4WXOA

Sadc (300-487) from pseudomonas aeruginosa pao1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
182
structure length
182
Chain Sequence
RYALQAHQDTLRGMMRQLEDLVATDELTGLFNRRHFMRMASRALEDLLPNRQHGLALIDLDHFKRINDRHGHAAGDRVLQTFAAVARSCLRDGDVLARYGGEEFVLLLPHADAEQLESCCERLRLAFQQAEPVGVTVDTLSLSVGMTLLYADDDLDEALQRADQALYRAKRGGRNRCDATWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of SadC (300-487) from Pseudomonas aeruginosa PAO1
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transferase
molecule keywords Uncharacterized protein
total genus 53
structure length 182
sequence length 182
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wxoA00
1TKXA 3MEDB 1RT5B 1S9GB 1LWEB 3V81A 1TP7A 3DRRB 4K4VA 5L9XA 2D41A 4DL7A 5DLFA 4RNFA 3DI6A 3CDEA 3M8PA 3NAHA 4RUCA 2ZE2A 3KLFA 4ECVA 5HROB 2OH2A 2FLNA 4M95A 4PQUA 4QW8A 2VG7A 4ED0A 4IFVA 1I6JA 4GC7A 4NCGA 4O3OA 4YQWA 2XGPA 1FKOB 1JLBA 3C6TB 5F8HA 4XPCA 1RT6B 3LANA 4ZMMA 2R2SA 2FLPA 2VA3A 4PUOA 5HBMB 1RT6A 3Q8RB 5I42A 1TL1A 2AGPA 4O3PA 1TL1B 4O3QA 5J2PB 3ICLA 2UVWA 1C1CA 3UQSA 3H5XA 1S1XB 3PJWA 2V4QA 2DPIA 2R2RA 1W25A 5C25A 2WOMA 4URGA 4U6PA 4ED2A 5KFVA 4FBTA 2IM3A 5C42A 3IRXA 1JLEA 2ASDA 1RTHA 3QO9B 3DOLB 3DYAA 4MH8A 3IS9A 3TQ1A 1RYRA 1RTHB 3QO9A 3RAXA 2UVVA 3FFIA 4YP3A 4IDKA 1QE1A 3QYYA 3KHRA 3PHEA 4FS1A 2ALZA 1RTDA 2YNIA 2OPQA 3PVXA 2V4RA 1FK9A 3PR4A 5F9NA 3T5LA 1S1WB 1LWEA 3QIPB 3BSOA 3V81B 1JLFA 4NZ0A 4PWDA 1S9EA 4RW8A 1T03B 1N48A 4WE1A 3QZ7A 5HROA 3D5MA 1S0NA 1S6QA 2R2UA 1BQMA 4O4RA 3DRSB 1REVB 4IH7A 2XI2A 3ITHB 5KFSA 4ZPCA 5KT5A 3MEDA 2R2TA 5J2NB 3KLGB 4F4ZA 4RW7A 1XR7A 4TLRA 3E01A 4EYHB 4F4WA 3MEGB 3SFUA 3HKWA 5C24B 1LW0B 5L1IA 4ECWA 3M9NB 4KV8A 1N5YB 2YKNB 5DLGA 3MR3A 4IR9A 4MIAA 1HPZA 3DOKA 3GQCA 2W9CA 2UVRA 5KFCA 1HNIA 4Q44A 3OLAA 2RF2B 2IJNA 5KFLA 3Q8QB 3IRXB 1RT1B 4RW6B 4K4TA 2JC1A 1RT1A 1RT4B 2R8IA 3N6LA 1RT3A 1HNVA 4ZP8A 4DEZA 5J2PA 4LSLB 4EO8A 4TYBA 1TKTA 4KAIA 2OPSA 5F8LA 4MK8A 4KHMA 4K4YA 1LWFA 1TKTB 2GIRA 4EO6A 2VG6B 3H5YA 2WOMB 2HNDB 2HNYA 4KE5A 4K4UA 1DLOA 4B3OA 4XPEA 2YKMB 2ASJA 2YKMA 3LALA 2D3UA 2YNGA 2W9BB 5KFFA 4ED3A 3PW5A 5F9LA 3T19A 2FLLA 3DRSA 2BE2B 4WXWA 5D3GB 1U09A 5I3UB 3CO9A 5EWFA 3DRPA 4QW9A 5D3GA 1S9GA 2CJQA 3BR9A 3CJ0A 3MF5A 5KFIA 3TAMB 2HWHA 4WXOA 4RZRA 3MR5A 1JLAA 3M9MB 3OL9A 5KFYA 1VRUA 2BQUA 4WYLA 4J9KA 4WE1B 4NLPA 3V6KA 4IG0B 5KFKA 3MEGA 1IKXB 4KBIA 4JV0A 2I5JA 4KO0A 4TY9A 1IKXA 5KFPA 2AX0A 4TN2A 3UDLA 3IN5A 2W7OA 3T5KA 2FJXA 4NCGB 4IFYB 4DL6A 4IQXA 1EP4A 4XO0A 1QAIA 2XI3A 5EWGA 1S4FA 4R5PB 1J5OB 4RNOA 4QWDA 4ED1A 4IRKA 3PW7A 5K14B 5CYQA 1DTTB 4OL8A 5K14A 2IAJB 2RDIA 3OL7A 2J6TA 1S0MA 4YR3A 2FVSA 4WFXA 1DLOB 4B3OB 3LP1A 4DL2A 3IS9B 5DQHA 3M8QA 1RAJA 1RT7A 2YNFA 3TVKA 4Y2AA 4IFVB 4LQ3A 3V6HA 4NLOA 4ZHRB 2VA2A 2QE5A 1JLQA 2B5JA 4Y2CA 2VG6A 1TQLA 5F8NA 5KFJA 4R8UB 3CWJA 2XC9A 1SUQA 3H4DA 1SH3A 1LW2A 4ED8A 1C1CB 3KNAA 1IKYB 4TQSA 5L1KA 1UWBB 3QGIA 4O4GA 5DG8A 1S1UB 5C25B 5J2MB 3EPIA 2C22A 1ZETA 3CJ4A 3CJ3A 5F8MA 3MEEB 4NLSA 1MU2A 4HYKA 1SH0A 3FQKA 4IKAA 4MK9A 4K4WA 4F4XA 3BGRB 4IH6A 2AQ4A 5KFNA 4LSNB 4NLRA 5KT3A 3KLGA 3BGRA 3PW0A 3OLBA 5F8GA 4IDKB 2GC8A 1XR5A 3MR6A 3CJ2A 3E01B 1QUVA 1TL3A 1JX4A 3OHBA 1DTQA 1SV5A 4KHRA 4URSA 4ECUA 4ECZA 2YKNA 2BR0A 4KO0B 5CYQB 3DRRA 3V6DB 1S6PB 3FQLA 2IM2A 1T05B 3FRZA 3HVAA 3RB0A 3HVTB 4TYAA 4O3SA 1VRTA 2RKIA 4TQRA 3OSNA 3FSIA 5J2QA 4QPXA 4ICLA 4EBEA 4MKBA 1N4LA 3NAIA 4I7FA 2WK4A 1TKXB 3KMSA 2J6UA 4LSLA 4I7FB 5KFGA 4URQU 2WRMA 4IRCA 1JLBB 1DTTA 1RA6A 4NLUA 3OL8A 5J2NA 4YR2A 4RW9A 1HYSA 2W8LA 1FKPB 1TV6B 3NBPB 3KLEA 3DMJB 4QWAA 4FS2A 3DMJA 1MMLA 4MK7A 5CYMA 3I0SA 1YVFA 3BSAA 3QGHA 3NKYA 4Q8EA 1HNIB 1C2PA 1BQNA 3CVKA 4O4GB 3KLVA 3ISNC 3G6XA 2DPJA 1GX5A 2IJFA 5C42B 4QWEA 1HQUB 2OPPB 3V4IA 1RTJA 2BQRA 4Q0BA 3DLEB 3NMAA 2C2EA 3OSPA 3UR0A 3FFIB 1N6QB 3LP2A 3FDSA 4ECSA 4ECQA 1LW2B 1NHVA 3KLIA 2EC0A 2GIQA 2AWZA 3KLIB 2JEGA 1C1BA 1HMVB 2HNZA 2UUTA 4YMEA 4EBDA 1TKZA 2YNHB 5KT7A 5KG5A 3PZPA 5KFMA 2E9TA 2BRLA 4IFYA 3EPGA 4Q45A 2YNGB 4DL4A 1T94A 1N56A 3DLKA 4Q8FA 4NLDA 4ZVHA 1S1VA 2HMIB 4ZP6A 5KT4A 4MIBA 3ITHA 4KKOA 3EZUA 3KOAA 1IKWB 4H4MA 1LWCB 5F8IA 3KLHA 1RT5A 2IAJA 4KFBA 3H59A 4ECTA 2BQ3A 1JLAB 2IM0A 4H54A 4R0EA 1T05A 3RBEA 3PR5B 5JXSA 1EETA 2ZKUA 1R0AA 3KK2A 4KB7A 2ZE2B 3H40A 3BQ2A 1REVA 1HPZB 3DOKB 5KG2A 4NLYA 2W9CB 4F4YA 2V9WA 3LAMA 4J9NA 3Q8SB 4I2PA 2XWYA 4RNNA 1RTIA 4M94A 3GYNA 3D28A 3T5HA 2IM1A 1RTJB 4ZP7A 5I42B 2R8GA 3IG1B 1C0TB 3NBPA 3I5CA 4ECXA 4ZPAA 5CYMB 2FVQA 2OPSB 4ECRA 4DL5A 3C6UB 4G1QB 4MKAA 4NRTA 5KG0A 4WFZA 5J1EB 3MFIA 4IG3B 2FJVA 1HQEB 5KFWA 2QV6A 3I5AA 3N6NA 4ED6A 1HQEA 2O5DA 1RT4A 4WFYA 5DQIA 2BANA 4TY8B 1JLCB 4Y3CA 5KG6A 1C0UB 2E9ZA 3DLKB 4GC6A 5KG1A 5L1LA 1RA7A 2BE2A 1S10A 2WONB 4HKQA 3QGGA 2C28A 3DLGA 1FK9B 4QWBA 1S6PA 3DLGB 5KFDA 1T03A 2HAIA 5C5JA 2FVCA 1TVRB 4PWDB 3RAQA 4ZPDA 1K1QA 4O3NA 5KFZA 1IKYA 3GIIA 1R0AB 5KFTA 5KFQA 4K4SA 3G86A 1KLMB 3LP0B 5EUHA 3NGDA 3GV7B 1RT2A 3V6JA 2ZD1B 1S0OA 2IBKA 2ILZA 1EP4B 3CJ5A 3KLHB 1NNDA 2UUWA 5KFHA 3IG1A 2AX1A 4ZPBA 5C24A 3BSCA 3MR2A 3JSMA 2I5JB 4J9QA 5DGBA 4Q43A 3MFHA 3KJVA 2VG7B 1IKVA 1T3NA 5FDLB 3I5BA 3JYTA 2FVRA 2WHOA 1RTIB 3HVTA 4RW6A 3I0RA 4ZVFA 5JUMA 4IR1A 5J2MA 3I0RB 3DYAB 1J5OA 2B43A 1RT7B 3SFGA 3GIJA 3H5SA 3LP2B 3DDKA 5KT2A 2ATLA 2R8JA 5KFRA 4ZHRA 4H4OB 3H5UA 3KMQA 2YNIB 1S1XA 2FVPA 4H4OA 5J1EA 5KFOA 1JLGB 5KG3A 2XCPA 1JLGA 4NLXA 3LP1B 1S97A 3MECA 4DG1A 3DOLA 1S9EB 2E9RX 4F50A 4I2QB 5KFUA 2VG5A 1WNEA 3UPFA 1UWBA 4ECYA 1BQNB 1QE1B 5DQGA 4WZMA 1S6QB 3Q8PB 3HVWA 4NLWA 1HARA 4RNHA 3DRPB 1KLMA 4ZVEA 1D1UA 2W9AA 4LSNA 4G3IA 5KG7A 5L1JA 2IA6A 3VQSA 3OHAA 2JEFA 4IG0A 3QZ8A 4NLVA 3KK2B 1NHUA 2WTFA 3JSMB 1LW0A 4O44A 4KV8B 3KHLA 3MEEA 5KFAA 4I2PB 1IM4A 2ASLA 2ZD1A 1VRTB 2RKIB 3C6TA 4PUOB 3DM2B 4WYWA 5HBMA 2C2DA 1ZTWA 4J9MA 1DTQB 2AGOA 3GIMA 5HLFA 3BJYA 5KFBA 2RDJA 2W7PA 3KHGA 4QWCA 1N5YA 3C6UA 4G1QA 1LWCA 3KJVB 1QAJA 3KK1B 4KFBB 1FKPA 1TV6A 3KLEB 2WCXA 3JYTB 2B6AB 2HNYB 2HNDA 4RNMA 3KLFB 3PW2A 4DL3A 4PQUB 1K1SA 3MTKA 4ICLB 4DG1B 3GILA 2WB4A 2YNFB 4LQ9A 5KFEA 1JLCA 4I2QA 2FJWA 1RT3B 2AGQA 3GV8B 1S48A 1D0EA 2IC3A 4ID5B 3ISND 3NL0A 2XGQA 3H4BA 4NLGA 4RW9B 1HYSB 1JLQB 4J9SA 5I3UA 5HP1A 5HP1B 1JLFB 4R8UA 4TXSA 4MFBB 2VG5B 2J6SA 1RYSA 3CDWA 2W9BA 2F8EX 3PJXA 1BQMB 1JIHA 1S1UA 4O44B 1KHWA 4Q0BB 5EWEA 1JKHB 3SI8A 2D7SA 4EBCA 3G6VA 1MU2B 4IH5A 4RW4B 3TAMA 4TY8A 1CSJA 2HWIA 4RW4A 4U7CA 4WZQA 1Z4UA 2V0NA 1TL3B 1S1VB 4KSEB 3RB6A 2BRKA 4R5PA 3T5JA 1SV5B 3PW4A 2IMWP 2JEJA 1GX6A 4Y34A 2OPQB 3T1AA 1HMVA 1C1BB 2HNZB 1IKWA 2JLEA 4H4MB 3M9OB 3H2LA 5HLFB 3IGNA 4JV1A 3CDUA 3BQ0A 1JXLA 1S1WA 3QIPA 2JEIA 4NLQA 3V6DA 1TVRA 3M8PB 2RF2A 1KHVA 3RB4A 3CIZA 3DM2A 4JUZA 3KHHA 2HMIA 3BREA 1HNVB 1OS5A 2XCAA 3GV5B 5DGAA 1RT2B 2R8HA 1FKOA 2R8KA 4FBUA 1LWFB 4YR0A 3RB3A 3KK1A 4RW7B 2B5JB 3QLHB 3DI6B 2CKWA 3BQ1A 2D3ZA 1EETB 1SH2A 3E51A 2B6AA 3QLHA 4J9OA 1XR6A 3MECB 3QIDA 4JV2A 5DG9A 1S49A 4RU9A 3LAKA 4K4XA 5KG4A 3I0SB 4J9LA 2I1RA 1IKVB 3M8QB 5FDLA 4IOBA 3N6MA 4IG3A 2IC3B 4ID5A 3BSNA 1S9FA 3V4IB 4IRDA 4K4ZA 3DLEA 2W8KA 3HHKA 5F8JA 1HQUA 1C0TA 2OPPA 4ZVGA 2BANB 1N6QA 3GIKA 5KFXA 1C0UA 1SUQB 4NYZA 1VRUB 2ILYA 4ED7A 3H98A 1RTDB 2JC0A 4MFBA 2WONA 2AU0A 4X2BA 2YNHA 5EDWA 4NLTA 3IGVA 4K50A 4J9RA 1JLEB 4NRUA 4ZP9A 4O3RA 1TKZB 4EEYA 3G6YA 4RW8B 1JKHA 3RBDA 1S1TA 5T14A 4RUAA 1S1TB 4EYIB 2UVUA 5DG7A 1RDRA 4J9PA 2C2RA 3KK3B 3OL6A 5J2QB 2OPRA 3KK3A 1ZTTA 4KKOB 2OPRB 5KT6A 3LP0A
chains in the Genus database with same CATH superfamily
3D67A 3RGIA 1TKXA 3MEDB 4G1PA 4DQSA 2C3MA 3V81A 3UN5A 1VI7A 2HFOA 2UXCJ 2OELA 5LXYA 5L9XA 2D41A 1J5EF 1N36F 4UW2A 3DI6A 1UVKA 1RQ0A 2PMWA 1H7XA 3CDEA 2OSRA 3FBBA 3M1VA 1Q5VA 2AT1B 1QY7A 4U96A 4YEAA 1IM6A 1PYSB 3TYTA 3F44A 2JLGA 2E1CA 4O0NA 3I9V9 3D68A 3M8SA 4DQIA 4JI4F 1IN0A 2ATCB 2AKWB 2CIMA 4IFVA 3M4XA 1WUUA 2R9LA 4YQWA 4PG6A 5GAHU 4XPCA 4ECRA 4PUOA 1BXNA 4UF4A 1MNEA 3HD2A 1FRKA 1DQ8A 2Y1LB 3Q8RB 2ZH6A 1L5UA 1K0TA 4ZLJA 1RABB 2XB2D 4P73A 5J2PB 2XG8A 1NKBA 2UVWA 3PJWA 2BKPA 4NWBA 2V4QA 2DPIA 1KQGB 2ZBIA 2WOMA 4AL6A 4EUVA 1TL7A 4LF5F 4OYAA 5L9NA 2B9EA 2IM3A 4CO1A 2N3OA 3SQGA 3MAAA 4UY8T 3BGUA 2BJEA 5HVFA 3HSDA 1N33F 1ZA1B 4WP3A 4DR2J 1WI6A 2V5HG 2QFJA 4IDKA 3KHRA 2ALZA 3X1LB 1RTDA 2QMWA 2JVOA 4OX7A 4B9MA 1VDHA 2MZRA 3PYGA 2F8MA 3T5LA 1NB7A 3D0IE 2VF3A 1S1WB 1LWEA 3QIPB 1JK9B 4C2MA 5AXLA 3MMAA 3BSOA 4E0DA 2P9CA 1T03B 2HPUA 2OO4A 5C2GA 4F3MA 2RAQA 3QZ7A 2MSSA 4HT5A 1S0NA 2LEBA 1FKAF 3GR0A 3ZXWA 2V4JB 2XI2A 1NMEB 3MM6B 4HI1A 5HJXA 3BR8A 5IV3A 1YJNS 2AQ4A 1PGZA 3K5LA 3DLLQ 3TOQA 3QSIA 1XR7A 3GJSB 2F65A 5IM0A 1T11A 5DM6Q 5T7LB 4F4WA 1U6FA 3K2YA 2CPJA 3SFUA 3TP2A 2Z56B 5C24B 3CCMS 4DZDA 5L1IA 3QWUA 2EFQA 1Q0NA 4KV8A 5DLGA 3GU0A 3D0HE 2ZH3A 1HPZA 3DOKA 2DNQA 2EPIA 1HQ2A 3HX9A 2HRUA 3OLAA 2WBRA 4HTIA 1GMVA 2CUYA 3K8VA 2MHEA 4AE5A 4X66J 4QR0A 1JNRB 2D69A 3KUHA 1RT4B 2E5GA 3L7UA 4ZP8A 4GVBA 3BN4A 1S57A 4KGVB 1LXJA 3CF5Q 1QAYA 4HHJA 2FVQA 2UXBJ 1PAUB 3EGWB 4MK8A 5HMYA 1W2IA 1LWFA 4KYZA 4EO6A 1ZS6A 2KT2A 4WKYA 2HNYA 1FEEA 3D6TB 2IRYA 1IJFB 4XPEA 2HVEA 4MTPA 1YTYA 1IWAA 5E3CA 4JYAJ 3HI9A 4A47A 2O01C 5D6GA 3A13A 4KIAA 5AE3A 2C2MB 4DV2J 4ED3A 3FCWA 3FBCA 3DRPA 4FF1A 1S9GA 2DHGA 1MN9A 3BR9A 3C66A 3MF5A 5KFIA 1N33J 1YRXA 3MR5A 1KQFB 1JLAA 5LXRA 2ZKTA 2OKQA 4NE9C 4HHHA 4ES3A 3VALA 4JI8F 3J81U 4LF8J 2JX2A 2R7WA 3K7RA 3MCOA 4DXLA 3J7YU 1VQ9S 3NGRA 4KO0A 4TY9A 1F5BA 4LF8F 5CH7B 1Q5YA 2HGMA 2HSEB 3EE3A 4I56A 1L3UA 2W7OA 1WD6A 1PKUA 3MCSA 4DL6A 2E5LF 4IQXA 2VQEF 3AB2B 5H9EK 3OT9A 3PCOB 3AJDA 2CZVC 4F04B 1IBCB 3SQOP 2J6SA 2DITA 4PPZA 4RNOA 1J5OB 2MKYA 4N41A 2QLBB 1AUDA 1BGXT 3PRVA 4QR1A 2Z2YB 4DBQA 1K44A 2W1BA 2LU2A 1UAWA 3R3TA 4OL8A 1GXLA 4WP8A 4LFBF 4DX8H 4EU0A 5LL6d 3EXYA 3W5ZA 3NS7B 5F41A 2OEJA 4B3OB 1QTMA 3IS9B 3MI7X 5DQHA 1QLNA 1FXLA 1V3ZA 3A8JA 1NJIT 2EVZA 3EZ5A 4Y2AA 4YOEA 2RB7A 2X1AA 4LQ3A 3V6HA 1Y4ZB 1YDLA 2ZWOA 1KS2A 4ZHRB 1CJVA 3HHDA 3ISZA 4CO3A 2VG6A 1H2TZ 3GYXB 1EB0A 2UV8A 1XTZA 1IXKA 3CWJA 4I1TA 3PX0A 3NS6A 3FCHA 3TZWA 4C8KA 4B3SF 3OD2A 4DV3F 1IKYB 1TL5A 3QGIA 3EPIA 1M5KC 5C25B 4JI7J 2KJWA 3FUYA 1ZETA 3MPWA 2U1AA 2X1BA 3CJ4A 4DI6A 5F8MA 4C8YA 1VRQC 2VKRA 1SH0A 3FQKA 3L7PA 5A76A 1RWMB 5I4MA 4XDCA 4TU7A 5D4NA 2ALYB 3MM7B 1VQOS 5F8GA 4YB1P 1XNRF 1YSJA 2L08A 2JWNA 5HO4A 4DV2F 1S77D 3BF4A 1SPBP 2VL1A 1JQGA 3ZZUA 2EK1A 4CM0A 2H5EA 4ECUA 3HMJG 3R6LB 5A0YA 5CYQB 4U9RA 2I6WA 1S6PB 2F9DA 3FQLA 2IM2A 1VQ4S 1W26A 4Y2MA 1XEZA 1RACB 2GO9A 4TYAA 3UN2A 4JI8J 2APOA 2RKIA 4JV5J 4GO5X 2AYEA 2H5IB 2XBPA 2HRTA 3T6JA 3RW6A 2GQ2A 2PEHA 3AQPA 3OQ2A 4B3MJ 4YB5A 3HP6A 4Q2MA 2HBZB 4IOCQ 2AW0A 4PQUB 3HF5A 2EWHA 4J5OA 2WRMA 3DGPA 4URQU 4LFCJ 4W4MA 4DG1A 1IJEB 3CNQP 1M5OC 3O5TB 4CO0A 2W8LA 2CPFA 1FKPB 2HGLA 3B6BA 1SKUB 3KLEA 4LBPA 2VHGA 3CJKA 4MK7A 5CYMA 1YVFA 4CH0S 3IRWP 2B51A 4DR3F 4WFNQ 3TAQA 1GTHA 2C3PA 4LBIA 4Q8EA 3W8GA 1HNIB 1C2PA 2EK6A 2PGCA 3CVKA 2CZ9A 3ISNC 4O4GB 4YDXA 3AD9C 3RUBL 2DYAA 3THVA 4LFAJ 4M5DB 4FZVA 2LXFA 2QL5B 2D74B 3N4WA 3IWLA 3AAWB 4CLWA 2C2EA 3OSPA 3R2DJ 4QCLA 4DFKA 4LF9F 3AOCA 1XQIA 3LP2A 3FDSA 3HD1A 5AXMA 1S5ZA 1LW2B 3OXFA 5A8RB 2V2ZA 1RZMA 1HMVB 2UUTA 4ZOSA 1CJTA 1NSAA 1TKZA 2YNHB 1QD1A 5KT7A 4WTOB 5KG5A 1CJTB 5KFMA 4P2SA 1TAUA 1RE1B 4CTAB 1UCNA 2BRLA 4ZPVR 5GVQA 2E5HA 2R4FA 2DR7A 3H8YA 2GS8A 1IBKJ 5DS7A 3PYFA 2QTWA 4Q8FA 4NLDA 2IA0A 5KT4A 5E5NA 2ABYA 3NLCA 4MIBA 4KKOA 1NDKA 2DNKA 3IP0A 1IKWB 2OD4A 3MOJB 2ZJRQ 2GAGC 3RRHA 1EAYC 3VCDA 2IAJA 4KFBA 2NUUG 3OR2B 4ECTA 4ELVA 3POTB 2GIFA 3R1HA 1F2GA 2XHCA 1R0BG 2BJ8A 3W2WA 4DV0J 4KB7A 3R7SB 1I5OB 1REVA 2B9WA 1HPZB 3DOKB 1HWLA 3I56S 3LAMA 3MOZA 4OX8A 2MKSA 5L8RC 2CQ0A 1WTBA 3TA1A 3T5HA 1H7WA 2KO1A 3A8EA 1QSYA 1QM9A 2IM1A 1RTJB 5I42B 1VJWA 2B7BB 1C0TB 2FYXA 2G2ZA 4DJBA 4N76A 3ET6A 1NK4A 1JMTA 1VCTA 3ET6B 5J1NA 2KG1A 3ETMA 3Q22A 2MLXA 3FCVA 3HFKA 4WJBA 2NSBA 1RADB 3TJ8A 1CPZA 3I4HX 1NLKL 1WDTA 1HQEB 3U1LA 1YBTA 2DGWA 4OZ1A 1IUJA 1HQEA 2UXBF 4PQAA 3PFEA 4WFYA 4DV6F 1NDLA 5KG6A 1MN7A 4ZLLA 3VZIA 1UW9A 3PXGa 1C0UB 4YY3F 3HHEA 2EKNA 2KRRA 5KG1A 3IBFB 2FHOB 2WONB 3W61A 4KPYA 1GH8A 4A8FA 4OIXA 1FK9B 1CJKB 1SB6A 4OHWA 1DARA 2HAIA 2W24A 2QMXA 3FNNA 4PWDB 2CQ2A 1N36J 4ZPDA 4O3NA 5KFZA 3UNGC 2XNRA 4F67A 5KFTA 5B0GA 2FD2A 2DVIA 1W2BR 2RMLA 2OJ3A 2QLFB 2YQ0A 3AXKA 2AZ1A 5K8OA 5AJ3J 2IBKA 3VWSA 2A2DA 1WORA 3CJ5A 3M2UB 4LR8A 5JVGQ 2EC2A 4CNZA 4CCHA 5KFHA 4QU7A 4DHVA 2DNYA 2AEJA 3GZ7A 2ZC4A 3IG1A 1D8YA 4DUYF 1Q81T 3JSMA 1EIYB 8AT1B 2A1BA 5DGBA 3BZQA 3BEGB 4Q43A 3KJVA 4KGKA 3TZXA 4USKA 3HK2A 3M30B 2FVRA 4PG8A 2ZHBA 3IAM9 2HHHF 4DFMA 4RW6A 1XIQA 3UVJB 4OYIA 5JUMA 1KBRA 2QA2A 4B9VA 1SJFA 3DYAB 4IR1A 3C15B 2SXLA 4KR0B 2KM8C 3SFGA 3H5SA 4DR2F 5KT2A 1E6VB 4YFUA 4I64A 2MZQA 4ZHRA 3H5UA 4A4JA 1T9TA 1UWAA 3M7VA 5H1SV 1Q86T 4A8SA 1KQSR 2B0GA 2QLWA 2DT9A 3ILOA 1JLGB 2UUBF 3EZOA 2Y0BB 2ZEJA 5KG3A 2HVHA 1JLGA 4EZ9A 4PXCA 1S97A 1R3NA 4Y2IA 4XK8C 1RAOA 1PG5B 2QG9B 2YKAA 2YQ1A 5M2RA 3EM1A 3PEJA 1R8BA 4C8NA 4M5JA 3R97A 2OLWA 5KFUA 2W2MP 4D3HA 3LGMA 3MUVP 1BQNB 1QE1B 3Q8PB 3HVWA 4DU7A 3VAGA 5D4PA 3PO5A 3BBFA 4G3IA 1VMBA 1WEZA 5L1JA 3BGLA 3VQSA 2IA6A 2I9SA 4F8RA 3OHAA 1H73A 2CJAA 2RQCA 2X1FA 3OTCA 3TUZC 2R7OA 4PCQA 3WQPA 3KK2B 4LF6J 3DDIA 5I3QA 4NMLA 2IHR1 4F2RA 5GADU 1YBUA 2BABA 3MM8A 4PG4A 3D54A 3MEEA 4LRDA 1B3TA 1KNZA 3W3SA 2QO3A 2KYZA 3OR1A 4M5GA 4U8YA 2CQCA 2RKIB 4MYUA 3DM2B 3KKFA 4WYWA 4LF1A 5HBMA 5D0HA 4E98A 4J9MA 3AD7C 2AGOA 1F1BB 1GAOA 2J8SA 2ZVSA 2RDJA 5KFBA 4X4PA 2A10A 4QPTA 3R8YA 4QWCA 3KHGA 2CVIA 3C6UA 4G1QA 1LWCA 4J9VA 1N5YA 1HI0P 2AJFE 2F5GA 3Q89A 4NEZA 4C3MA 3KK1B 1FKPA 1KWMA 3KLEB 1NK8A 3KWMA 1CBKA 2C2KB 4OZ3A 3K8WA 1KQKA 4RNMA 1AT1B 3D1QA 2OHDA 5C2CA 4ANEA 3MDFA 3LOUA 3BGOP 1YRUA 3BKUA 2WB4A 2YNFB 3W1YC 4I2QA 2MKHA 1IR2A 1CULA 4C97A 1B70B 1A6LA 4ID5B 5BXIA 3NL0A 2V34A 1RAFB 2AYBA 4DR4F 3OW2R 1Q8LA 3H0PA 2GHPA 4KH0B 5H9EJ 1VK3A 5HP1A 3L4BC 2O67A 5HP1B 5JJBA 2Z2ZA 4TXSA 1HWIA 1S59A 2OH2A 2VJVA 4ID8A 4LF5J 1GT8A 4EK2A 4OYMA 4MFBB 3SCLE 2HZAA 1FD8A 1RYSA 2W9BA 3QWPA 1VQ8S 2ZDOA 1JIHA 4ELUA 1N54B 3PTWA 4LR7A 2DEJA 4QJVA 4WU3A 3QAUA 5EWEA 3HXMA 4DR1F 4I6YA 1HNZJ 2VOOA 4NXMF 1UPMB 3G6VA 1MU2B 4RW4B 1CSJA 2HWIA 4RW4A 5SZTA 4QYZK 4USWA 4WZQA 2V68A 2VKZG 4KSEB 3RU0A 4F4XA 1Y3KA 2BRKA 2GHWA 3RB6A 1UA1A 2VPXB 3T1AA 1C1BB 3OTOF 2R7UA 1IKWA 4XAKA 4BWJA 2BJ9A 1NK9A 4JV1A 3AQOA 4CLTA 4MT1A 4U67Q 1S4EA 1U2RA 2KZMA 4ZITA 4BBYA 4IR9A 1TVRA 3M8PB 2HFNA 3A12A 3BH6B 4JI2J 5HMXA 3T1YJ 3SSQA 1HWKA 4XDDA 2LDIA 3P45B 2HMIA 2Y1IA 5HI7A 1OS5A 3MMCA 2EXUA 2X51A 1GXUA 3P5TL 4FVCA 4ETXA 5DGAA 2ACMA 1Y10A 2CZ4A 4IOAQ 5LSOA 2GJIA 4RW7B 3QLHB 3DI6B 2CKWA 2LQBA 4X4VA 3QLHA 1OY9A 1ZM3A 1DY3A 1SH2A 1VLYA 3B54A 3QMQA 4BLGA 4J9OA 2GJ2A 3JQJA 4RU9A 3UDCA 4LF4F 4F02A 1F2HA 3LPEA 3DLJA 4E8UA 2G0JA 1VGYA 1NZAA 3M8QB 4NXNF 3DHWC 1FDDA 3MM9A 2GAHC 3V4IB 2BOPA 3GG1A 1FNXH 2AV5A 3VAKA 5F8JA 3HHKA 3Q86A 4OX6A 1HQUA 1PJ7A 2OPPA 1NSQA 3TQEA 4N56A 5GAEI 3U7JA 3M32A 5KFXA 5MLCV 2DR5A 1C0UA 1SUQB 1SC4B 2GVDB 4USIA 3T9ZA 1T7PA 1XNQF 3TUJC 2CNKB 1R8PA 2WONA 1U45A 2QGFB 1UEKA 1EX8A 3G2XA 4ZP9A 1DQAA 4OJ3A 4WTYA 3G6YA 4EEYA 3BB5A 3G96A 1S1TA 1NJXA 3J7AN 1S1TB 4EYIB 4ZDNA 3IBWA 1L3TA 4K7QA 2H3EB 4J9PA 2DGOA 4Q5VA 3B8HA 3HJVA 3AA9A 1KKHA 2OPRA 1ZTTA 2HHTA 2R7VA 1GMUA 1NDCA 2OPRB 2QA4S 3BS9A 2ZHOA 1HD0A 4ZN1A 1RT5B 4PG5A 1LWEB 4C6AA 2E44A 1TP7A 4TKTA 3OVSA 3PIPQ 4B17A 2NPFA 4CZCA 1NU4A 5DLFA 2RILA 1LXNA 4RUCA 4M95A 2ZE2A 2HEKA 1FRHA 2MZSA 2CPZA 2IDLA 3EWGA 4N77A 4DR7J 1T9UA 4ILMA 1NPKA 2DGQA 1SKWA 1I6JA 4V19X 4FYVB 2MKKA 2DXEA 5A6WA 2P6SA 5L38A 1JLBA 3C6TB 2QLXA 2XGPA 2R2SA 2VA3A 4WF9Q 2J9DE 4PG7A 2FLPA 4LFAF 3BBBA 3JSRA 1IBLJ 3EGZA 2XMKA 3WIVA 4O3QA 1C4AA 1VQKS 2LQJA 2VASA 1C1CA 4FYXB 3UQSA 1LFWA 2EBGA 5A8KA 3NGUA 4A8MP 1M5VC 1O8BA 4ZLPA 3H5XA 3R27A 4DF4A 4URGA 3P5BP 3PACA 4ED2A 5KFVA 1JLEA 2ASDA 2ZH1A 3QO9B 4A8QA 3M8WA 1HR0F 1RHUB 3QO9A 1SJ3P 2UVVA 1JJ4A 1OY8A 1URRA 3IR5B 2ZWPA 4ZVRB 3FFIA 3QRQA 8ATCB 1QE1A 1EZZB 2GMJA 2GVZA 3AB4B 3PHEA 5IFMA 2QYGA 1DBDA 1HLWA 1SJQA 2QC3A 1WELA 5F9NA 1G6BA 3QT7A 2ZH7A 2VOPA 4DSIA 1BQXA 1JLFA 3F73A 1FNMA 1S9EA 3HSGA 1N48A 1YJTA 1HKAA 2XTJP 3D66A 3GCWP 3K57A 5HROA 2PMZD 3RBZA 1HBNB 1YHQS 4OI0A 4GKKJ 2LXIA 2B9XA 4HH0A 4X4UA 2PI5A 1A7GE 1OIAA 1RK8A 1WACA 3F0NA 2GX8A 2EFGA 1BE4A 1QTNB 2VDHA 3KLGB 1I51B 1UP1A 2EG2A 2JSXA 1FJGJ 3MD1A 2Y1JA 1U2CA 3E01A 4MMOA 3GYGA 4UQTA 1FTCA 3HKWA 1N5YB 5G0RB 5IS2A 1J5EJ 1U8SA 4LF4J 5ETVA 2GMHA 1X9WA 1BWEA 3HZEA 2VONA 3QFWA 2OD6A 1V5VA 2GQQA 2RF2B 3M6UA 2IJNA 4UUWA 1FRJA 2NSCA 2VC0A 5E7OB 3IRXB 3LH2S 5KFLA 4X84A 5F0WA 1F9FA 3TA2A 3V2UC 4MKVA 1O0PA 4LFCF 4KT0C 4RUHA 2BJ1A 1HNVA 4WWSA 1EQ0A 4QYRA 3BM7A 4L73A 3DC2A 2F1FA 4DEZA 3O8WA 4ZCMA 2CJKA 4LSLB 4EO8A 8RUCA 1MROA 2DRAA 5F8LA 1MROB 5E0OA 2CAJA 2HHHJ 4DLEA 4BS2A 2HNDB 4KE5A 4FN5A 2ZFHA 3JB9k 1K73T 4B3OA 4K4UA 2VH7A 5HMWA 2A6MA 2YKMB 1FRXA 3HZGA 3PYDA 4CRJA 4X4QA 2YKMA 2G2YA 3LALA 2D3UA 1PC5A 5H9FJ 2VBZA 4Y00A 2RQ4A 3NOCA 2W9BB 2MY7A 4P10A 5EN1A 1D3WA 4FDFA 3DRSA 4OLPA 3U27A 5CCMA 2B3TB 3OXGA 3CO9A 1WHVA 4QZVB 5I3UB 5EWFA 2KT5A 4QW9A 3CJ0A 4UOHA 1XMQJ 3CGIA 5E2QA 2O3DA 2NXEA 4U8VA 4WXOA 4WYLA 1KLNA 4WE1B 3V6KA 4P6QA 1GK8A 5ETNA 1IKXB 1RXOB 2KHDA 1IKXA 2LLZA 5HK4A 1KOHA 1NSPA 2K1RB 4AT1B 3OVBA 4TN2A 1NAQA 1UTAA 2LA4A 3R5GA 1X9SA 1H98A 5CZXA 3PO4A 4DSJA 2COLA 3LUYA 1ZPVA 2X1GA 4XO0A 2XI3A 2BJDA 2DXDA 2IRUA 5EWGA 2UU9F 2W01A 2FHJD 3MCMA 2F7VA 1TUWA 4OYBA 1X4CA 5E3PA 1FO1A 4CM2A 2FUG9 4DQQA 2RUGA 4B9SA 4IRKA 3LTOA 5B09A 5CYQA 5L39A 1DTTB 2B8PA 4OYWA 1NEEA 4ZN3A 1HWJA 1X4FA 1Y5LB 2ACYA 2AZ3A 2VU5A 1KONA 1TL7B 4UUXA 1FE0A 4EZ6A 2DO4A 4PWUA 3B78A 5DDPC 4YR3A 3UCGA 4DL2A 3MZIA 2YWWA 2VICA 2HBRB 1RAJA 3M8QA 4KRWA 2C42A 1TR0A 1TMMA 3MMBB 4IFVB 1N32J 4EI2A 4TLQA 1VQSA 2MTLA 4X62J 1RTZA 2QE5A 2VA2A 1Q79A 2MQ8A 3K58A 1OQ3A 3GLJA 1ZM4A 2DGSA 2VBWA 2L9DA 1ZAXA 3CCTA 5U47A 3HO1A 4R8UB 3QT5A 1WOPA 4JV5F 1VIOA 3MURP 2AJ1A 1Y0HA 2KI2A 3LGNA 2XLKA 1SUQA 2GVDA 3HFZB 3MUTP 1S6UA 3A8IA 3M6WA 3KLFA 1RAGB 1L3VA 4OYXA 1Y3JA 3KNAA 3PFOA 3PKYA 3GR1A 1MLAA 4FKYA 1ZBTA 1CQMA 2M5YA 4O4GA 5CCLA 2XQCA 3W63A 2HGNA 2C22A 3A3OB 1DAXA 1KTQA 2BV3A 4YY3J 3OJUA 3RG6A 4L3KA 4NPOA 4NLRA 5KFNA 4ED4A 5KT3A 3PW0A 1VQPS 1T9YA 5IQQA 3CMAS 5I3PA 3RBEA 1T9VA 4IDKB 4EMDA 5AE1A 1XR5A 5A8RA 1JX4A 1TKDA 1TL3A 2XLJA 2AJ4A 3U02A 1SV5A 4FXVA 3JXOA 4KHRA 1KFDA 4ECZA 3PX4A 4ZS6A 1RLDA 1P9YA 3DRXA 5D4OA 3V6DB 1NJYA 4S0MA 3I31A 1VQLS 2Z2LA 3RB0A 3QT6A 2XO6A 2DNOA 3MCNA 4O3SA 4KGMA 4L76A 1RISA 4TQRA 1SJ1A 2RQMA 3VGSA 3OUYB 3FSIA 2V63A 5J2QA 4RR5A 3Q8YA 4Z37A 1S79A 1HNWF 1LFPA 3NAIA 3UE2A 2HYIB 3KMSA 2K8GA 4NXMJ 5KFGA 2VJUA 5T41A 1JLBB 4YR2A 1UA0A 1QSSA 2DNNA 2NS1B 2J6TA 3J81j 1KVJA 5AT1B 1MMLA 2D3O1 3I0SA 3SSRA 2H4WB 3UNYA 1M5HA 5LMUF 1DRZA 3P4UB 2B56A 3GFHA 1NPRA 2HHQA 4RWXA 3D7SB 3G6XA 1GX5A 2N7YA 1F5AA 3CT9A 4M5IA 3ZO7A 1TTHB 1RTJA 4Q0BA 3C14A 1Q7LB 3DLEB 2DCLA 3EMTA 3I55S 1HNXF 3C14B 1OPIA 1FERA 3UR0A 2RU3A 3NNCA 3FFIB 1N6QB 4ECSA 2FHJA 1KD1T 2YWFA 4ECQA 1Q78A 1Q53A 2DNPA 5E3RA 3G6ES 2VD3A 1GMWA 1HD1A 1KDNA 4HHUA 2J5AA 1F3FA 4YMEA 3T3FA 2AYMA 2EFPA 3GPAA 3THPA 3PZPA 4HT7A 2X3DA 2XY6A 2E9TA 1VHFA 3ZZYA 2BW2A 2E1RA 3C16B 1FCAA 3B4MA 1B0PA 2BVZA 1NDPA 1AZSB 3FZ2A 4KH1B 3W9JA 2UU9J 4ZVHA 1S1VA 1U0HB 3R5DA 3D6HB 2CFXA 4AFFA 3KOAA 1G4CA 4ATNA 3HVRA 2LEPA 3KLHA 3F56A 2BQ3A 1S99A 4HLBA 1JLAB 2IM0A 2NXCA 4KC5A 2K7JA 3G4SS 3C19A 4WK1A 5DO2A 4OI1A 3ZZPA 5JXSA 3PR5B 4F7VA 2ZKUA 2LECA 4BCAA 4ZVUB 4FP9A 3N79A 1UFWA 1RGVA 3BDPA 5KG2A 3R2CJ 4NLYA 2HRYA 2NXUA 4KJIA 1MG7A 4J90A 4YHHF 2J0SD 1RTIA 1CS4A 1YG0A 4KQZA 2KM8B 2L48A 5LMNJ 4B3MF 2ZOFA 1X4AA 2N82B 3IR7B 2R8GA 1FRIA 2BDPA 1U48A 3IG1B 3NBPA 3I5CA 3QPIA 4YHHJ 1D09B 5IOLA 4B9TA 3NCPA 3CCRS 2YKPA 4C8MA 4J37A 2MLZA 4OX9F 4PYDA 1N34F 2C3YA 5KG0A 5J1EB 1NH8A 3MFIA 3L7OA 2UUCJ 3H20A 4OJHA 5GMDA 3PYEA 4UTGA 1IBLF 1TZ0A 4DUYJ 2IMOA 5DQIA 2WW8A 3HULA 4DR4J 4TY8B 4LRAA 1ROFA 3SDEA 4ZJQA 2ROPA 2NUHA 3DLKB 1RBLA 3AOAA 3Q0AA 2XCPA 4HDHA 4NZ7A 4HKQA 2H5JB 1BUXA 3FEYB 2XMTA 2YH0A 1AW0A 3DLGA 1S6PA 1I94J 3DLGB 4M1KA 1T03A 3TUIC 3T1HJ 1F0XA 1BD6A 2ZC3A 5C5JA 3A3PB 3CD0A 2ZHAA 1S72S 3LO3A 3MD3A 4M5MA 2NZ4A 1FXDA 1IKYA 5ITHA 1I3OB 2V4JA 3MM6A 4K4SA 4DCJB 4ENOA 3MM5B 1OYEA 2DCUB 3UD5A 3D3BJ 3D3CJ 1S0OA 3ENAA 3UI3A 2ILZA 1PAEX 2HQCA 2UUWA 2FY8A 2ZBCA 1CQNA 2PA8D 4USVA 2HLUA 4CT8A 2IVYA 3A1YG 5C24A 3PJ9A 1WTFA 3JTNA 2BMBA 2XY5A 2I5JB 1TU0B 2M88A 4N47A 1IKVA 1T3NA 2GCFA 5FDLB 3RR8A 1UZHA 2IDEA 1RWKB 1OY6A 3BN7A 3PRBA 2IVMA 2F9JA 4OJ1A 3HM9A 1VBXA 3IC1A 2EW9A 2B43A 1AFJA 1PSDA 1RAIB 2WVBA 3LP2B 3FBFA 3MMBA 2ATLA 4LF7F 5KAKA 3Q2TC 5KFRA 2R7XA 2H65B 4H4OB 5LSRA 3KMQA 3NCRA 1S1XA 4H4OA 2G0CA 2DRDA 2KRBA 3PY8A 2RVJA 3FSYA 5D8HB 4CLYA 2OAUA 3SXLA 4NLXA 3LP1B 3VV2B 4YDDB 3DOLA 2VBYA 2DR9A 4F50A 4I2QB 2DEIA 2VG5A 3NGKA 3UPFA 3ZZRA 2A18A 2N4DA 1JNZB 1EARA 1LK7A 5DQGA 2GJFA 4ZJLA 1HARA 2CG8A 1F6TA 2LQ9A 3DRPB 3K5MA 2AF6A 1ACMB 3IBCB 2DNLA 4ZVEA 3TJ9A 4MJKA 5LSLA 4DV7J 1KSPA 5KG7A 5DDRC 3KDOA 4DLGA 5IWAJ 4DR3J 5EX3A 1NSKL 3DLBA 2RD5C 3CUNA 3K59A 2WTFA 1U1QA 2MQLA 3FRYA 2J7WA 4KV8B 1ELOA 5HATA 3KHLA 2VFRA 3OFEA 4ES2A 2XMWA 3J80U 3CB4A 2ZD1A 4JI0J 1Q82T 3W66A 2I2YA 3IXQA 1EQMA 3KNGA 3H90A 1UPPA 1BC6A 1DTQB 3VHQA 5BYQA 2RHSB 3BJYA 1K8AT 4QYZJ 2W7PA 2V69A 2XZTB 4HL9A 4DF8A 4EGLA 1FF2A 1QAJA 1LNQA 1FRLA 3LF0A 4KFBB 1IVZA 2I38A 3JYTB 2VQFJ 4A46A 3QSYB 1EHWA 2E7VA 2HNYB 5CHCB 2MHNA 3MTKA 4ICLB 3GILA 2FJWA 2DTJA 4LQ9A 4AL5A 1U8WA 1SI9A 1RT3B 3JQKA 3D1OA 2MXYA 3GV8B 4DV5J 1S48A 4ZJOA 3BO4A 2AGQA 3EXCX 3ISND 4NOHA 2XGQA 2M8HA 1TFYA 1RWVB 3DOMB 5H9FK 2HBYB 4RW9B 3NS5A 3HT0A 4LUBA 5HN0A 1JLQB 4J9SA 1HYSB 3QATA 4UOCA 4Z7YA 3CMES 4O23A 1T0TV 2XWXA 3G9CA 3KTQA 2HQGA 2J8AA 2JHEA 4ILRA 3CDWA 3PDNA 3PJXA 1VC6A 3VAFA 1BQMB 1AFIA 4K2XA 1S76D 1S1UA 2MSTA 4O44B 3ZZ0A 4JI7F 2EI5A 3TANA 2CWKA 1JKHB 2K2PA 2W2OP 2D7SA 1IQTA 1M1HA 1MMDA 4IH5A 3O1LA 3TAMA 4X4OA 3RAMA 1AZSA 4NZ6A 4RL1A 5CD4A 1N32F 1S1VB 2KFZA 3DHXA 2UZAA 2OPQB 1KN6A 2HNZB 2JLEA 3LGHA 5EX0A 3VGUA 5HLFB 2HHXA 4PXEA 3IGNA 3ELHA 2HZCA 3CDUA 1JXLA 3PG9A 2JEIA 5CXTA 3M30A 3NG8A 4NLQA 3W7BA 5IWAF 3M1VB 4CLSA 4OHZA 1KHVA 3RB4A 1NUEA 1X5OA 3CDAA 1N5TA 4JUZA 1JB0C 2FZGB 4V1Ak 4DU8A 2FC8A 3V5RA 4OHXA 1UZDA 2LEAA 3K89A 1EKSA 1U02A 3GV5B 3EDRB 1CS4B 1YJWS 2CNNB 2ZZNA 2R8KA 1YJVA 2QSWA 4JI0F 3RB3A 4JYAF 1QUPA 3X3UA 5LJ3Y 2EG1A 2MPUA 3RRKA 1KVKA 1EETB 1OQ6A 3E51A 2B6AA 1GFWB 2CWXA 3JSBA 4RO0A 4DDFA 1SJRA 4ILLA 5DG9A 1HI1A 2XLIA 4K4XA 3Q8UA 4J9LA 2MKCA 1B7YB 3BYPA 2IC3B 2RU9A 3CMQA 1JXEA 1UL3A 3D6MB 4CYUA 4F3OA 2VBXA 2W8KA 3JTOA 5HQ8A 4ZCKA 1RAEB 3IWNC 2E1AA 3NMRA 2Q3PA 1FFSB 1YJ9S 3C15A 4U95A 2IY5B 3GIKA 3TW0A 1XK8A 1NKCA 4DR7F 2OEMA 1T9XA 1VRUB 3L9ZA 3H98A 3OFGA 1RTDB 4OI6A 2MGZB 1AROP 3GB0A 2YNHA 1U2FA 4NLTA 5EDWA 4CIOA 1FRMA 4DPUA 1JLEB 4JI1F 1HI8A 1N5SA 4FF4A 1Y9OA 2NXNA 4DPWA 4B08A 4ES1A 1RWXB 3CC2S 4NL5A 4X64J 5DG7A 1RDRA 2BJ3A 3KJFB 2G1DA 3CEDA 3US5A 3KK3B 2GVZB 2KU7A 4K0KF 4DPXA 3KK3A 1UETA 2F8HA 2J0QD 3UDEA 4KKOB 4LF9J 3E2EA 1KVIA 1FT8A 2VC1A 2BW7A 2OFGX 2R42A 1AXQA 2K3KA 3DRRB 3Q24A 4EWTA 3U1MA 3W2WB 4DL7A 4B3RJ 4RNFA 2DHHA 4CQ1A 4ECVA 4B9LA 5HROB 3OVAA 1HBNA 5IQ6A 4PABA 1S12A 2IPOB 2V2KA 1RCXB 4OZ2A 4GC7A 1X9MA 4NCGA 1CJUB 1J27A 4O3OA 1FKOB 1X4DA 1X4HA 3W5YA 2E5IA 1RT6B 2YKOA 3FEXB 3LANA 4ZMMA 5BR8F 3GFYA 1FWLA 1RT6A 3FKBA 1OYDA 5HBMB 2Y9HA 4BC7A 1R0CB 1H0HB 4DS4A 2AGPA 3L09A 4P52A 2BBEA 1GMWD 4KGZB 1IBMJ 4GKKF 3D2WA 3M2VB 4JI2F 1S1XB 2FPHX 4DV0F 2R2RA 1BY9A 4FBTA 3NXZA 2OEKA 3W2VB 3IRXA 2JLFA 1O6XA 3BKTA 3W2VA 4MH8A 5DZ6A 2Q1LA 2I0XA 1F9HA 2KB2A 3DOLB 3T9NA 5DM7Q 1FHTA 3KFWX 3P8BB 2F4FA 3I32A 1WJ9A 4B3TF 1BLUA 3QYYA 3EVMA 4LF2A 4P9SA 1VJQA 4NYOA 2YNIA 1HW8A 1WC0A 9ATCB 1LOUA 3PVXA 2M3DA 3I96A 1R43A 2V4RA 1D9DA 1FK9A 1WC1A 4NXNJ 1HBOA 1Y00A 1U6ZA 4F0HA 2HHUA 1ZH5A 2KDOA 4PWDA 1N5QA 1DJ0A 4RW8A 2VPYB 3EGVA 2XS7A 4JV2A 2GZOA 2GA7A 4OQJA 4ZVQB 1A9NB 1S6QA 1KP6A 3QRRA 4K59A 1RB0A 2BKOA 1REVB 3DRSB 4DPYA 1UVIA 2QZ8A 4DV1F 3ITHB 5KFSA 1G1XA 4ZPCA 3MEDA 3EUNA 3S6EA 5J2NB 4X64F 3M8RA 2DNGA 4RW7A 2DH9A 3T6BA 2H54B 3GWCA 4TLRA 3TVYA 2BE7D 1HBUA 5GAGI 4EYHB 4UT4A 2QA1A 1LW0B 1KTVA 1VISA 2E5JA 3CD7A 4MAKA 2YKNB 1TAQA 1W7WA 2DGUA 2W9CA 1NJWA 2UVRA 5KFCA 4OX9J 4LSZB 4YS2A 1M1KT 3UVJA 3CULA 1KOOA 2M2BA 4GRSA 2DH7A 2P9EA 2Q79A 3TEHB 2XM3A 4DQPA 1B64A 1RT1B 1QJHA 4K4TA 2JC1A 2FC9A 1RT1A 3CJTA 4NI2B 2R8IA 3C2PA 4BDPA 2R7QA 1RT3A 2CG4A 2YXLA 2MZJA 3MMCB 3M32B 3N6LA 4NI2A 4ZCLA 3G71S 2P8IA 2L9WA 2MJUA 3W9IA 5GADI 5J2PA 3DOMA 5FJ4A 2KVQE 4KAIA 2RUSA 2YBVA 1CJVB 2RDDA 4C98A 1P1LA 4UQGA 4IO9Q 2VG6B 4Z7CA 2CJXB 2LCWA 1P6TA 2WOMB 3UO0A 2QYCA 3W8PA 4N8NA 3CJSA 3UWTA 3GTYX 2M8DB 3AODA 1I94F 4OZJA 3Q23A 2XYHB 4ANDA 5HL7Q 1RJJA 3GIRA 2YNGA 2GW8A 3E8OA 3ILIA 5KFFA 4NCBA 1BMQB 1RLCL 3ETOA 3THTA 3PW5A 2CNLB 4CO5A 3KUEA 5F9LA 3CCSS 2KKHA 4QOTA 2FLLA 4DSFA 3MXHP 5D3GB 1U09A 5D3GA 1H72C 1Q4RA 2CJQA 3TAMB 2LYVA 1QAIA 1RUSA 2AEMA 2HWHA 2JL9A 3RW7A 4F0KA 4AD6A 3C3LA 2LQ5A 3MHYA 2YWKA 1KEKA 3M9MB 2HHWA 4FYDA 4J9KA 5F0UA 3M2RB 2VUGA 3SCKE 4IG0B 3TJAA 1U6BA 5KFKA 3MEGA 1XBWA 1D8ZA 1HL6A 4DWIA 4JV0A 2WSCC 1OMSA 3R1LA 1ZA2B 5KFPA 3IR6B 2AX0A 4P7TA 3UDLA 3IFEA 3IN5A 2LXUA 3T5KA 2ROEA 3TR5A 2FJXA 1SXLA 3K5PA 1WG5A 4FPRA 2C2ZB 4IFYB 1NK5A 1EP4A 4JI3J 1WC6A 3T1YF 2WZ1A 3AJ2A 3HSJA 5BYSA 4R5PB 1JJHA 3DKDA 2PT0A 4OZLA 4QWDA 4ED1A 3HLUA 4DV1J 5IC6B 5HQMA 2MZ1A 3PW7A 5K14B 2YH1A 2JH3A 2QFIA 5JMNA 5K14A 1FE4A 1YITS 2J0WA 5LT5A 2FVSA 4WFXA 3NGTA 4J9UE 4ZKAA 4OI4A 3K5OA 1XC9A 4C8LA 1DLOB 2YX1A 2HK3A 3FMWA 5J2QB 1CVJA 2DB1A 2UXCF 1N52B 1RWWB 1SC3B 2JNJA 3W65A 1URNA 2YWHA 3BYRA 4CYUB 2WVDA 1SL2A 1WHXA 2QIFA 5A2QU 4LFBJ 2B5JA 4J91A 4Y2CA 5F8NA 3D9BA 3CD6S 4AUKA 1RCOB 3NAHA 1DURA 1F5CA 3DCAA 4OI2A 2V6AA 3QJPA 4PPDA 4LR9A 1LEOA 3CPWR 1LW2A 3N28A 1C1CB 3TARA 2CQ1A 1WKLA 4X4TA 4A8YA 4RU2A 1UWBB 3SZ2A 5DG8A 5B0FA 2HK2A 3CC4S 4L74A 3DXBA 4HR2A 2CADA 2OP5A 3MEEB 1MU2A 1Y5IB 1YLXA 2BUNA 3LWMA 4HYKA 2BACA 4FXDA 2PDAA 4K4WA 2XMVA 1PBAA 2V8PA 3KLGA 4DV5F 3OLBA 1RI7A 1UFLA 1HW9A 2FGCA 2GC8A 1RWNB 2IFXA 1AUSL 3E01B 1FXRA 1B4SA 2XMJA 3J81Y 1K9MT 3ILJA 2MB0B 4KY3A 4XIUA 4P2FA 2IIHA 1UEVA 2HHPA 4NEYA 4YN3B 1WC4A 2H9ZA 3DRRA 4KO0B 4RBVA 4BWMA 3A4TA 4CH1A 3OR2A 2VB6A 3HVAA 3BPSP 2RSQA 3HVTB 3GJQB 3AT1B 1E6YA 1QAXA 3QBCA 1Z1ZA 2M4MA 4LRFA 1Q7YT 1U0HA 4QU6A 1ZOTA 1PYTA 3FBEA 4MKBA 4F26A 1Q8IA 1T3OA 4XTTA 5M2UA 4EBEA 2WK4A 1TKXB 2RIJA 4H4KC 2J6UA 4LSLA 4IRCA 4P72A 1RA6A 3OL8A 4N5SA 1MMNA 4WFBQ 2XMMA 3DLHA 2CPDA 2LKZA 3DMJB 4QWAA 3Q2SC 3DMJA 3CJ8A 3D4JA 3SBMA 5MAOA 1B7FA 1R8HA 2H4YB 5D0EA 1UVNA 2HFUA 3KLVA 1KC8T 2HQFA 3MR7A 2IJFA 1WF2A 2V67A 2Y0SD 4PXBA 4LF7J 1HQUB 2OPPB 3DNCA 1VQ7S 2OFHX 4HACA 3VQTA 4USHA 5SUHA 1XNRJ 3NMAA 1RWPB 4PYAA 3A3NB 3AJ1A 5D0GA 4UOGA 3IM9A 5GAEU 2NXJA 4UOFA 2VV5A 4X66F 3WX8A 2ZVIA 2BJ7A 2HLTA 2Y1RI 1QVGR 3R5JB 1TFWA 3EVWA 3KLIA 4G65A 2ZZMA 4F25A 2FJBB 2Q6BA 3KLIB 3VVUA 5HQLA 1C1BA 1NXIA 2HQIA 1VC5A 4CO4A 3SQGB 2X7IA 2RRBA 3UFCX 1U1KA 2DIUA 1EJ7L 1FWPA 3KG0A 2ZJQQ 2FY1A 1IR0A 1CC7A 1Z2ZA 3DRYA 3BPDA 2AJQA 3DLKA 2UUAF 1TUGB 2VDIA 1MWZA 4NA2A 4LT6A 4QIGA 4ZP6A 2BZ2A 4OMFG 1FD2A 4FXWA 3ITHA 3TVZA 2A0FB 1OSDA 3EZUA 2G4BA 2PIIA 2W7AA 4HI2A 1HWUA 4AL7A 2ZH8A 3IM8A 3M2UA 1FVSA 3H59A 1Q95G 1GNKA 4R0EA 4H54A 2XS2A 1HBUB 2HIQA 1FEHA 4OFZA 2F40A 2QX0A 4QIWD 5A6PA 1FJCA 2F3JA 2EFOA 2J9EA 4C0HA 2NR0A 3O3LA 1CC8A 2FIUA 4C0OC 2W9CB 3MM5A 1YKWA 1WC5A 4I2PA 2XWYA 3LW5C 4M94A 1S6OA 2V94A 3D28A 3PEHA 2UP1A 1HNWJ 3G82A 5ETSA 5IM0B 4W98A 4J7CA 3TZZA 2YKQA 5T7LA 2PN6A 2PC6A 1WG1A 4ECXA 4ZPAA 1E6VA 3B82A 1H6KX 3UD4P 2KN4A 5CYMB 2BOAA 2IYIA 3HHLD 4Y2KA 4DL5A 4Y65A 3DN9A 3CIMA 2Z8QA 4WFZA 4AYBD 3QJJA 4IG3B 4B3RF 4C4WA 3N5FA 1K47A 1F3VA 2QV6A 5KFWA 1RBAA 2B8QA 5HMZA 2O5DA 1RT4A 3MAAB 4GO7X 3VZHA 2ADBA 2Y8YA 1SBRA 2BANA 1GQEA 1MSWD 2HURA 3G8SA 1JLCB 1OO0B 2BR0A 4X65F 2KXNB 2QT7A 4CLPA 1WHWA 1X8DA 1ZZFA 3SEOA 4GC6A 2PE8A 2M52A 4K0KJ 2JRSA 4AQYJ 2Z0GA 1VIXA 2LVWA 1AA1B 3QGGA 2QL9B 4GVLA 2DR6A 4QWBA 2DNMA 2Z58B 2QL7B 3H2VE 3FGVA 3ZFVA 5HSPA 5KFDA 3HHNB 2JVRA 3MMAB 5CD4H 1LKZA 3AA8A 3RAQA 2HW3A 3HHLA 3GP9A 4LREA 2UUBJ 3L3CA 1R0AB 1WF1A 3ZTSA 1C4CA 2IJRA 1WSRA 1ZPWX 2B9YA 3K5NA 1SL1A 2DISA 2NLWA 3G86A 2ZH5A 2YPYA 4DN0A 1X5SA 1WG4A 3LP0B 3OR1B 3M8YA 1RT2A 1FVQA 1PC4A 3H25A 5B0EA 3ENQA 1EP4B 1NNDA 3EDQB 2BE9B 3Q8VA 5K8PA 2AX1A 3AHPA 2V8GA 1XMOJ 3BSCA 3NRBA 4DMZA 3J7ZT 3MR2A 3TO8A 4J9QA 4FF3A 1YRTA 2OTLS 2VG7B 2ZH4A 1FNOA 1SIZA 5BJRA 4LF6F 3G8TA 1V6HA 1XMOF 1P8GA 1LK5A 1OWXA 4DQRA 2HS3A 3I0RA 3O44A 4ZVFA 2LP4A 3I0RB 5IC4B 4WPAA 3H7HB 1J5OA 1U49A 1Q1KA 3N5BA 3DDKA 2R8JA 2HFVA 2DK2A 4UZBA 1TUVA 2FVPA 4M5HA 2VFTA 3HHLC 2KYXA 4DUTA 4Y0FA 5KFOA 1U4BA 4OYPA 1V3SA 5FLXU 2HVDA 2PO4A 3MECA 1VK8A 5THWA 1S9EB 2V2VA 2WAQD 1VC0A 3R9LA 3TNVA 1UWBA 4IYQA 4ECYA 4YB7A 3DU5A 5ADZA 2HQ3A 1NHKL 2HIYA 2M7SA 2QLJB 3FMBA 4NLWA 4RNHA 2VQEJ 6AT1B 3RTVA 4W92B 1KLMA 3UD3P 1D1UA 1APSA 1V3RA 3M6XA 2C1EB 1S7IA 3QJLA 2JEFA 1DFDA 1V5IB 2UV8G 3OV7A 3QZ8A 3CDBA 4OV6A 1NHUA 4QIVA 4RBTA 5A8WA 1YJ7A 3R7BB 3IA0A 4O44A 5G0RA 3C46A 1RBOB 5KFAA 3VAIA 2CQBA 3DU6A 1Q8BA 4M5LA 1IM4A 1R8CA 2JZ5A 2HWTA 3FEZA 4DS5A 4PUOB 5A8WB 4CO2A 1GXTA 3PHTA 4I6WA 4ZK7M 1ZTWA 1O51A 3GIMA 5HLFA 3BO3A 2VPWB 3KJVB 3O6QA 3RYLA 5F3ZA 2WCXA 4NYPA 1ZM2A 4F4AA 4JBCA 1WDDA 1JJCB 5B0BA 2HNDA 2HAFA 4WBFA 3W9HA 4USMA 3KLFB 3CCZA 3P6YC 2P9GA 4CWBA 1K1SA 1FFWB 1YBAA 2I8EA 1PJ5A 4TNOA 3ZTPA 3QT8A 1UJ6A 3QAEA 4OZ0A 3SDEB 4Q7AA 4OV1A 4DFPA 2GFFA 3TI0A 2R7RA 4HTJA 2JFKA 4ZVSB 2Y8WA 3D1HA 2RS2A 4AXJA 3NNAA 2DHXA 5I3UA 4ZLNA 5B08A 1VR6A 4A8XA 5CABA 1VOMA 1OPZA 1T02A 2AJ0A 1WHYA 3NOGA 2JFDA 4CLLA 2E7XA 2NYHA 2WVFA 2HZVA 2MQMA 4ETZA 2EFNA 5K9FA 3PX6A 4U7UD 5BYRA 5DDOC 1FDAA 2Z57B 2DNRA 1SC6A 2B4PA 1KHWA 3OTBA 4USTA 4BC9A 2K1RA 4C3KA 2AYGA 3SI8A 2RRNA 1UMJA 3HT3A 1NH7A 2WSFC 3KG4A 4TY8A 2KG0A 1YK9A 3TX0A 1HFEL 2JDJA 1GEHA 5A2QY 3M05A 1TK8A 1TL3B 9RUBA 3GJTB 2IMWP 3G8QA 1SV5B 3JQMA 5FLXY 2MGZA 2JEJA 1GX6A 5RUBA 4N7TA 4DV6J 1HMVA 4C8ZA 1YZ6A 3H2LA 2YWGA 3BQ0A 5A0YB 1S1WA 3NEKA 3QIPA 4CTAA 2FJEB 4ER8A 1HHQA 2V8DA 4R0JA 3IAS9 1VYAA 5ETTA 3U1NA 2P5VA 4ALZA 4QR2A 1V9OA 2LU1A 1WOOA 2VFSA 3UCUP 1UW4A 3DM2A 3UCZP 1D9FA 2HS4A 1I1GA 3BREA 1SKSA 2VPZB 2WSEC 1TELA 1U24A 4BHQA 3MAQA 1NJZA 1NKEA 2QRRA 3NWRA 1LWFB 2DD8S 5HVHA 1YGYA 4QQBA 3KK1A 3R5BA 3F41A 1HA1A 5D15A 3QRPA 3SMZA 3KUGA 1AB8A 2CQ4A 3MEKA 3SV4A 1XR6A 3QIDA 1B0TA 2DNHA 3HKZD 1SQEA 5B0CA 5A8KB 3BGFA 2OSQA 2I1RA 1IKVB 4NCAA 5FDLA 1R6VA 4IOBA 4IG3A 5CQGA 2CJYB 1EKRA 1FESA 2Q6CA 2NCKL 4ID5A 5KOWA 3BSNA 4DFJA 1S9FA 4IRDA 3DLEA 4K4ZA 3MMJA 4DX5A 3VGTA 2C2OB 1C0TA 4M5DA 2XSFA 2BANB 1NBEB 4ZVGA 3S1TA 1N6QA 4IUFA 1SL0A 3SSSA 4G6VB 4GVBB 2LQ8A 4NYZA 4A48A 4ED7A 1KRPA 2CDQA 2XY7A 4LIWA 4MFBA 2AU0A 3ILLA 5LMUJ 3EGNA 2HG4A 4Z2XA 4O3RA 1TKZB 4CLKA 1IBMF 2A2CA 3W64A 5T14A 3HHLB 4ZVTB 3I87A 1X31C 2OUGA 1WF0A 2W2PP 2MMYA 3ZZZA 1HNXJ 2ZNZA 3OL6A 4NA1A 5D4LA 2J7UA 4PZVA 4X62F 3VAHA 2HS0A 3I9ZA 4CLZA 3UN3A 5KT6A 2DH8A 3LP0A 1P1TA 1NM2A 1CG2A 3MPDA 2XO7A 3ONQA 1PO6A 3D0GE 4D3GA 1S9GB 5DZ7A 1U1MA 4P75A 4PAAA 3KJNB 3ZNJ1 2QEXS 4K4VA 4RPFA 2ERRA 1TK5A 6FD1A 1FDNA 3JS9A 4JI5J 1PBUA 4FYWB 3M8PA 4CT9A 1X0PA 3JAMU 1MWYA 3HPOA 2FLNA 1M5SA 4P71A 5F3TA 3ULHA 2V9KA 4QW8A 2VG7A 4F36A 1XJWB 1XN9A 4OYOA 4FVMA 4Y6IA 4DSEA 4ED0A 4B9NA 3KJQB 2PMHA 5GAGU 2A6OA 5K5MA 1PJ6A 5F8HA 1YZ7A 2FGOA 2XMAA 4LJMA 2MQPA 1WI8A 2P2CB 5I42A 1TL1A 2RJZA 2CPXA 3MPVA 5GMKa 3CCWA 1PYOB 3MPUB 1TL1B 4O3PA 4DOZA 3QQCD 4DL0C 1RWOB 3ICLA 4A8WA 1X60A 4OZ5A 2DO0A 3MTJA 3ZTRA 1N8RT 4M8LA 2HHSA 2E29A 1RU2A 1SC1B 1W25A 5C25A 4U6PA 2R7TA 4OJGA 5C42A 4USUA 2F4VF 1FX2A 2C3OA 1RTHA 1NB2A 1RYRA 2PD1A 3DYAA 3IS9A 3TQ1A 2KZZA 1RTHB 2CYYA 3C16A 2RRAA 3RAXA 1TL4A 5LMNF 1WEYA 4DUZF 4YP3A 2ZBPA 4GMKA 5DJBA 2D9PA 2VFVA 4FS1A 2UUAJ 1K0VA 4B02A 4OHYA 2KT3A 2OPQA 3CSKA 2BM1A 3WC2A 3PR4A 2ZOGA 3OPKA 2FDNA 5ETMA 3V81B 5AXKA 2DBBA 4NZ0A 2AMCB 3MWBA 2KH9A 4OZNA 3LWLA 5JVHQ 4QIFA 4WE1A 1DZ5A 2CQIA 4PEOA 4TVAB 1RKIA 3D5MA 2PEBA 2R2UA 5B0DA 5GAHI 1BQMA 4O4RA 4DCOB 4IH7A 1YWXA 1IWGA 3RBXA 5M2PA 4DV4F 7AT1B 5KT5A 3I6PA 2R2TA 1Z2LA 4C9DA 2PFFB 3MM7A 4F4ZA 1ZAVA 2G2OA 4X65J 1RWUA 3BH7B 2KTQA 3BBCA 1R31A 3M2RA 2KFNA 2WW4A 1SVDA 3MEGB 3OTDA 2CPIA 4DSKA 4ECWA 3M9NB 3MM8B 1LWXA 3MR3A 3RJMB 1TK0A 3OL9A 4MIAA 1FI4A 3GQCA 1O5JA 2XMUA 1HNIA 3P96A 3JAMY 4Q44A 2IRXA 1RAHB 3Q8QB 4OI3A 3NP5A 4RKUC 4RW6B 2ZM6F 3PNIA 4DPTA 2M0GB 3EJMA 1XWLA 1VQMS 2IBOA 4R25A 1ZM9A 2ZOMA 4YB6A 2K3IA 1YJRA 1IBKF 2EKYA 4DN9A 4PQUA 4TYBA 1TKTA 3DGPB 2OPSA 2CNOB 5ETLA 4KHMA 3S01A 4K4YA 1TKTB 2GIRA 4JOUA 3JSYA 3H5YA 2HVIA 2PFDA 4DPOA 2CPEA 1DLOA 1J2VA 1UVJA 3SV3A 1BHNA 2DGVA 3A8KA 5D0RA 2ASJA 2KL8A 2QJ3A 2ZUAA 4NX9A 2DXFA 3UR3C 1M90T 2ZDPA 1SJ4P 3R6GB 2YQ3A 3T19A 1FJGF 2BE2B 3S8SA 2MKIA 4WXWA 2ZJPQ 4B3TJ 4FPIA 2H48B 1VQ6S 3AXMA 3IWXA 4RZRA 2UXDF 3P49B 3PIOQ 3ENWA 1U1NA 1H2UX 2R3VA 1VRUA 2CPYA 2XSJB 2YX7A 5GMEA 5KFYA 2BQUA 2GQCA 4NLPA 1H38A 1UEUA 4ERDA 5E3QA 4CP5A 1REGX 4KBIA 2I5JA 2P6TA 3R5CA 5D78A 4OHVA 3D6FB 2CQ3A 1DQ9A 1M1GA 1G7CB 2M70A 4NCGB 5ETQA 1FFGB 1HBMA 1U1RA 5ETKA 1HBMB 1S4FA 1QDUB 2WB1D 3ZTQA 4FNHA 5HJYA 2DGXA 1NK6A 2R7SA 7FDRA 4ZIWA 4LVNP 1IQZA 6FDRA 4C7QA 2CQPA 4WKRA 4WCEQ 1FDBA 2BX6A 2IAJB 2RDIA 3MAHA 2JOQA 2RHQB 3GE9A 1OJ4A 3N0VA 3POTA 1M0SA 4QIEA 3WIUA 5DDQC 1B0VA 1E6YB 1UJ4A 1VS3A 1F60B 1U7LA 2HKEA 2V8HA 1H2VZ 3LP1A 3R5AA 4U7UK 3CCLS 5K8NA 1L3KA 2LMIA 1RT7A 2YNFA 1U25A 2WVEA 3TVKA 4X4RA 2CXEA 2MKJA 3IMQJ 3SCIE 4NLOA 3K0JA 1JJ2R 1CJUA 1JLQA 2G13A 4I69A 3HFVA 2ZM6J 2H51B 1TQLA 2XZDB 5EGYA 2HVZA 5KFJA 1QSLA 5DRKA 2VIHA 2O66A 2XC9A 3H4DA 3SCJE 2VQFF 1SH3A 1Q16B 4FYYB 4FF2A 4ED8A 3VR1A 3M2VA 1RKJA 4I68A 2BYCA 3J80Y 4TQSA 5L1KA 1XERA 4C11B 5J2MA 3T41A 1S1UB 2C3UA 3P3DA 5J2MB 1L3SA 2ZBQA 1NK0A 2BXJA 1RHKB 1WEXA 2B7CB 3CJ3A 3QGPA 2DY9A 4HACB 1HIYA 4NLSA 4WIQA 4B9UA 1N0UA 1Y11A 4IKAA 2GHVC 4MK9A 3TRGA 3BGRB 4IH6A 4ZCIA 1HHSA 2C2NA 4FKXA 4LSNB 3TZYA 3BGRA 4AQYF 3GCXP 3UW1A 3MR6A 3CJ2A 2GNKA 1QUVA 4LRBA 1U1LA 2HBQB 3OHBA 1DTQA 5IV4A 1HR0J 4DR6J 2LA6A 2VZ9A 4M5KA 4URSA 2FHKA 2MQOA 2ROGA 2YKNA 1M5PC 4X4NA 5EHHA 4K8RA 1CJKA 3T1HF 5KOXA 1T05B 2DRBA 3FRZA 2NQPA 1VQYA 3WDOA 3ADAC 2RS8A 1VRTA 1RHJB 5J1PA 3DXSX 2IVFB 1VHIA 3NCQA 3OSNA 4QPXA 3CXCR 1P27B 1UFKA 2HFZA 2MEWA 4Y28C 4ICLA 3R7NB 3S7RA 2AD9A 1N4LA 4P7VA 1NO8A 4JI3F 2AEFA 2ASYA 4I7FA 3W5XA 4NMXA 4I7FB 2IYGA 4ZPTR 2G1HA 1DTTA 2YTCA 4NLUA 5J2NA 4PRFA 4RW9A 3LPYA 4DZ6A 1OSCA 1TV6B 1HYSA 3NBPB 4IQMA 3TUPA 4FS2A 2W2NP 2XULA 4N8OA 4ZIVA 3M8ZA 2PSZA 4M5NA 2XYPB 3BSAA 3QGHA 3NKYA 1N0VC 2FQQB 3CD5A 5DETA 4JI6J 4C8OA 1BQNA 2DPJA 3NY0A 5C42B 3G82B 2XS5A 4QWEA 4H4KA 3V4IA 2BQRA 1ZAWA 1WC3A 5K20B 1NPPA 2OI2A 2QN6B 2FB0A 2GV1A 4RWWA 3PV8A 1B99A 2MY8A 2K06A 3BV8A 4WFAQ 2F4VJ 1NHVA 4F2SA 2EC0A 2GIQA 2AWZA 2JEGA 2HNZA 4EBDA 1T05A 5AXNA 2CVEA 4WK3A 2MJNA 2HHVA 3AD8C 7FD1A 4LIRA 3GFZA 2DIVA 4DSLA 5C7PA 4IFYA 3EPGA 4L6V3 2YVSA 3J7Z5 2DGTA 4Q45A 3VAMA 2YNGB 3OBIA 3TWZA 1T94A 3UDVA 5AJ3F 4DL4A 1N56A 2VODA 3HJFA 2E1MC 1NK7A 4W90B 5CA5A 4ZVPB 2E5LJ 2DY1A 4YUDA 2FJAB 4RLEA 3PRDA 4H4MA 1RHMB 4A8KA 3AOBA 4G1IA 1LWCB 5F8IA 2CJBA 1RT5A 4WIIA 3AFGA 3QFHA 2O1PA 3VGVA 3VAJA 4ITSA 2N7CA 1EETA 1R0AA 3KK2A 2L3MA 4ZA1A 2GMLA 2ZE2B 5LM7E 2DKOB 3CJKB 3H40A 2Z30B 3BQ2A 5E3AA 4DR6F 4F4YA 2V9WA 4J9NA 2QMUB 3Q8SB 2VFUA 2XEXA 4RNNA 2OMLA 3GYNA 1S0MA 2FJDB 1R27B 2H1YA 4K5SA 4RUBA 4ZP7A 1WWHA 4DX6A 1HNZF 1KFSA 1S0VA 1FJ7A 2J76E 4DR5F 4L3NA 3DGVA 5CAAA 3SYZA 1RSCA 2BEFA 3HDSA 4L75A 1SQGA 2OPSB 3VTIA 4LRCA 3C6UB 4G1QB 4MKAA 2XHWA 4NRTA 3W62A 3OFHA 3FSXA 2FLOA 4WP9A 4JP8A 3OTOJ 1YIJS 2FJVA 4B3SJ 1UVLA 3I5AA 3N6NA 4ED6A 2JJ4D 4JB8B 2LDYA 1R7IA 1KR4A 2MLYA 4MYTA 2POKA 4Y3CA 5IT0A 2CRLA 2D1CA 1DHMA 3H42A 1CULB 5FD1A 3TX8A 2E9ZA 2B4OA 2Z2MA 3EICA 1G2EA 4CDIA 4L72B 5L1LA 1RA7A 2BE2A 4LVOP 5HVGA 1S10A 1T8EA 3CE8A 5G4DA 2NPIA 3KYLA 2C28A 4MKYA 2OTJS 5HAOA 2NZCA 1N5VA 3SIPB 2J0XA 2KXFA 2FVCA 1TVRB 2XSJA 5FIIA 4P74A 4WU2A 1K1QA 1RU1A 2Z4PA 1FJEB 4JI5F 4F0MA 3OFFA 3GIIA 1QVFR 4TU8A 2ZZTA 5KFQA 2UXDJ 3VF0B 4USJC 1KLMB 1LQ9A 2AIRB 4OLOA 1F9EB 5EUHA 4CI0B 3NGDA 3GV7B 3V6JA 2ZD1B 3O2IA 3KLHB 4DUZJ 1JXVA 2XZWA 1T95A 2MQNA 2FZCB 2DNZA 4JI4J 2HQDA 1X5PA 3ENVA 2XNQA 2L9NA 4ZPBA 2G0IA 1CLFA 3CTRA 1WKJA 4V19J 2A3JA 1ICEB 1RP5A 3CJQA 2UUCF 4JI1J 2BM0A 2DJWA 2E1PA 2ZBRA 3MFHA 1R8AA 1XNQJ 3LQVA 3I5BA 3JYTA 2WHOA 1RTIB 1Y7PA 3HVTA 1G3OA 3WBZA 2OMOA 1IR1A 3FC9A 4I6AA 4I4BA 1MWQA 2J7KA 1RT7B 1SQFA 5B0AA 4CLFA 3GIJA 4LMZA 5IT4A 2M9KA 5CYJA 1X5TA 2J9DA 3OXLA 4DR1J 3VVTA 4A8OA 2X3GA 3E3XA 3GFXA 1YJUA 2ZUGA 2YNIB 2YWEA 3CO0P 5D77A 3MUMP 5IT9U 2MQQA 5J1EA 1UVMA 2RQKA 1WSVA 2WBMA 4KPCA 2EBEA 3HSZA 4MIWA 1RHQB 1U26A 1ULRA 4RX6A 1D9AA 2WVCA 1HBOB 3Q83A 4C0BA 3CCUS 1RHRB 2D9OA 1H3DA 3CCQS 3NGSA 4DX7A 4F3QA 2E9RX 2CQGA 1WNEA 2KFYA 4C11A 2EFVA 3LA0A 3N01A 3NWGA 4WZMA 1S6QB 2KVIA 3B4DA 1WKKA 3MM9B 2AP6A 2AJ2A 2E7WA 1NRKA 5BR8J 2F63A 1LV5A 2OIHA 1UKUA 4DV4J 2W9AA 2RH3A 4LSNA 4OYZA 1R6YA 1VBKA 1FA0A 4ZVOB 3NNHA 2W2QP 1X7VA 4IG0A 2AHOB 4NLVA 2MYFA 2V8VA 1SCJB 3AH6A 3JSMB 3RRGA 1LW0A 5K8MA 2XYGB 4I2PB 1CEZA 3JTPA 2ASLA 3WHIA 2K7KA 2Q43A 2BA9A 1VRTB 3C6TA 2GO8A 2MZTA 3FVYA 4HDGA 4CNYA 2QSFA 4LBHA 2W4PA 2C2DA 5B7WA 1BWVA 2CQDA 3CCJS 3IO1A 5HANA 1X4BA 4Q2LA 1YI2S 3L95X 2NREA 2FZKB 2Q66A 1P9QC 3I4PA 2B4VA 4RBUA 4ZPWR 5LOQA 4DV3J 5ETOA 2FTRA 1TV6A 3WC0A 4ANCA 3K17A 3CCVS 2RT3A 4DCPB 2B6AB 3PW2A 2G9OA 3KXDA 2GGPB 4DL3A 2V50A 5L46A 4K5RA 3EX7B 3WX4A 2GGPA 5ETPA 2HMIB 4DG1B 2D3OR 2KXHA 3OJSA 5KFEA 3GSDA 1JLCA 2CA9A 4ED5A 3ZTOA 5E41A 4DV7F 1D0EA 5ETRA 2IC3A 4PWWA 1GTEA 3RR7A 4QBUA 3H4BA 2CQHA 3M6VA 4NLGA 2L41A 2V2QA 2N3LA 2EEYA 2KJVA 5E33A 3CCES 1WOSA 3I82A 1PIEA 4HVZA 4TU9A 4K2JA 1JLFB 1FX4A 3DFEA 4R8UA 1VQNS 1NCLA 1S7HA 3W60A 3PM9A 4I67A 3BKFA 2VG5B 3N9UC 3EVOA 1RAAB 2F8EX 3CJRA 5CZVA 5AE2A 4O0IA 2OGUA 1VBYA 3KG1A 4X4SA 4Q0BB 4EBCA 3RZAA 2BKNA 3GJRB 5IT9Y 5IZHA 1MW7A 2LFVA 4U7CA 2ZNYA 1Z4UA 2FHMA 2V0NA 3DDNA 4R5PA 3T5JA 3PW4A 3FK4A 4ELTA 4Y34A 5KTQA 3TA0A 3M9OB 1U1PA 3EYZA 4H4MB 4GKJF 3OTEA 1T9WA 2KHCA 4I0WA 3FZBA 1N34J 2ZH2A 3C8YA 3H2UB 3V6DA 3PKMA 4M63A 3WZ0A 2NYIA 2RF2A 4IO1A 4PKDB 3GMGA 4GKJJ 3CIZA 3HCXA 3KHHA 4P2MA 2MDAA 1UJ5A 3ZC4A 1FWKA 3OUYA 1X0FA 1Q8KA 1HNVB 3TEGA 1PILA 3CW2C 1FTRA 4C3LA 2YY3A 4PR6A 3OL7A 2XCAA 1VQ5S 1RT2B 2R8HA 1FKOA 4FBUA 1PCAA 4YR0A 2B5JB 3J7YI 2DHAA 2W4CA 4F4KA 3BQ1A 2YX4A 2D3ZA 4KHPF 1U0SA 2ZH9A 2J9CA 2PA3A 3MECB 2RNEA 1SIWB 3ZZOA 3G87A 1S49A 1NZ8A 1X4GA 3AY0A 3LAKA 3QNWB 4KGXB 1R89A 3I0SB 4NASA 5KG4A 2Y3YA 1TMJA 4FNIA 4UZCA 1N88A 4E2FB 4C48A 5LJ5Y 1SKRA 4KHPJ 3N6MA 4DR5J 3GONA 3MGJA 2PI4A 1ITPA 4AXIA 4P2XA 2U2FA 1VLOA 2ADCA 1ZYQA 2W4DA 1HHTP 1JWWA 2CDRB 4HEA9 2CPHA 4CLUA 5IXUA 4RJVA 3GG0A 3GSIA 4JI6F 3CC7S 2ILYA 3TAPA 3ZZTA 2JC0A 2RE1A 4CH7A 1AYEA 1Y5NB 3V4MA 4X2BA 3BDEA 3ZNUA 4K50A 3IGVA 2B4UA 4J9RA 3FJ2A 4HH1A 4NRUA 1U47A 1VBZA 3RBDA 4RW8B 1JKHA 4PXDA 1X4EA 1H74A 1YQHA 4RUAA 1XMQF 2E66A 4UY85 2HFSA 1ZZNA 2UVUA 4EFAC 4NA3A 4KTQA 2C2RA 2N4CA 2DR8A 1YX2A 3KDNA 1U1OA 2QA4G 3MPYA 3BO2A 2YPZA 2ZITA 2CJ9A 2DHSA 2W25A 1VFJA 3J7A1 1A0OB 1XMBA
chains in the Genus database with same CATH topology
1TKXA 3MEDB 4G1PA 4DQSA 2C3MA 3V81A 1VI7A 2HFOA 5LXYA 5L9XA 2D41A 1J5EF 1N36F 4UW2A 3DI6A 1UVKA 1RQ0A 3CDEA 1H7XA 3M1VA 2OSRA 3NAHA 4YEAA 3ZZTA 3KLFA 1QY7A 2JLGA 3TARA 2HHVA 3TYTA 3F44A 2E1CA 3I9V9 3M8SA 4DQIA 4JI4F 1IN0A 2CIMA 4IFVA 3M4XA 2R9LA 4ECRA 4YQWA 4PG6A 5GAHU 4XPCA 4PUOA 1MNEA 1K0TA 1FRKA 1DQ8A 3Q8RB 2ZH6A 1L5UA 2XB2D 5J2PB 2XG8A 1NKBA 2UVWA 3PJWA 4NWBA 2V4QA 2DPIA 1KQGB 2ZBIA 2WOMA 4AL6A 4EUVA 4LF5F 5L9NA 2IM3A 2N3OA 4CO1A 4UY8T 3SQGA 3BGUA 2BJEA 1N33F 1WI6A 2V5HG 2QFJA 4IDKA 3KHRA 2ALZA 3X1LB 1RTDA 2QMWA 2JVOA 4OX7A 4B9MA 2MZRA 2F8MA 3T5LA 1NB7A 3D0IE 1S1WB 1LWEA 3QIPB 1JK9B 4C2MA 5AXLA 3MMAA 3BSOA 4E0DA 2P9CA 1T03B 2HPUA 2OO4A 4F3MA 3QZ7A 2MSSA 4HT5A 1S0NA 2LEBA 1FKAF 3GR0A 2V4JB 2XI2A 3MM6B 4HI1A 1YJNS 3BR8A 1PGZA 3K5LA 3DLLQ 3TOQA 1XR7A 5IM0A 5DM6Q 5T7LB 4F4WA 1U6FA 3K2YA 2CPJA 3SFUA 3TP2A 5C24B 3CCMS 5L1IA 3QWUA 2EFQA 4KV8A 5DLGA 2ZH3A 4IR9A 3D0HE 1HPZA 3DOKA 2DNQA 2EPIA 3HX9A 2HRUA 3OLAA 2WBRA 4HTIA 3K8VA 2MHEA 4AE5A 4QR0A 1JNRB 1RT4B 2E5GA 4ZP8A 3BN4A 3CF5Q 1LXJA 1QAYA 4HHJA 2FVQA 3EGWB 4MK8A 5HMYA 1W2IA 1LWFA 4EO6A 2KT2A 4WKYA 2HNYA 1FEEA 2IRYA 1IJFB 4XPEA 4MTPA 1YTYA 5E3CA 3HI9A 4A47A 2O01C 5D6GA 4KIAA 5AE3A 4ED3A 3DRPA 4FF1A 1S9GA 2DHGA 3BR9A 3MF5A 3C66A 5KFIA 1YRXA 3MR5A 1KQFB 1JLAA 5LXRA 2ZKTA 2OKQA 3VALA 4ES3A 4JI8F 2JX2A 2R7WA 3K7RA 3J7YU 1VQ9S 4KO0A 4TY9A 1F5BA 4LF8F 5CH7B 2HGMA 1L3UA 4I56A 2W7OA 1WD6A 3MCSA 4DL6A 2E5LF 4IQXA 2VQEF 3AB2B 2CZVC 2DITA 4PPZA 4RNOA 1J5OB 4N41A 1AUDA 1BGXT 4QR1A 4DBQA 4OL8A 2LU2A 1UAWA 3R3TA 1GXLA 4LFBF 4DX8H 4EU0A 5LL6d 3EXYA 5F41A 4B3OB 1QTMA 3IS9B 3MI7X 5DQHA 1QLNA 1V3ZA 1NJIT 2EVZA 3EZ5A 4Y2AA 4YOEA 2RB7A 2X1AA 4LQ3A 3V6HA 1Y4ZB 4ZHRB 1KS2A 3ISZA 3HHDA 4CO3A 2VG6A 1H2TZ 3GYXB 2UV8A 1XTZA 1IXKA 3CWJA 4I1TA 3PX0A 3NS6A 3FCHA 4C8KA 4B3SF 4DV3F 1IKYB 1TL5A 3QGIA 3EPIA 1M5KC 5C25B 2KJWA 1ZETA 3MPWA 2U1AA 2X1BA 3CJ4A 5F8MA 4C8YA 2VKRA 1SH0A 3FQKA 3L7PA 4TU7A 5I4MA 4XDCA 5D4NA 3MM7B 1VQOS 5F8GA 4YB1P 1XNRF 1YSJA 2L08A 2JWNA 5HO4A 4DV2F 1S77D 3BF4A 2VL1A 3ZZUA 2EK1A 2H5EA 4ECUA 3HMJG 5A0Y