2F5GA

Crystal structure of is200 transposase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
130
structure length
130
Chain Sequence
ELKSTRHTKYLCNYHFVWIPKHRRNTLVNEIAEYTKEVLKSIAEELGCEIIALEVMPDHIHLFVNCPPRYAPSYLANYFKGKSARLILKKFPQLNKGKLWTRSYFVATAGNVSSEVIKKYIEEQWRKEGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Metal Ion-bound IS200 Transposase
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Gene regulation
molecule keywords Transposase, putative
total genus 37
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2f5gA00
2VJVA 2VIHA 2F4FA 2XO6A 2VICA 4ER8A 2VJUA 2A6MA 2XM3A 2XQCA 2EC2A 2XMAA 2F5GA 2VHGA 2FYXA 2A6OA
chains in the Genus database with same CATH superfamily
4KGMA 4NWBA 1RT3A 2QG9B 3OFGA 2L48A 3GIIA 2VIHA 3MMJA 3UVJA 2Y1RI 2A6MA 5HO4A 1S10A 1WI6A 3GPAA 3I5BA 3CVKA 2DNNA 3IR6B 3IWXA 4P10A 1UFKA 1AUSL 2CG8A 3H59A 5K8PA 4IG3A 4K4WA 3PW4A 4EZ6A 1SVDA 4ZHRB 2GO9A 4M5LA 3MI7X 3OXLA 1N32J 1VOMA 3R7NB 2QMUB 3EWGA 1OQ6A 4LBHA 1MN9A 3NCQA 5F0WA 2R7RA 2B7BB 2AGQA 2FLNA 3JXOA 1VQPS 3I32A 3NOGA 3R1LA 4ELVA 1YSJA 5D0EA 5KFWA 5GVQA 1SJ4P 1AYEA 4FDFA 1HBUB 1JIHA 3AD8C 3BKTA 1GAOA 4CLSA 1HMVB 4HH1A 4ZN3A 2B3TB 4PQAA 4KIAA 1B0PA 1GEHA 3IRXA 3W2VB 3MM5B 2YKOA 2WTFA 2UVWA 3MXHP 2FJAB 4HH0A 1KQKA 2CQBA 2WVFA 4X4PA 1DZ5A 1AFIA 2B5JB 4P6QA 2QYCA 1WTFA 2MQNA 1U09A 2RDIA 1WEZA 4H4MA 2C2EA 1R7IA 2NSCA 1R43A 3EGWB 1UP1A 2ILYA 2E5HA 3SCKE 1UZDA 2V2QA 2U1AA 3F0NA 4USJC 5KFQA 2M3DA 4NLSA 1EP4A 1VRUA 4PYDA 3KMQA 3HZGA 2QFJA 4F02A 2KZMA 1ZTWA 4B3TF 2JJ4D 3OQ2A 2KT5A 1FK9B 2VKRA 4NLRA 3TAMA 1U45A 2E5LJ 4KH1B 3MEDB 3KJVB 2A0FB 2NPFA 4RWWA 3MUMP 1PG5B 2XLIA 3LWMA 2MMYA 2Q43A 3HSDA 3ILOA 1R27B 4HDGA 4ZVOB 2MKIA 2MLYA 3MAQA 2JLGA 4DFMA 2V8DA 2GZOA 2EKNA 3DLEB 4NLPA 4FXWA 2UXBJ 1MU2B 4NEYA 1FDNA 1QE1B 4ZOSA 1MU2A 1RHUB 2BACA 1H7XA 3TX8A 4KGKA 1NXIA 2E9TA 3DN9A 3M8WA 1DFDA 1PAEX 1YGYA 1PO6A 2FHOB 3Q8SB 1WHWA 1BE4A 4XO0A 1UCNA 3MEDA 2CWKA 3LAMA 1YJWS 3NXZA 1T11A 1WC3A 1P27B 2W9CA 3O1LA 1FFWB 4Y2AA 4LF9J 2HHWA 4KBIA 2NYIA 3N0VA 2XB2D 1RT2A 3MTKA 3CJ2A 4F4AA 4O44B 5KFIA 2M70A 4HT7A 4AL7A 4D3GA 2DNOA 1YJ7A 3T6BA 2LA4A 3MAAA 3GIKA 5ETOA 3DDKA 4FN5A 1U25A 2D9PA 4WFBQ 1CJKA 4YDXA 4MIBA 1S1UA 3D1QA 4QIFA 4C6AA 5IT4A 4J9UE 3J7AN 4IQXA 1G7CB 1S1WB 1UJ5A 2K2PA 4Y2MA 3OV7A 2RS2A 2OI2A 4O3PA 2HBYB 3HM9A 3V6DA 3PX4A 2CFXA 4DSJA 1NMEB 3C6TB 2FLPA 4DSLA 2XS2A 1IBMJ 1XR5A 3A1YG 3H4BA 2VD3A 1GXUA 3GQCA 2F7VA 2B5JA 4CI0B 1Y9OA 4K4SA 1RAFB 2ZFHA 4O23A 3ZZTA 1RAIB 1UTAA 2BRKA 3JTPA 2GVDA 3DGVA 1C4AA 4BWJA 2QL5B 1D8ZA 2P8IA 1V9OA 3UQSA 5KFZA 3GFZA 4IQMA 4ED3A 5D4LA 1M1KT 1TUGB 4M5IA 4DQPA 2A2DA 1H7WA 5LMNJ 3W3SA 1ACMB 4C8ZA 4X4QA 2QLXA 3OT9A 4JUZA 4YN3B 5DM7Q 2XSJA 4GC6A 1CBKA 1HW8A 2DR5A 1VC5A 4RX6A 4LQ9A 1PBUA 3VQSA 4LF4J 1TKDA 1SJFA 2XC9A 4RNHA 4CQ1A 5JVGQ 1REVB 2YWKA 4ZVTB 3EDQB 5L1JA 1MSWD 3IP0A 3FNNA 5HVGA 4NCGB 5ETTA 2FJDB 1S4EA 1REGX 4KGXB 5T14A 3DRYA 1U0HA 2WSCC 2RQCA 2FC9A 2OFHX 1IJFB 4RW6A 3MPUB 2R3VA 2HZVA 3M4XA 2MQQA 2XMJA 4KV8B 4HYKA 1KLMA 1F3FA 2B56A 1U47A 5LT5A 4PG4A 3BO4A 5I42A 2R2SA 3MHYA 5IXUA 2ZOGA 1YJUA 3VCDA 5HROB 1S6UA 1B7FA 4JI2J 3O6QA 3QJPA 3BR8A 3DLGB 2DIUA 1I3OB 2IDLA 4NI2A 4FXDA 3DU6A 2HVEA 2DYAA 1VS3A 2BEFA 3BPSP 8RUCA 1UEVA 1IKVB 4OX9J 4QR2A 3DOKA 1OYDA 4RPFA 2ERRA 2V2KA 4RUHA 3OR2A 4DSFA 1FKPA 1ZM4A 4F04B 4EBCA 3D2WA 1T03A 3H98A 1W2BR 1TVRA 2YNHB 2KHDA 2FGOA 3VR1A 1S9FA 2VF3A 4M94A 1U6BA 1UL3A 1UPMB 2GHPA 5DZ6A 4MKYA 2ZZMA 4DUYF 3MPVA 1WOPA 2MKSA 1TKXA 4R8UB 2GVZB 3W66A 5L1KA 1QAYA 3R8YA 1ROFA 3ZZ0A 4QWEA 4WIQA 5F8JA 1I5OB 2CDRB 1T9YA 3D1HA 1Q16B 4DBQA 4CH1A 2L41A 3Q8RB 3BSOA 2A1BA 3GILA 5CQGA 4JI0F 5C25A 1RT4A 1ZH5A 4LMZA 1RWVB 4HTJA 3WDOA 3ZTQA 4A4JA 4ZVUB 3IN5A 4LRAA 4CLZA 2GV1A 4RJVA 5HN0A 4X65F 4DJBA 1G3OA 4UTGA 4UUXA 2P6SA 3A3OB 4URQU 2I8EA 1EHWA 2UUCJ 4MYUA 1DARA 1NUEA 2J76E 4KTQA 1U6FA 3OXFA 3MR2A 3D28A 3KLIA 2O67A 1S6OA 5HSPA 2E1PA 3AD7C 3NAHA 2GHVC 3M6UA 4YMEA 2KG1A 2EEYA 3TVZA 3T5JA 1KVIA 2WVEA 4I2QB 2V9WA 4LF1A 2H1YA 4ETZA 3DRPA 2ALYB 2XLJA 5I4MA 4WE1A 5D6GA 1RTJB 5KFPA 1LXJA 2V4RA 1TV6B 1H6KX 2YX1A 1YRTA 2AV5A 2E5JA 1H2TZ 4G1IA 1X0PA 1PJ7A 4EEYA 4B9NA 4EUVA 4NLGA 4GVLA 1DTTB 1PSDA 1X31C 4CO5A 3AXMA 1N6QB 2O01C 4F0KA 4HACA 4OX6A 3KLHB 3IS9B 5KFUA 2V94A 2BKNA 2J9DE 5D78A 1UJ4A 4A46A 1RADB 2YNIA 2HWTA 2ZWPA 4NLYA 4ECSA 1SC4B 1U2RA 3Q89A 4GKJJ 1S57A 4S0MA 1IKVA 4IOCQ 2CQPA 2F9JA 2UUAF 4NYZA 1WG5A 2Q6BA 1NHUA 3L4BC 4GVBB 1Q4RA 5AT1B 3AOAA 3VGVA 2ZHBA 1HNWJ 4GO5X 1YJNS 1QSLA 1R0BG 2KU7A 2VC1A 3DXBA 2YWFA 5THWA 1WHVA 3LGNA 3FJ2A 3G82B 1QJHA 1X9SA 4E8UA 5LM7E 4NLQA 1E6YA 5KFBA 4J9QA 2AGOA 1EARA 2JNJA 3BBBA 1J27A 3JQKA 5A8KA 1KNZA 2CKWA 3H5UA 5M2RA 3N4WA 4AQYJ 4G3IA 4FYXB 2DPJA 1K44A 4N5SA 3ZTRA 2BBEA 2KVQE 1FRJA 1ITPA 2OPSB 1RQ0A 1DTQA 2NLWA 2YVSA 2D69A 3MM6A 5CYQA 1BQNB 1REVA 3IO1A 3UCUP 3I9V9 2HHXA 1U02A 4KHMA 3TQEA 4ZN1A 2CADA 1GXTA 1RGVA 2YKQA 3IC1A 3CCSS 4DU7A 1RAGB 1QUPA 4J7CA 3Q2TC 2KI2A 2JEIA 5SZTA 3FGVA 3MMCA 4DV3J 4BHQA 3AOCA 1JLAB 2P9EA 3CCTA 4KO0B 1YWXA 1VQMS 1M5KC 2A10A 2CPEA 2J8SA 1C1BA 1S1TB 4MKAA 2PEBA 2YTCA 5J1EA 4ZCKA 2V8HA 3AODA 5DLGA 1N48A 4DR6F 1VBXA 2QL9B 1IBKJ 1UA1A 4B9UA 4CM0A 4C3KA 4F26A 1FNMA 3P3DA 1UKUA 2FLOA 3DHWC 4OZ1A 3NOCA 2LP4A 4RNFA 2QIFA 3GV8B 3T9ZA 5KT2A 2BW2A 2OPQA 2BOPA 2IVYA 2Z58B 2PI4A 4DPYA 3RRKA 3UDVA 5B0EA 1QLNA 2RNEA 3ISZA 3HMJG 4LF9F 1SJ3P 3OVBA 1VQ4S 2CJBA 3G2XA 1YHQS 1HQUB 1RT5A 3POTB 1RHRB 3PRBA 1N5YB 2AYGA 3TA2A 3LOUA 2HWIA 2QGFB 4ALZA 4ECXA 1RLCL 4ZVSB 1VFJA 5RUBA 4TQSA 2HMIA 3KLIB 3O44A 3AJDA 2OEJA 2OSRA 1FVSA 4QWAA 4EO8A 4EBEA 3FDSA 1U1PA 1U0SA 3NMAA 3S6EA 2VZ9A 3MM7B 3RYLA 6AT1B 2C22A 2UU9J 2JEFA 2B9YA 3JTNA 5K14A 5KFCA 1RU1A 3FRYA 5M2UA 4J9LA 4RUCA 4ANCA 2UXDJ 2HHQA 2HFUA 4FYWB 3QIPB 4O3OA 1VMBA 2JVRA 2VG7B 4WP3A 4F50A 1N4LA 2GNKA 2U2FA 3OJUA 3TW0A 3PX0A 2XY7A 4DI6A 4BC7A 2R7OA 1R8HA 3OHAA 2MQMA 3H20A 5ETVA 3KLGB 4ZJOA 1TR0A 1TMJA 3DI6A 1QM9A 1S97A 1IXKA 4L74A 4WP9A 2ZE2B 5EX3A 3GJSB 2VFUA 2FJBB 3BKUA 4R8UA 3SDEA 3WX4A 2BE2B 4F4XA 3TAPA 4ED7A 3FBEA 1JLCB 3ZTSA 4DSIA 2HRYA 5A8WA 3RRHA 3DKDA 3HO1A 1YLXA 3CXCR 2ZH6A 4IDKA 1FO1A 3HZEA 5H9EJ 4ID8A 4X65J 3H8YA 3W5XA 1RKIA 5CH7B 2ZH3A 4ECWA 5FDLB 4TU7A 3C14A 2B43A 4UUWA 1N36J 1HI0P 5DG8A 4X62J 4O44A 2HK3A 1RHJB 1XMOF 5J2QA 4KFBA 3PYDA 2YNHA 4C97A 1ZTTA 3MUTP 5L9NA 1LQ9A 3EXCX 4DX6A 3C2PA 3QRQA 1S1TA 3A8IA 1RT1A 5HROA 2ROPA 4KJIA 2IMOA 1V3ZA 1HBMA 3BKFA 5KFKA 4LF2A 4DUZJ 4DUZF 3H5XA 1JKHB 2H48B 4ECTA 1B3TA 2B9WA 2D9OA 2DGXA 3C16B 3H5SA 2XLKA 3EGZA 1EETB 2HHUA 3C14B 3NWRA 3DM2B 2MY7A 4DL0C 4USMA 2R8KA 2MSTA 3K5PA 3QRPA 3R6GB 2B6AB 2F8MA 2VB6A 1DTQB 1W26A 2BZ2A 2HBQB 2MLXA 2XZWA 2AZ1A 4I69A 3UW1A 3SYZA 1HHTP 1UPPA 2DD8S 2ATLA 2DXEA 4W92B 1SL1A 3M2RA 3W9IA 4OMFG 2BDPA 4ZKAA 1X9WA 4JI2F 5ETPA 1GTHA 1TKXB 1S79A 1U0HB 2CQDA 2HZCA 4KKOA 4TLQA 2DY9A 4ETXA 2F4VF 2IY5B 1K8AT 1PAUB 4ZP7A 5DG9A 1VRTA 2PE8A 1PIEA 2ZBQA 3VQTA 2FHMA 3QNWB 5BR8J 3BB5A 3W9JA 4V19X 4XDDA 3QFHA 1TL5A 3GZ7A 1Q79A 1NHKL 1VIOA 1WD6A 5HK4A 1X5SA 4ZPBA 4LRFA 4F7VA 5CCLA 3GV5B 2CZVC 4NLUA 4DV5F 2OEKA 1UZHA 4K2JA 1V6HA 2JOQA 4OJHA 3S7RA 2VONA 2UXDF 2Y8WA 2IC3A 2MY8A 2V4JB 2PN6A 5LSRA 2BE9B 4DR5J 1RHQB 2C3MA 1KOOA 1N5TA 4YB6A 5BXIA 2YWWA 1KTVA 3I87A 1RABB 2XEXA 1VGYA 3M1VA 2DNZA 3ZC4A 2BJEA 1KLMB 3D68A 3N5FA 5A0YA 3V6DB 2DVIA 5A0YB 1OO0B 1GXLA 4B3MF 5DDQC 3R5CA 1DQ8A 4RW4A 1JJHA 5J1NA 4FVMA 2UUBF 2M4MA 4DUTA 1M5VC 5C42B 2BX6A 3MCNA 3ZTOA 3HP6A 5J2PA 3AFGA 2VKZG 1ZETA 2NXEA 1RTIB 3GYNA 2OEMA 5CZXA 2J9DA 3TJ9A 2PFFB 1RA6A 2Z56B 1RWXB 3LF0A 4HL9A 2CQGA 4LFAF 2NZCA 3GIRA 3IA0A 2AW0A 4LF6F 2LYVA 4OYOA 4N56A 2CG4A 3AA8A 3N01A 3HXMA 4OV6A 4DX5A 1ZM9A 1HNXJ 1FJGF 2XGPA 3BREA 1SV5B 4YR2A 2H65B 1NSPA 2KXHA 1SV5A 4U95A 1VRQC 1T9VA 2F4FA 5CYQB 1O5JA 1YRXA 3LAKA 4UY85 4NCGA 3G82A 5GAEU 1TU0B 4O4GB 4A8OA 2ZWOA 1TK5A 1S59A 2F63A 3M6WA 2OLWA 4DR6J 1UFWA 3QQCD 2PT0A 4PWDA 1SJQA 3NGKA 1SH3A 3CCLS 5DLFA 5LMUJ 4MYTA 2VASA 4A8YA 2ZDPA 1RAHB 2I5JA 2CXEA 3QLHB 2B9XA 4K0KJ 1FEEA 1WJ9A 2CJAA 3DGPA 3FMWA 3GONA 3QLHA 1Q1KA 2K1RB 2A2CA 3KG0A 5J1EB 1HR0F 1RT1B 4MKBA 3ITHB 2ZH8A 1N33F 3RB6A 4KHPF 4QYZJ 3SQGA 1NSQA 3U1MA 4GKKF 3LW5C 4QYZK 4IDKB 3UNGC 1VLYA 3BF4A 1ULRA 1Z2ZA 3HD1A 2PO4A 1NO8A 4OYBA 1U2CA 3QO9A 3PV8A 4QW8A 5ETSA 3LP1B 3TZXA 1PJ6A 2KM8B 2C2DA 3G9CA 4YHHF 1WC0A 1X5OA 2G2YA 1S0MA 1ZS6A 2L08A 5EDWA 5I42B 1X4DA 2AU0A 2MQPA 2HNYB 2EPIA 3BH6B 1IR1A 3CDUA 3CW2C 4NLDA 4ZLLA 3M9MB 2HVHA 2M0GB 2P5VA 2CQ3A 4USKA 3J7YI 4KPYA 1I6JA 1PILA 1H2UX 2UVUA 4A8FA 1TL3B 2WB1D 4P52A 3D0GE 3IR5B 4P74A 2ZHAA 4BS2A 1GQEA 2CWXA 4MAKA 1RDRA 5MAOA 4K4UA 3CO9A 3VWSA 3MFIA 5DETA 5F9LA 3GP9A 4ECRA 3LALA 2CNNB 1X4FA 4USTA 1Y11A 3W65A 5LSOA 3GFHA 4QCLA 1YVFA 1J5OA 4PCQA 2FHJD 1HW9A 1XEZA 2UU9F 3M2RB 4C8KA 2QZ8A 5CCMA 1QAXA 1RA7A 4Y00A 5IT9Y 3MEGB 2HAFA 3C66A 1IUJA 5J2MB 1BQMA 1SQGA 4UOCA 2ZBIA 2MB0B 3PXGa 4QWDA 2KXNB 2BV3A 2VPZB 2C3YA 2RU9A 4Y6IA 5A6PA 2YNGA 1RT3B 4PKDB 3J7A1 3WIVA 2FC8A 4KGZB 3CIZA 2DNQA 4CWBA 5A8RB 4OHYA 2IAJA 4KHRA 5A8RA 3TWZA 4DS5A 4OYWA 3TVKA 3ADAC 1YBAA 3K2YA 1IWAA 3FRZA 3NBPB 2XCAA 5JVHQ 2RU3A 2JEGA 2YH0A 5LL6d 2WB4A 3ULHA 2HBRB 2D1CA 4DV1J 1WC1A 4NZ7A 2ZNYA 3K8WA 5HQMA 1UWBA 2E9ZA 4NX9A 2GO8A 1IKXA 2EW9A 4K4VA 1JLAA 1HQEB 4KO0A 2ROGA 2VBZA 2VQFF 1S1UB 2VA2A 2HNZA 1BY9A 4A8SA 2C42A 2HURA 3VVTA 2V2VA 4C9DA 3TRGA 1SKSA 3NBPA 5A2QY 2WSFC 1RK8A 1XNQF 3MZIA 5F41A 3RW6A 2GJIA 1OY6A 1X7VA 2BM0A 3HHEA 5DQHA 5CXTA 1KQGB 2RHSB 4YY3J 4DHVA 4CYUA 2MZSA 2NUUG 3OLBA 2RKIB 4PR6A 2GJFA 4JV2A 4NYPA 3MDFA 4X4VA 5ETLA 3NNAA 4DL4A 1G6BA 1TKZB 3CEDA 2LXUA 4OI1A 2HHPA 4K59A 1CG2A 3OW2R 3MEGA 1PKUA 2KJWA 4XIUA 1N0UA 4WTYA 2XY6A 2KXFA 3OXGA 1FNXH 2KRRA 1CS4A 2QLWA 5HANA 4O0IA 4A8KA 2BMBA 3M32B 4JI3F 3T6JA 5DDPC 1P1TA 3LP0B 3NL0A 4ZP9A 2COLA 1VISA 3R3TA 4GVBA 5EUHA 2FPHX 2MDAA 3KJVA 3EICA 1SL0A 2KT2A 4F3OA 2HRTA 4XDCA 1JXEA 3M8PA 3IR7B 4D3HA 1U4BA 1MW7A 1WC4A 4AL6A 1S1XB 3GJQB 3UD4P 4PG5A 3RB0A 1JX4A 1ZZFA 1UVJA 4OZ0A 5ITHA 1M0SA 5H1SV 2ZKTA 3W9HA 5FIIA 2DRDA 1L3SA 2ZBCA 2DCLA 2EC2A 4PXDA 3PO5A 4B3SJ 2GW8A 3CJTA 4OLPA 3HLUA 1KFDA 3CWJA 3QSIA 2OSQA 3KK1B 5D4NA 5HMYA 1U8WA 3DI6B 1VIXA 3HD2A 4ZP8A 5KFMA 1HLWA 3K0JA 5ETQA 3HKZD 2IM1A 3TARA 3E8OA 3G4SS 4PQUA 2B4VA 2VDHA 4KY3A 3S01A 1NZAA 4OJGA 3SEOA 4DCJB 3VAHA 5H9EK 1KLNA 3Q2SC 4X4SA 2R8GA 4JI7F 3QJLA 2IC3B 4K2XA 3W2VA 1RBOB 4WFYA 3PO4A 3TYTA 2E5IA 6FD1A 5HMZA 3UWTA 5KG7A 1J2VA 1UW4A 3HHLD 5HQ8A 3L7OA 3CSKA 5KFXA 2HQGA 1YQHA 4G6VB 1CLFA 3IMQJ 3N28A 2Q79A 4DV5J 3J7Z5 1GMVA 3DRRB 5CYMB 1IQTA 5KT4A 3GCWP 1JNRB 1Y00A 2XI2A 3RTVA 2H4WB 4LIWA 1TMMA 3PIOQ 3MAHA 1RAJA 3EVMA 3H90A 3W63A 4DR2F 3I0SB 4ZCLA 4ED4A 2KH9A 3BQ0A 2AZ3A 4TQRA 2MQLA 5HMWA 1U6ZA 2WONA 3U02A 2KM8C 2CAJA 4G1PA 4CO2A 4DR1F 1F0XA 3N6NA 5E0OA 3TQ1A 2GQCA 3S1TA 1HNIA 3AQOA 3Q8YA 1RT4B 2ALZA 2QLFB 2ZITA 4OZ2A 4HEA9 2ZJPQ 1C0TB 3E01A 1MWYA 4UOGA 3KKFA 2HQFA 1BD6A 4MKVA 4P73A 2H54B 1EX8A 5IFMA 1QE1A 3KK1A 1FDDA 4YR0A 1KQSR 4EZ9A 1P8GA 1T0TV 4XPEA 1GH8A 1WORA 1B7YB 3TO8A 5DJBA 1MG7A 4H4KA 2MKYA 1JMTA 3TZYA 1HWLA 4KC5A 3HF5A 4OJ1A 3MWBA 3HJFA 4CP5A 1Q5YA 4OHWA 4ZPTR 5L9XA 3TUZC 1VBZA 4DPWA 4NMXA 1FRMA 4RLEA 1I94J 3FFIA 3DOKB 1R3NA 1WUUA 2V8PA 3PM9A 4MK8A 5B0DA 2CQ1A 5J2QB 4KGVB 1U1KA 5B0BA 2MHNA 3AJ1A 3NGSA 4HHUA 2WBMA 3A8EA 2LEBA 2LA6A 3CNQP 3M30B 1DTTA 4ECUA 2YBVA 1H3DA 1H73A 4OI2A 1NNDA 1EB0A 2BQUA 2A3JA 2RRBA 1KBRA 2BRLA 3CTRA 1RCOB 4RNOA 2HGNA 4DEZA 2MGZA 4YS2A 4JI3J 2Z0GA 3M6XA 1DRZA 2MZRA 4NPOA 1U8SA 3N6LA 2DR8A 2E29A 4OX7A 4ED1A 3ZZZA 2HLUA 3I0RA 3UNYA 1OIAA 2B0GA 1CJUB 3CCZA 2DH8A 4QPTA 4Q43A 3FEYB 3KHHA 1R0CB 4Y2CA 5D0HA 5IT9U 3E51A 3BO3A 1MMDA 1MROA 2H5EA 5K8NA 2Y0BB 4FS1A 3AB4B 2D3OR 4DV2F 4GKKJ 3PR5B 4Q8FA 4P72A 1S76D 4E98A 3OL7A 5KFHA 4ZPDA 2XO7A 3PKMA 3K5OA 3RJMB 2MQOA 2V67A 4Q2LA 4C8MA 3UE2A 1NK0A 1AROP 3LP2A 1A6LA 3JAMU 3PIPQ 4DL2A 2RMLA 2HFSA 2HMIB 2ZJQQ 2O5DA 2HS4A 2ZKUA 4ECYA 4U8VA 2O1PA 2V8VA 4G65A 1E6VB 2B6AA 4DMZA 2DO0A 4M5MA 4PQUB 3L3CA 2K3KA 3DOMA 3BSNA 3G86A 4IO1A 1U1MA 3KMSA 2LXIA 3TAQA 4ILLA 3B82A 3M2UB 5KT5A 5BYQA 1HI1A 1VI7A 4YB1P 2DNGA 3D6FB 3IBWA 2G2ZA 3CMAS 2GA7A 4DZDA 5KG6A 4WKRA 2DJWA 3WHIA 2KRBA 3GIMA 4IFVA 3V4IA 1T03B 4L73A 1FKAF 1KP6A 1YX2A 2DNYA 2IVMA 1Q82T 5LXYA 3T1HJ 4DR7F 1JWWA 3DLKA 5IV3A 3DGPB 3QT8A 1H98A 1LOUA 2MLZA 1LXNA 2VG6B 3QYYA 4OX8A 3GG0A 3T1HF 4LF6J 4DR7J 1C2PA 1YBTA 3BDEA 5C2CA 2ASJA 2ASDA 2ZD1A 1VBYA 2DK2A 3I0RB 3HHNB 4WZQA 3EVOA 1XMQJ 4AT1B 5EHHA 5AJ3J 2MJUA 4CDIA 1L3KA 3M8QB 2Y9HA 3C8YA 3GFYA 3W2WA 2W9BB 3A3NB 2G13A 1SCJB 4AXIA 3RAXA 1U1NA 4IRCA 4FF1A 3PACA 2J8AA 2VPXB 1NU4A 5C5JA 1TAQA 3BN4A 4ZA1A 1WKJA 1NJZA 3HSGA 4CLYA 1NPKA 2DXFA 3IGNA 1VQNS 2RT3A 2DPIA 4Y3CA 4B9MA 2MEWA 5A8KB 2OGUA 1S7HA 4NLWA 2UP1A 4QU7A 1XQIA 2LDYA 1GMWD 4DOZA 3DMJA 3KLVA 1JKHA 1R8CA 4AQYF 3A4TA 2Y0SD 4LR9A 4KYZA 4DX8H 4YDDB 3G8SA 3M8QA 3RRGA 4E0DA 4NASA 5AE3A 4U6PA 2MHEA 1X4HA 2VUGA 1JLGB 2QV6A 3I9ZA 3JTOA 1ZM3A 4IH6A 4Y2IA 3CCMS 1FX2A 4DV2J 5FLXY 1RSCA 3CGIA 1N8RT 5JXSA 1X4CA 1OY8A 2VFTA 4CLKA 4J9VA 4MFBB 4WKYA 4ZCMA 1RWNB 3FFIB 2ADBA 3CULA 1NBEB 2FTRA 3B78A 3P45B 4N7TA 5HVHA 2HIYA 3V4IB 1XNRF 4P7TA 2D3UA 1KTQA 4DSEA 2RD5C 3J81j 1EQ0A 2BJ7A 1UWBB 1VCTA 1RI7A 2AHOB 3LGMA 1IBLF 5F8LA 4Y34A 3W5YA 3SDEB 2LDIA 1F2GA 3OSNA 3MM6B 1FTRA 3J81Y 3KLHA 2JRSA 3Q8VA 3RBEA 3MM5A 4QIEA 3N79A 2VOPA 2FLLA 4EO6A 4GMKA 4TLRA 2CQ4A 1TV6A 1R31A 1T05A 5EWFA 2B4UA 1FJEB 4M5HA 5KG2A 1U7LA 3VZHA 4RU2A 3NAIA 3PCOB 2R7TA 3TJAA 4F0HA 4JI1F 4J9SA 3RR8A 3DRRA 1C1BB 3AY0A 1FNOA 4I64A 5CYMA 1X4GA 4KE5A 3VHQA 3UR0A 1T3OA 4P71A 4DQQA 4QR0A 1F60B 5IS2A 4RW7B 2VHGA 4GC7A 5E3PA 3DLLQ 2AJ4A 2DBBA 3MEKA 5JMNA 4ZVEA 2L9NA 4OYAA 2BVZA 5G0RA 4PEOA 5KFSA 3EZUA 4AYBD 3H40A 3MM7A 3R5BA 1XJWB 5ADZA 4LVNP 2N82B 1L3VA 3R27A 3ENWA 3LANA 4HDHA 1Q81T 1H2VZ 4JYAF 1CJUA 1S9EB 3GB0A 3K5LA 1RYSA 2NPIA 3ILLA 2XMTA 4P2MA 4Y2KA 4B9SA 4AL5A 4JI0J 3KHGA 3OD2A 2V69A 4HVZA 3KK3A 2P2CB 2FYXA 1OQ3A 4HTIA 4NEZA 3IWNC 4PPDA 1CJVB 2AJQA 4W98A 2AKWB 3EXYA 1NZ8A 2ZOFA 2DHAA 3NCRA 5HLFB 5IOLA 1KSPA 3FKBA 4HKQA 1XR6A 2Z30B 4ZPAA 1JLBA 3P6YC 3SCJE 4DV0J 2CUYA 4OIXA 1QAIA 2EK6A 1RCXB 5D77A 2NQPA 1Z1ZA 2AJFE 3HT0A 3TUIC 5B08A 1RWPB 2WBRA 3PRVA 1RP5A 3QIDA 2AIRB 3CC4S 4IUFA 2FJWA 3ZNJ1 2R2UA 5LOQA 1NK5A 2HS0A 4PWDB 2DHHA 1FI4A 2BR0A 1IM4A 3FSXA 3BM7A 3V2UC 4ZPCA 4KV8A 4DN0A 2DR9A 3TA1A 2V6AA 1XTZA 2D74B 1IR0A 2JFKA 2QSWA 3GSIA 3G8QA 4I2PB 3PR4A 5KT7A 3QRRA 2OELA 1KQFB 1B99A 3IRXB 3KDNA 3QWPA 1TL1A 4TU9A 1CQNA 3H5YA 3EZ5A 3DMJB 3D3BJ 1FD8A 1UMJA 2VG5A 3A8JA 5A2QU 4FS2A 4OZJA 3MECB 1QSSA 2R7XA 3NP5A 4Y0FA 2YQ3A 4F3MA 3EYZA 2NCKL 2IRYA 3PG9A 4TKTA 3CJ8A 4CLWA 3NGDA 1VQYA 3OJSA 2JL9A 3DLEA 1BWVA 4U96A 5I3UA 2YQ0A 4RBVA 2KZZA 3SZ2A 1K1QA 4B17A 1PYOB 3Q22A 2NSBA 3QAUA 5ETNA 4KHPJ 1LWEB 2OH2A 4QQBA 1NK4A 4NA1A 4JB8B 1N33J 2ILZA 4DCPB 2CQHA 2RJZA 2V8GA 3EE3A 3DYAB 1U2FA 1ZYQA 2CJ9A 3QT5A 4ANEA 3AD9C 1FXRA 2MKJA 2QEXS 1APSA 5KT6A 3M2VB 1GK8A 3CJSA 1TFWA 3MM9B 3MURP 4CH0S 2XYGB 2BXJA 3RUBL 2BJ3A 3H4DA 2ADCA 2AJ0A 2J9CA 4ELTA 1LNQA 2VH7A 2NYHA 4TU8A 1F9EB 4ZVHA 4LQ3A 4WYLA 3HKWA 3Q23A 2RUSA 3Q24A 4K4XA 4EBDA 5JJBA 5C2GA 2A6OA 1S72S 1OJ4A 3PDNA 2CNOB 1Q8KA 5AXLA 3VAMA 1N34J 1CEZA 2RRNA 5DZ7A 2DH9A 3J80Y 2LEAA 3D6HB 1GTEA 3G6VA 1BGXT 3MM9A 2VQFJ 3ITHA 4A8QA 1HBUA 2EFQA 2UV8G 1YI2S 4DLGA 4FNIA 2RILA 3SFGA 4WE1B 3HI9A 4I6AA 2CJYB 2ZH1A 3PW5A 4X4RA 4YOEA 5G0RB 4ECVA 1IR2A 4X62F 4QWCA 4Q0BA 1U48A 3OR1A 2Z57B 2ZDOA 2G0CA 2OD4A 1VLOA 2PA3A 2XBPA 2O3DA 3H42A 2F1FA 4MIAA 4UW2A 3UDLA 5B09A 1S6PB 4JI6F 3MUVP 1XERA 3MMAA 2HFVA 3EVWA 3OFEA 3AT1B 4JP8A 4LUBA 4NZ0A 3SCIE 1LWXA 4KPCA 4WK1A 4CNZA 4YR3A 2DH7A 3WIUA 4YB7A 4LBPA 3BGLA 3TOQA 4USHA 1IKYB 4RNMA 4ED8A 3SBMA 2JZ5A 4U7UK 2IHR1 1M5SA 1Y5LB 3DRXA 2N3OA 3FBFA 4UQGA 1OSDA 3JYTA 1IJEB 4UOFA 4F67A 1JLFA 1EQMA 1IVZA 3JSMB 4LRCA 1FKPB 2JSXA 1K73T 2VPWB 1YRUA 4X66F 2J0SD 1PGZA 1I94F 1NEEA 3MPYA 2M8HA 2GMLA 3FEXB 5ETMA 2CPFA 2MKHA 2R42A 2WCXA 4DV0F 1S12A 3MD3A 4U8YA 3MCMA 3D67A 5DM6Q 2FGCA 1RWMB 2V5HG 4DPUA 5KAKA 4B3TJ 3UI3A 4IRKA 2K06A 3QATA 5G4DA 1N6QA 3R2CJ 2X1GA 3CMES 3DLKB 3DLGA 5A6WA 4OZ3A 1JLBB 4HT5A 2FVPA 2CA9A 2AYEA 2DNMA 3FCHA 3W7BA 3SI8A 1TFYA 3ZXWA 3P5TL 3T5LA 2W24A 2XO6A 4OI0A 3OVAA 3I96A 1MN7A 3W62A 4A8MP 4USWA 1MLAA 4FNHA 3NS7B 4UOHA 5IC6B 3I82A 4DV7J 1FCAA 1WWHA 3HHLA 1NJYA 3DRSB 4EYIB 3VF0B 1CJKB 2YNFB 3R7BB 2KT3A 4I68A 4ID5B 1XBWA 1RHMB 2MZQA 4A48A 4RL1A 4J9MA 3B54A 1RTJA 1T95A 3EMTA 1WC5A 4PWUA 3ZZUA 2LQBA 2W1BA 3CDWA 3T9NA 4C7QA 4O3SA 4DSKA 1KN6A 1Z2LA 4RW4B 2B7CB 3DC2A 1ZOTA 2KL8A 1NJXA 2VOOA 3RU0A 2YX7A 3L09A 5FD1A 3CDBA 4OX9F 4BC9A 3SXLA 5F8MA 3GR0A 1BWEA 3ENQA 4RW9A 2VDIA 2PI5A 4N47A 1M5HA 2HK2A 4C98A 3QT7A 2ZUAA 4ANDA 4C4WA 2DR7A 4DV6F 2I2YA 5KFNA 2MZ1A 2LCWA 2V63A 5KFOA 2GVZA 1OPIA 4KT0C 1IBLJ 1TAUA 3HDSA 3SIPB 3JAMY 3MR5A 2ACYA 1X60A 3TUJC 1S0OA 3GLJA 3B4DA 4JV5F 2K7JA 1T9TA 2B4PA 4O3NA 2J7KA 2G2OA 3SQGB 5DQIA 1HMVA 1AFJA 7FDRA 2W2QP 2V4JA 3BGOP 2W4PA 4O4RA 1LFPA 1HNWF 2X1BA 2N4CA 3PYEA 2YKPA 2GIQA 4NRUA 4DQIA 1X9MA 2EBEA 2FJXA 4ILMA 2B8QA 4P9SA 3SMZA 3MF5A 2BJ1A 1FA0A 1Q95G 4X4TA 1MWQA 3E3XA 3PYGA 4K8RA 4NA2A 1B70B 2EG2A 4ZVFA 2DRBA 1SJ1A 2ACMA 1S6QA 4Q5VA 2PMWA 3PW2A 4PUOB 1RAAB 2KYZA 3BN7A 2W9CB 2EFGA 1B64A 4A8XA 2RF2B 3KUEA 3OTOJ 4F36A 1S7IA 4DL3A 4CT8A 1HL6A 3R5JB 2H5IB 2J5AA 4NLXA 4CLPA 3QPIA 2WW4A 2XMUA 3L9ZA 4N77A 1RBLA 4I4BA 5LSLA 4CO4A 2W8KA 5IWAJ 2GGPB 1RTHA 4IH5A 1KS2A 2RKIA 4C11B 4WIIA 5H9FJ 2JX2A 3RAMA 2H5JB 1LWCA 3OFHA 4DPOA 3R6LB 2O66A 3KWMA 3BR9A 4FPIA 4C3MA 1CPZA 2FB0A 3DOLB 3O5TB 4URSA 5MLCV 2KVIA 3VZIA 1E6YB 4YFUA 4DF8A 2HNZB 3AXKA 1QAJA 3MMAB 4IYQA 2C28A 3V6JA 4X4NA 4ED0A 2QTWA 1RJJA 1KFSA 3EX7B 4DS4A 3ONQA 4U7CA 2K7KA 3P49B 2VICA 5L1LA 1NDKA 2XHWA 3MM8B 3R2DJ 1YDLA 3UN3A 4J9NA 3CMQA 1P6TA 2H9ZA 5L8RC 3I4HX 2I1RA 4CO1A 2IIHA 4DV6J 3D6TB 1JLQA 3W60A 2MZJA 3ZZRA 3PFOA 4QU6A 5LJ5Y 3OVSA 2YQ1A 3D4JA 2C3UA 5FDLA 1DLOB 2H4YB 1VJWA 1P1LA 3C3LA 4USVA 2CVEA 3KLGA 4NE9C 2XZDB 4CIOA 1BQXA 3TNVA 2W7OA 1NK6A 1H74A 4OQJA 2AJ1A 4NXNJ 1GNKA 1SB6A 2L9WA 2NXNA 2FZCB 4N76A 2IRXA 2OPRB 2LQ5A 4LREA 3UCGA 4FVCA 2H51B 3M1VB 5BJRA 3SV3A 3MOJB 2DITA 1UJ6A 2HWHA 4QWBA 5C7PA 3HVRA 2IBKA 2YNGB 2VBYA 3TA0A 4FBUA 4DPXA 3J81U 4FKXA 2UUAJ 4DPTA 1RT6A 1RXOB 1JLEB 7FD1A 4ITSA 3G96A 2BJDA 2VU5A 3T19A 3HSZA 4ZHRA 1XMOJ 5E3QA 2NXJA 3IBCB 3MMCB 1VJQA 2AX1A 3MR3A 1S48A 2ZZNA 3B8HA 3OTDA 1BLUA 1YIJS 2E5LF 2QLJB 4CCHA 1HWUA 3CCRS 1R6YA 4JI8J 1HQUA 1Q8LA 4NA3A 4BWMA 1F5BA 2CJXB 4LF5F 3RG6A 5IQ6A 5GAHI 4C8LA 4LF8F 1FERA 5I3QA 2DRAA 4LFCF 5F8NA 3OPKA 1NPRA 5KFYA 2LVWA 2MGZB 2HEKA 3MR6A 3F73A 3LUYA 1NJIT 4JI6J 1CS4B 1T9UA 3DM2A 4I1TA 5F8HA 2FY1A 1FWKA 5HP1A 4ECZA 4KH0B 2YKNB 2VG5B 3H7HB 1M1HA 3GWCA 1WELA 3I5AA 1V3RA 1RTZA 2MKKA 4DR3F 5B0FA 2AQ4A 2XI3A 2F5GA 4ZVGA 3ZZYA 1HHSA 4XAKA 1U1OA 4CYUB 3PZPA 1WDTA 4L3NA 5DQGA 2UV8A 2IM3A 1LKZA 2IDEA 5HI7A 2E7WA 4TN2A 2WK4A 1R0AB 2GHWA 4LSNA 4QOTA 2EC0A 5C24A 2F3JA 1LW2B 4LF4F 3P96A 4G1QB 1D1UA 2XMMA 1LW2A 1JQGA 3CJ3A 1O51A 4DCOB 1LW0B 3HFKA 3RBXA 1EZZB 1FE4A 4LRBA 1QTMA 4RU9A 3LO3A 3TAMB 1WHXA 4K5SA 2K1RA 2VPYB 3C15A 4RWXA 1K9MT 3JSMA 4NXMJ 1IQZA 3OUYB 3GR1A 2W2PP 4QPXA 2R2TA 5B7WA 4OHVA 1Q8IA 4AFFA 1CULA 2BM1A 4NI2B 2JC0A 3HCXA 1OPZA 5D0GA 1ZA2B 2E66A 3NG8A 4ZIVA 1SC3B 1SIZA 3E2EA 2YX4A 4OYIA 4DDFA 1YZ7A 3HPOA 1OSCA 2RIJA 4C11A 5DRKA 1BQMB 2QE5A 4H4MB 2QMXA 1HNXF 1FRLA 4C8OA 4DU8A 3CJKB 3KG4A 1KEKA 2BE2A 5HATA 3DFEA 3R1HA 4CLFA 4WXOA 4Z2XA 2VBWA 1FE0A 1DURA 4HLBA 3H2LA 3QT6A 5AXNA 3W5ZA 3IRWP 1J5EJ 3T41A 3SV4A 4DL7A 1T9WA 2LMIA 3T1YF 1RZMA 1PC5A 1YJVA 2A18A 2B8PA 3NGRA 3TP2A 4ED2A 2XNRA 5KFTA 4PG8A 4DV3F 2NR0A 4ZCIA 5E2QA 3AQPA 1NJWA 4PXBA 4EGLA 5E5NA 1HBNA 1NAQA 1RTIA 2V68A 5CD4A 2G1DA 2QA2A 5I3UB 2Q1LA 3BQ1A 4Q0BB 3MD1A 4Q45A 4DL5A 3DRSA 1M5PC 3RR7A 3GIJA 4OI6A 5KFLA 2IA6A 1XMBA 3OTOF 4MK7A 5HJXA 3IGVA 1TUWA 2HNYA 1GX5A 1RWWB 5T7LB 2DNLA 1DQ9A 1NB2A 4W90B 1H72C 3V81A 2LU2A 1S99A 1QTNB 3N9UC 5FLXU 1HPZA 3PX6A 4ERDA 1QY7A 1D9FA 2JEJA 4IFYB 2DHSA 2EI5A 2OPRA 1DY3A 1TKTB 1UVKA 2SXLA 2YKMB 3BH7B 3FCWA 3KUGA 3L7PA 3LQVA 3BPDA 2KB2A 3WZ0A 1EAYC 2AT1B 4KAIA 1KD1T 4I67A 4ICLA 1Q86T 4R25A 1BMQB 2XNQA 3EGVA 2DNHA 1S1VB 3BSCA 3G8TA 2W9AA 3AHPA 1U1RA 4LF7J 3PNIA 4MFBA 2YWGA 1B4SA 2HGLA 5SUHA 5T7LA 3K5NA 4IKAA 4RKUC 1VQKS 4F4KA 4ZJQA 5BR8F 3KNAA 1PYSB 2C2KB 3HVWA 2N7CA 1RTDA 4KFBB 2C3OA 4C2MA 1RT7A 2RUGA 1I51B 3Q8QB 2HHTA 2W25A 3A12A 3LP0A 2PDAA 3OFFA 1JJCB 1ZAXA 2EG1A 3HSJA 5IC4B 3KYLA 5GAHU 2XY5A 1V5VA 4K4TA 2J0QD 2X1FA 4QIGA 1BQNA 1D9DA 2YY3A 1V3SA 1FRIA 1UVNA 1Q7LB 4NLOA 4U9RA 4JI8F 1SL2A 2RQ4A 2CNKB 2HGMA 2XMVA 3MPWA 4CTAB 3OSPA 3HJVA 1YZ6A 3U1LA 2BQRA 4Q7AA 3QBCA 4RW6B 4AUKA 3Q0AA 4WF9Q 1SXLA 2HFNA 1TK8A 2EBGA 1SQEA 3CJKA 3UDCA 2C2RA 4PXCA 3QGHA 2VBXA 1Q7YT 2QLBB 2BUNA 3CF5Q 4DR4J 3NCPA 3K89A 1K1SA 2HBZB 2VFRA 2ZVIA 2F9DA 1KVKA 4ZLJA 4A47A 4L76A 1N0VC 3ISND 2N3LA 1TL4A 1HWJA 1WF0A 2XSJB 3GCXP 1NLKL 2BW7A 2M5YA 3R5GA 3CB4A 5KTQA 1VQLS 3PTWA 1D09B 2G0JA 2PC6A 2X7IA 3D0IE 3C15B 4FZVA 1R89A 4WK3A 3M9NB 1HNVB 3PFEA 4Z7YA 1N36F 1CJTA 4NCBA 3NNCA 1NH7A 4CNYA 2FVSA 1S1VA 1M1GA 2ZZTA 1ZAWA 1C0TA 1RT5B 1YJRA 2FHJA 2HQIA 4ZS6A 1GMUA 5K20B 1YTYA 3GFXA 2AMCB 3ISNC 3JSYA 2V50A 2ZE2A 2C2OB 3DDIA 4LR8A 2C2NA 2AGPA 4LFBJ 2ROEA 4FPRA 4Y65A 4OYPA 5A8WB 4N41A 2DISA 1D3WA 2DY1A 1KR4A 1KOHA 2I0XA 4QR1A 4R5PB 3OHBA 1JLQB 3GU0A 5B0AA 3MFHA 1UVMA 2JLEA 2CQCA 4QW9A 5AXKA 1IM6A 3CUNA 2HHHF 4IOAQ 2VV5A 1ZM2A 1AZSA 5EN1A 3CD7A 5DO2A 1WOOA 1XIQA 2CQ2A 1FWLA 4C0BA 3IM9A 5L46A 4EMDA 3PKYA 4CLTA 1TK0A 2KFNA 5DG7A 3QMQA 1WEXA 4OZLA 5KFDA 3DU5A 5DGAA 4DV4F 1YJ9S 1M5OC 1T02A 1AB8A 4ID5A 3J7ZT 4H4OB 3RBZA 1F3VA 5F3ZA 3POTA 2RDJA 1LWEA 1B0VA 1URNA 3TVYA 2N7YA 3T5HA 2RH3A 1JLEA 4X84A 2R7VA 1NKCA 2DGUA 2Q3PA 3JS9A 2DEJA 2PIIA 2XYPB 4UY8T 3MMBA 2IFXA 3QFWA 4RBTA 1LWFA 3U1NA 3CJRA 3M30A 3CJ5A 1GFWB 1Y3KA 1F1BB 1VBKA 2DGOA 4LIRA 3US5A 2K3IA 3UPFA 1O0PA 3K57A 3T1YJ 1Y4ZB 3B4MA 1J5EF 3S8SA 1DLOA 1D9AA 1FKOB 1MMLA 3UO0A 3FSYA 1LW0A 2QRRA 1VC6A 1HR0J 3FZ2A 2R8JA 1AUDA 3L95X 2QN6B 4OV1A 2NZ4A 1N34F 3OLAA 3CDAA 1QSYA 1FESA 1QDUB 3MPDA 3ZNUA 3TANA 1NPPA 1YJTA 4OZ5A 1K0TA 2W2NP 1HNVA 5F9NA 3N5BA 2W8LA 3EUNA 3GE9A 1WI8A 4GRSA 2BJ8A 2RVJA 2XMWA 2YWEA 4MIWA 2MJNA 3GYXB 3KHLA 2FVRA 1MROB 2EFNA 2GIRA 3IBFB 2UVVA 3QSYB 3RBDA 2GIFA 3CCQS 1P9QC 2PEHA 3HVAA 2MXYA 5KFEA 5D15A 4YY3F 1NHVA 1UA0A 1CC8A 1H38A 4DG1A 3KK3B 4OHZA 2QMWA 1MNEA 2KTQA 4E2FB 3DHXA 4WP8A 3M8ZA 2R9LA 1FJGJ 2HFZA 5E33A 5KG0A 2MPUA 1S49A 5IM0A 3VTIA 1FTCA 1S9GA 3FK4A 3W8GA 4QJVA 4ZDNA 2CPYA 1URRA 3K59A 1F9HA 1RAOA 1ZPVA 4AE5A 4ZLPA 4ZITA 3IM8A 2OP5A 3DDNA 3D54A 5KFRA 2NREA 1YKWA 2UUTA 1YITS 3KNGA 1AA1B 2RS8A 3P5BP 2W9BA 2IBOA 1U24A 3KXDA 3MEEA 3KLEB 2F8HA 1VQ6S 2JHEA 3GG1A 3U7JA 1K0VA 2Z2YB 2QYGA 3OR1B 5KFJA 3UCZP 3IAS9 3PJ9A 2BQ3A 3UR3C 1RAEB 1VDHA 3HT3A 1HARA 1SBRA 3I31A 2DNPA 4YB5A 3K58A 3TZZA 1C4CA 2EXUA 2HQCA 3F44A 2VG6A 4W4MA 2IRUA 4Y28C 3VGUA 4AD6A 2ZM6J 3G6XA 1LV5A 4LFCJ 2WVDA 2XMKA 4OL8A 4LSNB 2R7UA 4EWTA 1VQ9S 5HJYA 2MZTA 4TVAB 1IWGA 5L38A 2YNIB 1M90T 2OMLA 1BHNA 1EIYB 1SKWA 4ICLB 4PXEA 3PEJA 1C1CA 1SUQA 3TJ8A 4F4ZA 1FDBA 4U67Q 2CNLB 5J2NA 1NK9A 2HQ3A 2RQKA 3QGIA 4RNNA 3ENAA 1NB7A 5HAOA 1AT1B 2BJ9A 4JI4J 2IYGA 1N5VA 3DCAA 2HHHJ 3DOMB 4WCEQ 1CULB 2HAIA 5F8IA 1SKRA 1TELA 1UVLA 4KSEB 1DAXA 4DF4A 3V81B 3D7SB 3DYAA 2QA4G 3MAAB 2QA1A 2DGQA 4WFZA 2ATCB 3HFVA 1UFLA 4V1Ak 3LP2B 4WJBA 1KVJA 4DQRA 4H4OA 4LVOP 3ZZPA 2ZM6F 4M95A 1BC6A 5K14B 2M8DB 2UUCF 2W7PA 2DO4A 2MSSA 2DHGA 2HKEA 1SJRA 2EVZA 2ZC4A 2ZUGA 3FBCA 3KFWX 2ZC3A 5CHCB 3GSDA 4J5OA 5HBMA 3VALA 2H3EB 4OYXA 3TUPA 4MTPA 1KKHA 2XCPA 1RT2B 3E01B 1W25A 2LQJA 1AZSB 4OJ3A 1TL7A 1WG4A 2XTJP 2J6SA 3QAEA 2DEIA 2XM3A 4X4UA 3ENVA 4Q8EA 5IM0B 5GADI 3CCJS 4I56A 1Q0NA 4CLLA 3M8RA 2X3GA 2RSQA 3TEGA 3F56A 1Y5NB 3QGGA 2KKHA 1WDDA 4USIA 2RQMA 1Y7PA 3HFZB 1JXLA 4RUAA 2Z2MA 4PUOA 3ETMA 5HBMB 4IOBA 2M52A 2LQ9A 4EYHB 4HHJA 3HK2A 4K0KF 3CJQA 4OI3A 2DNRA 5K8OA 2EK1A 2C2MB 4TXSA 1N32F 1NDPA 3P4UB 2IJFA 5AXMA 1IN0A 4CT9A 1XK8A 3M8SA 2BANB 4TY8A 5T41A 2KYXA 2FVCA 3GYGA 3KUHA 1TVRB 2CYYA 4NRTA 2F40A 4HR2A 3EGNA 2CPDA 4M5GA 3D66A 2GS8A 1XC9A 4LJMA 1X4AA 2KDOA 2J0XA 3IWLA 4QIVA 4P2SA 2OJ3A 2G4BA 3EPGA 1QUVA 3CPWR 2XS7A 2M7SA 1FXLA 4PPZA 2DGSA 4ED5A 2UZAA 4XPCA 2J7UA 5EWGA 2P6TA 1JLFB 3UD3P 3AA9A 1GMWA 1S9EA 5E3AA 4M5KA 2GCFA 2NS1B 4PZVA 3M2UA 4ES1A 2D41A 2K8GA 4LF7F 2BOAA 2HNDA 4FF3A 2HLTA 1PC4A 2V34A 1WC6A 2XULA 2CIMA 3QIPA 2AJ2A 1UEKA 2EFPA 1FDAA 4WWSA 2ZHOA 4IO9Q 2UVRA 3NWGA 1HYSA 3QGPA 1HYSB 3LPYA 1N56A 5D8HB 4PWWA 3IG1B 1WTBA 2KO1A 4J9PA 2FQQB 2RDDA 5J1PA 1JNZB 2XWXA 3ET6B 2LEPA 2FJVA 4LSZB 4WTOB 2G9OA 5U47A 4DV4J 2HHSA 2VJUA 2HNDB 1TL3A 3JSRA 5CYJA 1X5PA 4CZCA 4NLVA 3U27A 4F8RA 4ZPVR 2IPOB 3I6PA 2KN4A 1C1CB 1SUQB 4P7VA 5J2NB 1OS5A 5GMKa 3RAQA 1N5SA 3NNHA 1ELOA 5HL7Q 3HHLB 3BBCA 3LP1A 2WOMB 1T3NA 3BGUA 3ILJA 2CJKA 3UN5A 2P9GA 1HIYA 2QC3A 2RAQA 2OIHA 2FIUA 1S1WA 5CAAA 1CVJA 4OLOA 1OWXA 4ATNA 4Z7CA 1TTHB 1UEUA 1HBMB 2C1EB 2KFYA 3WBZA 3HHDA 3O2IA 4DV7F 1Z4UA 2OMOA 4PYAA 4OZNA 1KC8T 4ELUA 2XS5A 2MKCA 3M8PB 4UF4A 5B0GA 3AOBA 2WZ1A 3EZOA 4NYOA 2DIVA 3SFUA 3KHRA 3Q86A 1S1XA 2DXDA 2HVIA 4X2BA 2HFOA 4J9KA 2M9KA 1FFGB 4JYAJ 2VA3A 1F5AA 3D1OA 4QIWD 4H54A 4ZPWR 4K5RA 1PYTA 4NXMF 1RWKB 1XWLA 3FC9A 2HIQA 5B0CA 3OBIA 2KG0A 1ICEB 5ETKA 1RWUA 1VR6A 1ZAVA 3D6MB 4OYMA 1AW0A 1F5CA 3VAKA 3THVA 1ZA1B 1J5OB 1R8BA 1T94A 3BYPA 4LSLA 3Q83A 4F25A 4FF2A 3NMRA 4DR4F 2CPXA 2HS3A 3RW7A 1FD2A 3AB2B 2RE1A 3OL6A 3WX8A 3VAJA 2D3O1 2I38A 3A3PB 1LEOA 4M5DA 3FEZA 1TL1B 3HX9A 2EKYA 2DR6A 3GTYX 1X0FA 4P2FA 4DXLA 2PA8D 4X66J 1D8YA 4A8WA 4JI1J 1RYRA 4DR3J 1Y0HA 2HPUA 2IMWP 4H4KC 5F8GA 4UT4A 3MCSA 1B0TA 4HHHA 4KB7A 1HFEL 5D4OA 4MK9A 4DX7A 1EKRA 1FF2A 1EJ7L 4R0EA 1D0EA 1A0OB 3SCLE 3NRBA 3CCUS 4FBTA 2R7SA 1SKUB 2ZBRA 4N8NA 4X64J 1S77D 1R6VA 5I3PA 3T1AA 4LRDA 3OTCA 5KFGA 4LF8J 5DDRC 4F3QA 3PYFA 2EFOA 2R7WA 1S0VA 1WG1A 4G1QA 3VAGA 2JFDA 1CJVA 1PJ5A 4YHHJ 1T05B 1XNRJ 3K5MA 5DGBA 3THTA 2GQQA 3OL9A 4U7UD 3NS6A 1N52B 2JDJA 3C46A 1NDLA 4B3RJ 2UUWA 5E7OB 1G2EA 4P2XA 2CZ9A 1TUVA 1X4EA 1FXDA 1UAWA 2VFSA 4QBUA 4LR7A 4EK2A 4JI5J 3JQMA 1FHTA 3BJYA 1HWIA 5KFFA 2GJ2A 4M1KA 4CH7A 2VC0A 1ZZNA 5FJ4A 4WU3A 3Q8UA 1F2HA 4IRDA 1W7WA 5GMEA 1ZPWX 1Y3JA 1V5IB 1UETA 2LU1A 3IG1A 1TP7A 2QT7A 3B6BA 8ATCB 3UFCX 2XYHB 3PJWA 4C8NA 3ET6A 4KQZA 2ZNZA 1MWZA 4FF4A 3NGTA 3GV7B 1NK7A 5E3RA 1HA1A 2HG4A 4P75A 1UW9A 4EI2A 1RE1B 1SC6A 3LGHA 4B02A 4DZ6A 2ZH9A 2AEJA 4ER8A 3BDPA 2QFIA 3V6HA 4L75A 2YXLA 1H0HB 3MEEB 3W8PA 3SSRA 2GGPA 3KLEA 4DR1J 3I5CA 3EJMA 5KOXA 4IH7A 2YNFA 4JV0A 3THPA 3V5RA 1FEHA 4DR2J 2WVBA 3DOLA 2B4OA 4Q44A 4YP3A 3BSAA 2R2RA 1N5YA 3PHEA 3X1LB 3ILIA 3EDRB 4DN9A 6FDRA 4M5DB 3CJ4A 1EETA 2E7XA 2X3DA 3TEHB 2PFDA 3KJNB 2AYBA 3UD5A 2IVFB 1JJ2R 4MJKA 3LWLA 2RB7A 2WAQD 1OY9A 2HVDA 5LMUF 1U1LA 3FVYA 3G6ES 2E1RA 2AF6A 4M63A 3F41A 2BKPA 1QVGR 2B51A 2DGVA 3GJRB 2YPZA 3QO9B 4M8LA 3PJXA 4OHXA 5CABA 3Q8PB 3FZBA 3FSIA 5K8MA 1T7PA 1HQEA 1P9YA 1FJCA 3K17A 1IKWA 2WRMA 5CA5A 3CCES 4WXWA 2ZH2A 4FXVA 3VV2B 2E1CA 4DQSA 4WFNQ 1Y10A 1RACB 2E7VA 5HLFA 1Q53A 1KONA 1LK7A 1R8AA 2CQ0A 2I5JB 2OFGX 1BUXA 5GADU 3CD6S 2DNKA 3I4PA 1HHQA 1I1GA 2OPPA 1FRXA 2I6WA 5KG4A 4B3SF 2HHVA 2QL7B 5CZVA 1HBOA 1NH8A 4LFAJ 3MMBB 1JLCA 4DR5F 4DFKA 3BYRA 3D9BA 3LH2S 5L39A 3JYTB 2YPYA 3NEKA 2BYCA 2Z8QA 2PD1A 2VQEJ 4URGA 2J9EA 1SIWB 4JBCA 2VQEF 1L3UA 1TKZA 1L5UA 2QSFA 4B9VA 2IJRA 2JVOA 5EWEA 1G4CA 2IA0A 1VHIA 2C2ZB 3CIMA 2F65A 4KR0B 2PMZD 2XQCA 1RKJA 4O0NA 2UUBJ 3BZQA 9RUBA 3KLFA 3BGRA 2OAUA 3HHLC 3M7VA 3I56S 3KK2A 1VK3A 2YH1A 2E9RX 4GKJF 1S6PA 2E44A 2RRAA 5J2MA 1S6QB 5CD4H 2F4VJ 1LFWA 1KHWA 2J6TA 2APOA 2VJVA 4RW7A 1VQ7S 4LF5J 2XHCA 1SC1B 4I6YA 1YG0A 3CE8A 5EX0A 1A7GE 2D3ZA 2Z2ZA 5E3CA 4FYDA 1SH2A 2EWHA 1KHVA 1RB0A 1DBDA 1VYAA 2AEFA 2GMHA 2P9CA 2IM0A 5J2PB 2GVDB 2ZVSA 4CM2A 4ECQA 2KHCA 3H2UB 5ETRA 4WPAA 3MCOA 4YUDA 1K47A 2L3MA 4WFXA 2ZEJA 2DB1A 5KG5A 4NMLA 1NSAA 2HSEB 1QVFR 1RISA 2W01A 4DFJA 1C0UB 4MH8A 3HVTB 2DCUB 3LTOA 4MT1A 3HVTA 2AD9A 4PG7A 3ETOA 4LFBF 3HHKA 4TNOA 4B3OB 4B08A 2CPHA 3CDEA 2MYFA 1Q5VA 3C19A 2ZH5A 3R7SB 4DV1F 4K7QA 1HBNB 1S0NA 2FZKB 3NKYA 4FYYB 5DS7A 1WEYA 2E1AA 2VG7A 3MGJA 3VGSA 4TY8B 2D7SA 3N6MA 1U49A 3DLHA 3KOAA 1KDNA 2FY8A 2R7QA 2VL1A 3PVXA 2GX8A 4NL5A 2J7WA 1WKKA 5LMNF 3KLFB 3FUYA 5K5MA 2Y1LB 4LT6A 5F0UA 1MMNA 2LLZA 4J37A 4IG0B 1VQ5S 2OO4A 3BQ2A 2XG8A 3H0PA 2AP6A 2LQ8A 2X51A 3RB4A 3C6UB 4NOHA 3L7UA 3A8KA 2JC1A 4DUYJ 2OTLS 5KFAA 4JI5F 3ELHA 4O3QA 1WNEA 3VAIA 3MOZA 4FP9A 4I2PA 4TYBA 5HMXA 4R5PA 2PSZA 3MR7A 3IFEA 4L72B 4O4GA 1Y5IB 1HD1A 4CO0A 5D3GA 3RB3A 2HRUA 2WSEC 3PY8A 4CLUA 3NLCA 2X1AA 3W2WB 3I55S 2ABYA 3ZFVA 1DQAA 2W4CA 5JUMA 2LXFA 5D0RA 2J0WA 2CPZA 4UZBA 1O8BA 1JJ4A 5GAGU 4JI7J 1WSRA 1Q8BA 3C6UA 3HULA 3LA0A 2JH3A 5GMDA 2QO3A 1NCLA 3SQOP 3G87A 4ENOA 3CCWA 4N8OA 4J9RA 4PABA 1A9NB 1OMSA 3FQKA 3J7YU 4WZMA 4XK8C 4IR9A 5KOWA 3VVUA 4ZK7M 4JOUA 4C8YA 2M2BA 2OTJS 3BEGB 2HYIB 1FJ7A 3BV8A 2QX0A 4ZJLA 1WACA 4I7FA 1TZ0A 2XWYA 2ZH4A 2F8EX 2BANA 1Q78A 4RW8A 3UN2A 1VHFA 3QZ8A 1GT8A 4C48A 2Y8YA 4BCAA 1VC0A 5BYSA 1DJ0A 1NDCA 5C42A 1DHMA 4WYWA 2FVQA 1LWFB 1W2IA 2ZBPA 4USUA 4BLGA 4UQTA 1SQFA 2V4QA 3JSBA 2WOMA 3CC7S 4HACB 4R0JA 1N88A 1FRHA 3SSSA 4JV5J 2CZ4A 2QJ3A 2RHQB 3K7RA 5D4PA 1RHKB 1JB0C 1XN9A 4FKYA 4PG6A 2WHOA 4ZIWA 2AWZA 4I2QA 1RLDA 1HPZB 4RW8B 2EFVA 2XZTB 3DRPB 1E6VA 1OYEA 2HZAA 4F0MA 2Y1JA 3CO0P 1JXVA 1CSJA 3MM8A 1CJTB 1WKLA 2WONB 2GFFA 4OYZA 1S5ZA 2KJVA 4RW9B 1KRPA 2LFVA 2E1MC 2GC8A 1QD1A 3M8YA 1RT6B 2FD2A 1N5QA 5L1IA 2LECA 2HQDA 2OKQA 1IBCB 2OUGA 1PCAA 3AH6A 3AJ2A 4KKOB 4X4OA 5AJ3F 4DL6A 2W7AA 4NZ6A 2Q66A 1XNQJ 3EPIA 2W4DA 2NXCA 3M6VA 3QZ7A 1IBMF 3K8VA 1LWCB 2POKA 1VRTB 2DGTA 4UZCA 3PEHA 2AYMA 3GJTB 3T3FA 2Y3YA 3IS9A 2OPSA 5KFVA 1S9GB 5F3TA 1UVIA 2V9KA 4EFAC 2CPIA 5IV4A 3PW7A 4L6V3 4LSLB 3SSQA 1L3TA 1ZBTA 3R9LA 4O3RA 3TZWA 4K4ZA 3MECA 3WC0A 2XMAA 1KWMA 3PRDA 1FX4A 2OPQB 3EM1A 2GAHC 2DKOB 2GAGC 2XSFA 3TI0A 1S4FA 3DNCA 4M5JA 1VQ8S 4F2RA 4L3KA 2NUHA 5KG3A 3OR2B 3V4MA 3D3CJ 3JQJA 4RR5A 3WC2A 2DHXA 4ZVQB 1YBUA 2E5GA 5DDOC 3KJQB 5GAGI 1TQLA 3TR5A 3FMBA 4EU0A 9ATCB 5C24B 1EP4B 1VRUB 2WW8A 1WOSA 3LPEA 3M32A 4OFZA 4MMOA 1UWAA 2R4FA 1EKSA 4RO0A 3OTEA 3H25A 4NLTA 4ED6A 4CRJA 1R8PA 5AE1A 1T8EA 2CDQA 1HWKA 5AE2A 8AT1B 4CO3A 3W64A 4C0OC 1RTHB 3CD5A 3CCVS 2UXBF 3H2VE 2GMJA 2W2MP 2CRLA 2YKNA 4IR1A 1GX6A 2IAJB 1HI8A 2L9DA 1LK5A 4HI1A 4B3RF 1HNIB 3OL8A 4FYVB 1YK9A 2IYIA 1VK8A 3G6YA 1WHYA 5D3GB 1F9FA 2QA4S 4I6WA 2CJQA 1RBAA 1TL7B 5K9FA 2KFZA 3KDOA 5H9FK 3I0SA 3KJFB 4ZMMA 2VODA 1NKBA 4IG0A 2C3PA 4XTTA 1WSVA 5A76A 1NRKA 4TY9A 3G71S 1HBOB 3IAM9 1FWPA 4Q2MA 2RF2A 3GMGA 3BO2A 1HQ2A 4J90A 4X64F 1NKEA 2CQIA 2UXCJ 3R5AA 4K4YA 3DLBA 1RU2A 4F2SA 1WF1A 2ZD1B 3BS9A 2ZH7A 3NY0A 3ZTPA 4YQWA 1O6XA 1U26A 1RTDB 4WBFA 3BGRB 4QYRA 1XR7A 1RT7B 2G0IA 4J91A 2DGWA 4RBUA 7AT1B 1G1XA 3ZZOA 1NM2A 4KRWA 4M5NA 4IFVB 2W2OP 1SH0A 3IXQA 1C0UA 3DLJA 3BGFA 3CD0A 3V6KA 2J6UA 5IQQA 3P8BB 5IZHA 5HVFA 4B3OA 2HW3A 2LKZA 3ICLA 5HQLA 3C6TA 3W61A 4ILRA 2VFVA 2BA9A 5KT3A 2R8IA 2ZJRQ 5HP1B 4IFYA 4NXNF 2OHDA 2OPPB 3D0HE 4YEAA 1TKTA 2YKMA 1CC7A 4Z37A 5GAEI 3JB9k 2M88A 4JV1A 3UDEA 1X8DA 2BE7D 3NGUA 4WU2A 3OUYA 2Z2LA 3A13A 4QZVB 4J9OA 3O8WA 3KTQA 4AXJA 1HKAA 4B9TA 2UXCF 2PGCA 2V2ZA 3BBFA 3RZAA 2V0NA 4WFAQ 2FUG9 2NXUA 3AAWB 1IKWB 4IG3B 2CVIA 1VQSA 3D5MA 3WQPA 4BBYA 4C0HA 4ZLNA 1VQOS 5LXRA 1BXNA 2XGQA 4DLEA 4ZP6A 2YWHA 3PW0A 1SI9A 4I0WA 1T9XA 3FBBA 3KK2B 1HD0A 2N4DA 3R97A 3TX0A 4C3LA 2ASLA 4DWIA 2B9EA 3OTBA 1FT8A 4TYAA 5C25B 3PHTA 5M2PA 3M05A 2ZOMA 2Z4PA 1JLGA 1F6TA 1PBAA 3M9OB 3UVJB 3VAFA 3CJ0A 2Q6CA 4ES2A 2G1HA 3QWUA 3O3LA 3R5DA 4JI4F 5KG1A 3KG1A 4CTAA 2PMHA 5IWAF 2FHKA 5EGYA 4F4WA 4DG1B 4PAAA 2AEMA 2CPJA 2BKOA 1WF2A 2MTLA 1HNZF 4ZVRB 4B3MJ 3ZO7A 3DXSX 3QJJA 3NS5A 2FJEB 2HVZA 3C16A 4ES3A 1CQMA 2JWNA 5LJ3Y 1HNZJ 2MQ8A 2FDNA 3CT9A 1SPBP 4GO7X 4I7FB 3FCVA 1JK9B 3T5KA 4BDPA 2AX0A 1FK9A 5E41A 2I9SA 2OD6A 1U1QA 1FVQA 1RWOB 2WVCA 4V19J 3J80U 1IKXB 2GQ2A 2Y1IA 3VGTA 1XMQF 1N54B 1AXQA 4HI2A 4RUBA 2DT9A 3X3UA 1NSKL 1IBKF 1R0AA 4NCAA 2YKAA 1FRKA 1FKOA 2DTJA 4DFPA 4ZVPB 5IT0A 3RGIA 3FQLA 2ASYA 2R8HA 1NK8A 2IM2A 4B9LA 2IJNA 4RZRA 2JLFA 1FFSB 1X4BA 3MTJA 4OI4A 3W1YC 4LBIA 4PRFA 2BABA 3CC2S 1X5TA 2FZGB 4K50A 1IKYA 5BYRA 3M2VA 1RUSA 4F4YA
chains in the Genus database with same CATH topology
2VJVA 2VIHA 2F4FA 2XO6A 2VICA 4ER8A 2VJUA 2A6MA 2XM3A 2XQCA 2EC2A 2XMAA 2F5GA 2VHGA 2FYXA 2A6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJV A;  2VIH A;  2F4F A;  2XO6 A;  2VIC A;  4ER8 A;  2VJU A;  2A6M A;  2XM3 A;  2XQC A;  2EC2 A;  2XMA A;  2F5G A;  2VHG A;  2FYX A;  2A6O A; 
#chains in the Genus database with same CATH topology
 4KGM A;  4NWB A;  1RT3 A;  2QG9 B;  3OFG A;  2L48 A;  3GII A;  2VIH A;  3MMJ A;  3UVJ A;  2Y1R I;  2A6M A;  5HO4 A;  1S10 A;  1WI6 A;  3GPA A;  3I5B A;  3CVK A;  2DNN A;  3IR6 B;  3IWX A;  4P10 A;  1UFK A;  1AUS L;  2CG8 A;  3H59 A;  5K8P A;  4IG3 A;  4K4W A;  3PW4 A;  4EZ6 A;  1SVD A;  4ZHR B;  2GO9 A;  4M5L A;  3MI7 X;  3OXL A;  1N32 J;  1VOM A;  3R7N B;  2QMU B;  3EWG A;  1OQ6 A;  4LBH A;  1MN9 A;  3NCQ A;  5F0W A;  2R7R A;  2B7B B;  2AGQ A;  2FLN A;  3JXO A;  1VQP S;  3I32 A;  3NOG A;  3R1L A;  4ELV A;  1YSJ A;  5D0E A;  5KFW A;  5GVQ A;  1SJ4 P;  1AYE A;  4FDF A;  1HBU B;  1JIH A;  3AD8 C;  3BKT A;  1GAO A;  4CLS A;  1HMV B;  4HH1 A;  4ZN3 A;  2B3T B;  4PQA A;  4KIA A;  1B0P A;  1GEH A;  3IRX A;  3W2V B;  3MM5 B;  2YKO A;  2WTF A;  2UVW A;  3MXH P;  2FJA B;  4HH0 A;  1KQK A;  2CQB A;  2WVF A;  4X4P A;  1DZ5 A;  1AFI A;  2B5J B;  4P6Q A;  2QYC A;  1WTF A;  2MQN A;  1U09 A;  2RDI A;  1WEZ A;  4H4M A;  2C2E A;  1R7I A;  2NSC A;  1R43 A;  3EGW B;  1UP1 A;  2ILY A;  2E5H A;  3SCK E;  1UZD A;  2V2Q A;  2U1A A;  3F0N A;  4USJ C;  5KFQ A;  2M3D A;  4NLS A;  1EP4 A;  1VRU A;  4PYD A;  3KMQ A;  3HZG A;  2QFJ A;  4F02 A;  2KZM A;  1ZTW A;  4B3T F;  2JJ4 D;  3OQ2 A;  2KT5 A;  1FK9 B;  2VKR A;  4NLR A;  3TAM A;  1U45 A;  2E5L J;  4KH1 B;  3MED B;  3KJV B;  2A0F B;  2NPF A;  4RWW A;  3MUM P;  1PG5 B;  2XLI A;  3LWM A;  2MMY A;  2Q43 A;  3HSD A;  3ILO A;  1R27 B;  4HDG A;  4ZVO B;  2MKI A;  2MLY A;  3MAQ A;  2JLG A;  4DFM A;  2V8D A;  2GZO A;  2EKN A;  3DLE B;  4NLP A;  4FXW A;  2UXB J;  1MU2 B;  4NEY A;  1FDN A;  1QE1 B;  4ZOS A;  1MU2 A;  1RHU B;  2BAC A;  1H7X A;  3TX8 A;  4KGK A;  1NXI A;  2E9T A;  3DN9 A;  3M8W A;  1DFD A;  1PAE X;  1YGY A;  1PO6 A;  2FHO B;  3Q8S B;  1WHW A;  1BE4 A;  4XO0 A;  1UCN A;  3MED A;  2CWK A;  3LAM A;  1YJW S;  3NXZ A;  1T11 A;  1WC3 A;  1P27 B;  2W9C A;  3O1L A;  1FFW B;  4Y2A A;  4LF9 J;  2HHW A;  4KBI A;  2NYI A;  3N0V A;  2XB2 D;  1RT2 A;  3MTK A;  3CJ2 A;  4F4A A;  4O44 B;  5KFI A;  2M70 A;  4HT7 A;  4AL7 A;  4D3G A;  2DNO A;  1YJ7 A;  3T6B A;  2LA4 A;  3MAA A;  3GIK A;  5ETO A;  3DDK A;  4FN5 A;  1U25 A;  2D9P A;  4WFB Q;  1CJK A;  4YDX A;  4MIB A;  1S1U A;  3D1Q A;  4QIF A;  4C6A A;  5IT4 A;  4J9U E;  3J7A N;  4IQX A;  1G7C B;  1S1W B;  1UJ5 A;  2K2P A;  4Y2M A;  3OV7 A;  2RS2 A;  2OI2 A;  4O3P A;  2HBY B;  3HM9 A;  3V6D A;  3PX4 A;  2CFX A;  4DSJ A;  1NME B;  3C6T B;  2FLP A;  4DSL A;  2XS2 A;  1IBM J;  1XR5 A;  3A1Y G;  3H4B A;  2VD3 A;  1GXU A;  3GQC A;  2F7V A;  2B5J A;  4CI0 B;  1Y9O A;  4K4S A;  1RAF B;  2ZFH A;  4O23 A;  3ZZT A;  1RAI B;  1UTA A;  2BRK A;  3JTP A;  2GVD A;  3DGV A;  1C4A A;  4BWJ A;  2QL5 B;  1D8Z A;  2P8I A;  1V9O A;  3UQS A;  5KFZ A;  3GFZ A;  4IQM A;  4ED3 A;  5D4L A;  1M1K T;  1TUG B;  4M5I A;  4DQP A;  2A2D A;  1H7W A;  5LMN J;  3W3S A;  1ACM B;  4C8Z A;  4X4Q A;  2QLX A;  3OT9 A;  4JUZ A;  4YN3 B;  5DM7 Q;  2XSJ A;  4GC6 A;  1CBK A;  1HW8 A;  2DR5 A;  1VC5 A;  4RX6 A;  4LQ9 A;  1PBU A;  3VQS A;  4LF4 J;  1TKD A;  1SJF A;  2XC9 A;  4RNH A;  4CQ1 A;  5JVG Q;  1REV B;  2YWK A;  4ZVT B;  3EDQ B;  5L1J A;  1MSW D;  3IP0 A;  3FNN A;  5HVG A;  4NCG B;  5ETT A;  2FJD B;  1S4E A;  1REG X;  4KGX B;  5T14 A;  3DRY A;  1U0H A;  2WSC C;  2RQC A;  2FC9 A;  2OFH X;  1IJF B;  4RW6 A;  3MPU B;  2R3V A;  2HZV A;  3M4X A;  2MQQ A;  2XMJ A;  4KV8 B;  4HYK A;  1KLM A;  1F3F A;  2B56 A;  1U47 A;  5LT5 A;  4PG4 A;  3BO4 A;  5I42 A;  2R2S A;  3MHY A;  5IXU A;  2ZOG A;  1YJU A;  3VCD A;  5HRO B;  1S6U A;  1B7F A;  4JI2 J;  3O6Q A;  3QJP A;  3BR8 A;  3DLG B;  2DIU A;  1I3O B;  2IDL A;  4NI2 A;  4FXD A;  3DU6 A;  2HVE A;  2DYA A;  1VS3 A;  2BEF A;  3BPS P;  8RUC A;  1UEV A;  1IKV B;  4OX9 J;  4QR2 A;  3DOK A;  1OYD A;  4RPF A;  2ERR A;  2V2K A;  4RUH A;  3OR2 A;  4DSF A;  1FKP A;  1ZM4 A;  4F04 B;  4EBC A;  3D2W A;  1T03 A;  3H98 A;  1W2B R;  1TVR A;  2YNH B;  2KHD A;  2FGO A;  3VR1 A;  1S9F A;  2VF3 A;  4M94 A;  1U6B A;  1UL3 A;  1UPM B;  2GHP A;  5DZ6 A;  4MKY A;  2ZZM A;  4DUY F;  3MPV A;  1WOP A;  2MKS A;  1TKX A;  4R8U B;  2GVZ B;  3W66 A;  5L1K A;  1QAY A;  3R8Y A;  1ROF A;  3ZZ0 A;  4QWE A;  4WIQ A;  5F8J A;  1I5O B;  2CDR B;  1T9Y A;  3D1H A;  1Q16 B;  4DBQ A;  4CH1 A;  2L41 A;  3Q8R B;  3BSO A;  2A1B A;  3GIL A;  5CQG A;  4JI0 F;  5C25 A;  1RT4 A;  1ZH5 A;  4LMZ A;  1RWV B;  4HTJ A;  3WDO A;  3ZTQ A;  4A4J A;  4ZVU B;  3IN5 A;  4LRA A;  4CLZ A;  2GV1 A;  4RJV A;  5HN0 A;  4X65 F;  4DJB A;  1G3O A;  4UTG A;  4UUX A;  2P6S A;  3A3O B;  4URQ U;  2I8E A;  1EHW A;  2UUC J;  4MYU A;  1DAR A;  1NUE A;  2J76 E;  4KTQ A;  1U6F A;  3OXF A;  3MR2 A;  3D28 A;  3KLI A;  2O67 A;  1S6O A;  5HSP A;  2E1P A;  3AD7 C;  3NAH A;  2GHV C;  3M6U A;  4YME A;  2KG1 A;  2EEY A;  3TVZ A;  3T5J A;  1KVI A;  2WVE A;  4I2Q B;  2V9W A;  4LF1 A;  2H1Y A;  4ETZ A;  3DRP A;  2ALY B;  2XLJ A;  5I4M A;  4WE1 A;  5D6G A;  1RTJ B;  5KFP A;  1LXJ A;  2V4R A;  1TV6 B;  1H6K X;  2YX1 A;  1YRT A;  2AV5 A;  2E5J A;  1H2T Z;  4G1I A;  1X0P A;  1PJ7 A;  4EEY A;  4B9N A;  4EUV A;  4NLG A;  4GVL A;  1DTT B;  1PSD A;  1X31 C;  4CO5 A;  3AXM A;  1N6Q B;  2O01 C;  4F0K A;  4HAC A;  4OX6 A;  3KLH B;  3IS9 B;  5KFU A;  2V94 A;  2BKN A;  2J9D E;  5D78 A;  1UJ4 A;  4A46 A;  1RAD B;  2YNI A;  2HWT A;  2ZWP A;  4NLY A;  4ECS A;  1SC4 B;  1U2R A;  3Q89 A;  4GKJ J;  1S57 A;  4S0M A;  1IKV A;  4IOC Q;  2CQP A;  2F9J A;  2UUA F;  4NYZ A;  1WG5 A;  2Q6B A;  1NHU A;  3L4B C;  4GVB B;  1Q4R A;  5AT1 B;  3AOA A;  3VGV A;  2ZHB A;  1HNW J;  4GO5 X;  1YJN S;  1QSL A;  1R0B G;  2KU7 A;  2VC1 A;  3DXB A;  2YWF A;  5THW A;  1WHV A;  3LGN A;  3FJ2 A;  3G82 B;  1QJH A;  1X9S A;  4E8U A;  5LM7 E;  4NLQ A;  1E6Y A;  5KFB A;  4J9Q A;  2AGO A;  1EAR A;  2JNJ A;  3BBB A;  1J27 A;  3JQK A;  5A8K A;  1KNZ A;  2CKW A;  3H5U A;  5M2R A;  3N4W A;  4AQY J;  4G3I A;  4FYX B;  2DPJ A;  1K44 A;  4N5S A;  3ZTR A;  2BBE A;  2KVQ E;  1FRJ A;  1ITP A;  2OPS B;  1RQ0 A;  1DTQ A;  2NLW A;  2YVS A;  2D69 A;  3MM6 A;  5CYQ A;  1BQN B;  1REV A;  3IO1 A;  3UCU P;  3I9V 9;  2HHX A;  1U02 A;  4KHM A;  3TQE A;  4ZN1 A;  2CAD A;  1GXT A;  1RGV A;  2YKQ A;  3IC1 A;  3CCS S;  4DU7 A;  1RAG B;  1QUP A;  4J7C A;  3Q2T C;  2KI2 A;  2JEI A;  5SZT A;  3FGV A;  3MMC A;  4DV3 J;  4BHQ A;  3AOC A;  1JLA B;  2P9E A;  3CCT A;  4KO0 B;  1YWX A;  1VQM S;  1M5K C;  2A10 A;  2CPE A;  2J8S A;  1C1B A;  1S1T B;  4MKA A;  2PEB A;  2YTC A;  5J1E A;  4ZCK A;  2V8H A;  3AOD A;  5DLG A;  1N48 A;  4DR6 F;  1VBX A;  2QL9 B;  1IBK J;  1UA1 A;  4B9U A;  4CM0 A;  4C3K A;  4F26 A;  1FNM A;  3P3D A;  1UKU A;  2FLO A;  3DHW C;  4OZ1 A;  3NOC A;  2LP4 A;  4RNF A;  2QIF A;  3GV8 B;  3T9Z A;  5KT2 A;  2BW2 A;  2OPQ A;  2BOP A;  2IVY A;  2Z58 B;  2PI4 A;  4DPY A;  3RRK A;  3UDV A;  5B0E A;  1QLN A;  2RNE A;  3ISZ A;  3HMJ G;  4LF9 F;  1SJ3 P;  3OVB A;  1VQ4 S;  2CJB A;  3G2X A;  1YHQ S;  1HQU B;  1RT5 A;  3POT B;  1RHR B;  3PRB A;  1N5Y B;  2AYG A;  3TA2 A;  3LOU A;  2HWI A;  2QGF B;  4ALZ A;  4ECX A;  1RLC L;  4ZVS B;  1VFJ A;  5RUB A;  4TQS A;  2HMI A;  3KLI B;  3O44 A;  3AJD A;  2OEJ A;  2OSR A;  1FVS A;  4QWA A;  4EO8 A;  4EBE A;  3FDS A;  1U1P A;  1U0S A;  3NMA A;  3S6E A;  2VZ9 A;  3MM7 B;  3RYL A;  6AT1 B;  2C22 A;  2UU9 J;  2JEF A;  2B9Y A;  3JTN A;  5K14 A;  5KFC A;  1RU1 A;  3FRY A;  5M2U A;  4J9L A;  4RUC A;  4ANC A;  2UXD J;  2HHQ A;  2HFU A;  4FYW B;  3QIP B;  4O3O A;  1VMB A;  2JVR A;  2VG7 B;  4WP3 A;  4F50 A;  1N4L A;  2GNK A;  2U2F A;  3OJU A;  3TW0 A;  3PX0 A;  2XY7 A;  4DI6 A;  4BC7 A;  2R7O A;  1R8H A;  3OHA A;  2MQM A;  3H20 A;  5ETV A;  3KLG B;  4ZJO A;  1TR0 A;  1TMJ A;  3DI6 A;  1QM9 A;  1S97 A;  1IXK A;  4L74 A;  4WP9 A;  2ZE2 B;  5EX3 A;  3GJS B;  2VFU A;  2FJB B;  3BKU A;  4R8U A;  3SDE A;  3WX4 A;  2BE2 B;  4F4X A;  3TAP A;  4ED7 A;  3FBE A;  1JLC B;  3ZTS A;  4DSI A;  2HRY A;  5A8W A;  3RRH A;  3DKD A;  3HO1 A;  1YLX A;  3CXC R;  2ZH6 A;  4IDK A;  1FO1 A;  3HZE A;  5H9E J;  4ID8 A;  4X65 J;  3H8Y A;  3W5X A;  1RKI A;  5CH7 B;  2ZH3 A;  4ECW A;  5FDL B;  4TU7 A;  3C14 A;  2B43 A;  4UUW A;  1N36 J;  1HI0 P;  5DG8 A;  4X62 J;  4O44 A;  2HK3 A;  1RHJ B;  1XMO F;  5J2Q A;  4KFB A;  3PYD A;  2YNH A;  4C97 A;  1ZTT A;  3MUT P;  5L9N A;  1LQ9 A;  3EXC X;  4DX6 A;  3C2P A;  3QRQ A;  1S1T A;  3A8I A;  1RT1 A;  5HRO A;  2ROP A;  4KJI A;  2IMO A;  1V3Z A;  1HBM A;  3BKF A;  5KFK A;  4LF2 A;  4DUZ J;  4DUZ F;  3H5X A;  1JKH B;  2H48 B;  4ECT A;  1B3T A;  2B9W A;  2D9O A;  2DGX A;  3C16 B;  3H5S A;  2XLK A;  3EGZ A;  1EET B;  2HHU A;  3C14 B;  3NWR A;  3DM2 B;  2MY7 A;  4DL0 C;  4USM A;  2R8K A;  2MST A;  3K5P A;  3QRP A;  3R6G B;  2B6A B;  2F8M A;  2VB6 A;  1DTQ B;  1W26 A;  2BZ2 A;  2HBQ B;  2MLX A;  2XZW A;  2AZ1 A;  4I69 A;  3UW1 A;  3SYZ A;  1HHT P;  1UPP A;  2DD8 S;  2ATL A;  2DXE A;  4W92 B;  1SL1 A;  3M2R A;  3W9I A;  4OMF G;  2BDP A;  4ZKA A;  1X9W A;  4JI2 F;  5ETP A;  1GTH A;  1TKX B;  1S79 A;  1U0H B;  2CQD A;  2HZC A;  4KKO A;  4TLQ A;  2DY9 A;  4ETX A;  2F4V F;  2IY5 B;  1K8A T;  1PAU B;  4ZP7 A;  5DG9 A;  1VRT A;  2PE8 A;  1PIE A;  2ZBQ A;  3VQT A;  2FHM A;  3QNW B;  5BR8 J;  3BB5 A;  3W9J A;  4V19 X;  4XDD A;  3QFH A;  1TL5 A;  3GZ7 A;  1Q79 A;  1NHK L;  1VIO A;  1WD6 A;  5HK4 A;  1X5S A;  4ZPB A;  4LRF A;  4F7V A;  5CCL A;  3GV5 B;  2CZV C;  4NLU A;  4DV5 F;  2OEK A;  1UZH A;  4K2J A;  1V6H A;  2JOQ A;  4OJH A;  3S7R A;  2VON A;  2UXD F;  2Y8W A;  2IC3 A;  2MY8 A;  2V4J B;  2PN6 A;  5LSR A;  2BE9 B;  4DR5 J;  1RHQ B;  2C3M A;  1KOO A;  1N5T A;  4YB6 A;  5BXI A;  2YWW A;  1KTV A;  3I87 A;  1RAB B;  2XEX A;  1VGY A;  3M1V A;  2DNZ A;  3ZC4 A;  2BJE A;  1KLM B;  3D68 A;  3N5F A;  5A0Y A;  3V6D B;  2DVI A;  5A0Y B;  1OO0 B;  1GXL A;  4B3M F;  5DDQ C;  3R5C A;  1DQ8 A;  4RW4 A;  1JJH A;  5J1N A;  4FVM A;  2UUB F;  2M4M A;  4DUT A;  1M5V C;  5C42 B;  2BX6 A;  3MCN A;  3ZTO A;  3HP6 A;  5J2P A;  3AFG A;  2VKZ G;  1ZET A;  2NXE A;  1RTI B;  3GYN A;  2OEM A;  5CZX A;  2J9D A;  3TJ9 A;  2PFF B;  1RA6 A;  2Z56 B;  1RWX B;  3LF0 A;  4HL9 A;  2CQG A;  4LFA F;  2NZC A;  3GIR A;  3IA0 A;  2AW0 A;  4LF6 F;  2LYV A;  4OYO A;  4N56 A;  2CG4 A;  3AA8 A;  3N01 A;  3HXM A;  4OV6 A;  4DX5 A;  1ZM9 A;  1HNX J;  1FJG F;  2XGP A;  3BRE A;  1SV5 B;  4YR2 A;  2H65 B;  1NSP A;  2KXH A;  1SV5 A;  4U95 A;  1VRQ C;  1T9V A;  2F4F A;  5CYQ B;  1O5J A;  1YRX A;  3LAK A;  4UY8 5;  4NCG A;  3G82 A;  5GAE U;  1TU0 B;  4O4G B;  4A8O A;  2ZWO A;  1TK5 A;  1S59 A;  2F63 A;  3M6W A;  2OLW A;  4DR6 J;  1UFW A;  3QQC D;  2PT0 A;  4PWD A;  1SJQ A;  3NGK A;  1SH3 A;  3CCL S;  5DLF A;  5LMU J;  4MYT A;  2VAS A;  4A8Y A;  2ZDP A;  1RAH B;  2I5J A;  2CXE A;  3QLH B;  2B9X A;  4K0K J;  1FEE A;  1WJ9 A;  2CJA A;  3DGP A;  3FMW A;  3GON A;  3QLH A;  1Q1K A;  2K1R B;  2A2C A;  3KG0 A;  5J1E B;  1HR0 F;  1RT1 B;  4MKB A;  3ITH B;  2ZH8 A;  1N33 F;  3RB6 A;  4KHP F;  4QYZ J;  3SQG A;  1NSQ A;  3U1M A;  4GKK F;  3LW5 C;  4QYZ K;  4IDK B;  3UNG C;  1VLY A;  3BF4 A;  1ULR A;  1Z2Z A;  3HD1 A;  2PO4 A;  1NO8 A;  4OYB A;  1U2C A;  3QO9 A;  3PV8 A;  4QW8 A;  5ETS A;  3LP1 B;  3TZX A;  1PJ6 A;  2KM8 B;  2C2D A;  3G9C A;  4YHH F;  1WC0 A;  1X5O A;  2G2Y A;  1S0M A;  1ZS6 A;  2L08 A;  5EDW A;  5I42 B;  1X4D A;  2AU0 A;  2MQP A;  2HNY B;  2EPI A;  3BH6 B;  1IR1 A;  3CDU A;  3CW2 C;  4NLD A;  4ZLL A;  3M9M B;  2HVH A;  2M0G B;  2P5V A;  2CQ3 A;  4USK A;  3J7Y I;  4KPY A;  1I6J A;  1PIL A;  1H2U X;  2UVU A;  4A8F A;  1TL3 B;  2WB1 D;  4P52 A;  3D0G E;  3IR5 B;  4P74 A;  2ZHA A;  4BS2 A;  1GQE A;  2CWX A;  4MAK A;  1RDR A;  5MAO A;  4K4U A;  3CO9 A;  3VWS A;  3MFI A;  5DET A;  5F9L A;  3GP9 A;  4ECR A;  3LAL A;  2CNN B;  1X4F A;  4UST A;  1Y11 A;  3W65 A;  5LSO A;  3GFH A;  4QCL A;  1YVF A;  1J5O A;  4PCQ A;  2FHJ D;  1HW9 A;  1XEZ A;  2UU9 F;  3M2R B;  4C8K A;  2QZ8 A;  5CCM A;  1QAX A;  1RA7 A;  4Y00 A;  5IT9 Y;  3MEG B;  2HAF A;  3C66 A;  1IUJ A;  5J2M B;  1BQM A;  1SQG A;  4UOC A;  2ZBI A;  2MB0 B;  3PXG a;  4QWD A;  2KXN B;  2BV3 A;  2VPZ B;  2C3Y A;  2RU9 A;  4Y6I A;  5A6P A;  2YNG A;  1RT3 B;  4PKD B;  3J7A 1;  3WIV A;  2FC8 A;  4KGZ B;  3CIZ A;  2DNQ A;  4CWB A;  5A8R B;  4OHY A;  2IAJ A;  4KHR A;  5A8R A;  3TWZ A;  4DS5 A;  4OYW A;  3TVK A;  3ADA C;  1YBA A;  3K2Y A;  1IWA A;  3FRZ A;  3NBP B;  2XCA A;  5JVH Q;  2RU3 A;  2JEG A;  2YH0 A;  5LL6 d;  2WB4 A;  3ULH A;  2HBR B;  2D1C A;  4DV1 J;  1WC1 A;  4NZ7 A;  2ZNY A;  3K8W A;  5HQM A;  1UWB A;  2E9Z A;  4NX9 A;  2GO8 A;  1IKX A;  2EW9 A;  4K4V A;  1JLA A;  1HQE B;  4KO0 A;  2ROG A;  2VBZ A;  2VQF F;  1S1U B;  2VA2 A;  2HNZ A;  1BY9 A;  4A8S A;  2C42 A;  2HUR A;  3VVT A;  2V2V A;  4C9D A;  3TRG A;  1SKS A;  3NBP A;  5A2Q Y;  2WSF C;  1RK8 A;  1XNQ F;  3MZI A;  5F41 A;  3RW6 A;  2GJI A;  1OY6 A;  1X7V A;  2BM0 A;  3HHE A;  5DQH A;  5CXT A;  1KQG B;  2RHS B;  4YY3 J;  4DHV A;  4CYU A;  2MZS A;  2NUU G;  3OLB A;  2RKI B;  4PR6 A;  2GJF A;  4JV2 A;  4NYP A;  3MDF A;  4X4V A;  5ETL A;  3NNA A;  4DL4 A;  1G6B A;  1TKZ B;  3CED A;  2LXU A;  4OI1 A;  2HHP A;  4K59 A;  1CG2 A;  3OW2 R;  3MEG A;  1PKU A;  2KJW A;  4XIU A;  1N0U A;  4WTY A;  2XY6 A;  2KXF A;  3OXG A;  1FNX H;  2KRR A;  1CS4 A;  2QLW A;  5HAN A;  4O0I A;  4A8K A;  2BMB A;  3M32 B;  4JI3 F;  3T6J A;  5DDP C;  1P1T A;  3LP0 B;  3NL0 A;  4ZP9 A;  2COL A;  1VIS A;  3R3T A;  4GVB A;  5EUH A;  2FPH X;  2MDA A;  3KJV A;  3EIC A;  1SL0 A;  2KT2 A;  4F3O A;  2HRT A;  4XDC A;  1JXE A;  3M8P A;  3IR7 B;  4D3H A;  1U4B A;  1MW7 A;  1WC4 A;  4AL6 A;  1S1X B;  3GJQ B;  3UD4 P;  4PG5 A;  3RB0 A;  1JX4 A;  1ZZF A;  1UVJ A;  4OZ0 A;  5ITH A;  1M0S A;  5H1S V;  2ZKT A;  3W9H A;  5FII A;  2DRD A;  1L3S A;  2ZBC A;  2DCL A;  2EC2 A;  4PXD A;  3PO5 A;  4B3S J;  2GW8 A;  3CJT A;  4OLP A;  3HLU A;  1KFD A;  3CWJ A;  3QSI A;  2OSQ A;  3KK1 B;  5D4N A;  5HMY A;  1U8W A;  3DI6 B;  1VIX A;  3HD2 A;  4ZP8 A;  5KFM A;  1HLW A;  3K0J A;  5ETQ A;  3HKZ D;  2IM1 A;  3TAR A;  3E8O A;  3G4S S;  4PQU A;  2B4V A;  2VDH A;  4KY3 A;  3S01 A;  1NZA A;  4OJG A;  3SEO A;  4DCJ B;  3VAH A;  5H9E K;  1KLN A;  3Q2S C;  4X4S A;  2R8G A;  4JI7 F;  3QJL A;  2IC3 B;  4K2X A;  3W2V A;  1RBO B;  4WFY A;  3PO4 A;  3TYT A;  2E5I A;  6FD1 A;  5HMZ A;  3UWT A;  5KG7 A;  1J2V A;  1UW4 A;  3HHL D;  5HQ8 A;  3L7O A;  3CSK A;  5KFX A;  2HQG A;  1YQH A;  4G6V B;  1CLF A;  3IMQ J;  3N28 A;  2Q79 A;  4DV5 J;  3J7Z 5;  1GMV A;  3DRR B;  5CYM B;  1IQT A;  5KT4 A;  3GCW P;  1JNR B;  1Y00 A;  2XI2 A;  3RTV A;  2H4W B;  4LIW A;  1TMM A;  3PIO Q;  3MAH A;  1RAJ A;  3EVM A;  3H90 A;  3W63 A;  4DR2 F;  3I0S B;  4ZCL A;  4ED4 A;  2KH9 A;  3BQ0 A;  2AZ3 A;  4TQR A;  2MQL A;  5HMW A;  1U6Z A;  2WON A;  3U02 A;  2KM8 C;  2CAJ A;  4G1P A;  4CO2 A;  4DR1 F;  1F0X A;  3N6N A;  5E0O A;  3TQ1 A;  2GQC A;  3S1T A;  1HNI A;  3AQO A;  3Q8Y A;  1RT4 B;  2ALZ A;  2QLF B;  2ZIT A;  4OZ2 A;  4HEA 9;  2ZJP Q;  1C0T B;  3E01 A;  1MWY A;  4UOG A;  3KKF A;  2HQF A;  1BD6 A;  4MKV A;  4P73 A;  2H54 B;  1EX8 A;  5IFM A;  1QE1 A;  3KK1 A;  1FDD A;  4YR0 A;  1KQS R;  4EZ9 A;  1P8G A;  1T0T V;  4XPE A;  1GH8 A;  1WOR A;  1B7Y B;  3TO8 A;  5DJB A;  1MG7 A;  4H4K A;  2MKY A;  1JMT A;  3TZY A;  1HWL A;  4KC5 A;  3HF5 A;  4OJ1 A;  3MWB A;  3HJF A;  4CP5 A;  1Q5Y A;  4OHW A;  4ZPT R;  5L9X A;  3TUZ C;  1VBZ A;  4DPW A;  4NMX A;  1FRM A;  4RLE A;  1I94 J;  3FFI A;  3DOK B;  1R3N A;  1WUU A;  2V8P A;  3PM9 A;  4MK8 A;  5B0D A;  2CQ1 A;  5J2Q B;  4KGV B;  1U1K A;  5B0B A;  2MHN A;  3AJ1 A;  3NGS A;  4HHU A;  2WBM A;  3A8E A;  2LEB A;  2LA6 A;  3CNQ P;  3M30 B;  1DTT A;  4ECU A;  2YBV A;  1H3D A;  1H73 A;  4OI2 A;  1NND A;  1EB0 A;  2BQU A;  2A3J A;  2RRB A;  1KBR A;  2BRL A;  3CTR A;  1RCO B;  4RNO A;  2HGN A;  4DEZ A;  2MGZ A;  4YS2 A;  4JI3 J;  2Z0G A;  3M6X A;  1DRZ A;  2MZR A;  4NPO A;  1U8S A;  3N6L A;  2DR8 A;  2E29 A;  4OX7 A;  4ED1 A;  3ZZZ A;  2HLU A;  3I0R A;  3UNY A;  1OIA A;  2B0G A;  1CJU B;  3CCZ A;  2DH8 A;  4QPT A;  4Q43 A;  3FEY B;  3KHH A;  1R0C B;  4Y2C A;  5D0H A;  5IT9 U;  3E51 A;  3BO3 A;  1MMD A;  1MRO A;  2H5E A;  5K8N A;  2Y0B B;  4FS1 A;  3AB4 B;  2D3O R;  4DV2 F;  4GKK J;  3PR5 B;  4Q8F A;  4P72 A;  1S76 D;  4E98 A;  3OL7 A;  5KFH A;  4ZPD A;  2XO7 A;  3PKM A;  3K5O A;  3RJM B;  2MQO A;  2V67 A;  4Q2L A;  4C8M A;  3UE2 A;  1NK0 A;  1ARO P;  3LP2 A;  1A6L A;  3JAM U;  3PIP Q;  4DL2 A;  2RML A;  2HFS A;  2HMI B;  2ZJQ Q;  2O5D A;  2HS4 A;  2ZKU A;  4ECY A;  4U8V A;  2O1P A;  2V8V A;  4G65 A;  1E6V B;  2B6A A;  4DMZ A;  2DO0 A;  4M5M A;  4PQU B;  3L3C A;  2K3K A;  3DOM A;  3BSN A;  3G86 A;  4IO1 A;  1U1M A;  3KMS A;  2LXI A;  3TAQ A;  4ILL A;  3B82 A;  3M2U B;  5KT5 A;  5BYQ A;  1HI1 A;  1VI7 A;  4YB1 P;  2DNG A;  3D6F B;  3IBW A;  2G2Z A;  3CMA S;  2GA7 A;  4DZD A;  5KG6 A;  4WKR A;  2DJW A;  3WHI A;  2KRB A;  3GIM A;  4IFV A;  3V4I A;  1T03 B;  4L73 A;  1FKA F;  1KP6 A;  1YX2 A;  2DNY A;  2IVM A;  1Q82 T;  5LXY A;  3T1H J;  4DR7 F;  1JWW A;  3DLK A;  5IV3 A;  3DGP B;  3QT8 A;  1H98 A;  1LOU A;  2MLZ A;  1LXN A;  2VG6 B;  3QYY A;  4OX8 A;  3GG0 A;  3T1H F;  4LF6 J;  4DR7 J;  1C2P A;  1YBT A;  3BDE A;  5C2C A;  2ASJ A;  2ASD A;  2ZD1 A;  1VBY A;  2DK2 A;  3I0R B;  3HHN B;  4WZQ A;  3EVO A;  1XMQ J;  4AT1 B;  5EHH A;  5AJ3 J;  2MJU A;  4CDI A;  1L3K A;  3M8Q B;  2Y9H A;  3C8Y A;  3GFY A;  3W2W A;  2W9B B;  3A3N B;  2G13 A;  1SCJ B;  4AXI A;  3RAX A;  1U1N A;  4IRC A;  4FF1 A;  3PAC A;  2J8A A;  2VPX B;  1NU4 A;  5C5J A;  1TAQ A;  3BN4 A;  4ZA1 A;  1WKJ A;  1NJZ A;  3HSG A;  4CLY A;  1NPK A;  2DXF A;  3IGN A;  1VQN S;  2RT3 A;  2DPI A;  4Y3C A;  4B9M A;  2MEW A;  5A8K B;  2OGU A;  1S7H A;  4NLW A;  2UP1 A;  4QU7 A;  1XQI A;  2LDY A;  1GMW D;  4DOZ A;  3DMJ A;  3KLV A;  1JKH A;  1R8C A;  4AQY F;  3A4T A;  2Y0S D;  4LR9 A;  4KYZ A;  4DX8 H;  4YDD B;  3G8S A;  3M8Q A;  3RRG A;  4E0D A;  4NAS A;  5AE3 A;  4U6P A;  2MHE A;  1X4H A;  2VUG A;  1JLG B;  2QV6 A;  3I9Z A;  3JTO A;  1ZM3 A;  4IH6 A;  4Y2I A;  3CCM S;  1FX2 A;  4DV2 J;  5FLX Y;  1RSC A;  3CGI A;  1N8R T;  5JXS A;  1X4C A;  1OY8 A;  2VFT A;  4CLK A;  4J9V A;  4MFB B;  4WKY A;  4ZCM A;  1RWN B;  3FFI B;  2ADB A;  3CUL A;  1NBE B;  2FTR A;  3B78 A;  3P45 B;  4N7T A;  5HVH A;  2HIY A;  3V4I B;  1XNR F;  4P7T A;  2D3U A;  1KTQ A;  4DSE A;  2RD5 C;  3J81 j;  1EQ0 A;  2BJ7 A;  1UWB B;  1VCT A;  1RI7 A;  2AHO B;  3LGM A;  1IBL F;  5F8L A;  4Y34 A;  3W5Y A;  3SDE B;  2LDI A;  1F2G A;  3OSN A;  3MM6 B;  1FTR A;  3J81 Y;  3KLH A;  2JRS A;  3Q8V A;  3RBE A;  3MM5 A;  4QIE A;  3N79 A;  2VOP A;  2FLL A;  4EO6 A;  4GMK A;  4TLR A;  2CQ4 A;  1TV6 A;  1R31 A;  1T05 A;  5EWF A;  2B4U A;  1FJE B;  4M5H A;  5KG2 A;  1U7L A;  3VZH A;  4RU2 A;  3NAI A;  3PCO B;  2R7T A;  3TJA A;  4F0H A;  4JI1 F;  4J9S A;  3RR8 A;  3DRR A;  1C1B B;  3AY0 A;  1FNO A;  4I64 A;  5CYM A;  1X4G A;  4KE5 A;  3VHQ A;  3UR0 A;  1T3O A;  4P71 A;  4DQQ A;  4QR0 A;  1F60 B;  5IS2 A;  4RW7 B;  2VHG A;  4GC7 A;  5E3P A;  3DLL Q;  2AJ4 A;  2DBB A;  3MEK A;  5JMN A;  4ZVE A;  2L9N A;  4OYA A;  2BVZ A;  5G0R A;  4PEO A;  5KFS A;  3EZU A;  4AYB D;  3H40 A;  3MM7 A;  3R5B A;  1XJW B;  5ADZ A;  4LVN P;  2N82 B;  1L3V A;  3R27 A;  3ENW A;  3LAN A;  4HDH A;  1Q81 T;  1H2V Z;  4JYA F;  1CJU A;  1S9E B;  3GB0 A;  3K5L A;  1RYS A;  2NPI A;  3ILL A;  2XMT A;  4P2M A;  4Y2K A;  4B9S A;  4AL5 A;  4JI0 J;  3KHG A;  3OD2 A;  2V69 A;  4HVZ A;  3KK3 A;  2P2C B;  2FYX A;  1OQ3 A;  4HTI A;  4NEZ A;  3IWN C;  4PPD A;  1CJV B;  2AJQ A;  4W98 A;  2AKW B;  3EXY A;  1NZ8 A;  2ZOF A;  2DHA A;  3NCR A;  5HLF B;  5IOL A;  1KSP A;  3FKB A;  4HKQ A;  1XR6 A;  2Z30 B;  4ZPA A;  1JLB A;  3P6Y C;  3SCJ E;  4DV0 J;  2CUY A;  4OIX A;  1QAI A;  2EK6 A;  1RCX B;  5D77 A;  2NQP A;  1Z1Z A;  2AJF E;  3HT0 A;  3TUI C;  5B08 A;  1RWP B;  2WBR A;  3PRV A;  1RP5 A;  3QID A;  2AIR B;  3CC4 S;  4IUF A;  2FJW A;  3ZNJ 1;  2R2U A;  5LOQ A;  1NK5 A;  2HS0 A;  4PWD B;  2DHH A;  1FI4 A;  2BR0 A;  1IM4 A;  3FSX A;  3BM7 A;  3V2U C;  4ZPC A;  4KV8 A;  4DN0 A;  2DR9 A;  3TA1 A;  2V6A A;  1XTZ A;  2D74 B;  1IR0 A;  2JFK A;  2QSW A;  3GSI A;  3G8Q A;  4I2P B;  3PR4 A;  5KT7 A;  3QRR A;  2OEL A;  1KQF B;  1B99 A;  3IRX B;  3KDN A;  3QWP A;  1TL1 A;  4TU9 A;  1CQN A;  3H5Y A;  3EZ5 A;  3DMJ B;  3D3B J;  1FD8 A;  1UMJ A;  2VG5 A;  3A8J A;  5A2Q U;  4FS2 A;  4OZJ A;  3MEC B;  1QSS A;  2R7X A;  3NP5 A;  4Y0F A;  2YQ3 A;  4F3M A;  3EYZ A;  2NCK L;  2IRY A;  3PG9 A;  4TKT A;  3CJ8 A;  4CLW A;  3NGD A;  1VQY A;  3OJS A;  2JL9 A;  3DLE A;  1BWV A;  4U96 A;  5I3U A;  2YQ0 A;  4RBV A;  2KZZ A;  3SZ2 A;  1K1Q A;  4B17 A;  1PYO B;  3Q22 A;  2NSB A;  3QAU A;  5ETN A;  4KHP J;  1LWE B;  2OH2 A;  4QQB A;  1NK4 A;  4NA1 A;  4JB8 B;  1N33 J;  2ILZ A;  4DCP B;  2CQH A;  2RJZ A;  2V8G A;  3EE3 A;  3DYA B;  1U2F A;  1ZYQ A;  2CJ9 A;  3QT5 A;  4ANE A;  3AD9 C;  1FXR A;  2MKJ A;  2QEX S;  1APS A;  5KT6 A;  3M2V B;  1GK8 A;  3CJS A;  1TFW A;  3MM9 B;  3MUR P;  4CH0 S;  2XYG B;  2BXJ A;  3RUB L;  2BJ3 A;  3H4D A;  2ADC A;  2AJ0 A;  2J9C A;  4ELT A;  1LNQ A;  2VH7 A;  2NYH A;  4TU8 A;  1F9E B;  4ZVH A;  4LQ3 A;  4WYL A;  3HKW A;  3Q23 A;  2RUS A;  3Q24 A;  4K4X A;  4EBD A;  5JJB A;  5C2G A;  2A6O A;  1S72 S;  1OJ4 A;  3PDN A;  2CNO B;  1Q8K A;  5AXL A;  3VAM A;  1N34 J;  1CEZ A;  2RRN A;  5DZ7 A;  2DH9 A;  3J80 Y;  2LEA A;  3D6H B;  1GTE A;  3G6V A;  1BGX T;  3MM9 A;  2VQF J;  3ITH A;  4A8Q A;  1HBU A;  2EFQ A;  2UV8 G;  1YI2 S;  4DLG A;  4FNI A;  2RIL A;  3SFG A;  4WE1 B;  3HI9 A;  4I6A A;  2CJY B;  2ZH1 A;  3PW5 A;  4X4R A;  4YOE A;  5G0R B;  4ECV A;  1IR2 A;  4X62 F;  4QWC A;  4Q0B A;  1U48 A;  3OR1 A;  2Z57 B;  2ZDO A;  2G0C A;  2OD4 A;  1VLO A;  2PA3 A;  2XBP A;  2O3D A;  3H42 A;  2F1F A;  4MIA A;  4UW2 A;  3UDL A;  5B09 A;  1S6P B;  4JI6 F;  3MUV P;  1XER A;  3MMA A;  2HFV A;  3EVW A;  3OFE A;  3AT1 B;  4JP8 A;  4LUB A;  4NZ0 A;  3SCI E;  1LWX A;  4KPC A;  4WK1 A;  4CNZ A;  4YR3 A;  2DH7 A;  3WIU A;  4YB7 A;  4LBP A;  3BGL A;  3TOQ A;  4USH A;  1IKY B;  4RNM A;  4ED8 A;  3SBM A;  2JZ5 A;  4U7U K;  2IHR 1;  1M5S A;  1Y5L B;  3DRX A;  2N3O A;  3FBF A;  4UQG A;  1OSD A;  3JYT A;  1IJE B;  4UOF A;  4F67 A;  1JLF A;  1EQM A;  1IVZ A;  3JSM B;  4LRC A;  1FKP B;  2JSX A;  1K73 T;  2VPW B;  1YRU A;  4X66 F;  2J0S D;  1PGZ A;  1I94 F;  1NEE A;  3MPY A;  2M8H A;  2GML A;  3FEX B;  5ETM A;  2CPF A;  2MKH A;  2R42 A;  2WCX A;  4DV0 F;  1S12 A;  3MD3 A;  4U8Y A;  3MCM A;  3D67 A;  5DM6 Q;  2FGC A;  1RWM B;  2V5H G;  4DPU A;  5KAK A;  4B3T J;  3UI3 A;  4IRK A;  2K06 A;  3QAT A;  5G4D A;  1N6Q A;  3R2C J;  2X1G A;  3CME S;  3DLK B;  3DLG A;  5A6W A;  4OZ3 A;  1JLB B;  4HT5 A;  2FVP A;  2CA9 A;  2AYE A;  2DNM A;  3FCH A;  3W7B A;  3SI8 A;  1TFY A;  3ZXW A;  3P5T L;  3T5L A;  2W24 A;  2XO6 A;  4OI0 A;  3OVA A;  3I96 A;  1MN7 A;  3W62 A;  4A8M P;  4USW A;  1MLA A;  4FNH A;  3NS7 B;  4UOH A;  5IC6 B;  3I82 A;  4DV7 J;  1FCA A;  1WWH A;  3HHL A;  1NJY A;  3DRS B;  4EYI B;  3VF0 B;  1CJK B;  2YNF B;  3R7B B;  2KT3 A;  4I68 A;  4ID5 B;  1XBW A;  1RHM B;  2MZQ A;  4A48 A;  4RL1 A;  4J9M A;  3B54 A;  1RTJ A;  1T95 A;  3EMT A;  1WC5 A;  4PWU A;  3ZZU A;  2LQB A;  2W1B A;  3CDW A;  3T9N A;  4C7Q A;  4O3S A;  4DSK A;  1KN6 A;  1Z2L A;  4RW4 B;  2B7C B;  3DC2 A;  1ZOT A;  2KL8 A;  1NJX A;  2VOO A;  3RU0 A;  2YX7 A;  3L09 A;  5FD1 A;  3CDB A;  4OX9 F;  4BC9 A;  3SXL A;  5F8M A;  3GR0 A;  1BWE A;  3ENQ A;  4RW9 A;  2VDI A;  2PI5 A;  4N47 A;  1M5H A;  2HK2 A;  4C98 A;  3QT7 A;  2ZUA A;  4AND A;  4C4W A;  2DR7 A;  4DV6 F;  2I2Y A;  5KFN A;  2MZ1 A;  2LCW A;  2V63 A;  5KFO A;  2GVZ A;  1OPI A;  4KT0 C;  1IBL J;  1TAU A;  3HDS A;  3SIP B;  3JAM Y;  3MR5 A;  2ACY A;  1X60 A;  3TUJ C;  1S0O A;  3GLJ A;  3B4D A;  4JV5 F;  2K7J A;  1T9T A;  2B4P A;  4O3N A;  2J7K A;  2G2O A;  3SQG B;  5DQI A;  1HMV A;  1AFJ A;  7FDR A;  2W2Q P;  2V4J A;  3BGO P;  2W4P A;  4O4R A;  1LFP A;  1HNW F;  2X1B A;  2N4C A;  3PYE A;  2YKP A;  2GIQ A;  4NRU A;  4DQI A;  1X9M A;  2EBE A;  2FJX A;  4ILM A;  2B8Q A;  4P9S A;  3SMZ A;  3MF5 A;  2BJ1 A;  1FA0 A;  1Q95 G;  4X4T A;  1MWQ A;  3E3X A;  3PYG A;  4K8R A;  4NA2 A;  1B70 B;  2EG2 A;  4ZVF A;  2DRB A;  1SJ1 A;  2ACM A;  1S6Q A;  4Q5V A;  2PMW A;  3PW2 A;  4PUO B;  1RAA B;  2KYZ A;  3BN7 A;  2W9C B;  2EFG A;  1B64 A;  4A8X A;  2RF2 B;  3KUE A;  3OTO J;  4F36 A;  1S7I A;  4DL3 A;  4CT8 A;  1HL6 A;  3R5J B;  2H5I B;  2J5A A;  4NLX A;  4CLP A;  3QPI A;  2WW4 A;  2XMU A;  3L9Z A;  4N77 A;  1RBL A;  4I4B A;  5LSL A;  4CO4 A;  2W8K A;  5IWA J;  2GGP B;  1RTH A;  4IH5 A;  1KS2 A;  2RKI A;  4C11 B;  4WII A;  5H9F J;  2JX2 A;  3RAM A;  2H5J B;  1LWC A;  3OFH A;  4DPO A;  3R6L B;  2O66 A;  3KWM A;  3BR9 A;  4FPI A;  4C3M A;  1CPZ A;  2FB0 A;  3DOL B;  3O5T B;  4URS A;  5MLC V;  2KVI A;  3VZI A;  1E6Y B;  4YFU A;  4DF8 A;  2HNZ B;  3AXK A;  1QAJ A;  3MMA B;  4IYQ A;  2C28 A;  3V6J A;  4X4N A;  4ED0 A;  2QTW A;  1RJJ A;  1KFS A;  3EX7 B;  4DS4 A;  3ONQ A;  4U7C A;  2K7K A;  3P49 B;  2VIC A;  5L1L A;  1NDK A;  2XHW A;  3MM8 B;  3R2D J;  1YDL A;  3UN3 A;  4J9N A;  3CMQ A;  1P6T A;  2H9Z A;  5L8R C;  3I4H X;  2I1R A;  4CO1 A;  2IIH A;  4DV6 J;  3D6T B;  1JLQ A;  3W60 A;  2MZJ A;  3ZZR A;  3PFO A;  4QU6 A;  5LJ5 Y;  3OVS A;  2YQ1 A;  3D4J A;  2C3U A;  5FDL A;  1DLO B;  2H4Y B;  1VJW A;  1P1L A;  3C3L A;  4USV A;  2CVE A;  3KLG A;  4NE9 C;  2XZD B;  4CIO A;  1BQX A;  3TNV A;  2W7O A;  1NK6 A;  1H74 A;  4OQJ A;  2AJ1 A;  4NXN J;  1GNK A;  1SB6 A;  2L9W A;  2NXN A;  2FZC B;  4N76 A;  2IRX A;  2OPR B;  2LQ5 A;  4LRE A;  3UCG A;  4FVC A;  2H51 B;  3M1V B;  5BJR A;  3SV3 A;  3MOJ B;  2DIT A;  1UJ6 A;  2HWH A;  4QWB A;  5C7P A;  3HVR A;  2IBK A;  2YNG B;  2VBY A;  3TA0 A;  4FBU A;  4DPX A;  3J81 U;  4FKX A;  2UUA J;  4DPT A;  1RT6 A;  1RXO B;  1JLE B;  7FD1 A;  4ITS A;  3G96 A;  2BJD A;  2VU5 A;  3T19 A;  3HSZ A;  4ZHR A;  1XMO J;  5E3Q A;  2NXJ A;  3IBC B;  3MMC B;  1VJQ A;  2AX1 A;  3MR3 A;  1S48 A;  2ZZN A;  3B8H A;  3OTD A;  1BLU A;  1YIJ S;  2E5L F;  2QLJ B;  4CCH A;  1HWU A;  3CCR S;  1R6Y A;  4JI8 J;  1HQU A;  1Q8L A;  4NA3 A;  4BWM A;  1F5B A;  2CJX B;  4LF5 F;  3RG6 A;  5IQ6 A;  5GAH I;  4C8L A;  4LF8 F;  1FER A;  5I3Q A;  2DRA A;  4LFC F;  5F8N A;  3OPK A;  1NPR A;  5KFY A;  2LVW A;  2MGZ B;  2HEK A;  3MR6 A;  3F73 A;  3LUY A;  1NJI T;  4JI6 J;  1CS4 B;  1T9U A;  3DM2 A;  4I1T A;  5F8H A;  2FY1 A;  1FWK A;  5HP1 A;  4ECZ A;  4KH0 B;  2YKN B;  2VG5 B;  3H7H B;  1M1H A;  3GWC A;  1WEL A;  3I5A A;  1V3R A;  1RTZ A;  2MKK A;  4DR3 F;  5B0F A;  2AQ4 A;  2XI3 A;  2F5G A;  4ZVG A;  3ZZY A;  1HHS A;  4XAK A;  1U1O A;  4CYU B;  3PZP A;  1WDT A;  4L3N A;  5DQG A;  2UV8 A;  2IM3 A;  1LKZ A;  2IDE A;  5HI7 A;  2E7W A;  4TN2 A;  2WK4 A;  1R0A B;  2GHW A;  4LSN A;  4QOT A;  2EC0 A;  5C24 A;  2F3J A;  1LW2 B;  4LF4 F;  3P96 A;  4G1Q B;  1D1U A;  2XMM A;  1LW2 A;  1JQG A;  3CJ3 A;  1O51 A;  4DCO B;  1LW0 B;  3HFK A;  3RBX A;  1EZZ B;  1FE4 A;  4LRB A;  1QTM A;  4RU9 A;  3LO3 A;  3TAM B;  1WHX A;  4K5S A;  2K1R A;  2VPY B;  3C15 A;  4RWX A;  1K9M T;  3JSM A;  4NXM J;  1IQZ A;  3OUY B;  3GR1 A;  2W2P P;  4QPX A;  2R2T A;  5B7W A;  4OHV A;  1Q8I A;  4AFF A;  1CUL A;  2BM1 A;  4NI2 B;  2JC0 A;  3HCX A;  1OPZ A;  5D0G A;  1ZA2 B;  2E66 A;  3NG8 A;  4ZIV A;  1SC3 B;  1SIZ A;  3E2E A;  2YX4 A;  4OYI A;  4DDF A;  1YZ7 A;  3HPO A;  1OSC A;  2RIJ A;  4C11 A;  5DRK A;  1BQM B;  2QE5 A;  4H4M B;  2QMX A;  1HNX F;  1FRL A;  4C8O A;  4DU8 A;  3CJK B;  3KG4 A;  1KEK A;  2BE2 A;  5HAT A;  3DFE A;  3R1H A;  4CLF A;  4WXO A;  4Z2X A;  2VBW A;  1FE0 A;  1DUR A;  4HLB A;  3H2L A;  3QT6 A;  5AXN A;  3W5Z A;  3IRW P;  1J5E J;  3T41 A;  3SV4 A;  4DL7 A;  1T9W A;  2LMI A;  3T1Y F;  1RZM A;  1PC5 A;  1YJV A;  2A18 A;  2B8P A;  3NGR A;  3TP2 A;  4ED2 A;  2XNR A;  5KFT A;  4PG8 A;  4DV3 F;  2NR0 A;  4ZCI A;  5E2Q A;  3AQP A;  1NJW A;  4PXB A;  4EGL A;  5E5N A;  1HBN A;  1NAQ A;  1RTI A;  2V68 A;  5CD4 A;  2G1D A;  2QA2 A;  5I3U B;  2Q1L A;  3BQ1 A;  4Q0B B;  3MD1 A;  4Q45 A;  4DL5 A;  3DRS A;  1M5P C;  3RR7 A;  3GIJ A;  4OI6 A;  5KFL A;  2IA6 A;  1XMB A;  3OTO F;  4MK7 A;  5HJX A;  3IGV A;  1TUW A;  2HNY A;  1GX5 A;  1RWW B;  5T7L B;  2DNL A;  1DQ9 A;  1NB2 A;  4W90 B;  1H72 C;  3V81 A;  2LU2 A;  1S99 A;  1QTN B;  3N9U C;  5FLX U;  1HPZ A;  3PX6 A;  4ERD A;  1QY7 A;  1D9F A;  2JEJ A;  4IFY B;  2DHS A;  2EI5 A;  2OPR A;  1DY3 A;  1TKT B;  1UVK A;  2SXL A;  2YKM B;  3BH7 B;  3FCW A;  3KUG A;  3L7P A;  3LQV A;  3BPD A;  2KB2 A;  3WZ0 A;  1EAY C;  2AT1 B;  4KAI A;  1KD1 T;  4I67 A;  4ICL A;  1Q86 T;  4R25 A;  1BMQ B;  2XNQ A;  3EGV A;  2DNH A;  1S1V B;  3BSC A;  3G8T A;  2W9A A;  3AHP A;  1U1R A;  4LF7 J;  3PNI A;  4MFB A;  2YWG A;  1B4S A;  2HGL A;  5SUH A;  5T7L A;  3K5N A;  4IKA A;  4RKU C;  1VQK S;  4F4K A;  4ZJQ A;  5BR8 F;  3KNA A;  1PYS B;  2C2K B;  3HVW A;  2N7C A;  1RTD A;  4KFB B;  2C3O A;  4C2M A;  1RT7 A;  2RUG A;  1I51 B;  3Q8Q B;  2HHT A;  2W25 A;  3A12 A;  3LP0 A;  2PDA A;  3OFF A;  1JJC B;  1ZAX A;  2EG1 A;  3HSJ A;  5IC4 B;  3KYL A;  5GAH U;  2XY5 A;  1V5V A;  4K4T A;  2J0Q D;  2X1F A;  4QIG A;  1BQN A;  1D9D A;  2YY3 A;  1V3S A;  1FRI A;  1UVN A;  1Q7L B;  4NLO A;  4U9R A;  4JI8 F;  1SL2 A;  2RQ4 A;  2CNK B;  2HGM A;  2XMV A;  3MPW A;  4CTA B;  3OSP A;  3HJV A;  1YZ6 A;  3U1L A;  2BQR A;  4Q7A A;  3QBC A;  4RW6 B;  4AUK A;  3Q0A A;  4WF9 Q;  1SXL A;  2HFN A;  1TK8 A;  2EBG A;  1SQE A;  3CJK A;  3UDC A;  2C2R A;  4PXC A;  3QGH A;  2VBX A;  1Q7Y T;  2QLB B;  2BUN A;  3CF5 Q;  4DR4 J;  3NCP A;  3K89 A;  1K1S A;  2HBZ B;  2VFR A;  2ZVI A;  2F9D A;  1KVK A;  4ZLJ A;  4A47 A;  4L76 A;  1N0V C;  3ISN D;  2N3L A;  1TL4 A;  1HWJ A;  1WF0 A;  2XSJ B;  3GCX P;  1NLK L;  2BW7 A;  2M5Y A;  3R5G A;  3CB4 A;  5KTQ A;  1VQL S;  3PTW A;  1D09 B;  2G0J A;  2PC6 A;  2X7I A;  3D0I E;  3C15 B;  4FZV A;  1R89 A;  4WK3 A;  3M9N B;  1HNV B;  3PFE A;  4Z7Y A;  1N36 F;  1CJT A;  4NCB A;  3NNC A;  1NH7 A;  4CNY A;  2FVS A;  1S1V A;  1M1G A;  2ZZT A;  1ZAW A;  1C0T A;  1RT5 B;  1YJR A;  2FHJ A;  2HQI A;  4ZS6 A;  1GMU A;  5K20 B;  1YTY A;  3GFX A;  2AMC B;  3ISN C;  3JSY A;  2V50 A;  2ZE2 A;  2C2O B;  3DDI A;  4LR8 A;  2C2N A;  2AGP A;  4LFB J;  2ROE A;  4FPR A;  4Y65 A;  4OYP A;  5A8W B;  4N41 A;  2DIS A;  1D3W A;  2DY1 A;  1KR4 A;  1KOH A;  2I0X A;  4QR1 A;  4R5P B;  3OHB A;  1JLQ B;  3GU0 A;  5B0A A;  3MFH A;  1UVM A;  2JLE A;  2CQC A;  4QW9 A;  5AXK A;  1IM6 A;  3CUN A;  2HHH F;  4IOA Q;  2VV5 A;  1ZM2 A;  1AZS A;  5EN1 A;  3CD7 A;  5DO2 A;  1WOO A;  1XIQ A;  2CQ2 A;  1FWL A;  4C0B A;  3IM9 A;  5L46 A;  4EMD A;  3PKY A;  4CLT A;  1TK0 A;  2KFN A;  5DG7 A;  3QMQ A;  1WEX A;  4OZL A;  5KFD A;  3DU5 A;  5DGA A;  4DV4 F;  1YJ9 S;  1M5O C;  1T02 A;  1AB8 A;  4ID5 A;  3J7Z T;  4H4O B;  3RBZ A;  1F3V A;  5F3Z A;  3POT A;  2RDJ A;  1LWE A;  1B0V A;  1URN A;  3TVY A;  2N7Y A;  3T5H A;  2RH3 A;  1JLE A;  4X84 A;  2R7V A;  1NKC A;  2DGU A;  2Q3P A;  3JS9 A;  2DEJ A;  2PII A;  2XYP B;  4UY8 T;  3MMB A;  2IFX A;  3QFW A;  4RBT A;  1LWF A;  3U1N A;  3CJR A;  3M30 A;  3CJ5 A;  1GFW B;  1Y3K A;  1F1B B;  1VBK A;  2DGO A;  4LIR A;  3US5 A;  2K3I A;  3UPF A;  1O0P A;  3K57 A;  3T1Y J;  1Y4Z B;  3B4M A;  1J5E F;  3S8S A;  1DLO A;  1D9A A;  1FKO B;  1MML A;  3UO0 A;  3FSY A;  1LW0 A;  2QRR A;  1VC6 A;  1HR0 J;  3FZ2 A;  2R8J A;  1AUD A;  3L95 X;  2QN6 B;  4OV1 A;  2NZ4 A;  1N34 F;  3OLA A;  3CDA A;  1QSY A;  1FES A;  1QDU B;  3MPD A;  3ZNU A;  3TAN A;  1NPP A;  1YJT A;  4OZ5 A;  1K0T A;  2W2N P;  1HNV A;  5F9N A;  3N5B A;  2W8L A;  3EUN A;  3GE9 A;  1WI8 A;  4GRS A;  2BJ8 A;  2RVJ A;  2XMW A;  2YWE A;  4MIW A;  2MJN A;  3GYX B;  3KHL A;  2FVR A;  1MRO B;  2EFN A;  2GIR A;  3IBF B;  2UVV A;  3QSY B;  3RBD A;  2GIF A;  3CCQ S;  1P9Q C;  2PEH A;  3HVA A;  2MXY A;  5KFE A;  5D15 A;  4YY3 F;  1NHV A;  1UA0 A;  1CC8 A;  1H38 A;  4DG1 A;  3KK3 B;  4OHZ A;  2QMW A;  1MNE A;  2KTQ A;  4E2F B;  3DHX A;  4WP8 A;  3M8Z A;  2R9L A;  1FJG J;  2HFZ A;  5E33 A;  5KG0 A;  2MPU A;  1S49 A;  5IM0 A;  3VTI A;  1FTC A;  1S9G A;  3FK4 A;  3W8G A;  4QJV A;  4ZDN A;  2CPY A;  1URR A;  3K59 A;  1F9H A;  1RAO A;  1ZPV A;  4AE5 A;  4ZLP A;  4ZIT A;  3IM8 A;  2OP5 A;  3DDN A;  3D54 A;  5KFR A;  2NRE A;  1YKW A;  2UUT A;  1YIT S;  3KNG A;  1AA1 B;  2RS8 A;  3P5B P;  2W9B A;  2IBO A;  1U24 A;  3KXD A;  3MEE A;  3KLE B;  2F8H A;  1VQ6 S;  2JHE A;  3GG1 A;  3U7J A;  1K0V A;  2Z2Y B;  2QYG A;  3OR1 B;  5KFJ A;  3UCZ P;  3IAS 9;  3PJ9 A;  2BQ3 A;  3UR3 C;  1RAE B;  1VDH A;  3HT3 A;  1HAR A;  1SBR A;  3I31 A;  2DNP A;  4YB5 A;  3K58 A;  3TZZ A;  1C4C A;  2EXU A;  2HQC A;  3F44 A;  2VG6 A;  4W4M A;  2IRU A;  4Y28 C;  3VGU A;  4AD6 A;  2ZM6 J;  3G6X A;  1LV5 A;  4LFC J;  2WVD A;  2XMK A;  4OL8 A;  4LSN B;  2R7U A;  4EWT A;  1VQ9 S;  5HJY A;  2MZT A;  4TVA B;  1IWG A;  5L38 A;  2YNI B;  1M90 T;  2OML A;  1BHN A;  1EIY B;  1SKW A;  4ICL B;  4PXE A;  3PEJ A;  1C1C A;  1SUQ A;  3TJ8 A;  4F4Z A;  1FDB A;  4U67 Q;  2CNL B;  5J2N A;  1NK9 A;  2HQ3 A;  2RQK A;  3QGI A;  4RNN A;  3ENA A;  1NB7 A;  5HAO A;  1AT1 B;  2BJ9 A;  4JI4 J;  2IYG A;  1N5V A;  3DCA A;  2HHH J;  3DOM B;  4WCE Q;  1CUL B;  2HAI A;  5F8I A;  1SKR A;  1TEL A;  1UVL A;  4KSE B;  1DAX A;  4DF4 A;  3V81 B;  3D7S B;  3DYA A;  2QA4 G;  3MAA B;  2QA1 A;  2DGQ A;  4WFZ A;  2ATC B;  3HFV A;  1UFL A;  4V1A k;  3LP2 B;  4WJB A;  1KVJ A;  4DQR A;  4H4O A;  4LVO P;  3ZZP A;  2ZM6 F;  4M95 A;  1BC6 A;  5K14 B;  2M8D B;  2UUC F;  2W7P A;  2DO4 A;  2MSS A;  2DHG A;  2HKE A;  1SJR A;  2EVZ A;  2ZC4 A;  2ZUG A;  3FBC A;  3KFW X;  2ZC3 A;  5CHC B;  3GSD A;  4J5O A;  5HBM A;  3VAL A;  2H3E B;  4OYX A;  3TUP A;  4MTP A;  1KKH A;  2XCP A;  1RT2 B;  3E01 B;  1W25 A;  2LQJ A;  1AZS B;  4OJ3 A;  1TL7 A;  1WG4 A;  2XTJ P;  2J6S A;  3QAE A;  2DEI A;  2XM3 A;  4X4U A;  3ENV A;  4Q8E A;  5IM0 B;  5GAD I;  3CCJ S;  4I56 A;  1Q0N A;  4CLL A;  3M8R A;  2X3G A;  2RSQ A;  3TEG A;  3F56 A;  1Y5N B;  3QGG A;  2KKH A;  1WDD A;  4USI A;  2RQM A;  1Y7P A;  3HFZ B;  1JXL A;  4RUA A;  2Z2M A;  4PUO A;  3ETM A;  5HBM B;  4IOB A;  2M52 A;  2LQ9 A;  4EYH B;  4HHJ A;  3HK2 A;  4K0K F;  3CJQ A;  4OI3 A;  2DNR A;  5K8O A;  2EK1 A;  2C2M B;  4TXS A;  1N32 F;  1NDP A;  3P4U B;  2IJF A;  5AXM A;  1IN0 A;  4CT9 A;  1XK8 A;  3M8S A;  2BAN B;  4TY8 A;  5T41 A;  2KYX A;  2FVC A;  3GYG A;  3KUH A;  1TVR B;  2CYY A;  4NRT A;  2F40 A;  4HR2 A;  3EGN A;  2CPD A;  4M5G A;  3D66 A;  2GS8 A;  1XC9 A;  4LJM A;  1X4A A;  2KDO A;  2J0X A;  3IWL A;  4QIV A;  4P2S A;  2OJ3 A;  2G4B A;  3EPG A;  1QUV A;  3CPW R;  2XS7 A;  2M7S A;  1FXL A;  4PPZ A;  2DGS A;  4ED5 A;  2UZA A;  4XPC A;  2J7U A;  5EWG A;  2P6T A;  1JLF B;  3UD3 P;  3AA9 A;  1GMW A;  1S9E A;  5E3A A;  4M5K A;  2GCF A;  2NS1 B;  4PZV A;  3M2U A;  4ES1 A;  2D41 A;  2K8G A;  4LF7 F;  2BOA A;  2HND A;  4FF3 A;  2HLT A;  1PC4 A;  2V34 A;  1WC6 A;  2XUL A;  2CIM A;  3QIP A;  2AJ2 A;  1UEK A;  2EFP A;  1FDA A;  4WWS A;  2ZHO A;  4IO9 Q;  2UVR A;  3NWG A;  1HYS A;  3QGP A;  1HYS B;  3LPY A;  1N56 A;  5D8H B;  4PWW A;  3IG1 B;  1WTB A;  2KO1 A;  4J9P A;  2FQQ B;  2RDD A;  5J1P A;  1JNZ B;  2XWX A;  3ET6 B;  2LEP A;  2FJV A;  4LSZ B;  4WTO B;  2G9O A;  5U47 A;  4DV4 J;  2HHS A;  2VJU A;  2HND B;  1TL3 A;  3JSR A;  5CYJ A;  1X5P A;  4CZC A;  4NLV A;  3U27 A;  4F8R A;  4ZPV R;  2IPO B;  3I6P A;  2KN4 A;  1C1C B;  1SUQ B;  4P7V A;  5J2N B;  1OS5 A;  5GMK a;  3RAQ A;  1N5S A;  3NNH A;  1ELO A;  5HL7 Q;  3HHL B;  3BBC A;  3LP1 A;  2WOM B;  1T3N A;  3BGU A;  3ILJ A;  2CJK A;  3UN5 A;  2P9G A;  1HIY A;  2QC3 A;  2RAQ A;  2OIH A;  2FIU A;  1S1W A;  5CAA A;  1CVJ A;  4OLO A;  1OWX A;  4ATN A;  4Z7C A;  1TTH B;  1UEU A;  1HBM B;  2C1E B;  2KFY A;  3WBZ A;  3HHD A;  3O2I A;  4DV7 F;  1Z4U A;  2OMO A;  4PYA A;  4OZN A;  1KC8 T;  4ELU A;  2XS5 A;  2MKC A;  3M8P B;  4UF4 A;  5B0G A;  3AOB A;  2WZ1 A;  3EZO A;  4NYO A;  2DIV A;  3SFU A;  3KHR A;  3Q86 A;  1S1X A;  2DXD A;  2HVI A;  4X2B A;  2HFO A;  4J9K A;  2M9K A;  1FFG B;  4JYA J;  2VA3 A;  1F5A A;  3D1O A;  4QIW D;  4H54 A;  4ZPW R;  4K5R A;  1PYT A;  4NXM F;  1RWK B;  1XWL A;  3FC9 A;  2HIQ A;  5B0C A;  3OBI A;  2KG0 A;  1ICE B;  5ETK A;  1RWU A;  1VR6 A;  1ZAV A;  3D6M B;  4OYM A;  1AW0 A;  1F5C A;  3VAK A;  3THV A;  1ZA1 B;  1J5O B;  1R8B A;  1T94 A;  3BYP A;  4LSL A;  3Q83 A;  4F25 A;  4FF2 A;  3NMR A;  4DR4 F;  2CPX A;  2HS3 A;  3RW7 A;  1FD2 A;  3AB2 B;  2RE1 A;  3OL6 A;  3WX8 A;  3VAJ A;  2D3O 1;  2I38 A;  3A3P B;  1LEO A;  4M5D A;  3FEZ A;  1TL1 B;  3HX9 A;  2EKY A;  2DR6 A;  3GTY X;  1X0F A;  4P2F A;  4DXL A;  2PA8 D;  4X66 J;  1D8Y A;  4A8W A;  4JI1 J;  1RYR A;  4DR3 J;  1Y0H A;  2HPU A;  2IMW P;  4H4K C;  5F8G A;  4UT4 A;  3MCS A;  1B0T A;  4HHH A;  4KB7 A;  1HFE L;  5D4O A;  4MK9 A;  4DX7 A;  1EKR A;  1FF2 A;  1EJ7 L;  4R0E A;  1D0E A;  1A0O B;  3SCL E;  3NRB A;  3CCU S;  4FBT A;  2R7S A;  1SKU B;  2ZBR A;  4N8N A;  4X64 J;  1S77 D;  1R6V A;  5I3P A;  3T1A A;  4LRD A;  3OTC A;  5KFG A;  4LF8 J;  5DDR C;  4F3Q A;  3PYF A;  2EFO A;  2R7W A;  1S0V A;  1WG1 A;  4G1Q A;  3VAG A;  2JFD A;  1CJV A;  1PJ5 A;  4YHH J;  1T05 B;  1XNR J;  3K5M A;  5DGB A;  3THT A;  2GQQ A;  3OL9 A;  4U7U D;  3NS6 A;  1N52 B;  2JDJ A;  3C46 A;  1NDL A;  4B3R J;  2UUW A;  5E7O B;  1G2E A;  4P2X A;  2CZ9 A;  1TUV A;  1X4E A;  1FXD A;  1UAW A;  2VFS A;  4QBU A;  4LR7 A;  4EK2 A;  4JI5 J;  3JQM A;  1FHT A;  3BJY A;  1HWI A;  5KFF A;  2GJ2 A;  4M1K A;  4CH7 A;  2VC0 A;  1ZZN A;  5FJ4 A;  4WU3 A;  3Q8U A;  1F2H A;  4IRD A;  1W7W A;  5GME A;  1ZPW X;  1Y3J A;  1V5I B;  1UET A;  2LU1 A;  3IG1 A;  1TP7 A;  2QT7 A;  3B6B A;  8ATC B;  3UFC X;  2XYH B;  3PJW A;  4C8N A;  3ET6 A;  4KQZ A;  2ZNZ A;  1MWZ A;  4FF4 A;  3NGT A;  3GV7 B;  1NK7 A;  5E3R A;  1HA1 A;  2HG4 A;  4P75 A;  1UW9 A;  4EI2 A;  1RE1 B;  1SC6 A;  3LGH A;  4B02 A;  4DZ6 A;  2ZH9 A;  2AEJ A;  4ER8 A;  3BDP A;  2QFI A;  3V6H A;  4L75 A;  2YXL A;  1H0H B;  3MEE B;  3W8P A;  3SSR A;  2GGP A;  3KLE A;  4DR1 J;  3I5C A;  3EJM A;  5KOX A;  4IH7 A;  2YNF A;  4JV0 A;  3THP A;  3V5R A;  1FEH A;  4DR2 J;  2WVB A;  3DOL A;  2B4O A;  4Q44 A;  4YP3 A;  3BSA A;  2R2R A;  1N5Y A;  3PHE A;  3X1L B;  3ILI A;  3EDR B;  4DN9 A;  6FDR A;  4M5D B;  3CJ4 A;  1EET A;  2E7X A;  2X3D A;  3TEH B;  2PFD A;  3KJN B;  2AYB A;  3UD5 A;  2IVF B;  1JJ2 R;  4MJK A;  3LWL A;  2RB7 A;  2WAQ D;  1OY9 A;  2HVD A;  5LMU F;  1U1L A;  3FVY A;  3G6E S;  2E1R A;  2AF6 A;  4M63 A;  3F41 A;  2BKP A;  1QVG R;  2B51 A;  2DGV A;  3GJR B;  2YPZ A;  3QO9 B;  4M8L A;  3PJX A;  4OHX A;  5CAB A;  3Q8P B;  3FZB A;  3FSI A;  5K8M A;  1T7P A;  1HQE A;  1P9Y A;  1FJC A;  3K17 A;  1IKW A;  2WRM A;  5CA5 A;  3CCE S;  4WXW A;  2ZH2 A;  4FXV A;  3VV2 B;  2E1C A;  4DQS A;  4WFN Q;  1Y10 A;  1RAC B;  2E7V A;  5HLF A;  1Q53 A;  1KON A;  1LK7 A;  1R8A A;  2CQ0 A;  2I5J B;  2OFG X;  1BUX A;  5GAD U;  3CD6 S;  2DNK A;  3I4P A;  1HHQ A;  1I1G A;  2OPP A;  1FRX A;  2I6W A;  5KG4 A;  4B3S F;  2HHV A;  2QL7 B;  5CZV A;  1HBO A;  1NH8 A;  4LFA J;  3MMB B;  1JLC A;  4DR5 F;  4DFK A;  3BYR A;  3D9B A;  3LH2 S;  5L39 A;  3JYT B;  2YPY A;  3NEK A;  2BYC A;  2Z8Q A;  2PD1 A;  2VQE J;  4URG A;  2J9E A;  1SIW B;  4JBC A;  2VQE F;  1L3U A;  1TKZ A;  1L5U A;  2QSF A;  4B9V A;  2IJR A;  2JVO A;  5EWE A;  1G4C A;  2IA0 A;  1VHI A;  2C2Z B;  3CIM A;  2F65 A;  4KR0 B;  2PMZ D;  2XQC A;  1RKJ A;  4O0N A;  2UUB J;  3BZQ A;  9RUB A;  3KLF A;  3BGR A;  2OAU A;  3HHL C;  3M7V A;  3I56 S;  3KK2 A;  1VK3 A;  2YH1 A;  2E9R X;  4GKJ F;  1S6P A;  2E44 A;  2RRA A;  5J2M A;  1S6Q B;  5CD4 H;  2F4V J;  1LFW A;  1KHW A;  2J6T A;  2APO A;  2VJV A;  4RW7 A;  1VQ7 S;  4LF5 J;  2XHC A;  1SC1 B;  4I6Y A;  1YG0 A;  3CE8 A;  5EX0 A;  1A7G E;  2D3Z A;  2Z2Z A;  5E3C A;  4FYD A;  1SH2 A;  2EWH A;  1KHV A;  1RB0 A;  1DBD A;  1VYA A;  2AEF A;  2GMH A;  2P9C A;  2IM0 A;  5J2P B;  2GVD B;  2ZVS A;  4CM2 A;  4ECQ A;  2KHC A;  3H2U B;  5ETR A;  4WPA A;  3MCO A;  4YUD A;  1K47 A;  2L3M A;  4WFX A;  2ZEJ A;  2DB1 A;  5KG5 A;  4NML A;  1NSA A;  2HSE B;  1QVF R;  1RIS A;  2W01 A;  4DFJ A;  1C0U B;  4MH8 A;  3HVT B;  2DCU B;  3LTO A;  4MT1 A;  3HVT A;  2AD9 A;  4PG7 A;  3ETO A;  4LFB F;  3HHK A;  4TNO A;  4B3O B;  4B08 A;  2CPH A;  3CDE A;  2MYF A;  1Q5V A;  3C19 A;  2ZH5 A;  3R7S B;  4DV1 F;  4K7Q A;  1HBN B;  1S0N A;  2FZK B;  3NKY A;  4FYY B;  5DS7 A;  1WEY A;  2E1A A;  2VG7 A;  3MGJ A;  3VGS A;  4TY8 B;  2D7S A;  3N6M A;  1U49 A;  3DLH A;  3KOA A;  1KDN A;  2FY8 A;  2R7Q A;  2VL1 A;  3PVX A;  2GX8 A;  4NL5 A;  2J7W A;  1WKK A;  5LMN F;  3KLF B;  3FUY A;  5K5M A;  2Y1L B;  4LT6 A;  5F0U A;  1MMN A;  2LLZ A;  4J37 A;  4IG0 B;  1VQ5 S;  2OO4 A;  3BQ2 A;  2XG8 A;  3H0P A;  2AP6 A;  2LQ8 A;  2X51 A;  3RB4 A;  3C6U B;  4NOH A;  3L7U A;  3A8K A;  2JC1 A;  4DUY J;  2OTL S;  5KFA A;  4JI5 F;  3ELH A;  4O3Q A;  1WNE A;  3VAI A;  3MOZ A;  4FP9 A;  4I2P A;  4TYB A;  5HMX A;  4R5P A;  2PSZ A;  3MR7 A;  3IFE A;  4L72 B;  4O4G A;  1Y5I B;  1HD1 A;  4CO0 A;  5D3G A;  3RB3 A;  2HRU A;  2WSE C;  3PY8 A;  4CLU A;  3NLC A;  2X1A A;  3W2W B;  3I55 S;  2ABY A;  3ZFV A;  1DQA A;  2W4C A;  5JUM A;  2LXF A;  5D0R A;  2J0W A;  2CPZ A;  4UZB A;  1O8B A;  1JJ4 A;  5GAG U;  4JI7 J;  1WSR A;  1Q8B A;  3C6U A;  3HUL A;  3LA0 A;  2JH3 A;  5GMD A;  2QO3 A;  1NCL A;  3SQO P;  3G87 A;  4ENO A;  3CCW A;  4N8O A;  4J9R A;  4PAB A;  1A9N B;  1OMS A;  3FQK A;  3J7Y U;  4WZM A;  4XK8 C;  4IR9 A;  5KOW A;  3VVU A;  4ZK7 M;  4JOU A;  4C8Y A;  2M2B A;  2OTJ S;  3BEG B;  2HYI B;  1FJ7 A;  3BV8 A;  2QX0 A;  4ZJL A;  1WAC A;  4I7F A;  1TZ0 A;  2XWY A;  2ZH4 A;  2F8E X;  2BAN A;  1Q78 A;  4RW8 A;  3UN2 A;  1VHF A;  3QZ8 A;  1GT8 A;  4C48 A;  2Y8Y A;  4BCA A;  1VC0 A;  5BYS A;  1DJ0 A;  1NDC A;  5C42 A;  1DHM A;  4WYW A;  2FVQ A;  1LWF B;  1W2I A;  2ZBP A;  4USU A;  4BLG A;  4UQT A;  1SQF A;  2V4Q A;  3JSB A;  2WOM A;  3CC7 S;  4HAC B;  4R0J A;  1N88 A;  1FRH A;  3SSS A;  4JV5 J;  2CZ4 A;  2QJ3 A;  2RHQ B;  3K7R A;  5D4P A;  1RHK B;  1JB0 C;  1XN9 A;  4FKY A;  4PG6 A;  2WHO A;  4ZIW A;  2AWZ A;  4I2Q A;  1RLD A;  1HPZ B;  4RW8 B;  2EFV A;  2XZT B;  3DRP B;  1E6V A;  1OYE A;  2HZA A;  4F0M A;  2Y1J A;  3CO0 P;  1JXV A;  1CSJ A;  3MM8 A;  1CJT B;  1WKL A;  2WON B;  2GFF A;  4OYZ A;  1S5Z A;  2KJV A;  4RW9 B;  1KRP A;  2LFV A;  2E1M C;  2GC8 A;  1QD1 A;  3M8Y A;  1RT6 B;  2FD2 A;  1N5Q A;  5L1I A;  2LEC A;  2HQD A;  2OKQ A;  1IBC B;  2OUG A;  1PCA A;  3AH6 A;  3AJ2 A;  4KKO B;  4X4O A;  5AJ3 F;  4DL6 A;  2W7A A;  4NZ6 A;  2Q66 A;  1XNQ J;  3EPI A;  2W4D A;  2NXC A;  3M6V A;  3QZ7 A;  1IBM F;  3K8V A;  1LWC B;  2POK A;  1VRT B;  2DGT A;  4UZC A;  3PEH A;  2AYM A;  3GJT B;  3T3F A;  2Y3Y A;  3IS9 A;  2OPS A;  5KFV A;  1S9G B;  5F3T A;  1UVI A;  2V9K A;  4EFA C;  2CPI A;  5IV4 A;  3PW7 A;  4L6V 3;  4LSL B;  3SSQ A;  1L3T A;  1ZBT A;  3R9L A;  4O3R A;  3TZW A;  4K4Z A;  3MEC A;  3WC0 A;  2XMA A;  1KWM A;  3PRD A;  1FX4 A;  2OPQ B;  3EM1 A;  2GAH C;  2DKO B;  2GAG C;  2XSF A;  3TI0 A;  1S4F A;  3DNC A;  4M5J A;  1VQ8 S;  4F2R A;  4L3K A;  2NUH A;  5KG3 A;  3OR2 B;  3V4M A;  3D3C J;  3JQJ A;  4RR5 A;  3WC2 A;  2DHX A;  4ZVQ B;  1YBU A;  2E5G A;  5DDO C;  3KJQ B;  5GAG I;  1TQL A;  3TR5 A;  3FMB A;  4EU0 A;  9ATC B;  5C24 B;  1EP4 B;  1VRU B;  2WW8 A;  1WOS A;  3LPE A;  3M32 A;  4OFZ A;  4MMO A;  1UWA A;  2R4F A;  1EKS A;  4RO0 A;  3OTE A;  3H25 A;  4NLT A;  4ED6 A;  4CRJ A;  1R8P A;  5AE1 A;  1T8E A;  2CDQ A;  1HWK A;  5AE2 A;  8AT1 B;  4CO3 A;  3W64 A;  4C0O C;  1RTH B;  3CD5 A;  3CCV S;  2UXB F;  3H2V E;  2GMJ A;  2W2M P;  2CRL A;  2YKN A;  4IR1 A;  1GX6 A;  2IAJ B;  1HI8 A;  2L9D A;  1LK5 A;  4HI1 A;  4B3R F;  1HNI B;  3OL8 A;  4FYV B;  1YK9 A;  2IYI A;  1VK8 A;  3G6Y A;  1WHY A;  5D3G B;  1F9F A;  2QA4 S;  4I6W A;  2CJQ A;  1RBA A;  1TL7 B;  5K9F A;  2KFZ A;  3KDO A;  5H9F K;  3I0S A;  3KJF B;  4ZMM A;  2VOD A;  1NKB A;  4IG0 A;  2C3P A;  4XTT A;  1WSV A;  5A76 A;  1NRK A;  4TY9 A;  3G71 S;  1HBO B;  3IAM 9;  1FWP A;  4Q2M A;  2RF2 A;  3GMG A;  3BO2 A;  1HQ2 A;  4J90 A;  4X64 F;  1NKE A;  2CQI A;  2UXC J;  3R5A A;  4K4Y A;  3DLB A;  1RU2 A;  4F2S A;  1WF1 A;  2ZD1 B;  3BS9 A;  2ZH7 A;  3NY0 A;  3ZTP A;  4YQW A;  1O6X A;  1U26 A;  1RTD B;  4WBF A;  3BGR B;  4QYR A;  1XR7 A;  1RT7 B;  2G0I A;  4J91 A;  2DGW A;  4RBU A;  7AT1 B;  1G1X A;  3ZZO A;  1NM2 A;  4KRW A;  4M5N A;  4IFV B;  2W2O P;  1SH0 A;  3IXQ A;  1C0U A;  3DLJ A;  3BGF A;  3CD0 A;  3V6K A;  2J6U A;  5IQQ A;  3P8B B;  5IZH A;  5HVF A;  4B3O A;  2HW3 A;  2LKZ A;  3ICL A;  5HQL A;  3C6T A;  3W61 A;  4ILR A;  2VFV A;  2BA9 A;  5KT3 A;  2R8I A;  2ZJR Q;  5HP1 B;  4IFY A;  4NXN F;  2OHD A;  2OPP B;  3D0H E;  4YEA A;  1TKT A;  2YKM A;  1CC7 A;  4Z37 A;  5GAE I;  3JB9 k;  2M88 A;  4JV1 A;  3UDE A;  1X8D A;  2BE7 D;  3NGU A;  4WU2 A;  3OUY A;  2Z2L A;  3A13 A;  4QZV B;  4J9O A;  3O8W A;  3KTQ A;  4AXJ A;  1HKA A;  4B9T A;  2UXC F;  2PGC A;  2V2Z A;  3BBF A;  3RZA A;  2V0N A;  4WFA Q;  2FUG 9;  2NXU A;  3AAW B;  1IKW B;  4IG3 B;  2CVI A;  1VQS A;  3D5M A;  3WQP A;  4BBY A;  4C0H A;  4ZLN A;  1VQO S;  5LXR A;  1BXN A;  2XGQ A;  4DLE A;  4ZP6 A;  2YWH A;  3PW0 A;  1SI9 A;  4I0W A;  1T9X A;  3FBB A;  3KK2 B;  1HD0 A;  2N4D A;  3R97 A;  3TX0 A;  4C3L A;  2ASL A;  4DWI A;  2B9E A;  3OTB A;  1FT8 A;  4TYA A;  5C25 B;  3PHT A;  5M2P A;  3M05 A;  2ZOM A;  2Z4P A;  1JLG A;  1F6T A;  1PBA A;  3M9O B;  3UVJ B;  3VAF A;  3CJ0 A;  2Q6C A;  4ES2 A;  2G1H A;  3QWU A;  3O3L A;  3R5D A;  4JI4 F;  5KG1 A;  3KG1 A;  4CTA A;  2PMH A;  5IWA F;  2FHK A;  5EGY A;  4F4W A;  4DG1 B;  4PAA A;  2AEM A;  2CPJ A;  2BKO A;  1WF2 A;  2MTL A;  1HNZ F;  4ZVR B;  4B3M J;  3ZO7 A;  3DXS X;  3QJJ A;  3NS5 A;  2FJE B;  2HVZ A;  3C16 A;  4ES3 A;  1CQM A;  2JWN A;  5LJ3 Y;  1HNZ J;  2MQ8 A;  2FDN A;  3CT9 A;  1SPB P;  4GO7 X;  4I7F B;  3FCV A;  1JK9 B;  3T5K A;  4BDP A;  2AX0 A;  1FK9 A;  5E41 A;  2I9S A;  2OD6 A;  1U1Q A;  1FVQ A;  1RWO B;  2WVC A;  4V19 J;  3J80 U;  1IKX B;  2GQ2 A;  2Y1I A;  3VGT A;  1XMQ F;  1N54 B;  1AXQ A;  4HI2 A;  4RUB A;  2DT9 A;  3X3U A;  1NSK L;  1IBK F;  1R0A A;  4NCA A;  2YKA A;  1FRK A;  1FKO A;  2DTJ A;  4DFP A;  4ZVP B;  5IT0 A;  3RGI A;  3FQL A;  2ASY A;  2R8H A;  1NK8 A;  2IM2 A;  4B9L A;  2IJN A;  4RZR A;  2JLF A;  1FFS B;  1X4B A;  3MTJ A;  4OI4 A;  3W1Y C;  4LBI A;  4PRF A;  2BAB A;  3CC2 S;  1X5T A;  2FZG B;  4K50 A;  1IKY A;  5BYR A;  3M2V A;  1RUS A;  4F4Y A; 
#chains in the Genus database with same CATH homology
 2VJV A;  2VIH A;  2F4F A;  2XO6 A;  2VIC A;  4ER8 A;  2VJU A;  2A6M A;  2XM3 A;  2XQC A;  2EC2 A;  2XMA A;  2F5G A;  2VHG A;  2FYX A;  2A6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...