3BO2A

A relaxed active site following exon ligation by a group i intron
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein/rna
molecule keywords Group I intron P9
publication title A relaxed active site after exon ligation by the group I intron
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bo2A00
2VOOA 1HL6A 2M2BA 2DNLA 1VBZA 1CVJA 2M9KA 2DK2A 1U1PA 1X5OA 2MQNA 2E5HA 2XB2D 1U1OA 3TP2A 5GMKa 1N54B 2DHSA 3N9UC 3P3DA 3CD6S 2M8HA 1UAWA 5LSOA 2EVZA 2JRSA 3TO8A 5ITHA 3VAJA 3P49B 4W92B 2RS8A 4WFBQ 2X1BA 3NMRA 3CXCR 2SXLA 4QQBA 2DNQA 2DNGA 3VAGA 1M5PC 1FJEB 3PIOQ 1WI6A 3G9CA 1WG4A 2M0GB 1WHWA 3R1HA 2VOPA 2MXYA 2DNMA 2JX2A 2LA4A 3CC4S 3CULA 4F26A 1NO8A 2CQBA 3UD4P 3CCMS 1Q81T 1WHVA 3OW2R 3J7YU 1UFWA 3CCUS 4WF9Q 2MQQA 3JB9k 2ADCA 5LSLA 1VQLS 2AYBA 1WTBA 4IOCQ 2G0CA 4ZKAA 1WEXA 1U1KA 3SXLA 1X4CA 2DGTA 1YTYA 1FNXH 1M5OC 3S8SA 1PO6A 1ZZFA 1KOOA 1VBYA 1OPIA 1WHYA 2OJ3A 1K9MT 3TYTA 2EK1A 3S7RA 3CMAS 3U1MA 4IUFA 1SJQA 1X4DA 4CQ1A 4IOAQ 3CMES 1H6KX 1WEZA 2HVZA 1X4GA 1WWHA 5HO4A 2MYFA 2DHGA 2B0GA 1HA1A 3Q2TC 3CCQS 5GAHU 3CUNA 1Q82T 2LKZA 2ERRA 4BS2A 2CPFA 2LEBA 2FC9A 1P1TA 3NNAA 2E5JA 1X5SA 2G1DA 5DDPC 2X1GA 3MXHP 2DNKA 3H2VE 1QVFR 4M5DB 2DITA 2HYIB 1WF0A 2X1AA 1VC6A 3UE2A 2MZ1A 1M90T 1WF1A 2KHCA 2DNZA 2MQOA 1ZH5A 5GAGU 5CXTA 4EGLA 3BO2A 2HGMA 2F3JA 5DM7Q 3UCGA 2CQ1A 2HZCA 3CCSS 2LYVA 2ZJRQ 1NJIT 2OSRA 3LQVA 1JJHA 2HGLA 4IO9Q 1VQ5S 1JJ4A 2MQMA 1X4HA 2DGSA 4LIRA 1K8AT 2FY1A 3B4MA 1VQ6S 4CH1A 2KM8B 2CQ4A 5DM6Q 1U6FA 3IRWP 3G71S 3D2WA 2DH9A 4OZ1A 2KVIA 2CQCA 5BJRA 3SMZA 3THPA 2DO4A 2U1AA 1X4AA 1X5PA 1N8RT 1AUDA 5GADU 3G96A 4F25A 3MUMP 3G8SA 3CCRS 1FJCA 2DNHA 4QPTA 3HI9A 4YB1P 2CQHA 2RQCA 5DDRC 2YH1A 3MD1A 1YJ9S 4PKDB 3BO4A 2CPJA 5GVQA 2WBRA 1VC5A 4PR6A 4TLQA 4OZ0A 2KXNB 2CPXA 2DIUA 4PRFA 2LMIA 5LJ5Y 3V4MA 1N88A 2CPIA 2KRBA 1UW4A 2JWNA 2L9WA 3ULHA 2CPYA 5MLCV 4CH0S 5DDOC 2KH9A 3EGZA 3S01A 2LEAA 2GO9A 4C0OC 3DXBA 2CQDA 2XNQA 2LECA 3PIPQ 2F9DA 2DNRA 2OSQA 2DIVA 2GHPA 1PGZA 4WCEQ 2ZJPQ 1VQ8S 2RU3A 1WG5A 1FJ7A 3SDEA 1NU4A 2D9PA 2Q79A 1M1KT 3IWNC 4W90B 1H2TZ 3NS6A 1P27B 3G6ES 1QM9A 1YJNS 2DISA 3CC2S 2I2YA 1Q7YT 1FXLA 3VAKA 2X1FA 2RT3A 5LXYA 2DHXA 5JVGQ 2QA4S 2CPEA 4UQTA 1OWXA 2E44A 3Q2SC 2G4BA 4TU8A 3RW7A 1VQMS 1M5KC 1XN9A 2L08A 5LXRA 5CA5A 2F9JA 4F02A 3MUVP 1S79A 4Z2XA 2D3OR 2HGNA 2NZ4A 1R8HA 1RK8A 4UY8T 1X5TA 2J0QD 4WFAQ 1YIJS 3UCZP 2AYEA 3UWTA 5DDQC 4RU2A 4QU6A 4A8XA 2MY7A 2PEHA 1YI2S 2VODA 1SJ3P 2KU7A 2MZRA 2CQ0A 1ZZNA 3R1LA 3CCVS 5EN1A 3MDFA 1G2EA 2MZSA 4YOEA 1DHMA 2MHNA 2DB1A 2RNEA 3CPWR 1W2BR 3G4SS 1VBXA 4WFNQ 1U1NA 1YWXA 2QFJA 2MY8A 3FEYB 3NNCA 1VQKS 1KQSR 2CPHA 2RRAA 2CQPA 1A7GE 5GAEU 2OIHA 3THTA 3UCUP 2AYGA 2V94A 1X4BA 2RUGA 2DGOA 1BY9A 2BZ2A 2YWKA 2VONA 3US5A 3VAFA 2MKHA 2L41A 3R27A 2RVJA 2RQ4A 2KXFA 2MKJA 3SDEB 3NNHA 3B4DA 2MJUA 2D9OA 5CYJA 1YHQS 3J7ZT 4C4WA 1F9FA 5HL7Q 2M8DB 1Q86T 1UP1A 1VQ4S 2KRRA 5D78A 2CQIA 2UP1A 1YJWS 2RS2A 1R8PA 3MUTP 2CJKA 1L3KA 2K8GA 1VQ7S 1KOHA 2FC8A 2ADBA 3P6YC 2MZTA 2PE8A 3P5TL 4TU7A 4FXWA 5IQQA 1VQPS 2I38A 1S72S 2MKCA 2K3KA 4QU7A 2AYMA 2M88A 4U67Q 1HD0A 2DHAA 1SJFA 1YITS 3U1LA 4ED5A 2M70A 2XS7A 1SXLA 3MURP 3G8TA 1IQTA 5FJ4A 3RW6A 1QVGR 1OIAA 1FHTA 3VALA 4YUDA 3FEXB 3UD3P 5D77A 2FPHX 2KM8C 2LXUA 1N52B 1U2FA 1D8ZA 1D9AA 3VF0B 4FXVA 2DNYA 2KFYA 3LPYA 2MGZA 2MKKA 2YH0A 2QEXS 1B7FA 1WG1A 1X4FA 2DH8A 2XSFA 3CCLS 5IM0A 3K0JA 3CF5Q 1FO1A 2U2FA 1HD1A 3ZZZA 5JVHQ 2NLWA 2XS2A 1U1MA 4V19X 1URNA 5H1SV 2DH7A 3I55S 1U1RA 2XNRA 5LJ3Y 2KN4A 2E5GA 2EK6A 3VAMA 1SJRA 2MQLA 1VC0A 1VQNS 2MZJA 4Y0FA 3MD3A 3CCES 1X0FA 2A3JA 1FT8A 1JMTA 1U1QA 1H2UX 2RRBA 2YTCA 4ERDA 1VQ9S 2N3LA 2MJNA 2CQ2A 2MMYA 3BEGB 2YKAA 1M5VC 2MSSA 2CQGA 3MOJB 1U1LA 3VAIA 1A9NB 1DBDA 1WEYA 3CC7S 2N3OA 1K73T 2BOPA 2KG0A 5IFMA 2MZQA 3BO3A 3HHNB 3NS5A 1VQOS 2E5IA 3L3CA 2MKIA 1WF2A 2LXIA 4C7QA 4J5OA 1X4EA 3MI7X 4LJMA 1WI8A 2DGXA 2FHOB 3EX7B 2DNOA 2DO0A 2LA6A 3DLLQ 4WIIA 1O0PA 2KG1A 2ZJQQ 1KD1T 2OTJS 2LCWA 2CQ3A 1WELA 2CPZA 3BS9A 4Y00A 4WKRA 3CTRA 2J0SD 2CPDA 2MB0B 2MPUA 2XS5A 2DNNA 1U6BA 3VAHA 2JVOA 2KI2A 2M7SA 3ZZYA 3H2UB 3I56S 2DNPA 2M52A 2DGUA 2N7CA 2JVRA 4CIOA 2KXHA 1DZ5A 2MGZB 1KC8T 4TU9A 2MKSA 1RKJA 1H2VZ 2DGVA 3EGNA 2MQPA 4P6QA 3CCJS 2J8AA 2KYXA 5IM0B 2N82B 1DRZA 2O3DA 2MSTA 2DGWA 2OTLS 4LMZA 2DGQA 1OO0B 1WHXA 2KT5A 2LQ5A 1SJ4P 5DETA 2J76E 2AD9A 2M4MA 1JJ2R 3S6EA
chains in the Genus database with same CATH superfamily
4HHHA 1JX4A 1N5TA 1BD6A 1YZ7A 1U0HB 3AD9C 3PXGa 2DHSA 3N9UC 1N32J 1N5YB 5C7PA 4P7VA 2GCFA 1ZAWA 1T05A 1S57A 4XDCA 3U7JA 4L6V3 3Q22A 1Q53A 2B8PA 1B0TA 3A8IA 3BGRA 2VOPA 3OR2A 3QATA 2HHUA 3CC4S 3BYRA 5I3UA 2VASA 3V6KA 1KQGB 2GMJA 1IJFB 3ILIA 1Q81T 3DRRB 3HT3A 5A8WA 1HQEB 2EXUA 4OI1A 2B4OA 2P8IA 4BWJA 4HKQA 2IRUA 2EC0A 1M1GA 2R7WA 2XBPA 1T9YA 5J1NA 1OPIA 1Q5YA 4C2MA 4FS2A 3CMAS 4C3KA 2YWWA 9RUBA 4PXDA 3EDRB 1TAQA 1RWPB 4I1TA 1WWHA 1HA1A 1HHSA 5BXIA 4YY3F 2Z2ZA 5IT9U 2EW9A 1X5SA 3D5MA 2YXLA 1VLYA 4LVOP 2RJZA 2MZ1A 1PAUB 2OO4A 4DUZJ 5CD4A 3UCGA 2HGLA 4U7CA 2VH7A 1OSDA 1E6YB 4LQ3A 1CPZA 2CA9A 3MM9B 2XMVA 3W8GA 5ADZA 1JLQB 3DLGA 1HHQA 2OHDA 2DO4A 2BYCA 3G96A 1S1WB 1J5OB 1IKWA 2AW0A 3MD1A 3T6JA 4X4TA 1CC8A 4CLSA 5F41A 4DUYF 1LWCA 3D0HE 1N88A 3NCQA 3LP2A 2BMBA 4HDHA 3QFHA 3BYPA 2ZM6J 1V9OA 2LECA 4AXIA 1TELA 3QT8A 3KK3B 2ZJPQ 4GKJJ 4DR7J 4O3SA 3HHLB 2IAJA 3NS6A 4ILLA 2NPIA 1S1TA 3EE3A 3D3BJ 2AT1B 4UQTA 2DR6A 2B6AA 1VQMS 2C2DA 1SH0A 3ZO7A 3DDKA 2R2RA 1YQHA 4G3IA 1FRXA 4OYXA 1NMEB 2J9EA 1XR6A 4LBPA 4A8XA 4LFAF 4DR4J 3P96A 3RBXA 2DB1A 2B51A 5EX3A 3K57A 3PR4A 4I68A 4WPAA 3NGUA 3E51A 3C66A 3I0RB 2HFUA 4ELTA 2BZ2A 3RU0A 4OJHA 5AXKA 1NKCA 2J9DE 3AXKA 2YPZA 4YS2A 2GS8A 2OEMA 3DGVA 2RB7A 3VVUA 1NK5A 1REVA 3GR0A 5K8PA 4OYOA 4IRDA 1S72S 1RHJB 1FNMA 2M88A 1FX4A 3VWSA 2E7WA 2IC3B 2HQGA 4DR3F 3TAMB 3MEGB 2BEFA 2ZC3A 4DEZA 3BH7B 3PX0A 1JLCB 1P1LA 1WDDA 5KFTA 2HRTA 4NMXA 4X4PA 2KJWA 2DYAA 3L09A 3NBPB 4ZPWR 3LPYA 3OLBA 3OXGA 3CCLS 3K0JA 1FD8A 1TVRA 2C3OA 1UVNA 2V4JA 3W66A 1C0TA 3RBDA 4JI1J 3NLCA 2XHWA 3CGIA 4UUWA 4TQRA 4ALZA 3TI0A 3H59A 2W1BA 3D0IE 5KFMA 2MJNA 1FKOB 1M5VC 1XC9A 1S0OA 1FEEA 1LW2B 2RE1A 2UXDF 5KFBA 2FDNA 1O51A 1WF2A 2QYGA 2J8SA 4LUBA 3K5OA 2DO0A 2P6SA 5I3PA 2HZVA 3LANA 3IP0A 2F4VJ 1B0VA 3MECB 4WE1A 5KFIA 3CIMA 2NCKL 3KFWX 5AE1A 4QYZJ 4OHYA 2QRRA 3P5BP 3M7VA 4ZDNA 3MAHA 4FZVA 1BWVA 1FRMA 5IM0B 1XK8A 3M30B 2J7UA 3PX4A 5CH7B 2ASLA 3V81A 4D3GA 3OL7A 2F8HA 4DG1A 3EXCX 1U09A 1PSDA 5JXSA 1RHMB 1XMOF 4DV7J 1NUEA 5IOLA 4RBTA 2H48B 1LEOA 1EKRA 4UZCA 2HNYA 4MKYA 1FXDA 2E5HA 5I42A 3DLBA 1NDLA 4ZPBA 5GMKa 1CC7A 3CO0P 5ITHA 3P49B 3V2UC 4W92B 1IR2A 4NYZA 5IT4A 1M5PC 1ZM4A 1WHWA 1U7LA 4NEYA 1Z2LA 3TQEA 2VQFF 2IYIA 1NO8A 3DFEA 2RSQA 2YNFA 2E9TA 2A10A 4M1KA 1KTQA 1UVLA 3BB5A 3W63A 3UDVA 2LQBA 1JWWA 1F1BB 3CJ2A 4BBYA 3TYTA 4LSLA 1OY8A 2EK1A 4IUFA 1T02A 1NK4A 1H6KX 5HSPA 2ASDA 1E6VB 1L3VA 1H73A 4EBEA 3MMBB 3GFHA 4N8NA 2UXBJ 1YDLA 2CPFA 2XY5A 4XPCA 4WP3A 1S48A 1TV6B 1RT6A 2JFDA 4EK2A 1MSWD 2MQOA 2W9CB 2DTJA 4IDKB 1HNVB 3C46A 3QGPA 3MM7A 1UVJA 4H4OB 1J2VA 1GT8A 3V5RA 2KM8B 2D3UA 3MM6B 2H4WB 1IR0A 1RT3B 1JLAB 3M8SA 3SMZA 3AXMA 4ED6A 1RTIA 4DR1F 1DARA 4ZP8A 1FJCA 3G87A 5DG8A 2R9LA 3JSRA 2DR8A 3VZHA 4PKDB 2B4UA 3OUYB 2ASYA 3C16B 3QGIA 3NEKA 3OFGA 4F4XA 2KZMA 2L9WA 2ZH7A 5D0HA 4USUA 2HNZB 4ZVPB 2GGPB 4G1QB 4P71A 3SCIE 3FBFA 4CM0A 2I2YA 2W4DA 4NLQA 2Q6BA 4TU8A 3RW7A 1S9FA 5HVFA 3IXQA 3MUVP 4EMDA 2DHHA 2J0QD 2NZCA 4U6PA 4DWIA 3MM8B 1SCJB 1BUXA 2WZ1A 4Q5VA 4Q45A 5EWGA 1ZZNA 3KLGB 3ETMA 2E5LJ 2BV3A 3HVWA 2J7WA 3D6FB 3H90A 1U47A 1S6OA 2FLNA 4OYWA 4K4TA 3KMQA 1W2BR 4WFNQ 3W3SA 2JFKA 2VG5A 2HMIA 4ANDA 4Q0BB 4NLSA 3O6QA 2B4VA 2A18A 3HFKA 4C48A 3JSBA 4CNYA 2YQ3A 4FDFA 2ILZA 4WIQA 5IV3A 1N0VC 2KB2A 1M0SA 2UP1A 1A6LA 2WW8A 2BKPA 2OPPA 4P7TA 4N56A 2BE7D 3I5BA 3R5GA 4E98A 3AAWB 3LW5C 2WBMA 1TK5A 4NYPA 3MAQA 2DHAA 1LFPA 3VQTA 3QSIA 1RHUB 2ZE2A 4Y2MA 2H51B 3V6DA 4Y2AA 3W61A 2BXJA 1BQNB 4J9OA 1N52B 5E3QA 2ZH6A 3AB4B 3D3CJ 2QLFB 1N5SA 4LF6F 2HS3A 1S76D 3W9HA 2PO4A 3DYAB 1MU2A 1U1MA 5KG5A 4OI4A 1URNA 1I3OB 1ROFA 2HHHJ 1SJRA 1VC0A 1RAAB 4ZHRB 3T1HJ 5LMNF 3PV8A 4QOTA 4F04B 1G7CB 3IC1A 1U0HA 2EG1A 4K4YA 1PKUA 4DFMA 1BLUA 2WOMB 1L3UA 1N5YA 3MCMA 2ZBPA 2W01A 2AZ1A 2V2KA 2FVRA 3BQ1A 4ZA1A 3IR6B 3DLJA 5KFJA 1GX5A 5FLXU 1CJVB 3DRRA 4CIOA 1NKEA 1HQEA 1DLOA 2R8GA 1ZPVA 4QYRA 5KG7A 3UI3A 2C3MA 1X0PA 1RHKB 1KLMA 3LP0B 2DGWA 2CJYB 3M2UA 2GIQA 4O0IA 1OO0B 2WONB 3AHPA 1JJ2R 3HT0A 2R7UA 2HQIA 2M9KA 3ET6B 4TN2A 4Z37A 2Z58B 1YJVA 2UUCF 1R6VA 3GSIA 2Y3YA 1RP5A 2MDAA 4ATNA 3WX4A 3HX9A 4ES1A 3TO8A 3NWRA 2RS8A 5C24B 3CXCR 2FLOA 1RWOB 2DNQA 1CEZA 2XC9A 3SCJE 1E6YA 3R1HA 4TXSA 3MM9A 3CULA 3FQLA 5A2QY 2XO6A 1UL3A 1JLQA 1FVSA 1WHVA 2NXCA 5B09A 1FE4A 1K1SA 3JB9k 3Q24A 1R43A 1VQLS 1S1WA 3BN7A 1J5OA 1U6ZA 3IWXA 1TMJA 1WEXA 3QO9B 3D54A 1N33J 4PQAA 1YTYA 1XERA 1OYDA 1XNQF 4X64J 1ZZFA 1ACMB 4NYOA 3Q8PB 4ICLB 4Y2CA 1M1HA 1RT7B 4X66J 1CJKB 3D68A 1GNKA 3JAMY 1T9UA 4K0KF 3AH6A 3BBBA 3KK3A 1F5BA 1PC5A 1YJRA 3HHLA 3CDBA 4M5LA 1RLDA 1Q0NA 3LQVA 1JJHA 1QTMA 3GPAA 4DQPA 4IRKA 3M8PB 2NXUA 4ZP9A 3JTOA 3D2WA 4J9RA 4A8MP 4NRUA 4KPYA 8AT1B 4F4ZA 1TUVA 3B82A 2AP6A 4DOZA 4OZ2A 2HFOA 1TL1A 1NLKL 3AT1B 1F9HA 2AJ4A 2KYZA 1FKPB 2JEFA 5DDOC 4LF8J 1MROB 2LEAA 3ISZA 2ZH3A 4U9RA 3I0RA 3PRBA 4LT6A 1C1BB 5FIIA 5EHHA 2O1PA 1S9GB 2HQ3A 2D9PA 4DLGA 5KFCA 2ZVIA 1UWAA 4YMEA 2RT3A 1FE0A 2DHXA 2D3O1 3IGNA 3NXZA 4OZNA 1G6BA 4CT8A 2UXCF 1Y5LB 4DU8A 5FDLB 4RU2A 5CHCB 2IC3A 1G3OA 3TAMA 2CQ0A 2EC2A 5DG9A 2A6MA 3JXOA 2MZSA 1DHMA 3ADAC 3CSKA 3NS7B 1JLCA 4LVNP 2EFQA 1N32F 2VG6A 3NBPA 4NPOA 4X62J 1JLFB 5LT5A 5T14A 2IJFA 1VI7A 3I82A 1T95A 2HWIA 4F0KA 1XBWA 2DXDA 4MK8A 2BRKA 2RVJA 4AXJA 2DY9A 5EWFA 4B9NA 3SSSA 3BQ2A 4J9VA 2B9WA 4UT4A 1FKOA 2FJDB 1FWLA 1LW2A 5LMUF 4LF9J 3R7NB 2OKQA 1RAIB 2FLPA 2XMJA 4ZCKA 2AGPA 2DXFA 5AXMA 3G6VA 4OMFG 2BM1A 3MECA 3ZC4A 1TL3B 2XGQA 4H4KC 2LXUA 2NR0A 3DMJB 4IQXA 4QWAA 2KFYA 4DUZF 4AQYJ 2WSEC 1WG1A 2GX8A 2B7BB 2UUAJ 4S0MA 2HAIA 5IM0A 1Q8LA 4RPFA 4EUVA 3LGHA 3M30A 4X4SA 1TTHB 1FTCA 3H8YA 4DQQA 1JQGA 4DLEA 1CQNA 2MZJA 4KTQA 4R0EA 1UVIA 3R7SB 3MOJB 5K14B 2CNKB 2YVSA 4DFJA 2KG0A 4E2FB 5AJ3F 4QYZK 2IDLA 2F4FA 3HHLD 4ZPAA 2AJQA 2R42A 3DLLQ 1GMWA 2CQ3A 1I94F 1FDNA 2MB0B 3D6TB 2JVOA 2FHKA 2R2SA 2X51A 3GSDA 1T3NA 2R7QA 5LL6d 2I1RA 1RBLA 4GKJF 1KC8T 4N7TA 4GO5X 4ELUA 1RKJA 1H2VZ 3MR3A 2D74B 5CZXA 1H3DA 1RAJA 3D9BA 3FKBA 5BR8J 4NA2A 4RW8B 2WVEA 2VJUA 5KTQA 4WBFA 4WWSA 3CCTA 1E6VA 2DNLA 3MMBA 5AXLA 1HW9A 2ZDOA 3KJNB 1X5OA 4XK8C 3OTEA 3RB6A 2EBGA 4A4JA 1ZBTA 1TV6A 1F0XA 2ZBRA 4LF5J 2W9CA 4LFCJ 2X1BA 4IDKA 2QSFA 1HNVA 1FWPA 1I1GA 2GMHA 4H4OA 1TKTB 5HBMB 1IBKJ 2DNMA 2WSCC 4OX7A 1TQLA 4JV5F 2IM3A 1LXNA 5J2MB 3RBEA 3MM6A 3CCMS 1RT3A 1JLAA 2J6SA 3M32B 2HRUA 1KFSA 3I87A 4GVLA 2YKPA 3CD7A 3M9NB 5HVHA 1KVIA 1XTZA 2H5IB 4NI2B 4W98A 2WHOA 3OUYA 1M5OC 4WXWA 3JQKA 1WHYA 3C16A 3GJSB 5EGYA 1SJQA 1HIYA 2W7AA 1WKKA 3A13A 2ERRA 4DV3J 3HXMA 3SYZA 2C2NA 4KSEB 3H2VE 4DCJB 5SUHA 2HNZA 1VC6A 2GGPA 2E66A 1ZH5A 4KHPJ 4G1QA 3CO9A 2H3EB 4YB5A 4C0HA 5LSRA 2FJWA 3CJTA 5F8IA 3K5MA 2X3DA 4OI2A 3OFEA 3MM8A 1RT2B 4ZVUB 4F25A 1QSLA 4F67A 1MN9A 3HI9A 2BDPA 3BV8A 3KLGA 1GQEA 4QIFA 4CLZA 3PHEA 5IWAJ 1QE1B 4P73A 4NLPA 4DV2F 2KZZA 3C6UB 3T5LA 4QW8A 1FRKA 1YBAA 2ZITA 1YX2A 4BWMA 2JWNA 4UOGA 2ALZA 4Q0BA 5KG2A 2F9DA 4LRAA 3DOMB 2E1AA 4W4MA 4RZRA 2N7YA 1QM9A 1FDBA 4B9VA 3CC2S 4OX9J 4J37A 2X1FA 2HSEB 1C1CB 3CVKA 5JVGQ 2FZKB 2CPEA 2HNDB 5HQLA 2IA0A 2VIHA 4X4NA 2PA3A 1FFSB 4PXEA 5HN0A 5B0DA 4Z2XA 2WB1D 2OD4A 2NZ4A 4UY8T 2C2ZB 3DOLB 3ENAA 1QAXA 1FDAA 1RJJA 1HQUB 1GMWD 5F8JA 4M5MA 1SL2A 1L3SA 1BQNA 1RABB 4TYAA 1FJGF 3BQ0A 3N4WA 2E9RX 3OTOF 1NSQA 4CLTA 3I5CA 2LVWA 2RRAA 4O3QA 2WB4A 2AYGA 3F73A 4Y2KA 2VONA 1PG5B 4DUTA 2WVDA 4O0NA 3SDEB 3EGVA 3SQOP 4OYIA 4ZHRA 2V34A 3UDCA 3QIPB 5GMDA 3FSIA 1UP1A 3BREA 1OPZA 3PJWA 2D1CA 1YJWS 5DRKA 1VQ7S 5K9FA 3HD1A 3T5HA 3GV8B 2WOMA 4UOFA 2GO8A 1SKUB 4JI6F 4QU7A 1SH2A 5ETTA 2AYMA 3NCPA 4YR3A 1GXTA 2DXEA 3QZ7A 3DXSX 1X60A 4BC7A 3EYZA 2RDJA 4JI2J 4N76A 2VFSA 4P75A 1ZAVA 2XYGB 3PYFA 2GIFA 1CJVA 3RYLA 3CJ4A 2ZZNA 1W25A 4YQWA 1X4FA 4KE5A 5GAEI 4FF2A 2RDDA 3CF5Q 1N6QB 1AFIA 4M63A 2U2FA 5JVHQ 3BH6B 3ICLA 1CJTB 2H54B 2GQQA 1NPKA 2WONA 5U47A 3GV7B 4NZ7A 1JMTA 2P9CA 3NGKA 2MMYA 3ET6A 4B3MJ 1UPMB 2OEKA 3V6JA 1AT1B 5A8KB 3OFFA 3TJ8A 2GMLA 2AV5A 4ZN3A 3E3XA 2LLZA 1Q8KA 3D6MB 2KT3A 4IG0B 2QC3A 2C42A 5C24A 1RBOB 1RQ0A 1KONA 2HW3A 2B3TB 5KFWA 1S1XB 1CSJA 3BS9A 3MMJA 1RI7A 1S6PB 2B9YA 2ZDPA 2N7CA 5IC6B 3O8WA 2NSBA 3T5KA 3UVJB 3QO9A 4OLOA 5KFZA 1FK9B 2HBZB 4ZLPA 1D1UA 2FZCB 4ICLA 2HAFA 1S99A 2HHWA 1Y9OA 2RDIA 1HL6A 2H4YB 1RT7A 1CJKA 2QL9B 4G1IA 1U1PA 3N01A 3TAPA 3TP2A 1HKAA 1N54B 4GO7X 2F5GA 2EVZA 4ILRA 4UOHA 2WRMA 1IBLJ 1IBMJ 2ATLA 1RTZA 5CCLA 4ED1A 3PTWA 3TVZA 3VAGA 2HVHA 1V3RA 4I64A 4NX9A 2JLGA 5KG0A 1R31A 5LOQA 1OQ3A 1EX8A 3M8PA 2XQCA 3I0SB 4CWBA 3VTIA 2BANB 3RGIA 4LBHA 4JYAJ 3MHYA 1G4CA 3I9V9 4GKKJ 4O4RA 3TVKA 4FPIA 3MEDB 4URSA 3FBBA 2HBRB 3J81j 1TZ0A 3BSOA 1NJXA 1HBUB 2XMWA 4KY3A 5J2NA 2HWTA 3U1MA 1XR5A 1FKPA 4MYTA 4BCAA 3RR7A 1REGX 1MROA 3W9JA 3F0NA 3QYYA 2I5JB 2HURA 4ZIWA 1QVFR 1JKHB 1S9GA 1MWYA 1HWJA 4DR6F 3HMJG 4M8LA 3I31A 2F40A 4ZS6A 3H40A 1DQ8A 4WP8A 4U8YA 3EGWB 3IRWP 3G71S 2DH9A 2HHHF 2DJWA 5FDLA 3OV7A 3GIRA 4CZCA 1KR4A 3Q8VA 1U49A 1YJ9S 2YX1A 4C9DA 3HZEA 4DL2A 1NEEA 1IVZA 5LJ5Y 4WK1A 4YY3J 4JI3F 4CH0S 5F9NA 1JLFA 4ECVA 1UJ4A 3RRHA 3HCXA 1V5VA 1YRXA 1T9VA 3DHWC 3R6GB 1WG5A 3BSNA 1FJ7A 3AY0A 3VR1A 1VJWA 3VCDA 4B9UA 1H2TZ 2YX4A 5C2CA 2VQEF 1ZYQA 5JMNA 1XQIA 4DHVA 2KDOA 2FGCA 2L08A 3J7Z5 2PDAA 4PYDA 5DGAA 2D3OR 5KT5A 3ISND 1S59A 2V6AA 2DT9A 2JH3A 2NS1B 2R8KA 2VODA 4JV1A 4DUYJ 1TL3A 3JAMU 3QFWA 3DMJA 3BKUA 4DS5A 2XMMA 4PAAA 2QFJA 4KPCA 1SL1A 1VQKS 1VIXA 3WBZA 1OSCA 3FSXA 1BY9A 1C4CA 2L41A 1S77D 1VDHA 1J27A 2YKOA 1MG7A 3M8ZA 3WIVA 1D8YA 2E29A 2A6OA 5AE2A 4K5SA 3IR5B 4J91A 1Z1ZA 5ETOA 2OUGA 1R8PA 4YDXA 5K14A 4DL0C 4CO2A 3AD8C 4FXWA 1Y0HA 2RQKA 5B0EA 3JTNA 3W5XA 3UO0A 4I2QB 2BE9B 2KVQE 1QD1A 4X66F 4ZVEA 1QVGR 2UUBJ 3OVBA 3IBFB 2KL8A 4DPXA 3RAQA 5C5JA 3FRZA 2Z4PA 3GQCA 2IRYA 2YNHB 4O3OA 5RUBA 2DH8A 3BPDA 2BQ3A 4HT7A 4NZ0A 2BM0A 4V19X 4RW8A 3QNWB 4PWUA 3CCES 1H2UX 3T19A 3DLKA 3BEGB 1SV5B 4TYBA 4AUKA 2N3OA 4MIBA 1NB2A 2RKIB 1K44A 1Q78A 4ELVA 2C1EB 1X4EA 4DR3J 3C14B 5C25B 2ACMA 1EKSA 3KHRA 2GJFA 1FRJA 1TKTA 5HBMA 4GC6A 3D4JA 5J2MA 3HD2A 3M32A 1SVDA 3HSGA 2DGVA 2MQPA 2N82B 3EM1A 3RB4A 4U95A 2LDIA 4OYBA 3HF5A 2AX1A 3W2WB 2DGQA 2DR5A 3MTKA 2IHR1 3BN4A 3CMQA 4MK9A 2CZVC 3JYTB 5KFUA 3AFGA 1G1XA 2ZKUA 2MQNA 2XB2D 4CO4A 3P3DA 1SKWA 2V4QA 2CNOB 2UV8G 3NGDA 3LA0A 3IRXB 3UN5A 4QQBA 1Y4ZB 4KKOB 4HI2A 2IM1A 1WORA 3KLIB 2YNGB 5HQMA 5B0BA 1DURA 2AJ2A 1HBMB 1C4AA 3JSMB 2UUTA 2HPUA 2VHGA 1RT2A 5L1IA 2YBVA 3SXLA 2QA4G 5D4OA 1QE1A 2Y1LB 1XMOJ 4KR0B 4CQ1A 3GJRB 5D4LA 1VHFA 2YPYA 3HHLC 3VVTA 4LF9F 2PFDA 1P1TA 2VBYA 3TZYA 3K59A 3HLUA 3PYDA 4OYPA 2DITA 1WF0A 3DOMA 4K4UA 2DRAA 2X7IA 1LWEB 3T1YF 3MR7A 1CG2A 4EGLA 3OPKA 1VQYA 1NJIT 1C1CA 1RA7A 2HNDA 2VQFJ 2H5JB 2CRLA 2DGSA 3MR2A 3PRDA 2XYHB 3BR9A 2NSCA 3DOLA 4NMLA 3KNGA 2HHPA 4X4OA 3QQCD 2NXNA 1HQUA 5H9EJ 2CQHA 2B6AB 5L38A 2XCPA 2CPJA 1MN7A 3UNGC 3B54A 1UW4A 2K1RB 1NSKL 3ULHA 4DPUA 4RW6B 2C2KB 1P8GA 4NXNJ 1PIEA 5G0RB 2QLJB 1WTFA 4MFBB 3AOBA 3SDEA 1NU4A 5D0EA 1RYRA 5IXUA 3IM9A 3N79A 3QIPA 5LXYA 4CT9A 3I32A 2W8KA 3R5CA 1OYEA 1VYAA 1JLGB 4Q2MA 4DR1J 4C8YA 4OV1A 4EYHB 2V9WA 1WACA 5GADI 4C3LA 1TU0B 3R7BB 3KK1B 3M8YA 2KU7A 2MZRA 5F8MA 3PO5A 2POKA 4ANEA 3SIPB 4YOEA 2NYIA 3A3OB 2RNEA 2LQ8A 4DS4A 3M1VB 2ZUGA 1TKZB 1YWXA 4LF5F 2CPHA 4DMZA 3MEKA 2NQPA 1ZA2B 2JLEA 3Q89A 3QPIA 1N6QA 2FVCA 4L3KA 2XO7A 3AA8A 1CJTA 1K1QA 2K2PA 3ZXWA 4USMA 4TY8B 2LFVA 1KQFB 1V3SA 1YHQS 4ZITA 4ZPDA 2VUGA 3MUTP 5A8KA 4PZVA 5CABA 2ADBA 4HDGA 2ZOFA 2CUYA 5IQQA 2I38A 4C8NA 2CG4A 2HVIA 4QR0A 4DF8A 4IG0A 4WFXA 1YITS 3N5FA 1S1XA 1B3TA 2X3GA 4AL5A 1RCXB 3M05A 1Y3KA 4HACB 2XEXA 2QA2A 2V8GA 4K5RA 4HR2A 3DI6B 2V68A 3JTPA 3MCNA 1GXLA 4IH6A 3E2EA 2VPZB 4CTAB 3UVJA 1FK9A 4HI1A 2XS2A 4NXMF 3I55S 1A0OB 2E7VA 4KGZB 2NXEA 1HI1A 5ETKA 4MIWA 4BC9A 2CQGA 1GFWB 2HK3A 4DG1B 1ICEB 1UFKA 5CCMA 5HMXA 5IFMA 2MZQA 4XAKA 2IMOA 2MKIA 2Z2LA 1RXOB 3CE8A 3DDIA 4J9NA 4DZDA 4PXBA 4R8UB 2CZ4A 2LCWA 1KHWA 2EFOA 2G1HA 3C3LA 5I42B 4C8MA 2MPUA 2ZBCA 3I0SA 1Z2ZA 2ZOMA 2BANA 4LF6J 3TUJC 3MEDA 3TVYA 5B0CA 2G0JA 4HHUA 4JI5F 4F3QA 1HBUA 3TJAA 2XLIA 1U02A 1HWIA 1BGXT 4JI4F 4NEZA 2OAUA 1NZ8A 4J7CA 1RSCA 2PD1A 1KWMA 4DV4F 2KJVA 1DQ9A 2PSZA 3FC9A 5A6PA 2R4FA 2AJFE 4EFAC 3T9NA 1JKHA 4AD6A 1UAWA 1SC6A 2UVUA 5ETLA 3X1LB 3HK2A 5KOWA 3KJVB 1TFWA 2JX2A 1RT6B 1DQAA 3FUYA 4LRDA 2M3DA 1I51B 4MK7A 2HFVA 3CD0A 4RUHA 1UJ6A 4J9UE 4HVZA 3MMAB 2XMUA 3KLFB 1S10A 2HHSA 4ZKAA 3A12A 4ZLNA 3KUGA 2DGTA 3ZTQA 2XWYA 1PO6A 2EBEA 3GCWP 2HVDA 3R97A 1JLBB 1T11A 2F65A 1RAGB 2ROEA 1S0NA 1Q82T 4RO0A 4AL6A 1NB7A 2WVBA 5DDPC 2X1GA 4M5DB 3R5JB 1UFLA 1SC1B 1WF1A 2DNZA 1RWVB 3BO2A 2VPXB 1WC0A 3KXDA 3OT9A 3FRYA 5FLXY 4LREA 1KNZA 2O01C 5DM6Q 2ZH1A 4IH5A 4OHWA 1FXRA 1RWWB 4DZ6A 1LWXA 1O8BA 2VA2A 1XNQJ 3R2CJ 4DFKA 4B3MF 2NXJA 4PR6A 3N0VA 2CKWA 2KRBA 2GVDA 4K0KJ 3S01A 4DV0F 4UTGA 4O3NA 5GAHI 5D4NA 5D3GB 1EZZB 1K47A 4K50A 2CAJA 2GHPA 1ZM9A 1EETB 3R8YA 2A2CA 1M1KT 3HKZD 3HULA 1RE1B 3G6ES 4KH0B 4NE9C 4HTIA 1YJNS 1RTDB 4OHVA 1JXVA 3ENWA 1S0MA 2G4BA 2G2OA 5DGBA 1S79A 2VDIA 4DXLA 2QTWA 5KG3A 3IS9B 3H20A 2VJVA 4I2QA 1SJ3P 3HVTB 3HDSA 4M5GA 4QIGA 2OEJA 1ZAXA 1GH8A 2RHSB 2YNHA 3FBEA 4F3MA 2B56A 5HANA 5GAEU 3V6DB 2DGOA 2GHWA 3Q8SB 2KXFA 1UEUA 1RT4A 4LRBA 5D78A 1SV5A 5KFFA 4GKKF 5EX0A 2UXCJ 1T7PA 4JI8F 2K8GA 2JEGA 3GV5B 1HW8A 2CWKA 1EB0A 4F0MA 2RKIA 4Z7YA 1RAHB 3QAUA 3C14A 5C25A 4KO0B 3E01B 1F3FA 2CJQA 3NCRA 3EVOA 4FYDA 5D77A 2IBKA 2YKQA 1H0HB 2YWHA 3W2VB 3DRPB 3Q0AA 1AFJA 2J0XA 3A4TA 3IO1A 3ZZZA 3W2WA 3M4XA 1QY7A 3QAEA 3R6LB 1DLOB 3ISNC 2V8PA 3JYTA 1CLFA 1P9QC 2YTCA 1OY6A 1VQ9S 4OL8A 4I2PB 1FF2A 2MSSA 1KLMB 2IYGA 2Q43A 3M2UB 4OQJA 5LMUJ 3BKFA 2LXIA 4QWBA 2HBQB 2FJVA 3IRXA 4KKOA 4ZK7M 1S6QB 3KLIA 2YNGA 2MHEA 1HNZF 1PC4A 2W2QP 2M7SA 3I56S 3TRGA 3MEEB 3HHDA 1HBMA 2DGUA 3JSMA 1VFJA 1NJYA 4TU9A 2DEJA 3W64A 1UVKA 5L46A 4DQIA 1CJUB 3N6NA 3LAKA 2FVPA 4MTPA 3TEGA 1WHXA 3KLHB 2QX0A 3PY8A 1CULB 3AD7C 2AD9A 3S6EA 3FSYA 1NK6A 3UFCX 1HFEL 3LALA 3MPUB 3PJXA 5AJ3J 3DLHA 2FLLA 1QUVA 3RTVA 1IJEB 2W4PA 1KSPA 1LWEA 4MKAA 4IFVB 1I94J 4MJKA 4NLWA 2J0WA 2J7KA 2GFFA 2FHJA 1WG4A 4DV1F 1NSPA 4AL7A 1MWQA 1RACB 4EYIB 3BBFA 4PQUB 1JXEA 3U1NA 1UFWA 1X9MA 1C0UB 1U1KA 2DRDA 1TKXB 1RT5B 3MCOA 3H5SA 1TMMA 4LR9A 2K1RA 1Y5IB 2W2PP 5F8LA 1TUGB 4RW6A 2LKZA 3UN3A 2UU9F 1NK9A 2AEFA 3TJ9A 1TL1B 5G0RA 1VR6A 4MFBA 2UUBF 1BQMB 3PEJA 2AHOB 2VV5A 1RUSA 5C2GA 2AGOA 1IWGA 2OSRA 4ZPTR 2Q1LA 4JV5J 1SKSA 2W25A 3DRSB 4CRJA 5H9EK 2V2QA 2FTRA 2N4DA 1VQ6S 2WW4A 1FRHA 5J2QB 1JLGA 3JS9A 2QIFA 4FPRA 4YEAA 4OZ1A 2KVIA 2PI4A 1LK7A 2MTLA 4JOUA 4KHRA 1WD6A 2VB6A 3KK1A 2HIYA 1HR0F 1R3NA 5E2QA 4YB1P 2EG2A 2W4CA 1RZMA 1PILA 2LMIA 4KYZA 5KG1A 4ZPVR 3M1VA 2VKRA 2CPYA 3TUIC 1TKZA 3GJQB 1LFWA 4LF7F 3I5AA 2OSQA 2IFXA 2GAGC 4TY8A 1U0SA 2RD5C 2VG6B 2FD2A 2DISA 1D9FA 2RRNA 1NK8A 4YP3A 1F3VA 3F56A 1LQ9A 5KT6A 1M5KC 5KFQA 1TL4A 5SZTA 4F02A 4L76A 2BQRA 3D1OA 1RK8A 3PKMA 2J9DA 3HJVA 1QLNA 3UWTA 1JNZB 3Q8RB 1IKVB 3CJQA 4DV2J 1S1UB 1MW7A 3CCVS 2R7RA 2YKMB 2GC8A 3EMTA 1R89A 2ZOGA 3J7A1 3D0GE 4HACA 2RILA 1R8AA 1NJWA 2G2ZA 3DI6A 4QR1A 3FEYB 3ITHB 4F7VA 4CTAA 4B17A 3MFHA 1TKDA 1URRA 2QLXA 2MKJA 2W24A 3TZZA 1TL7B 1PBUA 2XG8A 1D09B 1FNOA 1UW9A 4O4GB 3FQKA 4QPXA 2BACA 5GMEA 2OH2A 2PMHA 2CJAA 2FJAB 2O66A 4DR5J 4M5NA 4L72B 1L3KA 1GMUA 4ZCMA 1CBKA 2FC8A 4JI7J 1WSVA 2QLWA 3QLHB 4P9SA 1YK9A 2ATCB 1ZM3A 3D28A 1KEKA 1HBNB 3AQPA 4R8UA 4OJ1A 2FHJD 3Q8UA 1FJGJ 2BA9A 5KFAA 3W1YC 4PG4A 3VGSA 2LP4A 3OTOJ 2IY5B 1FI4A 2Q66A 2Q6CA 2UV8A 3MOZA 3EPGA 2YKNB 1IWAA 3BSCA 2I8EA 1HNWF 4WJBA 2BUNA 2Y0BB 3U02A 4DV5F 1FWKA 3VAMA 4WU3A 3PKYA 3O2IA 5J1EB 2A3JA 4ERDA 4OLPA 2I0XA 1YZ6A 2PN6A 1XNRF 3J7AN 1A9NB 1WEYA 4JI6J 1VLOA 3EXYA 2OELA 2BOPA 2DD8S 3TA1A 1M5SA 3EX7B 4DJBA 1Q4RA 5A8RB 4WIIA 1IKXB 4Y00A 3KJVA 1Q16B 5HMWA 1B70B 4NXNF 2AWZA 3RG6A 3MMAA 3M9OB 3GR1A 3KLFA 1KN6A 1QSSA 3WC0A 4ZJQA 4OZLA 1PJ7A 1JLBA 2ZEJA 5EUHA 1SC3B 2QLBB 1CVJA 2HRYA 4IRCA 2F1FA 2GQCA 2GA7A 2PMWA 4NLYA 1RU2A 3DGPB 4M5DA 4K59A 2CDQA 2SXLA 1XIQA 2FJBB 5KT4A 1DAXA 5A76A 1YG0A 1WKJA 1S6UA 5HI7A 5B0GA 2HBYB 3OXFA 4M95A 3CD5A 2OGUA 3HHKA 4LF1A 4RWXA 3DHXA 2DVIA 4DL3A 3DN9A 4N5SA 1K9MT 1GMVA 2Y8YA 3CMES 2CDRB 5HO4A 4AE5A 4YR2A 4DR2J 3PYGA 5EWEA 5F0UA 2E5JA 4A8FA 2G0IA 5D3GA 4QIEA 2NYHA 3KHGA 1M90T 1EETA 3HJFA 1FFWB 4I69A 5T7LB 3PX6A 4DSEA 2ZJRQ 1RTDA 2DPIA 1VK3A 2DEIA 3W7BA 1VQ5S 1VHIA 4OI0A 2IJNA 2ZH5A 3P45B 5KFOA 3BZQA 5D0RA 2G9OA 4WFYA 2AJ1A 5BJRA 1RBAA 3J7YI 1RWKB 2R2UA 1CS4A 3CEDA 5GADU 3IS9A 4UUXA 4DPTA 3IFEA 5DDRC 4OZJA 3HVTA 4HYKA 2Z2YB 3SCLE 1AXQA 2DY1A 3G86A 4TLQA 4PRFA 2V2ZA 1S12A 1SUQB 4QW9A 4XDDA 4J9QA 1AZSA 4ZOSA 3OL8A 4ECTA 1PGZA 1B64A 1FDDA 1IUJA 1VQ8S 3L4BC 4C98A 4DR6J 1VBKA 2HHQA 2ZH4A 2BVZA 3O3LA 3IWNC 3VAKA 2FJXA 4PPDA 5KFKA 3HSZA 3MR6A 2XI2A 3EPIA 2C2EA 5D4PA 5IS2A 4I6YA 3KYLA 5IT0A 2VU5A 1X5TA 1YIJS 1Q7LB 1NDCA 3A8KA 1OMSA 5HMZA 5HP1B 4KO0A 3E01A 2VG7B 2OI2A 3H7HB 5K8MA 2QMXA 3KG1A 4A8WA 2C3YA 2P2CB 4JI3J 2RAQA 3CDUA 1VBXA 1XMBA 3W2VA 6FD1A 2BX6A 4F2SA 3DRPA 1Q8IA 3KG4A 2HLTA 2CZ9A 2W2NP 3VAFA 1Y10A 3R27A 3OTCA 2OFHX 3NNHA 3HFVA 2MJUA 1TFYA 2VQEJ 2PA8D 3AA9A 4WU2A 4WZQA 1Q86T 2ZNYA 2QJ3A 1VQ4S 2CQIA 4I2PA 3NKYA 4ETZA 5F9LA 4JB8B 5E3PA 3B8HA 1NCLA 3C8YA 2CFXA 1QSYA 3HHEA 3PHTA 1HD0A 1IM6A 3T41A 2M70A 2VZ9A 3MURP 3LTOA 1S6QA 2ZD1B 3VALA 4YUDA 4FVMA 5IC4B 1RWUA 3FEXB 1LV5A 4QIWD 3KWMA 3MEEA 4RNFA 3MF5A 4OJ3A 5KFDA 2PMZD 3ZNUA 3P8BB 3SSQA 1HMVB 5BYQA 1N5VA 1CJUA 2BJ3A 3S1TA 3ELHA 1KTVA 3OVSA 3KLHA 1U1RA 1CULA 3NAHA 4H54A 1FKAF 1VQNS 1F6TA 4WYWA 4HTJA 1NDKA 4FS1A 2VFRA 4F4KA 4KV8B 1ZS6A 1RAFB 1DBDA 3NGTA 1LWFB 3H42A 1JLEB 2XULA 4URGA 2ZHOA 1SQFA 1D9DA 2QZ8A 4LJMA 4IFVA 1DTQB 4RW9B 3LGMA 4Y2IA 2M5YA 1H7WA 1WELA 5DS7A 3OSNA 3PO4A 2R7OA 5K8NA 2M52A 4PQUA 2UVVA 4LF4F 5HJXA 5KFHA 3KTQA 1C0UA 4NLUA 2BW7A 1DRZA 5AT1B 4Q43A 3GTYX 5J2PB 1TKXA 4LMZA 2L48A 4CH7A 1PCAA 1RT5A 4OYZA 2VOOA 2IBOA 2R7XA 4I7FB 1KRPA 1UZDA 2XY7A 3BM7A 4USWA 4LFBF 5J2NB 2Y8WA 3KJFB 1BQMA 2AEJA 2M8HA 5LSOA 4USIA 3TX8A 4M5KA 1NNDA 4ITSA 4TY9A 1WI6A 1VISA 5D8HB 3K5PA 3DRSA 2AGQA 4RWWA 2LA4A 1RA6A 5J2QA 2EFGA 1FRLA 2OPRB 3QRPA 4DPYA 3OW2R 1VCTA 4B9SA 1NKBA 3ZZOA 4ZJLA 1TP7A 3GLJA 1WTBA 2AMCB 3CCWA 3BSAA 1YJTA 1T9TA 2CXEA 3WIUA 3HKWA 5F8GA 1MMDA 2RQMA 3ZZTA 5HLFB 2HVZA 5F8NA 1LOUA 1ZTTA 3TR5A 4IKAA 4BLGA 5GAHU 1OJ4A 2LEBA 2G1DA 2PIIA 2DNKA 2HYIB 2EFNA 1V3ZA 5ETSA 3R5DA 5BYRA 3TUZC 3RB0A 4FYXB 2VDHA 3N5BA 4USJC 3HVAA 4N77A 1AUDA 3TA0A 4Q44A 1RYSA 1IKVA 3MGJA 1S1UA 4EZ9A 5DG7A 2YKMA 2HG4A 3R5BA 1M5HA 3FEZA 2DIUA 3V4MA 1XJWB 3OJSA 4LR7A 2HFSA 3ITHA 2BRLA 1T3OA 9ATCB 1VK8A 4NWBA 3WDOA 4ED7A 4PCQA 3T1YJ 4WCEQ 2RU3A 3K8WA 3DM2B 2Q79A 3LO3A 4W90B 1TL7A 4D3HA 3JQJA 3GFZA 3UW1A 2IA6A 2JL9A 4O4GA 4ECRA 3FK4A 2I6WA 1OWXA 4RX6A 1XN9A 3OD2A 2F9JA 4YR0A 3QLHA 2JSXA 5D15A 1QAYA 1HBNA 3KUEA 1VRTB 4LIWA 3LF0A 3MFIA 1H38A 4P2SA 1RHQB 4ED4A 1G2EA 3CNQP 3KLEB 3HSDA 3WX8A 4MT1A 3MPWA 4PEOA 4JV0A 5M2PA 2ZH2A 2YKNA 4X4VA 1A7GE 3H25A 5KFGA 2OIHA 1RWMB 4MMOA 3UCUP 2R8HA 3W62A 1X4BA 2YWKA 3US5A 2MKHA 4DX6A 2RQ4A 1FESA 3HPOA 3QJJA 4FN5A 3SI8A 5J1EA 3L7UA 1F9FA 1T94A 2ZNZA 2VPYB 2IIHA 2CJKA 1N56A 1WNEA 4NCGB 2PC6A 1VQPS 2VBZA 2V4RA 1F5AA 4KGMA 4NZ6A 3G6YA 4FNHA 2GV1A 3DLKB 5A8RA 4IOBA 4A8SA 2XS7A 3OXLA 1IKXA 4B02A 3THVA 2PFFB 1OIAA 5CYQB 3PFOA 3DRYA 1U2FA 4A48A 1P9YA 3DLEB 4PWDB 4URQU 4GC7A 1S1VB 4QWEA 4L3NA 1T03B 4EEYA 2JLFA 2D41A 3CDAA 2XLJA 1PJ6A 2B7CB 2XNRA 5LJ3Y 1PYSB 3GCXP 2OD6A 2OLWA 1FA0A 5KFLA 5DQIA 3LH2S 3I96A 1YLXA 4ED2A 1S9EB 4FF4A 2CNLB 2CQ2A 2CJXB 1S5ZA 2YKAA 1GEHA 1WKLA 3DGPA 5L1JA 3L3CA 2V0NA 1W2IA 2Z30B 1WI8A 3T1AA 2DGXA 1HQ2A 1WUUA 2LA6A 1O0PA 3HSJA 4J9KA 2J0SD 3QJLA 3V4IB 2V69A 1UZHA 2VFVA 2YNIB 1N36F 3ZZYA 3H2UB 3SV4A 3DOKA 3FJ2A 2DNPA 3MMCB 4WP9A 1JNRB 5DLFA 4C8KA 3LWLA 2UUWA 1VMBA 1ZA1B 2MGZB 3H0PA 4OV6A 2JEIA 2QYCA 4IG3B 2QG9B 4NXMJ 1HNIB 2E1MC 4F4YA 4ECYA 2G13A 2VD3A 2AX0A 1XWLA 3O5TB 3LGNA 3Q86A 1KS2A 1Q8BA 2VA3A 1XMQF 2XZDB 3T6BA 5E3RA 4ZN1A 3BPSP 4TVAB 5KFEA 1UTAA 4KBIA 5T7LA 4ER8A 3HM9A 5B0FA 5HK4A 2M0GB 3SV3A 4K4SA 7FD1A 4J9SA 2A2DA 4DF4A 4ZVOB 5D0GA 3V6HA 4X65F 2IVYA 4X2BA 2C2RA 3ENQA 3CCUS 4ILMA 2ADCA 2Z56B 4JI5J 1R6YA 1U25A 2AYBA 4IOCQ 3M6XA 4JI4J 3KMSA 3PFEA 1JXLA 4YDDB 1VBYA 4DR5F 3PEHA 4JI7F 4DV4J 1BMQB 2CVIA 1SUQA 3O1LA 2MYFA 1MLAA 2AQ4A 4XIUA 3I9ZA 2JJ4D 2YY3A 4BS2A 3NWGA 2BABA 3NGSA 3MAAB 4DL4A 4RUAA 2EEYA 4ID5B 2DRBA 1FVQA 3AJ1A 4E0DA 4WXOA 3WZ0A 4KFBB 3QZ8A 1QDUB 5DM7Q 2C3PA 1BQXA 2AJ0A 5DQHA 4NLXA 3R3TA 1K8AT 5J1PA 1U6FA 3RAXA 1HBOB 4WFZA 2CQCA 3THPA 2EFPA 4GVBB 2U1AA 2ZWOA 1F9EB 4JI0F 3PCOB 1J5EF 1U26A 4I6AA 2QL5B 4C11B 5HP1A 2VG7A 4LBIA 2YH1A 3QJPA 2FIUA 2QN6B 2B8QA 3LUYA 1SL0A 3GMGA 4P2XA 2KH9A 4C8OA 3J80U 2R7VA 4P72A 2QA1A 4G1PA 2DIVA 3FFIB 3C6TB 5GAGI 3OTBA 4NLVA 1RHRB 2Z2MA 4KGXB 3Q8YA 2QA4S 4ANCA 3MTJA 2B5JA 4RUCA 2DR7A 2IDEA 1B4SA 4C97A 5B08A 4NCAA 3PW7A 5B0AA 3EZ5A 3UCZP 4RW7B 4USVA 3M8RA 2F8EX 2JC0A 2ZD1A 4C6AA 2Z57B 5KFYA 1YSJA 1SJ1A 3OSPA 4U7UK 5I3QA 5KT7A 4DV0J 3G4SS 3CDEA 1OQ6A 1KQSR 1HMVA 2CQPA 3G82B 3IA0A 2RUGA 4CLYA 5ETQA 3ZFVA 1AROP 1QUPA 3BDEA 4CYUB 2D9OA 5CYJA 4C4WA 2XM3A 4I67A 1WOPA 2J5AA 4R25A 3G8QA 4CNZA 3H4DA 2W9AA 3M2VB 4KV8A 3D66A 1LWFA 1KVJA 2PE8A 1JLEA 4TU7A 4ZJOA 4DI6A 1U2RA 1FTRA 1DTQA 4RW9A 2GNKA 4U67Q 3G8TA 4I0WA 3QIDA 1NHVA 4DR2F 3KJQB 1KBRA 1LXJA 2H65B 2FPHX 2ABYA 1X8DA 1GK8A 1D9AA 2CWXA 2H9ZA 3TANA 2XSFA 4NOHA 3VGTA 4WKYA 5J2PA 3VGUA 2E5GA 4F4WA 4OI6A 1NZAA 4Y0FA 3OBIA 1HWKA 3I6PA 4I7FA 4JI8J 4CM2A 2IRXA 1QAJA 4KQZA 4EO6A 1WC5A 2E9ZA 1SIZA 1N0UA 3SFUA 2MQ8A 2AEMA 2LQ9A 1B99A 2ROPA 4JP8A 3J81U 4IO1A 3E8OA 4B9MA 3H98A 2OTJS 1C2PA 3CTRA 1K0VA 3CB4A 2BJ8A 2V50A 3VAHA 1Q1KA 4R5PB 2OPRA 3K8VA 3C15B 1VRUB 1EQMA 1YVFA 2KYXA 2E1CA 1VQSA 4ECXA 2ACYA 1RWNB 3NRBA 4YHHJ 3PYEA 1IR1A 2LQ5A 3TEHB 1JJCB 5E0OA 5HLFA 4NCBA 3H5YA 3W8PA 2RF2B 2M2BA 4I56A 1PYTA 3OQ2A 4IR9A 1HNXF 3PNIA 4F36A 5C42B 1T0TV 4LRCA 3TW0A 3VAJA 4ECWA 4WFBQ 1HNZJ 3R9LA 2CQBA 3UD4P 2O67A 3UDEA 3J7YU 4B3SF 2LU1A 3A8EA 2HHXA 2BR0A 2GJIA 2HEKA 4B3OB 2ZC4A 1R0AB 1X4CA 1SIWB 3TAQA 3QSYB 4O23A 1X4DA 3BJYA 4DBQA 2DHGA 2DCLA 5DO2A 5HQ8A 3MXHP 1B0PA 3BR8A 3SEOA 1OS5A 2X1AA 1S0VA 1BHNA 1NK0A 3DM2A 2KHCA 3FZ2A 2GVDB 4DV1J 2HZCA 4RLEA 5L39A 3GJTB 2BJ9A 1W26A 2XLKA 3N6MA 4M5HA 4N8OA 5IV4A 2Q3PA 1PYOB 2B4PA 1VRTA 1N8RT 3KHLA 2XY6A 4CDIA 3M8WA 4QPTA 1DFDA 2W9BB 4HH0A 3FBCA 3RBZA 4PG7A 4FKYA 4USKA 4B3TF 4N47A 3KLEA 1VRQC 1L3TA 4FYYB 2CPIA 4ZVGA 1GXUA 2UU9J 4CO3A 4FP9A 2P6TA 3W65A 3UPFA 4LRFA 4CLWA 3QRRA 2DNRA 1IKYB 3AQOA 3HFZB 2WK4A 1VOMA 3TQ1A 4JV2A 1VJQA 2WCXA 1FXLA 3BDPA 4PG5A 4QJVA 3L9ZA 4AYBD 5LXRA 3CJ5A 3F41A 5CA5A 4NCGA 1HHTP 2V5HG 3SCKE 2BKOA 2HGNA 1R8HA 1N34J 4WFAQ 4EO8A 1RT4B 4P74A 3CCZA 2JEJA 1HR0J 4B3RF 3EDQB 2MY7A 2QE5A 1NM2A 4OJGA 1RU1A 1FERA 1ZTWA 1F5CA 1R0BG 3POTB 2F7VA 5CYQA 3QT5A 3DLEA 2NREA 4PWDA 4LF7J 1U1NA 1RAOA 2R8JA 4P10A 1S1VA 1T03A 2OP5A 3GG0A 3CIZA 4NLDA 1ULRA 1AW0A 4UQGA 3J7ZT 3ZZUA 1S9EA 5HL7Q 2CYYA 2JZ5A 5JUMA 3NG8A 2XZWA 1X9WA 2QO3A 4F4AA 1RKIA 3P6YC 2GZOA 3K89A 4LQ9A 2EPIA 2HQFA 4QZVB 3OVAA 2VKZG 2OPQB 4R0JA 2CJ9A 1UEKA 1RCOB 2AU0A 5FJ4A 4ZMMA 3V4IA 1FHTA 3D1QA 4ZVFA 3ONQA 2YNIA 3MMCA 1R7IA 3FVYA 4P2MA 2MKYA 4FYWB 2MGZA 2MKKA 3QWUA 5B7WA 4IG3A 2Y1RI 1N4LA 3HZGA 4DV6F 1FO1A 1HNIA 3TZXA 1RT1B 2B9EA 2NLWA 2IJRA 3DDNA 4ZP7A 3OFHA 2EK6A 1PJ5A 2MQLA 5HROB 3C2PA 2RHQB 5E7OB 3EZUA 2Y0SD 3PW0A 2N3LA 4ZIVA 3KNAA 1R0CB 3UR3C 2MEWA 5E41A 3VGVA 2LDYA 4DDFA 4TQSA 3MEGA 2ZHBA 3NS5A 3P4UB 2UVWA 4C7QA 4J5OA 4PWWA 2IPOB 1HLWA 4PYAA 2WVFA 1JK9B 2XS5A 2Y1JA 1ZM2A 2HS4A 3KHHA 2KI2A 3VQSA 5A0YB 2MLXA 3ENVA 2FY8A 1DZ5A 1RLCL 2MKSA 4B08A 3ZTPA 3IN5A 1HNWJ 4ENOA 1Y7PA 5LM7E 4DV5J 3K5LA 1O5JA 5IZHA 2BE2B 2KT5A 4LF2A 2ZUAA 3MCSA 2FVSA 1XNRJ 3GONA 1F60B 2K3IA 1VBZA 4PG8A 3FNNA 2WAQD 1RDRA 3OL9A 2K7KA 3MAAA 3UD5A 2JDJA 4ID5A 3OR1B 2BJDA 2JRSA 4KFBA 5THWA 3ZTSA 3NMRA 3OL6A 5HATA 3C19A 1FJEB 4Y3CA 4DU7A 1EP4B 3NY0A 2OPSB 3PM9A 2BBEA 3EVWA 3OLAA 4F2RA 5HMYA 1HBOA 2ZZTA 4GVBA 3QRQA 4IH7A 4CO5A 4C11A 4ECUA 3KDOA 3S8SA 1QAIA 3UR0A 4Y34A 1XR7A 4IOAQ 2ZWPA 3N6LA 1SQEA 1NSAA 1H72C 4PABA 1X4GA 1KP6A 1SB6A 1S4FA 3H2LA 2W7OA 3CCQS 4WTOB 4J9LA 2HZAA 5KFVA 2ZM6F 1IBCB 3TUPA 1UETA 4RU9A 3FFIA 3C6TA 1RB0A 1U8SA 4B9LA 2CQ1A 3CCSS 3FCHA 4DR7F 2P5VA 4G65A 3MZIA 4LIRA 1O6XA 3B4MA 5DZ7A 1HWLA 1NPRA 2A0FB 5L1KA 2C3UA 3N28A 4F8RA 1U8WA 4RW7A 3VZIA 1MWZA 4IFYB 4USTA 3BGOP 4A8KA 3CCRS 1PAEX 3RR8A 4MKVA 4B9TA 3BO4A 3AB2B 4UY85 5GVQA 4DR4F 2WBRA 4KHMA 4ZVTB 2FYXA 4C0BA 2GAHC 1T9XA 5MLCV 1APSA 1H7XA 3D7SB 2CQDA 3NOCA 3K5NA 1LW0B 1DJ0A 4LSZB 2QGFB 3G82A 4ZCIA 4EBDA 2Z8QA 1D0EA 5CYMB 4CYUA 1R8BA 3BGUA 2COLA 3I4PA 1Q7YT 3L7OA 2HK2A 1IM4A 4OX8A 2QSWA 1ELOA 2E44A 1TL5A 3M2VA 3TOQA 1DTTB 3M6VA 1WC1A 3GZ7A 5DDQC 2XGPA 2V63A 4HLBA 4ES2A 3U27A 3MDFA 3D6HB 5H9FJ 3TA2A 2HFZA 1EARA 4RW4B 1WDTA 2UZAA 1N48A 5HVGA 1UA1A 3PACA 4XPEA 4HHJA 3GB0A 4PXCA 2DCUB 2VFTA 2AKWB 2W2MP 2HQDA 4Q7AA 4A46A 2CADA 4JI1F 2GW8A 3ILOA 1YRUA 3CW2C 2M8DB 4UOCA 3DU6A 3PW2A 2R7SA 1JB0C 2RS2A 3CJKB 3RJMB 1R8CA 1PBAA 5G4DA 3PR5B 2UVRA 3EICA 3P5TL 2V2VA 2JOQA 2ZKTA 5KAKA 5KFXA 1RTJB 3HVRA 4KGVB 2XMKA 1V6HA 5F0WA 2D7SA 1ZPWX 3SFGA 4U96A 5M2UA 2R3VA 4ZVSB 3CJ0A 4YN3B 2F4VF 2FVQA 2KM8C 4R5PA 1F2HA 3C15A 1VRUA 2XMTA 3VF0B 3PVXA 2DNYA 2CG8A 1NPPA 2YH0A 4TKTA 3QT6A 3A1YG 4KB7A 3W5ZA 3KDNA 4NA1A 1HD1A 4C3MA 4Q2LA 1RWXB 2FGOA 1JIHA 2RF2A 3CWJA 2WTFA 4DV7F 4DL6A 5C42A 1K73T 1VQOS 3M9MB 2E5IA 3A3NB 3GYGA 3IG1B 3BKTA 3B6BA 3MI7X 4P52A 2P9GA 1I5OB 3LWMA 1SKRA 4OYAA 4O3PA 4QR2A 4WKRA 2CPZA 5ETRA 5E3AA 3DYAA 1U6BA 2ZVSA 4DFPA 5K5MA 2JVRA 4KGKA 4FBUA 3AOCA 2KXHA 1NH7A 1Y3JA 2L9NA 1U45A 1QTNB 3ZZRA 4B3OA 3EGNA 4P6QA 3VV2B 1R0AA 3MR5A 3MM5B 4HH1A 3ETOA 2O3DA 2MSTA 3K17A 4DN9A 4C8ZA 1KVKA 5CD4H 3D67A 2GIRA 1NK7A 4L74A 2BW2A 3QBCA 3FGVA 3UQSA 2RIJA 1UVMA 1CQMA 4DL7A 4KRWA 2QT7A 1Y11A 2UXBF 4BHQA 3CD6S 1YRTA 1MNEA 4RBVA 3IMQJ 2DNGA 1UWBB 1HPZB 2B9XA 4IR1A 1RGVA 3EZOA 3VHQA 2CVEA 3ZTOA 2I9SA 4P2FA 1L5UA 3LP0A 3MPYA 4LF4J 4Q8EA 2VC0A 2XI3A 2YQ1A 1SI9A 1NHUA 4ID8A 2MQQA 2BOAA 3ZZ0A 3DU5A 5AE3A 4DQRA 4IQMA 2D69A 2W9BA 1FNXH 4G6VB 1KOOA 1S49A 2ZBIA 2XWXA 3RB3A 1WEZA 1CS4B 1N5QA 4H4MB 7FDRA 4Q8FA 3A8JA 3MPDA 3Q2TC 3CUNA 4RNHA 4LFBJ 2HHVA 3CJ3A 1IKYA 3R2DJ 3DNCA 1T8EA 5CAAA 5GAGU 3RZAA 4IYQA 2F3JA 3IAM9 4BDPA 3TWZA 2LYVA 2W8LA 3JSYA 2K06A 2RU9A 5FD1A 4DQSA 1AZSB 2MQMA 3CDWA 2H5EA 1YJUA 4K4XA 2PI5A 1HI8A 1GAOA 2Y1IA 1HYSB 2LXFA 1I6JA 3DRXA 1X4AA 2V8VA 3G8SA 2DNHA 4FVCA 4CLUA 4DSLA 3POTA 1GX6A 2DPJA 1S7HA 2E5LF 4OZ0A 2KXNB 3BGLA 2RMLA 3EGZA 3SQGB 4PPZA 4C0OC 1TAUA 1RTHB 4K4ZA 3PIPQ 2KTQA 4ZPCA 4O44B 4PG6A 2VFUA 1BE4A 1P27B 3H5XA 3ILJA 5I4MA 1T9WA 4I4BA 4MAKA 2A1BA 2G2YA 2D3ZA 1MMNA 5L8RC 3QGGA 4FBTA 4YHHF 4UZBA 3D1HA 1AB8A 2XHCA 2OPQA 1Q5VA 2XZTB 3W60A 3HP6A 4QU6A 4RUBA 2PEHA 2HVEA 3RRGA 5BYSA 3R1LA 1C1BA 2EI5A 3SBMA 5EN1A 3OHAA 5KT3A 5ETMA 1V5IB 5E3CA 4USHA 3PG9A 4GRSA 1ITPA 1RT1A 2W2OP 1FFGB 3GIJA 4OYMA 1B7YB 3KOAA 5HROA 4ECZA 3NL0A 4AFFA 3T1HF 2KRRA 2VF3A 1UMJA 3KK2B 3PZPA 4WYLA 2J6TA 2ALYB 2MZTA 4OHZA 3U1LA 4L75A 4ZLJA 2LQJA 3DC2A 4K4WA 3RW6A 2QV6A 3NMAA 2CJBA 5A0YA 3WHIA 5ETNA 1U48A 3BBCA 2V9KA 2XSJB 5A2QU 2VICA 1B7FA 2YWGA 4X4QA 2DBBA 4J9MA 1WC3A 3A3PB 1SPBP 2BE2A 1BWEA 1IN0A 5CQGA 3Q83A 2E1RA 3MD3A 1X0FA 2BKNA 1FT8A 3GG1A 5E33A 5L1LA 1Y00A 3VAIA 4V19J 4FF1A 3BO3A 1NXIA 3OR1A 5IT9Y 2DNOA 3FMBA 2KG1A 2ZJQQ 1EP4A 2NUHA 2ZH8A 2OPSA 4ECSA 2CPDA 3BGFA 1FX2A 3UN2A 4NA3A 2DNNA 4CO0A 1P6TA 3M8QB 1H74A 3IBWA 1DY3A 3LAMA 3GWCA 4N41A 3CCJS 3LP1B 3Q23A 2JC1A 1AYEA 1WOSA 4ZVHA 2EWHA 4LSNB 1NRKA 1SJ4P 4DSKA 2HFNA 1N33F 5DETA 4X64F 1WOOA 3EVMA 2M4MA 2NUUG 4LFAJ 1N34F 2IVMA 3DKDA 4U7UD 2DK2A 5DLGA 3ILLA 1U1OA 4K4VA 2GVZB 3QT7A 4EZ6A 4QBUA 4DPOA 4QCLA 1U24A 1HI0P 1VS3A 3MPVA 4RNNA 3PIOQ 4DPWA 3G9CA 2JNJA 1N36J 4DX8H 2MXYA 3UDLA 3QGHA 4F26A 1EAYC 2FUG9 3EUNA 5KG4A 3AODA 4V1Ak 4HT5A 4E8UA 4PUOB 5LSLA 2FZGB 2VBXA 5K20B 4IFYA 1RISA 2G0CA 4MIAA 2OMOA 5KFPA 3TNVA 3IR7B 4EBCA 5ETPA 3T3FA 3RUBL 2OJ3A 3S7RA 3M2RB 4A8YA 4ZVRB 4X4RA 3SSRA 1XMQJ 4YFUA 1LW0A 2KFZA 4LF8F 4NLOA 2FC9A 1D3WA 5T41A 2KO1A 3H4BA 3UE2A 3M6WA 5CYMA 4ED3A 2PGCA 3X3UA 3AOAA 1T05B 5CXTA 1X9SA 3EJMA 2QL7B 3BGRB 4X65J 3OR2B 2FY1A 1UA0A 1DTTA 5HAOA 4NI2A 2HQCA 5F8HA 5I3UB 1SH3A 4OX6A 1Q95G 5A8WB 4ED8A 1VIOA 1X5PA 2XTJP 1UKUA 4CCHA 4K2JA 4RBUA 4UW2A 2RQCA 2UXDJ 4C8LA 1LK5A 5M2RA 5F3TA 3M6UA 1VC5A 2CPXA 2V8HA 1Z4UA 3GFYA 4RW4A 4DX7A 4F3OA 3QMQA 3DXBA 3LOUA 3L7PA 4X62F 4KJIA 1YGYA 4RNMA 3TARA 4NL5A 4NASA 3JQMA 2QMUB 5EDWA 1XEZA 2HIQA 4RNOA 4XTTA 6FDRA 2VC1A 3TZWA 3CJKA 3RRKA 3T5JA 2CNNB 2NPFA 3DLGB 1FCAA 3C6UA 4JI0J 1J5EJ 5H9FK 2C22A 1NJZA 1NAQA 2RH3A 3OHBA 4FXDA 1RTJA 3KUHA 2IM0A 1IKWB 4DCOB 3FCVA 4ES3A 1UJ5A 1W7WA 3PW4A 5L9XA 1NDPA 3G6XA 1LWCB 3CPWR 2FQQB 4KAIA 4F50A 2GQ2A 1YKWA 2MY8A 3LP2B 4RKUC 2R7TA 3NNCA 3CJRA 1RAEB 2K7JA 2ZFHA 4CLKA 4AQYF 2V94A 4OZ5A 2UUAF 1KFDA 3K7RA 3B4DA 4DX5A 2IAJB 2O5DA 1BXNA 1S1TB 2HLUA 2Z0GA 1GTEA 2XCAA 1SC4B 3IAS9 5KOXA 4ZCLA 3NOGA 2BJEA 4ZP6A 1LNQA 2F8MA 6AT1B 2E1PA 2N4CA 3IG1A 1HWUA 2MKCA 2C28A 5CZVA 2VBWA 4K7QA 3CJSA 4WK3A 1R27B 4ED5A 2HHTA 3GIIA 4YB7A 3ZZPA 5KFRA 2IM2A 3J80Y 3GP9A 1D8ZA 1KLNA 5JJBA 2WVCA 1AUSL 3G2XA 2HKEA 3IM8A 1ZETA 1X31C 4RL1A 3MM5A 4CI0B 5KG6A 4M5JA 3FZBA 2EFVA 3DOKB 1NBEB 5H1SV 4FF3A 2DH7A 2KN4A 5BR8F 1TR0A 3W5YA 4NLRA 2YWFA 1YBUA 3OTDA 3F44A 2XYPB 4A8QA 1U1LA 1REVB 3CC7S 2J6UA 2H1YA 5A6WA 4DSIA 1MMLA 5DQGA 1KQKA 3QWPA 4X4UA 1TK0A 3FCWA 1UWBA 1HPZA 4KT0C 4DCPB 4LFCF 3W9IA 1IBKF 3PJ9A 2QFIA 1EIYB 2GHVC 4MH8A 1YBTA 3GIKA 4Y65A 1K0TA 2KFNA 4KH1B 3NP5A 1S7IA 4CLLA 1FEHA 1LKZA 4CLFA 3L95X 1TVRB 2V4JB 1C0TB 1SBRA 4TNOA 4Y6IA 4H4MA 4NLTA 2KHDA 2APOA 4NRTA 2YX7A 4JBCA 2R2TA 1NHKL 1S6PA 2BQUA 4DV3F 4OHXA 3NGRA 3H5UA 2IMWP 4KHPF 3AJ2A 5KT2A 4WE1B 1HYSA 1BC6A 3WQPA 5F3ZA 3GU0A 1IXKA 4GMKA 3IBCB 4WF9Q 2ZZMA 2ZH9A 4F0HA 4KIAA 4OI3A 2C2MB 1FRIA 1GTHA 1NH8A 4O3RA 3V81B 4ED0A 1ZOTA 4OFZA 1WJ9A 3BF4A 3RAMA 4CO1A 5HJYA 4RJVA 1WSRA 5IWAF 1KKHA 3PW5A 2ZBQA 3FMWA 4EU0A 1OY9A 5E5NA 1HNXJ 3KLVA 3SQGA 4ECQA 2B0GA 3SZ2A 2HNYB 2B43A 4XO0A 3GIMA 4A8OA 1RTHA 4ETXA 4O44A 3NNAA 2FJEB 3J81Y 4YB6A 1EHWA 4KC5A 2R8IA 3B78A 4A47A 2ROGA 1WC4A 2HGMA 2IVFB 1EJ7L 4IO9Q 3NAIA 4QIVA 1JJ4A 1X4HA 4ZLLA 4OX9F 2RUSA 4CH1A 2EKNA 2CQ4A 5LMNJ 2YNFB 4B3SJ 2AZ3A 1WC6A 1UEVA 4HEA9 1X7VA 3OJUA 5DJBA 4QWDA 1S97A 2L9DA 3MUMP 1TK8A 2I5JA 2B5JB 2V67A 3TX0A 4FNIA 4LSLB 2F63A 4DN0A 1TUWA 8RUCA 4QWCA 5DZ6A 3UNYA 2HWHA 2GO9A 2XNQA 1HARA 4HL9A 3I4HX 4NLGA 2EKYA 3K2YA 4FYVB 4TLRA 1VGYA 4Y28C 3MWBA 4WTYA 2WSFC 3MM7B 3GILA 4LR8A 4DSJA 3KK2A 3KG0A 3Q2SC 3R5AA 2L3MA 5KFNA 2LEPA 1Y5NB 1KDNA 5KFSA 4Z7CA 8ATCB 3KKFA 3T9ZA 2JHEA 3GFXA 4UF4A 1RTIB 2AYEA 2VPWB 4M94A 3LPEA 5ETVA 1S4EA 2LU2A 2UUCJ 4B3TJ 1YI2S 2CIMA 2VL1A 4J9PA 3IGVA 2MHNA 5MAOA 3CT9A 2BJ7A 2PEBA 1SQGA 2C2OB 4JI2F 7AT1B 1EQ0A 5AXNA 2XSJA 4OZ3A 2KKHA 2XMAA 3GYNA 3THTA 2AF6A 4L73A 1Q79A 4RR5A 3ZNJ1 3IWLA 3EWGA 4X84A 4K8RA 1RADB 1AA1B 2W7PA 3WC2A 1KOHA 2ASJA 2FHMA 4B3RJ 4MYUA 3ZTRA 2K3KA 1IQZA 2P9EA 1SJFA 1SXLA 3HO1A 1IQTA 2ZHAA 1KHVA 4JUZA 3UD3P 3K58A 4AT1B 3M8QA 2Y9HA 2DKOB 4FXVA 5D6GA 2VG5B 2HMIB 5L9NA 2QEXS 4U8VA 3LP1A 2OFGX 2FB0A 2E7XA 2QMWA 2J9CA 3Q8QB 4LSNA 2KT2A 1UCNA 4FKXA 3FDSA 4H4KA 1YJ7A 2AIRB 2YQ0A 4I6WA 1FD2A 3PRVA 3CJ8A 1U2CA 1U1QA 2PT0A 2RRBA 4EWTA 3PDNA 2BJ1A 2MLZA 4CLPA 1QJHA 2DR9A 3DCAA 2OPPB 2HS0A 3HHNB 2GVZA 2V8DA 2FHOB 3AJDA 5IQ6A 1KD1T 1IBLF 1IBMF 2ZE2B 2OMLA 4WZMA 4K2XA 4M5IA 4ZVQB 2ILYA 4MKBA 1UPPA 4DSFA 4EI2A 4J90A 4DV6J 2MLYA 3GYXB 5K8OA 1F2GA 4PUOA 4JYAF 2J8AA 3GE9A 1H98A 1MU2B 4CP5A 2OTLS 3O44A 1U4BA 4DL5A 4OIXA 2YWEA 2J76E 3M2RA 2GJ2A
chains in the Genus database with same CATH topology
1Y9OA 3MCSA 2RDIA 2FVSA 1HL6A 1JX4A 1RT7A 5EUHA 1F60B 1N5TA 2K3IA 1VBZA 1CVJA 2HRYA 1BD6A 2F1FA 2GQCA 4G1IA 4IRCA 2GA7A 4NLYA 1U1PA 4PG8A 3FNNA 2WAQD 3N01A 1RDRA 3TAPA 3OL9A 3PXGa 2K7KA 4M5DA 3TP2A 1N54B 2DHSA 4GO7X 2JDJA 4ID5A 3N9UC 4K59A 3OR1B 1N5YB 2BJDA 2CDQA 2EVZA 4P7VA 2GCFA 2JRSA 1ZAWA 2WRMA 4ILRA 4KFBA 4XDCA 2ATLA 1T05A 3U7JA 5CCLA 5THWA 4ED1A 4L6V3 3Q22A 3NMRA 3TVZA 3OL6A 2SXLA 1Q53A 3VAGA 2HVHA 1V3RA 1FJEB 4I64A 4Y3CA 1B0TA 4NX9A 1EP4B 2FJBB 2JLGA 2OPSB 1R31A 3BGRA 5KG0A 5KT4A 2VOPA 1OQ3A 3OR2A 2HHUA 3PM9A 1DAXA 2BBEA 1YG0A 3CC4S 1S6UA 3M8PA 5I3UA 3OLAA 3I0SB 2VASA 5HI7A 5B0GA 3VTIA 3V6KA 4F2RA 5HMYA 1KQGB 2BANB 2GMJA 1HBOA 1IJFB 1Q81T 3MHYA 3DRRB 3OXFA 3HT3A 5A8WA 4M95A 1HQEB 3CD5A 3I9V9 4OI1A 3HHKA 2B4OA 4O4RA 3TVKA 4IH7A 4RWXA 3MEDB 4URSA 4BWJA 3DHXA 4CO5A 4HKQA 2IRUA 4C11A 2EC0A 2R7WA 1TZ0A 3BSOA 4ECUA 1NJXA 2DVIA 4DL3A 1HBUB 2XMWA 3DN9A 2XBPA 4N5SA 3S8SA 1QAIA 5J1NA 1OPIA 3UR0A 5J2NA 4C2MA 1K9MT 4Y34A 1XR7A 4FS2A 2HWTA 3CMAS 3U1MA 4C3KA 1XR5A 4IOAQ 4PXDA 3CMES 1FKPA 3N6LA 1SQEA 4MYTA 4BCAA 1TAQA 1X4GA 3RR7A 4I1TA 1WWHA 5HO4A 1SB6A 1MROA 4AE5A 4YR2A 1S4FA 1HA1A 3H2LA 2W7OA 1HHSA 3CCQS 3QYYA 2I5JB 4YY3F 4J9LA 5EWEA 5F0UA 5KFVA 2E5JA 2EW9A 1X5SA 4A8FA 5D3GA 4QIEA 3D5MA 2ZM6F 1QVFR 1VLYA 1UETA 4LVOP 2RJZA 4RU9A 1JKHB 3KHGA 2MZ1A 1S9GA 3FFIA 1M90T 1EETA 3C6TA 2OO4A 3HJFA 4I69A 5T7LB 3PX6A 1MWYA 1U8SA 1HWJA 4DSEA 4DR6F 4B9LA 3UCGA 2CQ1A 3HMJG 3CCSS 3FCHA 4M8LA 2ZJRQ 4DR7F 1RTDA 3I31A 2HGLA 2DPIA 1VK3A 2P5VA 4U7CA 2F40A 2VH7A 1OSDA 4ZS6A 3H40A 3W7BA 1E6YB 1VQ5S 1DQ8A 3MZIA 4LIRA 4LQ3A 4OI0A 1CPZA 3MM9B 2IJNA 3B4MA 2ZH5A 1HWLA 2XMVA 5KFOA 5L1KA 3BZQA 5ADZA 2C3UA 1JLQB 3DLGA 2G9OA 3EGWB 3IRWP 3G71S 4WFYA 2AJ1A 2DH9A 3N28A 5BJRA 4F8RA 3J7YI 2HHHF 2DO4A 2R2UA 2DJWA 4RW7A 3VZIA 2BYCA 3CEDA 5GADU 3IS9A 1MWZA 5FDLA 4IFYB 3OV7A 3G96A 1S1WB 4UUXA 1J5OB 4A8KA 4CZCA 3CCRS 3IFEA 1KR4A 1U49A 1IKWA 2AW0A 3RR8A 5DDRC 3MD1A 1YJ9S 4OZJA 4B9TA 3HVTA 4HYKA 3BO4A 3AB2B 3T6JA 4UY85 2YX1A 5GVQA 4X4TA 3SCLE 4C9DA 3HZEA 1AXQA 3G86A 4DR4F 1CC8A 2WBRA 4KHMA 4DL2A 4TLQA 1NEEA 5F41A 4DUYF 1LWCA 3D0HE 4PRFA 5LJ5Y 4WK1A 1N88A 4C0BA 4JI3F 1SUQB 5MLCV 4CH0S 1APSA 5F9NA 4QW9A 1JLFA 3NCQA 3LP2A 4XDDA 1H7XA 4ECVA 1UJ4A 2CQDA 4HDHA 1V9OA 4J9QA 2LECA 4AXIA 3K5NA 1LW0B 3RRHA 1DJ0A 4ZCIA 4EBDA 4ZOSA 2Z8QA 1YRXA 3KK3B 3OL8A 4ECTA 3DHWC 1PGZA 2ZJPQ 1B64A 1FDDA 1IUJA 1VQ8S 4C98A 1WG5A 3BSNA 1D0EA 1FJ7A 2HHQA 5CYMB 2ZH4A 3AY0A 2BVZA 3VR1A 3O3LA 4O3SA 3IWNC 1VJWA 3HHLB 3VCDA 4B9UA 2IAJA 1H2TZ 3NS6A 4ILLA 1R8BA 2NPIA 2COLA 1S1TA 3BGUA 3I4PA 2YX4A 1Q7YT 3VAKA 2FJXA 3L7OA 4PPDA 1IM4A 5KFKA 4UQTA 2VQEF 4OX8A 2QSWA 1ZYQA 3MR6A 1ELOA 2XI2A 2E44A 1TL5A 3EPIA 4DHVA 2B6AA 3M2VA 3TOQA 1VQMS 1DTTB 2C2EA 2KDOA 5D4PA 3M6VA 2FGCA 2L08A 5IS2A 2C2DA 4I6YA 3J7Z5 2PDAA 3KYLA 5DGAA 5IT0A 2D3OR 5KT5A 1SH0A 3ISND 3DDKA 1X5TA 1YIJS 1Q7LB 2R2RA 1YQHA 4G3IA 1FRXA 2DT9A 2JH3A 3GZ7A 2J9EA 1XR6A 5DDQC 2XGPA 2NS1B 5HMZA 4A8XA 5HP1B 2R8KA 4KO0A 3E01A 2VG7B 2VODA 4HLBA 4ES2A 4LFAF 5K8MA 2QMXA 3KG1A 4JV1A 4A8WA 3P96A 2C3YA 1TL3A 3U27A 3MDFA 2DB1A 2B51A 5EX3A 3K57A 5H9FJ 3TA2A 3CDUA 3DMJA 1VBXA 1XMBA 3PR4A 3W2VA 6FD1A 4I68A 4F2SA 2HFZA 4RW4B 3DRPA 2UZAA 4DS5A 2XMMA 2QFJA 1N48A 1UA1A 1SL1A 1VQKS 3PACA 1VIXA 3E51A 1Q8IA 4XPEA 3KG4A 3C66A 4HHJA 2HLTA 3I0RB 1OSCA 3WBZA 3GB0A 3FSXA 4ELTA 4PXCA 1BY9A 1C4CA 2BZ2A 3RU0A 3VAFA 2DCUB 2VFTA 2L41A 1S77D 3R27A 3OTCA 4OJHA 5AXKA 2OFHX 2YKOA 1NKCA 3NNHA 2J9DE 4Q7AA 1D8YA 2MJUA 2E29A 4A46A 1TFYA 5AE2A 4K5SA 4JI1F 3IR5B 2GW8A 2PA8D 1Z1ZA 1YRUA 3AA9A 4WU2A 4WZQA 2M8DB 1Q86T 2ZNYA 4UOCA 3DU6A 1VQ4S 3PW2A 2CQIA 4I2PA 2R7SA 1JB0C 2RS2A 1R8PA 4YDXA 2RB7A 3NKYA 3CJKB 5K14A 4DL0C 4ETZA 1R8CA 5F9LA 1NK5A 4CO2A 5G4DA 1REVA 3PR5B 3GR0A 5E3PA 2UVRA 3P5TL 4FXWA 5K8PA 1Y0HA 2RQKA 3B8HA 4IRDA 2JOQA 2ZKTA 5B0EA 1S72S 3JTNA 3C8YA 1FNMA 5KAKA 2CFXA 5KFXA 1QSYA 2M88A 3HHEA 1RTJB 1HD0A 3HVRA 4I2QB 2M70A 2XMKA 1V6HA 2VZ9A 3VWSA 2E7WA 3MURP 5F0WA 2IC3B 2D7SA 1ZPWX 4DR3F 1S6QA 2ZD1B 3SFGA 3TAMB 4X66F 4ZVEA 1QVGR 5M2UA 3VALA 3MEGB 4YUDA 3OVBA 4FVMA 1RWUA 3CJ0A 2ZC3A 3FEXB 1LV5A 4DEZA 2F4VF 2FVQA 2KM8C 4QIWD 4R5PA 1JLCB 3PX0A 1P1LA 3KWMA 3MEEA 4RNFA 3RAQA 3MF5A 5KFTA 5C5JA 4OJ3A 4X4PA 2KJWA 3FRZA 2Z4PA 1VRUA 2XMTA 3VF0B 5KFDA 3GQCA 3PVXA 2DNYA 2IRYA 3L09A 3NBPB 2PMZD 4ZPWR 3LPYA 2YNHB 2YH0A 4O3OA 3SSQA 1HMVB 4TKTA 5BYQA 2DH8A 3OLBA 3A1YG 3OXGA 3CCLS 2BQ3A 1N5VA 4HT7A 4NZ0A 2BM0A 4KB7A 1FD8A 3K0JA 1TVRA 2C3OA 4NA1A 1UVNA 1HD1A 2V4JA 1C0TA 3RBDA 4V19X 3S1TA 1KTVA 3OVSA 3KLHA 1U1RA 3NLCA 4RW8A 4C3MA 2XHWA 4Q2LA 3NAHA 4H54A 1FKAF 1VQNS 3CGIA 4WYWA 4PWUA 4HTJA 4UUWA 3CCES 4TQRA 4ALZA 2FGOA 3TI0A 3H59A 3D0IE 1H2UX 1JIHA 3T19A 2RF2A 5KFMA