1IKVB

K103n mutant hiv-1 reverse transcriptase in complex with efivarenz
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
423
structure length
404
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords POL POLYPROTEIN
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 97
structure length 404
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikvB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikvB03
3TAMB 5KFPA 3C6TB 4I2PB 2FVCA 1JKHB 4ZHRB 3LP0B 1UWBB 1HNVB 3V6JA 1FK9B 4ECTA 1JLFB 2XGQA 5KFBA 1XR5A 1HPZB 3GYNA 2GC8A 1TKZA 2HNYA 3EZUA 2ILZA 4J9MA 5KFCA 2B43A 2R8KA 4LQ9A 3IRXA 1ZTWA 4FS2A 5KT4A 2YNFA 5J1EB 4EBCA 3DLEA 3DLKA 4I2QB 5L1IA 2ZD1A 5T14A 1JLEA 2XCPA 3EPGA 1S6PB 3PVXA 4ECWA 3RB4A 2VG6A 4LSLA 5KG5A 1S9GB 4JUZA 1DLOA 1QAIA 1LWEB 3DI6A 4EO6A 2BRKA 4ECVA 3T5JA 3KMQA 1LW0A 1D1UA 3LP2A 3PHEA 3NL0A 3V81A 3QYYA 5L1LA 2BR0A 3CO9A 4ICLB 1OS5A 4R5PB 4PWDA 3PJXA 4NLQA 3G6VA 1S9FA 3H5XA 2VG7B 4IG3B 1U09A 1IKYB 4J9OA 2ASJA 3KK1A 2OPSB 4NLSA 5KT5A 4IH6A 3H5UA 1N4LA 4YR3A 3LP1B 4RNNA 3T5KA 1KLMA 5KFGA 1IKXA 5DG8A 1S9EA 1S1WB 4IFYA 3QGIA 4EBDA 5J2MB 3DM2A 5HROA 1FKOB 3PR5B 3KK3A 3FQKA 4TYBA 5KG3A 1RT4B 3HVTA 3I0SA 3Q8PB 2IC3A 3QZ7A 4J9QA 3QO9A 3D5MA 4Q0BA 4K4YA 1XR7A 1RYSA 2J6SA 2V9WA 4IRDA 1C0UB 1HQUA 3V6DB 4M95A 5DLFA 1S97A 3NMAA 2W7OA 1T03A 3BR9A 2W9AA 2B5JA 4LQ3A 5HP1B 4GC7A 2ALZA 3DLGA 3MFIA 3E01A 4DL6A 4G3IA 1C1CB 5HBMA 2XI2A 4ZVHA 5KFOA 4ED8A 5KG4A 4YP3A 3Q8QB 4ZPBA 1HMVB 4ECRA 3DOKA 3TAMA 5I42B 2BRLA 1SH0A 3BQ0A 1RT3B 4O3OA 5JXSA 4NCGA 1JX4A 1EP4A 2D41A 4ED7A 5CYQB 1LWCA 4TXSA 5J2PB 4MK8A 5KT6A 3TQ1A 1HPZA 3H40A 4IFVB 3NGDA 3IN5A 2R2RA 3BSCA 3DDKA 4YR2A 3MFHA 3MR5A 2W8KA 5KFMA 2HNYB 1I6JA 2V4QA 3CJ3A 3H59A 3KHHA 2D3ZA 3IRXB 2QV6A 3JYTA 4IH5A 3PR4A 2YNFB 4NLTA 4ED3A 4DL3A 4DL4A 3BGRA 1C2PA 3DLEB 4GC6A 1RT7A 2ZD1B 4ZP6A 1JLEB 2R8HA 4RNHA 1LW2A 3KK2A 2VG6B 2R2SA 4ZP7A 4RUAA 1DLOB 2FJXA 3DI6B 3HVWA 2HWIA 4JV0A 3DOLA 4O3NA 1LW0B 5K14A 3UR0A 3LP2B 2R2UA 1SUQA 1DTQA 2WHOA 3IG1A 4R5PA 5KFJA 2I1RA 2VG7A 1C1BA 4IG3A 3V81B 4ZVGA 3H2LA 2OPSA 4KFBA 1FKPA 4TY8B 4PWDB 4NLUA 1N6QA 2EC0A 3KK1B 3KJVA 2W9BA 5L1JA 1Z4UA 4MKAA 4IQXA 5J2MA 5KG2A 1XR6A 2AX0A 4WFXA 1KLMB 1IKXB 1RT4A 1S9EB 4Y2AA 4IFYB 1C0UA 3DM2B 5HROB 5F8NA 3KK3B 4YQWA 4YR0A 1RT1A 3I0SB 4ECSA 4F4YA 3PW5A 4Q0BB 3V6KA 1HQUB 2C2EA 1T03B 3M8PA 2B5JB 1MMLA 3QGHA 5J2NA 4K4VA 3ITHA 3I5BA 3OL7A 3KLVA 3RB6A 5HBMB 4XO0A 5KFLA 5C42A 1NHUA 3IGVA 1LWFA 5I42A 5JUMA 4QW9A 5F8JA 2OPRA 2OPPA 1JXLA 5EWEA 3KLHA 1TL1B 3RAQA 2WRMA 2YNHA 3ISNC 1RTDA 3DOKB 5CYQA 3V6HA 5J2PA 3NKYA 2J6TA 3QIDA 4ECQA 4FBTA 2FVRA 4NCGB 3GIKA 1EP4B 1IM4A 3RBDA 2C2DA 1SV5A 4IFVA 3T19A 1LWCB 3CJ4A 4NZ0A 3VQSA 1KHVA 4IOBA 4KE5A 4NRTA 3M9NB 1S4FA 4Q43A 3OSPA 3TVKA 1S1XA 1N56A 5F8LA 2C28A 4KV8A 1K1QA 3T5HA 3OL8A 4WXWA 4MIBA 2BQUA 1RYRA 4EBEA 4KHMA 4J9KA 4QPXA 4K4SA 4ED2A 4H4MB 4Q8FA 1MU2A 1RT6A 4IR1A 3JYTB 2R8JA 4QWDA 3BGRB 1TKTA 3MR2A 1RT7B 4NLPA 1LW2B 1D0EA 3GV8B 2W9CA 3KK2B 5FDLB 1RTIA 2QE5A 3QZ8A 4NLRA 3DOLB 1RA6A 5EUHA 5K14B 3RAXA 2ATLA 2WTFA 4TY8A 1SUQB 1DTQB 3IG1B 4RW4A 1ZETA 1C1BB 1DTTA 3KLEA 2FJWA 3FRZA 3DRRA 3Q8RB 3H98A 4KFBB 1FKPB 4IRKA 3BSNA 1S0NA 2IJNA 1JLAB 4H4OB 4ZPDA 3DYAB 1N6QB 4DEZA 3KJVB 1S0OA 2W9BB 4K4WA 2RF2B 4WFYA 2WOMA 1TV6A 2ASDA 3BQ1A 5C24A 2VA3A 2UUWA 2I5JB 3DMJB 4RUCA 4TYAA 1RDRA 1SH3A 1YVFA 3G6YA 4O3SA 4NLXA 5KFRA 1RT1B 1T3NA 4X2BA 3CWJA 3D28A 4PUOA 4NYZA 3N6LA 4NLVA 3KLGB 4TN2A 5F8HA 3EPIA 3M8PB 4RW7B 5KFXA 4HKQA 1IKWA 5EWFA 1SH2A 5J2NB 3ITHB 3CJ2A 2BQ3A 1TL1A 2JLEA 4KKOA 5DQIA 4R8UA 1TVRA 5C42B 3BJYA 1LWFB 2ZE2A 2D3UA 4NLDA 2OPRB 2OPPB 3MEEA 1BQMB 2W8LA 4HYKA 3KLHB 3RB3A 1REVA 4O4GA 2YNHB 4DG1B 1RTDB 4LSNB 3GIMA 4WZQA 4ECXA 5J2QA 2HAIA 2C22A 1RT2A 3ICLA 3H4DA 4Y2CA 4MK7A 2ASLA 2JEGA 4MIAA 4TLRA 5KFSA 4TQRA 3KNAA 5KFNA 1SV5B 5EDWA 5KFVA 4F4XA 3UPFA 4J9RA 1S1XB 3KLFA 2IM0A 4IKAA 5KG7A 4WZMA 4RW6A 1S48A 3HHKA 5KT2A 4KV8B 2W7PA 3MECA 5DQGA 4H4MA 4OL8A 4IR9A 3MEGB 2YNIA 3QLHA 2C2RA 4RW9B 1RTHA 4M94A 4O44B 3LAKA 1QUVA 5DQHA 2RKIA 1MU2B 1RT6B 3UQSA 2BQRA 4B3OA 5FDLA 4K4TA 1TKTB 2JEFA 3GIIA 2GIQA 4Y3CA 1N5YA 4Q45A 4I7FA 2W9CB 1TP7A 2IAJB 4ECYA 3JSMA 1RTIB 1NHVA 1T05B 1K1SA 3UDLA 5D3GA 2BANA 4NRUA 1R0AA 4WYWA 1JLAA 4H4OA 1GX6A 4RW4B 3CVKA 4KBIA 3DYAA 3QGGA 3KLEB 1DTTB 4KB7A 1S6QA 3DRRB 3KLIB 1JLBA 1ZTTA 4MFBA 1KHWA 3HKWA 2RF2A 5CYMA 2HWHA 4URQU 4ED0A 1S1TA 5KFFA 3MTKA 5DG7A 4K4XA 2I5JA 3DMJA 4PQUB 3FDSA 1TKXB 3SFGA 3BSAA 1NNDA 1TV6B 2WOMB 2FVSA 2ILYA 5KFDA 5C24B 3MEDA 1BQNB 4G1QB 3CJ0A 4ID5A 5KFAA 4EEYA 5F8MA 4ECUA 1HNIB 4K50A 4DL2A 2O5DA 3KLGA 4ZP8A 3MR6A 4IRCA 4RW7A 4PUOB 1RAJA 3MR3A 1C0TA 1JLCA 3OHAA 3M8QA 2UVRA 5KFQA 2XI3A 4FS1A 1IKWB 4J9PA 1BQMA 3GV7B 2CJQA 4KKOB 4DG1A 5C25A 4R8UB 1TVRB 2UVWA 4LSNA 2ZE2B 3MEEB 2HNDA 3SI8A 3OLBA 1REVB 4O4GB 2FVQA 4O4RA 4O3QA 3H5YA 3KHLA 4K4ZA 5J2QB 4WE1B 1RT2B 2FLNA 2JEIA 2OH2A 3OSNA 5I3UA 1TQLA 3LALA 4WFZA 2FLLA 5DG9A 4ECZA 2E9TA 4H54A 4NLGA 1EETA 3KLFB 3T5LA 3MEGA 3T1AA 2R8GA 4IG0B 4RW6B 4RW9A 3QIPA 4O44A 2OPQA 2R2TA 3MECB 3IS9B 2IM2A 5DLGA 1J5OA 4J9LA 2YNIB 3QLHB 5EWGA 4RNFA 4RW8A 1RTHB 4KO0B 5KG6A 4IDKB 3V4IA 3NAHA 4JV2A 1HYSA 1S1VA 4Q8EA 1IKVA 1HQEA 2RKIB 5F9LA 3FFIA 3DRSA 1CSJA 4ZMMA 3PJWA 2XC9A 4B3OB 2FLPA 2IAJA 3NBPA 3H5SA 1TL3A 2VG5A 1N5YB 2WK4A 3LAMA 1T05A 2JEJA 4EYIB 4FBUA 1RA7A 4I7FB 2HNZA 3I0RA 3RB0A 5KFKA 3JSMB 3G6XA 5D3GB 2BANB 3KLIA 5KFEA 3CDUA 1R0AB 2BE2A 1JLQB 5C5JA 3PW0A 2E9RX 4U7CA 2V4RA 5L1KA 3C6UA 1S6QB 3KHRA 1JLBB 4MFBB 1VRUA 2WONA 4PQUA 1TKXA 1HARA 2B6AB 1T94A 1VRTB 5CYMB 3G86A 1QE1B 4NLWA 3KMSA 3KHGA 3PW4A 1S1TB 1BQNA 4G1QA 3DRPA 1QAJA 5KFWA 4U6PA 1GX5A 1HNIA 4WXOA 2R8IA 4J9NA 3MEDB 4XPCA 4ID5B 4EYHB 2AX1A 3N6MA 4EO8A 3FQLA 5KFZA 3GILA 2YNGA 5KT7A 2YKMA 2UVUA 2HMIA 5KFYA 3N6NA 2RDJA 3KOAA 1C0TB 2F8EX 1RT5B 1JLCB 3M8QB 4URGA 1S1UA 3PW2A 4K4UA 3CIZA 5C25B 4ED1A 3CJ5A 2IJFA 1RTJB 3SFUA 3M9OB 2XWYA 4WE1A 3FSIA 3LANA 4F4WA 2HNDB 4Q44A 4KSEB 2CKWA 5HLFA 4QWCA 5F8IA 4ZP9A 1JLGA 2YKNA 3GIJA 4IG0A 5I3UB 4XPEA 1S49A 4MK9A 4QWEA 4WYLA 4R0EA 3IS9A 4RZRA 4O3PA 1EETB 5F8GA 3BSOA 4KO0A 3QIPB 4IDKA 3C6TA 3E51A 2OPQB 4I2PA 2FJVA 3ISND 1JKHA 1J5OB 4ZHRA 2WB4A 4KAIA 3LP0A 4RW8B 1WNEA 1UWBA 1HNVA 3V4IB 3NAIA 1HYSB 4KHRA 1FK9A 1S1VB 1IKVB 1HQEB 1JLFA 5L9XA 3FFIB 3DRSB 2DPJA 4F4ZA 5KFIA 4DL5A 3NBPB 3IGNA 4YMEA 3OHBA 4TQSA 1TL3B 2VG5B 2ZKUA 2FVPA 2JC1A 2XCAA 2DPIA 2IM1A 3BREA 2HNZB 3I0RB 3GQCA 5J1EA 1TKZB 1JLQA 5KT3A 4ZPCA 4I2QA 5KFUA 4QWBA 4QW8A 3PW7A 4J9SA 2WCXA 3RBEA 2IBKA 3BQ2A 1S6PA 2B6AA 2BE2B 1VRTA 3GV5B 4Y34A 1QE1A 1S9GA 3DLKB 1LWEA 3C6UB 4DL7A 4IH7A 2UVVA 2RDIA 1VRUB 2WONB 2GIRA 2AGQA 2IA6A 4LSLB 3DRPB 4ZVFA 4ICLA 3Q8SB 3H4BA 3CDWA 1S0MA 4F50A 1IKYA 4URSA 2IM3A 4MH8A 2YNGB 2VA2A 1RT5A 2YKMB 4RNOA 2HMIB 3LP1A 5KFHA 1N48A 1S1WA 2V0NA 4RNMA 5F9NA 4JV1A 2E9ZA 1FKOA 3CDEA 4TY9A 3I5AA 4MKBA 2J6UA 1S1UB 1RTJA 2JC0A 4ZPAA 4RU9A 3HVAA 2D7SA 2AGOA 5KG0A 2UUTA 5KFTA 3V6DA 3MF5A 2AWZA 3HVTB 1S10A 2IC3B 3QO9B 3OL6A 3M9MB 5HP1A 1W25A 4QWAA 5HLFB 2AU0A 5DGAA 1C1CA 2AQ4A 4NLOA 2AGPA 4O3RA 4NLYA 3OL9A 3DLGB 3E01B 1JLGB 1HMVA 2YKNB 4ED6A 2XGPA 3OLAA 1RT3A 3PZPA 2IMWP 5DGBA 5KG1A 4ZVEA 1JIHA 3I5CA
chains in the Genus database with same CATH superfamily
4N8OA 3QT8A 1S79A 2XTJP 2L08A 4MIWA 2ZHAA 5L1IA 2DR5A 2POKA 1XEZA 1HLWA 2XCPA 4ZK7M 2ZNYA 3T5JA 3NL0A 1HHSA 5L1LA 3BZQA 5J1NA 1EB0A 5JVGQ 4DV3F 4NLSA 4RNNA 2CQ2A 2QN6B 2VJVA 2A2CA 3MPWA 3S8SA 1P9YA 2B5JA 4G1IA 5B0BA 4F3QA 1A6LA 2OSRA 1UJ4A 1Q5VA 3VF0B 3OTOF 1L3KA 4AL6A 3BGOP 2WVEA 3M32A 4UQTA 2JHEA 4OYOA 4HHHA 2JOQA 4DLGA 1FA0A 1ROFA 1OSCA 1X9MA 2KVQE 4QQBA 1DQ8A 3OVAA 2CRLA 4ED3A 3LH2S 3PEJA 3DOLA 4NXNF 1SUQA 2VG7A 1Y7PA 4A8MP 2OPSA 1XNQF 4PWDB 1EX8A 3KJVA 4NCBA 1IKXB 1IVZA 3MPUB 1GMVA 2HFSA 4DV3J 1YG0A 2Y8WA 2G2YA 2KB2A 1AZSB 3BH6B 2VC1A 3NKYA 3MUMP 1SC3B 1U02A 1CJVB 4OYBA 2YX4A 1V5IB 1F60B 3OTOJ 1G6BA 1JXVA 1DQAA 1KWMA 3BPDA 4K4SA 4YN3B 1MU2A 2OSQA 3CE8A 1HWJA 1LW2B 2QE5A 4NLRA 3IM9A 3SQGB 1NKCA 4DPWA 2FJWA 3BSNA 1VGYA 4DEZA 2CQBA 4NXNJ 2V67A 3HI9A 4ELVA 4OJ1A 2KZMA 2V8DA 4KGZB 3PO5A 1NEEA 4TN2A 3N5BA 4RW7B 3MD3A 1FCAA 3VGVA 4R8UA 4HYKA 2L9DA 4GVBA 2BDPA 4MK7A 2JEGA 4JI4J 4LFCF 3MPYA 3OFEA 2YWKA 3KG1A 1NKBA 1KOHA 1S48A 1CLFA 3ZFVA 5HMWA 3CC2S 3DLLQ 4EI2A 1L3SA 4Y3CA 4OYIA 1B99A 3RGIA 4RW4B 3CVKA 4URQU 1S1TA 2P9EA 3DMJA 1TKXB 3TP2A 2WOMB 4LT6A 2GJFA 2JVOA 4DBQA 4EEYA 3MM5A 3N79A 5B0EA 2FQQB 2XO7A 4WBFA 1VHIA 3JAMU 2HKEA 4RBUA 3DDIA 1RT2B 3OSNA 2ZBIA 3B54A 3MI7X 3IR5B 3PM9A 2Y0SD 4LFCJ 4F36A 1NK7A 1HYSA 1JJHA 5D15A 1FDBA 4NCAA 2BA9A 2ROGA 3DRXA 4XAKA 4JP8A 3LAMA 5K20B 2JEJA 2J9DE 4L6V3 4ZLPA 4PPZA 5D3GB 3CCQS 4P73A 1R0AB 4YY3F 3CJTA 2EK6A 3NOGA 2W2MP 1FWLA 2AZ1A 4EO8A 2WSFC 5B09A 3RRKA 2FJBB 1TK5A 1RCXB 1M1GA 2J7WA 4URGA 1YIJS 1CULA 4DV1F 3SFUA 4QU7A 2F8HA 1YZ6A 1SKUB 2AJ0A 1X8DA 1DHMA 2K2PA 1M5OC 1JLGA 1PO6A 4CIOA 3W2VA 1KQGB 1S49A 1EETB 3BSOA 1SPBP 3G2XA 2BJ3A 3S6EA 4ANEA 3CJQA 2ZZMA 2Z2MA 2J0QD 5D4LA 2HRTA 4RL1A 3AXKA 1LQ9A 2W7AA 1FRXA 3D4JA 1JQGA 2JRSA 3TJ9A 4ZJQA 1GT8A 3MAAA 4YY3J 3MM6A 2VPWB 2ZH7A 1RTJA 3UN3A 3BYRA 1B3TA 4WCEQ 2PEBA 3C6TB 3NXZA 4KY3A 1REGX 2ILZA 4OJ3A 2QLXA 3B82A 3BM7A 3DKDA 4JUZA 3H25A 3P96A 3PX6A 1RAGB 4WF9Q 4ICLB 1Y10A 4OIXA 3H5UA 3OTEA 2E5GA 3G71S 2AD9A 1GMUA 3D5MA 2L3MA 1HQUA 4M95A 2MQNA 3TAQA 5HP1B 4YP3A 2HBQB 2PN6A 3FC9A 4O3OA 2BOPA 1S7IA 1ZAVA 4ZJOA 3TUPA 5CYQB 1GTHA 2E1RA 2DR6A 3LPYA 4IFVB 1FRLA 3BSCA 3EGZA 2LCWA 3MR5A 5KFMA 2CNOB 3AH6A 4DL4A 4USKA 2WSCC 1LK7A 2RQ4A 3K57A 1RSCA 2BJ7A 5A6PA 3AOCA 1FFWB 3V81B 3H2LA 3N01A 4PXEA 4JI3F 1KLMB 4F0KA 1F9HA 1WF0A 2H48B 2MJNA 4EU0A 4B9LA 3DHXA 1J2VA 3B4DA 3OQ2A 3MGJA 4FPRA 3RB6A 4XO0A 4J91A 3A8KA 3KLHA 1TL1B 5B7WA 3R7BB 4ECQA 2RHSB 1LWCB 1ITPA 2Z4PA 4NA1A 4J9KA 3UD3P 4B17A 3JYTB 1VIXA 3AODA 5F3ZA 3CO0P 3GV8B 3KJQB 1F6TA 4LVOP 1XTZA 2BX6A 2OO4A 2EFVA 3OVSA 1C1BB 4FYVB 2R7SA 1SXLA 1NHKL 2DRAA 4USTA 4RUCA 4FYWB 4OHYA 3MMCA 4CM0A 4JI3J 3U7JA 4FF1A 4FKXA 1CJVA 4C9DA 2YNHB 3ZO7A 1TK0A 2FDNA 3HSDA 4ED4A 2RU3A 3FZBA 1TUVA 1RT6B 1N52B 1AFJA 1B4SA 4ZLNA 3GIIA 2FUG9 4PWWA 1NLKL 4NRUA 1OSDA 3SEOA 3Q2TC 5CYMA 1LK5A 5DG7A 1SBRA 3SSQA 4MKVA 4DV2J 4RW7A 2ASYA 4ZVSB 3HD2A 3QRQA 2W01A 2HS3A 2MQPA 1VBZA 2NS1B 4QR2A 4A4JA 3JB9k 3H5YA 5K8MA 4N7TA 5I3UA 1HQ2A 2N4DA 2V94A 1BXNA 3IS9B 4GO7X 5EWGA 3LGHA 2OI2A 4NI2B 3O3LA 1RLCL 2VG5A 2HNZA 4L74A 1ZM4A 4EK2A 2B51A 3PW0A 1BMQB 2YPYA 1TKXA 4PRFA 2MB0B 5LJ5Y 3I87A 2XYGB 2QSWA 3J81U 2VODA 3QNWB 3CMQA 2DXFA 2WW4A 1YDLA 3GMGA 2HZVA 2M9KA 2I9SA 4HVZA 4F25A 4Q44A 5FD1A 3UD5A 1X4GA 3GWCA 4WYLA 1JXEA 1Z1ZA 3E51A 3HT3A 4DSIA 4JOUA 4C0OC 4FVCA 4USIA 3D6FB 2V8GA 2M0GB 4DL5A 3PFEA 3TJ8A 3GIRA 4I6WA 2MQMA 4QW8A 3RBEA 3BQ2A 5GAGI 1T3OA 4ZVRB 1N5TA 1YWXA 5LSLA 4LRCA 4LSLB 1A7GE 5HANA 5DDPC 2IPOB 5LM7E 1PC5A 3WQPA 4RNMA 1RKIA 1H2VZ 2KRRA 4MKBA 3HVRA 3V6DA 1TFYA 3J80Y 1S10A 2KFYA 2IC3B 2GJ2A 2Y8YA 4QIVA 3PACA 4P71A 4NLYA 2XY5A 1YQHA 2IMWP 2DNOA 4EBCA 5E3AA 1PSDA 3OFGA 1U0HB 1UFLA 2MZ1A 4UY85 3BEGB 2QMUB 2ZH3A 3KFWX 3V4MA 3BO2A 2EFQA 3SZ2A 1DLOA 4L73A 4WTYA 1ZM3A 3P8BB 2VFUA 1IKYB 3VGTA 4C0HA 4RWWA 2MLZA 2ZH2A 1ICEB 1S9EA 5HQMA 3R1LA 4EBDA 2XY7A 4LBPA 1XR7A 1X60A 4CO2A 4DSFA 3TUJC 2LDYA 4Z7YA 1VQ5S 2XI2A 4ZVHA 1WG4A 4OI6A 4Z37A 2BRLA 4BLGA 3BQ0A 1BGXT 2ZOGA 1JX4A 1R8BA 2PE8A 1WF1A 2O3DA 2DY1A 2N3OA 1YI2S 2RHQB 3R97A 2DHXA 2W8KA 1TK8A 3EGVA 4Q2MA 3TZZA 3OTDA 3M6WA 1LNQA 3R27A 1JLEB 4L3KA 4HHJA 1T0TV 1R8HA 3UR0A 1RLDA 2FJDB 4FYDA 3FZ2A 4Z2XA 2H65B 4IFYB 5L8RC 5DM7Q 4KT0C 5G0RA 1VBXA 1RBAA 3V6KA 5CD4H 4ZLLA 3QGHA 2ZM6F 2C3UA 2HIYA 1U2CA 2UV8G 2OPRA 3HT0A 5CYQA 2Z8QA 2P6SA 4FBTA 4NCGB 2D1CA 4IFVA 3A3NB 4A8OA 1UVNA 4WU2A 1WJ9A 2AYGA 3P5TL 3HD1A 3SIPB 2XYPB 2OUGA 1B7FA 1WC1A 3CCVS 1APSA 2HPUA 1AW0A 4KIAA 4U8VA 2XSJA 1K73T 4Y00A 4LF5F 3LWMA 3SSSA 4I56A 2HLUA 1RDRA 5CZXA 2MDAA 2JH3A 2HHQA 2G2OA 4FF2A 8ATCB 2COLA 5E3QA 1SH2A 1NK4A 1TL1A 4KKOA 2G1DA 1TVRA 1LWFB 2ZM6J 4WU3A 4NZ6A 2VDHA 2UXCF 1SV5B 3DCAA 2QIFA 1N32J 5M2UA 2R7VA 4A46A 1QUVA 3TNVA 3EVMA 1N5YA 3ZTSA 1Q5YA 3UDLA 2BANA 1GX6A 4UF4A 3C2PA 3JQMA 2G0CA 4UOHA 4PR6A 3G6ES 2FVSA 5ETVA 4C0BA 3G9CA 4FPIA 1SKRA 4ZPTR 4LF5J 4EUVA 2PSZA 2DRDA 1C4CA 3UI3A 1B7YB 4IQMA 3WBZA 1U49A 4O4GB 3PIOQ 2OIHA 4B9SA 1OYEA 2FLLA 3MHYA 1CJTA 4HR2A 2NYHA 1L3TA 2UXCJ 1J5OA 2YNIB 5KG6A 2BOAA 2WVCA 5A8KA 4ZMMA 3CIMA 1K0VA 3DU5A 3JSMB 4J9UE 3VR1A 4OI4A 2E9RX 2FGCA 4F04B 1VRUA 1Y3KA 2MZRA 2NPFA 4XPCA 4EYHB 1XWLA 5EN1A 4ZVOB 3OV7A 5HQ8A 4LRDA 1R31A 1S1UA 3MAHA 2ZBCA 1VQ9S 2LEAA 3CMES 4KSEB 1RHJB 3CC7S 1S6OA 3IS9A 4OZJA 2QRRA 2OPQB 4I2PA 3G82B 2XMTA 2E1CA 3ISND 1ZPWX 4RW8B 4NI2A 1S1VB 4DSJA 1IKVB 4X4UA 2EG2A 2IM1A 4ZPCA 2XSFA 4QOTA 2FZKB 1U6BA 3C6UB 1X4DA 3BB5A 2BYCA 3CDWA 3QT5A 1I5OB 2HBYB 5KFHA 5GVQA 3FEZA 2D7SA 1KFDA 4TNOA 4YB1P 3JTNA 4F26A 1GXLA 3HHLB 1FE4A 4ZVEA 1JKHB 5HVHA 1UWBB 2K7KA 2V4JA 3HKZD 1YBAA 1YHQS 1HPZB 3NMRA 2HQCA 1PILA 2B43A 4LQ9A 2CQ1A 5J1EB 2U2FA 1FTCA 2F63A 3VAJA 2D3OR 3WHIA 4LSLA 1CBKA 4CDIA 3KMQA 1D1UA 2DGSA 1YGYA 1M5HA 2HVHA 1MROA 3IC1A 3GFZA 3OT9A 4E98A 1WI8A 3EWGA 5DDQC 4F0HA 1QY7A 1KDNA 1QM9A 4F02A 3FQKA 2IC3A 2H3EB 3NOCA 4RWXA 1EARA 4DL6A 5ETSA 3FBCA 4ECRA 4PXDA 3R5GA 1YJUA 4N56A 3TAPA 4MK8A 1P8GA 2G13A 4DF4A 2OTLS 3EMTA 3D0GE 2FC8A 3H59A 1TAUA 3RUBL 3IRXB 4LBHA 4KH1B 4ZPWR 2FTRA 5HN0A 2Y9HA 4RNHA 3KK2A 4RUAA 1C4AA 1HNXF 4JV0A 3FMBA 1RWVB 4Y6IA 2HS4A 2PC6A 2K7JA 3W5ZA 3UNGC 2UXDF 4DV7J 3DXSX 1TKDA 3K59A 4Q0BB 4RX6A 4LR9A 3TUIC 2OPPA 1FJEB 1Q8IA 2FIUA 4AT1B 2P6TA 2LDIA 5D4NA 3OSPA 3R7NB 4DXLA 2DGXA 4KV8A 4WXWA 2K8GA 3NGKA 3FNNA 4DCOB 2MQ8A 2M88A 5A0YA 1BHNA 2EKNA 1FKAF 5EUHA 3RAXA 3O1LA 2YVSA 3IWNC 2OEKA 3H98A 1CS4B 1HNXJ 2CDQA 5FLXY 4K4WA 5B0DA 3EICA 3IO1A 2I5JB 4NLXA 1NPKA 3CWJA 4PUOA 4OI3A 2UXDJ 3EPIA 3M8PB 1E6VA 4HKQA 4MYTA 2IFXA 3VTIA 2QYGA 1IBLF 3GIMA 2HS0A 5K5MA 4TQRA 4J9RA 1RU2A 3KWMA 5LT5A 2E66A 4M94A 1QD1A 3I56S 2R7WA 1H38A 3UQSA 1TKTB 4WPAA 1WTFA 1BE4A 1D3WA 2DGUA 4DR6F 1CC8A 1HBNB 4N8NA 2PGCA 3QGGA 3VAKA 2Z57B 4ZCLA 2YWGA 3HKWA 5BYSA 3WZ0A 5LJ3Y 5IT9Y 1D9FA 2LKZA 2I6WA 4X4NA 3MEDA 1OY9A 1F3FA 1N33F 4KPYA 4CLFA 4UZBA 4GRSA 5KFQA 1IKWB 3N28A 3RU0A 1Y5IB 2R4FA 1REVB 1OMSA 1IBLJ 2ZH6A 3O5TB 2QSFA 4ELTA 3UE2A 4ZLJA 1RAFB 4KGVB 1KC8T 3H5SA 1IJFB 2J9DA 2PFDA 4TU7A 1WHWA 3POTA 3M8ZA 3NGSA 4FYYB 1DJ0A 4J37A 1ZH5A 2C2NA 4LF1A 1VRTB 4DR6J 2VIHA 3DRPA 1HBMB 1QAJA 4OHXA 1P27B 4GVLA 3C66A 3FQLA 1IM6A 1RACB 2YKMA 1RI7A 2LQ5A 2AEJA 1RT5B 1YJ7A 4XDCA 5LL6d 2MTLA 3M9OB 1N33J 2HQGA 2B4OA 1WG1A 2XLKA 2XLJA 4ZP9A 2YKNA 1U26A 4BS2A 3TX0A 1FJ7A 3K17A 4USJC 2BM0A 1FFSB 4KHRA 1FK9A 3M2UA 1RAAB 5GMEA 4X66F 5CAAA 2XCAA 2ZKUA 5KT3A 3I31A 4CO4A 4JI0F 2VPYB 4Z7CA 4ZIVA 1FEEA 4LF7J 2IA6A 1B0TA 2QLBB 2DYAA 2B7CB 2JFDA 2IM3A 2KHDA 5T7LB 1UVMA 3IBCB 3C14A 4AE5A 1S1WA 1F5AA 2EG1A 4WFNQ 3AJ2A 1DURA 5KFTA 1I3OB 2HURA 1Q8BA 3KYLA 3M9MB 4QWAA 1A9NB 1Q4RA 1C1CA 2KVIA 1S59A 1HMVA 3CCES 1RT3A 3PZPA 3L3CA 2RDDA 4C97A 2HRUA 2GVZA 3MM8A 1SJ1A 1XR5A 4KJIA 2GQQA 3ISZA 5KT4A 4X66J 1X5TA 3UO0A 2VG6A 1KONA 1LWEB 2E1MC 4JI0J 3QAUA 2BR0A 1VQOS 3H5XA 2D74B 4QYZJ 3P4UB 4ILRA 4YR3A 3CD7A 2A3JA 3PR5B 4IRDA 2BJ8A 3BR9A 3I32A 1PJ6A 1X0FA 3FCWA 4QIWD 4HDHA 4YDDB 3Q8QB 4ZPBA 1S6UA 1HWUA 2C1EB 1Q7YT 4ZOSA 3RZAA 3LQVA 3Q8VA 1HPZA 3NGDA 2VFTA 1YBTA 1P1TA 2QT7A 4FF3A 2D3ZA 4U9RA 1RWUA 4DL3A 4RJVA 2IJRA 2KRBA 3HVWA 2HWIA 2MGZA 5CHCB 4PKDB 4X4PA 2Q43A 3PO4A 4C4WA 3IG1A 3HF5A 3OFHA 1WOSA 1X4CA 3CD6S 2KYZA 1D8ZA 3PG9A 3KNGA 3NCQA 3ZZPA 3RR8A 1PYOB 2J0WA 3OL7A 5HBMB 2LXUA 3RR7A 4WP3A 1U6ZA 3RBDA 1KHVA 3CSKA 2AZ3A 3M8WA 3UVJA 1MWQA 3ZZZA 2G4BA 2W1BA 1VIOA 2LU2A 3THPA 3A3PB 2E1PA 2ZFHA 1RTIA 3QZ8A 3OR2B 3HHNB 4OZ0A 5K14B 3I55S 4A8YA 2XULA 2CXEA 3DYAB 2KG1A 2FHKA 4U96A 4PZVA 3I6PA 4LF8J 5GMKa 4OMFG 1WWHA 4A47A 4QIEA 2AYEA 5J2NB 3GJQB 2ZE2A 3MPDA 2W8LA 2R7RA 1FX4A 4ZDNA 1GFWB 4F4XA 1S1XB 3KLFA 4OZ5A 2CQDA 4P2XA 1YX2A 2GGPA 1WC5A 2PA8D 5D0RA 4IR9A 2GCFA 3W64A 1D9DA 4AL7A 2FYXA 1OPIA 4UUWA 3M6VA 2DGOA 3RAMA 2MMYA 1D9AA 4PYAA 3G4SS 2KXHA 1FX2A 4UZCA 3DRRB 1JLBA 2FHJD 3D0HE 2G1HA 1T9WA 1VMBA 2BE9B 5T41A 2EWHA 2I5JA 1Z2LA 4L76A 2XNQA 3D0IE 2IA0A 5H1SV 4AUKA 2B4PA 2BJDA 1BWEA 3W9JA 2YY3A 4A8XA 1TQLA 2MJUA 4IG0B 3QIPA 1MN7A 4N76A 1RWKB 4K59A 2KN4A 1NJWA 1VLYA 2ZWOA 1KRPA 3NBPA 2IDLA 2QZ8A 1CQMA 1HBNA 1WUUA 2ABYA 3BN7A 4AL5A 1J5EF 3MMBA 4OZLA 1M5PC 3TUZC 2DIVA 1S72S 4ELUA 1S6QB 1XNRF 3ZZTA 1HARA 3G86A 4C8NA 5HL7Q 1GX5A 2RH3A 4J9NA 2QC3A 4JI1F 3N6MA 3O44A 3W63A 2C2OB 2MZTA 2KI2A 4CT9A 3KOAA 2R7TA 4CH0S 1RHUB 2RS8A 1CG2A 2OELA 3PHTA 2VPZB 4QWCA 1SQFA 3GIJA 1IBMF 4M5MA 4QWEA 3GFYA 4O3PA 1ZA2B 2CQHA 2E7VA 1UAWA 2E1AA 3MM9B 3QMQA 2DPIA 4IOAQ 2XZWA 1QVGR 2M4MA 4DX6A 5BYQA 2ZJPQ 1S6PA 1VRTA 2M3DA 2GVDA 1HBMA 1T9YA 1J5EJ 3M2RB 4QIFA 5GMDA 3KJFB 2IBOA 3R9LA 1NAQA 1RT5A 3LA0A 2NXUA 2O67A 2MPUA 1VOMA 1OO0B 1FKOA 2AHOB 3CDEA 4JI1J 3P45B 2CPJA 3HVAA 1UEKA 3E3XA 4OHVA 3CD0A 2W4DA 1MW7A 1U25A 4FXDA 2V63A 1IBMJ 3LP0B 5FLXU 1KN6A 3EE3A 1HNVB 1L3UA 2DKOB 2HGLA 3SYZA 2HNYA 1KEKA 4DR1F 2AF6A 2AKWB 3GCWP 4I2QB 1T95A 2FJEB 1DBDA 3CO9A 3PJXA 4ZIWA 5KT5A 3OPKA 3LP1B 4NPOA 2E5IA 1LWXA 3KK3A 4ERDA 3I0SA 4Y28C 1C0UB 2DEIA 1T03A 4HI2A 4GC7A 2V2QA 3CB4A 5B0FA 5KG4A 1SH0A 3ETMA 2DNMA 4NA3A 3W1YC 1P6TA 4MMOA 3OR1A 1IR1A 4OFZA 4HT5A 2ZHOA 3GONA 2YNFB 4NLTA 3BGRA 4GC6A 4ZP6A 2PA3A 2OGUA 3FMWA 4DR1J 3DI6B 3D54A 1LW0B 3HSJA 1YJ9S 4HI1A 4DV4F 5H9FK 4ZVGA 1FKPA 2J7KA 2BACA 5MLCV 4MTPA 2E5LJ 3FSXA 5F8NA 3VAIA 3MM7B 4EGLA 2MKYA 5A2QU 4B08A 3I5BA 4DQPA 4P72A 3RG6A 5M2RA 4C6AA 2Z58B 4IUFA 3DGPA 3V6HA 2UUBF 4ZVTB 4IOBA 4IO9Q 1SIZA 3BPSP 2KFNA 3OJSA 3EZ5A 3NEKA 4ZVUB 5J1PA 1RYRA 4CNYA 2VH7A 3MCOA 3FGVA 2BVZA 1NZ8A 4QWDA 3H42A 1GEHA 4KRWA 4NLPA 4DOZA 5FDLB 2KT2A 5E3RA 2DR7A 4KPCA 3RJMB 2PI4A 1Q8KA 2LFVA 3KLEA 5CA5A 1S0NA 3VAFA 4WK3A 1XERA 1FE0A 1S0OA 5HSPA 1IQTA 2ASDA 4DV4J 1PCAA 1TV6A 2Y1LB 4A8QA 2RNEA 3ZTOA 3ITHB 3ZZ0A 2N7CA 7FD1A 4ENOA 5IV3A 3R5BA 3P5BP 5J2QA 1FESA 5LMNF 3WX4A 2UUBJ 2DXEA 3K89A 4AXJA 4I1TA 1ZM2A 1VQSA 1Q79A 2RKIA 2GFFA 4MT1A 2BQRA 1WELA 4L3NA 1HI1A 2IAJB 1NH8A 4F0MA 2YKOA 4DF8A 3K0JA 4CO1A 3DYAA 1DTTB 1F5BA 5DDRC 1CQNA 2B9EA 4FNHA 4K50A 4KR0B 1PG5B 1RAJA 1JLCA 1N88A 3M8QA 3OHAA 3GV7B 5ETTA 2ZOMA 3DN9A 2V50A 1HKAA 2D3O1 2XS7A 5D0HA 2CPHA 4B9VA 3ET6B 5DJBA 3BKUA 2EXUA 2ZJQQ 3SDEB 1OQ3A 3FFIA 2ADCA 2FLPA 4ZCIA 2DGWA 3FVYA 3JAMY 1LXNA 5KFEA 4A48A 2BE2A 1RTZA 1VRQC 2ZDPA 2OAUA 2CQ3A 4TU9A 1OQ6A 1U8WA 4YHHJ 3ZXWA 1F1BB 4N5SA 1SL1A 2AEMA 3MDFA 2MLXA 2XWYA 1SJ4P 2CKWA 5F8IA 1DARA 1VFJA 1WORA 2OHDA 4IG0A 2GS8A 3CC4S 2C2MB 3THVA 4DX5A 2DJWA 2I2YA 2ZITA 1KVKA 5L9XA 3IGNA 4YS2A 4W4MA 4W92B 1HW9A 1TKZB 2W2QP 5KFUA 5ITHA 4E8UA 3GZ7A 2AIRB 4W98A 4QIGA 4MH8A 4ZVPB 3OVBA 3ELHA 5LOQA 3BN4A 2OLWA 4NYPA 5A8RB 4ZPAA 4X4QA 1ZS6A 3MAQA 3FK4A 3HVTB 4I64A 3QO9B 3OL6A 4HTIA 5HLFB 2AU0A 3QWUA 5AXKA 1WEYA 1HBUB 1XIQA 4C3MA 3I82A 1W2BR 3V6JA 2XMKA 1X4HA 4P7VA 3FBFA 3MMJA 1OYDA 1HFEL 2WBMA 4RO0A 3HHLC 2ZD1A 2K1RB 4EO6A 2J9CA 1TAQA 5IXUA 4LR7A 4M5DA 1M5VC 5HJXA 1OS5A 1RHKB 1U1MA 1B0PA 3DLHA 2XMUA 2J0XA 4DFKA 1VQNS 5DG8A 2KM8C 2W9AA 4LQ3A 3TRGA 3GTYX 1NPRA 4ES2A 1M0SA 1XQIA 3L4BC 1B64A 5J2PB 2IIHA 2G9OA 3VV2B 3TJAA 2DHHA 2DGQA 4YR2A 1SJFA 1I6JA 4C8KA 2XMJA 1H72C 2R8HA 3ILOA 4ZP7A 2FJXA 2VOOA 4X4TA 1HBOB 1PAEX 4CO5A 4A8SA 2QFJA 1R89A 2QL7B 1N6QA 3CJKA 4DWIA 6FD1A 2X51A 5L1JA 3OUYB 5GAEU 1HNWF 5IM0A 2ZZNA 4G6VB 4LF6F 1C0UA 3DM2B 1RT1A 4CLWA 2KTQA 2E5HA 3GJSB 3F44A 2V8VA 3R2CJ 4QW9A 2HHWA 2UXBF 4HDGA 4KYZA 1Y5NB 5EWEA 2Y1JA 4CLLA 3RAQA 3DOKB 2HFNA 2JDJA 3R7SB 3BGFA 4YEAA 2BKNA 4Q43A 3GCXP 1LFPA 3W66A 4YOEA 1KTQA 3QRPA 2P5VA 4KHMA 1FFGB 4QPXA 5K8PA 2YQ1A 4Q8FA 2ATCB 2R8JA 5H9EJ 4QZVB 1AB8A 3HX9A 1D0EA 3PTWA 2W9CA 2DITA 1W2IA 3B4MA 5HJYA 1ZETA 3Q8RB 2D9PA 2MKKA 2IVMA 1IBKF 2LXFA 4YUDA 3IR7B 2ACYA 3CCLS 2XEXA 5C24A 2R42A 4B3RJ 3G6YA 3IXQA 1WC6A 1U1PA 2Z2LA 4M63A 1HNWJ 2HZCA 4LF6J 1WKLA 2FHOB 3C15A 2MKHA 3MUTP 1RTDB 2MKCA 1D8YA 4OYPA 1YK9A 3M30B 4PAAA 2UXBJ 2IM0A 4WZMA 5KT2A 4W90B 4WK1A 1UMJA 3LAKA 3VZHA 2BEFA 5FDLA 2DH8A 2GIQA 2UUAF 3M2VA 4RBTA 1TP7A 2LU1A 3I9V9 1TTHB 3CCRS 2VJUA 4MFBA 2I0XA 1KR4A 4ALZA 3MTKA 3CJ0A 1KD1T 2BKPA 3THTA 1HNIB 1VJWA 2O5DA 2IRUA 4ZP8A 1WTBA 4I67A 2MQOA 3US5A 2ERRA 2W2PP 4K5SA 4WE1B 1JJCB 4H54A 2ZC4A 2R8GA 4P2SA 2R2TA 1E6YA 3QLHB 1RTHB 2FZGB 3V4IA 2GAHC 4FKYA 3HSGA 2XC9A 2IAJA 4CCHA 4N77A 2HFOA 4EYIB 3I0RA 3RB0A 1ZYQA 2HHTA 2LYVA 3MCSA 2UUAJ 4CH7A 4CI0B 1WKJA 3PRDA 2QMWA 4U6PA 1UVKA 4ID5B 3EGWB 3K5MA 3P6YC 1NJZA 2HMIA 5KFYA 3NGRA 3N6NA 2CPDA 3CPWR 3ENQA 5C25B 4B3SF 4ED1A 3EVWA 4CTAA 3JSYA 3KJNB 4P52A 4R0EA 3F56A 4ZHRA 3J81Y 1JLFA 4IO1A 3DRSB 5AT1B 2F65A 9RUBA 4QWBA 4B3MF 4LREA 4IH7A 2CQ0A 2AGQA 1Q81T 3Q86A 3H2VE 3NWRA 1BY9A 2LECA 3UDCA 3TVZA 1BLUA 5F9NA 1UA1A 4RU9A 4C2MA 2AJ2A 5HVFA 3ZNUA 4UT4A 1AXQA 1WC4A 3DU6A 1HR0F 2QJ3A 4G65A 1NB2A 4E2FB 4B3SJ 4ED6A 2XGPA 3I5CA 5C2CA 1RWNB 1RWPB 2W4CA 3VZIA 3TZWA 5CQGA 2X3DA 2YX7A 2AT1B 2GMHA 1LOUA 2GC8A 1TKZA 5KFCA 1T9VA 3DLEA 2KU7A 5ADZA 3EPGA 1RAOA 4ECWA 1IR2A 4ES3A 4B3MJ 1O8BA 3CEDA 3X1LB 4UY8T 4DSLA 5KFGA 4CWBA 2LEPA 2LEBA 1S7HA 3HVTA 1XNQJ 1HI0P 3QO9A 3PJ9A 2RS2A 1T8EA 1KVJA 2CJBA 2XHCA 3W8PA 1KBRA 2D41A 4ED7A 1HR0J 4TXSA 2ZKTA 1N8RT 2EW9A 1UEUA 3IN5A 4JI5F 3IWLA 2A6MA 3TZXA 2CJKA 3CJ3A 5KAKA 3L7OA 2H5JB 1RJJA 3BKFA 4GKJF 3LP2B 1DTQA 2MLYA 1XJWB 1X4FA 1AT1B 3M7VA 4KFBA 2JLFA 2EC0A 3KK1B 1CJUA 3NNCA 2VU5A 3Q89A 1F2HA 2DH9A 1WD6A 2VUGA 4XIUA 5HROB 4Y0FA 2HVDA 2F40A 3PW5A 2R9LA 2ZC3A 2W4PA 2QLFB 5JUMA 4P2FA 2HFUA 2WRMA 1TZ0A 5J2PA 3CDBA 4QCLA 1EP4B 2DNKA 3U27A 2L41A 2J5AA 4DQQA 2LP4A 1F0XA 2WZ1A 4JI2F 3DOMA 1LXJA 4JI5J 1RT7B 1HBOA 2FY1A 2E5JA 3VAHA 4FZVA 2HAFA 2HSEB 1A0OB 2DNLA 4GKJJ 1QSLA 1PAUB 2HBZB 2W9BB 3AA9A 3BYPA 1RWWB 3PYFA 4NYOA 4K5RA 4DR2F 3D1QA 2Q1LA 5KFRA 4NYZA 3N6LA 1EIYB 3KLGB 2OMOA 3CCMS 3CCTA 1UW9A 2E44A 5C42B 4NLDA 3MEEA 1BQMB 3AJDA 2YH0A 3D6HB 3RB3A 4LSNB 4AD6A 1RABB 4WZQA 4ECXA 2ASLA 5KFSA 4TLRA 3TA2A 4DDFA 1SQGA 2H5IB 4RW6A 2MQLA 4X4RA 2B4UA 4CNZA 3MECA 3EM1A 1U1LA 1HNZF 2QEXS 2V2VA 4CO3A 4I7FA 2HK3A 4JI2J 1NHVA 3A8EA 1OPZA 4UW2A 1UJ6A 4WYWA 5D4OA 2EK1A 1KHWA 4OJHA 4A8WA 4PQUB 1FERA 3FDSA 5IT0A 2A0FB 1NNDA 2HVIA 2AJ1A 2DNNA 4YB5A 3LUYA 1C0TA 4KGMA 4DR2J 2MEWA 3UN5A 4RR5A 4LFBF 3M30A 2B3TB 2FLNA 3M05A 1VC5A 3LALA 2C3OA 4DV1J 5ETQA 2BKOA 2M52A 4KQZA 3K58A 1HQEA 1FVSA 4K7QA 4B3OB 4DUZF 3NWGA 4OJGA 3H90A 1VK3A 1HNZJ 3DLJA 1JLQB 4EMDA 1SJQA 5L1KA 3PX4A 3PIPQ 1RADB 2WONA 2NQPA 3TEGA 1T9TA 1HNIA 2PI5A 4E0DA 2AX1A 2YNGA 2VZ9A 1ZAWA 2HK2A 2HHXA 1EKSA 1FTRA 2MSSA 1NK0A 3CJ5A 4WE1A 2HNDB 9ATCB 2GW8A 2GHWA 1L3VA 2NZCA 3Q24A 1GXTA 4CP5A 1NDKA 2G0IA 4RLEA 2L9NA 3J7YI 3QFWA 4DPTA 4TQSA 1TL3B 3BREA 4UOFA 2IBKA 5L39A 5FIIA 2QFIA 3AD7C 4F50A 1D09B 1N48A 1KNZA 2E9ZA 3I5AA 1S57A 4V19J 5F0WA 2UUTA 3D66A 4M5GA 2NCKL 2GZOA 4NLOA 2AGPA 4MJKA 3OL9A 1NK6A 2GIFA 4F2RA 4WTOB 3TAMB 2FVCA 2B9YA 3R5DA 1QTNB 1UCNA 2VB6A 4ECTA 2HFVA 2HVEA 5KFBA 2F5GA 2QLJB 4P7TA 4TKTA 1PYSB 2B7BB 1ZTWA 1R7IA 2DO0A 3VWSA 4PG8A 4DR4F 4ZCMA 1S9GB 2ZDOA 1LV5A 3AOAA 1O51A 4LMZA 2JZ5A 5ETNA 4R5PB 4PWDA 4IG3B 4Y2KA 4J9OA 1HHQA 1RAEB 1R3NA 2YWWA 3GR0A 4NE9C 2BM1A 3R3TA 1IKXA 1VQ4S 5AXMA 1PGZA 2ZJRQ 3BDPA 1B70B 4OZNA 3VVTA 3SV3A 3LGMA 5KG3A 5DZ7A 1AZSA 1S97A 2RQMA 4NEZA 2ALZA 1W26A 3U1NA 5HMXA 4A8FA 1W7WA 1K47A 2H5EA 2YH1A 1NSKL 4USVA 2FZCB 5LXYA 3M8YA 3BR8A 5AJ3F 1CC7A 1NBEB 2V8HA 1LW2A 2YWFA 1S0VA 3K2YA 2RAQA 4DR4J 3SQGA 3D2WA 2HWTA 3ZZUA 4IQXA 1FXLA 3JQJA 3RBZA 4F4YA 1H74A 1WC3A 2B5JB 2NXEA 2Y0BB 3J7YU 2IYIA 1JXLA 3RTVA 3HSZA 2X1GA 2B0GA 3M32B 4KE5A 1RU1A 3TVKA 3DDNA 5BJRA 3T5HA 2C2KB 5AJ3J 3OBIA 1URRA 4ED2A 4ZJLA 3ONQA 1PJ7A 3DOLB 1SUQB 4DFJA 4RW4A 4IOCQ 1JLAB 3SQOP 3KJVB 4WFYA 2WOMA 1EHWA 2VA3A 4CLPA 4DCJB 1YVFA 5IS2A 3M4XA 5KOXA 3I4PA 1FRIA 2KJVA 3ENAA 2NUHA 3NGUA 1HWLA 1VJQA 2KKHA 3I96A 1RT2A 1N0UA 1XK8A 2FHJA 5B0AA 2W7PA 2YWEA 3AQPA 3K8WA 1NH7A 1RAIB 1MU2B 3PNIA 1XMOF 4NMLA 2H54B 4CM2A 2KYXA 2MKIA 2ZH5A 1RXOB 4Q45A 4BWMA 2IYGA 1JK9B 5D3GA 4M5KA 1R0AA 4KBIA 1VDHA 1NXIA 4PCQA 4KHPF 2FC9A 5KFAA 3MURP 2FJAB 3KLGA 3P49B 1BQMA 5SZTA 4R8UB 4LSNA 1SB6A 3OXFA 4O3QA 1FD2A 3JTOA 1KOOA 4QYZK 1UEVA 1EETA 3TA0A 5AE3A 3EUNA 5DLGA 2AMCB 2BBEA 2X1FA 4KO0B 3PYGA 3QJLA 3MOZA 2VFVA 1KQFB 3B78A 2RT3A 3KUGA 1XMOJ 4U7CA 4FF4A 4I0WA 4PQUA 3KMSA 3PW4A 1S1TB 2XZDB 4DV5F 1AYEA 3LW5C 3MM5B 3GLJA 3HPOA 5KFZA 2DNYA 3GB0A 2PIIA 4KHPJ 3CJ8A 5AXLA 3HP6A 1BQXA 3ZTPA 3LANA 4KGXB 4GKKF 3VAGA 2KT3A 4UUXA 4DZDA 2X1AA 4XPEA 1QAYA 5EX0A 3C6TA 1U7LA 1YJNS 4PG5A 1HYSB 1ZZFA 2DPJA 5M2PA 2N4CA 1JLQA 1LFWA 2BJ9A 4XK8C 3SSRA 2ZBPA 4ICLA 2RVJA 4FNIA 1S0MA 3NG8A 3AHPA 2VA2A 4DV5J 2V0NA 6FDRA 5IC6B 5ETLA 2JC0A 2AGOA 1CULB 5HP1A 4CO0A 2M5YA 4YFUA 4O3RA 1NPPA 3Q8UA 3E01B 1JLGB 4QBUA 4GKKJ 2JWNA 2XLIA 2RRAA 4UTGA 3GG0A 4C8MA 4AYBD 1FD8A 3EZUA 1NSPA 1VC6A 5RUBA 4FS2A 2VBXA 3PVXA 3S01A 3VVUA 4DU8A 3V81A 4DV0F 2O01C 3H2UB 4HEA9 3MAAB 3IMQJ 3VHQA 2J0SD 2AEFA 1KLMA 3MM6B 3FSYA 3DLBA 3QGIA 3Q8PB 4DI6A 2W7OA 2VFRA 2LQBA 4DPOA 1HL6A 7FDRA 3TAMA 1S5ZA 5HK4A 1LWCA 1N5QA 2BW2A 1YSJA 3HJFA 2R2RA 3GFXA 3AFGA 3A8IA 4DV6F 1JNZB 1BD6A 3JYTA 1C2PA 3W65A 4O3NA 4Q5VA 3T9ZA 3Q0AA 4R5PA 2I1RA 4DQSA 1C1BA 4IG3A 1T02A 2R7UA 2G2ZA 3RRGA 3ILJA 4DV0J 2NR0A 2YXLA 1N34F 3OTBA 1HQUB 2VDIA 1S4EA 4K4VA 2CPZA 1UWAA 2NXNA 4N41A 2CA9A 1UPMB 3F0NA 2WBRA 3D3BJ 2YNHA 3QT7A 2FY8A 3GIKA 2C2DA 4UOGA 4JV1A 4EZ9A 1TFWA 1WEZA 3A13A 1X4EA 1U48A 1K1QA 2AJQA 4EBEA 2YKQA 2VBZA 1RT6A 4Y65A 5SUHA 1M1KT 4ZCKA 4DV6J 2OFGX 3CMAS 3MTJA 1JJ4A 1LEOA 1X9WA 3TR5A 3MMAB 3L7PA 2ZNZA 1NJIT 2NSBA 1Y0HA 2CVIA 5G4DA 5KFXA 1N34J 3A4TA 3EX7B 4EWTA 5DQIA 2ZH4A 3K5LA 1XMQF 3KLHB 2QL5B 4OZ3A 2HAIA 5KFNA 5EDWA 2FLOA 2Q3PA 4RUHA 4OL8A 1KTVA 3MEGB 1NCLA 4RW9B 3HULA 5DQHA 3DC2A 4K8RA 2GO9A 2CJYB 2Y1IA 5CD4A 4BC9A 1K1SA 5LXRA 1H2UX 3A8JA 4S0MA 1JLAA 1ZPVA 4UOCA 1QVFR 2CNLB 3JS9A 4ED0A 2VPXB 4DQRA 2OKQA 4DPYA 3MMCB 2M8HA 4NASA 4JI4F 2XI3A 3MOJB 4BBYA 1TMMA 3AA8A 1PBAA 4USUA 2KT5A 3NLCA 1HA1A 1NK5A 4A8KA 3AD8C 1FT8A 1XMQJ 2ZVSA 4Y2IA 3O2IA 5JVHQ 2OEMA 4Q8EA 5F9LA 1IWAA 1TELA 3QAEA 3FKBA 1VBYA 4ANCA 2CQCA 1NSAA 4JI7F 3DFEA 2JVRA 4M5HA 2EC2A 3KUEA 3HXMA 2YWHA 3TEHB 5CYMB 2EFPA 4NLWA 1QE1B 3W61A 2KM8B 2V6AA 3TOQA 5ETPA 4LR8A 4P9SA 3L9ZA 4F8RA 1VCTA 1O6XA 4WP9A 5I3UB 1ACMB 2EFGA 5F8GA 2RUSA 2HGNA 4PG7A 4KO0A 1Z2ZA 1WHYA 3NAIA 1U0HA 4KGKA 3SCIE 4M5JA 2VG5B 2KL8A 1HWIA 1U1RA 5E33A 2HNZB 2ZHBA 3TWZA 1H73A 4BCAA 1FRJA 2GIRA 1Q16B 1RP5A 1V9OA 3HZGA 5BR8F 4JI7J 2ADBA 4ILLA 1ZBTA 1Q82T 1IKYA 3D68A 2HVZA 1F3VA 3CGIA 3M6XA 2GMJA 4RU2A 1T7PA 2Y1RI 1TUWA 3NCRA 4M5NA 5DM6Q 1G7CB 5H9FJ 2YPZA 4I69A 5KFPA 4DPXA 5A76A 3NP5A 1XN9A 1PJ5A 2WSEC 1YJTA 1HD1A 3GYNA 4J9MA 3HHDA 4OLPA 3X3UA 4NXMF 2MYFA 1JLEA 1VI7A 4ECVA 2XY6A 4JI8F 2QLWA 1S77D 3FJ2A 5BR8J 4ITSA 4IFYA 3OW2R 1S76D 3NRBA 4TYBA 2ZBRA 3PV8A 4K4YA 2LXIA 1RISA 1RYSA 3V6DB 3UD4P 4WJBA 2XZTB 4G3IA 3BDEA 3S7RA 3E01A 2ZVIA 1HD0A 5D8HB 4J9VA 4NCGA 1FNOA 3H0PA 5KT6A 3TQ1A 1TU0B 2DO4A 2DD8S 3R6GB 1U45A 2NSCA 1UVLA 1VHFA 2V9KA 3F73A 3Q2SC 2R2SA 1DLOB 2VKRA 2KO1A 5CCMA 4NXMJ 2WHOA 5KFJA 3QQCD 1QTMA 1MG7A 1QDUB 1Y00A 2K3KA 3N5FA 2V68A 1NUEA 1SL0A 1YJVA 1Z4UA 4JI8J 4WFXA 4H4KA 1S9EB 2DCLA 1NKEA 1RWMB 1WACA 1TR0A 1RWXB 1LWFA 1WDTA 1GMWD 1UKUA 1IM4A 1SV5A 4NZ0A 1LKZA 2OEJA 2NYIA 1KKHA 1K44A 2VL1A 1UZDA 1V5VA 2M2BA 1FWPA 1Q78A 2V8PA 5D0GA 4LF4F 3UCGA 2YTCA 3HK2A 1N5VA 5A2QY 1CJKB 2E7WA 2ATLA 1WOPA 3FRZA 4IRKA 2L9WA 2KDOA 4ZPDA 2OP5A 3TW0A 4B9TA 4OV6A 1HI8A 4X4SA 3BQ1A 3BH7B 2VBYA 2BE7D 3WC0A 5K8OA 5G0RB 2MZJA 5HVGA 2UU9F 4LRFA 2OPRB 4O4GA 2LA6A 2GQ2A 4GMKA 3L95X 1ELOA 3UPFA 1FWKA 1FRMA 1RCOB 3IFEA 3C8YA 2ZUGA 2C3YA 2YNIA 4BC7A 4IYQA 4WFBQ 4O44B 2K06A 3JSMA 2FGOA 1MMNA 4LF4J 3MMAA 4KB7A 2XSJB 1ZTTA 2VKZG 5KFFA 4U95A 1BQNB 1VQ7S 4ECUA 3CCZA 2UP1A 3MR6A 1TL5A 3IR6B 1EQMA 4KKOB 1TVRB 1U0SA 2RMLA 3NCPA 4ATNA 3CJSA 3RYLA 4DX7A 4WP8A 3KHLA 2UU9J 3C19A 3T41A 5DG9A 2WB1D 3FEXB 1X9SA 2M7SA 3MEGA 4RW9A 4O0NA 2OPQA 3G82A 2CZ9A 4RW8A 1S1VA 1IKVA 2CQGA 1N5YB 4X4OA 2DGTA 4FP9A 5KFKA 1OJ4A 3G6XA 3PCOB 2BANB 2X1BA 3C16B 3C6UA 4DV2F 2VOPA 3FBEA 1U1KA 3KHGA 3QBCA 1SC6A 1AUSL 4HTJA 2ALYB 2RE1A 3IAM9 4DFPA 2CJXB 3AD9C 4FN5A 3LTOA 2PFFB 3UDVA 2PDAA 3KTQA 5EGYA 4OYAA 1I94F 2HQIA 3HHLA 2B56A 4MK9A 1CJTB 1JKHA 1J5OB 1UWBA 5A8KB 3TX8A 4OYXA 4YMEA 1GQEA 4N47A 5J1EA 2FD2A 2F7VA 3AXMA 4XTTA 3TA1A 4J9SA 1QE1A 3IWXA 2DNQA 2UVVA 1VRUB 3W9IA 3UWTA 2CNKB 3U02A 4OHWA 1WC0A 1CPZA 3QFHA 5H9EK 2RB7A 3TI0A 3H20A 1VQYA 1S1UB 2ZUAA 2XM3A 2AYBA 4DSEA 3J7AN 3AB4B 4G1PA 5IWAF 4F7VA 2DR8A 1I94J 3J7ZT 4BHQA 2NREA 4PWUA 4I2PB 2X7IA 2HEKA 4FXWA 1VQLS 2Q79A 1U6FA 3IRXA 2RRNA 3GPAA 4FVMA 2CJ9A 5CCLA 1VC0A 5KG5A 4NL5A 4DPUA 3SCKE 1SI9A 3CT9A 3PHEA 2HHPA 2A1BA 1UVIA 2Q6BA 5IFMA 1U09A 2ASJA 1U2RA 4IH6A 1N4LA 2LMIA 5J2MB 4Q0BA 2OFHX 2J6SA 2ZWPA 6AT1B 2EPIA 1SL2A 2BW7A 1X31C 4CLYA 2HHVA 3OXLA 2VICA 2QA4S 5IWAJ 3V5RA 1IBCB 2V4JB 3D9BA 2JNJA 3MFHA 2E29A 3TO8A 3PR4A 3PKMA 5D6GA 1N36F 2F9JA 2XHWA 1WF2A 3IP0A 3JXOA 4HL9A 3L09A 1MROB 3QGPA 1QSSA 4TY8B 3ZC4A 1CS4A 4PPDA 2PT0A 1FO1A 4PXBA 1XR6A 2CPEA 4C48A 3OJUA 2A10A 2DHGA 4ECSA 1UJ5A 4DS4A 2C2EA 3M8PA 1MMLA 4GO5X 4DLEA 3W2WB 3N9UC 3MD1A 4LF9F 5L9NA 1Q86T 3ISNC 8RUCA 1GK8A 2DIUA 4DR3F 4X64F 5HAOA 3A3OB 1Y4ZB 1GTEA 4FDFA 3GP9A 3T6JA 1YJWS 1N56A 1RKJA 4DN9A 2BABA 1IR0A 3CD5A 1CEZA 2BV3A 3HCXA 1NDCA 1TKTA 3D67A 3NS7B 2C2ZB 2GAGC 3KK2B 2CPIA 4FYXB 2HHHF 5BYRA 2WTFA 1N36J 3WC2A 3R5JB 3B6BA 2LQ8A 1WHXA 2IJNA 1KQKA 1X5OA 1G2EA 4CQ1A 1Y9OA 3JSBA 2DNGA 1JB0C 2FHMA 3FUYA 2GA7A 4O3SA 3LF0A 1T3NA 3GSDA 1IKWA 3FCVA 4MAKA 2PD1A 3BF4A 2OPPB 1REVA 3TYTA 4LRBA 5KFVA 3MUVP 2RRBA 4LF9J 4IKAA 4ES1A 4DR3J 4KV8B 4X64J 5KTQA 1RUSA 3EYZA 4QR1A 2J8AA 1CJKA 5A0YB 2D69A 3IA0A 1M5SA 3I9ZA 3VAMA 2HHHJ 3IBWA 5F8MA 3GFHA 1XNRJ 5KOWA 4NX9A 4OV1A 4PUOB 3MR3A 1NJYA 2EBEA 1E6VB 3SI8A 1Q7LB 1N32F 2ZH1A 1VQ8S 4O4RA 4K4ZA 4X4VA 1U2FA 5GAGU 2H4YB 4F3MA 3T5LA 1RAHB 4O44A 4NWBA 4RNFA 4IDKB 2CPXA 3ENWA 5EX3A 2CUYA 4FBUA 1RE1B 1U4BA 2PO4A 1OWXA 5IV4A 3AT1B 3GYXB 1RWOB 1BUXA 1BQNA 3BV8A 1UVJA 3MEDB 1Y5LB 3G96A 3BBCA 4BDPA 5JJBA 3GILA 3VALA 5T7LA 3D1HA 2B4VA 1U1QA 2QTWA 2F8EX 4U7UD 2DISA 5THWA 4LVNP 2WVFA 2JLGA 3ZZRA 1KP6A 3FCHA 4USMA 3ZZOA 2CJAA 3CUNA 2IHR1 3QJJA 4WWSA 2FJVA 2WB4A 4ZVQB 2DT9A 4C8ZA 5LSOA 2YKAA 5KFIA 2JC1A 2KXNB 3POTB 3C16A 1QJHA 2WCXA 1SKWA 1NU4A 2VHGA 3BBBA 3DLKB 1LWEA 1YKWA 3L7UA 1NK9A 4PABA 3DRPB 3Q8SB 3R5CA 3R5AA 2B9WA 1AFIA 2BZ2A 4CT8A 3TANA 2YKMB 4HT7A 2R7XA 3F41A 5KG0A 4NOHA 3MF5A 2XO6A 2LQJA 3G8SA 3W60A 1VLOA 5DGAA 1R6VA 2YKNB 1NJXA 5IOLA 4C11B 4KC5A 4RBVA 3EXYA 1FK9B 3M2UB 5D4PA 4CYUB 1J27A 2W2NP 3MPVA 3N0VA 3PXGa 4OYMA 2MHNA 2HIQA 3QYYA 1H3DA 3GR1A 4U8YA 4HLBA 5DS7A 3G6VA 4LUBA 5DDOC 3C14B 1S1WB 2KHCA 3QZ7A 4J9QA 1FRKA 1IWGA 3MWBA 3EJMA 1C1CB 5HBMA 2QGFB 4ED8A 1H0HB 5E3CA 4PYDA 1HMVB 1TUGB 1K9MT 1RT3B 1HIYA 5HI7A 2GVZB 3MM8B 4CZCA 4ETXA 3LO3A 2XMMA 4OZ2A 2XWXA 1SC4B 2VONA 2VG6B 2R7QA 3OR2A 4B3TF 5K14A 4M5LA 2R2UA 4P10A 4B9MA 1MMDA 4PG6A 2CADA 1YBUA 1P9QC 1ZAXA 2GNKA 3G8TA 5J2MA 2AX0A 3ULHA 4Y2AA 3W7BA 1SKSA 4HACB 5J2NA 5KFLA 3IGVA 3GJRB 3C3LA 2ZOFA 5E0OA 2CQPA 1Q8LA 3CJ4A 3T19A 4ZN3A 3M9NB 5E3PA 1QSYA 1S1XA 5I3QA 3ILIA 2H4WB 2K3IA 1FXRA 3SCLE 4HH1A 3CULA 1G3OA 4H4MB 3U1MA 1RB0A 2HLTA 5LMNJ 2DNZA 2RJZA 5D0EA 1VBKA 2NXJA 2MGZB 4DV7F 4TY8A 3IG1B 2HQ3A 3DRYA 3DRRA 4CLZA 3BBFA 4B3TJ 2RF2B 2CAJA 2UV8A 4TYAA 5AXNA 2ACMA 4NLVA 1H6KX 3W2WA 4F4AA 1WKKA 3CJ2A 2JLEA 4ZKAA 2XNRA 3DXBA 2HW3A 4DG1B 3SMZA 1HHTP 2R3VA 1PC4A 4M1KA 1DRZA 1U24A 1OIAA 3VCDA 5GAEI 5KG7A 2CYYA 3UVJB 3KUHA 4WIQA 3W5YA 1RQ0A 4K4TA 4F4KA 3NS5A 4U67Q 1RTIB 1R0CB 4RUBA 2V2ZA 4J90A 4D3HA 1S6QA 3KLIB 3PYDA 4C3LA 2HWHA 4LJMA 3CCJS 4CRJA 2KG0A 1IXKA 2ILYA 4DQIA 2XS5A 3HZEA 4EFAC 3BO3A 4IRCA 1EJ7L 2FPHX 3T1YF 3NNAA 4KTQA 4J9PA 2ZE2B 2JFKA 2QA1A 2WW8A 2UZAA 2IRYA 1UFKA 1FHTA 4NLGA 3KLFB 1MWYA 2GGPB 1S12A 2V2KA 1FDNA 4CLTA 4JV2A 3MM9A 2HQDA 1G1XA 1CSJA 5JMNA 3PY8A 1IJEB 1RA7A 4OI1A 1EQ0A 1UTAA 2RQKA 3R1HA 1NDLA 3KKFA 1JLBB 2IDEA 5A6WA 2YQ0A 1JJ2R 1H2TZ 3M2RA 5KFWA 2Z0GA 3O6QA 2XB2D 3TQEA 3RW6A 1U47A 1Q53A 2XMAA 3CCWA 4DUTA 1YJRA 4MYUA 2IJFA 3T1YJ 3GYGA 3ZZYA 1CVJA 1WEXA 3QIPB 3UNYA 4IDKA 3ENVA 3LP0A 5IT4A 1HNVA 3FEYB 2CIMA 2HHSA 3NBPB 3OXGA 8AT1B 3J80U 3WIVA 3R6LB 3MMBB 4I2QA 2OD4A 4ER8A 1UZHA 5B0CA 2Q6CA 2OMLA 4C8OA 3H4BA 3GU0A 4OI0A 4L72B 5CABA 4LFAF 3LP1A 1Q1KA 2EBGA 1W25A 4P74A 2XS2A 1SJ3P 1MWZA 4ANDA 2B8PA 3HJVA 3OLAA 5DGBA 2GV1A 5KG1A 1JMTA 1RHMB 2XGQA 1X4BA 2RILA 1T9XA 4LF7F 4ZPVR 4DFMA 2R8KA 2KH9A 1PIEA 2YNFA 4R0JA 4QJVA 3DLKA 5T14A 3E2EA 5HATA 1S6PB 3M8RA 2MKSA 1QAIA 3DI6A 2GVDB 2BRKA 1LW0A 3W8GA 2WAQD 1WOOA 4NLQA 3UDEA 3KDOA 1FVQA 3A12A 2CQIA 1N5SA 1FKOB 4DS5A 3MM7A 4F3OA 4LFAJ 5DLFA 4X84A 2WVDA 1FNXH 2VBWA 3Q22A 5E2QA 4NMXA 3CDAA 1GXUA 4C11A 4D3GA 5I42B 2QMXA 5F3TA 2DY9A 2MSTA 5ETOA 4JV5F 3H40A 3QATA 4CYUA 2XMVA 4JI6F 4J7CA 2BJ1A 2OJ3A 2HNYB 2V4QA 2PEHA 3KHHA 3PX0A 2L48A 3Q83A 2JX2A 4DSKA 2CDRB 4F2SA 3QPIA 3CW2C 3PYEA 2RIJA 4NLUA 2RU9A 2QA4G 4I68A 5I4MA 5KG2A 1X0PA 2W2OP 3WDOA 3KDNA 3KK3B 3I0SB 4CLSA 1IBKJ 4K2JA 1T03B 3BS9A 5DO2A 4QYRA 1IN0A 2EVZA 3T3FA 3ITHA 3KLVA 1VQPS 5F8JA 4X65F 4KH0B 3H8YA 2J6TA 4OYWA 2FVRA 7AT1B 3VQSA 1NO8A 3QWPA 2CG4A 2BQUA 3OR1B 4JV5J 3D6MB 1MNEA 1FRHA 3BGRB 4JI6J 4DZ6A 3JQKA 3KXDA 2H1YA 1DTTA 1FKPB 3BO4A 3K5OA 1FJCA 3BGUA 1YRTA 2O66A 1R8AA 4HACA 3UFCX 4TVAB 3SXLA 3PDNA 3D28A 2GHPA 3J81j 2YX1A 3FRYA 4HH0A 4J5OA 2YKPA 4Q7AA 4B02A 2DK2A 2HYIB 1XBWA 3DGPB 3T6BA 3ICLA 4Y2CA 2XMWA 3KNAA 1H7XA 4OX7A 4I4BA 4X65J 4ZITA 3IRWP 3HMJG 3ET6A 1FI4A 1F9EB 4H4MA 2C2RA 3ETOA 4FXVA 5FJ4A 3AQOA 2Q66A 3SDEA 1QLNA 3EZOA 2JEFA 3S1TA 2M8DB 1VQKS 2KJWA 2NUUG 2HBRB 4C98A 1VQMS 3KLEB 3HHLD 4LF8F 2RF2A 5F41A 5CZVA 4K4XA 3SFGA 1TV6B 4DCPB 3PRVA 2DHSA 4DL2A 1KFSA 4I6YA 4ID8A 2JJ4D 2NLWA 2F3JA 2XYHB 5IZHA 4DG1A 3P3DA 2UVWA 2M70A 1RHRB 1FDDA 2HRYA 2FVQA 3IBFB 4MKYA 2OTJS 5J2QB 1KS2A 2JEIA 3AY0A 2EKYA 3W9HA 4WFZA 2LVWA 3MR7A 2D9OA 1DFDA 3T9NA 4P2MA 4RPFA 2I38A 2RKIB 1VYAA 4CLKA 3KG4A 5IQQA 1ZZNA 3QT6A 3KLIA 4K2XA 2V4RA 4DJBA 2XQCA 3EDQB 4WXOA 2E7XA 2RDJA 1JLCB 3M8QB 3TARA 5A8RA 3PW2A 2P8IA 4V19X 3CIZA 3EXCX 1ZA1B 2ROPA 3GE9A 5AE2A 2RQCA 5HLFA 3TVYA 5GAHI 1U1OA 2DVIA 3MCMA 3FBBA 5HQLA 4RZRA 1HBUA 3K8VA 3VGSA 4JB8B 4O23A 4BWJA 4KAIA 3O8WA 3FFIB 2G0JA 4F4ZA 2B9XA 3CNQP 3KG0A 2C3PA 2ZH9A 4QU6A 5C2GA 2P9CA 1FDAA 2DGVA 3H7HB 2BE2B 2K1RA 4Y34A 3HFZB 2BXJA 3PRBA 2C3MA 1PYTA 1RHQB 2EEYA 1FF2A 5U47A 2VQFF 2DEJA 3SCJE 4O0IA 3U1LA 4TY9A 2J6UA 3HLUA 3WIUA 3T1HF 3QSIA 4OLOA 5EHHA 2XG8A 1XMBA 2A2DA 3DLGB 1P1LA 2LLZA 4ZN1A 4ILMA 5E7OB 5AE1A 4HHUA 2HGMA 1JIHA 5B08A 3E8OA 3IM8A 3MCNA 2VC0A 2PMWA 3MZIA 2ZH8A 2U1AA 1PKUA 4AXIA 3AJ1A 2PMHA 2APOA 2ZBQA 1L5UA 1MN9A 4DHVA 1F2GA 1NZAA 2VASA 3D7SB 1S9FA 5E5NA 3OUYA 3T5KA 2AJFE 2Z2YB 4NA2A 1WG5A 2DHAA 3DM2A 2MXYA 1RT4B 2HFZA 2V9WA 3V2UC 1R27B 3RBXA 3Q8YA 3D3CJ 2DCUB 2VQFJ 3MFIA 4YB6A 5I3PA 5KFOA 2VFSA 2IMOA 4LSZB 4EZ6A 3DOKA 1FJGF 3T1HJ 5HMZA 3DDKA 5GADI 1FXDA 1O0PA 1OY6A 1SC1B 2HG4A 2ZD1B 5LSRA 5BXIA 4M5DB 3RW7A 1KLNA 2MKJA 1GMWA 2ROEA 5GAHU 1MLAA 1DQ9A 4DR7F 1WSVA 1X7VA 1NRKA 4YR0A 2F4FA 2HQFA 5ETMA 1H7WA 3IAS9 2V69A 4PEOA 3HFVA 1NHUA 5I42A 2AJ4A 3EVOA 1RTDA 3Q23A 1SQEA 3QIDA 4DL0C 3K5NA 4NRTA 2SXLA 2IVYA 2MHEA 1FJGJ 1WI6A 2C28A 5DRKA 1V6HA 3OL8A 4MIBA 3CF5Q 3CCSS 1YZ7A 2CPYA 2YQ3A 4OHZA 3WX8A 1NMEB 4WKRA 3G8QA 1KSPA 1DZ5A 1NSQA 5A8WB 2E5LF 3ZTQA 3HHEA 4H4OB 1N6QB 3CJKB 2O1PA 2BJEA 1SIWB 5IM0B 3W62A 2A18A 2WVBA 1RT1B 4PG4A 4X2BA 5F8HA 4DR7J 5EWFA 1ZM9A 3W3SA 2BQ3A 2D3UA 1U8SA 3K7RA 3M1VB 2C22A 2EFOA 3H4DA 3CCUS 4MIAA 5IT9U 1UP1A 2J76E 3ZTRA 3HO1A 1X4AA 3C46A 5DQGA 4LFBJ 3M8SA 3QLHA 1RTHA 1QUPA 1RK8A 2CWXA 4XDDA 1K0TA 2DB1A 3HDSA 3N4WA 4USWA 3PFOA 2JL9A 2W9CB 1U1NA 5DZ6A 1T05B 1BWVA 4K0KF 2YBVA 5D77A 1YRXA 1M90T 1TL7B 1NDPA 2IVFB 2DNRA 3BSAA 4DUZJ 5C24B 4G1QB 4ID5A 3UCUP 1T9UA 1OY8A 1Y3JA 2F4VF 1VK8A 2AYMA 2UVRA 4TU8A 4AQYF 4B9NA 2CJQA 5C25A 3C15B 3BGLA 1RBLA 1R6YA 1NK8A 5GADU 3RRHA 2OH2A 2E9TA 4V1Ak 3T1AA 1SVDA 2QL9B 2HHUA 2I8EA 3NAHA 4C8YA 2AP6A 3A1YG 3SBMA 3DRSA 2IY5B 5CYJA 1VR6A 2PMZD 2GJIA 3M2VB 3CDUA 3KHRA 4MFBB 2B6AB 1HWKA 4K0KJ 2R8IA 2NXCA 4U7UK 2UVUA 3CJRA 2Y3YA 3PKYA 4DN0A 1PBUA 5HO4A 3JSRA 4M8LA 2ZZTA 2F4VJ 4WKYA 4UQGA 2GMLA 4F4WA 3JTPA 4H4KC 4Q2LA 5DETA 1F9FA 4B9UA 4AQYJ 2Z56B 1I51B 1X5SA 5L38A 2J9EA 4L75A 2DXDA 3AB2B 1NB7A 1ZOTA 1E6YB 2KXFA 1WNEA 3V4IB 4DX8H 2RSQA 4QPTA 3OHBA 3I0RB 3GQCA 3D6TB 1TMJA 2VF3A 3D1OA 4YHHF 3PW7A 2DNHA 3GV5B 3GG1A 4DU7A 2N82B 5LMUF 1DY3A 4LIWA 2N3LA 4PQAA 4URSA 3MEKA 3DHWC 1YLXA 2DBBA 4RNOA 2HMIB 2GHVC 1GNKA 2H9ZA 2N7YA 4C3KA 2CFXA 1Q95G 2AWZA 4CTAB 2LQ9A 3LWLA 1KVIA 3UW1A 2CWKA 1WDDA 2GX8A 1FNMA 2MZQA 4ZHRB 1JLFB 1VS3A 2RD5C 3CTRA 2X3GA 3PEHA 2QO3A 1GAOA 1H98A 1UW4A 3DGVA 4M5IA 3RB4A 4DUYF 2J7UA 1X5PA 3LP2A 4YDXA 3K5PA 2LA4A 1AROP 2VG7B 5LMUJ 3KK1A 2OPSB 4DR5F 1N54B 2DH7A 4P75A 4OQJA 5HROA 1XC9A 2OD6A 3NMAA 4TLQA 3DLGA 4OX8A 4C8LA 2IRXA 4ZA1A 2RUGA 1BC6A 2QX0A 3VQTA 5JXSA 2CZVC 1EP4A 2P2CB 4WIIA 1R8PA 1YTYA 3NGTA 1Q0NA 4OYZA 3ILLA 3G87A 4WFAQ 4ETZA 1AUDA 4NZ7A 2QV6A 4IH5A 3DLEB 1RT7A 1ULRA 1TL4A 4QR0A 5IC4B 2DNPA 1HW8A 3QSYB 3J7Z5 4X62F 4DUYJ 3HFKA 1F5CA 2W9BA 4MKAA 2C42A 1RT4A 3SV4A 2F1FA 4YQWA 1SCJB 1WHVA 4DR5J 1RGVA 1G4CA 3LOUA 4CH1A 1GH8A 5C42A 5E41A 4I6AA 3MXHP 2MY8A 3CXCR 1R43A 4GVBB 1RZMA 3UR3C 1S4FA 5F8LA 2GQCA 2AW0A 1EKRA 2A6OA 2UUCF 5ETKA 4AFFA 3UCZP 4IR1A 3MR2A 4OZ1A 4Y2MA 1FEHA 2W24A 4LF2A 3VGUA 1SJRA 1RA6A 2AV5A 2JSXA 1DTQB 4OX6A 1I1GA 4KFBB 2V34A 4LRAA 2Z30B 1EAYC 2P9GA 1CJUB 1MSWD 3NY0A 3LGNA 2UUWA 4X62J 3DMJB 1JWWA 1SH3A 3AAWB 2FB0A 5IQ6A 4ED5A 1UPPA 4NEYA 3BJYA 2GO8A 3HM9A 5B0GA 2QYCA 2BUNA 2DTJA 1YRUA 3HHKA 3LPEA 1O5JA 2R7OA 3DOMB 5F0UA 1Y11A 2HZAA 4LIRA 1IUJA 3B8HA 4B3OA 3M6UA 5A8WA 5L46A 2UUCJ 1V3SA 4ECYA 2DRBA 2VV5A 4B3RF 4H4OA 5HMYA 3ZNJ1 2Z2ZA 2EI5A 2CG8A 2CPFA 1N0VC 1UFWA 1UL3A 5D78A 5KFDA 3GJTB 2VD3A 4DMZA 1RBOB 3UN2A 1EZZB 3R2DJ 4F67A 5K9FA 1K8AT 1R8CA 4FS1A 3AOBA 4CLUA 2CZ4A 3M1VA 3MEEB 3W5XA 2HNDA 3OLBA 2BMBA 1WSRA 3EDRB 2F9DA 5C7PA 4ECZA 2VQEF 3W2VB 4RW6B 2QA2A 3MECB 2IM2A 4J9LA 4JYAF 3OD2A 3J7A1 1AA1B 3PJWA 2NZ4A 1TL3A 2WK4A 1T05A 2F8MA 4I7FB 3ADAC 5MAOA 2V5HG 1KQSR 1R0BG 5C5JA 1TL7A 1T94A 3GSIA 2W25A 4G1QA 3OTCA 2ZEJA 4R25A 2CVEA 4OI2A 3TZYA 3EGNA 4OX9F 5KT7A 2J8SA 1YITS 2QG9B 2XBPA 3QRRA 1C0TB 1JNRB 3OFFA 4K4UA 4YB7A 1RTJB 1URNA 3FSIA 3QJPA 3I4HX 1V3RA 1UETA 2CNNB 3DNCA 1VISA 3R8YA 1B0VA 4LBIA 2H51B 4P6QA 1VQ6S 2VQEJ 1M5KC 1HQEB 2MY7A 4RKUC 4C7QA 2FVPA 2B8QA 1UA0A 5CXTA 4JYAJ 4USHA 1IQZA 2B6AA 1NM2A 1S9GA 1S99A 4DL7A 2RDIA 2WONB 2MZSA 4ZVFA 5ETRA 2YNGB 2MQQA 2DR9A 4PXCA 2KZZA 4ZS6A 5K8NA 1T11A 3NNHA 4OX9J 2CQ4A 1QAXA 2KFZA 2EFNA 3NS6A 1V3ZA 5CH7B 2AQ4A 4JBCA 1M1HA 3BKTA 2NPIA 1DAXA
chains in the Genus database with same CATH topology
4C11B 3TAMB 4N8OA 4C97A 4KC5A 2FVCA 2B9YA 2HRUA 4RBVA 3R5DA 1S79A 2VB6A 3MM8A 3EXYA 1FK9B 3M2UB 4ECTA 5D4PA 5KFBA 1SJ1A 1XR5A 4KJIA 2L08A 4P7TA 4TKTA 2GQQA 3ISZA 4MIWA 2ZHAA 2B7BB 1ZTWA 1R7IA 2DO0A 3VWSA 5KT4A 4PG8A 4DR4F 5L1IA 2DR5A 1X5TA 2POKA 1XEZA 4ZCMA 2XCPA 2VG6A 1S9GB 1KONA 1LWEB 2ZDOA 4ZK7M 1LV5A 2ZNYA 3MPVA 3N0VA 3T5JA 3PXGa 1O51A 3NL0A 1HHSA 2E1MC 2MHNA 3QAUA 2HIQA 3QYYA 5L1LA 4LMZA 2BR0A 3BZQA 5J1NA 1H3DA 3GR1A 2JZ5A 5JVGQ 4HLBA 5DS7A 4R5PB 4PWDA 1VQOS 3H5XA 3G6VA 2D74B 4IG3B 4Y2KA 4J9OA 4DV3F 1R3NA 3GR0A 4QYZJ 4NLSA 2BM1A 4ILRA 3R3TA 4LUBA 5DDOC 4YR3A 4RNNA 3CD7A 2CQ2A 1IKXA 1VQ4S 5AXMA 1PGZA 1S1WB 2ZJRQ 3BDPA 2A3JA 2A2CA 3MPWA 4OZNA 3S8SA 3SV3A 2KHCA 3PR5B 3LGMA 5KG3A 3QZ7A 4J9QA 1FRKA 4IRDA 1S97A 2RQMA 3BR9A 2B5JA 4G1IA 3I32A 2ALZA 1X0FA 5B0BA 4QIWD 3MWBA 4F3QA 1A6LA 1C1CB 5HBMA 2OSRA 3U1NA 4HDHA 1UJ4A 1H0HB 5E3CA 3VF0B 4YDDB 4ZPBA 3Q8QB 1S6UA 2H5EA 4ED8A 4A8FA 1HMVB 2YH1A 3OTOF 1HWUA 1K9MT 1L3KA 4AL6A 1RT3B 1Q7YT 4ZOSA 3M32A 3RZAA 4UQTA 2JHEA 5LXYA 3BR8A 5AJ3F 3LQVA 5HI7A 1HPZA 1CC7A 2JOQA 4DLGA 3NGDA 3MM8B 1FA0A 2VFTA 4CZCA 2V8HA 1P1TA 1ROFA 2QT7A 1OSCA 1X9MA 4FF3A 2D3ZA 4U9RA 4QQBA 1RWUA 1DQ8A 3OVAA 2CRLA 4ED3A 4DL3A 4ETXA 3LO3A 2XMMA 3LH2S 2XWXA 1LW2A 2KRBA 3PEJA 2VONA 2VG6B 2R7QA 2YWFA 3HVWA 2HWIA 3OR2A 2MGZA 1S0VA 3K2YA 3DOLA 4B3TF 5CHCB 5K14A 4PKDB 4X4PA 2Q43A 4NXNF 2R2UA 1SUQA 3PO4A 4C4WA 3IG1A 3SQGA 3HF5A 4B9MA 1MMDA 4PG6A 3D2WA 2VG7A 1P9QC 1Y7PA 4A8MP 2OPSA 1XNQF 4PWDB 1ZAXA 2HWTA 2GNKA 3OFHA 3KJVA 3ZZUA 3G8TA 4IQXA 5J2MA 1FXLA 2AX0A 4NCBA 3ULHA 1IKXB 1X4CA 4Y2AA 3W7BA 3CD6S 2KYZA 1D8ZA 1SKSA 1YG0A 4F4YA 3KNGA 2KB2A 3NCQA 3ZZPA 3RR8A 2B5JB 2J0WA 5J2NA 2VC1A 3OL7A 5HBMB 5KFLA 2LXUA 3IGVA 3J7YU 3C3LA 2IYIA 1JXLA 3RTVA 3RR7A 2ZOFA 2X1GA 3NKYA 5E0OA 3MUMP 2B0GA 3M32B 2CQPA 1U6ZA 3RBDA 1Q8LA 3CJ4A 3T19A 2YX4A 3M9NB 1KHVA 5E3PA 4KE5A 1QSYA 3CSKA 1F60B 1S1XA 3DDNA 3TVKA 5I3QA 5BJRA 1G6BA 3T5HA 1DQAA 2K3IA