3CTRA

Crystal structure of the rrm-domain of the poly(a)-specific ribonuclease parn bound to m7gtp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
GPLGSDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the RRM domain of poly(A)-specific ribonuclease reveals a novel m(7)G-cap-binding mode.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Poly(A)-specific ribonuclease PARN
total genus 14
structure length 75
sequence length 75
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2008-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ctrA00
1D9AA 2HGNA 1VQ8S 3CC4S 2OTJS 2CQ3A 4WKRA 2M8DB 3CCQS 1VQNS 1WI8A 1U1PA 2RRBA 2MSSA 2DO4A 2HGLA 2XB2D 2L41A 1H2UX 2LA6A 3DLLQ 1VQ9S 2E5GA 2I2YA 2A3JA 2KHCA 3B4MA 5JVHQ 2YH0A 3CMES 1SJ3P 2K8GA 2YWKA 1UP1A 2CQGA 1VQOS 1SXLA 2OJ3A 2MQNA 3PIPQ 2M4MA 2XS7A 1RK8A 1WI6A 1SJQA 2MY7A 3RW7A 3CULA 2VOOA 1JJ4A 3P3DA 2KG0A 5DDQC 2DGUA 2HYIB 2M88A 3CCRS 1YTYA 3CCMS 1X5TA 5DM7Q 3R1LA 4WFBQ 3BO2A 3CXCR 1Q82T 2BZ2A 1X4BA 1L3KA 1DBDA 2DNLA 2JX2A 4PRFA 4Y0FA 2MZRA 3RW6A 3B4DA 3P5TL 1M5KC 3CTRA 3L3CA 3FEYB 4CIOA 3S01A 1OO0B 1QVGR 3MOJB 3UD4P 3NNHA 3Q2TC 3HI9A 2RVJA 2CPXA 2PE8A 2D3OR 2QA4S 2G1DA 4TLQA 1NO8A 2MSTA 2EK6A 2CQ2A 3J7YU 1M1KT 2CQ4A 4TU9A 1DRZA 3G8TA 1U6FA 5GMKa 3SDEA 1U1RA 1P1TA 1X4CA 3IRWP 2ADBA 3G4SS 1QM9A 3P6YC 2LKZA 1WHXA 1M5OC 2ZJPQ 2MKJA 3S8SA 2AYGA 1SJRA 4ED5A 3K0JA 4CH1A 3G71S 1A7GE 1VQ5S 1D8ZA 3UCGA 3N9UC 3BEGB 3THPA 3CUNA 2JVOA 2JWNA 1FJ7A 2CPDA 1U2FA 5D77A 1U1KA 2X1GA 3MD3A 5DM6Q 2MZSA 4LMZA 2DNQA 5GAGU 4F25A 2M70A 1YITS 1X4GA 2NLWA 2G4BA 1VC5A 1X5OA 2KI2A 2M9KA 2U1AA 1JMTA 2J8AA 1VQMS 1WTBA 3I55S 5BJRA 1K8AT 2CQCA 4A8XA 2LECA 2GHPA 4C0OC 2RT3A 2D9PA 3IWNC 2FHOB 2RUGA 3G6ES 2FC8A 2MPUA 5GADU 2MGZA 2RS8A 2MQQA 5ITHA 2OSRA 2DNKA 3SXLA 4UQTA 1A9NB 3UE2A 2DITA 2MKHA 2MZJA 1U1OA 2MY8A 4FXVA 3MURP 3MUTP 2GO9A 2DGQA 2VONA 3US5A 3TYTA 2KT5A 1KOOA 2DNRA 2E5JA 3UCZP 5GVQA 1VBYA 3FEXB 3MD1A 3VF0B 2CPZA 5HL7Q 2U2FA 2QFJA 1YI2S 3S6EA 3G8SA 2OSQA 2F3JA 2CPEA 2ZJRQ 2KYXA 4W92B 2K3KA 3BS9A 3OW2R 2CPFA 1WF1A 3P49B 2MZ1A 2L9WA 2CPYA 1VBZA 1S79A 2E5HA 1WEZA 3UD3P 2M2BA 3G96A 2DNPA 5CXTA 2MYFA 2DGWA 1VQ4S 2E5IA 1X5SA 4WCEQ 3NMRA 1VQLS 2DNZA 5IM0B 4WFNQ 3JB9k 2HVZA 1DZ5A 1SJFA 2CPIA 1URNA 4C4WA 2JRSA 4J5OA 4LJMA 4U67Q 1FJCA 2DHGA 1YHQS 1ZZFA 2D9OA 2MGZB 2CQHA 2X1AA 1U6BA 3CPWR 2CQ1A 4Z2XA 1DHMA 1X4HA 5DDPC 2XS2A 2DIUA 1WG5A 1VC6A 1WWHA 2JVRA 1NJIT 2QEXS 4ERDA 3VALA 4Y00A 1M5VC 2SXLA 2KVIA 2DIVA 2F9DA 2KXHA 1VQPS 1H2VZ 1PGZA 1JJHA 1M90T 3NNAA 1VBXA 2DNMA 1O0PA 4TU7A 1F9FA 2LMIA 1FXLA 2YH1A 4LIRA 4QU7A 2EVZA 1CVJA 2DNOA 2AD9A 3DXBA 2KXNB 3VAFA 1N8RT 5GAEU 2MB0B 1XN9A 3VAMA 1FJEB 3EGNA 1N88A 3ZZZA 2DGXA 3CF5Q 5CA5A 2MZQA 2KM8C 3CMAS 1IQTA 4F02A 1KQSR 2LYVA 2DNNA 3U1MA 2WBRA 2KXFA 4IO9Q 2ADCA 2J0QD 2M0GB 1WF2A 2MQMA 1U1MA 4BS2A 1N54B 1UW4A 1VQ7S 2MQOA 1B7FA 1WG1A 4QPTA 3MXHP 2O3DA 2CPJA 3BO4A 2DISA 4CH0S 1U1LA 2DH8A 2MKCA 1Q86T 4RU2A 2FC9A 2LXUA 3I56S 1VQKS 4F26A 2DGSA 2M7SA 1HD0A 1X4AA 1WG4A 3S7RA 3UCUP 2J0SD 2M8HA 2OIHA 2PEHA 4QQBA 4YUDA 5LJ3Y 5LXRA 4PR6A 1WHVA 4WIIA 2MMYA 4IOAQ 1OWXA 2RS2A 2KG1A 2B0GA 2DNGA 2G0CA 5FJ4A 1WF0A 2I38A 3R1HA 1X0FA 2DH7A 3VAKA 2MJNA 2DHXA 3NS6A 3G9CA 1FO1A 1KC8T 2CJKA 3ZZYA 3UWTA 3MUMP 5LSLA 2N82B 1WEXA 4QU6A 1YJ9S 1K73T 4V19X 2CQBA 2CQIA 2LCWA 3D2WA 3PIOQ 2LEAA 2CQ0A 1Q81T 2HZCA 1W2BR 2LA4A 3VAJA 4IUFA 1HA1A 1KD1T 2DO0A 4FXWA 3NNCA 2DNYA 5LJ5Y 2RU3A 2X1BA 3NS5A 2VODA 1QVFR 1G2EA 2KH9A 2KRRA 3CD6S 1OIAA 2YTCA 5IM0A 4OZ1A 1X5PA 2DGOA 4UY8T 5DDOC 2J76E 1H2TZ 2CQPA 3Q2SC 1FNXH 2YKAA 3V4MA 2DHSA 5MLCV 4YOEA 2RQ4A 1X4EA 5LXYA 2RRAA 1SJ4P 4WF9Q 1VQ6S 2F9JA 2MHNA 3SMZA 3CCLS 2N3LA 2M52A 2MKKA 1R8HA 1P27B 2BOPA 2DGVA 3VAGA 2HGMA 2XNRA 2LQ5A 3H2UB 2KFYA 2CQDA 1M5PC 1H6KX 1WHWA 1R8PA 3ULHA 5DDRC 1ZH5A 2FY1A 3R27A 2V94A 2MKSA 3MUVP 4IOCQ 1HD1A 3BO3A 2Q79A 4EGLA 5D78A 5LSOA 5CYJA 1YWXA 2MJUA 1YJNS 2X1FA 1WEYA 2XS5A 1UFWA 3EX7B 5IQQA 2MKIA 4CQ1A 2AYBA 1RKJA 4M5DB 2RQCA 3LQVA 3THTA 1ZZNA 3TO8A 1FHTA 2DH9A 1AUDA 4W90B 2NZ4A 2L08A 1FT8A 5GAHU 3SDEB 3LPYA 5H1SV 2MXYA 1YJWS 2OTLS 3U1LA 5IFMA 2DB1A 3TP2A 2FPHX 2KU7A 2RNEA 3MI7X 3CCVS 1Q7YT 3CC7S 3CCSS 3EGZA 2AYMA 3VAIA 1K9MT 1U1NA 2DGTA 2EK1A 4YB1P 3VAHA 3HHNB 2KRBA 2UP1A 2VOPA 4P6QA 3J7ZT 1BY9A 1X4FA 2LXIA 2DK2A 5EN1A 5HO4A 3CC2S 5JVGQ 1NU4A 1PO6A 1OPIA 2MZTA 1U1QA 2MQPA 1N52B 3H2VE 1UAWA 2CPHA 2MQLA 1WHYA 1HL6A 2ZJQQ 4TU8A 2XSFA 4OZ0A 4PKDB 2LEBA 4ZKAA 2AYEA 1X4DA 3MDFA 3CCUS 2DHAA 2N3OA 2KM8B 1KOHA 3CCES 3CCJS 2E44A 4C7QA 1VC0A 4WFAQ 1WELA 2KN4A 2DNHA 1JJ2R 2ERRA 1YIJS 5DETA 2N7CA 1S72S 2XNQA
chains in the Genus database with same CATH superfamily
2B7BB 2OTJS 2XZTB 2CQ3A 3CJ8A 3GZ7A 3RBXA 4OYAA 1VLOA 5ETSA 1CJUA 4NLDA 1BLUA 3A8KA 4NRTA 3CCQS 4PUOB 2BRLA 4CLLA 3QT6A 1FXDA 2MSSA 4RWWA 4N47A 2DO4A 2IIHA 1RAJA 4IDKB 4O3OA 3QRPA 1R6YA 2RHQB 4N77A 4PPDA 3RUBL 1H7XA 5CCLA 2E5GA 2I2YA 2A3JA 2CG4A 2RQMA 2KHCA 3B4MA 2P9CA 3J7Z5 4J9KA 4KR0B 1HNXF 4DR6F 4DV3J 1B0VA 2NXCA 3AH6A 1UP1A 5IC6B 4DF8A 4B3SF 1RWWB 1SXLA 4J9RA 2OJ3A 2MQNA 4N76A 3M6XA 1X9WA 2IJNA 4A8WA 4EU0A 5EWFA 1GK8A 4DV2F 2ZC3A 1C0TA 2KZMA 2J6SA 2ZWOA 4YMEA 4O4GA 3ILLA 2HMIA 2C2EA 4ZN1A 4PQUA 4ZP9A 1F0XA 2MY7A 3AB4B 4L3NA 4JI5F 1U8WA 4PQAA 3P8BB 4DR7J 2QN6B 3ETMA 1GMVA 4Q44A 3CE8A 2DCLA 4Y28C 2F4VF 1S1UA 3MECB 3CD0A 1LK7A 2KG0A 2QGFB 1FE0A 1REVA 5DDQC 2DGUA 3M2UA 3MPYA 4I2PA 2B9YA 3MAHA 5KTQA 1ZPVA 2VPYB 3BJYA 3CCMS 4LT6A 3R1LA 1Q1KA 3DOKB 1RAHB 3M8SA 2GAGC 4EUVA 4J91A 3KK1B 3JSMB 1SCJB 3GIIA 1SL1A 2XY7A 5EUHA 4JV0A 2MZRA 3PO4A 1CBKA 4X2BA 2HRUA 3R8YA 1M5KC 4M1KA 3CTRA 4M5DA 4WZQA 2DCUB 1NUEA 3S01A 3SZ2A 2UUCF 2HNDB 4JI6F 4PAAA 2VF3A 1RBLA 4HHJA 3TAPA 4DWIA 4DR2F 1OS5A 4QR2A 4TKTA 2V2VA 2P5VA 3CEDA 1LWEB 2RVJA 5FDLB 5T14A 2XLJA 3KLEA 2EC2A 1U02A 2HS0A 2V2ZA 4J90A 1YQHA 4LF2A 3H4BA 5GAEI 4YR0A 1R3NA 2ZH4A 4LRAA 5DLGA 2PE8A 4ZPVR 4R8UB 2G1DA 3MM7B 2QA4S 5HP1B 2I6WA 4JYAJ 3UVJA 1B99A 1MLAA 4ES2A 2MSTA 2XMVA 3CO0P 3SQOP 3BSAA 1I6JA 3ADAC 3DGPA 3J7YU 4OJHA 1OY6A 3HO1A 4NLRA 4P71A 5EHHA 2W7PA 3KHGA 3BM7A 4TU9A 3G8TA 4DR5J 3PDNA 1HARA 3FFIA 1S1VB 1IBLJ 5EWEA 1P1TA 5DZ7A 5KFOA 2C2NA 3NMAA 4ELTA 1HMVB 1T11A 2J5AA 1W25A 4M5GA 3PW0A 4UOGA 3CB4A 5E3PA 1RABB 4NLWA 3TR5A 3M9NB 2KT2A 5KT7A 2CJAA 1FTCA 1LQ9A 1NK6A 1QAXA 3NWGA 1FX4A 2V2KA 3AQOA 3RBDA 1SJRA 1XMOF 3DDIA 1HR0F 3DLKB 4ECTA 1BQMA 2FHKA 5LMUF 2R7OA 4FYWB 1SC1B 3ZTOA 4M63A 2VIHA 2QMUB 3D6TB 3TVZA 1PC5A 3CWJA 2F40A 4PWWA 1A7GE 1RCOB 2DT9A 2QT7A 2V69A 1VQ5S 2HPUA 1D8ZA 1RU2A 1YK9A 2RUSA 1JLCA 2VKRA 3EGVA 3LP0A 4PEOA 5K14A 4C48A 4V1Ak 3BEGB 3BKTA 3HFKA 3Q8YA 2XM3A 1VRUA 3SCKE 4DSIA 2HHSA 1WC5A 2QZ8A 1ZAXA 1HBNB 2CPDA 1U2FA 4C8NA 4LQ3A 3IWXA 3WIUA 5IT9U 3EDRB 2ZBIA 2OFHX 2PA3A 2QV6A 5DM6Q 4DF4A 3RB0A 2E9ZA 2DNQA 1IKVA 5K8OA 5LMNJ 5KFAA 1MU2B 4UOCA 1JLEA 3LAMA 4LF4J 4LVOP 3M8ZA 2BXJA 5J1EA 2CA9A 2FIUA 3LPEA 3AB2B 4NCGA 1T9TA 3OXGA 4NMLA 3Q8PB 2M9KA 2OPRB 3M8QA 2JLEA 3TNVA 4ZK7M 5I3UA 1SIWB 4RW6B 3V2UC 1K8AT 3EYZA 1TKTB 3QRQA 3U7JA 3MOZA 2LECA 3Q22A 4RBTA 4PQUB 2HFUA 3MAAB 2D9PA 3J7YI 3PRBA 2UUCJ 4B3TF 5J1PA 3DMJA 4C0HA 1S6PB 1Q4RA 3AODA 4MIAA 1DTQB 2Y9HA 2HSEB 2Y1RI 4ER8A 3ZZTA 5HBMA 4Y2AA 1RT2B 1MG7A 1SC6A 3C14A 3HHDA 4JI4J 2RS8A 3MPDA 2Q43A 3ILIA 3GR0A 1Q16B 3U1LA 3FQKA 1B0PA 1CSJA 4S0MA 1TVRA 2MKHA 2GMJA 2MZJA 4IG3B 1U1OA 4IDKA 4JI1J 4K0KF 3N5BA 2GO9A 2OH2A 4HH0A 2DGQA 4LFCJ 1N5QA 3IGNA 3M9OB 3TYTA 1HHSA 1HNVA 4CO1A 4ZOSA 1DURA 1NHKL 1VK3A 1KOOA 4USUA 5ETPA 2ZH7A 1VRTB 3TUZC 1N0VC 4K59A 4KAIA 4DPWA 3V6HA 1S7IA 4QIFA 1HNWJ 2H48B 4XDCA 3I9ZA 1XC9A 3IGVA 4EWTA 3VF0B 5HL7Q 1T9XA 2JLFA 1TL1B 5K20B 4DJBA 1FD8A 1KKHA 1VDHA 1L3UA 2QYCA 1TUGB 2OSQA 4FYXB 4DV2J 3HK2A 2LFVA 4Y2MA 3G82B 5DG9A 4Y2CA 3EUNA 5B0CA 3I0SB 4TYAA 3PR5B 1NKCA 2FLPA 2K3KA 4F0MA 1T9VA 4WFZA 4QWEA 5B0DA 3P49B 2Z30B 1HNXJ 4DR6J 3T6JA 5KG0A 2CPYA 3PX6A 1VBZA 4CLSA 2VB6A 4ZMMA 3PEHA 3UD3P 2JSXA 2CJ9A 2N4DA 3K17A 4LSNB 4FDFA 2WSFC 1OQ3A 4ZVUB 3CJSA 3NCRA 2ALZA 5CXTA 4KH1B 5J1EB 1N5SA 1UZDA 1PIEA 1VQ4S 2E5IA 4J9NA 2YWFA 4CLZA 4WCEQ 3QGHA 3A1YG 1FFSB 2BW2A 2VJVA 4ZCLA 2EFPA 2G2OA 5IZHA 4WK1A 2DNZA 3PJWA 2VG6A 4CNYA 4WFNQ 3KK1A 1CJTB 4DMZA 4URGA 1Q8LA 1QD1A 3DRYA 3HKZD 3HVTB 1SJFA 3MEGA 1URNA 3MFHA 1S76D 2RJZA 4J5OA 3NGTA 1VQYA 1FJCA 3CCWA 1S6OA 4RWXA 3W2VB 5CAAA 3QGGA 4RW4A 2DY1A 1U6BA 1CULB 4E2FB 4GO7X 3MCSA 3S1TA 1S9EA 4Z2XA 2C2MB 4BWMA 1X4HA 4GC6A 3ZFVA 3QJPA 4C6AA 4K0KJ 3BN4A 1VC6A 2UUBJ 2B8PA 2HS4A 4I1TA 4YHHJ 3BPDA 3IR6B 3OQ2A 2DXEA 2SXLA 3AXMA 1R7IA 1HKAA 4F4XA 2KXHA 2E66A 2ZH3A 1T3OA 1GNKA 4U7UK 3J80U 2D74B 3W60A 4UUXA 1BD6A 2AU0A 3DC2A 3OVBA 3TANA 3C6TA 3GMGA 2AF6A 4JBCA 4OHXA 3D6HB 2DNMA 2WBMA 3MPUB 3T1AA 3O3LA 3NEKA 4CNZA 4WFYA 4X64F 3CMQA 1DQ8A 2LMIA 2HURA 1G4CA 4QU7A 1CC7A 1S6UA 1BQMB 3H8YA 3ENWA 5KG1A 4FS1A 5IV4A 1C1CB 3BR8A 1L5UA 3UDCA 1XN9A 5HI7A 4C8MA 2KKHA 3TEHB 4DN9A 1N4LA 2E1CA 2DGXA 5CA5A 3W3SA 3UR3C 2UU9F 2DHHA 4F02A 2EKNA 2WB4A 2XI3A 1QAJA 5L9NA 4BC7A 2NQPA 1RHJB 5THWA 2VG7A 2FDNA 3DOMB 1I5OB 3PR4A 3V6JA 4DFPA 4YDDB 1FJGJ 5EWGA 2P8IA 1S1UB 1WF2A 2MQMA 3KK2B 4RL1A 2IVYA 3O8WA 2B4UA 4I4BA 3H98A 4QPTA 1WUUA 1NDLA 2ROEA 4K4YA 5HROB 2O3DA 3FGVA 4LR7A 4N7TA 1FRMA 1IWAA 3BO4A 4RW9B 2H1YA 1XJWB 1HBUB 1U1LA 2DYAA 5E33A 2DH8A 3F41A 1AZSB 2XYGB 1X31C 4RU2A 3VQSA 2FC9A 4IYQA 4OYWA 2DY9A 2MHEA 2LDIA 2XCAA 1V9OA 1YJRA 4DQRA 3QGIA 3UCUP 4Q8FA 1X4AA 3QT7A 3HF5A 5KG2A 1TL4A 4A8QA 2WRMA 3UD5A 4RO0A 3R9LA 4L72B 4QQBA 2AMCB 4YUDA 5LJ3Y 2CZ9A 4PR6A 2LQJA 3HSDA 1NNDA 4WIIA 4RKUC 5E2QA 4F0KA 2QG9B 3R5BA 5L1IA 1UVNA 3CT9A 4QZVB 2HQCA 4Q2MA 1S10A 3U27A 3IMQJ 2IVFB 2DRBA 3BDEA 3D3BJ 3JS9A 5L1JA 1OWXA 3JSMA 2LVWA 2Y1IA 2RS2A 4DSKA 1UVJA 3HSZA 4ZDNA 2J8SA 1LW2A 4RNHA 2BMBA 4DUTA 3CJTA 5JMNA 3TI0A 2UVRA 1WF0A 3R1HA 1TTHB 1X0FA 2HBRB 1KWMA 1PJ7A 2ZUGA 3VZHA 2DHXA 4DCJB 4A8MP 3G9CA 1KC8T 4RUCA 2CJKA 2H5JB 2IM1A 1C1CA 3L7PA 3W64A 2R7VA 1N32F 1HQUB 4IG0B 1HNIB 1N34F 1WEXA 2Z8QA 3M30B 3MM9A 2QL9B 3KFWX 3V81A 4QU6A 3WQPA 2H9ZA 3FRZA 1UEUA 4ED4A 1WJ9A 2OPPB 5F8IA 4DR3F 1RB0A 2CQIA 5FLXU 2ZWPA 2Y1JA 1S1XB 2JOQA 3BH6B 1NKEA 1RTJB 3THVA 1KRPA 4NXMJ 3OTEA 2LEAA 3R5JB 3BZQA 1FK9B 3OTBA 2LLZA 4MKBA 3DYAB 3PJ9A 4CLTA 4CP5A 2CDRB 2WOMA 3QNWB 4LF8F 1I1GA 5KFKA 4IUFA 1TFWA 1RT1B 2CZVC 4OJ3A 3ZTSA 3FKBA 3CJKA 4DS5A 1RTDB 5BR8J 4MKYA 4FXWA 3NNCA 2K3IA 1LWFB 4JV5J 1T0TV 3M05A 2FHJA 5LL6d 3PZPA 3NS5A 5T41A 3LP1A 3PFEA 3CD7A 4QIVA 4TXSA 1UPPA 3NXZA 1G2EA 1NK8A 1YSJA 1YJ7A 4MIBA 3CD6S 1JLCB 1NHVA 4GKKF 1R8BA 4NLQA 2J7KA 5B0EA 4OZ1A 3E3XA 5MAOA 1OY9A 2JLGA 3IA0A 4UY8T 4L74A 3HVTA 1YJUA 2HIYA 3OTDA 4URSA 2AV5A 4J9PA 3MMJA 1FNXH 2JEFA 1QE1B 2EBEA 4EK2A 1YZ7A 4FKXA 3KJVA 4FYYB 3TWZA 3NOCA 1VGYA 2DHSA 3MEDA 3AAWB 2VBZA 5IC4B 3DN9A 4NLOA 2RQ4A 4DG1A 3GG0A 2AW0A 4Q5VA 3J80Y 1SJ4P 1NXIA 4HKQA 2FZKB 3GJRB 3RBEA 4XPEA 1X9MA 3TA1A 2RKIA 1LEOA 1Q53A 3H20A 4I69A 5KFJA 2QLFB 3CCLS 1GQEA 1RWOB 1SPBP 2M52A 3GFZA 3IG1B 3LOUA 3D66A 3QFHA 4XAKA 1R8HA 3R3TA 1P27B 5EGYA 4QPXA 3VGTA 2AGPA 4LF9F 3VAGA 3A8EA 3MM6B 3SCLE 5J2NA 2IJFA 2HRTA 1XMBA 2R2RA 1Z2LA 4DUYF 3TA2A 1WDDA 3ICLA 1UETA 3QT8A 1WHWA 4ECUA 2DVIA 4JI7F 5D4OA 4FS2A 4N56A 3W5YA 1R0AA 1ZH5A 4GKKJ 1FWLA 1RT2A 3C14B 2C2ZB 2MKSA 2UXBF 3MUVP 1IKWB 2W4DA 1HI0P 5A8RB 3RB4A 1GMWD 4ANCA 2VUGA 5KT5A 4IRCA 1KLMB 3KLIA 2VPWB 4A46A 1U8SA 2QX0A 2KT3A 4KO0B 2H4WB 1LWEA 1NRKA 5D15A 2VQFJ 4ILMA 2E7XA 1WEYA 3TAMB 2XS5A 3ZO7A 2WCXA 2HFVA 5HQ8A 1VLYA 5A0YB 2KDOA 3G87A 3J7AN 3ET6B 2W9BB 2AYBA 2W8LA 2ZNZA 4M5DB 2RQCA 4NLYA 1CQNA 2FJVA 1OSDA 3DHXA 3M9MB 4DV5J 3DGPB 4B3RJ 2QJ3A 1FHTA 1BUXA 4R5PA 3JYTA 1FEHA 2L08A 1U1MA 2RAQA 2VU5A 1FT8A 4C8YA 1QSSA 4ECXA 1KEKA 4YN3B 3SDEB 3LPYA 4DPOA 3CGIA 5H1SV 2OKQA 3H5SA 5IXUA 2ALYB 3T5KA 1YJWS 2OTLS 1CPZA 2VQEJ 2V68A 2V9KA 5RUBA 2RSQA 4ANDA 4RW8B 5HMWA 3CDUA 3TP2A 3GILA 1RAOA 2KU7A 2GIQA 1U49A 2JEIA 4J9QA 2KL8A 3WZ0A 3RB3A 1Q7YT 5KFYA 1F3FA 3CC7S 3VAIA 3LALA 3K5OA 1SL2A 3VAHA 1D09B 2LQ8A 1VRQC 2VG5A 3KG0A 3NGRA 3Q8QB 1N5YA 2AP6A 1Y3KA 2B4PA 2QMXA 1DTTB 3D0IE 3JSRA 4OYMA 3KJFB 4MT1A 4XK8C 3GJTB 2YNGB 3VGUA 4PXEA 1BY9A 3J7ZT 2EFOA 1OYDA 3KG1A 1UJ4A 2CG8A 4G1QB 3K7RA 1LV5A 3J7A1 3PKYA 2ZDOA 2CWKA 3CC2S 1OMSA 3FEZA 4CI0B 5D4LA 1W26A 3HKWA 2V67A 3A13A 1U1QA 4OZJA 5H9EK 3X1LB 1WKJA 1JLBA 1QY7A 4ITSA 3T1HJ 2LQBA 4DLGA 2RMLA 1KLMA 1YRXA 1U47A 4MKAA 3ZTRA 4DV4F 4ECZA 2FJEB 2PI4A 1HL6A 1SH0A 2HAIA 4LF5F 4HI1A 2XSFA 3MWBA 4JOUA 3RR8A 1KLNA 4G6VB 2IRXA 3V4IB 3M8WA 2FZGB 3BBFA 4M5KA 5D3GB 2YQ3A 2AYEA 3MDFA 1EQMA 4ZVPB 1WACA 1AA1B 3TJ8A 4RW7B 1S0MA 2UU9J 5E3CA 2AJ4A 4RW4B 2CXEA 5C24A 3WHIA 5DS7A 4CT9A 3D1QA 2PN6A 1S7HA 2PSZA 2VFVA 2YBVA 1BMQB 4M5NA 4NRUA 5BYRA 4IR9A 4KHRA 3OHBA 1YIJS 3IXQA 3ENVA 5DETA 2N7CA 2XNQA 5HQLA 5DQIA 2HGNA 2BKNA 4UQGA 3GQCA 5DGAA 3GFHA 4C11B 2E1RA 1RHQB 4CLPA 2HG4A 2QRRA 4NYOA 3PVXA 3KUEA 3AOCA 3MM7A 3CJKB 3MHYA 3OR2A 5KFUA 2HGLA 4AQYJ 5HP1A 1L3SA 2AJQA 1F5CA 1MW7A 3KDOA 4MK7A 3H0PA 1FERA 5HJXA 4G1PA 4FF2A 2YH0A 2VBXA 4RPFA 4DL4A 1JNRB 3Q24A 3R6GB 1OPZA 3PV8A 2CQGA 3P45B 4L73A 1TELA 4A4JA 1CQMA 1CJKB 4YHHF 4DFJA 1VQOS 2G1HA 2WVDA 3PYDA 2YWGA 4IR1A 1Q5VA 2GJIA 2QMWA 3NBPA 1HW9A 2FJAB 2HWTA 3JSBA 3GV5B 1J5OB 3GONA 1UWBB 1FKPB 2IHR1 1SV5A 3G82A 3KDNA 2KHDA 1RI7A 3BB5A 5I3QA 4EYHB 2XY6A 2HVDA 1WI6A 4Q0BB 1RU1A 3MEDB 3M8PA 4ILLA 2IC3A 4DG1B 1S1WA 5HVGA 2VOOA 1R0CB 3P3DA 2DXDA 4QYRA 1B4SA 4WTOB 1XMQJ 4ZPBA 2WHOA 3HJVA 4UOHA 2ZH5A 4U7UD 4DL3A 2WONB 4B9UA 3KJQB 1I51B 3OR1A 3CCRS 1TUVA 1RADB 4IO1A 4WFBQ 3QSIA 1Q82T 1RT5A 2FHMA 3BGUA 2BV3A 5KFLA 5C42A 1X4BA 1DBDA 2YWEA 2HWIA 2HNYA 4RW7A 4PRFA 3T5LA 4YB7A 2FGCA 2GV1A 2FY8A 2EW9A 3QQCD 4KYZA 2GGPA 2DTJA 3B4DA 3KMQA 4ELUA 3I4PA 2UV8A 2QE5A 3MOJB 1OO0B 4DCPB 3B78A 4ID5B 3EM1A 5BYQA 4H4KA 3TRGA 5K8MA 2CPXA 2OPPA 2E7WA 3PRDA 1D8YA 1YG0A 4PYAA 2OPRA 4AE5A 5GAHI 1HWLA 1REGX 1RT6A 5F9NA 3AT1B 1P9YA 1NO8A 2GS8A 1RHRB 1URRA 2D3ZA 2LEPA 2EK6A 5A8KB 2GQQA 3I96A 1KHVA 4KIAA 4NYPA 3SBMA 2W25A 2CQ4A 4NZ7A 4YDXA 1RACB 3JTPA 1N5VA 3VWSA 1DRZA 3OL9A 1XNQJ 2GMHA 4J9MA 1UZHA 2BACA 1FWKA 2Q1LA 1U1RA 1JLQA 1ZM3A 4OV1A 1H3DA 1X4CA 3EE3A 3R7NB 1HWIA 2ZKUA 3IRWP 3I4HX 3G4SS 1QM9A 3LUYA 4DUZJ 1S1XA 2HZVA 4UF4A 1TK5A 2YNIB 4OX6A 4CH7A 2LKZA 4NCBA 5E3QA 2HMIB 2XZWA 3U1NA 3C16A 5I3PA 1WNEA 3L4BC 3SI8A 1TVRB 4IG3A 4LF8J 2ZJPQ 4ETZA 1U6ZA 2MKJA 3FJ2A 3LGNA 3S8SA 1UJ6A 1X8DA 4NZ6A 1RTDA 4H4OA 2R7UA 2XMMA 2J9DE 3HVRA 3LWLA 3MZIA 1TL7B 4IRDA 2ZOGA 2V6AA 4UZCA 3KLVA 4NLXA 2Z2YB 4ENOA 5AXNA 2RDDA 5CYQB 4A8FA 4FBUA 4Z7CA 3C15A 5C42B 5HN0A 2UUAF 4KKOA 3I9V9 1EP4B 3HX9A 5CYMB 4JP8A 1FJ7A 1UVLA 1GAOA 2R4FA 2OO4A 2CNNB 1IKXA 2A10A 2X1GA 4QR1A 4R25A 4P2XA 4DV4J 1ZYQA 1NK7A 3QRRA 3SFUA 2J0WA 5KFTA 3KHRA 4OI2A 1BXNA 4OLPA 2R7XA 3OT9A 3VV2B 1YITS 1ZS6A 4CTAA 2EFGA 1O8BA 3HFZB 2YNFB 4NI2B 1UEVA 2X3DA 3CVKA 3HSJA 4DV0J 2NLWA 2VFUA 2HHXA 2HNZA 2G4BA 4WIQA 5CD4H 2NZCA 1X5OA 2R8GA 1ITPA 4MH8A 3ISZA 4K2XA 4PG6A 3I55S 4TLRA 3KLHB 3C8YA 4A8XA 1PBUA 2GHPA 4UZBA 1MWYA 4ZPAA 3IWNC 1GMWA 5C24B 4K4ZA 1T94A 2OELA 4RR5A 3UR0A 2LDYA 2DPJA 2HW3A 2HHTA 2OFGX 5HK4A 2GNKA 5DJBA 2DJWA 2FC8A 2HBQB 1HWKA 1S49A 3SSQA 1IN0A 3NCQA 3VR1A 3QLHA 4LFBF 1PJ5A 3DXSX 3OPKA 2XGPA 1KVJA 1RAAB 3DFEA 3TZWA 4F67A 2OSRA 4J7CA 2XCPA 3NGSA 4I68A 2KZZA 2XSJB 3IO1A 2DNKA 5L8RC 3SXLA 4HT7A 1XR6A 1HPZB 1U4BA 3UE2A 1A9NB 1TQLA 4F4WA 3T3FA 1FNOA 1S9GB 3MUTP 2KYZA 3BGLA 4OHWA 1Q8BA 2C3YA 4O23A 3DU6A 3US5A 4DSEA 4K5SA 4O44B 1QTNB 4TYBA 2V9WA 1QDUB 2DNRA 2YWHA 2E5JA 1RXOB 3VVUA 4DV5F 1FRJA 2CRLA 4JI2F 5AE3A 3QAUA 1SL0A 2HLUA 2AEFA 4DQSA 1FCAA 3DGVA 3T5HA 2R8JA 4HDGA 4O3RA 2RQKA 2F8EX 1YDLA 3D1HA 4G65A 3G8SA 1C0TB 1R31A 5ETQA 3JTOA 3FCHA 1J5EF 2OD4A 1DTTA 5M2RA 3KHHA 2ZJRQ 2VPXB 4W92B 3DOKA 4X64J 2ZC4A 1JXVA 2CPFA 3EMTA 4WE1B 1IKXB 1NSPA 1UFKA 2BJ9A 2CAJA 2Y0BB 1Y4ZB 2L9WA 3ISNC 2LU2A 4LRCA 1Y3JA 1GTEA 1WEZA 1GXUA 3B82A 3UN5A 3G96A 1VHIA 1S99A 3QGPA 1DFDA 4F4YA 1JLAB 3LH2S 1NPRA 4GC7A 4HVZA 4F2RA 1UVMA 1X5SA 4WK3A 1SIZA 1WDTA 1YGYA 2BJ7A 2B7CB 3FUYA 1RWXB 2VG5B 3NMRA 1B70B 2A6MA 1T9WA 3KKFA 2AZ1A 5IM0B 3AOAA 2ZFHA 4I0WA 1R89A 2HVZA 2W1BA 3PTWA 3AD8C 1HHTP 2UV8G 2C2RA 2GZOA 4JI5J 2JRSA 2LP4A 1M5HA 5ETTA 2CJXB 3V5RA 2DHGA 3MAQA 2C28A 3NY0A 2MGZB 1UA1A 2HQ3A 2X1AA 2K1RA 3ZC4A 1NDPA 3OFEA 4B3MF 1DHMA 3I32A 5DDPC 2QFIA 4OZLA 2HEKA 2HQDA 1WWHA 4RUHA 1YX2A 2QEXS 4Y00A 3OTOF 3RU0A 1Y9OA 1OQ6A 2AJ1A 4KY3A 4NPOA 3ZTQA 5A8RA 2ZE2A 5CD4A 1VQPS 1V6HA 5G0RB 3IRXA 1JJHA 1EJ7L 4PG8A 4HH1A 5A8KA 2UXCF 2HHVA 2VV5A 3WX8A 1KQGB 1VBXA 3QWUA 5B0BA 3OR2B 3OFFA 5IWAF 2AGOA 1BWEA 2G0JA 3BSCA 4U96A 1LW2B 1F9FA 2UUAJ 2ABYA 5IT4A 4DR4J 4NXNJ 2BYCA 1YRUA 4ZS6A 4RNMA 4F36A 2DNOA 3DXBA 2KXNB 2JFDA 1OJ4A 1S6QA 1LKZA 3PJXA 1M1HA 4JV1A 2B9WA 2H4YB 2XMAA 1F5AA 1TU0B 3I0SA 3VAMA 1FJEB 1LOUA 4QYZK 1GFWB 4P73A 3DU5A 3MPVA 2NYHA 2PIIA 1RT3A 2R7TA 3WC0A 2D3O1 4DEZA 3DLEA 4USVA 1D0EA 4L3KA 3O44A 1RT4B 4LIWA 1CS4A 1MNEA 4OX8A 4BWJA 3GTYX 2LYVA 4H4OB 3X3UA 2AQ4A 1KQSR 3U1MA 3PX0A 3M8PB 2M5YA 1K44A 4MIWA 2XMJA 4CO2A 5DLFA 3QJJA 4DPXA 5KFFA 1NSAA 4H54A 3T1YJ 2IA6A 2M0GB 2OLWA 3M32B 4I6YA 3ZZOA 1R43A 3PHTA 2Z2LA 4CTAB 3WX4A 3BSOA 1UW4A 3EZ5A 2C2OB 1TKZA 5K14B 3W9JA 2EFQA 3OR1B 3OL8A 1VRUB 3UDLA 3MXHP 1VISA 5F3TA 3R7SB 5KT6A 4J9SA 5F0WA 4Y2KA 3TVKA 3MMAB 5I3UB 3RAQA 2DISA 1HI1A 4FP9A 1F5BA 4YR2A 3UQSA 1N5YB 4C9DA 2MKCA 1Q86T 1KTQA 2IVMA 2WAQD 3TZYA 3I56S 2V5HG 4JI8J 2OMOA 2D7SA 2ZDPA 3NP5A 3BPSP 3PXGa 5A6PA 2GGPB 1RTHB 5L39A 5KFEA 3SV3A 1R6VA 4DBQA 2HLTA 3IFEA 4QW9A 2PEHA 1T9UA 2R42A 5ADZA 1TK0A 4M5IA 5DZ6A 4EFAC 2YNHB 1VOMA 2IMOA 4RW6A 2JC0A 3GCXP 2L9NA 3LP2B 2ATLA 4M95A 4HHHA 2Y8YA 1TUWA 2NPIA 4B9SA 4P7VA 3DDNA 4IFYA 2VKZG 4NA2A 2WTFA 1PCAA 2BJ8A 4IOAQ 2FJDB 2B6AA 3R5CA 4IFVA 4R0JA 1WKKA 5M2UA 2CYYA 2XZDB 2B0GA 3MM8B 2I38A 4X4RA 2HAFA 2FUG9 1J27A 1M5SA 2I1RA 3QZ8A 3NS6A 4ID8A 3VAKA 1IR2A 2NR0A 1VRTA 4CT8A 5KT3A 1QUPA 2VL1A 3HVWA 3KUHA 4X4TA 2N82B 3DDKA 4DR1F 1DAXA 1FESA 1K73T 2ZH8A 3W66A 2AT1B 4DR7F 3H5XA 2GJFA 3OSNA 4X66F 2LCWA 1FF2A 2ZKTA 4X62F 2HKEA 4QIGA 3PW4A 1OYEA 2D1CA 2JZ5A 4ZCMA 1K0TA 1KFDA 1RJJA 4DV1F 3P96A 2HZCA 3IM9A 3QAEA 5GAGI 2EKYA 1Q81T 2HHWA 3FBBA 3VAJA 3W63A 1HA1A 3TVYA 4DL6A 2DO0A 3MGJA 2RH3A 1FDDA 3BF4A 1M1GA 4UT4A 1P8GA 3MTJA 5LJ5Y 1FKOA 2GVZA 1C0UA 3HHLB 5CHCB 1K0VA 2X1BA 1HBOB 3FSIA 2K7JA 3V6DB 5I42A 2VQEF 1H73A 2YKNA 3IBFB 4NLTA 2VDHA 3NAIA 4P2SA 3UDVA 4ED7A 4FF1A 2IYGA 3JAMY 4HI2A 1X5PA 1U26A 3BV8A 3D3CJ 3GFYA 2VZ9A 5CYMA 5DDOC 3W9IA 3G6VA 1H2TZ 4X4QA 3R2CJ 3OUYA 2FYXA 4V19X 4B3RF 2UUBF 1ZM2A 2FD2A 4U8YA 4WU2A 3BREA 5MLCV 3P4UB 4OYPA 4Y2IA 1X4EA 2CNOB 2MKYA 4OLOA 3D67A 1HWJA 2GHWA 2F9JA 3HFVA 2G2YA 4DV1J 4JI6J 5CYQA 2YXLA 4USTA 1VJWA 1CJTA 3M1VB 5J2QB 1EKSA 5F8MA 2MKKA 3CIZA 2AEJA 4X66J 3UNYA 1KVKA 4CO3A 2UVWA 2QA2A 1FDBA 2QO3A 2YX7A 1VIXA 2AGQA 3GPAA 2JHEA 2XNRA 2W9CB 3H40A 1YLXA 1XEZA 4LUBA 2CQDA 2ZZTA 1SVDA 5D0RA 1SQFA 1C2PA 3LGMA 3ULHA 5DDRC 2FJBB 4X4SA 3PEJA 3RRGA 4LFBJ 3R27A 1FKAF 4WP3A 3KLFA 3AJ2A 1TKXA 4OFZA 2V8HA 4IOCQ 3I82A 2HNZB 4ATNA 4NCGB 2Q79A 1LK5A 3A8IA 4NA3A 1F3VA 4ICLB 4WFXA 4G3IA 4X84A 4QBUA 2AZ3A 1AT1B 2HIQA 1HI8A 3BGFA 5D78A 2ZITA 4IH7A 2CVEA 5LOQA 4ECVA 2DR6A 2X1FA 1C1BB 3I5AA 1WC0A 3MEEB 2ZHOA 1FD2A 2G13A 2CKWA 2MKIA 1S0VA 4CQ1A 4Q43A 3V6KA 1HNWF 3LQVA 1TV6A 2J7WA 3THTA 2A0FB 1S9FA 4KSEB 2WW8A 5LMNF 4NE9C 4P75A 3CJQA 3FCVA 4DX7A 3N79A 1KTVA 2NZ4A 1S1TB 4HR2A 4ECRA 2PMHA 5G4DA 3W2WA 2B9EA 1ZA2B 3N01A 3F73A 2PI5A 1RT4A 5D4PA 2V8PA 4MK9A 5BXIA 2BUNA 5SZTA 2E9RX 1FFGB 3W61A 2COLA 4BC9A 3AA9A 3HCXA 2BQ3A 2MLXA 2FPHX 3RYLA 4ETXA 3ELHA 3G6XA 1G1XA 2P6TA 3CCVS 1NBEB 2JL9A 1PG5B 2QL7B 1SJ1A 4FVMA 1TKZB 4HT5A 3L7UA 3A4TA 2ZNYA 4LQ9A 3CCSS 1WC3A 2AYMA 1HLWA 1JLQB 3FRYA 1K9MT 1U1NA 2DGTA 1A6LA 3IG1A 2QSFA 4GVLA 4DCOB 2VOPA 1HR0J 2UP1A 4RBUA 1KVIA 3GIMA 2VG6B 4OHZA 4KV8B 1CJVB 4WU3A 3TJ9A 4KTQA 1RZMA 2A18A 4FF3A 2R2UA 1DQAA 4M5LA 1TZ0A 3M2VA 4IQXA 1FKPA 3T19A 2CJQA 4P2FA 5HO4A 5EN1A 1N32J 9RUBA 3MF5A 1NU4A 3MM8A 3ZNJ1 1PO6A 4LSNA 3PW2A 2CWXA 2MZTA 1FEEA 5IWAJ 1JQGA 3H2VE 1RUSA 1ZAWA 2GQ2A 5ETOA 4O3PA 2J9DA 3HT3A 5B0GA 3MM5B 1NK5A 1WD6A 4IG0A 1TK8A 4A48A 5FLXY 3GSDA 1KQFB 4WXOA 3OXLA 3V81B 1SKWA 1TP7A 1T9YA 4KFBA 4TU8A 1NB2A 4C98A 1QTMA 2QL5B 3OHAA 1RHUB 4NLGA 2OEMA 3OTOJ 2PA8D 3MEEA 3UPFA 3RGIA 5K8NA 2XO6A 1V3ZA 1O5JA 1X4DA 2EFNA 2OAUA 2DHAA 1JNZB 2HNYB 2Q6CA 4LREA 2KM8B 3HULA 3KLGA 2LXFA 1Y7PA 3DRPB 3MAAA 2BE2A 2E44A 2V63A 2OI2A 2V8DA 4C7QA 4WFAQ 1NK0A 1WELA 2VFTA 1XNRF 1MSWD 2KN4A 2XG8A 3Q89A 1JJ2R 4USMA 4AD6A 4PYDA 5C7PA 1RBAA 2BQRA 2AEMA 2OHDA 4ED3A 1RTJA 4YQWA 3PKMA 4WKRA 5KFXA 1SC4B 2M8DB 5KG3A 2CNKB 1IBMJ 1TKTA 2WSEC 4DV6J 2IA0A 2W2NP 1E6VA 3A12A 3G86A 2L3MA 3KK3A 2YPYA 3ILOA 4K50A 1IWGA 3POTA 3AQPA 2FB0A 4DSLA 3WC2A 3OLBA 4NOHA 2DR5A 1APSA 4YFUA 1S9GA 1DTQA 4K4UA 4TQSA 2L41A 1H2UX 1NSKL 3DLLQ 3ZZPA 4EZ6A 1RWKB 5IT0A 4KBIA 1HNVB 1HBOA 2ZBCA 2ZH1A 4A8KA 2C22A 2OPSB 1PSDA 4ANEA 2GIFA 3P5BP 1MN9A 3CMES 2K8GA 3D6MB 4ZCKA 5A2QU 4CLUA 4URQU 4WZMA 1IJEB 2I5JA 3FFIB 3RR7A 5KFZA 3K2YA 3EICA 3BQ1A 1AFJA 2YX4A 2Z2ZA 3ISND 1NSQA 1NPKA 1JLGB 3DRRB 4M5JA 3QSYB 2M4MA 2XS7A 2VBYA 3AJ1A 2YX1A 4QOTA 1SJQA 4Y65A 3SCJE 3OL7A 2W9CA 1NK9A 2UVVA 2AJ2A 1D9FA 2BM1A 1FE4A 4RUBA 2FVQA 5IQ6A 3CULA 1R27B 1NB7A 2PGCA 2C3UA 3TZZA 4JI0J 3H5YA 2UXDJ 1N6QB 1N34J 4LF6F 3R7BB 1U7LA 3M1VA 3ZZ0A 1TL1A 4DQQA 3DLGB 4BLGA 1TKXB 3QT5A 2O67A 2V34A 3MMCA 4ZVFA 2M88A 1HQEB 1RWUA 1JLAA 1VYAA 3AHPA 1YTYA 1IBKF 2VJUA 1X5TA 5HROA 5DM7Q 4AQYF 1BQXA 2FGOA 1QUVA 1YBUA 1Q78A 2RB7A 5A8WB 3BO2A 4LFAF 2BZ2A 2DNLA 1L3KA 3E01A 1EETA 5KFBA 3Q8SB 2B6AB 1FX2A 2JX2A 3H2LA 4NZ0A 2Q3PA 4OMFG 4EO8A 3T9ZA 4DPUA 1UPMB 4QIWD 4QWAA 3MEGB 1TR0A 4FBTA 2YQ1A 1IR1A 2RE1A 5C25A 1Q0NA 2VH7A 3QO9B 1W2IA 3P5TL 1BHNA 4DPYA 2A1BA 3GIKA 3R97A 1F9EB 3RAXA 2BEFA 3FEYB 1JXEA 3PNIA 3BN7A 1C4AA 4WYWA 4OZ5A 4CIOA 4J9VA 4PG4A 3JAMU 3M8RA 1LWXA 3D6FB 4X62J 3UD4P 2YNFA 3EVWA 1F6TA 3FZ2A 3JYTB 3ENAA 3GV7B 4ED0A 3EGWB 5DQGA 1E6VB 1FFWB 2J0XA 3IAS9 3MCNA 3POTB 1JXLA 1IBCB 4B02A 2D3OR 1H0HB 1XR5A 2ZHBA 4TLQA 4IFVB 2D41A 4MKVA 4USJC 4Y6IA 2G2ZA 2PFDA 4FNIA 4CLWA 4E0DA 1ZETA 2L48A 4I6AA 4KGVB 4B3SJ 1NLKL 1SC3B 4DX8H 1RLDA 3OJUA 1WC4A 1N36J 1S48A 4NLUA 5IV3A 1RA7A 3PG9A 3U02A 1S1TA 2YKPA 4ALZA 3PY8A 3SDEA 1KN6A 4PCQA 5HMXA 5GADI 4O0IA 4F4KA 3NAHA 3N6LA 5L9XA 1DLOA 1LW0A 2ROPA 3P6YC 3C6UA 1RWVB 1J5EJ 2WVBA 1NMEB 1WHXA 4LSZB 4K4TA 1HIYA 5F8NA 1RT3B 4USHA 1DJ0A 2GIRA 4GMKA 2V50A 3VCDA 2V2QA 4ED5A 2W7OA 3NOGA 3JXOA 4JI8F 1UCNA 3IWLA 5L38A 1TL5A 3KMSA 4CWBA 3K0JA 3DLGA 4CH1A 3MMCB 5KOWA 1NAQA 4PXCA 2JC1A 3V6DA 4FPRA 3SYZA 2BJ1A 4PXDA 3CNQP 3SIPB 4C3KA 2ZOMA 4W98A 4DOZA 1W7WA 3HMJG 3KOAA 3N9UC 1T8EA 4EZ9A 1V3RA 1JWWA 2OPQB 3THPA 3CUNA 5AJ3F 2JVOA 1O6XA 3MM6A 5HATA 4ZJOA 3LO3A 3W62A 3K8WA 4RW9A 5KFCA 1HBMA 3MD3A 1TMJA 3PCOB 3PYFA 8AT1B 2F63A 4EYIB 1NCLA 5GAGU 2HWHA 4YEAA 4F25A 1RWPB 3T1HF 3F56A 4WBFA 4QWDA 2YY3A 2RDJA 4DLEA 3NGKA 4OYIA 5FD1A 2F8HA 4OHVA 4DXLA 4ZJQA 5H9EJ 1PJ6A 3NGUA 2GMLA 1AXQA 3O2IA 3ONQA 4J9LA 1T3NA 1EZZB 4C3LA 1NM2A 1VQMS 3H5UA 3K8VA 2ZZMA 5BJRA 4JI3J 4KRWA 4NMXA 2HQGA 1N0UA 1X9SA 4XPCA 2RT3A 3KK3B 3BKFA 2BANA 1DQ9A 1I3OB 2RUGA 3HPOA 3G6ES 5A0YA 4QWBA 4LF4F 3CO9A 2EXUA 2PD1A 2MPUA 3DRSA 3A3PB 1YZ6A 2B56A 2MGZA 3EVMA 4JB8B 2NXEA 1T05A 2MQQA 4C8LA 2RRNA 4KHPJ 3C6UB 5B0AA 3KXDA 4I2QB 4U9RA 2P6SA 3TW0A 3CCZA 2V8GA 4XTTA 3UI3A 1EHWA 4OYXA 4DL0C 4ZN3A 2NREA 2MY8A 3MURP 8RUCA 4C8ZA 2ZM6F 4TNOA 3IRXB 4ZPTR 4DSFA 1RBOB 4BCAA 4KPYA 4I56A 4PG7A 1WC1A 2KT5A 1ZTTA 1Z1ZA 1FK9A 2UXDF 4JI0F 4USWA 3SCIE 2WOMB 3UCZP 3TQ1A 1VBYA 1XTZA 2K7KA 1BQNA 2OP5A 3MD1A 1HNIA 3MR7A 4A47A 3MR5A 3FCWA 2CPZA 4NLPA 2QFJA 4W4MA 3C15B 3S6EA 2IM3A 2W4CA 5D0HA 2UUWA 1LNQA 4O4RA 3M2RB 4H4MB 4MFBA 2GC8A 3FBEA 5CZVA 4O3NA 2KFZA 1HW8A 4DX5A 2BJEA 2KYXA 1VBKA 2DPIA 1RSCA 3KNAA 4Q0BA 3DCAA 3OW2R 4ECQA 5F8JA 4RJVA 4UY85 1S1WB 1PBAA 5IOLA 2VPZB 2ZD1B 2OUGA 2MZ1A 2FJXA 1RT1A 4OV6A 2AKWB 4DR5F 4DU8A 2RDIA 4Z7YA 3L7OA 2HQIA 3JQMA 1IVZA 2KJWA 3QO9A 4U7CA 1VMBA 4QIEA 4C8OA 1GX5A 4I2PB 2GO8A 3M8QB 2IM2A 2XMKA 4ID5A 2FQQB 4DUYJ 3MEKA 1WSRA 4EMDA 4DV6F 5L46A 3MR6A 4O3QA 1FRXA 2GA7A 5C2GA 3JQKA 2E1AA 2IAJB 4N5SA 2V4RA 1FWPA 4TY8A 1S97A 3JB9k 4QCLA 1LWCA 4AYBD 1IM4A 3M2VB 3FK4A 4G1QA 1ICEB 3KJNB 1S77D 5KFPA 1QLNA 1H98A 1BE4A 2FZCB 1CG2A 4P7TA 4XDDA 5FIIA 5D4NA 4U67Q 2W2MP 5A2QY 1YHQS 1ZZFA 2D9OA 1KR4A 3K89A 3N5FA 2J9EA 3EZOA 5KFMA 2CQ1A 4B17A 1JLBB 4MAKA 3FC9A 3N28A 2XS2A 4ZP7A 1WG5A 1HHQA 2GVDA 1NJIT 3KUGA 1ZTWA 1M5VC 3GP9A 3DOLB 2UVUA 2KFNA 1U09A 3G6YA 2X51A 2MDAA 1GX6A 2ZBPA 2FLNA 5HQMA 2XWXA 1CJUB 2IPOB 4C97A 1M90T 1B0TA 5HAOA 4AL5A 4NYZA 3SQGB 1O0PA 1PYSB 4HTIA 3O6QA 4X4OA 2DR7A 4MYUA 2P9GA 3J81U 2IRUA 1Y5NB 1AB8A 2QA1A 1KP6A 1TL3A 3AXKA 2YH1A 1FXLA 4YB5A 1CVJA 4F4ZA 4JI2J 4JI3F 5BYSA 3VAFA 5GAEU 5E7OB 1WC6A 5F8GA 3BSNA 6FDRA 1TFYA 3M30A 3C3LA 2HFOA 1N33J 3QBCA 4I64A 1Y5LB 2MLZA 5KFSA 3VZIA 3CF5Q 4CM2A 3Q8UA 2A2DA 2KM8C 3CMAS 4B9TA 2IRYA 4DR3J 3CJ5A 1RYSA 3E2EA 2WBRA 3R5GA 4FYVB 1KBRA 1WTFA 2WSCC 3MCMA 3UNGC 3QIDA 4F4AA 2B5JA 2ADCA 1IKYB 1Q7LB 3ETOA 2OEJA 2J0QD 2OPSA 4U8VA 5AJ3J 2K2PA 4NEYA 3HLUA 4K7QA 1JLEB 1N54B 3WDOA 4ED8A 2IDLA 4TQRA 1VQ7S 2MQOA 2YKMB 2E5LF 1CJKA 1WG1A 2CVIA 4OJ1A 3UN2A 1BC6A 1S0OA 4CLKA 2VICA 2CPJA 1H7WA 3CW2C 4OQJA 4CH0S 1ULRA 2HBYB 1PYOB 2NXUA 1MN7A 1DARA 1PYTA 2NCKL 3BBCA 4USKA 4ZP8A 3W2VA 4DFKA 2DGSA 1SBRA 3QIPA 4M5MA 1WG4A 5AE1A 2J0SD 4LRDA 2M8HA 1RWMB 5E0OA 2OIHA 4LVNP 3GE9A 4LBIA 4DR2J 5KFDA 1V5IB 5KFQA 2B43A 5DGBA 2ZEJA 3QLHB 2JFKA 4OZNA 5LXRA 1B64A 4Y3CA 3LWMA 3M2UB 4ZVQB 1OSCA 1WHVA 2H54B 5IS2A 7FD1A 4DUZF 1SUQA 2WB1D 1RTIB 3PW7A 2EG1A 2Z4PA 4K4WA 1Z4UA 4C2MA 3OJSA 4LF5J 1L3VA 2KG1A 1UA0A 2FTRA 1FXRA 5J2NB 4P10A 2GFFA 4DS4A 3NWRA 2OMLA 2DH7A 1C4CA 3RAMA 6FD1A 2XO7A 1IR0A 4Y34A 3GB0A 5D3GA 1FO1A 3HJFA 2GQCA 4GKJF 2VFSA 2BRKA 2V4JA 3DRPA 4YS2A 5LSLA 3MUMP 2XBPA 2DEIA 3IR7B 3EDQB 4ILRA 2ZH2A 4NWBA 1YJ9S 3VTIA 5B08A 3EXYA 2QC3A 1NDKA 2DEJA 3QWPA 1HMVA 2ASLA 3IR5B 2IM0A 1CS4B 4C0BA 3TA0A 4MMOA 4O44A 2ASDA 1Z2ZA 3D0HE 3TAMA 4WKYA 2LA4A 2L9DA 2XMUA 1BQNB 3VQTA 1KD1T 4F50A 4WTYA 1ZM4A 1YBAA 1EAYC 1FDNA 2GHVC 2ZVIA 1KQKA 2DNYA 1LFWA 5KFIA 4EEYA 1S57A 2RU3A 1XWLA 2ROGA 4OJGA 3FSXA 4DZ6A 1QSYA 1K1SA 2VODA 3NG8A 2KH9A 4RZRA 2ZOFA 1ZAVA 2XULA 3LANA 4R0EA 1TKDA 5IM0A 1HFEL 1FRIA 2D3UA 1XMQF 3NGDA 5ETLA 1LWCB 1LXNA 4B08A 1F2GA 1G7CB 2G0IA 1UW9A 5KFNA 2CQPA 3FMWA 3Q2SC 2YKAA 3ZZRA 2IMWP 3GWCA 2JH3A 4FZVA 5HLFA 4WJBA 1I94J 1A0OB 1PC4A 4J37A 3TOQA 3W1YC 4ZHRB 4YOEA 4M94A 4WF9Q 1GMUA 2H65B 1VCTA 1RTIA 3SMZA 2R7SA 2WK4A 4J9OA 5F3ZA 1IUJA 1X60A 2OPQA 3KLHA 3ZXWA 4DR1J 2AIRB 2BOPA 5C2CA 2F1FA 1UVKA 2C2KB 3CD5A 3DLBA 1RT5B 3H2UB 4EBDA 4ECSA 4Q7AA 1RYRA 5J2MB 4F3QA 3T41A 3B6BA 2UXBJ 4LFAJ 1R8PA 4KJIA 2V4JB 2VD3A 2NS1B 2GVDB 2HHHJ 4FNHA 4ZITA 3DRSB 3MM9B 2V94A 3IM8A 4X65J 2WONA 3UDEA 5LSRA 2R2TA 1N56A 3KLFB 4WP9A 4EGLA 3CCUS 2B8QA 1Q5YA 3ENQA 1H72C 3AFGA 1MMLA 3MMBB 4RLEA 4IQMA 9ATCB 2F7VA 1YWXA 2MJUA 1U0SA 3NKYA 2BW7A 3D68A 1Q95G 2ZVSA 5KAKA 3EX7B 1EKRA 3BGRB 5IQQA 3DLEB 4R8UA 1XQIA 2KO1A 1S6PA 5B09A 3I31A 1ACMB 3DKDA 5DG7A 4RX6A 5DRKA 1RKJA 3NS7B 4O0NA 1U24A 1RQ0A 2NXJA 1ZZNA 2RD5C 5D6GA 4F2SA 1T05B 3TO8A 2R7QA 4FXDA 4W90B 2JDJA 2O5DA 5DQHA 3A3OB 4IKAA 4OYBA 4JUZA 1XBWA 5KFRA 4D3HA 5C5JA 4OX9F 2ILZA 1AW0A 2J7UA 2Y3YA 2MXYA 4JI1F 5KFGA 1NZAA 5HSPA 3FMBA 1NJYA 1VHFA 4WP8A 3IBCB 3HT0A 3H59A 2VG7B 3DOMA 3CCTA 4WE1A 5D0GA 4WXWA 2DB1A 3W8PA 3KHLA 2BDPA 1U2CA 1IKYA 3T1YF 3L95X 2KVQE 3PHEA 4NLSA 3MFIA 4ZVOB 3QIPB 3DLHA 1CEZA 2Q6BA 4CRJA 1BWVA 2B3TB 2H5EA 2VHGA 1ELOA 3D5MA 3R5DA 4DN0A 3EGZA 2MQ8A 4I7FA 4OI3A 1N48A 3T9NA 1SQEA 2IBOA 4DL5A 1QJHA 1Q8KA 4YB1P 1LFPA 3IS9B 3LA0A 3KG4A 4MFBB 4P6QA 3BH7B 1FRLA 4D3GA 4NXMF 1EARA 3N6MA 4IFYB 1N5TA 2EG2A 4YY3F 4KT0C 3M6UA 1X4FA 2LXIA 2DK2A 2MTLA 1FRHA 5HANA 4L76A 4RNFA 2DRDA 3FDSA 4P2MA 3FSYA 2QLXA 1E6YB 1T03B 4YB6A 4NXNF 2WVFA 4ZPDA 2C3MA 1V5VA 4MTPA 1TL7A 3D7SB 5JXSA 2MQPA 1NJXA 1H74A 4C3MA 4FKYA 5KG4A 2Z2MA 2EI5A 2CPHA 3PYEA 1S59A 1SKUB 1WHYA 2R9LA 4MK8A 2DR8A 2E5LJ 2UUTA 4DU7A 5EX3A 3TUJC 2ZJQQ 3TQEA 1T02A 2NSCA 3O1LA 5F41A 3BR9A 5SUHA 3T6BA 5KFWA 1SKSA 1C1BA 1T7PA 4OZ0A 4PKDB 4CYUA 1FVSA 3DHWC 4ZKAA 2VA2A 2HRYA 3GIRA 2ACMA 3F0NA 5E41A 3Q8RB 4DV7F 2BA9A 2BM0A 4P52A 1KOHA 3AY0A 4KE5A 1AYEA 2AJFE 4CLYA 3CCES 2HK3A 2W2OP 3VHQA 1KHWA 4I67A 5LMUJ 2RHSB 2DNHA 3GFXA 3HHLD 1N33F 2CIMA 2GVZB 2V8VA 2OEKA 3R6LB 4ZIWA 5HBMB 5F9LA 2ERRA 1NJZA 1WORA 1D9AA 4DL7A 4ZJLA 1XMOJ 1VQ8S 2JEJA 3CC4S 2IFXA 4GVBA 3TUPA 4X4VA 1R8CA 4AXIA 3TUIC 4KGKA 2FLLA 2R7WA 1MMNA 2YWWA 4MJKA 1NEEA 1VQNS 3EXCX 4RW8A 1WI8A 1U1PA 2RRBA 3BYRA 4LF7F 2N7YA 2VASA 3M4XA 5H9FK 4JI7J 2XB2D 4EI2A 2UXCJ 2LA6A 3LTOA 1VQ9S 1RA6A 3ILJA 3I0RB 1TL3B 4WYLA 2ACYA 3FNNA 4ECWA 4OX9J 1HWUA 5JVHQ 2PMWA 2RILA 4NX9A 2BOAA 4H4KC 3K57A 4LF9J 4CO4A 4DHVA 1SJ3P 2ZBRA 3OFGA 4Q8EA 2YWKA 2VFRA 2XHWA 4AUKA 1UFLA 4I2QA 2R8KA 2AJ0A 5B0FA 1VR6A 4CO5A 2BKPA 5AXLA 2C3OA 3PIPQ 2FLOA 3A8JA 3OV7A 4B3OA 5CCMA 3OUYB 2ASJA 3Q8VA 2VC0A 3JTNA 1RK8A 4OYOA 1FRKA 1YRTA 2RF2B 4F8RA 5HLFB 1HYSB 4PWDA 4ZHRA 3BQ2A 5J2MA 3RW7A 4UOFA 2BBEA 5ETRA 3TEGA 1ZM9A 2W7AA 4DSJA 1JJ4A 3QPIA 4OIXA 3VVTA 3M32A 2PT0A 2W4PA 2FVCA 3F44A 4LFCF 3N0VA 4KH0B 2CZ4A 3PX4A 4GKJJ 2GX8A 1H38A 2PFFB 2HHPA 4ZPCA 5J2PB 2FJWA 3K59A 4AFFA 4Q45A 3DI6B 1NKBA 3CXCR 4NCAA 3D1OA 4OI6A 3SSSA 1HBUA 3MMBA 1R8AA 3RB6A 4QWCA 5L1LA 2XLIA 2IAJA 1KS2A 5J1NA 3GJSB 4Y0FA 4OHYA 4ED1A 1WOPA 3J81j 3Q83A 3SSRA 4IRKA 1HBMB 1SH3A 4N8OA 3RW6A 5EX0A 3OVSA 4A8OA 5ETKA 4ZVHA 3C2PA 3L3CA 3HSGA 4B9NA 2QA4G 4B3TJ 3KLIB 4LBHA 4NI2A 3CDAA 3Q2TC 5HVFA 2B9XA 3HI9A 2BR0A 2CDQA 5D8HB 4K4XA 1SUQB 4DV7J 3H42A 1VJQA 2KB2A 4TY8B 2IBKA 4LBPA 3W5XA 4NL5A 2CFXA 4HACB 5KFHA 2XWYA 1RAEB 3Q86A 4KGZB 1ZOTA 2ZE2B 2W9BA 3GV8B 2GAHC 3DYAA 4X4UA 1MROA 3GYNA 3OL6A 1Q8IA 3G2XA 3I0RA 2Q66A 2CQ2A 4DV3F 4C8KA 3M6VA 2K1RB 1M1KT 4IOBA 1P6TA 5CABA 1VIOA 2ZZNA 1LWFA 3IN5A 5H9FJ 3MTKA 1U6FA 5GMKa 1JLFA 2BKOA 1U0HB 2VBWA 1U48A 1KFSA 2ADBA 5D0EA 3IAM9 4CCHA 4LF7J 4PABA 4FVCA 4LRFA 4PXBA 3C46A 3M8YA 1Y00A 3PACA 3ZNUA 2N4CA 4DQIA 3OXFA 1CJVA 4A8YA 1M5OC 2BQUA 1G6BA 5U47A 3T5JA 1NK4A 3DM2B 2AYGA 3VGVA 3DLJA 4WWSA 1PAEX 1RT7A 2DBBA 2X3GA 1NDCA 3L09A 1FNMA 1UKUA 1JB0C 2IYIA 1U25A 5A76A 1REVB 5DO2A 1VS3A 2VDIA 4FYDA 2XC9A 3AJDA 4ED6A 3G71S 5AXKA 2HHUA 4DL2A 3GIJA 3LP1B 3DI6A 3AA8A 2YNGA 3UCGA 1UVIA 2F65A 3EJMA 1B3TA 1PILA 2YKMA 2V4QA 3SV4A 1K1QA 4BHQA 2QLWA 3CSKA 4LRBA 3E51A 5B7WA 2JWNA 3HZEA 3V4IA 5D77A 4IH5A 1U1KA 2BJ3A 1AFIA 5C25B 3FBCA 5E3AA 1J2VA 3CDEA 3TX0A 4JI4F 2MZSA 3I5BA 4LMZA 3NNHA 2B5JB 4K5RA 3OVAA 4HEA9 5KT4A 2M70A 2HNDA 3HHEA 1R0AB 2EWHA 3CJ4A 1X4GA 1RWNB 2APOA 3NCPA 5FDLA 3KLEB 1RISA 1VK8A 2BE9B 2OD6A 2RKIB 3FQLA 4TY9A 1VC5A 4JYAF 2XI2A 2KI2A 3IC1A 2U1AA 1JMTA 2J8AA 1MWZA 2WW4A 2XEXA 4CO0A 5M2PA 1WTBA 4DI6A 2CQCA 4FN5A 3D9BA 3LP2A 4YY3J 1PAUB 4C0OC 2HHQA 1MROB 2CJYB 2OGUA 3GG1A 1XK8A 2WVEA 4KGMA 1O51A 2FHOB 3K5NA 1RE1B 1KNZA 3RBZA 1D3WA 2AX0A 3LAKA 4ED2A 1UJ5A 2XMWA 5AT1B 3C66A 1NH7A 4X65F 5GADU 5KG6A 1S1VA 2HHHF 2E1MC 2ZH9A 7AT1B 5AXMA 2JJ4D 3NLCA 1KDNA 4RNNA 3H4DA 5ITHA 4RNOA 3GYXB 3C16B 4UQTA 3PFOA 4KO0A 4M5HA 3H25A 2DITA 3I5CA 4HDHA 3K5MA 4FXVA 4JV2A 2CADA 1K47A 2O1PA 1RT7B 4M8LA 3K58A 5CQGA 2VONA 5IT9Y 1OY8A 2EPIA 3C6TB 3DLKA 3J81Y 3LGHA 4UTGA 2M3DA 4F0HA 1QAIA 1P1LA 4ZVTB 2EBGA 5GVQA 5A6WA 4ZIVA 5DG8A 1QVGR 2H5IB 2HVEA 1GH8A 3FEXB 1QSLA 2BJDA 4KGXB 1I94F 3UN3A 1YI2S 1JJCB 2U2FA 4YR3A 3LP0B 2R3VA 2MLYA 1RDRA 3FZBA 3W5ZA 1JLGA 3DRRA 4LSLA 2H51B 2FVRA 2F3JA 2CNLB 2J9CA 2HFNA 1MWQA 2CPEA 3N4WA 5L1KA 4TN2A 4UUWA 2YKNB 3B8HA 3BS9A 1WF1A 1IJFB 3ITHB 2HZAA 4I6WA 2B4VA 1IBLF 3MR2A 2B4OA 2YVSA 3LW5C 1S79A 2IDEA 2E5HA 2ZBQA 3NRBA 4E8UA 4CDIA 1X0PA 1T03A 1QAYA 4ZVSB 2M2BA 2P2CB 6AT1B 2F8MA 2DNPA 2VC1A 1FKOB 1SB6A 1C0UB 2DGWA 2MYFA 1QE1A 2QYGA 3HHLA 3OBIA 5GMDA 4EO6A 3KJVB 2YQ0A 1F2HA 1D1UA 1IBKJ 1LXJA 3W7BA 4NASA 1RP5A 3L9ZA 1T95A 2GW8A 3IS9A 4B3MJ 1VQLS 1EETB 1GT8A 5JJBA 2EC0A 4OYZA 4KFBB 1V3SA 2NYIA 3EPGA 1F60B 4ZCIA 1DZ5A 3RG6A 2CPIA 4USIA 3OD2A 3HZGA 4C4WA 3GCWP 3NL0A 4ZLPA 1NJWA 4LJMA 1AZSA 4OZ3A 3M7VA 3QYYA 4F7VA 1YBTA 3OFHA 3TZXA 2CQHA 3CPWR 1RAFB 2QIFA 2AWZA 1RTHA 3N6NA 4OX7A 4KQZA 2DIUA 1R0BG 3OSPA 1EB0A 1VI7A 2JVRA 4DPTA 2W2PP 3HXMA 3VALA 4HYKA 2E9TA 4F04B 3RRKA 4ERDA 1U0HA 4ZP6A 2RIJA 2KVIA 2DIVA 2F9DA 2HK2A 3GJQB 3KWMA 4O3SA 3D4JA 1H2VZ 2PEBA 4WPAA 5F8LA 4XIUA 1PGZA 3O5TB 3KNGA 1D9DA 3NNAA 1RAIB 4ZVGA 2YKOA 1JKHA 3FBFA 3M6WA 5GMEA 2Y0SD 3DM2A 4TU7A 4EBEA 2J6TA 2BE2B 2F4VJ 4K4SA 4LIRA 2VA3A 2FHJD 2EVZA 4K8RA 2NUUG 5E3RA 4BBYA 2AD9A 3WBZA 3W8GA 1DLOB 2GJ2A 1N8RT 2MB0B 1S4EA 4HHUA 1NPPA 4J9UE 2R8HA 2FVPA 3EGNA 3FVYA 1M0SA 1ZBTA 1N88A 3CJ0A 1NH8A 2UZAA 3NBPB 4KHMA 3G8QA 3ZZZA 1PKUA 2HYIB 1EQ0A 1FA0A 2QLJB 4DV0F 2E29A 1GXTA 2MZQA 4V19J 1IQTA 2EFVA 2RF2A 3RRHA 2DNNA 4L75A 2KXFA 3GYGA 4ZLNA 4QW8A 4RU9A 4F3OA 1DY3A 2XQCA 4IO9Q 1JX4A 3KYLA 1IM6A 5ETVA 1N6QA 4EBCA 4GO5X 4BS2A 1ZA1B 4ES1A 1MU2A 4R5PB 1S12A 2PO4A 1UWAA 2X7IA 3GU0A 1HNZJ 1EIYB 4DQPA 4HL9A 1B7FA 3DNCA 5I42B 5ETNA 4DDFA 4G1IA 1FVQA 3C19A 2B51A 1UWBA 4P72A 4ZVEA 3ZZUA 2ZUAA 1F1BB 3CIMA 2HFSA 1XNRJ 2YPZA 2LXUA 3D54A 4P9SA 1VQKS 4ZA1A 2FVSA 3PO5A 1HYSA 4F26A 3Q0AA 2M7SA 1HD0A 2Y1LB 4QJVA 4K2JA 3S7RA 2I8EA 1S9EB 3PYGA 4OI4A 4NA1A 4X4PA 1JIHA 3MECA 2I9SA 2G9OA 2C1EB 7FDRA 3DOLA 3H90A 3EVOA 2K06A 1HQEA 2LQ9A 3OLAA 2J6UA 1RTZA 8ATCB 5JUMA 2QSWA 5J2QA 1G3OA 4KV8A 2XSJA 2MMYA 2O01C 1RGVA 2W24A 5KT2A 3TARA 1HPZA 3DMJB 4GRSA 5KFVA 2CJBA 2EEYA 4X4NA 1E6YA 3QZ7A 2DNGA 2G0CA 4CYUB 3CJRA 2DD8S 5HJYA 3HP6A 5FJ4A 1CLFA 2DKOB 1RLCL 3Q23A 1WSVA 2MJNA 2GCFA 3HDSA 5CZXA 5I4MA 3MR3A 1U45A 3QATA 3ZZYA 1S6QB 3UWTA 4B9VA 3BGOP 2NUHA 3RJMB 4LR8A 4LF6J 5CH7B 2C3PA 2XTJP 2Z0GA 2W8KA 1TAQA 2CQBA 4QYZJ 1AROP 3CJ2A 2BABA 2IY5B 3D2WA 3PIOQ 5F8HA 2V0NA 4BDPA 2BX6A 2CQ0A 4C11A 2QLBB 4ZVRB 3KTQA 3HHKA 2WVCA 1W2BR 2Z58B 2ZD1A 3BQ0A 3BGRA 2E7VA 3E8OA 2POKA 3BKUA 1YJVA 2NXNA 2VQFF 4NLVA 3ET6A 3QJLA 4YP3A 1WKLA 3EPIA 4OL8A 3I87A 1TV6B 2HS3A 5E5NA 3A3NB 3IP0A 1XNQF 1YVFA 2PDAA 1QVFR 1U2RA 4PPZA 4L6V3 2BVZA 2KRRA 1LW0B 1OIAA 3HVAA 3WIVA 3AD7C 1XR7A 4Z37A 3LF0A 3HM9A 2YTCA 5KG7A 2DGOA 3IBWA 4Q2LA 2J76E 2F4FA 3EZUA 3HD1A 4LF1A 1J5OA 1KONA 4PWDB 4JV5F 1SV5B 2AHOB 5F0UA 3V4MA 1IBMF 4NEZA 3AOBA 1RAGB 2CUYA 4ZLJA 4B9MA 2HQFA 1XIQA 2KTQA 1ZPWX 2W9AA 5LXYA 3W9HA 2RRAA 2HVHA 1CULA 1Y5IB 2ATCB 1VQ6S 1HQ2A 2MHNA 2ASYA 3R5AA 4PG5A 2XGQA 4I7FB 4MYTA 4CM0A 2N3LA 4KPCA 3UO0A 2W2QP 1EP4A 2XLKA 5LT5A 1YKWA 2ZM6J 5J2PA 1BGXT 4DR4F 1ROFA 1SQGA 1WOSA 2DGVA 2WZ1A 3I6PA 2HGMA 3RZAA 3JQJA 3SEOA 2LQ5A 1NZ8A 4XO0A 1IXKA 4AL6A 1CC8A 3SQGA 3JSYA 2KFYA 1M5PC 1H6KX 2A6OA 4AT1B 2DRAA 1SH2A 3CJ3A 1GEHA 1S4FA 2FY1A 4U95A 4HTJA 2XMTA 5K8PA 3GLJA 3BO3A 1HD1A 1RCXB 4CZCA 3MM5A 4B9LA 5A8WA 2E1PA 2ILYA 1NHUA 2LU1A 1XERA 3DRXA 4CLFA 3E01B 2R2SA 5LSOA 4HLBA 5CYJA 1Y10A 1FDAA 5BR8F 1YJNS 3H7HB 4FPIA 1UFWA 4ELVA 1GTHA 4RUAA 1Y11A 4KC5A 2PC6A 5LM7E 4HACA 2Y8WA 1IQZA 3SFGA 3UVJB 2Z56B 3MCOA 2YKQA 3KLGB 3PW5A 1F9HA 4QR0A 3EWGA 3K5LA 4UW2A 1UTAA 2XY5A 2F5GA 2PMZD 2DH9A 2I0XA 3KK2A 3TAQA 1AUDA 5T7LB 1VFJA 2Z57B 3QMQA 4ECYA 2DXFA 1AUSL 3BBBA 3QFWA 4LSLB 4H4MA 5GAHU 1S72S 3BDPA 1JLFB 5KOXA 4N41A 1RT6B 4P74A 1X7VA 4GVBB 4DX6A 2NSBA 2ZH6A 3MMAA 5KG5A 1VQSA 1SI9A 5IFMA 1Y0HA 2YNIA 3MPWA 4ES3A 5HVHA 2XYPB 1HNZF 4PUOA 3RTVA 1SKRA 5EDWA 1FJGF 2JNJA 2RNEA 2XHCA 5HMYA 2C2DA 4KHPF 3MI7X 3OTCA 3R2DJ 1TAUA 2MEWA 2RU9A 2JEGA 4FF4A 4E98A 2A2CA 1YJTA 2W01A 2D69A 4F3MA 2O66A 1P9QC 1L3TA 2EK1A 1KSPA 3HHNB 5K5MA 2KRBA 5ETMA 3M2RA 1Q79A 1JK9B 2I5JB 4IH6A 3CDWA 4A8SA 4TVAB 3ITHA 4ZPWR 1EX8A 4KKOB 5K9FA 1RKIA 2BE7D 1MMDA 2XYHB 1RHKB 1RHMB 3CDBA 3W65A 4B3OB 4RBVA 4O4GB 4AL7A 3ZTPA 5JVGQ 3BYPA 2DR9A 4OI1A 3D0GE 1OPIA 2IC3B 1FI4A 2YNHA 3HD2A 4K4VA 3K5PA 1N52B 1IKWA 3TX8A 1UAWA 2KJVA 1N36F 1IKVB 1TMMA 3UW1A 1S0NA 2P9EA 4ICLA 4N8NA 2MQLA 4DFMA 2IJRA 2NPFA 4OI0A 3GR1A 4LR9A 3VGSA 1WOOA 1S5ZA 1FTRA 4KB7A 2QTWA 3HHLC 2H3EB 4PZVA 2HBZB 2HFZA 1HBNA 5G0RA 5HMZA 4U6PA 2LEBA 3B54A 1UL3A 2R7RA 1UEKA 3PRVA 1JKHB 4AXJA 2N3OA 4OZ2A 4DZDA 2R8IA 1B7YB 3TJAA 2BANB 3CCJS 1HQUA 3UFCX 3GSIA 1VC0A 4ZLLA 2HVIA 4PWUA 5T7LA 3PM9A 2C42A 1GXLA 5AE2A 1UMJA 3D28A 2AX1A 3AD9C 2ZHAA 3W2WB
chains in the Genus database with same CATH topology
2B7BB 2OTJS 2CQ3A 3GZ7A 4NLDA 1BLUA 4NRTA 3CCQS 4PUOB 2BRLA 1FXDA 2MSSA 4RWWA 4N47A 2DO4A 4IDKB 1RAJA 4O3OA 1R6YA 4PPDA 4N77A 1H7XA 5CCLA 2E5GA 2I2YA 2A3JA 2CG4A 2RQMA 2KHCA 3B4MA 2P9CA 3J7Z5 4J9KA 4KR0B 1HNXF 4DR6F 1B0VA 3AH6A 4DF8A 1UP1A 4B3SF 1SXLA 4J9RA 2OJ3A 2MQNA 4N76A 3M6XA 1X9WA 2IJNA 4A8WA 4EU0A 5EWFA 4DV2F 2ZC3A 1C0TA 2KZMA 2J6SA 4YMEA 4O4GA 2HMIA 2C2EA 4ZP9A 1F0XA 2MY7A 3AB4B 4L3NA 4JI5F 4PQAA 4Q44A 3CE8A 2DCLA 4Y28C 2F4VF 1S1UA 3MECB 3CD0A 1LK7A 2KG0A 1FE0A 1REVA 5DDQC 2DGUA 3M2UA 3MPYA 4I2PA 2B9YA 3MAHA 5KTQA 1ZPVA 2VPYB 3BJYA 3CCMS 4LT6A 3R1LA 1Q1KA 3DOKB 3M8SA 4EUVA 3KK1B 3JSMB 3GIIA 1SL1A 2XY7A 5EUHA 4JV0A 2MZRA 3PO4A 4X2BA 2HRUA 1M5KC 4M1KA 3CTRA 4M5DA 4WZQA 2DCUB 3S01A 3SZ2A 2UUCF 2HNDB 4JI6F 4DWIA 4HHJA 3TAPA 4DR2F 1OS5A 4QR2A 4TKTA 3CEDA 2P5VA 5T14A 1LWEB 2RVJA 5FDLB 2XLJA 3KLEA 2UVRA 1SL0A 2HS0A 3PKMA 1YQHA 3H4BA 5GAEI 4YR0A 1R3NA 2ZH4A 5DLGA 2PE8A 4ZPVR 4R8UB 2G1DA 3MM7B 2QA4S 5HP1B 4ES2A 2MSTA 2XMVA 3BSAA 1I6JA 3DGPA 3J7YU 4OJHA 3HO1A 4NLRA 2W7PA 5EHHA 3KHGA 3BM7A 4TU9A 3G8TA 3PDNA 1HARA 3FFIA 1S1VB 5EWEA 1P1TA 5KFOA 3NMAA 4ELTA 1HMVB 3PW0A 2J5AA 1W25A 3CB4A 5E3PA 4NLWA 3TR5A 3M9NB 2KT2A 5KT7A 2CJAA 1FTCA 1LQ9A 1NK6A 1QAXA 3NWGA 2V2KA 3AQOA 3RBDA 1SJRA 1XMOF 1HR0F 3DLKB 4ECTA 1BQMA 2FHKA 5LMUF 2R7OA 4M63A 3TVZA 1PC5A 3CWJA 2F40A 1A7GE 2DT9A 2QT7A 1VQ5S 2HPUA 1D8ZA 3LP0A 3TAQA 1JLCA 2VKRA 5K14A 3BEGB 3HFKA 4DSIA 1VRUA 3SCKE 2HHSA 2QZ8A 1ZAXA 1HBNB 2CPDA 1U2FA 4C8NA 4LQ3A 3IWXA 2ZBIA 2OFHX 2PA3A 2QV6A 5DM6Q 4DF4A 3RB0A 2E9ZA 2DNQA 1IKVA 5K8OA 5KFAA 1MU2B 4UOCA 1JLEA 3LAMA 4LVOP 2BXJA 5J1EA 3KLFA 2FIUA 4NCGA 3AB2B 3RR7A 3OXGA 4NMLA 3Q8PB 2M9KA 2OPRB 3M8QA 2JLEA 3TNVA 4ZK7M 5I3UA 1SIWB 4RW6B 3V2UC 1K8AT 3EYZA 1TKTB 3U7JA 3MOZA 2LECA 3Q22A 4RBTA 4PQUB 3J7YI 2D9PA 4B3TF 3PRBA 5J1PA 3DMJA 4C0HA 1S6PB 1Q4RA 4MIAA 1DTQB 2Y1RI 3ZZTA 5HBMA 4Y2AA 1RT2B 3HHDA 1SC6A 2RS8A 2Q43A 3GR0A 1Q16B 3FQKA 1B0PA 1CSJA 1TVRA 2MKHA 2GMJA 2MZJA 4IG3B 1U1OA 4IDKA 4K0KF 3N5BA 2GO9A 2OH2A 4HH0A 2DGQA 1N5QA 3IGNA 3M9OB 3TYTA 1HHSA 1HNVA 4CO1A 4ZOSA 1DURA 1VK3A 1KOOA 2ZH7A 1VRTB 3TUZC 1N0VC 4K59A 4KAIA 3V6HA 4QIFA 4XDCA 3I9ZA 1XC9A 3IGVA 4EWTA 3VF0B 5HL7Q 2JLFA 1TL1B 4DJBA 1FD8A 1L3UA 2QYCA 2OSQA 3HK2A 4Y2MA 5DG9A 4Y2CA 3EUNA 5B0CA 3I0SB 4TYAA 3PR5B 2FLPA 2K3KA 4WFZA 4QWEA 5B0DA 3P49B 3T6JA 5KG0A 2CPYA 3PX6A 1VBZA 2VB6A 4ZMMA 3PEHA 3UD3P 2JSXA 2CJ9A 2N4DA 4LSNB 2ALZA 5CXTA 2WSFC 1OQ3A 3NCRA 5J1EB 1N5SA 1VQ4S 2E5IA 4J9NA 2YWFA 4WCEQ 3QGHA 3A1YG 2BW2A 4ZCLA 2EFPA 5IZHA 4WK1A 2DNZA 3PJWA 2VG6A 4CNYA 4WFNQ 3KK1A 4URGA 4DMZA 1Q8LA 3DRYA 3HKZD 3HVTB 1SJFA 3MEGA 1URNA 3MFHA 1S76D 2RJZA 4J5OA 1VQYA 1FJCA 3CCWA 1S6OA 4RWXA 3W2VB 3QGGA 4RW4A 1U6BA 3T5JA 4GO7X 3MCSA 3S1TA 1S9EA 4Z2XA 4BWMA 1X4HA 4GC6A 3ZFVA 3QJPA 3BN4A 1VC6A 2HS4A 4I1TA 3IR6B 3OQ2A 2SXLA 1R7IA 4F4XA 2KXHA 2E66A 2ZH3A 1T3OA 1GNKA 4U7UK 2D74B 4UUXA 1BD6A 2AU0A 3DC2A 3OVBA 3TANA 3C6TA 3GMGA 2AF6A 4JBCA 4OHXA 2DNMA 2WBMA 3T1AA 3O3LA 4CNZA 4X64F 4WFYA 1DQ8A 2LMIA 4QU7A 1CC7A 1S6UA 1BQMB 3H8YA 3ENWA 5KG1A 4FS1A 1C1CB 3BR8A 1L5UA 3UDCA 1XN9A 5HI7A 4C8MA 2KKHA 4DN9A 1N4LA 2E1CA 2DGXA 5CA5A 3W3SA 3UR3C 2UU9F 4F02A 2WB4A 2XI3A 1QAJA 5L9NA 4BC7A 2NQPA 5THWA 2VG7A 2FDNA 3PR4A 3V6JA 4DFPA 4YDDB 5EWGA 1S1UB 1WF2A 2MQMA 3KK2B 2IVYA 3O8WA 2B4UA 4I4BA 3H98A 4QPTA 2ROEA 4K4YA 5HROB 2O3DA 3FGVA 1FRMA 3BO4A 4RW9B 1HBUB 1U1LA 5E33A 2DH8A 3F41A 4RU2A 3VQSA 2FC9A 4IYQA 2MHEA 2LDIA 2XCAA 1V9OA 1YJRA 4DQRA 3QGIA 3UCUP 4Q8FA 1X4AA 5KG2A 3HF5A 1TL4A 4A8QA 2WRMA 4L72B 4QQBA 4YUDA 5LJ3Y 4PR6A 2LQJA 1NNDA 4WIIA 4RKUC 5E2QA 3R5BA 5L1IA 1UVNA 3CT9A 4QZVB 4Q2MA 1S10A 2DRBA 3U27A 2IVFB 3BDEA 5L1JA 2Y1IA 1OWXA 3JSMA 2LVWA 4DSKA 2RS2A 1UVJA 4ZDNA 1LW2A 4RNHA 3TI0A 1WF0A 3R1HA 1X0FA 2ZUGA 3VZHA 4A8MP 2DHXA 3G9CA 1KC8T 4RUCA 2CJKA 2IM1A 3L7PA 1C1CA 2R7VA 1N32F 1HQUB 4IG0B 1HNIB 1N34F 1WEXA 2Z8QA 3M30B 3MM9A 3KFWX 4QU6A 3V81A 4DR3F 2H9ZA 3FRZA 1UEUA 4V19X 2OPPB 5F8IA 2Y1JA 1NKEA 2CQIA 1KRPA 1S1XB 2JOQA 1RTJB 3THVA 3OTEA 2LEAA 3BZQA 1FK9B 3OTBA 2LLZA 4MKBA 3DYAB 2WOMA 4LF8F 1I1GA 5KFKA 4IUFA 1TFWA 1RT1B 2CZVC 4OJ3A 4DS5A 3CJKA 1RTDB 4MKYA 4FXWA 3NNCA 2K3IA 1LWFB 3M05A 2FHJA 5LL6d 3PZPA 3NS5A 5T41A 3LP1A 3PFEA 3CD7A 4QIVA 4TXSA 1G2EA 1NK8A 1YSJA 3CD6S 4MIBA 1JLCB 1NHVA 4GKKF 1R8BA 4NLQA 2J7KA 5B0EA 4OZ1A 3E3XA 5MAOA 2JLGA 3IA0A 4UY8T 3HVTA 1YJUA 3OTDA 4URSA 2AV5A 4J9PA 3MMJA 1FNXH 2JEFA 1QE1B 2EBEA 3KJVA 1VGYA 2DHSA 3MEDA 3AAWB 2VBZA 4Q5VA 3DN9A 4NLOA 2RQ4A 4DG1A 3GG0A 2AW0A 1SJ4P 3J80Y 4HKQA 3RBEA 4XPEA 1X9MA 3TA1A 2RKIA 1Q53A 3H20A 4I69A 5KFJA 3CCLS 1GQEA 2M52A 3GFZA 4XAKA 3IG1B 3LOUA 1R8HA 3R3TA 1P27B 5EGYA 4QPXA 2AGPA 4LF9F 3VAGA 3A8EA 3MM6B 3SCLE 5J2NA 2IJFA 1XMBA 2R2RA 1Z2LA 4DUYF 3TA2A 3ICLA 2DVIA 1UETA 4ECUA 1WHWA 4JI7F 5D4OA 4FS2A 4N56A 1R0AA 1ZH5A 1RT2A