4WXOA

Sadc (300-487) from pseudomonas aeruginosa pao1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
182
structure length
182
Chain Sequence
b'RYALQAHQDTLRGMMRQLEDLVATDELTGLFNRRHFMRMASRALEDLLPNRQHGLALIDLDHFKRINDRHGHAAGDRVLQTFAAVARSCLRDGDVLARYGGEEFVLLLPHADAEQLESCCERLRLAFQQAEPVGVTVDTLSLSVGMTLLYADDDLDEALQRADQALYRAKRGGRNRCDATWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein
molecule tags Transferase
source organism Pseudomonas aeruginosa pao1
publication title Crystal structure of SadC (300-487) from Pseudomonas aeruginosa PAO1
rcsb
total genus 53
structure length 182
sequence length 182
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wxoA00
5F8HA 1I6JA 4ZVEA 5KG6A 3V6JA 3CDEA 2GIQA 1EP4B 4LQ3A 3DRRA 3NBPA 1N56A 1FKPB 4KHRA 4WFXA 5C25B 1BQNA 3KLVA 2BANB 4KKOB 4IKAA 4I2PB 1RT2A 3DRPA 5F9NA 3M8QB 5HROB 5D3GA 3RAXA 3QIPB 1HNVA 3MFHA 3PW7A 4O3RA 1RYRA 4J9MA 5KG1A 3IS9A 4Y2CA 4F4ZA 3C6TA 3QGIA 4KSEB 1LWEA 4DL6A 1TKTB 4NCGA 2XC9A 4DL2A 3E01A 1JLGB 3KNAA 2HNYA 2R2RA 3PZPA 2BANA 4KKOA 2V4QA 5L1IA 2YNGA 4MKBA 2FVPA 4H4OA 1N6QB 4M95A 4JUZA 4JV2A 3NBPB 1S1VA 4O4RA 2AU0A 1RT6A 2OH2A 4PWDB 4YR2A 2DPIA 2I1RA 3TAMA 3KK1A 5HBMB 3BSCA 3ISND 4RW6A 5DGAA 2HAIA 3N6LA 1VRTA 4LSNA 4LQ9A 1S4FA 4O3PA 3G6YA 2ATLA 2BRKA 2HNZA 5KFAA 1HQUA 4Q43A 4RUAA 3BSAA 3BQ1A 2AGOA 1FKPA 3IGNA 4I7FB 4IRCA 2YKNA 4KV8A 1J5OB 2XI3A 3Q8PB 5KFEA 1U09A 1ZTTA 2FLPA 3MR2A 3V6HA 1ZTWA 4URQU 2FVSA 2C28A 1KLMA 3SI8A 4RW8B 3JSMA 2IA6A 1VRUB 3SFGA 4NLDA 5KT4A 1TV6A 4NRUA 3GIJA 4ZP8A 2O5DA 3EZUA 2D3UA 1JLCA 4QPXA 5L9XA 4RW6B 4WXWA 1HARA 3T5JA 1JLAB 4QWEA 1C1CA 3PHEA 5KFPA 4TLRA 4YP3A 2E9ZA 1SH0A 2IM2A 5KG3A 4RNHA 4EYIB 2JLEA 3QLHA 3KHLA 1T05B 3PJWA 3QLHB 3TVKA 1T05A 1IM4A 1XR7A 5KT2A 3V4IA 2FJWA 4PQUA 4KV8B 1XR6A 4MK8A 1OS5A 3KLHA 1IKVB 2V9WA 1LW2A 3DLEA 3KHGA 1S0OA 3KLGB 2ASJA 1TKZA 1TV6B 3FFIB 3OLAA 3LP2B 2R8HA 5KG4A 2IM3A 1DTTA 3H5XA 4WFZA 1LWFA 1S1WB 1S1XB 1TL3A 4IG3B 4NLTA 1J5OA 3CJ5A 1IKVA 3M8PB 4XO0A 2UVUA 3UQSA 2UVWA 4ECSA 4Y3CA 4NLYA 4KB7A 5KFYA 3TQ1A 4WZMA 2IC3A 2C2EA 4KFBA 5KFOA 1JLEB 4EBCA 4RNOA 3EPGA 1DTTB 1LW0B 5DG7A 1LW0A 2XCAA 1FK9B 4ZP9A 3QYYA 5KFTA 4RUCA 2OPSB 4RZRA 1TKZB 4I2PA 4Y2AA 4F4XA 4IR1A 2I5JA 3DRPB 4IOBA 1RT1B 2VG6B 1RT3B 5J2QA 5J2NA 2W9CA 3BJYA 3V6DB 2JC1A 4K4VA 3DRRB 4PQUB 4ZP6A 3LP0A 3KLHB 2JEFA 3NGDA 4WZQA 2W9AA 2RKIA 4I2QB 3V81B 2AQ4A 4J9LA 5KFNA 2W9BA 2VG7B 2YNHA 3C6TB 5DLFA 2FVQA 1IKWA 4LSLA 2D41A 1JLAA 2V4RA 1RTDB 2W8LA 2JEGA 1S1UB 4U6PA 1ZETA 3DYAB 4MH8A 4QWCA 3DOLA 4F4WA 1RT1A 3CDWA 1HQUB 3KK2B 4RNFA 1TKXB 2C22A 1HQEA 3MEEA 4JV0A 1IKXB 3CDUA 4Q8FA 5KFBA 3TAMB 4ECZA 4R8UA 5DG8A 4J9OA 4LSLB 4ED8A 2FLNA 3H59A 4KFBB 2ASDA 1D0EA 4MK9A 1S6QB 4ED0A 4EYHB 3DRSA 3IN5A 2RKIB 1JLBA 5HP1B 2OPQA 4KHMA 3KJVB 1HQEB 1S48A 3MECA 1VRTB 3QIDA 4G1QB 5C42A 4ED3A 5HLFB 3H5SA 4NLWA 4K4UA 1N48A 2FJXA 5L1LA 1SH2A 2AX0A 5KFMA 1QUVA 4NRTA 2HWIA 5L1KA 3QIPA 1K1QA 4QW9A 2AX1A 5KFRA 4DG1A 3LP0B 1S1VB 4RNNA 2B5JB 4B3OA 4I2QA 3V81A 3QZ7A 1SV5B 4O4GA 1JLGA 5DQIA 1RTJA 3G6VA 3I5AA 3RB3A 4EEYA 4FBTA 5F8GA 3KK2A 2FJVA 1RT4B 3UR0A 5KG7A 1QE1A 3LP2A 3IS9B 1S0MA 3H40A 3PW5A 2OPPA 2IBKA 1JX4A 4U7CA 3OHAA 5HLFA 4TN2A 2W9BB 5CYMB 1RAJA 2IM0A 3HHKA 1JLFB 4G3IA 4Q8EA 1NHVA 1RTJB 4J9NA 5EWEA 3CJ0A 2W9CB 3V6DA 3DRSB 5HP1A 3KHRA 5KFLA 4DG1B 4K4TA 4TYBA 5DG9A 3D28A 2BQUA 2VG7A 4WE1A 5KT3A 3NMAA 3LAKA 3Q8SB 4PUOA 3BQ2A 4DEZA 2CKWA 3H4BA 2RDJA 5KFXA 3EPIA 2J6TA 2AWZA 2IJNA 1RT4A 3UDLA 2I5JB 1TKXA 5KFWA 5F9LA 1RTIB 3PJXA 3DOKB 3Q8RB 1BQNB 2OPQB 3GV8B 3LAMA 2YNFB 2B5JA 4RU9A 5KG5A 4B3OB 2YNHB 2JEIA 4MKAA 3JYTB 3CVKA 3H2LA 3JYTA 3CJ4A 2IC3B 5DQGA 3GIKA 1K1SA 4IFYA 3E51A 1FKOA 3ITHB 4J9SA 2IAJA 3HVWA 1QAJA 3HVAA 5FDLA 2OPRA 5J2PA 1T3NA 4H4MB 1WNEA 1D1UA 4URSA 4FS1A 5I3UB 2FLLA 3QGHA 3QO9A 4H54A 4URGA 3GV7B 4ECVA 2FVRA 4K4XA 4ZHRA 3PW4A 1EETB 5DLGA 2E9TA 3H4DA 4ECQA 5D3GB 3OL9A 4R0EA 3IG1B 4TY8B 1HPZB 3DMJA 1C0TA 1DTQA 3DI6A 4O3SA 4J9QA 1RT5A 4X2BA 3GIMA 1C0TB 1DTQB 2QE5A 3BGRB 3MEDB 4KO0A 4EBDA 1UWBB 5J2MB 4MFBB 2EC0A 3M8PA 2RF2B 2OPSA 4Q0BA 2HNZB 1S97A 3T5KA 4ECTA 3UPFA 1S1TB 4TQRA 3GILA 4WYLA 3Q8QB 5KFVA 2W7PA 4NLOA 4NLRA 4QWAA 4NLSA 2BQRA 3LALA 3VQSA 3MR5A 3BSNA 1MU2A 3PR4A 4IR9A 3C6UA 5KT7A 3BGRA 3MEDA 2F8EX 3NAHA 5L1JA 2JEJA 3DM2B 1UWBA 5J2MA 3PW0A 4O4GB 1GX5A 3D5MA 1TL1A 1S49A 4ECWA 4IQXA 4ED7A 2R8GA 5KT5A 5I42B 2BE2A 3CJ2A 3FQLA 5KFGA 3H5YA 1C1BB 1RTHB 2UUWA 3MEGA 4XPEA 2R8IA 1JIHA 1JKHA 3PR5B 2OPPB 1T03A 5JXSA 3NL0A 1RT2B 4TYAA 2HMIB 4ID5B 3M8QA 4H4OB 2GC8A 4IG0B 4ID5A 4WFYA 1N6QA 2WOMB 5KFJA 3DYAA 2IJFA 1RTDA 3OL6A 4Q45A 3RAQA 1HPZA 2XWYA 1T94A 2BQ3A 3KK1B 1BQMA 4EO6A 3I0SB 4TY8A 1IKWB 3CIZA 1JKHB 3SFUA 3FQKA 4IFVB 5KT6A 2CJQA 1W25A 3HKWA 3KLIA 4ZMMA 3PW2A 1QAIA 3QO9B 2R2SA 5C5JA 4F4YA 2YNGB 4F50A 4R5PB 4WXOA 3MEEB 4YMEA 2J6SA 2B43A 2YNIA 2OPRB 3NKYA 4QWBA 4J9PA 5KFZA 2ALZA 1RTIA 3IGVA 3I0RA 4J9KA 1JLQA 4ED2A 1RA7A 4ICLB 3G86A 4ZVFA 3BQ0A 4HYKA 2UUTA 2W8KA 4DL4A 2XCPA 3DI6B 5HBMA 1KLMB 1S9FA 1Z4UA 1KHVA 3KK3A 4YR3A 4PUOB 5KFCA 2IM1A 5KFSA 2BE2B 5KFIA 1S6PB 2WONB 1C1BA 3MEGB 5J1EB 5EWGA 3KMSA 1HMVA 4RW7B 3G6XA 1BQMB 5I42A 3IRXB 1RT5B 2D7SA 3H98A 3M9MB 2HNYB 4ICLA 1MU2B 2R2UA 3T19A 3CWJA 3KOAA 3C6UB 3QGGA 4IH7A 1T03B 2J6UA 2E9RX 1HYSA 4R5PA 4ZHRB 1TQLA 2ZD1B 2JC0A 4IFYB 5F8IA 4J9RA 1HNVB 1RT6B 1TVRA 2GIRA 4IH5A 4GC7A 3V6KA 2C2RA 1QE1B 5T14A 4JV1A 4IH6A 1RTHA 2VA2A 5F8LA 4H4MA 5KFHA 5KFQA 1RYSA 3DM2A 2RDIA 5CYQA 5C24A 3I5CA 1TL1B 3OL7A 1N4LA 5F8JA 4FBUA 5C24B 5KFDA 1S6PA 2WONA 1SUQA 4RW9B 4O3NA 3MFIA 3FSIA 3I5BA 4ECUA 3M9OB 3BR9A 2ZKUA 4M94A 1LWCB 1N5YB 1C2PA 4EBEA 3H5UA 4K50A 4K4SA 4WE1B 4KBIA 4EO8A 2D3ZA 1TP7A 4ED1A 1JXLA 1HYSB 1IKYB 3HVTA 1SV5A 3OSPA 2RF2A 3N6MA 4ZVHA 3KLEA 4TQSA 4Q0BB 2WRMA 4DL3A 1JLBB 5K14A 4RW7A 2VG5B 1FKOB 3DDKA 3IG1A 3ITHA 3KJVA 3IRXA 3DMJB 1REVB 1HMVB 3LP1B 1TKTA 4NCGB 4KAIA 4IFVA 4NLVA 3DLKA 5DQHA 4TY9A 3DLGB 4ZPBA 1R0AA 2R8JA 2WB4A 2YNFA 4IDKB 1S9GA 5J2PB 4R8UB 5I3UA 3KK3B 1YVFA 1S1TA 5KFUA 5HROA 3KLEB 3RB4A 4K4ZA 4IG0A 2BRLA 2ZE2B 4NYZA 1S9EB 4GC6A 3MF5A 4NLPA 5FDLB 4IRDA 1DLOB 1GX6A 3KLFA 2DPJA 3DLGA 2XGPA 4QW8A 4ZPAA 1XR5A 5DGBA 4O44B 1EETA 3ICLA 4ZVGA 3FDSA 4I7FA 3M9NB 1C0UA 5KFKA 4WYWA 5J2NB 1IKXA 1S10A 1S9EA 2YKMB 3DOKA 2W7OA 1NHUA 3E01B 1JLQB 5CYMA 2WTFA 3OHBA 4IRKA 3OL8A 2B6AA 3FRZA 1IKYA 3HVTB 4NZ0A 2R2TA 3GIIA 4RNMA 1HNIA 3T1AA 4LSNB 4ECRA 3T5LA 3N6NA 1S6QA 3RBEA 1JLEA 2R8KA 1REVA 3LP1A 3NAIA 4YR0A 4PWDA 3MR6A 4DL7A 3MECB 1MMLA 3OSNA 3KLFB 2YKNB 2ILZA 2YKMA 4RW4B 5C25A 3RB6A 3KHHA 2AGQA 4KE5A 1RT3A 2VG6A 5J2QB 1JLFA 5EWFA 3QZ8A 2HMIA 2HNDB 4NLUA 4NLGA 3GYNA 2ZD1A 2FVCA 4Q44A 1TVRB 3PVXA 3ISNC 3T5HA 4MIAA 2BR0A 4YQWA 2B6AB 1JLCB 3DLEB 1LW2B 2V0NA 3BREA 4NLXA 3BSOA 3RB0A 2AGPA 4TXSA 4KO0B 4G1QA 5C42B 5KG2A 2XGQA 2HWHA 4MFBA 5CYQB 3GQCA 3CJ3A 1SH3A 5K14B 1C0UB 1KHWA 5KG0A 3MR3A 4DL5A 1EP4A 4O44A 1CSJA 1NNDA 4Y34A 2ILYA 1LWFB 1S1XA 1TL3B 1LWEB 4IG3A 2QV6A 3MTKA 4FS2A 3V4IB 1FK9A 1R0AB 4ZPCA 2UVVA 3I0SA 1C1CB 4ED6A 1RDRA 1DLOA 1HNIB 4ZP7A 4QWDA 3RBDA 2HNDA 2WOMA 4NLQA 3KLGA 2ZE2A 2WHOA 3DOLB 4ZPDA 4MIBA 2IAJB 1RA6A 2WCXA 2YNIB 3CO9A 4XPCA 3KMQA 4RW4A 4ECYA 1LWCA 1N5YA 3KLIB 1S1WA 4MK7A 3DLKB 4K4YA 4ECXA 2ASLA 4K4WA 3LANA 2VA3A 1SUQB 4RW9A 5KFFA 2IMWP 5F8MA 4HKQA 2C2DA 2UVRA 2XI2A 3I0RB 5EDWA 2VG5A 4OL8A 4O3OA 1RT7B 1S0NA 5JUMA 1RT7A 3GV5B 5F8NA 2WK4A 4RW8A 3JSMB 4O3QA 3OLBA 1S1UA 4IDKA 1VRUA 3FFIA 1S9GB 5J1EA 5EUHA
chains in the Genus database with same CATH superfamily
4OX9J 5F8HA 1TR0A 3V6JA 4CLWA 3CDEA 4GVLA 1GMWD 1EP4B 2P8IA 2WVFA 3CMES 3NBPA 2EEYA 1FKPB 4KHRA 3EDQB 1MROB 1ULRA 2AJQA 2BE7D 4WFXA 5C25B 4DSEA 2GAGC 2EG1A 1XTZA 1OPIA 1VOMA 4LREA 3EVWA 4F02A 2V8HA 5F9NA 2HHSA 1CPZA 2Z2YB 3BDPA 1EX8A 2LEPA 2QLXA 2V69A 3MFHA 4AXIA 3PW7A 4O3RA 1HD0A 3MI7X 1NSPA 2R7UA 3PIOQ 1RQ0A 4J9MA 4FDFA 2CG8A 3IS9A 1F9FA 1MG7A 2L9DA 2R7QA 3C6TA 3MPUB 1D9AA 4USUA 2C2OB 4M5DB 3OTOF 3RJMB 2A1BA 2HNYA 4MMOA 3K5OA 3PZPA 3ENAA 1E6VB 3A8JA 5BXIA 3AD9C 3R6GB 1MN9A 2XULA 3MUMP 5HSPA 5C2GA 1PC4A 1R0CB 1JK9B 2LQ5A 4BLGA 2Q66A 5A8RA 1NK0A 4YR2A 3TAMA 3VWSA 1U0SA 2KJWA 3NWGA 4MYTA 1HBUA 4EFAC 2RQCA 2ATLA 3M2VA 1TFYA 2XG8A 1NK4A 4W4MA 1RISA 4NA2A 1EIYB 4ELTA 4Q43A 2HHVA 4K5RA 4PG5A 4RUAA 6FD1A 2ROEA 4Z7CA 3EYZA 3BQ1A 1ZA2B 4QIFA 2GVDB 2HHUA 4I7FB 4CDIA 2HRUA 4G65A 4OZLA 3X3UA 2LXUA 4DX7A 2XI3A 2E7XA 5KFEA 4F4KA 1TMJA 4IOAQ 5IC4B 5SZTA 2O1PA 3PX4A 3J81U 5ETKA 1X9MA 1URNA 2HFOA 2E1CA 4R25A 1WI6A 1OYDA 2LVWA 3SFGA 4CTAA 3F41A 3GIJA 3BYPA 4GKJJ 4M5KA 3MHYA 2M8DB 4ZP8A 4UOHA 3EZUA 4CO0A 3OJSA 2J0QD 3CJRA 3BR8A 1JLCA 2HQGA 4I0WA 2ZVIA 1HARA 1RWXB 3T5JA 1JLAB 1FD2A 2XZWA 4ITSA 3ZTRA 1C1CA 4QYZJ 1WF0A 4QJVA 1YIJS 2E9ZA 5B0GA 3HVRA 4EYIB 3QWPA 2XNQA 3KHLA 3QLHB 1HBNB 5D0EA 1Q1KA 1I94J 4LFCJ 2VFUA 4QIGA 1AFIA 2NLWA 2YX7A 1XR6A 2Z2ZA 4HHJA 1OS5A 3VR1A 1S12A 4V19X 2G9OA 1F5BA 2CJXB 1VLOA 4CIOA 1IN0A 1FKAF 1S0OA 3KLGB 5IV3A 3JSYA 1UFLA 2RUGA 5KG4A 2CPIA 1CJKB 1GFWB 3H5XA 4NI2B 4IG3B 1S1WB 3I6PA 4NLTA 1YRUA 2ZH6A 1J5OA 2GW8A 1IJFB 1KONA 2XMMA 4XO0A 1HWKA 2UVUA 3RYLA 3Q8UA 4ECSA 3D6FB 3I9V9 4DZ6A 4DLEA 2FHOB 4KB7A 4YUDA 2VQEJ 3W1YC 2PDAA 3DLHA 4WZMA 2C2EA 1CJTB 5CABA 1JLEB 2COLA 5BYSA 1FFSB 1WC6A 3HFKA 4Q2MA 5K20B 1DTTB 3EPGA 2R7SA 4ZCIA 2QTWA 3OTDA 2EFVA 5DG7A 3TANA 4C11B 2RH3A 2IBOA 1FK9B 3A3PB 2CPEA 2J7WA 3QYYA 4I6YA 4ZP9A 5M2PA 2NR0A 4USKA 4OX9F 4J37A 1KQFB 2I5JA 1PO6A 4IR1A 1RT1B 2D69A 5J2QA 1B7FA 2GHVC 3CMAS 4N47A 1C4CA 1EQMA 2BUNA 4X62F 2W9CA 1NSAA 3TZWA 1VHFA 3BJYA 5J2NA 4ZP6A 4K4VA 3KLHB 4PQUB 3TW0A 5DDPC 4CT9A 1Q5VA 2M0GB 2V9KA 2W9BA 1NRKA 1PJ7A 1GMVA 2MZJA 2VBYA 2YKAA 3TZXA 1DAXA 3QT6A 1WG5A 4LSLA 1KVJA 2V4RA 1FJCA 1OY9A 2DNGA 2W8LA 2JEGA 4U6PA 1XERA 2I38A 4E2FB 3AJ1A 4FNIA 2ZH8A 1HBMA 4YEAA 1HQUB 2CPXA 3SBMA 4RNFA 2FGCA 1UETA 2NREA 3MEEA 4UTGA 4ZKAA 2XYHB 4FXVA 5ETLA 2L41A 4GMKA 4X84A 2KZMA 5KFBA 4YY3J 3OVBA 4PXBA 1UAWA 4A8YA 5E3PA 2H3EB 1E6YA 3H59A 4KFBB 2CQPA 2OAUA 1D0EA 4ED0A 1VDHA 5E5NA 2ZH7A 2RKIB 3B78A 1EARA 2KXNB 6AT1B 4LFAF 2IY5B 1KVIA 2MSSA 2CWXA 3PCOB 1X5SA 3M6VA 1HW8A 4G1QB 4F3QA 1HNZF 3H5SA 2YX4A 2FJXA 4NCBA 3RR8A 1SH2A 2AX0A 2DHAA 4FVMA 2MKKA 1YTYA 1QUVA 4ZIWA 4DS5A 3D0HE 2HHQA 3QIPA 3VAIA 5GADU 4QW9A 1VRQC 2Z0GA 1YHQS 4PXDA 5KFRA 3TNVA 5J1NA 4P74A 1IBKF 4RNNA 1GXTA 2BJDA 2CPJA 1JXEA 4OJHA 4UUXA 4DPYA 3HXMA 3V81A 4LMZA 2OSRA 1LNQA 5LMUF 2CWKA 1RWPB 5I3PA 2MGZA 2W4CA 5DQIA 2FPHX 2QLJB 3K5LA 1VQKS 3R2DJ 3KJFB 2JWNA 1HL6A 3MMAB 4EEYA 2KVQE 3SSRA 3HJFA 4OYZA 2FYXA 2Z56B 3BYRA 2PO4A 2GQ2A 1RBLA 2DIVA 2ZFHA 3IO1A 3NGTA 1KN6A 2BZ2A 1FE4A 2W9BB 4E8UA 1NEEA 2VH7A 1RAJA 4CM0A 5D8HB 2H65B 2W24A 2XBPA 2PMZD 4DPOA 1HI0P 2CPYA 4C8ZA 1FJEB 3CJ0A 4WK3A 2W9CB 3P6YC 2DHXA 4K4TA 1HA1A 2ASYA 3F0NA 1M0SA 4CH7A 3D28A 4OZ3A 3W9HA 3PTWA 3HD1A 4WE1A 5KT3A 1NJYA 3W2VB 3OT9A 3CCVS 4QR0A 3Q8SB 3Q8YA 1F9EB 3BQ2A 1UPPA 3HSZA 3NGRA 4L75A 4RWXA 3H4BA 1H3DA 3MD3A 3EPIA 2AWZA 2RDJA 2J6TA 1FRIA 2XS2A 4WU3A 3TX0A 1N52B 2ALYB 2I5JB 4B9MA 5F9LA 1SPBP 3AB2B 4KH1B 5IC6B 1ZAVA 1P1TA 3PJXA 3DOKB 3MEKA 4AT1B 3ZZ0A 3NP5A 1PCAA 4B9NA 2NSCA 2PE8A 2HFSA 2H4YB 4ID8A 2JEIA 1Z1ZA 2DGQA 4DSIA 3JYTB 1FI4A 2H5IB 3LTOA 4QIEA 3CJ4A 1O5JA 5CQGA 2MQLA 1FKOA 1OSDA 5BR8J 2V8PA 2ZDOA 4J9SA 2A3JA 3HVWA 9RUBA 5L39A 4A8WA 1UA0A 5T7LB 4J9UE 4RO0A 4UZCA 1T3NA 1AZSB 2LEAA 4NE9C 4NI2A 3IFEA 4U95A 2XMAA 4URSA 1D1UA 1WC1A 2HS4A 3QO9A 2Y1RI 2Q6BA 2Z8QA 3K7RA 3R6LB 1RTZA 4K4XA 4P72A 4CNZA 3PW4A 2L48A 1FTCA 2E9TA 3H4DA 1ZPVA 1PC5A 3JAMY 5B0CA 5E41A 1LWXA 2AJ4A 3OVSA 3VAFA 1M5KC 4TY8B 3DMJA 1DTQA 2ZBIA 3DI6A 3IP0A 4CLFA 4O3SA 4X2BA 1VIXA 1GXLA 2QE5A 3ENVA 3Q2SC 4KC5A 1LV5A 3FBEA 2P2CB 5J2MB 4MFBB 5LSRA 4DF8A 2EC0A 2HNZB 2ZM6F 4NYPA 3IC1A 2QYCA 3BGOP 1HNXF 3AQPA 1H2VZ 3M7VA 4NMXA 4B17A 3DRYA 1DJ0A 2EFOA 2W2QP 3M6WA 3R5AA 2LCWA 4S0MA 2BE9B 4C8MA 4DDFA 1XC9A 1SIWB 3HSJA 3PR4A 3O5TB 1N8RT 5KT7A 3BGRA 2DXFA 2EXUA 3MEDA 4ZLPA 1WWHA 3DM2B 5L1JA 5J2MA 2CJKA 2XEXA 3D5MA 4O4GB 1SJQA 3QWUA 4ETZA 4DR6F 2R8GA 3NNCA 3H5YA 2QMXA 4OHXA 3CD7A 5D4PA 1HNWJ 4XPEA 1RTHB 4OYWA 3M30B 2VPYB 2PMWA 2R8IA 1JKHA 3NY0A 3ZTPA 4P2XA 2OPPB 4M5JA 4X64F 2UXCJ 4EU0A 4RBVA 1KKHA 1F2GA 2ABYA 4TYAA 4Q5VA 3QSYB 3M8QA 1EKSA 1VQSA 1RHJB 3PNIA 1VFJA 4IG0B 2WOMB 4OYPA 4RBTA 1RAEB 2IJFA 5B0EA 1NK8A 5HO4A 2G0CA 3HZEA 3QMQA 4ZVQB 5ETOA 4JI8F 4Q45A 1TK5A 2UUAF 1T94A 1P9QC 3TOQA 2KXFA 1SL1A 4PPDA 3SFUA 3R7NB 4A8QA 4IFVB 5KT6A 3CXCR 1W25A 4M5HA 3AD8C 1U26A 1RWMB 4ANCA 1Q7YT 3DXBA 6FDRA 3DGPB 3NCPA 3UD5A 4ZLJA 3OFGA 1PKUA 5LMNF 2VUGA 1CQNA 2HQ3A 2HVZA 2J5AA 3HPOA 2J6SA 2JNJA 4J91A 2OPRB 4L3NA 4QWBA 1L3SA 4JI8J 4J9KA 4ED2A 5HJXA 1JLQA 4ZPVR 1R8BA 3PXGa 2W2OP 3G86A 1G7CB 4LVOP 4ZVFA 2CQIA 3UCUP 1U6BA 2XLKA 1CJUB 3OUYA 2HIYA 2QLFB 1KHVA 1FWLA 2UXCF 4WK1A 4YR3A 5FJ4A 4B9TA 2ZBQA 3A3OB 1YWXA 2MKYA 4LRAA 5J1EB 1S6PB 2KHCA 3D6MB 4DXLA 2M2BA 5EWGA 1AT1B 3CW2C 3CCJS 1J2VA 1R6VA 2E44A 2B9XA 3FMWA 3NS7B 1N0UA 2D7SA 4PR6A 3M9MB 4JI7F 2X1FA 3TUZC 1MROA 3EICA 4ICLA 1TU0B 2RRBA 4NOHA 4WFBQ 2RU9A 3CWJA 3BH6B 2EPIA 2RILA 3QGGA 2BXJA 1N0VC 3M2RB 1T03B 4JI3F 4R5PA 5G0RA 5AE3A 2FD2A 1DURA 4GVBA 3L7OA 1SC4B 1S7HA 2JC0A 1SJRA 1HNVB 1RT6B 1TVRA 2B4PA 1T9YA 2DT9A 2XTJP 2ZBRA 3BN4A 3EDRB 4EGLA 2BJ3A 1HWLA 2A2DA 4FKXA 5AXLA 1R8PA 1RTHA 4JV1A 1HD1A 2WVDA 1WD6A 5D0HA 3MMBB 1CG2A 2BYCA 3W63A 1RAOA 2K8GA 1V5VA 3ENQA 3K5PA 3V4MA 5DS7A 3MR7A 1N4LA 2P9GA 4HACB 1YI2S 4LF5F 1CVJA 2CQCA 2QFJA 3KJQB 3RRKA 3M9OB 4DX8H 1WDTA 3KUEA 1I1GA 3CCUS 1C2PA 4TU7A 4EBEA 1N5YB 1HNXJ 2F40A 4QQBA 2HEKA 2F9JA 2O01C 3ETOA 2EBGA 3P4UB 2QSFA 2GIFA 4PYAA 1JXLA 2V8GA 2DO0A 3TAPA 1UTAA 1IKYB 3OTEA 5HL7Q 3AODA 3N6MA 5ADZA 4ZVHA 1UZDA 4UT4A 3H2UB 3MZIA 2UXDJ 2WRMA 3WQPA 5GAGU 1RSCA 5DDRC 1FKOB 3IG1A 5B0BA 5FD1A 3IRXA 2VFVA 3DMJB 1SL2A 1HMVB 1UZHA 4NCGB 3BGLA 5DQHA 4UQGA 2RQ4A 2R7RA 4DPWA 1JJ4A 3DN9A 3OUYB 3SQGA 2X1AA 5K9FA 4USJC 2CQ2A 1S1TA 2PA3A 4ILLA 1RLDA 2MHNA 2ZE2B 4K59A 3G4SS 1Q86T 3DKDA 1N34J 2PD1A 3SDEA 3ENWA 3MF5A 4YN3B 5T7LA 2YWHA 2G2OA 4LRBA 4Y0FA 1DLOB 4N8OA 1OIAA 4OYBA 4PXEA 1GK8A 3KLFA 2LMIA 1V3SA 1NJZA 3DLGA 4X4RA 2K1RA 2XGPA 3VAGA 5ETPA 4C3LA 5DGBA 1RHQB 1TAQA 2LKZA 2VDIA 3GONA 3ICLA 3RR7A 4RUHA 1VGYA 3B6BA 3TR5A 4WFNQ 3DOKA 3LGMA 3MOZA 2L9WA 1Q53A 4QIWD 1R43A 1WG1A 4WU2A 5CHCB 4USMA 4DFKA 2GO8A 2IDEA 3N28A 2I9SA 2VPZB 3FRZA 1GEHA 4QZVB 3UVJA 3VGTA 4DN9A 3K5MA 4HDHA 4DV7J 3T5LA 4LSNB 2GJIA 3MM8A 2YQ3A 1S6QA 2QX0A 3OTCA 4LRFA 1MNEA 3D4JA 3NAIA 2HYIB 4ZCMA 4H4KC 5EGYA 5A6PA 2YKNB 3R97A 1RE1B 2G13A 3JTOA 4DZDA 4U67Q 3JSRA 5C25A 4C9DA 2XWXA 2FIUA 3KJNB 4QR2A 3T1HJ 2AGPA 1RT3A 2F63A 1FCAA 4CLZA 4AL5A 5EWFA 3F44A 3H20A 1NB7A 1OY6A 2HMIA 4NLUA 1U0HA 1JJCB 2DEJA 4BC7A 1U2CA 1G4CA 1QY7A 1WC3A 3PHTA 1CULA 2GNKA 1KRPA 1B7YB 1GQEA 4KH0B 1HW9A 1LW2B 1X4HA 1Q5YA 1O0PA 2V0NA 2AW0A 3DLEB 5D0RA 5JVGQ 1PILA 2B51A 3BKFA 3BPDA 2V68A 3I96A 3MMAA 1RWWB 3GMGA 4UOCA 2WSFC 5C42B 5IWAF 1C0UB 1KHWA 2CNLB 4KJIA 1WKKA 2OEMA 1NNDA 3POTB 1TL3B 1LWFB 2ZZTA 3MTKA 3R7SB 1Q8IA 2E7VA 4ZPCA 1CULB 2QC3A 4KYZA 1JNRB 1RDRA 2BOAA 4JI3J 5B0DA 2VIHA 5H9EJ 1BE4A 4ZP7A 3O1LA 3JS9A 4JV5J 3RBZA 5GADI 5EX0A 1R8CA 1YQHA 4L76A 2FTRA 1U1PA 1UA1A 1GMWA 2UUAJ 1HIYA 2MKHA 1EAYC 1WSRA 4ZPDA 1M5OC 1RA6A 1UW9A 2WCXA 2QIFA 2VASA 1TFWA 2KFYA 2ADBA 4RU2A 3HM9A 4ECYA 2OMOA 3KLIB 4MK7A 1UKUA 2CPDA 2M5YA 2BW7A 3H2VE 4RBUA 4GO7X 3VAKA 4K4WA 4ECXA 2ASLA 1H38A 2ZHBA 4GKJF 3BO4A 4HKQA 2MEWA 3W9IA 3LO3A 3US5A 4DR4J 3I0RB 2O67A 2I8EA 2VG5A 1IQTA 4OL8A 1S7IA 2EVZA 2MMYA 3ILJA 1S0NA 1DRZA 1FHTA 2YQ0A 4M8LA 1RT7A 1IWGA 3GV5B 2XNRA 4DPXA 4FP9A 4NCAA 4P10A 1VRUA 2ZWOA 3R5DA 1RABB 3WX4A 3K58A 2CJAA 1I6JA 5AT1B 3PV8A 1S77D 2GIQA 3DHXA 1NSQA 4C2MA 3DRRA 2K3KA 2NCKL 8ATCB 1N56A 1V6HA 2FJAB 2ZH5A 2HK3A 1GAOA 2UZAA 4IKAA 4EZ9A 2KB2A 3M8QB 1IR1A 2JX2A 3P8BB 3T1HF 1HR0F 3RAXA 4E98A 3CO0P 1ZOTA 2FQQB 2HVEA 2J9EA 3G2XA 4B02A 2EK6A 4QU7A 2C1EB 3R7BB 2HHTA 3D67A 3QGIA 3M30A 4LF1A 2Y1JA 4NCGA 2B7CB 3E01A 3D0IE 4L74A 3P5TL 4CO2A 4KKOA 2R2RA 4X64J 3I55S 1U48A 2D74B 3UFCX 4X65J 1DARA 1LXNA 2QA4S 4I4BA 4ZPTR 4LJMA 1IBLF 2DO4A 4M95A 4JUZA 4LBIA 3NBPB 1S1VA 2AU0A 5GAGI 1RT6A 3GWCA 1IQZA 2DPIA 3B4MA 4AQYJ 3MPVA 1QVGR 3N6LA 4PAAA 4MJKA 2FZKB 1GNKA 2W4DA 1WORA 5DO2A 3LPEA 1JWWA 2BABA 2HNZA 4DR6J 4NASA 3LF0A 3RTVA 1JQGA 1VQ9S 2MPUA 2POKA 1FRJA 4DV6F 2AGOA 3UO0A 3RRGA 2RQKA 5F0WA 3VGUA 1BQXA 5M2RA 3A8KA 1U09A 3OXGA 2M8HA 3B8HA 1WHYA 3QATA 1ZTTA 1U2RA 3G8QA 5HAOA 2FVSA 3GPAA 1MMDA 2E29A 2JLFA 1UCNA 2U1AA 3S6EA 3W62A 3JSMA 2RUSA 4DUYJ 3SI8A 2XSJA 4CWBA 2LEBA 4NLDA 1TV6A 1U6ZA 1Y3JA 3AY0A 4X4QA 3M8RA 3CUNA 1VQMS 1A6LA 3N5FA 1SJFA 2O5DA 2D3UA 5CAAA 2X7IA 4AFFA 4QPXA 4DR3F 5L9XA 4WXWA 1ZBTA 4QWEA 2RT3A 3CJTA 3O3LA 2IM2A 1R31A 4N7TA 1T05B 4DX5A 4F8RA 1T9TA 5IWAJ 1BHNA 5DDOC 2EC2A 1TK0A 2Z30B 4OJ3A 2FJWA 4IOCQ 4PQUA 5L8RC 3ZZZA 1DFDA 1SBRA 1IKVB 2VQFJ 4ED5A 4ANEA 1YSJA 3MM6A 3OQ2A 4Q2LA 4O0IA 5GAEU 4U96A 3M2VB 4P9SA 3F73A 3H42A 2QLBB 4PG7A 3TX8A 3DGPA 2N82B 3OLAA 2R8HA 5F3ZA 3UDVA 2LDIA 1N36F 1X5TA 4F0HA 3RAMA 3HULA 1S1XB 3VVUA 1X9WA 3CJ5A 3HLUA 1IKVA 4XDDA 2VBXA 3M8PB 2R7OA 3UQSA 3I87A 4Y3CA 3OTOJ 3QT7A 3ILOA 2HZCA 4KGZB 2OFGX 5KFYA 3TQ1A 3EVOA 2QZ8A 4OI4A 4G1PA 5KFOA 2MB0B 4KTQA 4EBCA 4YHHJ 3PKYA 2GQQA 2R7XA 1I94F 3K5NA 2V8DA 2DGSA 4TU9A 4RZRA 5KFTA 1HWIA 2CZVC 3CDBA 3R5JB 3R8YA 4I2PA 4CYUB 2IPOB 1FXRA 4DU7A 2V6AA 2ZEJA 2VG6B 3RG6A 2KT3A 2W1BA 4M63A 1H6KX 3V6DB 1F2HA 2JC1A 2PGCA 5HATA 4WZQA 3LP0A 3IBFB 2LA6A 4HT5A 3V81B 2AQ4A 2DR9A 5KFNA 4TU8A 2HZVA 1FJGF 1QD1A 2ATCB 1NK7A 3K89A 1JLAA 4I69A 3FRYA 1NKCA 2DNLA 3BB5A 1QTMA 2HVIA 3UR3C 1ZETA 3DLBA 1RHUB 1NLKL 2P6SA 2RMLA 3CDWA 4F4WA 1TKXB 2DH9A 3SCLE 3JAMU 3Q0AA 4DV2J 2EK1A 1IBCB 3JSBA 3PACA 2C2KB 3Q83A 3M32B 3N4WA 2N3OA 4C8KA 2V4JA 1Q7LB 2ACYA 4DV5J 3HFVA 4OX8A 2DCUB 4ECZA 5DG8A 2YQ1A 4JP8A 1VS3A 1PG5B 2YH0A 3Q86A 1KC8T 3AFGA 1S6QB 3W8GA 2BM1A 2OUGA 1H7WA 3BH7B 3EGNA 3GTYX 5B0FA 4BDPA 2PMHA 3MMBA 4U9RA 1WOOA 3J7AN 4JI1F 2HZAA 5C42A 5HLFB 5DM7Q 4K4UA 4NLWA 2ZOGA 4C3KA 1U2FA 3EZ5A 3FBFA 5L1LA 1WC5A 4DFJA 2GO9A 4CLLA 1WHVA 1GT8A 2NSBA 2HWIA 3EWGA 4NRTA 5ETVA 5G0RB 4YB1P 2J0WA 3HX9A 2UV8A 1S1VB 2DNQA 2QFIA 2MXYA 1B64A 4USWA 5D6GA 2JDJA 4MIWA 2BJEA 1U1KA 2Z2LA 2Z58B 3UCGA 2Q1LA 3G6VA 4UY8T 1SIZA 1F5AA 2KJVA 3I5AA 4CLPA 4EWTA 3OFEA 5F8GA 1M90T 2KL8A 3UR0A 3X1LB 5A76A 1RHMB 4FVCA 2KZZA 2SXLA 3FVYA 3FEXB 4FPIA 1X0FA 4LIWA 2DY9A 1S0MA 1MWZA 3PW5A 3DOMA 3RUBL 2FUG9 1RKJA 1JX4A 5AJ3J 1WTFA 1HI8A 2PEHA 4Y2KA 4ATNA 4C3MA 3QT8A 5DJBA 1S5ZA 3FCHA 2IM0A 4NXMF 4CP5A 2XHCA 3HHKA 1D3WA 3UVJB 3QAEA 4IO9Q 3HK2A 2G1HA 4G3IA 3MXHP 5EWEA 3DRSB 5HP1A 3KHRA 2C3OA 4NEYA 1WDDA 5KFLA 2UXDF 4TYBA 4C0BA 3PFOA 1OQ6A 2BQUA 2VG7A 1ZPWX 1CJKA 1NB2A 3KG4A 3KWMA 1UFKA 3JQMA 2CVEA 4KRWA 1GTHA 2CJ9A 1OO0B 5K8PA 4DSJA 5KFWA 2JZ5A 3PYEA 2EBEA 2DGVA 3M1VB 5IXUA 3Q8RB 1BQNB 1RHRB 3QNWB 3FNNA 1FNXH 4WPAA 2HRTA 2YNHB 3L7PA 3SQGB 3CCQS 1U4BA 3WC2A 3CVKA 4WWSA 5U47A 5HK4A 2NPFA 2N7YA 1UP1A 2IC3B 3P45B 2DJWA 3E51A 3ITHB 1SC1B 4D3HA 5A2QU 3D1OA 1M5SA 3D54A 2C3UA 3M8WA 5ETNA 1YZ6A 4C7QA 3G82B 1AFJA 4DWIA 4LFBJ 3G82A 2EG2A 1WNEA 1APSA 4PCQA 1ZZNA 2IIHA 4ES1A 3M4XA 3FZBA 4URGA 4ECVA 2HS0A 2BOPA 2HGNA 2G4BA 1H74A 1J27A 2IJRA 3BGFA 2AEJA 5D3GB 5GAEI 1NKBA 3G9CA 4R0EA 2GMLA 3PFEA 1HPZB 3PRDA 4J90A 2CADA 4DF4A 3HFZB 4J9QA 3GIMA 1DTQB 3GE9A 2YKPA 4KO0A 1O51A 3AAWB 1FFGB 1FEHA 2RF2B 1RWNB 4WCEQ 2D3OR 4Q0BA 1AA1B 1RGVA 3T5KA 1L3VA 1WF1A 1RK8A 3MMCB 4OFZA 3GILA 5LL6d 3KYLA 2W7PA 1UEVA 4P7TA 1BC6A 2KG0A 4DR2J 1RBAA 2BQRA 2Q3PA 3VQSA 3MR5A 2OHDA 1HHTP 2B7BB 1MSWD 2LXIA 2F1FA 5HQLA 2BKNA 2F8EX 4QOTA 1UWBA 2V63A 2JRSA 3C15A 5E7OB 5A0YA 4IQXA 1PSDA 1IM6A 1Y5IB 2IVFB 4ED7A 5EX3A 5KT5A 4DPTA 3CJ2A 4P7VA 5GMEA 3H0PA 4M5MA 3SSQA 1JIHA 3CDAA 4C11A 1KS2A 3R27A 3DOMB 4KPCA 2AYGA 3L09A 3O8WA 2HQIA 2DNHA 1YBTA 5JXSA 4ZITA 2M52A 4QR1A 3AJ2A 2KT2A 4A8XA 3TZZA 1RT2B 3TARA 4LF7J 3JXOA 3GZ7A 2JFDA 4H4OB 2GC8A 1N6QA 3T6JA 1RP5A 3ZTQA 4WFAQ 2CPHA 1X9SA 2Y8YA 1HPZA 1FRHA 2C3PA 2ZDPA 4OHZA 3KK1B 1GMUA 3MM5B 3CIZA 4WTOB 3PO4A 2EKYA 2K7JA 2X51A 3EE3A 3FQKA 3GJQB 2CJQA 3R5CA 3HKWA 3KLIA 2KHDA 2OMLA 3WZ0A 2OSQA 3PW2A 1QAIA 4E0DA 2MLYA 3AJDA 2YWGA 3W3SA 4CZCA 4YMEA 3NKYA 2I6WA 4Y2MA 1FE0A 1RTIA 2IMOA 5F41A 4CO1A 4MKYA 3BQ0A 4CO5A 1JJHA 4DL4A 2W8KA 1SL0A 5KAKA 5KOXA 3DI6B 4IQMA 4EMDA 2XCPA 5HBMA 2J9DE 4AUKA 3CC2S 2ZITA 4NWBA 4OZNA 3MUTP 4PUOB 3OPKA 4NXMJ 3ZZPA 1F9HA 5KFIA 3KMSA 1YK9A 1HMVA 2HFNA 1OSCA 2HSEB 3IRXB 3SXLA 4EUVA 2B9WA 2R7WA 3OXLA 1REGX 1IWAA 2R2UA 3T19A 1WUUA 1NM2A 2CQ3A 2JJ4D 2M70A 4ZPWR 1NK6A 2HHHF 2J6UA 5K8MA 1QLNA 1LQ9A 3A3NB 3PYFA 3IAM9 2E9RX 4DUYF 5DDQC 2PC6A 4JOUA 3NNHA 2MY8A 4J9RA 3LUYA 4GC7A 3V6KA 4IH5A 2C2RA 1QE1B 4ZOSA 1U1RA 4N56A 1H72C 2VA2A 1XMOF 2P9EA 3D0GE 5D4OA 1FFWB 2C2ZB 1HBOA 3J81Y 5AXKA 5IM0B 4LR7A 4X66F 1TL1B 4WBFA 1WKJA 5F8JA 5LT5A 4LR9A 4WP3A 5KFDA 2ZOFA 3M6XA 1S6PA 2J8SA 3EJMA 4RW9B 4O3NA 3TUJC 4K5SA 3CD5A 1RAIB 4YB7A 2OI2A 2KVIA 1FXLA 4QYRA 1NXIA 2QA2A 2E1MC 1LWCB 1CJUA 3C16B 2MJUA 3J7YI 2LDYA 4FF3A 4WE1B 5LM7E 2WVCA 3OR2B 5E3AA 2OD6A 3FC9A 1VQ6S 1TP7A 4ED1A 3MM6B 3PKMA 2CFXA 2HPUA 1S6UA 2FHJA 1KLNA 4XK8C 2NZ4A 5DRKA 4OLOA 4KGMA 1K0TA 3EVMA 1JLBB 5K14A 5A8WB 4RW7A 3BBFA 3UCZP 3WHIA 2C3YA 2ZC4A 3ZTOA 2HHPA 1S79A 3D66A 4NA1A 3RW7A 1REVB 3LP1B 3MCOA 4DBQA 1Q82T 4M5DA 1SKWA 1D8YA 4B9LA 1QAYA 1VYAA 2MQNA 3BM7A 3GFYA 4IFVA 3DLGB 2MQ8A 4NLVA 4TY9A 2WB4A 2YNFA 4IDKB 3TWZA 4DUTA 1L3KA 1WHWA 2KT5A 1VHIA 3FCVA 4OZ5A 4OYXA 4R8UB 1V3RA 5I3UA 1D9FA 1YVFA 2IVYA 4F3MA 2A2CA 1SJ1A 3HHLB 4DSFA 1TUVA 4K4ZA 3RBXA 4IG0A 5GAHU 2P5VA 1Z2ZA 4U7UD 3W9JA 3GYXB 4GC6A 4ZJOA 2WAQD 3GSIA 2XQCA 2R3VA 5DETA 1GX6A 2JH3A 2N7CA 3FBBA 3ADAC 4QW8A 4ZPAA 5B0AA 1XR5A 1Y3KA 2AV5A 3P3DA 3VGVA 4DX6A 5JMNA 2A10A 2W01A 5LJ5Y 1AXQA 5B7WA 1X8DA 4O44B 2LYVA 4C6AA 5HVGA 3FDSA 2XLIA 2E5LJ 4V19J 1WG4A 1S10A 3UI3A 4DQSA 2OELA 1S9EA 2XMKA 1VQNS 3FEZA 3LQVA 4USTA 4I1TA 3OHBA 1I51B 4IRKA 4LF7F 3C14A 3SYZA 2QLWA 4ECRA 1BLUA 2A6OA 2BJ1A 1IBMF 3RBEA 2QN6B 1CBKA 3L95X 1FX4A 1UL3A 1DHMA 5A8KA 4DV3J 4PWDA 2NXEA 4YR0A 3MR6A 4DL7A 1SQGA 2UXBF 4P71A 1AYEA 1BMQB 4Q7AA 2YKMA 5JJBA 3IBCB 3RB6A 2AGQA 2YX1A 3K2YA 2VKRA 5E3QA 2DHSA 1VQ5S 4G1IA 1HBNA 3CF5Q 3QZ8A 1FERA 4UZBA 3OJUA 3GYNA 1KVKA 4DR2F 4V1Ak 1Y11A 4Q44A 4B3RJ 2DH7A 4JI5J 4AYBD 2BR0A 2UUBJ 1CLFA 2BBEA 5D15A 3C14B 4B3MF 1JLCB 4QPTA 2CIMA 2RSQA 3A4TA 4NLXA 3RB0A 3VAHA 1PYTA 3D3BJ 1RLCL 4G1QA 4FYWB 2VOOA 1RJJA 2VBWA 2HWHA 4MFBA 5CYQB 4AXJA 4CTAB 5AE1A 3QBCA 2B9EA 3K8WA 3RW6A 1C4AA 4O44A 3NOGA 1VQ7S 1CSJA 2GV1A 4Y34A 3U1MA 1ACMB 2ILYA 1WI8A 1RB0A 3UN5A 3GIRA 4FS2A 1BY9A 2DH8A 2QV6A 2VFTA 1FK9A 1R0AB 2ZH3A 4ZHRB 2V2VA 2XYPB 1HNIB 1VJWA 1FX2A 2MZQA 3RBDA 1VQLS 4OV6A 2HNDA 4NLQA 3WBZA 1NJXA 2LFVA 3M8ZA 2J9DA 1N32J 2DTJA 3DOLB 4P6QA 3I4HX 4ZLNA 2CQGA 3CO9A 4CM2A 4XPCA 4N8NA 2AJ2A 4RW4A 2MQOA 2CVIA 5F0UA 5LSLA 3UD3P 1PAUB 4NPOA 1S1WA 2OEKA 1Q8KA 1WEZA 2XZDB 3KTQA 3PEHA 2V50A 1F3FA 3J7Z5 3LANA 4A4JA 5AXNA 1SUQB 2AF6A 2F3JA 3HCXA 2XHWA 5BJRA 5KFFA 1K8AT 2ZJQQ 2IMWP 1FRXA 1XBWA 3IMQJ 1QUPA 4XAKA 1QTNB 4ZA1A 1RT7B 2AYEA 4I68A 5JVHQ 1YJNS 1T8EA 5ITHA 5JUMA 1X4FA 5LSOA 5F8NA 3D68A 2WK4A 2DVIA 4DQPA 1T9XA 1RI7A 3JSMB 4OYMA 1T02A 3OLBA 2UUCJ 1HFEL 3OTBA 2NZCA 1UW4A 3CB4A 3R3TA 5EUHA 4ES3A 1BGXT 2R7TA 4W90B 3POTA 5KG6A 3SV4A 4JI7J 2NXJA 2OTJS 1GH8A 3NRBA 2QEXS 2Y1IA 3SCJE 2C42A 3KLVA 3TQEA 2PEBA 1FD8A 2BANB 1OMSA 4CLSA 5MLCV 1KSPA 1KWMA 3TEHB 2QO3A 5HROB 4CCHA 5D3GA 3QIPB 2A18A 2NQPA 3MAHA 2DB1A 2MZSA 3ELHA 3D2WA 1R8HA 1HHQA 3QT5A 1TKDA 3IR5B 4Y2CA 3HHDA 2RE1A 3NGUA 1UPMB 4KSEB 4F4ZA 3VQTA 1VQPS 4DL6A 2XC9A 4EZ6A 3KNAA 4UUWA 1NHKL 5HJYA 3PG9A 2VQEF 2BANA 1KTQA 1K73T 4FKYA 2YNGA 5L1IA 1WJ9A 4MKBA 2X3DA 5GVQA 2FVPA 3HHLD 1UVJA 2Q79A 4WP8A 3BKTA 1YGYA 2DRAA 5EN1A 2OO4A 4C8NA 1Q0NA 2JVOA 4WP9A 2FGOA 5AE2A 2ZBPA 3ISZA 3UNYA 3DDNA 1NJIT 4PWDB 2I1RA 5HBMB 1N33J 2ZH1A 2AP6A 3BSCA 4RW6A 5DGAA 3O2IA 3G6YA 2BKPA 3CC7S 4LQ9A 4F0KA 2ZZMA 3UWTA 2G1DA 1MN7A 2VBZA 3CEDA 3L3CA 3UDCA 1HQUA 3L9ZA 3Q89A 3BSAA 2AT1B 1XMQF 1M1HA 4IRCA 1SC3B 4DV0J 3HSGA 2YKNA 1FVSA 3QSIA 4K2JA 3Q8PB 3DFEA 2HW3A 4URQU 2KXHA 1E6YB 2HFVA 2C28A 1QSSA 2ROPA 3CGIA 2ZUAA 1IUJA 2DGOA 2VU5A 3T9ZA 2IA6A 2QGFB 3R1HA 3MM8B 5HVFA 5KT4A 4DSKA 2D9OA 2XMTA 3A8IA 2OGUA 2M88A 1Q78A 4NRUA 5BYRA 1F3VA 3SCKE 2ZUGA 1B4SA 1M1GA 4ZVSB 2CQ0A 4FNHA 4PG4A 4P75A 2VQFF 2YWEA 1NPRA 1V3ZA 2MZRA 2HHHJ 3PHEA 1NBEB 1WOPA 1X7VA 4YP3A 4A8MP 4ELUA 1H98A 2JLEA 3ET6B 1UFWA 4HVZA 1KDNA 3BF4A 3PJWA 3TVYA 3TVKA 1T05A 2DR7A 1D9DA 3VALA 1XR7A 3V4IA 1T7PA 2DIUA 4KV8B 3SQOP 5I3QA 3KLHA 1N5VA 2VFSA 4PWWA 3TA0A 2NS1B 4X4NA 3JB9k 3VAMA 3UNGC 7FD1A 4ZCLA 3DU6A 2DR6A 2VZ9A 3UN2A 1XNRF 3LGHA 3KHGA 1YJ9S 3I82A 2ASJA 1TV6B 2BEFA 4I64A 1L3UA 4W98A 3QAUA 3W8PA 3BZQA 3BBBA 5FLXU 1DTTA 1OWXA 2IYIA 2L9NA 2W2NP 2ZVSA 4YHHF 2V2QA 4B3SF 2U2FA 2L08A 4WFZA 4M5IA 1PYSB 2B3TB 5HANA 1XN9A 2UVWA 1N5SA 4G6VB 1FA0A 4NLYA 3MUVP 4JYAJ 2ZNYA 4MT1A 2YH1A 4JI5F 2E5HA 4LFBF 3FK4A 3GG1A 1UVIA 4MKVA 2GZOA 3S7RA 1LW0B 2HFUA 4DFPA 3Q23A 2HBQB 3W2WB 2E7WA 1LW0A 4HI1A 3WC0A 4YY3F 2QL9B 2F4FA 2OPSB 3N01A 2JVRA 2IA0A 4DJBA 4F2RA 2AZ1A 4F4XA 4Y2AA 2Y0SD 3DRPB 2F4VF 5D78A 3FBCA 2VF3A 4XTTA 3N79A 2CNKB 1RAFB 1B99A 2HURA 3SSSA 3V2UC 5CH7B 1N36J 2JEFA 1XQIA 3NGDA 2GVZB 4OLPA 2NPIA 4DCJB 1S6OA 1N34F 1QSYA 3PY8A 4NMLA 4F3OA 5ETRA 2G2YA 4YS2A 2YNHA 5HMZA 5DLFA 1R8AA 1IKWA 2ZOMA 4ES2A 1ZZFA 2D41A 2CJBA 4I6WA 4X4TA 4PRFA 4BC9A 2H1YA 3ZTSA 3J80Y 1S1UB 3DYAB 1YBAA 4X62J 2E1PA 4KPYA 3MCMA 3KK2B 1HR0J 2C22A 1HBMB 1HQEA 1O6XA 1VI7A 4M1KA 4Y6IA 4JV0A 3GFZA 4F04B 3CDUA 2BJ9A 3MGJA 1F60B 1A7GE 3NMRA 1S4EA 3TAMB 2DITA 5B09A 2CYYA 5DM6Q 3BV8A 3CTRA 2FB0A 3KUHA 4OZ0A 3CJSA 4HTJA 2CQ4A 2ASDA 4ZIVA 4QBUA 4MK9A 2WVEA 3UDEA 1OJ4A 4DR7J 3DRSA 5HP1B 1JLBA 4DR1F 3DNCA 4KHMA 3KJVB 1HQEB 3HT0A 1OYEA 1S48A 1KOHA 3A1YG 2O66A 3WIUA 1VRTB 1VR6A 1WEXA 2FY1A 2MTLA 2KDOA 3U27A 2HS3A 4CNYA 3M2UA 4CYUA 5LMUJ 1N48A 3MAAB 2BDPA 4AQYF 4RX6A 5E3CA 3U7JA 2HRYA 3ZZOA 4C0HA 2NXNA 4USHA 5F8IA 5L1KA 1EB0A 2AX1A 3TP2A 2E5GA 2B5JB 2H54B 4I2QA 2XLJA 1J5EF 4CH0S 3TO8A 2DNRA 3PIPQ 4LF8J 4O0NA 1HNZJ 3QZ7A 2F7VA 1JLGA 4RR5A 1P1LA 5A0YB 3NNAA 2FZGB 2E5IA 3RB3A 3W66A 2ADCA 3KK2A 3CMQA 2FJVA 1WC4A 4C8OA 4ZJQA 1O8BA 2OJ3A 2QYGA 5A6WA 3IS9B 2M9KA 3Q24A 2MLXA 1F0XA 3D1QA 1YBUA 1NUEA 2OPPA 2R42A 4U7CA 1X4DA 5KG2A 2NUHA 3BO3A 4OQJA 2E66A 5HLFA 3M2UB 5CYMB 3TJAA 3GJRB 1T9WA 1NDCA 2OFHX 1HWJA 2DYAA 1JLFB 3A8EA 5K8NA 2ZM6J 1H2UX 2ZKTA 4PG8A 2VDHA 1QM9A 2Z4PA 2MZTA 2IVMA 1SJ3P 4DG1B 1I3OB 1ZYQA 4N41A 4M5LA 5LOQA 1YRTA 3JQJA 4DR5F 4N76A 4M5NA 2XO6A 1VC5A 3DDIA 3G96A 3W5XA 3W2WA 3NMAA 3NEKA 2V4JB 3LAKA 4BWJA 4NXNJ 4DEZA 3O6QA 5E3RA 1RT4A 4OHVA 2DISA 4NZ6A 4PQAA 4RJVA 1TKXA 1OQ3A 3KG1A 3EZOA 4B08A 1IVZA 4C0OC 1Y5LB 3MM9A 2FDNA 4PYDA 2CDRB 3GV8B 3LAMA 4LF4J 4RU9A 3BDEA 4B3MJ 4B3OB 1P6TA 4IYQA 2BJ7A 1P27B 3EM1A 4GRSA 1ZM2A 1R3NA 3BEGB 3N5BA 4F36A 2KU7A 1X5PA 1WEYA 1F6TA 1K1SA 2GGPB 3C8YA 4IFYA 4HACA 5DQGA 4LF5J 3E2EA 3PYDA 2IAJA 1EZZB 2MYFA 2ZNZA 1QAJA 2VJUA 3HVAA 3HZGA 5FDLA 2OPRA 3M1VA 2KO1A 2VV5A 3K8VA 1FRLA 5KOWA 1WOSA 5J2PA 1FWPA 2CNOB 3C3LA 2N4CA 4LFAJ 5HQMA 2OIHA 1RCOB 5I3UB 4ZN3A 2FVRA 8AT1B 1WF2A 4DFMA 1UWAA 2CNNB 5DLGA 2XY7A 4CT8A 1Q16B 4ECQA 3IR7B 3OL9A 1HNWF 2WW8A 3NS6A 4X4UA 2MJNA 3TI0A 2IRUA 1YZ7A 3L7UA 3MM5A 1WTBA 4OMFG 1Y10A 1C0TA 3SMZA 4KT0C 2LU1A 5HMXA 2KH9A 4B9UA 3QGPA 2LQBA 3OXFA 1X4AA 4ED4A 2B4OA 1S97A 3QJJA 3H25A 1U1OA 2UU9J 3UPFA 2KFZA 1FDNA 1S1TB 2AKWB 2B8QA 2MKJA 2QG9B 4WYLA 3TJ9A 4TQRA 4WTYA 3MMCA 4YDXA 3HMJG 4NLRA 4KY3A 4QWAA 3KDNA 3W64A 3LWMA 1MU2A 2RS8A 3OR1B 2UUBF 2BM0A 4P52A 2OP5A 5HMYA 1X0PA 5AXMA 1HBOB 4ZN1A 3PW0A 2D3O1 2LLZA 1GX5A 3PDNA 2EFGA 1S49A 4DV4F 4ECWA 2FHJD 4LF6F 1RAHB 2BE2A 3FQLA 2J7UA 2KN4A 3RZAA 2V5HG 2ROGA 1C1BB 3MEGA 2UUWA 4ZVOB 5KFGA 4DR7F 1Z2LA 2CPZA 4LBHA 1FF2A 1FDBA 1RXOB 3MM7A 4AL7A 2CQBA 3HJVA 3C19A 3U1LA 1KTVA 4FYXB 1HQ2A 3BGUA 3MPYA 2F4VJ 4NYOA 3NL0A 2GHPA 4K7QA 2AD9A 2DGWA 9ATCB 3EX7B 2DNNA 5KFJA 3HSDA 3DYAA 1RTDA 3RAQA 4C4WA 2VD3A 2XWYA 4ETXA 1U47A 1QJHA 1Y9OA 1BQMA 3MWBA 4EO6A 1UVLA 3EGWB 1IKWB 2KRRA 1JKHB 1F5CA 4Z37A 1BUXA 1HI1A 4UW2A 3Q22A 2PI4A 4HDGA 1OPZA 3QO9B 2GAHC 4F4YA 2HGMA 2YNGB 4F50A 4R5PB 1Y0HA 3VZHA 2J9CA 3MEEB 2E5LF 1QDUB 3BN7A 3VVTA 4J9PA 5KFZA 1DQ9A 4HH1A 3MCNA 4ICLB 4LRCA 4UF4A 5DZ7A 1N33F 2DGTA 4JI6F 3CT9A 3M05A 3TRGA 1KLMB 3KNGA 3MCSA 4DOZA 2F8HA 3AB4B 1S9FA 3CD6S 3BKUA 4N5SA 2Y1LB 2GFFA 2CPFA 2HHWA 2D9PA 2BE2B 5KFSA 2HBYB 4KHPF 3NLCA 1U1MA 3BO2A 5I42A 1BQMB 4WIIA 4ILRA 3TVZA 3U1NA 1QSLA 4B3SJ 2R4FA 3ZZUA 4NXNF 4I67A 1HLWA 2HWTA 1NKEA 4OI1A 1MU2B 2RDDA 5F3TA 3C6UB 1UEUA 2E1AA 3V5RA 1OY8A 3CJ8A 3NGKA 4X4VA 2DR8A 3CIMA 5LMNJ 4JI2J 1RAGB 5K5MA 3T6BA 3CD0A 2KRBA 4CQ1A 1CJTA 5T14A 2LECA 1NO8A 5F8LA 1IR0A 2H4WB 5KFHA 5CZXA 1TL7A 3GJTB 2RDIA 5LXYA 5CYQA 2WVBA 2FJDB 2PSZA 2QJ3A 1P9YA 2RIJA 5HQ8A 3OL7A 4Z7YA 5C24B 4FBUA 2PFFB 4GO5X 1I5OB 3DXSX 2WONA 3S01A 1SUQA 3MFIA 2RJZA 2VPXB 3I5BA 2FJBB 1TMMA 3P96A 3CULA 3AHPA 3BR9A 2GJ2A 1SC6A 1U25A 2WSEC 2ZKUA 3G8TA 3C16A 4K50A 2KYZA 2DNPA 2E5JA 5ETTA 3A12A 4YFUA 1XMOJ 1VJQA 1FWKA 2IRYA 2YBVA 4EO8A 5HMWA 1VQOS 4A47A 1HYSB 1QAXA 4LUBA 2MGZB 3OSPA 4OYAA 3HT3A 1N5TA 1U49A 2KYXA 4DL3A 1FNOA 2VFRA 1UJ6A 3KJVA 5A2QY 4YDDB 2DRDA 4ANDA 2DD8S 3I56S 1TKTA 2K7KA 3VZIA 4KAIA 4ZVPB 4XIUA 1R0AA 2R8JA 1URRA 4ZPBA 1AUDA 2ACMA 1W26A 2CQDA 2WBMA 2HKEA 3CCSS 4JI4F 4A46A 4X66J 3CCLS 1K47A 1S9GA 2BJ8A 2YPZA 5J2PB 2Y0BB 1W2IA 2KM8B 3KK3B 4PZVA 4JYAF 3PYGA 5KFUA 3LWLA 1KNZA 4LBPA 3P49B 3AA9A 3RB4A 1AB8A 1UMJA 4OI0A 2BRLA 1T9VA 3MMJA 4N77A 1NPPA 1PYOB 1NH8A 1S9EB 2CAJA 3PRVA 1PIEA 1YG0A 2DXDA 3MTJA 5FDLB 4ZJLA 2XMWA 2JSXA 4DS4A 1XNQF 3IBWA 1MLAA 3LA0A 4EI2A 2DPJA 1YITS 2FJEB 3MD1A 3KUGA 5IZHA 1CC8A 3QFHA 4WIQA 5A8KB 1FXDA 1TL5A 2V34A 4MAKA 2XYGB 4ZVGA 2DRBA 3M9NB 4I7FA 1C0UA 4WYWA 5E2QA 1U1NA 3M32A 2MQPA 5H1SV 2YKMB 3JTNA 3MM9B 2W7OA 4L72B 5BYQA 5AJ3F 3ZNUA 5CYMA 2A0FB 4NZ0A 1IKYA 2NXUA 1NCLA 3IRWP 3SV3A 2ZBCA 5M2UA 4A8FA 3I32A 3AOAA 2EFPA 3N6NA 4GVBB 2A6MA 1PJ6A 1R7IA 2QL5B 4CO4A 2R8KA 2P9CA 1REVA 3GCWP 3LP1A 3CCES 3OBIA 3DCAA 1VK3A 4DR3J 1R6YA 1Q81T 2D1CA 3C66A 1MMLA 3CJKA 4CH1A 5RUBA 3ULHA 2G0IA 2HK2A 3BBCA 2GS8A 2XZTB 2VG6A 2AIRB 1JLFA 3HHEA 1U7LA 5CD4A 1VQ8S 1LK7A 2H51B 2QRRA 4DV3F 1YJUA 5L38A 2M7SA 3HHLA 2OEJA 2ZD1A 2FVCA 3I4PA 3A13A 4RL1A 5DZ6A 1TVRB 2BKOA 3ISNC 2VL1A 1Y7PA 3PJ9A 3T5HA 2DHHA 3PVXA 2YWFA 2I2YA 5L9NA 4DQIA 2DEIA 3Q8VA 2HQCA 3BSOA 2Y9HA 4CI0B 5IM0A 1KEKA 2XGQA 1RWVB 4L6V3 3CJ3A 2L3MA 1SH3A 5K14B 5A8WA 3CCRS 2AJ0A 3MR3A 5KG0A 3QJLA 1EP4A 1ROFA 3HF5A 1RAAB 4F0MA 1YJ7A 1XMBA 2MY7A 4BHQA 3V4IB 1KQGB 1S1XA 3DU5A 2NYHA 2YKOA 2HFZA 3P5BP 2JOQA 3W61A 3KKFA 1XNRJ 5SUHA 5IS2A 4ED6A 3FCWA 4C98A 1DLOA 2LQJA 2NXCA 5CA5A 1X4BA 1ZA1B 2WOMA 3K59A 2ZE2A 2WHOA 1NJWA 1FO1A 4MIBA 2IAJB 1ZM9A 2DNKA 3FJ2A 3SCIE 4B3RF 1FDAA 1MWYA 3J7ZT 1PAEX 1V5IB 3KMQA 3TUPA 1LWCA 1M5HA 4CLYA 1KFDA 3D3CJ 1RADB 4LT6A 2GJFA 3SIPB 1B0VA 2YTCA 4NEZA 5IV4A 1YJWS 3J7YU 1TZ0A 4PPZA 1IXKA 2VA3A 4RW9A 4KQZA 3KDOA 1VMBA 1JNZB 4FXWA 2K06A 2HBRB 5HVHA 2OLWA 4LF2A 4BWMA 2H9ZA 1WC0A 1TL4A 1Y4ZB 1UVNA 2HVHA 2ZH9A 2XM3A 1N54B 2AJ1A 2MKSA 4FF1A 4CO3A 1SI9A 4TLQA 4B9VA 1S1UA 1NZ8A 2XSJB 1KR4A 3LGNA 1LOUA 3MAQA 4ZVEA 4C8YA 1H0HB 1ZAXA 2CDQA 1PJ5A 2QMWA 2GVDA 3THTA 1VBKA 4OX7A 2RHQB 1BQNA 3F56A 4HTIA 4KKOB 1Q95G 3HO1A 4ZS6A 4I2PB 4O23A 1RT2A 2RD5C 2LQ8A 3DRPA 4X65F 1SCJB 1HBUB 2HAFA 3IWNC 1HNVA 3ILLA 5ETMA 3FSYA 2V67A 3TJ8A 2AYMA 2QSWA 4ALZA 1JXVA 1RYRA 2ZHOA 5IOLA 5KG1A 3C2PA 4M5GA 1UEKA 1LWEA 2ZWPA 3AA8A 1TKTB 1AZSA 2DGUA 3GJSB 1KQKA 1JLGB 2W2PP 3W5YA 2F9DA 4DL2A 2VONA 3QRRA 4FZVA 2V4QA 3HHNB 3FEYB 3CCWA 2V2KA 2XMJA 4H4OA 1N6QB 3ZFVA 1PBUA 1TTHB 4JV2A 4O4RA 1MW7A 1U1LA 2OH2A 1R0BG 2H5JB 2GHWA 3B4DA 3EXYA 4AL6A 4OJ1A 4ER8A 2LXFA 3KK1A 1UJ5A 2RRNA 3HDSA 4PABA 3ISND 2HAIA 4LSNA 1VRTA 4O3PA 1S4FA 1XEZA 4WKYA 3I9ZA 2BRKA 1EKRA 2YVSA 5KFAA 2ZJRQ 3AH6A 3W60A 1IBKJ 3M8SA 4ERDA 1FKPA 2BMBA 3IGNA 3AD7C 2APOA 4KV8A 5H9EK 1J5OB 4JI4J 5IT9U 1Q8LA 2JFKA 4DPUA 3MR2A 3V6HA 4PXCA 1ZTWA 2FLPA 3Q2TC 3ET6A 1KLMA 4RW8B 2K1RB 5GMDA 4AD6A 3H90A 1VRUB 2DHGA 2GMJA 3E8OA 3ETMA 4B3TF 4FYVB 4TKTA 3QJPA 3GG0A 4P2SA 1NZAA 2AJFE 4RW6B 2HIQA 1VIOA 5KFPA 4TLRA 3NCRA 1SH0A 1RU2A 5KG3A 4RNHA 1B0TA 3QLHA 4YB6A 2RS2A 3HI9A 3VAJA 3D7SB 2RNEA 3WDOA 2CJYB 3ZNJ1 1IM4A 5KT2A 1X31C 2WBRA 3R1LA 1NK5A 4MK8A 1X4EA 2BX6A 1SB6A 4J5OA 5E0OA 4ZVRB 2V9WA 3CJKB 1FJ7A 4JV5F 2YKQA 4LR8A 1LW2A 3DLEA 4LRDA 3ZXWA 2P6TA 3OVAA 3GLJA 1TKZA 1FT8A 2AHOB 7FDRA 3FFIB 4X4OA 3LP2B 1Q79A 5IT4A 2IM3A 1U0HB 4HHHA 2C3MA 4HI2A 1LWFA 1TL3A 1RCXB 4RLEA 5THWA 1TUWA 2QL7B 2VODA 2VJVA 2VKZG 4OHYA 4U7UK 1AW0A 4JI2F 5L46A 4F7VA 4ZCKA 1TUGB 2YY3A 1B70B 2CQ1A 3QRPA 4OIXA 4TNOA 3AOBA 3MURP 2IC3A 2IDLA 4KFBA 2AEMA 3C46A 3OFHA 3IA0A 2F65A 3VF0B 4CLTA 4DV2F 4RNOA 2MDAA 4DMZA 3KFWX 2KI2A 3TUIC 5IQ6A 3MM7B 4K0KJ 2XCAA 1XWLA 1D8ZA 4RUCA 1TKZB 1KFSA 5CCLA 3T9NA 1GXUA 2UV8G 4IOBA 2QA4G 1RT3B 4FXDA 1CS4B 1E6VA 2DR5A 2DCLA 3DRRB 2KG1A 2VOPA 1YLXA 2RKIA 4I2QB 2W9AA 2OTLS 5J1PA 4CLUA 5MAOA 3OR1A 4J9LA 4XDCA 5B08A 2VG7B 3C6TB 4DV0F 2FVQA 2UXBJ 2CXEA 3G6ES 3T41A 4OJGA 3T1YF 3EXCX 1PGZA 2B4UA 2QA1A 4F26A 4HL9A 1VC6A 2J7KA 1VBYA 3IWLA 3MAAA 4MH8A 3G87A 3DOLA 4QWCA 1RT1A 5FLXY 5H9FJ 1LK5A 1M1KT 1FVQA 2LP4A 4DR1J 1S0VA 2H48B 1IKXB 1X4GA 3CCMS 3UE2A 4Q8FA 4Z2XA 1J5EJ 3IM8A 1Q4RA 1BWVA 1WKLA 5KTQA 2K2PA 1JB0C 2PN6A 2ZC3A 2PFDA 4R8UA 1S76D 4J9OA 4LSLB 1VLYA 3N9UC 4ED8A 2FLNA 1B0PA 2CZ4A 4NX9A 5C7PA 4B9SA 4DV4J 5CD4H 2FLOA 3R5GA 3CJQA 3IN5A 4EYHB 4DQRA 1K9MT 2OPQA 3T3FA 3FKBA 2AZ3A 4KHPJ 3TA2A 5IT0A 3MECA 4HHUA 1S59A 2VC1A 3QFWA 3QIDA 4ED3A 4GKKF 4DV7F 5F8MA 1D09B 1VQYA 2PA8D 3GFXA 1IJEB 2HQFA 2GCFA 3DGVA 5KFMA 2ZH2A 4LIRA 1K1QA 4Y2IA 1WELA 1M5VC 3IR6B 4DG1A 4FF2A 3EMTA 3LP0B 1H7XA 4JI0F 4B3OA 1U45A 3DRXA 4HEA9 4KGXB 3D1HA 1VK8A 4R0JA 3NOCA 3FSXA 5D0GA 1SV5B 4O4GA 4UQTA 4CLKA 1RTJA 3LW5C 4DN0A 5CXTA 2CQHA 2LQ9A 4FBTA 4WF9Q 1CEZA 2EFNA 4LF9F 1ITPA 1RT4B 3NWRA 2ERRA 1SKRA 2YPYA 5KG7A 1VQ4S 1QE1A 3LP2A 1NDKA 1IR2A 3H40A 2W7AA 4JI6J 1L5UA 2IBKA 2RHSB 3OHAA 4TN2A 4ZLLA 4HH0A 4OI2A 2XY5A 1S72S 2JHEA 3O44A 4KGVB 2IFXA 3K17A 4OZ2A 2RB7A 4Q8EA 1EJ7L 1NHVA 1KP6A 1RTJB 4J9NA 4FPRA 2G0JA 3V6DA 4QCLA 1YJTA 4A8SA 2HGLA 3AT1B 1W2BR 2Y3YA 1MWQA 5EHHA 5DG9A 4BCAA 2IRXA 2PI5A 2H5EA 4C8LA 4LF4F 5C2CA 2YWKA 4FN5A 1CQMA 1Q8BA 2HQDA 2CZ9A 3W5ZA 2NYIA 2CKWA 4J9VA 4PUOA 4K4SA 2YWWA 1T0TV 1TELA 5KFXA 4ZK7M 2IJNA 2Q43A 3UDLA 1JJ2R 4KIAA 2CA9A 2BACA 2DK2A 3GYGA 1TK8A 3KOAA 1RTIB 4LSZB 2HBZB 2C2NA 1RWUA 2N4DA 3TAQA 1RZMA 2OPQB 2W4PA 4K2XA 3OW2R 2YNFB 2B5JA 2AYBA 5KG5A 2DNYA 4MKAA 3OV7A 2EWHA 3B54A 3IM9A 1RUSA 3H2LA 3JYTA 2RQMA 3THPA 3GIKA 4HT7A 2MQMA 1HHSA 2V2ZA 1QVFR 2RAQA 2DNMA 3RGIA 3GFHA 2LU2A 4H4MB 1LFWA 1UJ4A 2YXLA 4PG6A 3VCDA 2ZH4A 4NZ7A 4FS1A 2FLLA 2CRLA 2EW9A 3PM9A 3QGHA 4H54A 3GV7B 1ICEB 2XY6A 4ZHRA 1EETB 1X4CA 2OKQA 4L3KA 4OX6A 2UU9F 5G4DA 4RKUC 2MHEA 5BR8F 2GVZA 2B56A 1XIQA 2V8VA 3IG1B 3HD2A 4DV1J 4D3GA 1RT5A 3RRHA 2F5GA 1C0TB 3BGRB 3MEDB 4I6AA 4P2FA 5LXRA 4EBDA 2KFNA 1UWBB 3C15B 3AXKA 3IXQA 3M8PA 3ILIA 2OPSA 2B9YA 5ETSA 2W2MP 3UW1A 8RUCA 2MKIA 2KM8C 3PX0A 1KD1T 4ECTA 4JBCA 3GU0A 2XMVA 2Z57B 4I56A 1XMQJ 2J0SD 3Q8QB 5KFVA 4OZJA 3THVA 4NLOA 4DR4F 1U8WA 4NLSA 4DI6A 2ZZNA 3LALA 3IAS9 2EKNA 4A8KA 1WHXA 4OV1A 3BSNA 2FHKA 4IR9A 3C6UA 1S57A 3NAHA 2JEJA 2GA7A 1NDPA 4OHWA 1K44A 2FC8A 1LFPA 3D9BA 2UUCF 1TL1A 1CJVA 3B82A 2RU3A 2HLUA 4ZVUB 2LA4A 1SVDA 3H7HB 4DU8A 5I42B 2ZHAA 2VPWB 4OYOA 4MYUA 3GB0A 5D4LA 4QIVA 1EQ0A 2M3DA 2JLGA 4GKKJ 3PR5B 4DV1F 3CC4S 2HHXA 3U02A 5T41A 3AXMA 4OI3A 1ZM4A 2HG4A 2XSFA 3CSKA 1T03A 3DC2A 1LEOA 2I0XA 3D6TB 4RPFA 2HMIB 4ID5B 2Y8WA 2FHMA 1BD6A 2KKHA 2VICA 3JQKA 4WFYA 4ID5A 1G3OA 2MSTA 3I31A 4LF6J 3R2CJ 4FYDA 2MKCA 1RKIA 3OL6A 1U1QA 1FESA 4DQQA 4ELVA 3CCTA 1M5PC 1X5OA 2G2ZA 2BQ3A 4PEOA 3I0SB 3FZ2A 4TY8A 1V9OA 4RUBA 2MZ1A 3PO5A 4DLGA 2OD4A 1YDLA 4ZMMA 4Y00A 4ENOA 4OI6A 4LF8F 2QMUB 3NG8A 3IWXA 5C5JA 2R2SA 2VHGA 2RRAA 4WXOA 1KQSR 2DGXA 2B43A 2YNIA 4AE5A 2ALZA 3BS9A 3MDFA 1L3TA 1RTDB 3IGVA 3I0RA 2MQQA 1XNQJ 1RA7A 1VCTA 4EK2A 4HYKA 4P2MA 2UUTA 1AROP 2IHR1 4FYYB 2C2MB 2M4MA 3W2VA 1Z4UA 3KK3A 3MOJB 2EI5A 2J8AA 3MPDA 1Y5NB 2HLTA 2VB6A 4ZDNA 5KFCA 2IM1A 2B8PA 2BV3A 2BW2A 2WONB 1C1BA 3MEGB 3GCXP 1YJVA 3LH2S 3TYTA 2XS7A 1FRMA 4RW7B 4CRJA 3G6XA 1SKSA 1NSKL 1AUSL 3N0VA 3ZZRA 1RT5B 3H98A 1TAUA 3MPWA 4KR0B 4Y65A 1TL7B 2HNYB 3G71S 4K0KF 1KOOA 1W7WA 2X3GA 3QPIA 3OR2A 4ILMA 4IH7A 1VISA 1ZH5A 3LOUA 1HYSA 3W7BA 3J7A1 1SXLA 3OFFA 2XO7A 3RU0A 2DNOA 3CNQP 1TQLA 2ZD1B 2GGPA 3QQCD 1NAQA 4IFYB 2GIRA 1T11A 4JI0J 4USVA 4IUFA 1N32F 4IH6A 4HLBA 5CZVA 4DHVA 2X1GA 3TA1A 3L4BC 4H4MA 1SJ4P 3HKZD 5KFQA 4YB5A 1RYSA 4L73A 2AMCB 2QT7A 3DM2A 1P8GA 5C24A 2JL9A 2X1BA 3I5CA 2GQCA 2NUUG 2W25A 2R9LA 4W92B 1FRKA 1T9UA 1FEEA 2DBBA 3ONQA 3PRBA 3G8SA 3DLLQ 3FSIA 1R89A 1BWEA 1DQ8A 2BVZA 4ECUA 2UVRA 1RWKB 4F2SA 2UP1A 4J7CA 4M94A 1NMEB 3EUNA 3H5UA 3FMBA 4BBYA 3EGVA 1LKZA 1NK9A 1LXJA 3AOCA 4KBIA 3DHWC 2D3ZA 3NCQA 3S8SA 4BS2A 1RWOB 3KG0A 3HVTA 3ZC4A 1SV5A 2K3IA 2MLZA 2RF2A 3PEJA 5IFMA 1DY3A 4TQSA 3KLEA 4Q0BB 5H9FK 1CJVB 1ZM3A 1U02A 2VG5B 3DDKA 3ITHA 3ZO7A 4UOFA 4RWWA 3HHLC 3M8YA 4DV6J 1RACB 1U24A 2WZ1A 4DCOB 4UY85 3DLKA 4JI1J 1G1XA 5GMKa 2RVJA 2GX8A 1FNMA 4FF4A 1A0OB 2XS5A 2XB2D 3CPWR 4WKRA 1G2EA 3TZYA 1SQFA 2E1RA 3M2RA 7AT1B 4F4AA 5HROA 3KLEB 1MMNA 4NYZA 3PX6A 3UN3A 4WJBA 2BA9A 1NDLA 2CG4A 4NLPA 1FTRA 4IRDA 1U8SA 2V94A 1DZ5A 3GP9A 3T1YJ 2WB1D 3R5BA 4NL5A 5I4MA 4DL0C 4OYIA 5K8OA 2FZCB 1N5QA 3JTPA 1IBMJ 1NPKA 3UD4P 1EETA 3EGZA 1A9NB 5KFKA 5J2NB 1IKXA 1IBLJ 4Y28C 3VHQA 1UVMA 1YKWA 5IT9Y 4PKDB 1NHUA 3WIVA 3E01B 1BXNA 1JLQB 1YRXA 4U8VA 3R9LA 2WTFA 4DUZJ 1FJGJ 3OL8A 2B6AA 2R2TA 2IYGA 3HVTB 2HVDA 1RBOB 4C97A 1SQEA 4RNMA 1HNIA 3GIIA 3T1AA 2KTQA 4ZVTB 5D77A 3GSDA 3VTIA 1JLEA 3KXDA 1ZAWA 4IO1A 3VGSA 1YJRA 2DNZA 3NGSA 4TVAB 2N3LA 2XMUA 4PWUA 5A8RB 1X60A 2FY8A 5E33A 4DR5J 3MECB 2F8MA 3OSNA 1F1BB 1GTEA 3KLFB 2ILZA 4RW4B 5ETQA 3SEOA 2PIIA 3NXZA 3KHHA 1ELOA 1XK8A 2WW4A 3M6UA 4DSLA 4NA3A 3J80U 4KE5A 3QRQA 5J2QB 2PT0A 4LVNP 3E3XA 1FDDA 4P73A 4A8OA 2HNDB 1PBAA 4NLGA 2J0XA 2DKOB 4MTPA 3LPYA 2GMHA 2B0GA 4QU6A 4USIA 3J81j 4MIAA 3S1TA 2AEFA 4K8RA 4UOGA 4F25A 4YQWA 1EHWA 4C48A 4QYZK 2B6AB 3CCZA 1HWUA 3BREA 4TXSA 4KO0B 1HKAA 3NS5A 3ZZTA 2EFQA 3GQCA 4LFCF 1YX2A 3FGVA 4DL5A 3SZ2A 1VBXA 4LQ3A 3H8YA 3AQOA 3HP6A 1ZS6A 5FIIA 1K0VA 4IG3A 1CC7A 1LWEB 5GAHI 2ZJPQ 1B3TA 1XJWB 1KBRA 4F67A 2UVVA 4KGKA 3FUYA 1C1CB 1N88A 3I0SA 4DCPB 3TEGA 1RHKB 1VC0A 4X4SA 1T3OA 4QWDA 5IQQA 1CS4A 3VV2B 4JB8B 2O3DA 3KLGA 1NH7A 4LF9J 2CUYA 3DLJA 2Q6CA 3SDEB 1DBDA 1S99A 5LJ3Y 2DY1A 2YNIB 1U6FA 4A48A 3K57A 1WSVA 5D4NA 4X4PA 1N5YA 2WSCC 4YOEA 3DLKB 1Y00A 1T95A 3W65A 5CYJA 4K4YA 4DV5F 4OZ1A 3K0JA 1RU1A 1WACA 2R7VA 1H73A 2Z2MA 1NU4A 3OD2A 4HR2A 2B4VA 3WX8A 3ZZYA 4H4KA 3GR1A 2XI2A 3CE8A 3BPSP 1H2TZ 1JMTA 2C2DA 5EDWA 2FC9A 5HN0A 1DQAA 1R27B 4O3OA 4B3TJ 3GR0A 5CCMA 4DUZF 1SKUB 1G6BA 3D6HB 4RW8A 2VC0A 4O3QA 1VBZA 4IDKA 4U8YA 3FFIA 1S9GB 5HI7A 1UVKA 5J1EA 2DXEA 2J76E
chains in the Genus database with same CATH topology
5F8HA 1TR0A 3V6JA 3CDEA 1EP4B 3CMES 4LQ3A 2AJQA 3NBPA 1AFIA 1FKPB 4KHRA 1MROB 1ULRA 4WFXA 5C25B 4DSEA 2EG1A 1XTZA 1OPIA 1VOMA 4F02A 2V8HA 5F9NA 2HHSA 1CPZA 3BDPA 2LEPA 2QLXA 3MFHA 4AXIA 3PW7A 4O3RA 1HD0A 3MI7X 2R7UA 3PIOQ 1RQ0A 4J9MA 3IS9A 1F9FA 2R7QA 2L9DA 3C6TA 1D9AA 4M5DB 3OTOF 2A1BA 2HNYA 4MMOA 3K5OA 3PZPA 1E6VB 2XULA 3MUMP 1PC4A 1JK9B 2LQ5A 2Q66A 5A8RA 1NK0A 4YR2A 3TAMA 3VWSA 2KJWA 3NWGA 4MYTA 1HBUA 4EFAC 2RQCA 2ATLA 3M2VA 1TFYA 2XG8A 1NK4A 1RISA 4NA2A 4ELTA 2HHVA 4Q43A 4K5RA 4PG5A 4RUAA 6FD1A 2ROEA 3BQ1A 4QIFA 2HHUA 4I7FB 2HRUA 4OZLA 3X3UA 2LXUA 2XI3A 2E7XA 5KFEA 4F4KA 4IOAQ 2O1PA 3PX4A 1X9MA 1URNA 2HFOA 2E1CA 4R25A 1WI6A 2LVWA 3SFGA 4CTAA 3F41A 3GIJA 2M8DB 3MHYA 4ZP8A 3EZUA 4CO0A 3OJSA 2J0QD 3BR8A 1JLCA 4I0WA 3T5JA 1HARA 1JLAB 1FD2A 2XZWA 4ITSA 4QYZJ 1C1CA 1WF0A 4QJVA 1YIJS 2E9ZA 5B0GA 3HVRA 4EYIB 3QWPA 2XNQA 3KHLA 3QLHB 1HBNB 1Q1KA 2VFUA 4QIGA 2NLWA 2YX7A 1XR6A 4HHJA 1OS5A 3VR1A 4V19X 2G9OA 1F5BA 4CIOA 1IN0A 1FKAF 1S0OA 3KLGB 3JSYA 1UFLA 2RUGA 5KG4A 2CPIA 3H5XA 4IG3B 1S1WB 3I6PA 4NLTA 1YRUA 2ZH6A 1J5OA 2GW8A 1IJFB 1KONA 2XMMA 4XO0A 1HWKA 2UVUA 3RYLA 4ECSA 3I9V9 4DLEA 2FHOB 4KB7A 4YUDA 2PDAA 3DLHA 4WZMA 2C2EA 1JLEB 2COLA 5BYSA 3HFKA 4Q2MA 3EPGA 1DTTB 2R7SA 4ZCIA 2EFVA 3OTDA 5DG7A 3TANA 4C11B 2RH3A 2IBOA 1FK9B 4I6YA 2CPEA 2J7WA 3QYYA 4ZP9A 5M2PA 2NR0A 4OX9F 4J37A 1KQFB 2I5JA 1PO6A 4IR1A 1RT1B 5J2QA 1B7FA 2GHVC 3CMAS 4N47A 1C4CA 2BUNA 4X62F 2W9CA 3BJYA 5J2NA 1RKJA 1VHFA 4K4VA 4PQUB 4ZP6A 3KLHB 3TW0A 5DDPC 4CT9A 2M0GB 2V9KA 2W9BA 1NRKA 2YKAA 2MZJA 2VBYA 1KVJA 1DAXA 1WG5A 4LSLA 2V4RA 1FJCA 2DNGA 2W8LA 2JEGA 4U6PA 1XERA 2I38A 3AJ1A 4FNIA 2ZH8A 1HBMA 4YEAA 1HQUB 2CPXA 4RNFA 2FGCA 1UETA 2NREA 3MEEA 4ZKAA 4FXVA 2L41A 4GMKA 4X84A 2KZMA 5KFBA 3OVBA 4PXBA 1UAWA 4A8YA 5E3PA 1E6YA 3H59A 4KFBB 2CQPA 2OAUA 1D0EA 4ED0A 5E5NA 2ZH7A 2RKIB 3B78A 2KXNB 4LFAF 1KVIA 2MSSA 1X5SA 3M6VA 1HW8A 4G1QB 4F3QA 1HNZF 3H5SA 2YX4A 2FJXA 4NCBA 3RR8A 1SH2A 2AX0A 2DHAA 4FVMA 2MKKA 1YTYA 1QUVA 4DS5A 3D0HE 2HHQA 3QIPA 3VAIA 5GADU 4QW9A 2Z0GA 1YHQS 4PXDA 5KFRA 3TNVA