1IKVB

K103n mutant hiv-1 reverse transcriptase in complex with efivarenz
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
423
structure length
404
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords POL POLYPROTEIN
total genus 97
structure length 404
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikvB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvB03
1IKYA 4B3OB 3GV7B 4XPEA 4H4MB 4NRUA 3HKWA 3MECA 3IS9A 2V9WA 4EO6A 2YNHB 3LP1A 3IRXB 2YNGA 1RT2B 3DRSB 2FVQA 3IGNA 4NLVA 3KNAA 4WZMA 3KHGA 3KHRA 3T5JA 3I0RA 4IOBA 1QE1B 3KHHA 5L1JA 1RTJB 2W9BA 1JLBB 3MR3A 5F9LA 3PVXA 5FDLB 3C6TB 2B43A 2JEFA 5J1EA 3OL9A 2W7OA 4KKOA 4PWDA 3ICLA 4LQ9A 2HNZB 1NHUA 2F8EX 2ASLA 3PR4A 5KG7A 4LSNA 1KLMB 4Y34A 3KLGB 1D1UA 2WK4A 4URGA 5KFWA 3QO9B 1S9EA 4Q0BA 1TV6B 4IG3A 1EP4B 3BGRB 3C6UB 3M8PA 3MEDB 1N5YB 4OL8A 3H40A 3KHLA 2AGOA 1C1BB 1S1UB 5DGBA 3DOLA 5I3UA 5J2NB 3KJVB 2FVSA 3MFHA 1N6QA 4EBCA 5EWGA 3RAQA 2BR0A 4LSLA 3PW7A 1TL3A 1HQUA 4J9KA 4QWAA 2E9RX 1DTTA 5DQHA 2BQRA 4IH7A 1TP7A 5F8GA 1RT1A 3QIDA 1HPZA 1FKOB 1VRTB 1JX4A 5DQIA 5F8HA 4ECTA 4WFYA 1JLAA 4IKAA 4RNOA 1HQEB 2VG6A 4O3RA 4QW8A 5KFZA 1IKXA 3DLGB 4ZMMA 3FDSA 4TQSA 3V6KA 1RTIB 5D3GB 4PQUB 3CDWA 1OS5A 3MECB 2BANB 5KT2A 3MEDA 4B3OA 4Q8EA 1C1BA 1S1UA 5L9XA 2AX0A 2D7SA 4ED7A 4URQU 1TKXA 1ZETA 3DDKA 4ID5B 2R8IA 1JLCB 4WE1B 1UWBA 4O3QA 2AGPA 4ED2A 4J9LA 3PW2A 3SFUA 1QAIA 2UUTA 5KFPA 4ECYA 4DL4A 3UDLA 4PWDB 4NYZA 1BQMA 2BE2B 1LW2A 2WOMB 1YVFA 4IQXA 4DG1A 1EETA 3QZ8A 1W25A 1C0TB 1JLAB 5HLFB 3QLHB 2ASDA 2VG6B 1RA7A 3RB4A 2IA6A 4RNMA 1RT6A 4DL7A 3GIIA 4H4MA 2C2DA 4U7CA 2ILYA 5KG5A 2V0NA 1REVA 3LP1B 4RW9A 2IM3A 4FBTA 2UVWA 2YKNA 2AGQA 1N6QB 5KT4A 4ZP8A 1JLFA 1S1WB 4IG0B 1IKWA 1C1CA 1SUQB 3BSCA 3OHAA 3E01A 3ISNC 4K4TA 2R2UA 4O4RA 4KO0B 4ZVFA 1DTTB 2D3UA 4NLOA 3D28A 3M8QB 2V4QA 4RW6B 1BQNA 1R0AA 2HAIA 4MKAA 5KG4A 5KG3A 4IRDA 3V6DB 2YNFA 4KKOB 4URSA 3LP0A 4ZHRB 3DI6A 3KLFA 3M9OB 4K4WA 4DL6A 2OH2A 3BQ0A 4WYWA 3OLAA 2RDIA 4MIAA 1KLMA 3QO9A 4RW7A 2ALZA 5F8NA 1TV6A 2IJNA 5JUMA 2VG7A 3GV8B 3JSMA 4Q8FA 4QWCA 3MTKA 5CYQB 4HKQA 4J9QA 5C24B 1S1TA 2XGQA 2D3ZA 3GV5B 4F50A 3NKYA 3Q8SB 3GILA 2R2RA 4ZP9A 1RTHA 4ECZA 4NRTA 3FSIA 1T05A 4ICLB 1C2PA 2UVRA 3DYAB 3LALA 3RAXA 4JV0A 3V6HA 2ZKUA 3DMJB 1JXLA 2BRLA 3DLGA 5F8IA 3Q8QB 4KB7A 3HVWA 2IBKA 2JLEA 4ECRA 1U09A 2FLNA 2JEIA 5L1LA 3MF5A 4R0EA 1LW0B 3Q8RB 3DLKA 1K1SA 4RW9B 4YMEA 1C0UA 3KLIB 4ZPCA 2WTFA 4FS1A 2YKNB 1RA6A 3UR0A 4H4OA 4KV8A 3MEGB 4IDKB 5C42B 1IKWB 1JKHA 4IG0A 3V81A 4JUZA 4NLSA 5KFUA 4F4WA 1S6QB 1S1TB 5DQGA 2IAJA 1S9GA 3IG1A 1RT3B 3H59A 3DLEB 4NZ0A 2CKWA 3V4IA 2FLLA 4EEYA 4IFVB 1S1VA 5KT5A 3H4DA 3H5UA 3IN5A 1BQMB 4NCGA 3KLEA 3DI6B 3KLFB 1N56A 2R8JA 3EPGA 3RB0A 4F4ZA 4O3PA 4QW9A 3DM2A 4EYHB 3I0SB 4ZPDA 3H5YA 4RW8A 3D5MA 2OPRA 3KLGA 2IM0A 4K4ZA 1S97A 1S9EB 4J9PA 2IC3B 3CIZA 3ISND 2RF2A 1MU2B 3E51A 3EZUA 5KFMA 5EUHA 4ZPBA 5KFLA 3DOLB 3PW5A 3JYTA 4YR0A 4K50A 4R8UB 5HBMB 4Q44A 3BSNA 4G3IA 3KLHB 2XI2A 5KFTA 1QE1A 4YR2A 5L1KA 4Y3CA 1TL1A 4MK7A 4O44A 5KFXA 4G1QA 3HVAA 4NLPA 4J9MA 4I2QB 4DL5A 1JLGB 1HNVB 1LWEA 2QE5A 4KAIA 5KG6A 4TN2A 4K4UA 3ITHB 3BSOA 3DRPA 4KE5A 1IKYB 5J2PA 2UVUA 3IS9B 3C6UA 3MR5A 1LW0A 2ZE2B 5HROB 2RF2B 2W8KA 4MIBA 4K4VA 3KJVA 1I6JA 2V4RA 4H54A 3H4BA 4KHMA 3DOKB 3T5LA 2XWYA 3CDUA 3QYYA 2HMIB 2D41A 5KFDA 3OL8A 4KSEB 4IRKA 4RUCA 1NNDA 1S1VB 3PJXA 3V4IB 4IFVA 3VQSA 5J1EB 5K14A 2HNZA 4J9OA 4QPXA 4HYKA 2WOMA 1HQEA 1HNVA 1JLGA 1FK9A 5DG9A 4YP3A 1IKVB 1TKZA 5J2QB 3MEEB 1S48A 3DRRB 1HARA 3H5SA 1VRUB 3RB3A 5DG8A 3DLKB 1HYSB 4PUOA 3NGDA 2IC3A 1XR7A 2W8LA 3EPIA 3Q8PB 4ZVGA 3HVTB 3I5CA 2RDJA 5J2NA 5JXSA 4GC6A 1JLEA 4I2PA 5I42B 4RU9A 3HHKA 3PJWA 4IH5A 4O3OA 1TKXB 4R8UA 4Q43A 2C2RA 3LAKA 1WNEA 4ID5A 2FJXA 3CJ3A 5HBMA 3M9NB 2EC0A 3PZPA 1JIHA 4TYAA 2WONA 4RUAA 3CJ2A 2J6UA 1S0MA 2XC9A 3LP2A 3TAMA 3UPFA 2J6SA 2AU0A 2C2EA 3FRZA 1T3NA 2RKIB 3NBPB 1FKPA 2OPSA 1T03B 1XR6A 3DM2B 4DL3A 3T1AA 4EBDA 4TY9A 1RT5B 2OPRB 4IH6A 1FK9B 3N6LA 4NLTA 2B5JA 1TKZB 5J2QA 3GIMA 5KFOA 1REVB 2VG7B 4O4GB 2I1RA 3T19A 2IM1A 1TKTB 5KG0A 1K1QA 2JEGA 1LWCA 4J9NA 2ATLA 1Z4UA 3KOAA 1RT2A 3DRSA 1S1XB 3OSNA 2WRMA 1DLOB 4ECVA 4J9SA 4ZVEA 3M8QA 4ZP6A 5KFFA 4RW6A 1R0AB 2AWZA 3GIJA 3CJ5A 4ECQA 3QGGA 2R8KA 3TAMB 2QV6A 4ZVHA 2OPPA 4ICLA 5KT7A 3NBPA 3LP0B 1HNIB 4ZHRA 4WYLA 4ECUA 2HNDB 2IMWP 2E9TA 3DRPB 3G6VA 2VG5B 2XCPA 2OPQA 2W9CB 5DG7A 1RT6B 4RNNA 1HYSA 3KK1B 4IG3B 3JSMB 4M95A 3NAHA 1VRUA 5KFVA 3SFGA 5KFQA 3HVTA 4PUOB 2C22A 2VA2A 4O4GA 5KFGA 2WHOA 3NAIA 3BQ1A 4NLWA 4F4XA 2ZD1B 3I5BA 5DLFA 5EWEA 2BQUA 3PHEA 2YNGB 3MEGA 4IDKA 1IM4A 3FQKA 4IFYA 1RDRA 5KT6A 1S6QA 4ECSA 4K4YA 4NLXA 1DTQA 5C25B 2ASJA 3V6JA 3TVKA 3NMAA 4ZPAA 1JLQB 2GC8A 3I0RB 4DEZA 2B6AB 2W9BB 4ED0A 4FBUA 2UVVA 2W9AA 1J5OA 1S4FA 2GIRA 5K14B 3SI8A 2YNIA 3OHBA 5T14A 2GIQA 1GX6A 1S9FA 2AQ4A 1HNIA 1S6PA 5F8LA 4Y2AA 5KG1A 2VG5A 4Q0BB 1EP4A 3M8PB 1N5YA 1RTIA 5D3GA 3I5AA 4KBIA 2DPJA 4TXSA 3KMQA 4TLRA 4YR3A 2FVRA 4WFXA 3KK2A 1T94A 1JLEB 4I2PB 5I42A 3CWJA 3BQ2A 5C24A 3H5XA 3BSAA 5KFBA 1LWCB 3FFIB 1DLOA 1SH0A 1JKHB 1S9GB 3CDEA 1S1XA 5KFNA 5KG2A 4IFYB 4XO0A 4NLRA 4ECXA 1RTJA 5DLGA 2IM2A 2R8HA 1JLBA 1JLQA 2HWIA 3G86A 3MR6A 5FDLA 4NCGB 3KLEB 1RT1B 2HNYB 4O44B 1QAJA 3CO9A 4NLUA 5KFKA 3T5HA 3RB6A 3KK3B 1LWFA 1HPZB 1VRTA 2W7PA 1LW2B 1RT5A 4DG1B 3GQCA 1EETB 2VA3A 4WXOA 2OPQB 2B5JB 4TY8A 5KFAA 2W9CA 3KK1A 1GX5A 3KMSA 4JV2A 4ED6A 2J6TA 3FQLA 4EYIB 5KFYA 1C0UB 3KLIA 5J2PB 4WZQA 4QWDA 1MU2A 4EO8A 3PR5B 5HROA 1RT4B 4J9RA 3KK2B 2I5JA 4IRCA 5DGAA 4RNFA 4ZP7A 3KLVA 1TVRA 4MFBB 1S1WA 2UUWA 1DTQB 1D0EA 1SUQA 3TQ1A 4WE1A 4IR9A 2JC0A 5F8JA 5HP1B 3BJYA 1TQLA 5C25A 1SV5B 4KFBB 4MKBA 3M9MB 2B6AA 4G1QB 3N6MA 1FKOA 2HNYA 5KFEA 3BR9A 4I2QA 1KHVA 1RAJA 2YNIB 1RT7B 4RW4A 1S49A 4Y2CA 3RBEA 4I7FB 4O3SA 2E9ZA 1C0TA 5HLFA 1CSJA 3MR2A 2JEJA 2DPIA 1IKXB 3G6YA 2FJWA 4RW7B 4K4SA 2WB4A 3DRRA 2YKMA 2FLPA 5J2MB 4K4XA 4ECWA 1S0OA 4O3NA 3RBDA 2ZD1A 2ZE2A 4F4YA 3JYTB 3CVKA 2XGPA 2YNHA 4NLYA 4JV1A 1RT4A 4EBEA 1JLCA 1JLFB 1UWBB 1TVRB 3N6NA 3UQSA 4KO0A 1C1CB 3H2LA 3DOKA 3E01B 2BRKA 2HMIA 5KFHA 3PW0A 4R5PA 1RTDB 1HMVA 2WONB 1J5OB 2JC1A 3CJ4A 2YNFB 5CYMB 2R2TA 3KK3A 4IR1A 4DL2A 2O5DA 3C6TA 5F8MA 1QUVA 3PW4A 4TQRA 1LWEB 4RZRA 1LWFB 4RNHA 1RT7A 4RW4B 1ZTTA 4Q45A 4I7FA 3QLHA 2HWHA 2IJFA 5KFSA 3MEEA 3QGIA 3LANA 5KT3A 4NLGA 4MK9A 4GC7A 1RYRA 3NL0A 4MK8A 1RYSA 3IGVA 2R2SA 3QGHA 4ED1A 4MH8A 3FFIA 4H4OB 3IRXA 2I5JB 5I3UB 4ED8A 4MFBA 2WCXA 5HP1A 5L1IA 1TL3B 2CJQA 5KFCA 3LAMA 3OL7A 3GYNA 3LP2B 1BQNB 4R5PB 4KFBA 1RTDA 1KHWA 3GIKA 1HMVB 3V6DA 4X2BA 5C5JA 1RTHB 3DYAA 1T05B 2OPSB 1T03A 2OPPB 1FKPB 2AX1A 5EDWA 1SH3A 4ED3A 4LSNB 3QIPA 5KFIA 4KHRA 1IKVA 2XCAA 2C28A 4NLDA 3I0SA 4TY8B 3MFIA 3T5KA 4WXWA 4XPCA 5J2MA 1SH2A 1NHVA 4NLQA 4PQUA 4WFZA 2BQ3A 1S0NA 1MMLA 2BANA 5CYQA 3OL6A 2ILZA 3G6XA 3OSPA 1N48A 1TKTA 3H98A 1XR5A 4KV8B 5C42A 3V81B 1RT3A 4QWBA 3QZ7A 2IAJB 4LSLB 2FJVA 1SV5A 3KLHA 3IG1B 1HQUB 3DLEA 5KFRA 2R8GA 4QWEA 1TL1B 1ZTWA 3OLBA 4FS2A 1S10A 5EWFA 2RKIA 1N4LA 3BREA 4YQWA 5CYMA 2BE2A 3DMJA 2HNDA 4M94A 5KFJA 4LQ3A 4TYBA 5F9NA 2FVPA 3CJ0A 2XI3A 3QIPB 1S6PB 2FVCA 3ITHA 4U6PA 4RW8B 2YKMB 3BGRA
chains in the Genus database with same CATH superfamily
1PC5A 4A8SA 3GV7B 2PI5A 4WF9Q 2FZCB 3IS9A 1SIWB 1F6TA 2ZBIA 2G2ZA 2M52A 3SEOA 3IFEA 1EHWA 2CJBA 1XWLA 2XYHB 1DBDA 4LF6J 3CO0P 1QE1B 3NGUA 5HSPA 3L7PA 4LF8F 3PHTA 3R3TA 4RJVA 1WKJA 3EZOA 4NYPA 3C6TB 2JEFA 5AE3A 5IV3A 4F2RA 1CJVB 4PWDA 3BEGB 3VF0B 2HNZB 4DFMA 1NHUA 2F8EX 3QRPA 4DR6J 1K47A 1CULA 3VVUA 5KG7A 1S5ZA 2LFVA 5L46A 2UU9F 2Z58B 4IG3A 2AT1B 2YWEA 3EUNA 4JI5F 5CCLA 4A4JA 3MAAA 4FF1A 1S1UB 5D78A 2H5JB 2FY8A 1XNRF 3KJVB 1N6QA 4CZCA 2E5GA 1IBLF 1W26A 3AAWB 3BKTA 2FC8A 1HQUA 2B56A 3P4UB 1DTTA 1OMSA 3QT8A 4F0MA 2P9GA 5GAHI 5DQHA 5HN0A 1KFDA 3M8SA 3HFZB 1NSAA 2BQRA 4IH7A 1VISA 2HEKA 3NCRA 5F8GA 4ZJOA 1VRTB 1YJWS 5F8HA 1GMWA 2DGSA 4IKAA 4WFYA 1V3SA 2VG6A 1FJEB 5CD4H 1WC4A 3WHIA 3N5BA 3OR1B 3QQCD 2BABA 4F3OA 4HL9A 1H73A 2VH7A 1OS5A 1UEKA 1LKZA 4U95A 1BLUA 1YI2S 1FHTA 2FIUA 1C1BA 5M2UA 4JI3J 2W25A 2R7RA 1MWZA 1GAOA 4FDFA 1TL7B 1VIOA 2V8PA 4PXCA 2CIMA 1JLCB 1T11A 4WE1B 2HQIA 2LEAA 3S6EA 5LT5A 4X4OA 3CCJS 3HMJG 1WC3A 4O3QA 5IZHA 3SFUA 1QAIA 5A8RB 2UUTA 5IQQA 3NY0A 1WHWA 4YHHF 3QGPA 3Q24A 5JVGQ 3K89A 4C0OC 2IYGA 3AT1B 2AYGA 4NYZA 1BQMA 2DITA 2MY7A 2ZJRQ 2YKPA 1OO0B 2HQCA 1CVJA 1YVFA 3I4HX 4OX8A 4DG1A 1HNXF 4IQXA 3P45B 1EETA 1R8CA 2KJVA 1C0TB 3Q8YA 2HPUA 3QLHB 3PRBA 1HNWF 1RA7A 1WEXA 3AJ1A 4PYAA 1TUVA 1ZAWA 4NWBA 3RB4A 1DFDA 1RT6A 4KGVB 1MMDA 3TUPA 1YKWA 2OSRA 2NYIA 4I6AA 2DH8A 2V68A 4G65A 3UVJA 4QBUA 4RW9A 2IM3A 5FLXY 2XS2A 1Y5IB 4DDFA 4LRCA 1O6XA 4M5JA 3BSCA 1CQNA 3E01A 2G13A 1KBRA 2HK3A 4KO0B 1N36J 3NLCA 2VBZA 2GCFA 2MQ8A 3D28A 4NLOA 4U8VA 4CO0A 2MQQA 3N9UC 2V4QA 1R0AA 2HAIA 3QAUA 4NMLA 2ZH2A 5KG3A 4KKOB 3M1VB 2V2QA 3LP0A 1AUDA 3DI6A 4DL6A 2RJZA 3D6TB 4J5OA 3DN9A 4MIAA 3SCJE 4X64F 4DHVA 4JYAF 2LMIA 3IP0A 2F7VA 5C2GA 3QO9A 1FX4A 2V5HG 1RWMB 4XAKA 1PIEA 2DNPA 2J7WA 3OTCA 2ZH7A 1M5SA 3VCDA 1X0FA 2HW3A 4FN5A 4QIVA 4Q8FA 2PT0A 4YDXA 1D9DA 2UXCJ 2M88A 4F3MA 1R8HA 2RQCA 4C3LA 4PYDA 5D8HB 4N77A 4LF4J 1RKIA 5BXIA 5JJBA 3EYZA 1DQ8A 2H51B 3G96A 3T1HJ 1R0BG 4YY3J 2R2RA 4X4PA 5IS2A 4ZP9A 1FJGJ 1B0PA 4MIWA 1RTHA 2B7CB 1Q86T 2BW7A 2OD4A 4DV1F 3TNVA 4ICLB 1C2PA 2UVRA 1HD1A 2AEJA 2ASYA 4WCEQ 3GLJA 4PG6A 3ZZYA 3RAXA 3DMJB 4DFPA 1ZH5A 4JI1J 4LREA 5D0RA 2J8AA 1HBUA 4KB7A 2ROEA 5DM6Q 1RK8A 2GNKA 3C14A 2NXUA 3D0IE 4LRAA 5B7WA 5GADI 2LXFA 3W5XA 4TU8A 5L1LA 4ECRA 2FLNA 2DRBA 1K1SA 4ZLLA 3KLIB 4ANCA 4CI0B 4GVBB 3BKUA 3DOMA 4P74A 4FS1A 3TZYA 1QTMA 2CVEA 1NJWA 4B3MJ 5C42B 4IDKB 2ABYA 1T95A 4HT5A 2M3DA 4CLKA 4DMZA 2IAJA 1S9GA 3MMAB 4WIQA 3MM7B 4PR6A 4WTOB 3PIOQ 3DLEB 1UZHA 1TL4A 3G2XA 2GQCA 2P5VA 4WIIA 3MAHA 2HK2A 2QC3A 2XHCA 3ZNUA 1Q8BA 3NGKA 4P2MA 5GAHU 2DR7A 1W7WA 3H4DA 3H5UA 3PFOA 3DC2A 3IN5A 4NCGA 2EK6A 3KLFB 3F56A 2HIYA 1Q79A 1T9YA 3MOZA 3EX7B 1N56A 2R8JA 4DQIA 1VLYA 2PC6A 3J7Z5 1U1RA 4K5SA 2PIIA 4M5LA 2BBEA 3JSBA 3SQGB 2QEXS 1TFYA 4RW8A 4PXDA 2IM0A 3KLGA 7AT1B 1VQ5S 2X1AA 2EKNA 3MD3A 5E3RA 4OV6A 4CH7A 4DU8A 1D3WA 3NS7B 4LFCJ 2Y8WA 2IC3B 1N32F 5LMUJ 1NM2A 1N33F 4ILMA 2DNGA 4RUBA 4KC5A 2HQDA 4WKRA 2HFVA 3OTDA 1KOHA 2H4WB 1SC4B 4R8UB 5HBMB 1LFWA 1Q5YA 8ATCB 1XK8A 4Q44A 3BSNA 3QRQA 1QE1A 5L1KA 2B4PA 3R5JB 1TL1A 2MSSA 4MK7A 3MM5B 4F8RA 1UEUA 1PAEX 2DNLA 1W2IA 3R5DA 5HVHA 2A2CA 2DHHA 2BMBA 2B4OA 1QD1A 3HVAA 3MD1A 1XIQA 2RSQA 4NLPA 3NWRA 5DRKA 2QE5A 4J9MA 4KAIA 4BS2A 4DSLA 4K4UA 3GJRB 3DRPA 6FD1A 4LF6F 1SKUB 1NZ8A 4DQSA 4OYMA 1J5EF 1IKYB 1WEZA 3D1QA 2E7WA 2V4JB 1E6VB 4CLLA 1NJZA 1LW0A 2N7CA 2QL7B 3ZZPA 4Y28C 2EKYA 4DSIA 3SSQA 4DUYJ 2CNOB 3HHLB 1PJ5A 2BZ2A 4B9TA 2D41A 5KFDA 4JB8B 3OL8A 3IWNC 2XS7A 1NNDA 2BXJA 3W65A 3V4IB 3I55S 4X4UA 3VQSA 2ZUGA 5J1EB 1XJWB 3R8YA 1MN9A 3ILJA 4J37A 3X3UA 3J80U 2CJKA 3G82B 1D9FA 2COLA 3RW6A 3DDNA 1RHJB 3FSYA 3HHEA 3D0GE 4J9OA 2HVEA 1Y4ZB 2WOMA 4X4TA 1HQEA 2QMXA 1FRIA 4BHQA 4WKYA 3Q22A 3CC7S 1KNZA 1WKKA 4TLQA 5J2QB 3DRRB 4DUZJ 3A13A 1G4CA 4NA2A 3ZZOA 5IQ6A 3RB3A 2P2CB 4FYWB 3DLKB 2JDJA 1HYSB 3I31A 3NGDA 1XR7A 2Y1RI 3EXYA 3CCUS 1VBKA 2YX7A 2MKIA 3HVTB 3I5CA 2XZDB 3PYGA 3ULHA 5J2NA 3MUVP 2CWXA 3C46A 3W3SA 4OZ2A 3T6JA 4RU9A 1N88A 2CPYA 4IH5A 4ZVSB 4R8UA 4Q7AA 1TKXB 5D0GA 1ZPWX 3TEGA 4AXJA 4FF4A 1ZAXA 4ZCIA 3VZHA 2BACA 3R5GA 2C3OA 3OFGA 3OVSA 4OYBA 4TYAA 3CSKA 3DLHA 3HJVA 1XNQJ 1R0CB 3S7RA 3MM9A 3LOUA 2XC9A 2QO3A 3TAMA 4X4RA 4GKJF 1U8SA 4XDDA 1T3NA 2RKIB 2F5GA 4N47A 4DR5J 1T03B 1XR6A 4G6VB 3QT5A 4DL3A 2JFDA 1U2RA 4EBDA 2KRBA 3IRWP 2OPRB 4IH6A 3P49B 2DH7A 3CMQA 3W61A 3GIMA 5KFOA 1JJ4A 1KVIA 4PG7A 4F02A 2IRYA 2DXFA 1REVB 1APSA 2F9DA 2VG7B 4O4GB 2I1RA 3T19A 1N0VC 3K7RA 3S8SA 5IT0A 1H38A 1TKTB 1P1LA 3WC0A 5KG0A 4KPCA 5A8WA 2F3JA 1Z4UA 1NDKA 3OSNA 3KOAA 1Q4RA 2UUCJ 4I64A 1R31A 1ZZNA 2J7KA 1VQ8S 3HHLA 1FCAA 3DGPA 3ENAA 2JLFA 4ANDA 5H9FK 4RW6A 1YQHA 2AWZA 2HRTA 2MZSA 2NSCA 5K8PA 3QGGA 5I4MA 2R8KA 2QV6A 1R27B 3J7YI 2VODA 3TAQA 4ZHRA 1UPMB 2BEFA 4ECUA 2YKOA 1YLXA 4BWMA 3UE2A 4AQYF 2Z56B 5HATA 3BGUA 2UV8G 3VGUA 4OHYA 1TZ0A 2HRYA 3KUEA 1RLCL 3MURP 2JL9A 3EJMA 4AE5A 3G6VA 1V5VA 2F4VJ 2CQ4A 1M5PC 4M95A 1RKJA 3JSMB 1VRUA 4KY3A 4EGLA 5KFQA 1WEYA 1X9MA 4L75A 2NXNA 2WHOA 3BQ1A 5D4PA 1PBUA 3OW2R 2F63A 1PC4A 4OHVA 2MKHA 4F4XA 5EWEA 3PHEA 4BCAA 4IDKA 1WELA 3FQKA 1Y3KA 5KT6A 1S6QA 5I3QA 4OZLA 1FFGB 3TVKA 4ZCKA 3V6JA 5CCMA 3RGIA 1FFSB 3OD2A 1U6ZA 4FBUA 1TUGB 2FHKA 1S4FA 2MYFA 3FMBA 3AA9A 2CQ1A 3R1LA 1A9NB 2YNIA 4TU9A 2QLJB 3VGSA 2VU5A 4HH0A 2BKNA 2N4DA 4QU6A 1H2TZ 2V69A 4QU7A 4Y2AA 3MM8A 3SQGA 1U4BA 3C14B 2GVZB 2DXEA 2DNZA 4GRSA 1HBUB 2VG5A 2EBEA 4R0JA 5E7OB 4Q0BB 4B9NA 4YUDA 4KBIA 1RTIA 3V5RA 3KNGA 3FZ2A 2K1RB 1S79A 4C0HA 4TLRA 4YR3A 1U49A 2LQJA 2C42A 4YN3B 3CCQS 1JLEB 1NKEA 1IWAA 3FFIB 1VQ6S 1JKHB 1S9GB 3KWMA 3MMAA 3BDPA 5KFNA 4C8YA 5EHHA 5KG2A 1ZS6A 4QZVB 5CQGA 2RHSB 1IQZA 2RU3A 2DHSA 4ZOSA 2IM2A 1JLBA 1JLQA 5GADU 5D4OA 5FDLA 1F3FA 2WW4A 1RT1B 1OY6A 3CCZA 1QAJA 4ZVRB 1RXOB 4C98A 2ZHAA 3MOJB 2HGNA 1RACB 2B4UA 1LWFA 2DCUB 2VASA 3PTWA 2W7PA 4P71A 1EX8A 3JQKA 4UT4A 4DFKA 3IXQA 1YDLA 3CCLS 1EETB 2VA3A 3T41A 1KS2A 3GWCA 3Q0AA 2LECA 2AJQA 2QLBB 1IR1A 1X4DA 4G1PA 4KR0B 2W9CA 1YTYA 4JV2A 4ED6A 4OYAA 2XMTA 2CNNB 5GMKa 3MUTP 4EYIB 1NK6A 1X4EA 4WZQA 4PG4A 1OSCA 4JBCA 1P27B 2I5JA 2XWXA 1TVRA 4USVA 4QPTA 2IFXA 1HR0F 2W4PA 1S1WA 4JV5J 4DV1J 1QSSA 3PRVA 5HP1B 2D9OA 1SV5B 3W7BA 4MKBA 1YRXA 2HWTA 2W2PP 2QT7A 4NX9A 3R7NB 3K5MA 5B0BA 4G1QB 3N6MA 1NHKL 4YOEA 3BR9A 4I2QA 1RAJA 1RT7B 4RW4A 5ETKA 1RWUA 3U7JA 5A8KA 3UCZP 1AROP 1OYDA 3GE9A 2AP6A 1GTEA 4DF4A 1S59A 4BC9A 4YDDB 2CNKB 3MTJA 3VAJA 1GEHA 2YH1A 1F2GA 1FI4A 3DRRA 2YKMA 2OSQA 3D1OA 5J2MB 5E5NA 3UR3C 5B0EA 4JI2F 4ECWA 4NXMJ 4BDPA 3G4SS 3UCUP 4F4YA 4DLGA 2XGPA 4LMZA 4LBPA 2QMUB 1AA1B 4OI4A 4USIA 1RHQB 2C2ZB 1QVGR 1UWBB 1TVRB 3NXZA 1BD6A 5ETLA 4X62J 4KGKA 3H2LA 4WTYA 2BRKA 1RHMB 3CCRS 1MSWD 2GMHA 4OI0A 1NPRA 4C9DA 3CJ4A 1N5SA 2K7KA 4OX7A 1NK4A 4IR1A 2PMZD 4F2SA 3MPWA 1QUVA 1KR4A 5F8MA 5FLXU 4B9SA 4RNHA 3M8ZA 1RT7A 4RW4B 1BWVA 1UA0A 3QLHA 3TA2A 5KFSA 2QZ8A 1Q8IA 1R43A 1VMBA 2GHVC 3AXKA 3OV7A 4NLGA 4X4VA 3P8BB 4RBUA 5E3PA 3VQTA 5CYJA 4JI4J 1Y7PA 4YB1P 2R7SA 1TU0B 4LRFA 5AXMA 3KYLA 1TFWA 1UFLA 2HURA 4ED1A 4MH8A 3CD7A 3LGHA 3L95X 2I5JB 3L7UA 4BLGA 4L74A 2ZWPA 5GMDA 3SBMA 1N5VA 1G3OA 5KFCA 3OL7A 3POTA 1BQNB 3I9ZA 2PN6A 3JS9A 1B70B 4B3SF 1HMVB 2DNMA 1KFSA 1T05B 2GHWA 4UF4A 2OPSB 1K8AT 3M6XA 1YZ6A 1SH3A 3NCQA 3QIPA 5KFIA 3M30A 2QGFB 2XCAA 4LR8A 4H4KA 3T5KA 3B4DA 1EARA 4Y6IA 2DTJA 1Y3JA 2ATCB 1NHVA 1UCNA 4PQUA 2BQ3A 2D1CA 1S0NA 4WU3A 1UJ5A 3LF0A 1MMLA 3HX9A 4ALZA 3UD3P 1U8WA 7FD1A 2G2OA 2YPYA 3H98A 2L3MA 3KJNB 1XR5A 5C42A 1MROA 4OYXA 2LEBA 1WF0A 1K73T 4H4KC 2XO6A 1RT3A 1R8BA 5BYSA 3DGVA 2XY5A 4LSLB 2FJVA 2C2KB 2GQQA 4K7QA 2OUGA 9RUBA 2C3MA 3DLEA 5KFRA 3W62A 4CO1A 4ZIVA 2R8GA 2UXCF 1S10A 2WSEC 4WP3A 5MAOA 1XMBA 3HF5A 2VFTA 4DV5F 4YQWA 5G4DA 2CG8A 4LF7F 4USKA 3DMJA 4M94A 3H0PA 4J91A 4O23A 2YWKA 2ZZMA 2FVPA 4C48A 4FYYB 5E3AA 4DSJA 3L3CA 3ITHA 4RW8B 4JI6J 1H2VZ 2CPJA 2DHXA 2CPHA 4E98A 3BGRA 1RTZA 5IWAJ 2IVFB 2VQEF 3RBXA 1CC7A 1FRXA 4R25A 2A6OA 4H4MB 2ZJPQ 4V1Ak 5U47A 2UXDJ 4HHHA 3DRSB 2RRNA 5AT1B 4N5SA 2GW8A 2KT5A 4LRDA 4PEOA 4KJIA 2XNRA 3KHGA 3KHRA 4WZMA 2E7XA 2H48B 2HHXA 4IOBA 5CZXA 3GJQB 5SUHA 3BN7A 2W9BA 5F9LA 4UOFA 3PVXA 2E44A 1NDCA 2E1AA 2B43A 2ZBCA 2HGMA 4OZ1A 1EQ0A 3ICLA 4OYZA 3PJ9A 3IR5B 2CFXA 2CQPA 2M4MA 2ZNYA 4W98A 4FZVA 4CH0S 2ASLA 2W2NP 2MKSA 1VC6A 4URGA 1XC9A 3AHPA 1TK0A 2MKJA 3CDAA 4Z7YA 2FLOA 4B3MF 1QAXA 1FT8A 3MEDB 4OL8A 1EQMA 3W2VB 4YY3F 3H40A 4N41A 5AXKA 3OUYB 4DR2J 3DOLA 1FNOA 4X4QA 5IFMA 3BGLA 3LO3A 2QA4S 3D66A 1M1HA 2FVSA 4DPWA 3MFHA 4EBCA 1S7HA 3ZTQA 2Z2YB 1SQFA 2CQ0A 1N34F 3W1YC 4DWIA 3DHWC 1FE4A 2KKHA 3EVMA 5A76A 2WSFC 4QWAA 4J9KA 1R8AA 1A0OB 2HBYB 3OTBA 2PEBA 4DPUA 3R2DJ 1UWAA 3PYEA 1WG5A 2AZ1A 3QIDA 1HPZA 3PKYA 4N56A 3CD5A 5DQIA 1UFKA 1FRLA 2F8HA 1HQEB 1YWXA 4QW8A 3DLGB 4ZMMA 3FDSA 4TQSA 3K5LA 3V6KA 4HHUA 3CDWA 1A7GE 2LU2A 4CYUB 2BANB 2XY6A 3MEDA 2KM8C 6FDRA 4B3OA 3WX8A 2AX0A 4Y65A 4ED7A 4URQU 5D4LA 4NEZA 2R42A 1QAYA 1FD2A 1UW4A 4ID5B 2A10A 3NOGA 4ZN3A 1DY3A 1ZETA 4RL1A 4KRWA 1L3UA 1OJ4A 2AGPA 3X1LB 1Q81T 4CWBA 2RUSA 1HWUA 3KKFA 4OZJA 1OWXA 1N32J 5K5MA 4PWDB 1NKCA 1XMOF 4KHPF 2KFYA 3TR5A 2CRLA 5ETNA 4DR4J 2WOMB 3NNAA 4C8KA 2A3JA 5D15A 3ZXWA 3BO4A 2YKQA 2ASDA 3MHYA 2BA9A 2RS8A 2PFFB 4RNMA 3PIPQ 2J9CA 4OFZA 9ATCB 4BBYA 2HBQB 4H4MA 2ILYA 2DXDA 4WJBA 2V0NA 4WFNQ 2Q6BA 3F0NA 4LR9A 4AQYJ 1PGZA 2EW9A 3IAM9 1N6QB 4NCBA 1KP6A 1VQOS 1S1WB 3Q89A 4IG0B 1IKWA 2EG1A 1SUQB 2IVYA 3CTRA 4U96A 1KVJA 2BW2A 4ELVA 2YQ3A 2VL1A 3FMWA 1DTTB 4KIAA 1HWIA 3Q2SC 2BJ8A 5K8OA 3M8QB 5A2QY 4RBTA 2DIUA 1RUSA 4LIWA 4MKAA 3RYLA 1I94F 3EGVA 3V6DB 2YNFA 3MMBB 4URSA 1NBEB 1DURA 3CB4A 5D4NA 1FTRA 3KLFA 1RU2A 3M9OB 4K4WA 2OH2A 3JTPA 1IXKA 1Q78A 1HWJA 2ZVSA 4PXBA 4OI2A 4OI1A 1WHVA 3HHLD 2FGCA 4RW7A 1VBXA 1FDAA 4P2FA 5DDOC 1DAXA 3MM8B 2UUBJ 4JI4F 1RHUB 3KXDA 1LFPA 1M0SA 3BH7B 5JUMA 4ED5A 2VG7A 3M32B 2HFSA 1UZDA 4RU2A 2XMUA 5CYQB 3EDQB 3QT6A 3H90A 4LFBF 1IWGA 4LBHA 2OTJS 3CJRA 3MCNA 1KTVA 1EIYB 3W9JA 4CLPA 5HQMA 2FPHX 4F50A 5CABA 3BGFA 5F0WA 1IBCB 3CMAS 1NAQA 4USJC 4EFAC 3FSIA 2LQBA 5HMWA 3DYAB 3LALA 3ZO7A 5B0FA 2PDAA 1RISA 3QAEA 2ZKUA 1KQFB 2GMLA 4IOAQ 4DPYA 4DR5F 4N8OA 2DR5A 4P7VA 3B6BA 5F8IA 3Q8QB 1NH7A 3D3CJ 1VI7A 2WW8A 1X5SA 2JLEA 4J9VA 3DFEA 5RUBA 4ANEA 2VONA 1K44A 4AT1B 2HLTA 1TL5A 4B17A 3DLKA 2NZCA 1U0SA 1C0UA 4J9UE 4JI8F 4NPOA 4YMEA 2YKNB 2WAQD 1SJFA 1TTHB 1ZM3A 2G1DA 1NXIA 4F67A 3MEGB 1FEEA 2FB0A 1IKWB 4IG0A 2GX8A 3GYGA 4JUZA 4NLSA 3RUBL 4F4WA 1FNMA 4P6QA 3THPA 2AV5A 3IG1A 1RT3B 3K17A 2PMWA 2L48A 3H59A 3OTOJ 4ZITA 4EEYA 2XS5A 4ILLA 1S1VA 2GS8A 2LQ5A 1UP1A 4IQMA 5KT5A 5KFYA 3KLEA 3TVZA 3DI6B 4YFUA 3CMES 4C2MA 3EPGA 3M1VA 3S01A 4CLSA 4F4ZA 2JJ4D 2XYGB 3FBEA 4O3PA 5B09A 4ES2A 2BE9B 4EYHB 2FJDB 2YH0A 4KTQA 3H5YA 4D3GA 2OPRA 2KXFA 1JJ2R 2OELA 2RU9A 2ROPA 2ADCA 2CDQA 3LPEA 3A8IA 1SCJB 3F41A 4F04B 3ISND 1T7PA 2F4VF 2HQFA 2RF2A 3EZUA 3E51A 1RBOB 2B0GA 2MHEA 4KH1B 4ZPBA 3TA0A 3O1LA 4K2JA 3M6VA 2G0JA 2JVRA 3DOLB 3N28A 2DGVA 2IDEA 3L4BC 4I4BA 3U1LA 3EGNA 4K50A 2EWHA 1X0PA 2KFZA 2XZWA 2XI2A 2HVZA 5KFTA 3RRHA 4YR2A 1U48A 1R7IA 2KVQE 1FEHA 2KH9A 3E2EA 2A6MA 4IUFA 1IVZA 4O44A 3C2PA 3DCAA 3CW2C 3M8WA 3G82A 2H5IB 2MSTA 4KGZB 5KFXA 3SZ2A 1C4CA 1S57A 5K9FA 4I2QB 4PG8A 1HNVB 3CJKA 2XLIA 3IMQJ 4HI1A 1U1OA 2QFIA 5KG6A 3QWUA 5G0RB 1SI9A 3BSOA 1FKAF 3QRRA 4B08A 2MKKA 1SPBP 3BZQA 4FXVA 3RR8A 2HRUA 1RJJA 3MR5A 3OUYA 1NKBA 2RF2B 3MGJA 2CQGA 3KJVA 3R9LA 1I6JA 2MGZA 3F73A 4OYOA 3H4BA 2ZM6J 2HMIB 2WBMA 4KSEB 1EKRA 3MZIA 4WWSA 3ZNJ1 4IRKA 3PJXA 1L5UA 2NZ4A 1U1MA 2DNHA 2CQBA 4FPIA 3SCIE 4C3MA 1KOOA 3EVWA 4F4KA 2DGWA 4DV6F 1K9MT 3LGMA 1QY7A 4V19X 2IVMA 1WORA 1HNVA 5DG9A 2C3UA 1N8RT 2QL5B 3N5FA 1VQPS 2VOPA 2MTLA 2XSFA 3H5SA 4DLEA 2WBRA 3CGIA 3J7AN 1U1PA 5DG8A 2W8LA 5H9FJ 4ZJLA 2YWHA 1IQTA 3DRYA 3DRXA 3KG1A 2RDJA 3D54A 5JXSA 2RD5C 2BJ9A 1TL7A 2KHDA 1JLEA 4LF2A 4PAAA 2BDPA 4K0KJ 3HHKA 3PJWA 5E3CA 2XZTB 3SMZA 4Q43A 3CC4S 1QDUB 3TQEA 2DGOA 2WVCA 4A8WA 5ADZA 5HBMA 2EC0A 5E0OA 4RUAA 2MLYA 3CJ2A 3LA0A 4NEYA 4Q2LA 4UZBA 1DRZA 3NMRA 3F44A 3UPFA 1FESA 3G6ES 3CC2S 1V3ZA 1Q8KA 1KC8T 2KJWA 3NBPB 2H4YB 2VFSA 2OPSA 2ZNZA 2OMOA 2YX1A 3B54A 1HBOB 1V3RA 3FKBA 3E3XA 5DZ6A 3ZC4A 1PYTA 4RPFA 2B5JA 1ZM2A 1TKZB 1FXRA 4A8OA 2QLWA 2W4DA 4OX9J 4D3HA 3HZEA 1FNXH 3EVOA 5J1NA 1NB7A 3C15A 2QSFA 3K0JA 1REGX 2IM1A 3HO1A 2KU7A 2BE7D 2DRDA 1K1QA 4ES1A 2HHUA 1LWCA 3SSSA 4ES3A 4J9NA 2ATLA 1RT2A 2PEHA 5DM7Q 4M5KA 3CUNA 1U47A 2AYBA 4ECVA 3L09A 4J9SA 4ZVEA 3M8QA 1HNZF 4QIWD 2DB1A 4CQ1A 3CJ5A 1VK8A 4ECQA 4PKDB 1HW8A 4N7TA 2VFVA 4RX6A 2VC1A 4ICLA 2V67A 4M5IA 4C8NA 3NBPA 4WYLA 2NR0A 1S12A 1VCTA 2OEJA 2BJDA 4B3RJ 4LVNP 2HNDB 4C8ZA 1T02A 6AT1B 1SQEA 2GVZA 3UNYA 2EK1A 1S99A 4HDHA 4CO3A 4N76A 1H2UX 5AXNA 2HVDA 1LXJA 3JSRA 3GP9A 2KDOA 5KFVA 1X9WA 3QNWB 3SFGA 3M6UA 2QA4G 1ITPA 3HVTA 4PUOB 4DQPA 1AXQA 1WI8A 2IHR1 2CPZA 2F8MA 2B9WA 1SC3B 4OHXA 4PG5A 5KFGA 1WI6A 3A4TA 5A8WB 2BQUA 5KOXA 1X4HA 4IFYA 1QTNB 1RDRA 1VQSA 2B7BB 2OEKA 2YWFA 3VALA 2ASJA 1WTBA 5C25B 3BH6B 1D9AA 1S0VA 1SXLA 4ZPAA 3NMAA 2LQ8A 3QSYB 1X4BA 4DEZA 2B6AB 3DU6A 1Y5NB 4OI3A 2XMWA 2W9AA 3GFYA 1CQMA 2DEJA 2M70A 3GONA 1QLNA 1I1GA 1FRMA 2CJYB 4NCAA 4QCLA 1VGYA 1S6PA 1WD6A 2BOAA 1BQXA 2E5HA 3I6PA 5KG1A 1JB0C 5F8LA 1VQLS 4DSFA 2ZDPA 2XMMA 3M2RA 1GXLA 2FDNA 1EP4A 1N5YA 2XSJA 4PCQA 3NNCA 2F65A 1OSDA 4X65F 1G7CB 5FJ4A 4TXSA 2F9JA 4C8LA 1T94A 3BQ2A 3BSAA 1Q53A 2GGPB 5FD1A 2XEXA 3DGPB 1Q1KA 2GAHC 4NLRA 3GU0A 4F4AA 4FF3A 2KYZA 2K2PA 2B3TB 1RTJA 3R5AA 2E5IA 3NS5A 1OYEA 4QQBA 3KLEB 1Q82T 3OFFA 1UVJA 1B7FA 1KQGB 3T5HA 1ZYQA 1U1NA 2PI4A 3IM8A 1HPZB 2DIVA 3U1NA 1KTQA 2VQEJ 2IIHA 4CM2A 1S76D 2OPQB 5ETOA 2DNQA 4TY8A 4A8YA 1WSVA 2CPFA 3KK1A 2E1PA 3KMSA 3Q8VA 1RWNB 5GAGI 2JNJA 1CJKB 1YSJA 2A2DA 1XMQF 3BPSP 1C0UB 3ZZRA 2V4JA 2VDIA 4QWDA 2J0QD 5HROA 5IT4A 1T3OA 4X4NA 3VGTA 4RNFA 2LXUA 1PKUA 2N4CA 3VAIA 2UUWA 1UFWA 1RAAB 3QT7A 4M5DB 4CP5A 4WE1A 1SBRA 2DH9A 2GO9A 2JC0A 4M5MA 2ZH8A 3T1YF 2GJ2A 4KFBB 2G1HA 3ILIA 1TUWA 1P9QC 4IO1A 5GAGU 4CH1A 5F0UA 2B6AA 2MHNA 4KGMA 1O8BA 2AJ1A 1XNRJ 5JMNA 4LF8J 3ELHA 5KFEA 1S49A 1KHVA 1WF2A 2YNIB 1CC8A 2CPIA 2EXUA 3I87A 3M2UA 4I7FB 2ZHBA 1HHTP 1C0TA 1CSJA 2CQIA 3MR2A 2DPIA 3G6YA 3O2IA 2FJWA 4PRFA 1F9HA 4RW7B 3CT9A 4WU2A 3BBFA 4DCOB 3A3OB 4BWJA 1L3SA 2FUG9 4K4SA 1RSCA 3C66A 3CEDA 1TR0A 4JV1A 1H98A 1SIZA 3L7OA 1U25A 3RJMB 4EBEA 3K5OA 1JLCA 3O44A 4DR2F 1JLFB 4QYZJ 4MT1A 2U2FA 1CG2A 1C1CB 2O1PA 2V8DA 4TU7A 2W2MP 3R6GB 2KZMA 4C7QA 3PW0A 4R5PA 2VJVA 3R5BA 1WOOA 1HMVA 2WONB 2CQ2A 2H9ZA 2JC1A 2PA3A 2YNFB 3MMBA 4M5GA 3AD9C 1RI7A 3KK3A 2PMHA 4DL2A 3PW4A 3C6TA 2HZCA 2Y1IA 1MN7A 2CA9A 3ZTPA 1LWFB 2FGOA 2QLXA 4I7FA 1HI1A 1VOMA 1H6KX 2IJFA 1IR2A 3MMCA 3MEEA 4DR1F 3K8WA 3MPUB 5KT3A 1YZ7A 3DHXA 1S72S 2RIJA 1NRKA 1BHNA 2U1AA 2J76E 3FGVA 2GA7A 4K59A 3A3PB 1D8ZA 5LL6d 4CLTA 4F7VA 2PA8D 3OVAA 1IBMJ 4DX6A 1JXVA 2V94A 3C15B 1YJVA 1RYSA 3QGHA 2R2SA 1ZOTA 2OD6A 2P6TA 1F5AA 1FXLA 1LXNA 2X1GA 5I3UB 2DO4A 2FHJA 4HHJA 4USMA 2VC0A 4FP9A 2UUAJ 3HM9A 4MFBA 3FSXA 1T0TV 2H1YA 3J81j 1TL3B 2CJQA 2XM3A 2CZVC 2RE1A 3KUHA 4OYWA 1YRUA 1RTDA 4KFBA 4GMKA 4JI8J 2QX0A 1RTHB 3MWBA 3QMQA 1LQ9A 3PEJA 3CJTA 4Z7CA 4CO5A 1T03A 2RAQA 1X7VA 2QN6B 2V50A 5LJ3Y 1M5OC 5BR8F 5IC6B 4J90A 2ZOMA 1XMOJ 4KHRA 2ALYB 1B99A 1YJRA 4U67Q 3C8YA 1X4FA 2GHPA 3LQVA 1RCOB 1PJ7A 1FXDA 5THWA 1CJKA 4W92B 4NLQA 4WFZA 1CS4A 5ETPA 2R3VA 2DNKA 5DO2A 1VFJA 2ZJQQ 2RRBA 2BANA 2N3LA 3G6XA 3OSPA 3CCTA 4MMOA 4IYQA 4KV8B 1NSQA 2UUBF 2R7TA 3J7YU 1A6LA 4DQRA 1Y11A 2IAJB 3TZWA 1SJ3P 3KLHA 2AKWB 2IA0A 1X9SA 4CLFA 3OLBA 2Q1LA 4FYDA 3PG9A 4HEA9 2H65B 3M05A 2EFPA 2RKIA 3MMJA 1VDHA 2HSEB 3AA8A 3GFZA 4P52A 1KVKA 4ZLNA 2JLGA 3OT9A 4LQ3A 3GR0A 2HQ3A 4TYBA 4P75A 5T41A 2QFJA 3PYDA 3CJ0A 1F1BB 1R89A 2R9LA 2VUGA 1UTAA 2YKMB 4TKTA 5DDQC 5IT9U 1B64A 1GTHA 3OJSA 4ID8A 4JI3F 2MQLA 3TUZC 1X8DA 4E0DA 2V9WA 3L9ZA 4XPEA 3UDVA 2D69A 3MECA 3HKWA 2ZBRA 4EO6A 2MZ1A 3FNNA 4CNZA 3IGNA 4NLVA 3KNAA 4F3QA 2WZ1A 5T7LA 3N01A 4UZCA 3MR7A 3I0RA 2AF6A 3OXFA 5CZVA 3KHHA 1RBLA 5LJ5Y 4LF4F 5L1JA 5ETRA 3GJSB 1JLBB 2ZBQA 4FXWA 4HVZA 4AFFA 1NSKL 3UWTA 2B9YA 5GAEU 5J1EA 2NSBA 3TZZA 4KKOA 2E7VA 4LQ9A 1PCAA 1T9WA 3A1YG 3NP5A 2W7OA 1P1TA 4KHPJ 3ET6B 4EI2A 3PR4A 3TI0A 2RRAA 4LSNA 3HDSA 2LXIA 2WK4A 2N7YA 3QO9B 3HULA 1S9EA 1CBKA 3SIPB 1TV6B 3SQOP 1MW7A 1HI0P 2K3IA 5K8MA 3M8PA 2AGOA 2DCLA 3SCLE 3KHLA 3HSGA 4Y2IA 2XMKA 3GSDA 5HL7Q 2FZKB 3BS9A 4ATNA 5DGBA 2DGTA 1JNRB 3TAPA 2ZC3A 5J2NB 1H72C 1JQGA 1B4SA 1UJ6A 2EFQA 2C3PA 3A3NB 1IM6A 4QR2A 4UOHA 4ZDNA 3TUIC 5EWGA 4LSLA 2BR0A 5L38A 3W66A 1WG4A 2IRXA 2NYHA 2VPYB 3M2VB 3MCSA 3C16A 3Q23A 3I82A 2CJAA 4MYTA 4WK3A 1DQ9A 4C11A 3EGZA 4DUYF 2WVFA 3GG0A 3HSDA 1UMJA 5B0CA 1RT1A 1LOUA 4U8YA 3K59A 1FKOB 2ZKTA 1YIJS 5KAKA 3QATA 1JX4A 5D6GA 2J0SD 2GAGC 4ECTA 3UN5A 5A8KB 3BB5A 4AXIA 3LPYA 4ILRA 1IKXA 1FRJA 3GG1A 2NQPA 1RTIB 1XN9A 1YBUA 2DGUA 1CS4B 2KO1A 2V8VA 3AODA 3MPDA 3H20A 5BYRA 3QSIA 2KM8B 2B8PA 4YS2A 3MECB 3CD0A 1U1LA 2N3OA 4Q8EA 5L9XA 3DXSX 3NWGA 4PZVA 5HJXA 2NUUG 4YB6A 3HI9A 1YHQS 3CIMA 1PYOB 5ETSA 3OXLA 2VIHA 3DDKA 3T1HF 2DT9A 2CZ9A 3VZIA 2B9XA 4C8OA 5IC4B 4J9LA 2OFHX 5K20B 3Q86A 3MCOA 3NOCA 5KFPA 4ELUA 3NG8A 2OLWA 5KOWA 2FD2A 3HLUA 4AUKA 4ECYA 4DL4A 2ZZNA 3BO2A 1VJQA 4DI6A 1LW2A 2CZ4A 3AJDA 5DDRC 4JP8A 3PNIA 2BM0A 3QZ8A 1W25A 1Y5LB 5HLFB 1JLAB 4HACA 2J8SA 2XBPA 2VG6B 2MPUA 4KH0B 4HYKA 4L3NA 4LJMA 8AT1B 2IA6A 1F3VA 2GVDB 3M32A 3IAS9 2ZOGA 2VZ9A 4DL7A 2C2DA 2BOPA 1Y00A 5KG5A 1H74A 1N54B 1Q7LB 2BJ3A 1VQ4S 4EMDA 1FJGF 3LP1B 1VBZA 1YK9A 4RKUC 1IBLJ 2YKNA 2WVEA 2V9KA 5KT4A 4I1TA 3DKDA 1JLFA 2CVIA 2KXHA 4NXNF 3OHAA 4M5DA 1HIYA 5HMZA 3ISNC 5H9EK 2IYIA 3GZ7A 2R2UA 4O4RA 2W7AA 4K4TA 3NNHA 3JQJA 4CT9A 2ZH9A 1Y10A 3HD1A 1BQNA 5KG4A 4DV6J 2UXBJ 1FO1A 5LXYA 3GJTB 1NH8A 4ZHRB 1LEOA 3MM6A 4ENOA 2E1RA 2EI5A 1PBAA 3FJ2A 2RDIA 3ZZ0A 2DBBA 2EC2A 1KLMA 2JHEA 2W1BA 3BM7A 3IR6B 3CJKB 2ALZA 4PXEA 1NJYA 1TV6A 2VB6A 1OPZA 2HQGA 3PEHA 2IJNA 5ETTA 5J1PA 2SXLA 1WC6A 2E1CA 3JSMA 1OQ6A 2MQMA 3MEKA 3UD4P 2ZDOA 4F26A 4Q5VA 3MTKA 2EEYA 4QWCA 2UZAA 1RAGB 1ZPVA 3OQ2A 5K8NA 1G1XA 3ETMA 5C24B 1S1TA 1FF2A 1RWPB 2XGQA 1X5PA 2G0CA 4USUA 2D3ZA 1E6YB 1KD1T 2AMCB 1UAWA 1H3DA 4UY8T 3NKYA 3Q8SB 5A8RA 3HD2A 3GILA 1F5CA 2P6SA 5ITHA 1NK9A 3PKMA 2W01A 1MG7A 4ZKAA 4NASA 1T05A 2AJ4A 2OAUA 3KJFB 5EN1A 2RNEA 1KSPA 4HTIA 4I56A 4JV0A 4LF1A 4DL0C 2BRLA 1TMJA 5LMNF 1OY8A 3DLGA 4M5HA 1YJUA 4USWA 1Q8LA 4FVMA 4C0BA 2IBKA 1RWOB 2PSZA 1URRA 1NU4A 1I94J 1WKLA 3BPDA 2JEIA 4R0EA 4Z2XA 1UVKA 3Q8RB 1RAHB 3PO5A 4RW9B 1SKWA 1BGXT 4MAKA 4ZPCA 2ZH1A 1RA6A 1F60B 3ZZTA 3UR0A 4X64J 2UUCF 3V81A 3W9HA 5KFUA 5A6PA 1H7XA 2GGPA 1VQKS 2IPOB 5DQGA 2XY7A 1HBNA 3RAQA 3CJ8A 1RGVA 3QFHA 4UY85 2MY8A 4NZ0A 4A8XA 2AD9A 2X1FA 4CIOA 1Q16B 2VPWB 3H25A 2ZH5A 1VQ7S 1N36F 4A8QA 4FKXA 2WSCC 4S0MA 1BQMB 2IY5B 3CDBA 3VHQA 3TZXA 4ZA1A 2KXNB 3T6BA 2HKEA 1FWKA 4QYRA 4ZPDA 1T9TA 1XBWA 3B4MA 4C8MA 1S9EB 1XQIA 1Y0HA 4EK2A 3KTQA 3D68A 1MU2B 5HI7A 3W2VA 5EUHA 3GCWP 5KFMA 3IWXA 2E29A 3KUGA 5KFLA 1E6YA 3KDNA 1FWLA 3MXHP 1NK5A 1UEVA 5IT9Y 5GVQA 1RHKB 4Y3CA 4ZVOB 1YJTA 5CAAA 1AUSL 3OR2A 1HNXJ 1SJQA 4M5NA 3HCXA 4G1QA 4OLPA 4YHHJ 2UP1A 1CJVA 2X7IA 1L3VA 5LSRA 2VICA 4DV2F 4LF9J 1LWEA 1ULRA 1NCLA 1Y9OA 2XULA 3GPAA 3ITHB 3CNQP 3D0HE 1VQNS 4DS5A 4X66J 2XHWA 3ZTOA 3SCKE 5C2CA 2WB1D 2CQ3A 1KQKA 4A8FA 1LK7A 4OMFG 1M5HA 2BKPA 2JVOA 1S4EA 3ZZZA 2W8KA 3O8WA 1IR0A 4X84A 1VRQC 2V4RA 5L9NA 4H54A 2V6AA 3J7A1 3JQMA 1WC1A 1H7WA 1GMWD 1U0HA 3DOKB 4KHMA 3QYYA 3T5LA 2E5LF 2Z4PA 4V19J 2RQKA 1PAUB 2VV5A 3I96A 2C1EB 1S1VB 2X51A 3PRDA 4Y00A 2EFGA 7FDRA 3WX4A 4IFVA 1JJCB 1RAEB 1FDBA 1KWMA 5K14A 3K5PA 4HTJA 4DV0F 2RHQB 5D0EA 4QPXA 2XTJP 1RADB 1FK9A 2DD8S 3MDFA 1NSPA 4RR5A 4ZPTR 4HACB 4L76A 4YP3A 3T1YJ 1IBKJ 1TKZA 1S48A 2KT2A 2NUHA 1UVMA 3ZTSA 3HFKA 1VRUB 2HYIB 1VHFA 3UO0A 1PJ6A 4PUOA 3O3LA 2IC3A 4GVBA 2HZVA 3WBZA 2Q6CA 2J5AA 5GMEA 1XMQJ 4GC6A 5I42B 1N5QA 3UNGC 4XK8C 4RLEA 4I67A 3PX6A 3KFWX 3R6LB 3D3BJ 2C2RA 2D9PA 3LAKA 2FJXA 3KDOA 1JIHA 3THTA 2LDYA 2WONA 4JI2J 4NXMF 4U7UD 2J6UA 1S0MA 1VJWA 2HFZA 3POTB 1O51A 2J6SA 2AU0A 2D74B 1IJFB 3FRZA 2ZM6F 2YPZA 1WACA 1FTCA 1ICEB 4K2XA 5IXUA 1SJ1A 1UKUA 1JNZB 4C6AA 1RT5B 4DV7F 1FK9B 3N6LA 2DNRA 2HFUA 2B51A 4NLTA 3FZBA 3FC9A 1ACMB 2M8DB 1F9FA 2OIHA 2VF3A 3N79A 1MWYA 1ZZFA 1GNKA 1HHSA 1MNEA 2F1FA 1XEZA 2RQMA 4PWWA 3CULA 1Z1ZA 2AIRB 3ILLA 3K5NA 2I0XA 1J27A 3DU5A 1S1XB 2ZUAA 3AY0A 3QBCA 2WRMA 3BBCA 1DLOB 4HH1A 4DCJB 2B4VA 3A8KA 2VFRA 2W2QP 4JI1F 3QFWA 3ZFVA 2L9WA 4DX8H 5KFFA 3GIJA 2YQ0A 2QYCA 3MM9B 4L72B 1VC5A 4B9VA 2CJXB 4K0KF 5KT7A 2Z2ZA 1LV5A 2Z2MA 3LP0B 1HNIB 3FK4A 2ZH4A 1SL1A 2HVIA 4CNYA 1AFIA 2E9TA 1NPPA 4DR3J 3DRPB 2M0GB 2FHOB 2H3EB 1S7IA 1FD8A 2BVZA 4P9SA 3TVYA 2W9CB 5DG7A 1RT6B 1F9EB 3FCVA 1IUJA 3K2YA 3QPIA 4QOTA 1QSYA 1HYSA 3KK1B 3R27A 3KJQB 2Z8QA 4OJ3A 4OJGA 1UPPA 2EG2A 4L6V3 4O4GA 1HL6A 1HW9A 2F4FA 4OZ5A 2OFGX 2MLXA 1U6BA 3I5BA 2HHTA 2GIFA 2YNGB 4PABA 1IM4A 5LM7E 4DR1J 3J81Y 2MZTA 4ECSA 2VDHA 3VVTA 3CF5Q 4NA3A 1IN0A 2EFNA 2MQNA 1NJIT 2W9BB 2RDDA 2FC9A 2PO4A 2YXLA 3GIRA 3IR7B 4C11B 4ED0A 4JYAJ 5BR8J 1NPKA 4ZVUB 3SI8A 3UI3A 2V8HA 3ZTRA 3OHBA 2KRRA 3W5YA 3MAQA 2GIQA 1GX6A 1M1GA 3RTVA 3UD5A 5DJBA 2AQ4A 4NZ7A 1HNIA 4GVLA 3GCXP 3R7SB 5LSOA 4OI6A 2E66A 4LF5J 2DHGA 3AJ2A 4PWUA 4ER8A 3UN2A 5EX3A 3M8PB 3I5AA 3HXMA 1R3NA 2DPJA 2DRAA 5MLCV 1AT1B 1CJTA 1U45A 4B3RF 4WFXA 1U6FA 2LYVA 4ED4A 4IOCQ 4A46A 4I2PB 3H5XA 5C24A 4QR1A 1PILA 1DLOA 1HBNB 3CDEA 2KTQA 1S1XA 2HAFA 4IFYB 4XO0A 3BO3A 1T9VA 2GJIA 3ISZA 2DHAA 3OBIA 4WFAQ 4LR7A 3G86A 3MR6A 2Y0SD 2MKCA 4NCGB 2LDIA 2NPIA 1AB8A 2HNYB 4O44B 3CO9A 4NLUA 4Y34A 3RB6A 4WP8A 1VRTA 5H1SV 1RT5A 4DG1B 3GQCA 3CXCR 1CEZA 1WJ9A 1Z2ZA 2B5JB 3WIUA 2E1MC 2OMLA 3OVBA 1GX5A 1NK8A 4NA1A 3B8HA 3FEYB 3FQLA 2W2OP 3KLIA 2O3DA 5J2PB 2O67A 2RILA 3G8QA 3JSYA 2VKZG 4OV1A 3J81U 2GQ2A 4JI7F 3KK2B 3W63A 1GMUA 1RLDA 4ZP7A 3KLVA 2AJ0A 4EZ6A 3HJFA 4MFBB 2ZFHA 5HQLA 3C19A 3WC2A 4DFJA 1SUQA 1RBAA 3J80Y 1AZSA 1FERA 1SJRA 3TW0A 4IR9A 1WOPA 3BJYA 3HHNB 5C25A 3D67A 3MPYA 5F3TA 3DXBA 1O0PA 3HKZD 4LFCF 3Q2TC 3PXGa 1RCXB 3M9MB 3DLLQ 3W2WB 4DV2J 4LF9F 1FVQA 3AFGA 4OLOA 2B8QA 3NGSA 1F5BA 1WUUA 4GKJJ 2E9ZA 3G8SA 2JEJA 3GB0A 4DUTA 1G2EA 2Q43A 4LBIA 2CWKA 2OHDA 2WB4A 4WP9A 1S77D 3SV4A 2HBRB 2WVDA 2WVBA 2ZWOA 1EZZB 4I68A 3OFHA 1ZBTA 4QIFA 4DQQA 2VHGA 2CJ9A 2FLPA 1XNQF 4DR7F 3TEHB 1NO8A 3P5BP 2A0FB 4I0WA 2ZD1A 2ZE2A 2M2BA 3JYTB 2Y3YA 3CVKA 1HWLA 4NLYA 3TYTA 1RT4A 5BYQA 1U0HB 1FJ7A 3UDEA 3JAMY 4GKKJ 5D77A 4KO0A 2W4CA 2J9DA 4FPRA 3E01B 1RAFB 4OZ0A 2HMIA 5AE1A 1ELOA 1RTDB 3I32A 3R7BB 4YEAA 1HR0J 2JSXA 1J5OB 3GR1A 4MKYA 2J7UA 4NE9C 1RWKB 5FIIA 1LWEB 3UCGA 4RZRA 1PYSB 4TQRA 1IBKF 2YWGA 4Q45A 5CH7B 2HWHA 3ET6A 3Q8UA 5GAEI 2XLJA 2BM1A 3PX4A 1HLWA 1RU1A 4MK9A 2QTWA 4FYXB 4ZJQA 2R7VA 2VBYA 3A8JA 3QJLA 2ERRA 4MK8A 3IGVA 4UUWA 4NI2B 4QIGA 4DV5J 1WWHA 1WSRA 4H4OB 3IRXA 3JXOA 1WF1A 4F36A 3RBZA 4ED8A 4DN0A 1OPIA 2OTLS 1WOSA 3BBBA 5L1IA 3LAMA 1BY9A 2MZJA 3GYNA 5F8NA 1B0TA 4R5PB 4ZCLA 3V6DA 2RS2A 5C5JA 2ZH6A 1T9XA 3G9CA 2NPFA 1GMVA 3T9ZA 1X31C 1FKPB 1X5TA 3GMGA 4EU0A 5EDWA 5H9EJ 1FVSA 4NZ6A 1X4GA 4ED3A 2M7SA 2VQFJ 1VQ9S 2C28A 4NLDA 3I0SA 1YJ7A 1DJ0A 1LNQA 1RHRB 2JZ5A 4OQJA 4XPCA 4TY8B 5SZTA 2AYEA 1SH2A 2KG0A 1U1QA 4ZPVR 3CCMS 1FJCA 3JAMU 3EMTA 1ZA2B 2V34A 3P6YC 2ILZA 3R5CA 4ZIWA 2DYAA 5ETMA 1TKTA 1R6YA 4RO0A 3U02A 1FRHA 3V81B 4LUBA 3FCHA 1CLFA 1YBTA 1UETA 5LXRA 4PPDA 4DPOA 2LP4A 3QZ7A 3GFHA 4HLBA 4XDCA 1SV5A 1URNA 3IG1B 2NXJA 4O0IA 2K8GA 4QWEA 1ZTWA 3K8VA 3WQPA 3VAHA 2HHSA 4ERDA 3HZGA 3OTEA 2FHMA 5EWFA 1N4LA 2FZGB 3H2VE 4JI5J 5CYMA 1FRKA 2FJBB 3GSIA 1YGYA 2KFNA 1WG1A 3VR1A 1JJHA 2HNDA 4DU7A 5KFJA 3O5TB 4LSZB 4U7UK 5F9NA 2YY3A 5LOQA 3K58A 5CXTA 2XI3A 1HI8A 1S6PB 4JOUA 4IO9Q 2KG1A 2KB2A 1GH8A 4U6PA 1VS3A 1P6TA 1UL3A 1SH0A 1TELA 1DARA 4TNOA 4ETXA 1UVLA 1IKYA 4LFBJ 4B3OB 1NUEA 2F40A 2LVWA 2MZRA 2YTCA 3FCWA 1E6VA 4NRUA 2OGUA 4CYUA 4JI0F 2YNHB 1FDNA 3LP1A 2ZHOA 3IRXB 2HHHF 2YNGA 1RT2B 2HG4A 2FVQA 1AYEA 4YB7A 3WZ0A 2DNOA 3HSJA 3IO1A 2RMLA 1EB0A 3PY8A 4B3TJ 2YX4A 4ZLPA 1N5TA 1VLOA 3T5JA 1X4CA 1SL0A 4CT8A 4C3KA 2K06A 2X3DA 1RTJB 3RW7A 4FVCA 4MTPA 3MR3A 3LGNA 1BMQB 3LTOA 5FDLB 1UJ4A 2M5YA 5F41A 3OL9A 4EUVA 1HNWJ 2CQCA 2EPIA 3U27A 3I4PA 1EKSA 3T3FA 1KQSR 2NS1B 1KLMB 3FBBA 3KLGB 1D1UA 1RB0A 2CPDA 3BYRA 3IBWA 1U2FA 2CPXA 4Q0BA 2KI2A 2LLZA 3M30B 4QIEA 3SXLA 3IWLA 4Y0FA 5LMNJ 3VAFA 1P8GA 1EP4B 3BGRB 3C6UB 1N5YB 4U9RA 4ZVQB 1QVFR 4FXDA 3AOCA 1C1BB 1SKRA 2K1RA 2C2MB 5AE2A 4HR2A 3TOQA 2HFOA 1M5KC 2QJ3A 5I3UA 3PYFA 4DXLA 3PACA 3WDOA 2V2ZA 3HT3A 4LRBA 1GK8A 1XTZA 4CTAB 2V2VA 1TL3A 1TMMA 3QWPA 4OJHA 3PW7A 3SYZA 1NK0A 1BC6A 2CYYA 2FJAB 3H8YA 1RAIB 3OTOF 1TP7A 2GZOA 2DVIA 2VPZB 1VQMS 2ACMA 1RQ0A 3CCSS 4N8NA 3DLBA 1NLKL 1JLAA 4M63A 4RNOA 1M90T 4O3RA 3VAMA 2DGQA 5KFZA 1K0TA 2JRSA 2GVDA 5D3GB 3W60A 4PQUB 1P9YA 3UDCA 3BYPA 1PG5B 1CJTB 1UVNA 5KT2A 2R7WA 2I2YA 1FA0A 2QSWA 1S1UA 2LCWA 4M8LA 5IWAF 2BX6A 2D7SA 3FVYA 2CADA 5B0GA 4DV7J 1QUPA 3NCPA 1TKXA 4ZVTB 2R8IA 4RBVA 1AZSB 2P8IA 1UWBA 4DSKA 3HK2A 4ED2A 2RT3A 3PW2A 4MYUA 1I3OB 2CPEA 5E41A 1YITS 1V9OA 1H0HB 2MKYA 3UDLA 3D2WA 3VAGA 2BE2B 1HFEL 4HT7A 1GQEA 2XMVA 3D4JA 3DDIA 5HMYA 3OJUA 2KT3A 1JWWA 4FNIA 4W90B 3V2UC 1B7YB 2G0IA 2DJWA 3MMCB 4G1IA 2HHPA 2QL9B 1JXEA 2Z2LA 3GIIA 2CQHA 2KYXA 4E8UA 4U7CA 2VBWA 2MMYA 3I9V9 1REVA 4HDGA 4DV0J 5IM0A 4FBTA 2KVIA 4P7TA 3DOMB 5AXLA 2AGQA 3TA1A 4ZP8A 5DDPC 2UVWA 5AJ3J 2QRRA 2LU1A 1C1CA 3M4XA 3PFEA 2ZITA 3AQPA 2APOA 4ZVFA 2XO7A 4LIRA 2D3UA 2EVZA 3A8EA 3C16B 4X66F 4QYZK 4RW6B 4IRDA 1PO6A 1NEEA 5F3ZA 3BQ0A 4WYWA 3OLAA 1D8YA 2GJFA 3ADAC 3AH6A 1G6BA 2A18A 3FEXB 3EDRB 1CJUB 3AOBA 3RAMA 4Z37A 1FWPA 1I5OB 2J9DE 2D3OR 4LFAJ 2CXEA 2RQ4A 3W8GA 3GV8B 1NJXA 2G4BA 1Q95G 2IBOA 2RH3A 3P96A 4DR4F 4OYPA 1QM9A 3TUJC 1GT8A 1N0UA 5EX0A 3CCWA 3SV3A 4HKQA 2DR6A 2MZQA 4J9QA 8RUCA 2DR8A 2AW0A 5CHCB 2YKAA 5IV4A 2HS3A 4KT0C 3GV5B 2VOOA 1C4AA 3M2VA 4UOGA 1I51B 2M9KA 3MM5A 1XERA 3TRGA 4ECZA 3M6WA 4NRTA 4UQGA 1Q5VA 1CPZA 5L39A 4FKYA 3GTYX 5HANA 5C7PA 3V6HA 4ZLJA 1WDDA 1ZAVA 3D6FB 4CLZA 4DZDA 1LK5A 1YJNS 2NXCA 1VC0A 1JXLA 2QA1A 4CDIA 1FFWB 4OHWA 4DSEA 3HVWA 3CJSA 2HVHA 1U09A 2POKA 1IJEB 3HHLC 2YWWA 3MF5A 1F0XA 3VWSA 3VAKA 4A8KA 3ENQA 4KPYA 1LW0B 3ETOA 2WTFA 4L3KA 2ZEJA 2D3O1 4H4OA 3RG6A 2DEIA 2JX2A 4KV8A 2UV8A 4FNHA 4OZNA 1T8EA 1JKHA 4GO5X 1SC1B 1S6QB 1S1TB 3EZ5A 1EAYC 4DR6F 4MJKA 4P10A 4AL6A 2FYXA 3R2CJ 3LH2S 2CDRB 3V4IA 2CKWA 2FLLA 4IFVB 5BJRA 2IDLA 2YVSA 3JB9k 1YJ9S 4CCHA 2EBGA 1BUXA 3RB0A 1K0VA 2MEWA 1RZMA 4OJ1A 3UW1A 4K8RA 5KFWA 2HHWA 3WIVA 3DM2A 1BXNA 4QW9A 3I0SB 1LWXA 3D5MA 4J7CA 3M8RA 4K4ZA 2J0WA 1S97A 5A6WA 3W64A 4J9PA 3TARA 1V5IB 2KN4A 2PD1A 3CIZA 3TJAA 3N4WA 4DX7A 2I8EA 3BR8A 4AL7A 4BC7A 1SJ4P 2MLZA 3SDEA 2R4FA 2BJ1A 3FEZA 3NGRA 3PW5A 2AJFE 3JYTA 4KYZA 4YR0A 4OX6A 3PV8A 2VD3A 1J2VA 3JTOA 2VA2A 3W9IA 1U1KA 4G3IA 3KLHB 2Q3PA 2ZZTA 3LW5C 2HS0A 4I6WA 5DS7A 1JMTA 2DR9A 3TX8A 2H5EA 3W2WA 3A12A 1YG0A 5M2RA 4DV4F 1UA1A 4DPXA 3HVRA 4DL5A 4DV3J 2GFFA 1JLGB 3AB4B 5B0DA 3JTNA 5DETA 4DJBA 3BDEA 4TN2A 5HMXA 2OP5A 2HIQA 4KE5A 4DN9A 3BKFA 2LQ9A 5J2PA 2UVUA 2PGCA 4E2FB 3IS9B 3C6UA 3QJJA 4DPTA 2ZE2B 5HROB 1RWXB 2GV1A 4MIBA 2OI2A 5HK4A 1N52B 4CLYA 4K4VA 1WC0A 3SDEB 2HZAA 1RABB 2Z57B 3HHDA 1WC5A 4AD6A 2ROGA 1KKHA 2XWYA 3CDUA 1R6VA 1W2BR 1OQ3A 4I6YA 2MQPA 4RUCA 4OIXA 4LF5F 4X62F 4Q2MA 3AD8C 1S6UA 1PSDA 5IOLA 3U1MA 5EGYA 4B9UA 3D9BA 2J9EA 4Y2MA 2HNZA 3SSRA 4ELTA 2KZZA 3TJ8A 2HHVA 1F2HA 2V2KA 3IBCB 4RWWA 3UN3A 1JLGA 3W5ZA 4ETZA 3HP6A 3CCVS 5ETVA 1IKVB 3ENWA 3MEEB 5CD4A 4P73A 1HARA 2ZC4A 3B78A 1HQ2A 1VIXA 3AQOA 4HI2A 1HNZJ 3IA0A 2ZOFA 1B3TA 3EPIA 4JI7J 1HKAA 3Q8PB 4ZVGA 3PM9A 5ETQA 2VKRA 5JVHQ 4I2PA 1TK5A 4NYOA 2MGZB 1B0VA 4O3OA 1KN6A 2CUYA 2BJ7A 1WNEA 4ID5A 1TKDA 3CJ3A 3M9NB 2DY9A 2GMJA 3PZPA 2L9NA 2I38A 2L9DA 1AW0A 2VBXA 3EXCX 5A2QU 1TAUA 3LP2A 2QG9B 2DY1A 3DNCA 3OFEA 2C2EA 4ITSA 3TP2A 1FKPA 2FHJD 3PX0A 2HLUA 3DM2B 5D0HA 3T1AA 2Q79A 2OKQA 4TY9A 4Y2KA 2R7UA 1DZ5A 1HWKA 5HO4A 3TX0A 5J2QA 1BWEA 1NK7A 1RAOA 2V8GA 4W4MA 3RRKA 3UVJB 2R7XA 4UQTA 1RE1B 3GFXA 4WFBQ 1QSLA 1M5VC 2JEGA 2AEFA 2NCKL 3DRSA 4WK1A 3MCMA 2N82B 3RRGA 2Q66A 2E9RX 3BF4A 3CE8A 4I69A 2KL8A 2Y1LB 1Z2LA 3W8PA 1ZA1B 4B9LA 3D7SB 3H2UB 4P2SA 1HHQA 4ZP6A 1R0AB 3NGTA 4GKKF 2QLFB 4AL5A 2RB7A 1X5OA 2K7JA 1RWVB 2L08A 1SKSA 3TAMB 1GXTA 1WDTA 4ZVHA 2OPPA 4M1KA 1L3KA 4DCPB 4DR7J 2RUGA 3FBFA 3T9NA 3AXMA 2Y9HA 2Y1JA 4YB5A 5G0RA 2IMWP 4LF7J 2HBZB 2K3KA 4JV5F 2VG5B 3G71S 2IRUA 3NRBA 2XCPA 2OPQA 5LMUF 2XSJB 1N33J 3H42A 5A0YA 4RNNA 2BJEA 2LKZA 3H7HB 4USHA 4IG3B 3NAHA 2ACYA 1YBAA 5IM0B 2LA4A 3BGOP 2C2OB 2JWNA 1SB6A 3TJ9A 1FDDA 4DV3F 3NAIA 4OHZA 2C22A 5CA5A 4NLWA 2CAJA 2ZD1B 1BE4A 1MROB 1Q0NA 1ROFA 1ZM9A 5DLFA 3MEGA 1S6OA 3TANA 2UU9J 2NXEA 4EZ9A 4OX9F 2A1BA 2CNLB 1DTQA 4NLXA 4K4YA 3D1HA 1U02A 4UOCA 2L41A 4XTTA 1JLQB 2GC8A 3I0RB 2R7OA 3MI7X 2O01C 1OY9A 2UVVA 1J5OA 2AEMA 2GIRA 5K14B 2HGLA 2LA6A 3MM6B 3NS6A 2FQQB 3C3LA 2NLWA 5T14A 1S9FA 2IMOA 4F25A 1V6HA 3VV2B 4DS4A 1NMEB 4CM0A 1TK8A 2ZVIA 1X4AA 1RWWB 1MWQA 1SVDA 1VBYA 2VQFF 5L8RC 1T9UA 5D3GA 4CLUA 2YBVA 1EJ7L 4O0NA 2DNYA 3KMQA 3RZAA 3MAAB 2P9EA 2FVRA 4B02A 3B82A 1J5EJ 3KK2A 2FTRA 5I42A 3AOAA 3CJQA 3CWJA 1U26A 1KEKA 4NI2A 3LWLA 5KFBA 2OJ3A 1LWCB 4QR0A 1YRTA 2CQDA 3R1HA 2C3YA 4A48A 2OO4A 2ZBPA 2LEPA 3THVA 2BV3A 4ECXA 1HA1A 1VYAA 3MM7A 3BV8A 5DLGA 3VTIA 2R8HA 2HWIA 3M8YA 4LT6A 3IBFB 3RR7A 2XG8A 5KFKA 4UTGA 4DZ6A 2AYMA 3KK3B 2PFDA 4NL5A 1LW2B 4ZVPB 3S1TA 4B3TF 1HBOA 4WPAA 2ZH3A 1KRPA 3EICA 1OIAA 1UW9A 3DLJA 1D09B 3HFVA 4WXOA 5DZ7A 3RU0A 2IJRA 3ONQA 2M8HA 5A0YB 2J0XA 4PPZA 5KFAA 4B9MA 2EFVA 1Q7YT 4ZCMA 2HHHJ 4JI0J 1HBMA 2J6TA 1KLNA 4CO2A 2XLKA 4DUZF 3IC1A 3R97A 1MU2A 4EO8A 3PR5B 4RUHA 1YX2A 1RT4B 1KDNA 2Y0BB 4NMXA 3UFCX 4J9RA 5B08A 5DGAA 4IRCA 2MDAA 2V63A 3V4MA 2FJEB 1DTQB 1D0EA 2KHCA 2QIFA 3TQ1A 2VPXB 2NREA 5F8JA 1TQLA 2DK2A 2DO0A 2OEMA 1U7LA 1FE0A 3LUYA 4DV4J 3OR2B 3QJPA 3E8OA 1GXUA 1WTFA 3LWMA 1FKOA 5HVFA 1VHIA 2HNYA 2QYGA 2ADBA 1L3TA 4Y2CA 1IBMF 4L73A 3EGWB 3RBEA 4O3SA 4LVOP 4OYIA 5HLFA 3AB2B 4K5RA 3CD6S 4C4WA 1IKXB 2GO8A 5E33A 1CJUA 2XMAA 2UUAF 5E2QA 4F0HA 2JOQA 3TO8A 1ZM4A 5HQ8A 4K4XA 1AFJA 4ZN1A 4F0KA 4A8MP 4O3NA 1S0OA 3RBDA 2Y8YA 4B3SJ 3I56S 2G2YA 2YNHA 5HJYA 2JFKA 1VK3A 2E5LJ 3CPWR 4KQZA 2BUNA 3N6NA 3UQSA 4A47A 3EWGA 2AHOB 3DOKA 4FF2A 1O5JA 1WHXA 3J7ZT 5KFHA 4X4SA 1SC6A 3US5A 2DISA 2B9EA 2XMJA 5CYMB 2H54B 4NOHA 2R2TA 2W24A 2O5DA 2RVJA 2I6WA 3ILOA 3M2UB 5HVGA 1ZTTA 2AJ2A 4ZPWR 1WHYA 3BN4A 2DGXA 2JH3A 2PE8A 3FRYA 3LANA 2VFUA 1MLAA 3D6MB 3O6QA 3QGIA 2C2NA 1X60A 4OZ3A 2R7QA 3IM9A 3VGVA 5M2PA 3ZZUA 4GC7A 2BKOA 2G9OA 2CG4A 2UXDF 3PCOB 1RYRA 1MMNA 3HSZA 4CRJA 4DOZA 2I9SA 3NL0A 1NDPA 3EM1A 1DQAA 3MUMP 1U2CA 3ENVA 3FFIA 3P5TL 1NDLA 2XNQA 3M7VA 4P2XA 4WBFA 3HPOA 1VR6A 1SQGA 2WCXA 5HP1A 3G87A 2FY1A 5HAOA 2XQCA 3NEKA 3LP2B 2Z0GA 1KHWA 4ZS6A 3Q83A 4JI6F 3GIKA 4MKVA 4RWXA 4CLWA 2XB2D 4X2BA 2MJNA 3DYAA 3EE3A 4CO4A 2O66A 4QJVA 2OPPB 2AX1A 4KGXB 2VJUA 1TAQA 2P9CA 4LSNB 1VQYA 3N0VA 3KG4A 2QA2A 4USTA 1IKVA 2Z30B 2HHQA 3FBCA 3MPVA 3MFIA 3HT0A 3K57A 4WXWA 1GFWB 3CCES 2MB0B 3OR1A 5J2MA 1HBMB 2E5JA 2UXBF 1DHMA 1FX2A 2X1BA 3TWZA 5CYQA 3OL6A 3D6HB 3AD7C 3GYXB 4FYVB 1U24A 4EWTA 4DF8A 1N48A 3G8TA 3PDNA 2HFNA 1N34J 2BYCA 1R8PA 2QMWA 2YQ1A 4P72A 1QJHA 1NZAA 5E3QA 3FUYA 5T7LB 5LSLA 1RP5A 1KONA 1JK9B 2DKOB 2X3GA 4QWBA 4CTAA 4LFAF 5I3PA 4NXNJ 1UVIA 1HQUB 4AYBD 3OXGA 4DBQA 4UW2A 2EFOA 1TL1B 4PQAA 4FS2A 4UUXA 5KTQA 4XIUA 3PO4A 4DX5A 1HD0A 3BREA 4X65J 4C97A 2XYPB 2AZ3A 2HS4A 2BE2A 3OPKA 2MXYA 2MJUA 4DR3F 4GO7X 1CULB 1M1KT 1NB2A 3QIPB 2FVCA 4TVAB 5AJ3F 5B0AA 2DNNA 3KG0A 4ZK7M 3M2RB 1SL2A 3P3DA 2MQOA
chains in the Genus database with same CATH topology
1PC5A 4A8SA 3GV7B 2PI5A 4WF9Q 3IS9A 1SIWB 2ZBIA 3SEOA 2M52A 3IFEA 2CJBA 1XWLA 1DBDA 1QE1B 3L7PA 4LF8F 3R3TA 4NYPA 3C6TB 2JEFA 5AE3A 4F2RA 4PWDA 3BEGB 3VF0B 2HNZB 4DFMA 1NHUA 2F8EX 5KG7A 2UU9F 4IG3A 2YWEA 3EUNA 4JI5F 5CCLA 4A4JA 4FF1A 1S1UB 5D78A 1XNRF 3KJVB 1N6QA 4CZCA 2E5GA 1IBLF 3AAWB 2FC8A 1HQUA 2B56A 2E9RX 1DTTA 3M8SA 5GAHI 2P9GA 5DQHA 5HN0A 1KFDA 2BQRA 4IH7A 3NCRA 5F8GA 1VRTB 1YJWS 5F8HA 4WFYA 2DGSA 4IKAA 1V3SA 2VG6A 1FJEB 5CD4H 3N5BA 3OR1B 4F3OA 2BABA 4HL9A 2VH7A 1OS5A 1LKZA 1BLUA 1YI2S 1FHTA 2FIUA 1C1BA 5M2UA 2W25A 2R7RA 1MWZA 1GAOA 1VIOA 4PXCA 2CIMA 1JLCB 2HQIA 4WE1B 2LEAA 3S6EA 5LT5A 4X4OA 3CCJS 3HMJG 4O3QA 5IZHA 3SFUA 1QAIA 5A8RB 2UUTA 5IQQA 4YHHF 1WHWA 3QGPA 3Q24A 5JVGQ 4C0OC 2AYGA 2IYGA 4NYZA 1BQMA 2DITA 2MY7A 2ZJRQ 2YKPA 1OO0B 1CVJA 1YVFA 3I4HX 4OX8A 4DG1A 1HNXF 4IQXA 1EETA 1R8CA 2KJVA 1C0TB 2HPUA 3QLHB 3PRBA 1HNWF 1RA7A 1WEXA 3AJ1A 3RB4A 1TUVA 1ZAWA 4NWBA 1DFDA 1RT6A 1MMDA 2OSRA 4I6AA 2NYIA 2DH8A 4QBUA 2XS2A 4RW9A 2IM3A 5FLXY 1Y5IB 4DDFA 3BSCA 1CQNA 3E01A 2G13A 4KO0B 3NLCA 2VBZA 2GCFA 4NLOA 3D28A 4CO0A 2MQQA 2V4QA 3N9UC 1R0AA 2HAIA 3QAUA 4NMLA 2ZH2A 5KG3A 4KKOB 3M1VB 3LP0A 1AUDA 3DI6A 4DL6A 2RJZA 4J5OA 3DN9A 4MIAA 3SCJE 4X64F 4DHVA 4JYAF 2LMIA 2F7VA 3QO9A 2V5HG 4XAKA 2J7WA 2DNPA 3OTCA 2ZH7A 1X0FA 1M5SA 3VCDA 2HW3A 4FN5A 4QIVA 4Q8FA 2PT0A 4YDXA 1D9DA 2M88A 4F3MA 1R8HA 2RQCA 4C3LA 5D8HB 4N77A 1RKIA 5JJBA 3EYZA 1DQ8A 3G96A 4X4PA 2R2RA 5IS2A 4ZP9A 1B0PA 4MIWA 1RTHA 2B7CB 1Q86T 2OD4A 4DV1F 3TNVA 4ICLB 1C2PA 2UVRA 1HD1A 2ASYA 4WCEQ 4PG6A 3ZZYA 3RAXA 3DMJB 4DFPA 1ZH5A 2J8AA 1HBUA 4KB7A 2ROEA 5DM6Q 1RK8A 2GNKA 3D0IE 2NXUA 5B7WA 4TU8A 4ECRA 5GADI 2LXFA 5L1LA 2FLNA 2DRBA 1K1SA 3KLIB 4CI0B 4FS1A 1QTMA 3DOMA 2CVEA 1NJWA 5C42B 4IDKB 1T95A 2ABYA 4HT5A 2M3DA 4DMZA 2IAJA 1S9GA 3MMAB 3MM7B 4PR6A 3PIOQ 3DLEB 1TL4A 4WIIA 2GQCA 2P5VA 3MAHA 5GAHU 1Q8BA 3NGKA 2DR7A 3H4DA 3H5UA 3PFOA 3DC2A 3IN5A 4NCGA 2EK6A 3KLFB 3F56A 3MOZA 1Q79A 1N56A