2F5GA

Crystal structure of is200 transposase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
130
structure length
130
Chain Sequence
b'ELKSTRHTKYLCNYHFVWIPKHRRNTLVNEIAEYTKEVLKSIAEELGCEIIALEVMPDHIHLFVNCPPRYAPSYLANYFKGKSARLILKKFPQLNKGKLWTRSYFVATAGNVSSEVIKKYIEEQWRKEGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transposase, putative
publication title Crystal Structure of a Metal Ion-bound IS200 Transposase
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Gene regulation
total genus 37
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2f5gA00
2XQCA 2VICA 2VHGA 4ER8A 2VJUA 2A6OA 2XO6A 2VIHA 2EC2A 2F4FA 2XM3A 2VJVA 2A6MA 2FYXA 2XMAA 2F5GA
chains in the Genus database with same CATH superfamily
1RCXB 2DXFA 1EQ0A 3M6UA 4ICLA 4IRCA 3GIRA 2W2PP 2MQ8A 3LP2A 2GVZB 4GVLA 4X62J 4FVMA 5EHHA 3MPYA 1G2EA 2YKMB 5E3QA 1Q7YT 3OR1B 3G4SS 5D0GA 2MY7A 3DU6A 1ULRA 4FKYA 4DL2A 2RHSB 1HD1A 2ASYA 3QSYB 4KV8A 2MQNA 2FHOB 4R5PB 1VLYA 4CH0S 3CMAS 3QFHA 3R7BB 5HBMA 4ZJLA 2XGQA 3C66A 4LRCA 4LF5J 4TN2A 2GV1A 1NJYA 4WE1A 4AQYJ 3BDEA 3BGFA 2DGTA 3C14A 2AJ4A 4YS2A 4DLEA 1RT4A 1GFWB 2PIIA 3K8WA 1H72C 2UU9J 1C1BA 2XNQA 3DRYA 3VZHA 5D6GA 3JQMA 4NLPA 3EZOA 1TKTB 4FYYB 4R8UB 3BJYA 5ETRA 5KFQA 1S0OA 3PJWA 2HNZA 1NDLA 2FLLA 4KPCA 4J37A 3HVTA 4CH7A 3B6BA 3PCOB 5E7OB 2ZM6F 3EZ5A 3OJUA 3TRGA 1IXKA 5L8RC 3CTRA 2ADBA 2KZZA 2AJ2A 3QJLA 1C1CA 4FXDA 2WW4A 4K2XA 2EI5A 1K73T 4J9KA 2M9KA 4ETZA 4KH1B 3BYPA 2HHHJ 3IGVA 5H9EK 3M8WA 2XMWA 4DSKA 4M5IA 3CJSA 3OR2B 3LGMA 4ED0A 1RK8A 2NLWA 3VGSA 3PX0A 4WJBA 2IJRA 5CH7B 2VG5B 4DOZA 3GJQB 4NZ0A 2SXLA 4CO2A 4IUFA 4CP5A 2A3JA 3EDRB 3ETMA 4RWWA 2DHGA 3F41A 1NK5A 2WTFA 2DPJA 4FYWB 4JV5J 1U8SA 2HNYA 3FCHA 4ZVEA 1CJUB 4C48A 1D09B 2YQ1A 2YPZA 2W8KA 4GC7A 2QYCA 2OFGX 1EHWA 3H59A 4H4MB 3IBCB 1HNXF 1AUDA 5D3GB 1HI1A 3OL9A 2AHOB 2IIHA 3MEEB 1T9YA 5KG2A 5KG1A 5AJ3F 3LP0B 4X64F 3DRSB 2LEPA 4GO5X 4WP3A 4DQQA 3DOMB 4DL3A 2B6AB 2DT9A 4QWCA 2YKAA 1S1WB 3KLIB 4FBUA 2C3UA 1SKUB 4B3SF 4ED7A 2OSQA 2ACYA 1K1SA 5IZHA 2IBKA 4LVOP 1I5OB 3KFWX 3R27A 3R8YA 3AXKA 2KM8B 3EYZA 3QZ7A 1RBOB 3PR4A 3U02A 5KG7A 1YJVA 2WB4A 5KFDA 4MK9A 3KG4A 3RRHA 3KK1A 3NXZA 3AAWB 3D0HE 4J9LA 4K4WA 4X84A 3LO3A 4WWSA 3MR3A 3IFEA 3PNIA 4KGZB 3HHDA 1JLAA 1EETA 1RQ0A 1NO8A 4ED1A 2EKYA 1SIZA 1FXLA 1AYEA 1VQYA 4YB5A 4RW9B 4MTPA 3KHLA 1K0TA 2C3PA 3GV8B 4K0KF 4MFBB 3RU0A 2A6MA 4JI3F 5CZXA 4DV4F 4L72B 4N41A 2Q43A 3K7RA 4ANCA 4O23A 3VAHA 2ZKUA 2VQEJ 4Y2CA 1IBKF 2RDDA 3TA1A 1HQ2A 2L9NA 2QO3A 4RNFA 2VFRA 4WCEQ 2F3JA 4MKVA 5H9EJ 3PYDA 5FIIA 1KS2A 1FD2A 4ZP6A 3BN4A 2RSQA 3D6HB 1KOHA 4CYUB 3V81A 2YY3A 2QE5A 3BDPA 2RRBA 4A8MP 3D66A 4J9SA 3OFHA 1WDTA 3CO9A 1Q95G 5KG3A 1LW2B 3A8IA 3CD0A 4NLVA 1S1TB 2LEBA 2VKRA 2PDAA 3MEKA 2YKNA 1F60B 8AT1B 4J9RA 4P6QA 1SBRA 1GXUA 3T3FA 3CCLS 3NCPA 3TA0A 3QATA 3U1MA 3OTDA 4A46A 1UVIA 3L9ZA 2KM8C 1T94A 1CJKB 2HEKA 2BUNA 2BJEA 2V67A 1Q8IA 2HHTA 2ZM6J 1S0MA 5E5NA 3MM6A 4YB7A 2HLTA 3HFVA 3U1LA 3CD6S 3KJQB 5L38A 3D4JA 4OZ1A 3NKYA 3AA9A 4MK7A 3DM2B 4RNMA 1FA0A 3AXMA 2OD4A 1U49A 5KFYA 3C16A 2HBZB 4X4RA 1XNRF 2CPZA 3KJVA 3RR8A 2M88A 3QAEA 4M5MA 4N47A 3I5AA 3MEGA 3SSQA 2HFVA 2ROGA 1RYSA 1H2UX 4ILMA 2W01A 1KVKA 1LOUA 3GPAA 3MPVA 1T03A 3Q89A 1LFWA 5AXKA 1ROFA 5LXYA 1IKYB 2RF2B 2QJ3A 3GP9A 4KFBA 3L7OA 1BQMB 2AGPA 3IG1B 1G4CA 5HI7A 4LFAJ 1M5KC 1IM4A 2GHVC 3A1YG 1HNXJ 3BSOA 4Q0BA 3H5YA 3WQPA 3DC2A 5CZVA 4O0NA 1OQ3A 2ZWOA 2R7XA 3JAMY 4GVBB 4X64J 2ASJA 3S01A 1K8AT 2ZDOA 1IR1A 2L48A 5F3ZA 4ZP8A 2DISA 3QO9B 1DTTA 1T0TV 1XR6A 3CCVS 4DV7F 3FMBA 3AA8A 2IJFA 2H65B 1RTHB 2RVJA 2WSEC 1S9EB 2BANB 1Q16B 1RA7A 2QLJB 5FLXY 5KG0A 4OQJA 3RAQA 5CYQB 2PI5A 4DV5J 1AFJA 2CYYA 4DV3J 2B9WA 2RB7A 3HF5A 5FJ4A 2YX7A 2CPIA 2JLEA 3CD5A 3OVSA 5KFOA 2ZHAA 2KKHA 2XHCA 2RKIB 4CNYA 2AWZA 4P75A 4GRSA 4BC7A 4LF7F 3IM8A 3FKBA 1N33F 2XY7A 2IMWP 2JZ5A 1S0VA 1OJ4A 1GMUA 3P5TL 3CCMS 4K0KJ 2LMIA 1X0PA 4YEAA 4NCBA 3CCRS 2HYIB 4JI3J 2DNYA 4E0DA 2GVDA 2ZH4A 2IVMA 2MY8A 5C7PA 1QAIA 4HL9A 1UMJA 2KVIA 4ZVOB 3CJ8A 1NKBA 3V4IB 1IBKJ 4DV0F 5K5MA 1VBZA 1XQIA 2IPOB 2LU2A 1LXJA 3I6PA 3DLBA 3IO1A 4IFYB 4ZHRA 2ZZTA 1FWKA 3T1AA 1W26A 4AE5A 2G1HA 2V4JA 2XMMA 1GMWA 2V9KA 2XZTB 1LK5A 4ED6A 4OHWA 1JKHA 1F9HA 5HQ8A 3E8OA 5GMEA 2YNIB 4KE5A 3A8EA 4B9VA 4K4TA 2BW7A 3D28A 2IM2A 4LSNB 3WX8A 2POKA 2CPDA 1U48A 1HNZF 1UL3A 2AX1A 4MJKA 3RBXA 2HNZB 1X4AA 1FHTA 2HW3A 1RHKB 3HHLB 1P9QC 3DLLQ 1YLXA 1RT6A 4J9PA 1SI9A 5D4NA 1XNQJ 3GONA 2MZQA 3OQ2A 2GMHA 2XYHB 2PA3A 2O1PA 2ZH6A 4P2FA 1YRTA 3DGVA 3UNGC 1LWFA 1D1UA 1BC6A 3MEDA 1RAOA 3KOAA 1NM2A 2LQ9A 1Q4RA 1RHQB 4Y34A 1HBUA 3N6MA 2BACA 2OMOA 1QTMA 2GQQA 3MTKA 3L4BC 4OHXA 2D9OA 4URSA 4PG6A 3SEOA 4ILRA 3PDNA 5F9NA 5EWGA 1PIEA 4IOBA 3T9ZA 2XEXA 1A6LA 1T05A 4UZCA 2VASA 5E3CA 2DRBA 2MB0B 2QSFA 1B7FA 1XMOF 4K8RA 1L5UA 3W2WB 4NA2A 2D3ZA 4DSIA 2E5GA 2XQCA 1FXRA 4KT0C 3FQLA 3AD9C 2IC3B 2B5JB 1OSDA 2I5JA 5BR8F 1PAUB 1WJ9A 4PKDB 2HNYB 5EWFA 4F04B 4WIIA 3T6JA 1UJ5A 4NLYA 2OEKA 1HBMB 1RTJB 4Q44A 4KBIA 4DS5A 4DR4F 4CLZA 1MWYA 2BQ3A 2ZE2A 4KIAA 3TJ9A 4ID8A 1SH2A 2UUCF 2AIRB 1R8BA 1HMVB 3ICLA 4YR2A 5KFWA 2DNZA 3NBPA 4RW7B 1N8RT 2CAJA 3Q2SC 1FDDA 4HI1A 2EXUA 5HAOA 3RB6A 1FJEB 2DHXA 4J9QA 2EFOA 4UQGA 4A8OA 2JOQA 4LRAA 3W65A 2MLYA 5A76A 2ZZNA 4KSEB 3H98A 4KKOA 5D4LA 3J7YI 1ZYQA 2L08A 3R1LA 4P7TA 4M5JA 4TU8A 3BM7A 4IO1A 2K3IA 2E1CA 2DGQA 1PBUA 2N4DA 3KK1B 3TANA 4PXEA 3H25A 3BPDA 4K50A 5KFFA 2ZHBA 4DPYA 1TL7B 1KTQA 1N5TA 3MM9A 1ZBTA 2V2QA 1UP1A 3M8ZA 4CTAB 2XY6A 1I1GA 1V3SA 4I69A 1VQ7S 1R8PA 1M5VC 3DNCA 1IQTA 2KT2A 4LF7J 2B0GA 3JTNA 4UOHA 2J6SA 2ZH9A 4YDXA 3HZGA 1MG7A 2B9EA 2DXEA 3Q8RB 3G6ES 3WHIA 3G9CA 5LOQA 1BWVA 3T5HA 2HHUA 4DBQA 2J0XA 1KQKA 4FXWA 1FF2A 2B4UA 3MM5B 4M8LA 1PGZA 1V9OA 4DEZA 5K14A 5M2RA 5F9LA 3QT5A 4ZPDA 4B9NA 1WHXA 2GQ2A 5I42A 1U02A 3N9UC 2DEIA 3T19A 2YQ3A 3OSNA 1MROA 1FNMA 4C8LA 3CIMA 1RT5B 4QU7A 5D0RA 3SZ2A 1D0EA 4NASA 2V4QA 1TL5A 2WHOA 4YR3A 4DFMA 2HFNA 1MN7A 4HI2A 5E41A 2D1CA 5KFLA 3ENAA 1PO6A 2V5HG 3H2VE 1HNZJ 4Y65A 2F8HA 2F8EX 5HANA 4I67A 5GAHU 3EDQB 4ZS6A 3EICA 4NYOA 2QC3A 3C15A 4NL5A 4JI6J 4DSLA 2CNNB 2H4YB 2F4FA 4MIBA 4DS4A 4H4OA 4PWUA 3PIPQ 4DUZF 1FKOB 3H2UB 3V5RA 3SV3A 1Q82T 1H3DA 1WF0A 2ZH3A 2MLXA 4DR7J 1VRUB 2HK2A 2C3MA 5LM7E 5DS7A 3W8GA 4GMKA 5KAKA 1KC8T 3HM9A 1CULA 2AEJA 1NSPA 3W60A 2BR0A 2KJWA 2W9CA 1RTIA 3QRPA 4MKYA 3EGZA 3KUEA 5J2QB 3GG1A 1ZZFA 2MKHA 4ILLA 2DGXA 3FUYA 1RWKB 5T7LA 5BR8J 4WTYA 2ZHOA 1IUJA 1Y11A 4WU2A 1R6YA 4UOFA 4OX8A 4AL6A 1KTVA 2M0GB 5D77A 4BWMA 1SQGA 1HHTP 2FPHX 2E5LF 4WZMA 3HP6A 4DR4J 2YH0A 1T3OA 2CFXA 1XBWA 1ZM2A 2UUCJ 3DKDA 3CNQP 4QWEA 3JSMB 2K1RA 4HH1A 3CE8A 1SPBP 3D0IE 3IR7B 1IJFB 1WF2A 1HR0F 4DQPA 1SQEA 3DLJA 1Q5YA 2XO7A 3P45B 1YVFA 4ZPCA 2HVZA 1UWAA 5DGAA 2DXDA 3MHYA 2D3OR 3UI3A 4ZLNA 2DIUA 3I31A 2MQQA 3PW4A 1V3RA 4C0HA 2RE1A 4ZMMA 1QAJA 2MZ1A 1NHUA 1RWWB 4ID5B 2NQPA 1Y7PA 3MM7A 3UE2A 4WTOB 4B3TF 4PQUB 2Y1JA 4O3PA 4Y28C 5J2NB 2JHEA 4DR2J 1QE1B 1R31A 3DRRB 3IBFB 2V63A 2M2BA 2YNFA 3PW0A 1PYOB 3VGTA 1GX5A 2VONA 1BD6A 1UFLA 3QLHB 4DSJA 3BR9A 5A8KB 1S79A 3NRBA 3D7SB 4K7QA 2AJ0A 4NZ6A 2W2NP 4C11A 3ZZTA 1SC1B 1UETA 2V8HA 3KLFA 2VUGA 4M5DB 2LLZA 1Y3KA 4RUHA 3TP2A 5ETPA 4K4SA 1RISA 1YZ7A 2FJAB 1YBUA 5J2PB 4CH1A 3IRXA 2I8EA 2AX0A 3MGJA 3DN9A 1MU2A 2DYAA 4UOCA 4ERDA 3UN3A 3C6UA 2DY9A 6FDRA 1HPZA 3PACA 4DFPA 3OL7A 4G6VB 4U9RA 4G1IA 4K2JA 2MZTA 3TEHB 2R2SA 1K9MT 1TK8A 3NL0A 4F3QA 4YUDA 1FK9B 4DR5F 3ZZRA 1XC9A 2MQOA 3SCLE 1YSJA 2R4FA 3TNVA 4EK2A 4RUAA 3ZTPA 4M5HA 4EMDA 1YJNS 5DM7Q 1HKAA 4OYZA 5ETOA 2Z4PA 4X66F 5KFMA 3THVA 1NK7A 3LPEA 3MMJA 2XMTA 1DAXA 1RWNB 4EBDA 3ISND 1KLNA 2R2UA 4OJGA 4USTA 1KVJA 2R7WA 2KVQE 4DUZJ 4MAKA 2NPIA 1M5PC 5L9XA 1NDKA 4USJC 2DNMA 2XS5A 4ZP7A 4YR0A 2VU5A 2ZBIA 3RYLA 3CJKA 1BWEA 3QT6A 4U95A 3THTA 4XPEA 1S7HA 5A2QY 2ZZMA 2DNLA 3AD8C 4B02A 4ELTA 2K06A 2UV8G 2J0WA 4EGLA 3SXLA 7FD1A 1N88A 2V8GA 3HK2A 4HACA 3GG0A 3DLGB 5EX0A 3EVWA 3EX7B 3VGUA 4TY9A 4NRTA 2ATCB 4NLDA 1ZAWA 1NK8A 1Y3JA 2U1AA 4ZN3A 2GS8A 3HVWA 3RW6A 1CJTA 3UD4P 1DLOA 2PFDA 3ZZ0A 1Y9OA 2W2QP 1R7IA 4NXMF 3QT7A 3MUTP 1IN0A 3O6QA 4QR1A 3MMCA 4RW4B 2MJUA 3QRQA 3WX4A 3KK2A 1H6KX 4NLWA 1BY9A 4WPAA 4DSFA 2Z2MA 2FJVA 3I96A 3NY0A 4MIAA 4CLUA 2HQIA 1WWHA 2KTQA 3AY0A 2J9DA 2E1AA 3H7HB 1U2CA 1UW9A 4DQRA 1RT2A 1N56A 3CUNA 4ZVQB 4LFBF 3W2VB 2DIVA 1NBEB 2WW8A 2J9EA 3GIJA 1R8HA 2EEYA 2HHXA 4KKOB 2VG6B 2F9DA 4CM0A 1X5PA 2VDHA 3GV7B 1UVJA 4QIWD 3ZO7A 5EWEA 2Q6BA 1HNWF 3J81U 2LCWA 1KHVA 2MYFA 3LANA 3S8SA 4F0MA 4B3TJ 2Y8WA 1UWBB 2EC2A 1NMEB 1RKIA 2DRDA 1WC1A 3DOKA 5ETSA 4CLFA 1S1UA 6AT1B 2ZH7A 3AOAA 1B0VA 4PYDA 1UPPA 1KSPA 2WBMA 1GMWD 1KD1T 3CCWA 4JYAF 2LKZA 1B7YB 4QIVA 2WONB 4WYLA 3CULA 2HVDA 4FS1A 2IM0A 3QJJA 4F36A 1HW8A 4OJ1A 3G6YA 4E98A 2G0IA 4QBUA 1HBNA 4L6V3 1APSA 4DUTA 1NJIT 3HD2A 4JI7J 4KGXB 2MZJA 3KYLA 4LIRA 2F9JA 1X9MA 1TZ0A 1WTBA 4EZ9A 3HSZA 1JXEA 2DNOA 2R8JA 4ED4A 1RT7A 1W25A 2IAJA 3L09A 2OPQB 4X65F 4J9OA 4F7VA 1FJ7A 4CT8A 2V0NA 2HBQB 1FRJA 4PXBA 1GT8A 5K8MA 2XS2A 7AT1B 1NH8A 2R9LA 1YBAA 2B4VA 1SUQB 1NJXA 1HWLA 4DR5J 1T9UA 1SV5B 4HDHA 1JLCA 2LVWA 3BBCA 2NPFA 4LFCF 4C4WA 1RT3A 4ZCIA 4ZJOA 4QJVA 4X66J 2DHAA 1C0UA 2G1DA 4Y0FA 1UA1A 3WDOA 2OO4A 4ED5A 2YNGB 2L3MA 2QMWA 1AUSL 1H73A 2OAUA 4R0EA 3LWLA 3DU5A 2XSJB 1AT1B 3DYAA 5I3UA 3QWUA 4QIFA 2BJ8A 1BGXT 1S10A 2CQBA 3MAAB 5DDQC 1FFGB 1HWJA 1FFWB 3BH6B 2IM3A 2DH8A 4IH6A 3GSIA 2LXFA 1FJGF 2C2MB 1IBMF 1F9EB 3TI0A 2BYCA 2WAQD 1AXQA 1EAYC 5BYQA 4KH0B 1IKXA 1SXLA 1WHVA 1RLDA 2NREA 4P9SA 3MECA 4WP9A 4LRFA 1QM9A 4K5SA 4G3IA 5AT1B 1CC7A 1MW7A 4USIA 5IC4B 1VIXA 2W4DA 2JLGA 3RAMA 4D3GA 1VQ6S 1IKWA 4CT9A 2OPRA 3W5YA 2IYIA 2ZJPQ 2GGPA 3BQ0A 4PABA 3JSYA 1VJQA 1RUSA 1XN9A 4C3LA 3W7BA 2KXHA 1U1MA 4NXMJ 3D1OA 5K20B 4S0MA 4TYAA 2G2OA 2KXFA 1WKKA 1NUEA 4NMLA 4RBTA 4LF2A 4WFYA 5IXUA 5KFBA 2XM3A 1SC3B 1X5TA 1PCAA 1FVQA 3GJTB 3K5MA 5CD4A 1U1RA 2ZD1A 2VF3A 4URQU 4WKYA 1TL3A 2HZVA 2AV5A 4YDDB 4DFJA 4D3HA 3FMWA 5ETVA 3DGPA 3DI6B 2ZOMA 4J90A 5J2MA 4NXNJ 2MKJA 4OZNA 3WZ0A 3QIDA 4AXIA 1OY8A 1U1LA 4JI0F 5DG8A 5IWAF 4F0KA 5G0RB 2BW2A 1OWXA 5C5JA 3Q8PB 1U47A 2CADA 4K4YA 5B0AA 4A8FA 4LBIA 3D6FB 1FWPA 3R7NB 2F40A 3UDVA 1KQGB 1KKHA 3QNWB 1HNWJ 4TU9A 3LAMA 3MCOA 3O3LA 3CPWR 3RRGA 2V50A 1E6VA 1JLQA 3ZTOA 5HROB 4OYIA 5C25B 2FLNA 1E6YB 2QLFB 3VHQA 2VBYA 3BYRA 4ALZA 4AXJA 4NWBA 3N79A 1O6XA 4M5NA 4URGA 2B9YA 1VQLS 2OIHA 4I7FA 1F6TA 2RS2A 3UW1A 5C24B 3EZUA 1FKPB 5KFZA 3KXDA 1TL4A 5GADI 5B0GA 4F4KA 3EJMA 3CD7A 5GAEI 2I1RA 2IA0A 4C11B 1N5SA 5DRKA 2GVZA 4EYHB 2R8HA 2HKEA 1AB8A 4FF1A 4IG3B 4XDCA 2CQ1A 4UUWA 3G87A 1CS4B 1NZ8A 2CQDA 3OR1A 4RU2A 4C3MA 1WC6A 3VZIA 4JI8J 3DDNA 2A6OA 1TV6A 1VCTA 1KQSR 4LBHA 1WKJA 1S72S 4OX6A 2P6SA 3E01B 2KZMA 2XLJA 2Q3PA 4B9MA 4R5PA 5GAGU 1SH0A 1JQGA 3J81j 1I3OB 2BBEA 5L1IA 3LA0A 4DL6A 1M90T 2CNLB 2KHDA 2JC0A 1X4BA 2OPPB 4OI2A 5HJXA 4YFUA 2MQMA 2BE2B 3SQGB 2XWXA 4NLGA 5DG9A 4IH7A 2HWTA 4CCHA 3PVXA 1QUPA 1NK9A 2WSCC 1R0BG 3BB5A 1Q78A 3UR3C 5LMNJ 5F8NA 3N28A 4CLWA 1NHKL 3G96A 1S59A 3T5JA 3GYGA 1TKTA 3M8PA 4LF9F 2FZCB 2Z2YB 4R8UA 5CD4H 1LWCB 2RS8A 4B9TA 3MDFA 1VC0A 3NMAA 2OD6A 3QSIA 1F9FA 3HDSA 2QV6A 1IBMJ 2FLPA 4OIXA 2KB2A 2PT0A 1PYTA 1S5ZA 2WOMB 4PG7A 2HVHA 3SQOP 5JVGQ 4ZLLA 2E5HA 5B09A 2W4PA 4RBUA 2OPSB 3OBIA 2Y3YA 2CNKB 1WI6A 4Z7CA 4I6YA 1RTDB 2RDJA 3PHEA 2V2KA 4DV6J 3IM9A 4CLKA 2ZVIA 4PG4A 1N0VC 2UVUA 4A47A 4ECWA 2M7SA 3PY8A 4P71A 4ZDNA 4QW8A 2YKPA 1JJ4A 2ZEJA 3OR2A 4O3OA 4HTJA 2QX0A 5E3RA 4Z37A 3MM8B 1SJRA 3CDAA 3CJQA 2CPYA 4J5OA 3EPGA 2VG5A 3ILJA 3HFZB 1G6BA 4ECZA 3G82B 1F3FA 3ZTRA 4JI2J 1RBAA 3DHWC 2VOOA 4HVZA 1CJUA 4L75A 1U45A 3NS5A 4NLXA 4OYBA 5LJ5Y 2DO0A 2IY5B 4H4MA 3T9NA 5D3GA 2A0FB 2Y1RI 3FBCA 1J5OB 2VQFF 3MEEA 4EO6A 3FBBA 4W92B 3ZZZA 4ZIWA 4JI0J 4KPYA 5IWAJ 3LP0A 5KG5A 3KDNA 3KLGB 2H9ZA 3DRSA 1WC0A 1FKAF 2X1FA 3DOMA 4FYVB 2J7UA 2B6AA 2BE7D 4DV1F 2DO4A 2M52A 1YWXA 2WBRA 3W5XA 3T6BA 1S1WA 3KLIA 2GJ2A 1UJ4A 2EW9A 4USKA 3EGNA 1VQNS 3CDEA 3B54A 4IOCQ 5E2QA 2FJWA 1R6VA 3Q8UA 3GIKA 2QFIA 2E7VA 1FRMA 2P9GA 2KJVA 2I0XA 2WVFA 2XWYA 2BZ2A 1FD8A 2AGOA 2HRUA 3PKYA 4QR2A 4HLBA 4ZPAA 1OPIA 2UUWA 2FHJA 2B3TB 1XIQA 2E5JA 3D6TB 1N5YB 3O1LA 4ECXA 3R6LB 4X62F 4F4WA 2ZFHA 1ZM3A 4OI1A 3JYTA 1QVFR 2HQ3A 3Q2TC 3PG9A 3WC0A 3VVTA 2HGLA 5L1JA 2VG7B 2DHHA 1RYRA 2LDIA 4RW9A 3OFGA 1VQ4S 4J91A 2MSSA 4HH0A 4F2RA 1KONA 2GFFA 4MFBA 1BMQB 3N0VA 3ISNC 4NLRA 2IAJB 1HBOB 2OTLS 3PHTA 4NEZA 3MPWA 3HPOA 4C8MA 4JI1J 1F2HA 3SYZA 5KG4A 4DR6F 4ZVTB 5KFXA 4LF5F 1S57A 4QPTA 3DLKB 1R27B 2RNEA 1JLEB 3CC4S 1UVMA 1UTAA 2VHGA 1RAIB 2CIMA 4CYUA 2XMKA 4NI2B 3GYNA 3HD1A 2JL9A 2JFDA 3PW2A 4MH8A 4WP8A 4EBCA 5U47A 3SMZA 2UU9F 4RLEA 4X4SA 2Z2LA 2NYHA 3L95X 3J7AN 3C6TB 2CWXA 3QGGA 1VQ9S 2FDNA 2PD1A 4LF9J 2HS4A 3KHRA 2KDOA 2MZSA 4B9UA 2C2DA 5HMXA 2IVFB 3NNAA 2RHQB 2GAGC 1R8CA 1WSRA 4KHRA 1CJKA 2GC8A 4C8OA 2F63A 4CRJA 4OI3A 2NXJA 4L3NA 3RG6A 2IDEA 5T41A 4V1Ak 3RB3A 3CJTA 2YPYA 1S6PB 1O0PA 4W98A 5IT9Y 2CJBA 2H5IB 2MGZA 3PFOA 3QZ8A 3DM2A 3IMQJ 1Y0HA 2HHHF 1U0HB 2KYXA 4OYPA 1LW0B 4FYDA 4CLYA 1T8EA 1Q5VA 4RNNA 4XDDA 1WC4A 1FEEA 1DJ0A 3HFKA 4F02A 1YITS 5KT7A 1DURA 1WF1A 1JLBB 5KOWA 2ZD1B 1NZAA 4C97A 2CPFA 1KDNA 2ASLA 3R9LA 2AQ4A 4JV5F 2FIUA 1IKYA 2H3EB 3VVUA 1NSAA 3TA2A 3HO1A 1BXNA 4XAKA 3DRPB 3OHAA 1BQMA 2VA3A 3IG1A 3DLHA 5HVHA 3BGRB 3SSRA 2BV3A 2NS1B 3PRBA 5A0YB 5LT5A 1G1XA 2RRNA 4QU6A 2VQFJ 5T14A 2RT3A 1Q7LB 1V5VA 3LF0A 5AE1A 2LXUA 2UXBF 2D41A 1MMDA 3ZNUA 4GVBA 3HHKA 2PMWA 4KGMA 3GFZA 5IT0A 3LOUA 3M8SA 1IR0A 2Q6CA 2NSCA 3AJ2A 3QO9A 4GC6A 5IFMA 4QWAA 1RACB 1ZTWA 1RTHA 3I0RB 2YH1A 1FFSB 2AJQA 1S9EA 1Y4ZB 2BANA 2RQMA 2M5YA 4HEA9 1SC4B 3GYXB 3M6XA 5CYQA 2ZDPA 2DGVA 4M94A 5DDRC 1YDLA 5ETNA 3Q23A 2ILYA 3KDOA 3CCTA 2G0JA 2MKKA 4X4VA 2O67A 2CPJA 4NYZA 4OJ3A 3V6KA 1HARA 1BE4A 2RKIA 4F2SA 2PE8A 3H40A 2RJZA 3NS7B 1Z2LA 5DDOC 1H98A 2CJQA 4FN5A 2CVEA 2EVZA 2B8QA 4W4MA 1TV6B 2OEMA 2ROPA 3NGTA 5JMNA 3VR1A 5L39A 4RNOA 2O5DA 4NOHA 1LXNA 2V6AA 3PEJA 2VQEF 2CQGA 1NRKA 1JLGB 1F1BB 4OYOA 3TWZA 3V4IA 1VQ5S 4HYKA 3DLEB 3RBEA 2DGUA 2RU9A 4DR6J 4IFYA 4Q2LA 1GTEA 3UN5A 1L3TA 2BOPA 2C3OA 3OD2A 4UUXA 1X9SA 1CJVB 1HD0A 2YNIA 3NGRA 3CJ4A 4UY8T 4DL5A 4DG1B 1QUVA 5L9NA 3M2RA 4ES3A 2CQHA 1XWLA 4OZLA 1FT8A 4LSNA 2BMBA 3BO3A 2R3VA 1CBKA 2FJXA 4ECQA 3QGIA 3M8PB 2R2RA 3Q8VA 2MQLA 4LR9A 2XBPA 1N0UA 2GX8A 4O3QA 2H51B 4XIUA 2CDRB 1I6JA 3AOBA 3TVKA 1TL1A 3HHLA 4MIWA 4QOTA 1TKXB 3MFHA 4LQ9A 4CO1A 3QRRA 3ZZUA 2ZBQA 1D9FA 3T41A 3TO8A 1GK8A 4ZVPB 1R89A 5KFGA 3RZAA 2VJUA 5B0BA 2X7IA 2V9WA 3AT1B 3UQSA 1ZA1B 4TQRA 3MCNA 2G9OA 3UN2A 2RIJA 4WXWA 1S9GB 4B3MJ 1SL2A 4DXLA 2WZ1A 2Y8YA 5AXLA 2Y0SD 4NE9C 3RBDA 2UXCJ 4NLSA 1JIHA 4DR1J 1K47A 4DQSA 3IP0A 3W2WA 2E7XA 2ZH2A 1TVRB 3L7PA 3J7A1 2HMIB 3VQSA 5DLFA 2U2FA 1QTNB 3FEZA 2ZOGA 4DL0C 4DZ6A 3M2UB 2IC3A 1C4AA 1SJ3P 2B5JA 1M5SA 4ZJQA 2CJ9A 1ZAVA 3TAMB 3B4DA 1TUGB 3BO4A 5DM6Q 5KFEA 2CZ4A 1YHQS 2ZBPA 1HI8A 5GVQA 3M2VB 1QJHA 4OL8A 3ELHA 3JQKA 1HBMA 4LFAF 1RTJA 2ZBCA 3CJ0A 3VWSA 3EXCX 2PO4A 5FD1A 1OO0B 3ITHB 2R2TA 2R7TA 4ECRA 5DGBA 4ZLPA 3IXQA 4RZRA 1HMVA 1VBXA 2UXBJ 2CG4A 3CXCR 4B17A 4P2SA 3P3DA 4RW7A 4A8WA 2P9CA 5DJBA 3OW2R 2XO6A 3FSYA 2YNHB 3MAQA 1OMSA 4NMXA 1OYEA 2XZDB 1A0OB 1NPRA 3FDSA 3W9JA 5F0UA 5IV4A 3NLCA 3G8SA 5K8NA 2Y1LB 5F3TA 3MUMP 5GMDA 1MSWD 4OI0A 5G4DA 2YWKA 4DV5F 5A8RB 4DV3F 4PWDB 1J27A 2E1MC 3FEXB 2C2KB 3PYGA 4ECYA 2YWGA 1U25A 1TL7A 4LF1A 5HP1A 2BEFA 4DPXA 2JEJA 1Y5NB 2Y0BB 1RDRA 3JXOA 3JYTB 4CTAA 1U1OA 2Z57B 4TY8B 1YBTA 2BM1A 2AYMA 3M6WA 4FS2A 1PAEX 3IAM9 3BSAA 3H5UA 2BJ1A 2VODA 3HULA 3GJRB 2CJXB 2B43A 2HWHA 5KFIA 1X4FA 2J7KA 1MMLA 5HMWA 1HQEB 1RA6A 2N82B 3R97A 2E1PA 4ZVUB 1Q8LA 2K8GA 3RR7A 3MM5A 1HQUB 4LUBA 2HVIA 1N5QA 4P52A 2J6TA 1WC5A 1WEYA 2J76E 3BV8A 1RSCA 2C3YA 2B7BB 3P4UB 1QLNA 1RT5A 2D3UA 4DCJB 2EPIA 4WFBQ 2BJ7A 1VYAA 4QYZK 2AJ1A 1X5SA 2N7YA 1UEVA 3VAIA 2F7VA 4DZDA 2VDIA 4C3KA 4M63A 5B08A 4YHHF 2JSXA 1T11A 5E3PA 5C2GA 3ET6B 3K2YA 3HZEA 1R3NA 4EYIB 1Q1KA 3M8QB 3FRYA 1U2RA 1R0AB 4NCGB 2IDLA 4RKUC 2KFYA 5KT2A 5IQ6A 1XNQF 3UVJB 3IRWP 4ELUA 3OV7A 2NXEA 4U8YA 1S1XB 4USUA 1TKZB 5CYMB 3NCRA 1FKOA 1RABB 1VJWA 2QA4G 4I2PB 1LV5A 1VRUA 4QW9A 5ETKA 4IKAA 2MGZB 3PV8A 4X2BA 3HSGA 2WVBA 1A7GE 2FZKB 2N3LA 1HIYA 1RAAB 3O44A 3D9BA 4KHMA 3PIOQ 1VS3A 4BBYA 3MAHA 2QA4S 2OMLA 4USMA 4C8KA 3C46A 5CCMA 1PG5B 4BC9A 4DPTA 1ITPA 5J2QA 3OJSA 3VGVA 2BX6A 1BLUA 3W66A 2JVRA 4UOGA 2YX4A 4UT4A 4V19J 3B8HA 2GCFA 2HAIA 2BXJA 2EK6A 3HMJG 3P8BB 1N54B 2HIQA 1EKSA 2JDJA 1VRTB 4TKTA 2OFHX 3MZIA 4ZPWR 2H5EA 1AA1B 1Z2ZA 4PRFA 1MNEA 2CWKA 1M1KT 4LT6A 1KFDA 2K3KA 3WBZA 4U7UD 1D9AA 2UVRA 4B08A 2XNRA 1RT1B 2OH2A 1VFJA 1LEOA 1KQFB 1UKUA 3FCVA 2C1EB 4MT1A 3JSMA 3GWCA 2JEFA 2FHJD 3NMRA 4J7CA 4Q8EA 1W2BR 1IBLJ 3FBEA 4RR5A 5EX3A 2Z8QA 5J1EB 3GILA 1UZHA 4Q43A 1HNVB 4GO7X 4K4UA 1S77D 4PWWA 1QVGR 1GXTA 2R8GA 1RWVB 5F8JA 2BM0A 2C2RA 3MR7A 2H1YA 3UD3P 1T7PA 3THPA 2HPUA 4N76A 2HNDB 5I3PA 3RB0A 1NAQA 2HSEB 3IA0A 3CDWA 4ZKAA 3CF5Q 1FJCA 2BRKA 3KHGA 5CABA 4ID5A 4PPDA 3V2UC 1BQNB 3RBZA 3HVRA 4PQUA 3GR0A 4G1QB 2XB2D 1DQ8A 3I9ZA 5J2NA 1B64A 2XCAA 1QE1A 3DRRA 3R2DJ 1Q8KA 5KFPA 3QFWA 2DB1A 3FC9A 3M1VB 4IYQA 3PM9A 1HNIB 3Q24A 2QLBB 5DQGA 3GQCA 2CRLA 3C3LA 4Q5VA 1D8YA 3D68A 2QN6B 1YJTA 4A8QA 3QLHA 2A1BA 1IM6A 5A8KA 2R7QA 2CPHA 5SUHA 4FKXA 2FHKA 2R7RA 3DDKA 4QR0A 2IVYA 2NYIA 4M5DA 1FWLA 2HBYB 2BKNA 1R43A 5H9FK 3JAMU 4F4YA 2GHWA 1FE0A 3K5NA 3M6VA 4FDFA 4IFVB 3ZZYA 2V2ZA 5J2PA 5BXIA 2DHSA 2ZBRA 4ITSA 5KFHA 5BJRA 5AXNA 2COLA 3BGOP 2W24A 1S4EA 1VHFA 4FBTA 1S49A 1P6TA 3BPSP 1CVJA 1PC5A 3R1HA 3X1LB 4ATNA 1B3TA 3HT0A 4AL7A 3M2RB 3TJ8A 4WIQA 2ALZA 3BBBA 1FK9A 5B7WA 5FLXU 4EEYA 3NGUA 3W61A 4KQZA 3V4MA 5CAAA 4OYWA 1ZTTA 4TXSA 3NCQA 4YHHJ 5DZ7A 3EVMA 3E2EA 3MR5A 4FF4A 3Q8QB 5KT6A 1TL1B 1KR4A 3EWGA 4JI6F 1UJ6A 3M32B 4WFZA 1KLMA 2DNPA 1N5VA 4EO8A 4DCPB 4O44B 4CZCA 3K5OA 4YQWA 4OHZA 3DOLB 3TUZC 4DR7F 3QYYA 4MMOA 3K0JA 1HI0P 3SDEA 4P10A 2N3OA 5BYSA 1VLOA 2E9RX 4EBEA 3Q22A 3J80Y 3HJFA 3MCMA 2DEJA 3GU0A 5KFUA 1TUVA 2NUHA 4H4KA 4OHYA 3D0GE 3S7RA 4BWJA 1S4FA 3K8VA 1RWOB 1HHQA 2EFQA 3D5MA 4I2QB 3FSIA 5RUBA 1FRXA 3DLGA 2ZJQQ 2GIRA 2Z58B 5F8LA 4DF8A 1SJFA 2BA9A 2R8KA 1T95A 4DX6A 1RU1A 5A6PA 4N7TA 4ES2A 1S6QB 4G65A 2QA1A 3MOZA 4N77A 1QSLA 2CJKA 3MPDA 2J8AA 2DNNA 2KXNB 3CEDA 2MMYA 1EB0A 2QFJA 1UAWA 3OLBA 1NHVA 4RW4A 2OEJA 2ZUAA 2M8HA 4TNOA 5F8IA 4IOAQ 1K0VA 2MLZA 4LVNP 3FVYA 3PW7A 4I68A 3GTYX 3MF5A 4HTIA 2CQ2A 5H9FJ 1ZS6A 1IR2A 4OZJA 3NNHA 2IM1A 2FY8A 3SBMA 1N32J 4C2MA 5LL6d 3KUHA 3BR8A 3W5ZA 3W2VA 3HI9A 1RU2A 3KLEB 4DSEA 2QTWA 2MJNA 1N48A 1HYSB 4LSLB 2AYEA 2VJVA 1LWEB 5E0OA 1FESA 2VG6A 2VH7A 2FYXA 1TQLA 5C42B 1S0NA 1VK8A 4OMFG 2A2CA 4BDPA 2WVDA 5F0WA 4ZPBA 3KLHA 2MKIA 4UY85 3M8RA 3BO2A 2XG8A 1TFWA 3V6JA 2ZKTA 2V2VA 2CKWA 5HP1B 4DR2F 4Y2KA 1UWBA 3K5PA 5EUHA 3K59A 1UVNA 1SJ1A 3UNYA 2R7SA 4J9MA 4O3RA 3HHNB 1S12A 3BKUA 1I94J 2ZNZA 2HVEA 5D15A 1PJ5A 2K7JA 4IH5A 3CMES 1OY9A 4AD6A 2X1GA 2XMVA 2WONA 1ICEB 5KFSA 4RUCA 3JSRA 3W63A 4UF4A 3LP1B 1B70B 3FJ2A 3VAGA 3TARA 2UVWA 4P7VA 3OHBA 3UDCA 4RBVA 4IO9Q 4RUBA 4GKJJ 1IKVB 1LQ9A 1MWZA 1FVSA 2QA2A 1RAGB 5I4MA 1DZ5A 4OLOA 1REGX 1KP6A 1N36J 4IG0B 2CJYB 2ROEA 3I9V9 2QZ8A 3EGWB 3GFXA 1TKDA 3HHLD 3ENVA 2XLIA 1T9XA 2M4MA 1C0TB 3VV2B 2OPQA 3ZC4A 1Y10A 1KBRA 4AUKA 2Z30B 2EKNA 5LSOA 1SUQA 1WD6A 1HFEL 4WFAQ 2XI2A 3LPYA 1VIOA 3FSXA 2LXIA 3VQTA 1SV5A 2CDQA 3H4BA 4DQIA 3JB9k 4QZVB 2ADCA 2JC1A 2HG4A 2DITA 5DETA 2RILA 4OX9J 2GO8A 2VBZA 5HLFB 4PG8A 3VAMA 2PEHA 4DUYJ 1XMQJ 1PJ6A 4K59A 1I51B 2V68A 2IRYA 2YNGA 4MKBA 4OYAA 3QGHA 5IQQA 4Q8FA 2YXLA 4C0BA 3RAXA 4WKRA 3CCES 2XSJA 1NK0A 4F8RA 1REVB 4L74A 3OL8A 2BVZA 3MAAA 1X4GA 2CZ9A 4Y00A 1LNQA 4RWXA 1JX4A 2Q66A 3TUJC 4Q2MA 4JB8B 4NLTA 1MLAA 4B3RJ 4IDKB 4OLPA 3UCUP 2VZ9A 2ZJRQ 1VR6A 3PFEA 1Y00A 2FC8A 4NLUA 1FTCA 3UPFA 3BGUA 3AD7C 4N8NA 5FDLB 3DDIA 4AYBD 1G7CB 3AB4B 5B0FA 2XSFA 3U27A 4USHA 5K8OA 2DY1A 2VPXB 2RMLA 4NZ7A 3SIPB 3PEHA 2XMUA 4LBPA 4RW8B 5IOLA 3ZZOA 1EP4B 1S48A 4PXCA 4Y6IA 3EUNA 2LA6A 3S1TA 3SSSA 2YWWA 2QLWA 1VC6A 1RAFB 5K9FA 3RGIA 4ZCMA 1NKCA 3MMAB 1TUWA 4NCAA 4UTGA 4RX6A 1TFYA 2A18A 1WI8A 5KT5A 1X8DA 5IT4A 3PX4A 4DX8H 3POTB 5I3QA 3X3UA 4DV2J 2VFTA 4CWBA 3I55S 4ED8A 1X60A 1RHMB 4MYTA 4DN0A 1EQMA 3MMBB 3SFUA 3KMQA 3H20A 4U7UK 1J5EJ 3DI6A 2EG2A 4AT1B 1F5AA 4Y3CA 1H0HB 1JK9B 2DJWA 2ASDA 2B4PA 2DNHA 1U1KA 2W9BB 2QLXA 1VBYA 4U8VA 4PUOA 5HVFA 5G0RA 2ZUGA 3QBCA 4Z2XA 2AP6A 3JTPA 4B3OA 2JEGA 1WTFA 1T9VA 4FVCA 4M5LA 3JQJA 4B9SA 5HROA 3FFIB 5C25A 1WKLA 2ZH5A 4ZA1A 1E6YA 3OTBA 4CNZA 2E9ZA 5EDWA 3EPIA 2A2DA 4RJVA 2D7SA 2APOA 2KFNA 4P2MA 1KNZA 5IM0A 4ZPVR 3JSBA 3CCJS 1ZM4A 2ZH8A 5C24A 2YBVA 1FKPA 2FJBB 3KK3B 4X4PA 1D8ZA 4LMZA 2MTLA 2GMLA 3R5AA 1TAUA 2GJFA 4Y2AA 1SIWB 2ZC4A 1Z4UA 4JI7F 1F3VA 2M8DB 3P6YC 1L3UA 4IG3A 1TMMA 2K2PA 3BKFA 3ZTSA 4JP8A 1YZ6A 3OUYB 1CS4A 4MK8A 3I4PA 4K4XA 4PG5A 3DMJB 2DVIA 3LQVA 3F44A 2W2MP 4DU8A 4PAAA 4DLGA 1Z1ZA 3CCQS 4WZQA 4IRDA 1YQHA 3E01A 3IWLA 3CDBA 1U6BA 1FERA 4J9NA 3FK4A 3GJSB 4TVAB 2FUG9 2V8VA 1BHNA 2B8PA 2HURA 2VA2A 3HXMA 1FRIA 4F4ZA 4OV1A 2PFFB 2VKZG 5HN0A 4EZ6A 5ADZA 2FTRA 4HHUA 1ZZNA 3R5GA 5HMYA 2OPPA 3P96A 2FVPA 2KRRA 2BE2A 3SQGA 3JTOA 2MZRA 1Q8BA 5GADU 4K4ZA 1VK3A 3QIPA 5GAEU 3TUIC 3Q8YA 3M30B 1NK4A 4UW2A 1KLMB 4FYXB 1QAYA 1U8WA 2UUBF 5E33A 1LWXA 1VQ8S 4U96A 3ZNJ1 1VGYA 1NKEA 1RJJA 4UQTA 3SDEB 3L3CA 2HGMA 1LWCA 4I6WA 4ZCLA 1DTQA 1RXOB 4NLQA 3DXSX 1X4DA 4H54A 2CNOB 1FRLA 5DLGA 4KO0A 5LSLA 4X4QA 1U1PA 1L3KA 4KGKA 1HWKA 2WOMA 5EN1A 3ULHA 4E2FB 3KWMA 2E44A 2H48B 1WHYA 3F73A 3SI8A 3D54A 2HGNA 2OPSA 3GSDA 1P8GA 5KTQA 4OZ0A 3Q0AA 1RTDA 3HSJA 3PJ9A 3BF4A 3OXGA 1H38A 3HVAA 1LK7A 1XR7A 4M95A 3OTCA 3OLAA 2NZCA 2W25A 4LR8A 4EI2A 3MM8A 3OVAA 2DR8A 1NB7A 3LALA 4ZP9A 3A3NB 3A12A 4RW6B 4ED2A 2G2ZA 3G82A 4R0JA 3I0SB 1RWPB 2NZ4A 2WCXA 2BE9B 4DL7A 3CGIA 2FJEB 2FB0A 1KN6A 1YJWS 2UUAF 1P27B 2MQPA 4LF8F 2DR6A 3M9NB 1X4EA 3ENQA 5DDPC 3V6DB 3I4HX 3EM1A 1X4CA 3U1NA 3PW5A 4NXNF 3FNNA 3K57A 4AL5A 2RQCA 4NA3A 2ZVSA 1J5OA 2RDIA 2P6TA 4OX7A 4UZBA 2J7WA 2QRRA 3RTVA 2CQIA 3M9OB 1SCJB 1HHSA 5A2QU 3KLGA 1CG2A 1FNOA 1M0SA 3LUYA 3CC7S 4RO0A 3IAS9 3KLHB 5BYRA 1CLFA 5KFVA 3EGVA 4FPRA 1TR0A 1GTHA 4RPFA 2QGFB 5A8WB 4I6AA 2VPYB 1UCNA 5AJ3J 1XJWB 3C8YA 4DX5A 2V34A 4FP9A 3UO0A 3VAJA 1IWGA 3CIZA 1O8BA 1WHWA 1TAQA 2LP4A 2QL9B 1WOOA 2VC0A 2ZNYA 2V94A 1U4BA 3MOJB 1JLFB 4B3SJ 4ECVA 5JUMA 2AGQA 1S1VB 5H1SV 2BDPA 5KOXA 4BCAA 1WG1A 3UDLA 3MI7X 3NP5A 1D3WA 4BHQA 3TQEA 4YY3F 1N5YA 1RWMB 1VQSA 1NB2A 1IJEB 2QL5B 1WNEA 4OI4A 4U7CA 2HHQA 1ACMB 1MN9A 2GIFA 3D1HA 1YKWA 3M8YA 2VG7A 1RCOB 4ICLB 2V69A 1FNXH 4BLGA 5KFJA 3ADAC 3F0NA 2DKOB 5HQLA 2VOPA 3LP2B 1RE1B 4JI8F 5C2CA 2LDYA 4NEYA 2QT7A 1LFPA 2VBWA 1HBOA 4DPOA 4C7QA 1YJRA 2IFXA 2N7CA 1CPZA 1RHUB 2Q1LA 4HHJA 1EJ7L 5MLCV 5ITHA 8ATCB 3IWXA 1U24A 1VDHA 3CJRA 3DLKA 4DV4J 1JLEA 4KV8B 2WB1D 1UEKA 5CA5A 3SCKE 3PZPA 4WK3A 2J0SD 1JMTA 4NI2A 5HBMB 3WC2A 2XS7A 1AZSA 5DQHA 5JJBA 4KYZA 3IWNC 4K5RA 4ANDA 2H4WB 2GQCA 4P73A 2I2YA 2MSTA 1FDBA 4WE1B 5A6WA 2I38A 1NXIA 3W9IA 5LMNF 3C14B 1W7WA 4I4BA 4QPXA 2ABYA 2UUBJ 1SKRA 3C6TA 3CWJA 2LU1A 4YB1P 1RT4B 3NOGA 3CCSS 3FBFA 3K5LA 5CXTA 4JV2A 2NXNA 2KT5A 1SB6A 1C1BB 3KJFB 2F65A 2JVOA 2CQPA 1YX2A 3QGPA 3O8WA 4PZVA 3RJMB 4WU3A 2IBOA 4O4GA 2MPUA 4ZLJA 2LQJA 2AMCB 1BUXA 3N5BA 3N5FA 1H2VZ 3HVTB 2C2NA 1S6PA 1XTZA 1DHMA 5B0CA 1NNDA 2AKWB 1WG5A 2AZ1A 5LMUF 2VD3A 4DV6F 2HHSA 2EFVA 2UXDF 1D9DA 1F0XA 1FI4A 2G0CA 1VQKS 3MPUB 1U0HA 3GCXP 4ZVSB 1PILA 3NAHA 1LW0A 2N4CA 2VL1A 3SFGA 3RB4A 5DG7A 2JX2A 1C1CB 3PO5A 1WACA 1YI2S 1KOOA 2ZC3A 3BH7B 4L76A 1X7VA 1JLBA 3M4XA 1XNRJ 1G3OA 2MKCA 4JI2F 2DNRA 2VV5A 2HHVA 3H5SA 3QQCD 2Z56B 2UUAJ 4LF8J 3FZBA 4C8ZA 3DRPA 2Y1IA 3FQKA 1RWXB 2I6WA 2YWHA 3BGRA 3QWPA 5KG6A 5CYJA 2JRSA 1T9WA 1SH3A 5A0YA 3H5XA 1FDNA 3OVBA 5THWA 4GKKF 2EG1A 4PUOB 3AH6A 2KG1A 4DJBA 1RLCL 3D67A 2E66A 4JUZA 3OXFA 2XLKA 4B3OB 1RKJA 3Q8SB 2VFUA 2VFSA 1KVIA 3UCGA 4JV0A 4PCQA 1ZOTA 3GFHA 1X0FA 3I0RA 1FDAA 4DR3F 3AQOA 4HKQA 3TZXA 4WFXA 3C2PA 4CQ1A 4TU7A 3LGHA 5IM0B 1CEZA 4CO4A 1RGVA 4DV7J 2HQGA 1YRUA 1DY3A 2DNKA 2FVQA 2CPEA 3HHLC 3SV4A 1TK0A 3OT9A 2DBBA 4Q7AA 4ECSA 3ENWA 4ZVHA 4YY3J 4DMZA 2MXYA 4YN3B 1NPKA 2AD9A 4B9LA 2LQBA 3FCWA 4ZVFA 4ECTA 3O2IA 3J7ZT 1JLAB 4OJHA 1EETB 2UV8A 1VRQC 3ZTQA 2FVSA 2IYGA 3T1HF 3RW7A 3LAKA 1N6QA 3IR6B 5AE2A 4JI1F 1N33J 3NS6A 1JLGA 3OPKA 3I56S 3HSDA 3DLEA 2B9XA 2X3DA 3CB4A 3BSCA 3IN5A 2AYBA 2F4VF 2KN4A 2G13A 2JH3A 4R25A 2XULA 4CDIA 3GZ7A 4TLQA 3BBFA 3ISZA 2ALYB 1UEUA 1RAHB 2R7UA 4DV0J 5F8HA 5KFCA 1CJVA 4A4JA 5ETLA 3QJPA 5IS2A 3HT3A 3QIPB 2C2OB 5LSRA 1B0TA 2CQCA 4DG1A 1BQXA 1UFKA 2RUSA 1OYDA 3PTWA 3V81B 3R2CJ 3H4DA 4X4OA 3TAPA 1XR5A 1MMNA 4DI6A 2YVSA 2H5JB 3K17A 1S76D 1N34F 1DTQB 1EARA 3VALA 2AU0A 2HZCA 1DBDA 3UDEA 2YKNB 5ETQA 4ED3A 2JFKA 4KO0B 1TKXA 2X51A 3ONQA 2KHCA 4L3KA 4QQBA 2XGPA 1JWWA 1UFWA 2CA9A 2DGWA 2DPIA 2PSZA 1NEEA 4KGVB 3FEYB 2FLOA 4HHHA 1WORA 2HFOA 5MAOA 2AJFE 1X5OA 3EXYA 2ZH1A 3ZZPA 1JXLA 1J2VA 4DPUA 1H2TZ 3US5A 1IBCB 4FF2A 1S9GA 3MM6B 5LMUJ 2DR9A 1PBAA 2D69A 1K1QA 2UXDJ 5JXSA 3N6LA 3QMQA 5ETTA 3LWMA 1XMBA 3QAUA 3UWTA 2DH9A 1TVRA 5GMKa 3KNGA 5M2PA 1C2PA 2HMIA 2LQ5A 4DDFA 3BEGB 3C16B 2W2OP 1TU0B 1VQOS 4F26A 1YJ9S 3KJVB 3M9MB 3M2UA 4LF4F 2JEIA 2R7OA 3CVKA 1KHWA 2D74B 1XMOJ 1UZDA 2QL7B 4ES1A 3MR2A 3TAMA 3MEGB 1M1HA 1NK6A 3UCZP 2CQ0A 1ZH5A 1YRXA 4CIOA 3M2VA 3IS9A 4KY3A 2V8DA 4CLSA 1T03B 2J5AA 1YJUA 4F50A 3TQ1A 3I32A 2Y9HA 4F67A 3ITHA 2F8MA 4DPWA 3OSPA 1PSDA 4PQAA 4GKKJ 2EBEA 1WOSA 3DHXA 4LQ3A 4KFBB 5AXMA 3W8PA 2J9CA 1DRZA 4HDGA 1WSVA 3A3OB 1V6HA 3M05A 3OXLA 4Q0BB 2YNHA 3PJXA 4O3NA 3G71S 2DTJA 3IBWA 2XYPB 4USWA 2MKYA 4IR1A 2PMZD 2XMJA 3TX0A 2OTJS 3B78A 3KG1A 4QIGA 2HHWA 2XTJP 3NOCA 4DR3J 3NEKA 2X1AA 2NSBA 2AZ3A 2E9TA 4MKAA 4OV6A 1DTTB 2CG8A 3CCZA 1FRHA 3KLVA 5A8RA 3BN7A 4C9DA 2EBGA 5HSPA 4CI0B 4PWDA 1JJCB 3N4WA 1KFSA 2RD5C 2W1BA 1HWIA 3LH2S 3PRVA 3NWGA 1GMVA 3A4TA 1RB0A 5J1PA 4TY8A 2NXUA 1WC3A 5D4OA 4C98A 1WOPA 2DCUB 1YG0A 3OTEA 1S99A 4DN9A 1AROP 2B51A 3IC1A 1HLWA 3SCJE 4QWDA 3GE9A 1P1LA 2B7CB 1SL0A 3G6XA 3MWBA 2A10A 3T1HJ 1HQEA 3W1YC 2AEFA 4DFKA 2L9DA 5L46A 4EUVA 3ILIA 3ZFVA 4LSZB 5SZTA 2P2CB 1OS5A 3A8KA 2M3DA 1HQUA 1U1NA 3HLUA 2GVDB 4HT5A 1VBKA 4XTTA 2F4VJ 4OZ3A 2UVVA 3ILLA 1Q81T 2XY5A 1AZSB 1TELA 1VQPS 2AEMA 2NUUG 5HVGA 2ZWPA 4ZHRB 2DR7A 4I0WA 2V4JB 2R8IA 1B0PA 3MXHP 3FGVA 4YOEA 3DCAA 3AJ1A 3D3BJ 1OIAA 2E5IA 1JKHB 1ZPWX 4CLTA 2HRTA 3ET6A 1N34J 1HW9A 3R5DA 2HIYA 1YJ7A 3M8QA 1DQAA 4ZITA 2EK1A 4LR7A 1R0AA 4NRUA 4NCGA 4O4GB 1AW0A 1PJ7A 3NGKA 3UVJA 1U1QA 3FZ2A 1LKZA 1S1XA 3MD1A 1TKZA 5CYMA 3LGNA 2AW0A 1V3ZA 4I2PA 5L1LA 1RT6B 5IC6B 3GMGA 1FX4A 2P5VA 3HJVA 4B3MF 1UVKA 4M1KA 4WYWA 4RU9A 1LWFB 2CQ4A 2HFSA 3DRXA 3O5TB 1ZA2B 3TOQA 3MEDB 3TZZA 1WUUA 2GAHC 3A3PB 3UR0A 2UXCF 3CCUS 4DR1F 1HBUB 1X4HA 1M5OC 4JV1A 3KUGA 9ATCB 3PYEA 2JWNA 2OI2A 3HHEA 2KT3A 2YKOA 3TW0A 5HO4A 2HQCA 1T05B 4ZCKA 1U09A 2J8SA 3C19A 4XPCA 3PKMA 1U26A 3J81Y 2DCLA 3GR1A 4P74A 4LF4J 1UPMB 3ILOA 2UP1A 1NPPA 3PXGa 5IV3A 5E3AA 1VRTA 4QYRA 2DGSA 2I5JB 1YTYA 2W9AA 4JI5F 2NXCA 2I9SA 1RT1A 3VCDA 2MHEA 1DFDA 4N5SA 2E5LJ 3BSNA 4M5KA 3QT8A 2AYGA 3PR5B 2ZE2B 5J1EA 2C2ZB 4F3OA 2HS0A 1HNVA 1QDUB 2E29A 2BRLA 5IT9U 3KNAA 5ETMA 4OFZA 3NBPB 5HK4A 2ERRA 1XK8A 2VPZB 1QSYA 5L1KA 3TR5A 3K58A 4ZVGA 4O3SA 1HR0J 1ZPVA 2RH3A 4U67Q 2BJ3A 2HNDA 2RQKA 1QAXA 1ZAXA 2ZITA 3Q83A 2RUGA 4OYXA 1CQMA 2YWEA 1BQNA 4KB7A 1YK9A 2MHNA 4NLOA 2G4BA 4G1QA 2L9WA 4JOUA 2XCPA 4ELVA 1XERA 4HR2A 1NDCA 3M1VA 2JLFA 3W9HA 1JB0C 1HNIA 2HQFA 3MM9B 2R7VA 3H8YA 4ER8A 4WBFA 2YTCA 1V5IB 4H4KC 2CPXA 2GZOA 2KI2A 4L73A 4ZN1A 1N6QB 1JNRB 1WEZA 1NDPA 4A8YA 4FNHA 1GH8A 5GAHI 4P72A 4DF4A 3TZWA 3UD5A 4IFVA 1VC5A 3B82A 2J9DE 2FGCA 4X4TA 4FF3A 5CCLA 5K14B 2HFUA 1JJHA 4OZ2A 1SKSA 4E8UA 1RADB 3BKTA 1ZETA 1VHIA 3ZXWA 3KKFA 5I42B 1T02A 4KR0B 3TVZA 1SC6A 1MROB 2NCKL 4USVA 3DFEA 2IRXA 2NR0A 2BQRA 2HZAA 4DWIA 5EGYA 2Z0GA 3M32A 1P9YA 2W7AA 1Y5LB 2UZAA 1U6ZA 4O44A 5F8MA 2RQ4A 2FY1A 3DOLA 3IGNA 4YMEA 3C15B 4A48A 2RAQA 3OFFA 4X4UA 2YWFA 4ETXA 1SL1A 3NWRA 3Q86A 3TUPA 1WDDA 3KG0A 2PGCA 4FXVA 3GLJA 4H4OB 2HLUA 2BOAA 2DRAA 3TEGA 4F3MA 5HQMA 2P8IA 1L3VA 4PYAA 1HL6A 3UFCX 1N4LA 3G86A 3EMTA 1OY6A 7FDRA 3KTQA 4I56A 3N01A 1CULB 2HBRB 2YX1A 4I2QA 5DQIA 2GMJA 2KFZA 4PR6A 2HS3A 2KYZA 9RUBA 2HK3A 3GIMA 1PC4A 1UW4A 1M1GA 2BJDA 2W9CB 5K8PA 1RTIB 1H7XA 4QIEA 2FVCA 4KAIA 5M2UA 2VICA 3V6HA 2OLWA 2C22A 1S6QA 2LA4A 2W4CA 4O0IA 4N8OA 4PXDA 3IS9B 2WRMA 1X31C 2RRAA 3J7Z5 5T7LB 3VAFA 2LQ8A 4JI5J 5AE3A 3BGLA 1U6FA 2VBXA 2R42A 3HX9A 3AOCA 4CO3A 3T1YF 3BZQA 3D3CJ 4XO0A 1IBLF 2IJNA 2QIFA 1GQEA 4XK8C 3FRZA 2ATLA 3CMQA 2IRUA 1W2IA 4LIWA 2CUYA 4IQMA 4X4NA 1JXVA 4O4RA 3KLEA 5HL7Q 2LFVA 4F4XA 1FEHA 2K1RB 1HYSA 4LSLA 4Y2MA 3RUBL 1LWEA 1FTRA 2OKQA 1Q79A 2EFGA 3G8QA 1KEKA 5D0HA 2VC1A 4Y2IA 5C42A 1H7WA 2XMAA 3D2WA 4LFBJ 1VI7A 3R6GB 3NAIA 1GAOA 1GNKA 3N6NA 4NYPA 1B99A 2VFVA 4I1TA 5F41A 2CJAA 3I5CA 3TAQA 5J1NA 3IR5B 1Q0NA 2GIQA 1L3SA 2FZGB 3MM7B 3W62A 3EVOA 1MWQA 4A8XA 1URNA 3H42A 2MEWA 1QSSA 2KU7A 3LP1A 5HJYA 1NSQA 3MFIA 1T3NA 2YNFB 1AFIA 3MURP 2DR5A 1Q86T 3AFGA 3ETOA 1S9FA 2J0QD 4JYAJ 3H0PA 1O5JA 2PA8D 3E3XA 1IKVA 4ANEA 4G1PA 3J7YU 4C0OC 3KLFB 4KC5A 1F5CA 4IG0A 4OI6A 1H74A 1YGYA 5HMZA 2FGOA 3P5BP 5KFAA 2YKMA 3VAKA 1C0TA 1CQNA 3CT9A 1F5BA 3QPIA 3SCIE 1NCLA 3IRXB 1MU2B 1URRA 4BS2A 1S97A 4LREA 3I82A 3BQ1A 2VIHA 3C6UB 3OFEA 4YP3A 3TZYA 1HPZB 3CJ3A 3I87A 1VQMS 1YIJS 4LF6F 4X65J 2KO1A 3CO0P 4CO5A 2V8PA 2OHDA 5HLFA 6FD1A 2GW8A 2FVRA 1VMBA 2DD8S 3LW5C 3G6VA 2OSRA 1JNZB 2FJDB 3E51A 3VTIA 2XI3A 1A9NB 2Z2ZA 1RWUA 1GXLA 4LFCJ 2Q79A 2P9EA 1CSJA 1KWMA 1REVA 3CJ2A 1OQ6A 1CC8A 2HAFA 5DO2A 3I5BA 1NU4A 2EWHA 3GIIA 1WEXA 1ZM9A 1TK5A 3R5JB 1FX2A 4IDKA 2XC9A 2XZWA 1UVLA 1UA0A 3TVYA 2KG0A 3AJDA 2XYGB 2IA6A 5D0EA 4IRKA 4KRWA 3U7JA 2QEXS 3CJKB 2B4OA 3NGSA 4JI4F 4W90B 1FJGJ 2O3DA 3MUVP 5FDLA 2VPWB 4V19X 1QY7A 4CLLA 2GHPA 2LYVA 4RNHA 4ZVRB 2GA7A 1VISA 2PC6A 3WIVA 1HA1A 2HWIA 2ILZA 4HACB 1EKRA 4J9VA 1GEHA 4DX7A 3AB2B 4RW8A 2EFNA 4F4AA 1EP4A 3AHPA 2CZVC 4F25A 1IVZA 4MYUA 1CJTB 4IQXA 3TYTA 4WFNQ 1DLOB 3MMAA 1P1TA 3GV5B 4NA1A 1K44A 2D3O1 1FE4A 1SKWA 4DL4A 1RAJA 1O51A 4EU0A 3POTA 2DGOA 3MMCB 3LTOA 3T1YJ 2IHR1 3F56A 3CW2C 2KRBA 2ACMA 4A8KA 3RRKA 1N32F 3KK2B 4WF9Q 4LJMA 3MMBA 1EZZB 1SJ4P 2MKSA 2C28A 5CQGA 2E7WA 1OPZA 1NLKL 3S6EA 2WVCA 2GNKA 2C2EA 5KFKA 3HCXA 2W8LA 5B0DA 2RU3A 2W9BA 2MDAA 3VF0B 1RT2B 2L41A 2OUGA 4QYZJ 3GB0A 3MD3A 2JNJA 2CVIA 1NSKL 2G2YA 4P2XA 2W7OA 1FXDA 1WELA 4YB6A 3OTOF 2UUTA 3FFIA 2CXEA 4J9UE 2V4RA 5D4PA 5F8GA 4CLPA 1Q53A 1I94F 2W7PA 3T5KA 2F1FA 2QSWA 4KHPF 4N56A 2HQDA 2H54B 1SQFA 4DHVA 2QG9B 1S6OA 1TTHB 1NJWA 2EFPA 3DOKB 2BQUA 1DARA 4LRDA 3NNCA 1S1UB 2F5GA 3KK3A 2QMXA 2BABA 5KFNA 4ZPTR 4QWBA 2HHPA 1B4SA 2FHMA 3PYFA 2BKOA 3MTJA 4GKJF 1GX6A 1PYSB 2FQQB 3OUYA 2OELA 3KMSA 4FNIA 2OGUA 2O01C 4WK1A 2FD2A 3R3TA 1HBNB 3DMJA 1N36F 4ZOSA 2O66A 4TYBA 1ELOA 3BREA 1EX8A 2YQ0A 4FPIA 1QD1A 2KH9A 2ZOFA 5LXRA 4NX9A 5DZ6A 1NJZA 2DNGA 3G2XA 1SJQA 3JS9A 4C8YA 1U2FA 1RT7B 2M70A 2QYGA 5KT3A 1TMJA 4NPOA 1IQZA 1RP5A 4LF6J 4FZVA 1RHJB 4OX9F 4CO0A 4DUYF 1XMQF 3D1QA 3KJNB 1XEZA 3L7UA 4OHVA 5KFTA 1DQ9A 3B4MA 4AQYF 1HWUA 1JLCB 1FO1A 3M30A 2GO9A 4KJIA 3OL6A 1RTZA 2VB6A 4I64A 3HKWA 1RT3B 4Q45A 2PEBA 2AT1B 4OYMA 1C0UB 3G8TA 4ENOA 4TLRA 4LRBA 2KL8A 3BS9A 1LW2A 4K4VA 5D8HB 1S1TA 2X1BA 2B56A 3AQPA 3DYAB 4B3RF 4QCLA 5CHCB 4C6AA 2E1RA 5I3UB 3WIUA 1IWAA 2OP5A 3A13A 4DU7A 3CSKA 3TJAA 3R5CA 2GJIA 3R7SB 3W3SA 1KRPA 3DXBA 3EE3A 4JI4J 1JJ2R 4TQSA 2D9PA 2EC0A 2J6UA 4HT7A 1RBLA 2WSFC 1RI7A 3GFYA 1IKXB 1PKUA 3KHHA 2WVEA 1M5HA 3MECB 3W64A 5KFRA 1U7LA 2DH7A 3D6MB 5D78A 1RHRB 3P49B 1OSCA 5KT4A 4Z7YA 1IKWB 2OPRB 3CJ5A 2PN6A 1WG4A 4M5GA 2GGPB 2HRYA 3H90A 1C4CA 1U0SA 4OZ5A 2DNQA 4RW6A 4DCOB 4DV2F 3T5LA 3I0SA 4KTQA 3H2LA 4EWTA 2AF6A 2HFZA 2QMUB 5LJ3Y 2LECA 4C8NA 2YKQA 1J5EF 1SVDA 1EIYB 4PEOA 3V6DA 2OJ3A 4ZK7M 3MCSA 3PO4A 2X3GA 1VOMA 5JVHQ 1TL3B 2JJ4D 4JBCA 2XHWA 3PX6A 2WK4A 3GCWP 2RF2A 4RL1A 1T9TA 3A8JA 1R0CB 3J80U 1FRKA 2FC9A 3DGPB 4U6PA 3HKZD 3MR6A 2PMHA 3R5BA 1X9WA 1Y5IB 5J2MB 3M7VA 4F0HA 2C42A 2LEAA 1S6UA 1R8AA 1TP7A 3BQ2A 1NH7A 1RZMA 2DK2A 5A8WA 3CC2S 4ZIVA 3TX8A 3OTOJ 1S7IA 8RUCA 4CM2A 4IR9A 4EFAC 3NG8A 3CDUA 3K89A 5B0EA 1FCAA 4DV1J 4ECUA 3PRDA 4KHPJ 2BJ9A 4A8SA 1E6VB 1JLQB 4WXOA 2IMOA 3NGDA 1JLFA 2BKPA 5GAGI 4PPZA 4AFFA 1S1VA 1N52B 1RAEB 2CQ3A 2K7KA 2PI4A 1F2GA 4I7FB 3AODA 5HATA
chains in the Genus database with same CATH topology
2XQCA 2VICA 2VHGA 4ER8A 2VJUA 2A6OA 2XO6A 2VIHA 2EC2A 2F4FA 2XM3A 2VJVA 2A6MA 2FYXA 2XMAA 2F5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XQC A;  2VIC A;  2VHG A;  4ER8 A;  2VJU A;  2A6O A;  2XO6 A;  2VIH A;  2EC2 A;  2F4F A;  2XM3 A;  2VJV A;  2A6M A;  2FYX A;  2XMA A;  2F5G A; 
#chains in the Genus database with same CATH topology
 1RCX B;  2DXF A;  1EQ0 A;  3M6U A;  4ICL A;  4IRC A;  3GIR A;  2W2P P;  2MQ8 A;  3LP2 A;  2GVZ B;  4GVL A;  4X62 J;  4FVM A;  5EHH A;  3MPY A;  1G2E A;  2YKM B;  5E3Q A;  1Q7Y T;  3OR1 B;  3G4S S;  5D0G A;  2MY7 A;  3DU6 A;  1ULR A;  4FKY A;  4DL2 A;  2RHS B;  1HD1 A;  2ASY A;  3QSY B;  4KV8 A;  2MQN A;  2FHO B;  4R5P B;  1VLY A;  4CH0 S;  3CMA S;  3QFH A;  3R7B B;  5HBM A;  4ZJL A;  2XGQ A;  3C66 A;  4LRC A;  4LF5 J;  4TN2 A;  2GV1 A;  1NJY A;  4WE1 A;  4AQY J;  3BDE A;  3BGF A;  2DGT A;  3C14 A;  2AJ4 A;  4YS2 A;  4DLE A;  1RT4 A;  1GFW B;  2PII A;  3K8W A;  1H72 C;  2UU9 J;  1C1B A;  2XNQ A;  3DRY A;  3VZH A;  5D6G A;  3JQM A;  4NLP A;  3EZO A;  1TKT B;  4FYY B;  4R8U B;  3BJY A;  5ETR A;  5KFQ A;  1S0O A;  3PJW A;  2HNZ A;  1NDL A;  2FLL A;  4KPC A;  4J37 A;  3HVT A;  4CH7 A;  3B6B A;  3PCO B;  5E7O B;  2ZM6 F;  3EZ5 A;  3OJU A;  3TRG A;  1IXK A;  5L8R C;  3CTR A;  2ADB A;  2KZZ A;  2AJ2 A;  3QJL A;  1C1C A;  4FXD A;  2WW4 A;  4K2X A;  2EI5 A;  1K73 T;  4J9K A;  2M9K A;  4ETZ A;  4KH1 B;  3BYP A;  2HHH J;  3IGV A;  5H9E K;  3M8W A;  2XMW A;  4DSK A;  4M5I A;  3CJS A;  3OR2 B;  3LGM A;  4ED0 A;  1RK8 A;  2NLW A;  3VGS A;  3PX0 A;  4WJB A;  2IJR A;  5CH7 B;  2VG5 B;  4DOZ A;  3GJQ B;  4NZ0 A;  2SXL A;  4CO2 A;  4IUF A;  4CP5 A;  2A3J A;  3EDR B;  3ETM A;  4RWW A;  2DHG A;  3F41 A;  1NK5 A;  2WTF A;  2DPJ A;  4FYW B;  4JV5 J;  1U8S A;  2HNY A;  3FCH A;  4ZVE A;  1CJU B;  4C48 A;  1D09 B;  2YQ1 A;  2YPZ A;  2W8K A;  4GC7 A;  2QYC A;  2OFG X;  1EHW A;  3H59 A;  4H4M B;  3IBC B;  1HNX F;  1AUD A;  5D3G B;  1HI1 A;  3OL9 A;  2AHO B;  2IIH A;  3MEE B;  1T9Y A;  5KG2 A;  5KG1 A;  5AJ3 F;  3LP0 B;  4X64 F;  3DRS B;  2LEP A;  4GO5 X;  4WP3 A;  4DQQ A;  3DOM B;  4DL3 A;  2B6A B;  2DT9 A;  4QWC A;  2YKA A;  1S1W B;  3KLI B;  4FBU A;  2C3U A;  1SKU B;  4B3S F;  4ED7 A;  2OSQ A;  2ACY A;  1K1S A;  5IZH A;  2IBK A;  4LVO P;  1I5O B;  3KFW X;  3R27 A;  3R8Y A;  3AXK A;  2KM8 B;  3EYZ A;  3QZ7 A;  1RBO B;  3PR4 A;  3U02 A;  5KG7 A;  1YJV A;  2WB4 A;  5KFD A;  4MK9 A;  3KG4 A;  3RRH A;  3KK1 A;  3NXZ A;  3AAW B;  3D0H E;  4J9L A;  4K4W A;  4X84 A;  3LO3 A;  4WWS A;  3MR3 A;  3IFE A;  3PNI A;  4KGZ B;  3HHD A;  1JLA A;  1EET A;  1RQ0 A;  1NO8 A;  4ED1 A;  2EKY A;  1SIZ A;  1FXL A;  1AYE A;  1VQY A;  4YB5 A;  4RW9 B;  4MTP A;  3KHL A;  1K0T A;  2C3P A;  3GV8 B;  4K0K F;  4MFB B;  3RU0 A;  2A6M A;  4JI3 F;  5CZX A;  4DV4 F;  4L72 B;  4N41 A;  2Q43 A;  3K7R A;  4ANC A;  4O23 A;  3VAH A;  2ZKU A;  2VQE J;  4Y2C A;  1IBK F;  2RDD A;  3TA1 A;  1HQ2 A;  2L9N A;  2QO3 A;  4RNF A;  2VFR A;  4WCE Q;  2F3J A;  4MKV A;  5H9E J;  3PYD A;  5FII A;  1KS2 A;  1FD2 A;  4ZP6 A;  3BN4 A;  2RSQ A;  3D6H B;  1KOH A;  4CYU B;  3V81 A;  2YY3 A;  2QE5 A;  3BDP A;  2RRB A;  4A8M P;  3D66 A;  4J9S A;  3OFH A;  1WDT A;  3CO9 A;  1Q95 G;  5KG3 A;  1LW2 B;  3A8I A;  3CD0 A;  4NLV A;  1S1T B;  2LEB A;  2VKR A;  2PDA A;  3MEK A;  2YKN A;  1F60 B;  8AT1 B;  4J9R A;  4P6Q A;  1SBR A;  1GXU A;  3T3F A;  3CCL S;  3NCP A;  3TA0 A;  3QAT A;  3U1M A;  3OTD A;  4A46 A;  1UVI A;  3L9Z A;  2KM8 C;  1T94 A;  1CJK B;  2HEK A;  2BUN A;  2BJE A;  2V67 A;  1Q8I A;  2HHT A;  2ZM6 J;  1S0M A;  5E5N A;  3MM6 A;  4YB7 A;  2HLT A;  3HFV A;  3U1L A;  3CD6 S;  3KJQ B;  5L38 A;  3D4J A;  4OZ1 A;  3NKY A;  3AA9 A;  4MK7 A;  3DM2 B;  4RNM A;  1FA0 A;  3AXM A;  2OD4 A;  1U49 A;  5KFY A;  3C16 A;  2HBZ B;  4X4R A;  1XNR F;  2CPZ A;  3KJV A;  3RR8 A;  2M88 A;  3QAE A;  4M5M A;  4N47 A;  3I5A A;  3MEG A;  3SSQ A;  2HFV A;  2ROG A;  1RYS A;  1H2U X;  4ILM A;  2W01 A;  1KVK A;  1LOU A;  3GPA A;  3MPV A;  1T03 A;  3Q89 A;  1LFW A;  5AXK A;  1ROF A;  5LXY A;  1IKY B;  2RF2 B;  2QJ3 A;  3GP9 A;  4KFB A;  3L7O A;  1BQM B;  2AGP A;  3IG1 B;  1G4C A;  5HI7 A;  4LFA J;  1M5K C;  1IM4 A;  2GHV C;  3A1Y G;  1HNX J;  3BSO A;  4Q0B A;  3H5Y A;  3WQP A;  3DC2 A;  5CZV A;  4O0N A;  1OQ3 A;  2ZWO A;  2R7X A;  3JAM Y;  4GVB B;  4X64 J;  2ASJ A;  3S01 A;  1K8A T;  2ZDO A;  1IR1 A;  2L48 A;  5F3Z A;  4ZP8 A;  2DIS A;  3QO9 B;  1DTT A;  1T0T V;  1XR6 A;  3CCV S;  4DV7 F;  3FMB A;  3AA8 A;  2IJF A;  2H65 B;  1RTH B;  2RVJ A;  2WSE C;  1S9E B;  2BAN B;  1Q16 B;  1RA7 A;  2QLJ B;  5FLX Y;  5KG0 A;  4OQJ A;  3RAQ A;  5CYQ B;  2PI5 A;  4DV5 J;  1AFJ A;  2CYY A;  4DV3 J;  2B9W A;  2RB7 A;  3HF5 A;  5FJ4 A;  2YX7 A;  2CPI A;  2JLE A;  3CD5 A;  3OVS A;  5KFO A;  2ZHA A;  2KKH A;  2XHC A;  2RKI B;  4CNY A;  2AWZ A;  4P75 A;  4GRS A;  4BC7 A;  4LF7 F;  3IM8 A;  3FKB A;  1N33 F;  2XY7 A;  2IMW P;  2JZ5 A;  1S0V A;  1OJ4 A;  1GMU A;  3P5T L;  3CCM S;  4K0K J;  2LMI A;  1X0P A;  4YEA A;  4NCB A;  3CCR S;  2HYI B;  4JI3 J;  2DNY A;  4E0D A;  2GVD A;  2ZH4 A;  2IVM A;  2MY8 A;  5C7P A;  1QAI A;  4HL9 A;  1UMJ A;  2KVI A;  4ZVO B;  3CJ8 A;  1NKB A;  3V4I B;  1IBK J;  4DV0 F;  5K5M A;  1VBZ A;  1XQI A;  2IPO B;  2LU2 A;  1LXJ A;  3I6P A;  3DLB A;  3IO1 A;  4IFY B;  4ZHR A;  2ZZT A;  1FWK A;  3T1A A;  1W26 A;  4AE5 A;  2G1H A;  2V4J A;  2XMM A;  1GMW A;  2V9K A;  2XZT B;  1LK5 A;  4ED6 A;  4OHW A;  1JKH A;  1F9H A;  5HQ8 A;  3E8O A;  5GME A;  2YNI B;  4KE5 A;  3A8E A;  4B9V A;  4K4T A;  2BW7 A;  3D28 A;  2IM2 A;  4LSN B;  3WX8 A;  2POK A;  2CPD A;  1U48 A;  1HNZ F;  1UL3 A;  2AX1 A;  4MJK A;  3RBX A;  2HNZ B;  1X4A A;  1FHT A;  2HW3 A;  1RHK B;  3HHL B;  1P9Q C;  3DLL Q;  1YLX A;  1RT6 A;  4J9P A;  1SI9 A;  5D4N A;  1XNQ J;  3GON A;  2MZQ A;  3OQ2 A;  2GMH A;  2XYH B;  2PA3 A;  2O1P A;  2ZH6 A;  4P2F A;  1YRT A;  3DGV A;  3UNG C;  1LWF A;  1D1U A;  1BC6 A;  3MED A;  1RAO A;  3KOA A;  1NM2 A;  2LQ9 A;  1Q4R A;  1RHQ B;  4Y34 A;  1HBU A;  3N6M A;  2BAC A;  2OMO A;  1QTM A;  2GQQ A;  3MTK A;  3L4B C;  4OHX A;  2D9O A;  4URS A;  4PG6 A;  3SEO A;  4ILR A;  3PDN A;  5F9N A;  5EWG A;  1PIE A;  4IOB A;  3T9Z A;  2XEX A;  1A6L A;  1T05 A;  4UZC A;  2VAS A;  5E3C A;  2DRB A;  2MB0 B;  2QSF A;  1B7F A;  1XMO F;  4K8R A;  1L5U A;  3W2W B;  4NA2 A;  2D3Z A;  4DSI A;  2E5G A;  2XQC A;  1FXR A;  4KT0 C;  3FQL A;  3AD9 C;  2IC3 B;  2B5J B;  1OSD A;  2I5J A;  5BR8 F;  1PAU B;  1WJ9 A;  4PKD B;  2HNY B;  5EWF A;  4F04 B;  4WII A;  3T6J A;  1UJ5 A;  4NLY A;  2OEK A;  1HBM B;  1RTJ B;  4Q44 A;  4KBI A;  4DS5 A;  4DR4 F;  4CLZ A;  1MWY A;  2BQ3 A;  2ZE2 A;  4KIA A;  3TJ9 A;  4ID8 A;  1SH2 A;  2UUC F;  2AIR B;  1R8B A;  1HMV B;  3ICL A;  4YR2 A;  5KFW A;  2DNZ A;  3NBP A;  4RW7 B;  1N8R T;  2CAJ A;  3Q2S C;  1FDD A;  4HI1 A;  2EXU A;  5HAO A;  3RB6 A;  1FJE B;  2DHX A;  4J9Q A;  2EFO A;  4UQG A;  4A8O A;  2JOQ A;  4LRA A;  3W65 A;  2MLY A;  5A76 A;  2ZZN A;  4KSE B;  3H98 A;  4KKO A;  5D4L A;  3J7Y I;  1ZYQ A;  2L08 A;  3R1L A;  4P7T A;  4M5J A;  4TU8 A;  3BM7 A;  4IO1 A;  2K3I A;  2E1C A;  2DGQ A;  1PBU A;  2N4D A;  3KK1 B;  3TAN A;  4PXE A;  3H25 A;  3BPD A;  4K50 A;  5KFF A;  2ZHB A;  4DPY A;  1TL7 B;  1KTQ A;  1N5T A;  3MM9 A;  1ZBT A;  2V2Q A;  1UP1 A;  3M8Z A;  4CTA B;  2XY6 A;  1I1G A;  1V3S A;  4I69 A;  1VQ7 S;  1R8P A;  1M5V C;  3DNC A;  1IQT A;  2KT2 A;  4LF7 J;  2B0G A;  3JTN A;  4UOH A;  2J6S A;  2ZH9 A;  4YDX A;  3HZG A;  1MG7 A;  2B9E A;  2DXE A;  3Q8R B;  3G6E S;  3WHI A;  3G9C A;  5LOQ A;  1BWV A;  3T5H A;  2HHU A;  4DBQ A;  2J0X A;  1KQK A;  4FXW A;  1FF2 A;  2B4U A;  3MM5 B;  4M8L A;  1PGZ A;  1V9O A;  4DEZ A;  5K14 A;  5M2R A;  5F9L A;  3QT5 A;  4ZPD A;  4B9N A;  1WHX A;  2GQ2 A;  5I42 A;  1U02 A;  3N9U C;  2DEI A;  3T19 A;  2YQ3 A;  3OSN A;  1MRO A;  1FNM A;  4C8L A;  3CIM A;  1RT5 B;  4QU7 A;  5D0R A;  3SZ2 A;  1D0E A;  4NAS A;  2V4Q A;  1TL5 A;  2WHO A;  4YR3 A;  4DFM A;  2HFN A;  1MN7 A;  4HI2 A;  5E41 A;  2D1C A;  5KFL A;  3ENA A;  1PO6 A;  2V5H G;  3H2V E;  1HNZ J;  4Y65 A;  2F8H A;  2F8E X;  5HAN A;  4I67 A;  5GAH U;  3EDQ B;  4ZS6 A;  3EIC A;  4NYO A;  2QC3 A;  3C15 A;  4NL5 A;  4JI6 J;  4DSL A;  2CNN B;  2H4Y B;  2F4F A;  4MIB A;  4DS4 A;  4H4O A;  4PWU A;  3PIP Q;  4DUZ F;  1FKO B;  3H2U B;  3V5R A;  3SV3 A;  1Q82 T;  1H3D A;  1WF0 A;  2ZH3 A;  2MLX A;  4DR7 J;  1VRU B;  2HK2 A;  2C3M A;  5LM7 E;  5DS7 A;  3W8G A;  4GMK A;  5KAK A;  1KC8 T;  3HM9 A;  1CUL A;  2AEJ A;  1NSP A;  3W60 A;  2BR0 A;  2KJW A;  2W9C A;  1RTI A;  3QRP A;  4MKY A;  3EGZ A;  3KUE A;  5J2Q B;  3GG1 A;  1ZZF A;  2MKH A;  4ILL A;  2DGX A;  3FUY A;  1RWK B;  5T7L A;  5BR8 J;  4WTY A;  2ZHO A;  1IUJ A;  1Y11 A;  4WU2 A;  1R6Y A;  4UOF A;  4OX8 A;  4AL6 A;  1KTV A;  2M0G B;  5D77 A;  4BWM A;  1SQG A;  1HHT P;  2FPH X;  2E5L F;  4WZM A;  3HP6 A;  4DR4 J;  2YH0 A;  1T3O A;  2CFX A;  1XBW A;  1ZM2 A;  2UUC J;  3DKD A;  3CNQ P;  4QWE A;  3JSM B;  2K1R A;  4HH1 A;  3CE8 A;  1SPB P;  3D0I E;  3IR7 B;  1IJF B;  1WF2 A;  1HR0 F;  4DQP A;  1SQE A;  3DLJ A;  1Q5Y A;  2XO7 A;  3P45 B;  1YVF A;  4ZPC A;  2HVZ A;  1UWA A;  5DGA A;  2DXD A;  3MHY A;  2D3O R;  3UI3 A;  4ZLN A;  2DIU A;  3I31 A;  2MQQ A;  3PW4 A;  1V3R A;  4C0H A;  2RE1 A;  4ZMM A;  1QAJ A;  2MZ1 A;  1NHU A;  1RWW B;  4ID5 B;  2NQP A;  1Y7P A;  3MM7 A;  3UE2 A;  4WTO B;  4B3T F;  4PQU B;  2Y1J A;  4O3P A;  4Y28 C;  5J2N B;  2JHE A;  4DR2 J;  1QE1 B;  1R31 A;  3DRR B;  3IBF B;  2V63 A;  2M2B A;  2YNF A;  3PW0 A;  1PYO B;  3VGT A;  1GX5 A;  2VON A;  1BD6 A;  1UFL A;  3QLH B;  4DSJ A;  3BR9 A;  5A8K B;  1S79 A;  3NRB A;  3D7S B;  4K7Q A;  2AJ0 A;  4NZ6 A;  2W2N P;  4C11 A;  3ZZT A;  1SC1 B;  1UET A;  2V8H A;  3KLF A;  2VUG A;  4M5D B;  2LLZ A;  1Y3K A;  4RUH A;  3TP2 A;  5ETP A;  4K4S A;  1RIS A;  1YZ7 A;  2FJA B;  1YBU A;  5J2P B;  4CH1 A;  3IRX A;  2I8E A;  2AX0 A;  3MGJ A;  3DN9 A;  1MU2 A;  2DYA A;  4UOC A;  4ERD A;  3UN3 A;  3C6U A;  2DY9 A;  6FDR A;  1HPZ A;  3PAC A;  4DFP A;  3OL7 A;  4G6V B;  4U9R A;  4G1I A;  4K2J A;  2MZT A;  3TEH B;  2R2S A;  1K9M T;  1TK8 A;  3NL0 A;  4F3Q A;  4YUD A;  1FK9 B;  4DR5 F;  3ZZR A;  1XC9 A;  2MQO A;  3SCL E;  1YSJ A;  2R4F A;  3TNV A;  4EK2 A;  4RUA A;  3ZTP A;  4M5H A;  4EMD A;  1YJN S;  5DM7 Q;  1HKA A;  4OYZ A;  5ETO A;  2Z4P A;  4X66 F;  5KFM A;  3THV A;  1NK7 A;  3LPE A;  3MMJ A;  2XMT A;  1DAX A;  1RWN B;  4EBD A;  3ISN D;  1KLN A;  2R2U A;  4OJG A;  4UST A;  1KVJ A;  2R7W A;  2KVQ E;  4DUZ J;  4MAK A;  2NPI A;  1M5P C;  5L9X A;  1NDK A;  4USJ C;  2DNM A;  2XS5 A;  4ZP7 A;  4YR0 A;  2VU5 A;  2ZBI A;  3RYL A;  3CJK A;  1BWE A;  3QT6 A;  4U95 A;  3THT A;  4XPE A;  1S7H A;  5A2Q Y;  2ZZM A;  2DNL A;  3AD8 C;  4B02 A;  4ELT A;  2K06 A;  2UV8 G;  2J0W A;  4EGL A;  3SXL A;  7FD1 A;  1N88 A;  2V8G A;  3HK2 A;  4HAC A;  3GG0 A;  3DLG B;  5EX0 A;  3EVW A;  3EX7 B;  3VGU A;  4TY9 A;  4NRT A;  2ATC B;  4NLD A;  1ZAW A;  1NK8 A;  1Y3J A;  2U1A A;  4ZN3 A;  2GS8 A;  3HVW A;  3RW6 A;  1CJT A;  3UD4 P;  1DLO A;  2PFD A;  3ZZ0 A;  1Y9O A;  2W2Q P;  1R7I A;  4NXM F;  3QT7 A;  3MUT P;  1IN0 A;  3O6Q A;  4QR1 A;  3MMC A;  4RW4 B;  2MJU A;  3QRQ A;  3WX4 A;  3KK2 A;  1H6K X;  4NLW A;  1BY9 A;  4WPA A;  4DSF A;  2Z2M A;  2FJV A;  3I96 A;  3NY0 A;  4MIA A;  4CLU A;  2HQI A;  1WWH A;  2KTQ A;  3AY0 A;  2J9D A;  2E1A A;  3H7H B;  1U2C A;  1UW9 A;  4DQR A;  1RT2 A;  1N56 A;  3CUN A;  4ZVQ B;  4LFB F;  3W2V B;  2DIV A;  1NBE B;  2WW8 A;  2J9E A;  3GIJ A;  1R8H A;  2EEY A;  2HHX A;  4KKO B;  2VG6 B;  2F9D A;  4CM0 A;  1X5P A;  2VDH A;  3GV7 B;  1UVJ A;  4QIW D;  3ZO7 A;  5EWE A;  2Q6B A;  1HNW F;  3J81 U;  2LCW A;  1KHV A;  2MYF A;  3LAN A;  3S8S A;  4F0M A;  4B3T J;  2Y8W A;  1UWB B;  2EC2 A;  1NME B;  1RKI A;  2DRD A;  1WC1 A;  3DOK A;  5ETS A;  4CLF A;  1S1U A;  6AT1 B;  2ZH7 A;  3AOA A;  1B0V A;  4PYD A;  1UPP A;  1KSP A;  2WBM A;  1GMW D;  1KD1 T;  3CCW A;  4JYA F;  2LKZ A;  1B7Y B;  4QIV A;  2WON B;  4WYL A;  3CUL A;  2HVD A;  4FS1 A;  2IM0 A;  3QJJ A;  4F36 A;  1HW8 A;  4OJ1 A;  3G6Y A;  4E98 A;  2G0I A;  4QBU A;  1HBN A;  4L6V 3;  1APS A;  4DUT A;  1NJI T;  3HD2 A;  4JI7 J;  4KGX B;  2MZJ A;  3KYL A;  4LIR A;  2F9J A;  1X9M A;  1TZ0 A;  1WTB A;  4EZ9 A;  3HSZ A;  1JXE A;  2DNO A;  2R8J A;  4ED4 A;  1RT7 A;  1W25 A;  2IAJ A;  3L09 A;  2OPQ B;  4X65 F;  4J9O A;  4F7V A;  1FJ7 A;  4CT8 A;  2V0N A;  2HBQ B;  1FRJ A;  4PXB A;  1GT8 A;  5K8M A;  2XS2 A;  7AT1 B;  1NH8 A;  2R9L A;  1YBA A;  2B4V A;  1SUQ B;  1NJX A;  1HWL A;  4DR5 J;  1T9U A;  1SV5 B;  4HDH A;  1JLC A;  2LVW A;  3BBC A;  2NPF A;  4LFC F;  4C4W A;  1RT3 A;  4ZCI A;  4ZJO A;  4QJV A;  4X66 J;  2DHA A;  1C0U A;  2G1D A;  4Y0F A;  1UA1 A;  3WDO A;  2OO4 A;  4ED5 A;  2YNG B;  2L3M A;  2QMW A;  1AUS L;  1H73 A;  2OAU A;  4R0E A;  3LWL A;  3DU5 A;  2XSJ B;  1AT1 B;  3DYA A;  5I3U A;  3QWU A;  4QIF A;  2BJ8 A;  1BGX T;  1S10 A;  2CQB A;  3MAA B;  5DDQ C;  1FFG B;  1HWJ A;  1FFW B;  3BH6 B;  2IM3 A;  2DH8 A;  4IH6 A;  3GSI A;  2LXF A;  1FJG F;  2C2M B;  1IBM F;  1F9E B;  3TI0 A;  2BYC A;  2WAQ D;  1AXQ A;  1EAY C;  5BYQ A;  4KH0 B;  1IKX A;  1SXL A;  1WHV A;  1RLD A;  2NRE A;  4P9S A;  3MEC A;  4WP9 A;  4LRF A;  1QM9 A;  4K5S A;  4G3I A;  5AT1 B;  1CC7 A;  1MW7 A;  4USI A;  5IC4 B;  1VIX A;  2W4D A;  2JLG A;  3RAM A;  4D3G A;  1VQ6 S;  1IKW A;  4CT9 A;  2OPR A;  3W5Y A;  2IYI A;  2ZJP Q;  2GGP A;  3BQ0 A;  4PAB A;  3JSY A;  1VJQ A;  1RUS A;  1XN9 A;  4C3L A;  3W7B A;  2KXH A;  1U1M A;  4NXM J;  3D1O A;  5K20 B;  4S0M A;  4TYA A;  2G2O A;  2KXF A;  1WKK A;  1NUE A;  4NML A;  4RBT A;  4LF2 A;  4WFY A;  5IXU A;  5KFB A;  2XM3 A;  1SC3 B;  1X5T A;  1PCA A;  1FVQ A;  3GJT B;  3K5M A;  5CD4 A;  1U1R A;  2ZD1 A;  2VF3 A;  4URQ U;  4WKY A;  1TL3 A;  2HZV A;  2AV5 A;  4YDD B;  4DFJ A;  4D3H A;  3FMW A;  5ETV A;  3DGP A;  3DI6 B;  2ZOM A;  4J90 A;  5J2M A;  4NXN J;  2MKJ A;  4OZN A;  3WZ0 A;  3QID A;  4AXI A;  1OY8 A;  1U1L A;  4JI0 F;  5DG8 A;  5IWA F;  4F0K A;  5G0R B;  2BW2 A;  1OWX A;  5C5J A;  3Q8P B;  1U47 A;  2CAD A;  4K4Y A;  5B0A A;  4A8F A;  4LBI A;  3D6F B;  1FWP A;  3R7N B;  2F40 A;  3UDV A;  1KQG B;  1KKH A;  3QNW B;  1HNW J;  4TU9 A;  3LAM A;  3MCO A;  3O3L A;  3CPW R;  3RRG A;  2V50 A;  1E6V A;  1JLQ A;  3ZTO A;  5HRO B;  4OYI A;  5C25 B;  2FLN A;  1E6Y B;  2QLF B;  3VHQ A;  2VBY A;  3BYR A;  4ALZ A;  4AXJ A;  4NWB A;  3N79 A;  1O6X A;  4M5N A;  4URG A;  2B9Y A;  1VQL S;  2OIH A;  4I7F A;  1F6T A;  2RS2 A;  3UW1 A;  5C24 B;  3EZU A;  1FKP B;  5KFZ A;  3KXD A;  1TL4 A;  5GAD I;  5B0G A;  4F4K A;  3EJM A;  3CD7 A;  5GAE I;  2I1R A;  2IA0 A;  4C11 B;  1N5S A;  5DRK A;  2GVZ A;  4EYH B;  2R8H A;  2HKE A;  1AB8 A;  4FF1 A;  4IG3 B;  4XDC A;  2CQ1 A;  4UUW A;  3G87 A;  1CS4 B;  1NZ8 A;  2CQD A;  3OR1 A;  4RU2 A;  4C3M A;  1WC6 A;  3VZI A;  4JI8 J;  3DDN A;  2A6O A;  1TV6 A;  1VCT A;  1KQS R;  4LBH A;  1WKJ A;  1S72 S;  4OX6 A;  2P6S A;  3E01 B;  2KZM A;  2XLJ A;  2Q3P A;  4B9M A;  4R5P A;  5GAG U;  1SH0 A;  1JQG A;  3J81 j;  1I3O B;  2BBE A;  5L1I A;  3LA0 A;  4DL6 A;  1M90 T;  2CNL B;  2KHD A;  2JC0 A;  1X4B A;  2OPP B;  4OI2 A;  5HJX A;  4YFU A;  2MQM A;  2BE2 B;  3SQG B;  2XWX A;  4NLG A;  5DG9 A;  4IH7 A;  2HWT A;  4CCH A;  3PVX A;  1QUP A;  1NK9 A;  2WSC C;  1R0B G;  3BB5 A;  1Q78 A;  3UR3 C;  5LMN J;  5F8N A;  3N28 A;  4CLW A;  1NHK L;  3G96 A;  1S59 A;  3T5J A;  3GYG A;  1TKT A;  3M8P A;  4LF9 F;  2FZC B;  2Z2Y B;  4R8U A;  5CD4 H;  1LWC B;  2RS8 A;  4B9T A;  3MDF A;  1VC0 A;  3NMA A;  2OD6 A;  3QSI A;  1F9F A;  3HDS A;  2QV6 A;  1IBM J;  2FLP A;  4OIX A;  2KB2 A;  2PT0 A;  1PYT A;  1S5Z A;  2WOM B;  4PG7 A;  2HVH A;  3SQO P;  5JVG Q;  4ZLL A;  2E5H A;  5B09 A;  2W4P A;  4RBU A;  2OPS B;  3OBI A;  2Y3Y A;  2CNK B;  1WI6 A;  4Z7C A;  4I6Y A;  1RTD B;  2RDJ A;  3PHE A;  2V2K A;  4DV6 J;  3IM9 A;  4CLK A;  2ZVI A;  4PG4 A;  1N0V C;  2UVU A;  4A47 A;  4ECW A;  2M7S A;  3PY8 A;  4P71 A;  4ZDN A;  4QW8 A;  2YKP A;  1JJ4 A;  2ZEJ A;  3OR2 A;  4O3O A;  4HTJ A;  2QX0 A;  5E3R A;  4Z37 A;  3MM8 B;  1SJR A;  3CDA A;  3CJQ A;  2CPY A;  4J5O A;  3EPG A;  2VG5 A;  3ILJ A;  3HFZ B;  1G6B A;  4ECZ A;  3G82 B;  1F3F A;  3ZTR A;  4JI2 J;  1RBA A;  3DHW C;  2VOO A;  4HVZ A;  1CJU A;  4L75 A;  1U45 A;  3NS5 A;  4NLX A;  4OYB A;  5LJ5 Y;  2DO0 A;  2IY5 B;  4H4M A;  3T9N A;  5D3G A;  2A0F B;  2Y1R I;  3FBC A;  1J5O B;  2VQF F;  3MEE A;  4EO6 A;  3FBB A;  4W92 B;  3ZZZ A;  4ZIW A;  4JI0 J;  4KPY A;  5IWA J;  3LP0 A;  5KG5 A;  3KDN A;  3KLG B;  2H9Z A;  3DRS A;  1WC0 A;  1FKA F;  2X1F A;  3DOM A;  4FYV B;  2J7U A;  2B6A A;  2BE7 D;  4DV1 F;  2DO4 A;  2M52 A;  1YWX A;  2WBR A;  3W5X A;  3T6B A;  1S1W A;  3KLI A;  2GJ2 A;  1UJ4 A;  2EW9 A;  4USK A;  3EGN A;  1VQN S;  3CDE A;  3B54 A;  4IOC Q;  5E2Q A;  2FJW A;  1R6V A;  3Q8U A;  3GIK A;  2QFI A;  2E7V A;  1FRM A;  2P9G A;  2KJV A;  2I0X A;  2WVF A;  2XWY A;  2BZ2 A;  1FD8 A;  2AGO A;  2HRU A;  3PKY A;  4QR2 A;  4HLB A;  4ZPA A;  1OPI A;  2UUW A;  2FHJ A;  2B3T B;  1XIQ A;  2E5J A;  3D6T B;  1N5Y B;  3O1L A;  4ECX A;  3R6L B;  4X62 F;  4F4W A;  2ZFH A;  1ZM3 A;  4OI1 A;  3JYT A;  1QVF R;  2HQ3 A;  3Q2T C;  3PG9 A;  3WC0 A;  3VVT A;  2HGL A;  5L1J A;  2VG7 B;  2DHH A;  1RYR A;  2LDI A;  4RW9 A;  3OFG A;  1VQ4 S;  4J91 A;  2MSS A;  4HH0 A;  4F2R A;  1KON A;  2GFF A;  4MFB A;  1BMQ B;  3N0V A;  3ISN C;  4NLR A;  2IAJ B;  1HBO B;  2OTL S;  3PHT A;  4NEZ A;  3MPW A;  3HPO A;  4C8M A;  4JI1 J;  1F2H A;  3SYZ A;  5KG4 A;  4DR6 F;  4ZVT B;  5KFX A;  4LF5 F;  1S57 A;  4QPT A;  3DLK B;  1R27 B;  2RNE A;  1JLE B;  3CC4 S;  1UVM A;  1UTA A;  2VHG A;  1RAI B;  2CIM A;  4CYU A;  2XMK A;  4NI2 B;  3GYN A;  3HD1 A;  2JL9 A;  2JFD A;  3PW2 A;  4MH8 A;  4WP8 A;  4EBC A;  5U47 A;  3SMZ A;  2UU9 F;  4RLE A;  4X4S A;  2Z2L A;  2NYH A;  3L95 X;  3J7A N;  3C6T B;  2CWX A;  3QGG A;  1VQ9 S;  2FDN A;  2PD1 A;  4LF9 J;  2HS4 A;  3KHR A;  2KDO A;  2MZS A;  4B9U A;  2C2D A;  5HMX A;  2IVF B;  3NNA A;  2RHQ B;  2GAG C;  1R8C A;  1WSR A;  4KHR A;  1CJK A;  2GC8 A;  4C8O A;  2F63 A;  4CRJ A;  4OI3 A;  2NXJ A;  4L3N A;  3RG6 A;  2IDE A;  5T41 A;  4V1A k;  3RB3 A;  3CJT A;  2YPY A;  1S6P B;  1O0P A;  4W98 A;  5IT9 Y;  2CJB A;  2H5I B;  2MGZ A;  3PFO A;  3QZ8 A;  3DM2 A;  3IMQ J;  1Y0H A;  2HHH F;  1U0H B;  2KYX A;  4OYP A;  1LW0 B;  4FYD A;  4CLY A;  1T8E A;  1Q5V A;  4RNN A;  4XDD A;  1WC4 A;  1FEE A;  1DJ0 A;  3HFK A;  4F02 A;  1YIT S;  5KT7 A;  1DUR A;  1WF1 A;  1JLB B;  5KOW A;  2ZD1 B;  1NZA A;  4C97 A;  2CPF A;  1KDN A;  2ASL A;  3R9L A;  2AQ4 A;  4JV5 F;  2FIU A;  1IKY A;  2H3E B;  3VVU A;  1NSA A;  3TA2 A;  3HO1 A;  1BXN A;  4XAK A;  3DRP B;  3OHA A;  1BQM A;  2VA3 A;  3IG1 A;  3DLH A;  5HVH A;  3BGR B;  3SSR A;  2BV3 A;  2NS1 B;  3PRB A;  5A0Y B;  5LT5 A;  1G1X A;  2RRN A;  4QU6 A;  2VQF J;  5T14 A;  2RT3 A;  1Q7L B;  1V5V A;  3LF0 A;  5AE1 A;  2LXU A;  2UXB F;  2D41 A;  1MMD A;  3ZNU A;  4GVB A;  3HHK A;  2PMW A;  4KGM A;  3GFZ A;  5IT0 A;  3LOU A;  3M8S A;  1IR0 A;  2Q6C A;  2NSC A;  3AJ2 A;  3QO9 A;  4GC6 A;  5IFM A;  4QWA A;  1RAC B;  1ZTW A;  1RTH A;  3I0R B;  2YH1 A;  1FFS B;  2AJQ A;  1S9E A;  1Y4Z B;  2BAN A;  2RQM A;  2M5Y A;  4HEA 9;  1SC4 B;  3GYX B;  3M6X A;  5CYQ A;  2ZDP A;  2DGV A;  4M94 A;  5DDR C;  1YDL A;  5ETN A;  3Q23 A;  2ILY A;  3KDO A;  3CCT A;  2G0J A;  2MKK A;  4X4V A;  2O67 A;  2CPJ A;  4NYZ A;  4OJ3 A;  3V6K A;  1HAR A;  1BE4 A;  2RKI A;  4F2S A;  2PE8 A;  3H40 A;  2RJZ A;  3NS7 B;  1Z2L A;  5DDO C;  1H98 A;  2CJQ A;  4FN5 A;  2CVE A;  2EVZ A;  2B8Q A;  4W4M A;  1TV6 B;  2OEM A;  2ROP A;  3NGT A;  5JMN A;  3VR1 A;  5L39 A;  4RNO A;  2O5D A;  4NOH A;  1LXN A;  2V6A A;  3PEJ A;  2VQE F;  2CQG A;  1NRK A;  1JLG B;  1F1B B;  4OYO A;  3TWZ A;  3V4I A;  1VQ5 S;  4HYK A;  3DLE B;  3RBE A;  2DGU A;  2RU9 A;  4DR6 J;  4IFY A;  4Q2L A;  1GTE A;  3UN5 A;  1L3T A;  2BOP A;  2C3O A;  3OD2 A;  4UUX A;  1X9S A;  1CJV B;  1HD0 A;  2YNI A;  3NGR A;  3CJ4 A;  4UY8 T;  4DL5 A;  4DG1 B;  1QUV A;  5L9N A;  3M2R A;  4ES3 A;  2CQH A;  1XWL A;  4OZL A;  1FT8 A;  4LSN A;  2BMB A;  3BO3 A;  2R3V A;  1CBK A;  2FJX A;  4ECQ A;  3QGI A;  3M8P B;  2R2R A;  3Q8V A;  2MQL A;  4LR9 A;  2XBP A;  1N0U A;  2GX8 A;  4O3Q A;  2H51 B;  4XIU A;  2CDR B;  1I6J A;  3AOB A;  3TVK A;  1TL1 A;  3HHL A;  4MIW A;  4QOT A;  1TKX B;  3MFH A;  4LQ9 A;  4CO1 A;  3QRR A;  3ZZU A;  2ZBQ A;  1D9F A;  3T41 A;  3TO8 A;  1GK8 A;  4ZVP B;  1R89 A;  5KFG A;  3RZA A;  2VJU A;  5B0B A;  2X7I A;  2V9W A;  3AT1 B;  3UQS A;  1ZA1 B;  4TQR A;  3MCN A;  2G9O A;  3UN2 A;  2RIJ A;  4WXW A;  1S9G B;  4B3M J;  1SL2 A;  4DXL A;  2WZ1 A;  2Y8Y A;  5AXL A;  2Y0S D;  4NE9 C;  3RBD A;  2UXC J;  4NLS A;  1JIH A;  4DR1 J;  1K47 A;  4DQS A;  3IP0 A;  3W2W A;  2E7X A;  2ZH2 A;  1TVR B;  3L7P A;  3J7A 1;  2HMI B;  3VQS A;  5DLF A;  2U2F A;  1QTN B;  3FEZ A;  2ZOG A;  4DL0 C;  4DZ6 A;  3M2U B;  2IC3 A;  1C4A A;  1SJ3 P;  2B5J A;  1M5S A;  4ZJQ A;  2CJ9 A;  1ZAV A;  3TAM B;  3B4D A;  1TUG B;  3BO4 A;  5DM6 Q;  5KFE A;  2CZ4 A;  1YHQ S;  2ZBP A;  1HI8 A;  5GVQ A;  3M2V B;  1QJH A;  4OL8 A;  3ELH A;  3JQK A;  1HBM A;  4LFA F;  1RTJ A;  2ZBC A;  3CJ0 A;  3VWS A;  3EXC X;  2PO4 A;  5FD1 A;  1OO0 B;  3ITH B;  2R2T A;  2R7T A;  4ECR A;  5DGB A;  4ZLP A;  3IXQ A;  4RZR A;  1HMV A;  1VBX A;  2UXB J;  2CG4 A;  3CXC R;  4B17 A;  4P2S A;  3P3D A;  4RW7 A;  4A8W A;  2P9C A;  5DJB A;  3OW2 R;  2XO6 A;  3FSY A;  2YNH B;  3MAQ A;  1OMS A;  4NMX A;  1OYE A;  2XZD B;  1A0O B;  1NPR A;  3FDS A;  3W9J A;  5F0U A;  5IV4 A;  3NLC A;  3G8S A;  5K8N A;  2Y1L B;  5F3T A;  3MUM P;  5GMD A;  1MSW D;  4OI0 A;  5G4D A;  2YWK A;  4DV5 F;  5A8R B;  4DV3 F;  4PWD B;  1J27 A;  2E1M C;  3FEX B;  2C2K B;  3PYG A;  4ECY A;  2YWG A;  1U25 A;  1TL7 A;  4LF1 A;  5HP1 A;  2BEF A;  4DPX A;  2JEJ A;  1Y5N B;  2Y0B B;  1RDR A;  3JXO A;  3JYT B;  4CTA A;  1U1O A;  2Z57 B;  4TY8 B;  1YBT A;  2BM1 A;  2AYM A;  3M6W A;  4FS2 A;  1PAE X;  3IAM 9;  3BSA A;  3H5U A;  2BJ1 A;  2VOD A;  3HUL A;  3GJR B;  2CJX B;  2B43 A;  2HWH A;  5KFI A;  1X4F A;  2J7K A;  1MML A;  5HMW A;  1HQE B;  1RA6 A;  2N82 B;  3R97 A;  2E1P A;  4ZVU B;  1Q8L A;  2K8G A;  3RR7 A;  3MM5 A;  1HQU B;  4LUB A;  2HVI A;  1N5Q A;  4P52 A;  2J6T A;  1WC5 A;  1WEY A;  2J76 E;  3BV8 A;  1RSC A;  2C3Y A;  2B7B B;  3P4U B;  1QLN A;  1RT5 A;  2D3U A;  4DCJ B;  2EPI A;  4WFB Q;  2BJ7 A;  1VYA A;  4QYZ K;  2AJ1 A;  1X5S A;  2N7Y A;  1UEV A;  3VAI A;  2F7V A;  4DZD A;  2VDI A;  4C3K A;  4M63 A;  5B08 A;  4YHH F;  2JSX A;  1T11 A;  5E3P A;  5C2G A;  3ET6 B;  3K2Y A;  3HZE A;  1R3N A;  4EYI B;  1Q1K A;  3M8Q B;  3FRY A;  1U2R A;  1R0A B;  4NCG B;  2IDL A;  4RKU C;  2KFY A;  5KT2 A;  5IQ6 A;  1XNQ F;  3UVJ B;  3IRW P;  4ELU A;  3OV7 A;  2NXE A;  4U8Y A;  1S1X B;  4USU A;  1TKZ B;  5CYM B;  3NCR A;  1FKO A;  1RAB B;  1VJW A;  2QA4 G;  4I2P B;  1LV5 A;  1VRU A;  4QW9 A;  5ETK A;  4IKA A;  2MGZ B;  3PV8 A;  4X2B A;  3HSG A;  2WVB A;  1A7G E;  2FZK B;  2N3L A;  1HIY A;  1RAA B;  3O44 A;  3D9B A;  4KHM A;  3PIO Q;  1VS3 A;  4BBY A;  3MAH A;  2QA4 S;  2OML A;  4USM A;  4C8K A;  3C46 A;  5CCM A;  1PG5 B;  4BC9 A;  4DPT A;  1ITP A;  5J2Q A;  3OJS A;  3VGV A;  2BX6 A;  1BLU A;  3W66 A;  2JVR A;  4UOG A;  2YX4 A;  4UT4 A;  4V19 J;  3B8H A;  2GCF A;  2HAI A;  2BXJ A;  2EK6 A;  3HMJ G;  3P8B B;  1N54 B;  2HIQ A;  1EKS A;  2JDJ A;  1VRT B;  4TKT A;  2OFH X;  3MZI A;  4ZPW R;  2H5E A;  1AA1 B;  1Z2Z A;  4PRF A;  1MNE A;  2CWK A;  1M1K T;  4LT6 A;  1KFD A;  2K3K A;  3WBZ A;  4U7U D;  1D9A A;  2UVR A;  4B08 A;  2XNR A;  1RT1 B;  2OH2 A;  1VFJ A;  1LEO A;  1KQF B;  1UKU A;  3FCV A;  2C1E B;  4MT1 A;  3JSM A;  3GWC A;  2JEF A;  2FHJ D;  3NMR A;  4J7C A;  4Q8E A;  1W2B R;  1IBL J;  3FBE A;  4RR5 A;  5EX3 A;  2Z8Q A;  5J1E B;  3GIL A;  1UZH A;  4Q43 A;  1HNV B;  4GO7 X;  4K4U A;  1S77 D;  4PWW A;  1QVG R;  1GXT A;  2R8G A;  1RWV B;  5F8J A;  2BM0 A;  2C2R A;  3MR7 A;  2H1Y A;  3UD3 P;  1T7P A;  3THP A;  2HPU A;  4N76 A;  2HND B;  5I3P A;  3RB0 A;  1NAQ A;  2HSE B;  3IA0 A;  3CDW A;  4ZKA A;  3CF5 Q;  1FJC A;  2BRK A;  3KHG A;  5CAB A;  4ID5 A;  4PPD A;  3V2U C;  1BQN B;  3RBZ A;  3HVR A;  4PQU A;  3GR0 A;  4G1Q B;  2XB2 D;  1DQ8 A;  3I9Z A;  5J2N A;  1B64 A;  2XCA A;  1QE1 A;  3DRR A;  3R2D J;  1Q8K A;  5KFP A;  3QFW A;  2DB1 A;  3FC9 A;  3M1V B;  4IYQ A;  3PM9 A;  1HNI B;  3Q24 A;  2QLB B;  5DQG A;  3GQC A;  2CRL A;  3C3L A;  4Q5V A;  1D8Y A;  3D68 A;  2QN6 B;  1YJT A;  4A8Q A;  3QLH A;  2A1B A;  1IM6 A;  5A8K A;  2R7Q A;  2CPH A;  5SUH A;  4FKX A;  2FHK A;  2R7R A;  3DDK A;  4QR0 A;  2IVY A;  2NYI A;  4M5D A;  1FWL A;  2HBY B;  2BKN A;  1R43 A;  5H9F K;  3JAM U;  4F4Y A;  2GHW A;  1FE0 A;  3K5N A;  3M6V A;  4FDF A;  4IFV B;  3ZZY A;  2V2Z A;  5J2P A;  5BXI A;  2DHS A;  2ZBR A;  4ITS A;  5KFH A;  5BJR A;  5AXN A;  2COL A;  3BGO P;  2W24 A;  1S4E A;  1VHF A;  4FBT A;  1S49 A;  1P6T A;  3BPS P;  1CVJ A;  1PC5 A;  3R1H A;  3X1L B;  4ATN A;  1B3T A;  3HT0 A;  4AL7 A;  3M2R B;  3TJ8 A;  4WIQ A;  2ALZ A;  3BBB A;  1FK9 A;  5B7W A;  5FLX U;  4EEY A;  3NGU A;  3W61 A;  4KQZ A;  3V4M A;  5CAA A;  4OYW A;  1ZTT A;  4TXS A;  3NCQ A;  4YHH J;  5DZ7 A;  3EVM A;  3E2E A;  3MR5 A;  4FF4 A;  3Q8Q B;  5KT6 A;  1TL1 B;  1KR4 A;  3EWG A;  4JI6 F;  1UJ6 A;  3M32 B;  4WFZ A;  1KLM A;  2DNP A;  1N5V A;  4EO8 A;  4DCP B;  4O44 B;  4CZC A;  3K5O A;  4YQW A;  4OHZ A;  3DOL B;  3TUZ C;  4DR7 F;  3QYY A;  4MMO A;  3K0J A;  1HI0 P;  3SDE A;  4P10 A;  2N3O A;  5BYS A;  1VLO A;  2E9R X;  4EBE A;  3Q22 A;  3J80 Y;  3HJF A;  3MCM A;  2DEJ A;  3GU0 A;  5KFU A;  1TUV A;  2NUH A;  4H4K A;  4OHY A;  3D0G E;  3S7R A;  4BWJ A;  1S4F A;  3K8V A;  1RWO B;  1HHQ A;  2EFQ A;  3D5M A;  4I2Q B;  3FSI A;  5RUB A;  1FRX A;  3DLG A;  2ZJQ Q;  2GIR A;  2Z58 B;  5F8L A;  4DF8 A;  1SJF A;  2BA9 A;  2R8K A;  1T95 A;  4DX6 A;  1RU1 A;  5A6P A;  4N7T A;  4ES2 A;  1S6Q B;  4G65 A;  2QA1 A;  3MOZ A;  4N77 A;  1QSL A;  2CJK A;  3MPD A;  2J8A A;  2DNN A;  2KXN B;  3CED A;  2MMY A;  1EB0 A;  2QFJ A;  1UAW A;  3OLB A;  1NHV A;  4RW4 A;  2OEJ A;  2ZUA A;  2M8H A;  4TNO A;  5F8I A;  4IOA Q;  1K0V A;  2MLZ A;  4LVN P;  3FVY A;  3PW7 A;  4I68 A;  3GTY X;  3MF5 A;  4HTI A;  2CQ2 A;  5H9F J;  1ZS6 A;  1IR2 A;  4OZJ A;  3NNH A;  2IM1 A;  2FY8 A;  3SBM A;  1N32 J;  4C2M A;  5LL6 d;  3KUH A;  3BR8 A;  3W5Z A;  3W2V A;  3HI9 A;  1RU2 A;  3KLE B;  4DSE A;  2QTW A;  2MJN A;  1N48 A;  1HYS B;  4LSL B;  2AYE A;  2VJV A;  1LWE B;  5E0O A;  1FES A;  2VG6 A;  2VH7 A;  2FYX A;  1TQL A;  5C42 B;  1S0N A;  1VK8 A;  4OMF G;  2A2C A;  4BDP A;  2WVD A;  5F0W A;  4ZPB A;  3KLH A;  2MKI A;  4UY8 5;  3M8R A;  3BO2 A;  2XG8 A;  1TFW A;  3V6J A;  2ZKT A;  2V2V A;  2CKW A;  5HP1 B;  4DR2 F;  4Y2K A;  1UWB A;  3K5P A;  5EUH A;  3K59 A;  1UVN A;  1SJ1 A;  3UNY A;  2R7S A;  4J9M A;  4O3R A;  3HHN B;  1S12 A;  3BKU A;  1I94 J;  2ZNZ A;  2HVE A;  5D15 A;  1PJ5 A;  2K7J A;  4IH5 A;  3CME S;  1OY9 A;  4AD6 A;  2X1G A;  2XMV A;  2WON A;  1ICE B;  5KFS A;  4RUC A;  3JSR A;  3W63 A;  4UF4 A;  3LP1 B;  1B70 B;  3FJ2 A;  3VAG A;  3TAR A;  2UVW A;  4P7V A;  3OHB A;  3UDC A;  4RBV A;  4IO9 Q;  4RUB A;  4GKJ J;  1IKV B;  1LQ9 A;  1MWZ A;  1FVS A;  2QA2 A;  1RAG B;  5I4M A;  1DZ5 A;  4OLO A;  1REG X;  1KP6 A;  1N36 J;  4IG0 B;  2CJY B;  2ROE A;  3I9V 9;  2QZ8 A;  3EGW B;  3GFX A;  1TKD A;  3HHL D;  3ENV A;  2XLI A;  1T9X A;  2M4M A;  1C0T B;  3VV2 B;  2OPQ A;  3ZC4 A;  1Y10 A;  1KBR A;  4AUK A;  2Z30 B;  2EKN A;  5LSO A;  1SUQ A;  1WD6 A;  1HFE L;  4WFA Q;  2XI2 A;  3LPY A;  1VIO A;  3FSX A;  2LXI A;  3VQT A;  1SV5 A;  2CDQ A;  3H4B A;  4DQI A;  3JB9 k;  4QZV B;  2ADC A;  2JC1 A;  2HG4 A;  2DIT A;  5DET A;  2RIL A;  4OX9 J;  2GO8 A;  2VBZ A;  5HLF B;  4PG8 A;  3VAM A;  2PEH A;  4DUY J;  1XMQ J;  1PJ6 A;  4K59 A;  1I51 B;  2V68 A;  2IRY A;  2YNG A;  4MKB A;  4OYA A;  3QGH A;  5IQQ A;  4Q8F A;  2YXL A;  4C0B A;  3RAX A;  4WKR A;  3CCE S;  2XSJ A;  1NK0 A;  4F8R A;  1REV B;  4L74 A;  3OL8 A;  2BVZ A;  3MAA A;  1X4G A;  2CZ9 A;  4Y00 A;  1LNQ A;  4RWX A;  1JX4 A;  2Q66 A;  3TUJ C;  4Q2M A;  4JB8 B;  4NLT A;  1MLA A;  4B3R J;  4IDK B;  4OLP A;  3UCU P;  2VZ9 A;  2ZJR Q;  1VR6 A;  3PFE A;  1Y00 A;  2FC8 A;  4NLU A;  1FTC A;  3UPF A;  3BGU A;  3AD7 C;  4N8N A;  5FDL B;  3DDI A;  4AYB D;  1G7C B;  3AB4 B;  5B0F A;  2XSF A;  3U27 A;  4USH A;  5K8O A;  2DY1 A;  2VPX B;  2RML A;  4NZ7 A;  3SIP B;  3PEH A;  2XMU A;  4LBP A;  4RW8 B;  5IOL A;  3ZZO A;  1EP4 B;  1S48 A;  4PXC A;  4Y6I A;  3EUN A;  2LA6 A;  3S1T A;  3SSS A;  2YWW A;  2QLW A;  1VC6 A;  1RAF B;  5K9F A;  3RGI A;  4ZCM A;  1NKC A;  3MMA B;  1TUW A;  4NCA A;  4UTG A;  4RX6 A;  1TFY A;  2A18 A;  1WI8 A;  5KT5 A;  1X8D A;  5IT4 A;  3PX4 A;  4DX8 H;  3POT B;  5I3Q A;  3X3U A;  4DV2 J;  2VFT A;  4CWB A;  3I55 S;  4ED8 A;  1X60 A;  1RHM B;  4MYT A;  4DN0 A;  1EQM A;  3MMB B;  3SFU A;  3KMQ A;  3H20 A;  4U7U K;  1J5E J;  3DI6 A;  2EG2 A;  4AT1 B;  1F5A A;  4Y3C A;  1H0H B;  1JK9 B;  2DJW A;  2ASD A;  2B4P A;  2DNH A;  1U1K A;  2W9B B;  2QLX A;  1VBY A;  4U8V A;  4PUO A;  5HVF A;  5G0R A;  2ZUG A;  3QBC A;  4Z2X A;  2AP6 A;  3JTP A;  4B3O A;  2JEG A;  1WTF A;  1T9V A;  4FVC A;  4M5L A;  3JQJ A;  4B9S A;  5HRO A;  3FFI B;  5C25 A;  1WKL A;  2ZH5 A;  4ZA1 A;  1E6Y A;  3OTB A;  4CNZ A;  2E9Z A;  5EDW A;  3EPI A;  2A2D A;  4RJV A;  2D7S A;  2APO A;  2KFN A;  4P2M A;  1KNZ A;  5IM0 A;  4ZPV R;  3JSB A;  3CCJ S;  1ZM4 A;  2ZH8 A;  5C24 A;  2YBV A;  1FKP A;  2FJB B;  3KK3 B;  4X4P A;  1D8Z A;  4LMZ A;  2MTL A;  2GML A;  3R5A A;  1TAU A;  2GJF A;  4Y2A A;  1SIW B;  2ZC4 A;  1Z4U A;  4JI7 F;  1F3V A;  2M8D B;  3P6Y C;  1L3U A;  4IG3 A;  1TMM A;  2K2P A;  3BKF A;  3ZTS A;  4JP8 A;  1YZ6 A;  3OUY B;  1CS4 A;  4MK8 A;  3I4P A;  4K4X A;  4PG5 A;  3DMJ B;  2DVI A;  3LQV A;  3F44 A;  2W2M P;  4DU8 A;  4PAA A;  4DLG A;  1Z1Z A;  3CCQ S;  4WZQ A;  4IRD A;  1YQH A;  3E01 A;  3IWL A;  3CDB A;  1U6B A;  1FER A;  4J9N A;  3FK4 A;  3GJS B;  4TVA B;  2FUG 9;  2V8V A;  1BHN A;  2B8P A;  2HUR A;  2VA2 A;  3HXM A;  1FRI A;  4F4Z A;  4OV1 A;  2PFF B;  2VKZ G;  5HN0 A;  4EZ6 A;  5ADZ A;  2FTR A;  4HHU A;  1ZZN A;  3R5G A;  5HMY A;  2OPP A;  3P96 A;  2FVP A;  2KRR A;  2BE2 A;  3SQG A;  3JTO A;  2MZR A;  1Q8B A;  5GAD U;  4K4Z A;  1VK3 A;  3QIP A;  5GAE U;  3TUI C;  3Q8Y A;  3M30 B;  1NK4 A;  4UW2 A;  1KLM B;  4FYX B;  1QAY A;  1U8W A;  2UUB F;  5E33 A;  1LWX A;  1VQ8 S;  4U96 A;  3ZNJ 1;  1VGY A;  1NKE A;  1RJJ A;  4UQT A;  3SDE B;  3L3C A;  2HGM A;  1LWC A;  4I6W A;  4ZCL A;  1DTQ A;  1RXO B;  4NLQ A;  3DXS X;  1X4D A;  4H54 A;  2CNO B;  1FRL A;  5DLG A;  4KO0 A;  5LSL A;  4X4Q A;  1U1P A;  1L3K A;  4KGK A;  1HWK A;  2WOM A;  5EN1 A;  3ULH A;  4E2F B;  3KWM A;  2E44 A;  2H48 B;  1WHY A;  3F73 A;  3SI8 A;  3D54 A;  2HGN A;  2OPS A;  3GSD A;  1P8G A;  5KTQ A;  4OZ0 A;  3Q0A A;  1RTD A;  3HSJ A;  3PJ9 A;  3BF4 A;  3OXG A;  1H38 A;  3HVA A;  1LK7 A;  1XR7 A;  4M95 A;  3OTC A;  3OLA A;  2NZC A;  2W25 A;  4LR8 A;  4EI2 A;  3MM8 A;  3OVA A;  2DR8 A;  1NB7 A;  3LAL A;  4ZP9 A;  3A3N B;  3A12 A;  4RW6 B;  4ED2 A;  2G2Z A;  3G82 A;  4R0J A;  3I0S B;  1RWP B;  2NZ4 A;  2WCX A;  2BE9 B;  4DL7 A;  3CGI A;  2FJE B;  2FB0 A;  1KN6 A;  1YJW S;  2UUA F;  1P27 B;  2MQP A;  4LF8 F;  2DR6 A;  3M9N B;  1X4E A;  3ENQ A;  5DDP C;  3V6D B;  3I4H X;  3EM1 A;  1X4C A;  3U1N A;  3PW5 A;  4NXN F;  3FNN A;  3K57 A;  4AL5 A;  2RQC A;  4NA3 A;  2ZVS A;  1J5O A;  2RDI A;  2P6T A;  4OX7 A;  4UZB A;  2J7W A;  2QRR A;  3RTV A;  2CQI A;  3M9O B;  1SCJ B;  1HHS A;  5A2Q U;  3KLG A;  1CG2 A;  1FNO A;  1M0S A;  3LUY A;  3CC7 S;  4RO0 A;  3IAS 9;  3KLH B;  5BYR A;  1CLF A;  5KFV A;  3EGV A;  4FPR A;  1TR0 A;  1GTH A;  4RPF A;  2QGF B;  5A8W B;  4I6A A;  2VPY B;  1UCN A;  5AJ3 J;  1XJW B;  3C8Y A;  4DX5 A;  2V34 A;  4FP9 A;  3UO0 A;  3VAJ A;  1IWG A;  3CIZ A;  1O8B A;  1WHW A;  1TAQ A;  2LP4 A;  2QL9 B;  1WOO A;  2VC0 A;  2ZNY A;  2V94 A;  1U4B A;  3MOJ B;  1JLF B;  4B3S J;  4ECV A;  5JUM A;  2AGQ A;  1S1V B;  5H1S V;  2BDP A;  5KOX A;  4BCA A;  1WG1 A;  3UDL A;  3MI7 X;  3NP5 A;  1D3W A;  4BHQ A;  3TQE A;  4YY3 F;  1N5Y A;  1RWM B;  1VQS A;  1NB2 A;  1IJE B;  2QL5 B;  1WNE A;  4OI4 A;  4U7C A;  2HHQ A;  1ACM B;  1MN9 A;  2GIF A;  3D1H A;  1YKW A;  3M8Y A;  2VG7 A;  1RCO B;  4ICL B;  2V69 A;  1FNX H;  4BLG A;  5KFJ A;  3ADA C;  3F0N A;  2DKO B;  5HQL A;  2VOP A;  3LP2 B;  1RE1 B;  4JI8 F;  5C2C A;  2LDY A;  4NEY A;  2QT7 A;  1LFP A;  2VBW A;  1HBO A;  4DPO A;  4C7Q A;  1YJR A;  2IFX A;  2N7C A;  1CPZ A;  1RHU B;  2Q1L A;  4HHJ A;  1EJ7 L;  5MLC V;  5ITH A;  8ATC B;  3IWX A;  1U24 A;  1VDH A;  3CJR A;  3DLK A;  4DV4 J;  1JLE A;  4KV8 B;  2WB1 D;  1UEK A;  5CA5 A;  3SCK E;  3PZP A;  4WK3 A;  2J0S D;  1JMT A;  4NI2 A;  5HBM B;  3WC2 A;  2XS7 A;  1AZS A;  5DQH A;  5JJB A;  4KYZ A;  3IWN C;  4K5R A;  4AND A;  2H4W B;  2GQC A;  4P73 A;  2I2Y A;  2MST A;  1FDB A;  4WE1 B;  5A6W A;  2I38 A;  1NXI A;  3W9I A;  5LMN F;  3C14 B;  1W7W A;  4I4B A;  4QPX A;  2ABY A;  2UUB J;  1SKR A;  3C6T A;  3CWJ A;  2LU1 A;  4YB1 P;  1RT4 B;  3NOG A;  3CCS S;  3FBF A;  3K5L A;  5CXT A;  4JV2 A;  2NXN A;  2KT5 A;  1SB6 A;  1C1B B;  3KJF B;  2F65 A;  2JVO A;  2CQP A;  1YX2 A;  3QGP A;  3O8W A;  4PZV A;  3RJM B;  4WU3 A;  2IBO A;  4O4G A;  2MPU A;  4ZLJ A;  2LQJ A;  2AMC B;  1BUX A;  3N5B A;  3N5F A;  1H2V Z;  3HVT B;  2C2N A;  1S6P A;  1XTZ A;  1DHM A;  5B0C A;  1NND A;  2AKW B;  1WG5 A;  2AZ1 A;  5LMU F;  2VD3 A;  4DV6 F;  2HHS A;  2EFV A;  2UXD F;  1D9D A;  1F0X A;  1FI4 A;  2G0C A;  1VQK S;  3MPU B;  1U0H A;  3GCX P;  4ZVS B;  1PIL A;  3NAH A;  1LW0 A;  2N4C A;  2VL1 A;  3SFG A;  3RB4 A;  5DG7 A;  2JX2 A;  1C1C B;  3PO5 A;  1WAC A;  1YI2 S;  1KOO A;  2ZC3 A;  3BH7 B;  4L76 A;  1X7V A;  1JLB A;  3M4X A;  1XNR J;  1G3O A;  2MKC A;  4JI2 F;  2DNR A;  2VV5 A;  2HHV A;  3H5S A;  3QQC D;  2Z56 B;  2UUA J;  4LF8 J;  3FZB A;  4C8Z A;  3DRP A;  2Y1I A;  3FQK A;  1RWX B;  2I6W A;  2YWH A;  3BGR A;  3QWP A;  5KG6 A;  5CYJ A;  2JRS A;  1T9W A;  1SH3 A;  5A0Y A;  3H5X A;  1FDN A;  3OVB A;  5THW A;  4GKK F;  2EG1 A;  4PUO B;  3AH6 A;  2KG1 A;  4DJB A;  1RLC L;  3D67 A;  2E66 A;  4JUZ A;  3OXF A;  2XLK A;  4B3O B;  1RKJ A;  3Q8S B;  2VFU A;  2VFS A;  1KVI A;  3UCG A;  4JV0 A;  4PCQ A;  1ZOT A;  3GFH A;  1X0F A;  3I0R A;  1FDA A;  4DR3 F;  3AQO A;  4HKQ A;  3TZX A;  4WFX A;  3C2P A;  4CQ1 A;  4TU7 A;  3LGH A;  5IM0 B;  1CEZ A;  4CO4 A;  1RGV A;  4DV7 J;  2HQG A;  1YRU A;  1DY3 A;  2DNK A;  2FVQ A;  2CPE A;  3HHL C;  3SV4 A;  1TK0 A;  3OT9 A;  2DBB A;  4Q7A A;  4ECS A;  3ENW A;  4ZVH A;  4YY3 J;  4DMZ A;  2MXY A;  4YN3 B;  1NPK A;  2AD9 A;  4B9L A;  2LQB A;  3FCW A;  4ZVF A;  4ECT A;  3O2I A;  3J7Z T;  1JLA B;  4OJH A;  1EET B;  2UV8 A;  1VRQ C;  3ZTQ A;  2FVS A;  2IYG A;  3T1H F;  3RW7 A;  3LAK A;  1N6Q A;  3IR6 B;  5AE2 A;  4JI1 F;  1N33 J;  3NS6 A;  1JLG A;  3OPK A;  3I56 S;  3HSD A;  3DLE A;  2B9X A;  2X3D A;  3CB4 A;  3BSC A;  3IN5 A;  2AYB A;  2F4V F;  2KN4 A;  2G13 A;  2JH3 A;  4R25 A;  2XUL A;  4CDI A;  3GZ7 A;  4TLQ A;  3BBF A;  3ISZ A;  2ALY B;  1UEU A;  1RAH B;  2R7U A;  4DV0 J;  5F8H A;  5KFC A;  1CJV A;  4A4J A;  5ETL A;  3QJP A;  5IS2 A;  3HT3 A;  3QIP B;  2C2O B;  5LSR A;  1B0T A;  2CQC A;  4DG1 A;  1BQX A;  1UFK A;  2RUS A;  1OYD A;  3PTW A;  3V81 B;  3R2C J;  3H4D A;  4X4O A;  3TAP A;  1XR5 A;  1MMN A;  4DI6 A;  2YVS A;  2H5J B;  3K17 A;  1S76 D;  1N34 F;  1DTQ B;  1EAR A;  3VAL A;  2AU0 A;  2HZC A;  1DBD A;  3UDE A;  2YKN B;  5ETQ A;  4ED3 A;  2JFK A;  4KO0 B;  1TKX A;  2X51 A;  3ONQ A;  2KHC A;  4L3K A;  4QQB A;  2XGP A;  1JWW A;  1UFW A;  2CA9 A;  2DGW A;  2DPI A;  2PSZ A;  1NEE A;  4KGV B;  3FEY B;  2FLO A;  4HHH A;  1WOR A;  2HFO A;  5MAO A;  2AJF E;  1X5O A;  3EXY A;  2ZH1 A;  3ZZP A;  1JXL A;  1J2V A;  4DPU A;  1H2T Z;  3US5 A;  1IBC B;  4FF2 A;  1S9G A;  3MM6 B;  5LMU J;  2DR9 A;  1PBA A;  2D69 A;  1K1Q A;  2UXD J;  5JXS A;  3N6L A;  3QMQ A;  5ETT A;  3LWM A;  1XMB A;  3QAU A;  3UWT A;  2DH9 A;  1TVR A;  5GMK a;  3KNG A;  5M2P A;  1C2P A;  2HMI A;  2LQ5 A;  4DDF A;  3BEG B;  3C16 B;  2W2O P;  1TU0 B;  1VQO S;  4F26 A;  1YJ9 S;  3KJV B;  3M9M B;  3M2U A;  4LF4 F;  2JEI A;  2R7O A;  3CVK A;  1KHW A;  2D74 B;  1XMO J;  1UZD A;  2QL7 B;  4ES1 A;  3MR2 A;  3TAM A;  3MEG B;  1M1H A;  1NK6 A;  3UCZ P;  2CQ0 A;  1ZH5 A;  1YRX A;  4CIO A;  3M2V A;  3IS9 A;  4KY3 A;  2V8D A;  4CLS A;  1T03 B;  2J5A A;  1YJU A;  4F50 A;  3TQ1 A;  3I32 A;  2Y9H A;  4F67 A;  3ITH A;  2F8M A;  4DPW A;  3OSP A;  1PSD A;  4PQA A;  4GKK J;  2EBE A;  1WOS A;  3DHX A;  4LQ3 A;  4KFB B;  5AXM A;  3W8P A;  2J9C A;  1DRZ A;  4HDG A;  1WSV A;  3A3O B;  1V6H A;  3M05 A;  3OXL A;  4Q0B B;  2YNH A;  3PJX A;  4O3N A;  3G71 S;  2DTJ A;  3IBW A;  2XYP B;  4USW A;  2MKY A;  4IR1 A;  2PMZ D;  2XMJ A;  3TX0 A;  2OTJ S;  3B78 A;  3KG1 A;  4QIG A;  2HHW A;  2XTJ P;  3NOC A;  4DR3 J;  3NEK A;  2X1A A;  2NSB A;  2AZ3 A;  2E9T A;  4MKA A;  4OV6 A;  1DTT B;  2CG8 A;  3CCZ A;  1FRH A;  3KLV A;  5A8R A;  3BN7 A;  4C9D A;  2EBG A;  5HSP A;  4CI0 B;  4PWD A;  1JJC B;  3N4W A;  1KFS A;  2RD5 C;  2W1B A;  1HWI A;  3LH2 S;  3PRV A;  3NWG A;  1GMV A;  3A4T A;  1RB0 A;  5J1P A;  4TY8 A;  2NXU A;  1WC3 A;  5D4O A;  4C98 A;  1WOP A;  2DCU B;  1YG0 A;  3OTE A;  1S99 A;  4DN9 A;  1ARO P;  2B51 A;  3IC1 A;  1HLW A;  3SCJ E;  4QWD A;  3GE9 A;  1P1L A;  2B7C B;  1SL0 A;  3G6X A;  3MWB A;  2A10 A;  3T1H J;  1HQE A;  3W1Y C;  2AEF A;  4DFK A;  2L9D A;  5L46 A;  4EUV A;  3ILI A;  3ZFV A;  4LSZ B;  5SZT A;  2P2C B;  1OS5 A;  3A8K A;  2M3D A;  1HQU A;  1U1N A;  3HLU A;  2GVD B;  4HT5 A;  1VBK A;  4XTT A;  2F4V J;  4OZ3 A;  2UVV A;  3ILL A;  1Q81 T;  2XY5 A;  1AZS B;  1TEL A;  1VQP S;  2AEM A;  2NUU G;  5HVG A;  2ZWP A;  4ZHR B;  2DR7 A;  4I0W A;  2V4J B;  2R8I A;  1B0P A;  3MXH P;  3FGV A;  4YOE A;  3DCA A;  3AJ1 A;  3D3B J;  1OIA A;  2E5I A;  1JKH B;  1ZPW X;  4CLT A;  2HRT A;  3ET6 A;  1N34 J;  1HW9 A;  3R5D A;  2HIY A;  1YJ7 A;  3M8Q A;  1DQA A;  4ZIT A;  2EK1 A;  4LR7 A;  1R0A A;  4NRU A;  4NCG A;  4O4G B;  1AW0 A;  1PJ7 A;  3NGK A;  3UVJ A;  1U1Q A;  3FZ2 A;  1LKZ A;  1S1X A;  3MD1 A;  1TKZ A;  5CYM A;  3LGN A;  2AW0 A;  1V3Z A;  4I2P A;  5L1L A;  1RT6 B;  5IC6 B;  3GMG A;  1FX4 A;  2P5V A;  3HJV A;  4B3M F;  1UVK A;  4M1K A;  4WYW A;  4RU9 A;  1LWF B;  2CQ4 A;  2HFS A;  3DRX A;  3O5T B;  1ZA2 B;  3TOQ A;  3MED B;  3TZZ A;  1WUU A;  2GAH C;  3A3P B;  3UR0 A;  2UXC F;  3CCU S;  4DR1 F;  1HBU B;  1X4H A;  1M5O C;  4JV1 A;  3KUG A;  9ATC B;  3PYE A;  2JWN A;  2OI2 A;  3HHE A;  2KT3 A;  2YKO A;  3TW0 A;  5HO4 A;  2HQC A;  1T05 B;  4ZCK A;  1U09 A;  2J8S A;  3C19 A;  4XPC A;  3PKM A;  1U26 A;  3J81 Y;  2DCL A;  3GR1 A;  4P74 A;  4LF4 J;  1UPM B;  3ILO A;  2UP1 A;  1NPP A;  3PXG a;  5IV3 A;  5E3A A;  1VRT A;  4QYR A;  2DGS A;  2I5J B;  1YTY A;  2W9A A;  4JI5 F;  2NXC A;  2I9S A;  1RT1 A;  3VCD A;  2MHE A;  1DFD A;  4N5S A;  2E5L J;  3BSN A;  4M5K A;  3QT8 A;  2AYG A;  3PR5 B;  2ZE2 B;  5J1E A;  2C2Z B;  4F3O A;  2HS0 A;  1HNV A;  1QDU B;  2E29 A;  2BRL A;  5IT9 U;  3KNA A;  5ETM A;  4OFZ A;  3NBP B;  5HK4 A;  2ERR A;  1XK8 A;  2VPZ B;  1QSY A;  5L1K A;  3TR5 A;  3K58 A;  4ZVG A;  4O3S A;  1HR0 J;  1ZPV A;  2RH3 A;  4U67 Q;  2BJ3 A;  2HND A;  2RQK A;  1QAX A;  1ZAX A;  2ZIT A;  3Q83 A;  2RUG A;  4OYX A;  1CQM A;  2YWE A;  1BQN A;  4KB7 A;  1YK9 A;  2MHN A;  4NLO A;  2G4B A;  4G1Q A;  2L9W A;  4JOU A;  2XCP A;  4ELV A;  1XER A;  4HR2 A;  1NDC A;  3M1V A;  2JLF A;  3W9H A;  1JB0 C;  1HNI A;  2HQF A;  3MM9 B;  2R7V A;  3H8Y A;  4ER8 A;  4WBF A;  2YTC A;  1V5I B;  4H4K C;  2CPX A;  2GZO A;  2KI2 A;  4L73 A;  4ZN1 A;  1N6Q B;  1JNR B;  1WEZ A;  1NDP A;  4A8Y A;  4FNH A;  1GH8 A;  5GAH I;  4P72 A;  4DF4 A;  3TZW A;  3UD5 A;  4IFV A;  1VC5 A;  3B82 A;  2J9D E;  2FGC A;  4X4T A;  4FF3 A;  5CCL A;  5K14 B;  2HFU A;  1JJH A;  4OZ2 A;  1SKS A;  4E8U A;  1RAD B;  3BKT A;  1ZET A;  1VHI A;  3ZXW A;  3KKF A;  5I42 B;  1T02 A;  4KR0 B;  3TVZ A;  1SC6 A;  1MRO B;  2NCK L;  4USV A;  3DFE A;  2IRX A;  2NR0 A;  2BQR A;  2HZA A;  4DWI A;  5EGY A;  2Z0G A;  3M32 A;  1P9Y A;  2W7A A;  1Y5L B;  2UZA A;  1U6Z A;  4O44 A;  5F8M A;  2RQ4 A;  2FY1 A;  3DOL A;  3IGN A;  4YME A;  3C15 B;  4A48 A;  2RAQ A;  3OFF A;  4X4U A;  2YWF A;  4ETX A;  1SL1 A;  3NWR A;  3Q86 A;  3TUP A;  1WDD A;  3KG0 A;  2PGC A;  4FXV A;  3GLJ A;  4H4O B;  2HLU A;  2BOA A;  2DRA A;  3TEG A;  4F3M A;  5HQM A;  2P8I A;  1L3V A;  4PYA A;  1HL6 A;  3UFC X;  1N4L A;  3G86 A;  3EMT A;  1OY6 A;  7FDR A;  3KTQ A;  4I56 A;  3N01 A;  1CUL B;  2HBR B;  2YX1 A;  4I2Q A;  5DQI A;  2GMJ A;  2KFZ A;  4PR6 A;  2HS3 A;  2KYZ A;  9RUB A;  2HK3 A;  3GIM A;  1PC4 A;  1UW4 A;  1M1G A;  2BJD A;  2W9C B;  5K8P A;  1RTI B;  1H7X A;  4QIE A;  2FVC A;  4KAI A;  5M2U A;  2VIC A;  3V6H A;  2OLW A;  2C22 A;  1S6Q A;  2LA4 A;  2W4C A;  4O0I A;  4N8O A;  4PXD A;  3IS9 B;  2WRM A;  1X31 C;  2RRA A;  3J7Z 5;  5T7L B;  3VAF A;  2LQ8 A;  4JI5 J;  5AE3 A;  3BGL A;  1U6F A;  2VBX A;  2R42 A;  3HX9 A;  3AOC A;  4CO3 A;  3T1Y F;  3BZQ A;  3D3C J;  4XO0 A;  1IBL F;  2IJN A;  2QIF A;  1GQE A;  4XK8 C;  3FRZ A;  2ATL A;  3CMQ A;  2IRU A;  1W2I A;  4LIW A;  2CUY A;  4IQM A;  4X4N A;  1JXV A;  4O4R A;  3KLE A;  5HL7 Q;  2LFV A;  4F4X A;  1FEH A;  2K1R B;  1HYS A;  4LSL A;  4Y2M A;  3RUB L;  1LWE A;  1FTR A;  2OKQ A;  1Q79 A;  2EFG A;  3G8Q A;  1KEK A;  5D0H A;  2VC1 A;  4Y2I A;  5C42 A;  1H7W A;  2XMA A;  3D2W A;  4LFB J;  1VI7 A;  3R6G B;  3NAI A;  1GAO A;  1GNK A;  3N6N A;  4NYP A;  1B99 A;  2VFV A;  4I1T A;  5F41 A;  2CJA A;  3I5C A;  3TAQ A;  5J1N A;  3IR5 B;  1Q0N A;  2GIQ A;  1L3S A;  2FZG B;  3MM7 B;  3W62 A;  3EVO A;  1MWQ A;  4A8X A;  1URN A;  3H42 A;  2MEW A;  1QSS A;  2KU7 A;  3LP1 A;  5HJY A;  1NSQ A;  3MFI A;  1T3N A;  2YNF B;  1AFI A;  3MUR P;  2DR5 A;  1Q86 T;  3AFG A;  3ETO A;  1S9F A;  2J0Q D;  4JYA J;  3H0P A;  1O5J A;  2PA8 D;  3E3X A;  1IKV A;  4ANE A;  4G1P A;  3J7Y U;  4C0O C;  3KLF B;  4KC5 A;  1F5C A;  4IG0 A;  4OI6 A;  1H74 A;  1YGY A;  5HMZ A;  2FGO A;  3P5B P;  5KFA A;  2YKM A;  3VAK A;  1C0T A;  1CQN A;  3CT9 A;  1F5B A;  3QPI A;  3SCI E;  1NCL A;  3IRX B;  1MU2 B;  1URR A;  4BS2 A;  1S97 A;  4LRE A;  3I82 A;  3BQ1 A;  2VIH A;  3C6U B;  3OFE A;  4YP3 A;  3TZY A;  1HPZ B;  3CJ3 A;  3I87 A;  1VQM S;  1YIJ S;  4LF6 F;  4X65 J;  2KO1 A;  3CO0 P;  4CO5 A;  2V8P A;  2OHD A;  5HLF A;  6FD1 A;  2GW8 A;  2FVR A;  1VMB A;  2DD8 S;  3LW5 C;  3G6V A;  2OSR A;  1JNZ B;  2FJD B;  3E51 A;  3VTI A;  2XI3 A;  1A9N B;  2Z2Z A;  1RWU A;  1GXL A;  4LFC J;  2Q79 A;  2P9E A;  1CSJ A;  1KWM A;  1REV A;  3CJ2 A;  1OQ6 A;  1CC8 A;  2HAF A;  5DO2 A;  3I5B A;  1NU4 A;  2EWH A;  3GII A;  1WEX A;  1ZM9 A;  1TK5 A;  3R5J B;  1FX2 A;  4IDK A;  2XC9 A;  2XZW A;  1UVL A;  1UA0 A;  3TVY A;  2KG0 A;  3AJD A;  2XYG B;  2IA6 A;  5D0E A;  4IRK A;  4KRW A;  3U7J A;  2QEX S;  3CJK B;  2B4O A;  3NGS A;  4JI4 F;  4W90 B;  1FJG J;  2O3D A;  3MUV P;  5FDL A;  2VPW B;  4V19 X;  1QY7 A;  4CLL A;  2GHP A;  2LYV A;  4RNH A;  4ZVR B;  2GA7 A;  1VIS A;  2PC6 A;  3WIV A;  1HA1 A;  2HWI A;  2ILZ A;  4HAC B;  1EKR A;  4J9V A;  1GEH A;  4DX7 A;  3AB2 B;  4RW8 A;  2EFN A;  4F4A A;  1EP4 A;  3AHP A;  2CZV C;  4F25 A;  1IVZ A;  4MYU A;  1CJT B;  4IQX A;  3TYT A;  4WFN Q;  1DLO B;  3MMA A;  1P1T A;  3GV5 B;  4NA1 A;  1K44 A;  2D3O 1;  1FE4 A;  1SKW A;  4DL4 A;  1RAJ A;  1O51 A;  4EU0 A;  3POT A;  2DGO A;  3MMC B;  3LTO A;  3T1Y J;  2IHR 1;  3F56 A;  3CW2 C;  2KRB A;  2ACM A;  4A8K A;  3RRK A;  1N32 F;  3KK2 B;  4WF9 Q;  4LJM A;  3MMB A;  1EZZ B;  1SJ4 P;  2MKS A;  2C28 A;  5CQG A;  2E7W A;  1OPZ A;  1NLK L;  3S6E A;  2WVC A;  2GNK A;  2C2E A;  5KFK A;  3HCX A;  2W8L A;  5B0D A;  2RU3 A;  2W9B A;  2MDA A;  3VF0 B;  1RT2 B;  2L41 A;  2OUG A;  4QYZ J;  3GB0 A;  3MD3 A;  2JNJ A;  2CVI A;  1NSK L;  2G2Y A;  4P2X A;  2W7O A;  1FXD A;  1WEL A;  4YB6 A;  3OTO F;  2UUT A;  3FFI A;  2CXE A;  4J9U E;  2V4R A;  5D4P A;  5F8G A;  4CLP A;  1Q53 A;  1I94 F;  2W7P A;  3T5K A;  2F1F A;  2QSW A;  4KHP F;  4N56 A;  2HQD A;  2H54 B;  1SQF A;  4DHV A;  2QG9 B;  1S6O A;  1TTH B;  1NJW A;  2EFP A;  3DOK B;  2BQU A;  1DAR A;  4LRD A;  3NNC A;  1S1U B;  2F5G A;  3KK3 A;  2QMX A;  2BAB A;  5KFN A;  4ZPT R;  4QWB A;  2HHP A;  1B4S A;  2FHM A;  3PYF A;  2BKO A;  3MTJ A;  4GKJ F;  1GX6 A;  1PYS B;  2FQQ B;  3OUY A;  2OEL A;  3KMS A;  4FNI A;  2OGU A;  2O01 C;  4WK1 A;  2FD2 A;  3R3T A;  1HBN B;  3DMJ A;  1N36 F;  4ZOS A;  2O66 A;  4TYB A;  1ELO A;  3BRE A;  1EX8 A;  2YQ0 A;  4FPI A;  1QD1 A;  2KH9 A;  2ZOF A;  5LXR A;  4NX9 A;  5DZ6 A;  1NJZ A;  2DNG A;  3G2X A;  1SJQ A;  3JS9 A;  4C8Y A;  1U2F A;  1RT7 B;  2M70 A;  2QYG A;  5KT3 A;  1TMJ A;  4NPO A;  1IQZ A;  1RP5 A;  4LF6 J;  4FZV A;  1RHJ B;  4OX9 F;  4CO0 A;  4DUY F;  1XMQ F;  3D1Q A;  3KJN B;  1XEZ A;  3L7U A;  4OHV A;  5KFT A;  1DQ9 A;  3B4M A;  4AQY F;  1HWU A;  1JLC B;  1FO1 A;  3M30 A;  2GO9 A;  4KJI A;  3OL6 A;  1RTZ A;  2VB6 A;  4I64 A;  3HKW A;  1RT3 B;  4Q45 A;  2PEB A;  2AT1 B;  4OYM A;  1C0U B;  3G8T A;  4ENO A;  4TLR A;  4LRB A;  2KL8 A;  3BS9 A;  1LW2 A;  4K4V A;  5D8H B;  1S1T A;  2X1B A;  2B56 A;  3AQP A;  3DYA B;  4B3R F;  4QCL A;  5CHC B;  4C6A A;  2E1R A;  5I3U B;  3WIU A;  1IWA A;  2OP5 A;  3A13 A;  4DU7 A;  3CSK A;  3TJA A;  3R5C A;  2GJI A;  3R7S B;  3W3S A;  1KRP A;  3DXB A;  3EE3 A;  4JI4 J;  1JJ2 R;  4TQS A;  2D9P A;  2EC0 A;  2J6U A;  4HT7 A;  1RBL A;  2WSF C;  1RI7 A;  3GFY A;  1IKX B;  1PKU A;  3KHH A;  2WVE A;  1M5H A;  3MEC B;  3W64 A;  5KFR A;  1U7L A;  2DH7 A;  3D6M B;  5D78 A;  1RHR B;  3P49 B;  1OSC A;  5KT4 A;  4Z7Y A;  1IKW B;  2OPR B;  3CJ5 A;  2PN6 A;  1WG4 A;  4M5G A;  2GGP B;  2HRY A;  3H90 A;  1C4C A;  1U0S A;  4OZ5 A;  2DNQ A;  4RW6 A;  4DCO B;  4DV2 F;  3T5L A;  3I0S A;  4KTQ A;  3H2L A;  4EWT A;  2AF6 A;  2HFZ A;  2QMU B;  5LJ3 Y;  2LEC A;  4C8N A;  2YKQ A;  1J5E F;  1SVD A;  1EIY B;  4PEO A;  3V6D A;  2OJ3 A;  4ZK7 M;  3MCS A;  3PO4 A;  2X3G A;  1VOM A;  5JVH Q;  1TL3 B;  2JJ4 D;  4JBC A;  2XHW A;  3PX6 A;  2WK4 A;  3GCW P;  2RF2 A;  4RL1 A;  1T9T A;  3A8J A;  1R0C B;  3J80 U;  1FRK A;  2FC9 A;  3DGP B;  4U6P A;  3HKZ D;  3MR6 A;  2PMH A;  3R5B A;  1X9W A;  1Y5I B;  5J2M B;  3M7V A;  4F0H A;  2C42 A;  2LEA A;  1S6U A;  1R8A A;  1TP7 A;  3BQ2 A;  1NH7 A;  1RZM A;  2DK2 A;  5A8W A;  3CC2 S;  4ZIV A;  3TX8 A;  3OTO J;  1S7I A;  8RUC A;  4CM2 A;  4IR9 A;  4EFA C;  3NG8 A;  3CDU A;  3K89 A;  5B0E A;  1FCA A;  4DV1 J;  4ECU A;  3PRD A;  4KHP J;  2BJ9 A;  4A8S A;  1E6V B;  1JLQ B;  4WXO A;  2IMO A;  3NGD A;  1JLF A;  2BKP A;  5GAG I;  4PPZ A;  4AFF A;  1S1V A;  1N52 B;  1RAE B;  2CQ3 A;  2K7K A;  2PI4 A;  1F2G A;  4I7F B;  3AOD A;  5HAT A; 
#chains in the Genus database with same CATH homology
 2XQC A;  2VIC A;  2VHG A;  4ER8 A;  2VJU A;  2A6O A;  2XO6 A;  2VIH A;  2EC2 A;  2F4F A;  2XM3 A;  2VJV A;  2A6M A;  2FYX A;  2XMA A;  2F5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...