4ID5B

Hiv-1 reverse transcriptase with bound fragment at the rnase h primer grip site
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
424
structure length
412
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 122
structure length 412
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4id5B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id5B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id5B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id5B03
5KFNA 4KE5A 4JV1A 1HYSB 2IAJB 3BJYA 3KHGA 5J2QA 1TKZA 1N5YB 3KLFA 5F8MA 3LALA 4KKOB 1JIHA 4H4OB 3H5UA 3PHEA 4RZRA 4NZ0A 1EP4A 5J1EA 3IGVA 1IKYB 2AX0A 4F4XA 4ED3A 1XR6A 3DYAA 4ED2A 3KLIA 5DG8A 3V6HA 4F4WA 4IFVB 4HYKA 4J9LA 4KO0A 3ISNC 2XCPA 1DTTA 3KK3B 1KLMB 3NKYA 5K14B 2AGPA 3BQ0A 1T94A 3HVTA 1Z4UA 3CIZA 2QV6A 3OLBA 2BRKA 4NCGB 4WE1B 1SH3A 2OPQA 1C1CA 2HMIB 2F8EX 4H54A 4MKBA 3PJXA 3IG1A 1K1QA 2YNFA 3QIDA 5KFIA 4K4YA 3PW2A 1RYRA 3CDUA 4PQUB 3NBPA 4RW4A 3ITHA 4IR9A 3RB6A 5EDWA 3GIKA 3GQCA 3Q8SB 1BQNA 1HQUA 1S1XA 2RF2B 4ZVHA 3N6NA 4URGA 4O4RA 3RBEA 5KG6A 3N6LA 3KK2B 3DLKA 4ID5B 1N6QB 2OPPA 2ZKUA 3NAHA 3UR0A 3GYNA 4F50A 3TQ1A 2WOMA 3KLHB 2ZE2A 1S6QB 2I5JB 1U09A 5EWFA 1C0UA 3OL8A 4DL3A 1MU2B 2BQUA 5KG1A 3H59A 4O3RA 1HYSA 5L1JA 2IAJA 4MK8A 5F8IA 4QWCA 3GV5B 1RT5B 4ZHRB 1T03B 4RNFA 1N5YA 1K1SA 4WFZA 4H4OA 2B43A 2GIQA 1HNVB 3JSMB 4ZVGA 4ECVA 3H5XA 3NMAA 4EBCA 2IJNA 2W8KA 5CYMB 4XPEA 4QWBA 1S1UB 3PZPA 4IFVA 4RUCA 4MH8A 1HNIB 4KB7A 5KFEA 1KLMA 1T05A 5K14A 1RYSA 1RT1B 4IOBA 4FS1A 2IMWP 1S48A 4NCGA 3MEGA 4WE1A 4K4XA 2HMIA 5KG0A 1LWFB 3QO9A 4DL7A 4NLTA 2BQ3A 4IRCA 4PQUA 2OPSB 4LSLB 1RTJB 3CDEA 4O3SA 2EC0A 5KT6A 2RF2A 5FDLB 1J5OB 2C22A 2XWYA 2BR0A 3CJ4A 3MF5A 4U7CA 3KK2A 1S6PB 3QLHA 1N6QA 2IM3A 5KFCA 3KLHA 1UWBB 4KSEB 4RW9A 1S6QA 2I5JA 4B3OB 3E51A 1LW0B 3PW4A 5F9LA 1MU2A 1N56A 3QIPB 3I5BA 4O3PA 4J9PA 1SV5B 4WFYA 3PW7A 4XPCA 1TL3B 4LSNB 2IM0A 1RT5A 2FVRA 4MK7A 3OHBA 2UVWA 3DRRA 1T03A 2AWZA 2RKIB 2GC8A 2R2TA 2WCXA 5KFZA 2R2UA 1JLEB 5KG7A 1RT4B 3KLVA 1HNVA 3SFGA 4ZPCA 4DL6A 2FLLA 4K4UA 1REVB 3BGRB 1N48A 2JEIA 5CYMA 1IKWB 1CSJA 5KFRA 2VA3A 3C6TA 2HWHA 3OL6A 1S9FA 1HNIA 1MMLA 3OL7A 5HLFB 1QE1B 3LP2A 1ZETA 5DGAA 4OL8A 1RT1A 3SI8A 1HQEB 1JKHB 4IR1A 1FKOB 2D7SA 1KHVA 1HPZB 1R0AA 2E9RX 1S49A 4RW6B 4ECZA 3PJWA 4YQWA 3RB3A 1LWFA 3KLEB 2E9ZA 3OSPA 3FFIB 4YR3A 4NLVA 2OPSA 1S1VB 3MEDB 4LSLA 4TN2A 5DQGA 2YKNB 4RNNA 3KMSA 4ECTA 2AGOA 5FDLA 1J5OA 4NYZA 5KFDA 3EPGA 3TAMA 4ZP8A 1S6PA 4J9NA 4ZP9A 4R0EA 5C24A 2CJQA 2R8GA 1RT6B 2QE5A 1UWBA 3HKWA 3T19A 3V6DB 4B3OA 1D0EA 2VG6B 2ALZA 5J2PB 1IKVB 1FK9B 1RA7A 1JLFB 3QIPA 2FJVA 1S1WB 3JYTB 4NLXA 3Q8RB 4GC7A 1TL3A 2IM2A 4LSNA 3CJ5A 2YNHB 3LP0B 4NLSA 4NLUA 4TLRA 2RKIA 5HBMB 4KBIA 4IFYB 4DG1B 2WHOA 3G86A 5L9XA 1RT4A 5EUHA 3RB0A 1D1UA 3M8PB 3H5SA 1SH0A 1JLAB 4RU9A 4IRKA 4Q43A 3FSIA 2OH2A 5L1LA 4Q8FA 2HWIA 3HVAA 4Q44A 1REVA 3BGRA 2IM1A 3MTKA 4WZMA 1IKWA 1TVRB 2WONB 2UVRA 4DL4A 1S0NA 3UQSA 4IG0B 5HLFA 1QE1A 2AU0A 4QWDA 2ASLA 1RT3B 1LW2A 1HQEA 1JKHA 4IDKB 3VQSA 1FKOA 3KHLA 5DLGA 4ZPAA 1HPZA 3IGNA 3H40A 4M94A 4I2PA 4RW6A 1SH2A 2V0NA 4QWAA 2ASJA 4PWDB 2DPJA 3T5KA 4J9RA 3DMJB 5KFWA 3MEDA 3IRXB 2IJFA 2YKNA 3ISND 4IH6A 5HP1B 2W7PA 1N4LA 1GX6A 4ZVEA 2JC1A 2YNIB 3CJ3A 4G1QA 3QYYA 4X2BA 1NHUA 4NLDA 1RT6A 2JC0A 3ICLA 4TQSA 4ED1A 3V6DA 1S0OA 2VG6A 4NLPA 5J2PA 4ZPBA 1IKVA 1FK9A 1JLFA 2AGQA 4IKAA 1S1WA 4PUOB 4TYBA 1QAJA 4EYIB 3DOLB 4ZP6A 3RBDA 3CO9A 2ILZA 4FS2A 3LP0A 4J9MA 3FDSA 2W8LA 1XR7A 4K50A 2BANB 4KKOA 5HBMA 4IFYA 4ICLB 4DG1A 1OS5A 4J9OA 2C28A 3PW0A 3BREA 1JLAA 1IKYA 1KHWA 2ATLA 3KLGB 3H4BA 1WNEA 1TVRA 2HNZB 2WONA 5CYQB 5KFJA 2HNDB 3KK3A 4IG0A 3NGDA 2BE2B 5F9NA 5DG9A 5J2MB 1RT3A 4ED0A 2UUTA 4KV8B 4O44B 3QZ7A 5KFTA 2ASDA 4QWEA 1IKXB 1T3NA 4URQU 4ECWA 4EBEA 4K4TA 3LAKA 5KT7A 1TL1B 1ZTTA 3I0RB 3MR3A 3DMJA 4YMEA 3DI6B 3IRXA 3KHHA 5KT4A 5HP1A 4MIAA 5KFFA 2D41A 4EBDA 4R8UB 4Y2CA 4ID5A 2V4QA 1TKTB 3NAIA 3SFUA 2WB4A 2I1RA 3DM2B 1RAJA 4ZVFA 1RT7B 2XGPA 4J9QA 4NLOA 3PR5B 3DRPB 2FVCA 4K4SA 3DDKA 3LANA 3BSNA 4K4WA 5F8GA 3GILA 4PUOA 5KT5A 2R8IA 3DOLA 3DLEB 4ZHRA 5C42B 3RAXA 5DQHA 2BANA 3QZ8A 1S0MA 2CKWA 4ICLA 4I7FB 3JSMA 5KFUA 5KFXA 4O3NA 4DL5A 5KG3A 4EEYA 2R2RA 5C5JA 2JEFA 3NL0A 1XR5A 3BSAA 2D3UA 1S1UA 3DLGB 4WXOA 2HNZA 1DLOB 5CYQA 4K4VA 5L1IA 2HNDA 5C25B 4ZPDA 4MFBB 1RTHB 1ZTWA 2BE2A 5J2MA 2YNGB 4O44A 4IH5A 4KAIA 3DRSB 3KK1B 2R2SA 4TY9A 1TKZB 5L1KA 4ECYA 1TL1A 4KHMA 3I0RA 1TV6B 4TY8B 5KFVA 3GV8B 4DL2A 2JEJA 1RTJA 4G3IA 3KNAA 1TQLA 4KHRA 3DI6A 2R8KA 4TYAA 2B5JB 4WFXA 3G6YA 2RDJA 4Q8EA 5KFMA 4RW8B 4NRTA 1TKXB 1NHVA 5KFGA 4ECQA 2E9TA 3DYAB 4R8UA 4J9KA 4ED8A 1HMVB 5KG5A 3PVXA 1LWCB 1TKTA 5F8HA 3G6VA 3DM2A 4LQ9A 4ECUA 1RT7A 4TQRA 3V6KA 3Q8PB 5DGBA 4R5PB 1LW0A 1SUQB 4LQ3A 2IA6A 3DRPA 3CWJA 4QPXA 2D3ZA 1SV5A 2OPQB 5I3UB 4KFBB 5JXSA 3M9NB 2W9CB 3Q8QB 1FKPB 3CJ0A 3V4IB 3GV7B 3DLEA 5C42A 2B6AB 4IRDA 3ITHB 4O4GB 1JLEA 3EZUA 4I7FA 3DOKB 3IN5A 3KHRA 2OPRB 2IBKA 5KFOA 2VG7B 2ZD1B 3OLAA 4ECRA 2GIRA 2OPPB 4I2QB 3I0SB 3KMQA 3DLGA 1DLOA 1S9GB 2HNYB 5C25A 2FVQA 3V6JA 4MFBA 1RTHA 5KFSA 5F8NA 1RTDB 4YP3A 1HARA 1VRUB 1C1BB 1QAIA 3OL9A 2VG5B 2YNGA 3RAQA 3DRSA 3KK1A 3LP1B 3H2LA 4IQXA 3V81B 3KLEA 4RNHA 2AQ4A 3M9MB 3BSOA 4TY8A 2JEGA 3FFIA 1RT2B 3MECB 1TV6A 4JV2A 1S1VA 2WRMA 2B5JA 4M95A 1QUVA 5KFHA 3H98A 4RW7B 4O3QA 4RW8A 1TKXA 4WYLA 2W9AA 1HMVA 4IH7A 1LWCA 3MR2A 5DQIA 3KOAA 2BRLA 2WK4A 4O3OA 1JLQB 1T05B 1S9EB 1GX5A 4R5PA 1SUQA 2AX1A 5KFQA 2V9WA 2XI3A 1EETB 4URSA 3KJVB 3MEGB 3JYTA 4QW8A 5I3UA 2V4RA 4KFBA 4Q0BB 3GIMA 3GIIA 1C2PA 2XC9A 1FKPA 4MIBA 3QO9B 4IG3B 2W9CA 3V4IA 1BQMB 3LAMA 2IC3B 2YNHA 2B6AA 1YVFA 4NLYA 2W9BB 4ECSA 4ZMMA 4NLGA 4O4GA 4TXSA 1NNDA 3I5AA 3DOKA 2O5DA 5KG2A 3M8PA 3BQ1A 4WYWA 2OPRA 2VG7A 2ZD1A 3IS9B 4NLRA 4F4YA 5KFYA 3I5CA 3QLHB 2C2EA 4I2QA 2FLNA 3I0SA 3N6MA 4RW9B 1S9GA 2HNYA 2YKMB 4JV0A 1RTDA 5J2NB 1I6JA 1VRUA 1C1BA 4EO8A 4IDKA 2VG5A 3H5YA 5KG4A 3G6XA 1VRTB 3FQLA 5KFPA 3LP1A 1JLGB 1RTIB 3DRRB 4PWDA 3V81A 1C0TB 1W25A 3BR9A 3HVWA 4K4ZA 1RT2A 3MECA 2BQRA 2R8JA 3M8QB 4GC6A 1JLCB 2UVUA 3H4DA 4RW7A 3BSCA 3UPFA 4FBTA 3GIJA 2YNIA 4JUZA 4ECXA 3T5LA 5KFKA 3MEEB 2FLPA 3C6TB 4F4ZA 5D3GB 4H4MB 4HKQA 1JLQA 3LP2B 3MFHA 1S9EA 5I42B 1LWEB 3FQKA 3C6UB 4YR0A 1EETA 4ED7A 3PW5A 3KJVA 1R0AB 1JLBB 3D28A 5KT2A 4RUAA 4Q0BA 5KT3A 3OHAA 4YR2A 3QGGA 4IG3A 1TP7A 2HAIA 1BQMA 3M9OB 2IC3A 4ED6A 2W9BA 2J6TA 1DTQB 5EWGA 1RA6A 3RB4A 3CJ2A 5F8JA 1IM4A 5HROB 2R8HA 1S97A 3T5HA 3QGIA 5JUMA 1JX4A 3E01B 3IS9A 1JXLA 4MK9A 4EO6A 3TAMB 3KLGA 3QGHA 4WZQA 2WTFA 5DG7A 5C24B 2DPIA 1S4FA 2FJWA 4Q45A 1S1TB 2YKMA 4RNOA 5J2NA 4FBUA 2C2DA 4KV8A 2XI2A 3MFIA 1IKXA 3TVKA 4RNMA 1VRTA 5J2QB 1JLGA 1RTIA 3KLFB 1C0TA 2C2RA 2FVPA 2FJXA 3T5JA 3M8QA 3FRZA 5KFAA 1EP4B 1JLCA 5J1EB 4WXWA 2XCAA 3D5MA 2UUWA 3KLIB 3CVKA 4MKAA 5F8LA 3MEEA 5KFLA 4KO0B 4Y3CA 3MR5A 5D3GA 4H4MA 1DTTB 5T14A 4J9SA 3T1AA 2JLEA 3HVTB 5I42A 1LW2B 1LWEA 3C6UA 3PR4A 2XGQA 1C1CB 1JLBA 3MR6A 2ILYA 3IG1B 2VA2A 2YNFB 4I2PB 2RDIA 4XO0A 3HHKA 1S10A 2J6UA 4DEZA 3NBPB 4RW4B 3EPIA 1DTQA 3OSNA 2W7OA 2UVVA 4NLWA 4Y2AA 3UDLA 5HROA 1BQNB 1HQUB 1S1XB 4NLQA 5EWEA 1RDRA 3CDWA 3E01A 2FVSA 4U6PA 3DLKB 4EYHB 4NRUA 4G1QB 5KFBA 4ZP7A 4Y34A 5DLFA 2WOMB 2ZE2B 3BQ2A 1C0UB 1S1TA 2J6SA 4QW9A
chains in the Genus database with same CATH superfamily
4LBHA 3P96A 2IAJB 5D0HA 1VBXA 4KKOB 3NGUA 1PG5B 4NE9C 4F4XA 3V6HA 4IFVB 3KK3B 3NKYA 4HT7A 3C8YA 2WAQD 4NCGB 3E3XA 2HMIB 4F3QA 2AP6A 1NSAA 1NBEB 3Q0AA 1FNMA 2KRBA 5HQMA 3UR3C 1RWNB 5EHHA 3DLKA 2GW8A 2ZE2A 3OL8A 3H59A 4MK8A 4ZA1A 1RT5B 2FC8A 3PRBA 5CYJA 3R97A 2B43A 4DQQA 2JDJA 3OTOJ 4CT9A 2F4FA 1DQAA 4C11A 3QATA 5A0YB 1T05A 4ZPTR 3EGZA 2QLBB 3T3FA 3EVOA 2Q66A 3LPYA 1YK9A 3JS9A 3QLHA 2XEXA 2IM3A 1H6KX 4LBIA 2ZOGA 3HO1A 4RW9A 2DKOB 4ZDNA 2DR6A 2RRAA 4KHPF 2KYXA 4A8MP 4NZ6A 2R2UA 2P6TA 4QIVA 3THTA 2GA7A 1GXUA 1MMLA 5GVQA 1WG5A 5B0BA 4YQWA 1BLUA 3X3UA 2GJ2A 2VDIA 1GNKA 2V8HA 1QJHA 3W63A 3G8TA 2R8GA 1RT6B 2ALZA 3JAMU 1RA7A 4Y2IA 3B82A 1KOOA 4ZPWR 2CDRB 4MKYA 2PE8A 1XMBA 2Z4PA 1UVLA 4OV6A 5HMZA 1TVRB 2UVRA 5DLGA 1FRIA 4I2PA 4RW6A 3M2UB 4PWDB 4XIUA 4YUDA 1CJVA 4EI2A 4CYUA 3VVUA 2R3VA 3HFZB 4M5MA 2H65B 3R27A 3DGPA 2KO1A 1UVIA 1IKVA 1FK9A 9RUBA 4PUOB 1CJKB 3RBDA 3CO9A 3K17A 2KVIA 2GVDA 4ICLB 1ZAVA 3RGIA 4J9OA 2FGOA 1NCLA 3OFEA 3VGUA 4YY3F 2BOAA 3ENWA 2CPHA 3OTCA 3LGNA 2POKA 1UP1A 1TL1B 1ZA1B 4ILMA 2CA9A 4CTAA 3KG4A 1T8EA 2XSFA 1XNQF 5HP1A 2XYGB 1N0UA 4BHQA 1MSWD 2MLYA 3K5PA 2G1DA 4FYVB 3DDKA 3K58A 4ERDA 5DDQC 3DOLA 1SL2A 5C42B 2HFVA 2R7WA 4ED4A 4OYWA 4PXDA 1LQ9A 3TOQA 2XB2D 4I0WA 2NPFA 3W2VA 3S8SA 4MFBB 1YJWS 3DNCA 2G0IA 1VS3A 1Y5IB 3A8IA 3FC9A 4CM0A 2RT3A 4WFXA 2E1CA 1XQIA 4R8UA 4A46A 5LMNF 2IRXA 1RT7A 3V6KA 1SUQB 3N79A 1KQFB 3CCTA 3M9NB 3CJ0A 4OYBA 2OLWA 4J9VA 4FDFA 4NXNF 5KFOA 1ICEB 4AXIA 2NXJA 5H9EK 4CNYA 2Q3PA 1KTVA 3G82A 2I38A 4DUTA 4Z7CA 5HVGA 4JV2A 1TTHB 2WRMA 4M95A 5KFHA 4PYDA 4DFKA 5IT9Y 5EX3A 2KFNA 4NA3A 3VGVA 5D4PA 1YIJS 2MQLA 4ZMMA 2FD2A 5DS7A 4NLRA 2O1PA 1VQ7S 2F1FA 2VONA 2KKHA 1FRXA 3M8RA 3CCVS 2V2ZA 1NH7A 5B0EA 3CB4A 4WF9Q 1Y0HA 3K7RA 1AB8A 5D78A 4IO1A 4HTIA 4JUZA 4DR5J 2WSCC 3MFHA 1ELOA 2DCUB 1OY9A 4DR6J 1EQMA 2W9BA 3CJ2A 5F8JA 1Q8IA 1X4GA 4L74A 1RGVA 5JUMA 1VQ4S 4EO6A 3TAMB 1D9DA 1OYEA 2W2QP 4KV8A 1FDBA 1N88A 1IKXA 1JLGA 2K7JA 5KFAA 4X65F 4DSIA 2GJIA 5J1EB 4WXWA 1FDNA 3VAIA 2HG4A 4DV2J 4OYZA 4J9SA 1I94J 1C1CB 2YY3A 2ILYA 3BO4A 5E5NA 4D3GA 1DTQA 4Y2AA 1B7YB 3BEGB 1F0XA 1QAXA 4OLPA 4P2FA 3R5AA 1X9MA 4JV1A 4LFCF 2AF6A 2D1CA 3CO0P 3GR1A 5F8MA 1JIHA 4H4OB 3OVAA 2PC6A 1KLMB 3GMGA 3UNYA 3ZTSA 2DIVA 3VAFA 3OVBA 3CDUA 3MAHA 3SXLA 5GADI 3RB6A 4QZVB 3H0PA 1HQUA 1SI9A 3CJKB 2EK1A 5KG1A 4O3RA 2HHPA 2VV5A 4JP8A 1KN6A 4FKYA 1F5CA 3L9ZA 2EBGA 2QL5B 1RHMB 1KC8T 3CEDA 3OXGA 4FVMA 2DGSA 2GVZB 3MDFA 1JJHA 1N5TA 1S99A 4K4XA 3K8VA 2Q43A 1GQEA 1EQ0A 1RU1A 1NK0A 2UV8A 2DGQA 2KHDA 1F60B 5AT1B 4QCLA 2UVWA 1T03A 2DGOA 2HW3A 2O3DA 2OEKA 4O0IA 4Q5VA 3F44A 3ILIA 3SFGA 1ZAWA 1U0SA 2DNYA 2GMLA 1WC1A 2KXFA 2ZDPA 2KB2A 3C14B 4M63A 5HMWA 2XMAA 2XY5A 1JWWA 3QT6A 1J5OA 2V34A 2VQFF 3MCSA 2U1AA 2MQNA 3CCQS 3HULA 1JLFB 1LFPA 3POTA 4NLXA 3JYTB 2OUGA 1TL3A 2IM2A 1IBKJ 1YJ9S 1RT4A 4ZK7M 3LW5C 1DFDA 1VQKS 5L1LA 3JTPA 4DZDA 3MTKA 5B09A 4I64A 2M0GB 1GH8A 4A8KA 2ZWOA 4YDXA 2D74B 4QWAA 5A2QU 3ENVA 2E7XA 4G1QA 3MM7B 2FY8A 3UDEA 2L9DA 4ED1A 2MTLA 4WIIA 4NX9A 3L09A 1FJGF 2YQ1A 4IFYA 4DR4J 3PV8A 3IRWP 4EK2A 4ENOA 3BV8A 1QSLA 4M8LA 3C16A 4WKYA 1L3TA 1TFYA 3BS9A 1YJNS 2B9YA 3PEJA 2F3JA 2G0CA 3SFUA 4OFZA 1MROB 4J9QA 2DNPA 4ZVRB 4BC9A 2UUCF 4GKKJ 4F7VA 1HW8A 5GAGI 2P5VA 2WVBA 4KH0B 4DV6J 4K4VA 5CYQA 1SKUB 4N56A 3EMTA 2ZBPA 2ROPA 2YNGB 8AT1B 1R7IA 3OR2A 4KHMA 4TY8B 1TV6B 5LOQA 3SZ2A 2XBPA 1TKXB 1U25A 2X51A 5IV3A 4R25A 1HMVB 1WOPA 2CZ9A 4WP9A 3SBMA 1NKEA 2DT9A 5I3UB 2CQ3A 5JXSA 5HMXA 3DLHA 1R8PA 4WU2A 4KH1B 3ZNJ1 4B9TA 1S9GB 3FBCA 4RR5A 4EGLA 3MUVP 2W2PP 2ZHBA 3H2LA 3M9MB 3BSOA 1IBLJ 1R27B 1S1VA 3MAAA 2BJDA 2BZ2A 2HYIB 3PJ9A 3GYXB 3FNNA 2XLKA 1JLQB 2N3LA 4GKJJ 1VK3A 4IOCQ 2UUBF 3KWMA 1H72C 2DGTA 1AZSB 3B6BA 3D6MB 1VHIA 3I5CA 2ASYA 1VQ6S 2HNYA 3MM9A 1RP5A 2VG5A 3FQLA 3LP1A 3SSSA 1RCXB 3HVWA 4HACA 3RUBL 1Y3KA 4K8RA 3W65A 4DS5A 4H4MB 4FVCA 1WF1A 5I42B 7FDRA 1TP7A 1PKUA 4ED6A 4USKA 4OZLA 3T5HA 1MMDA 2UXDF 4MK9A 5C2GA 4IQMA 1TK8A 2HEKA 4RNOA 3UVJA 4ETZA 1RHRB 1NK6A 2ZJQQ 3T5JA 4IUFA 4UY85 2ACMA 3BM7A 3CVKA 5F8LA 4O0NA 3QRRA 5LSRA 3ZC4A 1UJ5A 3PYEA 3IG1B 2G4BA 1TMMA 1NSPA 1CC7A 2Z30B 4DEZA 2QLXA 3F41A 1V3ZA 2AJ0A 4C0HA 4DZ6A 2CQHA 2KFZA 2XMJA 5LJ3Y 1YWXA 2NZ4A 3T1HF 1TKZA 3KLFA 2DR9A 2F63A 4FF3A 4X84A 4MIWA 4O23A 4UZBA 5B08A 1YBAA 3A1YG 1J5EJ 3BZQA 1H98A 2QV6A 3L7PA 5A8KA 3C15B 1HBOB 2CZ4A 4O4RA 1VLYA 3TO8A 4DL3A 1C0UA 1WTBA 1MU2B 2Y1JA 3M8WA 4HR2A 5F8IA 3GV5B 1P1LA 3LGHA 3QGPA 1N5YA 4WFZA 3KJNB 1X4CA 1FCAA 4ECVA 2W8KA 4OMFG 4EWTA 2B4OA 1YRUA 1RWPB 5KFEA 3EWGA 2DH7A 5KG0A 1KSPA 4M5DA 3TX0A 3AH6A 3G2XA 3PFOA 4A8FA 2BOPA 3HK2A 1S4EA 5H1SV 3GTYX 1WEXA 4OHZA 1S6PB 2JH3A 4FXVA 5E3QA 1N56A 7AT1B 4J9PA 3TA0A 2UU9F 1QM9A 2RKIB 5L8RC 3M6WA 1KRPA 1U0HB 2YKPA 3BGRB 2CPJA 2V9KA 4UUXA 3T41A 2PA8D 2X3GA 5DO2A 3PTWA 4C8LA 2IDLA 1HHQA 2BVZA 2E9ZA 1LWFA 4P2XA 4QQBA 1ACMB 5ETLA 4RNNA 3KMSA 4A8XA 3Q23A 4NYZA 2KN4A 5AE1A 5AE2A 5J2PB 3Q8RB 4ZIVA 4ATNA 3CNQP 4DG1B 4LR8A 5DRKA 4RWWA 1MMNA 4CLPA 1S7IA 4WZMA 3BGLA 2QGFB 2MKKA 2RSQA 2DNQA 5ETKA 1PYSB 4BS2A 1GX6A 4LFAF 1RAEB 4TQSA 4H4KC 4DSLA 1HWLA 2V50A 1E6VA 2C3OA 1KVJA 1XR7A 2BANB 4KKOA 2RHSB 2W2NP 3G71S 1VFJA 2BJ1A 3OQ2A 1D8YA 3KK3A 4X4QA 1G4CA 1K0VA 1T3NA 4K4TA 5HVFA 3DI6B 2W01A 4XK8C 1DARA 1TKDA 2FHKA 5LSLA 2HRYA 3DRPB 4XDDA 3R6GB 4UUWA 4BCAA 4DU7A 5F3ZA 5KFUA 3UCGA 2IIHA 1XR5A 4NMLA 3QFWA 3U27A 2CUYA 2RNEA 2BE2A 2DNHA 4ECYA 2JEJA 4QIFA 1GK8A 5D0RA 1LWCB 4A8OA 5HK4A 1S6UA 1NH8A 1RKIA 2E7WA 1REGX 5E33A 2V67A 3SEOA 4MMOA 3VR1A 1HD1A 3UD5A 4YP3A 1HARA 2XLIA 3DRSA 2ZH8A 3PDNA 5IV4A 1Q5YA 1F5AA 4WYLA 3RU0A 3PCOB 3PNIA 3C2PA 3A13A 1TAUA 1GFWB 4DUYF 2V9WA 3NMRA 3F73A 3QNWB 3V4IA 2MKYA 1UTAA 5KG2A 2PEHA 1X5TA 1BUXA 4F4YA 2VOPA 1CQNA 3PX6A 2HS3A 1LV5A 2IBOA 4P72A 4PWDA 4F8RA 1Y00A 1FWKA 3JQMA 4RW7A 2J8AA 3VZHA 4F4ZA 4C3MA 2HURA 1U1RA 3KJVA 1R0AB 2MLXA 1X4AA 2HAIA 3QBCA 5HROB 3UN5A 4P2MA 4DCJB 2PO4A 1IVZA 1Q5VA 1AW0A 2C2DA 1TZ0A 4WPAA 1FVSA 1GMWD 4JI3F 4UW2A 3CJQA 4EFAC 3D6TB 4I6AA 3DRXA 1HBMB 1Z2LA 1VC0A 1VYAA 4XO0A 2J6UA 5A8RB 2JRSA 3FEZA 1UEVA 4P73A 2F65A 3T6BA 4JV5J 1BQNB 3OT9A 2XO7A 3F56A 4U6PA 4DWIA 4Y34A 3D1QA 2DISA 1HBUA 2LA4A 4FYXB 2JZ5A 3H5UA 3KG0A 3M8SA 4FNIA 2BACA 1N54B 2ZNYA 3TVZA 2I0XA 2IJRA 4G1PA 4KO0A 2XCPA 1DTTA 2DRBA 5K14B 2HS4A 2AGPA 1XIQA 3M2RB 4OHVA 5CZXA 3HHNB 4MJKA 3CCSS 3EGVA 1FE0A 2BJEA 4ED2A 4ID5B 2PT0A 4N8NA 3FUYA 3ET6A 1HYSA 5L1JA 3MM6B 3RRGA 1KR4A 4Y0FA 4DL0C 1ITPA 4HDHA 4LRAA 4YFUA 1HNIB 5B0FA 2BW2A 1ULRA 4F0MA 4FS1A 1CG2A 2DNZA 2HQFA 4IRCA 5FDLB 4X66J 4LRDA 5BJRA 4Z7YA 4B3OB 3JSRA 5F9LA 3HD1A 4LSNB 5KG7A 1FE4A 2FLLA 1REVB 2H48B 2C2KB 5DGAA 1NM2A 1JKHB 3P8BB 1KHVA 1HPZB 3KLEB 4Y6IA 2OPSA 5DQGA 2HQGA 4BWJA 5KFDA 4CQ1A 2OTJS 3TAMA 2LQJA 2FZGB 3PX0A 3R7NB 1FD2A 2M9KA 2DNGA 1VQMS 1IWAA 3M32A 1L5UA 1RSCA 1SIZA 4N7TA 1U2FA 2MQPA 2HHHF 2P8IA 2IM1A 2MKHA 3OVSA 1SC1B 3H40A 3DMJB 3A3PB 5I3PA 3IRXB 5G4DA 1P8GA 2R7TA 5ADZA 2RS2A 3QYYA 4KIAA 2AMCB 2KM8C 2AGQA 3C66A 2J0XA 3EICA 3O2IA 4TLQA 1UW4A 2HNDB 1VR6A 4ED0A 3QZ7A 2MY8A 5G0RB 2PI5A 2RQCA 1ZBTA 3QT7A 4Y2CA 2HHTA 1TKTB 1FXRA 2WB4A 3H7HB 4DPTA 3A8KA 3LANA 3ENAA 1F1BB 1NDKA 1GMVA 3LO3A 2Z2LA 4I7FB 2R2RA 3ONQA 4HT5A 4F4KA 4JI0J 5ETOA 1X0FA 4DX5A 2P2CB 1AA1B 4DOZA 1APSA 1RBLA 3GV8B 2F9DA 1KDNA 5KFGA 4LF7J 5LMUJ 2K06A 4C9DA 3G87A 5F8HA 4USTA 1XMOF 2BE9B 4A47A 3MMBA 3CWJA 4CT8A 2M70A 5HL7Q 2EXUA 4J90A 4JBCA 4ECRA 2V69A 1IWGA 3DLGA 1PGZA 1ZPWX 2JLFA 4LR9A 5KFSA 1DBDA 2CQ0A 1C1BB 3KK1A 4RNHA 2VFRA 4LF5J 4O3QA 3ZNUA 3HKZD 4WTOB 4O3OA 1FO1A 1GX5A 4R5PA 1M5PC 2OEJA 3JYTA 1FJ7A 2V4RA 1V9OA 2EWHA 3QO9B 2HVDA 4ECSA 1M1KT 3BQ1A 2HK3A 5CD4A 2QN6B 3MMJA 2ZD1A 4CLZA 1ZM4A 3JQJA 4TKTA 5A8WB 4RL1A 3K8WA 4PEOA 3CCES 5KG4A 3BR9A 3P5BP 3I32A 2R8JA 4V19X 3I56S 3D1HA 3D9BA 2M2BA 3OJSA 2MHEA 3NGRA 1WKLA 3FQKA 3HZEA 4OQJA 4KYZA 3ILOA 5DETA 1I94F 2ZFHA 2BMBA 4G1IA 5J2NA 1VHFA 1WI8A 3D6FB 3NP5A 1RTIA 5IT9U 3HCXA 4LF6F 1WC6A 2H4WB 3ULHA 2VB6A 4Y3CA 5THWA 1LOUA 5T14A 1VOMA 1LW2B 3R6LB 1JLBA 4M5GA 2VA2A 1MWYA 4KHPJ 1PAEX 2PMHA 3RJMB 8RUCA 3CDWA 2XMWA 3DOMB 5DDPC 1ZAXA 2DHSA 1UVJA 5KFNA 2DGXA 3QRQA 1BY9A 4F02A 4MKBA 2KM8B 2AT1B 3NBPA 5EDWA 4CLFA 2DR8A 4X4RA 3SMZA 5DZ7A 2WOMA 4X4NA 2RILA 4USMA 4RUHA 2IVYA 2N7YA 4ER8A 1ZA2B 4QU6A 2IVFB 4HH0A 4WTYA 3IM9A 3D0HE 1T11A 2ATCB 5D4NA 2MXYA 2XSJA 4O3SA 3FVYA 1N6QA 2EFPA 1JJ2R 1S6QA 3TEGA 3E51A 1LW0B 4KTQA 5IC4B 4O3PA 3FSXA 4YY3J 5ETQA 4GMKA 5DDOC 3KLVA 4MAKA 2VBWA 3W9JA 4USJC 1XNQJ 3RAMA 3OL7A 1RT1A 1OSDA 5A6PA 3AT1B 1FNXH 4ZVQB 4ECZA 2V8GA 1VBYA 4LSLA 1NU4A 2YKNB 4DCOB 1M1GA 2DO0A 3N9UC 2H3EB 2KDOA 1HNWF 2GX8A 4CI0B 2QE5A 1UWBA 4GRSA 2EFQA 1NO8A 1S1WB 4OZ3A 2KT2A 4NLSA 4NLUA 2DB1A 3NRBA 2GHVC 2HWTA 2WONB 1Q0NA 4WFAQ 5HLFA 5LMNJ 3PYGA 4AL6A 1EHWA 3AOAA 4CLYA 4M94A 1PYOB 1Z1ZA 1OY8A 2HKEA 3B8HA 3M6UA 1N4LA 4ZVEA 4LVNP 4OI4A 4NXNJ 1VC5A 4NLDA 3KKFA 4ZCKA 4C4WA 1URRA 4Z2XA 5LSOA 4FS2A 2IA0A 4CWBA 4U9RA 2WBRA 5D4OA 2OI2A 2PI4A 5J2MB 4OI6A 3P3DA 1SXLA 2R7OA 3D3CJ 2YWKA 1C4AA 1I51B 2WZ1A 1E6YA 2I1RA 3DM2B 2VJVA 4RBVA 2I6WA 2DGWA 3W2WA 2CPEA 3O6QA 4X4PA 2HK2A 4BBYA 2BJ3A 3FK4A 1ZTWA 1XC9A 4IH5A 1UVNA 1PCAA 1NXIA 5IFMA 2HGLA 3TUJC 2E9TA 1RAHB 2CPXA 2KH9A 1TUWA 2AZ3A 4ILLA 2E5JA 2MZQA 3KJQB 2W9CB 3Q8QB 3F0NA 3HMJG 2EW9A 3MM8B 1FXDA 3DOKB 1KVKA 2BKNA 2VU5A 2DY1A 3D3BJ 2MJNA 2DR5A 2MQ8A 1A9NB 5FIIA 1SL1A 2ROGA 3NEKA 3R5JB 4FPRA 4Z37A 1SIWB 2H54B 2Y1IA 5D6GA 4BC7A 4JB8B 3AQPA 1SJFA 4LFCJ 1PSDA 2Z2YB 1NJWA 2V4JA 3QWUA 2HIYA 2UXBJ 2C2EA 2BA9A 1XJWB 2HQ3A 1F6TA 2CVIA 1VJQA 3D7SB 1W25A 3DRRB 2DK2A 1RT2A 1P9QC 5L9NA 4DX6A 2KVQE 3GE9A 5KFKA 4L3KA 1N52B 2CNKB 3R5GA 3SCLE 4A8YA 3S01A 2VIHA 2BYCA 3Q8VA 2J6TA 1RE1B 1OY6A 2DHGA 4RLEA 2WVFA 4AFFA 1JXLA 4DX7A 3EDQB 2NPIA 3MM5A 3R5CA 2J0SD 1NEEA 4KGXB 1C0TA 3AJ1A 1K0TA 4LREA 3CMAS 5KFLA 1CJTA 2H4YB 3MR5A 5D3GA 4C7QA 2F8HA 3C6UA 5D8HB 2QT7A 3T6JA 3CCZA 3DLLQ 4NLQA 5B0AA 4NRUA 4ZJLA 1JNZB 4CO5A 1S1TA 2JVRA 1FNOA 2C3MA 4OZJA 2AJ1A 1IBMF 2E5HA 4OV1A 2FIUA 1X9SA 2BDPA 4JI2F 3HT3A 3HT0A 3HVTA 1R8HA 2VQFJ 3CIZA 1SH3A 4QYRA 3M30B 4H54A 1RHUB 1U7LA 2CNOB 4CH1A 3MTJA 4E2FB 2LDYA 3GSIA 3I9V9 4X4VA 3KLHB 2J76E 1VCTA 3FRYA 2XQCA 5MLCV 2BX6A 3JSMB 1RAOA 1S1UB 2GJFA 4KB7A 4RUCA 3I55S 2NXEA 4D3HA 2DD8S 2COLA 5E3AA 2EC0A 5KT6A 1FJGJ 3EGWB 2RQMA 2XWYA 1LNQA 4BDPA 1PAUB 1YRXA 3TZYA 1LXJA 3Q24A 5ETSA 2EFOA 1RQ0A 4ZVPB 2HFNA 2R2TA 2ZH6A 2EPIA 1HNVA 3BN7A 5CYMA 2RAQA 1CSJA 3BB5A 4F36A 2HWHA 1FKOB 5CH7B 1R0AA 1YZ7A 2Y0SD 4AE5A 3ISZA 2UUCJ 2M52A 3D4JA 2CJQA 4DCPB 3HKWA 1S76D 3SV4A 1CJUB 2RRNA 1A7GE 4DSKA 5L9XA 2HFUA 4ELUA 2QEXS 1SH0A 2OH2A 4W98A 2LKZA 1XBWA 3KHLA 1BD6A 2XLJA 2OFHX 3P5TL 2W7PA 2G2YA 4CRJA 4RWXA 2FC9A 4ZN1A 2RD5C 4W90B 3M1VB 4HDGA 4DV3F 3R2DJ 2DNRA 4OIXA 4YEAA 3LP0A 5K8PA 1X8DA 3BREA 1JLAA 1H2TZ 3D68A 4DV4J 2ATLA 1Q86T 2HQCA 2PSZA 1IQZA 5DG9A 3AY0A 4H4KA 2X1AA 1RWVB 2OD4A 5KT7A 2NREA 1RB0A 2J9EA 1TU0B 4ZVOB 4ID5A 3HM9A 2ZEJA 3A8JA 2FVCA 6AT1B 3BSNA 1WELA 3MM6A 3QZ8A 3JQKA 1R89A 1DY3A 2CG4A 5L1IA 3M6VA 4KPCA 1RTHB 1FTCA 4KAIA 2VPZB 4GVBB 2HHVA 2H9ZA 1HWJA 2YTCA 4TYAA 4NWBA 4PCQA 1XTZA 4RW8B 4NRTA 4QYZJ 2UXDJ 1YJ7A 4K2XA 3J81Y 2OPQB 1WTFA 3DLEA 1T9UA 2FJDB 3CMES 1NLKL 3AODA 3IN5A 2GMHA 2IBKA 3GONA 3PRVA 2DO4A 1SJRA 3MXHP 1DLOA 5CD4H 2FVQA 4I4BA 1FTRA 3RAQA 3SIPB 1H7XA 1YKWA 3KLEA 2HFSA 3VHQA 4E98A 2B5JA 5FD1A 2DNNA 1RWOB 4DHVA 2XO6A 4DFMA 3MUMP 2A10A 3GIMA 4AQYF 3KTQA 5CHCB 4NLYA 1NNDA 3O5TB 2VBXA 4PPZA 5KFYA 1ZM3A 4I2QA 3FZBA 3CC2S 1QD1A 2K7KA 1QVFR 1HA1A 3H5YA 2V6AA 5EN1A 1VRTB 2XHWA 4OHXA 2Y0BB 3N01A 1YJUA 4DU8A 2KXHA 2UVUA 1G2EA 2YX7A 1WF2A 4W4MA 4LIWA 2MPUA 1R3NA 3D28A 4DQIA 3M7VA 4Q0BA 2K3KA 5AE3A 3E8OA 5M2UA 1YGYA 1ZPVA 2IRUA 1S4FA 3RRKA 1SKWA 1TL5A 2H5IB 3UD4P 5G0RA 1F5BA 1XN9A 1PIEA 3US5A 5B0DA 1N34F 1TAQA 2K1RA 5D15A 4X4OA 2Q6BA 1D3WA 1X31C 4DR2J 1KQSR 5GMKa 1ZS6A 1DZ5A 1S10A 1NJXA 2UU9J 1VK8A 4W92B 4ELVA 3KUGA 3KNGA 3CCRS 2HAFA 1RWXB 2ZVSA 1JQGA 4PZVA 3W9IA 2HFZA 3SQGA 2NUHA 1M5SA 4DR1F 2H51B 1M90T 3PM9A 1JK9B 2CAJA 2BM1A 3PJXA 2CJYB 5J1NA 1RYRA 4JI1F 3Q8UA 4K59A 4C8YA 3N6NA 5KG6A 2GAGC 5EWFA 3HF5A 2BJ8A 4CZCA 3LPEA 1Q7LB 4Q2MA 2YQ0A 4UF4A 4ZHRB 2D9OA 1RJJA 2EVZA 1FWLA 4RU2A 2G9OA 3PZPA 2F7VA 4LFAJ 2MKIA 2P9CA 4NEZA 1RLCL 2GGPA 2JHEA 5ETPA 3QO9A 4DL7A 4PQUA 5IWAF 1FX4A 3MF5A 3KK2A 5KFCA 2HLTA 3AXKA 1D8ZA 3PW4A 3HZGA 4QPTA 2ZBCA 1Q8BA 3WIUA 1Y7PA 1T3OA 2CYYA 3DFEA 1S5ZA 4U7UK 2AYEA 1N48A 3ZTOA 4AXJA 3RYLA 3DU5A 2MZJA 1HQEB 1TL7B 1UVMA 1N32F 4YR3A 4X4SA 5CXTA 3T1YF 5T7LB 1EZZB 2CZVC 3G86A 2ZVIA 3AD7C 3J7YU 1VDHA 3HVAA 1IKWA 1SL0A 3VF0B 2DNOA 1ZZNA 5HN0A 4QWDA 2JWNA 1LW2A 1RWMB 1N36F 4X4TA 4CCHA 3PIPQ 3Q2TC 2MGZB 3MEDA 3HDSA 3CJ3A 4X2BA 2FHJA 3V6DA 2VG6A 2LQ8A 4NLPA 2K8GA 2VFSA 4EYIB 3QRPA 1N5SA 2HVZA 2OAUA 4DMZA 1RUSA 1U1MA 4EMDA 1VQ8S 3PO5A 3VV2B 3HHEA 5IM0B 3Q86A 4TU7A 4WBFA 5IOLA 4IG0A 4X62F 1VQ9S 1RT3A 1TFWA 4KGMA 3AQOA 2OP5A 5KFTA 2ASDA 2VF3A 4B02A 2ZH7A 4DUYJ 2XMTA 3EE3A 1A0OB 3D6HB 4EBDA 1T9YA 3P4UB 4JI0F 2X1BA 4ZJOA 4NLOA 4K4SA 2CQ2A 3HHDA 2YKQA 3FGVA 3HSDA 1ZZFA 2CKWA 2FJBB 4EEYA 5C5JA 2JEFA 1JNRB 2HNZA 2RDDA 3A3NB 5C25B 1VQOS 1FKAF 2QA2A 3IR5B 2QRRA 1WHVA 2DY9A 4KHRA 4E0DA 1EJ7L 3PY8A 3CT9A 4FP9A 1PILA 1K73T 4ECUA 4NZ7A 3R1HA 1LW0A 1JJCB 5HSPA 3TR5A 4LF5F 2B6AB 2NXNA 1J2VA 3CDBA 3ENQA 5A76A 3K5NA 4X4UA 1WD6A 3IM8A 4NA1A 3I31A 3W64A 3S1TA 2VG7B 4JI3J 4PRFA 3I0SB 3GB0A 3PACA 5M2RA 2MSTA 3MMAB 2WW4A 5F8NA 2Y8YA 1VRUB 4P6QA 2BJ9A 3FCVA 1RXOB 2RUSA 2HVIA 4M5IA 2VPWB 2QFJA 3H98A 5F41A 1RCOB 3KUHA 4F0HA 5DJBA 4AUKA 3KOAA 1X7VA 2VBYA 3MEKA 5AXLA 2DBBA 4Y00A 1C2PA 3EDRB 4CLUA 4O4GA 4C8ZA 1G3OA 1KNZA 3HJVA 1FRJA 3JXOA 1RTDA 2B9WA 3CJSA 1H7WA 4K4ZA 4OJ3A 3PG9A 1WC4A 2V2KA 5ETVA 3OJUA 4NASA 3S6EA 1X60A 2FLPA 1VQSA 1S9EA 2HBYB 4ED7A 3KUEA 1MNEA 2IC3A 5A6WA 2VBZA 1JX4A 1FRKA 3HHLA 2HHXA 2IVMA 2DIUA 2FJXA 1JLCA 2IY5B 3C3LA 3NNHA 1XEZA 3CTRA 1MN7A 3JTNA 2CDQA 1AFJA 3U7JA 2M3DA 2Z2ZA 5ETNA 4DXLA 5EWEA 2CJKA 3DLKB 2ZE2B 3BBBA 1CQMA 3BJYA 1S72S 2E5LF 3PHEA 1KQGB 3LUYA 2AX0A 3KLIA 3E2EA 4C11B 1V3RA 2QG9B 2BRKA 2DRAA 1NKBA 2VFVA 4ZLPA 3PYDA 2FHOB 2RU9A 1B3TA 2CPDA 3ZZPA 2RIJA 2Z58B 4F50A 1PBAA 4S0MA 2HHHJ 5AJ3F 2CQ1A 2C3UA 3H8YA 3SCKE 2VPXB 2DITA 5ETTA 3NMAA 2YWGA 3AJDA 1MN9A 2BEFA 4QWBA 4P2SA 1T0TV 4M5JA 4YB1P 4X64F 7FD1A 1Q78A 3GG0A 5JJBA 1VRQC 2ZITA 2RHQB 2I5JA 2BABA 2KZMA 3UWTA 2VFTA 1SV5B 4WFYA 4XPCA 1IQTA 2HHSA 2VJUA 4MK7A 3DRRA 1WDDA 3B4DA 5KFRA 1XK8A 1FJEB 4IR1A 2D7SA 4OJGA 4RW6B 1CJVB 2CQGA 4TN2A 2E1MC 2RQKA 3EPGA 4J9NA 1YX2A 3DGPB 3PKMA 1CS4A 1IKVB 1FK9B 3WX4A 3QIPA 3P45B 2I2YA 4GC7A 3B78A 2W2MP 1IJEB 4ETXA 2YNHB 2E5IA 2GVDB 1GMUA 1RI7A 4CLTA 2HQIA 2ZJPQ 1Y3JA 1KP6A 2FTRA 1XMOJ 3I82A 3RBXA 1WEZA 4CTAB 3CCMS 4L75A 5HP1B 2YNIB 3QJLA 4ZCIA 4YS2A 2AV5A 3ICLA 1NB2A 3QJPA 1L3VA 1T9VA 2YWWA 3DOLB 3K0JA 5MAOA 5HBMA 1X0PA 2MZTA 2OMOA 3W2VB 1X5OA 5F9NA 2FUG9 2UUTA 2GQ2A 4URQU 5DZ6A 3R8YA 2HPUA 4LVOP 1W7WA 4R8UB 2V4QA 3QSYB 3CC7S 1RAJA 4ZVFA 1RT7B 3MURP 2XGPA 1K9MT 2AJ2A 2DGVA 2PMZD 5CCMA 1YJTA 3JSMA 1HNZJ 3BSAA 1S1UA 3R7BB 2D69A 4HI1A 2W25A 5CZVA 2LQBA 4ANEA 1R8BA 3DHXA 4G3IA 4Q8EA 4LF4F 4KJIA 2YPYA 4NEYA 3DYAB 4DUZF 3OPKA 2V68A 5JVGQ 3K5OA 4C8OA 1FHTA 3FCHA 3ZTQA 2ROEA 3KHRA 3OLAA 3OUYA 2BXJA 1RABB 4LF6J 3HLUA 1AUDA 2VKRA 3BF4A 1RK8A 2DYAA 2Q79A 2UXBF 3W8GA 4I56A 5F0WA 1YLXA 2AW0A 3BGFA 5E0OA 5KFQA 1CJUA 2LMIA 2VASA 4MIBA 2DNMA 1DQ8A 2W9BB 2M5YA 2IPOB 2O5DA 2J7UA 1MG7A 1PBUA 3LH2S 3N6MA 4USWA 2HZVA 2ZH1A 1JLGB 1F9EB 2BQRA 4DS4A 2CQDA 4K5RA 3T5LA 3H20A 3MUTP 3SDEA 2QFIA 4OI3A 3LGMA 1EETA 4IG3A 1B0TA 1DTQB 5EWGA 1RA6A 3G4SS 3IS9A 1U02A 2PGCA 2NYIA 5DG7A 2ZZNA 4KGVB 2YKMA 1Y10A 1KEKA 2XI2A 3H2UB 3MFIA 1OIAA 2O01C 3TEHB 4C8KA 3LA0A 3LOUA 2CVEA 3M8QA 1KQKA 1T7PA 2J9CA 2ZNZA 3MEEA 1VBKA 2JLEA 3R9LA 1LWEA 4C0BA 3PR4A 2EKYA 4QBUA 2G2OA 4DSFA 4KPYA 3K89A 2A2DA 2RQ4A 3VTIA 2ZZTA 1HQUB 3E01A 3PO4A 2FVSA 3B4MA 1L3UA 2H5EA 3TW0A 5DLFA 1OJ4A 2J6SA 1OQ3A 3K57A 3CIMA 3LALA 4DX8H 3NWRA 1WDTA 5E7OB 3BH6B 2E5GA 4ZPVR 1IKYB 2AHOB 2B7BB 1NK4A 2B4PA 1HNWJ 2UZAA 2HZAA 2OPQA 3UN2A 2ZH3A 3BN4A 4RW4A 1EKRA 3GIKA 1N0VC 5H9FJ 3DCAA 5LM7E 2I9SA 2FGCA 3N6LA 2WVCA 2ZKUA 4OZ1A 2LXUA 4AD6A 1AT1B 3KJFB 4QWCA 4DV5F 1FEEA 3BPDA 1T03B 4RNFA 5C2CA 2MDAA 2GIQA 1Q1KA 4UOFA 3H5XA 1CULA 2FQQB 2HS0A 1X5SA 4XPEA 3N4WA 3NNCA 4IOAQ 3DRYA 1RBAA 4C2MA 4MT1A 4JI6F 5K9FA 4WE1A 2CFXA 5EGYA 1PO6A 1FVQA 2FYXA 2RS8A 1WHXA 2RF2A 1J5OB 2C22A 3RTVA 3OTEA 1NMEB 4ZCLA 1PJ6A 4QR2A 3RZAA 3CF5Q 3CCLS 3POTB 2QLJB 1TL3B 2E1PA 1PYTA 3FKBA 5LL6d 1RT4B 2VC0A 4JYAF 2OD6A 4UZCA 3UDCA 2JLGA 3OL6A 4Y2KA 1ZETA 2E9RX 1ROFA 3PJWA 2B9EA 4OX8A 2XWXA 2AGOA 4I6WA 2M88A 1SJ1A 2RUGA 4C8MA 1D0EA 1CVJA 2N3OA 2BKOA 2IMOA 2Y3YA 2C3YA 1F3FA 4IFYB 1QUPA 4WP3A 2ZUGA 2LEBA 4Q8FA 3MMCA 3C16B 1T9XA 1HBNA 3TX8A 1QE1A 3CCJS 1IM6A 3IXQA 2YVSA 1V5VA 4J9RA 3HSGA 3TZXA 3HSJA 3H25A 4DV4F 4FYDA 1H73A 2A18A 3MHYA 4QOTA 1F3VA 1NHUA 1S0OA 2QA1A 2W2OP 4YHHF 4ZP6A 2ZHAA 4K50A 2RU3A 4OZNA 5D77A 1NRKA 5CQGA 2Z2MA 5CYQB 1WACA 5C7PA 2XYPB 4EBEA 3OR2B 1SC4B 4LRFA 3NS5A 4ILRA 1S6OA 5F3TA 3IWXA 3NAIA 5BR8F 3QT8A 4F3OA 3OXLA 4ZITA 3VAHA 2R8IA 1RTZA 4ZHRA 2V5HG 5DQHA 1TK5A 1HWIA 1FA0A 4O3NA 1URNA 4B9MA 1PC4A 4ZPDA 4WWSA 4O44A 2JFDA 2ALYB 2R2SA 3I0RA 3CJTA 3MAAB 3UNGC 4ECQA 1WSVA 3RBZA 1NJIT 3G6VA 3AHPA 1HW9A 1GMWA 3THPA 3EZUA 2XS7A 1U47A 2JX2A 4EU0A 2LDIA 4FN5A 4MYTA 2HNYB 4TNOA 3MM9B 1UJ4A 3OL9A 2VG5B 4DFPA 1TL7A 3LP1B 3RR8A 2L41A 3PXGa 1ZH5A 1CEZA 3MR2A 1FXLA 3ZZUA 4J7CA 3AJ2A 3ETOA 1B0VA 1IUJA 4KFBA 1FKPA 2R7VA 1VQPS 3DGVA 3R5BA 2OPRA 1HFEL 1IBMJ 5K5MA 2NUUG 4JI2J 2VFUA 3UVJB 4B08A 1UAWA 2XMVA 4DQPA 3V81A 3MECA 2MGZA 4GC6A 4QYZK 3GYGA 3BSCA 3G9CA 3GIJA 1OPZA 3NGTA 3C6TB 3J81U 3IWLA 4HKQA 2KJWA 1UEKA 3IO1A 1NJYA 1BQMA 2CWXA 4DPWA 2XZTB 1YZ6A 3W8PA 1Q95G 4DR2F 3HJFA 2WB1D 3GP9A 3PX4A 3KLFB 1B0PA 1F2GA 4OLOA 4JI4F 2G1HA 2XCAA 2V8VA 2YX1A 4MKAA 2MSSA 4C97A 4OX7A 6FDRA 5HO4A 3T1AA 1VC6A 3NWGA 3OTDA 2ZH2A 4B17A 5DM7Q 5A8KB 2QC3A 3U1LA 1C0UB 2HVHA 2PN6A 3BKTA 3FZ2A 2OHDA 3VQTA 5J2QA 3M4XA 1N5YB 2KJVA 2RJZA 1OWXA 1EP4A 3G8SA 4DPXA 2A6MA 2NR0A 1I1GA 5DG8A 4XAKA 4CO0A 2HIQA 4FXWA 2JL9A 4K4YA 2YNFA 2DXDA 4M5DB 5FLXY 2ZM6F 3GQCA 3IBFB 1S1XA 3TQ1A 3W60A 2EBEA 2XTJP 2IRYA 1B7FA 2IAJA 2OIHA 3MAQA 1K1SA 5B7WA 2GHPA 4ALZA 2B8PA 2JSXA 2IDEA 2GHWA 4IFVA 4B9NA 1UPMB 1S48A 4NCGA 2M8HA 2HMIA 5IQ6A 1LWFB 2BQ3A 4NLTA 2MKJA 1RTJB 2DHAA 4DV3J 2EG1A 1VLOA 1PC5A 2BR0A 3CJ4A 1S79A 3BBFA 4KSEB 4I69A 4V1Ak 2UUAJ 2XS2A 2IM0A 2B56A 1RT5A 2Q1LA 3ADAC 1QSYA 5HJYA 3CPWR 1ZOTA 2KTQA 1HL6A 4LFBF 5BYSA 4UOHA 1S9FA 5A0YA 1LK7A 3SI8A 1RISA 2I8EA 3ZO7A 3H2VE 2VQEF 3FFIB 2YWEA 1UW9A 1N8RT 3VWSA 4ZP8A 4PABA 4ZP9A 2EG2A 3T19A 1RKJA 1MWZA 1E6VB 4TLRA 3GR0A 2J7WA 3M8PB 1QLNA 2V94A 2ADBA 4CP5A 1SQGA 4LBPA 3M6XA 3RG6A 3P49B 3TAQA 2QJ3A 2WVEA 1S7HA 2B8QA 4NXMF 1YHQS 3FMBA 3ISND 2F9JA 2AEJA 2JC1A 3OFFA 3JTOA 1RT6A 1UJ6A 2CQIA 1KOHA 2X1GA 2LU2A 3KLGB 1WNEA 1TVRA 2BE2B 3T9ZA 4OHWA 2NSBA 2A0FB 4QWEA 1FESA 2B0GA 3M2UA 2KRRA 4ZIWA 4AQYJ 3IFEA 2D41A 3CCWA 2EKNA 2CXEA 3IMQJ 4PUOA 4DR3J 1CJKA 4PG7A 4ICLA 2OTLS 4DL5A 5KG3A 3GG1A 3TANA 1HNXF 1EAYC 4K0KF 3ZTPA 2OSQA 3DRSB 1TL1A 1TQLA 3G6YA 1DJ0A 3R5DA 4LQ9A 1QVGR 4TQRA 1FX2A 4QPXA 5AXNA 1SV5A 4OYXA 2LQ9A 1XNRJ 1PJ7A 4KY3A 3V4IB 1P6TA 1WC3A 5C42A 1R0BG 1U1NA 4QU7A 3LTOA 2VUGA 2CRLA 2Z0GA 4C6AA 4MFBA 2GFFA 1N34J 2RB7A 4DV1F 4DR7F 2YKAA 3CMQA 4R0JA 1NDCA 4K7QA 3GCWP 4ZLLA 4RW7B 1P9YA 4GO5X 5DQIA 1YITS 2WK4A 4DPOA 2BW7A 4N77A 1SUQA 4URSA 3KJVB 3MEGB 4QW8A 2Q6CA 1RU2A 3GIIA 3EXCX 1U6BA 3LAMA 4KGKA 2YNHA 4J91A 2CJ9A 2MQMA 5LXRA 1T9TA 2QLFB 3BH7B 3Q2SC 4JV0A 2D3OR 2BE7D 1I6JA 3VAKA 1EIYB 4B3TF 1NAQA 4DR1J 1M0SA 3QAUA 1Y5LB 1FWPA 3JSYA 3IAS9 4DV0F 2FZCB 4JI1J 3H4DA 2YNIA 1U45A 5F0UA 2LA6A 1I3OB 4USHA 4WU3A 3OR1B 2FJAB 1IM4A 2R8HA 4Q7AA 3JB9k 4B3MF 2AD9A 1QTMA 3G8QA 1NDLA 4F25A 3QSIA 1L3SA 1HBUB 3N0VA 5LXYA 3J80U 4DF4A 4M5KA 3OV7A 2C2RA 3QMQA 3ZZOA 4TVAB 5IWAJ 2EFNA 2ZZMA 4PG5A 4KO0B 1DTTB 4QJVA 1O5JA 2RDIA 3HHKA 3V5RA 3EPIA 1BC6A 3VAGA 1BQXA 2ZKTA 3UDLA 1B99A 1U1OA 2HRUA 3ET6B 4HEA9 1HYSB 3W5ZA 3BKUA 5HQLA 3BYPA 2FHJD 1N32J 3AA8A 1RAAB 1GXTA 2X1FA 5J1EA 3DYAA 3FBEA 4F2RA 1C1CA 3QIDA 1K1QA 1VI7A 4DN9A 3T1YJ 5IZHA 2YPZA 5CAAA 4URGA 2CNNB 3W5YA 2KI2A 1PJ5A 2BQUA 2DCLA 3DKDA 1OQ6A 1WF0A 1N36J 3D0IE 4H4OA 1RAIB 4ZVGA 1LXNA 1NK9A 1KLMA 2MQOA 3LF0A 1SQFA 4IOBA 5D0EA 1R0CB 1N5VA 4UY8T 2EEYA 2OPSB 1JXEA 1SC3B 4J5OA 3EGNA 3CD5A 2XULA 1DQ9A 3CJKA 3CCUS 4UOGA 3VALA 3PW7A 2C1EB 1BWEA 4X62J 3HX9A 3M32B 2GC8A 4CO4A 3GSDA 2A2CA 1U1KA 1KVIA 3DXSX 4F2SA 3TJ9A 4YOEA 2VA3A 2GVZA 4LT6A 3CE8A 4U67Q 1SKSA 2VODA 1IN0A 3LWLA 1XMQF 4LJMA 3OSPA 3NS6A 4OYMA 4P7VA 4WCEQ 1OYDA 4A48A 4OJ1A 4B3SF 3ZZRA 2FPHX 4RKUC 3IBWA 1XWLA 4K2JA 2FJVA 4LRBA 3D67A 1KONA 2IFXA 3I4HX 1FERA 3I4PA 3FSIA 4HHHA 3SSRA 3CD6S 2ASLA 4CH0S 1M1HA 4I1TA 4ZPAA 2QZ8A 3C14A 4TU9A 3T5KA 3SSQA 2B4UA 1OPIA 1D9AA 2HHQA 5E3PA 1FEHA 4JI5F 2VH7A 1NZAA 4WP8A 4L76A 2B4VA 2JC0A 4PWWA 1JLFA 1Y9OA 3UCZP 4Q2LA 1OO0B 2DJWA 2MQQA 2WW8A 4F67A 3VAMA 2C28A 3W9HA 4LRCA 2PA3A 4UT4A 1IKYA 1FDDA 1NPKA 5EX0A 3BBCA 3N5FA 3LAKA 3HHLD 5CCLA 1HR0F 1HNZF 3CGIA 3KXDA 5JVHQ 3KHHA 4OHYA 5KFFA 3IP0A 3MM7A 1D9FA 3M8YA 3MMBB 2FZKB 5F8GA 5KT5A 3RAXA 1UA0A 4OZ0A 4Y2MA 5KFXA 1HI0P 3DLGB 5K8MA 4RUBA 3D2WA 3FMWA 2F8MA 3KK1B 2D9PA 2LP4A 5ETMA 4DL2A 2WBMA 1QSSA 1SQEA 2MB0B 4J9KA 3PHTA 1MROA 4R5PB 3FBBA 1EB0A 2OELA 3AFGA 4FYYB 2MKCA 3KDNA 2ZD1B 3CJ8A 1Q82T 2GIRA 3KMQA 1UWAA 4WFNQ 3HFKA 4OZ5A 4DV7F 2L3MA 1FFGB 2YNGA 3GPAA 2ADCA 3Q89A 5LJ5Y 2JEGA 4TY8A 1TV6A 4ZLNA 5IXUA 1QUVA 1TKXA 1HMVA 4F26A 1WG1A 5KOWA 1FT8A 2XI3A 1S12A 2LXIA 2APOA 5I3UA 3FJ2A 1U4BA 2UP1A 4NLGA 2E5LJ 1NDPA 2UXCF 1HWUA 3THVA 1MW7A 1S9GA 1U8SA 5J2NB 1WKKA 2SXLA 5KFPA 2XM3A 1RTIB 1GTHA 4KT0C 3UPFA 3J7Z5 2GQQA 2J0WA 1JLQA 4JI7J 1JLBB 4RUAA 5KT3A 3OHAA 1WOOA 5AJ3J 1O8BA 1AZSA 2XMUA 2FJEB 1TUGB 3AB2B 5CA5A 3W66A 4XDCA 4RO0A 1RZMA 4FZVA 2YQ3A 4X64J 2YWFA 2ZOFA 3D1OA 3A3OB 2EFGA 2UUWA 5GAEU 1YJRA 2CQCA 4H4MA 2CIMA 3A8EA 1NKCA 2QSFA 5I42A 3MR6A 3TUZC 4RBUA 3NBPB 3BDPA 2GAHC 3TRGA 2FB0A 4YB6A 4F0KA 4EYHB 2NS1B 2NXUA 3R1LA 3TWZA 2WOMB 4QW9A 1QTNB 4HLBA 4P10A 2GO8A 5RUBA 4AL7A 1FI4A 4FPIA 1XR6A 1NSKL 4F4WA 1UCNA 2R9LA 3J7YI 1T94A 3BKFA 1Z4UA 4BLGA 3OD2A 3L7OA 3G96A 2YBVA 3IG1A 1IBCB 1U6ZA 2XSJB 1X4HA 4OX9J 2KG0A 4B9UA 1N6QB 3TZZA 3GYNA 4OZ2A 4FF4A 1S6QB 2ERRA 3I6PA 2GZOA 4GO7X 3NOCA 3BPSP 2ZHOA 4HL9A 2DHHA 2BKPA 2YH1A 2XHCA 4EBCA 2YKOA 1KD1T 2HZCA 4MYUA 1AYEA 1RT1B 4G6VB 3P6YC 2XMKA 1Q8KA 1V6HA 4ANCA 1CLFA 1WWHA 4LSLB 3MCNA 3C15A 3IA0A 1HBOA 2VC1A 2HVEA 4NA2A 4ZVUB 1UWBB 5D4LA 1XERA 1MU2A 3UDVA 3C19A 5E3CA 3SCIE 4LSZB 3IAM9 1U2RA 3M8ZA 4K4UA 2O67A 4UOCA 2QX0A 3V2UC 3C6TA 5HLFB 4OL8A 3VCDA 2AIRB 2W24A 3RB3A 5H9FK 2H1YA 4NLVA 2GV1A 1TK0A 2N4CA 1OMSA 2QTWA 1S6PA 2MY7A 2E1RA 4R0EA 4OI0A 2OO4A 2RH3A 4ES3A 3CW2C 4L73A 9ATCB 2RKIA 4KBIA 3RB0A 1D1UA 3H5SA 4IRKA 1U0HA 1YRTA 2H5JB 3BGRA 1HI8A 4DL4A 2XY7A 4LF4J 2AU0A 3JSBA 3W1YC 4DUZJ 1KFDA 4ID8A 2MZRA 1R31A 1E6YB 2LQ5A 3W62A 5J2PA 4IKAA 4QIWD 2Z8QA 3W2WB 4DG1A 3PW0A 4OYPA 4P74A 3NCRA 4LUBA 1HD0A 3MOZA 1K8AT 3TQEA 2W7AA 1CC8A 2G0JA 3MR3A 2AZ1A 2J0QD 2MZSA 2C2NA 4JI8F 4HHJA 3W61A 4KR0B 1V5IB 1UFKA 1D09B 1HHSA 3U1NA 2BANA 1S0MA 1QY7A 1Y5NB 2D3UA 3ELHA 1MLAA 3D0GE 1M5VC 4CNZA 2DTJA 1IJFB 3DLJA 3GZ7A 4ANDA 2ZH9A 1RTJA 3DI6A 2R8KA 1NHKL 2M4MA 1M5KC 2KU7A 5KFMA 1FRHA 2F40A 4PQAA 4QIGA 1VQNS 2LXFA 4LQ3A 3DRPA 1UMJA 3ITHB 2V4JB 1NPRA 1H38A 1NPPA 3GWCA 2OPPB 4LF8J 4PXBA 2B3TB 5SZTA 2C2MB 5GMDA 2AQ4A 3FFIA 1RT2B 4OJHA 2CJXB 4IO9Q 3DLBA 1LWCA 3BYRA 2AX1A 3GLJA 2OFGX 4QR0A 3OFGA 5E41A 4A8SA 4TXSA 3O8WA 3M8PA 2V8DA 2AKWB 5BYQA 2FLNA 3MM5B 1HI1A 3CXCR 2V8PA 4I68A 4DQRA 1Q7YT 4N76A 1C0TB 1CJTB 5D3GB 4A4JA 2VDHA 3C6UB 2KYZA 1X4BA 3U02A 1HIYA 3QGGA 2DVIA 3M9OB 2XNQA 1WOSA 3M2VB 4DV5J 3EX7B 3UCUP 3QGIA 4RJVA 3KLGA 2WTFA 2J8SA 1S1TB 3MD1A 3MOJB 2AYBA 4WIQA 1WHWA 4JI6J 2P9EA 2GCFA 4ZVSB 4F3MA 3HVTB 2HBRB 3NLCA 4ITSA 2QO3A 2W7OA 2UVVA 4OI2A 5HROA 5KFBA 1Q53A 3GJRB 3NGKA 5DM6Q 4JYAJ 3CC4S 3BQ2A 2IHR1 1WJ9A 3KHGA 1N33F 4DI6A 2AJQA 5IS2A 3IGVA 4U8YA 3O1LA 3ISNC 2ZUAA 1HBMA 2CG8A 3I96A 3GJTB 1H0HB 5A8RA 2XYHB 3EJMA 2HGNA 1BQNA 1T9WA 2G2ZA 2DXFA 3UR0A 1NK7A 3GFHA 4XTTA 4PAAA 1HNVB 1ZM9A 2L9WA 2Y9HA 1NSQA 1IR2A 3L95X 5CYMB 2UUAF 5K14A 2IMWP 4AL5A 3MEGA 2KT3A 3M2RA 2F4VF 4DLEA 2KXNB 4YHHJ 3CDEA 1LWXA 2YH0A 4NCAA 3CD0A 4C0OC 3L4BC 1R6YA 1SJQA 1NK5A 1WKJA 1BE4A 2WCXA 3TAPA 1CPZA 4ZLJA 2ZWPA 4DL6A 1L3KA 1X4FA 4DQSA 1HNIA 1NB7A 4DSEA 5FLXU 5BR8J 1EARA 1S49A 1JJ4A 1GT8A 3OR1A 2RRBA 3DHWC 3MCMA 4K5SA 5FDLA 1SJ3P 2CQBA 2ABYA 4RX6A 4EZ6A 5IT0A 1T02A 3KFWX 4OI1A 2L9NA 4B3OA 5L38A 2E29A 2ZJRQ 4LSNA 1GTEA 3LP0B 3R3TA 2VPYB 2IYGA 4A8QA 1UVKA 2L48A 2QSWA 1JLAB 4ZS6A 1REVA 1RWWB 3PFEA 1YSJA 1RHKB 5SUHA 1JKHA 4IDKB 5GADU 1HPZA 1U1QA 2ASJA 3OTOF 4KGZB 3DDIA 2VD3A 3J7ZT 2IJFA 3WIVA 2LU1A 3QT5A 4PWUA 4P9SA 1KLNA 1BHNA 2HBQB 5BYRA 2QMWA 1BMQB 4GVLA 1B4SA 3KDOA 1DHMA 2MJUA 3AOBA 1A6LA 3Q83A 3MCOA 4PYAA 4DSJA 3O44A 1UKUA 4DR3F 2CPZA 3AA9A 2K3IA 1FRLA 4ECWA 3FBFA 3QPIA 3BO3A 2Y1RI 3DMJA 3KYLA 2CPIA 2HRTA 3IRXA 5KT4A 1DAXA 3HXMA 2ZC3A 3R7SB 3PR5B 1I5OB 2MMYA 1S59A 4ELTA 3GILA 3DLEB 3BR8A 2XS5A 3NL0A 3AXMA 1DLOB 2HNDA 1XNRF 4TY9A 5L1KA 2ZBQA 2B5JB 2RE1A 2GNKA 3EZOA 1NHVA 4ED8A 5KG5A 3PVXA 1TKTA 3D54A 1FDAA 2OJ3A 4UQTA 1VGYA 1VMBA 4I7FA 4DJBA 3RRHA 2BJ7A 2GQCA 4JI4J 2MYFA 4I2QB 1N5QA 2XNRA 1AFIA 1RACB 4LF9J 1W26A 5T41A 3AAWB 4IQXA 1H74A 1RLDA 1RWKB 2XMMA 3CD7A 2ZDOA 3W3SA 3C46A 4Q0BB 1F9FA 4CH7A 2XC9A 3O3LA 1YVFA 2X7IA 3NG8A 1HQ2A 4YN3B 1TR0A 3TA2A 2B51A 3W7BA 1YI2S 4DLGA 2W4DA 1BWVA 4QR1A 1C1BA 4OYIA 4EO8A 3LQVA 4EUVA 3A12A 2ZM6J 1EX8A 5L39A 1KBRA 3LP2B 2K1RB 4ZCMA 1U49A 2VKZG 3PW5A 2R7UA 3NY0A 5GAGU 1WORA 2W4CA 4CO2A 2DEJA 3CULA 4WZQA 3ZZTA 5C24B 4BWMA 3FEXB 5B0GA 3QJJA 5A8WA 2MEWA 2R42A 5LT5A 2AEFA 2A3JA 5IQQA 3SQGB 3TARA 1GEHA 3D5MA 3J81j 4C48A 2LEAA 4PXEA 2JJ4D 1LK5A 2XGQA 4B3RJ 3TNVA 1RHJB 4USIA 4LIRA 4NLWA 3TYTA 1RDRA 4NI2B 4A8WA 3DU6A 4ZP7A 1SCJB 4LFBJ 1SKRA 4KE5A 2JNJA 4G65A 4RZRA 4ED5A 2VQEJ 2CJBA 3DN9A 4FYWB 4HYKA 1FD8A 3BQ0A 2RVJA 4CIOA 4DBQA 4C3KA 2F8EX 2GGPB 5KFIA 3PW2A 4PXCA 5ETRA 4PQUB 2NQPA 3CSKA 2R4FA 3H42A 3HP6A 4DR5F 3DOMA 3MD3A 4PR6A 3ZZYA 3RBEA 1IXKA 3KK2B 4PG6A 4V19J 2PFDA 1U09A 3A4TA 4DR6F 2OMLA 3JAMY 2ZH5A 1YBTA 4M5HA 4C8NA 1NUEA 1X5PA 4NXMJ 3HHLC 3UW1A 1AXQA 2R7XA 1RYSA 3K5LA 3BGOP 1DURA 4NPOA 3QAEA 2J5AA 4FF1A 5I4MA 4DV2F 1YBUA 2GMJA 3WX8A 1VQLS 4USUA 2FVRA 1JLEB 1G7CB 4ZPCA 2JEIA 1IKWB 4ZJQA 4MTPA 4RBTA 2LVWA 1GAOA 1F2HA 3MEDB 2XZDB 4IYQA 4ECTA 3OTBA 2ZOMA 3CDAA 3V6DB 2VG6B 3IWNC 2QA4G 2Z56B 1HNXJ 3AOCA 4K0KJ 4NYOA 2PEBA 2WHOA 4KC5A 5EUHA 2AYGA 5K8OA 4RU9A 4IG0B 2ZH4A 1RT3B 3VQSA 3D66A 4DDFA 2Y8WA 1B64A 3J80Y 2JVOA 5KFWA 2YKNA 4IH6A 3WQPA 3AD8C 5B0CA 2J7KA 1IR1A 3VAJA 1S1WA 1K47A 4MKVA 1QAJA 5GAHI 3FDSA 4DV1J 1VQ5S 3SCJE 4DR7J 1OS5A 2QYCA 3NOGA 2U2FA 3FEYB 2VZ9A 2WONA 2HNZB 5KFJA 3NGDA 2HSEB 2XZWA 3ZFVA 5H9EJ 1WC5A 2DXEA 4HI2A 3TJ8A 2HQDA 2KZZA 4MIAA 2C2ZB 1SB6A 2P6SA 2NXCA 4I6YA 4K4WA 4LF1A 3HVRA 2GS8A 1H2UX 4B3TJ 2HFOA 4U96A 1AROP 2QYGA 4DV0J 1U48A 1G6BA 4TU8A 5J2MA 1IBKF 4OX6A 5ITHA 4HHUA 1FRMA 5KFVA 3KNAA 2AYMA 2RDJA 2V2QA 5I3QA 1TMJA 1WI6A 4B3MJ 3DM2A 3Q8PB 2WSFC 2IA6A 5U47A 4IRDA 4U7UD 4O4GB 1BGXT 3MPDA 2HHUA 2OSRA 4ES2A 1LEOA 5E3RA 2G13A 1S0VA 2PD1A 1UETA 2QL7B 2W1BA 1RTDB 1QAIA 3HI9A 4DR4F 3S7RA 1WHYA 3KG1A 3FCWA 3QWPA 3AD9C 2CPYA 5FJ4A 1SJ4P 4ZKAA 2MHNA 1KTQA 1T05B 1UL3A 1S9EB 1YG0A 1WEYA 3OFHA 2W9CA 2IC3B 3MM8A 1Q4RA 3DOKA 3TJAA 3QLHB 4JI7F 3HHLB 4RW9B 2CWKA 3UN3A 4GKKF 3K59A 2B9XA 2LYVA 3G6XA 3PRDA 4Y65A 5HJXA 4B9LA 4DV6F 1JLCB 1R8AA 2O66A 3UD3P 4YR0A 2A6OA 4YR2A 4QIEA 1EKSA 3RB4A 1S97A 1M5HA 3TA1A 2DNKA 2DPIA 3ZZ0A 3G6ES 3ETMA 2N7CA 2XY6A 2F5GA 1B70B 3MPWA 3KLIB 4DFJA 3QQCD 1IBLF 5HQ8A 4I2PB 3PYFA 3N28A 4CYUB 1ZM2A 1NK8A 3SQOP 2KT5A 4X65J 3I87A 1J27A 1OSCA 1Z2ZA 4GKJF 4ZVTB 5K8NA 2AJFE 2VHGA 4F4AA 5M2PA 3PKYA 2YXLA 4OX9F 1V3SA 4NZ0A 1FFWB 1XMQJ 3BGUA 3HFVA 1QAYA 4RPFA 4J9LA 3R2CJ 4B3SJ 1YJVA 3OLBA 2M7SA 4N5SA 1VBZA 4U95A 3BO2A 2K2PA 3ZXWA 3ITHA 2OKQA 3Q8SB 5J1PA 2FDNA 2B7CB 3NAHA 3N5BA 2OPPA 1W2IA 5HAOA 2J9DE 2I5JB 2KL8A 3UO0A 1CBKA 1X4DA 2LFVA 4WFBQ 2DGUA 2IJNA 2PIIA 4CM2A 2XG8A 3MPVA 4JI5J 1ZYQA 1HWKA 4WK3A 3M30A 4NYPA 3OW2R 2PFFB 4B9VA 5A2QY 2AEMA 1U1LA 1YQHA 3OBIA 4U7CA 2GO9A 3VGSA 2E66A 3KLHA 3J7AN 4DPYA 2OGUA 1CS4B 5IC6B 3QIPB 3I5BA 3GJSB 4FF2A 2AWZA 5KFZA 1FJCA 2Y1LB 1HR0J 4J9UE 1RWUA 4L72B 1UPPA 3AB4B 4N8OA 3G82B 2W4PA 3M2VA 2RMLA 3WDOA 1J5EF 3NXZA 1U6FA 2MZ1A 4ES1A 2DRDA 2C42A 5HBMB 2HGMA 4Q43A 1TUVA 2HWIA 4Q44A 3Q22A 1FKOA 2DPJA 2R7SA 4OYOA 4FXDA 1P1TA 1KWMA 3TI0A 1YDLA 1U2CA 4CLWA 1UA1A 1NZ8A 4LR7A 4ZPBA 2WSEC 3K5MA 4TYBA 3VZIA 2E44A 4DV7J 3K2YA 1U26A 2ILZA 4J9MA 2ZC4A 1O6XA 5CABA 4N47A 1KHWA 3H4BA 3MWBA 1VIXA 2EFVA 2J9DA 4KV8B 1IKXB 4ZOSA 4WKRA 2NLWA 4LF2A 1ZTTA 4YMEA 1R8CA 1WUUA 3MZIA 3EUNA 2UXCJ 3MI7X 2FLOA 3WHIA 3M1VA 1SBRA 3EM1A 4CO1A 3RW6A 4KRWA 5KOXA 3NS7B 3TZWA 1W2BR 2QLWA 3OUYB 1RAFB 3B54A 4WXOA 2HHWA 2CPFA 3U1MA 4JOUA 3GJQB 4EZ9A 4LF8F 2GIFA 5DGBA 3FSYA 4B9SA 4UTGA 1Y11A 3L7UA 2DH9A 3MPYA 4NMXA 4CDIA 4FNHA 2LLZA 1RTHA 4GVBA 2AJ4A 5DDRC 3MPUB 1P27B 1RBOB 4RW8A 4P7TA 2W9AA 4IH7A 5HMYA 1QDUB 2BRLA 3M05A 3SDEB 1EETB 3DDNA 2EC2A 4CLKA 4IG3B 4PPDA 3I5AA 5GMEA 3IS9B 5HI7A 2JOQA 4L6V3 2PMWA 2FY1A 2YKMB 4IDKA 1RAGB 1UZDA 2EK6A 4DN0A 2UUBJ 4HVZA 3M8QB 2JFKA 1AUSL 6FD1A 2CNLB 4FBTA 4ECXA 3WZ0A 3MEEB 8ATCB 5L46A 1LWEB 2MLZA 1KKHA 3DC2A 2YX4A 1Q79A 4J37A 2EI5A 3GIRA 1R6VA 4DF8A 3E01B 5IT4A 3MGJA 4Q45A 4FBUA 2QMXA 4M5LA 2QL9B 1VRTA 1YTYA 3MR7A 3BDEA 2FVPA 1GXLA 4AT1B 3FRZA 3EVMA 4YDDB 2MKSA 1G1XA 4CO3A 4USVA 2Z57B 3HPOA 2R7QA 4HH1A 4RW4B 1SPBP 4OYAA 4G1QB 5HANA 1X9WA 2YWHA 1VQYA 4YB7A 4N41A 1WG4A 4P75A 2ZBIA 5E2QA 2QA4S 2FHMA 3IBCB 1FFSB 1CULB 4ED3A 4CLLA 5K20B 3L3CA 4WE1B 1F9HA 4IR9A 3T1HJ 3GFZA 2VICA 2RF2B 4ZVHA 2DNLA 5HVHA 3HD2A 3NCQA 4C98A 3UE2A 2C3PA 4P71A 2ZBRA 4M1KA 1R43A 3ILLA 3X1LB 1VJWA 4HTJA 3SV3A 2DH8A 2NSCA 2BV3A 2V63A 1HHTP 1FF2A 4FKXA 4MH8A 3UFCX 2WVDA 1Q81T 2E7VA 2NCKL 2L08A 2IYIA 3RW7A 1O0PA 4Y28C 2VL1A 1KFSA 1JXVA 1S77D 3OHBA 4JV5F 3I9ZA 3V4MA 1H3DA 3IC1A 3TUPA 1IR0A 3MMCB 1HBNB 3TUIC 5KTQA 3RR7A 1QE1B 3LP2A 2N4DA 1LFWA 2E1AA 3TP2A 4JI8J 2CADA 5KAKA 1S1VB 1U24A 2PDAA 1U1PA 1T95A 5C24A 3H90A 4M5NA 5BXIA 3CJ5A 4I67A 4DPUA 3OXFA 3TVYA 2R7RA 2D3O1 2ACYA 1S0NA 3UQSA 1HQEA 2HLUA 3IGNA 1SH2A 2V0NA 4HACB 4LMZA 1UZHA 4NI2A 4WJBA 4UQGA 2LCWA 2UV8G 5AXKA 5GAHU 4L3NA 5T7LA 2W8LA 4X66F 1TELA 2CJAA 1SC6A 2LECA 3ILJA 1VISA 3LWMA 1X4EA 4AYBD 3EYZA 2VOOA 3GCXP 1UFWA 4O44B 2N82B 2KFYA 3I0RB 1BXNA 1LKZA 1WSRA 3UI3A 3NNAA 2X3DA 2OEMA 3IR6B 3GU0A 4PG8A 2KG1A 2DR7A 5IM0A 3NCPA 2C2OB 3WC2A 3W5XA 5HATA 2BM0A 3CJRA 2A1BA 1Y4ZB 4YB5A 1TKZB 2V2VA 4CLSA 3PEHA 4NOHA 5JMNA 4LF9F 5D0GA 3VGTA 5GAEI 2D3ZA 2CQPA 4KFBB 1JB0C 1FKPB 4NCBA 3GV7B 4F04B 1O51A 1JLEA 1VIOA 3J7A1 2OPRB 1WC0A 3WBZA 3VVTA 3DXBA 3HSZA 5C25A 3V6JA 2BBEA 3V81B 3EVWA 3MECB 2LEPA 3Q8YA 2CQ4A 1UEUA 3IR7B 1Q16B 1U8WA 1JMTA 3GFYA 2BUNA 1RADB 4PG4A 2HBZB 1RHQB 1BQMB 2B6AA 3PIOQ 4WYWA 1N33J 2VG7A 3ZZZA 1K44A 2DHXA 3I0SA 1H2VZ 3MMAA 1C4CA 1VRUA 2NZCA 1Q8LA 3SYZA 1S57A 2QIFA 4E8UA 4C3LA 1UFLA 3QFHA 5KT2A 2M8DB 3EXYA 3ZTRA 5AXMA 4LF7F 5LMUF 1KS2A 4KQZA 3WC0A 3QGHA 3NGSA 4B3RF 2DEIA 2FJWA 4U8VA 2QMUB 1TL4A 3TVKA 4RNMA 5J2QB 4PKDB 2P9GA 1MWQA 2F4VJ 1HKAA 1EP4B 3GFXA 1DRZA 4P52A 1NJZA 1SVDA 2KHCA 2YNFB 4NL5A 3OSNA 1S1XB 4ZN3A 3EZ5A 3CUNA 1HLWA 3T9NA 4WK1A 2NYHA 1M5OC
chains in the Genus database with same CATH topology
5KFNA 2IHR1 3P96A 1OQ3A 3K57A 2IAJB 3KHGA 2DGXA 3CIMA 1VBXA 1N33F 3LALA 4KKOB 4DX8H 5E7OB 2AJQA 5IS2A 3IGVA 2E5GA 4ZPVR 1IKYB 2B7BB 4F4XA 3V6HA 3O1LA 1NK4A 4IFVB 2B4PA 3ISNC 3KK3B 1BY9A 3NKYA 4HT7A 1HBMA 3C8YA 2UZAA 2WAQD 4F02A 4NCGB 2OPQA 3E3XA 2HMIB 4MKBA 2KM8B 4F3QA 2ZH3A 2AP6A 3I96A 1H0HB 3BN4A 5A8RA 3Q0AA 3NBPA 4RW4A 1FNMA 2KRBA 5EDWA 3GIKA 1N0VC 2HGNA 1BQNA 3DCAA 5H9FJ 2I9SA 3UR3C 2DR8A 2FGCA 4X4RA 3N6LA 5EHHA 3DLKA 2ZKUA 3SMZA 3UR0A 1NK7A 2GW8A 2WOMA 2ZE2A 3GFHA 3OL8A 4OZ1A 2LXUA 4X4NA 3H59A 2RILA 4MK8A 2IVYA 2N7YA 4ZA1A 4RUHA 4QWCA 4DV5F 1FEEA 1RT5B 2FC8A 1T03B 3PRBA 4RNFA 4QU6A 5CYJA 2MDAA 2IVFB 2B43A 4DQQA 2GIQA 1HNVB 2JDJA 1Q1KA 4HH0A 1ZM9A 3H5XA 2L9WA 4WTYA 2HS0A 3L95X 4CT9A 5CYMB 4XPEA 1X5SA 2UUAF 3N4WA 3NNCA 4IOAQ 3D0HE 1DQAA 3DRYA 4C11A 5A0YB 1T05A 5K14A 2IMWP 4C2MA 4AL5A 4JI6F 5K9FA 4ZPTR 3MEGA 4WE1A 2CFXA 3EGZA 2KT3A 3M2RA 2F4VF 3T3FA 5D4NA 4DLEA 2Q66A 2KXNB 3LPYA 5EGYA 1PO6A 3CDEA 2MXYA 1FVQA 2XSJA 2RS8A 4O3SA 1WHXA 2YH0A 2RF2A 3FVYA 1J5OB 2C22A 3RTVA 3OTEA 4NCAA 4ZCLA 3CD0A 4C0OC 3QLHA 1N6QA 2XEXA 2IM3A 1H6KX 1R6YA 2EFPA 1SJQA 2ZOGA 4QR2A 1NK5A 1JJ2R 3HO1A 4RW9A 3RZAA 1S6QA 3E51A 4ZDNA 1LW0B 3CF5Q 4KTQA 3CCLS 3POTB 4O3PA 3FSXA 1TL3B 2RRAA 4KHPF 2KYXA 4GMKA 4A8MP 4NZ6A 5LL6d 2WCXA 2R2UA 1RT4B 5DDOC 3KLVA 2P6TA 2VC0A 3TAPA 1CPZA 4QIVA 4JYAF 4MAKA 2VBWA 4DL6A 2OD6A 4USJC 3THTA 1L3KA 2GA7A 1X4FA 3UDCA 2JLGA 4DQSA 3RAMA 3OL6A 1GXUA 1HNIA 1MMLA 5GVQA 3OL7A 1WG5A 4Y2KA 1ZETA 4DSEA 1NB7A 1RT1A 1OSDA 5A6PA 5B0BA 2E9RX 1S49A 1JJ4A 1FNXH 1GT8A 1ROFA 3PJWA 4YQWA 1BLUA 3OR1A 4ECZA 2RRBA 2V8GA 3DHWC 1VBYA 4LSLA 4K5SA 1NU4A 4OX8A 2YKNB 3X3UA 2GJ2A 2XWXA 2AGOA 5FDLA 1SJ3P 4I6WA 2DO0A 3N9UC 1GNKA 2CQBA 2M88A 2ABYA 4RX6A 2KDOA 1SJ1A 2V8HA 2GX8A 2RUGA 5IT0A 4EZ6A 1HNWF 4CI0B 1QJHA 1T02A 3KFWX 4OI1A 3G8TA 1RT6B 2QE5A 2R8GA 1UWBA 2L9NA 4B3OA 4C8MA