3CTRA

Crystal structure of the rrm-domain of the poly(a)-specific ribonuclease parn bound to m7gtp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
GPLGSDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the RRM domain of poly(A)-specific ribonuclease reveals a novel m(7)G-cap-binding mode.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Poly(A)-specific ribonuclease PARN
total genus 14
structure length 75
sequence length 75
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2008-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ctrA00
1H2TZ 2FC9A 1PGZA 1SJFA 2PEHA 3CC2S 3CCLS 2KVIA 3RW6A 1O0PA 2A3JA 1ZZFA 1U1KA 1YWXA 3CMES 5GADU 2CQDA 1WF1A 1JJ4A 1M90T 2N3LA 2RRAA 5LJ3Y 3UCZP 5CA5A 5ITHA 4WFBQ 4C4WA 3CCMS 2MMYA 3G71S 1DBDA 3ZZZA 3U1MA 4IUFA 4ERDA 1JJHA 1AUDA 2F9JA 3HI9A 5GAHU 1WF0A 3NMRA 2CQIA 1VQ5S 4FXWA 2MZJA 2CQCA 1M5KC 3MOJB 2HZCA 3BO2A 2MKHA 2DNRA 2YKAA 1WG1A 4J5OA 1U1MA 3DXBA 3LQVA 2KG0A 3EX7B 5JVGQ 4WCEQ 2XS5A 1X4EA 2G1DA 2M7SA 4QQBA 5CXTA 2KU7A 1KD1T 4PRFA 3P6YC 2MKJA 2KI2A 2J76E 3TYTA 2AYEA 2OJ3A 2L9WA 5HL7Q 2LA6A 2K8GA 5LXYA 3CPWR 1URNA 1FJEB 2CQPA 1OIAA 2G0CA 2M70A 2DNNA 3I56S 4RU2A 4CIOA 3CCSS 1WEYA 2JVOA 1P1TA 2MY7A 5DM7Q 1RK8A 3N9UC 3S7RA 4YUDA 1F9FA 1UAWA 2D9PA 3RW7A 2DGTA 1HL6A 2DNMA 1K8AT 2JVRA 3SDEA 3CCES 3CCUS 2M0GB 1JJ2R 4Z2XA 2M52A 3THTA 2CQ1A 2FC8A 1U1PA 1X4HA 3VAIA 4QU7A 1UP1A 2E5HA 5D78A 4WIIA 2DGOA 4CH1A 2LXIA 2NLWA 2JRSA 2DHXA 1U1NA 2KG1A 2O3DA 2E5IA 4WFNQ 2JX2A 1KQSR 2CPIA 5IM0A 2KFYA 4IO9Q 4ZKAA 2MKKA 5MLCV 1OPIA 2VOPA 5LXRA 2V94A 2CQ3A 2EK6A 1Q81T 1Q86T 1NU4A 2NZ4A 2ADCA 1M5PC 4U67Q 2U2FA 1A7GE 2M9KA 3CCRS 1N8RT 1VQ6S 2DO4A 3UE2A 2CQ4A 2LXUA 1B7FA 1WEZA 1WG4A 1WHVA 3I55S 1VC6A 1SXLA 2DK2A 2E5GA 1XN9A 3BS9A 1KC8T 2MZTA 3H2VE 3TO8A 3MD3A 1PO6A 1FJCA 2DGUA 4LMZA 1R8PA 1U6FA 2DGSA 3S6EA 3IRWP 2ZJPQ 5JVHQ 1Q82T 1UW4A 2DB1A 2I38A 1U2FA 2N7CA 1WELA 1SJQA 1G2EA 3NS5A 1N52B 3UD4P 2DH8A 2X1GA 1H2UX 2M4MA 2LKZA 3S8SA 2YH0A 3HHNB 2MHNA 2MJNA 3R1LA 1VBXA 2N82B 2MB0B 5GAEU 1HD1A 2FHOB 4M5DB 2MZ1A 3G96A 2I2YA 3THPA 1P27B 2D3OR 3J7ZT 1NO8A 2AYBA 2OSQA 3H2UB 3NNCA 2OIHA 2VODA 3U1LA 2RS2A 1VQ7S 3CXCR 2MY8A 3VAKA 1WTBA 2J0SD 1X4CA 3K0JA 3DLLQ 3CD6S 3VAJA 2OTLS 1YJ9S 3ULHA 2HVZA 2DGXA 1W2BR 4F26A 4WKRA 3P3DA 3B4MA 1X4FA 3MI7X 3R27A 4ED5A 5GMKa 3Q2TC 4C0OC 2X1FA 5DETA 2GHPA 2L08A 4CH0S 2F9DA 1VBYA 3VAGA 3MD1A 3CUNA 1DHMA 3CC7S 2LEAA 4FXVA 2M8HA 4TU7A 2KXFA 2RQ4A 2FPHX 2CQBA 1VQ9S 1HA1A 2DNOA 2ERRA 1YITS 1WHYA 2DITA 2KRBA 2MQNA 3P49B 3BEGB 3EGNA 3EGZA 1WEXA 1CVJA 3CF5Q 3NS6A 3J7YU 2DNPA 4TU8A 3LPYA 4UQTA 2MGZA 1QVGR 2DHAA 2DNZA 5H1SV 2KHCA 1K73T 3G9CA 3TP2A 2CPFA 2RUGA 2KXHA 4F25A 4Y0FA 2RU3A 1X4DA 3UCUP 3MXHP 1X5TA 2MQLA 5HO4A 4YOEA 1WHXA 1X4GA 3MURP 3OW2R 2MZQA 2MQQA 1OO0B 4WF9Q 3MDFA 1YJNS 2XS7A 1N54B 1H2VZ 1VBZA 5LJ5Y 2ADBA 3CMAS 1VC0A 1YIJS 3G8SA 3CTRA 4C7QA 1OWXA 1M5OC 4A8XA 2K3KA 1H6KX 4OZ1A 5LSLA 2LA4A 3R1HA 2UP1A 2MKSA 2CPDA 5LSOA 4LJMA 3UD3P 2HGLA 5IFMA 2D9OA 2KXNB 2RT3A 2KRRA 1YJWS 2CPJA 2RQCA 1HD0A 2MQMA 5DDQC 3S01A 2MYFA 1N88A 2DNLA 4BS2A 4W90B 1M1KT 3PIPQ 1M5VC 2CQGA 3VAFA 3G4SS 3CULA 2MKCA 2KT5A 2DGQA 4IOCQ 2MZRA 2JWNA 2DIVA 2YWKA 1VQNS 2KM8C 2KN4A 1S72S 1FNXH 3NNAA 4CQ1A 1YHQS 4PR6A 1VQKS 1A9NB 1D8ZA 2RRBA 1DZ5A 3CC4S 4TLQA 2DNYA 3G8TA 2J0QD 1KOHA 1ZZNA 2LQ5A 3BO3A 2Q79A 2MZSA 2XSFA 2EVZA 2KYXA 2DHGA 2ZJRQ 1JMTA 1X4AA 2MPUA 2CPXA 2N3OA 1WF2A 2LEBA 2MQPA 3US5A 4TU9A 2SXLA 4P6QA 5DDOC 2DH9A 2DGWA 3NNHA 2EK1A 3UCGA 3Q2SC 1R8HA 1WWHA 2MJUA 2FY1A 2XB2D 1X5OA 4OZ0A 2HGNA 5DDPC 4F02A 2XS2A 1FJ7A 3SMZA 1FT8A 2DGVA 5DM6Q 2G4BA 2KH9A 1NJIT 5CYJA 3MUMP 5GVQA 2AD9A 3PIOQ 2CQ0A 1U1QA 1X5PA 1RKJA 4EGLA 2QFJA 2HGMA 3V4MA 1D9AA 2BOPA 4IOAQ 1WI8A 2RNEA 4WFAQ 2WBRA 2YH1A 1KOOA 2MXYA 1DRZA 2QA4S 4QU6A 2CPEA 1IQTA 1BY9A 2DNGA 2DNKA 2LYVA 2OSRA 3D2WA 2MSSA 3L3CA 1VQMS 3UWTA 2YTCA 4QPTA 1L3KA 1Q7YT 5D77A 2RS8A 2AYGA 2X1AA 2VOOA 1FHTA 1VQPS 2E5JA 2M8DB 2DNHA 2CQHA 2LMIA 2CJKA 1YI2S 5EN1A 2BZ2A 2CQ2A 1UFWA 4UY8T 2M2BA 1YTYA 3SDEB 3B4DA 1U1RA 2XNRA 1SJRA 3SXLA 5IM0B 1S79A 2CPHA 2CPYA 1VQ8S 2MGZB 1QM9A 1VC5A 4W92B 1WI6A 1WHWA 2LECA 1VQ4S 2QEXS 1WG5A 1X4BA 1U6BA 2L41A 1U1OA 2PE8A 2DNQA 4Y00A 2F3JA 1SJ3P 1VQLS 2DO0A 3BO4A 1X0FA 1ZH5A 2DH7A 3VALA 3JB9k 1U1LA 2MSTA 2LCWA 2GO9A 3FEXB 3MUVP 4V19X 5FJ4A 2XNQA 2U1AA 2VONA 1FO1A 2DISA 3VF0B 1K9MT 1VQOS 3CCVS 2J8AA 3P5TL 2MQOA 3G6ES 4LIRA 2ZJQQ 1QVFR 2B0GA 1FXLA 2AYMA 3MUTP 5IQQA 5GAGU 2DIUA 1SJ4P 3FEYB 2MKIA 3CCJS 5DDRC 2HYIB 2RVJA 3VAHA 5BJRA 2X1BA 4PKDB 3IWNC 1X5SA 2CPZA 3CCQS 2E44A 3VAMA 2M88A 2OTJS 2DHSA 2KM8B 3ZZYA 4YB1P
chains in the Genus database with same CATH superfamily
2L3MA 5IXUA 3OJUA 1VISA 2XMJA 2L9DA 4JI5J 8ATCB 1BHNA 5IWAJ 4JI0J 1XNRF 1FDNA 2F4VJ 4ZPDA 2GVZB 4DZ6A 5C42A 3O5TB 1X7VA 3HDSA 1IWGA 2ZOGA 4H4KA 4LSZB 2ZD1B 2NUUG 3CCLS 3OFFA 2G2YA 4ED3A 2XMVA 1HI8A 3GR1A 2VFTA 4GC7A 2OPSB 3GJRB 2QIFA 1MROA 4DL5A 2B4UA 2E1MC 5A6WA 4X62F 3D6FB 2IFXA 5L46A 2O67A 2RD5C 2FGCA 5CCMA 4I56A 3QSYB 4HKQA 3IS9A 4ED2A 1M90T 5ETKA 2YNFA 3ILLA 4BWMA 1IKXB 1SI9A 1VRTB 4F4AA 3UCZP 2RRAA 1VOMA 4UTGA 2RDIA 5ITHA 2V9WA 1GX5A 3CCMS 3DHWC 2ALYB 5EGYA 1YG0A 1UWBB 1DBDA 4ERDA 3HLUA 4ZVPB 5AJ3J 2IA6A 2A6MA 3AODA 1T03A 4FP9A 2F9JA 2C3UA 2V69A 3HI9A 3DRSA 2VD3A 3I31A 3J80Y 1MNEA 5HLFA 2XYHB 4F3OA 3KMQA 1N33J 2B7BB 2CWKA 4M95A 3VZHA 1M5KC 2HHHJ 3MOJB 3DU6A 5M2RA 4KGZB 3G87A 2MKHA 4FS1A 4DQSA 1XBWA 4K2XA 4KC5A 4NCGA 1ZM2A 4J5OA 3KLGB 3NCPA 3B8HA 4YEAA 4B08A 4DSJA 4J90A 4IH6A 1RCOB 2B8PA 3KJVA 1NK5A 2AHOB 1RT6B 3DLEA 3MECB 3EX7B 2F8MA 1FESA 2AP6A 2PMHA 2WVFA 3G8QA 4P72A 1L3SA 3J81Y 4QR2A 1C1CA 1N32F 2UUCJ 4WPAA 3KHLA 3QWPA 2HNYA 5CCLA 1HI1A 2G1DA 3W60A 1XTZA 1HWJA 1FNMA 2GMJA 2M7SA 4ZN1A 1TELA 1J5EF 2KU7A 2HHUA 2NR0A 2OPRB 4KIAA 4RW4A 3TAMB 1EB0A 1JKHA 1KONA 3M8WA 1B4SA 3GSIA 1RWPB 4M5DA 4NRUA 4J9LA 1P8GA 1GXUA 1IKVA 1FTRA 1S6OA 2J76E 2KI2A 2LDYA 4N8OA 1NHKL 3TX0A 3PYFA 3HT3A 3BJYA 2L9WA 5CD4A 4K0KJ 2IBKA 4NLDA 5DG8A 2LA6A 3CJKB 4CLPA 2Y9HA 2XY7A 4K4ZA 2Y1JA 3HKWA 3PYGA 4IQMA 3H8YA 5KFTA 4MKBA 4LRCA 3VCDA 1FJEB 2DNNA 2W24A 5KFPA 2V8VA 2VH7A 3I56S 3HHLC 1M5SA 2VDHA 4QIWD 5BR8F 1XNQJ 2H48B 2JNJA 5LM7E 3GCXP 4LF4F 4ZPWR 1BQNA 4HHJA 2ASLA 3B54A 4X65J 3R6GB 2XMTA 3SFGA 2K1RB 1PYSB 2MY7A 2ZBRA 2OGUA 5DM7Q 2QE5A 4G1IA 3N9UC 1U26A 1EETA 4OYZA 3C2PA 4DPXA 3MPUB 3DI6B 5IC4B 3KLIB 4Y34A 1N33F 1NDPA 3JTPA 4WZMA 2PT0A 2DGTA 1GTHA 5D4LA 3RJMB 4QYRA 4AXJA 3M30B 3AXKA 2Z8QA 3KUHA 1U6BA 2M52A 3HCXA 1HWIA 2R2RA 4B9NA 3POTA 1HHQA 3R5DA 4RWWA 3N5FA 2PDAA 1TL4A 1X4HA 3D9BA 3MM5A 3Q8RB 3FFIA 2F8HA 1YBTA 2VPWB 2JFKA 4BDPA 4LF5F 2V68A 2XHWA 4RNFA 4UOGA 4L76A 2R8IA 1UP1A 2E5HA 4TVAB 4ES3A 4FPIA 2BXJA 5AE1A 4EYHB 4DDFA 2GCFA 3SZ2A 2Y1IA 3QSIA 2LXIA 4JI6F 4RNMA 3DKDA 3ZNJ1 2JRSA 1NJYA 1MW7A 1C4AA 1NK6A 4NA2A 3OD2A 3A4TA 2KG1A 4JI0F 4HHUA 5IWAF 2ZH3A 1HBOA 2E5IA 1BQNB 3DLHA 3K58A 4MYUA 4PG4A 3EXYA 5IM0A 4DV6J 1TKTA 2HPUA 2AX1A 1T02A 3UN3A 3ZTQA 5F9LA 4X62J 1GNKA 4U6PA 1TL1B 3GONA 1M1GA 3TVKA 1SC6A 3NWGA 4DF4A 2V94A 1H3DA 1MMLA 1QY7A 2RSQA 4QOTA 1TKDA 1KNZA 1S5ZA 2JHEA 1GH8A 2IMOA 2U2FA 4D3HA 2AKWB 5F8HA 2KKHA 4ID5B 4DL4A 3NAIA 2J5AA 5U47A 1NCLA 3HSDA 1TFWA 1UWBA 2H54B 5L38A 1FRLA 2GW8A 3X1LB 3HMJG 2DVIA 5FD1A 1AZSA 4JV2A 1P6TA 4OX7A 2DKOB 1RAAB 4UW2A 3TO8A 1SV5A 3KTQA 4ZP9A 1IUJA 2FJXA 8RUCA 1QAJA 3I4PA 4ZLJA 5F8IA 4Q8FA 1YSJA 3DLGB 6FDRA 4FF2A 4ED0A 2HSEB 1RDRA 4DV4J 1VJWA 2A2CA 4ZCIA 4OYMA 1PILA 1VMBA 1WELA 2QMWA 2A1BA 2RKIB 3IM9A 4YN3B 3RU0A 2N7CA 1N52B 3PW0A 2DH8A 3JSYA 4AL5A 1TQLA 1VRQC 1ITPA 3ETMA 4JV5J 2V2QA 3EDQB 1S6PA 4ZLPA 2HZAA 3GIRA 4Q2MA 3QBCA 2AJFE 4P2SA 5KAKA 3VR1A 3GIKA 2LQ9A 2HNYB 2R4FA 4J9QA 3GFZA 1KN6A 2GAGC 1UVNA 3BQ0A 2FJVA 3QQCD 1R0CB 4JI8F 2OMLA 2J6UA 3G96A 2HKEA 2I2YA 3THPA 2XC9A 3HZEA 3EWGA 4ZVHA 5L39A 1N34J 1FEEA 3DU5A 4URGA 1TVRA 4I6WA 1YZ7A 3KLEA 1NO8A 2FJBB 1CULA 2KT2A 3IG1B 3M2RA 5ETOA 2OSQA 3ZZUA 4ED6A 4OYWA 3OJSA 3AAWB 3NNCA 2ZNYA 2GJIA 5K14A 1RUSA 1AZSB 2JJ4D 1J27A 2POKA 4NASA 1FEHA 4OLPA 1C0TA 4HDGA 1KHWA 3V2UC 5EWEA 2QLFB 3K0JA 2P6SA 1N5QA 1DTQB 3VAJA 1UJ4A 2KYZA 4WP3A 2BKNA 1U2CA 2ZBIA 3ULHA 4A4JA 4C6AA 2HVZA 2DGXA 1W2BR 3D68A 1HNXF 3OL9A 4K50A 3HX9A 3UI3A 2R8HA 5GMKa 3MFIA 1TU0B 4DX8H 4C0OC 4XPEA 4JI4J 1V9OA 3AQOA 4J9OA 4N7TA 5DETA 4M5HA 2CNNB 2DR9A 3QGHA 2C2OB 2KHDA 2KFNA 1RWWB 3I0RA 3SSQA 4RNNA 1J5OA 2LXFA 2VQFJ 1BUXA 1F60B 3MD1A 2PA3A 4ZVOB 4IG0A 2XULA 5F8NA 1Y7PA 3FCVA 4QWDA 1F0XA 3V4IB 3CO0P 2LEAA 2M8HA 3K5OA 4DL2A 3DXSX 5HMZA 2HG4A 1CJTA 1VQ9S 3GR0A 1T95A 4FF3A 1RT7B 1RAEB 3W65A 3RR8A 3L9ZA 4BC9A 1YITS 2UZAA 1WHYA 2V4JB 5DG7A 1FF2A 2E7XA 4I1TA 4CLSA 4C8YA 4DV1J 2G2ZA 4Y6IA 1UEUA 5K14B 1GMVA 3SV3A 4R5PB 3P49B 2AJ1A 3AOAA 3BEGB 4AQYJ 2UXBJ 1NSAA 1EHWA 2RE1A 3DRYA 1X60A 2IAJA 3RR7A 2NSCA 1CVJA 3K5NA 2NUHA 1DTQA 2UXCF 1JLBB 1UVKA 1XC9A 4WP9A 1W7WA 1QVGR 2D3ZA 1Q4RA 1VRUA 3TZXA 1FKPA 1TL7A 2LDIA 4MK8A 4ES1A 4ZITA 4DL7A 4I67A 3H25A 2KHCA 1LWXA 2RH3A 1EP4A 1AT1B 4ZIWA 1R3NA 3NGDA 1RT1A 2EC2A 4O23A 3GLJA 2RUGA 2RU3A 1C2PA 1IBCB 1X4DA 3FJ2A 4H4MB 4RBVA 4MAKA 4UQGA 4QIFA 1Q53A 5B0BA 5HO4A 4YOEA 1WHXA 2LLZA 3HFZB 4JYAF 1X4GA 3B6BA 3OT9A 2XLJA 3V81B 4NYOA 4TQSA 4P7VA 2MZQA 2BE2B 1GXTA 4LT6A 4NOHA 4RPFA 4Q0BA 1LKZA 2VUGA 4WF9Q 3FCHA 3QAEA 2FHMA 3DLKB 1SJ1A 3M8PA 3RB6A 3KMSA 2XS7A 1PAUB 5BYSA 3DOLA 1TK5A 2C3MA 3W2VB 1TKXB 3J81U 2BJEA 4PEOA 2R7QA 2XMAA 3CMAS 1VC0A 3D5MA 1BMQB 4RR5A 5D3GA 4NA1A 4AFFA 3KNAA 5F0WA 2P5VA 3GV8B 2NREA 2WVDA 4HHHA 3KK1A 2ZHAA 2K3KA 2YKMA 1RWMB 4YB1P 4RKUC 2FVRA 5LSLA 4OHYA 1NEEA 4QIGA 3H90A 2BJ7A 2HQ3A 3GYXB 5EUHA 1VGYA 2FGOA 2MKSA 3PRDA 1N56A 2NQPA 4HT7A 4RW4B 4LJMA 2B9YA 5B0EA 3ZZOA 2HGLA 1JLAB 5IFMA 4JI8J 1XR6A 1YQHA 2D9OA 2G1HA 5I3UB 2KXNB 4IDKA 5H9FJ 1RTDA 2HFUA 3BGUA 3HVWA 4ZMMA 2PD1A 3AFGA 3IRXA 5J1EA 2RQCA 1ZYQA 3IXQA 1WTFA 1TV6B 3HVTB 4LRAA 2OI2A 3BN4A 4FVMA 4DU8A 2VASA 3JSRA 1VS3A 1YZ6A 3KG1A 2MYFA 3AT1B 4ICLA 3OL8A 4KR0B 4QW9A 5C2CA 5LOQA 3OL7A 4FS2A 4BS2A 1CEZA 2W7PA 3PIPQ 4U7UK 3W8GA 2AGPA 1RTHB 3BBBA 2IVYA 2F7VA 2HQIA 1CJVB 3BDEA 2MKCA 2XZWA 2QC3A 2ZH2A 1F3FA 4YY3J 3W64A 5E3QA 2J0XA 2MZRA 4DPYA 4DV4F 1KSPA 1PJ7A 2DIVA 2YWKA 3GB0A 4ED8A 2QN6B 3QGPA 1N5TA 4IFVA 3MM7A 3M4XA 4WP8A 5KG1A 3MCMA 4DPUA 4EEYA 2AGQA 2HBRB 3MPYA 5B0DA 3ITHB 1D8ZA 2EFGA 1VQKS 2VC0A 2CZ4A 4KH0B 1NDLA 1SC1B 4B3SJ 2VA2A 4WYLA 2DNYA 3TWZA 2J0QD 3E8OA 2YWHA 2IM2A 4X4OA 4IKAA 2HVEA 3GE9A 3THVA 2ASDA 1GTEA 1AROP 1TZ0A 2Q79A 3I0RB 4HT5A 3DLJA 1J5OB 2HHXA 1MG7A 3D1HA 5IT9Y 3CJ0A 5DJBA 2EVZA 2R2TA 3SEOA 1FKAF 3L7OA 2R8JA 3IA0A 5BXIA 5ETSA 2DHGA 3I82A 2MLZA 1GMWD 3UVJB 2LEBA 3FNNA 2RDJA 2NCKL 3K8VA 3US5A 4TU9A 3FVYA 2OH2A 4P6QA 1NZAA 2DH9A 3LALA 5A2QU 1NSKL 1PSDA 1E6YA 3C66A 3Q2SC 2R7TA 4LRDA 3I5CA 1LV5A 1ZETA 2XZTB 2XB2D 2VL1A 3CDWA 1IR0A 1ZS6A 2VKRA 2HGNA 2ILYA 2QYCA 3CIMA 1Q8KA 3I5BA 3MCSA 4ZPCA 3TA1A 7AT1B 4WTOB 4BBYA 1RHJB 5DM6Q 2H5IB 2JEIA 3BH6B 2PC6A 2GAHC 1NJIT 5CYJA 3MUMP 5GVQA 1HBUB 1TL1A 1YJRA 1U02A 2EG2A 3EM1A 1C1BB 4LFAJ 1MU2B 3WX8A 1PG5B 4QIEA 4EZ6A 2ZE2B 3KK3B 2WTFA 2V9KA 1RKJA 5HMWA 2W9AA 4W98A 3DOMA 1RXOB 3GG1A 2QFJA 4USMA 1QSSA 1NSQA 1S7HA 5JXSA 5AXNA 1CS4A 3KHGA 1RU1A 2W2NP 3MAQA 1M1HA 2YNIA 3PJWA 4TY9A 4RW9A 2DCLA 2I0XA 1D1UA 3LP2A 3WIVA 4EO8A 4KHRA 5IT0A 4ZCKA 5KFOA 2R9LA 3FMBA 1HFEL 3L7PA 1OJ4A 4E2FB 4B9TA 1SV5B 4TY8A 1BY9A 2B3TB 2DNGA 2GNKA 2W9CA 1HYSA 2ZUAA 2XLKA 1IKWA 4KGVB 3MR3A 2IJRA 2KFZA 2YTCA 2W8KA 4DQRA 3PJXA 2EG1A 2XWYA 3FRYA 3IMQJ 4N76A 4ELVA 2RF2B 4G1PA 2VOOA 4X2BA 3SCJE 1X31C 2B56A 4LF4J 2M8DB 5DS7A 5EN1A 3BPDA 1MWZA 3Q24A 2BZ2A 3CMQA 5KOXA 5EWFA 5HROA 1LW0A 2FIUA 3C14A 4DCPB 4CH7A 3MM6B 3B4DA 4UY85 4EU0A 2RHSB 1U1RA 2AEMA 1S6UA 2IJFA 3ZNUA 1F6TA 4CTAA 3NL0A 3SXLA 5C24B 1R7IA 3OTEA 4RBTA 1VLOA 2GIQA 5K8OA 2I5JB 1NH8A 1NLKL 2IC3A 5DO2A 3M9MB 2ZH6A 2XG8A 2E1AA 1XJWB 1RHRB 3NAHA 4W4MA 4EO6A 4HLBA 4YDDB 5CZXA 4IFYA 2UUWA 3AJDA 1B99A 3QGIA 4W92B 1MSWD 1HIYA 1FX4A 1WKLA 2QEXS 4OX8A 2OPQB 2YX4A 2LFVA 3MMJA 1X9WA 1KVIA 1S99A 2K2PA 4MK9A 1H0HB 1MMDA 3CJRA 4LSLB 4HH0A 2L41A 2R8KA 1FFGB 1V3RA 1U1OA 1NZ8A 4S0MA 4Y00A 1RAIB 5T7LA 2MLYA 3IR5B 3C46A 3OBIA 5DZ7A 1HBOB 1VQLS 4DX5A 2DO0A 1UKUA 3DMJA 3MM8B 4ECRA 4TKTA 4DG1B 4B9VA 3I9ZA 5KFJA 1QD1A 2DH7A 1VFJA 3HXMA 1Z4UA 3C19A 2FDNA 3OR1A 4OYAA 4B9LA 1RP5A 2GO9A 3MUVP 4V19X 2HQCA 2FHKA 5FJ4A 1N32J 1TMMA 1Y5LB 4J9MA 2U1AA 1DY3A 5AJ3F 2AJQA 1E6VA 3MEDA 1S1VB 4O4GB 4CO3A 4ZN3A 4RX6A 1U8WA 2FZKB 2OMOA 2VPZB 1KP6A 1I1GA 5E3CA 4MK7A 2W2QP 4LIRA 1O51A 2UUBF 3PRVA 2FQQB 3W5XA 1FXLA 2NPFA 2VFVA 4DS5A 2DIUA 3MTKA 2MKIA 3KLFB 2YX1A 2ZDPA 4RU9A 4RW8A 2F5GA 2YXLA 2ZC4A 1QAIA 3IWNC 1PYTA 4L3NA 2C2RA 1NHVA 2E44A 3C3LA 1RAGB 2M88A 2PMZD 1F5CA 4ZDNA 3D6HB 2ZZTA 3BGRB 3ZTSA 1KLNA 2C3YA 4F2SA 2E1RA 2E5LF 1FRKA 1S9GB 3ISND 3OR2A 4Y3CA 3OHBA 1Y11A 2J8SA 3VVUA 1KVJA 3R97A 1SJFA 5HVFA 3BF4A 1AUSL 4J9VA 2DR5A 4JI5F 5GAEI 5HQ8A 5HAOA 3LTOA 3RW6A 4USKA 5H9FK 3SCIE 3QZ8A 3VGUA 1RU2A 2HWTA 2GIFA 2A3JA 3GG0A 2XY5A 2R7OA 5A8KA 4DPTA 1N36J 1EIYB 1JLEB 1UW9A 2B43A 4I0WA 4LFAF 4ZPTR 1YWXA 3H5XA 3C6UA 1G3OA 1UVJA 2EFNA 2ZE2A 3KK3A 4NCBA 1JJ4A 4I64A 3DRPB 1E6VB 2N3LA 3MEDB 3I4HX 1AB8A 2IVMA 2WOMB 1VIOA 1AYEA 1TVRB 4PQUB 3HF5A 1A0OB 3FZ2A 2BABA 3G71S 4XDCA 3T1HF 3IN5A 3U1MA 4IUFA 1LWFB 4P71A 4OI0A 3JSMA 1JJHA 3LP2B 5JJBA 2BQUA 2A6OA 2AQ4A 2HS4A 4FYVB 1QUVA 2Q43A 4Q2LA 4DR1F 3V6JA 1AUDA 1WF0A 3DRSB 1RAJA 2B6AA 1V6HA 5ETPA 1FE0A 1L3TA 2CQCA 3IM8A 4G1QA 3LGHA 4DN0A 5KFMA 4C0HA 4C4WA 3OTOF 1FRJA 2DNRA 3BDPA 1KRPA 2YKAA 3T41A 1RYSA 2J6SA 1WG1A 2BW2A 1U1MA 3GFXA 4K2JA 3TX8A 1AW0A 2DPIA 4ZVUB 3LQVA 4UOCA 5D0EA 4RW6A 2W25A 4IH7A 3W61A 1SPBP 5AE3A 3AJ1A 3KLHB 2YWFA 5ETNA 3DLEB 3MECA 2EBEA 2BM0A 1JNRB 1VIXA 4NLWA 5HQMA 3KK1B 4C8KA 1SUQA 3BM7A 3RB4A 4LF6J 4WCEQ 2OO4A 1JJCB 2LQJA 1O5JA 5I42A 2OD4A 4QCLA 2BQ3A 1FDDA 1RCXB 3PKMA 3DFEA 1QTNB 3O44A 4JB8B 2XSJB 5J2NA 4DR2F 1S0MA 3CNQP 1JKHB 4OI3A 1I5OB 4OI4A 4DEZA 1NB2A 4IDKB 5B0FA 1T94A 3MAHA 3K57A 4NI2B 3DRPA 2ZH7A 2WZ1A 4HL9A 4WXWA 4WIQA 1UZDA 1WC4A 2R42A 4JV1A 3OLBA 2HK2A 3W3SA 2K8GA 3P8BB 1DFDA 3EVMA 1RB0A 4NPOA 4LQ9A 2KTQA 2G0CA 1S1UB 3JSMB 2ABYA 4CM0A 4RU2A 4CIOA 2HFSA 1CJVA 3CCSS 3C16A 1HKAA 1WEYA 4YB6A 5L8RC 3MPDA 4DFMA 4LF6F 1P1TA 2IAJB 1RT3A 2WB1D 2ZWPA 4NE9C 4Y2AA 3FBFA 4DR7F 5IT9U 3MMBA 4BWJA 4DUZF 4JI3F 4YHHF 5B0GA 2WSEC 1UAWA 2D9PA 1TL7B 1LQ9A 2IDLA 4PXDA 3RRKA 4J7CA 3CJ4A 3FBEA 3H42A 3RW7A 4ZP7A 2DNMA 1U09A 3OHAA 2RMLA 1NHUA 3CCUS 3M30A 1BWEA 2CJYB 4U9RA 4Z2XA 1LWCA 1RI7A 3HHEA 2XCAA 2CJQA 2BE7D 1S0VA 3H20A 1DJ0A 3VGVA 2BANB 1RISA 2HHVA 4FVCA 4NMXA 2CQ1A 3FKBA 3F0NA 1ACMB 1FDAA 4ID8A 4ECSA 4NI2A 3AQPA 3NBPB 1SQFA 4C8MA 3PR4A 2DY9A 1IBLJ 1D3WA 4Q0BB 3EICA 4JYAJ 4PPZA 5BYRA 2DGOA 3DLKA 4CH1A 5HBMB 2NLWA 5LL6d 2AJ0A 2BJ3A 1HW8A 4IRDA 4CDIA 2DHXA 2GVZA 2RQMA 4NYPA 5D4OA 5IZHA 3R5GA 3IGNA 2EKNA 2A10A 1YJUA 4U8VA 3M8YA 3HULA 2XQCA 2IA0A 2W9BA 1MROB 3UNYA 5A8KB 3PACA 4OI1A 4ZKAA 3TJ9A 2KFYA 2MKKA 4DS4A 1C1BA 2CVEA 3ZZPA 2V34A 2W7OA 4K4TA 1NK4A 2EK6A 2HLTA 1Q81T 2HHTA 4U67Q 3CCRS 1A7GE 3EVWA 3VV2B 5HMXA 1I94J 3QJLA 4URSA 2DO4A 5L1LA 2ZOMA 1TV6A 1M5HA 4FYWB 4IRKA 4DR4J 2HK3A 4B3OA 3UDLA 4CYUB 2JLGA 2NXJA 3I55S 1VC6A 1JLGA 2H5EA 3GIIA 3HKZD 1KFSA 1D9DA 2XY6A 3I87A 1MMNA 4ED4A 4YB7A 1FE4A 4TY8B 2VPYB 3TUIC 2ZKTA 4YB5A 4LVOP 1HYSB 3UQSA 5KFCA 2LQBA 1FJCA 3N6MA 1VLYA 2GVDB 2OHDA 3AA9A 3ZFVA 1B3TA 1NSPA 3TUJC 2ROGA 4P73A 4B3RJ 3S6EA 3IRWP 4DFKA 2QYGA 2JEJA 1V3ZA 5JVHQ 2AIRB 4RW7A 3CWJA 4D3GA 2RAQA 5KFRA 4DBQA 2I38A 1NM2A 2VBYA 1H72C 2LP4A 3BKUA 3Q8PB 2DR6A 1LW0B 3C14B 1T9VA 4JI4F 3HJFA 1H2UX 5KFQA 2VIHA 2OLWA 1WDDA 1UMJA 4UUWA 2YBVA 2YPZA 3PYDA 2DBBA 3UO0A 3JAMY 5I3QA 2ZUGA 2G13A 3M2UB 2CAJA 4MFBA 4A8WA 2DR8A 4KV8B 3LGMA 1VBXA 1SKWA 2MB0B 1XNRJ 4WYWA 1J2VA 2Z2YB 5B0AA 1HD1A 4KYZA 4M5DB 1RGVA 2X51A 2DEJA 4Q45A 1KLMB 1P27B 3GV5B 1PBUA 3HM9A 2VBWA 3D28A 1CQMA 2IHR1 2ZDOA 3H4BA 1FWKA 4DSFA 5A76A 1U0SA 2ZEJA 3FGVA 4ZVTB 1SH3A 5D6GA 2FYXA 2UVVA 2QLXA 4WU2A 4AL7A 1IM6A 2VFUA 3M32B 4M1KA 3KDNA 3H2UB 1MWQA 4R0EA 4F4KA 3D7SB 4ENOA 1IBKF 1BD6A 1S1UA 2R2SA 1ZA2B 1VQ7S 4J9SA 1P9QC 5K8PA 1WTBA 4OYOA 4X64J 1EKRA 1HQEA 4A48A 1RT3B 3CD6S 1UFLA 3CDEA 3MMAB 2OPSA 4ILMA 1FD8A 1CJKA 1F2HA 4B3RF 2XEXA 4QWEA 4YMEA 3PYEA 1YJ9S 3OR1B 3CD7A 4PXCA 2OTLS 1P1LA 2W4PA 1MU2A 4WKRA 3B4MA 1X4FA 4FKXA 4ANCA 4ED5A 1JNZB 4CO5A 1U7LA 1HBNB 4WFYA 2V2ZA 1VRTA 2LU2A 2VG6B 1HPZA 3CJQA 4X4PA 2GHPA 3DCAA 1HLWA 2YNIB 2D3O1 2GMLA 2IRUA 1IBMJ 2VA3A 4FZVA 3ILOA 1VK3A 1HHTP 2HBZB 1VBYA 4DR4F 5KFKA 3KLFA 3NMAA 4P10A 4A46A 3DHXA 1RHKB 4NZ6A 2UU9F 1R31A 1SH2A 1GXLA 4UOFA 1DHMA 1S6QA 3U02A 3OTOJ 1TR0A 4FXVA 1RT4A 4O3OA 9ATCB 3V4IA 4TU7A 1AFJA 5F8MA 4O3NA 2NXCA 2CQBA 3ET6A 1SC3B 1XQIA 1DARA 3C6TA 3GJSB 3PDNA 2V50A 1KQFB 4C3KA 3C8YA 1RWKB 2ERRA 1HR0F 2E9TA 4ZLNA 1G7CB 2M3DA 1S9GA 3M32A 4CO4A 5MAOA 5KFHA 2KO1A 4C2MA 1RLDA 4OZLA 3HPOA 4F4ZA 4ZOSA 2H4WB 5L9NA 4LF8J 2J0WA 3EGNA 2C22A 4K4UA 4F4YA 2DXFA 3A1YG 2C28A 5LMNF 1RT5B 3KK2B 3G2XA 4GVBB 1NPRA 3TZZA 1BLUA 2ZC3A 4YS2A 4OJHA 3CDUA 2WK4A 1IBLF 3J7YU 1CQNA 2DNPA 2Z2ZA 3CIZA 3FSYA 3D1QA 3QAUA 4UQTA 2O1PA 3C6UB 3L09A 3RGIA 1IXKA 1SQGA 2DHAA 1RTIB 3IR6B 4IO1A 3H0PA 5H1SV 4DV6F 1H7XA 2G0IA 3M8QA 1GT8A 4LIWA 4C48A 5K8NA 1HNZF 2MQ8A 4WFZA 4LFBF 4DFPA 5KG0A 2WOMA 2ZWOA 1TL3A 1SIZA 5LT5A 3AJ2A 3L4BC 3BSCA 2QLJB 3PNIA 4OLOA 4FN5A 5E33A 3UCUP 4CLTA 3PO4A 3MXHP 1JLGB 3ONQA 1X0PA 1VHIA 2MQLA 4L75A 4XIUA 1TL5A 1FFSB 2QO3A 2B6AB 3EVOA 4ZVGA 4ZVSB 3W5ZA 4QR1A 4LF5J 2W1BA 3OW2R 4YR0A 4EBCA 3T3FA 3QIDA 4RNOA 4ECYA 1QAYA 1OO0B 1Q8LA 2GVDA 4KJIA 1EZZB 4NLTA 1LNQA 3MDFA 3K8WA 4JI2J 4B17A 3IGVA 5DQGA 3GTYX 2HBQB 1TKXA 3K89A 4XK8C 3TEHB 2UUBJ 3QZ7A 4L73A 1OWXA 3M8ZA 3NEKA 2HQDA 4O4GA 1M5OC 3H5YA 3KKFA 3L7UA 4DQPA 2W01A 1FX2A 2LA4A 2VV5A 1FFWB 1N0UA 3N0VA 4LQ3A 3NRBA 5HN0A 4ECVA 1RA7A 5J2QB 5LSOA 5J2NB 1RBOB 1S10A 1YBAA 3N79A 1JLAA 1REVA 1U0HA 2ZBPA 5KT5A 4DR2J 4F8RA 7FDRA 2KRRA 3MFHA 1HD0A 1VJQA 2I1RA 3T5HA 3HVTA 1XNQF 3UR0A 2YPYA 5BR8J 1JLQA 3S01A 5DDQC 1WSVA 2P8IA 1YRUA 2DNLA 2YNGA 4LR7A 4USUA 5KFBA 4UZBA 4GKJJ 1WACA 4ELTA 4U7UD 3W5YA 3PCOB 1RWUA 4ZA1A 2ACYA 2CQGA 3VAFA 3J7YI 4K0KF 1CG2A 3CGIA 5GADI 2GQ2A 4C98A 5BYQA 1OY8A 4Q5VA 1FVSA 4IOCQ 1JX4A 3MMAA 2JWNA 3MM9B 3NWRA 2X3GA 3E2EA 3ISNC 3SV4A 3PW4A 3M6UA 1S72S 4IFVB 3NNAA 1U24A 1F2GA 2VFRA 1Q5YA 1XR5A 1UJ6A 1YHQS 2A2DA 3FBBA 4PR6A 3FRZA 4ES2A 2BOAA 1A9NB 4QIVA 2RRBA 5D4PA 2HURA 4N8NA 1DZ5A 3IBWA 5DQHA 3GIMA 3CC4S 3T1HJ 4JUZA 4NEZA 4OV1A 4JOUA 1JXEA 2KJVA 4BLGA 3M8RA 1TUVA 3T1YF 1U47A 2UVUA 3EXCX 2BVZA 5ETMA 3EUNA 2CJ9A 2B8QA 4NLUA 1T9WA 4OL8A 1OPZA 4YQWA 3D66A 4IG0B 4M5MA 3LP1B 2QMUB 4FPRA 4BHQA 4JI1F 1X4AA 2ZNZA 2CPXA 2N3OA 2VHGA 1ZM3A 1Y4ZB 2CZVC 2L48A 1Y10A 1DTTB 2DD8S 3DLGA 4NWBA 4HACA 4DQIA 5CYMB 3NNHA 5ADZA 1S4EA 1T9YA 1ULRA 3UCGA 4CO2A 5KTQA 1E6YB 1HW9A 1R8HA 3LAMA 1WWHA 2Y0BB 2J9CA 2EXUA 4R5PA 4ZJOA 2FY1A 1X5OA 2FZGB 1DQ9A 3JYTA 1FWLA 1SUQB 4C8LA 1RABB 2VB6A 1S0NA 4O3PA 1FT8A 3MM9A 3ZZTA 2G4BA 1S9EB 2LEPA 3C15A 4DR5J 4F2RA 1I51B 5L9XA 2AD9A 2VQEJ 1VHFA 2CQ0A 2FLOA 3PIOQ 1U1QA 1X5PA 5J1NA 4ZP6A 2ALZA 1Q79A 4N5SA 1SL1A 1R8AA 1Y5IB 3KUGA 4DCOB 2BOPA 3T1YJ 4IOAQ 3A3NB 4DV3F 2WBRA 2CNKB 4H4MA 2EPIA 1KOOA 5A6PA 4YFUA 2NS1B 2CXEA 5LMUF 3T5JA 4ZJQA 2YH1A 2BV3A 2C1EB 4USVA 4QU6A 4HDHA 2CPEA 1SVDA 1CSJA 4KO0A 2ZBCA 4M5NA 5HJXA 4OHZA 7FD1A 2W9CB 2ZH8A 1RWOB 1T05A 3GILA 4KGKA 3A3PB 5I3PA 1DTTA 2D7SA 3ELHA 3LW5C 3DM2A 5B7WA 5HJYA 2V8PA 5D77A 2MLXA 2OD6A 2RS8A 2AYGA 4RW7B 3NGUA 2KJWA 3DNCA 3DOLB 3KNGA 4KPCA 1NAQA 3SI8A 1VQPS 2IY5B 3G6XA 3IR7B 1NKCA 2DNHA 2CJKA 5D3GB 2N4DA 4Q7AA 4PG8A 2H4YB 1YI2S 1BC6A 2D69A 3ZZYA 2XO6A 2ZD1A 3LANA 4M5JA 1LK7A 4KPYA 4LF7J 4M63A 2XNRA 4R8UA 4CTAB 3AD7C 3Q8UA 2CDRB 1S79A 2CJAA 2FHJD 3ZXWA 1VQ8S 2X7IA 1D8YA 2B5JB 5I3UA 1RTDB 3RAMA 1REVB 2C2EA 1FRMA 1GK8A 1PC4A 1HHSA 3IRXB 3EJMA 2HFZA 1QJHA 1UFKA 2AZ1A 3OPKA 1BE4A 1LFPA 1RT7A 1F9EB 1EKSA 1WG5A 3HHLB 4ECQA 4DSKA 4N56A 3DRRA 5EHHA 1XMBA 2K06A 3M7VA 1FI4A 3F44A 4NX9A 4C3LA 3ZTPA 3CCWA 4DL6A 1L5UA 2MDAA 1KQKA 2QA2A 4CLWA 5HLFB 3Q8VA 3Q8YA 4DR3F 2PFFB 4JI2F 4ZPBA 4E98A 3BO4A 3MPWA 1XK8A 3K5PA 4PXEA 1X0FA 3SIPB 4DF8A 4X4TA 5D0RA 4RUAA 5ETQA 1U1LA 4Q44A 2MSTA 2LCWA 3FZBA 3AD8C 1IQZA 4L74A 3TJ8A 3FEXB 3WX4A 4EUVA 1K1SA 3VVTA 3MEEA 4P2XA 4USIA 5AT1B 3SFUA 3R2DJ 4CO0A 3RB0A 4DN9A 2Z58B 2VONA 1D9FA 2DISA 5C5JA 4NZ0A 3ZZ0A 1S1VA 1VQOS 2V4QA 3A13A 3HVAA 1TK8A 3LPEA 2ZH5A 2BJ1A 1QVFR 4R8UB 1SBRA 4WTYA 4NXMJ 3B82A 2HFOA 1TAQA 4DSLA 4ILLA 3IWLA 2MKYA 2HHWA 2ZM6J 2QZ8A 1SJ4P 5F8JA 3CCJS 5KFZA 1ZAVA 5DDRC 2C2MB 3M1VA 4QZVB 1S6QB 2DEIA 2VG5A 2F63A 5C2GA 2X1BA 4PKDB 4ANDA 3V81A 3D0IE 3UVJA 2E9ZA 4O44B 5SUHA 2GQQA 1SKSA 3GFHA 2DHSA 1RWVB 5HVGA 2O01C 3LWMA 2PSZA 5HSPA 3ZTRA 4M94A 2DJWA 5LMNJ 3GZ7A 2XBPA 3W2VA 4ALZA 3T5KA 4OZ5A 2YY3A 3EYZA 2FC9A 2VZ9A 4OZJA 1PGZA 3MHYA 1S1WB 2GGPA 4ED7A 4EI2A 2PEHA 4P7TA 3LO3A 2YX7A 4ILRA 1O0PA 3LWLA 2OEMA 2FZCB 1B0PA 3PRBA 4RUCA 3TI0A 1PBAA 4DCJB 1HBUA 2FVCA 3EE3A 6FD1A 1U1KA 4DLGA 3GFYA 2CVIA 3MZIA 2BUNA 5GADU 2W7AA 3DYAB 3W9JA 1CC8A 2VPXB 3QRPA 1KR4A 3WHIA 4IOBA 5LJ3Y 5CA5A 2G2OA 1NXIA 2PN6A 4V1Ak 3BYPA 4U8YA 2K3IA 2MMYA 2VBXA 3FQLA 3HT0A 4ETZA 3PVXA 4NLQA 2K7JA 1WSRA 5IOLA 1B7YB 4Y65A 4DV0F 2VICA 1YRTA 4CLFA 2IJNA 2CFXA 3F73A 3NMRA 2IYGA 2Z56B 1A6LA 1EQMA 1FXDA 2UUTA 4FXWA 1VQ5S 2MZJA 1HQEB 2P9CA 3FSXA 4O44A 3DDKA 1AXQA 2DRDA 2HZCA 1FK9B 2FTRA 4C11B 3BO2A 4J9UE 3BN7A 1Q5VA 3MEGA 3J81j 1HNWF 1S57A 1KBRA 1F9HA 2KG0A 3ITHA 5B08A 1T3OA 3BYRA 5HROB 2GS8A 2NXUA 3KLVA 4F4WA 2GGPB 2E7WA 4I69A 1NUEA 3WDOA 5JVGQ 1PC5A 1XWLA 2JLFA 3ENWA 3P45B 4CNZA 3OVSA 5HP1B 1X4EA 4PWDA 1HQUA 1UWAA 2RILA 2XHCA 2Y0SD 2QJ3A 3BSNA 1JLCB 3DOKB 3JTNA 4QQBA 5CXTA 1S1XA 1KD1T 1HBMB 2HIYA 2HNZB 2CJXB 1HQ2A 1KQGB 2Q6BA 3GYGA 3KFWX 2HQGA 4I4BA 1XR7A 3I5AA 5FDLA 5J2PB 3OXFA 1IQTA 3M2VA 2AYEA 1IKYA 5HK4A 5KFIA 1XIQA 4ID5A 4EMDA 1D09B 3D3CJ 3MR2A 2J7UA 5L1IA 3MAAB 4IRCA 5LXYA 1QDUB 1URNA 3WZ0A 1RTZA 3IFEA 4DR6F 4TLRA 1OIAA 2LVWA 4O0IA 3O3LA 1FNOA 3TANA 2Q6CA 2ROEA 4NLPA 4USHA 4CNYA 1LXJA 1N34F 2JVOA 5EX3A 3HFKA 4NLYA 4PUOA 2V6AA 1OSCA 3FSIA 2FJEB 3W62A 4X4NA 3PW7A 4USTA 1S0OA 1RK8A 1UZHA 2RUSA 4YUDA 2ZITA 4OYPA 3VGTA 2NXNA 2AZ3A 2HVHA 3IBFB 2PEBA 3GJTB 3HJVA 2EEYA 3TQ1A 3RAQA 2DPJA 2Y8YA 3DOMB 1WD6A 4DV0J 1IKXA 2JVRA 3QRQA 3CCES 2YWWA 1TL3B 3W63A 2W4DA 3OFEA 4J9RA 4TU8A 1XMOJ 4I2PA 3PEJA 4J9KA 1HNWJ 2XLIA 2BA9A 4WE1B 1Q8BA 2O5DA 4FBTA 4O3QA 2F40A 1JLCA 3THTA 2BANA 4Y2KA 1U1PA 2FC8A 1N5SA 2QGFB 1VQSA 4LF9F 1RWNB 2Q3PA 5KG5A 1KFDA 1F3VA 3TOQA 3VAIA 4QU7A 1IKWB 1S77D 5C25B 3BREA 2UXCJ 2PMWA 4UOHA 1IKYB 3TRGA 2KZZA 1AFIA 5D78A 4LRFA 4KFBA 3PXGa 1RHMB 4URQU 3TAQA 1CULB 3KLGA 4ELUA 1F1BB 2H5JB 1YX2A 5KFLA 4PABA 1R27B 2HIQA 1WUUA 1U1NA 1TTHB 4OI6A 2MHEA 3OLAA 1C0TB 3CVKA 4I7FA 4DX7A 1T7PA 2O3DA 2FUG9 2BW7A 4LFCJ 4PUOB 1T11A 1RHUB 3ENAA 3H7HB 1KQSR 2CPIA 4P75A 2WVEA 2VJVA 3RBEA 3K59A 4IO9Q 4UT4A 3CCZA 5F41A 2OPRA 4NXNF 5LXRA 3PW5A 4J91A 4DMZA 2CQ3A 3M6WA 4XAKA 2B4OA 1Q86T 3PY8A 3FCWA 4K4WA 2NZ4A 1M5PC 1DURA 2B51A 3GSDA 3GP9A 2M9KA 4XTTA 5A8WB 2ZM6F 3EZOA 1LWEB 1URRA 1Y9OA 4F3MA 4IR1A 3BSOA 3W1YC 4O4RA 5L1KA 3OV7A 4NXMF 2LXUA 2YNGB 1B7FA 2UXBF 1WOPA 4LSLA 1WEZA 1WHVA 2CRLA 3OFHA 2UUAJ 1SXLA 2CADA 3HVRA 5M2UA 1C4CA 4MH8A 3BS9A 1KC8T 1HNVB 3VTIA 2YWGA 4KO0B 1NJZA 2AEJA 2OPPA 2OELA 4HI2A 2APOA 1P9YA 4I2QB 5I4MA 3OL6A 1PO6A 2JOQA 2HAIA 4KKOA 2BJ9A 5C25A 1NK7A 4LMZA 1SB6A 4X84A 3ZZRA 1R8PA 4C11A 3GIJA 2ZJPQ 2FHJA 1TAUA 2KVQE 4KE5A 4C3MA 1Q82T 2DB1A 2AT1B 2MTLA 4XDDA 1KEKA 2AGOA 2PIIA 2RU9A 4B3TJ 1T9XA 4RW6B 4FF1A 1G2EA 1RACB 3NS5A 2B9XA 2NPIA 3UD4P 3UD5A 2BRKA 2X1GA 3QLHB 3QYYA 2M4MA 1V5IB 2PGCA 1TKZA 2YH0A 4PG5A 4ZVQB 3H4DA 4G6VB 2JDJA 2MHNA 2MJNA 3D3BJ 3R1LA 2GHVC 3M2UA 4M5IA 4MFBB 2N82B 2V5HG 3NOGA 2C2NA 2DYAA 3LP1A 3O2IA 1VRUB 2B5JA 5SZTA 1MN7A 2P2CB 3MM5B 4KAIA 5KFSA 5FDLB 5KOWA 2ATCB 3GQCA 5F8GA 4GVLA 2BX6A 2RRNA 3J7ZT 2D3OR 4H54A 4OYXA 2CA9A 3M9NB 3DRRB 2V8GA 4KB7A 1TFYA 2AYBA 5KFNA 3OR2B 3LUYA 2VODA 4F0KA 2HWIA 2NYHA 3U1LA 2RS2A 2B4VA 1NRKA 3SYZA 3CXCR 2MY8A 3VAKA 3PHTA 4WBFA 4I2QA 5E3RA 3W9HA 5EWGA 4N47A 1X4CA 3JYTB 4MMOA 2R8GA 2GV1A 3BPSP 3HHDA 2V2KA 1C0UA 3CT9A 3TUZC 1RT2B 1S9EA 1F5BA 1ROFA 3W66A 2Q66A 2IRXA 3PG9A 3D6MB 1WOSA 4KGMA 2E7VA 3OXLA 1DAXA 4ZP8A 3MEEB 4F26A 4MIAA 2HFNA 2UUCF 4DHVA 3K2YA 3V6DA 2J7KA 4HTIA 1V3SA 1QAXA 2OUGA 2QLBB 3IAM9 4ZCMA 1HBNA 4PYDA 1Z2LA 3GJQB 2X1FA 1KWMA 1OY6A 2L08A 3M8SA 2Y8WA 5A2QY 3WIUA 2UXDJ 3SQGB 4CH0S 4CI0B 4QR0A 3CO9A 2F9DA 2ZKUA 3W7BA 4MIWA 1LWFA 5HVHA 1U49A 2ACMA 3BSAA 4FXDA 3GPAA 4OIXA 1QTMA 2VG5B 2Z2MA 3E3XA 5KFFA 3CJ5A 3PKYA 1FCAA 1BQXA 1CBKA 3KJNB 4ECWA 1T05B 2WHOA 1RADB 2E9RX 4WK1A 2FPHX 4FBUA 5KFVA 1HA1A 1RTJB 4K4XA 3C6TB 3CW2C 4ICLB 3I32A 1YRXA 5HBMA 2DITA 2KRBA 3PTWA 1U48A 1PKUA 4LSNA 3QFHA 5F9NA 3AB2B 3CCTA 5E5NA 3KLHA 1GQEA 1S1WA 3R5AA 3OUYA 5KFDA 3VQTA 3A8JA 3QATA 3Q8SB 3NG8A 1WEXA 2YKNB 3QIPB 3QGGA 4JI6J 1RT5A 3KK2A 1FJGJ 1UTAA 2H51B 2Y1RI 3LP0A 3T1AA 3CF5Q 1RT2A 3Q83A 4KY3A 3AA8A 3HSJA 3V6KA 1ICEB 4DR5F 2EKYA 2YNHA 4RLEA 2ROPA 3LOUA 1RTIA 3PHEA 4H4OA 3OVBA 1FJGF 2I8EA 5A8WA 1NK9A 1K73T 3G9CA 4KH1B 3TP2A 2R7WA 4GKKF 2FVPA 4DL3A 2JFDA 3P96A 2KXHA 4F25A 4Y0FA 4HYKA 2E66A 4CT9A 3MTJA 2HZVA 5IV4A 1SKUB 3AY0A 2VU5A 2XWXA 3HD1A 5IQ6A 2COLA 5IM0B 2E1PA 1TUWA 1QSLA 3QT8A 1PJ6A 3X3UA 2F8EX 2GO8A 4Z7CA 1ZM9A 3D0HE 4MT1A 2V67A 4X65F 3K17A 1N54B 1H2VZ 1T0TV 3RYLA 3UDVA 1VBZA 2FJWA 2ADBA 1YIJS 5D0HA 4ECXA 2W4CA 3KYLA 3CTRA 5C42B 1FTCA 2YKOA 3A8EA 4EBDA 3QWUA 3OFGA 3BGLA 4A8XA 3NCQA 3KG0A 1ZPWX 2QV6A 4OZ1A 1IM4A 3G82A 1WJ9A 4BC7A 1KTQA 1O6XA 1WC6A 2DXEA 2DT9A 5IS2A 4KV8A 1T8EA 4C8NA 2CPDA 1JK9B 2JL9A 5J2QA 1WC1A 3A8KA 1OSDA 4K59A 5J2PA 3A8IA 4IH5A 4WJBA 1SC4B 5J2MB 2CPJA 1KDNA 1XERA 1HWLA 1U8SA 3ILIA 1RBAA 2HEKA 1S76D 1R6VA 2F4FA 1MN9A 4W90B 2DRAA 4RWXA 4E8UA 4DPOA 4CLYA 1FKOA 1MWYA 2C2ZB 2HAFA 5KG7A 2C2KB 3CD5A 3G4SS 4U7CA 3D54A 2R7UA 4N77A 2GA7A 1WOOA 1NB7A 4X4VA 2AMCB 4PWWA 2KM8C 3NGKA 4M5GA 1VDHA 2Z30B 1I3OB 5CZVA 4E0DA 3MEKA 1FNXH 4NCAA 1ZOTA 1R0BG 3DDIA 3RG6A 3P4UB 4CLZA 2AV5A 3DYAA 4CQ1A 2QA4G 2EI5A 3FEZA 4N41A 3KJVB 3BKTA 4A8MP 1LXNA 1EP4B 2GIRA 3ILJA 4OI2A 2AW0A 3KXDA 4L72B 3R5CA 4OX6A 2B7CB 5KT7A 3G8TA 1KOHA 1Z1ZA 1TK0A 1ZZNA 4USJC 4CWBA 2LQ5A 3A12A 3BH7B 3F41A 3G82B 5K9FA 3VWSA 2DCUB 3BO3A 5F3ZA 2MZSA 3J7Z5 4A8SA 5KG3A 1YVFA 3ZO7A 1HNZJ 2IC3B 4HTJA 2KYXA 4K7QA 5A8RB 3AB4B 4K8RA 1LW2B 4ZPVR 4HVZA 1LEOA 4KGXB 2ZJRQ 1JMTA 4LRBA 5AE2A 4NXNJ 1WF2A 3ET6B 1IKVB 1T9UA 1FK9A 1OQ6A 2LU1A 2OPQA 4KFBB 4DUYJ 3V6HA 3IC1A 3DGPA 3R7SB 5DDOC 3AHPA 1IWAA 2DGWA 2EK1A 2QSWA 2YQ0A 2CG4A 3CE8A 5CYMA 1K44A 4LFCF 1UVMA 4MYTA 1L3UA 1N6QB 3SCKE 2BACA 3V5RA 5F0UA 1FKOB 4KBIA 4I7FB 4GO7X 5DDPC 5IV3A 1PAEX 5HP1A 9RUBA 5IC6B 2XS2A 2GHWA 3E01B 5D0GA 2ZFHA 4GVBA 4OHVA 2IVFB 3SMZA 1HWUA 4HEA9 4F36A 4FKYA 2K1RA 3BZQA 2KH9A 3K5MA 3J7A1 4GRSA 4AT1B 3DOKA 4EBEA 4X4RA 3U7JA 4KHPF 1HMVB 2HNZA 3PR5B 2NSBA 2HQFA 3M8QB 4PWUA 1RBLA 4RO0A 4MJKA 1KLMA 1YBUA 3HSGA 4EGLA 2CKWA 2OP5A 4K5SA 5J1EB 2HGMA 1EQ0A 4LF8F 2PI4A 2IBOA 3R9LA 1U2RA 1IBMF 1K0VA 2RNEA 3MAAA 4PAAA 4WFAQ 2MXYA 2WBMA 4B3SF 1FDBA 3UDCA 3ENQA 2HS0A 3TA2A 2E29A 2HNDB 4Q43A 1LOUA 3O8WA 5HI7A 3TJAA 1T03B 2WVCA 4NA3A 4ZVRB 2DNKA 3QJJA 2OSRA 5A0YA 3J80U 3KHHA 2IDEA 4WKYA 5KT4A 3L3CA 3UWTA 3MR7A 5E41A 1CJKB 1Q1KA 1V5VA 1L3KA 3BBFA 4DZDA 1Q7YT 2JEGA 5DQIA 1WKJA 4M5KA 2X1AA 3MF5A 4TYAA 4FYYB 4X64F 5E7OB 2E5JA 2J9DA 3DN9A 3QFWA 2CQHA 3HP6A 4WFXA 2V8DA 3T9NA 3MR5A 2QL7B 3GV7B 2CQ2A 1XMOF 1UFWA 3NLCA 5KFEA 1B70B 1NKBA 3N6NA 4F50A 3T5LA 3PX6A 1SKRA 4DR6J 4WZQA 1JLFB 2NZCA 1K1QA 4TQRA 1PJ5A 1SJRA 3PM9A 4I2PB 4CM2A 1DQAA 1GMUA 2H1YA 1W25A 2HLUA 3O6QA 5E3AA 3ZC4A 2CPHA 8AT1B 3AD9C 2CPYA 2XO7A 3BKFA 3L95X 2BYCA 2MGZB 1HI0P 1YDLA 3MGJA 4GO5X 1VC5A 4FYDA 3UFCX 4TNOA 3CSKA 3SQOP 1WI6A 1R8BA 4C97A 4ZVFA 5J2MA 1WHWA 3LF0A 2F65A 3CJ2A 4H4KC 3RRHA 3GYNA 5CYQA 1S1TA 4A8QA 5AXLA 5FLXY 2I9SA 2VG7B 2DNQA 3EZUA 3WC2A 2OEJA 1ZTTA 3FUYA 4K5RA 2F3JA 2PA8D 5A0YB 4ZIVA 2VC1A 2VJUA 2GC8A 3SSSA 2FY8A 4PYAA 1ZAWA 4F0HA 2FVQA 2HMIB 1T9TA 1WORA 3TNVA 2V4RA 3H40A 5GAHI 5CQGA 1TP7A 4JP8A 5JMNA 2GX8A 4TYBA 1BQMA 3KWMA 1VCTA 1UEVA 1GFWB 2GMHA 4F67A 2XNQA 3IO1A 3T6BA 2XGPA 3RRGA 4PXBA 1R0AA 1K9MT 1LWEA 1NBEB 4M5LA 4B3MF 1CS4B 2J8AA 2QX0A 1B0TA 5DRKA 3SQGA 2VDIA 3QPIA 2JSXA 3ADAC 4EWTA 2MQOA 4DV2J 4C9DA 2J6TA 2PI5A 1BGXT 3POTB 5D15A 3FEYB 2HYIB 3DC2A 1HNVA 3HHLD 2R2UA 2XSJA 1JXLA 3VAHA 3R5BA 3PJ9A 5BJRA 1TUGB 1UPMB 2A0FB 1FA0A 3FFIB 4DOZA 5GAEU 3CCQS 3N28A 4X66J 3VAMA 2OTJS 3EPIA 2KB2A 1QSYA 5CYQB 2KM8B 4ECTA 2RF2A 4DXLA 5T14A 1FD2A 4A8YA 4TXSA 4A8FA 1H2TZ 2VKZG 1N6QA 1UVIA 1YK9A 2BBEA 4NLOA 3C16B 2JC1A 1FVQA 1KVKA 2HRTA 3MM6A 4L6V3 1MLAA 4PZVA 3CC2S 1H73A 2KVIA 3CEDA 4QW8A 5C24A 1EJ7L 2KZMA 3MMCA 2RQKA 1Y0HA 2VFSA 2D1CA 1TKTB 1ZZFA 3OTBA 3C15B 1ELOA 2I5JA 5FLXU 2ZZMA 1S59A 4PCQA 3CMES 3PO5A 2YNHB 4X4UA 1OYDA 2CQDA 4MTPA 1WF1A 4ZHRB 3R7BB 4H4OB 3QRRA 3EGVA 3PFOA 5K20B 1N0VC 2P6TA 1O8BA 2V63A 4DSIA 4CZCA 4WFBQ 5JUMA 1LWCB 4K4YA 4NL5A 1GAOA 1N48A 3ZZZA 3OXGA 5J1PA 4JI7F 3NGTA 4NYZA 5E3PA 4OZNA 2V8HA 1AA1B 4YDXA 2CG8A 2IM1A 5GAHU 1CC7A 4DUYF 2ASJA 2CQIA 1Y3JA 2XCPA 3NGRA 4YHHJ 1NK0A 1S9FA 1CJTB 4LBIA 4BCAA 1Q0NA 1QE1B 3B78A 2EFVA 3DRXA 5DLGA 2IMWP 2YQ1A 3FQKA 5ETRA 4NCGB 1DQ8A 1U6ZA 3BR9A 3HFVA 2HFVA 1PYOB 4DR3J 3BB5A 3DXBA 2ZH1A 3F56A 3K7RA 3IWXA 2FD2A 2E1CA 2H3EB 1S97A 5DGBA 3R5JB 2OAUA 4LBHA 4RBUA 1GMWA 4MIBA 4Y28C 2C3OA 2FVSA 2FJAB 1RE1B 2XS5A 4ANEA 1TMJA 3OVAA 3MMCB 2BDPA 3RZAA 4QYZK 1OY9A 2XI3A 3DLBA 3N4WA 4J37A 3KDOA 1Q95G 2XZDB 4RW8B 4M8LA 5DLFA 1HBMA 1OYEA 3T6JA 4PRFA 1NH7A 3H5SA 3P5BP 2MKJA 3ICLA 2WAQD 2Y3YA 3VHQA 3BQ2A 3TYTA 1PCAA 2ZZNA 2G9OA 5B09A 2OJ3A 5HL7Q 2PFDA 4B3OB 2FB0A 3CJKA 3R7NB 1KHVA 3CPWR 3IG1A 3M2RB 4LF7F 2R3VA 6AT1B 1QLNA 1ZBTA 2VG7A 2CQPA 1NK8A 2M70A 5CABA 4Y2CA 3NXZA 2OKQA 2C3PA 3AOBA 2QMXA 1X9SA 3KJFB 2ZH4A 3UR3C 1NPKA 2WW8A 5DGAA 2H9ZA 2ATLA 4DV5F 2BKOA 1LFWA 1XMQF 2CDQA 2HMIA 4IG3A 1QE1A 4KQZA 3U1NA 1SL2A 4JV0A 3PZPA 1JLEA 1VR6A 4Z37A 2IM3A 3NS7B 3S7RA 2L9NA 1F9FA 3KLIA 1BQMB 2XMKA 4CT8A 1Q78A 3OSPA 4DR1J 3HZGA 4OHWA 1HL6A 2VF3A 1K8AT 3PW2A 3SDEA 1JJ2R 2M0GB 5HATA 3Q0AA 3VQSA 4DV3J 1DLOA 4PQUA 1H7WA 1W2IA 2QG9B 3ISZA 4OYBA 2UVRA 4WU3A 5GMDA 3JAMU 2H65B 4WWSA 3UPFA 2IIHA 5A8RA 3M1VB 1UA1A 2WONB 3R3TA 4IYQA 1EAYC 3PX4A 4X4QA 4NLRA 2NXEA 2YKQA 4LR8A 2P9GA 3P6YC 2AF6A 2EFPA 2DR7A 1UPPA 1QUPA 2XYPB 4WIIA 5KFYA 3TZWA 1S7IA 2F1FA 4OX9F 5LMUJ 3RAXA 3NCRA 5HMYA 1RLCL 1IR1A 5KFGA 2GFFA 1SCJB 4LBPA 2ZOFA 5ETVA 2RDDA 4HR2A 4QWAA 2XTJP 3OQ2A 4RZRA 4CRJA 4GKKJ 3R6LB 5HQLA 1YJVA 2E5LJ 3CDAA 2R7SA 4WFNQ 3E01A 2JX2A 3FMWA 4OV6A 4G3IA 4QWBA 4DQQA 2FLNA 4PQAA 2ZHBA 3CJ3A 3MCOA 5KFWA 2VQEF 1JLBA 4ZCLA 4OFZA 1OPIA 5MLCV 2VOPA 3R8YA 1N36F 4O3RA 1FKPB 1NU4A 4NLXA 5KG4A 4ZHRA 4CO1A 2ADCA 3QT5A 4B9MA 2BKPA 1VQ6S 1N8RT 4V19J 4MKAA 3UE2A 4AE5A 1YJ7A 4A8OA 4B02A 2UVWA 2CQ4A 3N6LA 2V2VA 5H9EK 2YVSA 2KL8A 2CNOB 1NDCA 1N4LA 1WG4A 4TN2A 4PPDA 2FLPA 2DK2A 1U45A 2E5GA 1JWWA 1HNIA 1XN9A 3EMTA 5G0RB 4CCHA 2MZTA 1Q8IA 2AEFA 2DXDA 3FC9A 3H2VE 3VZIA 4C0BA 3MD3A 2OPPB 2GZOA 2DGUA 3FBCA 3I0SA 3G6VA 4JI1J 2BE2A 1H74A 2HVIA 2BEFA 1FRIA 2JLEA 2AX0A 5IT4A 1U6FA 2DGSA 2HRUA 4GC6A 1B64A 1UW4A 2OFGX 2C2DA 2GQCA 1FRHA 1SL0A 1U2FA 4UUXA 2YQ3A 4LVNP 4DV7J 1SJQA 3D6TB 4YR2A 3O1LA 2UXDF 4DPWA 5DG9A 3U27A 1BXNA 3M6VA 3TAPA 2LKZA 1JLFA 3SBMA 2ASYA 4CLKA 2P9EA 3S8SA 3HHNB 3BV8A 2D3UA 3G6YA 3CJSA 5M2PA 2BRLA 3JQKA 3SSRA 3J7AN 4NZ7A 3IAS9 2FHOB 3W2WB 1M0SA 2MZ1A 1UCNA 1XMQJ 2QL5B 4DV5J 2BR0A 5EX0A 2YNFB 1EX8A 4DL0C 1J5EJ 4EK2A 2W2OP 3KOAA 3SCLE 3KLEB 3DGPB 1ZA1B 4NMLA 2WSFC 2CJBA 4GMKA 3UN2A 4R0JA 1WC5A 4GKJF 1OQ3A 2OIHA 1RTHA 3H59A 2DY1A 2WCXA 2OFHX 4Y2MA 4DV7F 4F7VA 2DTJA 2J0SD 1K0TA 4Y2IA 3QT6A 4ER8A 1NPPA 1RYRA 2RJZA 4A47A 2XGQA 3DLLQ 4KT0C 2WW4A 3D4JA 4IG3B 4PG6A 5F3TA 2HHHF 1RAOA 1KKHA 3RBXA 1Y00A 3ENVA 2B9WA 3P3DA 4FYXB 4I68A 1SH0A 3MI7X 3R27A 4I6AA 3W8PA 4IQXA 2D41A 3LH2S 3Q2TC 2EW9A 3UW1A 4I6YA 1REGX 2B4PA 3CB4A 3Q23A 4UF4A 1C1CB 2J9DE 3H98A 4CYUA 4WE1A 5HANA 4B3TF 2Z4PA 1NNDA 3GWCA 3PFEA 3VAGA 4MKVA 1UEKA 3CUNA 3KUEA 4P52A 4LUBA 4RL1A 1R6YA 3CC7S 2O66A 1S4FA 3PV8A 4NEYA 3T19A 4LF1A 1APSA 2KXFA 2YWEA 2VBZA 2RQ4A 3N5BA 4OYIA 2A18A 1G1XA 2DNOA 1RTJA 3DDNA 4C8ZA 1JLQB 3HO1A 3QT7A 1JB0C 1JQGA 2V4JA 4AYBD 3EPGA 2MQNA 3MEGB 2W2PP 3JQMA 4NLVA 5FIIA 4OMFG 1VI7A 4C8OA 4ZLLA 5F8LA 2BM1A 5T7LB 2F4VF 2WSCC 2V0NA 4ATNA 3EGZA 3K5LA 2Q1LA 4KTQA 3DMJB 1GX6A 3MM8A 4OX9J 3QIPA 1K47A 1HR0J 2XYGB 2QL9B 1HQUB 4J9NA 4LFBJ 4DG1A 1F5AA 3NS6A 1R89A 2FJDB 1Q16B 3TARA 3W9IA 3LPYA 1JIHA 3PEHA 2MGZA 2UUAF 1YGYA 1WDTA 2MEWA 4CLLA 1ZM4A 2DNZA 3LGNA 1YJTA 3TA0A 4DU7A 4QPXA 2UU9J 4P74A 3WQPA 2KT3A 2XMMA 4ZVEA 1IN0A 2CPFA 1IVZA 1OMSA 4EFAC 4ITSA 3HSZA 4RW9B 1X5TA 1SIWB 3WBZA 5CHCB 3ZTOA 3JTOA 3CDBA 1I6JA 2BMBA 2PO4A 5B0CA 3QJPA 4OZ2A 3MURP 3BQ1A 5AXKA 1VYAA 2MQQA 3I0SB 4LF9J 2DRBA 1VBKA 3GU0A 4PG7A 4UZCA 4HACB 4NLGA 3M8PB 4YY3F 1YJNS 1FXRA 3TEGA 3TZYA 5LJ5Y 3TQEA 4QYZJ 1RKIA 4DV2F 3G8SA 4C7QA 5GAGI 4P2FA 1R0AB 1IBKJ 3M6XA 2VG6A 3TUPA 1HPZB 4B3MJ 2J7WA 1L3VA 1RJJA 1H6KX 2WVBA 3IBCB 3MCNA 4DFJA 2IRYA 5H9EJ 2Z0GA 3MOZA 1RAHB 2CYYA 2XMWA 3NGSA 1FWPA 3MPVA 3R1HA 2UP1A 3EDRB 3EGWB 4P2MA 1NDKA 3UD3P 2HVDA 3TAMA 4ZS6A 4K4VA 1UJ5A 3OSNA 4FNIA 4HI1A 1RT4B 2RT3A 1HWKA 1Y5NB 4EYIB 1NMEB 1FRXA 1S12A 1YJWS 4IFYB 3FDSA 4FF4A 5D4NA 2MQMA 1N5VA 1WC3A 4X4SA 1W26A 1YKWA 4QWCA 1N88A 3QMQA 2IM0A 2ZVIA 2I6WA 2X3DA 4IR9A 4KRWA 4FDFA 1M1KT 1M5VC 2B9EA 2GJFA 2W8LA 4OHXA 3WC0A 3CULA 4LR9A 5KFXA 4U95A 2KT5A 1VK8A 2ZBQA 2DGQA 4RUBA 5KT3A 4G1QB 4EZ9A 3UDEA 2RHQB 1VQNS 2KN4A 1RHQB 3GMGA 5E2QA 2QLWA 3D1OA 3TVYA 3MM7B 4OQJA 1EETB 2AU0A 3KG4A 4OJGA 3JS9A 2LQ8A 3V6DB 4DI6A 4JI7J 3BGFA 3IP0A 1H98A 4P9SA 4TLQA 4ZPAA 1S6PB 4F3QA 4Q8EA 1DLOB 3OTCA 4Z7YA 2AWZA 3DGVA 2N4CA 1N5YA 4HH1A 1G6BA 4FNHA 1IJFB 3I6PA 3M9OB 2JC0A 1UA0A 3A3OB 5EDWA 1Q7LB 2XSFA 1Y3KA 4DSEA 1I94F 2ILZA 1LW2A 4JBCA 4OJ1A 2ZH9A 1GEHA 3CJTA 2MPUA 5CH7B 3Q22A 3N01A 5K5MA 2EFOA 4XO0A 4YR3A 2QTWA 4KKOB 2MQPA 4RJVA 1WKKA 5KFAA 2SXLA 3HHLA 3QO9A 4J9PA 3T9ZA 3BGRA 4KSEB 3RBDA 1RSCA 5T41A 2HRYA 2MJUA 3OUYB 3LAKA 2QA1A 4WXOA 1NJWA 3QLHA 2IYIA 3TR5A 4OZ0A 2Z57B 2QRRA 1G4CA 2ZVSA 2JH3A 5E0OA 1WC0A 1TKZB 2CZ9A 4CLUA 4F02A 3E51A 2XM3A 4L3KA 1FJ7A 2ZHOA 5D8HB 2DGVA 3UN5A 1KTVA 1RA6A 2EBGA 3MMBB 1SQEA 4OZ3A 4X66F 1LK5A 2BJDA 2HHQA 4USWA 3TW0A 1HMVA 4XPCA 4O3SA 1U0HB 2RB7A 4NRTA 2CIMA 1H38A 4B9SA 3IS9B 2OEKA 3I9V9 5KT2A 1ZTWA 2IPOB 2YKPA 3V4MA 1D9AA 1X8DA 2W2MP 2EC0A 2QSFA 4AQYF 1X9MA 3AOCA 2D74B 1WI8A 3G86A 4DV1F 2BQRA 2C42A 2N7YA 3RBZA 2WB4A 1DRZA 1ZPVA 1HNIB 2HBYB 2UV8A 2QA4S 3NP5A 2HNDA 1UL3A 3NKYA 5KFUA 4A8KA 5L1JA 1NJXA 1RWXB 2LYVA 4AUKA 1NKEA 3D2WA 2MSSA 3NBPA 1VQMS 2CWXA 4AD6A 4F04B 1U25A 5K8MA 2G0JA 1C0UB 5KG2A 1ZAXA 4QPTA 4F4XA 4JI3J 3H2LA 3R2CJ 1KS2A 3HD2A 2HW3A 3QO9B 3S1TA 4ECZA 3FK4A 3H5UA 3Q89A 4CP5A 2JZ5A 2Y1LB 2VQFF 1FHTA 4LREA 3ETOA 2RKIA 2Z2LA 2CNLB 2LMIA 5G4DA 4DJBA 1RT6A 1T3NA 3PX0A 3KJQB 4UY8T 1YTYA 2HWHA 2XMUA 4KHMA 3SDEB 2NYIA 3MR6A 5GMEA 2QT7A 1RAFB 2HS3A 3RB3A 5I42B 1HNXJ 2W9BB 2JEFA 1R8CA 4DWIA 3HK2A 4QJVA 1S49A 2HHSA 3VGSA 1R43A 1CLFA 1FERA 5C7PA 2WONA 1IJEB 1QM9A 4DUZJ 3W2WA 4RNHA 3AH6A 5THWA 4K4SA 1EARA 3GCWP 2WRMA 4QBUA 3EZ5A 4DR7J 3LA0A 4ETXA 4AL6A 3I96A 4YP3A 4B9UA 1CJUB 3JSBA 3QNWB 3BR8A 2LECA 1VQ4S 3NOCA 1X4BA 1RT1B 3D67A 1S1TB 4O0NA 2R7RA 3AXMA 5DZ6A 2UV8G 1B0VA 1UETA 1XEZA 2PE8A 2BJ8A 3JQJA 4LSNB 1WNEA 5RUBA 1UVLA 3BGOP 1SJ3P 4LF2A 4ECUA 1RZMA 2EFQA 2M5YA 3M05A 2YKNA 3KHRA 5ETLA 2BE9B 3LP0B 2AJ4A 1RQ0A 3CD0A 1JXVA 4ZJLA 5CAAA 2J9EA 3Q86A 4G65A 4U96A 3VALA 3JB9k 1ZH5A 2KDOA 3Q8QB 4NLSA 1D0EA 3UNGC 3DI6A 2FLLA 3MWBA 3JXOA 3D0GE 3CJ8A 2XI2A 3TVZA 5KT6A 3OTDA 1OS5A 1Z2ZA 4DX6A 1FO1A 3VF0B 3RTVA 4F0MA 5CD4H 4JV5F 3CCVS 4DLEA 2YKMB 3P5TL 3G6ES 2ZJQQ 4PWDB 1U4BA 4ED1A 2B0GA 2AYMA 1N5YB 1BWVA 3MUTP 5IQQA 4DUTA 5GAGU 2K7KA 2DHHA 5ETTA 1S48A 2RIJA 2R7VA 5AXMA 5G0RA 3RUBL 2RVJA 1S1XB 3NY0A 4RUHA 3BBCA 4ZK7M 4MKYA 2GJ2A 1IR2A 1CPZA 5KG6A 2R7XA 1PIEA 1VQYA 1X5SA 4KHPJ 1HARA 2CPZA 4WK3A 1CJUA 2HHPA 4AXIA 2CUYA 3M2VB 4OJ3A 3DM2B 4R25A 5LSRA 1YLXA 2AJ2A 2EWHA 2M2BA 3HHKA 2QFIA
chains in the Genus database with same CATH topology
2L3MA 5IXUA 3OJUA 2XMJA 2L9DA 1FDNA 4ZPDA 5C42A 3O5TB 1X7VA 3HDSA 2ZOGA 4H4KA 2ZD1B 2NUUG 3CCLS 3OFFA 4ED3A 2XMVA 1HI8A 3GR1A 2VFTA 4GC7A 2OPSB 2QIFA 1MROA 4DL5A 2B4UA 2E1MC 5A6WA 4X62F 2IFXA 2O67A 2RD5C 2FGCA 5CCMA 4I56A 4HKQA 3IS9A 4ED2A 1M90T 2YNFA 4BWMA 2RRAA 1IKXB 1SI9A 1VRTB 3UCZP 2V9WA 1VOMA 2RDIA 5ITHA 1GX5A 3CCMS 3DHWC 5EGYA 1YG0A 1UWBB 1DBDA 4ERDA 3HLUA 2IA6A 1T03A 4FP9A 2F9JA 2C3UA 3HI9A 3I31A 3DRSA 2VD3A 3J80Y 5HLFA 1MNEA 4F3OA 3KMQA 2B7BB 4M95A 3VZHA 1M5KC 3MOJB 3DU6A 5M2RA 2MKHA 4FS1A 4DQSA 1XBWA 4K2XA 4KC5A 4NCGA 1ZM2A 4J5OA 3KLGB 3NCPA 3B8HA 4YEAA 4B08A 4DSJA 4IH6A 3KJVA 1NK5A 1RT6B 3DLEA 3MECB 3EX7B 2F8MA 1FESA 2AP6A 2PMHA 3G8QA 1L3SA 3J81Y 4QR2A 1C1CA 1N32F 3KHLA 3QWPA 2HNYA 5CCLA 1HI1A 2G1DA 1XTZA 1HWJA 1FNMA 2GMJA 2M7SA 1J5EF 2HHUA 2KU7A 2NR0A 2OPRB 4KIAA 4RW4A 3TAMB 1JKHA 1KONA 4M5DA 4NRUA 4J9LA 1P8GA 1GXUA 1IKVA 1FTRA 1S6OA 2J76E 2KI2A 2LDYA 4N8OA 3HT3A 3BJYA 2L9WA 2IBKA 4NLDA 5DG8A 2LA6A 3CJKB 2XY7A 4K4ZA 2Y1JA 3HKWA 4IQMA 1FJEB 3H8YA 5KFTA 4MKBA 3VCDA 2DNNA 2W24A 5KFPA 2V8VA 2VH7A 3I56S 3HHLC 1M5SA 4QIWD 5BR8F 4WZMA 4LF4F 4ZPWR 1BQNA 4HHJA 2ASLA 2XMTA 3SFGA 2K1RB 2MY7A 5DM7Q 2QE5A 4G1IA 3N9UC 1U26A 1EETA 3C2PA 3DI6B 1N33F 3KLIB 4Y34A 3JTPA 2PT0A 2DGTA 1GTHA 5D4LA 4QYRA 4AXJA 3M30B 2Z8QA 2M52A 1HWIA 2R2RA 4B9NA 3POTA 3R5DA 4RWWA 3N5FA 2PDAA 1TL4A 1X4HA 3MM5A 3Q8RB 3FFIA 2F8HA 2VPWB 2JFKA 4BDPA 4LF5F 2XHWA 4RNFA 3OL9A 4K50A 2R8IA 1UP1A 2E5HA 4ES3A 2BXJA 5AE1A 4EYHB 4DDFA 2GCFA 3SZ2A 2Y1IA 2LXIA 4JI6F 4RNMA 2JRSA 1NJYA 1MW7A 1C4AA 1NK6A 4NA2A 2KG1A 4JI0F 5IWAF 2ZH3A 1HBOA 2E5IA 1BQNB 3DLHA 3K58A 4MYUA 4PG4A 3EXYA 5IM0A 1TKTA 2HPUA 2AX1A 1T02A 5F9LA 1GNKA 4U6PA 1TL1B 4DF4A 3TVKA 1SC6A 3NWGA 1TKDA 2V94A 1H3DA 1MMLA 1QY7A 2RSQA 4QOTA 1KNZA 2JHEA 1GH8A 2IMOA 2U2FA 4D3HA 5F8HA 2KKHA 4ID5B 4DL4A 3NAIA 2J5AA 5U47A 1TFWA 1UWBA 5L38A 1FRLA 2GW8A 3X1LB 3HMJG 2DVIA 5FD1A 4JV2A 1P6TA 4OX7A 4UW2A 3TO8A 1SV5A 3KTQA 4ZP9A 1IUJA 2FJXA 1QAJA 4Q8FA 3I4PA 5F8IA 1YSJA 3DLGB 6FDRA 4FF2A 4ED0A 1RDRA 1VJWA 2A2CA 4ZCIA 1PILA 1VMBA 1WELA 2QMWA 2A1BA 2RKIB 3RU0A 2N7CA 1N52B 3PW0A 2DH8A 3JSYA 4AL5A 1TQLA 1S6PA 4ZLPA 4Q2MA 2AJFE 4P2SA 5KAKA 3VR1A 3GIKA 2LQ9A 2HNYB 2R4FA 4J9QA 3GFZA 1KN6A 1UVNA 3BQ0A 2FJVA 4JI8F 2OMLA 2J6UA 3G96A 2I2YA 3THPA 2XC9A 3HZEA 4ZVHA 5L39A 1FEEA 3DU5A 4URGA 1TVRA 4I6WA 3KLEA 1NO8A 2FJBB 2KT2A 3IG1B 3M2RA 4ED6A 2OSQA 3ZZUA 3OJSA 3NNCA 3AAWB 2ZNYA 2GJIA 5K14A 2JJ4D 2POKA 1FEHA 4OLPA 1C0TA 4HDGA 1KHWA 3V2UC 5EWEA 3K0JA 2P6SA 1N5QA 1DTQB 3VAJA 1UJ4A 2KYZA 2ZBIA 3ULHA 4A4JA 2HVZA 2DGXA 1W2BR 1HNXF 3HX9A 3UI3A 2R8HA 5GMKa 3MFIA 4DX8H 4C0OC 4XPEA 1V9OA 3AQOA 4J9OA 5DETA 2DR9A 3QGHA 2KHDA 2KFNA 4RNNA 3I0RA 3SSQA 1J5OA 2LXFA 1F60B 3MD1A 2PA3A 4IG0A 2XULA 5F8NA 1Y7PA 4QWDA 1F0XA 3V4IB 2LEAA 2M8HA 3K5OA 4DL2A 3DXSX 5HMZA 2HG4A 1VQ9S 4FF3A 3GR0A 1T95A 1RT7B 3RR8A 4BC9A 1YITS 2UZAA 1WHYA 2V4JB 5DG7A 1FF2A 2E7XA 4I1TA 4C8YA 4Y6IA 1UEUA 5K14B 3SV3A 3P49B 4R5PB 2AJ1A 3BEGB 2RE1A 3DRYA 2IAJA 3RR7A 2NSCA 1CVJA 3K5NA 2NUHA 1DTQA 2UXCF 1JLBB 1UVKA 1XC9A 1QVGR 2D3ZA 1Q4RA 1VRUA 1FKPA 2LDIA 4ES1A 4MK8A 4DL7A 4I67A 3H25A 2KHCA 2RH3A 1EP4A 1R3NA 3NGDA 1RT1A 4O23A 2RUGA 2RU3A 1C2PA 1X4DA 3FJ2A 4H4MB 4RBVA 4MAKA 4UQGA 4QIFA 1Q53A 5B0BA 5HO4A 4YOEA 1WHXA 2LLZA 4JYAF 1X4GA 2XLJA 3V81B 4NYOA 4TQSA 4P7VA 2MZQA 2BE2B 1GXTA 4LT6A 4NOHA 4Q0BA 1LKZA 2VUGA 4WF9Q 3FCHA 3QAEA 2FHMA 3DLKB 1SJ1A 3M8PA 3RB6A 3KMSA 2XS7A 5BYSA 3DOLA 1TK5A 2C3MA 3W2VB 1TKXB 2BJEA 3CMAS 2R7QA 1VC0A 3D5MA 5D3GA 3KNAA 4NA1A 4AFFA 5F0WA 2P5VA 2NREA 3KK1A 2ZHAA 2K3KA 2YKMA 4OHYA 4RKUC 2FVRA 5LSLA 1NEEA 4QIGA 2HQ3A 3GYXB 5EUHA 1VGYA 2FGOA 2MKSA 3PRDA 1N56A 2NQPA 4HT7A 4RW4B 4LJMA 2B9YA 5B0EA 3ZZOA 2HGLA 1JLAB 5IFMA 1XR6A 1YQHA 2D9OA 2KXNB 5I3UB 1RTDA 4IDKA 5H9FJ 3BGUA 3HVWA 4ZMMA 2PD1A 3IRXA 5J1EA 2RQCA 1ZYQA 1S77D 3IXQA 1WTFA 1TV6B 3HVTB 3BN4A 4FVMA 2VASA 3JSRA 1VS3A 3KG1A 4ICLA 2MYFA 3OL8A 4KR0B 4QW9A 3OL7A 4BS2A 4FS2A 1CEZA 2W7PA 3PIPQ 4U7UK 2AGPA 1RTHB 2IVYA 2F7VA 2HQIA 3BDEA 2MKCA 2XZWA 2ZH2A 4DV4F 4JV1A 5E3QA 2J0XA 2MZRA 1KSPA 2DIVA 2YWKA 3GB0A 4ED8A 3QGPA 1N5TA 4IFVA 3MM7A 3M4XA 5KG1A 4EEYA 2AGQA 5B0DA 3MPYA 1VQKS 3ITHB 1D8ZA 2EFGA 2VC0A 2CZ4A 2VA2A 4WYLA 2DNYA 2J0QD 3E8OA 2YWHA 2IM2A 4X4OA 4IKAA 3GE9A 3THVA 2ASDA 1GTEA 1AROP 1TZ0A 2Q79A 3I0RB 4HT5A 3DLJA 1J5OB 2HHXA 5IT9Y 3D1HA 3CJ0A 5DJBA 2EVZA 2R2TA 3SEOA 3L7OA 3IA0A 2DHGA 3I82A 2LEBA 3FNNA 2RDJA 3K8VA 3US5A 4TU9A 3FVYA 2OH2A 4P6QA 1NZAA 2DH9A 3LALA 1PSDA 1E6YA 3C66A 3Q2SC 2R7TA 3I5CA 1LV5A 1ZETA 2XB2D 2VL1A 3CDWA 1IR0A 2VKRA 3CIMA 2HGNA 2ILYA 2QYCA 3I5BA 4ZPCA 3MCSA 3TA1A 4BBYA 5DM6Q 2JEIA 2PC6A 1NJIT 5CYJA 3MUMP 5GVQA 1HBUB 1TL1A 1YJRA 2EG2A 1C1BB 4EZ6A 1MU2B 4QIEA 2ZE2B 3KK3B 2WTFA 2V9KA 1RKJA 5HMWA 2W9AA 3DOMA 2QFJA 3GG1A 2R7SA 1QSSA 5AXNA 1S7HA 5JXSA