1JLCB

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with pett-2
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
427
structure length
402
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT A-chain
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 110
structure length 402
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlcB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcB04
2FLLA 3LP2A 3M9NB 3KK2A 3Q8RB 4YR3A 3FRZA 2YNFB 4JV0A 3T5KA 5J2QA 3NAIA 2BR0A 2FJXA 1GX5A 1XR7A 3H2LA 5KFXA 3RB0A 5KFAA 4ED7A 2OPSB 4WXOA 3QIPB 2UVVA 2W9CA 3KLHA 3KK1A 2JC0A 3JYTA 5KFEA 1S97A 3HVTB 2HWIA 3Q8SB 1RT2B 4B3OA 5KG6A 3M8PB 1HMVB 1LWFB 4EBEA 4NCGB 1JLBA 2I5JB 3PW4A 3T1AA 3QGGA 1T03A 1LWEB 3ITHB 2BRLA 3BREA 4DL5A 2AGPA 3QLHB 4F4ZA 3PHEA 2W8KA 4ECZA 1R0AB 4QW8A 1S10A 2QV6A 3DOLA 1IKXA 3CO9A 4TYAA 5KG0A 4PQUA 1TL1A 4LQ9A 1TP7A 2XCPA 2IAJA 4TXSA 5KFCA 3N6LA 2FVPA 4DL2A 1S9EA 3CWJA 4F4WA 3IN5A 2ZE2B 5DG9A 2FVCA 1RA6A 4ECTA 2XI3A 3H5UA 1JLQA 4NYZA 2B6AA 1KHVA 3NGDA 4WE1B 4EYHB 5I42A 4IRKA 3Q8QB 2C2RA 4J9OA 4K50A 2FVRA 5KFZA 4XPEA 5HLFB 4RW6B 3BR9A 5KFDA 4ZP8A 3BGRA 3NKYA 1OS5A 1SH3A 4O3QA 1BQMB 1RT3B 4FS1A 5KG1A 1RT7B 5I3UB 4I7FA 3N6NA 1SUQA 5KFPA 2AQ4A 1C2PA 1UWBB 3RB3A 2UVUA 4YR0A 3G6XA 1JX4A 3MTKA 1S1TB 4KHRA 4RW4B 4ZP7A 3NMAA 4KFBA 4MIBA 4IDKB 5J2MB 3T5LA 2B43A 2WOMA 4ECSA 3KK2B 1TKZA 4JV2A 4O3SA 1TL3B 1XR6A 4NLYA 4ID5B 5HROA 1RT1A 4RW9B 1ZETA 1S1UB 1T3NA 4F4YA 1DLOA 3KLHB 3KK1B 3JYTB 3QZ7A 2JC1A 3MR5A 1JKHB 5DG7A 3KLGB 4B3OB 3MR2A 2J6TA 2OPPB 1ZTWA 1NHUA 1RTHA 5KG3A 1QAJA 4DG1B 5HP1B 1D0EA 1D1UA 2F8EX 4MK9A 5KFUA 1LW2B 5C25A 4J9PA 2IM1A 1MU2B 4R5PA 1T03B 5F8IA 3CJ2A 5KFRA 3DM2B 5KT4A 4ZHRB 2FJWA 4ZPAA 3KLFA 4YP3A 3M8QA 3MEGB 4H4OB 5J2PB 2CJQA 2AGQA 1N48A 4PWDB 4NLTA 3EZUA 1C1BA 2ASDA 3CJ0A 2VA2A 4K4XA 1HPZA 3LANA 2YNFA 4HKQA 3UDLA 4PUOA 4IH6A 5KG4A 4RNNA 3GV5B 3QIPA 2XGPA 4QWDA 2VG5A 3KNAA 1QUVA 2IA6A 1RT2A 3NBPB 3M8PA 1HMVA 2I5JA 3UQSA 1IKYA 1RT5B 4XO0A 2ATLA 4ECUA 4LSLB 1DTQA 3FQLA 4ED0A 1TKTB 2HNYA 4ICLB 3I5BA 3H40A 4J9RA 4Y2AA 3PVXA 2R8KA 1R0AA 1EP4B 3DLKB 2DPIA 4DL7A 3IG1B 4ED1A 1MMLA 4EBCA 5DLGA 4MH8A 2UVWA 4O3NA 3BJYA 5DQIA 4RNOA 2XI2A 3GV7B 2UVRA 2D3ZA 3V6HA 3V6DA 5DLFA 1BQNB 4KFBB 3OL8A 4JUZA 5DQGA 2WOMB 5KFBA 1JXLA 1N56A 2J6UA 1RT6A 1TKZB 1T05B 2IJNA 3MECB 3H4BA 3G6VA 5C42A 4KAIA 2IM0A 5HROB 5KFOA 3IGNA 3QYYA 4TQRA 4NLDA 2HNZB 3ISND 1N5YB 1BQMA 3BQ1A 3H5YA 4M95A 4Y3CA 4GC6A 1RT3A 3E51A 4ED8A 1RT7A 3RBDA 5I3UA 3TVKA 2R8JA 4NLQA 1RTDB 4I2QB 4R5PB 3E01B 3CJ5A 4KB7A 2C2DA 1UWBA 2IC3B 3LP0B 4WFZA 3KLFB 3V4IA 2R8IA 4RW4A 3BQ2A 5FDLA 5J1EB 4KV8A 4IDKA 1JLEB 5J2MA 3N6MA 5KFQA 4WZMA 4IR1A 1HPZB 3V81A 1TL3A 1S1XA 4PUOB 4NLVA 4ID5A 5L1KA 4X2BA 4RW9A 1S1UA 3DMJB 1HARA 1JIHA 4Q44A 2OPQB 5D3GA 3SFUA 2VG5B 3M9OB 1JKHA 4IFVB 3MF5A 4LSNB 3KLGA 2D7SA 2HAIA 5KFGA 3KOAA 2OPPA 2V4QA 5JUMA 1C0TB 4R0EA 4DG1A 1NHVA 5HP1A 3HVAA 4K4ZA 1LW2A 1IKYB 3ISNC 1MU2A 3FDSA 2HNDB 3QGHA 1DTQB 3DM2A 3DRSB 4ZHRA 1S4FA 2HNYB 2WONB 4OL8A 3MEGA 3DRRB 4H4OA 5J2PA 3H5SA 5EWEA 5CYQA 4PWDA 1VRUA 1TQLA 3GYNA 4FS2A 3BSOA 4O44A 1K1SA 1LW0B 5T14A 4O3PA 2HMIA 2E9TA 3DOKB 3NL0A 4ED6A 3V6DB 4DL4A 1I6JA 1RT6B 5C42B 4QWCA 3NBPA 3RAXA 1FK9B 5L1LA 3DRPA 1RT5A 4RW8B 4EYIB 1KLMA 4ECYA 3RBEA 1JLGB 2V0NA 4KO0A 4LSLA 1RAJA 2AWZA 5KT3A 3G6YA 1FKOB 4ECXA 4J9QA 2C2EA 1TKTA 4TYBA 4ICLA 4FBUA 4KBIA 1EP4A 3DLKA 2C22A 3IG1A 3PR5B 4K4YA 2AU0A 5J2NB 3V4IB 4WYWA 2W9BB 4IH5A 2JEGA 4DEZA 1QAIA 5FDLB 1BQNA 5KFYA 4KV8B 4ZVHA 4KSEB 1S6QB 5KFIA 3KHRA 3V81B 1T05A 3FSIA 3MECA 2JLEA 3KMSA 2JEJA 3FQKA 1S1XB 4F50A 1ZTTA 2WCXA 2R2SA 3PW2A 4J9SA 1JLCB 3CJ3A 5KFHA 3T19A 3KLIB 1S1WB 5D3GB 2HNZA 1N5YA 2J6SA 4NLSA 4M94A 4IOBA 3LAKA 1Z4UA 1JLFB 5KFFA 3UR0A 3MEDB 4I2QA 1RTDA 3E01A 4R8UB 2XGQA 2R8HA 1S49A 2BQUA 4JV1A 3VQSA 2IC3A 2W7OA 3LP0A 3GIKA 5L1IA 4K4SA 4H54A 1FKPA 5J1EA 5CYQB 5F9NA 1VRUB 1JLEA 1GX6A 4J9NA 2IBKA 2AGOA 2RDJA 4O44B 5HBMA 4O3RA 3IS9A 4IG3A 2YNGB 5C24B 2R2RA 2HMIB 5JXSA 5F8LA 5EDWA 3LP1B 3OL6A 3DMJA 3ICLA 4IR9A 1SH0A 2OPQA 4ZP9A 3HVWA 5F8GA 4RNMA 3V6JA 1WNEA 4IFVA 5KFVA 4LSNA 2GC8A 3Q8PB 3GILA 3T5HA 2C28A 3FFIB 1C0TA 4K4WA 3I5CA 1TKXB 3DRPB 4ECWA 1KLMB 5KFSA 3GIJA 1S0OA 2HNDA 4KO0B 4DL6A 3PZPA 3DRSA 3QZ8A 4ECQA 2WONA 3PR4A 2ZD1A 4YR2A 3DRRA 3GIMA 3H59A 4WYLA 2XWYA 4EO6A 1REVA 1LW0A 1VRTB 3KMQA 4TQSA 4IH7A 1C1CA 2RKIB 1W25A 4Q43A 4MFBB 3KK3A 3DOKA 2XC9A 4G1QB 3KHLA 3G86A 2VG7B 1DTTB 4YMEA 4LQ3A 3M9MB 2IJFA 3PW0A 2FLNA 1T94A 4K4TA 1JLAA 2YKMB 2WK4A 3OLBA 2ASJA 3KLVA 4EO8A 2JEFA 1FK9A 2V4RA 3DYAB 1S0NA 4RW8A 3KJVB 1JLGA 4Q45A 1IKVA 1FKOA 2WRMA 5KFMA 5L1JA 2I1RA 2ALZA 3LAMA 4EEYA 1EETB 3BSCA 2QE5A 1KHWA 1N6QA 3OL7A 2VG6A 3T5JA 2RF2B 3NAHA 2EC0A 1RDRA 1CSJA 4J9KA 5J2NA 3QIDA 2W9BA 1FKPB 2AX1A 1YVFA 2YKNA 5C5JA 3IGVA 3C6UB 5F8HA 4O4GB 2ILYA 4U7CA 5EWGA 3EPIA 1HQEB 1U09A 1S6QA 4MK8A 5KG7A 3BSAA 3D28A 5HBMB 4XPCA 4NLWA 3IS9B 4IG3B 3PJWA 4Y2CA 5KFNA 3OSNA 4K4VA 1RTJB 1JLCA 2IM3A 2W7PA 3KLIA 5KT7A 3GQCA 2BANA 4O3OA 1HQUB 1S1WA 4WXWA 2BQ3A 3CDWA 4QWEA 5KT5A 2ZKUA 2YNHA 1S6PA 3UPFA 2YNIA 4ED3A 4Q0BB 3H4DA 1JLFA 3MEDA 4IFYB 4R8UA 2ILZA 4Y34A 3IRXB 3OHAA 2E9ZA 3DLEA 4NLUA 3CDEA 3I0SB 4TY8B 3MFHA 1S1VB 1N4LA 2ZD1B 4H4MB 4RNFA 5KT2A 1SV5B 4TY9A 3CIZA 1IM4A 4RU9A 3C6TB 4K4UA 1REVB 1RT4A 4WFYA 1C1CB 2YNGA 5C24A 4ZVGA 5EWFA 3KK3B 5KFTA 4EBDA 3LP1A 1TV6B 1QE1B 5KFJA 3MR6A 1RTIB 3QO9B 4IQXA 4URGA 1JLAB 3FFIA 4NLPA 4MKBA 1HNIA 1TKXA 2HWHA 5K14A 2XCAA 1IKVB 3V6KA 3DI6B 2VA3A 3H98A 4O4RA 4MKAA 3PW5A 3KLEB 5KFWA 4QPXA 1N6QB 3BSNA 4J9MA 4QWAA 2VG6B 1VRTA 2RKIA 4NLRA 3RAQA 4MFBA 3SI8A 5KFKA 2YKNB 4G1QA 3I0RB 2VG7A 2O5DA 1DTTA 3HKWA 1LWCA 2YKMA 1J5OB 5DGBA 4WZQA 2IM2A 2FLPA 2FVQA 4RUAA 3DYAA 1HNVB 4KKOB 1C0UA 2UUWA 2BANB 2WB4A 4KE5A 2BE2A 2OPRA 3KJVA 4ZP6A 4G3IA 1S9GA 3MEEA 1RYSA 2YNHB 3DLGA 1S6PB 2RDIA 5L9XA 2YNIB 1IKWB 3JSMA 1HYSB 4ZPCA 5EUHA 4DL3A 4IG0A 1EETA 4I2PB 4IKAA 5CYMA 3CDUA 4IRCA 5F8MA 2W8LA 4ECVA 2RF2A 4NRUA 3DLEB 4RW7A 4MIAA 3LALA 2FJVA 2B5JA 4URSA 2R8GA 3C6UA 1K1QA 4O4GA 2D3UA 4ZMMA 3LP2B 1HQEA 2BQRA 1S0MA 1RT4B 5J2QB 4RZRA 4J9LA 1RTJA 2DPJA 3D5MA 2W9CB 4HYKA 5KG5A 3CJ4A 1HQUA 4ECRA 1JLBB 1S9FA 2JEIA 1TVRA 1HNIB 4Q0BA 4TLRA 3KHHA 5K14B 4IFYA 3TAMA 5KFLA 3RB6A 3IRXA 3MR3A 3QGIA 2CKWA 4RNHA 4YQWA 1RYRA 3I0SA 4TY8A 1S1VA 5KG2A 4ZPDA 4H4MA 1SV5A 3DOLB 2V9WA 1IKXB 3H5XA 1SH2A 3PJXA 3C6TA 4PQUB 1TL1B 4ZVFA 2IAJB 4URQU 3RB4A 4QWBA 2OPSA 3HHKA 4NZ0A 1TV6A 1S9EB 1QE1A 3HVTA 2BRKA 1JLQB 1RTIA 2UUTA 1LWCB 3QO9A 2B6AB 3GIIA 2E9RX 4U6PA 1LWFA 5I42B 4NCGA 4NLXA 4F4XA 4GC7A 3TQ1A 4QW9A 1C0UB 3OSPA 1LWEA 2BE2B 2OPRB 3ITHA 3BGRB 2R2TA 2AX0A 3GV8B 4Q8EA 1S9GB 3MEEB 3DI6A 3QLHA 3DLGB 5DQHA 4I7FB 3JSMB 1SUQB 3KLEA 4IG0B 2R2UA 5F9LA 5CYMB 4NLOA 3OL9A 2WTFA 4RW7B 2ASLA 2IMWP 2B5JB 3I5AA 5F8NA 3DDKA 1S48A 2GIRA 2FVSA 4TN2A 3I0RA 2ZE2A 3EPGA 3SFGA 5KT6A 4RUCA 2OH2A 2GIQA 4ZPBA 5DG8A 4WE1A 1RT1B 1J5OA 4KHMA 1RA7A 3OLAA 1DLOB 3CVKA 1HNVA 4KKOA 4RW6A 5HLFA 3PW7A 4NLGA 3KHGA 5DGAA 4FBTA 1RTHB 2D41A 4NRTA 1NNDA 2W9AA 1TVRB 1IKWA 5C25B 1HYSA 5F8JA 4MK7A 3TAMB 4I2PA 2WHOA 3BQ0A 1XR5A 4WFXA 4ZVEA 3MFIA 4ED2A 4Q8FA 1S1TA 3M8QB 3OHBA 4IRDA 1C1BB
chains in the Genus database with same CATH superfamily
4Q5VA 2LP4A 5J2QA 1UPPA 3OFHA 4WXOA 5J1PA 2JC0A 1A6LA 3THPA 3HSDA 3Q8SB 1UEVA 1JLBA 2P2CB 2K7KA 2GVZA 3QGGA 2R42A 2AGPA 1DHMA 1IR1A 4F8RA 3Q83A 2AKWB 2LQBA 1FKAF 1S10A 1KRPA 2HHWA 1YBTA 3WZ0A 5EGYA 3IN5A 2FVCA 1KKHA 4EYHB 2KFNA 2FLOA 1IBKF 1SH3A 4JI5F 4DV7F 2AQ4A 2COLA 1Y4ZB 4KHRA 3NP5A 3RRHA 1V3ZA 1XNRF 5E2QA 1TKZA 4ZIWA 3ILJA 1YGYA 3AJDA 1VQYA 1J5EF 4M5DB 1QAJA 1D0EA 3KLFA 2YWEA 1CBKA 1GXLA 4EU0A 2IFXA 4QWDA 2QSWA 2XLKA 3F56A 2IA6A 4A4JA 3DHXA 3T1YF 4NA3A 3CMQA 3M6VA 1NKCA 2KKHA 5HMZA 3CO0P 3W8PA 1OSDA 4CYUB 2HVHA 4CRJA 5AXLA 3UI3A 4NL5A 2VHGA 2BDPA 3DFEA 2E5LF 4WK3A 4M5MA 2A10A 5B7WA 1SC4B 3V4IA 1VIOA 3ZNUA 3X3UA 2V2VA 4RUBA 5RUBA 3MM8A 4CM2A 1FA0A 4R0EA 1BY9A 4P7VA 2JL9A 5GAEI 3IFEA 3BV8A 3FSYA 3TZYA 2Q3PA 4O44A 2E7VA 2WAQD 4A46A 4X4PA 1HR0F 1FDNA 4LIRA 3S8SA 5D4NA 1MG7A 3AOBA 1KLMA 3GR1A 4GO5X 4KBIA 3CE8A 2ZZNA 3SSSA 4PG7A 2W9BB 1D9AA 4Y28C 4ZVHA 3V81B 1KNZA 2E5GA 1ZTTA 2DR7A 2JZ5A 1U6ZA 3R5JB 2UV8G 4DR3F 4UOGA 1RTDA 2HK2A 3E01A 4QYZK 1YDLA 2XULA 4Y65A 1JLEA 2VFRA 3HSGA 1FJCA 4O3RA 3IS9A 2HMIB 4IR9A 3PYFA 4ZPVR 3K89A 1SJFA 4A8OA 4I68A 4F04B 1SC1B 3W65A 4C0OC 1LW0A 4IH7A 1TK5A 1FFGB 1T94A 1YX2A 3QFHA 3M8YA 2GGPB 3HHLA 2IVFB 1JLGA 3VV2B 3QSIA 1FRKA 2E1CA 3TVZA 2AX1A 2YKNA 3C6UB 2HBRB 2BKPA 1CJTB 1ZM2A 4USMA 2EPIA 1Q8IA 2CQPA 2VJVA 1JJCB 4YOEA 4O3OA 1PJ7A 3BPDA 4WCEQ 3MTJA 3GMGA 1S1VB 1VQLS 1NDLA 4FDFA 4LF1A 4DPYA 4K4UA 1RT4A 5HL7Q 5EWFA 1TV6B 5AJ3F 3OQ2A 3MR6A 3ZTOA 2NUHA 2QX0A 2GS8A 3V6KA 2X1BA 4F26A 2RSQA 3AJ1A 3JTOA 4A8QA 2OSQA 2CDQA 4CO0A 2N3LA 3ILLA 4QOTA 1OPZA 4OLPA 4N47A 3ZZ0A 5DETA 2KI2A 3BBBA 1IKWB 2DO0A 1IVZA 1UFKA 4URSA 2LDYA 4WIQA 4O4GA 1NBEB 4HH1A 2PD1A 4DX5A 2PFFB 1TVRA 2MDAA 5CQGA 3MAAB 5D0HA 4ZPDA 5B0BA 4G1PA 2J9CA 2X51A 4UOFA 2B6AB 1RQ0A 4I6WA 3OSPA 4Q8EA 3VGTA 2E1MC 2FHJA 4I7FB 3JSMB 2CPHA 4DV2F 4DUZF 2HHXA 2VBXA 1U02A 4JI4F 5DG8A 1RT1B 1J5OA 4M5IA 3C15B 2IHR1 4DR5F 3SZ2A 1XR5A 2D3O1 4HVZA 4JI3J 3M8QB 4LSZB 2MZ1A 1AZSA 4ED7A 2CPFA 4WP3A 3KLHA 3JYTA 1ZBTA 2XMVA 3VAFA 3K8WA 3EYZA 2UP1A 4F3MA 3A12A 3HXMA 2G0JA 2XO7A 2DR5A 4FZVA 1TMJA 2XCPA 4DR6J 2FZKB 4FN5A 1K9MT 5M2UA 2C2RA 4K50A 5LMNJ 2V67A 3UCZP 4C7QA 5LSRA 3OUYB 3D0HE 1C2PA 1WOOA 1XR6A 4RWXA 1CQMA 2Z57B 2HGLA 2JC1A 3KLGB 1NHUA 5F8IA 3AH6A 1S79A 4YN3B 2FQQB 3EZUA 4HKQA 4DN9A 4JI6F 2BJ8A 3UR3C 1RT2A 4RBTA 3MOJB 1AUDA 4LSLB 4X66F 1U24A 3DLKB 1MMLA 2AEJA 1X5OA 4P7TA 3G2XA 4M1KA 5HROB 3KG1A 1GMUA 2YQ3A 1BQMA 2MY7A 3H5YA 4Y3CA 2VOOA 3CJ5A 1UVLA 2G2ZA 2C3MA 1X4CA 5DZ6A 5C2CA 3R27A 4JV5J 4KV8A 4IQMA 5ADZA 5L1KA 4ID5A 4DQIA 4F25A 3K8VA 1R31A 3TAPA 2GA7A 5A0YB 1XNQF 4DG1A 3A3PB 3PKYA 4P75A 2CG8A 3FCWA 1RHKB 3MEGA 1KS2A 4W98A 4ED6A 5A76A 5K8PA 3KUGA 2YWGA 1RT5A 2VBYA 1X9WA 2AWZA 3VAGA 4PXEA 1AA1B 4UF4A 3BN7A 2KHDA 3UD5A 2C2MB 4D3GA 2BE7D 2FPHX 1BQNA 3KMSA 3MECA 2KT5A 1N88A 3ZFVA 1U1RA 4CH7A 1WC6A 2HNZA 3RU0A 4WP9A 4CCHA 4USUA 2CQIA 3HD1A 4K4SA 2N3OA 2HVDA 4ZPTR 5C24B 2GQQA 4ZP9A 3MDFA 4K2JA 3W9HA 3M6WA 2WW4A 1S0OA 1NCLA 4ECQA 2ACYA 1B0PA 1K0VA 3ZZUA 3BB5A 1SC6A 4YY3J 1IJFB 2FLNA 4DBQA 1HWIA 4LFCF 4YHHF 5IT4A 1SQGA 4P6QA 2DHXA 2I1RA 4JYAF 2RF2B 3F73A 3FZBA 1YRXA 4K4VA 1S7HA 3PJWA 4ZVPB 3M2RA 3UN5A 2V34A 2VQEF 3L7OA 2YNHA 4ED3A 3SDEB 2BW7A 4IFYB 1WKKA 4A8XA 4LF2A 2DGUA 4BBYA 4DOZA 1RKIA 3HHDA 1IUJA 4YB7A 1YJUA 3ZNJ1 1CPZA 2NPFA 2VG7A 3HKWA 1FTRA 2MQPA 2FHOB 1ZM3A 2MGZA 2AJFE 4RUAA 3IAM9 3UCUP 2AEFA 4WU3A 4DV5J 1EETA 3BBCA 1IBLF 4NRUA 2UU9F 1R8PA 1N33F 5HN0A 3D5MA 4JI2F 5IT9U 4KJIA 3MCNA 2XBPA 3BS9A 1UW9A 2VIHA 3IRXA 2KZMA 1IKXB 3C2PA 2EG2A 1QE1A 1LWCB 5J1NA 2XSFA 4WTOB 2L9WA 3Q89A 1NO8A 1EQMA 2N7CA 4K2XA 3OL9A 4EZ9A 5CD4A 4RW7B 4P52A 2B5JB 2GIRA 1PIEA 5KT6A 3ULHA 2JHEA 3IO1A 1WF2A 3DLBA 1DJ0A 5A8WB 1V5VA 3BQ0A 3FVYA 3L4BC 1S1TA 4DN0A 2O1PA 2F3JA 2NXNA 3KK2A 3R8YA 2YNFB 2FJXA 5HSPA 4I6YA 4P9SA 3O8WA 1S97A 4U9RA 1HMVB 3H42A 3VZIA 3H8YA 2MQMA 1RLDA 3D66A 1JXVA 1S76D 2E29A 3N6LA 2FVPA 1KQGB 1JLQA 1VC0A 1KHVA 4C8NA 2XHWA 4CO4A 2Z2MA 4FS1A 2NREA 2E1PA 1UW4A 1WEYA 4FF4A 1R6YA 2DY1A 3HT0A 4TKTA 2G1HA 1Q79A 2LECA 4DX7A 2CDRB 4B3OB 3R5AA 1QDUB 2FJWA 4ZPAA 2C42A 4JI8J 2DNYA 1U2FA 3SCKE 4RNNA 1WHVA 4ANEA 1EQ0A 2ATLA 4ECUA 2QL7B 3H40A 3HCXA 1Z2ZA 2HSEB 2UV8A 2FJBB 2CNKB 2XSJA 3H4BA 5A6PA 5IOLA 2VKZG 4DV3J 3C46A 2XNRA 3MMBA 5ETLA 3FMWA 2IC3B 3LP0B 3LWLA 2PSZA 1G2EA 3BQ2A 4C98A 1FRLA 5G4DA 4BDPA 3LOUA 1Q81T 2V4QA 1C0TB 3FDSA 2C2KB 1S4FA 1ZM4A 3B78A 4MIWA 1MSWD 3AQOA 5FD1A 2FJDB 3QJJA 2QA1A 1ACMB 2WBRA 4DQSA 4DSIA 5JVHQ 3V6DB 2CFXA 1L3UA 2HFZA 4D3HA 2GMJA 2DXEA 3S01A 1U1OA 4JI0F 1RAJA 2QLXA 3MMCA 3J7Z5 4J91A 4CLFA 4NMXA 2VJUA 3CXCR 2M8HA 2QLBB 3ENWA 2GX8A 4DWIA 2GHVC 1JLCB 2RAQA 3PIOQ 1AT1B 3VGVA 4KRWA 3P45B 3ZTRA 4AUKA 2W7OA 1VOMA 2ZUAA 5F0WA 1LFWA 2IBKA 3IBWA 5HBMA 3P49B 4IG3A 1HI1A 2HRTA 1SJ3P 4BCAA 2KM8C 4DX8H 3GIJA 2HNDA 4KO0B 5CH7B 2XMKA 3NS5A 3QZ8A 2WONA 3UE2A 2A1BA 4OZ5A 3GIMA 4M8LA 3THTA 1REVA 2XC9A 1VQOS 3KHLA 2B51A 4LQ3A 5LMUF 3ELHA 3ONQA 4EO8A 3DYAB 4B3SJ 2SXLA 4Q45A 3TX8A 1FKOA 2I2YA 3TO8A 3BO2A 2L41A 3HO1A 2JDJA 3LAMA 2AHOB 3T3FA 2A3JA 1T95A 1PGZA 2EC0A 3QAUA 1CSJA 2AJQA 1YVFA 1F6TA 1HQEB 4ATNA 3N28A 4DCPB 5KT7A 5LSOA 4PKDB 3U02A 5K8OA 4LF8J 4PYAA 3TUJC 2F4VJ 1NK6A 1RTIB 3FFIA 2BOAA 1NB2A 4B3RJ 1H38A 2WBMA 2H1YA 3MM9B 4MKAA 3SSRA 3R5GA 4ZVTB 2Y8YA 2UXDF 3PDNA 4O0NA 3MMAB 2J9DE 3ET6B 3W2WA 4G1QA 1QTNB 3I0RB 2NXJA 2KRBA 5H9EJ 2LU2A 1DTTA 4CO1A 5DGBA 2CPXA 2BANB 2BE2A 2YWHA 3MPYA 1S9GA 1UAWA 5F8MA 5DJBA 4IUFA 3LGMA 3CC7S 4EK2A 1YTYA 3HZGA 3NCRA 3L09A 3KHHA 2L9NA 3HJVA 3OFEA 3TAQA 1SV5A 3MGJA 2J5AA 4I0WA 3C6TA 2FC9A 2HHHF 2PN6A 4LF4F 1EIYB 4QJVA 1G6BA 1N8RT 2R7QA 3BGLA 1HWLA 2DRBA 3G8QA 2OJ3A 3KTQA 1FF2A 1S48A 3I4PA 5F3ZA 2OH2A 4K7QA 2GVDB 1FFSB 1APSA 2VPYB 1HNWJ 3R6GB 3HHLC 1IQTA 1XMQJ 2YBVA 2CPYA 1WI8A 4OZ1A 4DR4J 3TAMB 3N5FA 3MFIA 4LBHA 1UVKA 4J37A 3TZZA 2POKA 4C8ZA 3T5KA 2MXYA 4PZVA 3D6FB 2F65A 2UVVA 1FX4A 1FFWB 3HVTB 1GAOA 2HWIA 2OIHA 4NCGB 3EDQB 2IY5B 1NZAA 1MROB 2D69A 3DOLA 2F5GA 4TYAA 5KG0A 2CJBA 4TLQA 2A0FB 1RA6A 2YX1A 5I42A 2PMZD 2HK3A 3NMAA 4KPYA 4IDKB 1H74A 1T3NA 2UUBF 4F4YA 4B9NA 4MJKA 2CRLA 2QLFB 5KOXA 2LKZA 3WX8A 2VPXB 1HWKA 6AT1B 1T03B 4DV6J 3RR7A 3A1YG 1HKAA 1NMEB 2VG5A 2CUYA 2JVOA 1LXJA 4BHQA 3JQKA 2WSCC 3MPDA 3MUTP 3NWRA 1RABB 2DGTA 4FP9A 2W4DA 3TUZC 1I3OB 2C3PA 3V6HA 2KVQE 3CJTA 4RU2A 4FYXB 4OIXA 1SJRA 2PEHA 4W90B 3AT1B 4ZLLA 1S72S 4R5PB 7AT1B 2OI2A 1VBKA 4NYPA 3K5OA 2MQOA 1BMQB 4IR1A 4PUOB 4X65J 1HARA 4RUHA 4YB6A 1M5OC 3QAEA 3H5SA 1TTHB 3L7PA 4TU8A 5D0EA 1X9SA 5A8RB 4F02A 1I6JA 3ZZOA 5FJ4A 3OW2R 2H5JB 2LDIA 4QBUA 5CXTA 1WC1A 2AJ0A 2V0NA 1Q95G 2EBEA 4TYBA 1BWEA 4HDHA 1YJ7A 5EX0A 1XIQA 3I31A 4E0DA 3GFYA 5F41A 5FDLB 2GW8A 5CHCB 4CYUA 4MYUA 2BABA 3PW2A 2QMWA 2WCXA 2R2SA 2DY9A 3FCHA 4J9SA 1S1WB 1RAGB 3D9BA 4M94A 1B4SA 3GP9A 5CAAA 3M1VB 4KGKA 1BC6A 1FKPA 5CYQB 3GJTB 5HATA 3NWGA 1S12A 2IDLA 5F8GA 3V6JA 3GILA 2R7WA 1JQGA 4OMFG 4AXJA 2HIQA 4OQJA 4B02A 2ZJQQ 4PQAA 3WDOA 2CQ3A 3AXMA 3H59A 3FCVA 3UO0A 4WYLA 1LNQA 2IVYA 4V1Ak 2L08A 2P8IA 4UZBA 3EGVA 3M9MB 3CF5Q 2BW2A 1TL5A 3HMJG 3AA9A 3DNCA 2J0SD 2CG4A 3KXDA 2WVFA 1KHWA 3N0VA 3QIDA 2W9BA 4U7CA 3N5BA 2B9EA 1JNRB 5KFNA 2DT9A 5ITHA 1KEKA 3C14B 4WXWA 4U8VA 1QM9A 2XS7A 1J2VA 1S6PA 3RZAA 5BXIA 2L48A 2CWXA 2ZD1B 3PIPQ 1RAHB 2DNNA 2BJDA 5KFJA 2ZWOA 4URGA 1D9DA 2R3VA 1TUWA 5K14A 2A18A 2UUCJ 2XCAA 2FC8A 2MKYA 4J9VA 3FUYA 3C3LA 1JMTA 1TL7B 1FWKA 3RUBL 1WG4A 2V8HA 2GGPA 2B9YA 1HNVB 3VGUA 1C0UA 1N36F 3TJ9A 1FNOA 3HP6A 5HO4A 2Y0SD 1HYSB 5EUHA 1N52B 2HBYB 5L38A 3W1YC 4UY8T 1SL1A 5D15A 4NXNJ 1UEUA 2ZHAA 3C6UA 1CJTA 4USIA 4NI2B 3RJMB 1VMBA 4B9UA 3QBCA 5DM6Q 2U1AA 4C11B 2G13A 5DZ7A 4MT1A 1RYRA 1S1VA 5KG2A 2V4JA 2KL8A 1TV6A 4ZCMA 2BKNA 4LFAF 4ETXA 4OI4A 5E3PA 1SUQB 4IG0B 3QATA 2IMWP 2FVSA 2ZE2A 3W9IA 2YXLA 2BA9A 3OTOJ 3OLAA 3CVKA 5HLFA 4FXVA 2DGXA 4NLGA 3MEKA 3N9UC 1O0PA 2W9AA 2VL1A 1IKWA 1B0VA 4BLGA 2Z0GA 4ZVEA 4WFXA 3A8IA 4DV4J 2DBBA 2LXFA 1C1BB 2VC0A 1QD1A 3GLJA 5KFEA 4DFPA 3PG9A 2QFJA 1RE1B 2ZH5A 1P8GA 4DL5A 3W2VB 1ZA1B 1SJ4P 3C19A 1B70B 5B0GA 2B6AA 3NGDA 2Z8QA 3O44A 1RT3B 1L3SA 4I7FA 1HW9A 2VU5A 5DDQC 3JAMU 4NWBA 2GMLA 3T5LA 2VODA 1D8ZA 1U49A 1RT1A 4QYRA 4EFAC 3C15A 3KK1B 2RNEA 3BKUA 2HYIB 1R6VA 2UXBF 3V4MA 2F1FA 2N4CA 3MAHA 3OVSA 2PI4A 3M8QA 1AFJA 2MSTA 4K4XA 3GV5B 1WHYA 3M2UA 1H2VZ 1TAQA 4UOCA 4OHXA 1P1TA 3P3DA 2H3EB 1DARA 2WOMB 3K17A 1T05B 2JVRA 4B08A 1ZPWX 1I94F 2BV3A 3EVWA 2R8JA 4I2QB 2U2FA 1WSRA 4WFZA 4CT9A 3TUPA 5KFQA 1VLYA 4DPWA 2ZH8A 1KOHA 1JIHA 2WSEC 1ZZFA 4LRDA 3KLGA 4RBVA 1RAOA 3N79A 2DGSA 2V94A 3DDNA 1YKWA 5C7PA 3U1LA 3W5XA 3G87A 2XZDB 1HBUB 4OLOA 1HLWA 2BJ7A 4PG8A 4LSLA 3DKDA 3G6YA 2VF3A 1KFDA 1KWMA 2KDOA 1NKBA 1HNZF 4C97A 2M4MA 3DLKA 3NS7B 1Q82T 1H72C 2L9DA 2H9ZA 4LR8A 1S6QB 1U45A 2DCUB 3KJQB 1N5QA 3B54A 2RVJA 5KFFA 1B0TA 4R8UB 1YJ9S 2JLFA 1RISA 4H54A 3ZZTA 4NXMF 2YKOA 2HS3A 5JMNA 1M90T 3ICLA 1IXKA 4OYAA 2AW0A 1HNXF 1MNEA 3R2CJ 1M5PC 3CGIA 2K3IA 2HGMA 1XMOJ 4TQSA 1W25A 1GMWD 5ETSA 1T9XA 1OY9A 3I55S 2NZCA 4E2FB 1FVQA 1CQNA 1PYTA 2HLUA 4X4UA 1HBMB 3L3CA 1LXNA 2VG6A 1LK5A 4LF8F 5C5JA 2QJ3A 1S59A 1REGX 4LF5J 3BSAA 1YBAA 5ETNA 2P5VA 1WWHA 1N0UA 2ALYB 2LQJA 4USWA 5DDOC 2E9ZA 2C3YA 4C8LA 3J81U 1IM4A 4KYZA 1C1CB 5C24A 3D1QA 1P27B 4CDIA 2P6SA 3DU6A 3BF4A 2PI5A 3RAMA 2A2CA 4LRCA 3MD1A 4NLRA 1VQPS 3MCMA 2KXHA 1WSVA 1RWNB 4CH0S 2FLPA 3PX0A 4KKOB 4NCAA 4GMKA 3MEEA 1RYSA 4EEYA 1RWXB 3CCZA 1RHQB 4I2PB 4IRCA 2W8LA 2RF2A 3DLEB 4PABA 1RWVB 2BJ9A 2J8SA 2DPJA 3PKMA 1J27A 2W9CB 1M5HA 3EZ5A 4ZA1A 2CA9A 1HNIB 3EICA 3SDEA 4NCBA 4IFYA 4QIGA 1JJHA 4CO5A 4ZVFA 4KH0B 4URQU 2NZ4A 1A7GE 4JOUA 3CCWA 3HHLD 3T9NA 4GC7A 1MMDA 2YTCA 1LWEA 2IRUA 5DQHA 3MCOA 4CO2A 1RGVA 2AZ1A 4QCLA 3OV7A 2IRXA 3CCRS 3AA8A 3EX7B 1YSJA 5DGAA 1VQ6S 2HIYA 5F8JA 4Q8FA 2EG1A 1FD2A 5H9FK 2FLLA 1GX5A 2J9DA 3ZXWA 4FYDA 4GKKJ 4KHPJ 1G3OA 5HJYA 3VVTA 3MI7X 6FDRA 1U47A 4CLYA 2J0WA 4F4ZA 2W8KA 2HFNA 1IKXA 2G0IA 4DV0F 4U7UD 4DL2A 2YWWA 3UVJB 4IRKA 2E44A 3OR2B 3P96A 3TWZA 2RRAA 1IQZA 3MTKA 3FK4A 2DR9A 1M1HA 4NLYA 1OYEA 1TAUA 1S1UB 3Q8YA 2VD3A 4FF1A 1JKHB 2FJEB 1CJUB 2JRSA 2F9DA 1DY3A 3P5BP 3PNIA 3Q8UA 2PO4A 3GJSB 2YH1A 1HPZA 3LANA 2YNFA 2QTWA 1HMVA 4HL9A 2LEPA 3EGNA 2YY3A 4XO0A 1U1PA 3DN9A 2FHJD 4J9RA 2NYIA 1MLAA 1RJJA 1VK8A 2AYBA 2GIFA 2XI2A 3GV7B 4KFBB 4JUZA 4CTAB 3SQGB 5C42A 2IM0A 3PV8A 2AT1B 2VDIA 2D9OA 3EMTA 4NLQA 4PG5A 3VTIA 2YPZA 2R8IA 4OX9F 4HHUA 4F2RA 2ZJPQ 4HACB 2DRAA 2OPQB 4GKJF 3ZZRA 4X84A 3ADAC 3H2UB 4F4AA 2CIMA 4FS2A 4OZ0A 4O3PA 4ZS6A 1JWWA 3DOKB 1KONA 2MKSA 2JSXA 3M32B 4QWCA 1FK9B 3Q23A 4L72B 4PG4A 4Y6IA 2Z2ZA 4OJ3A 2C2EA 5E7OB 3D68A 3M05A 4XTTA 3QT8A 4PCQA 3VGSA 4AD6A 2MQLA 4DZDA 1NSAA 2W2NP 4DEZA 3CC2S 1QAIA 1K73T 4JI7J 5B0DA 1S57A 1FXDA 1KLNA 1HBOB 1YJRA 2DNOA 3VQSA 2IC3A 3LP0A 5L1IA 3R1HA 3AODA 3US5A 1VRUB 3CD0A 3HI9A 1RWMB 2YNGB 4CQ1A 5H9EK 1VBYA 2Z58B 2HS4A 2XZTB 1C0TA 3TA1A 4Y2KA 4OHZA 2ROEA 2X3DA 2FHMA 2GCFA 3R5DA 1F9FA 2CZ4A 4CNYA 4EO6A 1N32F 1LOUA 2QZ8A 1Q86T 1FXLA 1SCJB 2AYEA 3WBZA 3OTDA 3I4HX 1U4BA 4P71A 3MUVP 2HQDA 3KJVB 4CO3A 4EGLA 3CCUS 1WUUA 2QE5A 4W4MA 1RBLA 3S1TA 3QWUA 2CQ2A 1U09A 3ZC4A 4DSKA 3BO3A 2GJ2A 3WHIA 1JLCA 2J7WA 2E1AA 2MZQA 4IYQA 2RD5C 1UETA 1KQSR 3CDEA 4H4MB 3AD7C 2DGWA 3QT6A 4LF9J 3GCXP 4DFMA 3KK3B 4MKBA 2AMCB 1D9FA 3MM5B 3EZOA 3UN3A 2ZNYA 4AL7A 4PPZA 4J9MA 2EFNA 4N77A 4NXNF 5IS2A 2JH3A 3R6LB 2OFGX 1F0XA 2DNMA 2DYAA 3DYAA 2WB4A 4CM0A 2FY8A 2KVIA 2VFSA 5K8MA 3DLGA 2XMWA 2YNIB 1Y7PA 5CYMA 2J0XA 4XDDA 1HQEA 2BVZA 4KGVB 1S0MA 1M0SA 4J9LA 1Q5VA 4JI1J 1BGXT 5KG5A 4TU7A 1W2BR 3QWPA 3TX0A 4RLEA 1TUGB 1SH2A 2KH9A 3OR1B 2BXJA 2PGCA 1IWAA 1RTIA 1RWUA 2BJEA 1YZ6A 3R97A 2OPRB 1X4EA 5IC4B 3QLHA 3M4XA 3VHQA 4DR2J 2K1RB 2B9WA 4DPTA 3I5AA 3ET6A 3EPGA 3I0RA 4LF6J 4WE1A 2RT3A 1S5ZA 1VBXA 4DV1J 1N5SA 1KTQA 4RBUA 2J8AA 4MK7A 3SV3A 2X1FA 5AE1A 2GJFA 1EAYC 2QLJB 4JV0A 2OPSB 3JAMY 3UDCA 1SQFA 3ITHB 1UEKA 3RW7A 4OHYA 1RK8A 1LK7A 3POTB 1R0AB 2QV6A 2HQGA 3CO9A 1UZHA 1SPBP 3G82B 4AXIA 1WG1A 2XI3A 3H5UA 4NYZA 3HJFA 5BYSA 2DTJA 1IBMF 5SZTA 2FVRA 5KFZA 1ICEB 4RW6B 2NYHA 4FYYB 4CLLA 2ZOFA 4M5KA 4JBCA 2MY8A 3OTBA 1VQNS 5J2MB 5CZXA 3JB9k 1R0BG 4YFUA 3UNGC 2GZOA 3QT5A 2MLZA 3QZ7A 2B7CB 5DG7A 5L39A 2GVZB 4P10A 3SCLE 1N54B 1WJ9A 2GO8A 2Q6BA 1Y00A 3DHWC 4M5NA 1IKYA 4HH0A 2XQCA 4X4OA 4MH8A 3HX9A 2FZGB 1TKZB 4CH1A 3MXHP 2LA4A 2E66A 3W5YA 1X5SA 2GO9A 2Y9HA 3TVKA 2AJ4A 3KLFB 3RGIA 4IDKA 2OP5A 2L3MA 2DXFA 1V3SA 2HFUA 4IFVB 3GWCA 3X1LB 1NHVA 4K4ZA 4F7VA 3N01A 5I3PA 3NGSA 3D0IE 3QGHA 3CCLS 1QUPA 2B9XA 2QG9B 3BSOA 1KSPA 2GQ2A 3JSBA 3ENQA 2LQ9A 3D2WA 3D54A 4ZJLA 4WKRA 2DGVA 3BKTA 4I6AA 1KC8T 4OFZA 3T1HF 2ZH9A 1UVNA 2XYHB 1XQIA 3PEHA 2QC3A 4KGMA 2EEYA 2NQPA 3V4IB 5IV4A 4LR9A 4KSEB 3DOMB 4OZJA 3KG0A 4NE9C 3MM8B 2LQ5A 2EKYA 4ZPWR 4NLSA 3MWBA 4Y00A 2XGQA 1U2CA 2V2ZA 1WC4A 2DIUA 4O44B 3A4TA 5D4OA 3CDAA 3AD8C 3Q8PB 4FKYA 2A6MA 4ECWA 4M5LA 1KLMB 4YR2A 2RKIB 5A8RA 1RZMA 3K57A 4LF5F 3J81Y 4F36A 1LEOA 4C2MA 1IKVA 3QT7A 4USTA 1X4GA 2ZBPA 3CULA 4J9KA 4ALZA 1N5VA 2CWKA 3KUEA 2VKRA 2O01C 3IS9B 4CLSA 2DO4A 5D4LA 3GQCA 1HQUB 1S1WA 2BQ3A 4LF7J 1VR6A 4QWEA 3NRBA 3W61A 4ANDA 3I0SB 1NJZA 1KVJA 5KFTA 3R1LA 1U0SA 1U1MA 2UZAA 4NLPA 4B9TA 5E3RA 2ASYA 4JB8B 2EBGA 1CULA 4DR1F 3PW5A 1YHQS 4XK8C 2ZH3A 4QWAA 5KFKA 2YKNB 2D3OR 5BR8J 2DJWA 3AJ2A 1Q0NA 5I4MA 2V8DA 2YQ0A 2JJ4D 4DL3A 3ZZYA 4OI1A 4X4TA 3CDUA 4ECVA 2YVSA 2HG4A 3JSYA 2BQRA 1RT4B 1NDCA 3V5RA 1UMJA 4OI6A 4KIAA 3C14A 1F2GA 2I8EA 2V5HG 2JEIA 4TLRA 3RB6A 5KFLA 1HI0P 3WC0A 4PQUB 3PFEA 1FTCA 3AQPA 4U6PA 2VFUA 3RRGA 3EE3A 2B4OA 3BGRB 3TUIC 3SCIE 2XLJA 2MZTA 2WSFC 1GMWA 3SFGA 4ZPBA 3B4MA 3Q22A 2DH7A 1DLOB 1HNVA 2HBZB 2E7XA 4NRTA 4CT8A 1TVRB 3MAQA 1HYSA 1FE0A 2LYVA 3O2IA 3TOQA 3SMZA 3AD9C 3W8GA 1MW7A 3FRZA 2BR0A 3RB0A 4NI2A 5KFXA 1KD1T 2M9KA 1YITS 3M8PB 3GJQB 3U1MA 4C11A 6FD1A 1Y5IB 3PHEA 1HW8A 3AAWB 2XMTA 5KFCA 2ZBQA 3DC2A 4Y2MA 3IR6B 3NNCA 2ZKTA 1UFWA 1CJKB 1Q8KA 3HFZB 1M5SA 3N6NA 1SUQA 1QSSA 1UWBB 2VQFJ 2UVUA 3A8KA 4USHA 5F3TA 3GG1A 4WFBQ 5IV3A 4ZOSA 4B3MF 2XMMA 4FYVB 4DUYJ 1TELA 3FC9A 1AZSB 2W4CA 3KLHB 3JYTB 3MR5A 3GTYX 2OPPB 3W62A 5KFUA 4J9PA 2IM1A 1MU2B 1S77D 3CJ2A 1C1BA 2VA2A 2ADCA 4IH6A 5KG4A 2HQIA 3G96A 3OFFA 2HNYA 2AYMA 3W2VA 2R8KA 5IWAJ 3IG1B 3P8BB 3BDEA 4O3NA 2QN6B 3NNHA 3GCWP 3OL8A 3PYDA 2I6WA 3VVUA 3E2EA 5HK4A 2VB6A 2HVZA 2ACMA 4LFBF 5KFOA 2YX7A 4K5SA 5E5NA 3W63A 1RT3A 5SUHA 5LJ3Y 1ELOA 3TZWA 4ZN1A 2ZDPA 1RI7A 4Q44A 3M9OB 3MF5A 2H48B 3RRKA 5KFGA 3ISNC 3H25A 2R7TA 4C3KA 3V2UC 2AJ1A 5M2PA 2B8PA 3ZTSA 4ZLNA 5A8KB 3DRPA 3RBEA 4WBFA 2KXFA 1HD1A 3M2VB 4WYWA 4ZDNA 4IH5A 2JEGA 1HI8A 4WWSA 4KV8B 4OHVA 1T05A 3FSIA 3FQKA 3M6XA 2QLWA 1QAYA 2J6SA 3R5BA 3SV4A 2WVBA 4JI5J 4DV7J 1JLFB 4I2QA 2CZ9A 4ANCA 4DS4A 1SKSA 1P6TA 5F8LA 2CYYA 3J7YU 1FO1A 2HURA 1NPRA 1TKXB 2B3TB 2N82B 4I56A 1VQ9S 2QYGA 2ZJRQ 1LKZA 3GFHA 1M1GA 1JLAA 1RADB 3T1YJ 1WC0A 2HZAA 4DL0C 1ZAXA 1BWVA 1B7FA 4KTQA 4OZ3A 5EWGA 5G0RB 2ZHOA 1S6QA 1MN7A 5HQMA 3OSNA 3THVA 2HHSA 1RTJB 3GYXB 1NKEA 4L73A 3BM7A 3PRVA 3QQCD 1MWZA 1SJ1A 4ZJOA 2DH8A 4R8UA 4NZ7A 2E5LJ 1FJGF 3TJAA 1MWQA 4GRSA 1ULRA 2RH3A 5GMKa 4UUWA 1A9NB 2KFZA 1OSCA 3QPIA 4ZK7M 2MYFA 5KFWA 4ILMA 4H4KA 1EZZB 3SI8A 2ZH6A 1FXRA 1HR0J 1NH8A 4C6AA 4J7CA 1P9QC 1HBMA 2LFVA 5IC6B 1O6XA 2YNHB 2RDIA 4ZPCA 2EKNA 2LA6A 2N7YA 1WHXA 3CJ4A 4OYZA 1KQFB 1YJVA 1NUEA 1OY6A 4DR3J 2PA3A 2MJUA 2C3OA 4DR2F 1D09B 3D7SB 2IAJB 1DQ8A 1P1LA 3SCJE 3LGNA 2MGZB 1UJ4A 1YK9A 1QSYA 1OQ3A 4KY3A 3OXFA 4WIIA 4YUDA 3AOAA 4F3QA 2W2MP 1E6VB 4TN2A 4FF2A 2R7UA 4B9SA 4KKOA 5E0OA 1NNDA 1H6KX 5LL6d 4AT1B 4I2PA 1U1KA 4AL6A 3DCAA 3NEKA 2NUUG 2W9CA 4UZCA 1NK4A 4WJBA 3PY8A 3PW4A 5M2RA 3FMBA 1PJ6A 1VK3A 4QW8A 1YG0A 5HMWA 1RWWB 4LQ9A 2B7BB 4TU9A 3GU0A 5AJ3J 3IM8A 3PO5A 4F3OA 3QRRA 3TANA 2UUAF 3FKBA 3RB3A 1S1TB 2HKEA 2CQGA 3B6BA 4YDDB 4ECSA 4B3TJ 3KK2B 1U8WA 4HR2A 1V9OA 3CMAS 1X7VA 3MR7A 1LWXA 3GZ7A 4H4OB 2FJAB 1N48A 3NG8A 4DR7F 1T9WA 2ZNZA 1U6FA 2BM1A 3MHYA 2VPWB 3JS9A 4J9UE 4U7UK 3OD2A 1X4DA 1X9MA 1DTQA 2B56A 4ED0A 5K20B 2K2PA 2W2QP 3SQOP 1ZOTA 2UVWA 1X31C 2C2ZB 1WORA 5EX3A 2R7SA 3D0GE 4ZCKA 2WVDA 4C9DA 1YWXA 3JXOA 2J6UA 1N56A 2CNLB 3UVJA 3BR8A 1NZ8A 3OR2A 3QYYA 1RCXB 3B8HA 1HA1A 2H5IB 3RBDA 2QGFB 3MCSA 4IO9Q 4DV2J 4DCOB 4LUBA 4DUZJ 3M8RA 1T3OA 4X2BA 3J81j 4JI4J 1S1UA 3DMJB 2XNQA 1FX2A 5D3GA 1JKHA 3L95X 1DURA 1CJUA 4WK1A 3HVAA 2HS0A 1FEEA 2PFDA 3MPVA 2ERRA 1WELA 2O67A 2GAHC 3DRRB 2DITA 3D1HA 5EWEA 3Q2TC 1Q1KA 3KJNB 1VS3A 3PXGa 2E9TA 3D6HB 3QSYB 5C2GA 4Q2MA 2XSJB 2HHVA 1AB8A 4K8RA 1EARA 5GADI 2V9KA 3A13A 1SIWB 1Q7LB 4AYBD 2VH7A 5KFYA 4CLWA 3SQGA 2IMOA 1BHNA 2AP6A 2FTRA 2H4YB 2DCLA 4B9MA 4EMDA 4JV1A 5F0UA 2ZBIA 1K47A 2FGCA 3T9ZA 1GX6A 2JFKA 1UWAA 1ZAVA 1GTEA 2XS2A 4LVOP 2OPQA 4L3KA 2P9EA 2GC8A 3FRYA 2C28A 3PYGA 7FDRA 4N8NA 4AE5A 2Q1LA 3AOCA 1RHUB 1H7WA 5B0CA 3KMQA 2XO6A 4ES1A 3DOKA 4HI2A 4JI6J 3M32A 4DU7A 5CABA 2UXCF 1FK9A 2V4RA 3F0NA 3O5TB 4X66J 2MHEA 1GXTA 1RLCL 3KG4A 1JJ4A 4QR0A 3EXYA 4CLTA 5HANA 3UN2A 2ILYA 3D28A 5HBMB 4IG3B 2DHSA 1LV5A 1HBOA 5CYJA 1X5PA 1ZYQA 4Q0BB 5IM0A 3H20A 4YS2A 3CIZA 3HFVA 4RU9A 1REVB 2W2PP 2XWXA 2YNGA 1GQEA 2OEKA 1R0CB 3MM7B 3QO9B 3IA0A 2HWHA 3HSJA 2RDDA 1XNQJ 3SYZA 1Q78A 1RWPB 2H5EA 4K5RA 1PAEX 2J7KA 2O5DA 4OYBA 1HD0A 2RILA 4DU8A 2XY6A 2HBQB 5AE3A 3KJVA 3CCVS 3F41A 1S0VA 3FBFA 3M8WA 2CJYB 4LRBA 3ZZZA 2FIUA 1FNMA 2LXIA 2FDNA 5FIIA 4O23A 3QGIA 2CKWA 2JFDA 2RRNA 4H4MA 1Q7YT 4HLBA 3H5XA 1XJWB 3H0PA 3G6ES 3R7SB 4QWBA 1LWFA 1LFPA 3MM5A 2BE2B 1ZPVA 2E1RA 1S9GB 5H9FJ 4HTJA 5HJXA 3J7ZT 1EB0A 2GNKA 4ED5A 3MD3A 2ZH7A 4U95A 1VYAA 4F67A 3I82A 1RA7A 1R43A 4LFCJ 4YHHJ 3VZHA 3GYGA 4KC5A 3OFGA 3KHGA 2XY7A 4FBTA 1CS4B 3BEGB 1WACA 5E3CA 4JYAJ 2IYIA 5B0FA 2Q6CA 1WEZA 5IQ6A 3K58A 1Q5YA 1Y5NB 3QIPB 2AZ3A 5L46A 2DGOA 1Y0HA 5KG6A 1H98A 5GMEA 2QSFA 2I5JB 2OO4A 2KT2A 2CQBA 2Z4PA 1FERA 1URRA 3VR1A 2X7IA 3GSDA 2HZVA 4FNIA 1U7LA 2FYXA 3OR1A 1NJIT 3HSZA 3NLCA 4X4VA 5DG9A 4ECTA 4DUYF 2F7VA 1SVDA 2HVEA 2CNNB 3GPAA 4OJGA 3HULA 3BH7B 3WIUA 1RAEB 2K1RA 2KYXA 1PAUB 1F9EB 2B43A 4JP8A 1H0HB 1RACB 5D0RA 4RW9B 1X4AA 1ZTWA 1D1UA 5AT1B 2LLZA 4RPFA 4ZHRB 1XEZA 1IBLJ 5DS7A 3G8SA 5K5MA 2UU9J 4UQTA 1N33J 2HHQA 4X64J 2KN4A 1QUVA 4JI2J 2XMAA 3UD4P 4A8SA 4ZN3A 2M3DA 2YWKA 1NB7A 2F8HA 1YQHA 9RUBA 3POTA 1R0AA 1XBWA 1KFSA 2GMHA 3M7VA 2UVRA 2MLYA 2D3ZA 1RUSA 2DNHA 4OYXA 1B99A 3G82A 4QIFA 4WKYA 1RT6A 2IJNA 4RX6A 3IGNA 2QL9B 4RJVA 3TRGA 3UNYA 5ETOA 3ISND 1N5YB 2GFFA 1R8BA 4DQRA 4M95A 2DNZA 1NSQA 1YJTA 4KB7A 5E3AA 4R25A 4WU2A 5J1EB 5GAHU 5J2MA 1G7CB 4MTPA 2X1AA 1S1XA 3FNNA 2VG5B 1NXIA 5HAOA 2W24A 3Q2SC 1EKRA 1AFIA 4GVBA 4OZ2A 4CLZA 4O3SA 3CCQS 1WOSA 1N34J 3HHEA 3CD7A 3RBXA 2QRRA 4ECXA 3T41A 2V8PA 2R7RA 5BYRA 1WTFA 2JLEA 1T9YA 4DX6A 1WF1A 3WC2A 2HGNA 3KLIB 2HAFA 3IM9A 1CLFA 2CPJA 3NCPA 4USKA 2OD4A 4IOBA 1U0HA 1Z4UA 2V2KA 1NPKA 1NSKL 4A8WA 5IZHA 5F9NA 3IBFB 4KGXB 5D6GA 3DLJA 2JWNA 3R3TA 1FT8A 1SH0A 4IFVA 3T5HA 4YDXA 4F2SA 3I5CA 4DL6A 3CSKA 2R9LA 1FI4A 1K0TA 1AUSL 4AQYJ 1EHWA 1AROP 2IJFA 2R7OA 1VJWA 2BJ1A 2WK4A 3NS6A 1K8AT 2KG1A 3O3LA 1N6QA 2I0XA 4JI3F 4J9QA 1FKPB 5E3QA 1H2UX 3CCSS 3DOMA 2M5YA 4Y2CA 1WDDA 3TZXA 2ZDOA 1QTMA 5KT5A 1FRXA 1EX8A 3AB2B 4F0HA 1KBRA 3T6JA 4TY8B 1RHJB 2MQQA 3GJRB 1I5OB 4DR6F 2BBEA 4USJC 1NHKL 1QJHA 3D3CJ 2C3UA 1A0OB 1S4EA 5LMNF 4DMZA 3CJKB 4C0HA 4Y0FA 4HT5A 2HFVA 4IOAQ 2RKIA 1F1BB 3OPKA 2OTJS 5ETPA 3KDOA 4JI0J 2FVQA 2DVIA 3MMJA 1KVIA 3RG6A 3FEZA 1HBNA 5A2QU 1UVJA 1S6PB 3HZEA 4QR1A 3C8YA 2R8GA 4C4WA 4ZMMA 1CJVA 2OD6A 2ZITA 5LT5A 1T7PA 2DNRA 3WQPA 1HQUA 2KJWA 3LH2S 5ETMA 2ZH4A 3G4SS 2R4FA 5K14B 4P74A 4QQBA 3L7UA 5IQQA 4RNHA 1S99A 3I0SA 2LXUA 1S9EB 2E9RX 4OI3A 5B09A 4NLXA 4QW9A 1C0UB 4CWBA 2QA4G 3NGKA 3NOCA 4DSFA 1HFEL 3C66A 2DHGA 2MZSA 4QIEA 1IR2A 5F9LA 1SKUB 3Q8VA 4DLGA 4JV5F 2CJ9A 3D6MB 5LXYA 2Y1LB 1IN0A 2I9SA 5LMUJ 4A8MP 4F0KA 2RQ4A 3PRDA 3W5ZA 2D41A 3J80U 5C25B 2QA4S 3W60A 4MYTA 4IRDA 5HVGA 3Q8RB 3NAIA 2V4JB 1MWYA 4M5DA 3D1OA 1IR0A 3IC1A 1FRHA 1T9VA 1F5CA 2KU7A 4PQUA 1TP7A 3PX6A 5HMXA 2BX6A 4TXSA 1QVGR 4I67A 4B3TF 4FXWA 5IFMA 2MTLA 2ZE2B 4DCJB 4G65A 4S0MA 3DRXA 2RE1A 5HLFB 3A3NB 4ZP8A 3BGRA 3NKYA 3K59A 4PEOA 5I3UB 2UXDJ 1FD8A 3MPUB 5BJRA 4H4KC 1M5VC 3W3SA 2V68A 2AF6A 1DLOA 3OTEA 2F8EX 3EJMA 3DM2B 3PHTA 4PWDB 2RJZA 4YY3F 2ADBA 1M5KC 1OY8A 3M8PA 3FQLA 4L3NA 4ZVOB 1TKTB 2XG8A 3JTNA 3SIPB 1WKJA 1UTAA 3QNWB 2GHWA 4FYWB 3FBCA 5DLFA 2HHHJ 4DDFA 4Q7AA 2ZUGA 2Y3YA 4DF8A 2LVWA 1VISA 3GE9A 4LF4J 4KGZB 1CJKA 2QO3A 3QJLA 1UWBA 4WF9Q 4HTIA 1NAQA 1XTZA 2M52A 2O3DA 2BMBA 2PC6A 2F40A 3V81A 3MURP 4QZVB 2RHQB 2DISA 4LSNB 2Z56B 2OPPA 3M2UB 2YKPA 1MU2A 3CJ8A 4OV1A 1UJ6A 9ATCB 1TQLA 3R9LA 1X5TA 2HMIA 4DL4A 3O1LA 3RW6A 5KT3A 1VIXA 2RU3A 1SBRA 4DV5F 2ZC4A 1BD6A 1SKRA 2H51B 2C22A 3IG1A 2MPUA 1U8SA 4QIVA 1RCOB 3K5LA 4BWJA 3TYTA 1WC5A 3JQMA 2ZOGA 5HI7A 5E41A 3GIKA 3M30B 4J9NA 3ISZA 4Z7YA 2UUBJ 3HVWA 4A8FA 1X0PA 3A8EA 3ILOA 3PZPA 3UDVA 2P6TA 4ZVSB 4N5SA 2XWYA 2F63A 4Q43A 1MN9A 2IBOA 3K5PA 3CNQP 2LQ8A 2PEBA 2VV5A 1F5AA 2W4PA 2CPEA 5A8KA 3P5TL 1S6OA 2RUGA 3ZO7A 3HLUA 5KFMA 2ALZA 3HHNB 1U25A 4LIWA 3M2VA 2MKHA 5F8HA 3CDBA 3IBCB 4MK8A 2C2OB 2IIHA 2PMWA 8RUCA 2WVEA 1WF0A 4ES3A 5KTQA 1JLFA 5HMYA 4Y34A 2RB7A 3P4UB 4ZVGA 3FSXA 1X4HA 2ABYA 3OVBA 3C16B 3TNVA 2LCWA 1TKXA 1TK0A 1PJ5A 5LOQA 3HDSA 3MAAA 3EGZA 1E6YB 1U1QA 2YWFA 2VG6B 2Y0BB 3TA2A 1N5TA 4ER8A 3WIVA 2MKJA 3JSMA 3UDEA 3Q0AA 2IVMA 4JI8F 1SL2A 4C0BA 4MIAA 1V3RA 4U96A 3LP2B 3TEGA 1UL3A 5G0RA 1PYOB 1KOOA 2YX4A 5HQ8A 5AXNA 1RTJA 1X60A 5LJ5Y 3FZ2A 2F4FA 1TKDA 1OPIA 2Z2LA 3CTRA 2EFQA 2NSCA 1GXUA 1TL1B 1RHRB 5HVHA 1NJYA 2G9OA 2UUTA 1O51A 4DV3F 1RXOB 3MEEB 1NK0A 4U67Q 2AV5A 5ETTA 1H3DA 3H90A 2MZJA 4NLOA 2HRUA 3TA0A 5AXKA 4EI2A 3LPEA 4B17A 3ZTPA 4KHMA 1UZDA 2M2BA 1VHIA 3OUYA 3NGUA 3K5MA 4BWMA 4ED2A 2EFVA 1UKUA 4FNHA 3OHBA 1UP1A 3OJUA 2Z2YB 1VQ8S 5KFAA 3MPWA 5FLXU 2V2QA 4DJBA 1LWEB 2OUGA 8ATCB 1YI2S 5KAKA 3EVOA 2K3KA 3EUNA 2V50A 2XMJA 2IAJA 2DGQA 1NU4A 4F4WA 4EZ6A 1PC4A 4DUTA 3KWMA 4O3QA 4P72A 3UCGA 4RW4B 1FDDA 1E6VA 4Y2IA 2HFSA 4JV2A 4YB5A 1TL3B 5KOWA 4LBIA 5HROA 5K9FA 4X64F 2VBZA 3BGFA 4LJMA 4B9LA 2J6TA 5CD4H 3RTVA 2KG0A 1N36J 1OQ6A 3EGWB 5HP1B 1LW2B 1WI6A 3KUHA 2CQHA 4DPXA 1URNA 4O0IA 3TJ8A 3MUMP 5J2PB 2CJQA 2ASDA 4PXDA 3O6QA 2C1EB 3PACA 4QPTA 4OHWA 4ELTA 3NBPB 5DDRC 5A0YA 4B3SF 4C8MA 1F3VA 1TU0B 2GJIA 3PVXA 3TI0A 1EP4B 5B0EA 3GSIA 1VJQA 3BJYA 3F44A 5DQIA 1O5JA 4LMZA 5T7LB 5U47A 3CC4S 3CCES 4LFAJ 4UT4A 3BQ1A 3AHPA 2ROGA 4LVNP 2WW8A 1KTVA 1TMMA 2H54B 1N34F 1HPZB 2HEKA 2F4VF 1VI7A 1UCNA 2F9JA 3MM6B 4B3RF 2QIFA 2ZHBA 2BJ3A 4OL8A 4H4OA 1NJXA 3PEJA 2PA8D 2VASA 3GYNA 1HHTP 2AJ2A 4P2SA 1W7WA 5C42B 2HZCA 4ELUA 1FDAA 4RW8B 4ECYA 2FD2A 2ATCB 4P2XA 3IMQJ 3J7YI 3DRYA 4K4YA 4K0KJ 2OGUA 5KFIA 3DU5A 3HF5A 4P2MA 2ZZTA 1R8AA 4CLUA 2E5IA 2JOQA 2OTLS 3EVMA 2EWHA 3MEDB 3CUNA 3I9V9 2R8HA 2BQUA 1S49A 4ELVA 2DH9A 1DAXA 4AQYF 3LP1B 4HT7A 3OL6A 3DMJA 1R27B 1SKWA 3J7A1 2V63A 2UXBJ 3CMES 4PXBA 1NLKL 3DRRA 4RR5A 2FUG9 1VRTB 2VPZB 4OJHA 3CCJS 3PW0A 2G4BA 4K4TA 3OTCA 1HNWF 1XERA 1VQ4S 2GHPA 1XMQF 4DR4F 4X62J 3OL7A 3ETMA 2FZCB 4PR6A 3IGVA 5KG7A 4L75A 2W7PA 1I94J 2ZKUA 3IP0A 2E5JA 1L5UA 4RNFA 1O8BA 2OELA 2I38A 4FKXA 5A2QY 5HVFA 1Y5LB 2PIIA 1VBZA 5CCLA 4ILLA 4LRAA 1JJ2R 2MHNA 4ITSA 3H98A 1FJEB 2MEWA 1NK9A 1QSLA 3AY0A 3RAQA 1LWCA 3GFZA 1VLOA 2IM2A 1SL0A 1FRMA 2CAJA 5L8RC 3DLLQ 2VFTA 1JXEA 3BN4A 4DV6F 1HNZJ 2XY5A 1YJWS 4RW7A 2B5JA 1EKSA 4U8YA 2OEJA 4I69A 1NJWA 4ES2A 1XC9A 4ECRA 1IWGA 2D1CA 1S9FA 5A8WA 4Q0BA 2OHDA 2Q66A 3CD5A 2KTQA 5THWA 1OO0B 4YQWA 1IJEB 3PJXA 1T9UA 1FNXH 2MQ8A 3J80Y 4NXMJ 3RB4A 3HHKA 2M88A 3MM7A 4NEZA 3QO9A 2CQ0A 3GIIA 1X4BA 1TK8A 3S6EA 3LF0A 1Y3KA 3VAMA 1HNXJ 5GAGU 2R2TA 2CADA 3U27A 1WKLA 2HHPA 3DLGB 2IRYA 5CYMB 4KQZA 3IWXA 1OIAA 3W9JA 4X65F 1KP6A 2MKKA 5K8NA 1RTHB 1SIZA 3GONA 1NH7A 2RUSA 1JNZB 1YBUA 2Y1IA 4YR3A 1IBCB 1OJ4A 4OX8A 1HHSA 4OYOA 2IPOB 4B3OA 1VFJA 4ZITA 2G2YA 5AE2A 3QLHB 2K8GA 3S7RA 2DNPA 1ROFA 1FRJA 1GNKA 1GT8A 3CWJA 1WD6A 4WE1B 3DXBA 4J9OA 2DK2A 1RT7B 3QRPA 3OBIA 3TR5A 1B64A 4DSEA 2DRDA 2CQ4A 4RKUC 5KG3A 3K7RA 1CS4A 5GVQA 2QL5B 5KFRA 4YP3A 2A2DA 1WEXA 3CJ0A 2G2OA 4NYOA 3NCQA 4TNOA 3QIPA 3BYPA 2XGPA 2CJAA 1YLXA 2XS5A 2I5JA 2KO1A 5HQLA 2LEAA 2ZFHA 3IWLA 4ICLB 4P2FA 2MB0B 1U48A 3G71S 3V6DA 2WVCA 4NA1A 4OX7A 4NX9A 3PM9A 3I32A 4Z2XA 2NS1B 2C2DA 2YKAA 4C8KA 1OWXA 4WZMA 4RW9A 2ROPA 3IRWP 3SFUA 2PT0A 3QMQA 2B0GA 2UUCF 1IKYB 2X1GA 3DRSB 3HK2A 4ZHRA 2J9EA 2RS8A 3IWNC 1Y9OA 3GB0A 1K1SA 3TEHB 2QYCA 3MOZA 4EWTA 3W66A 2YH0A 4Q2LA 4KO0A 2B8QA 2VICA 5IT0A 1F9HA 2CVIA 1F3FA 3PR5B 4C3MA 2AU0A 4DV0J 5J2NB 5GAEU 2V69A 1FJ7A 1PG5B 3CJ3A 3T19A 3T6BA 2EI5A 5EHHA 4ZCLA 4GO7X 5DRKA 4XAKA 1N5YA 4ZVQB 1DQ9A 3GR0A 3MZIA 3KYLA 2EK1A 3ZZPA 2OEMA 1ZZNA 5J1EA 2RDJA 4UTGA 2VFVA 3ENAA 2R2RA 5JXSA 5IXUA 4RNMA 3KNGA 2VZ9A 5KFVA 2E5HA 1U1NA 2GV1A 2HQ3A 3NGTA 4OYMA 4BC7A 5KFSA 4UQGA 2BYCA 4NZ6A 1B3TA 2HHTA 4WP8A 3BZQA 4DF4A 1YRUA 4MFBB 3GG0A 2CPDA 4ID8A 1DZ5A 3CCTA 1YJNS 3OTOF 4DLEA 4N41A 2RQCA 2YKMB 3OLBA 3KLVA 2JEFA 3NNAA 4DS5A 2EK6A 3MM9A 2WRMA 3UFCX 3DGPB 4DV4F 3MMAA 5D78A 3EPIA 3J7AN 4DQQA 3KLIA 2BANA 2ZVSA 3CIMA 3OHAA 3K0JA 3MFHA 4TY9A 4OX9J 3SSQA 1HHQA 3M8ZA 4LREA 1X4FA 1VQSA 4GKJJ 2AYGA 4IQXA 1MMNA 4YB1P 4AL5A 2Q79A 4PWWA 2VC1A 1IKVB 3DI6B 1FHTA 1FCAA 2DHHA 3KLEB 3I56S 4FXDA 1M1KT 3G8TA 3OXLA 4N7TA 2RHSB 1WG5A 4G3IA 1WOPA 4UW2A 4ZP6A 5DM7Q 2FY1A 3B4DA 2EXUA 2R7VA 3UD3P 3HPOA 3LALA 4X4NA 1RWOB 1VGYA 3SEOA 4RZRA 5J2QB 2GVDA 3NXZA 4PPDA 2DHAA 1JLBB 2ZBCA 3TAMA 1CULB 4NMLA 1NDPA 4TY8A 1Y10A 3LPYA 1Z2LA 3HVTA 2BRKA 2PDAA 4UUXA 2Q43A 4NCGA 3G9CA 4OYIA 3CJKA 2AX0A 1RTZA 2EW9A 2NXEA 4I64A 5FLXY 1SXLA 1MROA 2NR0A 2X3GA 1N32J 4HHJA 4ZKAA 4DI6A 1G4CA 4RUCA 4RL1A 1U26A 2RMLA 3I96A 2KM8B 4DSLA 2CPZA 4OI2A 4G1IA 4F4XA 1NM2A 4FPIA 1XR7A 1KR4A 3OJSA 3I6PA 2FHKA 4EBEA 2W7AA 4NASA 3D3BJ 3DDIA 1I51B 1T03A 4M5GA 1GFWB 3HKZD 4X4SA 4ECZA 5IT9Y 2DIVA 2PMHA 1S9EA 4PWUA 1FWLA 3Q8QB 4XPEA 1R7IA 4OV6A 1WHWA 3BR9A 4DHVA 2M0GB 2H65B 3HD2A 4YEAA 1F60B 5KFPA 2OFHX 3G6XA 1JX4A 2KB2A 4MIBA 1LQ9A 2BEFA 2YPYA 5LXRA 1ZETA 2D74B 4BS2A 2OMOA 3EWGA 5A6WA 2DD8S 4E8UA 4MK9A 5C25A 4R5PA 2CNOB 2AGQA 1XMOF 4QR2A 4PUOA 4PRFA 2ZC3A 3VAKA 4OZLA 4B9VA 4A8YA 3KNAA 4WTYA 1C4AA 4HHHA 2V8GA 1FWPA 5GAHI 3BGOP 2BZ2A 3I5BA 2DPIA 2HHUA 5JVGQ 2OMLA 2M70A 5DLGA 2M7SA 2KXNB 1GMVA 3E3XA 1JXLA 1WDTA 4TQRA 4NLDA 3GFXA 3NGRA 5I3UA 1PBUA 4UY85 1RTDB 3E01B 1VQ7S 3W7BA 4PYDA 5FDLA 4OI0A 1JLEB 1R3NA 1VQMS 3VF0B 2NPIA 4FVMA 2D7SA 2HAIA 3FEYB 5JUMA 1PSDA 4OYWA 2CVEA 3HFKA 3DM2A 3I87A 2HNYB 3M1VA 5CYQA 4PWDA 3K2YA 1LW0B 4K0KF 3NL0A 1TFWA 2AIRB 2XEXA 2LMIA 2CJKA 1UVIA 1W26A 3HHLB 1JLGB 4G6VB 1TKTA 4CI0B 2HVIA 4N76A 5B08A 2B4VA 3ZTQA 1ITPA 1Y11A 3VAIA 3KHRA 1L3KA 3H2VE 5KFHA 1IBMJ 3CJSA 3TVYA 1X8DA 1NEEA 3PTWA 4C48A 1K44A 1GH8A 2JLGA 5JJBA 3TQEA 1JB0C 3VAHA 5DO2A 3NOGA 1BE4A 4GVLA 4MMOA 2QT7A 4LSNA 1XK8A 3CB4A 2G0CA 3DRPB 1VQKS 4A8KA 1DFDA 3EM1A 2ZD1A 4X62F 1RSCA 4MKYA 4DSJA 3G86A 1XN9A 2HLTA 4FVCA 5L1JA 4KH1B 2FGOA 1P9YA 4O4GB 1TL7A 4NLWA 4GKKF 4KHPF 4WPAA 3M6UA 3VAJA 3CDWA 1RHMB 1N0VC 3H4DA 2P9GA 1TUVA 2RQMA 2BKOA 5D8HB 3M30A 4CZCA 1RBAA 2DNKA 4EBDA 4LT6A 1UVMA 1RP5A 1JLAB 1YRTA 3R2DJ 4QYZJ 3KKFA 4ENOA 4A48A 2KT3A 3KJFB 1NRKA 4W92B 2IA0A 2ZEJA 1J5OB 1FEHA 2XTJP 4QU7A 3T1HJ 3M8SA 5L9XA 3AFGA 4V19J 4IG0A 4RWWA 1QLNA 3PRBA 5GADU 3PYEA 2FJVA 2D3UA 4OX6A 3I9ZA 4ZVRB 2KRRA 3BDPA 2BM0A 1NPPA 1PYSB 4HYKA 2EC2A 2GQCA 3D4JA 1PCAA 1UA1A 3QRQA 3GIRA 4WFNQ 3Q24A 5AXMA 1Q16B 3R7BB 3VQTA 1VQ5S 4BC9A 2IJRA 2QEXS 4MAKA 4NZ0A 3C16A 1FVSA 5MLCV 2DNLA 5D4PA 1VC6A 2ZM6J 2XB2D 2W25A 1E6YA 1KQKA 2DEIA 4WFAQ 2ASLA 3L9ZA 2RU9A 2ZH2A 4C8YA 4ZIVA 4DFJA 2KYZA 1ZS6A 1H2TZ 8AT1B 1AYEA 3BO4A 1VHFA 1CG2A 3VCDA 3TP2A 2MQNA 1RU2A 3LP2A 3M9NB 3H2LA 2R7XA 3KK1A 2XM3A 3LW5C 1RT2B 4IOCQ 3BYRA 3T1AA 1Q8BA 1UPMB 3OVAA 1PO6A 1RAAB 1TL1A 4I1TA 1X0FA 4JI7F 1TZ0A 1GK8A 2QFIA 4FF3A 3QJPA 4Z37A 2J0QD 3JTPA 4KPCA 1OS5A 4DR1J 1BQMB 5KG1A 4YR0A 4CNZA 2Y1JA 4LR7A 3DXSX 2KZZA 2WOMA 3LWMA 4ID5B 2NLWA 2ZVIA 3LQVA 2QMXA 2DR8A 1IBKJ 5L9NA 2QMUB 3MR2A 4DG1B 4N8OA 1KN6A 4CLKA 5KT4A 3OT9A 1T0TV 3MEGB 4UOHA 3ENVA 4ED4A 4ZLJA 1XNRJ 3UDLA 2OSRA 1EJ7L 1J5EJ 3AB4B 1RT5B 3NY0A 2VDHA 4Y2AA 2KHCA 4ED1A 2HQCA 3KDNA 4EBCA 4RNOA 1BQNB 3WX4A 3MECB 1HBUA 4DQPA 4DZ6A 2HNZB 4M5HA 4NA2A 2K7JA 4GC6A 4ED8A 1TL4A 1Q8LA 3H7HB 2HPUA 4RW4A 2K06A 4PG6A 1IM6A 3W64A 3N6MA 4LF9F 1TL3A 1Y3JA 3KOAA 5HP1A 1LW2A 1DTQB 1QY7A 5J2PA 4L6V3 3B82A 2JNJA 5T14A 1RAFB 5BYQA 4DPOA 2GAGC 2MJNA 4X4RA 3RYLA 3NBPA 3NMRA 4M5JA 5D77A 4EYIB 2APOA 3EXCX 1EP4A 3AXKA 4CIOA 4V19X 1SB6A 2CQ1A 1G1XA 4C8OA 5T7LA 2CQDA 2XLIA 4JI1F 1R89A 4ZCIA 3M2RB 1XMBA 2DEJA 5D3GB 5ETRA 3LAKA 2MKIA 3UR0A 4FPRA 4KR0B 1Z1ZA 4PAAA 3EDRB 1F2HA 4B3MJ 1WNEA 3MM6A 1QAXA 1TR0A 3Q86A 4K4WA 2XMUA 3PR4A 4ETZA 4L76A 1GTHA 1C1CA 2MMYA 2VG7B 4LF6F 2DXDA 4YMEA 1BXNA 1PKUA 2ASJA 1S0NA 4RW8A 4DV1F 1PILA 2ZWPA 2ZH1A 1CC8A 2KFYA 1EETB 3BSCA 3K5NA 1F5BA 3NAHA 5CZVA 3RBZA 1RKJA 2NXUA 2Z30B 4LFBJ 2RQKA 1T02A 4L74A 4QIWD 4M63A 2AEMA 1H73A 3UPFA 3LA0A 3MEDA 2ILZA 4DFKA 3IRXB 3DLEA 2P9CA 2C2NA 1N4LA 3FJ2A 1SQEA 4R0JA 1SJQA 2CJXB 4XIUA 1VDHA 2MLXA 4WFYA 3LP1A 3PX4A 1DRZA 1QE1B 2J76E 3IR5B 5ETKA 1HIYA 1HNIA 1PC5A 1UA0A 4QPXA 3BSNA 1VRTA 2IDEA 4KT0C 3LUYA 3CJRA 4F4KA 2MSSA 2Y8WA 2AD9A 1FDBA 4P73A 4WZQA 2UUWA 3BKFA 1WTBA 2H4WB 1UFLA 2VBWA 5IM0B 3KFWX 1V6HA 4HI1A 2B4PA 2QA2A 1XWLA 3BPSP 2FB0A 1HWJA 4ILRA 1NK7A 4NPOA 4A47A 3DLHA 5LSLA 4QU6A 1NK5A 2N4DA 3CPWR 2A6OA 1TFYA 1GEHA 4TVAB 5I3QA 5T41A 1JLQB 2NXCA 3HT3A 2VUGA 3GV8B 3R5CA 3PFOA 3PO4A 4F0MA 2R2UA 4DPUA 1L3VA 2WTFA 4LRFA 5F8NA 3DDKA 2BACA 2HWTA 2W1BA 3ILIA 1SC3B 4E98A 3SXLA 1D8YA 2KJVA 4AFFA 2EFGA 2E7WA 5E33A 3JSRA 1VC5A 2XHCA 1PBAA 2MKCA 2OLWA 1LWFB 4LBPA 4DR5J 2BRLA 1HWUA 3JQJA 3BREA 4J5OA 3TW0A 2HQFA 3CW2C 3HVRA 2YKQA 1FJGJ 1DQAA 3A8JA 3ETOA 4K59A 3UWTA 5KFDA 3MMBB 3BGUA 2XYGB 2HFOA 3CEDA 1R8CA 4ZP7A 3CJQA 4KFBA 2PE8A 4CTAA 1AW0A 1FE4A 2CPIA 2DB1A 2XZWA 1RTHA 7FD1A 5CA5A 1KVKA 5ETVA 4DXLA 4NLTA 1HQ2A 4ZLPA 2DNQA 1CEZA 2IYGA 3CD6S 4HACA 3D6TB 3UQSA 4NOHA 1HL6A 5ETQA 3MMCB 2V6AA 4DL7A 3A3OB 1JK9B 3IXQA 5DQGA 1RB0A 5KFBA 3G6VA 4ERDA 4KAIA 3QGPA 4LF7F 5CCMA 3E51A 5DDPC 1RT7A 3UW1A 2DNGA 3VWSA 4CLPA 2B4UA 1ZM9A 1WC3A 2NCKL 3QFWA 1S7IA 2G1DA 3BBFA 4NLVA 3RR8A 4XDCA 3LO3A 2HNDB 2NSBA 2WONB 1S6UA 3BH6B 2LEBA 1VRUA 2EVZA 1FESA 1FRIA 1RT6B 5BR8F 5MAOA 3HM9A 3RAXA 5L1LA 1KDNA 4HEA9 1D3WA 1DBDA 1FKOB 4NEYA 5LM7E 4ICLA 2O66A 4FBUA 3VALA 2WZ1A 4ZJQA 4USVA 1R8HA 2W01A 4OZNA 3TARA 2JEJA 1ZAWA 1S1XB 4F50A 2ZBRA 2M8DB 3U7JA 2RS2A 4X4QA 1Q53A 4C3LA 3OXGA 1T9TA 1V5IB 5B0AA 1QVFR 3P6YC 2UUAJ 2RRBA 4GVBB 3U1NA 2AGOA 1VCTA 4RO0A 5EDWA 2HW3A 1YIJS 2D9PA 4N56A 3FFIB 1C4CA 4HDGA 3DRSA 1VRQC 3N4WA 1T8EA 4DR7J 3KK3A 3W2WB 4OYPA 4G1QB 1DTTB 1RBOB 1U1LA 3LTOA 3FBBA 1U0HB 2CZVC 4MKVA 1AXQA 2YQ1A 3T5JA 3LGHA 1RDRA 5J2NA 2EFOA 5GMDA 4XPCA 3PJ9A 2IM3A 2F8MA 3DGVA 2YNIA 1B7YB 1BQXA 1RAIB 2JX2A 4NLUA 1RWKB 5KT2A 1SV5B 3C6TB 2BUNA 3CT9A 1NK8A 4EUVA 5EN1A 2VOPA 2BE9B 3IAS9 4OJ1A 2VQEJ 2ZOMA 2VA3A 3R7NB 2BOPA 4O4RA 3SBMA 4Z7CA 2DR6A 2VQFF 1N6QB 2WB1D 4MFBA 1SI9A 2CXEA 2Y1RI 2XYPB 4ZVUB 2YKMA 1NSPA 4KE5A 2OPRA 1RU1A 2EFPA 1ZA2B 2MZRA 3PCOB 5H1SV 1UJ5A 4IKAA 3DGPA 1U2RA 5D0GA 2VONA 1K1QA 3FBEA 3FEXB 2J7UA 1CC7A 5GAGI 1U6BA 2OAUA 1H7XA 2ZM6F 3D67A 1Q4RA 1I1GA 3IR7B 3MR3A 5IWAF 3DOLB 2V9WA 3E8OA 4I4BA 2RIJA 2CQCA 2OPSA 3CCMS 4PXCA 1T11A 5I42B 4IO1A 3TQ1A 1L3TA 1NDKA 3ITHA 3DI6A 1HBNB 2ZZMA 3KLEA 1CVJA 1OYDA 1OMSA 1BUXA 2HRYA 1CJVB 3FGVA 2DKOB 2GIQA 1YZ7A 2UXCJ 1ZH5A 4RW6A 2LU1A 3PW7A 4CP5A 2W2OP 1BLUA 4J90A 2V8VA 2OKQA 2WHOA 1W2IA
chains in the Genus database with same CATH topology
4AL6A 2Y1IA 4Q5VA 4YR3A 3DCAA 2VC0A 5J2QA 4OX8A 1HHSA 3OFHA 2NUUG 4WXOA 2W9CA 5J1PA 2JC0A 1A6LA 3THPA 5KFEA 4DFPA 1NK4A 4WJBA 3Q8SB 3PY8A 4B3OA 1VFJA 2QFJA 1UEVA 1JLBA 3PW4A 5M2RA 3FMBA 2K7KA 3QGGA 2ZH5A 1P8GA 4DL5A 2AGPA 5AE2A 1DHMA 3QLHB 1VK3A 3W2VB 4F8RA 2K8GA 2LQBA 1FKAF 3S7RA 4QW8A 2DNPA 1S10A 1SJ4P 1ROFA 1FRJA 1YG0A 1KRPA 5HMWA 4LQ9A 2B7BB 1GNKA 2HHWA 3WZ0A 4TU9A 1GT8A 3CWJA 5EGYA 3IN5A 2FVCA 1WD6A 5B0GA 2B6AA 3NGDA 3PO5A 2Z8QA 4WE1B 4EYHB 3DXBA 2KFNA 4J9OA 2FLOA 4F3OA 1IBKF 3O44A 1SH3A 4JI5F 4DV7F 1RT3B 2DK2A 3TANA 1RT7B 1L3SA 4I7FA 1HW9A 5DDQC 2UUAF 2AQ4A 3RB3A 4NWBA 2COLA 1Y4ZB 1S1TB 3NP5A 4KHRA 3OBIA 2CQGA 2GMLA 3TR5A 3RRHA 3T5LA 1V3ZA 4YDDB 1XNRF 4ECSA 5E2QA 3KK2B 1TKZA 2VODA 1B64A 1D8ZA 1U49A 4DSEA 1RT1A 4QYRA 4EFAC 3KK1B 1V9OA 1YGYA 2RNEA 3CMAS 1X7VA 2HYIB 2CQ4A 4RKUC 2UXBF 1VQYA 1J5EF 4M5DB 5KG3A 2F1FA 3K7RA 1QAJA 3V4MA 5GVQA 1D0EA 3GZ7A 2N4CA 5KFRA 3MAHA 3KLFA 2YWEA 4YP3A 3OVSA 2PI4A 3M8QA 4H4OB 2FJAB 1N48A 3NG8A 1AFJA 2MSTA 2A2DA 1WEXA 3CJ0A 4K4XA 4DR7F 4NYOA 1GXLA 3NCQA 2ZNZA 3GV5B 4TNOA 3QIPA 4EU0A 2IFXA 4QWDA 2XGPA 2QSWA 2XLKA 3F56A 2CJAA 1U6FA 2BM1A 3MHYA 2VPWB 2IA6A 1WHYA 4A4JA 2XS5A 3M2UA 3DHXA 4U7UK 3T1YF 2I5JA 1X4DA 2KO1A 1H2VZ 4NA3A 1TAQA 3M6VA 2LEAA 1X9MA 1DTQA 4UOCA 1NKCA 2B56A 4ED0A 4OHXA 2ZFHA 3IWLA 4ICLB 2KKHA 1P1TA 3P3DA 2K2PA 5HMZA 1ZOTA 2UVWA 5EX3A 2R7SA 2MB0B 1U48A 3D0GE 4ZCKA 3G71S 3V6DA 4C9DA 1DARA 4NA1A 1OSDA 1YWXA 4OX7A 2J6UA 2WOMB 4NX9A 1N56A 2HVHA 1T05B 3PM9A 2JVRA 3BR8A 3OR2A 1ZPWX 3QYYA 4B08A 5AXLA 3UI3A 4NL5A 1I94F 2BDPA 3B8HA 1HA1A 2BV3A 3RBDA 2R8JA 3I32A 4Z2XA 4I2QB 2U2FA 3DFEA 3MCSA 2E5LF 4WK3A 2NS1B 2C2DA 2A10A 2YKAA 4WFZA 5B7WA 4CT9A 4IO9Q 3V4IA 4LUBA 4C8KA 1VIOA 1OWXA 5KFQA 3X3UA 4WZMA 3M8RA 1VLYA 1T3OA 2ZH8A 4X2BA 3MM8A 4RW9A 1KOHA 1S1UA 3DMJB 2ROPA 1JIHA 2XNQA 3IRWP 2WSEC 5D3GA 3SFUA 1JKHA 1ZZFA