1WHYA

Solution structure of the rna recognition motif from hypothetical rna binding protein bc052180
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
97
structure length
97
Chain Sequence
GSSGSSGKIGYGKANPTTRLWVGGLGPNTSLAALAREFDRFGSIRTIDHVKGDSFAYIQYESLDAAQAACAKMRGFPLGGPDRRLRVDFAKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein RIKEN cDNA 1810017N16
publication title Solution structure of the RNA recognition motif from hypothetical RNA binding protein BC052180
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 7
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1whyA01
2CPHA 1WHXA 1RK8A 3PIPQ 3THPA 1K8AT 2MZRA 2RS2A 1H6KX 3UCGA 4W92B 2CPDA 2KHCA 3EX7B 2MGZB 4RU2A 1X4BA 2OTLS 1D8ZA 1FXLA 2K3KA 3MD1A 2JWNA 1FT8A 1A7GE 2QFJA 3LPYA 2CQIA 2KH9A 3EGZA 1UAWA 2DNNA 5IFMA 1U6FA 3H2UB 1H2TZ 2YKAA 1S79A 4F26A 3JB9k 3CCUS 1FHTA 2LMIA 1PGZA 2J0SD 2XB2D 1DZ5A 2NLWA 5CYJA 3VAMA 2CPIA 2RNEA 3HHNB 2OTJS 1OIAA 1UW4A 3G8TA 3CCLS 1YIJS 1AUDA 1VQMS 1OPIA 2GO9A 3MI7X 3MUTP 3CCVS 2MKCA 3CCQS 4WFNQ 3MURP 2J76E 1FO1A 2DGOA 3NS5A 3VAGA 1N8RT 1VQ5S 2CQ4A 2V94A 4OZ1A 3MDFA 2GHPA 4CH1A 4CH0S 3UWTA 2X1FA 4QQBA 1N52B 4LMZA 3VAHA 1X0FA 2RQCA 2I38A 1NU4A 1URNA 3UCUP 1WHVA 1WELA 5LSLA 1A9NB 2MYFA 5GAHU 2RT3A 5GAEU 3B4MA 3FEYB 1SJ4P 2MMYA 3I56S 2DHXA 3CD6S 1VQ4S 3K0JA 5EN1A 4WFAQ 3IWNC 2PEHA 2HVZA 2MQOA 3UCZP 2DNLA 3P49B 1KC8T 3CPWR 1O0PA 4OZ0A 2KT5A 1VC5A 4Z2XA 1WEZA 2DISA 4TU8A 3NNCA 1VQ6S 2MSTA 2EK6A 4PR6A 1YJ9S 1X5OA 4TU9A 1RKJA 1SJQA 2MY8A 5D77A 2D3OR 3TO8A 2DNQA 2CPZA 5H1SV 3VAFA 3TP2A 1OO0B 2KXHA 2MKKA 1HD0A 1P27B 2MZSA 5HO4A 5LJ5Y 4IOCQ 4IO9Q 3RW7A 3S6EA 4C0OC 4ZKAA 3VALA 3G6ES 1YHQS 5LXYA 2HYIB 3VF0B 2YH1A 2X1AA 3MD3A 2G4BA 2ADCA 5DETA 1WI6A 2DNOA 3DXBA 5LXRA 3CCRS 2ZJQQ 1N88A 2BZ2A 5MLCV 2RRAA 1D9AA 3PIOQ 4TLQA 4EGLA 2NZ4A 2MKIA 1WI8A 3NNAA 3R1HA 3G9CA 1ZZFA 1B7FA 2M70A 1X5PA 2F9JA 5DDOC 2RQ4A 2M0GB 1M5OC 4ED5A 4U67Q 2CPFA 2MSSA 1DRZA 2MZ1A 2KM8B 1YI2S 2AD9A 4UQTA 3FEXB 2DGWA 2MY7A 3J7YU 1VQPS 1M5KC 1WHYA 2LA6A 5FJ4A 2F3JA 1WF1A 4UY8T 2MJUA 2LA4A 5IM0B 3ZZZA 1M5PC 2JVOA 4YB1P 4F02A 4TU7A 2YWKA 2MB0B 2XSFA 2MZJA 2FHOB 4QU7A 2M4MA 2DNZA 2KVIA 4QPTA 1ZZNA 3TYTA 2KG1A 1U6BA 1YJNS 3DLLQ 2DHSA 1IQTA 3H2VE 3BS9A 5CA5A 2D9PA 4F25A 3SMZA 3R27A 3P6YC 1YJWS 1WF0A 2FC9A 1Q7YT 1M90T 2DNKA 1M1KT 2DH7A 5DM6Q 2CJKA 5GAGU 2SXLA 3CC2S 4IUFA 2LQ5A 1WG4A 1DBDA 1X4GA 1VQOS 1KOHA 4BS2A 1U1PA 2EVZA 3U1LA 4QU6A 2D9OA 1X4HA 1K73T 1WTBA 4IOAQ 1VBYA 1UFWA 2CQCA 2CPJA 1VQKS 2X1GA 2MJNA 2LYVA 1P1TA 2CQPA 2DH8A 1WF2A 3SXLA 4FXWA 1X5TA 2HGNA 2MGZA 5IQQA 3P5TL 1DHMA 4WF9Q 2CPYA 5IM0A 3MXHP 3VAJA 2DNYA 4PRFA 1OWXA 2MZTA 3Q2TC 2MQPA 1FJEB 3MUVP 2LCWA 2MKSA 3ULHA 1QVGR 5DDRC 2DH9A 1YITS 1VQLS 2LEAA 2M88A 1QM9A 1F9FA 2CQHA 2AYBA 2I2YA 1Q81T 2KRBA 2MZQA 1JJ4A 3B4DA 2XS7A 3S8SA 2PE8A 3CUNA 2XNQA 2YH0A 5GVQA 2M7SA 1VC6A 2OIHA 1FJCA 2XS2A 5JVGQ 1QVFR 1SJ3P 2RS8A 2ZJPQ 5DDPC 3CCMS 3VAKA 3BO2A 5LJ3Y 4LIRA 3LQVA 2DNMA 2DB1A 2VODA 2B0GA 5BJRA 2CQ2A 2KXNB 2CQ3A 2CQBA 4CQ1A 1R8HA 5GMKa 3UD4P 1BY9A 1VQNS 2EK1A 2CQ0A 1X4FA 2JVRA 2OSRA 3EGNA 2DGQA 3N9UC 3IRWP 1NO8A 2AYEA 3ZZYA 2MQQA 1X4EA 2RVJA 3CCES 4Y0FA 2DK2A 2E5HA 2E44A 2KG0A 2BOPA 4YOEA 3U1MA 3VAIA 2DGTA 2LKZA 3UD3P 3CTRA 2CQ1A 3NS6A 2DHGA 3CMAS 1U1KA 4C7QA 4W90B 2U2FA 1U1RA 3CCSS 1PO6A 2FY1A 5D78A 2L41A 2E5GA 2MQMA 3NMRA 2E5IA 3D2WA 4ERDA 1WWHA 3R1LA 1X4CA 3UE2A 2LEBA 1VQ7S 2DIVA 1SXLA 4J5OA 2QA4S 3CMES 1CVJA 2CPXA 2HGMA 2VOOA 2G1DA 1SJRA 3G96A 2ZJRQ 1VQ9S 1W2BR 2VOPA 2DGXA 1KD1T 2YTCA 2UP1A 2M2BA 3HI9A 2M9KA 2J0QD 3CXCR 2MHNA 2E5JA 2JX2A 2X1BA 3SDEB 4M5DB 5GADU 1JJHA 2DO4A 2DO0A 2LECA 1N54B 3G8SA 2MQLA 2ERRA 2DHAA 1Q86T 3NNHA 2J8AA 2KXFA 1U1OA 1M5VC 2OSQA 1H2VZ 3RW6A 4LJMA 1U1QA 2XS5A 2KU7A 2LXIA 2ADBA 1WHWA 4A8XA 5LSOA 2KYXA 2QEXS 2KFYA 2DNPA 3I55S 3CC7S 5HL7Q 2N82B 2M52A 3L3CA 1WEXA 1H2UX 2MQNA 2MKJA 2G0CA 3G71S 1HA1A 4YUDA 1XN9A 2WBRA 3G4SS 2DNRA 1WEYA 4Y00A 3MOJB 2U1AA 3BEGB 2N7CA 2AYMA 4WFBQ 4PKDB 4C4WA 2KN4A 3P3DA 2HZCA 5CXTA 1U1LA 2AYGA 1UP1A 2KI2A 2RUGA 2CQDA 1VC0A 1JMTA 2M8DB 5DM7Q 2MXYA 2DITA 1FNXH 2N3OA 1ZH5A 2F9DA 1X4DA 1G2EA 1YTYA 1NJIT 2DIUA 1HD1A 2FC8A 3BO4A 3SDEA 2CQGA 3V4MA 4FXVA 2Q79A 4WCEQ 3J7ZT 2VONA 3CC4S 3US5A 5ITHA 1WG5A 2RU3A 2CPEA 2L9WA 2KRRA 4P6QA 1YWXA 4CIOA 3MUMP 1JJ2R 3CCJS 2N3LA 1VBXA 1VBZA 1KOOA 1X5SA 4WKRA 2DGUA 2DGVA 2K8GA 3S7RA 4V19X 1S72S 1WG1A 3THTA 1K9MT 2DNHA 3CF5Q 2A3JA 2MPUA 1HL6A 1VQ8S 2XNRA 2MKHA 3Q2SC 4WIIA 2HGLA 2DGSA 2LXUA 2JRSA 1U1NA 1FJ7A 1U1MA 3BO3A 1U2FA 1KQSR 2DNGA 2O3DA 2OJ3A 2KM8C 1L3KA 2L08A 1SJFA 2RRBA 3OW2R 1R8PA 5JVHQ 1Q82T 5DDQC 2M8HA 3CULA 3S01A 2FPHX 1X4AA
chains in the Genus database with same CATH superfamily
2V4JA 4F3MA 4WK3A 5RUBA 5HAOA 4KFBA 3FFIA 2QMUB 2QC3A 5CD4H 4ED8A 3GR1A 4MIWA 1CJTB 1RQ0A 5ETTA 5KAKA 2F40A 3NCRA 4BC7A 4L3NA 2LVWA 3HHKA 2CPIA 4B3OA 5ADZA 1IKYA 1V5VA 2L9DA 2YQ0A 1H3DA 2HIYA 3LW5C 1VQMS 4CYUB 1HBNB 4J9RA 5IT4A 1NRKA 1MNEA 2GHPA 2B5JA 5KT3A 2Y3YA 4QQBA 2FVCA 3ITHA 3N6LA 1XIQA 4TYBA 5GAHU 1T05A 3J81j 3B4MA 2W2NP 1RWNB 1WNEA 3KG1A 1XJWB 2XMVA 4WFAQ 4DHVA 2DPIA 4YDDB 3TARA 2HAFA 4DR3F 1RT1B 4NRUA 4ZVOB 4OI6A 3O3LA 1BHNA 2DNQA 3KK2B 2HAIA 1OO0B 2UXBF 5DZ7A 4TKTA 1NHVA 5LM7E 1N36J 3C15B 4IH7A 4IQMA 1S1TB 1K1QA 3DRYA 3CJ2A 3CCRS 4RW6A 3TANA 3IG1A 4RUHA 1XNRF 4JV0A 1M5OC 3SQGA 3MAHA 1MWZA 2Z58B 4JI3F 3HFZB 3TQ1A 4X64J 5BR8J 4LSNB 2H5IB 4ICLA 1RT3B 2QN6B 2MB0B 3SIPB 2WONA 1RBAA 5L1JA 1YRUA 1XC9A 4NCBA 2QYGA 5LMUJ 5F3TA 2J9CA 5B7WA 5H9EK 1R0AA 2VASA 2YKQA 4NYPA 4OHYA 3BPDA 1PBUA 4K4TA 3MPUB 3T6JA 3WZ0A 2ZNYA 2G9OA 3FCWA 1NK9A 2UZAA 2HHSA 1T11A 2DH8A 3CJSA 2DYAA 1PYOB 1TP7A 2R8HA 2K1RA 3HLUA 4O3RA 3PW5A 2NCKL 4O44B 3FQLA 3Q8RB 3MM5B 1T3OA 3E01B 2GAGC 2MQPA 4ZVSB 2HVHA 1VQLS 4HL9A 2I2YA 2LQJA 2C42A 3PNIA 4P7TA 5J2PB 4N5SA 3OTOJ 3EXYA 2XS7A 1E6VB 3IGVA 5D4LA 2XEXA 3ZZUA 3CCMS 1KQFB 2VODA 2CQ2A 3H59A 5J2QB 1FRLA 5KFCA 3TZZA 3IRWP 4J9OA 3M8WA 2UXCJ 1SQEA 4UT4A 1GXUA 4B3MF 2EW9A 3QWPA 1CJKA 1U1KA 2U2FA 2BXJA 3QWUA 2VQEJ 2FVPA 3D3BJ 1KN6A 1Y3JA 1CVJA 2QA4S 4LFCJ 4ZOSA 1VQ9S 2KB2A 2WHOA 3G6XA 3I0SA 4DX8H 2RD5C 5GADU 3IRXA 1JIHA 4CZCA 3V81A 3BR8A 2KJWA 1V5IB 2OSQA 5DLFA 4IFYB 4URQU 2W2PP 3OL6A 3KJQB 2AJQA 1RWUA 1SKRA 3DGPA 4GC6A 1TL3B 2QSFA 3FCVA 2KFYA 1X9WA 1VK8A 1VRTB 3HZEA 4K5SA 3ZFVA 4OJ3A 5IOLA 3G71S 1CJVA 2BM0A 4K4SA 3U1NA 1HR0J 4DDFA 4QWCA 2KN4A 2EXUA 2VPYB 4B02A 4LIWA 4GC7A 1Y7PA 5KFIA 1SKUB 3QO9A 3ILOA 4KRWA 3BREA 4PPDA 1UTAA 4M5DA 3D1HA 3KLVA 2VFSA 1R7IA 4HTJA 3RBDA 5C24B 2C2EA 2KRRA 1APSA 3OUYB 4OLOA 1FE0A 4WKRA 1JLAB 4Q44A 1RHQB 2K8GA 2UV8A 2A3JA 3PYDA 2DTJA 2MPUA 1I94F 4YHHF 3MM8A 1RADB 5D3GB 3BDEA 5K5MA 1U2FA 4DN9A 2LFVA 2ASJA 3NOGA 2HFUA 4WFZA 2V2ZA 4EYHB 3QIDA 4N76A 3Q8QB 1HWIA 3GP9A 3MPYA 4FBTA 1U6FA 3CDAA 1AT1B 4O3SA 1HBOB 2BVZA 3OBIA 1M0SA 3GFYA 3BPSP 2IRXA 3HVTA 4NCGB 3MPWA 5D4PA 5KFAA 4JYAJ 4P2FA 2VKZG 2LLZA 5A6PA 4F36A 2JLGA 3MI7X 4DEZA 2MKCA 4Q5VA 2YNFA 4CDIA 3VAGA 3KJVA 2Y9HA 4X65F 5KFDA 3H40A 5HP1B 1RWOB 2I38A 2HZAA 3AJDA 2OGUA 1CS4B 1ELOA 4OFZA 2VF3A 4LFBF 1Y5IB 3I6PA 3CD6S 1R31A 1GT8A 2DXFA 2HVZA 4LF4J 1N56A 3OXGA 2P9GA 1CJTA 4DWIA 4PXDA 1X5OA 1SUQB 1HKAA 1YQHA 1LQ9A 3BQ0A 2CPZA 2AX1A 3HULA 4YFUA 4KGXB 5G4DA 2EG2A 4CYUA 3V6HA 1YHQS 1HBNA 5DETA 2ZJQQ 1NXIA 2QO3A 2RRAA 4DBQA 2F63A 3M8ZA 2DVIA 2RF2B 3PW4A 4A8OA 4GKKF 3N79A 3DGVA 2E1MC 2ASDA 3GJTB 1RZMA 5FJ4A 3CE8A 4W4MA 4R5PA 2YWKA 3DI6B 1RT1A 4B3RJ 1LFPA 2BBEA 4CNYA 1JKHB 2HNDB 4WE1B 1ZZNA 3KK2A 5K9FA 4K2XA 3VGUA 1NK4A 1S10A 2WSEC 3UDLA 3GTYX 1TAUA 1VRQC 4EZ9A 2XM3A 1FKOB 2R42A 3C15A 3DOLB 1S1TA 3FMBA 3R5AA 2C2DA 4Y2MA 2AJFE 2LQ5A 5IWAF 5DG7A 4P2SA 1DURA 3M8QB 5HQMA 3IMQJ 4PYAA 3FCHA 4LRCA 3R3TA 4L76A 1NDKA 5CCLA 4LSNA 3FK4A 4NXMJ 1RT3A 2ZHBA 4HDGA 4Q2MA 2HURA 3DRXA 4YQWA 4Q45A 3SI8A 1RACB 3UW1A 4JBCA 3Q8UA 4H54A 4NLOA 1J2VA 4ZLNA 4L75A 2XC9A 1RAIB 3FBEA 1SKWA 4L74A 1SJ3P 4ZVPB 3NGSA 4C0HA 3BSCA 2UU9J 2ABYA 2E5HA 2DJWA 3EVOA 3VAIA 3UD3P 2CQ1A 2NUHA 4C7QA 1NDLA 2AW0A 2HHPA 3CCZA 4O44A 4UOFA 3GQCA 3W62A 3MM5A 3PJ9A 2IYIA 3E01A 1SXLA 3K8WA 3F73A 1TL7B 3AD9C 3A12A 3MCSA 1SJRA 1W2BR 2DGXA 1G6BA 4KIAA 4DR4J 2J7KA 5ETQA 5T14A 3TZYA 5FDLB 1WKKA 5J2PA 4F50A 1E6VA 1JJHA 2RDDA 1QLNA 2LECA 5M2RA 4O23A 1NKCA 2ASLA 1OSDA 5J2QA 3O44A 1MU2B 3TA0A 3A8JA 1WEXA 3M8RA 2JJ4D 2DNRA 1T02A 1Y10A 2AV5A 1HI0P 2Q43A 4H4KA 4LSLB 2N3OA 1YG0A 5JUMA 4CM2A 4LBPA 4Q0BB 4YS2A 1PC5A 3J81Y 3ENQA 3V4MA 2F1FA 3GJQB 3OR1B 4C9DA 4PCQA 5AE2A 2B9WA 3PRBA 4EFAC 4IFYA 3BBCA 4P6QA 1PC4A 1VBZA 1KOOA 2IDEA 2RKIB 3KK3B 1TL3A 4DUZF 1EQ0A 2FLNA 1VRTA 2GZOA 1I6JA 2WCXA 4K4WA 2PO4A 2LXUA 1T9WA 1SJFA 1N33J 2ZOMA 3K17A 3T5LA 3W5YA 3CULA 4OJGA 3LF0A 4DUYF 2IY5B 1C2PA 4DS4A 2COLA 3EX7B 1HHTP 1GNKA 2IHR1 5J2MB 5LL6d 2C2OB 3PW0A 3CJKB 3MD1A 3Q89A 3PKMA 1A7GE 1VGYA 3I9V9 1I51B 2ROGA 1KNZA 2H3EB 4PEOA 1FHTA 1NK0A 3QT8A 5C24A 4ZCIA 4DSJA 3OUYA 1WORA 1JLAA 2YWHA 3G8TA 3H25A 4WFNQ 4AT1B 3M32B 2N7YA 4FZVA 2IVMA 4ZVGA 1YX2A 5D3GA 2FTRA 4QW8A 1RJJA 2I9SA 3RZAA 1X0FA 3BJYA 5GAEU 3QAEA 2DHHA 4CCHA 2PEHA 4M5NA 2NYHA 4EBDA 2MQOA 2W01A 5HI7A 5DJBA 2LP4A 3MTKA 4CNZA 4OIXA 4DV3F 1HBOA 3LO3A 4TN2A 2J9DE 3LANA 4KBIA 4NCGA 1YBUA 2MKKA 3M8YA 2V68A 4IO9Q 2QG9B 4JI3J 4ZKAA 3WIUA 1RHJB 1XR7A 3DDIA 4FP9A 4J9SA 2IM3A 3KLHB 3OR2A 5HP1A 2UVUA 1WI8A 4XK8C 3R1HA 4NLGA 3G9CA 3NRBA 1NCLA 4I68A 3D1OA 2R9LA 1CS4A 3T1YJ 1T3NA 3K59A 1RAFB 4Y28C 2FIUA 4B17A 1M5PC 2OELA 2P9CA 4NOHA 5KT2A 4EBEA 3GIIA 3P5BP 5DZ6A 4AL6A 1OS5A 2OPPB 2GGPB 3MFIA 2ZUGA 2GO8A 1UJ4A 5AXNA 4MKBA 1KLNA 4PABA 4DFMA 1IWAA 2Y0SD 1TMMA 4RJVA 2YBVA 4CLSA 3OFHA 5KFLA 1L3SA 3IA0A 3RB0A 3C2PA 2V2QA 2RF2A 3H4BA 5KG1A 2O1PA 4FKXA 2EPIA 1MWYA 3HFVA 2H48B 2GQ2A 2WK4A 1T94A 1EARA 1LXNA 2XWXA 4HDHA 5DG8A 1Q79A 5D4NA 3MXHP 2A6MA 1KLMA 3DI6A 3NY0A 5DDRC 3TAMB 1JKHA 2EBGA 2HNDA 1F9FA 2AYBA 2ZZTA 2PFDA 1JJ4A 3AQOA 1VJWA 2BJ8A 1FKOA 2HFNA 1HFEL 3DOLA 3U27A 2WBMA 5E3QA 1Q5VA 3QLHB 2A1BA 2V8GA 2X51A 1KONA 5AJ3J 2VBZA 4F0MA 1R43A 3EZOA 3M8QA 2DGQA 2CJYB 1NO8A 2CWKA 4URGA 5C25B 4GKJJ 5KFOA 3BDPA 4LREA 4Y0FA 1U45A 2JEFA 3AT1B 3QGIA 1RHMB 5CYMB 5F0UA 1N5SA 4MFBB 4K8RA 2VOPA 1SL2A 3GSIA 4FBUA 2JLEA 3NGTA 1HMVB 4IYQA 1S7HA 2DCLA 3CEDA 2X1BA 3DLHA 2HKEA 4JI4J 3HJFA 1Q86T 2YWFA 5D0RA 1KEKA 2GVZB 4DV0F 4EWTA 3GYNA 3SCKE 2UUBJ 4MIAA 4WP3A 4AXJA 4OV1A 4KGVB 3J80U 2ZWOA 3G2XA 1KDNA 4LF1A 1XERA 3Q22A 4P52A 3JSMB 1VC0A 2Z2YB 2PEBA 5DM7Q 5KT4A 2IA0A 1NJYA 5FDLA 1NSPA 3K2YA 4KHMA 2BYCA 2E29A 5T41A 3BV8A 2OPRB 4ZITA 4OV6A 4BCAA 3CJTA 4ZPTR 4JI6F 5F8GA 3HM9A 2HQIA 4IG3B 4Y3CA 4V19X 3EE3A 1MU2A 4Z37A 5ETKA 3QFWA 4HEA9 3Q2SC 3JTNA 4KC5A 2HGLA 4MKAA 5B0AA 4DN0A 3CIMA 1JWWA 3WQPA 4FYYB 1KQSR 2O3DA 1HNXF 1YSJA 2QGFB 2VG6B 3S01A 5DDPC 1SI9A 1WHXA 2QLBB 4B9TA 3P8BB 4DLGA 4LSLA 3ENWA 1OQ3A 1E6YB 4Q0BA 4OHXA 3UN3A 4AL5A 4K4ZA 4X65J 2YNHB 3OR1A 3R7BB 2OD4A 3MEEB 2XBPA 1NB2A 1Z1ZA 4DLEA 1XEZA 3UO0A 2RKIA 3GZ7A 2IRYA 1OPIA 3KK3A 3CCVS 2R7VA 2QLWA 2J76E 4MTPA 5KT6A 5BYSA 3UDVA 1PG5B 2GMLA 3D67A 4OZ1A 1W7WA 3MZIA 5GAHI 1U4BA 1FCAA 1GMUA 3CMQA 3UPFA 3GYGA 4USIA 1QJHA 3NGKA 1HNIB 5J2MA 4HR2A 3CJKA 4Z2XA 2DISA 3NNCA 1VQ6S 4LFAJ 2E1PA 1F5AA 2XO6A 3TP2A 3EPIA 2YNIB 2R7XA 4ZVQB 1VDHA 3DRPB 3M32A 3THVA 5LXYA 2X1AA 2G4BA 4YP3A 2GJIA 1J5EF 5KFVA 1JK9B 2BZ2A 4TLQA 2B4VA 1LW0B 1EB0A 1CC7A 2ZVSA 3PTWA 2Q6CA 3H5YA 3MAAB 3OJSA 2BKOA 4CLZA 4UY8T 1B99A 4CH7A 3VCDA 4A48A 2QLJB 1EHWA 2V34A 2ZC4A 1FRMA 4JI8J 3V6DB 3AJ1A 3HDSA 3R5JB 4N41A 1REVB 5THWA 3R7NB 2DXDA 1JX4A 4BLGA 3BQ2A 1TL5A 3P6YC 5KFXA 1MMDA 1RB0A 1Z2ZA 3MTJA 3IAM9 5GAGU 1TL4A 2YKNB 1GEHA 2ZVIA 4G6VB 1ZAWA 2V4QA 2KO1A 1X4GA 1KOHA 3KJNB 3ISND 5I42A 3U1LA 2HQ3A 3T5HA 4AD6A 4ZP9A 4DPOA 4X4TA 2CAJA 1TKXB 5E41A 3NGDA 2GX8A 2R2RA 2CWXA 4FYDA 1DHMA 5LMNF 4KV8B 2W9AA 1KSPA 3EUNA 2BKPA 4J9NA 2MKSA 3LGHA 3W9JA 2ZBQA 4DV4J 3Q8VA 4JI5F 3QNWB 1YBAA 4QR1A 1LWXA 3BGLA 2GGPA 2PIIA 4X4PA 4F4KA 5K8PA 2HQFA 3IFEA 2NUUG 5I4MA 2OIHA 4C98A 3MR7A 3PFOA 4H4MB 3VGSA 4OYXA 1VCTA 3NP5A 2DXEA 3DRSB 2B8QA 4PQAA 2OSRA 2B8PA 3CJ8A 3N9UC 4N56A 1KP6A 2DK2A 2PN6A 4HLBA 5DS7A 3CMAS 1MW7A 2L41A 3G8QA 2VFRA 3FBCA 1S6OA 3Q8SB 1XWLA 2E5IA 3D2WA 3UE2A 2V2VA 2VA2A 4PQUB 2Y8WA 2ZOGA 3TAMA 2XYGB 5GADI 3W63A 4NX9A 2J6TA 1LOUA 3JTPA 3KUGA 4USHA 2J8AA 4JI0F 5IV3A 1RWXB 2W9CB 3QLHA 2G0IA 2CNNB 1JB0C 2QMWA 1X7VA 4DR7F 2VBYA 3FSXA 1LWCA 3HZGA 2HHUA 2UUAJ 4UOHA 4J9QA 3L3CA 2M52A 3DLKA 5C25A 2RILA 4XIUA 2MKJA 5CH7B 3J81U 1HA1A 4O3QA 1FF2A 2NXCA 1PBAA 4Y00A 3UN5A 2ZH5A 3GV5B 2B3TB 5CYMA 5H9FJ 4MFBA 4FNIA 2AEMA 2GJ2A 2FJEB 1ZH5A 3O1LA 3Q86A 1HMVA 2VDIA 3AJ2A 4FXVA 2V8PA 2MDAA 3KYLA 4M5JA 3A4TA 2JLFA 2GVZA 1UWBB 1ITPA 2GQCA 4ZHRB 1VBXA 1FXDA 1QD1A 3QSIA 4RUAA 4ZPVR 3A3NB 4HHUA 3N5BA 3QJLA 2MKHA 2L3MA 4CLPA 1S0MA 1WC6A 5KOWA 3MR2A 1AW0A 2KM8C 4F7VA 1OJ4A 5HQ8A 4P75A 4RUCA 4ZVTB 4Y65A 1XBWA 2OKQA 3JSMA 1K8AT 4LVOP 3HMJG 2VQFF 1N34J 2RMLA 3ZNUA 2C1EB 2K3KA 2R8JA 2PMHA 3HHLC 4QR0A 3R8YA 2Z57B 2M3DA 2WVDA 1VR6A 2OPRA 2IIHA 3OFFA 1FK9B 2LMIA 4P2MA 4RBVA 1PJ5A 5HMXA 2DY1A 4C8YA 2OTJS 3KXDA 4IG3A 2PA8D 3CCQS 4C8MA 2HFSA 1ZETA 1EP4B 4RZRA 5F9LA 4ZP7A 1WDTA 4UY85 1FD8A 2WW4A 1W25A 4MAKA 2A10A 4LF8F 1NU4A 1WHVA 1PIEA 5LSLA 3AAWB 1DFDA 2VG6A 4DX6A 1FRXA 3I56S 4J9LA 3PM9A 4OJHA 1TK8A 1WACA 4CO0A 3W1YC 3IWNC 4WZMA 1URRA 2Z2LA 1HIYA 1X0PA 3M1VA 1E6YA 1B64A 2MSTA 1QE1B 1YJ9S 3ZTRA 2CXEA 2BOAA 1S9GB 4LRBA 3W66A 2YNHA 4C3MA 4J9PA 3MEEA 4DS5A 1HPZB 2KL8A 1Q5YA 4F0HA 3FVYA 4P10A 3WX4A 2KVQE 4EEYA 1F5CA 4ANCA 2GC8A 1UWAA 1HYSB 2QA1A 4PWWA 2P9EA 4PG6A 3QZ8A 4ZLLA 2RUSA 1VLOA 2RHQB 2F9JA 1D9FA 8RUCA 1EQMA 1U02A 4EK2A 4K59A 2LA6A 1WF1A 1HNIA 4FF2A 1R89A 4DR2F 3DHXA 3L4BC 5FLXU 2NQPA 3BYPA 4LF9F 4NYZA 5KFPA 4MT1A 3TYTA 2FLOA 2ZE2B 2YNIA 1S5ZA 2Y1JA 3BS9A 4X66F 1S76D 3DRPA 4B3TF 3KJFB 2HSEB 4LRFA 3VQSA 2AGOA 5HATA 4CLLA 1RISA 5EUHA 4FF1A 1LW0A 4Q7AA 4P73A 2JFKA 3MAAA 3PXGa 2Q6BA 1OY8A 4OZJA 5ETMA 2FJBB 3GIMA 1ZTTA 3Q2TC 3V6DA 1QVGR 1REVA 3MR5A 1XMQF 4XDCA 4QCLA 5D6GA 2XMAA 2MZQA 2NZCA 1FEHA 2W2MP 4KAIA 1OPZA 5HK4A 2XNQA 1YKWA 5GVQA 5JVGQ 2V8DA 3GCXP 2HFOA 2O5DA 3QRQA 5LJ3Y 2DNMA 2YKNA 1RU1A 5KG7A 1F2HA 3K58A 1X4FA 4PG8A 4IRKA 1U09A 1RWWB 3BF4A 1RWPB 2AYEA 2RVJA 1TKXA 3TX8A 2KG0A 2LKZA 5KFSA 2BDPA 1WSVA 4ID8A 1U1RA 3KKFA 1PO6A 2EFPA 4KV8A 2MQMA 2H5EA 4DR5F 4K0KJ 3D0IE 2VC1A 2CPXA 2WOMB 2J8SA 1KD1T 2ZZNA 1Q1KA 3UN2A 2M9KA 2G0JA 3CXCR 5DQHA 2IM1A 2LQ9A 2DO4A 4OZNA 4YEAA 4RU9A 4H4MA 2AMCB 5I3UA 1H2VZ 2DR7A 3BKFA 3AQPA 1SJ1A 1U1QA 4A4JA 1HWUA 2CNKB 1RI7A 3DRSA 3KHLA 2W7AA 3GFZA 4ECWA 5EX3A 3QQCD 1UKUA 1R6YA 2V50A 2AEFA 4F4AA 1RT5B 3WX8A 2U1AA 2HZCA 3W2VB 4DPUA 1U1LA 2VL1A 2EI5A 4PQUA 1JMTA 1G4CA 2MXYA 2DITA 2YPYA 1NK5A 4CLUA 4TXSA 3K5PA 4OHZA 2X3DA 4Q43A 4ECZA 5IT9U 2CG8A 3BO4A 4A8QA 1YRTA 2CQGA 1ACMB 2KJVA 2W9CA 1Q8BA 1R8AA 1QDUB 3NBPB 1YWXA 4LF2A 4DI6A 2N3LA 4L72B 2BANB 5DLGA 4G1QB 4ILLA 2ZZMA 2FB0A 4E98A 2F4VJ 4E0DA 3FRYA 4DFKA 4LF7J 3R5BA 3A13A 1FX2A 3DRRB 5HJXA 4N77A 2AJ2A 2VU5A 4C8KA 1D09B 1C1CB 2A6OA 1GK8A 2ALZA 1NKBA 2MGZB 4OYMA 3LPYA 5I3QA 3TI0A 2CZ4A 2J5AA 1NHKL 4I69A 3CCUS 3M8PB 3ENAA 1UWBA 2NLWA 2HHQA 2RNEA 3OFGA 4ZHRA 3C19A 4U8VA 2GO9A 4LBHA 1EZZB 3AOAA 1WC3A 4KHPF 3KHRA 2IDLA 3EJMA 3KUHA 3UWTA 5GAEI 4CTAB 3ZZ0A 1TK0A 4X4RA 2MYFA 2IM0A 3V6JA 4DL0C 2VV5A 2HNZB 1H7WA 2C2RA 3ISZA 2ACYA 3UCZP 1CC8A 3G6VA 1VC5A 3FZBA 4DPWA 2IJFA 3FGVA 3IWLA 3POTB 3OSNA 1V3RA 1YGYA 5JMNA 1FK9A 1TVRB 2FVQA 1GH8A 1K44A 2OHDA 3VALA 1NSQA 3VF0B 5E33A 2GJFA 4OYBA 2ADCA 4K50A 4YB6A 3OT9A 5LXRA 1EP4A 3PO5A 4NEZA 3BR9A 1DTTB 1HHQA 2CA9A 3IR7B 2BACA 1K0TA 4QIWD 2BJ7A 1IM4A 2MKIA 1WOPA 3MM6B 3F41A 1ZZFA 1RAAB 5M2UA 4QYZJ 4RW9B 2W4CA 2AD9A 2V8HA 3LP0B 1JLBB 3KMQA 3RAXA 3GV7B 1KTVA 3VHQA 3AOBA 2FJVA 4KE5A 1QE1A 1RT2B 2FHOB 1S9GA 2QTWA 2ZH6A 2D3O1 2FDNA 4WFXA 1HPZA 5C2GA 4DX7A 3RB4A 3AHPA 5HMZA 4DU7A 4NMLA 1WF0A 3G87A 4AUKA 1HYSA 2DPJA 2R8IA 4DV5J 2CZVC 1WG4A 4BS2A 1U1PA 2EVZA 3T9NA 1RAOA 3PVXA 3SXLA 3VVTA 4FXWA 1N5QA 3R5GA 4LF6J 3FBBA 2BX6A 2OMLA 5IQQA 3P5TL 1K47A 3OL8A 1B7YB 2AP6A 2QLXA 1XK8A 3ULHA 2GA7A 1JNZB 2ZE2A 5KG0A 1UJ6A 2ALYB 4OI2A 3DLGB 2E1AA 5HVFA 2M7SA 3CJQA 3SV3A 3H0PA 2ZJPQ 4TLRA 3GPAA 3SCIE 1T8EA 1NH8A 3BKUA 4NCAA 3PHEA 9ATCB 4IH5A 2UVVA 3D4JA 3SBMA 2IVYA 1DLOB 4P74A 3BH6B 3RR7A 1H7XA 4HHJA 1RT7B 3DU6A 2PFFB 1G3OA 2R7UA 4JI0J 4KH0B 1WOOA 3SCLE 3QPIA 4PWDB 2CJAA 4DU8A 3JSYA 5DQGA 4ZCLA 3CT9A 2UP1A 1YJUA 1X31C 3ZO7A 2UXDF 4G65A 1ZOTA 1RYRA 2FY8A 3CWJA 3G8SA 3SFUA 1M5VC 4NASA 3RRGA 3OL7A 1FRIA 1F3FA 1WC5A 4ETXA 2UUCF 2DBBA 2HHHF 3FSIA 2YX4A 2B4PA 3I55S 1D1UA 3VQTA 2N82B 4WWSA 3C46A 3UDCA 1KTQA 1SH0A 2JNJA 2NPIA 1TQLA 2WB1D 1JNRB 2N7CA 1YBTA 3TQEA 1GMWD 4C3LA 2C28A 3SQGB 3TEGA 1S1UB 1N5TA 1H72C 3W60A 2WOMA 2M8DB 2N4CA 1QUVA 1KS2A 1X60A 2OI2A 1DARA 4RNMA 1N4LA 5CABA 2VUGA 4LBIA 4DV2J 1AYEA 4USKA 3BGUA 4DL3A 3T1HF 3OSPA 2DY9A 4I1TA 1BMQB 2VC0A 2XG8A 3CCJS 2NXNA 3QIPB 4DUTA 3R97A 1RAEB 1Q78A 3OTCA 4FVMA 3U02A 4ELUA 1RT5A 3KHHA 1L3TA 5CCMA 4ZP8A 1LW2B 1IJFB 4NZ7A 3W2VA 3TWZA 2FPHX 3T5KA 1RTIB 3GWCA 2OP5A 3OLAA 5AXKA 1TL1B 3F44A 1FXLA 1UZHA 1NJXA 1WKJA 1VHFA 2JHEA 3EGZA 1UAWA 5IFMA 4JI1J 2XHCA 3JB9k 1KVIA 2XB2D 2VKRA 3EZ5A 1FDNA 1GTHA 3NBPA 5DRKA 2O66A 5KG6A 4HH0A 2BANA 3MURP 1AUSL 4G1QA 4A8FA 3M8SA 3EZUA 4CH1A 4LQ3A 3DRRA 5KFTA 1Q8KA 1HI1A 3VAHA 1URNA 1Q0NA 1F3VA 2JH3A 1IBMJ 2PMZD 2BKNA 4HYKA 1Y4ZB 1C1CA 3A8KA 2VFVA 5IZHA 2QFIA 5C42B 2ZC3A 1KC8T 1O0PA 4LF5J 1FJGJ 1RKJA 4YB5A 3BB5A 2B4UA 4AQYJ 4WP9A 3N4WA 3M8PA 4QYRA 5KFQA 3I0SB 3T9ZA 3M2UB 4KH1B 2VIHA 3D0HE 1VBKA 1UCNA 1P6TA 2J7UA 3KUEA 4A8WA 2HZVA 4J9KA 3H4DA 4CTAA 3H5UA 4OX9J 3TVZA 1X5PA 2R2SA 5G0RB 2HNZA 3V5RA 1UZDA 1UVLA 1R6VA 1WHYA 2CKWA 4B3TJ 4LVNP 4ED2A 1XQIA 2LA4A 3D1QA 2JVOA 4X62J 4F02A 2BE7D 3AD8C 1HWKA 4QU7A 2M4MA 3POTA 2KVIA 2JDJA 1U6BA 1TVRA 3M7VA 3LALA 2IM2A 5B0DA 3TZXA 4WP8A 5GAGI 3OV7A 4O0IA 2E5LJ 1IR1A 5DM6Q 3WC2A 1VQYA 1DTTA 3AXMA 1VQOS 2QYCA 3WBZA 3MM6A 1IR2A 3RRKA 2UVWA 3L7PA 1VBYA 4PG4A 4RW9A 4HI1A 3LP0A 1JLBA 1NDCA 4WF9Q 1S77D 1SQGA 5CHCB 3A8EA 1RT2A 2LCWA 3PCOB 1YITS 1MROB 4LR8A 1BQMB 2B6AB 5HROA 4U95A 1T03B 3QJPA 4QBUA 4F3QA 3A3PB 3B4DA 3UQSA 2XS2A 2H65B 1QVFR 3GCWP 4WU3A 4FKYA 4F4ZA 1HQEB 5E3RA 2B0GA 3HFKA 3LP1A 3NCPA 3UD4P 2GV1A 2XSJA 2O67A 4DPTA 2FY1A 1XNQJ 3SYZA 2LEBA 2VB6A 3M6VA 5EX0A 4OI3A 1GFWB 2D1CA 3MWBA 4OLPA 3G96A 2ZJRQ 2I5JA 2V6AA 2WVBA 4DZDA 3QYYA 1LWFB 1SB6A 3DLGA 2K7JA 3C6UA 2DO0A 3CNQP 3I9ZA 4YY3F 2VBXA 1Y3KA 4KGKA 1LWEB 2W9BB 3CC7S 1DLOA 3W5XA 4ES2A 4C8OA 4ZVEA 4B9SA 1RT7A 2WBRA 4RR5A 3BEGB 2IJRA 3P3DA 5D0GA 5KFBA 4F4XA 4CLFA 2KI2A 4I56A 4PWDA 1TUWA 3QFHA 4MKVA 2IAJB 4JI7J 2CDQA 1YK9A 1G2EA 4MYTA 4R5PB 1ULRA 2XGPA 1IWGA 2Q79A 2KZMA 3H7HB 3J7ZT 2VONA 3ADAC 1VI7A 2RU3A 2L9WA 4DSEA 2DGUA 2P2CB 3TJ8A 5LOQA 2DKOB 1NKEA 2UUWA 1L5UA 1KWMA 1QAYA 2Z8QA 3RB3A 2OD6A 1V6HA 5HVHA 2RQMA 3SSQA 3K7RA 4JB8B 4D3GA 1N6QB 2BJDA 3L09A 3ZTPA 3G86A 2CNOB 1RK8A 1S1UA 2AJ1A 2HHXA 4CLYA 2HVIA 2F7VA 1X4BA 2HNYB 3M6UA 4ZVUB 2QFJA 5KOXA 3HVAA 3H2UB 2DRBA 1ZS6A 4F26A 1UPPA 4RKUC 1ZM2A 1PGZA 2B56A 1TTHB 1NK6A 3QIPA 2FHKA 4NLXA 2XZTB 3DU5A 1N8RT 1IQZA 4DR6F 4MYUA 3LTOA 3UCUP 1HNWF 1LW2A 1RTIA 4ZLJA 4F2RA 4USUA 4QIGA 1ROFA 5IC6B 1TL1A 2I0XA 3GB0A 4OZ2A 5HVGA 3AFGA 1NBEB 3IP0A 3I4HX 3CDEA 2ZDOA 4DSIA 1MG7A 3TX0A 2D7SA 3QRRA 2FZKB 1TKZB 5HO4A 5A76A 4IOCQ 4C0OC 4WK1A 3QATA 2DNOA 1R3NA 3MCOA 3M2RB 2FD2A 2ZDPA 2V67A 3L95X 2ZITA 1RCOB 3D3CJ 3NNAA 4DV6J 1B7FA 2QL5B 3K5MA 5KTQA 1TZ0A 9RUBA 1MN7A 3PJWA 1XMOJ 2KT2A 3H5SA 2XI3A 2F3JA 5C42A 5FD1A 4AE5A 3SQOP 6FD1A 4HKQA 4JI2F 2B43A 4M5HA 1VYAA 3TUZC 1IBKJ 4ECRA 2EWHA 5IXUA 1VS3A 4ZS6A 3M2UA 3SMZA 3R27A 2DNKA 4ZJQA 1SQFA 3HVWA 2SXLA 4O3PA 3JSRA 3PJXA 1R27B 1IJEB 4DFJA 1Q53A 1T9TA 1Y9OA 2R2UA 5G0RA 4I2QB 2OEKA 3KG0A 1ICEB 2R4FA 2Q3PA 4DMZA 4B9MA 5J1PA 1PKUA 1GTEA 1SVDA 4ED3A 2MZTA 2XULA 1NPPA 2QIFA 2GHWA 5DO2A 3Q0AA 3J80Y 4ED7A 2EFVA 4XO0A 1V3ZA 2WW8A 1UEUA 3A1YG 4M5IA 4Y2AA 3CUNA 3T41A 3GR0A 4F0KA 2RS8A 3KDOA 4DXLA 3ICLA 5F8MA 4F4YA 4OJ1A 4JP8A 2L9NA 2C3YA 4DV1J 1LEOA 1UVIA 3ZZOA 4NLWA 2E44A 4WIQA 1N36F 4Y2KA 2KT3A 3NS6A 3A8IA 3K89A 4ZPBA 2ZH1A 4KTQA 5D78A 2D3ZA 2E5GA 2MLXA 2P8IA 3R1LA 2ZFHA 3J7Z5 3FDSA 1HLWA 1RDRA 3M30B 1MROA 2G1DA 1BQMA 1O6XA 2B6AA 4P7VA 1T03A 4JV1A 4X64F 2HW3A 5BR8F 1QAXA 2JEJA 3AB4B 3DXSX 5DQIA 3LP2B 3PYEA 2DHAA 4DSFA 2ERRA 1S97A 3LGNA 1VJQA 1HQEA 2CYYA 3AY0A 2IMWP 4IG0B 2MEWA 1N32J 4A8XA 4AFFA 5T7LB 5LMUF 2QEXS 5E2QA 2LQBA 4LRDA 3SFGA 3Q8YA 1S6QB 2WSCC 3NG8A 2RSQA 1D8YA 3OR2B 1EAYC 1U7LA 3NAIA 2AYMA 4WFBQ 3QGPA 2KDOA 3ZTSA 3BN4A 4NE9C 3C66A 2ZH2A 4N47A 1FNXH 4H4OB 1S0OA 1UVJA 1LWFA 3GONA 2FC8A 4USTA 4IOBA 2BV3A 4RW4B 4I6YA 1S1VB 5L39A 5HBMB 1RP5A 2I1RA 2CPEA 2W1BA 4D3HA 1JJ2R 1LXJA 1FERA 2EC0A 3I82A 2AQ4A 3EWGA 1WG1A 1LWEA 2W9BA 1Q95G 4QIFA 3BKTA 3OTOF 1VQ8S 2Y0BB 3OXFA 1U1NA 1FJ7A 2RAQA 4B3SJ 4RNOA 2V63A 2BEFA 2YKPA 3C3LA 1SBRA 5KFNA 4KKOB 5L1LA 1H98A 2EFNA 3NNHA 3RJMB 3PR5B 4WYLA 5IV4A 2R7SA 4RNHA 1H6KX 2CPDA 2IAJA 3C6TB 2BRLA 2XLKA 3M4XA 2NREA 2OTLS 2UXCF 4F2SA 1PJ6A 1KLMB 4X4NA 4LR7A 2YKAA 2C3MA 3HKWA 3WIVA 1U2CA 2HQGA 2VQEF 4AL7A 4LFCF 4KQZA 3HSGA 2ROPA 1UW4A 1C4AA 1YIJS 3DYAB 3LGMA 2ZH4A 3MDFA 2RB7A 1ZAXA 3SSSA 2OUGA 1N6QA 4FF3A 2B4OA 2RT3A 3FEYB 2MMYA 3K0JA 8AT1B 1S57A 1LV5A 2HNYA 5F8JA 2FJXA 2CFXA 1DQAA 3DC2A 1EKRA 4K4YA 2D3OR 1KRPA 4QWEA 2Z2ZA 4LUBA 3RBEA 2B9EA 2J9EA 2CUYA 2E7WA 1FTRA 2W7PA 4QWAA 1XTZA 1C1BB 1S6UA 5L38A 2XGQA 2HHVA 4JV5J 3P96A 4U7UK 2CJ9A 4YMEA 4M8LA 3CSKA 3JAMY 1DRZA 4ECUA 3FEXB 3FJ2A 1HW8A 2QL7B 4ED0A 4FS1A 4XPCA 4FYXB 1RGVA 2XSFA 3IR5B 1L3UA 1WOSA 1FDAA 4IR9A 2BQUA 2BE9B 1S49A 2FHMA 2DHSA 2IBKA 1BUXA 1TKZA 1Q8IA 5CA5A 5LT5A 2Q66A 3EXCX 2XLJA 3CIZA 4KHRA 2CJKA 3M2RA 4QW9A 3DCAA 3EMTA 4Z7CA 3PRVA 3JQMA 1YRXA 3AXKA 3RB6A 1ZM9A 4JYAF 3TJ9A 4C8NA 5L9XA 1Q7LB 1QTNB 4MMOA 4UOCA 4P71A 2B7CB 2CG4A 4ECSA 1MLAA 3BSNA 1PAUB 4G3IA 4ZN3A 3TJAA 3M05A 1RWMB 2R8KA 3QAUA 4KT0C 1FJEB 1VK3A 1DTQB 4WFYA 4PXBA 1F9HA 2KRBA 4X4OA 2ZH9A 3R2DJ 2K2PA 3WC0A 2MQ8A 1NMEB 4LF4F 4QIEA 3DHWC 1SH3A 2WZ1A 4USVA 4HVZA 3LQVA 3ZZTA 5BJRA 3JXOA 1VLYA 1NSKL 2R7OA 2VPWB 4ED6A 2JVRA 3T3FA 3MFHA 2HPUA 1N5VA 2VDHA 1NDPA 3RAQA 4I2QA 3QRPA 1U2RA 1GMWA 4FXDA 1BQNB 4QJVA 3KLEB 1EJ7L 5KFWA 3CMES 1HBUB 4XDDA 3T19A 5IS2A 3X1LB 3HHLD 2QA4G 4IRCA 5J1NA 4U7CA 1OQ6A 5HJYA 4ZPDA 2ILZA 5A2QU 2OFHX 2X3GA 2BMBA 2BQRA 4LJMA 4ES1A 4B3RF 1KQGB 2RJZA 5BYQA 3KLGB 1DJ0A 1LFWA 2D69A 1H73A 2FGOA 1WHWA 2IC3B 2DNPA 5HL7Q 3DNCA 1LK7A 4C48A 1JQGA 1J5OB 1N5YB 4DR3J 3UNGC 1CULA 2CNLB 3B6BA 1WD6A 5D8HB 1QSSA 4O0NA 2RUGA 3M30A 2UXBJ 3AA9A 1CJUB 3IWXA 4B08A 1HNVB 1RE1B 3ELHA 2ILYA 4NXMF 3LP2A 1YJVA 3US5A 4ZIVA 2WTFA 2RDIA 2V4RA 4IG0A 1ZTWA 1XNRJ 3IGNA 2PSZA 5JXSA 3FC9A 1X5SA 4FNHA 5T7LA 2E1CA 2XO7A 4PXCA 1YJ7A 1S6QA 1JLCB 1M1GA 3MAQA 3W9IA 4KJIA 1O5JA 2OEMA 2OJ3A 1XR5A 2YWGA 5I42B 4FYWB 1W2IA 3UR0A 1IBCB 2V8VA 2UU9F 3RG6A 2HBYB 4EBCA 2ZKTA 4H4OA 3D5MA 1OYDA 2BJ1A 2HBRB 4DL5A 4QWBA 4RW4A 1LKZA 5DGAA 1S1VA 4CO5A 5J1EB 4ZA1A 2QA2A 1RLCL 5HBMA 1S9EB 2J0SD 4FPIA 2NR0A 4HT5A 4CT9A 3VR1A 2IYGA 1DY3A 2BR0A 4DR4F 1AUDA 3KNAA 5E7OB 2DR6A 1FDBA 5FLXY 2CQ4A 4KR0B 1P1LA 4WBFA 4TNOA 4NRTA 4U6PA 4TQSA 1WELA 4KKOA 4N7TA 3ENVA 3MMJA 3C6TA 1B0PA 2HLUA 2HWIA 3HSDA 5HLFB 5EWFA 1NHUA 2YQ3A 2IA6A 1VMBA 3NOCA 1SJQA 4DCPB 3ONQA 1R8BA 2VPZB 3VGTA 4WPAA 4QOTA 4KYZA 5LJ5Y 3B8HA 4I6AA 3DYAA 3J7A1 1RCXB 4B3MJ 2AJ4A 3ILIA 5HMYA 2F65A 2HVDA 3CCTA 1AFIA 1D3WA 2C22A 3GV8B 4V19J 4OMFG 5ETLA 2AHOB 4EGLA 2NZ4A 1LWCB 4I67A 4DG1B 5F8NA 4DQQA 3DLKB 4NLSA 1UA1A 1MSWD 2RU9A 4C97A 2KFNA 1REGX 1YLXA 3Q24A 1JLGB 2AWZA 2AGQA 1M5SA 1GXTA 3R5CA 2DR8A 1N33F 3LWMA 2AZ3A 4NA2A 3FEZA 1ZM4A 2P6SA 4FN5A 4DSLA 2Z30B 2R7RA 1BQXA 4F25A 1UW9A 3DOKB 1TKTB 1YJWS 4K4XA 2AF6A 4QWDA 1YJTA 1C1BA 3D6MB 1UEVA 5LSRA 4MIBA 3JQKA 3K8VA 1Y0HA 4OI4A 3UD5A 1FFWB 2LYVA 2LU2A 4I7FB 5ETOA 3MPDA 1WF2A 1X5TA 5B09A 1W26A 4CO4A 1U26A 2DEJA 3AOCA 4DFPA 2ZOFA 4DPXA 4DCOB 3BZQA 4ILRA 4IKAA 2YKOA 3I0RB 2IMOA 4EU0A 5KFFA 2BM1A 4OYIA 2PGCA 1M5HA 1IKWB 1UMJA 3TR5A 1M1HA 1I94J 4YHHJ 2YH0A 1KFSA 2QSWA 5KFHA 5L1KA 2CQBA 2MKYA 1S99A 1BY9A 3HO1A 3TA2A 1KKHA 3A3OB 3H8YA 2AX0A 1PILA 4YR2A 5IT9Y 2BOPA 1QUPA 2DGTA 1UFKA 5H9EJ 2WAQD 3NMRA 5KG3A 3KHGA 2HGMA 1DTQA 5L8RC 4LT6A 1NSAA 1NUEA 4GVLA 2M2BA 3I32A 3T1YF 3M1VB 3UNYA 2MHNA 2XY6A 5KFKA 4O4GB 1NK8A 3D0GE 4UF4A 4CI0B 3AD7C 3KNGA 1N54B 3T1AA 1RA6A 4F4WA 5JJBA 2QL9B 4OX8A 2ZBCA 1AB8A 1KHVA 2ZHAA 1FFGB 1NPRA 3IN5A 1P9QC 4YB7A 4LFBJ 3FZ2A 4NLVA 3M2VB 1QTMA 4C0BA 3RTVA 4LQ9A 4YUDA 3OTDA 4X4UA 1P9YA 1QAJA 3D7SB 1X9SA 1BQNA 5KFZA 1AROP 3KLEA 1RHKB 2A18A 1HBUA 4ZP6A 4USJC 4WTOB 2F9DA 1X4DA 4DR1F 1N48A 1NJIT 4GO5X 4OZLA 3MHYA 2YQ1A 4U7UD 4OX6A 2E1RA 4IO1A 5D4OA 4P9SA 4JUZA 3KLGA 4GKKJ 3OD2A 3S7RA 5SZTA 2IC3A 4LSZB 4J37A 4HT7A 1J5OA 2DGSA 1N5YA 1S6PB 1U1MA 2RRBA 5AJ3F 2XWYA 3GG1A 2GS8A 3NS7B 4MK8A 1D9DA 4I0WA 2RIJA 2OPQB 1CJUA 2XZWA 4GKJF 1D8ZA 1HNVA 4DQIA 1OYEA 1H2TZ 1R8CA 3TVYA 5IWAJ 2HBQB 4C11B 4HHHA 2F8EX 4R0EA 1SKSA 1RAGB 1CQMA 4X4SA 3GIKA 2DGOA 3CD7A 2F4FA 1SH2A 1JLCA 4JI4F 1PYSB 1FX4A 2EKNA 6AT1B 1C0UB 3R6GB 2APOA 3EGVA 1A9NB 3TUPA 1SJ4P 2UUBF 4R25A 3CO0P 2RDJA 4ANDA 3CPWR 2KT5A 4TU8A 1RU2A 5EGYA 4G1PA 3ZZPA 1TUVA 1GX6A 3SSRA 4YDXA 5J1EA 2DR9A 3I5CA 3TO8A 3CVKA 1S9EA 3N6NA 3VAFA 2PI4A 3HD2A 2KXHA 2C3OA 3J7AN 2MZSA 3JAMU 4URSA 4M94A 3S6EA 1EETB 1S59A 5I3UB 2E9TA 4NLRA 4USMA 2VG7B 1EIYB 2WSFC 2M0GB 1FA0A 2ZH7A 2KM8B 3ET6B 2W2OP 1M5KC 5HLFA 1IVZA 4WZQA 1HBMB 3TUIC 2XCPA 3PO4A 1F5BA 4H4KC 4TU7A 1S9FA 1S48A 4JOUA 3V2UC 2HQCA 1QSYA 2P5VA 3HHLB 1SCJB 3IS9B 1FNMA 4MJKA 3MM7B 1YJNS 4NLTA 3EDQB 1HQ2A 6FDRA 1EX8A 2ASYA 2OAUA 2VJVA 1RBOB 1NZ8A 2JZ5A 4LR9A 4ITSA 3PZPA 1YJRA 2IFXA 4YR3A 4OYOA 1FNOA 2KTQA 4EUVA 1X8DA 3MEDB 3F56A 1X4HA 4DG1A 3O5TB 2FHJD 1JLEB 2X1GA 3HK2A 5HMWA 1AXQA 5AE1A 2ZHOA 4B9VA 1WUUA 5A8WB 1JLFB 1JLGA 5ETNA 1GQEA 4USWA 1KHWA 2CPYA 2NPFA 4PRFA 3OXLA 3C16B 4A8KA 1QAIA 3K57A 2I6WA 1Q81T 4DUZJ 2GMHA 1FRKA 3AH6A 4M5GA 4CO1A 3BSAA 1VIXA 3DOKA 1TKTA 1FJCA 4ELVA 4ECQA 1F60B 1CEZA 3BO2A 3GYXB 3HP6A 4V1Ak 2DB1A 5H9FK 4LFAF 4NL5A 4ID5B 4DUYJ 2VPXB 1VQNS 2QLFB 1NAQA 3W3SA 1S1XB 2NYIA 4ATNA 4BWJA 4I7FA 3QT5A 1QSLA 4CP5A 3L7OA 3CCSS 3GIJA 5A6WA 4NI2B 5CAAA 3VTIA 4ER8A 2OFGX 3I0RA 2VOOA 4ECXA 1NPKA 3N6MA 2RH3A 2H4YB 4ECYA 3B82A 1IKWA 4DF8A 1P8GA 3QBCA 4JI8F 1O8BA 2GMJA 2W24A 2LXIA 2J6SA 1RWVB 4CM0A 1RT4B 1CSJA 1WC4A 2VFTA 3MEKA 1NJWA 4K7QA 5B0FA 3G4SS 2G13A 3MOJB 4DV3J 3D68A 4PKDB 2XYPB 4X84A 2AYGA 2CQDA 3MMBB 5E3CA 3ZZRA 2LU1A 3SEOA 2GCFA 4UUWA 4O4GA 5EWGA 2FZGB 2JOQA 5ITHA 2F8HA 3MUMP 4DV4F 5KFGA 3WHIA 3LUYA 2CVIA 3L9ZA 3PX0A 1K9MT 2GW8A 3M2VA 1HL6A 1YVFA 2XNRA 3SCJE 4ED1A 2JRSA 5F41A 4DV7F 3NL0A 2H4WB 2DNGA 5JVHQ 3I5BA 4A8YA 4ALZA 3THPA 2MZRA 2PMWA 3HHDA 2RS2A 1NJZA 3UCGA 3FQKA 4ZDNA 3CGIA 2BJEA 4K4VA 1T9XA 2JWNA 4WXWA 1FT8A 2CQIA 3PR4A 2DNNA 4CWBA 2XLIA 2XHWA 2HRTA 3I4PA 1IR0A 2J0WA 2PD1A 3QMQA 2CRLA 4NPOA 4L3KA 1SC3B 1DZ5A 2HG4A 5K14B 5KFRA 3D54A 3O6QA 3HVRA 4UOGA 3D6FB 1OIAA 3MUTP 5GMDA 5IC4B 1FO1A 1T9YA 1WDDA 3T6BA 4PXEA 1S6PA 4CH0S 2MLYA 3PHTA 3CB4A 2HLTA 3M6WA 3M6XA 1VHIA 3HHEA 2GAHC 1JXLA 5EN1A 1AFJA 2UUAF 2OPQA 2YPZA 3P49B 3PFEA 2OEJA 2AKWB 1UVMA 2AU0A 2EK6A 3SZ2A 4TU9A 1JLQB 1NEEA 5H1SV 4C11A 1ZA2B 4WTYA 1EKSA 1RWKB 4ZLPA 5CYQB 4HH1A 2V69A 3IBCB 3M9MB 2XYHB 4ILMA 1FVQA 4RNNA 1R0BG 4FPRA 4OYPA 1UPMB 2BRKA 1MMNA 1C0UA 2GFFA 1DQ8A 2DRAA 4QR2A 2C2MB 2GNKA 3IXQA 4ZCMA 2DGWA 1VQPS 3W9HA 5K8MA 4DOZA 1HW9A 3ZZZA 3HSJA 3W7BA 4IQXA 3LAKA 4DV0J 2BUNA 4KPYA 3H42A 4OHVA 3JSBA 3D6HB 1GX5A 5F8IA 4TY9A 1NLKL 1N34F 3K5LA 2D9PA 4A46A 1EETA 4F3OA 3IC1A 1XMBA 4OL8A 2DH7A 4NLQA 1B0TA 1HWJA 2VG7A 2NXEA 2XMTA 1Y5LB 2JEGA 2WB4A 2FVSA 1RTDB 3GFHA 2CPJA 2CQPA 4XPEA 3ET6A 1OY9A 2KFZA 2HGNA 1HBMA 3PY8A 1FWKA 4ZJOA 5IT0A 1OWXA 3PEHA 2CIMA 1Y5NB 2HS4A 2LEAA 4JI6J 3HHLA 3H5XA 3IS9A 3MM7A 2W8KA 1R0CB 2IRUA 4F04B 3S8SA 1H74A 2PE8A 3BBFA 1KR4A 4CLWA 2HVEA 2ZUAA 1PAEX 1HNXJ 2EBEA 1R8HA 2G1HA 5GMKa 2DR5A 3MEDA 2C3UA 2CQ0A 3OTEA 3UFCX 1TUGB 1JLEA 2Z0GA 2MLZA 5GMEA 4ZJLA 3U1MA 4W90B 5A8WA 2PT0A 1JLFA 2LQ8A 2LEPA 3OHBA 4B9UA 4TVAB 3PDNA 2V9KA 1WWHA 1X4CA 2G2ZA 2HBZB 2DIVA 4ZVHA 2ZH8A 3C16A 2NS1B 1SUQA 3GSDA 1BLUA 4EZ6A 3GU0A 2GHVC 3HI9A 4RBUA 5J2NB 3W5ZA 2QRRA 4ED4A 1UETA 5CD4A 1I5OB 1SV5B 3LPEA 4O3NA 3E3XA 4ID5A 4ZPWR 5LSOA 1S1XA 1B70B 2WVEA 1HI8A 2Y1RI 4DR1J 4L6V3 1U24A 2O01C 2Z56B 5HN0A 2ZEJA 1AZSB 1C4CA 3DFEA 4NI2A 1TV6B 5KT5A 3OVAA 4RW8B 2EG1A 2VD3A 4WE1A 1DAXA 4Y2CA 2HIQA 1ZPVA 1HD1A 1T9VA 1J5EJ 3EGWB 3KMSA 3HJVA 4WCEQ 1GMVA 3R9LA 4NA3A 3RYLA 1PCAA 2V9WA 2DGVA 4C2MA 3PEJA 1S72S 1HARA 1RT4A 1VRUB 4I6WA 1F0XA 1CG2A 2IBOA 3R6LB 4WIIA 3EM1A 2YWEA 4EYIB 5CZXA 3OVSA 3I31A 1L3KA 2L08A 5D0HA 3EPGA 3OW2R 4L73A 1G1XA 3PV8A 4UQGA 1X4AA 3LAMA 2E66A 3PIPQ 3H2LA 4B9LA 3MMBA 4W92B 2POKA 1TMJA 3KTQA 4RU2A 2R3VA 2EEYA 4PZVA 2FYXA 3DKDA 4NXNF 4TQRA 4K0KF 4QYZK 5HROB 5CYJA 2EFGA 4ENOA 5A8KB 3VAMA 3K5NA 3NWGA 1S12A 2K3IA 3N28A 2W7OA 5CQGA 4DL4A 1RTHB 1JXVA 2FJWA 2VA3A 5LMNJ 5F0WA 3OTBA 2X1FA 3LP1B 1IKXB 4UZBA 2C2ZB 2IPOB 3E2EA 3LH2S 4JI5J 5K8NA 5L9NA 4DQRA 1TL7A 4J7CA 3I5AA 2XSJB 2HMIB 4O3OA 1CBKA 2A0FB 3NXZA 3TAPA 1FXRA 2HFZA 4Q8EA 3MCMA 2XQCA 3SV4A 2I5JB 1IBLF 5K14A 1P27B 3KK1B 3RW7A 4NLUA 3C6UB 3UI3A 2DD8S 3M9OB 3TAQA 3VZHA 1N88A 1S1WB 1U0HB 5KFUA 3EVWA 4MK9A 3C14B 2M70A 3Q83A 4HTIA 4U67Q 1F2GA 2LDYA 4IR1A 2GIRA 3J7YU 2F4VF 2MJUA 4LF7F 5IM0B 4YB1P 3FBFA 4FF4A 2V2KA 1UVNA 1YZ7A 3BGRB 1JLQA 2ZWPA 2UVRA 4DR7J 4U8YA 4DL7A 3QZ7A 1AA1B 4JV2A 4A8MP 2HEKA 3DLLQ 1V3SA 2XMMA 1IQTA 4LRAA 5CYQA 2D41A 3ZTOA 5KFMA 4OHWA 1Q7YT 4PAAA 4F8RA 3E51A 2XMKA 3KDNA 4IUFA 5KG4A 3BSOA 4M1KA 4RBTA 2Y1LB 2DEIA 3MPVA 3TW0A 3L7UA 4QU6A 3N5FA 3EVMA 2BABA 2XTJP 1UFWA 2QX0A 4U9RA 3H98A 1C0TB 4N8OA 1F1BB 4EO8A 2D3UA 4BDPA 3RGIA 2CJXB 5B0CA 3VAJA 3CDWA 2YX1A 4ANEA 1FWLA 3MOZA 3RRHA 2VJUA 4NZ0A 4X4QA 2PI5A 3D66A 2XMUA 3OQ2A 1L3VA 4FDFA 2ROEA 4HI2A 3AA8A 2CQ3A 1BGXT 2H9ZA 5DG9A 2VQFJ 3BGFA 2DCUB 1RTDA 3JYTB 3N01A 4TYAA 4DPYA 3CCES 2DHGA 2QMXA 4ZN1A 2KKHA 3OJUA 5MAOA 3DLJA 1WSRA 4K2JA 4ERDA 3MMCB 2J6UA 4NWBA 2YY3A 3DM2B 3ILLA 3D9BA 2YTCA 3EICA 3LA0A 3RUBL 1V9OA 2XMWA 4KSEB 4QIVA 1U1OA 1FTCA 1CPZA 1IXKA 4LF8J 3KLHA 2KU7A 4RPFA 2FQQB 2ADBA 2KYXA 1Q16B 1ZA1B 2MQNA 4DCJB 4OYZA 4RLEA 2GIQA 4OX7A 1WEYA 1BWEA 2DRDA 1SC1B 1YDLA 4M63A 1RUSA 1TK5A 3W64A 4DV5F 3QT7A 2BJ3A 3ZTQA 5CXTA 2ZBIA 1UP1A 2KHDA 2XY5A 3MECB 2G2YA 4FVCA 2ZH3A 5J2NA 4GRSA 2OPPA 3MR6A 4RWWA 4LF6F 4NLYA 2HHWA 2VG5B 1SV5A 1TFWA 2B51A 4DQPA 3CC4S 4DV7J 3HPOA 1KVJA 3NAHA 2HRYA 5CZVA 4WJBA 1RHRB 3THTA 3QJJA 5EWEA 4DR2J 4NMXA 2ZM6F 2EC2A 4R8UB 1I1GA 3BO3A 1AZSA 3B78A 1UVKA 4LF9J 1Q82T 1TV6A 4OYAA 3FKBA 4RW8A 1SC4B 3N0VA 2CADA 3GG0A 2CZ9A 4X66J 5AT1B 2OMOA 3GLJA 3CDUA 5HANA 2FUG9 8ATCB 1S79A 5HSPA 4DL6A 4TY8B 4DF4A 2R7QA 4K5RA 1VRUA 4N8NA 2C3PA 1OMSA 1VQ5S 2V94A 3VZIA 4OI0A 2GIFA 3TA1A 2HS0A 1N52B 4LMZA 3QGHA 2RQCA 4MH8A 1UEKA 5AE3A 5KG5A 2NSBA 3U7JA 4CT8A 1XMQJ 1S0VA 3TRGA 3UR3C 3JS9A 2L48A 4ZMMA 1N0VC 3KOAA 4OZ0A 4IRDA 1WEZA 3TOQA 4PR6A 1KFDA 1GAOA 1BD6A 3P4UB 5A8KA 1KBRA 2FLPA 1RT6B 2HYIB 1WI6A 3MF5A 1RTHA 2HRUA 3DXBA 1HNZF 3CDBA 3W8GA 5I3PA 3PIOQ 4DV2F 3R5DA 4DR5J 1IKXA 2AIRB 2PC6A 2FHJA 2RQKA 3AB2B 2RQ4A 3NEKA 2KYZA 2XI2A 4UQTA 1A0OB 1RYSA 2XZDB 2HMIA 1G7CB 4KO0B 3HSZA 2OPSB 4I2PB 2ATLA 1TKDA 2JFDA 5E3AA 3PYFA 1SL1A 5K8OA 3KK1A 3EYZA 1ZM3A 1QY7A 3MM9B 1M1KT 4A47A 1IN0A 3BH7B 1FRJA 4JI1F 4Q2LA 2GQQA 3DDKA 1S1WA 1U0HA 1FFSB 2M5YA 1TR0A 1T9UA 2BQ3A 4DSKA 5D15A 4ELTA 1K73T 3C14A 4PUOB 1CQNA 3D28A 1BE4A 2Z2MA 2MJNA 4F67A 3I96A 3TEHB 1T0TV 5A2QY 4ZCKA 1FKPB 2D74B 1B0VA 5IM0A 1ZAVA 3O8WA 1FRHA 1FWPA 1MN9A 2DH9A 3BGRA 1Q4RA 2M88A 1IBMF 2CQHA 4RL1A 4CRJA 4W98A 2CJQA 4P72A 4NYOA 3VAKA 4LF5F 4C8ZA 1FJGF 2KXNB 2OO4A 4AQYF 4CQ1A 3CJRA 3ETOA 4OI1A 3CJ4A 2NSCA 1X4EA 3LOUA 1H38A 4YOEA 3CTRA 1FE4A 1C0TA 1F9EB 4PG7A 4FS2A 4OX9F 4J5OA 4BWMA 1X9MA 4ZPAA 3BQ1A 1SPBP 4U96A 4KHPJ 3HF5A 2FJDB 4QZVB 4KPCA 3SDEB 4BC9A 4XTTA 2MQLA 2KXFA 4X62F 1J27A 3V4IB 1U25A 1RXOB 1RTJB 2HQDA 5M2PA 4OQJA 1RABB 5ETRA 3UDEA 3BM7A 1WC1A 3JYTA 2JEIA 2E5LF 2G0CA 4QPXA 1XN9A 1OSCA 4RUBA 1IKVB 1RTZA 2QV6A 3GMGA 2HHTA 3MMCA 3Q23A 2BE2B 2OLWA 3DM2A 1TAQA 3CJ3A 4IH6A 4YN3B 3EDRB 5BXIA 1U8WA 2CVEA 1NZAA 2V5HG 4UTGA 2VZ9A 5IQ6A 2VHGA 4CIOA 5A0YB 3H90A 3RAMA 3DMJB 4I64A 3AODA 3HD1A 2MTLA 3JQJA 3CF5Q 5F9NA 3D6TB 4HACB 4C3KA 5EDWA 1T7PA 5A8RB 4WU2A 1U0SA 3DLEB 3PYGA 4DQSA 2VICA 2MHEA 2NXJA 3CD0A 2H54B 4NXNJ 3W8PA 2CPHA 1SC6A 2ZBRA 4E2FB 2A2DA 3MECA 1FKAF 4GVBB 4M95A 1NNDA 5DGBA 3PKYA 4OZ5A 2KH9A 1UFLA 3HT0A 2AJ0A 5BYRA 2VG5A 2W2QP 1XNQF 2HK3A 2A2CA 1FI4A 3HXMA 2EFOA 2C2NA 4EI2A 4J90A 4MK7A 3FUYA 3CCLS 4Q8FA 3ILJA 2Y1IA 3NS5A 1F6TA 3HT3A 4R8UA 3R7SB 4C8LA 4BBYA 1K0VA 2Y8YA 3DOMB 2OH2A 3RBXA 3FNNA 1IBLJ 2DHXA 1VQ4S 5F8LA 3IM8A 2W4PA 5L1IA 3MEGB 1HQUB 5D77A 4IFVB 4P2XA 2HFVA 2XMJA 1WC0A 5KG2A 1T95A 4JI7F 1LNQA 4TY8A 5B0BA 2FGCA 1SIZA 3G6ES 3TNVA 3Q8PB 2YH1A 3S1TA 2FLLA 1O51A 1UL3A 2LDIA 5MLCV 2HS3A 3H20A 4CO2A 2YKMB 1FDDA 2NXUA 2RHSB 2UV8G 1MWQA 4OZ3A 5DDOC 4ECTA 2MSSA 3KLIB 1U49A 5KT7A 2MZ1A 2UXDJ 1KQKA 2G2OA 4NLPA 3OLBA 1SIWB 5E0OA 1CULB 5KFYA 4WKYA 2N4DA 3QGGA 2J9DA 2B9YA 2DNZA 3TVKA 4ZVFA 2UUCJ 2HHHJ 2GVDB 4E8UA 1WTFA 3X3UA 4PYDA 2W25A 1B4SA 3H2VE 1BC6A 2K7KA 2FZCB 2E7XA 2YNGB 3B54A 5L46A 2FC9A 4M5LA 1RT6A 2J0XA 4GO7X 3GJRB 1U48A 2VFUA 1NH7A 3G82B 3CC2S 2EKYA 4ECVA 1WTBA 2C2KB 3BBBA 1VQKS 2WVCA 1RAHB 7FD1A 4M5MA 1BWVA 3BGOP 5ETPA 4YR0A 5ETSA 3W2WB 1U8SA 1U6ZA 3BYRA 2DNYA 2R8GA 2F8MA 4KO0A 3T1HJ 3MUVP 1PSDA 2OPSA 4I2PA 1QM9A 2X7IA 5KFJA 2QE5A 4RX6A 4S0MA 5AXLA 3IAS9 3O2IA 2V0NA 5ETVA 3MM9A 3CJ5A 2R7WA 4ETZA 2QZ8A 3PX6A 3VVUA 1PYTA 3TUJC 2VBWA 3IR6B 4G1IA 3MMAB 4RW7B 4WYWA 3EGNA 1VISA 1PJ7A 3P45B 4PUOA 4Z7YA 3ZZYA 4IDKB 1Z2LA 4XAKA 1UJ5A 2HWTA 3CO9A 4UUXA 4UW2A 1FKPA 3UVJB 4M5KA 4X4VA 3FMWA 4DV6F 4CLKA 2HK2A 5E3PA 2E7VA 3ETMA 3KLFB 3GFXA 1XMOF 2E5JA 2JL9A 2CJBA 3VGVA 3KFWX 2YXLA 3QSYB 3RW6A 1VOMA 3PG9A 3NWRA 2Z4PA 4ES3A 2ATCB 3ZNJ1 1IBKF 2PDAA 3ISNC 1UA0A 3CCWA 3MGJA 4AYBD 3CW2C 4WXOA 1OY6A 3HCXA 5F8HA 2UUTA 2ZD1B 2V4JB 4BHQA 4KFBB 3FFIB 4DJBA 3JTOA 2R2TA 3FRZA 1CLFA 1RSCA 1YTYA 4DX5A 2DIUA 3SDEA 3PACA 1HR0F 2ZM6J 4PG5A 4K4UA 4J9UE 2RRNA 3V4IA 1WG5A 4B3OB 1IKYB 1RTJA 3G6YA 3FSYA 2P6TA 2DNHA 3IBWA 1ZBTA 2DT9A 2XY7A 2B5JB 2H51B 1NB7A 3ITHB 4DL2A 5SUHA 1NM2A 1IKVA 5U47A 1T05B 5K20B 1VFJA 2BE2A 4DV1F 2KHCA 1RLDA 3GIRA 1N0UA 3V6KA 4RNFA 1K1SA 3T5JA 5KFEA 4AXIA 3W65A 3WDOA 4NEYA 3RBZA 2JSXA 3VWSA 1BXNA 5A0YA 3HHNB 1FEEA 2W4DA 3DMJA 5F3ZA 3GJSB 4ZIWA 2AGPA 3OHAA 1S7IA 3ZC4A 4Y6IA 4HACA 4RW6B 1TFYA 5A8RA 4R0JA 3IG1B 1SL0A 3TZWA 3DLEA 1LK5A 3PW7A 2I8EA 4RWXA 1N32F 3LWLA 3NLCA 4KGZB 4UZCA 3GILA 3I87A 4GVBA 2DNLA 2ZKUA 4ICLB 2BW7A 1FD2A 1RA7A 1RBLA 1HNZJ 2WONB 3C8YA 2XCAA 2MY8A 3R2CJ 3OPKA 1HD0A 1R0AB 3NGRA 3CD5A 3MCNA 3MD3A 2B7BB 5HQLA 1D9AA 7FDRA 5EHHA 3DOMA 3HKZD 3J7YI 3PX4A 1IM6A 2JC0A 4ED5A 2CPFA 2HWHA 2VH7A 1YI2S 2AZ1A 3DN9A 2MY7A 2K06A 2K1RB 3VV2B 3HX9A 3K5OA 4B3SF 3MEGA 2MZJA 1D0EA 1XR6A 1HQUA 2CDRB 4YY3J 4IFVA 4QPTA 3NGUA 2KG1A 3OL9A 4Y2IA 1JXEA 5B0EA 5E5NA 1GXLA 1ZYQA 2R7TA 1IUJA 2YVSA 1YZ6A 5AXMA 4FYVB 1M90T 2E9ZA 3NMAA 7AT1B 1DBDA 3RU0A 2YKMA 1VIOA 2D9OA 4ZVRB 4NLDA 4A8SA 5C2CA 4IOAQ 2FVRA 2CQCA 3RR8A 1P1TA 3BN7A 1H0HB 3KLIA 3CJ0A 3IBFB 1CJKB 2BJ9A 2MGZA 3W61A 4Y34A 5C5JA 3OVBA 2QT7A 2PA3A 2H1YA 1A6LA 2ZNZA 1Y11A 1RKIA 4CO3A 2FJAB 1VQSA 1FVSA 2ZBPA 2GVDA 2E9RX 1HHSA 3MR3A 5B08A 5C7PA 4EO6A 4B9NA 3IRXB 4J9MA 1VC6A 3V81B 2YNGA 2BW2A 3F0NA 4LIRA 3G82A 2YX7A 1JJCB 2IVFB 4GMKA 1MMLA 1NK7A 3DGPB 2H5JB 2EK1A 3PW2A 1S0NA 1HWLA 3PRDA 3DDNA 2MQQA 4J9VA 4KB7A 1S4EA 1CJVB 3IO1A 3DLBA 4KY3A 3W2WA 1TU0B 3M9NB 2BA9A 2F5GA 4KGMA 1VQ7S 1WJ9A 4MKYA 2B9XA 4JV5F 1S4FA 2KZZA 2WRMA 4J91A 2J0QD 3QO9B 4PPZA 2JX2A 4M5DB 1WKLA 4RO0A 4DR6J 1RAJA 1HNWJ 2J7WA 2YWWA 2XS5A 5FIIA 2IJNA 1U47A 2EFQA 4EMDA 4RW7A 3MMAA 2AEJA 4OYWA 1I3OB 4IDKA 1RHUB 1H2UX 3MM8B 1Q8LA 4ZK7M 1FESA 2QJ3A 3UVJA 4C4WA 4O4RA 3IM9A 3KWMA 2AT1B 1ZPWX 1Z4UA 4X2BA 3KG4A 2WVFA 3GE9A 1DQ9A 3KLFA 4CLTA 5D0EA 2JC1A 3OFEA 1TELA 3NKYA 3QT6A 2ACMA 4C6AA 3HVTB 3E8OA 2W8LA 4DZ6A 5B0GA 1KVKA 3ZXWA 2LXFA 4I4BA 1Y00A 2YNFB 3NCQA 2RE1A 3KJVB 1B3TA 2Q1LA 4NA1A 4NZ6A 4ZPCA 4PWUA 4JI2J 5DDQC 2M8HA 1R8PA 2ZD1A
chains in the Genus database with same CATH topology
1XBWA 2OKQA 3LAMA 2V4JA 3JSMA 3PR5B 2E66A 3PIPQ 3H2LA 4WYLA 4B9LA 1K8AT 4F3MA 4LVOP 4RNHA 4WK3A 3HMJG 3MMBA 1H6KX 2VQFF 2R7SA 4KFBA 3FFIA 2RMLA 2CPDA 2POKA 4W92B 2IAJA 3C6TB 2BRLA 3KTQA 4RU2A 2XLKA 5CD4H 3M4XA 2NREA 2OTLS 2UXCF 2K3KA 4ED8A 2PMHA 2R8JA 3HHLC 4QR0A 4F2SA 3GR1A 4MIWA 1KLMB 2M3DA 4X4NA 1RQ0A 2YKAA 5KAKA 2F40A 3NCRA 2OPRA 2C3MA 4BC7A 3HKWA 4L3NA 2LVWA 3OFFA 4NXNF 1FK9B 4TQRA 2VQEF 2LMIA 4K0KF 4RBVA 5HROB 3HHKA 5CYJA 2EFGA 2CPIA 5A8KB 5HMXA 3VAMA 3K5NA 4B3OA 5ADZA 4AL7A 3NWGA 4LFCF 1IKYA 2L9DA 4C8YA 4KQZA 2K3IA 2OTJS 2ROPA 1UW4A 3N28A 4IG3A 1H3DA 1C4AA 3LW5C 1YIJS 3DYAB 1VQMS 2PA8D 2W7OA 3CCQS 4C8MA 5CQGA 1HBNB 1ZETA 4J9RA 5IT4A 4DL4A 1RTHB 3LGMA 1EP4B 2FJWA 4RZRA 5F9LA 2VA3A 4ZP7A 2ZH4A 1NRKA 5F0WA 3MDFA 1MNEA 2GHPA 2B5JA 3OTBA 5KT3A 4UY85 1FD8A 2X1FA 4QQBA 2RB7A 2FVCA 1W25A 4MAKA 2A10A 3ITHA 3LP1B 1IKXB 1ZAXA 3SSSA 3N6LA 4LF8F 1NU4A 1N6QA 1WHVA 1DFDA 5LSLA 3AAWB 3E2EA 4FF3A 4TYBA 3LH2S 5GAHU 1T05A 2VG6A 2B4OA 2RT3A 3B4MA 3FEYB 5K8NA 5L9NA 1FRXA 4DQRA 2MMYA 3I56S 4J9LA 3PM9A 1WNEA 4OJHA 3KG1A 1TK8A 1WACA 2XMVA 4CO0A 3K0JA 4WFAQ 3IWNC 3I5AA 4WZMA 2XSJB 1URRA 1LV5A 4DHVA 2HMIB 4O3OA 2DPIA 2Z2LA 2HNYA 1X0PA 3M1VA 5F8JA 1E6YA 2FJXA 2CFXA 3TAPA 1B64A 1FXRA 4YDDB 2MSTA 3TARA 1DQAA 1QE1B 3DC2A 4DR3F 1RT1B 4NRUA 1YJ9S 2HFZA 1S9GB 4OI6A 4Q8EA 3O3LA 2YNHA 4K4YA 4C3MA 4J9PA 2D3OR 1KRPA 2DNQA 4QWEA 3KK2B 2HAIA 3SV4A 2I5JB 3MEEA 4DS5A 1IBLF 5K14A 1HPZB 1OO0B 2UXBF 4LUBA 3RBEA 3FVYA 1P27B 3KK1B 4TKTA 3RW7A 3WX4A 4NLUA 2J9EA 1NHVA 4EEYA 3C6UB 3UI3A 2E7WA 1FTRA 4IH7A 2DD8S 4IQMA 1F5CA 4QWAA 2W7PA 1S1TB 1K1QA 3DRYA 1XTZA 3M9OB 3CJ2A 2GC8A 3TAQA 1HYSB 3CCRS 1C1BB 4RW6A 3VZHA 3TANA 2QA1A 1S6UA 1N88A 1S1WB 3IG1A 4RUHA 2P9EA 4PG6A 5KFUA 3QZ8A 5L38A 2XGQA 2HHVA 4MK9A 1XNRF 3P96A 4HTIA 2M70A 4JV0A 2F9JA 4U7UK 1D9FA 2CJ9A 1M5OC 3SQGA 3MAHA 4U67Q 4YMEA 4M8LA 1MWZA 1F2GA 4JI3F 3CSKA 3JAMY 2LDYA 1DRZA 4ECUA 4IR1A 3TQ1A 2GIRA 3FEXB 4K59A 3J7YU 2LA6A 3FJ2A 1HW8A 4LSNB 1WF1A 1HNIA 4FF2A 4ICLA 2F4VF 4ED0A 2MJUA 1R89A 4DR2F 3DHXA 1RT3B 5IM0B 4FS1A 4XPCA 4LF7F 4YB1P 2MB0B 1RGVA 2XSFA 3IR5B 2WONA 2V2KA 4FF4A 5L1JA 1L3UA 1YRUA 1UVNA 1FDAA 3BGRB 2NQPA 1JLQA 4IR9A 1XC9A 2UVRA 4LF9F 4NCBA 4NYZA 5KFPA 2BQUA 3TYTA 4DL7A 3QZ7A 1S49A 2FLOA 2ZE2B 4A8MP 5F3TA 4JV2A 2J9CA 2FHMA 5B7WA 1V3SA 2DHSA 2YNIA 2IBKA 2XMMA 3DLLQ 1IQTA 1TKZA 2Y1JA 3BS9A 1R0AA 1Q8IA 5CYQA 5CA5A 2VASA 5LT5A 2Q66A 4X66F 2YKQA 4NYPA 4OHYA 3EXCX 2D41A 1S76D 2XLJA 5KFMA 3DRPA 4B3TF 3CIZA 4OHWA 4K4TA 1Q7YT 4KHRA 4F8RA 3E51A 2CJKA 2XMKA 3VQSA 2AGOA 3M2RA 3T6JA 3WZ0A 4QW9A 2ZNYA 4IUFA 3DCAA 1RISA 5KG4A 3BSOA 2G9OA 4M1KA 4RBTA 5EUHA 1YRXA 4FF1A 1LW0A 3MPVA 3TW0A 1NK9A 3RB6A 4QU6A 3N5FA 2UZAA 1ZM9A 4Q7AA 2BABA 4JYAF 4C8NA 5L9XA 1UFWA 1Q7LB 2HHSA 2JFKA 4MMOA 4UOCA 2DH8A 2B7CB 2CG4A 3PXGa 4ECSA 2Q6BA 3BSNA 4U9RA 4G3IA 1TP7A 3H98A 1C0TB 4OZJA 2R8HA 2K1RA 3HLUA 3M05A 4O3RA 3PW5A 4N8OA 4EO8A 4O44B 2D3UA 3FQLA 4BDPA 5B0CA 3VAJA 2FJBB 3Q8RB 3MM5B 3QAUA 1T3OA 2R8KA 3GIMA 3CDWA 3E01B 4KT0C 1ZTTA 3Q2TC 2MQPA 3V6DA 1QVGR 1FJEB 2YX1A 2HVHA 1VK3A 1DTQB 1VQLS 1REVA 4WFYA 4HL9A 3MR5A 1XMQF 2I2YA 4PXBA 2LQJA 4XDCA 2C42A 4QCLA 2KRBA 3PNIA 4X4OA 4P7TA 2ZH9A 2K2PA 5D6GA 3WC0A 2MZQA 3MOZA 3RRHA 1FEHA 5J2PB 4N5SA 4NZ0A 4KAIA 1OPZA 3EXYA 4X4QA 2XS7A 1E6VB 3IGVA 4LF4F 4QIEA 3DHWC 2XNQA 1SH3A 5GVQA 2PI5A 5JVGQ 5D4LA 4HVZA 2V8DA 2XEXA 3ZZUA 2HFOA 2XMUA 3OQ2A 2O5DA 3CCMS 1KQFB 1L3VA 5LJ3Y 3LQVA 2DNMA 2ROEA 2YKNA 2VODA 4HI2A 3ZZTA 5BJRA 2CQ2A 3AA8A 3H59A 2CQ3A 5J2QB 1VLYA 5KG7A 2R7OA 2VPWB 1FRLA 1BGXT 4ED6A 5KFCA 3K58A 2JVRA 2H9ZA 1X4FA 3T3FA 4PG8A 3MFHA 5DG9A 4IRKA 2HPUA 3BGFA 3IRWP 1U09A 2DCUB 3BF4A 1RTDA 3JYTB 2AYEA 4J9OA 1N5VA 3N01A 2RVJA 1TKXA 4TYAA 3CCES 3RAQA 4I2QA 1J5OA 1SQEA 3TX8A 2KG0A 1GXUA 4B3MF 2EW9A 3QWPA 2LKZA 1U1KA 2DHGA 5KFSA 2BDPA 2U2FA 2QMXA 4ID8A 2BXJA 1U2RA 2KKHA 1U1RA 3OJUA 3KKFA 1PO6A 3QWUA 5MAOA 3DLJA 2EFPA 4KV8A 2MQMA 4FXDA 1BQNB 2H5EA 4ERDA 4DR5F 4QJVA 3MMCB 2FVPA 3KLEB 2J6UA 1KN6A 3D0IE 4NWBA 2VC1A 1Y3JA 2YY3A 3DM2B 5KFWA 3CMES 2QA4S 1CVJA 1HBUB 2CPXA 4XDDA 3T19A 2WOMB 4ZOSA 5IS2A 1VQ9S 1KD1T 2ZZNA 3X1LB 1Q1KA 3HHLD 2KB2A 2YTCA 2M9KA 2QA4G 2WHOA 4IRCA 3G6XA 3CXCR 5DQHA 3I0SA 2IM1A 4DX8H 5J1NA 4U7CA 1OQ6A 2LQ9A 2RD5C 1V9OA 5GADU 3IRXA 1JIHA 2XMWA 4ZPDA 4CZCA 3V81A 2DO4A 3BR8A 4OZNA 4KSEB 2ILZA 2KJWA 4YEAA 4RU9A 4QIVA 4H4MA 1U1OA 2OFHX 2X3GA 5I3UA 1H2VZ 2OSQA 5DLFA 3AQPA 1FTCA 1SJ1A 2BQRA 2DR7A 1CPZA 4IFYB 4LJMA 1U1QA 4ES1A 4URQU 1IXKA 4A4JA 1KQGB 2RJZA 5BYQA 3OL6A 3KLGB 1HWUA 3KLHA 4B3RF 2KU7A 1DJ0A 1LFWA 2AJQA 1RWUA 1RI7A 2FGOA 3DGPA 3DRSA 2ADBA 1WHWA 1SKRA 4GC6A 2KYXA 1TL3B 2QSFA 1Q16B 2IC3B 2W7AA 2DNPA 2KFYA 3KHLA 1X9WA 3GFZA 4ECWA 1VK8A 1VRTB 3HZEA 5EX3A