4ID5B

Hiv-1 reverse transcriptase with bound fragment at the rnase h primer grip site
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
424
structure length
412
Chain Sequence
b'IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 122
structure length 412
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4id5B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id5B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id5B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id5B03
1LWFA 2VG7A 1JLBA 2OPQA 1HQUA 1S1XA 4MFBA 1SH2A 2IM3A 5KFDA 3OL9A 3DRRA 5F8HA 5EWEA 1S10A 1FKOB 3KK1B 4H4MA 2VG5B 2DPJA 3CDEA 3OLBA 5KFHA 5C24B 1SV5B 4H4OA 1DTQA 4O44A 1QAIA 3I5AA 4F4YA 4LQ3A 3GV7B 2FVRA 4X2BA 1Z4UA 3CDWA 5KFVA 1IKVA 3RB4A 3I5BA 2HNYB 2BE2A 1C1BA 4MKBA 1C0TB 4ID5A 3HVWA 3V6KA 1K1QA 1RT3A 3G6YA 1JLCB 3QIPA 2OPRA 4QWEA 4NRUA 1HMVB 5KT6A 5J2MA 3NAHA 3MFHA 2VG7B 4NLDA 1JLBB 1HQUB 1S1XB 4MFBB 5J2QA 1UWBA 4IG3B 4Q43A 1C0UB 4H4MB 3KLHB 2O5DA 3HHKA 4K4TA 3OL6A 2FVPA 4O3OA 5KG5A 4MKAA 1TV6A 4H4OB 3KLEB 3RBEA 3M8QA 4WFXA 5HBMA 5KT2A 4F4ZA 1IKVB 3KLGA 3MR5A 3G6VA 1C1BB 3G6XA 1XR7A 3DM2A 3SFUA 3IS9A 3Q8PB 4PUOA 4NCGB 1T3NA 1RT3B 4QWDA 1RTJB 3N6MA 2OPRB 3CJ4A 1TKZB 3CDUA 4MK7A 5J2MB 3GIJA 3MR3A 1FK9A 3I5CA 4YQWA 5J2QB 4XO0A 1UWBB 1D1UA 3H5UA 3T1AA 3OSPA 4NLWA 1REVA 3FDSA 4NZ0A 3LP2A 1KHVA 5DGAA 3CIZA 3CJ3A 2W9BA 3RAQA 1XR6A 3C6UB 3DDKA 5DQHA 1RT6A 3M8QB 1C2PA 2ZKUA 5J2PA 1HYSA 4Y34A 3ISND 1HQEA 3KLGB 3LALA 3JSMA 2W7PA 2RF2A 2IMWP 1N48A 2W8KA 3DM2B 4IRKA 3IS9B 4RW4A 1IM4A 4PUOB 4RZRA 3IN5A 3FRZA 3NL0A 2YNIA 4O3NA 1HNIA 4YR0A 5L1JA 2QE5A 5C42B 4MK8A 2IBKA 2YNGA 3QGIA 4J9PA 1LWCA 1S6QA 3IRXB 3KK3A 2WRMA 4FBTA 1REVB 3I0SA 2AGOA 3LP2B 2BQ3A 3CJ0A 4RW7A 1S1VA 1YVFA 2XI2A 2YKNA 3PR4A 4IQXA 3MEDB 2ZE2A 2W9BB 1HPZA 4MH8A 3DYAA 4NRTA 2WOMA 1RAJA 3H4BA 4J9KA 3JSMB 5J1EA 4ZP8A 2RF2B 2F8EX 5KFCA 3KHLA 4RNMA 4DL3A 2ILYA 1LW2A 5CYMA 3M8PA 4RW4B 1RT7B 5L9XA 5KT7A 5JXSA 4ECVA 2B5JA 3DLKA 2BRLA 2GC8A 4K4UA 5KFZA 3UQSA 3QZ7A 2YNIB 5KG6A 1HNIB 3SI8A 3DLEA 4O4GA 3SFGA 4YMEA 4J9MA 2BQUA 1LWCB 1NHVA 2ILZA 3IGVA 2W7OA 4EEYA 4KBIA 4IG0A 3I0SB 4K4XA 5KFQA 3UPFA 1IKYA 4RW7B 1S1VB 3T19A 2YKNB 4KV8A 1S6PA 2ZE2B 1JLFA 1HPZB 4EYIB 2AU0A 2UVRA 4ED7A 2VA3A 2YNHB 4Q45A 4EYHB 4RW9A 2IAJA 5J1EB 3DLGA 1TP7A 1T05A 2ASLA 5CYMB 3E01A 3M8PB 4IR1A 4Q8EA 1JLEA 5HROA 1SH0A 3DLKB 2FLNA 3KK2A 3GYNA 2D3ZA 4R8UA 4MK9A 3FQLA 4I7FA 3RB6A 1TL1A 4O4GB 4DL5A 1HNVA 3LANA 3H2LA 4FBUA 4IG0B 2ASDA 4XPEA 3CJ5A 1IKYB 4EO8A 1RT5A 1S6PB 3GIKA 1JLFB 5KFTA 4URQU 4FS2A 1LWEA 2WONA 2IAJB 4ZPCA 1QUVA 3DLGB 1VRUB 3OLAA 3E01B 3Q8SB 4TY8B 5HROB 4NLYA 2HWIA 3UR0A 5KG1A 4JUZA 4KHRA 4G1QA 4R8UB 2R8JA 4ZHRB 3DRSA 1TL3A 4I7FB 1TL1B 3I0RA 3LAKA 2VG6A 3MF5A 4WFYA 3UDLA 3BJYA 3KMQA 5KT5A 5I42A 2DPIA 3ICLA 5EWGA 2ALZA 2J6TA 5HLFA 4K4SA 1MU2B 3QO9A 5KT4A 1RT5B 3MEGA 2V4RA 1LWFB 2OPQB 4TYAA 5D3GA 4LSNA 1LWEB 2WONB 5KFUA 3RBDA 3RB3A 1ZETA 1QE1A 3DRRB 4NLGA 3V6DA 2XCAA 3BQ2A 5DGBA 5KFOA 4DL4A 4WXOA 3DOLA 5DG8A 4MIAA 5KFRA 3N6NA 1JLAA 1JLGA 4TY9A 1DTQB 4O44B 4H54A 3M9NB 5DLGA 3EPIA 3BQ0A 1TVRA 5C25A 4G1QB 2I5JA 3DRSB 1TL3B 2BE2B 3DRPA 3I0RB 1T03A 2VG6B 3H4DA 1N56A 2J6SA 2B6AA 3DOKA 4ID5B 2ATLA 4ED3A 4YR2A 4XPCA 3BSNA 5I42B 3Q8RB 1ZTTA 4FS1A 3PW4A 3QIPB 3M9OB 3CJ2A 3OL8A 5HLFB 4LSLA 2WTFA 3QO9B 4Y2CA 2HNZA 3BSOA 5KFAA 5KFKA 5D3GB 4LSNB 3E51A 1BQNA 1S0MA 2RDIA 3V6DB 4KO0A 3N6LA 3PZPA 4J9OA 5KT3A 1BQMA 4Q8FA 4GC6A 4RNFA 3DOLB 1RTIA 1J5OA 2IM1A 5KFJA 4DL7A 2I1RA 4RUCA 2BQRA 1JLAB 1TV6B 2R8KA 3H40A 5HBMB 1SH3A 4KAIA 2I5JB 4NLOA 4TXSA 2V0NA 3DRPB 2E9RX 4DL6A 1NNDA 4IRDA 2B6AB 3DOKB 5F9NA 1FKPA 1K1SA 4R0EA 1LW0A 2ZD1A 1S9GA 4QW8A 3BQ1A 4QPXA 4LSLB 4ZP6A 5KG3A 3BREA 2HNZB 3DI6A 1GX5A 4IH6A 4K4ZA 3NGDA 2YNFA 1R0AA 1FK9B 4RNHA 4ZVGA 4KFBA 3KJVA 1BQNB 5KFFA 2UVUA 4DG1A 2JC0A 5EWFA 4OL8A 1BQMB 1GX6A 4WYWA 3QIDA 1J5OB 1RTIB 4F50A 3TVKA 1RT6B 1RA7A 4RW8A 4ECQA 1IKXA 3ITHA 4I2PA 5J2PB 1HYSB 4KHMA 5KG0A 1HQEB 1QAJA 3PR5B 4NLXA 4ED2A 4KB7A 2GIQA 1LW0B 2JEGA 2D7SA 2ZD1B 1S9GB 2D41A 2W8LA 2FLPA 1S9EA 4ZP7A 4NYZA 3DI6B 2FVQA 1JKHA 4IDKA 4DEZA 4TQSA 2YNFB 2YNGB 4ECSA 3V6JA 1RTDA 3GV8B 4ECRA 4KFBB 1S6QB 3KJVB 3KK3B 1S4FA 2IM0A 1HARA 2D3UA 4DG1B 2R2UA 3NKYA 2XGQA 1EP4A 5KFXA 2RKIA 4R5PA 2FJVA 4PWDA 3GIIA 1TKTA 3DYAB 4RW8B 2UUWA 4ED6A 1IKXB 3T5LA 2C28A 3ITHB 4I2PB 2WOMB 3MTKA 1S49A 3RB0A 3JYTA 1DLOA 4B3OA 3KLFA 1LW2B 3HVTA 3V4IA 3PJXA 4EO6A 3FFIA 5F8MA 2V9WA 2B5JB 1JLQA 1S9EB 2HAIA 3NBPA 3BSCA 4Y2AA 5KG4A 2C2RA 4O3RA 2HWHA 4IFYA 2IM2A 3CVKA 1JKHB 4IDKB 1T94A 4HKQA 4ZVFA 3RAXA 3DLEB 3LP1A 1RTDB 4PQUA 3MR2A 4QWBA 3PHEA 4WXWA 2JEJA 5FDLA 2W9CA 4MIBA 3HKWA 2BANA 1TQLA 4TQRA 1KLMA 3MECA 3PW7A 4KV8B 1RYRA 4IRCA 2CKWA 2XGPA 1TKTB 4ZPBA 4ZVHA 5KFLA 3M9MB 3KK1A 4ED8A 2BRKA 2C2EA 4RW9B 4WE1A 4M94A 3JYTB 1DLOB 2FJWA 4B3OB 2UVVA 1T05B 3HVTB 3KHGA 1JLEB 4YR3A 4EBEA 4EBDA 4RNNA 1JLQB 3KK2B 3NBPB 4QWCA 4NLRA 1C0TA 3QGGA 4IFYB 4KKOA 2CJQA 5KFSA 3PW5A 5KFWA 4GC7A 3LP0A 4PQUB 3QLHA 5KFYA 1HNVB 3T5JA 1S97A 4JV1A 4J9QA 5FDLB 2W9CB 4J9RA 2BANB 3CWJA 1KLMB 3MECB 1C1CA 5KFNA 4WZMA 1ZTWA 3IG1A 1N4LA 4ED1A 4HYKA 4IG3A 3HVAA 4J9LA 3GV5B 1C0UA 4YP3A 2WCXA 4IFVA 3KLHA 4WE1B 2OH2A 5KFEA 1SUQA 2R2SA 3KLEA 2FVCA 4IH5A 1OS5A 3GIMA 3OSNA 3KLVA 3BGRA 4KKOB 1S1TA 1I6JA 3QYYA 5DG7A 3LP0B 2WK4A 4NCGA 1CSJA 3QLHB 4O3QA 3LAMA 5C5JA 1RTJA 4O3PA 3BR9A 4ECZA 1D0EA 1W25A 1TKZA 2AGPA 5F8JA 2OPPA 1C1CB 2OPSA 3T5HA 1TKXA 3MEGB 2IA6A 3IG1B 4RU9A 2R2TA 4IR9A 3MEEA 4NLSA 5EDWA 2IJNA 1S1UA 4IFVB 1QE1B 1U09A 4ED0A 5KG2A 4F4WA 4WZQA 4KE5A 2R8HA 3PVXA 1SUQB 4NLTA 3C6UA 1S0OA 1RA6A 2AX0A 2C2DA 1JLGB 4O3SA 2JEIA 5L1KA 4IH7A 1RTHA 1TVRB 5C25B 5L1LA 3BGRB 4ZPAA 1S1TB 3BSAA 1T03B 4M95A 1EETA 4U7CA 3G86A 4Y3CA 2AWZA 4NLVA 4ZVEA 2W9AA 2UUTA 1N6QA 3NAIA 3OHBA 4URSA 5F9LA 1RT4A 3EZUA 2QV6A 5I3UA 4ZPDA 5C42A 2OPPB 5K14A 3H5SA 1RDRA 2JC1A 4EBCA 2OPSB 3KHHA 1TKXB 4Q0BA 2FLLA 1S48A 3IRXA 1S1WA 1RYSA 4K4WA 3MEEB 2J6UA 4IKAA 1S1UB 4TN2A 5EUHA 4ECXA 3IGNA 3KLIA 3VQSA 4KO0B 2R2RA 4DL2A 1S0NA 4RUAA 3MEDA 3ISNC 3FSIA 2XC9A 1IKWA 3D28A 4JV0A 3TAMA 1RT1A 2IJFA 5T14A 4TYBA 3QZ8A 3PJWA 3Q8QB 1RTHB 5KFGA 5DQGA 3DMJA 1KHWA 3OHAA 4ECUA 4URGA 1RT7A 4F4XA 1EETB 2HNDA 2YKMA 1FKPB 5HP1A 1XR5A 4I2QA 4O4RA 1N6QB 2XCPA 1RT4B 5KFMA 3GILA 2FVSA 5I3UB 4JV2A 5K14B 2AQ4A 1WNEA 4Q0BB 4WYLA 1S1WB 1R0AB 3QGHA 4IOBA 3NMAA 2E9ZA 4ICLA 4Q44A 3KLIB 3V81A 2WHOA 2JEFA 2HMIA 3MFIA 1JXLA 4G3IA 1IKWB 3TAMB 3C6TA 1RT1B 2IC3A 5DG9A 4K4YA 3PW2A 2YNHA 1VRTA 3PW0A 3V6HA 4ECYA 5DLFA 3DMJB 2R8IA 5CYQA 5F8LA 4ECTA 4K4VA 1DTTA 5J2NA 3H5YA 3H59A 2HNDB 5DQIA 2YKMB 5HP1B 2V4QA 4I2QB 2ASJA 4NLPA 3KHRA 1RT2A 1N5YA 2FJXA 4KSEB 2GIRA 3T5KA 3TQ1A 4RW6A 3FQKA 5KFBA 4J9SA 2E9TA 2JLEA 4LQ9A 5JUMA 3GQCA 5KG7A 3KNAA 4ICLB 4NLUA 2C22A 3V81B 3D5MA 3EPGA 2HMIB 3OL7A 4NLQA 1EP4B 5F8IA 2AX1A 5L1IA 2RKIB 4R5PB 1S9FA 3C6TB 2IC3B 4PWDB 2B43A 4QW9A 1VRTB 1JIHA 2XWYA 4U6PA 1FKOA 2VG5A 1VRUA 3H98A 1JX4A 5C24A 5CYQB 1MMLA 4TY8A 1DTTB 5J2NB 5KFIA 4ECWA 1SV5A 2AGQA 3KLFB 3V4IB 4QWAA 3MR6A 3FFIB 3H5XA 2RDJA 5KFPA 1RT2B 1N5YB 3CO9A 3KOAA 2WB4A 4ZHRA 2HNYA 2EC0A 2XI3A 4RNOA 5F8GA 2UVWA 4RW6B 4ZMMA 4TLRA 4J9NA 5F8NA 4K50A 2BR0A 3LP1B 1NHUA 2R8GA 1JLCA 3KMSA 2VA2A 1MU2A 4WFZA 4ZP9A 1HMVA
chains in the Genus database with same CATH superfamily
2A3JA 4F04B 3O44A 3DRRA 2DNGA 5HMZA 2KJWA 3CJTA 1KVIA 2IRYA 3J7A1 3GV7B 3MM8B 2CQDA 2CJ9A 2LDIA 1K1QA 3VAIA 4K0KJ 2GMJA 2DD8S 2W2OP 2J5AA 1JLBB 4DX6A 4A8YA 2L08A 2FVPA 3O5TB 2NR0A 1U1PA 3H20A 5CD4A 2P9GA 1MWYA 4PUOA 1X4FA 2RIJA 3CDUA 2X1AA 5A76A 4RU2A 1TMJA 2L3MA 2XS5A 2YPZA 3CJ3A 1BE4A 3C6UB 1FTCA 2GQQA 2NSCA 1N48A 5ETRA 1TZ0A 4RZRA 3DXSX 2IBKA 3I32A 3A8JA 3IR7B 3LP2B 4DR6F 2ZE2A 4YDXA 4QIGA 2MKSA 1N32F 1YRUA 1HWJA 2ILYA 1TTHB 1KS2A 1H2TZ 3F73A 2GW8A 2MLXA 1KRPA 1S6PA 3NWGA 2ZM6J 3D7SB 3FC9A 2FQQB 5CYMB 4CLUA 3E01A 5HROA 4GRSA 2IFXA 4DL5A 2L9NA 5KAKA 2QMWA 3EX7B 2FJBB 2WZ1A 2IJRA 2FPHX 5D8HB 4ZPCA 3Q8SB 4CCHA 2BKNA 2W4PA 3TR5A 1GT8A 1O6XA 4G1QA 1AB8A 2OLWA 4ZVOB 3M8SA 3I87A 3UDEA 1U6ZA 5JVHQ 4DL4A 1GMVA 3N6NA 2C2NA 4OI1A 3QRQA 4DV4J 1YI2S 4CQ1A 2BE2B 4ID5B 2KZZA 5I42B 3L3CA 3K2YA 4Y2CA 3LGNA 4PEOA 5D3GB 2P6SA 4KPYA 2MY8A 2IDLA 3NS7B 4A8OA 4ZJLA 5A0YA 2D1CA 3GJTB 4DL6A 3DOKB 4GO5X 1XJWB 1H7XA 4RNHA 4ZVGA 1OPIA 2HAFA 4X4TA 5IM0B 4RWXA 1IKXA 3ITHA 5J2PB 1HYSB 1NDCA 3JAMY 4DWIA 3AJ1A 4X4UA 3MCMA 3K5OA 1AW0A 1GMWA 1ELOA 4LIRA 5KOXA 1XTZA 3TWZA 4FXDA 4WWSA 1NPKA 4DPWA 2UUWA 2BJ8A 4DR3F 3GPAA 5F8MA 2HIYA 2CPXA 4PQUA 2BANA 2GAGC 1CJTB 2OTJS 2X51A 3C14A 5A8KA 3V2UC 4EBEA 3OTBA 1UPMB 3F41A 3OUYB 4F67A 3Q24A 4NLRA 4IFYB 3RGIA 3MM7A 5KFWA 3S7RA 4OHVA 3RW7A 3CMQA 4J9LA 3MMCB 3UDVA 2FZCB 3D1QA 2OH2A 2RQKA 3CD7A 3KLEA 3W65A 4WK3A 4KHPJ 2K3IA 1S1TA 3LP0B 1F6TA 3GFHA 3QLHB 2WW8A 1CC7A 4UW2A 4ILMA 1TKXA 1Q82T 1RHQB 2IJNA 1YJ9S 3PVXA 1SUQB 4WK1A 2YX7A 5L1LA 2ZH9A 1NKEA 1YDLA 1HBUB 1BWVA 1JXVA 3UD5A 4HHHA 4RUAA 3FSIA 2L9WA 2FUG9 1J2VA 4DSEA 3DMJA 3OHAA 1VS3A 3W9IA 2HNDA 4QZVB 2FVSA 3NLCA 2DGSA 4IOBA 4ICLA 1M90T 1P6TA 1JXLA 3TAMB 2YTCA 1S57A 1T95A 1VRTA 1AXQA 3W2VB 2ZOMA 4LF5J 1A7GE 2E5LJ 1SC4B 1R8AA 1FRHA 3HHNB 3UVJA 1WG1A 4JI2J 5F8IA 4RLEA 1Q81T 4PWDB 2VL1A 4ETXA 1UJ5A 3MM8A 5GMDA 3ZC4A 4RNOA 2G0JA 4HACB 3NGKA 1VQNS 3O1LA 5GAEU 1JLBA 2ADCA 1HHSA 3IR5B 1S10A 3IAM9 1QUPA 3Q89A 2XYHB 3BGOP 3QIPA 5BXIA 4NRUA 3D3BJ 2HFSA 3TOQA 2NUUG 2Y0BB 1X4BA 2YX4A 4USIA 4B3RJ 2FGOA 3OFGA 2HZVA 1T3NA 3N6MA 1C4AA 2HBZB 3LP2A 5HSPA 3TX0A 2BYCA 4PWWA 2W8KA 2KKHA 4V19J 4U7UK 4I56A 4MK8A 3MAQA 4DR6J 3MWBA 3NY0A 3D0GE 2UXBF 3RG6A 1WC1A 5CYMA 2UUAF 3OJSA 4Y6IA 1UFWA 2H4YB 4YMEA 2BQUA 4EEYA 2KT2A 2QIFA 2CDRB 2IRUA 1S1VB 4LF8F 3ZTPA 2FZKB 1UW4A 4Q45A 2CQGA 2NZ4A 5LJ5Y 2ALYB 3HXMA 1F9EB 1Q78A 3FCVA 1PYSB 2LCWA 2ASDA 4DN0A 3O8WA 2VQEF 3GIKA 1OSCA 2IAJB 1RCXB 4LRBA 2HWIA 2BBEA 4JUZA 3KMQA 3T1YF 5I42A 2ALZA 1X4DA 3GJQB 4M5JA 4DU7A 2XHWA 3EUNA 3R6GB 2I38A 5D3GA 3S01A 2CPZA 5KFRA 2BJEA 3M30B 2BACA 2KO1A 2WBRA 4F0MA 3QATA 4X84A 1K9MT 3DOKA 2HZAA 1PC5A 1HWLA 4ED3A 1NJWA 2GHWA 3GONA 1RHJB 1UKUA 3ZO7A 5KFKA 3NWRA 1RADB 2RDIA 3ONQA 4RNFA 2IM1A 4GC6A 5IM0A 1EQMA 4W4MA 1Y4ZB 3BYRA 4P9SA 5LSRA 3NGDA 1R0AA 1FK9B 5L9NA 2JC0A 3SCJE 2K2PA 1AUDA 5CA5A 1M5KC 4OYWA 4FVMA 3CJSA 4OZJA 3PO5A 4DFKA 1Q79A 4USJC 1LK7A 1BUXA 2O01C 1TU0B 1CJTA 4DR3J 3T5LA 2CZVC 2F63A 4CLYA 3Q86A 1WEXA 1TL7B 1VMBA 2B5JB 2FDNA 3OUYA 2C2RA 4CM2A 4IFYA 4IDKB 1FNXH 4NMLA 2C3YA 2JEJA 4K5RA 2W24A 3HKWA 1HIYA 4MJKA 4OYBA 3TNVA 1RYRA 1WSVA 1VQ7S 1WOSA 4ED8A 3JYTB 2J7UA 1VC0A 2UVVA 4RWWA 1NK7A 3PXGa 4DV3F 2H1YA 2GGPA 2F4VJ 3LP0A 4C3MA 3QLHA 1RJJA 4J9QA 3BGLA 4IUFA 3U27A 3GV5B 2WCXA 3A3NB 5M2PA 1SUQA 1LOUA 4USKA 1MSWD 3Q2TC 3KJNB 2HHHF 2NPIA 3G82B 3W9JA 1B99A 3HF5A 5C5JA 2LP4A 5C7PA 3IG1B 4J9VA 1HBUA 5IV4A 3CD0A 1U09A 1QE1B 2COLA 3R97A 3M32B 1MN9A 3NNHA 1DY3A 4OFZA 3L95X 2JEIA 2HHUA 4DF4A 5IS2A 4FDFA 2CNKB 4B3TF 5H9FK 4ZLPA 3GMGA 1S48A 5DDOC 2CQ0A 4IKAA 2R7OA 2J8SA 3P96A 3TAMA 4O0IA 3UW1A 1VQKS 3W2VA 4JI3F 1VR6A 2KHDA 4XAKA 3GE9A 2QO3A 2JEFA 5E5NA 3J7AN 1BLUA 1J27A 1IBMF 1FEHA 3F44A 2E7VA 4ERDA 2X3DA 2RQ4A 2M7SA 3TQ1A 3PIPQ 4OI3A 3DKDA 4HACA 1GEHA 4R5PB 4U6PA 4QR1A 3M2RB 1QVGR 3KLFB 2PFDA 3CO9A 5HMYA 4DS4A 2NLWA 3HHLD 1KLNA 5L8RC 1FRJA 5KFDA 2W4CA 2W01A 4EU0A 1R7IA 2VG5B 3OLBA 2HG4A 2ZUGA 3CCZA 5KFHA 3A3PB 2XYPB 3ET6A 4X66F 2M8HA 4A8QA 4UOCA 4MKBA 4BS2A 4LF2A 1KNZA 3FZ2A 4NLDA 2HFUA 1N5TA 2PDAA 3PEHA 3J81U 4K4TA 3RBEA 2OUGA 3G6XA 2BDPA 1L3SA 3MPVA 4X4OA 3VGSA 1SXLA 4OZLA 1PBAA 5LOQA 4LFBF 3MR3A 1D8ZA 4YQWA 3TJAA 1UWBB 1BGXT 1KWMA 1RKJA 5LMNF 3HFKA 5CCMA 4C98A 4CT8A 3OBIA 1IM4A 3I56S 2RS8A 1H0HB 2C3MA 3MMAA 4ES1A 2WRMA 2UXBJ 1S1VA 2I8EA 6AT1B 3MEDB 2F40A 5LXRA 2QA1A 2BV3A 4FKXA 5D77A 1VQSA 3J7Z5 4K4UA 1CJVA 1RWNB 3SMZA 1OMSA 2BW7A 2XQCA 1NHVA 4LF8J 1T11A 2ABYA 4OX7A 1FTRA 2IAJA 2DGOA 2IVYA 1T05A 3HFVA 2MQQA 4OZ5A 1Y10A 1REGX 3N9UC 5B0CA 4WP3A 2PE8A 4FP9A 4ZVPB 1U49A 2I0XA 5LSLA 5IWAF 2CJBA 2HFZA 3M30A 4NXNF 3T1YJ 1RWPB 3CJRA 5KT5A 2YWWA 4WIQA 4OX6A 4DCJB 1U0HB 2ROPA 2NZCA 3C16B 5K8PA 2LVWA 4I6AA 2DNYA 1TL3B 2OEJA 3SZ2A 1GNKA 2LXFA 4LF1A 1RAEB 4DUZJ 3HVRA 1YBTA 2ZHAA 1S0MA 4KO0A 1YBAA 4GMKA 1SVDA 1TV6B 2GX8A 1RBLA 4TXSA 3R5JB 4DMZA 2B6AB 1NH7A 3LWLA 1DQ8A 1L3KA 2DH8A 3PYDA 4ZCKA 4OL8A 2XY5A 4PXBA 4CO5A 1WKKA 4C7QA 1HQEB 3A13A 2J7KA 4LJMA 2ZFHA 1DURA 2CZ9A 1U1KA 4CH7A 4IDKA 4CLZA 1S7IA 4OYOA 2DEIA 2F9DA 1I5OB 4DPUA 3JYTA 3FFIA 1Z1ZA 4O3RA 4Y2AA 3CVKA 2LQ5A 2M5YA 1IXKA 1NH8A 3CNQP 3VWSA 3K7RA 1UP1A 1M5PC 5THWA 3KK1A 4ZVQB 4CTAB 3AD9C 4RW9B 4L74A 4DV3J 3HVTB 3CCJS 5GVQA 2FHJD 3FEXB 1Y7PA 5FDLB 5GAEI 3MECB 5KFNA 3GB0A 3IWNC 3IG1A 3TVZA 3QT5A 1XNRF 4WE1B 4BLGA 3M32A 1NK8A 1P9QC 3AH6A 2MQLA 1YJUA 5LSOA 4O3QA 3ZTRA 2IBOA 4ECZA 1TKZA 4I69A 1R6YA 1AUSL 4F4WA 1WWHA 4NLTA 3MUMP 3JQJA 4B3TJ 3KKFA 1T03B 2HRUA 2IVFB 2VFSA 4C2MA 2JC1A 3IRXA 4NYPA 2XG8A 3OFHA 3O3LA 1HA1A 4K5SA 3D28A 3JQKA 4EFAC 2W2MP 4JI3J 2ZJRQ 2BUNA 3NMRA 4O4RA 2J7WA 3T1HF 2FJAB 4C8ZA 5K14B 1VFJA 1AA1B 2QFIA 4RUBA 3KLIB 4WTYA 4ER8A 4CH1A 3MFIA 1IBMJ 2OAUA 4P2XA 3N79A 3C15B 3H59A 2ASJA 1R8HA 2GCFA 2XSJB 3T5KA 3FQKA 4J9SA 2Z4PA 1DAXA 4NCBA 4CIOA 4DFMA 2VG5A 5C2CA 1MROB 3BGUA 4W92B 1GTEA 4FVCA 3EGNA 3GJSB 3OL9A 3M2UB 4X66J 4KIAA 4JI7J 3CDAA 2ZH1A 1X9WA 5KFVA 3OTEA 2DCUB 4ES3A 4OJGA 1RABB 2KM8B 1KBRA 4ZDNA 1UWBA 3JTOA 3OL6A 4OHXA 2Z0GA 1NDKA 1IKVB 1FRKA 3HPOA 3S6EA 4AL6A 1S7HA 3PNIA 4JYAF 3CJ4A 3GSDA 5CAAA 3AOAA 5J2MB 3KYLA 4QYRA 4HTIA 4L3KA 3ZZZA 3RAQA 2CG4A 4CT9A 2MSTA 5IZHA 2HKEA 1YG0A 4YB7A 1X5OA 3EGWB 1U8SA 4M5MA 2EFPA 1U1LA 3MCSA 3FCWA 2AHOB 2IMOA 2XTJP 1I94J 1YK9A 5BJRA 4WFAQ 2RAQA 2OSRA 3KG4A 4LF4F 3JSMB 4KGZB 3GZ7A 3RR7A 1RT7B 2GHPA 2GMLA 3MPWA 1HWIA 1ULRA 3U02A 3SFGA 2YWEA 5CZXA 2W7OA 4DX7A 3M8RA 3P5BP 5AXLA 1I3OB 1WJ9A 1S59A 3K57A 5J1EB 2OTLS 5AJ3J 1UETA 1UFKA 2KTQA 3MUTP 4PQAA 2X1GA 4NA2A 3FRYA 2BKPA 4ELTA 3H2LA 1X4CA 5E2QA 4X62F 2VF3A 1U0HA 2UZAA 5KFTA 2KH9A 5IWAJ 3C16A 3FSYA 4NWBA 4LR7A 3MPDA 4NXNJ 4C8OA 3A8EA 3PCOB 3TRGA 4I7FB 1TL3A 1TL1B 4A8FA 1UTAA 3I9V9 5BYQA 2DPIA 3K5NA 4X65F 4RKUC 2QLBB 1F3VA 3UNYA 2FJEB 2MPUA 5DLGA 2AJ4A 4P72A 3W5YA 2B51A 3LWMA 3IBCB 3D9BA 1XEZA 2B6AA 5E41A 2GQ2A 3V6DB 3PZPA 2G0CA 5H1SV 1RAGB 1FNOA 3PFOA 3MCOA 1UCNA 2BMBA 5BYRA 5HJYA 4B02A 1TELA 3LUYA 4UOHA 4LSLB 1EAYC 1V6HA 3R3TA 4I6YA 2UVUA 4F50A 3TEGA 3D67A 4CP5A 2IRXA 1S9GB 1VK8A 2F3JA 3D54A 3KJVB 1RK8A 3MMJA 2XNQA 1S72S 3KDNA 3MTKA 2FHOB 4CTAA 2GAHC 2V94A 3PEJA 1LW2B 3HVTA 4ZOSA 4RBVA 1EB0A 3ZTQA 4I4BA 1S9EB 5KG4A 1M1KT 5FDLA 1TQLA 3MECA 4L72B 3MPYA 4ZPBA 3C3LA 3ENAA 3NOCA 4WE1A 1SJRA 5E7OB 2GO8A 4YR3A 1SKUB 1SKRA 1L3TA 5F3TA 4CH0S 4A8KA 2RE1A 2J0WA 4J9RA 3H0PA 2BKOA 2RUGA 1JQGA 4HYKA 1FJEB 3TQEA 2KN4A 3G96A 2VU5A 4LRCA 1ZAVA 4DR2F 2WK4A 4NCGA 4GKKF 1RTJA 4LF6F 2YWFA 4C9DA 3RW6A 2YWGA 4IOCQ 2DNHA 1BMQB 1F60B 4NOHA 2M2BA 1RWOB 2V6AA 2P2CB 1IBKF 3OHBA 1Y00A 5K14A 4LT6A 3BKTA 3ZZTA 1NSKL 2J6UA 1FT8A 3KLIA 2GNKA 2NUHA 3PYEA 4ED5A 1OY6A 1FESA 3T1HJ 2XSJA 1RT4B 3GILA 5MLCV 2RVJA 2D3O1 1P1TA 2KZMA 3CUNA 1H98A 1IVZA 3SQGA 2LA4A 1Q8KA 3H5YA 1MROA 2MEWA 5HP1B 4KPCA 4NLPA 3VTIA 1T3OA 3FBEA 2Q66A 2Y1JA 4OJ3A 4YB1P 2MGZB 2HK2A 4A8MP 4QOTA 1Z2ZA 3EDQB 2Q43A 3NGUA 2E66A 3M2UA 4B17A 1NJYA 5ETVA 3JAMU 2QLFB 3CE8A 4HI2A 1Q7LB 4ZMMA 5CABA 2BR0A 3LP1B 5G4DA 2E1AA 1EARA 1E6VB 3DU6A 5DZ6A 5B7WA 2PN6A 4O44A 1IKVA 2QX0A 1C0TB 4C8NA 4DSJA 3RBZA 1F2HA 4QWEA 1OY8A 3LW5C 5J2MA 1WDDA 4MFBB 2B0GA 4H4MB 1U6FA 1TAUA 1JMTA 1LWXA 3NEKA 1C1BB 2MKCA 4D3HA 4JYAJ 3MPUB 2XNRA 4MK7A 1WC3A 2J9CA 2MLYA 1NMEB 1WSRA 3I55S 2HGMA 3HSJA 1RT6A 3ISND 3JSMA 2UU9F 4JI4J 2YWHA 4ELUA 1N33F 3LPYA 4L76A 1PJ5A 5DDPC 5DDRC 4YOEA 2YNGA 3OV7A 1TKDA 3CJ0A 1O0PA 3PR4A 2PIIA 4LF4J 1QTNB 4QIEA 5J1EA 4ZP8A 2F8EX 2EK6A 3ZTSA 3WHIA 5LM7E 2BEFA 2PEHA 4DR7F 2HQCA 4PG8A 4PXDA 4LRDA 2DTJA 2V2KA 2HZCA 4C8KA 4ED7A 1FFWB 1JLEA 1VCTA 1HNZF 4DXLA 4I7FA 1TL1A 4X62J 1ZPVA 1U1NA 2UXCJ 2XEXA 2Z2ZA 4PZVA 2UXDJ 3DLJA 1NZAA 4TY8B 3DHWC 3FEYB 2CZ4A 3BJYA 3ENWA 1DBDA 2XY7A 5EWGA 4X65J 4L73A 3B8HA 4DLGA 3V6DA 5DGBA 2MY7A 3L9ZA 3QMQA 2QLWA 3DRSB 3QWUA 3AY0A 1QAYA 5B0GA 4CO3A 4LSLA 2Y9HA 2QLJB 5A2QY 1CBKA 2QSWA 2M9KA 2I1RA 3DOMA 1OWXA 4JV5F 3THTA 5D0EA 3G8SA 3NGSA 4AQYF 2DGUA 1S9GA 2XSFA 4C0OC 3LQVA 4QPTA 2DNZA 3FVYA 3RAMA 1QM9A 1VLYA 3KJVA 2YY3A 2R7VA 4XDDA 4KHMA 4WF9Q 4DV2F 1QAJA 1KOHA 4NLXA 1LW0B 4RUHA 2XMVA 1S9EA 4MKYA 3GG0A 4ECSA 3QGPA 3NKYA 4LF7F 2XGQA 3CCWA 4RW8B 3DYAB 5HN0A 5E3PA 3DLBA 3CC2S 5HI7A 4PR6A 1VGYA 3TUPA 2DITA 1FJGF 2HAIA 1N36F 1IJFB 1KDNA 2AKWB 2LLZA 1AFJA 4IRCA 1HBNB 2BRKA 3D6HB 1TK8A 3P4UB 3VVUA 5A6WA 3P8BB 4OYMA 3QGGA 3T9NA 5ETKA 4QIWD 4ZPTR 3CWJA 4Z37A 3D6MB 5U47A 3KLHA 3LPEA 5AE1A 5KFEA 3R8YA 2VKZG 4IH5A 2A1BA 4GKKJ 3QYYA 3BBCA 1EX8A 1SQFA 2W1BA 4DV7F 2VBZA 1Y3JA 4DV5F 2WVFA 1WHWA 2B4PA 2R8HA 3POTB 4KGKA 4YDDB 2AX0A 4DR4F 1TVRB 1IBKJ 2MQOA 1RT4A 2FGCA 4B3MF 1H38A 2G2OA 3OR2A 3D6TB 4IO9Q 3HMJG 3Q22A 4K4WA 4FPIA 3PO4A 2V9KA 3UE2A 1XNQF 5HP1A 4JB8B 5I3UB 2MGZA 2F8HA 1N88A 3CCUS 1VYAA 4Q44A 2B7CB 1IKWB 3UN5A 4ZIWA 2YNHA 1A6LA 5DLFA 4JI5F 2AIRB 1ZM2A 1MWZA 2M52A 2RRNA 2ZITA 2B43A 4DFJA 1KEKA 4FN5A 4ZITA 5IC6B 2RDJA 1TUVA 1FRMA 4NZ6A 1RACB 5G0RB 1VJQA 5LJ3Y 4MFBA 2ACMA 3ILIA 4H4MA 1GK8A 1RTZA 2CUYA 4RR5A 4F4YA 4YUDA 1C1BA 3V6KA 4PG6A 1WHXA 5LMUJ 3ZNUA 5KT6A 1FO1A 1C0UB 2ZH3A 4DR1F 4H4OB 2OD6A 2KXHA 2ZH5A 1WELA 1YJ7A 1KC8T 1UMJA 3UWTA 1HW8A 1U45A 4Q5VA 2PI5A 2ZKUA 2UU9J 4DBQA 3LALA 4UUWA 2E29A 4FYXB 3FRZA 1NDPA 1CJKA 2QE5A 3TYTA 2C42A 2C2ZB 2VQFF 1JJ2R 1WD6A 3GYXB 2QTWA 1Q7YT 4D3GA 1RLCL 2VUGA 2WOMA 1MMDA 2B4VA 4WPAA 2RF2B 1UVMA 1XERA 3H2VE 1NB2A 2CQPA 1Y0HA 2RMLA 1PAUB 3SI8A 3EZOA 1RWUA 1LWCB 4FF4A 5A8WB 1HLWA 5KFQA 1VQ6S 4YHHF 2HQIA 3QPIA 3L09A 1RQ0A 2J8AA 2ZH7A 2EFVA 2ZVIA 4N7TA 3AXMA 2XO6A 1V5IB 4CYUB 2FHJA 2DIUA 3DLGB 1VRUB 3G8QA 3CMAS 4KHRA 4R8UB 1T9WA 3DRSA 1O51A 3K5PA 5HL7Q 4K4SA 2N4CA 4DSIA 2DK2A 1HL6A 4MIAA 1DTQB 2RU3A 4C0HA 3BO2A 1QDUB 1Q8IA 2BOAA 1N56A 3WX8A 2ZEJA 4OV1A 2A18A 4KQZA 5ADZA 4DQQA 3B4MA 1KP6A 1T9XA 4LSNB 2K06A 2WSFC 3UD3P 4C3LA 2ZOGA 4JV5J 3BR8A 4AQYJ 1EQ0A 2I5JB 3RRHA 4IRDA 4R0EA 3V5RA 1LW0A 4QPXA 3SQOP 3VAMA 3QJLA 1B0TA 1WF2A 1R8BA 4RW8A 3G4SS 2QEXS 2XLJA 2W8LA 4L6V3 4LF7J 4KFBB 4N8OA 3GTYX 4YS2A 1HBNA 3VZHA 3AQOA 1O8BA 1N36J 3HLUA 4LVNP 1S99A 5HATA 3DLEB 1Q5YA 2F7VA 2FYXA 2NREA 4MIBA 2QYGA 5B08A 1RBAA 1EHWA 2ZDPA 1X4HA 4KTQA 4C11B 1U4BA 4C6AA 4EBDA 3W60A 3SCIE 2OFGX 4Y0FA 1SJ3P 1HNVB 2DRDA 1YQHA 1VQLS 2HVHA 1N4LA 4QR2A 2DY1A 3SEOA 2KT5A 2R2SA 5RUBA 1ITPA 1N0UA 4ZVTB 1CSJA 2HHWA 2HGLA 3LAMA 3J7ZT 3BZQA 5F8JA 2DBBA 2NQPA 3MEGB 4RU9A 4IR9A 4NLSA 4UOFA 4ED0A 4DR4J 3CGIA 4LFCJ 1S0OA 1RA6A 3J7YU 2LQJA 4B3MJ 3R5DA 3G8TA 2DR6A 3HSZA 5I3UA 2OPPB 2R7XA 5EUHA 3VQSA 1IKWA 2AYMA 3D0HE 1XNQJ 1PJ7A 1XMQF 5T14A 2B8PA 3BO3A 1K0TA 4OYZA 3EWGA 2MB0B 1QAXA 3FBCA 2CNLB 2YH1A 1KQSR 3FEZA 1HI0P 2DKOB 3GWCA 4A47A 2AZ3A 1FWLA 5CHCB 1DRZA 5HMXA 3KJQB 3PW0A 3OJUA 1WOOA 4K4VA 1ZM9A 1U24A 4I2QB 2VD3A 2V67A 1TUGB 3LOUA 1K8AT 3RU0A 2BJ7A 4O0NA 5KG7A 4GO7X 3MM5B 2VFUA 4KRWA 4LMZA 3M8WA 4G6VB 1QD1A 3BDEA 2CADA 1VK3A 1R8CA 2C2KB 1SH2A 4NXMF 1AFIA 2DPJA 3CDEA 1FRIA 5H9EJ 3PX4A 4ZCIA 4H4OA 3KUGA 3ELHA 2N7CA 4OJ1A 4YN3B 4DF8A 4MT1A 1CULB 3L7OA 2AJQA 2VG7B 3NCRA 4DR1J 1OJ4A 4P7TA 4EI2A 5HBMA 3QAEA 1UVLA 5AT1B 1G2EA 4YEAA 2WSCC 1AYEA 2C1EB 4PPDA 3MOJB 1WI8A 5AE2A 2E1PA 3OSPA 2GO9A 1YHQS 4FPRA 1F3FA 2AEJA 1VLOA 3DHXA 4ALZA 4Y2IA 2RF2A 3CMES 3IS9B 4QR0A 1N34F 3OVSA 2J0SD 5C42B 1YGYA 3PRVA 1XWLA 1JK9B 1LWCA 1S6QA 4OHYA 2VQFJ 4RL1A 1YITS 1SQEA 4WBFA 2WBMA 4P52A 1B0PA 3H4BA 4J9KA 4DR5J 2QL5B 2G2ZA 3QT6A 3PKYA 4AD6A 3NCQA 3R2DJ 2MTLA 3JTNA 1RP5A 5C2GA 4CYUA 4CO0A 3HP6A 4OHWA 2VA3A 3KJFB 3DLGA 1OYDA 3HSDA 3NNCA 3O6QA 4R8UA 3QSYB 4MK9A 3ZZPA 4EO8A 3NGTA 3EM1A 4AE5A 2C3PA 3QWPA 2XS2A 2Y1IA 1OY9A 4FF3A 3ICLA 2J6TA 4LSNA 1WEZA 1UVKA 4J37A 1Q8BA 2FHMA 2I5JA 5CYJA 3H4DA 3I0RB 1X0FA 1ZTTA 1IWAA 2C2MB 1R6VA 5IQ6A 3O2IA 5KT3A 3CCRS 1RHMB 3BPDA 4LF9F 2BQRA 1JLAB 1DARA 4KAIA 3BBBA 5H9EK 2E9RX 1FKPA 3IWLA 5L38A 1VQ9S 3D66A 3VR1A 4M5NA 2JZ5A 4KFBA 1SQGA 4WYWA 3QIDA 2LKZA 4ECQA 1YKWA 1ZOTA 1MW7A 2UUCF 3AODA 2HK3A 4MAKA 5HVFA 3J81j 2V4JB 5MAOA 4KGMA 4WU2A 3FKBA 2Z2MA 1FI4A 5AE3A 5ETTA 2V9WA 1T0TV 4C11A 2OELA 2Z2LA 3T6BA 3PHEA 3PW7A 5DS7A 1IUJA 1WC0A 4B3OB 2HVZA 3Q0AA 2Y1LB 3DDNA 1RLDA 3W9HA 2CFXA 3T5JA 3HHLC 4LBPA 3Q8UA 2WVBA 3ENVA 3ZZYA 4IG3A 3RRKA 2QGFB 1IM6A 3T3FA 2CJAA 2OEMA 2OSQA 2Q6BA 4FXVA 2ZZMA 4A8XA 2OPPA 1C1CB 2JRSA 2V8HA 3W2WB 4USMA 2Q79A 3NP5A 1OSDA 4PG5A 4HEA9 1O5JA 2PT0A 3UCZP 3H8YA 2KL8A 1S6OA 1VQYA 2AWZA 4CM0A 3TO8A 5CQGA 4EBCA 5FJ4A 4ECXA 1FE4A 1W26A 3CCES 3IXQA 4ZJQA 3AHPA 2QMXA 4F4XA 4I2QA 2BABA 1D09B 2DGTA 4JI1F 3NMAA 3K17A 3QJPA 3NS6A 4F7VA 4JI6F 4NZ7A 2M70A 2DJWA 3KHRA 2FJXA 3D3CJ 3QFWA 2HQFA 1XC9A 2C22A 3V81B 2B4UA 2XMTA 2HMIB 4J9UE 3TZWA 1MG7A 2VPWB 2ZNYA 3AJDA 4ECWA 5EX0A 2AP6A 4QWAA 3H5XA 5IV3A 4ZHRA 4J9NA 3CCQS 1NKBA 1HD1A 4QJVA 1CULA 3R1LA 1FEEA 3K59A 4FF1A 4ZP9A 5DETA 4NXMJ 4H4KC 1LWFA 1IBLF 2VG7A 2OPQA 3PYFA 4OYXA 4FKYA 1FD2A 2V8VA 4PRFA 1FJCA 2MHEA 3CDWA 5D78A 1Q8LA 1TFYA 1E6YB 4KGXB 4C0BA 8RUCA 4RBTA 4BCAA 3D0IE 5KT2A 1Q95G 2XZTB 4HH1A 2YPYA 1QY7A 5D4OA 3SFUA 4KT0C 3IS9A 4OI0A 3X3UA 3MXHP 3WQPA 3T1AA 3W63A 3CIZA 1FX2A 3CF5Q 3KLGB 4QBUA 6FDRA 3IN5A 5AXKA 2JFKA 1DHMA 4UQGA 4BC9A 2GZOA 2AGOA 1TL4A 3R1HA 2G0IA 5KFCA 2ACYA 2RD5C 4RW4B 1NO8A 2R9LA 3UQSA 1X5TA 2AMCB 3IGVA 3ZZRA 4KBIA 4DS5A 3K8VA 4KV8A 2VOOA 1HPZB 3TZXA 2ZH6A 1FWKA 4M8LA 2KJVA 2VOPA 3D1HA 3BDPA 3LANA 4IG0B 4PXEA 3OR1B 1YJVA 5I4MA 1NM2A 2ZHBA 3BN7A 4M5KA 4PKDB 4F2RA 2CNNB 2EBGA 3BV8A 3IAS9 4CDIA 2VIHA 3I0RA 2AF6A 3M2VB 2J76E 3HJVA 3I4HX 1RT5B 1TK5A 1U0SA 3BQ2A 2E5IA 2DXFA 1HR0F 5DG8A 4UT4A 1JLAA 1R43A 5C25A 1UJ6A 2R7QA 2F8MA 3OTOF 4IOAQ 4NEZA 2HS3A 4BHQA 2EBEA 1P8GA 3M9OB 1IQZA 3OL8A 3BN4A 3K8WA 4OJHA 4B9SA 1Q86T 4HT7A 2EG2A 1NRKA 1RWVB 3J7YI 4PPZA 4I67A 2HFVA 1WACA 3R9LA 4C8LA 1GFWB 4LFAJ 3NG8A 3A12A 2A2CA 3CT9A 1GX5A 4ZKAA 2V4JA 5KFFA 1XMOF 5HQLA 1GX6A 1BQMB 1WKJA 5IOLA 2UUCJ 2B8QA 1WF1A 4DQIA 4EK2A 3WC0A 2Z8QA 1WEYA 2D7SA 1ZH5A 5T7LB 4DHVA 2XMUA 4ANEA 3KK3B 2HHPA 3EVOA 1EP4A 1WC4A 1VOMA 3CW2C 4B3OA 3CCMS 2CPFA 2ZJQQ 2DNNA 3WBZA 2ZHOA 4ZVFA 1G4CA 2XGPA 4WP9A 1DLOB 1UA0A 2HLUA 4C8YA 1VHIA 3KK2B 1XBWA 4N41A 4A4JA 1KSPA 3GR0A 4QU7A 1C1CA 5IT4A 2MQMA 1ZPWX 2YKAA 2C3OA 4QIFA 1UVIA 3EE3A 1IR2A 3OW2R 4KKOB 3CXCR 1ZAWA 1BQXA 1NU4A 2HS0A 5CXTA 2DR5A 3UNGC 1RHRB 4DN9A 3GJRB 1PO6A 3BO4A 4RO0A 2H48B 3W8GA 1KTQA 2Y8YA 1S76D 3C6UA 4HHUA 2KXFA 1JLGB 1FRLA 4EWTA 2K1RB 4ZVEA 2PMHA 1F5BA 4URSA 1N5QA 4ED4A 3J80Y 4GKJF 2FLLA 1RYSA 4OZ3A 3Q8QB 4TYBA 3BGFA 3R7SB 2X1FA 4JI1J 3PY8A 3PX0A 4I1TA 3KFWX 5A2QU 3V81A 2QZ8A 2NCKL 4F3OA 1N32J 2HMIA 1KONA 3PW2A 3HCXA 5GMKa 3FMWA 5F8LA 4M5LA 2B9YA 1SJQA 4LQ9A 4OZ1A 2YKQA 2XMKA 3OL7A 5B0EA 2RKIB 1J5EF 2IC3B 2FIUA 4UZBA 3IRWP 1SIWB 5KFIA 3V4IB 4I0WA 2IHR1 2EFQA 3PRBA 2EC0A 2CVIA 3UCGA 2Z58B 3P45B 4TLRA 1T9YA 2RS2A 3BBFA 3TAPA 2IDEA 1DQ9A 5EWEA 2KU7A 1ZZFA 4R0JA 4F36A 3D2WA 2FVRA 2DNKA 2OEKA 2Y3YA 2BE2A 4ID5A 5I3PA 1YLXA 1LK5A 1HMVB 3NAHA 2HURA 4CZCA 3VF0B 1SC3B 3WIUA 1QSYA 5KG5A 2VHGA 3DC2A 3KLGA 3MR5A 5K20B 3P49B 2J0XA 4E8UA 1H3DA 1V3SA 4U8YA 2OP5A 4OZNA 1NK4A 4ZPWR 2B9XA 2CQ1A 3I5CA 5J2QB 2DT9A 3T9ZA 2HQGA 3DDKA 5DQHA 4DV1F 5J2PA 1HYSA 4RW4A 3P5TL 2LQBA 2FY8A 1G6BA 4Q2LA 4HTJA 3QGIA 1QJHA 1A0OB 3TZZA 1URNA 3US5A 3A4TA 1FX4A 4HDGA 1R3NA 1HPZA 4USHA 4RNMA 1JXEA 4N8NA 5DZ7A 4N47A 2KXNB 2FC8A 1H2VZ 4P75A 3LGHA 4IG0A 3SCKE 4NYOA 3OR1A 2N3OA 4LR9A 4XDCA 2UVRA 1M5HA 1ZZNA 2G1DA 3S8SA 4X4SA 3MD3A 3OXLA 4QCLA 2F9JA 4PXCA 4M5DB 2ZDOA 4OX8A 2CJYB 3B6BA 2R7UA 3FCHA 1IKYB 1RT5A 1UJ4A 2GIFA 2V63A 3MMCA 4J91A 4S0MA 2CWXA 3OLAA 4F25A 4OLPA 2NXCA 2GVDB 1FXLA 3RBXA 5KG1A 2DISA 2QJ3A 2I9SA 4WFYA 1F9FA 2MZJA 2DIVA 2H54B 1MU2B 1HNWF 3DRRB 1FDAA 3OTOJ 4H54A 3QAUA 2RNEA 4XPCA 3BSNA 2VZ9A 4EZ6A 2DGXA 2GHVC 2CPYA 3M6WA 5IT9Y 5KFAA 4XIUA 1BQMA 4RUCA 1D3WA 5T7LA 1Y3KA 2EPIA 3DCAA 3EYZA 2DVIA 1HQ2A 1J5OB 3OXFA 2M0GB 3MAAB 4DPXA 3W66A 2ROGA 5CD4H 2YNFB 2W25A 3JB9k 4DG1B 2R2UA 1Q5VA 4PWDA 1OQ6A 4ED6A 1NPRA 1HI1A 1DLOA 3NGRA 3MEKA 1RCOB 4NCAA 2HWHA 1T94A 3RAXA 1RU1A 2PMZD 4E2FB 2RQCA 2CKWA 1URRA 4M94A 3QNWB 1WUUA 5LXYA 2YQ1A 1JLQB 3NBPB 4KKOA 3AD8C 1JNZB 2RRAA 1VBKA 1DFDA 1ZTWA 2CDQA 2MYFA 2ZNZA 3G6ES 4DPTA 2FVCA 3M1VB 1CPZA 4PG4A 4EMDA 2K1RA 2AEMA 4DV4F 1RXOB 1VC5A 3HT3A 1NSPA 4NEYA 5IQQA 3VAFA 3GG1A 1RHUB 2RB7A 4WKYA 3CEDA 4ZPAA 1SIZA 4IYQA 3G86A 4GKJJ 5F9LA 4JBCA 2N82B 1DZ5A 4ELVA 1LKZA 4OYAA 2POKA 4IO1A 1B0VA 1S0NA 3ISNC 4JV0A 1WTFA 3GFYA 4Q7AA 3F0NA 3MHYA 1EETB 4GVLA 4RBUA 2KG0A 2K3KA 4YY3F 1GXUA 4ES2A 2IC3A 2UUAJ 4ECYA 4K59A 2YKMB 4CLPA 2BM1A 2BJDA 5KFBA 4NX9A 3KNAA 2BW2A 4YB6A 2VBWA 1J5EJ 1FE0A 3D5MA 3RUBL 1KFSA 4NLQA 1S9FA 1GH8A 2PSZA 5LT5A 5SZTA 1Y5LB 1JX4A 5CYQB 3Q83A 1DTTB 3UD4P 1KKHA 1N5YB 3W61A 3UN2A 2WB4A 2CXEA 2DR9A 2VQEJ 1NHKL 2R8GA 3KMSA 2V2QA 3TUZC 1HMVA 4B9UA 2IM3A 2VJVA 1TL5A 5FIIA 4ZLJA 1QAIA 3I5AA 1OO0B 3TJ9A 3MM7B 4KHPF 4OLOA 1LFPA 4ZS6A 1RB0A 4DX5A 4QYZJ 3WX4A 1S1XB 5J2QA 4P71A 3IWXA 3EGVA 4HDHA 3C66A 5L46A 1KTVA 2AT1B 3KLEB 4PABA 2WAQD 2ZBRA 2CQ2A 2QN6B 3DN9A 1FK9A 5KOWA 2B9EA 2UUBF 3H5UA 3ZXWA 5DGAA 3IA0A 3DLLQ 1C2PA 4E0DA 1VC6A 5GAGU 3RYLA 1G1XA 5D15A 1R0CB 1KR4A 1WHVA 1YVFA 2XI2A 2W9BB 2BVZA 1RAJA 1TL7A 4FYVB 2B5JA 2FLOA 2KT3A 2G2YA 2P6TA 2CPEA 3JTPA 4J9MA 2F1FA 1UZDA 1YWXA 4JI0F 2ZBIA 2E5LF 1IKYA 1W2BR 2APOA 4JI2F 4EYHB 3AB2B 2ZH4A 2U1AA 2GVDA 2CJKA 1GAOA 1RWXB 3GYNA 1IQTA 1VHFA 3CJ5A 2MZ1A 3UVJB 3PX6A 1JLFB 1KN6A 2NXJA 2GVZB 4CO4A 4NLYA 4KJIA 2R8JA 2XMMA 3G82A 1YJNS 2JWNA 1HNWJ 2VJUA 2FD2A 3X1LB 3EZ5A 2QA2A 1KVKA 3JSBA 1ZETA 1QE1A 4CWBA 2HHHJ 2GJFA 4OV6A 2V2VA 3EMTA 1UEKA 4LRFA 2QSFA 3OT9A 4TVAB 4V1Ak 3Q8RB 3QIPB 4B3RF 1VQMS 3QBCA 3KWMA 3W7BA 5KFJA 1J5OA 3I31A 4DL7A 3DDIA 1W7WA 3MAAA 4DQPA 3C46A 4IQMA 3LA0A 2HNZB 4A8SA 1WG5A 2YNFA 4DG1A 2OMOA 2VPXB 4QYZK 1X8DA 2EVZA 3C19A 2B9WA 4AL7A 1RA7A 2LEPA 2CIMA 2GIQA 4KYZA 1S79A 2Q1LA 3OVAA 5CCLA 1TUWA 1HARA 1YZ6A 4R5PA 3GIIA 2EW9A 5HQMA 3M2RA 2HBQB 2O3DA 2PMWA 3KLFA 2BJ9A 1JLQA 3NBPA 4P73A 2E7WA 4W90B 5AXNA 1P27B 1U1MA 4A48A 3CC7S 2YBVA 1XMBA 1TR0A 3N01A 3HHDA 1U2CA 3VZIA 1NKCA 1X7VA 3R7BB 4FYDA 2LQ8A 1TK0A 4P2SA 3M1VA 3RZAA 2AJ0A 4UY85 4RNNA 1WF0A 5GADI 4FXWA 3RTVA 2W9CB 3PIOQ 2YVSA 3HVAA 1VBZA 3TZYA 3ILOA 4YP3A 4U9RA 2GV1A 3N28A 4O3PA 2HVIA 2IA6A 1V5VA 2G13A 1PGZA 4WZQA 3LF0A 5L1KA 2RH3A 2JOQA 1ZAXA 1EETA 3CCSS 1F1BB 4LFBJ 1GTHA 3EZUA 2MZTA 5LMNJ 2OPSB 3KUEA 3QQCD 1S1UB 4DCPB 3MEDA 1YX2A 2IJFA 4I6WA 5D0RA 5IXUA 5DQGA 3NS5A 4ECUA 4URGA 3M6XA 2YKMA 2Z30B 2ERRA 4YY3J 2XCPA 1R8PA 3CJKB 1WNEA 4Q0BB 1R0AB 3QGHA 2E9ZA 4P7VA 3UFCX 1U25A 4K4YA 2BJ1A 1F0XA 5CYQA 1DTTA 4K7QA 2V4QA 5ETOA 3OVBA 1N5YA 1VQOS 3UR3C 5EN1A 3FZBA 3HO1A 4K2JA 3M6VA 1CC8A 3R5AA 4YFUA 5IFMA 4K50A 2UP1A 3AQPA 2F4VF 2IY5B 1HWKA 1S1XA 1SKSA 3KG0A 5C24B 4JI8F 1VI7A 4OX9F 7FDRA 1S5ZA 4LQ3A 1ACMB 3IM9A 4PAAA 3I5BA 2HNYB 2GGPB 2RHQB 4M5GA 1BY9A 1FHTA 1KQFB 3GR1A 2KRRA 1RAFB 2V50A 4DZDA 1HQUB 3CSKA 4UUXA 3JSYA 3HHKA 3EJMA 1TV6A 5GAHU 5ETQA 3I9ZA 3G6VA 2OHDA 2V8DA 1FKAF 2AV5A 2WVDA 2OPRB 2UUBJ 3SV4A 2HEKA 2W9BA 2UV8G 1HQEA 1YJWS 2AYGA 3I4PA 2H51B 1EKRA 2DHHA 4PYAA 4FBTA 3Q8YA 2XMJA 1REVB 2HYIB 2XMAA 1FFGB 2E7XA 1G7CB 2OFHX 4USUA 3KHLA 4HI1A 2ZJPQ 2V2ZA 4ECVA 1GXLA 1X60A 5KFZA 1Y5IB 2XLKA 5KG6A 1SJ4P 2VB6A 4JI0J 4N77A 2KVQE 2DNMA 3T19A 1JLFA 3TEHB 1FVSA 1XK8A 4RW9A 2GVZA 1TP7A 1UEUA 1PKUA 3M8PB 1HKAA 4NL5A 3U1NA 1PC4A 1U1QA 4X4PA 5DJBA 4USWA 2KI2A 2O66A 4FYWB 1NK6A 1N54B 3M6UA 1QUVA 3TA2A 1RAHB 2B7BB 1LNQA 2Z56B 3UR0A 3MTJA 2P5VA 1AT1B 3UDLA 1NUEA 1L3VA 1CQMA 2ASYA 3UI3A 3KDOA 1XNRJ 4TYAA 2WONB 1NAQA 2CRLA 2R7SA 5M2UA 5KFOA 2ZZNA 4CNZA 1FNMA 1KFDA 2JL9A 4CLWA 3M9NB 3ET6B 2HFOA 1T03A 2VG6B 2J0QD 2WTFA 2HNZA 4FYYB 2EFGA 3S1TA 2E1MC 2D9OA 1NCLA 2CAJA 3N6LA 3HZGA 2BE9B 5B0DA 4Q8FA 3DOLB 2GJ2A 1ZYQA 4R25A 1HHQA 2K8GA 3PRDA 4TLQA 3K0JA 3TVYA 3BQ1A 2QG9B 2AJ1A 3BREA 1NB7A 3TUIC 2HLTA 2CQ3A 2M3DA 1U6BA 3D1OA 2VONA 5DM7Q 4F0KA 5KG0A 4V19X 3C15A 4DFPA 4ZP7A 1JJHA 4NYZA 3W5ZA 3MMAB 4TQSA 2VDHA 2HHTA 2YQ0A 5BYSA 3BKFA 2HS4A 2F65A 2B3TB 1CJVB 3BSCA 2G4BA 2XB2D 4ID8A 1X9MA 3N5BA 1B7YB 3FMBA 2W9CA 4X4NA 2CG8A 4DQSA 2DHXA 2FJWA 1T05B 3KHGA 2VC1A 5J1NA 2ZC3A 4QWCA 2H3EB 5H9FJ 2CJQA 3PW5A 1XIQA 3H25A 2DO0A 3U1LA 4ED1A 4ZK7M 1M0SA 4FF2A 1EZZB 2EK1A 2KFZA 4ANCA 5DG7A 5KTQA 3R5GA 2OPSA 4I68A 5CH7B 1S1UA 4DUZF 4TU7A 4KE5A 4O3SA 4DDFA 2N3LA 2UUTA 2HHVA 3CJKA 4ZPDA 1VQ8S 1WC6A 3H5SA 1RDRA 2PD1A 4Q0BA 2V8PA 2MKYA 3PYGA 4KO0B 2CNOB 1I1GA 2DHSA 3W3SA 4USVA 1RI7A 5ETPA 2V34A 3HZEA 1RT7A 5GAGI 1N6QB 1N5VA 2YH0A 2AQ4A 5DDQC 1S12A 2HHSA 1RHKB 4FNIA 2WHOA 2XULA 4G3IA 5DG9A 1QTMA 3PTWA 1SB6A 2H9ZA 1FVQA 4ECTA 5E33A 3CULA 1V3RA 2RHSB 2XS7A 1L5UA 5K8NA 4ZVUB 2GIRA 2MDAA 1H7WA 1D9AA 1SL0A 4DCOB 5L1IA 2W4DA 2V68A 2K7KA 5BR8F 5C24A 2LDYA 2MJNA 4DSFA 5J2NB 4WIIA 3FFIB 3A8IA 5KFPA 1RT2B 3EGZA 2HNYA 2DO4A 2R7TA 2V5HG 3ISZA 3IC1A 4NPOA 4LUBA 4WFZA 4M1KA 1YJTA 3K5LA 1HQUA 4JI8J 2XO7A 3KK1B 4OX9J 5JMNA 1SV5B 3AA8A 2MQNA 4KR0B 1SI9A 3EVWA 2OPRA 4A8WA 4LVOP 3Q23A 3SIPB 4Q43A 4EZ9A 2DEJA 2Y0SD 4WFXA 2MJUA 7AT1B 4N76A 3Q8PB 4N56A 2R4FA 2PEBA 4ZA1A 4MYTA 1TKZB 4WP8A 3VAHA 3LH2S 3VCDA 1REVA 2JVRA 1WDTA 2AYBA 2YKPA 2HHXA 5HK4A 5F0WA 1UVNA 1NEEA 4AXIA 2ZVSA 2E5JA 2XHCA 4X4RA 4YR0A 1ZBTA 3OFFA 4J9PA 3IRXB 3UDCA 2FHKA 1T9TA 4MH8A 2DNOA 2JDJA 2J6SA 3QRRA 2RQMA 1LW2A 3M8PA 5L9XA 1EKSA 1BXNA 1X4GA 4MIWA 3NCPA 1LEOA 4ILLA 2ILZA 3AB4B 3J80U 3MM6B 5HMWA 2YKNB 4DUTA 2ZBQA 1OPZA 1PILA 3GSIA 2EEYA 1V9OA 3ILJA 1X4AA 2MZSA 2G9OA 3B82A 3W8PA 3LTOA 1PG5B 2EI5A 2WONA 2A2DA 1CG2A 3H7HB 5E0OA 1JB0C 4JI7F 3MF5A 4TKTA 3MUVP 3W5XA 2VG6A 3FJ2A 4Z2XA 2ZBPA 1RISA 5KT4A 4AUKA 4C4WA 1FDDA 2XCAA 3PG9A 3DOLA 2LA6A 4DR2J 4TY9A 3BQ0A 1HFEL 4LF6J 2ATLA 1F5AA 3CJ2A 4DL0C 4G65A 2VFVA 2NSBA 4J9OA 3TW0A 2MKKA 1U2FA 1U1RA 1SH3A 1KVJA 1VQ5S 2V0NA 3R5CA 2GA7A 2C3UA 4IH6A 4LSZB 1UW9A 1ICEB 5F3ZA 1I94F 5E3AA 1IBCB 4LRAA 3TVKA 3DNCA 3U1MA 3ZZ0A 3PR5B 1T9UA 2DGQA 2ZD1B 2FLPA 7FD1A 3PV8A 4L3NA 3MMBB 1WG4A 3N5FA 3RB0A 1FD8A 5IC4B 3PJXA 5AJ3F 2IM2A 4HKQA 3VAJA 4P10A 3LP1A 3OQ2A 3CB4A 4WXWA 1PCAA 1APSA 1E6VA 4ZVHA 2C2EA 4U95A 4G1IA 2QYCA 1C0TA 1GMUA 1WI6A 4K8RA 5KFYA 2QLXA 5ETMA 3BKUA 4MMOA 5FLXU 1QLNA 2W7AA 3ULHA 3G87A 1R31A 2HVEA 1S0VA 4Q2MA 3FBBA 2VV5A 3IM8A 2JLFA 4P6QA 4DI6A 1RE1B 1YZ7A 1K0VA 5GAHI 3K5MA 1CVJA 2C2DA 2DR8A 2CYYA 3BGRB 2R7RA 1VBXA 2D9PA 4NLVA 2W9AA 1N6QA 4CRJA 2BZ2A 3OXGA 4UTGA 5EGYA 2VPZB 3NRBA 3KHHA 1NZ8A 3HX9A 3MEEB 2HFNA 4TN2A 3IGNA 2CA9A 2AJFE 3THVA 2WVCA 1RKIA 4I64A 1N33J 2R3VA 2GMHA 4DV6F 3MGJA 4Y2KA 5HJXA 4WYLA 5IT9U 1N5SA 4BDPA 4WKRA 3BH7B 1RT1B 2L48A 5J2NA 1VQPS 1B64A 1RT2A 4DR7J 2M8DB 1DJ0A 4U8VA 5BR8J 1ZM3A 3R2CJ 1JIHA 1HNZJ 4KY3A 2WB1D 1MMLA 4TY8A 1X5PA 1SV5A 2VC0A 2XM3A 2MKJA 3BYPA 3B78A 4C3KA 1ZA1B 2VPYB 1TFWA 3FNNA 4HLBA 2OD4A 1HD0A 4YB5A 3HDSA 1U8WA 2EFOA 1JLCB 4LBIA 3VV2B 2UV8A 2ATCB 4EUVA 3OTDA 4PCQA 2N7YA 2KFYA 2JJ4D 1YTYA 1RGVA 1S77D 4NCGB 1MWQA 1RT3B 4QWDA 4FZVA 1RTJB 2U2FA 4UF4A 4B9NA 3EVMA 3FDSA 3CJQA 2CQBA 3VVTA 5HO4A 2IMWP 3CD5A 3NL0A 2MSSA 3RJMB 4DSKA 5JVGQ 2PFFB 2RT3A 3ZTOA 2JNJA 3R27A 3MM6A 2YKNA 1HI8A 4DV2J 1VDHA 3DYAA 3R7NB 2MQ8A 2HIQA 2KFNA 2YNIB 5SUHA 4K2XA 3I0SB 3AT1B 4J7CA 3HSGA 3AAWB 3KXDA 3DLHA 3SQGB 1FJGJ 5F41A 2ZBCA 1SH0A 2FLNA 2N4DA 1RU2A 3RB6A 4O4GB 2DHAA 2E5GA 1ROFA 4DPOA 2XMWA 1GQEA 3TUJC 4URQU 1N0VC 4ZCMA 4M63A 1JWWA 2W2NP 1PYTA 2LXUA 1NBEB 4PG7A 9RUBA 3ZZOA 4CNYA 3AFGA 3Q2SC 4O23A 1PIEA 3GFZA 2KG1A 2ZH8A 3AJ2A 1Y9OA 1V3ZA 1CS4B 2VODA 3POTA 4WXOA 5FD1A 4LBHA 4O44B 3EPIA 1TVRA 3C8YA 4DV7J 4NASA 5F0UA 4DV5J 2YXLA 2MMYA 3E51A 1PJ6A 2CQ4A 4JP8A 1B3TA 2R8KA 4X4QA 4P74A 2X1BA 3M4XA 4NLOA 3DRPB 2L41A 2AZ1A 2P8IA 4J90A 1K1SA 2ZD1A 4NE9C 1SCJB 1YSJA 5ITHA 4JI4F 5KG3A 3KG1A 4CLTA 1ZA2B 1BQNB 4ZJOA 3MMBA 1OIAA 3WZ0A 4NA3A 4DV0F 1RT6B 4ZN3A 3TJ8A 2DXEA 4KB7A 2D41A 3V4MA 2B56A 1UAWA 2CPHA 3V6JA 2YNGB 1MLAA 3GV8B 4ECRA 3EXYA 1B70B 2CPJA 3LGMA 4JI5J 4C97A 1S49A 3Q8VA 3QSIA 2QA4G 1NK5A 2J9DE 1EIYB 4A46A 1RTDB 3JS9A 3BEGB 2QC3A 5G0RA 1JNRB 2UXCF 4CLKA 3ETOA 1QSLA 3VAGA 3HHEA 1JLEB 5HVHA 1MMNA 2H5IB 2UXDF 4GC7A 3QFHA 2KM8C 2LXIA 5B0BA 1Q0NA 1C0UA 2AD9A 2ZKTA 3T6JA 2DHGA 2MZRA 3DGVA 5K8OA 4F4AA 5ETLA 4AXJA 3BGRA 1I6JA 1CEZA 1UWAA 4DSLA 3BR9A 3MOZA 1WOPA 4N5SA 4L75A 3SCLE 3MEEA 4OYPA 3WDOA 1YBUA 2LU2A 4PWUA 2C2OB 2HWTA 2QV6A 3K58A 2JFDA 2IA0A 1HBOB 1YRTA 2BOPA 3VHQA 2R2RA 1K73T 1RT1A 3DOMB 3PJWA 1RTHB 2LECA 1LV5A 4DV6J 2M4MA 5DO2A 1RAAB 2OO4A 4ZLNA 4JV2A 4DZ6A 1S1WB 3T41A 4F26A 1H72C 5A8WA 2HRTA 2EKYA 1T7PA 4GVBB 4ILRA 3MM9B 1GXTA 4OMFG 3QT8A 2DH7A 5DQIA 3GCWP 1T9VA 3H2UB 9ATCB 2PI4A 4YHHJ 4ZIVA 1R89A 5LL6d 2WSEC 3VGVA 1VRUA 4J5OA 2DGWA 5IT0A 5E3CA 3MR6A 4M5IA 1FXRA 3D6FB 4RX6A 1IN0A 1M5VC 4AYBD 5F8NA 2ZH2A 1JLCA 2XZDB 3L4BC 3GU0A 3P3DA 1VQ4S 3HJFA 2ZOFA 2NXUA 1DTQA 3HFZB 3HHLB 3RB4A 1MN7A 3HVWA 3SXLA 1RT3A 1FWPA 2Z57B 3VQTA 3KLHB 2O5DA 4DPYA 3CC4S 1QSSA 3IMQJ 4F4ZA 1G3OA 2VFRA 3TX8A 4OZ0A 5EX3A 3I82A 3DRYA 5L39A 1F5CA 4BBYA 2DNPA 1NJZA 1KHVA 2NPFA 1M1HA 3KNGA 2V8GA 1HW9A 1LFWA 3CJ8A 3BPSP 2HW3A 2LU1A 2YNIA 4O3NA 4UY8T 3OR2B 1RAOA 4WFBQ 2Q3PA 3I0SA 5D4NA 2NYIA 4NRTA 3L7UA 2EFNA 2JSXA 3AOCA 3QJJA 5B09A 3DLEA 4O4GA 4RW7B 4EYIB 4LR8A 2YNHB 5CZVA 5M2RA 1BWEA 4Q8EA 2XLIA 2Y8WA 4JOUA 3G71S 3GCXP 1SPBP 4Z7CA 5K8MA 1SL2A 1YJRA 2D3ZA 5B0FA 1HNVA 3K89A 2QL9B 3DFEA 4LIWA 3GP9A 3FBFA 2OIHA 1FFSB 1CS4A 4B9MA 1RBOB 3W62A 4WJBA 4HHJA 5D4PA 2PGCA 3ILLA 3MEGA 2LYVA 5LMUF 1AROP 2CPIA 3ZFVA 5D4LA 4NLGA 1HWUA 3WC2A 1HNXF 3IP0A 4AFFA 3A8KA 2HGNA 1RWMB 3DRPA 2PC6A 1M1GA 5AXMA 4OI6A 2B4OA 1B4SA 1K44A 3IR6B 1A9NB 8AT1B 1BQNA 3IBWA 4KH1B 3E8OA 1FCAA 2RILA 1SL1A 3CCTA 4X64F 3MURP 3WIVA 4HH0A 5F9NA 3QRPA 4QW8A 4ZP6A 3I96A 4LREA 4BC7A 4OI2A 2W2QP 1XMQJ 4DV0J 5EWFA 3OPKA 2I6WA 4DQRA 4OZ2A 1U48A 2O67A 4ED2A 4C8MA 3B54A 4Y65A 1CJKB 2FVQA 1K47A 4DEZA 1RTDA 3M8YA 1PYOB 3MM5A 2LEAA 5KFXA 3ETMA 2FJVA 3AD7C 1SC6A 1BD6A 1BC6A 4I2PB 2WOMB 2HBYB 2ZWOA 3P6YC 4OYIA 3MR2A 4QWBA 1H6KX 1TKTB 5KFLA 2Z2YB 2JVOA 5D0GA 4EGLA 4KGVB 3IBFB 1TMMA 2WVEA 1U7LA 2EG1A 3CTRA 3A1YG 4F8RA 4F2SA 4XK8C 2DCLA 3SSQA 2WW4A 5A8RB 4JV1A 4WFNQ 1Y11A 3THPA 3AXKA 3HM9A 2CJXB 2L9DA 3N0VA 1OQ3A 1FF2A 1S6UA 5K5MA 2YX1A 2E5HA 1W25A 1X9SA 2QRRA 4UOGA 1NK0A 1FXDA 1HBOA 2QMUB 2DB1A 5KG2A 2H65B 4Y2MA 2D69A 1C4CA 1RTHA 2ZWPA 3D4JA 1Q4RA 3CIMA 4B3SF 2DGVA 1PBUA 1F9HA 1HBMB 5C42A 5D0HA 1S1WA 3TA0A 3OD2A 2OKQA 3CPWR 2RUSA 2XC9A 4GVBA 1YIJS 3MM9A 5KFGA 3ZNJ1 2VICA 1N34J 4ENOA 3BF4A 2BJ3A 4NI2B 4ZN1A 3KTQA 4HL9A 2MKHA 2KVIA 2LFVA 3PACA 2DNRA 1GMWD 2R8IA 3HD2A 4BWMA 1H74A 2QFJA 3VGUA 3N4WA 3TI0A 3PDNA 3SV3A 5JUMA 3BH6B 2RRBA 2CQIA 3EPGA 2A6OA 2MHNA 3W1YC 4Y00A 3MR7A 2XWYA 3G9CA 4CI0B 2BX6A 1UFLA 2XWXA 4NMXA 2F5GA 3KOAA 3HHLA 3SSRA 3HT0A 1CJUB 2XI3A 2P9CA 3GFXA 1NHUA 1NLKL 1JJCB 1FRXA 3HULA 1T02A 3FSXA 5F8HA 1FKOB 3FK4A 1YRXA 2AW0A 4UQTA 4WTOB 1Q1KA 4B08A 4X2BA 2IPOB 1RZMA 2BE7D 3NOGA 3G6YA 3UCUP 3VGTA 4X4VA 3MFHA 2EXUA 2NXEA 2HRYA 2JX2A 3ZZUA 4O3OA 3KUHA 4MKAA 2BA9A 4KC5A 4ZPVR 4LFCF 4HVZA 3PM9A 3GIJA 4XO0A 1D1UA 4LF9J 4NLWA 3DU5A 4P2MA 3M8QB 3OTCA 4G1PA 6FD1A 4Z7YA 3MCNA 3DM2B 2NXNA 2E44A 3EDRB 1FDBA 2IIHA 5L1JA 4WU3A 2BQ3A 1FDNA 4RW7A 4IQXA 2XZWA 2DR7A 1UZHA 4HR2A 3CD6S 2PO4A 5JXSA 3TP2A 2BRLA 2SXLA 1DQAA 3QZ7A 1HNIB 1KQGB 2KDOA 3UPFA 1NJIT 2AU0A 3MD1A 4M5HA 3DLKB 2QT7A 3BM7A 3GLJA 1ZS6A 3TA1A 3FQLA 3AA9A 3NNAA 2K7JA 4QIVA 4H4KA 2XYGB 3IFEA 4XPEA 4QQBA 1SJFA 4FS2A 3JXOA 2FB0A 4DOZA 4CLSA 4B9TA 8ATCB 3HD1A 3B4DA 1UEVA 4MYUA 1X4EA 2MKIA 3D68A 2OGUA 2GJIA 2PA8D 3JSRA 1NSAA 2HBRB 1Q53A 3W2WA 3EICA 1LWEB 1RWKB 1HNXJ 1LXJA 2A0FB 4TU8A 5K9FA 2BM0A 2IVMA 4YR2A 4RPFA 4FS1A 3PW4A 2DXDA 5HLFB 3QO9B 2Q6CA 4X64J 5HBMB 4HT5A 1U1OA 4Y28C 1RSCA 2M88A 1WKLA 4USTA 1IR0A 1RTIB 4I2PA 4F02A 4DX8H 4DR5F 1X31C 5D6GA 2A6MA 3DI6B 1S6QB 2IM0A 2D3UA 4JI6J 2BXJA 2G1HA 4DJBA 1TKTA 2C28A 3SDEB 5JJBA 4EO6A 2KYXA 2HVDA 2GFFA 3PHTA 1JKHB 5A8RA 4B9VA 4MTPA 4TQRA 1OYEA 3J81Y 3M9MB 3C2PA 2QL7B 1NXIA 2LMIA 1AZSB 5KFSA 1E6YA 2VASA 3M8ZA 5GADU 1S97A 1IBLJ 1UVJA 4DUYF 1KLMB 4TNOA 4WZMA 2LQ9A 4NA1A 1L3UA 2NYHA 1LXNA 2KYZA 1F2GA 1OS5A 3GIMA 2KHCA 4PYDA 2ADBA 1HHTP 2AGPA 1HBMA 5B0AA 2DNLA 3T5HA 1KD1T 3HK2A 5EDWA 4IFVB 4DU8A 4B3SJ 1JJ4A 2GQCA 1X0PA 3BSAA 1NSQA 4U7CA 4Y3CA 3NAIA 4NI2A 1NJXA 1PAEX 3L7PA 4DL2A 2X3GA 1EJ7L 3CCLS 2MXYA 3RRGA 4ITSA 1Y5NB 3QZ8A 3HKZD 5HVGA 4ANDA 2EKNA 1MNEA 1NPPA 1FKPB 1XR5A 5ETNA 3UN3A 2DRBA 1TAQA 5KFMA 1D9DA 4MKVA 1SBRA 1SKWA 2EC2A 3OFEA 3QT7A 1LQ9A 1M5OC 1WORA 4TU9A 3V6HA 3DGPB 1FJ7A 2LEBA 2MQPA 4KSEB 1CJUA 2DH9A 1FERA 2JLEA 5FLXY 3GQCA 4CO1A 4NLUA 1NK9A 2VH7A 2AEFA 2AYEA 3C6TB 4QW9A 1FKOA 1U47A 3H98A 1P9YA 4ZVSB 2FC9A 2XBPA 2UVWA 4RW6B 2KB2A 4QU6A 2ROEA 3M2VA 4FNHA 2VBXA 3LO3A 1X5SA 2OI2A 2VA2A 3AOBA 1VJWA 3W64A 4CO2A 4OI4A 2CQCA 1H73A 3TANA 1IWGA 1Z4UA 2VBYA 5E3RA 1B7FA 1CLFA 2R7WA 2D74B 2A10A 4K0KF 1HR0J 4IG3B 5HANA 5T41A 3M8QA 1N52B 4UZCA 1XR7A 3DM2A 3IO1A 3NXZA 3R6LB 4NZ0A 2E1CA 1XR6A 4Y34A 2W7PA 3MDFA 4IRKA 3SSSA 1U26A 3ENQA 4PUOB 2FJDB 2O1PA 1SJ1A 4OQJA 1RAIB 1HNIA 1XMOJ 1VBYA 2H4WB 3KK3A 1UPPA 1ZM4A 2RSQA 1WHYA 3BB5A 2H5EA 4DL3A 2FY1A 5KT7A 3DLKA 2GC8A 1UL3A 3E2EA 1H2UX 4K4XA 2VDIA 2ZE2B 2JLGA 1P1LA 2ZM6F 2J9EA 2ASLA 2CQHA 4IR1A 2YWKA 4ATNA 1VRQC 3KK2A 4FBUA 2FTRA 2GS8A 2QA4S 2D3OR 1S6PB 1LWEA 2FZGB 1KOOA 3E01B 3UO0A 5DM6Q 5HROB 1Q16B 2KRBA 4AL5A 3PKMA 4ZHRB 5EHHA 2RDDA 3LAKA 2CPDA 4F3MA 2HHQA 1XN9A 5J1PA 5HLFA 3A3OB 3QO9A 1D9FA 2V4RA 1LWFB 2RJZA 2OPQB 5KFUA 3RBDA 3RB3A 1R27B 1T8EA 2OJ3A 2DRAA 2E1RA 1JLGA 2MLZA 2CWKA 4G1QB 4CLLA 3CDBA 2JEGA 2ZZTA 1IJEB 3H90A 1S4EA 3BSOA 4CLFA 4F3QA 2P9EA 4U7UD 1UA1A 1RTIA 2XY6A 3H40A 2X7IA 1I51B 1NNDA 3CCVS 1RUSA 3PFEA 3DI6A 4K4ZA 4E98A 4ZVRB 2PA3A 2DY9A 1VIXA 2JH3A 3SDEA 5A0YB 2CVEA 3GYGA 2IYGA 5ETSA 1JKHA 3F56A 3ADAC 4U67Q 1S4FA 2VFTA 2RKIA 3VAKA 2DNQA 2I2YA 1FA0A 1IKXB 3ITHB 3H42A 1QVFR 3V4IA 1U2RA 3SBMA 1KQKA 3E3XA 4OHZA 1AZSA 1D8YA 3PJ9A 4XTTA 3FUYA 5E3QA 1PSDA 2Y1RI 4ZCLA 1KLMA 4DLEA 4KV8B 4AT1B 1IR1A 2AJ2A 2HSEB 4U96A 3R5BA 3JQMA 3GIRA 3BS9A 5HQ8A 3TAQA 1WTBA 2ZC4A 3MAHA 4DUYJ 4PQUB 3VALA 2NS1B 2HQ3A 2BANB 4F0HA 2J9DA 4C48A 3DRXA 4IFVA 5I3QA 3C14B 4KH0B 1R0BG 5A8KB 2ZUAA 4F4KA 4ETZA 2MZQA 2RU9A 3OSNA 3KLVA 2V69A 1WC5A 3MI7X 1D0EA 5DRKA 4WCEQ 2R2TA 1M5SA 3RR8A 4BWJA 1VIOA 3DXBA 4IH7A 5C25B 3TARA 5HAOA 3M7VA 1S1TB 4M95A 4B9LA 1U02A 2IYIA 1BHNA 4LFAF 1TKXB 1Z2LA 4P2FA 4DV1J 1NDLA 4RJVA 3MZIA 1SC1B 3FGVA 3DGPA 1KHWA 1CQNA 3CO0P 2H5JB 2OMLA 3G2XA 4OIXA 5GMEA 2EWHA 2HPUA 2W2PP 3C6TA 1RWWB 3DMJB 3EXCX 2HNDB 4M5DA 3HI9A 3SYZA 1N8RT 4RW6A 2R42A 1W2IA 2E9TA 4LF5F 4W98A 4ICLB 2YQ3A 1EP4B 3U7JA 2AX1A 2F4FA 4ZLLA 1VRTB 3I6PA 2JHEA 2AGQA 5A6PA 2HQDA 1VISA 2DYAA 2YKOA 5F8GA 2VKRA 1XQIA 1MU2A 3M05A
chains in the Genus database with same CATH topology
2A3JA 3FNNA 3O44A 1DQ9A 1E6VB 3DRRA 5EWEA 2DNGA 4HLBA 5HMZA 2KJWA 2KU7A 3DU6A 1ZZFA 2OD4A 4R0JA 5B7WA 1HD0A 1KVIA 4YB5A 2PN6A 2IRYA 4O44A 3D2WA 3J7A1 3GV7B 2FVRA 3MM8B 2DNKA 3HDSA 1IKVA 2CQDA 2BE2A 2CJ9A 1C0TB 4ID5A 4C8NA 5I3PA 4DSJA 2LDIA 1K1QA 1LK5A 2EFOA 3VAIA 1JLCB 2GMJA 4QWEA 3LW5C 1HMVB 2DD8S 5J2MA 3NAHA 2J5AA 1JLBB 4MFBB 2UV8A 4CZCA 3VF0B 2B0GA 4H4MB 1U6FA 4EUVA 3OTDA 1TAUA 4PCQA 4A8YA 2L08A 2FVPA 2N7YA 3O5TB 1QSYA 5KG5A 1JMTA 2KFYA 2JJ4D 1YTYA 2NR0A 1U1PA 3H20A 3DC2A 3KLGA 3MR5A 3P49B 1C1BB 1RGVA 2J0XA 4E8UA 2MKCA 4D3HA 2P9GA 1MWYA 1S77D 4PUOA 4NCGB 1H3DA 1V3SA 1RT3B 1X4FA 2OP5A 4QWDA 4JI7F 2XNRA 4FZVA 1RTJB 2RIJA 2U2FA 3CDUA 4MK7A 4OZNA 2X1AA 1NK4A 4RU2A 2J9CA 4ZPWR 2L3MA 2B9XA 2CQ1A 3I5CA 5J2QB 2XS5A 4B9NA 2DT9A 3FDSA 3I55S 2CQBA 3T9ZA 3CJ3A 2HGMA 3C6UB 3DDKA 5DQHA 1RT6A 4DV1F 5J2PA 1HYSA 1FTCA 3ISND 3JSMA 2GQQA 2NSCA 5HO4A 2IMWP 1N48A 2UU9F 4RW4A 3P5TL 1TZ0A 4RZRA 2LQBA 3CD5A 2YWHA 3DXSX 4ELUA 1N33F 3NL0A 2MSSA 3LPYA 4DSKA 5DDPC 1G6BA 5DDRC 4YOEA 4Q2LA 2YNGA 4HTJA 3OV7A 5JVGQ 2IBKA 3QGIA 1TKDA 3I32A 2PFFB 3IR7B 2RT3A 1QJHA 3LP2B 3R27A 3CJ0A 3MM6A 1O0PA 1URNA 3US5A 2YKNA 3PR4A 2PIIA 4DR6F 2ZE2A 1HI8A 4HDGA 1R3NA 1HPZA 3DYAA 4YDXA 4USHA 4QIGA 2MKSA 1N32F 1YRUA 4QIEA 2HIQA 5J1EA 4ZP8A 2F8EX 2EK6A 1HWJA 4RNMA 2ILYA 1KS2A 1JXEA 2KFNA 4N8NA 4N47A 2YNIB 1H2TZ 2KXNB 3F73A 2FC8A 5SUHA 1H2VZ 2GW8A 2PEHA 4IG0A 4K2XA 3I0SB 3SCKE 4DR7F 4NYOA 4PG8A 3AAWB 3OR1A 4PXDA 2N3OA 2DTJA 2V2KA 1KRPA 1S6PA 3NWGA 4XDCA 2HZCA 4C8KA 2UVRA 4ED7A 1M5HA 1ZZNA 3DLHA 2G1DA 3SQGB 3S8SA 4X4SA 3MD3A 5F41A 2ZBCA 3OXLA 5CYMB 3E01A 1JLEA 5HROA 1SH0A 4QCLA 2FLNA 2N4DA 1HNZF 2F9JA 4PXCA 4M5DB 2ZDOA 4OX8A 4I7FA 3RB6A 1TL1A 2IFXA 4O4GB 2DHAA 4DL5A 1ZPVA 2E5GA 2L9NA 5KAKA 1ROFA 1U1NA 4DPOA 2R7UA 2QMWA 2XMWA 3FCHA 3EX7B 1IKYB 2FJBB 1RT5A 1GQEA 2XEXA 2FPHX 1UJ4A 3TUJC 4URQU 1N0VC