2F5GA

Crystal structure of is200 transposase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
130
structure length
130
Chain Sequence
ELKSTRHTKYLCNYHFVWIPKHRRNTLVNEIAEYTKEVLKSIAEELGCEIIALEVMPDHIHLFVNCPPRYAPSYLANYFKGKSARLILKKFPQLNKGKLWTRSYFVATAGNVSSEVIKKYIEEQWRKEGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transposase, putative
publication title Crystal Structure of a Metal Ion-bound IS200 Transposase
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Gene regulation
total genus 37
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2f5gA00
2F4FA 2XO6A 2A6OA 2A6MA 2FYXA 2VJVA 4ER8A 2EC2A 2XMAA 2XM3A 2VJUA 2XQCA 2VHGA 2F5GA 2VICA 2VIHA
chains in the Genus database with same CATH superfamily
2K3IA 1NH8A 2A18A 3LTOA 3RW7A 3M9NB 1C1CA 3CD6S 4WXOA 4FN5A 1BHNA 2BJ7A 3KMQA 2HYIB 3DFEA 2HVZA 3TUIC 1T9VA 5EN1A 1RAGB 5I3PA 4EYHB 3BBCA 4PYDA 3KNAA 4DFPA 2VJVA 4U96A 4J9NA 4Y00A 2YNGA 4NZ0A 5KG5A 2X1BA 1KHVA 2I9SA 1FRJA 2RMLA 1KFDA 5HLFA 2BW2A 2RE1A 1UAWA 1VQ5S 2BANB 1TMMA 4WXWA 3KK2B 2UVRA 2WB4A 1TK0A 4J5OA 3W9JA 3MI7X 4EWTA 4JI0F 3DOKA 1EP4A 2VFTA 3C15A 9ATCB 2IA6A 3KUHA 5AJ3J 3AXKA 2DK2A 1F9EB 4DR1J 3OL9A 1PBAA 1WOPA 2A0FB 3UI3A 4DR2J 1AUSL 4FVCA 2GJFA 5FDLB 1GFWB 3US5A 3MECA 3C14B 4DV1J 1UA1A 2Z2MA 2DHSA 1YITS 2ZH1A 2BXJA 5K8OA 1RHUB 2DKOB 1JLCA 2Z56B 3CD5A 1N0VC 4X4TA 4QBUA 5LXYA 1RB0A 3MEGA 2HZVA 4DR6J 2FJEB 3HSGA 4Y0FA 2R4FA 3A3PB 3OD2A 4OJHA 1FK9A 3MPYA 4DV0J 4KHPF 3G86A 4QIEA 3CCUS 1CJKA 3W7BA 4WKYA 2NSBA 2P9GA 1YRTA 2H5IB 4KFBB 2Y1LB 3OL7A 4ECYA 2PMWA 4FKXA 4GC6A 3GJSB 3M8PB 4ID5B 4Y65A 2BJ3A 4A48A 2MLZA 3MR7A 1M5KC 4JV5F 4WZMA 1JLAB 1L3UA 3A12A 5CXTA 1UEVA 5C25A 1I5OB 1HQEA 2NUHA 4DWIA 1IKXB 2FVCA 1R0AA 3BGRA 3N9UC 4RW7B 3H40A 4MKAA 2AZ1A 4CLPA 3M8YA 2QV6A 1Y7PA 1U45A 1HWJA 1RWVB 4PPZA 3AQOA 4YB5A 2DGXA 4DSFA 2ZDOA 2DITA 2W4CA 4JUZA 4K4WA 3MPWA 4DPWA 3EZUA 2HIQA 4DR3J 3WIUA 1BWEA 3KHHA 4ECWA 3AD7C 1NLKL 5IV4A 4H4KC 3CF5Q 5HBMB 2DRAA 5GAEI 1TL5A 4M95A 2VQFF 3H59A 3HJVA 4HHHA 1N54B 3FBCA 4WJBA 1WHWA 4NCGB 3A8JA 1X60A 2HIYA 2VG5A 1JJ2R 2ZBIA 2GW8A 1N88A 2B9EA 4LFCF 2CJAA 1V9OA 1Q5VA 3HCXA 2MSTA 2BKNA 5K5MA 3DC2A 1RU2A 1YBTA 3KJVA 6FD1A 2R7OA 3UNYA 4OFZA 2GHWA 2ILZA 3TUJC 2K2PA 4NL5A 3IWLA 2IJRA 2GIQA 2PIIA 1R31A 1HBUA 2OPQA 1FRXA 1J27A 5KFVA 2MQOA 3MEDA 1Y5LB 1FJCA 2HNZB 2QZ8A 1DQAA 1KLNA 2ZBPA 2WHOA 4GC7A 2ROPA 2DNGA 1MWYA 4WBFA 1KVJA 2O01C 2VBXA 1PJ7A 4KTQA 5HN0A 1H2UX 4LQ9A 3OXFA 1EQMA 3AJDA 1RTIB 3WHIA 5F3TA 4PKDB 1IBKJ 2J0SD 2LA4A 4LJMA 1X5PA 2K7KA 2D3ZA 2QJ3A 4DCPB 5DJBA 5F8HA 4TY9A 5C24A 2CADA 2F40A 4CTAA 2OEKA 1ACMB 1RT6B 2C3OA 2QYCA 3MMCA 2VJUA 1G4CA 1TKXA 1UVJA 2H48B 5GAHI 2YH0A 1ZZFA 1JXEA 1QTNB 2CJ9A 1BQMB 5KFRA 4ZIVA 1ZPWX 3LPYA 3NS5A 1VS3A 2ZH7A 1JLBA 1RBOB 2JZ5A 1RWXB 2VFVA 2ZC4A 4BLGA 3UE2A 1V3RA 2VV5A 1IJEB 1SPBP 1FJGF 1IR0A 1KOOA 2IM2A 4NLVA 3SV4A 3V81A 4EO6A 1RADB 2CQPA 1NDCA 1N5SA 2HFOA 2OP5A 4RUAA 2ZNZA 3MMAB 3HMJG 3IBWA 5I42B 3NGUA 4DXLA 3QJJA 3GFHA 3PR5B 3TQ1A 1SH0A 2ZWPA 1NK9A 3LO3A 3FRYA 3NNCA 3PHTA 1KRPA 5L9NA 1FVSA 4KGXB 2KFNA 2CQCA 2V4RA 2X1FA 3P49B 1NMEB 2DXEA 1WC5A 3IFEA 4R25A 1IM6A 2W1BA 1S4EA 1VC6A 4ECQA 3C16B 4J9LA 1U48A 2OI2A 3BO4A 2PI4A 4K4VA 4P74A 4PYAA 2CNKB 4KIAA 3WX8A 4F7VA 4G3IA 1N6QB 2ZH8A 4NA3A 1REGX 3EGVA 4NEZA 2BE2B 3VZIA 5SUHA 2DNNA 1FA0A 4OZ3A 4CLWA 3H2UB 2KVQE 2CVIA 5FJ4A 3M30A 2V6AA 3W5XA 4NYPA 4K5RA 5DG8A 2F4VF 2LYVA 2C2KB 2CFXA 3S7RA 4GRSA 1UWAA 5HMYA 2FZKB 2XI2A 3MM9B 3W5ZA 2QA4S 3BM7A 4ED6A 3POTB 1RT4A 3CIZA 1F5AA 4IG0A 2ZNYA 1CBKA 1T9UA 5K8NA 2MHEA 4C48A 3ZNUA 2D69A 4XK8C 3MM8A 3PW2A 1XEZA 2FC8A 4Q2LA 1RYRA 4ILLA 4Y3CA 4I6YA 3EPGA 1VQ6S 1KHWA 1T3OA 3PJXA 3H5UA 4M5DB 1JLFA 3WZ0A 2PDAA 4TY8B 3RU0A 2YWKA 4HTIA 4HHJA 3W2WB 4S0MA 5CZVA 2GJIA 4KSEB 4QQBA 1E6YA 4DR7F 3KLIB 2V4JA 1S4FA 3VZHA 2HLUA 1F5BA 3J80Y 2DCUB 1FJEB 3IMQJ 7FD1A 4X65F 3BR8A 2CA9A 1X5SA 2LVWA 3NOCA 1H2TZ 2E7XA 3DRSB 4DX6A 3KLGB 3JYTA 2U1AA 4NX9A 2IDLA 1IR1A 3PYDA 1PAEX 1K8AT 2MQ8A 3PRDA 3VF0B 2YWHA 3LGMA 1V5VA 1UVLA 2YQ0A 5IV3A 4OL8A 1PYOB 3ZTOA 1QY7A 1J2VA 3SCJE 3CC2S 2AGOA 1QAJA 4OJGA 5C2CA 3IRXB 3G8QA 1NK8A 3R2CJ 3T1YJ 2QMXA 4QJVA 4QR0A 1SVDA 1OQ6A 2A1BA 4ZPTR 2EC0A 4RWXA 4DL6A 1P9QC 2B8QA 1XIQA 3I56S 3CMAS 4ALZA 4IRCA 1NDLA 1VBKA 3IP0A 1SV5B 1YQHA 1DFDA 1S7IA 4OQJA 4F4YA 1U1PA 1U25A 3QRQA 4KKOB 5EWGA 3PO5A 3QBCA 4PQUA 4OZLA 1Q8BA 2IYIA 4M5JA 3W63A 2BJ1A 1EHWA 1PYTA 2HS0A 2F9DA 2WBRA 1D0EA 4E8UA 2V34A 1EX8A 3VAHA 4I6WA 3ETMA 4A8SA 1Z1ZA 3VAIA 4MKYA 1KC8T 1ZA1B 3UDVA 3HSDA 3RBXA 1FKPB 2FB0A 1TVRA 4D3GA 1S97A 2KZMA 1RT2A 2BUNA 1CVJA 1EB0A 2OHDA 4JI6F 4NOHA 3H0PA 5KT4A 3K8VA 2LDYA 1Q8LA 2DB1A 2E5GA 3VGUA 3KLEA 4LF4F 5D3GA 2CG8A 2Z57B 2BBEA 2BM0A 4P2FA 5KFOA 1S6UA 1HNIB 1NDPA 1OSCA 3DMJA 4FP9A 5C42A 4P72A 3F73A 1VQ4S 3RRGA 2E1CA 4LF6J 5T7LA 2ADBA 1RACB 5HJYA 1FRLA 5LL6d 2CJBA 2JRSA 1BQXA 1RT7B 2IRXA 3BSOA 4IYQA 4C8KA 2UVUA 2V8HA 1W2IA 3OL6A 1VK8A 4K4TA 2VC0A 3OL8A 3BGOP 3P96A 3ZTSA 1HIYA 4X66J 4G1PA 1FTRA 5K9FA 2CNLB 2OIHA 3AOBA 2H3EB 3IM8A 1GAOA 3PR4A 2GAGC 4YOEA 5IOLA 3T3FA 1EP4B 3CULA 2FLNA 5GAGI 1IBMF 4RW6A 4QPXA 2MEWA 3NNHA 2EWHA 3W62A 3DGVA 2I38A 2C2MB 2HURA 3MECB 2EC2A 1S6OA 2B9YA 3GU0A 1XK8A 2V9KA 1CJTB 5GMEA 2AGQA 2RHQB 4UOHA 1VQMS 4ELUA 1Q86T 3GFYA 1S1VA 4M5GA 4JI6J 5B0BA 4J9SA 4HL9A 4OYOA 4A8OA 4NE9C 3Q23A 2FY1A 1VHIA 5HMZA 1PJ5A 1Q1KA 3FQLA 1G1XA 4QWAA 3KOAA 3EVWA 4H4MA 4FXDA 4LFAF 4L73A 4OV1A 3EVMA 4KY3A 2QA1A 3J7YU 1XQIA 4O3PA 4B3SJ 4JV0A 3TZWA 2XTJP 2DCLA 4J9QA 4F3OA 2R2RA 4F67A 2CAJA 3F56A 2I5JB 1JB0C 1DURA 3LP1A 4IRKA 3H2LA 4IG3A 3OHBA 4ZP6A 4C2MA 2G2ZA 3I6PA 3V6DB 2UXDJ 4RR5A 1HNXF 4IH7A 5DGAA 1RAFB 4K50A 2DGQA 4BDPA 5KFYA 1N52B 2KT5A 5D77A 2OKQA 2R7WA 3NCQA 1H72C 3QFHA 3C19A 2KFZA 4ZP8A 3CO0P 1JLQA 2B3TB 2L3MA 3W1YC 2AYEA 3KKFA 1JLEA 5ETLA 5K20B 1YJWS 5LOQA 4RUCA 3DXSX 3M8SA 2FY8A 5IS2A 5KFZA 4ES3A 1X4GA 1R6VA 4NA2A 3DLEA 4AL6A 2W2MP 3D7SB 3ILJA 1B99A 3OVBA 2DO4A 3TNVA 3G82A 1WC0A 2RT3A 3K7RA 1BE4A 3SCLE 2HNDB 1IBLF 1WHYA 4Q44A 3J7A1 1MU2A 1RHKB 2B4UA 3CCRS 3HKZD 4TQSA 1LEOA 2XS2A 1QUPA 5KFAA 4H4OA 1N36J 1XR6A 5M2RA 2YY3A 2HVHA 1S49A 3UVJA 2QLFB 3EX7B 2DGUA 2JJ4D 2DT9A 3H90A 4MKBA 2FYXA 4A47A 2OSRA 4GKKJ 4Y2AA 4A8KA 2AW0A 3MM7B 3OVAA 1X31C 5M2PA 5F0UA 4K2XA 3MFIA 2VODA 3D6FB 4DEZA 1D1UA 4B3RJ 4MFBA 3DLHA 2JLEA 4QWCA 1FKAF 3ZXWA 3CJKB 2C28A 3GIRA 3QZ8A 5J2QB 5L1IA 4IFYA 3R1LA 3BS9A 5A0YA 2IAJB 3U02A 2IRYA 3EJMA 5L46A 4Q43A 1DARA 1VRUA 4DFMA 3GWCA 3A8IA 3IWXA 2UUAF 1FNMA 4DV4F 5ETPA 5HVGA 1NH7A 1TL4A 2ZWOA 1R27B 4ZKAA 4ANCA 2HG4A 2ZHAA 2COLA 4N5SA 1XMOJ 4U9RA 3KNGA 3TJ9A 3DRRB 1PBUA 2F65A 3M2UB 4WP3A 4FYYB 5IWAJ 2KVIA 2OPRA 1M5SA 2WW4A 3AJ2A 1VQPS 3P5TL 3P6YC 1YJRA 3PY8A 2M88A 3MXHP 1ZAWA 3OTOJ 5A6PA 3DU6A 4OYXA 2GZOA 3MAAA 5B0AA 2QL9B 1WEZA 1T94A 3H5SA 2ZBRA 4QWDA 3IO1A 5IQQA 2W8KA 1VJWA 1TELA 1HD0A 4URGA 4MKVA 4K4ZA 1WTFA 1UPMB 1F1BB 1T02A 4E2FB 1SKWA 1KQSR 3SFUA 2EEYA 4CNZA 5CCLA 1X8DA 1PSDA 3CCMS 2R7UA 4DL2A 2NCKL 5JVHQ 2B5JA 4UZCA 3E01A 3BSNA 5LXRA 5KFEA 2KG1A 1X0FA 3PFEA 4V1Ak 4DL0C 2NYHA 2VG6A 4RKUC 3KK1B 1QSLA 3FVYA 3TJ8A 3QQCD 3V81B 5HROA 4ZHRA 3DOMB 4DFJA 1RJJA 2H4YB 5KFLA 4RLEA 4CO1A 2M70A 4FF1A 1YI2S 4K4YA 3BKUA 3D6MB 2Z8QA 3GTYX 3IR6B 2OH2A 3R5CA 3DDNA 3HVAA 4DV4J 1F2HA 4KJIA 3AOAA 3ZZYA 1N5YA 1R6YA 4ZS6A 4ZVEA 4JI5F 1X0PA 3BR9A 3GJRB 2GMHA 3HVTB 4OX9F 2GGPA 2F8EX 1KFSA 4ED5A 2CPXA 4OYWA 4DG1A 1FESA 3UN2A 3FFIA 3VAGA 5HP1A 3MCMA 4DSIA 1N5VA 1F2GA 3P45B 1WHXA 4ZCIA 3FRZA 1BUXA 4M94A 4LF7J 7FDRA 1SIWB 2NPIA 2VDIA 1LNQA 3R7SB 2YNHB 2XWXA 2V2KA 2ZH6A 3D0IE 2GJ2A 1JJHA 2H54B 5JUMA 1R43A 1KKHA 4ZN3A 3NY0A 1GMWA 3SMZA 4IFVA 1YRUA 1I6JA 3DLKA 4M5KA 1HR0J 2QRRA 2EPIA 1X4DA 4LVOP 1XNRF 1N32F 2M2BA 5DDPC 2HHTA 1CC8A 2JDJA 1X9SA 3DU5A 2HHQA 5C7PA 1WSVA 4DDFA 4EUVA 4AL7A 5L38A 3EE3A 4OI2A 1Q8KA 2HEKA 4I7FB 1YX2A 4B9VA 4DUZJ 2OTLS 3FMBA 1FVQA 2QO3A 2XYHB 2QX0A 2ZC3A 2AZ3A 2JC1A 1GTHA 3FZ2A 2W4DA 4RBUA 4QIFA 1VFJA 1FDDA 4OHVA 1S6QA 1RTZA 1CSJA 1D9AA 2QFIA 2V4JB 1WNEA 3MPVA 3PEJA 1P6TA 3DRPA 1UA0A 3QATA 5G0RB 2QT7A 2DXDA 2C2RA 3NS7B 3AFGA 4KO0A 1SXLA 1ULRA 3CWJA 3NBPB 4FF4A 1I94F 1MMDA 1TL1B 3ET6B 5I3UA 5H9EJ 1IUJA 5HL7Q 2KXHA 3FCVA 4OI0A 1YKWA 2EFVA 4IH6A 4LF2A 5D4NA 2ZE2B 3L09A 1TV6A 3LWLA 4F4XA 4O4GB 1IBCB 4ZN1A 1X9WA 1NJZA 1RZMA 3A3OB 2K8GA 4JI8F 1YTYA 3DDIA 2PC6A 3JAMY 1H74A 2P2CB 1RUSA 4NLDA 2HVDA 2RF2B 3TAMA 2ZHOA 4ZCLA 5IQ6A 1VR6A 4F4KA 4B3OB 2VA2A 5F8IA 3IWNC 4X4SA 3MMBB 5EDWA 4B9LA 3IN5A 1S9EB 3NAHA 4PWWA 3G6YA 3Q24A 3IG1B 2J9CA 4JI7F 1T9XA 1F3VA 2E1PA 4DV2F 1RLCL 4QW9A 3BV8A 4DU7A 1NK0A 4UQTA 3H2VE 5HAOA 4QR2A 1B7FA 2YKMA 3LP0B 3LAKA 5FLXU 4USKA 2GC8A 3I4HX 2EFOA 2BEFA 2Q6CA 3TVKA 2M52A 1JJCB 2Z2ZA 4BWMA 4FBUA 3M32A 4EO8A 5K8MA 2A2CA 2LXFA 1WJ9A 1IN0A 3KTQA 4LT6A 1S1WB 2B6AA 3FSYA 1WOSA 3NL0A 4O23A 3TARA 1J5EJ 5F8LA 3RB4A 4UUXA 2DYAA 5DDRC 4ZJQA 3L7PA 1OY6A 3SDEB 6AT1B 3R9LA 4C7QA 1U7LA 3HDSA 1RHJB 3IAM9 2YTCA 5SZTA 4DJBA 3TW0A 2ZEJA 4PXCA 4AD6A 4O3QA 2GFFA 2ROGA 3W5YA 1YJ9S 4AYBD 3ITHA 3N0VA 5G4DA 2IA0A 2RKIB 3R6GB 2BJ9A 4AT1B 1VC0A 3KDOA 2VASA 2DR5A 3E8OA 2IJFA 5ETNA 3ZZTA 4KAIA 3AXMA 3R5AA 1LWXA 4ECUA 1T8EA 4FF2A 1HFEL 5DLGA 1TFWA 3CGIA 5KFQA 2RDJA 4WFZA 3CE8A 2YVSA 2HNYB 4K5SA 5LMNF 1S59A 2DGWA 3ZZ0A 1LK5A 4DX7A 4CZCA 1U0HA 4RX6A 4C3MA 1KLMA 1NZAA 2WAQD 5KFNA 4XO0A 2FJDB 2P9EA 2XLJA 1SL0A 2I8EA 3M1VB 1OSDA 3MTJA 3R2DJ 2D3O1 3U1MA 1UKUA 3MR5A 2NR0A 2FJVA 3Q2TC 2Z4PA 1T03A 4ID8A 2ZD1B 5B0FA 1CS4A 2CQIA 1H38A 4K7QA 4YY3F 1HKAA 3VQTA 1KD1T 4IDKA 2D1CA 4RNNA 3KUEA 2XSJB 1FFSB 2HVIA 5J2MA 4C4WA 3KJFB 2KYXA 2RRNA 2DNKA 2XMVA 3Q83A 4L72B 1PIEA 1HD1A 1AFJA 4G1QA 5AT1B 3HI9A 3QGIA 4EZ6A 3CCES 5L1LA 2W2OP 3UPFA 4CT9A 1PC4A 1PG5B 4MYUA 2AD9A 2MGZA 1QE1B 1RU1A 1S57A 1UEUA 5IT4A 2WONA 1APSA 5I4MA 2JEGA 1SBRA 2FQQB 2RAQA 2CPZA 3NLCA 5BR8J 2CDRB 4I4BA 3R1HA 3IRWP 4HKQA 3G71S 4NXMF 1FERA 1NHUA 2EI5A 3VAJA 4EI2A 1B64A 4I6AA 2MKYA 1G7CB 1HNWF 2ZZMA 2VD3A 4DV6J 4CLFA 5CAAA 1CULB 4I67A 2W25A 3AODA 4RBVA 4CH7A 3PYEA 3PFOA 1ZTTA 3CMQA 3W2VA 1EZZB 2K06A 2JSXA 4ED4A 3GV5B 3ELHA 4ZPBA 1HARA 4YB7A 3M8QA 2CQGA 1GEHA 3QT7A 1NM2A 4ZJLA 2Z2LA 2ATCB 1UJ4A 4HACA 2QYGA 4DCJB 4PR6A 1RAJA 3JXOA 5KTQA 4NEYA 2RVJA 3NWGA 2WSCC 3IC1A 1RT1A 4R0JA 2ZITA 2VPXB 4O4RA 3IBFB 5DLFA 4DV5F 2KZZA 5KFMA 1OYEA 1LXNA 2N7CA 7AT1B 2ILYA 3GCXP 4LRDA 3HHLA 3SI8A 3GMGA 1W26A 2VUGA 2P6TA 4GVBA 2W7OA 3PIOQ 2Y9HA 1HNVA 4K0KJ 2OFGX 3PCOB 4ED3A 1HHSA 2C3YA 3DM2A 4MJKA 4O0IA 3D5MA 3LP2B 3K5OA 1PGZA 3TEGA 3T1HJ 1I1GA 5A8KA 1U49A 1Z4UA 3WQPA 2VONA 2B7BB 2HFVA 3GV7B 3BQ1A 5BYQA 1FRHA 2X3GA 1GX6A 3C6UB 4TXSA 3PVXA 3LGNA 3HK2A 1SKUB 1FE4A 5A8RA 2GIFA 1RE1B 1N56A 2IIHA 4DV7F 4CNYA 4AQYJ 1EETA 2DNRA 1NUEA 4USIA 2EKNA 4KYZA 4C98A 1JMTA 3RUBL 1HMVB 4DR4J 1U6BA 5HSPA 1Q8IA 1SUQB 2ZFHA 4YP3A 1S0VA 5D0GA 4LSNA 3SSRA 4WIIA 3M6XA 3O1LA 4X62F 4ZIWA 4C8OA 2HWIA 3KXDA 4JI1F 2RQ4A 2FVSA 2LP4A 4HTJA 2KG0A 3RTVA 1TUGB 4ECZA 3ADAC 4U7UD 1QTMA 5KG6A 4Z37A 3HPOA 4U95A 4N77A 4C0BA 3A8EA 1AYEA 1UMJA 4Y6IA 3R5GA 3ZFVA 1LWFA 3TZZA 4UOFA 3CC7S 5E7OB 1D09B 3BYPA 5E33A 3Q2SC 5CYMA 5H9FK 2F3JA 5H1SV 2FVQA 2B4OA 1S6PB 2M3DA 2VF3A 3MAAB 3KLHA 1KQGB 4AXIA 2Y8YA 1LFPA 4M1KA 1S10A 2K1RB 2DVIA 2CYYA 2MKJA 2QL7B 1YZ7A 2ZH2A 1A0OB 2DIUA 2E44A 4J9MA 2V67A 1JKHA 2QIFA 3D4JA 4JYAF 2R42A 1U0SA 3M2RB 2MZRA 2NREA 3GE9A 4F3QA 1M5OC 3FEYB 2CQ3A 3I82A 3I5BA 4OHZA 3HLUA 1PC5A 4CWBA 2N4CA 3OUYB 2XGQA 4OYMA 5D6GA 4UY8T 2EFPA 4HHUA 4X64F 3SBMA 2HBZB 2AX1A 5KT5A 5F41A 4CLYA 1H98A 2HRUA 2KB2A 4ZA1A 2KT2A 2HFSA 3CDUA 1XMQJ 3HO1A 2V68A 1TL3B 3CJSA 1CJVB 2W7AA 1FRKA 3ZTRA 4OYZA 2BKOA 2FPHX 3MM5B 4RW9A 2HVEA 2GAHC 2C42A 1NB2A 2ASLA 2DRBA 3F0NA 2PD1A 1T9WA 1TTHB 2F8MA 4EBDA 5KFKA 2YBVA 2ASJA 1U1MA 5E0OA 2R2TA 1Q81T 1R0CB 3GIIA 2CIMA 2D74B 4KV8A 3OVSA 2UUBJ 4ICLA 3FZBA 2HZAA 3PX6A 2MZJA 2RDDA 3IXQA 4LUBA 3BO3A 4WTYA 4WK3A 1X4AA 4IFVB 3MF5A 3V4IB 4RUHA 3Q8VA 2XBPA 4OV6A 1RTDB 4USJC 3QPIA 2E5LF 4OZ1A 2OPSA 1NXIA 4PUOA 1Z2LA 3I5AA 2KU7A 2HMIB 1N8RT 1XNQJ 2R7RA 2BJEA 3P3DA 4YN3B 2GVZB 3CCLS 3AA8A 2HS3A 2ZJPQ 4XPEA 2LQ5A 2O5DA 3UO0A 1Q5YA 1WD6A 5THWA 2GO9A 4C8NA 3VALA 1S1UA 3MD1A 3CEDA 2EBEA 3Q8SB 2HAFA 4F2SA 5E3RA 2DY9A 3TEHB 3BGUA 2LQ8A 4BBYA 4LF1A 3P5BP 3PJWA 4HDHA 1S48A 5K14A 2OEMA 5FD1A 2L9NA 4CM2A 4KO0B 1OQ3A 2YKQA 2LKZA 4DI6A 4RU2A 1R89A 4NRTA 4IKAA 3QLHB 2CUYA 2NZCA 3MDFA 2XMTA 1HI0P 1L5UA 1VQNS 2UU9F 3TYTA 3K5PA 2PEHA 4OYPA 4YFUA 4ZLNA 8ATCB 4DCOB 3PO4A 3HVWA 4DUYJ 1WF0A 3WBZA 1KONA 4NXNF 1WDTA 3RR7A 3MCOA 2F8HA 1FFGB 3MEKA 2BA9A 1UJ6A 3OLBA 3AA9A 2XZWA 5HANA 1QJHA 4LVNP 1ZAXA 2DNOA 1M5VC 5J1NA 5IC6B 4FNIA 4WCEQ 4B3TJ 5BXIA 2J0XA 2YH1A 1XBWA 4LSLB 1FTCA 5DETA 1RT3A 3PG9A 1IKYA 2BRLA 4DZDA 1IWAA 3TA1A 1OS5A 4X2BA 4MMOA 4NLGA 2DD8S 4GKJF 5CZXA 3ILOA 1H3DA 3PYFA 2BQUA 4CYUB 3CIMA 2MZQA 4LBIA 1JXLA 3I0SA 2YKMB 1TQLA 2XMWA 3BDEA 3OV7A 4QIWD 2J6UA 2UVVA 1S0OA 1JK9B 4P71A 5AXKA 1C1BB 1FDBA 4UT4A 2MY7A 3A13A 2D3UA 1VGYA 2MB0B 3T6JA 5A8WA 3UN5A 1TKZA 5B09A 2UXCJ 1UVNA 2AT1B 5ITHA 4K59A 3K8WA 3BH6B 4DL7A 1FXLA 4C3LA 5CH7B 3UR0A 4WE1A 3ISND 2DISA 2FHOB 2FJBB 4X4NA 3GSDA 1IKVA 1MW7A 2CQ1A 1LWCA 2DNYA 3GIMA 2N7YA 4R5PB 4ZMMA 5CYQB 1VBXA 1B0TA 2YX1A 1CPZA 5L8RC 5KFUA 3IS9A 4DR5F 2UV8G 1A6LA 3ZTQA 3KG1A 5JMNA 3PV8A 1Z2ZA 1RTJA 4WP9A 1S79A 2G0JA 1KOHA 4FZVA 4QYRA 2RU9A 1WC6A 2GO8A 2BV3A 3CC4S 2H65B 4ANEA 2YKNA 4JOUA 3ZO7A 3HSJA 1DRZA 3W8GA 1C4AA 3NWRA 1HA1A 3MR6A 2BDPA 2MKSA 3MEEA 5HATA 1FEEA 1WC1A 4FYVB 3VAFA 1XERA 2A3JA 2P6SA 2BE7D 4I2PA 2MQMA 1L3SA 2IY5B 3CJ0A 2PN6A 1V5IB 3I87A 1F3FA 4JI3J 1PJ6A 4USWA 3BPDA 1TKTA 5LMUF 3BQ2A 3V4MA 5DS7A 3CXCR 1S5ZA 1VIXA 4WFNQ 3L7UA 1IQZA 1UW9A 1NNDA 1X4FA 1Y00A 2AWZA 3HHLC 4YR3A 3AH6A 4E98A 4JI2F 2HQIA 1IWGA 4JI4F 3CSKA 5LSLA 3BREA 1W7WA 2C2DA 2RUSA 3J80U 1WWHA 1U1OA 4B3MJ 2WZ1A 3BQ0A 4F36A 5RUBA 4QCLA 1HQUA 1KBRA 2ASDA 4LRAA 5HO4A 2XI3A 4NLOA 1U6ZA 4U7CA 1X7VA 4BC9A 4ZK7M 1QLNA 5LM7E 2DY1A 2J0QD 2BMBA 3OFFA 4QYZJ 2GHVC 2IM0A 2R7QA 1TAQA 9RUBA 1KS2A 2M7SA 2JOQA 5J1PA 3C2PA 4FBTA 4NLQA 3MUVP 2OGUA 2J0WA 1SL2A 2RDIA 2HBYB 1WKJA 3HF5A 4Y28C 1C0TA 4K4UA 1K44A 2KDOA 1SC4B 4R8UA 4DV3F 2CJYB 4W90B 1WC4A 4HI1A 3MD3A 1VRQC 2XMAA 2J76E 2VQEF 4FDFA 1K1QA 2VICA 3M05A 2KT3A 1FNXH 1KNZA 1SB6A 1TK5A 2VIHA 1RK8A 3HJFA 3T6BA 1UL3A 1E6VA 2HKEA 2LECA 1QAIA 1SL1A 3FJ2A 1NK6A 3HM9A 4MTPA 1S1TA 2XMUA 3OLAA 4IR9A 4O0NA 5D8HB 5JJBA 2AHOB 3OT9A 1MSWD 1NU4A 2AEMA 2C2EA 1RT5B 4TNOA 4DSKA 4WK1A 1RKJA 2Z30B 1REVB 3SYZA 1DLOB 1KEKA 1RWMB 1NO8A 3JQKA 2YWEA 3CDWA 4ZPDA 5DDQC 1YVFA 2KHCA 3KK3A 4ZVGA 1EKSA 1TL7A 2AP6A 3U27A 1HBMA 3MM6B 1YDLA 1K47A 2XY6A 1XR7A 3DCAA 3R5DA 2V4QA 1NRKA 2OTJS 2MPUA 5KT6A 1UJ5A 2HHPA 1LWEB 2AV5A 2KKHA 4W4MA 3DLJA 3BGFA 1U47A 2V94A 2HAIA 2XMKA 1WOOA 4ZPAA 4YQWA 4U6PA 1XN9A 3RBZA 4O44A 3QRPA 5M2UA 3G87A 2NSCA 1GQEA 4KR0B 1CG2A 4RBTA 4KH0B 4B08A 4P73A 3TX0A 1CJUA 3C6TB 4NLTA 2CNNB 3KLFA 4JI0J 4WU2A 5AE1A 4RNOA 1J5OA 3ENVA 4RW8A 5KFPA 1ITPA 2FLLA 4DQSA 1GNKA 3C8YA 1DTQB 5J1EA 4LF5F 2ZVIA 2BX6A 3FCHA 4Q5VA 2G0IA 3MGJA 4V19J 4IOAQ 4EU0A 1EIYB 2J5AA 1HBOB 3O8WA 4Q0BB 1SI9A 3FC9A 4GVLA 1YRXA 3S6EA 2N4DA 3RJMB 1D8YA 5J2NB 1RHQB 1ZM9A 2BANA 2CDQA 4KHPJ 3I9V9 3KK2A 1Q16B 2LU1A 3ISZA 3GG1A 3DGPB 2BQ3A 2BRKA 4Z2XA 2FLOA 2OO4A 4HT5A 1T05B 1L3VA 5A2QY 2DGOA 2YNFB 2HHWA 4X4UA 4OHYA 1A9NB 2HFNA 1FD8A 3FSIA 1RBAA 3SSSA 1HQ2A 3R97A 2YNIB 5CQGA 4JV5J 5FDLA 3J81j 3MR2A 3C14A 4EBCA 3KUGA 4OYAA 2O66A 3CCSS 4PG8A 4QU7A 4RW9B 3V5RA 2X51A 5KG7A 5F3ZA 4DSEA 4FS2A 3B4DA 3H42A 5HJXA 1V3ZA 4KGMA 2J9EA 4DF4A 3F44A 3QWUA 1N34F 3B54A 2M5YA 4Q2MA 3HX9A 3UCGA 2GVDB 4KFBA 4CLLA 1NDKA 1QSSA 5IT9Y 4NMXA 4ZP9A 2OPPA 2V8VA 2HS4A 4OZJA 3NEKA 3M8PA 4DPXA 2FGOA 2F63A 2ZUGA 2DHGA 1SJFA 1JLAA 3CDEA 1F6TA 3BN4A 5AXNA 4C0OC 3ZZUA 4UZBA 2VQFJ 1Y3KA 3DRXA 3Q8UA 2V0NA 2L08A 1UFWA 1LW2B 1IKXA 5KFSA 4RW7A 4RW4B 3OR1A 4IH5A 1PKUA 4PQAA 4LFCJ 3BPSP 3GYNA 3OFHA 3I5CA 1U4BA 4ETZA 1B7YB 2OLWA 3DOLB 2J7WA 1SCJB 4NLSA 1RYSA 4X4VA 2XY5A 4TU9A 4CLTA 3QIPB 2MKKA 5GVQA 1WELA 3CW2C 3GFXA 4EBEA 3ZZPA 2BOPA 4PWDB 1IKWB 1S72S 1N48A 5HBMA 4F3MA 2G4BA 2MLXA 3EUNA 1X4CA 3H8YA 1MLAA 5CCMA 1BWVA 1OJ4A 4NWBA 3G8TA 4NCGA 3B82A 3JSMB 2CKWA 2V69A 1MROB 3TA2A 6FDRA 3U7JA 1UTAA 3OR2A 3CCVS 5EWFA 1NKEA 1MNEA 4W98A 4PXEA 3FGVA 3QIDA 1X5TA 4HDGA 3TAPA 2E29A 3DHXA 4F04B 2H5EA 3D28A 3W9HA 4WZQA 1DTTB 1YSJA 3MUMP 1RT3B 1UP1A 1IKYB 4PCQA 2HNZA 4XAKA 2G0CA 4PXBA 1HYSB 4A8MP 2PEBA 4ZVRB 4YHHF 1VOMA 2HSEB 4O3OA 3TZXA 2KM8C 5KG1A 4B9NA 1S76D 3OFEA 2BJDA 3WC0A 2WOMB 2R8JA 4EEYA 3OXLA 3UW1A 1FJGJ 1HW8A 1FWKA 4C11B 2LQBA 1RTIA 2JVRA 3K5LA 3AOCA 4I2QA 3W9IA 4ED0A 5A8WB 2J8AA 2ZBQA 3V6HA 4L75A 2VL1A 2W9CB 1RT6A 2ZZTA 4F2RA 4LF9F 2MQLA 3QO9B 2YKOA 5U47A 3THVA 1K9MT 4N56A 3EM1A 4DL5A 3UNGC 1Q7LB 1O5JA 5KG2A 1LWCB 1HWKA 4FPIA 1U26A 2QLJB 5KFGA 2WSEC 3NMAA 1F5CA 3KHRA 3CJ2A 3W3SA 4U8YA 3I0RB 2DNPA 2DH8A 1NEEA 1BGXT 3GIJA 3MTKA 4OI6A 3EVOA 1VMBA 3EGZA 4PXDA 2EFNA 3RRHA 3MMAA 5I42A 3CNQP 3UD4P 1DY3A 2XMMA 4M5NA 2RSQA 2Q6BA 2JEFA 2VKZG 3FBBA 2B7CB 1DAXA 4EK2A 2MQQA 2RRAA 2RHSB 1AZSB 2F4VJ 4TYAA 1VJQA 1HPZB 1UWBB 3OTCA 4C8LA 3D9BA 1XC9A 3NAIA 3C16A 2M8HA 5IM0B 1IM4A 4K8RA 3ISNC 1EARA 1YG0A 2GMJA 2D41A 3TVZA 3A3NB 2E1MC 4DBQA 1QVGR 1N6QA 1S1XB 2BE2A 4USVA 1AXQA 2KFYA 1Y5IB 3EZ5A 4QR1A 4XPCA 4CO0A 3EWGA 3VVTA 4DR7J 4D3HA 4RL1A 2R7TA 1HBNB 5EHHA 2AEFA 4P10A 3PM9A 4X65J 1VI7A 3MM9A 5KFHA 2ZDPA 3T5LA 1M1KT 3POTA 4NI2B 4OLPA 2XM3A 4YDDB 4P2SA 4DLGA 3QRRA 4HR2A 2LEBA 5J2PA 2CQBA 2XS5A 2HHHF 4G65A 3ZNJ1 4NCAA 4OIXA 3JB9k 4NMLA 1LW0B 4Z7YA 3VAMA 1U1KA 2YPZA 4DHVA 1ZPVA 3LPEA 2ZM6F 1CEZA 4M5DA 1B70B 1VK3A 2R2UA 4ZVFA 4TY8A 3JAMU 3W2WA 1SC3B 3RZAA 1C1CB 3FEXB 4TLQA 3HT0A 3KLIA 3BO2A 4RO0A 3J81Y 3QAUA 2Y1IA 2WVDA 2Y3YA 3IGVA 2RS2A 3RG6A 1FXDA 2Y8WA 2RB7A 2E1RA 2YNGB 2RQMA 5HLFB 3B78A 5KFJA 4RU9A 4P2XA 1FDNA 2XHWA 1BC6A 5HMXA 2VG7A 3DRSA 3TUPA 1P1TA 4O3NA 2YX4A 2CJKA 3DOKB 1K0VA 3H5YA 1QD1A 1NJWA 1IR2A 3C15B 1YGYA 2KN4A 4KT0C 2BE9B 2P8IA 3CMES 2JL9A 1S1TB 1CQMA 4QIVA 4OZ2A 4Q7AA 1RCXB 2IRUA 3G96A 4I64A 2W2NP 2QSFA 5DG7A 4DUTA 3IRXA 2HHUA 2ASYA 1AROP 1L3TA 3GILA 5JVGQ 2CZ4A 1JLCB 3NG8A 2IM3A 2JC0A 3MEGB 2HPUA 5HQMA 2Y0BB 4ZCMA 3MWBA 1NSPA 4F4ZA 3ZZOA 1SV5A 1N33F 2HZCA 1FK9B 1RA7A 2DH7A 4RNHA 4CDIA 4ZLLA 1NBEB 2FVPA 1CJKB 1TL7B 4X4QA 3HP6A 2XULA 4LF4J 4KKOA 1RHRB 1NHKL 1O51A 2L9DA 5MAOA 2DR9A 1RBLA 2J7UA 2MLYA 2XO7A 2RRBA 3D3BJ 5AJ3F 4F8RA 2PI5A 2ZZNA 4DR1F 3M9MB 1ZYQA 3QJPA 4P7TA 4BHQA 2MSSA 1R7IA 4DR2F 2PA3A 4Y2KA 2LDIA 3AB4B 4JB8B 4DV1F 8RUCA 2J6SA 4YB1P 5C25B 1UCNA 2XEXA 1HQEB 4WTOB 2XNQA 2KI2A 4DR6F 1R0AB 1FWPA 3BGRB 1H7WA 3K0JA 2AGPA 1JIHA 2PO4A 1D3WA 4ZVSB 4L3KA 4DV0F 2X1GA 4J9OA 2G13A 4FXWA 3M8WA 5CD4H 2CXEA 2QG9B 2W24A 1IBMJ 2QL5B 1MN7A 2CQ4A 3C46A 1T11A 3G9CA 1HWLA 2EKYA 1GT8A 3O2IA 4KGVB 1X4HA 2C2ZB 3LUYA 5C5JA 4IO1A 2DNLA 3R27A 4L6V3 3KFWX 1RT7A 4I69A 4A8WA 1VHFA 1VLYA 3K5MA 3QT5A 4WFBQ 1N0UA 1HNZF 1MMLA 3LAMA 1Q7YT 4BCAA 2F9JA 1OMSA 3M4XA 1K73T 4OLOA 2FD2A 2VG5B 1N33J 2CRLA 2XYPB 3OW2R 1YZ6A 3AJ1A 1U6FA 2DHAA 1DJ0A 4PPDA 3S1TA 4LFAJ 5AXMA 1ZBTA 2MJUA 4DN0A 3OJUA 3KJVB 4NLPA 5H9EK 4KB7A 2B9WA 1GH8A 2NXEA 4DR3F 1UEKA 3T5KA 3KHGA 4ZVQB 4ZCKA 4I56A 1B4SA 1HBUB 2BOAA 3A1YG 2OPQB 3TO8A 4N8NA 4UUWA 2FHKA 3MCNA 3MEDB 2NXUA 2BABA 2IPOB 3GYGA 1ROFA 1CJTA 2XNRA 4AL5A 1VISA 1HNXJ 1FJ7A 1HI1A 1U2CA 1V3SA 3UCUP 4DF8A 5CD4A 3GP9A 3PIPQ 2AU0A 3SXLA 2CVEA 2GMLA 1UETA 4GO5X 3HD1A 2Q1LA 4B9TA 1QM9A 3PYGA 1IJFB 5C2GA 2CG4A 1MWZA 2C3MA 2HBRB 2OPPB 2H4WB 2GS8A 2NXNA 1U1NA 2O1PA 1P1LA 2WVFA 5F8JA 2HBQB 2XLIA 5C24B 1TUWA 2M9KA 1WEXA 4IQMA 5ETKA 4CTAB 1AA1B 4C97A 1SIZA 2I5JA 3L7OA 1WEYA 3MMCB 1YBAA 1IBLJ 1TKXB 4NZ6A 2E9RX 3FEZA 3D0GE 2FHJD 3V6DA 4USUA 1HNZJ 5IFMA 3U1NA 2EG2A 4TLRA 4OHXA 1JLBB 1M0SA 3TA0A 1YJTA 3OXGA 3OR1B 4F0MA 4DSLA 3LA0A 2UP1A 2QLXA 2R8IA 5I3QA 3KYLA 4KHMA 3WDOA 5KFIA 2OAUA 1IBKF 2ZJQQ 3NCRA 2F4FA 5ETVA 3T1AA 2MKCA 1FKOA 1UVKA 1ZTWA 3PDNA 5F0WA 5CA5A 1RWKB 2QSWA 2CNOB 3CT9A 1RAEB 3FBFA 5B7WA 4IRDA 2HNDA 5ETRA 4USHA 3CCQS 2HHSA 2QMUB 2VFRA 5KFCA 2UUAJ 1U1RA 3N5BA 2BJ8A 4B9SA 5KFFA 5BYRA 1R8CA 2QEXS 1TUVA 3TWZA 2BKPA 2UUCF 3BEGB 3MHYA 2V5HG 1KWMA 1U8WA 1HLWA 5KFTA 4F0HA 3OR2B 3Q89A 5DM6Q 1AT1B 3RB6A 4XTTA 5LJ5Y 1OY9A 5T14A 3ILLA 3MM7A 3D0HE 4OI3A 4DQQA 4X4OA 2QA4G 3QAEA 4PWUA 4UQGA 4YB6A 4OX6A 3EDQB 4DPTA 3JTOA 2C22A 1UPPA 3H98A 1YIJS 2E5JA 4WWSA 1NKCA 3GV8B 1NK4A 1FDAA 3CJ5A 5HQ8A 1NSAA 3CJKA 1RABB 3R3TA 3M30B 5J2QA 2K3KA 4AXJA 2OD4A 3HKWA 2IHR1 2IAJA 4LR7A 4PABA 4DQIA 3NOGA 1GK8A 4DX5A 2AJQA 4HT7A 1KTVA 2OMOA 1OWXA 3W65A 2NXCA 3K2YA 4LR9A 4LRBA 4WFYA 3TR5A 4HH1A 1RT4B 3FMWA 2D3OR 3RRKA 4RUBA 3EPIA 4IG0B 4DS5A 2V63A 4OYIA 2E66A 3DRRA 3HFKA 4I2QB 4L74A 1B0VA 1Q78A 2XO6A 3M2UA 1NK5A 1FX4A 3MM8B 3FUYA 1FO1A 4O3SA 1ELOA 4CO5A 1RWWB 2BR0A 5IC4B 4MK8A 2EBGA 2AQ4A 1JLFB 2CJXB 1QUVA 5IXUA 3KG4A 3AQPA 3O6QA 2CPHA 1WG1A 3H4DA 1E6YB 4OZNA 2J7KA 2FUG9 5GADI 2FHJA 1CQNA 1SKSA 3VR1A 1M90T 5D78A 3ZTPA 1SKRA 2LCWA 2C3UA 3DRYA 4JI5J 2UUCJ 3TOQA 3H5XA 2LQJA 5F9LA 1T9TA 4OX9J 3IGNA 3BH7B 5DZ6A 2XGPA 1RSCA 2R9LA 4NLXA 2EW9A 2CQHA 1WKLA 3BSAA 1ZA2B 2DNQA 3JYTB 2DNHA 3TX8A 3KK1A 5E3CA 3GR1A 3DOMA 1D8ZA 1EJ7L 1LFWA 5EX0A 4CH0S 3SSQA 2NXJA 4ZVOB 2IJNA 1FF2A 2E5IA 4PZVA 5T41A 2GV1A 4M5IA 1GMUA 2GCFA 4EZ9A 1LQ9A 2QA2A 1M1HA 2ACMA 1MWQA 4UF4A 4E0DA 2JFKA 1X9MA 3GB0A 2HHVA 5L39A 1XNRJ 1VQSA 1N32J 3HVTA 2CWXA 4C8ZA 2OMLA 3H4BA 2KRRA 4AUKA 5LSOA 2B9XA 4FXVA 1UZHA 3D54A 1OY8A 1RTHA 2HQDA 2L9WA 3G6VA 3M2VA 3D2WA 2R3VA 4PQUB 5E41A 1DHMA 1V6HA 3VGTA 3HD2A 4FPRA 4F50A 3V6KA 2B51A 2ZH4A 1R8AA 2XSFA 2YNHA 3Q86A 5E3QA 5B0GA 2ZOMA 2HK3A 2RH3A 3BGLA 1T3NA 3T1YF 1TFYA 3CCTA 4A8FA 3UDCA 2RD5C 1NJXA 2IFXA 2VC1A 1TVRB 1X4EA 2PFFB 3O3LA 4ZVHA 2JEJA 3SCKE 4LBPA 5GAEU 2PGCA 1RT2B 4ZVPB 1Y0HA 1YWXA 1JJ4A 3VVUA 4EYIB 5HK4A 2G1HA 2R7VA 4IOCQ 1RWUA 1I94J 2ZVSA 2LXUA 2V2ZA 5J2PB 2RUGA 1NZ8A 4ELTA 4B9MA 1AW0A 2MZTA 2ALZA 2R8HA 3KLEB 4BWJA 1SH3A 3VQSA 3R7NB 5D3GB 3R6LB 4I7FA 1VQOS 4DU8A 2IMWP 3CJ4A 3DMJB 2AJ1A 1I3OB 3ETOA 5C42B 4MH8A 1ZM4A 3WIVA 4JI8J 1CLFA 4MT1A 3H20A 5T7LB 2V8PA 4I1TA 4J9UE 1O0PA 3D1QA 4ED1A 1HWUA 1R0BG 1FE0A 3D1HA 5LSRA 4LIRA 1KQKA 2VBYA 1H6KX 4CP5A 4ECXA 1U1QA 3L4BC 5G0RA 2IBKA 4DX8H 1TK8A 1K0TA 2LEPA 2AKWB 4BC7A 2CPYA 2KO1A 3NBPA 2DHXA 3WX4A 3DKDA 2RILA 4RJVA 2WB1D 1TL1A 2Z0GA 2GX8A 5AXLA 3ET6A 4NYZA 4JI7J 4DV2J 2VG7B 3BSCA 3DYAA 4ZP7A 3IA0A 3MPDA 2HQFA 2ZE2A 2FTRA 1X4BA 5IZHA 5L1KA 2FLPA 4O4GA 5KOWA 3QZ7A 4RW6B 4Z7CA 2IM1A 2LA6A 4DQPA 1WF2A 4CLUA 2XZDB 4UOCA 5HI7A 3OHAA 4A4JA 1TU0B 2GA7A 3GYXB 4LF6F 4ZOSA 3ENAA 2RF2A 3UD3P 3MFHA 4Y2IA 1DZ5A 4PG5A 5L1JA 1RHMB 3K89A 3AB2B 4B3OA 4DLEA 1S1VB 4X66F 1W25A 3MMBA 2JX2A 5K8PA 2HHXA 4F26A 1S9EA 5GAHU 4X84A 3X3UA 3ICLA 3THTA 4L76A 3IG1A 1NAQA 1RQ0A 3GPAA 4H4MB 2KJVA 5LT5A 3S8SA 2BACA 2RNEA 4FVMA 2LLZA 2KYZA 2QMWA 4F25A 1YJVA 1RAIB 4CLKA 3LP0A 3MOZA 5A76A 1NPKA 1OPIA 1D9DA 1H0HB 4LF8F 3LP1B 3VCDA 4ECSA 5F8GA 2PFDA 4IG3B 1S0NA 5DQHA 1S1WA 1YJNS 2ZHBA 4KHRA 3K58A 2RQKA 2Z2YB 2ZOFA 1GXUA 2NLWA 5LMNJ 3TI0A 3SDEA 2HFUA 1HWIA 5KT2A 1JLQB 2G1DA 2SXLA 1JLEB 1KSPA 1M5HA 3VAKA 1VCTA 3V2UC 2Y0SD 5D0EA 5ETSA 1KQFB 3DLEB 2Q43A 4B3SF 2RKIA 2KL8A 4N41A 1FFWB 2ZJRQ 3G82B 2MY8A 1LOUA 4CI0B 4YY3J 3UDLA 1SJQA 3QGPA 4LRFA 5HQLA 2KXFA 3LQVA 1OO0B 3PRBA 3UFCX 3NGRA 3NGTA 1MMNA 2ZH5A 2F1FA 2UXDF 2AJFE 1MU2B 2WTFA 3OTEA 4P6QA 4ILMA 2HGLA 2CPFA 2HNYA 3N6MA 3RGIA 1EQ0A 4ECTA 4H4OB 3FDSA 2R7XA 3UVJB 2CWKA 3GONA 1XMBA 3WC2A 3K5NA 1PILA 4GO7X 3M1VA 4DL3A 1XWLA 1S9FA 5ADZA 3MAHA 1VQKS 4NXMJ 1UFLA 2Q3PA 4MFBB 2ZD1A 4LF8J 4WYWA 1RAHB 2JLFA 1FD2A 3GZ7A 3CVKA 1HNWJ 3M8RA 1TZ0A 4JV1A 2XSJA 4IFYB 3PXGa 5A0YB 3IBCB 1SQEA 2XQCA 1VRUB 1ZM3A 3BN7A 2J9DE 1LXJA 3KDNA 4V19X 2OFHX 3AT1B 2P5VA 1N36F 1BQNA 4M5HA 1QE1A 3T5HA 1WC3A 1VIOA 2IYGA 1ZAVA 2XZTB 4GKKF 3D66A 3D6TB 3RYLA 2QLBB 2RU3A 4N76A 3T9NA 4CT8A 2B4PA 3M6UA 4DV5J 3Q8PB 2ZH3A 4FF3A 4B3RF 2AYMA 3RBDA 2OPRB 5JXSA 2YXLA 2V8GA 4OJ1A 1U2RA 2B0GA 3T41A 3I9ZA 2NZ4A 1GMVA 2ACYA 1PAUB 1VC5A 1CULA 1WG4A 3SV3A 1VQ7S 1WI6A 3CDBA 2MMYA 4XDCA 2WSFC 1RA6A 3Q8RB 2AEJA 4B02A 3S01A 1YK9A 4ZPCA 2MDAA 3P4UB 3E3XA 4N47A 2G2OA 1XMOF 2B5JB 4KQZA 1Y3JA 3E01B 1XTZA 4ES2A 3Q22A 1GTEA 3DI6A 2DEJA 2VG6B 2V2QA 4C3KA 1FKOB 3HHKA 4ZITA 2HK2A 5B08A 3NRBA 5HROB 4ZHRB 2YWGA 3LWMA 5IWAF 3A8KA 2E7VA 4DV7J 4Q45A 4ZLPA 3M6WA 3R7BB 3SZ2A 4UTGA 4JP8A 3L3CA 3BJYA 3CJTA 3OTOF 2FC9A 1XJWB 2GNKA 3FNNA 4C9DA 4ECRA 4DSJA 3HHEA 2IBOA 4NCBA 3OTBA 1U1LA 1DBDA 3AD9C 4X62J 1JNZB 3LP2A 4OZ5A 1N5YB 4OHWA 4JI1J 3CD0A 2OSQA 2HLTA 2L48A 3N79A 4J9RA 2GGPB 2FIUA 5KG0A 4DG1B 4WYLA 3FFIB 3C6UA 5HP1B 2XC9A 5KAKA 1VQYA 4LFBF 3J7Z5 2Z58B 5KT3A 1X5OA 2ALYB 2IVMA 2GQCA 1FI4A 4FYXB 2Y1JA 4NLUA 4P2MA 1OIAA 4TU8A 1GMWD 2OJ3A 1HMVA 3KLVA 2KTQA 1SUQA 4F02A 2WVBA 2MTLA 3QJLA 4WU3A 2QLWA 3DLKB 3QWPA 3W8PA 4C6AA 1JX4A 5DZ7A 3J7ZT 1BMQB 4OJ3A 3PTWA 1IVZA 4Y2MA 2WK4A 4UW2A 4JYAJ 4ZDNA 4EMDA 1HHTP 4QIGA 3FBEA 5D15A 1H7XA 3PKYA 1PO6A 1RAOA 2VPZB 1YBUA 2LU2A 4QW8A 2PT0A 2O67A 3QMQA 2ZH9A 4LF7F 4ED8A 2YX7A 4UOGA 5ETQA 3DLGA 4OI1A 5GAGU 2E1AA 5ETOA 2R7SA 1S6PA 2MKHA 5A2QU 1KN6A 1S6QB 4X64J 1RP5A 3JS9A 3PKMA 1URNA 4PG7A 4QYZK 3DRPB 4G6VB 2UUTA 4J9VA 2K1RA 1BD6A 1O8BA 2CPIA 1YJ7A 5EWEA 2VA3A 2B4VA 1HR0F 2JNJA 2HFZA 3D3CJ 2NPFA 1WORA 1IQTA 1T9YA 1Y4ZB 2EFGA 1VRTA 2DBBA 1Y11A 5I3UB 4NRUA 1Q79A 2D9PA 2E9TA 2KH9A 4NASA 2RJZA 1C0UA 4DPUA 2C2NA 3M2RA 4LFBJ 1TV6B 2RIJA 5HMWA 4DUZF 5D0HA 3GR0A 3QGHA 4PG6A 4NYOA 1SJRA 1AUDA 2AMCB 1S0MA 3GIKA 3W66A 2GQQA 3OUYA 1KR4A 2IVFB 3TAMB 4XIUA 1SQGA 5IT9U 2X3DA 3ENWA 5EUHA 2M4MA 5F8MA 3OTDA 4IOBA 2HQCA 2E5LJ 1CC7A 4ER8A 3EGWB 1TL3A 3EGNA 3QFWA 1CJVA 2HQGA 1BLUA 1ZOTA 1NJYA 2EK1A 1UZDA 2DPIA 3MM5A 1RTHB 3MMJA 2G9OA 2MZ1A 3M2VB 1NHVA 2VOPA 2W01A 4M5LA 3PJ9A 3HZGA 3SFGA 1DQ8A 2Q79A 2DTJA 4ZPWR 1Y10A 3M32B 1KDNA 2LXIA 2N3LA 1B0PA 4MIWA 1ZZNA 4ENOA 3DHWC 2R8GA 3GSIA 3RW6A 1RWNB 2B6AB 3W61A 3V4IA 4KGZB 4M8LA 1RTDA 2JFDA 1RGVA 4I0WA 2JLGA 4IUFA 4CLSA 3K57A 3A4TA 2VFUA 2HMIA 3EDRB 1QDUB 2F5GA 3RAXA 5DDOC 5E2QA 4WFXA 2GVZA 2YWFA 3OSPA 5GMDA 2QC3A 2UU9J 4FNHA 1B3TA 4I68A 2X7IA 4JV2A 2BQRA 3I4PA 3EXCX 1N5QA 2KRBA 5B0EA 2HRYA 1S9GA 3PW4A 4YS2A 3ITHB 2I6WA 3PRVA 4NXNJ 3D6HB 2DHHA 2I1RA 1WHVA 4RZRA 1F0XA 4FYWB 2QGFB 4ILRA 3T19A 2CJQA 2GQ2A 3SQGA 2VZ9A 3NMRA 2FHMA 3IR5B 3N01A 5DRKA 3TUZC 1N5TA 4P75A 2NUUG 3IAS9 2CPJA 3GLJA 2DH9A 3CJ3A 3NNAA 3GQCA 1J5EF 3QLHA 4A8XA 1U24A 4PEOA 3FSXA 1TR0A 1U0HB 3CCWA 1KLMB 4AFFA 1FHTA 3DYAB 4GKJJ 4WP8A 1RKIA 3N28A 4DL4A 4WF9Q 3C66A 4P7VA 4LMZA 2KJWA 4X4RA 4IR1A 3GCWP 1T03B 2FZGB 5AE2A 2J6TA 1CS4B 3N6NA 4NZ7A 2DRDA 4AE5A 2WCXA 1JLGA 4IDKB 1QVFR 5J2MB 4G1QB 1VBYA 2XWYA 5DQIA 3SIPB 3HT3A 4LSLA 3TJAA 1FCAA 3QGGA 4B9UA 3GJQB 2HWTA 3GJTB 3MPUB 1RLDA 4DMZA 2AF6A 4X4PA 2MGZB 4J7CA 2WONB 2VHGA 5KFBA 3G6XA 1PYSB 4CYUA 1BY9A 5L9XA 5KFDA 1F9HA 1QAYA 5GMKa 1HI8A 3QNWB 3CJ8A 3DN9A 4LQ3A 1NPRA 3PW5A 3MR3A 4OX8A 4JBCA 2GHPA 3V6JA 1C1BA 4ECVA 5KOXA 4DR5J 4KH1B 3CUNA 2LEAA 5B0CA 3PZPA 2F7VA 4TKTA 2W2PP 2Q66A 1F9FA 4EGLA 3LW5C 3CO9A 3CPWR 2W9BA 1KTQA 4NPOA 4QU6A 2LQ9A 3W2VB 2IDEA 3U1LA 3QT6A 3HZEA 4G1IA 1NB7A 3M8QB 3BKTA 2ABYA 2H1YA 1QAXA 3RAQA 4HACB 2A10A 2CQ0A 4RNMA 1RISA 2HRTA 4J90A 3Q8YA 5KFXA 2R2SA 5BR8F 1FRIA 2AYBA 4CLZA 4ANDA 1RT1B 2D7SA 2VFSA 2PE8A 4R5PA 4ED7A 2DEIA 4KBIA 5CYQA 3TAQA 3HHLD 3OSNA 1M5PC 2H9ZA 2XMJA 3CTRA 1HHQA 1T7PA 3HHLB 3DXBA 4DV6F 5LMUJ 2KHDA 1ZETA 3R5JB 3F41A 4GVBB 1HNVB 4CCHA 3JSYA 4HVZA 3HULA 3DM2B 3H25A 1I51B 1WI8A 2PSZA 4JI2J 4JI4J 3CB4A 2MZSA 5A8KB 2MHNA 4RPFA 2PMZD 4WFAQ 3OPKA 2PMHA 1FWLA 2IVYA 3W60A 1RXOB 4CH1A 4CO4A 1TKDA 2XLKA 2EK6A 3M7VA 3SQOP 2I2YA 1UW4A 1P8GA 2PA8D 2HWHA 4P9SA 5A8RB 2R8KA 2WBMA 3ZZRA 1JXVA 1R3NA 4ZPVR 2B8PA 1EETB 4K4XA 2N82B 2JEIA 1SC6A 2APOA 4J9PA 5HVHA 2ZKTA 1C2PA 4QOTA 4K0KF 2AX0A 2GIRA 4LSNB 2FJWA 2WRMA 2XHCA 2JVOA 2WW8A 4LBHA 2C1EB 4OX7A 4EFAC 1D9FA 2NQPA 3UR3C 1U02A 1NSKL 3ILIA 3T1HF 3UCZP 1BQNB 5GADU 1R8PA 4ED2A 2IMOA 2EG1A 3P8BB 3J81U 3PX0A 4DV3J 5EX3A 2RS8A 4F0KA 2VQEJ 1WDDA 2WVEA 4MYTA 1KVIA 2IC3A 1LWFB 4NLRA 5HVFA 4HEA9 2XYGB 3ZC4A 2VKRA 3PEHA 5CYMB 4ETXA 2UXBF 2EXUA 4CO3A 2XS7A 2W9AA 4KRWA 3PACA 4AQYF 3HHNB 4TU7A 2W4PA 3KLHB 4YUDA 4DPOA 4DR4F 1FEHA 3R8YA 1VQLS 3RB0A 5CHCB 8AT1B 3QYYA 2EFQA 2YQ3A 3UDEA 4Y2CA 4DFKA 1M1GA 1GXLA 3BBFA 1XR5A 4HLBA 1JKHB 4R0EA 1VBZA 1NK7A 1MN9A 3DI6B 4LSZB 1SQFA 1S12A 2QFJA 1G3OA 3BBBA 4W92B 3LF0A 2A6OA 2UUWA 3BDPA 2ADCA 3QSIA 2V9WA 3UD5A 3SCIE 2AJ0A 2L41A 2CPDA 2QE5A 2Y1RI 3DLLQ 3W64A 3BKFA 1RT5A 1T0TV 1UVMA 3LALA 2AIRB 4FYDA 1RAAB 2OUGA 1REVA 2K7JA 5D4OA 3ONQA 1DLOA 2B56A 4MIBA 2W8LA 4ELVA 3BYRA 4CQ1A 4C0HA 3LH2S 3JTNA 3NP5A 4ZVUB 2MQNA 2CQ2A 2MJNA 2V50A 2E9ZA 3KWMA 2MYFA 1W2BR 2QTWA 2UXBJ 4URSA 3GFZA 4U8VA 1VQ8S 1O6XA 4KV8B 3MM6A 1FXRA 3AD8C 4ICLB 3MCSA 4F4AA 2MXYA 3AY0A 3G4SS 1UFKA 4LF5J 1UVIA 4QWBA 1LWEA 2XG8A 1RWOB 4Q8FA 2ZOGA 4ID5A 1ZS6A 5DO2A 3VWSA 4HI2A 2FJAB 1XMQF 2OPSB 4PUOB 2DGVA 4LREA 2CQDA 3C3LA 4J91A 4DS4A 4HYKA 5KFWA 4M63A 1WUUA 3CDAA 3EYZA 3J7AN 1HL6A 5LJ3Y 4ZLJA 1KP6A 3GG0A 2LMIA 1NJIT 1ICEB 3NCPA 3FQKA 2ZBCA 2H5JB 4C8YA 3L95X 2VBZA 3G8SA 1P27B 3HXMA 1GX5A 1S1UB 1S77D 1WACA 3C6TA 3DLGB 2UUBF 4QZVB 4YMEA 4WIQA 1DTQA 1MG7A 3Q0AA 5K14B 4QPTA 2WVCA 1N4LA 4KC5A 3D67A 1HBOA 2VPYB 3KMSA 1H73A 2A6MA 5B0DA 5BJRA 4UY85 4Q0BA 4YEAA 4KPCA 1VRTB 2J8SA 1XNQF 3HHDA 2O3DA 3L9ZA 2XCPA 2DR7A 1C0UB 5D4LA 5J2NA 3FK4A 4LRCA 3FCWA 1SJ4P 1LK7A 2M0GB 3ENQA 5CABA 4MIAA 3EXYA 3THPA 3DGPA 3TVYA 3EICA 1N34J 3DLBA 3RR8A 2DJWA 4A8YA 1FNOA 4USMA 2DPJA 3D68A 1T05A 4ZJOA 5D4PA 2YNFA 4P52A 2G2YA 2FGCA 1SJ1A 3I55S 3EMTA 1L3KA 2P9CA 1NPPA 2W7PA 2YNIA 1AB8A 2HQ3A 1FX2A 4M5MA 3KHLA 1FT8A 3R5BA 4MAKA 3JQJA 1WG5A 3FKBA 3IM9A 1SH2A 1QSYA 4FKYA 4OYBA 3PNIA 3BB5A 3I0SB 3KJQB 1GXTA 4DUYF 2E7WA 2YKAA 1RWPB 4QWEA 3B8HA 3OFGA 3MAQA 2GVDA 4H4KA 1NSQA 2OEJA 3B6BA 2KXNB 2VDHA 1RCOB 2FVRA 5FIIA 1TKZB 3T5JA 3RB3A 3PHEA 1URRA 3HSZA 3EZOA 2RQCA 4B3TF 2XCAA 4GMKA 3TANA 2V2VA 3IR7B 1G2EA 1JNRB 4C8MA 1NCLA 1S99A 2UV8A 2YKPA 1OYDA 4WE1B 2QN6B 1LW2A 1BQMA 1K1SA 3M6VA 2HGNA 1YHQS 4DN9A 4DPYA 5F8NA 1R8HA 1WSRA 2I0XA 1IKVB 4RW4A 3NS6A 2BVZA 2BYCA 1S9GB 3E2EA 2YPYA 3SEOA 5FLXY 3OBIA 4DOZA 2AJ4A 2DGTA 3CJRA 2VBWA 3J7YI 3DOLA 3IS9B 4U67Q 3SQGB 2B43A 2ZUAA 4NLWA 1Y5NB 3Q8QB 3HVRA 3QIPA 1Q95G 5DG9A 2UXCF 3MURP 1RTJB 3LOUA 5AE3A 4PWDA 1IKWA 3M9OB 1P9YA 3O44A 2KM8B 4ITSA 1YJUA 4KGKA 5ETMA 4PAAA 1F60B 5KG3A 2YKNB 4Y34A 3VGVA 3CD7A 3I96A 4YHHJ 4ERDA 3JSMA 2MQPA 1FRMA 3CCJS 4USTA 1JWWA 3MEEB 4OZ0A 1MROA 4FS1A 4OI4A 1VLOA 5BYSA 1C4CA 4I2PB 1JLGB 2VU5A 2DR8A 2LFVA 3QSYB 1RDRA 5E5NA 1TKTB 1Q82T 1YLXA 4KE5A 5A6WA 3VHQA 2C2OB 1DTTA 4URQU 1EAYC 4LR8A 4IO9Q 4LF9J 1BXNA 2HW3A 4U7UK 3I31A 2AYGA 1HYSA 2VPWB 4XDDA 3D1OA 2EVZA 4LIWA 5E3PA 1Q4RA 2DIVA 3DDKA 3JSBA 4WKRA 2POKA 4TVAB 1ZH5A 3G6ES 1Y9OA 5F9NA 2D9OA 1DQ9A 1HW9A 5MLCV 1HQUB 2MKIA 2BZ2A 5H9FJ 2CZ9A 2WOMA 4TQRA 5DQGA 2DNMA 4ZVTB 4N7TA 3TQEA 3K17A 4CIOA 1TP7A 4C11A 1U8SA 5E3AA 2DR6A 4BS2A 3OJSA 1Q53A 2XB2D 2DXFA 3ULHA 1PCAA 3H7HB 2M8DB 4JI3F 2YWWA 4Q8EA 4RWWA 1LKZA 4ATNA 2N3OA 2VB6A 1H2VZ 3KG0A 1ZM2A 2W9BB 2W9CA 5DGBA 3O5TB 1WF1A 4DZ6A 4TYBA 4CO2A 1WTBA 2DGSA 3UN3A 4IQXA 3E51A 2ATLA 5KG4A 1A7GE 3KJNB 3QO9A 2JH3A 2ERRA 3X1LB 4OMFG 1VDHA 3BF4A 1C0TB 3VV2B 3PW7A 3M8ZA 3HFZB 4R8UB 4PRFA 2CPEA 4K2JA 3MOJB 2FZCB 4A46A 3MZIA 4B3MF 5D0RA 1R8BA 1AFIA 4DQRA 4KPYA 3NGKA 2X1AA 3JSRA 3NGSA 3PW0A 4WPAA 1SJ3P 2JWNA 2NYIA 1G6BA 2YQ1A 3I0RA 4PG4A 1TAUA 1Q0NA 3CJQA 3KLGA 4RNFA 5IT0A 4B17A 2H51B 1LV5A 1E6VB 1JQGA 4J9KA 4H54A 4L3NA 1U09A 2VH7A 3JQMA 3TZYA 3T9ZA 5EGYA 2DO0A 2BW7A 1T95A 5ETTA 3DNCA 3K59A 2CZVC 1SC1B 1OPZA 3G2XA 4ES1A 4O3RA 3TRGA 1AZSA 1S7HA 3LANA 3LGHA 1U2FA 4N8OA 3UWTA 3NKYA 1IXKA 2UZAA 1HPZA 1UWBA 3JTPA 4MK7A 4HH0A 4NA1A 2FDNA 3N4WA 2ROEA 5IM0A 3KK3B 1VQ9S 1EKRA 2AJ2A 4J37A 3VGSA 2HHHJ 2OELA 1HBMB 3BZQA 2UVWA 2VOOA 3N5FA 1RI7A 3OQ2A 3UQSA 3VTIA 2A2DA 3I32A 1TMJA 2E5HA 2JHEA 2NS1B 3HFVA 4CM0A 2ZM6J 2DNZA 1S1XA 2HGMA 3QT8A 3AHPA 2XY7A 4F4WA 3TP2A 2ZKUA 2V8DA 5CYJA 4YR0A 4YR2A 3NXZA 4MK9A 2BM1A 2C3PA 2FJXA 1HBNA 5KT7A 1WKKA 1FKPA 2U2FA 4O44B 3RBEA 3CCZA 3AAWB 3NGDA 4K4SA 3ZZZA 4CRJA 2IC3B 3N6LA 5DM7Q 4TN2A 4NI2A 4YDXA 3MUTP 3PX4A 3RAMA 1CJUB 3B4MA 3KLFB 1NKBA 1VYAA 1J5OB 2J9DA 4RW8B 1LW0A 1KVKA 2W2QP 2OD6A 1HNIA 4A8QA 5J1EB 4NLYA
chains in the Genus database with same CATH topology
2F4FA 2XO6A 2A6OA 2A6MA 2FYXA 2VJVA 4ER8A 2EC2A 2XMAA 2XM3A 2VJUA 2XQCA 2VHGA 2F5GA 2VICA 2VIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4F A;  2XO6 A;  2A6O A;  2A6M A;  2FYX A;  2VJV A;  4ER8 A;  2EC2 A;  2XMA A;  2XM3 A;  2VJU A;  2XQC A;  2VHG A;  2F5G A;  2VIC A;  2VIH A; 
#chains in the Genus database with same CATH topology
 2K3I A;  1NH8 A;  2A18 A;  3LTO A;  3RW7 A;  3M9N B;  1C1C A;  3CD6 S;  4WXO A;  4FN5 A;  1BHN A;  2BJ7 A;  3KMQ A;  2HYI B;  3DFE A;  2HVZ A;  3TUI C;  1T9V A;  5EN1 A;  1RAG B;  5I3P A;  4EYH B;  3BBC A;  4PYD A;  3KNA A;  4DFP A;  2VJV A;  4U96 A;  4J9N A;  4Y00 A;  2YNG A;  4NZ0 A;  5KG5 A;  2X1B A;  1KHV A;  2I9S A;  1FRJ A;  2RML A;  1KFD A;  5HLF A;  2BW2 A;  2RE1 A;  1UAW A;  1VQ5 S;  2BAN B;  1TMM A;  4WXW A;  3KK2 B;  2UVR A;  2WB4 A;  1TK0 A;  4J5O A;  3W9J A;  3MI7 X;  4EWT A;  4JI0 F;  3DOK A;  1EP4 A;  2VFT A;  3C15 A;  9ATC B;  2IA6 A;  3KUH A;  5AJ3 J;  3AXK A;  2DK2 A;  1F9E B;  4DR1 J;  3OL9 A;  1PBA A;  1WOP A;  2A0F B;  3UI3 A;  4DR2 J;  1AUS L;  4FVC A;  2GJF A;  5FDL B;  1GFW B;  3US5 A;  3MEC A;  3C14 B;  4DV1 J;  1UA1 A;  2Z2M A;  2DHS A;  1YIT S;  2ZH1 A;  2BXJ A;  5K8O A;  1RHU B;  2DKO B;  1JLC A;  2Z56 B;  3CD5 A;  1N0V C;  4X4T A;  4QBU A;  5LXY A;  1RB0 A;  3MEG A;  2HZV A;  4DR6 J;  2FJE B;  3HSG A;  4Y0F A;  2R4F A;  3A3P B;  3OD2 A;  4OJH A;  1FK9 A;  3MPY A;  4DV0 J;  4KHP F;  3G86 A;  4QIE A;  3CCU S;  1CJK A;  3W7B A;  4WKY A;  2NSB A;  2P9G A;  1YRT A;  2H5I B;  4KFB B;  2Y1L B;  3OL7 A;  4ECY A;  2PMW A;  4FKX A;  4GC6 A;  3GJS B;  3M8P B;  4ID5 B;  4Y65 A;  2BJ3 A;  4A48 A;  2MLZ A;  3MR7 A;  1M5K C;  4JV5 F;  4WZM A;  1JLA B;  1L3U A;  3A12 A;  5CXT A;  1UEV A;  5C25 A;  1I5O B;  1HQE A;  2NUH A;  4DWI A;  1IKX B;  2FVC A;  1R0A A;  3BGR A;  3N9U C;  4RW7 B;  3H40 A;  4MKA A;  2AZ1 A;  4CLP A;  3M8Y A;  2QV6 A;  1Y7P A;  1U45 A;  1HWJ A;  1RWV B;  4PPZ A;  3AQO A;  4YB5 A;  2DGX A;  4DSF A;  2ZDO A;  2DIT A;  2W4C A;  4JUZ A;  4K4W A;  3MPW A;  4DPW A;  3EZU A;  2HIQ A;  4DR3 J;  3WIU A;  1BWE A;  3KHH A;  4ECW A;  3AD7 C;  1NLK L;  5IV4 A;  4H4K C;  3CF5 Q;  5HBM B;  2DRA A;  5GAE I;  1TL5 A;  4M95 A;  2VQF F;  3H59 A;  3HJV A;  4HHH A;  1N54 B;  3FBC A;  4WJB A;  1WHW A;  4NCG B;  3A8J A;  1X60 A;  2HIY A;  2VG5 A;  1JJ2 R;  2ZBI A;  2GW8 A;  1N88 A;  2B9E A;  4LFC F;  2CJA A;  1V9O A;  1Q5V A;  3HCX A;  2MST A;  2BKN A;  5K5M A;  3DC2 A;  1RU2 A;  1YBT A;  3KJV A;  6FD1 A;  2R7O A;  3UNY A;  4OFZ A;  2GHW A;  2ILZ A;  3TUJ C;  2K2P A;  4NL5 A;  3IWL A;  2IJR A;  2GIQ A;  2PII A;  1R31 A;  1HBU A;  2OPQ A;  1FRX A;  1J27 A;  5KFV A;  2MQO A;  3MED A;  1Y5L B;  1FJC A;  2HNZ B;  2QZ8 A;  1DQA A;  1KLN A;  2ZBP A;  2WHO A;  4GC7 A;  2ROP A;  2DNG A;  1MWY A;  4WBF A;  1KVJ A;  2O01 C;  2VBX A;  1PJ7 A;  4KTQ A;  5HN0 A;  1H2U X;  4LQ9 A;  3OXF A;  1EQM A;  3AJD A;  1RTI B;  3WHI A;  5F3T A;  4PKD B;  1IBK J;  2J0S D;  2LA4 A;  4LJM A;  1X5P A;  2K7K A;  2D3Z A;  2QJ3 A;  4DCP B;  5DJB A;  5F8H A;  4TY9 A;  5C24 A;  2CAD A;  2F40 A;  4CTA A;  2OEK A;  1ACM B;  1RT6 B;  2C3O A;  2QYC A;  3MMC A;  2VJU A;  1G4C A;  1TKX A;  1UVJ A;  2H48 B;  5GAH I;  2YH0 A;  1ZZF A;  1JXE A;  1QTN B;  2CJ9 A;  1BQM B;  5KFR A;  4ZIV A;  1ZPW X;  3LPY A;  3NS5 A;  1VS3 A;  2ZH7 A;  1JLB A;  1RBO B;  2JZ5 A;  1RWX B;  2VFV A;  2ZC4 A;  4BLG A;  3UE2 A;  1V3R A;  2VV5 A;  1IJE B;  1SPB P;  1FJG F;  1IR0 A;  1KOO A;  2IM2 A;  4NLV A;  3SV4 A;  3V81 A;  4EO6 A;  1RAD B;  2CQP A;  1NDC A;  1N5S A;  2HFO A;  2OP5 A;  4RUA A;  2ZNZ A;  3MMA B;  3HMJ G;  3IBW A;  5I42 B;  3NGU A;  4DXL A;  3QJJ A;  3GFH A;  3PR5 B;  3TQ1 A;  1SH0 A;  2ZWP A;  1NK9 A;  3LO3 A;  3FRY A;  3NNC A;  3PHT A;  1KRP A;  5L9N A;  1FVS A;  4KGX B;  2KFN A;  2CQC A;  2V4R A;  2X1F A;  3P49 B;  1NME B;  2DXE A;  1WC5 A;  3IFE A;  4R25 A;  1IM6 A;  2W1B A;  1S4E A;  1VC6 A;  4ECQ A;  3C16 B;  4J9L A;  1U48 A;  2OI2 A;  3BO4 A;  2PI4 A;  4K4V A;  4P74 A;  4PYA A;  2CNK B;  4KIA A;  3WX8 A;  4F7V A;  4G3I A;  1N6Q B;  2ZH8 A;  4NA3 A;  1REG X;  3EGV A;  4NEZ A;  2BE2 B;  3VZI A;  5SUH A;  2DNN A;  1FA0 A;  4OZ3 A;  4CLW A;  3H2U B;  2KVQ E;  2CVI A;  5FJ4 A;  3M30 A;  2V6A A;  3W5X A;  4NYP A;  4K5R A;  5DG8 A;  2F4V F;  2LYV A;  2C2K B;  2CFX A;  3S7R A;  4GRS A;  1UWA A;  5HMY A;  2FZK B;  2XI2 A;  3MM9 B;  3W5Z A;  2QA4 S;  3BM7 A;  4ED6 A;  3POT B;  1RT4 A;  3CIZ A;  1F5A A;  4IG0 A;  2ZNY A;  1CBK A;  1T9U A;  5K8N A;  2MHE A;  4C48 A;  3ZNU A;  2D69 A;  4XK8 C;  3MM8 A;  3PW2 A;  1XEZ A;  2FC8 A;  4Q2L A;  1RYR A;  4ILL A;  4Y3C A;  4I6Y A;  3EPG A;  1VQ6 S;  1KHW A;  1T3O A;  3PJX A;  3H5U A;  4M5D B;  1JLF A;  3WZ0 A;  2PDA A;  4TY8 B;  3RU0 A;  2YWK A;  4HTI A;  4HHJ A;  3W2W B;  4S0M A;  5CZV A;  2GJI A;  4KSE B;  4QQB A;  1E6Y A;  4DR7 F;  3KLI B;  2V4J A;  1S4F A;  3VZH A;  2HLU A;  1F5B A;  3J80 Y;  2DCU B;  1FJE B;  3IMQ J;  7FD1 A;  4X65 F;  3BR8 A;  2CA9 A;  1X5S A;  2LVW A;  3NOC A;  1H2T Z;  2E7X A;  3DRS B;  4DX6 A;  3KLG B;  3JYT A;  2U1A A;  4NX9 A;  2IDL A;  1IR1 A;  3PYD A;  1PAE X;  1K8A T;  2MQ8 A;  3PRD A;  3VF0 B;  2YWH A;  3LGM A;  1V5V A;  1UVL A;  2YQ0 A;  5IV3 A;  4OL8 A;  1PYO B;  3ZTO A;  1QY7 A;  1J2V A;  3SCJ E;  3CC2 S;  2AGO A;  1QAJ A;  4OJG A;  5C2C A;  3IRX B;  3G8Q A;  1NK8 A;  3R2C J;  3T1Y J;  2QMX A;  4QJV A;  4QR0 A;  1SVD A;  1OQ6 A;  2A1B A;  4ZPT R;  2EC0 A;  4RWX A;  4DL6 A;  1P9Q C;  2B8Q A;  1XIQ A;  3I56 S;  3CMA S;  4ALZ A;  4IRC A;  1NDL A;  1VBK A;  3IP0 A;  1SV5 B;  1YQH A;  1DFD A;  1S7I A;  4OQJ A;  4F4Y A;  1U1P A;  1U25 A;  3QRQ A;  4KKO B;  5EWG A;  3PO5 A;  3QBC A;  4PQU A;  4OZL A;  1Q8B A;  2IYI A;  4M5J A;  3W63 A;  2BJ1 A;  1EHW A;  1PYT A;  2HS0 A;  2F9D A;  2WBR A;  1D0E A;  4E8U A;  2V34 A;  1EX8 A;  3VAH A;  4I6W A;  3ETM A;  4A8S A;  1Z1Z A;  3VAI A;  4MKY A;  1KC8 T;  1ZA1 B;  3UDV A;  3HSD A;  3RBX A;  1FKP B;  2FB0 A;  1TVR A;  4D3G A;  1S97 A;  2KZM A;  1RT2 A;  2BUN A;  1CVJ A;  1EB0 A;  2OHD A;  4JI6 F;  4NOH A;  3H0P A;  5KT4 A;  3K8V A;  2LDY A;  1Q8L A;  2DB1 A;  2E5G A;  3VGU A;  3KLE A;  4LF4 F;  5D3G A;  2CG8 A;  2Z57 B;  2BBE A;  2BM0 A;  4P2F A;  5KFO A;  1S6U A;  1HNI B;  1NDP A;  1OSC A;  3DMJ A;  4FP9 A;  5C42 A;  4P72 A;  3F73 A;  1VQ4 S;  3RRG A;  2E1C A;  4LF6 J;  5T7L A;  2ADB A;  1RAC B;  5HJY A;  1FRL A;  5LL6 d;  2CJB A;  2JRS A;  1BQX A;  1RT7 B;  2IRX A;  3BSO A;  4IYQ A;  4C8K A;  2UVU A;  2V8H A;  1W2I A;  3OL6 A;  1VK8 A;  4K4T A;  2VC0 A;  3OL8 A;  3BGO P;  3P96 A;  3ZTS A;  1HIY A;  4X66 J;  4G1P A;  1FTR A;  5K9F A;  2CNL B;  2OIH A;  3AOB A;  2H3E B;  3IM8 A;  1GAO A;  3PR4 A;  2GAG C;  4YOE A;  5IOL A;  3T3F A;  1EP4 B;  3CUL A;  2FLN A;  5GAG I;  1IBM F;  4RW6 A;  4QPX A;  2MEW A;  3NNH A;  2EWH A;  3W62 A;  3DGV A;  2I38 A;  2C2M B;  2HUR A;  3MEC B;  2EC2 A;  1S6O A;  2B9Y A;  3GU0 A;  1XK8 A;  2V9K A;  1CJT B;  5GME A;  2AGQ A;  2RHQ B;  4UOH A;  1VQM S;  4ELU A;  1Q86 T;  3GFY A;  1S1V A;  4M5G A;  4JI6 J;  5B0B A;  4J9S A;  4HL9 A;  4OYO A;  4A8O A;  4NE9 C;  3Q23 A;  2FY1 A;  1VHI A;  5HMZ A;  1PJ5 A;  1Q1K A;  3FQL A;  1G1X A;  4QWA A;  3KOA A;  3EVW A;  4H4M A;  4FXD A;  4LFA F;  4L73 A;  4OV1 A;  3EVM A;  4KY3 A;  2QA1 A;  3J7Y U;  1XQI A;  4O3P A;  4B3S J;  4JV0 A;  3TZW A;  2XTJ P;  2DCL A;  4J9Q A;  4F3O A;  2R2R A;  4F67 A;  2CAJ A;  3F56 A;  2I5J B;  1JB0 C;  1DUR A;  3LP1 A;  4IRK A;  3H2L A;  4IG3 A;  3OHB A;  4ZP6 A;  4C2M A;  2G2Z A;  3I6P A;  3V6D B;  2UXD J;  4RR5 A;  1HNX F;  4IH7 A;  5DGA A;  1RAF B;  4K50 A;  2DGQ A;  4BDP A;  5KFY A;  1N52 B;  2KT5 A;  5D77 A;  2OKQ A;  2R7W A;  3NCQ A;  1H72 C;  3QFH A;  3C19 A;  2KFZ A;  4ZP8 A;  3CO0 P;  1JLQ A;  2B3T B;  2L3M A;  3W1Y C;  2AYE A;  3KKF A;  1JLE A;  5ETL A;  5K20 B;  1YJW S;  5LOQ A;  4RUC A;  3DXS X;  3M8S A;  2FY8 A;  5IS2 A;  5KFZ A;  4ES3 A;  1X4G A;  1R6V A;  4NA2 A;  3DLE A;  4AL6 A;  2W2M P;  3D7S B;  3ILJ A;  1B99 A;  3OVB A;  2DO4 A;  3TNV A;  3G82 A;  1WC0 A;  2RT3 A;  3K7R A;  1BE4 A;  3SCL E;  2HND B;  1IBL F;  1WHY A;  4Q44 A;  3J7A 1;  1MU2 A;  1RHK B;  2B4U A;  3CCR S;  3HKZ D;  4TQS A;  1LEO A;  2XS2 A;  1QUP A;  5KFA A;  4H4O A;  1N36 J;  1XR6 A;  5M2R A;  2YY3 A;  2HVH A;  1S49 A;  3UVJ A;  2QLF B;  3EX7 B;  2DGU A;  2JJ4 D;  2DT9 A;  3H90 A;  4MKB A;  2FYX A;  4A47 A;  2OSR A;  4GKK J;  4Y2A A;  4A8K A;  2AW0 A;  3MM7 B;  3OVA A;  1X31 C;  5M2P A;  5F0U A;  4K2X A;  3MFI A;  2VOD A;  3D6F B;  4DEZ A;  1D1U A;  4B3R J;  4MFB A;  3DLH A;  2JLE A;  4QWC A;  1FKA F;  3ZXW A;  3CJK B;  2C28 A;  3GIR A;  3QZ8 A;  5J2Q B;  5L1I A;  4IFY A;  3R1L A;  3BS9 A;  5A0Y A;  2IAJ B;  3U02 A;  2IRY A;  3EJM A;  5L46 A;  4Q43 A;  1DAR A;  1VRU A;  4DFM A;  3GWC A;  3A8I A;  3IWX A;  2UUA F;  1FNM A;  4DV4 F;  5ETP A;  5HVG A;  1NH7 A;  1TL4 A;  2ZWO A;  1R27 B;  4ZKA A;  4ANC A;  2HG4 A;  2ZHA A;  2COL A;  4N5S A;  1XMO J;  4U9R A;  3KNG A;  3TJ9 A;  3DRR B;  1PBU A;  2F65 A;  3M2U B;  4WP3 A;  4FYY B;  5IWA J;  2KVI A;  2OPR A;  1M5S A;  2WW4 A;  3AJ2 A;  1VQP S;  3P5T L;  3P6Y C;  1YJR A;  3PY8 A;  2M88 A;  3MXH P;  1ZAW A;  3OTO J;  5A6P A;  3DU6 A;  4OYX A;  2GZO A;  3MAA A;  5B0A A;  2QL9 B;  1WEZ A;  1T94 A;  3H5S A;  2ZBR A;  4QWD A;  3IO1 A;  5IQQ A;  2W8K A;  1VJW A;  1TEL A;  1HD0 A;  4URG A;  4MKV A;  4K4Z A;  1WTF A;  1UPM B;  1F1B B;  1T02 A;  4E2F B;  1SKW A;  1KQS R;  3SFU A;  2EEY A;  4CNZ A;  5CCL A;  1X8D A;  1PSD A;  3CCM S;  2R7U A;  4DL2 A;  2NCK L;  5JVH Q;  2B5J A;  4UZC A;  3E01 A;  3BSN A;  5LXR A;  5KFE A;  2KG1 A;  1X0F A;  3PFE A;  4V1A k;  4DL0 C;  2NYH A;  2VG6 A;  4RKU C;  3KK1 B;  1QSL A;  3FVY A;  3TJ8 A;  3QQC D;  3V81 B;  5HRO A;  4ZHR A;  3DOM B;  4DFJ A;  1RJJ A;  2H4Y B;  5KFL A;  4RLE A;  4CO1 A;  2M70 A;  4FF1 A;  1YI2 S;  4K4Y A;  3BKU A;  3D6M B;  2Z8Q A;  3GTY X;  3IR6 B;  2OH2 A;  3R5C A;  3DDN A;  3HVA A;  4DV4 J;  1F2H A;  4KJI A;  3AOA A;  3ZZY A;  1N5Y A;  1R6Y A;  4ZS6 A;  4ZVE A;  4JI5 F;  1X0P A;  3BR9 A;  3GJR B;  2GMH A;  3HVT B;  4OX9 F;  2GGP A;  2F8E X;  1KFS A;  4ED5 A;  2CPX A;  4OYW A;  4DG1 A;  1FES A;  3UN2 A;  3FFI A;  3VAG A;  5HP1 A;  3MCM A;  4DSI A;  1N5V A;  1F2G A;  3P45 B;  1WHX A;  4ZCI A;  3FRZ A;  1BUX A;  4M94 A;  4LF7 J;  7FDR A;  1SIW B;  2NPI A;  2VDI A;  1LNQ A;  3R7S B;  2YNH B;  2XWX A;  2V2K A;  2ZH6 A;  3D0I E;  2GJ2 A;  1JJH A;  2H54 B;  5JUM A;  1R43 A;  1KKH A;  4ZN3 A;  3NY0 A;  1GMW A;  3SMZ A;  4IFV A;  1YRU A;  1I6J A;  3DLK A;  4M5K A;  1HR0 J;  2QRR A;  2EPI A;  1X4D A;  4LVO P;  1XNR F;  1N32 F;  2M2B A;  5DDP C;  2HHT A;  1CC8 A;  2JDJ A;  1X9S A;  3DU5 A;  2HHQ A;  5C7P A;  1WSV A;  4DDF A;  4EUV A;  4AL7 A;  5L38 A;  3EE3 A;  4OI2 A;  1Q8K A;  2HEK A;  4I7F B;  1YX2 A;  4B9V A;  4DUZ J;  2OTL S;  3FMB A;  1FVQ A;  2QO3 A;  2XYH B;  2QX0 A;  2ZC3 A;  2AZ3 A;  2JC1 A;  1GTH A;  3FZ2 A;  2W4D A;  4RBU A;  4QIF A;  1VFJ A;  1FDD A;  4OHV A;  1S6Q A;  1RTZ A;  1CSJ A;  1D9A A;  2QFI A;  2V4J B;  1WNE A;  3MPV A;  3PEJ A;  1P6T A;  3DRP A;  1UA0 A;  3QAT A;  5G0R B;  2QT7 A;  2DXD A;  2C2R A;  3NS7 B;  3AFG A;  4KO0 A;  1SXL A;  1ULR A;  3CWJ A;  3NBP B;  4FF4 A;  1I94 F;  1MMD A;  1TL1 B;  3ET6 B;  5I3U A;  5H9E J;  1IUJ A;  5HL7 Q;  2KXH A;  3FCV A;  4OI0 A;  1YKW A;  2EFV A;  4IH6 A;  4LF2 A;  5D4N A;  2ZE2 B;  3L09 A;  1TV6 A;  3LWL A;  4F4X A;  4O4G B;  1IBC B;  4ZN1 A;  1X9W A;  1NJZ A;  1RZM A;  3A3O B;  2K8G A;  4JI8 F;  1YTY A;  3DDI A;  2PC6 A;  3JAM Y;  1H74 A;  2P2C B;  1RUS A;  4NLD A;  2HVD A;  2RF2 B;  3TAM A;  2ZHO A;  4ZCL A;  5IQ6 A;  1VR6 A;  4F4K A;  4B3O B;  2VA2 A;  5F8I A;  3IWN C;  4X4S A;  3MMB B;  5EDW A;  4B9L A;  3IN5 A;  1S9E B;  3NAH A;  4PWW A;  3G6Y A;  3Q24 A;  3IG1 B;  2J9C A;  4JI7 F;  1T9X A;  1F3V A;  2E1P A;  4DV2 F;  1RLC L;  4QW9 A;  3BV8 A;  4DU7 A;  1NK0 A;  4UQT A;  3H2V E;  5HAO A;  4QR2 A;  1B7F A;  2YKM A;  3LP0 B;  3LAK A;  5FLX U;  4USK A;  2GC8 A;  3I4H X;  2EFO A;  2BEF A;  2Q6C A;  3TVK A;  2M52 A;  1JJC B;  2Z2Z A;  4BWM A;  4FBU A;  3M32 A;  4EO8 A;  5K8M A;  2A2C A;  2LXF A;  1WJ9 A;  1IN0 A;  3KTQ A;  4LT6 A;  1S1W B;  2B6A A;  3FSY A;  1WOS A;  3NL0 A;  4O23 A;  3TAR A;  1J5E J;  5F8L A;  3RB4 A;  4UUX A;  2DYA A;  5DDR C;  4ZJQ A;  3L7P A;  1OY6 A;  3SDE B;  6AT1 B;  3R9L A;  4C7Q A;  1U7L A;  3HDS A;  1RHJ B;  3IAM 9;  2YTC A;  5SZT A;  4DJB A;  3TW0 A;  2ZEJ A;  4PXC A;  4AD6 A;  4O3Q A;  2GFF A;  2ROG A;  3W5Y A;  1YJ9 S;  4AYB D;  3ITH A;  3N0V A;  5G4D A;  2IA0 A;  2RKI B;  3R6G B;  2BJ9 A;  4AT1 B;  1VC0 A;  3KDO A;  2VAS A;  2DR5 A;  3E8O A;  2IJF A;  5ETN A;  3ZZT A;  4KAI A;  3AXM A;  3R5A A;  1LWX A;  4ECU A;  1T8E A;  4FF2 A;  1HFE L;  5DLG A;  1TFW A;  3CGI A;  5KFQ A;  2RDJ A;  4WFZ A;  3CE8 A;  2YVS A;  2HNY B;  4K5S A;  5LMN F;  1S59 A;  2DGW A;  3ZZ0 A;  1LK5 A;  4DX7 A;  4CZC A;  1U0H A;  4RX6 A;  4C3M A;  1KLM A;  1NZA A;  2WAQ D;  5KFN A;  4XO0 A;  2FJD B;  2P9E A;  2XLJ A;  1SL0 A;  2I8E A;  3M1V B;  1OSD A;  3MTJ A;  3R2D J;  2D3O 1;  3U1M A;  1UKU A;  3MR5 A;  2NR0 A;  2FJV A;  3Q2T C;  2Z4P A;  1T03 A;  4ID8 A;  2ZD1 B;  5B0F A;  1CS4 A;  2CQI A;  1H38 A;  4K7Q A;  4YY3 F;  1HKA A;  3VQT A;  1KD1 T;  4IDK A;  2D1C A;  4RNN A;  3KUE A;  2XSJ B;  1FFS B;  2HVI A;  5J2M A;  4C4W A;  3KJF B;  2KYX A;  2RRN A;  2DNK A;  2XMV A;  3Q83 A;  4L72 B;  1PIE A;  1HD1 A;  1AFJ A;  4G1Q A;  5AT1 B;  3HI9 A;  3QGI A;  4EZ6 A;  3CCE S;  5L1L A;  2W2O P;  3UPF A;  4CT9 A;  1PC4 A;  1PG5 B;  4MYU A;  2AD9 A;  2MGZ A;  1QE1 B;  1RU1 A;  1S57 A;  1UEU A;  5IT4 A;  2WON A;  1APS A;  5I4M A;  2JEG A;  1SBR A;  2FQQ B;  2RAQ A;  2CPZ A;  3NLC A;  5BR8 J;  2CDR B;  4I4B A;  3R1H A;  3IRW P;  4HKQ A;  3G71 S;  4NXM F;  1FER A;  1NHU A;  2EI5 A;  3VAJ A;  4EI2 A;  1B64 A;  4I6A A;  2MKY A;  1G7C B;  1HNW F;  2ZZM A;  2VD3 A;  4DV6 J;  4CLF A;  5CAA A;  1CUL B;  4I67 A;  2W25 A;  3AOD A;  4RBV A;  4CH7 A;  3PYE A;  3PFO A;  1ZTT A;  3CMQ A;  3W2V A;  1EZZ B;  2K06 A;  2JSX A;  4ED4 A;  3GV5 B;  3ELH A;  4ZPB A;  1HAR A;  4YB7 A;  3M8Q A;  2CQG A;  1GEH A;  3QT7 A;  1NM2 A;  4ZJL A;  2Z2L A;  2ATC B;  1UJ4 A;  4HAC A;  2QYG A;  4DCJ B;  4PR6 A;  1RAJ A;  3JXO A;  5KTQ A;  4NEY A;  2RVJ A;  3NWG A;  2WSC C;  3IC1 A;  1RT1 A;  4R0J A;  2ZIT A;  2VPX B;  4O4R A;  3IBF B;  5DLF A;  4DV5 F;  2KZZ A;  5KFM A;  1OYE A;  1LXN A;  2N7C A;  7AT1 B;  2ILY A;  3GCX P;  4LRD A;  3HHL A;  3SI8 A;  3GMG A;  1W26 A;  2VUG A;  2P6T A;  4GVB A;  2W7O A;  3PIO Q;  2Y9H A;  1HNV A;  4K0K J;  2OFG X;  3PCO B;  4ED3 A;  1HHS A;  2C3Y A;  3DM2 A;  4MJK A;  4O0I A;  3D5M A;  3LP2 B;  3K5O A;  1PGZ A;  3TEG A;  3T1H J;  1I1G A;  5A8K A;  1U49 A;  1Z4U A;  3WQP A;  2VON A;  2B7B B;  2HFV A;  3GV7 B;  3BQ1 A;  5BYQ A;  1FRH A;  2X3G A;  1GX6 A;  3C6U B;  4TXS A;  3PVX A;  3LGN A;  3HK2 A;  1SKU B;  1FE4 A;  5A8R A;  2GIF A;  1RE1 B;  1N56 A;  2IIH A;  4DV7 F;  4CNY A;  4AQY J;  1EET A;  2DNR A;  1NUE A;  4USI A;  2EKN A;  4KYZ A;  4C98 A;  1JMT A;  3RUB L;  1HMV B;  4DR4 J;  1U6B A;  5HSP A;  1Q8I A;  1SUQ B;  2ZFH A;  4YP3 A;  1S0V A;  5D0G A;  4LSN A;  3SSR A;  4WII A;  3M6X A;  3O1L A;  4X62 F;  4ZIW A;  4C8O A;  2HWI A;  3KXD A;  4JI1 F;  2RQ4 A;  2FVS A;  2LP4 A;  4HTJ A;  2KG0 A;  3RTV A;  1TUG B;  4ECZ A;  3ADA C;  4U7U D;  1QTM A;  5KG6 A;  4Z37 A;  3HPO A;  4U95 A;  4N77 A;  4C0B A;  3A8E A;  1AYE A;  1UMJ A;  4Y6I A;  3R5G A;  3ZFV A;  1LWF A;  3TZZ A;  4UOF A;  3CC7 S;  5E7O B;  1D09 B;  3BYP A;  5E33 A;  3Q2S C;  5CYM A;  5H9F K;  2F3J A;  5H1S V;  2FVQ A;  2B4O A;  1S6P B;  2M3D A;  2VF3 A;  3MAA B;  3KLH A;  1KQG B;  4AXI A;  2Y8Y A;  1LFP A;  4M1K A;  1S10 A;  2K1R B;  2DVI A;  2CYY A;  2MKJ A;  2QL7 B;  1YZ7 A;  2ZH2 A;  1A0O B;  2DIU A;  2E44 A;  4J9M A;  2V67 A;  1JKH A;  2QIF A;  3D4J A;  4JYA F;  2R42 A;  1U0S A;  3M2R B;  2MZR A;  2NRE A;  3GE9 A;  4F3Q A;  1M5O C;  3FEY B;  2CQ3 A;  3I82 A;  3I5B A;  4OHZ A;  3HLU A;  1PC5 A;  4CWB A;  2N4C A;  3OUY B;  2XGQ A;  4OYM A;  5D6G A;  4UY8 T;  2EFP A;  4HHU A;  4X64 F;  3SBM A;  2HBZ B;  2AX1 A;  5KT5 A;  5F41 A;  4CLY A;  1H98 A;  2HRU A;  2KB2 A;  4ZA1 A;  2KT2 A;  2HFS A;  3CDU A;  1XMQ J;  3HO1 A;  2V68 A;  1TL3 B;  3CJS A;  1CJV B;  2W7A A;  1FRK A;  3ZTR A;  4OYZ A;  2BKO A;  2FPH X;  3MM5 B;  4RW9 A;  2HVE A;  2GAH C;  2C42 A;  1NB2 A;  2ASL A;  2DRB A;  3F0N A;  2PD1 A;  1T9W A;  1TTH B;  2F8M A;  4EBD A;  5KFK A;  2YBV A;  2ASJ A;  1U1M A;  5E0O A;  2R2T A;  1Q81 T;  1R0C B;  3GII A;  2CIM A;  2D74 B;  4KV8 A;  3OVS A;  2UUB J;  4ICL A;  3FZB A;  2HZA A;  3PX6 A;  2MZJ A;  2RDD A;  3IXQ A;  4LUB A;  3BO3 A;  4WTY A;  4WK3 A;  1X4A A;  4IFV B;  3MF5 A;  3V4I B;  4RUH A;  3Q8V A;  2XBP A;  4OV6 A;  1RTD B;  4USJ C;  3QPI A;  2E5L F;  4OZ1 A;  2OPS A;  1NXI A;  4PUO A;  1Z2L A;  3I5A A;  2KU7 A;  2HMI B;  1N8R T;  1XNQ J;  2R7R A;  2BJE A;  3P3D A;  4YN3 B;  2GVZ B;  3CCL S;  3AA8 A;  2HS3 A;  2ZJP Q;  4XPE A;  2LQ5 A;  2O5D A;  3UO0 A;  1Q5Y A;  1WD6 A;  5THW A;  2GO9 A;  4C8N A;  3VAL A;  1S1U A;  3MD1 A;  3CED A;  2EBE A;  3Q8S B;  2HAF A;  4F2S A;  5E3R A;  2DY9 A;  3TEH B;  3BGU A;  2LQ8 A;  4BBY A;  4LF1 A;  3P5B P;  3PJW A;  4HDH A;  1S48 A;  5K14 A;  2OEM A;  5FD1 A;  2L9N A;  4CM2 A;  4KO0 B;  1OQ3 A;  2YKQ A;  2LKZ A;  4DI6 A;  4RU2 A;  1R89 A;  4NRT A;  4IKA A;  3QLH B;  2CUY A;  2NZC A;  3MDF A;  2XMT A;  1HI0 P;  1L5U A;  1VQN S;  2UU9 F;  3TYT A;  3K5P A;  2PEH A;  4OYP A;  4YFU A;  4ZLN A;  8ATC B;  4DCO B;  3PO4 A;  3HVW A;  4DUY J;  1WF0 A;  3WBZ A;  1KON A;  4NXN F;  1WDT A;  3RR7 A;  3MCO A;  2F8H A;  1FFG B;  3MEK A;  2BA9 A;  1UJ6 A;  3OLB A;  3AA9 A;  2XZW A;  5HAN A;  1QJH A;  4LVN P;  1ZAX A;  2DNO A;  1M5V C;  5J1N A;  5IC6 B;  4FNI A;  4WCE Q;  4B3T J;  5BXI A;  2J0X A;  2YH1 A;  1XBW A;  4LSL B;  1FTC A;  5DET A;  1RT3 A;  3PG9 A;  1IKY A;  2BRL A;  4DZD A;  1IWA A;  3TA1 A;  1OS5 A;  4X2B A;  4MMO A;  4NLG A;  2DD8 S;  4GKJ F;  5CZX A;  3ILO A;  1H3D A;  3PYF A;  2BQU A;  4CYU B;  3CIM A;  2MZQ A;  4LBI A;  1JXL A;  3I0S A;  2YKM B;  1TQL A;  2XMW A;  3BDE A;  3OV7 A;  4QIW D;  2J6U A;  2UVV A;  1S0O A;  1JK9 B;  4P71 A;  5AXK A;  1C1B B;  1FDB A;  4UT4 A;  2MY7 A;  3A13 A;  2D3U A;  1VGY A;  2MB0 B;  3T6J A;  5A8W A;  3UN5 A;  1TKZ A;  5B09 A;  2UXC J;  1UVN A;  2AT1 B;  5ITH A;  4K59 A;  3K8W A;  3BH6 B;  4DL7 A;  1FXL A;  4C3L A;  5CH7 B;  3UR0 A;  4WE1 A;  3ISN D;  2DIS A;  2FHO B;  2FJB B;  4X4N A;  3GSD A;  1IKV A;  1MW7 A;  2CQ1 A;  1LWC A;  2DNY A;  3GIM A;  2N7Y A;  4R5P B;  4ZMM A;  5CYQ B;  1VBX A;  1B0T A;  2YX1 A;  1CPZ A;  5L8R C;  5KFU A;  3IS9 A;  4DR5 F;  2UV8 G;  1A6L A;  3ZTQ A;  3KG1 A;  5JMN A;  3PV8 A;  1Z2Z A;  1RTJ A;  4WP9 A;  1S79 A;  2G0J A;  1KOH A;  4FZV A;  4QYR A;  2RU9 A;  1WC6 A;  2GO8 A;  2BV3 A;  3CC4 S;  2H65 B;  4ANE A;  2YKN A;  4JOU A;  3ZO7 A;  3HSJ A;  1DRZ A;  3W8G A;  1C4A A;  3NWR A;  1HA1 A;  3MR6 A;  2BDP A;  2MKS A;  3MEE A;  5HAT A;  1FEE A;  1WC1 A;  4FYV B;  3VAF A;  1XER A;  2A3J A;  2P6S A;  2BE7 D;  4I2P A;  2MQM A;  1L3S A;  2IY5 B;  3CJ0 A;  2PN6 A;  1V5I B;  3I87 A;  1F3F A;  4JI3 J;  1PJ6 A;  4USW A;  3BPD A;  1TKT A;  5LMU F;  3BQ2 A;  3V4M A;  5DS7 A;  3CXC R;  1S5Z A;  1VIX A;  4WFN Q;  3L7U A;  1IQZ A;  1UW9 A;  1NND A;  1X4F A;  1Y00 A;  2AWZ A;  3HHL C;  4YR3 A;  3AH6 A;  4E98 A;  4JI2 F;  2HQI A;  1IWG A;  4JI4 F;  3CSK A;  5LSL A;  3BRE A;  1W7W A;  2C2D A;  2RUS A;  3J80 U;  1WWH A;  1U1O A;  4B3M J;  2WZ1 A;  3BQ0 A;  4F36 A;  5RUB A;  4QCL A;  1HQU A;  1KBR A;  2ASD A;  4LRA A;  5HO4 A;  2XI3 A;  4NLO A;  1U6Z A;  4U7C A;  1X7V A;  4BC9 A;  4ZK7 M;  1QLN A;  5LM7 E;  2DY1 A;  2J0Q D;  2BMB A;  3OFF A;  4QYZ J;  2GHV C;  2IM0 A;  2R7Q A;  1TAQ A;  9RUB A;  1KS2 A;  2M7S A;  2JOQ A;  5J1P A;  3C2P A;  4FBT A;  4NLQ A;  3MUV P;  2OGU A;  2J0W A;  1SL2 A;  2RDI A;  2HBY B;  1WKJ A;  3HF5 A;  4Y28 C;  1C0T A;  4K4U A;  1K44 A;  2KDO A;  1SC4 B;  4R8U A;  4DV3 F;  2CJY B;  4W90 B;  1WC4 A;  4HI1 A;  3MD3 A;  1VRQ C;  2XMA A;  2J76 E;  2VQE F;  4FDF A;  1K1Q A;  2VIC A;  3M05 A;  2KT3 A;  1FNX H;  1KNZ A;  1SB6 A;  1TK5 A;  2VIH A;  1RK8 A;  3HJF A;  3T6B A;  1UL3 A;  1E6V A;  2HKE A;  2LEC A;  1QAI A;  1SL1 A;  3FJ2 A;  1NK6 A;  3HM9 A;  4MTP A;  1S1T A;  2XMU A;  3OLA A;  4IR9 A;  4O0N A;  5D8H B;  5JJB A;  2AHO B;  3OT9 A;  1MSW D;  1NU4 A;  2AEM A;  2C2E A;  1RT5 B;  4TNO A;  4DSK A;  4WK1 A;  1RKJ A;  2Z30 B;  1REV B;  3SYZ A;  1DLO B;  1KEK A;  1RWM B;  1NO8 A;  3JQK A;  2YWE A;  3CDW A;  4ZPD A;  5DDQ C;  1YVF A;  2KHC A;  3KK3 A;  4ZVG A;  1EKS A;  1TL7 A;  2AP6 A;  3U27 A;  1HBM A;  3MM6 B;  1YDL A;  1K47 A;  2XY6 A;  1XR7 A;  3DCA A;  3R5D A;  2V4Q A;  1NRK A;  2OTJ S;  2MPU A;  5KT6 A;  1UJ5 A;  2HHP A;  1LWE B;  2AV5 A;  2KKH A;  4W4M A;  3DLJ A;  3BGF A;  1U47 A;  2V94 A;  2HAI A;  2XMK A;  1WOO A;  4ZPA A;  4YQW A;  4U6P A;  1XN9 A;  3RBZ A;  4O44 A;  3QRP A;  5M2U A;  3G87 A;  2NSC A;  1GQE A;  4KR0 B;  1CG2 A;  4RBT A;  4KH0 B;  4B08 A;  4P73 A;  3TX0 A;  1CJU A;  3C6T B;  4NLT A;  2CNN B;  3KLF A;  4JI0 J;  4WU2 A;  5AE1 A;  4RNO A;  1J5O A;  3ENV A;  4RW8 A;  5KFP A;  1ITP A;  2FLL A;  4DQS A;  1GNK A;  3C8Y A;  1DTQ B;  5J1E A;  4LF5 F;  2ZVI A;  2BX6 A;  3FCH A;  4Q5V A;  2G0I A;  3MGJ A;  4V19 J;  4IOA Q;  4EU0 A;  1EIY B;  2J5A A;  1HBO B;  3O8W A;  4Q0B B;  1SI9 A;  3FC9 A;  4GVL A;  1YRX A;  3S6E A;  2N4D A;  3RJM B;  1D8Y A;  5J2N B;  1RHQ B;  1ZM9 A;  2BAN A;  2CDQ A;  4KHP J;  3I9V 9;  3KK2 A;  1Q16 B;  2LU1 A;  3ISZ A;  3GG1 A;  3DGP B;  2BQ3 A;  2BRK A;  4Z2X A;  2FLO A;  2OO4 A;  4HT5 A;  1T05 B;  1L3V A;  5A2Q Y;  2DGO A;  2YNF B;  2HHW A;  4X4U A;  4OHY A;  1A9N B;  2HFN A;  1FD8 A;  3FSI A;  1RBA A;  3SSS A;  1HQ2 A;  3R97 A;  2YNI B;  5CQG A;  4JV5 J;  5FDL A;  3J81 j;  3MR2 A;  3C14 A;  4EBC A;  3KUG A;  4OYA A;  2O66 A;  3CCS S;  4PG8 A;  4QU7 A;  4RW9 B;  3V5R A;  2X51 A;  5KG7 A;  5F3Z A;  4DSE A;  4FS2 A;  3B4D A;  3H42 A;  5HJX A;  1V3Z A;  4KGM A;  2J9E A;  4DF4 A;  3F44 A;  3QWU A;  1N34 F;  3B54 A;  2M5Y A;  4Q2M A;  3HX9 A;  3UCG A;  2GVD B;  4KFB A;  4CLL A;  1NDK A;  1QSS A;  5IT9 Y;  4NMX A;  4ZP9 A;  2OPP A;  2V8V A;  2HS4 A;  4OZJ A;  3NEK A;  3M8P A;  4DPX A;  2FGO A;  2F63 A;  2ZUG A;  2DHG A;  1SJF A;  1JLA A;  3CDE A;  1F6T A;  3BN4 A;  5AXN A;  4C0O C;  3ZZU A;  4UZB A;  2VQF J;  1Y3K A;  3DRX A;  3Q8U A;  2V0N A;  2L08 A;  1UFW A;  1LW2 B;  1IKX A;  5KFS A;  4RW7 A;  4RW4 B;  3OR1 A;  4IH5 A;  1PKU A;  4PQA A;  4LFC J;  3BPS P;  3GYN A;  3OFH A;  3I5C A;  1U4B A;  4ETZ A;  1B7Y B;  2OLW A;  3DOL B;  2J7W A;  1SCJ B;  4NLS A;  1RYS A;  4X4V A;  2XY5 A;  4TU9 A;  4CLT A;  3QIP B;  2MKK A;  5GVQ A;  1WEL A;  3CW2 C;  3GFX A;  4EBE A;  3ZZP A;  2BOP A;  4PWD B;  1IKW B;  1S72 S;  1N48 A;  5HBM A;  4F3M A;  2G4B A;  2MLX A;  3EUN A;  1X4C A;  3H8Y A;  1MLA A;  5CCM A;  1BWV A;  1OJ4 A;  4NWB A;  3G8T A;  4NCG A;  3B82 A;  3JSM B;  2CKW A;  2V69 A;  1MRO B;  3TA2 A;  6FDR A;  3U7J A;  1UTA A;  3OR2 A;  3CCV S;  5EWF A;  1NKE A;  1MNE A;  4W98 A;  4PXE A;  3FGV A;  3QID A;  1X5T A;  4HDG A;  3TAP A;  2E29 A;  3DHX A;  4F04 B;  2H5E A;  3D28 A;  3W9H A;  4WZQ A;  1DTT B;  1YSJ A;  3MUM P;  1RT3 B;  1UP1 A;  1IKY B;  4PCQ A;  2HNZ A;  4XAK A;  2G0C A;  4PXB A;  1HYS B;  4A8M P;  2PEB A;  4ZVR B;  4YHH F;  1VOM A;  2HSE B;  4O3O A;  3TZX A;  2KM8 C;  5KG1 A;  4B9N A;  1S76 D;  3OFE A;  2BJD A;  3WC0 A;  2WOM B;  2R8J A;  4EEY A;  3OXL A;  3UW1 A;  1FJG J;  1HW8 A;  1FWK A;  4C11 B;  2LQB A;  1RTI A;  2JVR A;  3K5L A;  3AOC A;  4I2Q A;  3W9I A;  4ED0 A;  5A8W B;  2J8A A;  2ZBQ A;  3V6H A;  4L75 A;  2VL1 A;  2W9C B;  1RT6 A;  2ZZT A;  4F2R A;  4LF9 F;  2MQL A;  3QO9 B;  2YKO A;  5U47 A;  3THV A;  1K9M T;  4N56 A;  3EM1 A;  4DL5 A;  3UNG C;  1Q7L B;  1O5J A;  5KG2 A;  1LWC B;  1HWK A;  4FPI A;  1U26 A;  2QLJ B;  5KFG A;  2WSE C;  3NMA A;  1F5C A;  3KHR A;  3CJ2 A;  3W3S A;  4U8Y A;  3I0R B;  2DNP A;  2DH8 A;  1NEE A;  1BGX T;  3GIJ A;  3MTK A;  4OI6 A;  3EVO A;  1VMB A;  3EGZ A;  4PXD A;  2EFN A;  3RRH A;  3MMA A;  5I42 A;  3CNQ P;  3UD4 P;  1DY3 A;  2XMM A;  4M5N A;  2RSQ A;  2Q6B A;  2JEF A;  2VKZ G;  3FBB A;  2B7C B;  1DAX A;  4EK2 A;  2MQQ A;  2RRA A;  2RHS B;  1AZS B;  2F4V J;  4TYA A;  1VJQ A;  1HPZ B;  1UWB B;  3OTC A;  4C8L A;  3D9B A;  1XC9 A;  3NAI A;  3C16 A;  2M8H A;  5IM0 B;  1IM4 A;  4K8R A;  3ISN C;  1EAR A;  1YG0 A;  2GMJ A;  2D41 A;  3TVZ A;  3A3N B;  2E1M C;  4DBQ A;  1QVG R;  1N6Q A;  1S1X B;  2BE2 A;  4USV A;  1AXQ A;  2KFY A;  1Y5I B;  3EZ5 A;  4QR1 A;  4XPC A;  4CO0 A;  3EWG A;  3VVT A;  4DR7 J;  4D3H A;  4RL1 A;  2R7T A;  1HBN B;  5EHH A;  2AEF A;  4P10 A;  3PM9 A;  4X65 J;  1VI7 A;  3MM9 A;  5KFH A;  2ZDP A;  3T5L A;  1M1K T;  3POT A;  4NI2 B;  4OLP A;  2XM3 A;  4YDD B;  4P2S A;  4DLG A;  3QRR A;  4HR2 A;  2LEB A;  5J2P A;  2CQB A;  2XS5 A;  2HHH F;  4G65 A;  3ZNJ 1;  4NCA A;  4OIX A;  3JB9 k;  4NML A;  1LW0 B;  4Z7Y A;  3VAM A;  1U1K A;  2YPZ A;  4DHV A;  1ZPV A;  3LPE A;  2ZM6 F;  1CEZ A;  4M5D A;  1B70 B;  1VK3 A;  2R2U A;  4ZVF A;  4TY8 A;  3JAM U;  3W2W A;  1SC3 B;  3RZA A;  1C1C B;  3FEX B;  4TLQ A;  3HT0 A;  3KLI A;  3BO2 A;  4RO0 A;  3J81 Y;  3QAU A;  2Y1I A;  2WVD A;  2Y3Y A;  3IGV A;  2RS2 A;  3RG6 A;  1FXD A;  2Y8W A;  2RB7 A;  2E1R A;  2YNG B;  2RQM A;  5HLF B;  3B78 A;  5KFJ A;  4RU9 A;  4P2X A;  1FDN A;  2XHW A;  1BC6 A;  5HMX A;  2VG7 A;  3DRS A;  3TUP A;  1P1T A;  4O3N A;  2YX4 A;  2CJK A;  3DOK B;  1K0V A;  3H5Y A;  1QD1 A;  1NJW A;  1IR2 A;  3C15 B;  1YGY A;  2KN4 A;  4KT0 C;  2BE9 B;  2P8I A;  3CME S;  2JL9 A;  1S1T B;  1CQM A;  4QIV A;  4OZ2 A;  4Q7A A;  1RCX B;  2IRU A;  3G96 A;  4I64 A;  2W2N P;  2QSF A;  5DG7 A;  4DUT A;  3IRX A;  2HHU A;  2ASY A;  1ARO P;  1L3T A;  3GIL A;  5JVG Q;  2CZ4 A;  1JLC B;  3NG8 A;  2IM3 A;  2JC0 A;  3MEG B;  2HPU A;  5HQM A;  2Y0B B;  4ZCM A;  3MWB A;  1NSP A;  4F4Z A;  3ZZO A;  1SV5 A;  1N33 F;  2HZC A;  1FK9 B;  1RA7 A;  2DH7 A;  4RNH A;  4CDI A;  4ZLL A;  1NBE B;  2FVP A;  1CJK B;  1TL7 B;  4X4Q A;  3HP6 A;  2XUL A;  4LF4 J;  4KKO A;  1RHR B;  1NHK L;  1O51 A;  2L9D A;  5MAO A;  2DR9 A;  1RBL A;  2J7U A;  2MLY A;  2XO7 A;  2RRB A;  3D3B J;  5AJ3 F;  4F8R A;  2PI5 A;  2ZZN A;  4DR1 F;  3M9M B;  1ZYQ A;  3QJP A;  4P7T A;  4BHQ A;  2MSS A;  1R7I A;  4DR2 F;  2PA3 A;  4Y2K A;  2LDI A;  3AB4 B;  4JB8 B;  4DV1 F;  8RUC A;  2J6S A;  4YB1 P;  5C25 B;  1UCN A;  2XEX A;  1HQE B;  4WTO B;  2XNQ A;  2KI2 A;  4DR6 F;  1R0A B;  1FWP A;  3BGR B;  1H7W A;  3K0J A;  2AGP A;  1JIH A;  2PO4 A;  1D3W A;  4ZVS B;  4L3K A;  4DV0 F;  2X1G A;  4J9O A;  2G13 A;  4FXW A;  3M8W A;  5CD4 H;  2CXE A;  2QG9 B;  2W24 A;  1IBM J;  2QL5 B;  1MN7 A;  2CQ4 A;  3C46 A;  1T11 A;  3G9C A;  1HWL A;  2EKY A;  1GT8 A;  3O2I A;  4KGV B;  1X4H A;  2C2Z B;  3LUY A;  5C5J A;  4IO1 A;  2DNL A;  3R27 A;  4L6V 3;  3KFW X;  1RT7 A;  4I69 A;  4A8W A;  1VHF A;  1VLY A;  3K5M A;  3QT5 A;  4WFB Q;  1N0U A;  1HNZ F;  1MML A;  3LAM A;  1Q7Y T;  4BCA A;  2F9J A;  1OMS A;  3M4X A;  1K73 T;  4OLO A;  2FD2 A;  2VG5 B;  1N33 J;  2CRL A;  2XYP B;  3OW2 R;  1YZ6 A;  3AJ1 A;  1U6F A;  2DHA A;  1DJ0 A;  4PPD A;  3S1T A;  4LFA J;  5AXM A;  1ZBT A;  2MJU A;  4DN0 A;  3OJU A;  3KJV B;  4NLP A;  5H9E K;  4KB7 A;  2B9W A;  1GH8 A;  2NXE A;  4DR3 F;  1UEK A;  3T5K A;  3KHG A;  4ZVQ B;  4ZCK A;  4I56 A;  1B4S A;  1HBU B;  2BOA A;  3A1Y G;  2OPQ B;  3TO8 A;  4N8N A;  4UUW A;  2FHK A;  3MCN A;  3MED B;  2NXU A;  2BAB A;  2IPO B;  3GYG A;  1ROF A;  1CJT A;  2XNR A;  4AL5 A;  1VIS A;  1HNX J;  1FJ7 A;  1HI1 A;  1U2C A;  1V3S A;  3UCU P;  4DF8 A;  5CD4 A;  3GP9 A;  3PIP Q;  2AU0 A;  3SXL A;  2CVE A;  2GML A;  1UET A;  4GO5 X;  3HD1 A;  2Q1L A;  4B9T A;  1QM9 A;  3PYG A;  1IJF B;  5C2G A;  2CG4 A;  1MWZ A;  2C3M A;  2HBR B;  2OPP B;  2H4W B;  2GS8 A;  2NXN A;  1U1N A;  2O1P A;  1P1L A;  2WVF A;  5F8J A;  2HBQ B;  2XLI A;  5C24 B;  1TUW A;  2M9K A;  1WEX A;  4IQM A;  5ETK A;  4CTA B;  1AA1 B;  4C97 A;  1SIZ A;  2I5J A;  3L7O A;  1WEY A;  3MMC B;  1YBA A;  1IBL J;  1TKX B;  4NZ6 A;  2E9R X;  3FEZ A;  3D0G E;  2FHJ D;  3V6D A;  4USU A;  1HNZ J;  5IFM A;  3U1N A;  2EG2 A;  4TLR A;  4OHX A;  1JLB B;  1M0S A;  3TA0 A;  1YJT A;  3OXG A;  3OR1 B;  4F0M A;  4DSL A;  3LA0 A;  2UP1 A;  2QLX A;  2R8I A;  5I3Q A;  3KYL A;  4KHM A;  3WDO A;  5KFI A;  2OAU A;  1IBK F;  2ZJQ Q;  3NCR A;  2F4F A;  5ETV A;  3T1A A;  2MKC A;  1FKO A;  1UVK A;  1ZTW A;  3PDN A;  5F0W A;  5CA5 A;  1RWK B;  2QSW A;  2CNO B;  3CT9 A;  1RAE B;  3FBF A;  5B7W A;  4IRD A;  2HND A;  5ETR A;  4USH A;  3CCQ S;  2HHS A;  2QMU B;  2VFR A;  5KFC A;  2UUA J;  1U1R A;  3N5B A;  2BJ8 A;  4B9S A;  5KFF A;  5BYR A;  1R8C A;  2QEX S;  1TUV A;  3TWZ A;  2BKP A;  2UUC F;  3BEG B;  3MHY A;  2V5H G;  1KWM A;  1U8W A;  1HLW A;  5KFT A;  4F0H A;  3OR2 B;  3Q89 A;  5DM6 Q;  1AT1 B;  3RB6 A;  4XTT A;  5LJ5 Y;  1OY9 A;  5T14 A;  3ILL A;  3MM7 A;  3D0H E;  4OI3 A;  4DQQ A;  4X4O A;  2QA4 G;  3QAE A;  4PWU A;  4UQG A;  4YB6 A;  4OX6 A;  3EDQ B;  4DPT A;  3JTO A;  2C22 A;  1UPP A;  3H98 A;  1YIJ S;  2E5J A;  4WWS A;  1NKC A;  3GV8 B;  1NK4 A;  1FDA A;  3CJ5 A;  5HQ8 A;  1NSA A;  3CJK A;  1RAB B;  3R3T A;  3M30 B;  5J2Q A;  2K3K A;  4AXJ A;  2OD4 A;  3HKW A;  2IHR 1;  2IAJ A;  4LR7 A;  4PAB A;  4DQI A;  3NOG A;  1GK8 A;  4DX5 A;  2AJQ A;  4HT7 A;  1KTV A;  2OMO A;  1OWX A;  3W65 A;  2NXC A;  3K2Y A;  4LR9 A;  4LRB A;  4WFY A;  3TR5 A;  4HH1 A;  1RT4 B;  3FMW A;  2D3O R;  3RRK A;  4RUB A;  3EPI A;  4IG0 B;  4DS5 A;  2V63 A;  4OYI A;  2E66 A;  3DRR A;  3HFK A;  4I2Q B;  4L74 A;  1B0V A;  1Q78 A;  2XO6 A;  3M2U A;  1NK5 A;  1FX4 A;  3MM8 B;  3FUY A;  1FO1 A;  4O3S A;  1ELO A;  4CO5 A;  1RWW B;  2BR0 A;  5IC4 B;  4MK8 A;  2EBG A;  2AQ4 A;  1JLF B;  2CJX B;  1QUV A;  5IXU A;  3KG4 A;  3AQP A;  3O6Q A;  2CPH A;  1WG1 A;  3H4D A;  1E6Y B;  4OZN A;  2J7K A;  2FUG 9;  5GAD I;  2FHJ A;  1CQN A;  1SKS A;  3VR1 A;  1M90 T;  5D78 A;  3ZTP A;  1SKR A;  2LCW A;  2C3U A;  3DRY A;  4JI5 J;  2UUC J;  3TOQ A;  3H5X A;  2LQJ A;  5F9L A;  1T9T A;  4OX9 J;  3IGN A;  3BH7 B;  5DZ6 A;  2XGP A;  1RSC A;  2R9L A;  4NLX A;  2EW9 A;  2CQH A;  1WKL A;  3BSA A;  1ZA2 B;  2DNQ A;  3JYT B;  2DNH A;  3TX8 A;  3KK1 A;  5E3C A;  3GR1 A;  3DOM A;  1D8Z A;  1EJ7 L;  1LFW A;  5EX0 A;  4CH0 S;  3SSQ A;  2NXJ A;  4ZVO B;  2IJN A;  1FF2 A;  2E5I A;  4PZV A;  5T41 A;  2GV1 A;  4M5I A;  1GMU A;  2GCF A;  4EZ9 A;  1LQ9 A;  2QA2 A;  1M1H A;  2ACM A;  1MWQ A;  4UF4 A;  4E0D A;  2JFK A;  1X9M A;  3GB0 A;  2HHV A;  5L39 A;  1XNR J;  1VQS A;  1N32 J;  3HVT A;  2CWX A;  4C8Z A;  2OML A;  3H4B A;  2KRR A;  4AUK A;  5LSO A;  2B9X A;  4FXV A;  1UZH A;  3D54 A;  1OY8 A;  1RTH A;  2HQD A;  2L9W A;  3G6V A;  3M2V A;  3D2W A;  2R3V A;  4PQU B;  5E41 A;  1DHM A;  1V6H A;  3VGT A;  3HD2 A;  4FPR A;  4F50 A;  3V6K A;  2B51 A;  2ZH4 A;  1R8A A;  2XSF A;  2YNH A;  3Q86 A;  5E3Q A;  5B0G A;  2ZOM A;  2HK3 A;  2RH3 A;  3BGL A;  1T3N A;  3T1Y F;  1TFY A;  3CCT A;  4A8F A;  3UDC A;  2RD5 C;  1NJX A;  2IFX A;  2VC1 A;  1TVR B;  1X4E A;  2PFF B;  3O3L A;  4ZVH A;  2JEJ A;  3SCK E;  4LBP A;  5GAE U;  2PGC A;  1RT2 B;  4ZVP B;  1Y0H A;  1YWX A;  1JJ4 A;  3VVU A;  4EYI B;  5HK4 A;  2G1H A;  2R7V A;  4IOC Q;  1RWU A;  1I94 J;  2ZVS A;  2LXU A;  2V2Z A;  5J2P B;  2RUG A;  1NZ8 A;  4ELT A;  4B9M A;  1AW0 A;  2MZT A;  2ALZ A;  2R8H A;  3KLE B;  4BWJ A;  1SH3 A;  3VQS A;  3R7N B;  5D3G B;  3R6L B;  4I7F A;  1VQO S;  4DU8 A;  2IMW P;  3CJ4 A;  3DMJ B;  2AJ1 A;  1I3O B;  3ETO A;  5C42 B;  4MH8 A;  1ZM4 A;  3WIV A;  4JI8 J;  1CLF A;  4MT1 A;  3H20 A;  5T7L B;  2V8P A;  4I1T A;  4J9U E;  1O0P A;  3D1Q A;  4ED1 A;  1HWU A;  1R0B G;  1FE0 A;  3D1H A;  5LSR A;  4LIR A;  1KQK A;  2VBY A;  1H6K X;  4CP5 A;  4ECX A;  1U1Q A;  3L4B C;  5G0R A;  2IBK A;  4DX8 H;  1TK8 A;  1K0T A;  2LEP A;  2AKW B;  4BC7 A;  2CPY A;  2KO1 A;  3NBP A;  2DHX A;  3WX4 A;  3DKD A;  2RIL A;  4RJV A;  2WB1 D;  1TL1 A;  2Z0G A;  2GX8 A;  5AXL A;  3ET6 A;  4NYZ A;  4JI7 J;  4DV2 J;  2VG7 B;  3BSC A;  3DYA A;  4ZP7 A;  3IA0 A;  3MPD A;  2HQF A;  2ZE2 A;  2FTR A;  1X4B A;  5IZH A;  5L1K A;  2FLP A;  4O4G A;  5KOW A;  3QZ7 A;  4RW6 B;  4Z7C A;  2IM1 A;  2LA6 A;  4DQP A;  1WF2 A;  4CLU A;  2XZD B;  4UOC A;  5HI7 A;  3OHA A;  4A4J A;  1TU0 B;  2GA7 A;  3GYX B;  4LF6 F;  4ZOS A;  3ENA A;  2RF2 A;  3UD3 P;  3MFH A;  4Y2I A;  1DZ5 A;  4PG5 A;  5L1J A;  1RHM B;  3K89 A;  3AB2 B;  4B3O A;  4DLE A;  1S1V B;  4X66 F;  1W25 A;  3MMB A;  2JX2 A;  5K8P A;  2HHX A;  4F26 A;  1S9E A;  5GAH U;  4X84 A;  3X3U A;  3ICL A;  3THT A;  4L76 A;  3IG1 A;  1NAQ A;  1RQ0 A;  3GPA A;  4H4M B;  2KJV A;  5LT5 A;  3S8S A;  2BAC A;  2RNE A;  4FVM A;  2LLZ A;  2KYZ A;  2QMW A;  4F25 A;  1YJV A;  1RAI B;  4CLK A;  3LP0 A;  3MOZ A;  5A76 A;  1NPK A;  1OPI A;  1D9D A;  1H0H B;  4LF8 F;  3LP1 B;  3VCD A;  4ECS A;  5F8G A;  2PFD A;  4IG3 B;  1S0N A;  5DQH A;  1S1W A;  1YJN S;  2ZHB A;  4KHR A;  3K58 A;  2RQK A;  2Z2Y B;  2ZOF A;  1GXU A;  2NLW A;  5LMN J;  3TI0 A;  3SDE A;  2HFU A;  1HWI A;  5KT2 A;  1JLQ B;  2G1D A;  2SXL A;  1JLE B;  1KSP A;  1M5H A;  3VAK A;  1VCT A;  3V2U C;  2Y0S D;  5D0E A;  5ETS A;  1KQF B;  3DLE B;  2Q43 A;  4B3S F;  2RKI A;  2KL8 A;  4N41 A;  1FFW B;  2ZJR Q;  3G82 B;  2MY8 A;  1LOU A;  4CI0 B;  4YY3 J;  3UDL A;  1SJQ A;  3QGP A;  4LRF A;  5HQL A;  2KXF A;  3LQV A;  1OO0 B;  3PRB A;  3UFC X;  3NGR A;  3NGT A;  1MMN A;  2ZH5 A;  2F1F A;  2UXD F;  2AJF E;  1MU2 B;  2WTF A;  3OTE A;  4P6Q A;  4ILM A;  2HGL A;  2CPF A;  2HNY A;  3N6M A;  3RGI A;  1EQ0 A;  4ECT A;  4H4O B;  3FDS A;  2R7X A;  3UVJ B;  2CWK A;  3GON A;  1XMB A;  3WC2 A;  3K5N A;  1PIL A;  4GO7 X;  3M1V A;  4DL3 A;  1XWL A;  1S9F A;  5ADZ A;  3MAH A;  1VQK S;  4NXM J;  1UFL A;  2Q3P A;  4MFB B;  2ZD1 A;  4LF8 J;  4WYW A;  1RAH B;  2JLF A;  1FD2 A;  3GZ7 A;  3CVK A;  1HNW J;  3M8R A;  1TZ0 A;  4JV1 A;  2XSJ A;  4IFY B;  3PXG a;  5A0Y B;  3IBC B;  1SQE A;  2XQC A;  1VRU B;  1ZM3 A;  3BN7 A;  2J9D E;  1LXJ A;  3KDN A;  4V19 X;  2OFH X;  3AT1 B;  2P5V A;  1N36 F;  1BQN A;  4M5H A;  1QE1 A;  3T5H A;  1WC3 A;  1VIO A;  2IYG A;  1ZAV A;  2XZT B;  4GKK F;  3D66 A;  3D6T B;  3RYL A;  2QLB B;  2RU3 A;  4N76 A;  3T9N A;  4CT8 A;  2B4P A;  3M6U A;  4DV5 J;  3Q8P B;  2ZH3 A;  4FF3 A;  4B3R F;  2AYM A;  3RBD A;  2OPR B;  5JXS A;  2YXL A;  2V8G A;  4OJ1 A;  1U2R A;  2B0G A;  3T41 A;  3I9Z A;  2NZ4 A;  1GMV A;  2ACY A;  1PAU B;  1VC5 A;  1CUL A;  1WG4 A;  3SV3 A;  1VQ7 S;  1WI6 A;  3CDB A;  2MMY A;  4XDC A;  2WSF C;  1RA6 A;  3Q8R B;  2AEJ A;  4B02 A;  3S01 A;  1YK9 A;  4ZPC A;  2MDA A;  3P4U B;  3E3X A;  4N47 A;  2G2O A;  1XMO F;  2B5J B;  4KQZ A;  1Y3J A;  3E01 B;  1XTZ A;  4ES2 A;  3Q22 A;  1GTE A;  3DI6 A;  2DEJ A;  2VG6 B;  2V2Q A;  4C3K A;  1FKO B;  3HHK A;  4ZIT A;  2HK2 A;  5B08 A;  3NRB A;  5HRO B;  4ZHR B;  2YWG A;  3LWM A;  5IWA F;  3A8K A;  2E7V A;  4DV7 J;  4Q45 A;  4ZLP A;  3M6W A;  3R7B B;  3SZ2 A;  4UTG A;  4JP8 A;  3L3C A;  3BJY A;  3CJT A;  3OTO F;  2FC9 A;  1XJW B;  2GNK A;  3FNN A;  4C9D A;  4ECR A;  4DSJ A;  3HHE A;  2IBO A;  4NCB A;  3OTB A;  1U1L A;  1DBD A;  3AD9 C;  4X62 J;  1JNZ B;  3LP2 A;  4OZ5 A;  1N5Y B;  4OHW A;  4JI1 J;  3CD0 A;  2OSQ A;  2HLT A;  2L48 A;  3N79 A;  4J9R A;  2GGP B;  2FIU A;  5KG0 A;  4DG1 B;  4WYL A;  3FFI B;  3C6U A;  5HP1 B;  2XC9 A;  5KAK A;  1VQY A;  4LFB F;  3J7Z 5;  2Z58 B;  5KT3 A;  1X5O A;  2ALY B;  2IVM A;  2GQC A;  1FI4 A;  4FYX B;  2Y1J A;  4NLU A;  4P2M A;  1OIA A;  4TU8 A;  1GMW D;  2OJ3 A;  1HMV A;  3KLV A;  2KTQ A;  1SUQ A;  4F02 A;  2WVB A;  2MTL A;  3QJL A;  4WU3 A;  2QLW A;  3DLK B;  3QWP A;  3W8P A;  4C6A A;  1JX4 A;  5DZ7 A;  3J7Z T;  1BMQ B;  4OJ3 A;  3PTW A;  1IVZ A;  4Y2M A;  2WK4 A;  4UW2 A;  4JYA J;  4ZDN A;  4EMD A;  1HHT P;  4QIG A;  3FBE A;  5D15 A;  1H7X A;  3PKY A;  1PO6 A;  1RAO A;  2VPZ B;  1YBU A;  2LU2 A;  4QW8 A;  2PT0 A;  2O67 A;  3QMQ A;  2ZH9 A;  4LF7 F;  4ED8 A;  2YX7 A;  4UOG A;  5ETQ A;  3DLG A;  4OI1 A;  5GAG U;  2E1A A;  5ETO A;  2R7S A;  1S6P A;  2MKH A;  5A2Q U;  1KN6 A;  1S6Q B;  4X64 J;  1RP5 A;  3JS9 A;  3PKM A;  1URN A;  4PG7 A;  4QYZ K;  3DRP B;  4G6V B;  2UUT A;  4J9V A;  2K1R A;  1BD6 A;  1O8B A;  2CPI A;  1YJ7 A;  5EWE A;  2VA3 A;  2B4V A;  1HR0 F;  2JNJ A;  2HFZ A;  3D3C J;  2NPF A;  1WOR A;  1IQT A;  1T9Y A;  1Y4Z B;  2EFG A;  1VRT A;  2DBB A;  1Y11 A;  5I3U B;  4NRU A;  1Q79 A;  2D9P A;  2E9T A;  2KH9 A;  4NAS A;  2RJZ A;  1C0U A;  4DPU A;  2C2N A;  3M2R A;  4LFB J;  1TV6 B;  2RIJ A;  5HMW A;  4DUZ F;  5D0H A;  3GR0 A;  3QGH A;  4PG6 A;  4NYO A;  1SJR A;  1AUD A;  2AMC B;  1S0M A;  3GIK A;  3W66 A;  2GQQ A;  3OUY A;  1KR4 A;  2IVF B;  3TAM B;  4XIU A;  1SQG A;  5IT9 U;  2X3D A;  3ENW A;  5EUH A;  2M4M A;  5F8M A;  3OTD A;  4IOB A;  2HQC A;  2E5L J;  1CC7 A;  4ER8 A;  3EGW B;  1TL3 A;  3EGN A;  3QFW A;  1CJV A;  2HQG A;  1BLU A;  1ZOT A;  1NJY A;  2EK1 A;  1UZD A;  2DPI A;  3MM5 A;  1RTH B;  3MMJ A;  2G9O A;  2MZ1 A;  3M2V B;  1NHV A;  2VOP A;  2W01 A;  4M5L A;  3PJ9 A;  3HZG A;  3SFG A;  1DQ8 A;  2Q79 A;  2DTJ A;  4ZPW R;  1Y10 A;  3M32 B;  1KDN A;  2LXI A;  2N3L A;  1B0P A;  4MIW A;  1ZZN A;  4ENO A;  3DHW C;  2R8G A;  3GSI A;  3RW6 A;  1RWN B;  2B6A B;  3W61 A;  3V4I A;  4KGZ B;  4M8L A;  1RTD A;  2JFD A;  1RGV A;  4I0W A;  2JLG A;  4IUF A;  4CLS A;  3K57 A;  3A4T A;  2VFU A;  2HMI A;  3EDR B;  1QDU B;  2F5G A;  3RAX A;  5DDO C;  5E2Q A;  4WFX A;  2GVZ A;  2YWF A;  3OSP A;  5GMD A;  2QC3 A;  2UU9 J;  4FNH A;  1B3T A;  4I68 A;  2X7I A;  4JV2 A;  2BQR A;  3I4P A;  3EXC X;  1N5Q A;  2KRB A;  5B0E A;  2HRY A;  1S9G A;  3PW4 A;  4YS2 A;  3ITH B;  2I6W A;  3PRV A;  4NXN J;  3D6H B;  2DHH A;  2I1R A;  1WHV A;  4RZR A;  1F0X A;  4FYW B;  2QGF B;  4ILR A;  3T19 A;  2CJQ A;  2GQ2 A;  3SQG A;  2VZ9 A;  3NMR A;  2FHM A;  3IR5 B;  3N01 A;  5DRK A;  3TUZ C;  1N5T A;  4P75 A;  2NUU G;  3IAS 9;  2CPJ A;  3GLJ A;  2DH9 A;  3CJ3 A;  3NNA A;  3GQC A;  1J5E F;  3QLH A;  4A8X A;  1U24 A;  4PEO A;  3FSX A;  1TR0 A;  1U0H B;  3CCW A;  1KLM B;  4AFF A;  1FHT A;  3DYA B;  4GKJ J;  4WP8 A;  1RKI A;  3N28 A;  4DL4 A;  4WF9 Q;  3C66 A;  4P7V A;  4LMZ A;  2KJW A;  4X4R A;  4IR1 A;  3GCW P;  1T03 B;  2FZG B;  5AE2 A;  2J6T A;  1CS4 B;  3N6N A;  4NZ7 A;  2DRD A;  4AE5 A;  2WCX A;  1JLG A;  4IDK B;  1QVF R;  5J2M B;  4G1Q B;  1VBY A;  2XWY A;  5DQI A;  3SIP B;  3HT3 A;  4LSL A;  3TJA A;  1FCA A;  3QGG A;  4B9U A;  3GJQ B;  2HWT A;  3GJT B;  3MPU B;  1RLD A;  4DMZ A;  2AF6 A;  4X4P A;  2MGZ B;  4J7C A;  2WON B;  2VHG A;  5KFB A;  3G6X A;  1PYS B;  4CYU A;  1BY9 A;  5L9X A;  5KFD A;  1F9H A;  1QAY A;  5GMK a;  1HI8 A;  3QNW B;  3CJ8 A;  3DN9 A;  4LQ3 A;  1NPR A;  3PW5 A;  3MR3 A;  4OX8 A;  4JBC A;  2GHP A;  3V6J A;  1C1B A;  4ECV A;  5KOX A;  4DR5 J;  4KH1 B;  3CUN A;  2LEA A;  5B0C A;  3PZP A;  2F7V A;  4TKT A;  2W2P P;  2Q66 A;  1F9F A;  4EGL A;  3LW5 C;  3CO9 A;  3CPW R;  2W9B A;  1KTQ A;  4NPO A;  4QU6 A;  2LQ9 A;  3W2V B;  2IDE A;  3U1L A;  3QT6 A;  3HZE A;  4G1I A;  1NB7 A;  3M8Q B;  3BKT A;  2ABY A;  2H1Y A;  1QAX A;  3RAQ A;  4HAC B;  2A10 A;  2CQ0 A;  4RNM A;  1RIS A;  2HRT A;  4J90 A;  3Q8Y A;  5KFX A;  2R2S A;  5BR8 F;  1FRI A;  2AYB A;  4CLZ A;  4AND A;  1RT1 B;  2D7S A;  2VFS A;  2PE8 A;  4R5P A;  4ED7 A;  2DEI A;  4KBI A;  5CYQ A;  3TAQ A;  3HHL D;  3OSN A;  1M5P C;  2H9Z A;  2XMJ A;  3CTR A;  1HHQ A;  1T7P A;  3HHL B;  3DXB A;  4DV6 F;  5LMU J;  2KHD A;  1ZET A;  3R5J B;  3F41 A;  4GVB B;  1HNV B;  4CCH A;  3JSY A;  4HVZ A;  3HUL A;  3DM2 B;  3H25 A;  1I51 B;  1WI8 A;  2PSZ A;  4JI2 J;  4JI4 J;  3CB4 A;  2MZS A;  5A8K B;  2MHN A;  4RPF A;  2PMZ D;  4WFA Q;  3OPK A;  2PMH A;  1FWL A;  2IVY A;  3W60 A;  1RXO B;  4CH1 A;  4CO4 A;  1TKD A;  2XLK A;  2EK6 A;  3M7V A;  3SQO P;  2I2Y A;  1UW4 A;  1P8G A;  2PA8 D;  2HWH A;  4P9S A;  5A8R B;  2R8K A;  2WBM A;  3ZZR A;  1JXV A;  1R3N A;  4ZPV R;  2B8P A;  1EET B;  4K4X A;  2N82 B;  2JEI A;  1SC6 A;  2APO A;  4J9P A;  5HVH A;  2ZKT A;  1C2P A;  4QOT A;  4K0K F;  2AX0 A;  2GIR A;  4LSN B;  2FJW A;  2WRM A;  2XHC A;  2JVO A;  2WW8 A;  4LBH A;  2C1E B;  4OX7 A;  4EFA C;  1D9F A;  2NQP A;  3UR3 C;  1U02 A;  1NSK L;  3ILI A;  3T1H F;  3UCZ P;  1BQN B;  5GAD U;  1R8P A;  4ED2 A;  2IMO A;  2EG1 A;  3P8B B;  3J81 U;  3PX0 A;  4DV3 J;  5EX3 A;  2RS8 A;  4F0K A;  2VQE J;  1WDD A;  2WVE A;  4MYT A;  1KVI A;  2IC3 A;  1LWF B;  4NLR A;  5HVF A;  4HEA 9;  2XYG B;  3ZC4 A;  2VKR A;  3PEH A;  5CYM B;  4ETX A;  2UXB F;  2EXU A;  4CO3 A;  2XS7 A;  2W9A A;  4KRW A;  3PAC A;  4AQY F;  3HHN B;  4TU7 A;  2W4P A;  3KLH B;  4YUD A;  4DPO A;  4DR4 F;  1FEH A;  3R8Y A;  1VQL S;  3RB0 A;  5CHC B;  8AT1 B;  3QYY A;  2EFQ A;  2YQ3 A;  3UDE A;  4Y2C A;  4DFK A;  1M1G A;  1GXL A;  3BBF A;  1XR5 A;  4HLB A;  1JKH B;  4R0E A;  1VBZ A;  1NK7 A;  1MN9 A;  3DI6 B;  4LSZ B;  1SQF A;  1S12 A;  2QFJ A;  1G3O A;  3BBB A;  4W92 B;  3LF0 A;  2A6O A;  2UUW A;  3BDP A;  2ADC A;  3QSI A;  2V9W A;  3UD5 A;  3SCI E;  2AJ0 A;  2L41 A;  2CPD A;  2QE5 A;  2Y1R I;  3DLL Q;  3W64 A;  3BKF A;  1RT5 A;  1T0T V;  1UVM A;  3LAL A;  2AIR B;  4FYD A;  1RAA B;  2OUG A;  1REV A;  2K7J A;  5D4O A;  3ONQ A;  1DLO A;  2B56 A;  4MIB A;  2W8L A;  4ELV A;  3BYR A;  4CQ1 A;  4C0H A;  3LH2 S;  3JTN A;  3NP5 A;  4ZVU B;  2MQN A;  2CQ2 A;  2MJN A;  2V50 A;  2E9Z A;  3KWM A;  2MYF A;  1W2B R;  2QTW A;  2UXB J;  4URS A;  3GFZ A;  4U8V A;  1VQ8 S;  1O6X A;  4KV8 B;  3MM6 A;  1FXR A;  3AD8 C;  4ICL B;  3MCS A;  4F4A A;  2MXY A;  3AY0 A;  3G4S S;  1UFK A;  4LF5 J;  1UVI A;  4QWB A;  1LWE A;  2XG8 A;  1RWO B;  4Q8F A;  2ZOG A;  4ID5 A;  1ZS6 A;  5DO2 A;  3VWS A;  4HI2 A;  2FJA B;  1XMQ F;  2OPS B;  4PUO B;  2DGV A;  4LRE A;  2CQD A;  3C3L A;  4J91 A;  4DS4 A;  4HYK A;  5KFW A;  4M63 A;  1WUU A;  3CDA A;  3EYZ A;  3J7A N;  1HL6 A;  5LJ3 Y;  4ZLJ A;  1KP6 A;  3GG0 A;  2LMI A;  1NJI T;  1ICE B;  3NCP A;  3FQK A;  2ZBC A;  2H5J B;  4C8Y A;  3L95 X;  2VBZ A;  3G8S A;  1P27 B;  3HXM A;  1GX5 A;  1S1U B;  1S77 D;  1WAC A;  3C6T A;  3DLG B;  2UUB F;  4QZV B;  4YME A;  4WIQ A;  1DTQ A;  1MG7 A;  3Q0A A;  5K14 B;  4QPT A;  2WVC A;  1N4L A;  4KC5 A;  3D67 A;  1HBO A;  2VPY B;  3KMS A;  1H73 A;  2A6M A;  5B0D A;  5BJR A;  4UY8 5;  4Q0B A;  4YEA A;  4KPC A;  1VRT B;  2J8S A;  1XNQ F;  3HHD A;  2O3D A;  3L9Z A;  2XCP A;  2DR7 A;  1C0U B;  5D4L A;  5J2N A;  3FK4 A;  4LRC A;  3FCW A;  1SJ4 P;  1LK7 A;  2M0G B;  3ENQ A;  5CAB A;  4MIA A;  3EXY A;  3THP A;  3DGP A;  3TVY A;  3EIC A;  1N34 J;  3DLB A;  3RR8 A;  2DJW A;  4A8Y A;  1FNO A;  4USM A;  2DPJ A;  3D68 A;  1T05 A;  4ZJO A;  5D4P A;  2YNF A;  4P52 A;  2G2Y A;  2FGC A;  1SJ1 A;  3I55 S;  3EMT A;  1L3K A;  2P9C A;  1NPP A;  2W7P A;  2YNI A;  1AB8 A;  2HQ3 A;  1FX2 A;  4M5M A;  3KHL A;  1FT8 A;  3R5B A;  4MAK A;  3JQJ A;  1WG5 A;  3FKB A;  3IM9 A;  1SH2 A;  1QSY A;  4FKY A;  4OYB A;  3PNI A;  3BB5 A;  3I0S B;  3KJQ B;  1GXT A;  4DUY F;  2E7W A;  2YKA A;  1RWP B;  4QWE A;  3B8H A;  3OFG A;  3MAQ A;  2GVD A;  4H4K A;  1NSQ A;  2OEJ A;  3B6B A;  2KXN B;  2VDH A;  1RCO B;  2FVR A;  5FII A;  1TKZ B;  3T5J A;  3RB3 A;  3PHE A;  1URR A;  3HSZ A;  3EZO A;  2RQC A;  4B3T F;  2XCA A;  4GMK A;  3TAN A;  2V2V A;  3IR7 B;  1G2E A;  1JNR B;  4C8M A;  1NCL A;  1S99 A;  2UV8 A;  2YKP A;  1OYD A;  4WE1 B;  2QN6 B;  1LW2 A;  1BQM A;  1K1S A;  3M6V A;  2HGN A;  1YHQ S;  4DN9 A;  4DPY A;  5F8N A;  1R8H A;  1WSR A;  2I0X A;  1IKV B;  4RW4 A;  3NS6 A;  2BVZ A;  2BYC A;  1S9G B;  3E2E A;  2YPY A;  3SEO A;  5FLX Y;  3OBI A;  4DOZ A;  2AJ4 A;  2DGT A;  3CJR A;  2VBW A;  3J7Y I;  3DOL A;  3IS9 B;  4U67 Q;  3SQG B;  2B43 A;  2ZUA A;  4NLW A;  1Y5N B;  3Q8Q B;  3HVR A;  3QIP A;  1Q95 G;  5DG9 A;  2UXC F;  3MUR P;  1RTJ B;  3LOU A;  5AE3 A;  4PWD A;  1IKW A;  3M9O B;  1P9Y A;  3O44 A;  2KM8 B;  4ITS A;  1YJU A;  4KGK A;  5ETM A;  4PAA A;  1F60 B;  5KG3 A;  2YKN B;  4Y34 A;  3VGV A;  3CD7 A;  3I96 A;  4YHH J;  4ERD A;  3JSM A;  2MQP A;  1FRM A;  3CCJ S;  4UST A;  1JWW A;  3MEE B;  4OZ0 A;  1MRO A;  4FS1 A;  4OI4 A;  1VLO A;  5BYS A;  1C4C A;  4I2P B;  1JLG B;  2VU5 A;  2DR8 A;  2LFV A;  3QSY B;  1RDR A;  5E5N A;  1TKT B;  1Q82 T;  1YLX A;  4KE5 A;  5A6W A;  3VHQ A;  2C2O B;  1DTT A;  4URQ U;  1EAY C;  4LR8 A;  4IO9 Q;  4LF9 J;  1BXN A;  2HW3 A;  4U7U K;  3I31 A;  2AYG A;  1HYS A;  2VPW B;  4XDD A;  3D1O A;  2EVZ A;  4LIW A;  5E3P A;  1Q4R A;  2DIV A;  3DDK A;  3JSB A;  4WKR A;  2POK A;  4TVA B;  1ZH5 A;  3G6E S;  1Y9O A;  5F9N A;  2D9O A;  1DQ9 A;  1HW9 A;  5MLC V;  1HQU B;  2MKI A;  2BZ2 A;  5H9F J;  2CZ9 A;  2WOM A;  4TQR A;  5DQG A;  2DNM A;  4ZVT B;  4N7T A;  3TQE A;  3K17 A;  4CIO A;  1TP7 A;  4C11 A;  1U8S A;  5E3A A;  2DR6 A;  4BS2 A;  3OJS A;  1Q53 A;  2XB2 D;  2DXF A;  3ULH A;  1PCA A;  3H7H B;  2M8D B;  4JI3 F;  2YWW A;  4Q8E A;  4RWW A;  1LKZ A;  4ATN A;  2N3O A;  2VB6 A;  1H2V Z;  3KG0 A;  1ZM2 A;  2W9B B;  2W9C A;  5DGB A;  3O5T B;  1WF1 A;  4DZ6 A;  4TYB A;  4CO2 A;  1WTB A;  2DGS A;  3UN3 A;  4IQX A;  3E51 A;  2ATL A;  5KG4 A;  1A7G E;  3KJN B;  3QO9 A;  2JH3 A;  2ERR A;  3X1L B;  4OMF G;  1VDH A;  3BF4 A;  1C0T B;  3VV2 B;  3PW7 A;  3M8Z A;  3HFZ B;  4R8U B;  4PRF A;  2CPE A;  4K2J A;  3MOJ B;  2FZC B;  4A46 A;  3MZI A;  4B3M F;  5D0R A;  1R8B A;  1AFI A;  4DQR A;  4KPY A;  3NGK A;  2X1A A;  3JSR A;  3NGS A;  3PW0 A;  4WPA A;  1SJ3 P;  2JWN A;  2NYI A;  1G6B A;  2YQ1 A;  3I0R A;  4PG4 A;  1TAU A;  1Q0N A;  3CJQ A;  3KLG A;  4RNF A;  5IT0 A;  4B17 A;  2H51 B;  1LV5 A;  1E6V B;  1JQG A;  4J9K A;  4H54 A;  4L3N A;  1U09 A;  2VH7 A;  3JQM A;  3TZY A;  3T9Z A;  5EGY A;  2DO0 A;  2BW7 A;  1T95 A;  5ETT A;  3DNC A;  3K59 A;  2CZV C;  1SC1 B;  1OPZ A;  3G2X A;  4ES1 A;  4O3R A;  3TRG A;  1AZS A;  1S7H A;  3LAN A;  3LGH A;  1U2F A;  4N8O A;  3UWT A;  3NKY A;  1IXK A;  2UZA A;  1HPZ A;  1UWB A;  3JTP A;  4MK7 A;  4HH0 A;  4NA1 A;  2FDN A;  3N4W A;  2ROE A;  5IM0 A;  3KK3 B;  1VQ9 S;  1EKR A;  2AJ2 A;  4J37 A;  3VGS A;  2HHH J;  2OEL A;  1HBM B;  3BZQ A;  2UVW A;  2VOO A;  3N5F A;  1RI7 A;  3OQ2 A;  3UQS A;  3VTI A;  2A2D A;  3I32 A;  1TMJ A;  2E5H A;  2JHE A;  2NS1 B;  3HFV A;  4CM0 A;  2ZM6 J;  2DNZ A;  1S1X A;  2HGM A;  3QT8 A;  3AHP A;  2XY7 A;  4F4W A;  3TP2 A;  2ZKU A;  2V8D A;  5CYJ A;  4YR0 A;  4YR2 A;  3NXZ A;  4MK9 A;  2BM1 A;  2C3P A;  2FJX A;  1HBN A;  5KT7 A;  1WKK A;  1FKP A;  2U2F A;  4O44 B;  3RBE A;  3CCZ A;  3AAW B;  3NGD A;  4K4S A;  3ZZZ A;  4CRJ A;  2IC3 B;  3N6L A;  5DM7 Q;  4TN2 A;  4NI2 A;  4YDX A;  3MUT P;  3PX4 A;  3RAM A;  1CJU B;  3B4M A;  3KLF B;  1NKB A;  1VYA A;  1J5O B;  2J9D A;  4RW8 B;  1LW0 A;  1KVK A;  2W2Q P;  2OD6 A;  1HNI A;  4A8Q A;  5J1E B;  4NLY A; 
#chains in the Genus database with same CATH homology
 2F4F A;  2XO6 A;  2A6O A;  2A6M A;  2FYX A;  2VJV A;  4ER8 A;  2EC2 A;  2XMA A;  2XM3 A;  2VJU A;  2XQC A;  2VHG A;  2F5G A;  2VIC A;  2VIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...