1IKVB

K103n mutant hiv-1 reverse transcriptase in complex with efivarenz
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
423
structure length
404
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POL POLYPROTEIN
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 97
structure length 404
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikvB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvB03
4K4YA 2XCPA 1SH0A 4YR2A 3DOLB 1S6QA 4O44B 5KFWA 4WE1B 2WCXA 2RKIA 5KFTA 5I42A 3KHRA 5HLFB 2WRMA 3FDSA 5L1JA 3SI8A 1MU2A 4KHRA 4ZHRA 4PWDA 1RT2A 2R2TA 4ZPDA 2BE2B 2YKNB 4EBDA 3MEDA 3RB0A 3KK3B 4ICLB 4YMEA 3T5HA 2DPJA 4JV1A 2RDIA 4QWAA 3KLIA 5J2NB 2YNGB 3CDEA 1TVRA 3DLGA 1SH3A 3CJ2A 1T05A 3FFIB 4ZVEA 1R0AA 3G6VA 2WONA 1D0EA 4JV0A 4NLPA 3VQSA 1RT1A 3I0RB 5J2PB 4IOBA 4QPXA 5KFFA 1JLFB 5DGAA 3CDUA 3TVKA 3DMJA 3GV7B 1TKZA 4K4WA 3DLKB 3KLGB 4TY9A 3H4BA 1LWEB 2CKWA 3KLEB 3C6TB 4ECWA 4F4WA 3HVTA 1RYRA 2BQUA 3G6YA 1JX4A 4KV8B 4ECVA 1HQEB 2GIQA 1DTTA 2YNHB 3PHEA 4NYZA 1S1XA 2W9BA 4F50A 4IKAA 3DM2A 1S1WB 1T03B 1Z4UA 2R2RA 3NAHA 4Q44A 5JXSA 5J2MA 1S1TA 3LP2B 3OL7A 5L1KA 3M9OB 1S9EB 4Y2CA 1IKVB 1RT6A 1VRUA 2HWIA 3H2LA 3QIPB 3H98A 2UVUA 2FVCA 4ZVGA 1RT5A 3LANA 1IKXA 4WFYA 3GIIA 3KK2B 3MR3A 4ZPCA 1S0MA 3KHHA 3N6LA 3HVWA 3QLHA 3FSIA 4EYHB 1EP4A 4ED2A 2I5JA 3DRPA 2XWYA 4HKQA 4URQU 4KHMA 2VA3A 3LP0A 1HMVA 2OPQB 2FVSA 3QGIA 4MIBA 4ED3A 5EUHA 4DL5A 1K1QA 1XR6A 3DRRB 1EETB 2D3UA 4IRKA 2IAJB 3KJVA 3GIJA 1JLCB 2VG5B 4O3QA 2R2SA 1N5YA 1KHWA 2AGPA 1TKTB 1TKXA 4PUOA 3JSMB 3GYNA 1REVA 4QW8A 3ICLA 5L9XA 2E9TA 1LWCA 5KG4A 5I3UA 3DLEA 4RU9A 3PR5B 2W9CB 2IA6A 4ECRA 1JLBA 1RTDB 4R8UA 4Q0BB 3GIMA 2OPPB 4J9PA 1T94A 5KT7A 5F8MA 4Q45A 5DG7A 4O4GB 2ZE2A 1JLGA 3LP1B 1LW2B 2IM2A 4QWBA 4WZMA 2HMIA 3OL6A 3KHGA 1JLAA 1C0TB 1S1UB 3MTKA 5KG1A 5KG6A 3E01B 5KFAA 4LSNB 4KAIA 1S6PA 1KLMB 4XPCA 2F8EX 4KB7A 4Y3CA 2V4QA 3IGVA 3DRSA 3C6UB 2D41A 5KFEA 2YKMA 3DYAA 4F4YA 4ECSA 4WXOA 4NCGB 5KFQA 1HNIA 1RT4A 4RW6B 1BQNA 2HNZB 3SFUA 3RBEA 1TL3B 3PW7A 3IGNA 2C2RA 3KOAA 1BQMB 1ZTWA 4IFVB 3G86A 4TY8A 3CIZA 1I6JA 5KT3A 5HBMB 2VG7A 4J9OA 5KFYA 4K4UA 3H4DA 1SUQA 2W7PA 4ZP8A 3JYTA 3MEGB 4IRDA 5K14B 1J5OB 1TL1A 4IG0A 2W8LA 2HNYA 4J9NA 2B5JB 4KSEB 4DG1A 3MEEA 4QWDA 4I2PA 2AQ4A 5KFDA 3G6XA 1IKWA 3FQLA 4TYAA 1NHVA 1UWBA 4RNOA 1QUVA 4YQWA 1S9GA 1SV5B 4RW7B 3KLHA 5DQGA 1KHVA 2JEFA 1LW0B 4NLUA 5F8LA 3GV8B 3BQ2A 2DPIA 5KFCA 2JC0A 4RNFA 3UQSA 1FKPA 3BQ1A 3I0SA 1QE1A 5D3GA 4ZP7A 3E51A 4MK9A 2ASJA 2AGOA 3V81A 1C2PA 3DI6B 1LWFA 4I2QB 3T19A 1N6QA 4TYBA 5CYMA 4J9QA 4ID5A 1S1VB 4I7FA 3DOKB 4B3OB 2HWHA 2ATLA 2QE5A 3ISNC 1RT3B 3IRXB 2FLNA 2V0NA 4F4XA 5F9NA 1FKOA 3BJYA 4K4SA 5JUMA 3OLAA 1S6QB 2JLEA 2XGQA 2C2DA 4ZPBA 3MFIA 1RTIA 4EEYA 5I42B 4J9MA 4WXWA 3NAIA 1MU2B 3V6DA 5F9LA 3DOLA 4ZHRB 4H54A 1IKYB 1RT2B 2WK4A 3MEDB 4RUAA 3Q8QB 4RW4A 1ZETA 3KLIB 3EZUA 3BSNA 1TVRB 3DLGB 2WOMB 3KLFB 1T05B 2IM3A 1R0AB 2IM1A 2WTFA 1JIHA 1CSJA 1RT1B 4MIAA 5HP1A 3KMSA 4NLDA 3KK1A 1C1BB 1HNVA 2XC9A 3HKWA 3DMJB 3LAMA 3HVAA 4FS2A 3FFIA 3N6MA 4EYIB 5F8NA 1TKZB 3CJ0A 4NLXA 2HNDA 4ZVFA 2FLLA 3MECA 1MMLA 1TV6A 3QIDA 4NRUA 3HVTB 5KFRA 3DLKA 2UVWA 3OL8A 3NBPA 4ECZA 1W25A 4WFXA 4KFBA 5CYQA 2I1RA 4O3OA 3TAMA 3Q8PB 1HQUB 1DTTB 2XI2A 4NLRA 3H5UA 1S1XB 2CJQA 4KV8A 3QYYA 2W9BB 3CWJA 3DM2B 3Q8RB 4QWCA 5KFZA 1C0UA 4RW8A 1K1SA 4NLVA 4LQ3A 1S1TB 1RT6B 1S1WA 1VRUB 2OPSA 3TQ1A 3CJ4A 2J6UA 5KFBA 3BSCA 4OL8A 3NKYA 1DTQB 3EPIA 3I5BA 3M8PA 2IC3A 1TQLA 2QV6A 3H5SA 5EDWA 5KT4A 3QLHB 1EP4B 1DLOB 2I5JB 2YNFA 5KFNA 1N48A 3RB4A 2C22A 3DRPB 5L1LA 5KFPA 3LP0B 1VRTA 1HMVB 4IH7A 2ZD1A 3IG1A 4RUCA 5C24A 3ITHA 3CO9A 4IRCA 5FDLA 3FQKA 5C25A 1NNDA 2JEIA 3KJVB 5HROA 4M94A 4LQ9A 1N5YB 1OS5A 4H4OA 2ASLA 1TKXB 4PUOB 2B43A 3M9MB 2AU0A 4ZP6A 4MFBA 2R8IA 4Q8FA 1REVB 2OPRA 1JLEA 3CJ3A 2V4RA 4ED7A 1LWCB 5I3UB 3DLEB 2BRKA 2B6AA 4ECYA 1JLBB 4R8UB 1JLQA 2BQRA 4ZVHA 4PQUA 3QGHA 4URGA 3SFGA 4YP3A 4H4MA 3N6NA 1RTJA 4JUZA 1C1CA 4NLQA 2ZE2B 1N56A 3BREA 2OPPA 1JLGB 3ISND 5L1IA 4EBEA 2HMIB 1GX5A 4TN2A 1JLAB 5F8GA 4QWEA 3PZPA 4XO0A 3D5MA 4R0EA 1S6PB 2VG6A 5C5JA 3PVXA 4NZ0A 1RT7A 3DRSB 2FVQA 2YKMB 1C0TA 3DYAB 4Y34A 4IFYB 2J6TA 3IS9A 1HNIB 1RT4B 1BQNB 4IH6A 4ZPAA 4U7CA 2XGPA 3BSOA 4XPEA 1HPZA 4TY8B 5KFVA 4J9LA 4TQRA 3QO9A 1S97A 4ECXA 4ECQA 2VG7B 4ZP9A 1RTHA 3T5JA 2FVRA 1SUQB 4R5PA 3V4IB 3MR6A 3JYTB 2ALZA 1D1UA 1ZTTA 3HHKA 3NGDA 1TL1B 4IG0B 4NLYA 2HNYB 4YR3A 3H5YA 3PW5A 4DG1B 2XI3A 3MEEB 4I2PB 5KG2A 2BR0A 4EBCA 4LSLA 3MR5A 1IKWB 4KO0A 1UWBB 2AWZA 1S9GB 1HYSA 3V6HA 3CVKA 3MR2A 5KFUA 2RF2B 4HYKA 5DLGA 1JKHB 4Y2AA 3UR0A 4NRTA 4RNMA 5J1EA 3M9NB 2UVRA 1U09A 2E9ZA 5KFMA 4RW7A 3RB6A 3CDWA 3M8QA 4IDKA 1FKPB 4IG3A 3BQ0A 3I0SB 1QE1B 2ASDA 2BANA 5D3GB 4G1QA 5C42A 5J2QA 4KKOA 3BGRB 4NLWA 5KT6A 3PJXA 2XCAA 1FK9A 4K4XA 4EO6A 3V81B 2JC1A 4ED0A 1LWFB 2YNIA 4RW9A 1N6QB 5CYMB 4ID5B 5EWFA 4FBUA 4FBTA 2RKIB 4EO8A 2ILZA 4I2QA 2W8KA 2W9AA 3RBDA 2IM0A 2W7OA 2WB4A 2AX0A 1FKOB 1HARA 4O44A 2FJXA 4WE1A 1QAIA 4PWDB 1SH2A 4MK7A 1S4FA 3OLBA 2IMWP 3PJWA 3OHAA 5HLFA 2R2UA 5DQHA 1RTIB 4DL2A 2WHOA 4FS1A 5DG8A 2FVPA 4J9RA 3V6DB 2WONB 2BE2A 2YKNA 1S49A 2BRLA 3KK3A 4ICLA 4GC6A 2V9WA 2E9RX 5KFGA 5J2NA 2YNGA 4IH5A 4YR0A 4RW4B 5KG3A 4O3SA 2ZKUA 1IKYA 3I0RA 5J2PA 5KFKA 5T14A 2FJVA 1JLFA 4ECTA 2AGQA 2ILYA 5HP1B 2FJWA 4F4ZA 3KK1B 4Q8EA 4G3IA 4MKAA 1HNVB 3KLFA 2WOMA 3KLGA 2J6SA 3NMAA 1LWEA 4O3RA 2HNDB 1WNEA 1C1BA 3C6TA 3KLEA 3MECB 1S9FA 1TV6B 5DG9A 3D28A 2JEJA 1T3NA 3I5AA 4K4TA 2UUTA 3NBPB 3T1AA 1HQEA 4DL6A 4KFBB 5CYQB 4TLRA 1XR5A 2YNHA 3TAMB 5F8JA 5J2MB 1RA7A 3BSAA 3FRZA 1TP7A 2FLPA 3RB3A 3H5XA 1RA6A 1T03A 3UPFA 3OSNA 2UVVA 4RNHA 1HQUA 4M95A 3KNAA 5KFXA 3KMQA 3LP2A 4NLTA 2OH2A 1RT5B 1C0UB 4RW8B 1S9EA 1IKVA 1IKXB 2EC0A 3H40A 3V6JA 4U6PA 3QIPA 3OL9A 3OSPA 5DQIA 2OPSB 4ED8A 1S48A 3UDLA 2C2EA 3KK2A 2GC8A 4ECUA 5F8IA 3M8PB 2IC3B 2AX1A 2C28A 4K4ZA 4MK8A 4MKBA 3CJ5A 3KHLA 1DTQA 2YNFB 1S0OA 2OPQA 1YVFA 1VRTB 4WFZA 5EWEA 4IQXA 3RAQA 2ZD1B 3DRRA 1EETA 1DLOA 3IG1B 3ITHB 5C24B 2UUWA 2IAJA 2D7SA 4JV2A 5FDLB 1JLCA 2VG5A 5C25B 5HROB 4X2BA 1TKTA 2IJFA 3IN5A 4RZRA 4K4VA 4H4OB 3JSMA 1GX6A 2GIRA 4O4RA 4O3PA 4MFBB 5KFIA 2OPRB 1JLEB 2W9CA 1XR7A 5KFLA 2B6AB 1RTDA 4Q0BA 4ED1A 1N4LA 4GC7A 5KFHA 1JLQB 4ZMMA 4PQUB 2VA2A 4NLGA 3BR9A 4H4MB 4O4GA 3QZ8A 1RTJB 3GV5B 1C1CB 2IBKA 3LP1A 3DDKA 1LW2A 3MF5A 4DEZA 3GILA 3V6KA 1NHUA 1S1UA 4QW9A 5KT5A 3PR4A 3E01A 4LSNA 3QGGA 4IR9A 1KLMA 4IR1A 1QAJA 2BQ3A 3C6UA 2VG6B 3MFHA 1S0NA 1RT7B 4NCGA 3GIKA 2R8GA 2D3ZA 3OHBA 4RW6A 2HNZA 1TL3A 3IS9B 4DL3A 1BQMA 3LAKA 4IFVA 5EWGA 2R8KA 4URSA 4O3NA 4KBIA 3PW2A 1HPZB 1RDRA 5HBMA 2R8JA 4IFYA 5F8HA 3QO9B 1IM4A 1RTHB 4WYLA 3MEGA 4MH8A 4R5PB 5K14A 1J5OA 5KFSA 3QZ7A 4DL7A 2B5JA 3KLHB 5KG7A 2RDJA 4Q43A 5KFOA 2JEGA 3V4IA 1RAJA 3T5LA 3H59A 3Q8SB 1RYSA 4KE5A 5KFJA 4J9KA 4K50A 4LSLB 1SV5A 4NLSA 4KO0B 1HYSB 3LALA 1LW0A 4NLOA 5KG5A 3GQCA 5J1EB 4TQSA 2IJNA 3EPGA 4RNNA 4ED6A 3PW4A 4WYWA 3KLVA 3M8QB 4TXSA 2HAIA 2RF2A 4IDKB 1S10A 4IG3B 1JKHA 3I5CA 2BANB 3RAXA 4G1QB 5C42B 4I7FB 4KKOB 5J2QB 5KT2A 4J9SA 3PW0A 1FK9B 3DI6A 5KG0A 2O5DA 3T5KA 5DLFA 4DL4A 5DGBA 3NL0A 2YNIB 4RW9B 1S1VA 2R8HA 3DOKA 3BGRA 4B3OA 4WZQA 1RT3A 3IRXA 1JXLA
chains in the Genus database with same CATH superfamily
1R6YA 3MI7X 2XCPA 3TOQA 5LSLA 1S6QA 2RKIA 1NB7A 4NCBA 1ZPVA 2R9LA 3IFEA 1R7IA 2M8HA 2DIUA 1Q78A 4QPXA 1DAXA 4PXBA 4F0KA 3MOZA 2ZJPQ 4F25A 3C6TB 2K3IA 1FE4A 1S99A 2DK2A 2R2RA 4JI5F 2W2PP 2MSSA 3LUYA 4OI2A 2ZH4A 3C16B 2VA3A 4U9RA 1PBAA 2ZNYA 3ILOA 1DY3A 1NU4A 1CJTA 1REVA 2IA6A 4RU9A 4J37A 1JLBA 5A8WA 1FI4A 4PKDB 1S6PA 4XPCA 3IGVA 2H51B 2Z2ZA 3BEGB 2GMLA 5K8PA 2CNKB 2W7PA 1UPMB 4IRDA 3R5JB 4JYAJ 2HNYA 2GX8A 1B0TA 3M1VA 4B3RJ 3C19A 1Q5YA 5BYQA 2J8SA 4CT8A 4RNFA 2G4BA 1NSQA 1DRZA 1TU0B 4MK9A 4F4KA 1GMWD 3T19A 2C42A 3LGNA 4B3OB 2QE5A 5JUMA 1UKUA 1RAAB 4ZPBA 4CT9A 1RKJA 1UEKA 1TR0A 2ADBA 3R9LA 3W9JA 2J9DA 2VOPA 3SDEB 3OFHA 1XMOJ 4NLDA 2V4JA 3MD1A 4FYVB 3MR7A 1VYAA 3UCZP 4USJC 1FRLA 2KYXA 2KO1A 4WJBA 1DTTB 3NOGA 4WK3A 1HBNA 4AFFA 4C3LA 1C0UA 4CTAB 4NLVA 4WTOB 4M5DA 4F0HA 4YEAA 5KFBA 1U2FA 2VPZB 3TA2A 1HD0A 5KFNA 1N48A 3QT7A 2VU5A 1GTEA 5KFPA 4F4AA 2E66A 3NWGA 5ETRA 3TX0A 1JXEA 3CJ3A 4E98A 2MZJA 5I3UB 5IXUA 1QM9A 3OW2R 1P1TA 3FBFA 4H4MA 3CF5Q 4ZVTB 5H9EJ 2RU9A 2ACMA 2BV3A 5M2PA 2D9OA 2UZAA 2XSJB 3WX4A 2GA7A 5BXIA 2K7KA 4QU7A 3MCNA 1LNQA 5A2QY 1E6YB 4TY8B 2QRRA 4MKVA 2V94A 3RYLA 4C2MA 2E1AA 4LRDA 1ZTTA 3HHKA 3W8PA 4MYUA 1SJ4P 1HKAA 2J0SD 2RF2B 4G1PA 2R7WA 2BM1A 1HWJA 2BANA 4NLWA 2YX4A 3OTDA 2RQMA 3LWLA 1A6LA 3DXBA 2NUHA 3RBDA 2IM0A 2MKYA 1OYDA 3HMJG 9RUBA 4XDDA 1PJ6A 4EGLA 2AJQA 3OFGA 1YJUA 3MECB 3CDBA 3R27A 1E6VA 3GTYX 1ZAWA 2X51A 5ETPA 1YI2S 5IM0A 3OSNA 2E7XA 1AUSL 1N32F 1ZOTA 3W2VA 2V69A 4U6PA 5DQIA 1SPBP 1P9YA 1H7XA 3G71S 1YJ7A 1FNXH 4AD6A 2C28A 8ATCB 1EETA 4M8LA 2I6WA 1L5UA 2P5VA 2GIRA 2DHXA 3TO8A 3ETMA 5LMNF 1KKHA 4DS5A 3ENVA 4O4GA 4QR1A 4WU3A 1Q86T 2DNYA 3HK2A 1FDBA 2K3KA 1N33F 2CQ4A 1N5QA 2W4DA 2M9KA 2MTLA 2HHXA 1FDNA 1UA1A 3T5LA 3BF4A 4HDHA 4WIQA 3K5LA 4QBUA 1TFYA 4LIRA 2H48B 5D15A 4KGKA 4ED6A 5G0RA 4C3KA 2VFUA 3TZXA 3P96A 4OHXA 2LYVA 3DOKA 2BQRA 1U0HB 2A0FB 3HHLC 4LT6A 2C2MB 3H0PA 4CM0A 2DH7A 4FDFA 4KHRA 2ZH1A 4QZVB 5J2NB 3MMAB 1D0EA 1X8DA 3JAMU 4OZ1A 3CDUA 3DMJA 5IZHA 3HF5A 3PG9A 2VICA 2NSCA 2BYCA 3LWMA 1S1WB 3B6BA 1XN9A 3GZ7A 4LR9A 2CPZA 1IKVB 1RT6A 1U1RA 1VRUA 1TK0A 2HWIA 4WP9A 2VFSA 1T8EA 5GADU 3S7RA 1S0MA 2UXDF 3ENAA 3QLHA 3MM7A 2NS1B 2PGCA 2OPQB 4LF9F 4D3GA 3DRRB 1JLCB 1N34J 3W62A 4OHYA 4TKTA 1FD8A 2K1RA 3W1YC 2W4CA 4B3TJ 1R8BA 1HNXJ 2XEXA 5KT7A 2VOOA 4OZ5A 3J7ZT 1JB0C 3H2UB 1VQLS 5B0DA 3EM1A 1RBOB 3P3DA 4OFZA 2C3PA 2XWXA 3F73A 2G13A 4AXIA 5KFQA 3JS9A 3R8YA 3GPAA 3OVBA 4QR0A 2VDHA 2ZH7A 3FSYA 2O67A 3BN7A 1VJQA 5JMNA 5E0OA 4KHPF 1ZZFA 1SV5B 2ABYA 4FZVA 2DXFA 4P2FA 3E51A 4JI1J 3MZIA 1KQKA 3A1YG 4I7FA 4F3MA 4F4XA 4UUXA 3BJYA 1KP6A 1B99A 1R6VA 3JSRA 3RZAA 3OUYA 4EEYA 3IR7B 3Q8QB 4X64F 4TU9A 2PC6A 2RH3A 1HNVA 1UWAA 3HVAA 1IBMF 4E8UA 2HNDA 3ZFVA 3OTEA 3TUIC 3H25A 4X4SA 3CWJA 1N52B 2ZBQA 2VUGA 3CJ4A 4FKXA 1VHFA 3TP2A 1MW7A 1RWPB 1PO6A 2O01C 1HQ2A 3RB4A 4DZ6A 3G4SS 3SQGA 3CO9A 3OXFA 5B0EA 4N8NA 1OS5A 2B43A 4DR4J 3M2UB 3NGUA 3AJ2A 3MGJA 2VHGA 2L08A 4R8UB 2F4VF 4ZCLA 1EZZB 4JB8B 2KG0A 3TUZC 2HQCA 4QYRA 2M52A 4Y65A 2HHHF 3ZNJ1 2CQ3A 5B09A 1OJ4A 1RT4B 1NPKA 1HPZA 5HJYA 2O1PA 4TQRA 4DSEA 2DRDA 4DUZF 1Q7LB 3JYTB 1PSDA 1NDKA 1X60A 1UWBB 2CUYA 2X3GA 3RB6A 2F1FA 1QE1B 2ASDA 5D3GB 4JI0J 2DITA 1IBKJ 4U7UK 2R42A 1IUJA 3HDSA 1FRIA 2PEBA 3CCLS 3SCKE 3MMBB 2AX0A 1FKOB 4PWDB 1EQ0A 3MAQA 2OAUA 1Y5NB 5A8KA 4A8XA 3I87A 1JJ2R 2AKWB 4P9SA 2YWWA 2NPFA 1YG0A 4MMOA 3AD9C 3HHLB 1PYSB 4M5NA 1T9TA 1QLNA 3C6TA 3I96A 3I56S 2J76E 1S9FA 3D28A 2HG4A 5ETSA 5CD4A 3MWBA 2XZWA 2EFOA 2EPIA 4OX7A 4Y2IA 3C16A 4B3SJ 2ZBPA 2C2NA 2ZD1B 5L46A 2CDRB 2IJFA 3ZTOA 4PR6A 4JI6J 4NWBA 2R7SA 1JLEB 2ZHOA 2G1DA 4NLGA 2MPUA 2XO6A 2KT2A 4LF2A 4M5JA 3GILA 1RWKB 4QW9A 1RWNB 3HM9A 2HVIA 4OZJA 2BQ3A 3J7YU 3OTBA 1BY9A 3Q2TC 2BKOA 2AJ4A 2VJUA 2EI5A 2AMCB 2B8PA 1CS4B 1RWOB 2Z2LA 3A12A 3QZ7A 1H73A 5KFOA 3D0GE 1BWEA 3DXSX 5KFJA 1UJ6A 3J81Y 2JFKA 4XK8C 3LALA 1NK8A 4LBIA 4TXSA 2WVEA 1FK9B 3T5KA 3U02A 5CD4H 3TJ8A 3BGRA 4B3OA 2E5HA 2JRSA 2BOAA 4X84A 3H8YA 4DHVA 5L1JA 1UFWA 1Q16B 1SJRA 5LT5A 4ICLB 2CPHA 4NZ7A 1URRA 2BOPA 3SDEA 1J27A 2D3OR 3GV7B 3KLGB 4CP5A 4ZVSB 2IDEA 1DTTA 2J7UA 3GCWP 4CTAA 1S9EB 1KQFB 2X1AA 3LANA 1RHRB 2MGZB 3K5OA 1K44A 3EJMA 1T3OA 4ELTA 2IVYA 1K1QA 2QO3A 3JQKA 2AJFE 1JWWA 2VIHA 5KG4A 5I3UA 4LFCF 1RSCA 3PX6A 2UP1A 3BGUA 2DGTA 4GKJJ 4OX9J 1LW2B 2W2OP 4JOUA 4M5IA 3KHGA 3MTKA 1T9XA 3AT1B 4NCGB 3J80Y 2HNZB 3RBEA 1K73T 4BDPA 1E6YA 4TY8A 3I32A 4EK2A 4HLBA 1UL3A 2UU9J 1WKJA 4P2SA 3VGVA 3MEGB 5K14B 1RHJB 3N01A 2H54B 1U8WA 1DURA 1KHVA 2JEFA 1WF2A 2FQQB 4YDXA 3Q89A 5AXNA 1FJ7A 5HMXA 4B9LA 2FZKB 1EJ7L 2Y1IA 1S1VB 4DV0J 4HI2A 3OLAA 4WCEQ 4JV5F 2HS4A 3K89A 5L9NA 2LEAA 1V3RA 2DR8A 4DFKA 3R1HA 1JIHA 1R8AA 4RR5A 4C8ZA 2A3JA 3MECA 4AUKA 3R3TA 2UVWA 4ECZA 1GQEA 2CJAA 2XMUA 3LQVA 1YGYA 2DNQA 1S1XB 4KV8A 3RBZA 1TL7A 2NYIA 4DU7A 5KTQA 2ZC3A 2VDIA 1YBUA 2HVHA 4E0DA 3BO4A 3SSSA 2ZM6J 5LXYA 3DLJA 4M94A 1OPZA 3FUYA 2LA4A 1AT1B 4HHHA 4YY3J 3CT9A 2GMHA 4YDDB 1YX2A 1GX5A 4CLLA 5F8GA 2OEJA 3PVXA 1KLNA 2FVQA 3MAAB 3TVYA 2KVQE 2F3JA 4OYXA 2OTLS 2H9ZA 3N5FA 3TVZA 2DNOA 2XYHB 1IKWB 1N36J 4N8OA 5DLGA 4NRTA 3SSQA 4CDIA 2FJBB 4LF4J 4DX6A 3ZC4A 3M8YA 4RW7A 1NSKL 4OIXA 4DQIA 1FRJA 5KT6A 5HSPA 2JC1A 4PXEA 3PNIA 4ZCIA 4AQYF 3THVA 1U0HA 4I2QA 1NO8A 2W7OA 2WB4A 3SEOA 2OKQA 3D0IE 4GC6A 5J2NA 3MMAA 3PX0A 1KQGB 2J0WA 5T14A 2ILYA 3CB4A 4DI6A 4MKAA 4ANEA 4C0BA 3GB0A 3BDEA 1Z1ZA 3D6TB 1FWKA 2GJ2A 4Z7YA 1XR5A 2DHAA 2OH2A 4NLTA 4QIWD 1IKVA 4P10A 3SMZA 4DQQA 2RJZA 4AT1B 4ED8A 2CPIA 1Y9OA 3M8PB 2IC3B 4MK8A 1U0SA 4I0WA 1RU2A 2OPQA 3RAQA 4ZJQA 3DRRA 2UUWA 1DLOA 3R7NB 1JLCA 5HK4A 4QOTA 3JB9k 3MDFA 1FTRA 5LOQA 4HL9A 2UUBF 2MYFA 1C1CB 2IVFB 3V6KA 2HBQB 2CIMA 4IR1A 2HS3A 2CWKA 3H7HB 3I4PA 3IS9B 4DL3A 4CNZA 2MHEA 3GJQB 1QY7A 2ZH2A 1H2UX 4WK1A 2HURA 3QJLA 4HH0A 1SV5A 1NPRA 3UE2A 4NXNJ 3W64A 4CYUB 4RNNA 2HAIA 2KM8B 1N0VC 4ENOA 2YNIB 1XMOF 4CO5A 3JTNA 1SH0A 1G3OA 5KFTA 5BR8J 3T5HA 2ADCA 4NLPA 2FHOB 2FGCA 5F0UA 5KFFA 2BJEA 2GGPB 1AXQA 4TY9A 1XJWB 1HWKA 3DC2A 1M5KC 3EGZA 5IFMA 3KG0A 2ZZTA 1O5JA 1FO1A 3H2LA 2BVZA 1M1HA 4WFYA 3GSIA 4LFBF 3MR3A 4WKYA 1UVMA 3ZXWA 2N4DA 2AIRB 3QRRA 2KZZA 5AE2A 5JJBA 1HLWA 3QJJA 3M2UA 2YWEA 5CYJA 5KAKA 1V9OA 4R8UA 2ZITA 3FEZA 3KWMA 1ZA2B 3WIUA 1RWUA 4KB7A 4DR2J 3C6UB 1RT4A 2C2RA 1YIJS 2DISA 5A2QU 3EVOA 3O8WA 3JYTA 4DV5J 4ZN3A 2VBYA 2HRUA 5KFDA 2ASLA 1UWBA 4P72A 1SL0A 4KT0C 1RJJA 3R7BB 2C3MA 4OX6A 1QE1A 5D3GA 1QAYA 3BH7B 1XIQA 3GG1A 4IO1A 3MMBA 1FKOA 1R0CB 1MMNA 5F9LA 1VC5A 1IKYB 2D3O1 2WTFA 1WHVA 1REGX 1FNOA 4ZLJA 2BXJA 2MHNA 3OR1B 3HVTB 2ALYB 5AE3A 1T7PA 3OL8A 1FKAF 2CJQA 2W9BB 4N41A 4QWCA 4B9UA 1KSPA 3D6HB 2ZBCA 2A2CA 3NKYA 1DTQB 1ZM4A 4BCAA 5KT4A 5M2RA 3A13A 3Q86A 2ZD1A 4RUCA 4QIGA 1TKXB 1JLEA 4DV2F 4BLGA 2ZE2B 2Q66A 1KEKA 2HMIB 4TN2A 3PZPA 3VAGA 4F26A 4K2XA 1B4SA 3CD5A 3RTVA 4CLTA 1CS4A 4ZP9A 2IMOA 5AJ3F 1F2GA 1SUQB 1D1UA 2QIFA 1VOMA 3UDCA 3MR5A 4FVCA 3V6HA 2BE7D 4HYKA 4HTJA 5A6WA 1F6TA 2VPXB 2MZSA 4LIWA 3Q24A 1TMJA 1FK9A 5HVFA 2V34A 2HBYB 1LWXA 1CVJA 3AXMA 2J7WA 1SC6A 1SH2A 2RUSA 1S4FA 1VRQC 3HKZD 3B8HA 3MURP 4LR7A 2FVPA 3ZZRA 3T1HJ 3OXLA 4ICLA 3ENWA 3AFGA 3D3CJ 5KFKA 2AGQA 2KRRA 3UDVA 4F4ZA 2MKCA 2HRTA 2SXLA 2VODA 3KLGA 3NCQA 3P4UB 4L75A 1NKEA 3M30B 3AHPA 3TAMB 4QYZJ 3DGVA 3MAHA 2CPEA 3KNAA 3KMQA 4RW8B 1S9EA 4HEA9 1DQAA 1D8YA 5CAAA 4NEYA 1NRKA 2QN6B 3FZ2A 2MGZA 4B3TF 2A6OA 2CZVC 3BBFA 1QSLA 3V2UC 3VAKA 3IWNC 3B4DA 3LW5C 5C24B 2Y9HA 5C25B 1K9MT 2FGOA 1K8AT 4BBYA 1GX6A 4F02A 3EUNA 3L4BC 1XMQF 3P5TL 2F4FA 3GV5B 2IBKA 3GFXA 3DDKA 1LW2A 3QGGA 1MNEA 2KTQA 1Q0NA 4I68A 3IO1A 3W7BA 1S0NA 1SQGA 4NCGA 1SC3B 2HNZA 1NUEA 1NJYA 1UTAA 4RU2A 3GG0A 1H3DA 2M8DB 3QO9B 3MEGA 5LXRA 2QL7B 4EWTA 5K14A 3AJDA 4DL7A 4ZIVA 2VC0A 4LSLB 1M5VC 1VI7A 2Q79A 4K59A 2EFQA 2IJNA 3WX8A 3PW4A 3M8QB 5KT2A 5J2QB 2N82B 1HBMA 1S1VA 1HWIA 3IAS9 1PILA 4O0IA 1SIZA 1J2VA 2B4PA 3N9UC 3WIVA 2DCUB 3HVRA 1X5TA 4NMLA 3C46A 3GYXB 1RACB 3CJTA 4NA1A 3J7AN 4K4WA 2G9OA 3EGWB 4ECWA 2WZ1A 4ECVA 2LEPA 2MXYA 3NOCA 4FF3A 3PHEA 4NYZA 1S1XA 2KHDA 3IBWA 1Y00A 3FMWA 3NAHA 3OL7A 1XNQF 1LFWA 3BBCA 4DR4F 4YHHJ 1RT5A 2M0GB 4PG7A 2R4FA 5DDQC 3M2VB 2QMXA 1VBXA 4URQU 4DX8H 4V19J 4OX8A 3D1HA 3FBBA 2FVSA 1WF1A 5ADZA 1B3TA 2QA4G 2AGPA 3CCQS 3ICLA 1HR0F 4J9PA 1T94A 2HFOA 2D74B 4WZMA 3FK4A 2VH7A 2RU3A 1NK5A 1SKRA 3MAAA 3MCOA 2X1GA 4DJBA 2ZBRA 3R97A 1SB6A 3QT8A 3G86A 3M7VA 4DCPB 4PAAA 4I6WA 3J7A1 2IA0A 4ZVOB 2AQ4A 1IKWA 4PPZA 5K8OA 3AJ1A 4L6V3 3W3SA 4ZP7A 2RD5C 1XC9A 1UCNA 4ES3A 5DZ7A 1OWXA 3I9V9 3DU6A 2QYGA 2V0NA 4KH1B 1YRXA 1KVJA 4AE5A 4ZHRB 3KLIB 3EZUA 4LFAF 2KFNA 4CRJA 2HQGA 2IM3A 1R0AB 1RT1B 1ROFA 5L39A 4FS2A 4LF7F 1ZYQA 4CO0A 3UR3C 3A4TA 5C2CA 4A48A 2RHQB 3HD2A 2HLTA 4HR2A 3CGIA 4A8KA 2I1RA 1RHQB 1WEXA 3R5CA 5DRKA 1N5SA 3MOJB 4WKRA 3P6YC 1AZSA 3UDEA 3KJFB 3M8PA 2IC3A 1WOOA 2ZKTA 4FNHA 1RBLA 2DJWA 5C2GA 2XMMA 2ZVIA 4Q8FA 1RZMA 1C1CA 1HW9A 3S8SA 2NREA 3ISND 4QIVA 2XB2D 3WQPA 4DPWA 4DDFA 2KT5A 2RRBA 5IT0A 3DRSB 2MQNA 4IFYB 3IS9A 2GQ2A 3QRQA 2VG7B 5B0BA 2KXNB 1S79A 4J5OA 1PJ7A 1MN9A 3UO0A 2LECA 2CAJA 2GFFA 4EBCA 1FXLA 1X4GA 4CLWA 3UCUP 4R25A 1T9WA 3MR2A 2IY5B 4CYUA 3CDWA 2MKHA 2PN6A 2YNIA 3SYZA 2PI5A 2FJXA 5DG8A 3MPVA 1S49A 1IVZA 3NGTA 1VHIA 2ROEA 5JVHQ 2HFSA 2GGPA 1BHNA 4OLOA 3C15B 2L9DA 1XEZA 3VZHA 1UVJA 2E1PA 2ZH5A 2C3OA 1F2HA 4W98A 2VONA 3PHTA 1J5EJ 1SKUB 4WP3A 3OL9A 3K7RA 4K0KJ 5CXTA 5F8IA 4K4ZA 1P1LA 2MLYA 5L8RC 3P45B 2XLIA 4ILLA 1P27B 1RWMB 4UOHA 1TAQA 3W2WB 1S5ZA 3I4HX 1HNZJ 4B9MA 3MF5A 3RR7A 1H0HB 1OY6A 1HWLA 7FDRA 2JHEA 1QAJA 2DTJA 3C6UA 3ONQA 1RT7B 4C98A 2W25A 5A6PA 1QTMA 5F8HA 1HNWJ 4CO4A 3D2WA 3HZGA 2DRAA 1RQ0A 2Y0BB 1VFJA 1RYSA 4NLSA 3AQOA 5J1NA 4TQSA 1VC6A 3TJ9A 2LU1A 4CO3A 4LREA 3MXHP 5IQQA 2XMKA 3WHIA 4DR7J 3K5NA 4WE1B 4PWWA 2WCXA 2YQ0A 3FDSA 2YH0A 3UD4P 3B4MA 2DPJA 1SVDA 2RDIA 1SH3A 5D0GA 4EFAC 1JLFB 3JAMY 3LGMA 3H4BA 4P73A 3EXYA 1HI8A 3OR1A 3HVTA 2BQUA 3QNWB 2R7RA 3HHNB 3NMRA 1JXVA 2OD4A 2W9BA 1O0PA 4UZBA 1YHQS 1XWLA 1BMQB 4FXDA 4O23A 4FYDA 5LSRA 3NNCA 1Q81T 1VQ9S 4NXMJ 1XR6A 4Y2MA 1RCXB 4KGMA 4AL6A 1F9HA 2R2SA 1TKTB 1TKXA 3FCWA 2ZH8A 4DV1F 2E9TA 2D69A 3POTB 4Q0BB 5CCLA 3AY0A 3B82A 2ZE2A 1XNRF 2HMIA 3OL6A 5KG6A 4PXDA 4KGVB 3KOAA 2N3OA 1OIAA 3OJSA 3EWGA 3HX9A 4ILRA 4ZN1A 5F3ZA 1SUQA 3VCDA 3CC7S 4FYYB 4KSEB 1NKCA 1YJVA 3FQLA 4DLGA 1QUVA 3CPWR 2OP5A 3HSGA 1LW0B 4OHVA 2DHHA 3AA9A 4C8LA 2CVIA 1R0BG 4JI4F 3IWXA 3HP6A 1Q8BA 1CG2A 2FLNA 3VWSA 4I1TA 2KL8A 1MU2B 5D4PA 2HHWA 1I1GA 3SCJE 4DV7F 3KLFB 2WOMB 3KG4A 3ZZUA 3B54A 2CNLB 2MKSA 3HKWA 4UT4A 1YZ6A 2L48A 1WUUA 2BE9B 4ZVFA 4B3MJ 2M70A 3FCVA 4WFXA 4D3HA 4ED5A 3TAMA 1HQUB 3R5GA 3QAUA 1VJWA 2Q43A 4RW8A 3EX7B 4OZ3A 1OPIA 4K5RA 2P8IA 1SBRA 2OMOA 2NXJA 1YSJA 3ZZPA 3UD3P 2CQ2A 4N76A 2BJ3A 3TW0A 3CULA 1R31A 1S6UA 3LH2S 1TL4A 4P71A 1FFSB 5C24A 3QATA 5C25A 4QYZK 2ZBIA 4LQ9A 2L3MA 5HMYA 4USTA 2LVWA 3GE9A 3I31A 1U1KA 1U26A 1LWCB 3DLEB 4FXWA 3N0VA 3QT6A 3MM6B 2ZEJA 2EFGA 1KOHA 1OSDA 4DX7A 1JLAB 1OSCA 2K2PA 2UUCJ 2OELA 1TL5A 3BGFA 1HNIB 5HMWA 2JJ4D 3TAPA 3P8BB 2NPIA 3QO9A 2DR5A 3V4IB 3PFOA 1CC8A 2XLKA 4YR3A 2MMYA 4A46A 4I2PB 5IWAJ 2MZTA 4LSLA 5HANA 2AWZA 1S9GB 1IWAA 1LV5A 2UVRA 4NA3A 1BLUA 3M8QA 2F8HA 2JFDA 5J2QA 5BR8F 4K4XA 4ZPVR 4XIUA 4ED0A 1HARA 2ZWPA 1NAQA 3OLBA 3G8TA 2R2UA 3CJQA 4FS1A 3CCSS 3V6DB 3R5AA 2RT3A 1UW9A 4RW4B 5KG3A 2ZKUA 2MKJA 4ECTA 3I55S 6FDRA 2J6SA 4O3RA 3WC0A 3LGHA 4DBQA 4DPXA 3MD3A 1U2RA 5CYQB 2RHSB 2WBMA 3A8EA 4M95A 4ETXA 3C8YA 2OPSB 2UXBJ 3A8JA 4RBUA 2Y8YA 1YJ9S 4MKBA 3M2VA 4WBFA 1U6BA 1YRTA 3PO5A 1S4EA 3QWPA 1YWXA 1U4BA 5IC4B 3M6VA 3IG1B 2BJ8A 4LF5J 2QLJB 2ERRA 3W5XA 4DR3J 4MIWA 4BC7A 5D0HA 4L72B 4DPYA 4OV6A 5ETLA 1PGZA 1UJ4A 2IHR1 1RTZA 4I69A 2ZJRQ 1NHUA 2MQ8A 2VG6B 1RBAA 3D54A 3O44A 4N7TA 4C8NA 1RKIA 4X66F 3M4XA 2B8QA 4LRAA 1D09B 2F9JA 1RTHB 2A18A 4C0OC 5HAOA 2JEGA 3H59A 2Z2MA 2CJKA 4ZVQB 5J1EB 5THWA 4G1QB 4Z2XA 3A3OB 3K59A 3OQ2A 4YR2A 5GVQA 2AD9A 4A8SA 4OZ0A 2M2BA 2E5JA 2JH3A 3KHRA 1HFEL 5HLFB 4ZHRA 3KLIA 1NXIA 1R0AA 2WONA 1RT1A 2XBPA 1ACMB 1WHXA 2KRBA 3D9BA 3M8RA 3K5PA 4C4WA 2E5GA 3GFYA 5IV3A 2UXCJ 4F50A 2YKQA 4B9VA 1M5PC 1FXRA 1DBDA 1MG7A 1RAIB 2OFHX 3ET6B 2JZ5A 4ED3A 5EUHA 1U8SA 3AOAA 4J91A 4CZCA 2F40A 2OJ3A 1X4EA 5DETA 1RHKB 5B0GA 1S0VA 1RADB 2HKEA 2KZMA 2IM2A 5F41A 1NK6A 5CZXA 1Y3JA 3DRSA 4WXOA 2C3UA 5F3TA 2HHVA 3IGNA 3IP0A 3HSDA 2VG7A 1LXNA 1HI1A 4JI3F 4CH0S 3OTOJ 2E44A 2DGSA 2AW0A 5F8LA 3IBFB 4NLUA 4PWUA 1KTVA 4OZNA 2YWKA 3UQSA 3NGSA 2FD2A 5HVGA 3AODA 4HACB 1BUXA 2HWHA 1RT3B 1VDHA 1YITS 5I42B 3OPKA 3QSIA 1Y4ZB 3SCLE 5FLXU 3BSNA 1SIWB 4ZPTR 4ERDA 1QSSA 1C1BB 4NL5A 1IR0A 1H6KX 1TKZB 4JI2J 2FYXA 3T6BA 1X5OA 2EEYA 3PYFA 5KFRA 4A47A 3DLKA 3OR2B 3RW7A 4ES1A 1I3OB 4OYIA 2CPJA 2V2QA 3BYPA 3CJ8A 3Q83A 2NR0A 4ALZA 3FZBA 3K17A 2E1CA 3BSCA 5DM7Q 3JQJA 1RWXB 2QSFA 2W1BA 3DFEA 1MROB 2AZ3A 2QZ8A 1TFWA 3CCJS 4DU8A 2N3LA 1GMWA 4HH1A 3HHDA 2DNLA 3CEDA 3PRVA 4RPFA 3W2WA 4B9TA 2ZNZA 1N0UA 4URGA 4YP3A 4DCJB 2RDDA 1JJCB 2MQMA 1N8RT 4R0EA 2XTJP 3QPIA 1RT7A 2HSEB 8RUCA 3ZZ0A 3MPDA 2RAQA 1S77D 3IR5B 4XAKA 4J9LA 3MMCB 4NX9A 1L3TA 4DPOA 3RW6A 3RU0A 4DG1B 2KN4A 4P7TA 2QJ3A 1EHWA 1OYEA 1EKSA 1FKPB 1L3SA 3E2EA 4TU8A 1RISA 3DNCA 4FBTA 3CD0A 5CCMA 2DGQA 4WE1A 1X9MA 4U96A 5B0FA 5KOXA 1VQ8S 1X9SA 1JLFA 2BX6A 4GRSA 1EX8A 1H98A 1UAWA 5HI7A 1RLDA 2AP6A 4F0MA 3NBPB 2FY1A 4F2SA 1V5IB 5D4LA 4F67A 3MM9B 5GMKa 5J2MB 1SQEA 2QYCA 2R7OA 3V6JA 4NYPA 1JMTA 3O1LA 1WSVA 2BKNA 4EI2A 2AX1A 4ETZA 4LRCA 2E5LF 1YTYA 4B17A 2YNFB 3VGUA 1X0PA 2PMZD 1AFJA 4Q2MA 2ATCB 2N7CA 1TKTA 2R3VA 4PG8A 1G2EA 1S59A 3POTA 4Q0BA 1UA0A 4ED1A 2KJVA 2XYGB 4ZMMA 4DUYF 2IRUA 3U1LA 2HEKA 2HGNA 2JX2A 1O8BA 4QIEA 2G0JA 2WSCC 4OJGA 2DGOA 1WHWA 3T9ZA 3V4MA 4MH8A 5KFSA 4UW2A 1FT8A 4TU7A 1WC4A 2NZCA 4LF6F 3KFWX 1LW0A 1RAOA 1SJQA 5C42B 4KKOB 2RVJA 3O6QA 3IAM9 1UPPA 1G4CA 4X4RA 5IV4A 3Q0AA 2YWHA 3JQMA 4KGXB 1MU2A 4ED4A 3RB0A 2VQEF 4JV1A 1HA1A 3G6VA 3FFIB 1CJKB 3VQSA 1VK8A 2IRXA 2XMWA 4IO9Q 1HIYA 1H38A 1U48A 2WBRA 2DO4A 2JLGA 4PYDA 1HD1A 2E5IA 2DYAA 3CCTA 2LQ5A 2H5JB 1B0PA 4CLUA 5B0CA 2CJBA 3A8KA 2FVCA 4ZVGA 3N6LA 2KFYA 1SL2A 4DX5A 1TTHB 4DL5A 4M5LA 4IRKA 2Y8WA 4PRFA 1VGYA 3O5TB 2DEIA 1WOPA 1LWCA 1EIYB 3DLEA 1RTDB 3MM6A 3VTIA 5DG7A 2BJ1A 4X65F 2DY1A 3D6MB 1N5VA 3BDPA 2LEBA 1W2IA 1JLAA 1C0TB 4LSNB 2F8EX 3HD1A 5KFEA 3TUJC 1NK4A 2B56A 1HNIA 2YH1A 3IXQA 3KYLA 3CSKA 4LF1A 2B5JB 1X4AA 1Q79A 4I2PA 3KUGA 4P75A 1VQ7S 4TYAA 4RNOA 1NHVA 4YQWA 1S9GA 2LQ8A 1IBLF 1S72S 3BKUA 1DJ0A 1RXOB 3MFIA 3V6DA 3DOLA 2I0XA 4RW4A 3DLGB 2RB7A 4DOZA 2Y1JA 3QSYB 1DQ9A 4MJKA 3RGIA 3EGNA 4OLPA 3VGSA 1B0VA 1RAEB 3G87A 3VR1A 5CYQA 3Q8PB 2DNKA 1HBUB 3L7PA 2NSBA 4DR6F 4PYAA 4ZCMA 1YJRA 2OD6A 2HZAA 2OPSA 2GVDB 3R1LA 2QV6A 2M88A 4IYQA 3F56A 1N32J 2FHKA 5L1LA 1HNZF 4DUTA 3LP0B 1O51A 3N28A 3IG1A 3IR6B 2DNGA 3KJVB 2LLZA 5CABA 1RHUB 2BMBA 2U2FA 1FWLA 1IJFB 1GNKA 2XHWA 2OPPA 2J9DE 1FA0A 3VVUA 4I67A 4RWXA 2NUUG 5EHHA 2VG6A 5LMNJ 2YKMB 3KDNA 1WG1A 4IH6A 2R7TA 3US5A 1RTHA 1T9YA 3MR6A 4F2RA 1U24A 4DF4A 3PM9A 3BB5A 2UV8G 2XI3A 4WU2A 5HN0A 5LMUJ 1AB8A 1RK8A 2OUGA 1JKHB 4X4UA 2HYIB 5J1EA 2QMUB 3S1TA 1U09A 2IVMA 2OO4A 4G1QA 3V81B 2V2ZA 5CYMB 4Q5VA 2RKIB 2H4YB 1VCTA 2W8KA 1K0TA 4A8QA 4MK7A 5HLFA 1EB0A 3FGVA 1Z2ZA 5KFGA 2UV8A 2B9WA 1WC6A 3L7OA 4OI4A 4K7QA 1WNEA 4CH7A 1F3VA 3I5AA 1CQNA 1RP5A 3LA0A 1FRMA 2ROGA 2CADA 2V8PA 3M05A 1TZ0A 3IMQJ 1SI9A 4PXCA 3I6PA 2C3YA 2EC0A 3TJAA 1SC4B 2C2EA 2KT3A 4DV4F 4LF8J 3CJ5A 4ZJOA 5MAOA 1ICEB 2FLOA 4LMZA 2O66A 3P49B 2GO8A 2D7SA 2OSQA 4I6AA 2UXDJ 4H4OB 5KFIA 3NP5A 2GAGC 4LF9J 1DARA 2YVSA 1FFWB 5KFHA 3PKMA 3PIPQ 4USUA 1UW4A 1SKWA 4IR9A 1RGVA 3GIKA 2X1BA 8AT1B 3K0JA 3OVAA 3JTOA 4KBIA 2LP4A 1U1NA 2HK2A 1T9VA 4R5PB 3H90A 4DV3F 1F5BA 2Z58B 2BEFA 1U1MA 2N7YA 4DQSA 3AOCA 4JBCA 4WYWA 4IG3B 4KHPJ 5KG0A 4HACA 3NL0A 1RT3A 2ZWOA 2OFGX 2Z56B 4KC5A 2RILA 3P5BP 3I9ZA 2KDOA 1VQKS 3QJPA 2P9CA 5I42A 2FHJA 3SI8A 1WDTA 3JSBA 4UZCA 3PEHA 2CPFA 2OHDA 2F63A 1TKZA 4F4WA 1RYRA 3EICA 4X64J 3OR2A 2A2DA 1HQEB 3CJSA 1JJ4A 3EDQB 1IBMJ 2XQCA 2EFNA 2ACYA 4M5DB 4DN9A 5JXSA 2JVRA 3CW2C 1IKXA 4U8VA 1JK9B 1UEUA 2RUGA 1QVGR 1S76D 1MROA 4HKQA 1FESA 2RNEA 4KHMA 2FJAB 1MN7A 4MKYA 1QVFR 2WW4A 3JSMB 1UVLA 2W9CB 1BC6A 1G6BA 3VQTA 5F8MA 1CLFA 2LU2A 2KYZA 1BQXA 2AF6A 2XY5A 4L3NA 3E01B 3UW1A 3KTQA 2D41A 2F4VJ 4RW6B 3SFUA 2XS7A 2GZOA 2HQFA 4IFVB 3MMCA 2HHHJ 4K4UA 2ZH6A 2BACA 3L09A 3LPYA 2L41A 4DG1A 1IJEB 1HW8A 3G6XA 3KLHA 5IT9U 2XLJA 4DUZJ 4RBVA 3D3BJ 4ELVA 1FKPA 3NCRA 4YB5A 5B08A 4PPDA 3W61A 2IDLA 3ISNC 5D0RA 3IRXB 1FJCA 4H4KA 2G2OA 1NB2A 4J9MA 4WXWA 3MTJA 1H74A 4QPTA 2Y0SD 1NH8A 4X62J 2OMLA 3LAMA 2QX0A 2DT9A 4PCQA 4NLXA 2GJFA 2AHOB 1EARA 4NRUA 1F1BB 3GJRB 2UXBF 3NBPA 3KUHA 1W25A 4FYXB 2V9KA 2BABA 4NLRA 4DQRA 1UETA 4UY85 3BR8A 2CZ9A 2H5IB 1VQPS 4DR3F 3TQ1A 4M5HA 3EPIA 1KVKA 3CMES 2W24A 3GCXP 2YNFA 2RQKA 4DR5F 4CLFA 4W4MA 2DXDA 5M2UA 1NNDA 2AU0A 4PUOB 2BRKA 4Q7AA 4CWBA 3NG8A 5D6GA 3QGHA 2IBOA 1X31C 3SXLA 1KOOA 4FXVA 3SV4A 2W01A 3RRKA 2VB6A 1I94F 3HI9A 2QA1A 4B08A 1S57A 4ZIWA 1GT8A 2EFPA 4G65A 5T7LB 2IRYA 2ALZA 4C11B 3NGDA 2JLFA 1TL1B 3ZZTA 1W2BR 4HVZA 2YBVA 4DV6F 2DO0A 4ANDA 2VPYB 3CIMA 3UNYA 3BQ0A 5C42A 1FJGF 4KKOA 4M1KA 2XCAA 1R8HA 4C8KA 4OQJA 4FBUA 1AYEA 3TA1A 2ILZA 2W9AA 2IMWP 2W7AA 3PJWA 2WHOA 2BRLA 2CPYA 3HCXA 4YR0A 3MUTP 1CJUB 2GQQA 2PO4A 1CJKA 4B02A 1VQYA 4U7UD 2QFJA 2V2KA 3HT3A 3CD7A 3PXGa 2WVBA 5EX3A 4DMZA 3FRZA 4MT1A 2MSTA 3O2IA 1WORA 2LXIA 2YXLA 1KS2A 2LKZA 3H40A 3OSPA 4PG4A 3MM7B 4X4QA 1KVIA 4YOEA 2CA9A 2ZC4A 1PAUB 4HHUA 2MY8A 4OYPA 1ZAXA 4Y28C 4EZ9A 1RTDA 2PIIA 1N4LA 3BR9A 1P9QC 2AYGA 4ZDNA 3G8QA 1NJXA 5KT5A 4LSNA 3MPWA 3MFHA 4LFCJ 2XSJA 3LAKA 1Q8LA 4PZVA 2CRLA 3GJSB 1RAHB 1Y10A 3SBMA 2B5JA 3GMGA 2X1FA 1FXDA 3D67A 2H65B 1RAJA 1IXKA 4QU6A 4DR1F 5GAEI 4CNYA 3DGPB 2RF2A 4USVA 4Z7CA 3I5CA 2MQOA 4I7FB 3PJ9A 4JI7F 5AE1A 4DQPA 2POKA 2KHCA 4TLQA 2BE2B 4EBDA 1U1QA 3KK3B 3G9CA 3DLGA 5K20B 3K2YA 4JV5J 5DS7A 1IQTA 3HULA 1L3VA 1BE4A 1U6ZA 1NZAA 1HBUA 2UVUA 4RUHA 2GVDA 4C9DA 3SQGB 4ED2A 5CH7B 2XNRA 3LP0A 4OMFG 1AFIA 4MIBA 4RJVA 1VQ6S 3KJVA 2DNZA 4QW8A 1A7GE 2YQ3A 2PMWA 3KNGA 2MQPA 1H2VZ 1WOSA 4ZJLA 2HZVA 1X9WA 1KQSR 4A8MP 1H72C 3FC9A 1B64A 4EUVA 4Y3CA 2B4VA 3RR8A 1LK7A 2YKMA 2Q1LA 4YB1P 2RRNA 3GFHA 4QJVA 1JNZB 2VQFF 5KFYA 4LVOP 2KJWA 2W8LA 1ZM9A 2XYPB 3E3XA 5I3QA 4LR8A 2XZDB 4JP8A 1BGXT 1FRHA 1GTHA 2K7JA 3V81A 3CD6S 1YBTA 5CYMA 4WP8A 2RMLA 4XTTA 5JVGQ 4KH0B 4CLZA 2JLEA 5A8KB 4A8OA 5EN1A 2CG8A 4PABA 4AQYJ 2VBZA 3G8SA 2WK4A 4RLEA 5L38A 1M5HA 4MIAA 4CIOA 1VC0A 3G6ES 3N6MA 2E7WA 4WFAQ 1RWVB 4CLYA 2VKRA 2AYBA 1NLKL 3R2DJ 4DF8A 4GKKJ 3DM2B 3AQPA 5KFZA 2IPOB 2XNQA 3AD8C 4JI8J 3O3LA 1RB0A 1S1WA 1U25A 2C2OB 2OI2A 1FJEB 2NZ4A 1EP4B 2HZCA 2COLA 1WEZA 3PIOQ 3G82B 2DGXA 4H4OA 3M9MB 2KI2A 2J0XA 3PY8A 2Z8QA 1U49A 3CC4S 1IR1A 2AJ0A 4JUZA 4PQAA 4NA2A 4DL0C 3G96A 2IJRA 2UUBJ 4NZ0A 1SXLA 2V50A 4DZDA 4JYAF 1VK3A 3VAJA 4U7CA 3HFVA 3M2RB 2HFUA 2MDAA 4B3RF 2B51A 2GVZB 5RUBA 3DHWC 5A8RB 4R5PA 4NLYA 3KKFA 2BR0A 3M6UA 1O6XA 3M9NB 3DHXA 4A4JA 4IG3A 2OTJS 3BGRB 1KWMA 4V19X 1N6QB 4ID5B 4U8YA 5J1PA 3GJTB 3CMAS 4ZA1A 2A6MA 2EC2A 4J9RA 2XS2A 4IH5A 4YS2A 3PRDA 2QA4S 4ZKAA 2HHQA 2A1BA 3T3FA 4W90B 3RBXA 2M4MA 2XHCA 2CWXA 2H4WB 5LJ5Y 2GMJA 1UVKA 2DHGA 1HQEA 1YJNS 2NXUA 3UPFA 1MSWD 4ZVRB 1GXLA 1UVIA 2PD1A 2MLXA 1WSRA 1UVNA 2G1HA 1D9AA 1X0FA 2KU7A 1VRTB 4WFZA 2NQPA 3ITHB 2BW2A 1QAXA 1U6FA 3F0NA 4LFBJ 4CH1A 3JSMA 4F36A 2WAQD 3AB4B 2W9CA 3ZTRA 1JLQB 4XDCA 4OYBA 4ILMA 4J9UE 2YX1A 3E01A 3MCMA 1WKLA 1CEZA 1M5SA 4OYMA 4KPYA 3OHBA 4RW6A 1QD1A 4U67Q 4IFVA 3PW2A 2HHSA 1IM4A 1VIOA 1T02A 2GJIA 3SCIE 3VGTA 3WBZA 3C66A 4KO0B 1HYSB 2U1AA 3GQCA 3S01A 5K9FA 1S10A 5D4NA 2C2ZB 2VFVA 1VQOS 2JOQA 3IRXA 1S6OA 4K4YA 1T0TV 3GIRA 1FNMA 2DY9A 2PA8D 3HSJA 4UQTA 5D78A 4PWDA 2YNGB 3CDEA 4ZVEA 5AXMA 3R2CJ 4JV0A 5J2PB 4G1IA 1CJVB 2VKZG 4C0HA 2OGUA 2MZQA 3KLEB 3HHLA 2DIVA 1MWYA 1JX4A 4KV8B 1TL7B 4CO1A 2LQBA 1HBOB 4Y2CA 1IBCB 1CULB 2K06A 5CZVA 4WIIA 3AXKA 1BWVA 3VAHA 5FIIA 2W2NP 2XWYA 3T1YJ 2J5AA 1WTBA 3PCOB 3GIJA 4PUOA 3DDIA 4J7CA 2QLBB 1L3KA 1M1KT 4ZVPB 4RKUC 3HJVA 2ZZNA 4KR0B 4FF4A 3IM9A 2BW7A 2YPYA 1NK0A 4DV2J 5HQ8A 4F4YA 5LMUF 1TL3B 2YKPA 4DLEA 4ZPWR 5T7LA 1LQ9A 4GO5X 4C11A 1TL1A 3DOMB 2DR6A 4QWDA 4RW7B 2M7SA 3CCRS 1Z2LA 5AJ3J 5FJ4A 1I51B 3BQ2A 4C8MA 4LRBA 3ZNUA 2JC0A 4P7VA 2IYIA 2LQ9A 4FPIA 3U27A 4I2QB 3H2VE 4TYBA 1U45A 2KXHA 1LKZA 2CJXB 2XGQA 2FB0A 3FBEA 3X1LB 2QA2A 4KGZB 1CJUA 1RU1A 1T05B 4X4TA 2V63A 3HFKA 5FLXY 3MM8B 1SCJB 3CJ0A 1GK8A 5I3PA 2B4UA 3GWCA 2X3DA 2V6AA 4LF8F 2WVDA 2Q3PA 3BGLA 1M5OC 2NYHA 4AYBD 2ZH9A 3W8GA 4ID8A 1N34F 4DSIA 1DLOB 3LOUA 2DNNA 1HMVB 4UOCA 1HNXF 2D9PA 1X5PA 1HL6A 1YBAA 3CCWA 2R8IA 1YLXA 3V5RA 2WW8A 4X4NA 1R8CA 1N56A 1JLGB 4P6QA 2KH9A 4UY8T 2CYYA 1FD2A 4OZ2A 1XMQJ 4OZLA 3DYAB 3HT0A 1S97A 4GMKA 3T5JA 1CC7A 2FVRA 1ZM3A 5E7OB 2XY6A 4JI1F 2K8GA 2Z2YB 3CVKA 4C8OA 3DGPA 4HDGA 4X4OA 2B3TB 3B78A 1HI0P 4OYWA 2EK6A 2LXFA 2G0CA 1F0XA 3FNNA 4DL2A 2BE2A 3KK3A 3NWRA 1S7IA 3S6EA 2QLWA 4LBHA 4G3IA 3BYRA 2ZZMA 1TV6B 4TVAB 4K4TA 3T1AA 2HS0A 1R8PA 4GVBB 3LO3A 2UVVA 5E3RA 3TR5A 5IS2A 2HQDA 4MAKA 4K2JA 1X7VA 1XNQJ 3KJQB 4I4BA 3BKTA 4IUFA 1NK9A 5FDLB 5I4MA 2QTWA 1R27B 5KFLA 2B6AB 2DNPA 4GC7A 3GR0A 3DCAA 1WC3A 1FX4A 1RTJB 2CJYB 3LTOA 3K5MA 1PG5B 1F3FA 2GAHC 1HR0J 3MCSA 1RCOB 3WC2A 2D3ZA 3CMQA 1IWGA 4URSA 4O3NA 2YKAA 4WYLA 2V2VA 2OSRA 5HMZA 2VV5A 3F44A 3Q8VA 4JI0F 4KE5A 1VBKA 1IBKF 5KG5A 1RUSA 4FF2A 3KLVA 2NXEA 2Y1LB 3TAQA 4X62F 1Y5LB 3OD2A 4Y6IA 4M5GA 1YK9A 3PFEA 2WRMA 4DPTA 5GAGU 2GHPA 3PV8A 1WC5A 4RBTA 4QWAA 3CJ2A 4P52A 3UN5A 2F7VA 5CHCB 3I0RB 2FDNA 2MLZA 2Z57B 2GW8A 1LWEB 2CKWA 2GHVC 3ILJA 4LFAJ 3G6YA 3HSZA 2GIQA 1ZAVA 2Q6CA 3DN9A 4LF7J 1TKDA 3DM2A 4B3SF 4X4PA 3A8IA 3NGKA 3G2XA 1UZDA 4QQBA 3R7SB 4ZPCA 4LUBA 1ZBTA 1EP4A 1VQ5S 4JI6F 2C1EB 2Y3YA 2RS8A 5DZ6A 2ZHBA 3D68A 3EYZA 1QUPA 3G82A 2FHJD 7AT1B 3BN4A 1YZ7A 3PR5B 1GAOA 4WWSA 3GIMA 3C3LA 5E3CA 3M8WA 4Y2KA 4AXJA 3U7JA 1NSAA 4MTPA 3VZIA 3RG6A 4CLKA 3M2RA 3PW7A 1ZTWA 3PYEA 1RHMB 3CIZA 1I6JA 5HBMB 1D9DA 2GVZA 4B9NA 2WSEC 5A8RA 3H4DA 2Z30B 5G4DA 4J9NA 1KD1T 1ZPWX 1PIEA 4L74A 2CQDA 3TYTA 5KFCA 4KY3A 3MM5B 2FIUA 3DI6B 3CE8A 1N6QA 2LQJA 1T9UA 3KUEA 4ID5A 1PBUA 2CFXA 4QR2A 1ZA1B 2XM3A 5F9NA 2C2DA 4OJ3A 4FN5A 1PC5A 3ZO7A 2BJDA 3LPEA 2IM1A 1KFSA 1VMBA 5LM7E 4X4VA 2QG9B 5HQMA 2GIFA 3OBIA 4A8YA 2CQ1A 3H5UA 3QYYA 4NCAA 1K1SA 1VLOA 4F3OA 3VF0B 3L3CA 4OL8A 1WD6A 3H5SA 4DS4A 3DRPB 1VRTA 2H3EB 3ITHA 1FCAA 2QFIA 2XG8A 4GKJF 4OX9F 2J9CA 5AT1B 4ED7A 4HHJA 1SC1B 4ATNA 4ECYA 2BA9A 1RAGB 1JLQA 4NLQA 1FHTA 1KFDA 2ZOGA 2UU9F 4Y0FA 2J8AA 1DQ8A 2KM8C 3FMBA 3R6LB 1SJ3P 4ECXA 5H9EK 2B7BB 1WI6A 2J0QD 1AUDA 3H5YA 4IG0B 1XK8A 3MEEB 5KG2A 2HGMA 4KO0A 3HHEA 1HYSA 4KPCA 2E9ZA 5KFMA 2QL9B 1HBMB 1UP1A 4DV0F 3PDNA 3L7UA 2V8VA 4NOHA 1U02A 1WDDA 3GFZA 1GMVA 4J90A 1AA1B 3GLJA 3TA0A 2E9RX 2HQIA 3D1QA 2YNGA 1EAYC 1IKYA 5J2PA 2VC1A 5HP1B 1CJVA 3UD5A 3FRYA 1WF0A 4A8FA 2AJ2A 3KLEA 3H20A 4F04B 4CO2A 2JEJA 2NLWA 2OLWA 1B7FA 4HI1A 1RA7A 3BSAA 4O0NA 3OTCA 2FLPA 1TP7A 1G1XA 5KFXA 3N4WA 4AL7A 1RT5B 4YUDA 1HBOA 4KJIA 2ZM6F 3UDLA 2I8EA 1CULA 3HXMA 2B0GA 1DTQA 3IM8A 4RUBA 4IQXA 5EWEA 2JWNA 3RUBL 4YY3F 3L95X 4L73A 4USKA 3IN5A 1LOUA 4OI0A 1WI8A 3CNQP 2RIJA 2AEFA 3W9HA 1TK8A 3CUNA 1PC4A 3D7SB 4DV1J 1IN0A 2V8DA 1M90T 3D6FB 3CXCR 1EQMA 1HWUA 1TL3A 2XZTB 2XY7A 2GQCA 1XNRJ 2QSWA 1Q82T 2XSFA 1N36F 3U1MA 3BPDA 4LF4F 5ITHA 3DOMA 2RDJA 4K50A 5GAHU 1U1OA 1NJIT 4IDKB 5H1SV 3FSXA 5CA5A 1S12A 1WTFA 4S0MA 1K0VA 3UCGA 1HHSA 3FKBA 2RQCA 4O44B 4JI4J 2LA6A 5E5NA 3JXOA 4NASA 2ZOFA 2CQGA 2YKNB 4CI0B 1T05A 4GKKF 4IOBA 3MM8A 3TVKA 4JI8F 4DV7J 2B9XA 1NSPA 2YWFA 3W66A 3M30A 1MMDA 1UMJA 1AZSB 3AA8A 1Z4UA 3LP2B 2YWGA 3MHYA 4USMA 5L1KA 2VFRA 3QIPB 3THPA 2FC9A 3KK2B 2AV5A 2MY7A 3KHHA 2WVFA 5E3QA 3HVWA 1UEVA 3L9ZA 2B4OA 2GHWA 1ZH5A 1HMVA 3JSYA 2UUAJ 1TUVA 1KNZA 3QFWA 2IAJB 1W7WA 3DKDA 2LXUA 4I64A 5T41A 2VL1A 3PTWA 3TARA 1WG4A 4WPAA 2MEWA 1JLGA 4QWBA 1H7WA 1WEYA 1KLMB 1OMSA 3DYAA 2N4CA 2G2ZA 2NXNA 4HT5A 3R5DA 3CCES 1F9FA 3FEYB 1GH8A 4NXNF 3NGRA 2YQ1A 2DGUA 1WWHA 3C14B 1UJ5A 2VD3A 4F3QA 2DPIA 5IT9Y 4ZCKA 1FDAA 2ASJA 2AGOA 1NM2A 1ITPA 3MPUB 2HGLA 4J9QA 2D1CA 5GAEU 3CJRA 4KQZA 4K4SA 4ITSA 2ZDOA 1NKBA 2HRYA 3T41A 1GEHA 1RWWB 1ZETA 4ZS6A 4DSKA 1TVRB 2HHUA 1NJZA 3JTPA 3KMSA 4PG6A 1NEEA 1OQ3A 1MMLA 1TV6A 2MQLA 4U95A 3NY0A 4GVBA 4DWIA 2P6TA 5ETQA 5KOWA 3SSRA 4BWMA 3FCHA 2VASA 5ETNA 3NLCA 1PCAA 5E41A 3OJUA 4DFPA 1DZ5A 4C6AA 1H2TZ 2I5JB 3WZ0A 2KFZA 2XMVA 2AEMA 3FJ2A 4IRCA 2IYGA 5SZTA 5FDLA 3HFZB 3QWUA 3ENQA 1IR2A 2AJ1A 4DFMA 3TQEA 1NH7A 4ZP6A 2R7VA 1KTQA 5C7PA 1NDLA 2B6AA 3T9NA 1KDNA 4DR2F 1RTJA 2JDJA 4M5MA 2LDIA 5DDOC 1PYOB 3EZOA 2VZ9A 4XO0A 4RWWA 1BQNB 4DV5F 4XPEA 5K5MA 2QT7A 4OHWA 4DXLA 4GO7X 3W65A 3FBCA 2F8MA 2HVZA 1X4CA 4X66J 4W92B 4OI3A 1GFWB 1VR6A 1WJ9A 1KN6A 4OV1A 1N88A 1FEEA 1XMBA 3RJMB 2X7IA 3PJXA 2FJDB 3QMQA 2CG4A 1LWFB 1Q5VA 4M5KA 4FYWB 1R43A 1C4AA 4ES2A 1RTIB 2E7VA 3PYGA 1QDUB 4KRWA 4RO0A 2FY8A 4N47A 4O3SA 4DPUA 3I0RA 2FJWA 4Q8EA 1LWEA 5D77A 4EU0A 5DG9A 2HBZB 1RABB 2MKKA 3CC2S 3RB3A 1RA6A 4RNHA 3T1YF 2EKNA 3HO1A 3D0HE 1TAUA 3K8WA 2GC8A 3NNAA 4ECUA 4EZ6A 3QFHA 4AL5A 4UOFA 4NYOA 4EMDA 2VBXA 3SIPB 2HAFA 4K4VA 2HW3A 1VQ4S 2OEMA 5GMEA 3TUPA 5D0EA 2R7UA 4PQUB 4IOAQ 4Y00A 3EVWA 1VBZA 4BS2A 5IC6B 4YFUA 1BXNA 4P74A 4OI6A 2YKOA 1YKWA 5HBMA 3MPYA 1RI7A 2R8JA 1FF2A 4IFYA 5H9FJ 3PO4A 3IWLA 2H1YA 1FRKA 1FEHA 4ER8A 2ZH3A 2Z4PA 4NLOA 2QC3A 2KG1A 1WELA 5A0YB 4JI3J 3MM5A 1NDPA 3PW0A 3DI6A 4DL4A 7FD1A 2CXEA 5DGBA 4RW9B 3T1HF 4DFJA 2I2YA 1GXUA 4WZQA 4N77A 1D3WA 4LSZB 4ZLLA 5KFWA 2YPZA 2DCLA 3A3PB 4ZPDA 5E2QA 4RL1A 1Q7YT 1YJWS 2DXEA 2GNKA 1VBYA 2J9EA 2EFVA 3DRXA 3HPOA 4WFNQ 2EK1A 4BC9A 2YNHB 1TK5A 1U1PA 4PG5A 2L9NA 3C15A 3BV8A 4IKAA 3PACA 4ELUA 1Q8KA 4Q44A 3M9OB 1RE1B 2MQQA 4FNIA 3Q8YA 3GIIA 2ZUAA 3QAEA 2P2CB 3DRPA 3ILIA 1WC1A 2M5YA 2VG5B 4C48A 3W60A 2HQ3A 2DHSA 2CZ4A 4Q45A 4OYOA 3GR1A 5B7WA 1B70B 3HHLD 2E1MC 2V8GA 1FVSA 5KFAA 4KAIA 4IQMA 4DN0A 4ECSA 1HHTP 3IRWP 3Q23A 1LXJA 3OT9A 4NEZA 1ULRA 2CPXA 1J5OB 4IG0A 3MEEA 2V8HA 4I56A 1FWPA 3GV8B 2ZHAA 2QGFB 3WDOA 3BQ1A 1F9EB 5GMDA 2PI4A 3SZ2A 2DGVA 3GP9A 5ETVA 2HFVA 2ASYA 3BBBA 1TELA 3T6JA 3NNHA 1RT2B 3MEDB 3ZZYA 4RUAA 4R0JA 4ZLPA 2ZFHA 3UFCX 2AT1B 5HP1A 4WTYA 3ULHA 2E1RA 1VQSA 4ANCA 4C3MA 1WHYA 3OFFA 4YHHF 2XI2A 3GU0A 5CQGA 3TZZA 1S1TB 3SQOP 2BJ7A 2ROPA 2NCKL 3AD7C 2VFTA 1TQLA 1FE0A 3M6XA 2EBGA 3ZTPA 3R5BA 2FPHX 4JI5J 3VALA 1N5YB 2E5LJ 1QJHA 3HJFA 2V4RA 4YB6A 4ZLNA 5BYSA 2W4PA 1F5CA 3BREA 2B7CB 2FJEB 1NJWA 3VAIA 1Q95G 3CJKB 4QWEA 4LBPA 2B9EA 4DUYJ 2XGPA 2R7QA 4PEOA 4FF1A 2APOA 4HTIA 1WACA 3QT5A 5U47A 1GMUA 2XO7A 2HVEA 2VBWA 3CCUS 4BHQA 4KTQA 2DGWA 1AW0A 2OIHA 3UWTA 1A0OB 3W5ZA 4IDKA 4OI1A 3I0SB 1MWQA 2FZGB 4J9VA 2YY3A 4LF6J 4KYZA 5BJRA 1Y5IB 4O44A 3UN3A 2Q6BA 1CQMA 2DD8S 1GXTA 4FKYA 4N56A 2WONB 2YKNA 1Y7PA 1Y3KA 1XBWA 2HIYA 3KK1B 3KLFA 2WOMA 1V3ZA 2VQEJ 4QCLA 4UOGA 1X4BA 3MUVP 4TNOA 3CCMS 4UTGA 4DL6A 4KFBB 5GADI 5F8JA 3UNGC 1F60B 4DSFA 5DDPC 3TEHB 1HQUA 2QLFB 3LP2A 1R89A 1DFDA 4CLPA 1V6HA 3QIPA 2IFXA 2JVOA 3ZZOA 1S48A 2Z0GA 3KK2A 4UF4A 3ISZA 2XMAA 1YRUA 3D66A 1FTCA 3M32B 1YVFA 1APSA 4LVNP 2IAJA 3ELHA 5LJ3Y 5HROB 2ZVSA 2PMHA 3EXCX 1AROP 2BJ9A 4O3PA 4MFBB 1KBRA 3A3NB 2VPWB 4FVMA 3TZWA 2OPRB 1NPPA 2ZUGA 3BZQA 2RE1A 3UVJB 4L3KA 5HATA 2KB2A 2VA2A 4DEZA 1XTZA 3FEXB 3PR4A 1FRXA 1KLMA 4ZOSA 3AAWB 2HLUA 1KONA 3BM7A 4X65J 2PFDA 1RDRA 1K47A 3OVSA 5ETMA 3KJNB 1MWZA 3J81U 3V4IA 9ATCB 3C14A 2W2QP 2HPUA 1C4CA 4G6VB 2MKIA 1URNA 1YDLA 3RAXA 1X5SA 2O5DA 1ELOA 4NI2B 5E3AA 1QTNB 2FZCB 1IBLJ 1TUWA 4DCOB 1FX2A 1OY9A 2VF3A 2R2TA 1TVRA 3R6GB 2EG2A 3DLKB 2YX7A 1R3NA 3K58A 2PT0A 1J5EF 3MUMP 4L76A 1IQZA 4K0KF 2WSFC 2V68A 2F9DA 3PKYA 1T03B 1XERA 3PX4A 1NHKL 3H98A 3K57A 4ZITA 3EVMA 4DR6J 4EYHB 2I5JA 3QGIA 2GO9A 4MYTA 2JSXA 1KHWA 2E29A 1VLYA 1U47A 3BO3A 1NDCA 1X4HA 1W26A 4ECRA 2CQCA 2BM0A 3PYDA 1KR4A 2EW9A 2HFNA 3LP1B 1WKKA 1LK5A 1S1UB 5KG1A 2AEJA 3J80U 1HNWF 2V4QA 3AH6A 2WB1D 1BQNA 2FHMA 1BQMB 5F0WA 5KT3A 4J9OA 1CPZA 1ZZNA 1WG5A 2G0IA 3VAMA 2HHPA 4K8RA 2MJNA 1N33J 4DR7F 1X4DA 4K5SA 5HQLA 2EG1A 4NE9C 1V3SA 1C2PA 1LWFA 1XQIA 1ZM2A 5GAGI 3UI3A 5LSOA 5HJXA 1S6QB 1RTIA 4USHA 4F7VA 4H54A 5D4OA 2LFVA 3BH6B 2V5HG 3DLBA 4OJHA 1FFGB 3ADAC 5HVHA 1SKSA 2XC9A 4UQGA 2DKOB 4EYIB 5F8NA 2FLLA 3U1NA 1CBKA 3QQCD 3X3UA 2RSQA 3BKFA 4ZVUB 4NXMF 5ETOA 1NMEB 3OXGA 3I5BA 5EDWA 2RQ4A 1P8GA 2P9EA 2C22A 5DO2A 3TRGA 3FQKA 3ET6A 3M6WA 2JEIA 1X4FA 2VJVA 4DV4J 1CJTB 3UN2A 1REVB 1U2CA 5E33A 3DU5A 2PSZA 3LF0A 3J7YI 1JLBB 2FTRA 4ZVHA 4PQUA 6AT1B 2GCFA 1PYTA 2DBBA 2MJUA 5A8WB 1Y0HA 4EBEA 3MMJA 3AOBA 4F8RA 4BWJA 3D5MA 1S6PB 3N79A 4KIAA 5EX0A 4Y34A 2CQBA 5DDRC 2DEJA 3H42A 2GS8A 4CM2A 4ECQA 3HZEA 3VHQA 5HO4A 3OFEA 2BDPA 2PDAA 1JNRB 1OO0B 2HNYB 3PW5A 5ETTA 2F65A 3RRGA 3QRPA 3M1VB 4M63A 2RS2A 1YQHA 1DHMA 5A0YA 4DV3J 3FVYA 2GV1A 1JQGA 4EO6A 5H9FK 1YJTA 2AZ1A 3BS9A 4RW9A 5MLCV 3KDOA 5EWFA 1Y11A 3CDAA 4P2XA 1QAIA 3OHAA 5ETKA 3THTA 1LFPA 2V9WA 3IBCB 4B3MF 1Q53A 3Q8UA 2FJVA 2V4JB 2QMWA 2ZDPA 1FVQA 1RAFB 3NMAA 1C1BA 3TX8A 5DM6Q 4B9SA 1FERA 2UUTA 2DH9A 2MB0B 2YNHA 3DLHA 1N54B 2UUAF 2BUNA 1HBNB 1C0UB 2CVEA 3GONA 3RAMA 2BBEA 3BO2A 3RRHA 3TEGA 3M8SA 3CO0P 3QBCA 1S0OA 3GYGA 3TNVA 1HHQA 2PEHA 3TWZA 1NCLA 2VG5A 4RZRA 4O4RA 4V1Ak 1XR7A 1SQFA 4CLSA 3BGOP 2UUCF 4NPOA 3IC1A 1KRPA 4H4MB 3QZ8A 2HK3A 5B0AA 5HL7Q 2DNMA 4HT7A 4FP9A 4C97A 1T95A 2XS5A 2P9GA 1MLAA 3DDNA 2HIQA 4N5SA 5LL6d 5IWAF 3NS5A 3I82A 5E3PA 3CCVS 2LCWA 1J5OA 1EKRA 5KG7A 3DLLQ 3Q8SB 3QGPA 4J9KA 3PRBA 2H5EA 2HWTA 3EPGA 2EWHA 3E8OA 3VV2B 2PFFB 2BANB 5AXLA 4J9SA 4NMXA 3Q22A 2P6SA 5DLFA 2R8HA 2DRBA 1JXLA 2QL5B 2I9SA 2KVIA 3DOLB 2DH8A 4RX6A 1RT2A 2KXFA 3ETOA 3MEDA 4LRFA 4YMEA 2XULA 2RRAA 4WFBQ 4C8YA 4IOCQ 5DGAA 1QSYA 4QIFA 2V67A 4OHZA 2CDQA 2LMIA 1E6VB 1UZHA 3J7Z5 1LEOA 3J81j 1U1LA 2M3DA 5IM0B 3MM9A 5J2MA 3N5BA 1S1TA 1I5OB 3NRBA 1VISA 3W2VB 3EZ5A 4LF5F 2EKYA 3FSIA 4USWA 2D3UA 1EETB 2ZJQQ 4O3QA 1N5YA 3GYNA 3W63A 5L9XA 5AXKA 4DR5J 3EE3A 5EGYA 3ZZZA 2HHTA 2XMJA 2OPPB 2LDYA 4O4GB 2XMTA 3OV7A 2CNOB 1TMMA 2PA3A 3CJKA 1NZ8A 4A8WA 3VVTA 1D8ZA 2OEKA 4ZP8A 1Q4RA 5GAHI 3Q2SC 1D9FA 1I94J 3W5YA 3GSDA 4H4KC 2A10A 3VAFA 5DQGA 2CQPA 4OYZA 3MEKA 3I0SA 5G0RB 4Z37A 1KC8T 5FD1A 4CCHA 4DV6J 2FC8A 3CCZA 2Y1RI 3NS6A 3DOKB 2ATLA 1FJGJ 1G7CB 2R7XA 3NAIA 3NS7B 1P6TA 2DR9A 2HVDA 5SUHA 2BKPA 2HFZA 1CSJA 2JL9A 3KK1A 2UXCF 2YTCA 4C7QA 3DMJB 3FFIA 2JNJA 1VQNS 3NCPA 1RLCL 3QIDA 2O3DA 1NK7A 4KFBA 4O3OA 3Q8RB 3D4JA 4LQ3A 1RT6B 2MZ1A 1VRUB 2J6UA 4E2FB 5K8NA 3NXZA 3QLHB 4DSLA 2I38A 1VIXA 3KXDA 3M32A 4IH7A 1A9NB 3ZTQA 3EDRB 5HROA 1Q8IA 3HLUA 2CNNB 2DNRA 4MFBA 2OPRA 2QLXA 2K1RB 2HBRB 1VS3A 3UVJA 2DNHA 3SFGA 3N6NA 1N5TA 2DVIA 5L1IA 3TI0A 5C5JA 4CQ1A 1C0TA 1M0SA 2J6TA 1VQMS 1S7HA 1Q1KA 4ZPAA 3BSOA 5KFVA 3OTOF 5DJBA 2PE8A 1OQ6A 2CJ9A 3IA0A 5BYRA 2QEXS 2EXUA 3F41A 5IT4A 1PAEX 3NEKA 2DR7A 1OY8A 5KFUA 2FUG9 3AB2B 3UR0A 4Y2AA 4RNMA 4FPRA 3C2PA 4DR1J 1JJHA 2DB1A 4NI2A 4OJ1A 4EO8A 3DRYA 2AYEA 1F5AA 5IQ6A 5DQHA 3OUYB 2W2MP 4WF9Q 4JI7J 4JI2F 2EVZA 2CQHA 3EGVA 3K8VA 2J7KA 1SL1A 1HNVB 4USIA 1PJ5A 3SV3A 2B9YA 2HNDB 3M8ZA 1T3NA 3KG1A 4TLRA 3H5XA 1T03A 1V5VA 2EBEA 1IKXB 4YB7A 1FDDA 2MZRA 2CPDA 2G2YA 1BD6A 2F5GA 4P2MA 1B7YB 2CQ0A 3KHLA 1IM6A 3EMTA 4YN3B 4JV2A 4LJMA 3TZYA 4X2BA 2KKHA 3ZTSA 3ILLA 4ZK7M 3PEJA 3LP1A 2CQIA 3BPSP 3W9IA 2AYMA 1S1UA 4I6YA 1T11A 2R8GA 5D8HB 2BZ2A 2L9WA 1BQMA 3TANA 2R8KA 1UFKA 5EWGA 5K8MA 3D1OA 5IOLA 1HPZB 1U7LA 1NBEB 4Q2LA 2C2KB 1PKUA 4UUWA 3CTRA 4DSJA 1M1GA 3KLHB 2NXCA 4Q43A 4NZ6A 1SJFA 6FD1A 2VQFJ 2WVCA 4GVLA 1UFLA 1JKHA 1TUGB 1WC0A 1ZS6A 2ZOMA 1SJ1A 2IIHA 4OYAA 1L3UA 5A76A
chains in the Genus database with same CATH topology
1R6YA 3MI7X 4O0IA 2OFGX 2XCPA 1K0VA 1SIZA 1J2VA 4KC5A 1HHSA 2RILA 3TOQA 2B4PA 3UCGA 1S6QA 4O44B 3I9ZA 3N9UC 5LSLA 2RQCA 2KDOA 2RKIA 1VQKS 3QJPA 2P9CA 5I42A 2DCUB 2FHJA 2LA6A 3HVRA 3SI8A 1NB7A 5E5NA 1X5TA 4NMLA 2ZOFA 2CQGA 2R8KA 3JSBA 2YKNB 3C46A 4NCBA 1ZPVA 4CI0B 2R9LA 3IFEA 1T05A 1R7IA 2M8HA 2DIUA 3PEHA 3GYXB 4GKKF 1Q78A 2CPFA 4QPXA 4IOBA 4NA1A 3MM8A 1DAXA 3TVKA 4PXBA 4JI8F 3MOZA 1TKZA 4K4WA 2G9OA 3EGWB 2ZJPQ 4F25A 3C6TB 2B9XA 4F4WA 4ECWA 1RYRA 3OR2A 2A2DA 2YWFA 4ECVA 2K3IA 1HQEB 1FE4A 1JJ4A 2LEPA 3M30A 2MXYA 1MMDA 4FF3A 3PHEA 4NYZA 1S1XA 1S99A 2ACYA 2EFNA 1Y00A 2DK2A 2KHDA 1UMJA 3FMWA 3IBWA 4M5DB 3AA8A 1Z4UA 2R2RA 4DN9A 3NAHA 5JXSA 2JVRA 3LP2B 2YWGA 3MHYA 3OL7A 5L1KA 2VFRA 4JI5F 1XNQF 3QIPB 1LFWA 2MSSA 2FC9A 3THPA 4DR4F 1RT5A 1IKXA 3LUYA 2M0GB 4OI2A 4PG7A 3KK2B 2AV5A 1JK9B 2MY7A 1UEUA 2RUGA 3KHHA 1QVGR 5E3QA 3HVWA 1UEVA 2R4FA 2ZH4A 5DDQC 3M2VB 1S76D 2QMXA 1VBXA 1MROA 4URQU 4HKQA 1FESA 2B4OA 2RNEA 2FJAB 2GHWA 4KHMA 4OX8A 1HMVA 3D1HA 2VA3A 4V19J 2FVSA 3JSYA 1WF1A 1ZH5A 5ADZA 4U9RA 1TUVA 1KNZA 2ZNYA 4MKYA 1NU4A 2QA4G 2IAJB 1QVFR 2AGPA 3CCQS 2LXUA 4I64A 3JSMB 1REVA 1UVLA 3ICLA 1HR0F 2IA6A 2W9CB 4RU9A 4C8YA 1BC6A 5T41A 2VL1A 4J37A 1JLBA 3TARA 4J9PA 1WG4A 1T94A 1G6BA 2HFOA 2D74B 3VQTA 5F8MA 1CLFA 2LU2A 2KYZA 1BQXA 1JLGA 5A8WA 2AF6A 4QWBA 4WZMA 1H7WA 2XY5A 4L3NA 1WEYA 3E01B 4PKDB 3UW1A 3KTQA 1S6PA 1KLMB 4XPCA 4YUDA 2VH7A 2RU3A 1NK5A 3IGVA 2D41A 1SKRA 3DYAA 2X1GA 2N4CA 4DJBA 4RW6B 3SFUA 2XS7A 3BEGB 1SB6A 4IFVB 3G86A 2GMLA 4HT5A 3R5DA 5K8PA 3CCES 3MMCA 1F9FA 4K4UA 3FEYB 2W7PA 2ZH6A 4NXNF 2BACA 1GH8A 3L09A 4IRDA 3LPYA 2HNYA 4I6WA 2GX8A 2L41A 3J7A1 1B0TA 4DG1A 2DGUA 2IA0A 3M1VA 1WWHA 1IJEB 2AQ4A 1HW8A 1IKWA 3G6XA 1UJ5A 3KLHA 5BYQA 4PPZA 2VD3A 4F3QA 5K8OA 3AJ1A 2XLJA 4RBVA 2DPIA 5IT9Y 4CT8A 4RNFA 4ELVA 1FKPA 3NCRA 2G4BA 4L6V3 3W3SA 4YB5A 4ZP7A 5B08A 1DRZA 2RD5C 4ZCKA 1XC9A 1FDAA 4MK9A 4F4KA 2ASJA 2AGOA 4PPDA 3T19A 2C42A 3LGNA 4ES3A 2HGLA