2F5GA

Crystal structure of is200 transposase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
130
structure length
130
Chain Sequence
ELKSTRHTKYLCNYHFVWIPKHRRNTLVNEIAEYTKEVLKSIAEELGCEIIALEVMPDHIHLFVNCPPRYAPSYLANYFKGKSARLILKKFPQLNKGKLWTRSYFVATAGNVSSEVIKKYIEEQWRKEGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords Transposase, putative
publication title Crystal Structure of a Metal Ion-bound IS200 Transposase
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 37
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2f5gA00
2F4FA 2FYXA 2XMAA 2VHGA 2VICA 2XO6A 2XM3A 2VJVA 2VIHA 2A6OA 2EC2A 2XQCA 2A6MA 2F5GA 4ER8A 2VJUA
chains in the Genus database with same CATH superfamily
1PYSB 2W9AA 3PEJA 3FZBA 4ANCA 3DM2B 1NUEA 3M8QB 2JH3A 3F41A 3U1NA 2CWXA 5FLXY 3IM9A 4EZ9A 2GHVC 1WF1A 2ZUGA 5GMEA 3BSNA 2OP5A 1DTQA 4PWUA 1NK7A 1R31A 1S7IA 3NGUA 4DR5J 3LPYA 2E9RX 1FDAA 3HFVA 3EMTA 1DAXA 1UAWA 3RTVA 2R7RA 3K2YA 3IS9B 3RR7A 5ITHA 3BN4A 2ABYA 3IG1B 3FK4A 3DNCA 2PO4A 4ZVGA 2W01A 2BANB 4PXCA 1SKSA 2G1DA 4JI1F 2OPPB 4G3IA 3IAS9 5B7WA 3QMQA 4ENOA 5EGYA 3Q8PB 5SUHA 4O44B 2QYCA 5IT0A 4U9RA 2BKNA 1O51A 4ZVOB 1UWAA 3L7OA 5KG2A 1Y5IB 3B4DA 3OUYB 2L9NA 4RNHA 1B99A 4OIXA 5GAHU 2M3DA 1CJVA 1NDPA 4F4ZA 1RWVB 1A6LA 3JS9A 2HZAA 3V6JA 1ZM4A 2UV8A 3PNIA 1R0CB 3TP2A 3N6MA 1HYSA 1VBYA 4HI1A 1H73A 3SDEA 4LFCF 4FNHA 3EM1A 1YBUA 1B4SA 2JOQA 3SCKE 3MUTP 1UVLA 4KGXB 3LH2S 3AA8A 4DUTA 3SCIE 4UT4A 4K0KF 2RU3A 4X4SA 5I4MA 3KLGB 4O3PA 2AGPA 4Q43A 4WF9Q 1HWKA 1WD6A 3KHGA 2ZWPA 2N4CA 4FPRA 1RHRB 1BY9A 3M2RB 1XNQJ 2KT5A 3HP6A 1FRHA 3HPOA 3QFHA 2IYGA 3BGFA 2DITA 3FMWA 2DNKA 1FRLA 3J81U 4ZP7A 2RDDA 1RXOB 3JSMB 5C5JA 2B8PA 4KPCA 5CZXA 1L3VA 2D7SA 4NYZA 2P6TA 1XR6A 5LSOA 3BKTA 1KHWA 1DFDA 3MURP 1IN0A 3GILA 1SQFA 3K5MA 1FNXH 5DJBA 5D3GA 3NMAA 3TANA 2CQ0A 3DOKB 1Y0HA 1UFKA 5CYQB 1S6PA 2DNGA 2V69A 2FVCA 3DXBA 2ZH7A 4N56A 3J7Z5 3M4XA 1RT3B 1TKTB 3QIDA 3POTB 2W2PP 3W2VA 4EI2A 2D74B 1UFWA 3EXCX 5H1SV 2F1FA 5KFNA 2RRAA 2R2SA 4PPZA 3CCRS 1FJCA 4HDHA 2QGFB 4HT5A 1KONA 1SV5A 3MM6B 1D9FA 4OZNA 1G3OA 2XI2A 5ADZA 3GYGA 2GHWA 5CD4H 2MKKA 1LXNA 2FIUA 4YFUA 5MAOA 4KGVB 2BXJA 2G1HA 3AB4B 5FD1A 4Y28C 1KR4A 1UPPA 4EMDA 2MKCA 3SCLE 3W62A 3M9NB 5DG7A 1N33J 5B0CA 2F40A 2CXEA 1AW0A 2A3JA 4UOHA 2DXDA 5HSPA 2CNOB 1R3NA 1Y11A 4WBFA 2O67A 2VKZG 4N5SA 4DR5F 2H5JB 1KDNA 3MHYA 4FF4A 1XMQJ 3GIKA 5DQGA 4WCEQ 3R7BB 1RA6A 3R5GA 2I5JA 1VFJA 2F65A 2OI2A 2HQIA 2CA9A 3M2VB 1PBAA 4XO0A 2HBRB 2E7VA 2VPWB 1RT7A 3VAKA 4K4SA 4BC7A 1XQIA 2ZKUA 1MMNA 2DGUA 2ZH1A 3HM9A 1HPZB 2C1EB 3PZPA 1RAIB 1W2BR 1ZH5A 3SQOP 1FE0A 3J7ZT 3LQVA 3W2WA 1WKJA 1IM6A 2DXEA 4ECUA 4MJKA 3MM9B 1BXNA 2YBVA 5B08A 2VA3A 4BBYA 4WP8A 4RW9B 5D15A 2V4JB 1FVQA 2AV5A 4Y3CA 4C8YA 2YKOA 3FUYA 2VFRA 1UTAA 5C24A 2HHVA 3H7HB 3JQMA 2LA4A 3VGUA 2AQ4A 1M1GA 1T8EA 4IDKA 2OELA 5AXMA 1S0OA 1LK5A 1WF2A 4LF7J 1IBKF 3RB4A 1NKEA 2BE2B 2FY8A 1FFWB 2C3YA 3M8SA 3RAQA 1WNEA 2FC8A 4CLPA 5IV4A 5KG1A 2XB2D 1AA1B 3TX8A 4R8UA 3N6LA 1XNQF 2FVRA 2ERRA 5T41A 1FK9B 2OPQA 4USKA 1PG5B 3R7NB 2FHJD 4JYAJ 4CNYA 1RAOA 4DV6F 5HL7Q 1WKKA 1BMQB 1VRQC 1I94J 2VV5A 2ZH6A 4J9OA 2OIHA 4TQSA 4USWA 2AU0A 3D0GE 2KXHA 4TXSA 1O6XA 4C8OA 2CJBA 1QLNA 2OD4A 2BJ7A 4PG5A 5HMXA 2OO4A 2JVRA 1ZTTA 1SIZA 2GJ2A 2UUTA 2X1BA 2XMUA 4UW2A 1S1XA 3FBCA 3N9UC 2GMJA 1LWCA 3IR7B 4NWBA 4FXVA 5HLFB 2EBGA 4QIVA 3FQKA 2VPYB 3NS5A 1CJTB 4KAIA 1KQSR 3FMBA 2AZ3A 3EXYA 3PW2A 2AD9A 2RNEA 2DNMA 5K8PA 2NXEA 1IKWA 2XMAA 2LYVA 2A6OA 3MPDA 5KFQA 3N4WA 2FLOA 3SFUA 1S9EB 1QSLA 2MKHA 2JEJA 4OV6A 2E1PA 4FXWA 3IP0A 2MSTA 4DR2F 2W9BB 3KLIA 3G82A 3EVOA 1X4AA 1ZBTA 2UXBF 1S9GA 4B3TJ 4WXWA 1IUJA 3OTCA 1Q1KA 2QEXS 2WW8A 3GU0A 3HVTB 4RWXA 1FX2A 4P2SA 2LKZA 1VISA 2WRMA 1N33F 4K5RA 1PBUA 1HD1A 4Y2MA 3D1HA 2AJ1A 4B9VA 2N7CA 1EX8A 3K8WA 2HFNA 4JOUA 4J9KA 1FDDA 2F4FA 3LUYA 1Q7LB 2MB0B 3DDIA 2FY1A 3TX0A 3PXGa 4LF9J 3N79A 3CDBA 4U8VA 3GSDA 2WHOA 5KFKA 1XMQF 1PIEA 4Q5VA 4OZ3A 1N0UA 4C11A 3L09A 1IR2A 3HJVA 5E3RA 3P5TL 1P6TA 4ZOSA 5DZ7A 2HNZA 2RS2A 3G9CA 2KXNB 3L4BC 1GFWB 1U1OA 3QZ7A 1GXTA 4JV1A 3IGVA 2XI3A 4P74A 3W5XA 4FDFA 4X66J 2XYHB 4OX9F 4Z7YA 2J9DA 3CB4A 1HL6A 3FCWA 3K8VA 3MEDA 1GMVA 3K5NA 1YHQS 2HZVA 2RT3A 2DD8S 4X64F 2MQMA 2WB1D 3HHLB 2AYMA 4L74A 1D09B 2V67A 3OTOF 1U6ZA 4OLPA 2VDHA 3DLLQ 1NK5A 2LLZA 3KK1B 4PG8A 4MH8A 1EQMA 1NK4A 4ECTA 3G71S 1NSAA 1X4FA 4J9MA 4Y2KA 2K3IA 3HVWA 3E3XA 1HHQA 1RTHA 3MPUB 2B43A 1SJ4P 4Q2LA 4J90A 1QY7A 1S1VA 2OAUA 2H4YB 1R8HA 3M32A 2E1RA 1U26A 4ZJLA 1UJ5A 1NHVA 2WSCC 1G6BA 2A6MA 5F3TA 2WBMA 2XNRA 3NG8A 4DLEA 4OYAA 3C16A 1YBAA 3UN2A 1SB6A 4ED2A 4KQZA 1SC1B 3C6TB 3W8PA 3HX9A 1TKDA 4JYAF 1PYTA 2WVFA 1U8SA 1J2VA 4QIWD 1H0HB 2E44A 4HTJA 3FEZA 4R5PA 2FPHX 1YX2A 2B6AB 2IRYA 4URSA 4UQTA 1LW0A 2QSFA 2YNGA 2LU1A 4WTOB 3GG0A 4J7CA 1X60A 2XMKA 1T03A 2R8GA 2XM3A 3M30B 2BW2A 4GO5X 1R27B 4J5OA 3RW6A 4M5LA 4J37A 3MEKA 2WVCA 2GGPB 4K4UA 4X4UA 1D9AA 2G2ZA 4LRBA 2YNIA 2R7VA 1JIHA 3W5ZA 2LDYA 4IO9Q 2HFOA 3LPEA 3CJTA 3QRRA 1ZETA 1XERA 4DG1A 4ZPCA 5LL6d 3Q8RB 4B3MJ 3C14B 3GIMA 3MM7A 4UOGA 2DHHA 5JJBA 2ZNYA 1KOHA 2EG2A 1JLAB 1FKPB 4CO2A 1UW9A 3T6JA 2PN6A 3D0IE 5HVGA 2CPHA 4B3RF 4WKRA 3PVXA 1FRIA 1RU1A 1LKZA 4DL0C 3KXDA 2PMWA 4E98A 2W7AA 2EC0A 3K58A 2CJKA 5SZTA 1RBLA 3NGSA 2IY5B 2DNPA 3TUZC 4DU7A 4YP3A 3G8TA 1TFWA 3J81j 3BBFA 1FXRA 4DPYA 4CYUA 1KKHA 4B3TF 2Y8WA 1SXLA 1Z1ZA 2V8HA 3DOMB 5C42A 1RYSA 3J7A1 2VODA 2FJEB 2N7YA 3NLCA 2CPDA 2MY7A 2VBZA 3CJ5A 3BQ1A 4DN0A 1CS4A 1GX6A 1VGYA 3VCDA 1PYOB 1U6FA 2Z2ZA 3NNAA 2VFUA 3CDUA 1RHMB 3M9OB 4N47A 1B0VA 2OMOA 2FGOA 2R2TA 5I3QA 4TYAA 3UNYA 4ZITA 3SSRA 2HWHA 2CNLB 3LF0A 3C6UA 5GAGI 3Q8VA 2D3UA 4A8OA 4A47A 2DHXA 1UJ4A 1VRUA 2M5YA 1KQKA 5B0EA 2VOOA 2HS3A 1SUQB 1V3ZA 3KMQA 1KTQA 3HVRA 2XBPA 1FKOB 5IXUA 3THTA 3V4IA 2HRYA 3VTIA 3ZTSA 1WJ9A 4NA1A 1TVRB 5CYMA 1V9OA 3N01A 1SJQA 4HR2A 2ZNZA 4MYTA 4RJVA 1JB0C 1JLEB 2YQ1A 3MECB 2FJDB 1MSWD 1ZPWX 4GVBA 1HR0J 1X9WA 1L3KA 4L73A 1C0UB 2LA6A 2HHWA 1UVJA 4YR2A 4O0NA 3HLUA 3HULA 3GMGA 3M6VA 3MEEA 2QLWA 1OS5A 5J2NA 1MROB 1WELA 3I87A 1T3OA 1H6KX 4QWDA 3IRXA 3PFEA 5A2QU 1SQEA 1KVIA 1JLGB 3MM5A 3MPWA 5AJ3F 3AY0A 3UDEA 4YS2A 4DSIA 2Q6CA 4NCAA 4FZVA 2KT2A 4CLZA 5L1KA 1WC1A 1TQLA 3FFIB 3EE3A 4DV7J 1WI6A 2XC9A 2FJBB 1NO8A 1T02A 4QCLA 3Q8QB 5LM7E 3MM8A 1RHQB 3FBEA 3VAGA 3EVWA 4K8RA 1H3DA 3OHAA 2F5GA 4F4WA 1I51B 2WBRA 1TL4A 1IR1A 3PV8A 4WYWA 1XJWB 1F9EB 1YZ6A 5D0HA 2IAJA 1VQ5S 2Z56B 4JV2A 3OR1A 5BR8J 1UKUA 4D3HA 5GMDA 4A8YA 3ZTRA 3MD3A 2JFDA 5L1LA 2IMWP 5K9FA 4CM0A 5KG4A 4ZLNA 1VDHA 3TA0A 5FLXU 1JLQB 1B3TA 3PRBA 3WZ0A 1X9MA 3RUBL 2VH7A 4RR5A 3B54A 1ZTWA 3VVUA 4ZIVA 3G8SA 4F04B 1S6QA 1WG1A 3HHLC 5CXTA 1B7FA 4QYZJ 5M2PA 3LP1A 1U25A 5IWAJ 4B3MF 3Q2SC 4DV4J 3E01A 3CJ0A 4BC9A 1PKUA 2BRKA 5KFAA 5CHCB 2G9OA 2EKNA 2B5JB 2CZVC 3KK3A 3PIOQ 2VFVA 2MY8A 3NOGA 3W9HA 1FJEB 3E8OA 4NCGB 4YB5A 3P96A 2JNJA 1ULRA 4OI2A 3UPFA 3KUEA 3H2LA 4Q0BA 5E7OB 1N5SA 5D4LA 3GR0A 2FHMA 4CIOA 5GVQA 3W3SA 3ISZA 3TZXA 3NWRA 3UO0A 3D1QA 1NDLA 3HFKA 1HYSB 5EN1A 3L7UA 3SDEB 4J9LA 3CF5Q 4DR3F 2NUHA 4IRCA 4F4YA 1NLKL 2CFXA 4ED5A 2EFVA 2HKEA 3MCMA 1S5ZA 5F9NA 4ERDA 3IXQA 5L1JA 2BYCA 4F50A 4Y2AA 2QA1A 2WB4A 1N4LA 2YKMB 1T9XA 2R7WA 2Y0BB 3RB0A 1U6BA 2RRNA 2ZDOA 1SJ3P 4DDFA 3J7YU 3LWLA 1H38A 5GAHI 5L9XA 2DKOB 4NLRA 3QT5A 2JC0A 1TUGB 2HVEA 1Q95G 2ROGA 4BHQA 1U2CA 4NLVA 2APOA 2E7WA 4IOBA 4WZMA 2BUNA 2OFGX 4JI0F 1Q16B 4OL8A 3RRGA 2YVSA 1XMBA 1C4CA 2CIMA 3BJYA 1RADB 4DFKA 4DOZA 2Y0SD 5D3GB 2KRRA 1S6OA 4C8NA 2QT7A 3M6WA 2XLIA 3PEHA 1DJ0A 1S6PB 4WK3A 1F1BB 2Z30B 1UFLA 2ZDPA 3SQGA 3AFGA 4C8KA 2IJRA 1P9YA 4ECRA 4YB6A 4O3QA 2XSJA 1NPKA 3KLVA 4DFJA 3W2VB 3WIVA 1KLNA 1WC0A 2AJFE 2J76E 2AJ0A 3FDSA 3QJLA 3EPGA 1FERA 1WWHA 4DR4J 3PACA 4YUDA 1Z2LA 5B0FA 1SV5B 1RTIA 3HMJG 4HL9A 4DV7F 1H2VZ 3MEGB 4QIFA 1LOUA 4RBVA 2DJWA 3PFOA 2HHTA 1VLOA 1C1CA 4DUZJ 5DDPC 2GQCA 2MZQA 4Y2CA 4HHJA 2OPSA 3GCXP 4M5KA 4NZ6A 4K4VA 2V63A 3PY8A 3RW7A 4LIWA 5CCLA 1LWFA 1IM4A 2PD1A 3W1YC 4OX8A 4EWTA 2C42A 3FBBA 4C8ZA 2MXYA 2CQPA 1OY8A 2VICA 1ZA2B 4QWBA 5F8NA 1C0TA 4LREA 5IT4A 2UXDJ 2DNYA 2NUUG 5ETLA 1VBXA 1VRTA 1UVKA 3BR9A 2I9SA 3D7SB 3CCJS 3K7RA 4WK1A 2I5JB 1VIXA 3BPSP 2ACYA 4OJGA 5IWAF 2HK2A 4DV3J 4NA3A 3THVA 3QYYA 1MN7A 4DV4F 2LP4A 2P5VA 1S9FA 4M1KA 3ENWA 2KG1A 4EEYA 1HNIA 3UN3A 2RQKA 2BOPA 1NU4A 4DPOA 2C2OB 3BREA 3F73A 3R5AA 5LJ3Y 1MN9A 1KEKA 5M2RA 4QYRA 1JQGA 4C48A 4PCQA 2MPUA 4WIQA 3AQPA 2J0XA 3W2WB 2KM8B 3EJMA 3TWZA 3ZXWA 3EDRB 1KVJA 2FD2A 1SKRA 2Z57B 2V94A 4DV2F 2Q6BA 2MGZA 1RDRA 2VASA 1HW8A 2FJXA 3PW4A 2E9ZA 3HD1A 3UDVA 5J2QA 4I67A 4ED4A 2HHXA 2CQDA 4IDKB 5E3CA 4A48A 3KKFA 5CH7B 1N34F 4ED7A 4M5DB 4TU8A 5HP1A 4WPAA 3E51A 1M90T 4LF4F 4G1PA 4R8UB 4LBPA 3P5BP 1ZS6A 4DS4A 3D2WA 4J9UE 4AD6A 4BCAA 2VONA 2UU9J 3ZC4A 2OPQB 1IR0A 3WC0A 4NASA 4DPWA 2PI5A 1VJWA 4DV5J 5B0BA 1ZZNA 4BWMA 3CJ4A 3DLBA 3J81Y 1A7GE 4MKBA 2ZC3A 3NCRA 2P2CB 5JUMA 3R2CJ 2IHR1 3TRGA 3MUVP 1FRKA 3FEYB 2LQ9A 3OL8A 1GNKA 5LMUJ 1MMLA 3GIRA 3ILLA 1Y10A 1G1XA 2IBKA 3BQ2A 3D4JA 3ZZPA 1CBKA 3DU5A 4RW8A 2FYXA 1Y5NB 2CQGA 2YWHA 1S1XB 1HWUA 3ZZZA 3FRZA 1U49A 2IM2A 4EU0A 3EWGA 3VR1A 4ELTA 3LWMA 3IN5A 3NGRA 4LF1A 2RMLA 2CG8A 1NKBA 5EX3A 2MEWA 3DHXA 3CSKA 4QR1A 3ZNUA 2G0IA 3IAM9 2MZ1A 4ATNA 2XZTB 2G4BA 3VAHA 5C25A 1F6TA 4ZHRA 1SH0A 4O4GA 1BUXA 1LWEB 2CAJA 2AP6A 4DR4F 2Y9HA 1R6VA 1RLDA 3TUIC 2B0GA 3K5PA 1VC0A 4OZJA 5KFRA 2X51A 5DS7A 2DHAA 1WHYA 1X31C 5L39A 2E5LJ 4JP8A 3TAMA 5JVHQ 1B0PA 1X0PA 4G65A 2K3KA 4WFYA 2HW3A 4ZPBA 1HKAA 9ATCB 4DUZF 1CULA 3QRQA 1S9GB 3I82A 3CCES 3TZWA 1NAQA 5DQIA 4QJVA 3GJQB 4CO0A 2DEIA 4RBTA 2MZTA 2DH7A 2ZBRA 4F2RA 2CQ3A 2I1RA 5ETSA 3JB9k 1NHKL 5B0DA 3JSYA 2DISA 3SV4A 4CLLA 2XHCA 2KG0A 3S6EA 4DR7J 2JJ4D 4HH1A 1DTTA 4DI6A 4QW8A 3PW7A 2ZZMA 2ZH2A 1NH8A 2UXDF 4C6AA 2MKYA 2ZD1A 1IQZA 5HBMB 5H9FK 4M95A 4H4MA 5MLCV 3IM8A 4C11B 3QFWA 3NAHA 2R8JA 2BA9A 4DV3F 1GMUA 3KJQB 3NS7B 3GYNA 2VG6A 1V3SA 4P2FA 2ZH4A 3VZHA 1I5OB 1NDCA 2GFFA 2D9PA 2Q43A 3TYTA 3VVTA 2OPRB 4WU2A 1FA0A 3RBDA 2LXUA 3K5OA 3BO3A 1ROFA 4CT8A 3CC2S 3UN5A 5F9LA 1R6YA 5KT6A 3UR0A 2RRBA 2NXJA 2UVUA 3FC9A 1IKXA 3KDOA 3HHLD 3T5KA 5CD4A 2HGLA 4K4ZA 2JL9A 2CQHA 1NPPA 2YY3A 4OJ3A 4P71A 3N5FA 2IRXA 2F3JA 4QZVB 4GC7A 4LF5J 4NZ7A 1IBLF 2MHEA 1FF2A 2IM1A 2ZFHA 3DOLA 5HANA 1RTHB 1H7WA 3PYEA 4ES2A 1E6VA 3LA0A 4QWEA 3R6LB 3SCJE 1AYEA 2CQ2A 2ZBPA 4B08A 4PUOA 4AL6A 1CQNA 1BC6A 4C97A 2HMIA 3C16B 1JJ4A 3LGHA 1NXIA 2B7CB 5AXLA 4LBIA 4UZCA 5IC6B 2ZH5A 4X4NA 4DV5F 4QU6A 4U7UK 2A10A 5F8GA 4F8RA 3I0RA 2QFJA 5LMNF 1N6QA 4HYKA 4R5PB 4G6VB 2VG7A 3OJUA 3MMJA 4DXLA 5LMUF 1RT2A 2BVZA 3LAMA 2YNGB 3Q24A 1NJYA 2KJVA 5U47A 2NSCA 2WW4A 4DPXA 4ZS6A 3IBWA 2VQFF 2QTWA 3FVYA 4K50A 4DL2A 3K17A 3ZO7A 1APSA 4NE9C 3UDCA 2BQUA 2CQ4A 2YNIB 3DI6B 1IXKA 4UUXA 5KFLA 1Y4ZB 3AODA 5FDLA 2J6TA 3VGTA 4IQXA 3DLKB 4DG1B 3FBFA 1RTZA 4JI4J 4KR0B 2EI5A 4KYZA 1IWAA 3MM7B 1QVFR 3IA0A 2KM8C 2UUBJ 1U48A 3TAPA 4KC5A 4A4JA 2B4VA 1WF0A 4I4BA 3TJAA 5DDQC 5D4NA 2QL5B 3MMAA 1EP4A 5DGAA 4USIA 1S76D 3BGLA 4CLUA 4EZ6A 2DGVA 1HWLA 2LXFA 4HLBA 3W64A 3HT0A 4CRJA 3K57A 4PXDA 1F2HA 1LQ9A 4I2PA 2L08A 1U24A 4CYUB 3EGVA 1HD0A 4C9DA 1R43A 3RBZA 2BKPA 4L76A 4RUBA 3US5A 4EBDA 4WTYA 4DL4A 4IR9A 2PE8A 1IWGA 1TP7A 2VFSA 5HN0A 1CS4B 2NQPA 3H5UA 3OXLA 1WOOA 4ID5A 1QSSA 1RTJB 3UI3A 2CPJA 4DR7F 2BJDA 4OZ5A 2KH9A 4JB8B 1Q78A 3W5YA 3DRXA 1KFDA 2IJNA 4O4RA 1YBTA 2C3OA 2ZZTA 2HRTA 3C6UB 3D9BA 2NXCA 1HQUA 1VRUB 5ETKA 3HI9A 5E2QA 1GH8A 3GONA 3DLGA 4U7CA 1FHTA 2GCFA 4UF4A 2ADCA 3CMAS 4KFBA 2K7KA 4NRUA 1S59A 1LW2A 3ETOA 3V4IB 1YRXA 4K59A 4PQUB 2LQBA 4MIAA 3TQ1A 2P9CA 3C19A 4I7FA 4ECSA 2RH3A 1FRMA 1SKUB 2WAQD 4DF8A 5CYMB 4CQ1A 1KD1T 2DK2A 2DPJA 3T19A 4F36A 1WOSA 3TA1A 3EPIA 4GVBB 4AXJA 3HFZB 4PPDA 1PSDA 2HZCA 3M1VB 4DR6J 1G4CA 2W4PA 3MEEB 2V4RA 1FTCA 5K8MA 2CPZA 5GAEI 1VQNS 1B64A 3IRXB 2DGOA 4Y34A 3BYRA 4DPUA 1UP1A 4PR6A 4F02A 4DQIA 4CO5A 3MM5B 2DT9A 2W2MP 1X4DA 3MMCA 4RNOA 3H25A 2LEPA 2R7XA 4OHWA 4CDIA 1SJ1A 4RO0A 1ACMB 3DYAB 3A13A 3PCOB 4O0IA 1RWUA 2VHGA 4ED0A 2IMOA 3TAQA 4F26A 3DDNA 5ETPA 1YJVA 3MM8B 3CE8A 2VG5A 1MW7A 1V3RA 2D69A 1I1GA 4NCBA 4NRTA 3ELHA 3HSDA 1T7PA 1XWLA 2XS5A 2VPZB 3T1HF 3FJ2A 3UE2A 1Q8KA 2A1BA 2IAJB 4U6PA 5E33A 1IKVA 1FESA 3IWNC 1HLWA 2AJQA 3OR1B 2CNNB 1T9WA 4DZ6A 1NEEA 4LSZB 4YOEA 2OKQA 2Z2LA 2KTQA 3H98A 1KBRA 2YWGA 3OT9A 1ICEB 3BGRA 3JAMY 4M8LA 3GTYX 3ICLA 5F8IA 2JDJA 4QOTA 4IH5A 3QT8A 1RT6A 3PKYA 3TQEA 4KV8B 1S6QB 2KJWA 4JI4F 2A2CA 2AF6A 4F0HA 2UUBF 4C7QA 2OTLS 3CGIA 1VQ8S 1YIJS 1JLFA 3CNQP 4RNFA 3CJRA 4RW7A 3A3OB 3A4TA 1S48A 4Q45A 4LSNA 3IC1A 3SXLA 4CH1A 2RSQA 4XPCA 3NXZA 4Q0BB 2X1AA 5GAGU 4B3OA 1U8WA 1NJIT 1DZ5A 2ILZA 2P9EA 4ER8A 5D0GA 1SJFA 1RCOB 1RWMB 4KHPJ 2VDIA 1PAEX 1SIWB 1Q7YT 2VC0A 4RX6A 1AT1B 4J9VA 5A8WA 1U1NA 2W8LA 4RZRA 3BQ0A 2GMHA 3NBPB 3UVJA 2JVOA 4USJC 4OI1A 1WSVA 3UCUP 1GT8A 1U47A 4URGA 2I2YA 5IV3A 4ICLB 5DETA 2O01C 4ANEA 4AQYF 4NMLA 1KLMA 4DZDA 4U7UD 5I42B 4OZ0A 5KOWA 1C1BB 1XK8A 4FBTA 4HTIA 2UUCJ 2W2OP 2FGCA 4TU7A 2AYEA 4HI2A 3CCQS 3FRYA 2IC3A 2MHNA 1Z4UA 4ZLJA 4MMOA 3Q23A 3PIPQ 3CULA 3PW5A 3LP2A 1SC3B 4LR8A 1BWEA 4DLGA 3KHHA 2Y1IA 2HPUA 1DBDA 2M2BA 3HHKA 2HQCA 4IG3A 4OZLA 1RT5A 1ZAXA 3ZZYA 4PYDA 4KIAA 2XS2A 3EGWB 4ID8A 1FKAF 3GZ7A 3PYGA 3HZEA 4OQJA 4YB7A 2KL8A 2GS8A 4FN5A 3N28A 4K7QA 1S49A 4LSLA 1NCLA 4F67A 3DM2A 2DGXA 1YKWA 2JHEA 1F9HA 1Q5YA 2HS0A 4F3MA 3LGNA 1RABB 5D0EA 5HQMA 4I6YA 2B9XA 3SQGB 1NJZA 3VWSA 1ZPVA 2M4MA 3DDKA 3A12A 2R7UA 4JI6J 3VAIA 2MQ8A 3EDQB 3QZ8A 5KFUA 2ZKTA 3T5LA 3DMJA 3TARA 3BH7B 3J7YI 2MKJA 2HIQA 3A3PB 3BEGB 1BWVA 2QYGA 2GVZA 2ZOGA 3NP5A 2BANA 1DRZA 1LFPA 3PX4A 4XPEA 2OSQA 2J8SA 3T9ZA 2DR9A 2OPPA 3HDSA 3TUPA 3X1LB 1RBAA 4BS2A 5CQGA 2PGCA 2FZKB 3BSOA 2X1GA 1FWKA 3HKZD 4LR7A 3JTOA 3SYZA 3QATA 1UW4A 4F4KA 2J7UA 3VQSA 2F63A 3R9LA 5D8HB 3CWJA 2CPIA 3BSCA 3TEHB 1TV6B 2OPSB 2QMUB 4B3SJ 1NK6A 4K2XA 2W7PA 1Y5LB 1LWFB 2DNOA 1WORA 2HURA 2EBEA 1RKJA 3WIUA 2CPYA 2VIHA 3Q8SB 1T11A 4IFVB 4ZPAA 3QPIA 4NLXA 5K20B 1TKZB 1C0TB 5CABA 1JLCA 4JI5F 2G0JA 2RKIB 2HBZB 3VQTA 3A8IA 2KDOA 1C4AA 3WX8A 4TN2A 1D8YA 2ZH9A 2R7TA 4YY3J 4NLQA 4GC6A 2Q1LA 1XR5A 1K0TA 2V8PA 2N3LA 4ZPTR 2DXFA 1FXDA 4NL5A 1VBKA 1F5CA 2YTCA 3KG0A 5KFWA 3OL7A 1VQMS 2EVZA 2HVIA 4M5JA 2W2NP 2EFNA 2R2UA 1HNIB 3MR3A 3EICA 4B9MA 1OQ6A 2HNDB 1OSDA 2HFZA 1AZSB 3V6DA 3G8QA 2Q3PA 2V2ZA 1HBNA 2HQFA 3EVMA 4KHPF 2VFTA 3CIMA 1VBZA 3CJ2A 2HG4A 2IRUA 3ZZRA 1U09A 1MMDA 2M88A 1RACB 4OYPA 4HKQA 3DOKA 3OVSA 3MDFA 3HSGA 1HI0P 3BSAA 5AXNA 1H98A 3ILIA 5J2QB 5B0GA 3M8RA 2FC9A 2EFOA 1FTRA 1RAHB 1IBCB 1KP6A 1NB2A 4GVLA 4YDDB 4XAKA 3CDEA 1NSKL 4I69A 3S01A 4USVA 2YQ3A 5KT5A 1K0VA 4EYHB 2R8IA 5HP1B 3QJJA 2H4WB 2HFSA 4KE5A 3OXFA 1UWBA 2UUCF 3KJVA 4KRWA 3EYZA 2HSEB 2ZJQQ 3BO2A 1S77D 3R5CA 2NPFA 2RAQA 1W2IA 3K5LA 1BGXT 2BDPA 2CRLA 3HXMA 2RB7A 4URQU 3ENAA 2C22A 4NLUA 1CPZA 3J7AN 2AEFA 4CLKA 2YX4A 4D3GA 2K8GA 3D3CJ 3ZFVA 3S8SA 2BABA 2DNHA 3CTRA 4ANDA 4LF8J 1BQMB 1H7XA 3TZYA 2KHDA 1SCJB 2J9CA 3HT3A 2ZOFA 3G6YA 3KLFA 2ZHOA 4GMKA 1V5IB 2DNQA 1R0BG 1JK9B 3M8YA 2H1YA 5HJXA 4RW8B 1N5TA 4NXMJ 1M5SA 3S7RA 3DC2A 1HQEA 1N8RT 1AFJA 1WHVA 2O5DA 4QIEA 4QR0A 2J6SA 3AOAA 3FNNA 5RUBA 2UUAJ 1N54B 1KSPA 4JI6F 3OBIA 3G2XA 2QLFB 3PR5B 4LRFA 4CH0S 4RW4A 2AKWB 2UVVA 4V1Ak 1FI4A 3DLEB 2VB6A 1S4FA 3FQLA 4FF1A 2PT0A 4ZHRB 2E9TA 3P45B 5A76A 2Y3YA 4O4GB 3QLHA 2J7WA 5DG8A 1RAAB 2H9ZA 3D6TB 1HHSA 3C2PA 5A8RA 3MAHA 4QR2A 2WCXA 5KG5A 5KFGA 4EGLA 5E0OA 3TAMB 4HHUA 1NK8A 2UVRA 4ZPVR 1LWXA 1GMWA 2MJUA 4U67Q 4L72B 2ZEJA 4KPYA 3UW1A 3MOJB 4DSKA 2QG9B 2GO8A 2QA2A 4NZ0A 2Y1RI 4B3SF 1WOPA 2H65B 2HFUA 2WSEC 4GKKF 1U1PA 4FYDA 3W9JA 5IT9U 2DNNA 4M63A 5KFDA 4OFZA 1X4HA 2BE2A 3UR3C 3ZZUA 1OPZA 3ZTQA 4NLTA 1GAOA 1S72S 1TMMA 5DO2A 2ZD1B 2G0CA 2QLXA 3I4HX 4H4MB 3DXSX 2NCKL 4YY3F 3HKWA 5KFCA 3PRVA 2W7OA 3TZZA 3QAEA 2V6AA 3QGGA 2V9WA 4AXIA 5A0YB 2HWTA 4K5SA 2ZE2A 1M1HA 5J2PA 3SSQA 4FKXA 2KU7A 2XYPB 4MK8A 1HNZJ 3QO9A 2FLLA 4B9LA 2IA6A 2PFDA 4X2BA 4FBUA 1OY9A 3EZUA 3NS6A 4J9RA 8AT1B 2P6SA 4C4WA 4P75A 2BBEA 3I5CA 5EDWA 3Q83A 2K1RA 4LRAA 2QL7B 1CQMA 3SIPB 1FFSB 3PO4A 5D77A 1KN6A 1HA1A 3EGZA 4C0BA 4G1QA 1QVGR 1RAFB 2XMMA 2U2FA 4P2MA 5HLFA 1QE1A 2ROEA 1M5HA 1CJTA 1E6VB 5KT2A 5EHHA 2Y8YA 1FD8A 2HBQB 2OEKA 4WFAQ 1FX4A 3M8PA 4RPFA 3JTNA 3KYLA 3V2UC 2X3GA 4DX6A 4DN9A 2RD5C 2ILYA 4CO3A 4A46A 3JYTB 3OW2R 2HMIB 4NEYA 1KQGB 1S9EA 3R5JB 2EPIA 2AIRB 3AT1B 2GIQA 2VJUA 6FD1A 3C66A 4EK2A 3V6HA 3PX0A 3I0RB 1FE4A 3HCXA 4B9TA 2DGTA 4ECXA 4KT0C 2JLGA 2VG7B 4LF8F 3HVTA 4OHZA 2EWHA 3H5YA 4TY8A 1RT2B 1HNWJ 1OJ4A 4I1TA 2I6WA 1R0AA 2N82B 3V6KA 2DRBA 3GJRB 2PEHA 2AJ2A 4LIRA 4NXMF 1MWZA 2EFPA 3KOAA 1FXLA 4NXNJ 1UETA 4JI7J 2NLWA 5FDLB 2DH8A 3IO1A 2UUAF 4CTAA 5DM6Q 1UA0A 5K14A 1X5PA 2R7OA 3O5TB 1X9SA 2HHHJ 3HSZA 5AT1B 1WC6A 3NGDA 3MMAB 1EP4B 3DRPB 2HQ3A 4ZPDA 3B6BA 3R3TA 2BOAA 1NRKA 1Q8BA 4E8UA 5ETTA 3BF4A 1MU2B 2LMIA 1UZHA 3R1HA 4BLGA 4OI3A 2DTJA 4LVOP 3JQKA 5KFFA 3FSXA 4I2PB 2DB1A 2AYGA 3FEXB 1M5VC 2X1FA 4TLRA 1EIYB 2G2YA 1TK0A 4YQWA 2QO3A 3U02A 4CO1A 4DL6A 3KK1A 4DR1J 1UZDA 5H9FJ 4ZDNA 3BYPA 4KH0B 4R25A 2B8QA 2E5GA 3GE9A 5IQ6A 1T05A 4OHYA 3QWUA 1KNZA 2AYBA 3G6ES 1NM2A 4DHVA 1PC4A 1RWOB 3CCUS 4PXBA 2AEJA 1N56A 3GYXB 3P3DA 4ZVQB 5EUHA 1UVMA 3NGKA 3CCTA 4DL7A 3HO1A 3KNGA 3MCSA 3CIZA 1CC8A 1MNEA 1RJJA 1TAUA 5ETRA 1FNMA 4AE5A 1SVDA 2CJAA 4P73A 3BDPA 3KJNB 2EXUA 3GFZA 3DLGB 3EUNA 2HVZA 3ITHA 2VA2A 4KFBB 3ISNC 1HNZF 1AUSL 2ASYA 1H2TZ 2B6AA 3TJ8A 2AWZA 4B9NA 2GJFA 1TL1A 3HSJA 1E6YB 1WEZA 4I7FB 5JXSA 4CH7A 4PAAA 1NZAA 1DY3A 2GHPA 1TELA 3DKDA 2DHGA 3M30A 4XDDA 2MLZA 1REVB 4JV0A 4H4OA 4ECWA 1A9NB 4KBIA 5KFYA 2HHUA 2BM0A 3HZGA 2J6UA 5KG6A 3FZ2A 2YH1A 5IZHA 2FQQB 4ZIWA 1FWPA 1QAXA 1KC8T 1OYDA 3CPWR 1CJKA 4LF7F 3OL9A 4OX7A 3QIPA 2FHOB 4K4TA 4NLOA 3CJQA 1YITS 1M1KT 2IPOB 4E0DA 2COLA 5KT3A 2QA4G 2P9GA 1DQAA 4DV0J 1F3VA 4C8MA 1Q0NA 3KK2B 2FZGB 4MYUA 4F4AA 2DGWA 2D9OA 3CJSA 3H42A 3QQCD 3VAFA 1V5VA 1LFWA 3OR2B 1Q79A 3I31A 2XZDB 2GX8A 1I94F 4U8YA 3M2UA 1IKVB 5FJ4A 4EYIB 5HMZA 1HNWF 3A3NB 1S97A 1IVZA 3VALA 2EEYA 1MWYA 5HMWA 3T5HA 3VAJA 5DQHA 4YR3A 1HW9A 3F56A 3BGRB 2HVHA 1UA1A 2MZRA 3D5MA 3CDAA 3OTBA 3C8YA 3JAMU 2Z2YB 2DGQA 1RT6B 4KO0A 4JI7F 3NNCA 3H8YA 4C3KA 2IDLA 1S1WA 4CNZA 2MZJA 4KH1B 3KLHB 2R7QA 4PG4A 1NBEB 3BBCA 1N32J 4IG0B 2HHHF 1JLFB 1V6HA 3G6VA 4DV1J 4X4TA 4P6QA 1Q82T 4ILLA 5F8MA 4LSNB 5F8JA 1JXEA 4WJBA 5G0RA 1B70B 1NB7A 3K59A 2XG8A 3NL0A 5EWEA 3PW0A 2YNHA 4M5GA 4B3OB 2W4DA 3R5BA 2PDAA 1FFGB 2YKAA 3GPAA 2VBXA 2QFIA 2BR0A 2ZVSA 4IR1A 2Q66A 2GQQA 2IM3A 1TVRA 5L9NA 2ZHBA 5A8WB 1QAJA 4AL5A 1JJCB 2BE7D 3LOUA 3UVJB 4QW9A 2KN4A 5L1IA 2DVIA 1HIYA 3R2DJ 3G6XA 2FVQA 4R0EA 2Y1JA 2ZUAA 5HK4A 2N3OA 1RTDA 2HQDA 5KFIA 1IKYA 5HAOA 1KLMB 2QJ3A 2V8DA 1P9QC 3MMBB 3RG6A 1ITPA 1CSJA 3OFFA 4O3RA 3BBBA 3OL6A 5HQLA 3MAQA 4LF9F 2W9CA 3EGNA 5HMYA 4LVNP 3TOQA 5GAEU 1WEYA 3WC2A 2IC3B 2I38A 2OMLA 3RR8A 3RU0A 4ELVA 2ATCB 2BZ2A 3QGHA 2OH2A 1RK8A 1VC5A 4A8QA 1YJRA 4IG3B 1RT5B 1XTZA 1JMTA 3R8YA 1JJHA 1YLXA 4QPTA 1CVJA 4Y00A 4X66F 4DU8A 4PG7A 3H0PA 1FD2A 4ZP9A 3BGOP 5KG0A 4Z2XA 4LSLB 4RNNA 1RE1B 4E2FB 4TNOA 4IFYB 1EAYC 4AT1B 1NZ8A 3KJFB 1JLQA 5DLGA 3PDNA 1U2RA 4DUYJ 4I0WA 4YHHJ 3PX6A 1D8ZA 2V2QA 4DPTA 4F2SA 2DO4A 2MKSA 5KFEA 3LO3A 3DMJB 2J8AA 1UEUA 1TAQA 5D0RA 2GVZB 2BJEA 4RU9A 1RQ0A 4QQBA 2M0GB 2ZBQA 3W9IA 4CLTA 2M70A 2B5JA 3DRSA 4LF6J 4NCGA 1ELOA 2FDNA 4M5NA 1S1TA 2B9YA 4DV0F 5CAAA 1Y3KA 2ZJPQ 1LEOA 3T1AA 1JNZB 3D67A 3R7SB 3Q89A 2Z4PA 2BJ8A 4TQRA 3CCZA 3I6PA 1SL1A 3TVKA 1L3SA 1N52B 2G13A 2QX0A 2OHDA 1JXLA 1A0OB 4Z7CA 2KFZA 1TK5A 4USMA 2KB2A 2L48A 4ZVRB 2I0XA 1FNOA 3GCWP 3X3UA 3MCNA 5C7PA 1GQEA 1TMJA 1RWPB 3EZOA 5KFMA 4USTA 1LXJA 1PJ5A 4W92B 2FB0A 1IBKJ 2CQ1A 4XIUA 1AFIA 2GAGC 1DTQB 1HBMA 1JLCB 1DARA 4U96A 1JJ2R 2QV6A 2YKMA 7FD1A 2HHPA 4X4RA 4DEZA 3D68A 2PMZD 1VQ4S 1WKLA 3AOCA 3D6FB 3T41A 1VHFA 3GJSB 3AOBA 2F8HA 4LMZA 4MT1A 5E3QA 3CCMS 4ZVHA 2BJ1A 4DS5A 1RAJA 3O2IA 1LV5A 2BM1A 1N32F 1SC6A 3Q2TC 1NDKA 2GA7A 3T6BA 3CCSS 4DV1F 2MTLA 2A2DA 4I2QA 4O3NA 4FYWB 1U1LA 4DV6J 3H2UB 2FVPA 3PHTA 2K7JA 1VQOS 1XC9A 3FGVA 4FS1A 3BS9A 1G7CB 1HWJA 3V6DB 2QSWA 4USHA 3LP0A 2LU2A 1HBNB 4QIGA 3O6QA 4HVZA 2L41A 2GQ2A 1CJVB 3I96A 2VJVA 3WHIA 1T0TV 2V68A 5LXRA 2NXNA 2VC1A 1X5OA 3IBCB 3RRKA 2LVWA 3MR7A 5ETQA 5HROA 3RAMA 2QC3A 5E3AA 3CT9A 2CDQA 2IM0A 4WFBQ 4LJMA 5EWFA 1U7LA 3V81A 3W60A 3N0VA 3BO4A 1S6UA 4HACA 5ETMA 2QMXA 1W26A 5EWGA 2D1CA 1UWBB 2MQOA 3KJVB 3CMQA 2B4PA 3I9V9 4NMXA 2HFVA 1HNVA 4YR0A 5DGBA 3A1YG 2HNYA 2JFKA 2GV1A 2Z8QA 3MEGA 4ZVTB 4DR2J 2E1AA 4X4QA 4ZCIA 1CG2A 3KUHA 2J0QD 4HDGA 3U1MA 2UXBJ 1PO6A 4LRDA 3HJFA 4OYXA 4F0MA 1S4EA 4DQQA 3HF5A 5D4OA 3P4UB 2HHQA 1VQLS 3KLFB 3D0HE 2ZITA 4WE1A 2XQCA 1AROP 3KG1A 2JEGA 3ET6A 2B3TB 3MI7X 2OSRA 5BYSA 3DHWC 4C0HA 2XS7A 5ETVA 4F7VA 1HQEB 1N88A 2QIFA 5H9EJ 5KAKA 2XGPA 4B9UA 3DLJA 3NKYA 3UD3P 1W25A 1HR0F 5IFMA 4DUYF 4YHHF 2RDIA 4J91A 3ISND 1R7IA 1FCAA 1X4EA 4RW4B 3CCVS 1TL5A 4F25A 4PWWA 4MKVA 4RW6A 5DLFA 3DFEA 4FVCA 2OD6A 3QLHB 2Z58B 4WKYA 3BR8A 3F44A 1GXUA 1N0VC 4MKYA 2UV8G 4K4XA 1XNRJ 2CPEA 3T1YJ 4OX9J 1PGZA 3LANA 5A8RB 4YB1P 3UCGA 2EKYA 3H5XA 1HI8A 4LF6F 2HK3A 4X64J 3TO8A 3MR5A 1FWLA 2OLWA 5I3PA 4Q7AA 1M5KC 2BEFA 5IC4B 3OTOJ 3FSYA 2WVBA 2BQ3A 3IMQJ 1YJWS 2YX7A 2XZWA 1RWNB 2BMBA 2Z2MA 3N6NA 5GMKa 2HS4A 6FDRA 2H5IB 4U95A 2RIJA 4C3MA 4ZK7M 1U2FA 3PM9A 2QLJB 1N5YA 3AD8C 4DJBA 1HFEL 2LFVA 4QWCA 3Q8YA 2CADA 1RSCA 3ENVA 2UZAA 3ENQA 4DFPA 2G2OA 3JXOA 5E41A 5BR8F 1JLBA 4M5DA 1TKXA 2B4UA 5HATA 2EFGA 1EHWA 3TA2A 2BACA 2WZ1A 1N36J 1T95A 2KVQE 2KYZA 1CLFA 3NCPA 3KLEA 4A8SA 2KHCA 4RNMA 2ZE2B 2E7XA 1F60B 1AXQA 4ITSA 4LBHA 1RT7B 3AAWB 5J2PB 4IKAA 3TR5A 4CWBA 4EO8A 3QO9B 3MTKA 4DCJB 3MGJA 1ZM3A 3HK2A 1WTFA 1ZOTA 1YJTA 2CQBA 4C98A 2XWXA 4PKDB 3UQSA 2OTJS 3I0SA 2CNKB 2NS1B 4NLDA 5A6PA 1T9VA 4F0KA 2NXUA 2HLTA 1P1TA 2LEAA 3QSYB 2K1RB 2WK4A 4PWDA 5E5NA 1WHWA 4LUBA 4V19J 4G1QB 2HVDA 4ZCLA 5C24B 4A8KA 1QE1B 3SFGA 4PG6A 2JSXA 4CCHA 2FZCB 3PR4A 3DRRA 3M8PB 4IRKA 4OYWA 4L6V3 1ZAWA 4AYBD 2JLFA 3I4PA 5K8NA 5HO4A 2O66A 1Y9OA 4J9QA 5KG7A 4B3RJ 3QWPA 1LWEA 2KFYA 1F5AA 1SI9A 4KSEB 2W8KA 4ZN3A 4RL1A 2WONA 2B9WA 2YPYA 5KT4A 4RLEA 2IIHA 4L3NA 4CT9A 1X4GA 4Y2IA 4GO7X 4ECVA 1EQ0A 2DO0A 4FVMA 2GO9A 1NJWA 1YWXA 4P2XA 2Q79A 2PA8D 4C3LA 1YJ7A 2GNKA 2L9DA 4TY8B 5ETOA 2ZH3A 2KFNA 5L38A 2HRUA 3A8JA 2FHKA 2HQGA 2CJXB 3R1LA 3DGPA 1R0AB 3QJPA 1H72C 4DFMA 1Y3JA 2MQNA 4WP9A 1TTHB 1K1SA 1T94A 2WOMA 3VAMA 1X0FA 3R6GB 4LT6A 5KFSA 1D1UA 2PC6A 4KKOA 4IH7A 5F41A 2RE1A 1LWCB 1QAYA 3RB3A 1U45A 1KOOA 2XSFA 4UOFA 2DIUA 5HBMA 2RQCA 3MUMP 4CTAB 3TUJC 4ZVEA 1HMVA 1EETA 5K14B 3GJTB 1HNXJ 2R42A 4RUCA 4AUKA 2D3OR 3IRWP 4ZN1A 4O23A 4BWJA 3W63A 6AT1B 3MAAA 4HHHA 2VUGA 1VK8A 1IKWB 3Q86A 3ZZTA 4MAKA 3K89A 4B17A 1XNRF 2XO6A 3T1YF 2GIRA 2OPRA 9RUBA 3QSIA 4ZVFA 2DCLA 3OFGA 4X4PA 5BJRA 4DQPA 3HHEA 3UWTA 2DYAA 4EBEA 1XMOJ 3KLIB 3G82B 3IGNA 3OXGA 5A8KA 3VHQA 2RQ4A 1DQ9A 4ECQA 3CJKA 1F5BA 1QAIA 4DSFA 3HHDA 2FLNA 5CA5A 1FVSA 2HAIA 2EG1A 5CZVA 2Z0GA 1WC3A 1CJUA 2IVFB 1T05B 3ILOA 2B4OA 1BLUA 4GRSA 3K0JA 2M8DB 3PKMA 2GAHC 4MFBA 1QSYA 4K4WA 5IT9Y 4DCPB 1S99A 5HJYA 4M94A 1VK3A 3I9ZA 4DWIA 5AJ3J 2WVEA 2ZVIA 4KJIA 3AH6A 4I64A 1DLOA 1X4CA 2AX0A 2A18A 1N36F 4TY9A 3FCVA 3TJ9A 1U1KA 2VBWA 4Z37A 4ZKAA 4WFZA 3GB0A 3SEOA 5J1EA 1W7WA 2GVDA 2C2DA 2HNZB 2FHJA 1VLYA 2KT3A 4IOAQ 2RHQB 1YJ9S 1WG4A 4WFXA 2LCWA 3PRDA 3ITHB 1XIQA 2JC1A 4F3OA 2AX1A 2HEKA 2OGUA 4P72A 3MEDB 2DGSA 1TL1B 2DRDA 1VC6A 3RAXA 2DY9A 1RAGB 3GV5B 3VGVA 1HBOA 2IA0A 1RZMA 2WTFA 5LSLA 3I5AA 2XWYA 4IUFA 7FDRA 2ASDA 1UPMB 3IBFB 4H4OB 1YI2S 2J5AA 4LFBJ 3DI6A 2C2NA 3N5BA 4MIWA 3KHLA 2MKIA 5K8OA 3GIIA 3CJ3A 1OO0B 1UL3A 2YPZA 3MFIA 3DLKA 3PYFA 4WYLA 1T9YA 2QE5A 1CJKB 1G2EA 3MCOA 2R9LA 4ED3A 1S1VB 1ZZFA 3M32B 1KFSA 2V2KA 3QIPB 1S57A 1BHNA 1T3NA 5CYJA 3W66A 4XDCA 3UCZP 2ZZNA 1KS2A 3G96A 2R4FA 1FEHA 2J9EA 2NZ4A 1S79A 3PJ9A 2RF2A 1N5QA 5BXIA 4UOCA 2YH0A 3MPVA 2C3PA 3CD0A 2UU9F 1BQNA 1S12A 2LQJA 2CUYA 4LRCA 2KO1A 2SXLA 2PFFB 5KFHA 1URRA 2J7KA 4K2JA 3CD7A 2XMWA 5IM0A 2AT1B 4B9SA 3CW2C 2ASJA 2JX2A 1SBRA 2LQ8A 4DR3J 3MOZA 2ZH8A 1SH2A 3M2UB 3AJ1A 1FRJA 1LW0B 1UVIA 2V8VA 1T03B 4NEZA 3V4MA 1KWMA 3OV7A 4W4MA 1RTJA 5T7LA 3FSIA 2FTRA 2YKNA 1YGYA 3FCHA 2DR7A 4N76A 4KO0B 2DR8A 4ES1A 4GKJJ 5J2MA 2BJ9A 3G4SS 1S1WB 5E3PA 1NKCA 4NLSA 5BYRA 3OQ2A 1EARA 2IVMA 2MMYA 4P10A 2Y1LB 4FPIA 1HNXF 2CVEA 3I32A 4J9NA 2DNZA 3VGSA 2KZMA 5G0RB 1HWIA 2GMLA 4JI0J 4FXDA 4BDPA 5KG3A 2YNHB 2AMCB 2B7BB 1R8BA 4PQUA 3OSPA 4F3QA 1WTBA 2E5LF 1VJQA 1XMOF 2ATLA 1QUPA 4H54A 3AD7C 1RKIA 1JKHA 5KOXA 1H2UX 5C42B 4ZVPB 2JWNA 4X84A 2AGOA 3M1VA 4NLWA 3KHRA 3GIJA 1L3TA 4HEA9 1RTDB 4UQGA 4RWWA 1PILA 3UD4P 1IKYB 3AA9A 1ZYQA 2E66A 1FO1A 3QAUA 1VMBA 4KHMA 2YNFA 1VR6A 1VOMA 2CWKA 4KGMA 3DYAA 1J5OA 1RBOB 1NSQA 3S1TA 2W9CB 5HVFA 2K06A 3MXHP 1YRUA 4L75A 3OPKA 1RT4A 3AXMA 2OEJA 2UUWA 4ZP6A 2KZZA 4OI6A 1ZM2A 3RGIA 2D3O1 2U1AA 5AE3A 3SI8A 2D41A 5GADU 3ZZOA 1RYRA 4A8WA 2H5EA 1X8DA 3GFXA 1MG7A 4RU2A 4QWAA 1M0SA 1UJ6A 1BQXA 3LW5C 2W4CA 1K9MT 3UDLA 4LQ9A 1ZA1B 2HGNA 3AB2B 3P6YC 2V2VA 5AE2A 3C46A 1TUVA 2GIFA 1FJGJ 4LFBF 1U0HA 4PXEA 3JTPA 3CJ8A 3TW0A 4ZVSB 3M7VA 3NEKA 4LF5F 4MTPA 2EK6A 1XR7A 4J9PA 1QTMA 4KV8A 3TI0A 5J2NB 1L3UA 2QA4S 1RISA 4NYOA 1FDNA 4EBCA 2RJZA 4WIIA 3KWMA 3O3LA 5KFOA 2GJIA 3DRSB 5I3UA 1MWQA 4NI2A 1HBUA 2LECA 1WI8A 2K2PA 3BV8A 1R8CA 4IO1A 3H59A 5IQQA 1S1TB 2VQEJ 1IBMJ 2PSZA 3ZZ0A 2CDRB 5JMNA 2XYGB 2N4DA 2C3MA 1VI7A 2CQCA 1RI7A 3H20A 1I6JA 4LR9A 1C2PA 4YN3B 4YDXA 2CZ9A 4DV2J 3TVZA 3NBPA 5HI7A 5IS2A 4H4KC 3D3BJ 8RUCA 3W8GA 1VQ7S 4P7VA 1NK0A 4I56A 3OLBA 2JLEA 2LDIA 2NYHA 2W1BA 4X62J 2DBBA 1N34J 3AJ2A 4ICLA 2YKPA 1HBMB 3DN9A 5DZ6A 4LF4J 2VKRA 2F8MA 4N7TA 5I42A 2B51A 2V9KA 1C1BA 4ZCKA 4GKJF 1WACA 3CVKA 1PAUB 3DGVA 1NK9A 4FP9A 3LP1B 1VQ6S 1RHKB 4AFFA 3E01B 5KFVA 4OYMA 1F2GA 1OPIA 1XBWA 1RA7A 2XY7A 5F0WA 2E5IA 4I2QB 1TL3A 4Q2MA 4NLGA 3KK3B 3BGUA 4UZBA 2PEBA 3KTQA 1KTVA 3J80Y 3LP0B 2FVSA 4ES3A 1D9DA 1RUSA 2VBYA 4WP3A 2IBOA 1U1RA 1F0XA 1Q53A 4DSEA 1YDLA 4TKTA 2F9JA 2CVIA 2NREA 1TL7A 1UEKA 3GLJA 5HROB 1T9UA 4CI0B 1EZZB 1VQKS 2UXCJ 1TZ0A 1O5JA 4FS2A 2KXFA 3AD9C 2RUSA 1TR0A 3V81B 5F8LA 1S1UA 3HVAA 4HACB 4DL5A 4TYBA 1NH7A 2BX6A 4LF2A 1NSPA 4CLFA 2XY6A 2EFQA 4Q8EA 4OYOA 3ZTOA 1O0PA 4ELUA 1Q4RA 1VQ9S 1JXVA 3C15A 2RQMA 1HNVB 1N5VA 1RT1A 2HNYB 4M5HA 2O1PA 4LQ3A 1P27B 3A8EA 2YKQA 2OFHX 3L95X 2ZBCA 2GZOA 3MR6A 3U1LA 1K1QA 1QDUB 4AL7A 4OI0A 5K5MA 2ZOMA 3BZQA 2A0FB 1TV6A 1K44A 2EC2A 1UVNA 1SH3A 4WE1B 3OD2A 3D6MB 5L46A 3ET6B 3ONQA 2B9EA 2F7VA 3JQJA 5DRKA 2AHOB 2C28A 3M8QA 4IFVA 2L3MA 2MDAA 3P8BB 1TKZA 1BD6A 2NYIA 1FJGF 4X65J 3OJSA 2RKIA 5B0AA 3CC4S 3NY0A 4EO6A 3SV3A 4DR6F 2C2ZB 4NLYA 3BPDA 3IR5B 2XSJB 4PQAA 4KGKA 2BV3A 2MLXA 1YK9A 2VL1A 1KQFB 5KT7A 1T9TA 3IS9A 4RW6B 4JI8J 4P9SA 4CLYA 3IG1A 1OYEA 2AW0A 3OTDA 3MZIA 4ETXA 2ROPA 2PI4A 2NPIA 1RP5A 2HAFA 4IH6A 3SSSA 1WG5A 2M7SA 5H9EK 4UUWA 2X7IA 2HNDA 4O44A 1RTIB 2H48B 2XNQA 3H4DA 1AZSA 2VQEF 2W25A 3OUYA 1IBMF 2RS8A 4CP5A 3R5DA 1Q8LA 4ALZA 2MQQA 2W24A 2LQ5A 2VU5A 1C1CB 3NGTA 4M5MA 1GMWD 2JZ5A 3GSIA 1ZAVA 4KGZB 2DNRA 1WC5A 5B09A 2HYIB 1IBLJ 4N8OA 1N5YB 4ZP8A 3G86A 5IOLA 1PJ7A 4JV5J 3IWXA 4KB7A 5CCMA 3KNAA 4OYZA 4X62F 4OJHA 1JLBB 4YEAA 3D28A 1TKXB 3ETMA 1R8PA 1VHIA 4IRDA 2NSBA 2P8IA 3AHPA 1K47A 2DNLA 3KLGA 1HQ2A 1VRTB 4FYYB 4NYPA 3UD5A 1B0TA 4ZLLA 1CC7A 5DDRC 4A8FA 1FJ7A 2RILA 4ECZA 2FJVA 3LGMA 4JI2J 3KLEB 1H74A 4OHVA 3M2RA 1RHUB 5M2UA 4DX8H 2C2KB 1RLCL 3B78A 4NOHA 5LMNJ 1X7VA 4OX6A 3GQCA 3NWGA 5KTQA 1X5TA 3MPYA 1WUUA 1XN9A 2IFXA 1RWWB 3JSMA 4CLWA 3EX7B 1BQMA 1GTHA 2CJ9A 3QRPA 5LSRA 2OUGA 3I0SB 2E1MC 3I55S 3B8HA 3M05A 2VQFJ 1R8AA 1OQ3A 4QU7A 2D3ZA 1VQYA 1OY6A 4ZLPA 4PWDB 2MGZB 4Q8FA 2RUGA 2XTJP 5CYQA 2DY1A 5KFZA 2UXCF 4W98A 3KG4A 1RT3A 1TKTA 3POTA 3T3FA 3DRRB 3NNHA 3DLEA 3RRHA 1SL2A 2WVDA 3TEGA 3THPA 5J1NA 3JSBA 1RWKB 1QUVA 2DR5A 4K4YA 1SPBP 2UVWA 1FRXA 2CZ4A 4ZCMA 4OMFG 1R89A 2VPXB 5L8RC 4JUZA 1YRTA 3TNVA 2V5HG 2WONB 3MM6A 2VD3A 4NA2A 4DCOB 4ZJQA 4L3KA 5THWA 8ATCB 4FNIA 3CEDA 1D3WA 2POKA 2KVIA 4EUVA 3OFHA 2H51B 2M52A 4FYXB 4OV1A 3I5BA 5J1PA 3CXCR 2QRRA 2DPIA 2CPXA 4ZVUB 3BB5A 2XY5A 1Q5VA 3SBMA 3RZAA 2DHSA 3DGPB 2V4QA 2QL9B 1WEXA 3P49B 2VF3A 2BRLA 4I6WA 4KHRA 2CJQA 5D78A 2WOMB 4DBQA 2XCPA 4Q44A 4ZMMA 3NCQA 2FUG9 3GR1A 2XLJA 4X65F 4KKOB 5F0UA 3KDNA 2BJ3A 4M5IA 4USUA 2ZJRQ 4LFAJ 3BM7A 3HD2A 1HMVB 1EETB 4ED8A 2MQLA 3H90A 4PZVA 5EX0A 4JI8F 3PTWA 5DDOC 4ZA1A 5C25B 5A0YA 3M2VA 3MAAB 2PIIA 1RGVA 4P52A 4TLQA 2C3UA 3R97A 2YWWA 2YWEA 4NPOA 3RYLA 2YWFA 4J9SA 2GC8A 2V34A 4TVAB 1EJ7L 3D54A 2QMWA 4FYVB 2AEMA 3FKBA 1HPZA 3QGPA 1VCTA 3MR2A 2RVJA 1AB8A 3OVBA 5JVGQ 1PJ6A 2KI2A 1DURA 2NZCA 1JNRB 3OLAA 5A8KB 2ALZA 2F9DA 1K8AT 3CJKB 1CULB 3D66A 3CD5A 3IWLA 1MLAA 3MM9A 2C2MB 4G1IA 2XMVA 3T5JA 1FT8A 4JI3J 4RW9A 1CJUB 1S7HA 5F3ZA 1D0EA 4RBUA 2V4JA 3MFHA 4JV5F 2MLYA 2FLPA 3UFCX 3PJXA 2YX1A 2XMTA 3T9NA 1VQPS 4MFBB 4O3OA 1EKRA 1WC4A 2E5JA 1QM9A 2R3VA 1YJUA 1VQSA 1PC5A 1DTTB 1XEZA 1TK8A 1Y00A 4PYAA 4OI4A 4V19X 1DLOB 3SZ2A 2IJFA 2YXLA 4YMEA 1OMSA 3JYTA 4HT7A 3E2EA 4JI2F 4DSJA 3PG9A 2LXIA 3CCLS 5J1EB 2GVDB 1YSJA 1YTYA 5A6WA 3QBCA 5HQ8A 4OJ1A 1FK9A 2VG6B 3CO9A 3G87A 1GTEA 2M9KA 2C2EA 4PRFA 5T14A 4CLSA 4W90B 1S0VA 3T1HJ 3DRYA 1HHTP 4N8NA 4HH0A 3PO5A 4ZJOA 2HBYB 1CEZA 1HBOB 4Y0FA 4XTTA 1IKXB 1WDTA 1JX4A 3D1OA 3O44A 5LXYA 3RBEA 4ZPWR 1SKWA 1LNQA 3O1LA 2JEIA 2IVYA 2V8GA 1O8BA 4QBUA 3H4BA 2H3EB 1RHJB 3KMSA 3M8ZA 1YZ7A 3GWCA 2F4VJ 2DEJA 2BW7A 2ZBIA 2MQPA 3DOLB 4ILRA 3QT7A 1U1QA 2XLKA 2DCUB 1SC4B 2M8HA 1DQ8A 4DQRA 3W61A 3OTEA 2CPFA 3CC7S 5LT5A 1EB0A 1UCNA 2AZ1A 5G4DA 4PUOB 3DRPA 3RB6A 2OEMA 3A8KA 3GP9A 2RF2B 4DL3A 3R27A 4FKYA 4S0MA 1MU2A 1QTNB 3QGIA 3BH6B 1BQNB 5C2GA 2HHSA 1VS3A 1WHXA 1F3FA 3CCWA 5IM0B 1N6QB 2W9BA 3QNWB 1TUWA 4QPXA 2PMHA 2B56A 5KFJA 2RU9A 3MTJA 4FF2A 4ED1A 1P1LA 3DLHA 1JWWA 4RUHA 1YJNS 3MWBA 4C8LA 1FDBA 5DM7Q 2R2RA 2ZHAA 1GEHA 4OZ1A 3NMRA 4AQYJ 3CD6S 5T7LB 2E5HA 2YKNB 3B82A 5DG9A 1IJFB 4X4OA 4KTQA 3NRBA 2BE9B 5J2MB 3C3LA 1GX5A 4LFAF 3MF5A 3Q0AA 2EK1A 1SQGA 1Q8IA 3BN7A 4MIBA 2ZWOA 4TU9A 3NOCA 1Q81T 7AT1B 3DCAA 1YG0A 3WBZA 2OJ3A 4NX9A 2YQ0A 2CG4A 3M8WA 1TFYA 4B02A 1E6YA 3HHLA 1RWXB 4OLOA 4RUAA 2PA3A 3OFEA 1VYAA 4IQMA 3KUGA 1JKHB 3Q22A 3LTOA 1REVA 4JI3F 1M5OC 3VZIA 4DMZA 3WDOA 1NMEB 3ZTPA 2FJWA 1F9FA 1REGX 1GK8A 1U0SA 1B7YB 1OIAA 1RAEB 1S0MA 2AGQA 4WU3A 2ASLA 3GV8B 2HGMA 3CDWA 4ID5B 1ZM9A 2R8HA 2XHWA 4CO4A 1NNDA 2O3DA 1OSCA 2YNFB 1KVKA 1TU0B 1J5OB 2F8EX 2ALYB 1RT4B 4DSLA 4H4KA 4NLPA 4UTGA 1X4BA 2DH9A 3KK2A 3O8WA 3ILJA 1HQUB 1Z2ZA 4N77A 2C2RA 2YWKA 2KKHA 4PABA 1Q86T 3H5SA 4RKUC 4FF3A 1L5UA 3C6TA 2XCAA 4KY3A 3OR2A 2ZM6J 1DHMA 1J5EJ 1LW2B 2L9WA 1SL0A 4XK8C 3VV2B 1IJEB 3IR6B 3W7BA 2H54B 4DQSA 4C0OC 4A8XA 3KFWX 4N41A 4DX7A 3WQPA 2X3DA 4Y65A 1U0HB 1UMJA 1PCAA 2ZC4A 2GGPA 4JI5J 5HVHA 2CKWA 5KFBA 2V50A 3AJDA 1IQTA 3U7JA 2F4VF 4JBCA 3UNGC 1S0NA 3RJMB 3OSNA 2QZ8A 2R7SA 1QJHA 3KLHA 1I3OB 2HIYA 2IYIA 3M6XA 3C14A 3DU6A 4P7TA 4IG0A 3MMCB 2JRSA 1X5SA 1BE4A 4JI1J 1JLAA 1FKPA 2MSSA 4UY85 5I3UB 4NI2B 1HBUB 1Y7PA 2XGQA 5GADI 2XULA 3LAKA 2RDJA 1U4BA 3HHNB 2XMJA 2CYYA 1S10A 3GV7B 1URNA 4ILMA 5KFPA 1WSRA 2VOPA 4MK9A 5LJ5Y 1J27A 2FJAB 4X4VA 5AE1A 1HI1A 2VG5B 4QYZK 3IFEA 2BKOA 3W65A 2V0NA 3CO0P 1RB0A 2W2QP 3B4MA 3PHEA 2J0SD 2MYFA 2IDEA 4LFCJ 1KRPA 3DOMA 3VF0B 2EW9A 2ADBA 4Y6IA 3JSRA 3AQOA 3QT6A 1U02A 1YVFA 4OYIA 2JEFA 2NR0A 2MJNA 1OWXA 2CQIA 4K0KJ 5KFXA 3V5RA 2CJYB 3PJWA 2E1CA 3MMBA 5LOQA 3EZ5A 2DIVA 4NXNF 1K73T 3ZNJ1 4MK7A 2KRBA 2VZ9A 4WXOA 2ACMA 3L7PA 2LEBA 4C2MA 4O3SA 2UP1A 3H40A 5D6GA 3OHBA 3AXKA 3SMZA 3LALA 4WFNQ 1SJRA 1QD1A 1TL3B 3F0NA 4RW7B 3GG1A 3U27A 5ETNA 1SUQA 5D4PA 2KYXA 1RU2A 3GFHA 3BKFA 1FKOA 4OYBA 3BKUA 3M9MB 1NHUA 4WZQA 3TVYA 3J80U 4ETZA 3CMES 3M6UA 4I6AA 1NPRA 4A8MP 1HARA 1UEVA 5FIIA 4CM2A 2E29A 2WSFC 1GXLA 4IFYA 4R0JA 1VIOA 1TL7B 1JLEA 1YQHA 3MECA 1RCXB 3PYDA 3WX4A 4DR1F 4UY8T 1C0UA 4I68A 2J0WA 2RHSB 3ULHA 2QLBB 2MZSA 1U1MA 5BYQA 3BDEA 3D6HB 4MKAA 4DX5A 1S1UB 1M5PC 1MROA 3OVAA 5A2QY 3MD1A 2GW8A 4OHXA 2HLUA 2DR6A 4PEOA 1JLGA 2AJ4A 3L9ZA 2R8KA 4DF4A 3L3CA 2XEXA 4IYQA 1EKSA 2HWIA 3H2VE 4OZ2A 2XO7A 4ED6A 2QN6B 3C15B 3FFIA 2DRAA 3Q8UA 1RT1B 5KFTA 2BQRA 5AXKA 1P8GA 1AUDA 5C2CA 5F8HA 2J9DE 4ECYA 1NJXA 3I56S 3LP2B 2I8EA 3GFYA 3CUNA 4EFAC 3RBXA 3NAIA 4F4XA 3ADAC 4CZCA 1WDDA 1LK7A 2ZM6F 1J5EF 1N48A 1FEEA 1KHVA 4GKKJ 4WWSA 4IOCQ
chains in the Genus database with same CATH topology
2F4FA 2FYXA 2XMAA 2VHGA 2VICA 2XO6A 2XM3A 2VJVA 2VIHA 2A6OA 2EC2A 2XQCA 2A6MA 2F5GA 4ER8A 2VJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4F A;  2FYX A;  2XMA A;  2VHG A;  2VIC A;  2XO6 A;  2XM3 A;  2VJV A;  2VIH A;  2A6O A;  2EC2 A;  2XQC A;  2A6M A;  2F5G A;  4ER8 A;  2VJU A; 
#chains in the Genus database with same CATH topology
 1PYS B;  2W9A A;  3PEJ A;  3FZB A;  4ANC A;  3DM2 B;  1NUE A;  3M8Q B;  2JH3 A;  3F41 A;  3U1N A;  2CWX A;  5FLX Y;  3IM9 A;  4EZ9 A;  2GHV C;  1WF1 A;  2ZUG A;  5GME A;  3BSN A;  2OP5 A;  1DTQ A;  4PWU A;  1NK7 A;  1R31 A;  1S7I A;  3NGU A;  4DR5 J;  3LPY A;  2E9R X;  1FDA A;  3HFV A;  3EMT A;  1DAX A;  1UAW A;  3RTV A;  2R7R A;  3K2Y A;  3IS9 B;  3RR7 A;  5ITH A;  3BN4 A;  2ABY A;  3IG1 B;  3FK4 A;  3DNC A;  2PO4 A;  4ZVG A;  2W01 A;  2BAN B;  4PXC A;  1SKS A;  2G1D A;  4JI1 F;  2OPP B;  4G3I A;  3IAS 9;  5B7W A;  3QMQ A;  4ENO A;  5EGY A;  3Q8P B;  5SUH A;  4O44 B;  2QYC A;  5IT0 A;  4U9R A;  2BKN A;  1O51 A;  4ZVO B;  1UWA A;  3L7O A;  5KG2 A;  1Y5I B;  3B4D A;  3OUY B;  2L9N A;  4RNH A;  1B99 A;  4OIX A;  5GAH U;  2M3D A;  1CJV A;  1NDP A;  4F4Z A;  1RWV B;  1A6L A;  3JS9 A;  2HZA A;  3V6J A;  1ZM4 A;  2UV8 A;  3PNI A;  1R0C B;  3TP2 A;  3N6M A;  1HYS A;  1VBY A;  4HI1 A;  1H73 A;  3SDE A;  4LFC F;  4FNH A;  3EM1 A;  1YBU A;  1B4S A;  2JOQ A;  3SCK E;  3MUT P;  1UVL A;  4KGX B;  3LH2 S;  3AA8 A;  4DUT A;  3SCI E;  4UT4 A;  4K0K F;  2RU3 A;  4X4S A;  5I4M A;  3KLG B;  4O3P A;  2AGP A;  4Q43 A;  4WF9 Q;  1HWK A;  1WD6 A;  3KHG A;  2ZWP A;  2N4C A;  4FPR A;  1RHR B;  1BY9 A;  3M2R B;  1XNQ J;  2KT5 A;  3HP6 A;  1FRH A;  3HPO A;  3QFH A;  2IYG A;  3BGF A;  2DIT A;  3FMW A;  2DNK A;  1FRL A;  3J81 U;  4ZP7 A;  2RDD A;  1RXO B;  3JSM B;  5C5J A;  2B8P A;  4KPC A;  5CZX A;  1L3V A;  2D7S A;  4NYZ A;  2P6T A;  1XR6 A;  5LSO A;  3BKT A;  1KHW A;  1DFD A;  3MUR P;  1IN0 A;  3GIL A;  1SQF A;  3K5M A;  1FNX H;  5DJB A;  5D3G A;  3NMA A;  3TAN A;  2CQ0 A;  3DOK B;  1Y0H A;  1UFK A;  5CYQ B;  1S6P A;  2DNG A;  2V69 A;  2FVC A;  3DXB A;  2ZH7 A;  4N56 A;  3J7Z 5;  3M4X A;  1RT3 B;  1TKT B;  3QID A;  3POT B;  2W2P P;  3W2V A;  4EI2 A;  2D74 B;  1UFW A;  3EXC X;  5H1S V;  2F1F A;  5KFN A;  2RRA A;  2R2S A;  4PPZ A;  3CCR S;  1FJC A;  4HDH A;  2QGF B;  4HT5 A;  1KON A;  1SV5 A;  3MM6 B;  1D9F A;  4OZN A;  1G3O A;  2XI2 A;  5ADZ A;  3GYG A;  2GHW A;  5CD4 H;  2MKK A;  1LXN A;  2FIU A;  4YFU A;  5MAO A;  4KGV B;  2BXJ A;  2G1H A;  3AB4 B;  5FD1 A;  4Y28 C;  1KR4 A;  1UPP A;  4EMD A;  2MKC A;  3SCL E;  3W62 A;  3M9N B;  5DG7 A;  1N33 J;  5B0C A;  2F40 A;  2CXE A;  1AW0 A;  2A3J A;  4UOH A;  2DXD A;  5HSP A;  2CNO B;  1R3N A;  1Y11 A;  4WBF A;  2O67 A;  2VKZ G;  4N5S A;  4DR5 F;  2H5J B;  1KDN A;  3MHY A;  4FF4 A;  1XMQ J;  3GIK A;  5DQG A;  4WCE Q;  3R7B B;  1RA6 A;  3R5G A;  2I5J A;  1VFJ A;  2F65 A;  2OI2 A;  2HQI A;  2CA9 A;  3M2V B;  1PBA A;  4XO0 A;  2HBR B;  2E7V A;  2VPW B;  1RT7 A;  3VAK A;  4K4S A;  4BC7 A;  1XQI A;  2ZKU A;  1MMN A;  2DGU A;  2ZH1 A;  3HM9 A;  1HPZ B;  2C1E B;  3PZP A;  1RAI B;  1W2B R;  1ZH5 A;  3SQO P;  1FE0 A;  3J7Z T;  3LQV A;  3W2W A;  1WKJ A;  1IM6 A;  2DXE A;  4ECU A;  4MJK A;  3MM9 B;  1BXN A;  2YBV A;  5B08 A;  2VA3 A;  4BBY A;  4WP8 A;  4RW9 B;  5D15 A;  2V4J B;  1FVQ A;  2AV5 A;  4Y3C A;  4C8Y A;  2YKO A;  3FUY A;  2VFR A;  1UTA A;  5C24 A;  2HHV A;  3H7H B;  3JQM A;  2LA4 A;  3VGU A;  2AQ4 A;  1M1G A;  1T8E A;  4IDK A;  2OEL A;  5AXM A;  1S0O A;  1LK5 A;  1WF2 A;  4LF7 J;  1IBK F;  3RB4 A;  1NKE A;  2BE2 B;  2FY8 A;  1FFW B;  2C3Y A;  3M8S A;  3RAQ A;  1WNE A;  2FC8 A;  4CLP A;  5IV4 A;  5KG1 A;  2XB2 D;  1AA1 B;  3TX8 A;  4R8U A;  3N6L A;  1XNQ F;  2FVR A;  2ERR A;  5T41 A;  1FK9 B;  2OPQ A;  4USK A;  1PG5 B;  3R7N B;  2FHJ D;  4JYA J;  4CNY A;  1RAO A;  4DV6 F;  5HL7 Q;  1WKK A;  1BMQ B;  1VRQ C;  1I94 J;  2VV5 A;  2ZH6 A;  4J9O A;  2OIH A;  4TQS A;  4USW A;  2AU0 A;  3D0G E;  2KXH A;  4TXS A;  1O6X A;  4C8O A;  2CJB A;  1QLN A;  2OD4 A;  2BJ7 A;  4PG5 A;  5HMX A;  2OO4 A;  2JVR A;  1ZTT A;  1SIZ A;  2GJ2 A;  2UUT A;  2X1B A;  2XMU A;  4UW2 A;  1S1X A;  3FBC A;  3N9U C;  2GMJ A;  1LWC A;  3IR7 B;  4NWB A;  4FXV A;  5HLF B;  2EBG A;  4QIV A;  3FQK A;  2VPY B;  3NS5 A;  1CJT B;  4KAI A;  1KQS R;  3FMB A;  2AZ3 A;  3EXY A;  3PW2 A;  2AD9 A;  2RNE A;  2DNM A;  5K8P A;  2NXE A;  1IKW A;  2XMA A;  2LYV A;  2A6O A;  3MPD A;  5KFQ A;  3N4W A;  2FLO A;  3SFU A;  1S9E B;  1QSL A;  2MKH A;  2JEJ A;  4OV6 A;  2E1P A;  4FXW A;  3IP0 A;  2MST A;  4DR2 F;  2W9B B;  3KLI A;  3G82 A;  3EVO A;  1X4A A;  1ZBT A;  2UXB F;  1S9G A;  4B3T J;  4WXW A;  1IUJ A;  3OTC A;  1Q1K A;  2QEX S;  2WW8 A;  3GU0 A;  3HVT B;  4RWX A;  1FX2 A;  4P2S A;  2LKZ A;  1VIS A;  2WRM A;  1N33 F;  4K5R A;  1PBU A;  1HD1 A;  4Y2M A;  3D1H A;  2AJ1 A;  4B9V A;  2N7C A;  1EX8 A;  3K8W A;  2HFN A;  4JOU A;  4J9K A;  1FDD A;  2F4F A;  3LUY A;  1Q7L B;  2MB0 B;  3DDI A;  2FY1 A;  3TX0 A;  3PXG a;  4LF9 J;  3N79 A;  3CDB A;  4U8V A;  3GSD A;  2WHO A;  5KFK A;  1XMQ F;  1PIE A;  4Q5V A;  4OZ3 A;  1N0U A;  4C11 A;  3L09 A;  1IR2 A;  3HJV A;  5E3R A;  3P5T L;  1P6T A;  4ZOS A;  5DZ7 A;  2HNZ A;  2RS2 A;  3G9C A;  2KXN B;  3L4B C;  1GFW B;  1U1O A;  3QZ7 A;  1GXT A;  4JV1 A;  3IGV A;  2XI3 A;  4P74 A;  3W5X A;  4FDF A;  4X66 J;  2XYH B;  4OX9 F;  4Z7Y A;  2J9D A;  3CB4 A;  1HL6 A;  3FCW A;  3K8V A;  3MED A;  1GMV A;  3K5N A;  1YHQ S;  2HZV A;  2RT3 A;  2DD8 S;  4X64 F;  2MQM A;  2WB1 D;  3HHL B;  2AYM A;  4L74 A;  1D09 B;  2V67 A;  3OTO F;  1U6Z A;  4OLP A;  2VDH A;  3DLL Q;  1NK5 A;  2LLZ A;  3KK1 B;  4PG8 A;  4MH8 A;  1EQM A;  1NK4 A;  4ECT A;  3G71 S;  1NSA A;  1X4F A;  4J9M A;  4Y2K A;  2K3I A;  3HVW A;  3E3X A;  1HHQ A;  1RTH A;  3MPU B;  2B43 A;  1SJ4 P;  4Q2L A;  4J90 A;  1QY7 A;  1S1V A;  2OAU A;  2H4Y B;  1R8H A;  3M32 A;  2E1R A;  1U26 A;  4ZJL A;  1UJ5 A;  1NHV A;  2WSC C;  1G6B A;  2A6M A;  5F3T A;  2WBM A;  2XNR A;  3NG8 A;  4DLE A;  4OYA A;  3C16 A;  1YBA A;  3UN2 A;  1SB6 A;  4ED2 A;  4KQZ A;  1SC1 B;  3C6T B;  3W8P A;  3HX9 A;  1TKD A;  4JYA F;  1PYT A;  2WVF A;  1U8S A;  1J2V A;  4QIW D;  1H0H B;  2E44 A;  4HTJ A;  3FEZ A;  4R5P A;  2FPH X;  1YX2 A;  2B6A B;  2IRY A;  4URS A;  4UQT A;  1LW0 A;  2QSF A;  2YNG A;  2LU1 A;  4WTO B;  3GG0 A;  4J7C A;  1X60 A;  2XMK A;  1T03 A;  2R8G A;  2XM3 A;  3M30 B;  2BW2 A;  4GO5 X;  1R27 B;  4J5O A;  3RW6 A;  4M5L A;  4J37 A;  3MEK A;  2WVC A;  2GGP B;  4K4U A;  4X4U A;  1D9A A;  2G2Z A;  4LRB A;  2YNI A;  2R7V A;  1JIH A;  3W5Z A;  2LDY A;  4IO9 Q;  2HFO A;  3LPE A;  3CJT A;  3QRR A;  1ZET A;  1XER A;  4DG1 A;  4ZPC A;  5LL6 d;  3Q8R B;  4B3M J;  3C14 B;  3GIM A;  3MM7 A;  4UOG A;  2DHH A;  5JJB A;  2ZNY A;  1KOH A;  2EG2 A;  1JLA B;  1FKP B;  4CO2 A;  1UW9 A;  3T6J A;  2PN6 A;  3D0I E;  5HVG A;  2CPH A;  4B3R F;  4WKR A;  3PVX A;  1FRI A;  1RU1 A;  1LKZ A;  4DL0 C;  3KXD A;  2PMW A;  4E98 A;  2W7A A;  2EC0 A;  3K58 A;  2CJK A;  5SZT A;  1RBL A;  3NGS A;  2IY5 B;  2DNP A;  3TUZ C;  4DU7 A;  4YP3 A;  3G8T A;  1TFW A;  3J81 j;  3BBF A;  1FXR A;  4DPY A;  4CYU A;  1KKH A;  4B3T F;  2Y8W A;  1SXL A;  1Z1Z A;  2V8H A;  3DOM B;  5C42 A;  1RYS A;  3J7A 1;  2VOD A;  2FJE B;  2N7Y A;  3NLC A;  2CPD A;  2MY7 A;  2VBZ A;  3CJ5 A;  3BQ1 A;  4DN0 A;  1CS4 A;  1GX6 A;  1VGY A;  3VCD A;  1PYO B;  1U6F A;  2Z2Z A;  3NNA A;  2VFU A;  3CDU A;  1RHM B;  3M9O B;  4N47 A;  1B0V A;  2OMO A;  2FGO A;  2R2T A;  5I3Q A;  4TYA A;  3UNY A;  4ZIT A;  3SSR A;  2HWH A;  2CNL B;  3LF0 A;  3C6U A;  5GAG I;  3Q8V A;  2D3U A;  4A8O A;  4A47 A;  2DHX A;  1UJ4 A;  1VRU A;  2M5Y A;  1KQK A;  5B0E A;  2VOO A;  2HS3 A;  1SUQ B;  1V3Z A;  3KMQ A;  1KTQ A;  3HVR A;  2XBP A;  1FKO B;  5IXU A;  3THT A;  3V4I A;  2HRY A;  3VTI A;  3ZTS A;  1WJ9 A;  4NA1 A;  1TVR B;  5CYM A;  1V9O A;  3N01 A;  1SJQ A;  4HR2 A;  2ZNZ A;  4MYT A;  4RJV A;  1JB0 C;  1JLE B;  2YQ1 A;  3MEC B;  2FJD B;  1MSW D;  1ZPW X;  4GVB A;  1HR0 J;  1X9W A;  1L3K A;  4L73 A;  1C0U B;  2LA6 A;  2HHW A;  1UVJ A;  4YR2 A;  4O0N A;  3HLU A;  3HUL A;  3GMG A;  3M6V A;  3MEE A;  2QLW A;  1OS5 A;  5J2N A;  1MRO B;  1WEL A;  3I87 A;  1T3O A;  1H6K X;  4QWD A;  3IRX A;  3PFE A;  5A2Q U;  1SQE A;  1KVI A;  1JLG B;  3MM5 A;  3MPW A;  5AJ3 F;  3AY0 A;  3UDE A;  4YS2 A;  4DSI A;  2Q6C A;  4NCA A;  4FZV A;  2KT2 A;  4CLZ A;  5L1K A;  1WC1 A;  1TQL A;  3FFI B;  3EE3 A;  4DV7 J;  1WI6 A;  2XC9 A;  2FJB B;  1NO8 A;  1T02 A;  4QCL A;  3Q8Q B;  5LM7 E;  3MM8 A;  1RHQ B;  3FBE A;  3VAG A;  3EVW A;  4K8R A;  1H3D A;  3OHA A;  2F5G A;  4F4W A;  1I51 B;  2WBR A;  1TL4 A;  1IR1 A;  3PV8 A;  4WYW A;  1XJW B;  1F9E B;  1YZ6 A;  5D0H A;  2IAJ A;  1VQ5 S;  2Z56 B;  4JV2 A;  3OR1 A;  5BR8 J;  1UKU A;  4D3H A;  5GMD A;  4A8Y A;  3ZTR A;  3MD3 A;  2JFD A;  5L1L A;  2IMW P;  5K9F A;  4CM0 A;  5KG4 A;  4ZLN A;  1VDH A;  3TA0 A;  5FLX U;  1JLQ B;  1B3T A;  3PRB A;  3WZ0 A;  1X9M A;  3RUB L;  2VH7 A;  4RR5 A;  3B54 A;  1ZTW A;  3VVU A;  4ZIV A;  3G8S A;  4F04 B;  1S6Q A;  1WG1 A;  3HHL C;  5CXT A;  1B7F A;  4QYZ J;  5M2P A;  3LP1 A;  1U25 A;  5IWA J;  4B3M F;  3Q2S C;  4DV4 J;  3E01 A;  3CJ0 A;  4BC9 A;  1PKU A;  2BRK A;  5KFA A;  5CHC B;  2G9O A;  2EKN A;  2B5J B;  2CZV C;  3KK3 A;  3PIO Q;  2VFV A;  2MY8 A;  3NOG A;  3W9H A;  1FJE B;  3E8O A;  4NCG B;  4YB5 A;  3P96 A;  2JNJ A;  1ULR A;  4OI2 A;  3UPF A;  3KUE A;  3H2L A;  4Q0B A;  5E7O B;  1N5S A;  5D4L A;  3GR0 A;  2FHM A;  4CIO A;  5GVQ A;  3W3S A;  3ISZ A;  3TZX A;  3NWR A;  3UO0 A;  3D1Q A;  1NDL A;  3HFK A;  1HYS B;  5EN1 A;  3L7U A;  3SDE B;  4J9L A;  3CF5 Q;  4DR3 F;  2NUH A;  4IRC A;  4F4Y A;  1NLK L;  2CFX A;  4ED5 A;  2EFV A;  2HKE A;  3MCM A;  1S5Z A;  5F9N A;  4ERD A;  3IXQ A;  5L1J A;  2BYC A;  4F50 A;  4Y2A A;  2QA1 A;  2WB4 A;  1N4L A;  2YKM B;  1T9X A;  2R7W A;  2Y0B B;  3RB0 A;  1U6B A;  2RRN A;  2ZDO A;  1SJ3 P;  4DDF A;  3J7Y U;  3LWL A;  1H38 A;  5GAH I;  5L9X A;  2DKO B;  4NLR A;  3QT5 A;  2JC0 A;  1TUG B;  2HVE A;  1Q95 G;  2ROG A;  4BHQ A;  1U2C A;  4NLV A;  2APO A;  2E7W A;  4IOB A;  4WZM A;  2BUN A;  2OFG X;  4JI0 F;  1Q16 B;  4OL8 A;  3RRG A;  2YVS A;  1XMB A;  1C4C A;  2CIM A;  3BJY A;  1RAD B;  4DFK A;  4DOZ A;  2Y0S D;  5D3G B;  2KRR A;  1S6O A;  4C8N A;  2QT7 A;  3M6W A;  2XLI A;  3PEH A;  1DJ0 A;  1S6P B;  4WK3 A;  1F1B B;  2Z30 B;  1UFL A;  2ZDP A;  3SQG A;  3AFG A;  4C8K A;  2IJR A;  1P9Y A;  4ECR A;  4YB6 A;  4O3Q A;  2XSJ A;  1NPK A;  3KLV A;  4DFJ A;  3W2V B;  3WIV A;  1KLN A;  1WC0 A;  2AJF E;  2J76 E;  2AJ0 A;  3FDS A;  3QJL A;  3EPG A;  1FER A;  1WWH A;  4DR4 J;  3PAC A;  4YUD A;  1Z2L A;  5B0F A;  1SV5 B;  1RTI A;  3HMJ G;  4HL9 A;  4DV7 F;  1H2V Z;  3MEG B;  4QIF A;  1LOU A;  4RBV A;  2DJW A;  3PFO A;  2HHT A;  1VLO A;  1C1C A;  4DUZ J;  5DDP C;  2GQC A;  2MZQ A;  4Y2C A;  4HHJ A;  2OPS A;  3GCX P;  4M5K A;  4NZ6 A;  4K4V A;  2V63 A;  3PY8 A;  3RW7 A;  4LIW A;  5CCL A;  1LWF A;  1IM4 A;  2PD1 A;  3W1Y C;  4OX8 A;  4EWT A;  2C42 A;  3FBB A;  4C8Z A;  2MXY A;  2CQP A;  1OY8 A;  2VIC A;  1ZA2 B;  4QWB A;  5F8N A;  1C0T A;  4LRE A;  5IT4 A;  2UXD J;  2DNY A;  2NUU G;  5ETL A;  1VBX A;  1VRT A;  1UVK A;  3BR9 A;  2I9S A;  3D7S B;  3CCJ S;  3K7R A;  4WK1 A;  2I5J B;  1VIX A;  3BPS P;  2ACY A;  4OJG A;  5IWA F;  2HK2 A;  4DV3 J;  4NA3 A;  3THV A;  3QYY A;  1MN7 A;  4DV4 F;  2LP4 A;  2P5V A;  1S9F A;  4M1K A;  3ENW A;  2KG1 A;  4EEY A;  1HNI A;  3UN3 A;  2RQK A;  2BOP A;  1NU4 A;  4DPO A;  2C2O B;  3BRE A;  3F73 A;  3R5A A;  5LJ3 Y;  1MN9 A;  1KEK A;  5M2R A;  4QYR A;  1JQG A;  4C48 A;  4PCQ A;  2MPU A;  4WIQ A;  3AQP A;  2J0X A;  3W2W B;  2KM8 B;  3EJM A;  3TWZ A;  3ZXW A;  3EDR B;  1KVJ A;  2FD2 A;  1SKR A;  2Z57 B;  2V94 A;  4DV2 F;  2Q6B A;  2MGZ A;  1RDR A;  2VAS A;  1HW8 A;  2FJX A;  3PW4 A;  2E9Z A;  3HD1 A;  3UDV A;  5J2Q A;  4I67 A;  4ED4 A;  2HHX A;  2CQD A;  4IDK B;  5E3C A;  4A48 A;  3KKF A;  5CH7 B;  1N34 F;  4ED7 A;  4M5D B;  4TU8 A;  5HP1 A;  4WPA A;  3E51 A;  1M90 T;  4LF4 F;  4G1P A;  4R8U B;  4LBP A;  3P5B P;  1ZS6 A;  4DS4 A;  3D2W A;  4J9U E;  4AD6 A;  4BCA A;  2VON A;  2UU9 J;  3ZC4 A;  2OPQ B;  1IR0 A;  3WC0 A;  4NAS A;  4DPW A;  2PI5 A;  1VJW A;  4DV5 J;  5B0B A;  1ZZN A;  4BWM A;  3CJ4 A;  3DLB A;  3J81 Y;  1A7G E;  4MKB A;  2ZC3 A;  3NCR A;  2P2C B;  5JUM A;  3R2C J;  2IHR 1;  3TRG A;  3MUV P;  1FRK A;  3FEY B;  2LQ9 A;  3OL8 A;  1GNK A;  5LMU J;  1MML A;  3GIR A;  3ILL A;  1Y10 A;  1G1X A;  2IBK A;  3BQ2 A;  3D4J A;  3ZZP A;  1CBK A;  3DU5 A;  4RW8 A;  2FYX A;  1Y5N B;  2CQG A;  2YWH A;  1S1X B;  1HWU A;  3ZZZ A;  3FRZ A;  1U49 A;  2IM2 A;  4EU0 A;  3EWG A;  3VR1 A;  4ELT A;  3LWM A;  3IN5 A;  3NGR A;  4LF1 A;  2RML A;  2CG8 A;  1NKB A;  5EX3 A;  2MEW A;  3DHX A;  3CSK A;  4QR1 A;  3ZNU A;  2G0I A;  3IAM 9;  2MZ1 A;  4ATN A;  2XZT B;  2G4B A;  3VAH A;  5C25 A;  1F6T A;  4ZHR A;  1SH0 A;  4O4G A;  1BUX A;  1LWE B;  2CAJ A;  2AP6 A;  4DR4 F;  2Y9H A;  1R6V A;  1RLD A;  3TUI C;  2B0G A;  3K5P A;  1VC0 A;  4OZJ A;  5KFR A;  2X51 A;  5DS7 A;  2DHA A;  1WHY A;  1X31 C;  5L39 A;  2E5L J;  4JP8 A;  3TAM A;  5JVH Q;  1B0P A;  1X0P A;  4G65 A;  2K3K A;  4WFY A;  2HW3 A;  4ZPB A;  1HKA A;  9ATC B;  4DUZ F;  1CUL A;  3QRQ A;  1S9G B;  3I82 A;  3CCE S;  3TZW A;  1NAQ A;  5DQI A;  4QJV A;  3GJQ B;  4CO0 A;  2DEI A;  4RBT A;  2MZT A;  2DH7 A;  2ZBR A;  4F2R A;  2CQ3 A;  2I1R A;  5ETS A;  3JB9 k;  1NHK L;  5B0D A;  3JSY A;  2DIS A;  3SV4 A;  4CLL A;  2XHC A;  2KG0 A;  3S6E A;  4DR7 J;  2JJ4 D;  4HH1 A;  1DTT A;  4DI6 A;  4QW8 A;  3PW7 A;  2ZZM A;  2ZH2 A;  1NH8 A;  2UXD F;  4C6A A;  2MKY A;  2ZD1 A;  1IQZ A;  5HBM B;  5H9F K;  4M95 A;  4H4M A;  5MLC V;  3IM8 A;  4C11 B;  3QFW A;  3NAH A;  2R8J A;  2BA9 A;  4DV3 F;  1GMU A;  3KJQ B;  3NS7 B;  3GYN A;  2VG6 A;  1V3S A;  4P2F A;  2ZH4 A;  3VZH A;  1I5O B;  1NDC A;  2GFF A;  2D9P A;  2Q43 A;  3TYT A;  3VVT A;  2OPR B;  4WU2 A;  1FA0 A;  3RBD A;  2LXU A;  3K5O A;  3BO3 A;  1ROF A;  4CT8 A;  3CC2 S;  3UN5 A;  5F9L A;  1R6Y A;  5KT6 A;  3UR0 A;  2RRB A;  2NXJ A;  2UVU A;  3FC9 A;  1IKX A;  3KDO A;  3HHL D;  3T5K A;  5CD4 A;  2HGL A;  4K4Z A;  2JL9 A;  2CQH A;  1NPP A;  2YY3 A;  4OJ3 A;  4P71 A;  3N5F A;  2IRX A;  2F3J A;  4QZV B;  4GC7 A;  4LF5 J;  4NZ7 A;  1IBL F;  2MHE A;  1FF2 A;  2IM1 A;  2ZFH A;  3DOL A;  5HAN A;  1RTH B;  1H7W A;  3PYE A;  4ES2 A;  1E6V A;  3LA0 A;  4QWE A;  3R6L B;  3SCJ E;  1AYE A;  2CQ2 A;  2ZBP A;  4B08 A;  4PUO A;  4AL6 A;  1CQN A;  1BC6 A;  4C97 A;  2HMI A;  3C16 B;  1JJ4 A;  3LGH A;  1NXI A;  2B7C B;  5AXL A;  4LBI A;  4UZC A;  5IC6 B;  2ZH5 A;  4X4N A;  4DV5 F;  4QU6 A;  4U7U K;  2A10 A;  5F8G A;  4F8R A;  3I0R A;  2QFJ A;  5LMN F;  1N6Q A;  4HYK A;  4R5P B;  4G6V B;  2VG7 A;  3OJU A;  3MMJ A;  4DXL A;  5LMU F;  1RT2 A;  2BVZ A;  3LAM A;  2YNG B;  3Q24 A;  1NJY A;  2KJV A;  5U47 A;  2NSC A;  2WW4 A;  4DPX A;  4ZS6 A;  3IBW A;  2VQF F;  2QTW A;  3FVY A;  4K50 A;  4DL2 A;  3K17 A;  3ZO7 A;  1APS A;  4NE9 C;  3UDC A;  2BQU A;  2CQ4 A;  2YNI B;  3DI6 B;  1IXK A;  4UUX A;  5KFL A;  1Y4Z B;  3AOD A;  5FDL A;  2J6T A;  3VGT A;  4IQX A;  3DLK B;  4DG1 B;  3FBF A;  1RTZ A;  4JI4 J;  4KR0 B;  2EI5 A;  4KYZ A;  1IWA A;  3MM7 B;  1QVF R;  3IA0 A;  2KM8 C;  2UUB J;  1U48 A;  3TAP A;  4KC5 A;  4A4J A;  2B4V A;  1WF0 A;  4I4B A;  3TJA A;  5DDQ C;  5D4N A;  2QL5 B;  3MMA A;  1EP4 A;  5DGA A;  4USI A;  1S76 D;  3BGL A;  4CLU A;  4EZ6 A;  2DGV A;  1HWL A;  2LXF A;  4HLB A;  3W64 A;  3HT0 A;  4CRJ A;  3K57 A;  4PXD A;  1F2H A;  1LQ9 A;  4I2P A;  2L08 A;  1U24 A;  4CYU B;  3EGV A;  1HD0 A;  4C9D A;  1R43 A;  3RBZ A;  2BKP A;  4L76 A;  4RUB A;  3US5 A;  4EBD A;  4WTY A;  4DL4 A;  4IR9 A;  2PE8 A;  1IWG A;  1TP7 A;  2VFS A;  5HN0 A;  1CS4 B;  2NQP A;  3H5U A;  3OXL A;  1WOO A;  4ID5 A;  1QSS A;  1RTJ B;  3UI3 A;  2CPJ A;  4DR7 F;  2BJD A;  4OZ5 A;  2KH9 A;  4JB8 B;  1Q78 A;  3W5Y A;  3DRX A;  1KFD A;  2IJN A;  4O4R A;  1YBT A;  2C3O A;  2ZZT A;  2HRT A;  3C6U B;  3D9B A;  2NXC A;  1HQU A;  1VRU B;  5ETK A;  3HI9 A;  5E2Q A;  1GH8 A;  3GON A;  3DLG A;  4U7C A;  1FHT A;  2GCF A;  4UF4 A;  2ADC A;  3CMA S;  4KFB A;  2K7K A;  4NRU A;  1S59 A;  1LW2 A;  3ETO A;  3V4I B;  1YRX A;  4K59 A;  4PQU B;  2LQB A;  4MIA A;  3TQ1 A;  2P9C A;  3C19 A;  4I7F A;  4ECS A;  2RH3 A;  1FRM A;  1SKU B;  2WAQ D;  4DF8 A;  5CYM B;  4CQ1 A;  1KD1 T;  2DK2 A;  2DPJ A;  3T19 A;  4F36 A;  1WOS A;  3TA1 A;  3EPI A;  4GVB B;  4AXJ A;  3HFZ B;  4PPD A;  1PSD A;  2HZC A;  3M1V B;  4DR6 J;  1G4C A;  2W4P A;  3MEE B;  2V4R A;  1FTC A;  5K8M A;  2CPZ A;  5GAE I;  1VQN S;  1B64 A;  3IRX B;  2DGO A;  4Y34 A;  3BYR A;  4DPU A;  1UP1 A;  4PR6 A;  4F02 A;  4DQI A;  4CO5 A;  3MM5 B;  2DT9 A;  2W2M P;  1X4D A;  3MMC A;  4RNO A;  3H25 A;  2LEP A;  2R7X A;  4OHW A;  4CDI A;  1SJ1 A;  4RO0 A;  1ACM B;  3DYA B;  3A13 A;  3PCO B;  4O0I A;  1RWU A;  2VHG A;  4ED0 A;  2IMO A;  3TAQ A;  4F26 A;  3DDN A;  5ETP A;  1YJV A;  3MM8 B;  3CE8 A;  2VG5 A;  1MW7 A;  1V3R A;  2D69 A;  1I1G A;  4NCB A;  4NRT A;  3ELH A;  3HSD A;  1T7P A;  1XWL A;  2XS5 A;  2VPZ B;  3T1H F;  3FJ2 A;  3UE2 A;  1Q8K A;  2A1B A;  2IAJ B;  4U6P A;  5E33 A;  1IKV A;  1FES A;  3IWN C;  1HLW A;  2AJQ A;  3OR1 B;  2CNN B;  1T9W A;  4DZ6 A;  1NEE A;  4LSZ B;  4YOE A;  2OKQ A;  2Z2L A;  2KTQ A;  3H98 A;  1KBR A;  2YWG A;  3OT9 A;  1ICE B;  3BGR A;  3JAM Y;  4M8L A;  3GTY X;  3ICL A;  5F8I A;  2JDJ A;  4QOT A;  4IH5 A;  3QT8 A;  1RT6 A;  3PKY A;  3TQE A;  4KV8 B;  1S6Q B;  2KJW A;  4JI4 F;  2A2C A;  2AF6 A;  4F0H A;  2UUB F;  4C7Q A;  2OTL S;  3CGI A;  1VQ8 S;  1YIJ S;  1JLF A;  3CNQ P;  4RNF A;  3CJR A;  4RW7 A;  3A3O B;  3A4T A;  1S48 A;  4Q45 A;  4LSN A;  3IC1 A;  3SXL A;  4CH1 A;  2RSQ A;  4XPC A;  3NXZ A;  4Q0B B;  2X1A A;  5GAG U;  4B3O A;  1U8W A;  1NJI T;  1DZ5 A;  2ILZ A;  2P9E A;  4ER8 A;  5D0G A;  1SJF A;  1RCO B;  1RWM B;  4KHP J;  2VDI A;  1PAE X;  1SIW B;  1Q7Y T;  2VC0 A;  4RX6 A;  1AT1 B;  4J9V A;  5A8W A;  1U1N A;  2W8L A;  4RZR A;  3BQ0 A;  2GMH A;  3NBP B;  3UVJ A;  2JVO A;  4USJ C;  4OI1 A;  1WSV A;  3UCU P;  1GT8 A;  1U47 A;  4URG A;  2I2Y A;  5IV3 A;  4ICL B;  5DET A;  2O01 C;  4ANE A;  4AQY F;  4NML A;  1KLM A;  4DZD A;  4U7U D;  5I42 B;  4OZ0 A;  5KOW A;  1C1B B;  1XK8 A;  4FBT A;  4HTI A;  2UUC J;  2W2O P;  2FGC A;  4TU7 A;  2AYE A;  4HI2 A;  3CCQ S;  3FRY A;  2IC3 A;  2MHN A;  1Z4U A;  4ZLJ A;  4MMO A;  3Q23 A;  3PIP Q;  3CUL A;  3PW5 A;  3LP2 A;  1SC3 B;  4LR8 A;  1BWE A;  4DLG A;  3KHH A;  2Y1I A;  2HPU A;  1DBD A;  2M2B A;  3HHK A;  2HQC A;  4IG3 A;  4OZL A;  1RT5 A;  1ZAX A;  3ZZY A;  4PYD A;  4KIA A;  2XS2 A;  3EGW B;  4ID8 A;  1FKA F;  3GZ7 A;  3PYG A;  3HZE A;  4OQJ A;  4YB7 A;  2KL8 A;  2GS8 A;  4FN5 A;  3N28 A;  4K7Q A;  1S49 A;  4LSL A;  1NCL A;  4F67 A;  3DM2 A;  2DGX A;  1YKW A;  2JHE A;  1F9H A;  1Q5Y A;  2HS0 A;  4F3M A;  3LGN A;  1RAB B;  5D0E A;  5HQM A;  4I6Y A;  2B9X A;  3SQG B;  1NJZ A;  3VWS A;  1ZPV A;  2M4M A;  3DDK A;  3A12 A;  2R7U A;  4JI6 J;  3VAI A;  2MQ8 A;  3EDQ B;  3QZ8 A;  5KFU A;  2ZKT A;  3T5L A;  3DMJ A;  3TAR A;  3BH7 B;  3J7Y I;  2MKJ A;  2HIQ A;  3A3P B;  3BEG B;  1BWV A;  2QYG A;  2GVZ A;  2ZOG A;  3NP5 A;  2BAN A;  1DRZ A;  1LFP A;  3PX4 A;  4XPE A;  2OSQ A;  2J8S A;  3T9Z A;  2DR9 A;  2OPP A;  3HDS A;  3TUP A;  3X1L B;  1RBA A;  4BS2 A;  5CQG A;  2PGC A;  2FZK B;  3BSO A;  2X1G A;  1FWK A;  3HKZ D;  4LR7 A;  3JTO A;  3SYZ A;  3QAT A;  1UW4 A;  4F4K A;  2J7U A;  3VQS A;  2F63 A;  3R9L A;  5D8H B;  3CWJ A;  2CPI A;  3BSC A;  3TEH B;  1TV6 B;  2OPS B;  2QMU B;  4B3S J;  1NK6 A;  4K2X A;  2W7P A;  1Y5L B;  1LWF B;  2DNO A;  1WOR A;  2HUR A;  2EBE A;  1RKJ A;  3WIU A;  2CPY A;  2VIH A;  3Q8S B;  1T11 A;  4IFV B;  4ZPA A;  3QPI A;  4NLX A;  5K20 B;  1TKZ B;  1C0T B;  5CAB A;  1JLC A;  4JI5 F;  2G0J A;  2RKI B;  2HBZ B;  3VQT A;  3A8I A;  2KDO A;  1C4A A;  3WX8 A;  4TN2 A;  1D8Y A;  2ZH9 A;  2R7T A;  4YY3 J;  4NLQ A;  4GC6 A;  2Q1L A;  1XR5 A;  1K0T A;  2V8P A;  2N3L A;  4ZPT R;  2DXF A;  1FXD A;  4NL5 A;  1VBK A;  1F5C A;  2YTC A;  3KG0 A;  5KFW A;  3OL7 A;  1VQM S;  2EVZ A;  2HVI A;  4M5J A;  2W2N P;  2EFN A;  2R2U A;  1HNI B;  3MR3 A;  3EIC A;  4B9M A;  1OQ6 A;  2HND B;  1OSD A;  2HFZ A;  1AZS B;  3V6D A;  3G8Q A;  2Q3P A;  2V2Z A;  1HBN A;  2HQF A;  3EVM A;  4KHP F;  2VFT A;  3CIM A;  1VBZ A;  3CJ2 A;  2HG4 A;  2IRU A;  3ZZR A;  1U09 A;  1MMD A;  2M88 A;  1RAC B;  4OYP A;  4HKQ A;  3DOK A;  3OVS A;  3MDF A;  3HSG A;  1HI0 P;  3BSA A;  5AXN A;  1H98 A;  3ILI A;  5J2Q B;  5B0G A;  3M8R A;  2FC9 A;  2EFO A;  1FTR A;  1RAH B;  1IBC B;  1KP6 A;  1NB2 A;  4GVL A;  4YDD B;  4XAK A;  3CDE A;  1NSK L;  4I69 A;  3S01 A;  4USV A;  2YQ3 A;  5KT5 A;  1K0V A;  4EYH B;  2R8I A;  5HP1 B;  3QJJ A;  2H4W B;  2HFS A;  4KE5 A;  3OXF A;  1UWB A;  2UUC F;  3KJV A;  4KRW A;  3EYZ A;  2HSE B;  2ZJQ Q;  3BO2 A;  1S77 D;  3R5C A;  2NPF A;  2RAQ A;  1W2I A;  3K5L A;  1BGX T;  2BDP A;  2CRL A;  3HXM A;  2RB7 A;  4URQ U;  3ENA A;  2C22 A;  4NLU A;  1CPZ A;  3J7A N;  2AEF A;  4CLK A;  2YX4 A;  4D3G A;  2K8G A;  3D3C J;  3ZFV A;  3S8S A;  2BAB A;  2DNH A;  3CTR A;  4AND A;  4LF8 J;  1BQM B;  1H7X A;  3TZY A;  2KHD A;  1SCJ B;  2J9C A;  3HT3 A;  2ZOF A;  3G6Y A;  3KLF A;  2ZHO A;  4GMK A;  1V5I B;  2DNQ A;  1R0B G;  1JK9 B;  3M8Y A;  2H1Y A;  5HJX A;  4RW8 B;  1N5T A;  4NXM J;  1M5S A;  3S7R A;  3DC2 A;  1HQE A;  1N8R T;  1AFJ A;  1WHV A;  2O5D A;  4QIE A;  4QR0 A;  2J6S A;  3AOA A;  3FNN A;  5RUB A;  2UUA J;  1N54 B;  1KSP A;  4JI6 F;  3OBI A;  3G2X A;  2QLF B;  3PR5 B;  4LRF A;  4CH0 S;  4RW4 A;  2AKW B;  2UVV A;  4V1A k;  1FI4 A;  3DLE B;  2VB6 A;  1S4F A;  3FQL A;  4FF1 A;  2PT0 A;  4ZHR B;  2E9T A;  3P45 B;  5A76 A;  2Y3Y A;  4O4G B;  3QLH A;  2J7W A;  5DG8 A;  1RAA B;  2H9Z A;  3D6T B;  1HHS A;  3C2P A;  5A8R A;  3MAH A;  4QR2 A;  2WCX A;  5KG5 A;  5KFG A;  4EGL A;  5E0O A;  3TAM B;  4HHU A;  1NK8 A;  2UVR A;  4ZPV R;  1LWX A;  1GMW A;  2MJU A;  4U67 Q;  4L72 B;  2ZEJ A;  4KPY A;  3UW1 A;  3MOJ B;  4DSK A;  2QG9 B;  2GO8 A;  2QA2 A;  4NZ0 A;  2Y1R I;  4B3S F;  1WOP A;  2H65 B;  2HFU A;  2WSE C;  4GKK F;  1U1P A;  4FYD A;  3W9J A;  5IT9 U;  2DNN A;  4M63 A;  5KFD A;  4OFZ A;  1X4H A;  2BE2 A;  3UR3 C;  3ZZU A;  1OPZ A;  3ZTQ A;  4NLT A;  1GAO A;  1S72 S;  1TMM A;  5DO2 A;  2ZD1 B;  2G0C A;  2QLX A;  3I4H X;  4H4M B;  3DXS X;  2NCK L;  4YY3 F;  3HKW A;  5KFC A;  3PRV A;  2W7O A;  3TZZ A;  3QAE A;  2V6A A;  3QGG A;  2V9W A;  4AXI A;  5A0Y B;  2HWT A;  4K5S A;  2ZE2 A;  1M1H A;  5J2P A;  3SSQ A;  4FKX A;  2KU7 A;  2XYP B;  4MK8 A;  1HNZ J;  3QO9 A;  2FLL A;  4B9L A;  2IA6 A;  2PFD A;  4X2B A;  4FBU A;  1OY9 A;  3EZU A;  3NS6 A;  4J9R A;  8AT1 B;  2P6S A;  4C4W A;  4P75 A;  2BBE A;  3I5C A;  5EDW A;  3Q83 A;  2K1R A;  4LRA A;  2QL7 B;  1CQM A;  3SIP B;  1FFS B;  3PO4 A;  5D77 A;  1KN6 A;  1HA1 A;  3EGZ A;  4C0B A;  4G1Q A;  1QVG R;  1RAF B;  2XMM A;  2U2F A;  4P2M A;  5HLF A;  1QE1 A;  2ROE A;  1M5H A;  1CJT A;  1E6V B;  5KT2 A;  5EHH A;  2Y8Y A;  1FD8 A;  2HBQ B;  2OEK A;  4WFA Q;  1FX4 A;  3M8P A;  4RPF A;  3JTN A;  3KYL A;  3V2U C;  2X3G A;  4DX6 A;  4DN9 A;  2RD5 C;  2ILY A;  4CO3 A;  4A46 A;  3JYT B;  3OW2 R;  2HMI B;  4NEY A;  1KQG B;  1S9E A;  3R5J B;  2EPI A;  2AIR B;  3AT1 B;  2GIQ A;  2VJU A;  6FD1 A;  3C66 A;  4EK2 A;  3V6H A;  3PX0 A;  3I0R B;  1FE4 A;  3HCX A;  4B9T A;  2DGT A;  4ECX A;  4KT0 C;  2JLG A;  2VG7 B;  4LF8 F;  3HVT A;  4OHZ A;  2EWH A;  3H5Y A;  4TY8 A;  1RT2 B;  1HNW J;  1OJ4 A;  4I1T A;  2I6W A;  1R0A A;  2N82 B;  3V6K A;  2DRB A;  3GJR B;  2PEH A;  2AJ2 A;  4LIR A;  4NXM F;  1MWZ A;  2EFP A;  3KOA A;  1FXL A;  4NXN J;  1UET A;  4JI7 J;  2NLW A;  5FDL B;  2DH8 A;  3IO1 A;  2UUA F;  4CTA A;  5DM6 Q;  1UA0 A;  5K14 A;  1X5P A;  2R7O A;  3O5T B;  1X9S A;  2HHH J;  3HSZ A;  5AT1 B;  1WC6 A;  3NGD A;  3MMA B;  1EP4 B;  3DRP B;  2HQ3 A;  4ZPD A;  3B6B A;  3R3T A;  2BOA A;  1NRK A;  1Q8B A;  4E8U A;  5ETT A;  3BF4 A;  1MU2 B;  2LMI A;  1UZH A;  3R1H A;  4BLG A;  4OI3 A;  2DTJ A;  4LVO P;  3JQK A;  5KFF A;  3FSX A;  4I2P B;  2DB1 A;  2AYG A;  3FEX B;  1M5V C;  2X1F A;  4TLR A;  1EIY B;  2G2Y A;  1TK0 A;  4YQW A;  2QO3 A;  3U02 A;  4CO1 A;  4DL6 A;  3KK1 A;  4DR1 J;  1UZD A;  5H9F J;  4ZDN A;  3BYP A;  4KH0 B;  4R25 A;  2B8Q A;  2E5G A;  3GE9 A;  5IQ6 A;  1T05 A;  4OHY A;  3QWU A;  1KNZ A;  2AYB A;  3G6E S;  1NM2 A;  4DHV A;  1PC4 A;  1RWO B;  3CCU S;  4PXB A;  2AEJ A;  1N56 A;  3GYX B;  3P3D A;  4ZVQ B;  5EUH A;  1UVM A;  3NGK A;  3CCT A;  4DL7 A;  3HO1 A;  3KNG A;  3MCS A;  3CIZ A;  1CC8 A;  1MNE A;  1RJJ A;  1TAU A;  5ETR A;  1FNM A;  4AE5 A;  1SVD A;  2CJA A;  4P73 A;  3BDP A;  3KJN B;  2EXU A;  3GFZ A;  3DLG B;  3EUN A;  2HVZ A;  3ITH A;  2VA2 A;  4KFB B;  3ISN C;  1HNZ F;  1AUS L;  2ASY A;  1H2T Z;  2B6A A;  3TJ8 A;  2AWZ A;  4B9N A;  2GJF A;  1TL1 A;  3HSJ A;  1E6Y B;  1WEZ A;  4I7F B;  5JXS A;  4CH7 A;  4PAA A;  1NZA A;  1DY3 A;  2GHP A;  1TEL A;  3DKD A;  2DHG A;  3M30 A;  4XDD A;  2MLZ A;  1REV B;  4JV0 A;  4H4O A;  4ECW A;  1A9N B;  4KBI A;  5KFY A;  2HHU A;  2BM0 A;  3HZG A;  2J6U A;  5KG6 A;  3FZ2 A;  2YH1 A;  5IZH A;  2FQQ B;  4ZIW A;  1FWP A;  1QAX A;  1KC8 T;  1OYD A;  3CPW R;  1CJK A;  4LF7 F;  3OL9 A;  4OX7 A;  3QIP A;  2FHO B;  4K4T A;  4NLO A;  3CJQ A;  1YIT S;  1M1K T;  2IPO B;  4E0D A;  2COL A;  5KT3 A;  2QA4 G;  2P9G A;  1DQA A;  4DV0 J;  1F3V A;  4C8M A;  1Q0N A;  3KK2 B;  2FZG B;  4MYU A;  4F4A A;  2DGW A;  2D9O A;  3CJS A;  3H42 A;  3QQC D;  3VAF A;  1V5V A;  1LFW A;  3OR2 B;  1Q79 A;  3I31 A;  2XZD B;  2GX8 A;  1I94 F;  4U8Y A;  3M2U A;  1IKV B;  5FJ4 A;  4EYI B;  5HMZ A;  1HNW F;  3A3N B;  1S97 A;  1IVZ A;  3VAL A;  2EEY A;  1MWY A;  5HMW A;  3T5H A;  3VAJ A;  5DQH A;  4YR3 A;  1HW9 A;  3F56 A;  3BGR B;  2HVH A;  1UA1 A;  2MZR A;  3D5M A;  3CDA A;  3OTB A;  3C8Y A;  3JAM U;  2Z2Y B;  2DGQ A;  1RT6 B;  4KO0 A;  4JI7 F;  3NNC A;  3H8Y A;  4C3K A;  2IDL A;  1S1W A;  4CNZ A;  2MZJ A;  4KH1 B;  3KLH B;  2R7Q A;  4PG4 A;  1NBE B;  3BBC A;  1N32 J;  4IG0 B;  2HHH F;  1JLF B;  1V6H A;  3G6V A;  4DV1 J;  4X4T A;  4P6Q A;  1Q82 T;  4ILL A;  5F8M A;  4LSN B;  5F8J A;  1JXE A;  4WJB A;  5G0R A;  1B70 B;  1NB7 A;  3K59 A;  2XG8 A;  3NL0 A;  5EWE A;  3PW0 A;  2YNH A;  4M5G A;  4B3O B;  2W4D A;  3R5B A;  2PDA A;  1FFG B;  2YKA A;  3GPA A;  2VBX A;  2QFI A;  2BR0 A;  2ZVS A;  4IR1 A;  2Q66 A;  2GQQ A;  2IM3 A;  1TVR A;  5L9N A;  2ZHB A;  5A8W B;  1QAJ A;  4AL5 A;  1JJC B;  2BE7 D;  3LOU A;  3UVJ B;  4QW9 A;  2KN4 A;  5L1I A;  2DVI A;  1HIY A;  3R2D J;  3G6X A;  2FVQ A;  4R0E A;  2Y1J A;  2ZUA A;  5HK4 A;  2N3O A;  1RTD A;  2HQD A;  5KFI A;  1IKY A;  5HAO A;  1KLM B;  2QJ3 A;  2V8D A;  1P9Q C;  3MMB B;  3RG6 A;  1ITP A;  1CSJ A;  3OFF A;  4O3R A;  3BBB A;  3OL6 A;  5HQL A;  3MAQ A;  4LF9 F;  2W9C A;  3EGN A;  5HMY A;  4LVN P;  3TOQ A;  5GAE U;  1WEY A;  3WC2 A;  2IC3 B;  2I38 A;  2OML A;  3RR8 A;  3RU0 A;  4ELV A;  2ATC B;  2BZ2 A;  3QGH A;  2OH2 A;  1RK8 A;  1VC5 A;  4A8Q A;  1YJR A;  4IG3 B;  1RT5 B;  1XTZ A;  1JMT A;  3R8Y A;  1JJH A;  1YLX A;  4QPT A;  1CVJ A;  4Y00 A;  4X66 F;  4DU8 A;  4PG7 A;  3H0P A;  1FD2 A;  4ZP9 A;  3BGO P;  5KG0 A;  4Z2X A;  4LSL B;  4RNN A;  1RE1 B;  4E2F B;  4TNO A;  4IFY B;  1EAY C;  4AT1 B;  1NZ8 A;  3KJF B;  1JLQ A;  5DLG A;  3PDN A;  1U2R A;  4DUY J;  4I0W A;  4YHH J;  3PX6 A;  1D8Z A;  2V2Q A;  4DPT A;  4F2S A;  2DO4 A;  2MKS A;  5KFE A;  3LO3 A;  3DMJ B;  2J8A A;  1UEU A;  1TAQ A;  5D0R A;  2GVZ B;  2BJE A;  4RU9 A;  1RQ0 A;  4QQB A;  2M0G B;  2ZBQ A;  3W9I A;  4CLT A;  2M70 A;  2B5J A;  3DRS A;  4LF6 J;  4NCG A;  1ELO A;  2FDN A;  4M5N A;  1S1T A;  2B9Y A;  4DV0 F;  5CAA A;  1Y3K A;  2ZJP Q;  1LEO A;  3T1A A;  1JNZ B;  3D67 A;  3R7S B;  3Q89 A;  2Z4P A;  2BJ8 A;  4TQR A;  3CCZ A;  3I6P A;  1SL1 A;  3TVK A;  1L3S A;  1N52 B;  2G13 A;  2QX0 A;  2OHD A;  1JXL A;  1A0O B;  4Z7C A;  2KFZ A;  1TK5 A;  4USM A;  2KB2 A;  2L48 A;  4ZVR B;  2I0X A;  1FNO A;  3GCW P;  3X3U A;  3MCN A;  5C7P A;  1GQE A;  1TMJ A;  1RWP B;  3EZO A;  5KFM A;  4UST A;  1LXJ A;  1PJ5 A;  4W92 B;  2FB0 A;  1IBK J;  2CQ1 A;  4XIU A;  1AFI A;  2GAG C;  1DTQ B;  1HBM A;  1JLC B;  1DAR A;  4U96 A;  1JJ2 R;  2QV6 A;  2YKM A;  7FD1 A;  2HHP A;  4X4R A;  4DEZ A;  3D68 A;  2PMZ D;  1VQ4 S;  1WKL A;  3AOC A;  3D6F B;  3T41 A;  1VHF A;  3GJS B;  3AOB A;  2F8H A;  4LMZ A;  4MT1 A;  5E3Q A;  3CCM S;  4ZVH A;  2BJ1 A;  4DS5 A;  1RAJ A;  3O2I A;  1LV5 A;  2BM1 A;  1N32 F;  1SC6 A;  3Q2T C;  1NDK A;  2GA7 A;  3T6B A;  3CCS S;  4DV1 F;  2MTL A;  2A2D A;  4I2Q A;  4O3N A;  4FYW B;  1U1L A;  4DV6 J;  3H2U B;  2FVP A;  3PHT A;  2K7J A;  1VQO S;  1XC9 A;  3FGV A;  4FS1 A;  3BS9 A;  1G7C B;  1HWJ A;  3V6D B;  2QSW A;  4USH A;  3LP0 A;  2LU2 A;  1HBN B;  4QIG A;  3O6Q A;  4HVZ A;  2L41 A;  2GQ2 A;  1CJV B;  3I96 A;  2VJV A;  3WHI A;  1T0T V;  2V68 A;  5LXR A;  2NXN A;  2VC1 A;  1X5O A;  3IBC B;  3RRK A;  2LVW A;  3MR7 A;  5ETQ A;  5HRO A;  3RAM A;  2QC3 A;  5E3A A;  3CT9 A;  2CDQ A;  2IM0 A;  4WFB Q;  4LJM A;  5EWF A;  1U7L A;  3V81 A;  3W60 A;  3N0V A;  3BO4 A;  1S6U A;  4HAC A;  5ETM A;  2QMX A;  1W26 A;  5EWG A;  2D1C A;  1UWB B;  2MQO A;  3KJV B;  3CMQ A;  2B4P A;  3I9V 9;  4NMX A;  2HFV A;  1HNV A;  4YR0 A;  5DGB A;  3A1Y G;  2HNY A;  2JFK A;  2GV1 A;  2Z8Q A;  3MEG A;  4ZVT B;  4DR2 J;  2E1A A;  4X4Q A;  4ZCI A;  1CG2 A;  3KUH A;  2J0Q D;  4HDG A;  3U1M A;  2UXB J;  1PO6 A;  4LRD A;  3HJF A;  4OYX A;  4F0M A;  1S4E A;  4DQQ A;  3HF5 A;  5D4O A;  3P4U B;  2HHQ A;  1VQL S;  3KLF B;  3D0H E;  2ZIT A;  4WE1 A;  2XQC A;  1ARO P;  3KG1 A;  2JEG A;  3ET6 A;  2B3T B;  3MI7 X;  2OSR A;  5BYS A;  3DHW C;  4C0H A;  2XS7 A;  5ETV A;  4F7V A;  1HQE B;  1N88 A;  2QIF A;  5H9E J;  5KAK A;  2XGP A;  4B9U A;  3DLJ A;  3NKY A;  3UD3 P;  1W25 A;  1HR0 F;  5IFM A;  4DUY F;  4YHH F;  2RDI A;  4J91 A;  3ISN D;  1R7I A;  1FCA A;  1X4E A;  4RW4 B;  3CCV S;  1TL5 A;  4F25 A;  4PWW A;  4MKV A;  4RW6 A;  5DLF A;  3DFE A;  4FVC A;  2OD6 A;  3QLH B;  2Z58 B;  4WKY A;  3BR8 A;  3F44 A;  1GXU A;  1N0V C;  4MKY A;  2UV8 G;  4K4X A;  1XNR J;  2CPE A;  3T1Y J;  4OX9 J;  1PGZ A;  3LAN A;  5A8R B;  4YB1 P;  3UCG A;  2EKY A;  3H5X A;  1HI8 A;  4LF6 F;  2HK3 A;  4X64 J;  3TO8 A;  3MR5 A;  1FWL A;  2OLW A;  5I3P A;  4Q7A A;  1M5K C;  2BEF A;  5IC4 B;  3OTO J;  3FSY A;  2WVB A;  2BQ3 A;  3IMQ J;  1YJW S;  2YX7 A;  2XZW A;  1RWN B;  2BMB A;  2Z2M A;  3N6N A;  5GMK a;  2HS4 A;  6FDR A;  2H5I B;  4U95 A;  2RIJ A;  4C3M A;  4ZK7 M;  1U2F A;  3PM9 A;  2QLJ B;  1N5Y A;  3AD8 C;  4DJB A;  1HFE L;  2LFV A;  4QWC A;  3Q8Y A;  2CAD A;  1RSC A;  3ENV A;  2UZA A;  3ENQ A;  4DFP A;  2G2O A;  3JXO A;  5E41 A;  5BR8 F;  1JLB A;  4M5D A;  1TKX A;  2B4U A;  5HAT A;  2EFG A;  1EHW A;  3TA2 A;  2BAC A;  2WZ1 A;  1N36 J;  1T95 A;  2KVQ E;  2KYZ A;  1CLF A;  3NCP A;  3KLE A;  4A8S A;  2KHC A;  4RNM A;  2ZE2 B;  2E7X A;  1F60 B;  1AXQ A;  4ITS A;  4LBH A;  1RT7 B;  3AAW B;  5J2P B;  4IKA A;  3TR5 A;  4CWB A;  4EO8 A;  3QO9 B;  3MTK A;  4DCJ B;  3MGJ A;  1ZM3 A;  3HK2 A;  1WTF A;  1ZOT A;  1YJT A;  2CQB A;  4C98 A;  2XWX A;  4PKD B;  3UQS A;  2OTJ S;  3I0S A;  2CNK B;  2NS1 B;  4NLD A;  5A6P A;  1T9V A;  4F0K A;  2NXU A;  2HLT A;  1P1T A;  2LEA A;  3QSY B;  2K1R B;  2WK4 A;  4PWD A;  5E5N A;  1WHW A;  4LUB A;  4V19 J;  4G1Q B;  2HVD A;  4ZCL A;  5C24 B;  4A8K A;  1QE1 B;  3SFG A;  4PG6 A;  2JSX A;  4CCH A;  2FZC B;  3PR4 A;  3DRR A;  3M8P B;  4IRK A;  4OYW A;  4L6V 3;  1ZAW A;  4AYB D;  2JLF A;  3I4P A;  5K8N A;  5HO4 A;  2O66 A;  1Y9O A;  4J9Q A;  5KG7 A;  4B3R J;  3QWP A;  1LWE A;  2KFY A;  1F5A A;  1SI9 A;  4KSE B;  2W8K A;  4ZN3 A;  4RL1 A;  2WON A;  2B9W A;  2YPY A;  5KT4 A;  4RLE A;  2IIH A;  4L3N A;  4CT9 A;  1X4G A;  4Y2I A;  4GO7 X;  4ECV A;  1EQ0 A;  2DO0 A;  4FVM A;  2GO9 A;  1NJW A;  1YWX A;  4P2X A;  2Q79 A;  2PA8 D;  4C3L A;  1YJ7 A;  2GNK A;  2L9D A;  4TY8 B;  5ETO A;  2ZH3 A;  2KFN A;  5L38 A;  2HRU A;  3A8J A;  2FHK A;  2HQG A;  2CJX B;  3R1L A;  3DGP A;  1R0A B;  3QJP A;  1H72 C;  4DFM A;  1Y3J A;  2MQN A;  4WP9 A;  1TTH B;  1K1S A;  1T94 A;  2WOM A;  3VAM A;  1X0F A;  3R6G B;  4LT6 A;  5KFS A;  1D1U A;  2PC6 A;  4KKO A;  4IH7 A;  5F41 A;  2RE1 A;  1LWC B;  1QAY A;  3RB3 A;  1U45 A;  1KOO A;  2XSF A;  4UOF A;  2DIU A;  5HBM A;  2RQC A;  3MUM P;  4CTA B;  3TUJ C;  4ZVE A;  1HMV A;  1EET A;  5K14 B;  3GJT B;  1HNX J;  2R42 A;  4RUC A;  4AUK A;  2D3O R;  3IRW P;  4ZN1 A;  4O23 A;  4BWJ A;  3W63 A;  6AT1 B;  3MAA A;  4HHH A;  2VUG A;  1VK8 A;  1IKW B;  3Q86 A;  3ZZT A;  4MAK A;  3K89 A;  4B17 A;  1XNR F;  2XO6 A;  3T1Y F;  2GIR A;  2OPR A;  9RUB A;  3QSI A;  4ZVF A;  2DCL A;  3OFG A;  4X4P A;  5BJR A;  4DQP A;  3HHE A;  3UWT A;  2DYA A;  4EBE A;  1XMO J;  3KLI B;  3G82 B;  3IGN A;  3OXG A;  5A8K A;  3VHQ A;  2RQ4 A;  1DQ9 A;  4ECQ A;  3CJK A;  1F5B A;  1QAI A;  4DSF A;  3HHD A;  2FLN A;  5CA5 A;  1FVS A;  2HAI A;  2EG1 A;  5CZV A;  2Z0G A;  1WC3 A;  1CJU A;  2IVF B;  1T05 B;  3ILO A;  2B4O A;  1BLU A;  4GRS A;  3K0J A;  2M8D B;  3PKM A;  2GAH C;  4MFB A;  1QSY A;  4K4W A;  5IT9 Y;  4DCP B;  1S99 A;  5HJY A;  4M94 A;  1VK3 A;  3I9Z A;  4DWI A;  5AJ3 J;  2WVE A;  2ZVI A;  4KJI A;  3AH6 A;  4I64 A;  1DLO A;  1X4C A;  2AX0 A;  2A18 A;  1N36 F;  4TY9 A;  3FCV A;  3TJ9 A;  1U1K A;  2VBW A;  4Z37 A;  4ZKA A;  4WFZ A;  3GB0 A;  3SEO A;  5J1E A;  1W7W A;  2GVD A;  2C2D A;  2HNZ B;  2FHJ A;  1VLY A;  2KT3 A;  4IOA Q;  2RHQ B;  1YJ9 S;  1WG4 A;  4WFX A;  2LCW A;  3PRD A;  3ITH B;  1XIQ A;  2JC1 A;  4F3O A;  2AX1 A;  2HEK A;  2OGU A;  4P72 A;  3MED B;  2DGS A;  1TL1 B;  2DRD A;  1VC6 A;  3RAX A;  2DY9 A;  1RAG B;  3GV5 B;  3VGV A;  1HBO A;  2IA0 A;  1RZM A;  2WTF A;  5LSL A;  3I5A A;  2XWY A;  4IUF A;  7FDR A;  2ASD A;  1UPM B;  3IBF B;  4H4O B;  1YI2 S;  2J5A A;  4LFB J;  3DI6 A;  2C2N A;  3N5B A;  4MIW A;  3KHL A;  2MKI A;  5K8O A;  3GII A;  3CJ3 A;  1OO0 B;  1UL3 A;  2YPZ A;  3MFI A;  3DLK A;  3PYF A;  4WYL A;  1T9Y A;  2QE5 A;  1CJK B;  1G2E A;  3MCO A;  2R9L A;  4ED3 A;  1S1V B;  1ZZF A;  3M32 B;  1KFS A;  2V2K A;  3QIP B;  1S57 A;  1BHN A;  1T3N A;  5CYJ A;  3W66 A;  4XDC A;  3UCZ P;  2ZZN A;  1KS2 A;  3G96 A;  2R4F A;  1FEH A;  2J9E A;  2NZ4 A;  1S79 A;  3PJ9 A;  2RF2 A;  1N5Q A;  5BXI A;  4UOC A;  2YH0 A;  3MPV A;  2C3P A;  3CD0 A;  2UU9 F;  1BQN A;  1S12 A;  2LQJ A;  2CUY A;  4LRC A;  2KO1 A;  2SXL A;  2PFF B;  5KFH A;  1URR A;  2J7K A;  4K2J A;  3CD7 A;  2XMW A;  5IM0 A;  2AT1 B;  4B9S A;  3CW2 C;  2ASJ A;  2JX2 A;  1SBR A;  2LQ8 A;  4DR3 J;  3MOZ A;  2ZH8 A;  1SH2 A;  3M2U B;  3AJ1 A;  1FRJ A;  1LW0 B;  1UVI A;  2V8V A;  1T03 B;  4NEZ A;  3V4M A;  1KWM A;  3OV7 A;  4W4M A;  1RTJ A;  5T7L A;  3FSI A;  2FTR A;  2YKN A;  1YGY A;  3FCH A;  2DR7 A;  4N76 A;  4KO0 B;  2DR8 A;  4ES1 A;  4GKJ J;  5J2M A;  2BJ9 A;  3G4S S;  1S1W B;  5E3P A;  1NKC A;  4NLS A;  5BYR A;  3OQ2 A;  1EAR A;  2IVM A;  2MMY A;  4P10 A;  2Y1L B;  4FPI A;  1HNX F;  2CVE A;  3I32 A;  4J9N A;  2DNZ A;  3VGS A;  2KZM A;  5G0R B;  1HWI A;  2GML A;  4JI0 J;  4FXD A;  4BDP A;  5KG3 A;  2YNH B;  2AMC B;  2B7B B;  1R8B A;  4PQU A;  3OSP A;  4F3Q A;  1WTB A;  2E5L F;  1VJQ A;  1XMO F;  2ATL A;  1QUP A;  4H54 A;  3AD7 C;  1RKI A;  1JKH A;  5KOX A;  1H2U X;  5C42 B;  4ZVP B;  2JWN A;  4X84 A;  2AGO A;  3M1V A;  4NLW A;  3KHR A;  3GIJ A;  1L3T A;  4HEA 9;  1RTD B;  4UQG A;  4RWW A;  1PIL A;  3UD4 P;  1IKY B;  3AA9 A;  1ZYQ A;  2E66 A;  1FO1 A;  3QAU A;  1VMB A;  4KHM A;  2YNF A;  1VR6 A;  1VOM A;  2CWK A;  4KGM A;  3DYA A;  1J5O A;  1RBO B;  1NSQ A;  3S1T A;  2W9C B;  5HVF A;  2K06 A;  3MXH P;  1YRU A;  4L75 A;  3OPK A;  1RT4 A;  3AXM A;  2OEJ A;  2UUW A;  4ZP6 A;  2KZZ A;  4OI6 A;  1ZM2 A;  3RGI A;  2D3O 1;  2U1A A;  5AE3 A;  3SI8 A;  2D41 A;  5GAD U;  3ZZO A;  1RYR A;  4A8W A;  2H5E A;  1X8D A;  3GFX A;  1MG7 A;  4RU2 A;  4QWA A;  1M0S A;  1UJ6 A;  1BQX A;  3LW5 C;  2W4C A;  1K9M T;  3UDL A;  4LQ9 A;  1ZA1 B;  2HGN A;  3AB2 B;  3P6Y C;  2V2V A;  5AE2 A;  3C46 A;  1TUV A;  2GIF A;  1FJG J;  4LFB F;  1U0H A;  4PXE A;  3JTP A;  3CJ8 A;  3TW0 A;  4ZVS B;  3M7V A;  3NEK A;  4LF5 F;  4MTP A;  2EK6 A;  1XR7 A;  4J9P A;  1QTM A;  4KV8 A;  3TI0 A;  5J2N B;  1L3U A;  2QA4 S;  1RIS A;  4NYO A;  1FDN A;  4EBC A;  2RJZ A;  4WII A;  3KWM A;  3O3L A;  5KFO A;  2GJI A;  3DRS B;  5I3U A;  1MWQ A;  4NI2 A;  1HBU A;  2LEC A;  1WI8 A;  2K2P A;  3BV8 A;  1R8C A;  4IO1 A;  3H59 A;  5IQQ A;  1S1T B;  2VQE J;  1IBM J;  2PSZ A;  3ZZ0 A;  2CDR B;  5JMN A;  2XYG B;  2N4D A;  2C3M A;  1VI7 A;  2CQC A;  1RI7 A;  3H20 A;  1I6J A;  4LR9 A;  1C2P A;  4YN3 B;  4YDX A;  2CZ9 A;  4DV2 J;  3TVZ A;  3NBP A;  5HI7 A;  5IS2 A;  4H4K C;  3D3B J;  8RUC A;  3W8G A;  1VQ7 S;  4P7V A;  1NK0 A;  4I56 A;  3OLB A;  2JLE A;  2LDI A;  2NYH A;  2W1B A;  4X62 J;  2DBB A;  1N34 J;  3AJ2 A;  4ICL A;  2YKP A;  1HBM B;  3DN9 A;  5DZ6 A;  4LF4 J;  2VKR A;  2F8M A;  4N7T A;  5I42 A;  2B51 A;  2V9K A;  1C1B A;  4ZCK A;  4GKJ F;  1WAC A;  3CVK A;  1PAU B;  3DGV A;  1NK9 A;  4FP9 A;  3LP1 B;  1VQ6 S;  1RHK B;  4AFF A;  3E01 B;  5KFV A;  4OYM A;  1F2G A;  1OPI A;  1XBW A;  1RA7 A;  2XY7 A;  5F0W A;  2E5I A;  4I2Q B;  1TL3 A;  4Q2M A;  4NLG A;  3KK3 B;  3BGU A;  4UZB A;  2PEB A;  3KTQ A;  1KTV A;  3J80 Y;  3LP0 B;  2FVS A;  4ES3 A;  1D9D A;  1RUS A;  2VBY A;  4WP3 A;  2IBO A;  1U1R A;  1F0X A;  1Q53 A;  4DSE A;  1YDL A;  4TKT A;  2F9J A;  2CVI A;  2NRE A;  1TL7 A;  1UEK A;  3GLJ A;  5HRO B;  1T9U A;  4CI0 B;  1EZZ B;  1VQK S;  2UXC J;  1TZ0 A;  1O5J A;  4FS2 A;  2KXF A;  3AD9 C;  2RUS A;  1TR0 A;  3V81 B;  5F8L A;  1S1U A;  3HVA A;  4HAC B;  4DL5 A;  4TYB A;  1NH7 A;  2BX6 A;  4LF2 A;  1NSP A;  4CLF A;  2XY6 A;  2EFQ A;  4Q8E A;  4OYO A;  3ZTO A;  1O0P A;  4ELU A;  1Q4R A;  1VQ9 S;  1JXV A;  3C15 A;  2RQM A;  1HNV B;  1N5V A;  1RT1 A;  2HNY B;  4M5H A;  2O1P A;  4LQ3 A;  1P27 B;  3A8E A;  2YKQ A;  2OFH X;  3L95 X;  2ZBC A;  2GZO A;  3MR6 A;  3U1L A;  1K1Q A;  1QDU B;  4AL7 A;  4OI0 A;  5K5M A;  2ZOM A;  3BZQ A;  2A0F B;  1TV6 A;  1K44 A;  2EC2 A;  1UVN A;  1SH3 A;  4WE1 B;  3OD2 A;  3D6M B;  5L46 A;  3ET6 B;  3ONQ A;  2B9E A;  2F7V A;  3JQJ A;  5DRK A;  2AHO B;  2C28 A;  3M8Q A;  4IFV A;  2L3M A;  2MDA A;  3P8B B;  1TKZ A;  1BD6 A;  2NYI A;  1FJG F;  4X65 J;  3OJS A;  2RKI A;  5B0A A;  3CC4 S;  3NY0 A;  4EO6 A;  3SV3 A;  4DR6 F;  2C2Z B;  4NLY A;  3BPD A;  3IR5 B;  2XSJ B;  4PQA A;  4KGK A;  2BV3 A;  2MLX A;  1YK9 A;  2VL1 A;  1KQF B;  5KT7 A;  1T9T A;  3IS9 A;  4RW6 B;  4JI8 J;  4P9S A;  4CLY A;  3IG1 A;  1OYE A;  2AW0 A;  3OTD A;  3MZI A;  4ETX A;  2ROP A;  2PI4 A;  2NPI A;  1RP5 A;  2HAF A;  4IH6 A;  3SSS A;  1WG5 A;  2M7S A;  5H9E K;  4UUW A;  2X7I A;  2HND A;  4O44 A;  1RTI B;  2H48 B;  2XNQ A;  3H4D A;  1AZS A;  2VQE F;  2W25 A;  3OUY A;  1IBM F;  2RS8 A;  4CP5 A;  3R5D A;  1Q8L A;  4ALZ A;  2MQQ A;  2W24 A;  2LQ5 A;  2VU5 A;  1C1C B;  3NGT A;  4M5M A;  1GMW D;  2JZ5 A;  3GSI A;  1ZAV A;  4KGZ B;  2DNR A;  1WC5 A;  5B09 A;  2HYI B;  1IBL J;  4N8O A;  1N5Y B;  4ZP8 A;  3G86 A;  5IOL A;  1PJ7 A;  4JV5 J;  3IWX A;  4KB7 A;  5CCM A;  3KNA A;  4OYZ A;  4X62 F;  4OJH A;  1JLB B;  4YEA A;  3D28 A;  1TKX B;  3ETM A;  1R8P A;  1VHI A;  4IRD A;  2NSB A;  2P8I A;  3AHP A;  1K47 A;  2DNL A;  3KLG A;  1HQ2 A;  1VRT B;  4FYY B;  4NYP A;  3UD5 A;  1B0T A;  4ZLL A;  1CC7 A;  5DDR C;  4A8F A;  1FJ7 A;  2RIL A;  4ECZ A;  2FJV A;  3LGM A;  4JI2 J;  3KLE B;  1H74 A;  4OHV A;  3M2R A;  1RHU B;  5M2U A;  4DX8 H;  2C2K B;  1RLC L;  3B78 A;  4NOH A;  5LMN J;  1X7V A;  4OX6 A;  3GQC A;  3NWG A;  5KTQ A;  1X5T A;  3MPY A;  1WUU A;  1XN9 A;  2IFX A;  1RWW B;  3JSM A;  4CLW A;  3EX7 B;  1BQM A;  1GTH A;  2CJ9 A;  3QRP A;  5LSR A;  2OUG A;  3I0S B;  2E1M C;  3I55 S;  3B8H A;  3M05 A;  2VQF J;  1R8A A;  1OQ3 A;  4QU7 A;  2D3Z A;  1VQY A;  1OY6 A;  4ZLP A;  4PWD B;  2MGZ B;  4Q8F A;  2RUG A;  2XTJ P;  5CYQ A;  2DY1 A;  5KFZ A;  2UXC F;  4W98 A;  3KG4 A;  1RT3 A;  1TKT A;  3POT A;  3T3F A;  3DRR B;  3NNH A;  3DLE A;  3RRH A;  1SL2 A;  2WVD A;  3TEG A;  3THP A;  5J1N A;  3JSB A;  1RWK B;  1QUV A;  2DR5 A;  4K4Y A;  1SPB P;  2UVW A;  1FRX A;  2CZ4 A;  4ZCM A;  4OMF G;  1R89 A;  2VPX B;  5L8R C;  4JUZ A;  1YRT A;  3TNV A;  2V5H G;  2WON B;  3MM6 A;  2VD3 A;  4NA2 A;  4DCO B;  4ZJQ A;  4L3K A;  5THW A;  8ATC B;  4FNI A;  3CED A;  1D3W A;  2POK A;  2KVI A;  4EUV A;  3OFH A;  2H51 B;  2M52 A;  4FYX B;  4OV1 A;  3I5B A;  5J1P A;  3CXC R;  2QRR A;  2DPI A;  2CPX A;  4ZVU B;  3BB5 A;  2XY5 A;  1Q5V A;  3SBM A;  3RZA A;  2DHS A;  3DGP B;  2V4Q A;  2QL9 B;  1WEX A;  3P49 B;  2VF3 A;  2BRL A;  4I6W A;  4KHR A;  2CJQ A;  5D78 A;  2WOM B;  4DBQ A;  2XCP A;  4Q44 A;  4ZMM A;  3NCQ A;  2FUG 9;  3GR1 A;  2XLJ A;  4X65 F;  4KKO B;  5F0U A;  3KDN A;  2BJ3 A;  4M5I A;  4USU A;  2ZJR Q;  4LFA J;  3BM7 A;  3HD2 A;  1HMV B;  1EET B;  4ED8 A;  2MQL A;  3H90 A;  4PZV A;  5EX0 A;  4JI8 F;  3PTW A;  5DDO C;  4ZA1 A;  5C25 B;  5A0Y A;  3M2V A;  3MAA B;  2PII A;  1RGV A;  4P52 A;  4TLQ A;  2C3U A;  3R97 A;  2YWW A;  2YWE A;  4NPO A;  3RYL A;  2YWF A;  4J9S A;  2GC8 A;  2V34 A;  4TVA B;  1EJ7 L;  3D54 A;  2QMW A;  4FYV B;  2AEM A;  3FKB A;  1HPZ A;  3QGP A;  1VCT A;  3MR2 A;  2RVJ A;  1AB8 A;  3OVB A;  5JVG Q;  1PJ6 A;  2KI2 A;  1DUR A;  2NZC A;  1JNR B;  3OLA A;  5A8K B;  2ALZ A;  2F9D A;  1K8A T;  3CJK B;  1CUL B;  3D66 A;  3CD5 A;  3IWL A;  1MLA A;  3MM9 A;  2C2M B;  4G1I A;  2XMV A;  3T5J A;  1FT8 A;  4JI3 J;  4RW9 A;  1CJU B;  1S7H A;  5F3Z A;  1D0E A;  4RBU A;  2V4J A;  3MFH A;  4JV5 F;  2MLY A;  2FLP A;  3UFC X;  3PJX A;  2YX1 A;  2XMT A;  3T9N A;  1VQP S;  4MFB B;  4O3O A;  1EKR A;  1WC4 A;  2E5J A;  1QM9 A;  2R3V A;  1YJU A;  1VQS A;  1PC5 A;  1DTT B;  1XEZ A;  1TK8 A;  1Y00 A;  4PYA A;  4OI4 A;  4V19 X;  1DLO B;  3SZ2 A;  2IJF A;  2YXL A;  4YME A;  1OMS A;  3JYT A;  4HT7 A;  3E2E A;  4JI2 F;  4DSJ A;  3PG9 A;  2LXI A;  3CCL S;  5J1E B;  2GVD B;  1YSJ A;  1YTY A;  5A6W A;  3QBC A;  5HQ8 A;  4OJ1 A;  1FK9 A;  2VG6 B;  3CO9 A;  3G87 A;  1GTE A;  2M9K A;  2C2E A;  4PRF A;  5T14 A;  4CLS A;  4W90 B;  1S0V A;  3T1H J;  3DRY A;  1HHT P;  4N8N A;  4HH0 A;  3PO5 A;  4ZJO A;  2HBY B;  1CEZ A;  1HBO B;  4Y0F A;  4XTT A;  1IKX B;  1WDT A;  1JX4 A;  3D1O A;  3O44 A;  5LXY A;  3RBE A;  4ZPW R;  1SKW A;  1LNQ A;  3O1L A;  2JEI A;  2IVY A;  2V8G A;  1O8B A;  4QBU A;  3H4B A;  2H3E B;  1RHJ B;  3KMS A;  3M8Z A;  1YZ7 A;  3GWC A;  2F4V J;  2DEJ A;  2BW7 A;  2ZBI A;  2MQP A;  3DOL B;  4ILR A;  3QT7 A;  1U1Q A;  2XLK A;  2DCU B;  1SC4 B;  2M8H A;  1DQ8 A;  4DQR A;  3W61 A;  3OTE A;  2CPF A;  3CC7 S;  5LT5 A;  1EB0 A;  1UCN A;  2AZ1 A;  5G4D A;  4PUO B;  3DRP A;  3RB6 A;  2OEM A;  3A8K A;  3GP9 A;  2RF2 B;  4DL3 A;  3R27 A;  4FKY A;  4S0M A;  1MU2 A;  1QTN B;  3QGI A;  3BH6 B;  1BQN B;  5C2G A;  2HHS A;  1VS3 A;  1WHX A;  1F3F A;  3CCW A;  5IM0 B;  1N6Q B;  2W9B A;  3QNW B;  1TUW A;  4QPX A;  2PMH A;  2B56 A;  5KFJ A;  2RU9 A;  3MTJ A;  4FF2 A;  4ED1 A;  1P1L A;  3DLH A;  1JWW A;  4RUH A;  1YJN S;  3MWB A;  4C8L A;  1FDB A;  5DM7 Q;  2R2R A;  2ZHA A;  1GEH A;  4OZ1 A;  3NMR A;  4AQY J;  3CD6 S;  5T7L B;  2E5H A;  2YKN B;  3B82 A;  5DG9 A;  1IJF B;  4X4O A;  4KTQ A;  3NRB A;  2BE9 B;  5J2M B;  3C3L A;  1GX5 A;  4LFA F;  3MF5 A;  3Q0A A;  2EK1 A;  1SQG A;  1Q8I A;  3BN7 A;  4MIB A;  2ZWO A;  4TU9 A;  3NOC A;  1Q81 T;  7AT1 B;  3DCA A;  1YG0 A;  3WBZ A;  2OJ3 A;  4NX9 A;  2YQ0 A;  2CG4 A;  3M8W A;  1TFY A;  4B02 A;  1E6Y A;  3HHL A;  1RWX B;  4OLO A;  4RUA A;  2PA3 A;  3OFE A;  1VYA A;  4IQM A;  3KUG A;  1JKH B;  3Q22 A;  3LTO A;  1REV A;  4JI3 F;  1M5O C;  3VZI A;  4DMZ A;  3WDO A;  1NME B;  3ZTP A;  2FJW A;  1F9F A;  1REG X;  1GK8 A;  1U0S A;  1B7Y B;  1OIA A;  1RAE B;  1S0M A;  2AGQ A;  4WU3 A;  2ASL A;  3GV8 B;  2HGM A;  3CDW A;  4ID5 B;  1ZM9 A;  2R8H A;  2XHW A;  4CO4 A;  1NND A;  2O3D A;  1OSC A;  2YNF B;  1KVK A;  1TU0 B;  1J5O B;  2F8E X;  2ALY B;  1RT4 B;  4DSL A;  4H4K A;  4NLP A;  4UTG A;  1X4B A;  2DH9 A;  3KK2 A;  3O8W A;  3ILJ A;  1HQU B;  1Z2Z A;  4N77 A;  2C2R A;  2YWK A;  2KKH A;  4PAB A;  1Q86 T;  3H5S A;  4RKU C;  4FF3 A;  1L5U A;  3C6T A;  2XCA A;  4KY3 A;  3OR2 A;  2ZM6 J;  1DHM A;  1J5E J;  1LW2 B;  2L9W A;  1SL0 A;  4XK8 C;  3VV2 B;  1IJE B;  3IR6 B;  3W7B A;  2H54 B;  4DQS A;  4C0O C;  4A8X A;  3KFW X;  4N41 A;  4DX7 A;  3WQP A;  2X3D A;  4Y65 A;  1U0H B;  1UMJ A;  1PCA A;  2ZC4 A;  2GGP A;  4JI5 J;  5HVH A;  2CKW A;  5KFB A;  2V50 A;  3AJD A;  1IQT A;  3U7J A;  2F4V F;  4JBC A;  3UNG C;  1S0N A;  3RJM B;  3OSN A;  2QZ8 A;  2R7S A;  1QJH A;  3KLH A;  1I3O B;  2HIY A;  2IYI A;  3M6X A;  3C14 A;  3DU6 A;  4P7T A;  4IG0 A;  3MMC B;  2JRS A;  1X5S A;  1BE4 A;  4JI1 J;  1JLA A;  1FKP A;  2MSS A;  4UY8 5;  5I3U B;  4NI2 B;  1HBU B;  1Y7P A;  2XGQ A;  5GAD I;  2XUL A;  3LAK A;  2RDJ A;  1U4B A;  3HHN B;  2XMJ A;  2CYY A;  1S10 A;  3GV7 B;  1URN A;  4ILM A;  5KFP A;  1WSR A;  2VOP A;  4MK9 A;  5LJ5 Y;  1J27 A;  2FJA B;  4X4V A;  5AE1 A;  1HI1 A;  2VG5 B;  4QYZ K;  3IFE A;  2BKO A;  3W65 A;  2V0N A;  3CO0 P;  1RB0 A;  2W2Q P;  3B4M A;  3PHE A;  2J0S D;  2MYF A;  2IDE A;  4LFC J;  1KRP A;  3DOM A;  3VF0 B;  2EW9 A;  2ADB A;  4Y6I A;  3JSR A;  3AQO A;  3QT6 A;  1U02 A;  1YVF A;  4OYI A;  2JEF A;  2NR0 A;  2MJN A;  1OWX A;  2CQI A;  4K0K J;  5KFX A;  3V5R A;  2CJY B;  3PJW A;  2E1C A;  3MMB A;  5LOQ A;  3EZ5 A;  2DIV A;  4NXN F;  1K73 T;  3ZNJ 1;  4MK7 A;  2KRB A;  2VZ9 A;  4WXO A;  2ACM A;  3L7P A;  2LEB A;  4C2M A;  4O3S A;  2UP1 A;  3H40 A;  5D6G A;  3OHB A;  3AXK A;  3SMZ A;  3LAL A;  4WFN Q;  1SJR A;  1QD1 A;  1TL3 B;  3F0N A;  4RW7 B;  3GG1 A;  3U27 A;  5ETN A;  1SUQ A;  5D4P A;  2KYX A;  1RU2 A;  3GFH A;  3BKF A;  1FKO A;  4OYB A;  3BKU A;  3M9M B;  1NHU A;  4WZQ A;  3TVY A;  3J80 U;  4ETZ A;  3CME S;  3M6U A;  4I6A A;  1NPR A;  4A8M P;  1HAR A;  1UEV A;  5FII A;  4CM2 A;  2E29 A;  2WSF C;  1GXL A;  4IFY A;  4R0J A;  1VIO A;  1TL7 B;  1JLE A;  1YQH A;  3MEC A;  1RCX B;  3PYD A;  3WX4 A;  4DR1 F;  4UY8 T;  1C0U A;  4I68 A;  2J0W A;  2RHS B;  3ULH A;  2QLB B;  2MZS A;  1U1M A;  5BYQ A;  3BDE A;  3D6H B;  4MKA A;  4DX5 A;  1S1U B;  1M5P C;  1MRO A;  3OVA A;  5A2Q Y;  3MD1 A;  2GW8 A;  4OHX A;  2HLU A;  2DR6 A;  4PEO A;  1JLG A;  2AJ4 A;  3L9Z A;  2R8K A;  4DF4 A;  3L3C A;  2XEX A;  4IYQ A;  1EKS A;  2HWI A;  3H2V E;  4OZ2 A;  2XO7 A;  4ED6 A;  2QN6 B;  3C15 B;  3FFI A;  2DRA A;  3Q8U A;  1RT1 B;  5KFT A;  2BQR A;  5AXK A;  1P8G A;  1AUD A;  5C2C A;  5F8H A;  2J9D E;  4ECY A;  1NJX A;  3I56 S;  3LP2 B;  2I8E A;  3GFY A;  3CUN A;  4EFA C;  3RBX A;  3NAI A;  4F4X A;  3ADA C;  4CZC A;  1WDD A;  1LK7 A;  2ZM6 F;  1J5E F;  1N48 A;  1FEE A;  1KHV A;  4GKK J;  4WWS A;  4IOC Q; 
#chains in the Genus database with same CATH homology
 2F4F A;  2FYX A;  2XMA A;  2VHG A;  2VIC A;  2XO6 A;  2XM3 A;  2VJV A;  2VIH A;  2A6O A;  2EC2 A;  2XQC A;  2A6M A;  2F5G A;  4ER8 A;  2VJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...