1JLCB

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with pett-2
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
427
structure length
402
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords HIV-1 RT A-chain
total genus 110
structure length 402
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlcB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcB04
1FK9A 3RBEA 5DQHA 1FK9B 3BJYA 4O3OA 4J9RA 5L1IA 1Z4UA 2JEJA 1OS5A 2ZKUA 4IG3B 3KLEB 1VRTB 2B6AB 4Y2AA 4Y2CA 3PW0A 3QIDA 4H54A 4IQXA 5KT3A 5DQIA 4ZP8A 5KFCA 1SH2A 1HYSB 4IDKB 3KLIA 2B5JB 3ISND 5L9XA 2ILYA 4Q45A 1T94A 4K4XA 2AGPA 3CIZA 1W25A 4ZHRB 3FSIA 1HQEA 5HP1A 4NRUA 5J2MA 2WONA 4MFBB 3M8PA 2GIQA 2W8LA 3M8QB 1IKXB 5C42A 3H98A 2YNGA 4KFBB 2YNGB 2B43A 3KOAA 1MU2B 4EYHB 4IG0A 4O44A 1S4FA 2AWZA 4K4YA 3QO9B 1S9GB 4RUCA 5FDLB 2WHOA 3FFIA 4TY8A 3DRSB 3FFIB 4RW9B 1QAJA 4O3SA 2HWIA 2AQ4A 3BQ2A 5EWGA 5DGBA 3V81B 5L1LA 2C2DA 2IC3A 3QIPB 1SUQA 3V4IB 3QLHB 2I1RA 4EEYA 3KLVA 5HLFA 4DL6A 5DG8A 1QUVA 4LSNB 5F8LA 1S6PA 1TKZB 4ZMMA 3MR2A 2OPPA 1KLMA 1TV6A 2DPIA 1IKYA 4EO8A 2YKMB 4R5PB 3V6HA 5HBMB 3MEEB 1SH3A 4G3IA 5HBMA 2HNYA 4MK8A 4WFXA 4ED7A 3V6KA 1HQUB 1JLAB 1HYSA 1IKVB 1YVFA 2EC0A 3I0RB 2HMIA 4ZPDA 1XR7A 4HYKA 4ED6A 3H59A 1RDRA 2VG6B 5KFRA 1TVRA 3G6YA 5KT4A 3PW7A 3OHAA 3G86A 1IKXA 3LANA 2UUWA 1S1VB 1RT6B 3E51A 4IR9A 1S1VA 3OL7A 2UVVA 2R8JA 5F8NA 4XPCA 4EBCA 3NMAA 3TVKA 4JUZA 2XCPA 4H4MA 4IDKA 4DL7A 3CDWA 1HNVA 4LQ3A 5KG1A 1HNVB 3HKWA 3PJXA 4WYLA 5F9NA 2FLNA 2WB4A 2WRMA 1IKWB 2RKIB 3NBPB 4YR2A 2BANA 4NLWA 1JLBB 3KLIB 2JC0A 4JV1A 1ZTWA 1KHVA 3JYTA 4O44B 1IKYB 1S1TB 3OSNA 5DQGA 2IBKA 5KFZA 3RBDA 2HNDA 4NYZA 4ID5B 1VRUA 2YKNA 3M9NB 2JEGA 2YKNB 4I2QB 1TL3A 3H4DA 4ZPCA 1RT1B 2OPRA 1JLAA 2VG5A 4ZVFA 1RTHA 2IM3A 1JLCB 1JLQB 4ZP6A 4RU9A 4IFYA 4WE1B 5J1EA 1S48A 2ZD1A 3BQ0A 3KMQA 4K50A 1TL1A 3DLKB 1S6PB 1LWFA 1TKZA 3KMSA 3NL0A 1T03B 4R0EA 3KK2A 2FJWA 3GIMA 3T5JA 3KK2B 4RW7A 4K4WA 4RW7B 4RNFA 3TAMA 1N56A 1EETA 1S1WB 2R2TA 2YNFA 3UDLA 5HLFB 2IMWP 4I2PB 3MEGB 3EZUA 2V4RA 3IN5A 3MR3A 3FQLA 1KLMB 2J6UA 2B5JA 4XPEA 4GC6A 1QE1B 4NLUA 1QE1A 3QZ7A 1TKXA 4F4WA 1TVRB 1IKWA 5J2PB 3SFGA 1XR5A 3DLGB 5I3UA 4NLTA 1K1QA 4K4ZA 4KFBA 2WCXA 5I42B 2YNHA 5I42A 3JYTB 1JLEB 1N5YB 4ZPAA 3OL6A 1JLFA 4ECUA 4ZVGA 3HVTB 1HQEB 4KHMA 4RZRA 3M8PB 1JIHA 3IGNA 1RTHB 1S10A 2W9CB 1JLCA 1JLQA 2C2RA 4KAIA 3DMJA 1RA7A 4ICLA 4WZMA 1RTDA 3GQCA 2R8KA 1RT3B 2BRKA 1RTJA 3V4IA 3DM2B 4H4MB 3Q8PB 5DLFA 3DM2A 1C0UA 4Q0BB 2CKWA 3BSOA 4IH5A 3GV5B 2ASJA 1HPZB 2ZE2B 1UWBA 1T03A 2HNZA 3DLEA 4R8UB 5D3GA 1C2PA 4NLRA 4IFVA 4MIBA 1BQNA 3KK3B 4IFVB 1LW2B 4FS2A 4IH6A 2AX0A 3N6MA 4ED0A 1DTQA 1KHWA 5DLGA 2WK4A 2XC9A 3KLFA 2BQRA 4KKOA 2BQ3A 3KLFB 3LP0B 3NAIA 3LP0A 3KHLA 3V6DB 4K4TA 3V6DA 1K1SA 3LAMA 5I3UB 4ZP9A 3DOLA 1S1XB 1RT6A 3RB0A 2FVSA 5KFNA 5CYQB 3T5HA 1S6QB 2C2EA 4F4ZA 4YQWA 3I0SB 2QE5A 3M9MB 3M9OB 1TQLA 2V9WA 5KFPA 4KHRA 4DL4A 2GIRA 4DG1A 4ICLB 4NLGA 5HROB 5EWEA 3MEGA 2R2UA 1JLBA 2V0NA 2RDIA 1JLEA 1N5YA 4YP3A 4M95A 2D3UA 4NLSA 4WYWA 1REVA 2R8GA 4QW9A 1RT2A 3LAKA 3KLGA 4I2QA 5C42B 3NAHA 4FBUA 2I5JA 3DRPB 3CVKA 4ED8A 2OH2A 4HKQA 4WZQA 2XGPA 3PVXA 3IG1A 3DMJB 2ILZA 5T14A 4F50A 4TYBA 3IGVA 3FQKA 1DLOA 5KFGA 5J1EB 2E9RX 5FDLA 4TY8B 2IM0A 1LWCB 1JLGA 4ECTA 4IKAA 1UWBB 1SV5B 4KSEB 1S1XA 3DLEB 4O3PA 4R8UA 3SI8A 4X2BA 3I5BA 4I7FB 1SUQB 1C1CA 1S1UA 1N6QB 3DDKA 4WXOA 5KG3A 5KT7A 3OHBA 2R8HA 3EPIA 2JLEA 3IRXA 3SFUA 3DYAB 1NNDA 4ECVA 2UUTA 3CO9A 3KHGA 1LWFB 4U6PA 4QWAA 4G1QB 1RT5A 2VG7A 4ZVEA 5D3GB 2JC1A 2HNYB 3KK3A 4DEZA 4IG3A 3KHRA 4J9KA 4WFYA 4B3OA 2WOMA 3BQ1A 3JSMB 5CYMB 3RAQA 3GV8B 3KK1A 2HMIB 4YR3A 3OLBA 1D0EA 4GC7A 2XI2A 1HMVB 1QAIA 3GV7B 5DGAA 1HMVA 2VG6A 3CJ5A 1C0TA 5KG0A 2RDJA 3LP1B 4J9OA 1ZETA 4EO6A 2W9BB 4PWDA 4MKAA 1T3NA 3QGGA 5KG4A 4F4XA 3MEDB 3T5LA 2UVWA 4RW8A 3QO9A 3I5CA 3PR4A 1RT3A 1GX6A 4DL3A 3T5KA 1FKOB 4K4UA 4ECXA 1TKTA 1C0UB 2VA3A 4LSLB 2BE2B 2FJXA 2W9CA 5KT6A 4Q43A 5L1JA 3V6JA 4J9PA 1S0MA 3V81A 4WXWA 2IAJA 2JEIA 3QIPA 2IC3B 1RTDB 1RT2B 3KLGB 1J5OB 2FVQA 5EUHA 3Q8RB 2BANB 3G6XA 4J9NA 2JEFA 2R2SA 3C6UA 4IOBA 3EPGA 4QWBA 4KE5A 5F8JA 4PUOB 4URGA 1HPZA 2ZE2A 5KFQA 3CJ2A 5KFFA 4ECYA 1DLOB 1HARA 3MEEA 2IM1A 1REVB 5F8GA 3H5YA 4PQUA 3FDSA 5F8IA 1JX4A 3N6NA 4JV2A 4O3NA 2I5JB 3DRPA 3PW2A 3MTKA 2W8KA 3QYYA 3PW4A 4K4VA 2ZD1B 2RF2A 4TQSA 1S0NA 3OL9A 1LWCA 5J2QB 4MK7A 3RB6A 1N48A 4LSNA 3HVAA 4Q8FA 4XO0A 3FRZA 3I0SA 4TY9A 3LP2A 1U09A 4Q8EA 4ECWA 3MEDA 1RYSA 4ZPBA 1C1CB 1S1UB 3KLEA 1S9EB 3CWJA 5J2NB 4B3OB 1HQUA 3LALA 4IRCA 2V4QA 1MMLA 5CYMA 3H5SA 3UQSA 3UR0A 4J9SA 4RW6B 4RNOA 5KFLA 4J9LA 1RT5B 2VG7B 4ECQA 1NHUA 5DG7A 1WNEA 1C0TB 3KLHB 2C28A 2IAJB 3DI6A 2RKIA 4PWDB 1DTTA 4MFBA 4QWCA 1RYRA 3JSMA 2R8IA 2YNHB 3H4BA 4U7CA 3C6TA 4NLOA 4H4OB 3C6TB 4RW8B 2ALZA 5JXSA 2HNDB 4NLPA 2DPJA 1NHVA 4DL5A 1JLGB 3DRSA 4TQRA 3MFHA 5KFYA 2W7PA 4FBTA 5C25A 2FVPA 1LWEA 3NKYA 3T19A 3IS9B 3MECA 4RW4A 3BSNA 4I7FA 1R0AA 1N6QA 1RTJB 3CJ3A 4RNMA 2UVUA 2BR0A 3QLHA 5KFHA 1HNIA 3RB3A 3ISNC 4PUOA 5KG5A 3GIIA 3LP2B 4IRKA 4G1QA 2IJFA 2E9ZA 2FVCA 4NRTA 4MH8A 5KFSA 1LW2A 3CJ4A 5KFBA 4KV8A 1J5OA 4KV8B 3PHEA 2IA6A 4I2PA 3IRXB 4MK9A 5C24A 3MR6A 2XI3A 5KFUA 5F8MA 4RNNA 4ECZA 4WFZA 4RNHA 5JUMA 1JKHB 5EDWA 2XGQA 1TKXB 4PQUB 2FVRA 2OPSA 3DLGA 4ECRA 1TL1B 2WTFA 4KBIA 3PZPA 5KT2A 4O4RA 5F9LA 4NZ0A 2R2RA 5CYQA 1RTIB 1EETB 1S1WA 3H5XA 2YNFB 5J2NA 4O3QA 3OSPA 2FLLA 1S97A 3DOKB 3CDEA 2IJNA 5KFEA 1S0OA 4O4GA 5K14A 3QGHA 1FKPB 3GILA 2QV6A 2BE2A 1FKPA 4Y3CA 4J9MA 4ECSA 4ZHRA 4Q44A 1XR6A 3MECB 4RW4B 5HP1B 3D5MA 2WONB 5J2PA 3ICLA 4TXSA 5DG9A 5EWFA 3M8QA 1C1BB 3NBPA 3H5UA 3GIJA 2ATLA 3BGRA 3E01A 4NLDA 2BQUA 4RW6A 4LSLA 4H4OA 2YNIA 2BRLA 2HNZB 3N6LA 3BSAA 3D28A 4ED2A 3HVTA 1S9GA 4Y34A 3GYNA 1BQNB 3MR5A 5J2MB 3H40A 1VRUB 3CJ0A 1DTTB 4KB7A 1TL3B 4NLVA 3NGDA 4F4YA 2OPRB 1LWEB 3DRRB 5KG6A 3IS9A 2D41A 4KKOB 3BR9A 5KG7A 4K4SA 4ZP7A 5KFMA 1RT7B 2OPQB 3KJVB 4URQU 1RT7A 2OPQA 3KJVA 3Q8SB 4EYIB 1S49A 3G6VA 4Q0BA 4MKBA 1RT4B 1TV6B 1EP4A 2W7OA 1GX5A 4NCGA 1IM4A 3BSCA 4MIAA 4NCGB 4RUAA 4ZVHA 5KG2A 2AGQA 1R0AB 3TAMB 1VRTA 2B6AA 3OLAA 4NLXA 5J2QA 4YMEA 1DTQB 5C24B 4ED1A 3I0RA 3KHHA 2YKMA 4R5PA 1T05B 2O5DA 3QZ8A 4EBDA 3HHKA 4M94A 5KFTA 2VA2A 3KNAA 1S9EA 2OPSB 1C1BA 4FS1A 5C5JA 3BGRB 3E01B 1IKVA 4URSA 3QGIA 2W9AA 4KO0B 1CSJA 2YNIB 4KO0A 4QPXA 1RTIA 1JKHA 4YR0A 1JLFB 2D3ZA 3KLHA 2D7SA 5KFIA 4QWEA 3RB4A 3DI6B 5KFDA 3I5AA 2CJQA 1RA6A 4NLQA 1BQMA 1BQMB 5C25B 2UVRA 4JV0A 2FLPA 4DG1B 4IR1A 4EBEA 1SH0A 1N4LA 4OL8A 4TLRA 5HROA 1FKOA 3DOKA 3HVWA 3OL8A 1TKTB 3GIKA 5KFAA 1LW0B 4O4GB 5K14B 1RAJA 1LW0A 3VQSA 3PW5A 1EP4B 1SV5A 1S1TA 1ZTTA 4TN2A 4IH7A 2C22A 3TQ1A 3UPFA 2AX1A 4ID5A 5F8HA 3Q8QB 4ED3A 4DL2A 1S9FA 3ITHA 1TP7A 3ITHB 3T1AA 2VG5B 3C6UB 2AGOA 5KT5A 1HNIB 2IM2A 3DRRA 1MU2A 3IG1B 2GC8A 1D1UA 2OPPB 3BREA 4IG0B 3PJWA 1T05A 2XWYA 2XCAA 4IFYB 4WE1A 5KFWA 4J9QA 4QWDA 2J6SA 4O3RA 4IRDA 5KFJA 5KFKA 3MF5A 3PR5B 2F8EX 1I6JA 2E9TA 2HAIA 4TYAA 1RT1A 5L1KA 2HWHA 3DLKA 2AU0A 2WOMB 2J6TA 1RT4A 5KFVA 4RW9A 2ASLA 3RAXA 4NLYA 5KFXA 3DOLB 3KK1B 3MFIA 4LQ9A 2ASDA 1JXLA 2RF2B 1S6QA 3CDUA 3H2LA 4QW8A 3LP1A 5KFOA 2W9BA 3DYAA 2FJVA
chains in the Genus database with same CATH superfamily
3RBEA 3IR6B 3M6UA 4J9RA 4MYUA 1LWXA 2MKHA 4PG7A 1Z4UA 2ZM6F 2E5LJ 3M8YA 2DNKA 4JI3J 1OS5A 2ZKUA 3PEJA 3KLEB 1VRTB 2XMMA 3ENQA 4Y2AA 2I6WA 4IQXA 3PCOB 2JFKA 5KT3A 4ILRA 5KTQA 1SH2A 1HYSB 4WIIA 5DZ7A 1VQ4S 2IY5B 3CJKB 1Q86T 2F8HA 3FEZA 3WZ0A 4K4XA 1T94A 2YWKA 1P9QC 1UJ4A 3D1OA 3BO4A 2C3PA 1GAOA 3FSIA 1HQEA 1SQEA 2GJFA 2AU0A 2AYBA 3IO1A 2ZWPA 1VBXA 4MFBB 3M8PA 1XK8A 3BKUA 4DPWA 4Y65A 2GHPA 1NM2A 5C42A 2YNGA 2UXBJ 5C2CA 2YNGB 1RWOB 2B43A 3BEGB 3KOAA 2FJBB 4USHA 3HHLC 1BD6A 2AWZA 4K0KF 3BPSP 4ZVOB 5CZVA 4RUCA 1YG0A 2VPYB 5FDLB 2WHOA 3FRYA 1EIYB 3DRSB 3FCHA 1Y4ZB 1SJFA 2GVDA 1G4CA 1FJGF 4DR7J 3T1YJ 2HWIA 4W98A 2YWHA 3JAMU 2U2FA 3BQ2A 3KUGA 2GGPB 2AQ4A 3QRPA 3V81B 2VL1A 4DR6F 3TRGA 2C2DA 3IXQA 2MDAA 2RVJA 2KZZA 3V4IB 4X66F 2FZGB 4EEYA 5HLFA 4I0WA 1QUVA 1S99A 1XQIA 5DDPC 3MR2A 2QN6B 4OJ1A 2XYHB 3FSXA 4ZLLA 4EO8A 2QLBB 2HFOA 1WG4A 2HNYA 2NXEA 4FXVA 4ED7A 1NK6A 2DB1A 2AV5A 3C19A 4JI0F 1KFSA 2RHSB 1HQUB 3POTB 3QJLA 2VQFF 4FXWA 2XB2D 1IKVB 4F0HA 3W64A 1R31A 2BKPA 3W5XA 1YJWS 2HG4A 3I0RB 1P27B 2HMIA 1V3SA 2CPJA 4HYKA 4BCAA 2GS8A 5B7WA 1KEKA 1RDRA 2RRBA 4ANEA 1WELA 2CJBA 1DHMA 2G0JA 2GAGC 3AODA 3QWPA 4A8OA 4CLSA 1MROB 5KT4A 1MLAA 1IKXA 2AT1B 3EVOA 3NXZA 3PRBA 1GT8A 2QZ8A 1S1VA 3M6XA 1X5TA 2MPUA 1UEKA 1ZM9A 4DX7A 2GV1A 2B9WA 4JUZA 2CNNB 1SC4B 4P2MA 4CWBA 1YZ7A 4DL7A 3CDWA 1QJHA 5DM7Q 1HNVA 4LQ3A 1HNVB 3M6WA 2V69A 5F3ZA 1X0FA 3L7UA 4WYLA 5D8HB 2RUSA 5F9NA 1U45A 1HNWJ 2I2YA 2WB4A 3E3XA 1WC5A 4DLEA 1IKWB 2RKIB 2VIHA 1TELA 4OMFG 2YXLA 1JLBB 3CCVS 1AUDA 2WBMA 4G1IA 4O44B 3CEDA 3ZZTA 3C2PA 3OSNA 5DQGA 5E7OB 2AHOB 4ZVRB 5KFZA 4NYZA 3SDEA 4ID5B 4FYVB 3HD2A 1IVZA 2V63A 5GAEI 1RT1B 2BKOA 4U96A 2Z2YB 1JLAA 3ZC4A 1ZYQA 1FT8A 3MZIA 3NCRA 4ZP6A 1NXIA 3VGSA 4RU9A 1FJEB 3U1LA 1S48A 4A8FA 2ZD1A 2VASA 1I94J 3BQ0A 5CAAA 3K89A 3M6VA 2VBXA 1X4HA 4FYDA 2DHSA 4PQAA 3NL0A 4LF5F 3TYTA 1T03B 3IA0A 3KK2A 2ZDOA 3KNGA 3KK2B 1ULRA 4RW7A 4K4WA 4L3NA 1OQ6A 4RW7B 2Z2ZA 3CCTA 3GB0A 3RBXA 1EETA 4I68A 3WQPA 2R2TA 4DUYJ 4V1Ak 5FD1A 4LF7F 3UDLA 2IMWP 4I2PB 4OX6A 3EZUA 4C3KA 5DDQC 4CI0B 3AQPA 5CD4H 2DCLA 3NOCA 3R1LA 2J6UA 1Y00A 2PO4A 3JQKA 1X0PA 2MQMA 2DHGA 1O5JA 2PDAA 1XMBA 1TKXA 3J7YU 3H25A 1ROFA 4F4WA 4OV6A 1XR5A 3M2RA 3KJNB 5I42B 4LVOP 2YNHA 1U8WA 4F4AA 2QIFA 1S79A 4X65F 3CXCR 4ECUA 3OL6A 1F2GA 4F3OA 3RAMA 3HVTB 1UVKA 2B56A 4NMLA 5GAHI 4KHMA 4DF4A 4JI0J 3SEOA 4CLLA 4DCOB 4X4UA 1PBUA 1IWGA 2DH8A 4AYBD 1RWWB 1RXOB 1RTHB 1NDKA 3MAHA 4F04B 1S10A 3OTOF 1JLCA 4B3SF 2CPYA 1FTRA 2K8GA 3M1VB 3MM5A 1JNRB 4WZMA 2QT7A 2PMWA 1RTDA 1NSAA 2R8KA 1M5PC 1RTJA 3Q8PB 1O0PA 3DM2A 2W2OP 4EK2A 3OTBA 5AJ3F 4D3HA 3BSOA 1NH7A 1NH8A 1SIZA 3GV5B 2ZE2B 1MWQA 2W01A 3G6ES 4YUDA 3E8OA 5LMUF 4OZ3A 1C2PA 4P74A 5DO2A 3KK3B 4IFVB 6FD1A 2F65A 4DR1J 4E98A 4DUZF 4IH6A 1FO1A 2FPHX 3K59A 4FYYB 1KHWA 2FD2A 2GMLA 4K59A 4PYDA 5JVHQ 3AOAA 3DFEA 3NCQA 4RLEA 4Q5VA 2BQ3A 2H48B 1U25A 3KHLA 3T1HJ 3LF0A 1WSRA 2YKPA 2MMYA 4CNZA 4DX5A 1S76D 3X3UA 2QFIA 1Q78A 5ETNA 3BM7A 3LAMA 4B3RF 2RJZA 2E66A 2HK3A 4ZP9A 2FJEB 1QTMA 5CYQB 3RRKA 5ETPA 1S6QB 1UVLA 3GCWP 3EX7B 2XS7A 4F4ZA 3ULHA 1MN7A 1N34J 1D8YA 1FFWB 3I0SB 1U1LA 1RWNB 3MM7A 2VKRA 1KFDA 4OYXA 4KHRA 5FLXU 3ZZYA 4C48A 4WKRA 1FNXH 4ICLB 1ICEB 2QMUB 3T41A 1SJQA 4DR5F 1RI7A 4OI0A 2C2OB 5A6PA 5HROB 1HBOA 1ZM4A 4XDDA 3R5GA 2J8SA 4U9RA 4UF4A 4N8NA 3EYZA 4CP5A 2PFDA 3A8KA 3HI9A 4M1KA 4NEZA 1ZA1B 4YP3A 3I4HX 4WYWA 2HBYB 1S6UA 2HRTA 2JLGA 3QRQA 5AXKA 4J90A 1W26A 2GVZB 3PDNA 1RT2A 3W9IA 4CLFA 4I2QA 3MTJA 4A8SA 3NAHA 4CM0A 2W1BA 4NCAA 4WZQA 2LLZA 3H2VE 3SSQA 3PIOQ 3NG8A 3HSJA 2DHAA 1DLOA 4CO0A 1VJWA 4TY8B 4U7UD 1LWCB 3KUEA 3VZIA 5H9FK 4DUTA 2HQCA 4CTAB 1FERA 4HLBA 3OR2B 4ZCKA 2J9EA 2F3JA 3HHLD 3TA2A 1UWBB 3FJ2A 2DNOA 2F40A 2C3YA 2Z0GA 2DHXA 3EGWB 1UPMB 2C2KB 2F4FA 3KJFB 4O3PA 2EI5A 3I5BA 4I7FB 1N6QB 1S1UA 2EFQA 2MKSA 3F41A 5KT7A 1WC0A 3ZZOA 4G3IA 4CT8A 4L3KA 3EPIA 5IT9Y 3B54A 3IRXA 3ET6B 4JI7J 2UUTA 2CQ1A 1LWFB 4B3SJ 4QWAA 2QX0A 2VG7A 5HI7A 3OVBA 1TUGB 3C16A 2JC1A 4DEZA 4J9KA 1RCXB 2EK1A 1O8BA 3G8QA 5L39A 2P9GA 3TQEA 4ELTA 1AROP 5ETMA 3W7BA 4LFCF 1TL7B 4M5NA 1Q8LA 3O6QA 2UUAF 4X4VA 3SSSA 3HM9A 5LM7E 2XI2A 4GVLA 2LMIA 3K0JA 2C1EB 1LK5A 2ZH2A 4PWDA 3GTYX 1R6VA 3MGJA 4CLWA 1RHRB 2PN6A 4DV5J 3G82A 1FRMA 2IHR1 2VJVA 2KT3A 2DKOB 4P72A 3V2UC 3AY0A 3MEDB 1VIXA 1YDLA 3T5LA 4FVCA 4P9SA 2UVWA 4C8ZA 4HTJA 2Z4PA 1RT3A 3QSIA 2CQ3A 2FIUA 5L8RC 1FKOB 4ENOA 3C15B 3WIVA 4L76A 4LSLB 3HSZA 2FJXA 4MTPA 1L3KA 4J9PA 1WWHA 3V81A 2X51A 5GMDA 3GPAA 1KC8T 1RT2B 3ZZRA 4I67A 3QAEA 5EUHA 2XY5A 2BANB 3G6XA 1PC4A 2A2CA 2OGUA 3B78A 5KOXA 5BR8J 4X4TA 3I32A 3IM8A 1R43A 3U27A 2AMCB 3BN4A 4AL6A 3ETMA 5F8JA 1M5KC 1WACA 3HDSA 1SC1B 3VGUA 3MEEA 1REVB 4LF4F 2AJ2A 4ZITA 5I4MA 2CYYA 4I69A 3LWLA 3H5YA 4PQUA 2FZCB 5F8IA 4AL7A 1JX4A 3QJPA 2HHPA 3MCMA 1IR0A 2K3KA 2ZHOA 3MPDA 3POTA 3PW2A 4JI1F 2V5HG 3UCGA 3MTKA 2W8KA 3H7HB 1YBTA 5J1PA 2UXBF 3BYRA 4LRAA 4AD6A 4MK7A 5ETQA 1FESA 1N48A 4C8KA 3LWMA 4XO0A 1JQGA 1X5SA 2SXLA 1U09A 3NCPA 2EG1A 2BOPA 4LF8J 4ZPBA 2OEKA 5GMEA 1H2VZ 3KLEA 2HURA 4PPZA 4IRCA 2CJYB 5B0DA 4YOEA 1HI1A 2M3DA 3UQSA 2Z57B 4RW6B 4X66J 2VG7B 1VK8A 5F0UA 2KYZA 3AJ1A 1VC6A 4TU8A 5LXYA 4X64F 3KLHB 3Q0AA 2C28A 2XZDB 3ILLA 4MFBA 2NPIA 5E0OA 2EFVA 4ED5A 3DN9A 4USMA 4B9LA 1RHQB 1TL7A 2JWNA 4DZ6A 1YJRA 1OPIA 2CDRB 4UZCA 4H4OB 2DO4A 3C6TB 3AH6A 1NKCA 2A3JA 3D6MB 2DH7A 3DRSA 4TQRA 2HFVA 3MFHA 2W7PA 4FBTA 2FVPA 1X5OA 4UQGA 2JHEA 1V9OA 3DLLQ 1LWEA 2BM1A 4CZCA 5F41A 2L9DA 3IS9B 4KGXB 1AT1B 3Q8UA 1SL2A 1WC6A 4N76A 3MOJB 5D4NA 3S01A 5H9EJ 2O67A 2YWFA 1YGYA 2YX7A 4DPUA 5KFHA 4DR2J 4JV5F 2YQ1A 1WOSA 5IWAJ 1VQ8S 1PJ6A 1RWXB 1T11A 2KDOA 4W92B 2E9ZA 2F4VF 3PEHA 2BACA 4M5IA 3VR1A 5KFSA 3R6LB 4EFAC 4N5SA 4KV8A 3UCZP 2Y3YA 3PHEA 2IA6A 1PG5B 3QT6A 3MMCA 1WEZA 1ZA2B 4YN3B 2XMAA 4MK9A 3MR6A 3DDIA 3TUJC 3EGNA 5KFUA 1X31C 4RNHA 3JTPA 4YY3F 1RGVA 8AT1B 3M32A 5EX0A 3OT9A 4PQUB 1WHXA 1HHQA 2LA6A 2VBYA 3IR5B 4HL9A 2RD5C 2V50A 3UDEA 4NA1A 4KBIA 3UN5A 3PZPA 2NQPA 4CLTA 5KT2A 3EGVA 5F9LA 4NZ0A 2YWGA 2R2RA 4ZLJA 1S1WA 3VAGA 4OQJA 5J2NA 2M0GB 2QYCA 4O3QA 3DOKB 1XNRF 3GCXP 3HFKA 1WHWA 3FMBA 5KFEA 4UY8T 5K14A 2QLWA 1I94F 2BOAA 4ECSA 3DLBA 3Q89A 1NJZA 3CCWA 1VJQA 4F2SA 2UXCF 5E5NA 2XLKA 4TXSA 1D09B 5J2PA 1F5BA 3ICLA 4W90B 5CXTA 3T9NA 3ZFVA 3PM9A 2KZMA 3BGRA 3E01A 1FWPA 2ZOMA 1WHVA 2XYPB 3A8EA 2J0WA 2Q3PA 2ZZMA 4P7VA 1RAEB 2PMHA 1FRJA 1Q79A 2KT5A 3LGHA 1VLOA 4KB7A 3UR3C 2YQ3A 3AAWB 4ZN3A 1F3VA 3GR1A 2GCFA 3IFEA 1LWEB 3RBZA 3DRRB 5KG6A 5G0RB 4LR9A 2ADCA 1HNXF 3BR9A 2DR9A 4K4SA 2Y0SD 2HW3A 2OPQB 1RBLA 2MZRA 4CLYA 1RT7A 3KJVA 4EYIB 1RAAB 2W4PA 2CQHA 5DDOC 3HVRA 4JI4F 5E3PA 3M2VA 3G6VA 4OHYA 3M2UA 2DCUB 4JI5J 4MKBA 4B02A 2CIMA 1H6KX 2PMZD 1RP5A 2QTWA 4NCGA 1IM4A 3N9UC 3THVA 2EKYA 2VC0A 4MAKA 4DSEA 2NXCA 5DZ6A 2AGQA 1R0AB 2B6AA 3OLAA 3OW2R 3I56S 4NLXA 1LXNA 3CJ8A 3N5FA 3KFWX 4P73A 4YMEA 3W62A 4F36A 3HLUA 3EGZA 3I0RA 2DNQA 3KHHA 2E5JA 1HFEL 1RAFB 3TEGA 4B3MF 3M8WA 2CG4A 1QSLA 2MZTA 1DFDA 4WK3A 3ZTRA 4ZDNA 1S9EA 1RZMA 3I87A 3NGSA 1C1BA 4FS1A 2DNNA 4URSA 1FXDA 2JVOA 4DR1F 3FUYA 3QGIA 2YNIB 2QC3A 4QPXA 2HLUA 1JKHA 1T9WA 4HTIA 1U47A 1J5EF 5KFIA 2XYGB 1ZS6A 2GVZA 3DI6B 2QLXA 4GO5X 1S6OA 4NLQA 2GAHC 1BQMB 3W1YC 3D66A 1QVGR 4OX9J 1N32J 4ZCLA 1H2UX 2ZOGA 1PGZA 1NMEB 4JV0A 1FNOA 2AYMA 3R27A 3UVJA 4FKXA 2J9DA 3ZTSA 4DHVA 4IR1A 2F9JA 2I38A 4EWTA 5E41A 1NZAA 2QA1A 2VFUA 3OL8A 2MJNA 4FVMA 2KXNB 3GIKA 2Y8WA 2HAFA 2IMOA 2JJ4D 2ZITA 2UV8A 5K8MA 3QRRA 2BA9A 2HBQB 3C66A 2FHOB 1AXQA 2WB1D 3T6JA 1VQKS 2G0IA 2HBZB 4OIXA 3Q8QB 4DL2A 1S9FA 3ITHA 2W24A 4FDFA 3TZWA 3ITHB 1KR4A 1WG5A 3T1AA 2H54B 3AOBA 2VG5B 3ILIA 4J9UE 5DS7A 2H4YB 4DR3J 4C3LA 5ETOA 3C14B 2XMWA 2AGOA 3I9ZA 4Y6IA 3IG1B 2GC8A 1D1UA 3BO2A 3UD4P 1H98A 1UZDA 3GWCA 3PJWA 2XWYA 3VTIA 2XCAA 4J9QA 5KFWA 1NDPA 3IM9A 2BJ3A 2UZAA 5G4DA 3SDEB 3W2WB 4LRDA 3PR5B 4IRDA 2E9TA 2HAIA 3S6EA 2CPDA 1U02A 2HWHA 2QL5B 3GG0A 2J8AA 4CRJA 4ANCA 1KDNA 5IT4A 5IZHA 1QD1A 2HVDA 3CMQA 2HK2A 4KR0B 2XHCA 3DOLB 3ZO7A 3EZ5A 2QA4S 3SQGB 1B3TA 3OV7A 1JXLA 1KNZA 2W2MP 2JL9A 3CCMS 4ZVQB 2EVZA 3I55S 2HHVA 1NRKA 4N8OA 1ZM2A 1B4SA 3P5BP 5K5MA 1U6FA 4KH1B 4TLQA 4YR0A 2PA8D 4WFAQ 2RNEA 1FJCA 2H1YA 2ZZTA 5DQHA 2M5YA 1YHQS 4O3OA 5L1IA 1NSKL 4KRWA 4LR7A 5SZTA 2JEJA 1RADB 2AJQA 1A9NB 4NA2A 4IG3B 1M1HA 2B6AB 2HFZA 4ITSA 3W63A 3PW0A 2NXUA 3RR8A 3RRGA 3MD1A 1K47A 3RW6A 2FHMA 4ZP8A 3FGVA 4Y2IA 3HMJG 3J7AN 3OVSA 4D3GA 5L9XA 2HHWA 1CJUB 2B4PA 4Q45A 3I82A 3MPYA 3TEHB 2DRAA 5HP1A 2A2DA 3F0NA 4NRUA 5DETA 2IVMA 3R5CA 4KY3A 3M8QB 1IKXB 3H98A 4KFBB 4HACB 5ADZA 2QEXS 3PX0A 3WHIA 1MNEA 4EYHB 5AT1B 4QIWD 4LFCJ 3ZZZA 1S9GB 3T1YF 1NK7A 1HD0A 2OSQA 1WEXA 3FFIA 4JOUA 4TY8A 1R8PA 1HL6A 4DCPB 5E3QA 4WKYA 5BYSA 2DIVA 3MHYA 4X62F 4C2MA 3BH6B 5CHCB 5DGBA 2DIUA 1YITS 1UJ5A 2RU9A 3T9ZA 3WBZA 1SUQA 3SQOP 4HT7A 3QLHB 2I1RA 4NI2B 2CADA 1DAXA 3FBEA 3MI7X 5F8LA 2KN4A 1S6PA 4ZMMA 2DHHA 2OPPA 1IBCB 1TV6A 2RAQA 3QPIA 5HMZA 3I4PA 2DPIA 5HBMB 3UN2A 3NGKA 3DNCA 2LEBA 3UDVA 4V19J 1T9YA 4X4NA 2YPYA 4KIAA 5K8NA 1HYSA 2O3DA 4UW2A 2WAQD 2HHTA 3G8TA 1YVFA 1GTEA 1OSCA 3LGNA 2XMTA 3Q8VA 2VPXB 2KM8C 1XR7A 2M2BA 2BJ1A 2GO8A 4QIVA 5KFRA 2CQGA 2AEJA 2DGSA 3SCLE 2L08A 5EHHA 3G6YA 4KGKA 2Y1IA 1MWYA 2YX4A 3E51A 3GJTB 3OL7A 4LR8A 4A8KA 3AXMA 5D0HA 3ELHA 2QA2A 3D67A 3MM6A 2MHEA 3OFFA 4B9SA 1X9SA 3TVKA 3CTRA 2XY7A 1PKUA 1WDDA 1WF1A 5HJYA 2BJ9A 2E1PA 2MEWA 1VBZA 3W9HA 1EX8A 2IIHA 3P3DA 4DV6F 3C8YA 1P9YA 5KG1A 3MAAA 2GGPA 3GFYA 1CJKA 3FVYA 1Y7PA 4J91A 3D0HE 4LF5J 2RQCA 2V9KA 1N88A 1Y3JA 3VWSA 5LXRA 3SZ2A 2BUNA 2ZKTA 2BZ2A 4K5RA 1F0XA 3HT0A 4NLWA 2NS1B 2ZH3A 2JC0A 2YKOA 1RACB 3GZ7A 3OXLA 3PKYA 1X60A 1ZTWA 1KHVA 2J7UA 3H90A 1IKYB 1S1TB 1JJ4A 4KHPF 4FN5A 3LOUA 2ZH1A 1R8AA 4B9TA 3M9NB 1S4EA 3R1HA 2HHXA 4I2QB 1TL3A 4B17A 5IQ6A 2FYXA 2OPRA 1H7WA 1RTHA 3PX4A 3QT5A 2BBEA 1SKWA 2IM3A 1JLCB 2DNGA 2WBRA 1ZZFA 4X4SA 3R8YA 4IFYA 5J1EA 1RABB 3NY0A 3TA1A 4X4OA 5GAHU 4X65J 4OLOA 4JI8F 2XLIA 1BC6A 4DV2J 4K50A 5K8OA 2QYGA 3RRHA 3DLKB 1TKZA 3DC2A 2CNLB 5LMNJ 4R0EA 3GIMA 3T6BA 2P6TA 5LJ5Y 3DU5A 4U8YA 2GA7A 2HWTA 3N0VA 4PRFA 3W8PA 1S1WB 2F7VA 2KRRA 1KKHA 2QL9B 1N5TA 2YNFA 4OHZA 4BWJA 2ZH7A 2Z2LA 2H65B 3MEGB 2EFGA 2ROGA 2LCWA 3R5BA 4R0JA 4DPTA 2C2MB 1WOOA 4EUVA 1KLMB 2LU2A 2V4RA 1T8EA 2R7XA 3ZZPA 2PI4A 4H4KA 3BGFA 4LIWA 4OYZA 1XMOJ 2AEFA 2CQBA 1VS3A 5T41A 7AT1B 5I3UA 1WTFA 5D0GA 1D9FA 4OYPA 1K1QA 2OD6A 2WCXA 3IRWP 5IT0A 4DUZJ 2CQ4A 3OJSA 4IUFA 3JYTB 1N5YB 4ZPAA 2C3OA 1VGYA 1JLFA 1PJ5A 4UT4A 1UA0A 1NB7A 3MUVP 3K5PA 4QQBA 5D15A 2CQ2A 2OP5A 1LNQA 5F3TA 1CVJA 4ZPWR 1JIHA 1DBDA 1YRUA 2OSRA 4I6AA 4RL1A 2ZOFA 3T1HF 1M1KT 1HHSA 4OYBA 3US5A 1MWZA 3DMJA 4ICLA 1HA1A 1R0CB 3PRDA 4P52A 4A46A 5D4OA 4K5SA 1RT3B 3THPA 5HVGA 3MCNA 3VAIA 4H4MB 2KG0A 4UY85 2XSFA 3VAHA 1X7VA 4IH5A 1H2TZ 2HLTA 4MYTA 2OHDA 1T03A 1KWMA 2HNZA 3JTOA 4G6VB 4KQZA 1KQGB 2RRNA 3CCZA 5D3GA 2CJ9A 4LRFA 4MIBA 1RLCL 2XLJA 4Y0FA 2AJ1A 1FWLA 4E2FB 2YWWA 3UNYA 4B9MA 3N6MA 2L3MA 1DTQA 4DFMA 2QG9B 2QMWA 2DR7A 6FDRA 1KSPA 2JEIA 2XC9A 3KDNA 3KLFA 3CMES 1U0HA 2N4DA 3WIUA 3M05A 3ZTPA 3V6DB 2ACYA 3V6DA 2R7SA 2XEXA 4PXCA 2MLYA 1U1MA 5EGYA 2LECA 2B0GA 3PYFA 1B0TA 5GADU 1S1XB 4PXEA 3RB0A 4P2XA 1RK8A 2FVSA 5A6WA 1XNQJ 5T7LA 2DBBA 3CW2C 4LFBF 4FF3A 4YQWA 3A3PB 4DCJB 1FJGJ 2V34A 5B0BA 2R7OA 3RZAA 3P45B 5GMKa 5CQGA 5KFPA 2V9WA 3CC4S 3GMGA 1GMUA 2GIRA 4CH7A 1OIAA 4M5KA 3K5MA 2VZ9A 3HCXA 5HJXA 2LXFA 3R7NB 3MEGA 1QSSA 1FX4A 1JLBA 2YWEA 3L7PA 3CCLS 2QSFA 2RDIA 2MQNA 3C46A 5F0WA 4AL5A 2ZBIA 3UD5A 2NPFA 4NLSA 2YPZA 3D3BJ 1KQFB 1W7WA 2KJWA 4F0MA 3JQMA 4QW9A 3LAKA 3KLGA 3UFCX 5C42B 3DRPB 4I6WA 2BW7A 1VYAA 3CVKA 4HKQA 3BV8A 5GVQA 1EARA 2ZJQQ 1UW4A 1N36J 3IG1A 2DGWA 1CQNA 4WFBQ 5T14A 1OWXA 1TU0B 2B4OA 3FQKA 3O1LA 4PYAA 5KFGA 3WC0A 1GFWB 1J2VA 4QIFA 5FDLA 4NXNF 3CIMA 2O66A 1TK8A 2HVIA 2E7WA 2RT3A 2MHNA 3JXOA 3NNCA 2DNZA 2N82B 3J7A1 1RBAA 2M70A 1KD1T 3ISZA 2AIRB 2MZSA 2KL8A 1I1GA 1NSPA 5E2QA 5KG3A 4CT9A 2OEJA 3OHBA 4DV3J 4WXOA 3P96A 3MMCB 4PR6A 1H38A 2JLEA 1KRPA 4OHWA 4ECVA 1U48A 1RAHB 4U6PA 3R5JB 3Q23A 3RW7A 1EKRA 1RT5A 1GNKA 2MSTA 2HNYB 2KHDA 3UI3A 1HR0F 4WFYA 3K2YA 2IFXA 2UP1A 1U6BA 1F5AA 2WOMA 4BC9A 3BPDA 3VF0B 3M30A 3JSMB 3B4DA 2VH7A 3KK1A 1IR2A 2HMIB 4YR3A 3R9LA 1NU4A 4GC7A 1HMVB 1AB8A 7FDRA 1HMVA 3CJ5A 2RDJA 3BN7A 1RKIA 1DURA 2FLOA 4ZJOA 2W9BB 3GSDA 1HNZJ 5BXIA 4MKAA 1U1PA 2HQ3A 1U1RA 5HAOA 1H73A 1PYTA 3A13A 3TJ8A 3A12A 1G6BA 5KG4A 1NAQA 5L1KA 4F4XA 2CJKA 2MGZB 1IJEB 2XHWA 2OLWA 1K9MT 1HNWF 1WF0A 3QO9A 4DR5J 2AYGA 1U49A 3FC9A 1CC7A 2NXJA 3MPWA 4ZPTR 4LFAJ 2XSJB 4DPOA 4ECXA 4K4UA 1TKTA 1C0UB 2DO0A 2VA3A 1HBUB 1ZPWX 4PXDA 3HFVA 4S0MA 1OJ4A 1S0MA 1FD8A 5L1JA 4YHHJ 4NYPA 1EAYC 2HGLA 2W4DA 3N79A 2LQ8A 1N0VC 1RTDB 2FVQA 2IDEA 3DGPA 4J9NA 2NZCA 3O3LA 3PX6A 2FUG9 2YKAA 3EPGA 3T3FA 1IBKF 3K58A 2R7UA 4OI2A 3GFHA 3GG1A 2ZE2A 2VFSA 3SSRA 2B9XA 5KFQA 1X4CA 3CJ2A 1HARA 1Q5YA 3Q8YA 4OX8A 2IM1A 1UVJA 4DR7F 2Q6BA 2N7CA 2YVSA 4FF2A 4UOHA 3N6NA 2GVDB 3DRPA 5A0YB 1M5SA 4X64J 1DRZA 2CQPA 1IBLJ 2UU9J 2OMOA 2ZUGA 2UUBJ 4LRCA 2ZBCA 4DFJA 2GJ2A 5H9EK 4PEOA 1XMQF 2ZD1B 3Q2TC 4K4VA 8RUCA 3CCES 1S0NA 2MKJA 2CPFA 1ZBTA 4JP8A 2EFNA 3B6BA 1WOPA 1N0UA 2A18A 3I0SA 3LP2A 1F5CA 1PC5A 1L3UA 3BBCA 3ZNJ1 3MWBA 2VFRA 5D4LA 1S9EB 1F1BB 2CA9A 3KXDA 3GFXA 1VQPS 4B3OB 1NJWA 2VONA 3PYDA 1MMLA 2CG8A 2DGOA 3C15A 4PXBA 1HI0P 3MXHP 4J9SA 1T3OA 3L95X 5KFLA 4J9LA 1FEHA 4ECQA 2LXUA 5DG7A 3KG0A 3IMQJ 2XMUA 4F67A 1C0TB 1D8ZA 2IAJB 3DI6A 2KT2A 1MROA 1DTTA 2LVWA 4I1TA 3KKFA 4QWCA 3FBFA 2GMJA 2R8IA 1URRA 2YNHB 1JJCB 2ZNYA 3MR7A 4L73A 4U7CA 4F02A 1WJ9A 1FVQA 4NLOA 1E6VA 4IYQA 1PCAA 1WDTA 2Z56B 4MIWA 1NEEA 1WHYA 1N5SA 2BEFA 3BGLA 4J7CA 4NLPA 5JXSA 3PIPQ 2DPJA 1N5VA 2OFGX 1JLGB 1NJXA 3VAMA 3QMQA 4ERDA 5IV3A 3D9BA 2EXUA 1CQMA 4ZCIA 2RS8A 5B0AA 2BJ7A 3T19A 3HXMA 3DXBA 2J9CA 1IXKA 4DBQA 5ETLA 1WKJA 4C9DA 4I7FA 1N6QA 2FGCA 3R97A 3UE2A 4K7QA 5CABA 1PYOB 4RNMA 2J6SA 2W2QP 5BR8F 2PEHA 1APSA 1WUUA 1HNZF 3IWXA 3ET6A 1VC5A 3ONQA 3RJMB 1EQ0A 3OR2A 4JB8B 2XQCA 2AKWB 4A8WA 2FVCA 4DOZA 2JZ5A 5E3CA 1UVIA 3CJ4A 1J5OA 3MMBB 3CMAS 1IJFB 1ZPVA 1NBEB 1PAEX 2AYEA 3SXLA 2FHKA 2H51B 5C24A 2IYIA 2X3GA 4OX7A 3FK4A 3IAS9 2X1FA 2CZVC 1CS4B 2JLFA 4WFZA 1FWKA 5JUMA 2CNKB 4L6V3 3PYGA 5EDWA 4F2RA 2CWXA 4C8YA 1EJ7L 4M5DA 1GK8A 2WVEA 4ECRA 3DLGA 4I4BA 1TL1B 4C8MA 4CH1A 3VAJA 2CVEA 2JOQA 2B7BB 5HO4A 2J7KA 3G82B 1KTQA 1AZSA 5IQQA 4OI3A 4XAKA 3FBBA 5CYQA 2CFXA 3NRBA 2ZDPA 1EETB 1X4AA 3K17A 1S77D 4E0DA 2HSEB 5CA5A 3OSPA 1S97A 2CZ4A 3CDEA 1MMDA 2IJNA 2ZBQA 1BE4A 3CC7S 2D69A 4O4GA 1DARA 1RWMB 2AJ4A 4ZVSB 2BE2A 4HI1A 3OXFA 3GILA 4DL0C 2IVFB 1L3VA 3MECB 4RW4B 2LDIA 5HP1B 2WVCA 1RJJA 2V8VA 2X1BA 4RUBA 3D5MA 1QAXA 3GIJA 3DDNA 3OUYA 1C1BB 3SCIE 4NLDA 1KTVA 2V6AA 1U8SA 3KJQB 3W60A 3GFZA 2BRLA 2VOOA 1QUPA 2KB2A 5HN0A 3BSAA 3D28A 2KI2A 2VDIA 2M7SA 4Y34A 3MR5A 1WG1A 4J37A 5J2MB 3H40A 5HANA 1VRUB 3TAPA 3CJ0A 1DTTB 3LO3A 3NGDA 1FFSB 2PT0A 2OPRB 4P75A 4F4YA 3BBFA 4KJIA 2NUHA 2KO1A 3L4BC 2VICA 4AQYJ 4TVAB 2NYIA 3MMJA 4DS4A 3TI0A 3Q83A 4ZP7A 4URQU 4USWA 1B0VA 5KFMA 1FKAF 1WKKA 2XBPA 1S49A 2DVIA 1SQGA 4Q0BA 4DSLA 1NJIT 1VC0A 1YRXA 4O23A 5SUHA 5FJ4A 1TV6B 3OBIA 5LSRA 4OFZA 4MIAA 1JNZB 1UL3A 3GSIA 4ZVHA 2A6MA 1VRTA 2W4CA 2K06A 3Q86A 5J2QA 3BR8A 4C8NA 1F60B 5D4PA 3K57A 1ZZNA 2KJVA 3MM8A 4LREA 1HQ2A 2YKMA 3FMWA 1TK0A 2KFNA 4YY3J 1WSVA 2WW8A 4WFNQ 1SC6A 1CULA 1VOMA 3J81U 2VA2A 3KNAA 2LEPA 2OPSB 3GU0A 1REGX 1B0PA 4USUA 3BGRB 3E01B 1VLYA 1TL5A 3PNIA 1KN6A 4NEYA 4ZS6A 4DPXA 4KO0A 2DEJA 1RTIA 3TAQA 3R2DJ 4M5GA 1N32F 1TZ0A 3O2IA 3PFEA 2CJQA 3RU0A 4JI1J 2RSQA 5C25B 2MY7A 1SI9A 1CPZA 4CLPA 3MMAA 2BJ8A 2MY8A 3CCQS 4ZN1A 2UXCJ 1SH0A 2UV8G 2V4JA 2G1HA 1F2HA 1VCTA 1YLXA 2MQOA 1VQNS 1LW0B 4O4GB 5GAEU 4USKA 1ZTTA 4RBUA 2L9NA 3FNNA 1TFWA 2MB0B 3TZXA 2C22A 2IJRA 5F8HA 5EN1A 2YTCA 3AJDA 1FDNA 1TP7A 1VDHA 4FPRA 3TO8A 2F5GA 2DGTA 5K20B 1UEUA 4UOGA 2VOPA 3C6UB 4QYZJ 4HACA 1NK5A 3BREA 3H2UB 2ZC3A 4YDDB 1T9XA 4BBYA 1T05A 3ENAA 2CPEA 4WE1A 2WVBA 3EVMA 4M5HA 2R9LA 5KFJA 1BGXT 1NPRA 5KFKA 2DY9A 2F8EX 2VV5A 3CC2S 4B9NA 1FJ7A 3HD1A 1YJNS 3DLKA 1HWUA 2ZWOA 1R3NA 2V8HA 1RT4A 2B4VA 2MLXA 2NXNA 3MM9B 2DR6A 4DQPA 3GJRB 4LT6A 3KK1B 3MFIA 5D0EA 4CCHA 4OHXA 2XNRA 4J5OA 2RF2B 2BDPA 4M5LA 2V8GA 5IM0B 5T7LB 2HBRB 2ASYA 1V6HA 1FTCA 2W9BA 2BM0A 1HBNA 3DYAA 2FJVA 4K2XA 4CLKA 4F50A 1AFJA 4CO5A 3BJYA 4QPTA 3EWGA 2KXHA 1TMJA 2EPIA 5HMYA 2UUAJ 3UW1A 4H54A 4DV4F 2H4WB 3KWMA 3DXSX 4RU2A 1H72C 3KLIA 1QAYA 2B5JB 1X4DA 2WVDA 3VCDA 2J76E 2YH0A 2RS2A 4ZHRB 3TVYA 1MN9A 2KKHA 2W8LA 4QU6A 1VHIA 4AXIA 2AW0A 4ETXA 3NOGA 3E2EA 2FHJD 1KONA 1Q0NA 1MU2B 4ANDA 2W2PP 4ALZA 4IG0A 4O44A 3PHTA 3MM6B 2V94A 4K4YA 2J5AA 1FA0A 1FCAA 1BQXA 4NA3A 1TL4A 4Z2XA 1FI4A 3CDAA 4U67Q 1UJ6A 1LEOA 1IBMJ 3HULA 2BW2A 2HS4A 1VQYA 1FRLA 4LSZB 1Q1KA 5AE1A 2BE9B 3MAQA 4O3SA 5EWGA 1B7YB 3EM1A 2U1AA 3CGIA 1IR1A 2IC3A 3QIPB 1T95A 2JFDA 4PG5A 4DR3F 2HS0A 4YEAA 3TA0A 2MQPA 5DG8A 1T9VA 3KLVA 4LSNB 2XZWA 4B3TF 4Q2MA 3NMRA 3K5OA 1K0VA 4P71A 5A8KA 1YSJA 1IKYA 4KH0B 4R5PB 3MEEB 1VI7A 1T02A 4DV6J 2XULA 4L72B 1U2CA 2B8QA 3CCSS 4Y2KA 3SMZA 3V6KA 4KTQA 2ZFHA 3N4WA 1NO8A 2HQDA 2BABA 2R7QA 3R7BB 4Q7AA 4DSFA 2HHHJ 4ELVA 1BY9A 1RU2A 4FXDA 1NHKL 1RHKB 4TKTA 4ZPDA 4ED6A 2BV3A 2MJUA 3H59A 1F9HA 1M5OC 4FKYA 1Z2ZA 3J7ZT 1TKDA 3F56A 3G87A 1S1VB 1RT6B 5F8NA 4RBVA 1B7FA 1NB2A 4XPCA 4EBCA 1E6VB 2F9DA 8ATCB 4WK1A 1DY3A 5ETRA 5A2QY 2XCPA 3G71S 2UUBF 4AFFA 3J81j 1DQAA 2HQGA 3BYPA 1HBUA 2ZJPQ 5A2QU 3EUNA 2HZCA 3FBCA 3B82A 3HKWA 3OQ2A 3PJXA 1R6YA 1NKBA 4FF1A 2WRMA 1P8GA 3I9V9 5LMNF 1RLDA 3NBPB 5I3PA 4YR2A 2A6OA 1P1LA 4FNHA 4GVBB 1Q8KA 3HKZD 3KLIB 3QT8A 3C14A 2CPXA 2EG2A 1Y3KA 4RBTA 2GW8A 5HMWA 5IS2A 3JYTA 2XG8A 3Q22A 2IBKA 2I0XA 2HNDA 2PE8A 4DU8A 2ZZNA 1NUEA 2GHVC 4GO7X 4ZPCA 4QR2A 2ZH8A 4ZVFA 2VG5A 2HFUA 3W8GA 3UO0A 4QZVB 4C0HA 3AXKA 4WTYA 4JI8J 1W2IA 1DJ0A 2DISA 5EX3A 3VAFA 2E1CA 3HZGA 1NSQA 5AXNA 1X8DA 3MCSA 2XO7A 1WI6A 1TL1A 9ATCB 5ETSA 4HHJA 4WWSA 4LVNP 4Y28C 3KMSA 1CLFA 2LEAA 5ETKA 2FJWA 4ID8A 2KYXA 4RNFA 1N56A 4NASA 1X4BA 2ZC4A 4JI2F 5HLFB 2W25A 3JS9A 1ZAVA 1T0TV 2DY1A 3AA9A 1C4AA 4CYUA 2ZH9A 3FQLA 1PILA 1YRTA 5A8KB 4EMDA 4GC6A 1TAQA 1UFKA 1CJUA 2FJDB 4NLUA 4OYAA 1XIQA 1UWAA 3M32B 3G96A 2ZUAA 2EEYA 2FZKB 1NLKL 3SFGA 4KC5A 3BDPA 4NLTA 3SCJE 2RE1A 4QYZK 4K4ZA 4KFBA 4F3QA 1L3TA 4P10A 2B8PA 5I42A 5JVGQ 1JLEB 4L75A 1SKUB 3GE9A 3M8ZA 3QGPA 1VQOS 4MKYA 2XSJA 2GMHA 2JX2A 2VPZB 3IGNA 2CZ9A 4BWMA 3HZEA 2W9CB 1JLQA 4NXMF 2C2RA 2MGZA 2G2YA 4KAIA 1RA7A 3W2VB 3R2CJ 1YJVA 3GQCA 2BRKA 2HGMA 1UCNA 2CUYA 3DM2B 3D1QA 4YB6A 2J0QD 4CO1A 1C0UA 4Q0BB 2D9PA 2ASJA 1HPZB 2K1RA 1UWBA 4KT0C 4F7VA 3DLEA 3FCVA 4R8UB 1GEHA 3UWTA 1Y5NB 4NLRA 4KHPJ 4IFVA 1LW2B 4FS2A 1VISA 3CJSA 2AX0A 1HNXJ 4F8RA 3HHDA 4J9MA 1RCOB 4DXLA 2RU3A 3HF5A 3NWRA 3L3CA 2Z2MA 2BQRA 1KBRA 2VHGA 2LKZA 1QTNB 1CJVB 1H74A 3LP0B 2HGNA 2M8DB 4GKKF 3LP0A 1U1KA 1A0OB 4K4TA 1B70B 4KPYA 1K1SA 1Q16B 3CB4A 3M2VB 4LBPA 1Y0HA 4RKUC 1K8AT 5I3UB 3IP0A 1RU1A 4TU7A 3TANA 3DOLA 2DJWA 1PYSB 1E6YA 1U1NA 1SB6A 3BH7B 1AZSB 1KS2A 1MW7A 1XWLA 5KFNA 4A8YA 4JI6J 1N36F 2AZ1A 4YS2A 2W2NP 1C4CA 1FDBA 3R7SB 3ETOA 4DX8H 2DNYA 4C4WA 1WF2A 1GMWA 2XMJA 2Q66A 3VQTA 4RR5A 4KGVB 4NLGA 3QT7A 4WP9A 2IRYA 2R42A 5EWEA 1J27A 2R2UA 1VQ7S 4YB1P 1VQSA 3D7SB 3EVWA 1JLEA 4QIGA 1HKAA 4ZVTB 4ILMA 1BWVA 2DGQA 2JRSA 2Q79A 2V2KA 2ROPA 3EZOA 1EQMA 1REVA 3W5ZA 4DR4F 4UUXA 2R8GA 3PTWA 2PA3A 1BUXA 3WX4A 2J0SD 4FBUA 4EZ6A 1RBOB 3M2RB 1UFLA 4ZIVA 3LTOA 4WTOB 2XGPA 2DEIA 5M2PA 4ED8A 2OH2A 4NXNJ 3HX9A 3A8IA 4TYBA 3IGVA 2D74B 4B9UA 2HHQA 5J1EB 1BXNA 1RWUA 4P7TA 2IM0A 3UNGC 1JLGA 4ECTA 2H3EB 1HW9A 3ENWA 4F26A 1URNA 2HHUA 1LV5A 3VALA 1S1XA 3DLEB 1OQ3A 3AHPA 4P2SA 4R8UA 3G9CA 1SUQB 1YJTA 2YY3A 3DDKA 1JMTA 2KVQE 4CO4A 2L9WA 4P2FA 3RR7A 4LF9F 2H5IB 2ROEA 4DSIA 3DYAB 2MKCA 2B7CB 2FY8A 3CO9A 3KTQA 2Z8QA 1CJVA 1YK9A 3O8WA 3C16B 4USVA 4ZVEA 2R7WA 2RDDA 3KK3A 4ES1A 1P1TA 2AP6A 2VPWB 3VV2B 4DFKA 3IWNC 3ILOA 4RWXA 4DV0J 1AA1B 4I6YA 4E8UA 3BQ1A 1WORA 1V3ZA 4YB5A 1R7IA 1VQLS 5DGAA 1LOUA 1QAIA 4DN9A 3LGMA 3PO5A 2VG6A 3OTEA 5KG0A 3EXCX 3K5NA 3LP1B 5B0EA 2UUCF 1ZETA 4CM2A 1UAWA 2VKZG 3QFHA 2CVIA 1TK5A 3MOZA 1HW8A 3U02A 1T9UA 1YIJS 3CO0P 1X4FA 3D1HA 4GKKJ 4PWWA 2A10A 5IXUA 2UU9F 3I5CA 3OUYB 2IRXA 1GX6A 4DL3A 3BGOP 1YJ9S 1WEYA 2BE2B 2ZBPA 3PG9A 4Q43A 1FEEA 3D6HB 2MZ1A 3FZBA 3MCOA 3J80Y 2IAJA 1UZHA 3QIPA 2IC3B 2OKQA 4WU3A 1OO0B 2DK2A 3IBWA 3R5DA 1Q8BA 2JEFA 5LOQA 2HHSA 2DH9A 3PO4A 3QJJA 3C6UA 4IOBA 2Q6CA 4QWBA 4KE5A 1Q4RA 2NZ4A 4PUOB 1VK3A 2RQKA 4DV4J 4JYAJ 5L9NA 5KFFA 1DLOB 3DU6A 4HH0A 2PFFB 5A8WB 1XMOF 5LJ3Y 4CH0S 5A8WA 4UQTA 4X62J 4FP9A 1ACMB 3D4JA 3NS6A 3HJFA 4DV1J 4PG4A 2K2PA 4JV2A 3LA0A 2APOA 3NLCA 1VQMS 3D6FB 2BE7D 2HPUA 3NNAA 3EDRB 3QYYA 4XIUA 4H4KC 3PW4A 4N77A 2RF2A 1YI2S 1QM9A 3MEKA 3NEKA 1LWCA 1FVSA 1WKLA 5J2QB 3W66A 6AT1B 4TQSA 3RB6A 3OL9A 2UXDJ 1HBMA 2HZVA 3HVAA 1M0SA 3FRZA 3MUTP 3G8SA 2Y8YA 3BS9A 3TR5A 2MQ8A 2PGCA 2DYAA 1RYSA 4NYOA 1S1UB 1IN0A 5ETVA 2DRBA 3CWJA 5J2NB 5HQLA 5B09A 5JJBA 4M8LA 3VVTA 5M2RA 3MM8B 1Q95G 2BYCA 3U7JA 3CD6S 3LPEA 4OJGA 1N5QA 4OV1A 2E5LF 3NS5A 1TFYA 2VODA 1NHUA 2CJAA 2MKIA 1S12A 2N3LA 2X1GA 1WNEA 3L9ZA 1QY7A 4N7TA 2RKIA 4ED4A 1QVFR 4PWDB 2E5HA 4K0KJ 3TW0A 5L38A 1KVIA 2DNMA 4A8QA 2LQ9A 2HRUA 1DQ9A 1JK9B 1W2BR 3H4BA 1RTZA 3C6TA 2HFSA 2HVHA 5FLXY 1U24A 1ZAXA 2V4JB 2HHHF 4N41A 2HNDB 2LQBA 3NGUA 4DL5A 3CJQA 2WVFA 5C25A 4ZPVR 1L5UA 2CAJA 2CQIA 3JAMY 4LIRA 2FQQB 4CLUA 3NKYA 5IC6B 3VVUA 5G0RA 1FDDA 3MECA 4RW4A 5DDRC 4YHHF 1LKZA 3BSNA 1R0AA 2IBOA 3TUPA 4CO3A 5HL7Q 3UD3P 2BR0A 1CJTB 1FXLA 3ISNC 4PUOA 3N5BA 3LP2B 3AA8A 2VDHA 4G1QA 2IJFA 4K8RA 4UUWA 2WZ1A 2VC1A 3BGUA 3OR1B 4PZVA 3AOCA 5KFBA 4DSKA 4KV8B 2V8PA 1NK8A 3AD7C 2Y9HA 1L3SA 4I2PA 2KHCA 2XS2A 4WPAA 5J1NA 2XI3A 5F8MA 4ECZA 4OZ1A 3P8BB 2KM8B 1JKHB 2QMXA 1XMQJ 3THTA 1SJ4P 2XGQA 1TKXB 3QNWB 2L48A 4LBIA 2X1AA 1XNQF 5KOWA 1HBNB 2FVRA 1XN9A 2G2ZA 2NYHA 2R3VA 3V5RA 2VQEJ 2WTFA 4ER8A 2P6SA 1QDUB 2DD8S 4O4RA 2E1AA 1ZAWA 4F25A 2XZTB 2VBWA 4OLPA 2VB6A 2EK6A 1UMJA 2YNFB 2IRUA 3VGVA 1OMSA 4AQYF 2FLLA 2OI2A 3CD7A 3CD0A 3CCJS 2KTQA 2DNPA 1S0OA 1WC3A 3K7RA 3MD3A 1FKPB 3QGHA 4FZVA 5THWA 1FKPA 4Y3CA 4QBUA 1HWLA 2R7TA 1RQ0A 4ZHRA 4ZOSA 3QSYB 3GP9A 2XY6A 4DQIA 2BMBA 3JSRA 5DG9A 1SCJB 3FSYA 3S8SA 2ATLA 3NBPA 3H5UA 7FD1A 2NR0A 3OFGA 4RW6A 1D3WA 2KH9A 4OZLA 4H4OA 5HQMA 1U26A 4ZJLA 3TJ9A 2GZOA 3AB2B 9RUBA 3GYNA 2DR5A 1SKSA 4NLVA 2EFOA 4B08A 1G2EA 3QFWA 1TMMA 4RWWA 3IS9A 2D41A 2HQFA 4U8VA 1RT7B 3KJVB 2FC9A 1NK0A 2OPQA 1OPZA 3Q8SB 2IVYA 4OYWA 1D9AA 4ZJQA 3CCRS 4DV3F 1Q81T 2R7VA 3AJ2A 1SBRA 3DOMA 3M2UB 1JXEA 4WBFA 2WSCC 2W7OA 2HKEA 3GYXB 2G0CA 2G2OA 3BSCA 1H7XA 4NCGB 2HVZA 3SQGA 4RUAA 4AXJA 5KG2A 2EWHA 2G9OA 5AE2A 1VRQC 1GMVA 2OEMA 2VJUA 3MPVA 2ADBA 1MSWD 2CQDA 3NWGA 1S7HA 1XEZA 1Z2LA 1DTQB 2D3O1 4GKJJ 4F4KA 3PXGa 2ZH6A 4R5PA 5CD4A 1T05B 3OJUA 3HHKA 3BBBA 2B9EA 5E3AA 1CBKA 2MTLA 3JTNA 5KFTA 1N33J 1HWKA 2HIQA 1WC4A 2M8HA 5C5JA 3GR0A 1GTHA 3U1NA 1IKVA 3MM9A 4OZJA 2W9AA 2KFZA 2ERRA 2E5GA 2GQ2A 1G7CB 2D3ZA 4OZ5A 3PRVA 4DU7A 2KG1A 1Q7LB 4QWEA 3RB4A 2ZVSA 1BQMA 1A6LA 3CT9A 4BHQA 2P2CB 1IBLF 1Q5VA 2DR8A 5HATA 3M8SA 1OY8A 2RRAA 1NDLA 3FKBA 4LUBA 5D0RA 3UVJB 4X4PA 1PO6A 4DG1B 2C3UA 2Z30B 4DUYF 1OY6A 4LRBA 2QO3A 3IWLA 3DOKA 1RSCA 4RPFA 3HHNB 1TKTB 5KFAA 4C11B 5K14B 2D3OR 3VQSA 4C11A 3PJ9A 1EP4B 4TN2A 2BJEA 2H5EA 1SJRA 1VBKA 4CIOA 2AX1A 4ID5A 4PPDA 3S7RA 1KQKA 1YWXA 4CQ1A 2CWKA 4EI2A 3CPWR 2M4MA 1LFPA 5E3RA 4GVBA 4WU2A 1A7GE 2GX8A 3HO1A 2KVIA 3TARA 1HNIB 2IM2A 3DRRA 1MU2A 4HR2A 4DV7J 4FYXB 2OPPB 5K8PA 4IG0B 1CS4A 1SVDA 3GONA 2BX6A 1FDAA 1OYEA 1T7PA 2PC6A 1K73T 4F3MA 1RT1A 2C42A 3D0GE 3K8WA 3SV4A 5B0CA 2CPHA 2J6TA 2CPZA 2VQFJ 5KFVA 4CO2A 2ASLA 3RAXA 2MXYA 4ATNA 2RILA 2EBEA 3JSBA 3M7VA 2XWXA 3SBMA 1SL0A 1S6QA 4QW8A 5CYJA 4M5MA 3LP1A 1RKJA 2NSCA 4OJ3A 4B3RJ 1BLUA 1FK9A 2LFVA 1FK9B 1HR0J 3A4TA 4UTGA 4C7QA 1U6ZA 2GQCA 2HZAA 5DM6Q 4EU0A 3AD9C 4Y2CA 2ZM6J 3QIDA 2G4BA 4DMZA 5DQIA 2WW4A 4NL5A 2AZ3A 2H5JB 5IFMA 5KFCA 4IDKB 4OZ2A 4ZK7M 2ACMA 3PKMA 3ISND 5AXMA 2ZH4A 2ILYA 2GNKA 2AGPA 3CIZA 4PKDB 1W25A 5H1SV 1CJKB 4OZNA 1MMNA 3ZXWA 4C8OA 5J2MA 2VBZA 2WONA 1FNMA 2GIQA 4DI6A 2MKKA 3IC1A 4GKJF 3BF4A 1GXLA 3CNQP 5C7PA 4ZLPA 2RB7A 4OYMA 4X4RA 1KOOA 1UEVA 4IO1A 2MYFA 4LFAF 2Y0BB 1S4FA 5CZXA 4DQSA 2FY1A 4AUKA 3PYEA 3QO9B 4Z7CA 3HK2A 2AJFE 2M9KA 3RG6A 1UETA 2VUGA 2HEKA 3G2XA 3FFIB 3OTCA 3P49B 1R8CA 2MSSA 1M5HA 4RW9B 1QAJA 4X2BA 1FD2A 1LXJA 1SXLA 2LA4A 2V2QA 4FPIA 3D54A 1FRHA 1M90T 1R89A 2N4CA 5ETTA 5L1LA 1IBKJ 1D9DA 3DGPB 4FF4A 2I8EA 3D0IE 3TUZC 1SPBP 4DL6A 5B0GA 1AFIA 4ZKAA 1HBMB 1Y5LB 2RQMA 1TKZB 2NCKL 1KLMA 1PBAA 1AYEA 4DJBA 3EJMA 3V6HA 2YKMB 3NGTA 2XM3A 1F9FA 1SH3A 3ZZ0A 3VAKA 5HBMA 3B4MA 5HK4A 1NDCA 4MK8A 4WFXA 5ITHA 4DSJA 4WF9Q 1YJUA 1FHTA 1K0TA 1R8BA 1JLAB 5A0YA 2F8MA 4JI7F 1IQZA 3CJKA 2EC0A 2DXFA 2HQIA 2KRBA 2K7KA 3ZTOA 3TNVA 2DTJA 3HT3A 2VG6B 5JMNA 2OFHX 2E7XA 3GIRA 1TVRA 2C3MA 2B51A 3PW7A 3OHAA 3G86A 3N28A 1X4GA 1VFJA 3LANA 2M52A 2UUWA 3BB5A 4IR9A 1E6YB 4C3MA 4Q2LA 3LH2S 2UVVA 2FJAB 4UZBA 4LJMA 3J81Y 2PD1A 2R8JA 3AD8C 4ZIWA 1FF2A 2QLFB 3QQCD 3NMAA 4IQMA 4H4MA 4PCQA 5RUBA 4LF6J 4IDKA 5B0FA 4NZ7A 2LXIA 3L09A 3MAAB 1N54B 3HSDA 4OHVA 3CULA 2FLNA 1HLWA 4NOHA 2ZHAA 2OIHA 2FHJA 4BS2A 2XMKA 1LK7A 4TU9A 2BANA 2VFTA 3H42A 5A8RA 5A8RB 5AJ3J 1G3OA 4QCLA 2FTRA 4JV1A 4JI2J 2UVRA 2C2NA 1U4BA 1X5PA 4OI6A 2YQ0A 3RBDA 4M5JA 2Q43A 2OMLA 3OFEA 1VRUA 2YKNA 1YKWA 3TZZA 4HI2A 2YKNB 3H4DA 2JEGA 1IBMF 3DCAA 3WDOA 2OD4A 1QLNA 1S0VA 1EB0A 2F4VJ 2RQ4A 2GHWA 2DT9A 4R25A 1JLQB 3DHXA 4USIA 1UKUA 1TAUA 1UFWA 2HFNA 3B8HA 3W2VA 4WE1B 1XTZA 4USTA 3RGIA 4C0BA 2CXEA 3GJQB 3KMQA 3SIPB 5H9FJ 3IBFB 1VQ5S 1TR0A 3DKDA 3ENVA 4NWBA 1S6PB 1LWFA 2DNRA 3PY8A 1EHWA 3TOQA 3MPUB 3AFGA 3T5JA 2OO4A 1BMQB 2FGOA 3TAMA 3O44A 2DGVA 2G1DA 3EICA 1S72S 4WP8A 5C2GA 4ZVUB 1ZH5A 1N34F 3CJTA 3IN5A 3MR3A 3HHEA 2B5JA 4XPEA 4C98A 3NNHA 1QE1B 2P8IA 4OI1A 1GH8A 1QE1A 3F73A 4LF8F 3QZ7A 1Q8IA 4LF4J 4HH1A 1TVRB 1IKWA 2I9SA 5J2PB 3DLGB 4OYOA 1IUJA 3P6YC 4OI4A 3CUNA 1JWWA 3KDOA 1BHNA 4ZCMA 3FEXB 1XJWB 3VZHA 4HT5A 2EFPA 2FC8A 4EGLA 1XBWA 4ZVGA 1HQEB 2BJDA 4F0KA 3QATA 4NXMJ 2AJ0A 2JH3A 4RZRA 3EE3A 3M8PB 3A8JA 2NUUG 4OZ0A 2J7WA 3Q2SC 3W5YA 2PEBA 2KFYA 3M4XA 5HVHA 4GMKA 5D78A 1GXUA 2DGUA 3D6TB 3OTOJ 1VMBA 5DJBA 3V4IA 5DLFA 4LF1A 2F63A 2D1CA 2CKWA 2G13A 3DOMB 3OPKA 4YDXA 5HVFA 3SYZA 1XERA 3TX8A 4U7UK 1ELOA 4HEA9 1BQNA 3HHLB 2CQCA 2YBVA 1YX2A 2GIFA 2V8DA 4LF6F 1F3FA 4ED0A 4ZA1A 1YBUA 1KVKA 3VGTA 4CYUB 4HVZA 5DLGA 2WK4A 2YKQA 1UP1A 2COLA 4KKOA 2DGXA 3KLFB 1DZ5A 3NAIA 1X9WA 1RE1B 3S1TA 2K3IA 2ATCB 4DWIA 2W7AA 2MLZA 4CTAA 1Y10A 4LMZA 3M30B 1RT6A 4QJVA 3P4UB 3TVZA 2RUGA 1N52B 4ZVPB 3T5HA 3GJSB 1AUSL 5M2UA 2C2EA 5LMUJ 5LSLA 5IWAF 2OTLS 1O51A 2QE5A 3KYLA 2IDLA 4O0IA 3M9MB 3M9OB 1TQLA 4DV5F 1U1QA 2C2ZB 3M1VA 4ETZA 2ZJRQ 4DL4A 1SKRA 4DG1A 1CC8A 2VD3A 2CDQA 1U2FA 3A1YG 1JB0C 3A3OB 4B3TJ 5IOLA 1X4EA 2V0NA 4A8XA 1T9TA 1N5YA 2LYVA 2B9YA 3F44A 4BC7A 4M95A 2D3UA 2QSWA 2L41A 2V2VA 2MQQA 1HI8A 1TTHB 1SQFA 2BVZA 1FX2A 1GMWD 4LF2A 4OJHA 2N3OA 2I5JA 2E5IA 2EC2A 3V4MA 3PVXA 2B3TB 2AEMA 4CNYA 4NE9C 3DMJB 1VR6A 2ILZA 4DQQA 2FB0A 1LQ9A 5IV4A 2GQQA 3DLHA 4ELUA 2E9RX 3OD2A 3M8RA 2EKNA 3HFZB 3R6GB 4IKAA 4DS5A 5FIIA 1HWJA 1SV5B 3EXYA 4KSEB 5L46A 1OSDA 2A0FB 1NKEA 3DRXA 3KG1A 3I6PA 1VHFA 1I5OB 1O6XA 1C1CA 2JSXA 4KGMA 4QR0A 3QWUA 2R8HA 4A48A 4C0OC 4WCEQ 3Q24A 1JJ2R 3SFUA 1CJTA 4JI5F 1NNDA 3KHGA 3BKTA 1KOHA 4HHHA 3TJAA 4M63A 4G1QB 1U0HB 1FRIA 5D3GB 4XK8C 1U2RA 2Y1LB 4USJC 3KHRA 4IG3A 2Z58B 5IC4B 5GAGU 1IQTA 1F9EB 3QAUA 4B3OA 2CNOB 3OTDA 2LU1A 1N8RT 5CYMB 3RAQA 3GV8B 3OLBA 1D0EA 2D9OA 1BWEA 2CQ0A 3GV7B 2DITA 5IM0A 1YTYA 1C0TA 3CJRA 3NGRA 3NP5A 5MLCV 4J9OA 4C97A 4EO6A 3DRYA 3WC2A 4K2JA 1T3NA 1UW9A 5KAKA 3QGGA 3MM5B 3FEYB 1M1GA 1VBYA 4RW8A 1OYDA 2CRLA 3JB9k 3PR4A 1R27B 4KPCA 2P9CA 4X84A 4A4JA 4MMOA 2PSZA 4FNIA 3T5KA 4OX9F 1PIEA 2E44A 5BJRA 4QOTA 2DRDA 2W9CA 5KT6A 2V2ZA 3V6JA 2UXDF 4I64A 2POKA 5D6GA 4WXWA 1SC3B 3Q8RB 3KLGB 1J5OB 2P5VA 3MMBA 4O0NA 4RX6A 3HSGA 3J7YI 1GQEA 2R2SA 1I51B 2RIJA 3LQVA 4DR2F 1U1OA 4JV5J 2VFVA 3BZQA 5LT5A 2J0XA 3J80U 3TX0A 5I3QA 4IO9Q 5HMXA 3GLJA 1HPZA 2K1RB 3RUBL 4AE5A 4URGA 4DLGA 4ECYA 5AXLA 1WC1A 2V67A 1S7IA 2X3DA 3W2WA 5F8GA 2IPOB 3FDSA 4M5DB 4A8MP 2XTJP 2QLJB 4HDGA 4Y00A 4Z37A 1U7LA 2I5JB 3I31A 3FZ2A 4O3NA 3J7Z5 3PV8A 1QSYA 3EDQB 4WIQA 2LQJA 5CCMA 1EZZB 1FRKA 2GFFA 2NREA 4PG8A 2OJ3A 2YH1A 4RJVA 2MZJA 2Y1JA 4LSNA 4Q8FA 5A76A 1UVNA 2F1FA 4TY9A 4NPOA 2A1BA 2YX1A 3MM7B 1Q53A 3CD5A 3ILJA 3K5LA 4ECWA 1M5VC 1S59A 4Q8EA 3MEDA 1C1CB 1S57A 2MZQA 4I56A 4P6QA 4UOFA 1HQUA 3LALA 4DV0F 4YFUA 5K9FA 2V4QA 3I96A 5CYMA 3H5SA 3UR0A 1RUSA 4RNOA 1RT5B 1B99A 1RAOA 1UTAA 1UVMA 2UUCJ 3P5TL 1HIYA 2QL7B 1JJHA 2RMLA 2LP4A 4GRSA 1X9MA 1B64A 1NPPA 4DZDA 3AQOA 3CSKA 3TP2A 1RYRA 3JSMA 2E1RA 3CCUS 2EBGA 2XNQA 2B4UA 2QRRA 4JBCA 2V68A 4PABA 1SJ1A 4RW8B 2BXJA 4QR1A 1NJYA 1RWKB 2ALZA 3U1MA 1NHVA 2HYIB 2Q1LA 3D2WA 4W4MA 3RYLA 5KFYA 2AD9A 2FDNA 2QJ3A 4LF7J 2HVEA 4NZ6A 4JI6F 2MKYA 1YQHA 3BDEA 1RTJB 3CJ3A 4ILLA 2RH3A 2UVUA 3OXGA 3QLHA 2ZEJA 1KP6A 2DNLA 2DXDA 4NI2A 4QIEA 3SI8A 1HNIA 1AW0A 2KXFA 1V5VA 3UDCA 3UN3A 5KG5A 3GIIA 4AT1B 3RB3A 4IRKA 5GAGI 2QFJA 4NRTA 2X7IA 4MH8A 1LW2A 1CULB 3H20A 2JDJA 2MQLA 4RUHA 1EKSA 4PWUA 3DGVA 3LUYA 1ITPA 1JXVA 2O1PA 1SIWB 4C6AA 5AE3A 3IRXB 1FRXA 2PIIA 1VQ6S 4IOCQ 4RNNA 1K44A 1CG2A 3CF5Q 1H0HB 4X4QA 4NMXA 4DN0A 4ES3A 2NLWA 2HS3A 2OPSA 2VU5A 2R7RA 1VIOA 3JSYA 4CDIA 1ZOTA 1NZ8A 1PJ7A 2CPIA 3MMAB 4QU7A 1RTIB 3ZZUA 3N01A 3W65A 4DFPA 3H5XA 1WI8A 1Y9OA 2OUGA 3R3TA 1I3OB 3H0PA 5GADI 1DQ8A 1FFGB 1RWPB 2ZBRA 4HDHA 4J9VA 2J9DE 4DF8A 1IWAA 3AB4B 4V19X 2QV6A 2ALYB 3HP6A 1XNRJ 4Q44A 1XR6A 3PACA 1YBAA 4DR4J 1HD1A 2OTJS 2WONB 4DX6A 5E33A 5EWFA 3PW5A 3KUHA 3M8QA 1YZ6A 1R0BG 2CJXB 2R4FA 1HHTP 4LF9J 1WD6A 2BQUA 2E29A 4LSLA 3GYGA 2YNIA 3VHQA 2HNZB 3CE8A 1RISA 2Y1RI 3BKFA 3N6LA 4DPYA 3TZYA 4NCBA 3HVTA 1S9GA 1TUVA 1BQNB 2P9EA 3HHLA 4MJKA 1XC9A 1UPPA 2DXEA 3MURP 1TL3B 3IR7B 4PAAA 3HJVA 2ZNZA 1PAUB 4KKOB 2OELA 3EMTA 4ZLNA 5KG7A 3RTVA 4JI3F 2ZVIA 2ZHBA 3JQJA 3K8VA 2IA0A 2N7YA 4G65A 1Y11A 2E7VA 2QGFB 4WJBA 2LQ5A 3UCUP 3SV3A 1RT4B 4IOAQ 1EP4A 3ADAC 1TUWA 3O5TB 1GX5A 2K7JA 4JI4J 4RO0A 4CLZA 5MAOA 1RHUB 1ZM3A 2XMVA 4PG6A 3TAMB 4Y2MA 3LW5C 4HHUA 4EZ9A 3HPOA 1NK4A 1NK9A 2WSFC 4B9VA 1IM6A 3TUIC 3TWZA 3CDBA 4XDCA 3OFHA 5C24B 4G1PA 4DDFA 3NS7B 4WP3A 4U95A 4ED1A 1VQ9S 1N33F 4LFBJ 2GO9A 3QZ8A 2HRYA 4EBDA 2O5DA 5LSOA 1RWVB 4M94A 3LPYA 2BKNA 1Q82T 4B3MJ 3W3SA 2DNHA 3FCWA 2AF6A 2XO6A 1SL1A 3D68A 3ZNUA 2VQEF 2ABYA 3R5AA 1RHJB 4BLGA 4UOCA 4C8LA 5U47A 4KO0B 1CSJA 3QBCA 3AT1B 1FE4A 2LDYA 4DR6J 2PI5A 1JLFB 3X1LB 5D77A 1CEZA 4A47A 3KLHA 2D7SA 5KFDA 3I5AA 3PFOA 1RA6A 3H8YA 3D3CJ 4MT1A 4MKVA 4DV1F 4DV2F 1H3DA 2NSBA 1J5EJ 3MUMP 1KQSR 2EW9A 1HWIA 1NPKA 4NX9A 3G4SS 3DHWC 4LBHA 3ZTQA 2FLPA 2IYGA 5HQ8A 4EBEA 4ED2A 5BYRA 2O01C 1N4LA 4OL8A 3W61A 4TLRA 3A3NB 5HROA 1HBOB 3KG4A 4QYRA 1FKOA 3HVWA 4ES2A 1V3RA 1PSDA 2H9ZA 4N47A 4YB7A 4TNOA 1RAJA 2HIYA 1LW0A 2VF3A 4BDPA 1SV5A 1S1TA 3WX8A 1NCLA 1LFWA 4IH7A 5B08A 4JYAF 5DRKA 3TQ1A 3UPFA 2XS5A 1KVJA 1RHMB 3OR1A 3OVAA 4DV7F 4ED3A 1RAGB 4FYWB 2M88A 4XTTA 1UA1A 1WTBA 3MDFA 3C3LA 2OAUA 1F6TA 2JNJA 3L7OA 3SCKE 5KT5A 5HSPA 5BYQA 1R8HA 2ZH5A 1Z1ZA 4O3RA 4IFYB 1S5ZA 2RHQB 5CH7B 4KYZA 5CCLA 1MG7A 2E1MC 2KU7A 1U0SA 3MF5A 4N56A 4QWDA 1I6JA 1G1XA 4TYAA 1RAIB 1YJ7A 2QA4G 1Q7YT 1RB0A 1V5IB 1GXTA 2WOMB 1SJ3P 3DLJA 4RW9A 1FE0A 4NLYA 5KFXA 2GJIA 4Z7YA 2ASDA 4LQ9A 1Y5IB 3BO3A 4KGZB 1KLNA 2WSEC 5IT9U 4L74A 1P6TA 1FXRA 4OYIA 2JVRA 3H2LA 3CDUA 5LL6d 4DQRA 3W9JA 5KFOA 1OY9A 3IAM9 3IBCB
chains in the Genus database with same CATH topology
3RBEA 3IR6B 3M6UA 4J9RA 4MYUA 2MKHA 4PG7A 2ZM6F 1Z4UA 2DNKA 1OS5A 2ZKUA 3PEJA 3KLEB 1VRTB 2XMMA 3ENQA 4Y2AA 4IQXA 2JFKA 5KT3A 4ILRA 5KTQA 1SH2A 1HYSB 4WIIA 1VQ4S 3CJKB 1Q86T 2F8HA 3FEZA 3WZ0A 4K4XA 1T94A 2YWKA 1P9QC 1UJ4A 3D1OA 3BO4A 2C3PA 1GAOA 3FSIA 1HQEA 1SQEA 2AYBA 3IO1A 1VBXA 4MFBB 3M8PA 1XK8A 4Y65A 2GHPA 5C42A 2YNGA 2YNGB 3BEGB 2B43A 3KOAA 2FJBB 4USHA 3HHLC 1BD6A 2AWZA 4K0KF 5CZVA 4RUCA 1YG0A 2VPYB 5FDLB 2WHOA 3FRYA 3DRSB 3FCHA 1Y4ZB 1SJFA 1FJGF 2HWIA 2YWHA 2AQ4A 2U2FA 3BQ2A 2GGPB 3V81B 2VL1A 4DR6F 3TRGA 2C2DA 3IXQA 2MDAA 2RVJA 2KZZA 3V4IB 4X66F 4EEYA 5HLFA 4I0WA 1QUVA 1S99A 5DDPC 3MR2A 4OJ1A 3FSXA 4EO8A 2HFOA 1WG4A 2HNYA 4FXVA 4ED7A 2DB1A 2AV5A 4JI0F 1KFSA 1HQUB 3POTB 3QJLA 2VQFF 4FXWA 2XB2D 1IKVB 1R31A 1YJWS 2HG4A 3I0RB 1P27B 2HMIA 1V3SA 2CPJA 4HYKA 4BCAA 5B7WA 1KEKA 1RDRA 2RRBA 1WELA 2CJBA 1DHMA 4A8OA 3QWPA 1MROB 5KT4A 1IKXA 3PRBA 1GT8A 2QZ8A 1S1VA 3M6XA 1X5TA 2MPUA 1ZM9A 2GV1A 2B9WA 4JUZA 4DL7A 3CDWA 1QJHA 5DM7Q 1HNVA 4LQ3A 1HNVB 3M6WA 5F3ZA 1X0FA 5D8HB 4WYLA 5F9NA 1U45A 2I2YA 2WB4A 3E3XA 4DLEA 1IKWB 2RKIB 4OMFG 1JLBB 3CCVS 1AUDA 2WBMA 4G1IA 4O44B 3CEDA 3ZZTA 3C2PA 3OSNA 5DQGA 5E7OB 5KFZA 4NYZA 3SDEA 4ID5B 5GAEI 1RT1B 1JLAA 3ZC4A 1ZYQA 1FT8A 3MZIA 3NCRA 4ZP6A 4RU9A 1FJEB 3U1LA 1S48A 4A8FA 2ZD1A 2VASA 3BQ0A 3M6VA 2VBXA 1X4HA 4FYDA 2DHSA 4PQAA 3NL0A 4LF5F 3TYTA 1T03B 3IA0A 3KK2A 2ZDOA 3KNGA 3KK2B 1ULRA 4RW7A 4K4WA 4L3NA 1OQ6A 4RW7B 3CCTA 5I3QA 3GB0A 1EETA 4I68A 2R2TA 5FD1A 4LF7F 3UDLA 2IMWP 4I2PB 4OX6A 3EZUA 4C3KA 5DDQC 4CI0B 3AQPA 5CD4H 2DCLA 3R1LA 2J6UA 1Y00A 2PO4A 1X0PA 2MQMA 2DHGA 1O5JA 2PDAA 1XMBA 1TKXA 3J7YU 3H25A 1ROFA 4F4WA 1XR5A 3M2RA 4LVOP 5I42B 2YNHA 3CXCR 4X65F 2QIFA 1S79A 4ECUA 1F2GA 3OL6A 4F3OA 3RAMA 3HVTB 1UVKA 2B56A 4NMLA 5GAHI 4KHMA 4DF4A 3SEOA 4X4UA 2DH8A 4AYBD 1RTHB 4B3SF 3MAHA 1S10A 3OTOF 1JLCA 2CPYA 1FTRA 2K8GA 3M1VB