4ID5B

Hiv-1 reverse transcriptase with bound fragment at the rnase h primer grip site
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
424
structure length
412
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
total genus 122
structure length 412
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4id5B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id5B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id5B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id5B03
1S6QB 1Z4UA 4KE5A 3BSCA 2ZKUA 4ED1A 3DRPB 1RTHA 3MEDB 4U7CA 3KK2B 4KB7A 2BE2B 2O5DA 4K4VA 2W9BB 1DTTA 1RA7A 4EEYA 3KHHA 1TV6B 3LP2A 4NLXA 2FJXA 1TL3A 1C1CA 5HROA 2WTFA 5J2MB 5J2QB 1XR5A 3I5AA 3T5HA 4RUCA 3PVXA 4Q8FA 2YKMA 4XO0A 5L1KA 1KHVA 4DL7A 3D28A 2R2TA 4NLQA 2HNDB 4KKOB 3CDUA 5CYQB 3NGDA 2IC3A 4RU9A 1KHWA 2AGQA 1IKVA 1S6PB 2XI2A 3N6NA 3DRPA 1FK9A 5DGBA 4IG3A 3KK1B 4MKBA 4ECQA 2R2SA 4EYHB 1HNIA 4KHRA 4MFBA 2HNZB 5F8IA 5C5JA 3PW0A 1TV6A 3DLKA 3LP2B 1I6JA 1JLBB 4M95A 3D5MA 5KG6A 4Q45A 4TY8B 3BQ1A 5F8HA 5HROB 1N6QA 4O3QA 1RT1A 3HVTA 1HPZB 3ITHB 4R8UB 3N6LA 2J6SA 1C1BA 4Q0BA 4MK8A 4JV1A 2UVUA 3JYTB 2D3ZA 2BQRA 3T19A 4TN2A 2DPIA 2JC0A 1TKXA 4J9OA 4WE1A 4ZP9A 1K1QA 4ZP8A 3GILA 5K14B 1IKYB 2V9WA 3HKWA 4ED0A 2OPQB 4I7FA 4URQU 5J1EB 5DQHA 1RTJB 5J2NB 3V4IA 4IFYA 3H5XA 1JLEA 3DLEA 5KG0A 4ED7A 3I0RB 1S1TB 4F4ZA 2CJQA 1XR7A 4RUAA 1C1BB 1DLOA 2FJVA 4Q0BB 2ALZA 2JEIA 3JYTA 1KLMA 1RTIA 3HVTB 3IGVA 3I0SB 5KFOA 2BR0A 1JKHA 2ZD1B 5EWFA 2GIRA 4O44A 4DL5A 2R2RA 2EC0A 3E01A 4WYWA 3V6DA 3KLFA 1UWBA 2VG6A 5KFHA 3V81A 4TLRA 2WOMB 4J9KA 1JXLA 4IG3B 3H98A 4H54A 4IDKA 5C24B 2AU0A 3BSOA 4WZQA 4GC6A 2WB4A 4IRKA 1JLBA 5HLFB 2D3UA 3N6MA 3PW4A 1SV5B 1BQMA 1C1CB 1HQUB 2VG7A 4GC7A 3HVAA 4NLTA 4DL2A 4X2BA 3KLGA 5DLGA 5F8LA 3HVWA 1S1VB 2I1RA 3TAMA 3UR0A 1HMVB 1VRUA 5KFCA 5DG9A 3BSAA 4F4YA 4KFBB 3LP0A 3KK3A 4YQWA 5DG8A 1RTHB 2UUWA 4O3RA 3GIKA 4FS1A 5CYMB 3SI8A 5EWEA 4TXSA 1FKPA 1S9GB 3RB3A 3LP1B 2HWIA 3BR9A 2ASLA 2WHOA 1EETA 4JUZA 2V0NA 4KO0A 2B5JA 2UUTA 1S9EA 4KSEB 2AGPA 2WCXA 1TKTA 2I5JB 4EO8A 1VRUB 1HMVA 3CJ3A 3GIMA 3G6YA 3ITHA 1RT1B 3GQCA 2J6UA 4EBCA 3Q8QB 1EP4B 1JLCA 4LSNA 3H2LA 2OPPB 1JLEB 1T3NA 3DYAA 4NLOA 2XCAA 3PW2A 3Q8PB 5J1EA 3DOKA 3KLEA 1RAJA 1RT2A 3DRRB 4RW4A 4ZHRB 2D7SA 3DI6A 4ID5A 4MIBA 5F9NA 4FS2A 2YNGB 2ZE2B 1IKYA 2J6TA 2FVCA 4ECUA 3DMJB 2WK4A 4O4RA 2HNZA 1VRTB 1QE1B 2B6AA 3M8QA 4TQRA 1N4LA 3LANA 4TYBA 1RTDB 4RW8A 1RT6B 2AWZA 5KFVA 3NBPA 3EPGA 3BQ0A 3OL9A 4EBEA 2XGPA 2OPSB 3H5SA 4NLVA 3OL7A 3GV8B 4IOBA 1HQUA 2IJFA 1SH0A 2JC1A 2AGOA 3FQLA 4QWCA 4DL4A 3SFGA 1TKZA 4DL6A 4OL8A 3DOKB 3KLEB 4J9LA 4K4SA 1S6PA 4MK9A 4RW9A 4IH6A 4R5PA 3MEEB 5F8MA 2ASDA 3H4DA 3KK1A 3OLAA 3BQ2A 2FLLA 3M8PB 2WOMA 2XI3A 5L1IA 5L1JA 2W9BA 2FVQA 2RKIB 5KT7A 4ZVFA 4HKQA 3IN5A 4NLSA 3QGIA 2JEGA 1C0TA 4IG0A 2BANB 4NLWA 5FDLA 3T5KA 2DPJA 3I5BA 5KFSA 4ECRA 2JLEA 1EP4A 1JLCB 1JLAA 1RYRA 5KFBA 4LQ9A 2RF2B 4NRUA 5KFJA 4WFXA 4I2QB 1HYSA 1S48A 3NAIA 2W8KA 2FLNA 2R2UA 2B5JB 5J2NA 5KFMA 4IR9A 3V6KA 2C28A 5C25B 5KFKA 1FKPB 1MU2B 2BANA 4F4WA 2ILYA 4ZP7A 3MFIA 3RB6A 3DOLA 3C6TA 3JSMB 1RT3B 1SH2A 1N5YB 2HWHA 3VQSA 4K4UA 4R8UA 2HNDA 1TVRB 4KKOA 3KJVA 3FFIB 3CWJA 4J9SA 4QWBA 3QIPA 4B3OB 3LP0B 3KK3B 4ZPAA 2VA2A 3PJXA 4J9NA 4Y3CA 2VG6B 3KLIB 5C42A 2FVPA 3H4BA 2IBKA 5J2PA 5L9XA 4URGA 1IKXA 5I42A 3OSNA 3CJ5A 3IS9A 2V4QA 1S97A 2R8IA 2R8JA 3OSPA 1RT7A 1S4FA 3V6HA 1R0AA 1D1UA 2IC3B 3C6TB 3NBPB 3JSMA 3QYYA 5KFAA 4RW6B 3Q8SB 4ECZA 3T5LA 5DG7A 1T94A 4K50A 2YKMB 2IMWP 1D0EA 5C42B 4O4GA 5KFPA 3E01B 4IRDA 1CSJA 2FVSA 2ZE2A 3QLHA 3KLHB 2GIQA 4NLUA 5KT6A 1S1XB 4I2PB 4Q8EA 2YNHA 5D3GA 1TP7A 3MEGB 5HBMA 2HNYA 3DLGA 5HP1A 4ECWA 2E9ZA 3RB4A 3BGRA 4O3NA 5KG4A 3KHRA 4ED3A 3LAMA 4MK7A 4QW8A 2YNFB 4O3OA 3UDLA 4ZPDA 3MTKA 3MECA 2IAJB 3QGGA 1N6QB 4NLRA 4WFYA 3G6XA 3IRXA 2W8LA 4KO0B 4TY8A 1QUVA 3KMSA 1QAIA 4O3PA 3DOLB 4NLDA 5T14A 4I7FB 2OPQA 2FJWA 4TY9A 3M9MB 4J9RA 4K4YA 3NMAA 1TKXB 1LW0B 1HNVA 2HAIA 3TQ1A 5EWGA 2ASJA 4F4XA 4LSNB 1SUQA 3FDSA 3H5YA 4ED6A 4WE1B 4G3IA 4KFBA 5HBMB 4R5PB 3PW7A 4ECSA 2WONB 1LW2A 3PHEA 3M8PA 4KAIA 1LWFB 3DLGB 1IKXB 5HP1B 2OPRA 2W9CB 3IG1A 5F8NA 4DEZA 3QO9B 3KHLA 5HLFA 4YR2A 1SV5A 3QGHA 4NCGA 2BQ3A 3GIJA 4Y34A 3OHBA 4XPEA 1FKOB 4ICLB 3FRZA 3GYNA 2UVVA 4NYZA 1IM4A 4YP3A 5KFTA 4YMEA 5KFEA 3KOAA 5CYQA 5KG7A 1JLGB 5KFQA 3FSIA 3V81B 1J5OA 3V6DB 3MF5A 4KHMA 2AQ4A 1RTDA 2YKNA 3DRSA 4EO6A 4ZHRA 3IS9B 4R0EA 4RW7B 1U09A 3MR6A 3OL8A 3DM2A 4KV8A 4PUOA 2AX0A 2OPRB 2E9RX 2R8KA 1JKHB 2ZD1A 1TL3B 3PZPA 4IDKB 3C6UA 1ZTWA 3M9OB 4M94A 4LSLB 4MKAA 1HQEA 3UQSA 2C22A 3UPFA 2IM0A 2IM2A 2OPSA 3MEDA 4EYIB 2XWYA 4KBIA 1S1XA 4I2PA 4DG1A 4ED2A 4K4ZA 4ECVA 3ISND 3KNAA 4YR0A 1ZETA 2YNFA 1NNDA 5DQIA 4RNNA 2B43A 2IAJA 4WZMA 5F8JA 3BGRB 5KFZA 2UVWA 4G1QA 1S0OA 5JXSA 2JEJA 1MMLA 4PWDB 2YNHB 5D3GB 5KFDA 3H5UA 2HNYB 2W7OA 5KFRA 4IQXA 4LSLA 1EETB 1RA6A 3TAMB 1HPZA 1C0TB 1GX6A 4IKAA 1S1UA 1WNEA 1SH3A 5KG2A 3RB0A 4NLYA 5CYMA 5KFGA 4H4OA 1JLGA 4Y2AA 3OLBA 3MR3A 3GV5B 1RT6A 1GX5A 4O3SA 1IKWB 5C24A 4IH7A 2W9AA 1XR6A 2E9TA 3SFUA 1IKVB 1QE1A 2BRKA 3CIZA 1JLFB 5I42B 1S0MA 5F8GA 4KV8B 5KT3A 5EUHA 2ILZA 4IH5A 4MFBB 1S9FA 3T1AA 5DQGA 1TKZB 1BQMB 2VG7B 3QIPB 4B3OA 4ZP6A 2VG5A 3RBDA 1S49A 2JEFA 4ZVGA 4O44B 5I3UB 3V6JA 1T03A 3GIIA 2YNIA 3FFIA 2RDIA 3OL6A 4ZVEA 3MFHA 3I0RA 4H4OB 4TYAA 4Q44A 3QIDA 1VRTA 2B6AB 1UWBB 3M8QB 3V4IB 4F50A 1LWCA 4FBTA 3IGNA 4MIAA 3CJ0A 3RAQA 3LALA 3HHKA 4PQUA 3DDKA 3OHAA 1RTJA 1MU2A 3PW5A 4QWAA 1TL1B 1RT4A 4WXWA 5KFYA 1T05A 1KLMB 1RTIB 2HMIB 4HYKA 3MECB 4DG1B 2BRLA 2RKIA 3CJ4A 3IRXB 2C2RA 5I3UA 5KFUA 4QWEA 3C6UB 4ZPCA 2VG5B 5FDLB 1HQEB 2RDJA 1T03B 4J9MA 2F8EX 3KHGA 3GV7B 1S1VA 1LWEA 2XGQA 2IJNA 1NHUA 2W7PA 1BQNB 1W25A 2UVRA 5KFIA 4O4GB 3DLKB 1LWCB 1FK9B 5KFFA 4JV2A 1OS5A 3FQKA 1S9GA 1S10A 4NLGA 5KT2A 1REVA 1JLFA 2ATLA 3KMQA 1RT7B 3LAKA 4TQSA 1JX4A 4NRTA 4RNMA 2IM3A 1DTQB 2AX1A 2IM1A 3H59A 1QAJA 5J2PB 2IA6A 4ECYA 1RT5B 1LWEB 4ZVHA 5KFNA 4IRCA 4H4MB 4WYLA 2CKWA 4J9PA 1NHVA 5KFLA 1J5OB 5EDWA 3PR5B 3MR5A 1LW2B 4ZMMA 3DLEB 5DLFA 2OH2A 1IKWA 2XCPA 3RBEA 4RW8B 3CDWA 1ZTTA 5KG1A 1N5YA 3Q8RB 3QO9A 3CO9A 1C0UA 4ED8A 3EZUA 3DYAB 4ECXA 4Q43A 3I0SA 5KFWA 4IFVA 1RT2B 3DRRA 4RW4B 2R8GA 2OPPA 1TKTB 3CDEA 3CVKA 4WFZA 2RF2A 1JLAB 3G86A 3QZ8A 5JUMA 3QZ7A 4QW9A 2YNIB 1N48A 3DM2B 2BE2A 4PUOB 5KT4A 1T05B 2HMIA 4XPCA 4PQUB 5KG3A 3TVKA 3M9NB 2VA3A 2GC8A 3LP1A 3NL0A 3DRSB 4YR3A 1RT4B 1RDRA 3CJ2A 5KG5A 4J9QA 4EBDA 4ZPBA 2XC9A 1N56A 4LQ3A 1C0UB 4RNFA 4URSA 4NLPA 4QWDA 3BSNA 3G6VA 1S1WA 3RAXA 3KLGB 4FBUA 3MEEA 3QLHB 3KLHA 2BQUA 3MR2A 2FLPA 1JLQA 3I5CA 4RZRA 1RT5A 3ISNC 4RW9B 3PR4A 3BJYA 2YKNB 4H4MA 1C2PA 4K4TA 2FVRA 3NAHA 4RW7A 1HNIB 5J2MA 5J2QA 3PJWA 1RYSA 2WONA 1K1SA 3IG1B 1DTQA 4JV0A 1S0NA 4Y2CA 4RNOA 1LWFA 2QE5A 4RW6A 5KT5A 4NZ0A 1S1WB 1FKOA 1HNVB 4ICLA 1R0AB 4RNHA 3H40A 3EPIA 4U6PA 4NCGB 2D41A 5L1LA 1SUQB 3ICLA 2C2EA 4QPXA 3DI6B 4ID5B 1S1UB 3KLFB 1S6QA 2YNGA 2V4RA 2R8HA 2C2DA 1BQNA 3DMJA 1JLQB 5DGAA 4I2QA 1HYSB 1DTTB 5K14A 3E51A 2W9CA 3KLIA 2QV6A 4MH8A 1DLOB 3KK2A 1TQLA 4G1QB 4WXOA 2WRMA 3MEGA 3NKYA 4DL3A 4PWDA 1YVFA 1REVB 1RT3A 4IFYB 1S9EB 5KFXA 4IFVB 3KLVA 1TVRA 1TL1A 1S1TA 1HARA 2I5JA 3KJVB 4K4WA 4K4XA 4IG0B 5F9LA 4ECTA 5C25A 3BREA 4IR1A 3T5JA 1LW0A 1JIHA
chains in the Genus database with same CATH superfamily
1NDPA 1B0VA 2M52A 1S6QB 4KE5A 5CCLA 2PEHA 4AUKA 2Z30B 1RAGB 5MLCV 3PRBA 4UT4A 3M30A 7FD1A 2EBEA 1DRZA 3KK2B 4OYOA 4K4VA 1X5SA 2Q43A 3DHXA 1SIWB 2W9BB 1YG0A 4JV5F 3SMZA 3R5AA 3LP2A 1OSCA 1IUJA 3MCMA 3GG1A 4CM0A 3RU0A 3AFGA 3NNCA 5B0FA 5ETQA 3MM8A 1RAFB 3FK4A 4QR2A 4WP9A 3VVTA 1NKEA 4RUCA 3PVXA 1EQMA 2KZZA 2W4CA 4Q8FA 4XO0A 5L1KA 4LFBF 1AXQA 1JXEA 2EG1A 4A8FA 3PFEA 3BGUA 2KI2A 4RU9A 1FERA 4XDDA 1IKVA 4CH1A 3N6NA 3W62A 1I1GA 2PIIA 5E3RA 2APOA 1SI9A 2CG4A 4DR5F 4OI0A 3CCTA 1YK9A 3DGVA 4XTTA 3CC2S 4EYHB 4MFBA 2PMWA 3LP2B 1I6JA 2DH9A 4PXEA 1JLBB 3BQ1A 4Q45A 3HD2A 5F8HA 2I2YA 1WI6A 1FNMA 2R42A 1HPZB 2VB6A 3KJQB 4MAKA 2KJWA 3F56A 2E66A 3N6LA 3TX0A 4JV1A 1FA0A 4MK8A 1RHMB 1UEUA 5K8MA 3JYTB 3EICA 5KAKA 2UVUA 1FESA 4LF7F 2DPIA 4JI4J 4WBFA 1HW9A 2IIHA 3GE9A 3IC1A 5B0DA 2VUGA 4ZP9A 4ZP8A 5E7OB 5K14B 2CPIA 3QFWA 1N5TA 2ZHAA 2Y1LB 4X4UA 3H8YA 4WKRA 4UZCA 5G0RB 2GHVC 5J2NB 3MMCA 1M1HA 3PYFA 1X5TA 1RQ0A 4W92B 3IO1A 3H5XA 2QJ3A 1M5SA 2CWKA 1PAUB 1OY9A 2CJQA 3JTPA 1TL7A 1BLUA 2DB1A 2H1YA 3Q2TC 1RTIA 3EMTA 5ETNA 2HFUA 1WF2A 2J8SA 2DITA 4HL9A 3TA0A 2V4JA 2YQ1A 3MM7B 4UOHA 4ZOSA 1NU4A 2J7KA 1WHVA 5HL7Q 2I38A 1UWBA 2VG6A 2CYYA 2HAFA 4CLKA 2O1PA 4MYUA 3V81A 4TLRA 5D4OA 5KFHA 4JI6J 1QAYA 3VGTA 1JXLA 2WSFC 4USUA 2AJ4A 5AXMA 4H54A 1RWPB 4HT7A 3M6UA 2P6TA 4I4BA 1B64A 2HURA 3KWMA 1JLBA 1HNWF 3R2DJ 1KD1T 3X1LB 5IT9U 4DFKA 2V4JB 1SV5B 3R5JB 2IY5B 1FJGF 4GC7A 3PTWA 2UV8G 3HVAA 5DLGA 2UXDJ 5F8LA 3M32A 3PO5A 1F9FA 4UF4A 4DLEA 2QFIA 1LQ9A 4QBUA 1HMVB 4DSFA 4KFBB 2QZ8A 3CJKA 3EVOA 2VC0A 3LH2S 2UUWA 5DG8A 3GIKA 4O3RA 2Y9HA 1WUUA 4RL1A 2PN6A 4E0DA 5EWEA 2RB7A 1HKAA 1SCJB 2HQDA 1S9GB 3BV8A 3IR7B 1U2CA 4JI0J 5LSRA 2MZ1A 1M1KT 2XMJA 3AQOA 2CG8A 1EETA 2VFSA 4NE9C 3ELHA 5H1SV 4DXLA 2DHSA 2E44A 1PJ5A 4GO7X 2RRAA 4QU7A 2CZ4A 1FDBA 4OYXA 2XBPA 1R31A 1U0HA 3GQCA 3LGMA 4J37A 4EBCA 1XMQF 3EGZA 4LSNA 1U24A 5E3CA 1S6UA 3QT6A 2XCAA 4B08A 2FC9A 4DQSA 1RAJA 1RT2A 3W9HA 2ZZMA 4ZHRB 2AF6A 4FS2A 4P6QA 1VJWA 1T02A 5HQMA 2YNGB 2XM3A 2UUBF 1X4FA 2YWKA 1WD6A 2HNZA 1VRTB 2HLTA 3T1YJ 3GJTB 5K5MA 3LANA 1JJHA 2NYHA 1NPRA 2MJUA 3FJ2A 2CPFA 1M90T 2AWZA 3NBPA 2EEYA 3IR6B 1GT8A 1YBTA 2OPSB 1CULB 1F5CA 1FFGB 2ZNZA 3H5SA 4HHUA 1SXLA 3OL7A 3HP6A 1TK5A 2MPUA 4IOBA 2DR9A 3R5CA 3HJVA 1PJ7A 1FXDA 2EFNA 2VPWB 1X8DA 2E1AA 5AXNA 2AGOA 2CVIA 1HBNA 1H98A 1YDLA 1X4BA 2KT2A 3E8OA 3C16A 4OL8A 3NS6A 4J9LA 2DNMA 3HI9A 2K2PA 3MEEB 3UVJA 3WHIA 1ZM3A 3KK1A 2DGSA 2J0XA 2M2BA 5GMEA 2ASYA 5LT5A 2WOMA 3AA9A 5L1JA 2HK2A 2FVQA 3KUHA 4LF2A 5ETLA 1Q8KA 3D7SB 6FDRA 2HQCA 5D0EA 2NUUG 4ZVFA 5KT7A 2QA4S 2RT3A 1MNEA 1OYDA 1RBLA 3C15B 3UN5A 4LRCA 2DBBA 2HGMA 2JVRA 4QQBA 2B4OA 2X3DA 2F9JA 4C98A 4DV0F 3UCUP 3LO3A 4U95A 3R2CJ 2EG2A 1FTCA 3V4MA 3T5KA 2DPJA 2XSFA 3I5BA 5KFSA 3T6JA 2C3YA 5A8RA 3M8WA 3UN2A 4IOCQ 4B9VA 3K7RA 4NXMJ 3R97A 1RYRA 3D1OA 5KFBA 4OHYA 1U8WA 4LQ9A 2RF2B 1B0PA 1WACA 2XNQA 3OFFA 4RBTA 3EGVA 3NAIA 3KG1A 1TL5A 1O6XA 3P5TL 2G0JA 3R5GA 2CVEA 1RCXB 2KN4A 2Y3YA 2HFOA 2YKPA 1Y5NB 1SKUB 4NI2A 4O23A 4F7VA 5B08A 3POTA 2BANA 3ADAC 4F36A 2J9DA 2R4FA 4DSEA 2LECA 3UD4P 2ILYA 1PYOB 2C3OA 3C6TA 3JSMB 1RT3B 1NCLA 2AV5A 1N5YB 1G2EA 2W24A 4R8UA 2HNDA 3ZZUA 2BW7A 3EGNA 3SYZA 4A8WA 4BS2A 4B9MA 2CAJA 5HK4A 2KYXA 3QPIA 4V1Ak 4C7QA 1N34F 3GJRB 3DKDA 3PJXA 2X7IA 1FWKA 3MD1A 2AZ3A 1RZMA 4L75A 2LFVA 2HVEA 4ZCKA 2JLGA 1H7WA 4C8ZA 2HG4A 4JV5J 1VMBA 1JQGA 5LSOA 4HT5A 3HVRA 2Q6BA 4QIWD 1Y7PA 3K8WA 2YWWA 3I96A 2V4QA 2ZZTA 1YJRA 2XHWA 3RW7A 5IV3A 1H38A 1N32J 3OSPA 1S4FA 4OLOA 2ZH1A 3HK2A 2N3OA 2IA0A 2CDRB 3C6TB 3JSMA 4OI4A 3QYYA 4X62J 2CPXA 3MOZA 3OTEA 2HS0A 3NGTA 3T5LA 2UUAJ 3M1VB 1CQNA 1VK8A 2OFGX 5DG7A 4K50A 1RWKB 2GJ2A 5ADZA 5HJYA 1U1RA 1WJ9A 2XSJA 3OXLA 4TNOA 5LMNJ 3QLHA 3BDEA 2V8GA 1SC1B 3RR8A 3MEGB 2Z2ZA 1XQIA 3RRGA 3NCRA 1YGYA 5C7PA 3BGRA 2M7SA 1NPKA 1UVMA 2QA1A 4MK7A 4O3OA 1ZA1B 3VAJA 4WFYA 8AT1B 2FY1A 4C0BA 2W8LA 1VCTA 4WFAQ 1QAIA 4O3PA 1ZAXA 3DOLB 2OPQA 2FJWA 1RP5A 4TY9A 1K9MT 5IC6B 1LW0B 1HNVA 1H2UX 1VRQC 2B9EA 4ZLLA 2DK2A 2LQ5A 3BZQA 4C0HA 2V8PA 3K17A 4M5HA 4WP8A 4AQYF 4HVZA 1YJ9S 3GCXP 3PW7A 3O44A 4XIUA 3R1LA 3M8PA 3IAM9 4X4RA 3M8ZA 4LSZB 1FT8A 2ZM6J 3IG1A 1FE4A 2VPZB 2CRLA 2DGWA 3FZ2A 4P7TA 1YX2A 1HA1A 3QO9B 2FHKA 5F8NA 2C2MB 4M1KA 4PXDA 4OX7A 3W61A 4BLGA 1FJCA 2FC8A 4FXDA 4F0MA 3JSYA 3OTOF 2WVFA 3GYNA 2UVVA 2KU7A 1YZ7A 2O66A 5CYQA 2ALYB 4YB5A 3FSIA 2XZTB 1TMMA 2FGCA 3LF0A 1J5OA 3V6DB 3NLCA 5IT4A 2CPHA 1RTDA 2YKNA 3A8IA 3IRWP 4ZHRA 1A9NB 4NA3A 1RWNB 2PD1A 1U09A 3EVWA 2AX0A 4DV2F 2E9RX 4PG8A 5L9NA 2XY7A 2J0QD 1TL3B 1NZ8A 4WKYA 4M94A 1RHUB 4UY85 2OD6A 3W5XA 2ZHOA 1HQEA 2IM2A 4CLWA 2N82B 1U1OA 3RR7A 2UXDF 1H3DA 3M8SA 2R7XA 1T9YA 5T7LB 4EYIB 3MPWA 1NRKA 3NOCA 4ECVA 2D9OA 4WIIA 3GFHA 4CYUA 4B17A 1KQFB 4K2XA 5FLXY 3EXYA 3J7ZT 2FZGB 3A1YG 3JSBA 4YR0A 4LF8F 2Q79A 4F4KA 1FCAA 1D3WA 4H4KA 4J7CA 5JXSA 1MMLA 4I6AA 2D74B 5D3GB 3MMAB 5HQLA 4DV4F 3Q8YA 3BN7A 4IQXA 3IBWA 1NK7A 1LWXA 1MMDA 2DO4A 2MY8A 3AB4B 3H2VE 2ZH5A 4CO3A 1AFJA 2KTQA 4KH0B 4IKAA 1ZS6A 3O6QA 1LXNA 1UETA 1WNEA 1QSSA 2R7TA 3M6WA 1WG5A 3CT9A 1DQAA 4DUTA 4CLYA 3OLBA 3RRHA 3Q22A 4O3SA 1IKWB 4WK1A 1OO0B 5C24A 2LXUA 2ZH4A 2R7VA 4GKKF 4LF5F 1MROB 2YKAA 5I42B 2H51B 3M2VA 2QX0A 4PPDA 3POTB 1CS4A 1TKZB 2CQIA 1HNZJ 1NDCA 2CPJA 2Z56B 1BQMB 5IC4B 3QIPB 4PCQA 3PKMA 1Y3KA 2F40A 1EJ7L 2MGZA 1RI7A 5I3UB 3CPWR 2HHXA 2GS8A 3ENQA 4ETZA 4HHJA 4EZ6A 1KN6A 3OXGA 3MFHA 2XLKA 3UWTA 1RB0A 2DXFA 4DF4A 1LWCA 1SL0A 4NYPA 3M30B 1I94J 1VLYA 2RJZA 3CJ0A 3LALA 4DV3J 2ZDPA 3JQJA 3MM8B 3DDKA 1RTJA 1TU0B 1Q5VA 4U7UK 1TL1B 3HSZA 1V5IB 1RTIB 2ZH7A 3N79A 3D6TB 2K3IA 4C3MA 4HYKA 2BRLA 4DG1B 2DH8A 2RKIA 3H42A 4FPIA 4OJ3A 3IRXB 3BPDA 5I3UA 4LRAA 4WCEQ 3MUTP 2C2RA 3T6BA 3BDPA 1LEOA 1SC3B 1HQEB 1VGYA 2A2DA 3C19A 1T03B 1U6FA 3MCSA 3KHGA 1NJIT 1RACB 1WOOA 4J5OA 1RAEB 1ZAVA 4OZ2A 1BQNB 1W25A 3VGSA 2W7PA 1EIYB 2UVRA 1RWVB 1FVQA 2RHQB 1LWCB 3L3CA 1T0TV 3ZNJ1 5IT9Y 2DGQA 2HRUA 5LXYA 1QAXA 2V67A 4FYYB 3D0IE 1OS5A 3L09A 4PWUA 4EWTA 5E3PA 4B3SJ 4NLGA 2HHWA 2ABYA 3IWLA 4ZJQA 4OI6A 2V5HG 2F8HA 3BS9A 1UFKA 4M5DB 2CDQA 4TQSA 2DNRA 3WX8A 3CDBA 2XYHB 3G6XA 3TZYA 3J81U 1SQFA 1PCAA 4X66J 2F4VJ 1ZBTA 4FYDA 4B3TJ 3J7A1 1SKSA 2L9WA 1YJUA 1ZOTA 1QAJA 1RGVA 3D1HA 3H59A 3QQCD 3SDEA 1UA0A 1RK8A 2Y0BB 3FCHA 4USHA 3G96A 3MMJA 4CM2A 2IRYA 2KHDA 4ZVHA 3J7YU 2WVEA 1EAYC 4DFPA 2CKWA 4P73A 4OX9J 2C3PA 5EDWA 1KWMA 3PR5B 2GO8A 2YKOA 3BPSP 1RXOB 5DLFA 4ZMMA 2G0IA 2OH2A 2MY7A 1KQGB 3ZZ0A 4DZDA 2R7WA 5JMNA 3I9ZA 4X4QA 2IMOA 2V68A 3CC7S 1XNQJ 1ZTTA 1N5YA 2P6SA 2CJAA 2OO4A 5AJ3F 3Q8RB 3QO9A 2DRAA 2R7UA 3W8PA 4P9SA 1WC5A 3EZUA 3MHYA 4ED8A 2UUAF 3GP9A 4F2RA 4X4OA 1RT2B 2MZRA 3BKTA 2HYIB 1TKTB 3MPVA 3I9V9 3GR0A 3QZ8A 5JUMA 3QZ7A 2VDHA 1VQ8S 4LF4J 1N48A 2BE2A 5KT4A 1B70B 5KG3A 1GTHA 3LP1A 3CXCR 4YR3A 5SUHA 4KGXB 1RT4B 1TL4A 2QC3A 1XIQA 4J9VA 4J9QA 4EBDA 2B0GA 4TU8A 1HBOA 2MTLA 1J5EF 3OT9A 4JI5F 2R3VA 3TEHB 2RS2A 5FLXU 2VFTA 3T1HJ 1UVNA 3BSNA 2NLWA 1S1WA 3RAXA 1SJFA 3DDIA 1L5UA 2DNKA 1UVIA 3QLHB 2FIUA 1N5VA 3B82A 1JLQA 3I5CA 5LL6d 1MSWD 3SSQA 2HHQA 2OTLS 2ZWOA 2F5GA 2XZDB 1GMWD 2IVYA 1SPBP 3BB5A 3BJYA 3NS7B 1C2PA 4K4TA 1RAHB 3NAHA 5A0YA 4A8QA 1RABB 1H7XA 2JX2A 2DGOA 2VD3A 4RUBA 3LPYA 5J2QA 3TUPA 3IM8A 3PJWA 2WONA 2G4BA 3MR7A 3F0NA 1H73A 1TTHB 4LIRA 3D3BJ 1Q16B 3C14A 4RW6A 2OSRA 2VH7A 1S1WB 1HNVB 1EHWA 2J9EA 4G1IA 4ATNA 2J0WA 1IR0A 4K5RA 5A6WA 4NCGB 5I3QA 3CD5A 1N0UA 1XC9A 2CZVC 1RLDA 1MWZA 2CQHA 3DI6B 1MG7A 3DCAA 5KOWA 1S99A 4ES3A 1BQNA 1Q78A 3KG4A 4UY8T 1WC4A 5K14A 1CJUA 1G7CB 2RNEA 3E51A 4Q7AA 4UUXA 2W9CA 4MH8A 1BQXA 1YQHA 2DXDA 1U1PA 4HH1A 4KIAA 1N36J 2IJRA 1YVFA 2Z58B 2XTJP 3UDCA 1RT3A 5KFXA 2NPIA 1R27B 1VLOA 3A8EA 2QL9B 3JTOA 4LRBA 3B8HA 1TVRA 2OP5A 3AD8C 1HARA 2RUGA 3H20A 1V3SA 3PO4A 1KBRA 5CH7B 5ETSA 1QJHA 1JIHA 2M9KA 1NSKL 4UOGA 4DR2J 5IWAJ 1F9EB 4OZ0A 4NMXA 2QLBB 4QU6A 1JXVA 2EKYA 2A0FB 3JS9A 2B9WA 2QEXS 3BSCA 2ZKUA 1IWGA 1VQMS 4ZK7M 1RTHA 3MEDB 1KR4A 3I32A 4U7CA 4LF8J 2LQBA 2OKQA 3UFCX 1RA7A 1NM2A 5D77A 2MXYA 1M5KC 4GKJJ 2GCFA 4NLXA 4OZ3A 3QMQA 2I6WA 1TL3A 1R43A 1T95A 5CZVA 2V2KA 2WTFA 4DV4J 5J2QB 1PJ6A 1WELA 1XR5A 3I5AA 1HR0F 1SQGA 2QG9B 1OMSA 2LA6A 3HHNB 4L6V3 1FDNA 3TA2A 1KHVA 2QA2A 2XS2A 2F1FA 2G2YA 3CDUA 1N8RT 3MM9B 2HPUA 1CJKA 4HI2A 4L3NA 2OEKA 4DUYF 3PX6A 1VISA 1ROFA 4X64F 1S77D 3DRPA 5DGBA 4UW2A 1U45A 2XS5A 4YOEA 1M1GA 3W65A 4NI2B 1MN9A 4ECQA 4F26A 1HNIA 3PW0A 2HNZB 1JMTA 1DY3A 2HBQB 2HRYA 2H54B 2JWNA 2LQJA 2O67A 5C5JA 1V3RA 3P96A 4BWJA 4TY8B 2QGFB 3HZEA 2RD5C 1IBMJ 2DNYA 3HFZB 1N6QA 4O3QA 4NXNJ 2BKOA 2JH3A 3AA8A 3ZTSA 3AOBA 5D0RA 4R8UB 4K2JA 1C1BA 4Q0BA 4X65J 1HNZF 2M88A 1GNKA 3GYGA 2XO7A 2D3ZA 4AXJA 3AD9C 4TN2A 1KQKA 4CI0B 2ZH3A 2XZWA 1TKXA 1IBLF 2CQ0A 1BC6A 3AAWB 3GILA 2UP1A 2B7BB 3MAHA 4MMOA 2MKKA 2SXLA 3Q8SB 4IO9Q 4JI2J 2WAQD 3GG0A 2YH1A 4ILLA 5IM0B 2DHXA 4DPYA 1VS3A 9ATCB 3NWGA 3V4IA 4IFYA 4YY3J 2YVSA 4ED7A 1U6ZA 1S1TB 3JB9k 4GVBA 3F73A 3DXSX 2MKCA 1XR7A 1F1BB 4WIQA 4J9OA 1X31C 1C1BB 4Q0BB 2FJVA 4WJBA 1RKJA 2E5LF 3SV3A 1VQOS 1DZ5A 3QJJA 1FXLA 3I0SB 3BKUA 1JKHA 2ZD1B 4X4SA 1K0VA 4OYAA 3DDNA 2R2RA 2BJDA 2EVZA 3PEJA 4K8RA 2PSZA 3RZAA 5A8KB 2MMYA 4CLUA 3K0JA 2ZHBA 3V6DA 3KLFA 1KVKA 3M1VA 1Q8LA 3G2XA 1Y5LB 4FPRA 4C8OA 3QWPA 1SL1A 2WOMB 4QCLA 4FP9A 5AE2A 5LJ3Y 3CSKA 1S6OA 2ROEA 3K5NA 4DV7J 2VPYB 5D0HA 4Y65A 2P9GA 1TMJA 3EM1A 2M5YA 3U02A 4CO1A 2KG0A 1RU1A 4CLTA 4GC6A 2AJ2A 3HHLC 4FZVA 4DUZF 1B99A 1Y00A 3R5DA 4FVCA 1H2VZ 2NZ4A 2VG7A 1HQUB 3TX8A 5B0CA 1YTYA 3AODA 2ZOGA 4X2BA 4LFBJ 3EZ5A 1VQKS 2CQ1A 4L74A 4BHQA 2I1RA 5B7WA 2W2PP 4QIGA 3DFEA 5DG9A 4WFNQ 1OPZA 2M8HA 2XB2D 1FNXH 1Q82T 1RTHB 2KKHA 3PG9A 2C1EB 2MSTA 4PXBA 2DY1A 1UZDA 4DR5J 2CJYB 3SI8A 1KVIA 3I87A 4DS5A 5DM6Q 2ZFHA 3OUYB 2IPOB 3MDFA 4IRKA 2ASLA 2X1GA 1AZSA 1TAUA 2MLZA 2CPYA 2LDYA 2J7WA 3ONQA 3QSIA 1Y4ZB 2G1DA 2V0NA 5EX3A 4JUZA 3BYPA 2VICA 2VONA 5DZ7A 3S8SA 1NPPA 2WCXA 2ZBRA 3CD6S 2CNNB 4UUWA 2I5JB 4P2FA 3U1NA 3CJ3A 4M63A 4ZCIA 3GIMA 1WC1A 1NKBA 2F63A 3Q8QB 5GAGI 1MWYA 1JLEB 4CT8A 3DYAA 1FRXA 4NLOA 3Q24A 3PW2A 4LFAJ 4USIA 5J1EA 2D7SA 4NCAA 3DI6A 2HHPA 2L3MA 1A6LA 3ETOA 4MIBA 2ZE2B 1IKYA 2J6TA 4LF4F 3DMJB 1YRUA 4O4RA 3AXMA 3M8QA 2GFFA 3RBXA 1FNOA 1QD1A 2M70A 1RADB 4TYBA 2KDOA 1RTDB 4RW8A 1Y10A 3Q8PB 4JI1J 2BA9A 2MHNA 3PRDA 5BYRA 3R3TA 2J76E 3BQ0A 2KG1A 2MQMA 3UNGC 1XBWA 2DNPA 2CQ2A 4N76A 4UOCA 4QYZK 2N3LA 2P9EA 3J81j 3EX7B 1FRKA 4P2XA 4DN9A 3KFWX 2MKYA 4QWCA 3DOMB 1HD1A 2NXCA 4YUDA 2RHSB 4P7VA 3O8WA 1LFWA 4JI6F 1FJ7A 4K4SA 1HFEL 1PBUA 4Q2LA 3P8BB 1RU2A 4R5PA 5F8MA 1S0VA 1GXUA 2FLLA 3FCVA 3M8PB 1EZZB 2GV1A 3LGHA 4WTOB 5L1IA 5B0EA 2ZUGA 2JNJA 3NCPA 3VGUA 1VOMA 1AA1B 2ZBQA 2WBRA 5DRKA 3BYRA 2A1BA 3IN5A 3U1LA 4Z37A 2JEGA 4PG7A 1HD0A 1H0HB 2BANB 4NA1A 5BR8F 2F9DA 4LR7A 2XO6A 4NLWA 2VKZG 2HLUA 5A8KA 3GFZA 3TQEA 1U1NA 3QRPA 1N0VC 2RE1A 2G9OA 2ATCB 1JLAA 1UWAA 4OHVA 4CLLA 1CVJA 3ZNUA 3BH7B 4WFXA 4JI0F 1QVFR 2V8VA 2YXLA 1S59A 2B5JB 1YRTA 1R0CB 2E29A 3HFKA 3MM6A 1KFSA 5C25B 2NS1B 1MU2B 1Z1ZA 1WKLA 2AYEA 3OPKA 4RWXA 4DV1F 3J7AN 3F44A 2AKWB 2C3MA 2V94A 3ILIA 3LGNA 1NH7A 1DFDA 3MUMP 1SH2A 2HWHA 5H9EJ 4K4UA 2FUG9 2GAGC 3KJVA 2DNLA 3CWJA 1RHKB 1KSPA 1XJWB 3TA1A 3CCZA 4Y28C 5EX0A 3QIPA 4ZPAA 3LP0B 5L38A 2ZVIA 1IJFB 2E7VA 2VA2A 2L41A 2I9SA 2YBVA 1WF1A 5C42A 2FVPA 4NPOA 5L9XA 1RHRB 3NCQA 4X4PA 5I42A 4AD6A 2GGPA 3HHEA 4EU0A 3IFEA 5LXRA 3CJ5A 5M2UA 4U67Q 2UXBJ 2BE9B 4RU2A 2CXEA 4K0KF 4BBYA 1RT7A 2ZJQQ 5DM7Q 2DH7A 1IBKJ 1R0AA 4K7QA 1N33J 2BUNA 2IC3B 2WBMA 2ZWPA 4OHZA 5KFAA 2V50A 1NK4A 4YS2A 4ZLJA 3TVYA 1PAEX 4FVMA 3DXBA 2YKMB 5DJBA 2UXCF 2LMIA 5C42B 2LDIA 3S1TA 3E01B 4DWIA 1CSJA 1X4AA 3CJQA 4HDGA 2ZE2A 3KKFA 3AQPA 2GIQA 2LLZA 4NLUA 1U6BA 4Y2IA 5D3GA 2EKNA 3MMAA 3AXKA 4P10A 1IJEB 3CB4A 2HNYA 5HP1A 3W8GA 2XNRA 4ZDNA 4XAKA 4O3NA 3KHRA 3LA0A 3J80U 3RB4A 4DR3J 1H6KX 2ZOFA 4ZPDA 1AW0A 1RISA 1RWWB 1O8BA 2O3DA 2OI2A 3M7VA 3HHLD 3HFVA 3QGGA 4P52A 1S7HA 4X65F 2YX4A 4DQIA 2GIFA 4JI7J 1HNWJ 1RHQB 4NLDA 2UUCF 1SJ1A 1U0SA 5GAHU 4K4YA 3NMAA 4ED5A 1WHWA 1TFYA 3MEKA 3GB0A 1MWQA 1SUQA 2W7AA 5THWA 2IBOA 3PACA 4NOHA 4WE1B 2LXIA 3UNYA 4OI3A 5HBMB 4A8MP 4R5PB 2FJAB 3SZ2A 2XY6A 1FX4A 4DX8H 1YKWA 2HS3A 5HMZA 3CCRS 5GAHI 1L3TA 4W90B 5HP1B 4LR8A 1WHYA 1S4EA 2OPRA 3SSRA 1CS4B 3MMBA 4PR6A 4OZ5A 4W98A 3A13A 1M5HA 4YR2A 1NK0A 1SV5A 3QGHA 2BQ3A 2X1AA 3LW5C 3G9CA 5LOQA 2HBYB 1FKOB 4ICLB 3A3OB 1KFDA 3M2VB 3L7UA 4GRSA 4OMFG 4ZVTB 1PO6A 4CH7A 1BWEA 4HDHA 3B78A 1BHNA 4FNHA 4FKXA 4M5GA 5BXIA 3TZXA 5KFEA 3THVA 5KG7A 5IXUA 4WU3A 5KFQA 4Y00A 1ZAWA 3LUYA 3THPA 2V8DA 2XMMA 3MF5A 5B09A 2W4DA 4DV7F 4FNIA 3IS9B 4P2MA 3UI3A 4CNYA 1UVKA 3W63A 3MR6A 4PUOA 2LEAA 1URRA 3ET6B 2OPRB 3DU6A 3WX4A 1ZM4A 3MMBB 3BF4A 2Y1IA 1GEHA 4IDKB 3PZPA 4DPUA 4WF9Q 2QYGA 1VBKA 1VQYA 3L7PA 4LSLB 1WOPA 3P3DA 4MKAA 1WI8A 3UQSA 2KZMA 3MCNA 1U0HB 4DPTA 2DHAA 3UN3A 2VQEF 4KBIA 1S1XA 4I2PA 2IDEA 3ISND 2J8AA 3D0HE 2NCKL 3KNAA 1HBMB 2YNFA 4ZVSB 2KVIA 1NNDA 4RNNA 4M5IA 2IAJA 4NMLA 1PILA 1RAAB 5FIIA 2UVWA 4G1QA 1S0OA 3QGPA 4PWDB 1FRHA 2AMCB 2MZQA 2W7OA 2HNYB 1SJ4P 5KFRA 4LFCF 4LSLA 4N7TA 1OQ6A 1GX6A 4BCAA 1HLWA 1FRMA 4WFBQ 4DV6J 4FYWB 1Q95G 5KG2A 1BUXA 4NLYA 1FI4A 1HI8A 2EFPA 5KFGA 5JJBA 4JB8B 4H4OA 4OX8A 1U48A 2ZUAA 2MYFA 2VOPA 5L8RC 3VALA 1RT6A 2QLWA 1GX5A 3ENWA 3VAMA 1HNXF 4IH7A 1AROP 1XR6A 1WG4A 2MKHA 2W9AA 1QE1A 2BRKA 1X4EA 1ZA2B 3T3FA 4C9DA 2B56A 1UEKA 2DNZA 1QDUB 2FJBB 4CO0A 3CD7A 2ILZA 2CJ9A 2QSFA 3W2VB 5LJ5Y 1S9FA 3NNAA 5DQGA 3L95X 2LP4A 3G6ES 4KPYA 2YWHA 2VG5A 4A48A 3PDNA 1FEHA 2B3TB 2GMJA 4ZVGA 4ZVQB 4O44B 3ZTQA 3RBDA 1FO1A 1T03A 1YI2S 4B9SA 1KTQA 2GJIA 3OL6A 2AIRB 4ZVEA 3ZTPA 1YJTA 4H4OB 2FHMA 2ZNYA 3M2UB 1VRTA 4PAAA 5D6GA 3V4IB 1CEZA 1ULRA 2QLFB 1A0OB 3KJNB 4FBTA 1UL3A 5D4NA 2EFOA 2F7VA 2KHCA 5DDQC 5GAGU 2R9LA 1P8GA 4Q5VA 1RE1B 2AP6A 2B51A 3OHAA 2GJFA 3NGUA 3MPYA 3IBFB 5KFYA 1T05A 2HMIB 2V2QA 3A3PB 4XK8C 3K59A 1N32F 3DGPB 2WZ1A 4CLSA 3B54A 5IQ6A 3C6UB 5HN0A 2VG5B 2LYVA 5FDLB 1DURA 4ZN3A 1KS2A 1LNQA 4KPCA 2MB0B 3OVBA 4J9MA 4OZJA 3LWMA 2KL8A 2EFQA 2XGQA 1NHUA 1NJZA 1CLFA 5KFIA 2D9PA 3ZC4A 3CCUS 3ZZTA 3DLKB 5F3ZA 3I56S 4C4WA 4JV2A 1LK7A 2DY9A 4LIWA 2LEPA 1S10A 1P9QC 3TYTA 3LPEA 3W64A 4N56A 2ATLA 1C4AA 3KMQA 4MT1A 3HHDA 3BM7A 1VR6A 4NRTA 5BYSA 2DISA 3P4UB 2BVZA 1VC6A 3C14B 1Y3JA 3RAMA 3L9ZA 2FTRA 5HSPA 1IR2A 1FRIA 2AX1A 2UV8A 3TW0A 3MUVP 1YIJS 4ES2A 3MPDA 1BE4A 1YRXA 2BJ7A 2FGOA 3RUBL 3G8TA 3JSRA 5KFNA 3AJ2A 1WWHA 4L73A 1KQSR 3DC2A 5DDRC 3ZZPA 2RQ4A 1X9WA 3IP0A 4I0WA 4KHPF 2FD2A 3MR5A 2VJVA 1U8SA 4FF4A 1YSJA 1FFWB 1D9DA 2UXBF 3ZTOA 4DCJB 1B7YB 2DXEA 1ZYQA 2DNOA 2PT0A 2ZM6F 3RBEA 2DCLA 2H5IB 2VDIA 2DEIA 5KG1A 3QSYB 1VQ9S 2BOPA 1FJEB 1C0UA 1R8HA 4USMA 4CNZA 2Z2MA 2KFZA 4Q43A 2HHSA 3K5OA 2R8GA 1MMNA 3UCZP 1FRJA 2MLYA 4QIVA 2MQNA 2RF2A 4C8KA 1TUWA 4KH1B 4OX6A 4CTAA 3HM9A 2DRBA 5D8HB 3FEZA 2JSXA 3DM2B 1R7IA 4DBQA 4NA2A 5E0OA 4V19X 4DV3F 3M9NB 1UP1A 2QN6B 3GONA 1B0TA 4DOZA 4DR3F 1VDHA 2DCUB 5KG5A 2E1MC 2JDJA 1N56A 1C0UB 1VC5A 5DO2A 4FN5A 3J7YI 3CNQP 4DR1F 3C3LA 2PGCA 2RQKA 3DLBA 3KTQA 2V9KA 4YN3B 2MHEA 2DYAA 2IRUA 1HL6A 2J9DE 4FBUA 2WVBA 2C28A 1NO8A 3MEEA 3UVJB 4ZS6A 2RQMA 3MR2A 1L3KA 2FLPA 2VF3A 3ISNC 1B4SA 3OQ2A 3PR4A 4LF6F 2ZBIA 4YEAA 3N5BA 1T7PA 2ZZNA 1GQEA 4OZLA 1RKIA 3OJSA 3EE3A 1IVZA 4B3SF 1DBDA 2A2CA 2DHHA 1HNIB 2GNKA 1AB8A 3OR1A 2IYIA 4JI3F 1G4CA 2EBGA 1DTQA 4NEZA 1YWXA 2HQ3A 2HVHA 1NK8A 1X5PA 2ACMA 1TAQA 2QE5A 4MIWA 3N4WA 4YDDB 6FD1A 3C2PA 4WWSA 4BC9A 5KOXA 2HIYA 1NDLA 2H9ZA 2CPZA 2YWFA 2BW2A 5GAEI 2F4VF 3IWNC 2AW0A 5L1LA 3ICLA 4DX7A 2NUHA 3I55S 1D09B 2VU5A 3VF0B 1HBNB 2E5IA 3KLFB 3UCGA 4C3KA 2FJDB 2CNOB 3HHLA 3KUEA 4PWWA 3DMJA 5C2CA 2XMVA 2FPHX 3RBZA 4RLEA 4OX9F 1DTTB 3SQOP 3BH6B 1IN0A 5A8WA 4F3MA 4ANEA 1TQLA 2IDLA 2VFUA 3NKYA 2KT3A 1I5OB 2KVQE 1REVB 3IWXA 2DNNA 2BEFA 2EW9A 3TUIC 2YPYA 3LTOA 3KLVA 1V3ZA 1S1TA 2I5JA 4K4WA 4NXNF 1S12A 5LMUJ 2MSSA 4K4XA 1KOHA 2DGTA 4ECTA 3BREA 2VL1A 2M8DB 1LW0A 4KJIA 1Z4UA 4DZ6A 2MQ8A 3JQMA 1NB7A 3MD3A 4DR7F 1GMVA 2DIUA 2QTWA 1J27A 2V69A 4L76A 5CAAA 3DRPB 1YLXA 4ED1A 2W1BA 2XYPB 2UZAA 3ENVA 2AHOB 2EK1A 4I56A 4KB7A 4LREA 4DX6A 1JNRB 2XMAA 1Q86T 1DTTA 3T41A 3NWRA 5ETRA 3KHHA 2OEMA 2FJXA 2HSEB 1SJQA 1TK8A 2GVZA 4LFCJ 1S57A 2ZH2A 1WORA 1CC7A 3PEHA 4I69A 4LF7J 3EUNA 3D4JA 4N77A 2CNKB 4P75A 3T9ZA 2D3OR 4XDCA 3OUYA 4DL7A 2R2TA 1L3SA 4KKOB 2H48B 1HHQA 2JHEA 4DV6F 4LBIA 3DU5A 3ZZOA 1RBAA 3NGDA 1LV5A 3MM5A 5HMXA 1KHWA 3F41A 2E7XA 5I3PA 2K06A 3M32B 1FK9A 1R8PA 4IG3A 1WC6A 2KRBA 3KK1B 3B4DA 1JB0C 5L39A 4YHHJ 4MKBA 5A2QU 2X51A 2R2SA 4KHRA 5F8IA 1WEYA 2OLWA 3N28A 2ZC3A 4CCHA 3DLKA 5KG6A 3D5MA 2H4WB 1NZAA 5GVQA 5EHHA 5HROB 4YB1P 1RT1A 3HVTA 4ID8A 4KGVB 3Q83A 2XMKA 4F67A 2OEJA 2AYGA 1M5OC 3GU0A 4OI2A 5CA5A 2JC0A 1V6HA 1EKRA 3CJRA 4WE1A 1E6YA 2HK3A 3AB2B 4B3TF 1F2GA 2K8GA 2PA8D 2WB1D 1RHJB 1U47A 4F3OA 1IKYB 2DD8S 2V9WA 1URNA 1VQ6S 1OIAA 3Q23A 3HKWA 2FHOB 4I7FA 4ED0A 1K47A 2RRNA 2W2NP 2XSJB 4FF2A 5J1EB 2C42A 5HJXA 3VHQA 1OY8A 4A4JA 1X7VA 4DV5F 1JLEA 5KG0A 4HACB 1UPMB 4F4ZA 4LVNP 3RRKA 5A8WB 2J5AA 3CCQS 4RX6A 1KRPA 1Q53A 2JEIA 1FJGJ 4LRFA 1KLMA 1FRLA 3HVTB 2ZH8A 5ETVA 1EX8A 4A46A 5EWFA 2GIRA 4O44A 4OQJA 2MQPA 4DL5A 3FSYA 4JOUA 2EC0A 2BXJA 3E01A 3WIVA 1X4DA 4WYWA 4ER8A 1AYEA 3N01A 3GYXB 2C2ZB 2KM8B 3NP5A 2ZKTA 3DHWC 3VAHA 2ZDOA 4PG5A 2J9CA 2G1HA 2Z2YB 4ZPTR 1QY7A 4KQZA 3TVZA 4Z7YA 3M8YA 1Q8BA 2AU0A 1LKZA 3BSOA 4WZQA 4P74A 4C8NA 3VAKA 2CQPA 3BO4A 4RJVA 2EFGA 2V2VA 3EGWB 1L3VA 3CMES 5HLFB 2D3UA 2H3EB 3N6MA 2IHR1 4ZJOA 2ZH6A 2E1RA 3PW4A 3Q0AA 3GFXA 3SBMA 4NLTA 4DL2A 4AE5A 3KLGA 3TANA 5K9FA 4ZN1A 2R7QA 3UR0A 3TAMA 4DMZA 3T1HF 3TARA 1O0PA 5CHCB 2QT7A 3BSAA 5ITHA 3N0VA 5KFCA 3LP0A 4YQWA 4F4YA 3DRYA 2VODA 1TUVA 3GPAA 5CYMB 5IT0A 1RAOA 1VQNS 2VHGA 1SVDA 2XMTA 4CYUB 2ACYA 3BR9A 2PI4A 5GAEU 2WHOA 4C48A 2C2KB 4OJGA 4ILRA 1I51B 4EUVA 2B5JA 3X3UA 1S9EA 1FEEA 2AGPA 3TJ8A 1LK5A 2P2CB 3IA0A 5CYJA 1VRUB 4YFUA 5A6PA 1RT1B 3OFGA 1AFIA 1UPPA 2DNHA 3GMGA 1D8YA 3UD5A 1EP4B 1JLCA 4W4MA 1Q7YT 1T3NA 1WSVA 2OJ3A 3J7Z5 3TO8A 2PFDA 5E3QA 3KLEA 3G82B 2NR0A 3DRRB 4RW4A 1YJWS 5LM7E 4IO1A 3QAUA 4B9LA 3KJFB 2WK4A 5AE1A 2ZJPQ 2B6AA 3K5MA 3RG6A 3FVYA 1U49A 4TU7A 1N4LA 3TR5A 3QBCA 4OJHA 2F4FA 3W7BA 5EN1A 3TUJC 3U7JA 2QMWA 4G6VB 4GKJF 3OL9A 2HHHJ 5HVFA 5FD1A 1U1MA 1CBKA 4DQQA 2CJKA 4NLVA 2WW8A 3T9NA 2KXFA 4DV0J 2KT5A 3GV8B 4S0MA 2CJBA 1F0XA 1HQUA 2B4VA 2DTJA 2Y8WA 1SH0A 2JC1A 2MJNA 4ZVUB 5HMYA 3FQLA 3UD3P 3SFGA 1TKZA 1XMQJ 1CQMA 2BDPA 5ETPA 1JJCB 3KLEB 3G82A 1S6PA 4PEOA 4RW9A 4IH6A 4OYWA 2ASDA 5JVHQ 1JX4A 1X60A 1T9WA 2GHWA 3PKYA 1E6VB 2DEJA 1Q79A 1WKJA 3OLAA 1GXLA 5B0AA 1VIOA 3IBCB 3T1YF 2RQCA 2RKIB 2ZVSA 4EGLA 2NSCA 3R27A 4HKQA 4NLSA 2QA4G 3OFEA 4F3QA 1IQTA 1O51A 2CADA 4IG0A 4A8YA 4R25A 4Y2MA 1NMEB 2IRXA 2LQ8A 1XERA 3D66A 4HLBA 2QLXA 5FDLA 4ZCMA 3HMJG 1X0FA 1UTAA 2BM0A 2VBZA 3BEGB 4LBHA 4LUBA 4ECRA 2JLEA 5C2GA 3ZXWA 1MN7A 1YJNS 1KLNA 3TP2A 4JI8F 3HKZD 1GFWB 1OWXA 2V2ZA 4NRUA 1TKDA 1IWAA 4I2QB 1HYSA 3W60A 2W8KA 2FLNA 2R2UA 5KFMA 4HI1A 3OW2R 2AJQA 3V6KA 4ZVRB 3ZZYA 3W1YC 3QRRA 3ET6A 5KFKA 4N8NA 2FQQB 2GMHA 2BJ9A 1APSA 4F4WA 1Y5IB 2N4DA 1IBMF 3RB6A 3HZGA 3CGIA 1FE0A 1KNZA 1FDDA 3VQSA 4N47A 4FYXB 1GH8A 4AL7A 3KK3B 1BGXT 4KC5A 2LEBA 2ADCA 2FDNA 2DNQA 2YQ3A 2VG6B 1X4CA 4QJVA 2XULA 3H4BA 2B7CB 2IBKA 2J7UA 5J2PA 5HAOA 1IKXA 4X4VA 2XHCA 2RIJA 3OSNA 3MURP 2H5EA 2HFZA 1U26A 3WC0A 2MQOA 2R8IA 1HI0P 4YB6A 1P27B 3BGLA 3V6HA 3A8JA 3CCSS 1AUDA 2KXNB 2N4CA 1OY6A 4RR5A 5ETTA 4ECZA 1XMOF 1PYSB 3QT5A 2BX6A 4DQPA 3MI7X 1WTBA 1T94A 3QFHA 2YH0A 2AT1B 2IMWP 2DR8A 2FB0A 2XYGB 2Q1LA 5KFPA 1U2FA 4IRDA 2DR6A 2V34A 1U1KA 2Z2LA 3KLHB 1ZZFA 4USKA 5KT6A 2A6OA 2GQCA 2QFJA 3PJ9A 1TP7A 1CJTA 5HBMA 3DLGA 4ECWA 2E9ZA 4B3RJ 2QYCA 8RUCA 3LAMA 4QW8A 2PMZD 2YNFB 3CJTA 3FZBA 4OIXA 3SEOA 2HKEA 2X1BA 3MTKA 4NLRA 5J1PA 5CD4A 4DUZJ 4DR4F 3IRXA 4USVA 5ETKA 4KO0B 2Y0SD 1NUEA 2CZ9A 1QUVA 2H5JB 2QL7B 5HVGA 5HO4A 2XWXA 5T14A 4P71A 4FF1A 4J9RA 2MLXA 1LXJA 1NHKL 2B8QA 1T9UA 2K1RB 2YWEA 5ETMA 1NBEB 3TQ1A 1M5PC 2LU2A 5EWGA 5M2PA 4F4XA 4LSNB 3FDSA 3H5YA 2LU1A 2KJVA 3FGVA 2HFVA 4AFFA 3N5FA 3U1MA 4MTPA 2RRBA 4DV5J 2K3KA 3HSDA 4ECSA 2WONB 2OELA 2WVDA 3P45B 3PHEA 2QSWA 4I6YA 4X84A 4E8UA 3CCES 2ADBA 3DLGB 1IKXB 2B9XA 3CCJS 3PCOB 1H72C 1VYAA 3VR1A 2KFYA 4DEZA 3OXFA 3D67A 1YBAA 4C11A 4C3LA 1NK9A 1VQLS 4NCGA 2DGXA 3S7RA 1HQ2A 2MZTA 3GR1A 4D3GA 4I68A 3M8RA 3CD0A 1TR0A 3GIJA 1CULA 3FRZA 3ZTRA 2A10A 3IM9A 1XTZA 1IM4A 2CQGA 4NYZA 1NAQA 4F0HA 2U1AA 5KFTA 3OV7A 4B3MF 4DF8A 2NPFA 2LVWA 3KOAA 3BR8A 5U47A 1JLGB 2DRDA 3AT1B 3CCVS 1WSRA 1ITPA 3C16B 2VBYA 5IS2A 4KHMA 4AQYJ 2AQ4A 3DRSA 1WKKA 4NASA 3SCJE 3VAFA 4RW7B 2NXUA 3TOQA 4KV8A 3HDSA 4ENOA 4K0KJ 2R8KA 4JI1F 1JKHB 2ZD1A 1VC0A 1R6YA 3C6UA 1ZTWA 1KDNA 4L3KA 2HQGA 2P8IA 4MKVA 1X9MA 1AUSL 1W26A 1WC3A 2L9DA 3IAS9 4NZ6A 3VZIA 4G65A 3KDNA 4OV6A 1U1QA 2WSCC 1K0TA 2KH9A 2BJ3A 1LOUA 3MEDA 4PQAA 4DG1A 4RWWA 1U1LA 4K4ZA 1W2BR 4BWMA 2F3JA 5K8PA 3TUZC 1YBUA 2VKRA 5J1NA 1TELA 1HHSA 2MZJA 2W2QP 2XMWA 5DQIA 1ZETA 2VOOA 5F8JA 2OIHA 1BY9A 2A6MA 4QIFA 2YNHB 1GMUA 5KFDA 1F3FA 1OSDA 1XWLA 3DNCA 1ZM2A 3H5UA 1L3UA 4ERDA 3PYGA 2VBWA 2U2FA 4NL5A 5DZ6A 4PG4A 3W9JA 1GK8A 4JI7F 1EETB 1RA6A 2N7YA 4QR1A 1HPZA 3W2VA 4LMZA 1C0TB 1S1UA 1NEEA 3MTJA 4AL6A 5A76A 1SH3A 3RB0A 2AEJA 1DQ8A 3A8KA 2ZH9A 1KKHA 1NKCA 1VQ5S 5CYMA 4C0OC 2JFKA 2BOAA 4F0KA 3O2IA 2AJ0A 4Y2AA 1XK8A 1I94F 1CJKB 1BXNA 5RUBA 5GMKa 2FHJD 2HHVA 3M2UA 5HMWA 3OR1B 1IKVB 3D6MB 3SFUA 3VV2B 4CWBA 3CIZA 3D6FB 4E98A 1JLFB 4OLPA 2QMXA 1S0MA 3EYZA 3ETMA 5F8GA 2HHHF 4LT6A 5KT3A 5EUHA 3AJDA 4MFBB 4IH5A 2V8HA 3T1AA 1UJ5A 2G0CA 1X9SA 3GTYX 3A3NB 1NK5A 2VG7B 2HBZB 4B3OA 4ZP6A 4ZJLA 4C11B 3ILJA 4KTQA 2JEFA 4Q2MA 3V6JA 1IR1A 4C6AA 2VFVA 4P2SA 3GIIA 2RDIA 4HTIA 4QOTA 5K8OA 1T8EA 3B6BA 4F50A 3M8QB 1UWBB 2HBRB 2RU9A 2RAQA 4DPXA 1H74A 1R3NA 4G1PA 3MAAA 3RAQA 5B0GA 3D1QA 4GVLA 4DJBA 1NK6A 4GKKJ 1WF0A 1WDTA 4KY3A 2XG8A 2RDDA 4QWAA 1RT4A 4QYRA 5AT1B 1VQ4S 1KLMB 2FHJA 2E1CA 1QSLA 4DDFA 3MECB 3CJ4A 1PYTA 1ICEB 2GO9A 2YPZA 4QWEA 3NGSA 4DU7A 1DQ9A 5CZXA 2GQQA 1SIZA 2XMUA 3FBCA 3P6YC 2RDJA 4YB7A 1S1VA 4WTYA 4JI8J 2K7KA 1NDKA 2IJNA 5H9FJ 3MAAB 4RKUC 4M5LA 4O0IA 4O4GB 1KTVA 4HEA9 1FF2A 3H0PA 3WC2A 2NYIA 1FK9B 1Y9OA 2BABA 2PE8A 1S9GA 1UW9A 1Y0HA 5KT2A 1KONA 1REVA 1D9AA 2OAUA 1RT7B 3LAKA 2JFDA 5GMDA 1KP6A 2JRSA 4ELVA 2IM3A 4B9TA 1YZ6A 5HANA 5M2RA 4PRFA 3HHLB 4IQMA 1O5JA 3P5BP 4V19J 2IM1A 3OBIA 1KVJA 3HPOA 2XEXA 3DLJA 3OD2A 4IYQA 1GTEA 1RT5B 1R89A 1MROA 1LWEB 3W2WA 4H4MB 2JVOA 3CMQA 4WYLA 3S01A 2DIVA 5KFLA 4CIOA 3M2RA 2MQQA 3QJPA 3PYDA 1VJQA 2QMUB 2V63A 4USJC 3QATA 2ZC4A 3Q8VA 2VBXA 2VV5A 3FEXB 2Y8YA 2H4YB 1GXTA 2EPIA 2I8EA 3RYLA 3CO9A 5GADU 3UR3C 4LF1A 1DARA 1XMBA 2CIMA 3DYAB 2AJ1A 3AOAA 1E6YB 1FX2A 4X4NA 3I0SA 2COLA 7AT1B 3DRRA 4RW4B 2GQ2A 3VTIA 2ROPA 4ELTA 4KGZB 2YX1A 4WFZA 5E2QA 2HEKA 1SC4B 1JLAB 2JOQA 2JZ5A 3G86A 5CD4H 2KRRA 4QW9A 3G4SS 2YNIB 3FBBA 3GCWP 4KRWA 1S79A 4XPCA 4PQUB 3NL0A 1D9FA 2GC8A 4LJMA 5AE3A 1QSYA 3DRSB 4B3RF 3CJ2A 5E3AA 4KYZA 3W5YA 2PI5A 4LQ3A 3WDOA 2CPEA 5A2QY 4NLPA 2CQ3A 2PMHA 1NSAA 3MPUB 4QWDA 1UJ6A 2IYGA 5AJ3J 2NREA 2AEFA 2AYMA 4C2MA 4QR0A 1HWJA 2BKNA 3QAEA 1IBCB 4UQTA 1ZPVA 2DHGA 3CJSA 3D3CJ 3ILLA 2VQEJ 4A8SA 3P49B 3KLHA 4ZLPA 5CXTA 1E6VA 2HGLA 2QLJB 3ZO7A 4RZRA 1CJVA 1RT5A 4RW9B 1NSQA 3KG0A 2YKNB 4CQ1A 2HVDA 1NJWA 3SIPB 2DNGA 4OZNA 3DN9A 1N36F 2EWHA 5J2MA 5JVGQ 1K1SA 4Y2CA 2W01A 1TUGB 4ZKAA 1LWFA 4A8KA 4RPFA 1J5EJ 3SCKE 1R0AB 4RNHA 2RS8A 3R7SB 5IWAF 4WU2A 2YX7A 4U6PA 3EPIA 2D41A 4QZVB 1SUQB 2C2EA 4DI6A 4JI4F 2E5JA 4QPXA 1OPIA 3VAGA 4ID5B 5AXLA 1S1UB 3TAQA 2V4RA 2A18A 1R8AA 3S6EA 4F8RA 1SKWA 1R0BG 3VCDA 2UU9J 3CC4S 2HZAA 2H65B 2MZSA 3MWBA 3KLIA 4G1QB 2WRMA 3MEGA 3G8SA 4DL3A 4TVAB 1REGX 3OTBA 5IV4A 2G2OA 1EQ0A 4PXCA 4IFYB 4IFVB 3Q86A 3ISZA 1G3OA 1VHFA 1TL1A 3KJVB 3GLJA 2XLJA 3PYEA 2QO3A 5F9LA 4IR1A 2A3JA 3T5JA 2RMLA 4B02A 3SXLA 1FFSB 5F0UA 3JQKA 2DT9A 2AD9A 1FHTA 3CJ8A 3LOUA 3MM5B 2BE2B 2O5DA 4EEYA 2BKPA 2Q3PA 3PHTA 3I31A 2ERRA 1TV6B 1UCNA 3ZZRA 1C1CA 5HROA 3OR2B 5J2MB 2GAHC 4ANCA 3T5HA 1XNRF 3EWGA 5F0WA 1SBRA 3CCWA 4M5JA 2YKMA 1SQEA 1XEZA 3TZWA 3D28A 4OYBA 2XS7A 4NLQA 2HNDB 1JJ4A 4NXMF 5CYQB 3PNIA 1V5VA 3B4MA 3FBFA 4JI2F 1CC8A 4CZCA 1CG2A 1R8BA 3KXDA 2IC3A 3HF5A 3K89A 1F6TA 2XQCA 3K57A 1S6PB 2AGQA 2XI2A 3R8YA 4IUFA 1FWLA 3L7OA 1MLAA 2LCWA 1UMJA 3QT8A 3AOCA 4BC7A 3BKFA 2L08A 2GW8A 1CJVB 2CNLB 2GGPB 4PG6A 1TV6A 1S7IA 2BJ1A 2W2MP 1EKSA 4M95A 1KOOA 5T41A 3OVSA 1B7FA 3NEKA 1J2VA 3ITHB 2CJXB 1HR0J 4E2FB 3MXHP 2OGUA 2VPXB 2MKSA 2J6SA 2KB2A 4QIEA 4DSIA 1SJ3P 2HZVA 2DGVA 2BQRA 3T19A 1FD2A 2JLFA 4A47A 2MKIA 1N34J 4AL5A 4NYOA 1K1QA 1P6TA 1ZM9A 2BJEA 3FRYA 4OFZA 2HZCA 4RBUA 4UOFA 2EK6A 2OPQB 4URQU 4DUYJ 3RTVA 1UJ4A 5DQHA 2PC6A 3SV4A 1RTJB 5BYQA 3MOJB 1OYEA 3DLEA 3TI0A 3MM6B 3I0RB 1IM6A 3BBBA 4DSJA 4C8YA 4HTJA 2HHTA 1ZZNA 3EDQB 4RUAA 4CP5A 4MYTA 2ALZA 1DLOA 4CLPA 3C66A 2J0SD 3JYTA 1FD8A 4M5NA 5KFOA 3IGVA 4X62F 2BR0A 4DL0C 1RAIB 1HWIA 2EC2A 3WZ0A 1FTRA 2GHPA 3FCWA 2KXHA 1T11A 2Z57B 1Q1KA 3NY0A 1M5VC 3QJLA 4QYZJ 4DR7J 4NZ7A 4Y0FA 1UFLA 2LA4A 5D78A 2VIHA 3HXMA 4J9KA 2IFXA 3D54A 3BBFA 4IG3B 4Y2KA 3WQPA 1TZ0A 1P9YA 3H98A 2POKA 4DCOB 4YY3F 4IDKA 5C24B 2O01C 3GFYA 3OTCA 2IVFB 2HFNA 4BDPA 5HI7A 3CULA 1X5OA 2WB4A 3Q89A 3QWUA 3R6GB 1U25A 2X3GA 2D3O1 2KM8C 1BQMA 1C1CB 3OR2A 4DR6F 3OVAA 1ZPWX 1F5BA 1Q5YA 3MM7A 3HVWA 2DKOB 5LSLA 1S1VB 3PIPQ 3M6VA 1VRUA 4NX9A 2L9NA 3KK3A 3TWZA 3D2WA 3CO0P 3NG8A 4IOAQ 2MKJA 1VBXA 4YHHF 4FS1A 1HBMA 3THTA 4GO5X 4F25A 1DJ0A 3MZIA 1FKPA 4TXSA 3SCIE 3RB3A 5KTQA 2CQBA 4LF6J 1T9XA 3SCLE 4NCBA 3LP1B 2GZOA 3HULA 4KGKA 2HWIA 3R7BB 5HVHA 5IOLA 2BZ2A 1WEXA 4OYMA 4KO0A 2MQLA 3D9BA 2UUTA 4RBVA 1R8CA 2P5VA 1QLNA 4KSEB 3OTOJ 1HIYA 1TKTA 1NLKL 1F5AA 1HMVA 2NSBA 3R5BA 4ZCLA 4EO8A 3G6YA 3ITHA 1U7LA 1ZH5A 3AD7C 2J6UA 4Z7CA 1WG1A 1YJ7A 3LWLA 2FZKB 3H2LA 2OPPB 2CUYA 2NXEA 3GSDA 3D0GE 3UE2A 4EFAC 2MGZB 3BN4A 3DOKA 4GVBB 4OYZA 1X4GA 3AH6A 5G0RA 5F9NA 5SZTA 4ID5A 3K5PA 1FDAA 2ZBPA 3C8YA 3HD1A 5D4PA 2FVCA 4ECUA 3US5A 4JBCA 1QE1B 4LF9J 4TQRA 2CQ4A 4KGMA 4DHVA 1RT6B 2BYCA 5KFVA 3EPGA 4U8YA 3CCLS 2DO0A 5IM0A 4EBEA 5BR8J 2XGPA 2VQFJ 3HLUA 4FKYA 4DLGA 1WDDA 2CFXA 2IJFA 2CWXA 3I6PA 3CCMS 1UA1A 3Q2SC 1S5ZA 4PYDA 4EMDA 5E41A 4DL4A 3W5ZA 1RWMB 3FSXA 3VQTA 4DL6A 3DOKB 3N9UC 4KT0C 5CABA 3W3SA 2OMLA 4MK9A 3WIUA 5LMNF 2R7SA 4USWA 3H4DA 3BQ2A 2XI3A 4DSLA 2PEBA 2W9BA 2EXUA 3DGPA 2LXFA 3D68A 2JL9A 1W2IA 3QGIA 9RUBA 2B4UA 2M0GB 2QL5B 4UZBA 1C0TA 1PKUA 2Y1JA 1QVGR 2MEWA 4KR0B 1Q8IA 4CLFA 4OYIA 4U9RA 2F65A 3DRXA 1UW4A 2DJWA 3V2UC 1UEVA 1PGZA 2BM1A 1EP4A 1JLCB 2GA7A 3WBZA 4HR2A 2UU9F 1PC5A 1I3OB 4ZVPB 2OSQA 3KUGA 2CA9A 5KFJA 4FF3A 4LF5J 1S48A 5J2NA 3MMCB 5IFMA 4IR9A 3BO3A 2D69A 1Z2LA 3RGIA 4ED4A 1S76D 1FKPB 4CDIA 3G8QA 4ZIVA 1IBKF 1TFWA 1N33F 3C15A 4ZP7A 3MFIA 1R6VA 3DOLA 1D8ZA 1JNZB 2LKZA 4KKOA 1TVRB 3FFIB 3HT0A 4X4TA 2UXCJ 2VC1A 4J9SA 4QWBA 4B3OB 2HVIA 1VIXA 4ZLNA 1JJ2R 4DU8A 4DQRA 2PFFB 4J9NA 3O1LA 4Y3CA 3H90A 4CO2A 2HVZA 3KLIB 1SC6A 3HX9A 4K5SA 1OJ4A 2E5HA 3QNWB 4CO5A 3HCXA 4URGA 2P9CA 1YHQS 2KO1A 3CUNA 3I4HX 3IS9A 2HQFA 1LFPA 3A12A 4DV2J 1S97A 4TLQA 2R8JA 3VZHA 5HQ8A 1XNRJ 3CE8A 2RUSA 2W2OP 3PXGa 1D1UA 4DV1J 1PG5B 4EZ9A 3NBPB 2RSQA 3PX0A 4RW6B 3AJ1A 3QT7A 1WEZA 3CF5Q 2RVJA 3VAIA 2ROGA 5B0BA 3TZZA 1S72S 3SDEB 1D0EA 1XN9A 2FJEB 4O4GA 1N5QA 2K1RA 4NWBA 4P72A 2PO4A 2M3DA 4UQGA 2FVSA 1GAOA 4F02A 4USTA 2CQDA 4Q8EA 1S1XB 4I2PB 1DHMA 2YNHA 1K73T 1NB2A 3E2EA 1IBLJ 2YY3A 1C4CA 2F8MA 4CRJA 4DCPB 5KG4A 4R0JA 4CTAB 3UDEA 2CQCA 4ED3A 1H2TZ 1QTNB 3G87A 3MECA 2IAJB 1EARA 1N6QB 2AJFE 2BJ8A 2BMBA 1P1LA 4M8LA 1YJVA 1NJYA 5A8RB 4HH0A 1IQZA 4TY8A 3KMSA 3FMWA 2Q66A 1WTFA 4I7FB 3M9MB 5T7LA 1F3VA 1HBOB 2Q6CA 1TKXB 3E3XA 2HAIA 3GZ7A 3SQGB 4M5KA 1N5SA 5H9EK 1JK9B 1M0SA 2ASJA 2FYXA 3K8VA 4J91A 1HWUA 3UW1A 4ED6A 4HHHA 4LR9A 4G3IA 4KFBA 3CJKB 1VI7A 2VFRA 3NNHA 2HIQA 2YWGA 1F60B 1LW2A 2QIFA 7FDRA 1FKAF 3R7NB 3W2WB 3ZFVA 4CLZA 2RILA 2ZBCA 1LWFB 1NXIA 3GWCA 1A7GE 4KAIA 4F04B 1FXRA 3J80Y 4DS4A 2W9CB 4DFJA 1X0PA 1XNQF 3CMAS 1G1XA 3TEGA 3KHLA 5HLFA 1HBUB 5A0YB 1VFJA 1RWOB 4Y34A 3OHBA 4XPEA 3QRQA 2VASA 4FDFA 3FNNA 4TKTA 5MAOA 3JXOA 4CT9A 1G6BA 3MGJA 4PPZA 4YP3A 1UAWA 4YMEA 3EXCX 2UUCJ 4LBPA 4UTGA 1SL2A 2VJUA 1SB6A 4JYAF 4ZIWA 2NZCA 4I6WA 3IXQA 3HO1A 1YITS 3V81B 4NEYA 1AT1B 3BGFA 4ES1A 2C2NA 2BACA 4EO6A 4R0EA 4ELUA 1BD6A 1T3OA 2HFSA 2WSEC 3V5RA 3DM2A 3OL8A 2W4PA 4PYAA 5DS7A 4JI5J 2GMLA 3NGRA 3M9OB 1RBOB 3FBEA 4PKDB 6AT1B 2IVMA 2MDAA 2ZOMA 3M6XA 5D0GA 2B9YA 3K5LA 3DLHA 3W66A 3UPFA 2IM0A 2C22A 2GVDA 1XMOJ 4ZPVR 2OPSA 3NOGA 4I67A 2HRTA 4O0NA 1Q81T 2XWYA 2EFVA 4ED2A 3SQGA 3GIRA 4N5SA 2AYBA 3BO2A 4RO0A 1DAXA 1KEKA 2C3UA 2Z8QA 5CCMA 1JWWA 4AT1B 4WZMA 1SJRA 2B43A 3FEYB 3OTDA 3BGRB 5KFZA 3ULHA 3H25A 1HWLA 4LVOP 1SKRA 2JEJA 3PY8A 1RJJA 1RUSA 3IR5B 4DR4J 4JP8A 3UDVA 2GVDB 4U96A 2CPDA 5K8NA 3L4BC 1NH8A 3TAMB 3CTRA 4J9UE 4X66F 1PSDA 2OD4A 1RLCL 2OFHX 2N7CA 4N8OA 3SSSA 3BBCA 3JAMU 1Q7LB 5E5NA 4DSKA 4OYPA 4ZA1A 1JLGA 2HGNA 3EZOA 3M05A 3MR3A 3GV5B 2UUBJ 3AY0A 3K2YA 4MJKA 3C46A 3ENAA 2DVIA 4A8OA 3PIOQ 3FKBA 4LF9F 2E9TA 1QTMA 4J90A 3W9IA 3EDRB 2HS4A 2E1PA 4C8LA 3VVUA 4KV8B 1N52B 3U27A 1IXKA 2YKQA 3CEDA 1P1TA 2GVZB 3GJSB 3O3LA 1RSCA 2WVCA 5K20B 4LRDA 1VBZA 1CPZA 1U2RA 2VQFF 4DR2F 4C97A 1HBUA 4D3HA 1S49A 3FUYA 2G2ZA 3FC9A 1UFWA 2D1CA 2L48A 3VWSA 1HWKA 3H7HB 2YNIA 4WPAA 1RTZA 1ACMB 3FFIA 1U02A 1NSPA 1VQPS 4K59A 3D6HB 2YTCA 3I0RA 2M4MA 2JJ4D 4TYAA 4Q44A 3PRVA 2B6AB 3QIDA 5E33A 2DR5A 2W25A 3NXZA 3NMRA 2K7JA 3IGNA 4MIAA 1K44A 2AZ1A 3CIMA 4N41A 1OQ3A 2FY8A 2R7OA 1HNXJ 2G13A 3HHKA 1UZHA 3JTNA 5DDPC 4PQUA 2EI5A 1MU2A 4CH0S 3PW5A 4WXWA 1F2HA 3G71S 2RU3A 4A8XA 4OI1A 3UO0A 1RWUA 5IZHA 2E5GA 2AEMA 3UDLA 5KFUA 1VK3A 5BJRA 4ZPCA 4WP3A 4DFMA 4H4KC 2OHDA 1VBYA 2F8EX 2PDAA 1WHXA 1WOSA 3GV7B 4MKYA 1LWEA 4M5MA 1UKUA 2E7WA 3GSIA 4PZVA 4KHPJ 2NXJA 3NGKA 5HATA 3LQVA 4FYVB 5AXKA 4ZITA 5DDOC 2R7RA 5KFFA 1QM9A 5D4LA 3FQKA 1NJXA 3M2RB 3TAPA 4FXWA 1JLFA 4DR6J 1T9TA 2HWTA 3ILOA 4U8VA 4RNMA 1Q0NA 3TJ9A 3TJAA 5F41A 3NRBA 2WW4A 3H2UB 1DTQB 1RCOB 4RUHA 2Z0GA 2ZEJA 4OHWA 2LQ9A 5F3TA 5J2PB 4ETXA 2IA6A 3DOMA 4ECYA 2XY5A 5L46A 3PFOA 4CO4A 3CDAA 4IRCA 1UVLA 3NS5A 1T9VA 4OJ1A 3HSJA 4J9PA 1NHVA 4DPOA 1J5OB 1UVJA 4F2SA 4Z2XA 1LW2B 2B8PA 3DLEB 2C2OB 4QPTA 2XLIA 4Y6IA 1IKWA 2XCPA 3Q8UA 3DLLQ 8ATCB 4RW8B 2KYZA 3CDWA 2BBEA 2HW3A 5D15A 2VZ9A 2BV3A 4DR1J 3KYLA 1V9OA 1PC4A 4ECXA 3VGVA 3IMQJ 5KFWA 4IFVA 2GX8A 1GMWA 2NXNA 3BGOP 1RWXB 2OPPA 3PM9A 1B3TA 3M4XA 4B3MJ 4GMKA 2DGUA 2X1FA 5CQGA 1BWVA 3CDEA 3CVKA 5DETA 4B9UA 1VQ7S 4ILMA 2NQPA 1Y11A 3OFHA 1CJUB 1F9HA 5GADI 4EK2A 1KC8T 4PUOB 3CW2C 1T05B 2HMIA 2VA3A 3TVKA 2FLOA 2I0XA 2PA3A 2V6AA 1RDRA 1AZSB 4OZ1A 1PIEA 2RH3A 4ZPBA 4PABA 2XC9A 3FMBA 1N88A 4URSA 4RNFA 1VHIA 2HQIA 4OHXA 3PV8A 4F4AA 3AHPA 3KDOA 3HSGA 3G6VA 3R1HA 3RW6A 3KLGB 2KFNA 3R6LB 3OJUA 4L72B 2BQUA 2Y1RI 3EVMA 4X64J 5EGYA 2HHUA 1CJTB 4DPWA 1Q4RA 4H4MA 3A4TA 2FVRA 1BMQB 1WC0A 4WK3A 4RW7A 4B9NA 1VQSA 4I64A 3HJFA 1RYSA 3MCOA 3IG1B 3GJQB 4JV0A 1S0NA 3TRGA 4RNOA 1TK0A 5IQQA 4AXIA 5FJ4A 4YDXA 4DX5A 5LMUF 4FXVA 5KT5A 1HW8A 1PBAA 1X4HA 2FZCB 4NZ0A 4ALZA 1FKOA 4ICLA 4U7UD 4DN0A 4M5DA 3MM9A 3H40A 2YQ0A 4ITSA 1K8AT 3EJMA 3O5TB 2ZJRQ 1FWPA 2ZITA 4LFAF 4JYAJ 4TU9A 2BE7D 1S6QA 2YNGA 5ETOA 3TNVA 3J81Y 2R8HA 2C2DA 1N54B 1JLQB 5DGAA 3I82A 4ZVOB 1MW7A 1W7WA 4I2QA 1HYSB 4EI2A 3PX4A 1U4BA 1TL7B 4ANDA 2OTJS 1EB0A 2QV6A 4WXOA 3KK2A 1DLOB 1Z2ZA 2OUGA 2Z4PA 3JAMY 1ELOA 4AYBD 2DR7A 4HACA 4PWDA 4OV1A 4JI3J 5I4MA 1S9EB 3I4PA 4I1TA 4ZPWR 3K58A 1FVSA 5H9FK 2E5LJ 2QRRA 2OMOA 3KNGA 3RJMB 3MAQA 1QUPA 1HI1A 4C8MA 4IG0B 3R9LA 3HT3A 5C25A 3ZZZA 1HHTP 2B4PA 5G4DA
chains in the Genus database with same CATH topology
1B0VA 2M52A 1S6QB 4KE5A 5CCLA 2PEHA 4AUKA 5MLCV 3PRBA 3M30A 7FD1A 2EBEA 1DRZA 3KK2B 4K4VA 1X5SA 2Q43A 3DHXA 1SIWB 2W9BB 1YG0A 4JV5F 3SMZA 3R5AA 3LP2A 1OSCA 1IUJA 3GG1A 3RU0A 3NNCA 5B0FA 3MM8A 4QR2A 1NKEA 4RUCA 3PVXA 2KZZA 2W4CA 4Q8FA 4XO0A 5L1KA 4LFBF 1AXQA 1JXEA 2EG1A 4A8FA 3PFEA 3BGUA 2KI2A 4RU9A 1FERA 4XDDA 1IKVA 4CH1A 3N6NA 1I1GA 2PIIA 5E3RA 2APOA 1SI9A 2CG4A 4DR5F 4OI0A 3CCTA 3CC2S 4EYHB 4MFBA 3LP2B 1I6JA 2DH9A 4PXEA 1JLBB 3BQ1A 4Q45A 5F8HA 2I2YA 1WI6A 1FNMA 2VB6A 1HPZB 4MAKA 2KJWA 3F56A 2E66A 3N6LA 4JV1A 1FA0A 4MK8A 5K8MA 1UEUA 2UVUA 3JYTB 5KAKA 4LF7F 1FESA 4QU7A 2DPIA 1HW9A 3GE9A 3IC1A 5B0DA 4J9OA 2VUGA 4ZP9A 4ZP8A 5E7OB 5K14B 2CPIA 1N5TA 2ZHAA 4X4UA 3H8YA 4WKRA 5G0RB 2GHVC 5J2NB 3MMCA 4W92B 3H5XA 1X5TA 1RQ0A 3IO1A 1M5SA 2CJQA 3JTPA 1BLUA 2DB1A 3Q2TC 1RTIA 1WF2A 2DITA 4HL9A 3TA0A 2V4JA 3MM7B 4ZOSA 1NU4A 2J7KA 1WHVA 5HL7Q 2I38A 1UWBA 2VG6A 2CYYA 2O1PA 4MYUA 3V81A 4TLRA 5D4OA 5KFHA 1QAYA 1JXLA 2WSFC 2AJ4A 5AXMA 4H54A 4HT7A 4I4BA 3M6UA 2P6TA 1B64A 3KWMA 1JLBA 1HNWF 3X1LB 1KD1T 4DFKA 2V4JB 1SV5B 1FJGF 4GC7A 2UV8G 3HVAA 5DLGA 5F8LA 3M32A 3PO5A 1F9FA 4DLEA 1LQ9A 4QBUA 1HMVB 4DSFA 4KFBB 2QZ8A 3CJKA 2VC0A 3LH2S 2UUWA 5DG8A 3GIKA 4O3RA 2PN6A 4E0DA 5EWEA 2RB7A 3IR7B 1S9GB 5LSRA 2MZ1A 2XMJA 3AQOA 1EETA 2VFSA 5H1SV 2DHSA 2E44A 4GO7X 2RRAA 2CZ4A 1FDBA 2XBPA 1R31A 3GQCA 3LGMA 4J37A 4EBCA 1XMQF 3EGZA 4LSNA 1U24A 5E3CA 1S6UA 2XCAA 4B08A 2FC9A 4DQSA 1RAJA 1RT2A 2ZZMA 4ZHRB 2AF6A 4FS2A 4P6QA 1VJWA 1T02A 2UUBF 2YNGB 1X4FA 2YWKA 1WD6A 2HNZA 2HLTA 1VRTB 5K5MA 3LANA 1JJHA 2MJUA 3FJ2A 2CPFA 1M90T 2AWZA 3NBPA 3IR6B 1GT8A 2OPSB 1F5CA 2ZNZA 3H5SA 4EZ6A 3OL7A 1SXLA 3HP6A 2MPUA 4IOBA 2DR9A 3R5CA 2VPWB 1FXDA 2EFNA 5AXNA 1X8DA 2E1AA 2AGOA 2CVIA 1HBNA 1H98A 1X4BA 2KT2A 3E8OA 4OL8A 3NS6A 4J9LA 2DNMA 3HI9A 2K2PA 3MEEB 1ZM3A 3KK1A 2DGSA 2J0XA 2M2BA 5LT5A 2ASYA 2WOMA 3AA9A