4WXOA

Sadc (300-487) from pseudomonas aeruginosa pao1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
182
structure length
182
Chain Sequence
RYALQAHQDTLRGMMRQLEDLVATDELTGLFNRRHFMRMASRALEDLLPNRQHGLALIDLDHFKRINDRHGHAAGDRVLQTFAAVARSCLRDGDVLARYGGEEFVLLLPHADAEQLESCCERLRLAFQQAEPVGVTVDTLSLSVGMTLLYADDDLDEALQRADQALYRAKRGGRNRCDATWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Uncharacterized protein
publication title Crystal structure of SadC (300-487) from Pseudomonas aeruginosa PAO1
rcsb
source organism Pseudomonas aeruginosa pao1
total genus 53
structure length 182
sequence length 182
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wxoA00
1S9GA 3NGDA 2FLLA 1FKOA 4WFYA 5I3UB 3HVTB 4LQ9A 2RF2A 3QGHA 4IOBA 4WXOA 5F9NA 4IDKA 5F9LA 1JKHB 1DTQA 5HP1A 2BE2B 3I5CA 2R8KA 4PWDB 3GIMA 2IBKA 2WONB 4K4UA 4HKQA 3MTKA 5JUMA 4K4YA 1S1XB 2GIQA 3HHKA 5J1EA 1LW2A 1LWEB 4NLQA 4IQXA 4ZP9A 4KB7A 3T1AA 3I0SB 2W7PA 5DG9A 3BSNA 2C28A 1FK9B 3FQKA 1JLBA 4PWDA 4NRTA 4FS2A 1BQMB 4TYBA 3FDSA 5EDWA 4JUZA 3G86A 4MKAA 1QUVA 1S1XA 1VRUB 4LSLB 1RT1B 4Q0BB 5KFNA 2WHOA 3BGRB 4MFBB 3ITHA 1K1QA 3G6YA 1N56A 3KHRA 1FK9A 4G1QB 4K4VA 2JLEA 2JEJA 3OSNA 1RA6A 1NNDA 4I7FA 3RB6A 1VRTB 1S48A 4LSLA 4R8UB 1T05B 3MEGA 1DLOB 5HROB 4H4MA 2FVQA 2IMWP 3GIIA 3BGRA 3NBPA 4RUAA 4GC6A 4G1QA 4NLTA 3DM2A 1S6PA 2V4QA 2WB4A 5DLGA 4B3OA 3DRSA 5KFDA 1QE1B 5KFIA 1S10A 1MU2A 3KHLA 5KG1A 1N5YB 3IG1A 4DEZA 1I6JA 2B6AB 3MR6A 4ZHRB 4O3OA 1GX5A 1HQUB 5KFVA 5KFJA 3FQLA 2ALZA 4J9SA 3LP2B 4ZPDA 4DL7A 2V0NA 1QE1A 3E01B 3MR5A 4ECTA 4EBDA 3RBEA 1HNIA 4ECRA 3V4IA 4LQ3A 4NZ0A 5JXSA 4H54A 5KFUA 4ECQA 3KNAA 4RW4B 5J2MA 1RT6B 2W9CA 1N5YA 2B6AA 5KT7A 4KV8A 3UQSA 4WYLA 2R2SA 4K4ZA 4O3NA 4RW7B 4QWAA 3LP2A 1BQNB 3KK1A 1ZETA 3I0RB 2O5DA 1FKPB 2ZD1A 1LWCB 3CVKA 3RAXA 4J9MA 4RW4A 1RA7A 4KO0B 1NHVA 3H98A 2WTFA 5KFAA 2WOMB 5C25A 1RTJA 4J9RA 4M94A 5L1JA 4DL2A 1J5OB 4MKBA 5FDLA 5CYQB 5HLFB 2C2EA 3V6JA 1TKZB 1BQNA 2FJVA 3I0RA 1IM4A 4O4GB 4JV2A 2WRMA 5KFOA 5F8IA 2W9BB 1LWCA 5L1KA 4IG0B 1SH2A 4URQU 5KFBA 2FVSA 2V9WA 4KO0A 3PW5A 1WNEA 1TV6B 3CWJA 3RB3A 2ZE2B 3SFUA 5I42B 2XGPA 5HLFA 3C6TA 3KLHA 4DL5A 5KFYA 3G6XA 3LAKA 2AX0A 1RYSA 1TQLA 4GC7A 1T03B 2HAIA 3QIDA 3OHAA 1RAJA 3MECB 3PR4A 4RUCA 3KLEA 2UUTA 4NLUA 4R0EA 3V6DB 5CYMB 2J6UA 2IM2A 4ZPCA 3LP0B 5KFHA 5I42A 5C5JA 2HNZA 1C0TB 3SFGA 3IS9B 2FVRA 2JC0A 3MFIA 4JV1A 4G3IA 3QGIA 2BR0A 4PUOB 2CKWA 4NLOA 4ZVHA 4KHRA 1EETA 2YKNB 2YNIA 3V6DA 1TKTA 5KFEA 3GV8B 1C2PA 4ZVEA 1S1UB 2IM0A 4ECXA 2D3UA 1RT7A 4YMEA 4MK7A 2UVUA 1S9GB 4WE1A 4DL6A 1FKOB 4TY8B 5DQIA 3IS9A 4EYIB 2RF2B 1TKXA 3DYAA 4PUOA 4Y2AA 4IDKB 5HP1B 1DTQB 5J2PA 1S1TA 5KFKA 1K1SA 4ZP8A 3QZ8A 3V6HA 5EWFA 2XWYA 5KT5A 4IRKA 1LW2B 4R5PB 2OPRA 1S1UA 1Z4UA 2W7OA 3M9NB 3E51A 3HKWA 3IRXA 1EP4B 5EWEA 1QAIA 2J6TA 1RT3A 2BANA 4RU9A 4IR9A 4IFVA 4TY8A 4NLVA 5J2NB 4U7CA 3GV5B 3CJ5A 3OL6A 4EEYA 4DG1A 1RYRA 4O3RA 3GV7B 1JLBB 5KG0A 3QLHB 4TQSA 3DOLA 3Q8RB 3KK3A 4KFBA 3KMSA 3OL7A 2RKIB 1RTHA 1SUQB 4R5PA 3SI8A 1TVRA 4IFYA 5K14B 1EP4A 1TL1A 1RTIA 1JLFA 3ITHB 5J2NA 1N4LA 5F8NA 3MF5A 2IM3A 3QLHA 3JYTB 5L1LA 3DLKA 1S9EA 4IG3B 2AGPA 2RKIA 4I7FB 1SUQA 2VG5A 4MIAA 2HNYB 2IM1A 2OPQA 2VG7B 3MEGB 2FVCA 4H4MB 5KFQA 4YR3A 4QWCA 5K14A 3OLBA 3NBPB 4DL3A 4KAIA 2FJXA 2FLPA 1XR5A 3PW4A 2QE5A 2RDIA 1YVFA 2I5JB 1S6PB 3DM2B 3NKYA 2B43A 2ASDA 2YNGA 4EO8A 3DI6A 3JYTA 3ISNC 4IG3A 4XPCA 1HMVB 4B3OB 1QAJA 5F8GA 3DRSB 2FLNA 3Q8SB 2HNYA 3UPFA 1RT5B 2VG7A 5DGBA 4NLPA 3OLAA 4ED2A 2HMIB 1JIHA 2HNDA 5C42A 4K50A 1MU2B 1UWBA 3PZPA 4YQWA 3KLFB 5KG5A 3IG1B 3G6VA 2I5JA 4ED3A 3KLIA 3LALA 3QO9B 5KG6A 1HYSB 3N6LA 1T94A 1HMVA 3H40A 2C22A 5KT3A 4J9PA 3CJ2A 4MIBA 1HNIB 4WXWA 1RT5A 4NYZA 4MH8A 5KG2A 4F4XA 3V4IB 4RNHA 2HMIA 3H5SA 5J2MB 3KLFA 2W9CB 4ZMMA 1IKXA 3KK2A 4KV8B 2VA3A 3QO9A 1HYSA 4NLGA 3H5YA 4RZRA 2OPPA 1JX4A 3KK1B 3RBDA 4U6PA 4ID5B 3KHHA 4K4SA 4TXSA 5KFWA 4ICLB 3CO9A 2ZD1B 1NHUA 3T5KA 4KHMA 2C2DA 1XR7A 1GX6A 3IGVA 5C25B 1RTJB 3LANA 5FDLB 3BJYA 4J9KA 4J9NA 2D7SA 1IKVB 1T3NA 1LW0A 3EPIA 1KHWA 4ID5A 3CDEA 4NLYA 5HBMA 4I2QA 2UVVA 4ICLA 1JLAB 2YNFB 4NLXA 4QW9A 2JEFA 5KFZA 1S6QB 5EUHA 3PJXA 3QZ7A 5DG7A 2AWZA 2FVPA 1JLGA 4TLRA 2WCXA 3C6TB 3KLHB 1IKVA 4RW8B 3GYNA 4LSNB 2JC1A 4NLSA 4YR0A 4EBCA 1JLAA 5DG8A 2YNFA 2DPJA 2IA6A 2RDJA 1S6QA 4RW6A 3KLEB 2R8HA 2XC9A 2V4RA 4QW8A 4FBTA 2R8JA 5KFTA 4Y2CA 4K4TA 1S0NA 2XCPA 1C1CA 1TL3A 3OL8A 4RW8A 2HNZB 3BQ1A 3PJWA 4LSNA 5KFXA 1LWFA 3MEDA 4XPEA 4HYKA 4K4XA 3EPGA 3H5XA 3CIZA 1EETB 3D28A 5KFGA 1S0MA 2YNIB 3DLGB 1TKTB 3MEEB 1JLCA 3MR3A 3RB0A 1S9FA 1IKYA 3BREA 3DRPA 2IC3A 3FFIA 1RT7B 2R2TA 1R0AA 5C24B 4WZMA 4WE1B 3KLGB 5DGAA 3GQCA 1D1UA 4YR2A 2C2RA 1TKXB 3DYAB 3QYYA 2BQUA 5KFLA 1IKWA 1KLMA 5J2PB 1S1TB 4ZP7A 4K4WA 3PVXA 1RTDB 5DQGA 3BQ0A 3DLGA 3ISND 3MEEA 2OPRB 2E9ZA 3GILA 1S1VA 3IRXB 5C24A 1RT3B 2BANB 3KLGA 4IFVB 4O4RA 4J9QA 2J6SA 4DG1B 2AGOA 3PR5B 3KK3B 3TAMB 3DOLB 4YP3A 4KFBB 3FSIA 4ZVFA 2I1RA 2AU0A 1RTDA 1RTHB 2D3ZA 1DTTB 2IAJA 4O3PA 4IH7A 2XGQA 2ASJA 2OH2A 1TVRB 3KOAA 4IFYB 1TL1B 3QIPA 4IRDA 3KJVB 3DMJA 1RTIB 1C0UA 1JLFB 3I5BA 1S49A 3DOKB 4F50A 2VG6B 5L9XA 5L1IA 1S97A 2UUWA 3TAMA 3DLKB 5D3GA 1S9EB 1HNVB 3Q8PB 5J2QA 2E9RX 4URGA 2HWIA 2VG5B 3CDUA 1DTTA 3D5MA 3OHBA 3CJ0A 2OPQB 3FRZA 1S1WA 4I2PB 3H4DA 3KJVA 1RDRA 3DOKA 2VG6A 3M8PA 4IH5A 3UR0A 2YNGB 4Y34A 3DI6B 3HVAA 4IRCA 3VQSA 1JXLA 1HNVA 5F8MA 5KFSA 3H5UA 3M9MB 4KKOB 4ED6A 2HNDB 4I2PA 1ZTTA 5C42B 2ASLA 5KT4A 1UWBB 1JLQB 4NLWA 1OS5A 2FJWA 4KBIA 3KLIB 4Q8FA 3NMAA 3LP1A 4O44A 4Q43A 3KMQA 3IN5A 5KFPA 4WZQA 2YNHB 4EO6A 5KG3A 3MR2A 2AQ4A 4O3QA 4M95A 5I3UA 4KKOA 3BSOA 3HVTA 3Q8QB 2ZKUA 3H59A 3M8QB 1JLQA 4WFXA 1JKHA 2BE2A 4QWEA 1IKXB 2XI3A 3NAHA 2WONA 3KK2B 4ED1A 3RAQA 1S4FA 4IH6A 3EZUA 5DLFA 2HWHA 2OPPB 1LWEA 1N6QB 3I0SA 1SV5B 4NCGB 4NLRA 3TVKA 2YNHA 1HPZB 2IJNA 4ECUA 4KE5A 4ZPBA 1RT2B 2BQ3A 5KFRA 3NL0A 3M8QA 5KG4A 1BQMA 1SH3A 4JV0A 3QGGA 4F4WA 4ED0A 2JEGA 3M9OB 1VRUA 4ECYA 4MK9A 1RT1A 1N6QA 4Q0BA 1LW0B 1TP7A 1SV5A 4NCGA 3OL9A 4MFBA 5HBMB 5T14A 2ILZA 4Q45A 4I2QB 1HPZA 2UVWA 2W9AA 4ECZA 3PW7A 4ECVA 1RT2A 2B5JB 3N6NA 5EWGA 4WFZA 1REVB 1JLGB 1VRTA 3UDLA 4R8UA 4TQRA 1T05A 4X2BA 1DLOA 4ZP6A 2YKMB 5HROA 3CDWA 2JEIA 2AX1A 4ED7A 2R2RA 4OL8A 2R8GA 1ZTWA 2VA2A 4F4ZA 4PQUB 2B5JA 4RW6B 4QPXA 4RNOA 4EBEA 4QWBA 3TQ1A 4URSA 4ZPAA 1REVA 1C1CB 3DRRB 5KFFA 1TL3B 5KT6A 2YKMA 2XI2A 4J9OA 1LWFB 4IR1A 3MEDB 4TN2A 1N48A 3H2LA 4Y3CA 3BSCA 3OSPA 4ZHRA 5F8HA 4EYHB 4PQUA 1HQUA 2EC0A 5KFMA 3H4BA 1JLCB 3GIKA 3CJ4A 3E01A 1IKYB 1R0AB 3DRPB 2IC3B 3DRRA 3FFIB 3IGNA 4TY9A 2BRLA 5KG7A 2D41A 3BQ2A 1JLEB 2F8EX 1C1BB 4NRUA 3HVWA 1RT6A 3T19A 4O3SA 3BSAA 2WK4A 1KLMB 1IKWB 3N6MA 2IJFA 2R2UA 3NAIA 3I5AA 4RW7A 3KHGA 4QWDA 2W8KA 2UVRA 1FKPA 1S1VB 3KLVA 2CJQA 3JSMB 3LAMA 2XCAA 2OPSB 3DLEB 1JLEA 1C1BA 4F4YA 1D0EA 2WOMA 4DL4A 1J5OA 4WYWA 3BR9A 4H4OB 5CYQA 1U09A 1TKZA 5F8JA 2IAJB 1W25A 4O4GA 2W9BA 3QIPB 3JSMA 4RNMA 3DMJB 2OPSA 1C0UB 4IG0A 3C6UB 3DLEA 2AGQA 1MMLA 2QV6A 4KSEB 4ZVGA 1TV6A 4ECSA 3RB4A 4IKAA 4XO0A 1RT4B 5D3GB 1HARA 2BRKA 2ZE2A 3ICLA 4H4OA 4MK8A 2R8IA 5J2QB 4Q44A 3MFHA 3PW2A 1KHVA 1S1WB 4RNFA 1T03A 5KFCA 3T5HA 3T5JA 1HQEB 3C6UA 3V6KA 3M8PB 1S0OA 3MECA 3T5LA 4FBUA 5CYMA 3GIJA 1RT4A 4FS1A 5F8LA 3PW0A 2E9TA 3LP0A 4RW9B 4RNNA 3V81B 5KT2A 5DQHA 1C0TA 2GC8A 3CJ3A 4NLDA 2ILYA 4ED8A 1CSJA 1HQEA 4J9LA 4Q8EA 1SH0A 4ECWA 4TYAA 2DPIA 3PHEA 2ATLA 2BQRA 2YKNA 2GIRA 3DDKA 3LP1B 4O44B 5J1EB 4RW9A 2W8LA 1XR6A 3V81A
chains in the Genus database with same CATH superfamily
3N9UC 1VQNS 3W2WB 2GIQA 4NLQA 1H38A 4KB7A 3T1AA 5ETPA 4HACA 1U0SA 2RHQB 1XK8A 4LSLB 1CG2A 1RWVB 1WELA 4FVCA 4JOUA 3J81j 2YQ3A 2LEBA 2HW3A 5AE1A 2GS8A 3GIIA 4OJGA 2IYGA 5KTQA 2V2KA 4G1QA 4X4TA 4ZVTB 4A8SA 4E8UA 2CJKA 1OPZA 4L6V3 3CCQS 1WG5A 2RSQA 3SBMA 1PJ5A 4ECQA 2ZH4A 1RT6B 2A1BA 3PIPQ 2B6AA 4G1PA 3BBCA 3THPA 1N36J 3OFHA 1FKPB 4CRJA 5G4DA 5ITHA 4BWMA 1J5OB 1DQ8A 4HVZA 4CLUA 1NB2A 2O3DA 2KB2A 5L1KA 4URQU 2NREA 2L48A 5H9FJ 1KLNA 4LFBF 3OR1B 2NXCA 3FVYA 1U2CA 4K8RA 1ROFA 1NDCA 2M2BA 3NNAA 3UD4P 3MCNA 5CYMB 1C0TB 2RU3A 1XEZA 3QGIA 4JI1F 1YRUA 4FYYB 2YWEA 1TKTA 3GG1A 4YMEA 2LP4A 2AYMA 4QIVA 2UXDF 4LJMA 4IDKB 3TX0A 1NDLA 5KT5A 4B3RJ 1EP4B 1GFWB 5J2NB 2JL9A 2QA1A 3OUYA 4X4PA 2BJ7A 2RKIB 2ZH5A 3AJ2A 2XZDB 2J9DA 1R8PA 2AJ0A 3OBIA 1SUQA 2VG5A 2M3DA 4YFUA 2HNYB 1XR5A 1UFKA 4CIOA 1EZZB 1S6PB 2WAQD 3DI6A 5F8GA 1SL2A 2WBMA 4ED2A 3UDEA 3PZPA 3G4SS 2KVIA 1E6YA 2I5JA 1NJWA 4C7QA 5KT3A 2CQ1A 4F3MA 2HVDA 1NUEA 2QYCA 3RBDA 1FVSA 2HS3A 4LR9A 5A8KA 4QJVA 4WP8A 1PJ6A 3KHHA 2RNEA 5KAKA 4YB5A 1GX6A 2EEYA 2WVBA 2DISA 5AJ3F 5FDLB 1E6VB 4J9KA 1WHXA 5EGYA 3LWLA 1KHWA 2DO4A 4NE9C 4QU6A 1TL4A 4IUFA 3M2UB 1C4CA 1VC0A 4NLSA 1Q86T 2CPYA 2MKKA 1S6QA 4DU7A 2ZJRQ 1TL3A 4LFBJ 4EGLA 4W98A 1VBXA 3PIOQ 2KM8C 2RJZA 4ELVA 2EG2A 1FE4A 4DV6F 4JI1J 1OY8A 2VJUA 1S1TB 4ZP7A 2OPRB 1S1VA 3UCUP 5C24A 4UW2A 2VL1A 1RT3B 2UXDJ 3SCLE 4ZVFA 2CJ9A 1RTHB 1FJCA 1VQ9S 4IFYB 3D66A 3W9IA 1C0UA 1JLFB 2VG6B 1RSCA 5D3GA 1NPRA 1V3RA 1DTTA 3QT5A 3QJLA 1OO0B 4OX9F 5IZHA 3UR0A 3S7RA 2M4MA 1K8AT 2L3MA 2B8QA 5GAHU 1N88A 2DITA 1FRHA 1ZAWA 5IQQA 1UWBB 2DIVA 4KBIA 3NG8A 3LP1A 2YX1A 2Q3PA 3JXOA 1JJHA 2W2QP 5FIIA 2HHUA 4J9UE 5E33A 3DKDA 3RAQA 4IH6A 3AOCA 2IRUA 2AD9A 1PGZA 4E98A 2AT1B 3CF5Q 4DPYA 1B7YB 2FJAB 3RJMB 3ZZPA 1YJWS 4JI2J 4NCGA 2W9AA 1MMDA 4F4KA 3S01A 2Q1LA 4X2BA 3CDWA 3HFKA 4QPXA 2N7CA 1BQXA 4JI3F 1REVA 1FDAA 3KDOA 4IR1A 1AUSL 3RRGA 2F40A 1X31C 1D09B 1VHIA 3VWSA 2V8PA 4K2JA 3I5AA 4BBYA 3M32B 3CXCR 4DL4A 4OHYA 3BR9A 4DV6J 3FJ2A 2PC6A 2W9BA 3DLEA 2NPFA 2BE9B 4G6VB 2R8IA 4OYAA 2MY8A 4B9SA 1KHVA 4J90A 3MPYA 1TUVA 1CJUB 4WU3A 3R5AA 4GO5X 1CSJA 1HQEA 3EGZA 2LXUA 3G96A 4OX9J 2KXHA 4AL5A 1XR6A 2QT7A 3MMJA 3SCKE 2R8KA 1JKHB 4X4NA 3GIMA 3TYTA 3PRVA 4ZP9A 1YX2A 2C28A 1R8CA 4FS2A 1B70B 3TEGA 1QUVA 3DCAA 5KFNA 4O23A 3BGRB 5FJ4A 1U6FA 2UV8A 2W1BA 4K4VA 4C6AA 2ZOMA 3D1HA 4I7FA 3RB6A 1PC4A 2IMWP 3MEGA 4GC6A 2HG4A 1YZ7A 4ES2A 1RBAA 1LOUA 3HVRA 2IY5B 4CYUB 2Y1LB 5I4MA 3MR5A 4JI3J 4EBDA 5LMUF 2RH3A 4X4QA 4AD6A 1RHUB 1BQNB 2KZZA 2ZHOA 2FHJA 3PFOA 4IQMA 4J9MA 4DR7F 3VGUA 4UZBA 3R5DA 5KFAA 3I0RA 4LF1A 1LWCA 4C48A 2EI5A 3TOQA 2YKOA 3C6TA 4CLYA 3G6XA 1N34J 2K8GA 2VU5A 3PR4A 1UFWA 1YJ9S 5BYQA 1K44A 3U7JA 2HNZA 4F3OA 4JV1A 2CKWA 2YKNB 5K8PA 4ECXA 5LXYA 4WE1A 2V68A 2CPXA 2FGCA 2MKCA 2H65B 3EDQB 4Y2AA 4B3SF 2AZ3A 5J2PA 5CABA 5EWFA 1ZM2A 5E0OA 2ZVIA 1FT8A 1QAIA 2NCKL 1UVMA 3R3TA 5GAEU 2CQGA 2V94A 4RUBA 2NQPA 2YQ0A 2G13A 2A2CA 1KC8T 1BMQB 2ZJQQ 3LTOA 3ITHB 1T95A 1ZYQA 4RPFA 1S7IA 3QQCD 3MF5A 4AL7A 5L1LA 3TNVA 3RZAA 3BV8A 4AYBD 4DQIA 2QE5A 2B43A 1VJQA 3FKBA 2FY8A 1OIAA 3EXYA 5KG6A 4MYUA 2MZJA 3MM6A 3PJ9A 1Q8BA 4OYIA 5D0HA 2VV5A 1JX4A 1WEXA 5IT4A 3NOCA 2ZD1B 5LMUJ 5ETOA 1XR7A 5C25B 3BJYA 1S79A 2YNFB 2E7WA 3RGIA 3D54A 4DR7J 2CIMA 1RWUA 5DM7Q 3HT3A 4KH1B 2DNQA 2QA2A 3EGNA 4PKDB 1BGXT 2LA4A 2KXNB 4DSLA 1HBNA 3HPOA 5KFGA 2CJYB 3RR7A 1R0AA 2QZ8A 4X64F 4LBHA 2GCFA 1QSYA 1RTDB 4ZK7M 2AF6A 2B4UA 2JOQA 3K8WA 2F4VF 3H20A 3B54A 4NI2B 2QYGA 4ILMA 4B3SJ 4KFBB 1FEHA 2CNKB 4PXDA 2ASJA 2OH2A 4OI6A 2AJ4A 3DOKB 2VHGA 2XEXA 4CDIA 3C2PA 2Y8WA 3MD3A 1CS4A 3CDUA 4C8LA 1VQ6S 2YNGB 5L38A 3HVAA 3M9MB 3I9ZA 3QT8A 4DF8A 2OD4A 3NMAA 1VI7A 2A0FB 1FKAF 1X4FA 2YNHB 4O3QA 2J76E 3KG0A 5LSOA 1RZMA 2YKPA 3CJKB 4AE5A 2F9DA 2MPUA 2EFVA 1HPZB 2BJDA 3NY0A 4MK9A 3VCDA 2Z8QA 3KG1A 3B8HA 3CEDA 3PW7A 1FVQA 4A8KA 2G0IA 1PJ7A 2CYYA 1LKZA 4HLBA 3C3LA 2KT5A 4UZCA 4QWBA 3FZ2A 2VJVA 1X9SA 2YKMA 2ZBRA 1LWFB 3KNGA 4ZHRA 4EYHB 1HQUA 3GJRB 1TL7A 3DRRA 3IGNA 4MKVA 1M1HA 2XHWA 1YI2S 1EARA 1IKWB 2OGUA 4WKRA 4TKTA 3I32A 2XCAA 2DXDA 4K7QA 3IM8A 4WYWA 3IXQA 4H4OB 2KL8A 2QMUB 2R7RA 4U95A 2OPSA 2AYGA 4ID8A 3C6UB 2HZCA 2V8HA 4ECSA 1QJHA 1S1WB 4RNFA 1NSQA 1HQ2A 4H4KA 4ED8A 2M9KA 4RKUC 5CHCB 5A8WA 2FLLA 3BDEA 4J5OA 1U1NA 3K59A 1KR4A 1X0FA 3AT1B 3HHKA 3D6FB 1RAEB 4DSJA 1RLCL 2XSJA 9ATCB 2VOOA 1N33F 1V3ZA 2LEPA 4P73A 4Q0BB 3O5TB 4ENOA 2C2KB 2JLEA 3CD5A 3MM5A 3CJ8A 2KVQE 5HMXA 2ZUAA 3SQGB 1JK9B 2HKEA 2V69A 3FMBA 2V63A 3HFZB 1GX5A 2W4PA 4ZPDA 3M6VA 1O6XA 4NZ0A 4WKYA 2QLJB 2R2SA 4K4ZA 1HD1A 4ED4A 2HHVA 4AT1B 1VYAA 3H98A 2WOMB 5CCLA 1RUSA 2FJVA 4NZ6A 4DPUA 3HO1A 2NXUA 2ZNYA 3L4BC 1UP1A 4KO0A 5AT1B 2XGPA 3V6DB 2J8SA 2C42A 4W92B 1F5CA 1YJRA 4ANEA 5KFEA 1RWOB 1EKRA 3SSQA 1Y00A 5HP1B 1DTQB 2WVDA 6AT1B 4F2SA 3E51A 3PY8A 4DG1A 4DL0C 1RISA 2W01A 2GIFA 1HHSA 1KVJA 4B9UA 1F2HA 4DR6F 4IG3B 1WTFA 4QIEA 4MIAA 2A6MA 1ZZFA 3HHEA 5HANA 3NBPB 1YVFA 3UR3C 1MROB 4X4RA 4XPCA 1Y3KA 1RT5B 4ED3A 3MM9A 3HHLC 4BDPA 4ETXA 2AZ1A 5KG2A 3ZZTA 2IPOB 3KLFA 3VHQA 1GK8A 3L09A 3QO9A 4KV8B 4P6QA 2L41A 5IWAJ 2DHGA 5KFWA 4UQGA 5EX3A 4ICLB 4L75A 3J7YI 3VAJA 4DZDA 2XMTA 3OR2A 1LW0A 1SC6A 1XJWB 2WCXA 2Y1IA 2Y1RI 4DR4F 4WFNQ 2I0XA 5A0YA 2RDJA 1WHYA 1HI0P 2B56A 5IV4A 3M8SA 1FTRA 5CD4H 4WFBQ 2YNIB 1JLCA 3FFIA 3DYAB 1HWIA 3NLCA 3BQ0A 3DXSX 1BC6A 4DV5F 3TAMB 4KGVB 3AXKA 1R8BA 1SJ3P 1WKJA 4O3PA 4JI6F 4F3QA 5T7LA 3PEJA 4URGA 4DWIA 4PRFA 2D69A 2ZVSA 3BYRA 3EWGA 4DR6J 3HP6A 4L74A 4BC7A 4AL6A 1JLQB 2QEXS 4O44A 4QQBA 3THTA 2AQ4A 4CLFA 2ROEA 1LWEA 4NEZA 1D9DA 4YB7A 3M8QA 3NS5A 2NSBA 1Q53A 3CC4S 1SV5A 4Q45A 4JB8B 2J5AA 1JLGB 2DGVA 3DLLQ 3D6HB 1GTHA 4OL8A 1CQMA 1RHJB 1U47A 4EBEA 4DFPA 5KFFA 5KT6A 3QGPA 3VQTA 2AJ2A 2HHPA 4F0KA 2ZH6A 4UQTA 2HIYA 2CPDA 2L9NA 1M5VC 4QIWD 3G87A 3SCIE 1VK3A 5FLXU 2MKYA 5B0AA 5E3QA 1C1BA 3EJMA 3LPYA 4WU2A 1D0EA 3NNHA 4Y6IA 4NXNF 3W7BA 2Y1JA 5D8HB 4KJIA 1TK0A 2EG1A 4JI6J 4C2MA 1U26A 4QPTA 3MECA 4IO1A 2CQ2A 1DRZA 2DCLA 3FEYB 4AUKA 5A6PA 3GYGA 4MKYA 4PWWA 4HTIA 5I3UB 3M6XA 4LT6A 3CCUS 2WONB 4R25A 4CTAA 1TK5A 1FDNA 1QM9A 5MLCV 1X4BA 4PWDA 4FNHA 1N0UA 3ENVA 3HI9A 4OI1A 4G1QB 1FJGF 1RA6A 2DKOB 4S0MA 1OQ3A 4H4MA 1J5EF 3GU0A 1M5OC 1X5OA 4NLTA 3DM2A 3J7A1 1VQSA 3GSIA 3CCWA 1EIYB 5HVGA 1NK8A 2PDAA 3F56A 2B6AB 2MQ8A 4J9SA 1QE1A 3IC1A 2DXEA 1TFWA 2W9CA 3LA0A 1S59A 4B3TJ 2JH3A 1ZETA 2OFGX 1YBUA 4TLQA 3CCTA 4DL2A 1TFYA 2MJNA 2OP5A 4DSFA 2YY3A 1Q79A 4NXNJ 4ETZA 2N82B 4TNOA 5KFYA 4F7VA 1M90T 3AFGA 1RAAB 2P9CA 2J6UA 4MAKA 5D15A 1WF1A 2DNNA 2JZ5A 1LK5A 3DGPA 2IM0A 4KC5A 2RF2B 1TKXA 1X4CA 2LDIA 5DZ6A 3ZZ0A 4B17A 3GV5B 2VQFF 5ETSA 1RWKB 3HZGA 1SUQB 3SI8A 2MXYA 4WBFA 2NXJA 4GRSA 1KQGB 4QBUA 3M8RA 2FVCA 3Q2TC 4HR2A 4N5SA 4X4OA 3PW4A 4LF5F 2XB2D 2I5JB 4O0NA 1UVKA 1FJGJ 3DRSB 2VBXA 4NLPA 3IBWA 1KQFB 1N32F 1J5EJ 4KHPF 3IG1B 3G6VA 3KLIA 3LALA 2HBQB 4L73A 4I0WA 4ELUA 1FRIA 1XMQF 1NJIT 4WXWA 3H7HB 2ADCA 2FTRA 2GVZA 1X9MA 1KOHA 1WD6A 5B0DA 6FDRA 1TMJA 3CO9A 2DGSA 1NPKA 2C2DA 3NS6A 1SQGA 3C15B 3CDEA 1LV5A 2DHXA 4JI5F 1S6QB 4RWWA 1Q16B 2KYZA 1SIWB 4V19X 3PCOB 3KLEB 4YOEA 4ATNA 3H5XA 1S9FA 4ES1A 1T7PA 5C24B 5K20B 5DGAA 3ULHA 2ZOGA 4ZIVA 5KOWA 1RK8A 3IRXB 3UO0A 4Q5VA 1YZ6A 2COLA 1W2BR 3HLUA 1AROP 2I1RA 2V50A 3FCWA 2CDQA 1DTTB 3JSBA 4QYZJ 4DN9A 2FZKB 1Q8IA 5E3CA 2BV3A 2VQFJ 2B3TB 3MURP 5C7PA 3I82A 2MHEA 1FWLA 2DH7A 1VQ5S 3JTNA 2I2YA 3M8PA 2DK2A 2HQDA 2CRLA 1NH7A 4CLWA 3K0JA 1KRPA 3W63A 3AJ1A 2J0SD 1WOSA 3B78A 3NWRA 2H54B 2GW8A 2YX4A 2HBYB 3JSRA 3W2WA 1U02A 1N32J 4KHPJ 2XI3A 4ED1A 5D77A 2E44A 8ATCB 2NYHA 1SJRA 3EZUA 4NCGB 1XMQJ 1QLNA 1XMBA 1NH8A 1RWMB 1Q78A 2E7VA 1VFJA 2HHXA 3FBBA 4PG7A 5EN1A 2MQLA 1REVB 2Y3YA 2ZHAA 4PQAA 1MMNA 4JI5J 3BO2A 3OJSA 3DRXA 1BLUA 1C1CB 2HLTA 1KP6A 2QG9B 4Y2MA 2H48B 3N4WA 4ZVPB 3DRPB 2PMZD 1RT6A 1VQ7S 3B82A 1RU1A 1FKPA 2BW2A 3G9CA 3DLEB 2OI2A 3VGVA 1J5OA 2HVIA 3ZO7A 2RUGA 4Y2IA 4P71A 2WSCC 2WVCA 4DPWA 4QR2A 4ZJLA 3KYLA 5J1NA 3OR1A 4A48A 3MEKA 2H51B 1WOOA 3T5HA 1HQEB 2OKQA 5CYMA 5LXRA 3PW0A 2VBWA 4FYWB 5CH7B 1C0TA 4NLDA 4TU8A 2LXIA 4G65A 3EM1A 2XYHB 3DLHA 3TUPA 5GAGI 2YXLA 1IQTA 3D3CJ 4IDKA 4A8OA 5JUMA 2KRRA 1HI1A 3BSNA 4GMKA 2HFNA 2AIRB 4L76A 3VAGA 5LSRA 4MFBB 4K5SA 1N56A 3EVWA 1HNWF 3EGVA 4FKXA 3LGMA 5F0UA 4C97A 4FZVA 4EZ9A 5D6GA 4PZVA 3DRYA 1S6PA 4YB1P 2Z56B 3HKZD 3A3PB 5KFDA 2VICA 3D9BA 2GA7A 1S10A 4WFAQ 5GMKa 2CJBA 4V19J 2X3GA 5D4NA 1FCAA 5HMWA 4N47A 4WYLA 4O3NA 1RQ0A 1UKUA 1HWUA 3I0RB 2O5DA 2V9KA 1P9YA 1LWCB 3RAXA 3NRBA 2OEJA 1RA7A 3IMQJ 2MKIA 1HKAA 4Z7CA 5L1JA 2LU2A 5FDLA 1E6VA 1TKDA 4O4GB 5B08A 1SH2A 2QRRA 1UVJA 5HLFA 3M2UA 2F4FA 1KNZA 3RYLA 3U27A 4DSKA 2BKOA 4ZPCA 4DJBA 4U7UD 4CO5A 2BR0A 4NLOA 3VAHA 1MWQA 2OO4A 5LJ3Y 4YY3F 2FC8A 2PT0A 3TJ8A 4PUOA 4DLGA 1GNKA 1S1TA 2XULA 1K1SA 4B9NA 1GMWD 2RS2A 2OPRA 1Z2ZA 4M8LA 3GIRA 1RT3A 2BXJA 4X62F 3Q8RB 1RTHA 4UUWA 4OFZA 2I6WA 4A47A 4IFYA 1JLFA 1HBMA 4ZKAA 1O0PA 1OYEA 1SVDA 4USVA 5F8NA 2X3DA 3UVJA 1AZSB 4Z2XA 2FJXA 4JI8F 1ELOA 1YJUA 1U8WA 1HNWJ 4B3OB 4RWXA 2W25A 3OLAA 3FC9A 4OZ1A 3MM6B 1UWBA 3NCQA 1T94A 3J81Y 4Q7AA 4OZLA 7FDRA 2HS4A 3V4IB 1NMEB 3H5SA 5GADI 1TELA 3BM7A 2PEHA 2KXFA 3KK1B 1VC5A 3M05A 1KEKA 2UZAA 3PXGa 4CO3A 3KXDA 2V8DA 2FQQB 2UVVA 2X1GA 2Z58B 4NLXA 4RJVA 1CPZA 1NLKL 2EKNA 4KPCA 2XC9A 1RADB 2R8JA 2Z2YB 1UWAA 3OL8A 4BC9A 5DDRC 2XZWA 3DC2A 1S99A 3RB0A 4OZ5A 2DR8A 2WW8A 5CZXA 3H2VE 3IWXA 3GB0A 3DHXA 3IRWP 3GILA 3CC7S 2RQ4A 4YY3J 3M32A 1X5PA 2AU0A 2OAUA 2CPFA 2QMXA 1MN9A 3B6BA 1R27B 3M30B 4ZA1A 5L9XA 5HVHA 4X62J 4DLEA 4OI2A 4C8ZA 2P5VA 9RUBA 3MWBA 5E5NA 4U8VA 1RHKB 2E1RA 3VQSA 1DFDA 3RRHA 5C42B 2CJAA 4JI8J 4Q43A 3IN5A 4EWTA 2CWXA 1O8BA 1VJWA 2RE1A 3VAFA 1KONA 2RAQA 1QSLA 1JKHA 1IKXB 3TAPA 3R2CJ 2HHQA 3R9LA 4N77A 3BYPA 4C4WA 2HHHF 5KFRA 5DDOC 1AFIA 3DN9A 5HQLA 2CPJA 3W66A 1U4BA 2M5YA 2ROGA 4OHVA 1LEOA 4ZP6A 2YKMB 2E5GA 1GXUA 3OJUA 3DRRB 2VIHA 3JTOA 3I4HX 2L9DA 4NRUA 3HVWA 3T19A 1KOOA 1APSA 2OPSB 1HBOB 4FN5A 3THVA 3FEXB 3QIPB 4CLTA 3AAWB 4KSEB 1FJ7A 1HIYA 4DMZA 4DI6A 2EPIA 4RNNA 2GC8A 1N8RT 2BKNA 2YKNA 3DDKA 2VASA 1KFDA 1VRQC 1EB0A 2BX6A 2JSXA 4LQ9A 2XSJB 1ZA2B 3R27A 4K4UA 3WC0A 3EDRB 5DG9A 5ETKA 2PA8D 1YTYA 4PYDA 4B9VA 5C2GA 3FDSA 1VRUB 3W2VA 1NK4A 1X5SA 2ZOFA 3ITHA 3G6YA 2IIHA 3KHRA 4ES3A 1NKBA 1QDUB 2HHHJ 5LMNF 2JEJA 3MOZA 3K57A 4NL5A 1SBRA 3CD7A 2HAFA 5HJYA 1FX2A 1X8DA 2VBZA 4JI4F 1OJ4A 3CE8A 1S4EA 2LFVA 3N79A 1CVJA 2MEWA 3MHYA 4USIA 3MAAB 2ZD1A 4KO0B 5C25A 1FRKA 1TKZB 3FSYA 4DX5A 3JAMY 1IR1A 1SC4B 1PYTA 1TV6B 3CWJA 4NXMF 4OZNA 2EBEA 4F67A 4GC7A 3JS9A 4I68A 3QIDA 1U1PA 4C3MA 2UUTA 1L3UA 3IR6B 1JJCB 2ZH1A 1T9TA 2MGZB 1C2PA 1J2VA 3MR7A 4DL6A 1HW8A 5A2QU 1VOMA 2PE8A 5K9FA 1H7XA 3HHLD 1WUUA 1B7FA 2EC2A 2XWYA 2KFZA 3HKWA 5EWEA 2O67A 4NI2A 3OL9A 4EEYA 2CNNB 4KFBA 3OL7A 4CT9A 1BE4A 3DXBA 1F2GA 2JDJA 2CQ3A 1HNZF 1VISA 3W9HA 4USMA 1T9XA 3PYDA 4BWJA 2DH8A 3MM9B 3CCLS 2YNGA 4EO8A 2KZMA 5LMNJ 1R7IA 4MTPA 3TO8A 1ZM9A 4DR2F 3KLFB 3OQ2A 4ZLNA 3PKMA 3QO9B 3H40A 3P5BP 1HNIB 2MJUA 4NYZA 2HMIA 3LOUA 1V9OA 5J2MB 3CJKA 4CM0A 4U6PA 4JI4J 2UUBJ 4K4SA 4LFAF 3ISZA 4YN3B 1VMBA 1I94F 3NGUA 1FNOA 2RMLA 4J9NA 4PXCA 4IO9Q 4JBCA 4ZPTR 1YBAA 2J0QD 3QZ7A 2N3LA 1IKVA 3H25A 3CCVS 1JXVA 5DG8A 1RABB 1XIQA 1RXOB 3MMAB 1S0NA 4NXMJ 3BQ1A 1LWFA 8RUCA 1FEEA 2WSEC 2DHSA 3VF0B 3ETMA 1CC7A 2V2ZA 4WP9A 4ZN3A 1BWEA 2C2RA 2HRUA 1IKWA 3JQJA 5DO2A 2XMJA 2VZ9A 4OJ1A 2LYVA 2LQ5A 2G0CA 1VIXA 3KK3B 3KUGA 3OTBA 4WPAA 2XG8A 1TVRB 1VK8A 1S49A 1T02A 4ELTA 2XY6A 4PABA 1S1WA 2EXUA 1IR0A 1HNZJ 2MZSA 4F0HA 1RB0A 2ZKTA 2Z4PA 4USTA 3GFZA 1KDNA 4ED5A 4I2PA 3TR5A 4J9VA 1IBKF 5DDQC 3CJTA 2ZBCA 4WZQA 1IUJA 3F0NA 1VIOA 4DR2J 3M8QB 2KDOA 1FXRA 1S4FA 3TVZA 1SV5B 4RU2A 2LVWA 2CDRB 4BCAA 1U1LA 2VF3A 2A10A 4HHHA 4Q0BA 1YJNS 4LFAJ 2CPZA 4ILLA 1NU4A 1I94J 3UDLA 4C8MA 4ED7A 3RBZA 1ZM4A 7AT1B 2B0GA 3ADAC 4USUA 1NK0A 5F8HA 2DY9A 2Y9HA 1WI6A 4XIUA 3W65A 1C1BB 1HW9A 2PN6A 2WK4A 2PMWA 3T3FA 1DY3A 3R8YA 3NCRA 2Q6CA 2D9PA 1D8ZA 2WOMA 2F3JA 2N7YA 2R7SA 4LF2A 1K73T 3D6TB 3RW6A 1Y3JA 1FF2A 3OXLA 3RB4A 4IKAA 2OLWA 1PILA 2NZCA 4FPIA 1IM6A 3T5JA 1ZZNA 3T5LA 2XNQA 3CJ3A 1S5ZA 3DU5A 5U47A 2V67A 3PHEA 4CQ1A 5HP1A 4PWDB 1DTQA 2BE2B 2DR7A 4HKQA 3I0SB 1WKLA 2NXNA 3P45B 2HGMA 4NRTA 3GYXB 1YHQS 2OELA 1S1XA 1RI7A 1Q4RA 3OSNA 2DR5A 2QL9B 1L3VA 3NBPA 2DRBA 1RAOA 4K59A 1TL5A 1MROA 1QE1B 5CD4A 3GTYX 4NOHA 1GMVA 2OFHX 4O3OA 3I96A 4ECTA 3HSGA 4FKYA 3NGRA 2DGWA 4KV8A 3BKTA 4DCOB 3OW2R 2GJFA 5K5MA 2ROPA 1M5PC 5L8RC 5CYQB 1PO6A 4IG0B 3Q89A 2XMMA 1WNEA 5B0EA 3RB3A 5H9EK 4PR6A 2HZAA 3IWNC 2DNLA 2IA0A 3MAQA 1XMOF 1RAJA 4X65F 4DDFA 2ZH9A 5HAOA 3F73A 1CULB 2YNIA 2D3UA 4FXWA 3DYAA 2E66A 1SQFA 3IBFB 3UN3A 4QIFA 2JLGA 2QL5B 3GV7B 3IFEA 2FHJD 4ZIWA 2O66A 2BZ2A 1G3OA 1XNRJ 3VGTA 2RU9A 2HQCA 2XMUA 2ATCB 4YR3A 4KAIA 4DCPB 1M5HA 2ASDA 3R7SB 2G4BA 2F9JA 1T8EA 3GCXP 1DBDA 1MN7A 3UPFA 1G4CA 2R4FA 2SXLA 2DD8S 3N6LA 2P6TA 1UVIA 4Z7YA 3G82B 3WIUA 4MIBA 3AOBA 2XS7A 4V1Ak 4PG6A 2FJBB 3N01A 2VA3A 2OD6A 2HSEB 3H0PA 2FJDB 2QLXA 2CPIA 2E1CA 5CXTA 3EPIA 2VC0A 3RW7A 2QJ3A 1R43A 5EUHA 1JLGA 2HK2A 4M1KA 4U7UK 2KT3A 2M70A 1HHTP 4FBTA 2J9DE 2J7WA 3RG6A 1FNXH 1XMOJ 3RBXA 4X65J 1R0CB 3CTRA 4UOFA 4CLZA 1HBUB 2DNRA 4M5MA 3PR5B 1UCNA 3FSIA 3ET6A 4IH7A 3FBCA 4I6WA 1RTIB 1OY6A 3A12A 4WF9Q 3A13A 2E9RX 1X4EA 2EKYA 3O6QA 3EXCX 2J7KA 3CJ0A 4OIXA 2NUHA 4QOTA 3N5BA 3UE2A 1Q5VA 4ZJOA 2QIFA 1PC5A 5HO4A 2LECA 4I6AA 4USJC 5I3UA 3PFEA 3D0GE 3H59A 4TU7A 2H5IB 3KK2B 2WONA 2XYGB 4CO0A 3MMBB 1PYSB 3GPAA 2Z57B 2BBEA 4JV0A 4F4WA 3VAMA 3FZBA 5E3RA 1UTAA 2ILZA 3N6NA 1KS2A 4EFAC 5EWGA 3QATA 2F8HA 3Q2SC 1ZTWA 3BN4A 4F4ZA 1R6VA 4FF4A 2FHKA 3DNCA 2ACYA 4J9OA 3MEDB 1IWGA 3OSPA 1U1KA 3I6PA 3ZFVA 2CQHA 1FNMA 1SI9A 3FUYA 1UW9A 1G1XA 4EK2A 3BSAA 5B7WA 4GVLA 3K8VA 1SC1B 5G0RB 4A8FA 4M5GA 4PPZA 4C98A 2VODA 4A8MP 5ETLA 2DO0A 4DS4A 2KT2A 2QSWA 2QLFB 1JWWA 5HL7Q 1GAOA 2IBOA 2X1BA 3M8YA 3MFHA 2IRXA 1JXEA 4NX9A 4LRAA 2BJ9A 4DQQA 3OXGA 1NHKL 3K7RA 3P4UB 3VAIA 1XBWA 3C16A 4GVBB 3BGLA 3PM9A 5KFPA 4A8QA 5SZTA 2RF2A 1QVGR 1UW4A 2ZJPQ 2Q79A 3Q83A 4DX7A 1UJ5A 1BQMB 4XK8C 1RKIA 2ZZTA 2VFSA 5EX0A 1HNXF 4C3KA 1FK9A 2CJXB 2R42A 2HQFA 3MXHP 1DURA 3DRSA 3DOMA 1F5BA 3N0VA 1YSJA 3KHLA 3Q8YA 3IG1A 3G8TA 2ALZA 3FQLA 4WK3A 1P1TA 4CO1A 5AE2A 3P49B 1RBOB 3KTQA 4A46A 1WF2A 1FDBA 3IP0A 3W1YC 4PWUA 5HLFB 2C2EA 2XZTB 3C15A 1IM4A 2EK6A 3DU6A 4RBVA 4N8NA 4YHHF 1GT8A 3GFYA 3KLEA 2FY1A 2XWXA 1EX8A 4OJHA 3OV7A 3VR1A 1Y5NB 1U7LA 3K5MA 4PUOB 1SJFA 4XDDA 3TZWA 4CT8A 1QTMA 4L72B 1TR0A 3IS9A 2F8MA 1FO1A 4K2XA 2Y0BB 2ZH8A 4PXBA 1Z4UA 3QNWB 3IRXA 4TY8A 1HBMB 4NLVA 3UVJB 5JVGQ 4CI0B 4ZDNA 1RU2A 1FE0A 1KWMA 2V4JB 1NSPA 1X4DA 3WBZA 3ZTQA 3MI7X 2ZWOA 1WC4A 1HNXJ 1URRA 3H8YA 3TZXA 2FHOB 4K50A 2IYIA 1RWWB 5I3QA 2RDDA 4FXDA 1ZOTA 2K1RB 2U2FA 4F04B 4DBQA 3GR0A 2BJ8A 1QAYA 3TRGA 3FRYA 4NCBA 5HVFA 2B7CB 1Y4ZB 3J7YU 2PEBA 1C4AA 3FBFA 5AJ3J 4U8YA 1T3NA 2NPIA 1GXTA 2VFTA 1WG1A 2RVJA 2D3O1 2OSRA 4OYWA 1JQGA 2JC1A 1WSRA 2O1PA 2B51A 2KYXA 2ZH7A 5HMZA 2V4RA 1NSAA 1C1CA 2C3OA 4HDHA 3HT0A 2OEMA 1EETB 4QU7A 4DSEA 3VTIA 2DXFA 3DRPA 2GMHA 1MG7A 4K5RA 4YR2A 1M1GA 3QYYA 2BQUA 2QX0A 2E9ZA 2PD1A 2BANB 2DRDA 3KLGA 1SJ1A 2DH9A 3DOLB 3ENAA 1ITPA 2CA9A 4M5KA 3I5BA 4P7TA 1NJZA 2B9WA 2CPEA 3KUEA 4IH5A 4Y34A 4C8NA 3BS9A 1JXLA 4MMOA 2UV8G 4WCEQ 4OHZA 3GMGA 1JB0C 4PG8A 1ZBTA 4WIQA 4M95A 3PYEA 5IC6B 4KKOA 4ZPWR 3SMZA 4WFXA 4QWEA 1HFEL 3UNYA 3M7VA 4DUYF 1FD8A 3IR7B 5ETMA 2RRNA 1N6QA 4MFBA 5T14A 5FD1A 3FCVA 4O0IA 4PYAA 5D0RA 3A8KA 5LM7E 4RW6B 4RNOA 1SJ4P 2NR0A 5CCMA 1S76D 3QSYB 2VPYB 1A7GE 3BSCA 1S72S 2RUSA 2H4YB 5KFMA 3CD0A 1TZ0A 4XTTA 3CD6S 2KFNA 2HBZB 3BQ2A 4O3SA 2HFOA 3N6MA 2IJFA 2XQCA 4EMDA 2UVRA 1LXJA 2I8EA 2MLZA 4DR1F 2AV5A 4NA1A 1U25A 5LT5A 4LBIA 3AQOA 4O4GA 3ELHA 2K3IA 4C0OC 5IOLA 4ZVGA 1Y11A 4LUBA 3L7UA 2PO4A 1X0PA 4IYQA 1U49A 2DNMA 5DZ7A 4Q8EA 3BO3A 2F65A 2QO3A 3RTVA 2HQGA 1YITS 1RWPB 4IOBA 5F9NA 1TAQA 2WBRA 4K4YA 3POTB 3BF4A 3W2VB 1SB6A 4P2SA 1WF0A 2BOAA 3FQKA 3SYZA 1NPPA 4QCLA 3J81U 4JUZA 1IBMF 1WACA 1X7VA 4LMZA 4DUYJ 4CLSA 3D1OA 1FWKA 1AZSA 2QGFB 3T1YF 1X60A 2WSFC 3MD1A 3CC2S 3ZTRA 2MSTA 2CPHA 1WORA 2WB4A 4B3OA 4KIAA 4DEZA 3MR6A 2QTWA 1D9AA 3GR1A 3E01B 3V4IA 2LLZA 1SPBP 2PSZA 1N5YA 3LO3A 4QWAA 3KK1A 2IVFB 3ZZZA 4KGZB 3CVKA 2G1HA 4DN0A 4QYRA 1WDTA 3CIMA 2DHAA 4MKBA 3DLBA 4NYOA 2YWGA 4BLGA 4OYOA 1RLDA 5KFBA 2EFNA 4DR1J 2AJQA 3R5GA 4FXVA 3W5XA 3TARA 5I42A 3OTDA 3JQMA 3M4XA 2FVRA 2D9OA 3TI0A 4CH7A 4ZN1A 5DQIA 4EYIB 5JVHQ 2GO8A 2E1PA 3S8SA 3BN7A 2LXFA 1LW2B 2ZZNA 1S1UA 2BE7D 3M9NB 2J6TA 2W4CA 1QAXA 2ERRA 4O3RA 5KG0A 2VFVA 4TQSA 1HR0F 2OMOA 3M30A 3QT6A 5A2QY 2GO9A 2OJ3A 4LRFA 2B4PA 3C19A 4EI2A 1IBMJ 3HX9A 4N8OA 4P9SA 2PFDA 5RUBA 5DGBA 2VG7A 2YKAA 2HMIB 4AXJA 2UP1A 5C42A 3T1YJ 4A4JA 2GX8A 5KG5A 1FTCA 1SL1A 3QSIA 1HMVA 3U1NA 1KFSA 1D8YA 1IKXA 4NASA 3R6GB 4USKA 2HVEA 4ZVSB 3W3SA 4F0MA 2MZQA 1IKVB 2P9GA 4NLYA 4EZ6A 4P10A 4CZCA 4TLRA 3KLHB 3T9NA 1Q1KA 4YR0A 4EBCA 3DDIA 1JLAA 4GO7X 2H5EA 5KFTA 4N41A 4LF9F 4RW8A 1MSWD 4LSNA 5KFXA 4HYKA 4KT0C 1TMMA 1WC1A 1WC3A 3QAUA 3RUBL 2V5HG 4X64J 3MPVA 2HQ3A 4CO4A 1K0TA 2CG4A 1M0SA 1LXNA 2FUG9 2OEKA 1LFWA 1HBOA 2F4VJ 4O4RA 4J9QA 1WOPA 3UDVA 3AXMA 3AD9C 2DNHA 2BDPA 4DSIA 2D3ZA 3GSDA 3PEHA 1TL1B 3IAS9 3QIPA 4UUXA 4F50A 2J0WA 2OUGA 3Q8PB 5HQ8A 3EVMA 2E29A 1HR0J 4EU0A 1S6UA 4I2PB 3PO5A 1DHMA 1UMJA 4FP9A 1HNVA 5CQGA 2J9EA 3ENWA 3AB2B 2HNDB 2H4WB 2ASLA 3KJNB 3NWGA 3EZOA 2NXEA 2NSCA 1N0VC 1AT1B 4HHJA 1L3SA 5K8NA 1CEZA 3FEZA 2DGQA 4QIGA 1H2UX 2AHOB 2IJNA 4ECUA 2CG8A 1SH3A 4DFKA 5M2RA 1TU0B 3M9OB 1VRUA 3CDAA 2ZBQA 3I56S 4A8WA 2R7UA 3FNNA 4OZ3A 4TQRA 2AX1A 3DGVA 1UJ4A 1BWVA 1D3WA 3BDPA 3ZNUA 3JAMU 1N48A 2DEIA 1AW0A 3CGIA 3LQVA 4P2FA 1IJFB 3GIKA 1IKYB 2ZUGA 4LF9J 2BRLA 1N54B 4LSZB 1U1MA 3R1HA 1OMSA 3MMCB 4YEAA 3WHIA 2W8KA 3KLVA 3MAAA 4K0KF 3PX6A 1JLEA 2RIJA 2B9XA 4F4YA 2KG0A 2MB0B 2E5JA 1TKZA 3JSMA 3BBFA 3PNIA 1TV6A 1KD1T 2BRKA 1ZH5A 2PFFB 2GGPA 1RAIB 3UN5A 4DX6A 3EMTA 3K89A 4J7CA 5KT2A 3VV2B 2JRSA 1GMUA 2MGZA 1VS3A 4F02A 5HSPA 5GAGU 3NGDA 4WFYA 1DARA 3QGHA 4F25A 3J80Y 1ZS6A 2KTQA 1S1XB 4OLOA 3SZ2A 4Q2LA 2AMCB 1N5TA 2DY1A 1N33J 5EDWA 4CWBA 1FX4A 3ZNJ1 3LW5C 5AXMA 2Q6BA 2GHVC 3UWTA 3T41A 3KUHA 3WDOA 4OZ2A 2QA4S 5DDPC 1YRTA 4ZS6A 1NK5A 1HNIA 3IM9A 2VONA 1VC6A 5J2MA 1TAUA 2HRYA 1Q7YT 2Z2ZA 4I67A 3HZEA 1P1LA 3WX8A 2HZVA 2QLBB 2WW4A 2WB1D 3SSSA 4GKKF 2EVZA 3SEOA 3TP2A 2WRMA 4K0KJ 2V9WA 2OTJS 3BPSP 4D3HA 1RYSA 3QWUA 4DQSA 3OHAA 2V2VA 5J1PA 3MMAA 3UD5A 2DNPA 1DZ5A 4DX8H 3IO1A 2V2QA 1WEZA 4MK7A 3UNGC 5A76A 5KFKA 1P9QC 3B4DA 3LWMA 1REGX 2ZDPA 3P5TL 3KK3A 3M8ZA 1TVRA 4X4SA 4XAKA 2UU9F 4OZJA 1N4LA 2IM3A 2GQQA 4QZVB 1T3OA 2GAGC 5D78A 2AGPA 2MKJA 2PGCA 3E8OA 2DHHA 2FLPA 2RS8A 2FLNA 2YTCA 1Q0NA 3QRRA 1F6TA 4P7VA 3VVUA 2BM0A 5GADU 4P2MA 1RJJA 1HYSA 2CQBA 1BY9A 1RE1B 3RR8A 3HHLA 4ZVRB 3X3UA 2ZZMA 4PCQA 3EE3A 2VFUA 3IR5B 4ANDA 2HHSA 1RCXB 2BA9A 2HFVA 1X5TA 4AXIA 4DV4F 1NM2A 2QFJA 4Y00A 5IT9Y 2CZ4A 4GKKJ 1NZ8A 4KY3A 4DR4J 4UY85 2C2MB 2R8HA 1RACB 1U48A 3MM8B 1H72C 2QN6B 1FWPA 3I31A 5ADZA 4WIIA 1PBUA 3MR3A 3BREA 3BGOP 3PYGA 3PVXA 3ET6B 5DQGA 3ISND 3MEEA 5E3AA 5HQMA 1IR2A 5IM0A 4WWSA 4DV5J 2DYAA 2YVSA 2YWFA 3KOAA 2H9ZA 3ILOA 2YH0A 4N7TA 2QFIA 2UUWA 3LPEA 2YBVA 3OHBA 3FRZA 1WJ9A 5KOXA 2BVZA 2E5LF 4ZITA 2UU9J 2DIUA 1F60B 1NK7A 1ZPVA 2D1CA 2IMOA 3SQOP 4OYBA 2BABA 5E41A 1NB7A 1BUXA 1RBLA 1B4SA 2BE2A 3NAHA 1WG4A 4DUTA 4CLKA 3I0SA 4NLRA 2FHMA 1WSVA 2FLOA 1J27A 4QR1A 4JI2F 1UVLA 4LREA 3G71S 4ZLPA 3CCZA 3CULA 4ECZA 1U6BA 1VBZA 4RBUA 1I3OB 4OYZA 1ZAXA 2DGTA 5H9FK 4DV3F 1Y0HA 1CJTB 4UOGA 2DCUB 2WZ1A 2RT3A 4DV4J 2CQ0A 2LKZA 2G9OA 2CNOB 4ZVUB 4KYZA 1CJKA 4KGKA 1JMTA 3V2UC 3D0HE 2D41A 4C0HA 1ACMB 1KLMB 2N4CA 1EQMA 3AA8A 4Y65A 5CYQA 2IAJB 2V34A 4C8YA 4IG0A 2MQPA 1Q82T 1KTVA 4OI3A 5J2QB 4RX6A 1W7WA 1SKWA 4FBUA 3C16B 3GIJA 4FS1A 2E9TA 1OYDA 2HFSA 5E7OB 2R9LA 1T9VA 3C8YA 5D0GA 2E5LJ 3IA0A 1M5SA 5SUHA 1CULA 4RW9A 3C14B 1UEUA 1NBEB 2MDAA 3UN2A 2HLUA 1H74A 1EAYC 1FK9B 4DR5F 4TYBA 4RLEA 2R7QA 3CCRS 3DOMB 5F41A 4R8UB 2XNRA 2J7UA 3A8EA 4DHVA 3M2VA 5B0GA 5JMNA 5AXLA 2XLIA 2JFDA 4DQRA 2MYFA 5KG1A 2YWHA 4DV3J 3SV3A 4X66F 5ETTA 3G82A 1WEYA 2QMWA 4Z37A 1WDDA 4H54A 4N76A 4ZCMA 3M8WA 1Q7LB 1M5KC 4OYPA 4MJKA 2WTFA 1NHVA 3KJQB 1F5AA 3DDNA 1F1BB 1UVNA 5HMYA 2ZE2B 4DL5A 3WZ0A 1N34F 2Z2LA 1T03B 2HAIA 1CC8A 1YGYA 2AYEA 3G2XA 4NLUA 5IT0A 4R0EA 1EJ7L 4F26A 1KQKA 3IS9B 4KHRA 2GMLA 1HWLA 2KJWA 4C3LA 2POKA 4TY8B 3GG0A 4FDFA 4JV5F 2ZH2A 4ZP8A 3QZ8A 3V6HA 3A1YG 1QUPA 4DFJA 1HBUA 2FJEB 2NZ4A 5DJBA 1RAGB 1JLBB 4FF2A 1R31A 4R5PA 5AXNA 3J7Z5 1RTIA 1GEHA 4HDGA 1VLOA 4L3KA 4DR5J 5KFQA 5K14A 2CVEA 2ASYA 2CQIA 5B0FA 5L9NA 3SDEB 4LF5J 3JYTA 1HL6A 2KHCA 3ETOA 5IV3A 1RAFB 1JIHA 1MU2B 2VUGA 1WWHA 2GHWA 4NA3A 4J9PA 3L7PA 3I9V9 4MH8A 2EW9A 3FBEA 3KK2A 4JP8A 4X66J 4RZRA 3MMBA 3DHWC 3L3CA 2ZNZA 1TUGB 1RTJB 2HYIB 1VQ4S 2FD2A 4QW9A 2JEFA 3PJXA 2XMKA 1SKSA 2FVPA 1YLXA 5ETVA 2RD5C 2LQ9A 2ABYA 3MPDA 4U9RA 3WC2A 1N5QA 1VHFA 4QW8A 2K06A 3CUNA 3PJWA 1NAQA 4OYMA 3MEDA 1KKHA 1FRJA 4ANCA 1VR6A 3D28A 4R0JA 2HQIA 1NSKL 3AJDA 1U24A 1MWZA 2KM8B 4WZMA 3KLGB 3K5PA 5KFLA 4K4WA 5G0RA 4ALZA 2RQCA 2DTJA 1H98A 4JV5J 3A3OB 1IVZA 1R3NA 2W2PP 3HMJG 1LNQA 3QFHA 1FESA 1OY9A 5L1IA 2IVMA 1S9EB 3NGKA 2HVHA 1L3TA 1SIZA 4U96A 2VDHA 4L3NA 2RRAA 2M52A 3CJSA 3M1VB 4KKOB 1IJEB 1Y10A 4GVBA 1GXLA 2FDNA 4F8RA 2C1EB 4PG5A 5DLFA 1N6QB 1UEVA 3CT9A 3Q24A 2BQ3A 1BQMA 1GH8A 3H90A 3B4MA 3AY0A 3HM9A 2CFXA 3CB4A 5HBMB 1X4AA 1XTZA 5L46A 1LFPA 4FPRA 2R2RA 1P6TA 2VA2A 3CNQP 2B5JA 3LF0A 3BGFA 3OFEA 4J37A 2XI2A 4YDDB 1UETA 1HI8A 3HJVA 1OPIA 3BH7B 1Y9OA 4B02A 3MOJB 2HFZA 2IC3B 4ZOSA 5KG7A 2F8EX 1EQ0A 1H2VZ 2JFKA 3NAIA 1W26A 1PAUB 4DQPA 1L5UA 1B0VA 3H42A 5F0WA 1U2RA 5IFMA 3WX4A 4DS5A 2UXCF 5I3PA 2K2PA 2VBYA 4H4KC 1HD0A 3DMJB 2QV6A 2P6SA 1JNRB 3AODA 3MM7A 1CJVA 3TAQA 3JQKA 1FJEB 5F8LA 3ZZOA 2BKPA 4ECWA 3ILJA 2BMBA 1VGYA 1AYEA 3K17A 2GZOA 2KU7A 2XYPB 4OX6A 4OI0A 5J1EA 2W7PA 2XLKA 1VDHA 1Q95G 3AD8C 5DS7A 2WHOA 3VVTA 3R5JB 2V4JA 4ZLLA 2HEKA 3R6LB 1VRTB 1S48A 1T05B 1DLOB 5ETRA 2FYXA 2AEJA 1ULRA 3BEGB 5LJ5Y 1N5YB 2KRBA 2OTLS 4NWBA 5EHHA 1PKUA 1L3KA 2I38A 1LK7A 2VFRA 2CUYA 1UEKA 2K1RA 2LA6A 2H1YA 3ZTPA 4DF4A 3UQSA 4RW7B 3LP2A 2MQQA 2MZRA 1NEEA 2Q43A 2EFGA 3EYZA 4E0DA 1VQYA 1H6KX 2CVIA 5BXIA 1LWXA 2UXCJ 5I42B 1N5VA 3QWPA 3LAKA 2AX0A 3W5YA 2I9SA 1DJ0A 2P8IA 2IJRA 2IM2A 2B7BB 3T9ZA 1QY7A 3QRQA 3MFIA 4G3IA 2C3MA 2R7WA 1PCAA 4DR3F 1EETA 2JVOA 4DU8A 1S1UB 1S9GB 1FKOB 2CQDA 1VLYA 3D7SB 1YBTA 2BANA 4U7CA 2ALYB 3L9ZA 2D74B 3DOLA 2KO1A 3CCJS 3TUIC 1VBYA 2YQ1A 4HHUA 2X7IA 3V5RA 1SKUB 2VG7B 3UW1A 3QFWA 1Z2LA 2X51A 1OWXA 1HMVB 1PYOB 2KI2A 1KN6A 4G1IA 4DXLA 2C22A 2X1FA 2GNKA 2G1DA 2XY7A 4CLLA 5IWAF 1S77D 1QVFR 1NHUA 1S57A 4KHMA 3SCJE 1NJXA 5JJBA 3VAKA 1FD2A 1JLAB 3MCOA 2VPWB 5K8OA 2EK1A 5C2CA 4RW8B 2BACA 2K7KA 4LSNB 5ETNA 2DPJA 2PMHA 4RW6A 3G8QA 4Y2CA 3SSRA 3KFWX 4IOAQ 4FF1A 3S6EA 2YX7A 3CSKA 3GWCA 3A4TA 2J8AA 1RT7B 1YG0A 2WVEA 3P8BB 1ZM3A 4DR3J 3DLGA 2HGLA 3ZTSA 5CYJA 4IFVB 2J6SA 3HXMA 2FB0A 3DFEA 5BJRA 2RRBA 3DLKB 1HNVB 5L39A 2OPQB 1FXLA 3KJVA 1IXKA 4IRCA 1KVIA 5A8RA 5GAHI 3HSDA 1WC0A 1OS5A 2F5GA 4DFMA 3HSZA 2KG1A 3BSOA 1G7CB 2Y8YA 4PAAA 1UJ6A 3POTA 2HWHA 2OPPB 4DV7F 2OIHA 3TVKA 5GMDA 2RQMA 3SV4A 4LVNP 3P3DA 3QGGA 4ED0A 2LU1A 4RUHA 1I5OB 2CWKA 4ECYA 3TANA 1TP7A 4E2FB 4I2QB 1RT2A 4LF6F 2W4DA 1AB8A 3CMQA 2PI5A 2OMLA 2EBGA 4C8KA 3I4PA 1FFWB 4PQUA 1YWXA 4RR5A 3E01A 1FFSB 2FIUA 1JLEB 2CQ4A 2R2UA 4I69A 2CJQA 5IS2A 3JSMB 2J9CA 4DUZF 1U09A 2Y0SD 1YJ7A 2GGPB 3M2RB 2MZ1A 3ICLA 1F3FA 3LH2S 1NZAA 3AA9A 1AA1B 2GHPA 1S0OA 4A8YA 4HI2A 1SL0A 2G2YA 2HHTA 5DQHA 1RKJA 4Y0FA 3CMES 3OVBA 4OLPA 3NP5A 2JLFA 1XERA 3V81A 1SCJB 4UT4A 3G8SA 3HVTB 4M5DB 3I5CA 3CCSS 2IBKA 3QJPA 4IQXA 1LW2A 1U2FA 3D4JA 3CW2C 4RO0A 4PG4A 4NA2A 1RT1B 2FC9A 2IRYA 4DV7J 4B9LA 4LIRA 5T41A 4DOZA 2FVQA 5HROB 2APOA 4EUVA 3AQPA 3D68A 1XQIA 4LF6J 5KFIA 2L9WA 1UPPA 5K8MA 1H2TZ 2EWHA 3Q23A 2DB1A 2V0NA 4ECRA 4B3MF 2YPYA 2LQBA 1KBRA 1HWKA 4B3TF 3KWMA 1U0HB 2IDLA 2LEAA 3OFGA 2HFUA 3CMAS 2P9EA 2JNJA 3Q0AA 4RW4A 4PXEA 2XS2A 3CJQA 2MSSA 5F8IA 2DR6A 2ZDOA 1WC5A 4DUZJ 2KN4A 3KLHA 1TQLA 1F9FA 3HF5A 1YRXA 3LP0B 5C5JA 3N28A 3FCHA 4C11B 1XC9A 2C3PA 4ZVEA 2DNZA 2FZGB 1AXQA 1URNA 4GKJF 4DV2F 4LR8A 3BKUA 2DR9A 4LRDA 5GAEI 4IR9A 4LRCA 4HACB 3MCSA 3OL6A 4DV0F 1RYRA 2BW7A 3KMSA 1X4GA 2AEFA 3J7AN 2M8HA 1TL1A 4ER8A 4P52A 2HURA 3QLHA 4WTYA 1HHQA 1V5VA 5LSLA 3X1LB 1H73A 4DL3A 1UL3A 2RDIA 1QAJA 3Q8SB 2UUCF 2EFPA 2HNDA 2MTLA 4YQWA 1HYSB 3HHLB 1I51B 4RNHA 2GVDA 4ZCKA 3MCMA 1CQNA 2B4OA 4OV6A 2AP6A 3H5YA 2QA4G 4B9MA 2BJ1A 3T5KA 4B3MJ 1TK8A 3IGVA 1R8AA 4F4AA 4ID5A 1Y5IB 3GE9A 3BGUA 3Q86A 3GYNA 4DPOA 2IA6A 4DCJB 2XMAA 1U1RA 2G2ZA 2XCPA 3CJRA 1FERA 4HH0A 2JX2A 1TUWA 2MQNA 4K4XA 2VPXB 3OD2A 1T0TV 1TKTB 3MEEB 4M5LA 1DQ9A 1IKYA 2R2TA 3ZZRA 2JWNA 5IM0B 1YJVA 4LF7F 4UOCA 1NCLA 3OTEA 3MMCA 2GAHC 1PBAA 3OUYB 2AGOA 1JJ2R 3AOAA 4GKJJ 3W64A 3D6MB 4DV2J 2XGQA 1G6BA 5H9EJ 4WP3A 3BO4A 1NXIA 3J80U 4DV0J 3GZ7A 2DVIA 3CCMS 2B8PA 3OVSA 2VG5B 3NOGA 3AD7C 1QSSA 2FPHX 3LGHA 3DI6B 1N52B 2XHCA 3R5BA 3H5UA 1T11A 4NLWA 4TVAB 1E6YB 1IBKJ 2DGUA 3KJFB 1A6LA 1IN0A 3F41A 2UUCJ 2ZKUA 2V8GA 1Q81T 2ZBPA 2Z30B 5A8KB 3VGSA 2HVZA 3MZIA 2RQKA 3QMQA 3P6YC 3HHNB 1PAEX 4ECVA 3A8JA 5LL6d 4YUDA 4B08A 2A6OA 4ZCIA 2JEIA 3TJ9A 1CJKB 2CZVC 2R7TA 3IBCB 1TL3B 3BB5A 4KRWA 3ZTOA 5DRKA 3HULA 3LGNA 3H2LA 1F3VA 4KPYA 2XO6A 2KFYA 3TVYA 3W9JA 3NGSA 1QD1A 1S1VB 4LF8F 4LF7J 2MMYA 3M6WA 5CAAA 3IAM9 1VCTA 1C0UB 1Q5YA 2AGQA 1MMLA 3HDSA 5D3GB 2DNYA 3R2DJ 2DRAA 1F0XA 5KFCA 2GQCA 2PIIA 1ICEB 1RT4A 4RW9B 3OTOF 3M6UA 3MPUB 3LP1B 4X4UA 3TZZA 2IVYA 4A8XA 3OVAA 4WXOA 5F9LA 3K58A 1V3SA 5D4PA 5LOQA 2B9YA 3UCGA 3TUZC 4LRBA 3G86A 4YS2A 1KQSR 2VKRA 3TA0A 3M2VB 2VB6A 4LSLA 4FF3A 1VQOS 3C46A 2VOPA 2R7XA 2VPZB 5DLGA 4HEA9 3NXZA 4I64A 3MUTP 2C3UA 1I6JA 2NS1B 5KFVA 5KFJA 3UD3P 2E1AA 2CADA 5IT9U 3RBEA 4CM2A 1LQ9A 4Q2MA 1U6ZA 4LQ3A 3K5OA 3KNAA 1AFJA 3Q8UA 1U1OA 5GVQA 2HGNA 4OHXA 3IWLA 4P75A 2C2OB 3KDNA 2GJIA 2BEFA 2D3OR 3A8IA 2W9BB 3H2UB 4LF8J 4QYZK 3PACA 1RHQB 4FYVB 1YJTA 1H7WA 3ZZUA 8AT1B 2K7JA 3D0IE 2QLWA 2GJ2A 2K3KA 4HTJA 2IDEA 3MM8A 2B4VA 4ZVQB 1PIEA 3GJTB 1T9WA 3GV8B 1Z1ZA 4CNYA 2UVUA 3BZQA 1MWYA 3OTOJ 3RAMA 2DGXA 1KVKA 3VZIA 4ZJQA 4IRKA 3K5LA 2W7OA 4R5PB 3PHTA 2CAJA 5K14B 1EP4A 5J2NA 4DV1F 3JYTB 1FI4A 2R7OA 2RKIA 4I7FB 2C2NA 2IM1A 3MEGB 3OLBA 1V5IB 3GLJA 3NKYA 2AEMA 3ISNC 5ETQA 2HNYA 1JNZB 2BJ3A 2LMIA 2ZFHA 2MHNA 1BXNA 1UFLA 4FYDA 4KQZA 3PRDA 3TZYA 4D3GA 2GQ2A 4TU9A 4TXSA 3O3LA 2ZWPA 3NNCA 3MGJA 3LUYA 3NCPA 3K5NA 5HJXA 4YDXA 2B9EA 4X84A 3CO0P 5E3PA 3C6TB 3W8PA 1CJTA 1NK6A 2M88A 3I87A 2BYCA 2HNZB 3CDBA 3K2YA 4XPEA 4DPXA 3EPGA 1SQEA 1XWLA 5B09A 3GP9A 3HCXA 3OXFA 4WE1B 4P74A 3W5ZA 3GQCA 1D1UA 2OHDA 1KLMA 5J2PB 3PX0A 2DBBA 3TEHB 3OT9A 1U45A 1SC3B 3W8GA 4KGXB 2XMVA 1M1KT 4CH1A 1YKWA 1ZA1B 4YP3A 2ZITA 2IAJA 1VQMS 4MT1A 3MTJA 2H3EB 3R97A 1O51A 2CQPA 3KG4A 1YIJS 4Y2KA 5J2QA 3D5MA 1YK9A 4I4BA 3H4DA 3BKFA 3QJJA 5M2UA 3D1QA 2VG6A 4DV1J 2DNGA 2LDYA 5KFSA 3OPKA 4J91A 2BUNA 1VQ8S 2E7XA 4EO6A 3C14A 4W90B 5MAOA 1U8SA 3PX4A 2PI4A 2GMJA 2LQ8A 4OX7A 1SJQA 5HN0A 1UAWA 3NL0A 2M0GB 5KG4A 3MPWA 2JEGA 3R1LA 2AKWB 4CP5A 2B5JB 4WFZA 5B0BA 1U1QA 4R8UA 2ZC4A 1OSCA 2XLJA 1DQAA 3TQ1A 4JI0F 3U02A 3CPWR 4KH0B 1TTHB 1HBNB 3HHDA 3O1LA 2XBPA 2EC0A 1SKRA 3D67A 2KJVA 3R5CA 1R0AB 2CXEA 5DM6Q 4M5JA 3AH6A 3HD2A 3KHGA 1FRMA 3D2WA 4PEOA 4JI7F 2VH7A 1H0HB 3ZZYA 2GV1A 1FFGB 1YDLA 3EX7B 4I56A 3MM7B 4OMFG 3JTPA 4DPTA 3PYFA 1CJVB 2YPZA 4AQYF 5BYSA 3EVOA 3L7OA 2ZE2A 1CS4B 4Q44A 2NUUG 1T03A 1P27B 1RCOB 4BS2A 1WHWA 3O44A 2CZ9A 4NMLA 2EFQA 2ILYA 3T6BA 1N5SA 1SH0A 1XN9A 2DPIA 2GIRA 3JB9k 5J1EB 1CJUA 2W8LA 3ENQA 4WJBA 1NRKA 2NYIA 1R0BG 3RRKA 3HFVA 3PG9A 3MTKA 1VBKA 1JLBA 4MKAA 1KTQA 1K1QA 1H3DA 1GQEA 1DAXA 4P2XA 1NK9A 3BGRA 2RB7A 2N4DA 4RUAA 3SDEA 2V4QA 2E1MC 3OFFA 2HRTA 2F1FA 1FRLA 1MU2A 3ILLA 4ZHRB 1HQUB 2XM3A 4DL7A 4C8OA 3LP2B 1TL7B 1F9EB 4P72A 4JI0J 5JXSA 4OHWA 5KT7A 2MLXA 1EKSA 7FD1A 4CYUA 3HK2A 4FVMA 4HT7A 3T6JA 1RTJA 4HH1A 3V6JA 4UTGA 1BQNA 2DNOA 2HWTA 2QC3A 4JI7J 5IXUA 2M7SA 2FVSA 1VQLS 2HIQA 2VQEF 2FGOA 4MIWA 1S6OA 3SFUA 2Z2MA 1WKKA 2A18A 1IBCB 2Z0GA 4YHHJ 3WIVA 4AQYJ 3SFGA 1P8GA 1R8HA 3U1MA 1QTNB 3N5FA 5B0CA 3MAHA 5A8WB 4MYTA 2V8VA 2YKQA 4RU9A 3SXLA 1UA0A 3CJ5A 3ILIA 1NDPA 2JHEA 4ZPVR 4F2RA 1MNEA 1D9FA 1S9EA 2M8DB 3MM5B 2E5HA 2GFFA 3KKFA 1SXLA 3M1VA 1ZAVA 4ZCLA 1X9WA 2RILA 4ZMMA 2KHDA 2ZBIA 1R89A 3W62A 2UUBF 3AHPA 1T9UA 3TWZA 4M5NA 1NKEA 4RBTA 5CZVA 3QRPA 2D7SA 4CH0S 5HBMA 5KFZA 1I1GA 4NYPA 3EGWB 2VC1A 1RHRB 2A2DA 4ZVOB 3O2IA 4OX8A 4WK1A 2YNFA 4WTOB 1YQHA 1HLWA 1FXDA 2W2NP 4K4TA 2VQEJ 1GTEA 2OSQA 1UPMB 3GONA 1BD6A 3GFXA 3DLGB 2IC3A 2A3JA 2AW0A 4XDCA 3G6ES 4PPDA 1BHNA 1WHVA 1UA1A 1RTZA 1S7HA 2DEJA 4DG1B 2MLYA 2LCWA 2N3OA 1RTDA 2C3YA 1CBKA 2W24A 4IRDA 3KJVB 3DMJA 3RU0A 5A8RB 5BYRA 2HWIA 4DZ6A 4USWA 4B9TA 3DOKA 1FHTA 3JSYA 1V6HA 5F8MA 3ZC4A 3EUNA 4LF4F 4ED6A 5KT4A 1R6YA 2FJWA 4Q8FA 5D4OA 3KMQA 5KG3A 5IC4B 4ITSA 1PSDA 3S1TA 3Q8QB 1MW7A 5THWA 3NGTA 2YNHA 2AJ1A 4KE5A 1RT2B 2KKHA 1S12A 4QR0A 1RWNB 4NZ7A 3OR2B 5CA5A 1LW0B 4IOCQ 1OSDA 1IBLF 1X4HA 1HPZA 2UVWA 3GJQB 5BR8F 2W2OP 4NMXA 1VRTA 1T05A 1DLOA 1HA1A 1VQPS 5A0YB 2R8GA 4PQUB 4ZPAA 3W61A 2XMWA 5GMEA 4TN2A 2XY5A 2LQJA 1B64A 1JLCB 3CJ4A 4M5IA 3FFIB 4TY9A 4USHA 3R7BB 4KTQA 4RW7A 3C66A 2WVFA 2DNKA 4QWDA 3LAMA 5H1SV 4LBPA 1K47A 3T1HF 3I55S 4C0BA 5F8JA 5HK4A 1B99A 3PKYA 3AB4B 4RNMA 2V6AA 2JVRA 5T7LB 2AJFE 4XO0A 1HARA 2DGOA 4H4OA 4JYAF 3NS7B 1MLAA 4OI4A 3UI3A 2F63A 2MQMA 3HD1A 3C6UA 3V6KA 3TX8A 2XO7A 3V81B 1FA0A 3OTCA 2DT9A 3E3XA 2ATLA 2BQRA 4ERDA 4O44B 2ZHBA 2BM1A 1S9GA 1FKOA 4AFFA 2QL7B 4LF4J 2MKSA 1LWEB 1K9MT 3TA2A 1EHWA 2VD3A 4ILRA 1NKCA 4HI1A 3R7NB 2VKZG 1K0VA 3DLJA 4HL9A 4UY8T 3BPDA 3MUMP 1NNDA 3Q8VA 1VQKS 4M5HA 1IBLJ 5A6WA 2ADBA 5HI7A 5BR8J 1B0TA 3WQPA 4NEYA 1NDKA 3SQGA 2AYBA 1GMWA 1Y5LB 4F36A 5KFUA 4RW4B 1UZDA 5AXKA 3GJSB 5E2QA 4X4VA 3QPIA 1G2EA 1T9YA 3V4MA 4J9RA 4M94A 2NLWA 4JV2A 5KFOA 1W2IA 3ZXWA 3PW5A 2R7VA 3T1HJ 4HT5A 2EFOA 2ZH3A 4RL1A 4LFCF 4NPOA 2QSFA 3MECB 4RUCA 5KFHA 5FLXY 1PG5B 5D4LA 4JYAJ 4CCHA 3TA1A 2JC0A 4OYXA 4Y28C 5M2PA 4ZVHA 2HS0A 3V6DA 3O8WA 3PV8A 1RT7A 4KGMA 2CNLB 2ZEJA 3QBCA 3FGVA 4CTAB 3NMRA 5D0EA 3PRBA 1A0OB 4IFVA 4CNZA 2HBRB 2XSFA 2XS5A 3QLHB 3TW0A 1XNRF 1WTBA 1Y7PA 2UUAF 1WI8A 3DLKA 2FZCB 3D3BJ 3QAEA 2OPQA 2ZC3A 4H4MB 4QWCA 2XTJP 1FRXA 4NCAA 3DM2B 1B3TA 2BJEA 2ZM6F 4IG3A 2MY7A 3US5A 3VALA 4OJ3A 2MKHA 2W7AA 2GVDB 1WC6A 2R3VA 2F7VA 3CJ2A 1RT5A 4F4XA 4LR7A 3SIPB 2W9CB 4NLGA 2OPPA 2E5IA 1Q8LA 4ID5B 3FMWA 3ONQA 3HSJA 2IFXA 4UF4A 3BBBA 2MQOA 3LANA 1F9HA 1NJYA 4I2QA 4ICLA 4YB6A 4LVOP 5DG7A 2AWZA 2UXBF 3PTWA 4UOHA 1Q8KA 2IHR1 2U1AA 1ZPWX 4LIWA 1S0VA 1HWJA 4FNIA 3W60A 1RGVA 1RP5A 3GFHA 2G2OA 3EICA 2HHWA 4I1TA 4OQJA 3CIZA 1S0MA 4LFCJ 3DGPB 2KH9A 2BOPA 2W2MP 3FSXA 4N56A 1TKXB 3QT7A 3MUVP 1JJ4A 4KR0B 1O5JA 1AUDA 1IQZA 2J0XA 3CCES 2PA3A 4M63A 1S97A 3BR8A 3M2RA 3TAMA 3NEKA 2X1AA 1XNQF 1RDRA 5HATA 3GCWP 2L08A 2UUAJ 3PO4A 3UFCX 4I6YA 1ZTTA 2C2ZB 2P2CB 3KLIB 3PDNA 2ZM6J 4ZLJA 3MR2A 1RHMB 3HVTA 2GVZB 4M5DA 4BHQA 2Q66A 1JLQA 4W4MA 4ZPBA 3TJAA 2YH1A 2O01C 3BH6B 1RT1A 2YWWA 3TQEA 5AE3A 2HPUA 4CO2A 2DJWA 4C9DA 2HK3A 5HROA 3UDCA 3A3NB 4CLPA 1CLFA 4U67Q 3L95X 5F3TA 2RHSB 3U1LA 3F44A 2CQCA 4URSA 5F3ZA 1A9NB 2UXBJ 5IQ6A 3MDFA 2YWKA 4Y3CA 3H4BA 1N36F 4OV1A 5DETA 1FDDA 4OZ0A 2ACMA 4FYXB 1RWXB 1U0HA 1KSPA 3J7ZT 2JJ4D 3TUJC 6FD1A 1W25A 1RAHB 1IWAA 3HJFA 3UCZP 2H5JB 1NO8A 1RT4B 4MK8A 2G0JA 3VZHA 3PW2A 3E2EA 3M8PB 3FK4A 1OQ6A 2VDIA 3LP0A 1UZHA 4C11A 4J9LA 1XNQJ 3Q22A 4TYAA 3P96A 2MZTA 3EZ5A 4B3RF 1B0PA
chains in the Genus database with same CATH topology
3N9UC 1VQNS 1IQTA 3G8SA 3HVTB 4M5DB 4IOBA 5F9NA 1TAQA 2WBRA 4IDKA 3W2WB 4A8OA 3I5CA 3CCSS 2IBKA 5JUMA 3POTB 3BF4A 2GIQA 2KRRA 3W2VB 1LW2A 4NLQA 4K4YA 1U2FA 1H38A 4KB7A 3T1AA 4IQXA 1HI1A 3BSNA 1SB6A 4P2SA 1WF0A 3FQKA 1XK8A 4GMKA 3SYZA 4QCLA 2HFNA 3VAGA 4JUZA 4PG4A 1IBMF 1WACA 1X7VA 4LSLB 4NA2A 1RT1B 5LSRA 4LMZA 1CG2A 2FC9A 4MFBB 2IRYA 1WELA 4FVCA 4B9LA 4JOUA 4K5SA 4LIRA 1N56A 1HNWF 2YQ3A 2LEBA 3D1OA 5F0UA 3LGMA 5T41A 4DOZA 2HW3A 5AE1A 2FVQA 5HROB 2APOA 4EUVA 3T1YF 4C97A 3AQPA 3GIIA 4FZVA 2WSFC 3MD1A 4OJGA 3CC2S 4EZ9A 2IYGA 2MSTA 2V2KA 5KTQA 5D6GA 4G1QA 3DRYA 2CPHA 1S6PA 4YB1P 4X4TA 2WB4A 3HKZD 4B3OA 5KFDA 5KFIA 4A8SA 4E8UA 2CJKA 2GA7A 2L9WA 1S10A 4WFAQ 5GMKa 4KIAA 2CJBA 4V19J 4DEZA 1OPZA 3MR6A 5K8MA 1H2TZ 4L6V3 1D9AA 2X3GA 3GR1A 2EWHA 3CCQS 3Q23A 2DB1A 1WG5A 2RSQA 2V0NA 3E01B 5D4NA 4ECRA 3V4IA 4B3MF 1FCAA 2LLZA 2PSZA 4ECQA 5HMWA 2LQBA 2ZH4A 1RT6B 2A1BA 4N47A 1N5YA 3PIPQ 1HWKA 2B6AA 3LO3A 4WYLA 4B3TF 4O3NA 4G1PA 1RQ0A 1UKUA 3KWMA 4QWAA 2IVFB 3KK1A 1HWUA 3I0RB 2LEAA 2O5DA 1FKPB 2V9KA 3OFHA 3OFGA 3THPA 3ZZZA 3CMAS 2P9EA 3CVKA 1LWCB 5G4DA 3NRBA 3RAXA 3Q0AA 4RW4A 1RA7A 4PXEA 4DN0A 4QYRA 2XS2A 3CIMA 5ITHA 2DHAA 4BWMA 2MKIA 5L1JA 4MKBA 1J5OB 2LU2A 1DQ8A 1E6VA 2MSSA 5FDLA 4HVZA 1TKDA 4NYOA 3DLBA 2YWGA 2O3DA 4O4GB 5B08A 2KB2A 5F8IA 5L1KA 1SH2A 4URQU 2L48A 2EFNA 2QRRA 2ZDOA 5KFBA 2NREA 5H9FJ 1UVJA 1KLNA 2AJQA 4LFBF 5HLFA 3M2UA 3OR1B 2KN4A 3KLHA 4FXVA 3FVYA 1TQLA 1F9FA 1ROFA 1YRXA 2M2BA 3HF5A 3RYLA 3TARA 1KNZA 3NNAA 3U27A 4DSKA 3UD4P 5CYMB 4ZPCA 3LP0B 5I42A 5C5JA 3OTDA 3M4XA 3N28A 1C0TB 3FCHA 4DJBA 2RU3A 2FVRA 4C11B 2D9OA 1XEZA 3QGIA 4CO5A 2BR0A 4JI1F 1YRUA 4NLOA 3VAHA 1XC9A 2YWEA 2C3PA 2OO4A 5LJ3Y 1TKTA 3TI0A 4ZVEA 4CH7A 4YY3F 3GG1A 2FC8A 4YMEA 2DNZA 2AYMA 4QIVA 2UXDF 5DQIA 4EYIB 2PT0A 2GO8A 3S8SA 5JVHQ 4LJMA 4PUOA 4IDKB 1AXQA 4DLGA 1URNA 4GKJF 1GNKA 1S1TA 2XULA 1K1SA 3BN7A 4B9NA 4DV2F 2LXFA 5KT5A 1LW2B 2RS2A 2OPRA 1S1UA 2DR9A 2ZZNA 1Z2ZA 3M9NB 2J6TA 1EP4B 4M8LA 2W4CA 5GAEI 1RT3A 1QAXA 4IR9A 2BXJA 5J2NB 4X62F 2JL9A 2ERRA 3MCSA 3OL6A 2QA1A 4DV0F