1WHYA

Solution structure of the rna recognition motif from hypothetical rna binding protein bc052180
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
97
structure length
97
Chain Sequence
GSSGSSGKIGYGKANPTTRLWVGGLGPNTSLAALAREFDRFGSIRTIDHVKGDSFAYIQYESLDAAQAACAKMRGFPLGGPDRRLRVDFAKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords hypothetical protein RIKEN cDNA 1810017N16
publication title Solution structure of the RNA recognition motif from hypothetical RNA binding protein BC052180
rcsb
source organism Mus musculus
total genus 7
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1whyA01
1KOHA 3Q2SC 1FJEB 3VAGA 4BS2A 5DDOC 3FEXB 3EX7B 3P5TL 4IUFA 3UCZP 1WF2A 1WEYA 2U2FA 1YITS 2XNRA 3MD3A 3S6EA 3BO2A 4M5DB 2OJ3A 1VC5A 2E44A 1S72S 2QEXS 2CPFA 2CQDA 5ITHA 5DDRC 2MMYA 1R8PA 3SXLA 2KI2A 4FXVA 3U1MA 4F26A 2JRSA 4ZKAA 1OPIA 2MKHA 1X4GA 2BZ2A 3PIOQ 1K8AT 4C7QA 2DH8A 4QU6A 1HD0A 4CH1A 4P6QA 2WBRA 2X1AA 1M5KC 3TYTA 5GAGU 2MKJA 2MQQA 2RRAA 2CQ1A 1A7GE 2E5IA 1N88A 2RQCA 3UE2A 1WI6A 2KT5A 1WHVA 5BJRA 1H6KX 1SJ3P 1DHMA 2CJKA 2DO4A 2LMIA 1WHWA 3MURP 3EGZA 2X1GA 3MUVP 1VQLS 2KRBA 1X4FA 3NNHA 2E5GA 2KXNB 2XSFA 1U1NA 4U67Q 2VOOA 3P49B 1AUDA 2LEBA 2CQCA 3CCVS 2HYIB 1WF1A 2F9JA 4CIOA 1U6BA 4C0OC 1YI2S 2PEHA 1ZZFA 2M52A 3NS5A 5CYJA 4ED5A 2VOPA 1UFWA 2MQPA 1SJFA 4PR6A 2DISA 3HI9A 1YJ9S 5CA5A 3FEYB 4WFNQ 4WFBQ 2XB2D 3G71S 2SXLA 2CPZA 1WHXA 1FNXH 2OSRA 1X4AA 3BO3A 1FJCA 2MQMA 1N8RT 1OIAA 2DHSA 2J76E 3SDEA 3DLLQ 2DNHA 2KYXA 3BEGB 5LXRA 1VC6A 4QQBA 3CC2S 1JMTA 5IM0A 2NLWA 3CF5Q 2M9KA 3CCJS 1O0PA 1FHTA 2DNRA 2RT3A 1X4DA 5DETA 1HL6A 2DNLA 2G1DA 2KN4A 4ERDA 4CQ1A 2CQ3A 3D2WA 5GVQA 1RKJA 1U1QA 2L08A 4PRFA 2VODA 2M0GB 4LMZA 3NNAA 4OZ1A 2XS7A 1VQPS 5LXYA 2D3OR 1ZZNA 1IQTA 1P27B 5DDQC 2LECA 5DM6Q 2CPDA 1OWXA 4LJMA 2DHAA 2DGOA 2CQ2A 2LQ5A 3VAKA 4RU2A 2YWKA 2QA4S 3R1HA 2J0QD 1M5VC 4YUDA 2N3LA 2LEAA 4TU7A 5FJ4A 4YB1P 3US5A 3THTA 2ADBA 1VQ9S 3EGNA 2JX2A 2CQIA 3H2VE 2DB1A 2X1BA 3H2UB 2EK6A 1L3KA 2CPHA 1F9FA 2AYBA 1SJ4P 2CQBA 1SXLA 2DNNA 3G8SA 1X5TA 2CPXA 4W92B 3S7RA 1B7FA 3VAMA 2DNPA 3ZZYA 3N9UC 1OO0B 1X5OA 4Y0FA 2NZ4A 3BO4A 1NO8A 2D9PA 1X4CA 1DZ5A 1XN9A 2DHXA 1FO1A 1N54B 3B4MA 3MOJB 3SDEB 2V94A 1M90T 3J7ZT 2HGLA 4CH0S 2XS5A 2GO9A 3UD3P 3R27A 1HA1A 3UWTA 3ZZZA 3I56S 1K73T 5DDPC 1YJWS 2BOPA 5IM0B 5LSLA 2RQ4A 3CCUS 3CC4S 2DK2A 2JVOA 2M88A 4WIIA 1M5OC 2MQOA 3G9CA 2RS2A 2FHOB 3UD4P 2DIVA 1KOOA 3S01A 2RNEA 1VQ5S 3PIPQ 1UW4A 1YHQS 1KQSR 3V4MA 1U1KA 3G8TA 4Y00A 1H2VZ 3BS9A 3MXHP 2RU3A 1HD1A 3RW7A 5D77A 2MHNA 2CPIA 2KU7A 2CQPA 3HHNB 1X4HA 2YTCA 1W2BR 1WWHA 2M4MA 1VBZA 1WG1A 1SJQA 1S79A 2CQHA 2LA4A 1JJ4A 2N82B 1UAWA 2G0CA 3CULA 3P3DA 1KC8T 3U1LA 4F02A 3CCMS 3R1LA 2I38A 2I2YA 5CXTA 2MPUA 2X1FA 1KD1T 2LXUA 2DIUA 3CCRS 3MD1A 1FT8A 2KM8C 3CC7S 5HO4A 3NNCA 2MGZA 1VQOS 4WKRA 3VAJA 3CCSS 1NJIT 2OTJS 1WG5A 2RS8A 5LSOA 1U1RA 2KM8B 2F9DA 4C4WA 1VQMS 4Z2XA 2FC8A 1VQ8S 2MKKA 1VQKS 2AYMA 2ADCA 2MKSA 2M7SA 3CCLS 4OZ0A 3DXBA 1YTYA 3TO8A 1JJHA 4QPTA 2OSQA 4EGLA 3MUTP 5JVHQ 2YH0A 1Q86T 2MZ1A 3LQVA 2D9OA 2VONA 2GHPA 2N7CA 3CMAS 1H2UX 1U1PA 1QVFR 2MQLA 4YOEA 3CCQS 5EN1A 1CVJA 5IFMA 1P1TA 3SMZA 2KFYA 1DBDA 2OTLS 2LXIA 4IOCQ 1H2TZ 2HVZA 2DGWA 2HZCA 3I55S 2G4BA 4J5OA 2CPEA 3VAHA 2LKZA 1Q81T 3G6ES 2MZJA 2XS2A 5DM7Q 3THPA 2DGUA 1VC0A 1Q7YT 3IWNC 2MZTA 3Q2TC 4UQTA 2QFJA 4FXWA 2ZJQQ 1X5SA 4UY8T 1A9NB 1R8HA 1U1LA 1X5PA 2MY8A 1URNA 5LJ5Y 1VQNS 2EK1A 2MSSA 2B0GA 2OIHA 1YIJS 4QU7A 2KXFA 2AYEA 2LYVA 3S8SA 1VBXA 4PKDB 2DNMA 2CQ4A 2HGMA 2MZQA 2O3DA 3UCGA 4LIRA 1ZH5A 4W90B 1YJNS 3ULHA 2CQ0A 2DO0A 2KVIA 2DNGA 2MGZB 2KHCA 2J8AA 5GMKa 1N52B 2KH9A 2A3JA 5GADU 3MUMP 2DGVA 3L3CA 1WHYA 1U1OA 2MY7A 2KXHA 5GAEU 3MDFA 2HGNA 2DGXA 3VF0B 2MXYA 2DGQA 2DGSA 3CD6S 1SJRA 2M8HA 2DNOA 1UP1A 2L41A 2MZSA 3VAFA 1FJ7A 5D78A 4TU9A 2U1AA 2KG1A 3UCUP 1K9MT 3P6YC 2EVZA 2MYFA 3G4SS 2FY1A 2DNQA 3MI7X 2PE8A 1WEXA 4TLQA 4IO9Q 2RUGA 2MSTA 3NS6A 5H1SV 1VBYA 3K0JA 4F25A 4A8XA 2DH9A 5LJ3Y 2DNZA 2CQGA 2E5JA 1Q82T 4WF9Q 3IRWP 5JVGQ 1U2FA 2YH1A 2FC9A 2YKAA 1QVGR 1FXLA 2MB0B 2E5HA 3G96A 2DNYA 2FPHX 2AD9A 2DITA 1X0FA 1G2EA 1WG4A 1VQ4S 2DH7A 1RK8A 2K3KA 2RVJA 1D9AA 2CPJA 1QM9A 1WEZA 1X4EA 2DHGA 2K8GA 2MQNA 2MZRA 3TP2A 2M70A 2CPYA 3VALA 3CTRA 3J7YU 1M1KT 2XNQA 1PGZA 2LA6A 2RRBA 1WF0A 3LPYA 3JB9k 2MKCA 1WELA 2DNKA 5HL7Q 3CXCR 1X4BA 2KRRA 3B4DA 2N3OA 3CPWR 3CCES 4TU8A 2UP1A 2ERRA 1BY9A 2F3JA 1WTBA 5MLCV 1DRZA 5IQQA 1VQ7S 1VQ6S 1U1MA 2Q79A 1U6FA 2M2BA 2ZJRQ 2JWNA 4WCEQ 1M5PC 2L9WA 1WI8A 1D8ZA 4WFAQ 2J0SD 2MKIA 2AYGA 4IOAQ 1NU4A 2DGTA 2MJNA 5GAHU 1JJ2R 1PO6A 2LCWA 2JVRA 3RW6A 3CMES 2MJUA 4V19X 1YWXA 3OW2R 3NMRA 3CUNA 2ZJPQ 2KG0A 3VAIA 2M8DB
chains in the Genus database with same CATH superfamily
3FZ2A 4O3SA 3TNVA 4LFBJ 3ISZA 4KV8B 3NAHA 3VV2B 4P73A 3FEXB 5IV3A 3CD5A 4IUFA 5IS2A 2YWFA 1T9VA 2MEWA 3QRRA 2FZCB 4UUXA 4LQ3A 1EIYB 3OJUA 3SZ2A 2UXDJ 4RWXA 4L3KA 2K7KA 5F8IA 2WONA 1PSDA 3AA8A 3CJ2A 2X3DA 4OYMA 1K8AT 4WYWA 1S9EA 3Q24A 1XMQJ 2VFUA 2KT5A 3D67A 2NYIA 4E98A 4ZVPB 3QT8A 1WHWA 2MQ8A 1IKVB 4KSEB 2KXNB 5EDWA 1R7IA 4RUCA 4WXWA 2ZDOA 1HPZB 2ZNZA 2P5VA 2GNKA 2YKMB 1U6BA 2HHHF 1S1UA 1FKOB 1ELOA 1SJFA 1AUSL 3CJ3A 4LT6A 1FNXH 2ROEA 2OSRA 4S0MA 3HHLD 4BCAA 2J9DE 3D6HB 2WCXA 4X4UA 5I3UA 1GTEA 1X8DA 2KYZA 5IM0A 2IM3A 3E01A 4GKKF 2JZ5A 1LK7A 3DHWC 2KFZA 3W9HA 3EZOA 2DNLA 2G1DA 3RUBL 1TAQA 5RUBA 5E2QA 4KHPJ 3K5LA 2L08A 3QFWA 4DR1J 3VCDA 2XMMA 3DU5A 4RWWA 1WOOA 3KHGA 2CPDA 1KSPA 2WSEC 3FRZA 1UVMA 3N0VA 4N8NA 2UVUA 2BMBA 2ZBIA 2RQKA 5A2QY 3GIIA 2AP6A 5KFRA 1ZPWX 1NH8A 3DGPA 2J9DA 3Q8SB 4B9LA 2B7BB 1X5OA 4Y0FA 1NO8A 3MM5B 4Q0BB 3ILOA 4X66F 1LKZA 3QAEA 2R7WA 3V4IA 3HK2A 2NCKL 2V94A 3Q86A 4OX6A 2D7SA 3ZXWA 3W66A 3BBCA 3C6TB 1YJWS 3TZWA 3J81U 3HVAA 3BH7B 4ZPTR 2NREA 3LW5C 3FZBA 1KKHA 3TUZC 2CZ4A 3D4JA 1C0TB 3TZZA 2EG1A 5D77A 4FYDA 2MHNA 3HHNB 5KG5A 4ZVGA 5A0YA 3H7HB 2YTCA 2RH3A 2FY8A 2M4MA 2V63A 2XEXA 4LF5F 2EFNA 2R8IA 2BACA 4USKA 7FDRA 4IOBA 3R7NB 1HW8A 1LFWA 1KD1T 3ZZUA 2XCPA 4ED0A 3PW4A 4EMDA 3CC7S 4DV2F 3BDPA 1MROA 4O44B 1HW9A 5B0BA 5EGYA 5LSOA 3VR1A 2PA8D 3H59A 2FC8A 5DQIA 2HLTA 1FRLA 1JJHA 4EGLA 2MZ1A 3JYTA 2Y3YA 2J5AA 2ASLA 3BB5A 2E1AA 4P7VA 1JLBB 4DUYJ 3HFVA 2GVDB 2GHVC 4YR0A 4B17A 5EWEA 2C3PA 2IMWP 2XS2A 2MZTA 1QAIA 2BABA 2P9CA 4CCHA 4DHVA 2ZJQQ 5EUHA 1R8HA 3WDOA 3L7PA 5LJ5Y 3GMGA 4OLOA 2B5JB 3H5SA 2IIHA 4R8UB 2HRUA 3N5FA 4R5PB 4U8VA 3OUYA 2OMLA 2ZVIA 4WP9A 2DO0A 2I5JB 5HBMA 3K59A 1HI0P 2IRXA 2J8AA 2KH9A 1IWGA 1YRXA 4O0NA 2IVMA 2CFXA 2MY7A 1U1OA 2DGXA 4X2BA 1REGX 3GYNA 3W3SA 3NOCA 4ILMA 2IC3B 1FEHA 4RJVA 1RT2B 2ZKUA 1LWFB 2OFHX 3JTNA 2GMLA 1K1SA 2RKIB 3QZ8A 1WDDA 4P74A 4V19J 4U6PA 4QPXA 2W2QP 4I69A 2YX1A 3MPVA 1NEEA 3ZNJ1 4DR5F 1NK0A 3QRPA 2G0JA 3TJ9A 1NM2A 1RABB 2K7JA 2E1RA 1SIWB 1P8GA 3A8JA 3LPYA 4DPUA 2NSBA 1XIQA 1BWVA 1J27A 1IKVA 1H7WA 5F3TA 4AD6A 1U45A 4NXMJ 5AJ3J 1D8ZA 5CYMB 1HPZA 2YWWA 2YKMA 1PO6A 4ED7A 5AXLA 4RNNA 3CCTA 4A8MP 1U0HB 1RBLA 3VGUA 4DUTA 3GONA 1B0VA 4LSLB 3SV4A 1I51B 1DQ9A 2GFFA 1PYSB 1YITS 2HIYA 4UZBA 2R9LA 1NK6A 4ZPDA 5KG6A 5KT6A 2OD6A 4DCOB 2E44A 3JTOA 3DC2A 2QEXS 1VK8A 2Q1LA 5DDRC 2RJZA 1Q8BA 2JRSA 4ZKAA 5BYRA 3MM8B 2BZ2A 2FUG9 1U8WA 4DX6A 3TYTA 3VGVA 3D1HA 2ROPA 2Z4PA 4OYAA 3BSNA 2B4UA 1CQNA 1TP7A 4ZPAA 1RT6B 1N33J 4CLYA 4DX7A 4JI8F 2BV3A 2I6WA 1XBWA 4JUZA 1VDHA 3PYEA 5F8NA 2OKQA 1ZZFA 3AD7C 4ZPWR 3T6JA 3OVAA 5C25A 3MM5A 4JI3J 4Q0BA 3EZUA 3I9V9 3MFIA 5LXRA 3CDUA 4MKYA 3C6TA 3ISND 4CLZA 3FCVA 2DNRA 4ZIWA 2KN4A 1RTIB 1C0TA 4HTIA 1A6LA 1U24A 3KHHA 1OJ4A 1RDRA 2Y1LB 1I3OB 1FFWB 3KKFA 1VQPS 5KFTA 3N6LA 3WC0A 3HKWA 2X7IA 1VI7A 3MMJA 4IFYA 1GH8A 4YUDA 3T5HA 2W8LA 3US5A 4PG8A 2ZH2A 4DR2F 1Z4UA 3H2UB 4E0DA 1R89A 4QIFA 4LFAJ 1NHUA 5EHHA 2YKNB 1E6VB 1GT8A 3S7RA 4O44A 4NCGB 3GV8B 1XMBA 3QZ7A 5IXUA 2W9AA 2RSQA 4DV3J 3R2DJ 3RB0A 5E3PA 1N54B 4ZMMA 3R6GB 2HGLA 1VLOA 4ES3A 5D0RA 3I56S 1PYTA 2Z0GA 4M1KA 1JB0C 3NXZA 3A8KA 2QRRA 1FTRA 5CCMA 3S01A 3M2VA 1S0NA 3G8TA 3C6UA 1S1TA 1H2VZ 4LR9A 1KWMA 1GAOA 2GVDA 2D3UA 4JI1J 1HNZJ 2XULA 4ECWA 3WX4A 4TLRA 1VHIA 1UAWA 2BW2A 2NQPA 1DQAA 4DL2A 2B5JA 3IA0A 4R8UA 5KTQA 2I38A 4R5PA 4PPZA 3G6YA 3JS9A 5E3RA 4FKXA 1FT8A 3EXCX 3ETOA 2I5JA 1Y4ZB 3PYGA 5J1NA 2VDIA 1VQOS 4WKRA 1TL1A 4P10A 2F9DA 5BR8F 2E7WA 4OJ3A 4F3MA 5LL6d 4IR1A 2E9TA 3TO8A 1LWFA 1MWYA 2HZVA 1AZSB 4M95A 1R3NA 2HHVA 1UMJA 2O67A 2QFIA 2RKIA 1VRTA 1KONA 4H4MA 5EN1A 3AD9C 4DCJB 3T5JA 2IDLA 2KFYA 1DBDA 2QIFA 4LRAA 4C9DA 2ILZA 8AT1B 3UDLA 2CNOB 3HSZA 4KRWA 2CPEA 3TX0A 4HI2A 4JI2J 1RJJA 3Q2TC 3FFIB 4Q2MA 4ED6A 2XC9A 2NUHA 3M8QA 2LYVA 2W2MP 1VBXA 2LVWA 1U2CA 5KFLA 2AEMA 2JDJA 2FTRA 2HVHA 5CYMA 2YKOA 3TVZA 2B9YA 2KHCA 3DLKB 1T9TA 4CO0A 2C42A 2JSXA 1NPPA 1UP1A 4OX8A 4LSLA 1XK8A 2NR0A 2B8PA 4AL7A 4JP8A 4HL9A 5H1SV 3N28A 2Z2LA 4F25A 3D54A 4LQ9A 4NL5A 1Q82T 3JSMB 3J7AN 2AMCB 2VA2A 1I6JA 3MM8A 1CJUA 2XO6A 2IVYA 2E9ZA 5HVHA 1RT6A 3Q89A 2UP1A 3DLBA 1GQEA 4WU3A 5KFJA 3MM6A 3D0HE 2KJWA 4NLVA 4WCEQ 1M5PC 2MKIA 1CEZA 4RNMA 2O66A 5AE2A 3RU0A 2JVRA 4C3MA 3BGUA 4TY8A 1YLXA 3GV7B 1FJEB 4JV0A 1WF2A 3GIMA 3MD3A 2UUWA 2YNGB 4B3MJ 3QFHA 1SKRA 3KLIA 3TA2A 1OPIA 4J9LA 1ACMB 1S5ZA 2AEFA 4A46A 2CADA 3NMAA 2VQFF 3NEKA 3LO3A 2FHJA 4CLKA 2HQIA 4M5NA 4B08A 4UTGA 3NNHA 2XSFA 1U1NA 2AGQA 2CQCA 1N5VA 3O3LA 3D7SB 1E6VA 2Q6CA 4GRSA 4JI5J 3M2UB 1YJ9S 1C0UA 5CA5A 1S59A 3G71S 2LDYA 1WHXA 5GAEI 3RR7A 3BBBA 2HS3A 2VH7A 1OIAA 3QSIA 1IXKA 4B3RF 2BEFA 3CC2S 2Y9HA 1IKWB 2H48B 3K5MA 1X9MA 2I1RA 4KY3A 1H74A 1Q4RA 1FXDA 1FEEA 1RKJA 2MLYA 4KR0B 2GX8A 5DDQC 2ASDA 1UVIA 2DHAA 2CQ2A 2YWKA 4KGVB 1S7HA 4K4VA 2HFUA 3DOKA 2DEIA 2X1BA 4RUBA 3GJQB 2HKEA 5DJBA 4KIAA 1SJ4P 1SXLA 3H20A 4OZNA 3BGOP 1OO0B 1GXTA 3A13A 2VIHA 3MOJB 3LAKA 3SDEB 1U26A 3LANA 1SI9A 4C8KA 1FDNA 2DHHA 1AZSA 4F4ZA 3MM9B 1Y3JA 2MQOA 4ICLA 3P5BP 4E8UA 3V4MA 4X4OA 1K47A 2KVQE 1FJGF 3M8PB 1WC0A 3GFXA 1Q95G 3E51A 2Y1IA 2HEKA 2BE9B 2AHOB 2LA4A 2V2ZA 2Y0SD 4X84A 3R1LA 3U7JA 3AOBA 2CDQA 2I2YA 2YQ1A 2C22A 4F3QA 9ATCB 1JLFB 1RT1B 1NJXA 2HQ3A 1IR0A 2ZH7A 3KHLA 3W5YA 3KLGA 5HK4A 2OELA 5DG7A 2V50A 1NDPA 3MPUB 1UVLA 5ADZA 1R6VA 1FDBA 2OD4A 2IM1A 4F0MA 2BJ7A 2AZ3A 4ELVA 3C16A 5HMWA 4A8WA 3K8VA 1QVFR 2PEBA 4U7UK 2VBWA 2OLWA 1K0TA 3R3TA 2VFRA 4F0KA 3VAHA 4LBPA 1MU2B 2EC0A 1U1LA 4H4KC 3O1LA 3A8EA 4LVOP 2Y1JA 1S97A 4IQXA 4JI7J 4CLUA 1P1LA 3CNQP 1UL3A 4CH7A 3JSBA 5HI7A 1NDLA 5CAAA 1SL2A 2ZZNA 1S6OA 2MXYA 2N4DA 4F4AA 2OGUA 1TK0A 1JNZB 2L41A 1KTVA 4DV4J 1K9MT 5DGAA 2MYFA 3MI7X 2YNGA 3QJLA 1VBYA 3K0JA 1FX2A 1EKSA 2FC9A 4ANDA 2DNYA 3IR5B 2ZH4A 1RHKB 4LRDA 2CPYA 3TJ8A 3T19A 3UD5A 3IRXB 1YKWA 3KTQA 4A4JA 4UZCA 3GLJA 3U1NA 1S6PB 5IQQA 4FYXB 3QIPB 3FNNA 4MYUA 2B6AA 3PKYA 5ETNA 2XY6A 2NS1B 3Q8PB 2A1BA 1RU1A 1RT5A 4QIVA 1KR4A 3EX7B 1UWBB 1UFLA 4LFBF 4CM0A 3MOZA 1QSYA 4EYIB 1IKWA 2VG5B 2IRYA 5KFEA 3ZZOA 4OI3A 2HWIA 1BHNA 1C4CA 2B7CB 2UXDF 3GG1A 4ZN1A 3NGTA 2MQQA 4J9OA 4HACB 3UE2A 1NLKL 4Y34A 1DURA 2IA6A 3F56A 1XMQF 2E1CA 2HNDB 2FB0A 4R25A 1SQFA 2AF6A 4NA2A 3MURP 5KT2A 4FS2A 4EWTA 5LMNJ 3OXFA 4C11B 1WF1A 3GFZA 4EO6A 1SCJB 4CZCA 4K4SA 1NHKL 4MIAA 2E9RX 3FEYB 4WFNQ 4DJBA 4KBIA 3RAXA 4B3OB 4DR3J 2JEIA 2BXJA 3SDEA 1UJ6A 3JQJA 2NXCA 4O3NA 1QUVA 2NPFA 1HNVB 3MM9A 3CF5Q 4FPIA 2F8MA 2E7VA 5D0EA 2ZH1A 5J1EB 4UUWA 4NA1A 1HNIA 3M8PA 4NZ6A 2WB4A 4YB7A 4WK3A 2X3GA 3BN7A 2BJ1A 2M0GB 2BJEA 1HMVA 3CJKB 4DR1F 4LJMA 1LW0B 2G2YA 1Q8LA 1QLNA 3HVRA 5HSPA 4XDCA 3CT9A 2CRLA 3MMCA 1FESA 2QL5B 4OJHA 1F9FA 3R9LA 3OV7A 1JLFA 1LQ9A 4DR7J 1RT1A 3N9UC 3KJFB 4DSFA 4CWBA 1QAYA 1TAUA 1DZ5A 1XN9A 1UA1A 4CLSA 1KVKA 5A6PA 2MLZA 3R27A 1HA1A 4NCBA 2W01A 1MMLA 3LALA 4AFFA 4LF6J 5K14B 2RS2A 2FHOB 4NLQA 2EKYA 3PR4A 3HT0A 4LRCA 1YHQS 2JNJA 3ZTQA 1HHSA 1RWPB 4X4VA 1RACB 4ED4A 1VMBA 2HNZA 4RBTA 1HD1A 1KRPA 2BRLA 1UPPA 1NK4A 4DL3A 2PI4A 2B43A 3QJJA 3TANA 1HIYA 1NSQA 1MU2A 2VQEJ 3HO1A 3A12A 3PRVA 4B02A 4F02A 3OHAA 4UT4A 5CXTA 2QYCA 1RADB 2W1BA 3CWJA 3IN5A 4Y28C 3QSYB 4I6AA 3ZTPA 1U1RA 1JIHA 1F0XA 2IJFA 1FVSA 2AT1B 2DY1A 2DT9A 4QPTA 4OHZA 3OJSA 3IGNA 1ZA1B 1WTFA 1H2UX 5KFXA 4KYZA 2GV1A 3UR3C 2DR8A 1LWEA 2H5IB 5SUHA 5KFFA 3ZZTA 2HW3A 4DUYF 4C0HA 3C14B 4ECUA 3CO0P 1CPZA 3L4BC 3OL8A 2CJYB 1Z2ZA 1NNDA 1U8SA 2OO4A 1N4LA 2MSSA 5I42B 2IBKA 4NOHA 4QU7A 2AYEA 4GO7X 2QMUB 2XYPB 1S6PA 2UUBJ 1L3TA 3QIPA 3CJ4A 3NOGA 4NLTA 4M5LA 4ZVEA 2NSCA 4ZK7M 1H7XA 2CNKB 1GMWA 3K57A 3JQMA 1KP6A 5GAEU 3G86A 3M8YA 1FJ7A 4J9NA 3CJ5A 3FBCA 2FVPA 4TYBA 3TA1A 3Q8QB 2EBEA 3W5XA 4F36A 2CJXB 2YH1A 3OPKA 1HI8A 4EYHB 2FIUA 3AAWB 2HQGA 1WSVA 1QM9A 3PW0A 1JLGB 2MQNA 2CUYA 4RW7A 3HVTB 2XNQA 2HNDA 5E7OB 2FQQB 1Q5VA 3G82B 2JWNA 2JOQA 4IOAQ 3P8BB 2UUAJ 5AJ3F 3IWLA 3R7BB 2RQCA 3Q2SC 4KC5A 1FVQA 2IJNA 4DN0A 4B3OA 2D1CA 1JXEA 1TKZB 3AH6A 2XNRA 5GMDA 1KQKA 1HNVA 3KMQA 4NLGA 1E6YB 4C8MA 2V8PA 4ENOA 3AB4B 1G6BA 4CM2A 4Y65A 4X66J 4J7CA 3SCIE 1BQMB 5J1EA 4NLPA 3KMSA 4P6QA 2R2TA 2H54B 5J2QB 1K1QA 1RKIA 1XWLA 1WI6A 5EX0A 1WHVA 4ETXA 2DXDA 4ZVUB 1J5OA 1C4AA 3CJKA 2CJKA 4P71A 3FC9A 4A47A 1ROFA 2H1YA 1TMJA 1N33F 1RHUB 3P4UB 2JC0A 2AWZA 5DQGA 1DQ8A 2GQ2A 4FZVA 2F9JA 3QLHA 2ZFHA 1DLOB 4ANEA 2HK2A 5K8MA 4O4GB 4TN2A 3RRHA 3QWPA 3GILA 5D15A 3MPWA 4USIA 2DNHA 3DCAA 2FYXA 1EX8A 1X9SA 3OTBA 3RBDA 4OL8A 4XAKA 1L3UA 4KQZA 2NLWA 2F65A 5K14A 1JLAB 1U2RA 2VUGA 4AXIA 5H9FJ 2ZH5A 2H4YB 1U25A 4C8LA 4ZJQA 2ZC3A 1J5EF 1U48A 3B54A 3HJFA 1NKCA 3RJMB 4O0IA 3QGIA 1VQ9S 2QLWA 3I0SB 2EK6A 1L3KA 2ZDPA 4YS2A 3RBZA 2CG8A 1VS3A 2DNNA 1YVFA 5GAHI 2C2NA 4ZLNA 2Y1RI 2EFVA 2A0FB 2XO7A 1YJTA 3TAPA 1FDDA 4DV3F 3DLGA 2XMWA 4RZRA 4DN9A 5LMUF 3RAQA 5L39A 1T05B 2B9EA 3UD4P 3BGFA 1MW7A 2W7PA 3MPDA 1UW4A 5G0RB 1PBAA 2RDDA 4B9TA 3LAMA 4A8OA 3PRDA 3OBIA 2RQMA 1PIEA 3C14A 3GYXB 2W24A 4JI1F 1HNZF 3CD7A 1SJQA 3G6VA 1S12A 1V3SA 4YEAA 1JLQB 1GEHA 5J2PA 3PXGa 2FJEB 3MCOA 3TZXA 3MMAA 4ED2A 4PG4A 4OJ1A 5A76A 5HO4A 2V9WA 1JXVA 3D68A 2K06A 5F8GA 2VBXA 1ZETA 3OR1B 4MKBA 4C4WA 4N41A 3OT9A 2MKSA 2VG6A 3RB4A 2HBYB 3DXBA 3BM7A 1K0VA 1XJWB 1F2HA 2A18A 2ZOGA 1YJVA 4XTTA 5J2NB 3W2WB 1RP5A 3OL6A 1P1TA 2EWHA 1FCAA 3Q8UA 2GIFA 1T8EA 4PZVA 4J5OA 2NXEA 3KYLA 1IJEB 2MZJA 5DM7Q 4Q7AA 4WZQA 4Q5VA 1JLGA 1Q7YT 3WC2A 2VB6A 4UQTA 2UZAA 4JI2F 1A9NB 4OI1A 1YIJS 2DEJA 2XWXA 1RT4B 2DCUB 2IJRA 3IS9A 2HGMA 3D0IE 4F8RA 3ZTSA 3G82A 2K2PA 3MGJA 2J6SA 3SFUA 3HHDA 1HBUB 2DNGA 2MGZB 4RNOA 3IP0A 3PW5A 1YK9A 2LEPA 2R42A 2KXHA 4JI8J 1NK7A 3CB4A 4I1TA 3VAFA 4IRKA 3D3BJ 2ATCB 3J80U 3WZ0A 2KG1A 4Q43A 4AUKA 1LNQA 2KDOA 1E6YA 2DH9A 2J8SA 4HR2A 3T3FA 2CQGA 1WDTA 1SKUB 1UVNA 7AT1B 1BXNA 4USVA 4LRBA 1YJ7A 2E5HA 2DH7A 1UJ5A 2XY5A 5I3QA 4ECTA 4DS4A 1RWOB 3BH6B 5EWFA 2V4QA 3UNGC 2VF3A 3OL7A 2V6AA 4F2RA 1NRKA 3OLAA 2WTFA 4CLLA 2XLJA 4IDKA 2ZHBA 1SJ1A 5KG1A 5KT3A 5BXIA 2XG8A 2MJUA 3ENVA 3MM7A 5IZHA 2QE5A 1HR0J 1IR1A 4HYKA 2AV5A 4FDFA 4QYRA 4BS2A 3QJPA 4C8ZA 4DG1A 1U0SA 3S1TA 4B3MF 4PYAA 1XMOF 3FSXA 4FXVA 3UNYA 3KFWX 3U1MA 4FS1A 2D3O1 5I3PA 3P45B 2WBRA 3C2PA 3AOCA 3Q0AA 4NLXA 3M2RB 3N01A 4X64J 4RW9B 3WHIA 1NCLA 4H54A 2DR6A 5L1IA 1X4FA 1T9XA 2V8DA 2XZTB 1FA0A 5CHCB 2AKWB 1UFKA 2ZC4A 4DOZA 4U7UD 1FWLA 5THWA 2DPJA 3DRSB 5CYJA 5ETMA 2Z2MA 4PR6A 1KHWA 1SV5B 2XZDB 4CRJA 1RYSA 3KUHA 2BKNA 2MQMA 2VKRA 3SI8A 2LDIA 5E33A 2Y8WA 4QQBA 2R2RA 4X4NA 4OMFG 4I0WA 4X4SA 4AQYJ 4MTPA 4JI6J 1V3RA 4FBTA 5DLFA 2OI2A 5E3QA 1LXJA 4DQRA 3TOQA 1C1CB 4OYZA 4LSNA 3BF4A 4Q8EA 3PHTA 4DFJA 4N5SA 4LMZA 1TV6B 5LXYA 1JLQA 1N5YB 1MSWD 2GVZB 4ELTA 1H38A 2JLFA 1RTHB 2QA4S 1M5VC 5B09A 5FJ4A 4WBFA 4GVLA 2FLLA 1YG0A 1SC3B 2IAJB 4OYPA 1X5TA 1KQFB 2OUGA 1HYSB 3Q8RB 4ID5B 4USMA 2GJIA 2KJVA 1C1BB 1X4CA 1YGYA 3PJWA 4L75A 3TUIC 1XR6A 3ZTOA 5IOLA 1LK5A 1VOMA 2XS5A 2HAIA 2GO9A 4FF2A 1K73T 3W2WA 5IWAJ 2QLFB 3O2IA 2J0XA 2HQCA 5MAOA 1TR0A 3MFHA 3EUNA 4TXSA 2KU7A 5GAGI 1S77D 4PXBA 1MWQA 3KNAA 4DF8A 2CDRB 2G0CA 4NEZA 1NSPA 2V69A 4M63A 1HKAA 2J9CA 1HBUA 1TKTB 4NZ0A 4WTOB 2MGZA 2PMWA 1WG5A 1YZ6A 4MT1A 2HPUA 3ONQA 4I6WA 2XQCA 4I56A 5KFVA 3MUTP 1EB0A 5JVHQ 4GC6A 3ET6B 3EDRB 2BE2B 1F5BA 2H5JB 4HEA9 2EFGA 4QIGA 3MZIA 1REVA 2BJ8A 4G65A 3SMZA 3HSGA 3CCZA 1HWJA 4J37A 2ILYA 1WORA 3B6BA 2L48A 3MEGB 4ES2A 1YBTA 2C2OB 1IM6A 3MCSA 1KEKA 1X5SA 5G4DA 1V5IB 3GR0A 1KLMA 2YNFB 4KFBA 4DCPB 3G2XA 1TFYA 4IH6A 2FDNA 3BGRB 4WE1B 4JI7F 1YRUA 3NGKA 3TEHB 3NGUA 4DPXA 1Q8KA 2K3IA 1FERA 1N52B 3M9NB 1NK8A 4U96A 2GMJA 4DI6A 4RKUC 3MUMP 2AGOA 3WQPA 4YB5A 3LGNA 3UCUP 1S99A 1TL7A 2FY1A 2DNQA 2C2ZB 1T3OA 1BGXT 4DV4F 1R8CA 2XMTA 1Z1ZA 4RNFA 4WJBA 1VQ4S 1ZPVA 1UVJA 2GAGC 1D9AA 1YBUA 3M2RA 4B3RJ 1D3WA 5D8HB 3VALA 3PNIA 1M1KT 2C1EB 1PGZA 3UO0A 2BANA 1SUQB 5J2MB 5FLXU 2ZWOA 4QWDA 2KHDA 2KZZA 3M9MB 3CCES 1N32J 2DRBA 3VGSA 1L3SA 4HKQA 4MH8A 3M8SA 2DGTA 1S4FA 5GAHU 2GA7A 1KFDA 3N6NA 4LRFA 3DRSA 2QT7A 4IO1A 1TMMA 1OSCA 1SV5A 1RAJA 2VC0A 4Y3CA 2H3EB 4L6V3 2C3YA 1T9WA 4GMKA 4CLPA 3S6EA 4M8LA 3DM2B 2LFVA 4ECYA 4Z7CA 5ITHA 2V2KA 3V2UC 2F40A 1NPRA 3KUEA 4ZVFA 5H9EJ 1U4BA 4RW6B 3LTOA 1A7GE 4J9VA 1RBAA 3CJQA 4ZIVA 4JV1A 2ZVSA 1IVZA 1D1UA 5KOWA 2LMIA 4DPTA 1RTHA 2EPIA 3EGZA 2V8VA 2KRBA 3U02A 2RUSA 2K1RA 5T7LA 2HSEB 3SEOA 3EICA 2XYHB 2YPZA 4K2XA 4ELUA 4KO0B 5LMNF 2IAJA 4C0OC 4DR6J 1HYSA 2IA0A 4ID5A 4WU2A 5ETKA 1MLAA 3AT1B 3HF5A 1S1VB 2XB2D 2BKOA 5KFWA 4CO5A 1KS2A 4LF1A 1CULB 4DR3F 1G7CB 1VC6A 4KPCA 1RT7B 4C3LA 3DOLB 4GO5X 1HWKA 2R4FA 1O0PA 1RZMA 3PACA 2HVEA 4ZHRA 3FEZA 1Z2LA 3ZZPA 2G1HA 2R3VA 3GP9A 4EEYA 2FLPA 4P7TA 2WBMA 4KB7A 1U1QA 2WHOA 2QC3A 5ETLA 3GIRA 2VBYA 2WB1D 3DXSX 3T9ZA 1VJWA 4QYZK 1W2IA 3X1LB 3AOAA 3IBFB 3HFKA 3HHLA 2BDPA 1WOPA 3T1YJ 3VAMA 2DNPA 4C3KA 1TL5A 2NZ4A 2D9PA 1FRKA 2W4CA 3TZYA 4UOHA 4DR7F 3NRBA 4UW2A 4LBHA 2YNHB 2GHWA 2EFQA 3PW2A 3I5CA 3Q8VA 5DDPC 2BE2A 3DYAB 2CVIA 3EVOA 3PIPQ 4LF9F 3SCKE 4LF6F 4YN3B 1NH7A 1VFJA 5HAOA 3RW7A 5KG4A 1RWVB 1WACA 2M5YA 3PM9A 2PN6A 3MEGA 3O8WA 2YNIB 5KFMA 5L8RC 4QR2A 3D0GE 4UOCA 1WG1A 2EW9A 1TUWA 1U02A 1RWMB 5A8WA 2YNFA 2VQEF 4OYXA 2F1FA 4WE1A 4H4OA 2QGFB 3CCRS 4JB8B 4K4WA 2JH3A 3VAJA 2GIQA 1VR6A 1T3NA 1NBEB 4PQAA 2E1PA 3PKMA 4KHMA 4DV5J 4ALZA 1RAIB 2KL8A 4Q2LA 2JJ4D 4P75A 3I82A 3GV5B 4B3TJ 2N7CA 4C48A 1RWUA 5FIIA 4M5GA 3NG8A 1QY7A 5IFMA 2OTLS 2YWHA 3R5CA 3PX0A 4CYUB 4OI6A 2PC6A 3WBZA 3PO4A 4KTQA 1SUQA 4ZLLA 4DR4J 3NBPB 3Q22A 4EBCA 4YMEA 3KLHB 2OHDA 4X65F 3IG1B 1RWWB 1RE1B 4W90B 1EHWA 2UUBF 1Q53A 3B78A 2KVIA 4NRTA 2YKPA 3HKZD 2C2DA 4DQPA 4A8QA 1RHRB 2J7WA 4C2MA 1I5OB 3R7SB 2M8HA 2MZSA 1QUPA 2PE8A 4ED1A 2XWYA 1EETB 1M1GA 3IRWP 4EFAC 1WC5A 5HQMA 1NUEA 2J6UA 1HHTP 4O3QA 2AD9A 2ZOMA 4I6YA 1WNEA 1OQ3A 2AX0A 2XMVA 4RW6A 3IFEA 4OIXA 3TP2A 4Z37A 2N4CA 3MMBA 2H5EA 4DZDA 4EBEA 4ILLA 4UY85 2DNKA 1JKHB 4B9MA 2N3OA 1QTNB 4GVBB 1BY9A 5MLCV 1DRZA 4NLSA 1VQ7S 1U1MA 2AYGA 2B9XA 2GQCA 2OPSA 1WOSA 1CJKB 2JL9A 3OW2R 4QW8A 4FXDA 3OHBA 5A6WA 2UUAF 1S1VA 1S1WB 1S6UA 2DXFA 2BJ3A 2WOMB 5CD4A 1S1XA 4TYAA 1CULA 2OJ3A 1L3VA 4PXCA 3PW7A 3DLJA 1RT7A 4HDGA 3C15B 3DOLA 3E2EA 3EPIA 4X4TA 1IBCB 2UVRA 3SXLA 3MWBA 2UVWA 5B0EA 4C7QA 3TX8A 5GAGU 1DY3A 3QBCA 2W9CA 2CQ1A 3IGVA 2E5IA 1N88A 3IWXA 4ZLJA 4CP5A 3PTWA 1H6KX 1XQIA 2FJVA 1KBRA 1R0BG 1HLWA 1BC6A 3AJ1A 1VIXA 4J9RA 4U67Q 3HFZB 2GMHA 2E29A 1VRUB 1R0AB 3OLBA 2YXLA 2MQPA 1SL0A 4NE9C 5KG3A 1RCXB 4LREA 2EFOA 5HLFA 1QE1B 1N8RT 1RXOB 3MAQA 2FJAB 3K5PA 5DLGA 1JMTA 3DYAA 4HH1A 4L76A 1IBMJ 4UOGA 1PG5B 1GFWB 2LQBA 2ABYA 4EU0A 2OH2A 4CLTA 5B0AA 3FMWA 3TI0A 3DMJB 1H0HB 2ZBPA 3QO9A 2V8GA 2XS7A 1NDCA 2CNNB 3TRGA 4OHVA 3V6JA 3CJRA 3H2VE 1GXLA 1AYEA 1JLEA 2R2UA 4OI4A 4FNIA 2CPXA 4W92B 2BBEA 1B7FA 3FQKA 2BUNA 1XTZA 4WPAA 4ZA1A 4J9SA 5L46A 1X9WA 4HHUA 4YDDB 4P52A 2X51A 4F7VA 3WIUA 5ETSA 4ER8A 5KFNA 3CDEA 4NLWA 1S9GB 1SIZA 2GJ2A 3DKDA 4YY3F 4KV8A 3JSYA 4C8OA 2CA9A 4HI1A 1X7VA 5B0CA 4QWCA 5IT9U 3FUYA 4PEOA 2ZBQA 5HVGA 3KJNB 3NBPA 5C7PA 1WKLA 5AXMA 4B9SA 1FNOA 3KLHA 3MF5A 3AD8C 3IG1A 2W2OP 3LP1B 1PJ5A 1M0SA 4V1Ak 2I8EA 3KOAA 2IHR1 3SSRA 4ILRA 2F4VJ 2IM0A 1LW2B 3W7BA 3I0RB 4PQUB 3H5UA 5L1LA 1S57A 1Q86T 3CMAS 1EETA 2MQLA 1CVJA 4EZ9A 2FJBB 4ZVSB 1FKOA 2LXIA 5KFSA 4B3SJ 2FLOA 2YKQA 2HVZA 4OZJA 1DJ0A 1IWAA 1RSCA 2VPXB 3IMQJ 3B8HA 3JXOA 1X5PA 2B0GA 1Y5NB 5ETQA 5F0UA 2F7VA 1FF2A 2Q66A 2GC8A 3PV8A 5HJXA 1FRJA 1JQGA 3OXGA 2FJXA 5K20B 1CJKA 3EGWB 1DAXA 1ZM3A 4HLBA 2UXCJ 4QWAA 3L3CA 2XTJP 3EE3A 3TAQA 1S1WA 2DGSA 4BHQA 2DNOA 1PAEX 3V81B 1N5SA 1VHFA 3PYFA 3LOUA 4DV6J 5KT5A 4DF4A 2ALZA 2RUGA 1AXQA 3TUJC 2ZUGA 2UUCJ 1U2FA 3DRPB 3HPOA 4FNHA 5AXNA 2V68A 1NSAA 3D28A 4F0HA 3FJ2A 2ZM6J 4F4KA 2BQUA 2F5GA 4NYPA 4PG6A 1FRXA 3GZ7A 3QAUA 1WSRA 2C3MA 4RX6A 3M1VB 4JI0F 2RRBA 4RLEA 4RNHA 2MKCA 4Y2KA 3CXCR 2UVVA 2KRRA 4TU8A 5HATA 1TFWA 4J9MA 2CNLB 2VASA 2ZJRQ 1DARA 2J0SD 1LFPA 2MJNA 3CW2C 3H40A 1VRUA 4R0JA 3RW6A 4DL6A 1J5EJ 4DLGA 3BSAA 1KDNA 4ZPCA 1UZHA 2VJUA 1DTTB 3C8YA 5HQLA 4IRCA 1QE1A 1HR0F 2XHCA 4ZP6A 2LXFA 2CZ9A 4G1IA 1TKXB 3NGSA 3M4XA 2AW0A 1F5AA 1CJVB 4DU8A 1FRHA 5F3ZA 3H5YA 2AQ4A 2CPFA 4J9KA 4RW8B 1TZ0A 4O23A 3LWMA 4F26A 1A0OB 1FKPB 1HNWJ 3BDEA 1HBNB 1TELA 3MEDB 3DMJA 3LP0B 4DV1J 3MTKA 3CMQA 5LMUJ 3TW0A 4QCLA 4N47A 5C42B 2DJWA 4X64F 1I94F 3FSYA 2YQ0A 3UW1A 1T03B 1BMQB 1CQMA 3OTDA 2CKWA 4LIWA 1H72C 1JLBA 3I32A 5B7WA 3PR5B 1YI2S 2R8JA 2OPQB 2OEJA 4N76A 2EC2A 2DISA 4N56A 4DL5A 2A2CA 1FJCA 3ICLA 2AJFE 3SFGA 1RWNB 1O8BA 1OYEA 5HANA 4KHRA 1RAGB 4AQYF 1S9GA 2RT3A 3A3NB 3ENWA 1HL6A 4JI6F 4CLFA 1ZAXA 1OMSA 3DDKA 2IC3A 1RT2A 1NKBA 1FE0A 2LECA 3J7YI 4TQSA 2DGOA 1K44A 4TU7A 2GW8A 3MEKA 2V4RA 1IJFB 2ADBA 3EGNA 3LP1A 1DTQB 2CPHA 4ZVOB 1Y0HA 2KO1A 3KLVA 3ZZYA 2QJ3A 3DOMB 1ZM2A 1NJWA 1RTZA 1LW2A 4BDPA 4K4UA 3N79A 4PQUA 2VFSA 4B9NA 4BWMA 1I1GA 3RZAA 3MAAB 3J7ZT 1JJCB 3P96A 2B3TB 3H5XA 5ETRA 2UXBJ 1YRTA 1Q5YA 2CJBA 3OVSA 2Z56B 2ZNYA 4ZP8A 4RL1A 1CJTB 1Y7PA 1U1KA 5IWAF 1S49A 4ECSA 2QLBB 3MXHP 1U0HA 4D3GA 4DQIA 5KFDA 3W2VB 2FHMA 4ECVA 1S79A 2YX7A 1KN6A 3LGHA 2BM0A 2BX6A 5D0GA 1H3DA 3CULA 4Z7YA 3K7RA 4L73A 4P2XA 1TL3B 2KT3A 3LA0A 5JUMA 2XGPA 3R5DA 2X1FA 1S0MA 3L9ZA 3K8WA 3AHPA 3I4PA 1Q78A 1NJIT 3RR8A 4G1QB 2MLXA 2RDIA 2VG7B 2XGQA 1RAFB 1FRMA 2VD3A 4LFCJ 3N4WA 5D4OA 2V9KA 1GK8A 3L7OA 3LQVA 1ZAWA 2ZH6A 2R8GA 4KPYA 2WVDA 2YQ3A 5DRKA 4AE5A 2VKZG 2HVIA 4IOCQ 3BQ1A 2DGWA 2HZCA 4E2FB 3C46A 2C3UA 2FD2A 2PMZD 2ASYA 4ID8A 3M1VA 1XMOJ 1TL4A 2WVCA 3I4HX 1URNA 2EK1A 5HMXA 6AT1B 3NCPA 2KXFA 3KG0A 5I3UB 2NZCA 2MZQA 1FWPA 2BQ3A 4RBVA 1RTIA 1S6QB 4ECQA 4LR8A 2VJVA 3CDBA 3MDFA 3CD6S 3AA9A 4TU9A 1T9YA 4L3NA 1W25A 4PXEA 1TKXA 2EVZA 3KG1A 3EZ5A 1XR7A 3Q23A 2E5JA 2LLZA 4YP3A 5IT4A 4QW9A 2YKNA 1CSJA 1M5SA 2C28A 5F9NA 1FKPA 2HHWA 4NCGA 4NEYA 3G96A 1HBNA 2DITA 2Q6BA 5T41A 3LP0A 4NRUA 3DGPB 3PZPA 3GQCA 3MEEB 2I0XA 2IFXA 2HFVA 3FCWA 1YBAA 1BE4A 2E5LJ 1T03A 2WVFA 5M2RA 4URGA 2ERRA 1QSLA 4YR2A 1WTBA 3T1HJ 1FWKA 1D9FA 3H98A 3W65A 2Q79A 1N32F 1NU4A 2G2OA 3CMES 2OPQA 1PAUB 5KFCA 2VC1A 1KOHA 4NLYA 3HCXA 5A0YB 3OL9A 3UI3A 3EGVA 2CWXA 1VC5A 2CQDA 3OTOJ 2BQRA 5ETPA 2YX4A 1X4GA 4RBUA 1MROB 4LUBA 2OPPB 1RAAB 1VJQA 9RUBA 2B4OA 1ZTWA 1Y3KA 2VBZA 4ECRA 3G6XA 1C2PA 4NLUA 1TUVA 3PJXA 2C2EA 2VPWB 3JYTB 2R7QA 2VOOA 2LEBA 5EX3A 1F5CA 1W7WA 3DI6B 2KKHA 4CIOA 4ZCLA 3FFIA 3BGLA 3DOMA 3DHXA 4DR6F 2LP4A 4WFBQ 1S48A 4J9QA 2C2KB 1X4AA 3VWSA 3OTCA 2OP5A 4Q45A 3MAAA 1TUGB 5HROB 3KK3B 3SCLE 2W9BB 2R7UA 1R43A 3AQPA 4ECXA 1WC6A 1ZYQA 4ZVHA 3DLKA 3GU0A 2Z57B 2DRDA 4CQ1A 2CQ3A 2KFNA 4ES1A 4NPOA 4DSKA 3W2VA 3K89A 4FVMA 4DPWA 3J7Z5 3V5RA 1B99A 2DR9A 2LQ5A 4M5HA 4JI4J 2BJDA 3JSMA 2ROGA 1TL3A 2QA4G 3N5BA 3DRYA 3D9BA 1BD6A 4G1QA 3T1YF 4XK8C 2ZZTA 2VG7A 4DPYA 5DG9A 3I5BA 3DGVA 3THVA 1YX2A 4WIQA 3AQOA 3UD3P 4DL4A 4NMLA 3ZZZA 4ETZA 5IT0A 3NGRA 5ETVA 3GJTB 3JTPA 3PO5A 2DXEA 1TK5A 1OQ6A 4F4XA 2IVFB 1RT3B 4MIBA 2MDAA 4FPRA 3VGTA 2P6TA 1VBZA 3IO1A 4ZN3A 3NWRA 1NJZA 1SKWA 3HDSA 5KFUA 3IR6B 3RAMA 2VL1A 2IPOB 1LOUA 1SQGA 2HIQA 4YDXA 2AJQA 2BVZA 3DU6A 2ZH3A 4NI2B 1S6QA 5LSRA 4PABA 3ZTRA 2FLNA 4YR3A 3D5MA 4URSA 4WXOA 3ILLA 2M7SA 2RE1A 4DV5F 2QMWA 3PEJA 1EKRA 2D9OA 2Y8YA 2AEJA 1KLNA 1SC1B 2VONA 1U1PA 1FK9B 4YOEA 3CCQS 4B3TF 2I9SA 4M5JA 3EM1A 3SIPB 2MHEA 3M2UA 2QZ8A 2UU9J 3CIMA 4LBIA 2QV6A 2DGUA 4IKAA 4GKJJ 3MEEA 5C25B 2H9ZA 2MY8A 1RUSA 2RB7A 1S0VA 2E7XA 3OXLA 2HBRB 1Y11A 1ZM9A 4DR4F 3ZC4A 3K2YA 4K4TA 5DZ6A 2EKNA 3BQ0A 4RR5A 2R7XA 1X60A 5GMKa 2W7OA 1XNRJ 6FD1A 3V6KA 2DGQA 3H90A 1S7IA 4F4WA 2E66A 2XI2A 3QNWB 4A48A 4IFYB 3OFFA 1F2GA 2IM2A 1AFIA 4FN5A 3GSIA 3M8RA 4KH1B 1WG4A 3PEHA 3DRXA 4MK8A 2OPPA 2Z58B 2ZUAA 2C3OA 3EVWA 3J7YU 4DMZA 3IAM9 1FDAA 3VTIA 5HL7Q 3KLEB 3AODA 3KUGA 2HHXA 3R5BA 5DS7A 3HSJA 3H0PA 4YQWA 2HLUA 2XY7A 2L9WA 3DI6A 3MR5A 1XC9A 3W61A 3M2VB 3I96A 5DZ7A 2G13A 3JAMU 3C6UB 1S1TB 3VAIA 2M8DB 2DVIA 3NL0A 3CCWA 5D4LA 3UCZP 3EPGA 5HROA 3KK3A 1IQZA 4OZ2A 2A6MA 2GGPB 2LU2A 2V8HA 5IC6B 5C2CA 4LVNP 2W9BA 3H8YA 2PSZA 2XLKA 1ZTTA 5C24B 4K7QA 3HD1A 5F41A 4FP9A 3GB0A 2FGCA 2ZE2B 3A4TA 2Z8QA 1RLDA 1WC3A 1TL1B 4LF8J 2LU1A 3MCMA 4NCAA 1ZOTA 3EVMA 2HS0A 1NPKA 5KFKA 3CDAA 1P9QC 4LF9J 2WSCC 1FTCA 3FMBA 2XMAA 1Y10A 3POTB 2HFSA 4AL6A 3CCVS 1VRTB 2FZGB 4H4MB 4TNOA 3NS5A 3ZO7A 2QSWA 1RAEB 2ZOFA 3EJMA 1T02A 3HI9A 2RHSB 4CO4A 4OLPA 2OPRB 4WFZA 2J76E 1VQSA 4P2FA 3BEGB 3BSCA 2APOA 1U49A 2DYAA 5D3GB 3M8QB 2NXUA 3O6QA 1WD6A 2FHKA 1FHTA 3M8WA 1IBKJ 3VZHA 1IBMF 1AT1B 4ERDA 1ZBTA 1NZAA 1RT3A 2IYIA 5GVQA 4OX7A 4O3OA 2J0WA 4QIWD 3TQEA 3EYZA 3NNAA 2AJ2A 3NLCA 2WW4A 2ATLA 1P27B 3HT3A 3BYPA 3G8QA 4RU2A 3EWGA 4A8SA 4K50A 4EZ6A 1CLFA 3TVYA 4P9SA 4WP8A 4NZ7A 1S4EA 4OHYA 3I5AA 1S10A 2CQBA 4JYAJ 4NI2A 1TU0B 1CJUB 5LT5A 5L1JA 2GIRA 3HLUA 4TY9A 3ZZ0A 3C3LA 3IRXA 4X65J 2BW7A 1GMUA 1JLCB 4X4QA 1B70B 4CH0S 1F3FA 3UWTA 2QN6B 4HT5A 5B0DA 2RQ4A 1FK9A 1JNRB 1F6TA 4X62J 3MM6B 1M1HA 2HBQB 5L9XA 2DBBA 2RU3A 2XYGB 1X4HA 1UWBA 4QJVA 3D6MB 1VLYA 4TY8B 1IKXB 2KZMA 1NMEB 5K8NA 1HI1A 4PXDA 2H65B 4U8YA 1N5TA 3OFHA 2VG5A 4QR1A 2O5DA 3UN5A 2LXUA 3KLIB 5A2QU 2KM8C 2WVEA 4HACA 5KOXA 3HZGA 4G6VB 1NSKL 1RHMB 2D3ZA 2F4VF 2ADCA 3J80Y 3FCHA 5H9FK 1JWWA 1SKSA 2W2PP 2HHPA 4USJC 2GHPA 5KFPA 2PI5A 2AIRB 4C11A 3DNCA 3W64A 4LR7A 3EMTA 4WFXA 2R8KA 2Z2ZA 2G4BA 2LKZA 2PDAA 2CXEA 2JC1A 4CNYA 3G6ES 4B3SF 2HBZB 1LWXA 4J9UE 1C0UB 3UDEA 4OYIA 1NAQA 3DDNA 2DY9A 3KLEA 5KAKA 2JFKA 3A3PB 2VPYB 1YJNS 1OYDA 3BJYA 2CQ0A 2POKA 3UDVA 3NCQA 1GTHA 1RAHB 4FF3A 4W98A 4B9VA 4K59A 1PC4A 5CQGA 3K58A 1LW0A 2HVDA 4I2PB 2UXCF 1LWCB 5AXKA 2VA3A 4O4RA 1FE4A 2GGPA 3G4SS 2F4FA 1SC6A 1F1BB 1SH0A 4DV6F 1TKDA 3TR5A 5JVGQ 3HHLC 4QOTA 5C24A 4DWIA 3OFGA 3OSNA 2RIJA 2B51A 3DOKB 2UUCF 3BYRA 1FXLA 3D1QA 3BR8A 1RA7A 2ZE2A 2F8HA 3FDSA 2ZM6F 4ED8A 3OSPA 1YJRA 2ZBCA 1HHQA 2QYGA 2JLGA 4PWUA 1UCNA 1T11A 2ASJA 1UEUA 5KFYA 5LOQA 4FYYB 3POTA 2KT2A 4LSZB 4W4MA 4WWSA 3M8ZA 4ICLB 2LCWA 2XSJB 3CUNA 4KGKA 2QO3A 5D6GA 3GCWP 2VU5A 3BV8A 4HDHA 4ECZA 2OPRA 1UJ4A 3K5OA 3FBEA 2HRTA 1WEYA 5HQ8A 4DU7A 5D3GA 4Y2MA 3AJDA 4CI0B 3W8GA 1R8PA 2KI2A 1RTJB 1CBKA 4CT8A 2MKHA 5KT4A 1UWAA 4GC7A 3PIOQ 4FYVB 1HD0A 1HNWF 2MKJA 5CCLA 1YZ7A 2XBPA 4UOFA 4QBUA 5B08A 3SCJE 4DV1F 3KLGB 4QZVB 2HHQA 1SJ3P 1DHMA 2QSFA 5K5MA 2DO4A 3BKUA 2JEFA 2QA2A 4I68A 5HMYA 2X1GA 1VQLS 2QL9B 3M7VA 2HG4A 2CJQA 4YY3J 3C16B 1G4CA 1QSSA 4WTYA 4PWDB 4F2SA 3M6UA 3LF0A 5GADI 1D0EA 2PMHA 3BO3A 1P6TA 5I42A 2DR7A 1JLCA 2YVSA 1NHVA 3MECB 4HHHA 3HZEA 2XM3A 1NZ8A 1QJHA 1BLUA 4PUOB 1V3ZA 1HWLA 2HWHA 1X4DA 6FDRA 3V6DB 1TQLA 1CC7A 3I9ZA 2Z30B 1XERA 4KGZB 1IKXA 4IH5A 4OZ1A 1IQTA 2W8KA 5DM6Q 3IXQA 3CGIA 4DEZA 2V2QA 3CJ8A 4YB1P 3QWUA 3GSDA 4MMOA 2B56A 1R0CB 5AT1B 1Q8IA 4ZS6A 1WKJA 4C8NA 2M3DA 1UEKA 3KJVB 3GFHA 3HVTA 1RAOA 3R5AA 2RF2B 5KFQA 4YHHJ 3B4MA 3PRBA 1ZAVA 3QATA 1KQGB 3VZIA 4DV0J 3SQGB 1S76D 2GS8A 4RW4B 2WSFC 1UKUA 5LSLA 1RISA 5K8PA 2UXBF 3W63A 4Y00A 3G87A 2B6AB 3IBWA 3NGDA 2CPIA 5IV4A 4A8KA 1TKZA 3PDNA 2UV8G 1DFDA 2CQHA 1R31A 1RT5B 3W5ZA 4DV7F 2FVSA 7FD1A 3P3DA 4USWA 4RU9A 1UA0A 1RCOB 4FBUA 3CJTA 5KG2A 1BQMA 5M2UA 2YWEA 1R6YA 4Q8FA 1XNQF 5J2QA 4JI0J 1BWEA 4AYBD 2GZOA 1VQ8S 4I2PA 1LWCA 1PYOB 1RU2A 3HX9A 2EFPA 2XMUA 2BJ9A 1YTYA 4Y6IA 2Y0BB 2HRYA 2YH0A 4LFCF 5KFZA 1YDLA 2P9GA 3NP5A 2BM1A 1RHQB 5AE1A 5ETOA 1DLOA 4YFUA 1D9DA 4O4GA 3I55S 4OZ3A 3GTYX 4MAKA 4HHJA 2W4PA 1RTDB 2F63A 1BQXA 2F8EX 3T5LA 4K4ZA 2VV5A 5FLXY 2B8QA 2OIHA 1JLAA 3S8SA 2CJ9A 1ZM4A 2B4VA 4NYZA 2NYHA 2H51B 3UVJB 3QIDA 2DKOB 2XSJA 1I94J 1B4SA 1NDKA 1HNIB 5F8MA 3PG9A 1EQ0A 3QGHA 2FVCA 1PILA 2HZAA 2U1AA 5KT7A 5AE3A 5KFBA 1HMVB 4U7CA 1QTMA 3NS6A 3I0SA 4QIEA 2PD1A 2DNZA 3NKYA 4BLGA 1SC4B 1PC5A 2L9NA 1RTJA 1N36J 2FZKB 4USTA 5KFHA 2HHUA 1MMNA 3MMCB 3J81j 3ISNC 2RVJA 2W7AA 5KG0A 3I6PA 4OQJA 5FDLB 3BZQA 2MZRA 1IBLJ 5T14A 3KLFB 4OX9J 1T05A 4JV5J 4OYWA 4CTAB 2B9WA 1LEOA 5G0RA 2E5LF 1X31C 3IC1A 2EBGA 1U6FA 1HBOB 4XPCA 3T1HF 2FHJD 3VQTA 1JJ2R 4PWDA 2ZD1B 3NWGA 4JBCA 3VHQA 3TUPA 2HNZB 3MTJA 2DRAA 2CG4A 3I31A 3FSIA 3MECA 3BO2A 4ZCMA 1H98A 2ZWPA 2CAJA 1ICEB 4PUOA 1ULRA 4NLRA 2PO4A 3OR1A 1LXNA 3V6DA 3OTOF 4CH1A 1FX4A 1UETA 3EXYA 4HVZA 2X1AA 1FFSB 4FYWB 4KAIA 5A8RB 3RRGA 4K5SA 4JV2A 1Q16B 3KK1B 3EDQB 3Q8YA 4G3IA 1EJ7L 1YJUA 3FRYA 5J2NA 3ZZRA 3KXDA 2OEMA 1OS5A 4U9RA 3CVKA 1VBKA 2HYIB 1HQ2A 1SBRA 3TVKA 3HHKA 1ZS6A 1LWEB 1UFWA 3QMQA 3KJVA 4P2MA 2IMOA 4EK2A 2RF2A 5F8LA 3C19A 2XCAA 1AW0A 1RWKB 5JMNA 3W1YC 3SQGA 2BR0A 1RT4A 4AL5A 4NLDA 4RW4A 1B7YB 1FD8A 3M9OB 3D1OA 3O44A 4DUZJ 1T0TV 3TJAA 3UDCA 3IBCB 1HBMB 2M9KA 3CCJS 4KGXB 2DR5A 3MAHA 5DETA 3IM9A 4BWJA 5B0GA 1EQMA 2ZKTA 2HWTA 5CABA 3R2CJ 1U6ZA 4WK1A 4FKYA 3H42A 2R7RA 3LGMA 3IR7B 1CG2A 1OPZA 4EBDA 2J0QD 1FFGB 2LEAA 4XO0A 3LPEA 4JI4F 3U27A 2DB1A 4F4YA 4DX5A 3AY0A 4NXNJ 1OSDA 3L09A 4R0EA 1VIOA 2YBVA 3RGIA 1HNXJ 3KJQB 2D41A 4KT0C 3M6WA 2VICA 5GMEA 4DSJA 1UVKA 3I87A 4RW7B 1RI7A 3M05A 5H9EK 2BOPA 3CCUS 3CC4S 4K0KJ 3G9CA 1EAYC 5HMZA 3E3XA 2IDEA 4ED3A 2DIVA 3LP2B 1G1XA 1TTHB 4FF1A 1V6HA 3RB6A 1VCTA 4IG3B 4NLOA 3F73A 4XPEA 3PFOA 1RTDA 3QGPA 3GJRB 4YB6A 4X4RA 1JJ4A 1XEZA 3KWMA 4EO8A 4F3OA 1VYAA 3KDOA 2MPUA 2J7KA 4ZLPA 3ADAC 3WX8A 2DIUA 3UVJA 2R7SA 3GIJA 3H4DA 3NNCA 3HXMA 2ZHOA 3TEGA 2RS8A 4RW9A 1N34J 2P9EA 4LF2A 1YSJA 4LF7J 1S0OA 3CCLS 5KFIA 4KHPF 1J5OB 1PJ7A 1W26A 3ENQA 1KFSA 2HURA 2WZ1A 3IM8A 1HQUB 4KH0B 3OFEA 1JK9B 5BYSA 3HSDA 3QLHB 1HARA 2WK4A 2C2MB 4PYDA 5FDLA 1Q0NA 2UU9F 2QLJB 3D6FB 4I4BA 3GFYA 4FXWA 4LF4J 4UY8T 4Y2AA 3KLFA 4GKJF 2BA9A 1U47A 4CTAA 2JEJA 4N8OA 4PKDB 2DNMA 1TVRB 2HMIB 2O3DA 4RUHA 3CEDA 1C1CA 1HBOA 1KVIA 3QT6A 1MN7A 2ZD1A 5GADU 1TV6A 2CIMA 4M5MA 1GX5A 1N5YA 1OY6A 2LQ9A 2GVZA 1XNRF 1RGVA 3DRRB 1Y9OA 4K4XA 1T94A 4HH0A 3RBXA 2JHEA 1GXUA 4A8XA 3T6BA 2HK3A 1N48A 1QVGR 5E3AA 1AB8A 1HWUA 1C1BA 1RK8A 2K3KA 5A8RA 4O3PA 3CD0A 2CPJA 3CJ0A 5CYQB 1B64A 2DHGA 2K8GA 1QAJA 3KK1A 1WF0A 3HD2A 1AA1B 4OZ5A 3GIKA 4I67A 4C98A 5B0FA 4N77A 2F3JA 3DLGB 1VQ6S 4RPFA 1N0VC 1SH2A 2M2BA 1URRA 1EP4B 3M6XA 1BQNB 5D4NA 5DO2A 3CJSA 2BOAA 1WKKA 4WP3A 3ENAA 3B82A 3P5TL 1U09A 2U2FA 4QWBA 4ZCIA 2AGPA 3PX6A 4HTJA 4PCQA 1F3VA 5J2PB 2ACYA 2V4JB 1S72S 4CO1A 1HBMA 1TKTA 2QA1A 3NCRA 3MMAB 3W8PA 2D74B 2ZEJA 2HAFA 4NX9A 4ATNA 2N7YA 1F9EB 5BJRA 1FI4A 5KG7A 1IN0A 3ET6A 3PVXA 4LF8F 4B9UA 2VG6B 3GYGA 4KJIA 2XZWA 3FGVA 1MNEA 3WIVA 2HHHJ 1KHVA 2FVRA 4IH7A 2PEHA 2M52A 2BE7D 3SSQA 2J9EA 3SYZA 2VOPA 3GG0A 3FKBA 1S9FA 3KG4A 5JJBA 1VQYA 4P72A 4IG0B 2NXNA 4IFVB 4RO0A 3SQOP 2DHSA 2RD5C 3MHYA 3BREA 1HWIA 5L1KA 1KTQA 3AXKA 3BGRA 4GKKJ 3M6VA 1WC4A 3LP2A 3MPYA 3IS9B 3L95X 2RAQA 4EI2A 4BC7A 1IBKF 4IG3A 4NXMF 2VODA 2V34A 3BKFA 2GO8A 3V6HA 1ZZNA 4HT7A 5IT9Y 4CO3A 3VAKA 3NAIA 3D3CJ 2MTLA 1F9HA 3W9JA 2AX1A 2JX2A 3F44A 2A6OA 4ZJOA 3FBFA 2AYBA 4WKYA 4DBQA 1V5VA 5CZVA 1SQEA 4MKVA 3BO4A 4JYAF 3KDNA 2WW8A 5F0WA 1RQ0A 3MR3A 1SL1A 5J2MA 3UQSA 2DHXA 3A3OB 1T9UA 1M90T 4DFKA 3DDIA 4CT9A 1M5OC 2JVOA 3TAMB 4WIIA 3A1YG 1IR2A 4IDKB 2P6SA 1KOOA 1HQUA 2P8IA 1RB0A 2HFZA 4G1PA 4TQRA 4X62F 2CQPA 4LF5J 1WWHA 1SPBP 3MM7B 4I2QB 4OHXA 2ZITA 3GJSB 5KFAA 3DM2A 3W62A 1SB6A 2N82B 2Q3PA 2L3MA 3ITHB 4PPDA 3DLHA 4JI3F 5BYQA 4DG1B 3K5NA 3CCMS 4TKTA 4WYLA 1TVRA 4DV2J 2HMIA 3MD1A 3R6LB 3C66A 1R27B 1TK8A 2VPZB 2IYGA 1N56A 2ZZMA 3ETMA 1EARA 3DRRA 2AYMA 4USHA 2PIIA 3Q83A 4OZ0A 1GMWD 2OSQA 2PFDA 3T41A 1O5JA 5HP1B 2ALYB 4KO0A 5J1PA 2PA3A 4EUVA 3R5GA 2JFDA 1H2TZ 2RRNA 5C5JA 2UUTA 5CYQA 4LFAF 1FD2A 2RU9A 3D6TB 2W25A 1RLCL 2HQDA 1VQNS 4RUAA 2CQ4A 3BKTA 1SH3A 1HQEB 3R5JB 1Y00A 5M2PA 3ILIA 1BUXA 1EP4A 5LM7E 4A8FA 1BQNA 2DGVA 4LSNB 2BKPA 2HGNA 1Q79A 2VDHA 1U7LA 2WRMA 5D78A 3MR2A 3T5KA 3TWZA 1UW9A 2VHGA 3X3UA 3GPAA 2HQFA 3OQ2A 3HVWA 4IYQA 4ZITA 3RRKA 2MSTA 1HFEL 2KB2A 3AB2B 3VQSA 2V4JA 3MCNA 3ZNUA 3CDWA 4MFBB 4OI0A 1F60B 3TQ1A 2G2ZA 4Q44A 1QD1A 1G2EA 4DR5J 1GMVA 2AZ1A 4DFPA 2DTJA 4D3HA 2NXJA 2YNHA 2ZBRA 2OEKA 2UV8A 2XI3A 2ZHAA 1Y5IB 3SV3A 4FVCA 3RG6A 1N6QB 4WFAQ 8RUCA 5E5NA 1PKUA 2YNIA 1MG7A 2RDJA 4V19X 1YWXA 1IKYB 2ZJPQ 2KG0A 2R2SA 3W9IA 4IG0A 4IFVA 2QG9B 4CLWA 2GAHC 4Y2IA 4NYOA 4M5DB 5I4MA 3R8YA 1MWZA 1OY8A 1QDUB 2IRUA 2L9DA 2MMYA 1NXIA 2XLIA 2D69A 3DN9A 4ZJLA 1WC1A 3O5TB 4ZOSA 2RRAA 3D66A 2OMOA 2GCFA 1FXRA 3M30B 2R7VA 4J9PA 1R8BA 1FRIA 4CO2A 3PX4A 4F67A 2E5GA 3M32B 2W4DA 3P49B 4KKOB 3LH2S 1REVB 4CYUA 1LV5A 3KNGA 4ED5A 3CE8A 3QPIA 1SVDA 1FNMA 2KTQA 2SXLA 2V67A 1KNZA 4ZPBA 5F9LA 4KE5A 4J91A 3DLLQ 2A10A 4H4KA 2E1MC 1FKAF 3J7A1 4BBYA 1EZZB 4TVAB 1ITPA 2AU0A 1ZA2B 2LQJA 1KLMB 3TAMA 4KFBB 5KFOA 1NKEA 3CIZA 2PGCA 3NY0A 3HHEA 4IRDA 4ZVTB 4FF4A 3D2WA 4K8RA 2XHWA 3FQLA 4I2QA 3HP6A 4OV6A 2D3OR 4JOUA 3DFEA 2NPIA 3R1HA 4P2SA 3ITHA 2N3LA 1TL7B 5DG8A 4DR2J 5E41A 4U95A 1JX4A 4F04B 3TA0A 1NB7A 2OFGX 4K2JA 2FJDB 3G8SA 5A8KB 4X4PA 3RB3A 1UZDA 2HS4A 1VK3A 1RHJB 2R7OA 3PHEA 2PFFB 4QR0A 2VFVA 3K17A 1FO1A 1JKHA 4GVBA 4YHHF 1GNKA 2BANB 3QQCD 5HP1A 4DV0F 4UF4A 3BN4A 3MR7A 4DXLA 2M88A 3FVYA 3TARA 3SSSA 2VZ9A 3BS9A 3CO9A 2WOMA 2Z2YB 1W2BR 4DL0C 4OI2A 2QX0A 1KVJA 5L38A 4JI5F 3C15A 4ZP7A 1KC8T 1H73A 3VVUA 4ITSA 3CSKA 4NASA 5K8OA 1HQEA 3H2LA 1NB2A 5C2GA 4L72B 5BR8J 3CCSS 2KM8B 4OHWA 4Z2XA 2V2VA 3MR6A 3F41A 2MKKA 1VQKS 4PAAA 4NMXA 2DPIA 2IBOA 3IAS9 3R97A 5F8HA 4ZVQB 2DCLA 2QL7B 4MFBA 3PY8A 1R0AA 2K1RB 5T7LB 2J7UA 4M94A 4C97A 1Q81T 3THPA 1B0TA 4DDFA 1VC0A 3IWNC 4DX8H 3LWLA 2JEGA 2G9OA 3UR0A 2V5HG 3ILJA 5CH7B 3UCGA 1ZH5A 1N6QA 3DLEB 3ULHA 4MYTA 2YWGA 2ZH9A 4ZHRB 5EWGA 2A3JA 3ELHA 3HULA 1IKYA 3A8IA 3VF0B 1IM4A 4WZMA 1SJRA 1Y5LB 1D8YA 2RMLA 4PG7A 4DFMA 3P6YC 3OR2B 1RWXB 4M5DA 3T9NA 5DGBA 2HHTA 8ATCB 5LJ3Y 4WF9Q 1GX6A 3NS7B 5ETTA 2J6TA 1PBUA 2YKAA 2CVEA 3HHLB 4DQSA 2BYCA 1X0FA 2QTWA 1N36F 4DSIA 3BPDA 2WAQD 1WEZA 1X4EA 2M70A 4ZVRB 3CTRA 3M30A 2OAUA 2AJ1A 2FVQA 3AFGA 1IBLF 4MJKA 2H4WB 3VVTA 3CPWR 2B4PA 4OX9F 4JV5F 3M32A 3E8OA 5F8JA 3QGGA 2XMJA 3BPSP 4KKOA 3QRQA 2HNYB 3RBEA 3VAGA 4XDDA 5D0HA 5DDOC 5IQ6A 4I7FB 4DL7A 5KFGA 2HFNA 2P2CB 3GR1A 3QYYA 5A8WB 5IC4B 3RTVA 3BR9A 1QAXA 1M5HA 2RILA 3KK2B 3PCOB 1RA6A 4H4OB 2DH8A 4QU6A 2FGOA 3QT7A 1M5KC 3I0RA 2VQFJ 1NK5A 2QMXA 3FBBA 1R8AA 1NK9A 1RYRA 4WFYA 5HN0A 1D09B 1N5QA 1B3TA 3BSOA 3MUVP 5SZTA 4OJGA 3PFEA 2EG2A 4OV1A 4USUA 1AUDA 3BQ2A 3W60A 1VISA 1CS4B 2O01C 2IY5B 5A8KA 4DV7J 3L7UA 1L5UA 4K5RA 4O3RA 2CPZA 4KGMA 2G0IA 1WUUA 2V0NA 2KYXA 1MN9A 2CWKA 4DZ6A 1XNQJ 4DUZF 4C8YA 5CZXA 2WONB 5U47A 4QWEA 1P9YA 4PG5A 1PJ6A 2WVBA 1S9EB 3V81A 4PRFA 5E0OA 3HJVA 3QT5A 1V9OA 2HFOA 4ZPVR 5HVFA 1OWXA 2LQ8A 4DS5A 3GCXP 1N0UA 3AJ2A 5K9FA 4NWBA 5FD1A 3DRPA 1UEVA 5L9NA 3THTA 3H4BA 2CQIA 2HHSA 4IR9A 3H25A 1APSA 2MKYA 3F0NA 1S1UB 3UFCX 1VGYA 4NXNF 2GJFA 2QLXA 1HNXF 4I64A 3PYDA 3MMBB 4M5IA 1UPMB 4DQQA 1NJYA 1Q7LB 2EI5A 4AT1B 5IM0B 2DK2A 2A2DA 3E01B 2AJ4A 2R7TA 1FJGJ 2RNEA 1VQ5S 1KQSR 4K0KF 4ZCKA 1WJ9A 1DTTA 2VFTA 2OPSB 3HM9A 5D4PA 4Y2CA 1CJVA 2ZH8A 1S1XB 3U1LA 2CZVC 4DSEA 1B0PA 4RW8A 4XIUA 4F50A 2YPYA 4OYOA 4ZP9A 3J81Y 3UPFA 3DLEA 3MEDA 4CDIA 3LUYA 2OTJS 4ANCA 3JQKA 1O51A 5C42A 3N6MA 1VQMS 3SBMA 1N34F 4K4YA 2W9CB 3V4IB 2DD8S 2EEYA 3ZFVA 3GE9A 1CC8A 3PJ9A 2RHQB 3OR2A 4LF7F 1AROP 1G3OA 1O6XA 4URQU 1MMDA 1T95A 4IQMA 3BBFA 4DLEA 1PCAA 4L74A 2NUUG 4OYBA 2COLA 3OD2A 1UTAA 2CJAA 1JXLA 4NA3A 2QFJA 4J90A 5HLFB 2EXUA 4DPOA 4A8YA 3GWCA 4LF4F 4MK9A 3JSRA 1X0PA 4CNZA 1VRQC 1XR5A 2PT0A 4LIRA 2JLEA 4UQGA 1Q1KA 4OFZA 4PWWA 5DQHA 2AJ0A 3HMJG 2HNYA 5E3CA 1J2VA 2W2NP 3OVBA 3JAMY 3UN3A 1WHYA 2CYYA 3T1AA 3AXMA 3QO9B 4I7FA 5CD4H 3OTEA 1WEXA 4TLQA 4IO9Q 2GQQA 1DTQA 5HJYA 3KK2A 4DSLA 1AFJA 2R8HA 2MB0B 1YQHA 2FPHX 1JLEB 2BRKA 3UN2A 2Q43A 1T7PA 4MK7A 2XMKA 4AXJA 4MKAA 2LA6A 1RBOB 3JB9k 1WELA 4OZLA 2YY3A 4M5KA 1X4BA 3B4DA 4MIWA 4C6AA 3OUYB 3KHRA 4ZDNA 1CJTA 2ACMA 2FJWA 4BC9A 1IUJA 3FK4A 1WI8A 5JXSA 5HBMB 2C2RA 4N7TA 2O1PA 1CS4A 4QYZJ 3NMRA 3RYLA 4C0BA 1OY9A
chains in the Genus database with same CATH topology
2HNZB 3FZ2A 4O3SA 3Q2SC 3MTJA 3TNVA 1DTTB 2DRAA 4KC5A 1FVQA 2CG4A 3C8YA 3ISZA 4KV8B 3NAHA 4IRCA 2IJNA 3I31A 1QE1A 2D1CA 3FEXB 1JXEA 4DN0A 3FSIA 1TKZB 3CD5A 1HR0F 4ZP6A 4IUFA 2LXFA 5IS2A 2YWFA 3AH6A 2XNRA 4G1IA 1TKXB 3MECA 3BO2A 4ZCMA 3M4XA 2AW0A 4UUXA 1H98A 1F5AA 4LQ3A 1KQKA 1FRHA 1HNVA 5F3ZA 3KMQA 4NLGA 1E6YB 3H5YA 4C8MA 3OJUA 3SZ2A 2AQ4A 2CPFA 4J9KA 4RWXA 4RW8B 4PUOA 1ULRA 1TZ0A 4NLRA 2PO4A 3AB4B 4O23A 1G6BA 3LWMA 2K7KA 5F8IA 4F26A 2WONA 4Y65A 1FKPB 3SCIE 1PSDA 1BQMB 3AA8A 3BDEA 3CJ2A 4NLPA 1HBNB 5J1EA 3OR1A 1LXNA 3V6DA 1K8AT 3OTOF 4CH1A 3KMSA 4P6QA 3MEDB 1UETA 3EXYA 3DMJA 3LP0B 4HVZA 4WYWA 2X1AA 2R2TA 4KAIA 5A8RB 1S9EA 3MTKA 5J2QB 3Q24A 1K1QA 1RKIA 1XWLA 3TW0A 2VFUA 4N47A 4QCLA 1WI6A 3RRGA 2KT5A 5EX0A 1WHVA 4ETXA 4K5SA 4JV2A 1Q16B 5C42B 3KK1B 4G3IA 2DJWA 1J5OA 2NYIA 1YJUA 1C4AA 3FRYA 3CJKA 4E98A 4X64F 1I94F 2CJKA 3FSYA 1WHWA 3UW1A 5J2NA 4A47A 3ZZRA 1CQMA 1T03B 1ROFA 3OTDA 1OS5A 1IKVB 2CKWA 4KSEB 4LIWA 4U9RA 2KXNB 1N33F 1JLBA 3CVKA 2JC0A 1R7IA 5EDWA 4RUCA 2AWZA 5DQGA 4WXWA 2ZDOA 1HPZB 2ZNZA 2HYIB 3I32A 1DQ8A 2GQ2A 4FZVA 1SBRA 2F9JA 2P5VA 2GNKA 2YKMB 3QLHA 3TVKA 2ZFHA 1DLOB 3HHKA 5B7WA 3PR5B 1YI2S 2HHHF 1U6BA 1S1UA 2R8JA 5K8MA 2OPQB 1FKOB 1LWEB 1UFWA 4O4GB 4TN2A 1ELOA 4N76A 3QMQA 1SJFA 2DISA 4N56A 3KJVA 3RRHA 4DL5A 2IMOA 3CJ3A 3QWPA 4LT6A 2RF2A 1FNXH 2ROEA 3GILA 2OSRA 3HHLD 5F8LA 4BCAA 2A2CA 2XCAA 1FJCA 1AW0A 3MPWA 2J9DE 4USIA 2DNHA 3DCAA 3ICLA 3SQGA 2BR0A 1RT4A 2WCXA 1X9SA 4AL5A 2AJFE 3OTBA 4NLDA 4RW4A 4X4UA 1FD8A 3M9OB 3D1OA 3O44A 3RBDA 5I3UA 4OL8A 1GTEA 3SFGA 4XAKA 1X8DA 3UDCA 1L3UA 2KYZA 4KQZA 1O8BA 5IM0A 2NLWA 5K14A 2IM3A 1JLAB 1HBMB 3E01A 2M9KA 3CCJS 4GKKF 2JZ5A 1U2RA 2VUGA 4AXIA 4KHRA 2DR5A 1LK7A 1S9GA 2RT3A 3MAHA 4AQYF 5DETA 3DHWC 2KFZA 3ENWA 5H9FJ 1HL6A 4BWJA 5B0GA 2ZKTA 2DNLA 2G1DA 4JI6F 2HWTA 1TAQA 2ZH5A 1U6ZA 1ZAXA 4WK1A 5E2QA 3DDKA 3K5LA 2IC3A 2R7RA 2L08A 3LGMA 1RT2A 1NKBA 3VCDA 2XMMA 3IR7B 1U25A 1FE0A 3DU5A 4RWWA 2LECA 4C8LA 2ZC3A 3J7YI 2CPDA 3KHGA 1KSPA 4TQSA 1CG2A 2DGOA 1OPZA 1J5EF 2WSEC 3FRZA 4EBDA 1U48A 2J0QD 3N0VA 1UVMA 2LEAA 4TU7A 2GW8A 4N8NA 4XO0A 1NKCA 2UVUA 3MEKA 2V4RA 3HJFA 4O0IA 1IJFB 3QGIA 2ADBA 1VQ9S 2QLWA 3EGNA 2ZBIA 4JI4F 3LP1A 2RQKA 3U27A 2DB1A 3I0SB 4F4YA 2EK6A 1DTQB 5A2QY 1L3KA 3AY0A 2CPHA 2ZDPA 3GIIA 2AP6A 5KFRA 1ZPWX 1NH8A 3DGPA 1VS3A 2DNNA 1Y0HA 1OSDA 1YVFA 2J9DA 3L09A 3Q8SB 2KO1A 4R0EA 5GAHI 3KLVA 3ZZYA 4B9LA 1VIOA 2B7BB 1X5OA 4Y0FA 1NO8A 1ZM2A 1NJWA 2D41A 1LW2A 3MM5B 4BDPA 2Y1RI 2EFVA 4K4UA 3N79A 4Q0BB 4X66F 1LKZA 4PQUA 4KT0C 2XO7A 3QAEA 1YJTA 3M6WA 2R7WA 2VFSA 3V4IA 4B9NA 3TAPA 4BWMA 3HK2A 1I1GA 1FDDA 4DSJA 3RZAA 2V94A 1UVKA 3I87A 3J7ZT 4OX6A 4RW7B 1RI7A 2D7SA 4DV3F 3DLGA 2XMWA 4RZRA 3P96A 4DN9A 5LMUF 3M05A 2B3TB 3RAQA 3H5XA 3C6TB 1YJWS 2BOPA 1YRTA 5L39A 3HVAA 3CCUS 1T05B 3CC4S 4ZPTR 3G9CA 2NREA 2CJBA 3LW5C 3OVSA 3FZBA 5HMZA 3UD4P 3E3XA 4ED3A 2DIVA 3BGFA 1MW7A 3LP2B 2W7PA 1G1XA 2ZNYA 4ZP8A 1UW4A 5G0RB 1Y7PA 1U1KA 5IWAF 1S49A 3LAMA 3TUZC 1V6HA 4ECSA 4B9TA 4FF1A 3MXHP 2CZ4A 3RB6A 4A8OA 4D3GA 1C0TB 2EG1A 5D77A 3PRDA 4FYDA 4IG3B 4DQIA 2MHNA 3OBIA 2RQMA 5KFDA 3HHNB 5KG5A 4ZVGA 5A0YA 3GYXB 4NLOA 3W2VB 2YTCA 3F73A 2RH3A 2W24A 4XPEA 2M4MA 3PFOA 4JI1F 2FHMA 4ECVA 1RTDA 1HNZF 3CD7A 3QGPA 1SJQA 1S79A 4YB6A 3G6VA 1V3SA 4YEAA 4X4RA 1JLQB 2XEXA 4LF5F 1JJ4A 5J2PA 2YX7A 3PXGa 1KN6A 1XEZA 3KWMA 2BM0A 2FJEB 2EFNA 1H3DA 3CULA 4EO8A 2R8IA 4F3OA 3K7RA 2UVRA 2BACA 1TL3B 2KT3A 7FDRA 5JUMA 4IOBA 2MPUA 2XGPA 2J7KA 3MMAA 4ZLPA 1HW8A 1LFWA 3R5DA 1S0MA 1KD1T 2X1FA 4ED2A 2DIUA 4PG4A 3ZZUA 2XCPA 2R7SA 4OJ1A 4ED0A 3PW4A 3GIJA 3H4DA 3CC7S 4DV2F 3BDPA 1MROA 3K8WA 5HO4A 3NNCA 3AHPA 2V9WA 3I4PA 3HXMA 2ZHOA 4O44B 1HW9A 1Q78A 1NJIT 2RS8A 5B0BA 4RW9A 5EGYA 5LSOA 3RR8A 4G1QB 5F8GA 3VR1A 2VBXA 1ZETA 2RDIA 2P9EA 3OR1B 4MKBA 2PA8D 3H59A 4C4WA 4N41A 2FC8A 2VG7B 1YSJA 2XGQA 5DQIA 2MKSA 1FRMA 2VD3A 2VG6A 3N4WA 1S0OA 2HLTA 3CCLS 3RB4A 3DXBA 5KFIA 1FRLA 4KHPF 1JJHA 3BM7A 4EGLA 1K0VA 5D4OA 2V9KA 1J5OB 2MZ1A 3JYTA 3L7OA 3LQVA 1ZAWA 2ZH6A 2A18A 2ZOGA 1YJVA 2J5AA 2R8GA 4KPYA 5J2NB 3W2WB 2YQ3A 2ASLA 3BB5A 2E1AA 3ENQA 1KFSA 5DRKA 1RP5A 4P7VA 3OL6A 4AE5A 1P1TA 1JLBB 1HQUB 2EWHA 2VKZG 1FCAA 2HVIA 4IOCQ 3OFEA 3BQ1A 1JK9B 1T8EA 2GHVC 2DGWA 2HZCA 5BYSA 4YR0A 4J5OA 3C46A 3KYLA 3QLHB 1HARA 2WK4A 4B17A 2C3PA 1IJEB 5EWEA 2IMWP 2C3UA 2MZJA 2XS2A 5DM7Q 4B3OA 5FDLA 4Q7AA 4WZQA 4Q5VA 1JLGA 1Q7YT 2MZTA 1QAIA 2UU9F 3WC2A 2BABA 2FD2A 2VB6A 2P9CA 4CCHA 4UQTA 2PMZD 2UZAA 4I4BA 3GFYA 2ASYA 4FXWA 4ID8A 4JI2F 3M1VA 4DHVA 2ZJQQ 4UY8T 1A9NB 5EUHA 1R8HA 4Y2AA 1TL4A 4OI1A 3I4HX 3WDOA 3KLFA 3L7PA 5LJ5Y 1URNA 2EK1A 4GKJF 2BA9A 5HMXA 3GMGA 4OLOA 1YIJS 2B5JB 1U47A 3H5SA 3NCPA 2KXFA 4CTAA 2XWXA 4R8UB 2JEJA 2HRUA 3N5FA 4R5PB 3OUYA