1P8GA

The solution structure of apo copz from bacillus subtilis
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
MEQKTLQVEGMSCQHCVKAVETSVGELDGVSAVHVNLEAGKVDVSFDADKVSVKDIADAIEDQGYDVAKIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords similar to mercuric transport protein
publication title Solution Structure of Apo CopZ from Bacillus subtilis: Further Analysis of the Changes Associated with the Presence of Copper
pubmed doi rcsb
source organism Bacillus subtilis
total genus 17
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1p8gA00
1RJJA 1SI9A 3BR8A 2ASYA 2KT3A 3BF4A 2N4DA 2GCFA 2IYIA 3FGVA 2RU9A 4Y2IA 1N5TA 1YJUA 4A47A 1K0VA 3F44A 3E8OA 1ULRA 2KYZA 3IWXA 2AP6A 4HH1A 1TZ0A 5IXUA 4OJ1A 3DXSX 2QLXA 1APSA 1OSDA 2ACYA 1X7VA 1CC8A 2FTRA 2HFNA 2EW9A 4U9RA 1YJTA 2GGPB 1QUPA 1XBWA 2W4DA 4F67A 1JWWA 2HLTA 1KVJA 1OQ6A 1VQSA 1P6TA 1URRA 1JK9B 2OP5A 1TUVA 2BUNA 2ZDPA 2Q3PA 5B0EA 2GV1A 3TNVA 3IWLA 4YEAA 3BN7A 2XMKA 1FESA 2QIFA 3KG1A 2LXFA 2FIUA 2GO8A 2RSQA 5B09A 3BM7A 2BJEA 2OD4A 4A48A 2XMTA 1IUJA 1SB6A 3MCSA 2GGPA 2OMOA 1OPZA 2LDIA 2VH7A 4OIXA 4DPOA 1LQ9A 2N4CA 3HHLC 2K1RB 2CRLA 2JDJA 2QLWA 3WDOA 2ROGA 1TL4A 2BBEA 3FRYA 2QYCA 4FNHA 2VV5A 5F0WA 5K9FA 3HHLD 4DL0C 2OFHX 4QOTA 1MWYA 2BJDA 3HDSA 4HI1A 2RILA 3TRGA 2KKHA 4A4JA 2K7KA 2OKQA 3LGMA 1FE0A 5T7LB 1AW0A 3HX9A 2HIQA 1TL5A 1YJRA 1S6OA 2GFFA 2HFOA 2K1RA 3T9NA 2W4PA 1Y3KA 3HHLB 2AW0A 2PD1A 2XMWA 3QGPA 4A46A 1V3ZA 5B0AA 2HLUA 5B0GA 2HQIA 3K7RA 2IFXA 1FE4A 1N5VA 4YDXA 3DCAA 2FB0A 5T7LA 4Q2LA 1Y9OA 2XMVA 1KVIA 4DN9A 3GZ7A 4ZOSA 2ZDOA 1U7LA 3CJKB 2XMMA 3HFKA 1Y0HA 3HHLA 1X0PA 1FD8A 2XMUA 3BB5A 2OFGX 2OD6A 3MZIA 1P8GA 4Q2MA 2BYCA 1Y3JA 1FEEA 2AJ1A 4HH0A 1FVSA 1AFJA 1VQYA 1W2IA 3BGUA 4ZA1A 4NL5A 4Y2MA 5B0BA 2GA7A 2W4CA 1SQEA 1R6YA 2N7YA 3KKFA 4OJ3A 1S6UA 4HI2A 1KQKA 5B08A 5A6PA 3FMBA 1N5QA 1YJVA 1Q4RA 1TR0A 3KG0A 2IYGA 2FHMA 1YRXA 5F0UA 3CJKA 2AJ0A 3UDCA 2ROPA 2PGCA 4Y2KA 5B0DA 3LGNA 5A6WA 3QMQA 3VTIA 1WD6A 4EFAC 3LO3A 3TOQA 2KT2A 2G9OA 1N5SA 2OAUA 2ROEA 5KAKA 2K7JA 1AFIA 1CPZA 1Q53A 3HF5A 2K2PA 5B0FA 1X8DA 2L3MA 4OJHA 3I9ZA 4OJGA 4HL9A 1CC7A 1OQ3A 1GXTA 1Q8BA 1YG0A 1Q8LA 5B0CA 1MWZA 4NPOA 1FVQA 2LQBA 3KNGA 2XMJA 3BDEA 4FNIA 2RMLA 1GXUA 2LQ9A
chains in the Genus database with same CATH superfamily
4DL4A 2DIVA 2X1FA 2F9JA 5ETTA 3BYPA 1RWVB 3OT9A 1AXQA 2I38A 1CC8A 5A0YA 2J6TA 1KBRA 3U02A 5KT3A 1T9TA 1NPPA 1SVDA 2XWXA 5IT9U 2QYGA 1YZ7A 3D1HA 2EC0A 2YTCA 1TP7A 2OPQB 3AAWB 3DDIA 3GV5B 1DQ8A 2BE2A 3F73A 2BM0A 4FKYA 3ZZTA 3V6DB 1F1BB 3Q0AA 2H51B 4PYDA 2N3OA 2HZVA 2ALYB 2M3DA 2OKQA 3BREA 4JI3J 3OJUA 3N28A 4FP9A 2BJ9A 1MLAA 3BBBA 3W5ZA 3I5BA 5C24A 2YNFB 1C1CB 5IV3A 4GVBB 3SMZA 1VQ8S 5DQIA 2AYBA 3POTA 4OI3A 1FCAA 4ZK7M 3GE9A 2E1CA 2C42A 3FDSA 3DRRA 1U1KA 3P45B 5AXLA 1NZ8A 5D8HB 4K5SA 2JLGA 3R7SB 4RKUC 2NZ4A 2ALZA 3IAS9 1OSDA 4LF5J 4P6QA 2EW9A 1JLBA 2HFUA 4CTAB 1VQSA 3J7ZT 3EZOA 4WCEQ 3HKWA 2WONB 4DSIA 1RT5B 3O6QA 3PKMA 1OY6A 3PYFA 4JI0J 2DJWA 2JHEA 4XTTA 4DUZF 1QTNB 4MKBA 4QOTA 2NUUG 1C0TB 4ED2A 3B4MA 3MURP 1ZOTA 4ECTA 3T41A 2M8HA 2HW3A 3Q8UA 4XO0A 3ITHB 1EAYC 4NEYA 4HKQA 5FIIA 4TYAA 4DQPA 1WOSA 1KFDA 2NPIA 1LW0A 4DV6J 2ROPA 5B7WA 1X4BA 4IG3B 1G1XA 1Y7PA 1AFIA 4KBIA 5GAHU 2F9DA 1G3OA 3EPGA 3G9CA 2CWXA 3QGGA 5C5JA 2QA4S 1R8AA 3IGNA 4LF4F 3VAFA 1FKPB 4X65J 4F25A 2IVMA 2EKNA 2MTLA 2ACYA 4OI4A 2K3KA 2HWHA 3BO3A 4OZLA 2GVDA 2C2RA 3DLLQ 3M2RA 4ED5A 5KFQA 1HQEB 3CCLS 3JSBA 1HL6A 2W2PP 1XR6A 3IC1A 3MFIA 3EGZA 3FC9A 2BBEA 1U49A 3D4JA 5IWAF 1X4EA 4CO0A 5DG9A 5J2PA 3UDLA 2GFFA 2V4JB 4ERDA 1AUDA 4EZ9A 2ACMA 2LYVA 2QL7B 2DISA 4QWCA 4GC7A 3TAMB 3NGSA 3HHLA 1H7WA 3NCPA 2KVIA 1GMWA 2D9PA 2XC9A 3PYGA 1XMQF 1WKLA 2VFVA 2HVZA 3AOBA 2PFFB 2QA4G 5KAKA 5IT9Y 3PRDA 4CLFA 3T1HF 4WU2A 3EDRB 1FTCA 3MR5A 1S0VA 4NYOA 4NI2A 1LV5A 2RU9A 4DUZJ 2B56A 4ZHRB 1A9NB 1APSA 2ZH9A 1NJWA 3MAAB 3FQLA 2V0NA 3MDFA 3ZTQA 5KFVA 2RSQA 4KT0C 2ZOGA 2HNZA 3MM8A 2X3DA 2WSFC 3FCVA 5KFDA 5CZXA 1UZHA 4IQXA 2W8KA 3PR4A 2IJNA 1U48A 2A1BA 2LP4A 3GSIA 3RBXA 4PWUA 1QY7A 1SBRA 4QWEA 2ZWPA 1F9HA 2B5JB 2AWZA 3R7NB 1YX2A 4U7CA 4Q2MA 3GWCA 1WG5A 3FUYA 1VISA 4LF4J 3QGIA 2BMBA 3I56S 5LM7E 1NK4A 3E3XA 2HKEA 1T9YA 5A8RA 3CCTA 2P8IA 3IXQA 4BS2A 3I5AA 1CC7A 4YR0A 3R5JB 4WYLA 2W7OA 5DDQC 4R5PB 5KG2A 1NH7A 4IRDA 4P71A 1KLMB 3HK2A 5C7PA 1V9OA 1S9FA 1M1KT 3UVJA 3F44A 2MKHA 3M8PA 3GJQB 4LR9A 2DBBA 2VL1A 2IAJA 1BXNA 2JEJA 5KT5A 5A2QU 3OVSA 5CHCB 4ES1A 2IHR1 1VDHA 1NRKA 2IRYA 2KH9A 3ZZYA 2RS2A 4HEA9 4A8KA 2DGOA 1V6HA 4KY3A 1FRLA 2ROGA 4IQMA 4WXWA 3G86A 1RT6A 1RAEB 1VFJA 3DRYA 1T7PA 3OLAA 3S6EA 2KHDA 2DNHA 2MZRA 1YSJA 3EYZA 1T03B 5ETLA 4LFCJ 5JXSA 2I2YA 2HQGA 2W4PA 3ET6A 5KFEA 2OIHA 2MQNA 3SV3A 5KFIA 2HZCA 4LIRA 4D3HA 4WIIA 4UZCA 3QLHA 3TW0A 4DR6J 1PCAA 1X0PA 2HQDA 3MZIA 4YDDB 3RRHA 4WU3A 3C66A 4XAKA 3T5LA 1PC5A 3BPSP 1N52B 5L39A 4KR0B 2DR9A 4W98A 4OJGA 1LW0B 3AD9C 1R6VA 3KK3A 1GXUA 2HG4A 4C0HA 3GMGA 1B64A 2DIUA 3CMQA 3ZNUA 3G6XA 2FTRA 1R8BA 3VCDA 1M90T 1TKXA 3DRXA 5DDOC 2GO8A 4IFVA 2MZQA 3CMES 2K1RB 2AJ2A 2ZVSA 3M2RB 2XLKA 4KHPJ 5JUMA 4XPEA 1GX6A 4DBQA 4HTJA 1IBLF 4PKDB 4X62F 4OZ5A 2BXJA 2RQ4A 5IM0A 1HBNA 3HT0A 4CLSA 2HGLA 2ZC4A 2O3DA 3I0RA 4DG1B 2HHPA 2N7YA 2EFVA 1TR0A 1G6BA 1UAWA 1WD6A 4RR5A 1VGYA 4A8YA 4ER8A 2GNKA 2U2FA 3TO8A 1ELOA 2W9AA 1U47A 1B4SA 2HMIB 3OPKA 1BQNB 1S7HA 4PG5A 4I7FA 3TI0A 3M6VA 4IG0A 2VG5B 3DOLB 1RI7A 2L9DA 4PUOB 5F8LA 1JLCA 4TY9A 4KPYA 1T9VA 3AB4B 4AL7A 2M7SA 4NXNF 3KNAA 1VIXA 3CCQS 3CO9A 4NLXA 2X51A 5IQ6A 4WWSA 1SIZA 2DXFA 1QUVA 3MUTP 2M88A 8AT1B 3J81U 3THVA 2ZZMA 3LA0A 2QLJB 2VB6A 3GFYA 3KUGA 2UUAF 1IBKJ 1I5OB 5FLXU 3PW2A 2IBKA 1HI0P 1XN9A 3ISZA 4B9TA 1SL2A 3FBCA 4QWBA 1XNQF 4LF7F 5A2QY 5L1IA 4NMXA 4RLEA 2H9ZA 4P9SA 1KHVA 4ATNA 2FJEB 1VI7A 4J9RA 2DR8A 2AF6A 1N36F 1TKZB 4NX9A 4ILMA 2B9XA 4QYZJ 3SCKE 4B3SF 4IDKA 3C6UB 2OO4A 3UNGC 2C2MB 2BUNA 5CXTA 4M63A 5I3UA 2IAJB 5JVHQ 1KLNA 3E01B 1ZBTA 3J7YU 3ZZZA 4DSJA 1KONA 4K4XA 3M2VB 5EHHA 1WTBA 3T5JA 1RWOB 4NLWA 2A3JA 4B9VA 1I6JA 3R7BB 2ILZA 1IR1A 1SKUB 1F3VA 1MWQA 1HBUB 4HVZA 3PEHA 2J8SA 2NQPA 3W63A 2LECA 3IBCB 2HWTA 2G2OA 3BSCA 5L38A 1FKOA 3NOGA 5HROB 2HNDB 3HLUA 3JYTA 3NY0A 5E3PA 2EFQA 3MEGB 4BC7A 2LEBA 4DWIA 3EZ5A 4KFBA 3ISNC 1H7XA 2JVRA 4L76A 2AYGA 1Q86T 5IXUA 4O3NA 2GAGC 4XDCA 3ILLA 5KT2A 2DYAA 3VAHA 2BV3A 2HFZA 4B3TF 2MB0B 3UWTA 3ZZPA 3IN5A 4A48A 1FT8A 1SC6A 3RB3A 5E3RA 3H0PA 1I3OB 4C0BA 2GHWA 2QEXS 5GMKa 1D09B 3OBIA 4WZMA 4USJC 1KOHA 1NDKA 3RGIA 4CDIA 2LLZA 4PXEA 3GR1A 1XNQJ 1HYSA 1YBTA 1YJ9S 4WP9A 3GCWP 1LNQA 5T7LA 4JI2F 2WTFA 2L08A 1ZPWX 2JFKA 1NDPA 4CO2A 1IM6A 5DGBA 2M9KA 5IFMA 1HBNB 1G2EA 3BSNA 4B3OB 2WVCA 5DZ6A 4NXMF 5HMZA 3CJ8A 2FJVA 4Q45A 5AXKA 5A8WB 1WHXA 4L72B 2KN4A 1KEKA 2YNGA 2JX2A 2Q1LA 5ETNA 2AU0A 5LSLA 3F0NA 2C2EA 4WFNQ 4LFBF 3PFOA 2WOMA 3J80U 4I69A 2WW8A 1OQ6A 5JJBA 4DFMA 2RB7A 3QIPA 3SBMA 4WKRA 1NNDA 2QO3A 3Q86A 5F8MA 4UUXA 1J5EJ 5FLXY 3T9ZA 2E5LJ 4DQIA 4LF8J 4DV7J 4K50A 1ZZFA 3LPYA 1NLKL 4ELVA 2XYPB 1NZAA 4DV5J 1EETB 1JMTA 1SJQA 2HHQA 3QT5A 1HHSA 4GMKA 3C14A 3BN4A 4K7QA 3WC0A 5ETQA 1W2BR 4MK9A 3DDNA 1GX5A 3BB5A 4ED6A 2J9DA 2ZC3A 4M5DA 1RDRA 3VAJA 3Q89A 1VQOS 3LO3A 1YRTA 4B3TJ 2RMLA 1B0VA 5K20B 5DM6Q 2UXBF 3S8SA 2AGOA 5KOXA 2F8EX 4CH7A 2COLA 5CA5A 2JH3A 3I55S 3KLIA 4KHRA 3RW7A 2VHGA 2MKYA 1M5KC 3GIKA 4CM0A 2VC1A 4Q0BA 3PRVA 4C48A 3KHGA 4JI2J 3ZTSA 5KFMA 4Q5VA 2LA6A 5CH7B 4GKJF 2FVPA 4ZPVR 2CPXA 1U1LA 2PEHA 3MECA 2G0JA 1UVLA 2HYIB 4NLOA 3NGKA 1GK8A 4NXMJ 4UY85 3DLEA 1SH3A 1B7YB 1FI4A 4IO1A 4PEOA 3G87A 3C8YA 5E0OA 5U47A 4WF9Q 3CCRS 1HQUB 1HBMB 1JLGB 4EI2A 1OY8A 3FK4A 4JI5J 1HR0J 4RW4A 1X5TA 3NMAA 2CUYA 2UUCF 1KVKA 2FQQB 3LQVA 1HWKA 2ZWOA 5D15A 2HBYB 3VAKA 2QZ8A 4NZ0A 2G2YA 4J9OA 1WF1A 4HTIA 1KNZA 2H65B 2MLYA 4Y3CA 3NWRA 3A8KA 1IKXB 3FEYB 3IP0A 3HZGA 2BACA 2A18A 1FESA 1K1QA 3KLHA 4UOGA 4KSEB 1Q78A 2Z0GA 4PXDA 3TEGA 1T95A 1RWUA 2DEIA 2HBRB 2ZBRA 4JI8J 1VQLS 1LQ9A 2KG0A 5D3GA 1T9UA 2ERRA 1ZZNA 2BJDA 3T1YJ 1YLXA 4IFYB 4QU7A 2QL5B 2C2NA 3FFIA 3HJFA 2R42A 1VQNS 1U2RA 3KK2A 2J6UA 3D66A 5KFRA 2UVRA 3FJ2A 1HNWF 1WI8A 2W9BA 2OHDA 2IVFB 2HNYA 2HZAA 5A6PA 2O5DA 4I2QB 4YHHF 3J80Y 5F0UA 1CULB 2A10A 1RGVA 2RRAA 3VTIA 1NJYA 1P9YA 3CCJS 1IR2A 3GTYX 1UW9A 3W60A 1B70B 1RACB 2P9GA 1JJHA 3CXCR 1RWPB 3QWPA 3FGVA 4GKJJ 2F3JA 2XS2A 5HMYA 2MGZB 1OY9A 3CMAS 2MKIA 3GPAA 2PMHA 1LK7A 1WC1A 4K4TA 1KQGB 2Q3PA 2IM3A 4DU7A 2ZH7A 3D0IE 4A8OA 1BY9A 3VQSA 4P72A 2B4VA 2XI3A 2WAQD 4QIEA 2E7WA 3DLGA 1WUUA 2GJ2A 1JKHA 1O0PA 2RDDA 5H9EK 1HMVB 3PX4A 4ED7A 2WVEA 2IFXA 2DK2A 2DNZA 5H1SV 1FJEB 3US5A 3SFGA 3HVTA 2EVZA 3ZO7A 1LWCB 1YRUA 1EHWA 2DT9A 3PEJA 3Q8RB 4DV4J 4OYXA 1OIAA 2CDRB 4Z37A 1FA0A 3EJMA 1S6PA 1ZAWA 2FJXA 4N77A 3PR5B 1RHMB 1UW4A 1F5BA 4IR9A 1RJJA 3R27A 3D1QA 1C0UB 4WK3A 3MAHA 4DR3F 1N88A 1VIOA 1U45A 4DJBA 5EX0A 5H9FJ 1UA1A 4MKVA 3CWJA 2KU7A 4TKTA 2BZ2A 2XMKA 2DH7A 2UUBF 2D1CA 2LXFA 1Z1ZA 1JLAB 3HFZB 4OYPA 2ZNYA 3CJ4A 1SPBP 1V3RA 3LP0B 4IH6A 1WTFA 1S4EA 5LSOA 1C2PA 3AOCA 1B99A 2XGPA 3SDEA 1VYAA 1U02A 2F40A 3QSYB 3E2EA 1XQIA 1MN7A 1YTYA 2VOPA 2NXJA 1K8AT 3MCMA 3ONQA 2KO1A 2UUWA 2XTJP 1VQYA 4GC6A 3P6YC 4LFAJ 1UA0A 2EC2A 3DGPB 4WKYA 2M8DB 4LSNB 4JV5F 4H4KA 4OJHA 4FF2A 1Q8LA 1U2FA 2OI2A 2Z58B 3RRGA 4FNIA 4RNFA 1GT8A 5AE2A 2BKOA 4OZ1A 4L3NA 3MPDA 2KRBA 2VG7B 3GIRA 2MKCA 4ZVGA 5AJ3F 2P5VA 1DHMA 4RNNA 3GIJA 2CPJA 2CVIA 2OP5A 1D9AA 2IA6A 1G4CA 3MMAA 4CCHA 3CJ2A 1RK8A 4USWA 3CJSA 1AUSL 4AXIA 2H5JB 2OEMA 3KJNB 3UN2A 3B54A 1JNRB 1TL4A 4ECRA 2FVRA 2K7KA 2EBGA 2CQGA 4WYWA 3LAKA 2PN6A 2YY3A 1YHQS 8ATCB 5HO4A 3AQPA 5K8OA 1NEEA 3FFIB 4FYDA 4DX5A 3HP6A 3KK2B 4ITSA 3IRWP 3DRPB 2WB1D 2MKKA 5E3CA 1FDNA 1QAYA 2L48A 2LQ5A 3M8QB 5D4PA 2B43A 3CJKA 2AJ0A 1NAQA 1RUSA 4OYBA 2OMLA 2UUBJ 2BOPA 4DPYA 2QSWA 3W2VB 4K0KF 3BO2A 4K4VA 1RTHA 1HWLA 3OL9A 2ASYA 3F56A 4BWJA 2AJQA 1F0XA 2KYZA 3DHWC 4C11B 2CADA 4E8UA 1ZA1B 1P6TA 4EBCA 3OTOF 2V2QA 1FXRA 2VIHA 1IWGA 2XMTA 5D0RA 2MY8A 2NSBA 4G65A 3W65A 4ZLNA 2V9WA 4ZJQA 1NB2A 2WSCC 2CDQA 2JOQA 3BDPA 4GO7X 1DQAA 3KLEA 5DGAA 4DSKA 4DMZA 2VD3A 3NRBA 3J7Z5 1JKHB 1RWXB 1RAJA 4IOCQ 1PGZA 3IBWA 1RA6A 3DOMA 1G7CB 1SUQB 2Y0SD 2PA8D 1IBCB 2OTLS 1ZM4A 2P6SA 2DO0A 4F3OA 1OYDA 1VOMA 2JEFA 4ZCLA 4PWDA 1U0HB 3IR7B 4B9SA 4U8YA 2QMXA 3G8SA 1DTTB 3UD4P 2GVZA 2KHCA 4F0MA 4WJBA 2LQ9A 1C4AA 5HP1B 2V8GA 1B0PA 2ZBCA 4YN3B 1F2GA 2BW2A 1QUPA 2HLTA 2BKPA 2RUSA 3KLGB 2YNHA 4H4MA 2JC1A 3CIMA 4LRCA 2WVFA 3CJRA 2HGNA 1BQMB 4K8RA 6AT1B 1BHNA 1F6TA 3K8WA 3G82B 4KE5A 1F9EB 3MPUB 1WNEA 1NHKL 2EFPA 1BD6A 4N7TA 3I6PA 2SXLA 2YH1A 3FCWA 2W01A 3AHPA 1XNRF 4F4ZA 2D3UA 1H2VZ 4WFAQ 2BYCA 3I31A 4DR7J 4CO3A 3KKFA 1SQEA 3KLVA 2DR6A 5BR8J 3H40A 4YB1P 2CZVC 1WC4A 1FK9B 1S9GA 2ZHOA 3I9ZA 5L9XA 3M1VA 4IUFA 4ZVTB 2ZKTA 2CNLB 3OL6A 1N6QA 3BV8A 2VKZG 4FVMA 4ZJLA 4ES2A 1S7IA 3MD3A 4DV0F 1JJCB 3BGRA 1HNXJ 1O8BA 2RAQA 5CYMA 3TVYA 1JLFB 2Z2ZA 3TWZA 2MYFA 2DR5A 4BDPA 3FZBA 4WTOB 2EK1A 4MIAA 5FD1A 3KMSA 2FHJA 1IQTA 5B0AA 4DR4F 2MZJA 1VBYA 2CQ0A 2PO4A 4CYUA 3DU5A 1KVIA 3MF5A 2W9CA 3HFKA 4OHVA 5T41A 2UV8A 3DDKA 1U6BA 5AT1B 1HNZJ 1NKEA 4AUKA 2E9RX 3PG9A 3OTEA 2B3TB 1RU2A 1SV5B 2JVOA 5GMDA 3MI7X 2BX6A 1N0VC 3UCZP 1ZAVA 4ZVEA 3MEEA 4TNOA 3NBPB 4F4AA 2VKRA 1V5IB 2QSFA 1PYTA 4C8KA 5THWA 1U1NA 3IWLA 4BHQA 4YOEA 3SXLA 3CPWR 2KDOA 1N0UA 2ZUAA 3CCUS 4FS1A 4DX7A 5B09A 1REVA 4H4OA 4MYUA 2GIQA 2GHVC 3PV8A 4PG6A 4C3MA 3NG8A 4EWTA 2VBZA 5J1EA 2KM8B 5D0EA 4HT7A 4NCGA 2HIQA 2Y3YA 1U6FA 2Z8QA 3AQOA 2HFOA 3V5RA 3NGRA 2AMCB 2MQPA 5IQQA 1JLEB 3K7RA 1HWJA 1N5VA 3QGHA 5C25B 2VPZB 3KLEB 2ZEJA 5HQ8A 1D3WA 2FYXA 1S1UA 3ILOA 1ZTWA 3B6BA 4HR2A 2HK3A 4B02A 3S7RA 3CDBA 4ZA1A 3PJWA 4MKAA 4USIA 3M9MB 2ZHAA 3W2WB 2RH3A 3JXOA 4MFBB 5M2PA 2XWYA 2V67A 2ROEA 2X1BA 1OO0B 1UP1A 2OPPB 5D0HA 3OSNA 5KFUA 3PDNA 3Q8QB 2ZHBA 2IRXA 1RT2B 2AD9A 4KGKA 1S97A 4HLBA 4DOZA 2M52A 4X2BA 2HVIA 4HT5A 4DR4J 3C16A 1LWFA 2VODA 4DV1F 2XNQA 4PCQA 2U1AA 3DRSA 1LFWA 4F0HA 3M6XA 3PVXA 3KK1B 4A46A 2UU9J 1HFEL 3BPDA 1T94A 4DS4A 3V4IA 3M05A 1CJKA 2MKSA 4RWXA 4YY3F 2I9SA 3M30B 5I4MA 1GFWB 1RAIB 1XEZA 1M5SA 4RBTA 1GQEA 4PYAA 1T02A 1R43A 4IRKA 4LSLB 1FRIA 4I6WA 3GFHA 5IOLA 3RB6A 4USUA 1GXTA 1OMSA 1RCXB 4FPIA 3Q22A 1VJQA 3UE2A 4UTGA 4X4OA 2LKZA 3L7PA 1NK7A 2KT3A 2IDLA 3ULHA 4XK8C 3D3BJ 1NHUA 4O4GA 2QG9B 1YJWS 2MLXA 1NDCA 2E1MC 2ABYA 2AEMA 2GS8A 4KJIA 2RDJA 2XLJA 1H73A 2M4MA 5CYJA 3KHHA 2BM1A 1HBOA 2DNLA 1IKYA 2NS1B 1FJGF 1S1TB 2V94A 1MMDA 1XK8A 5E41A 3CJ5A 2H4WB 4HACA 2MMYA 4Q2LA 1NJXA 4RW9B 3TUZC 1LFPA 5LMNJ 4DSEA 2V6AA 4B17A 1Y10A 3MM9A 4G1QA 2PSZA 1Q5YA 2FZGB 3FEXB 3TANA 3MTJA 2Q43A 2F65A 4KRWA 3OR1B 3EE3A 4YS2A 4OZJA 2LU2A 3LWMA 4DV1J 3LP1A 3CNQP 1I51B 2IC3B 4RW6A 5IT0A 2HRUA 2J5AA 1N4LA 1NSAA 1PO6A 3VGSA 4NRUA 2HGMA 3KOAA 4C8MA 2ZE2A 4YY3J 1KHWA 4FN5A 2JDJA 2D3OR 1TL3A 1KS2A 1NBEB 1AZSB 1EARA 1X4DA 1T05A 1QE1B 4NCGB 3FSYA 3VVUA 3SCLE 2LU1A 2Q6CA 4DL3A 4C8YA 4NLSA 4QR2A 2VZ9A 1Y0HA 3J7A1 1WJ9A 1AT1B 1CS4A 3MMCA 2DNYA 1Q7LB 4I6YA 1QAJA 2IDEA 3HD1A 5B08A 3WIUA 5D4LA 3LW5C 2RDIA 3SSRA 1RBOB 2FHKA 3H5XA 2K2PA 4CH0S 3DC2A 4ZDNA 3QO9B 4EYIB 3NGTA 1URNA 1KRPA 1SXLA 2IJFA 3R1HA 3Q2TC 2AP6A 2J9EA 1M5PC 2ZFHA 4KTQA 1X7VA 3R5DA 2F63A 1GTEA 3MPVA 1FJGJ 4KH0B 2XEXA 3PW0A 2LEPA 3R5BA 3A8IA 1YZ6A 4RX6A 2Y1RI 2R7OA 1UKUA 2RT3A 2BJ8A 1LOUA 2FVSA 2AIRB 2OEJA 2F1FA 3OLBA 2XCAA 4EU0A 2CQ1A 1EP4B 3H90A 5I3QA 1BWEA 4G1PA 2Y8YA 2D69A 3MEDB 4UT4A 4ZIVA 2WK4A 3M9NB 3DCAA 1EZZB 3EGVA 1RT7A 1FWPA 3TQ1A 1CJTA 4E2FB 2GX8A 2O01C 4LF9F 1R8PA 1L3SA 1CQMA 1RTJB 3MR2A 2XSJB 2IM2A 2G13A 3HSZA 3ZFVA 2BANB 4NYZA 5B0DA 2D3ZA 5KFBA 1HIYA 3GV8B 3ICLA 2VF3A 4JV2A 4O3PA 1GTHA 3GCXP 4ECWA 3OUYA 4ED4A 3M6WA 3MGJA 2AJFE 4JUZA 3H5SA 2ADBA 4CLKA 1ZS6A 2RKIA 1VRTA 2AGPA 3W64A 2GGPB 2BVZA 1X9WA 3D6TB 3WX8A 2DHHA 4F2RA 3DI6B 2ATLA 3D3CJ 3ENQA 1N54B 3W1YC 2WVBA 3L95X 1TUGB 1CPZA 1Q0NA 5KT7A 5KG1A 1HWIA 4L6V3 1IJEB 3B4DA 2EFNA 1IKWA 1FDDA 5ADZA 5LSRA 3OFGA 2IIHA 2CG8A 4NASA 4N8OA 4J9VA 1PJ5A 1NSQA 1Q16B 4ILLA 1ACMB 4OFZA 3QRPA 1RTIB 4Y65A 2ZNZA 1SL0A 3AFGA 1BLUA 4G1QB 5E33A 3E51A 1N32F 3J81j 3SQGB 1R89A 3CCZA 3BO4A 4CRJA 5C42B 1YKWA 5HATA 2W8LA 4B3RJ 1DY3A 4DV3F 4ECQA 3OVAA 2DHXA 2ZBQA 1NHVA 4A47A 2OGUA 4PPDA 1ULRA 2DY9A 4J5OA 5J2QA 5F8HA 2OPRB 2F4FA 3TARA 1DBDA 3KHLA 4EUVA 2B9WA 5RUBA 1HD0A 4OIXA 3EVMA 1B0TA 4CLPA 5CD4H 2MQLA 2KJVA 3BKUA 2ZE2B 4TY8B 1FE0A 4MK7A 3UI3A 1UFWA 5LJ3Y 3MWBA 2DGQA 3L7UA 4OX6A 2HAIA 5AE1A 4JBCA 3KUHA 2EXUA 3AD8C 1RHJB 1D9DA 1HQ2A 4Y2MA 1ZA2B 1X5OA 3IG1A 1K47A 4L75A 1VC0A 2NYHA 3CW2C 4RNOA 1T9XA 2VONA 2YXLA 2P9EA 3NNAA 1DLOB 1TAUA 4DEZA 3JAMY 3UPFA 4UUWA 1V5VA 2YNIA 1RT1B 4ZJOA 4J9SA 5KFLA 4ZPDA 1FERA 1I94J 1IVZA 5KFAA 4MK8A 2YQ1A 1HHTP 4ECYA 2VQEJ 2DGUA 5DLFA 1X4GA 4IH7A 2CPIA 3ILJA 1XIQA 4F4YA 1NU4A 2XZDB 4FPRA 5IS2A 2MLZA 1EX8A 2AZ1A 2QLWA 2XS5A 3DOKA 2VFTA 1TAQA 1IBMJ 4FVCA 1BQXA 4BWMA 4KAIA 1RKJA 3C6TB 3IRXB 3NKYA 3DMJB 1DZ5A 3DM2B 2YVSA 4G6VB 4F36A 3LP2B 2ZH3A 4ETZA 1N32J 1U7LA 4KH1B 2QT7A 4LRFA 1E6YA 2CQIA 3UCUP 2ASDA 3W9HA 1CJTB 3TQEA 1N34F 2OAUA 2C2ZB 1CJUA 1S9EB 3G8TA 1Q8BA 1Q1KA 1T11A 4NPOA 3OXGA 2PE8A 2HQ3A 3SYZA 2NLWA 4QZVB 4GKKF 1UPPA 4YR2A 2YKPA 3V4MA 2Y0BB 4UW2A 3SSQA 4UQGA 3HVRA 3W61A 1X31C 1XWLA 4FDFA 4WFXA 2ZDPA 2WRMA 2L9NA 1TV6B 3P5BP 4J9PA 3ZTOA 1IUJA 5F9LA 1RAAB 3SEOA 3VVTA 3D1OA 4AXJA 2YKQA 3QSIA 4ID5A 5I42A 4PQUB 2DNOA 2I5JA 2JSXA 1RAOA 3OHBA 1X5SA 4ZVPB 4ZP7A 1SKSA 2MQMA 4M5LA 1S1VB 3QT6A 4PR6A 4NYPA 4CO4A 4TQSA 4F2SA 3LALA 1HW8A 3PO4A 4LBPA 3CE8A 2UXCF 3GFXA 4LF6F 1EKRA 3P49B 1RTDB 4JP8A 4J90A 4R8UA 5E2QA 1PYSB 1P1LA 2FVQA 3HO1A 3BQ1A 4EBDA 3BR8A 3MR6A 2V9KA 2IYIA 4U7UK 1FFGB 4KC5A 1T3NA 1PBUA 4DUYJ 4X66F 2XO7A 2W7AA 1Z2ZA 4CNYA 2HPUA 4JI1F 2DRDA 4PG4A 4ZVFA 4ICLA 4ID8A 5J2QB 4YEAA 1CJVA 3C15B 4OYAA 4DR2J 1TFYA 1R0AA 3NS7B 3MCSA 4RW7A 4LJMA 5J1PA 2ZD1B 1WHWA 3K0JA 2KYXA 2HRTA 4OYOA 2GMJA 1FRXA 2ZOFA 5HMXA 1P27B 2DRAA 2MZSA 3SV4A 3R5GA 4CZCA 1MROB 4NMLA 2XMWA 1N34J 5AE3A 3DLHA 4FS2A 3JTOA 2LVWA 2PFDA 1U1RA 3ZZOA 1ZYQA 4NA3A 4GKKJ 1JXVA 3FEZA 3TAPA 1NJIT 1UVIA 3VAMA 2MZTA 2RVJA 1DQ9A 3LGNA 5BXIA 3TOQA 2E9TA 2K7JA 2B4UA 3Q8VA 7FDRA 2HBQB 4O44B 3JQKA 2V69A 3M32A 4RUAA 5C2CA 3NS5A 4QIGA 2JEGA 2B4OA 3CC7S 1IKVB 2KB2A 4C9DA 3D28A 2DPJA 4ZN3A 5A8KA 1D9FA 1X4CA 4V19J 3KJVA 1RSCA 1NPKA 5J2MB 1IXKA 5HLFB 1S6QB 2O67A 1Y3KA 4I2PB 3DOKB 2HVDA 1YJNS 5J2NB 2ZVIA 4HI2A 1Q4RA 3UDCA 4USKA 4RW8A 4X64F 2MHNA 4DHVA 1T3OA 2AGQA 2HRYA 2RQMA 1LW2B 1YBAA 5LMUF 3Q2SC 4DCOB 1IM4A 1HNIA 3SCIE 3QJPA 1CJUB 4EO8A 5FJ4A 2XHWA 3QYYA 3MM6B 3HJVA 4Y0FA 1IR0A 1KVJA 1IN0A 1N5YA 4O3RA 1FEHA 5G0RA 2CPDA 2OPSB 2QGFB 1TKTB 3V81B 3N6MA 4MIWA 2CJQA 3PJ9A 3VF0B 4QIVA 5CABA 1H2TZ 2RJZA 4QWAA 4B3MF 2HLUA 3QAEA 1IJFB 1ZTTA 4NCBA 3J7YI 1C1BB 3HSGA 3GG0A 2PIIA 1Q7YT 1PAUB 3JSMB 3K5OA 1LXNA 1Y3JA 3AJ2A 2B6AB 3NWGA 4KV8B 4DF8A 4YB6A 1OS5A 1S5ZA 1UEKA 1N5SA 4A8WA 2R8JA 4OZNA 4O0NA 2E66A 1MU2A 4JV1A 5K5MA 1P1TA 5K14A 4ZPCA 5A0YB 2Z2LA 1RISA 1JLQA 2DXDA 2EI5A 1F60B 4G3IA 4P74A 4DX8H 1XBWA 3DYAA 2BE2B 2CPZA 4X4TA 2GJFA 3Q24A 4EO6A 3QJLA 4P52A 2C22A 1S1XA 4BLGA 2IJRA 3NAIA 3DGVA 3HFVA 5MLCV 3QATA 2V4QA 1UJ4A 1R0AB 4CLZA 5KFCA 2AEFA 5FDLA 4OI2A 3QRQA 5F41A 3LGMA 3FSIA 4C8OA 1L3UA 3VWSA 3TUPA 1FNMA 3KG4A 5C24B 4X64J 3WQPA 1PG5B 4NLGA 1VHFA 4KO0A 1ITPA 4JYAF 3U1LA 1ICEB 2PMWA 3QPIA 4ED1A 3POTB 1YIJS 2CPEA 1YK9A 1AFJA 3QAUA 1GMWD 1CBKA 1E6VA 2DKOB 3BKTA 2VQFF 3DRRB 2RU3A 1TL1A 4ZITA 5ETMA 5IWAJ 4KGMA 2Z2YB 1UWBA 3MUVP 3I0SA 5LL6d 1KDNA 2QV6A 3OHAA 1JLBB 3W9IA 1RT4A 2HIYA 2DPIA 4P2MA 5G4DA 3NMRA 4HH1A 4KGZB 2XI2A 2WCXA 1OWXA 1XMQJ 2CJYB 1QM9A 1NM2A 4TYBA 2OD4A 2YKMA 3T1HJ 2XYGB 2W25A 4ZPWR 2ZH6A 5HAOA 5LXRA 4O0IA 1KOOA 1ZM2A 1Q82T 3H4BA 3K58A 1VK3A 2Y9HA 4U6PA 1GAOA 3PX0A 2YKNA 1S57A 3I32A 3R97A 1Y00A 2ZJPQ 1TVRA 5DDRC 3JTPA 3CEDA 1RHRB 3H20A 2WZ1A 3KLFA 4QIWD 1HW9A 3G96A 2KG1A 2BDPA 3K59A 1ROFA 4OJ3A 4JI4F 1J5OA 3L3CA 3KG0A 1Z2LA 2I1RA 5DS7A 1WI6A 5L1LA 4WE1A 5D6GA 1B7FA 4HHHA 5BYQA 4X4VA 1FX4A 1FRKA 1VQ4S 1D1UA 3K5LA 2UVUA 3L4BC 2DGTA 5JMNA 4OHZA 4KGVB 3PW4A 2GVDB 4EBEA 1UWAA 1DTQA 2R7WA 3U1MA 2DGVA 4RUBA 1YJTA 2MHEA 2R2SA 4RZRA 1JK9B 3BH6B 2DNQA 4J7CA 4OX9F 4NA2A 4JOUA 5J2PB 3PXGa 4M95A 1AB8A 3M2UA 5CYQA 1A7GE 3EPIA 3MEKA 3MXHP 2YWHA 3MMBA 3EVOA 2POKA 1S12A 2QL9B 1N48A 1VBXA 2LQ8A 3HHLB 4DR1F 5GVQA 5L1JA 3KUEA 1S0OA 4DCJB 5HJYA 1X9SA 3O1LA 4CI0B 3P8BB 3CD0A 4X4NA 1S1WA 1S48A 2H1YA 1FFWB 2CYYA 4DUTA 1VR6A 4NI2B 3N0VA 4LBHA 4P2SA 4AL5A 1WOOA 1YITS 3H4DA 2ZH5A 1WG4A 3FKBA 3KNGA 3AT1B 5EWGA 1RT3A 4Y28C 1V3SA 1VK8A 3WIVA 2FPHX 2JL9A 1K0VA 4J9UE 3H8YA 2XGQA 1FWLA 4OJ1A 1FHTA 2UV8G 2R7SA 2HNZB 3ZZUA 4ES3A 3MM8B 5KTQA 1WF0A 2C1EB 1PJ7A 3AJDA 4P75A 2W2MP 3A3NB 1TL7A 1R27B 3T5HA 1SJ3P 2FJBB 1S77D 1UETA 1MWYA 3EX7B 2C3PA 4JI4J 2VG6A 1VS3A 2DNGA 2RF2A 5L46A 5HBMA 2HHSA 3H59A 2KXHA 1FE4A 3JB9k 3BGOP 2UZAA 5L9NA 4LREA 3P5TL 3D2WA 4PXCA 5A8RB 2B8QA 4U67Q 5SUHA 1H74A 1S0NA 2V8PA 3OTDA 3D68A 1XMOF 3B82A 1YJVA 1FWKA 4YUDA 3UR0A 1BGXT 3ZTRA 2JWNA 3K2YA 3GONA 4M1KA 2VA2A 4P2FA 1SC3B 4OX9J 4C8LA 3HI9A 3UVJB 3M8PB 1IBLJ 1WACA 4X62J 4UQTA 2M5YA 3E8OA 2GC8A 1RT4B 2ZH1A 4ZCMA 4DCPB 4DR1J 1VBZA 2ILYA 3W8PA 1RT6B 3HSJA 3ETOA 3R5CA 2K3IA 4ZLPA 4I4BA 3CCMS 3MM7A 3ET6B 2VPXB 4FNHA 1RP5A 4F3QA 3AY0A 3PY8A 2OPQA 1KQFB 2D3O1 3HX9A 1FDAA 2XS7A 3V6DA 3QLHB 4C3LA 4CO1A 2KVQE 2NXCA 5D0GA 3MAQA 4YP3A 1VC5A 4A8MP 4NXNJ 1LXJA 1XR5A 4YQWA 3KK3B 5DM7Q 3CDAA 2FC9A 4NRTA 4Y2KA 4ECSA 2YNFA 1C1CA 1FJ7A 2YPYA 4WFZA 4GVBA 1X8DA 2H3EB 2LFVA 4F04B 3CVKA 5D4OA 4I1TA 2D9OA 2XULA 3UFCX 2JNJA 3Q23A 1A0OB 3SCJE 1TKXB 4IO9Q 2FLOA 1HPZA 1HNVA 1U1QA 2UUAJ 1N33F 4IFVB 4W92B 3LGHA 4QU6A 2R2UA 1DTQB 1Q81T 2QIFA 4LF7J 1VLYA 3K89A 2YH0A 2OMOA 4CTAA 4MH8A 2HVHA 1DJ0A 4ETXA 1KD1T 1JNZB 2IM0A 2WONA 2RD5C 2UXDF 1N36J 4TLQA 2CJXB 2E7VA 5CYQB 4OZ0A 5IM0B 3K5MA 3NNHA 3N4WA 2O66A 3PW5A 4B3SJ 3I0RB 2VUGA 1C0TA 3TAQA 3TX0A 2DHSA 2HS0A 1S99A 4AE5A 4LSZB 2OFGX 4QIFA 2YQ3A 4D3GA 3H25A 5H9EJ 4W90B 4I64A 4IRCA 3FMWA 1WF2A 3ITHA 2E1PA 4ZPTR 2ZKUA 2ATCB 1H6KX 4ED0A 3WX4A 5KFHA 3RU0A 2V50A 4I7FB 4IG0B 4OX8A 4IG3A 3J81Y 7AT1B 2RQCA 4A8SA 3PNIA 4JI3F 2OUGA 3VGTA 3W5YA 1JLCB 3QQCD 1N56A 3OFEA 4UOCA 4Y2AA 3VR1A 4ED3A 2C2KB 1R3NA 1JWWA 3D6HB 3G2XA 1M0SA 1FKPA 3EZUA 1DURA 1WEXA 2FIUA 2X1GA 1K73T 4QJVA 3BGFA 1UPMB 2QYCA 2MQOA 4J9QA 2OFHX 2YWFA 1HQEA 2LXUA 3RJMB 3UO0A 2V8VA 2MSSA 5DETA 1S72S 2JJ4D 5EDWA 3VALA 1JIHA 3HULA 4XDDA 1Q95G 3G8QA 4PXBA 2E7XA 1UL3A 3QFHA 1Y9OA 2V4JA 2QA2A 3GYXB 2KXNB 4LF5F 4J9KA 3TAMA 2D74B 2WVDA 1REGX 3D9BA 2CKWA 2DNPA 1U0SA 4JI0F 5DG8A 2PI4A 3W62A 1KSPA 4IDKB 1VC6A 2DNMA 1TK8A 3D6FB 5EX3A 5GAGI 3IWXA 5I3UB 3DLJA 4CLTA 5ITHA 2H54B 2MKJA 3R6GB 2EFOA 4ZHRA 3BM7A 4A8XA 2VC0A 3FQKA 3MAAA 3O3LA 5K8PA 2V8HA 2C3UA 3WDOA 2BE9B 4DV6F 1CQNA 1PAEX 1X60A 3FBFA 3HVWA 4PWWA 4HI1A 3MM7B 3PTWA 2BE7D 2AW0A 4LFBJ 4OLOA 1FX2A 1IQZA 4KYZA 2XYHB 1FKOB 2F4VF 5GAEU 4X4UA 3JYTB 4X65F 3DLKA 1TUWA 4ECXA 1AYEA 3R6LB 2W4CA 1R6YA 1WSRA 2B5JA 4L3KA 4KFBB 4QYRA 3R1LA 5C2GA 3H7HB 1MNEA 4HL9A 3QWUA 1RWKB 2C2DA 3SQOP 2XM3A 4MKYA 1QSYA 4ZVHA 1W25A 5HL7Q 2H4YB 2R8IA 4R5PA 2Y1JA 2DNKA 1KP6A 4DFKA 1X4AA 1HPZB 1YWXA 1HNVB 1KLMA 2MDAA 1ZAXA 2DCUB 4M94A 1RHKB 1RAGB 2XY5A 2HVEA 3CIZA 1VQ9S 3DNCA 5DO2A 4PZVA 1F2HA 2ZITA 2VV5A 4ZP8A 1HYSB 2W2QP 2UXBJ 1MSWD 2RS8A 5T7LB 1R8HA 5LT5A 5HQMA 3A12A 3TYTA 3BH7B 2LMIA 4DPWA 4DI6A 4EMDA 4RU9A 1FRMA 4C0OC 2HURA 1WKKA 2FB0A 1T03A 1SH2A 2F7VA 3D6MB 3D5MA 4EZ6A 4P73A 4LBIA 3UDVA 1RLCL 3JTNA 4F02A 2DGSA 1K44A 1M5OC 3IO1A 3QBCA 3KMQA 2CQDA 2CZ9A 2YNGB 2KT2A 2FD2A 1WOPA 2OSRA 2KFNA 2PC6A 3VGUA 5IC6B 2LQBA 2IBOA 1FDBA 2HWIA 2HHVA 3FVYA 3K5PA 3B8HA 2WOMB 1VBKA 3D7SB 1WC3A 2CWKA 1YJUA 2AEJA 5HI7A 3QIPB 2XNRA 2IPOB 2OELA 3HHKA 4NE9C 2XZTB 4C7QA 2YKAA 2DRBA 9ATCB 3ISND 2F4VJ 2LDIA 2N4CA 2CFXA 4ZVUB 2KI2A 2A2CA 2Z2MA 3C14B 2UUCJ 2B51A 2K1RA 5KFWA 3SIPB 1UMJA 1NXIA 1Q8IA 4MIBA 3BBCA 3CB4A 2KT5A 4M5DB 4OZ3A 3JS9A 3M8ZA 4DN0A 1U1PA 4OMFG 8RUCA 1OJ4A 2W1BA 3HKZD 3GFZA 4JI7F 3PIOQ 2UVWA 4K59A 2ZBPA 4DG1A 2WBMA 1WC0A 1ZH5A 2B0GA 3LF0A 5DQGA 3SFUA 3CJTA 3K57A 3ZNJ1 3KLIB 3M8WA 4GO5X 4USHA 4LFCF 4ZVQB 3CDEA 4JI6F 1MN9A 2HMIA 1BQNA 2HS4A 4Q0BB 1HNWJ 4F26A 4DU8A 1RXOB 2RHQB 4BCAA 2XMAA 4RBUA 4YHHJ 3ADAC 4DR6F 2CQPA 2VG5A 3VZHA 3BQ0A 3DOLA 3GJRB 2FJAB 5ETSA 4PUOA 4I0WA 3MECB 2N7CA 1OPIA 2DB1A 3FRYA 1SC4B 5IV4A 3DFEA 3OTBA 3LAMA 3DLEB 4N47A 1SQFA 2E29A 3T9NA 2EKYA 3QGPA 4TU7A 5B0GA 2DEJA 4X4PA 5E5NA 3CT9A 3M8RA 3I87A 2NXNA 2C28A 1W26A 3BR9A 4P2XA 3DLKB 2KL8A 4M5HA 4RW4B 2FGOA 1YRXA 3OD2A 2FY1A 4CWBA 3FCHA 4CT9A 2FZCB 3GLJA 2H5EA 2HK2A 4F50A 3QNWB 2G1DA 1FNXH 1R31A 2YX1A 1SJRA 4KHPF 2LXIA 3U27A 2QLFB 3KLHB 3MPWA 4NLTA 1Y5NB 3MR3A 5D3GB 2CQ2A 3CO0P 1TKZA 1NK9A 1P9QC 5IT4A 3IM8A 2BJEA 4AL6A 1FJCA 4MT1A 3C6UA 3HT3A 3AODA 4B9NA 2NREA 4W4MA 1KKHA 1UFLA 2OH2A 1PYOB 4CP5A 4Z7CA 3E01A 2CIMA 4JI7J 4DR3J 1KN6A 2W9BB 2FZKB 3M2VA 5GAGU 2HNYB 3MTKA 3VAGA 4ZOSA 2ZDOA 2QFIA 2WB4A 5HVFA 4YMEA 3KXDA 3G6ES 1FVSA 3JSRA 2R7VA 4ZP9A 1HBUA 4JI6J 1LWXA 3V2UC 4USVA 5EUHA 2E5HA 3DHXA 3QMQA 3T3FA 2BA9A 2VFUA 4MYTA 1L3VA 5HROA 3T5KA 2HNDA 3KJQB 2HHXA 1Q79A 3RZAA 4XPCA 2BRLA 1Y4ZB 2A0FB 3MEGA 3GG1A 1ZM9A 2HEKA 3CC2S 1TZ0A 3PACA 3R2CJ 3MCNA 2G1HA 2HBZB 4K4ZA 4PAAA 1BUXA 1H38A 1IBKF 3DLGB 3F41A 4DLGA 4JV5J 4ZVRB 3UN3A 1YI2S 3IA0A 4DL0C 1RAFB 2Q6BA 1MW7A 2KKHA 2CVEA 3TA0A 4DZ6A 3ENAA 1YJRA 2E9ZA 1FF2A 2D41A 3HVTB 5AJ3J 3L7OA 4RJVA 1R8CA 2EK6A 2GO9A 2DGWA 2V4RA 1S6PB 4CLUA 5GMEA 3WHIA 3HZEA 4LRDA 1NH8A 1O6XA 4LR7A 2QE5A 1S79A 1RBAA 2FJWA 1U26A 5KFNA 2PGCA 5ETRA 3EDQB 3BSOA 2EG2A 4B3OA 1RABB 4IR1A 4CH1A 4MTPA 3N6LA 3NGUA 4FBUA 4OHWA 5A8WA 3K8VA 2MZ1A 2BABA 4QW9A 3CUNA 2W4DA 2V68A 1SJ4P 2QA1A 2V34A 5DG7A 2C3YA 2DD8S 4FF3A 3CD7A 3W5XA 2GQCA 5I3PA 4K0KJ 4ZMMA 1FD2A 3SDEB 1FNOA 4LQ9A 4NLDA 1KWMA 2AX0A 1YGYA 4C2MA 1O51A 3PM9A 4R0JA 3K17A 3NXZA 1EETA 3B78A 3AXMA 2HS3A 2BJ1A 3OTOJ 2KRRA 1S49A 3LANA 4K4WA 4RWWA 4IOBA 5K8NA 2G9OA 3KDOA 1VMBA 1TMJA 2J8AA 1H2UX 2VU5A 3GU0A 1H0HB 4PPZA 4FZVA 2CJBA 3MMAB 4MJKA 1LK5A 3UN5A 1T8EA 3HVAA 2GV1A 2VPYB 3BQ2A 2QFJA 3TZZA 2Q66A 2ZM6F 2DO4A 3FSXA 2LQJA 3CDWA 5F3TA 3N9UC 2Y8WA 3A3OB 2GW8A 1EJ7L 4RNHA 1QSLA 5F3ZA 4J9LA 2F8MA 2YX4A 4E98A 5KG3A 3M9OB 3OXLA 1JJ2R 3GZ7A 3BYRA 2YPZA 2M70A 3CJKB 1FD8A 2XZWA 2HQFA 2L41A 2CAJA 4LF2A 1QD1A 4USTA 1FRHA 2QTWA 2O1PA 4URSA 3N01A 3BZQA 3W66A 2GAHC 3RAQA 1RTHB 2Z56B 5A6WA 4LRBA 1HI1A 2ZJRQ 3VAIA 3RAXA 1HQUA 1J5EF 4C6AA 4CT8A 2E5LF 4LF8F 3R2DJ 4DV7F 1HBMA 1JLGA 4M5NA 3O44A 4TN2A 1FXDA 4DV5F 4XIUA 4Y2IA 1XNRJ 1VJWA 1FXLA 3GILA 1QTMA 3WC2A 2OLWA 2VBXA 4Y2CA 1GEHA 3FRZA 1YVFA 3VQTA 1SB6A 2YQ0A 1IKXA 3MHYA 3DXBA 4DSLA 3OFHA 1PBAA 2RILA 2LEAA 4ECVA 3HHNB 4RPFA 3DOMB 4DV0J 4ZKAA 1SH0A 2FHJD 2P6TA 3V6HA 2KZMA 3PFEA 4IFYA 2F8HA 4OL8A 4PWDB 3ZZRA 1CEZA 3FBEA 2B9YA 5E7OB 3C3LA 4F4WA 2GVZB 2IYGA 3RBZA 3TJ9A 3VHQA 1Z4UA 1A6LA 3HF5A 1L3KA 1NDLA 3HM9A 4I2QA 1CULA 3MOJB 1LEOA 1UZDA 3I96A 4V19X 5F8GA 2M2BA 4A8FA 2ZM6J 4AT1B 1QDUB 2R7TA 5CD4A 1TKDA 1X5PA 3PCOB 2YNHB 4H4MB 4ZCIA 4C8NA 3PYDA 4OYMA 1L3TA 2FUG9 5SZTA 2MGZA 1R0CB 1EQ0A 2G2ZA 4BC9A 1OPZA 5HJXA 2RE1A 4FKXA 4C8ZA 4B9LA 5KFPA 4B9UA 2G0CA 3O8WA 3THPA 3MPYA 1TL5A 4JI5F 1HR0F 1DARA 3Q8YA 3IFEA 4U96A 2HSEB 2VBWA 4WZQA 1KQSR 4DN9A 2RIJA 2FC8A 4IOAQ 1HMVA 1F5CA 3ZZ0A 1YJ7A 1S9GB 2GA7A 4FYVB 3M1VB 3IS9A 4B9MA 1KR4A 4YB7A 4J9NA 2FJDB 3EICA 3OVBA 1N6QB 3NS6A 4FYYB 1LWCA 4JI8F 4NLPA 3VGVA 5F8JA 3BGRB 2KJWA 5KG6A 4OX7A 1SI9A 2C3OA 3T1YF 1VQ5S 4X4SA 1S76D 3TEHB 5CYMB 1XERA 4DLEA 2IY5B 2DGXA 5ETKA 1C0UA 3TNVA 4Q43A 1NK0A 3UNYA 2MJUA 4WXOA 4Q8FA 3N79A 4DDFA 3W9JA 1JLAA 4TLRA 4CYUB 4DQSA 1QAIA 4IYQA 2AJ4A 2W9CB 4CNZA 2ZUGA 2GJIA 1UTAA 1OSCA 3LP0A 5F8NA 5CZVA 2ASJA 1PC4A 2E44A 1RZMA 4M5IA 4NL5A 2WW4A 4MAKA 4H4KC 4QYZK 4DPXA 4LUBA 4Y6IA 4NA1A 4WIQA 1EIYB 3MEEB 1UEVA 5GADI 1VCTA 3TX8A 3DGPA 3TZXA 4DFPA 4LSNA 2G0IA 2ZJQQ 2GCFA 4OI6A 4K2XA 2L9WA 3RTVA 2IVYA 3Q8PB 3CCWA 2HFNA 4ALZA 1REVB 3GV7B 4H4OB 1RWMB 4DV2F 2VG7A 4DL7A 4WPAA 4C3KA 1PILA 3BSAA 4HDHA 5J1EB 2GMLA 3PO5A 3UR3C 1F5AA 3TVZA 4UF4A 1WDDA 3EMTA 4DV4F 4ENOA 2LCWA 5F9NA 5KG0A 3HDSA 1HARA 2CQ4A 1JXEA 4O4RA 4M5GA 2J0XA 1S1UB 2DVIA 2DITA 1CSJA 5DZ7A 3EVWA 2IMOA 2BQ3A 2V2KA 2B8PA 3UCGA 1D8YA 4CM2A 5LOQA 2VPWB 2K8GA 2N3LA 3LOUA 1H72C 2JFDA 2DNRA 5HVGA 2PA3A 4F0KA 1WC6A 2JLFA 2XCPA 3DRPA 3CJQA 4URQU 2DH9A 3M8QA 4ZCKA 1RB0A 1J27A 2DNNA 2HFVA 2I8EA 3MCOA 3THTA 1RYSA 4QQBA 2CQ3A 2E1RA 3W2VA 5DLGA 1H3DA 3C16B 1LWFB 3GYNA 3TJ8A 3M8SA 3OL7A 3IWNC 1TUVA 2E5JA 3QIDA 3CC4S 3DRSB 4CO5A 2KM8C 1TELA 4C11A 1BC6A 4LFAF 1FKAF 3AXKA 4RU2A 1K0TA 2J0SD 5D78A 3V4IB 1JJ4A 2FVCA 1CJKB 2IA0A 3CULA 3CCVS 4AYBD 1JQGA 5IC4B 5LJ5Y 2H48B 4OYIA 3NCQA 5KOWA 4U95A 2VOOA 2K06A 3S1TA 5KFJA 4H54A 3H42A 4ELTA 1VQ7S 1NK5A 2X1AA 2AX1A 4GVLA 1S10A 1S0MA 1RE1B 4Z2XA 4V1Ak 1SUQA 3MM5A 4N41A 2ZOMA 3A3PB 4DV2J 2VBYA 3IS9B 3NCRA 3CF5Q 3ZTPA 5DDPC 1U0HA 2NXEA 3QZ8A 4O4GB 1WSVA 3A8JA 2PEBA 4FYXB 1DTTA 2MJNA 4YFUA 4N56A 1B3TA 4DL6A 4WBFA 3NOCA 4S0MA 5HP1A 4NLUA 1HBOB 4ANCA 1IKYB 3RB0A 2Z30B 3BS9A 3C19A 5HMWA 2FY8A 4QCLA 4MMOA 3GB0A 1YDLA 3KLGA 4HACB 2OSQA 2EWHA 4K4YA 3KTQA 1BQMA 2GHPA 3MM9B 4OV6A 2CQBA 5HANA 3D0HE 3G82A 4TXSA 4O3QA 3IBFB 4J9MA 5BYSA 2R8HA 1VRUA 1HLWA 4KPCA 3PZPA 4NCAA 3FZ2A 4CLLA 1NCLA 3LP1B 3LPEA 5B0FA 1XJWB 2BEFA 2J7UA 2Q79A 4K5RA 3NGDA 4RW6B 3BDEA 4U7UD 2RUGA 4WFYA 5K8MA 1FK9A 2DHGA 2IMWP 4X4QA 4LF9J 3NNCA 2BR0A 4WP3A 1U8WA 2M0GB 2YX7A 4Y34A 3KWMA 1TL3B 4F4KA 3IR5B 4WK1A 2VJUA 4Q44A 4OYWA 3MOZA 3OSPA 1T05B 2MPUA 4LRAA 2R2TA 3TRGA 1TTHB 5KT4A 1U1OA 3RW6A 1JLFA 3VV2B 3AH6A 1CS4B 3MMCB 5KFOA 4KQZA 4NEZA 4LQ3A 2P9CA 1RTZA 4K4SA 3HXMA 1AROP 4M5MA 1SKRA 2GMHA 3FMBA 2MXYA 4IKAA 1NK8A 4QR1A 4ZN1A 3TUJC 2R2RA 3TZWA 1U2CA 5DQHA 2GQQA 2AYEA 3H2LA 3V6JA 1FFSB 1LWEA 1R0BG 1GXLA 2P2CB 3CD6S 2W2OP 1EKSA 1N5TA 2X3GA 3EWGA 1GMUA 1SV5A 1DRZA 2QC3A 1QVFR 1HA1A 1SJ1A 3I9V9 2C2OB 3NBPA 4DQQA 1RBLA 2RHSB 4PQAA 4DR7F 5BR8F 2YBVA 2J0WA 5GADU 2JZ5A 3EUNA 2CPYA 4DV3J 1RT7B 2A6OA 2MY7A 4IH5A 4CQ1A 3A4TA 5A76A 2XHCA 1X9MA 2AYMA 2XO6A 4YDXA 3Q8SB 2XMVA 1CG2A 5MAOA 2B9EA 4ZS6A 4OV1A 4OQJA 1M1HA 3L09A 1M5VC 5KFFA 2R7UA 4NWBA 3PW7A 1HHQA 1HNXF 1JLEA 3ENVA 3LH2S 3UD5A 5C25A 4O3SA 1CVJA 2NZCA 4UZBA 2FHMA 3HMJG 3V6KA 3OUYB 3ETMA 1NKCA 1U09A 1RHQB 2CXEA 2RRNA 2OTJS 5E3QA 5B0CA 3MM5B 1MWZA 3W2WA 2BQRA 4F8RA 4GRSA 4RL1A 2A2DA 2RKIB 1VRTB 4MFBA 2EPIA 1Y5IB 1QLNA 2N4DA 2OPPA 2W7PA 4KGXB 2NSCA 3DXSX 2VFRA 2IM1A 4M8LA 1RT2A 3IR6B 4I67A 5T14A 1EB0A 2QRRA 3GJSB 4PRFA 4NZ6A 2HHTA 3J7AN 3GIMA 4NLYA 1IKWB 1MG7A 1HNZF 3TA1A 4F3MA 2A6MA 4JV0A 2CNOB 4K4UA 2BKNA 1T0TV 2J6SA 5KFXA 4RO0A 1J2VA 1F9FA 3H2UB 3RBEA 1XTZA 3TZYA 3KK1A 2QMUB 2NXUA 1BMQB 3PHEA 1RKIA 4LF1A 2WBRA 3M30A 4DPUA 1VRUB 4QW8A 1WHYA 4X4RA 2V5HG 4RUCA 4ANDA 5H9FK 5JVGQ 4LSLA 2J9CA 1DAXA 1NKBA 1NB7A 3W7BA 2MQ8A 1VQPS 2BJ7A 3OV7A 2PMZD 2V63A 3IGVA 3KDNA 2DTJA 4LVOP 1JXLA 3AA9A 3RRKA 3HSDA 3NLCA 1LKZA 2CQCA 3PKYA 2FLLA 1RLDA 4A4JA 3KFWX 4P10A 2FGCA 3R9LA 1S6OA 2EG1A 4UOFA 1UCNA 3IG1B 2C3MA 2W24A 1S1TA 2DY1A 2Y1IA 5B0BA 4OHYA 4OI0A 1R7IA 3RB4A 1PIEA 4RW9A 2PT0A 4Q8EA 2RRBA 3NL0A 2XY7A 2YNIB 3H98A 4I68A 1WWHA 2L3MA 3OW2R 1D8ZA 1VLOA 2HQCA 1EQMA 1ZM3A 1W7WA 3R5AA 3LWLA 4ZLJA 3OXFA 3IAM9 2J7WA 3BKFA 4EYHB 5DRKA 1LWEB 3OR1A 2UU9F 4ILRA 3PJXA 2UXCJ 1URRA 2IC3A 4WFBQ 4LF6J 4DS5A 3GSDA 1WORA 1NK6A 3X1LB 2GIFA 2FDNA 1KTVA 4AQYF 1X4HA 3EM1A 3T6JA 4DXLA 1HKAA 2R9LA 2HFSA 3ZXWA 2CZ4A 2GIRA 4ZP6A 2QX0A 5D77A 3NP5A 1V3ZA 1E6YB 3H2VE 4X66J 3U7JA 3T6BA 3OJSA 1WELA 3A1YG 2BOAA 5KT6A 4O3OA 4JI1J 1AZSA 2VASA 1QE1A 2AKWB 1GNKA 2AJ1A 3H5UA 4PG7A 1PSDA 1RADB 1S6UA 3TR5A 2V2ZA 3UQSA 2I0XA 4QBUA 2Y1LB 3EXYA 4FYWB 2V2VA 2XMJA 2UVVA 3TJAA 3QO9A 4YB5A 3ILIA 4LIWA 1WC5A 1Q8KA 1PKUA 4F67A 4TQRA 3AOAA 3WBZA 4NLRA 5LMNF 3SSSA 4C4WA 4ID5B 5I42B 2B4PA 2ZH4A 3JQJA 2I5JB 2PDAA 2NR0A 2GZOA 2YWGA 4O23A 3OFFA 1RA7A 1UVNA 5J1NA 3C2PA 2CNNB 4DF4A 1RWNB 2LA4A 2HAFA 3SZ2A 3GR0A 3DLBA 1ZPVA 2NPFA 2BW7A 2E5GA 2OEKA 1IWAA 5L1KA 1EP4A 4R25A 2ASLA 2EEYA 3MEDA 4KIAA 4Q7AA 1FEEA 4URGA 3JQMA 1KQKA 4R8UB 5HVHA 3I4HX 3MD1A 1S4FA 3I82A 3M6UA 3CTRA 4EFAC 1RTJA 3AA8A 2XSJA 2CJKA 3RYLA 2BANA 2CPHA 4FXVA 2ZBIA 4OI1A 1U4BA 5KG5A 4AQYJ 4YR3A 4ECZA 4NOHA 4ICLB 1Y5LB 4J91A 1CJVB 1UVKA 3PIPQ 3W3SA 4HDGA 3RG6A 4ECUA 1U6ZA 5KFYA 1NSPA 4RW7B 3HCXA 2E5IA 5KFZA 4TU8A 4HHJA 4DR5F 3PRBA 1RAHB 5B0EA 2HHUA 6FDRA 2UP1A 4I6AA 4LVNP 4U8VA 2GGPA 3HHDA 1KTQA 1U8SA 5LMUJ 5KFTA 3KJFB 3HHLD 2GQ2A 4KHMA 4QWDA 3U1NA 3DI6A 3MFHA 1NJZA 4R0EA 1RCOB 3H5YA 1KFSA 4JB8B 4QPTA 2XMMA 2AQ4A 2V8DA 4N5SA 1JX4A 5KFGA 2XQCA 4A8QA 3RR8A 1W2IA 1F3FA 4CIOA 3T19A 3C46A 4F7VA 1RTIA 2IRUA 4KB7A 3M32B 3CCES 1YG0A 3UDEA 4B3MJ 3CDUA 3SQGA 5A8KB 4P7TA 3G6VA 1CLFA 3FBBA 3KJVB 5C42A 4OYZA 3BJYA 1H98A 1SQGA 3UD3P 5HQLA 5CAAA 3BBFA 2KXFA 2OPRA 3ELHA 3X3UA 3OL8A 4DSFA 4RBVA 1M1GA 5K9FA 3AJ1A 2JRSA 5M2UA 3CGIA 1U25A 3M4XA 4QPXA 4AD6A 3LUYA 5M2RA 1VRQC 4TY8A 3EGNA 2AT1B 2YWEA 1SJFA 2R3VA 1MMLA 4RW8B 1I1GA 3ENWA 3N5FA 4KKOA 1RYRA 3CD5A 2ZH8A 2AV5A 1RQ0A 2J9DE 1HNIB 5E3AA 2XG8A 4ZLLA 4DR5J 4LMZA 3P4UB 5BJRA 2BRKA 4AFFA 2HHHF 1YQHA 1WEZA 5EWFA 3DKDA 5DJBA 5CCLA 2KZZA 3UW1A 2W2NP 2HHWA 3PX6A 3BGLA 1O5JA 4DPTA 3DU6A 1WDTA 1N5YB 4JYAJ 4WP8A 1DLOA 1UJ6A 5G0RB 2X7IA 4OLPA 4BBYA 9RUBA 1X4FA 4U9RA 3VZIA 1RT1A 4B08A 4DL5A 2H5IB 2R8GA 1TQLA 1TFWA 2AHOB 1UEUA 2VQFJ 3KG1A 4ELUA 1FO1A 4CLWA 1XMBA 5L8RC 5D4NA 2VH7A 1M5HA 1C4CA 1NO8A 2XBPA 2WHOA 3CJ3A 5EWEA 3D54A 2JEIA 3QRRA 4ZIWA 1Y11A 4L74A 1WKJA 4X84A 3R8YA 3AD7C 2R7QA 4P7VA 3M7VA 2HQIA 3BEGB 3JAMU 4B3RF 4I56A 5HSPA 4HYKA 4TU9A 1RU1A 2XMUA 3C6TA 3IRXA 3DMJA 1QJHA 1K9MT 5KG4A 2YKOA 3BGUA 3DM2A 2LDYA 3LP2A 1Q5VA 3I5CA 1MU2B 1WHVA 2AZ3A 5K14B 2D7SA 4FF1A 2R7XA 5GAEI 3O2IA 4ANEA 3GJTB 1JLQB 4DZDA 2EFGA 1SIWB 1FVQA 1UVMA 4DFJA 3DYAB 1S9EA 3QJJA 1XC9A 1FRJA 2Z4PA 1VHIA 2CJAA 2QLXA 2XLIA 1S1XB 4HHUA 2MSTA 4USMA 4UY8T 3BN7A 4FXWA 4LT6A 4M5KA 2CA9A 4RUHA 3RR7A 3MR7A 3OTCA 5FDLB 2G4BA 1K1SA 3GQCA 1RHUB 5IZHA 2CRLA 3TVKA 4CLYA 1TV6A 3OR2A 1HD1A 1KC8T 4KO0B 4ZPBA 1N8RT 4EEYA 1ZETA 4RNMA 2YWKA 2CNKB 1XR7A 4ED8A 2BQUA 4PQUA 1BWVA 5EGYA 4NZ7A 2HHHJ 1E6VB 2RQKA 3A8EA 2MQQA 1S1VA 3PYEA 2FHOB 1YBUA 1P8GA 1TL1B 2QN6B 3I4PA 1I94F 1UWBB 3I0SB 3TA2A 4WTYA 2ZZTA 5AXMA 2VQEF 2QLBB 4TVAB 3RAMA 4OHXA 5LXYA 2EBEA 4Y00A 2CJ9A 3FNNA 1OQ3A 2VDIA 3OQ2A 4FF4A 4G1IA 2MEWA 2DR7A 5F8IA 1OYEA 3D67A 3MMJA 1RTDA 3JSYA 2JLEA 1IBMF 1QSSA 1QVGR 2QJ3A 2RNEA 2VJVA 2YKMB 1T9WA 2KFZA 3S01A 3GP9A 2UUTA 1TK5A 2KFYA 2YKNB 2CG4A 3O5TB 1S59A 3C15A 3N5BA 1TVRB 1UVJA 5GAHI 1AA1B 3TP2A 1TMMA 2ZD1A 4DL2A 2N82B 2ZH2A 3EXCX 3KLFB 2PD1A 2J7KA 3IMQJ 3EGWB 3QFWA 1J5OB 1D0EA 1VQ6S 1SC1B 2CQHA 1MROA 3PHTA 4E0DA 2OD6A 3G6YA 1HWUA 4WE1B 1QAXA 4NLQA 3CCSS 2PI5A 7FD1A 4EK2A 1PJ6A 2J0QD 4KKOB 3T1AA 3RBDA 4ZVSB 3G71S 1Q53A 4QR0A 2XY6A 5KG7A 5ETPA 3N6NA 3CJ0A 5KFKA 2VICA 3WZ0A 4N76A 4ZVOB 3BF4A 1GH8A 1SKWA 3MUMP 3NAHA 2ADCA 1NUEA 4DQRA 4M5JA 4ZPAA 5CCMA 5ETOA 4O44A 5KFSA 2KTQA 4J37A 1XMOJ 1RT5A 3M2UB 4DX6A 2F5GA 3P3DA 5HK4A 4FXDA 2XSFA 3MMBB 1WEYA 1IKVA 4DPOA 3L9ZA 5BYRA 3KYLA 2I6WA 1X0FA 4UOHA 3NEKA 1UJ5A 2Z57B 3M8YA 2OJ3A 3R3TA 4C97A 2DCLA 3QT8A 3QT7A 1BE4A 5EN1A 1AW0A 2E1AA 5J2MA 5HN0A 3G4SS 5HLFA 1WG1A 1L5UA 3SI8A 1NMEB 3D0GE 3TUIC 1VQKS 5AXNA 4L73A 1S1WB 1S6QA 1U1MA 3GIIA 4I2PA 4DUYF 4N8NA 5J2NA 1MMNA 3Q83A 1TK0A 1NPRA 2WSEC 4DR2F 1RT3B 3P96A 3RUBL 3QZ7A 4FBTA 3KHRA 4PABA 2VA3A 1SL1A 2XB2D 2B7CB 3CSKA 4Z7YA 1LW2A 3HPOA 2DXEA 3A13A 3GYGA 5ETVA 2R7RA 1VQMS 1TL7B 3MM6A 3DN9A 2DH8A 2APOA 1JB0C 2VG6B 4NLVA 2RF2B 3HHLC 4PG8A 1GMVA 2QMWA 5HBMB 1RWWB 5F0WA 2R4FA 1U24A 2NUHA 3K5NA 3HD2A 4EGLA 2OPSA 3ZC4A 2JC0A 1TKTA 3OR2B 3V81A 1N33J 2B7BB 5CQGA 2R8KA 2BJ3A 3AB2B 4LR8A 2FLNA 2J76E 2CPFA 4OZ2A 1UFKA 2ZZNA 4C98A 4K2JA 4HH0A 1NSKL 6FD1A 3LTOA 3IM9A 1C1BA 1DFDA 1N5QA 2VFSA 3HHEA 2YWWA 2NYIA 2DHAA 3JSMA 2FLPA 2UXDJ 1FTRA 2B6AA 1TU0B 4KV8A 1SCJB 3W8GA 2NCKL 2VDHA 4F4XA 1HI8A
chains in the Genus database with same CATH topology
4LSNA 4DL4A 4OHZA 2DIVA 2ZJQQ 2GCFA 2X1FA 2F9JA 4OI6A 4K2XA 3PW4A 5HP1B 2V8GA 1B0PA 2L9WA 2ZBCA 4EBEA 3RTVA 1DTQA 2R7WA 2IVYA 3U1MA 3Q8PB 1AXQA 2I38A 1CC8A 2HFNA 1REVB 3CCWA 4ALZA 2BW2A 2DGVA 1YJTA 5A0YA 1QUPA 3GV7B 1F2GA 2MHEA 4H4OB 2J6TA 2HLTA 3U02A 5KT3A 2R2SA 4DV2F 4RZRA 1JK9B 2VG7A 2XWXA 4DL7A 2DNQA 4C3KA 1PILA 4OX9F 3BSAA 4HDHA 3D1HA 5J1EB 2GMLA 4NA2A 2EC0A 2YTCA 1TP7A 4JOUA 2OPQB 3KLGB 3PO5A 3AAWB 2YNHA 5J2PB 3GV5B 1DQ8A 2BE2A 3UR3C 4H4MA 2JC1A 3CIMA 3F73A 1N32F 1F5AA 3PXGa 3TVZA 2BM0A 3ZZTA 3V6DB 3Q0AA 4M95A 2HGNA 1BQMB 3M2UA 2N3OA 5CYQA 4DV4F 1A7GE 2LCWA 2M3DA 5F9NA 5KG0A 3HDSA 3MEKA 1HARA 3K8WA 3EPIA 2CQ4A 1JXEA 2OKQA 4O4RA 3MXHP 2YWHA 3BREA 4KE5A 3MMBA 2POKA 2J0XA 1WNEA 1N48A 2EFPA 1BD6A 3OJUA 1VBXA 1S1UB 3HHLB 4DR1F 5GVQA 5L1JA 3I6PA 2SXLA 3N28A 2DVIA 2YH1A 4FP9A 1S0OA 2DITA 1CSJA 3AHPA 1XNRF 2IMOA 1X9SA 4F4ZA 2D3UA 2V2KA 2BQ3A 3O1LA 3I5BA 5C24A 3UCGA 1H2VZ 2YNFB 4WFAQ 1D8YA 2BYCA 3I31A 4CI0B 2VPWB 3CD0A 1C1CB 2K8GA 3SMZA 2N3LA 3LOUA 4CO3A 1VQ8S 4X4NA 3KKFA 1SQEA 3KLVA 1S1WA 1S48A 2JFDA 2DNRA 2CYYA 3H40A 2PA3A 4YB1P 2CZVC 5DQIA 2JLFA 2AYBA 3POTA 4OI3A 1FCAA 3N0VA 2XCPA 3DRPA 4ZK7M 4P2SA 4AL5A 1FK9B 1S9GA 2ZHOA 4URQU 3I9ZA 2DH9A 3GE9A 5L9XA 1YITS 3M1VA 3H4DA 4IUFA 2E1CA 2ZH5A 2C42A 1WG4A 3FDSA 3M8QA 4ZCKA 3KNGA 2DNNA 2ZKTA 3DRRA 5EWGA 1U1KA 3OL6A 2I8EA 1RT3A 5AXLA 3THTA 4Y28C 1N6QA 5D8HB 4K5SA 1V3SA 1VK8A 2VKZG 4FVMA 2JLGA 4RKUC 2FPHX 2JL9A 4ES2A 1RYSA 3MD3A 4QQBA 2NZ4A 2CQ3A 4DV0F 2ALZA 1K0VA 3H8YA 2E1RA 3W2VA 3BGRA 2XGQA 5DLGA 4OJ1A 3IAS9 1H3DA 1OSDA 1LWFB 4P6QA 3GYNA 2EW9A 1JLBA 4CTAB 1FHTA 2UV8G 1VQSA 3J7ZT 3M8SA 3OL7A 3IWNC 2R7SA 1O8BA 2HNZB 1TUVA 2E5JA 3QIDA 3CC4S 3ZZUA 4ES3A 3MM8B 4WCEQ 5CYMA 5KTQA 3DRSB 3HKWA 3TVYA 4CO5A 2KM8C 1WF0A 2WONB 4C11A 1JLFB 2MYFA 1RT5B 3O6QA 4DSIA 3PKMA 2DR5A 4BDPA 1BC6A 4LFAF 1FKAF 2DJWA 2JHEA 3FZBA 1R27B 4DUZF 3T5HA 4RU2A 1K0TA 2J0SD 1SJ3P 2FJBB 1S77D 2EK1A 1UETA 4MIAA 4MKBA 4QOTA 2NUUG 1MWYA 1C0TB 5D78A 5FD1A 3V4IB 1JJ4A 2FVCA 3EX7B 2C3PA 2IA0A 3CULA 2VG6A 1VS3A 3CCVS 4AYBD 2DNGA 2RF2A 4ED2A 3KMSA 5HBMA 2HHSA 3B4MA 5LJ5Y 3H59A 3MURP 1ZOTA 2FHJA 4ECTA 1IQTA 5B0AA 3NCQA 5KOWA 4DR4F 2M8HA 2HW3A 2KXHA 2MZJA 4XO0A 1VBYA 2CQ0A 1FE4A 2PO4A 3JB9k 2VOOA 3S1TA 3DU5A 1KVIA 3MF5A 5KFJA 2W9CA 3ITHB 2UZAA 3HFKA 4H54A 3P5TL 5L9NA 3D2WA 4PXCA 5A8RB 4ELTA 1VQ7S 1NK5A 4HKQA 4U67Q 4OHVA 5SUHA 2X1AA 2AX1A 5T41A 5FIIA 1S0NA 4TYAA 1S10A 4DQPA 2UV8A 3OTDA 1S0MA 3DDKA 1XMOF 3B82A 1U6BA 1KFDA 1YJVA 2NPIA 4Z2XA 1LW0A 2ROPA 4YUDA 1SUQA 3MM5A 1X4BA 4IG3B 5B7WA 3UR0A 1BGXT 1NKEA 1G1XA 4AUKA 4N41A 2JWNA 1Y7PA 2ZOMA 3K2YA 4KBIA 1AFIA 4M1KA 2E9RX 2VBYA 3IS9B 3NCRA 2VA2A 5GAHU 2F9DA 3CF5Q 1G3OA 3OTEA 3EPGA 4C8LA 3HI9A 2B3TB 3G9CA 3M8PB 3QGGA 5C5JA 1SV5B 5DDPC 1WACA 2JVOA 4UQTA 3QZ8A 4O4GB 2QA4S 3MI7X 1R8AA 1N0VC 3IGNA 4LF4F 3VAFA 1FKPB 2M5YA 3UCZP 1ZAVA 4ZVEA 1DTTA 2MJNA 3MEEA 4F25A 3E8OA 4YFUA 2IVMA 4TNOA 4N56A 2GC8A 1RT4B 3NBPB 2ACYA 2VKRA 4OI4A 2K3KA 2HWHA 2QSFA 2ZH1A 4DL6A 4ZCMA 3BO3A 4C8KA 5THWA 1U1NA 5HP1A 4OZLA 3IWLA 4NLUA 4BHQA 4YOEA 3SXLA 3CPWR 1VBZA 2KDOA 2ILYA 1RT6B 1N0UA 2C2RA 3DLLQ 3M2RA 3OLAA 5B09A 1HBOB 3ETOA 3CCUS 4FS1A 1REVA 4ED5A 3R5CA 2K3IA 1IKYB 5KFQA 1HQEB 4ZLPA 3CCLS 4I4BA 3RB0A 4H4OA 3JSBA 1HL6A 4MYUA 3CCMS 3BS9A 2GIQA 1XR6A 3IC1A 3MFIA 5HMWA 2GHVC 3PV8A 3EGZA 3MM7A 2VPXB 4PG6A 4C3MA 4QCLA 2BBEA 4FNHA 1RP5A 3NG8A 4EWTA 4F3QA 3AY0A 2VBZA 4MMOA 1U49A 3PY8A 3GB0A 5J1EA 2KM8B 5IWAF 4HT7A 2OPQA 4NCGA 1X4EA 3KLGA 1KQFB 4CO0A 5DG9A 5J2PA 3HX9A 2HIQA 2OSQA 1FDAA 3UDLA 2XS7A 2GFFA 2V4JB 1U6FA 2Z8QA 2EWHA 2HFOA 3AQOA 3QLHB 3V6DA 4K4YA 4ERDA 3V5RA 4C3LA 3KTQA 1BQMA 2GHPA 3MM9B 2MQPA 1AUDA 2CQBA 4CO1A 5IQQA 4EZ9A 1JLEB 2LYVA 3K7RA 1HWJA 2DISA 4QWCA 3D0HE 1N5VA 4GC7A 3QGHA 4TXSA 4O3QA 3TAMB 5C25B 2VPZB 3KLEB 5HQ8A 1D3WA 4J9MA 1S1UA 3HHLA 1H7WA 1ZTWA 3NCPA 4B02A 3S7RA 2KVIA 3MAQA 3CDBA 4YP3A 5BYSA 2R8HA 4ZA1A 1VC5A 3PJWA 4MKAA 1VRUA 2D9PA 4USIA 4A8MP 3M9MB 2ZHAA 1LXJA 3W2WB 3PZPA 2XC9A 1XR5A 4YQWA 1XMQF 3KK3B 2VFVA 5DM7Q 3CDAA 2FC9A 4NRTA 4Y2KA 4ECSA 2HVZA 4NCAA 3FZ2A 2YNFA 2RH3A 4MFBB 5M2PA 2XWYA 3LP1B 2PFFB 2QA4G 2ROEA 5KAKA 5IT9Y 2X1BA 1OO0B 3PRDA 1C1CA 3T1HF 4WFZA 1FJ7A 1UP1A 4WU2A 5B0FA 1X8DA 2OPPB 1FTCA 2J7UA 3MR5A 2Q79A 4K5RA 3NGDA 1S0VA 3CVKA 5D4OA 3OSNA 5KFUA 4I1TA 2D9OA 4RW6B 3PDNA 2XULA 3BDEA 3Q8QB 2ZHBA 4NYOA 2RUGA 4WFYA 3UFCX 1LV5A 3Q23A 5K8MA 2IRXA 1RT2B 3SCJE 1FK9A 1TKXB 2DHGA 4IO9Q 2RU9A 2FLOA 1HPZA 1HNVA 2IMWP 4X4QA 2B56A 1U1QA 4ZHRB 1N33F 2AD9A 1A9NB 4KGKA 1S97A 1APSA 2ZH9A 4HLBA 4IFVB 4W92B 3NNCA 2BR0A 1NJWA 4QU6A 2R2UA 3FQLA 4DOZA 2V0NA 3MDFA 2M0GB 2YX7A 1DTQB 2M52A 4Y34A 3KWMA 1Q81T 1TL3B 5KFVA 4X2BA 2HVIA 2QIFA 4HT5A 4F4KA 1VLYA 2RSQA 1LWFA 2YH0A 3IR5B 4KT0C 2VODA 2ZOGA 2XNQA 4WK1A 4DV1F 4PCQA 2OMOA 4CTAA 2U1AA 4MH8A 2HVHA 4Q44A 2HNZA 1DJ0A 3MM8A 4ETXA 3MOZA 3OSPA 1T05B 3DRSA 1LFWA 2WSFC 1KD1T 2MPUA 5KFDA 1JNZB 2R2TA 2IM0A 2WONA 5CZXA 3TRGA 2RD5C 5KT4A 1U1OA 3RW6A 1JLFA 4IQXA 2W8KA 2UXDF 3AH6A 4TLQA 3PR4A 3M6XA 2IJNA 5CYQB 4OZ0A 5IM0B 1U48A 3K5MA 2A1BA 3PVXA 3KK1B 4A46A 3NNHA 3MMCB 3N4WA 1HFEL 2O66A 4PWUA 5KFOA 3PW5A 4KQZA 1QY7A 1T94A 3I0RB 4DS4A 2VUGA 3V4IA 1C0TA 1SBRA 4QWEA 4LQ3A 3TAQA 2P9CA 3M05A 2B5JB 2AWZA 2DHSA 2HS0A 4K4SA 2MKSA 1S99A 4RWXA 4YY3F 4U7CA 4AE5A 2I9SA 1AROP 3HXMA 3M30B 2OFGX 5I4MA 4Q2MA 3GWCA 1SKRA 1WG5A 1XEZA 1M5SA 4QIFA 1GQEA 4RBTA 2YQ3A 3QGIA 2GMHA 4D3GA 1T02A 3H25A 5H9EJ 3I56S 4W90B 4I64A 4IRCA 3FMBA 3FMWA 1NK4A 3E3XA 1WF2A 1R43A 3ITHA 2MXYA 4IKAA 1NK8A 4QR1A 4ZPTR 2ZKUA 4LSLB 5A8RA 4IRKA 1FRIA 1H6KX 3CCTA 3TUJC 2R2RA 4ED0A 4I6WA 3GFHA 3WX4A 5KFHA 3IXQA 3RU0A 5DQHA 3I5AA 4BS2A 2GQQA 2AYEA 1CC7A 3RB6A 3H2LA 1GXTA 4YR0A 4I7FB 3Q22A 4IG0B 4WYLA 3UE2A 3V6JA 4OX8A 2W7OA 1LWEA 5DDQC 4R5PB 5KG2A 4IG3A 4X4OA 3J81Y 2LKZA 3L7PA 1NH7A 2RQCA 1NK7A 4IRDA 1GXLA 2KT3A 4A8SA 3PNIA 3CD6S 4JI3F 1KLMB 3HK2A 3ULHA 1N5TA 1V9OA 1S9FA 4XK8C 1JLCB 2X3GA 1M1KT 1N56A 3F44A 1NHUA 2MKHA 3M8PA 3OFEA 4UOCA 4Y2AA 3VR1A 1SV5A 4ED3A 2DBBA 2VL1A 1DRZA 2IAJA 1R3NA 4O4GA 1JWWA 2JEJA 1YJWS 5KT5A 1QVFR 3OVSA 1HA1A 1M0SA 1FKPA 3EZUA 5CHCB 4ES1A 1SJ1A 1DURA 1WEXA 2IHR1 3I9V9 2FIUA 2X1GA 2E1MC 1NRKA 3NBPA 2IRYA 2KH9A 4DQQA 2ABYA 3ZZYA 4PQAA 2RS2A 1K73T 4HEA9 4DR7F 4A8KA 4QJVA 2DGOA 1V6HA 4KJIA 1FRLA 2RDJA 3BGFA 2XLJA 5BR8F 2ROGA 4IQMA 2M4MA 2QYCA 5CYJA 2MQOA 4WXWA 3KHHA 3G86A 2BM1A 1RT6A 4J9QA 1VFJA 3DRYA 1T7PA 2OFHX 1HBOA 2J0WA 3S6EA 2KHDA 2DNHA 2MZRA 2JZ5A 2YWFA 2DNLA 3EUNA 1YSJA 1IKYA 2CPYA 1HQEA 3EYZA 1T03B 2LXUA 2NS1B 1FJGF 1RT7B 5JXSA 2I2YA 2MY7A 2MSSA 2V8VA 2W4PA 5DETA 5KFEA 1S72S 2OIHA 2JJ4D 4IH5A 4CQ1A 5EDWA 1S1TB 2MQNA 3SV3A 2V94A 5KFIA 1JIHA 4XDDA 1MMDA 1XK8A 5E41A 3VALA 2HZCA 3G8QA 3CJ5A 1X9MA 2AYMA 4PXBA 3Q8SB 4YDXA 2E7XA 2MMYA 4LIRA 4D3HA 1UL3A 4Q2LA 1Y9OA 2XMVA 1CG2A 1NJXA 5MAOA 4WIIA 4RW9B 2V4JA 3TUZC 1LFPA 4ZS6A 3QLHA 4OV1A 4OQJA 4DSEA 3TW0A 2QA2A 1X0PA 3L09A 4B17A 1M5VC 5KFFA 3MM9A 3GYXB 4NWBA 3PW7A 2R7UA 3MZIA 4G1QA 2KXNB 4YDDB 2PSZA 3RRHA 1HNXF 4LF5F 4J9KA 4WU3A 1JLEA 3ENVA 3LH2S 3FEXB 3C66A 3TAMA 3TANA 5C25A