1WHYA

Solution structure of the rna recognition motif from hypothetical rna binding protein bc052180
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
97
structure length
97
Chain Sequence
GSSGSSGKIGYGKANPTTRLWVGGLGPNTSLAALAREFDRFGSIRTIDHVKGDSFAYIQYESLDAAQAACAKMRGFPLGGPDRRLRVDFAKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RNA recognition motif from hypothetical RNA binding protein BC052180
rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords hypothetical protein RIKEN cDNA 1810017N16
total genus 7
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1whyA01
1VQ5S 2DIVA 3FEYB 1AUDA 2UP1A 2LMIA 3LQVA 1D8ZA 2MKCA 3UE2A 2A3JA 2F3JA 5IFMA 4LMZA 1VC0A 2MQMA 1UAWA 2ZJPQ 1URNA 1U6FA 1WG4A 2J0QD 2N7CA 4EGLA 3B4MA 3OW2R 5LJ5Y 2KXFA 2DHAA 4WCEQ 2RQ4A 5JVGQ 1ZH5A 2XNQA 3CUNA 1YITS 3ZZYA 1Q86T 5DM7Q 2LECA 3S01A 1M5OC 2D3OR 1M1KT 2CQIA 2OSRA 2LKZA 2Q79A 2KG1A 1PGZA 4Y00A 4F25A 2JRSA 5DDRC 5JVHQ 4RU2A 2CPDA 3MUVP 3R1LA 1CVJA 5DDOC 2MKIA 1JMTA 2DH8A 3NNAA 2SXLA 4IO9Q 1WG1A 1U1RA 2HGMA 5DM6Q 2CQDA 5GMKa 3MOJB 4FXVA 2KFYA 2J0SD 3D2WA 3EGZA 2FC8A 4F02A 1U1LA 5IM0B 2MQQA 2DGTA 2KVIA 1WF1A 2YH0A 4OZ0A 3S8SA 1R8PA 2G4BA 2KU7A 3L3CA 2J8AA 2K3KA 2M9KA 4YB1P 1WTBA 2CJKA 2AD9A 4J5OA 3NMRA 4PRFA 4U67Q 4PKDB 2J76E 1DRZA 2VONA 2DGVA 1YWXA 1X4EA 4LJMA 2MGZB 3G9CA 2DNRA 1YIJS 1X4FA 2KRBA 4QPTA 5DETA 2LEBA 3LPYA 2MY7A 2MZRA 2F9DA 2RQCA 2WBRA 3MDFA 4V19X 1VQ6S 3S7RA 1U1NA 2O3DA 5IQQA 1H6KX 2L41A 2X1FA 2KRRA 1L3KA 1NO8A 2DK2A 2PE8A 2KN4A 2M8HA 3PIPQ 1WEZA 2KXHA 2CPFA 2N3OA 2BZ2A 3MD1A 1WF2A 2MZ1A 2G1DA 2MZTA 2KHCA 2E5HA 2DITA 2RS2A 1VQPS 1VBYA 2DNPA 1U1QA 1YJ9S 3CC4S 3CCVS 2F9JA 2DO0A 2LA4A 2RVJA 1SJ4P 2ADBA 1NU4A 1H2TZ 1N88A 1OO0B 5HL7Q 1Q81T 2L9WA 3R27A 3SDEB 2OSQA 4QU7A 3SMZA 3VF0B 1U1PA 2E5IA 5D78A 1X5SA 1X4HA 2CQPA 3IRWP 3THPA 4P6QA 3EGNA 4YUDA 1K8AT 5H1SV 3Q2TC 1H2VZ 3B4DA 3CCSS 5CXTA 2OJ3A 4LIRA 2X1AA 5GAGU 3G8TA 2HVZA 3Q2SC 3UWTA 1B7FA 1WI8A 2MZQA 1SJ3P 2JX2A 4QQBA 2CPEA 3P5TL 3SDEA 1NJIT 5CA5A 3CD6S 2XNRA 1YTYA 3MUTP 4ERDA 3ZZZA 2CPZA 4BS2A 5DDPC 2OTJS 1M90T 2MKSA 2MSSA 5FJ4A 2CQ4A 4TU9A 4WKRA 3TP2A 2G0CA 2DNQA 3HHNB 2MGZA 2LA6A 1HD1A 1F9FA 3TYTA 2M2BA 3IWNC 1ZZNA 4M5DB 3CCQS 2YH1A 2PEHA 2RUGA 2OIHA 3UCUP 5MLCV 2NZ4A 2X1BA 3VAKA 2QEXS 2FHOB 3J7YU 1SJFA 1WG5A 4OZ1A 3CCES 3VAMA 2M52A 2N3LA 1PO6A 1DZ5A 2D9OA 2LQ5A 5IM0A 4WFBQ 1G2EA 5HO4A 2HGNA 2DGWA 4F26A 2MKJA 1YHQS 2HYIB 1X5TA 2DGSA 2M88A 1K73T 1WEXA 2DNLA 1VQOS 1U1MA 2EK6A 2MQPA 1DBDA 2RNEA 3U1LA 2RS8A 2MJUA 2MJNA 3MURP 1HL6A 2DNHA 2KI2A 2XS7A 2CQ3A 1SJRA 1VQMS 4WIIA 2MPUA 1QVGR 5LJ3Y 3DLLQ 1SXLA 1RKJA 2XSFA 2DNOA 2M0GB 2NLWA 1YJNS 2DISA 2MXYA 1FXLA 3UD4P 2CPXA 2CQHA 5DDQC 2BOPA 5EN1A 5GADU 1WF0A 2DNYA 3EX7B 3VAJA 2DO4A 1BY9A 2CQBA 2CQ2A 1WI6A 3G4SS 1FJCA 3UCGA 4W90B 3BEGB 2LYVA 1M5VC 1HA1A 4TLQA 2HZCA 2DHXA 2KH9A 2DIUA 1U2FA 2AYGA 2EVZA 1O0PA 2ERRA 2AYMA 2JVOA 1P27B 1FHTA 2YTCA 2M70A 1KD1T 4ED5A 1N8RT 1X4CA 1WHXA 4CH1A 1WHYA 2LCWA 2YWKA 3CF5Q 1DHMA 1JJ4A 3NNHA 1RK8A 2CPHA 3NS6A 5LSLA 1X4DA 3I55S 4WFAQ 3CMES 1H2UX 3MD3A 2MQOA 2FPHX 5BJRA 3JB9k 2YKAA 2CPIA 2DHSA 2DGXA 1N52B 1M5PC 2MQLA 3PIOQ 2KG0A 2DNKA 1X4AA 1VBXA 1U6BA 1VQNS 3CPWR 2MY8A 1M5KC 4WFNQ 4CH0S 2XS5A 1KOOA 2DGQA 2CQGA 1VQKS 1P1TA 3SXLA 1WHVA 4C4WA 1VQ4S 1FJEB 3H2VE 3P49B 2XS2A 2M7SA 2E5GA 2GHPA 2JWNA 1S79A 1ZZFA 2DH7A 1YI2S 2VODA 1VQ8S 1R8HA 1K9MT 2QA4S 4IOCQ 2MYFA 4WF9Q 2MZSA 3G96A 3DXBA 3BS9A 1SJQA 2L08A 4C0OC 1JJ2R 2I38A 1HD0A 5GAHU 1WELA 2QFJA 1OWXA 2DNNA 4UQTA 3CCJS 1YJWS 3CCRS 3CCLS 2AYBA 1KC8T 3G8SA 2FC9A 2OTLS 3U1MA 1X5PA 2ZJQQ 1U1OA 2CQCA 2HGLA 1Q82T 1VQLS 2MMYA 4UY8T 2KM8C 3BO2A 4PR6A 3CC7S 3K0JA 1A7GE 1U1KA 2GO9A 2DNGA 1VQ7S 2D9PA 2FY1A 3CXCR 2JVRA 1KQSR 2KT5A 3H2UB 2DHGA 2DNMA 3P3DA 1WWHA 2MZJA 5LSOA 3VAGA 1X4BA 2KYXA 2U1AA 5GVQA 4A8XA 2N82B 1UP1A 1WHWA 3UCZP 3MI7X 3MXHP 3I56S 5GAEU 2I2YA 2E44A 1N54B 2M8DB 1FJ7A 4CQ1A 1X5OA 1W2BR 3RW7A 3G6ES 3ULHA 2MHNA 2VOOA 2LXIA 2RRBA 1XN9A 2LEAA 3S6EA 3G71S 1VBZA 1Q7YT 3CULA 2XB2D 2MQNA 1D9AA 2B0GA 2RT3A 3CCMS 1FNXH 1QVFR 1IQTA 1KOHA 1VC5A 5CYJA 2KM8B 2MB0B 4W92B 1FO1A 1VQ9S 2V94A 2CQ0A 1OPIA 5LXYA 3TO8A 4IUFA 2M4MA 3CCUS 1A9NB 3VAHA 3RW6A 2VOPA 3CC2S 3FEXB 2DNZA 3VAIA 3HI9A 4FXWA 3US5A 1JJHA 1UW4A 2DGOA 5LXRA 3J7ZT 4TU7A 2ZJRQ 4C7QA 1OIAA 2X1GA 3UD3P 2K8GA 2LXUA 2DH9A 4Y0FA 3VALA 3NS5A 3P6YC 2CPJA 2EK1A 1VC6A 4YOEA 1FT8A 2U2FA 2MKKA 3N9UC 2CPYA 4CIOA 2DGUA 2AYEA 3BO3A 3BO4A 4Z2XA 4QU6A 4IOAQ 2CQ1A 2RRAA 1UFWA 2MSTA 3THTA 2DB1A 2RU3A 4TU8A 3CMAS 1X0FA 2ADCA 1X4GA 3R1HA 1QM9A 2KXNB 5ITHA 5D77A 3V4MA 4ZKAA 2MKHA 3MUMP 1WEYA 3VAFA 1S72S 2E5JA 3CTRA 3NNCA
chains in the Genus database with same CATH superfamily
1NSAA 2K7KA 3W2WB 3GSIA 2V0NA 1PJ5A 3DRPB 1HWUA 2GMLA 2RE1A 3AOAA 5AXLA 4DV1J 3FEYB 2IMWP 3KTQA 4G3IA 2LMIA 5THWA 1Y5NB 4ECZA 3OFEA 2HQCA 3K8WA 1WKLA 3C6TA 2BX6A 4X84A 3ZZRA 2YWFA 1LWFA 1URNA 1KKHA 2VDIA 4YB5A 2HS3A 2QFIA 1S0OA 2PFFB 5E3QA 4F67A 1UEUA 4XDCA 2KXFA 4DR7F 3I0SA 1NK4A 4BDPA 4ED3A 3MTKA 4DR7J 2G2YA 3QWPA 3V2UC 4H4MA 1BQXA 4NYOA 3CUNA 4ED6A 2J0XA 1Q86T 1FX4A 3Q8SB 3S01A 1M1KT 3BSNA 1RWKB 4Q0BA 2V4JB 3IR7B 3FKBA 3BBBA 2KG1A 4ED0A 3DLEA 3QFHA 3K5NA 2Q6CA 3UN2A 1VIOA 4ZJLA 3K5LA 2P6TA 3GQCA 4NXNF 3R1LA 4Q8EA 3WZ0A 2OPPA 3KLGA 1IUJA 1O6XA 1HBUB 3KKFA 2QN6B 1NK8A 4TNOA 1WC6A 1EIYB 3NNAA 1CJVB 5KFSA 1AZSB 2CVEA 1RTJA 4KKOB 5HLFA 2IBKA 4D3GA 4P74A 1F3FA 3AJDA 1HBUA 3AOCA 4RUHA 4ZCMA 4IO9Q 4KGVB 2P9CA 1U25A 4I7FB 4J9OA 1NK5A 2R7QA 5HMYA 3W63A 4QPXA 1TL1B 4E8UA 2J9EA 4DEZA 4ID5B 5A6PA 4OYAA 1UETA 1S9GB 5F8HA 3M9MB 3D2WA 4DV5J 4ER8A 2BJ8A 4A8KA 2BBEA 3QATA 4LF6J 4F02A 1S9GA 4KE5A 3KLHA 1R8BA 1S6PA 1WF1A 2KVIA 2L9NA 2OEKA 1O8BA 2ZNZA 3PCOB 4OZ0A 1R8PA 2CXEA 2B9YA 2O5DA 4WU2A 2KU7A 3L3CA 3GV7B 2HBYB 3MPWA 4RW8B 5DO2A 4ZDNA 1FEEA 3HKZD 2AD9A 1LFPA 2V34A 3DC2A 3MMAB 3P45B 3PVXA 1FKOA 2AKWB 2XSJA 4HR2A 3KLIA 3QZ7A 2AJQA 3DYAB 5J1EA 3PW0A 4LFCJ 1S7IA 1DRZA 2CKWA 2I0XA 1B0PA 3Q8VA 2CNOB 2HS4A 2KL8A 3KJQB 2AZ1A 3QJJA 1UVMA 2MGZB 4RW9B 3G9CA 2JZ5A 3X3UA 4DR2F 5K20B 4OYMA 3A13A 4J7CA 3DRPA 3N6NA 4KFBB 1R0AB 4OI2A 5DETA 4DSEA 4DFJA 1RU1A 4DV7J 1BLUA 2V67A 2F7VA 1ZA1B 2HIQA 2ASDA 1TUWA 1SH3A 1TL7A 4PYDA 1U48A 3UN3A 2PI5A 3QFWA 1JLQA 1WUUA 4IDKB 2DTJA 2WBRA 2X3DA 3QAEA 3GR0A 2LP4A 2AX1A 4XK8C 3MPYA 1U1NA 2FJEB 5D3GB 2GZOA 2O1PA 3LOUA 2L41A 2IM1A 3PDNA 1VK3A 2M5YA 3R5BA 3FNNA 2PE8A 2GAGC 3ZTPA 3T1HF 2FVRA 4N8NA 2ZHBA 2M8HA 4ANDA 4PXDA 1REVB 3RBXA 4CLLA 5AJ3J 3IFEA 1N56A 3M8SA 4FYXB 1Z2LA 1WNEA 4G1QB 1V6HA 1KP6A 4EFAC 4FPRA 2RDJA 3PJWA 2FHKA 2OHDA 3EICA 3AAWB 1JLBA 4N47A 4DN9A 2VBZA 1WF2A 3SCIE 2G1DA 1C1BA 2C1EB 2KHCA 2DITA 4H4KC 3FDSA 2YNGA 2DNPA 2NXEA 2Y1IA 2NYHA 4RL1A 2GIRA 3OTOF 4DCOB 3H5YA 2UXCF 2QA1A 1YZ7A 4EZ9A 2BUNA 4ZVFA 1PSDA 3RRHA 4RWXA 2HVHA 2B4PA 1JLGB 4ED8A 4M95A 3ELHA 2RVJA 5F0WA 1EETB 4IFVA 2ADBA 2H4WB 5KFYA 3BQ2A 1V5VA 3IBWA 1OO0B 1LXJA 3A8JA 3HVTA 3W7BA 4EBDA 3C46A 1NUEA 2OSQA 4MYUA 3W62A 3VGTA 2RMLA 1H98A 2VHGA 4QU7A 2BANA 2OO4A 3HHLC 4IO1A 1U1PA 1HNZJ 1X4HA 2CQPA 4O23A 4ZMMA 5C7PA 2V4RA 4W98A 1WC4A 4P6QA 2ZDPA 4MT1A 2J7WA 1HPZA 3Q2TC 5SUHA 3CCSS 1WDDA 3IR6B 3RTVA 2IM3A 4LIRA 3T5HA 4X4OA 4GVBA 4URQU 2HVZA 3AXKA 4OZ5A 5D0GA 2HHVA 2K1RB 1QSYA 4MH8A 3UWTA 1XNRJ 3K17A 3MF5A 2MZQA 1XERA 2AF6A 4FNHA 4LF1A 3IWXA 5ETRA 1RHRB 3CJKA 2IHR1 4PG8A 3OL7A 2CPEA 3V6KA 4B9LA 2B56A 1RT2A 2XNRA 3NAHA 4DUTA 2CDQA 2QMWA 2E29A 5I3UA 1I1GA 1SIZA 4RJVA 2MKSA 3G87A 1UEVA 2MSSA 3TZXA 3GILA 3H4BA 4XO0A 4F4WA 4GRSA 4FF2A 5FJ4A 2ZHAA 2CQ4A 4TU9A 3OTOJ 2HS0A 3CJ3A 5D4PA 1RT3A 4DSJA 1R8AA 5BYRA 1VFJA 3A8IA 1B0VA 3TP2A 4X65J 1EAYC 1RT4A 1J5OB 3RAXA 1NRKA 2ZH9A 2Q3PA 2VFTA 2PFDA 3D0IE 1R6VA 5B0AA 5J2NA 2AU0A 1HNZF 3GIIA 1F9FA 1ZM2A 2BANB 3B82A 3MGJA 3GYGA 4FVCA 5D0EA 2ZH4A 1ZZNA 4EO6A 2QZ8A 5HQMA 3W8PA 2PEHA 1C0TA 2JFKA 2RUGA 4B02A 3UCUP 1J2VA 3H0PA 4USIA 1DTQA 4JI8J 3QJPA 5CYQA 3W5ZA 2GFFA 5KFMA 5SZTA 3QO9B 1UJ4A 4FPIA 4NLXA 2CJQA 4J9SA 4F04B 3MM9B 4CRJA 1G1XA 4OZ1A 2LDIA 3LWLA 2OPRB 2VC1A 2VG5A 2W9BB 2N3LA 3VAMA 1QSSA 4LFAJ 2OH2A 2DCUB 1OY8A 1REGX 2LQ5A 2XY5A 2ASLA 1JX4A 2G0JA 1SKRA 2HGNA 2HYIB 3O8WA 1FXDA 2M88A 1K73T 5D15A 4QYZK 3ZTSA 2DRDA 4IR9A 3NAIA 2E1CA 4LF4F 2Y9HA 3DI6B 2MQPA 1IKYA 2DT9A 3C14A 3N5FA 4H4OB 1RT6B 4A8SA 3V6HA 5H9EK 4HHJA 4PPDA 3QRPA 3PNIA 1CULB 4B17A 3OVAA 3KHRA 3DDIA 4DN0A 2MJNA 5CZXA 4O3OA 4CO1A 3MURP 2HFUA 1HL6A 3KHGA 1TKTB 4ECXA 3KK1A 4F3OA 2CQ3A 1S9FA 5L8RC 2YVSA 1VQMS 5IT9Y 2DCLA 5LJ3Y 3DLLQ 1U0HA 2YWEA 4PUOB 1EETA 1KVKA 2VBYA 4IFVB 1FK9A 4OI3A 1S1VA 4UOCA 2G1HA 5FD1A 5HBMB 4OFZA 2M0GB 3K58A 1YJNS 3CMQA 1I6JA 2V9KA 4V1Ak 2KKHA 2E7WA 2KVQE 2CQHA 1N5TA 2OFGX 2R42A 5DDQC 5GADI 1NEEA 2VH7A 5A76A 1Z4UA 2HW3A 1TU0B 2ZBQA 2B4OA 3VAJA 1TFYA 2CQ2A 3V6DA 4K4WA 1WI6A 4Y2KA 3BQ0A 4DBQA 5CABA 2Y8WA 2ASJA 5D8HB 5HVGA 3BEGB 1VLYA 4C8OA 1V3ZA 1HW9A 4DHVA 3OL6A 4WFXA 1HA1A 2C2DA 2CWKA 2O66A 3PR5B 2DHXA 4PABA 2JJ4D 3HHDA 5CHCB 2GGPB 6FDRA 4K0KJ 3DLJA 3PYEA 1TMMA 5HLFB 4X66F 2IJRA 2LU2A 1CJVA 1IBKJ 1AFJA 2AYMA 3GFHA 2JVOA 1P9QC 4WZQA 4ZP8A 2V8HA 3TW0A 2UUWA 3JSRA 4RUCA 1N8RT 4ED5A 4AXJA 1WHXA 3SFUA 3NGKA 5A2QY 4C3KA 3F73A 2BV3A 4CH1A 4NLGA 4PUOA 2YKNA 4KGKA 1PAEX 4ZVQB 4B3TF 4WE1B 2BM1A 2ZOFA 4F2SA 1LK7A 3R7NB 1DHMA 1D1UA 3FBCA 1RK8A 2CPHA 4V19J 5LSLA 2EFGA 1TMJA 3Q8PB 1K44A 3I55S 2HMIB 3NEKA 3TARA 1RLDA 3O2IA 1HHSA 1S1WB 3L4BC 4PEOA 3WBZA 4CLYA 1EZZB 3H40A 1JLCA 3GTYX 3MD3A 1NXIA 4ZVUB 2BE2B 1ZAVA 2FPHX 2CJBA 5BJRA 2KZZA 1M0SA 1SCJB 1IQZA 2DHSA 2GMHA 4MIBA 4DSFA 2MQLA 3BKFA 3PY8A 1WC5A 2DNKA 3TZWA 2KG0A 5AXKA 3VZHA 3DLHA 1VQNS 5ETPA 1L3UA 1M5KC 2ILZA 1MU2A 1V3RA 3LP0B 4WTYA 2XS5A 1GX5A 2W8KA 2DGQA 1JKHA 2F8MA 4OJ1A 3CD0A 4ALZA 2ZITA 2GJIA 3DGPA 4NL5A 4USVA 4NYZA 2C3OA 3UD5A 4NLQA 4PQAA 1YSJA 3KJVA 2ZVSA 1TK8A 4LQ9A 4IG0A 1UPPA 2KO1A 2OKQA 4ENOA 3AQOA 2M7SA 4LRAA 1YBTA 3LTOA 3GJRB 3Q83A 1U26A 2VODA 4WK1A 1ZZFA 1JLFA 4KC5A 1R8HA 2H5JB 4AL7A 1S1VB 4X4SA 2C2RA 3GR1A 2QLJB 2QA4S 1LW0A 3DLGB 1MN7A 1N6QA 2MZSA 4KHRA 5AXNA 4ZPVR 1RHKB 2RRNA 1GMUA 1SQFA 1PYSB 1T0TV 1WACA 3R7BB 4F4YA 2BJ9A 1FJGJ 1S49A 1RBLA 1SJQA 2L08A 2VBXA 3GFYA 4N5SA 5EUHA 4LUBA 4Y2MA 3BYRA 4NI2A 4C0OC 1JJ2R 1XEZA 4U8YA 4A48A 5HMWA 2QIFA 3UR0A 2W4PA 3KLFB 1HD0A 2AGPA 1LKZA 4EMDA 1SH0A 3DDKA 1R8CA 2MEWA 3MEDB 4OHXA 3BPSP 2WW8A 5HVFA 2DXEA 3CCJS 2V2KA 4O4GB 2PD1A 1HMVB 2FB0A 3MAAA 4HYKA 2R8IA 2IIHA 3AY0A 3NGDA 3CCRS 2AYBA 3B78A 4K4YA 1AUSL 1KC8T 3FC9A 1HNXJ 4I2QA 4Q2MA 4BC7A 1K0TA 1GH8A 1TL3A 4PWDB 3I32A 1Z1ZA 2DY9A 1Q82T 4LVNP 5C2CA 3FSXA 3VVUA 4CT8A 1U4BA 1LNQA 1T9WA 2CADA 1YJRA 3BPDA 4XTTA 4OX9J 1NDKA 1MW7A 1NPRA 4NZ6A 2WTFA 2YKPA 2GO9A 2QO3A 3C6TB 3ZXWA 5GAHI 4UOHA 4IH6A 1XJWB 3AD9C 1N34F 1KQSR 4X4RA 3ZTQA 1FFGB 4JI2J 1Q8KA 5HN0A 1GXLA 3NGSA 2MZJA 4F8RA 1FRLA 4WXWA 3RR7A 1X4BA 1ZPVA 3KK2A 1LWEA 1Y7PA 2U1AA 5GVQA 2R7RA 2BE9B 2N82B 3GLJA 3HVWA 1N5VA 2BJ7A 4ID8A 4NCGA 1S77D 2VONA 1MWZA 1UP1A 6AT1B 1Q5YA 1R0CB 4YDXA 1XC9A 2VG6A 3UCZP 1JKHB 2H3EB 2WRMA 3DCAA 4B9SA 2V8GA 3ZO7A 1NAQA 2XG8A 2UUTA 1NCLA 4WIQA 2I2YA 3AJ1A 2CJYB 1NSQA 2HHWA 1MU2B 3OXGA 1QE1B 4CQ1A 4E0DA 1SI9A 1X5OA 3R7SB 2XMAA 1W2BR 1WC3A 1S0VA 3RW7A 4A8OA 3JYTB 3UQSA 1M1GA 3GONA 4RBTA 4WYWA 2NQPA 3G6ES 4LQ3A 3ULHA 5J2PA 2MHNA 2VOOA 1IVZA 4F4ZA 4F0MA 5HJYA 2LXIA 1REVA 2QG9B 2YNFB 4QIEA 3S6EA 1VRUB 5F9LA 3G71S 1YBUA 2FHMA 1XTZA 2LQBA 2HMIA 3I9ZA 1JLEA 1SQEA 3GG0A 3QIPB 1UZHA 3LALA 4KBIA 1FESA 2E1AA 1NHUA 4DLGA 1B0TA 1C2PA 2H1YA 3PRVA 2KTQA 1ITPA 2DXDA 5H9FK 1QVFR 2UXBJ 2IBOA 2OMLA 3WIVA 1IQTA 4EU0A 3DHWC 1GQEA 5D0HA 2HBRB 4WK3A 2UVWA 1XWLA 2IRXA 3LGHA 3LP1B 2YNHB 4K4UA 1OPIA 4L6V3 2XEXA 2XULA 3DYAA 5LMNF 4P9SA 2RILA 5U47A 1FKOB 1OJ4A 1X60A 5AXMA 3Q23A 1P6TA 2QTWA 4LBIA 2XCAA 3C2PA 5E2QA 3CCUS 4IUFA 3VAHA 3RW6A 5DS7A 1A9NB 4DU7A 2H4YB 4RW8A 4ED7A 2VOPA 3CC2S 2WK4A 3TI0A 2FVPA 3HI9A 2BQRA 3CB4A 3JAMY 2H65B 4HTJA 1E6VB 4N7TA 5FDLA 1UW4A 4HACB 4USJC 4WPAA 4ILMA 2OPSB 3S1TA 1U8SA 1IBLF 3MPDA 3J7ZT 3ISZA 2XWYA 4IRDA 5KG3A 5LL6d 1F5BA 3LP0A 3IBFB 3RBDA 1TL1A 1RWUA 2ZEJA 3BH7B 4B3OB 4IDKA 1RCOB 4RX6A 1UFKA 1FTCA 2BABA 2KHDA 4ZPAA 1FT8A 1BMQB 2XY7A 5KFFA 4UTGA 2AYEA 2VFUA 1RJJA 2FYXA 2GIQA 2EPIA 4HH1A 3BO4A 1F60B 3QT8A 2UUCF 4B3RF 3DRYA 1WC0A 1G7CB 2MSTA 1HBNB 4DL6A 3THTA 3W61A 3HMJG 2RU3A 1KONA 2QRRA 2A6MA 2XLIA 1FXRA 2RIJA 2Y1RI 5DRKA 3MTJA 4WFYA 4C2MA 2IPOB 3JAMU 2M3DA 1V5IB 1RWNB 4ZPTR 3O6QA 2E5LJ 3ENAA 1QM9A 2KXNB 4RU9A 5I42B 4XDDA 3T1AA 1WC1A 2HQGA 3OR2B 4ETZA 2R7XA 4O0IA 2MKHA 1WEYA 3BBFA 3OTEA 4DPOA 3KJFB 1IKWB 1LQ9A 3CTRA 4OI4A 5KFRA 1R7IA 3UDCA 2FGOA 2VA3A 4NA3A 4UF4A 4JI6F 1BQNB 2D1CA 1VQ5S 3KLEA 3UN5A 1DTQB 2ZUGA 2A6OA 2AJFE 1AUDA 3LQVA 4HACA 1RT1B 2UP1A 3UE2A 4U96A 2A3JA 2F3JA 5IFMA 3RBZA 5IXUA 2NYIA 2RF2B 1RAIB 2Z57B 3DXSX 4X64J 2MQMA 1UAWA 4P72A 5KT5A 4C3LA 2E9ZA 1WG4A 1Y9OA 5T14A 1T3OA 2VV5A 3G8QA 3HSJA 4I7FA 4G65A 1SUQA 4NLVA 1RT5A 3OL8A 4OX7A 4CO3A 2Z2YB 4I56A 1EQ0A 2OPQB 4KQZA 5JVGQ 1ZH5A 3DRRB 4QOTA 2F4VJ 1YITS 2JLGA 1RISA 4DV7F 2R2UA 3X1LB 4URGA 4F4XA 2DEJA 3CJTA 3MECB 5L9NA 2WONA 5K14B 2PI4A 1RTHB 2ALZA 4U9RA 3KJNB 5KFBA 1S1XA 3BR9A 3MCOA 1RT2B 3OFFA 4MKBA 3W9JA 3RRKA 2XMKA 4Y00A 1YDLA 1HWJA 3B6BA 4CO0A 5EX0A 4F25A 5DDRC 1Y11A 2CPDA 3CJKB 3V4IB 1AXQA 1NHVA 4RU2A 4KPYA 3CDUA 3MUVP 1VRUA 3FVYA 5F41A 4JV5J 5DDOC 1EB0A 1OSCA 2PGCA 1JMTA 2ZM6F 2UVVA 4LSNA 3D4JA 4U8VA 2VFSA 2DH8A 1NH7A 2ZD1B 1EARA 3BM7A 3TAMA 1HI8A 1IWAA 1ZM9A 4K7QA 5F9NA 4TQRA 5A8WA 1RBAA 5DM6Q 2NXJA 3GU0A 3THVA 4ZVGA 3V4IA 2CQDA 3FMWA 2WSEC 1OY6A 3QAUA 4FXVA 3MOJB 2IDLA 2XBPA 2J7KA 2A2CA 1U8WA 3T1YJ 1DAXA 1TR0A 3NP5A 5IM0B 2GO8A 2VBWA 4ECYA 1UCNA 4BLGA 5CCMA 2MQQA 2YH0A 3DRRA 4DV2J 2EFOA 1D8YA 2G4BA 4G1PA 1LWCA 2YQ1A 2J8AA 2K3KA 4YB1P 1SKWA 4LFAF 5KT7A 4B3SJ 2PEBA 4USUA 3OQ2A 4DR1F 3H8YA 4Q2LA 3K5OA 4PKDB 1VDHA 3HSGA 4IH5A 1SV5B 2DGVA 2IYGA 3IGVA 3T9NA 4CLWA 3F41A 2RF2A 2FZCB 4I1TA 4JI1J 1VS3A 2RJZA 3I82A 2HPUA 3R6LB 3EPGA 1IBMJ 4LBPA 4M5GA 2HRYA 2OD4A 1X4FA 2KRBA 4QPTA 5B0FA 3CJ0A 1RYSA 5E41A 4OI0A 1BWEA 4FP9A 2KFNA 2MY7A 4K4ZA 1AW0A 2JL9A 4FYWB 2LVWA 1T11A 1WSRA 2FDNA 1G6BA 3MDFA 5A0YA 2YX7A 1A0OB 1T05B 3CE8A 2Y3YA 3S7RA 1X9MA 2D41A 1T9VA 1H6KX 1CJUA 1VYAA 4OV6A 5D4OA 2X1FA 3DM2B 4CLSA 4EYIB 1S1XB 3MM8B 5KFOA 1DQ9A 4DR4F 2QV6A 3TAQA 4CYUB 1W26A 1JXEA 4C8NA 3RB4A 2KXHA 1S0NA 3CCTA 3HVTB 1N6QB 4NE9C 1I51B 3GV5B 3HM9A 3G6XA 3MD1A 1S76D 2FLPA 2XSJB 1WOPA 1LW0B 4IH7A 1GFWB 2CNKB 2HRUA 3CDBA 1VBYA 4ITSA 4YB7A 4DXLA 4KSEB 2I5JB 1U1QA 5DLFA 2H5EA 3CCVS 2F9JA 3OD2A 1FKAF 4Y2IA 2UXDF 1FRJA 2RU9A 5KG6A 5D4NA 3DN9A 4RLEA 1NJXA 3MEKA 4TY8A 3NWRA 4CI0B 4NLOA 3PHTA 5BYSA 2A2DA 4CCHA 4JI0J 2QYCA 1MN9A 3SMZA 3AD7C 4YY3F 4P2XA 2E5IA 2CG8A 1SC1B 5B0BA 1N5YB 2R7VA 4FVMA 4ICLB 4DL4A 4X62J 3J81j 4YUDA 2AW0A 5H1SV 4ZP9A 1UVIA 3B4DA 4GKKJ 2YNHA 3UDVA 1S59A 2ZUAA 9RUBA 2W7PA 2X1AA 1JLCB 2Z56B 1SIWB 1XR5A 3GP9A 2DRAA 2UUAJ 1FCAA 3C15A 3D0GE 1IKYB 4H4OA 5KFGA 4CO2A 3M30A 1NJIT 3H42A 3NCQA 5CA5A 1N5SA 2JHEA 4P52A 4O3NA 4OZJA 2W24A 4QWCA 1SL1A 1PILA 2FQQB 2I9SA 4Q8FA 2OPSA 4TY8B 4BS2A 1M90T 3A8EA 3WX4A 3W9HA 2DPJA 3MMBA 3TANA 2OPRA 2VG5B 2B9EA 5K8MA 1FKPA 1T9TA 2GGPA 3Q8QB 2G0CA 5C5JA 2DBBA 4R8UB 1EHWA 3LA0A 3C66A 3KLVA 1N5YA 1IR0A 4OI1A 3D9BA 3KMQA 4DS4A 4X2BA 2RDDA 2GVDA 2FVQA 3MCNA 3QZ8A 4M5DA 2HHSA 4K59A 5DZ6A 2IRYA 2UU9J 1QY7A 2PMWA 4JI7F 1U2RA 3V6DB 1GMWD 1R0BG 2ZE2A 4OYPA 3BQ1A 1B3TA 4WYLA 2FGCA 3VAKA 1UVLA 2QEXS 2OELA 3AOBA 3J7YU 3DM2A 2E5LF 3OTBA 1NSKL 4JB8B 2QE5A 1PKUA 3EXCX 3BV8A 2WOMA 5EWGA 1PO6A 1DZ5A 2D9OA 2V69A 4HHUA 1XMQJ 2FUG9 2WVCA 2DGWA 2MKJA 2R7OA 5HBMA 4EK2A 2BKPA 2HFSA 1TK5A 4O3RA 1Y5IB 2AEJA 1VGYA 2BVZA 3CD5A 2WZ1A 1WEXA 2RD5C 3IRXA 4P2SA 3RBEA 3K7RA 2UUCJ 2R7TA 2DKOB 2EK6A 1UPMB 3HLUA 1F5CA 2J9CA 3RZAA 3OR1A 3U1LA 2RNEA 4ZVRB 4X4TA 1VQ9S 3A8KA 2QLFB 1IJFB 4OX6A 3K5MA 2KZMA 1CPZA 4DX6A 2RQKA 2VUGA 1B64A 2DNHA 4PPZA 3Q8YA 1NKEA 2QSFA 4DQSA 4WIIA 1AYEA 4OHYA 1NZ8A 5J2PB 2AP6A 4LF5J 3R8YA 4C0BA 4C0HA 2POKA 3EYZA 5BYQA 1JXLA 4ZIVA 2VASA 3QSIA 4WXOA 4OL8A 4QR1A 2AJ1A 3M2RB 2MXYA 4DL0C 1FXLA 2CPXA 4ZITA 1UWBB 3V5RA 1Y10A 3QSYB 3JSMA 3QGGA 4M63A 1RTHA 1FRXA 5CYQB 1FTRA 1MMDA 2DNYA 1IM4A 3G4SS 3D5MA 4FBTA 1FE4A 1LWFB 2YWGA 3TUIC 3U02A 3D3CJ 1RA7A 4PYAA 3KHHA 5E3AA 4EEYA 1CJKA 1HWIA 2WB4A 2WVBA 2LYVA 1H72C 3SCKE 2YNIA 2G0IA 1XNQF 3PXGa 2BOAA 2HZCA 2V50A 3KWMA 4ZOSA 3KG0A 2UXBF 3W65A 4JI7J 3D0HE 2V2QA 4W4MA 5KT3A 4NLDA 3I87A 4I0WA 1D0EA 1C0UA 2EVZA 1ZM3A 1SKUB 3IBCB 4NCBA 1FHTA 2YTCA 4I4BA 4K2JA 4L73A 4P2FA 5J2MA 4WBFA 4CLUA 1HMVA 4FF4A 5I3QA 1BHNA 1BQNA 2VFVA 1S0MA 1NBEB 4C6AA 4JI2F 1WKKA 4PAAA 4KJIA 2DJWA 1WHYA 1SJ1A 5D3GA 2FIUA 3CF5Q 3AB2B 3NMAA 5AT1B 3NNHA 5C25A 4KGZB 3M6UA 2VG7B 2V9WA 1VQPS 1APSA 1A6LA 4WFAQ 1G3OA 1F9EB 2A10A 2KYZA 4IOBA 4ZVTB 2CAJA 1NKCA 3TRGA 1VCTA 2MQOA 1WKJA 1U49A 3L09A 4KT0C 2CPIA 2YWWA 3KHLA 4L76A 2DGXA 3DU6A 1N52B 4PXEA 3WC2A 3P96A 2B4UA 4PG4A 2V2VA 1G4CA 4YFUA 3M8QA 4MTPA 1KOOA 5F8GA 1T8EA 1CJKB 4M1KA 3TUJC 1FNOA 3L9ZA 4ZA1A 4JUZA 1R43A 3TJ9A 5L46A 4C8KA 2CQGA 3I31A 1T03A 3RGIA 3K59A 1VQKS 1P1TA 3SXLA 4R0EA 3PYDA 3H2VE 3KLIB 4FF3A 1ZAXA 3D3BJ 4MAKA 4P73A 5ADZA 4FXDA 3IC1A 2OD6A 1CJTA 3GE9A 5DQIA 1BC6A 2E7VA 2JWNA 2EC2A 1RWOB 2DXFA 4MFBA 4QW8A 1VJQA 1VQ8S 2AT1B 4MKAA 1K9MT 1H38A 2B7CB 3KMSA 2VQFF 4IOCQ 3G82B 1FWKA 4F0HA 4ECVA 2MYFA 4WF9Q 3ISND 4DG1B 2EFQA 1HWLA 3PRBA 5KFCA 4CT9A 4ZVPB 4BWMA 3G96A 1JNRB 3E51A 4LR8A 4AE5A 2NS1B 1U09A 2UV8A 2HQ3A 1GXUA 4USMA 5HP1B 4GKKF 1X7VA 4NLRA 2I38A 3EVOA 4ZCKA 4R8UA 1HQUB 2B6AB 1GXTA 1IR2A 1LEOA 2ROEA 4KAIA 3WDOA 3MAQA 4WZMA 1RTJB 4J91A 2BE2A 3KFWX 3PG9A 3IMQJ 1FRMA 1YJUA 3TZZA 1YJWS 2GHVC 2YKMB 3AHPA 1MG7A 3CCLS 2P6SA 5I42A 2FC9A 2W2NP 4NRTA 4UUXA 2YXLA 4U95A 2YPZA 3IAM9 3BGOP 3U1MA 1T3NA 2OTLS 4DSIA 3MZIA 2V2ZA 1FD8A 4KFBA 4DL3A 1R0AA 2P2CB 3HXMA 3T41A 4A8FA 1WDTA 3DOMB 2HBQB 1HQUA 2GQ2A 3NS7B 2KM8C 1U45A 1UFLA 2W4CA 2F5GA 3BSCA 4LBHA 2V8DA 2YBVA 1IN0A 3NWGA 5KFZA 1A7GE 2P9EA 5AE1A 3Q22A 1QAJA 4DMZA 4RW6B 2GV1A 7FDRA 2ATLA 1Y3KA 5JJBA 1YGYA 1S6OA 2W2OP 1VQ7S 3MMAA 1QTNB 3HHEA 4RUBA 3OTDA 5JMNA 2LLZA 4I64A 4DL2A 2JVRA 1QE1A 3H2UB 5DG9A 2N7YA 3CJRA 4FYVB 3NKYA 3FCWA 5DJBA 4DQPA 3P3DA 1TP7A 5DQHA 2R2RA 5LSOA 2XLKA 2EBEA 2NREA 4ZK7M 2RSQA 3ILOA 3OR2A 5D6GA 1IBKF 2YY3A 5IS2A 2J6TA 1C0TB 3D6FB 4RW6A 2GCFA 3OBIA 3FBBA 5L39A 4RNNA 3D28A 4DQRA 1T03B 2VL1A 3H90A 4TYAA 2IA6A 2VQEF 3MXHP 2M8DB 2J5AA 2Z8QA 2UUAF 2Z2ZA 2DR6A 3HSZA 3M8QB 4QBUA 3MCMA 3A4TA 2H54B 2HHPA 4KHPJ 1RT6A 2JH3A 5EDWA 2BR0A 2OLWA 3D1QA 3L7PA 3F44A 2XWXA 2HHTA 1S9EA 5B08A 1IBMF 1JLAB 1IBCB 1HR0F 4M5KA 3IAS9 1VQYA 2ROPA 3LP1A 3LW5C 1TKTA 4HL9A 3OFHA 2RRBA 4PG5A 5K8PA 3CDWA 5KG7A 1HHTP 2LEAA 2XZDB 4CYUA 1S12A 2GA7A 3M2UA 3CCMS 3LP2B 3QRRA 1FNXH 1S6QB 2QA4G 4ZLPA 4F4KA 3MEGA 1U02A 2B6AA 2NZCA 1HNIB 3DRSB 3I9V9 4DZDA 3R2DJ 2W25A 1JQGA 2JLEA 2OI2A 4CLZA 2XGPA 4W92B 4KB7A 4PG7A 3PEHA 5KG1A 1FFSB 2HK3A 2CJXB 2WBMA 1SV5A 3H98A 2UXDJ 2V94A 5LXYA 3T1YF 1FD2A 1RT7B 2EC0A 2E9RX 2AX0A 3HFVA 1RBOB 3NCPA 2COLA 3GCXP 3U27A 1XR7A 5KG0A 4Y3CA 4NI2B 3OLBA 1UMJA 2HVEA 2BM0A 3FEXB 1SH2A 4F4AA 1PJ7A 3VAIA 3SV3A 1H7XA 1WOOA 1DY3A 4I6AA 1S57A 2KB2A 4ZS6A 4FXWA 4LR7A 5DGAA 2XMVA 1JJHA 4QR2A 4XPEA 4DF4A 4I6WA 2DPIA 2E66A 1KQFB 4Q43A 4R25A 4U7UK 4A46A 4MMOA 1FFWB 4C7QA 2G9OA 2X1GA 1GMVA 3UD3P 2K8GA 2LXUA 2HNZA 2XZWA 3PYFA 3TA0A 2QYGA 5E0OA 2IJNA 1UVJA 3RB3A 5M2UA 3M7VA 2VPXB 4YOEA 2K06A 2U2FA 2MKKA 1S1UA 5IT0A 4JI5J 1GNKA 4CIOA 2DGUA 4FDFA 4F36A 3BO3A 3DDNA 4Z2XA 3MEGB 7FD1A 3M9OB 5HANA 4IOAQ 2CQ1A 1S6QA 5G0RA 5KFKA 3MR2A 4X65F 3EDQB 3OXFA 1T9UA 3OSNA 3EZOA 4JI1F 2AGOA 2QL9B 5G0RB 3NGTA 4LR9A 1X4GA 3F56A 4WP8A 3W3SA 3PW4A 5T7LB 1KQKA 5HVHA 1PBUA 3ZC4A 4WKYA 3BGFA 1HARA 2XMMA 5KFJA 1RU2A 1S1UB 4TLRA 4ZVSB 1XMOJ 1K1QA 2K3IA 4B3SF 4KGMA 2X7IA 2R7SA 3BGLA 4ZKAA 3JSYA 1JLGA 1AT1B 1ZTWA 3B54A 1BGXT 3I0RB 2GQQA 2E5JA 5E5NA 4DPTA 4RUAA 3NNCA 1RB0A 4LSZB 2AGQA 1S10A 2YNGB 3IXQA 4HI1A 1FEHA 3RR8A 4I67A 2ZZNA 4DR2J 1UTAA 2MKCA 4M5IA 3N6MA 2V8PA 1H3DA 1RSCA 1Q95G 1TVRA 1VC0A 1VMBA 3LWMA 2ZJPQ 5L1JA 1U6FA 4L72B 1RHUB 2N7CA 3K57A 4BBYA 3WHIA 3RB0A 3C6UB 3GMGA 4K2XA 2W9CA 3OW2R 1X9SA 1S1TB 2RKIA 4WU3A 5KT2A 1QUVA 2DHAA 1EKRA 3CJ2A 3W9IA 2HHHF 1NLKL 1H0HB 2RDIA 1SC6A 1UZDA 4Y2CA 5CZVA 2G2ZA 3FK4A 1PC4A 2HFVA 2LECA 2ALYB 2JOQA 2DD8S 5ETSA 1M5OC 2W2QP 4YR0A 5ETNA 3J80U 4HKQA 2NCKL 2Q79A 3D68A 5KFAA 1YZ6A 2XHWA 3ET6A 3HHKA 4WFZA 3C15B 3SSRA 5JVHQ 1PGZA 1B7YB 5IWAJ 3H7HB 3FRZA 3QT7A 2FTRA 4QIFA 3SQOP 1CVJA 1URRA 3TEHB 4JOUA 2MKIA 5LMUF 2WB1D 2JEGA 2Y8YA 1RWWB 3TUZC 2VQEJ 5DG8A 2R9LA 4DX8H 1FVQA 3IM9A 1AZSA 1NB2A 4KKOA 4USWA 2YQ3A 3CD7A 4OIXA 4OHZA 1HFEL 3AQPA 3DOLB 4DCPB 3T5JA 3BGUA 3MPVA 1J5EF 3N4WA 2Y1JA 1TZ0A 1CULA 4RO0A 4L74A 4RKUC 2IVMA 3P4UB 5F3TA 2EFVA 3SBMA 1UW9A 2B9WA 2HQIA 4JP8A 8RUCA 3VWSA 1HI0P 2JEIA 4NLYA 3W2VB 3NGRA 3TJ8A 2B9XA 2E7XA 2KFYA 2J0SD 4Y28C 2VU5A 2PA3A 1BQMB 3M8WA 4IG0B 1T7PA 4IQXA 4LF7F 3R9LA 2XC9A 1U1LA 3QQCD 3QJLA 4KV8B 1H73A 4DSKA 1ZAWA 2Y1LB 2DGTA 3EZ5A 5KFNA 1CQNA 5ETOA 3KG1A 3IO1A 4LFBJ 2HHQA 2M9KA 1NHKL 1OPZA 1WTBA 2FVSA 1EP4A 2CJKA 2UVUA 3M8PA 4C9DA 2VDHA 2YWHA 3EXYA 3J81Y 4DUYF 2NXUA 1NMEB 4IR1A 1FDAA 5LMNJ 4CTAA 4U67Q 4UW2A 2C3UA 2J76E 3T3FA 1O5JA 3W2VA 2ABYA 3M9NB 3FMBA 1YWXA 1X8DA 1S1WA 4OLOA 1N36F 3OV7A 2VKRA 5MAOA 3KXDA 1RGVA 4ZVOB 3MM8A 2DNRA 2HQDA 4IKAA 3M05A 1YJVA 3SSQA 4I68A 1ELOA 4OYWA 2NSCA 3F0NA 2HLTA 4NA2A 1D3WA 5HMZA 2VPYB 4DPWA 5HQ8A 2MZRA 5HJXA 5A0YB 1F5AA 4J9NA 4I2PB 2C22A 2RQCA 1NK0A 3Q8UA 3K5PA 1F0XA 4ED2A 3ZZUA 2P9GA 3HDSA 1PBAA 4WP3A 1U0HB 1BWVA 1VQ6S 1Q16B 1VRTA 3ENQA 4I69A 3DLEB 1YBAA 2O3DA 3SIPB 1MWQA 3PX0A 2KRRA 1L3KA 1NO8A 5A8KB 4PQUB 2VPWB 5IT4A 2LEPA 4AL6A 1HNXF 2RKIB 3A3OB 4ZCLA 2APOA 3ZZOA 4CO4A 4UOGA 4DFPA 3PIPQ 2CJ9A 1DLOA 3AODA 1ZTTA 3GB0A 1RHJB 2EEYA 2XI2A 2YX4A 2CVIA 2J0WA 2CPFA 1SPBP 2ZH7A 1P1LA 1RQ0A 3AD8C 1R89A 2XMTA 2HHXA 4YR3A 3BSOA 5IZHA 3NOCA 2MZ1A 2MZTA 2KDOA 2VFRA 3QMQA 1ZA2B 3L95X 5ETTA 4A8QA 3DLBA 1YJ9S 4NLSA 5D0RA 2BJEA 4LSLB 1FF2A 3D1HA 2R7UA 1TKXA 1EKSA 4DOZA 3M2VA 3QO9A 4C11A 4DUZJ 1KN6A 4U7UD 3L7UA 1FK9B 2DO0A 3KUGA 1XK8A 2V68A 3NOGA 1H2TZ 2QSWA 3BR8A 3DMJB 3HHLB 4RBVA 4ZP7A 1TKXB 3U7JA 2GS8A 2L9WA 3W2WA 5HL7Q 4UQGA 3SDEB 1L5UA 2XMUA 3QT5A 4K50A 5LT5A 2X51A 2ZBCA 3VF0B 4OHWA 1F6TA 3IS9B 2EI5A 5KFPA 5D78A 4HT7A 3RU0A 2EXUA 4R5PA 3NRBA 3EGNA 1RT7A 1MMNA 1T95A 2C2KB 1H2VZ 3PEJA 5CXTA 1ACMB 3QPIA 5E3CA 1T05A 2OJ3A 3GFZA 4FS1A 5GAGU 1XBWA 4DV6J 1CEZA 3G8TA 1Q8LA 3G6YA 3P8BB 1VHIA 1YLXA 4DUYJ 1SJ3P 1QTMA 4PWDA 2JX2A 4QQBA 3P5TL 2J9DA 3FEZA 3SDEA 5LSRA 4B3TJ 2HHUA 3CD6S 4LRFA 5EWFA 2UU9F 1YTYA 4ZVEA 4RW4B 3MUTP 3H59A 2XMWA 3ZZZA 2MQ8A 4PWUA 4GO7X 4CLTA 3MR3A 4X4PA 4L75A 5J2MB 5T41A 3HT0A 4KH0B 5DDPC 3CJQA 4YR2A 1H7WA 3POTB 2R8JA 4OZNA 3PV8A 4LF7J 1TAQA 2F4FA 4ZLLA 2HNZB 2GJ2A 2O01C 4GC7A 2K7JA 4YQWA 3DFEA 3V81B 1YRUA 1U2CA 2F63A 2QMXA 3DLGA 2DNQA 4X4QA 2XCPA 1L3SA 1HHQA 4QR0A 3UNGC 5K9FA 1SUQB 3HHNB 2I6WA 2MGZA 2ZFHA 2LA6A 1B70B 3V81A 2YNIB 2BW2A 3R3TA 3CWJA 3TYTA 3IWNC 3FQKA 4M5DB 1PIEA 4C97A 5KG5A 1CQMA 2FZKB 2MKYA 4AD6A 3CCQS 2YH1A 3BDEA 2HBZB 2NZ4A 2R7WA 2BQ3A 1R3NA 1NJWA 1F1BB 2LQJA 4FZVA 3HFZB 5C42A 1QLNA 2FHOB 3BF4A 3DRSA 3TA1A 3OL9A 5ETVA 1SJFA 3HFKA 2HWIA 4DV0J 3HD2A 1I94F 2W01A 4ELTA 2R2SA 3CCES 4A47A 2FHJA 3K8VA 4NLUA 2M52A 1S6PB 3M8RA 1RYRA 5F8IA 4MK8A 1W7WA 2B43A 4WJBA 4WFBQ 1G2EA 1NPKA 1T9XA 5HO4A 1YHQS 4DSLA 2PO4A 1X5TA 2DGSA 1BQMA 4QCLA 2QLBB 2BXJA 3MEDA 4LF8J 1RWMB 4NWBA 1VQOS 1U1MA 4F50A 1LXNA 1Y00A 3WQPA 3PR4A 4DZ6A 2FJDB 1UA0A 3FCVA 2HWHA 3FCHA 1DBDA 3D6TB 3I4HX 2RS8A 1RUSA 4X66J 1HBNA 3CDAA 1XMQF 4NEYA 1DQ8A 2EW9A 3JQKA 2HHHJ 3IS9A 4DDFA 2VIHA 4FS2A 2ZC3A 2OEJA 2BQUA 2XS7A 2PA8D 2BJ1A 3BJYA 1SJRA 2Q43A 2MPUA 3DNCA 4HEA9 4CTAB 3GIKA 1HQEA 3QGHA 5J2QA 1MSWD 1Q7LB 1SXLA 4ECRA 1RKJA 5I4MA 4YEAA 2C2NA 2HRTA 2XSFA 1SC3B 3M1VA 4Z7CA 4AQYF 2HFZA 1TL7B 2DNOA 1KVIA 4K4XA 3JQMA 4LF9F 1M1HA 1JB0C 4N8OA 3W64A 1IR1A 3MM5A 5B0EA 3C8YA 3HZGA 1OS5A 4PWWA 4M5LA 4DFKA 3QGPA 2BOPA 5EN1A 1X9WA 4OJHA 4DV6F 2QL5B 3CEDA 3G2XA 4PXBA 4CLFA 3D7SB 3EVWA 5DLGA 5GADU 2JC0A 2OFHX 2ZE2B 3EX7B 1N32J 3OJUA 1FJCA 1E6VA 2PSZA 5KTQA 3HULA 3UCGA 2BE7D 4IRCA 2BKNA 3D54A 1T94A 2ZVIA 1Q79A 2Z0GA 4USKA 3ZZPA 7AT1B 2VZ9A 3FSIA 2CZ4A 4ECSA 1M5VC 3I0SB 4TLQA 2WW4A 3KG4A 4Q5VA 1HBOA 2V5HG 1Y4ZB 3R5CA 4P10A 4O3QA 5DQGA 2KH9A 3HVRA 4NPOA 2BKOA 2AYGA 1HNVA 3ZZTA 1IKXA 2W8LA 3QLHA 2Q66A 1O0PA 1F2HA 2ERRA 4UOFA 1FDNA 3PW2A 2QLWA 3KLGB 1C4AA 1JIHA 1XR6A 2M70A 1KD1T 1JLQB 1X4CA 3IM8A 4B3MF 2ZKTA 3AJ2A 5FLXY 1RA6A 4WWSA 5GAEI 3TNVA 3DOMA 3JTPA 5KFEA 1FA0A 2BJDA 2FJVA 2V4JA 2XO7A 3Q0AA 1JJ4A 3DKDA 2UUBF 2ZHOA 3TQEA 1NZAA 3NS6A 2V6AA 3NCRA 4QW9A 1X4DA 5IT9U 4JV2A 1HYSA 2QL7B 3IG1B 4DWIA 1GTHA 3C14B 3ISNC 4A8MP 3CMES 4ED1A 1NK9A 1H2UX 2BEFA 1YJ7A 3S8SA 3JB9k 1KTVA 2C3MA 2E1RA 2EKNA 4IG3B 2PIIA 3SSSA 3J7A1 3NBPB 4DV3F 3W5XA 1NNDA 3OT9A 1VBXA 2XYGB 1U6BA 1XNRF 3FFIA 3CPWR 1CC7A 3VGUA 4OJ3A 2YKOA 4CH0S 2VICA 1PG5B 5KFWA 3PW7A 2CRLA 3TOQA 3MM9A 1RTDA 5IOLA 3HP6A 3OLAA 1WHVA 4C4WA 1VQ4S 1FJEB 4R0JA 4G1IA 3CJSA 4NCGB 5FDLB 2LFVA 4OJGA 4BHQA 2DYAA 1HIYA 3BN7A 1VQSA 4IYQA 3T6JA 2RUSA 2Z58B 1FDBA 3TZYA 4IRKA 2GHPA 1RLCL 1S79A 3UDEA 1YI2S 4ELUA 2R8KA 5BR8F 3PRDA 1OQ6A 1MROB 5EGYA 3UVJB 4ZPWR 2DEIA 2LU1A 3A3NB 5ETMA 3DOLA 4ETXA 5J2QB 2W4DA 3MMJA 3U1NA 3MFHA 1YX2A 1Q0NA 4ECQA 5L1LA 3KK1B 2B5JB 1RDRA 3DXBA 4P7TA 3BS9A 1RAOA 4HDHA 2C28A 1YRXA 2CFXA 4MK9A 1HR0J 3EUNA 3AB4B 1KFSA 2FLOA 3LAKA 4EI2A 2XI3A 3AT1B 1OMSA 2IC3B 3ITHB 3GYXB 4TY9A 1UWBA 4U6PA 4B3MJ 3UR3C 1OWXA 3I0RA 4FBUA 2F4VF 1JLEB 3QIPA 3CJ8A 4AYBD 2H9ZA 2GQCA 3MAAB 3I5AA 2DVIA 1U7LA 2DY1A 3W1YC 3J80Y 2VD3A 4J9RA 2C3PA 2RAQA 4LRBA 2WSFC 1NDCA 1HNIA 4DX7A 3CJ4A 2NXNA 2HZAA 3SFGA 3GG1A 5F8MA 5A2QU 1X5PA 2ZJQQ 2HVDA 1BE4A 5B0CA 2HGLA 4DL5A 1VQLS 2MMYA 4OHVA 4YS2A 2JEJA 3BO2A 3CIMA 4MKVA 3KDNA 3TVZA 3CC7S 3CT9A 4GVBB 2C2EA 3K0JA 3C16B 3SEOA 4FYYB 4CM2A 1E6YA 1C0UB 2E1PA 1YRTA 2DNGA 3CJ5A 4HTIA 4CH7A 4WTOB 3IR5B 1S4FA 3CSKA 3FQLA 3GPAA 3MR7A 4I6YA 4R5PB 3IGNA 2G13A 4DCJB 2D9PA 4JI5F 1MROA 1UWAA 1YKWA 3CXCR 2KT5A 1LWCB 2D3O1 1IJEB 2B4VA 1LW2A 2DNMA 4B08A 3T1HJ 2WOMB 1IKVA 1LK5A 4HT5A 1HBMB 3NGUA 4QIVA 4AQYJ 1TTHB 4J9VA 4KY3A 1FNMA 2KYXA 5JUMA 3BGRB 2BJ3A 4MK7A 1TL4A 2ZH5A 3MMCB 3EZUA 4YY3J 5F8NA 5EHHA 3E2EA 3UFCX 4DPYA 3T6BA 2ZH3A 2WHOA 4ELVA 2HVIA 5BR8J 4G1QA 2LQ8A 3IWLA 3MI7X 4TN2A 5HROB 2E44A 4PZVA 1N54B 4K8RA 1VRQC 1KS2A 1RACB 1VOMA 1ZOTA 2IM2A 3MEEB 4C8MA 1N0UA 2QJ3A 2VB6A 5KFQA 2MLZA 5A8WB 3MWBA 5A8KA 2XM3A 1RADB 5K5MA 2XY6A 1JLAA 1LOUA 4RPFA 1YJTA 4URSA 3ETMA 1X0PA 5C24B 4DPXA 2ATCB 4A8WA 1Q5VA 3PX4A 1F3VA 2PT0A 2NR0A 1XN9A 3BKUA 4ZCIA 1Q7YT 3BREA 2MQNA 1D9AA 1WD6A 1PAUB 2LDYA 1HYSB 2B0GA 2RT3A 2XZTB 4OYOA 6FD1A 3QWUA 4Q45A 2VQFJ 3MM7A 1RTIB 2IRUA 5HATA 1KLNA 2FLNA 2ZH1A 1EJ7L 1KLMB 2W1BA 3JSBA 3CNQP 3HHLA 5F0UA 2Q1LA 4CP5A 1KOHA 1YK9A 3M8YA 2YKNB 1C1CB 3PYGA 4TVAB 2KM8B 2MB0B 3VGSA 3SZ2A 1FRKA 5D4LA 2CIMA 1FO1A 4GKJJ 2F1FA 1DJ0A 3KUHA 2CQ0A 2PMHA 1S5ZA 4LSLA 5A8RA 1WJ9A 4X64F 3BSAA 5M2RA 1HBOB 3TO8A 2CNLB 1RE1B 3KNGA 2BMBA 2UZAA 5HP1A 3UNYA 5AE2A 2FVCA 4DFMA 2K2PA 3R5GA 3GJTB 4P71A 3EWGA 5HI7A 1KTQA 3OHAA 2OAUA 2W9AA 1K0VA 2BDPA 2ZBIA 2VJVA 3PACA 3A12A 3FSYA 2B51A 4QIGA 1RCXB 3P5BP 5CYMA 4ZN3A 3M32A 5HQLA 5KAKA 5LXRA 3QGIA 1CSJA 2CA9A 2D3ZA 4N77A 1Y3JA 2GVZB 3R97A 2ZJRQ 2O67A 1QAYA 2I8EA 3O1LA 1Q8IA 4ID5A 4LRCA 3VQSA 1SC4B 5A8RB 5F3ZA 5KFIA 4UZCA 3SI8A 3VALA 3NS5A 4CNZA 3P6YC 1TFWA 2CPJA 2EK1A 2AEMA 2ZZTA 2DR8A 4I2PA 1RKIA 2N4DA 4F7VA 4OQJA 1UJ6A 3ADAC 3AXMA 4QU6A 1KLMA 2CZVC 2W7OA 3HKWA 2RRAA 1EX8A 3MM7B 1UFWA 4QIWD 4RNFA 2EFPA 4ICLA 2ZWPA 4LRDA 1VR6A 3PJXA 4E98A 4ECUA 3H5UA 4UY85 2DB1A 1OYDA 4TU8A 4KHMA 3UPFA 1HW8A 3I5BA 4OYIA 1VK8A 4CZCA 5IV3A 2ADCA 1X0FA 1CJUB 4B9NA 2I1RA 1PCAA 2GAHC 2IVYA 3NY0A 1FI4A 4MIAA 1XNQJ 4NOHA 3GSDA 4F0KA 5ITHA 3H25A 1CS4B 1TUGB 5D77A 3GIJA 2OPPB 4Y2AA 1TL5A 3V4MA 2ZH8A 1EP4B 4HH0A 2L48A 1S72S 4DX5A 2JEFA 4O0NA 3ET6B 1NDPA 2Y0BB 4CO5A 5HROA 2FJAB 4JV5F 2DIVA 3O3LA 4ES3A 4KV8A 4QYZJ 4M8LA 4ES1A 3M32B 3NXZA 5KG4A 3PJ9A 1M5SA 1NK7A 1VHFA 1D8ZA 4MJKA 3KK3A 3N6LA 1W2IA 3QYYA 4J9UE 1IXKA 2ZWOA 2FJWA 4LMZA 1V3SA 4KTQA 1QJHA 2ACYA 1IKVB 4OZ3A 1I5OB 1NDLA 4LREA 4J9PA 4HHHA 3V6JA 2J0QD 4X4VA 2B7BB 2KJVA 4OYBA 3B4MA 4KR0B 5J2NB 4EGLA 1TELA 4A4JA 5IQ6A 5LJ5Y 4YHHF 1ZPWX 2QMUB 4WCEQ 4DQIA 1NPPA 3HO1A 2C3YA 2RQ4A 5A6WA 8ATCB 1PJ6A 3PKMA 3DLKA 3IA0A 2QX0A 4O3PA 2XNQA 5L9XA 3UDLA 4A8YA 4O44B 3ZZYA 2HZVA 3MAHA 4ZPCA 1QD1A 4GVLA 5DM7Q 4L3KA 1T9YA 4S0MA 2Q6BA 4RW4A 4AXIA 2D3OR 1N33J 1HQEB 1TQLA 2IFXA 5HAOA 3LO3A 3JSMB 5T7LA 5RUBA 2CQIA 3EDRB 2OSRA 2LKZA 3CO9A 5M2PA 4RZRA 1VLOA 4IFYA 2JRSA 1YVFA 4I2QB 2A1BA 3D1OA 4IQMA 4UT4A 3IN5A 2EG2A 2XMJA 3OXLA 4RW7B 1QSLA 3LAMA 3M6XA 4FNIA 1RABB 3H4DA 1P9YA 4ZP6A 1OQ3A 4E2FB 3FUYA 4H4MB 3SCLE 3TAMB 4ECWA 2UVRA 2SXLA 4LFBF 2PC6A 2B8QA 5DG7A 1WG1A 5KFHA 4K4TA 1KRPA 2CJAA 1U1RA 3LF0A 1DURA 1QAXA 3I96A 1HQ2A 2HGMA 2VG7A 4C48A 4EO8A 3K2YA 3W5YA 4DQQA 5GMKa 1SKSA 3EGZA 3EJMA 1N34J 2AZ3A 4KYZA 1WOSA 5C42B 5J1PA 9ATCB 2FC8A 4OMFG 2C2MB 5CCLA 1P8GA 3SV4A 3AA9A 3FZ2A 2N4CA 3WIUA 1J5EJ 4OX9F 4QZVB 5AE3A 4KIAA 2F65A 1FRHA 1FX2A 4JV0A 2B8PA 1UKUA 2XYPB 1R6YA 1OYEA 3QNWB 3PX6A 4P2MA 2F8HA 5E3PA 4J5OA 5EWEA 3NMRA 2WSCC 1RP5A 4TXSA 4C98A 4PRFA 1FVSA 2IAJA 1HNWJ 4NXMF 3KUEA 1IWGA 1X4EA 4OX8A 1KEKA 4O3SA 1VI7A 4LJMA 4J9MA 4HLBA 2YQ0A 1RWVB 3N0VA 4NMXA 4RW7A 4DR5J 3CIZA 1NSPA 3GZ7A 1YIJS 3PKYA 4DR4J 1TL3B 2J6UA 3MPUB 3PFOA 4DS5A 2LEBA 2KJWA 3GYNA 3LPYA 1SVDA 3M2UB 3EGWB 2A18A 4BC9A 3HT3A 4CLKA 2JFDA 2CDRB 3VTIA 3OUYA 3GV8B 2WONB 2F9DA 1Q53A 2HAIA 5K14A 1QDUB 5C2GA 3PHEA 4O4GA 4C8ZA 4NEZA 2ZBRA 1Y0HA 1U47A 4KH1B 4O44A 1KWMA 4OLPA 1F2GA 3R5JB 4V19X 3DLKB 2JLFA 1WTFA 1VISA 3D6HB 1HPZB 1X31C 1ZM4A 2GHWA 2Y0SD 4OZ2A 4WE1A 5IQQA 4ED4A 1NB7A 3T5KA 3QT6A 2DK2A 5KFTA 2KN4A 2AIRB 1SB6A 1D9FA 1H74A 1S7HA 1ULRA 2W2MP 4RNOA 3Q8RB 1ICEB 1MLAA 1WEZA 2N3OA 2HQFA 5J1EB 3CGIA 4M5JA 2BZ2A 3ZNUA 3Q24A 2MLYA 4L3NA 1K1SA 2MHEA 2XQCA 2AQ4A 4K5SA 3WX8A 5L1IA 4JI4F 3W8GA 3KLEB 4X4NA 3M8PB 3RB6A 4J9LA 2E5HA 4NZ7A 2RS2A 5H9EJ 1FKPB 1JLFB 2BRKA 1N36J 3DOKB 1FE0A 2NXCA 2QLXA 3CC4S 5HK4A 4ANEA 1XMOF 1IKWA 2F40A 3A3PB 3IP0A 1C1BB 2MLXA 3ILIA 3NG8A 4H4KA 5IC4B 4NYPA 4QWDA 3KLHB 4NCAA 2LA4A 1SJ4P 1NU4A 2HLUA 2IVFB 1CS4A 5B0DA 1N88A 1Q81T 1FDDA 3R27A 4CLPA 4ILRA 4Q44A 3E01B 2GW8A 1SBRA 2NUUG 3FFIB 3TX8A 4DUZF 1X5SA 4C8YA 4LF4J 2FJBB 1KSPA 3IRWP 3M1VB 3Q86A 3THPA 2VF3A 3DHXA 3UW1A 3TAPA 1RHMB 1K8AT 3UI3A 4C8LA 1S9EB 3HJFA 1PC5A 2AJ0A 1NJYA 4DF8A 5B09A 1ROFA 1KNZA 3IG1A 3HK2A 4GKJF 3VR1A 2RHQB 5G4DA 2R2TA 3Q2SC 3KYLA 1B7FA 2JDJA 1WI8A 4B3OA 4DR1J 2AEFA 4JI8F 3TEGA 3DI6A 4JYAF 4ZLJA 3M30B 2GX8A 4GC6A 4AL5A 4Q0BB 1EQMA 1KFDA 4FKXA 5GMEA 2NUHA 4ERDA 4LF5F 4RW9A 2J8SA 2ZNYA 2CPZA 3JTOA 4Z37A 5BXIA 3R2CJ 3ZTOA 2BA9A 2OTJS 5LMUJ 3ICLA 2YPYA 3JS9A 2J9DE 3EE3A 3OUYB 1GTEA 1KDNA 3RJMB 4Y6IA 1BD6A 5IWAF 2LQ9A 4WKRA 2RH3A 1HNVB 4RNMA 1FRIA 3DOKA 2AMCB 1IKXB 2I5JA 4TYBA 1TKZA 4DG1A 2L9DA 1JXVA 1LWXA 3GWCA 2PDAA 4UUWA 4C3MA 4JBCA 4EWTA 1S1TA 4X62F 1D9DA 2NPIA 1R27B 2ZOGA 1HD1A 5L1KA 2R4FA 2W9CB 1SQGA 1TKZB 4EBCA 3DU5A 4J90A 3E01A 2M2BA 4Z7YA 4ECTA 3T5LA 4M5MA 3MOZA 1MMLA 2W2PP 4CNYA 4NASA 2IY5B 2IA0A 1RWXB 4K0KF 3B8HA 3HD1A 4P7VA 3T9ZA 4AUKA 4DV4J 3G82A 5MLCV 2OIHA 3J7YI 2X1BA 4UZBA 3JQJA 2R8HA 3KK2B 1WG5A 3A1YG 1J5OA 5CH7B 3HZEA 5F8LA 3ENWA 3SYZA 5CQGA 2V8VA 4M5NA 3SQGA 1T02A 4LVOP 1J27A 5I3PA 3T19A 3W66A 5KFVA 1ZS6A 1FWPA 3KDOA 4ZHRB 5IM0A 3OVSA 4F26A 4MYTA 1JNZB 5I3UB 2EG1A 1CBKA 2JSXA 1VJWA 4O4RA 3RYLA 3ENVA 3N79A 2ASYA 4KHPF 3I4PA 2DNLA 1UVKA 3C19A 3RG6A 5L38A 4ILLA 4LIWA 4HI2A 2AHOB 3E3XA 1DFDA 2A0FB 4ZN1A 1NK6A 1ZYQA 1U24A 1PYOB 1S97A 3PM9A 1CLFA 1Q1KA 4DR6F 3HHLD 1TAUA 1KHVA 2BW7A 2MJUA 1CC8A 4F2RA 2KT2A 2KI2A 5HSPA 2LXFA 3FZBA 2HURA 3H2LA 3HF5A 1KQGB 4PCQA 4Q7AA 1NJZA 3HVAA 2EWHA 2H5IB 1QVGR 1F9HA 2DHHA 3G86A 4LSNB 2W7AA 2HEKA 2AV5A 1LV5A 3VVTA 2HNDB 3HJVA 4KO0B 3LGNA 4F3QA 2XGQA 4OV1A 3BGRA 1SL0A 2NLWA 3D67A 3GJSB 1WSVA 4RNHA 4N41A 2DISA 3GFXA 3UD4P 1HWKA 2DR5A 1JK9B 3ITHA 2YX1A 2Z2LA 3VQTA 4JI6J 3CDEA 4QWAA 2RQMA 3CCZA 3FBFA 4LT6A 1WF0A 4NLWA 4NLTA 5ETLA 4ZLNA 5AJ3F 4N56A 2DO4A 1BY9A 2C2ZB 2CQBA 4EUVA 1TUVA 3VV2B 4JI3F 2VPZB 1FWLA 2VC0A 4W90B 2OMOA 1ZBTA 3BH6B 1TVRB 1U0SA 2GJFA 4YDDB 1XMBA 2QC3A 3BN4A 4G6VB 4DPUA 1RT5B 4B9UA 2IJFA 4J37A 5GAGI 3L7OA 1RI7A 4DR3J 1C4CA 1NKBA 2DIUA 3H5XA 1IM6A 1RT4B 1U2FA 5B0GA 2VJUA 3CW2C 2EKYA 3AH6A 3TA2A 3MM6B 1RT3B 4DV4F 3O5TB 1TKDA 3C3LA 4DR6J 1E6YB 3TX0A 4DV2F 3HX9A 1P27B 2CUYA 2HFOA 3C16A 3ZTRA 3MCSA 1BXNA 1HKAA 3R5AA 3GJQB 1RT1A 2HK2A 4Y34A 3BBCA 5GMDA 3N5BA 4QJVA 1NM2A 2GMJA 2EFNA 5KT4A 3LANA 2ZH2A 2WVDA 2LCWA 2YWKA 2WVEA 1AB8A 1VRTB 3J81U 3TJAA 4EZ6A 3WC0A 2CZ9A 4FYDA 1JJCB 1W25A 2HNDA 2K1RA 3OR1B 4NLPA 2WCXA 5B7WA 3H20A 3NLCA 2QT7A 2B5JA 4F3MA 2OPQA 1N5QA 4WP9A 3UO0A 1Y5LB 3MM6A 5H9FJ 4MKYA 2ZD1A 2YKAA 4DR3F 5LM7E 1SL2A 2L3MA 3PIOQ 3MR5A 2ZM6J 4P75A 5DZ7A 1X4AA 4CM0A 1MNEA 4HVZA 1RZMA 5CAAA 2MY8A 4WFNQ 1N0VC 1TV6B 4ZVHA 3TVYA 2E9TA 2UXCJ 3TUPA 3SCJE 1AFIA 3DRXA 2CYYA 5KFDA 1N4LA 2RB7A 2CNNB 3PTWA 3RAQA 2AWZA 4B9TA 2ZBPA 2PMZD 3KJVB 2D3UA 1KHWA 3P49B 4K4VA 3M2VB 2X3GA 4FKYA 3RUBL 3DGPB 1UJ5A 4PG6A 3R6GB 4MIWA 2HNYA 4QYRA 2XS2A 3M6VA 3M8ZA 3AFGA 3GIRA 3N28A 2P5VA 1KBRA 5KFXA 2E5GA 4TQSA 1GX6A 4KRWA 1L3VA 2DH7A 3HPOA 1UVNA 3EM1A 4JYAJ 1DQAA 3HSDA 1QAIA 1JLBB 3G6VA 1OY9A 1FERA 1HI1A 3PO5A 1DTTA 3D6MB 2VKZG 3Q89A 5K8OA 3K89A 2GVDB 3RAMA 4ZJOA 4ATNA 2E1MC 5LOQA 1DLOB 3ZNJ1 5CD4A 3AA8A 3TR5A 2FLLA 3EGVA 3RRGA 2IM0A 1N32F 2OP5A 4YB6A 4U7CA 3ONQA 3TQ1A 1GEHA 2IDEA 4OZLA 5GAHU 3MFIA 1WELA 4IG3A 4RBUA 4PQUA 5JXSA 3LP2A 3MM5B 2QFJA 2DNNA 2XYHB 1RTZA 4UQTA 4NX9A 4USHA 4LF9J 1BUXA 1Q4RA 2FY8A 4USTA 3MECA 3TWZA 4J9KA 2YKMA 2R8GA 1C1CA 3LPEA 3BDPA 3G8SA 1D09B 2ZKUA 1R31A 1RWPB 4K4SA 5ETQA 2DR7A 4M5HA 4QWEA 3M4XA 3HCXA 1VIXA 3BB5A 2CQCA 3EVMA 5E3RA 2G2OA 4XPCA 4H54A 4DV3J 1U1OA 1IBLJ 2DRBA 4UY8T 2QGFB 2OUGA 3QRQA 1N48A 4PR6A 2NPFA 4AFFA 4HDGA 1RAEB 4JI4J 1LFWA 5KFLA 2J7UA 5C24A 1RAHB 5J1NA 1U1KA 3O44A 3QLHB 1DTTB 3OJSA 4DV1F 3VCDA 4LF8F 1HLWA 3KK3B 5KOXA 3MEEA 1RTDB 4ZIWA 3KNAA 2FY1A 4MFBB 4DV5F 2FJXA 3C6UA 4FN5A 2DHGA 2HAFA 1GT8A 2W9BA 1M5PC 1XIQA 1WWHA 3MMBB 1HNWF 2D69A 2Z30B 5IC6B 5KG2A 3VAGA 4X4UA 3LH2S 1CJTB 2GVZA 4A8XA 2CG4A 2XO6A 5KOWA 1B4SA 4AT1B 1WHWA 1B99A 3E8OA 1CG2A 1UEKA 1LWEB 2HIYA 2IMOA 4Y65A 1NH8A 3TVKA 3VHQA 1RTIA 4EBEA 4J9QA 3I56S 2Z2MA 5GAEU 5HMXA 4YN3B 3J7Z5 5F8JA 2V4QA 1FJ7A 5KFUA 3FJ2A 4NXNJ 5IV4A 3NL0A 3GIMA 1I3OB 4LF2A 2ZZMA 2UUBJ 3PW5A 3VGVA 2VA2A 3OVBA 1AROP 2ACMA 2GC8A 3PZPA 1YQHA 2BYCA 1QUPA 2IYIA 1UA1A 3OHBA 4KPCA 2B3TB 5KT6A 3CO0P 4NXMJ 1RAGB 3JYTA 3CVKA 1VBZA 4K5RA 3CULA 2XB2D 5E7OB 1PYTA 3FRYA 1S48A 2AJ4A 1Q8BA 2D7SA 4RR5A 1Z2ZA 5FLXU 1WORA 5C25B 5ETKA 1XQIA 2WAQD 5E33A 4XAKA 4QWBA 2GIFA 2P8IA 5DGBA 1OSDA 2RHSB 1VC5A 1L3TA 1RAAB 5CYMB 3PO4A 3FGVA 4DI6A 2UV8G 5CYJA 5K8NA 1VBKA 4XIUA 3H5SA 3EMTA 3CCWA 2IAJB 2XHCA 2FZGB 1GMWA 1HBMA 1O51A 1S4EA 1RHQB 2BRLA 2EBGA 2H51B 5EX3A 4BWJA 3KOAA 1LW2B 2KT3A 3QIDA 5CD4H 4B9MA 2C2OB 2Z4PA 4B9VA 1UL3A 3OSPA 3KLFA 4NMLA 4PXCA 1N33F 4NZ0A 4ES2A 4TKTA 2M4MA 4GO5X 4NA1A 1M5HA 4CWBA 4DL7A 3GCWP 4B3RJ 4ZPBA 1RXOB 3JXOA 4RWWA 2MTLA 2H48B 3J7AN 2DNZA 2HNYB 3N01A 2JNJA 2QA2A 1KVJA 1S99A 2HG4A 3OFGA 4JV1A 3US5A 4BCAA 4FF1A 3DMJA 2ZOMA 3OTCA 2DGOA 2CWXA 3UVJA 4DU8A 3PFEA 4N76A 2J6SA 4LFCF 4TU7A 2NSBA 2HFNA 2PN6A 2HWTA 4DV0F 1ZETA 3FBEA 1OIAA 2F8EX 1I94J 2ZH6A 3LUYA 2HSEB 4GMKA 2ZC4A 1TV6A 2BACA 1K47A 2DH9A 2DR9A 3OPKA 4Y0FA 3VZIA 2OGUA 3POTA 3M2RA 1TK0A 3I5CA 2R3VA 3BYPA 1VC6A 1JWWA 2FD2A 4KO0A 3N9UC 2CPYA 2YNFA 4NRUA 2AJ2A 3MR6A 1RAFB 3I6PA 1GK8A 2OEMA 2ZDOA 4DLEA 4M94A 3JTNA 2IC3A 2ILYA 2JC1A 4YP3A 3EPIA 1S6UA 2HKEA 3ETOA 3DGVA 4DR5F 4LF6F 1AA1B 4YMEA 3M6WA 4EYHB 2V63A 2WVFA 3ZZ0A 3BKTA 1U6ZA 2ROGA 3ILLA 4CDIA 3D66A 3QBCA 5FIIA 4OYXA 4JI0F 3W60A 3NBPA 3R5DA 3ZFVA 4D3HA 3CMAS 3BZQA 1MWYA 4IFYB 1FJGF 1RAJA 4YHHJ 2D74B 4KGXB 3IRXB 4OI6A 3R1HA 3LGMA 2YKQA 2FHJD 2VG6B 8AT1B 2KFZA 4JI3J 1Q78A 1KR4A 2GNKA 3MMCA 2XLJA 3VAFA 3MUMP 4C11B 1GAOA 3SQGB 1YG0A 2MDAA 3ILJA 2C42A 1V9OA 3MHYA 4OYZA 2XTJP 4ZPDA 4DJBA 4ANCA 4ZHRA 1DARA 4ZJQA
chains in the Genus database with same CATH topology
1VQ5S 2K7KA 3W2WB 2V0NA 3DRPB 5AXLA 1HWUA 2GMLA 2RE1A 2IMWP 3KTQA 4G3IA 3FEYB 2LMIA 5THWA 1Y5NB 4ECZA 3OFEA 3K8WA 3C6TA 4X84A 3ZZRA 2YWFA 1LWFA 1URNA 4YB5A 2HS3A 1S0OA 2PFFB 5E3QA 4F67A 1UEUA 4XDCA 2KXFA 4DR7F 3I0SA 1NK4A 4BDPA 4ED3A 3MTKA 3QWPA 3V2UC 4H4MA 1BQXA 4NYOA 3CUNA 4ED6A 2J0XA 1Q86T 3Q8SB 3S01A 1M1KT 3BSNA 4Q0BA 2V4JB 3IR7B 2KG1A 4ED0A 3DLEA 3K5NA 2Q6CA 1VIOA 3K5LA 4Q8EA 2P6TA 3GQCA 4NXNF 3R1LA 3WZ0A 2OPPA 3KLGA 1IUJA 3KKFA 1HBUB 1NK8A 4TNOA 3NNAA 5KFSA 2CVEA 4KKOB 1RTJA 5HLFA 2IBKA 4D3GA 1HBUA 4RUHA 4ZCMA 4IO9Q 4J9OA 2P9CA 1U25A 4I7FB 1NK5A 2R7QA 5HMYA 4QPXA 1TL1B 4E8UA 2J9EA 4DEZA 4ID5B 5A6PA 1UETA 1S9GB 5F8HA 3M9MB 3D2WA 4A8KA 2BBEA 4F02A 1S9GA 4KE5A 3KLHA 1R8BA 1S6PA 1WF1A 2KVIA 2L9NA 4OZ0A 1O8BA 2ZNZA 3S8SA 4K4XA 1R8PA 2O5DA 2B9YA 4WU2A 2KU7A 3L3CA 3GV7B 4ZDNA 3MPWA 4RW8B 5DO2A 1FEEA 3HKZD 2AD9A 1LFPA 3DC2A 3MMAB 3PVXA 1FKOA 2XSJA 2AJQA 3KLIA 3QZ7A 3DYAB 5J1EA 3PW0A 1DRZA 2CKWA 2I0XA 1B0PA 2HS4A 1UVMA 2MGZB 4RW9B 3G9CA 2JZ5A 3X3UA 4DR2F 3DRPA 3N6NA 4KFBB 1R0AB 4OI2A 5DETA 4DSEA 4DFJA 1BLUA 2F7VA 2HIQA 2ASDA 1SH3A 1U48A 2PI5A 1JLQA 4IDKB 2DTJA 2WBRA 3QAEA 3GR0A 2AX1A 4XK8C 3MPYA 1U1NA 2FJEB 5D3GB 2O1PA 2L41A 3LOUA 2IM1A 3PDNA 1VK3A 2M5YA 3R5BA 3FNNA 2PE8A 2FVRA 3T1HF 4N8NA 2ZHBA 2M8HA 4PXDA 1REVB 3IFEA 1N56A 3M8SA 1Z2LA 1WNEA 4G1QB 1V6HA 4EFAC 4FPRA 2RDJA 3PJWA 2FHKA 4N47A 4DN9A 3AAWB 1JLBA 2VBZA 1WF2A 3SCIE 2G1DA 1C1BA 2KHCA 4H4KC 2DITA 4DLEA 3FDSA 2YNGA 2DNPA 1VQPS 2Y1IA 3OTOF 2GIRA 3H5YA 2UXCF 2QA1A 4EZ9A 2BUNA 4ZVFA 1PSDA 3RRHA 4RWXA 2HVHA 2B4PA 1JLGB 4ED8A 4M95A 5F0WA 2RVJA 1EETB 4IFVA 2ADBA 3BQ2A 5KFYA 3IBWA 1OO0B 1LXJA 3HVTA 3W7BA 3C46A 4EBDA 2OSQA 4MYUA 2RMLA 1H98A 4QU7A 2BANA 2OO4A 3HHLC 4IO1A 1U1PA 1X4HA 2CQPA 4O23A 4ZMMA 2V4RA 4P6QA 2ZDPA 2J7WA 1HPZA 3Q2TC 5SUHA 3CCSS 3IR6B 3RTVA 2IM3A 4LIRA 3T5HA 4X4OA 4URQU 2HVZA 4OZ5A 2HHVA 2K1RB 1QSYA 4MH8A 3UWTA 3MF5A 2MZQA 1XERA 2AF6A 4FNHA 3IWXA 3CJKA 3OL7A 2IHR1 4PG8A 2CPEA 3V6KA 4B9LA 2B56A 1RT2A 2XNRA 3NAHA 2CDQA 2QMWA 2E29A 5I3UA 1I1GA 1SIZA 2MKSA 1UEVA 2MSSA 3GILA 3H4BA 4FF2A 4XO0A 4F4WA 5FJ4A 2ZHAA 2CQ4A 4TU9A 3CJ3A 2HS0A 5D4PA 1RT3A 4DSJA 1R8AA 5BYRA 1VFJA 3TP2A 1B0VA 1J5OB 1RT4A 3RAXA 1NRKA 2ZH9A 2Q3PA 2VFTA 3D0IE 5B0AA 5J2NA 1HNZF 2AU0A 3GIIA 1F9FA 1ZM2A 2BANB 3B82A 3MGJA 4FVCA 1U45A 2ZH4A 1ZZNA 4EO6A 2QZ8A 2PEHA 1C0TA 2JFKA 2RUGA 4B02A 3UCUP 1J2VA 4USIA 1DTQA 3QJPA 5CYQA 2GFFA 5KFMA 5SZTA 3QO9B 1UJ4A 4NLXA 4J9SA 2CJQA 3MM9B 1G1XA 4OZ1A 2LDIA 3LWLA 2OPRB 2VC1A 2VG5A 2W9BB 2N3LA 3VAMA 1QSSA 2OH2A 2DCUB 2XY5A 2LQ5A 2ASLA 1JX4A 1SKRA 2HGNA 2HYIB 3O8WA 1FXDA 2M88A 1K73T 3NAIA 2E1CA 4LF4F 3DI6B 2MQPA 1IKYA 2DT9A 3N5FA 4H4OB 1RT6B 4A8SA 3V6HA 4HHJA 4PPDA 3PNIA 4B17A 3OVAA 3KHRA 4DN0A 2MJNA 5CZXA 4O3OA 4CO1A 3MURP 1HL6A 3KHGA 1TKTB 4ECXA 3KK1A 4F3OA 2CQ3A 1S9FA 5L8RC 2YVSA 1VQMS 5IT9Y 2DCLA 5LJ3Y 3DLLQ 2YWEA 4PUOB 1EETA 2VBYA 4IFVB 4OI3A 1FK9A 4UOCA 1S1VA 5FD1A 5HBMB 3K58A 3QJJA 4OFZA 2M0GB 1YJNS 1I6JA 2V9KA 2KKHA 2E7WA 2CQHA 1N5TA 2OFGX 5DDQC 5GADI 1NEEA 2VH7A 2HW3A 1Z4UA 2B4OA 3VAJA 1TFYA 2CQ2A 3V6DA 4K4WA 1WI6A 4Y2KA 3BQ0A 4DBQA 2ASJA 5D8HB 3BEGB 1VLYA 4C8OA 1V3ZA 1HW9A 4DHVA 3OL6A 4WFXA 1HA1A 2C2DA 2O66A 3PR5B 2DHXA 2JJ4D 3HHDA 5CHCB 2GGPB 6FDRA 3DLJA 5HLFB 4X66F 2LU2A 1AFJA 2AYMA 3GFHA 2JVOA 1P9QC 4WZQA 4ZP8A 2V8HA 3TW0A 2UUWA 3JSRA 4RUCA 1N8RT 4ED5A 4AXJA 1WHXA 3SFUA 3NGKA 5A2QY 4C3KA 3F73A 2BV3A 4CH1A 4NLGA 4PUOA 2YKNA 4KGKA 4B3TF 4WE1B 2BM1A 2ZOFA 4F2SA 1LK7A 1DHMA 1D1UA 1RK8A 2CPHA 5LSLA 2EFGA 3Q8PB 3I55S 2HMIB 3TARA 3O2IA 1HHSA 1S1WB 3WBZA 3H40A 1JLCA 3MD3A 2BE2B 1ZAVA 2FPHX 2CJBA 5BJRA 2KZZA 1M0SA 4MIBA 1IQZA 2DHSA 2GMHA 4DSFA 2MQLA 3PY8A 5F8JA 2KG0A 2DNKA 5AXKA 3VZHA 3DLHA 1VQNS 1L3UA 1M5KC 2ILZA 1MU2A 1V3RA 3LP0B 4WTYA 2XS5A 1GX5A 2W8KA 2DGQA 1JKHA 2F8MA 4OJ1A 3CD0A 4ALZA 2ZITA 2GJIA 3DGPA 4NL5A 4NYZA 2C3OA 4NLQA 4PQAA 1YSJA 3KJVA 2ZVSA 1TK8A 4LQ9A 4IG0A 2KO1A 2OKQA 3AQOA 2M7SA 1U26A 2VODA 4WK1A 1ZZFA 1JLFA 4KC5A 1R8HA 2C2RA 4AL7A 1S1VB 4X4SA 3GR1A 2QA4S 1LW0A 3DLGB 1N6QA 2MZSA 4KHRA 5AXNA 4ZPVR 2RRNA 1WACA 4F4YA 1S49A 1SJQA 2VBXA 2L08A 3GFYA 4N5SA 5EUHA 4LUBA 4Y2MA 4C0OC 1JJ2R 1XEZA 5HMWA 4A48A 3UR0A 2QIFA 2W4PA 3KLFB 1HD0A 2AGPA 1LKZA 1SH0A 3DDKA 1R8CA 3MEDB 4OHXA 2WW8A 3CCJS 2V2KA 4O4GB 2PD1A 1HMVB 2FB0A 4HYKA 2R8IA 3CCRS 3AY0A 3NGDA 2AYBA 3B78A 4K4YA 1KC8T 4I2QA 4Q2MA 4BC7A 1K0TA 1GH8A 1TL3A 4PWDB 3I32A 1Z1ZA 1Q82T 4LVNP 3FSXA 4CT8A 1U4BA 1YJRA 1MW7A 4NZ6A 2WTFA 2YKPA 2GO9A 2QO3A 3C6TB 5GAHI 4IH6A 1N34F 1KQSR 4X4RA 1GXLA 2MZJA 4F8RA 1FRLA 4WXWA 3RR7A 1X4BA 1ZPVA 3KK2A 1LWEA 1Y7PA 2U1AA 5GVQA 2R7RA 2N82B 3HVWA 1S77D 1N5VA 4NCGA 4ID8A 1MWZA 1UP1A 1XC9A 4YDXA 2VG6A 3UCZP 1JKHB 2WRMA 3DCAA 4B9SA 2V8GA 1NAQA