1JLCB

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with pett-2
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
427
structure length
402
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT A-chain
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 110
structure length 402
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlcB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcB04
4ID5A 1RTDA 3KK3A 4ZPBA 2B5JB 3UR0A 3LP1B 4MFBB 1HQEB 2IC3A 3PJWA 3KHGA 4O4RA 1T03A 1KHVA 3RB4A 5KT5A 3VQSA 5EWEA 1RT1B 3DLKA 4KV8A 4JV0A 1S1XB 2AQ4A 2OPPA 3BGRA 3KJVA 1JLBA 1IKVB 4WE1A 1C1BA 4EYHB 2R2SA 1JKHB 3PW2A 2FLLA 2FLPA 4ED3A 1HPZA 4IG0B 2IAJA 4MKBA 3NL0A 5KFNA 4JV2A 4MKAA 3GIJA 4KKOB 4FS2A 2OPSB 4O3SA 2R8KA 3LANA 4TQSA 1HQUB 1S97A 4PQUB 5KFYA 2ILYA 3Q8PB 2RKIB 3NAIA 4ED7A 4K50A 1FKPA 4RZRA 4J9NA 2ZD1A 3PW0A 1U09A 5DGBA 3FRZA 1S6PB 1JLGB 1TL1A 5HLFB 3KLHA 3IGVA 5KT7A 5J2MB 5DG9A 2IM2A 3DI6A 4KHMA 2W9BB 1TKXA 1REVA 3PR5B 3RBDA 3KLEB 2J6UA 2FJXA 2BR0A 2EC0A 1BQMB 3CJ2A 3JSMB 2JEJA 4ICLA 4RW7A 3C6TB 3MECA 5CYMA 2RDJA 2C28A 2FVSA 3DYAA 3V81A 3UPFA 3V6KA 3FSIA 3QLHA 2GIQA 3IS9B 1HQUA 2UVRA 1C0TA 3GQCA 1LWFB 4NLWA 2JC1A 3DM2A 4R8UB 1T05B 4KFBB 2XGQA 3KLVA 2WCXA 3SFGA 3CWJA 2ATLA 3BQ2A 4URSA 2IM0A 2VG6B 3I5BA 1JLAA 3DMJA 3DOLB 3IGNA 2IJFA 1IKWB 2R2UA 3DDKA 5KT4A 2JC0A 2W9BA 4J9OA 3G6VA 2VG7B 3KLEA 3I0SB 1LW0B 5KFCA 3HVWA 3JSMA 1RTJA 1C1CA 3ITHA 4IDKB 2GIRA 3GYNA 3HVAA 1S9GB 5L1KA 5DLGA 3DRPA 2BQRA 2FLNA 2C2DA 1S0MA 3TAMB 3QO9A 5HBMA 1S6QB 4NLOA 5I3UB 4NLDA 4PWDA 1VRTB 3LAKA 4MIBA 1JX4A 3PZPA 3FDSA 2ALZA 3JYTB 1WNEA 1T05A 3PW5A 4KFBA 5F8MA 4R5PB 4K4ZA 5F8GA 3QZ7A 4O4GB 1FK9B 1HYSB 3KMQA 1DTTA 1RT3B 4ECQA 1N48A 3H5SA 1CSJA 2VG5B 2ZE2A 3FQKA 3QGHA 5DQIA 3Q8RB 3CJ3A 4Q45A 5DGAA 1LW0A 4YP3A 1SH3A 4O44B 5KFIA 4I2QB 2I5JB 1RA6A 4WYWA 2JEFA 3KK1B 4TY8B 1QE1B 4NCGB 1R0AB 4PUOA 1UWBA 1EETB 1SUQA 4NZ0A 2YKNA 4XPCA 5C5JA 1DLOB 2RF2B 3RAXA 5KG6A 4I7FA 3V4IA 2AX1A 1BQNA 4ZHRA 3TAMA 5KFMA 3D28A 2YNGA 5J1EA 4LQ3A 1EP4A 5KFAA 3M8PA 5EWFA 4DL3A 2BANB 4B3OB 3JYTA 4ZVHA 3BSOA 1S9FA 3KK3B 5KFEA 4DL4A 1NHVA 5KT3A 3PVXA 4IRCA 2IC3B 1XR6A 5J2QA 5L9XA 1HYSA 3ISND 2IJNA 4MK8A 2FJWA 1HNVA 3DLKB 3IG1A 2HNYA 3TVKA 4IG3A 4KV8B 2ASJA 4IQXA 3KLFA 5KFRA 2OPPB 3KJVB 1JLBB 4WE1B 2W7PA 1C1BB 2HNZA 3N6MA 1GX5A 3BREA 1R0AA 1HPZB 4G1QA 1S49A 2IAJB 5KT2A 4J9RA 4F4YA 1S1TA 1ZTTA 3KLIA 3C6UA 1JLCA 3RBEA 4DG1A 2XCAA 2UVUA 1TP7A 4DL2A 4Y2CA 2BANA 1RDRA 4RUAA 4MH8A 1S0NA 2ZD1B 4WFYA 1SV5A 2W8LA 1HARA 1N6QA 1TL1B 1SH0A 1T94A 4M95A 3M8QA 5KFUA 3Q8QB 3E01A 3KLHB 2BQ3A 4LSNA 4KBIA 4IRKA 1DTQA 2WOMA 1KLMA 3DI6B 3KK2A 3CJ4A 1N4LA 4TYAA 1TKXB 2HMIA 5KG5A 1REVB 4LSLA 4U6PA 4J9KA 4Q8EA 2DPIA 3OL7A 4NLGA 1FKOA 4J9LA 2WK4A 4ICLB 4H4MA 3LP2A 4O3QA 4RW7B 5CYMB 3MECB 3MR3A 1RYRA 3RB3A 4ED2A 5EWGA 3DYAB 3V81B 4XPEA 3QYYA 3QLHB 5C24A 1C0TB 2CKWA 4I2PA 2WONB 1QUVA 3G6YA 3MEEA 2B43A 4WFXA 5KFTA 2AGPA 3DM2B 1S1WB 3CO9A 1VRUA 4QWAA 3MFIA 4ED6A 4KB7A 5KFWA 1W25A 4F4WA 1JLAB 3DMJB 1S0OA 1MMLA 1LWEA 4NLRA 4GC7A 1TVRA 1OS5A 4KSEB 1YVFA 3FFIA 2D3ZA 1JLQB 4RNFA 2C2EA 3I0RA 1RTJB 1C1CB 2QE5A 4OL8A 4WFZA 4O3OA 3ITHB 1TL3A 4WXOA 5K14A 4RW8B 4DL5A 3UQSA 3DRPB 3DRRA 1RYSA 4J9MA 3QO9B 5HBMB 2WONA 1QAIA 5JUMA 4PWDB 4RW9A 2FJVA 4IFVA 1KHWA 4IFYA 1S1WA 2W9CA 4Y2AA 5KFSA 3IN5A 2FVRA 4NLXA 5J2PB 1K1SA 4QWCA 1TV6A 4M94A 5CYQA 3BR9A 5F9NA 3NBPA 2R8GA 1C0UA 3EZUA 2XCPA 1DTTB 3KHHA 5KFFA 4G3IA 1SH2A 2ASLA 3ISNC 2ZE2B 4J9QA 1JLQA 2D41A 4O3PA 1IKXA 2R8HA 4RNMA 1RT4A 3MF5A 4RW4B 4PUOB 5C42A 1UWBB 4IH6A 1SUQB 4RW8A 2YKNB 5KG3A 2R8IA 4K4TA 4I7FB 3OSNA 2IM1A 3LP0A 3IRXA 1NNDA 3V4IB 3OL8A 1BQNB 4ZHRB 2JEIA 1TKTA 2YNGB 5J1EB 2B6AA 3RAQA 2BRKA 1S1UA 2UUWA 2W7OA 1EP4B 2ILZA 3M8PB 3QGGA 3H4DA 2YNIA 5C25A 5J2PA 5KT6A 1RT2A 2R2RA 5J2QB 2GC8A 4O3NA 5L1LA 4EBDA 4KHRA 1TKZA 1HNVB 3MEDA 2IA6A 1JXLA 1LWCA 1IKYA 4NLPA 2HNYB 3IG1B 4ECXA 4IG3B 4FBUA 3I5AA 3KLFB 3QGIA 3OLAA 3T5KA 5HROA 3M9NB 2HNZB 4KO0A 3QZ8A 4RW4A 4X2BA 4G1QB 3BSAA 3MR5A 2HNDA 3BSNA 5J2NA 1S1TB 4ZPAA 3KLIB 2V4QA 1S10A 3KNAA 3C6UB 1Z4UA 1JLCB 5KFPA 4DG1B 2FVCA 3BQ1A 2WRMA 2C22A 4ZPDA 4ECSA 3T5HA 4Q43A 2D3UA 4K4SA 1RTIA 3V6DB 4NLVA 5KFJA 5F8JA 5KG1A 2OPRA 3MTKA 3GILA 1SV5B 1N6QB 3CIZA 3HHKA 5FDLA 5F8LA 2V4RA 3M8QB 3E01B 3KMSA 4HYKA 4LSNB 4RW6A 2IM3A 2FVQA 1DTQB 2WOMB 1KLMB 3KK2B 3G86A 1MU2A 2BE2A 2HMIB 5KFDA 4LSLB 3KHRA 3PJXA 1JLFA 2E9RX 4K4WA 3KLGA 3TQ1A 1FKOB 5D3GA 4ZVEA 4QWBA 4O3RA 4H4MB 3LP2B 4IOBA 2JLEA 2YKMA 3QIPA 4DL7A 1RAJA 1RT5A 1S1VA 5C24B 3MR2A 4NLSA 4I2PB 2WB4A 1JLEA 3MEGB 3V6DA 4LQ9A 3MEEB 4DEZA 3NAHA 3DLEA 3DRSA 2W9AA 4ECYA 1N56A 4ZP7A 4ZMMA 3FQLA 2J6TA 1VRUB 4TXSA 1N5YA 1TQLA 3LAMA 2AGQA 3GIKA 2V0NA 2WTFA 4Y3CA 1LWEB 3CJ5A 3LALA 5I42A 1TVRB 3BSCA 3PW7A 5F8NA 3FFIB 5KG7A 3DOKA 3GIIA 5DG7A 4QW8A 5KG0A 3I0RB 5KFHA 5KFZA 3RB0A 3G6XA 3Q8SB 2D7SA 5DQGA 3EPGA 4H4OA 3H40A 3OHAA 1I6JA 4ED0A 1TL3B 1S48A 5K14B 3UDLA 4QWDA 5DLFA 1RT7A 1GX6A 3T19A 1LW2B 3DRRB 4J9SA 5KFGA 4J9PA 1RTHA 2BRLA 4EO6A 3MEGA 4IH5A 4RNHA 5T14A 3H4BA 3CDWA 2XI2A 3GV5B 4RW9B 3CDEA 3HVTB 4IFVB 4QPXA 1RT6A 4IFYB 4Q0BA 1S4FA 3H59A 4NLQA 5KFXA 5KG4A 4YR2A 2W9CB 5KFOA 5HP1A 1TV6B 1HNIA 5CYQB 2YNHB 4TYBA 3NBPB 3DLGA 1C0UB 4ED8A 1S9EA 5DG8A 2YNFA 4NRTA 2J6SA 2BQUA 1IKXB 2OPQA 3MFHA 2CJQA 1RT4B 1HMVA 4EBEA 4URGA 2XGPA 5F8HA 4HKQA 5C42B 3PR4A 3BQ0A 4JUZA 3D5MA 3LP0B 1LW2A 3IRXB 3CDUA 4KE5A 2XI3A 3T5JA 1TKTB 2B5JA 3LP1A 2B6AB 4MFBA 4ECTA 1S1UB 1HQEA 4FS1A 3GIMA 2RDIA 3HVTA 4EBCA 1ZETA 2YNIB 4NYZA 2IMWP 3OL9A 3M9MB 4MIAA 5C25B 4K4XA 1RT1A 3RB6A 3EPIA 1NHUA 1S1XA 2O5DA 1RT2B 2YNHA 2UVVA 1IKVA 1TKZB 3MEDB 2JEGA 1JKHA 4F4ZA 1IKYB 1LWCB 4IG0A 4RNNA 1C2PA 1J5OB 4U7CA 4F4XA 3V6HA 4R0EA 4NRUA 5HROB 4KKOA 3NKYA 4KO0B 2OPSA 3QIDA 2DPJA 3OLBA 3NMAA 2HNDB 5J2NB 4IR1A 4PQUA 4IR9A 4ECWA 2RKIA 3H5XA 4Q8FA 4NLYA 5KFQA 1S6PA 1JLGA 5HLFA 4TQRA 1RTIB 3MR6A 2XC9A 2HWIA 2HWHA 2VA2A 5J2MA 1XR5A 2OPRB 2FVPA 2C2RA 2E9TA 3CVKA 4ED1A 4ZP9A 5KG2A 5FDLB 3N6LA 3H2LA 4YR3A 5F8IA 4QW9A 4RW6B 4H54A 1BQMA 5KFBA 4K4YA 4F50A 3I5CA 3GV7B 1J5OA 3C6TA 1MU2B 1D1UA 2BE2B 4ECUA 4WZMA 5KFVA 2UVWA 3ICLA 1JLFB 4Y34A 2ZKUA 3V6JA 3KLGB 1D0EA 5L1JA 5D3GB 1ZTWA 3OHBA 4EYIB 4MK9A 3OSPA 2VA3A 3IS9A 2E9ZA 4IKAA 4K4UA 4ZVGA 2YKMB 1LWFA 2UUTA 3QIPB 5EDWA 3OL6A 2ASDA 3GV8B 4Q44A 3BJYA 1T3NA 2AU0A 1RT5B 1S1VB 5EUHA 4R8UA 2IBKA 4RU9A 1JLEB 2AWZA 5F9LA 4EO8A 4TN2A 2VG6A 3DLEB 3DRSB 4EEYA 3DOLA 2V9WA 2HAIA 2R8JA 4RNOA 1IKWA 1N5YB 4WYLA 2VG7A 2R2TA 3I0SA 4FBTA 5I42B 1IM4A 4JV1A 3M9OB 4IDKA 2XWYA 5DQHA 4ZP8A 1S9GA 3DOKB 3PHEA 3H5UA 4YMEA 3SI8A 3KOAA 4H4OB 1S6QA 4K4VA 5I3UA 3SFUA 5KFKA 4GC6A 4IRDA 1RT7B 1VRTA 1K1QA 1XR7A 4YR0A 3H5YA 3E51A 4ID5B 1RTDB 4KAIA 1RTHB 4MK7A 4R5PA 1RA7A 3PW4A 4ZPCA 2W8KA 1JIHA 1QAJA 2AGOA 1T03B 4O4GA 1FK9A 1RT6B 4Q0BB 3H98A 1RT3A 5JXSA 4TLRA 5KFLA 4ZVFA 3N6NA 2VG5A 5HP1B 4IH7A 5L1IA 1HNIB 3BGRB 2QV6A 3T1AA 3HKWA 3T5LA 4O44A 3DLGB 4ECZA 4I2QA 2I5JA 2WHOA 1S9EB 2AX0A 2I1RA 3KK1A 4TY8A 1QE1A 4NCGA 4RUCA 1EETA 2YNFB 4WZQA 3KHLA 2F8EX 1DLOA 2RF2A 3NGDA 2OH2A 3CJ0A 2OPQB 4WXWA 4NLTA 1HMVB 4QWEA 4ECRA 4URQU 4YQWA 4NLUA 4ECVA 4TY9A 4DL6A 4B3OA 4XO0A 4ZP6A 1FKPB
chains in the Genus database with same CATH superfamily
3KK3A 3LP1B 3KHGA 4Y2IA 4OJGA 2MZJA 4KV8A 2VJUA 1C1BA 3PW2A 5BYSA 2ZH5A 3I32A 4BCAA 3GIJA 4KKOB 1U47A 4F2RA 3Q89A 3CGIA 1YJWS 1X5PA 2YQ3A 3TWZA 4JI1F 2NQPA 4JI2F 1YK9A 3V5RA 3TAQA 2XLKA 2K2PA 1UVJA 3KLHA 1RQ0A 3LPYA 4CO3A 4DV3F 5L9NA 1YIJS 1RLCL 2EC0A 2JEJA 4UW2A 4OFZA 3GFZA 2O3DA 4ER8A 3IS9B 3EWGA 2VBXA 4YHHJ 3J81U 3CD6S 2DY9A 2AD9A 1VRQC 4CLYA 3C8YA 5B0CA 3AB4B 4C3KA 3O44A 4DR4F 4O0NA 3RR8A 4MIBA 3JYTB 3PW5A 1Y4ZB 1Y9OA 2YWWA 2GNKA 4DR5F 3Q8RB 4B3MJ 2LA4A 2ZM6J 3CJ3A 3NS5A 4WYWA 4NCGB 1LXJA 3FC9A 1DLOB 4PWWA 5HSPA 4F3QA 2G2OA 1WOSA 1SIWB 3QNWB 2RHQB 2IC3B 2N3LA 2FLOA 3WQPA 2BABA 2I0XA 1R31A 1JLBB 2HLTA 1G1XA 1R0AA 3C6UA 2Y1IA 4NI2A 3F44A 1T94A 3M8QA 5KFUA 4U95A 3M32B 2PGCA 2V2QA 4QPTA 3SSSA 4NLGA 1FKOA 2M8HA 4ICLB 2CWKA 1F6TA 1H72C 3FBFA 1FESA 4YHHF 2YVSA 4DCOB 1NZAA 4LR8A 3VGVA 1Y7PA 1VRUA 1MROA 5KFWA 4ZIVA 2YX1A 1K0VA 3MURP 4OL8A 3PYFA 4F4KA 1YJ7A 5DM6Q 1Y0HA 1PO6A 3P96A 5L46A 3BPDA 4IFYA 3FBEA 1WUUA 2L9DA 4B3MF 2ZM6F 4ETXA 4G3IA 1OQ6A 1OY9A 1SQGA 4RNMA 1G3OA 1LV5A 2XZTB 2BJ9A 2UUBJ 3MPVA 1HWLA 4WK3A 2F4VJ 4KTQA 3RAQA 4WFNQ 4OI6A 2W7OA 1QJHA 4ENOA 5C25A 2RAQA 3CCJS 1VQ6S 1BD6A 1X31C 4USVA 4JI8J 2NPIA 1UWAA 1AYEA 3DGVA 3AA8A 3BN7A 2PD1A 1CULB 4C0BA 1ZM3A 5F8LA 1IQZA 4LSNB 4RW6A 2WOMB 3G86A 4GO7X 3TQ1A 4O3RA 1IJFB 3CJKB 2R7TA 4G1IA 2LQJA 2V2KA 3NAHA 1VQ8S 7FDRA 3QFWA 3GU0A 1OYEA 2C42A 4OHYA 2RRNA 1FJGJ 4L73A 3WHIA 1RWNB 3OHAA 3EMTA 4AYBD 3UDLA 3HVRA 2F1FA 2XNRA 2BBEA 4LF6F 2KDOA 4NLQA 2E1AA 2XS5A 4ELTA 1NKBA 3Q24A 1RAHB 3MD3A 3TUIC 5DG8A 2UUBF 2CNOB 2F4VF 1XNRJ 2DHXA 4OZNA 1TAQA 4FS1A 3VVTA 4FP9A 2CJKA 4JI8F 4NXNJ 3MAQA 3MEDB 1JKHA 3P5TL 3HF5A 4F4XA 3D67A 3QIDA 3OLBA 3SBMA 4IR1A 2M9KA 3VHQA 3MUMP 3I87A 3H5XA 4QR0A 1JLGA 2GQCA 1L3VA 2HWHA 4ANEA 5J2MA 2G13A 3H2LA 4K4YA 4ZVRB 2HQGA 1H3DA 3OV7A 4Y34A 2ZJPQ 2P8IA 2DNKA 3LTOA 4R8UA 1RAAB 4EO8A 1GMWD 1WELA 2HBQB 4TNOA 3SIPB 2OD6A 4PXBA 5A8KB 2G9OA 4G6VB 2MY7A 2ZH6A 3BO4A 4KAIA 3W64A 2GJIA 3PDNA 2CG4A 1PCAA 2QV6A 2B7BB 3DLGB 1PJ6A 1EETA 2QT7A 2NYHA 4OYWA 1O5JA 1PG5B 4JOUA 5U47A 1RE1B 2I2YA 4B08A 4NXNF 3C46A 3FMWA 1RT1B 1WHVA 4ZLNA 1S1XB 1PBAA 2QL9B 3WC0A 4UOCA 1TU0B 4CLWA 4NA2A 2B4VA 2LQBA 4ITSA 5B0DA 2CPFA 3ZTPA 5BJRA 3MEKA 2BR0A 5CA5A 3HSGA 4CP5A 8ATCB 1VCTA 1YJNS 1N5VA 4P72A 1VBYA 4ELUA 1RACB 4P2MA 4ZVTB 2HWTA 5CAAA 1R43A 3HSJA 3IGNA 1ZYQA 2XZDB 1VISA 2H1YA 2JVOA 4DR7J 5IQ6A 4CLKA 5KFCA 1C4CA 3ETOA 5FJ4A 2GIRA 1LOUA 3DOMA 1XBWA 2EKNA 4CO1A 3J7ZT 1EIYB 1F3FA 3P6YC 1TUVA 3G6ES 3QT8A 5AXNA 3I55S 4DS4A 3ZZPA 3SXLA 1FDAA 1U1MA 2RF2B 1VBXA 1Q82T 2EFGA 1V6HA 2J9EA 2IJNA 1WI6A 5MAOA 2FD2A 3KJQB 3VGSA 3UR3C 2W7PA 5E3AA 3BREA 1FRXA 5KT2A 1EX8A 3R5JB 4AUKA 1VDHA 4Q7AA 2FHOB 1FEEA 4YN3B 3Q22A 4KBIA 1FDDA 1GQEA 1JXVA 2WK4A 2J0SD 1BHNA 1UL3A 2F8MA 3QLHB 2Q79A 1FCAA 4DR7F 3POTA 2LDIA 3I0RA 4WFZA 5K9FA 3I56S 4J37A 3AHPA 1SKUB 3M2VA 3DRRA 3QO9B 5HBMB 3PJ9A 2HHTA 5E3RA 2GJFA 3OR2B 2FVRA 3LO3A 3WX4A 1F9HA 4LUBA 2R8GA 4F04B 2DR7A 2ZE2B 2E5IA 3EDRB 3W61A 5A6PA 2J0WA 3DLLQ 3EGNA 3DU6A 2W2OP 2P5VA 1TAUA 2XS2A 4NLPA 4IG3B 3KLFB 3OLAA 3SCIE 3BGUA 4F2SA 4F0KA 4Y65A 5J2NA 1S1TB 2V4QA 2DGSA 1BGXT 3T6BA 4ECSA 3C15A 3N01A 3OFGA 4DQSA 4A8FA 2FVQA 5AXMA 4ETZA 2C3UA 2KG0A 2CG8A 3QIPA 2KB2A 3AB2B 1UTAA 5F0UA 4M5DB 1EKRA 4C48A 5HATA 2H5EA 4LF1A 1M5SA 1S5ZA 2LQ9A 3D2WA 3R5DA 3AQOA 1JQGA 1W2IA 4L75A 2JNJA 4QW8A 5KG0A 3KNGA 3H40A 2OMOA 4ED0A 4WPAA 4KPCA 2BKPA 7FD1A 2Z57B 3MM8A 5GMDA 4WIQA 1CJUB 3Q83A 4LVNP 5JVHQ 3ZFVA 4CO0A 3W2VA 4EBEA 1WC6A 2PC6A 4WP9A 4G65A 3LP0B 3NP5A 3LP1A 4R25A 1S1UB 4OJHA 2FGOA 4DCJB 3KUHA 2R7XA 3CNQP 3LW5C 2RUSA 3FSXA 4KKOA 4PZVA 2R3VA 4X65F 1R8PA 3NXZA 4NL5A 4DSFA 4IR9A 4C8KA 4NLYA 2UU9J 4WWSA 5CABA 4TU8A 2FHJD 5KAKA 1IVZA 1CJVB 2HEKA 4M5MA 3H25A 2MKJA 3GJTB 1K73T 4WZMA 2ZC4A 3ICLA 4N7TA 3VQTA 4Y00A 3IS9A 4ZVGA 1WKJA 1NM2A 2AU0A 1PYOB 1JLEB 2ZWOA 1BUXA 1N5YB 4A46A 1WEZA 1NJWA 2KZZA 4YMEA 2G4BA 3KOAA 2BJ1A 1T0TV 1JMTA 3DRXA 4ZIWA 1GXLA 2YPYA 2K3IA 1T8EA 4P75A 3JAMU 3B54A 4NCGA 2YNFB 1DLOA 3BKFA 3TJ9A 4KC5A 1UP1A 4ZPBA 5E3PA 2IC3A 1T03A 1WC4A 1JLBA 4Q2LA 2FLLA 3NL0A 2PT0A 3JSRA 1IN0A 3JAMY 2W01A 3LGMA 2ZC3A 5DGBA 3FRZA 1O8BA 1KRPA 3FBCA 3M32A 2AJ0A 3CCVS 2C3OA 1U1PA 1ZH5A 1X9SA 4ICLA 2RDJA 2FVSA 4DR2F 1RGVA 4FN5A 3FSIA 3MMAB 3KJNB 4ZCLA 4NLWA 4DQPA 2HFUA 4N76A 4KFBB 2FQQB 3IMQJ 4HHHA 1M5OC 4DLGA 3DOLB 3TRGA 1PYTA 4FXWA 4CDIA 1EZZB 1U2FA 2LA6A 1S0MA 2HFZA 3HHLA 1HYSB 4C0OC 1RT3B 4ECQA 3ILLA 1RCXB 2ZNYA 3AJ1A 2KHCA 4Q5VA 3TAMA 4A8WA 3EXCX 2BANB 2UUAJ 2DTJA 4E8UA 2DXDA 1X0FA 2FJWA 2IBOA 4NEYA 2NUHA 3TYTA 1VJWA 3RBEA 2VFUA 2P6TA 3I31A 1CULA 4X4OA 1S0NA 1WC0A 4LSNA 3M8WA 3DN9A 2WOMA 3BO2A 1YG0A 5AE2A 2ZDPA 2BVZA 3H7HB 3CJKA 3W62A 4DCPB 1ZAVA 1C0TB 4HTJA 4MJKA 2EG2A 4OYPA 1OS5A 4J9VA 3QRQA 1QTNB 1OWXA 1NHKL 4DL5A 5H9FK 1EJ7L 1U1KA 2WONA 4CCHA 1QAIA 2FJVA 3ENAA 3AOCA 3EZUA 1UMJA 4PXCA 2G0IA 4PUOB 3DLHA 3F41A 2AYEA 2M88A 2JEIA 2BRKA 4OZ3A 4C9DA 5HAOA 1QM9A 1URNA 3MEDA 2N3OA 1Q8BA 1TK8A 4UZBA 3OFFA 3OFHA 4HI1A 4ZPAA 1BWVA 2BKOA 3BQ1A 4PQAA 3MM6B 2D3UA 4K4SA 2E5GA 5F8JA 5KG1A 3ZTOA 5LJ3Y 5G0RB 1D9AA 2CQIA 1S12A 2IM3A 4M5GA 3EZOA 3L7PA 1J5EF 2R4FA 2JLEA 2DH8A 1X4DA 4NLSA 4ATNA 4I2PB 1QVFR 5EGYA 3P3DA 4N8NA 4OQJA 5IM0B 3ZNJ1 2YWFA 2KM8B 4NX9A 1AROP 5A8KA 3VV2B 5GAHU 1NJIT 3MR7A 3MEGA 2C2OB 4IFVB 2GGPB 2MLYA 2YNHB 3DLGA 2GVDB 4DR3J 4H4KC 4ZPWR 2L3MA 3B4DA 1JNRB 3UD5A 3RBXA 1LW2A 1KOOA 3W3SA 1SKSA 1DZ5A 5IWAJ 4C8OA 1RT1A 1S1XA 1OSCA 2DR5A 5D4OA 1TKZB 3TQEA 5B0AA 3K59A 2BMBA 2KN4A 3NS6A 3K57A 1H38A 3NGUA 2H3EB 2HS0A 3E8OA 5KFQA 3AXMA 5F3ZA 1RTIB 3KYLA 5CD4A 2OPRB 2FVPA 1RB0A 2QSFA 3GG0A 3TEHB 2HQCA 4EK2A 2DNLA 3V6JA 1VS3A 4DN0A 5D3GB 5L1JA 4EYIB 4LT6A 2P9EA 1S1VB 4PABA 3T1HJ 3FBBA 2A3JA 1WC3A 4NASA 2L9WA 2R8JA 2WB1D 4DZ6A 1UVLA 4JV1A 3DOKB 3SI8A 3AJ2A 1K1QA 2HHPA 2N7CA 4ZA1A 1CJKB 3DFEA 1S6OA 5GAGU 3G8QA 2RNEA 3T5LA 2QRRA 5E7OB 4X4SA 2V2VA 2GW8A 2RF2A 4KQZA 3LH2S 4URQU 1KONA 3M8YA 4NLUA 3BPSP 1NZ8A 1X4BA 1KDNA 1KHVA 3KJFB 2R9LA 2AZ1A 5DM7Q 3M8SA 4TQSA 2GO9A 1UPMB 2HFOA 4J9NA 4OZ2A 2I8EA 1N34F 2W2MP 3W5ZA 2UXCJ 4JB8B 4LFAJ 5B09A 3J7AN 3CJ2A 3PIPQ 2AYGA 3V6KA 1RBAA 3QLHA 3O2IA 1NPPA 3MPDA 3TUJC 2V2ZA 4XAKA 4DPTA 1NDKA 2P6SA 2XGQA 1WDTA 4D3HA 4DQQA 1TUWA 5DJBA 3HVAA 2VBYA 4DPYA 2FY8A 2ZH7A 3QO9A 5HBMA 4NLDA 4KPYA 2HQIA 4ZVOB 1T05A 3OR2A 3MMBB 1F2HA 3CSKA 2L9NA 2ZE2A 1T9XA 4LR7A 4DR6J 4NZ0A 3W9JA 1P8GA 3L95X 2WVEA 5IQQA 3HM9A 1HHQA 2LP4A 2HW3A 4IG3A 3KLFA 2W25A 3GJRB 2X1AA 2VOPA 1S1TA 3IWNC 1TP7A 3TP2A 3QJLA 2B51A 1S0VA 3FCWA 3P4UB 4LFAF 2DISA 4NYOA 1REVB 2NZCA 4PRFA 1UEUA 1GH8A 1U49A 4M5DA 4IO9Q 3F73A 2KRRA 2JHEA 5ITHA 3DM2B 1S1WB 3K5OA 4ED6A 1Q5YA 1WF2A 2C3MA 4ZLPA 3DMJB 2MKKA 1TR0A 1JLQB 2C2EA 1D9FA 5HVFA 2AMCB 4WXOA 4J9MA 4DL0C 3DHXA 3KTQA 2QLWA 5KFSA 3RZAA 2NSBA 3EUNA 2CQ0A 2H54B 3HZGA 4J9QA 1AFIA 2C2NA 3JXOA 1SQFA 1SUQB 3LP0A 3M6VA 1U02A 2B0GA 2L41A 1S1UA 3K5PA 2D74B 2HSEB 3GYXB 5KT6A 2EK1A 2GC8A 1PYSB 3I5AA 4CT9A 1AZSB 1IBKJ 5CZXA 1VIOA 2ZHBA 5GAHI 4Q43A 4P7VA 2JLFA 1CJVA 3MM5B 2Q3PA 3A3NB 2VODA 2NZ4A 1KSPA 1H2UX 2MLXA 4IOBA 5HMZA 2MKYA 4CLLA 4OJ3A 2DGUA 1JLEA 1N5YA 1AA1B 2XMTA 2RDDA 2V0NA 4RJVA 2WTFA 1XWLA 3BSCA 2IRUA 4EFAC 3BH6B 1PIEA 1SJ4P 5DLFA 3W2WB 5THWA 3OTCA 2ABYA 2KT5A 2ZJQQ 1YJVA 5KFXA 5KFOA 2CQDA 1S72S 3U1LA 1FTRA 2JVRA 4QZVB 4YFUA 2YNFA 1UVKA 3WDOA 3TUPA 1RT4B 4JUZA 3CDUA 3BBCA 1TKTB 1ZETA 4CO5A 3Q2TC 2W1BA 5IV4A 3HDSA 2O5DA 3R7NB 2VICA 1IBKF 2BEFA 1H2TZ 5AT1B 1C2PA 1SKRA 1X5TA 4R0EA 2G1HA 2JFDA 3QRRA 1WF0A 2Z56B 1QTMA 5AXKA 2HVIA 5IS2A 1TZ0A 2M2BA 5GAGI 2WSEC 4WKRA 1K9MT 2XMMA 4F50A 4NXMJ 1KQKA 1IJEB 4J7CA 2E9ZA 4MK9A 2A6OA 8AT1B 3MMAA 2YKMB 3OL6A 3MOZA 3DRSB 1HR0J 3DOLA 2G1DA 1UZDA 2HAIA 6AT1B 1VQKS 1R8HA 4DXLA 2HLUA 1IBMJ 3AODA 3IA0A 3CMES 2VPXB 4ZPCA 4KJIA 2DNYA 1G7CB 2RQMA 1RT3A 1B70B 1HNIB 1OPIA 3OTOJ 3OVBA 4B9TA 2V8DA 1TMJA 1PJ7A 1QVGR 2LEAA 4W90B 4CTAA 5LXRA 5IOLA 2ZITA 5D0RA 4MKBA 5KFNA 4F0HA 2AJ4A 2IDLA 4O3SA 3NGKA 4DUZF 2RKIB 5DDOC 1FERA 3QJPA 1U09A 2VV5A 4NXMF 1L3KA 2W9BB 4C8LA 3RBDA 3KLEB 2IHR1 1BQMB 4DDFA 2Z2MA 2C28A 2GHWA 2VQFF 2FDNA 4LF2A 1C0TA 2HGMA 3SYZA 4QCLA 2PEBA 3O8WA 5ETNA 3IBCB 3KLVA 3SFGA 2MMYA 2LXUA 4B3TF 2VG6B 1ZM9A 4IOCQ 2K1RA 1IBMF 3OD2A 3MOJB 1KEKA 1IBLJ 1EHWA 1TL4A 1VRTB 1YRXA 1E6VB 5F8GA 2MTLA 5ETPA 1FRLA 4K0KJ 3OTOF 2R7UA 3T6JA 4PUOA 2XYHB 4LBHA 4TVAB 5B08A 4P9SA 1V3ZA 1N54B 4J9RA 5MLCV 3HCXA 2DGQA 2PMHA 3MM6A 1LEOA 2GVZB 4PYAA 2OELA 4E98A 4MH8A 2FHJA 2VL1A 5G0RA 1NJZA 2KYZA 2F65A 4IRKA 3D6TB 3CJ4A 4TYAA 3OL7A 2JX2A 3BN4A 3V81B 4I2PA 3BEGB 3EVWA 2DH9A 2RSQA 2BZ2A 2NSCA 2VDIA 2QO3A 5IM0A 2RVJA 1S0OA 1VK8A 3ZZ0A 4B17A 3GPAA 4ES3A 3WC2A 1UVNA 1RTJB 1VC0A 2ZBCA 5LMNJ 2J8AA 4RW8B 2X51A 4L3KA 4IFVA 2GGPA 1FX4A 2F9JA 4K0KF 4LFCJ 2GVDA 1F1BB 2D41A 3DDIA 3MMJA 3PYGA 4GKJJ 3ZZUA 3V4IB 4CIOA 3H4DA 4DBQA 3D0HE 4U7UD 5L1LA 1ZM4A 1TKZA 1HNVB 4A8YA 1KVIA 3NOCA 3M9NB 1OMSA 4NEZA 4I68A 4WU3A 2VPZB 3D3BJ 1BXNA 1RTIA 3V6DB 3TA1A 2CADA 2OPRA 3S7RA 3H90A 4HYKA 2WSCC 3KK2B 4PCQA 1G4CA 4B9SA 2HMIB 3I82A 4LSLB 1DFDA 4DV5J 5D3GA 3GP9A 3FZBA 2DYAA 4C6AA 1S1VA 2UXBJ 5GMEA 4LQ9A 2YBVA 1Q5VA 3J80U 4LJMA 3A1YG 3DOKA 1KNZA 1RKJA 3GJQB 5ETKA 1UJ6A 2CJAA 1JXEA 1RU1A 3T9NA 2CPYA 4EO6A 4IH5A 1CJKA 3CDEA 1VQLS 1CPZA 4Z7CA 4TYBA 3C16A 5AJ3F 3PYDA 1CVJA 4NYPA 4GKJF 3LGNA 3J80Y 4AXJA 1IUJA 4E2FB 2GZOA 4OIXA 4F02A 1HIYA 1U1QA 1RT2B 2YQ0A 4YUDA 5K8MA 4AD6A 2H5JB 1J5OB 2B4PA 1KVJA 3A3PB 1Y11A 3RW6A 3VZHA 2KI2A 5F41A 3HULA 3U1MA 3CC4S 1Y5IB 4BLGA 5DRKA 3FJ2A 4DV5F 1KN6A 2LLZA 2HQDA 2BE2B 5CCLA 1JLFB 5HK4A 1D0EA 2UXBF 2F8HA 1N5TA 3HJVA 5GAEI 1GT8A 4K8RA 4DF8A 2KJWA 3EGVA 1H0HB 3OXLA 4HHJA 2MY8A 2XWYA 5DQHA 4CLFA 2CZ4A 4QQBA 3HD1A 3G2XA 3QGPA 2V8PA 1UEVA 3MMBA 1QSLA 2PN6A 1FD2A 2J9DA 1Z2ZA 3HKWA 3BBBA 2AX0A 1VQMS 4R0JA 4DL6A 1QSSA 4HT7A 4XO0A 3MM9B 5LM7E 2B8PA 3Q8YA 1DQAA 3I96A 1M5PC 5DO2A 1IKVB 2FLPA 3SMZA 4IG0B 3Q23A 3JTNA 1MN7A 3HJFA 4ANCA 4X62J 3QJJA 3H20A 2MKCA 1REVA 5GMKa 4UY8T 1SXLA 4A4JA 2KT3A 4NA3A 4XIUA 3DM2A 3K2YA 3DMJA 3CF5Q 3PFOA 2V63A 3DDKA 3Q8VA 2VBWA 3QRPA 1ZOTA 3BO3A 3UN5A 5LSOA 1N0VC 3FDSA 4Z37A 1QUPA 3D1OA 4FNHA 3PX4A 4QIVA 2WBMA 5J1NA 2GAGC 2JH3A 3QGHA 5DQIA 1LW0A 1RA6A 2JEFA 1R0AB 1SUQA 1RWVB 2ALYB 3VAHA 5ETTA 5FIIA 1VHFA 2LECA 1XMOJ 3TA0A 4P6QA 2DHAA 1QY7A 4ZCIA 1RP5A 2V4JB 1AZSA 2AP6A 1KD1T 5A8WB 3N6MA 4F4YA 4YB7A 5G4DA 2PMWA 4LFBJ 4CNZA 3CC7S 3MM5A 2MXYA 3R1HA 3G8TA 4U6PA 4J90A 1HD0A 2EW9A 3AJDA 3B82A 2F40A 1YRUA 5KFTA 2GMJA 4GC7A 3FCVA 2E66A 4KSEB 1YVFA 1KQFB 2ASYA 4OHWA 3G9CA 1Q8LA 1N5SA 1M5KC 4C98A 2QL5B 3NGRA 4PWDB 1KHWA 5H9EK 2AZ3A 2D69A 1DTTB 1NK8A 1AFJA 2Y9HA 1WC1A 1RCOB 1RT4A 3HSZA 1Q8IA 2QGFB 1TKTA 3GIRA 5J2PA 2VF3A 1R0CB 1AW0A 2XMWA 2HNYB 1CG2A 1YBAA 4CYUB 4UUXA 3C2PA 5C2CA 2LEPA 4DV4F 3X1LB 3T5HA 3UN2A 4NLVA 3QFHA 2PFFB 5ETLA 5EN1A 1DTQB 3N5BA 1W26A 3N4WA 3PJXA 2VFTA 1NSAA 3LP2B 3NG8A 2YKMA 1ACMB 1FT8A 3GONA 3L9ZA 2WB4A 4JI3F 3DRSA 2APOA 2LQ5A 4RBTA 2J6TA 1P9YA 4FYXB 4K5RA 3TZXA 4ZVQB 5DQGA 2V34A 1GX6A 2V5HG 3T19A 3S8SA 1Q0NA 5A0YA 4RNHA 2W9CB 1S57A 1SQEA 1HNIA 3FSYA 3CPWR 4ANDA 2DR6A 2BOPA 2DITA 5C42B 2CVEA 4C2MA 3UI3A 4DU8A 1FI4A 2CA9A 3FNNA 1D3WA 3VAJA 3BV8A 1YITS 4GKKJ 2RKIA 1L3SA 2CIMA 5HI7A 3L3CA 2CJ9A 2NCKL 4KHPJ 1HA1A 2KKHA 2XC9A 2KRBA 2C2RA 4ZP9A 5KG2A 2ZVSA 3GB0A 1BQMA 2FZGB 4USJC 1MU2B 2D9OA 4QJVA 1N8RT 1RWXB 3CDBA 3OHBA 1OY6A 4WU2A 4FYDA 2VG6A 3EXYA 5HO4A 1LNQA 2XTJP 4GO5X 1KQGB 1LK7A 1U1LA 3E2EA 2XMKA 3EICA 4GC6A 1OQ3A 1VRTA 3H5YA 3E51A 1E6VA 4B9LA 4S0MA 1FXRA 1E6YB 4IH7A 3T1AA 3FVYA 3OUYB 4RUCA 2F8EX 2HFSA 4PYDA 3QBCA 2DNGA 4QWEA 3CDAA 4ECRA 3CCQS 1ZPWX 4DX6A 2BM0A 1RTDA 2HVEA 3J7Z5 4NPOA 4YDXA 1HBMA 5KT5A 3PG9A 1U45A 4GKKF 2VFRA 3GJSB 4ZS6A 4FS2A 4RZRA 2R7VA 4KHPF 2VKZG 4B3SJ 4FYWB 1T9TA 3IGVA 3O5TB 4ZPTR 1UETA 2DB1A 4U7UK 3U1NA 3JB9k 3V81A 2BOAA 4B9NA 3AD8C 1WEXA 4BBYA 2XEXA 4C8YA 3BQ2A 2QA2A 2U2FA 4J9OA 3HVWA 1RTJA 1BY9A 3HHEA 2OAUA 1QAXA 1WD6A 3A3OB 1X5SA 1JX4A 3HLUA 1R8AA 3C3LA 3CCES 4KRWA 1M90T 4AL7A 1FK9B 1FDBA 1RI7A 4O44B 2IA0A 1VQ9S 3RAXA 3V4IA 1QDUB 3SCKE 4ZVHA 1Q86T 2EFVA 1B7FA 2RH3A 4MK8A 1HNVA 2Z2ZA 3TA2A 2E44A 3TVKA 1H98A 3B78A 3J7YU 2MZ1A 3K89A 5IV3A 2HHVA 3DDNA 4B3SF 4DV7J 1HBOB 3R8YA 4XK8C 4XTTA 2UP1A 1RHKB 4QWAA 3KK2A 2HMIA 2E7XA 4LSLA 1NMEB 2DNNA 5IXUA 2CFXA 5E33A 5CZVA 3ZZRA 2VPYB 2WVFA 3QYYA 3TX8A 1FRKA 2WAQD 1QUVA 2FJDB 3G6YA 3HHLD 1JJ2R 4KB7A 1RZMA 3IR6B 4OZ5A 1JLAB 5H9EJ 1T9VA 2KZMA 1RK8A 4O3OA 4FXVA 1R3NA 4GRSA 1LQ9A 3BS9A 2EBGA 3AY0A 3TANA 1A7GE 3P45B 3M2RB 2ZH2A 4QWCA 2ADBA 3DLJA 4JV5J 4TLQA 5KFFA 3PCOB 3ISNC 1F9EB 4M63A 4USIA 1LK5A 1UWBB 2ZNZA 1XJWB 4OI3A 1KVKA 3DLBA 4DSEA 2AJFE 1HI8A 1MLAA 2HK3A 1RT2A 4O3NA 4KHRA 3D4JA 1XIQA 4A8QA 2J9CA 3QGIA 3OPKA 3W7BA 2DNOA 1RWMB 3CE8A 3BDPA 4DG1B 2Q6CA 2WRMA 4PXDA 5BYQA 2BW2A 3P49B 2K7KA 4OI0A 2Z58B 3GILA 3G87A 3HHKA 2VH7A 3E01B 4LBPA 1D8ZA 2HPUA 3KUGA 4DJBA 4FF3A 1MMNA 1H2VZ 2BE2A 3KHRA 1JLFA 3PTWA 4DPXA 4CH0S 3RG6A 2QMXA 3P8BB 3AXKA 3ENVA 3F0NA 3JS9A 1TTHB 1NB7A 4ZP7A 4ZMMA 1ITPA 3MM8B 3L7OA 2VC1A 5DZ7A 4MKYA 2HVDA 3TX0A 3G6XA 3Q8SB 1I6JA 3HP6A 4OLOA 4DF4A 2QTWA 5HMXA 4JV5F 4YR2A 3LOUA 1VQNS 2AHOB 3TR5A 5KOWA 2UXDJ 1N5QA 2HFNA 5BXIA 4F3MA 1X4AA 1SL1A 3ZXWA 2NXUA 4P73A 3D5MA 3MM9A 3UNGC 2W4PA 2XSFA 2YX4A 3OL9A 2P9CA 4DMZA 4M5LA 1ZPVA 3OJUA 1IKVA 4IG0A 2ZH4A 1NKEA 2HS4A 2C1EB 3NKYA 6FD1A 2DPJA 2HNDB 2ZZMA 3TI0A 2RILA 2GO8A 4M5HA 4V19X 3UCGA 2EFOA 3GWCA 3WBZA 2PO4A 1ZTWA 2HG4A 2GV1A 4JI7J 2CPIA 2UUTA 3TVZA 5HVHA 1FVQA 3NNCA 1DY3A 5EUHA 4UTGA 1NUEA 2E7WA 2R2TA 5F3TA 3THVA 5I42B 3K7RA 2GS8A 3PHEA 2O01C 3NS7B 1HWIA 4YR0A 2DJWA 2WVCA 2MKHA 1BMQB 2VB6A 4U67Q 1JIHA 1T03B 2HGLA 1RT6B 4Q0BB 2UXDF 5A8RB 4IQMA 4FZVA 4K59A 1FE0A 4QIEA 2POKA 1NJXA 3K8WA 1Y3KA 4ZCMA 1RAFB 5HQ8A 5D77A 3HFZB 5EWEA 1O51A 4JV0A 2V4JA 5A8WA 3RTVA 3Q0AA 1RKIA 3TOQA 5DDRC 2R8KA 1T9UA 3NAIA 3GFYA 2G0CA 1U1RA 3AOAA 1S6PB 5IFMA 1WG1A 4J5OA 5KT7A 3GE9A 4EMDA 4OZ1A 1WACA 2XQCA 2M4MA 4U8YA 4JI7F 1Z2LA 3DHWC 2HGNA 4NMLA 1AB8A 1HQUA 4OMFG 3GQCA 3D3CJ 2VQEF 1F9FA 2JC1A 4OV1A 2WW8A 3HHLB 4WFBQ 4LF6J 4M5KA 2MZQA 4ZN1A 2JC0A 4CLSA 2MQMA 3J7YI 3PIOQ 3PX0A 1UPPA 3JSBA 1U4BA 1N33J 4DOZA 3TAMB 4RKUC 4PWDA 3LAKA 4NWBA 4R5PB 1NBEB 3M05A 1DTTA 2XYPB 2E1RA 3P5BP 4NOHA 3M4XA 1K8AT 4XPCA 5KG6A 2MKSA 4WFAQ 1D09B 4OX9J 5EWFA 2AEJA 3BYRA 1S9FA 3PVXA 1TELA 1WHYA 4OHVA 2HNYA 2MZTA 2OPPB 3PX6A 4CYUA 2E5LF 3SQOP 2Q6BA 3O1LA 3TZYA 3M30B 2Y1JA 2NS1B 4USWA 1NCLA 2XMAA 1S4EA 1WORA 4ZOSA 1DARA 1WG5A 3JTOA 2ZD1B 4M95A 1RHUB 1WHWA 1DTQA 4QU7A 2HHWA 3LP2A 3MECB 2F5GA 1RYRA 2CAJA 3NRBA 4XPEA 2WONB 3CD5A 4DPWA 4DFMA 4ZLJA 4NMXA 2DGOA 3MFIA 4F4WA 4F7VA 3CJSA 2KFYA 1JB0C 1KP6A 2F4FA 4JBCA 2QE5A 1N33F 5E2QA 3VAMA 3M6UA 1B7YB 5I3PA 1D8YA 1P1LA 3EVMA 3I6PA 2W9CA 4Y2AA 4A8SA 1R89A 4CM2A 5K8PA 1S7HA 2RUGA 4HEA9 3MZIA 2NLWA 3W65A 2MEWA 5C42A 4IH6A 4OX9F 2ZZNA 3D6FB 3DXBA 2D3O1 2E7VA 4ZHRB 3AAWB 4IUFA 3D66A 5J1EB 3LGHA 3CCWA 1IR2A 2IA6A 2MSTA 3VF0B 9ATCB 2HNZB 1SC4B 1S10A 1Z4UA 1RLDA 3UO0A 1VGYA 5KFJA 1WHXA 2V4RA 3KMSA 3CMQA 4GVBA 2CVIA 1MU2A 1X4GA 3HT3A 3WZ0A 1R6VA 5C24B 3MEGB 2W9AA 2PDAA 2K7JA 4CO4A 3OTEA 1LFWA 2X3GA 1NO8A 1ZAXA 5GADI 1CS4B 3W63A 2HK2A 3RU0A 1FX2A 1XEZA 1U6FA 5K5MA 1V3RA 3ELHA 4M5IA 1LW2B 3AT1B 3CDWA 2XI2A 3GYGA 1S4FA 2VU5A 1E6YA 4KGXB 3NBPB 3OUYA 1C0UB 2VHGA 2OMLA 3D68A 2FJEB 4A8OA 4FF2A 2BW7A 3PY8A 2GQQA 2XI3A 3BGLA 1LWXA 2HRUA 3NLCA 2RDIA 2XO7A 3A8IA 2NREA 4FXDA 4PPDA 3EYZA 3IC1A 1T7PA 2R42A 1NSQA 1EAYC 4MYTA 3HKZD 4JI4F 1RAGB 3RW7A 1IBCB 3C14B 3ZTQA 3UCZP 2WZ1A 2ZKUA 2HIYA 1TMMA 4LF7J 4IOAQ 2ZH3A 1S76D 4YB1P 2I9SA 2FJBB 4X4UA 2RS2A 4WTYA 3TVYA 4WYLA 4CWBA 2R7QA 2DRAA 2KYXA 3SFUA 4B9UA 1RWPB 2CQ4A 2W4DA 4A8MP 1XR7A 4W98A 1KWMA 2HBRB 5K8OA 3PW4A 2KTQA 2AGOA 3C66A 1FK9A 2CQPA 1FWPA 2MGZA 4O44A 3RRHA 2IYGA 2HIQA 2AJQA 3CJ0A 2OPQB 2EI5A 3QPIA 4B3OA 4OYOA 3J81j 4ECVA 4AL5A 3OVSA 4OHXA 5LJ5Y 4KGVB 3V4MA 2AQ4A 2CQHA 2NPFA 4UQTA 3GSDA 5A2QU 1S97A 1FJEB 1X4FA 1MWZA 1HBOA 1DURA 3T41A 1Q95G 2JRSA 2E29A 3N5FA 2F9DA 4M5JA 4LF7F 3C6TB 4DR1F 4OYAA 3K8VA 1N32J 5B0FA 3NNHA 2XLIA 3PFEA 1T05B 2Y8WA 5A2QY 4I69A 1JLAA 4P2SA 3IBWA 2R2UA 1B0TA 3G6VA 4PEOA 3QMQA 3JSMA 4NZ7A 4LMZA 2XY5A 4YOEA 1S9GB 4X64J 3BKUA 2RB7A 1HWKA 3M2RA 1HNZJ 3QZ7A 4RBUA 2ERRA 4LF9F 1VQ4S 2NXJA 3W5XA 2OKQA 5KFIA 1UWBA 4CM0A 2AX1A 4X65J 2HAFA 4P10A 5KFAA 5CCMA 2Y1LB 3PNIA 5KT3A 5L9XA 4DN9A 2KJVA 2IAJB 4DG1A 3NGTA 3BZQA 3GFHA 1HARA 3E01A 2ZBQA 1SI9A 1F5AA 1TKXB 4N8OA 2PFDA 4A8XA 2F3JA 3VWSA 1N32F 5ETMA 1GEHA 1HW8A 2V67A 2ZKTA 3VAFA 3W8PA 1YBUA 2C3YA 5M2RA 1XK8A 1C1CB 4X64F 2Z30B 3HHDA 1RABB 5D0GA 1YZ7A 1HNZF 3OVAA 1TL7B 5CQGA 5D4PA 1HI0P 2JZ5A 4RWXA 2VFVA 1JJHA 3EZ5A 1KS2A 2E5JA 2LQ8A 2XLJA 1N52B 2Q66A 4ILRA 4C8ZA 1GMVA 2OFGX 3N0VA 2B9YA 3R7SB 3BDEA 3MUVP 2ZHAA 3PKMA 3AA9A 1FFWB 4G1QB 2HNDA 1HI1A 4FNIA 4DR2J 2ZUGA 4ZPDA 2MQNA 3D54A 1SV5B 3ZZOA 1NB2A 2RHSB 1I3OB 2BACA 4OYMA 2DO0A 4RX6A 1QAYA 1YHQS 2Y0BB 5I42A 4DUYJ 3PW7A 3BM7A 2IIHA 2H5IB 3GIIA 2X7IA 4JI0J 2D7SA 2MB0B 3PACA 5LMUJ 4PG4A 4QWDA 1S77D 2Y0SD 3DXSX 5KFGA 1A9NB 2BRLA 3BR8A 3H4BA 1FFGB 4RW9B 1X4HA 2R7SA 4QPXA 1RT6A 4Q0BA 1SC1B 5A8RA 3ULHA 4LF4F 2IPOB 1Q53A 3G71S 3I4PA 1L5UA 4NRTA 4U96A 2CJQA 5E3CA 1NK9A 4QYZK 1HHSA 3ADAC 3PRDA 2VBZA 2B6AB 2YKQA 3QAEA 3D0IE 4RUHA 2GJ2A 1RSCA 1HD1A 3CD7A 1IKYB 1LWCB 4U7CA 1J2VA 3D1HA 5HROB 4L6V3 3CD0A 4KO0B 3I9ZA 4M8LA 1U1OA 2E1MC 4Q8FA 1S6PA 3MR6A 1FJ7A 1HL6A 2ZJRQ 4FKYA 3R9LA 4K4UA 1WC5A 4RWWA 1RT5B 1Y00A 4WK1A 4DFJA 4KH0B 4RU9A 5F9LA 2XM3A 3DLEB 5FLXU 4DLEA 4DUYF 1UFLA 1VLYA 1IM4A 4JI0F 3M9OB 2PIIA 5LMUF 3RGIA 3QSYB 1U26A 2QA4S 1I1GA 5KFKA 1FXLA 4X4VA 4DFKA 4A8KA 4R5PA 3TZZA 4CTAB 3M8RA 2COLA 1Y5LB 5T41A 5FLXY 4HR2A 3OXFA 2QEXS 1HMVB 1WI8A 3LPEA 2EPIA 4O0IA 4ID5A 4DV0F 3IAM9 4RUBA 4O4RA 1SVDA 4ZK7M 2OPPA 2J9DE 3FUYA 3CB4A 3M30A 3RAMA 1PC4A 4WP8A 1J5EJ 3R6GB 1FJCA 2HFVA 1VJQA 2OP5A 2ZD1A 5HLFB 4N56A 4EU0A 2WW4A 2K1RB 1EB0A 3MECA 2DHHA 3SV4A 2RU9A 4V19J 1LWFB 3JQJA 2MHNA 2ATLA 1XNQJ 3QWUA 2NXNA 4ZVSB 2P2CB 1ICEB 2F63A 3F56A 5DLGA 3CCUS 3R27A 2QFIA 5I3UB 5LOQA 4HVZA 5T7LB 3IAS9 2ZWPA 4X4TA 1YWXA 5DDQC 4C11B 1N48A 3H5SA 4MYUA 1CSJA 2XYGB 3FQKA 4Q45A 4YP3A 1WTBA 2EFPA 4BWJA 3K5MA 3UDEA 4ZHRA 5J1EA 4M1KA 2XNQA 2O66A 4V1Ak 4N47A 5D4LA 1Q4RA 2ASJA 3KJVB 4BWMA 4WE1B 2HNZA 2OUGA 4QIGA 4YY3F 4ZJOA 1F0XA 1GTEA 4DL2A 2AV5A 3BKTA 4Y2CA 2YKOA 1BLUA 1Q1KA 2ZBPA 1N4LA 1QLNA 5KG5A 3UD4P 2DPIA 2V68A 3MR3A 2XY7A 4MAKA 2OJ3A 5C24A 2CKWA 1SJ1A 2G2ZA 3GLJA 4WFXA 1XNQF 2RQ4A 3R6LB 4DZDA 4NLRA 1CS4A 3SSRA 3JTPA 2PMZD 3IWXA 2UUCF 2NUUG 3PEHA 1Y3JA 2OHDA 1FRHA 2M52A 3A8JA 1N36J 2PI5A 3NGSA 4NLXA 4C97A 3NBPA 1C0UA 4LF8J 4LSZB 2LU1A 3IRWP 3HO1A 4N41A 2OI2A 1BQNB 1VYAA 2YNGB 2HZAA 3B6BA 1N34J 2Z4PA 2DEIA 2R2RA 5J2QB 2LVWA 1L3UA 3C19A 2JFKA 3D1QA 4UOFA 3J81Y 1S7IA 4RW4A 2Y1RI 4Y2KA 2IRYA 2FVCA 3UVJB 1H73A 1X9MA 2QC3A 3C14A 2AT1B 1FA0A 1BE4A 2YY3A 1EARA 2CJXB 4L72B 3HHNB 1CLFA 1H74A 1A6LA 3MR2A 2XMVA 2HHXA 3LAMA 2XY6A 3QT7A 5E41A 3C16B 3G82B 5HMYA 2MQLA 1YLXA 2BJ7A 2CQGA 4UOGA 3SCLE 2CPXA 2ZVIA 4J9SA 1N36F 4QYZJ 3GV5B 4E0DA 4LF8F 4BDPA 2FB0A 3OJSA 3T1YJ 4ED8A 2J6SA 4PG7A 2OPQA 4CI0B 1U0HB 3CJ8A 4OV6A 4N77A 1Q79A 1SBRA 2IFXA 2IMOA 3VAKA 3Q8UA 2C2KB 4UF4A 1KC8T 1O0PA 1J27A 1U0SA 4WCEQ 3NMAA 2MLZA 4DPOA 1RBOB 1AUSL 3GR1A 3WX8A 4GVLA 4TQRA 1FEHA 5JMNA 4EI2A 3RYLA 2PA3A 3CVKA 4ED1A 1X5OA 4LREA 2VOOA 4H54A 3CUNA 4UOHA 3C6TA 4ECUA 1FRMA 4KYZA 2EFQA 3EGZA 4F8RA 4C0HA 5C7PA 4OHZA 3KUEA 4TN2A 5D78A 1IQTA 2BJDA 5HN0A 2MQ8A 1OY8A 5AE3A 1S9GA 4KGKA 3H5UA 2LCWA 3D0GE 4UY85 1RISA 2Y8YA 1UVMA 1RA7A 3CCTA 5K8NA 1R8BA 2W8KA 3DKDA 3FMBA 1QAJA 3T1YF 1B99A 2WHOA 4ZVPB 2E1CA 1SJRA 1SKWA 3A8KA 3S01A 4YQWA 2C3PA 5HL7Q 4TY9A 4C4WA 3TARA 1S79A 3DRYA 1WDDA 3N9UC 1YKWA 3BGRA 2MJUA 4EYHB 2R2SA 3UNYA 1WSVA 2VIHA 2IAJA 4JV2A 3HFVA 5H9FJ 2CQ1A 1FKPA 3CCMS 5IZHA 1M1KT 3EE3A 3GCWP 2VDHA 1TKXA 2J5AA 3PR5B 3CCZA 3G96A 3G8SA 2KM8C 3THPA 2CQBA 3MCSA 3B8HA 3MHYA 5HJXA 1YX2A 4URSA 3SDEB 2RMLA 1IKWB 1I5OB 2FC9A 4WBFA 1LW0B 1C1CA 2YH0A 3R5AA 3W66A 1LFPA 2E5HA 4NLOA 1S6QB 2RQCA 1GXTA 1TL7A 1XMQJ 4ZN3A 3GFXA 4AQYJ 1FJGF 2JLGA 4J91A 1RAIB 1EKSA 4FF1A 1EQ0A 3CULA 4DL4A 4IRCA 3W9IA 2FC8A 1VR6A 3E3XA 3DLKB 5KFRA 4G1QA 1S49A 4DWIA 1XNRF 4EWTA 3MCOA 2UVUA 3MPUB 4RUAA 3FEZA 1SV5A 1VFJA 3Q8QB 3M6WA 4EGLA 4I6YA 1GNKA 2ACYA 3DC2A 3A12A 3RB3A 1Q78A 2HHUA 3DYAB 2M7SA 4I1TA 2D3OR 2AGPA 1FHTA 4J9UE 1UZHA 3AFGA 1RUSA 1U2RA 3ITHB 3DRPB 3BH7B 3KG4A 4RW9A 2DO4A 3I4HX 1XMQF 4DHVA 5J2PB 1DBDA 1S6UA 4AQYF 3BR9A 5D6GA 2RD5C 2V8VA 1ELOA 4KT0C 1WG4A 3BGOP 2UV8G 2R8HA 3WIUA 4YS2A 3IBFB 4K4TA 4I7FB 4DUZJ 2B6AA 3QGGA 3M8PB 5AXLA 3MCNA 3GMGA 1LWCA 1IKYA 1XN9A 3IG1B 1XMBA 5HROA 4FVCA 4KO0A 1GK8A 3MR5A 4G1PA 3KLIB 3IR7B 4XDDA 1ZA1B 2VQFJ 2C22A 3CIZA 4B3TJ 4MT1A 2FUG9 2YH1A 3DU5A 2B8QA 4RPFA 4P52A 4K2JA 4DI6A 1LXNA 1RT5A 2GMLA 5A0YB 4BHQA 1IWAA 1U6BA 1OPZA 4DEZA 4F3OA 5GVQA 3DLEA 3H42A 2KG1A 1TQLA 3GIKA 3CXCR 2QYCA 4Y3CA 1Z1ZA 2ZOFA 2BJ8A 1V5IB 1SB6A 1S48A 5CYJA 2ZEJA 5GAEU 4J9PA 1NH8A 3KFWX 2W4CA 1KTQA 1TV6B 2W2NP 3MDFA 2DIVA 1HHTP 3Q86A 2QLJB 1HWJA 4OYIA 1M1GA 4WF9Q 1NK7A 1HMVA 4DSLA 2W2QP 2MZSA 3HVTA 2YNIB 4MIAA 4RNNA 3V6HA 3SCJE 2PE8A 1TL5A 3TZWA 3NCRA 1TK5A 5HLFA 2Q43A 2HWIA 3U7JA 2HVZA 2BJEA 4HL9A 5KFBA 3CW2C 3GV7B 4HACB 4Y2MA 3AQPA 2QLFB 2OLWA 3KLGB 2CPJA 3OSPA 1VQYA 1LWFA 2ASDA 2MQOA 3JQKA 1VI7A 4HLBA 4ELVA 4RNOA 1V3SA 2CYYA 5BYRA 1KBRA 2VZ9A 1U8SA 5I3UA 2A2CA 4IRDA 5T7LA 4IYQA 1RTDB 2M5YA 2NYIA 4C11A 1HBMB 3H98A 3PEJA 3NCPA 5HP1B 4ECZA 4DSKA 2OH2A 3VR1A 1WWHA 4YDDB 1Q16B 5HQLA 3M7VA 2B5JB 3PJWA 1Y5NB 3FK4A 1IXKA 3KJVA 3CCLS 4ZPVR 4WE1A 3MPYA 2K06A 2EBEA 2YWGA 4MTPA 2KFNA 5ADZA 2OEKA 4WJBA 3HK2A 4PG5A 1SIZA 1U6ZA 3O6QA 2G0JA 4F67A 2IM2A 4KHMA 2N4DA 3UWTA 4WKYA 4L3NA 4ZKAA 2DR8A 3UPFA 2KH9A 1YZ6A 4LIRA 1HFEL 4DV1J 5DS7A 2IDEA 5BR8J 2WCXA 1YDLA 3ZO7A 6FDRA 2CPDA 1ZBTA 3I5BA 2UV8A 1RHJB 1YI2S 2ZDOA 1VBKA 2CDRB 3I0SB 4CT8A 5AJ3J 4IDKB 2J76E 4PXEA 4K2XA 2FLNA 2DKOB 2D1CA 3PM9A 2MHEA 1NDCA 1D9DA 4O4GB 1UKUA 3HXMA 1C4AA 5DGAA 1CJTB 2I5JB 2JL9A 3DGPB 4NE9C 2H9ZA 2JSXA 1BQNA 1UAWA 2YNGA 3QQCD 1NSKL 3JYTA 4CLTA 1DQ9A 2QX0A 1CBKA 3S6EA 5J2QA 4FDFA 2J7UA 4IQXA 1NPKA 2V8HA 1HPZB 1G6BA 2OIHA 2XMUA 2OTLS 3UVJA 1P9QC 4OX6A 1SJFA 2W2PP 1YBTA 3A8EA 3QSIA 2WSFC 3X3UA 2OEJA 4QU6A 4J9KA 2L48A 5D0HA 4O3QA 2MJNA 3OXGA 4KH1B 4DV1F 2J7KA 3AOBA 3HX9A 2UU9F 5BR8F 1CEZA 2IVMA 3CT9A 1WEYA 4USKA 4F0MA 1UJ4A 1X8DA 2WBRA 3G82A 4NCAA 3CIMA 2FY1A 2FTRA 2ZBIA 1NDLA 1H6KX 3KKFA 2IVFB 2OSRA 4DX7A 2JWNA 2Z8QA 3TAPA 2N4CA 1CC8A 3KDOA 1GXUA 5EHHA 4QR2A 1HNWJ 1T11A 4LRAA 4NA1A 1OJ4A 1OO0B 1T95A 2FPHX 4UUWA 2DNZA 3CEDA 3MF5A 1U0HA 3IR5B 2HVHA 2R7OA 1DJ0A 3QWPA 1ZZNA 1NNDA 4BS2A 2UUWA 2ZH9A 2DHSA 2C2ZB 1UCNA 1HW9A 3FKBA 4C8MA 3U27A 4X66J 3K5LA 1P27B 2W24A 2XZWA 2LEBA 1PGZA 3HPOA 4FYYB 2B3TB 5IC6B 2A6MA 2DD8S 5KTQA 4K4WA 2CNLB 4QOTA 3UD3P 4B02A 3FQLA 4ED5A 1FRJA 1TVRB 5DG7A 1TFYA 3H8YA 5K14B 3OR1B 2LKZA 2QJ3A 1KR4A 2U1AA 2QN6B 1HNWF 1M0SA 1VK3A 1RBLA 3K58A 2WVBA 3VVUA 1FVSA 1T9YA 3SQGB 2V8GA 4KGZB 4ED4A 4PAAA 5CYQB 2AJ1A 2BE7D 2Q1LA 4URGA 5F8HA 3T5JA 3D6MB 4TU9A 4B9MA 5D0EA 4EBCA 4NYZA 2ROPA 3IXQA 3EPIA 4A48A 2P9GA 3GTYX 2IJRA 1FWKA 1SL2A 4FYVB 2EXUA 4X66F 4ECWA 2UUAF 2E1PA 1NKCA 5F8IA 4FF4A 2BV3A 2XHWA 1X4CA 3CO0P 1WTFA 3CJTA 4W4MA 3QATA 1KOHA 4FPIA 2HQFA 3PXGa 5EDWA 1O6XA 4Q44A 1LKZA 3SDEA 1IKWA 2XG8A 2DHGA 5ETQA 1RHQB 4RO0A 2QLBB 4ZP8A 3MAHA 3OW2R 1S6QA 1RT7B 3FEXB 1MWYA 1RTHB 3MI7X 3NCQA 5KFLA 2O1PA 3ILIA 2I1RA 2FYXA 3DCAA 4LRCA 2L08A 3NGDA 5K20B 4WXWA 2XSJB 4PWUA 1DRZA 4DV4J 4O23A 1XERA 1XTZA 4AL6A 4WP3A 1HQEB 3SSQA 2QFJA 3DLKA 2OGUA 2YQ1A 2W7AA 1Q8KA 3CCSS 2IVYA 4P74A 4CH7A 1HQUB 7AT1B 5KFYA 4ED7A 2OEMA 2BKNA 4CH1A 4JI3J 8RUCA 2J8SA 2M70A 1N88A 2M8DB 1RADB 1K0TA 4ERDA 3DYAA 1ZA2B 3KWMA 4QIFA 1RXOB 5A76A 3LWLA 5F0WA 1VQ5S 2VG7B 5DETA 2PSZA 2YXLA 3ITHA 5L1KA 2V9KA 3DRPA 1B64A 3PHTA 2H51B 1SPBP 1G2EA 1WNEA 4W92B 2DXFA 2VG5B 1WSRA 4OZ0A 4MMOA 1SH3A 3EGWB 3ENWA 4TY8B 1QE1B 4HTIA 1FXDA 4I7FA 3R3TA 3TUZC 5M2UA 5KFMA 3KG0A 3M8PA 3Q2SC 5DDPC 4DL3A 3BSOA 3HZEA 1NHVA 5IT4A 1HWUA 2DR9A 1JK9B 3IM8A 3FRYA 4DR3F 3IG1A 3PO5A 4IO1A 3ISZA 1HBUB 2QMWA 1ZTTA 3KLIA 2NXEA 3N79A 3GCXP 2AW0A 4X84A 5IWAF 4I4BA 2DCUB 1M1HA 2G2YA 3EM1A 4DFPA 4EUVA 1V5VA 2I6WA 1FE4A 4DSJA 2EFNA 4BC9A 4RW7B 5CYMB 3AD9C 2B9WA 3LF0A 3R5CA 4ED2A 1SCJB 3MAAB 1HNXJ 4FVMA 4F36A 2B43A 3HT0A 1F5CA 4USTA 1MMLA 4MKVA 4RNFA 3IP0A 1H7WA 1YGYA 3T1HF 3D6HB 2BE9B 4P71A 3IN5A 3HD2A 1TV6A 4M94A 2H4WB 5F9NA 2H4YB 3KG1A 2FHMA 4Y0FA 1IR1A 2YKNB 2J0XA 3TNVA 1YJ9S 1EP4B 4D3GA 2YNIA 4I0WA 4GVBB 4FBUA 1JXLA 3MD1A 4CO2A 1N0UA 3QZ8A 3BSAA 2R7WA 3BSNA 2FGCA 3UN3A 2HBZB 3H2VE 2DBBA 1SJ3P 3LWMA 3MMCB 5FD1A 1KLMB 4HACA 5M2PA 2QG9B 5EX3A 3KLGA 4H4MB 3TO8A 1HNXF 4DL7A 2CQ3A 3MEEB 2XB2D 4U8VA 4HHUA 1N56A 2ATCB 2YTCA 2UXCF 1T9WA 4PR6A 3RRKA 1PAEX 2EVZA 3ZZTA 1LWEB 3LALA 1JNZB 5KFHA 3RB0A 3M2UB 1URRA 2HURA 4F25A 4DPUA 1MW7A 2XMJA 3A4TA 1GMWA 5KG4A 5A6WA 5HP1A 4ZJQA 1YJRA 3V2UC 2MDAA 2OFHX 2DNHA 5D4NA 2BQUA 1IKXB 1AUDA 4HKQA 1SJQA 1H7XA 3ET6B 1L3TA 3IRXB 1K47A 4KGMA 2B5JA 4ECTA 3I9V9 3L7UA 1M5HA 2AEFA 2GX8A 3RB6A 3BYPA 1NHUA 1CJUA 1U24A 2FHKA 5LXYA 4DR6F 2HQ3A 1VQ7S 4JYAJ 3CTRA 4CLPA 3ZTRA 2NR0A 1XR5A 4AT1B 9RUBA 1NPRA 2YKAA 5FDLB 1V9OA 4QW9A 1PILA 3MGJA 1D1UA 3VGTA 2HHHJ 1F60B 1X60A 2RRAA 3NMRA 4HDHA 3BJYA 3NWRA 4OYXA 2AYBA 2MGZB 3IFEA 3I0SA 5CD4H 1WOOA 4IDKA 2GIFA 4H4OB 3ZTSA 4OLPA 4MK7A 1I94J 4LBIA 4O4GA 2DGXA 1CJTA 2I5JA 3DGPA 1ZS6A 1U1NA 2ZFHA 4Q2MA 2YX7A 3GG1A 1Q7YT 3CCRS 3BF4A 4EZ6A 4ZP6A 1MWQA 4MFBB 4DX5A 2OO4A 3VQSA 4H4KA 3RJMB 3JQMA 3T3FA 2DY1A 1NAQA 4ED3A 1HPZA 4JYAF 2AKWB 3OFEA 4FPRA 1GTHA 1YRTA 1CQMA 1OYDA 2OPSB 4DV2J 4PQUB 4K50A 4N5SA 3PW0A 3D9BA 5IT9U 3ILJA 2HHHF 2FJXA 3JSMB 2DGWA 1X0PA 3M1VB 3K0JA 2UVRA 4B9VA 2LFVA 2KO1A 4OI2A 4I64A 1BC6A 1REGX 2EC2A 1APSA 3CWJA 3NEKA 4F4AA 3OQ2A 5B0BA 3MM7B 5IC4B 2HS3A 3ZZZA 3TJ8A 1RHRB 3LUYA 5IT9Y 3GYNA 2AYMA 4YB5A 1I94F 4DV6J 2B9EA 1ZAWA 1B4SA 4KFBA 1WF1A 1FF2A 3SV3A 4K4ZA 1YJTA 1F2GA 4YEAA 2QIFA 4TKTA 4I2QB 2CZVC 3KK1B 2YWKA 1RWUA 1FNMA 5H1SV 2CPEA 1DAXA 3D28A 2M0GB 4LQ3A 3NOGA 2JDJA 3CJRA 4WIIA 1BQXA 1XR6A 1HYSA 4X4NA 2OTJS 1X7VA 5RUBA 1WJ9A 2ZH8A 5E3QA 1GX5A 2PI4A 4DV2F 2CNKB 4HT5A 2BANA 1RDRA 1TL1B 1AT1B 1VC5A 2AIRB 3DI6B 4ILLA 3PO4A 4J9LA 1OSDA 4DSIA 2B56A 2MYFA 5LL6d 5CXTA 4K7QA 3L4BC 5I4MA 1KTVA 3W1YC 2KXFA 1YSJA 1TVRA 5B0GA 1NRKA 3BGFA 5EX0A 5K14A 4DV6F 2BYCA 3OR1A 4X4RA 4Z7YA 5C2GA 1HR0F 3SQGA 3IWLA 1K1SA 5CYQA 5GADU 4NCBA 2ASLA 4O3PA 3QT5A 4M5NA 3IM9A 3OSNA 2BA9A 2X1BA 4PG6A 3RBZA 5DZ6A 4EBDA 2VFSA 4ECXA 4RL1A 2GMHA 3AH6A 3T5KA 2Y3YA 3PYEA 1JLCB 5KFPA 4Z2XA 2BDPA 1RWKB 2VQEJ 1I51B 2KL8A 3MTKA 2DGTA 1N6QB 4C7QA 1EQMA 1RAJA 2ROEA 3FEYB 4CQ1A 2ZBRA 3FGVA 4TXSA 2D9PA 1ZM2A 1F3VA 2H65B 1XC9A 3FFIB 5KOXA 5KG7A 1NK4A 5D15A 5KFZA 3EPGA 3UCUP 1TL3B 1A0OB 1RT7A 4LVOP 5ETRA 1RTHA 1ZZFA 3VALA 1PKUA 1U48A 2GQ2A 4ZCKA 1FKAF 1AXQA 3OBIA 2E5LJ 3MFHA 1IBLF 2XSJA 1YJUA 3PR4A 3PRBA 2HRYA 3PRVA 4KE5A 3MXHP 1RTZA 2RE1A 4OI4A 1HQEA 2DNPA 4LIWA 1RWWB 1T02A 4K4XA 4Y6IA 2KXHA 2YNHA 2EEYA 4F4ZA 4NRUA 1WKLA 2MSSA 3R1LA 3ONQA 2AEMA 2ZOMA 1P6TA 3EJMA 2Z2YB 4ZVUB 4HDGA 3N6LA 2LYVA 4HI2A 2ZHOA 2MQPA 2DGVA 2DCLA 1TUGB 2RJZA 4IKAA 2V69A 5JJBA 1MSWD 2Z0GA 1UEKA 2XHCA 2FZCB 1RAEB 2AJ2A 4UZCA 2CQ2A 2KT2A 2EKYA 4EEYA 2V9WA 4DQIA 3OTDA 2K3KA 3M6XA 2VG7A 3VGUA 1UJ5A 5SZTA 1GAOA 2ZZTA 1Q81T 4LR9A 2VC0A 1HLWA 1T3OA 2X1GA 4ID5B 1U2CA 1OIAA 1RHMB 1NK6A 3ETMA 4TLRA 2VASA 2VG5A 3N6NA 3B4MA 2VUGA 4I6WA 1M5VC 1S9EB 1VQPS 4TY8A 1QE1A 5AE1A 3MWBA 5LMNF 2FIUA 3MCMA 3BBFA 3OT9A 5CH7B 3UR0A 1QSYA 4X4PA 4LFCF 1CC7A 4P2FA 3AD7C 2QZ8A 3W60A 2DXEA 1HBUA 4WTOB 2AF6A 4MKAA 4L76A 3LANA 2VONA 3Q8PB 1PJ5A 3VZIA 4UQGA 1HBNB 4OZLA 2DNMA 3KXDA 4UT4A 5HVGA 5ETOA 2VPWB 4QYRA 3WIVA 3ZNUA 5DG9A 2GA7A 4MIWA 3W8GA 2J6UA 4RW7A 5CYMA 2DNQA 3K17A 2CQCA 4ZJLA 1NXIA 1UW4A 3MAAA 1VC6A 1TK0A 2CDQA 1MN9A 2IJFA 2IRXA 2QA4G 2HBYB 2BX6A 1KLNA 2HYIB 2ZH1A 2BQRA 2A0FB 1FWLA 4ZLLA 3PZPA 2MPUA 1W7WA 4AE5A 2GFFA 1ULRA 3KMQA 4LF5J 2ACMA 2CUYA 5L38A 1DQ8A 2A10A 1R0BG 3HSDA 1KKHA 2YKNA 4OX8A 3TEGA 4JI4J 1EP4A 4B3OB 3PKYA 3KK3B 5KFEA 1Q7LB 2A2DA 3GSIA 4GMKA 3ISND 4OYZA 4ES1A 4KV8B 1Y10A 3H0PA 1C1BB 1FFSB 4FKXA 2OSQA 2V6AA 1U7LA 4CLZA 2XCAA 2CJBA 2QA1A 2LU2A 3KLHB 3MMCA 2KVQE 1KLMA 2LMIA 2X1FA 4CZCA 4Q8EA 3J7A1 4H4MA 5B7WA 1FO1A 3MUTP 4QBUA 3MEEA 3MTJA 3CO9A 1HKAA 2R7RA 1VQSA 1LWEA 1XQIA 3TW0A 2HHQA 3ILOA 3RR7A 2F7VA 4OYBA 3NNAA 3M2UA 2KXNB 1FNXH 1NSPA 1UA1A 4QIWD 1S1WA 3HI9A 4LF5F 4JI5J 2XCPA 3KHHA 1SH2A 4K5SA 5JVGQ 1VOMA 1JLQA 3CC2S 1IKXA 4RW4B 2XULA 4C3MA 2CJYB 5KG3A 2BUNA 3ET6A 4B3RJ 1NDPA 2FZKB 3IRXA 3W5YA 4RLEA 4TU7A 2ILZA 2B7CB 2QSWA 3R2CJ 1JWWA 1P1TA 3BB5A 2B4OA 2HHSA 2O67A 4DR1J 4ZITA 3C6UB 5SUHA 4NI2B 2JJ4D 5LSRA 3NWGA 3HHLC 5FDLA 3M8QB 1SC3B 3CMAS 4I67A 2A18A 3HMJG 1FKOB 4QWBA 2A1BA 1FNOA 1FD8A 2MKIA 3FZ2A 4X62F 4ECYA 1UVIA 1VRUB 3EDQB 1MROB 1R6YA 4USHA 4LF9J 2QL7B 5IT0A 5F8NA 3R97A 2SXLA 3H2UB 2J7WA 4H4OA 2EWHA 1UFKA 2WVDA 1VIXA 2DVIA 1PSDA 5T14A 4JI5F 4IFYB 1VHIA 2YKPA 1NK5A 2DRDA 2RQKA 1R27B 4OI1A 4B3RF 2XGPA 3BQ0A 2XBPA 3W2WA 4MFBA 2N7YA 4LRBA 2IMWP 5C25B 5HMWA 2XWXA 4USUA 4KY3A 2YPZA 2C2MB 1IM6A 3UW1A 2OPSA 4LRDA 3QT6A 4PQUA 4USMA 2YWHA 2CPZA 4XDCA 5D8HB 1XMOF 3UFCX 1WKKA 2J0QD 4PKDB 4PPZA 2VA2A 2E9TA 2VKRA 3HFKA 4RW6B 2FJAB 3UE2A 3M8ZA 2V94A 5KFVA 2UVWA 1JJ4A 4LFBF 3M1VA 1U8WA 2VA3A 1S99A 4RBVA 2IBKA 4ZDNA 3MM7A 1U25A 1BWEA 3ZZYA 4I6AA 1F5BA 2K8GA 4FBTA 2X3DA 2KU7A 2BJ3A 2DNRA 3L09A 3G4SS 2UZAA 2KHDA 3NY0A 3R5BA 3K5NA 5JXSA 2GCFA 4ZVFA 5L1IA 3BGRB 1UFWA 4I2QA 1MNEA 3KK1A 1TFWA 2QYGA 3KHLA 4RU2A 5J1PA 3D7SB 4HH0A 1FKPB 3LA0A 1KQSR 3QAUA 4ID8A 3RB4A 1VBZA 2QMUB 4OZJA 3VAIA 4L74A 2QLXA 5CHCB 1IR0A 2XO6A 1JKHB 3UDVA 3ENQA 2RIJA 1QD1A 2ILYA 3VAGA 3JSYA 5L39A 1W2BR 1JLGB 1TL1A 1RWOB 5J2MB 3DI6A 4EZ9A 1JJCB 1IWGA 3RRGA 1PAUB 2LDYA 2CNNB 2GIQA 3ZC4A 1SL0A 1RU2A 1CQNA 4R8UB 2IM0A 2DH7A 2HKEA 4KIAA 1WOPA 5KT4A 2W9BA 2MZRA 4LF4J 1S59A 4DS5A 1UW9A 3KLEA 5ETVA 3OTBA 2C2DA 1RAOA 2ALZA 2GHVC 5F8MA 2IY5B 4CLUA 4JI6J 2DIUA 4CRJA 3EX7B 1B3TA 3SZ2A 1X9WA 1EETB 5C5JA 1B0PA 5L8RC 1SC6A 3O3LA 2YWEA 2RT3A 1MMDA 3N28A 1FDNA 1VQOS 1JLCA 3CJQA 1R8CA 4YB6A 4WFYA 2N82B 2W8LA 1N6QA 1SH0A 5HANA 2BQ3A 1PBUA 2GAHC 3R7BB 3GZ7A 5ETSA 4RR5A 4JP8A 5EWGA 4ALZA 2GVZA 4LRFA 4DQRA 1W25A 3THTA 1NK0A 1VMBA 3FFIA 2D3ZA 2KFZA 2CWXA 1TL3A 3GR0A 1NU4A 3DOMB 3UQSA 3R5GA 3VCDA 3R2DJ 1RYSA 2B9XA 5JUMA 2ADCA 4AXIA 1NJYA 4JI6F 4DV0J 2VD3A 1GFWB 1NH7A 5E5NA 2RS8A 2PEHA 4F26A 4RW8A 2R8IA 2IM1A 3OL8A 2DRBA 4DX8H 5LT5A 4C8NA 4P2XA 1NLKL 5E0OA 1YTYA 3T9ZA 4X2BA 3PV8A 3KNAA 4DUTA 3TJAA 3A13A 3VTIA 2DK2A 1R7IA 5KFDA 2E9RX 1DHMA 4I56A 4ZVEA 1YQHA 2CPHA 2GHPA 2PA8D 1GMUA 3IO1A 5LSLA 1NEEA 3RUBL 1HQ2A 3V6DA 4DU7A 1KFSA 3U02A 1ROFA 2AGQA 4OX7A 3CJ5A 2ROGA 3POTB 3I0RB 2HZCA 2CZ9A 1X4EA 3M2VB 3DRRB 2B4UA 2BM1A 4OJ1A 3HVTB 1KFDA 3H59A 2H48B 1S9EA 2EG1A 1UA0A 2OD4A 4C3LA 2MQQA 4YY3J 5HJYA 1FTCA 3S1TA 2HRTA 3UDCA 3KDNA 3GIMA 3M9MB 2UVVA 4QR1A 3LQVA 2JEGA 2XS7A 1VLOA 1RJJA 1FRIA 5J2NB 3FCHA 1MG7A 1HBNA 3W9HA 5HQMA 2EK6A 3C15B 4JI1J 4JI2J 1TKDA 4X4QA 2VJVA 4YR3A 2I38A 2LXFA 2JOQA 3I5CA 4DV3J 1J5OA 4HH1A 1B0VA 3US5A 2IYIA 4CNYA 2RRBA 4DV7F 4ES2A 3QIPB 3GV8B 2UUCJ 1T3NA 2LXIA 2BXJA 2AWZA 2M3DA 2V50A 2ZOGA 2CRLA 4NZ6A 4ILMA 5I3QA 2DT9A 2ZUAA 1K44A 4K4VA 2NXCA 4DR4J 1PC5A 2CXEA 4BC7A 3DNCA 4PG8A 3MPWA 2KVIA 2RU3A 5B0EA 2DEJA 3EVOA 2HZVA 4Y28C 3SEOA 4AFFA 4DR5J 4KR0B 4P7TA 4WZQA 2Z2LA 3W2VB 4A47A 4NLTA 4U9RA
chains in the Genus database with same CATH topology
1XTZA 3KK3A 4W90B 4AL6A 3LP1B 3OVSA 1HQEB 3KHGA 4OHXA 5LJ5Y 4CTAA 4Y2IA 3SSQA 4OJGA 2QFJA 3DLKA 2MZJA 3V4MA 4KV8A 5LXRA 2AQ4A 2CQHA 1C1BA 2NPFA 3PW2A 2ZITA 2W7AA 4UQTA 5BYSA 2ZH5A 4MKBA 3I32A 5KFNA 3CCSS 2IVYA 4CH7A 4BCAA 3GIJA 4KKOB 3GSDA 2AJ4A 1U47A 4F2RA 3CGIA 1YJWS 1X5PA 3NGKA 2YQ3A 4O3SA 4DUZF 1HQUB 1S97A 1FJEB 1MWZA 1X4FA 5KFYA 4ED7A 4JI2F 2RKIB 1HBOA 5DDOC 1FERA 4JI1F 3QJPA 2NQPA 3V5RA 1DURA 4CH1A 3TAQA 1U09A 2VV5A 2XLKA 2K2PA 1UVJA 3KLHA 1RQ0A 3LPYA 2M70A 1N88A 2JRSA 4CO3A 4NXMF 4DV3F 1L3KA 2E29A 3N5FA 2F9DA 5L9NA 2W9BB 3RBDA 2M8DB 4C8LA 3KLEB 2IHR1 1YIJS 2EC0A 1BQMB 2JEJA 4UW2A 4OFZA 4DDFA 4LF7F 2Z2MA 3C6TB 4DR1F 1K0TA 2C28A 4ERDA 3DYAA 3GFZA 2O3DA 2GHWA 3KWMA 2VQFF 3IS9B 2FDNA 1C0TA 2HGMA 4QIFA 3K8VA 2VBXA 3SYZA 4QCLA 5B0FA 3NNHA 2XLIA 3PFEA 3O8WA 1T05B 3KLVA 3SFGA 5A2QY 2MMYA 4I69A 3CD6S 2LXUA 4B3TF 2VG6B 1JLAA 4P2SA 2AD9A 3IBWA 2R2UA 3LWLA 1B0TA 1ZM9A 5F0WA 3G6VA 5B0CA 3C8YA 4IOCQ 2VG7B 1VQ5S 3AB4B 4C3KA 2K1RA 5DETA 3QMQA 3JSMA 2PSZA 4NZ7A 1IBMF 4LMZA 3O44A 3MOJB 1KEKA 2XY5A 3ITHA 5L1KA 4YOEA 1S9GB 2V9KA 3DRPA 4DR4F 1B64A 3RR8A 1TL4A 2RB7A 1VRTB 4MIBA 1G2EA 1HWKA 3JYTB 1WNEA 4W92B 3PW5A 1YRXA 3M2RA 1Y4ZB 1E6VB 1Y9OA 2GNKA 5F8GA 3QZ7A 4RBUA 2ERRA 4LF9F 1VQ4S 1FRLA 4DR5F 2VG5B 3Q8RB 2LA4A 4OZ0A 4MMOA 3OTOF 3CJ3A 2OKQA 1SH3A 5KFIA 3EGWB 3NS5A 4WYWA 3ENWA 2R7UA 3T6JA 4TY8B 1QE1B 4NCGB 4PUOA 4HTIA 1UWBA 1LXJA 1FXDA 1DLOB 4F3QA 4I7FA 2AX1A 3R3TA 3TUZC 5M2UA 1SIWB 5KFMA 3KG0A 3M8PA 3Q2SC 5KFAA 5B08A 5CCMA 5DDPC 4DL3A 3BSOA 3HZEA 3PNIA 1NHVA 5KT3A 5IT4A 2IC3B 2N3LA 1HWUA 5L9XA 2DR9A 1JK9B 4DN9A 2FLOA 3FRYA 4DR3F 1V3ZA 3IG1A 3PO5A 2BABA 4IO1A 2I0XA 1R31A 1JLBB 2HLTA 1G1XA 1N54B 1R0AA 2KJVA 4J9RA 2IAJB 3ISZA 1HBUB 5MLCV 2QMWA 1ZTTA 3KLIA 3C6UA 2DGQA 2PMHA 4DG1A 3N79A 3MM6A 2Y1IA 4E98A 3BZQA 2AW0A 3GFHA 4X84A 5IWAF 4MH8A 4I4BA 2FHJA 2VL1A 2DCUB