1JLCB

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with pett-2
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
427
structure length
402
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords HIV-1 RT A-chain
total genus 110
structure length 402
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlcB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcB04
3CJ5A 4F50A 5J2NA 5J2PB 1FKOA 3IRXA 4TQRA 3T5KA 2AGQA 1C2PA 4NLOA 3MEDA 4IG0A 5KFCA 2FVCA 1IKWA 3KJVB 1D0EA 3UDLA 4J9QA 4DL2A 2VA2A 4ECRA 3KK2A 2GIQA 1IKXA 5C24B 3UPFA 2D41A 2JEIA 1NHVA 3GV5B 2D3ZA 3PR4A 4RW9B 4KV8A 4O3SA 3PHEA 5J1EA 1ZETA 4PQUA 5KT3A 1C1BA 4ICLB 4R0EA 4TXSA 1T03B 1S9FA 5CYQA 1W25A 4ECTA 3DI6A 1NHUA 1SH0A 5EUHA 4NCGB 1T3NA 3I5AA 2R2TA 3OL8A 3CJ4A 3QGGA 4QWDA 4HYKA 3ITHA 3D5MA 3GILA 2IM2A 1S1WA 3H5YA 1C0UA 1BQNB 1RT7A 5C25A 3GV8B 2QE5A 2E9RX 1N5YA 3CDWA 4RW8A 5EWFA 4K4WA 4F4YA 2OPPA 5K14A 2ATLA 2OPQA 3LP1B 1HARA 1QAIA 3H5UA 3NMAA 2VG5B 1MMLA 1S1WB 2ALZA 2I5JA 4B3OA 5KFZA 1R0AA 1HNVB 3FQKA 3KHGA 3V6DB 4KHMA 1RT3A 4LQ9A 4O3PA 2WTFA 1IM4A 1S6PB 1HPZB 5K14B 4H54A 4DG1B 4EYIB 3KK1B 2OH2A 3MEGA 1DTQB 1JLBB 4IH5A 4IFYA 1S0MA 1RT5A 3HVWA 4RNMA 2ASDA 3IS9B 2HWIA 3CO9A 2JEFA 4TY8A 5HLFB 1EP4B 2RDIA 3H5XA 4Y2AA 1HMVA 3MECA 3CDEA 1LWCA 3IN5A 4KFBA 3MEDB 4IG0B 4YR2A 1RT6A 2IJNA 2V4RA 3BGRB 2W8LA 1T03A 4Q44A 4URSA 1C1BB 4ICLA 4MK8A 5DGBA 3Q8QB 4K4UA 5KFWA 2FLLA 3DLKB 2W9CB 3BREA 3H5SA 1WNEA 4LSNB 3MTKA 1LW2A 4KSEB 3KK2B 5KFKA 3DRRA 3DLKA 2HAIA 2IM0A 4WYLA 3KLGB 2W9CA 5KT7A 3BSNA 4ZP9A 5KFYA 4J9OA 4ED8A 4QW9A 3QYYA 4Q8EA 4MFBA 2V4QA 2C2RA 2IJFA 1QUVA 3JYTB 4Y34A 4ED0A 1LWCB 3DRRB 4QW8A 3HVTA 2CKWA 1LW2B 1HMVB 3MECB 1HYSA 1SH2A 1EP4A 3SI8A 5HLFA 5DQHA 2O5DA 1TL3B 2VG6B 5C42B 5D3GA 3IS9A 5F8HA 2DPJA 1T05A 3DRSB 4PWDA 4MIAA 4ZP6A 3UR0A 4DL3A 3KLEA 5L1LA 3BQ0A 3T1AA 4ED1A 4DG1A 1JXLA 4ZVHA 4KAIA 3BGRA 1HPZA 4KHRA 2JEJA 4XPCA 3OHBA 4ECSA 1RT6B 1LWEA 2BE2B 3T5LA 1RT3B 5KFEA 5L9XA 4JUZA 4EBEA 3KLHB 1FKPB 4ECZA 1XR6A 4MKBA 1JLEB 3IG1B 2BQRA 4IFVB 4RUAA 4ECYA 3KLVA 2VG5A 4KBIA 4NLTA 3DLEB 5F8MA 2OPPB 4K4TA 4IRCA 3JSMB 4ECXA 5KFSA 3OLAA 1S6PA 2YNHA 4Q45A 4ED7A 4KO0B 1S0OA 2VG7B 1K1SA 4NLUA 2ZD1B 5FDLA 3DRPB 3LANA 1VRUA 2C22A 2UVVA 4NLSA 3QO9B 4G3IA 2WONA 3KHHA 2XGQA 1RAJA 2R8GA 4O44A 5T14A 2HWHA 2YNIA 3LP1A 2OPQB 5F9LA 4NLDA 2FJXA 5L1KA 3IGNA 4ZVEA 3CJ3A 4KV8B 3G6YA 1TV6B 3KLIB 3DYAB 4ZVFA 3IG1A 4WXOA 5KFIA 3RAXA 3ISNC 5KFTA 1FK9B 4IG3B 1IKWB 4O4GA 3CDUA 1JLCB 4YR3A 5KG3A 1RT2B 4WFYA 4EBCA 4RNHA 1FKOB 3IRXB 3I0SB 4K4SA 5J2QB 2RF2B 3H98A 1YVFA 4EO8A 3PJXA 2OPSB 1J5OB 3KLEB 4RNOA 4JV1A 3LALA 1TVRA 4IDKA 3MR6A 4NYZA 4RW9A 1BQMA 4M94A 4I2PB 4EYHB 5F8JA 4RW4B 4LSLB 1IKXB 1SUQA 5C24A 4F4XA 5DLFA 2HNDA 4TYBA 3FFIB 4DL5A 1JX4A 2UUTA 4IH6A 4RU9A 5DG7A 2IBKA 3JYTA 3DDKA 5J2PA 3MFHA 3KHLA 1LWFA 1XR5A 3PZPA 1UWBA 4QWBA 3MEEB 4HKQA 3NGDA 4I2QA 4J9LA 1DTTB 3DM2A 3H2LA 4IH7A 5C5JA 1C1CB 2RKIA 3DOKA 3V6HA 3NL0A 4ZPDA 3QZ8A 1TL1B 4ECQA 3MEEA 3E01B 3BSAA 3VQSA 1S1UA 5KFGA 5KFNA 1JLAA 2IA6A 3V6KA 1RTDB 1MU2B 4M95A 5HP1B 1LW0B 1QAJA 2AGPA 3G86A 1S0NA 3V4IB 2ASLA 5KFFA 3Q8SB 1RTHB 2FLNA 4RW4A 4JV0A 3EZUA 1KHVA 1BQMB 5KT4A 4KFBB 4R5PA 2B5JA 2YNGA 2BRKA 2UUWA 5KFPA 4WXWA 2WOMA 2OPSA 2BANB 2R2SA 2D7SA 1RTIB 2XGPA 1EETB 2FLPA 4WE1A 2W9BA 2J6SA 2XCPA 4PUOA 3M9NB 1DLOB 1S1TA 1RT5B 1JLBA 5F8IA 2YKNB 5KT5A 4O4GB 4TQSA 4YR0A 3I0RA 5L1IA 4FS2A 2E9TA 2RDJA 4GC6A 3QGHA 3QIPB 1QE1B 3GV7B 4H4MB 1RTJB 1SV5B 1JLQA 2HNZB 3Q8PB 4ECVA 3LP2B 4Y2CA 4URGA 4U6PA 4NRUA 4WFXA 4RW7A 2YNFA 1S6QA 2ZE2B 1R0AB 3KLFA 4QWCA 4ECUA 5HBMA 2IAJA 5KG5A 4ID5A 4Q8FA 2YNIB 2VA3A 3KK3B 1JKHB 4J9NA 4J9SA 3KLFB 5KT6A 4DL4A 2YNFB 2ZE2A 5DLGA 4EBDA 4O3RA 1N5YB 5KFDA 3DRPA 3GIJA 3N6NA 4MK7A 3IGVA 5KFBA 5KG6A 4J9RA 2VG7A 4F4WA 1RT1B 2C2EA 4O3OA 4LQ3A 4WZQA 1RA6A 1IKYA 1RA7A 3I0RB 3PW7A 4QWAA 1ZTWA 2V0NA 1S1VA 2B6AB 3CWJA 4TLRA 3M8QB 3OHAA 4K4ZA 3DI6B 5KFQA 1HNIA 5DG8A 3DMJB 4ZPBA 3MFIA 3M9MB 2YKMA 1JLEA 5KG0A 2W7PA 4QPXA 1S9GB 2IC3A 5I3UA 5DGAA 2AU0A 4R5PB 4GC7A 2BR0A 3KOAA 3OSNA 1SV5A 2IM1A 3HVAA 3MR5A 1RT4A 2F8EX 1CSJA 1JIHA 2FJWA 1S48A 3RB4A 4WYWA 4TYAA 4K4XA 4R8UA 5F8LA 4QWEA 4KE5A 1T05B 4PWDB 4RZRA 1DLOA 1S1TB 3C6UB 5KT2A 1TKTB 1REVA 3H59A 1N4LA 1S1UB 3V81B 1RTIA 3E01A 2QV6A 3C6TB 1HYSB 4XO0A 3FDSA 2XI3A 4XPEA 5L1JA 3HVTB 2UVWA 2JLEA 3MR2A 3QLHA 4ZP8A 1RYSA 3OL7A 4X2BA 5HROB 3DOLB 3GIKA 5J2MA 1HQUA 3RBDA 4ZPAA 2R8HA 3V81A 3ICLA 1REVB 3V4IA 2FJVA 3C6UA 4Y3CA 2R8JA 4U7CA 3E51A 3QZ7A 2HMIB 1RTDA 2WRMA 4RNFA 2WK4A 4NZ0A 3KLGA 2I1RA 3CJ0A 3GIIA 3M8PB 3BJYA 4LSNA 1TP7A 3CIZA 3I5CA 5F8GA 4IRKA 4IKAA 2J6UA 1T94A 1VRTB 3DOKB 5KG1A 1TVRB 4IDKB 1KLMA 2JC0A 3BSCA 4G1QA 4OL8A 3UQSA 4YQWA 4K50A 2YKMB 5KG4A 4DEZA 4IR1A 1TKTA 1Z4UA 4MKAA 4MIBA 2FVQA 1TQLA 1TKZA 1TKXB 4I7FA 3T19A 1S1VB 2B6AA 1N48A 1S97A 1FK9A 2HNYB 3FFIA 4IG3A 4URQU 4O3NA 2ZKUA 1C0TA 3DLGA 3NBPB 4LSLA 2AX0A 4O4RA 3PW5A 1JLGA 4TY8B 3PW2A 2AX1A 2W9AA 2UVRA 1JKHA 2UVUA 3DMJA 3KK3A 4ZHRA 3LAKA 4J9MA 3RB0A 3OL9A 4JV2A 1RT2A 2BQUA 4Q0BB 3FRZA 3N6MA 3RB6A 4NLYA 4O3QA 2WB4A 5KFUA 2B43A 3DYAA 2ZD1A 5FDLB 1K1QA 1N6QA 2HNZA 4H4MA 1U09A 4KO0A 4KB7A 2FVSA 3LP0B 3BSOA 3FQLA 4MH8A 5F9NA 3GIMA 3T5JA 2HNYA 3HKWA 3NAHA 4ED6A 4ECWA 4DL6A 4Q0BA 1TKXA 4MK9A 4PUOB 2FVPA 4IFVA 5EWGA 3PW4A 2IM3A 4ED2A 3M9OB 4EEYA 2ILYA 3V6JA 3KLHA 3OLBA 2C2DA 4NLQA 1VRTA 3N6LA 2R8KA 2WHOA 1JLQB 4RNNA 3KMQA 1RTHA 1QE1A 2YNHB 3DLGB 3M8PA 3NBPA 1ZTTA 2R8IA 4RUCA 5KG2A 5HP1A 5CYMA 1HQEA 5I42A 1D1UA 1TKZB 4I7FB 4PQUB 2CJQA 1IKVA 5J1EB 5KFXA 3PR5B 3TQ1A 2J6TA 3NAIA 4WE1B 2W9BB 2BANA 1SH3A 1HQUB 2FVRA 3RBEA 3DOLA 2AGOA 2IMWP 5KFVA 3G6XA 1LWEB 4ZPCA 2GC8A 2BQ3A 4KKOA 5J2NB 5KFMA 5DG9A 3SFUA 4MFBB 3KHRA 1GX6A 2R2UA 4R8UB 4ZVGA 3OL6A 2HNDB 3GYNA 3TVKA 4KKOB 3CJ2A 3PVXA 5J2MB 4NLRA 3H4BA 5HROA 3D28A 5KFRA 3QLHB 3TAMA 2IC3B 1J5OA 3RAQA 3KNAA 4IQXA 4ZMMA 1N56A 5J2QA 5EWEA 3I0SA 4ED3A 1IKVB 1RYRA 1HQEB 1S1XB 5I42B 5CYMB 1JLFA 2BRLA 3I5BA 2W8KA 3EPIA 4DL7A 1IKYB 1RT4B 3Q8RB 4K4VA 4NLGA 3KLIA 1TV6A 4WFZA 2XWYA 4IFYB 1S9GA 5I3UB 1DTQA 3LAMA 1S9EB 1GX5A 1S10A 3KK1A 3ISND 2RF2A 1HNIB 5KFJA 5KFHA 2EC0A 2OPRA 4RW6A 4O44B 5DQIA 3M8QA 4ID5B 4NLVA 1JLCA 3BQ2A 2XI2A 2WONB 5HBMB 3V6DA 3QO9A 3HHKA 5KFOA 2V9WA 4WZMA 2ASJA 3LP0A 1VRUB 3EPGA 3LP2A 2I5JB 1RT1A 4H4OB 1N6QB 1RTJA 3OSPA 4TY9A 3PJWA 3BQ1A 3QIPA 3MEGB 4K4YA 3FSIA 2R2RA 4RW8B 2W7OA 4NRTA 3DLEA 4FBTA 3H40A 5JXSA 1BQNA 5C25B 4ZHRB 3QIDA 4H4OA 3RB3A 2IAJB 1EETA 1OS5A 3CVKA 2ILZA 2C28A 2D3UA 1S6QB 2WCXA 1HNVA 4RW7B 3SFGA 1FKPA 4B3OB 4IOBA 5KFLA 1JLGB 2GIRA 2OPRB 4RW6B 4J9PA 3MF5A 3KMSA 1C0TB 4F4ZA 3JSMA 1S4FA 3NKYA 1LW0A 2XCAA 5F8NA 1MU2A 1S9EA 3GQCA 2YKNA 3PW0A 2DPIA 4IRDA 3DRSA 1KHWA 5KG7A 1C0UB 1RT7B 2VG6A 5C42A 5D3GB 3QGIA 2JEGA 2JC1A 3H4DA 3T5HA 3ITHB 4EO6A 4G1QB 2WOMB 1KLMB 4ZP7A 5JUMA 4FBUA 1C1CA 2RKIB 2B5JB 2YNGB 1JLFB 1S49A 1S1XA 2BE2A 3DM2B 4NCGA 4I2QB 5EDWA 4NLXA 1RDRA 4NLPA 4YMEA 4Q43A 5CYQB 4J9KA 2E9ZA 4IR9A 3BR9A 3G6VA 2HMIA 3TAMB 2AWZA 4YP3A 1TL3A 1JLAB 1SUQB 4NLWA 3MR3A 1XR7A 1I6JA 1TL1A 4I2PA 4TN2A 2XC9A 2AQ4A 3KJVA 4FS1A 5KFAA 1DTTA 3C6TA 1UWBB 5DQGA 1NNDA 1LWFB
chains in the Genus database with same CATH superfamily
4K2XA 1XJWB 3MM6B 3AXKA 4RJVA 4TQRA 4B17A 5A0YA 1HNWF 1C2PA 4USWA 4AL6A 5E41A 3CCTA 3KJVB 5LJ3Y 4FF4A 1H74A 2B4VA 2DCLA 2H4YB 4P7VA 1WC5A 3ZTQA 5A76A 2ROEA 3UPFA 2NYIA 4BWJA 4L73A 4U96A 1VCTA 4OX8A 2XO7A 2D3ZA 3PR4A 4RW9B 1PJ6A 5E5NA 4CLKA 2EFGA 1ZETA 4PQUA 1DBDA 2JRSA 4X66F 2R7TA 5CYQA 3K17A 4ECTA 2VFVA 4NCGB 3OFEA 4CLPA 4F3QA 3EGZA 3CJ4A 3ENAA 1S7IA 2ALYB 3HF5A 2BABA 3ITHA 1CEZA 3K2YA 1WHYA 3TI0A 1NMEB 4ANDA 1FDBA 1BQNB 2DNZA 2GGPA 2QN6B 3VCDA 2QE5A 2ZDOA 1WDTA 4NZ7A 5ETPA 1JJ2R 2E9RX 2R7UA 5T7LA 4F4YA 3D6MB 2OPPA 1XTZA 2NYHA 3MGJA 4D3GA 3ZZRA 2OPQA 3SV4A 2W1BA 4S0MA 2ATLA 4WKRA 4DSJA 1X4EA 1P1LA 2LVWA 1SL1A 4CLTA 5KFZA 2Q6BA 3BGUA 4ETXA 1R0AA 4PYAA 8RUCA 1F2GA 2O01C 1F3FA 4CLWA 4KHMA 2RJZA 5G0RB 3IRWP 3DLBA 2NXCA 4X4UA 2HBRB 1S6PB 3PDNA 3MMBB 2DNLA 3MEGA 4LF6F 1TK0A 1DTQB 1TUVA 3N5BA 1IBKJ 4C8YA 3H20A 5ADZA 3DLLQ 3HO1A 1UPMB 2BX6A 3J7YU 3ZZYA 2VQFJ 3MCNA 2CDQA 4ZN1A 1HFEL 4DSLA 3D0IE 3CDEA 5D0GA 3V5RA 5B7WA 1TFYA 1H0HB 1OQ6A 2KHDA 1X4DA 3OV7A 5JVHQ 4JV5F 2CQ3A 3O6QA 4E2FB 1FRMA 2R7SA 3AB2B 3BGRB 1T03A 2E1RA 4URSA 2UXBF 2NXEA 3CJ8A 5LSOA 2HHSA 4ICLA 3D54A 5KFWA 1RSCA 4ALZA 2W9CB 3BREA 2M7SA 2A6MA 3FUYA 4DX5A 3H5SA 4TLQA 4DV0J 3MTKA 2UUAJ 4HEA9 3J81j 3MCOA 4KSEB 4DQQA 4U7UK 2QSFA 1N34F 2Y1JA 2W9CA 2IM0A 4DPXA 1U2CA 3BSNA 3CC2S 1PC4A 2FDNA 1K47A 1VLOA 3AD9C 4Q8EA 2V4QA 5B0EA 2C2RA 1QUVA 4LIRA 3DGPA 3JYTB 1Q8BA 3THPA 1PCAA 3BKTA 4LFCJ 4ED0A 4PRFA 1LWCB 2VDIA 3DN9A 1RCOB 3MECB 2XEXA 2ZBPA 1SH2A 3A4TA 2F5GA 2ZWOA 2ADCA 1T9XA 1XMQF 1FNXH 2O5DA 1TL3B 5C42B 4GVBB 4B9NA 3MOJB 2MLXA 3D67A 2ZBIA 3FJ2A 3TEGA 4ZP6A 3WIUA 3K8WA 1CJTA 4PEOA 5HVGA 1EIYB 1HBMB 4ZIWA 3NNCA 4ED1A 4DG1A 2J8AA 1KSPA 4A8QA 4CLSA 4CO3A 1HPZA 2FLOA 3AA9A 3DOMA 3MCSA 4NOHA 5L39A 4CZCA 2ZM6J 2ZHBA 3VALA 4ECSA 1RT6B 4QU6A 1LWEA 1X4BA 3WC2A 2Z56B 2HS0A 1DFDA 4EBEA 5KFEA 2RD5C 3OR2B 4ES1A 1RAFB 3HSZA 4V1Ak 4AXIA 1FD8A 4MKBA 3IG1B 1U1PA 3R6LB 4CM2A 3MOZA 1R6YA 2VBWA 2GVZA 4ECYA 2PI5A 4KBIA 5HL7Q 2OI2A 4ZKAA 3DLEB 2PO4A 4AQYF 3QWUA 3MXHP 3NS6A 2CG4A 3CC7S 1GAOA 3JSMB 2DXFA 3MM9A 4ECXA 3R6GB 2J9DE 2YNHA 2V2QA 4P2MA 2E66A 4PG6A 4ED7A 1S0OA 4B3SF 4BLGA 2AEMA 4CTAB 1TKDA 4BHQA 1ZAXA 2AJ4A 3DRPB 5GAGI 1VRUA 2C22A 3CIMA 1VR6A 2B4PA 2QLXA 2MQ8A 2V5HG 3W8GA 2XZWA 1PBAA 2F65A 2X3GA 3WX8A 3KHHA 4ZLLA 5DDRC 1RGVA 3AB4B 2Y0BB 2YNIA 3PYFA 2DNQA 1NDKA 2F9DA 3VVUA 2XS2A 1RCXB 1KD1T 5F9LA 5CZXA 2OEKA 1RWUA 4ZVEA 4K2JA 2A6OA 2AJ0A 3CMES 2B3TB 2KTQA 4KV8B 3G6YA 3TARA 1VBZA 4B3TF 4ZVFA 2WBRA 3LQVA 5HAOA 1T3NA 2EK6A 2E5HA 1FK9B 2K1RA 3RR7A 4O4GA 2LDIA 1VC6A 1JLCB 4YB5A 4KY3A 4W92B 2CWXA 3T1HF 1J5OB 3KLEB 2D74B 4RNOA 4FNHA 4IDKA 4JBCA 2YWHA 4OX9J 3OVBA 3UCUP 4M94A 2IA0A 5F8JA 2AEJA 4Y00A 5C24A 4DL0C 2FJAB 2VB6A 4TYBA 1JX4A 3FFIB 2C3PA 3NNHA 3J7AN 2CQCA 3E3XA 4DR3J 3MHYA 1S6UA 4RU9A 2IBKA 2HS4A 2E7XA 2KN4A 5ETLA 1EB0A 1AXQA 4EUVA 3J80U 3MFHA 1I94J 4XDDA 2RHSB 3H2LA 7AT1B 1FI4A 3Q89A 2VOOA 4KGVB 1QVGR 3I82A 4KR0B 4TY9A 3QZ8A 3JB9k 2YX1A 1WTFA 1R7IA 1QAYA 1RXOB 3BSAA 3BF4A 2NZCA 4PWUA 3NOGA 2GQCA 3VQSA 2JVRA 3A1YG 3GR1A 2VBZA 2BOPA 4JI4F 4ZPVR 2EW9A 3VAJA 3LPYA 3UE2A 1HIYA 5GADU 2M52A 1Q1KA 1ZZFA 3TX8A 1BY9A 4KFBB 2BRKA 2B5JA 1Z1ZA 3KUGA 4FPRA 2RQKA 4RR5A 1KFSA 2R2SA 2FLPA 2GNKA 4QR1A 2EKNA 4WE1A 2W9BA 4O0NA 4DV2F 1KVJA 4HL9A 4N76A 4DR7J 4ZJLA 1RT5B 3JSBA 1YHQS 1JLBA 1FX4A 1URRA 5F8IA 4TQSA 2HQ3A 2MKKA 2CJBA 4YR0A 3NNAA 1R8HA 3KFWX 2RDJA 3QGHA 3QIPB 4P2FA 4U9RA 4ILLA 1Q5VA 1HNZF 4P71A 4H4MB 1RTJB 1SV5B 1DAXA 2JWNA 4RU2A 3Q8PB 3GPAA 1P27B 1WI8A 3A3PB 4U6PA 2GMLA 1OWXA 1R89A 4WFXA 5GAHI 4AT1B 4X4RA 3P5BP 1Q86T 2PN6A 2DGQA 4QWCA 4DV7F 5KG5A 1LK5A 4ID5A 4OLPA 3TZXA 4Q8FA 2VA3A 2G0JA 1KQGB 1PJ5A 2ZBRA 2K8GA 2H65B 2JFDA 2N3LA 2UZAA 2YNFB 3OTEA 4EBDA 1N34J 1RHJB 3OTOF 4O3RA 1OYDA 2F4FA 5KFDA 2HVDA 1CJKA 3GIJA 2MZTA 3BGFA 5KG6A 3VZHA 4K0KF 5FIIA 2QL5B 2YH0A 2IJRA 2CJ9A 4USKA 2PDAA 1N33J 1ZTWA 2V0NA 3L7UA 3ZNJ1 1GMWD 3M8QB 1AUSL 1KS2A 2H9ZA 3DI6B 1IJEB 1VQLS 1E6YA 1VIXA 3CJTA 1KDNA 1FNOA 2DRDA 1Y7PA 3HT0A 2QZ8A 4I64A 3E8OA 2YKMA 5KG0A 1AA1B 3EGNA 3R5GA 4QPXA 1S9GB 2IC3A 2FD2A 2V63A 4F4AA 1UL3A 2APOA 4I0WA 1FFWB 1N52B 4LT6A 3QBCA 4JYAJ 1Q7YT 3OSNA 2MJNA 3HVAA 3R5BA 2VFUA 4M5NA 4QR0A 4P9SA 1V5IB 3TQEA 1RT4A 4WJBA 1CSJA 2F8HA 2FJWA 4F0KA 2EFOA 3OFFA 4JI0F 4WYWA 2BJ9A 2HFZA 2RS8A 3N01A 4TYAA 4YEAA 1GXUA 3KG1A 4R8UA 4QWEA 1GTHA 3ZO7A 4KE5A 4PWDB 4LF6J 3WBZA 1A6LA 2G2ZA 2E5IA 2PGCA 3C6UB 1NEEA 4LVOP 1REVA 1G6BA 3T1YF 4Z37A 4DR1F 1UPPA 2HGNA 4XO0A 3FDSA 5KTQA 1RYSA 3ZC4A 4F0HA 2DGVA 2FZGB 3P45B 4X84A 1HQUA 4ZPAA 3NXZA 3ICLA 1V3SA 2EC2A 2OTLS 2HHTA 1RTDA 2IHR1 2WRMA 5BYRA 1YRUA 2WK4A 5DDQC 3B78A 1WHVA 2VV5A 3RW7A 3MEKA 2I2YA 1FF2A 4RWWA 1TP7A 3BBFA 3CIZA 3I5CA 5ETOA 1B3TA 2MJUA 4USVA 2CQIA 2G0CA 4YB7A 3BSCA 4FP9A 1FE0A 1RAHB 2HQIA 2E1AA 4I67A 2DH9A 2WVCA 3A13A 1DJ0A 3Q83A 1V5VA 4OZ1A 1QM9A 1Z4UA 3AOAA 4MKAA 5CHCB 1D09B 4MIBA 3TVYA 1QUPA 4I7FA 2W4PA 2B6AA 3KWMA 2RDDA 1LFWA 4URQU 1QAXA 3M4XA 4LSLA 1Q7LB 2F40A 3PYGA 2HKEA 4NMLA 3W5ZA 1JLGA 2Z4PA 4I56A 5DJBA 3M2VA 4PABA 1TAUA 1CJUB 2EKYA 3ZTPA 3JAMY 3PW2A 2R4FA 1RAIB 4HI2A 1PGZA 2UVRA 3QRQA 2QX0A 1VFJA 3SSQA 4ZHRA 3RB0A 3AJDA 4DF4A 4PXDA 4PKDB 1FVSA 1HNWJ 2GW8A 2BQUA 4Q0BB 2KZMA 5DM6Q 1NK0A 3ZNUA 1WTBA 2V69A 3RB6A 4B3MJ 4LF8J 2BBEA 1VK8A 2CXEA 5KFUA 2VZ9A 2LFVA 4DZ6A 3W9IA 2R7XA 1Y10A 2ZD1A 1K1QA 4XAKA 1U09A 1PYSB 4KB7A 5LSLA 3O1LA 5IM0A 1JK9B 4MH8A 3Q8VA 2FHJD 4QIWD 2LA4A 1KWMA 4B9MA 4LJMA 3HKWA 4CO5A 4N77A 3PFEA 4Q0BA 1TKXA 1WI6A 3BGLA 1OPZA 2ZH2A 3RTVA 1U1KA 5B0FA 4LUBA 1HNXF 3AAWB 2EFNA 1TFWA 4IFVA 2BZ2A 3GSDA 2QEXS 4ED2A 3SEOA 5DM7Q 2CPXA 2CPFA 2ILYA 3MMAA 2D9PA 3UCGA 3OLBA 3V6JA 2C2DA 1VRTA 3QRRA 1N32F 1WC6A 1RTHA 1OO0B 3DFEA 4UQTA 3NBPA 4PXCA 1ZTTA 2YKPA 4RUCA 2OP5A 1T11A 2F8MA 2H5IB 5KG2A 2DRBA 4HI1A 4JI2J 2C2OB 1NJWA 4JI6J 5HQLA 2L9WA 3TQ1A 1JJHA 2UXCJ 2J6TA 4NI2B 4B9UA 5B09A 4WE1B 2W9BB 2HFUA 3WC0A 2GJ2A 3ENVA 3BO2A 2XSFA 3PNIA 3RBEA 2AGOA 3KUEA 2V94A 3PG9A 4LF1A 1K9MT 4KKOA 5J2NB 4P75A 2DR8A 3IR5B 4MFBB 5H9EK 1GX6A 2KKHA 1AW0A 1CJTB 4KJIA 4PAAA 1VJQA 1L3UA 3VAGA 3A3NB 2GFFA 2KH9A 3GYNA 3VAHA 4LF2A 2F4VF 4H4KC 4KKOB 5EGYA 3PVXA 3H4BA 1RHMB 1B7YB 3D28A 4JI6F 1HD0A 2PMZD 4F2SA 1R43A 5KFRA 3TAMA 5L8RC 2HRUA 4OJGA 4R0JA 4ZA1A 2I8EA 3KNAA 1CQMA 2E7WA 4CNYA 2W2OP 4ZMMA 3IAS9 4ED3A 3GIRA 3OFHA 3DLHA 4NA2A 4LF5F 1S1XB 5CYMB 1JLFA 3ISZA 1DY3A 5U47A 3FBFA 2UU9F 3I5BA 1S57A 1HW8A 4C3MA 3Q8RB 3MM5B 4F02A 2AIRB 1TV6A 1MNEA 1IR1A 2VONA 4HVZA 5HVFA 1Q81T 5I3UB 3AODA 3VAMA 2B9XA 1UA1A 1VIOA 2ZKTA 2MZJA 1HNIB 3QT5A 4J91A 2AYMA 2E5JA 3J80Y 4RW6A 2QG9B 3M8QA 1RP5A 3BQ2A 4JB8B 1NU4A 2EPIA 2DITA 3QO9A 2HW3A 1FXDA 2XY6A 3UDEA 3K5PA 4PG5A 2E7VA 1AUDA 1VBXA 1GT8A 3LP2A 2ZUGA 1OSCA 3BH6B 4H4OB 2KXNB 4DX8H 1XC9A 1SJ3P 1BUXA 3G96A 2C3OA 2AP6A 2EG2A 3MEGB 1UJ4A 2VH7A 3MMBA 5L46A 4X4OA 2BUNA 3CCWA 4FBTA 4P2XA 2NLWA 3SDEA 4ZHRB 1HLWA 4H4OA 3LTOA 1OS5A 1EETA 2QMWA 2C2MB 4HTJA 2D3UA 3H2UB 3PX4A 2C28A 4RW7B 3FCHA 4QU7A 4DX7A 1S99A 4B3OB 3KXDA 3IC1A 1X5SA 4FXWA 5E3CA 1JLGB 2GIRA 1R8CA 3EWGA 3M32A 2OPRB 1U49A 1HR0J 3MF5A 4PG7A 3UD4P 2DGTA 1YRTA 1Y00A 4I6AA 3NKYA 1SIWB 1LW0A 2JX2A 1R0CB 1X4FA 3SSSA 3GQCA 2DPIA 2CQ1A 3PKMA 2LCWA 2OEMA 3D66A 3DRSA 1WEZA 1MW7A 4KC5A 4MIWA 3MAAA 4JI2F 2DR7A 1WKJA 1TAQA 3BR8A 2JJ4D 1GXTA 4IO1A 2W01A 1KQFB 3IWNC 2GJFA 3T5HA 5E3AA 3UR3C 3HD1A 2C3YA 3WHIA 4FBUA 2RU3A 1C1CA 2RKIB 2B5JB 1YI2S 1MN7A 1S1XA 1WOSA 2HBQB 2VKRA 4NCGA 1SB6A 4I2QB 4LRBA 5JJBA 2AKWB 2Z0GA 2JSXA 5CYQB 1Y9OA 2WSCC 1Q78A 2ZOFA 4J9KA 3FSXA 1HBOB 4LIWA 2E1CA 1RB0A 4A46A 3EGVA 2CIMA 1D8YA 3TAMB 2LA6A 4J9UE 2XLKA 3FK4A 2GMJA 1TL3A 1JLAB 1SUQB 4GO5X 3PCOB 4GVBA 4OI6A 4ZVQB 5HATA 3H90A 4W4MA 4DPUA 2A10A 3MR3A 1HR0F 4I2PA 3CMAS 3A8KA 1FFGB 2NSBA 4X64J 5ETRA 3TVZA 2MHNA 3N9UC 1Q79A 1HBOA 3GJQB 4OYIA 2MKJA 1LWFB 5DQGA 2VIHA 2KT2A 2DH8A 1NBEB 2LEPA 5J2NA 5J2PB 1FKOA 3IRXA 3IR7B 4LRCA 1U25A 4TKTA 5D0EA 2LQJA 4M5HA 3D0HE 4IG0A 2EG1A 5KFCA 4M5GA 1IKWA 1TU0B 1D0EA 3UDLA 4A8SA 2BACA 1T0TV 5J1PA 3KK2A 5D77A 2HYIB 3LH2S 1IKXA 1T9TA 3PJ9A 5F3ZA 1NPPA 3BO3A 1LWXA 4A8KA 3D6FB 2ZH8A 1T3OA 3PHEA 4RX6A 4B9LA 4NPOA 1XIQA 3A8JA 1C1BA 3SQGB 3J7Z5 4WIIA 2Y1LB 1IWAA 1UJ5A 4I69A 4OJHA 2K3IA 5HN0A 4CO1A 2HFOA 3DI6A 1SH0A 3BBCA 1YBUA 3HXMA 3OL8A 5AT1B 2EK1A 2ZUAA 3QGGA 5DRKA 1X4HA 2MHEA 4IOCQ 4JI1F 5E0OA 3CCRS 2IM2A 2LXIA 2N4CA 3TUIC 2ZFHA 1L3KA 1C0UA 1RT7A 4N5SA 2XWXA 3LGMA 4XK8C 2JHEA 3SDEB 4DN0A 5EWFA 1ITPA 3W9HA 3NGTA 3GG1A 2MGZB 1HI0P 2MSSA 3DCAA 2HVZA 1KTQA 3NMAA 1U6ZA 2VG5B 1X4CA 5LL6d 4KIAA 3D1OA 4FF3A 1HNVB 4NEYA 2EFQA 2W25A 3L7OA 3KHGA 1BLUA 2VC0A 1RT3A 4B02A 2CNNB 2PSZA 4QYZK 4CTAA 4RLEA 3PX6A 2VUGA 3PRDA 2CJAA 1CC7A 4GKKJ 4H54A 1QD1A 3R3TA 1JLBB 2E1MC 2D9OA 1Q8IA 3FRYA 2ZJQQ 3F0NA 2JEFA 2OSQA 4OYMA 2NXUA 3MMCA 3H5XA 5A8WB 3M8SA 2GIFA 3JQJA 1U1LA 2CPJA 3EE3A 4IG0B 4YR2A 1RT6A 2DO0A 3J81Y 2GMHA 4LSZB 2W8LA 3N4WA 5IT0A 2P6TA 1X8DA 1BE4A 2DNRA 2W24A 4LR7A 4P7TA 3HDSA 1KVIA 5DGBA 3OTBA 2AMCB 2FLLA 1X31C 2UU9J 1N33F 4DU7A 2VKZG 2FTRA 2VASA 4F25A 4ID8A 4PWWA 4WKYA 1NKBA 3C2PA 4IOAQ 2DKOB 1ZAVA 3MDFA 4A8XA 3R2CJ 2KJWA 2HAIA 3RRKA 2ASLA 4DR4F 1DARA 1RHQB 2CQ2A 1FFSB 4GKKF 4ZP9A 5KFYA 5EN1A 5AXMA 4QW9A 5A0YB 1U8WA 2MQQA 2CQHA 4MFBA 1NDLA 4GMKA 3MD1A 1M5VC 3VGSA 5CD4H 2GZOA 3Q8YA 1S5ZA 1IVZA 4Y34A 3BPDA 3RW6A 3DXSX 1FJGJ 2IIHA 3CB4A 2HZAA 2CKWA 1HMVB 2OFGX 3HHLC 1C4AA 3SI8A 5HLFA 3CEDA 1PKUA 5D3GA 3C14B 3IS9A 1VHFA 2M2BA 5CCMA 1F5AA 5F8HA 2ZNYA 2XMUA 4MIAA 1YRXA 2K7JA 2CPDA 1YK9A 5LMUF 2E29A 3BQ0A 4JI8J 2CG8A 1VBYA 1JXLA 3IO1A 4QZVB 4KHRA 3QATA 3W63A 4XPCA 3TZZA 4JI1J 2CPHA 3FMBA 5F41A 2BE2B 2Z2LA 2R9LA 1Q95G 5LMNJ 3A8EA 5L9XA 4A8YA 2BJDA 1FKPB 2BJ3A 1N5VA 2B7BB 1XR6A 2BJ1A 2Y8WA 1U1MA 2Z30B 2WBMA 4IFVB 1FXRA 1MSWD 2VG5A 1WELA 1O51A 1RAAB 3DRXA 3MWBA 3HMJG 4DUYF 4DDFA 3G8TA 4IRCA 2W4DA 3LPEA 1S6PA 4WFBQ 3SCLE 4KO0B 1KFDA 3B4MA 1K1SA 3GYGA 5GVQA 3P3DA 2QA4G 5G0RA 4DUZJ 2ZD1B 3AFGA 3QQCD 4C8MA 1KP6A 4DN9A 2AJQA 2UVVA 2NPFA 2R7QA 5EHHA 1LQ9A 1RADB 2CQBA 1RU2A 2QC3A 3HSDA 2KFYA 2R8GA 5B0CA 3NGKA 2KDOA 2QFJA 3MM9B 2QYCA 2M0GB 3TAPA 3QJLA 2HBYB 2KT5A 4ZLPA 4NLDA 3GP9A 1WC1A 3BYPA 4USMA 2JLFA 1J5EJ 3JTOA 3MM5A 4DCOB 4WXOA 1O8BA 5KFIA 2V4JB 3DDIA 4CRJA 3RAXA 1M5KC 3DU5A 1NO8A 4OX9F 4FF2A 5KFTA 4PZVA 1IKWB 2DEIA 3OXLA 1LKZA 4ZK7M 3DRYA 5KG3A 1NM2A 3C66A 3EVMA 4YUDA 5A8KB 1RWNB 1XMBA 2EBGA 4RL1A 3K8VA 3R7BB 2RF2B 1U48A 5A6WA 1S72S 1YVFA 2DNHA 4EO8A 1WWHA 3OW2R 2GS8A 1JJCB 1NUEA 2P2CB 4JV1A 1XERA 4PPDA 1TVRA 1FX2A 4NYZA 4RW9A 4DLEA 3FKBA 4I2PB 4DV7J 4EYHB 3RRHA 2KJVA 4L6V3 5GAGU 1X4AA 1SUQA 2MQPA 4UT4A 5E2QA 4FXVA 2HNDA 5DLFA 1B70B 1Q16B 1ZAWA 2HBZB 5D15A 5AE2A 3JYTA 2P9CA 3DDKA 3PM9A 3C8YA 3PZPA 1XR5A 3G71S 2Q43A 1MLAA 4IRDA 4D3HA 4I2QA 1FDAA 2IYGA 5AE1A 3CCLS 2XMMA 3V6HA 4LF7J 3B6BA 2VHGA 5ETTA 1CC8A 3MEEA 2KM8C 2MQNA 5KFNA 4JOUA 5CAAA 1H2VZ 1MWYA 1X4GA 2IA6A 1U1QA 1RK8A 3AJ2A 3NCPA 1YJTA 3FBBA 3BDEA 3W66A 5SUHA 4LRAA 5DETA 4M95A 1NCLA 2Y1IA 2AGPA 3G86A 4U8YA 1FRLA 3ZTSA 4XTTA 1AT1B 5EX3A 3Q8SB 4JV0A 3EZUA 5KT4A 4R5PA 1VHIA 2UUWA 5KFPA 2OJ3A 1MROB 2WOMA 3CTRA 3AQOA 2Y9HA 2OPSA 1GMVA 4X4TA 2XGPA 1RTIB 4OYPA 1EETB 1PYOB 1H72C 4QIEA 3M9NB 2PMHA 1WEYA 2ZBQA 4C9DA 2IRUA 2H3EB 1TZ0A 2CA9A 3X1LB 2U1AA 1HHTP 4LFCF 4O4GB 3M8YA 4FS2A 2E9TA 4ILMA 3NOCA 2LXUA 3OFGA 3ZZ0A 1ZYQA 2L08A 1U1NA 2AT1B 1KOHA 4C97A 1Q4RA 2HLTA 4ECVA 3LP2B 4URGA 1XMQJ 3PIPQ 1VMBA 4ER8A 1R0AB 2XYGB 2CPEA 1OSDA 1WSVA 5HBMA 1SC1B 2IAJA 2HFSA 5IS2A 1QDUB 2YNIB 4HACB 2H1YA 3GJTB 4C11A 3KK3B 1JKHB 4WK1A 1UETA 3MPVA 6AT1B 4J9NA 4DL4A 1L3VA 1HBNB 3EICA 4OZLA 2XSJA 4CH7A 4E0DA 3UNGC 4BC9A 2GCFA 1UA0A 3N6NA 1HI1A 4MK7A 1ZA1B 3RYLA 4F8RA 2VG7A 1XNQF 1RT1B 1H3DA 3DGVA 3W2VB 2CPYA 4N8OA 3J7YI 2XSJB 4NCBA 1LNQA 2VFTA 3LA0A 1VISA 5E7OB 1J5EF 3PW7A 3J7A1 4EGLA 1YLXA 2BKOA 2B6AB 4TLRA 4QWAA 1AZSB 4LR9A 4A8WA 2SXLA 5KFQA 2XNQA 1SKSA 3DMJB 5EX0A 1VQYA 3OT9A 2WAQD 2J0XA 1UVKA 3MFIA 2HQCA 4UUXA 5C5JA 3I96A 5A6PA 4ZLNA 2Q6CA 2RQ4A 5DGAA 3RJMB 3M8ZA 4FPIA 4DR6J 2PC6A 2PMWA 4P52A 2WVDA 4KGKA 5GAHU 2FGCA 2EXUA 3FC9A 2F8EX 4USJC 4HH1A 3U1MA 4ZJOA 1S48A 2XMTA 3RB4A 3W3SA 4DUZF 2RRBA 1HBMA 3QT7A 1HA1A 3HZGA 5F8LA 4LF4F 4CO0A 1EQ0A 3ZFVA 4B3SJ 4KQZA 4RZRA 4G65A 6FDRA 2D3OR 3HHNB 1TKTB 1VI7A 1SQFA 2QV6A 1RTIA 3E01A 2BVZA 4QIGA 4AE5A 4O23A 4J9RA 2XI3A 4XPEA 2AW0A 2OAUA 1F6TA 1XWLA 2GHPA 3TUZC 3QLHA 1RTZA 1HQ2A 2G0IA 1PJ7A 1FE4A 1TUWA 2I38A 2XBPA 3RBDA 1GMUA 4X2BA 2XS7A 2X1BA 4FVCA 1REVB 2FJVA 1FRJA 4YN3B 2PI4A 4DR5F 4Y3CA 4B3TJ 3CCMS 2KU7A 1F2HA 3E51A 1OMSA 4MTPA 4U7CA 1FRKA 3H7HB 3QNWB 1TMJA 4NZ0A 3CJ0A 2QTWA 2AYGA 2DCUB 3R27A 2LECA 4LSNA 1T9YA 3ILOA 1HI8A 2CJYB 4CLUA 1SJ1A 1FHTA 2RE1A 4NZ6A 4BC7A 3NS7B 1T94A 2HQGA 4IDKB 4K50A 1KLMA 3QWPA 3UN2A 4ERDA 4OL8A 3DHXA 1SBRA 4KGZB 3UQSA 4ED5A 1IWGA 2VFRA 2IVYA 2FHMA 2C1EB 4IYQA 5KG4A 4IR1A 3HSJA 2YWGA 3GZ7A 2FVQA 1TQLA 1A7GE 1WKKA 1TKZA 1TKXB 2Q3PA 1RWXB 1S1VB 3CJKA 4WCEQ 5E3RA 1FK9A 2K1RB 3GFYA 1RWVB 2F1FA 4NE9C 4O3NA 2PA3A 2ZKUA 3AHPA 3ZZTA 2J0QD 3QSIA 4OZ2A 3TO8A 3MURP 4Q5VA 3GU0A 5CCLA 1VRQC 5G4DA 2A2CA 1HBUA 2DGOA 4OV6A 2W9AA 2P6SA 2LMIA 2UVUA 2OD4A 4J9MA 3DHWC 3M6WA 2XM3A 1CJVB 4M63A 1K44A 4RBUA 2I6WA 3FRZA 4C8OA 5IC4B 1SC6A 2H5JB 2Y3YA 1UMJA 4BWMA 3UI3A 1XNRF 2B43A 5FDLB 3NEKA 3OXGA 2B8PA 2V2VA 4H4MA 3RAMA 1RI7A 2F7VA 4DV5J 3LP0B 3FQLA 3IP0A 4OYAA 3GIMA 3W64A 3T5JA 3Q0AA 2FY1A 3NAHA 1FJGF 1ULRA 1V3ZA 4OYXA 1LV5A 1FT8A 4P2SA 4NL5A 4PUOB 1YBTA 4F0MA 5EWGA 3PW4A 2IM3A 4DR1J 3M9OB 1J27A 2FC8A 3M8WA 4P72A 5C2CA 3KLHA 4EEYA 1VQNS 4FNIA 3T1YJ 3N6LA 2R8KA 4E8UA 1UVIA 2BM0A 1TELA 1QE1A 2B4OA 2GQ2A 3JSRA 3DLGB 4NASA 4ILRA 2ZZNA 2ZBCA 4OQJA 4F26A 1KRPA 1RLDA 3CC4S 2AZ1A 1REGX 3M2UB 4PQUB 4DLGA 2RIJA 3TA2A 2UXDJ 3I32A 1BXNA 4A4JA 4CLLA 3NRBA 3CO0P 2BANA 1SH3A 1HQUB 2FVRA 4YFUA 4X4QA 2IMWP 1VQPS 4ZCLA 5KFVA 1RKJA 3G6XA 2BJ8A 5D6GA 3NCRA 4ZPCA 2C2NA 5A2QY 3OBIA 2AJ1A 2DNGA 3AJ1A 4ELUA 3KHRA 5K20B 4J37A 3IWXA 1BMQB 4N41A 2W7PA 3W2WA 2JVOA 2HVIA 1M5HA 3KG0A 3RBZA 2KZZA 1U6FA 4G1IA 2RB7A 3PRVA 1WEXA 2BMBA 5HROA 5HO4A 5K8OA 3BYRA 2ACMA 3A12A 3DC2A 5D4PA 5HMZA 1YJNS 4MYUA 3EYZA 3RAQA 1IR2A 4NMXA 4QPTA 1N56A 3CJRA 4KTQA 2A0FB 1S77D 4LF9F 1IXKA 3I0SA 1R6VA 1IKVB 3CPWR 1Y5IB 2HK3A 2NS1B 5LSRA 1VK3A 3SBMA 4YHHJ 2D1CA 3U02A 3EPIA 4DL7A 2FJBB 3R7SB 2W4CA 2ATCB 1ZM2A 4UF4A 4NLGA 2P9EA 4LF8F 3U7JA 1CJKB 2DD8S 4IUFA 2OO4A 3CCSS 1IQZA 1RE1B 2DGSA 3GONA 3U1NA 3K5LA 1S9EB 3K57A 4DS4A 3PX0A 1S10A 4ZJQA 1ZA2B 2QA2A 2RF2A 4X4VA 4Q7AA 4A8FA 2EC0A 5A8KA 5DQIA 5IWAJ 2HHHJ 1UVMA 3DDNA 3AY0A 2WONB 3N79A 3R9LA 3V6DA 2MKCA 4WZMA 2ASJA 2FJEB 1YDLA 2RRNA 4C48A 3EPGA 3SCIE 2VJUA 3W2VA 3MAHA 2I5JB 1RT1A 2HG4A 4DV3F 1M90T 1XNQJ 4DR4J 4LFBJ 2B9YA 4MKVA 3OSPA 4K5SA 1N36J 1YJUA 4K4YA 5M2UA 3FSIA 3D7SB 3CCVS 3MAQA 4JI0J 4C11B 1L3SA 2QSWA 3ETMA 4NRTA 4USIA 3AXMA 4AD6A 5JXSA 5C25B 2FQQB 5FD1A 3PHTA 2DEJA 3B4DA 3QIDA 4WTYA 2IAJB 3L3CA 2UP1A 3UN3A 1HWUA 3GB0A 2BM1A 2ILZA 4J9VA 4ELTA 1HNVA 3ZZOA 4Z2XA 3PKYA 3OR2A 4YDXA 4DMZA 3THTA 4B9VA 4FKXA 1TTHB 1NB7A 4IOBA 5KFLA 2V8DA 4DI6A 2KXHA 1KEKA 3MD3A 1KONA 2JDJA 3BPSP 2G9OA 1YJ9S 1C0TB 3WZ0A 2JNJA 1LK7A 3RG6A 5F8NA 1MU2A 3BDPA 2H51B 2BKNA 2YQ1A 4WP3A 1T95A 4UOGA 3T5KA 1D9FA 2PFDA 1KHWA 1R27B 4A8MP 3P96A 2BEFA 3QGIA 5C42A 3GFHA 5KG7A 2ZH1A 1VDHA 2JEGA 2XY5A 5C7PA 4B9SA 4OHVA 3SSRA 4G1QB 1G1XA 2WOMB 5H9FJ 1YIJS 1S49A 2DNPA 4L76A 2GA7A 2BE2A 1HW9A 2CAJA 4CLZA 3HZEA 4HDHA 3C19A 4NX9A 4JI5J 5JVGQ 2OEJA 4OMFG 3MI7X 1KR4A 4DV1F 2E9ZA 1WG5A 3O8WA 2JLGA 3EGWB 4IR9A 2KL8A 1YWXA 3HM9A 1TL5A 1M5PC 1VQ8S 2LKZA 3HD2A 4F67A 4X62J 3RR8A 4NLWA 1CS4A 3G87A 1RBLA 4MYTA 4TN2A 2HSEB 1QLNA 5AXKA 2W7AA 4EK2A 2DNKA 2J7WA 1DTTA 2OLWA 3JTNA 3R1LA 3C6TA 1HWKA 2ZC4A 2JOQA 2FJXA 1NNDA 3IGNA 3OUYA 1NSKL 4F50A 2CNKB 1KTVA 4NLOA 3MEDA 4EU0A 3UCZP 3O44A 2VA2A 3AD7C 4AFFA 4ECRA 3VR1A 4NXNJ 2H4WB 3RUBL 3Q2TC 3VGUA 2D41A 3OXFA 3K59A 1RWPB 3GV5B 4CP5A 2MKSA 4KV8A 4O3SA 5J1EA 2GJIA 2N4DA 2G1DA 3F73A 1F5BA 3HFVA 4NXNF 1S9FA 3D1HA 4OZ0A 1W25A 4USHA 3HK2A 3UD3P 1NHUA 2AJFE 2IYIA 1KQKA 2PA8D 4L3NA 2CUYA 4N8NA 1NJXA 3KJFB 1KN6A 3D5MA 3O5TB 1X9MA 1NJIT 3M30A 1I94F 2QLWA 4EZ9A 4X64F 4UY85 1S1WA 3H5YA 5C25A 4HHHA 3MAAB 4OIXA 2NREA 1N5YA 1SJQA 3VAIA 4OI2A 4K4WA 2NUUG 4DV2J 5HK4A 4X62F 2CQGA 1QTNB 2UXCF 1QVFR 1HARA 1W2BR 5IV4A 3H5UA 2WVBA 2G13A 1MMLA 1S1WB 1FDNA 3M32B 4OFZA 2ALZA 4PPZA 2I5JA 4B3OA 1H38A 4DV1J 4JI5F 3V6DB 4OX6A 4LQ9A 5DO2A 1OY6A 1E6VB 4O3PA 1ZS6A 2WTFA 2NQPA 2PIIA 2IDLA 1CJVA 5K5MA 4UZBA 3ADAC 3UD5A 4LF4J 1HPZB 2KRBA 3DOMB 3CD6S 3JXOA 5K14B 4DG1B 1YJ7A 3KK1B 4YB6A 2OH2A 1NLKL 1UJ6A 4IH5A 3S8SA 4IFYA 2KXFA 5F0WA 4DV0F 3HVWA 3EDRB 2NXJA 2XYPB 4BBYA 2HWIA 3CO9A 4RNMA 3S01A 2GO9A 2KFNA 1TK5A 4TY8A 3F56A 3ZTRA 2XB2D 3HSGA 2HQDA 4Y2AA 3MECA 1UW4A 1V3RA 2DRAA 4DQIA 2MZ1A 2DT9A 1YITS 3W5YA 2CZVC 3OD2A 4DSKA 1LWCA 3W62A 4NA1A 3IN5A 3MEDB 2W2PP 1WUUA 2V9KA 2J5AA 2V4RA 2DNYA 4KRWA 3N28A 1BGXT 3NCQA 4Q44A 3A8IA 4YDDB 3TX0A 1C1BB 4MK8A 4X4NA 3TJ9A 3GSIA 3G9CA 3WDOA 4U95A 1PILA 2VU5A 2Y1RI 2MKIA 2DVIA 2MY7A 2ZZTA 1WNEA 4LSNB 1LW2A 3CJQA 3KK2B 4G1PA 4FZVA 4LRDA 1UFWA 2MZSA 2ROPA 4WYLA 3W2WB 2ERRA 5KT7A 4ED8A 2CJXB 2ZHOA 2DGWA 2OELA 1RUSA 1NSAA 3QYYA 1ROFA 3P49B 1FJ7A 1NPKA 1RWKB 3NWGA 1VLYA 2VJVA 2IJFA 1HNXJ 1XBWA 2HRYA 2IVFB 5HJYA 2RQCA 2B0GA 3G6ES 1G7CB 1JQGA 2FYXA 1XN9A 4LMZA 3DRRB 4QW8A 3MUMP 2XO6A 5LMNF 3HVTA 3TAQA 1IBLJ 1S0VA 1Q53A 3FEZA 3J81U 1TL7B 2XMVA 3KKFA 1NSQA 2VG6B 4FVMA 5CD4A 5IXUA 2C42A 1T05A 4JI8F 3UR0A 4DL3A 2VPWB 3OJSA 4B3RF 1G3OA 3BV8A 5LMUJ 1O6XA 3T1AA 2IPOB 3I9V9 4ZDNA 4ZVHA 1VOMA 4K59A 1ZM3A 3OHBA 4AL5A 2Y0SD 4C0OC 2C2KB 3OR1B 3TWZA 4JUZA 3KLHB 4KHPF 4C8ZA 2DHHA 5DS7A 1UZHA 1JLEB 2C3UA 4LVNP 4ZCMA 2ZDPA 4WF9Q 1FD2A 4HHUA 4USUA 5MAOA 4RUAA 1SCJB 3PRBA 1BQXA 2NR0A 4DUYJ 2RH3A 1AZSA 4WP8A 2CQ0A 2C3MA 2NXNA 3GJRB 3PYDA 2OPPB 4ZPTR 3HHLD 1H6KX 3R7NB 1IN0A 3OLAA 5M2RA 2UUAF 2KI2A 3W65A 1DQAA 2VG7B 4NLUA 2AYBA 4LF7F 3M30B 5FDLA 4KH0B 3LANA 2V50A 2J7KA 5E33A 1PAUB 1HKAA 1UEVA 3MZIA 3X3UA 2ZM6F 1LOUA 2XYHB 3KDNA 1UKUA 2WONA 2AHOB 2DNOA 5BYQA 2UV8G 2XGQA 1NSPA 2FHOB 1RAJA 1SJRA 3EZOA 3HFZB 3LWMA 2FY8A 4HT7A 3LP1A 1MWZA 2H48B 1UVJA 4ZVSB 1RBAA 5L1KA 4DR2F 1KLNA 1R8BA 2AZ3A 2CZ4A 3ONQA 2V8GA 3CJ3A 3H0PA 3NG8A 2EFVA 3RZAA 4M5KA 4F3MA 3KLIB 1FEEA 4YY3F 2HHQA 2B8QA 4NYPA 3EZ5A 2V8HA 2FPHX 1DQ8A 4CIOA 4CYUB 3M2RB 4P73A 3US5A 2QIFA 3ENWA 4IG3B 3CDUA 4YR3A 2EWHA 1RT2B 4WFYA 3ZZPA 4RNHA 2XQCA 4EBCA 3I0SB 3MM6A 4K4SA 5J2QB 4R25A 1ICEB 1JNZB 3LWLA 1I5OB 3SQOP 2OPSB 2MLYA 3LALA 4FN5A 3D68A 2FB0A 3MR6A 2LP4A 1URNA 1T9WA 3IBWA 4I6YA 4RW4B 2ZNZA 4K5RA 4ES2A 5B08A 4LSLB 1IKXB 2KYZA 1M1GA 3PIOQ 4AUKA 4F4XA 1YTYA 4DL5A 2RUGA 3GMGA 4N7TA 2V34A 1HNZJ 5D0RA 5J2PA 3VTIA 4C6AA 1RHRB 2BXJA 4JI3J 3KHLA 1LWFA 1RACB 1UWBA 4QWBA 3MEEB 4HKQA 4WBFA 3NGDA 4J9LA 3DM2A 3GJSB 4DR7F 2ZOMA 1YKWA 2O67A 2MPUA 3NS5A 4G6VB 1EARA 2X51A 3VZIA 3IWLA 3E01B 3HHLB 1S1UA 1U0HB 5KFGA 1JLAA 3UW1A 1RZMA 4EMDA 4ZCIA 3V6KA 3S7RA 3OTOJ 3K0JA 3ET6B 1RTDB 2UUBF 1MU2B 3KJQB 5K8PA 3R5DA 3RRGA 4P10A 1UWAA 3C16B 3WIVA 4M5DB 3R8YA 5HMYA 2RAQA 2FLNA 5D8HB 2BKPA 2QRRA 1BQMB 1X9SA 3T9NA 5ETKA 3MMJA 4OV1A 4WXWA 3W9JA 5HJXA 4DX6A 3QFHA 1VYAA 3VVTA 4MMOA 2KG0A 1RKIA 2D7SA 1V9OA 3U27A 2ZH5A 2FHKA 2A3JA 4F4KA 4PUOA 2LLZA 5K8NA 3CCJS 3SMZA 2XY7A 1SJFA 3SXLA 1Y4ZB 1P1TA 2CQDA 3R1HA 2M8DB 4DV4J 3FNNA 4FYWB 5GMEA 2YX4A 1ZPVA 4GC6A 4B3RJ 4DV6J 3AT1B 4DR3F 1JLQA 1NZAA 2POKA 2A18A 2Q79A 3BKFA 1NK5A 1A9NB 4ZITA 3VV2B 3CD0A 1N54B 4RW7A 4F3OA 2ZE2B 5E3QA 1IBMF 2HQFA 4LREA 1Y5NB 4I1TA 1BD6A 1I3OB 2DB1A 2GAGC 4KT0C 4W90B 1GH8A 2G2YA 1Q8LA 3HLUA 3KDOA 3FCVA 4CT8A 4WFAQ 4I68A 3ILLA 3SV3A 4Y0FA 2J9CA 3KLFB 1XK8A 5ETMA 2RSQA 5DLGA 1B0VA 3MM8B 5D78A 1EZZB 3M7VA 2CPIA 3IGVA 4C0HA 4F4WA 4L72B 1NK9A 4JI7F 1VQ9S 2W2NP 1RA6A 3C15B 1IKYA 5AXNA 1RA7A 3I0RB 4PCQA 1S1VA 3D3CJ 2JL9A 4LFAJ 2BDPA 4K4ZA 3P4UB 3UVJA 5FJ4A 5HSPA 1X0FA 2QO3A 3MUTP 1Y3KA 1HNIA 4ZPBA 1NKEA 2ZH3A 3H42A 3M9MB 5HANA 1XMOJ 2KHCA 2MLZA 2FUG9 1G2EA 5I3UA 3QAUA 3EJMA 3JQMA 2KG1A 3RGIA 3DU6A 2AU0A 4R5PB 2MDAA 4GC7A 2BR0A 2HZVA 1SV5A 2IM1A 2HIQA 1RWMB 2DHXA 4BS2A 3MR5A 1FRIA 1JIHA 4QR2A 5K9FA 2ZH9A 1MWQA 4K4XA 1P6TA 2IRXA 2OIHA 3CE8A 2QL7B 2JZ5A 2N7CA 4RKUC 2GO8A 3FSYA 5GMDA 3TNVA 1T9VA 1HYSB 3ULHA 2RVJA 2L9NA 5D4LA 3MUVP 2UVWA 2AV5A 3MR2A 4CH0S 3OL7A 3GIKA 3DOLB 5J2MA 5IV3A 3QFWA 5HI7A 2R8HA 3V81A 1RHKB 2PD1A 3TJAA 5GAEU 2KM8B 1CLFA 1UFLA 1FCAA 3I9ZA 5L9NA 2R8JA 2DY1A 2HMIB 3BEGB 1RISA 1S4EA 1OQ3A 4RNFA 3KLGA 3LW5C 1SKWA 3M8PB 2BW2A 4FDFA 1S97A 4TU8A 3I56S 1K0VA 2Z2YB 1TVRB 2JC0A 2J0WA 4YQWA 2CQPA 1P9QC 2DXEA 4LBPA 4J7CA 4WZQA 4DEZA 3TUPA 3K7RA 4NEZA 4RWXA 4EWTA 3L09A 3L9ZA 1VQMS 1VS3A 2DO4A 3MCMA 3T19A 2IVMA 1N48A 3FFIA 2R42A 1IQTA 3EDQB 4PG4A 2V4JA 3NBPB 4O4RA 3DLJA 3MMCB 4OYBA 4KPCA 3Q23A 5C2GA 2QLJB 4KH1B 2E1PA 2F3JA 3I6PA 3VHQA 4QYRA 4JI4J 1H2UX 2AJ2A 2PFFB 1JKHA 3KK3A 4JV2A 2RUSA 2CQ4A 3IXQA 1RT2A 4P6QA 4C0BA 2YH1A 2UXBJ 1FWLA 3FBCA 3N6MA 3IM9A 3UDCA 4JP8A 4W98A 1NAQA 5CH7B 4UQGA 2WB4A 2XLIA 1SC4B 1VGYA 1SI9A 3NY0A 1GNKA 3IBFB 2HNZA 1BHNA 1RAGB 2DR6A 3D0GE 3T6JA 4KO0A 4DU8A 2R7WA 4LF5J 3BSOA 3BN4A 1RABB 3T6BA 3BKUA 2QGFB 2HNYA 3FEYB 3BH7B 1W26A 1NH8A 3G82A 4NA3A 3TUJC 1S59A 4MK9A 3WQPA 3ZTOA 4ECWA 3D6TB 3EUNA 4DL2A 2V2ZA 5LOQA 5BR8F 4ZCKA 4C7QA 4ZVPB 2VOPA 3I4HX 3B54A 4UOHA 3GTYX 3P5TL 3CJSA 1JLQB 3KMQA 3CT9A 3G2XA 3QJJA 2YNHB 1GQEA 2Z8QA 1BWVA 5K8MA 5HP1A 4QJVA 3C3LA 5CYMA 4Q2LA 1HQEA 5KFXA 2CJQA 1D1UA 4I7FB 3PR5B 1AFIA 2KO1A 4OZ5A 4HH0A 3CXCR 4ED4A 3CCZA 2P9GA 3QT8A 4USTA 2UUCJ 2A2DA 5FLXY 5LJ5Y 1NPRA 3U1LA 2DYAA 4K0KJ 3IMQJ 1NDCA 4AYBD 1ZM9A 2GVDB 2VPYB 4WIQA 4B3MF 1LWEB 2E44A 2LU2A 3AQPA 2RRAA 1PG5B 2GC8A 5D0HA 4A8OA 1A0OB 2F9JA 2HFNA 4Y2MA 5KFMA 2BQ3A 3GLJA 3JSYA 4LFAF 1F9FA 4CLYA 4A47A 4FXDA 2R2UA 4JI7J 4L75A 4ZVGA 4KGMA 2HRTA 4UZCA 2ROGA 2HNDB 2AF6A 3CMQA 2Z57B 1TL7A 4DV3J 1SL0A 1Q8KA 4RUHA 3CJ2A 5J2MB 2HK2A 4NLRA 3G8SA 5HMWA 4AQYJ 1M5SA 3NP5A 4Y65A 2XHCA 1H2TZ 2DY9A 4L3KA 3ENQA 4IQXA 1V6HA 4UW2A 3S6EA 1YJVA 1N5QA 3BM7A 4C3LA 2FGOA 2KYXA 1HQEB 4RO0A 2BRLA 5AJ3J 4Y2KA 2W8KA 1B64A 2LU1A 2J0SD 3EMTA 1RT4B 4X4PA 4DXLA 1X9WA 4CH1A 4BCAA 4XIUA 4A48A 1ZPWX 5BJRA 2O3DA 1TUGB 1UTAA 3I31A 3L4BC 3M6VA 1S9GA 4C2MA 4J5OA 4LF9J 3ISND 1W7WA 3Q2SC 5KFHA 2OPRA 2HLUA 4O44B 4LFBF 1JLCA 2W2QP 2GHVC 2XI2A 1AYEA 5HBMB 3G82B 4QIFA 3VQTA 3G4SS 5KFOA 4NXMJ 2FJDB 3EVWA 4QQBA 2YY3A 3OVSA 1U02A 3BB5A 3HKZD 3QMQA 1D9AA 4ZOSA 2E5LJ 1HD1A 1UW9A 3K5OA 2MSTA 1OPIA 4M5MA 2IFXA 3PJWA 1S79A 4DSIA 4P74A 1CVJA 4OI4A 4U67Q 1WC0A 4RW8B 2CZ9A 2W7OA 1CULB 5LT5A 3GR0A 1P8GA 5DZ6A 4F7VA 3RB3A 1LXNA 1JWWA 4CM0A 3LGHA 3SFGA 1FKPA 4OJ3A 2VPZB 2CWKA 3BBBA 3HVRA 1ZOTA 4C3KA 3P6YC 3Q8UA 4TU9A 3FVYA 4PXBA 1U1RA 4RW6B 2MXYA 1KNZA 1WG1A 4F4ZA 1S4FA 3JSMA 1EKSA 2F63A 1FEHA 1B4SA 1X5PA 2J7UA 3CW2C 4OYWA 2XCAA 3PW0A 2YKQA 1IBKF 2BV3A 3TA0A 3TEHB 2J76E 4I6WA 3PO5A 2NCKL 3LOUA 2GGPB 4LR8A 4OLOA 2GVZB 5D3GB 1SIZA 4WU2A 4ZVTB 1DURA 3UNYA 2B56A 4OI0A 2XZTB 3CDBA 1EJ7L 3F41A 3ITHB 1WACA 4DPOA 4ZP7A 4DWIA 5JUMA 1X5TA 1JLFB 3F44A 2YKOA 1YJRA 4NLXA 4CLFA 1RDRA 4LBIA 2O66A 4NLPA 4YMEA 4NXMF 2DHGA 4ANEA 4Z7YA 4HTIA 1UEKA 2HHPA 3BR9A 4M8LA 2HMIA 3G6VA 2AWZA 4FYXB 4YP3A 2CYYA 2OMLA 1GTEA 1F60B 3HHDA 4JYAF 1U0HA 4Z7CA 1XR7A 2N3OA 1FRHA 1I6JA 4DSFA 2ZH4A 2BOAA 3CULA 1LEOA 2IDEA 3SYZA 2AQ4A 4BDPA 3KJVA 4FS1A 1HHSA 4C98A 1XNRJ 5KFAA 3UN5A 1N5TA 3B8HA 2VD3A 1SQEA 1UWBB 2DNMA 4KGXB 3D4JA 3CJ5A 5AJ3F 3BN7A 3FEXB 1FA0A 2ZITA 3M05A 3ZZUA 2AGQA 3V2UC 1N0UA 3OTDA 2RS2A 2WB1D 2FVCA 4DQPA 1C4CA 4J9QA 1DQ9A 1YZ7A 2HGMA 2YWWA 5J1NA 1PC5A 3L95X 2GIQA 5C24B 2VL1A 5IT9Y 2JEIA 2I0XA 5LXYA 2QLFB 1NHVA 4PXEA 3CCQS 4NI2A 5F0UA 1VQSA 4CDIA 1D9DA 3PXGa 3IA0A 9ATCB 1QY7A 4U7UD 2WVFA 2ZEJA 4ICLB 5KT3A 5CYJA 1NH7A 1S7HA 4R0EA 4TXSA 1T03B 4MT1A 2VICA 4WK3A 1E6YB 2CADA 3MR7A 1F3VA 3O3LA 1RBOB 5EUHA 3M8RA 3I5AA 2R2TA 1WKLA 3H25A 1SXLA 1L5UA 5GAEI 1DZ5A 2PT0A 3MMAB 2DBBA 1R0BG 4QWDA 3CCUS 2JH3A 4HYKA 1N0VC 2WW8A 1TK8A 1WC3A 3GCXP 3GILA 4PR6A 4PG8A 5ITHA 1CULA 3TR5A 2B51A 3GV8B 1HL6A 3CDWA 3QSYB 4RW8A 1I1GA 1Z2ZA 4MAKA 4DR6F 5K14A 3K5NA 4X65J 4DR5J 3LP1B 4DCPB 3JTPA 1QAIA 2I9SA 1CPZA 3M6UA 3O2IA 4OZNA 1TMMA 3SZ2A 2VDHA 2RQMA 3T9ZA 4YOEA 1SKRA 3FQKA 1UVLA 2YQ3A 2DK2A 3AOCA 3R5CA 8AT1B 4PQAA 1CBKA 1J2VA 4I4BA 1IM4A 4Q2MA 3IM8A 1SVDA 2DNNA 3KJNB 4EYIB 5BR8J 3TZWA 3SQGA 1IJFB 2M8HA 2YXLA 1EAYC 1RT5A 3I4PA 4DZDA 1S0MA 1K0TA 4WP9A 2CNOB 3IS9B 2ASDA 2XNRA 3M2VB 2ZWPA 2EVZA 4DCJB 2E5GA 5KOWA 5HLFB 1EP4B 2RDIA 1MMNA 1HMVA 2DH7A 1FRXA 2K7KA 1AROP 4KFBA 3OQ2A 1ZM4A 1YSJA 2HIYA 2HS3A 1VJWA 4UTGA 2IJNA 1R31A 5F3TA 5MLCV 3WX4A 4Y2IA 4ANCA 2Y8YA 2UUCF 3C16A 1GK8A 2V67A 3EVOA 2YQ0A 1MMDA 1XQIA 3Q8QB 5ETSA 3DLKB 1FWKA 5IFMA 4K4UA 1OYEA 1WF2A 5IT4A 3PTWA 4HT5A 4X4SA 2K06A 2VF3A 3GG0A 4C4WA 1NK7A 1YQHA 3OJUA 5RUBA 3AH6A 2XZDB 5KFKA 3DRRA 3DLKA 2R7OA 3FZ2A 3KLGB 4J9OA 2HVHA 1NDPA 3NMRA 2H54B 1FJCA 5M2PA 1AB8A 2BE7D 3DXBA 4XDCA 1DHMA 3JS9A 5CQGA 1RWWB 1SL2A 4GKJJ 2NZ4A 1K73T 4GVLA 3Q24A 3D3BJ 1RAOA 2V2KA 4ENOA 3TJ8A 7FD1A 3KNGA 3VAKA 1LW2B 2RHQB 1NJYA 1SJ4P 5A8WA 1HYSA 1NKCA 1EP4A 3PYEA 2IMOA 4X65F 5DQHA 1PBUA 2YPZA 2QA4S 2ADBA 1JMTA 2ZVSA 2DPJA 3K5MA 4PWDA 3DRSB 2QL9B 1IUJA 2YWFA 2LQ9A 3FMWA 3NGSA 3OTCA 3KLEA 3PEHA 5L1LA 1SKUB 2NPIA 1N5SA 1VBKA 3PEJA 2XHWA 2QJ3A 1HWJA 3BGRA 2BJ7A 3D6HB 4KAIA 4NYOA 2LXFA 3NGRA 2XG8A 2JEJA 1WSRA 1AFJA 1IR0A 3ZZZA 3T5LA 3THVA 1RT3B 1Q0NA 1U4BA 1F1BB 4ECZA 2YWKA 1U26A 4WWSA 4CYUA 3W7BA 1FJEB 3BO4A 2BQRA 5ETQA 1VQ6S 3TP2A 3CF5Q 4WFNQ 2M9KA 5CABA 3KLVA 2ZJRQ 4NLTA 3M6XA 2WVEA 5F8MA 2MGZA 4K4TA 1X60A 3HP6A 4OHYA 2B9WA 4WU3A 5KFSA 5IM0B 4Q45A 1VQ7S 3P8BB 4QCLA 1UZDA 1F9EB 3IR6B 1UCNA 2YX7A 1ZH5A 3MM8A 2WW4A 3GCWP 3CCES 1Y0HA 3VAFA 3QGPA 1WD6A 2U2FA 3W1YC 2CVIA 4NLSA 3QO9B 4DPYA 4DPWA 4G3IA 2CFXA 5GADI 3R5AA 4O44A 1YGYA 2HWHA 5T14A 2OPQB 5CA5A 2R3VA 3HHEA 2HPUA 4UUWA 5A8RA 1XMOF 4CCHA 3J7ZT 1U2FA 3EXYA 3CDAA 5IC6B 2MY8A 3PACA 1CJUA 2W2MP 1CQNA 2VQFF 1TV6B 3R5JB 1R8AA 1EHWA 3N5FA 3VF0B 3DYAB 5ETVA 3ILJA 3IG1A 4M5LA 4UOFA 4AL7A 4GKJF 3ISNC 1RJJA 1WDDA 5B0AA 4F2RA 5H9FK 4ZVRB 3T41A 1WHWA 1O5JA 2HZCA 3TA1A 1U7LA 2OMOA 3HJVA 9RUBA 1FKOB 3IRXB 1B0TA 3H98A 4HHJA 1FTCA 2YKAA 3PJXA 3A3OB 2VQEJ 1L3TA 1FXLA 1HBUB 1FDDA 1NXIA 2DHSA 2QMXA 1M1HA 2WSEC 4HDGA 4DQSA 1S6OA 2M3DA 2MMYA 4DFPA 1BQMA 1K8AT 2OGUA 3K89A 3CD5A 1JXVA 1KKHA 3UFCX 2CNLB 1Q5YA 2XMJA 3Q86A 1WHXA 2UUTA 4IH6A 2QMUB 2HURA 1U8SA 2V68A 3FGVA 3CJKB 5DG7A 1T7PA 2VBYA 2KFZA 2B9EA 3PFOA 4DFMA 4HLBA 3LUYA 1X0PA 3OUYB 3HHLA 4DV4F 2LEBA 3MM7A 1DTTB 4IH7A 2N7YA 1F5CA 1H98A 3LF0A 3NWRA 3IAM9 5I3PA 5I3QA 1C1CB 2RKIA 3DOKA 3HULA 4U8VA 4FYDA 3NL0A 1P9YA 4ZPDA 1TL1B 4KYZA 3TOQA 4ECQA 1FERA 2HEKA 3HT3A 2DGUA 2Z2MA 3LGNA 4X66J 2ZJPQ 1WF0A 4M1KA 1RLCL 1T9UA 3R97A 2G2OA 1PO6A 5HP1B 1LW0B 1QAJA 2D69A 1S0NA 5IQ6A 2XMAA 2MB0B 3V4IB 2OSRA 2HHWA 5KFFA 1RTHB 3QAEA 4RW4A 3Q22A 2QYGA 1YBAA 1KHVA 2YVSA 4OJ1A 2YNGA 4FF1A 4UOCA 5IWAF 4DUTA 3EX7B 4K7QA 1M1KT 1IBMJ 3GFXA 2HHHF 3C46A 1FWPA 3FBEA 4KHPJ 2BANB 2M5YA 3IBCB 2HGLA 5D4NA 2RNEA 2XCPA 2J6SA 1DLOB 1S1TA 1B0PA 1F0XA 1QJHA 2BW7A 1PAEX 5I4MA 5IZHA 2XMKA 3AOBA 5KT5A 2YKNB 2HVEA 2P8IA 4CI0B 3I0RA 5L1IA 2OTJS 4FYVB 4DFJA 1Y5LB 3M2RA 4ZIVA 4EI2A 1T8EA 1QE1B 2Z2ZA 2A1BA 2CVEA 3GV7B 4HR2A 5T41A 2HNZB 4RBVA 4RPFA 2D3O1 4B9TA 2G1HA 1H7XA 4Y2CA 5IT9U 2AEFA 3CD7A 4NRUA 2ABYA 5ETNA 1NB2A 3W60A 1UFKA 2YNFA 1S6QA 2FIUA 2NUHA 3KLFA 3GFZA 3MPUB 4ECUA 1JJ4A 1B7FA 2XTJP 2K3KA 3I55S 4ZVUB 2Q1LA 3MPWA 4CWBA 1QSLA 2XS5A 1BWEA 1WG4A 1U1OA 4GRSA 5KT6A 4J9SA 5T7LB 2UUBJ 2ZE2A 1N5YB 1PIEA 3DRPA 2RMLA 2HHVA 3GE9A 1UAWA 1X5OA 3CGIA 5KFBA 4LQ3A 1ZBTA 1R8PA 2C2EA 4O3OA 2FC9A 2GQQA 1IM6A 2QFIA 3JQKA 3QT6A 4RBTA 2V8VA 3T3FA 3SCKE 1WORA 5CXTA 1HBNA 3R2DJ 1UVNA 3CWJA 3M1VA 3OHAA 2CRLA 2R7RA 2FZKB 3LO3A 1EKRA 4JV5J 2QLBB 1D8ZA 4AXJA 5E3PA 2DXDA 5DG8A 3QPIA 3HPOA 1YG0A 2J8SA 4JI3F 2X1FA 1JLEA 1KBRA 4DPTA 1RQ0A 4DQRA 2ACYA 1APSA 1YZ6A 5B0GA 3KOAA 2UXDF 3PO4A 2RT3A 1FTRA 5KAKA 2MQLA 4ITSA 4M5DA 4TNOA 1CG2A 1RU1A 2VFSA 3FZBA 2GAHC 4QOTA 2BE9B 2VQEF 4DFKA 1T05B 1S76D 2M4MA 4EZ6A 1YX2A 1DLOA 1S1TB 5KT2A 4B08A 2M70A 3H59A 1N4LA 1S1UB 3V81B 3V4MA 5SZTA 3C6TB 5LM7E 5L1JA 2DJWA 3HVTB 2YBVA 3FCWA 2JLEA 1GEHA 5DZ7A 2GVDA 4ZP8A 4E98A 4ETZA 3D2WA 1LFPA 5HROB 1I51B 2MEWA 3TYTA 1EQMA 2ZOGA 4YY3J 5HQ8A 3V4IA 2EI5A 3C6UA 4H4KA 1JXEA 1U6BA 2KT3A 2KRRA 2ZVIA 3QZ7A 4DV5F 1VQ4S 2V8PA 2YTCA 3GWCA 1X7VA 2I1RA 2MZQA 3TW0A 5THWA 3GIIA 4CO4A 1FO1A 4DJBA 4J90A 3BJYA 5F8GA 4QBUA 1O0PA 4IRKA 4OX7A 2DIUA 3IFEA 4DBQA 2L48A 2X7IA 1VRTB 3DOKB 5KG1A 2RU9A 2DISA 4EFAC 2J6UA 4ELVA 4CO2A 4G1QA 2OHDA 2YKMB 2WSFC 1Y3JA 2GV1A 2G4BA 1TKTA 2VC1A 4IO9Q 2DR9A 3UVJB 2BJEA 2MKYA 3CSKA 5DDOC 4QYZJ 1JNRB 3AD8C 1FNMA 2OUGA 4IG3A 2HNYB 4OYOA 5AE3A 5HQMA 1C0TA 3W5XA 3DLGA 3KYLA 2AX0A 2GX8A 4CT9A 3POTA 3PW5A 2AYEA 4IQMA 4TY8B 3BS9A 4CNZA 2OD6A 4N56A 4MJKA 2AX1A 4KPYA 1H73A 3W61A 1NHKL 4ZN3A 2B4UA 2DGXA 1VC5A 3W8PA 2C2ZB 3QJPA 3DMJA 1Q82T 2K2PA 2OFHX 3LAKA 3OL9A 5H9EJ 2QT7A 2YWEA 1Y11A 1ACMB 1E6VA 2DTJA 3M1VB 2QA1A 4NLYA 1BC6A 4O3QA 1OY8A 2L41A 3DYAA 2EFPA 3DNCA 1WOPA 1N6QA 4ATNA 1M5OC 1F9HA 2GHWA 4MKYA 2FVSA 2PEHA 2ZZMA 1IBLF 5F9NA 4FYYB 1GMWA 3BGOP 2P5VA 3HJFA 4ED6A 4DL6A 2HHXA 3GYXB 2LEAA 2Q66A 3UDVA 4HACA 3RU0A 1JB0C 1MG7A 3CNQP 4GO7X 4NWBA 2FVPA 2LQ8A 4M5JA 3SCJE 2N82B 1PYTA 3T1HJ 1M0SA 4UY8T 1FVQA 1U45A 2CPZA 4OYZA 3D1QA 2AD9A 4NLQA 1WJ9A 3I87A 1FKAF 1NK8A 1N88A 1VQ5S 2WHOA 2YPYA 4RNNA 3K58A 3HFKA 1VQKS 3M8PA 1ELOA 2R8IA 4C8LA 2DHAA 3EM1A 5I42A 1HWIA 1SPBP 1TKZB 2MTLA 1KQSR 1IKVA 5J1EB 4RUBA 2WZ1A 3PV8A 2LQ5A 3NAIA 4WTOB 4YB1P 1OY9A 1VQOS 3B82A 1QSSA 3DOLA 3EXCX 2CJKA 1MROA 1SQGA 5CZVA 5B0BA 1U2RA 5B0DA 2EBEA 2JFKA 1XEZA 5A2QU 3CUNA 1ZZNA 5DG9A 2HFVA 3SFUA 1HWLA 3TZYA 1KOOA 4V19J 1N8RT 4R8UB 4OHZA 7FDRA 3OL6A 1IBCB 5IQQA 3C14A 3TVKA 5HVHA 2DR5A 3KUHA 5HMXA 2VBXA 1CS4B 2HHUA 2KVIA 3BZQA 1WF1A 3HCXA 1U47A 2J9DA 1WOOA 2VODA 5JMNA 3QLHB 2MYFA 2IC3B 4Y6IA 3MM7B 1J5OA 4ZPWR 3VWSA 1NK6A 2FHJA 1NZ8A 1DRZA 4FKYA 5BXIA 5J2QA 4ZLJA 4F36A 5EWEA 1GXLA 3AA8A 2DIVA 3M2UA 1S12A 1NRKA 5H1SV 5I42B 3VGVA 1MN9A 1RYRA 4NCAA 3NGUA 2ZC3A 2J9EA 2IBOA 2M88A 5D4OA 1IKYB 4OI3A 4ZS6A 3C15A 2BA9A 1KC8T 4K4VA 1H7WA 1UEUA 3ZXWA 2XMWA 3KLIA 2LDYA 4WFZA 2HWTA 4YS2A 2XWYA 3MPYA 4CQ1A 4IFYB 3ETOA 4F04B 1DTQA 3LAMA 1LXJA 4OHWA 4YHHF 1GX5A 2ZH7A 3KK1A 2KVQE 2MKHA 3UO0A 2MZRA 5KFJA 4DHVA 3OPKA 3KG4A 1VC0A 3MPDA 2MQOA 4ID5B 4L74A 4NLVA 4ES3A 3HHKA 4WPAA 2V9WA 3L7PA 5DDPC 3E2EA 3KTQA 3LP0A 1VRUB 1OIAA 4PYDA 2X3DA 2IY5B 4C8NA 1U0SA 2F4VJ 1N6QB 4TU7A 1RTJA 2COLA 2NSCA 1D3WA 1TL4A 4LRFA 2VPXB 4M5IA 3QIPA 2B7CB 1TR0A 3BQ1A 3PY8A 2XLJA 3H8YA 2XULA 4OZJA 2X1AA 1WC4A 1FESA 4DSEA 5A8RB 1RAEB 2R2RA 3DLEA 1PSDA 1BQNA 1G4CA 2EEYA 1NK4A 3CVKA 1SC3B 1S6QB 2L3MA 2PEBA 2WCXA 4ZVOB 3H40A 3OR1A 3RBXA 3ELHA 3MTJA 4QIVA 4OHXA 2CDRB 3OVAA 3POTB 2V6AA 2PE8A 5FLXU 4J9PA 4C8KA 3DKDA 2Z58B 5KOXA 3KMSA 1R3NA 1T02A 1RHUB 5BYSA 5LXRA 1S9EA 1EX8A 2YKNA 1OJ4A 3ET6A 1QTMA 4OI1A 3QRPA 1U24A 2KB2A 1C0UB 1RT7B 2VG6A 3SIPB 1RWOB 2OKQA 5GMKa 2JC1A 8ATCB 1N36F 3H4DA 3HI9A 3TANA 4EO6A 3NLCA 1KLMB 2RILA 3H2VE 4K8RA 4N47A 6FD1A 2YNGB 5IOLA 3JAMU 1N32J 2O1PA 2LQBA 3DM2B 2E5LF 2IRYA 5EDWA 1KVKA 3DGPB 3ILIA 5AXLA 2BYCA 2ZH6A 1GFWB 4Q43A 1B99A 4DOZA 1YJWS 4Y28C 2LYVA 5L38A 2L9DA 3N0VA 2FZCB 1QSYA 2H5EA 2UV8A 4DR2J 4TVAB 2MQMA 4DV6F 4V19X 1TL1A 2ASYA 4LBHA 2HAFA 2X1GA 3D9BA 3S1TA 3TRGA 3HX9A 4OZ3A 3UWTA 1Z2LA 4O0IA 2XC9A 3G8QA 4DF8A 4DS5A 1NJZA 2R7VA 1UP1A 3VGTA 2ZHAA 1W2IA 4IKAA 1HHQA
chains in the Genus database with same CATH topology
4K2XA 3MM6B 4TQRA 1HNWF 4B17A 5A0YA 1C2PA 4AL6A 5E41A 3CCTA 3KJVB 5LJ3Y 4FF4A 2B4VA 2DCLA 4P7VA 3UPFA 2ROEA 2NYIA 4BWJA 2XO7A 4OX8A 2D3ZA 3PR4A 4RW9B 5E5NA 2EFGA 1ZETA 4PQUA 1DBDA 2JRSA 4X66F 2R7TA 5CYQA 4ECTA 2VFVA 4NCGB 3OFEA 4F3QA 3EGZA 3CJ4A 3HF5A 2BABA 3ITHA 1CEZA 3K2YA 1WHYA 3TI0A 1FDBA 1BQNB 2DNZA 2GGPA 3VCDA 1JJ2R 2QE5A 2ZDOA 4NZ7A 2E9RX 2R7UA 5T7LA 4F4YA 4D3GA 2OPPA 1XTZA 3MGJA 2ATLA 3ZZRA 2OPQA 3SV4A 4WKRA 4DSJA 1X4EA 1P1LA 2LVWA 5KFZA 2Q6BA 3BGUA 4ETXA 1R0AA 1F2GA 2O01C 4KHMA 2RJZA 5G0RB 3IRWP 3DLBA 4X4UA 1S6PB 3PDNA 3MMBB 2DNLA 3MEGA 4LF6F 1TK0A 1DTQB 1TUVA 3N5BA 4C8YA 3H20A 5ADZA 3DLLQ 3HO1A 3J7YU 3ZZYA 2CDQA 4DSLA 1HFEL 3D0IE 3CDEA 3V5RA 5B7WA 1TFYA 1H0HB 1OQ6A 2KHDA 1X4DA 3OV7A 5JVHQ 4JV5F 2CQ3A 3O6QA 2R7SA 1FRMA 3AB2B 3BGRB 1T03A 2E1RA 4URSA 2UXBF 5LSOA 4ICLA 3D54A 5KFWA 4ALZA 2W9CB 3BREA 2M7SA 3H5SA 4TLQA 3MTKA 4HEA9 4DQQA 4KSEB 4U7UK 2QSFA 1N34F 2Y1JA 2W9CA 2IM0A 3BSNA 3CC2S 1PC4A 2FDNA 4Q8EA 2V4QA 5B0EA 2C2RA 1QUVA 4LIRA 3DGPA 3JYTB 1Q8BA 3THPA 4ED0A 4PRFA 1LWCB 3DN9A 3MECB 2XEXA 2ADCA 1SH2A 1XMQF 1FNXH 3MOJB 2O5DA 1TL3B 5C42B 4B9NA 2ZBIA 3FJ2A 4ZP6A 3K8WA 1HBMB 4ED1A 4DG1A 2J8AA 1KSPA 4A8QA 4CO3A 1HPZA 2FLOA 3AA9A 3DOMA 3MCSA 4NOHA 5L39A 4CZCA 2ZHBA 3VALA 4ECSA 4QU6A 1RT6B 1LWEA 1X4BA 3WC2A 1DFDA 2HS0A 4EBEA 5KFEA 2RD5C 3OR2B 4ES1A 4AXIA 1FD8A 4MKBA 3IG1B 1U1PA 3MOZA 1R6YA 2VBWA 4ECYA 2PI5A 4KBIA 5HL7Q 4ZKAA 4AQYF 3DLEB 2PO4A 3MXHP 3QWUA 3NS6A 2CG4A 3CC7S 1GAOA 3JSMB 3MM9A 4ECXA 4B3SF 2J9DE 2YNHA 4PG6A 4ED7A 2E66A 1S0OA 1TKDA 4CTAB 4BHQA 1ZAXA 2AJ4A 3DRPB 5GAGI 1VRUA 2C22A 3CIMA 2QLXA 2B4PA 2V5HG 2XZWA 2X3GA 3KHHA 5DDRC 1RGVA 3AB4B 2YNIA 2DNQA 2F9DA 2XS2A 1KD1T 5F9LA 5CZXA 1RWUA 4ZVEA 2KTQA 2AJ0A 3CMES 2B3TB 4KV8B 3G6YA 3TARA 1VBZA 4B3TF 4ZVFA 2WBRA 3LQVA 2EK6A 2E5HA 1FK9B 2K1RA 3RR7A 4O4GA 2LDIA 1VC6A 1JLCB 4YB5A 4W92B 3T1HF