1JLCB

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with pett-2
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
427
structure length
402
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 RT A-chain
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 110
structure length 402
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlcB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcB04
5JXSA 4K4YA 2JC1A 1HQEA 2IAJB 5CYMA 3H5SA 5KFHA 5CYMB 1RT6B 3KLGB 3KHGA 2IMWP 2JEIA 1D0EA 3IRXA 4TY8A 4H54A 3HVTA 4TY8B 5DLGA 4ZP6A 4R5PB 3HKWA 1S0OA 4FS2A 3RB3A 4ZP9A 1IKYB 1JLAB 5KFEA 4F4XA 4EO8A 3PHEA 3MTKA 3KLEB 4KO0B 3QLHA 3BREA 5JUMA 1RT7A 4IDKA 3H59A 2HMIB 4ZMMA 4IDKB 1C1BA 5J1EB 2YNIA 3EZUA 5T14A 2XCPA 2YNIB 3N6NA 4PWDA 4ED2A 4PWDB 1CSJA 1T94A 3OLAA 4NLPA 1LWCB 1TKXA 2HWHA 1OS5A 1TKXB 4RW6A 4IRCA 1RT4A 3OL6A 1RT4B 3IGNA 2WONB 4WYWA 5KG6A 1JLEB 3FQLA 3T5KA 3NAHA 1RYRA 1GX5A 3GYNA 3KLVA 2R8IA 4EYIB 1RT3A 3M8QA 4TQRA 3FFIA 2W7PA 2HNZA 2D3ZA 2ASLA 3FFIB 5EWFA 2HNZB 4O44B 5HLFA 4MK9A 3M9NB 5HLFB 1QE1A 1S1UB 3MEDA 4KV8A 3MEDB 1C0UB 4KV8B 1TV6A 5I3UA 4YR0A 4RW4A 5I3UB 1TV6B 4YP3A 2UVVA 3TQ1A 3RB4A 3LP2B 3PW2A 1ZTTA 2ASDA 4EYHB 1SH2A 3PW7A 3T5LA 3DOKA 3DRPA 5HROA 3CWJA 1RTHA 3DOKB 3JSMB 1T05A 3DYAA 1RTHB 1T05B 4EO6A 3DYAB 2QE5A 3Q8RB 5KFXA 5DLFA 5DQHA 2WRMA 2F8EX 4G1QA 2J6SA 1SV5A 2IA6A 1SV5B 5KFMA 1FKPA 3TAMA 1FKPB 4H4OB 3TAMB 4O3RA 4IH5A 2AU0A 1RA7A 1LW0A 1MU2B 4DL6A 2V0NA 5CYQA 1IKVA 2RDJA 1C0TB 3T5HA 5CYQB 1IKVB 4LQ3A 3NL0A 5KFRA 3CVKA 1N48A 3DLGB 1D1UA 4MK8A 4ID5A 5KT4A 5F8NA 3KLFA 4ZVFA 4K4TA 1LWEA 4TN2A 4QWBA 4O3QA 3T5JA 5KFFA 1IKXA 1HYSA 3I5BA 4QWAA 4G3IA 1S1WA 5KT7A 1DTTB 3E01A 2UVRA 1S1WB 3KJVB 3N6LA 1HQUA 3DI6A 4YMEA 2YKNA 2XGPA 3KMSA 4RW9A 2QV6A 2YKNB 2D3UA 1JLBB 3QO9B 4IKAA 1S1VA 3CJ0A 1S1VB 5KG7A 4OL8A 5L1KA 3I0SA 3RAQA 1IKWA 3I0RB 3I0SB 1XR6A 3MEGB 2WTFA 1XR5A 2IC3A 2IC3B 3LAMA 2XGQA 4ZVEA 1S0NA 4F4YA 1BQMA 4B3OA 2RF2A 5KFAA 4B3OB 5J2MB 3MEEA 1HMVA 2RF2B 1HMVB 3KLIA 3MEEB 5KFVA 4ZP7A 4PQUB 1HNVB 3KLIB 2BRKA 3BR9A 3ICLA 5KFIA 4PUOB 3GV8B 3BSOA 5KFWA 5DG8A 3Q8QB 3KK3B 2FVPA 5KFGA 2E9ZA 3ITHA 4J9LA 3OL8A 3EPGA 2YNHB 4NLTA 4ZVGA 1SH3A 4O4GA 3ISNC 4IG0A 3PR5B 2VG5A 2W9AA 4IG0B 4M95A 1C1CA 4ICLA 4ZPCA 4QWEA 2ZE2A 1C1CB 3GIMA 3KHHA 2UVUA 4Q8FA 5L1IA 4JV1A 4ZPAA 4ECYA 2FVQA 2HAIA 1S6QB 2I5JA 2AX1A 4NLDA 2I5JB 4JUZA 3IGVA 4QW9A 4IFYA 4DL5A 4IFYB 4IH6A 1TKZA 3MFIA 1TKZB 3DRSA 5C25A 4QWCA 2R8JA 1RTIA 1K1QA 3MFHA 1RTIB 5KT5A 3H40A 5KFUA 4QWDA 3BJYA 3QIDA 2C2RA 2IBKA 1S9GA 2GIQA 4WZQA 2BRLA 2GC8A 3Q8PB 3NBPA 2FJVA 2W9BA 4HKQA 3SI8A 2W9BB 3G6YA 4X2BA 2IAJA 4J9MA 2XI3A 1RT6A 1JLGB 2OPPB 3KLGA 2OH2A 4J9OA 2RDIA 3FQKA 3OSNA 3LAKA 3RB0A 1LWFA 2O5DA 3RBEA 1LWFB 4NLYA 5KFDA 4R5PA 4J9KA 5L1LA 1J5OB 5J2NA 4XO0A 5L1JA 3RAXA 5J2NB 4MKBA 1IKYA 1JLAA 3M8PA 4RW7A 1NHUA 4IH7A 5KFTA 3M8PB 4RW7B 5I42A 4ECXA 1S0MA 2FLLA 3DRRA 5I42B 3KLEA 3BSAA 3DRRB 4KO0A 3V6HA 3GILA 3N6MA 4J9SA 3PJXA 2WCXA 4NLVA 4NLSA 5F8GA 2ATLA 2E9RX 2HMIA 3QGIA 1RT1B 5J1EA 4I2PB 3JYTA 3JYTB 3NGDA 1SH0A 4URGA 4F4WA 4NZ0A 4TXSA 3BSNA 4J9RA 4ED6A 2UVWA 3KK2A 1LWCA 1KHVA 3KK2B 3KMQA 2EC0A 2YNGB 4GC7A 4IG3B 3H98A 2WONA 3QGHA 1S9EB 4MK7A 1N6QA 1JLEA 3D5MA 1N6QB 4EBCA 4ECRA 1MMLA 5J2PA 5J2PB 4U6PA 4KHMA 3PZPA 4ZVHA 4M94A 5F9LA 3H5YA 5F8MA 3ISND 4IFVA 4O44A 4Q44A 3PW0A 4NCGA 4IFVB 2R8GA 1S1UA 4NCGB 4FBUA 1R0AB 1C0UA 5KFJA 2BQUA 1TL3B 3CJ4A 4FS1A 2FJWA 4R0EA 1TQLA 3LP2A 5F8IA 3GQCA 2XCAA 1HARA 3NMAA 1JLFA 4TQSA 1JLFB 3JSMA 4R8UA 1ZETA 4R8UB 2FVCA 3OL7A 4K4WA 4I2QA 3KLHA 5KT3A 4I2QB 3KLHB 3MR5A 4RNNA 5KFNA 4H4OA 3M9OB 4ED0A 4J9QA 1MU2A 5KFZA 3MF5A 4EBEA 1C0TA 1S6PB 4LSLB 3OHAA 1S97A 4NYZA 3DLGA 1HPZB 4RNFA 5KFBA 2OPQB 4IR1A 5D3GB 4NLWA 5F8JA 4KB7A 1RA6A 2HNDB 4WXWA 4IOBA 2JEFA 4F50A 2IM1A 1XR7A 4DL3A 1T03A 4KBIA 1S48A 2IJFA 2BQ3A 1T03B 5KFOA 2W8LA 1DTTA 2GIRA 3CJ2A 4WE1A 2V4RA 3KJVA 4WE1B 1FKOA 4ED7A 4J9NA 1FKOB 5DQGA 2VG7B 3PW4A 3IG1B 1JLBA 5C24A 3QO9A 3PR4A 1TVRB 5C24B 2CJQA 1KHWA 3DOLA 1BQNB 3DOLB 4WZMA 4KKOB 3V6DA 2C2EA 3V6DB 3MECA 3MECB 3OL9A 3I0RA 2VA2A 4U7CA 1ZTWA 3MEGA 3CJ5A 4ZPDA 1S1TA 4GC6A 3V81A 1W25A 1S1TB 3G86A 1N4LA 3V81B 2XWYA 5KG5A 1QAIA 3PW5A 4K4VA 1WNEA 4J9PA 3QZ8A 5J2MA 1S49A 1EP4A 2W9CA 1EP4B 4PQUA 1HNVA 3D28A 3C6TB 2W9CB 2ALZA 3DMJA 4PUOA 3DMJB 1HNIB 1RTJA 3OHBA 3BSCA 3KK3A 4TYAA 1RTJB 4JV0A 4QPXA 3CO9A 5F9NA 3Q8SB 4F4ZA 4RNMA 1JKHB 1T3NA 5KG1A 2YNHA 3UDLA 1JLCA 2D7SA 3FDSA 1S10A 1JLCB 2JEGA 1FK9B 2RKIA 3VQSA 2FVRA 1JIHA 2HWIA 2OPRB 2RKIB 3V4IA 4K50A 3V4IB 3QYYA 4ECWA 4IQXA 1S6QA 2XI2A 4ZHRA 3QZ7A 4ZHRB 5DGBA 3KNAA 1DLOA 3IN5A 1DLOB 2BANA 4KSEB 4ECZA 2BANB 1IM4A 4DG1A 4DG1B 4I7FA 5KFCA 1N5YA 5F8LA 4I7FB 4TLRA 1N5YB 5KG4A 4ED1A 2V9WA 4KE5A 3MR2A 3H2LA 3HVAA 3DM2A 4KFBA 3DM2B 4KFBB 2AQ4A 5DGAA 1TKTA 3FRZA 1JLGA 2OPPA 1TKTB 3LALA 4Y34A 2R2TA 2I1RA 2BE2A 4MIAA 3G6VA 2FLPA 3C6UA 2BE2B 4O3NA 3C6UB 2R8HA 1J5OA 4WFYA 4QW8A 4NLUA 4NRUA 4ECUA 1C2PA 2AX0A 2BQRA 2VG6B 1K1SA 5KG3A 4ECVA 3LP0B 3T19A 5EWEA 1DTQB 5EDWA 2B5JB 4Q8EA 2WOMB 2HNYB 4WFZA 1I6JA 4URQU 3KHLA 3RB6A 2YKMA 4NLGA 1RT1A 2YKMB 4RUAA 2B43A 4I2PA 2UUWA 4XPCA 4IRKA 5C5JA 2ILZA 3MR6A 1HQEB 4RUCA 3H5XA 2VA3A 3GIJA 2YNGA 1S9GB 4IG3A 3IRXB 3HVTB 1S9EA 1JX4A 4K4SA 4MH8A 1VRUA 3DLKA 4NLOA 1LW2A 4Y2AA 1VRUB 3DLKB 2IM3A 1LW2B 1NHVA 2UUTA 2W8KA 3GV5B 4ECSA 3PVXA 2WB4A 1JXLA 4Y2CA 5HP1A 4MKAA 5HP1B 4NLQA 1UWBA 1RAJA 1R0AA 4ED3A 1UWBB 3H4DA 1TL3A 3QLHB 5EWGA 1RT7B 3GIIA 1C1BB 3NAIA 4ZPBA 4KAIA 5L9XA 3KOAA 1YVFA 4TYBA 1S1XA 5KT2A 4RZRA 1S1XB 3KK1A 4RNOA 4RW6B 3KK1B 4Q45A 4K4UA 2IM2A 4YR3A 2ILYA 3IS9A 3BQ0A 4O4RA 4ECQA 3IS9B 5KG0A 2R2SA 4O3SA 3CDUA 2WHOA 1RT3B 3M8QB 4DEZA 1S6PA 5FDLA 4LSLA 1EETA 2FVSA 1QE1B 5FDLB 1TL1A 1EETB 1QUVA 3UPFA 2ASJA 1HPZA 1TL1B 2OPQA 4RW4B 5D3GA 3E51A 2BR0A 3G6XA 2OPSA 4EBDA 3NKYA 2OPSB 5KFLA 2HNDA 3PJWA 2V4QA 1JLQA 3RBDA 1JLQB 4O3PA 3BQ2A 4H4MA 3DRPB 5HROB 4TY9A 4H4MB 4DL2A 1QAJA 2ZKUA 3I5AA 3QGGA 4YQWA 3GIKA 4DL7A 3BGRA 3M9MB 3BGRB 3QIPA 4G1QB 2VG7A 4IRDA 3IG1A 3QIPB 1TVRA 3DLEA 3HVWA 5KT6A 4RNHA 3DLEB 1BQNA 3LANA 2IJNA 2WK4A 3GV7B 1RYSA 4KKOA 2JC0A 1LW0B 2ZD1A 2IM0A 2C2DA 4Q43A 2ZD1B 2AGQA 1NNDA 5HBMA 4WYLA 5KFSA 5HBMB 4WFXA 4O3OA 2C28A 4EEYA 4ID5B 4LQ9A 5DQIA 5KFQA 2W7OA 4FBTA 3KLFB 2J6UA 1LWEB 4Q0BA 3SFUA 3CDWA 4Q0BB 1IKXB 1HYSB 3I5CA 2J6TA 2XC9A 3CJ3A 2JEJA 4IR9A 2YNFA 3C6TA 4YR2A 3E01B 2YNFB 1HNIA 3UQSA 1HQUB 3DI6B 4LSNA 4RW9B 5EUHA 4LSNB 1JKHA 1RTDA 5C42A 1S9FA 3DDKA 1RTDB 4NLXA 5C42B 3V6JA 2E9TA 3KHRA 4RW8A 2JLEA 4RW8B 1FK9A 4MIBA 2R2RA 2OPRA 3MR3A 1KLMA 5DG9A 1IKWB 1KLMB 3TVKA 2FLNA 4JV2A 1Z4UA 4NLRA 2R8KA 3EPIA 1BQMB 4KHRA 4XPEA 4RU9A 3BQ1A 4HYKA 3LP1A 5KFYA 3LP1B 2AGPA 1VRTA 1VRTB 2C22A 1N56A 1RT2A 1RT2B 3ITHB 5KG2A 4K4ZA 3HHKA 4URSA 5F8HA 4DL4A 1RT5A 4O4GB 1RT5B 2VG5B 1S4FA 2AWZA 4ECTA 5KFKA 3SFGA 4ICLB 2ZE2B 4ZP8A 3H4BA 2D41A 3H5UA 2DPIA 2DPJA 3FSIA 3CIZA 2VG6A 4MFBA 2FJXA 1TP7A 2CKWA 4MFBB 5KFPA 3OSPA 1RDRA 3LP0A 5J2QA 4Y3CA 5DG7A 1DTQA 5K14A 2B5JA 5J2QB 3UR0A 5K14B 3OLBA 2WOMA 1GX6A 3CDEA 4K4XA 2HNYA 3DRSB 5C25B 4NRTA 2B6AA 1U09A 3T1AA 4ED8A 2B6AB 1SUQA 2R2UA 3V6KA 1REVA 2AGOA 1SUQB 1REVB 4WXOA 3NBPB
chains in the Genus database with same CATH superfamily
4B9LA 3KHGA 4AE5A 1IWAA 5T41A 1CJTA 4FZVA 3HKWA 1VJQA 4EO8A 5B09A 3W66A 2XZTB 3SYZA 4WKYA 1JJCB 1T9WA 4PWDA 2ZBQA 5IT9U 1U8WA 4NX9A 4NMXA 1JLEB 1Q95G 4JV5F 1QSSA 4ED5A 1U24A 1TV6B 2Q79A 3LW5C 4EYHB 2E7VA 2J9DE 4LF8J 3DRPA 2HVIA 3DYAB 3UCGA 1B64A 1YLXA 4MYTA 2F8EX 3BO4A 1U1LA 1J27A 4DSEA 2NZ4A 1PSDA 2L3MA 3IR6B 1RISA 3T5JA 2CNOB 1EB0A 3SBMA 1S1WB 3OR1A 3HSGA 1RAAB 2LKZA 2IMOA 1S0NA 5IC4B 2DITA 2VJUA 2I38A 1HNVB 3QT7A 2VFRA 4F4AA 4J9LA 4B3TF 2GQ2A 1WEYA 1QM9A 2VHGA 3H0PA 2QA1A 4IFYB 2Q6BA 4QWDA 2AYMA 2HG4A 2GC8A 4KJIA 2OPPB 4DR7J 2PFFB 1J5OB 1JLAA 1S0MA 4USUA 3QRQA 3ENAA 1FRHA 3MAQA 3JB9k 2ATLA 3QT8A 2HMIA 1NZAA 3L09A 3G8TA 3NGDA 2Y8WA 2EG2A 2E44A 2G0JA 1XMOF 3H98A 1N6QA 1Q4RA 3Q89A 4O44A 4DX8H 4F0MA 4Q44A 2M8DB 1R0AB 2BQUA 4FS1A 2I9SA 1N0VC 4AL6A 3NGSA 2OIHA 5F41A 3ENVA 4P74A 2MGZB 4R8UB 3TUZC 2R7UA 3MR5A 4RU2A 3T9ZA 4HHJA 2ROGA 2AIRB 1FWKA 1CS4B 2Y1JA 5IQ6A 2IM1A 4KBIA 2IJFA 2V4RA 2XMUA 1S79A 3TVZA 4HHHA 3PR4A 1BQNB 2WAQD 2F9JA 3TZZA 1H73A 3MECB 3OL9A 3HFKA 2H3EB 4ES2A 2W9CA 3C6TB 5HJXA 5KG1A 3FDSA 1JLCB 4B17A 3MM7B 3I32A 3VAIA 4ECWA 1X4CA 2G2OA 2J0WA 2BANB 3ZZPA 4DG1A 2P6SA 2MZRA 3BBCA 2D1CA 2VBXA 2HRYA 2DVIA 3SSSA 2BQRA 4CLZA 3LP0B 2QFIA 3JAMU 3CCMS 2ZJRQ 1VYAA 4LF6F 4X4VA 1H2UX 1AXQA 1BE4A 1Q81T 4N56A 4V19X 1FX2A 1N5VA 1RAJA 2QL7B 4WU2A 1HWKA 2B9EA 3GIIA 4GKKJ 3T9NA 5T7LB 2YXLA 1SPBP 3G82A 2V8GA 2XNRA 1ZAXA 4M5GA 1I51B 4K5SA 1XJWB 3DRXA 2ADBA 3SSQA 1QE1B 1DZ5A 1FNOA 4P72A 2OPSB 1TR0A 1VQ4S 1QAJA 3EUNA 4BHQA 1HR0F 1HD0A 3BGRB 4K0KJ 3I82A 4N5SA 4USHA 4O23A 3BM7A 5ETPA 2BA9A 3UN2A 2RU3A 1YJTA 3CD7A 4Y00A 4ANCA 4DI6A 3PO5A 3UQSA 4NLXA 5IC6B 2D9PA 2FLNA 3BO2A 1PYTA 2QLBB 1NJIT 5KFYA 2Z2LA 1XNRF 3G96A 3JQJA 1WHXA 2Y0SD 2AEMA 1F9HA 1FDAA 1S6OA 3M8ZA 3HHKA 1IN0A 3UI3A 4I6WA 1SKRA 2QSWA 4ECTA 3GG0A 1N88A 2DPIA 3FSIA 2HVHA 3OSPA 1SIZA 1DTQA 3DRYA 2B6AA 3RBZA 2YPZA 2IPOB 1RT6B 1JMTA 4CLUA 3B4DA 4IDKA 3MD1A 1G2EA 1TKXA 1HBNB 3LWMA 2MZ1A 4IRCA 1U1PA 1IXKA 4IYQA 2HYIB 2Z8QA 2DYAA 2E5HA 3ZZYA 3D54A 5HLFB 4KV8B 1C0UB 2UVVA 4I69A 2ASDA 2D9OA 3EZOA 1GTEA 1K8AT 5DQHA 2L08A 2AU0A 1IKVA 3NL0A 5KFRA 4MK8A 4P6QA 3I5BA 4Z7CA 4KC5A 1HQUA 1TU0B 3O44A 4RW9A 1YJWS 1HI1A 2DKOB 2NSBA 3HT0A 2PGCA 2UXDJ 4QR2A 3W2WB 3OFHA 5DO2A 2HHHF 3A1YG 2UXCF 3RZAA 4HHUA 2E9ZA 2NR0A 1IBKF 2MSSA 3MM9B 2GAHC 2HIYA 5L1IA 4ECYA 3BDEA 3ZTPA 4IH6A 1RTIA 1R7IA 3Q8PB 3BYRA 3HZEA 5BYSA 2CAJA 1KOHA 3ZZOA 2RDIA 2MEWA 3LAKA 1VMBA 1LWFB 4NLYA 1JJHA 4XO0A 1F0XA 5K5MA 4NLSA 4USIA 2QEXS 3CJQA 4OIXA 3KK2A 3KMQA 3N5BA 2IYGA 3KTQA 2ZKTA 4WJBA 4KHMA 4DV1F 1QAYA 2LQBA 2JDJA 4ZIWA 1TL3B 2DXEA 4HH1A 1CULA 3HT3A 4DLGA 3D3CJ 3OL7A 2XLIA 3KNGA 4I2QA 3CCTA 3DFEA 1EARA 5LSRA 3D2WA 3GIRA 4ZVQB 1TELA 2H1YA 4UF4A 2QRRA 3LWLA 4ED7A 4U8YA 5CCLA 1TVRB 5C24B 2MKCA 4YB1P 2EKYA 5F0WA 1B0TA 3CJRA 4GC6A 4N77A 2LU2A 4P9SA 2OFGX 5J2MA 1S49A 3ENWA 2UV8G 1DFDA 5DS7A 3I9V9 1FFWB 2MZSA 2YNHA 3AD7C 1NH7A 2E1MC 4DV7F 4K50A 2CPYA 4WTYA 2V2QA 3FVYA 3OUYB 3ZZRA 2YQ1A 1UZHA 1PYOB 2VKRA 5EN1A 3PX6A 1FE4A 1QTMA 4I7FA 2HFVA 1EX8A 4KFBB 2QLFB 5IWAJ 2R2TA 1FESA 4QIVA 4CLSA 4CLYA 4OFZA 4MAKA 2LDYA 1GXLA 4OI6A 4DN9A 1M1KT 2DB1A 1CJVB 3GSIA 3CIMA 2UUWA 4JI8F 5LSOA 4X66F 3K5NA 1JWWA 5D0RA 2MY7A 2FZCB 4X84A 2QX0A 4ZVOB 1EQMA 4QU7A 4DHVA 5LM7E 4L75A 4C0HA 6FDRA 1Z2LA 2HGNA 3P45B 2DNHA 1L5UA 2HLTA 2R4FA 4LFBF 2IM2A 2ILYA 2L48A 4ECQA 1IJFB 5CD4H 3IBWA 2WHOA 2ZUAA 4ANEA 1XC9A 2V94A 1HBOA 4CNZA 3UN3A 1CJUB 2FD2A 3W61A 3PJWA 1UP1A 4H4MB 1P8GA 2ZBRA 1KFDA 2QLJB 3EGVA 2NXJA 3QIPB 3DLEA 3BBFA 3GG1A 2IRYA 2QZ8A 2BW7A 4DPUA 1LW0B 1D9AA 5I3QA 2A6OA 1EIYB 6AT1B 4B9UA 3HZGA 2YKOA 2ADCA 1ZZNA 2J6UA 1FXLA 3SFUA 1IKXB 1U1NA 3CJ3A 3UR3C 2OD6A 3JTOA 1F1BB 3D7SB 4DUYF 3GB0A 2BVZA 1CG2A 1NSAA 1KLMA 4Y28C 1YJ9S 2O67A 3LP1A 1IBMF 3TJ8A 3LGNA 1U6ZA 1AFJA 5F8HA 2DGVA 2W7AA 2OEMA 2ZE2B 2J7WA 4H4KA 3RBXA 5U47A 1U4BA 2FJXA 1TP7A 2CKWA 2QT7A 3RJMB 2ZZTA 4I67A 1PAEX 4WKRA 1AFIA 1RHJB 1SUQA 4F3MA 5KFHA 1WC4A 1YBAA 3IRXA 1CJTB 1FDDA 1FNXH 2DHXA 1Q1KA 1M90T 3JSYA 3MTKA 3BV8A 3R97A 2C2OB 4DV3J 5T14A 1X9SA 1SXLA 2HQ3A 4PWDB 1CSJA 1G6BA 3AXMA 2A0FB 1X9WA 2V4JB 1ZAVA 1RT4A 3G71S 1KN6A 2FUG9 2NPFA 3PV8A 2GCFA 2R3VA 3M4XA 1LFPA 2MJNA 5KOXA 2VC1A 3TAQA 3A3OB 2W2PP 1WC5A 2QE5A 2FJEB 4DUZJ 5E3CA 2XSFA 1U1MA 3OT9A 4BWMA 3SEOA 2CQ1A 4YB5A 4LRFA 1I94F 4DN0A 4CT9A 4YMEA 3OR1B 2O1PA 2D3UA 1JLBB 2CPHA 2FHJD 4OL8A 2WSFC 2DRBA 2H5JB 4DR6J 3I0SA 3CCES 3MEGB 5HAOA 1YITS 5CAAA 4BS2A 3SIPB 1ELOA 3WIVA 4Q8FA 4PQUB 2ROEA 2I6WA 3W60A 4NE9C 2KRRA 3P5TL 1IM6A 3T1YJ 1GEHA 2PI5A 5THWA 3GIMA 3KHHA 4PKDB 3IGVA 2WW8A 1RABB 3SI8A 1TUWA 2MB0B 2FC9A 2G9OA 5IS2A 5AXNA 4USWA 1Z1ZA 3EMTA 1ACMB 1LEOA 3MAAA 3K0JA 4QR0A 3D0GE 1T7PA 3PKYA 2QIFA 1LWCA 3OXGA 4F0KA 1QDUB 4NMLA 1N6QB 2X3DA 4ETXA 3NGTA 1O5JA 3OVSA 3H5YA 2UV8A 5GVQA 5AT1B 3CJ4A 2PSZA 4UY8T 4R0EA 4X4QA 3MAHA 4DR3J 3A8JA 2P5VA 2BJDA 4OZ3A 2KO1A 3QFWA 4H4OA 4Z2XA 4ZPVR 4USTA 4MTPA 5IM0A 1DHMA 1B7YB 1YG0A 4IR1A 1H72C 5IFMA 3D68A 4CTAA 2F5GA 5KFOA 3CD5A 1OQ3A 1H7XA 2R7VA 3V6DA 1PCAA 4LRDA 3UN5A 3CJ5A 2RMLA 2J0QD 1RWNB 4K4VA 2OSQA 4PR6A 2W9CB 1DQ8A 1TTHB 1RTJA 4TYAA 5D6GA 3HD1A 3Q8SB 4MJKA 1HBMB 1QY7A 1B7FA 2K3IA 2JZ5A 1NAQA 1FNMA 2IY5B 5HVGA 1WSVA 3TUIC 4JI4F 4C4WA 2COLA 3P49B 2HBZB 2C2NA 2FJBB 2CYYA 3KNAA 3U1MA 4DG1B 2A3JA 4P71A 4LF5J 4BDPA 3W9IA 5GADU 1TKTA 4Y34A 2W2QP 3C6UA 4WFYA 2AT1B 2VG6B 3AB4B 4F25A 3WC2A 3MUVP 1RHMB 4P7VA 1TL5A 3M2UA 3EVWA 4MH8A 4NLOA 5DGAA 4LMZA 5G4DA 1UWBA 1UA1A 3RRHA 3M2RA 3P6YC 1VLOA 4LF2A 1RBOB 3TUPA 4DV6F 1IWGA 1HWUA 3DGPA 3G82B 4YR3A 3IS9A 4O4RA 4YB6A 3UFCX 1AROP 3R1LA 3GR0A 3MPWA 1D8ZA 1FO1A 1R43A 1HPZA 4TKTA 5D3GA 1FRKA 1Y4ZB 1KOOA 2AHOB 3RRGA 5HROB 4TY9A 4ZA1A 1KBRA 2HVZA 1F60B 2IM0A 2AGQA 1U49A 2H54B 4ATNA 3BEGB 5K8PA 2JEJA 3TEHB 1VOMA 4DLEA 5EUHA 1APSA 1U1RA 2JWNA 3V6JA 1XQIA 1RKIA 2MZJA 4JV2A 2XO7A 4JI1J 1WEXA 1LK7A 4ZPTR 3SMZA 3IMQJ 4HYKA 4JI5F 2C22A 1N56A 1RT2A 1A7GE 1N33J 3JTPA 1RQ0A 2V5HG 1NSQA 5ETTA 5LXYA 3DLBA 3TVYA 4MFBA 4OX9F 4B9TA 1TL7A 2PA8D 2B6AB 1RAGB 2N7YA 4DV4F 1QTNB 1EKRA 1NJYA 4Q2LA 5LMUJ 4ID8A 1P6TA 3S1TA 4IO1A 2VFUA 3PHEA 2UP1A 3QLHA 4PAAA 4L6V3 4IDKB 1TKXB 4RW6A 3GYNA 2W7PA 3CT9A 1S1UB 2ATCB 2K1RA 4NA3A 4YR0A 2DEJA 3PW2A 4P2MA 2CQHA 3PW7A 3ZTQA 2VC0A 3JSMB 4EO6A 3PNIA 1UA0A 1SV5A 4IH5A 5CYQA 1IKVB 3D6TB 2VV5A 3Q83A 3CVKA 1F9EB 2X51A 4HH0A 3A3PB 1RGVA 4YDDB 5SUHA 2X1BA 1WDTA 3N6LA 3DI6A 2GFFA 2EK1A 1S1VA 3IP0A 4CIOA 5DDQC 2V8HA 4ZVEA 4DU7A 4XAKA 2AD9A 1U8SA 4C8LA 2V8PA 3ITHA 3G8SA 1YGYA 5BXIA 4EZ9A 1WI8A 2CG8A 2AX1A 2DK2A 4UY85 4DL5A 1K1QA 1RTIB 1W2BR 3QIDA 2HBRB 4C11A 5GAHU 2CQCA 4CCHA 3FGVA 5M2PA 2MLXA 4ZJQA 4DV0J 4PZVA 2LXFA 2DJWA 3K8WA 3D9BA 3VALA 4ECXA 3KLEA 3PG9A 4NLVA 4DU8A 2ERRA 5RUBA 2RSQA 3KK2B 4X64F 1ITPA 4KGMA 2WONA 3JSBA 1NK9A 2WBRA 3VWSA 3PM9A 2XCAA 2MY8A 3M8SA 4DV5F 1U45A 4ENOA 3IBFB 4X62F 1YBTA 4I2QB 1IQTA 3EE3A 2VUGA 4I68A 4MKVA 3MF5A 4FXVA 4EBEA 2ZWOA 2MKKA 3QWUA 2N82B 4DSJA 2VFVA 1M0SA 4WE1A 2B9YA 3D66A 2AZ1A 5ETLA 2N7CA 3DOMB 4DR5J 5ETKA 4U7CA 1TK5A 3V81A 5FIIA 4DV2J 1FA0A 3TYTA 3QPIA 2FYXA 3GYGA 4P73A 4F4ZA 3IAM9 3CD6S 3TZWA 3AB2B 4N7TA 2RKIA 1S6QA 1DLOA 1GMUA 4Q2MA 4PG6A 3MTJA 1WUUA 3A8EA 2ZHBA 4I7FB 2C3MA 4M1KA 1S77D 4HACA 1D9FA 3W8GA 2EBGA 2NUUG 4L3KA 4ZDNA 1UEUA 3UD4P 1PILA 1X4AA 3DHXA 2VF3A 3PX4A 1U26A 1RT1A 3HHLA 2AMCB 4XPCA 5BYQA 3L9ZA 1DAXA 4K2JA 1NBEB 4IG3A 1YI2S 3EGZA 1HFEL 5HP1A 4MKAA 3LF0A 4ED3A 2ZH8A 3SSRA 1RT7B 3IR7B 2VQEJ 5G0RB 3NWRA 3OJUA 1X4EA 2D3OR 4LF9J 3BR8A 1HBOB 2FVSA 3E51A 2MKYA 3QWPA 3TJ9A 3J7ZT 4P2SA 2FY1A 1VBZA 1W26A 1AZSA 3DLEB 2GZOA 5A76A 2VPWB 4KKOA 4B3MF 4PABA 3W62A 4Z7YA 3J7YU 4DPXA 3H42A 1WHVA 4C0OC 3CDWA 3I5CA 3G6ES 3B78A 2YNFA 2E9TA 1MN9A 2RUSA 4B3SF 3VR1A 1BUXA 3TANA 1KLMB 2F40A 2DGUA 2KTQA 3IBCB 4LF4J 1BQMB 2LP4A 4LFAJ 5IV3A 3LP1B 2GNKA 1KTVA 3VAKA 3KDNA 3TO8A 4UUWA 1HIYA 3OXFA 1WACA 2C2EA 2Y1IA 1T9XA 2ABYA 3CDEA 3X1LB 2YWFA 7FDRA 1SUQB 1XERA 1P9YA 1TMJA 4RL1A 1HQEA 3F73A 2B8QA 4TY8A 2QO3A 2KYZA 4L74A 5JMNA 1FKAF 2CQ2A 3WQPA 3RB3A 4MIWA 2I0XA 3O1LA 1PYSB 1SJRA 2H9ZA 4F4KA 2HGMA 4LVOP 1K73T 3W8PA 2VDIA 3G2XA 1FVQA 2BE7D 2FGCA 2HS3A 3QSYB 4OX7A 2LEAA 3OL6A 3K17A 1RT4B 5KG6A 4WYWA 4YHHJ 3VGSA 5KAKA 1WTBA 2R8IA 3PACA 2ASLA 5EWFA 2IDLA 4RW4A 1OO0B 3TQ1A 2HRUA 1NLKL 4BC9A 2CJ9A 2KFYA 2MQPA 4A8SA 4G1QA 1FKPA 2HPUA 4Y2MA 2WB1D 3D3BJ 1LV5A 3DLGB 3CEDA 5HATA 4CO1A 2OJ3A 2ACMA 4TN2A 1NKBA 1CVJA 1NSKL 1DTTB 1W7WA 2YQ3A 1HWJA 2ZH3A 2KZZA 1IBLJ 4AXJA 4QCLA 3I0RB 3I0SB 3P4UB 4ITSA 1KQFB 2H48B 1WHYA 5L1JA 4DR2F 2CUYA 5DG8A 1X5OA 4ZVGA 5K8NA 4M5NA 3AA9A 4QU6A 2ZH5A 3PEJA 2I5JA 2MQ8A 3BGLA 4J91A 3DRSA 2R8JA 2QN6B 5GAGI 2QL5B 2XG8A 2R42A 4R0JA 3AJDA 2DGQA 4K2XA 4Y65A 4EK2A 4M5IA 3DNCA 1VQNS 5J2NA 1IKYA 3M8PA 2IIHA 1HHQA 3MAAB 2HHPA 4KGVB 2DNMA 3TA0A 3NGKA 5AJ3F 3DHWC 1RWOB 1VC0A 5KFJA 1VK8A 4BCAA 2PEBA 3VGTA 1NK8A 3CMQA 2MPUA 1Q78A 2K3KA 1CC8A 5HMXA 3GCXP 2UXBJ 1C0TA 5IM0B 1XNQJ 3CCSS 5F8JA 4KHPJ 3NCQA 4G6VB 4CTAB 1T03A 5B0FA 4AFFA 5GMDA 3D0IE 3K5PA 4OV6A 1J5EF 3WC0A 3W9JA 3V6DB 5LMNJ 5AE2A 1UVLA 1W25A 4EWTA 4TVAB 2PA3A 4J9PA 4HEA9 2IRUA 5HI7A 4OYBA 1RTJB 2B9XA 2Z4PA 4RNMA 1SL1A 4JI7F 5H9EJ 3TWZA 2MQNA 1N54B 2AYGA 2MJUA 4ZHRA 3FUYA 3PFEA 3MXHP 2MHEA 3ZFVA 1HBUA 4ZVTB 2C1EB 5EGYA 2W24A 3Q2SC 1RU1A 1UAWA 2QLXA 1TKTB 1JQGA 1BWEA 3C6UB 4DOZA 4CRJA 2LQJA 4ZVUB 4ECVA 1RWKB 3T19A 3DDNA 2HQDA 2W2OP 3AY0A 4I2PA 1SVDA 5HK4A 1FRIA 4I56A 2ZM6J 3GIJA 2R7XA 3HVTB 3RTVA 2IM3A 2E5GA 3AT1B 1VFJA 4CNYA 4TU8A 1UWBB 4PG5A 3M2RB 3MPDA 4DQSA 3NAIA 1O8BA 4USVA 2G2YA 3DGPB 3OBIA 3B54A 2HEKA 3IS9B 2J0XA 1FJCA 2R2SA 1V5VA 2RQMA 3BS9A 5E2QA 2DNLA 1ZA1B 1QUVA 1S99A 2OPQA 3G6XA 3CTRA 2XBPA 2FHOB 1E6VB 3GTYX 4WIIA 4FVMA 1SKWA 4HVZA 2MQOA 1NNDA 1VHFA 1FI4A 4LQ9A 4Q0BA 3DC2A 1Y0HA 1HNIA 4LSNA 3H2VE 3P5BP 1RI7A 3OFFA 2FC8A 1N36F 3HP6A 2GVZB 4OYWA 1BMQB 2NXUA 1N34J 2CQBA 2W4PA 2JHEA 3W1YC 4RU9A 2JNJA 1RT2B 4O0IA 3SCLE 5AE1A 1SJ3P 4FXWA 2FDNA 2DCUB 2DH8A 3SFGA 1UVKA 1WWHA 2HHUA 2HFOA 1SC4B 4MFBB 3EXCX 5FLXY 1RWWB 2WOMA 4LF7J 1TL7B 5C25B 2DGWA 4YDXA 3WBZA 2B4PA 2MSTA 2WZ1A 3SDEA 2CQDA 3PEHA 3CF5Q 4DR1J 1MWQA 3T6JA 3KLGB 4A8QA 5DLGA 1KVKA 5D4LA 4PPZA 4CM2A 3KDOA 5JUMA 1C1BA 5J1EB 3EZUA 4LIRA 2D69A 1VC6A 4DX5A 3I6PA 1OS5A 5IT9Y 5L46A 4M5KA 1FVSA 4QJVA 3D1OA 1HKAA 3GYXB 2K1RB 5D4PA 4ZJLA 1XN9A 3MR7A 1Y00A 4QIFA 3EZ5A 4DQRA 3CCZA 3MM8A 3HF5A 4DF4A 3FBCA 1SV5B 4ETZA 4GVBA 2BUNA 2EXUA 4I64A 5CYQB 2JH3A 2OD4A 4DFMA 2CPEA 4QYZK 3E01A 1ZM9A 3KMSA 1Q8LA 3QO9B 2WVBA 3ET6B 1S1VB 3U1LA 3FSXA 3RAQA 2HBQB 5H1SV 2DT9A 5KFAA 3TZXA 4KH0B 5B7WA 3EDRB 3BH6B 5L9NA 4PUOB 5KFWA 3ZTSA 2HHTA 4U9RA 1F5BA 3KYLA 2W4CA 4ZITA 4O4GA 3PR5B 2VG5A 1KNZA 4OZ1A 4CYUA 2DR5A 3NXZA 2FB0A 4DXLA 2BKOA 3GR1A 4PG7A 1F2GA 2MMYA 3JQKA 3NBPA 2W9BA 2OHDA 2A1BA 3SCIE 1GFWB 2NYHA 2OH2A 3FQKA 1RJJA 2WBMA 2FGOA 2HQCA 3RAXA 4RW7A 2AJ4A 5KFTA 2YWEA 3DRRA 2RIJA 4UT4A 3VGUA 2YBVA 2M7SA 2E9RX 3ZNJ1 3E2EA 1GMWA 5EHHA 4F4WA 3L7OA 4X65J 3PRDA 2YNGB 2DR6A 4EBCA 1PJ5A 1K0VA 2UUCJ 4USJC 2R8GA 2KKHA 5HMZA 1UFLA 2FJWA 4EZ6A 3FCHA 2KH9A 2NS1B 5E0OA 2Y1LB 3CD0A 1H38A 2NLWA 2F4VF 1RA6A 3J7A1 3SV3A 2BQ3A 2W8LA 4WWSA 4N76A 5A6PA 3KJVA 4WE1B 3ZO7A 2OSRA 4EU0A 1NDCA 4M5MA 3BN7A 3R3TA 1V3SA 3V81B 2XY5A 2J7UA 3CNQP 1Q16B 1UJ4A 3OHBA 3VGVA 1MMDA 1T3NA 2PDAA 1DURA 1NKEA 5JVGQ 2JEGA 1FK9B 2RKIB 3V4IA 3CDBA 3QZ7A 1DLOB 4ECZA 4N47A 1IM4A 3NOGA 2GHWA 4NWBA 1N5YA 1HNZJ 4KE5A 3BKFA 3O3LA 3CULA 2I2YA 2ZH7A 3GU0A 3QJPA 2M70A 2R8HA 1D09B 4CWBA 1EQ0A 3AODA 3I31A 3JAMY 3UWTA 4HI2A 3RYLA 1HW9A 4OYZA 3HHLB 4UQGA 1S59A 1XK8A 3A8KA 2Y8YA 2VBZA 5HP1B 1VQLS 5GAEI 4ELVA 3HI9A 1BC6A 4DR4J 5C2CA 4CP5A 5DZ7A 4UOFA 4C8MA 5KT2A 3J80U 2HBYB 2QMWA 1IR2A 2XSJB 4LBIA 3OR2A 4LSLA 1EETA 2M8HA 4CO3A 2HNDA 2V4QA 1M5VC 2EFNA 3M8WA 1SL2A 2W25A 4OZ0A 3GIKA 1F5AA 3HO1A 4RKUC 5DM6Q 4V19J 4DX6A 1AZSB 2VQFJ 1QAXA 2RB7A 1FF2A 4WYLA 2G13A 4JOUA 3LO3A 3ZXWA 5KFQA 1KP6A 3DU5A 2YQ0A 1LWEB 3A8IA 2UU9F 5DM7Q 1NPKA 3FBBA 2YNFB 2ASYA 2ZH6A 4PXBA 3EXYA 3DDKA 4RW8A 3W63A 2PMHA 2W2NP 1KDNA 3K2YA 4XPEA 1VRTA 2B9WA 1WC0A 2KYXA 1RT5A 3UO0A 4ICLB 2DPJA 1F9FA 4EFAC 1RDRA 5J2QA 3R5CA 4C9DA 4NRTA 4WK1A 3NMRA 2GAGC 1U2FA 4UOHA 1B99A 4PYAA 3AD9C 4OHVA 5JXSA 3FEYB 4LBHA 4A8WA 1N32F 4O0NA 4TY8B 1NDPA 2M4MA 2XYHB 5KFEA 1R31A 1T9TA 5D78A 4ELTA 3HM9A 3M05A 1Q0NA 1H74A 3HSDA 1T94A 3EJMA 3MDFA 3TNVA 3IGNA 4CLTA 3U02A 3BB5A 2YWWA 1KLNA 1RYRA 2CNNB 3ILJA 3FFIA 1PJ7A 4MK9A 3UCUP 3MEDA 2GS8A 4XK8C 5D0HA 1ICEB 4M8LA 4ZVRB 1SH2A 3CWJA 1KWMA 5DLFA 2J6SA 2DHHA 5KFMA 1EHWA 1FKPB 2AEFA 2E1CA 3NGUA 3T5HA 2RDJA 4J37A 2G1DA 4ILMA 4G3IA 4F7VA 4QWAA 1HYSA 2ZOGA 2KXHA 4ELUA 2QV6A 4IKAA 1L3TA 4OJ3A 4JYAF 1IKWA 1XR5A 1FERA 5ETOA 4DSFA 3MCMA 4LVNP 4B3OA 8AT1B 4ZP7A 1U6BA 4DWIA 1MN7A 3KK3B 3W9HA 4B3RJ 3OL8A 1SJFA 1KONA 1RLDA 2ZDOA 4LFCJ 5H9EK 1VQ9S 3AJ2A 2I5JB 5LJ3Y 2BXJA 1TKZA 2EPIA 4MT1A 1H2VZ 3BJYA 2C2RA 2GIQA 5E3AA 2FJVA 4OX6A 2CWKA 4ED4A 2CJAA 5J2NB 4MKBA 1UW4A 3M8PB 2RE1A 4KO0A 2YKAA 4Z37A 3TOQA 3M32B 1UPMB 1KHVA 3CJKB 2ZJPQ 5A8WB 1IR1A 1V3RA 3MM6B 2LECA 4YY3F 2CIMA 5IV4A 3QT6A 4X4SA 3M2VA 2E1RA 1TQLA 3FK4A 4LUBA 4TQSA 3MUMP 1S7IA 3IO1A 2GX8A 4NXMF 1I1GA 2B0GA 1MU2A 2N4DA 1S6PB 2E5LJ 4OHZA 2MKIA 5HVFA 4Y6IA 4ZK7M 1T03B 3DOLA 4ZPDA 2SXLA 2RS2A 3POTA 3PW5A 1EP4A 2I8EA 5B08A 3MCSA 4F36A 1R8PA 3UDLA 2XMWA 2OFHX 1JK9B 1TK8A 4ZHRB 1HBUB 4TLRA 1M1GA 1K0TA 1V9OA 2V34A 1NK6A 1ROFA 5L39A 4MIAA 4LF1A 4XTTA 2V8VA 1RADB 1K1SA 4JI2F 4H4KC 2B5JB 3F56A 2L9NA 1WHWA 3KHLA 4RUAA 1Z2ZA 2GVDA 2ZZNA 4G1IA 2DNPA 3P3DA 1TMMA 4DZDA 4X4UA 4CT8A 1AT1B 4NCAA 2W8KA 3IWXA 2DR9A 4C97A 1YZ7A 3VQTA 2J8SA 4JB8B 3HKZD 5LT5A 5I4MA 3ETOA 3U27A 2YKPA 2VB6A 2C3YA 1RT3B 4JI6J 1NZ8A 3IAS9 4PCQA 4Y0FA 3W2VB 4EBDA 1AW0A 5BJRA 1QLNA 3RBDA 2KM8C 1K9MT 1VHIA 3QGGA 2QMUB 4ES3A 2VG7A 2YWHA 2U2FA 1U02A 3R5GA 2ZBIA 3G87A 2OELA 3W64A 4Q0BB 2R7WA 4IR9A 4DL0C 2MQQA 4HTJA 1H98A 4LSNB 3IM9A 3MZIA 1JKHA 1RTDA 3OTOJ 1FJGJ 4F2SA 4DF8A 3QNWB 2OPRA 1X7VA 2BJ8A 2F9DA 2R8KA 2E1AA 2UUAJ 2QYCA 1S72S 1I5OB 2W1BA 2AGPA 2UUBF 1VCTA 1XMQF 3CB4A 4DCPB 3NY0A 3QFHA 3R8YA 1FTRA 4LREA 3H5UA 1S10A 3LQVA 4K4XA 1GX6A 4K5RA 4DJBA 2BW2A 3VF0B 3RW6A 1S9GB 4N8NA 4WXOA 4F8RA 2ZFHA 5D0GA 2GO9A 2JC1A 3H5SA 4NZ7A 2RVJA 1D0EA 8ATCB 4G1PA 2GO8A 1FRLA 2O66A 3DLJA 4F2RA 2U1AA 1KSPA 3NCRA 3A13A 1BGXT 3BKTA 2NZCA 3KLVA 3M8QA 4JI0F 2YX4A 1VLYA 3M9NB 4FKXA 3LP2B 3R5DA 4G65A 6FD1A 5B0EA 2GHPA 2WRMA 4C2MA 4Q7AA 2NXCA 2Z56B 1HNXJ 3Q86A 3CC2S 2HRTA 3K5LA 3H90A 4LQ3A 4ID5A 3ELHA 1VBXA 3AAWB 5KT4A 3KLFA 5BR8F 1FTCA 2UVRA 4R25A 4YS2A 4C0BA 3UDEA 1YK9A 2BABA 3G4SS 1NJXA 2KFNA 2OMLA 2QYGA 3EGWB 3T1HJ 4OI3A 3ZZTA 1KQKA 4GMKA 3NNHA 3ILLA 2MHNA 3P96A 5LXRA 7AT1B 4GKJJ 3GFXA 4B9SA 2VZ9A 1HNWJ 2P9EA 5KFGA 2F3JA 3GJQB 1IBCB 2B7CB 4C3MA 2XS2A 2O3DA 1RHUB 2CVEA 3KUGA 2L9DA 4DCOB 1T9VA 4NLDA 1NCLA 4CYUB 4QW9A 3MM5A 3H40A 4IOCQ 5KFUA 2E5IA 3BF4A 3HMJG 2W9BB 5M2RA 2ZNZA 2XMTA 1JLGB 4DFJA 4CLPA 1MROB 3V4MA 4RW7B 5I42A 3VHQA 3DRRB 5D8HB 2KVQE 4WTOB 1A0OB 2IJRA 3QGIA 2FPHX 5ADZA 4WBFA 1P9QC 4LF8F 5DRKA 2VBWA 3MMBB 1JLEA 1NJWA 1Y3KA 3ILOA 1UJ6A 5LSLA 2BOPA 4J5OA 3R6GB 5H9FJ 2Q66A 2JJ4D 4NCGA 2DNZA 2FIUA 1KRPA 1YIJS 3UD3P 1XMBA 2HQGA 1FEEA 3UVJA 2K7KA 3CCVS 5KFZA 1KS2A 5CD4A 4KB7A 2V69A 3VTIA 1XR7A 3FBFA 3N0VA 1X4BA 3IG1B 3N01A 4KGKA 3N4WA 3QATA 3M1VB 4NYOA 4WZMA 2EVZA 1VQSA 1CPZA 2PC6A 2NXNA 1D8YA 5SZTA 1U7LA 4U67Q 1HNVA 3NG8A 2KHCA 1RWMB 2KJWA 3RU0A 4KRWA 4U7UK 3ZTRA 2HZVA 5ITHA 4DR7F 3V4IB 4FF2A 4JI3J 1R89A 1ZPVA 3TW0A 1N5YB 2V8DA 5A8RA 3C2PA 5AXLA 2OPPA 2HZAA 3UW1A 1J5OA 1S4EA 3SZ2A 5KG3A 2RS8A 2NCKL 4Q8EA 2PT0A 2HNYB 2XWXA 3N9UC 4URQU 2YKMA 2VFTA 1AUDA 3KUEA 2BV3A 1WF1A 3IC1A 1JX4A 3R1HA 5AXMA 2XS5A 1H6KX 2KVIA 3GV5B 4P2FA 3C46A 1WG5A 1R0BG 4Y2CA 1P1TA 2JVOA 1R0AA 2RU9A 3IM8A 5GMKa 1S76D 3FMBA 1NDLA 3FCWA 3VZIA 1UW9A 4PPDA 1T3OA 4Y2IA 4IOAQ 1EETB 1B0PA 1VQOS 2IVMA 1RACB 1U0HA 4DL7A 4IRDA 3Q2TC 1BQNA 3LANA 2IJNA 2WK4A 5B0CA 2C2DA 4Q43A 4RO0A 5E33A 1R3NA 4LSZB 3I4PA 3EGNA 5HANA 3C6TA 4U8VA 5C42A 4RW8B 4PYDA 1YRXA 1BY9A 3MM7A 4OZ5A 3TVKA 3FMWA 2D74B 2RAQA 2HHWA 3SXLA 4KHRA 1FRXA 3BQ1A 4F3OA 1X5SA 3VAJA 1VRTB 1YJVA 1TL4A 2GGPA 4LIWA 2PEHA 1RT5B 1L3VA 2D41A 3AH6A 3PRBA 2BM0A 3LP0A 2ZBPA 1KC8T 5J2QB 2BM1A 5GMEA 3Q23A 3HSJA 3T1AA 1A6LA 2XQCA 1REVA 3C14A 4GKKF 2IAJB 2V9KA 4NXNJ 4R5PB 4PXCA 1UTAA 3L95X 2XS7A 4YOEA 2VD3A 1U47A 3CCRS 1RAFB 3VAFA 5T7LA 3MMJA 3SQGA 3OLAA 4C3LA 4AUKA 3FFIB 1HI8A 1QE1A 3MEDB 5B0GA 4E98A 3O2IA 1UVMA 4NA1A 3R2DJ 1RP5A 1GXUA 2AJFE 4DL6A 4TU7A 1MW7A 4O3QA 4A8OA 2HQIA 2CVIA 3KUHA 2YKNA 5J1PA 2C3OA 5L1KA 3M7VA 1CBKA 4NZ6A 1UPPA 1SL0A 4B3OB 4BWJA 2IVFB 1RHKB 4S0MA 2YTCA 1XIQA 2MDAA 4IG0A 4M95A 1CJKA 3PYFA 1C1CA 1U1OA 4QWEA 2LEPA 2PO4A 3WX8A 1G7CB 2OEJA 1BXNA 1TKZB 2CFXA 3T41A 1F3VA 2IBKA 1OYDA 1RT6A 2Q3PA 2DHAA 3IR5B 5FD1A 3CPWR 4OX8A 2Z57B 4URGA 1PKUA 4C98A 3HHLC 3D6FB 3QGHA 1S9EB 3UCZP 4NI2A 5IOLA 5B0DA 2G2ZA 1O0PA 1UMJA 1C0UA 3TEGA 1KQGB 1G1XA 3TX0A 1U2CA 3C16B 5D0EA 2H4YB 2BE9B 4FNIA 1JLFA 2XM3A 1RE1B 3VVTA 4K4WA 3M9OB 4ED0A 5E3RA 1RBAA 4NYZA 1NK5A 4RNFA 2V50A 5HQMA 2FTRA 4IOBA 1WORA 1HLWA 5DQGA 4NXMJ 3DOLB 3B8HA 2P6TA 3KJQB 2VA2A 2CQIA 4L76A 1N4LA 1D9DA 2XWYA 3RGIA 1FEHA 2EI5A 3MCNA 1EP4B 2IBOA 1L3SA 4WU3A 5F9NA 3CDAA 2NSCA 2DNGA 1VQMS 3HD2A 3FRYA 2LCWA 2F63A 3MM9A 1M5HA 3RR8A 3NNAA 2PIIA 1Y5LB 5CQGA 5I3PA 1U0SA 3HHEA 5KG4A 2GMHA 1VR6A 1EKSA 2AQ4A 4AL7A 2H5EA 4NLUA 5HO4A 1C2PA 2AX0A 4RBUA 3CE8A 2DO0A 4ZLJA 3MCOA 4UTGA 2J9EA 4EI2A 3RB6A 1OMSA 5CZVA 2B43A 2GVDB 3U7JA 1NHVA 2WB4A 3OFEA 2BACA 4KGXB 3H4DA 1TL3A 2JSXA 1M5PC 1GH8A 4ILRA 2CPJA 2ZH4A 2XZWA 1YVFA 1IVZA 3K5OA 3BQ0A 5KG0A 3GWCA 4DEZA 1VQ8S 2CG4A 1TL1A 2ZVSA 4KR0B 2E7XA 2F65A 1D3WA 3CJSA 4AYBD 4U96A 3DRPB 3LPYA 4W92B 4YQWA 4NL5A 3GFZA 3M9MB 3NNCA 4L72B 3C66A 1TVRA 1CQNA 4JV5J 2ZOFA 2GV1A 2LQ9A 3R5JB 3K8VA 2A6MA 5DQIA 3AD8C 3KG0A 2J8AA 2J6TA 2X3GA 2KB2A 1TAQA 2DEIA 1RTDB 1M5SA 5IWAF 5DG9A 2HHVA 4NLRA 1KVIA 5ETSA 2QGFB 2OMOA 3EPIA 3O6QA 3MMAA 3EX7B 1LQ9A 4OQJA 4K7QA 4K4ZA 4DL4A 1GAOA 1X60A 1S4FA 4ZP8A 3H4BA 2DTJA 2BJ9A 4FNHA 5KFPA 4Y3CA 2GW8A 5K14A 1UEVA 3CJ8A 1CJVA 1QUPA 2ZWPA 3U1NA 4B3TJ 2JL9A 3TP2A 2IMWP 1S6UA 4ZP6A 3OJSA 4FS2A 2LA6A 4OZLA 1JLAB 3M6UA 3Q0AA 3ETMA 4WPAA 2V6AA 2HMIB 4F04B 3N6NA 1ZZFA 3Q22A 1BHNA 3VAHA 1VRQC 2FHKA 3W5ZA 1R6YA 2CPXA 3FQLA 3NAHA 2HZCA 2HNZA 4O44B 4OLPA 1CJUA 4OYOA 1SI9A 3BPSP 2BZ2A 3PZPA 1NK0A 3HJFA 1XMOJ 2H5IB 1URRA 3S01A 1LW0A 1RHQB 1N48A 3HPOA 4AXIA 2MKSA 5KFFA 1IKXA 5KT7A 8RUCA 3K57A 4FDFA 3CJ0A 2FHMA 2AKWB 1WKLA 2XGQA 4OZJA 1M5KC 2HGLA 2X1GA 3AQOA 3NS6A 3BR9A 4DSIA 2ZUGA 2QG9B 4NLTA 2YVSA 1T9UA 2W2MP 4USKA 1P1LA 2ZE2A 2P9CA 2AYEA 3OTCA 1Y7PA 1Q79A 3CW2C 3MM5B 1YJ7A 3H8YA 2DY9A 4DV3F 5E3QA 3LGMA 1VBKA 2HKEA 4AQYF 3EICA 3OSNA 4WFAQ 4ZVSB 2ZC3A 1GNKA 1NHUA 5I42B 2WCXA 3FC9A 1HW8A 1YRUA 2JRSA 3I87A 5ETQA 4NZ0A 2V4JA 4F67A 3FSYA 2CZVC 3NWGA 2RILA 1MNEA 3KXDA 4DUZF 3B82A 1UFKA 3Q24A 1N52B 5JJBA 2EC2A 4NCGB 1X31C 5B0BA 3HSZA 2JLGA 3LA0A 4LF6J 1TUVA 4U95A 2YX1A 4XDDA 4ZCLA 1X5TA 3UVJB 1UVNA 3VZHA 4DR6F 3BGFA 1TK0A 3CMAS 4A8KA 2JEFA 2Z0GA 3W5YA 1FT8A 1Y5IB 4NCBA 1JLBA 3T1YF 3THPA 2EFQA 5IT0A 3HDSA 3QMQA 4QIEA 4PQAA 1HQ2A 1ZTWA 3MEGA 1SIWB 2EKNA 1S1TA 3TI0A 2Y0BB 4PQUA 4A48A 1HR0J 1RAOA 2D7SA 3HHDA 4I1TA 4FPIA 2XI2A 5DGBA 4L3NA 3MR2A 3MI7X 1CLFA 5A8RB 4F26A 3PRVA 4OHWA 2I1RA 1NM2A 2FLPA 3BH7B 3PCOB 4JP8A 1C4CA 5E41A 1DTQB 2CDRB 1XNRJ 4DDFA 1G3OA 2KI2A 4RBTA 2FHJA 2YKMB 2OLWA 3MMCA 4DR3F 5A0YA 3HVRA 4DQIA 3GJRB 4Y2AA 3CUNA 4ECSA 4WK3A 3DKDA 1U25A 3MPYA 4CO2A 1CQMA 4ZCMA 1JB0C 4UQTA 4ZPBA 4NOHA 5L9XA 4CO4A 4P52A 1VDHA 2XB2D 5HQ8A 2V63A 4A8XA 1FFSB 4K4UA 2KT2A 3WX4A 1UL3A 1T95A 2BR0A 5KFLA 3T6BA 2F8MA 1JLQA 3KKFA 2ACYA 1U0HB 4ANDA 2ZKUA 4QZVB 4OV1A 3HVWA 4X4OA 2KJVA 4WFXA 4PXEA 2XMMA 1OYEA 2F7VA 3R9LA 3QAEA 2GIFA 1HQUB 4LF5F 4RW9B 3LTOA 2NQPA 1UZDA 1HBMA 5C42B 5CCMA 3OTDA 2JLEA 4J7CA 2R2RA 2EWHA 3QRPA 4KH1B 3CO0P 1HL6A 4ZN1A 2ZDPA 2V68A 2Q43A 1YQHA 4URSA 2GGPB 2VU5A 5DETA 4QBUA 4AD6A 3GCWP 3I96A 2VG6A 3KWMA 2HHHJ 1LXJA 1RBLA 2UXCJ 1U09A 4ZLLA 1REVB 1WF0A 3BYPA 2HHXA 1ZYQA 1IBKJ 3C14B 4H54A 2GJIA 3US5A 2RUGA 1S0OA 2KN4A 2VONA 4OI2A 2DHGA 3QJLA 5L38A 4C7QA 3IRWP 1DQAA 2ZOMA 3RR7A 1ZH5A 3D6HB 4ED2A 1LK5A 3SQGB 1NB2A 3QSIA 4GO7X 5HMWA 1XWLA 3T5KA 4MKYA 1Q86T 3D1HA 3WIUA 2EG1A 1VIOA 5I3UA 1VK3A 3TQEA 4YP3A 3RB4A 1WKKA 3GJTB 1CULB 3T5LA 5HROA 2MQMA 3QT5A 5KFXA 4B02A 1R8AA 2HFUA 4DV1J 2GQCA 2V0NA 5DZ6A 4JI1F 1YX2A 1GK8A 2CPZA 3B6BA 2YKNB 2Y3YA 1N33F 2AJ1A 2VPXB 5HMYA 3CC7S 2RRAA 2DRDA 3LAMA 4LR8A 5J2MB 3MEEA 1XEZA 4CZCA 2RQCA 1E6YA 4CI0B 3N79A 2R7RA 3BZQA 2HK3A 1DARA 3J81U 2YNHB 2B7BB 4YUDA 4OMFG 4IG0B 1CJKB 1C1CB 1RAEB 2UVUA 5LMUF 4UOCA 2CZ4A 3AHPA 1B70B 3CCLS 5HVHA 4HKQA 1X0FA 2VH7A 5GAGU 4DV7J 3RBEA 1SKUB 2ZC4A 3QGPA 2DR8A 3F41A 5CH7B 5HSPA 3KG4A 3DXBA 5F8GA 3KJNB 3AOAA 4GVLA 4ILLA 4NI2B 4U6PA 4ZVHA 3ISND 4IFVA 3PIPQ 1S1UA 3LPEA 4ZPWR 4JI8J 4X66J 1BWVA 1JLFB 3JSMA 1M5OC 1RTZA 2KG0A 2BKPA 3R5AA 3JXOA 2MYFA 3ZNUA 2HW3A 2AW0A 4F0HA 3BKUA 4OZ2A 5MLCV 2XMKA 1YJRA 3OV7A 2DNQA 2MZTA 2OI2A 5HJYA 2DBBA 3IA0A 4LFBJ 4ZLNA 1FKOA 4J9NA 4OJ1A 5D4NA 1F6TA 2LVWA 4KYZA 2CA9A 1UETA 1V3ZA 2XNQA 2EEYA 9RUBA 1KQSR 4TU9A 1VBYA 2LQ8A 1OY6A 3M8RA 3QZ8A 2ALZA 3CO9A 3M30A 2DXFA 2AEJA 3EVMA 1JIHA 4DV0F 1OJ4A 2K06A 3QYYA 2W4DA 2QA2A 2EFVA 4DUYJ 2OO4A 3AFGA 4N8OA 1ZM2A 4CQ1A 3N28A 2BE2A 2DNNA 4A4JA 4A8MP 1NPPA 5K8OA 1IBMJ 1I6JA 1LFWA 3PKMA 2B4UA 3CC4S 4IRKA 5C5JA 2M52A 3IRXB 4EGLA 2DNKA 5LOQA 1S1XA 3W7BA 3J80Y 3GJSB 3E3XA 3OQ2A 4WP8A 2EFGA 2VICA 3MOZA 4DR5F 1TL1B 3ISZA 2KM8B 4DV2F 5EX0A 1N5TA 4RJVA 5D15A 1Y9OA 4DUTA 1QVFR 5A2QU 3DOMA 5KFSA 3SCJE 1FHTA 3PYDA 1NO8A 2W7OA 4FBTA 1GXTA 2RHQB 2XC9A 2CPDA 1DRZA 1UKUA 2RNEA 4WFBQ 5E7OB 3RG6A 3NGRA 4OYAA 1M1HA 1I94J 3MMAB 2HLUA 3BBBA 4LRCA 3JTNA 2RJZA 2OEKA 4FF1A 2ZITA 1FFGB 1X0PA 2HSEB 2VPZB 3NS7B 3VAGA 2XMVA 2K2PA 5K14B 2NPIA 2DXDA 1H0HB 3V6KA 2AGOA 2JFDA 3LGHA 4F3QA 5A6WA 1Q7LB 5CYMA 1U48A 2VQEF 2R9LA 3RAMA 2EW9A 4LF9F 2VASA 2ZBCA 2BDPA 2CRLA 4B9VA 5D77A 3BREA 2DCLA 1ZPWX 1RT7A 3LH2S 3H59A 3ILIA 1KEKA 4I0WA 1LWCB 5G0RA 2N4CA 3R7NB 2G0IA 4I4BA 2AYBA 4EYIB 2BBEA 2D3ZA 2HNZB 1X4FA 2OGUA 4RLEA 5IT4A 1H7WA 1PO6A 2C3PA 2HFSA 2IA6A 3TAMA 1FRMA 4H4OB 2JOQA 4C6AA 2ROPA 3X3UA 2KT3A 4V1Ak 4K4TA 4LF4F 4LFAF 3DU6A 3OPKA 2CNLB 4NEYA 3C3LA 3UNGC 1XR6A 2WTFA 4F4YA 4A8FA 1BQMA 2RF2A 2LA4A 1QSLA 2X1FA 4JV1A 3A3NB 4ZPAA 2HAIA 3TARA 4JUZA 7FD1A 3QBCA 4OJGA 2HS4A 2DNYA 5CYJA 4IO9Q 1YHQS 1FJ7A 2RT3A 1Y10A 3JQMA 2XI3A 3EDQB 4JI4J 2O5DA 5KFDA 2MXYA 4YHHF 3DDIA 3R5BA 4IH7A 4UZBA 2IFXA 3P8BB 3GILA 4ZOSA 3JYTA 4OI4A 1V6HA 4TXSA 3BSNA 3CCJS 4ED6A 2UVWA 2PE8A 4AQYJ 2QSFA 3M2UB 4MK7A 5J2PA 3PDNA 4FKYA 1ZS6A 4BLGA 1SCJB 4Q5VA 2DHSA 1UCNA 1Q8KA 3PIOQ 3NMAA 1ZETA 2GMLA 5J1NA 1Q5YA 3OFGA 1IBLF 2MKHA 4OLOA 2RD5C 3DLGA 1HPZB 5D3GB 4Y2KA 4LRAA 4DV6J 5MAOA 4F50A 1DTTA 3SV4A 2IDEA 3PW4A 2BJ3A 3I0RA 1S5ZA 1S1TB 3G86A 1QAIA 2KRBA 1WNEA 3PX0A 2J5AA 2AV5A 2LLZA 5FJ4A 1FCAA 1OPZA 1NUEA 3SCKE 1DJ0A 2J76E 5C7PA 1NRKA 5F0UA 3Q8YA 1VQKS 1GMVA 4KSEB 3L3CA 5EX3A 2MQLA 1K47A 2XULA 3DM2A 4ZJOA 1FD8A 3GLJA 3M6XA 1LNQA 2QLWA 2XEXA 1WG1A 1NDKA 3S8SA 1F3FA 4WFZA 4JI5J 1RB0A 1FE0A 4WP9A 2DY1A 1JJ4A 3MMCB 4WIQA 5A0YB 1VRUA 4CLLA 3G9CA 1RK8A 5KTQA 3TUJC 1JXLA 1UEKA 4OX9J 4OZNA 2UXBF 2C3UA 3QLHB 1XNQF 4KHPF 4DV4J 4DCJB 5GAEU 2KG1A 3NP5A 4RW6B 2FZKB 3Q8UA 4DPYA 2BJ1A 5LMNF 2R7QA 2DIUA 1HHSA 1PC5A 1JLQB 4O3PA 4DL2A 1SQGA 2YWGA 1MWZA 1RYSA 1OIAA 1HHTP 4D3GA 2CDQA 1UVIA 1YRTA 4EEYA 2LEBA 3OD2A 1VIXA 3DI6B 1IJEB 2CJBA 2XZDB 2GJ2A 2PI4A 4WP3A 1HI0P 3HFZB 3ONQA 1SJQA 1HD1A 4ZS6A 2E29A 1Q8IA 2QMXA 3MEKA 4J9UE 1R27B 3AOCA 3ITHB 1RXOB 4RBVA 2ZM6F 4DMZA 4FVCA 1S57A 4YEAA 3TR5A 3BO3A 2DH7A 2KU7A 3H25A 3OLBA 4CLKA 3W3SA 1OSCA 3CCWA 4C11B 2JFKA 2ZH2A 2BJEA 3HVTA 4LT6A 3C15A 2QC3A 2M3DA 3KLEB 4DX7A 3GSDA 5CABA 1WOPA 2GJFA 2WSEC 4KT0C 5E5NA 4ZMMA 3EYZA 4E8UA 1SJ4P 1NXIA 4OYXA 4WF9Q 5IXUA 4NLPA 2XLKA 2WONB 4RWXA 1GX5A 3D1QA 4X4PA 3NCPA 3VVUA 2LDIA 2XTJP 5I3UB 2XLJA 3AQPA 2QFJA 3R6LB 3DOKA 1E6VA 1T05A 4X64J 1MMNA 1B4SA 3ZTOA 3S6EA 3MOJB 1YSJA 1OY9A 3TX8A 1VQPS 4QWBA 1N34F 4DV5J 3TA2A 4X62J 1OQ6A 4OYIA 4P2XA 1CC7A 3CSKA 3HHLD 3K5MA 4NEZA 1OSDA 2GVZA 2Z2YB 2HHSA 5LL6d 1HMVA 3MEEB 4LF7F 1L3KA 4QR1A 3ICLA 4I6AA 3GV8B 1E6YB 2FVPA 3R2CJ 4DR1F 2ZH1A 2VBYA 1S6QB 1TFWA 2B56A 3DXSX 5C25A 2CWXA 3NEKA 2CJYB 1YJNS 3LUYA 2FJDB 3EM1A 2MKJA 4HACB 2IYIA 3KLGA 1X4DA 5AE3A 5L1LA 3K7RA 4FYYB 2R7SA 3MPVA 2ZZMA 2P2CB 2EBEA 3BSAA 1YTYA 4A46A 2WSCC 1RT1B 5J1EA 3IXQA 1FDBA 2F8HA 3O8WA 5L8RC 2EC0A 1AUSL 3N5FA 4IG3B 1FDNA 3UD5A 5F9LA 4IFVB 1VJWA 4FF3A 2ZNYA 3UNYA 3O5TB 3TJAA 1MG7A 2PN6A 5KT3A 4KIAA 2PMWA 2B4OA 2P8IA 5ETVA 2OTLS 2RHSB 4NLWA 4M5DA 3GFYA 1FKOB 3QO9A 1LOUA 1Y3JA 3ET6A 1O6XA 4WCEQ 4KKOB 3RW7A 2M5YA 5KG5A 4UW2A 1YBUA 4PUOA 4QPXA 2FQQB 4ES1A 3M30B 1QSYA 4OJHA 4B3MJ 3VQSA 2HWIA 4I6YA 5IQQA 3H20A 3HFVA 3PYEA 1WTFA 5GADI 3HX9A 3M6WA 4ED1A 2LQ5A 2V9WA 3HVAA 3JSRA 2GQQA 4X65F 4B3SJ 3ULHA 2QTWA 2BE2B 4QW8A 1PG5B 4ZN3A 4NYPA 5EWEA 2UUCF 3FKBA 2M2BA 4PG4A 1HQEB 2DISA 4RUCA 3H5XA 2YNGA 2Z30B 3QJJA 1T8EA 2VDHA 1WF2A 4K4SA 3DLKA 4K8RA 3MPUB 2KFZA 1MLAA 3D6MB 1T11A 1PBUA 2AJ2A 4HT5A 4PEOA 3AXKA 4PXDA 1SQEA 2A2CA 1S1XB 2ZHOA 4Q45A 1TAUA 2DIVA 1FWPA 2H51B 5FDLA 2ASJA 3UPFA 4QYZJ 4RW4B 3AA8A 1T02A 4YFUA 3NKYA 3MHYA 4PG8A 4BC7A 1VC5A 2IRXA 4G1QB 2HVDA 2AJ0A 3GV7B 2MZQA 2ZD1A 2DRAA 2ALYB 4B08A 2LMIA 2CADA 2KHDA 4ZVPB 5HN0A 1NSPA 4RUHA 2JX2A 5LJ5Y 3SQOP 1S7HA 1VI7A 1NPRA 1HNZF 1S9FA 2O01C 4N41A 3PFOA 2XHCA 1WC1A 1LKZA 1FK9A 2AP6A 4OHYA 3BDPA 3AOBA 4RWWA 1VISA 4W4MA 4DSKA 1SB6A 3ZC4A 3QAUA 2W01A 5HL7Q 2E5JA 2XY6A 1KKHA 1OPIA 2FLOA 1ULRA 2HFZA 2XHWA 2Q1LA 2E7WA 4P10A 3MUTP 5ETNA 3DRSB 4DR2J 1SC3B 4M63A 2R2UA 4HLBA 4RUBA 4DR4F 4K4YA 2V67A 3D4JA 5CYMB 4UZCA 2JEIA 3FZ2A 5F3TA 1IKYB 4F4XA 3GP9A 1NK7A 3AJ1A 2YWKA 2V2KA 2CPIA 1WOSA 2YNIA 2IHR1 2KT5A 2P9GA 2HWHA 4YN3B 2XSJA 4TQRA 2VQFF 5A8KA 1PGZA 1YDLA 4J9VA 2BMBA 1RTHA 3Q8RB 5AJ3J 4ALZA 3TRGA 3TAMB 1RA7A 2OAUA 1C0TB 3PTWA 4TNOA 1REGX 4CLFA 3OW2R 1RLCL 1SC1B 4ZVFA 1LWEA 1FXDA 1NB7A 4FPRA 1A9NB 3GONA 3K58A 2IC3A 1ZOTA 4UUXA 5CXTA 4TLQA 2IA0A 2RF2B 2B8PA 3KLIA 3BSOA 5KFIA 1J5EJ 4NASA 1VGYA 1SH3A 2X7IA 3ISNC 4ZLPA 4IQMA 1QVGR 4ZKAA 4ICLA 4ZPCA 4C8YA 2M9KA 3FNNA 3L4BC 4OI0A 1U6FA 1WC6A 2DNRA 4ZIVA 1DBDA 2DGTA 5GAHI 3HLUA 4QWCA 4WZQA 4JI7J 1IR0A 2BOAA 3RB0A 4PRFA 2C2KB 4J9KA 3V2UC 3LOUA 2C2MB 4YB7A 1G4CA 3N6MA 4XIUA 4I2PB 3JYTB 2BJ7A 4C3KA 2NYIA 3D5MA 1ZAWA 4ECRA 1MMLA 5J2PB 4M94A 2Z2MA 4QPTA 2HURA 4M5LA 3GMGA 5F8IA 3GQCA 1HWLA 1HARA 4PWUA 4CLWA 5D4OA 5DDOC 2MLYA 3KLHA 1YKWA 2BKNA 1IUJA 5KFNA 2G1HA 4J9QA 4BBYA 2AF6A 1S97A 5KFBA 2OPQB 1ZM3A 2DNOA 1N8RT 1EZZB 1RWXB 1Q53A 3GE9A 2GIRA 3Q8VA 2PD1A 4HI1A 4B3RF 2MLZA 4WFNQ 3ZZUA 2DGXA 3K59A 2Y1RI 1TUGB 1R8BA 2DR7A 4LFCF 2HK2A 4OYPA 3MWBA 2HIQA 3DMJA 4ZCIA 1HNIB 3KK3A 4JV0A 1FWLA 1J2VA 1X5PA 2YX7A 4UOGA 1LXNA 2DH9A 3CJTA 4CH0S 4C8KA 3D67A 1S0VA 1O51A 5DDPC 2ZHAA 5F8LA 2JVRA 3DM2B 1U1KA 3ADAC 1N36J 1UFWA 3G6VA 4O3NA 2QL9B 2CQ3A 2IVYA 2B4VA 5EDWA 3FEZA 2GMJA 2WOMB 4PWWA 3RRKA 4JBCA 1NK4A 3SDEB 1RWVB 3M32A 3ZZZA 1HWIA 5CA5A 1X9MA 4LR9A 3CJKA 2G0CA 2UZAA 1LW2A 1VRUB 5A8WA 3PVXA 3MM6A 3BPDA 4K59A 2E5LF 5BYRA 5EWGA 2CJXB 3CMES 2YY3A 3L7UA 1C1BB 1WKJA 3G8QA 3DLLQ 2QA4G 3KK1A 4HTIA 4EUVA 4O3SA 4KGZB 1VQ6S 4CH7A 1S6PA 2HQFA 4CM0A 3T3FA 2AZ3A 5ETRA 2BX6A 3MM8B 2VIHA 3I5AA 5K20B 3EVOA 3J7YI 5KT6A 4RNHA 1L3UA 2K8GA 2VKZG 4GVBB 2JC0A 1YWXA 3I56S 5HBMA 1RWPB 3VCDA 4NA2A 2D3O1 4EMDA 4YR2A 3E01B 3NLCA 1NEEA 3KFWX 1GMWD 4MIBA 1OY8A 2LYVA 4CO5A 1V5IB 3NS5A 4O4GB 3H7HB 2VG5B 1B0VA 4W98A 1PBAA 2B5JA 3UR0A 1RU2A 2POKA 3NBPB 3J7Z5 1N0UA 4XDCA 3HCXA 3JS9A 3OVAA 1RWUA 3C15B 4JI6F 3QQCD 2VL1A 4GRSA 1WOOA 3PXGa 3HK2A 2Q6CA 5E3PA 2Z2ZA 1SQFA 1RT3A 1FRJA 3TZYA 1TKDA 1LWXA 1NHKL 2K7JA 1JNZB 1TV6A 4P7TA 3W2VA 1RAHB 1P27B 2QJ3A 1H2TZ 3DOKB 3DYAA 1T05B 4LBPA 2CQPA 3OTOF 1FJGF 1RSCA 2X1AA 1D1UA 1QD1A 2KDOA 3GPAA 5F8NA 2UUAF 2HAFA 1WEZA 2R7TA 1R8CA 2J9CA 2XYGB 1S1WA 3KJVB 2J7KA 1FXRA 1SJ1A 1JNRB 2LXIA 3FZBA 3PO4A 1RUSA 1UVJA 2F4VJ 1HMVB 2HFNA 3FCVA 5KFVA 3A4TA 2BRKA 2EFOA 1EAYC 3Q8QB 1ZBTA 2CJKA 4KPCA 3UDCA 1KTQA 2W9AA 2FZGB 4X2BA 2FVQA 4IFYA 1VS3A 2DO4A 3MFIA 3F44A 4RPFA 5KT5A 3VV2B 1S9GA 2KXFA 2WVEA 3DCAA 2FJAB 1R0CB 2C42A 4FYXB 1NKCA 4HDGA 4KPYA 1Q5VA 2FLLA 4J9SA 3J7AN 3R7BB 1SH0A 4J9RA 1NU4A 1ZA2B 4MMOA 2GHVC 3WDOA 4LRBA 2XMAA 1HNXF 2L41A 5CZXA 4MYUA 5F8MA 5HQLA 3PW0A 3OXLA 2B3TB 4FBUA 3OTBA 1C4AA 4U7UD 3LP2A 3CXCR 4C8ZA 2MGZA 3C19A 4R8UA 2FVCA 4AT1B 2VJVA 1CEZA 2H65B 3HHNB 3OR2B 4C48A 4LSLB 3MGJA 3T1HF 4RR5A 1CS4A 3KG1A 2ZJQQ 1AA1B 4X4RA 2HNDB 4WXWA 4M5DB 3PJ9A 4GKJF 1QJHA 1X4HA 1S48A 1RAIB 3CJ2A 1HNWF 2HWTA 2F1FA 3MECA 1RKJA 3ZZ0A 4M5JA 3QRRA 2RRBA 1WSRA 4OYMA 4FYWB 2XMJA 4DPWA 2ZH9A 3D28A 2LXUA 3BSCA 4DS5A 2B51A 1JLCA 3DGVA 2FVRA 3F0NA 4IQXA 3IWNC 5M2UA 2BANA 2UU9J 1TFYA 2LFVA 5KFCA 3PY8A 1WDDA 1WI6A 3OTEA 5C2GA 1JLGA 1Q8BA 3GFHA 3THVA 1MROA 1PC4A 4NRUA 1N5SA 5KOWA 2V2ZA 3D0HE 4NLGA 4FP9A 4FYDA 2ILZA 2VA3A 4KY3A 3MMBA 3DLKB 2UUTA 4NLQA 1RHRB 2OP5A 3WZ0A 4KAIA 4TYBA 1GT8A 1N32J 1R8HA 4K0KF 2VODA 3I4HX 2ZVIA 1KVJA 3W5XA 5FDLB 1Q7YT 3BGUA 2OPSA 3I55S 2VPYB 3BQ2A 2J0SD 5AXKA 3BGRA 1S12A 3FBEA 3IG1A 2HVEA 3M1VA 2ZD1B 4A8YA 2WVDA 4JI3F 4OHXA 1HYSB 4M5HA 3B4MA 4ER8A 1X4GA 2WVFA 2XY7A 2Z58B 3BN4A 3J81j 3KHRA 1TZ0A 2DD8S 3MR3A 4DSLA 1GQEA 1IKWB 2GA7A 4CH1A 1SBRA 1FD2A 1Q82T 1AB8A 5JVHQ 4QIWD 1BD6A 1UWAA 4FXDA 1UJ5A 1VQ7S 4JYAJ 4DFPA 5KFKA 4LR7A 2CQ4A 3CIZA 3OVBA 2HNYA 4ED8A 4HDHA 1Y11A 1FJEB 2YH0A 1MWYA 3CCQS 2CXEA 1KD1T 1RCOB 2YPYA 4ZP9A 2J9DA 3H2UB 2KXNB 1YJUA 1PIEA 4KO0B 2F4FA 3V5RA 4KTQA 2M0GB 3W65A 2XCPA 2YNIB 2FY8A 3VAMA 2RDDA 1WC3A 1HBNA 1OWXA 1WELA 3NRBA 4B9MA 1EJ7L 1U2RA 5HLFA 1NMEB 5A8KB 4KV8A 1B3TA 3M2VB 2NXEA 1ZTTA 4FN5A 1GTHA 2H4WB 1VQYA 1RTHB 4L73A 4O3RA 2E1PA 4YY3J 1MU2B 3EWGA 5ETMA 2UXDF 4DFKA 4NPOA 1BQXA 4QOTA 4LJMA 1BLUA 1KFSA 2XGPA 3S7RA 1URNA 5KG7A 3NOCA 3FJ2A 3PYGA 2IC3B 3C8YA 3W2WA 3POTB 1JXVA 1N5QA 3KLIB 4ZCKA 1Y5NB 3EPGA 2N3LA 3J81Y 3PHTA 1SC6A 4NXNF 3UDVA 1FX4A 3MFHA 2BRLA 2APOA 3G6YA 2IAJA 4J9MA 4OI1A 4J9OA 1LWFA 4FF4A 4R5PA 3WHIA 4KQZA 3V6HA 1K44A 2XO6A 4QYRA 3PJXA 2VOOA 1ZM4A 1XBWA 2WW4A 2LU1A 4USMA 4GC7A 1T9YA 3RUBL 1MSWD 4JI2J 1HA1A 2RRNA 3M6VA 2QA4S 3HULA 3THTA 3A12A 5IZHA 3KLHB 3GZ7A 4RNNA 1T0TV 1F2HA 4ERDA 3OHAA 2CPFA 2N3OA 3TAPA 1WD6A 1RZMA 4GO5X 4B9NA 3L7PA 4DL3A 2NUHA 4D3HA 1WJ9A 4P75A 2HHQA 2E66A 1R6VA 3E8OA 2VG7B 2EK6A 5C24A 2CJQA 2BYCA 1KHWA 2A18A 2DGOA 2JLFA 4E0DA 1SKSA 1H3DA 2CQGA 4DBQA 9ATCB 3K89A 2RQKA 3DMJB 3R7SB 1RCXB 4E2FB 1JKHB 4DPOA 1W2IA 4HT7A 2OPRB 3DLHA 3OUYA 3KJFB 2WVCA 3TA1A 3IN5A 5DJBA 3CGIA 2AJQA 1PAUB 2EFPA 3H2LA 4KFBA 4AL5A 4RX6A 2DGSA 1I3OB 3FRZA 3HJVA 3LALA 4IUFA 3UE2A 1DY3A 4ECUA 1IQZA 2CNKB 2G4BA 2KZMA 2R7OA 5K9FA 2UUBJ 2VOPA 3HXMA 1XMQJ 2BEFA 3MD3A 1VQ5S 4X4TA 1YZ6A 3ENQA 2CZ9A 3MR6A 2V2VA 3IWLA 1S9EA 1LW2B 4C8OA 1WG4A 4C8NA 2XYPB 2C2ZB 3C16A 5CHCB 5K8MA 1PJ6A 3KOAA 5B0AA 4DS4A 4HL9A 4RZRA 3BGOP 3M8YA 2YKQA 1AYEA 4RNOA 3KK1B 4J90A 4DQPA 2Y9HA 3MURP 3CDUA 4W90B 3M8QB 4HR2A 4CO0A 2ZEJA 4FYVB 1KR4A 5H9FK 2CQ0A 4H4MA 3R27A 3QIPA 2OKQA 5DDRC 1NJZA 3I9ZA 4JI0J 2PFDA 1F5CA 5A2QY 2OTJS 2VFSA 5HBMB 2C28A 4O3OA 4ID5B 2NREA 3KLFB 2MTLA 2YH1A 1JXEA 3IFEA 2L9WA 1U1QA 2OUGA 2RQ4A 5F3ZA 2PMZD 1Z4UA 4QIGA 5BR8J 1NH8A 2A2DA 2KL8A 2A10A 3FEXB 4DZ6A 4DQQA 5KG2A 3DN9A 4A47A 4QQBA 2AWZA 1XTZA 2M88A 3CCUS 5FLXU 2HS0A 1JJ2R 5DG7A 4DPTA 4X4NA 2RH3A 1DQ9A 4F02A 4CDIA 1X8DA
chains in the Genus database with same CATH topology
4C11B 4GKKF 2JFKA 4B9LA 1HQEA 2IAJB 2BJEA 3KHGA 3F73A 2ZH2A 2V9KA 4AE5A 4TY8A 5T41A 3HVTA 2QO3A 2KYZA 4R5PB 4FZVA 4LT6A 3HKWA 4PXCA 1FKAF 3L95X 2CQ2A 3RB3A 2XS7A 4YOEA 4MIWA 2M3DA 4EO8A 5B09A 3KLEB 3GSDA 2I0XA 3O1LA 1SJRA 2VD3A 1U47A 3CCRS 3SYZA 2H9ZA 2WSEC 4F4KA 2HGMA 4KT0C 5E5NA 4LVOP 4WKYA 4ZMMA 3EYZA 3VAFA 4E8UA 1SJ4P 1K73T 5T7LA 4WF9Q 4PWDA 3MMJA 3SQGA 1FVQA 5IXUA 3OLAA 4NLPA 2FGCA 2HS3A 4C3LA 4OX7A 4AUKA 2LEAA 4NX9A 2XLKA 3OL6A 1RT4B 5KG6A 2WONB 4WYWA 4RWXA 1JLEB 5KAKA 1WTBA 1GX5A 3D1QA 4X4PA 2R8IA 3PACA 2ASLA 3NCPA 3FFIB 1HI8A 5EWFA 1QSSA 4JV5F 4ED5A 1QE1A 3MEDB 2LDIA 1U24A 4RW4A 5I3UB 1TV6B 2Q79A 2XLJA 1OO0B 3TQ1A 3AQPA 3LW5C 2HRUA 2QFJA 4BC9A 4EYHB 2J9DE 2CJ9A 5B0GA 3DOKA 3DRPA 1E6VA 2KFYA 1T05A 2HVIA 2MQPA 3DYAB 3UCGA 4E98A 3O2IA 1UVMA 1MMNA 1B64A 3BO4A 4MYTA 2F8EX 4NA1A 4G1QA 4A8SA 1FKPA 1RP5A 1GXUA 2HPUA 1U1LA 3S6EA 2AJFE 4DL6A 4DSEA 2NZ4A 4Y2MA 2WB1D 3MOJB 1LV5A 3DLGB 3CEDA 1YSJA 1PSDA 4CO1A 4TU7A 2OJ3A 1MW7A 2L3MA 3TX8A 1VQPS 3IR6B 1RISA 1NKBA 4TN2A 4O3QA 4QWBA 4A8OA 3T5JA 1N34F 1CVJA 2HQIA 3TA2A 2CVIA 1DTTB 2YQ3A 1S1WB 3OR1A 2YKNA 1HWJA 2ZH3A 5J1PA 2KZZA 1OQ6A 4AXJA 4QCLA 2C3OA 1CC7A 3CSKA 3HHLD 3K5MA 5L1KA 1OSDA 3I0RB 3I0SB 2LKZA 4ITSA 1KQFB 2IMOA 1S0NA 2HHSA 4NZ6A 5LL6d 2DITA 1SL0A 4B3OB 1HMVA 1WHYA 3MEEB 2I38A 5L1JA 4LF7F 1HNVB 1L3KA 4QR1A 2VFRA 3ICLA 4I6AA 4BWJA 3GV8B 2IVFB 4DR2F 1E6YB 5DG8A 2FVPA 1X5OA 2YTCA 4J9LA 2MDAA 2GQ2A 4B3TF 1WEYA 4ZVGA 5K8NA 1QM9A 4DR1F 2ZH1A 4IG0A 4M95A 1C1CA 3AA9A 1U1OA 4QWEA 2LEPA 2QA1A 2ZH5A 4QU6A 2VBYA 3PEJA 1S6QB 2I5JA 2PO4A 3BGLA 1TFWA 1G7CB 2B56A 4IFYB 1TKZB 3DXSX 2CFXA 3DRSA 5C25A 2Q6BA 2R8JA 5GAGI 4QWDA 1YJNS 2AYMA 3LUYA 2IBKA 2FJDB 2HG4A 2GC8A 2XG8A 2MKJA 4R0JA 4KJIA 1RT6A 2OPPB 3KLGA 2DGQA 2IYIA 1X4DA 2Q3PA 4K2XA 4Y65A 2PFFB 3DNCA 1VQNS 5AE3A 5L1LA 1J5OB 3K7RA 5J2NA 2R7SA 1IKYA 1JLAA 3M8PA