3CTRA

Crystal structure of the rrm-domain of the poly(a)-specific ribonuclease parn bound to m7gtp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
GPLGSDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the RRM domain of poly(A)-specific ribonuclease reveals a novel m(7)G-cap-binding mode.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Poly(A)-specific ribonuclease PARN
total genus 14
structure length 75
sequence length 75
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2008-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ctrA00
3OW2R 2FPHX 3UE2A 2JX2A 4IOCQ 1X4BA 1WG4A 2E5GA 3THTA 1X5OA 2KXFA 1VQKS 1ZZFA 2I2YA 1S72S 1HD0A 2SXLA 1G2EA 2KXHA 1WI8A 1Q81T 4CH1A 3I55S 2DITA 2DIUA 2DNGA 4W90B 4WFAQ 2FC8A 3ULHA 3RW7A 1B7FA 2DHSA 3CCSS 2CPHA 3BS9A 2YH1A 4A8XA 4CQ1A 3CXCR 2YWKA 1UP1A 3IRWP 2KRRA 1VQ9S 2M70A 3NNAA 2AYGA 3CCMS 4RU2A 2LEBA 3SMZA 2CQ4A 1YTYA 3UWTA 3IWNC 2M4MA 2JWNA 3MUMP 1YJWS 1U1NA 1M5VC 2DNMA 2YKAA 1VQMS 2NZ4A 4FXVA 1X4DA 2N7CA 5GVQA 2KRBA 5CYJA 3R1HA 1X5TA 1NJIT 4J5OA 2M9KA 2J76E 1H2TZ 4LMZA 2ADCA 1U6BA 4YOEA 1RK8A 2XB2D 2DNLA 5D78A 2CQ2A 3G9CA 1U1LA 1FO1A 1U2FA 3H2UB 1A9NB 5LJ5Y 2N3OA 2G4BA 1FXLA 2MKSA 2KU7A 4OZ1A 1U6FA 4F26A 2DISA 2ZJQQ 2OSRA 2KH9A 1KOHA 1KD1T 3P6YC 2FHOB 3TYTA 2DGXA 5MLCV 2X1BA 1AUDA 3SDEB 4WCEQ 3VAMA 2CPIA 1OPIA 3BO3A 1U1PA 3CCLS 1N54B 4UQTA 4WKRA 5DDPC 2RQCA 4W92B 2MZSA 3VAKA 3CCRS 2MYFA 3DLLQ 4Z2XA 2LXUA 2M2BA 4TLQA 3S7RA 3MOJB 1FHTA 2DGSA 2KVIA 5DETA 1X5SA 3DXBA 2M7SA 2RRAA 3P49B 2DNYA 1HD1A 1F9FA 2M8HA 3MUVP 2KFYA 2D9OA 2JVOA 5BJRA 1WWHA 2CQGA 2MHNA 4WFBQ 2RS2A 3JB9k 2KG1A 4C4WA 4YUDA 4FXWA 3UCZP 1PGZA 3NS5A 3VAHA 2MZJA 2MQMA 2E5HA 1X4CA 2GO9A 3G8TA 2KHCA 2CPZA 5DDRC 1SJQA 3UD4P 2CPJA 1WG1A 2MKKA 1VQ5S 2RUGA 5LXYA 5DDQC 1N8RT 1R8HA 2CQPA 2MZTA 3RW6A 3G71S 1KC8T 3SXLA 3VAFA 2QEXS 2K8GA 2XSFA 4PRFA 2MSSA 2DNHA 4Y0FA 4BS2A 1YHQS 2MSTA 2DNZA 2MXYA 1X4GA 2MZQA 3CF5Q 4TU9A 3EGNA 2MQLA 2CQ0A 3FEYB 2PE8A 3NMRA 2V94A 3FEXB 1SJRA 3MURP 1SJFA 1WHWA 1M90T 1WEZA 4ED5A 2CPDA 3BO2A 2VONA 2CQDA 4LJMA 3US5A 2WBRA 1U1QA 3CULA 2DGTA 5GAGU 2PEHA 1IQTA 4U67Q 1VC0A 2HZCA 1DRZA 3G96A 3TP2A 1X5PA 1RKJA 2XS5A 5EN1A 2LYVA 2DNKA 3UCGA 5JVGQ 3MXHP 1JJHA 3SDEA 2YTCA 1R8PA 2CQHA 1WHXA 3MI7X 1D9AA 2DNNA 1FJ7A 3EX7B 3G8SA 1H2UX 5IM0B 2N82B 1VQ4S 2MJUA 2G0CA 2B0GA 2E5IA 3VAIA 1VQPS 2MGZA 2RU3A 2L9WA 1XN9A 4ERDA 4WIIA 5FJ4A 1H6KX 3S6EA 2M8DB 1QVFR 2OSQA 3MD1A 2MZ1A 1DHMA 2DK2A 4CH0S 2KYXA 1ZZNA 2D3OR 3U1MA 2X1FA 4M5DB 4C7QA 2LA4A 4LIRA 2M88A 2J0QD 1FJEB 3CMES 1X4EA 2EK1A 2VOOA 3NNCA 2L08A 1WG5A 4V19X 2ZJRQ 1HA1A 2DH7A 2RT3A 1U1KA 3B4MA 1JJ4A 4PR6A 1ZH5A 3CCQS 2XNQA 3MD3A 1UFWA 3Q2SC 1VBXA 2AYEA 1WF1A 2MGZB 1DZ5A 2DGUA 2DGQA 3TO8A 1DBDA 3CCVS 1WHVA 4TU8A 2LMIA 2LCWA 3CUNA 3EGZA 3LPYA 1NU4A 2RS8A 3BEGB 3I56S 2MKHA 2KT5A 1WEXA 2MKCA 3MUTP 1NO8A 2MQNA 2DIVA 4QU6A 4IUFA 1X0FA 2F9DA 2K3KA 2QA4S 1SJ4P 1X4HA 1P27B 5GAHU 5LJ3Y 1U1OA 1M5OC 5DM6Q 2DB1A 1Q86T 2LQ5A 2X1AA 1VQLS 2E5JA 2F9JA 3D2WA 2MKIA 3PIOQ 5ITHA 4QPTA 2HYIB 3ZZYA 2MQPA 4CIOA 2KG0A 2MQQA 3HHNB 5CA5A 1S79A 1WF0A 1U1RA 2CQIA 2EVZA 2CPFA 3MDFA 1YJNS 2U1AA 2M0GB 4F25A 5GAEU 2MY7A 1BY9A 3CPWR 2LECA 2A3JA 2JVRA 2UP1A 1OO0B 5HL7Q 2FC9A 2L41A 1P1TA 1VC5A 2LA6A 1VQOS 1OWXA 2FY1A 1JJ2R 2G1DA 3VAGA 1M5KC 2HVZA 5IM0A 1QM9A 3H2VE 5LXRA 2F3JA 1M5PC 2OTLS 2DO0A 5DDOC 2OIHA 2AYBA 5H1SV 2MZRA 1HL6A 3Q2TC 5IFMA 2MY8A 5D77A 5GADU 2OJ3A 2VODA 4F02A 2KM8C 3CC4S 2RRBA 2J8AA 3ZZZA 3LQVA 4PKDB 1UAWA 1K73T 1YJ9S 1PO6A 4C0OC 2BZ2A 1VC6A 2DO4A 2DHAA 5LSLA 1VBYA 3CCJS 2DNQA 3P3DA 3S8SA 1VQNS 3N9UC 4QQBA 2XS7A 1OIAA 1N52B 2LEAA 3BO4A 1YITS 1KQSR 1O0PA 1WELA 1WTBA 4IOAQ 2E44A 3CCUS 4IO9Q 2LKZA 1VQ7S 5CXTA 1URNA 3R27A 2MQOA 2OTJS 2CQ1A 1SJ3P 4WFNQ 2MPUA 2XNRA 2YH0A 2CQBA 1YWXA 1QVGR 2DGWA 1FNXH 2KI2A 2GHPA 2MJNA 1X4AA 1JMTA 2DHXA 3NNHA 2D9PA 2N3LA 2HGLA 1Q82T 2VOPA 3J7ZT 2ZJPQ 2CPYA 2DNRA 2BOPA 2ERRA 3NS6A 1K9MT 1N88A 1SXLA 2O3DA 3G6ES 2M52A 2Q79A 3P5TL 2MKJA 4EGLA 2ADBA 1YIJS 1WF2A 2NLWA 2DHGA 4YB1P 2XS2A 1D8ZA 1VBZA 1L3KA 2RQ4A 2CQ3A 4Y00A 1CVJA 2MMYA 2RNEA 3B4DA 3G4SS 1WEYA 1WHYA 2DH8A 4QU7A 2CQCA 3THPA 2X1GA 1U1MA 3VAJA 1M1KT 1VQ6S 4TU7A 1YI2S 1UW4A 2KN4A 2MB0B 5HO4A 2DNPA 3S01A 2DGOA 2CPXA 2RVJA 3UCUP 5IQQA 5GMKa 2I38A 2U2FA 2KXNB 3PIPQ 2CPEA 3UD3P 4OZ0A 1KOOA 3CC2S 2DH9A 3L3CA 3CC7S 4WF9Q 1H2VZ 2EK6A 4ZKAA 3CMAS 3CCES 1FT8A 2DNOA 3R1LA 3VF0B 1WI6A 2CJKA 2QFJA 2JRSA 2LXIA 1Q7YT 2KM8B 1VQ8S 2AYMA 4UY8T 1X4FA 1FJCA 5LSOA 3CD6S 2J0SD 5JVHQ 3HI9A 5DM7Q 1W2BR 3J7YU 3VALA 2AD9A 3K0JA 2HGNA 3U1LA 2DGVA 4P6QA 1K8AT 1A7GE 2HGMA 3CTRA 3V4MA
chains in the Genus database with same CATH superfamily
5U47A 3HX9A 2JX2A 4OV6A 4R8UA 1DTTB 1X4BA 3D0GE 2BUNA 4RNNA 3OBIA 2E5GA 2EFQA 4C0HA 5DRKA 5B0FA 1GTEA 4OZLA 4ZHRB 2O5DA 3QZ8A 2I2YA 1S72S 1AFJA 1HD0A 1T95A 3CD7A 2J9EA 3L9ZA 3ZTRA 4PG8A 2KXHA 1WI8A 1Q81T 1FNMA 1R89A 2XSJB 1NRKA 1FEHA 4KTQA 2VPZB 3TUJC 4S0MA 2FC8A 3ULHA 1RU2A 3GE9A 4HI1A 3M6VA 2FZKB 2AF6A 1JXEA 2QMXA 3RW7A 2L9NA 2FVSA 1RAHB 1FRIA 3BR8A 3LP1B 3NLCA 4PXCA 3CCSS 1UVJA 3T5LA 1NJXA 2OI2A 1UEKA 2BW2A 5RUBA 1YKWA 5ETLA 4P2XA 3J7A1 4A8WA 1Y00A 4NZ7A 3KLEA 4URQU 1L3TA 1UP1A 1IN0A 1VQ9S 5T7LB 3PW4A 3RB6A 1UVIA 4DLEA 4N7TA 3DM2B 4O0NA 3V81B 3V6DA 3N6LA 3GJSB 4UY8T 4J9UE 3X1LB 3TUPA 1SCJB 2ZC3A 4JI7J 3QJPA 2GZOA 2F5GA 4NLYA 4RW9B 4CO2A 4LF1A 5CYMA 4NCAA 2BJ9A 1FJGF 5A8KA 1M5VC 3FVYA 3C8YA 2DNMA 2YKAA 3W9IA 4PXBA 2NZ4A 3OVSA 1U6ZA 1X4DA 4FXVA 3VZIA 2Q6CA 5GVQA 5K20B 4ID8A 2N7CA 5J2PA 2WTFA 1X5TA 2UXCJ 1S6QB 1U7LA 4UOGA 4Q45A 4WYLA 3M32B 3Q8RB 4B3SF 5F3TA 2HFOA 3OL6A 3QRPA 4JI6J 5ETRA 3AD9C 1U6BA 2HFNA 5GMEA 4CLUA 3KTQA 2XB2D 3MF5A 2CQ2A 1K47A 1FO1A 1OYDA 2ZVSA 3IG1B 3R5GA 4NX9A 1FCAA 5DG8A 1F5BA 3M2RA 3B8HA 3H2UB 4X4OA 4ECSA 2FVPA 2NSBA 3BREA 2AGPA 3W5ZA 2JFKA 2LQJA 4Y28C 4ZVQB 1U6FA 4RZRA 1C0TA 4F26A 2DISA 1EAYC 2YQ0A 3HZEA 2DBBA 2GQCA 4I2QA 3KK3B 2W9AA 3BKTA 1UFLA 2J7UA 4O44B 2DTJA 4CI0B 3VGUA 2FHOB 4ELTA 3CDBA 3NXZA 4ZHRA 2R8JA 1HNWF 1AZSA 3UDLA 3ILLA 4NMXA 3BV8A 4DL2A 3VAMA 1JLQA 1N0VC 1T9WA 2CPIA 4ZP7A 2P8IA 4TQSA 4E2FB 1N54B 3MM9B 4UQTA 3ZZUA 2ZC4A 2GX8A 2I8EA 1WC0A 4OHVA 3QT8A 5DDPC 3LP0A 1JKHA 1UL3A 3LA0A 4OYWA 1N5YA 2XCAA 2YNFB 2X3GA 2R2SA 2VASA 3CCRS 2MYFA 3TUZC 1VRTA 2LXUA 2VFSA 3CJRA 3HHEA 2VJVA 3ZTPA 3F44A 1R7IA 2AEJA 2QYCA 4Y2CA 3N6NA 2GW8A 1U8SA 3A1YG 5KT4A 2RKIB 2XMAA 1NCLA 4MT1A 1T3NA 3R7NB 3RB3A 4DEZA 4DL3A 3OFGA 1P1LA 1C2PA 2DNYA 4WFXA 1Z4UA 4Q8FA 4FYVB 4XO0A 2DEIA 2M8HA 2WVFA 3MUVP 4JI2J 2GO8A 4FF2A 3QNWB 3LTOA 2YNHB 2R7RA 3T1YF 3MECB 1TL1B 3R97A 4AL7A 1JNZB 4ENOA 1KVJA 2QL5B 1XNQJ 1WWHA 2CQGA 2MHNA 3KJNB 4O4RA 4WXWA 4YEAA 2RS2A 1I94J 4YUDA 4B02A 1RBAA 3POTB 1RHKB 2OEMA 4HEA9 3C6UA 4WP3A 3M9OB 3PO5A 5AXLA 2VB6A 2K1RB 3NGRA 4O4GA 2OMLA 3N79A 2OGUA 1FDBA 3JSMA 1X4CA 1RT5B 3DLJA 3HCXA 2CPZA 3LANA 4LBHA 4MIWA 4X4RA 4IOBA 3Q8PB 1RZMA 3T3FA 2OO4A 1APSA 1HI8A 5BR8F 1GFWB 1VI7A 1T9UA 1R8HA 1UMJA 2C2ZB 2CQPA 5D0RA 3TAPA 3D1HA 4OZ2A 2VV5A 4RW4B 5ETKA 1WDTA 3BQ2A 4GC7A 3H7HB 4K7QA 4GC6A 4LRFA 3RW6A 2RF2B 2VG7A 4DS4A 2K8GA 4QW8A 1YZ6A 2GCFA 2HLTA 3R7SB 1DQAA 2R8IA 2XBPA 1XNQF 3DXSX 4BS2A 1EARA 2QLJB 4IYQA 2DNZA 4OI0A 3MEEB 3PRVA 1XMQJ 4V1Ak 1CQMA 1W2IA 2PA8D 3W3SA 1HWKA 3NMRA 3EWGA 1VJWA 4QWCA 4B3OA 3A8IA 1SJRA 4ZP6A 4F2RA 4GKKF 3M6XA 4PZVA 1SJFA 1WHWA 3K58A 3FFIA 1CQNA 4CM2A 3VGTA 1WEZA 4ZA1A 4N56A 2AIRB 3V2UC 3T6JA 2ACYA 3P45B 1J5EF 3D0IE 2E9TA 1TL7B 2XYGB 5ETTA 1GTHA 3EM1A 3M8PB 5HQLA 1RU1A 1YRXA 1NJWA 4ZVRB 5B0CA 1R0AB 2Z57B 3G86A 2AT1B 1KTQA 3CIMA 3T9NA 4PXDA 4ECWA 2IM1A 1WC5A 4LFAJ 2HZCA 3JSYA 3DRRA 1TL1A 5CZXA 3TX8A 1UFKA 4BWJA 1GX6A 4DWIA 1B0VA 4C8OA 1LWFB 4F4XA 1DTQB 4DR7F 1JLCA 4D3HA 3LF0A 3IGNA 2AQ4A 2FGCA 4LF4F 2KJWA 4USTA 2LYVA 2ZD1A 4ATNA 3OL9A 3SFUA 1KLMA 2KL8A 5DJBA 1TL4A 1R8AA 3NAIA 4FPRA 3PO4A 1QAXA 3KOAA 3PHTA 4P71A 2ZHBA 1OS5A 1DY3A 1RKIA 3G82B 1AUSL 3MMJA 5IQ6A 1WHXA 2QLXA 4ED4A 2VBYA 4QIFA 2GAHC 4CM0A 1U8WA 3W2WB 1GX5A 1F5AA 2IAJB 3ENVA 1HHQA 2ZBQA 3I6PA 3I9V9 5CQGA 1PC4A 1XR7A 1EETA 5IM0B 2N82B 3JSMB 3LWMA 4RW6B 4DL4A 1P6TA 2IMWP 4DCPB 1FE0A 3OL7A 2B0GA 4N5SA 3VAIA 2HW3A 1VQPS 5K8OA 1RT7B 2AP6A 3ICLA 4M5MA 4WWSA 3SCIE 5I3QA 1HNIA 1SV5A 3AB2B 1F9HA 4C8NA 2RU3A 4IR1A 3K89A 4YB6A 4O44A 5H9FJ 5FJ4A 4CWBA 4J9SA 2Z30B 2M8DB 1IKYB 3BGOP 5CCLA 3MD1A 1RT4B 4M5GA 3OTBA 5AXKA 5KT3A 2GHWA 4CH0S 2PT0A 2MEWA 2CRLA 1JLFA 1ZBTA 2X1FA 2ALZA 4KH0B 2FUG9 1T8EA 4DV7J 2BE7D 3H5YA 3C15B 1XMOF 1BUXA 4P52A 5KFWA 1T9YA 3MM8B 5F3ZA 1GNKA 4M5NA 4BC7A 1JLEA 5F0UA 1HA1A 4LBPA 1REVA 3BDPA 4DQPA 1PIEA 1C1CB 3BGFA 2IHR1 4QWEA 2YNFA 5DG9A 3C6TB 3HXMA 3DDKA 4XK8C 3B4MA 2N4DA 2E7WA 1FK9A 3TOQA 3Q89A 2VG6A 1ZYQA 4WBFA 3MD3A 4X64F 5KG6A 3CIZA 3CMQA 4TY9A 3O2IA 3NL0A 1CC7A 1N6QB 3JB9k 1RTJB 1RAGB 2YNHA 1LW2B 2UXBJ 1RTIA 1ITPA 3GFHA 1HI0P 1DTQA 4QR2A 3UO0A 3DOMA 2AU0A 1DZ5A 2DGUA 2DGQA 1MWYA 3C14A 1S1TA 4NCGB 4TKTA 4DI6A 5I4MA 1X7VA 3SQOP 5A8KB 5HLFA 2GFFA 2LMIA 4HHHA 1BXNA 2A10A 2B6AB 3HDSA 4ZVEA 3BEGB 5KFIA 2FYXA 3DRPB 3IGVA 1O51A 3KDNA 3FDSA 3NRBA 4U8VA 4KHMA 4DUYJ 4YHHJ 3KHGA 3G6XA 4RW7B 4QU6A 1F3FA 2DCLA 2ILZA 3OQ2A 3E8OA 3UD5A 1E6VB 3GU0A 2X3DA 2GS8A 3TWZA 2K3KA 1H3DA 3KG1A 4AXIA 4C6AA 4ETZA 4J9NA 1SI9A 1XK8A 3RJMB 4OX9J 2IA0A 3HVRA 1QSSA 3W2WA 1VGYA 1U1OA 1VQSA 5DM6Q 4EYHB 4C11A 1SL0A 4L73A 2N7YA 3M8QB 4OYPA 4C0BA 3TQ1A 2X1AA 1RXOB 2A18A 1VQLS 1RSCA 3G2XA 4BCAA 2O67A 2F9JA 1CC8A 2DRBA 4Q43A 4J91A 4OYIA 3DN9A 4QPTA 3QJJA 5IT9U 4I2QB 3KK3A 2ZH5A 2QJ3A 2VA2A 1FESA 4LRDA 3T5JA 1FRHA 2ACMA 2CNOB 1FVQA 2W24A 2XMVA 5HI7A 1UEVA 3QAUA 1S59A 4DUZF 4KRWA 4I1TA 2YQ1A 2GVDA 1YSJA 2BW7A 2JNJA 2FHJA 1RT3A 1XBWA 3GR0A 3IRXA 2XSJA 1LNQA 3LW5C 3M2VA 1UPMB 3H5UA 4LF2A 3ZTSA 1TKXB 3RU0A 3K5MA 3IRXB 2XG8A 1V5IB 3ENQA 4F25A 3CPWR 1BY9A 1EQ0A 2BR0A 4L6V3 1QJHA 4BBYA 4RR5A 2JVRA 4A8YA 2UP1A 2Y9HA 2FC9A 1FRMA 2FJDB 5A6WA 1I3OB 3H59A 4KQZA 1OWXA 2AV5A 1VQOS 1N56A 4NLRA 1BGXT 3DRRB 2WAQD 2HQFA 4JV2A 1S9GB 3MMAB 4NEYA 1R8CA 2JHEA 2V9KA 2WW8A 2NZCA 3H2VE 3MOZA 4PAAA 5HBMA 2HRUA 4CO4A 2DRDA 3F41A 2DO0A 2Z2ZA 5DDOC 2PI5A 2DPJA 1HBUA 3H42A 5H1SV 1ZETA 1HL6A 4IFYA 5C25B 4NLDA 1HBUB 2PMHA 2MY8A 2V8PA 2OJ3A 1LK5A 2VODA 3RUBL 2KM8C 4XTTA 3QJLA 3CC4S 1S7HA 4DX8H 4XDDA 2YX4A 2ZM6F 2CYYA 4I4BA 4ECRA 5DQGA 2LFVA 2CNKB 3ZFVA 2KO1A 3OL8A 1YJ9S 4L72B 1HNWJ 1KONA 1PO6A 2HPUA 2DO4A 1OQ6A 3HSJA 4ZPWR 3MFIA 2GMJA 2ZBCA 4NWBA 4A8QA 1S76D 3KHLA 5LSLA 1F0XA 4KT0C 2LQ8A 4OQJA 4C8KA 2V5HG 4OI6A 1Q79A 4NRTA 2DR9A 2DNQA 3CJQA 2XLJA 2HVIA 2PA3A 1JWWA 1RT5A 2OEKA 4F3MA 2YKOA 4MFBB 4HHUA 4OZ3A 4EBDA 1OIAA 2AZ3A 3BO4A 3H0PA 2W4PA 3K8WA 1NNDA 3ZZPA 1RBLA 4CLKA 1MROA 2BJDA 2HIQA 4RKUC 5HVGA 2HMIA 4Y34A 5F0WA 3MEEA 4RUHA 1FJGJ 1I6JA 2MQOA 1WSRA 8ATCB 4C8ZA 4F8RA 3Q0AA 4A4JA 2BYCA 2HQGA 2ZITA 3ONQA 3VV2B 1IR1A 2XNRA 2YH0A 4MMOA 4XAKA 1MU2B 1Q5VA 3ZO7A 2CQBA 5F8LA 4IO1A 2JLEA 3L95X 4JI5F 2DGWA 1Q1KA 4WFYA 3LP0B 2KI2A 4AL5A 1FTCA 4ZLNA 1KTVA 3ZNUA 1NJZA 2YKNA 1ACMB 2XQCA 2MJNA 4K50A 2FHKA 3MM9A 2G0JA 3D0HE 4ZPDA 3TEGA 2V67A 2R7XA 3FCVA 3BGRA 2N3LA 1WC6A 4HACA 1IBKF 1Y4ZB 4IDKB 4DHVA 2QGFB 4JP8A 3NGSA 1H7WA 4QIEA 3MR3A 4JI5J 3QGIA 3M30A 1RWPB 2ZOGA 2XZTB 4ZVGA 1UWBB 2RDIA 2R7SA 4OIXA 3DRXA 2QFIA 5DO2A 1JLGA 1PJ7A 2CDQA 2LU2A 3MECA 2YNIA 3R5JB 4DXLA 1SXLA 2C3MA 3C14B 4NCGA 4USMA 1Z2LA 1YBAA 2AX0A 1IBLF 4ZP9A 4K4ZA 2MKYA 5HMWA 4UQGA 4NXMJ 4EGLA 4I7FA 2IJNA 4HI2A 1JLAB 2DHGA 4I2PA 5DQHA 3U27A 2D3UA 3UPFA 4EBEA 3ENWA 2RE1A 2CQ3A 2J7WA 2P6SA 2RQ4A 2V2KA 2UV8A 4Y00A 3W65A 4EMDA 2A2CA 1NPPA 1NJYA 1FHTA 2GC8A 2IAJA 4CT9A 2XC9A 2DRAA 3M32A 2I5JB 2C2KB 2R7TA 1TKTA 3BSNA 2YWEA 1YVFA 1RWVB 1TKTB 2FHMA 4E0DA 4Y2MA 4P7TA 3AT1B 1VIOA 3H25A 4J9VA 3R6LB 3VAJA 1EB0A 1M1KT 2QO3A 4TU7A 3C16B 2XMJA 1J5EJ 1VQ6S 4M94A 6FD1A 1WNEA 1SL2A 4KGMA 1C0UA 3KLFA 5HO4A 1XERA 2DNPA 4LSNB 1R8BA 4M5KA 1SV5B 3N5FA 4NXMF 5HMYA 2AJ2A 1NK4A 2XEXA 4OZ5A 5AE1A 4ID5B 2BKPA 2E5LF 3PIPQ 3MM6A 3IAM9 5F8MA 2HRTA 2CPEA 4I67A 5DQIA 2HHQA 4Y2KA 3SCJE 2BEFA 2C3UA 3H90A 1WJ9A 3H8YA 2DH9A 3CC7S 1S0NA 4DPOA 4NXNF 2KJVA 2UVRA 2UVUA 2EK6A 2V34A 4RBVA 3TEHB 4C3MA 3CMAS 3CCES 1XQIA 3LAMA 5CCMA 2DNOA 2VL1A 3NCQA 2CJKA 1PKUA 3H5SA 1MU2A 3K57A 4NLWA 3MEGA 1N32F 3AODA 1ROFA 3ENAA 3LUYA 4MKVA 1T3OA 2NUHA 1NAQA 4PPDA 1NDPA 4MKYA 4CLSA 4DZ6A 1SUQA 3I0RA 2HQIA 3LP1A 3SIPB 3RBZA 1RWOB 1YJVA 3EXYA 3EGWB 3HI9A 3OJSA 5DM7Q 3J7YU 2GVZA 2QSFA 3DI6B 2AD9A 4H4MA 4ECVA 1WOOA 4K2JA 3M05A 5KFBA 1IUJA 2V63A 4EO6A 3OJUA 3T5HA 2GGPA 1U26A 1GMWA 1EJ7L 3N0VA 3TZZA 1GMWD 3AY0A 3I9ZA 3OTEA 3V4MA 1HHSA 4RW9A 1NB2A 2FPHX 4LRBA 4O23A 3UE2A 1V9OA 2Z2YB 2ZH2A 4IOCQ 2A6OA 2WW4A 2C3YA 4RWWA 3ET6A 4IFYB 1VQKS 1S1UB 4K5RA 5KFQA 4FVMA 1HWIA 1LOUA 2H48B 4B9LA 4HVZA 4DX5A 2KT2A 1N32J 1G2EA 4CH1A 5EUHA 3I55S 2V8VA 3O6QA 1RTDA 2DIUA 2HK2A 4RUAA 2I9SA 4Q44A 1IKWA 2R7QA 4H4OA 9RUBA 4HL9A 1S6QA 3B6BA 4MTPA 1YX2A 1DURA 1B7FA 1HW8A 2CPHA 2FJAB 2YX7A 5L39A 2CZ9A 4USWA 4J9PA 5D0EA 5E7OB 2XHCA 4B3SJ 4CQ1A 1T05B 1J5OA 3CXCR 4FS1A 2B3TB 2C1EB 2YWKA 2HURA 4IRCA 1NH7A 2W4CA 1S1XA 2COLA 4CTAB 5D0GA 2VPWB 4QWDA 3OPKA 3CCMS 2RF2A 2VG7B 2B5JB 5JXSA 2BDPA 3SMZA 3DKDA 3LOUA 2UXCF 3K0JA 3HSDA 5KG3A 2BE2A 2RHSB 3NAHA 3TZYA 4XPEA 3TUIC 2W1BA 2R2UA 2M4MA 4PPZA 1RT6A 2R2TA 2XYPB 1MG7A 3PJWA 1S4EA 1RT3B 2ZOFA 3JQMA 4O3NA 1VQMS 3DYAB 2A6MA 2BRLA 1PJ6A 3OTCA 1TKDA 4G1QA 4XIUA 3IR5B 4LUBA 4Z7YA 1NSAA 4F0KA 4DQQA 1N5YB 4J9KA 3OFEA 1ZTWA 4J5OA 3LGMA 2OPRB 1CS4A 4YY3J 4RUCA 2HZVA 2GMLA 2DCUB 3UDVA 4NLQA 2XLIA 3T41A 4PQUB 1TKZA 2NPIA 4KYZA 3DLKA 4IRKA 2ILYA 3D5MA 3KLGB 5D78A 4NI2B 3VQSA 3GV8B 3G9CA 1F6TA 2DY1A 4DG1B 2RRNA 2E1AA 3W8GA 4DJBA 1U1LA 1XMOJ 2DXDA 3G6YA 2G4BA 2J7KA 3D1OA 2OKQA 4DF4A 5ETMA 4FDFA 3NWGA 5HBMB 1BQNB 2CJYB 3CWJA 2V69A 2OSRA 3PJXA 1V3ZA 3CJ8A 3QO9A 1MMNA 1TK5A 3QBCA 5CYQA 3DLGA 4OYMA 3DOMB 1SKSA 3P6YC 4DDFA 5B0BA 1CJKB 1DLOA 1X31C 2B7CB 4DN9A 2X1BA 3SSQA 2O1PA 2HQCA 1QUVA 2NXCA 4G6VB 5J1EA 4WCEQ 3LAKA 2FLLA 5CD4A 2NSCA 1FX4A 4F50A 2BKOA 3I5CA 1KN6A 5KFCA 1E6VA 3KLHB 2Y0SD 2Y0BB 2UUCJ 1F60B 2RQCA 2H5EA 2ZNYA 3GFXA 3J7YI 2HNYA 5B7WA 2W2QP 3MM5A 4E8UA 3OLBA 1HNVB 2M2BA 4Z2XA 3T1HF 2LVWA 1QE1A 1RQ0A 3AOAA 4TLQA 2WSEC 3GG1A 3S7RA 1C0UB 3QIPB 2ZH4A 5D8HB 2LU1A 2KVIA 3OUYB 1GXTA 5DETA 3K5NA 4DV0F 2KFNA 1JJCB 1VCTA 1NSKL 3OD2A 4HDHA 3HMJG 4YQWA 4JI4J 4Q0BA 4OX7A 5A2QU 1KWMA 3TJ8A 3N5BA 1F9FA 3TAMA 1RT7A 3TX0A 4A8MP 2CWKA 2RDDA 3IM9A 1OQ3A 4PXEA 4FBTA 2D9OA 2JVOA 4L76A 2H1YA 2D69A 2YWWA 2BM0A 3IBCB 5I3PA 4WFBQ 3C19A 4OI1A 2G2YA 4DUZJ 1ZA1B 2CZ4A 4FXWA 4JI4F 4PQAA 1PGZA 4A48A 4DQIA 4WZMA 1AZSB 1IKVB 1RAEB 2C3PA 5J2QB 1QSLA 2FLNA 1C1CA 1ZM2A 2OD4A 4DR7J 4ZCLA 4JUZA 4N77A 2BA9A 2E5HA 4B3MJ 1Y9OA 2ROPA 4WJBA 3WX8A 3JYTA 2KHCA 2RSQA 2BRKA 5B0AA 1R43A 5DDRC 3UD4P 2UUCF 1WG1A 1RWKB 3W1YC 2MKKA 2HS0A 4QYRA 5M2PA 4F2SA 4UOHA 1N8RT 2DR7A 1RB0A 2VG6B 2BJEA 5JUMA 2EBEA 3G71S 4KPCA 1KC8T 1JNRB 3TVKA 4MYTA 3ZNJ1 5HVFA 4PG4A 4LF7J 1VK8A 1VS3A 3IA0A 2JC1A 3QGGA 2MSSA 1JLGB 1B7YB 3QPIA 4OFZA 3TZWA 1ZA2B 2L3MA 3OTOF 3KLEB 5HSPA 1UWBA 1TELA 2EEYA 2EI5A 2M5YA 3OXGA 4NLVA 2QA4G 4RLEA 1R27B 5EX3A 3GIIA 3CF5Q 1BQMB 3P8BB 4DV5F 1S9FA 2CQ0A 3FEYB 1CJKA 3A8KA 2V9WA 3FEXB 3QT7A 1U47A 1NXIA 5KFDA 3DLGB 3M6UA 5E2QA 5KFMA 2MQ8A 4H4OB 3HVAA 1NKEA 4CLTA 4KHPJ 1P8GA 1XIQA 4ED5A 2CPDA 2JOQA 2V2VA 4C98A 3BO2A 4LSLA 2VONA 5F8NA 2GNKA 3W2VA 1H73A 3A8JA 3L4BC 4ZVFA 2WBRA 3PTWA 4DSKA 1PAUB 1RTZA 2ZE2B 1OPZA 3AQOA 5KFTA 3MWBA 5JMNA 1T03B 3CULA 3E2EA 2DGTA 1DFDA 1AB8A 2MHEA 1HQUB 1EQMA 2WVBA 3HHKA 3HF5A 3MHYA 1Y5IB 3BN4A 3AD8C 3ILOA 1IQTA 4AE5A 1FFWB 1VC0A 4DR6F 2OPPB 1B0PA 4ZJOA 1HNIB 1R0CB 1HHTP 4B9VA 4DS5A 3W5XA 1HWUA 5ETSA 3QT5A 3UI3A 3AB4B 3GSIA 4DR3F 5FLXU 4RW8B 5EN1A 4AFFA 2EW9A 4CLFA 4QR1A 2XCPA 4Q7AA 3DLEA 3HHLC 5KT7A 4ED8A 3K5PA 5JVGQ 3PYDA 3SDEA 4DR4F 2EWHA 1R8PA 2HS4A 2GQ2A 2Y8YA 4C4WA 2VF3A 1S10A 1OMSA 3OLAA 2DNNA 1V3SA 2WHOA 3WZ0A 4LR9A 4HT7A 5F8HA 1Q0NA 2G2ZA 3M2VB 5KG7A 4X4PA 3EX7B 2E7XA 1S9GA 3MMAA 5KAKA 5LSRA 2MJUA 1M5SA 2QTWA 3PYFA 5HQ8A 1S99A 2BXJA 2DJWA 3PX0A 3Q83A 2WVDA 5HMZA 2B9WA 1D8YA 1VMBA 1U24A 3CT9A 3FEZA 2PFFB 2MGZA 2L9WA 4NLPA 3W9HA 2BANA 3A3NB 4AYBD 3OHAA 4K4XA 3S6EA 3LGNA 3SSSA 3ZZRA 4P2SA 1SKRA 1QVFR 3KUEA 3B82A 2VFRA 4FYWB 4R5PB 4ER8A 1YK9A 4AQYJ 2DK2A 2FJVA 2YNGA 3JAMU 1JLBB 5CH7B 3MFHA 3ZZ0A 2QLBB 2CG4A 3U1MA 5L1KA 1JX4A 3PY8A 5IT9Y 3BYRA 3M8WA 1Q16B 3RAXA 2CDRB 2BV3A 2M88A 1Q53A 3A3OB 1M5HA 2J0QD 3C6UB 3CMES 1X4EA 2EK1A 3M8SA 2VOOA 1SBRA 5G0RB 2B51A 3NGTA 5KFGA 2E7VA 9ATCB 4LFCF 3E01B 4V19X 2B9EA 4TY8A 3SBMA 3PEHA 4USHA 1U1KA 2EBGA 2GIFA 1SH2A 2P5VA 5HATA 1XNRJ 1K0VA 3W62A 1KFSA 1B4SA 5H9FK 1NEEA 2IDLA 1EHWA 1YG0A 1GAOA 4C11B 2OMOA 4CTAA 4F0MA 3W2VB 4F36A 4LSNA 4KV8B 4ZJQA 1RYSA 4Y2IA 4Q0BB 2XNQA 2XMKA 1FVSA 2HAFA 4X62F 2HZAA 4PYDA 1UFWA 5K9FA 5I3UB 1QAYA 5EDWA 3MR6A 5LOQA 4DR2F 3HSZA 2FB0A 2AYEA 5F9NA 3RRHA 1RABB 2R7OA 2C42A 3EJMA 3IN5A 2A0FB 3QGPA 4RO0A 4B3TF 1LQ9A 3QRRA 3CB4A 1RISA 3N6MA 3CCVS 1R6VA 3MM7A 4TU8A 1RGVA 4ZPBA 5C2GA 2K7JA 2LCWA 5A8RB 3M6WA 1WKKA 3LPYA 1HLWA 2FZGB 2RS8A 2V2QA 3QYYA 2E1MC 3LO3A 3MEGB 3PKYA 4DV0J 4H4KA 3DC2A 4C3LA 1FFSB 2HIYA 1FWPA 4WE1A 2MQNA 2RILA 4EO8A 1F2GA 3K17A 3TZXA 1IJEB 4ALZA 3Q24A 4E98A 5F8JA 4JI3J 1XWLA 1TK0A 5C7PA 2W2OP 1Q8BA 1UEUA 4FYYB 4PG5A 2FZCB 2YPYA 3EXCX 1XJWB 4YMEA 3PW7A 4K4YA 4LF8J 1ZS6A 3DMJA 4O3RA 2OFGX 3SV3A 2DB1A 4H4MB 5D4NA 1RUSA 4DSFA 1Q86T 1M5OC 3MAQA 2LQ5A 1LW2A 3LP2A 4QJVA 1RE1B 5FLXY 2NR0A 1PBAA 3GIKA 3LGHA 4DQSA 4JI3F 2EG2A 2CNLB 1RT1A 3PIOQ 1RT2A 4OV1A 4B3MF 1W7WA 3ZZYA 1TZ0A 4CIOA 1IR2A 3MAAB 3HHNB 4NLTA 5MAOA 5J1NA 3O3LA 3M1VA 4ZJLA 4JB8B 2XM3A 3FQKA 2EVZA 4RNMA 4NLUA 2IRUA 4DF8A 1KSPA 4NMLA 1YQHA 2G13A 1GXUA 1VK3A 2JC0A 4ZPTR 3W61A 4QW9A 1NK0A 3BPSP 4QIVA 4KGXB 4LF8F 4IKAA 3VTIA 1FWLA 4F4AA 4GMKA 4LIWA 2HFVA 4NYOA 4CLWA 3L7UA 1NZAA 5HQMA 2A3JA 1RHJB 3EVOA 1OO0B 1R31A 3KXDA 5HL7Q 4Y6IA 4B9UA 2Z8QA 4FVCA 4LR7A 4NRUA 3IG1A 5KFUA 3KLFB 1KQGB 2EC2A 1JJ2R 2EPIA 1M5KC 3EDRB 5I3UA 5IM0A 1IKYA 4Y2AA 4OYAA 5LXRA 3OUYA 1M5PC 3KLGA 2IC3B 1TVRA 2XO6A 1AXQA 2HS3A 2B7BB 2UV8G 1NUEA 3V5RA 4EWTA 5IFMA 5GADU 2V4RA 4DX7A 3MZIA 3WBZA 3D7SB 3FZ2A 1GEHA 2RRBA 3FQLA 2J8AA 1KEKA 2F8MA 3AJ2A 2QZ8A 3ZTQA 4JI0J 2HQ3A 3MM7B 2DR5A 4ECUA 1DARA 2ZFHA 4C0OC 1TFYA 2P6TA 1RAIB 2HVEA 4GO5X 4LRCA 1AT1B 2E9RX 5THWA 5KG1A 1VBYA 4KY3A 1PSDA 4DG1A 2UVVA 4H4KC 4LF6J 2UXDF 3BSOA 2DXEA 5F9LA 3P3DA 1S9EA 2L9DA 1Y3JA 4MK7A 1L3VA 3O44A 3N9UC 1HQ2A 4ZIVA 4K0KF 1Q8LA 3RG6A 4BHQA 5KG2A 4X4QA 2J9DA 1R0AA 4B9SA 4LFCJ 5B0DA 1F1BB 2LEAA 5EX0A 1VLOA 5A0YB 1SH3A 1YITS 1WTBA 3FGVA 2XY6A 1T9VA 5T7LA 4YR0A 3UN2A 2AMCB 2LKZA 1F3VA 1VQ7S 3K8VA 3GJTB 3G6VA 2FLOA 4ICLB 2IM0A 1SL1A 3MGJA 4ECTA 1SJ3P 2JL9A 2YWHA 3I5BA 4KGVB 2CAJA 2E29A 4I56A 2HNZB 4UTGA 5IOLA 3RBEA 3A3PB 2C2OB 3CEDA 3NWRA 3Q8SB 2F4VF 1WACA 3NG8A 1QVGR 1K0TA 2GIQA 2AGQA 4OHYA 1N36F 2IM3A 3EYZA 1IKWB 1UZHA 1ZAXA 3SI8A 2AJ4A 3N28A 4UUXA 4YB5A 1X4AA 5AXNA 4JYAF 3GCWP 3PHEA 2IM2A 4W98A 3V6KA 1S48A 2HGLA 1RCOB 4WU2A 2CJXB 1RAJA 2IRYA 1URNA 1ZM9A 2E1RA 5ETPA 1WC4A 3M8QA 3HFZB 4U9RA 5KFHA 4EZ9A 2UU9F 3BN7A 3ZC4A 2ZJPQ 2VOPA 4UOFA 2XMUA 2W7PA 3G87A 4HHJA 4WFZA 2PC6A 5E3PA 2RQMA 2DNRA 1N34J 4HKQA 2ZWPA 2R9LA 1T05A 3MTKA 3UVJB 1OYEA 2ZDPA 2HWHA 3J81j 1GK8A 1K9MT 1N88A 3WC2A 2E1PA 1FKOA 1KBRA 2O3DA 4LF7F 5K5MA 1DAXA 1HYSB 3O8WA 2A1BA 4C8LA 1WF2A 5IT0A 4F3OA 4C8YA 3TNVA 1D8ZA 1MMLA 1VBZA 1L3KA 4OYBA 4NA1A 2VPYB 1RT6B 2R3VA 2F8EX 4FNIA 1URRA 1CVJA 2MMYA 3MM8A 2F8HA 4ILRA 3OXLA 5F8IA 1V6HA 3G4SS 1CG2A 4QU7A 2LDYA 3CO9A 4NA2A 4ZLLA 2C2RA 3SEOA 5L1LA 2FVRA 1MN7A 1ZAWA 1WUUA 4TXSA 3DDNA 1NDCA 2HBZB 3DGPB 4JI6F 3M2UB 2FDNA 3KNGA 1LKZA 5IZHA 2P9EA 4RBUA 1WC1A 1UW4A 2MB0B 4RBTA 3T5KA 2J8SA 1X8DA 2BACA 2ZWOA 2J9CA 3S01A 3FBBA 2DGOA 2CPXA 2IDEA 2WZ1A 4MIAA 1CJVA 1DQ8A 1T02A 3AA8A 1T94A 5HMXA 5GMKa 4ECXA 4LF9F 2KXNB 3MR2A 4EEYA 1BQMA 1TR0A 2IPOB 3CCWA 1U09A 3KG0A 1MN9A 1QY7A 5DLFA 4KPYA 1NM2A 2ZEJA 2CWXA 1HQEB 4OZ0A 3SQGA 2ASYA 3BH6B 3P5BP 1SJ1A 2PIIA 3MR5A 2XI3A 3KJVA 3L3CA 2XWXA 3CC2S 2BQUA 2QLWA 4KKOA 4C97A 3HULA 3MEDB 4YDDB 4UOCA 1NHKL 1FT8A 3R1LA 2VQFJ 1WI6A 3UDCA 2R2RA 3Q22A 2I5JA 3O5TB 3DLBA 4X4NA 2F63A 3ISZA 3JSBA 4DU7A 1T9TA 2KM8B 3LWLA 2XY7A 3GB0A 4NEZA 1FKPB 1FJCA 5F8GA 2VJUA 2QL7B 2VZ9A 4NZ6A 5LSOA 2V4JB 2WOMB 4DFMA 1FA0A 4PABA 4BLGA 3MCSA 1HR0F 2J0SD 3P96A 2WVCA 4TYBA 3WDOA 3M8YA 4IFVA 3W63A 4Q5VA 3VALA 3M2RB 4U96A 3OR1A 5IWAF 4EZ6A 1MW7A 3VCDA 1K8AT 1IBKJ 1RHUB 2BE9B 1A7GE 1QUPA 1G7CB 2VKZG 2HGMA 3CTRA 3NGDA 1DBDA 4WTOB 3OW2R 2QLFB 5EWEA 3NOGA 2IMOA 2RAQA 3OHBA 3CDAA 3DU5A 2UUAJ 1YRUA 2OFHX 4LQ9A 3TRGA 3THTA 2XHWA 1X5OA 2KXFA 3K5LA 1IKVA 5J2QA 1ZZFA 3RR8A 1JLFB 1S1WA 2PMWA 3D66A 2QV6A 3BBFA 3CJ0A 5DZ6A 3RB0A 3J81U 3GR1A 2W4DA 2AJ0A 5KFOA 4I6YA 3I87A 4F3QA 2Q66A 4KC5A 1S57A 1YJ7A 2LP4A 2ASLA 3KK2A 1H0HB 4IG0B 4OJ3A 2C3OA 1D1UA 1QTNB 2E66A 4K8RA 1SQEA 3FNNA 3GJQB 5IWAJ 1TL3A 1S1VB 2G1HA 3A8EA 3W8PA 3Q23A 1U49A 1RAFB 4USUA 2YH1A 5HP1B 2GHVC 5I42A 2UVWA 1JK9B 1N33J 4PCQA 5HAOA 1QAJA 4ZOSA 2XWYA 2WVEA 2JZ5A 3EE3A 3IMQJ 4KHRA 4QOTA 3VQTA 3IRWP 1D09B 3M30B 1PYTA 3NNAA 1A6LA 1EP4A 4NLGA 1V3RA 1CULA 1B70B 2Z2MA 5H9EK 5A6PA 1YTYA 2H65B 2YVSA 1JLBA 2YKMB 5L1IA 3UWTA 3PACA 5K14A 2HNDA 1NSQA 2VQEF 3D6HB 3MUMP 1AYEA 1M0SA 2Z2LA 2ZH8A 2QC3A 1U1NA 1N34F 2ZZTA 3EVMA 4DFKA 3BB5A 4OLOA 3M9NB 4ZK7M 4I7FB 2NXNA 3G82A 5C24B 3R1HA 1BE4A 2F40A 3UQSA 1KVIA 1NSPA 2VBXA 4UZCA 4ES2A 1BWVA 2ZHOA 1B3TA 3D6TB 2J76E 4HH1A 4OJ1A 2ADCA 2ZZMA 2JH3A 4ED6A 4IH7A 1RK8A 4DSJA 4K4TA 2XGQA 4ZCMA 1HQUA 3DOLB 4J9MA 1U2FA 2PFDA 2CVIA 1H74A 4M95A 3DLHA 1LFPA 5LJ5Y 2R7VA 1FXLA 1LXJA 5JJBA 2MKSA 4R8UB 2KU7A 4MFBA 4OZ1A 1NZ8A 2IVMA 2QSWA 4FKXA 2AJ1A 3HVTA 4CNZA 5L46A 1NK7A 1Y10A 4DPXA 4QZVB 3ZZTA 2KH9A 1KD1T 2P9CA 4KR0B 3TYTA 1HYSA 3IR6B 4RL1A 1NB7A 5MLCV 2LQBA 3SDEB 3GZ7A 4X66F 2V2ZA 1NDLA 1FNOA 1Q78A 2YPZA 1FDAA 1OPIA 3IS9B 4HTJA 1HPZB 5E3QA 2G0IA 3UFCX 3BO3A 1U1PA 4NE9C 2B43A 1FEEA 3JS9A 3TA2A 4A8OA 3SV4A 3Q8UA 4WKRA 2YY3A 5E3AA 1IKXA 1B99A 2UUBJ 1KR4A 4P73A 1UETA 3VAKA 3GQCA 4D3GA 4DPWA 1SC4B 2R8HA 2W01A 3V6HA 4IG0A 2LQ9A 5L8RC 1SPBP 5KFNA 1MWZA 1HFEL 2D1CA 2VFUA 3CCZA 4FKYA 3VWSA 4M5HA 2ROGA 4DFJA 4B3RJ 1Y5LB 1EKRA 1X5SA 1YRTA 1S9EB 1S12A 2Q6BA 1AA1B 2V8DA 4OLPA 5I42B 3DU6A 4R5PA 5HP1A 2CFXA 2GGPB 3P49B 1LWCA 3ITHA 3DI6A 2CA9A 3KUGA 3ETOA 4WP8A 3C3LA 1HD1A 3CJ2A 5A8WA 2ZH6A 1B64A 2Z56B 2QMWA 3FMBA 1HWLA 3AD7C 2HHHF 3FSYA 1NKCA 1N4LA 1P9YA 4JI7F 2E9ZA 2IYIA 3D54A 3O1LA 3VVUA 1HARA 3R3TA 5KT5A 4A8SA 5D3GA 4O4GB 2NCKL 4KFBB 3VAHA 2QL9B 5DLGA 2MZJA 1S7IA 3R5CA 5CZVA 2Q43A 6FDRA 4ZPVR 2CUYA 3J81Y 4RX6A 2W8LA 1SKWA 2D41A 4GO7X 4DV4F 2FLPA 3G8TA 2WCXA 2XTJP 2HRYA 1HNZJ 2H54B 5D4LA 1HBMA 2CPJA 1UVNA 1EZZB 2Y1IA 5GAGI 1VQ5S 3QSIA 1U0HA 5DDQC 1Q4RA 2QX0A 2MZTA 1HNVA 4U6PA 2ZH9A 4F7VA 4ZN1A 5IS2A 3SXLA 4LF6F 4C9DA 1H7XA 4RW4A 1X0PA 2XSFA 3CNQP 2Y1RI 4OI2A 4A46A 3R5DA 1CJTB 4PRFA 4P72A 3BGUA 2DNHA 4ZLPA 1PJ5A 4Y0FA 2GJIA 1YHQS 2HVDA 3FBFA 1RACB 5A8RA 2HFSA 4AXJA 5KG5A 1S1WB 3H4BA 1M1HA 3CO0P 3EGNA 4TU9A 1FXDA 2RH3A 1ZPWX 2RD5C 2V94A 5KTQA 1ZM3A 1L3UA 1BLUA 1BMQB 4J90A 1OY9A 2XYHB 1TV6B 1IQZA 1M90T 4WZQA 3CDEA 3EGVA 1E6YB 4Z37A 5LMNJ 3BQ1A 2CIMA 3H5XA 2L48A 3W9JA 3JYTB 1N5SA 1FK9B 1KVKA 1I5OB 2H4YB 3B54A 3C66A 3QQCD 4YHHF 4DFPA 2XO7A 1U1QA 1RBOB 3KYLA 1UVLA 1TUGB 4HACB 1IKXB 1OY8A 2OHDA 3JQJA 2DD8S 4JI0F 4FF3A 4ZCIA 5KFLA 1Y0HA 2EC0A 1WOPA 5GAGU 3DLKB 4N76A 4K4VA 1RT2B 4U67Q 1Y5NB 1DRZA 5J2MB 2IBKA 1WTFA 2Z58B 1FX2A 2DYAA 4O3PA 1HMVA 4X65J 4MIBA 3THVA 1JLAA 3DM2A 5ETOA 3V81A 1RKJA 2GV1A 1HMVB 4QPXA 3MEDA 4IR9A 2XS5A 2R4FA 3MAAA 1YGYA 3KJVB 1NMEB 2Z0GA 1RWWB 3UCGA 3MXHP 2GA7A 3DCAA 3NBPB 5G4DA 5J1EB 1S1TB 5DGBA 2R7WA 1ZOTA 5E5NA 5KT6A 3J80U 3IFEA 1VRQC 1S6PB 5KG4A 1H98A 1RAOA 2V68A 4ZVOB 3RTVA 2AGOA 1XC9A 4ECZA 4DV6J 3P4UB 5D3GB 1D9AA 2FJBB 2J6SA 2FJEB 2V4JA 2AW0A 2JFDA 2WOMA 2IJFA 3D6FB 1HBMB 4LSZB 4TY8B 4ETXA 4QYZJ 2QT7A 1V5VA 1H2UX 3Q8QB 3G8SA 3NKYA 2FJXA 2XMWA 4USVA 2KT3A 3D67A 4X65F 1RCXB 3CJ4A 2HNYB 1KQFB 5BR8J 4N41A 4HYKA 2WONB 2MLXA 3KMQA 2JEJA 3M9MB 4ERDA 4WIIA 4K59A 2W9BB 5SZTA 1IBCB 3IAS9 4KBIA 2OSQA 2BJ1A 4X4SA 2MZ1A 1D3WA 1CJTA 1DHMA 1RP5A 2YBVA 1F5CA 3LALA 3N4WA 3FFIB 5IT4A 5KFKA 4OL8A 2KYXA 1ZZNA 1UTAA 4AT1B 2HBRB 2EXUA 2HK3A 3MCNA 1S4FA 3TJ9A 1N48A 3BSAA 1TUWA 4C7QA 3PG9A 4DV6F 1HNXJ 4B9MA 4FXDA 2HHUA 4Q2LA 2VG5B 4X4UA 1BC6A 2BJ3A 3PFOA 1GT8A 5J2NA 2C2EA 2L08A 4G65A 1WG5A 3IM8A 4WPAA 1NK5A 4PQUA 3TW0A 1Q8IA 2BOAA 2VQFF 2ZJRQ 5LMUJ 1S1VA 1T11A 2KDOA 4OHZA 4IH5A 3D3CJ 1FKAF 3IWXA 4IG3A 3RRGA 3R2DJ 3FZBA 3KLIA 4PR6A 1JJ4A 1ZH5A 2JDJA 3KKFA 2H3EB 4FF4A 1G4CA 2NYIA 1EX8A 2RB7A 3F56A 4ZVHA 3WIUA 1R3NA 4CLYA 5BXIA 2J6UA 3PRDA 3Q2SC 4ICLA 1GXLA 2QA1A 4C48A 5K14B 3VVTA 4CO5A 5A2QY 2RDJA 1WF1A 1QD1A 5EWFA 2MGZB 1N5QA 5A0YA 4TQRA 4ZCKA 5C25A 2IIHA 1EP4B 1XEZA 2Q3PA 3M1VB 1Y3KA 6AT1B 2ASJA 3TO8A 3AXMA 4OI4A 3BDEA 1IJFB 2V0NA 1JQGA 3POTA 1RWXB 3R9LA 1RTDB 3BBCA 1GMUA 4MK9A 3CUNA 1NU4A 4M8LA 2CJQA 1J2VA 4RWXA 1BQXA 2MKHA 1GMVA 2KT5A 3Q86A 1WEXA 2MKCA 4KH1B 4RPFA 5M2RA 3UNYA 1FD8A 4OYOA 1NO8A 4W4MA 1WSVA 2K1RA 5ETVA 3SCKE 4F67A 8AT1B 2VFVA 4IUFA 2J9DE 1X0FA 2KB2A 3VR1A 1XR5A 4J9RA 3C16A 2POKA 1SJ4P 1YJTA 4MK8A 2QMUB 1RAAB 4DL6A 2B4VA 1P27B 3QIDA 5GAHU 1F9EB 2W9BA 4ECYA 4LFAF 1HBNA 4NLOA 3MPDA 5AT1B 1EIYB 2D7SA 2X51A 5AE2A 3CD5A 4M63A 4DBQA 3EVWA 1IWGA 3H20A 4OZJA 3FK4A 2E5JA 1VISA 1TVRB 2A2DA 3DDIA 2MKIA 3K59A 2F4FA 3I4HX 3IXQA 5ITHA 3DLEB 3SYZA 2J0XA 3QRQA 2HYIB 3HVWA 5BYQA 5IV3A 2MQQA 3C15A 3GIMA 5CA5A 2YXLA 4P10A 1S79A 3FSXA 4LVNP 4RU9A 1U1RA 4AUKA 2CQIA 5DS7A 3U1NA 2OLWA 1JKHB 2ZH1A 3NOCA 3PW2A 3MDFA 3PVXA 1YJNS 4CCHA 3OVBA 5B0GA 4ELVA 1M1GA 3OR2B 2M0GB 5B08A 2NPFA 3HHLB 3EPGA 3DOKA 2R7UA 2ZH7A 1JLQB 1UA0A 3BKFA 5GAEU 2MY7A 2LECA 3SZ2A 2GVZB 3QAEA 4Y65A 2LA6A 3A12A 1RLDA 1VC5A 2BBEA 1RTJA 2AEMA 5D4OA 2I6WA 1NK6A 4J37A 2G1DA 4OJGA 5BYSA 3VAGA 2K7KA 1G6BA 2HVZA 1JXVA 4DR1J 5D15A 1QM9A 4I0WA 2F3JA 4ED3A 3T1YJ 5GMDA 1R6YA 3TJAA 2OTLS 2YKMA 1NK8A 3KLHA 2OIHA 4JV5F 2VBWA 5A8WB 3TI0A 2XGPA 3J7Z5 1CJVB 3EZUA 1FRXA 1SC3B 4OI3A 1QTMA 2E5LJ 5D77A 5E3RA 4V19J 3Q2TC 1RTIB 3BBBA 4LVOP 4A8KA 2FTRA 2YNGB 3AFGA 4RNHA 3ILJA 3AJDA 4ZPCA 1TAQA 2B6AA 4GVBA 3LQVA 3HPOA 2IY5B 3FCHA 3D68A 4GVBB 5CHCB 4KIAA 1K73T 1HI1A 2ZHAA 2JEFA 4MH8A 4OMFG 4Z7CA 4X66J 2PMZD 3KNAA 4IFVB 1CLFA 2NUUG 4NL5A 2DHAA 2YKQA 2OPSA 2VC0A 2ZUAA 4DUYF 4DL5A 2QG9B 2VFTA 3BH7B 1FKPA 4X64J 1IR0A 1RTHB 3BJYA 4DCOB 3QIPA 4NLSA 1TMMA 1UKUA 3IWLA 3QT6A 2NXUA 4KV8A 4QQBA 3EZ5A 2YKPA 2XS7A 3D9BA 3AAWB 1MROB 2YX1A 2D74B 3DRYA 3ZTOA 4C2MA 1LK7A 4B3RF 1O0PA 4UF4A 1WELA 3PRBA 4I69A 2W25A 2HSEB 1HBNB 2WB1D 4K5SA 3GFYA 2RU9A 4ZS6A 4ZIWA 5CXTA 2HMIB 1TP7A 5AJ3F 3C46A 2CJBA 2ZBPA 4TYAA 1N5VA 4GKKJ 2OTJS 2QRRA 4QR0A 2HLUA 3R7BB 5E0OA 3UW1A 2FJWA 4M5IA 2WK4A 2MPUA 3GONA 4NLXA 2VU5A 2F65A 2JLFA 4FNHA 4YFUA 2BMBA 4EK2A 5CABA 2Y1JA 4PWDA 3GMGA 4P2MA 2B56A 1S97A 1CJUB 3HSGA 2YWGA 4JI1J 1HKAA 3EUNA 3GTYX 3EDQB 4GKJJ 2GQQA 2JEIA 5KOWA 4YR3A 1LFWA 4U7UK 3HHLD 2EFNA 1FERA 3QZ7A 2VPXB 1E6YA 2FVCA 4P74A 4NXNJ 3RYLA 3QFWA 3GLJA 1CS4B 2QIFA 3KK1B 1Y11A 4R25A 4CYUA 2HFZA 1Q82T 3VGVA 3BPDA 4CO0A 5C2CA 2ASDA 3PDNA 1HNZF 2NQPA 4X84A 3K5OA 4KAIA 2CPYA 2OP5A 1IBMF 2RIJA 1VR6A 2BOPA 3MTJA 4QBUA 1TQLA 1B0TA 4FYXB 2DY9A 2RQKA 1CEZA 3G6ES 3UR3C 1HIYA 4M5JA 1JLCB 2BABA 4HH0A 4HTIA 2K3IA 1NKBA 1DQ9A 3P5TL 1YIJS 4JI1F 3IO1A 4YB1P 2VC1A 2H5IB 4MAKA 2F1FA 2CKWA 4USIA 4DZDA 5EHHA 2XS2A 1UVKA 1VHFA 1VJQA 1SQGA 4NPOA 3R2CJ 3PXGa 4HDGA 1RA6A 1BD6A 4ZLJA 3A4TA 2G9OA 3JTOA 3B4DA 1LXNA 4EUVA 2R8GA 5L38A 2FIUA 1WHYA 2DH8A 4ED2A 2QN6B 2CG8A 2CQCA 5C24A 4G1PA 1J27A 4YDXA 1KRPA 1S6PA 4WXOA 1R0BG 5E3CA 3I5AA 3FKBA 2OH2A 3M4XA 5GAEI 3FUYA 1U1MA 2W9CA 2KTQA 1RHQB 4R0EA 3Q8YA 1L5UA 3RRKA 3I0SB 4BWMA 1YI2S 5DGAA 5KFSA 1RJJA 4I64A 5FDLB 2KN4A 3FBEA 3PNIA 4O3OA 4DL7A 2PN6A 1IVZA 2RJZA 3JTPA 1UJ4A 4AD6A 3GFZA 3HJFA 5DG7A 4WYWA 4NYPA 2I38A 4CP5A 3KHRA 2W2PP 2JLGA 2H5JB 4GVLA 4A8FA 2F7VA 4LT6A 3NMAA 1KOOA 4ITSA 1S6UA 4DV3J 2ZM6J 1G1XA 5J2NB 2VICA 1I51B 1H2VZ 3ISNC 3L7PA 4ZKAA 2E1CA 2AJFE 2VG5A 4B3OB 5K8NA 2HHVA 1CJUA 2CNNB 1KQKA 2HHWA 2MDAA 4N47A 3D6MB 3VF0B 3MR7A 2QFJA 5L9NA 1RDRA 2LXIA 4J7CA 3KK1A 4B9TA 1VQ8S 2ZZNA 4OYXA 2IVYA 1KFDA 2ZDOA 3AQPA 4XPCA 3HM9A 2AYMA 1HPZA 4FN5A 1YBTA 5C42B 2PI4A 4YP3A 3PR4A 4F4KA 1OSCA 3WX4A 3CD6S 5GADI 1TL3B 3PYEA 5ADZA 3HP6A 4DQRA 4YR2A 5SUHA 1HBOB 5A76A 2C2DA 2DVIA 3S1TA 2HGNA 1WORA 3ADAC 1SKUB 3I4PA 3NEKA 4P6QA 2V8HA 4TVAB 4CYUB 3WHIA 2OELA 1G3OA 3DGVA 4F4YA 3AHPA 1P9QC 3CDWA 5D6GA 4IRDA 4L75A 1AFIA 3QSYB 4WU3A 3HKWA 2WSCC 2JSXA 4TLRA 5HJXA 2R8KA 1SC1B 3LP2B 1WG4A 1RADB 5EWGA 3BM7A 4EU0A 3PM9A 4YS2A 4PYAA 1SQFA 5CAAA 4JOUA 2W2NP 1K1QA 1NDKA 4KSEB 3DRPA 2SXLA 2OD6A 1UWAA 1I94F 2DITA 4FYDA 1MNEA 2DNGA 4F4WA 4G3IA 4W90B 1X9WA 4WFAQ 2OPSB 4OX9F 5KFPA 3RBXA 2O01C 2YWFA 5M2UA 2DHSA 1VLYA 3MEKA 2UU9J 3BS9A 1U0HB 3I31A 4ANEA 3E01A 3QATA 4A8XA 3I32A 1EETB 2ROEA 5LMUF 1N36J 3VGSA 1RTHA 5D0HA 1C0TB 1QSYA 4K4UA 4FPIA 1MLAA 1QE1B 2KRRA 3MM6B 1U4BA 2HHPA 2M70A 1T9XA 4USKA 4JYAJ 2XZDB 2KHDA 3OR1B 2AYGA 3AH6A 4NZ0A 2LEBA 4RU2A 3TAMB 4ZMMA 2CQ4A 4F04B 3OT9A 1Q95G 1T0TV 1K1SA 2Y3YA 2IC3A 4XDCA 4PEOA 3R5BA 3IWNC 4KO0A 2B4UA 2JWNA 1YJWS 2HG4A 5T14A 3HK2A 3OTDA 1TV6A 1FE4A 2OPQB 2W2MP 3HT0A 2IA6A 2KVQE 5K8MA 1VFJA 4U7UD 2KRBA 5CYJA 1NJIT 5BYRA 1REVB 3NGKA 5FIIA 3MCMA 3KJFB 3NGUA 3GIJA 4KJIA 2M9KA 1WD6A 4Y3CA 2EKYA 5C42A 1H2TZ 4LMZA 1IM4A 2LEPA 2DT9A 3M2UA 3OR2A 5LT5A 1T7PA 4YOEA 5HK4A 5ETNA 3DFEA 2DNLA 4KE5A 3H40A 1TAUA 4YB7A 2AZ1A 2ZNZA 1NBEB 2X7IA 4P2FA 3CJKB 1H38A 4ZP8A 4UT4A 5L1JA 1A9NB 4HT5A 3ITHB 4F0HA 3CGIA 2N3OA 1O8BA 2QE5A 3KDOA 2V4QA 2XLKA 2HKEA 5IXUA 4DV1F 3R5AA 2IFXA 2WRMA 1HQEA 3SQGB 3KMSA 4N8NA 2ZJQQ 4DV5J 1Q7LB 3UN5A 2WBMA 1BQNA 5LL6d 4DL0C 4O0IA 1C4CA 2PSZA 4ZITA 2C22A 1KOHA 4KB7A 4QIWD 1DLOB 4DPUA 1S1UA 1LV5A 3L7OA 2FQQB 3DRSA 2DGXA 4KFBA 1EKSA 1SIWB 5IV4A 3W66A 1AUDA 3HKZD 1NHUA 2J5AA 3RR7A 2R42A 4DUTA 3IP0A 3TAQA 4LF9J 4LFBJ 4EBCA 3CCLS 5J1PA 3CE8A 4U8YA 1IWAA 3AOBA 3PCOB 3N01A 4CLPA 2HQDA 4DX6A 4IQXA 4DR4J 3ISND 2RHQB 2DR6A 4W92B 1MWQA 2MZSA 2ABYA 3JSRA 3MM5B 1ULRA 4NA3A 8RUCA 3M8RA 3GV5B 3DLLQ 1S77D 2ZE2A 1OY6A 3CJSA 1HWJA 3DOLA 4ZN3A 1S1XB 2PDAA 4G1IA 4DV1J 3MOJB 2HHSA 2UUAF 4DV4J 3CW2C 3EICA 2DGSA 3GYXB 3GYNA 3MMBB 1J5OB 1KHWA 3FRZA 3DXBA 1VRUA 2M7SA 3PJ9A 4PWWA 7FD1A 3UDEA 1VIXA 2CJ9A 1SVDA 2RRAA 4RW8A 3T6BA 2VHGA 3IBWA 3BZQA 3SFGA 1TTHB 3AA9A 4DR5J 1FXRA 1VQYA 5KOXA 2OPPA 2B8QA 2KFYA 4I68A 2MLZA 4YY3F 4Q2MA 1X9SA 5BJRA 3IR7B 5AXMA 2P9GA 2HVHA 3BR9A 2KG1A 2GVDB 3UCZP 1FRLA 2VQEJ 1VBKA 2BKNA 2NS1B 3U02A 3NS5A 5FD1A 3MAHA 1TL7A 2MQMA 3C2PA 3QWPA 4L3KA 5KFFA 4WK3A 3KK2B 1SUQB 3I0RB 2B8PA 2GO9A 2HEKA 2VA3A 1SJQA 3PYGA 3L09A 1LEOA 3EMTA 3R8YA 2OPRA 2RUGA 5LXYA 3MMCA 1XMBA 2CXEA 4MKAA 3OXFA 1N0UA 3SCLE 2EFPA 3TA0A 1CULB 3VAFA 2QEXS 4C8MA 2GJFA 2H4WB 1CPZA 3TR5A 5J2MA 1FDDA 1FF2A 1KDNA 2RKIA 2Y1LB 1RWUA 4NOHA 4DU8A 2HNDB 1NPRA 2BX6A 2MSTA 5KFZA 2MXYA 2DPIA 1TFWA 1JB0C 3KHHA 1SH0A 1X4GA 2MZQA 3V6JA 1GH8A 2MQLA 4ZVUB 1S0MA 4UW2A 2PE8A 3ET6B 3PFEA 2ZBRA 5AJ3J 1FI4A 4M5DA 5GAHI 2HWTA 3CJ5A 3KJQB 4QWAA 4X4TA 3MURP 1RWMB 3GPAA 3UR0A 4HLBA 2EFVA 5HROB 3UNGC 2VBZA 2D3ZA 2PGCA 1XNRF 3AJ1A 2CQDA 4LJMA 3W64A 4B17A 1PC5A 3US5A 2WB4A 4GKJF 5IC4B 5KFAA 1ZM4A 4WP9A 1OSDA 1Q5YA 2NREA 3BF4A 3CCTA 3FJ2A 4RUBA 4CLLA 2OAUA 2UUBF 1H72C 1LW0B 1ZTTA 1KLNA 2OEJA 2PEHA 3BGLA 1AW0A 2D3O1 3QWUA 1PILA 3ELHA 3EPIA 3OSPA 4ILLA 2AX1A 2IRXA 3G96A 3IBFB 4DV2J 2BVZA 1X5PA 3TP2A 2O66A 1IBMJ 2HAIA 3HO1A 3TVYA 1WKJA 3Q8VA 4CLZA 4L3NA 5LMNF 4ILMA 2J6TA 4GRSA 1UZDA 2AWZA 2YQ3A 4CO3A 2W8KA 2DNKA 3A13A 1CSJA 3QMQA 1UCNA 1VYAA 4KO0B 1IXKA 4OZNA 2V6AA 4JV0A 1JJHA 5LM7E 2YTCA 2ZKTA 2C28A 2GAGC 2CADA 2Z4PA 2CQHA 4DV2F 3PW0A 1DJ0A 2H51B 3NY0A 5HANA 1I1GA 2EFGA 3MI7X 4WIQA 1YJRA 3EZOA 4JI8F 4EYIB 4AL6A 4H54A 4LFBF 3NCPA 4MKBA 4EI2A 1FJ7A 5KFEA 1C1BB 1UW9A 3GILA 3DOKB 1ZPVA 1VQ4S 2C2MB 1C1BA 2FD2A 2VH7A 2UZAA 2G0CA 3T19A 2KZZA 3VZHA 2BQRA 1BHNA 2E5IA 4DOZA 1NPKA 2KFZA 3CJKA 1HNXF 3MPWA 2IYGA 1HBOA 3BSCA 1PYSB 4B9NA 4LF4J 1YBUA 1XN9A 3I82A 3DMJB 3QO9B 1H6KX 3OFHA 2HHHJ 4ZVTB 4RNOA 3PR5B 1RT1B 3JTNA 2DKOB 4R0JA 5D4PA 4KHPF 3T9ZA 2CVEA 2VDHA 7FDRA 3OTOJ 4EFAC 3M7VA 2Q1LA 2V8GA 3QLHB 2D3OR 4M5DB 4O3SA 2LA4A 4LIRA 1D9FA 2N4CA 2C2NA 5AE3A 1PCAA 1FJEB 3ILIA 1PG5B 4KGKA 3NNCA 5HROA 2LDIA 4DR5F 2B4OA 5KFJA 4ECQA 2DH7A 2RT3A 3WIVA 1UA1A 2HHTA 2OUGA 1FTRA 1REGX 3W7BA 4ANDA 1CBKA 2FGOA 1MSWD 4NCBA 3D1QA 1NLKL 3FMWA 3CCQS 2B9YA 3U7JA 1FDNA 5H9EJ 2CZVC 2ZOMA 3QFHA 1ELOA 3HVTB 5CD4H 1LW0A 3J80Y 1VBXA 2KZMA 4IH6A 1FD2A 2MTLA 2UUTA 1SC6A 1NH8A 1O6XA 2KKHA 3SSRA 3DYAA 1RHRB 4K4SA 1FKOB 1FRKA 4QCLA 3PZPA 1WHVA 3HZGA 3HD1A 1U2CA 3KFWX 2K2PA 2ATLA 5B0EA 3EGZA 3HHDA 3OSNA 3CVKA 3IS9A 1RLCL 3NP5A 2APOA 3I56S 4B08A 2H9ZA 1JXLA 1UJ5A 2UXDJ 5KT2A 4YN3B 3MUTP 4IQMA 4M5LA 3M8PA 2DIVA 3D3BJ 4TNOA 2ZH3A 3BGRB 1LWXA 3D28A 4DV3F 3MMCB 2F9DA 2K06A 4P75A 3DNCA 1WC3A 2QA4S 3AXKA 4ANCA 1X4HA 2VKRA 4N8OA 4A47A 1U48A 2XI2A 1WKLA 1GQEA 5LJ3Y 1QLNA 4DR6J 4WFNQ 4IG3B 1SIZA 2DXFA 1LWCB 1U0SA 3B78A 1SB6A 4P7VA 4TN2A 3VHQA 1ICEB 3AOCA 4DN0A 1YZ7A 4MYUA 3D2WA 4ES1A 2NXEA 3GP9A 1WDDA 4LREA 2FY8A 5T41A 1KLMB 1TMJA 2KYZA 4DPTA 4WKYA 5C5JA 2JEGA 1TU0B 4K0KJ 2BANB 2MQPA 2KG0A 5HLFB 2XULA 1IBLJ 3HT3A 4ES3A 3HFVA 2DHHA 4ZVPB 4DSEA 1UJ6A 2VIHA 4JV5J 3MCOA 1WF0A 1LWFA 3UN3A 3F73A 4AQYF 2XZWA 3JXOA 7AT1B 2CPFA 3QLHA 4FS2A 2HNZA 2U1AA 4LSLB 4DPYA 4DR1F 3TVZA 4LF5J 3GV7B 1FWKA 3CDUA 4FP9A 4DCJB 4OX8A 3RB4A 1O5JA 3MMBA 2QA2A 1RYRA 2IVFB 1TL5A 2RUSA 3HLUA 1XMQF 4URSA 5HVHA 2L41A 1VHIA 1P1TA 1U25A 3J7AN 1LWEA 4ED1A 2FY1A 3RZAA 4OHXA 3HFKA 4PUOB 1VRUB 1Z2ZA 2ZUGA 1VOMA 5L9XA 1ZAVA 3ZXWA 3OV7A 3I0SA 1NHVA 2BE2B 5KG0A 4LQ3A 1S0VA 3T1AA 4PUOA 3MPVA 5KFRA 3TA1A 2AEFA 3V4IA 3PW5A 2BM1A 2MZRA 2AYBA 4I6WA 4DR2J 1S5ZA 4JBCA 3QGHA 4PWDB 4WK1A 2OPQA 4F02A 5IC6B 3E3XA 1C4AA 1TUVA 2EFOA 3DHXA 4B3TJ 4JI2F 3ZZZA 1RT4A 4PKDB 4J9LA 1RHMB 2AJQA 3OFFA 1D9DA 3JAMY 1UAWA 3H4DA 3GIRA 3PX6A 3BKUA 2EG1A 3FCWA 4OJHA 1MMDA 3JQKA 2BZ2A 1VRTB 3HJVA 3R6GB 1VC6A 1X9MA 1Q8KA 4M1KA 2RMLA 2P2CB 4IDKA 4UZBA 4PWUA 1KP6A 2AKWB 3KG4A 1NK9A 3CCJS 1QAIA 4UY85 3H2LA 5HJYA 2B4PA 2I0XA 4X62J 2IJRA 4FZVA 4CO1A 3S8SA 4ZVSB 4J9QA 1VQNS 3MPUB 4ED0A 1HR0J 3PV8A 4WTYA 3GJRB 4CZCA 1U2RA 1N52B 4CT8A 4RNFA 1HW9A 3C6TA 5E41A 2M3DA 2DEJA 1FRJA 2XMTA 1KQSR 3ETMA 3CD0A 4IOAQ 2E44A 5CYQB 3CCUS 4IO9Q 3MPYA 2YNIB 3R27A 4HR2A 5B09A 3PKMA 2XMMA 1N6QA 4JI8J 2CQ1A 2AHOB 5F41A 4BC9A 2XY5A 3GWCA 1JIHA 4LR8A 3TANA 3BQ0A 4KGZB 1X60A 1A0OB 4I2PB 4LRAA 3FC9A 3NCRA 1YWXA 5J2PB 1FFGB 4NYZA 3HD2A 3ZZOA 1F2HA 4ELUA 2PD1A 4CH7A 1W26A 1FNXH 2GHPA 3NBPA 4KKOB 1JMTA 1UVMA 2JJ4D 2HBYB 2DHXA 3WC0A 3NNHA 4OHWA 5KFXA 1YJUA 2D9PA 2J0WA 1XR6A 2BJ8A 1D0EA 3LH2S 4K2XA 2VD3A 4RW7A 5HN0A 2B9XA 1KKHA 3J7ZT 3TARA 4RW6A 4QYZK 1K44A 3K2YA 2DR8A 4Q8EA 4DR3J 2ZBIA 3GYGA 2NXJA 3H98A 3K7RA 3BYPA 4DV7F 2ZVIA 3NS6A 1WOSA 1S6OA 2ERRA 1TK8A 3CSKA 2FVQA 2CJAA 1PBUA 2FHJD 4ID5A 3X3UA 5KFYA 2M52A 2LXFA 1KS2A 2EKNA 2GIRA 2Q79A 2ZKUA 3GG0A 3IC1A 2B5JA 2MKJA 3RAQA 2ADBA 2Y8WA 2VDIA 2NLWA 4CRJA 3V4IB 3KUHA 1QDUB 3WQPA 4DSIA 1DTTA 2LLZA 2UUWA 5ETQA 3HHLA 2HFUA 1RWNB 2RNEA 1PAEX 4L74A 5KFVA 4RJVA 2YKNB 3FBCA 1RA7A 4UUWA 3GCXP 1WEYA 4F4ZA 1Z1ZA 4PG6A 1L3SA 4MJKA 4J9OA 4DMZA 4WE1B 4G1QB 4FF1A 1YLXA 3GSDA 2ALYB 3THPA 4BDPA 1PYOB 2X1GA 4K4WA 2GJ2A 2GMHA 1JLEB 1N5TA 4NI2A 3CJ3A 1Y7PA 4LBIA 3LPEA 2QYGA 1TKZB 1TKXA 5E33A 2W7OA 4U95A 2NYHA 3DGPA 2HWIA 2VUGA 2I1RA 4I6AA 4URGA 5DZ7A 4LF5F 2W7AA 1S0OA 3KLIB 3W60A 4CDIA 3CJTA 2F4VJ 3RBDA 3F0NA 4NASA 2RVJA 3UCUP 5IQQA 3V6DB 2PEBA 3RAMA 2ATCB 2U2FA 4X2BA 3G8QA 3I96A 2BJ7A 3E51A 3M8ZA 1N33F 4QWBA 4PG7A 3UD3P 1BWEA 4JV1A 5CYMB 1RI7A 4OYZA 2PO4A 2HBQB 2ZD1B 4CNYA 1S49A 1IM6A 4WF9Q 4ZPAA 4OX6A 3KLVA 3DHWC 3RGIA 2BQ3A 3DRSB 1YDLA 4O3QA 3FSIA 2JRSA 1Q7YT 4P9SA 1U02A 4X4VA 3TQEA 4C3KA 3PEJA 4DLGA 1X4FA 2MLYA 3D4JA 5G0RA 3KWMA 1UPPA 5EGYA 1OJ4A 4ZDNA 1U45A 4QIGA 2W9CB 1KHVA 1XTZA 2G2OA 2V50A 1LWEB 2WSFC 4FBUA 1VDHA 5JVHQ 1KNZA 1T03A 2WONA 1W2BR 4DSLA 5K8PA 3T1HJ 1W25A 2UXBF 3U1LA 3NS7B 4USJC 2DGVA 3PX4A 2HHXA 4ED7A 2IBOA 1AROP 5FDLA 3W5YA 3UVJA 3FRYA 3OVAA 4U7CA
chains in the Genus database with same CATH topology
5U47A 3HX9A 2JX2A 4R8UA 1DTTB 1X4BA 3D0GE 2BUNA 4RNNA 3OBIA 2E5GA 2EFQA 4C0HA 5DRKA 5B0FA 1GTEA 4OZLA 4ZHRB 2O5DA 3QZ8A 2I2YA 1S72S 1AFJA 1HD0A 1T95A 3CD7A 2J9EA 4PG8A 2KXHA 1WI8A 1Q81T 1FNMA 1R89A 2XSJB 1NRKA 1FEHA 4KTQA 2VPZB 3TUJC 2FC8A 3ULHA 4HI1A 3GE9A 3M6VA 2QMXA 2AF6A 1JXEA 3RW7A 2FVSA 2L9NA 3BR8A 1FRIA 3LP1B 3NLCA 4PXCA 3CCSS 1UVJA 3T5LA 1NJXA 2BW2A 3J7A1 4A8WA 1Y00A 4NZ7A 3KLEA 4URQU 1L3TA 1UP1A 1IN0A 1VQ9S 5T7LB 3PW4A 3RB6A 1UVIA 4DLEA 3DM2B 3V81B 3V6DA 3N6LA 3X1LB 2ZC3A 3QJPA 4NLYA 4RW9B 4CO2A 5CYMA 4NCAA 1FJGF 5A8KA 1M5VC 3FVYA 3C8YA 2DNMA 2YKAA 4PXBA 2NZ4A 3OVSA 1U6ZA 1X4DA 4FXVA 3VZIA 2Q6CA 5GVQA 2N7CA 4ID8A 5J2PA 2WTFA 1X5TA 1S6QB 1U7LA 4Q45A 4WYLA 3M32B 3Q8RB 4B3SF 5F3TA 2HFOA 3OL6A 1U6BA 2HFNA 3KTQA 2XB2D 3MF5A 2CQ2A 1FO1A 2ZVSA 3IG1B 4NX9A 5DG8A 1FCAA 4X4OA 1F5BA 3M2RA 3B8HA 3H2UB 4ECSA 2FVPA 2NSBA 3BREA 2AGPA 2JFKA 2LQJA 4Y28C 4RZRA 1U6FA 3KLGB 1C0TA 4F26A 2DISA 4I2QA 3HZEA 3KK3B 2DBBA 2GQCA 2W9AA 1UFLA 2J7UA 4O44B 2DTJA 4CI0B 2FHOB 4ELTA 3CDBA 4ZHRA 2R8JA 1HNWF 3UDLA 4DL2A 3VAMA 1JLQA 1N0VC 2CPIA 4ZP7A 4TQSA 1N54B 3MM9B 4UQTA 3ZZUA 2ZC4A 2GX8A 2I8EA 4OHVA 5DDPC 3LP0A 1JKHA 1UL3A 1N5YA 2XCAA 2YNFB 2X3GA 2R2SA 2VASA 3CCRS 2MYFA 3TUZC 1VRTA 2LXUA 2VFSA 3HHEA 3F44A 1R7IA 2QYCA 4Y2CA 3N6NA 2GW8A 1U8SA 3A1YG 5KT4A 2RKIB 1T3NA 3RB3A 4DEZA 4DL3A 3OFGA 1P1LA 1C2PA 2DNYA 4WFXA 1Z4UA 4Q8FA 4XO0A 2M8HA 3MUVP 4FF2A 2GO8A 2R7RA 2YNHB 3T1YF 3MECB 1TL1B 4AL7A 1JNZB 1KVJA 1WWHA 2CQGA 2MHNA 4O4RA 4WXWA 4YEAA 2RS2A 4YUDA 4B02A 3POTB 4HEA9 3PO5A 3C6UA 3M9OB 5AXLA 2VB6A 2K1RB 4O4GA 2OMLA 3N79A 1FDBA 3JSMA 1X4CA 1RT5B 3DLJA 3LANA 2CPZA 4MIWA 3Q8PB 4X4RA 4IOBA 3T3FA 1APSA 2OO4A 1HI8A 5BR8F 1VI7A 1UMJA 1R8HA 2CQPA 2HHVA 3TAPA 3D1HA 4GC6A 2VV5A 4RW4B 3BQ2A 3RW6A 4GC7A 2RF2B 2VG7A 4DS4A 2K8GA 4QW8A 2HLTA 2GCFA 2R8IA 1DQAA 2XBPA 1XNQF 3DXSX 4BS2A 4IYQA 2DNZA 4OI0A 3MEEB 1CQMA 1W2IA 2PA8D 3W3SA 1HWKA 3NMRA 1VJWA 4QWCA 4B3OA 4ZP6A 1SJRA 4F2RA 4GKKF 3M6XA 1SJFA 1WHWA 3K58A 3FFIA 1CQNA 4N56A 1WEZA 4ZA1A 3V2UC 3T6JA 2ACYA 1J5EF 3D0IE 2E9TA 1GTHA 3M8PB 1YRXA 5B0CA 1R0AB 3G86A 1KTQA 3CIMA 3T9NA 4PXDA 4ECWA 2IM1A 2HZCA 3JSYA 3DRRA 1TL1A 5CZXA 3TX8A 4BWJA 1GX6A 4DWIA 1B0VA 4C8OA 1LWFB 4F4XA 1DTQB 4DR7F 1JLCA 4D3HA 3LF0A 3IGNA 2AQ4A 2FGCA 4LF4F 2KJWA 2LYVA 2ZD1A 4ATNA 3OL9A 3SFUA 1KLMA 5DJBA 1TL4A 1R8AA 3NAIA 4FPRA 3PO4A 1QAXA 3KOAA 2ZHBA 1OS5A 1RKIA 3MMJA 5IQ6A 1WHXA 2QLXA 2VBYA 4QIFA 3W2WB 1GX5A 1F5AA 2IAJB 3ENVA 3I6PA 3I9V9 5CQGA 1PC4A 1XR7A 1EETA 5IM0B 2N82B 3JSMB 3LWMA 4RW6B 4DL4A 1P6TA 2IMWP 1FE0A 3OL7A 2B0GA 4N5SA 3VAIA 2HW3A 1VQPS 5K8OA 1RT7B 2AP6A 3ICLA 3SCIE 5I3QA 4IR1A 1HNIA 1SV5A 3AB2B 4C8NA 2RU3A 5H9FJ 4YB6A 4O44A 5FJ4A 4J9SA 2M8DB 1IKYB 5CCLA 3MD1A 1RT4B 5AXKA 3OTBA 5KT3A 2GHWA 4CH0S 2PT0A 2CRLA 1JLFA 1ZBTA 2X1FA 2ALZA 2FUG9 1T8EA 3H5YA 1XMOF 5KFWA 3MM8B 5F3ZA 1GNKA 4BC7A 1JLEA 5F0UA 1HA1A 1REVA 3BDPA 4DQPA 1C1CB 3BGFA 2IHR1 4QWEA 2YNFA 5DG9A 3C6TB 3HXMA 3DDKA 4XK8C 3B4MA 2N4DA 2E7WA 1FK9A 3TOQA 2VG6A 1ZYQA 3MD3A 4X64F 5KG6A 3CIZA 4TY9A 3O2IA 3NL0A 1CC7A 1N6QB 1RTJB 2YNHA 1LW2B 1RTIA 3GFHA 1HI0P 1DTQA 4QR2A 3DOMA 2AU0A 1DZ5A 2DGUA 2DGQA 1MWYA 4NCGB 1S1TA 4TKTA 5I4MA 1X7VA 5A8KB 5HLFA 2GFFA 2LMIA 5KFIA 3HDSA 2A10A 2B6AB 4ZVEA 3BEGB 3DRPB 3IGVA 1O51A 3FDSA 3NRBA 4KHMA 3KHGA 3G6XA 4RW7B 4QU6A 2DCLA 2ILZA 3OQ2A 3E8OA 1E6VB 3KLHA 4J9NA 2K3KA 1H3DA 3KG1A 4AXIA 4ETZA 1SI9A 1XK8A 2IA0A 3HVRA 1QSSA 3W2WA 1VGYA 1U1OA 1VQSA 5DM6Q 4EYHB 4C11A 1SL0A 2N7YA 3M8QB 4C0BA 3TQ1A 2X1AA 1VQLS 2A18A 4BCAA 2O67A 2F9JA 1CC8A 2DRBA 4Q43A 3DN9A 4QPTA 3QJJA 4I2QB 3KK3A 2ZH5A 2VA2A 1FESA 3T5JA 1FRHA 5HI7A 1FVQA 2W24A 2XMVA 1UEVA 3QAUA 4DUZF 4KRWA 4I1TA 1YSJA 3GR0A 2FHJA 1RT3A 1XBWA 3IRXA 2XSJA 3LW5C 3M2VA 3H5UA 3K5MA 1TKXB 3RU0A 3IRXB 2XG8A 3ENQA 4F25A 3CPWR 1BY9A 2BR0A 4L6V3 1QJHA 4BBYA 2UP1A 2JVRA 4A8YA 2FC9A 1FRMA 2FJDB 5A6WA 3H59A 4KQZA 1OWXA 2AV5A 1VQOS 1N56A 4NLRA 1BGXT 3DRRB 2WAQD 4JV2A 1S9GB 3MMAB 2BDPA 1R8CA 2JHEA 2V9KA 2WW8A 3H2VE 3MOZA 5HBMA 4CO4A 2HRUA 3F41A 2DO0A 5DDOC 2PI5A 2DPJA 1HBUA 5H1SV 1ZETA 1HL6A 4IFYA 5C25B 4NLDA 1HBUB 2PMHA 2MY8A 2OJ3A 1LK5A 2VODA 2KM8C 3QJLA 3CC4S 1S7HA 4DX8H 4XDDA 2YX4A 2ZM6F 2CYYA 4I4BA 4ECRA 5DQGA 3ZFVA 2KO1A 3OL8A 1YJ9S 4L72B 1KONA 1PO6A 2HPUA 2DO4A 1OQ6A 4ZPWR 3MFIA 2GMJA 2ZBCA 4NWBA 4A8QA 3KHLA 5LSLA 1F0XA 4KT0C 4OQJA 4C8KA 2V5HG 4OI6A 1Q79A 4NRTA 2DR9A 2DNQA 2XLJA 2HVIA 2PA3A 1JWWA 1RT5A 4F3MA 2YKOA 4MFBB 4EBDA 1OIAA 3BO4A 2W4PA 3K8WA 1NNDA 3ZZPA 1MROA 2BJDA 2HIQA 4RKUC 2HMIA 4Y34A 5F0WA 3MEEA 4RUHA 1I6JA 2MQOA 4C8ZA 4F8RA 3Q0AA 4A4JA 2BYCA 2ZITA 3ONQA 2XNRA 2YH0A 4MMOA 4XAKA 1MU2B 2CQBA 5F8LA 4IO1A 2JLEA 3L95X 4JI5F 2DGWA 1Q1KA 4WFYA 3LP0B 2KI2A 1FTCA 1NJZA 1KTVA 4K50A 2YKNA 2MJNA 2FHKA 3MM9A 3D0HE 4ZPDA 2R7XA 3BGRA 2N3LA 1IBKF 1Y4ZB 4IDKB 4DHVA 1H7WA