4ID5B

Hiv-1 reverse transcriptase with bound fragment at the rnase h primer grip site
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
424
structure length
412
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 122
structure length 412
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4id5B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id5B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id5B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id5B03
2XI3A 4ED7A 3KK1B 4O44B 4RW6B 3FDSA 3PJWA 5F8LA 4I7FA 5J1EB 3RB0A 3ITHA 3I5AA 5HP1A 2YNFA 2ILYA 3RBEA 3OSNA 1K1SA 1RTHA 2DPJA 1DTQA 4KFBA 3HHKA 3MECA 3CJ4A 4DEZA 5KFQA 2YNIA 1RDRA 1TKTA 3HKWA 1W25A 4URGA 4ZHRB 4K4VA 4IH5A 4NRUA 2FVCA 2WTFA 2IM3A 3NMAA 3T1AA 2C22A 1ZTTA 4J9RA 2W9CA 1DLOB 3EPGA 1TL3B 4ZVHA 1TKXB 4ED2A 2AU0A 2BE2B 3OHAA 1RT3A 1FK9A 1HNVB 4RW4B 5HBMB 4Q8EA 4NCGA 1RT6A 4IG3B 3CDWA 3TVKA 1JLAA 5KFXA 5KG1A 4MIBA 4RW7A 3OLBA 3T5LA 1C1CA 1VRUA 2O5DA 4TY9A 4O3SA 3H5XA 4KSEB 4IR1A 3BSAA 2FJWA 4R0EA 1IKYA 1BQMB 2R8JA 2YKNA 3MR2A 3FFIA 1D1UA 4IDKA 4DL7A 2R8GA 2YNGB 3JYTA 3RAXA 2JEJA 1SH0A 4URQU 4K4WA 2IJFA 4NZ0A 3DI6B 4WE1A 1N6QB 4M94A 4JV2A 3GIIA 1IKVA 4PWDA 2WONB 4JV0A 3DM2B 3T5KA 4WZMA 1J5OA 3KK2B 2V4QA 4K4YA 3BGRA 1JLCB 3SFGA 4J9SA 4YR0A 5DGBA 1S9EA 2J6UA 5F9NA 4KKOA 3V4IB 4RUAA 1RAJA 4ECQA 5DGAA 3C6TA 3KK3A 4WZQA 2JLEA 3HVAA 5DQGA 3IS9B 5I3UB 2XCPA 2ZE2A 3LP0A 3PW4A 4TXSA 4KE5A 1IKXA 1RYSA 2WOMA 4MK9A 3QLHB 3QIPB 3CJ2A 4ECXA 5KFPA 1S6PB 1RT5A 1S1WB 4GC6A 2RKIB 1HYSB 1TL1B 2J6SA 4O3QA 3LALA 4ECRA 2JC1A 5KG4A 1IKWB 4TY8B 4O44A 1SV5A 1RTIB 4RW6A 3NKYA 1FKPB 4G3IA 3I5BA 1C0UA 1RTJA 1S1TA 1R0AB 3D5MA 3DRPA 3BSOA 3GIJA 4LSNB 4HYKA 3PVXA 4ECSA 3OL8A 3I0SB 4Q44A 4JUZA 4U7CA 4NLYA 3VQSA 3DLGA 3V6JA 2W9BA 4ZHRA 1S1VB 4KBIA 1U09A 3IRXB 4FBUA 3CIZA 4MIAA 3N6LA 3CJ3A 4ED1A 3KMQA 4KV8A 3GIKA 4MK8A 1DLOA 2OPQB 1KLMB 3QZ8A 1TKXA 5DG7A 2BE2A 3QO9B 5J2NB 3OL9A 2VG6B 1RTDA 3BQ0A 2JC0A 2CJQA 2VG7B 4ZVEA 1LW0A 3M8PA 3H5YA 3BR9A 1LWEB 4KO0B 3GYNA 3PR4A 2WHOA 3Q8QB 4ID5B 5KG3A 2OPPA 4Q43A 4F4WA 1BQMA 5F9LA 1Z4UA 2HWIA 3KHHA 3Q8RB 4MFBA 1S49A 3ISNC 5JXSA 2AQ4A 2WB4A 1QUVA 4EBDA 5C24A 4RNOA 1JLQB 2HMIA 1C0TB 3DI6A 3FSIA 2RF2B 2WCXA 1SH2A 5DLFA 1JLBA 4RNMA 4O3RA 2B5JA 5DG9A 5FDLB 4B3OB 4R5PA 4ZMMA 1JLFA 4FS2A 4KHRA 3KK2A 2D7SA 2YNHB 3PR5B 4F4ZA 1RT2B 4RNNA 3CVKA 4YR3A 4DL6A 5KG0A 3KLVA 3DRRA 2IC3B 1REVA 1S0OA 4RNHA 3V81A 2UVRA 2C28A 1JLEA 2BANA 1EETB 1S97A 1YVFA 3IS9A 2YKMB 3SI8A 4TQSA 4XPCA 4DG1A 1MMLA 3DOKB 3LAMA 1RA7A 5C25A 4R8UB 4H4OA 2V0NA 4IG0A 3KLFA 1N48A 1S1WA 2XCAA 1HYSA 4KB7A 1TL1A 1HMVA 3IGVA 2HNYB 5KFWA 4TYBA 2GC8A 1TVRB 1T03A 2UUTA 3H4BA 3MEEB 4H4MA 2AX0A 4IFVA 4EO6A 3H4DA 2AGPA 3EPIA 4YP3A 1N5YB 5KFRA 1SH3A 3HVTA 2F8EX 3LP1B 5KFJA 4LSLB 4ZPAA 2I5JA 5KFUA 3KHLA 1S1XB 2C2EA 4LSNA 2E9TA 2XWYA 2BRLA 5KFNA 5HROA 1S6QA 3I0SA 3NAIA 4QPXA 1S4FA 4RNFA 3QYYA 3BREA 2OPSB 5F8NA 3MEGB 5KFDA 2ZD1A 5KT2A 3C6UB 4Q0BA 5HLFB 3DDKA 2IBKA 3KLHB 3OLAA 3CJ0A 3RB6A 3QGIA 3KHGA 3GV5B 1LW2B 1N4LA 3MR6A 1MU2B 3GILA 5CYMB 5K14A 3QO9A 4IFYB 5J2NA 5KFZA 4ICLA 5CYQA 4EO8A 2IA6A 2OPRB 5F8IA 4F4YA 3H40A 4EBCA 4RUCA 2UVUA 1LWEA 4J9MA 3KOAA 4LQ9A 4G1QA 4KO0A 2FVQA 3BSCA 2AWZA 4ECYA 1TP7A 2RDIA 5JUMA 1HQEB 3MFHA 1XR7A 3M8QA 3GQCA 2QE5A 3T5JA 2HNDA 4O4GB 4ZPBA 3KHRA 3NBPA 4ZVGA 1KHVA 4NLDA 3UPFA 3OL7A 3PW0A 1DTTA 4RZRA 1JKHB 4NYZA 2W7PA 3JSMA 1FKOB 5DLGA 1JLQA 4ZP6A 1C0TA 1RT7A 3I0RA 1NHUA 2RF2A 5I42B 3BQ2A 1TKZB 1BQNB 3PHEA 3FRZA 4URSA 3GV7B 3PZPA 5F8JA 1UWBB 5KFSA 1LWFB 4TLRA 3LP2A 5J2MB 2AX1A 3DRSB 4PUOB 4NRTA 4O3PA 2R2SA 3G86A 4H54A 2AGQA 2YNHA 3LAKA 3I5CA 3GIMA 2J6TA 3IG1B 1EP4A 3E01B 3M9MB 1S9GA 3PJXA 2HNZB 1SUQA 1T05B 2FJXA 2B6AA 3MFIA 1TV6A 1HNIB 5L1KA 4PQUB 2YKMA 1LWCB 3TQ1A 4RW8B 3MEDB 3KNAA 3KK1A 3QZ7A 4F4XA 3LANA 5J1EA 1JLGB 3KLEB 3FQLA 3DLEB 1NNDA 4KHMA 3UDLA 1S0MA 4I2QB 5HP1B 3NL0A 1HARA 4QWCA 2ASJA 2IAJB 2VG5B 1GX6A 3M9NB 2HNYA 4ECZA 4F50A 3E51A 4JV1A 4ZP9A 2D3ZA 3T19A 2YNFB 1C1BB 3MR5A 4J9LA 2FLLA 1N5YA 4FS1A 3UR0A 1DTQB 4KFBB 3LP1A 3MECB 4IH7A 1TL3A 5KFOA 4IQXA 4ZP7A 2YNIB 4K4SA 3TAMB 5KT7A 4ECTA 4WFZA 4NLWA 4DL3A 4RW4A 1HNVA 5HBMA 1ZTWA 2D41A 4MH8A 4RW9B 2BR0A 4IR9A 4IG3A 2W9CB 5T14A 3MEGA 2HWHA 4DL4A 2E9RX 3C6UA 1RA6A 1IM4A 5KFEA 3KMSA 2W8KA 4NCGB 4TQRA 4QWEA 3H5SA 1RT6B 5CYMA 1JLAB 1OS5A 4XO0A 4RW7B 4KAIA 1VRUB 1S0NA 3DYAB 2YNGA 5D3GB 2IM0A 4X2BA 2ASDA 3KJVB 1S1UB 3KLIB 1N6QA 3D28A 4NLQA 1HQEA 1HQUB 3MR3A 3H5UA 2WONA 2YKNB 3DM2A 3FFIB 4IDKB 2IJNA 5KT4A 2GIQA 3JYTB 1T94A 5F8MA 1QAIA 5DQIA 1CSJA 4WE1B 3NAHA 1JLCA 4NLOA 4LQ3A 1WNEA 4PWDB 2UVVA 2W8LA 3V4IA 5KG2A 5EUHA 4QW8A 1FKOA 3KLGB 3OSPA 1J5OB 2ILZA 4IKAA 1TKZA 3RAQA 4WYLA 5I3UA 3BGRB 1S10A 4ECUA 2JEFA 1LWFA 1VRTB 4YMEA 1QE1B 4U6PA 3IN5A 2V9WA 3DRSA 4J9KA 3QLHA 3QIPA 3C6TB 1N56A 4NLTA 1S6PA 1KHWA 3E01A 2RKIA 2ZE2B 3LP0B 5C5JA 3CWJA 5C42B 4EYHB 1HNIA 2WOMB 4EBEA 2IM1A 2ASLA 1LWCA 2XGQA 1IKWA 3MEDA 4RW8A 4TY8A 3V6HA 1RT5B 1RTIA 2QV6A 5KFMA 4NLUA 1FKPA 5L1LA 4QW9A 4ED6A 1R0AA 2R2TA 1NHVA 5KFFA 2JEIA 2ATLA 2UUWA 2B43A 1GX5A 1SV5B 3QGHA 5KG7A 2IAJA 2VG5A 4MK7A 2FVPA 4XPEA 1C0UB 1RTJB 1S1TB 1S1VA 3IRXA 2R8HA 3N6NA 3DRPB 1C1BA 5KFGA 4MKAA 4Y3CA 5DG8A 5KFAA 2OPQA 1KLMA 3V6KA 3G6XA 3DLGB 3TAMA 3Q8SB 2W9BB 3PW5A 2VG6A 2FJVA 4NLPA 4J9QA 2VG7A 3ICLA 4RW9A 5KG6A 2VA2A 2GIRA 3GV8B 4KV8B 4NLRA 3QGGA 5EDWA 4MKBA 1XR5A 4QWDA 3M9OB 4IRKA 2EC0A 1RTDB 4K4XA 3RB4A 1I6JA 4K4ZA 3V6DB 5L9XA 1LW0B 3QIDA 3M8PB 4ID5A 4QWBA 4ZP8A 1JXLA 4DL5A 3IGNA 3NGDA 2OH2A 1JX4A 1D0EA 3BQ1A 3DYAA 5D3GA 2I1RA 4O3NA 5J2PB 4K4UA 3UQSA 1HPZB 3EZUA 5DQHA 3KJVA 1S1UA 2OPPB 3KLIA 3DOLB 4Q45A 4K50A 4WXWA 3T5HA 1HQUA 4NLGA 5J2QB 4I2PB 3Q8PB 5FDLA 4B3OA 4MFBB 4QWAA 5KFKA 5C24B 4J9OA 5KFYA 2HMIB 5L1IA 3ISND 1RT2A 2XC9A 1JLBB 4ECVA 2B5JB 1S9FA 2IC3A 4R5PB 1JLFB 1RT4B 3KLGA 1JIHA 5EWEA 1EETA 4ED3A 4IOBA 2C2RA 3DMJB 3N6MA 1T3NA 1VRTA 2C2DA 1QE1A 3DOKA 3DRRB 4TN2A 1RT1B 1S48A 1REVB 3DLKB 4R8UA 3FQKA 5KG5A 3V81B 5L1JA 4EYIB 5EWFA 3H98A 1JLEB 3BJYA 2BANB 4FBTA 4NLXA 5KFVA 3CDUA 3SFUA 5KFIA 5KT6A 3CDEA 4DG1B 5C42A 5F8GA 4I7FB 4J9PA 2BQUA 2DPIA 5C25B 1K1QA 4TYAA 4H4OB 1TVRA 2XGPA 4IG0B 3ITHB 3MEEA 3CO9A 2W9AA 3KLFB 5KFLA 2IMWP 3HVWA 1RTHB 4RU9A 1HMVB 4LSLA 4OL8A 1S1XA 1TKTB 1T03B 4H4MB 4IFVB 3G6VA 3MTKA 2XI2A 2OPSA 3HVTB 4WFXA 2I5JB 1C2PA 4Q8FA 4YR2A 5HLFA 4WFYA 5F8HA 1RT3B 5HROB 1FK9B 1S6QB 3KLHA 2ALZA 2VA3A 4IRDA 1LW2A 4O4RA 1MU2A 5KFTA 4ED8A 4IFYA 5KT3A 3OHBA 2FLNA 3BSNA 2E9ZA 5EWGA 2OPRA 2ZD1B 1C1CB 1TQLA 4WXOA 4Q0BB 4Y2AA 4K4TA 3PW7A 3RBDA 4ZPCA 4EEYA 3OL6A 4YQWA 2FVRA 3H2LA 2BRKA 5K14B 3MF5A 1IKYB 2BQRA 4ICLB 5CYQB 2R2UA 4ZPDA 4IH6A 3V6DA 4HKQA 2W7OA 2FVSA 3PW2A 4O4GA 2JEGA 2WRMA 4G1QB 2R2RA 1JKHA 1IKVB 3CJ5A 2BQ3A 5J2PA 1HPZA 3M8QB 5KFHA 4ED0A 2AGOA 2ZKUA 2HNDB 3DOLA 5I42A 3NBPB 1QAJA 1BQNA 3RB3A 5J2QA 4I2PA 2RDJA 1DTTB 2R8KA 1UWBA 4IRCA 5KFCA 4NLVA 3JSMB 1S9EB 5J2MA 4Y2CA 4GC7A 4KKOB 4PUOA 4M95A 2IM2A 3KK3B 2HAIA 1RT7B 3I0RB 3IG1A 3H59A 2UVWA 2HNZA 1T05A 4ZVFA 1IKXB 4J9NA 1RT4A 3LP2B 1ZETA 4Y34A 5KT5A 4PQUA 4DL2A 3DMJA 1XR6A 3G6YA 2FLPA 2V4RA 5KFBA 2CKWA 4WYWA 1RYRA 1EP4B 1S9GB 2R8IA 1RT1A 1SUQB 3DLKA 1JLGA 3KLEA 3DLEA 2B6AB 2D3UA 1TV6B 4NLSA 2WK4A 4ECWA 4O3OA 4I2QA
chains in the Genus database with same CATH superfamily
4O44B 1F5BA 3PJWA 3HT3A 1R89A 1X5SA 1HHSA 2ILYA 2KFZA 2DPJA 4QU7A 3GZ7A 4IH5A 2IM3A 2DGWA 1TKXB 2DXDA 4IG3B 3GCWP 3PHTA 2PIIA 1X5OA 3PCOB 3H5XA 2HHSA 1M1KT 4ZVOB 3MR2A 4IDKA 4F3MA 1WTFA 2OSQA 3GMGA 4JI0J 2GAGC 1S0VA 1FEHA 1MW7A 2RNEA 2ZH3A 6AT1B 2GMLA 3W61A 2V4QA 3NMRA 4ER8A 3NCRA 4KKOA 4WZQA 3MI7X 1FNOA 2DIVA 3DXBA 3AT1B 3SSRA 3O2IA 4M5LA 2ZKTA 4CO1A 4NXMF 3MZIA 1NJZA 4HDGA 1R0AB 5E5NA 3NS7B 4ECSA 5CYJA 2QG9B 3HHEA 3DLBA 3J81Y 3MHYA 1O51A 1VIXA 4KR0B 1WG4A 4B9NA 2CADA 4WPAA 2DEIA 3IFEA 3CC7S 5KG3A 2OPPA 1A9NB 2F65A 2ZZTA 2WB4A 3EUNA 2AHOB 3DC2A 3OJSA 3D4JA 3SCJE 4DFJA 3PR5B 2XMAA 4OIXA 2AZ3A 1GTHA 1C4AA 3KLFA 2DNKA 1RAFB 2FZGB 1DBDA 1PAUB 5BR8F 1F9FA 2EVZA 2OO4A 2C2EA 1XMQF 2W4DA 2KU7A 4LREA 5CYMB 5K14A 2EWHA 4WTYA 1QSSA 5IWAF 2UVUA 2E5JA 3IM8A 2DNPA 2HGMA 2LQJA 4IOAQ 4DUYF 2HVHA 4MT1A 2W7PA 5DLGA 1EQMA 2RDDA 3BQ2A 3PHEA 2RUSA 3LAKA 3G2XA 3S01A 2NXNA 2YKMA 1U49A 3T9NA 1NUEA 2MHNA 4P6QA 3QJJA 1T02A 8RUCA 3IC1A 3T19A 3LP1A 2VBXA 1VBXA 4DL3A 2NSCA 2ZH4A 2HWHA 2DRDA 4DL4A 4GKJF 1W7WA 2JHEA 2OAUA 1RT6B 1JLAB 5D3GB 2KM8B 2E1CA 5CH7B 1U26A 1ZAXA 1RACB 4WE1B 4AL5A 1WNEA 1FNMA 2XSFA 2B3TB 3R5GA 3Q24A 1HHTP 1LWFA 4DZDA 4FPIA 1SBRA 1WKKA 3E01A 3HFVA 4C8KA 2FC8A 4DLGA 2WOMB 3IR7B 1SJ1A 3VAKA 4TY8A 5L1LA 3TUPA 4LRFA 1C0UB 2XO7A 1C1BA 5KFGA 4I6YA 4DR6J 1K47A 3CD6S 2VG7A 1HNZF 4IRKA 3N0VA 4K4XA 1NLKL 4DL5A 3ENWA 2LQ9A 4DR2J 2XS2A 3I96A 2QZ8A 2DVIA 1TAUA 1UMJA 2R7VA 1O5JA 9RUBA 2XC9A 2IC3A 1JWWA 3ET6A 4NYPA 3J81j 3D3CJ 3TZXA 2SXLA 3FZBA 1REVB 2CZVC 4R8UA 1XMOF 7FD1A 1M5SA 2G0JA 2MJUA 1HBUB 1RBOB 3UW1A 3MEEA 2FUG9 1RTHB 1S1XA 3W5YA 5K8NA 2VUGA 4L72B 3VWSA 3VVTA 1VQ8S 3HVTB 3J7A1 5IC4B 3VHQA 4WBFA 1LW2A 5KFTA 1H0HB 1CLFA 2GNKA 3CGIA 2OPRA 1C1CB 2WW4A 2NUHA 2ERRA 3MWBA 2W7OA 3D3BJ 4ZCKA 1RWOB 3TANA 4F2RA 3D7SB 4HLBA 4L74A 3OVAA 2R7SA 1RKJA 1MSWD 3GFHA 4FXWA 4NLVA 4GC7A 4DV0J 1N32F 2YH1A 4MMOA 3IG1A 4E0DA 1IWGA 1T05A 1D8YA 3LP2B 1ZETA 5H9EJ 3TR5A 1KOHA 2H54B 3BBCA 2R8IA 4K5RA 5J1PA 4C8YA 2WAQD 5HP1A 2KYXA 3VCDA 4N47A 2RIJA 2MSSA 1FJGJ 1BGXT 3TOQA 3MECA 4W92B 1W25A 4HHHA 2D3OR 2MZJA 2K7KA 3NMAA 2Y1LB 2I9SA 1V3RA 2BE2B 4CP5A 1FK9A 1IBLF 2G1DA 3CPWR 5HK4A 2PSZA 1T11A 3NS6A 2VB6A 4LF2A 2YNGB 1S57A 3SZ2A 1FFGB 3C15B 2Z58B 3NNCA 1IKVA 3EYZA 3BGRA 1S9EA 4USUA 1U6ZA 3GCXP 3TYTA 3PW4A 4MYUA 1IKXA 4OHYA 1S6PB 4OYMA 1SC1B 2J0XA 4LF4J 1RTIB 2YKQA 1OSDA 3I0SB 4ZDNA 2W9BA 4HT7A 4UUWA 1OQ6A 3MM9A 1SKUB 1Q1KA 4JI2F 4M5HA 3TP2A 4ES3A 3G6ES 5HN0A 2Z2YB 4Q43A 2ZHBA 1Z4UA 1Q8KA 3MEKA 4MFBA 3EJMA 2WW8A 2HVDA 4O3RA 5LL6d 2XLJA 2JFDA 3CJKB 3BN7A 3MMBB 2NYIA 2QTWA 2F40A 1YJNS 1SVDA 4F02A 4OZ0A 2KG1A 3UI3A 2WVBA 1EETB 1S97A 3UCGA 4DG1A 4C8NA 3VAMA 2FZKB 1JMTA 3W64A 4IG0A 4ATNA 2RAQA 1SIZA 3RBXA 3TO8A 4R0JA 4PRFA 4E2FB 4A8SA 3H4DA 4EK2A 3J7AN 2QA1A 1IR1A 3AD8C 2BRLA 2DXEA 4J5OA 2NCKL 3IM9A 4C3KA 4WF9Q 1IXKA 3D6TB 4DFPA 4RU2A 4J9MA 3UCUP 4LQ9A 1SI9A 1FNXH 4B9MA 2HGLA 2M52A 1VMBA 3Q2SC 2UUAF 3W2VB 1TKZB 1BQNB 3KUEA 3FRZA 2VBZA 3IBFB 4TLRA 3DGPB 4RR5A 3UWTA 1IVZA 1TKDA 1TV6A 1KTVA 4NA2A 1RZMA 3DU5A 5BR8J 4M5DA 2JSXA 2ASJA 2ZOFA 1OYEA 2VG5B 1FWPA 3O6QA 4FS1A 1TAQA 3CIMA 4ELUA 2HBYB 1X4DA 2W9CB 5IWAJ 5T7LB 4WWSA 3KNGA 2W01A 4B3RJ 2W8KA 4JI3J 1NSKL 4G65A 2V34A 4DUYJ 2E7WA 2D69A 1K0TA 1H72C 1Q0NA 1N6QA 2CJ9A 4FDFA 4NMXA 1M0SA 2UXCJ 2XMWA 2VPZB 2QMXA 4QIWD 1J5OB 4WYLA 2W24A 4RBTA 1N0VC 4J9KA 3ZO7A 4KT0C 1QLNA 3AOCA 2Q79A 2PO4A 5AXKA 1XNRF 2XGQA 3E3XA 3MEDA 3V6HA 1FKPA 3CJ8A 2JEIA 1NDKA 1CS4B 1T0TV 3N28A 3UNYA 3N6NA 1MROA 4J7CA 1FRHA 4X4SA 2IVMA 2I8EA 5LJ3Y 3VAHA 2CPEA 1Y3JA 1NK4A 2Z2ZA 4IOCQ 4QIGA 4CH1A 1OPZA 2HMIB 3J80U 3DCAA 4FF1A 3MPUB 5E3CA 1JIHA 5EWEA 3EVOA 2W25A 3R6GB 1J27A 3D9BA 1VRTA 3BKTA 3DRRB 1HBOA 4TN2A 4ZA1A 4NPOA 4ANEA 3L7PA 5ETVA 4TYAA 5ITHA 3MM6B 2XGPA 2W9AA 1VLYA 1ITPA 1NJWA 1TKTB 1SKWA 1UFWA 2GMJA 3MUTP 2RRNA 2EFPA 4LBHA 3DOMB 2FLNA 3GSIA 3NNHA 1L3UA 3MF5A 4LRBA 5CZVA 1U1KA 2E7XA 2OP5A 2V2ZA 3DFEA 1UCNA 3J7YU 1HW8A 2ZKUA 2XM3A 5J2MA 4WCEQ 1N5TA 2IHR1 1J2VA 1GFWB 1QM9A 1WWHA 1UJ4A 1U7LA 4PXDA 1HQ2A 1GMWD 2J8AA 2MLXA 2VJVA 3G8QA 3OSNA 4JI7F 1DTQA 4DEZA 3HJVA 3R7BB 3FKBA 2MDAA 1NK7A 2V5HG 4ES2A 3P49B 2XTJP 3H25A 3RUBL 3OLBA 1ZOTA 4N77A 1O8BA 5A8RB 3R6LB 3IBCB 3KUHA 4K4WA 1N32J 3MURP 2HHTA 3PX4A 1U4BA 4F4AA 5F9NA 2RD5C 2ZJRQ 1CVJA 1U1PA 1PJ6A 1WC5A 1RYSA 2RVJA 3CMES 2V9KA 5KFPA 1JB0C 2VDHA 5IQQA 3DNCA 2RQKA 4QR2A 5ETMA 1RTJA 4OYPA 3GIJA 2AJ1A 3I55S 1FRJA 3CTRA 3ILIA 3DLGA 1IBLJ 4KBIA 1S7IA 2EEYA 3A3OB 3AA8A 2W4PA 1NZAA 4O0IA 2XWXA 1HD1A 2MB0B 2OD6A 1KR4A 4DUZF 1BQMA 1CULA 5B0AA 1WDDA 1P8GA 3GYGA 4OV6A 1SH2A 1TFWA 3EXYA 4PWUA 3KLVA 1OY6A 3TA0A 4C97A 1JLEA 3Q86A 1HI1A 4MAKA 2XCAA 1VQPS 2EKNA 1MWQA 3IGVA 4EO6A 5JVHQ 4JI2J 2G2YA 3NY0A 2MQPA 2OIHA 5KFDA 1X31C 2JLGA 1RBAA 1U6FA 3BH7B 1RHRB 4DQPA 3EMTA 2UUCF 2BX6A 2GVZA 4KPYA 5LM7E 4O4GB 3I32A 1Q7LB 1JKHB 1Q16B 1YGYA 2CQPA 1FRLA 2J9EA 1URNA 2DH9A 4FF4A 3GIMA 4V1Ak 3M9MB 5FIIA 3FMBA 3M8WA 1U1OA 3KNAA 2P6SA 5ETSA 3LANA 3KLEB 4MKVA 2YWFA 4LUBA 3M6XA 5SUHA 3MR5A 4IH7A 4QR0A 1HNVA 3MM5A 4MH8A 5GADI 3MM8A 6FDRA 2ZUGA 2ZH8A 1RSCA 1S0NA 1UTAA 2UUAJ 1S1UB 3VGTA 2GIQA 3MPVA 3CC2S 4Y2KA 1CQMA 2C3PA 2DY1A 3KLGB 1XIQA 3RAQA 1KHWA 1M5VC 2ZE2B 3CWJA 5CHCB 3FBEA 2OMOA 1WEXA 2UUWA 1GX5A 3ENAA 1T9YA 1VLOA 4K2XA 2HPUA 5KFAA 1RLCL 3GLJA 3Q8SB 1NSQA 2Y3YA 3ICLA 4KV8B 5EDWA 3HD1A 1NPKA 2EC0A 3C8YA 3SYZA 4BDPA 4ID5A 5GAEI 1JXLA 2RT3A 3NGDA 3IP0A 4LFBF 3KLIA 1SC4B 3Q8PB 3G8SA 1WJ9A 3OVSA 1NK0A 2DNQA 2E1PA 1RT4B 2PC6A 1T3NA 3S6EA 2HHWA 3DOKA 2QA4S 3AOAA 1NO8A 2ROEA 1NBEB 2KHCA 3D0HE 4IO9Q 5GMEA 2XSJA 1E6VB 1X4EA 2I5JB 1I94J 4Y6IA 1S6QB 2XMJA 1KN6A 5CD4A 1UPMB 2VODA 4HL9A 1BC6A 4EEYA 4DR5F 1NK8A 3MR7A 3OUYA 2M8DB 2CQDA 5ADZA 4RUBA 2CQCA 2CQGA 2BQ3A 4I67A 1UW9A 4QYRA 5F0WA 4RLEA 4KKOB 5DM7Q 1HD0A 3R1HA 4RBUA 3T1YF 2HNZA 4Y34A 2QMWA 2KT3A 5LSRA 1S9GB 2PA8D 4I2QA 2LQ5A 2AJ4A 2WBMA 2ZJQQ 1T9UA 5D15A 5KFQA 2LA6A 2VPYB 4UZCA 2N3OA 1TL3B 4JI8F 2BE7D 3M30A 5HQMA 5GVQA 5A2QU 3M6WA 4DR3J 4C4WA 1UA0A 1UFLA 4ZLPA 4N56A 3OFGA 1JJ2R 3U1NA 2Q43A 2R8JA 3JYTA 2JEJA 2KJWA 3HP6A 4NZ0A 4WZMA 2V2QA 1WHXA 4BWJA 3UCZP 4FP9A 1QVGR 2XCPA 4KE5A 4P9SA 1BUXA 2RH3A 2C2NA 3HM9A 1PYOB 4ECXA 5FLXU 4ED5A 4ECRA 3HFKA 3GJRB 3RG6A 2F4FA 4DZ6A 5K5MA 3BSOA 2W2OP 3LQVA 4A8WA 2MJNA 3VQSA 1LQ9A 2HVZA 4YY3J 3N6LA 2UXDJ 3H90A 1KLMB 3OFHA 1F5CA 1RTDA 5DO2A 1FXRA 4WJBA 2I6WA 4USHA 3TJ9A 4ZIWA 5B7WA 4AL6A 3BV8A 3AH6A 4CWBA 5B0CA 3PEJA 1EJ7L 1JLBA 4KRWA 5M2RA 1RP5A 3ELHA 2MTLA 2D7SA 2MLZA 4RNNA 1K73T 3KYLA 4AE5A 4F7VA 2YKMB 3SI8A 1N36J 3W9IA 4H4OA 2DKOB 1R8BA 1LKZA 1PBUA 2XMUA 2F7VA 4I6AA 4KB7A 5BXIA 1T03A 3H4BA 1ZS6A 3OR1B 4I64A 3LP1B 1V6HA 1WDTA 2Z8QA 3GJQB 3KHLA 4RWXA 1WC3A 3TA1A 4OHXA 2KI2A 2IPOB 5IXUA 2GHVC 1JXEA 3KHGA 3MR6A 4EO8A 2ZHAA 2R42A 3QQCD 4G1QA 2B4VA 2X7IA 1XR7A 2IVFB 2HK3A 1APSA 3UPFA 3OL7A 1DTTA 1RHUB 2UU9F 4NEZA 4FPRA 4P10A 1BXNA 4UOCA 1C0TA 2KRRA 1NHUA 2OEKA 1LWFB 2PA3A 4O3PA 4OZ2A 4QU6A 4K8RA 3E01B 2V2VA 3PJXA 1SUQA 3W5ZA 4ELVA 1H98A 5AJ3J 4KHMA 3R27A 2JZ5A 3PYGA 4PG8A 4QYZK 4F50A 4LF9F 3GFZA 2NQPA 1C1BB 5GAGU 2LEAA 4YB1P 1NKEA 4HTIA 1SL2A 4NLWA 4Y28C 4LR9A 2UUCJ 1F1BB 4DDFA 4PG4A 3CDAA 1M1HA 1SIWB 3TJAA 5MLCV 4NI2B 1EZZB 1R8CA 2X1GA 1Q7YT 1HQEA 2YKNB 2IJNA 3EE3A 4AXJA 1QAIA 4Y2MA 1HBMA 4CLKA 1YBUA 3ET6B 1EARA 4DJBA 2XYPB 4TNOA 1NSPA 3QIPA 1IBKF 2ZC3A 5DJBA 1RJJA 4EYHB 3U1MA 3PIOQ 2X3GA 4QW9A 2KT2A 5KG7A 3D68A 2FVPA 2HIQA 5IT9U 4ZPWR 1JXVA 4ENOA 1GK8A 3PW5A 4L6V3 4X4TA 2HLTA 2GJIA 2GGPA 1YBAA 2EFQA 3CO0P 2BJ9A 1DQAA 1WD6A 2I0XA 2CWKA 4X4UA 3CT9A 2JWNA 4YEAA 1A0OB 5D4NA 2QL5B 4BS2A 5HANA 1U47A 2YQ0A 2OEMA 3MCNA 3FQKA 3BJYA 2BANB 1K1QA 4XK8C 2ZZMA 1XMBA 1HHQA 4RU9A 3LPEA 5H9FK 2FD2A 1QAXA 1S76D 1FK9B 2L08A 1Q82T 4O4RA 5HJYA 2MQQA 4ED8A 3BSNA 1TQLA 2C2OB 3JTPA 3Q0AA 3K5LA 2BV3A 3TUZC 4ZVTB 4CLSA 3CCZA 1IKVB 4P75A 3T3FA 2AP6A 1WF0A 4LIRA 2PMHA 1S9EB 1Y0HA 1FXLA 3PYEA 1IKXB 3W5XA 5DDRC 4H4KC 2JL9A 4Z7YA 1FESA 2LQBA 1K9MT 2GVDB 4FXVA 5F8LA 1YJ7A 3ZTPA 4BC7A 1JNRB 4FYDA 2RRAA 5C2CA 5JJBA 2AIRB 1ZTTA 3MM9B 4F0HA 4CYUA 4DR5J 1RT3A 4NCGA 3PIPQ 2IIHA 2O66A 3BSAA 2C3UA 2GO9A 1F60B 2Q6CA 3QSYB 2AZ1A 4JV2A 4PWDA 4X4QA 3MTJA 4OQJA 1ZBTA 5DGBA 3C6TA 2AJ0A 1WC1A 5LMUF 2GW8A 3H8YA 2DNHA 2WB1D 1FE0A 1UJ5A 1LK5A 1JNZB 2V8PA 2DNMA 2ZVSA 2E1MC 4U7CA 3IXQA 3CIZA 4C8ZA 3K59A 1DLOA 3D6MB 2EK1A 3O1LA 4ZVEA 2IYGA 3MUVP 3H5YA 4JI6F 4CTAB 4P2FA 2AQ4A 2NS1B 4C11A 4K59A 2J9DE 3G82A 5T41A 3VF0B 1YZ6A 2DITA 5I3QA 3FCWA 3KK2A 3P3DA 2B4UA 1K8AT 1FRMA 4O23A 4TQSA 2E5LJ 4WP9A 4M5DB 3N01A 1N48A 1TMMA 1XNQF 1VS3A 7AT1B 1QTNB 3LPYA 5KFNA 3AHPA 2F8HA 4EUVA 4AD6A 1OQ3A 3GJSB 1UZHA 3RZAA 3QO9A 4ICLA 3CCVS 1HNXJ 1TP7A 3DN9A 1YJUA 2V6AA 1Y5NB 2MLYA 4OI2A 4OMFG 3F56A 4FVCA 1QTMA 3BPDA 5L9NA 2MKHA 1GQEA 1JQGA 3EGNA 3MEDB 3K0JA 3U7JA 2HIYA 1NB7A 2HFOA 1HARA 5E41A 3SQOP 4KIAA 3E51A 2BYCA 5HSPA 1Y10A 2YNFB 1UEVA 4KFBB 4ECTA 1NJXA 1U02A 1AB8A 3WX4A 4F8RA 2MKSA 2BJ1A 1ICEB 2AEMA 2AW0A 1LEOA 1OS5A 4USJC 4XAKA 2DNGA 2UU9J 2NZ4A 1S99A 2ASDA 4X2BA 4JYAF 2B4OA 2QFIA 1JLCA 3HHLA 4NXNF 1VRTB 1HBOB 3UD5A 1DZ5A 1NMEB 5HQLA 4V19J 1QVFR 3PJ9A 3FEXB 4AL7A 1RT5B 5KFMA 3PEHA 2OTJS 2I38A 3I56S 4YB6A 4OI1A 2PDAA 3M8YA 2HGNA 1S1VA 2OPQA 4KGXB 1KVKA 4NLPA 2DY9A 4USKA 3NOGA 2ZH9A 3VALA 3C16A 1ACMB 3FEYB 1CJKA 1WF2A 2AYMA 3IAM9 5L9XA 4A47A 4OYIA 4NWBA 4ZP8A 4QWBA 1Q95G 2IRXA 3QBCA 5DDPC 1DY3A 3L4BC 1SKSA 3WHIA 5IC6B 5KFKA 1P9YA 4HH0A 1BWEA 1IBKJ 3SQGA 1X7VA 2P2CB 4ZJLA 2K1RB 1QE1A 5HVHA 3HF5A 1Z2LA 5F8GA 5C25B 1FRKA 1Y7PA 3KFWX 4GRSA 2IMWP 1SL0A 1J5EF 2RQCA 2DIUA 3G6VA 4DV2F 3R1LA 4C0HA 2HKEA 5ETPA 3KLHA 1PYSB 1AZSB 1MU2A 2LYVA 2B8PA 2PGCA 2FVRA 1NU4A 2BRKA 3CC4S 4IH6A 3H2VE 3POTB 2XMMA 3CJ5A 3M8QB 3ZTOA 3DOLA 2APOA 3AQPA 3K5PA 5B0BA 2CWXA 3H59A 1YHQS 4ZVFA 2LMIA 4UQGA 3EVWA 3G6YA 1R43A 2DNRA 1CC7A 1ZM4A 2MQLA 4LF6J 4AQYF 4I7FA 5CD4H 4F3QA 4GVLA 1K1SA 1YLXA 3C14A 3HHKA 1G6BA 1VQMS 1RDRA 4OI3A 4NRUA 5EHHA 4DPWA 3OHAA 1R3NA 3JAMY 3T5LA 1PYTA 5K8PA 2MZRA 4A4JA 4CO2A 2FJWA 3QWPA 2N7CA 1BQMB 3FFIA 5KOXA 4URQU 2KT5A 2DCLA 3VAGA 1X60A 3RYLA 5EX3A 4Q2MA 5DS7A 1E6YA 1IR2A 1EX8A 2BKNA 2JLEA 4PPZA 4G6VB 3FBFA 1Q86T 4RJVA 5B08A 3ZTSA 4G3IA 1EHWA 1F3FA 2BMBA 1KQGB 2XULA 2ADCA 3MAQA 3CJSA 2IDLA 4IUFA 3PX6A 2XZWA 1VCTA 1HBNA 3X1LB 3PRBA 3GYNA 3PR4A 2C2MB 1KRPA 1TR0A 5C2GA 4F4WA 2ZBRA 2HWIA 2XYHB 3D6HB 1UL3A 2AMCB 5C24A 1ZH5A 4N76A 2BM0A 5FDLB 4B3OB 1N5QA 2V68A 3UN2A 3J81U 2M3DA 2FHJD 2ZH2A 2G0IA 1RT2B 2OTLS 2PFDA 1VBKA 2PE8A 1KC8T 1NK9A 2H4YB 2V0NA 1S1WA 5HMXA 4Z7CA 2VFUA 6FD1A 2GC8A 4DV3F 4H4MA 1CBKA 1XBWA 1SQFA 1U0HB 2VASA 2VONA 3MM5B 3FJ2A 2CQ3A 2V4JB 5KT2A 4Q0BA 2BACA 4JI6J 2BXJA 1DURA 2O67A 2CPDA 4B08A 2MY7A 2XMTA 3GQCA 4X4NA 2HNDA 3EX7B 3NBPA 5A0YA 4RZRA 3HVRA 1OSCA 1RT7A 1SC3B 4HHJA 2ZH7A 2AEFA 2V8DA 4CO0A 2RILA 2A18A 4GMKA 1VQKS 1YG0A 1EP4A 3OVBA 2B6AA 4PQUB 3FNNA 2BW2A 3KK1A 4ITSA 3R2DJ 2X1AA 2WSEC 2MHEA 3NL0A 1CJTB 3TW0A 3M9NB 3D6FB 4B9TA 1UP1A 4OYOA 1IBCB 2AYEA 2HQCA 1LV5A 1WACA 1IBMF 5EN1A 2GV1A 2HRTA 4EGLA 3W8GA 3LW5C 4U7UK 3KLIB 3CMQA 3HZEA 4JI1J 2WONA 2LA4A 4DV7J 1KD1T 4DS4A 2BKPA 4QW8A 4B3MF 4HVZA 2CQHA 4DX5A 4F04B 4ZN1A 3KDOA 4J9VA 3HULA 1ZM3A 3W7BA 5KFFA 2OGUA 3DDNA 4JI5F 3BR8A 1S1TB 5DG8A 5DZ6A 3GR0A 2QFJA 1Q81T 2E5IA 2FJVA 3P5TL 4J9QA 4WFBQ 4ZKAA 4CO5A 3OUYB 2QO3A 4K4ZA 2CVIA 2NREA 4KYZA 2R3VA 4Q45A 2QA2A 1YDLA 3UDEA 4I1TA 2B7CB 2FHKA 4K2JA 1Y5IB 1UVMA 4FNIA 1YWXA 2QEXS 5KG5A 5L1JA 1RHMB 1IWAA 3HVWA 4WKRA 4BC9A 4CNZA 2BOAA 4TU7A 1KFDA 2CPXA 3M30B 5F8HA 3IR6B 2VA3A 1FE4A 2Y1JA 3PYFA 2WZ1A 1TTHB 2LXUA 3H2LA 3JQJA 3F41A 5CYQB 3BO3A 1UVJA 4FYYB 3PW2A 1FFWB 2FQQB 5J2PA 3SV4A 4I2PA 4IRCA 1MMDA 4Y2CA 3RTVA 2VKRA 3D2WA 5KT5A 4BBYA 2FLPA 2V4RA 1GH8A 1JLGA 4L76A 1J5EJ 3T1HF 1FEEA 3HSDA 3DLLQ 2B56A 1ZA1B 1M5HA 3CJ4A 3QATA 1XERA 3J80Y 1SQEA 4NOHA 2DGVA 2RS8A 2XBPA 2G1HA 4RW7A 1VRUA 2VV5A 4R0EA 2MQOA 1P27B 4DPOA 4QYZJ 3MAAA 3QFWA 2IJFA 1OY8A 3SEOA 5IZHA 3UN3A 1K0VA 4XDCA 2MSTA 2ZDPA 3NGRA 5E7OB 4ELTA 1EKRA 2M0GB 2R9LA 3LP0A 3AODA 2XY6A 3GG0A 4DSKA 2CNNB 3OL8A 4ETXA 2F4VJ 2HQ3A 2YWKA 1KBRA 1YTYA 2QJ3A 2CFXA 2NPIA 3ZZYA 2VG6B 1Q79A 2CJQA 1OO0B 5A8WA 1VQ4S 2FJAB 5B0GA 4DR6F 4DX6A 2XLKA 3EVMA 5J1NA 2VQEF 3ISZA 4DMZA 2DO0A 1C0TB 4O0NA 1JLFA 1N54B 3M8RA 3HZGA 2P5VA 1WKLA 1ULRA 4M5NA 5D78A 1FJ7A 3PKYA 3A4TA 3BYRA 1BE4A 1O6XA 4KHPJ 2NUUG 1HMVA 4KTQA 3OFEA 4IFVA 1DAXA 2DHSA 4KGKA 3W1YC 1Y3KA 3QYYA 2JNJA 4CLWA 4E8UA 1NJYA 2RS2A 2DR8A 1P9QC 3TARA 2VICA 2YKOA 1FDAA 2LECA 2D9OA 1KEKA 1VI7A 5JUMA 1HQEB 4KJIA 4ZPBA 1HWUA 4A8FA 3PW0A 5H9FJ 2V8GA 4NYZA 1HBMB 1JLQA 4ZP6A 3I0RA 3MMCA 3MPDA 5F8JA 2QLXA 1UWBB 5KFSA 4ALZA 4PUOB 5CCMA 2AGQA 2HZVA 2ZITA 2E1AA 4Q2LA 2KG0A 5AT1B 4P52A 1AUDA 2RHQB 5F41A 1RAIB 2RMLA 4GVBB 4ILMA 1XN9A 2ASYA 4UOHA 1GXTA 1OMSA 2YNIB 2DGUA 2BR0A 2GGPB 4IG3A 2QL7B 1FJGF 2FB0A 5IFMA 3BDPA 4DV1J 1OWXA 4N8OA 3C2PA 3FGVA 3N5FA 4Z37A 3Q83A 1GAOA 3H5UA 3R9LA 5F8MA 5DQIA 5ETNA 3V2UC 3M05A 4DN9A 3CJRA 1RWNB 2Y8WA 1R27B 4YMEA 3IN5A 4CI0B 5GAHU 4WFNQ 2WVEA 3DHWC 3VGSA 1LWCA 2NR0A 3JQKA 3US5A 4HDHA 1R0AA 1NHVA 1IBMJ 5A6PA 4ERDA 1VYAA 1CJUA 4LF4F 3CXCR 5JMNA 4NLRA 1HW9A 3JSRA 5GMKa 1LW0B 1TUWA 2Y8YA 3UQSA 4TU8A 4B3MJ 1UA1A 2V8VA 3MM7B 2DR6A 1AUSL 3TI0A 4R5PB 4PG7A 1P6TA 4PQAA 4LFCJ 1Z2ZA 2X1BA 1NK5A 2R7QA 2CDQA 4ZPTR 5KT6A 1T9TA 4JI5J 2BDPA 5IQ6A 3E2EA 1YJ9S 4GKKF 2HFVA 3JB9k 2DGQA 3Q2TC 1T7PA 4YDDB 2HHUA 4Q8FA 1RT3B 1IJEB 4NEYA 4C9DA 4PEOA 3PNIA 1FF2A 1YIJS 1B3TA 2L9WA 2VOPA 4ZPCA 4PABA 4LF5F 2B9XA 4FVMA 3DRYA 3BO2A 3UDVA 2WRMA 5RUBA 3DGVA 2YQ1A 5KFHA 1H74A 2LLZA 3RB3A 1JK9B 5J2QA 3SDEA 2IM2A 4J9NA 3ZXWA 2AKWB 4DL2A 1XR6A 3WIUA 1RYRA 3HLUA 3QNWB 2IFXA 4ECWA 3KWMA 4LBIA 5J1EB 5B0DA 2OSRA 1PC4A 1NDCA 4YUDA 1PCAA 1IM6A 2ZWOA 1U1QA 3DLHA 1DLOB 1VQYA 3EDQB 3GTYX 4CH7A 1RT6A 2QRRA 3CDWA 1JLAA 3CEDA 4LRCA 4PXBA 3KG0A 1V9OA 4KGZB 4PG5A 4X65J 3TA2A 3PG9A 1RGVA 2FYXA 5A8KB 3VV2B 1TK0A 3EGWB 4C11B 1TL4A 3MXHP 4WE1A 2MZQA 4OHVA 4B3RF 1IN0A 4JI3F 4OYXA 3KK2B 4QR1A 4CM2A 1VQ6S 2J6UA 2DEJA 2ZH5A 3MMAB 4AT1B 2CA9A 3T1HJ 1R6YA 2WOMA 3QLHB 2IJRA 1ZYQA 2UXCF 2HFNA 1UEUA 1KQKA 3VGVA 5K8MA 1UZDA 1C0UA 1D9FA 4IO1A 3PVXA 1UW4A 2H5EA 5SZTA 1D09B 1URRA 4Q44A 2XMKA 3R5CA 2LCWA 2D1CA 1I51B 3CCLS 3L9ZA 3QO9B 4CZCA 2JC0A 3J7YI 3D1QA 4DQIA 2KXNB 1KWMA 4D3HA 2HHHF 4XDDA 2WHOA 3B8HA 4G1IA 3ENVA 4F3OA 1RAAB 3FSIA 2KH9A 4ED4A 2F1FA 1U1LA 1N88A 1Z1ZA 1R7IA 5CABA 1REVA 3ZZ0A 1UWAA 2CQ0A 3AY0A 1RB0A 4TYBA 4F0KA 3M2UB 2CJYB 2OUGA 3HVTA 5M2UA 2FJDB 1NPPA 4ZVSB 3SBMA 1D9AA 2OPSB 5DRKA 5HLFB 2FIUA 3HHNB 3CJ0A 3RB6A 1RQ0A 1HFEL 2N4DA 4IFYB 5J2NA 3TZYA 2VQEJ 3SSSA 8ATCB 5F8IA 5D0RA 1P1TA 3A1YG 1PJ7A 4Y0FA 1NAQA 3NGKA 2KM8C 4W98A 3HHLB 3PO5A 3DKDA 1Q8LA 4C8OA 4P74A 4M63A 5I42B 3U02A 2H5IB 2GA7A 3LP2A 2CVEA 3Q8YA 2OLWA 4NRTA 4X64J 3OR2B 2W2QP 1YI2S 2GAHC 1YZ7A 2BW7A 2Z2MA 3FCVA 1T95A 4U9RA 2Y1IA 3QSIA 4DV4F 3P5BP 1DHMA 2ZH1A 1N5YA 2COLA 3M2VB 1ZTWA 1M5PC 3CE8A 1LWXA 3C16B 1FCAA 4B9LA 4FYVB 2NXUA 1CJKB 2Z56B 2E9RX 3LGMA 2CXEA 2DNYA 2YNGA 3HD2A 3VZHA 2GJ2A 2CPZA 2QLBB 3QRPA 4U8YA 4LR8A 3Q22A 1WC4A 4KH0B 4PXCA 2WVCA 2IVYA 3KJFB 3OSPA 1KVJA 2MZTA 2POKA 1QE1B 3DRSA 1S6PA 2CNLB 1RTIA 2QV6A 4NLUA 1VQSA 4JI4J 3AD9C 1FTRA 3FVYA 1SV5B 4K0KJ 1PILA 3AB4B 3G87A 2E7VA 3DRPB 4MKAA 3V6KA 2B7BB 4IQMA 3M9OB 3UR3C 1I6JA 2DGXA 2A2DA 1YRTA 3AXKA 1WSVA 2FZCB 1OJ4A 3MCMA 2UV8G 2FGCA 3EZUA 4DV5J 3DOLB 4WXWA 4YN3B 1VDHA 2WVFA 4QWAA 4LMZA 4Y2IA 3CJKA 3MMBA 2B5JB 1KP6A 1WOPA 1EETA 4A8YA 2EBEA 3UVJA 1R8HA 2KDOA 2VD3A 3K8WA 1RK8A 3V81B 3H98A 5KAKA 5KFVA 4I7FB 2DPIA 1ZAVA 3ILLA 3A8IA 1MN9A 4LFAF 3CO9A 2H3EB 1RU1A 2PI4A 4DN0A 3C14B 2AJ2A 4J9UE 1FFSB 5LXRA 2HHVA 1DARA 2W1BA 3OL9A 2ACYA 3K17A 2Y9HA 3TAQA 3OL6A 1QJHA 3OXFA 4L73A 2VJUA 3TNVA 4HACB 5AXLA 4B9SA 4C0BA 2K2PA 1GEHA 3W2VA 3P8BB 4J91A 2CYYA 4HR2A 1BQNA 1VQOS 3CJQA 3DGPA 2VQFF 1RAOA 3ZZOA 1Q4RA 2RQ4A 4KY3A 3DLKA 4KC5A 4GKKJ 2XI3A 3I4PA 4A48A 3RB0A 1WHWA 3QRQA 4JV5J 1BHNA 1SJ4P 1LFWA 1P1LA 4TKTA 2B0GA 1AW0A 1RWKB 3HKWA 2BA9A 4J9RA 2W9CA 3NWGA 4LF5J 4RW4B 3SMZA 5KG1A 1PG5B 4ILRA 4QCLA 4F67A 4ES1A 1HLWA 1FWLA 3MPYA 4IR1A 4EWTA 5HO4A 4F4KA 3B54A 4ZVQB 1Y11A 3D66A 2VOOA 1J5OA 3ZZRA 3TAPA 2K3IA 3V4IB 2F8MA 2ZVIA 4PR6A 3NEKA 2KKHA 2XY5A 2EC2A 2VC1A 1S1WB 1M90T 3KKFA 3T41A 2DHHA 5ETTA 1AXQA 4MKYA 3QT7A 1RUSA 3B4DA 1F2GA 3V6JA 5HVGA 3KMQA 1RADB 2CQ1A 3C66A 2GO8A 4LF8F 3L7UA 3R8YA 3MD3A 2HURA 5GMDA 2M5YA 1H73A 1HL6A 2HMIA 3DI6A 1RHKB 3FSXA 2CRLA 3BO4A 4HTJA 3DRRA 1FDDA 2UV8A 2UVRA 1YVFA 1V3SA 1Q78A 4TVAB 3P45B 3MM6A 1D3WA 2Z4PA 5AXNA 5KFWA 1I1GA 1TVRB 2UUTA 1NKCA 4W4MA 3LF0A 2X1FA 3R5AA 1UVLA 1ZM9A 4UW2A 5L38A 2PT0A 2HHHJ 4C2MA 3CW2C 1S6OA 4PPDA 2VHGA 3R5DA 1I94F 3W2WB 2XG8A 2DNNA 1VHIA 1X0FA 3SIPB 5D4OA 1U48A 3G86A 4A46A 1NHKL 2H4WB 2UP1A 2PEBA 3ZNJ1 4DCPB 4FKXA 4I68A 4F4XA 2GHWA 3DLEB 2G0CA 3MOZA 5KTQA 2HNYA 2KL8A 1C4CA 5ETKA 5AE2A 2OHDA 2YQ3A 4JOUA 2VPXB 3H42A 1VBZA 4ILLA 1AYEA 4M5JA 3HJFA 3G96A 5A8RA 3GPAA 4MTPA 2ZH6A 3R7NB 2AJQA 3IAS9 4DR3F 4UY8T 1DRZA 1G4CA 1S10A 3VGUA 3W9JA 2QN6B 2C42A 4U96A 3KTQA 4DV4J 4DR1J 2ZBCA 2ZDOA 1MN7A 2AD9A 4DV6J 2R2TA 2BKOA 3QGHA 1YJWS 5ETQA 1UKUA 2J5AA 5HI7A 4Y3CA 2CJBA 3L95X 2X51A 3MDFA 4P7VA 1OIAA 2ATCB 3JTOA 3GYXB 1XR5A 1TFYA 3QIDA 3JSYA 3M8PB 4YY3F 2UXDF 5LOQA 1D0EA 3WC2A 4O3NA 5J2PB 4GO5X 1HQUA 2K06A 4I2PB 4ZK7M 1G2EA 1HKAA 1WI6A 2HQIA 2DD8S 2M7SA 4F2SA 1CQNA 2EBGA 2BJEA 3CCWA 4NLXA 1GMWA 3SFUA 1AA1B 1GMUA 1KDNA 2FDNA 2ALYB 5GAGI 4HI1A 4OYAA 3EZOA 1N36F 4OI0A 4C6AA 5HROB 4P2XA 2MZ1A 2YX4A 3R2CJ 1RHJB 1HR0F 4PAAA 3NCQA 5I4MA 2ZD1B 4Y2AA 2MKCA 4DCJB 5BYSA 4O4GA 4CNYA 2R2RA 1JKHA 3X3UA 2AGOA 3QJLA 3PFOA 5IT0A 3PM9A 3JSMB 4NA1A 2IYIA 4LFAJ 2XNRA 3MCOA 4YB7A 2GX8A 3KLEA 4FNHA 1NEEA 2WK4A 4A8MP 4FF3A 2JVOA 3ONQA 2CJKA 2O01C 1F0XA 4I69A 2V8HA 3TX0A 5AJ3F 2A2CA 5HATA 3CD5A 5HBMB 5A8WB 2J0QD 5KFXA 1WC6A 2HHQA 4O3SA 3O8WA 1VK8A 3BEGB 3RAXA 1SH0A 1WG1A 2VQFJ 4JV0A 3DM2B 2BM1A 3M8ZA 1RBLA 3NWRA 5KOWA 3BBFA 3MCSA 3BPSP 3BGOP 1RAJA 5DGAA 3KK3A 2G2ZA 2E1RA 5I3UB 2ZE2A 4TXSA 2HWTA 3AA9A 2JX2A 3UDCA 4FF2A 2RQMA 4LSZB 4DSFA 2PI5A 2RKIB 3IR5B 1IKWB 3M32B 3NKYA 1B0TA 3I5BA 3FRYA 1WORA 4ZHRA 3ZZZA 3IRXB 4MIAA 4KV8A 1N52B 1FTCA 4MK8A 3W9HA 2VFVA 4Q7AA 4DSJA 2AYBA 2XHWA 2KXFA 4DOZA 1NDPA 3QGPA 2Y0SD 2GZOA 4F26A 4UQTA 5CA5A 2LXFA 2P6TA 2AYGA 1JLQB 1VK3A 2WCXA 2GQ2A 2HZAA 5DG9A 5G0RA 2YPZA 3MUMP 1WOSA 2ZHOA 3HMJG 3CULA 1IQZA 3AD7C 5U47A 1TL1A 3QWUA 1E6VA 5F0UA 4LSLB 2I5JA 2ZC4A 1S6QA 4LF8J 3NAIA 1S4FA 2DNOA 1U6BA 1RAGB 2KO1A 1VQ9S 8AT1B 2IA6A 2CJXB 1ROFA 2VPWB 3KHRA 3QAUA 5HVFA 2DK2A 2ROGA 3CCJS 4URSA 4USMA 1BWVA 4Y00A 3D1OA 2F9JA 4OZJA 1YRXA 1VQLS 2A6MA 1S9GA 3E8OA 1VC0A 2GQQA 1B0PA 3J7ZT 1LWCB 3TQ1A 1NNDA 4UOFA 1X4BA 1FXDA 4JV1A 2B8QA 3M4XA 2Y0BB 1ZPWX 5BYRA 4Y65A 1TL3A 5DDOC 1CJUB 1KOOA 3F44A 2YKPA 1FDNA 3IO1A 4C0OC 3MEGA 1XWLA 1VJWA 4P7TA 3SCLE 4OX9F 2CZ9A 2Q66A 4XO0A 2Q3PA 3QRRA 2N82B 5HMZA 4P71A 3T9ZA 3S8SA 4LVNP 4IDKB 4WK1A 1FVSA 3HSJA 2I2YA 3SSQA 2J0SD 5KG2A 3AJDA 4L3KA 1NXIA 2H51B 1RWMB 4U6PA 3FSYA 1VIOA 4NLTA 4OJ1A 3ADAC 1S77D 3H7HB 1T9VA 3PDNA 1HNIA 4DR7F 3D54A 4B17A 4M5GA 2IAJA 3HX9A 2YXLA 2G4BA 2HS4A 1B64A 1KLMA 3G9CA 1N34J 1QSYA 2LEPA 1FX2A 4RW9A 2GIRA 2ZNYA 2C3OA 4XIUA 2C3MA 1GXUA 1R0BG 3I9ZA 2OH2A 1JX4A 2GMHA 2I1RA 1NKBA 2OPPB 1UETA 5J2QB 3SDEB 3AXMA 2BEFA 4RBVA 5B0EA 2P9EA 1JJCB 5D6GA 5L46A 1X5TA 4YOEA 4PZVA 2DBBA 2DHAA 2H9ZA 1UEKA 1RWXB 5EWFA 4P2MA 2CG8A 5C42A 1KNZA 4PG6A 5IT4A 1FRXA 3OR1A 3KLFB 3NXZA 3VAFA 3LUYA 4NCBA 2E5LF 2WSCC 1WUUA 1W26A 1C2PA 4WFYA 2JRSA 1HNWJ 5E3PA 4K4TA 3FC9A 2NXCA 4OYZA 5K14B 3S7RA 2R2UA 4X66F 2JEGA 4I6WA 2HBRB 1X4CA 4ED0A 1SKRA 3OT9A 3PO4A 3P96A 1SJFA 1QAJA 1HNXF 5HMWA 4UOGA 2J7KA 2F5GA 5L39A 1S7HA 3DMJA 2BJ8A 1RT1A 1FRIA 4WFAQ 1X0PA 1WF1A 2FPHX 2EFOA 1U1NA 3BS9A 2KXHA 1HR0J 1FDBA 2WTFA 1PAEX 2EXUA 4ZVHA 2RB7A 2JJ4D 2IRUA 1AFJA 5DM6Q 3NG8A 5DETA 1D8ZA 2PMZD 3G71S 4NI2A 2YKNA 3OTOF 4YS2A 1U8SA 2KB2A 3GIIA 3VTIA 3WIVA 1T9XA 1U2RA 3JAMU 4QZVB 2FHMA 2MKJA 3N4WA 3A13A 2LFVA 3ENQA 1RLDA 4WU3A 2JOQA 3LALA 4TY8B 4RW6A 3CF5Q 1QUPA 2CQIA 2DNLA 4NLYA 5CQGA 3OTDA 3M1VA 5J2NB 2K8GA 3IWXA 2VG7B 4DLEA 2KTQA 1DJ0A 3FBBA 1K44A 3DDIA 4C7QA 5C7PA 2IBOA 4RNOA 3CCTA 4M8LA 3NGTA 4Q5VA 4B9UA 4ZMMA 2EKYA 3M2RA 3CVKA 2IC3B 4RNHA 4UUXA 2BANA 3ZTQA 2PFFB 3FBCA 3RRKA 4H4KA 4DX7A 3AOBA 1RA7A 4R8UB 1N5SA 4DHVA 4OJGA 1OYDA 2VDIA 3MEEB 3O3LA 4C8MA 1XJWB 1N5YB 2BVZA 1SH3A 2M4MA 1S1XB 2JVRA 1IJFB 3N9UC 1TU0B 2ZFHA 1FWKA 1B4SA 1PJ5A 3QGIA 1LW2B 3W65A 2OPRB 2HHXA 2DHXA 1LWEA 2FVQA 2RDIA 2EI5A 1U2CA 4DL0C 3GV7B 4QIVA 2Z30B 2LKZA 3DRSB 3TUIC 3IG1B 1T05B 2HFSA 1QSLA 2CJAA 1VC6A 2GVDA 4B3TF 3JXOA 2NLWA 3FUYA 2VC0A 5E3AA 4ZLLA 5HP1B 1FHTA 2LQ8A 2W7AA 4CT9A 3BBBA 4B9VA 3MECB 4IQXA 3LA0A 4K4SA 5KT7A 4LF6F 5ETOA 2RHSB 1Q8BA 4IR9A 3EXCX 3GJTB 3C6UA 5KFEA 4FYXB 3A8JA 1Y9OA 5K9FA 5A6WA 1X9MA 2EPIA 4AFFA 1F5AA 3EWGA 3V4MA 4MYTA 3HK2A 2GIFA 2W8LA 1FKOA 3G8TA 3BGRB 2HSEB 3UVJB 4NXMJ 2VU5A 3HSGA 4NMLA 3R97A 2AJFE 2G9OA 2C1EB 1N33F 4DU7A 2MKKA 1AROP 3MOJB 1IR0A 2B43A 1SL1A 3GIRA 3DHXA 3GFXA 4X4VA 2OELA 3B78A 3IWLA 1PBAA 4OX9J 3W60A 2MY8A 3TAMA 2W9BB 4I0WA 4M1KA 3W66A 3GV8B 1HWIA 2A0FB 2QA4G 1UAWA 3NCPA 4CTAA 3GE9A 3OTCA 3H20A 1HWJA 3KJVA 3T5HA 4B02A 2V94A 4MFBB 3QT5A 1YJVA 5KFYA 1HA1A 2J7UA 1R8PA 4DR7J 1DQ9A 2KZZA 3DLKB 2WVDA 3L3CA 1XMQJ 4DG1B 1N5VA 2Z0GA 4J9PA 4A8QA 4IG0B 3EM1A 3RJMB 2ZOGA 3CSKA 2XEXA 2D9PA 4DSEA 3W62A 4OZ5A 3BGLA 1PSDA 5EWGA 3RR8A 4DF8A 1BQXA 2YPYA 4ZJQA 2MZSA 3G4SS 3PW7A 1L5UA 2C2ZB 1WHVA 4U7UD 3HDSA 3NGSA 2FVSA 4NZ7A 4CH0S 4D3GA 5LMNF 2VBWA 2R8KA 2UVWA 4HEA9 5E3RA 1X4FA 5KFBA 3D67A 2GFFA 4CLYA 1TV6B 2V2KA 3B6BA 1LXJA 2YNFA 4GKJJ 4PKDB 3O44A 4KFBA 4URGA 4K4VA 2FTRA 4KGMA 1UPPA 1GNKA 5ETLA 5MAOA 2RU9A 1YJRA 3CDBA 2EFVA 4X66J 1RWVB 1S4EA 1RTZA 2MEWA 2EFGA 2H48B 5LSOA 2ACMA 3TZWA 1TL7A 5K8OA 3DI6B 1N6QB 4M94A 2DH7A 3K7RA 3O5TB 1R6VA 2BABA 2ZBPA 2HQGA 4K4YA 2QGFB 4ECQA 4JI1F 2RRBA 3B82A 5K20B 2L9DA 2V67A 4DV7F 4MK9A 3A8EA 4LRDA 1RT5A 4GC6A 2YX7A 2J6SA 4O3QA 2IA0A 2YWHA 1A6LA 3THTA 1FKPB 3S1TA 1HNZJ 4KGVB 4NE9C 1B0VA 1MROB 3IRWP 2P8IA 4BCAA 3MGJA 3T6BA 3BQ0A 3OTOJ 2VBYA 4K7QA 4C48A 2AEJA 2NPFA 1DQ8A 3C19A 3AFGA 1F9HA 2PMWA 3KHHA 1XK8A 5I3PA 1XMOJ 2QSFA 2QC3A 1OY9A 4USTA 4DL6A 2K1RA 2ZM6F 1NPRA 2VF3A 1S0OA 2C28A 1MLAA 3IS9A 2M88A 3LAMA 5C25A 3TUJC 2D74B 4ZVPB 1HYSA 4QBUA 2MMYA 3RAMA 3ZTRA 2HNYB 2HG4A 2DO4A 2MKIA 3CNQP 2UUBF 4YP3A 2B9WA 5DZ7A 5KFUA 4LSNA 3KJNB 1KSPA 2XWYA 4WK3A 1AZSA 4DF4A 5IS2A 2B9YA 3GILA 2R7UA 3H40A 3BKUA 3POTA 4N7TA 3BSCA 1X4HA 2B51A 3M8QA 3M8SA 3T5JA 4NLDA 3RU0A 2FLOA 3D0GE 5JVGQ 2U2FA 2OI2A 2RF2A 1ZAWA 4BLGA 5J2MB 2LVWA 2R2SA 1LNQA 5CZXA 1S59A 3BGUA 1WKJA 2KVIA 3AQOA 1NJIT 2RSQA 3QZ7A 2VH7A 2YWGA 3UE2A 2XS5A 4M5MA 4RO0A 2D3ZA 4J9LA 2FLLA 3UR0A 2HQFA 3GP9A 1DTQB 3NP5A 3GR1A 2D41A 5HAOA 1PC5A 3W8PA 3A3NB 3KMSA 4TQRA 3CB4A 3CUNA 4KAIA 1UJ6A 2DGTA 1U24A 4BWMA 3QT8A 3BM7A 1HQUB 1MNEA 5D77A 2OD4A 1B7YB 3BZQA 3WZ0A 2P9GA 4DPXA 2XZDB 2JEFA 3N5BA 4B3TJ 1GMVA 2NSBA 2JFKA 1X4GA 4EBEA 2ASLA 4DSLA 4CO3A 3U1LA 1RTJB 3DLJA 4YB5A 3DLGB 2KVQE 2HRYA 2VA2A 3EGVA 3I9V9 4PYDA 3HI9A 2XZTB 2HFZA 1IQTA 2F4VF 4DR4F 4X4RA 3HPOA 4QOTA 3MD1A 4QIEA 4NLGA 3RGIA 1CULB 5FDLA 4B3OA 2ZBQA 4YHHF 5HMYA 4J9OA 5BYQA 2Q1LA 3ISND 1RT2A 1D9DA 2MQMA 4ZPVR 3R7SB 1N33J 4DFKA 3Q8VA 1S48A 3K89A 1JLEB 1WOOA 4NL5A 1X4AA 5KFIA 4B3SF 1FJCA 4ZCLA 3FEZA 2E5GA 3VVUA 2HQDA 1B70B 4OL8A 1LXNA 1U0HA 4J90A 4KHPF 1NSAA 2XI2A 4NA3A 3OFFA 2V4JA 4IRDA 3OHBA 1CG2A 3I31A 1TK8A 2OMLA 1KLNA 4ZPDA 3OTBA 3V6DA 2GVZB 1YK9A 2QL9B 3OV7A 1HPZA 4FZVA 2IY5B 3GU0A 1TUGB 1L3SA 5GAHI 4ZVRB 3H0PA 3KK3B 3LWMA 4NX9A 1MG7A 4ZN3A 4PQUA 3QFHA 4I4BA 4CRJA 3WBZA 4UT4A 2F8EX 1KONA 1CJTA 3I5AA 4E98A 4ZHRB 4OYWA 2FVCA 3T1AA 3HHDA 1HNVB 2YVSA 3MM8B 4RX6A 3TVKA 5IM0A 1NDLA 5LMNJ 4OHZA 1IKYA 1FO1A 2ZWPA 4U95A 1PIEA 2R4FA 4DI6A 2HLUA 3T5KA 4ANDA 1RHQB 2FHJA 4DV1F 4CLLA 5G0RB 2XS7A 1X9WA 5E2QA 4CLUA 1XNRJ 4MIWA 3BKFA 3HVAA 5DQGA 1U25A 3OPKA 4A8OA 3KDNA 1TL1B 2U1AA 4FXDA 1S1TA 2IMOA 1F3VA 1VFJA 4DQRA 3WX8A 4CDIA 1SXLA 3B4MA 3P4UB 1G3OA 2ZEJA 1QD1A 1UFKA 5B09A 3GONA 3L09A 2HEKA 3W63A 1SQGA 3ILOA 3Q8QB 4ID5B 2AV5A 3Q8RB 4CO4A 3ISNC 2HFUA 5KG0A 1CPZA 2KJVA 2KFNA 1G1XA 1KS2A 3RRHA 4ZJOA 1XQIA 4ETZA 1MMLA 3DOKB 1WC0A 3EGZA 1R0CB 4G1PA 4CLPA 1NH7A 4OFZA 3DU6A 2QLWA 3AAWB 4LFCF 2JH3A 4U67Q 4ZPAA 4PXEA 2XSJB 3MEGB 2ZBIA 3THVA 1LOUA 3DRXA 3CCSS 3OLAA 4TU9A 3JSBA 2KYZA 5CYQA 2EFNA 1BLUA 1F9EB 2HBQB 2UXBF 4KO0A 2QX0A 1Y4ZB 4KH1B 3VAJA 2HVEA 3PXGa 1FT8A 2ZM6J 3LGNA 3VAIA 2YNHA 2HNZB 4QPTA 4JI7J 1TELA 1HNIB 3TQEA 4FKYA 2UUBJ 4I2QB 5BJRA 2IAJB 1GX6A 1H2UX 4QJVA 2E29A 1CJVA 4ZP7A 2ZNZA 1MWYA 3K8VA 2BJ3A 2VFRA 4RW9B 5T14A 1FERA 2BOPA 1PKUA 2DGSA 1IM4A 4QWEA 3C46A 3H5SA 4LF7F 2Z57B 3FCHA 3LOUA 4DS5A 3L7OA 2IM0A 4OZ1A 3JYTB 2OFGX 2DYAA 2IRYA 2MPUA 2UVVA 1SJQA 4X65F 3CCES 2PN6A 2R7TA 2VZ9A 1MMNA 4ECUA 2V9WA 3RR7A 3JTNA 2LXIA 3CCRS 3M6VA 3OXLA 4DWIA 5C42B 4WU2A 2MQNA 5LT5A 2IM1A 2CPHA 4X4OA 4RW8A 1X5PA 1WG5A 2MGZA 2M9KA 2ATLA 1UVNA 1YITS 3Q23A 3G6XA 2VG6A 2B4PA 3K57A 4DUZJ 1FD2A 4MKBA 1RTDB 2N4CA 2E5HA 2O1PA 1T3OA 2PEHA 4P2SA 3DYAA 3HO1A 3U27A 2J9DA 2HRUA 1WI8A 3R5JB 2R7WA 1RABB 3M7VA 4HH1A 5L1IA 3K58A 1JLBB 2EW9A 2C2RA 3DMJB 1VHFA 1FJEB 1RT1B 4EYIB 1RI7A 1TL5A 4H4OB 2CZ4A 1XC9A 1T03B 3HXMA 5AXMA 4FN5A 4WFXA 4K5SA 2YWWA 4DR4J 4MJKA 4YQWA 3VZIA 4OZ3A 4PYAA 2J8SA 4YHHJ 4DQSA 4G1QB 3K5NA 2HYIB 1G7CB 3TVYA 3ILJA 3TEHB 4M5KA 2M2BA 4QIFA 1DTTB 1UWBA 5KFCA 3NS5A 4PUOA 3UO0A 3ZZPA 4B3SJ 3MMJA 1SUQB 4ZITA 4ED7A 4RWWA 4RW6B 2V50A 4LJMA 4OLOA 2HZCA 4X64F 4GVBA 3ITHA 2QLJB 1N0UA 2YNIA 2NYHA 5EX0A 2QIFA 1VBYA 4OLPA 3M1VB 4S0MA 2C22A 4ED2A 4OYBA 4X4PA 4Q8EA 2F63A 3PYDA 3LH2S 3JQMA 5IV4A 3H2UB 1S12A 3BH6B 5D4LA 2MKYA 3M2RB 4OV1A 1W2BR 4U8VA 3SFGA 4J9SA 4RUAA 1M1GA 3KXDA 3NLCA 2KFYA 2XO6A 3QIPB 4A8XA 4OI6A 2CUYA 2HAFA 1RWWB 9ATCB 2JC1A 2ROPA 5E3QA 2RJZA 4O44A 4HHUA 3NNAA 2RU3A 1B99A 4RPFA 3R3TA 3TVZA 3PY8A 1YRUA 4CQ1A 4ZCMA 5EGYA 4F0MA 4FBUA 2EG2A 2R7XA 2PD1A 4JI4F 3GIKA 2DISA 3SXLA 3QZ8A 1TKXA 5DG7A 4YDXA 1DFDA 4LFBJ 3P6YC 4K0KF 4OX6A 5F3TA 1LW0A 1LWEB 3UFCX 5GADU 2XY7A 1TMJA 3MM7A 1RCOB 1WTBA 4EZ6A 2HVIA 5D4PA 5DLFA 4RNMA 4RL1A 4R5PA 4FS2A 2HW3A 4F4ZA 3F0NA 4DV5F 5A76A 1RWPB 4OZNA 4C8LA 1SB6A 4HI2A 3BN4A 2XLIA 1Q5VA 3EPIA 5KFJA 1Q53A 2KHDA 4OX7A 2E9TA 1QY7A 1Y00A 4QPXA 1VRQC 3BREA 1Q8IA 4F36A 4DPYA 4NASA 3NRBA 3C6UB 3DDKA 1VQNS 1MWZA 2HS3A 1UVKA 4F4YA 1O0PA 4EBCA 4RUCA 1SCJB 5HL7Q 4OJHA 3T1YJ 1M5KC 3ZZUA 4DBQA 4ZVGA 1V3ZA 1TK5A 2IDEA 5GAEU 1FKOB 4DCOB 2J76E 2FY8A 3QPIA 1H7WA 4H54A 2BJDA 3QJPA 1RXOB 3MFIA 5L1KA 3MPWA 3C3LA 5J1EA 5E0OA 4JI8J 1JJHA 1SPBP 4QWCA 1YKWA 3PFEA 4ZP9A 3UNGC 2ZZNA 4X62F 3PRDA 1EAYC 2K3KA 3TAMB 1XEZA 3WQPA 3SCKE 4JV5F 4DPTA 4CYUB 2UXBJ 4NCGB 1WELA 5CYMA 3IMQJ 4N41A 5A8KA 3ZZTA 3CD0A 3KJVB 7FDRA 3ULHA 1T94A 1U1RA 3TX8A 4LQ3A 1VGYA 4PWDB 3MMAA 2XNQA 1YQHA 3QLHA 2DCUB 3C6TB 1N56A 4ZVUB 1RU2A 5CXTA 2XQCA 1RWUA 2V69A 3GFYA 3HKZD 3QMQA 2FY1A 4MK7A 4WIQA 2OEJA 2R8HA 2YH0A 3TEGA 1VQ5S 3F73A 1V5IB 1F2HA 3LTOA 1VOMA 4LF7J 1A7GE 5AE1A 2C2KB 3QGGA 1L3VA 5M2PA 3PTWA 2E44A 3BQ1A 5D3GA 1IUJA 1B7FA 4RKUC 2NXEA 3G82B 4EI2A 4DSIA 4ECVA 3I4HX 1S9FA 3HT0A 1YJTA 4XTTA 5H1SV 3HHLD 1YSJA 5CCLA 3HFZB 4FBTA 3LO3A 4LVOP 1KQSR 3M2UA 4Z2XA 4C3LA 3OXGA 2ZJPQ 1XTZA 2VFTA 3MTKA 3FZ2A 2OPSA 2CG4A 4LT6A 2F9DA 5HLFA 2ALZA 1WSRA 2BE9B 3KG1A 4IFYA 5KT3A 2E9ZA 3TJ8A 3K2YA 3RBDA 3OJUA 2DTJA 4CT8A 3K5MA 3LGHA 4ID8A 4ICLB 4HKQA 3D1HA 3OBIA 1TL7B 1QAYA 1SC6A 3SCIE 2BBEA 2KRBA 2JLFA 5I42A 3EICA 5AE3A 2ZOMA 2J0WA 1V5VA 2CNOB 2E66A 4ZCIA 2HAIA 2MXYA 3OR2A 3EZ5A 2DR9A 2G13A 4LF9J 4L3NA 3ZC4A 2BZ2A 2NXJA 2D3UA 5A2QY 4ECYA 1FX4A 1UVIA 2UZAA 3RW7A 1ELOA 1HBUA 3OD2A 3RBEA 1RTHA 3M2VA 1REGX 1NZ8A 3HCXA 3EPGA 2AU0A 2GHPA 2KZMA 1R8AA 3T6JA 2JDJA 1C1CA 4KPCA 2O5DA 4UY85 4KSEB 3RRGA 4W90B 2YTCA 5FLXY 3IA0A 3RW6A 1VISA 4C3MA 4DPUA 4N5SA 3I6PA 1JLCB 1WEYA 1FD8A 4IYQA 3IS9B 3CCQS 2D3O1 1S79A 2A3JA 1HYSB 4GO7X 2LU1A 5KG4A 2L48A 1SV5A 2W2PP 4WP3A 3DRPA 1KQFB 4HYKA 4LSNB 1U0SA 1BD6A 4JUZA 1HI8A 2N7YA 1F6TA 5FJ4A 1S1VB 1U09A 4DR1F 2OPQB 4DV6F 2BE2A 2CPJA 2FHOB 4USWA 3ETOA 2M70A 5LJ5Y 4CM0A 5JXSA 2CDRB 4EBDA 3C15A 3ETMA 1N8RT 2RF2B 3HHLC 2B5JA 4V19X 3UD3P 3SQGB 2C3YA 3V81A 4EFAC 2DJWA 2P9CA 4XPCA 2LEBA 2VIHA 2HS0A 3A3PB 2AX0A 4PCQA 3R5BA 2DRAA 1Q5YA 5FD1A 5KFRA 4EZ9A 1L3KA 2GJFA 2VL1A 3I0SA 4RNFA 5F8NA 3A12A 3KLHB 5H9EK 1MU2B 5KFZA 1HWKA 1ZZFA 3HSZA 3OQ2A 4HACA 2AWZA 3MFHA 2FJBB 1HI0P 3UD4P 2LU2A 1H3DA 4LF1A 3PZPA 2RUGA 3CCMS 1ZZNA 3I5CA 5E33A 5IV3A 2FJXA 4NYOA 1YBTA 2CPFA 2HBZB 3FQLA 2K7JA 4LR7A 4BHQA 5L8RC 1VR6A 3GB0A 1YX2A 3AJ2A 1S6UA 1RE1B 2ABYA 2LDIA 1EQ0A 3ZFVA 5KFOA 1FVQA 1GTEA 4WFZA 4RW4A 1U1MA 3PACA 1EKSA 1U8WA 2XMVA 2HK2A 1KTQA 4FYWB 3GWCA 2A6OA 2KN4A 5LMUJ 1H7XA 3Q89A 3FFIB 5KT4A 4ANCA 4WIIA 1CSJA 4NLOA 3WDOA 1SJ3P 2XHCA 3V4IA 5EUHA 2QT7A 3WC0A 1TKZA 5IT9Y 1E6YB 3DXSX 4EU0A 1RISA 4DQQA 4CLZA 2XB2D 2ADBA 1FA0A 1KKHA 3FMWA 3BGFA 1H2VZ 4X62J 2GQCA 5ETRA 4UZBA 2DXFA 2VG5A 2QSWA 3VQTA 4R25A 4UTGA 4F25A 5T7LA 4QWDA 3PV8A 2X3DA 3RB4A 3V6DB 3BYPA 1HBNB 2GCFA 4L75A 1SJRA 3IGNA 4K4UA 1RAHB 1HPZB 2R7RA 5DQHA 1TUVA 4RUHA 2LP4A 4AYBD 5C24B 1H2TZ 1EB0A 3VR1A 1XNQJ 4ED3A 3N6MA 3PX0A 1M5OC 1ZM2A 3UN5A 2DRBA 2H1YA 3A8KA 3CMAS 1NRKA 3CDUA 3CDEA 5D0EA 3CCUS 1L3TA 1TVRA 4DXLA 1X9SA 5F3ZA 3GSDA 2QYGA 2RE1A 2CQBA 1CS4A 4H4MB 1BY9A 2AF6A 4YR2A 3D0IE 1KFSA 4JB8B 4OX8A 5IM0B 3OTEA 4Q0BB 3EDRB 3W2WA 1IKYB 5DDQC 4P73A 3JS9A 4DU8A 2W2NP 1BMQB 2L41A 2HNDB 1VC5A 4USVA 3NBPB 5A0YB 3J7Z5 1T9WA 2RDJA 1S5ZA 3Q8UA 2LDYA 4JI0F 4M95A 2YY3A 1WEZA 3LWLA 1RT7B 1PGZA 5IOLA 2M8HA 2CQ4A 2CKWA 4WYWA 1KVIA 1EP4B 3DLEA 2B6AB 2GS8A 3AJ1A 1GT8A 1T8EA 3KK1B 3FDSA 3GG1A 4ZS6A 4P72A 1RAEB 1GXLA 4ZLNA 1FI4A 1TKTA 2OFHX 4DX8H 3OW2R 1U45A 4JYAJ 3DOMA 4MIBA 4USIA 4CLTA 4TY9A 4M5IA 1S72S 4DFMA 2L3MA 3W3SA 4NXNJ 4DL7A 1D1UA 2R8GA 4CLFA 2WONB 4LRAA 5B0FA 3PKMA 3AB2B 2CPYA 4YR0A 3I87A 2CAJA 2XYGB 2N3LA 1RKIA 1HWLA 2DR5A 2WSFC 3CJ2A 3MAHA 1LFPA 1OPIA 3CD7A 4WTOB 1I3OB 4X84A 1NH8A 2DH8A 3D5MA 1R31A 4ZIVA 2W2MP 3CJ3A 4ED1A 3M8PA 2YKAA 3BR9A 4KO0B 3QAEA 3THPA 2A10A 1N34F 2AT1B 5F9LA 1U2FA 1S49A 1NM2A 1QUVA 1PO6A 2MQ8A 1RCXB 3KJQB 4KHRA 1JJ4A 5D0HA 2YNHB 3RBZA 2VKZG 4YR3A 4LBPA 5G4DA 4UF4A 2FC9A 1NK6A 2CPIA 1ZA2B 4DV2J 1LK7A 4OHWA 2DB1A 2DT9A 1X8DA 2QLFB 2AGPA 2BJ7A 1CJVB 5HROA 4JBCA 1NB2A 2ZD1A 2IBKA 1I5OB 2J7WA 4DUTA 2YWEA 3GV5B 1N4LA 3SV3A 3BF4A 2L9NA 3KOAA 4YFUA 4NZ6A 4EMDA 2QE5A 1HNWF 1KHVA 3JSMA 2V63A 2ZUAA 1HIYA 4WP8A 1AFIA 2EG1A 2AX1A 4AQYJ 2J6TA 2BUNA 3N79A 3ZNUA 3NOCA 4RW8B 1JLGB 3UDLA 1S0MA 2B9EA 3I82A 2MGZB 2NZCA 1Y5LB 2OKQA 4ECZA 4N8NA 5LSLA 5HBMA 3QT6A 5D8HB 1RA6A 2MYFA 1AT1B 4RW7B 1VRUB 1VJQA 3DYAB 1CC8A 4WKYA 4NLQA 3D28A 2Q6BA 3MR3A 3DM2A 3MAAB 4HT5A 3NAHA 4DR2F 4LIWA 1EIYB 3TRGA 2QYCA 1QDUB 4IKAA 2ILZA 5I3UA 2RKIA 3LP0B 5C5JA 2O3DA 1IKWA 3M32A 1CEZA 5LXYA 4NCAA 4ED6A 2WBRA 1WHYA 2H5JB 1H6KX 2CIMA 4XPEA 3IRXA 2Y1RI 1W2IA 4AUKA 3PRVA 4CCHA 4ZOSA 2FGOA 5HJXA 3M6UA 2HHPA 4OJ3A 2CQ2A 4CIOA 5KG6A 3KG4A 2DGOA 3V5RA 2YX1A 3FK4A 3IWNC 4J37A 1S1UA 4K50A 2A1BA 4AXIA 2G2OA 2QMUB 3NGUA 2F3JA 1H38A 2EK6A 3BB5A 1JLFB 3KLGA 3K5OA 4IOBA 4DV3J 2YBVA 2C2DA 2FJEB 4DV0F 4C98A 3KUGA 3IBWA 4ZLJA 2BQUA 1ZPVA 2Z2LA 2DR7A 3ITHB 5KFLA 1HMVB 4I56A 4LSLA 2H65B 5CAAA 4IFVB 1FKAF 2R7OA 4PWWA 4WXOA 3CJTA 3TZZA 2OJ3A 3TWZA 4OI4A 1VQ7S 2CNKB 1NCLA 4JP8A 2BQRA 2J9CA 4QQBA 5THWA 4OZLA 3BDEA 4TLQA 3I0RB 3MMCB 5D0GA 1RT4A 4KQZA 2DNZA 2W4CA 4A8KA 5HQ8A 1TZ0A 2DHGA 4NLSA 2VFSA 4O3OA
chains in the Genus database with same CATH topology
2XI3A 3I4PA 4O44B 4FXVA 1F5BA 3PJWA 5F8LA 3HT3A 1R89A 4A48A 3RB0A 1WHWA 1X5SA 1HHSA 3I5AA 2ILYA 1SJ4P 1LFWA 4BC7A 2KFZA 2DPJA 1P1LA 4QU7A 4TKTA 2B0GA 4E98A 1AW0A 1JNRB 3HKWA 4FYDA 3GZ7A 4ZHRB 2RRAA 4IH5A 5JJBA 2BA9A 2FVCA 2IM3A 3T1AA 1ZTTA 2DGWA 3MM9B 2W9CA 4J9RA 3NWGA 1TKXB 3HHDA 1RT3A 4RW4B 1HNVB 3SMZA 2YVSA 4NCGA 3MM8B 4IG3B 4RX6A 3TVKA 5KG1A 5IM0A 4ILRA 4QCLA 2PIIA 3PIPQ 4F67A 4ES1A 1X5OA 3H5XA 2HHSA 2O66A 3MPYA 1M1KT 4IR1A 3BSAA 4OHZA 1IKYA 4EWTA 1FO1A 5HO4A 3MR2A 2C3UA 4IDKA 2GO9A 1F60B 2R4FA 4F3MA 4F4KA 1WTFA 2OSQA 3GMGA 2Q6CA 1S0VA 1FEHA 4JV2A 1MW7A 2HLUA 2RNEA 3T5KA 4PWDA 2ZH3A 2VOOA 2FHJA 4X4QA 3MTJA 4DV1F 5G0RB 4OQJA 2XS7A 1ZBTA 2GMLA 1X9WA 1J5OA 5E2QA 2V4QA 3NMRA 3ZZRA 3TAPA 2K3IA 5DGBA 3NCRA 4KKOA 3V4IB 4MIWA 4WZQA 3C6TA 2F8MA 2AJ0A 3HVAA 5DQGA 5LMUF 1U25A 4PR6A 3MI7X 2GW8A 1FNOA 3H8YA 2KKHA 3OPKA 4A8OA 2DNHA 2DIVA 2XY5A 3DXBA 2VC1A 1S1WB 2WB1D 1FE0A 1TL1B 1M90T 1UJ5A 2U1AA 3KKFA 3SSRA 1LK5A 3O2IA 1AXQA 1JNZB 2ZKTA 4CO1A 4MKYA 4NXMF 4FXDA 3MZIA 1NJZA 4HDGA 1S1TA 1R0AB 5E5NA 2DNMA 2IMOA 2ZVSA 4ECSA 2E1MC 1VFJA 5CYJA 3B4DA 1F2GA 4DQRA 4U7CA 3HHEA 3DLBA 3V6JA 3IXQA 3CIZA 4C8ZA 1SXLA 3B4MA 3K59A 3KMQA 1G3OA 3J81Y 1DLOA 2EK1A 3MHYA 2CQ1A 1O51A 1VIXA 5B09A 3O1LA 3L09A 3C66A 2GO8A 4LF8F 4KR0B 1WG4A 4ZVEA 4B9NA 2IYGA 3MUVP 3MD3A 3H5YA 3IFEA 3CC7S 2M5YA 4JI6F 4CTAB 3Q8QB 4ID5B 2AV5A 2OPPA 5KG3A 1A9NB 1HL6A 3Q8RB 4CO4A 3ISNC 2AQ4A 2NS1B 2WB4A 3EUNA 4C11A 2HMIA 3DI6A 4K59A 2J9DE 3DC2A 5T41A 3OJSA 3VF0B 2DITA 3FSXA 5I3QA 3SCJE 2CRLA 3BO4A 3KK2A 4DFJA 4HTJA 3P3DA 2B4UA 3PR5B 1K8AT 5KG0A 1CPZA 3DRRA 2KJVA 1FDDA 2KFNA 1FRMA 2UV8A 2UVRA 1G1XA 1KS2A 3RRHA 1YVFA 4O23A 4OIXA 1V3SA 4TQSA 4ETZA 1MMLA 3DOKB 1Q78A 1GTHA 3EGZA 3MM6A 1C4AA 1D3WA 4M5DB 4G1PA 3KLFA 3N01A 2DNKA 1N48A 2Z4PA 1NH7A 4OFZA 3DU6A 2QLWA 5AXNA 1XNQF 3AAWB 5KFWA 1I1GA 4LFCF 1TVRB 2UUTA