2F5GA

Crystal structure of is200 transposase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
130
structure length
130
Chain Sequence
ELKSTRHTKYLCNYHFVWIPKHRRNTLVNEIAEYTKEVLKSIAEELGCEIIALEVMPDHIHLFVNCPPRYAPSYLANYFKGKSARLILKKFPQLNKGKLWTRSYFVATAGNVSSEVIKKYIEEQWRKEGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transposase, putative
publication title Crystal Structure of a Metal Ion-bound IS200 Transposase
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Gene regulation
total genus 37
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2f5gA00
2XQCA 2XMAA 2XO6A 2VICA 2F4FA 4ER8A 2VJVA 2VIHA 2F5GA 2XM3A 2VJUA 2VHGA 2EC2A 2A6OA 2A6MA 2FYXA
chains in the Genus database with same CATH superfamily
4CTAB 1QVFR 4MIBA 2IHR1 1F3FA 3GYXB 2AKWB 1R89A 3BH6B 2WVEA 1ZPVA 5KFIA 4OX6A 2DXFA 4RNNA 4U7UD 3IP0A 2FTRA 4X66J 4RW7B 4ZPBA 3QPIA 1HQ2A 4N41A 4O3RA 4CI0B 2J0QD 3MOZA 1G7CB 1OSDA 2M52A 2BVZA 1IQTA 1E6VA 2L41A 4RU9A 1SIWB 4YHHF 2IDLA 2R42A 1RAIB 2XWXA 2VFVA 2LEPA 3VAJA 5K14A 1ZS6A 1WC0A 3GILA 2HAIA 3ETOA 3KUHA 4RW7A 3D5MA 4AL7A 2AP6A 1L3TA 4C8KA 1EZZB 3H5SA 1NJZA 4DQPA 1RA6A 4CNZA 3GG0A 2QL9B 3BDEA 1PAEX 1UWBA 2VPWB 4X4RA 4YP3A 4IO1A 3M8ZA 4WE1B 2MZSA 4ERDA 2QX0A 2ZD1A 3NS7B 2W8LA 1HNXF 1BQMA 3V5RA 3H2LA 1GXLA 4BLGA 4JI0J 1FE4A 1OSCA 2QYCA 3PRBA 4IG3B 3OXFA 3PR5B 2W9AA 3HVRA 5HMZA 3OL6A 1UFKA 3TJAA 1XEZA 2ZUAA 4LF8F 1GXUA 4HL9A 3KKFA 1XNQF 4P7VA 5F8IA 2F65A 5I4MA 2GIQA 3IM8A 4H54A 3M8PB 1NNDA 5KFLA 3BR9A 5GADI 1URRA 3JS9A 1FJ7A 2CAJA 3I4HX 4CZCA 1DQ8A 3E2EA 3M9NB 1SC1B 1VQ6S 2MLYA 1YJRA 3MR6A 2VQEJ 4DI6A 3MM5B 1RWXB 1WOPA 2UUAJ 2CJ9A 1KSPA 3CCSS 4ED7A 4RJVA 3EM1A 1HFEL 1IJFB 1WELA 1AFJA 2Y1JA 2NREA 1JLAB 5ETTA 5KFJA 1UA0A 1N6QB 3QLHA 2F9DA 1LXNA 3TZYA 1G3OA 3OFHA 4YR2A 2XGQA 2CZ4A 2P5VA 2Q6BA 4KT0C 1ZOTA 1YX2A 3BO3A 1CJKA 1VRUA 1X4HA 2ZBCA 3KLHA 2A6OA 3CJTA 1FNXH 3V81B 3T9NA 1U02A 5HBMB 5CH7B 1S1UB 1S72S 2GJ2A 2I1RA 1DFDA 2BJ8A 2J6TA 2P9GA 4RW8B 3PKYA 3PW0A 3HVTA 3OVAA 4G1QB 1N6QA 2CIMA 4XPCA 3B54A 4ZA1A 5AXNA 1RHQB 4NXMJ 2E5LJ 1IR1A 2CJBA 2EI5A 2V8HA 5I42A 3W64A 1MWQA 3D6HB 4KHRA 3LA0A 3DLKB 1KFDA 2DGTA 3ZTSA 4O23A 4F4WA 1D3WA 4F4YA 1RT4A 3Q0AA 1RAGB 2B7BB 2KDOA 3H0PA 1OQ6A 1NDLA 2RQ4A 2WB4A 1QVGR 1LNQA 1C1BB 3OQ2A 3M2VA 3BZQA 1K8AT 1DTTB 1K1QA 3QNWB 4DL4A 3VWSA 5K8NA 2EK6A 1X0FA 5JVHQ 3N9UC 4NLPA 2UXCJ 4TQSA 2XMJA 2FVSA 2M8HA 2Q66A 1WUUA 4JP8A 2FHJA 1UZDA 3BGRB 2VU5A 4DN9A 3K5NA 3ENAA 1HBOB 2CPFA 2FVPA 4ZHRB 1C1BA 4DQSA 4FS1A 4MFBA 2NQPA 2N3OA 3NGUA 5CABA 1QSYA 3N28A 1UJ6A 4BDPA 4ZIWA 2CNKB 1S0OA 1W26A 1GTEA 4LBPA 5GAHU 1U7LA 4G3IA 1SV5B 1FT8A 2MEWA 2EC2A 1U48A 1RU2A 2RSQA 4DV5F 1UZHA 4X65F 1N5VA 1UETA 5GAHI 5J1EB 3GP9A 4QPXA 3T6JA 4B3RJ 4B9MA 3K5PA 4DV4J 1S9GB 4IG0B 3AD8C 3N5FA 2H5IB 1JLEB 5E0OA 3FJ2A 3DXSX 3U7JA 2DGOA 1LK5A 4X64F 1HYSB 3EXYA 3BKFA 1YTYA 2F8MA 5KFFA 4M8LA 3UN5A 1YZ7A 4ZCMA 1D1UA 4MKYA 4DR5F 3D1HA 4ZPDA 1OS5A 2ZOFA 1U0SA 2DNGA 1KP6A 2ZUGA 4X4NA 3EMTA 2BOPA 3NAHA 4PQUA 5DQGA 2WONA 2BACA 4DQIA 4O4GB 3TRGA 3BKUA 3QGGA 4DJBA 3ZZZA 1MMNA 3O44A 1NHKL 4XDCA 3PXGa 4N56A 4F0MA 3C14A 3CJ4A 2GNKA 2DNQA 4DU8A 1FKOB 1WTBA 3MMJA 1TL7A 5C24A 4LRCA 3F41A 3BSAA 2AT1B 2GZOA 2HPUA 5IV4A 5D6GA 5ETMA 4GKKF 3Q8RB 3IXQA 5LJ5Y 1RADB 2QN6B 3GV7B 2HVDA 2AJ2A 4DFKA 1T9YA 2E9RX 4QR2A 4LF9F 1K0TA 4PABA 1J5EF 3T5LA 4JI4J 4NLYA 3HSZA 2JFDA 2EKYA 2WVCA 1TZ0A 1SVDA 4ED6A 2BE9B 4KH0B 3FQKA 3L7PA 2WVFA 4FVCA 1WC5A 5A0YB 3EZ5A 2MY8A 5J2PA 2RDIA 3EDRB 5IT0A 1CG2A 4FYXB 1S1TB 3M1VA 3UR0A 3NNCA 3H25A 5CQGA 2WK4A 4HLBA 4C4WA 3BGUA 5DM7Q 3R2CJ 3N6MA 2IYIA 4U8YA 4ZVQB 1N4LA 2KYXA 1IBKJ 4UOGA 4DSKA 4NL5A 1JLQA 4U8VA 2AX0A 3P6YC 1NB7A 4JYAF 2A3JA 2EFVA 3R5CA 5CXTA 5DETA 3UCUP 4N8OA 4DG1B 3HI9A 3ETMA 3CD6S 3M2RA 3M7VA 1Y11A 4B08A 4J9PA 2CJYB 1UJ4A 3PYDA 1U1LA 1OO0B 3KUGA 3W7BA 4N7TA 4ZVFA 3DLHA 3Q8VA 1HNZJ 3UE2A 2GFFA 3PFOA 4E0DA 3TX0A 2QLJB 5EWEA 2ZJQQ 4DL6A 4WFNQ 1CSJA 2WCXA 1VQKS 4YB5A 3V6DB 1FX2A 5FJ4A 5T7LB 2O01C 1HBMA 2G2ZA 3R5DA 4KGVB 1PCAA 3JTPA 1HARA 1UVKA 1H3DA 1T9WA 2FDNA 4ER8A 1S99A 3AJDA 4LBIA 4DDFA 2VZ9A 3MM6B 2R2UA 3MGJA 5HP1B 2PMZD 4DL7A 3E01B 3R7SB 4J5OA 5J2NB 1NMEB 5KG1A 3EVOA 4EU0A 3D54A 2V50A 2R7VA 3UVJA 2CKWA 4O3NA 4I4BA 3JQMA 8RUCA 1HWKA 3M32A 2YX7A 3TJ8A 2QA4G 2CFXA 1Q8IA 2DGUA 4NLTA 3R27A 2R8KA 1WEXA 2I5JA 1VR6A 4PYAA 3TZWA 4M5LA 5FLXY 1TL5A 1UVNA 2V4JA 1S1WA 2GMHA 3QRPA 1FJEB 3VAKA 4BC7A 2WW4A 4CO0A 3KXDA 1WF1A 3MI7X 1K44A 4LJMA 3UDVA 1M1GA 4WXOA 1TV6A 4PXEA 2RU3A 3Q8YA 2ZBPA 2MKIA 4F3OA 2NYIA 2Z2YB 1ZYQA 4YN3B 2CPEA 3NXZA 1HNWJ 3ZZPA 5C7PA 2DITA 2PEBA 5EGYA 3DGPA 1RI7A 4LF5J 3FCHA 1KVJA 1LW0A 2D74B 3VAFA 1JJHA 2A2CA 4DOZA 4DN0A 4DR6J 4O0IA 2QYGA 2DXDA 3IS9B 1VIOA 2DNOA 2HIYA 1NPKA 1PJ5A 6FDRA 5AJ3F 1VYAA 1X4BA 2O5DA 1IKVA 4ZCIA 3ZC4A 4CO5A 3KLFA 4CO2A 2HQIA 1M5SA 1FJCA 1HQUA 3QZ8A 1UEUA 3D67A 4OZ2A 2EKNA 4QU6A 1RWKB 1WACA 5ITHA 3VAHA 5FLXU 3N0VA 2GAHC 1T05B 2LMIA 4OZNA 1Q82T 2VKRA 5KT4A 3HHLA 2ZDPA 3EWGA 1RT5A 1AW0A 3ZZ0A 3RB6A 4MJKA 2W2OP 3B78A 5AE2A 4RW6A 1N56A 2GHWA 2C2MB 2M4MA 1VQMS 1TKDA 4HH1A 3ZNUA 5LM7E 2DY1A 5LJ3Y 2XLKA 2HW3A 1RACB 4IDKA 4KIAA 2XY5A 2CNLB 4BHQA 3OJSA 3IGVA 3TZZA 2GVDA 3KG0A 2IRXA 1L3KA 1ITPA 3TA2A 4ECRA 2QLWA 4LUBA 3TA1A 1OIAA 2RRNA 2MZRA 3DOKA 1HBNA 5DQHA 5KFGA 3LGNA 5K8PA 1GK8A 4ZLJA 1F2GA 3I96A 4MIWA 3ONQA 1JLCA 5H9EK 4ZPCA 1AUSL 3U1NA 1JIHA 2W4DA 5HI7A 4YHHJ 2E29A 1NDKA 1NKBA 4ZIVA 2HNDB 2VG6B 4F0HA 2YKAA 2B3TB 3W1YC 4OHYA 3DRXA 2H5EA 2DR9A 1NUEA 1O0PA 4Y28C 1R0AB 3DI6B 4PR6A 5J2MB 4FF4A 3GE9A 1EETB 3IWLA 4F67A 4FYYB 4NZ7A 2PN6A 4X4OA 2GA7A 1RJJA 4USKA 3DRSA 6FD1A 4CWBA 3CJ8A 2ZZTA 3K57A 1FI4A 2LP4A 2J76E 2B7CB 4JI5F 1IVZA 4ILRA 1RUSA 2RUGA 5D3GA 2NCKL 1XNQJ 5F9LA 2DPIA 3EPGA 4J9OA 3W61A 1UWAA 4HACB 3CJKA 3LWLA 3QSIA 3IRWP 3ILOA 1OWXA 3RBZA 4KPCA 4ECWA 2GC8A 3QT8A 3W8PA 3O2IA 5K20B 2QL7B 4PWDA 2D9OA 4FYVB 2B5JB 5HVGA 4DR7F 3NY0A 2MQMA 2VA3A 3MM9B 1NH8A 2MKYA 2AGQA 1FEEA 2FVQA 2MKHA 3DMJB 1U6BA 4Y2MA 3JSYA 3R1LA 2ZH4A 1LWXA 3BB5A 3C6TA 4LR9A 1J5OA 2ILYA 3IRXA 5HMYA 1FDDA 5KG4A 4LVNP 2ZH5A 1PYTA 5LT5A 1RE1B 4J90A 4QWAA 3HHLD 1UEKA 1YBTA 2JEFA 3IO1A 5G0RB 4UUWA 4DX7A 1SKUB 5KFHA 3MEGA 3OUYB 2HNZB 1JLBA 4PQAA 4X4PA 4I7FA 1FNMA 3QJPA 1NK0A 2VJUA 1VJWA 1L3SA 4GO5X 1JLGB 4OIXA 4GO7X 1OY8A 5JXSA 1H74A 1YRTA 2ZVIA 4A8OA 4URSA 3L7OA 3MEEB 5BJRA 4MKBA 2HYIB 4LVOP 4C9DA 1FXLA 3VQSA 1KLMB 1S57A 2J5AA 1X7VA 5KOWA 3NKYA 1Y3KA 3I5CA 2G4BA 2HHSA 3CPWR 4I6AA 1F0XA 3DDKA 2XLIA 4JB8B 2KKHA 1GX6A 3FBEA 5M2RA 1UVJA 2EC0A 1S9EB 4NE9C 2BABA 4DL3A 4NCAA 2GX8A 1B3TA 1KOHA 4OMFG 3AD9C 3LANA 3ADAC 4NMLA 1N0UA 4OJHA 4QIVA 4YDXA 2E5GA 2NXNA 3IFEA 3POTB 3MXHP 3I0RA 5K9FA 2XHCA 4ED5A 2V5HG 4JV5F 1H73A 1T03B 4Y34A 1NJXA 4HT5A 2GCFA 1KVKA 1ZAWA 5KFBA 5HQ8A 2EK1A 4UOHA 2LEAA 5DQIA 1RTIA 5L46A 1NSKL 3UD5A 3OPKA 4M5IA 2ROPA 1SI9A 4LQ9A 2V9WA 3R2DJ 4HH0A 1FKPA 2DRBA 4F02A 2P6TA 2PO4A 5RUBA 4AL6A 3MD3A 5F3ZA 4ECYA 1AROP 1VCTA 1GAOA 4OYOA 4C97A 1T03A 4F2RA 3T1YJ 1YLXA 4RO0A 1RP5A 3M30A 1RBAA 2IVMA 2QLXA 1X5TA 1ELOA 1I94F 1AZSA 4X64J 4IRKA 4LSNB 2VOOA 4C8NA 2CQCA 3KLEA 4AFFA 2OMLA 3M8QB 1FJGJ 5L1LA 2UP1A 3KHGA 5E33A 3O1LA 4MK7A 4CYUA 4H4MB 3CDUA 1NK6A 2UXBJ 4R0EA 2L9DA 1VISA 2P8IA 4DR5J 3BDPA 1DTQB 5HROA 4EO8A 4NI2A 2KH9A 2HFUA 2L9WA 1RAOA 4M5NA 4CLFA 4KSEB 4QZVB 5L8RC 3RW7A 3U02A 2ASYA 2RE1A 4WZQA 4IOBA 3PR4A 1TFYA 1BWEA 3NL0A 4USVA 2QFJA 2KN4A 3MAAA 4DEZA 2EFPA 1PC5A 2HNYB 3TOQA 4DWIA 2VDIA 4QIEA 3FSXA 3SV3A 4H4KA 2DR8A 1GEHA 1NJIT 4L74A 3IG1A 4C11B 1UMJA 4NWBA 2HAFA 3UWTA 4DR4F 1IQZA 5HLFA 4ZVEA 3QT7A 2ZE2B 3MPVA 2ZJPQ 2DNPA 4GC7A 2CRLA 1S97A 2D3ZA 2LQJA 1XTZA 2AJQA 2MB0B 1J5EJ 2H54B 4AXIA 2R7XA 2K7JA 1JXEA 2MQLA 1Z1ZA 3CMES 1P27B 2AZ3A 2RJZA 1WF0A 3PEJA 3TANA 4H4OB 1VHFA 1N36F 5F3TA 4DV3J 5E3CA 3LP2B 1WNEA 2R8JA 3S6EA 1FWLA 2G13A 1RGVA 1S77D 3M6XA 4ECUA 1WWHA 3ZTOA 2HWHA 3NGDA 4HR2A 2MGZB 1SJFA 4USJC 1YSJA 3G86A 1WD6A 3RRKA 4YS2A 4NXNF 1WSVA 2I9SA 4HT7A 3D6TB 1JJ4A 4DV2F 3M2UA 1Q5YA 2YWKA 4ZP6A 4ZVPB 1F3VA 2F8EX 4FXVA 4K0KF 3S01A 1UW9A 3GFYA 2YKQA 1TK5A 3CSKA 4RNMA 1XMQJ 2FC9A 1VBKA 5D78A 2DH8A 1N33J 1S49A 3MM8A 4JV0A 2A18A 4C8YA 4Y65A 1NDPA 3CW2C 1ZM3A 1C0TB 2NUHA 1D9FA 2W8KA 4EEYA 4O3QA 4KGXB 4LFAJ 4ZLLA 5DG9A 4UY85 1PAUB 1TTHB 3KK1B 1EB0A 3GIRA 5H9EJ 1N8RT 5FDLA 1XR5A 2CQ4A 3R5JB 1S6PB 1U45A 2CDQA 4PRFA 2GO9A 3FEZA 4I2PB 3ISZA 1T95A 3SDEA 1CVJA 5DZ6A 4E2FB 1M5KC 2BKPA 3IWNC 4PG6A 4KV8A 4AQYF 4OV1A 4IH6A 4GKJF 4QYRA 2VG7A 1ZTWA 1U0HA 1KBRA 4USIA 3CDEA 3HT3A 5HMXA 3VALA 4TU9A 4QU7A 4U6PA 4ANEA 4M95A 3I55S 1DZ5A 4KO0B 1ZETA 4ES2A 3QJJA 2YKMA 2HVHA 3NOCA 1C1CA 4OYIA 2E9ZA 4F4AA 1FDBA 1K0VA 4C6AA 3DLBA 3DLGB 3JB9k 1FFSB 3VVTA 5A8KA 2XSJB 2AZ1A 4Q0BB 3GJSB 4FF3A 2R7RA 1XR6A 5J2QB 1Y5LB 2G2OA 1D0EA 3NGSA 4NZ6A 1GNKA 5HQMA 4CLKA 3ZZUA 3OTDA 1M5HA 2XZTB 2OELA 1DJ0A 4N76A 4DR1F 1TQLA 4P9SA 4LR8A 2DHSA 2YKPA 4JV2A 2BRKA 2CWKA 3QGHA 2ZHBA 1YBAA 2WBMA 3NMRA 3P8BB 3MCSA 4B3OA 2PA3A 4G1PA 2CQ3A 1GMVA 1XIQA 3CO9A 1HWUA 1LWEA 3BBFA 1X9SA 2V2KA 3M8YA 2BW2A 3AOAA 2C3YA 2AEFA 2C1EB 3LUYA 3EPIA 3ZZYA 1YKWA 3GYGA 4ZDNA 2GVZB 2JLGA 1Q0NA 2Z8QA 4W90B 1EP4B 2B8QA 2ASLA 1V3SA 3AD7C 3K89A 3EYZA 2GMLA 2JDJA 1B0VA 2V6AA 2RT3A 3UD4P 4IYQA 4U7CA 1RB0A 2QLFB 4A47A 2XULA 1KRPA 2UUTA 2QIFA 2KG0A 3SMZA 4OX8A 1YK9A 4KB7A 4ZVTB 4LFCF 3RUBL 2R7TA 4IKAA 1N5TA 3FK4A 3KLGB 3MMAA 4C0OC 3GMGA 4WCEQ 4K59A 5B0EA 5DRKA 1JKHB 2OD4A 3ENVA 3G96A 4BS2A 1LOUA 4C3LA 5KFMA 1BHNA 2PA8D 3DM2A 4KY3A 1W2BR 2M88A 1LFWA 3CE8A 1H7XA 4IH5A 4USTA 1AXQA 4MK8A 2V34A 3AJ2A 4M94A 4E8UA 3MAQA 4OV6A 2AF6A 4ECZA 3D3CJ 2OPSB 3KJFB 2MQQA 1R8CA 3HHNB 4IRDA 5LSLA 4U67Q 2I2YA 4U96A 1MU2B 2ZZMA 1RT1A 1SJQA 1H0HB 1BE4A 1CC8A 3KHHA 2VONA 1VHIA 3BKTA 3F73A 1NH7A 1CQNA 4OYBA 4NA2A 1XNRF 1N5YB 4LRFA 2A2DA 3SQGB 3BQ2A 2HHPA 3MPUB 2CWXA 4XK8C 3TAMA 3Q83A 3PEHA 3H2UB 3NG8A 4DV1F 2FB0A 2CXEA 3R5BA 2EWHA 2JRSA 4G65A 2YNIA 5CCLA 3MHYA 5DDRC 1CJUB 1KTVA 2VD3A 4YUDA 3OVBA 5C25A 3RBXA 5A2QY 1FRHA 2HURA 2RILA 5DLFA 5F8LA 2QMXA 3PYGA 2AHOB 1RTDA 2GGPB 3HDSA 3I56S 4NASA 1FK9A 2JVRA 3UDCA 3OVSA 3DU5A 3EDQB 1VQ5S 2IFXA 3LH2S 3B8HA 4DLGA 3V6JA 2M8DB 5IQ6A 2J9DE 2GAGC 2KJVA 2DRAA 2ZM6F 1D8YA 2FVRA 1FDNA 4LF4F 3ILJA 1CULA 2HZCA 2BJEA 5KFRA 2AJ4A 1RTJA 3MMBA 2W9BA 1PIEA 1U1NA 1QD1A 3MPDA 3OR1B 3CF5Q 3D68A 4DV0F 3WC0A 2R8GA 1R43A 4IFVA 3BREA 1WI8A 1ZA2B 3OD2A 3QIPA 3NBPA 1FFGB 2YQ1A 2AU0A 2J8SA 1RT2A 1EKRA 4UZCA 2EFOA 2Z2MA 3WC2A 1N5QA 1N34F 4NZ0A 2JL9A 3BBBA 4ANDA 3CCZA 1R8HA 3PX6A 1LV5A 2YTCA 4GRSA 5ETKA 1MLAA 2JOQA 1IKYA 3PYEA 5A2QU 2E7WA 4P72A 3RAXA 5D0HA 2ROEA 4J9UE 5EWFA 3ZZRA 5K8MA 1SJ1A 1RAJA 3QFHA 4P2MA 1TL3A 2DIUA 3IAM9 2KI2A 4ELUA 5I3UB 2BM0A 4Q7AA 2DGXA 2XB2D 1ULRA 4ZPVR 3FRZA 4JI7J 4ZVRB 3NLCA 2AGOA 2M9KA 1KTQA 2LA6A 4QR0A 3ZZTA 1YJTA 2RUSA 2PEHA 2O67A 2VBXA 1PYOB 1NEEA 3ZXWA 1IXKA 4NEZA 3QRQA 2SXLA 3D0HE 2KFYA 1IKWB 4DR3F 3BF4A 1D9DA 4MT1A 3OTEA 2A1BA 2IPOB 1R6VA 2K7KA 1IBLJ 5CYQB 4A8WA 1HNIA 1KLNA 2XMMA 1OYDA 1HW9A 1IKXA 2HZVA 2V8DA 4HYKA 1SH2A 2YPYA 1KR4A 1XBWA 2YBVA 4NPOA 3TR5A 3MEDB 2VFSA 2W7AA 1ROFA 2NS1B 1JJCB 2NUUG 2VV5A 2HVEA 1FTCA 3HKWA 1TAQA 2WRMA 2LECA 2UVUA 1HQEA 3ULHA 5DZ7A 4KFBB 4ID5B 4G1IA 5DS7A 3HSDA 2VG5A 4USWA 2XYPB 4C8MA 1T9UA 2B56A 5C2GA 1H98A 5B7WA 3EGNA 3MMCB 1NKCA 1LK7A 2VASA 3PRVA 4DUYF 1RT3B 4B9LA 4WYLA 2GMJA 1FRKA 4F36A 3KK3B 1HNVB 1RWNB 1JNRB 5BR8J 1IWAA 4L3NA 4IOCQ 1TUVA 3MPWA 1VOMA 1QE1B 1D8ZA 4CLWA 4KC5A 4ES3A 2A0FB 4HDHA 1JX4A 4F04B 2OTJS 2Q3PA 4J9MA 4L3KA 1MG7A 3A1YG 4V1Ak 1S0NA 1PC4A 2RAQA 3RYLA 2CVIA 2C2OB 1SPBP 1DURA 3Q22A 4F2SA 4GVBA 1KD1T 3H4BA 4HTIA 3PW2A 4R5PB 3K8VA 3VGTA 4N47A 5CYMB 5KFCA 3A13A 4J91A 2DGWA 2UUBF 3VAGA 4PUOA 2XEXA 4NA3A 1WKLA 1SC3B 3OW2R 4M63A 2FLLA 1G6BA 1S10A 3KDOA 3Q8QB 5KFDA 3B82A 4FKXA 1NB2A 1SUQB 1X4CA 1QSLA 1UAWA 1U49A 2OPQB 4YQWA 5KG2A 3PJXA 1IN0A 1OQ3A 3ITHA 3FFIB 1RHUB 2HHTA 4C0BA 4P52A 3UD3P 3GPAA 3KYLA 4JI3F 3CC2S 1N52B 1TFWA 2GQ2A 1B99A 4Y3CA 4CLZA 4NCGB 4P2FA 4C2MA 1GXTA 1ZM9A 2NPFA 2IC3A 2N82B 4FNIA 2PFFB 1JQGA 3C6UB 1CS4A 3FZBA 4EBCA 1AFIA 1F2HA 4RBUA 4FF1A 2HGNA 2BOAA 4DHVA 3W2WB 1HMVA 2MQ8A 1N48A 2C3MA 1DLOA 1TL1B 3H5UA 2F5GA 1BQNA 4Y0FA 3NCRA 2BEFA 2D7SA 1TKZA 3G8TA 1Y10A 1G1XA 4XAKA 1HWJA 2V4RA 2OFHX 4A8SA 3HX9A 2BANA 4NXNJ 2B6AA 4A4JA 3AODA 2DNRA 5IT9Y 2VIHA 1CQMA 1RTHB 4DV2J 2ZJRQ 1R0BG 3DRYA 1NJYA 1Q1KA 1RZMA 4NLDA 4K4XA 1TVRB 2JSXA 3ELHA 2EEYA 4B9SA 3MD1A 2L3MA 4K4WA 2RS8A 3DRPA 2OGUA 1D09B 1D9AA 1W25A 4LSLA 4B3SF 2JFKA 2AYMA 5IS2A 3KJVB 4KPYA 1Z2LA 2VQFJ 1WDTA 2JVOA 3MFHA 1UFLA 2XY6A 2HHQA 3MUMP 1LQ9A 2ZBRA 3HM9A 1GX5A 2V63A 3BQ1A 1UL3A 3KK2B 3RB0A 3NOGA 2MY7A 2GIFA 1PO6A 4LF7J 3OHBA 4IUFA 2QMUB 2DR7A 4OHZA 1S76D 2RRAA 1QTNB 2FHMA 2OO4A 2YKNB 1NSQA 1RBOB 2XI3A 3PM9A 2BE2A 1JJ2R 2H4YB 5M2PA 5F9NA 4QWDA 1U1RA 2B0GA 3EVMA 3HZEA 1QSSA 1R8AA 2JJ4D 2CJQA 3MR7A 5IT9U 2IBKA 3G6VA 3MM7A 4ZVSB 4TYBA 2UUWA 1UEVA 3BM7A 3CDAA 3Q8SB 2J7WA 4DPTA 1N32F 5A8WB 4OZ1A 2DBBA 2DD8S 2YXLA 4IFYA 1REVB 2YNFA 3DOLB 2YNHB 5CCMA 2WTFA 1KDNA 2CZVC 2K3IA 3M9MB 1CBKA 3V4IA 4UY8T 2DEIA 4UF4A 3TJ9A 2CQ0A 3RTVA 1JLFA 1LWFB 2IJRA 2OPRA 1Q7YT 5ETSA 1Q4RA 3I0SB 3K58A 2J6SA 2V9KA 3KLIB 3C16A 3JSMB 1CJTB 4DQQA 4DV7J 2BXJA 4ZVGA 4ALZA 3GONA 1GQEA 2CPYA 4TKTA 2ZFHA 3A3PB 2DH9A 2HMIB 3THTA 1VC6A 1H72C 4M5DA 2UUCF 5KFOA 2ZBQA 1FWKA 4JI1J 1QLNA 3NGTA 3UPFA 2CPJA 3GR1A 4ECSA 3KHRA 3E3XA 1H38A 1MWZA 3F56A 1L3UA 2WOMA 4X62F 3J7A1 1IM6A 4RNOA 4KKOA 2K8GA 4NA1A 1VLOA 3DLEB 2COLA 3EVWA 1S6QB 4JBCA 4DV6J 4HKQA 3NWRA 2AYGA 1V5IB 4Y6IA 2N4DA 1V9OA 3V6HA 2W9CB 5HATA 3CULA 3PIPQ 4FF2A 2B9XA 3LOUA 1HR0F 3LQVA 5JJBA 3HZGA 4XO0A 1XMOF 3TX8A 2JHEA 4A8QA 2FLOA 3GV8B 3L95X 4BC9A 3SFGA 2ILZA 2IVFB 3DLEA 1S6QA 3IR5B 1RCXB 1KC8T 2IDEA 5LSOA 1RT7B 3SZ2A 2QLBB 1C0UB 1VK3A 2NPIA 3DDIA 3D1QA 5IFMA 4QWCA 2ACYA 3TAQA 1Q8LA 2WAQD 4DFMA 3C15B 3IN5A 2N3LA 2UVVA 4X4TA 4M1KA 1DBDA 4KH1B 1W2IA 4P73A 5DM6Q 5D0GA 1VQ7S 4EZ6A 3G6ES 3NMAA 2OMOA 4I2QA 4B3MF 3W5ZA 4ZVOB 3A3OB 4CCHA 4O44A 3ICLA 2X51A 3D2WA 1NPPA 2HRYA 1KVIA 3JYTA 1P9QC 1RT6A 2CYYA 3SCJE 4CLTA 1R27B 1T0TV 2HQDA 4DSEA 3LWMA 3OTCA 3HHLC 4OHVA 3ILIA 5LMUJ 5D4PA 4A8MP 4NLWA 2YWEA 1PG5B 4HHUA 3E8OA 2J9EA 3LP0B 2ZBIA 1QUVA 1TKTB 4CTAA 2HLTA 5L9XA 4KE5A 2LQ9A 3TWZA 4KYZA 4J37A 5GVQA 4NOHA 3TQEA 3GG1A 3A12A 5B0DA 2DO0A 2BV3A 2RQMA 2UV8G 5IM0B 4WIQA 3RU0A 4TNOA 3FCWA 2V8PA 1FD8A 3LP0A 4ILMA 5F8HA 2DK2A 4LMZA 2D3OR 3T1AA 3BYRA 1Q5VA 5KFWA 5F8GA 5HMWA 3W2VB 2UVWA 2VDHA 3FVYA 4NLXA 1SKWA 1VBXA 3W9JA 3AB2B 3V2UC 1VQYA 2K2PA 3RBEA 3J7YU 1IBCB 4C48A 2DISA 3TUZC 2J9CA 2ZOMA 3I82A 2ZH3A 5IWAJ 3NWGA 3BPDA 2H9ZA 4WE1A 1VBZA 5GADU 3J7YI 3PDNA 2FPHX 3H7HB 3W66A 3PVXA 2W7OA 1HA1A 2UZAA 5SUHA 2CVEA 4JI8J 2Z58B 4IG3A 1QM9A 4DUZJ 2Z4PA 4LF2A 9ATCB 4CM0A 3RGIA 1VRTB 3MR3A 4KAIA 2QG9B 2GW8A 4J9QA 2ZOGA 2J6UA 3M8PA 1HBUB 1FX4A 4EUVA 3J80Y 4KR0B 3I6PA 3DCAA 2F4VJ 3V4MA 1WG5A 4K50A 3BN4A 4OI0A 3H8YA 3CJSA 1N34J 1FESA 1KKHA 4FBTA 5IT4A 2FVCA 4P2XA 3MM5A 3HP6A 3OTOJ 3S1TA 3HD2A 5ADZA 2L08A 4TVAB 4W4MA 4DSFA 2KXFA 3UO0A 1WSRA 1QAYA 3LAMA 2LU2A 1XC9A 1Q81T 1HL6A 2EBEA 1JLAA 3ZNJ1 1DRZA 1MN7A 3GSIA 4O3PA 4TN2A 1XK8A 4KQZA 3HCXA 3V81A 4DCPB 2BR0A 5HBMA 3C46A 1S6OA 2VUGA 1S1UA 5BYRA 1YI2S 4OI3A 4BWJA 4K4SA 2FJXA 4Q5VA 3JSBA 3CJ0A 4RW8A 5DO2A 2YNGB 3SCLE 1Y5IB 5KFAA 4G1QA 2P2CB 4WFZA 1UA1A 2RKIB 3N6NA 1P1LA 2FJAB 1S7HA 2ZWOA 4CO4A 3HHKA 3DLKA 3J80U 4C3MA 3GFXA 2CPXA 3RAMA 2NYHA 4ZPTR 3HJVA 2FQQB 4LSZB 1S7IA 3VAIA 4MH8A 1S1VB 2XHWA 3PFEA 1DTTA 2EFNA 2HHUA 1LW2B 2FJVA 4U7UK 3R5GA 5ETLA 3FC9A 3BQ0A 4ED2A 4WU3A 3BO4A 2U1AA 1NZAA 1HI1A 1TUWA 4LFBJ 1A7GE 3BGRA 5EX3A 2HFNA 5G4DA 4QYZK 3G71S 4I1TA 1HBOA 4ZHRA 3VHQA 2MKKA 4DUYJ 1FEHA 5E41A 2XSFA 1T3OA 5KG6A 2J0SD 3H5XA 1P9YA 4K2JA 1CJVB 2BJDA 1IR0A 2J7UA 3PHEA 4TY8B 1M90T 3QRRA 1SV5A 2XZWA 2X7IA 2W25A 3ZFVA 3VAMA 2LXUA 4KJIA 2LDYA 2IIHA 5J1EA 2MZQA 3HJFA 3CJ5A 4QWEA 5HJYA 3PCOB 4P74A 2LEBA 2HS3A 2Y3YA 2W1BA 1S9GA 4IG0A 4NXMF 2E5LF 1S59A 1JLEA 2XM3A 3DOMB 1KS2A 1R6YA 2DNKA 1HYSA 1SCJB 1RLDA 4OLOA 3C8YA 3BBCA 1RCOB 3AY0A 1LXJA 1KQGB 1F5AA 4N5SA 3BJYA 3D28A 2FD2A 2B43A 1R8PA 2OPPB 1SJ3P 1PYSB 1T11A 2O1PA 3QO9B 1UKUA 2KM8B 4B17A 2UXCF 1X9MA 4ICLB 4JI3J 4JI2J 1RWPB 2F40A 3R6GB 2ALZA 4MKVA 2C3PA 4R8UB 1PBAA 1OY6A 4DF4A 3A3NB 3CD0A 4O4GA 5I3PA 1WF2A 2K1RB 4Q44A 4MAKA 3UR3C 3RAQA 1HI0P 1PJ6A 2XI2A 2DHAA 3DHWC 4ATNA 1VMBA 1TMMA 1FKOA 2VL1A 3C66A 3NGKA 2XS5A 3NS5A 3T9ZA 4PPZA 4H4KC 2DHXA 3Q2TC 2R7UA 3M6UA 5HK4A 4DV4F 3PNIA 2IM0A 4M5JA 1Z4UA 2PDAA 3QATA 1ZM4A 3HFVA 3EGZA 1S1XB 3GSDA 2FHJD 3VGUA 1VGYA 3TEHB 1PSDA 3BS9A 5JUMA 2M2BA 2RVJA 4PZVA 3K2YA 3H20A 2XGPA 2DO4A 2CJKA 4O3SA 2DHGA 2HFSA 4ILLA 1LFPA 3UCGA 5KFPA 5DGBA 2XWYA 3TVZA 2MQOA 2NR0A 1U6FA 3DLJA 4EGLA 5A0YA 1HD1A 4YR3A 1I5OB 1Q95G 3MCNA 1S1TA 4OX7A 1N5SA 1O5JA 2H3EB 4ZJOA 5EN1A 1RKJA 3OBIA 4DUTA 4U9RA 3U1MA 1TKXB 3MR2A 3WHIA 1ZZFA 4ZJQA 4C8OA 3NCQA 2LVWA 3JAMU 4DL5A 2AYBA 3LPYA 1K47A 5CZXA 2HS0A 2YWWA 4NLGA 4FBUA 5J1NA 4C7QA 4CLSA 1VDHA 4MK9A 2OD6A 1SL0A 3Q86A 4DCJB 2FGOA 1M1HA 2HQCA 1YDLA 1OYEA 3CCWA 2CQHA 3PYFA 1NO8A 2B4OA 1C2PA 3F44A 4DG1A 2RH3A 1XQIA 2V2ZA 4CH7A 5C5JA 4WZMA 3SBMA 5A8RB 2UU9F 4FYDA 1NXIA 1WJ9A 4PKDB 2PGCA 1HPZB 4JI4F 2IM3A 2D41A 1OMSA 3GJQB 4ENOA 5D0EA 3L9ZA 3V6DA 3MECB 4JI6F 1RHMB 3K7RA 1S4EA 3O5TB 1WOOA 5T7LA 3CDBA 3KTQA 2VFTA 4ZP8A 2RF2B 3GYNA 4EK2A 4RX6A 2V68A 2HBRB 3MM6A 3GFZA 1U1PA 2EG1A 1RWOB 5HP1A 1KHWA 2VPZB 2FLPA 3E01A 1NBEB 4X4QA 5J2NA 1SIZA 2ZHAA 3ILLA 3HFZB 5GAEU 4LF1A 4WK1A 3OV7A 1LKZA 2XTJP 1RAHB 1RDRA 3KMSA 2BRLA 5GAEI 2P9EA 1IBKF 4WFAQ 4EWTA 4P2SA 1DY3A 1RKIA 5B08A 3GZ7A 4X62J 1APSA 3HHDA 5H1SV 2MKSA 5D4LA 4C98A 2HHHJ 5LXRA 3EX7B 1FWPA 3TA0A 2XYHB 2RDJA 2K06A 2VC0A 3VQTA 2ABYA 2MPUA 3C2PA 4RWXA 1BMQB 3TARA 3SSQA 2LQBA 1SL1A 4BCAA 1FXRA 1I51B 1HR0J 4PXBA 1VC5A 1XMOJ 3EICA 1HNZF 3ZTPA 1AB8A 4NEYA 4ZCKA 4CIOA 3QBCA 5DGAA 2AJFE 4RZRA 1CPZA 1RSCA 1NHVA 2M70A 5KT7A 3M8WA 2JNJA 2BJ7A 2OAUA 4RBVA 5LL6d 1VBYA 3TUPA 2FC8A 3IS9A 2FZKB 1KNZA 2MJNA 5M2UA 5MAOA 3AHPA 5DG7A 3EUNA 3PKMA 4B3TJ 4C8ZA 1YBUA 3SQOP 3T1HJ 3OFFA 5C42B 4DFPA 3F0NA 4HVZA 1O8BA 3OL8A 5ETPA 2YX4A 3HSGA 3BSCA 5EWGA 1BWVA 7AT1B 4F4XA 4NCBA 3LPEA 1T05A 2WBRA 5ETRA 5A6PA 3R9LA 3I5AA 4YFUA 2QGFB 3A8KA 3ET6B 3PZPA 1M5PC 2NSCA 4KTQA 4RW4B 3SI8A 5E3RA 3DRRB 4XIUA 2AJ0A 1JB0C 5ETVA 2DNNA 2PMHA 2DY9A 3NRBA 3EGWB 1NK8A 4G6VB 1Y00A 3LP1B 4P75A 2GIRA 5LMNF 1UPPA 2LA4A 1FRJA 3FUYA 4V19J 1HNWF 2ZWPA 1U1MA 3HXMA 4EYIB 4Y2AA 2QEXS 5AE1A 2R4FA 3ZTRA 2B51A 4NYPA 2CQ1A 2J8AA 3D0IE 2ZH2A 4ELTA 2PI5A 1LWCB 1HNXJ 3DYAB 2VHGA 2DNHA 2HNDA 1EQMA 2VG6A 4DLEA 4F4KA 3CCES 1WDDA 2V2QA 1R8BA 2E1AA 1VQPS 5F0UA 4LT6A 2KYZA 1R0AA 2DJWA 4RW9B 3G82B 2LCWA 3DI6A 4PCQA 4LF8J 5J2MA 2OEMA 2WW8A 1EETA 3IR6B 3T6BA 4CLUA 4NLRA 1FRLA 2CUYA 1PKUA 1GH8A 2W4PA 2NXUA 3GTYX 4OI6A 4DSLA 4A46A 3DU6A 1YRUA 2DGVA 2W01A 1WC6A 4MYTA 3H40A 1SBRA 1ZZNA 4PAAA 3MUVP 3AB4B 3SEOA 2KVIA 3CCQS 1HWLA 3AXKA 3M9OB 1H6KX 4ETZA 1E6VB 4HACA 3NCPA 1WEZA 1FD2A 5K14B 1RA7A 1E6YB 2N4CA 4DL0C 4OZJA 5T41A 2I38A 1K9MT 1DHMA 4RNHA 1KFSA 5AT1B 1M5OC 2B5JA 1RU1A 2PC6A 3H4DA 1UWBB 2BA9A 1MWYA 3H42A 3MM9A 2AV5A 1IBMF 1HHQA 2ZD1B 3AAWB 4ANCA 1BQXA 1VQ8S 3DMJA 1BQMB 2ZITA 1H2UX 2FHKA 3M8SA 1E6YA 3D7SB 2XS7A 5DDOC 1NSPA 5KG3A 3GCWP 1M5VC 3MF5A 2LDIA 4LQ3A 5AXMA 2EFQA 2VBZA 3QWPA 1YIJS 3GJTB 2Y1LB 1QDUB 4OZ0A 4QW9A 2ALYB 5G0RA 1XMBA 1Q86T 2FJEB 2R8HA 2AIRB 3OUYA 2HNZA 3OR2B 2KZMA 2AYEA 5KFVA 2QE5A 1JLGA 4GC6A 4DFJA 1YHQS 2OH2A 3LO3A 2D3UA 1X8DA 3MEEA 2F63A 2ZH6A 3NNHA 2XMVA 4F3MA 2ACMA 2GHPA 2ZH9A 2ASJA 1KLMA 2OHDA 3IBCB 5FIIA 3TNVA 1QTMA 4WP8A 5KTQA 4HEA9 3DN9A 2HS4A 1YJUA 3NGRA 3OR2A 4WFYA 3SSSA 3QLHB 4K5RA 3DC2A 2KHDA 4S0MA 1S9EA 1F5BA 3T19A 2PIIA 1CJKB 1VRUB 3KLHB 3S8SA 4UQGA 2KFZA 4DV5J 4OFZA 2VBWA 4X65J 4C8LA 4WF9Q 3VZIA 1XJWB 1L5UA 4EBDA 3MOJB 2CA9A 4Z37A 2JC1A 1L3VA 4ES1A 2EXUA 3POTA 3HVTB 4QOTA 4USHA 2D9PA 4AYBD 2Y1RI 1BY9A 2RIJA 2OP5A 4EO6A 1X4AA 5A76A 1R7IA 2F4FA 4XPEA 3CJ3A 2Z56B 3PX4A 5B0AA 5I42B 2K3KA 3M6VA 3D0GE 5E7OB 2BE7D 2CDRB 4LIRA 1RT4B 1X4EA 4F4ZA 2FIUA 1ZTTA 5B0CA 2C42A 3PG9A 2PE8A 2F8HA 4RR5A 1U2FA 3N79A 3RR7A 1RAAB 4NX9A 2YPZA 2BUNA 3M2VB 4ED4A 3FCVA 4KGZB 3MTJA 2YH1A 2OLWA 4RPFA 1S48A 2KM8C 2RQCA 1KQSR 1VQNS 2QFIA 4LSNA 2QV6A 2EFGA 4M5GA 1QAIA 3CO0P 1VI7A 3CCTA 3M8QA 2OIHA 3OXLA 4UW2A 1ACMB 2KHCA 2G0IA 5IQQA 3UN3A 5D4OA 1NK4A 4H4MA 4FVMA 2G0CA 4MFBB 2Z30B 2R9LA 1ZA1B 3CUNA 1F60B 3HT0A 2JEJA 5KT6A 1DTQA 5L39A 3KNAA 4OYZA 2XC9A 4ECQA 3FBCA 3SYZA 4ZJLA 3K5MA 3FKBA 3FBBA 3VGSA 3RJMB 2RQKA 3H90A 2KZZA 2PD1A 4IRCA 1UP1A 1SJRA 4RBTA 4ZCLA 4CQ1A 4GKKJ 1SQGA 4Q2MA 4CO3A 2E1PA 5D77A 4QIWD 3NP5A 3DHXA 3OXGA 2R2SA 5CAAA 2HNYA 2M3DA 3BSNA 3I4PA 1QAXA 3P3DA 2D69A 1JMTA 4LF9J 1T9XA 2ADBA 1XERA 2W2NP 4AXJA 4MKAA 4C11A 3PW5A 4J9KA 3I32A 5HVFA 5BXIA 4RUCA 3LW5C 3FGVA 3T1YF 1SQFA 5F0WA 1UJ5A 2VF3A 2GS8A 1QJHA 2ZE2A 1FRXA 2JLEA 2X1BA 2XZDB 2Y8YA 2X1AA 2QJ3A 3HVAA 1WC1A 2OSQA 4FZVA 2KT2A 4K4TA 2KRRA 2VPYB 4PEOA 2C3UA 1RHJB 1X5PA 1FJGF 4PQUB 4IOAQ 2WONB 2HIQA 3SV4A 5HSPA 4YOEA 3CCJS 2GJIA 2H4WB 4H4OA 2UXBF 3RW6A 4ZVUB 2DYAA 2C2EA 1LEOA 3MURP 3LP2A 1M1KT 3GIKA 3J81j 1V5VA 3GLJA 3C14B 2V4QA 2MQNA 2MGZA 1U25A 2X1GA 1WC4A 3Q8PB 1S9FA 4FN5A 1TL7B 5C24B 3HFKA 4F7VA 2BJ3A 3WZ0A 3MDFA 4NLQA 2VC1A 4LF6F 1R3NA 2R7QA 2ZC4A 4JYAJ 4OI1A 3OL7A 1U1KA 9RUBA 3ZO7A 2RRBA 1WG1A 5F8NA 1WHWA 1G2EA 2JEGA 1YQHA 2MHEA 4DPUA 4QJVA 2MSSA 3CT9A 4IR9A 1FTRA 1SKRA 3KNGA 3RZAA 1DQ9A 3R7NB 5IZHA 5KFXA 1U26A 1S0MA 1F9FA 2DPJA 4WU2A 3AOBA 2VBYA 4LRAA 1C0TA 2ADCA 1VFJA 3BEGB 1FERA 3J81Y 4B02A 2N7CA 4LRDA 5E2QA 1VQLS 2UU9J 1HIYA 3KK1A 3QT5A 2RNEA 2MQPA 3WX4A 4OZ5A 5J2PB 4K8RA 4F26A 3D3BJ 3M1VB 4HTJA 1J27A 2LFVA 3G2XA 2DVIA 1S6PA 2U2FA 1T02A 2AW0A 4JI6J 4I6YA 4DV3F 4WTOB 4I2PA 2F9JA 1Z2ZA 1BC6A 2X1FA 2XMKA 4Q43A 4DL2A 1SQEA 1B64A 3C3LA 1MROB 1JLQB 3HKZD 2IMOA 1SKSA 4R0JA 1NM2A 2NZCA 5E3AA 4OL8A 4P10A 1Q53A 1P8GA 2XQCA 3AA9A 3M2RB 3D1OA 5THWA 4KO0A 4ECTA 4K4ZA 2MKJA 3CIMA 3R1HA 2YQ0A 3GWCA 1XMQF 1MROA 3IBWA 2NXEA 3J81U 1N33F 4TY9A 4MTPA 2V69A 3DLGA 3CMQA 3PJWA 3DKDA 1WC3A 2VOPA 3W65A 1N0VC 1MNEA 4BWMA 2HEKA 2XSJA 2HFZA 1KWMA 4DZDA 4LFAF 4Q0BA 1HBMB 2E66A 4I6WA 2CQBA 1RYRA 2UVRA 4M5MA 4DZ6A 4J9LA 3FEYB 5J2QA 3PV8A 2QRRA 2ZH8A 1FRIA 3H2VE 4NLUA 2QSWA 3IWXA 5AJ3J 2DXEA 2YH0A 1HW8A 2MKCA 3UNYA 5D4NA 4YMEA 1FNOA 1X4FA 2C22A 1CLFA 3NNAA 4UOFA 3UVJB 3QQCD 3M32B 1HLWA 3KG4A 2MZJA 5I3QA 3P4UB 3GIMA 2I5JB 4CLLA 4OYAA 4B9TA 2V4JB 1S1WB 1S12A 1U2RA 3TAPA 5HN0A 4C3KA 3LF0A 2GVZA 4Y00A 3I31A 1MN9A 4NMXA 2HZAA 4DQRA 4OHXA 1EP4A 1TV6B 3KJNB 2F7VA 4WFXA 2HBZB 3RB4A 1TMJA 4IQXA 1KEKA 3HF5A 2CJAA 2O3DA 4PG7A 2AEJA 1EHWA 2KO1A 1TK8A 3DGPB 1F5CA 1RABB 1LW0B 4F50A 2W2QP 2C2ZB 3W5XA 2CJXB 3KLGA 3MPYA 1Q79A 1NK7A 1NZ8A 5KAKA 1RK8A 4DR2F 4PWWA 4DPYA 3ISND 2HSEB 8ATCB 3T41A 5LMNJ 1JKHA 4OZ3A 1X9WA 2RHSB 1IKVB 1OJ4A 2ZC3A 1B4SA 1RQ0A 4L76A 3KLFB 2XLJA 1REGX 4F0KA 1HQUB 3ENQA 1WORA 3JQJA 3HD1A 3I9ZA 3VGVA 1TP7A 4OZLA 1RWMB 1MMDA 1DAXA 3HHLB 1C4CA 1K73T 8AT1B 2OPSA 3D9BA 3PW4A 1RT5B 2B9WA 1R0CB 4RLEA 5JMNA 4RW6B 4D3HA 1B0PA 4JI5J 4JOUA 1MU2A 1IUJA 1RBLA 4LBHA 4DX5A 3J7Z5 2W4CA 3THVA 1BLUA 4IDKB 3DNCA 2H48B 1FA0A 1UVLA 3WIVA 4P71A 3KJQB 2G2YA 4FDFA 4USMA 1N5YA 2LXFA 3THPA 2GVDB 3CD7A 4MMOA 4K4VA 3SQGA 4OJ3A 4RUBA 4Q45A 1NPRA 4NYOA 2E9TA 1B0TA 5KFNA 3WX8A 4F25A 1AYEA 3DOKB 1HBNB 2RMLA 2Y0BB 1F9EB 3OFGA 2HK2A 2DGSA 2AJ1A 2YX1A 1XR7A 2KXHA 4LRBA 3O6QA 1CJUA 4FYWB 3R7BB 1JLCB 5CD4A 3N5BA 4DR7J 2UXDF 2DEJA 2FJBB 1X60A 1B7FA 4RNFA 1Q16B 2GGPA 2E1RA 1U47A 5KFUA 1Y7PA 2NSBA 2DNZA 5KT5A 3AJ1A 3X3UA 1NHUA 4ZVHA 2EVZA 5KFTA 5EX0A 3AOCA 5KFQA 4USUA 3EGVA 3LGMA 5AXKA 3L7UA 4DPWA 1IBMJ 3P45B 3ZZOA 1TK0A 1FF2A 3TVKA 4NYZA 2YWGA 5ETOA 3GU0A 3OR1A 2Z2LA 3DRSB 4DSIA 2F1FA 5KG0A 2DIVA 1SJ4P 4OYMA 4CH1A 4CLYA 4ITSA 1TU0B 1WTFA 2CADA 3CB4A 4B9UA 2CPZA 4J9VA 5D3GB 2C2NA 4NRTA 3TVYA 3BN7A 5K5MA 1RLCL 4P7TA 4AUKA 1VIXA 3UN2A 3G9CA 3HULA 2LYVA 3CJKB 5HL7Q 3G87A 1YWXA 2WSEC 1K1SA 1QUPA 1URNA 3KDNA 3UNGC 2JEIA 3PTWA 3H98A 2FGCA 4DCOB 1TL4A 3Q8UA 4PWDB 4KHPF 2MHNA 4FXWA 1NAQA 2MYFA 4PG5A 5I3UA 2C28A 2HGLA 3BGLA 4B9NA 4K5SA 3PJ9A 4TYAA 4KGMA 4AD6A 5LOQA 4OYXA 1IM4A 2HHVA 2DT9A 3V6KA 4JV5J 1X4GA 3U1LA 2W24A 3FMBA 3AQOA 3C6TB 1J5OB 3IRXB 4CNYA 3RB3A 3HMJG 1GMUA 1IKWA 4HHJA 2E5JA 4CO1A 3IR7B 2IJNA 2DNYA 5CYQA 3FSYA 1U24A 3MEGB 2OI2A 1SB6A 2JLFA 2ZKUA 1JLBB 1P6TA 3DLLQ 4IQMA 2YKOA 3OTBA 2FY1A 4I7FB 1SH3A 3CEDA 1YVFA 3KFWX 1JXVA 2HBYB 1TR0A 2CQGA 3T5JA 3MEDA 1RWUA 1IWGA 3K5OA 4ZN3A 1WEYA 4DSJA 4YDDB 3W9IA 2HK3A 4M5KA 1I94J 2QMWA 3QAUA 5AE3A 3IBFB 5E5NA 3PO4A 1UCNA 2OKQA 4K7QA 4I64A 3M8RA 4KFBA 1OPIA 4DXLA 1O51A 4ID5A 4FPRA 2ATLA 5HVHA 2R7WA 3T5KA 1F6TA 2WZ1A 4OJGA 3PW7A 3X1LB 2J0XA 5A6WA 3MMCA 4UTGA 4EFAC 4WBFA 4KRWA 3H59A 4QWBA 1H2TZ 2CPIA 1RT3A 3KK3A 1HNVA 3KUEA 3FZ2A 3SCIE 2QSFA 2GHVC 1R31A 2BKOA 4JI7F 2P9CA 1S4FA 1QE1A 3R97A 3O8WA 3I0RB 1YITS 1RYSA 1BUXA 3RRHA 3PRDA 2PFDA 4DF8A 2W2PP 5T14A 3UDEA 2Y0SD 3US5A 1FFWB 4PG8A 5CHCB 2V67A 3FEXB 3SCKE 1RTIB 1IBLF 4DX8H 2KTQA 1ZBTA 1FKPB 3SXLA 2ZEJA 3KWMA 1PILA 4ZS6A 4R5PA 2UV8A 2ERRA 3TQ1A 5CYMA 3OT9A 3FMWA 3KMQA 4DR4J 3TW0A 4OLPA 2G1HA 1QY7A 2JWNA 2KFNA 2HWIA 3M30B 4L75A 2C2KB 2QC3A 2FLNA 3CMAS 1AZSB 1KHVA 1SUQA 2OPQA 2ZDOA 5D8HB 3W62A 3KLEB 1T3NA 3FFIA 4L72B 3LAKA 2IA6A 3KHLA 3QMQA 4CYUB 1N36J 1X5OA 3Q2SC 3H5YA 4NCGA 4X4SA 4LIWA 5HROB 1NSAA 5U47A 3K59A 4K4YA 4FS2A 4NI2B 3C6UA 5BR8F 3OLBA 4X2BA 3I5BA 2GJFA 3W2WA 2Q6CA 1VK8A 1UVMA 2HQGA 3VVUA 4YB6A 3CJRA 5HAOA 1TL1A 4WXWA 3MEKA 1G4CA 3MAAB 2XCPA 1MSWD 1S6UA 2XBPA 4RUAA 1RWVB 4WWSA 4RUHA 2C2DA 4K0KJ 1NCLA 1U1OA 2VPXB 3IG1B 1HWIA 2BW7A 3QSYB 1U8WA 2X3DA 4LF6J 1YG0A 2BX6A 3AQPA 2XYGB 1RTHA 5HLFB 4WKYA 1VS3A 3BSOA 2Q1LA 4OJ1A 4Z7CA 3D6FB 1TVRA 4J9RA 1U1QA 5LXYA 4PXDA 4ELVA 2IRUA 1VJQA 3TYTA 4WFBQ 1UVIA 4ZPAA 3I9V9 3OLAA 3OL9A 3KJVA 3NEKA 3QFWA 1KONA 5GAGU 1WKKA 3K0JA 1NLKL 3BGFA 1XN9A 2ZH1A 3QGPA 2HFVA 2P6SA 2J0WA 1YJWS 4D3GA 4QIFA 4IH7A 4Q8FA 2HG4A 4A48A 5GAGI 1BD6A 1S5ZA 1FHTA 2GO8A 3KK2A 3KOAA 2KL8A 2H5JB 2H51B 4PWUA 3AFGA 2FYXA 3U27A 3AH6A 2VKZG 2L9NA 4A8FA 4AQYJ 3EXCX 2AWZA 4URQU 2ZNYA 1EIYB 4GKJJ 4OI4A 2YKNA 1A9NB 3S7RA 4DX6A 1UPMB 2QA1A 2M7SA 2MJUA 3M2UB 5IC4B 4W98A 4AE5A 3CIZA 4WKRA 3G6XA 3QAEA 3L3CA 5F41A 1O6XA 2V8GA 2B4VA 1P1TA 2BJ1A 3WDOA 4HI2A 3MM8B 1OY9A 1Y9OA 3CCUS 2E5HA 1N54B 4ZITA 5A8WA 5JVGQ 4YY3F 2LKZA 5GMDA 2CQIA 2DKOB 4UUXA 5L38A 1REVA 5H9FK 1RAEB 1FVSA 3DOLA 2YNHA 3UFCX 5MLCV 1YJ9S 5DG8A 4ZP7A 2OSRA 4TXSA 2R2RA 4DR1J 3HK2A 2VQFF 3J7AN 5KT3A 5FDLB 3GIJA 4QQBA 1KOOA 3ENWA 2BDPA 4EYHB 4O3OA 3K17A 1LWFA 2PI4A 2FZCB 3PY8A 3I0SA 2BBEA 2CQ2A 2LQ8A 2AD9A 3KLIA 3JSMA 2M0GB 1CJTA 3SDEB 1ZAVA 1DARA 2ZVSA 4LF7F 2HBQB 3VV2B 3CJ2A 1FCAA 4I0WA 4B9VA 2HMIA 4KV8B 1ZAXA 3FDSA 5KFKA 4OYPA 2CZ9A 3N01A 1Y4ZB 3C19A 2VG7B 1U2CA 4TU7A 2RB7A 3W63A 3D6MB 1U0HB 2Q79A 5F8MA 1PGZA 4QR1A 3Q89A 3A4TA 2G9OA 3EZUA 2OUGA 2MTLA 2E44A 2YKMB 2PMWA 2A6MA 1C1CB 4X84A 5E3PA 5AXLA 4CT9A 1A0OB 1Q78A 5CYJA 1JWWA 2BYCA 2CQDA 4Q8EA 4Z7YA 2W9CA 1X31C 1SH0A 3B4MA 3A8JA 2YWFA 4I69A 2DNLA 3NS6A 2J9DA 2MMYA 2IM2A 3JTNA 3BV8A 3HPOA 5HJXA 5A8KB 2IY5B 4LFCJ 4I68A 3MUTP 4OHWA 2C2RA 5E3QA 5CZVA 1EJ7L 4O4RA 1S0VA 2CG4A 2XY7A 1HHTP 2QA2A 1RT7A 1C0UA 1CC7A 4WTYA 3RRGA 5DDQC 2F3JA 1IR2A 3CGIA 1YJ7A 5HO4A 3TI0A 3C15A 3FRYA 2ROGA 1AT1B 1TAUA 2MDAA 1FVQA 4B3OB 2X3GA 2HFOA 4DR2J 1XWLA 4NLVA 4DV7F 2AQ4A 3GR0A 1LWEB 2XO6A 1EAYC 3VTIA 2V0NA 4JI1F 2RDDA 5KFSA 3EZOA 3R5AA 2V2VA 4OX9F 4DPXA 2QZ8A 2V8VA 1X4DA 1XNRJ 2MLZA 1RHKB 3MZIA 5SZTA 4DV6F 4X4UA 1RTZA 1EX8A 1FXDA 2KU7A 2WHOA 1TKTA 1U09A 4DV1J 3N4WA 2AEMA 3BGOP 1T7PA 1FDAA 2BKNA 5F8JA 3RR8A 1VC0A 3DGVA 4I67A 5B0BA 3K5LA 1UFWA 3MMAB 2DR5A 5IM0A 2D3O1 3GV5B 2IVYA 2HQFA 2MZTA 2XMTA 2B8PA 2BMBA 5KFZA 1ZH5A 4L73A 2FJDB 3W2VA 3DFEA 3DM2B 2VH7A 3IMQJ 2ZM6J 3P5TL 4LF4J 2MZ1A 2AMCB 4ID8A 2UXDJ 1TELA 3W3SA 4WK3A 5EHHA 2NLWA 3QIDA 4ZKAA 3CC7S 4UQTA 2ZH7A 1VRQC 2VODA 4DMZA 3CVKA 1RAFB 3HLUA 4DV0J 2ATCB 1YZ6A 4Y2KA 1QAJA 5HANA 4CT8A 3R6LB 3K8WA 3W9HA 3UCZP 4W92B 1RT1B 4GVLA 2RS2A 3G8SA 4ECVA 5EUHA 2XS2A 2D1CA 4ED3A 4X66F 3J7ZT 2HVZA 1V3RA 1H2VZ 5LMUF 1YJNS 4V19X 3CCLS 1KQKA 3JXOA 3TAMB 3JTOA 1T9TA 1VRTA 3B4DA 5BYQA 2R7OA 1HBUA 2DCUB 1HKAA 1FO1A 3IM9A 2YNIB 1EQ0A 2B4UA 3G6YA 1Q8BA 3OFEA 4NRUA 2KVQE 5C25B 4E98A 4RL1A 3OHAA 2E7XA 1RTDB 5IOLA 3MAHA 1B7YB 1X0PA 2HLUA 1FK9B 4ED0A 3QWUA 4LR7A 4PYDA 4TQRA 3P5BP 2LU1A 1HI8A 5B09A 4KHPJ 3SIPB 1WG4A 5J1PA 3TEGA 4DR3J 4BBYA 4ZMMA 2OEJA 2DB1A 2DTJA 4JI0F 1I1GA 1CULB 1RTJB 3MMBB 2W9BB 1HD0A 5IWAF 3W60A 2R8IA 2HQ3A 3HO1A 4IFVB 2O66A 4J9NA 2KB2A 3QIPB 4CH0S 3NBPB 1TUGB 2YNGA 3MWBA 1RT2B 4N8NA 1A6LA 3HSJA 3PIOQ 2XNQA 1I3OB 3BR8A 4JI8F 2RKIA 4URGA 2E1CA 4MYUA 1MW7A 4DUZF 1W7WA 2VQEF 2HVIA 4Y2IA 2UUAF 2CNOB 2FJWA 2LLZA 2RHQB 2OJ3A 1IKYB 3IC1A 5CA5A 3O3LA 1Q8KA 3I87A 3TUJC 3P96A 6AT1B 5HQLA 4QCLA 2JX2A 2F4VF 3GJRB 4U95A 4CP5A 1S1VA 1TL3B 4GMKA 1LW2A 4A8XA 5B0FA 2MSTA 5L1IA 4KGKA 2XNRA 3OTOF 1SC4B 3HHEA 4DU7A 3WBZA 2GQCA 1PJ7A 2CG8A 3CCVS 1BXNA 4RWWA 1U4BA 5KOXA 3MFIA 4YB7A 3CXCR 3QT6A 4IR1A 1F1BB 2CPHA 3JSRA 1NDCA 1WHYA 4YR0A 1Q7LB 2Z0GA 3VR1A 2DCLA 2EPIA 2QO3A 3WIUA 2XMUA 4I56A 1CJVA 2IAJB 4A8KA 3FNNA 4UOCA 4TY8A 4OI2A 2B4PA 1HNIB 4ZLPA 5GMKa 4ZN1A 5ETNA 1IKXB 3TO8A 2BQ3A 1SL2A 3QJLA 4WP3A 1FRMA 1NRKA 2BJ9A 4L6V3 2UUBJ 3CTRA 4EZ9A 2ZHOA 3G8QA 1GMWA 5KG7A 4RKUC 2BQUA 4CLPA 2QTWA 3Q24A 1YJVA 1HQEB 4WPAA 2IAJA 4N77A 3SSRA 2AX1A 3DOMA 1U8SA 3GFHA 3GCXP 3G4SS 2HKEA 2MXYA 1SC6A 2HWTA 2VG5B 5H9FJ 4CM2A 3QGIA 5C2CA 4HDGA 2HGMA 2I6WA 2Y8WA 3TZXA 2NXCA 2KT5A 2R2TA 4LREA 3L09A 3CCMS 3CC4S 2IMWP 2OPPA 4ZOSA 2XCAA 7FDRA 3W5YA 3MCOA 2OTLS 3QO9A 2ZKTA 5DDPC 3CDWA 3T3FA 4Q2LA 4ICLA 3IAS9 4LFBF 4R8UA 3UQSA 2JC0A 3JAMY 2DHHA 2CPDA 2G0JA 3WQPA 1C4AA 4B3RF 1WHVA 2K1RA 2H65B 2QL5B 3M4XA 2CQPA 1VQ9S 4GVBB 2I0XA 1VQ4S 2Q43A 5GMEA 5K8OA 5DJBA 2QT7A 1IJEB 4AT1B 2POKA 3CCRS 2WB1D 4PUOB 5L9NA 2Y1IA 1FE0A 1RWWB 2B9YA 4OQJA 5IC6B 5LSRA 4TLQA 3AT1B 2LQ5A 1T9VA 1MMLA 1UW4A 3UW1A 1WOSA 4XDDA 2VICA 2HRUA 3LTOA 2PT0A 2IM1A 3HVWA 2EG2A 4QW8A 3DDNA 3PX0A 4B3SJ 2WSFC 4PG4A 1S1XA 3ITHB 4Y2CA 1WHXA 5B0GA 2NXJA 2DR6A 2KT3A 3VZHA 2KRBA 3FQLA 4PXCA 2YY3A 2NZ4A 4Z2XA 2YQ3A 4JUZA 1F9HA 2RD5C 2IC3B 5KG5A 4JV1A 1NU4A 2FZGB 3QZ7A 4ZP9A 3DXBA 5BYSA 2YWHA 1GT8A 1FKAF 3BO2A 4KBIA 3EE3A 1CS4B 3CD5A 2XO7A 4EI2A 4KHMA 2W7PA 2IA0A 2FUG9 3M6WA 4WP9A 2WVBA 4F8RA 1HMVB 4JI2F 1DLOB 4NLOA 2PSZA 3T5HA 1BQNB 1DQAA 4FP9A 4X4VA 2KXNB 2IRYA 4NLSA 1TKZB 1U6ZA 1HHSA 1TKXA 4PPDA 1SXLA 1AA1B 2XMAA 3UI3A 5KFEA 2BANB 4ECXA 1EARA 2B6AB 4FXDA 4DBQA 1GMWD 1VLYA 2IBOA 2JH3A 1N32J 3AA8A 4DS5A 3MTKA 3FBFA 1JXLA 4CRJA 4J9SA 2VJVA 4A8YA 3UDLA 4QBUA 3AXMA 3OJUA 5IXUA 3GQCA 2G1DA 3MCMA 3L4BC 3MR5A 1M0SA 3DRPB 4F3QA 2VA2A 4LSLB 2DH7A 4YB1P 2HHXA 1WKJA 1CEZA 5A8RA 3B6BA 3OSPA 3CNQP 3GB0A 1GTHA 5KFYA 3LGHA 4YY3J 2Z2ZA 3OSNA 1HPZA 4XTTA 1GFWB 4QIGA 1RHRB 3D4JA 5D15A 2XG8A 3MECA 1JNZB 5ETQA 3ISNC 2FY8A 2B9EA 2UUCJ 2I8EA 1OPZA 4DS4A 1NKEA 2R7SA 2ZZNA 2BE2B 2RF2A 4AL5A 2ASDA 3TP2A 2VB6A 2JZ5A 1T94A 3W8GA 3CJQA 3BPSP 3A8EA 1KQFB 3P49B 1ZM2A 3MM7B 2R3VA 3KG1A 1VQSA 4FPIA 2J7KA 1V6HA 2VFUA 2IJFA 1ICEB 3ZTQA 2WSCC 3QYYA 2DRDA 1I6JA 4RU2A 1J2VA 3PHTA 4IFYB 2XMWA 4ZLNA 3LALA 7FD1A 2YNFB 2DGQA 3VF0B 5CD4H 3M05A 5KT2A 4ED8A 3V4IB 3N6LA 3R3TA 3R8YA 2FHOB 1JLFB 2HRTA 2OPRB 3Q23A 3CWJA 1NK5A 2RU9A 2MLXA 4EBEA 4ZPWR 3C16B 2DNMA 4K4UA 3SFUA 1NJWA 2E5IA 3D66A 2EBGA 2OEKA 4B3MJ 4M5DB 3PACA 4UZBA 3E51A 4O0NA 1V3ZA 2BM1A 4J7CA 1KN6A 5D0RA 2KG1A 1B70B 4ED1A 4UT4A 3IA0A 4WIIA 5IV3A 4WJBA 2EW9A 2WOMB 4TU8A 4KKOB 1WI6A 1Y0HA 5C42A 1VQOS 1AUDA 4YEAA 3VCDA 1RXOB 3IGNA 5FD1A 4TLRA 1EKSA 1JK9B 4IO9Q 2LXIA 2N7YA 2C3OA 5EDWA 4P6QA 1NK9A 1UTAA 1Y5NB 2E7VA 2V94A 3EJMA 4OX9J 3ET6A 2A10A 3BH7B 4EMDA 2BZ2A 3JQKA 4RW4A 3BYPA 4FKYA 2CNNB 2HHHF 3DRRA 2GV1A 3GIIA 4FNHA 4LF5F 2QA4S 4QYZJ 4DR6F 1T8EA 3TUIC 1ZPWX 2APOA 2HHWA 3RBDA 2OFGX 4ZK7M 4C0HA 3LP1A 2Z57B 2AGPA 2IYGA 1RISA 2M5YA 3A8IA 3PO5A 2Y9HA 2H1YA 5DLGA 3NAIA 1PBUA 1X5SA 2L48A 4DPOA 1S79A 4WYWA 4CDIA 1YGYA 3FSIA 2GQQA 4I2QB 2YVSA 4HI1A 4O44B 4R25A 4QPTA 3RG6A 1BGXT 1H7WA 4MIAA 3JYTB 1LWCA 1RT6B 2ZNZA 3DYAA 1YRXA 4K2XA 2E1MC 4ETXA 4B3TF 1Y3JA 2W2MP 2VFRA 2BQRA 3T1HF 4OYWA 1N88A 4M5HA 2KJWA 5L1JA 4RW9A 2WVDA 3G82A 5L1KA 4HHHA 3KLVA
chains in the Genus database with same CATH topology
2XQCA 2XMAA 2XO6A 2VICA 2F4FA 4ER8A 2VJVA 2VIHA 2F5GA 2XM3A 2VJUA 2VHGA 2EC2A 2A6OA 2A6MA 2FYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XQC A;  2XMA A;  2XO6 A;  2VIC A;  2F4F A;  4ER8 A;  2VJV A;  2VIH A;  2F5G A;  2XM3 A;  2VJU A;  2VHG A;  2EC2 A;  2A6O A;  2A6M A;  2FYX A; 
#chains in the Genus database with same CATH topology
 4CTA B;  1QVF R;  4MIB A;  2IHR 1;  1F3F A;  3GYX B;  2AKW B;  1R89 A;  3BH6 B;  2WVE A;  1ZPV A;  5KFI A;  4OX6 A;  2DXF A;  4RNN A;  4U7U D;  3IP0 A;  2FTR A;  4X66 J;  4RW7 B;  4ZPB A;  3QPI A;  1HQ2 A;  4N41 A;  4O3R A;  4CI0 B;  2J0Q D;  3MOZ A;  1G7C B;  1OSD A;  2M52 A;  2BVZ A;  1IQT A;  1E6V A;  2L41 A;  4RU9 A;  1SIW B;  4YHH F;  2IDL A;  2R42 A;  1RAI B;  2XWX A;  2VFV A;  2LEP A;  3VAJ A;  5K14 A;  1ZS6 A;  1WC0 A;  3GIL A;  2HAI A;  3ETO A;  3KUH A;  4RW7 A;  3D5M A;  4AL7 A;  2AP6 A;  1L3T A;  4C8K A;  1EZZ B;  3H5S A;  1NJZ A;  4DQP A;  1RA6 A;  4CNZ A;  3GG0 A;  2QL9 B;  3BDE A;  1PAE X;  1UWB A;  2VPW B;  4X4R A;  4YP3 A;  4IO1 A;  3M8Z A;  4WE1 B;  2MZS A;  4ERD A;  2QX0 A;  2ZD1 A;  3NS7 B;  2W8L A;  1HNX F;  1BQM A;  3V5R A;  3H2L A;  1GXL A;  4BLG A;  4JI0 J;  1FE4 A;  1OSC A;  2QYC A;  3PRB A;  4IG3 B;  3OXF A;  3PR5 B;  2W9A A;  3HVR A;  5HMZ A;  3OL6 A;  1UFK A;  3TJA A;  1XEZ A;  2ZUA A;  4LF8 F;  1GXU A;  4HL9 A;  3KKF A;  1XNQ F;  4P7V A;  5F8I A;  2F65 A;  5I4M A;  2GIQ A;  3IM8 A;  4H54 A;  3M8P B;  1NND A;  5KFL A;  3BR9 A;  5GAD I;  1URR A;  3JS9 A;  1FJ7 A;  2CAJ A;  3I4H X;  4CZC A;  1DQ8 A;  3E2E A;  3M9N B;  1SC1 B;  1VQ6 S;  2MLY A;  1YJR A;  3MR6 A;  2VQE J;  4DI6 A;  3MM5 B;  1RWX B;  1WOP A;  2UUA J;  2CJ9 A;  1KSP A;  3CCS S;  4ED7 A;  4RJV A;  3EM1 A;  1HFE L;  1IJF B;  1WEL A;  1AFJ A;  2Y1J A;  2NRE A;  1JLA B;  5ETT A;  5KFJ A;  1UA0 A;  1N6Q B;  3QLH A;  2F9D A;  1LXN A;  3TZY A;  1G3O A;  3OFH A;  4YR2 A;  2XGQ A;  2CZ4 A;  2P5V A;  2Q6B A;  4KT0 C;  1ZOT A;  1YX2 A;  3BO3 A;  1CJK A;  1VRU A;  1X4H A;  2ZBC A;  3KLH A;  2A6O A;  3CJT A;  1FNX H;  3V81 B;  3T9N A;  1U02 A;  5HBM B;  5CH7 B;  1S1U B;  1S72 S;  2GJ2 A;  2I1R A;  1DFD A;  2BJ8 A;  2J6T A;  2P9G A;  4RW8 B;  3PKY A;  3PW0 A;  3HVT A;  3OVA A;  4G1Q B;  1N6Q A;  2CIM A;  4XPC A;  3B54 A;  4ZA1 A;  5AXN A;  1RHQ B;  4NXM J;  2E5L J;  1IR1 A;  2CJB A;  2EI5 A;  2V8H A;  5I42 A;  3W64 A;  1MWQ A;  3D6H B;  4KHR A;  3LA0 A;  3DLK B;  1KFD A;  2DGT A;  3ZTS A;  4O23 A;  4F4W A;  1D3W A;  4F4Y A;  1RT4 A;  3Q0A A;  1RAG B;  2B7B B;  2KDO A;  3H0P A;  1OQ6 A;  1NDL A;  2RQ4 A;  2WB4 A;  1QVG R;  1LNQ A;  1C1B B;  3OQ2 A;  3M2V A;  3BZQ A;  1K8A T;  1DTT B;  1K1Q A;  3QNW B;  4DL4 A;  3VWS A;  5K8N A;  2EK6 A;  1X0F A;  5JVH Q;  3N9U C;  4NLP A;  2UXC J;  4TQS A;  2XMJ A;  2FVS A;  2M8H A;  2Q66 A;  1WUU A;  4JP8 A;  2FHJ A;  1UZD A;  3BGR B;  2VU5 A;  4DN9 A;  3K5N A;  3ENA A;  1HBO B;  2CPF A;  2FVP A;  4ZHR B;  1C1B A;  4DQS A;  4FS1 A;  4MFB A;  2NQP A;  2N3O A;  3NGU A;  5CAB A;  1QSY A;  3N28 A;  1UJ6 A;  4BDP A;  4ZIW A;  2CNK B;  1S0O A;  1W26 A;  1GTE A;  4LBP A;  5GAH U;  1U7L A;  4G3I A;  1SV5 B;  1FT8 A;  2MEW A;  2EC2 A;  1U48 A;  1RU2 A;  2RSQ A;  4DV5 F;  1UZH A;  4X65 F;  1N5V A;  1UET A;  5GAH I;  5J1E B;  3GP9 A;  4QPX A;  3T6J A;  4B3R J;  4B9M A;  3K5P A;  4DV4 J;  1S9G B;  4IG0 B;  3AD8 C;  3N5F A;  2H5I B;  1JLE B;  5E0O A;  3FJ2 A;  3DXS X;  3U7J A;  2DGO A;  1LK5 A;  4X64 F;  1HYS B;  3EXY A;  3BKF A;  1YTY A;  2F8M A;  5KFF A;  4M8L A;  3UN5 A;  1YZ7 A;  4ZCM A;  1D1U A;  4MKY A;  4DR5 F;  3D1H A;  4ZPD A;  1OS5 A;  2ZOF A;  1U0S A;  2DNG A;  1KP6 A;  2ZUG A;  4X4N A;  3EMT A;  2BOP A;  3NAH A;  4PQU A;  5DQG A;  2WON A;  2BAC A;  4DQI A;  4O4G B;  3TRG A;  3BKU A;  3QGG A;  4DJB A;  3ZZZ A;  1MMN A;  3O44 A;  1NHK L;  4XDC A;  3PXG a;  4N56 A;  4F0M A;  3C14 A;  3CJ4 A;  2GNK A;  2DNQ A;  4DU8 A;  1FKO B;  1WTB A;  3MMJ A;  1TL7 A;  5C24 A;  4LRC A;  3F41 A;  3BSA A;  2AT1 B;  2GZO A;  2HPU A;  5IV4 A;  5D6G A;  5ETM A;  4GKK F;  3Q8R B;  3IXQ A;  5LJ5 Y;  1RAD B;  2QN6 B;  3GV7 B;  2HVD A;  2AJ2 A;  4DFK A;  1T9Y A;  2E9R X;  4QR2 A;  4LF9 F;  1K0T A;  4PAB A;  1J5E F;  3T5L A;  4JI4 J;  4NLY A;  3HSZ A;  2JFD A;  2EKY A;  2WVC A;  1TZ0 A;  1SVD A;  4ED6 A;  2BE9 B;  4KH0 B;  3FQK A;  3L7P A;  2WVF A;  4FVC A;  1WC5 A;  5A0Y B;  3EZ5 A;  2MY8 A;  5J2P A;  2RDI A;  3EDR B;  5IT0 A;  1CG2 A;  4FYX B;  1S1T B;  3M1V A;  3UR0 A;  3NNC A;  3H25 A;  5CQG A;  2WK4 A;  4HLB A;  4C4W A;  3BGU A;  5DM7 Q;  3R2C J;  3N6M A;  2IYI A;  4U8Y A;  4ZVQ B;  1N4L A;  2KYX A;  1IBK J;  4UOG A;  4DSK A;  4NL5 A;  1JLQ A;  4U8V A;  2AX0 A;  3P6Y C;  1NB7 A;  4JYA F;  2A3J A;  2EFV A;  3R5C A;  5CXT A;  5DET A;  3UCU P;  4N8O A;  4DG1 B;  3HI9 A;  3ETM A;  3CD6 S;  3M2R A;  3M7V A;  1Y11 A;  4B08 A;  4J9P A;  2CJY B;  1UJ4 A;  3PYD A;  1U1L A;  1OO0 B;  3KUG A;  3W7B A;  4N7T A;  4ZVF A;  3DLH A;  3Q8V A;  1HNZ J;  3UE2 A;  2GFF A;  3PFO A;  4E0D A;  3TX0 A;  2QLJ B;  5EWE A;  2ZJQ Q;  4DL6 A;  4WFN Q;  1CSJ A;  2WCX A;  1VQK S;  4YB5 A;  3V6D B;  1FX2 A;  5FJ4 A;  5T7L B;  2O01 C;  1HBM A;  2G2Z A;  3R5D A;  4KGV B;  1PCA A;  3JTP A;  1HAR A;  1UVK A;  1H3D A;  1T9W A;  2FDN A;  4ER8 A;  1S99 A;  3AJD A;  4LBI A;  4DDF A;  2VZ9 A;  3MM6 B;  2R2U A;  3MGJ A;  5HP1 B;  2PMZ D;  4DL7 A;  3E01 B;  3R7S B;  4J5O A;  5J2N B;  1NME B;  5KG1 A;  3EVO A;  4EU0 A;  3D54 A;  2V50 A;  2R7V A;  3UVJ A;  2CKW A;  4O3N A;  4I4B A;  3JQM A;  8RUC A;  1HWK A;  3M32 A;  2YX7 A;  3TJ8 A;  2QA4 G;  2CFX A;  1Q8I A;  2DGU A;  4NLT A;  3R27 A;  2R8K A;  1WEX A;  2I5J A;  1VR6 A;  4PYA A;  3TZW A;  4M5L A;  5FLX Y;  1TL5 A;  1UVN A;  2V4J A;  1S1W A;  2GMH A;  3QRP A;  1FJE B;  3VAK A;  4BC7 A;  2WW4 A;  4CO0 A;  3KXD A;  1WF1 A;  3MI7 X;  1K44 A;  4LJM A;  3UDV A;  1M1G A;  4WXO A;  1TV6 A;  4PXE A;  2RU3 A;  3Q8Y A;  2ZBP A;  2MKI A;  4F3O A;  2NYI A;  2Z2Y B;  1ZYQ A;  4YN3 B;  2CPE A;  3NXZ A;  1HNW J;  3ZZP A;  5C7P A;  2DIT A;  2PEB A;  5EGY A;  3DGP A;  1RI7 A;  4LF5 J;  3FCH A;  1KVJ A;  1LW0 A;  2D74 B;  3VAF A;  1JJH A;  2A2C A;  4DOZ A;  4DN0 A;  4DR6 J;  4O0I A;  2QYG A;  2DXD A;  3IS9 B;  1VIO A;  2DNO A;  2HIY A;  1NPK A;  1PJ5 A;  6FDR A;  5AJ3 F;  1VYA A;  1X4B A;  2O5D A;  1IKV A;  4ZCI A;  3ZC4 A;  4CO5 A;  3KLF A;  4CO2 A;  2HQI A;  1M5S A;  1FJC A;  1HQU A;  3QZ8 A;  1UEU A;  3D67 A;  4OZ2 A;  2EKN A;  4QU6 A;  1RWK B;  1WAC A;  5ITH A;  3VAH A;  5FLX U;  3N0V A;  2GAH C;  1T05 B;  2LMI A;  4OZN A;  1Q82 T;  2VKR A;  5KT4 A;  3HHL A;  2ZDP A;  3EWG A;  1RT5 A;  1AW0 A;  3ZZ0 A;  3RB6 A;  4MJK A;  2W2O P;  3B78 A;  5AE2 A;  4RW6 A;  1N56 A;  2GHW A;  2C2M B;  2M4M A;  1VQM S;  1TKD A;  4HH1 A;  3ZNU A;  5LM7 E;  2DY1 A;  5LJ3 Y;  2XLK A;  2HW3 A;  1RAC B;  4IDK A;  4KIA A;  2XY5 A;  2CNL B;  4BHQ A;  3OJS A;  3IGV A;  3TZZ A;  2GVD A;  3KG0 A;  2IRX A;  1L3K A;  1ITP A;  3TA2 A;  4ECR A;  2QLW A;  4LUB A;  3TA1 A;  1OIA A;  2RRN A;  2MZR A;  3DOK A;  1HBN A;  5DQH A;  5KFG A;  3LGN A;  5K8P A;  1GK8 A;  4ZLJ A;  1F2G A;  3I96 A;  4MIW A;  3ONQ A;  1JLC A;  5H9E K;  4ZPC A;  1AUS L;  3U1N A;  1JIH A;  2W4D A;  5HI7 A;  4YHH J;  2E29 A;  1NDK A;  1NKB A;  4ZIV A;  2HND B;  2VG6 B;  4F0H A;  2YKA A;  2B3T B;  3W1Y C;  4OHY A;  3DRX A;  2H5E A;  2DR9 A;  1NUE A;  1O0P A;  4Y28 C;  1R0A B;  3DI6 B;  4PR6 A;  5J2M B;  4FF4 A;  3GE9 A;  1EET B;  3IWL A;  4F67 A;  4FYY B;  4NZ7 A;  2PN6 A;  4X4O A;  2GA7 A;  1RJJ A;  4USK A;  3DRS A;  6FD1 A;  4CWB A;  3CJ8 A;  2ZZT A;  3K57 A;  1FI4 A;  2LP4 A;  2J76 E;  2B7C B;  4JI5 F;  1IVZ A;  4ILR A;  1RUS A;  2RUG A;  5D3G A;  2NCK L;  1XNQ J;  5F9L A;  2DPI A;  3EPG A;  4J9O A;  3W61 A;  1UWA A;  4HAC B;  3CJK A;  3LWL A;  3QSI A;  3IRW P;  3ILO A;  1OWX A;  3RBZ A;  4KPC A;  4ECW A;  2GC8 A;  3QT8 A;  3W8P A;  3O2I A;  5K20 B;  2QL7 B;  4PWD A;  2D9O A;  4FYV B;  2B5J B;  5HVG A;  4DR7 F;  3NY0 A;  2MQM A;  2VA3 A;  3MM9 B;  1NH8 A;  2MKY A;  2AGQ A;  1FEE A;  2FVQ A;  2MKH A;  3DMJ B;  1U6B A;  4Y2M A;  3JSY A;  3R1L A;  2ZH4 A;  1LWX A;  3BB5 A;  3C6T A;  4LR9 A;  1J5O A;  2ILY A;  3IRX A;  5HMY A;  1FDD A;  5KG4 A;  4LVN P;  2ZH5 A;  1PYT A;  5LT5 A;  1RE1 B;  4J90 A;  4QWA A;  3HHL D;  1UEK A;  1YBT A;  2JEF A;  3IO1 A;  5G0R B;  4UUW A;  4DX7 A;  1SKU B;  5KFH A;  3MEG A;  3OUY B;  2HNZ B;  1JLB A;  4PQA A;  4X4P A;  4I7F A;  1FNM A;  3QJP A;  1NK0 A;  2VJU A;  1VJW A;  1L3S A;  4GO5 X;  1JLG B;  4OIX A;  4GO7 X;  1OY8 A;  5JXS A;  1H74 A;  1YRT A;  2ZVI A;  4A8O A;  4URS A;  3L7O A;  3MEE B;  5BJR A;  4MKB A;  2HYI B;  4LVO P;  4C9D A;  1FXL A;  3VQS A;  1KLM B;  1S57 A;  2J5A A;  1X7V A;  5KOW A;  3NKY A;  1Y3K A;  3I5C A;  2G4B A;  2HHS A;  3CPW R;  4I6A A;  1F0X A;  3DDK A;  2XLI A;  4JB8 B;  2KKH A;  1GX6 A;  3FBE A;  5M2R A;  1UVJ A;  2EC0 A;  1S9E B;  4NE9 C;  2BAB A;  4DL3 A;  4NCA A;  2GX8 A;  1B3T A;  1KOH A;  4OMF G;  3AD9 C;  3LAN A;  3ADA C;  4NML A;  1N0U A;  4OJH A;  4QIV A;  4YDX A;  2E5G A;  2NXN A;  3IFE A;  3POT B;  3MXH P;  3I0R A;  5K9F A;  2XHC A;  4ED5 A;  2V5H G;  4JV5 F;  1H73 A;  1T03 B;  4Y34 A;  1NJX A;  4HT5 A;  2GCF A;  1KVK A;  1ZAW A;  5KFB A;  5HQ8 A;  2EK1 A;  4UOH A;  2LEA A;  5DQI A;  1RTI A;  5L46 A;  1NSK L;  3UD5 A;  3OPK A;  4M5I A;  2ROP A;  1SI9 A;  4LQ9 A;  2V9W A;  3R2D J;  4HH0 A;  1FKP A;  2DRB A;  4F02 A;  2P6T A;  2PO4 A;  5RUB A;  4AL6 A;  3MD3 A;  5F3Z A;  4ECY A;  1ARO P;  1VCT A;  1GAO A;  4OYO A;  4C97 A;  1T03 A;  4F2R A;  3T1Y J;  1YLX A;  4RO0 A;  1RP5 A;  3M30 A;  1RBA A;  2IVM A;  2QLX A;  1X5T A;  1ELO A;  1I94 F;  1AZS A;  4X64 J;  4IRK A;  4LSN B;  2VOO A;  4C8N A;  2CQC A;  3KLE A;  4AFF A;  2OML A;  3M8Q B;  1FJG J;  5L1L A;  2UP1 A;  3KHG A;  5E33 A;  3O1L A;  4MK7 A;  4CYU A;  4H4M B;  3CDU A;  1NK6 A;  2UXB J;  4R0E A;  2L9D A;  1VIS A;  2P8I A;  4DR5 J;  3BDP A;  1DTQ B;  5HRO A;  4EO8 A;  4NI2 A;  2KH9 A;  2HFU A;  2L9W A;  1RAO A;  4M5N A;  4CLF A;  4KSE B;  4QZV B;  5L8R C;  3RW7 A;  3U02 A;  2ASY A;  2RE1 A;  4WZQ A;  4IOB A;  3PR4 A;  1TFY A;  1BWE A;  3NL0 A;  4USV A;  2QFJ A;  2KN4 A;  3MAA A;  4DEZ A;  2EFP A;  1PC5 A;  2HNY B;  3TOQ A;  4DWI A;  2VDI A;  4QIE A;  3FSX A;  3SV3 A;  4H4K A;  2DR8 A;  1GEH A;  1NJI T;  4L74 A;  3IG1 A;  4C11 B;  1UMJ A;  4NWB A;  2HAF A;  3UWT A;  4DR4 F;  1IQZ A;  5HLF A;  4ZVE A;  3QT7 A;  2ZE2 B;  3MPV A;  2ZJP Q;  2DNP A;  4GC7 A;  2CRL A;  1S97 A;  2D3Z A;  2LQJ A;  1XTZ A;  2AJQ A;  2MB0 B;  1J5E J;  2H54 B;  4AXI A;  2R7X A;  2K7J A;  1JXE A;  2MQL A;  1Z1Z A;  3CME S;  1P27 B;  2AZ3 A;  2RJZ A;  1WF0 A;  3PEJ A;  3TAN A;  4H4O B;  1VHF A;  1N36 F;  5F3T A;  4DV3 J;  5E3C A;  3LP2 B;  1WNE A;  2R8J A;  3S6E A;  1FWL A;  2G13 A;  1RGV A;  1S77 D;  3M6X A;  4ECU A;  1WWH A;  3ZTO A;  2HWH A;  3NGD A;  4HR2 A;  2MGZ B;  1SJF A;  4USJ C;  1YSJ A;  3G86 A;  1WD6 A;  3RRK A;  4YS2 A;  4NXN F;  1WSV A;  2I9S A;  4HT7 A;  3D6T B;  1JJ4 A;  4DV2 F;  3M2U A;  1Q5Y A;  2YWK A;  4ZP6 A;  4ZVP B;  1F3V A;  2F8E X;  4FXV A;  4K0K F;  3S01 A;  1UW9 A;  3GFY A;  2YKQ A;  1TK5 A;  3CSK A;  4RNM A;  1XMQ J;  2FC9 A;  1VBK A;  5D78 A;  2DH8 A;  1N33 J;  1S49 A;  3MM8 A;  4JV0 A;  2A18 A;  4C8Y A;  4Y65 A;  1NDP A;  3CW2 C;  1ZM3 A;  1C0T B;  2NUH A;  1D9F A;  2W8K A;  4EEY A;  4O3Q A;  4KGX B;  4LFA J;  4ZLL A;  5DG9 A;  4UY8 5;  1PAU B;  1TTH B;  3KK1 B;  1EB0 A;  3GIR A;  5H9E J;  1N8R T;  5FDL A;  1XR5 A;  2CQ4 A;  3R5J B;  1S6P B;  1U45 A;  2CDQ A;  4PRF A;  2GO9 A;  3FEZ A;  4I2P B;  3ISZ A;  1T95 A;  3SDE A;  1CVJ A;  5DZ6 A;  4E2F B;  1M5K C;  2BKP A;  3IWN C;  4PG6 A;  4KV8 A;  4AQY F;  4OV1 A;  4IH6 A;  4GKJ F;  4QYR A;  2VG7 A;  1ZTW A;  1U0H A;  1KBR A;  4USI A;  3CDE A;  3HT3 A;  5HMX A;  3VAL A;  4TU9 A;  4QU7 A;  4U6P A;  4ANE A;  4M95 A;  3I55 S;  1DZ5 A;  4KO0 B;  1ZET A;  4ES2 A;  3QJJ A;  2YKM A;  2HVH A;  3NOC A;  1C1C A;  4OYI A;  2E9Z A;  4F4A A;  1FDB A;  1K0V A;  4C6A A;  3DLB A;  3DLG B;  3JB9 k;  1FFS B;  3VVT A;  5A8K A;  2XSJ B;  2AZ1 A;  4Q0B B;  3GJS B;  4FF3 A;  2R7R A;  1XR6 A;  5J2Q B;  1Y5L B;  2G2O A;  1D0E A;  3NGS A;  4NZ6 A;  1GNK A;  5HQM A;  4CLK A;  3ZZU A;  3OTD A;  1M5H A;  2XZT B;  2OEL A;  1DJ0 A;  4N76 A;  4DR1 F;  1TQL A;  4P9S A;  4LR8 A;  2DHS A;  2YKP A;  4JV2 A;  2BRK A;  2CWK A;  3QGH A;  2ZHB A;  1YBA A;  2WBM A;  3NMR A;  3P8B B;  3MCS A;  4B3O A;  2PA3 A;  4G1P A;  2CQ3 A;  1GMV A;  1XIQ A;  3CO9 A;  1HWU A;  1LWE A;  3BBF A;  1X9S A;  2V2K A;  3M8Y A;  2BW2 A;  3AOA A;  2C3Y A;  2AEF A;  2C1E B;  3LUY A;  3EPI A;  3ZZY A;  1YKW A;  3GYG A;  4ZDN A;  2GVZ B;  2JLG A;  1Q0N A;  2Z8Q A;  4W90 B;  1EP4 B;  2B8Q A;  2ASL A;  1V3S A;  3AD7 C;  3K89 A;  3EYZ A;  2GML A;  2JDJ A;  1B0V A;  2V6A A;  2RT3 A;  3UD4 P;  4IYQ A;  4U7C A;  1RB0 A;  2QLF B;  4A47 A;  2XUL A;  1KRP A;  2UUT A;  2QIF A;  2KG0 A;  3SMZ A;  4OX8 A;  1YK9 A;  4KB7 A;  4ZVT B;  4LFC F;  3RUB L;  2R7T A;  4IKA A;  1N5T A;  3FK4 A;  3KLG B;  3MMA A;  4C0O C;  3GMG A;  4WCE Q;  4K59 A;  5B0E A;  5DRK A;  1JKH B;  2OD4 A;  3ENV A;  3G96 A;  4BS2 A;  1LOU A;  4C3L A;  5KFM A;  1BHN A;  2PA8 D;  3DM2 A;  4KY3 A;  1W2B R;  2M88 A;  1LFW A;  3CE8 A;  1H7X A;  4IH5 A;  4UST A;  1AXQ A;  4MK8 A;  2V34 A;  3AJ2 A;  4M94 A;  4E8U A;  3MAQ A;  4OV6 A;  2AF6 A;  4ECZ A;  3D3C J;  2OPS B;  3KJF B;  2MQQ A;  1R8C A;  3HHN B;  4IRD A;  5LSL A;  4U67 Q;  2I2Y A;  4U96 A;  1MU2 B;  2ZZM A;  1RT1 A;  1SJQ A;  1H0H B;  1BE4 A;  1CC8 A;  3KHH A;  2VON A;  1VHI A;  3BKT A;  3F73 A;  1NH7 A;  1CQN A;  4OYB A;  4NA2 A;  1XNR F;  1N5Y B;  4LRF A;  2A2D A;  3SQG B;  3BQ2 A;  2HHP A;  3MPU B;  2CWX A;  4XK8 C;  3TAM A;  3Q83 A;  3PEH A;  3H2U B;  3NG8 A;  4DV1 F;  2FB0 A;  2CXE A;  3R5B A;  2EWH A;  2JRS A;  4G65 A;  2YNI A;  5CCL A;  3MHY A;  5DDR C;  1CJU B;  1KTV A;  2VD3 A;  4YUD A;  3OVB A;  5C25 A;  3RBX A;  5A2Q Y;  1FRH A;  2HUR A;  2RIL A;  5DLF A;  5F8L A;  2QMX A;  3PYG A;  2AHO B;  1RTD A;  2GGP B;  3HDS A;  3I56 S;  4NAS A;  1FK9 A;  2JVR A;  3UDC A;  3OVS A;  3DU5 A;  3EDQ B;  1VQ5 S;  2IFX A;  3LH2 S;  3B8H A;  4DLG A;  3V6J A;  2M8D B;  5IQ6 A;  2J9D E;  2GAG C;  2KJV A;  2DRA A;  2ZM6 F;  1D8Y A;  2FVR A;  1FDN A;  4LF4 F;  3ILJ A;  1CUL A;  2HZC A;  2BJE A;  5KFR A;  2AJ4 A;  1RTJ A;  3MMB A;  2W9B A;  1PIE A;  1U1N A;  1QD1 A;  3MPD A;  3OR1 B;  3CF5 Q;  3D68 A;  4DV0 F;  3WC0 A;  2R8G A;  1R43 A;  4IFV A;  3BRE A;  1WI8 A;  1ZA2 B;  3OD2 A;  3QIP A;  3NBP A;  1FFG B;  2YQ1 A;  2AU0 A;  2J8S A;  1RT2 A;  1EKR A;  4UZC A;  2EFO A;  2Z2M A;  3WC2 A;  1N5Q A;  1N34 F;  4NZ0 A;  2JL9 A;  3BBB A;  4AND A;  3CCZ A;  1R8H A;  3PX6 A;  1LV5 A;  2YTC A;  4GRS A;  5ETK A;  1MLA A;  2JOQ A;  1IKY A;  3PYE A;  5A2Q U;  2E7W A;  4P72 A;  3RAX A;  5D0H A;  2ROE A;  4J9U E;  5EWF A;  3ZZR A;  5K8M A;  1SJ1 A;  1RAJ A;  3QFH A;  4P2M A;  1TL3 A;  2DIU A;  3IAM 9;  2KI2 A;  4ELU A;  5I3U B;  2BM0 A;  4Q7A A;  2DGX A;  2XB2 D;  1ULR A;  4ZPV R;  3FRZ A;  4JI7 J;  4ZVR B;  3NLC A;  2AGO A;  2M9K A;  1KTQ A;  2LA6 A;  4QR0 A;  3ZZT A;  1YJT A;  2RUS A;  2PEH A;  2O67 A;  2VBX A;  1PYO B;  1NEE A;  3ZXW A;  1IXK A;  4NEZ A;  3QRQ A;  2SXL A;  3D0H E;  2KFY A;  1IKW B;  4DR3 F;  3BF4 A;  1D9D A;  4MT1 A;  3OTE A;  2A1B A;  2IPO B;  1R6V A;  2K7K A;  1IBL J;  5CYQ B;  4A8W A;  1HNI A;  1KLN A;  2XMM A;  1OYD A;  1HW9 A;  1IKX A;  2HZV A;  2V8D A;  4HYK A;  1SH2 A;  2YPY A;  1KR4 A;  1XBW A;  2YBV A;  4NPO A;  3TR5 A;  3MED B;  2VFS A;  2W7A A;  1ROF A;  2NS1 B;  1JJC B;  2NUU G;  2VV5 A;  2HVE A;  1FTC A;  3HKW A;  1TAQ A;  2WRM A;  2LEC A;  2UVU A;  1HQE A;  3ULH A;  5DZ7 A;  4KFB B;  4ID5 B;  4G1I A;  5DS7 A;  3HSD A;  2VG5 A;  4USW A;  2XYP B;  4C8M A;  1T9U A;  2B56 A;  5C2G A;  1H98 A;  5B7W A;  3EGN A;  3MMC B;  1NKC A;  1LK7 A;  2VAS A;  3PRV A;  4DUY F;  1RT3 B;  4B9L A;  4WYL A;  2GMJ A;  1FRK A;  4F36 A;  3KK3 B;  1HNV B;  1RWN B;  1JNR B;  5BR8 J;  1IWA A;  4L3N A;  4IOC Q;  1TUV A;  3MPW A;  1VOM A;  1QE1 B;  1D8Z A;  4CLW A;  4KC5 A;  4ES3 A;  2A0F B;  4HDH A;  1JX4 A;  4F04 B;  2OTJ S;  2Q3P A;  4J9M A;  4L3K A;  1MG7 A;  3A1Y G;  4V1A k;  1S0N A;  1PC4 A;  2RAQ A;  3RYL A;  2CVI A;  2C2O B;  1SPB P;  1DUR A;  3Q22 A;  4F2S A;  4GVB A;  1KD1 T;  3H4B A;  4HTI A;  3PW2 A;  4R5P B;  3K8V A;  3VGT A;  4N47 A;  5CYM B;  5KFC A;  3A13 A;  4J91 A;  2DGW A;  2UUB F;  3VAG A;  4PUO A;  2XEX A;  4NA3 A;  1WKL A;  1SC3 B;  3OW2 R;  4M63 A;  2FLL A;  1G6B A;  1S10 A;  3KDO A;  3Q8Q B;  5KFD A;  3B82 A;  4FKX A;  1NB2 A;  1SUQ B;  1X4C A;  1QSL A;  1UAW A;  1U49 A;  2OPQ B;  4YQW A;  5KG2 A;  3PJX A;  1IN0 A;  1OQ3 A;  3ITH A;  3FFI B;  1RHU B;  2HHT A;  4C0B A;  4P52 A;  3UD3 P;  3GPA A;  3KYL A;  4JI3 F;  3CC2 S;  1N52 B;  1TFW A;  2GQ2 A;  1B99 A;  4Y3C A;  4CLZ A;  4NCG B;  4P2F A;  4C2M A;  1GXT A;  1ZM9 A;  2NPF A;  2IC3 A;  2N82 B;  4FNI A;  2PFF B;  1JQG A;  3C6U B;  1CS4 A;  3FZB A;  4EBC A;  1AFI A;  1F2H A;  4RBU A;  4FF1 A;  2HGN A;  2BOA A;  4DHV A;  3W2W B;  1HMV A;  2MQ8 A;  1N48 A;  2C3M A;  1DLO A;  1TL1 B;  3H5U A;  2F5G A;  1BQN A;  4Y0F A;  3NCR A;  2BEF A;  2D7S A;  1TKZ A;  3G8T A;  1Y10 A;  1G1X A;  4XAK A;  1HWJ A;  2V4R A;  2OFH X;  4A8S A;  3HX9 A;  2BAN A;  4NXN J;  2B6A A;  4A4J A;  3AOD A;  2DNR A;  5IT9 Y;  2VIH A;  1CQM A;  1RTH B;  4DV2 J;  2ZJR Q;  1R0B G;  3DRY A;  1NJY A;  1Q1K A;  1RZM A;  4NLD A;  4K4X A;  1TVR B;  2JSX A;  3ELH A;  2EEY A;  4B9S A;  3MD1 A;  2L3M A;  4K4W A;  2RS8 A;  3DRP A;  2OGU A;  1D09 B;  1D9A A;  1W25 A;  4LSL A;  4B3S F;  2JFK A;  2AYM A;  5IS2 A;  3KJV B;  4KPY A;  1Z2L A;  2VQF J;  1WDT A;  2JVO A;  3MFH A;  1UFL A;  2XY6 A;  2HHQ A;  3MUM P;  1LQ9 A;  2ZBR A;  3HM9 A;  1GX5 A;  2V63 A;  3BQ1 A;  1UL3 A;  3KK2 B;  3RB0 A;  3NOG A;  2MY7 A;  2GIF A;  1PO6 A;  4LF7 J;  3OHB A;  4IUF A;  2QMU B;  2DR7 A;  4OHZ A;  1S76 D;  2RRA A;  1QTN B;  2FHM A;  2OO4 A;  2YKN B;  1NSQ A;  1RBO B;  2XI3 A;  3PM9 A;  2BE2 A;  1JJ2 R;  2H4Y B;  5M2P A;  5F9N A;  4QWD A;  1U1R A;  2B0G A;  3EVM A;  3HZE A;  1QSS A;  1R8A A;  2JJ4 D;  2CJQ A;  3MR7 A;  5IT9 U;  2IBK A;  3G6V A;  3MM7 A;  4ZVS B;  4TYB A;  2UUW A;  1UEV A;  3BM7 A;  3CDA A;  3Q8S B;  2J7W A;  4DPT A;  1N32 F;  5A8W B;  4OZ1 A;  2DBB A;  2DD8 S;  2YXL A;  4IFY A;  1REV B;  2YNF A;  3DOL B;  2YNH B;  5CCM A;  2WTF A;  1KDN A;  2CZV C;  2K3I A;  3M9M B;  1CBK A;  3V4I A;  4UY8 T;  2DEI A;  4UF4 A;  3TJ9 A;  2CQ0 A;  3RTV A;  1JLF A;  1LWF B;  2IJR A;  2OPR A;  1Q7Y T;  5ETS A;  1Q4R A;  3I0S B;  3K58 A;  2J6S A;  2V9K A;  3KLI B;  3C16 A;  3JSM B;  1CJT B;  4DQQ A;  4DV7 J;  2BXJ A;  4ZVG A;  4ALZ A;  3GON A;  1GQE A;  2CPY A;  4TKT A;  2ZFH A;  3A3P B;  2DH9 A;  2HMI B;  3THT A;  1VC6 A;  1H72 C;  4M5D A;  2UUC F;  5KFO A;  2ZBQ A;  1FWK A;  4JI1 J;  1QLN A;  3NGT A;  3UPF A;  2CPJ A;  3GR1 A;  4ECS A;  3KHR A;  3E3X A;  1H38 A;  1MWZ A;  3F56 A;  1L3U A;  2WOM A;  4X62 F;  3J7A 1;  1IM6 A;  4RNO A;  4KKO A;  2K8G A;  4NA1 A;  1VLO A;  3DLE B;  2COL A;  3EVW A;  1S6Q B;  4JBC A;  4DV6 J;  4HKQ A;  3NWR A;  2AYG A;  1V5I B;  4Y6I A;  2N4D A;  1V9O A;  3V6H A;  2W9C B;  5HAT A;  3CUL A;  3PIP Q;  4FF2 A;  2B9X A;  3LOU A;  1HR0 F;  3LQV A;  5JJB A;  3HZG A;  4XO0 A;  1XMO F;  3TX8 A;  2JHE A;  4A8Q A;  2FLO A;  3GV8 B;  3L95 X;  4BC9 A;  3SFG A;  2ILZ A;  2IVF B;  3DLE A;  1S6Q A;  3IR5 B;  1RCX B;  1KC8 T;  2IDE A;  5LSO A;  1RT7 B;  3SZ2 A;  2QLB B;  1C0U B;  1VK3 A;  2NPI A;  3DDI A;  3D1Q A;  5IFM A;  4QWC A;  2ACY A;  3TAQ A;  1Q8L A;  2WAQ D;  4DFM A;  3C15 B;  3IN5 A;  2N3L A;  2UVV A;  4X4T A;  4M1K A;  1DBD A;  4KH1 B;  1W2I A;  4P73 A;  5DM6 Q;  5D0G A;  1VQ7 S;  4EZ6 A;  3G6E S;  3NMA A;  2OMO A;  4I2Q A;  4B3M F;  3W5Z A;  4ZVO B;  3A3O B;  4CCH A;  4O44 A;  3ICL A;  2X51 A;  3D2W A;  1NPP A;  2HRY A;  1KVI A;  3JYT A;  1P9Q C;  1RT6 A;  2CYY A;  3SCJ E;  4CLT A;  1R27 B;  1T0T V;  2HQD A;  4DSE A;  3LWM A;  3OTC A;  3HHL C;  4OHV A;  3ILI A;  5LMU J;  5D4P A;  4A8M P;  4NLW A;  2YWE A;  1PG5 B;  4HHU A;  3E8O A;  2J9E A;  3LP0 B;  2ZBI A;  1QUV A;  1TKT B;  4CTA A;  2HLT A;  5L9X A;  4KE5 A;  2LQ9 A;  3TWZ A;  4KYZ A;  4J37 A;  5GVQ A;  4NOH A;  3TQE A;  3GG1 A;  3A12 A;  5B0D A;  2DO0 A;  2BV3 A;  2RQM A;  2UV8 G;  5IM0 B;  4WIQ A;  3RU0 A;  4TNO A;  3FCW A;  2V8P A;  1FD8 A;  3LP0 A;  4ILM A;  5F8H A;  2DK2 A;  4LMZ A;  2D3O R;  3T1A A;  3BYR A;  1Q5V A;  5KFW A;  5F8G A;  5HMW A;  3W2V B;  2UVW A;  2VDH A;  3FVY A;  4NLX A;  1SKW A;  1VBX A;  3W9J A;  3AB2 B;  3V2U C;  1VQY A;  2K2P A;  3RBE A;  3J7Y U;  1IBC B;  4C48 A;  2DIS A;  3TUZ C;  2J9C A;  2ZOM A;  3I82 A;  2ZH3 A;  5IWA J;  3NWG A;  3BPD A;  2H9Z A;  4WE1 A;  1VBZ A;  5GAD U;  3J7Y I;  3PDN A;  2FPH X;  3H7H B;  3W66 A;  3PVX A;  2W7O A;  1HA1 A;  2UZA A;  5SUH A;  2CVE A;  4JI8 J;  2Z58 B;  4IG3 A;  1QM9 A;  4DUZ J;  2Z4P A;  4LF2 A;  9ATC B;  4CM0 A;  3RGI A;  1VRT B;  3MR3 A;  4KAI A;  2QG9 B;  2GW8 A;  4J9Q A;  2ZOG A;  2J6U A;  3M8P A;  1HBU B;  1FX4 A;  4EUV A;  3J80 Y;  4KR0 B;  3I6P A;  3DCA A;  2F4V J;  3V4M A;  1WG5 A;  4K50 A;  3BN4 A;  4OI0 A;  3H8Y A;  3CJS A;  1N34 J;  1FES A;  1KKH A;  4FBT A;  5IT4 A;  2FVC A;  4P2X A;  3MM5 A;  3HP6 A;  3OTO J;  3S1T A;  3HD2 A;  5ADZ A;  2L08 A;  4TVA B;  4W4M A;  4DSF A;  2KXF A;  3UO0 A;  1WSR A;  1QAY A;  3LAM A;  2LU2 A;  1XC9 A;  1Q81 T;  1HL6 A;  2EBE A;  1JLA A;  3ZNJ 1;  1DRZ A;  1MN7 A;  3GSI A;  4O3P A;  4TN2 A;  1XK8 A;  4KQZ A;  3HCX A;  3V81 A;  4DCP B;  2BR0 A;  5HBM A;  3C46 A;  1S6O A;  2VUG A;  1S1U A;  5BYR A;  1YI2 S;  4OI3 A;  4BWJ A;  4K4S A;  2FJX A;  4Q5V A;  3JSB A;  3CJ0 A;  4RW8 A;  5DO2 A;  2YNG B;  3SCL E;  1Y5I B;  5KFA A;  4G1Q A;  2P2C B;  4WFZ A;  1UA1 A;  2RKI B;  3N6N A;  1P1L A;  2FJA B;  1S7H A;  2ZWO A;  4CO4 A;  3HHK A;  3DLK A;  3J80 U;  4C3M A;  3GFX A;  2CPX A;  3RAM A;  2NYH A;  4ZPT R;  3HJV A;  2FQQ B;  4LSZ B;  1S7I A;  3VAI A;  4MH8 A;  1S1V B;  2XHW A;  3PFE A;  1DTT A;  2EFN A;  2HHU A;  1LW2 B;  2FJV A;  4U7U K;  3R5G A;  5ETL A;  3FC9 A;  3BQ0 A;  4ED2 A;  4WU3 A;  3BO4 A;  2U1A A;  1NZA A;  1HI1 A;  1TUW A;  4LFB J;  1A7G E;  3BGR A;  5EX3 A;  2HFN A;  5G4D A;  4QYZ K;  3G71 S;  4I1T A;  1HBO A;  4ZHR A;  3VHQ A;  2MKK A;  4DUY J;  1FEH A;  5E41 A;  2XSF A;  1T3O A;  5KG6 A;  2J0S D;  3H5X A;  1P9Y A;  4K2J A;  1CJV B;  2BJD A;  1IR0 A;  2J7U A;  3PHE A;  4TY8 B;  1M90 T;  3QRR A;  1SV5 A;  2XZW A;  2X7I A;  2W25 A;  3ZFV A;  3VAM A;  2LXU A;  4KJI A;  2LDY A;  2IIH A;  5J1E A;  2MZQ A;  3HJF A;  3CJ5 A;  4QWE A;  5HJY A;  3PCO B;  4P74 A;  2LEB A;  2HS3 A;  2Y3Y A;  2W1B A;  1S9G A;  4IG0 A;  4NXM F;  2E5L F;  1S59 A;  1JLE A;  2XM3 A;  3DOM B;  1KS2 A;  1R6Y A;  2DNK A;  1HYS A;  1SCJ B;  1RLD A;  4OLO A;  3C8Y A;  3BBC A;  1RCO B;  3AY0 A;  1LXJ A;  1KQG B;  1F5A A;  4N5S A;  3BJY A;  3D28 A;  2FD2 A;  2B43 A;  1R8P A;  2OPP B;  1SJ3 P;  1PYS B;  1T11 A;  2O1P A;  3QO9 B;  1UKU A;  2KM8 B;  4B17 A;  2UXC F;  1X9M A;  4ICL B;  4JI3 J;  4JI2 J;  1RWP B;  2F40 A;  3R6G B;  2ALZ A;  4MKV A;  2C3P A;  4R8U B;  1PBA A;  1OY6 A;  4DF4 A;  3A3N B;  3CD0 A;  4O4G A;  5I3P A;  1WF2 A;  2K1R B;  4Q44 A;  4MAK A;  3UR3 C;  3RAQ A;  1HI0 P;  1PJ6 A;  2XI2 A;  2DHA A;  3DHW C;  4ATN A;  1VMB A;  1TMM A;  1FKO A;  2VL1 A;  3C66 A;  3NGK A;  2XS5 A;  3NS5 A;  3T9Z A;  4PPZ A;  4H4K C;  2DHX A;  3Q2T C;  2R7U A;  3M6U A;  5HK4 A;  4DV4 F;  3PNI A;  2IM0 A;  4M5J A;  1Z4U A;  2PDA A;  3QAT A;  1ZM4 A;  3HFV A;  3EGZ A;  1S1X B;  3GSD A;  2FHJ D;  3VGU A;  1VGY A;  3TEH B;  1PSD A;  3BS9 A;  5JUM A;  2M2B A;  2RVJ A;  4PZV A;  3K2Y A;  3H20 A;  2XGP A;  2DO4 A;  2CJK A;  4O3S A;  2DHG A;  2HFS A;  4ILL A;  1LFP A;  3UCG A;  5KFP A;  5DGB A;  2XWY A;  3TVZ A;  2MQO A;  2NR0 A;  1U6F A;  3DLJ A;  4EGL A;  5A0Y A;  1HD1 A;  4YR3 A;  1I5O B;  1Q95 G;  3MCN A;  1S1T A;  4OX7 A;  1N5S A;  1O5J A;  2H3E B;  4ZJO A;  5EN1 A;  1RKJ A;  3OBI A;  4DUT A;  4U9R A;  3U1M A;  1TKX B;  3MR2 A;  3WHI A;  1ZZF A;  4ZJQ A;  4C8O A;  3NCQ A;  2LVW A;  3JAM U;  4DL5 A;  2AYB A;  3LPY A;  1K47 A;  5CZX A;  2HS0 A;  2YWW A;  4NLG A;  4FBU A;  5J1N A;  4C7Q A;  4CLS A;  1VDH A;  4MK9 A;  2OD6 A;  1SL0 A;  3Q86 A;  4DCJ B;  2FGO A;  1M1H A;  2HQC A;  1YDL A;  1OYE A;  3CCW A;  2CQH A;  3PYF A;  1NO8 A;  2B4O A;  1C2P A;  3F44 A;  4DG1 A;  2RH3 A;  1XQI A;  2V2Z A;  4CH7 A;  5C5J A;  4WZM A;  3SBM A;  5A8R B;  2UU9 F;  4FYD A;  1NXI A;  1WJ9 A;  4PKD B;  2PGC A;  1HPZ B;  4JI4 F;  2IM3 A;  2D41 A;  1OMS A;  3GJQ B;  4ENO A;  5D0E A;  3L9Z A;  3V6D A;  3MEC B;  4JI6 F;  1RHM B;  3K7R A;  1S4E A;  3O5T B;  1WOO A;  5T7L A;  3CDB A;  3KTQ A;  2VFT A;  4ZP8 A;  2RF2 B;  3GYN A;  4EK2 A;  4RX6 A;  2V68 A;  2HBR B;  3MM6 A;  3GFZ A;  1U1P A;  2EG1 A;  1RWO B;  5HP1 A;  1KHW A;  2VPZ B;  2FLP A;  3E01 A;  1NBE B;  4X4Q A;  5J2N A;  1SIZ A;  2ZHA A;  3ILL A;  3HFZ B;  5GAE U;  4LF1 A;  4WK1 A;  3OV7 A;  1LKZ A;  2XTJ P;  1RAH B;  1RDR A;  3KMS A;  2BRL A;  5GAE I;  2P9E A;  1IBK F;  4WFA Q;  4EWT A;  4P2S A;  1DY3 A;  1RKI A;  5B08 A;  3GZ7 A;  4X62 J;  1APS A;  3HHD A;  5H1S V;  2MKS A;  5D4L A;  4C98 A;  2HHH J;  5LXR A;  3EX7 B;  1FWP A;  3TA0 A;  2XYH B;  2RDJ A;  2K06 A;  2VC0 A;  3VQT A;  2ABY A;  2MPU A;  3C2P A;  4RWX A;  1BMQ B;  3TAR A;  3SSQ A;  2LQB A;  1SL1 A;  4BCA A;  1FXR A;  1I51 B;  1HR0 J;  4PXB A;  1VC5 A;  1XMO J;  3EIC A;  1HNZ F;  3ZTP A;  1AB8 A;  4NEY A;  4ZCK A;  4CIO A;  3QBC A;  5DGA A;  2AJF E;  4RZR A;  1CPZ A;  1RSC A;  1NHV A;  2M70 A;  5KT7 A;  3M8W A;  2JNJ A;  2BJ7 A;  2OAU A;  4RBV A;  5LL6 d;  1VBY A;  3TUP A;  2FC8 A;  3IS9 A;  2FZK B;  1KNZ A;  2MJN A;  5M2U A;  5MAO A;  3AHP A;  5DG7 A;  3EUN A;  3PKM A;  4B3T J;  4C8Z A;  1YBU A;  3SQO P;  3T1H J;  3OFF A;  5C42 B;  4DFP A;  3F0N A;  4HVZ A;  1O8B A;  3OL8 A;  5ETP A;  2YX4 A;  3HSG A;  3BSC A;  5EWG A;  1BWV A;  7AT1 B;  4F4X A;  4NCB A;  3LPE A;  1T05 A;  2WBR A;  5ETR A;  5A6P A;  3R9L A;  3I5A A;  4YFU A;  2QGF B;  3A8K A;  3ET6 B;  3PZP A;  1M5P C;  2NSC A;  4KTQ A;  4RW4 B;  3SI8 A;  5E3R A;  3DRR B;  4XIU A;  2AJ0 A;  1JB0 C;  5ETV A;  2DNN A;  2PMH A;  2DY9 A;  3NRB A;  3EGW B;  1NK8 A;  4G6V B;  1Y00 A;  3LP1 B;  4P75 A;  2GIR A;  5LMN F;  1UPP A;  2LA4 A;  1FRJ A;  3FUY A;  4V19 J;  1HNW F;  2ZWP A;  1U1M A;  3HXM A;  4EYI B;  4Y2A A;  2QEX S;  5AE1 A;  2R4F A;  3ZTR A;  2B51 A;  4NYP A;  2CQ1 A;  2J8A A;  3D0I E;  2ZH2 A;  4ELT A;  2PI5 A;  1LWC B;  1HNX J;  3DYA B;  2VHG A;  2DNH A;  2HND A;  1EQM A;  2VG6 A;  4DLE A;  4F4K A;  3CCE S;  1WDD A;  2V2Q A;  1R8B A;  2E1A A;  1VQP S;  5F0U A;  4LT6 A;  2KYZ A;  1R0A A;  2DJW A;  4RW9 B;  3G82 B;  2LCW A;  3DI6 A;  4PCQ A;  4LF8 J;  5J2M A;  2OEM A;  2WW8 A;  1EET A;  3IR6 B;  3T6B A;  4CLU A;  4NLR A;  1FRL A;  2CUY A;  1PKU A;  1GH8 A;  2W4P A;  2NXU A;  3GTY X;  4OI6 A;  4DSL A;  4A46 A;  3DU6 A;  1YRU A;  2DGV A;  2W01 A;  1WC6 A;  4MYT A;  3H40 A;  1SBR A;  1ZZN A;  4PAA A;  3MUV P;  3AB4 B;  3SEO A;  2KVI A;  3CCQ S;  1HWL A;  3AXK A;  3M9O B;  1H6K X;  4ETZ A;  1E6V B;  4HAC A;  3NCP A;  1WEZ A;  1FD2 A;  5K14 B;  1RA7 A;  1E6Y B;  2N4C A;  4DL0 C;  4OZJ A;  5T41 A;  2I38 A;  1K9M T;  1DHM A;  4RNH A;  1KFS A;  5AT1 B;  1M5O C;  2B5J A;  1RU1 A;  2PC6 A;  3H4D A;  1UWB B;  2BA9 A;  1MWY A;  3H42 A;  3MM9 A;  2AV5 A;  1IBM F;  1HHQ A;  2ZD1 B;  3AAW B;  4ANC A;  1BQX A;  1VQ8 S;  3DMJ A;  1BQM B;  2ZIT A;  1H2U X;  2FHK A;  3M8S A;  1E6Y A;  3D7S B;  2XS7 A;  5DDO C;  1NSP A;  5KG3 A;  3GCW P;  1M5V C;  3MF5 A;  2LDI A;  4LQ3 A;  5AXM A;  2EFQ A;  2VBZ A;  3QWP A;  1YIJ S;  3GJT B;  2Y1L B;  1QDU B;  4OZ0 A;  4QW9 A;  2ALY B;  5G0R A;  1XMB A;  1Q86 T;  2FJE B;  2R8H A;  2AIR B;  3OUY A;  2HNZ A;  3OR2 B;  2KZM A;  2AYE A;  5KFV A;  2QE5 A;  1JLG A;  4GC6 A;  4DFJ A;  1YHQ S;  2OH2 A;  3LO3 A;  2D3U A;  1X8D A;  3MEE A;  2F63 A;  2ZH6 A;  3NNH A;  2XMV A;  4F3M A;  2ACM A;  2GHP A;  2ZH9 A;  2ASJ A;  1KLM A;  2OHD A;  3IBC B;  5FII A;  3TNV A;  1QTM A;  4WP8 A;  5KTQ A;  4HEA 9;  3DN9 A;  2HS4 A;  1YJU A;  3NGR A;  3OR2 A;  4WFY A;  3SSS A;  3QLH B;  4K5R A;  3DC2 A;  2KHD A;  4S0M A;  1S9E A;  1F5B A;  3T19 A;  2PII A;  1CJK B;  1VRU B;  3KLH B;  3S8S A;  4UQG A;  2KFZ A;  4DV5 J;  4OFZ A;  2VBW A;  4X65 J;  4C8L A;  4WF9 Q;  3VZI A;  1XJW B;  1L5U A;  4EBD A;  3MOJ B;  2CA9 A;  4Z37 A;  2JC1 A;  1L3V A;  4ES1 A;  2EXU A;  3POT A;  3HVT B;  4QOT A;  4USH A;  2D9P A;  4AYB D;  2Y1R I;  1BY9 A;  2RIJ A;  2OP5 A;  4EO6 A;  1X4A A;  5A76 A;  1R7I A;  2F4F A;  4XPE A;  3CJ3 A;  2Z56 B;  3PX4 A;  5B0A A;  5I42 B;  2K3K A;  3M6V A;  3D0G E;  5E7O B;  2BE7 D;  2CDR B;  4LIR A;  1RT4 B;  1X4E A;  4F4Z A;  2FIU A;  1ZTT A;  5B0C A;  2C42 A;  3PG9 A;  2PE8 A;  2F8H A;  4RR5 A;  1U2F A;  3N79 A;  3RR7 A;  1RAA B;  4NX9 A;  2YPZ A;  2BUN A;  3M2V B;  4ED4 A;  3FCV A;  4KGZ B;  3MTJ A;  2YH1 A;  2OLW A;  4RPF A;  1S48 A;  2KM8 C;  2RQC A;  1KQS R;  1VQN S;  2QFI A;  4LSN A;  2QV6 A;  2EFG A;  4M5G A;  1QAI A;  3CO0 P;  1VI7 A;  3CCT A;  3M8Q A;  2OIH A;  3OXL A;  4UW2 A;  1ACM B;  2KHC A;  2G0I A;  5IQQ A;  3UN3 A;  5D4O A;  1NK4 A;  4H4M A;  4FVM A;  2G0C A;  4MFB B;  2Z30 B;  2R9L A;  1ZA1 B;  3CUN A;  1F60 B;  3HT0 A;  2JEJ A;  5KT6 A;  1DTQ A;  5L39 A;  3KNA A;  4OYZ A;  2XC9 A;  4ECQ A;  3FBC A;  3SYZ A;  4ZJL A;  3K5M A;  3FKB A;  3FBB A;  3VGS A;  3RJM B;  2RQK A;  3H90 A;  2KZZ A;  2PD1 A;  4IRC A;  1UP1 A;  1SJR A;  4RBT A;  4ZCL A;  4CQ1 A;  4GKK J;  1SQG A;  4Q2M A;  4CO3 A;  2E1P A;  5D77 A;  4QIW D;  3NP5 A;  3DHX A;  3OXG A;  2R2S A;  5CAA A;  2HNY A;  2M3D A;  3BSN A;  3I4P A;  1QAX A;  3P3D A;  2D69 A;  1JMT A;  4LF9 J;  1T9X A;  2ADB A;  1XER A;  2W2N P;  4AXJ A;  4MKA A;  4C11 A;  3PW5 A;  4J9K A;  3I32 A;  5HVF A;  5BXI A;  4RUC A;  3LW5 C;  3FGV A;  3T1Y F;  1SQF A;  5F0W A;  1UJ5 A;  2VF3 A;  2GS8 A;  1QJH A;  2ZE2 A;  1FRX A;  2JLE A;  2X1B A;  2XZD B;  2Y8Y A;  2X1A A;  2QJ3 A;  3HVA A;  1WC1 A;  2OSQ A;  4FZV A;  2KT2 A;  4K4T A;  2KRR A;  2VPY B;  4PEO A;  2C3U A;  1RHJ B;  1X5P A;  1FJG F;  4PQU B;  4IOA Q;  2WON B;  2HIQ A;  3SV4 A;  5HSP A;  4YOE A;  3CCJ S;  2GJI A;  2H4W B;  4H4O A;  2UXB F;  3RW6 A;  4ZVU B;  2DYA A;  2C2E A;  1LEO A;  3MUR P;  3LP2 A;  1M1K T;  3GIK A;  3J81 j;  1V5V A;  3GLJ A;  3C14 B;  2V4Q A;  2MQN A;  2MGZ A;  1U25 A;  2X1G A;  1WC4 A;  3Q8P B;  1S9F A;  4FN5 A;  1TL7 B;  5C24 B;  3HFK A;  4F7V A;  2BJ3 A;  3WZ0 A;  3MDF A;  4NLQ A;  2VC1 A;  4LF6 F;  1R3N A;  2R7Q A;  2ZC4 A;  4JYA J;  4OI1 A;  3OL7 A;  1U1K A;  9RUB A;  3ZO7 A;  2RRB A;  1WG1 A;  5F8N A;  1WHW A;  1G2E A;  2JEG A;  1YQH A;  2MHE A;  4DPU A;  4QJV A;  2MSS A;  3CT9 A;  4IR9 A;  1FTR A;  1SKR A;  3KNG A;  3RZA A;  1DQ9 A;  3R7N B;  5IZH A;  5KFX A;  1U26 A;  1S0M A;  1F9F A;  2DPJ A;  4WU2 A;  3AOB A;  2VBY A;  4LRA A;  1C0T A;  2ADC A;  1VFJ A;  3BEG B;  1FER A;  3J81 Y;  4B02 A;  2N7C A;  4LRD A;  5E2Q A;  1VQL S;  2UU9 J;  1HIY A;  3KK1 A;  3QT5 A;  2RNE A;  2MQP A;  3WX4 A;  4OZ5 A;  5J2P B;  4K8R A;  4F26 A;  3D3B J;  3M1V B;  4HTJ A;  1J27 A;  2LFV A;  3G2X A;  2DVI A;  1S6P A;  2U2F A;  1T02 A;  2AW0 A;  4JI6 J;  4I6Y A;  4DV3 F;  4WTO B;  4I2P A;  2F9J A;  1Z2Z A;  1BC6 A;  2X1F A;  2XMK A;  4Q43 A;  4DL2 A;  1SQE A;  1B64 A;  3C3L A;  1MRO B;  1JLQ B;  3HKZ D;  2IMO A;  1SKS A;  4R0J A;  1NM2 A;  2NZC A;  5E3A A;  4OL8 A;  4P10 A;  1Q53 A;  1P8G A;  2XQC A;  3AA9 A;  3M2R B;  3D1O A;  5THW A;  4KO0 A;  4ECT A;  4K4Z A;  2MKJ A;  3CIM A;  3R1H A;  2YQ0 A;  3GWC A;  1XMQ F;  1MRO A;  3IBW A;  2NXE A;  3J81 U;  1N33 F;  4TY9 A;  4MTP A;  2V69 A;  3DLG A;  3CMQ A;  3PJW A;  3DKD A;  1WC3 A;  2VOP A;  3W65 A;  1N0V C;  1MNE A;  4BWM A;  2HEK A;  2XSJ A;  2HFZ A;  1KWM A;  4DZD A;  4LFA F;  4Q0B A;  1HBM B;  2E66 A;  4I6W A;  2CQB A;  1RYR A;  2UVR A;  4M5M A;  4DZ6 A;  4J9L A;  3FEY B;  5J2Q A;  3PV8 A;  2QRR A;  2ZH8 A;  1FRI A;  3H2V E;  4NLU A;  2QSW A;  3IWX A;  5AJ3 J;  2DXE A;  2YH0 A;  1HW8 A;  2MKC A;  3UNY A;  5D4N A;  4YME A;  1FNO A;  1X4F A;  2C22 A;  1CLF A;  3NNA A;  4UOF A;  3UVJ B;  3QQC D;  3M32 B;  1HLW A;  3KG4 A;  2MZJ A;  5I3Q A;  3P4U B;  3GIM A;  2I5J B;  4CLL A;  4OYA A;  4B9T A;  2V4J B;  1S1W B;  1S12 A;  1U2R A;  3TAP A;  5HN0 A;  4C3K A;  3LF0 A;  2GVZ A;  4Y00 A;  3I31 A;  1MN9 A;  4NMX A;  2HZA A;  4DQR A;  4OHX A;  1EP4 A;  1TV6 B;  3KJN B;  2F7V A;  4WFX A;  2HBZ B;  3RB4 A;  1TMJ A;  4IQX A;  1KEK A;  3HF5 A;  2CJA A;  2O3D A;  4PG7 A;  2AEJ A;  1EHW A;  2KO1 A;  1TK8 A;  3DGP B;  1F5C A;  1RAB B;  1LW0 B;  4F50 A;  2W2Q P;  2C2Z B;  3W5X A;  2CJX B;  3KLG A;  3MPY A;  1Q79 A;  1NK7 A;  1NZ8 A;  5KAK A;  1RK8 A;  4DR2 F;  4PWW A;  4DPY A;  3ISN D;  2HSE B;  8ATC B;  3T41 A;  5LMN J;  1JKH A;  4OZ3 A;  1X9W A;  2RHS B;  1IKV B;  1OJ4 A;  2ZC3 A;  1B4S A;  1RQ0 A;  4L76 A;  3KLF B;  2XLJ A;  1REG X;  4F0K A;  1HQU B;  3ENQ A;  1WOR A;  3JQJ A;  3HD1 A;  3I9Z A;  3VGV A;  1TP7 A;  4OZL A;  1RWM B;  1MMD A;  1DAX A;  3HHL B;  1C4C A;  1K73 T;  8AT1 B;  2OPS A;  3D9B A;  3PW4 A;  1RT5 B;  2B9W A;  1R0C B;  4RLE A;  5JMN A;  4RW6 B;  4D3H A;  1B0P A;  4JI5 J;  4JOU A;  1MU2 A;  1IUJ A;  1RBL A;  4LBH A;  4DX5 A;  3J7Z 5;  2W4C A;  3THV A;  1BLU A;  4IDK B;  3DNC A;  2H48 B;  1FA0 A;  1UVL A;  3WIV A;  4P71 A;  3KJQ B;  2G2Y A;  4FDF A;  4USM A;  1N5Y A;  2LXF A;  3THP A;  2GVD B;  3CD7 A;  4MMO A;  4K4V A;  3SQG A;  4OJ3 A;  4RUB A;  4Q45 A;  1NPR A;  4NYO A;  2E9T A;  1B0T A;  5KFN A;  3WX8 A;  4F25 A;  1AYE A;  3DOK B;  1HBN B;  2RML A;  2Y0B B;  1F9E B;  3OFG A;  2HK2 A;  2DGS A;  2AJ1 A;  2YX1 A;  1XR7 A;  2KXH A;  4LRB A;  3O6Q A;  1CJU A;  4FYW B;  3R7B B;  1JLC B;  5CD4 A;  3N5B A;  4DR7 J;  2UXD F;  2DEJ A;  2FJB B;  1X60 A;  1B7F A;  4RNF A;  1Q16 B;  2GGP A;  2E1R A;  1U47 A;  5KFU A;  1Y7P A;  2NSB A;  2DNZ A;  5KT5 A;  3AJ1 A;  3X3U A;  1NHU A;  4ZVH A;  2EVZ A;  5KFT A;  5EX0 A;  3AOC A;  5KFQ A;  4USU A;  3EGV A;  3LGM A;  5AXK A;  3L7U A;  4DPW A;  1IBM J;  3P45 B;  3ZZO A;  1TK0 A;  1FF2 A;  3TVK A;  4NYZ A;  2YWG A;  5ETO A;  3GU0 A;  3OR1 A;  2Z2L A;  3DRS B;  4DSI A;  2F1F A;  5KG0 A;  2DIV A;  1SJ4 P;  4OYM A;  4CH1 A;  4CLY A;  4ITS A;  1TU0 B;  1WTF A;  2CAD A;  3CB4 A;  4B9U A;  2CPZ A;  4J9V A;  5D3G B;  2C2N A;  4NRT A;  3TVY A;  3BN7 A;  5K5M A;  1RLC L;  4P7T A;  4AUK A;  1VIX A;  3UN2 A;  3G9C A;  3HUL A;  2LYV A;  3CJK B;  5HL7 Q;  3G87 A;  1YWX A;  2WSE C;  1K1S A;  1QUP A;  1URN A;  3KDN A;  3UNG C;  2JEI A;  3PTW A;  3H98 A;  2FGC A;  4DCO B;  1TL4 A;  3Q8U A;  4PWD B;  4KHP F;  2MHN A;  4FXW A;  1NAQ A;  2MYF A;  4PG5 A;  5I3U A;  2C28 A;  2HGL A;  3BGL A;  4B9N A;  4K5S A;  3PJ9 A;  4TYA A;  4KGM A;  4AD6 A;  5LOQ A;  4OYX A;  1IM4 A;  2HHV A;  2DT9 A;  3V6K A;  4JV5 J;  1X4G A;  3U1L A;  2W24 A;  3FMB A;  3AQO A;  3C6T B;  1J5O B;  3IRX B;  4CNY A;  3RB3 A;  3HMJ G;  1GMU A;  1IKW A;  4HHJ A;  2E5J A;  4CO1 A;  3IR7 B;  2IJN A;  2DNY A;  5CYQ A;  3FSY A;  1U24 A;  3MEG B;  2OI2 A;  1SB6 A;  2JLF A;  2ZKU A;  1JLB B;  1P6T A;  3DLL Q;  4IQM A;  2YKO A;  3OTB A;  2FY1 A;  4I7F B;  1SH3 A;  3CED A;  1YVF A;  3KFW X;  1JXV A;  2HBY B;  1TR0 A;  2CQG A;  3T5J A;  3MED A;  1RWU A;  1IWG A;  3K5O A;  4ZN3 A;  1WEY A;  4DSJ A;  4YDD B;  3W9I A;  2HK3 A;  4M5K A;  1I94 J;  2QMW A;  3QAU A;  5AE3 A;  3IBF B;  5E5N A;  3PO4 A;  1UCN A;  2OKQ A;  4K7Q A;  4I64 A;  3M8R A;  4KFB A;  1OPI A;  4DXL A;  1O51 A;  4ID5 A;  4FPR A;  2ATL A;  5HVH A;  2R7W A;  3T5K A;  1F6T A;  2WZ1 A;  4OJG A;  3PW7 A;  3X1L B;  2J0X A;  5A6W A;  3MMC A;  4UTG A;  4EFA C;  4WBF A;  4KRW A;  3H59 A;  4QWB A;  1H2T Z;  2CPI A;  1RT3 A;  3KK3 A;  1HNV A;  3KUE A;  3FZ2 A;  3SCI E;  2QSF A;  2GHV C;  1R31 A;  2BKO A;  4JI7 F;  2P9C A;  1S4F A;  1QE1 A;  3R97 A;  3O8W A;  3I0R B;  1YIT S;  1RYS A;  1BUX A;  3RRH A;  3PRD A;  2PFD A;  4DF8 A;  2W2P P;  5T14 A;  3UDE A;  2Y0S D;  3US5 A;  1FFW B;  4PG8 A;  5CHC B;  2V67 A;  3FEX B;  3SCK E;  1RTI B;  1IBL F;  4DX8 H;  2KTQ A;  1ZBT A;  1FKP B;  3SXL A;  2ZEJ A;  3KWM A;  1PIL A;  4ZS6 A;  4R5P A;  2UV8 A;  2ERR A;  3TQ1 A;  5CYM A;  3OT9 A;  3FMW A;  3KMQ A;  4DR4 J;  3TW0 A;  4OLP A;  2G1H A;  1QY7 A;  2JWN A;  2KFN A;  2HWI A;  3M30 B;  4L75 A;  2C2K B;  2QC3 A;  2FLN A;  3CMA S;  1AZS B;  1KHV A;  1SUQ A;  2OPQ A;  2ZDO A;  5D8H B;  3W62 A;  3KLE B;  1T3N A;  3FFI A;  4L72 B;  3LAK A;  2IA6 A;  3KHL A;  3QMQ A;  4CYU B;  1N36 J;  1X5O A;  3Q2S C;  3H5Y A;  4NCG A;  4X4S A;  4LIW A;  5HRO B;  1NSA A;  5U47 A;  3K59 A;  4K4Y A;  4FS2 A;  4NI2 B;  3C6U A;  5BR8 F;  3OLB A;  4X2B A;  3I5B A;  2GJF A;  3W2W A;  2Q6C A;  1VK8 A;  1UVM A;  2HQG A;  3VVU A;  4YB6 A;  3CJR A;  5HAO A;  1TL1 A;  4WXW A;  3MEK A;  1G4C A;  3MAA B;  2XCP A;  1MSW D;  1S6U A;  2XBP A;  4RUA A;  1RWV B;  4WWS A;  4RUH A;  2C2D A;  4K0K J;  1NCL A;  1U1O A;  2VPX B;  3IG1 B;  1HWI A;  2BW7 A;  3QSY B;  1U8W A;  2X3D A;  4LF6 J;  1YG0 A;  2BX6 A;  3AQP A;  2XYG B;  1RTH A;  5HLF B;  4WKY A;  1VS3 A;  3BSO A;  2Q1L A;  4OJ1 A;  4Z7C A;  3D6F B;  1TVR A;  4J9R A;  1U1Q A;  5LXY A;  4PXD A;  4ELV A;  2IRU A;  1VJQ A;  3TYT A;  4WFB Q;  1UVI A;  4ZPA A;  3I9V 9;  3OLA A;  3OL9 A;  3KJV A;  3NEK A;  3QFW A;  1KON A;  5GAG U;  1WKK A;  3K0J A;  1NLK L;  3BGF A;  1XN9 A;  2ZH1 A;  3QGP A;  2HFV A;  2P6S A;  2J0W A;  1YJW S;  4D3G A;  4QIF A;  4IH7 A;  4Q8F A;  2HG4 A;  4A48 A;  5GAG I;  1BD6 A;  1S5Z A;  1FHT A;  2GO8 A;  3KK2 A;  3KOA A;  2KL8 A;  2H5J B;  2H51 B;  4PWU A;  3AFG A;  2FYX A;  3U27 A;  3AH6 A;  2VKZ G;  2L9N A;  4A8F A;  4AQY J;  3EXC X;  2AWZ A;  4URQ U;  2ZNY A;  1EIY B;  4GKJ J;  4OI4 A;  2YKN A;  1A9N B;  3S7R A;  4DX6 A;  1UPM B;  2QA1 A;  2M7S A;  2MJU A;  3M2U B;  5IC4 B;  4W98 A;  4AE5 A;  3CIZ A;  4WKR A;  3G6X A;  3QAE A;  3L3C A;  5F41 A;  1O6X A;  2V8G A;  2B4V A;  1P1T A;  2BJ1 A;  3WDO A;  4HI2 A;  3MM8 B;  1OY9 A;  1Y9O A;  3CCU S;  2E5H A;  1N54 B;  4ZIT A;  5A8W A;  5JVG Q;  4YY3 F;  2LKZ A;  5GMD A;  2CQI A;  2DKO B;  4UUX A;  5L38 A;  1REV A;  5H9F K;  1RAE B;  1FVS A;  3DOL A;  2YNH A;  3UFC X;  5MLC V;  1YJ9 S;  5DG8 A;  4ZP7 A;  2OSR A;  4TXS A;  2R2R A;  4DR1 J;  3HK2 A;  2VQF F;  3J7A N;  5KT3 A;  5FDL B;  3GIJ A;  4QQB A;  1KOO A;  3ENW A;  2BDP A;  4EYH B;  4O3O A;  3K17 A;  1LWF A;  2PI4 A;  2FZC B;  3PY8 A;  3I0S A;  2BBE A;  2CQ2 A;  2LQ8 A;  2AD9 A;  3KLI A;  3JSM A;  2M0G B;  1CJT A;  3SDE B;  1ZAV A;  1DAR A;  2ZVS A;  4LF7 F;  2HBQ B;  3VV2 B;  3CJ2 A;  1FCA A;  4I0W A;  4B9V A;  2HMI A;  4KV8 B;  1ZAX A;  3FDS A;  5KFK A;  4OYP A;  2CZ9 A;  3N01 A;  1Y4Z B;  3C19 A;  2VG7 B;  1U2C A;  4TU7 A;  2RB7 A;  3W63 A;  3D6M B;  1U0H B;  2Q79 A;  5F8M A;  1PGZ A;  4QR1 A;  3Q89 A;  3A4T A;  2G9O A;  3EZU A;  2OUG A;  2MTL A;  2E44 A;  2YKM B;  2PMW A;  2A6M A;  1C1C B;  4X84 A;  5E3P A;  5AXL A;  4CT9 A;  1A0O B;  1Q78 A;  5CYJ A;  1JWW A;  2BYC A;  2CQD A;  4Q8E A;  4Z7Y A;  2W9C A;  1X31 C;  1SH0 A;  3B4M A;  3A8J A;  2YWF A;  4I69 A;  2DNL A;  3NS6 A;  2J9D A;  2MMY A;  2IM2 A;  3JTN A;  3BV8 A;  3HPO A;  5HJX A;  5A8K B;  2IY5 B;  4LFC J;  4I68 A;  3MUT P;  4OHW A;  2C2R A;  5E3Q A;  5CZV A;  1EJ7 L;  4O4R A;  1S0V A;  2CG4 A;  2XY7 A;  1HHT P;  2QA2 A;  1RT7 A;  1C0U A;  1CC7 A;  4WTY A;  3RRG A;  5DDQ C;  2F3J A;  1IR2 A;  3CGI A;  1YJ7 A;  5HO4 A;  3TI0 A;  3C15 A;  3FRY A;  2ROG A;  1AT1 B;  1TAU A;  2MDA A;  1FVQ A;  4B3O B;  2X3G A;  2HFO A;  4DR2 J;  1XWL A;  4NLV A;  4DV7 F;  2AQ4 A;  3GR0 A;  1LWE B;  2XO6 A;  1EAY C;  3VTI A;  2V0N A;  4JI1 F;  2RDD A;  5KFS A;  3EZO A;  3R5A A;  2V2V A;  4OX9 F;  4DPX A;  2QZ8 A;  2V8V A;  1X4D A;  1XNR J;  2MLZ A;  1RHK B;  3MZI A;  5SZT A;  4DV6 F;  4X4U A;  1RTZ A;  1EX8 A;  1FXD A;  2KU7 A;  2WHO A;  1TKT A;  1U09 A;  4DV1 J;  3N4W A;  2AEM A;  3BGO P;  1T7P A;  1FDA A;  2BKN A;  5F8J A;  3RR8 A;  1VC0 A;  3DGV A;  4I67 A;  5B0B A;  3K5L A;  1UFW A;  3MMA B;  2DR5 A;  5IM0 A;  2D3O 1;  3GV5 B;  2IVY A;  2HQF A;  2MZT A;  2XMT A;  2B8P A;  2BMB A;  5KFZ A;  1ZH5 A;  4L73 A;  2FJD B;  3W2V A;  3DFE A;  3DM2 B;  2VH7 A;  3IMQ J;  2ZM6 J;  3P5T L;  4LF4 J;  2MZ1 A;  2AMC B;  4ID8 A;  2UXD J;  1TEL A;  3W3S A;  4WK3 A;  5EHH A;  2NLW A;  3QID A;  4ZKA A;  3CC7 S;  4UQT A;  2ZH7 A;  1VRQ C;  2VOD A;  4DMZ A;  3CVK A;  1RAF B;  3HLU A;  4DV0 J;  2ATC B;  1YZ6 A;  4Y2K A;  1QAJ A;  5HAN A;  4CT8 A;  3R6L B;  3K8W A;  3W9H A;  3UCZ P;  4W92 B;  1RT1 B;  4GVL A;  2RS2 A;  3G8S A;  4ECV A;  5EUH A;  2XS2 A;  2D1C A;  4ED3 A;  4X66 F;  3J7Z T;  2HVZ A;  1V3R A;  1H2V Z;  5LMU F;  1YJN S;  4V19 X;  3CCL S;  1KQK A;  3JXO A;  3TAM B;  3JTO A;  1T9T A;  1VRT A;  3B4D A;  5BYQ A;  2R7O A;  1HBU A;  2DCU B;  1HKA A;  1FO1 A;  3IM9 A;  2YNI B;  1EQ0 A;  2B4U A;  3G6Y A;  1Q8B A;  3OFE A;  4NRU A;  2KVQ E;  5C25 B;  4E98 A;  4RL1 A;  3OHA A;  2E7X A;  1RTD B;  5IOL A;  3MAH A;  1B7Y B;  1X0P A;  2HLU A;  1FK9 B;  4ED0 A;  3QWU A;  4LR7 A;  4PYD A;  4TQR A;  3P5B P;  2LU1 A;  1HI8 A;  5B09 A;  4KHP J;  3SIP B;  1WG4 A;  5J1P A;  3TEG A;  4DR3 J;  4BBY A;  4ZMM A;  2OEJ A;  2DB1 A;  2DTJ A;  4JI0 F;  1I1G A;  1CUL B;  1RTJ B;  3MMB B;  2W9B B;  1HD0 A;  5IWA F;  3W60 A;  2R8I A;  2HQ3 A;  3HO1 A;  4IFV B;  2O66 A;  4J9N A;  2KB2 A;  3QIP B;  4CH0 S;  3NBP B;  1TUG B;  2YNG A;  3MWB A;  1RT2 B;  4N8N A;  1A6L A;  3HSJ A;  3PIO Q;  2XNQ A;  1I3O B;  3BR8 A;  4JI8 F;  2RKI A;  4URG A;  2E1C A;  4MYU A;  1MW7 A;  4DUZ F;  1W7W A;  2VQE F;  2HVI A;  4Y2I A;  2UUA F;  2CNO B;  2FJW A;  2LLZ A;  2RHQ B;  2OJ3 A;  1IKY B;  3IC1 A;  5CA5 A;  3O3L A;  1Q8K A;  3I87 A;  3TUJ C;  3P96 A;  6AT1 B;  5HQL A;  4QCL A;  2JX2 A;  2F4V F;  3GJR B;  4U95 A;  4CP5 A;  1S1V A;  1TL3 B;  4GMK A;  1LW2 A;  4A8X A;  5B0F A;  2MST A;  5L1I A;  4KGK A;  2XNR A;  3OTO F;  1SC4 B;  3HHE A;  4DU7 A;  3WBZ A;  2GQC A;  1PJ7 A;  2CG8 A;  3CCV S;  1BXN A;  4RWW A;  1U4B A;  5KOX A;  3MFI A;  4YB7 A;  3CXC R;  3QT6 A;  4IR1 A;  1F1B B;  2CPH A;  3JSR A;  1NDC A;  1WHY A;  4YR0 A;  1Q7L B;  2Z0G A;  3VR1 A;  2DCL A;  2EPI A;  2QO3 A;  3WIU A;  2XMU A;  4I56 A;  1CJV A;  2IAJ B;  4A8K A;  3FNN A;  4UOC A;  4TY8 A;  4OI2 A;  2B4P A;  1HNI B;  4ZLP A;  5GMK a;  4ZN1 A;  5ETN A;  1IKX B;  3TO8 A;  2BQ3 A;  1SL2 A;  3QJL A;  4WP3 A;  1FRM A;  1NRK A;  2BJ9 A;  4L6V 3;  2UUB J;  3CTR A;  4EZ9 A;  2ZHO A;  3G8Q A;  1GMW A;  5KG7 A;  4RKU C;  2BQU A;  4CLP A;  2QTW A;  3Q24 A;  1YJV A;  1HQE B;  4WPA A;  2IAJ A;  4N77 A;  3SSR A;  2AX1 A;  3DOM A;  1U8S A;  3GFH A;  3GCX P;  3G4S S;  2HKE A;  2MXY A;  1SC6 A;  2HWT A;  2VG5 B;  5H9F J;  4CM2 A;  3QGI A;  5C2C A;  4HDG A;  2HGM A;  2I6W A;  2Y8W A;  3TZX A;  2NXC A;  2KT5 A;  2R2T A;  4LRE A;  3L09 A;  3CCM S;  3CC4 S;  2IMW P;  2OPP A;  4ZOS A;  2XCA A;  7FDR A;  3W5Y A;  3MCO A;  2OTL S;  3QO9 A;  2ZKT A;  5DDP C;  3CDW A;  3T3F A;  4Q2L A;  4ICL A;  3IAS 9;  4LFB F;  4R8U A;  3UQS A;  2JC0 A;  3JAM Y;  2DHH A;  2CPD A;  2G0J A;  3WQP A;  1C4A A;  4B3R F;  1WHV A;  2K1R A;  2H65 B;  2QL5 B;  3M4X A;  2CQP A;  1VQ9 S;  4GVB B;  2I0X A;  1VQ4 S;  2Q43 A;  5GME A;  5K8O A;  5DJB A;  2QT7 A;  1IJE B;  4AT1 B;  2POK A;  3CCR S;  2WB1 D;  4PUO B;  5L9N A;  2Y1I A;  1FE0 A;  1RWW B;  2B9Y A;  4OQJ A;  5IC6 B;  5LSR A;  4TLQ A;  3AT1 B;  2LQ5 A;  1T9V A;  1MML A;  1UW4 A;  3UW1 A;  1WOS A;  4XDD A;  2VIC A;  2HRU A;  3LTO A;  2PT0 A;  2IM1 A;  3HVW A;  2EG2 A;  4QW8 A;  3DDN A;  3PX0 A;  4B3S J;  2WSF C;  4PG4 A;  1S1X A;  3ITH B;  4Y2C A;  1WHX A;  5B0G A;  2NXJ A;  2DR6 A;  2KT3 A;  3VZH A;  2KRB A;  3FQL A;  4PXC A;  2YY3 A;  2NZ4 A;  4Z2X A;  2YQ3 A;  4JUZ A;  1F9H A;  2RD5 C;  2IC3 B;  5KG5 A;  4JV1 A;  1NU4 A;  2FZG B;  3QZ7 A;  4ZP9 A;  3DXB A;  5BYS A;  2YWH A;  1GT8 A;  1FKA F;  3BO2 A;  4KBI A;  3EE3 A;  1CS4 B;  3CD5 A;  2XO7 A;  4EI2 A;  4KHM A;  2W7P A;  2IA0 A;  2FUG 9;  3M6W A;  4WP9 A;  2WVB A;  4F8R A;  1HMV B;  4JI2 F;  1DLO B;  4NLO A;  2PSZ A;  3T5H A;  1BQN B;  1DQA A;  4FP9 A;  4X4V A;  2KXN B;  2IRY A;  4NLS A;  1TKZ B;  1U6Z A;  1HHS A;  1TKX A;  4PPD A;  1SXL A;  1AA1 B;  2XMA A;  3UI3 A;  5KFE A;  2BAN B;  4ECX A;  1EAR A;  2B6A B;  4FXD A;  4DBQ A;  1GMW D;  1VLY A;  2IBO A;  2JH3 A;  1N32 J;  3AA8 A;  4DS5 A;  3MTK A;  3FBF A;  1JXL A;  4CRJ A;  4J9S A;  2VJV A;  4A8Y A;  3UDL A;  4QBU A;  3AXM A;  3OJU A;  5IXU A;  3GQC A;  2G1D A;  3MCM A;  3L4B C;  3MR5 A;  1M0S A;  3DRP B;  4F3Q A;  2VA2 A;  4LSL B;  2DH7 A;  4YB1 P;  2HHX A;  1WKJ A;  1CEZ A;  5A8R A;  3B6B A;  3OSP A;  3CNQ P;  3GB0 A;  1GTH A;  5KFY A;  3LGH A;  4YY3 J;  2Z2Z A;  3OSN A;  1HPZ A;  4XTT A;  1GFW B;  4QIG A;  1RHR B;  3D4J A;  5D15 A;  2XG8 A;  3MEC A;  1JNZ B;  5ETQ A;  3ISN C;  2FY8 A;  2B9E A;  2UUC J;  2I8E A;  1OPZ A;  4DS4 A;  1NKE A;  2R7S A;  2ZZN A;  2BE2 B;  2RF2 A;  4AL5 A;  2ASD A;  3TP2 A;  2VB6 A;  2JZ5 A;  1T94 A;  3W8G A;  3CJQ A;  3BPS P;  3A8E A;  1KQF B;  3P49 B;  1ZM2 A;  3MM7 B;  2R3V A;  3KG1 A;  1VQS A;  4FPI A;  2J7K A;  1V6H A;  2VFU A;  2IJF A;  1ICE B;  3ZTQ A;  2WSC C;  3QYY A;  2DRD A;  1I6J A;  4RU2 A;  1J2V A;  3PHT A;  4IFY B;  2XMW A;  4ZLN A;  3LAL A;  7FD1 A;  2YNF B;  2DGQ A;  3VF0 B;  5CD4 H;  3M05 A;  5KT2 A;  4ED8 A;  3V4I B;  3N6L A;  3R3T A;  3R8Y A;  2FHO B;  1JLF B;  2HRT A;  2OPR B;  3Q23 A;  3CWJ A;  1NK5 A;  2RU9 A;  2MLX A;  4EBE A;  4ZPW R;  3C16 B;  2DNM A;  4K4U A;  3SFU A;  1NJW A;  2E5I A;  3D66 A;  2EBG A;  2OEK A;  4B3M J;  4M5D B;  3PAC A;  4UZB A;  3E51 A;  4O0N A;  1V3Z A;  2BM1 A;  4J7C A;  1KN6 A;  5D0R A;  2KG1 A;  1B70 B;  4ED1 A;  4UT4 A;  3IA0 A;  4WII A;  5IV3 A;  4WJB A;  2EW9 A;  2WOM B;  4TU8 A;  4KKO B;  1WI6 A;  1Y0H A;  5C42 A;  1VQO S;  1AUD A;  4YEA A;  3VCD A;  1RXO B;  3IGN A;  5FD1 A;  4TLR A;  1EKS A;  1JK9 B;  4IO9 Q;  2LXI A;  2N7Y A;  2C3O A;  5EDW A;  4P6Q A;  1NK9 A;  1UTA A;  1Y5N B;  2E7V A;  2V94 A;  3EJM A;  4OX9 J;  3ET6 A;  2A10 A;  3BH7 B;  4EMD A;  2BZ2 A;  3JQK A;  4RW4 A;  3BYP A;  4FKY A;  2CNN B;  2HHH F;  3DRR A;  2GV1 A;  3GII A;  4FNH A;  4LF5 F;  2QA4 S;  4QYZ J;  4DR6 F;  1T8E A;  3TUI C;  1ZPW X;  2APO A;  2HHW A;  3RBD A;  2OFG X;  4ZK7 M;  4C0H A;  3LP1 A;  2Z57 B;  2AGP A;  2IYG A;  1RIS A;  2M5Y A;  3A8I A;  3PO5 A;  2Y9H A;  2H1Y A;  5DLG A;  3NAI A;  1PBU A;  1X5S A;  2L48 A;  4DPO A;  1S79 A;  4WYW A;  4CDI A;  1YGY A;  3FSI A;  2GQQ A;  4I2Q B;  2YVS A;  4HI1 A;  4O44 B;  4R25 A;  4QPT A;  3RG6 A;  1BGX T;  1H7W A;  4MIA A;  3JYT B;  1LWC A;  1RT6 B;  2ZNZ A;  3DYA A;  1YRX A;  4K2X A;  2E1M C;  4ETX A;  4B3T F;  1Y3J A;  2W2M P;  2VFR A;  2BQR A;  3T1H F;  4OYW A;  1N88 A;  4M5H A;  2KJW A;  5L1J A;  4RW9 A;  2WVD A;  3G82 A;  5L1K A;  4HHH A;  3KLV A; 
#chains in the Genus database with same CATH homology
 2XQC A;  2XMA A;  2XO6 A;  2VIC A;  2F4F A;  4ER8 A;  2VJV A;  2VIH A;  2F5G A;  2XM3 A;  2VJU A;  2VHG A;  2EC2 A;  2A6O A;  2A6M A;  2FYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...