3CTRA

Crystal structure of the rrm-domain of the poly(a)-specific ribonuclease parn bound to m7gtp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
GPLGSDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Poly(A)-specific ribonuclease PARN
publication title Crystal structure of the RRM domain of poly(A)-specific ribonuclease reveals a novel m(7)G-cap-binding mode.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 75
sequence length 75
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2008-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ctrA00
1OPIA 1URNA 5MLCV 1VQLS 3THPA 2DNGA 2KYXA 1AUDA 2OJ3A 2OIHA 2CJKA 1N8RT 5LSOA 5GAGU 5ITHA 1VQOS 4M5DB 3G96A 3EGNA 4OZ1A 1X4DA 4IOCQ 5DM6Q 2KRRA 2DNRA 2X1BA 5CYJA 4CH0S 2DHGA 2QA4S 2QFJA 2RQ4A 2XNRA 4CQ1A 2J0SD 1DBDA 2NLWA 2AYMA 3N9UC 3R27A 2E5HA 2MKHA 3J7YU 4TU7A 4FXVA 1U1NA 3CULA 3MI7X 1YITS 4LMZA 1WI8A 1X5PA 2MXYA 1X4EA 3FEXB 2L9WA 3P6YC 4LIRA 2KT5A 2O3DA 1H2VZ 2LYVA 1VQ8S 3CC2S 2MZSA 3NS6A 2RUGA 2U2FA 4WIIA 1YJNS 1YJWS 1U1RA 3CCSS 1QVFR 2ZJPQ 5CXTA 2DO4A 2CPYA 2DB1A 3VF0B 2HYIB 3MOJB 5DDQC 2RU3A 2VOPA 2DIVA 2DGSA 2MSTA 2DGWA 3V4MA 2KG0A 2PE8A 1X4GA 3PIOQ 2MSSA 2LQ5A 2OTLS 3CPWR 3MUTP 5BJRA 4RU2A 2M9KA 2DNQA 2MQLA 4PKDB 1BY9A 1WF1A 1B7FA 1WTBA 2J8AA 4ZKAA 3CUNA 2MZ1A 3CMES 2YH1A 4QU7A 1X4CA 3CC7S 1WG4A 2LMIA 4QQBA 3CTRA 2Q79A 4C0OC 1A9NB 1P1TA 3NNHA 3CC4S 2CPIA 1U1KA 2F3JA 2MKJA 1FO1A 2RRAA 1CVJA 4CH1A 2DGQA 2M2BA 3I55S 3P49B 2YWKA 4Z2XA 2KM8B 5IM0A 1WF0A 3CCMS 2N3OA 2DNHA 1YIJS 2KXNB 3JB9k 1VQ4S 1JMTA 1UW4A 2MMYA 4F26A 4W90B 2JX2A 3BO4A 1JJ2R 2XS2A 2MQNA 2ERRA 2CQDA 3G6ES 1NJIT 2X1AA 1K9MT 1YHQS 2DGUA 1ZZFA 4YOEA 1VC5A 2M52A 4U67Q 3LPYA 1SJ3P 2DNZA 2MJUA 1H2TZ 2DNPA 2K8GA 3TP2A 1D9AA 5IM0B 3CCLS 3DLLQ 2J0QD 1D8ZA 5H1SV 1NU4A 2AYEA 2N82B 4IO9Q 5DM7Q 2KG1A 1N88A 5EN1A 5LXYA 1X5TA 2FC9A 3H2VE 1VQNS 2DNNA 2MJNA 2CPZA 1WG5A 2AD9A 2HGMA 3L3CA 3EX7B 1A7GE 5HL7Q 1VQ7S 1Q81T 5GAEU 2MZRA 5LJ3Y 2XNQA 3IRWP 4ED5A 5FJ4A 2RT3A 4C7QA 1HA1A 2J76E 1FT8A 2MY8A 1VBYA 1WELA 1WEZA 2L08A 3CMAS 2MB0B 2E5IA 2KFYA 2DIUA 3TYTA 4ERDA 4W92B 1W2BR 4IOAQ 2MZQA 2X1FA 2G4BA 4QU6A 2DGTA 2KM8C 5GMKa 3ZZYA 2MYFA 1M5PC 1VQ5S 3MUMP 3BO3A 5LXRA 1FJCA 2F9DA 3UCUP 1U1QA 2CQ4A 2LA6A 1O0PA 4F02A 4UQTA 5CA5A 1DHMA 3UD4P 2E5JA 1QVGR 4FXWA 1KD1T 1WHVA 1X0FA 1U6BA 1X4HA 2MKKA 1OIAA 3U1MA 2D9OA 2MHNA 1PGZA 3VAHA 2EK1A 2QEXS 2V94A 2BZ2A 2DHSA 1PO6A 2MKSA 4WFAQ 3CD6S 2VODA 3IWNC 3UWTA 3P3DA 1ZH5A 2DHXA 3VAJA 2KHCA 3G9CA 1U6FA 2G1DA 2LXUA 4F25A 1NO8A 1L3KA 2AYBA 4C4WA 4LJMA 2CQGA 4OZ0A 2E44A 2CPXA 2CPFA 5D78A 2D9PA 3MURP 1YTYA 1Q86T 3MUVP 3UCZP 3P5TL 2M70A 5DDRC 4WCEQ 2VOOA 1WEYA 1WF2A 3OW2R 1P27B 2E5GA 2XSFA 1U1PA 3U1LA 3B4DA 1JJ4A 2BOPA 2CQBA 1WHXA 4EGLA 2A3JA 4TU8A 1XN9A 2LECA 4TLQA 1WG1A 4BS2A 5DDPC 3CF5Q 1VC6A 1VBZA 1F9FA 2XB2D 3NNCA 3BS9A 1HD1A 2OSQA 2MKCA 5GAHU 2MZTA 4UY8T 2FC8A 2DH8A 2KN4A 4WFNQ 1M5VC 2DITA 2B0GA 2LKZA 3S8SA 1RK8A 1WEXA 1HL6A 3NMRA 5JVGQ 1FXLA 1SJFA 4IUFA 3H2UB 3D2WA 1KOHA 1N52B 5DDOC 1X5OA 2WBRA 3UD3P 2MKIA 1VQKS 2YKAA 1ZZNA 2DO0A 2KRBA 5LJ5Y 1IQTA 2DH9A 2MQPA 2SXLA 4PRFA 1WHWA 2CPJA 1M1KT 2GHPA 3S01A 2RVJA 2FHOB 2MQOA 2CQIA 2LA4A 1U1MA 1Q7YT 2NZ4A 3MD1A 2KXHA 3J7ZT 2CQPA 5HO4A 3PIPQ 2M4MA 3MDFA 1DZ5A 2M7SA 3UE2A 1X4BA 5IFMA 2DH7A 2CQ2A 2LCWA 4A8XA 1FNXH 3Q2SC 3FEYB 1H2UX 3EGZA 1YWXA 1UP1A 2HVZA 3TO8A 3VAKA 2KI2A 2X1GA 2D3OR 2F9JA 3SDEA 3CCJS 3K0JA 1FHTA 2FY1A 4YB1P 2K3KA 4Y00A 3CCQS 3G4SS 1UAWA 2CPDA 3VALA 2U1AA 2M0GB 2JVOA 3THTA 3BO2A 1N54B 2OSRA 3MD3A 1X5SA 2PEHA 2CPEA 3SMZA 1SJ4P 2CQCA 3HHNB 3R1LA 1SJRA 2DNMA 1KOOA 1WI6A 3B4MA 3CCES 2EVZA 2YTCA 3CXCR 3VAIA 1VBXA 4Y0FA 1KC8T 2CQ0A 3G71S 3SDEB 1VQMS 2HZCA 1X4AA 3I56S 2EK6A 1VQ6S 4WKRA 2MY7A 2ZJQQ 2JVRA 1WHYA 4QPTA 1FJEB 4P6QA 3VAMA 2L41A 1G2EA 2KVIA 2AYGA 2CPHA 2OTJS 1FJ7A 2JWNA 4TU9A 2M88A 2MQMA 3NNAA 1U1OA 3CCVS 1UFWA 2DK2A 4WF9Q 2MZJA 2G0CA 1QM9A 1SXLA 2XS7A 1SJQA 1RKJA 2ADBA 1U1LA 3VAGA 2DGOA 2RS2A 2HGNA 5IQQA 5D77A 2I2YA 4PR6A 4YUDA 3MXHP 1VQ9S 2DHAA 3G8SA 4WFBQ 3NS5A 4V19X 5GVQA 3DXBA 2CQ1A 3VAFA 5LSLA 1M90T 2MGZA 2CQHA 1HD0A 2RNEA 1KQSR 2MQQA 2KH9A 2DGXA 3HI9A 1VC0A 2XS5A 2CQ3A 1U2FA 2HGLA 5JVHQ 2YH0A 1M5KC 3BEGB 1R8HA 2DGVA 2VONA 3UCGA 3Q2TC 3LQVA 1Q82T 1DRZA 2RS8A 1WWHA 1OWXA 3US5A 2DNLA 3RW7A 2KXFA 3R1HA 1X4FA 2DNOA 1K73T 2MPUA 1YI2S 4CIOA 1M5OC 2LEAA 2ADCA 2LXIA 2DISA 2I38A 2MGZB 1R8PA 2FPHX 2RRBA 3ULHA 2GO9A 1JJHA 3CCUS 2N7CA 2ZJRQ 1S79A 3S7RA 4J5OA 2DNKA 1VQPS 1YJ9S 3RW6A 1H6KX 2DNYA 2RQCA 2KU7A 3CCRS 2M8DB 3ZZZA 1K8AT 2UP1A 2M8HA 3S6EA 3SXLA 2LEBA 1S72S 2N3LA 5DETA 2JRSA 5GADU 1OO0B 3G8TA
chains in the Genus database with same CATH superfamily
1N33J 3TANA 2VDHA 1URNA 4C8KA 4NLUA 4LRAA 1PJ5A 5J2QB 1F3VA 3QGPA 2XMWA 4PPDA 4ZVEA 2W9BA 4WJBA 2B4PA 4M5DB 4DPTA 4L75A 1ZTTA 4NLGA 1DTQB 3H40A 5FDLA 4FF2A 1H73A 1FRLA 3OXLA 3AH6A 4J91A 4RO0A 4WP9A 3EWGA 3OHBA 5L9NA 3CDWA 4ECUA 1VIXA 1GQEA 2W25A 3EM1A 2V5HG 4DR3J 4LBHA 2ZHBA 3FEXB 2FGCA 4OMFG 5HN0A 2LU2A 4Y28C 1R89A 4ZLPA 3RRGA 1REVA 2JC1A 2FUG9 4K50A 4IFVB 4TLRA 4QR2A 4QW8A 2WONB 2WVBA 4YR0A 4JYAF 3EICA 2HNYA 1GK8A 2HHHJ 4ZPWR 4RU2A 2DJWA 3ONQA 4EK2A 4CLTA 4K5SA 3B8HA 2OPQB 8ATCB 3PM9A 3QT7A 3M8YA 5G4DA 1IM4A 3QIDA 3KJVB 1HI8A 1UW4A 3TUZC 4FDFA 1Q8LA 1RU2A 4WK1A 2YNFB 1NJXA 1VC5A 3DRPA 3TAPA 2Z56B 3WC2A 2AJ0A 3H7HB 1RT4A 2J0QD 5H1SV 1NUEA 5EN1A 3TEGA 5LXYA 2MTLA 1X5TA 5JUMA 4I56A 2KFNA 4LRDA 4NRTA 3IR6B 5DLFA 3EJMA 2MY8A 5J2PB 2AKWB 3IC1A 1AXQA 1WEZA 4X64J 1RYRA 2XHCA 1JKHA 4IG0A 4NLRA 2BABA 3VAHA 3V81A 4XTTA 4HH1A 2QYCA 1I94F 4I2QB 3AAWB 2KHDA 1Z2LA 2H9ZA 2G1DA 4FXDA 4JV1A 4PPZA 1N6QA 2PMHA 1I94J 2R7VA 2WVDA 4DI6A 3PW5A 4HHHA 2C2NA 3H5UA 3B82A 3ILIA 4LRCA 3IR5B 2QA4G 2OSQA 4RW4B 4WXWA 2RQKA 4V1Ak 1CJUA 4WZQA 2DITA 5KT2A 4DL7A 2E7WA 4RUCA 5I42B 3Q8VA 1H38A 1ZZNA 2DO0A 3TUJC 4P72A 4HYKA 3PTWA 1FTCA 1FD2A 2AJFE 2HIQA 2KXHA 4L6V3 3IM8A 3X1LB 1J5OB 2W9AA 2EFVA 2E9ZA 3TO8A 1D8YA 3HCXA 1HBNB 1D09B 2V4JB 2EFPA 3FUYA 4JBCA 4W4MA 4KPCA 1TKXA 2JVOA 4JOUA 3IG1B 3KUEA 3H25A 1EHWA 4QIWD 4RPFA 1QTMA 3A13A 4H4MB 2BJ8A 3AXKA 4P6QA 3BR9A 1V5VA 2IM3A 3ETMA 2M88A 3NNAA 2UU9F 4OV1A 3FSYA 2B8PA 2G0CA 1XWLA 1CULA 1IKXB 1SJQA 3JYTA 1V6HA 4DXLA 1EP4B 2CZ4A 3HKWA 2JJ4D 3E8OA 5KG7A 4DV7J 1Q5VA 2A2CA 2CQ1A 1VMBA 2DGXA 4NZ0A 1U2FA 3OV7A 1UJ6A 3PJWA 4DV1J 4ECQA 2PO4A 3R1HA 2DNOA 5DG7A 1UVKA 3KK1A 3MEGA 5H9EJ 4ICLA 3QFWA 5HJXA 2ASLA 2V69A 2ZJRQ 3T1YJ 5EX3A 2VQEF 1QY7A 4ZVHA 3BZQA 1HHQA 1XJWB 1OPIA 1RT1B 3CW2C 4PG4A 3KOAA 1FD8A 3H20A 3BGRB 4OQJA 4ZITA 1T3OA 4WKYA 2AX1A 4J90A 3PDNA 4D3GA 3J7A1 3AODA 1KP6A 1TP7A 2IA0A 4YEAA 1NSPA 4Y34A 3WX4A 1DY3A 3H4BA 2AYMA 4K4XA 3LALA 1QDUB 2GVDA 5K9FA 4DX6A 2UXDJ 1SKRA 4X4TA 3M9OB 3HVWA 5HQ8A 3E51A 4M5MA 2RKIB 3MPUB 3ET6B 1NHVA 3SEOA 4ZVRB 2DO4A 2ZNZA 4L74A 2RU3A 2BJDA 2DGSA 4JI3F 3DN9A 2CRLA 3GIIA 1NK7A 2DNQA 1WF1A 2H54B 2MZ1A 1X4CA 4BLGA 4PWDA 1U2RA 2HVEA 4FVCA 4OYAA 1P1TA 1Q53A 1KLNA 2X3DA 3NGRA 3P45B 2XMVA 3H0PA 4CTAB 4EZ9A 2F8HA 2H51B 4MIBA 2GX8A 2BOAA 5CYMA 4P9SA 4LRBA 2ZWOA 1YHQS 2Y8YA 3QAEA 5KFOA 4WPAA 4JI1F 4U67Q 4ZCIA 3EVOA 4X4QA 3J7Z5 5LMNJ 3T1HF 2VKRA 2F65A 3DDIA 4KGXB 1TU0B 2WSCC 4ENOA 3SSSA 1FRMA 3OQ2A 3T9ZA 3CJTA 2H5JB 1QSSA 5C25A 1UVMA 1LXJA 4RJVA 1HMVA 4Q44A 5A0YA 1HA1A 2MB0B 4LF5J 1GNKA 1G6BA 3QJLA 2MZQA 3CJRA 3ZZYA 4RWWA 2C3UA 4NXNF 1TKZA 2HHTA 3SCKE 5CD4A 3CCWA 1LQ9A 3U02A 2HRTA 3LGNA 3P8BB 1OIAA 4F0KA 4DF4A 4NXNJ 1FEHA 4LBPA 5K5MA 5KFVA 2DVIA 2ROGA 3G9CA 2QL7B 2MLXA 5CCLA 4IR1A 2DR6A 2F4FA 3CJKA 5A8RB 1V3ZA 1GMVA 1TL5A 3CJ4A 2V6AA 4LF7J 3RB3A 4Z7YA 2JFDA 1SH2A 1VCTA 1XK8A 4TU8A 2LECA 3UDCA 4ECXA 1KONA 3AB4B 4K7QA 4KGKA 2CNOB 3H42A 1AB8A 1NSKL 1FWLA 4JI8F 2MZTA 5IS2A 1LWCA 4MT1A 2KN4A 1FFSB 1EQMA 4HACB 1UCNA 2GZOA 2B9YA 1OYDA 4CLUA 5LJ5Y 3BB5A 3R7BB 4YMEA 1FE0A 1M1KT 2C2EA 1TKDA 2WB1D 2OMOA 3DC2A 2YKNB 3M8PB 1JJCB 1TTHB 1WSRA 5HANA 3PIPQ 4J9UE 3OTCA 4J7CA 3LA0A 2C1EB 3EGZA 4M5JA 2J8SA 3FNNA 1ZA2B 2W8LA 4K2XA 2OPPA 3QJJA 4XPCA 2H65B 1S1VB 2WSEC 2Z8QA 2CWXA 3NGKA 2CQ0A 3N5BA 4KHPJ 4GVBA 1T9VA 2WAQD 4D3HA 1ROFA 5B0AA 1FFWB 2AJQA 4X84A 1N34J 2LFVA 4R5PB 3CCVS 4MKBA 1SC4B 1QM9A 1SKWA 3UR3C 4LR8A 1N36J 3LW5C 2I2YA 1TL3B 4H4KA 1HQEB 4V19X 4OHWA 1N32J 2QLFB 3W62A 2E66A 5F8HA 2GMHA 3RRKA 1JQGA 2NCKL 3Q2TC 2L9DA 3DRSB 3EDQB 3Q8UA 4DHVA 3ZC4A 3THVA 4EWTA 2K2PA 3N79A 3OTEA 1C1CB 1FCAA 1M0SA 2NXCA 5HBMA 5L1KA 4DF8A 2D69A 2IY5B 2VJUA 2QA1A 5CAAA 1Z4UA 1JJHA 1KEKA 1YJ9S 4R0JA 3CCRS 2RDIA 1S9GB 2ZH7A 2JL9A 3M2VA 5K14A 4ELTA 3BGLA 3HSZA 3M30B 1JK9B 1HNVB 2DNGA 5KFGA 2FJAB 4FYYB 2D41A 2QMWA 2P8IA 2GJ2A 2CG4A 2ZUGA 3GCXP 3BSOA 2IIHA 1D9FA 4C0BA 3JQJA 3R7NB 3OLAA 4U7UK 4Y3CA 4CWBA 5IC6B 3V5RA 4FXVA 1HNIB 3F56A 3I0SB 4UOFA 2HMIB 3JAMU 4AXIA 3GZ7A 4AQYJ 4OYPA 4ZP7A 3QLHA 1WOSA 1VRQC 5E3AA 4KGZB 2HHSA 2ZJPQ 2DGWA 3DI6A 3TAMA 2PE8A 2BBEA 2MSSA 2Z30B 3CPWR 1ZAVA 2V0NA 1Z1ZA 4DG1B 3EDRB 3VGSA 2B7CB 4QJVA 2O5DA 3POTA 3CTRA 2AJ4A 3F73A 1LWFB 2ZZNA 2HQIA 4FNIA 1KVKA 1FO1A 1CVJA 3R97A 3MMAB 4FVMA 3ILOA 3QIPB 3WDOA 1WDTA 1Q8IA 3JQMA 4ZVGA 1DQ9A 3HKZD 1S57A 4DPYA 4JV5J 2V2ZA 2GNKA 2HZVA 4FYWB 4ECVA 3CGIA 4DV4F 2QTWA 4AL5A 3AA9A 3SFGA 4DQIA 4DR5F 2B7BB 1RTZA 2DNZA 4KH1B 1JLBB 5H9FK 2DNPA 4PG7A 3JTPA 2DKOB 2EW9A 2N82B 1QE1A 2QMUB 4QYZK 3BGUA 4RUAA 4K0KF 2KG1A 2WTFA 4DL6A 4X65J 1PILA 4K0KJ 2LQ8A 3KLGA 4N8NA 5C42A 4FBUA 2KM8C 2GVZA 2A2DA 1O0PA 1U0HB 2E5JA 4KO0A 1KD1T 4ZLJA 1SVDA 3HHLB 1U6BA 4DX7A 4UUWA 1PGZA 1TL7B 2Z2ZA 4AFFA 1F5AA 4NLXA 4X4UA 2FD2A 2DHXA 5F9LA 1CJKB 2VKZG 3VTIA 3V2UC 1TZ0A 3CJ3A 4JI7F 2VFUA 2B9XA 1YTYA 5L1LA 2W9CA 1M1GA 1BQNB 2AQ4A 1OY8A 4OYIA 3AFGA 4K4YA 1ZM3A 3CE8A 1XN9A 4A4JA 4IG3A 5LOQA 1FRXA 2NS1B 3CF5Q 3M2UA 4B3OB 4GMKA 3DYAB 1HL6A 3TNVA 2VBYA 2ZE2B 1SJFA 1A0OB 2BDPA 5F9NA 4JI0J 4X66J 5CQGA 4NZ7A 4DV5F 4F0MA 4ID5A 1XERA 1KKHA 3TWZA 4PXDA 3VR1A 1HWLA 3W9HA 1Y4ZB 1M5HA 5F3ZA 4L3KA 1ZOTA 2HNZB 2DD8S 4KGMA 3VAKA 3N28A 3PRDA 4M63A 4KKOB 2YQ0A 3LWMA 3K0JA 2GHWA 2FY1A 2IM2A 2J9DA 3W66A 2J5AA 1XR6A 3W1YC 3VGUA 3MM5A 3O1LA 3BO2A 1RT5B 3M1VA 4K4VA 2F7VA 2R8KA 1RAEB 2QX0A 3MPWA 2JH3A 3DOMA 2ZC4A 4J9VA 3H2LA 4IO1A 2PIIA 3I56S 4I1TA 3FSIA 1U09A 1G2EA 5CH7B 4B9VA 1U1OA 2R7TA 3OSNA 2RHQB 1AFJA 7AT1B 3W8GA 3LP1A 4NLOA 1S6QB 3AOCA 1VC0A 2PSZA 4LSNA 3SV3A 3PG9A 1FKPB 4Y2IA 3R7SB 3OTOF 1SB6A 4AT1B 5HI7A 1NK9A 3K89A 4DCOB 5J2QA 3JAMY 3OTOJ 3VGTA 2GO9A 2VDIA 4DLGA 4OI2A 4XK8C 4ZA1A 2V8VA 2VG6B 4M5DA 3HJVA 2DCLA 4O3QA 3ZZZA 3PW4A 3SXLA 1DTQA 4AXJA 2DEJA 5MLCV 1S1WB 1M1HA 4TQSA 3AXMA 4HTJA 2GC8A 3BBFA 2ZH8A 3EGNA 4QYRA 4IOCQ 2X1BA 4NLDA 5F0WA 3T5LA 3TVKA 1JX4A 3KWMA 3VQSA 5E3CA 2ROEA 3NRBA 2LLZA 3RB4A 1K1QA 4DUTA 4WU3A 1BXNA 2ZH6A 4IFVA 1U1NA 2WONA 3CULA 2HRUA 1CQMA 3I31A 4OI0A 1XEZA 1X4EA 4DSFA 1WSVA 3VZHA 2BM1A 3ZXWA 3DDNA 1RBLA 2J6SA 1B0PA 3D54A 2RUGA 4KV8B 2V50A 1MU2B 4DR7J 2AP6A 2OPQA 1X9SA 2HURA 5B0FA 3RJMB 1ZYQA 1WD6A 4ED7A 1NDPA 5A8KB 1VLOA 6FDRA 6FD1A 5BJRA 1HBMB 5D0HA 1WOPA 4FPIA 3KJVA 2XLJA 2F5GA 2UVWA 3CC7S 2KT2A 3DFEA 2YNFA 2ZH5A 2HS3A 2ATLA 3DOLB 2NYHA 3OFGA 1WF0A 4ECWA 3RU0A 3JB9k 4F26A 2O1PA 5F41A 2EKYA 4UW2A 2KKHA 5E3QA 2MQNA 3G6ES 5B7WA 4B3RF 3IBFB 3P5BP 2FB0A 1K9MT 1B7YB 4AUKA 4C98A 5I4MA 1FDNA 5J2PA 3GP9A 4CCHA 1NK5A 2YKMB 2PI4A 4B3RJ 3HFKA 4QWDA 1OY6A 2LXFA 4DQPA 9RUBA 3TZXA 1MWQA 2E1CA 2FC9A 2DNNA 4PCQA 3W8PA 1WG5A 1NAQA 4BC9A 1ZM4A 4XDDA 2MZRA 5LJ3Y 3KJFB 1WELA 3PRBA 1RT2B 4OYOA 4OFZA 4I2QA 3CJ5A 3BO3A 1NLKL 4C8OA 1JB0C 4LF8F 4UQTA 2GHVC 3I0RB 1YQHA 4FXWA 1QUPA 2KVQE 2ZH9A 4M5GA 2OPSB 4RNNA 5AJ3F 2ZOMA 3MPYA 3QATA 3BREA 2YBVA 4DV6J 3EZ5A 4F4XA 3UDLA 3R6LB 3QWUA 2CWKA 3JSRA 4RW4A 2VU5A 4NLPA 4I69A 2L48A 3K2YA 1VQYA 2JEFA 4QW9A 4NE9C 5I42A 2M70A 4X4RA 1HQ2A 5CZVA 2E5GA 2VQFJ 3QSYB 3FGVA 1FKOB 3EZUA 5DDPC 2XB2D 4H54A 1N5YB 3KLHB 5HLFB 1TR0A 2L9NA 3T6JA 3A8KA 5I3PA 1J5OA 3I32A 2WBRA 4JB8B 1NDCA 2YKAA 3HMJG 2ATCB 4R8UB 2HLUA 4CO5A 4PRFA 4ED6A 2RVJA 2R2RA 2XMUA 1C4CA 1HBNA 1YZ6A 2V4JA 1S59A 1Q7YT 1XMQJ 2XWXA 4ETZA 3HHLD 2XSJB 3MDFA 3JSYA 2PD1A 3IG1A 1FNXH 2QSFA 3BYPA 2JHEA 1UP1A 2HVZA 1U45A 5KG3A 2BQRA 2FQQB 2QL5B 1FHTA 4Q8EA 4H4MA 3NGDA 4CLYA 2M0GB 2RMLA 1UVNA 3RBXA 3N01A 2VA2A 1EZZB 1IKXA 2FYXA 4X62F 1Q5YA 1EP4A 3O5TB 4PWWA 3CJQA 1VQ6S 2ZJQQ 1S0NA 3KMQA 2VHGA 5IXUA 5EWGA 1Y00A 3NGSA 1HHTP 1SQEA 2E5LJ 3GFHA 1U8WA 1WDDA 1U1LA 5E3RA 3UPFA 4YUDA 2ZH3A 5GVQA 2CJBA 3R2DJ 1SKSA 2FLPA 4ES3A 4G1PA 4LFCF 1VJQA 1RBAA 4WIQA 2RS8A 4O4GB 2KXFA 3W2VB 2YWEA 4ZJLA 3CDAA 4HEA9 3FEZA 1RT1A 3U7JA 1RU1A 3EPGA 3BGRA 1CSJA 2FHKA 2KU7A 1K8AT 3H8YA 4DFMA 4TY9A 3OR2B 2R4FA 1O8BA 2IHR1 2YX4A 1JLAB 1U48A 3NOCA 5T41A 3HXMA 5SUHA 2OIHA 2XI3A 1N8RT 5ITHA 5F3TA 3I87A 3R5AA 4PXCA 3V6HA 2RKIA 1JLQB 1UEKA 5ETMA 1YZ7A 2N7YA 5ETLA 3ET6A 4K59A 3ELHA 3AA8A 1SL0A 3OFEA 2BE9B 4L72B 4KHMA 5L1JA 3EGVA 1YRTA 2HQDA 4MIWA 2KT5A 2O3DA 5C5JA 1R0BG 4Y65A 4I6YA 2IYIA 3LTOA 2Q6CA 3A1YG 2EC2A 4DFKA 4FF1A 1HPZB 3MF5A 2CZVC 4OI4A 4A8WA 5IV4A 2R7UA 1VS3A 4O3RA 1HBOB 1TK0A 5LM7E 2A10A 4N8OA 4B08A 1RBOB 4CTAA 1N4LA 1FJGF 1KWMA 3FCWA 2XQCA 4ZVOB 4KH0B 2BACA 3O2IA 3OUYA 5AXKA 4WFZA 4ZCMA 3FJ2A 4DR2F 2M2BA 4FPRA 1VIOA 2KXNB 1VQ4S 2QRRA 1JMTA 1KSPA 1UTAA 3VWSA 3UVJB 1PAEX 2HFNA 4XPEA 5EDWA 1PBAA 3LPYA 1S9EB 3SI8A 4URQU 2JEGA 1RACB 3WIVA 1GAOA 1IBKF 5IM0B 1DURA 1Y11A 2ZHAA 2C2OB 4NWBA 1RT7B 2XZDB 2PFDA 4X4VA 4B3TJ 1IBKJ 1VQ7S 2VJVA 1T94A 4MKVA 2V8DA 3WIUA 4H4KC 2V34A 3PO4A 3G8QA 2G4BA 2R8GA 1S0MA 2KFZA 3M6VA 1U1QA 2CQ4A 4MMOA 3BBBA 4NMLA 4UF4A 5A8RA 1KHWA 1LW0B 2MHEA 4LREA 3H90A 1EKSA 3DLGB 1G3OA 3LAKA 2WB4A 3M05A 3RBZA 2CQGA 1RHJB 3Q0AA 4DL2A 1PYTA 3DM2B 2QL9B 3MWBA 4HACA 4ZPAA 2VOOA 2N4CA 4EBCA 1RLDA 3ITHB 3BS9A 4NCAA 2YKNA 3LP0B 3M8PA 1M5VC 4B9NA 2CNKB 5HATA 1WUUA 1XTZA 4IUFA 1LFPA 1SJ1A 4DQRA 3I9V9 1P8GA 2Y1LB 2GHPA 4EYIB 3M32B 2ZH4A 2NZ4A 4JV0A 1RTIB 4JUZA 2HBYB 3UE2A 3BPDA 1S1VA 3QZ8A 1NKCA 5SZTA 2CDRB 2IRYA 2UUWA 3CD7A 1HI1A 1YWXA 3BSNA 3ZTPA 1S1TB 3CIMA 3CCJS 1VBKA 2FVPA 4Y00A 1HWUA 3OTDA 1L3VA 2U1AA 4OHYA 4E98A 4R5PA 2CPEA 3C16B 4KGVB 1OSCA 2AEMA 2B6AB 2H1YA 3MEEB 4P7TA 2IM0A 2D7SA 2HZCA 1TL3A 4WE1B 1IBMJ 3G6XA 2WVEA 1HQEA 1WHYA 1TFYA 3VCDA 4JI2F 3ENQA 2CJYB 3DRSA 4NYZA 2DGOA 4ILRA 3PV8A 4RZRA 3R5JB 1ZM2A 3VVTA 3PYFA 1C1CA 4URGA 2ZBQA 5KFTA 4MJKA 2AHOB 3WX8A 1NDLA 1P6TA 1KQSR 4ZLLA 1M5KC 1YKWA 4DU7A 1R8HA 3AD9C 2FIUA 1WKKA 1S9GA 3U1NA 5IZHA 3US5A 4IH7A 3AD7C 1NNDA 5M2PA 5JJBA 3PHTA 3Q23A 3M30A 1KS2A 2E7VA 1HNVA 3M9NB 2BJ1A 3A8IA 4OZLA 2N3LA 2FHJD 4MKYA 1RTDB 3TJ8A 5IOLA 3FBEA 5KFAA 3FKBA 5EWEA 4OI1A 1RLCL 1AUDA 3GJSB 3W5ZA 1HNIA 4DUYJ 3I0SA 4ETXA 2HMIA 2DTJA 1IWAA 1IVZA 2RQ4A 1KR4A 2UXCF 2Z57B 1T7PA 2GCFA 1T9XA 2LEPA 1R0CB 3J7YU 3OL9A 1H98A 1FESA 2YKPA 4LFAF 4XAKA 6AT1B 4WFYA 2QG9B 2UXCJ 1N56A 5KFSA 4DUZF 1C1BB 3KDNA 4LFAJ 1Q1KA 4YN3B 4WYLA 3BN4A 4DG1A 1NEEA 5H9FJ 3QZ7A 1YJNS 4DUZJ 4N77A 1MMLA 5AT1B 2DB1A 4QYZJ 1LWFA 5DDQC 2ZVIA 3DRYA 2P2CB 1BMQB 1QAYA 3JTOA 5J2NB 1F9HA 3MMAA 2M9KA 4PKDB 3QIPA 2YNGB 4N56A 2AX0A 1TMMA 1IBLJ 1VYAA 2ACYA 1I1GA 2E7XA 3OVAA 4RBUA 1HLWA 5KT3A 2IMOA 2DGQA 1JLBA 1RHUB 3I55S 2D74B 2ZM6J 2X51A 1ACMB 2HEKA 1YIJS 3HSJA 1OQ3A 3ZZUA 4OJ1A 1T11A 2FZGB 4EO6A 5HJYA 2YVSA 4HLBA 3G82B 5F8IA 4M94A 2D1CA 5DM7Q 2RD5C 1BWVA 1XNQF 3H2VE 4IR9A 2ZFHA 1U0HA 3HHLA 2GGPB 4BWMA 4E2FB 1TL7A 1C2PA 1X7VA 2VFTA 5D4OA 1PC5A 3UCUP 1CJKA 1HFEL 1LW2B 2LP4A 1PJ7A 3ZTRA 3M9MB 4NYPA 3DKDA 3IFEA 1NSAA 1BQNA 2KL8A 4WFAQ 4B9TA 3HPOA 2CYYA 2Y0SD 3VZIA 2BKPA 3PX0A 1F2GA 1LK7A 5D78A 4B3OA 2UUAF 3Q8SB 2ZKUA 1RAGB 3W5YA 3DYAA 3E01B 2NPIA 2ZE2A 1S4FA 2MQ8A 5B08A 1VGYA 5A2QU 2UUAJ 2G2YA 1DLOB 2BKNA 1S97A 2XYGB 1HD1A 4P2SA 2HWHA 2ZH2A 3S8SA 1RK8A 1HKAA 2W1BA 4HH0A 3HX9A 5B0EA 2HNZA 4OX7A 2NSCA 2MKIA 2FGOA 1V5IB 4C8LA 2EG1A 2V2VA 4DR1J 2FJVA 1YBAA 2MQPA 2V63A 4KKOA 2RUSA 2MQOA 2KJWA 3MD1A 2UXBJ 4IRKA 2QN6B 1HW9A 1RT5A 2HHWA 3RZAA 4DV2F 3Q2SC 1QLNA 1N5SA 2AT1B 1AUSL 2AZ1A 3M2RB 4CLSA 2MKYA 4MTPA 2HAFA 4DV2J 3GU0A 4IH6A 1R8BA 2X3GA 1SJ4P 4LVNP 2OAUA 2ILYA 1SC6A 2WZ1A 2EVZA 4DCPB 3MEKA 1ZAXA 2QLJB 4NA3A 1VQMS 4DSKA 2UV8A 3HULA 1LWXA 1UMJA 1S6QA 3RYLA 2W7OA 2JWNA 4TU9A 5C7PA 1XQIA 1FKPA 1EQ0A 4B3MJ 2XS7A 3LWLA 3VAGA 2W2OP 1TMJA 1X9MA 3BQ1A 2BANB 3MXHP 5D4PA 3QFHA 1IBCB 1PJ6A 2RF2B 1S6OA 1EKRA 2C2KB 2KH9A 2HGLA 4WYWA 2HS4A 2VG6A 2FVCA 3FMWA 4ES1A 5KT5A 2HW3A 3LQVA 3IO1A 2MLZA 3I96A 2HQFA 2MLYA 4QR1A 4P73A 4J9NA 3RW7A 3PEHA 2VBZA 2CUYA 3CO9A 2BJ9A 3W60A 2ADCA 3I5AA 3A3PB 2FJEB 1S1WA 2JZ5A 1H6KX 2B9WA 2UP1A 2Z58B 4YY3F 4U7UD 5ETKA 3EPIA 1MMDA 3T1AA 1RP5A 3K8VA 4YY3J 4DSJA 2VFSA 1IN0A 3MMJA 3M8QB 4ID8A 2OH2A 5IV3A 2UVRA 4P2XA 1MROB 3MTJA 3GIRA 1I5OB 5HQMA 3R27A 4KV8A 1MU2A 1YITS 5L46A 2ASYA 3AOAA 3QT5A 1WKJA 5A8KA 2WW4A 1VQ8S 4HTIA 1RT6B 2H4WB 1Q95G 1HBMA 4CLPA 2OPRB 4WIIA 1HNWF 1QVFR 2OEMA 3VF0B 2UUBF 4O3NA 1XC9A 3V4MA 3RAQA 3DOLA 2OTLS 1DQ8A 1HNWJ 5BYQA 3G6YA 2UUBJ 2PGCA 1TK8A 1TVRB 1ZTWA 1T95A 2WK4A 1EARA 3V6DB 2H3EB 1A9NB 4Q0BB 4N76A 1ULRA 3HFZB 2XMTA 1RHRB 2C3OA 2EFOA 4F4ZA 1R3NA 3AOBA 2YWKA 2KM8B 4GC7A 2N3OA 2YKMA 1RWKB 2F1FA 2HLTA 4OYBA 5DJBA 4W90B 1YBUA 1JJ2R 5L39A 3KLEB 4HHJA 4G65A 1XNRF 2MJUA 2KB2A 4J9MA 3RRHA 1HARA 1D9AA 1RT2A 2AYEA 3SQOP 1XNRJ 4ED3A 4C6AA 1RWXB 1Y9OA 3I0RA 2AD9A 3AY0A 1NZAA 2XO7A 5GAEI 3U27A 2OPSA 5A2QY 2E5IA 1YG0A 3TYTA 4ERDA 2W01A 2NYIA 2X1FA 4QU6A 3TR5A 5GMKa 5IC4B 2BA9A 1VK3A 5ETOA 2XYHB 2EK1A 4DEZA 1TKTB 4PAAA 2MKSA 3EVWA 1Y5IB 2HBZB 3RR7A 1T9UA 4ECTA 1Y7PA 2R8IA 1U02A 1FKOA 2IM1A 1RB0A 1RKIA 2RHSB 2CPXA 1UA0A 2MEWA 1CLFA 1TFWA 2E1PA 1V3SA 4GRSA 3KLHA 1N5YA 5HLFA 1Q86T 3I4HX 3R2CJ 3IAS9 4ZVSB 4USJC 1WEYA 3R8YA 1S7HA 1RCXB 2UUTA 2ALZA 5D8HB 1WNEA 3MM8B 3HZGA 1K44A 3CD5A 4R8UA 3BN7A 2R2UA 3NNCA 1FE4A 4RW9B 1BHNA 3TZZA 2DR8A 2JC0A 2XSJA 5JVGQ 4LVOP 2XZWA 3BDPA 4MK7A 2OO4A 4QBUA 1IQTA 2COLA 2YWHA 3S01A 4BCAA 1RTHB 2RH3A 4KTQA 2CIMA 3PYDA 5E2QA 2FHJA 2CNNB 4ZVPB 1NZ8A 3IP0A 1VQSA 2I1RA 2D3OR 1GEHA 3QBCA 3GTYX 3BQ0A 3NWGA 5KOWA 3IA0A 2ZBIA 2EC0A 4I0WA 1MWYA 2DPIA 1WTFA 2H4YB 3FSXA 2EFNA 4C8ZA 4OLPA 1WI6A 3Q8YA 4ATNA 2W4PA 2YTCA 1VBXA 1NB2A 5FIIA 3I9ZA 3A8JA 3NCRA 1KLMB 4DSEA 2OTJS 4TQRA 2XULA 4QCLA 1LXNA 4DQSA 4H4OB 1PKUA 2ASJA 2DK2A 1IWGA 4O4GA 2BJ7A 2ADBA 4K4TA 2RS2A 3W2VA 2RSQA 4DWIA 4IFYB 3BDEA 4CLFA 2Z2LA 4CO3A 2QC3A 3FZBA 1S0OA 3DNCA 4JYAJ 3I6PA 1DRZA 2PMZD 3MAAB 3OR2A 1X4FA 1RWNB 5KOXA 4OZNA 1JLAA 2ZDPA 4GKKF 2BJ3A 3E2EA 2O67A 4KC5A 1SV5B 5B0BA 3H5YA 1R8PA 1MMNA 2JEIA 1UKUA 3K59A 5J2MB 1SCJB 2XO6A 2VH7A 3W63A 1VQPS 4PABA 2XYPB 2ZDOA 2LEBA 3P96A 2JRSA 1JLQA 1KVJA 1FRHA 3OT9A 4DPOA 2C42A 4CI0B 2NQPA 3Q8QB 3NAIA 1E6VB 3D0GE 1KVIA 4KIAA 3NAHA 1AYEA 2P5VA 3BGFA 2UZAA 3TUPA 3T19A 4ZK7M 3T6BA 2J0SD 2QGFB 5DLGA 2XCPA 4IOBA 4PXBA 1HPZA 3N4WA 4K4SA 3CCZA 3AJ1A 1OS5A 3LP2B 1HBOA 2QLWA 5D6GA 2ZWPA 2LYVA 1N0VC 3QJPA 1F5CA 4X2BA 1Q8KA 3DLKB 1Y3JA 2VD3A 2G13A 4C2MA 3CCSS 2CPYA 3MOJB 4ED1A 2VOPA 1FA0A 3RBEA 4DOZA 1IR2A 2LQ5A 3GV5B 1O51A 2AV5A 2CZ9A 1G7CB 1V3RA 2JSXA 1K0VA 3J81U 3EXCX 3FFIB 3UVJA 1XMBA 3O3LA 2YWWA 3VGVA 2V8HA 4I2PB 1RWOB 1S9EA 2RRAA 1L3SA 5BYSA 5IM0A 3CCMS 2GMJA 2Q3PA 1RT7A 3JTNA 3MM7B 4CZCA 4O0NA 2WVFA 3IWLA 3EUNA 2LQJA 1SJ3P 1JWWA 3QGHA 3BPSP 3PR4A 1KHVA 3ENVA 1YRXA 2PC6A 1OY9A 2DHHA 3CCTA 5KT6A 3GR1A 3QNWB 3FBFA 3H4DA 3HF5A 2MJNA 2XCAA 3LANA 2VPYB 1NRKA 1LW0A 5T14A 1UL3A 3GIMA 3MEDB 4N41A 2HVHA 4IQXA 2B4UA 1DAXA 3D7SB 3BYRA 1F1BB 3DRRB 4BBYA 3DLGA 2XLIA 2K7KA 5KG0A 3PKYA 3I5CA 5DS7A 1JLEB 2MHNA 3DM2A 1R6YA 4L76A 2ACMA 2VODA 1U47A 4RW6B 1WACA 4ZIWA 1ZH5A 2QIFA 4IH5A 2KHCA 2XZTB 3ITHA 5EUHA 1SPBP 4KY3A 1GX6A 3LP0A 3FQLA 2FVQA 2P9GA 4FS1A 3UCZP 4WCEQ 2UU9J 4I7FB 2BKOA 2V2KA 2CJAA 1U1PA 1BQMB 4C0HA 3B4DA 4DDFA 1KQGB 4EGLA 1KN6A 1U8SA 1Z2ZA 4TXSA 3UNGC 4DLEA 3M32A 1WC4A 1U0SA 1SI9A 1RTIA 3NMRA 3HT0A 4I68A 1R8CA 4CNYA 1IQZA 2GA7A 1IKYB 3BV8A 3BBCA 3Q24A 5KFIA 1UWAA 1S1TA 2J0XA 3GFZA 2A6MA 2ZKTA 2LA4A 4CLWA 1U1MA 3OSPA 2HFSA 5HO4A 2XLKA 2M7SA 2AWZA 3K5MA 4FBTA 3NWRA 4B9LA 1ELOA 1OYEA 1Y5NB 3C16A 2AW0A 5AE3A 4RW8B 1H7WA 1H2UX 2B6AA 4AL6A 2VQEJ 3MEEA 3I82A 2X1GA 4A47A 3PW7A 2PT0A 3UN3A 4WE1A 4OYZA 4YB1P 4ELUA 1NDKA 2OP5A 3IMQJ 2CPDA 2NPFA 1IUJA 3QPIA 4I67A 1MN9A 1RXOB 3K5PA 4GKJF 5ETQA 3VAIA 3PNIA 2YXLA 3A3NB 2W2QP 2GJIA 1SL2A 2L41A 2ASDA 3OVSA 4ECRA 2BEFA 2C2DA 2J9DE 4G3IA 2ZEJA 3NG8A 1S76D 4BDPA 4DPUA 1RKJA 1Q8BA 1WORA 2HGNA 3PFEA 5D77A 4ECZA 1UZDA 1IJEB 5KFFA 3DXBA 1CC8A 2EG2A 3KHLA 1P9QC 2DY9A 2MQQA 1Q7LB 2CQ3A 3RB0A 5D4NA 5EWFA 2RILA 4JI3J 4MYTA 3OXFA 3HHLC 3TX8A 5DO2A 1RTDA 3BQ2A 3J81j 1ZETA 2P9EA 4JI6F 1BQXA 2I5JB 3IBWA 2XY5A 4ZPDA 4NXMF 2MGZB 2FPHX 2N7CA 1S79A 2I9SA 1WJ9A 1G4CA 4PZVA 1JIHA 2VBXA 4ZOSA 1FERA 1KNZA 5GADU 1FDAA 3OUYB 3DCAA 1VQLS 1N5VA 3CJ0A 4MIAA 2JNJA 3GYXB 3C2PA 4B9MA 2W2NP 1B64A 5GAGU 1NSQA 2G0JA 4DX8H 3ZTSA 1KBRA 4JI1J 1C1BA 2DHGA 3J81Y 3T1HJ 1DJ0A 4E8UA 2VL1A 5HVGA 1RJJA 1QSLA 2CG8A 1HNXF 2HAIA 4WP8A 5KFBA 2W2PP 4WU2A 2E29A 3D1HA 2L9WA 5EGYA 4CH7A 4KPYA 5J2NA 4RX6A 4UTGA 3KUHA 1F9EB 2YNGA 2MZSA 3ETOA 1VK8A 2CA9A 5IWAF 2XG8A 3PXGa 4RNHA 4E0DA 1GMWD 1HR0F 2VICA 2UUCF 2D3UA 2J9EA 1A6LA 4Q45A 4UOCA 3D1OA 2MQLA 4DSLA 3S1TA 3V6JA 3TJAA 4QU7A 4QQBA 1TAUA 2DEIA 5HMWA 4CLLA 5E0OA 3CDBA 1NK6A 3G82A 1UEUA 4U8VA 2V67A 4NOHA 2OFGX 4ZP8A 4RR5A 2HWIA 1J2VA 4RUHA 3MAQA 4NLYA 2ERRA 3W9IA 4JI8J 3UD5A 2GGPA 2Z4PA 3I5BA 4PQAA 1LV5A 5LL6d 2K7JA 2KZMA 3RAMA 3ZTQA 4F50A 3R3TA 3D68A 1LW2A 2B3TB 2HGMA 1MSWD 5B0GA 2G2OA 4ED5A 5FJ4A 4O23A 3J7YI 1AT1B 1Y3KA 4PXEA 2DIUA 2F4VF 1W2BR 5D3GB 3PZPA 1RWPB 4XO0A 2ZZTA 1VHFA 3EE3A 1X9WA 3UNYA 3NGTA 2YWFA 3PKMA 2ZBCA 3K7RA 4EUVA 3CB4A 4NASA 3E01A 2BZ2A 1YRUA 3HSGA 1I6JA 2Y1RI 4OX8A 1D0EA 4MFBB 1RGVA 3NP5A 1UWBB 1DLOA 2KJVA 2XMJA 5L1IA 1ZPWX 1CJTB 4DL0C 3MECB 1S99A 3TX0A 4FNHA 4P2MA 3PEJA 4TN2A 1IR0A 2FVRA 1YGYA 4RLEA 3U1LA 2IDLA 1JJ4A 2BOPA 2HQGA 4TLQA 3FCHA 4BS2A 4IRCA 5KFNA 4YB6A 2OD6A 4CO1A 1RHKB 1VC6A 4BWJA 3IR7B 5GAHU 2VASA 2YWGA 4OYXA 4ZDNA 5DDOC 1L3UA 2R2SA 3CJSA 3BH7B 4F7VA 4EFAC 2K3IA 4LFBF 3GB0A 4L3NA 3CMQA 3M2RA 2KZZA 1KTQA 1HI0P 5KTQA 4KYZA 3TW0A 4ZCLA 5IFMA 4ANDA 2IVFB 3AB2B 3FEYB 1WOOA 1SKUB 5KG6A 3ZFVA 3PW0A 4MK9A 3MM9B 1O5JA 3ENAA 3C15B 3CCQS 1QUVA 4S0MA 2MDAA 3KK3B 2GIQA 2ZHOA 2DRBA 4Q8FA 3MPDA 2YNHB 2CVIA 2B43A 1FNOA 3ICLA 3M4XA 5DZ7A 1X4AA 2BANA 2EK6A 2AYGA 4ZN1A 2RF2A 2QYGA 3G2XA 4FYVB 5A8WB 2EPIA 1OSDA 4WF9Q 2MZJA 1EJ7L 2EBGA 3KUGA 4XDCA 2WCXA 5B0DA 2KO1A 3L95X 2DHAA 4WFBQ 2IBOA 2QA2A 3UR0A 5CYQB 3VAFA 5LSLA 3BM7A 3OXGA 2CQHA 1HD0A 4USKA 3M7VA 2W7AA 2DGVA 3LPEA 4A8FA 1S7IA 3ILLA 5BXIA 1WWHA 1OWXA 3MPVA 1RWVB 4CIOA 3GV7B 1C0TB 3PY8A 4C8YA 4NL5A 2DISA 4Q7AA 3D6MB 4NCGB 1CG2A 4U6PA 1NHUA 1TL4A 3GIKA 3IBCB 4TYBA 3M8QA 4XIUA 1YX2A 4FF3A 1MROA 3HHKA 1F3FA 1LFWA 2IVMA 4Q5VA 4M5HA 2KYXA 3SZ2A 5LMUF 4A8OA 1AW0A 5LSOA 2HFUA 4DV4J 4DPWA 4RNMA 4DR5J 1J5EF 3NMAA 2WHOA 4OZJA 3QMQA 3EMTA 1RT6A 1IJFB 5LMUJ 2JLGA 1DBDA 4KE5A 3T5JA 5A76A 2AJ2A 2OPRA 4PWUA 3DOKB 1RZMA 2QZ8A 4MK8A 4DV3F 3H98A 5DRKA 3VQTA 4LSLB 2WOMB 3KXDA 4WWSA 4F2SA 2DY1A 2VB6A 2ALYB 3FK4A 1SQFA 4WBFA 1TVRA 1YJWS 4NI2B 4JI4F 4P75A 3V6DA 4Q0BA 2MSTA 3HVTB 5B09A 2E1RA 3RGIA 4Q2LA 3CDEA 1SC3B 1JLFB 4URSA 2O01C 5JMNA 1CPZA 2LMIA 2F8EX 1T3NA 1PYOB 1S49A 4O4RA 3KLEA 1FF2A 2Y1IA 4LF6F 4JI7J 1DARA 1MN7A 4M8LA 4C3MA 2F40A 1N33F 4G1QB 4JI5F 2BRLA 2I6WA 3OD2A 4LF6J 2MMYA 4GVLA 1R43A 1OMSA 5A6WA 4NZ6A 4JI5J 3TJ9A 5KG5A 4DR4F 3J7AN 1H74A 4MAKA 4N7TA 3CCLS 3T3FA 4LBIA 3CWJA 2QLXA 3PRVA 4RWXA 4DV5J 3ADAC 3FVYA 4DR4J 1TUVA 1VQNS 1IKVB 4KRWA 2NXEA 4DR3F 1VISA 2HWTA 1TKTA 3CMAS 2HG4A 4LSZB 5ETVA 4J9RA 1VQ5S 3KLIB 5KFEA 1RDRA 3KJNB 1MNEA 4WTYA 2Y3YA 4A8MP 3GQCA 1WHVA 3IXQA 5JXSA 1Q4RA 2HHHF 1NJYA 1NBEB 3CD6S 5DGBA 2C3MA 4UOHA 3H5XA 1T9YA 3HO1A 2HVDA 3MM8A 1IKWB 1T03B 1QSYA 4J9QA 5D0RA 4RW9A 2C2ZB 4I6WA 2ZNYA 1HWJA 2UVUA 1PSDA 2WRMA 4UZCA 4UUXA 4J9OA 1FDBA 4ECYA 2XSFA 1WHXA 4OX6A 1S6PB 4ER8A 2YX7A 2RRNA 3SCIE 3HDSA 5G0RB 5KG2A 2FC8A 1U49A 3D9BA 5L8RC 3VVUA 1RTHA 2B0GA 2OKQA 2DR9A 2QT7A 4C3KA 1N5TA 1NKEA 2RDJA 1VQKS 2KRBA 4DN9A 3KDOA 4ZPCA 3TA1A 2CJQA 1DQAA 3TQEA 2W2MP 2LCWA 2BMBA 4X64F 1SL1A 4DR6F 4A48A 1ZAWA 1D9DA 1QAIA 3KG0A 1NH8A 1U7LA 4DR6J 2CJ9A 5ETSA 5HROB 4MYUA 1KLMA 2XBPA 2OSRA 1X5SA 4H4OA 4X4NA 2DNMA 4FKXA 2BVZA 4Y0FA 3F44A 3Q8RB 4GO5X 3DLHA 3DRXA 4IFYA 1SIWB 2G9OA 3M8ZA 3RTVA 3AD8C 2K06A 3DMJB 2FHMA 2KT3A 4ED2A 3MAAA 1B0VA 3KK2B 4NPOA 4WTOB 1VQ9S 4QWAA 2HBRB 1SV5A 1GMWA 5J2MA 1U2CA 4J9PA 3GFYA 1U4BA 2JOQA 3BEGB 5DG8A 3G86A 2AU0A 3D6HB 1BLUA 5KFXA 1P9YA 2MPUA 1KQKA 3W5XA 5K8NA 4ZVFA 2VV5A 2BQ3A 1E6VA 2D3O1 4NLSA 3D4JA 3SQGB 4Y2KA 4NLWA 9ATCB 5DETA 3AHPA 3C6TB 3SCJE 3UDVA 3D3CJ 3SIPB 1NB7A 4O44B 5RUBA 1W7WA 3KHRA 1F0XA 1MW7A 2FDNA 4RL1A 3G96A 3GJTB 2KRRA 2XMKA 3ENWA 3LP2A 8RUCA 3OL8A 3HM9A 3UN2A 1NCLA 3O44A 3DLKA 1YSJA 3QT8A 4ZPBA 4LMZA 1X5PA 3DLEB 2GAGC 4LIRA 5ETPA 1EETB 3CC2S 2M3DA 3NCQA 4DV7F 1TAQA 2IRUA 1VJWA 3FFIA 2BX6A 4LF8J 1S1UB 1SIZA 2HYIB 4EU0A 2FZCB 2V4RA 1Y0HA 4QZVB 2FJBB 2HHUA 4I2PA 2R2TA 3D6FB 3TOQA 1RABB 3PYGA 2IDEA 2GV1A 5HMXA 4DV1F 3L4BC 2XMAA 5AJ3J 4M5IA 1WTBA 4YDDB 2J8AA 1YJVA 4ZKAA 1T05B 3CMES 2QV6A 2LU1A 3F0NA 3MM7A 1S0VA 3T1YF 1AZSB 3IM9A 1V9OA 1XR7A 1H3DA 1HIYA 2A0FB 5AE2A 4NLQA 3FC9A 3OVBA 3GILA 1TUWA 4KFBB 2CQDA 4FS2A 1PIEA 3HT3A 4IDKB 4WK3A 1H2TZ 1XBWA 5ETNA 5KAKA 1YVFA 2ZZMA 3C14B 4C11B 1DFDA 3MEDA 3LGMA 3DRRA 3M6UA 2UXDF 3HZEA 3TVYA 1C0UB 1JLEA 2XNQA 3IRWP 2J0WA 2IPOB 2I0XA 2R9LA 4M5NA 5C2GA 2OELA 2HK2A 3DXSX 4RW6A 1M5PC 1FI4A 4DQQA 2WBMA 4OHXA 3TAQA 3U1MA 2D9OA 5E33A 3C3LA 2A18A 2OD4A 3GE9A 2V94A 4UQGA 1EB0A 4AD6A 4I7FA 1BQMA 4ALZA 4X62J 3PACA 3B6BA 2VFRA 5KFQA 4C4WA 5AXNA 2JEJA 3ZZPA 1YJ7A 3EXYA 4CNZA 3MURP 1ZPVA 1X31C 2B9EA 3MMCB 3EZOA 2HIYA 3P5TL 4FYXB 2L3MA 1IM6A 2OHDA 1IKYA 4HT5A 1NPPA 2OMLA 2ZITA 4UT4A 3V6KA 3CSKA 3N6MA 2CFXA 3AQOA 1VBZA 2E1AA 2BUNA 3VV2B 2E9RX 1RADB 2FZKB 5KFLA 4LFCJ 5LSRA 5LMNF 2CAJA 1TK5A 4RW8A 1S77D 2NREA 4U96A 2YX1A 1RHQB 2OUGA 3DGVA 2ZOFA 1CQNA 1SQGA 2NXUA 3J7ZT 4QWCA 2M4MA 4F2RA 1X4BA 5HK4A 1ZS6A 4J9LA 2DH7A 5M2RA 4LF5F 3W7BA 1PBUA 2V9WA 4FYDA 1NK4A 2GIFA 2W4CA 3C19A 3D0IE 1NJZA 1JLCB 3OFHA 2F9JA 2K3KA 4K8RA 4EBEA 1TQLA 3DU6A 4C97A 4ZN3A 2A6OA 2GIRA 3DGPB 4OJHA 2CQCA 1KOOA 3B4MA 1QD1A 5D15A 1GTHA 3G71S 3SDEB 3MR5A 1RAOA 4PG6A 2MY7A 1HBUB 2JVRA 3NCPA 2KVIA 4YP3A 4R0EA 1FJ7A 4ZJQA 4ZLNA 3GMGA 4LF7F 1UFWA 4Z7CA 3CT9A 4CO4A 2V8GA 2I5JA 4DFJA 2BE2B 2Z2YB 2MGZA 1L3TA 5KFCA 3HI9A 4FF4A 2YH0A 7FDRA 1YK9A 3RB6A 4O3OA 2PMWA 3V4IB 3HFVA 1S1XB 2BM0A 1YJTA 1WC6A 4P7VA 2O66A 2YPZA 1FJGJ 2I38A 2RRBA 3ULHA 3OR1B 2DNKA 3RW6A 2RQCA 2LVWA 1H72C 1W2IA 2W4DA 4DR2J 2NXJA 3AJDA 1UETA 4AL7A 3ILJA 3TZWA 1NKBA 3L7UA 3THPA 2W7PA 4N5SA 3TA0A 5CD4H 4IKAA 1XIQA 4NCBA 2HHVA 2XTJP 4B3SF 2QFJA 1RWWB 1S9FA 3D1QA 4JP8A 4LRFA 5C24B 4KHPF 2NLWA 3M6WA 4V19J 1RISA 4CO2A 4RW7B 1T9TA 4G1IA 4B3SJ 2XHWA 1N34F 5FD1A 1I3OB 3KG1A 2GJFA 1AFIA 3P4UB 1G1XA 1H2VZ 1N36F 3F41A 4ZP6A 4TY8B 2VPWB 4ZIVA 2C22A 3CD0A 4M95A 1N32F 3GJQB 2EEYA 4ZHRB 3PYEA 1B4SA 2C2MB 3L7OA 4B02A 3PIOQ 5CHCB 1UVIA 1K0TA 3GPAA 4P2FA 2KYZA 4DU8A 4ECSA 1SH0A 2Q79A 3BKTA 4I6AA 4OIXA 4A8KA 2IJNA 3NNHA 3CC4S 4Y6IA 4I4BA 3RBDA 4F4YA 2F3JA 1UA1A 4ITSA 3DHXA 1D3WA 1K47A 4PQUB 1VRUB 3KJQB 4J9KA 4J37A 4LR9A 2DYAA 2XS2A 2AGPA 5J1EB 5GADI 3D67A 1ZZFA 5KFJA 4F36A 4YOEA 1XMOF 4Y2MA 4KB7A 1ITPA 1OPZA 1RWMB 2OI2A 2ILZA 5D3GA 3R5GA 5GAGI 2OEJA 3Q22A 3KFWX 1XMOJ 2IBKA 3OL7A 4G6VB 3ZZOA 2C3PA 4L73A 5HL7Q 4AQYF 1T9WA 2RT3A 2ZBRA 3OLBA 4LF2A 2Q66A 2KFYA 3T5HA 4MFBA 3GYGA 3N0VA 3MUMP 1O6XA 2F9DA 4F02A 1DHMA 3T5KA 1UWBA 3UD4P 2NUUG 4ZVTB 4CP5A 2IC3B 4ZP9A 1LWEB 1CJTA 1LNQA 5AXMA 3W2WB 3MECA 3GG0A 2QJ3A 2VG7B 4NX9A 2HK3A 1MWZA 4YB5A 5ETTA 4KT0C 3LO3A 3R5BA 4A8QA 4P10A 4F25A 3ZNJ1 1L3KA 4OZ0A 4M1KA 2DRAA 2E44A 4KHRA 2GMLA 2W8KA 1ZM9A 4YFUA 4JI2J 3MR3A 5D0GA 1WF2A 4JV5F 1R8AA 1YDLA 1K1SA 3G6VA 3JS9A 1BD6A 3BKUA 2DCUB 3ZZRA 4CLKA 5E3PA 2LKZA 1PYSB 3NBPB 2H48B 4OJGA 1KOHA 1WHWA 2NZCA 4X65F 4OI3A 1Q78A 3IGNA 3MM9A 3C15A 2OLWA 2Z0GA 4IQMA 2IAJB 3AQPA 4NEYA 3JSBA 3KK3A 1B70B 4A8XA 1TV6B 2BW2A 2YNHA 4YR3A 2WSFC 1SUQB 1FTRA 4W98A 2V2QA 3L09A 2BR0A 3G4SS 1R7IA 3VALA 3Q8PB 1N54B 2PEHA 5A8WA 4M5KA 4DZ6A 3M6XA 3HHNB 1GTEA 3CCES 1JNZB 1FRIA 2CADA 3IRXB 5KT7A 2VG5B 2G1HA 1GFWB 3MM6B 5CYQA 4QPTA 1WC3A 5D0EA 3QO9B 4HL9A 2HHPA 1UFLA 5CABA 4QWBA 4ZVQB 2R7RA 1F2HA 4K4ZA 1SXLA 4K2JA 1W26A 4KAIA 3N6LA 5FLXU 3TRGA 3JXOA 3WZ0A 2PI5A 4CM0A 3G8SA 1C0TA 2IMWP 3RR8A 3FCVA 5I3QA 4NCGA 3SCLE 3LH2S 4F3QA 4NMXA 1HQUB 4JI0F 4X66F 1Y5LB 3MR7A 3JSMB 5GAHI 2IFXA 4KSEB 1K73T 1YI2S 2EFQA 2F63A 4OJ3A 2B56A 4UY85 4DS5A 1URRA 3S7RA 2OEKA 4EZ6A 3BH6B 4C8NA 2M8DB 3MZIA 3S6EA 1OO0B 3GCWP 4RBTA 2V68A 2YQ1A 2P6TA 5KT4A 3K58A 4ILMA 1VLYA 3DOKA 3AT1B 2CJKA 1RTJB 4LSLA 2DNRA 2WOMA 2ZC3A 1MG7A 3KLVA 3HD1A 1KFDA 2E5HA 4O3SA 4TU7A 2B5JB 1XNQJ 4NI2A 3MI7X 2D3ZA 1WI8A 3OFFA 1NK0A 3HVTA 2PDAA 2CKWA 4X4PA 5HAOA 2HFVA 2VFVA 5K8MA 4YR2A 1JLFA 3NS6A 3IS9B 1FXRA 4CYUB 2LQ9A 4QWEA 5E5NA 4NLTA 1RHMB 3W65A 3SV4A 4PG5A 4OHZA 1N0UA 3TUIC 4G1QA 1Q16B 3PX4A 1E6YB 4LF9F 2HHXA 3GSDA 1VRTB 4OZ5A 3FBBA 3C6UB 2ZBPA 3M8RA 4F4AA 4LF9J 5CCMA 2MKJA 4PUOB 4CH1A 4WFXA 1CS4B 2BE7D 1M5SA 4Q2MA 2DNHA 3K5NA 1ZBTA 3BO4A 1IKVA 1OJ4A 2RDDA 1L5UA 5IT9U 2K8GA 3TP2A 4OX9F 1NU4A 1QJHA 1FNMA 4QIVA 3H59A 1N88A 1S5ZA 3KLIA 4U9RA 4EYHB 4OX9J 1A7GE 3CVKA 1JLGB 5GAEU 3NGUA 1KRPA 3MMBB 1W25A 4IOAQ 2MYFA 4EEYA 2WVCA 3I4PA 1FJCA 4DR7F 5CA5A 3K5OA 3NS7B 1IKWA 1T03A 5KFKA 4DFPA 1UVJA 4IRDA 1H7XA 3IN5A 2A1BA 1PO6A 2C28A 4QIEA 5I3UB 1VDHA 2HS0A 2ZH1A 3KLFB 1S6PA 2W24A 5G0RA 5L38A 2D9PA 1Y10A 1RT3B 2RJZA 1C4AA 2K1RB 2HQ3A 1SBRA 4PYDA 3Q86A 3X3UA 3HLUA 4DZDA 4F04B 1PAUB 3QYYA 3EGWB 1EAYC 2CVEA 4X4OA 4HHUA 3TI0A 1FXLA 4ES2A 2XY6A 4F4WA 4NEZA 2XY7A 3CDUA 2DPJA 2YNIB 1R0AB 1F6TA 2FHOB 2OFHX 2CQIA 2LQBA 4P71A 2CQPA 5HROA 4EBDA 4USIA 3PR5B 1HHSA 4WXOA 5FLXY 1DTTB 2UV8G 2B51A 1NPKA 1CJVB 3O6QA 1RAIB 1AA1B 3QWPA 1JXLA 1IR1A 4HVZA 4KJIA 3ISNC 2Q6BA 3DLBA 3DMJA 3SMZA 4QIGA 2PN6A 4DV6F 3LUYA 1KC8T 1FWKA 3KK2A 2ZD1B 3KHGA 1FRJA 4ZPVR 2YY3A 4DSIA 4Q43A 1S6UA 2FY8A 1FK9B 1VI7A 2VQFF 1GXUA 2XI2A 3NKYA 5IQQA 4RNFA 1JNRB 3WHIA 5KFWA 1TL1B 4I64A 5M2UA 2XM3A 3R5CA 4PEOA 4DMZA 2BYCA 5DQGA 4YQWA 1HYSB 2RNEA 3E3XA 5JVHQ 3SQGA 2VONA 2RIJA 3UCGA 4C3LA 4FP9A 2R8HA 2DNLA 5DQIA 3C6TA 1GH8A 4K4UA 4LIWA 4O44A 2R7XA 1XMQF 3CCUS 3ZZ0A 3UDEA 5IQ6A 5T7LB 3LOUA 2FJDB 2DNYA 2ZOGA 4O0IA 2PFFB 1FWPA 4ZPTR 2GFFA 4MKAA 4OZ3A 3FQKA 4CRJA 3TEHB 1JXEA 5EHHA 1RWUA 2V4QA 4MH8A 2FLNA 2HNDB 3DLEA 4CH0S 5HP1B 2QA4S 1EETA 2ZVSA 2BW7A 3CO0P 3N9UC 1J27A 3UFCX 2W9BB 3GV8B 5KG1A 2X7IA 2I8EA 2HQCA 1UPMB 1S1UA 2XWYA 2YKOA 2MXYA 3BSAA 2QFIA 4HI1A 2E5LF 2J6UA 3P6YC 1HW8A 2M5YA 3ISZA 3MFHA 5FDLB 3MGJA 1KDNA 2GS8A 2C3YA 2J7UA 3MFIA 4EMDA 1T05A 3IWXA 3LGHA 3EVMA 1AZSA 5IT9Y 3O8WA 4Z37A 2HFZA 1REVB 3CUNA 4HR2A 2WW8A 2N4DA 1LK5A 2J7KA 4A8YA 1RE1B 1T0TV 3OHAA 1WC5A 4KFBA 2HBQB 3SSRA 2HNYB 2IJFA 1D1UA 1U1KA 2LDIA 3BJYA 2CJXB 4IDKA 3C14A 3JQKA 4NYOA 1UJ4A 4C11A 1UVLA 4WZMA 5DZ6A 4LR7A 1QTNB 3FDSA 3PCOB 2X1AA 4ILLA 2VA3A 3KHHA 2DGUA 1C0UA 1RA6A 5D4LA 4U8YA 5MAOA 4OV6A 4ED0A 5KFHA 2BJEA 3T41A 3L3CA 2DR5A 3HJFA 2BQUA 3DRPB 4HI2A 1X8DA 3MR6A 2J76E 1FT8A 3TA2A 1RT4B 1VOMA 1B3TA 2RQMA 4DL4A 4LQ3A 1XR5A 2DGTA 3VHQA 5LXRA 3SYZA 1X0FA 4F67A 5DG9A 1UEVA 4GO7X 1NXIA 1FVQA 3MMCA 3GG1A 1T8EA 4BHQA 3QAUA 1S48A 2KTQA 1U6FA 3K5LA 1NO8A 2CDQA 4LJMA 1JKHB 4IG0B 1KFSA 2VC0A 3J80U 3RAXA 3V81B 3GIJA 2JLEA 1P27B 3QRPA 2A3JA 1WG1A 4RU9A 1KTVA 5BYRA 2EKNA 1F9FA 1N6QB 4C8MA 2DH8A 1B0TA 1RUSA 4OZ2A 4FKYA 2DR7A 1REGX 3DLJA 4ANCA 4RKUC 1X5OA 2HKEA 5THWA 3UD3P 3UN5A 1GX5A 2AZ3A 2R7OA 1B99A 1BUXA 1JLCA 2CPJA 4B3TF 1N5QA 4GKKJ 5KFRA 1CJUB 3KKFA 2XGQA 1X60A 4BC7A 1DZ5A 2C2RA 2YQ3A 1RYSA 3OL6A 3DGPA 3K8WA 4LF1A 1GT8A 2GQCA 2DBBA 3CJ2A 2KI2A 1RI7A 2FJXA 4USMA 3SDEA 1HBUA 4ANEA 1UAWA 4F4KA 3MCSA 3MCOA 1RA7A 4CLZA 3WC0A 5ETRA 5DQHA 3KNGA 2VUGA 1R31A 3PJ9A 2FLOA 3PFOA 3ZTOA 2KDOA 5L9XA 2BE2A 4DV0F 2IA6A 3PJXA 2CXEA 2YKQA 1X0PA 4PG8A 1TKXB 3N6NA 3LAMA 5ADZA 2QSWA 5IT0A 1S12A 5DGAA 4DV0J 1JXVA 3V4IA 1NJWA 1RCOB 4ZVUB 4TKTA 4ED8A 1S1XA 4PR6A 5KFYA 2Y9HA 3D6TB 3OR1A 1N48A 3NL0A 1RSCA 4IYQA 2VZ9A 1CULB 3JYTB 4USHA 4NA1A 4OL8A 4F0HA 3FRZA 3KYLA 2Y8WA 2HSEB 4PYAA 5F8MA 3B78A 1VFJA 2DT9A 2GO8A 2RE1A 3KTQA 1EX8A 2B8QA 2IYGA 2IVYA 3G8TA 4YS2A 1KQFB 5C24A 3KK1B 3MEGB 3DDKA 4ICLB 2Q1LA 5HMZA 2R7WA 4RW7A 3OPKA 1VQOS 5F0UA 4OYMA 4OZ1A 1X4DA 5DM6Q 1UW9A 1F60B 2ROPA 2XNRA 3RUBL 3H5SA 4TY8A 2E9TA 1IBMF 4USTA 1YLXA 5K8PA 2JDJA 3PX6A 3RG6A 4GC6A 2MKHA 3FRYA 3PW2A 4ZHRA 3UQSA 3GJRB 3N5FA 1CBKA 4YHHF 3CEDA 5H9EK 2QMXA 5KG4A 2H5IB 3TARA 2DXFA 2U2FA 2XMMA 2FJWA 1TELA 2GVDB 7FD1A 4YHHJ 1U1RA 4ZJOA 5CXTA 3NY0A 5LT5A 2DIVA 1ZA1B 4RNOA 1WC0A 3HVRA 4QR0A 3T9NA 1BY9A 2DXEA 1AROP 1B7FA 4PQUA 2BV3A 1VRUA 5EX0A 2YH1A 1CEZA 1WG4A 1YJUA 2YPYA 3A12A 3GWCA 3UO0A 5J1EA 4RBVA 2RU9A 2PA8D 1YBTA 1FX4A 1SC1B 3MTKA 5KFPA 4Z2XA 2P9CA 1APSA 2AGOA 1Q0NA 4UOGA 4PWDB 3TVZA 1QAXA 1T02A 4DUYF 2JX2A 4ED4A 1NJIT 4P52A 2M52A 3BGOP 2LDYA 3DLLQ 1MLAA 1D8ZA 3C66A 2R3VA 4IO9Q 2Q43A 4QOTA 4UZBA 3J80Y 1H0HB 5CYMB 2AGQA 2IC3A 4B17A 2XGPA 4C7QA 1LWEA 1VBYA 3W2WA 3PO5A 2EBEA 3HSDA 2VG7A 1NK8A 3HK2A 4AE5A 2LA6A 5C25B 1QVGR 1HMVB 4DCJB 5A0YB 2QEXS 3W3SA 4WP3A 1NMEB 2DHSA 1U6ZA 3IWNC 2NSBA 2HFOA 3UWTA 4GKJJ 1TKZB 1IBLF 3VAJA 5U47A 1WC1A 1QAJA 2V8PA 3KG4A 3UW1A 1F5BA 5DDRC 3NBPA 4NRUA 2ZM6F 1S4EA 2EFGA 2VIHA 5A6PA 2BRKA 2PA3A 5HQLA 1R6VA 2MKCA 4QIFA 1U25A 3CJKB 4UY8T 2QLBB 3GR0A 3L7PA 4WFNQ 2IAJA 3A4TA 3D0HE 1HWIA 5AE1A 1TV6A 1SUQA 2FLLA 2SXLA 3MOZA 4JI6J 2AEFA 1Q79A 3MAHA 3QQCD 1LWCB 4NXMJ 1CC7A 3GLJA 1FRKA 4B9SA 2CQ2A 3MHYA 4ELVA 1BE4A 2IRXA 2XEXA 2AMCB 2AEJA 3CNQP 2Y0BB 2R7SA 4AYBD 2DXDA 2AIRB 3HHEA 3IRXA 2VG5A 3D28A 3MM6A 3MCMA 3QO9A 3QSIA 3THTA 3MD3A 1ICEB 4QPXA 4DPXA 4M5LA 3R1LA 3TQ1A 3WQPA 2FTRA 5HSPA 2OPPB 2OGUA 4WKRA 3QRRA 1FJEB 3VAMA 2BXJA 2CPHA 3M8WA 1UFKA 4R25A 3SFUA 4DX5A 1HNXJ 2MQMA 1HQUA 4EI2A 1FFGB 3JSMA 3PHEA 4P74A 5BR8F 2VPXB 4GVBB 2RB7A 4USWA 1M90T 5IWAJ 3QT6A 2R7QA 4FN5A 1GXTA 5BR8J 3KNAA 1HWKA 5KFDA 1NH7A 4OLOA 1HR0J 4DJBA 2UUCJ 3GONA 4Y2CA 4DR1F 3SSQA 2HZAA 4B9UA 3HHDA 2LEAA 3MCNA 4TNOA 1VHIA 2LXIA 1PC4A 3KMSA 2UXBF 5CZXA 1S10A 4J5OA 5KFZA 1RTJA 3MR2A 2GQ2A 2M8HA 1S72S 1GMUA 3GYNA 3QGGA 5HBMB 3GSIA 3BF4A 4O3PA 2B5JA 2OJ3A 3NLCA 4NA2A 4U7CA 4CDIA 5CYJA 5C2CA 3M2VB 5K14B 5IT4A 4CQ1A 1I51B 3QRQA 2ABYA 3W61A 3TZYA 3IS9A 2NR0A 4CYUA 4OI6A 4CT8A 4OHVA 3L9ZA 3OTBA 2VBWA 3IGVA 4B3MF 4HDHA 3R9LA 2G0IA 5K20B 3DHWC 1E6YA 5AXLA 4LF4F 2F4VJ 5F8GA 3OBIA 3W9JA 4DN0A 1VRTA 4DS4A 3OJSA 2F8MA 3C6UA 5B0CA 4F3MA 4LF4J 2KG0A 2DRDA 1X4GA 3QLHB 3ISND 4PUOA 5E41A 3MUTP 1CS4A 4YB7A 1VR6A 1UZHA 1OQ6A 4K5RA 2APOA 1UJ5A 2UVVA 4C0OC 2QE5A 3BSCA 2HHQA 3HP6A 2B4OA 3DI6B 3TAMB 3EYZA 4HDGA 3A8EA 4LQ9A 2CPIA 3ZNUA 2VPZB 3K57A 3R6GB 2AF6A 2Y1JA 3P49B 4KBIA 4LT6A 4YDXA 2CNLB 3POTB 3R5DA 4HT7A 3LF0A 3D66A 4JV2A 1YJRA 2IJRA 2POKA 2NUHA 4USVA 4ZS6A 3IAM9 4HKQA 4K4WA 1JLGA 2VC1A 1BWEA 4CO0A 3A3OB 3FBCA 1BC6A 4LUBA 3MMBA 3NEKA 4ZCKA 3CJ8A 3D3BJ 3AJ2A 3SBMA 4LFBJ 1RAAB 1P1LA 2CPZA 2XC9A 5HMYA 1Q81T 3EX7B 2EWHA 2HVIA 2L08A 2B4VA 3HD2A 4W92B 1QE1B 5I3UA 1LKZA 3GFXA 2NXNA 1PCAA 3Q89A 3QGIA 3KLFA 2GQQA 2JLFA 4FZVA 1X4HA 2MKKA 4NLVA 3ZO7A 1RT3A 5F8JA 1TUGB 3KLGB 2GW8A 4N47A 1BGXT 2E1MC 2K1RA 5C42B 4X4SA 1PG5B 2GVZB 3P3DA 3CIZA 5J1NA 1U26A 2LXUA 4KQZA 4EO8A 1GXLA 3Q83A 4DBQA 4KO0B 2AYBA 3FZ2A 2R42A 2CPFA 3K17A 4DL3A 1FKAF 3B54A 2J7WA 3MUVP 3OJUA 4CT9A 2RAQA 1EIYB 3OW2R 1SH3A 5HVFA 2CQBA 1RAHB 3ZZTA 2J9CA 2YNIA 1R0AA 1R27B 2ZUAA 4C48A 2W9CB 2J6TA 1WEXA 1NPRA 1RAFB 1DTTA 3H2UB 3D2WA 1N52B 1NHKL 1CJVA 4IG3B 3FMBA 3DU5A 2DH9A 2AJ1A 1FEEA 3M2UB 3C8YA 2HRYA 1LOUA 4U95A 3W64A 3WBZA 4OYWA 1FVSA 4ID5B 2HPUA 2P6SA 5E7OB 5K8OA 3M8SA 1IXKA 8AT1B 4C9DA 2ZD1A 1HNZF 2EI5A 2Z2MA 3PVXA 4KR0B 4A8SA 5F8NA 5GMDA 1FK9A 5F8LA 4RUBA 1SJRA 1J5EJ 2G2ZA 5GMEA 3CXCR 1HNZJ 3BKFA 3D5MA 1TL1A 3MM5B 1HYSA 2JFKA 3M1VB 4DV3J 3G87A 1RQ0A 3DOMB 1U24A 3NOGA 5HVHA 3NXZA 3NS5A 4A46A 4J9SA 4USUA 3C46A 4CM2A 4JI4J 4TYAA 2XS5A 5T7LA 5KFMA 2PEBA 3HVAA 2FVSA 2EXUA 5KFUA 1FXDA 1WKLA 1Q82T 4ZMMA 2GAHC 2V9KA 3LP1B 1FDDA 1M5OC 2VF3A 1NM2A 4DL5A 1FX2A 3BR8A 5J1PA 2QO3A 4TVAB 4LSNB 3UI3A 4Y2AA 2H5EA 4F3OA 4F8RA 1UPPA 2HNDA 2R8JA 1LEOA 5HP1A 1RAJA
chains in the Genus database with same CATH topology
3TANA 3OUYB 1O8BA 4RBTA 2IHR1 1URNA 4C8KA 4NLUA 2YX4A 3DCAA 1JLAB 1U48A 1VQLS 2P6TA 5J2QB 1N5VA 3CJ0A 4MIAA 5T41A 3QGPA 5KT4A 2XMWA 3K58A 4PPDA 4ZVEA 2W9BA 4ILMA 3HXMA 1VLYA 3DOKA 5SUHA 3GYXB 2OIHA 3C2PA 2XI3A 4B9MA 2CJKA 1N8RT 1B64A 5GAGU 5ITHA 4WJBA 2B4PA 4M5DB 1RTJB 4LSLA 2DNRA 5F3TA 4DX8H 2WOMA 1ZTTA 3I87A 4NLGA 1DTQB 2ZC3A 3H40A 1C1BA 2DHGA 3R5AA 4PXCA 3V6HA 2RKIA 1JLQB 5FDLA 4FF2A 3J81Y 2N7YA 1FRLA 1DJ0A 3OXLA 3AH6A 4K59A 4E8UA 3KLVA 2VL1A 3AA8A 1KFDA 2E5HA 1SL0A 4O3SA 4TU7A 2B5JB 3OFEA 3OHBA 5L9NA 4L72B 1RJJA 4KHMA 5L1JA 1QSLA 3CDWA 1HNXF 2HAIA 4ECUA 1YRTA 2D3ZA 3MI7X 5KFBA 1VIXA 1GQEA 2W25A 1WI8A 3OFFA 4WU2A 2E29A 2V5HG 1NK0A 3HVTA 3D1HA 2ZHBA 3FEXB 2L9WA 5EGYA 2FGCA 2PDAA 4OMFG 2CKWA 4MIWA 2KT5A 2O3DA 4CH7A 2LU2A 5HN0A 5C5JA 4Y65A 4KPYA 2R7XA 4X4PA 4Y28C 4RX6A 5J2NA 4I6YA 2IYIA 2Q6CA 2YNGA 1R89A 3A1YG 4ZLPA 2MZSA 2VFVA 5K8MA 4YR2A 1JLFA 3NS6A 3RRGA 4DFKA 1REVA 3ETOA 3IS9B 1FXRA 1VK8A 2JC1A 4FF1A 1HPZB 2FUG9 4K50A 4IFVB 5IWAF 2LQ9A 4TLRA 4QWEA 5E5NA 4NLTA 4QR2A 4QW8A 2XG8A 3PXGa 2WONB 3MF5A 2CZVC 4OI4A 4A8WA 4RNHA 4E0DA 4YR0A 2R7UA 1VS3A 4O3RA 4JYAF 2HNYA 1HBOB 1HR0F 3SV4A 2UUCF 1TK0A 2D3UA 2J9EA 1A6LA 4Q45A 4ZPWR 4UOCA 4PG5A 2A10A 1N0UA 3D1OA 4OHZA 3TUIC 4N8OA 2MQLA 2DJWA 4RU2A 3ONQA 4G1QA 1Q16B 4B08A 3PX4A 4CTAA 1E6YB 4LF9F 2HHXA 3GSDA 1N4LA 4DSLA 1FJGF 3S1TA 3V6JA 1VRTB 4QU7A 4K5SA 4OZ5A 3B8HA 4QQBA 3C6UB 2OPQB 2BACA 1TAUA 3O2IA 3OUYA 5HMWA 5AXKA 3M8RA 4WFZA 4ZCMA 3PM9A 5CCMA 3FJ2A 2MKJA 4DR2F 4PUOB 4CH1A 4WFXA 1M5SA 2M2BA 4FPRA 5E0OA 3CDBA 1NK6A 1UEUA 5G4DA 4Q2MA 1IM4A 1VIOA 4NOHA 3QIDA 3KJVB 2DNHA 1HI8A 2OFGX 4ZP8A 2KXNB 1VQ4S 2QRRA 1JMTA 1UW4A 3K5NA 1KSPA 3TUZC 2HWIA 3VWSA 1ZBTA 1J2VA 3BO4A 4RUHA 3MAQA 4NLYA 1Q8LA 1IKVA 2ERRA 2HFNA 4XPEA 4WK1A 5EDWA 2YNFB 1NJXA 1VC5A 3DRPA 2GGPA 3LPYA 1S9EB 3SI8A 2Z4PA 4URQU 3TAPA 3WC2A 3I5BA 2JEGA 2AJ0A 1L5UA 1RT4A 4PQAA 1LV5A 2K8GA 1GAOA 3TP2A 4OX9F 1IBKF 5IM0B 1DURA 2J0QD 5H1SV 1NU4A 5LL6d 2K7JA 1QJHA 2ZHAA 1FNMA 2KZMA 4NWBA 1RT7B 3RAMA 4QIVA 3H59A 1N88A 5EN1A 4F50A 5LXYA 1X5TA 3KLIA 5JUMA 3R3TA 4X4VA 4U9RA 4I56A 4EYHB 2KFNA 1LW2A 2B3TB 2HGMA 1MSWD 1A7GE 5B0GA 1VQ7S 3CVKA 4NRTA 1JLGB 1T94A 5GAEU 3IR6B 5DLFA 2V8DA 4ED5A 5FJ4A 1KRPA 2MY8A 4H4KC 4O23A 5J2PB 3J7YI 3IC1A 1AXQA 3MMBB 1WEZA 3PO4A 1W25A 1Y3KA 3BQ2A 4PXEA 2DIUA 2F4VF 1W2BR 1RYRA 3G8QA 5D3GB 4IOAQ 3PZPA 2G4BA 2R8GA 2MYFA 1S0MA 4XO0A 2KFZA 4EEYA 3I4PA 1VHFA 3M6VA 1FJCA 1X9WA 1U1QA 2CQ4A 2YWFA 4DR7F 5CA5A 3K5OA 3PKMA 1IKWA 4MMOA 2ZBCA 1T03A 3K7RA 5KFKA 1JKHA 4IG0A 4EUVA 3CB4A 4NMLA 4NLRA 4DFPA 5A8RA 2BABA 1KHWA 3VAHA 3V81A 1UVJA 4IRDA 3E01A 4HH1A 1LW0B 2BZ2A 1H7XA 1YRUA 3IN5A 2A1BA 1PO6A 2QYCA 2MHEA 2C28A 1I6JA 1I94F 4I2QB 3AAWB 4QIEA 2Y1RI 4OX8A 5I3UB 1D0EA 2KHDA 4MFBB 1RGVA 2HS0A 1Z2LA 3DLGB 2H9ZA 2G1DA 2ZH1A 1G3OA 3NP5A 3LAKA 1UWBB 3KLFB 1DLOA 1S6PA 2KJVA 2WB4A 3M05A 4JV1A 4FXDA 2CQGA 2XMJA 4PPZA 1N6QA 2W24A 5L1IA 2PMHA 5G0RA 5L38A 2D9PA 3Q0AA 2R7VA 4DL2A 1RT3B 3DM2B 1ZPWX 2RJZA 3MWBA 4DL0C 1C4AA 3MECB 2K1RB 3PW5A 1S99A 4FNHA 2FVRA 3PEJA 4TN2A 1IR0A 2HQ3A 1SBRA 4ZPAA 2VOOA 3X3UA 1YGYA 4RLEA 3U1LA 2N4CA 1JJ4A 3HLUA 4EBCA 2BOPA 3H5UA 3B82A 4TLQA 3FCHA 4BS2A 4IRCA 5KFNA 3ITHB 4YB6A 2OD6A 4CO1A 1VC6A 3IR5B 4BWJA 3BS9A 2QA4G 3IR7B 4NCAA 3QYYA 2OSQA 3EGWB 4RW4B 1WNEA 4WXWA 2RQKA 5GAHU 2CVEA 4X4OA 2YKNA 3LP0B 3M8PA 2VASA 4WZQA 1M5VC 4B9NA 2YWGA 2DITA 5KT2A 4DL7A 2E7WA 4ZDNA 5I42B 4RUCA 3TI0A 1FXLA 1XTZA 4ES2A 4IUFA 1LFPA 2XY6A 1SJ1A 5DDOC 4F4WA 1L3UA 2R2SA 4DQRA 1H38A 4EFAC 1ZZNA 2DO0A 2K3IA 2XY7A 4LFBF 3GB0A 4L3NA 3CDUA 3TUJC 3M2RA 3I9V9 1P8GA 2YNIB 2DPJA 2KZZA 1R0AB 1KTQA 2GHPA 4HYKA 2FHOB 4EYIB 2OFHX 2CQIA 3M32B 1HI0P 2ZH4A 2LQBA 2NZ4A 1FTCA 1FD2A 2AJFE 2HIQA 2KXHA 4L6V3 2CQPA 4JV0A 5KTQA 3TW0A 4EBDA 4USIA 4ZCLA 1RTIB 3PR5B 5HROA 4JUZA 3UE2A 3X1LB 1S1VA 5IFMA 1HHSA 4WXOA 1J5OB 5FLXY 3QZ8A 1DTTB 5SZTA 1NKCA 2IRYA 2UUWA 2UV8G 2IVFB 3AB2B 2W9AA 3FEYB 3CD7A 1HI1A 2B51A 1YWXA 2EFVA 2E9ZA 3BSNA 3TO8A 5KG6A 3ZFVA 3PW0A 4MK9A 1S1TB 3CIMA 3CCJS 1D8YA 2FVPA 3O6QA 1HBNB 2V4JB 3MM9B 1O5JA 4Y00A 2EFPA 1HWUA 3CCQS 1QUVA 3OTDA 4JBCA 1L3VA 3QWPA 2MDAA 2U1AA 3KK3B 4OHYA 1TKXA 2GIQA 2JVOA 4JOUA 1JXLA 2ZHOA 3IG1B 4HVZA 4KJIA 3ISNC 4E98A 4R5PA 2DRBA 4Q8FA 2CPEA 2Q6BA 3DLBA 3DMJA 3SMZA 3H25A 1OSCA 2YNHB 2B6AB 2CVIA 4QIGA 2PN6A 3MEEB 4DV6F 2B43A 1FNOA 3LUYA 4P7TA 3ICLA 3M4XA 1KC8T 2IM0A 3KK2A 4QIWD 2D7SA 1QTMA 2HZCA 1TL3A 4H4MB 4WE1B 1X4AA 2BANA 3G6XA 2EK6A 1HQEA 2ZD1B 1WHYA 1TFYA 4P6QA 3VCDA 3BR9A 3KHGA 1FRJA 2AYGA 4ZPVR 2YY3A 2RF2A 4DSIA 4Q43A 2IM3A 1S6UA 4JI2F 5A8WB 2EPIA 2M88A 3NNAA 3ENQA 1FK9B 1VI7A 2UU9F 1OSDA 4OV1A 4WF9Q 2MZJA 3FSYA 2VQFF 2G0CA 1XWLA 1IKXB 3DRSA 1SJQA 1GXUA 2EBGA 4NYZA 4XDCA 3JYTA 2WCXA 2DGOA 2XI2A 4ILRA 3PV8A 3NKYA 4RZRA 5B0DA 1V6HA 1EP4B 5IQQA 4RNFA 2CZ4A 1JNRB