1WHYA

Solution structure of the rna recognition motif from hypothetical rna binding protein bc052180
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
97
structure length
97
Chain Sequence
GSSGSSGKIGYGKANPTTRLWVGGLGPNTSLAALAREFDRFGSIRTIDHVKGDSFAYIQYESLDAAQAACAKMRGFPLGGPDRRLRVDFAKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RNA recognition motif from hypothetical RNA binding protein BC052180
rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords hypothetical protein RIKEN cDNA 1810017N16
total genus 7
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1whyA01
1X4GA 1U1QA 1W2BR 3CMAS 2MZ1A 5HL7Q 4YUDA 3BS9A 2LQ5A 3VAGA 2MQPA 1VQOS 2DHXA 2ZJPQ 1VQMS 2MQNA 2PEHA 1AUDA 5LJ3Y 5DDQC 1WELA 3SDEA 4M5DB 2NLWA 5DDRC 4TU8A 1YWXA 3MDFA 1B7FA 2LXIA 3CUNA 3CD6S 2MQMA 2UP1A 2MKSA 1U6FA 2FY1A 2LECA 1JJ4A 1FHTA 1DRZA 1OWXA 3CCES 2BZ2A 1JJ2R 2KRRA 1VQPS 2VOOA 4F26A 2G1DA 1SJQA 2MPUA 2DNOA 5DM7Q 3NNCA 1H6KX 2KXNB 3J7YU 1WHYA 2DNNA 2DNYA 2CQPA 2M52A 1X4EA 2MKJA 1UP1A 5IM0A 2J0QD 3CULA 1QVGR 5CA5A 1X0FA 2MJNA 2CPIA 3MOJB 4WIIA 2VODA 2CQ0A 1U1MA 2CPZA 2N3OA 2MKHA 2DGQA 2M8HA 1FJ7A 2G4BA 2KU7A 3P5TL 1K73T 3VAIA 1A7GE 1RKJA 1KC8T 2CPHA 1L3KA 3ZZZA 2N7CA 4PR6A 1D9AA 2JRSA 4U67Q 2DNRA 3RW7A 3OW2R 2DGSA 2MZQA 2RQCA 1WF1A 3R1HA 2KXHA 4QU7A 5IQQA 1ZZNA 1NJIT 3MURP 1VBXA 2FC8A 1KD1T 2NZ4A 2ZJQQ 1N52B 3NMRA 1Q86T 4P6QA 3CC2S 2E44A 1JMTA 1JJHA 2KXFA 1BY9A 3CCSS 4PKDB 2MQLA 2JVRA 1Q7YT 2OSRA 2CQGA 2YH0A 3UWTA 1WG4A 2KM8C 4LIRA 1OIAA 1F9FA 4TU9A 2DGXA 5HO4A 2J8AA 3NS5A 2DGVA 2MGZA 3CCQS 2E5JA 2CQCA 2MZTA 3D2WA 1N54B 1RK8A 2KFYA 3PIOQ 3IRWP 3CCVS 1Q82T 2O3DA 1VQLS 2HZCA 4J5OA 2OJ3A 1U1PA 4Z2XA 4QU6A 1X4CA 4OZ0A 4WFAQ 1P27B 1VC6A 2FC9A 3N9UC 1U2FA 2MKCA 3UCGA 2AYEA 4EGLA 2XB2D 2RT3A 1YIJS 2YWKA 2DIVA 1S72S 2N82B 2MXYA 1VBYA 2MY7A 1X5OA 2CQ3A 5DDPC 3CCLS 4TU7A 1U1NA 2KI2A 2XSFA 1U1LA 3TP2A 1WEXA 2LEBA 3G71S 2MZJA 2MQOA 2CQ1A 1U6BA 1VQNS 1VQ6S 1URNA 5GVQA 2D3OR 3NS6A 2AYBA 2U2FA 3S7RA 3SDEB 2AYGA 2LMIA 3THPA 2N3LA 4Y0FA 1FJCA 2DISA 2AD9A 3TO8A 5JVGQ 3CTRA 5EN1A 2DNGA 3R27A 4QPTA 3VAKA 2ADBA 2KN4A 2CJKA 2XNQA 1VQ9S 2RUGA 5LJ5Y 1X4HA 2B0GA 3VALA 4W92B 2JVOA 1WF2A 1UAWA 3VAFA 2MQQA 3V4MA 2MSSA 3UCZP 2GO9A 3EGNA 2CPEA 2CPDA 1SJRA 2U1AA 2CPYA 3CCRS 5GADU 4PRFA 5CYJA 2D9OA 2VONA 2DNQA 3FEXB 3P3DA 3U1LA 3CPWR 2FPHX 3TYTA 1YHQS 2MGZB 2MSTA 4LJMA 2DNZA 3ZZYA 2I2YA 1DBDA 1G2EA 2CPXA 2RVJA 2KM8B 2X1BA 1O0PA 4C4WA 3MUTP 2LA4A 2X1GA 1M5KC 3UE2A 1M5PC 3NNAA 2DHSA 2F9DA 1SXLA 2RNEA 1NO8A 2D9PA 3JB9k 2DH8A 5IM0B 2DO4A 1U1RA 2OSQA 1KOOA 1SJ3P 2HVZA 1WWHA 3BO4A 2LA6A 1HA1A 1M5OC 1M90T 2RS8A 1OPIA 2DNPA 2G0CA 2KYXA 2MZSA 2V94A 2YKAA 3FEYB 5LXYA 2CQ4A 2E5IA 1M5VC 1YJNS 2RRBA 2M2BA 2SXLA 3MI7X 4IO9Q 4WFBQ 2K3KA 1K8AT 2DIUA 3MUMP 2MYFA 3J7ZT 1CVJA 2MZRA 1PGZA 5FJ4A 2DNLA 4CQ1A 2OTJS 5LSLA 4Y00A 3HI9A 2MHNA 1VQ8S 3UCUP 5DDOC 4F25A 3S01A 2MY8A 2DB1A 2DGUA 4ED5A 2KG1A 1UFWA 5D77A 1SJFA 3RW6A 2KG0A 2KHCA 2DNKA 2EVZA 5GAGU 5H1SV 5GAEU 2MKKA 1WEYA 3CCUS 1X5PA 4A8XA 2CPJA 3HHNB 1X4FA 1YI2S 3G4SS 1FO1A 3Q2SC 2ZJRQ 3H2VE 2HYIB 1KQSR 3G9CA 1WG5A 1H2TZ 1YJWS 2KH9A 5DM6Q 2LYVA 2CPFA 2BOPA 2CQBA 1Q81T 5D78A 2YH1A 5LSOA 5CXTA 2L41A 3K0JA 1QM9A 2OIHA 3ULHA 2KRBA 2ERRA 2HGNA 5DETA 1FXLA 2WBRA 4LMZA 2JX2A 1FJEB 1IQTA 1NU4A 2F9JA 2F3JA 2DHGA 2MMYA 3VF0B 1VC5A 2LEAA 1S79A 3Q2TC 1A9NB 3BO3A 1VQ5S 2DHAA 2HGMA 3BEGB 2CQIA 3G6ES 1DHMA 1ZZFA 5GAHU 3VAJA 3B4MA 3L3CA 1VQKS 2YTCA 3US5A 2M7SA 2DH9A 4WF9Q 1YITS 1DZ5A 1WG1A 4IOCQ 2QA4S 4TLQA 3VAHA 2L08A 2DITA 4QQBA 5IFMA 4BS2A 1ZH5A 3SXLA 2KVIA 2X1AA 3UD3P 3VAMA 3CC7S 2GHPA 1OO0B 2DK2A 1WHXA 2ADCA 1VQ4S 1H2UX 2M70A 1VQ7S 2DNHA 4W90B 3CCMS 2AYMA 3LPYA 1P1TA 5JVHQ 4ZKAA 2RQ4A 4CH1A 3MUVP 5GMKa 3THTA 2XS5A 4FXWA 4RU2A 3U1MA 1D8ZA 3BO2A 4C0OC 3NNHA 2L9WA 1FT8A 3LQVA 4ERDA 4IUFA 1X4AA 1WI6A 2CQ2A 2E5GA 3G8TA 1M1KT 3MXHP 2Q79A 1KOHA 1X5SA 4UY8T 3I55S 2JWNA 3CMES 1UW4A 2EK1A 3CCJS 4F02A 2M88A 2KT5A 2FHOB 1PO6A 2DH7A 1WF0A 2M8DB 2MB0B 1X4BA 1H2VZ 3DLLQ 1HD1A 4WKRA 2EK6A 2M9KA 3P6YC 4WCEQ 2M4MA 4C7QA 2DNMA 1VC0A 4FXVA 2E5HA 4UQTA 2MJUA 3H2UB 2QEXS 1K9MT 2DGWA 2MKIA 3MD3A 3SMZA 1X5TA 2DO0A 3G8SA 3B4DA 3S6EA 1U1OA 1X4DA 2RS2A 1U1KA 3PIPQ 1SJ4P 5BJRA 1WEZA 3EGZA 2CQHA 2VOPA 3G96A 3CF5Q 1WI8A 4CH0S 2DGOA 4V19X 2LCWA 1WHWA 1YTYA 3CC4S 2RU3A 2XS7A 2CQDA 2OTLS 3P49B 2HGLA 3UD4P 1WTBA 1N88A 1QVFR 1R8HA 4WFNQ 2DGTA 3CXCR 3R1LA 3I56S 4IOAQ 2XNRA 2LKZA 1WHVA 2PE8A 1N8RT 2A3JA 2XS2A 3DXBA 3IWNC 1XN9A 5MLCV 4YB1P 1FNXH 2RRAA 1VBZA 4YOEA 2QFJA 5LXRA 2I38A 2K8GA 5ITHA 4CIOA 2J76E 2X1FA 3EX7B 1HD0A 4OZ1A 2J0SD 1HL6A 2LXUA 3MD1A 1R8PA 3S8SA 2M0GB 1YJ9S
chains in the Genus database with same CATH superfamily
1W2BR 4JI0J 5KFGA 1J5EJ 1V3ZA 4ED1A 5HATA 1RHQB 3BS9A 2LQ5A 3OR1B 4B17A 2BKNA 3BH7B 1FKOB 1UFKA 3W2WB 4DS5A 1VQMS 1L3UA 5JXSA 1RWXB 3GV8B 4UF4A 2Y3YA 4PYAA 5IQ6A 1UCNA 8RUCA 1B7FA 2CVIA 3FBCA 3DDKA 4I6YA 2MQMA 4DR2F 2ERRA 1IBLJ 2UP1A 3LF0A 2MKSA 5LMNJ 1MLAA 2B6AA 3DLGA 2WOMB 2FY1A 3NOGA 4S0MA 3LAKA 4DR3F 4LF9F 2W1BA 1X9WA 1DRZA 1HQEA 4URGA 5DDRC 4FKXA 1N6QB 1FHTA 2ZBQA 4G1QA 1VQPS 1FCAA 4PG7A 2VOOA 2G1DA 1SJQA 2MPUA 5F8JA 2P6TA 1VLYA 2DNOA 4USUA 1R7IA 3NNCA 2BE9B 2JFKA 2KXNB 3CJKA 3CJ3A 4USKA 1WHYA 3IS9B 3I9V9 1FDBA 2CQPA 5L39A 4EZ6A 3O3LA 2E9TA 5E5NA 4B3TF 5DG9A 1JLGB 3THVA 5J1PA 2JLEA 5K5MA 5IM0A 1SC6A 2OKQA 5J2QA 1SV5B 4HYKA 1UVNA 1MG7A 4ICLB 4QBUA 1SQEA 1VHFA 1S1VB 1RJJA 2MKHA 4I0WA 5CCMA 1VQ9S 4NLDA 4C8ZA 1FJ7A 1XNQF 2G4BA 3HD1A 1YK9A 3KFWX 4ID5A 1K73T 4USHA 3KLIA 3G2XA 4IG0A 4A8MP 2Y1LB 1KC8T 4DSLA 4DFMA 2H48B 3R7SB 1VRUA 3I4PA 3NBPB 3GU0A 4FF3A 4PR6A 5C24B 3Q89A 1VJWA 1IQZA 2BANA 2BUNA 1BXNA 2VPWB 3H4BA 1AROP 2W2MP 3SEOA 1HNWF 4ZPBA 2DGSA 3RRGA 1S77D 4RW6A 2PFFB 3QLHB 2KXHA 3CDBA 1S6OA 2D7SA 1MMNA 4I7FA 3OHAA 3TAMB 1ZZNA 5CZXA 4BBYA 3R9LA 2PN6A 2MKYA 1K44A 3W62A 4RLEA 1UMJA 3RZAA 2Y9HA 4ECSA 1RLCL 1TKXB 3HLUA 1VBXA 1KD1T 1JWWA 2HQGA 2C1EB 4C8NA 3SCKE 2R2SA 2OEMA 4GKKF 3FBBA 3W9HA 3NMRA 2MDAA 2WVBA 4P6QA 2R7UA 1FWKA 4GVLA 1AB8A 2NPIA 3KNAA 2RF2A 3IGNA 5A2QU 4ECTA 3BGLA 1JJHA 4AQYJ 3LP1B 4NASA 1HHQA 1FKOA 3HSGA 3M7VA 3VVTA 3CCSS 2GMHA 2VFSA 4PKDB 1Y0HA 1SKRA 4BCAA 4B9NA 1T02A 4P7VA 1HIYA 5BXIA 2YH0A 3MEGA 3IM9A 2XZDB 5KFBA 2RE1A 3FCWA 2BRKA 5I3PA 5GMDA 3R2CJ 4TU9A 1DQ8A 2HRTA 4MKVA 4UOCA 4EYHB 1LOUA 3NS5A 2DGVA 2WVFA 3EE3A 5CYMA 4DG1A 1SL0A 5J1EA 4USIA 2DT9A 2RQMA 5K8OA 4F2RA 2FJEB 2WW8A 4E2FB 1EB0A 2MZTA 3D2WA 1SPBP 1N54B 4X4OA 2KFYA 2FYXA 3IRWP 1Q82T 2O3DA 1VQLS 2CZVC 2YQ0A 3AB4B 4J5OA 5F9LA 1CC8A 4Z2XA 5KFJA 4I56A 4MK9A 2E7VA 3T1HF 1TK5A 4WFAQ 3MFIA 1V5IB 1U2FA 3FDSA 3MMCB 4Q5VA 2UXDF 3L7OA 3R5GA 4DCPB 2XMUA 3KJFB 1RAIB 2CVEA 1TUVA 4YN3B 3TUJC 1CJUA 5K9FA 1FRIA 2N82B 3PCOB 5BR8F 1RTIB 3M6WA 4DN0A 1PC4A 4HHHA 4O0NA 2CQ3A 5IT0A 2QSWA 2APOA 4O44B 5DLGA 3PJ9A 2WTFA 2CG4A 2IRXA 2K1RB 3DYAA 4X66J 2KI2A 3ZNUA 4DL4A 2HNDB 1U1NA 1F6TA 4JP8A 4MMOA 5LMNF 1QE1A 4NRTA 3EMTA 4DUTA 3RAXA 2HHVA 1FRXA 1VLOA 2XBPA 2LEBA 2UUCJ 3KXDA 4A8FA 1VRUB 1G6BA 2CQ1A 3HKWA 1NB2A 5FD1A 3V5RA 2ZM6F 3KK3B 1JLEB 1SQFA 1IBKF 2YKMB 2HHHJ 1VQ6S 3KKFA 1O6XA 5GVQA 4OIXA 4LF1A 2ROEA 1EHWA 3QWUA 4K4XA 4V19J 1QLNA 4TVAB 5HQ8A 1C1CA 1Y9OA 3K8WA 3SDEB 1PJ5A 5JJBA 2AYGA 4YQWA 4IH7A 2N3LA 3BBCA 4G65A 3H8YA 3JXOA 4Y0FA 4QYZK 4L74A 4X4RA 4NCGB 4K0KF 1CJKA 3BB5A 2EC2A 2AD9A 1NLKL 1XWLA 2YNGA 3G6YA 2GJ2A 3FSIA 5KG4A 1QAIA 5A6WA 2VBWA 3QJLA 5EN1A 5I42A 2KL8A 1DAXA 3PYEA 5T41A 4DZDA 2ASJA 2UXCJ 1PYTA 3S1TA 1T9VA 3JYTB 3OVSA 3W2VA 2G0IA 3R7NB 4CWBA 3AHPA 3M32A 4KH0B 2OMLA 3VGTA 4YFUA 2FLNA 2B3TB 1S5ZA 4ZVSB 2CXEA 4F0KA 5BYQA 5ADZA 3K5OA 4B3SF 2BVZA 4I69A 2JVOA 1UAWA 3KMQA 3LP1A 4KKOB 2QT7A 3VAFA 3PYDA 4N5SA 3M2VA 1P6TA 1B0PA 2BMBA 2NXJA 3NMAA 2BEFA 3EGNA 4N76A 3KLFA 4JYAJ 1BWVA 3D28A 1NK0A 1UKUA 2DRAA 2U1AA 2CPYA 2LQ9A 4DV2F 3M1VA 3PKYA 4PRFA 5CYJA 3HT3A 2P9GA 3G86A 3RJMB 3AQOA 1U45A 1IBMJ 1KKHA 1MSWD 2R2UA 4LBHA 2V50A 3FK4A 1F5BA 1AUSL 4PQAA 5HQMA 4FPIA 3IAS9 4EZ9A 2CDRB 2IDLA 1R8BA 3W2WA 3KJVA 4UY85 2MGZB 3KDOA 4L73A 4CYUA 4YHHF 3GV5B 2XWYA 3M8ZA 1S12A 4NLRA 5KT3A 4LJMA 3T5HA 4NA2A 2ALZA 3SSQA 4O3RA 4AT1B 3W3SA 2I2YA 1C0UB 2J8SA 1F1BB 3MTJA 2PMZD 2FIUA 2IBOA 4F36A 4FP9A 4ZCIA 3CJTA 1IKXB 4LFAF 2CPXA 1NNDA 2RVJA 3BREA 3M9NB 4DQSA 2PDAA 2YNGB 1CSJA 4MT1A 4CLSA 1HPZB 2HQDA 1O0PA 4QWAA 1Q8KA 2XI3A 4RBUA 2BACA 3T1HJ 2VF3A 2LA4A 2X1GA 3OL6A 1R43A 2NZCA 3IAM9 4O3NA 1FX2A 1M5PC 3NNAA 3OTCA 3KG0A 4DL6A 4K4VA 3ZZRA 5LMUJ 3TZWA 2A6MA 4NLGA 1S6UA 1IXKA 3MAAA 2GVDA 1HW8A 3HCXA 1U1RA 1QAJA 3N28A 1KOOA 4KYZA 2HVZA 3VV2B 1SJ3P 1XMBA 1WWHA 3BO4A 2CNOB 1HA1A 1OYDA 4DI6A 1OQ3A 1NBEB 2YKPA 2V94A 3OHBA 2G0CA 2YKAA 2BRLA 4KGKA 4QW9A 5HVHA 5DQIA 5A8WA 3F44A 2C3UA 1IKWB 1TZ0A 4Q0BB 4DL7A 4WFBQ 3D7SB 3M6XA 2DIUA 4ES3A 2YX4A 1CVJA 2F4VJ 1UA1A 2W4DA 4ZVFA 3K5NA 2MHEA 2H65B 4KFBB 1XR6A 1S6PA 2FJBB 2DNLA 3FZ2A 4DSKA 4JV5J 2ALYB 3NBPA 4G1QB 1LFWA 4IFVA 4KY3A 1ROFA 3CO9A 1RHKB 5I42B 3OL7A 4Y00A 1OYEA 1Q16B 5ETKA 2ZBCA 5E3AA 4LRCA 4X62F 1HBUA 4ZPTR 3LGNA 5I3QA 5C42B 4HH0A 2GQQA 1NDKA 2P2CB 5AXMA 2XGPA 1CG2A 4K0KJ 4OZ5A 1TL1A 2AX1A 3QT6A 1N34J 4KV8A 1IBLF 1JLGA 4FYWB 2F1FA 4ED5A 1UFWA 1TMJA 2LP4A 3CWJA 5J2QB 1UJ4A 3DOLB 2B7CB 4DFPA 1Y7PA 1HI1A 3R5JB 5GAGU 3IM8A 5H1SV 4RR5A 1LWEA 1X7VA 4TY9A 4J9KA 1JXEA 4URQU 1VQ4S 2JL9A 4A8XA 2XSJA 1WC4A 3TVKA 1TL7B 1FRJA 1KVKA 4WTOB 5K8NA 5D3GB 1U0HA 2E1MC 1LW0A 3HHNB 4ZVHA 3MM7B 2HQ3A 3GV7B 4ZPDA 2X7IA 5B0DA 2IJNA 1DTQB 5KTQA 5HROB 1FO1A 2FLOA 5JUMA 3MMBB 4DV3J 4IG3A 4GO7X 2MEWA 1J27A 2QFIA 3CDEA 3HSZA 1HWUA 3H90A 4KGMA 1WG5A 4M63A 3MEGB 4ZA1A 4DJBA 4I6WA 3H40A 1YJWS 4IO1A 2RSQA 1U0SA 5E3PA 4C8LA 1F9HA 1UVKA 4DX7A 4ZLNA 2CZ4A 1MWYA 2CPFA 4USVA 1LQ9A 4KHMA 5F8GA 3VGVA 2BOPA 2DCLA 2EG2A 3KJQB 3OV7A 3M9OB 4X65J 2CYYA 1V3RA 4NLQA 3GYXB 1Q81T 3TAMA 3D0HE 1MMDA 2EPIA 3WC2A 3MWBA 4PXCA 1HYSA 3K0JA 1QM9A 1AZSA 1T3OA 2CG8A 1HPZA 2ILZA 4IFVB 4QIGA 4C6AA 4JUZA 3I0SB 2R42A 1N33J 2KRBA 2VQFJ 2HBRB 1BC6A 3E8OA 3KNGA 4QWDA 5DETA 4DV7F 1FDNA 3MR5A 2JX2A 1FJEB 3CJ2A 1IQTA 2WB4A 7FDRA 3NRBA 3CSKA 1HNIA 3ITHB 1IBKJ 4RWWA 2F9JA 2F3JA 1UEUA 4L75A 2XI2A 2Z30B 3CCZA 4KHRA 2FDNA 3VF0B 3J7YI 4IYQA 3LWMA 3TJ8A 2D1CA 1RT1B 3NXZA 4JI8J 3KK2A 3AFGA 1BD6A 1U02A 3D54A 3HVAA 3PFOA 5HVFA 4DBQA 3D67A 3CD5A 3HZEA 1GEHA 1VQ5S 2EC0A 3OBIA 4YP3A 2FY8A 3HHLA 1YJUA 2HGMA 3BH6B 3CNQP 4WPAA 3VQSA 4RNNA 2W9AA 2AGPA 2CQIA 3G6ES 1DHMA 1N5TA 2GQCA 2LU1A 2OUGA 2WSFC 2VFRA 3FBEA 3HSDA 1VQKS 1JNZB 2M7SA 2DH9A 3US5A 4BHQA 3H5YA 1SH0A 2CZ9A 4C8OA 3SSRA 3I5AA 4ZIWA 4ECVA 3I82A 2X51A 3NOCA 4NE9C 1HWLA 2M5YA 3D5MA 4LSLB 5KFEA 3CIMA 4Z7CA 4IOCQ 1REVA 4TLQA 1FKPB 2QA4S 1GXLA 3VAHA 1TFWA 4B3OA 2ACYA 4A8OA 3CD7A 4NZ6A 4DV4J 2DXEA 4FF4A 2EFVA 3DN9A 1QSYA 2LQJA 3WQPA 4C98A 4XPCA 1GXUA 2GNKA 1S6QB 1TL7A 2OFHX 1KR4A 2OHDA 4XTTA 2I6WA 3VAMA 3MAHA 3BQ0A 3CC7S 2YWHA 2ZBPA 2Y1IA 2BQ3A 1T05B 1WHXA 2Q1LA 2ZDOA 3F41A 3FSXA 3MECA 2KB2A 2M70A 3T6JA 4D3HA 5LT5A 5HMXA 4DR5J 4RU9A 4W90B 2V2ZA 2YKOA 4JV5F 4OZNA 3NWGA 1ZYQA 3LPYA 3G82B 4FYVB 4EBCA 3AY0A 4ZKAA 3K7RA 4F4KA 4DR4F 5GMKa 1E6YB 2VBXA 1FA0A 4CLTA 1H7WA 3MM9B 4FXWA 1Q8BA 5D6GA 4YY3F 1HBOB 1R31A 2ZOMA 2RDIA 3RGIA 1JJCB 1TKTA 4IOBA 1SUQA 3GILA 3SQGA 4PQUA 1TVRA 1REGX 2HS4A 2CA9A 2XULA 3M8RA 2UUWA 2WBMA 4FNHA 4IDKA 4TNOA 3LQVA 2V4JA 5CYQB 1NB7A 3DLBA 4BS2A 1X4AA 1WI6A 2E5GA 2OELA 3GYNA 3NY0A 3G8TA 2OPQA 4L72B 4DL5A 3MXHP 2Q3PA 2R7VA 2D3UA 4CO4A 1K47A 4B9UA 5G4DA 1RZMA 2XYGB 3CMES 3KJVB 4OHVA 2EK1A 4NZ7A 1YG0A 3VWSA 1HYSB 5E3CA 4U8VA 5LMUF 1IBMF 1KNZA 2DJWA 2E7WA 2HK3A 4PCQA 4RNFA 2DH7A 2P8IA 2Z57B 4ZK7M 5KG7A 5CAAA 2MB0B 1UPPA 5BYSA 1H2VZ 3M2RA 3DLLQ 2EEYA 3FCHA 4H4KC 3C14B 2VC0A 3BYRA 4OJ1A 2HNZB 3PR4A 3ZZUA 4EO6A 2XC9A 1NJYA 3CGIA 3D1HA 3VQTA 4WKRA 4CO5A 1VDHA 1GTEA 4PWUA 5KFTA 5KFFA 3KK1A 1GAOA 3KUHA 4GC6A 1W2IA 3UN5A 3AOCA 3M2VB 4P10A 1H98A 1KEKA 4FS1A 5DGAA 1BGXT 1VMBA 3HFZB 4LQ3A 4CLZA 3H2UB 4DV7J 4RNOA 2QX0A 2AJ1A 3I5BA 1K9MT 3MR7A 1SKWA 4NOHA 3N6MA 1TAQA 1YJRA 3TOQA 3B4DA 2KYZA 1NKCA 1BWEA 2QL9B 1KQFB 4N7TA 1GNKA 1PC5A 2J6TA 2VA2A 4X2BA 2VPXB 3OPKA 4KPCA 1FWPA 2R9LA 4EBEA 3UNGC 1HNVA 1WEZA 2ZUGA 3JSBA 2JEFA 3EGZA 4KSEB 1RAHB 3CO0P 5C24A 4CH0S 3OJUA 2VOPA 5M2UA 2QIFA 4LSLA 3KYLA 1WHWA 4K2XA 2FJVA 1ZA1B 1VOMA 2E1CA 2XS7A 4NYZA 2IM1A 2OTLS 1JNRB 4QWCA 2QA1A 4C3MA 3GZ7A 3UD4P 4A4JA 3BSNA 2IIHA 4KTQA 3IR5B 4JB8B 2UU9J 1JLQB 1NPPA 1OJ4A 3CXCR 3CCWA 3EDQB 4KGZB 3I56S 3EYZA 1T3NA 4GMKA 3EZ5A 2XTJP 3MF5A 4NEZA 3DXBA 2FB0A 3RRKA 2HZAA 1YQHA 3HHEA 1JLBA 2QLXA 3MECB 4CTAA 1VBZA 4ZVEA 4TKTA 3QO9A 3Q8SB 2QFJA 5LXRA 1V5VA 2JLGA 4DWIA 4CIOA 1O8BA 4QPXA 4X66F 1GXTA 2J0WA 5HJXA 4H4OA 4HHUA 4HLBA 5D4OA 3V2UC 5KOWA 2MTLA 3GE9A 3LWLA 2VJUA 5A8KA 3MM6A 3DRXA 3PX0A 3TA0A 5C5JA 4J91A 2RIJA 2YNHA 4PG5A 1H38A 3NAIA 1X4GA 2EW9A 5DG8A 1U1QA 4DR6F 2WONA 3CMAS 2MZ1A 3C16B 1RAFB 5HL7Q 4FS2A 1TL3B 1JK9B 3BR9A 4OYXA 3GFZA 1EAYC 5L9XA 1Q0NA 5HN0A 4K4TA 1VQOS 3LPEA 2DHXA 5FIIA 4Q8FA 5HLFA 2X3GA 2V8PA 2EFQA 3D0IE 3O6QA 5KFDA 3PFEA 2BA9A 3TAQA 2KZMA 1IWGA 2NLWA 1RT7B 5IC4B 1NUEA 1GMWD 2HFOA 1P9QC 4WP8A 1DURA 4C0HA 4Y34A 1XC9A 1YWXA 2F8EX 2Z4PA 1RXOB 2HIQA 4K59A 2VPYB 3ISND 3OTDA 4M5HA 1SB6A 3GFYA 3OFFA 4K7QA 5H9FK 1JJ4A 1D09B 2AW0A 2WVCA 1NEEA 3ENWA 4OLOA 3DRSB 3G87A 2J7WA 4DF4A 1PG5B 2R7OA 3QT8A 3UDCA 2QLBB 4X4PA 3HHDA 2HMIA 2IPOB 5J2NB 4ZCMA 3JYTA 4K4UA 5KOXA 2B5JA 2RHSB 1OMSA 4U9RA 4DV4F 1U48A 4ZPVR 3K59A 4B3RF 1GTHA 3P5BP 3HSJA 6FD1A 2Q66A 2C3YA 1X4EA 3BDEA 1WC3A 4F8RA 2W2QP 2JC0A 3T5JA 2ZBIA 2ZNZA 3CULA 3OL9A 3HF5A 5I3UA 1IJEB 4L3NA 5CA5A 2CPIA 4RW9B 2VBYA 1PSDA 1RAOA 2CQ0A 3H59A 2D41A 2N3OA 5GAHI 4FYXB 4DPWA 2J6SA 5ETLA 3J7AN 3IBFB 1LXJA 3K89A 4KKOA 2YX7A 3DGPB 5AE3A 1A7GE 2W8LA 1Q5VA 3C16A 1I5OB 3MPUB 4DV0J 4DR1J 5KFLA 4KHPF 4P2XA 1ZAXA 3MR6A 2ZOGA 1L3KA 1O5JA 1T9WA 3LA0A 4OI3A 2N7CA 2R7SA 4YB7A 4U6PA 1DQ9A 2RMLA 3PEHA 5CQGA 1YVFA 3B6BA 1SC1B 1EP4A 1BUXA 2GVZB 1JLBB 4CTAB 4CYUB 5L9NA 1I51B 4EUVA 1RWNB 4KHPJ 1WSRA 3I4HX 4RUAA 3JAMU 5KG2A 1J2VA 2QRRA 4H4KA 2HVDA 4OLPA 1APSA 1NZAA 1NJIT 4O3PA 3RBZA 4PEOA 1SI9A 2W2OP 2UV8G 4DV5J 2FC8A 4DF8A 1TK0A 3N5BA 1W25A 5LM7E 1N52B 4URSA 1Q5YA 2XMVA 4FPRA 3W8GA 1M5HA 1FFWB 1LWXA 3NKYA 1ZPWX 2UXBF 3U1NA 2W2PP 4CO3A 3ILIA 1IR1A 2YNFB 2E44A 3GYGA 3H20A 4QWBA 1UFLA 4NPOA 3W64A 1HHSA 4EMDA 1Q7LB 1YGYA 3ZZ0A 3T5LA 3E2EA 5KFOA 4FF2A 1U25A 3OFHA 4IR1A 1PIEA 1Z4UA 2CQGA 2C2NA 4LIRA 3AB2B 1MU2A 3C66A 1OIAA 1F9FA 2HFZA 2DGXA 3JQJA 2VH7A 4P2SA 2B8PA 3LH2S 2RU9A 4QIFA 4J37A 2JH3A 2MGZA 3FEZA 3RR7A 2F5GA 4WFYA 3CCQS 5KFXA 4P71A 2CJXB 3DGPA 2CQCA 5IWAJ 2ZJRQ 1RABB 1SUQB 2JLFA 2MQ8A 2C2RA 1HR0F 1B0VA 3DLJA 1F2HA 2QYGA 4RNHA 5A8WB 1HHTP 1CJVB 2IMOA 3QWPA 4I64A 4DPOA 1IUJA 1MW7A 3DRPA 3N79A 3DRRA 5B0GA 1U1PA 1SC3B 1X4CA 1XMQJ 1VC6A 3PX6A 2FC9A 3A8JA 2HWTA 2YWEA 3ZO7A 4OI6A 2MKCA 5A8RB 4CO1A 2XZTB 3DOKA 4GVBB 1WOOA 1CULB 5C42A 2UXBJ 3QT7A 1XIQA 5MAOA 4Y6IA 4RPFA 1MN7A 3W9IA 2R7XA 6AT1B 4KO0B 1ZTWA 4OHWA 3CDAA 1NDCA 3M4XA 4P73A 5DDPC 3CCLS 2JNJA 1S48A 3T1AA 1RWKB 1C0TB 2XY5A 1IJFB 3HVTA 2DRBA 4P72A 1ACMB 4NRUA 1N56A 4CM0A 1B3TA 1U1LA 3OUYA 3FQKA 1WEXA 2ZFHA 5EWGA 2MZJA 3EPIA 2UUCF 3JTNA 3GTYX 4JI4F 1TK8A 3D6TB 4K50A 4AL5A 2WCXA 3NS6A 4M5IA 3HPOA 4E98A 4F3OA 2IYIA 3MPYA 2LLZA 1U47A 2BJ7A 2LXFA 3K5MA 2AMCB 2VG5A 5KT5A 3PZPA 5HMYA 4LF6F 3KHRA 2QL5B 1KQGB 1CC7A 3IR6B 2DISA 1HI8A 4E8UA 2BE7D 3MMBA 3ENQA 5JVGQ 4M1KA 4OQJA 3BKFA 3W66A 1JQGA 2UUAF 2DNGA 4MKBA 2AIRB 5AE1A 3S8SA 4F04B 3V81A 2XMTA 5HMWA 3TW0A 4NXNF 4OYOA 1GQEA 5L1KA 1VYAA 2BE2A 4LSNB 4HACA 2ADBA 2CJKA 3RR8A 1Y4ZB 2H5EA 3CJQA 2NXCA 2XNQA 3DOLA 5C25B 2RUGA 1CJUB 4QZVB 5A6PA 1X4HA 2B0GA 3N6NA 1CULA 3IBWA 3KUEA 4O44A 2FD2A 1K1QA 3DLKB 2AX0A 3M8PA 2GS8A 2K1RA 3FKBA 3Q83A 4HDHA 4MIWA 1RISA 2MQQA 1QAXA 3V4MA 2MSSA 2LQ8A 3UCZP 2HEKA 4M5GA 2I5JA 5J2PB 3VZHA 2ZH5A 4J9OA 3SV3A 2QTWA 2Z8QA 3ET6A 2HVIA 3FMWA 1NSPA 3QGHA 3UR3C 3CCRS 5J2MA 2B4VA 3ILOA 3KK2B 3D9BA 4Z37A 2QG9B 3T1YJ 3BPDA 4H4MB 4IH5A 1FX4A 4K5RA 2VONA 3FEXB 1WC5A 2CJBA 3W65A 3P3DA 4O3SA 3U1LA 2JZ5A 3CPWR 1U7LA 4IRCA 1RT1A 4C9DA 1C1CB 1K1SA 5CZVA 4ED3A 2HVEA 4B3MF 4DUYJ 1N5VA 5HLFB 2BDPA 1MWQA 1GMUA 2BXJA 4PXBA 2W9CA 4QIVA 3PO5A 1LKZA 3V4IB 1ICEB 2J9EA 5LSRA 3HXMA 1UVMA 5DLFA 1U26A 4ZVRB 9ATCB 3EICA 3WZ0A 2CNNB 2K06A 2J5AA 1M5SA 3K17A 2HHSA 1RKIA 1FWLA 4OX8A 1T8EA 3PYGA 2KM8B 3QO9B 4OYIA 4ZOSA 1N0UA 4B3OB 1C0TA 4USTA 3PYFA 4YR0A 3MR3A 4C4WA 3PACA 4PAAA 3MUTP 1NAQA 3DRSA 3PHTA 1FK9B 2FGOA 1GX6A 1RT6A 4DV2J 4I2PB 2CNLB 3PVXA 4KPYA 3HVRA 2QJ3A 1KVJA 1IKYB 5DQHA 3P45B 1YJTA 4NLTA 3SQOP 2D9PA 3M8QA 4ECQA 2DR9A 3DNCA 2DO4A 5IM0B 4QCLA 2HFVA 2OSQA 2NREA 1BMQB 2YQ3A 2Z56B 5U47A 4K8RA 2QMXA 2ZE2A 5B0CA 3GWCA 4Y2AA 1FVSA 2ZVIA 3O2IA 2JDJA 1YRUA 2RS8A 3BGRA 1S97A 4ILLA 1OPIA 2DNPA 3FEYB 4BDPA 2KHDA 4ZVUB 2DRDA 3ZZOA 3OT9A 4LRDA 2E5IA 5AT1B 1GT8A 4Z7YA 3BJYA 1BQMA 1Z2ZA 4TY8B 1ZTTA 4DR3J 2ASDA 1YJNS 1Q8LA 3PTWA 2SXLA 4DXLA 3TANA 3MI7X 4IO9Q 2E1AA 4DS4A 3IG1B 4R8UA 2RB7A 2P9EA 3GFHA 3GJQB 3LUYA 1K8AT 2FGCA 2XO6A 3MUMP 3HM9A 2MYFA 3RAQA 2L48A 3UD5A 1WNEA 4ZLLA 3OQ2A 5CYQA 3NCQA 5FJ4A 3BF4A 3PO4A 3MM9A 1KP6A 2UUBF 1TV6A 1NPRA 3DU5A 2ZEJA 4FNIA 4X4SA 2HHWA 4Q2LA 2YKNB 5LSLA 4LF6J 5FDLA 1TVRB 2VASA 3OXLA 3I0RA 3UCUP 2NQPA 4IUFA 3H0PA 4NL5A 4J90A 1ITPA 1J5EF 4LBIA 1RT4A 4PUOA 4ES2A 3QNWB 2J6UA 3TR5A 3M8PB 4MJKA 4ZJLA 4C8MA 3ILJA 4AXIA 1Q8IA 5KG0A 3V6KA 1CPZA 1H3DA 2DB1A 1BE4A 3QQCD 2RILA 2GX8A 4DV1F 4X65F 1N5YA 2KHCA 3FCVA 4PZVA 5CD4H 4F4AA 2R2RA 4ZPAA 2V34A 2EVZA 1R0BG 2O67A 1WEYA 3JSMA 3FFIA 4MFBB 5KG6A 2C22A 1K0VA 3M8SA 4YR2A 2BJ9A 3FSYA 5HK4A 3JQKA 1XERA 1NH7A 1RWPB 3HHLD 1NK4A 1N33F 3OR2A 4OV6A 1OY8A 3KUGA 2C3OA 3DYAB 4MYUA 1WC6A 5F8LA 5ETVA 1CJTB 2HNDA 3IRXA 5ETTA 2V4QA 4DX8H 1IKWA 1FTCA 2FHJD 3IBCB 3CDWA 3G9CA 4NCAA 3Q23A 4XPEA 3GG0A 4ELVA 4KQZA 5KT2A 1RTJB 3MTKA 2G2YA 2KH9A 2D3O1 3CEDA 2FVSA 1ZBTA 3IN5A 2VICA 2YNIB 2P6SA 5B09A 1FE4A 3WIUA 1HBUB 1SIWB 5CABA 1I1GA 4M5JA 4UQGA 3OJSA 3SCJE 4DR1F 1OY6A 1H74A 1TL1B 2YH1A 5LSOA 5CXTA 2V4RA 1TV6B 3ZC4A 2OIHA 2B56A 2DHHA 3VR1A 1P9YA 3HKZD 3C46A 2OLWA 1A6LA 3R5CA 4UOFA 4U7UK 1OS5A 2BKPA 3A3OB 1UEKA 2BW2A 2POKA 2QLJB 3F0NA 1VQYA 2B9WA 2GHWA 3ELHA 5B7WA 1RLDA 5KFCA 4LMZA 3M6VA 2Y1JA 3Q8RB 4NXMJ 4L76A 3TRGA 4LBPA 3E3XA 2R7QA 1VC0A 2R8JA 1HLWA 3GIIA 4YMEA 2KTQA 2XMWA 4DLGA 2JEIA 1EZZB 1OQ6A 1FNOA 2EKYA 1HNWJ 1EQ0A 1U2RA 3ENVA 3H42A 2COLA 3AXMA 4NEYA 4WWSA 3TVZA 3WX8A 2RDJA 3PW4A 1RWVB 2BQRA 2CJ9A 3T6BA 2Q6BA 4UW2A 3SV4A 3MPDA 4R0EA 1LW2A 1UL3A 2VQEJ 2VV5A 4DQRA 1NK5A 3K8VA 2H5JB 4MK7A 2BKOA 4UOGA 1S1TB 1NH8A 3BEGB 1S1VA 4XK8C 2C3MA 1T9TA 5E41A 1ZA2B 5CCLA 3QATA 1VBKA 1PJ7A 4MKYA 3NCPA 1LWFB 4N8NA 2FVPA 2DXDA 4WF9Q 2BJ1A 3EXYA 2HQIA 2RD5C 5D0GA 4LF7J 1QY7A 4I2QA 4A8YA 1N5SA 4TN2A 4YY3J 5D8HB 1KTVA 1Y3JA 3OTOF 3NAHA 4BWMA 1FD8A 2E9RX 4N47A 3L09A 1F60B 2C2KB 3BV8A 2YBVA 4JI6F 4N8OA 5FLXU 4RW6B 1VI7A 1KN6A 5M2RA 3DKDA 2LDIA 4DUZF 4JV1A 2GC8A 3I0SA 1ZH5A 3PJWA 1C4CA 1FDDA 1N0VC 1ZM4A 2KVIA 4Y2CA 4H4OB 3PHEA 2CUYA 4HVZA 5D15A 5ETPA 2X1AA 2CWXA 3UD3P 5DG7A 3KHGA 3W8PA 1PYOB 1AFJA 2DK2A 1RU2A 1GX5A 3D6HB 2ADCA 3JTPA 3L4BC 2DNHA 1VQ7S 2HHUA 2CWKA 3M6UA 4YDDB 1NRKA 1TL3A 4LR9A 2OH2A 2A1BA 1RSCA 4DQPA 1HWKA 3HHLC 1RTJA 1K0TA 2ZH8A 4JI1J 1Y5LB 3THTA 2XS5A 3LO3A 4RU2A 3MM8B 3OSNA 1D8ZA 3BO2A 4DU8A 1KONA 3A3PB 3SFGA 3NGUA 4U8YA 3HD2A 3GIMA 4WXOA 2R8HA 2VQFF 1R0AA 3MEEA 1FRHA 4EO8A 5F0WA 2Y8YA 2H54B 3QAEA 3WIVA 4DV3F 3K57A 1S0OA 4DR6J 1KOHA 2FJWA 3K5LA 2EXUA 3M05A 1B4SA 3L7UA 5E0OA 3OLBA 1I6JA 4F2SA 5K8PA 1C2PA 1UW4A 4KRWA 1BQXA 4QR1A 4F02A 5K14A 1RE1B 4HT5A 2NPFA 2KT5A 2ZH3A 1QSSA 1RADB 5IXUA 1S0VA 1WF0A 2M8DB 4KBIA 1ZAWA 4R5PA 1X4BA 3MMAA 3VCDA 3O44A 1NKEA 1S7HA 1NDLA 1VIXA 2EK6A 2YPZA 4FYYB 5C7PA 3ICLA 4WCEQ 2M4MA 2Y8WA 3P6YC 3N6LA 1OY9A 2E5HA 1S1WB 3T9NA 1DQAA 1D1UA 2PT0A 1VRQC 1LW2B 2AEFA 5E2QA 2G2ZA 1T05A 4NYOA 3BQ1A 4K4YA 1VHIA 2QEXS 4ILRA 2DGWA 1WOPA 3MD3A 2ZH9A 4OL8A 2DO0A 2ZOFA 4ANCA 1NZ8A 4IKAA 6FDRA 2RS2A 2IM2A 3IO1A 3TX0A 3PIPQ 4CT8A 4FKYA 3D1OA 1PBUA 2VPZB 1NMEB 3PX4A 1HBOA 4J9RA 2IVYA 1S49A 1PAEX 1S10A 3G96A 1WI8A 4DSFA 3AD7C 5B0EA 4CNYA 2BW7A 5E3RA 3TARA 3P4UB 3CC4S 1V3SA 3TAPA 2RU3A 1HNXJ 5ETSA 1UVIA 3MCSA 1SQGA 2WRMA 3MMJA 2GGPA 3P49B 2HGLA 4ZHRB 3DFEA 1N88A 2YXLA 1S9EB 5EWEA 1R8HA 2VUGA 3UNYA 4W4MA 3GIJA 3H7HB 2OP5A 4DV6F 1DFDA 1VK8A 1F0XA 1X60A 4ED4A 1SBRA 2VD3A 3MMCA 1NJWA 2OMOA 2XS2A 2B7BB 4AUKA 1YBUA 1TL5A 1XN9A 2VG7B 1EETA 3ILLA 5MLCV 4YB1P 4DR4J 4C8YA 4X4VA 4WP9A 4IFYB 3NG8A 2K8GA 4JV0A 3DRPB 5ITHA 1S99A 2J76E 2CFXA 1LK7A 5EX0A 3EWGA 4NX9A 2QN6B 1LWEB 1HD0A 3M8WA 2J0SD 2XCPA 5B08A 3MM8A 1SL1A 1MNEA 2KO1A 3MD1A 2VB6A 5BR8J 1R8PA 4ECZA 2C2ZB 1I94F 2DGOA 3W5ZA 1TP7A 1LW0B 3O5TB 1S1WA 4W98A 1IM4A 1RWOB 3U27A 4WE1B 1JB0C 4CZCA 2FHJA 3VAGA 5D4LA 4DSEA 5IT4A 1RCOB 4EI2A 3RAMA 1JKHA 1XQIA 3EUNA 3KLHA 1TKDA 4JI6J 1IKVB 2HRUA 2MQNA 4NXNJ 2XQCA 2PEHA 5LJ3Y 1HMVA 2HIYA 3M2UA 4LF7F 3SDEA 4M5DB 4OX7A 2ASYA 3MDFA 1CJVA 4M5LA 5KFNA 1HQ2A 4Q43A 3T1YF 1S9FA 1TKZB 4I4BA 3CD6S 4FYDA 1YBAA 5B0FA 1U6FA 3MMAB 3DU6A 3QYYA 2LECA 3OXFA 3MHYA 5F3ZA 3HX9A 4LF2A 2XO7A 1OWXA 3CCES 3PRBA 5L8RC 2BZ2A 3TZXA 2VG6A 1JJ2R 2QL7B 2VQEF 3UI3A 1Q95G 4P9SA 4RW7A 3QRQA 1NJZA 2HK2A 3OLAA 2HHPA 5AJ3J 1YRTA 2FJAB 4J9LA 3PG9A 4B3SJ 5DM7Q 2X1FA 2AEMA 4UZBA 2AV5A 4PWDA 2KJWA 1H6KX 1RAAB 4NLYA 4AE5A 1REVB 2BM1A 4DZ6A 4ZP6A 2FJXA 1S59A 4PG6A 1UWBA 3AA9A 3OSPA 2MKJA 3N01A 5D4NA 1UP1A 4C48A 1MROB 4CM2A 1WD6A 3M30A 2J0QD 2AF6A 2V2VA 4OYMA 2B43A 3EVWA 5L38A 1U49A 2P5VA 3MOJB 4HR2A 2A0FB 1HBMB 4Y2MA 5I4MA 5AXNA 1SV5A 3KLFB 3D6FB 2VODA 4ID5B 1JXLA 4B02A 2M8HA 4ITSA 4Q2MA 4DPTA 2LU2A 5KFWA 2NS1B 2DBBA 2GV1A 3P5TL 4ENOA 3VAIA 5LJ5Y 3TQ1A 2B51A 2DTJA 5J2MB 3J81Y 1RKJA 2HYIB 4P7TA 5L1IA 4KJIA 2ATLA 3POTA 4OI4A 2XEXA 2GO8A 1D9AA 2I0XA 1RT3B 4Q0BA 1CS4B 2OPSB 3LP2B 5DJBA 3RTVA 2JRSA 2HZVA 2IAJA 3AJ1A 4JI8F 4ZN1A 3RW7A 4U67Q 1TKTB 2VC1A 4H54A 2J9DE 3VGSA 3OVBA 4WZQA 3WBZA 3IGVA 3W63A 3ZTQA 2MZQA 2V63A 3QGGA 5HBMB 5EUHA 2RQCA 3R1HA 4QU7A 1LWFA 3BYPA 5IQQA 5KFZA 2W2NP 1E6VB 2RQKA 4LSNA 2HBZB 2VG7A 3TA2A 4DN9A 2FJDB 5HVGA 4FDFA 4LR8A 4BC7A 1KFSA 2KFNA 2ZJQQ 3PR5B 1PKUA 3E01B 1Q86T 4YS2A 5F8NA 2A18A 2JC1A 3U02A 3ZTSA 3UW1A 4DU7A 1L3TA 3CJ4A 3AJ2A 3J81j 2QZ8A 4NMLA 4A46A 4CLUA 2FZGB 1BY9A 2NYHA 2RF2B 3MCNA 4QR2A 2MQLA 3V6HA 1HMVB 2J9CA 2OSRA 4G1PA 1FK9A 3KTQA 1N5QA 4I2PA 3UWTA 2HSEB 4KC5A 4LT6A 1WG4A 5GAGI 2KM8C 4HEA9 3A8EA 1LXNA 4UUWA 4QW8A 4WZMA 2E29A 1BHNA 4ZJOA 5HO4A 2V69A 2IJRA 1HKAA 3CJ5A 1RQ0A 5DRKA 2AGQA 2M3DA 2V4JB 5IV4A 1IKXA 2NR0A 2O5DA 3BGRB 2F8MA 2UUBJ 2QSFA 3IG1A 4R8UB 3V4IA 3A1YG 3T9ZA 3CCVS 3I6PA 1BQMB 4TY8A 3PIOQ 2D74B 2QA4G 3PV8A 2OJ3A 3ZFVA 3UQSA 1YRXA 4ANDA 5H9EK 4QU6A 1S0NA 4MAKA 1P27B 1WTFA 4OHYA 8ATCB 3N9UC 4F50A 2AGOA 4TLRA 2PC6A 3BBFA 3UCGA 2AYEA 4EGLA 2K2PA 5DGBA 2RT3A 3C14A 3VGUA 1T95A 3FJ2A 1UTAA 1KTQA 4P74A 1E6VA 3DRYA 5ETRA 2ZVSA 2V67A 3IXQA 2ZKUA 1S4FA 3R5AA 4PWWA 3HHKA 5KT4A 3NWRA 4GC7A 4I68A 4F4XA 1IM6A 3AQPA 4WYLA 4ZCLA 4O0IA 4J9PA 1SIZA 2ROPA 2IRUA 1P1LA 2XSFA 4P2FA 3TP2A 4M5MA 4TYBA 4WFXA 4DUZJ 2E9ZA 1FKAF 5LOQA 2MQOA 3POTB 1VQNS 3BSCA 2AKWB 2ACMA 4AFFA 4C8KA 1SH2A 1N36F 1URNA 3J81U 1D8YA 1RT2A 4KIAA 3BSAA 4P52A 5AJ3F 2I9SA 4DR5F 3BGUA 2WVDA 2A6OA 1NHUA 4ETXA 2U2FA 1RWMB 2YY3A 3S7RA 2BOAA 4OYZA 2FLLA 2HHXA 2DCUB 1R0CB 3H4DA 1X0PA 2PMHA 3IFEA 4B9SA 4OZJA 3W1YC 2VA3A 1T94A 4Q7AA 5F9NA 1S76D 2VFUA 1CJTA 3C15B 3IRXB 5K14B 2YNIA 3TO8A 2BJ8A 2QC3A 4HTJA 3E01A 4DPYA 1NJXA 1KDNA 2XMKA 1MWZA 4EFAC 1D3WA 3HVWA 2AZ1A 4QPTA 2BQUA 4NXMF 1RBLA 4USMA 2Z2ZA 3AXKA 3EDRB 2XMJA 1Z1ZA 4XAKA 1FJGJ 4LUBA 1R8AA 1Y00A 2YWWA 5LL6d 4KO0A 2KJVA 4O23A 3OUYB 4OYWA 2HFSA 4C3LA 2V8HA 3T19A 1WSVA 1TMMA 1YDLA 3AOAA 3GB0A 2HHTA 3ZTPA 2W9BB 4EK2A 2R8GA 2C2EA 3H98A 4DL0C 2CPEA 4MK8A 1Y11A 2OEKA 4OZ3A 4RX6A 2ZH2A 5GMEA 2NXEA 4HI1A 2J7UA 2RRNA 1N36J 3KG1A 4C3KA 2D9OA 2E66A 5DQGA 2ZWOA 2ZH1A 4DV1J 2WZ1A 4NZ0A 3DM2B 1U8SA 2GIRA 2PA8D 3TYTA 1QSLA 4DDFA 1IKVA 4ZHRA 1EKRA 1GFWB 1RTHB 4ZLPA 3G6VA 4DEZA 3V6DB 5IOLA 1ZM2A 4NLPA 5D4PA 3UVJA 2ZH4A 3ZZYA 2W7PA 4PG4A 2A2DA 1NPKA 2V8GA 3L9ZA 4ZVQB 3KJNB 4USJC 3C19A 4ZP7A 3PNIA 2D69A 2UVRA 4OX9J 4Q44A 2MLYA 2WB1D 3UPFA 4PG8A 1XNRJ 2VJVA 4TQRA 5E7OB 3AA8A 3QIDA 2R7WA 2OD4A 3JSRA 3RB4A 3QJPA 3UE2A 1PYSB 2W7AA 4JOUA 3IWXA 2CKWA 2E5LF 3FNNA 2DHSA 2PEBA 4YEAA 4ICLA 1VS3A 4J9QA 2F9DA 1V9OA 3TVYA 2I5JB 1NO8A 3SZ2A 1T9UA 4KH1B 3JB9k 4U7CA 2LQBA 4X4TA 3DLKA 4MTPA 2LA6A 3MAAB 3LOUA 5EWFA 3ZTOA 2R8IA 3QFWA 3OD2A 4NLOA 2NSBA 3Q8PB 1M90T 1FEHA 1Q79A 2BV3A 3JQMA 4MYTA 3I9ZA 4DX5A 2UU9F 5D0RA 2Z2LA 5CHCB 5ETQA 5LXYA 1LEOA 3MCOA 4ZVTB 3X1LB 2CQ4A 3SSSA 3DI6A 2RRBA 4LF9J 4LRFA 1N5YB 2M2BA 2BANB 4N77A 4OYAA 4Q45A 2K3KA 2AQ4A 1RAJA 1RGVA 3Q8UA 4IDKB 3TUZC 4K4WA 5J1EB 3EXCX 3J7ZT 4CNZA 4UUXA 4NCBA 2LEPA 2MZRA 4ZVGA 4LSZB 3DM2A 1URRA 3R8YA 1PGZA 1EP4B 3MM5B 3C15A 2DR6A 4CQ1A 3A13A 3M9MB 3AJDA 2V68A 2VG6B 1GMVA 2IM3A 1RTHA 1RT3A 3GG1A 3I96A 4J9SA 1H73A 3MEDB 3HI9A 2MHNA 4HDGA 1RA7A 2XLJA 1VQ8S 1WKLA 1NHKL 5HP1A 4OYBA 1Q53A 2XMMA 4K4ZA 5DDOC 3DGVA 3H2LA 5KFYA 4F25A 5IZHA 3S01A 3FBFA 1RTDB 4CCHA 4WXWA 5EX3A 3M8QB 2MY8A 1UWBB 1DY3A 2CIMA 2DGUA 5KFPA 1IBCB 5D77A 2KG1A 2DKOB 3MZIA 1S1XB 1JLAA 4WP3A 5GAEU 2FHMA 4WIQA 1HI0P 1Z2LA 3FZBA 3I87A 3W2VB 3MM7A 1X5PA 2VKZG 2AHOB 1TU0B 3QT5A 2YX1A 3AD8C 3SCIE 3CCUS 1FXRA 3SYZA 1X4FA 1JXVA 4X4NA 1YI2S 5KFSA 2B4UA 3TA1A 4DV5F 3G4SS 4IG3B 3HFKA 3J7A1 3BBBA 1R89A 2NXUA 2Y1RI 2ZHAA 4ZPCA 2GMLA 1FDAA 1SH3A 3H2VE 4OI1A 2VBZA 7FD1A 2BJ3A 3Q8QB 4F0MA 1H2TZ 4RBTA 1YJ9S 2QMWA 1KQSR 4X4UA 2PA3A 3NEKA 5D0EA 2I1RA 4UTGA 5DM6Q 3M2RB 1UEVA 2VHGA 2A10A 1UVLA 4NCGA 1KLNA 4PABA 1SC4B 1RT4B 1UWAA 2CQBA 2AJ4A 2K3IA 2KDOA 1GK8A 2YWGA 4FVCA 3KK1B 2YKNA 3VZIA 2VG5B 3Q24A 1G7CB 1N48A 4DHVA 2KT3A 4QYRA 3ULHA 3TUIC 5GAEI 1R8CA 4KB7A 1AT1B 3KLVA 2HFNA 2HHQA 2HGNA 3MCMA 3QRRA 4U95A 4DPXA 2ROGA 3IS9A 4JI1F 4B3MJ 1NU4A 2H3EB 1SCJB 2G13A 5J2NA 2DHGA 2W8KA 4NA3A 1VIOA 2H4WB 2MMYA 1KRPA 1EETB 1VC5A 4JI5J 2LEAA 4NLVA 3L7PA 4LFCF 1UVJA 2DEJA 1M1HA 2IA0A 4A47A 1DJ0A 3D3BJ 4IFYA 1S79A 1MMLA 2OPRB 1JLFB 2QV6A 3SFUA 5T14A 3HHLB 5HANA 1A9NB 2V8VA 4TQSA 4A48A 2IDEA 4KR0B 4ELTA 1U6ZA 1HFEL 2NSCA 3QBCA 2GFFA 4AYBD 5J2PA 1ZZFA 2E1RA 1D0EA 1WDDA 1HNZF 3RYLA 5GAHU 3ET6B 4JBCA 3B4MA 2R7RA 3VAJA 3M2UB 3L3CA 1HQUB 1M5VC 2YTCA 4NWBA 3WC0A 4CLPA 4F67A 3MM5A 4OHZA 1ELOA 1U8WA 2HAIA 2GW8A 3BKTA 4HI2A 1JKHB 2H4YB 4ZP8A 4OJHA 3SBMA 1YITS 2ZZTA 3CDUA 1DZ5A 1WG1A 2DR8A 1B0TA 2PIIA 1C0UA 2D3ZA 2HURA 3UFCX 3QLHA 1RWWB 3V81B 4LFBF 2DY1A 4YR3A 4N41A 5EDWA 1S1XA 3K5PA 2BE2B 1YSJA 1TKZA 4IQMA 2EFNA 4RW7B 4O3QA 3SXLA 3D0GE 1NK8A 3V6JA 1H0HB 2HNYA 2DEIA 2ZD1A 4K2JA 4CLFA 2AP6A 2Y0BB 1IR0A 3TZZA 3NGKA 2IBKA 1NSKL 3NGDA 1OO0B 3C2PA 3BZQA 4P2MA 2ZZMA 3OTEA 4F7VA 3R3TA 2RDDA 2XG8A 2RAQA 5IT9U 2PGCA 1FRKA 3TX8A 3D3CJ 4LF5J 2XWXA 3W5YA 1G4CA 1MROA 2AYMA 3N0VA 1P1TA 1RT7A 5JVHQ 2RH3A 1XEZA 1IN0A 4CH1A 2FVCA 3MUVP 3NL0A 1XNRF 4EEYA 1XMQF 4JI7F 2W9BA 2C2OB 1JX4A 4LRAA 4DR7J 3EZOA 3PRVA 1H72C 3U1MA 4DL2A 2XY7A 1W26A 3W60A 5A76A 1NK9A 1S0MA 1NDPA 1UPMB 1T11A 2F65A 4FZVA 5KFVA 2XMAA 3SI8A 3QZ8A 2L9WA 5HI7A 5IWAF 4CLLA 1U0HB 3AAWB 4I2QB 3SQGB 3ZZTA 1M1KT 1HR0J 4PQUB 3CVKA 2W4PA 4A8QA 4ZS6A 4KFBA 1X5SA 2JJ4D 2JWNA 4CRJA 4X84A 2GIQA 4ECUA 2ASLA 4DR2J 3KOAA 4B08A 3A12A 4HT7A 3TJ9A 2IA6A 3CCJS 1FD2A 2OAUA 5T7LB 5HQLA 2M88A 3C6TB 4HHJA 2FHOB 3GSIA 1S9GB 4X64J 1XR7A 2LFVA 3DRRB 4FF1A 3HK2A 5I3UB 4LR7A 5K20B 1FNMA 2AJ2A 4ZVOB 4Y65A 5FDLB 2UV8A 4L3KA 2M9KA 1YBTA 1F5AA 4OZLA 3DHWC 3JAMY 4CLYA 5K8MA 1IKYA 1YLXA 2DNMA 3QSYB 1WUUA 1ZS6A 3GP9A 3M30B 2F63A 2GCFA 2XYPB 3DC2A 4O4GB 4UQTA 5AXLA 1HNZJ 3N4WA 1NHVA 4M95A 3SCLE 2CDQA 1H7XA 1BLUA 5H9EJ 1IWAA 4I6AA 1TR0A 3FC9A 1X5TA 4XO0A 1OSDA 3DLHA 3B78A 3RG6A 4DQIA 2HW3A 2C2DA 2V5HG 2ZC4A 1X4DA 5CD4A 1HNVB 1RT5B 2OPPA 3QZ7A 1U1KA 5E3QA 3KK3A 2L3MA 3HO1A 1GMWA 4OZ2A 2QLFB 3N5FA 5BJRA 2CQHA 3R6LB 3CF5Q 4A8WA 1NK6A 1I3OB 2V8DA 2LCWA 1L3SA 3D66A 4JI4J 1J5OB 4LFAJ 1JLCA 2W01A 2YWFA 3FGVA 3BGFA 5F41A 3HT0A 2B6AB 3R5DA 1PBAA 4QIWD 1WTBA 1QVFR 2ZHOA 3VHQA 5SZTA 1NM2A 2GZOA 3PEJA 2N7YA 4JI2F 1L5UA 3PJXA 4KV8B 4IOAQ 4DFKA 2PE8A 1Y5IB 2A3JA 2CRLA 4C97A 1FNXH 5IC6B 3C6UA 1O51A 4GO5X 4RL1A 1PCAA 3OTOJ 2I38A 1RI7A 2MLZA 5A0YA 2BYCA 4GKJF 5ETMA 4C0BA 2XSJB 3LALA 3EX7B 3A3NB 2VDIA 4JV2A 3GCWP 4WK1A 4UOHA 4OZ1A 1HL6A 3HULA 1VK3A 2HS3A 4G6VB 2E1PA 4RJVA 2M0GB 3QGPA 3D4JA 4Y2KA 4ZVPB 3G6XA 4O4GA 3ZNJ1 1UETA 3LW5C 8AT1B 4UT4A 3R5BA 1HBNB 1RWUA 4J9VA 3JTOA 4LVNP 5DS7A 5KFRA 4YUDA 2MQPA 3KLEA 3CW2C 4Y2IA 4ED6A 3D6MB 3M1VB 2ZJPQ 2AU0A 1AUDA 3HP6A 5DO2A 1FERA 3GONA 1TUWA 1WELA 5DDQC 1CQMA 3GIRA 3KHHA 3G82A 5BYRA 4TU8A 5T7LA 4OI2A 2LXIA 1FF2A 4OYPA 2F4FA 3CUNA 3LGHA 3CCTA 1RBAA 1M1GA 2PI4A 2GGPB 3B54A 1X9MA 3QIPA 1TFYA 2O1PA 2IHR1 4RUCA 1S57A 3AT1B 3F56A 2Z0GA 4V1Ak 2B9EA 4ERDA 4XIUA 4B9MA 2Q43A 4DLEA 1C1BA 2KRRA 4WK3A 4ECYA 1UZDA 3UR0A 3HVTB 4F26A 2V9WA 4PYDA 3R97A 5C2GA 1LNQA 4RWXA 5KFQA 3T5KA 4DR7F 3JSYA 3CJ0A 3J7YU 2CADA 1RP5A 2DNNA 2DNYA 4DCJB 4DX6A 4FXDA 4QYZJ 1ZOTA 4M94A 1UZHA 4NI2B 2M52A 5EGYA 3IA0A 4AL6A 3PDNA 4HL9A 3AD9C 4EYIB 1WC0A 4WU3A 4JYAF 1PAUB 1TUGB 2GA7A 2XLIA 3KHLA 1X0FA 1QVGR 2MJNA 3KLHB 1U09A 2L9NA 2N4DA 4WIIA 1WDTA 3EZUA 4WJBA 2BBEA 1U1MA 2CPZA 2AJQA 1ZPVA 2CAJA 2DGQA 2ZE2B 4WE1A 2JEJA 2ZUAA 2XLKA 1PILA 2KU7A 1YX2A 2XM3A 1HBNA 3GPAA 4AL7A 2UVVA 1U4BA 4RUHA 2CPHA 1JLCB 3UDEA 1AYEA 2PI5A 2HVHA 4LFBJ 1F9EB 1YKWA 3ZZZA 3MPVA 2YKQA 3QPIA 2GVZA 2IC3A 2H51B 4F3MA 2DNRA 5CYMB 2DY9A 2HRYA 2W9CB 1XMOJ 4LF8F 5L1JA 3OW2R 2UXCF 1LK5A 3EPGA 2ABYA 1XK8A 1WF1A 2ZZNA 3PKMA 2IFXA 3MPWA 4DQQA 2FVQA 5KFHA 3WHIA 2GIFA 3LANA 2PO4A 1G1XA 3GJRB 2K7KA 3AODA 4JI3F 2WW4A 2VFTA 4G3IA 4ZJQA 4W92B 3MURP 2GVDB 1NSQA 2NZ4A 3KLGB 1RB0A 2ZWPA 2JFDA 2XHCA 4DUYF 3CC2S 4BWJA 1QTNB 2UVWA 2OD6A 2Z2MA 1JMTA 2KXFA 4DV0F 1AFIA 4KT0C 1Q78A 1NK7A 1JLFA 2JVRA 1Q7YT 1N34F 1RHMB 3A8IA 3DDNA 2H9ZA 5F3TA 3WX4A 3KLEB 2W7OA 2BR0A 2FVRA 5D3GA 2HFUA 4EWTA 4D3GA 1B64A 2DYAA 3OVAA 2VL1A 3EGWB 3EJMA 3HDSA 4MFBA 4OJ3A 1RYSA 2WHOA 2FUG9 4QWEA 5AXKA 1CS4A 2OPSA 3LP2A 2J8AA 1WJ9A 2GAHC 2HWHA 2OPQB 3OR2B 3Q8YA 3NGTA 3GR0A 4YB6A 1HQUA 2IM0A 1L3VA 1IVZA 2G2OA 1HWIA 1YZ7A 5HBMA 4ANEA 1ZETA 2AEJA 1SVDA 2E5JA 2JEGA 4ILMA 3TEHB 2HLTA 2WVEA 2H1YA 3CE8A 5ETNA 4RO0A 1RK8A 3DI6B 5G0RB 3F73A 4E0DA 2GQ2A 3LP0A 1EX8A 2HZCA 4GRSA 2V2KA 1JLQA 2EI5A 4XDDA 4OZ0A 4JI5F 1B7YB 1CQNA 4A8KA 2UUAJ 4R25A 3IR7B 4MH8A 2VKRA 3SIPB 1HW9A 3NS7B 4WTYA 3UDLA 2XGQA 2XB2D 1YIJS 3GQCA 2YWKA 4RW8B 5FLXY 4JI2J 2DIVA 1DLOB 1NXIA 1X8DA 1UJ5A 1FTRA 2B8QA 3H5SA 2XHWA 3T41A 1S72S 4NMXA 2MXYA 2R2TA 5KFAA 1SJ1A 2BJDA 2CNKB 3CJ8A 1VBYA 2MY7A 1X5OA 3LGMA 2VIHA 1G3OA 4K4SA 4TU7A 3M32B 1HNIB 2NYIA 3MM6B 3JSMB 4YDXA 3Q8VA 2J0XA 1HWJA 4L6V3 2B5JB 4B3TJ 3G71S 1KHWA 1U6BA 2UUTA 2Q6CA 4ECRA 2IC3B 4KE5A 5A2QY 3RB6A 2B4OA 2RKIA 1MN9A 2XCAA 2D3OR 4C11B 1QAYA 2N4CA 9RUBA 1HQEB 4FVMA 4BLGA 2AYBA 1QJHA 3I0RB 3KLIB 4IG0B 2LMIA 1HARA 4RW9A 3OTBA 3NCRA 3THPA 1FXDA 4Q8EA 1S1TA 2CJYB 2HBQB 1NKBA 1LV5A 2DD8S 5GADI 1RUSA 1FJCA 1F5CA 5M2PA 1I94J 2F8HA 3C8YA 3DLEB 4F3QA 1NCLA 3CIZA 3CTRA 4WKYA 3CJSA 3DOMB 2UZAA 2KT2A 3P8BB 3GMGA 4NLWA 4PXDA 1VCTA 1RDRA 2ZH7A 3RBXA 3PY8A 2J7KA 1FKPA 2C3PA 3R27A 1WORA 4M5NA 1RHJB 1FRMA 3ISNC 5F8HA 2EFPA 1KVIA 2IVFB 3MGJA 3ADAC 4NLUA 3VAKA 2C28A 2KN4A 2R8KA 2B9XA 2OGUA 2I8EA 2R4FA 3BR8A 3CJRA 3ENAA 3QAUA 1ZAVA 3ZZPA 4ZLJA 2YNHB 2OO4A 5EHHA 1J5OA 2G1HA 5KT6A 2XYHB 1Q4RA 3C6UB 4RW8A 1Y5NB 1OSCA 3AOBA 1WF2A 1DLOA 1S1UB 3DCAA 5KG5A 3KMSA 1FVQA 4TXSA 4F4YA 4IH6A 1RU1A 2FHKA 2EBGA 1D9FA 3A8KA 2P9CA 3GSDA 2GO9A 5DZ6A 1NSAA 3LAMA 5C2CA 4M8LA 3PM9A 4ED7A 2CJQA 3R7BB 1EARA 2CPDA 1KQKA 3PW2A 4IQXA 1SJRA 1RHUB 5GADU 2O01C 1E6YA 1XBWA 2G9OA 2EWHA 2V9KA 1YJ7A 4X4QA 5G0RA 2GJIA 2KVQE 2DNQA 2FZCB 4M5DA 1QDUB 4LF8J 1XJWB 2QLWA 2FPHX 3QSIA 4I7FB 2EBEA 4LQ9A 2HPUA 1LWCA 4DPUA 4ES1A 4HH1A 1DTTA 1YHQS 1V6HA 3OFEA 1S6PB 4C11A 1QTMA 1TKXA 2MSTA 2PMWA 3K58A 3MFHA 1MU2B 2XZWA 2DNZA 4CDIA 4DSIA 2W25A 1GH8A 4OFZA 5IFMA 1DBDA 2F7VA 1T9XA 3GFXA 2UVUA 4OI0A 2VU5A 1G2EA 4ZITA 3CD0A 1F3VA 2KKHA 4RKUC 1RYRA 1EIYB 1AA1B 1R27B 3DLEA 5IS2A 3C3LA 2X1BA 1CLFA 3T3FA 1X31C 2IY5B 4CI0B 1WACA 3TI0A 2IMWP 4YB5A 1C1BB 2E5LJ 3NLCA 4RW4A 1C4AA 4LF4J 1M5KC 5KG1A 5KAKA 1TL4A 3R6GB 4OJGA 1WC1A 1SXLA 1RT6B 2RNEA 2KZZA 2DH8A 5KFKA 1S7IA 3IP0A 1IR2A 3LTOA 2OPRA 2JHEA 3GJSB 5B0BA 5E33A 5ETOA 1TQLA 2CJAA 3W9JA 3TJAA 4J9NA 3K2YA 2ATCB 1KFDA 1M5OC 4O3OA 4U7UD 2ZD1B 5D0HA 2KYXA 2QA2A 2MZSA 4FN5A 2DR5A 2ZITA 1U2CA 3L95X 3PW5A 2KFZA 1CEZA 1JIHA 4J9MA 3Q22A 4AD6A 3EGVA 2HAFA 2WSCC 1JLEA 3HJVA 4ER8A 1EKSA 3B8HA 5IT9Y 3MAQA 2HBYB 1DTQA 4NA1A 4A8SA 2LVWA 4OHXA 3QIPB 2F4VF 2AJ0A 4AQYF 1ULRA 3V6DA 1N32F 3DHXA 5SUHA 4OX6A 2HQCA 2OTJS 1FEEA 4AXJA 1RTIA 2PSZA 4CP5A 4GKKJ 1VISA 4LIWA 1TELA 2AT1B 1F3FA 2AWZA 4B9VA 1R3NA 3UO0A 3I31A 4X62J 3J80U 1S9EA 4R5PB 4ETZA 1R6YA 2B9YA 4ATNA 2YQ1A 5HAOA 1SKUB 4ID8A 1S9GA 4NI2A 3B82A 4PUOB 2VDHA 3E51A 4QJVA 2RUSA 2HG4A 4OMFG 3TUPA 4ECXA 2LDYA 1SJFA 2KG0A 3RW6A 2V6AA 5L46A 4MIBA 2DNKA 1S1UA 3I5CA 2J9DA 3IWLA 2HS0A 5CH7B 4I1TA 1QE1B 3KLGA 3P96A 5F8MA 5A8KB 2MKKA 3DMJB 4RBVA 2ZNYA 3W5XA 1UW9A 2CPJA 1R0AB 1RA6A 2RJZA 3MEEB 2V2QA 3IMQJ 3FFIB 1B99A 4EU0A 2F40A 7AT1B 4F4ZA 3CMQA 2AJFE 2G0JA 2NCKL 2L9DA 2QE5A 2V0NA 4DV6J 1XNQJ 4HKQA 1N4LA 3BN7A 3Q2SC 5HMZA 1RT5A 2OPPB 4KAIA 2NUHA 3JS9A 3QFHA 3J7Z5 4NLXA 4EBDA 2YVSA 3GIKA 3MOZA 1RTDA 1LWCB 4O4RA 4YHHJ 1W7WA 1FESA 1CJKB 5AE2A 4C2MA 3Q0AA 2LYVA 1ZM9A 4MIAA 4PXEA 1OPZA 3X3UA 1RT2B 5HP1B 2ZH6A 5A8RA 4RZRA 3VALA 3C6TA 3EVMA 4RW4B 5D78A 2NXNA 1VRTB 4DCOB 3MEDA 2L41A 3J80Y 3GLJA 3CJKB 1QUVA 4WU2A 3R2DJ 2YPYA 3LP0B 4LRBA 2IYGA 2EKNA 1BQNB 2ZKTA 2HMIB 5J1NA 4R0JA 1WKJA 2GMJA 4DMZA 1S6QA 1VJQA 1FXLA 3FQLA 2WBRA 4ZP9A 2A2CA 3O8WA 1XTZA 2HQFA 1RAGB 2VFVA 4MKAA 4TYAA 4WYWA 2BX6A 5C25A 3MR2A 1HNXF 1F2GA 5JMNA 5HJYA 4ECWA 4PWDB 4JI7J 2OFGX 1JLAB 4PPDA 3ZXWA 3UN3A 3H25A 2HLUA 4B9LA 3RBDA 3PRDA 1XMOF 4X64F 4Y28C 3Q2TC 3BGOP 3I32A 4KGVB 5A0YB 3BO3A 1S4EA 1KLMA 1FE0A 4QR0A 3ETOA 2DHAA 2GJFA 3TZYA 1X9SA 2XY6A 4H4MA 3RUBL 4JI3J 3MEKA 4JI0F 2E7XA 4J9UE 4KGXB 3TWZA 1R6VA 1KSPA 2RHQB 1KWMA 4OV1A 4QOTA 1U24A 3M8YA 4DG1B 3RB3A 2R7TA 4LREA 3UDVA 1T0TV 2HWIA 1T03B 2EFOA 1KBRA 2QO3A 4ELUA 1SKSA 2HHHF 2DVIA 3WDOA 4CH7A 1TAUA 4HACB 3PW7A 5KFMA 2L08A 2WSEC 2DPIA 4LFCJ 3HJFA 2EG1A 3PW0A 3U7JA 2DITA 1ZM3A 3DOMA 1VFJA 1YZ6A 4QQBA 3RU0A 1UJ6A 2GAGC 3UVJB 3ZTRA 2WAQD 1EQMA 3DMJA 1VRTA 4CO0A 4ED0A 4DL3A 2FLPA 5F8IA 2JOQA 4UZCA 2QGFB 4WFZA 3TEGA 1AXQA 2GHPA 1AW0A 2W24A 2R3VA 1DARA 4PPZA 4ZPWR 1BQNA 3VTIA 3RRHA 5L1LA 4ZMMA 2HNZA 2Y0SD 2YNFA 3BQ2A 1H2UX 2NUUG 3IC1A 1Q1KA 4CT9A 1FRLA 2DXFA 2OEJA 3KWMA 3GR1A 3W61A 4N56A 2FQQB 3BKUA 3CCMS 2IJFA 1HBMA 2UXDJ 3VVUA 2RQ4A 2H5IB 3FVYA 3ONQA 2ZM6J 3KDNA 4XDCA 4IRDA 2RKIB 3FRZA 1Y3KA 1D9DA 4P75A 4ED8A 3HMJG 2Z58B 1SL2A 4Y3CA 3TQEA 1A0OB 2Z2YB 4CLWA 3G8QA 4ZN3A 1M0SA 4C0OC 1T7PA 3ISZA 4BC9A 3EM1A 4CLKA 2YKMA 5HROA 4ZDNA 3NNHA 3OXGA 1WKKA 3FUYA 3NGSA 1FT8A 2BM0A 2W4CA 1KS2A 2CQ2A 3AH6A 4RUBA 3H5XA 2IAJB 2Q79A 3HZGA 2ZC3A 2MLXA 2WK4A 4UY8T 3NGRA 5RUBA 3I55S 1PJ6A 2C2MB 4HTIA 2DPJA 1QUPA 4K5SA 2ZDPA 3FMBA 4ALZA 3QGIA 2ZBRA 2DR7A 5THWA 3UN2A 1N6QA 4GKJJ 2PFDA 4J7CA 3DXSX 1PO6A 5KFUA 4I67A 4CO2A 1FFSB 4F0HA 3DLGB 2QYCA 4ZIVA 1HD1A 1AZSB 4NYPA 3OL8A 3RBEA 2B4PA 5KFIA 2HNYB 3TNVA 4C7QA 1YJVA 2FZKB 3OFGA 2EFGA 4QIEA 3BM7A 4FXVA 2HKEA 5DZ7A 3HFVA 1KLMB 2MJUA 3NP5A 3D68A 4IRKA 3OR1A 2MKIA 1B70B 3BSOA 2C42A 2WONB 3SMZA 1FJGF 3G8SA 1P8GA 2ILYA 2X3DA 3S6EA 3BDPA 1U1OA 4ED2A 1RHRB 4F4WA 2JSXA 3QRPA 5KT7A 3H5UA 1VQSA 3PXGa 2BABA 1SJ4P 1TTHB 2OI2A 3Q86A 3EVOA 4LVOP 1N32J 2AZ3A 2K7JA 4B3RJ 2PD1A 1DTTB 4DFJA 2BJEA 2IRYA 3A4TA 2GHVC 4FBUA 1XR5A 5H9FJ 4V19X 2ZHBA 1CBKA 2WOMA 1YTYA 1UA0A 3CT9A 4IR9A 3CB4A 5IV3A 2CQDA 1LFPA 3GJTB 1VR6A 5F0UA 4ZCKA 1T03A 1RAEB 1RACB 3DOKB 4GVBA 4NLSA 1Y10A 3ETMA 3QJJA 4WFNQ 2DGTA 1QD1A 1VGYA 1EJ7L 3R1LA 4U96A 4WBFA 5KG3A 3BPSP 4G1IA 1RTZA 2QMUB 3FRYA 2VZ9A 1RCXB 3RB0A 2XNRA 2LKZA 1WHVA 3W7BA 1N8RT 4FBTA 3IWNC 5HSPA 3GCXP 4M5KA 3QMQA 2RRAA 1FI4A 1KHVA 2FTRA 4YOEA 4USWA 3DDIA 5B0AA 3ITHA 4LF4F 1RBOB 4DSJA 2O66A 4DOZA 4LF5F 4B9TA 1T9YA 4RNMA 2IVMA 3BN4A 2LXUA 1FFGB 3O1LA 4OX9F 3D1QA 1WOSA 3KG4A
chains in the Genus database with same CATH topology
1W2BR 5KFGA 1V3ZA 4ED1A 3BS9A 2LQ5A 3OR1B 4B17A 1FKOB 4DS5A 3W2WB 1VQMS 1L3UA 5JXSA 3GV8B 5IQ6A 1B7FA 2CVIA 4I6YA 3DDKA 2MQMA 4DR2F 2UP1A 3LF0A 2MKSA 2FY1A 2B6AA 3DLGA 2WOMB 4DR3F 3LAKA 4LF9F 1X9WA 1FHTA 1DRZA 1HQEA 4URGA 1N6QB 4G1QA 1VQPS 1FCAA 4PG7A 2VOOA 2G1DA 1SJQA 2MPUA 5F8JA 2P6TA 1VLYA 2DNOA 1R7IA 3NNCA 2JFKA 2KXNB 3CJKA 3CJ3A 4EZ6A 1WHYA 3IS9B 3I9V9 1FDBA 2CQPA 5L39A 2E9TA 3O3LA 5E5NA 4B3TF 5DG9A 1JLGB 3THVA 5J1PA 2JLEA 5K5MA 5IM0A 1SC6A 2OKQA 5J2QA 1SV5B 4HYKA 1UVNA 4ICLB 4QBUA 1SQEA 1VHFA 1S1VB 1RJJA 2MKHA 4I0WA 5CCMA 4NLDA 4C8ZA 1FJ7A 1XNQF 2G4BA 3KFWX 4ID5A 1K73T 4USHA 3KLIA 4IG0A 4A8MP 1KC8T 4DSLA 4DFMA 1VRUA 3I4PA 3NBPB 4FF3A 4PR6A 5C24B 1VJWA 1IQZA 2BANA 2BUNA 2VPWB 3H4BA 1AROP 3SEOA 1HNWF 4ZPBA 2DGSA 3RRGA 1S77D 4RW6A 2PFFB 3QLHB 2KXHA 3CDBA 1S6OA 2D7SA 1MMNA 4I7FA 3OHAA 3TAMB 1ZZNA 5CZXA 4BBYA 2PN6A 4RLEA 1UMJA 3RZAA 4ECSA 1TKXB 3HLUA 1VBXA 1KD1T 1JWWA 4C8NA 3SCKE 2R2SA 4GKKF 3NMRA 2MDAA 4P6QA 2R7UA 2NPIA 3KNAA 2RF2A 3IGNA 4ECTA 3BGLA 1JJHA 3LP1B 1FKOA 3CCSS 2GMHA 2VFSA 4PKDB 1Y0HA 1SKRA 4BCAA 4B9NA 1T02A 4P7VA 2YH0A 3MEGA 5KFBA 2RE1A 2BRKA 5I3PA 4TU9A 1DQ8A 4UOCA 4EYHB 1LOUA 3NS5A 2DGVA 5CYMA 1SL0A 4DG1A 5J1EA 4USIA 2DT9A 2RQMA 5K8OA 4F2RA 2FJEB 2WW8A 2MZTA 3D2WA 1N54B 4X4OA 2KFYA 3IRWP 1Q82T 2O3DA 1VQLS 2CZVC 3AB4B 4J5OA 5F9LA 1CC8A 4Z2XA 5KFJA 4I56A 4MK9A 1TK5A 3T1HF 4WFAQ 3MFIA 1U2FA 3FDSA 3MMCB 4Q5VA 2UXDF 3L7OA 2XMUA 2CVEA 1TUVA 3TUJC 5K9FA 1FRIA 2N82B 5BR8F 1RTIB 3M6WA 4DN0A 1PC4A 2CQ3A 5IT0A 2QSWA 2APOA 4O44B 5DLGA 2WTFA 4DL4A 2CG4A 2IRXA 2K1RB 3DYAA 1U1NA 2KI2A 1N5YA 2HNDB 4MMOA 5LMNF 1QE1A 4NRTA 3RAXA 2HHVA 1FRXA 2XBPA 2LEBA 4A8FA 1VRUB 1G6BA 2CQ1A 3HKWA 5FD1A 3V5RA 2ZM6F 3KK3B 1JLEB 1IBKF 2YKMB 1VQ6S 3KKFA 5GVQA 4OIXA 2ROEA 4K4XA 3QWUA 4V19J 1QLNA 5HQ8A 1C1CA 1Y9OA 3K8WA 3SDEB 2AYGA 5JJBA 4YQWA 4IH7A 2N3LA 3H8YA 4Y0FA 4X4RA 4NCGB 4K0KF 3BB5A 2AD9A 1XWLA 2YNGA 3G6YA 2GJ2A 3FSIA 5KG4A 1QAIA 5A6WA 2VBWA 5EN1A 5I42A 1DAXA 5T41A 2ASJA 3S1TA 3JYTB 3OVSA 3W2VA 3AHPA 3M32A 2OMLA 4YFUA 2FLNA 2B3TB 5ADZA 5BYQA 4B3SF 3K5OA 2BVZA 4I69A 2JVOA 1UAWA 3KMQA 3LP1A 4KKOB 2QT7A 3VAFA 4N5SA 3M2VA 1P6TA 1B0PA 3NMAA 3EGNA 4N76A 3KLFA 3D28A 1NK0A 1UKUA 2U1AA 2CPYA 2LQ9A 4DV2F 3M1VA 3PKYA 4PRFA 5CYJA 3HT3A 2P9GA 3G86A 1U45A 3AQOA 1MSWD 2R2UA 1F5BA 4PQAA 3IAS9 4EZ9A 1R8BA 3KJVA 3W2WA 4UY85 2MGZB 3GV5B 3BSNA 4YHHF 2XWYA 5KT3A 4NLRA 3T5HA 4LJMA 2ALZA 4NA2A 3SSQA 4O3RA 3W3SA 2I2YA 1C0UB 3MTJA 2PMZD 2FIUA 2IBOA 4FP9A 4ZCIA 1IKXB 4LFAF 2CPXA 1NNDA 2RVJA 3BREA 3M9NB 4DQSA 2PDAA 2YNGB 1CSJA 1HPZB 1O0PA 4QWAA 4RBUA 2XI3A 2BACA 2LA4A 2X1GA 3OL6A 1R43A 1M5PC 3IAM9 4O3NA 3NNAA 3OTCA 3KG0A 4DL6A 4K4VA 3ZZRA 4NLGA 1S6UA 1IXKA 1HW8A 1U1RA 1QAJA 3N28A 1KOOA 1SJ3P 2HVZA 1XMBA 1WWHA 3BO4A 1HA1A 1OQ3A 2YKPA 2V94A 3OHBA 2G0CA 2YKAA 2BRLA 4KGKA 4QW9A 5DQIA 5A8WA 3F44A 2C3UA 1IKWB 1TZ0A 4Q0BB 4DL7A 4WFBQ 3M6XA 2DIUA 4ES3A 2YX4A 1CVJA 1UA1A 2W4DA 4ZVFA 3K5NA 2MHEA 4KFBB 1XR6A 1S6PA 2FJBB 2DNLA 3FZ2A 4DSKA 3NBPA 4G1QB 1LFWA 4IFVA 1ROFA 3CO9A 3OL7A 5I42B 4Y00A 1Q16B 4X62F 2ZBCA 5E3AA 1HBUA 4ZPTR 3LGNA 5I3QA 5C42B 4HH0A 2GQQA 5AXMA 2XGPA 1CG2A 4OZ5A 1TL1A 2AX1A 1IBLF 4KV8A 1JLGA 2F1FA 4ED5A 1UFWA 3CWJA 5J2QB 1UJ4A 3DOLB 2B7CB 4DFPA 1Y7PA 1HI1A 5GAGU 5H1SV 4TY9A 1LWEA 1X7VA 4J9KA 1JXEA 4URQU 2JL9A 4A8XA 2XSJA 3TVKA 3HHNB 1FRJA 5K8NA 5D3GB 2E1MC 1LW0A 4ZVHA 3MM7B 2HQ3A 3GV7B 4ZPDA 5B0DA 2IJNA 1DTQB 5KTQA 5HROB 1FO1A 2FLOA 5JUMA 3MMBB 4IG3A 4GO7X 4KGMA 2ZJRQ 3CDEA 4ZA1A 4M63A 1HWUA 4DJBA 1YJ9S 1WG5A 2HYIB 3MEGB 3H40A 2PI4A 4I6WA 1YJWS 4IO1A 2RSQA 5E3PA 4C8LA 1UVKA 2CZ4A 1MWYA 2CPFA 2BOPA 1LQ9A 4KHMA 5F8GA 1DFDA 2DCLA 2EG2A 3M9OB 3OV7A 2CYYA 1V3RA 4NLQA 3GYXB 1Q81T 3TAMA 3D0HE 1MMDA 2EPIA 3WC2A 3MWBA 4PXCA 1HYSA 3K0JA 1QM9A 1T3OA 1HPZA 2ILZA 4IFVB 4QIGA 4JUZA 3I0SB 2KRBA 1BC6A 3E8OA 3KNGA 4QWDA 5DETA 4DV7F 1FDNA 3MR5A 2JX2A 1FJEB 3CJ2A 1IQTA 2WB4A 7FDRA 3NRBA 3CSKA 1HNIA 3ITHB 4RWWA 2F9JA 2F3JA 1UEUA 2XI2A 3CCZA 4KHRA 2FDNA 3VF0B 3J7YI 4IYQA 3LWMA 2D1CA 1RT1B 3KK2A 1BD6A 3D54A 3HVAA 3PFOA 4DBQA 3CD5A 3HZEA 1VQ5S 2EC0A 3OBIA 4YP3A 3HHLA 1YJUA 2HGMA 3VQSA 2W9AA 2AGPA 4RNNA 2CQIA 3G6ES 1DHMA 1N5TA 2GQCA 2LU1A 2WSFC 2VFRA 1VQKS 1JNZB 2M7SA 2DH9A 3US5A 4BHQA 3H5YA 1SH0A 4C8OA 3SSRA 3I5AA 4ECVA 3I82A 2X51A 3D5MA 1HWLA 2M5YA 4LSLB 5KFEA 3CIMA 4IOCQ 1REVA 4TLQA 1FKPB 2QA4S 1GXLA 3VAHA 1TFWA 4B3OA 2ACYA 4A8OA 3CD7A 4NZ6A 4FF4A 2EFVA 3DN9A 1QSYA 2LQJA 4C98A 4XPCA 1GXUA 2GNKA 1S6QB 2OFHX 3VAMA 1KR4A 2FVQA 3CC7S 3DLHA 3MAHA 3BQ0A 2YWHA 2Y1IA 2BQ3A 1T05B 2ZDOA 1WHXA 2Q1LA 3F41A 3FSXA 3MECA 2KB2A 2M70A 3T6JA 4D3HA 5LT5A 5HMXA 1VQ4S 4RU9A 4W90B 2YKOA 4JV5F 4OZNA 3NWGA 1ZYQA 3LPYA 4EBCA 3AY0A 4ZKAA 3K7RA 4F4KA 4DR4F 5GMKa 1E6YB