5D4NA 3KOAA 2YKPA 1FDBA 5CD4H 2VG5B 2R7RA 4OIXA 5KT4A 2QA4S 2FHMA 2ZZNA 4HTIA 2NUHA 3L7PA 4X62F 2KZZA 4IH5A 4IYQA 5JJBA 3RYLA 3QIDA 2HMIB 2J0QD 1MU2A 3FEZA 4ECZA 1U24A 5IXUA 3CVKA 3FSYA 5DRKA 3CCUS 1RWUA 1VQOS 5L9XA 1AW0A 1QSLA 4M5DB 2IM1A 5D4LA 2LLZA 3AQPA 3I82A 4O4GA 3OSNA 2HHSA 3FRYA 1KTQA 5HROA 1XR6A 4KHRA 3EGWB 4D3GA 2KXHA 4ELTA 2GJIA 2RQCA 5FDLA 1DTTA 4A8QA 2GHVC 4ECRA 4TYBA 4F2RA 2WONA 3BGLA 2HHUA 1G3OA 3KNGA 3WBZA 1Q7YT 5A8KB 3GIIA 3N5FA 5KT5A 2MGZB 1TKDA 3DRSB 3M6VA 1S76D 4I4BA 5L1IA 1NHVA 4NLOA 3VF0B 3DRPB 1FRJA 2PMZD 1FTCA 4KSEB 2HNYA 1N54B 5B7WA 4Y2KA 2XHWA 3GFXA 1DLOB 2O66A 4CT9A 4N41A 5GAGI 2MYFA 2A2DA 5B0AA 2DH7A 1Q81T 3AHPA 2UXCF 4EUVA 3DMJB 2HVZA 2BM0A 1ZOTA 3TI0A 4F4YA 1R6YA 1WF1A 3S6EA 1RTJB 4A8OA 2BA9A 4RKUC 1IJEB 2HFNA 3GYNA 1MMDA 2E1MC 3GG1A 2IC3B 2JH3A 4ZK7M 4IOCQ 4OI4A 4CQ1A