3CJKB

Crystal structure of the adduct hah1-cd(ii)-mnk1.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
75
structure length
75
Chain Sequence
VNSVTISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGFDAVIHNIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Copper(I)-mediated protein-protein interactions result from suboptimal interaction surfaces.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport/hydrolase
molecule keywords Copper transport protein ATOX1
total genus 19
structure length 75
sequence length 75
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cjkB00
3LGMA 2K2PA 2HLTA 2ACYA 1OQ6A 4HH0A 2AW0A 1Y3KA 2IFXA 1SB6A 2N4CA 2KT2A 3BDEA 3HHLB 1VQYA 3KNGA 1IUJA 1V3ZA 3E8OA 1Q8LA 4HI2A 5B08A 2KKHA 1RJJA 1MWZA 2GA7A 3HFKA 3LGNA 2L3MA 2OFGX 3HDSA 5T7LA 2AJ0A 2AJ1A 1CC8A 1TL4A 1YJVA 3BM7A 3IWLA 4A47A 2K1RB 2HIQA 2QLWA 1FD8A 2HLUA 4HL9A 5A6PA 3HF5A 2FIUA 2BJDA 1YRXA 2OMOA 4OJHA 1Q8BA 2ZDPA 2OFHX 3KKFA 1P8GA 2QLXA 1FE0A 5K9FA 2K7KA 3CJKA 4EFAC 2GO8A 2QIFA 3HHLA 4HI1A 1KVJA 2HQIA 1KQKA 5B09A 3HX9A 1N5SA 3QGPA 2OAUA 5IXUA 2OP5A 3HHLD 1R6YA 5F0UA 2AP6A 2W4DA 1QUPA 1OSDA 2K7JA 1P6TA 2KYZA 2N4DA 2ROEA 5B0AA 4DN9A 2GFFA 3KG1A 1GXUA 2HFNA 4NPOA 3MCSA 3F44A 1SQEA 4ZA1A 5B0FA 1Y9OA 2GGPA 3GZ7A 4YDXA 2Q3PA 1YG0A 2LDIA 5A6WA 4F67A 1FESA 2XMKA 4U9RA 1VQSA 1X8DA 2LQ9A 2RU9A 1JK9B 2VH7A 1N5VA 2RILA 4QOTA 5F0WA 4DL0C 1TUVA 3K7RA 1CPZA 1FVQA 1SI9A 1ULRA 2BJEA 2BBEA 5B0BA 2VV5A 1CC7A 2ZDOA 2PGCA 3FGVA 5B0GA 2IYGA 1OPZA 3LO3A 1GXTA 4A48A 1URRA 1S6OA 3I9ZA 3TNVA 1TL5A 1TR0A 4FNIA 3UDCA 2RSQA 3BF4A 2OKQA 2QYCA 1YJRA 1YJTA 2BUNA 5B0DA 4DPOA 2FHMA 1S6UA 2JDJA 2N7YA 2ROPA 4OJ3A 1FEEA 1OQ3A 2G9OA 1FE4A 2LQBA 2K1RA 4FNHA 3TOQA 2GCFA 1TZ0A 5T7LB 4Y2MA 1W2IA 3TRGA 2ASYA 1WD6A 3FMBA 1X7VA 3BB5A 3HHLC 2EW9A 1FVSA 4Q2LA 1Q53A 1AFJA 3CJKB 4YEAA 2LXFA 4Y2IA 3QMQA 1MWYA 2XMMA 2OD6A 4ZOSA 5B0CA 1YJUA 4A4JA 3DCAA 3T9NA 3FRYA 3MZIA 4A46A 1N5QA 2HFOA 1N5TA 4Q2MA 2FB0A 2XMUA 1JWWA 3DXSX 3WDOA 2OD4A 2CRLA 1U7LA 2RMLA 1X0PA 2GV1A 4OJ1A 4OJGA 3IWXA 5KAKA 3BGUA 2ROGA 2BYCA 3BR8A 4HH1A 1LQ9A 4OIXA 1Y0HA 5B0EA 1AFIA 1K0VA 1KVIA 4NL5A 2XMTA 2FTRA 2IYIA 3KG0A 1AW0A 4Y2KA 3BN7A 2GGPB 1Y3JA 2W4CA 2XMJA 2XMVA 1APSA 2XMWA 1Q4RA 2PD1A 2W4PA 3VTIA 1XBWA 2KT3A
chains in the Genus database with same CATH superfamily
2ILYA 4C8OA 1CJVB 3PYEA 1IN0A 2OPRA 4R0JA 3NGRA 1NHKL 2BQRA 2HNZA 3BDEA 3NOCA 3UD5A 1XMOF 2UUAJ 2Q43A 3BYPA 2HQGA 4HEA9 3DLGA 5KFNA 2A6OA 3E8OA 2VJUA 1KNZA 4ECQA 1RKIA 4UQTA 3G6ES 2VIHA 2HZAA 4IR1A 3NMRA 4F3OA 1T0TV 3GJTB 3GYNA 1BWVA 3MTKA 5KFYA 5KFLA 7FDRA 3GIIA 2E5HA 3SSSA 2YNHB 4MIBA 4NLYA 1B64A 3BSOA 1FF2A 2YNFA 3DDNA 2L9DA 2XZDB 3W3SA 2C2RA 3M8RA 3P5TL 4RW7B 3CJ0A 4GKKF 3MM6A 4ITSA 2FJVA 4Q8FA 4EZ6A 4YR2A 2DTJA 4ZLLA 3HF5A 4Q44A 2DK2A 3OTOJ 4I68A 4ZITA 4QIGA 1S6PA 1V3RA 3PYDA 1U1QA 2RF2A 2IBKA 4YP3A 1AZSB 1X5PA 1WKLA 5D0HA 1N5SA 2DO0A 3FFIB 5F8MA 2RNEA 3UCZP 4ED2A 3MOZA 1R6YA 1S4EA 1PAEX 4P9SA 3DLHA 1HYSB 3HHKA 3R6LB 3POTB 2AGOA 2WOMA 2K06A 3ILLA 4NPOA 4OHWA 2CQHA 1UA0A 3KK1B 1LWFB 3BBFA 4U95A 1RT5A 2HHWA 1MSWD 3DM2B 3DLJA 3M2RB 5A6WA 1R0AA 2AEFA 3CJ8A 4LR7A 4QIEA 2GAHC 4CO2A 4Q0BA 3D0HE 4AYBD 1KHVA 2J7WA 2RILA 4EWTA 4K5SA 2R7QA 5AE1A 4F4ZA 4O44A 3UD4P 3U02A 4M5NA 4MH8A 4TYBA 2CPJA 5F8LA 2PO4A 3IS9A 3NAIA 5DQIA 3N0VA 4C0BA 3D67A 4A48A 2P9EA 2XWXA 2Y1RI 4GO7X 3BF4A 1U26A 4LF2A 1EHWA 2PI5A 3MTJA 4J9KA 3K5OA 4AQYF 1GTEA 1BXNA 1XR5A 2HWIA 4XK8C 2ZZTA 4I2QB 3AA9A 3R1HA 1NPKA 5DZ7A 3QIPB 5T7LB 3I0RA 1TFYA 3H5UA 3D0GE 4O0IA 2HVIA 1UPMB 3MM7A 1Y5IB 1P1LA 4WU2A 3M6UA 3QO9B 4Y34A 2JEJA 1T3OA 1UJ6A 5LMNJ 1GMUA 4KHMA 1FT8A 2ASDA 1D9DA 1PG5B 3K2YA 2O66A 3IRWP 1SJ3P 1QAIA 1RXOB 2GMHA 3G8QA 3SDEA 3S7RA 2ABYA 4RUCA 1YJUA 4ZP9A 3W66A 4OHXA 2LQ5A 3SCLE 3DOKB 1LFWA 3CCSS 1HKAA 4DOZA 1X9WA 1F1BB 2VONA 3AFGA 4R0EA 3PIPQ 3QZ8A 3A3PB 3NEKA 4DQIA 3DXSX 4MAKA 1SH0A 4LFBF 3QO9A 1VQNS 3FRZA 4QW8A 3DU6A 4RPFA 3GSDA 4DUZF 1B7YB 4PZVA 2A6MA 2NXNA 2XB2D 1PAUB 5CYJA 1KSPA 3M2RA 4A8FA 2QA1A 1FKPA 4NYOA 4ZVHA 2HHQA 1RAOA 2AX0A 3VTIA 2QX0A 1DTTA 3MPWA 5KFWA 3J81j 4NLTA 4J37A 2K2PA 4PXBA 4IH7A 1IKWB 1LK5A 3DHWC 1VJWA 4F0MA 1JKHA 3HVAA 4YS2A 1Y3KA 5HMYA 1RZMA 1ZM4A 2KHCA 4NLOA 4DU7A 5HSPA 4DV5F 4WK3A 4NYZA 4JI2F 2DO4A 1RHQB 1B0TA 1VHIA 3PRVA 1VQYA 2DNMA 3HVTB 4DL7A 3AAWB 4W98A 4B3SJ 4ILMA 3IG1A 2LKZA 4HI2A 2VU5A 4H4OB 2AQ4A 3QGGA 1FXLA 1CLFA 3MM7B 1NU4A 2GA7A 4I56A 3WBZA 4DR5J 2BDPA 3DDIA 1RK8A 2FC8A 2CPFA 5T7LA 5K8PA 1NDKA 4KY3A 3WZ0A 7AT1B 2DCUB 1LW0A 3OXFA 2E1AA 5IWAJ 1W25A 2VFUA 4C3KA 1HNXJ 1R8HA 3OTDA 3PVXA 1Q78A 4ZVQB 4K4ZA 3HFZB 2G1HA 1S76D 2DIVA 3DLGB 3M30B 3LAKA 1NXIA 4RW9B 2NZ4A 1UW9A 1EZZB 2OP5A 4NLVA 5CZVA 2CXEA 3T5KA 1S99A 1LKZA 4LF7J 1NK4A 1UMJA 3MEDB 4I2PA 1HWKA 4E8UA 3M9OB 1RUSA 3BYRA 3FCHA 1BC6A 1T9YA 2EFGA 2HQ3A 2DGXA 2Y8WA 4OI2A 2RS8A 1KOHA 4WCEQ 3LWMA 3IFEA 3PR5B 5L1JA 2UXBF 4DDFA 3QNWB 4IQMA 2D3ZA 1VQSA 3OJUA 1YBUA 3G8TA 3V81B 3FZBA 1D9FA 3TWZA 4ED6A 4TKTA 5ADZA 1TUVA 2HNDB 3TR5A 5KFOA 1ZTWA 1WG5A 2ZJPQ 2MZTA 1IBLJ 2EFNA 4YHHF 4QIFA 3CD0A 3R8YA 4DR1F 2Q6CA 3SYZA 2QMWA 2V2ZA 4O23A 4KHRA 4QPXA 2R8GA 1R8CA 1HARA 4UUXA 2VFTA 4MJKA 4X4VA 1ACMB 4Q0BB 2CAJA 2FHKA 2C3UA 1S49A 2RHSB 3MDFA 4XDCA 5I4MA 4P71A 1SL1A 3P45B 2NXEA 5HQ8A 3BB5A 3TVZA 3FBFA 1FVSA 1XERA 3TUJC 2M0GB 3RRKA 2HHUA 4URQU 3AB2B 4PG7A 3AOBA 4KV8B 1NSQA 4X4PA 4YR3A 3MD1A 1XNRF 4LQ3A 1IBCB 2YNIB 3CJ4A 2CJQA 4OI3A 1TL3B 2MKKA 5L9NA 1M5OC 2E5LJ 4DV7J 4W92B 3MXHP 3ELHA 2KZMA 2BABA 1RWPB 4AE5A 2B4PA 4R5PB 5EHHA 4WP9A 3WIUA 1N34F 1FO1A 3BEGB 3JTPA 4DSFA 1FFSB 1M5SA 3EM1A 2C2ZB 5A8RA 2BW7A 5IWAF 4ANEA 3QYYA 5DS7A 2AIRB 1TTHB 3SMZA 1KC8T 1D8ZA 1BY9A 3W9JA 3C3LA 4ZMMA 5AJ3J 4NLWA 2EBGA 3BR9A 1K73T 1H98A 3KJVB 2J9CA 5LOQA 5IT0A 2PMZD 3BR8A 1CULB 2AZ3A 3OT9A 5DDRC 3GTYX 5HMXA 2MGZB 4F2SA 2R7XA 2HEKA 3H5YA 2Y3YA 3OFEA 2E29A 2FTRA 3BGOP 1TL1A 2LMIA 3ZZTA 2ZJQQ 2GJIA 2RDDA 2X1GA 3SCIE 4B3RF 3TEGA 3LUYA 2JZ5A 3KLFA 3KK2A 3GG1A 2VDIA 3CEDA 1OQ6A 3DOMA 2VBWA 3QPIA 1BD6A 2X3DA 4AL6A 2CUYA 3NCPA 1RWOB 2HWHA 2A1BA 2N4CA 2MQ8A 3I31A 4USUA 5EWEA 3KMSA 5L1KA 2NCKL 3GV8B 4QYZK 4YR0A 1U1KA 3OUYA 1WHWA 3P4UB 2UVVA 1ROFA 1HPZA 3EGZA 4F36A 3B4DA 3DYAB 2G2ZA 4OYOA 1MWZA 4HYKA 1LW0B 2YX4A 4X4UA 1Z4UA 2RH3A 3QT6A 2RU3A 2JEIA 4P52A 2C3OA 4LSNB 2AD9A 3A8IA 2CWXA 1UZHA 4OI6A 2IC3B 5GAEU 2KXNB 1HHTP 2R7VA 4OYBA 2QLWA 2N3OA 1S1UB 2BE9B 1NCLA 1ZZFA 2OHDA 1OWXA 5H9FJ 2HURA 2O5DA 3R5AA 4OX7A 3K5LA 2FIUA 4JI3F 1Z2ZA 2Z58B 3M4XA 4DR7J 1X4AA 4RW9A 3BV8A 3KKFA 1P8GA 1TL3A 2EFQA 4PQUA 3PKYA 1TQLA 2K7KA 1VRTA 4KFBB 1JIHA 4M94A 3MCMA 4M95A 3ETMA 2KJVA 2ZE2A 2N4DA 3KJFB 1FXRA 4PYAA 3KG1A 5IT9Y 1IQTA 3TI0A 1SKUB 3V81A 4ZPAA 2QSFA 1SBRA 1MW7A 1SJ4P 1XTZA 4FYYB 4LVNP 5EN1A 1U49A 5FJ4A 2Q3PA 4DL6A 4IOBA 5L38A 2HHHJ 1WWHA 1FJCA 1Q8IA 2W2PP 3UN2A 1RCXB 4CQ1A 5IC4B 2DR8A 3G9CA 1OY8A 1GMWD 2E9TA 2DGVA 1U45A 2UUBJ 5F8HA 1WNEA 4PXEA 2AJ2A 2LQ8A 2BBEA 2YWHA 1TELA 4CLZA 5B0BA 2EVZA 3K8VA 3OPKA 1FDAA 4B3SF 2EFPA 1K1QA 3G82A 1FJ7A 2GQCA 3KHGA 3NNAA 1URRA 1S6QA 1DFDA 4HACB 2BJ8A 1T9UA 2FPHX 3UDVA 4JI1F 2RE1A 4UQGA 2GO9A 2P9GA 1N8RT 1G2EA 1OQ3A 2VJVA 3KFWX 4FBUA 2VQEF 3NNHA 3UDEA 1N54B 1X60A 5E3PA 1U1NA 1RT1A 4DV4F 3M32B 3C2PA 1K1SA 4N77A 2GVDB 3E3XA 3AH6A 1LK7A 3O3LA 5IV3A 2BR0A 4O4RA 3RZAA 3GFZA 3SEOA 2NXCA 4ZVFA 2WHOA 4EGLA 1KVJA 3ET6A 4RKUC 4DUYF 1N6QB 3M30A 1VHFA 2J0WA 1VC5A 4Y2IA 4UOHA 2VKZG 2AX1A 2OD6A 4I1TA 1HNWJ 1RYRA 4DSKA 2ZITA 1T9XA 5KFGA 4F0HA 4CP5A 1WC5A 1UW4A 1CBKA 1LW2B 3EVWA 1FKOA 2QLFB 3MAAA 5IQQA 3RBXA 5KG2A 1FDNA 5I42A 4NWBA 3N6LA 3TAPA 2WSCC 3ENWA 3IM8A 2BVZA 4IYQA 3KK3A 3V4IB 3TQEA 2JC1A 3D28A 4WTYA 2CJYB 3TZWA 2XS7A 2FDNA 4OIXA 2OPQB 4ZJLA 1KVIA 2I1RA 2IM3A 2J76E 3QWPA 1T8EA 4NLGA 1FI4A 2JFDA 4LBPA 3BN7A 4ILRA 5HLFA 1F0XA 3B6BA 2KU7A 2VODA 2AT1B 1FRIA 1HD0A 2RHQB 1Q4RA 3ZC4A 3KHRA 3KDOA 2BX6A 2YQ0A 4LF1A 4L6V3 3POTA 2DNRA 3PW7A 3D1OA 3JSRA 3VGVA 4PQUB 1LXNA 2CJ9A 1UFLA 1TK5A 1TFWA 3EXCX 5H9FK 2IJRA 1RU2A 3CC7S 3PG9A 4WJBA 5KFBA 3BGRA 2ZD1B 5CYQB 1XNQJ 3V2UC 3E2EA 1UVNA 3PRBA 1Q1KA 4CT8A 1T9WA 2CZ4A 1D09B 3H59A 3M8QB 4J9UE 4U7UK 1R27B 4DG1A 4XPEA 1LEOA 4URGA 2ASLA 3HVWA 1RJJA 3NGDA 4DQPA 2YY3A 1TUGB 2KRRA 3W61A 4USKA 1WEXA 2FHOB 1UTAA 3Q8RB 4A8SA 3X1LB 1QTNB 3ICLA 4C8KA 1RAJA 2ZOMA 3MAAB 1YJVA 3R5GA 1S1WA 1U1RA 1HNWF 2RQMA 4P2XA 3W64A 2DBBA 4JI4J 4OFZA 1FK9B 4IOAQ 3PYFA 4EO6A 5J2QB 1Q79A 3A8KA 3CCMS 2BJDA 4QYRA 3JAMY 1T02A 2DNZA 3BSAA 4GVLA 1FRXA 4KFBA 4XIUA 1S1TA 3RBEA 1C0UA 1S57A 1H2UX 1RTJB 2XCPA 4BS2A 1NM2A 2RAQA 5B09A 2B6AA 1B4SA 3W1YC 1YJ9S 4ECVA 4DR6F 1QUPA 2E1CA 2MLXA 2C2NA 3IBCB 3PJXA 3CCRS 1Y4ZB 3M8PA 4Z37A 1ITPA 1EARA 4CM0A 3NS7B 3IRXB 4DV6J 3K89A 1C1BA 1NMEB 4DCOB 4M5IA 1MMDA 1DHMA 3GCXP 3GIKA 3D6TB 2VF3A 5G0RB 4O3OA 1PGZA 2UUCJ 4X66J 3EDQB 3OLAA 5MAOA 2KRBA 5KFUA 2JLFA 3DDKA 1X8DA 1GMWA 3W9HA 3EYZA 4C8YA 3ENVA 4DJBA 1SJ1A 3SXLA 3TUIC 5J1EB 3Q2SC 2N3LA 2CQ2A 1B99A 2VV5A 2W1BA 3DRSA 1J5OA 2I0XA 2I5JA 5C25A 2QGFB 2CPIA 1O6XA 2F7VA 3M2UB 4M63A 4M5DA 4QR1A 3CCES 2GIQA 2ZNZA 3HD2A 2FGOA 3IR6B 2AJFE 3RAMA 2FLLA 3GILA 2QL7B 3Q23A 2HVHA 4R5PA 5B0DA 2YKOA 3ONQA 2JEFA 1MMNA 3T6JA 4NCAA 1HWJA 2M52A 3AY0A 2QG9B 2RUSA 2YVSA 3MPUB 4MMOA 2Z4PA 3QATA 4ZVGA 4N7TA 2NPIA 3HHLC 3BQ2A 3LALA 3PXGa 4CT9A 2UVUA 1ICEB 1NH8A 3RB4A 1W7WA 4UUWA 3J7ZT 2A2CA 1UWBB 1S9GA 3MEEB 4U7CA 4OX9J 1VLYA 4GRSA 2CPZA 3GFYA 1JNRB 2OSRA 1RHUB 1XMQJ 1QD1A 3HM9A 1C1CA 2MJNA 3H5XA 2PFFB 3CCTA 1N56A 2CG8A 2VASA 5K5MA 1JLEA 4QPTA 2DT9A 4H4MB 4LFBJ 3PIOQ 4E0DA 3J7A1 1HL6A 2FB0A 4M5DB 2OEKA 2DH9A 3NGSA 2H48B 5B7WA 8RUCA 2CNKB 1FERA 4NX9A 5C2GA 6AT1B 2DRDA 2JOQA 1HI1A 2CRLA 1H0HB 3KWMA 4NZ7A 2LYVA 2D7SA 1CJTB 5AE3A 5AE2A 4TQRA 1QVFR 4KT0C 4KB7A 1OSCA 5EUHA 4J91A 4QQBA 3OVAA 3KYLA 2HRUA 4LRDA 4OZNA 2GZOA 5FD1A 1RADB 4V19X 1RHMB 4RNNA 3OFHA 1REVB 3AD9C 2Y0BB 3C15B 2W9BB 2AYMA 1F6TA 2DXDA 1APSA 1GFWB 2CQIA 2HBRB 5ETSA 5HBMA 5L1IA 4L3NA 2AYBA 4NXNJ 3IAM9 3EZ5A 2KZZA 1MMLA 5JXSA 1RWWB 2CG4A 4LIWA 3U1NA 3WC0A 1JNZB 4A8OA 3TANA 2I5JB 1T94A 4LF9J 1OPIA 3T1AA 2LLZA 3BS9A 2CQPA 4CH1A 3NXZA 3EGVA 5HQMA 3HHLB 1IBMJ 2DEIA 3PV8A 3ADAC 1Q81T 2KYXA 2I9SA 2KVIA 1CQNA 3BPSP 3ISND 4GC7A 1S77D 2F4VJ 3IN5A 2NZCA 2O1PA 4J9OA 3QJJA 1NH7A 5KT2A 3NNCA 2J9DE 2XLKA 3LGNA 1HA1A 4LFAJ 5FLXU 3CF5Q 3AQPA 1SQFA 2QYGA 1NJIT 1N48A 4N41A 4ZHRA 1ZS6A 2K1RB 1X31C 2GQ2A 2XNQA 3KLGA 4HTJA 1U0SA 3CB4A 2YBVA 3G6XA 1IBKJ 5HJYA 2UUWA 2W25A 1WC6A 2I6WA 1SJRA 4TU7A 3SZ2A 4LRFA 4HI1A 2AEJA 3OJSA 2HQIA 3EXYA 3CVKA 3DRYA 4PYDA 1NKCA 1KQFB 2OAUA 5IXUA 1LNQA 4N47A 2J6UA 4B02A 4MFBA 2OPPA 1JKHB 3DI6A 2EK1A 4YB1P 1OO0B 5DJBA 1JLBA 2HFNA 2LEPA 2C3YA 2LXUA 4B3OB 2XI3A 1WF2A 4ZCIA 4LF8J 1VQKS 1Y9OA 3BGLA 4CLKA 4DL4A 1B3TA 3ITHB 3SBMA 3J7YI 2G0JA 3OR2B 4QOTA 4M5GA 4UZCA 4USIA 4OHZA 4ZN1A 1H7WA 4I2PB 1FRMA 4CLUA 2YWFA 4L73A 2BEFA 4EMDA 1D0EA 1KLNA 1L3SA 1DTQA 4JI5J 5C25B 2VG7A 4QWBA 4UOGA 5B0GA 3VGUA 4BBYA 4WF9Q 3R5DA 2E44A 4C0HA 2MLYA 4U96A 4IG3A 5KFMA 3W60A 4FDFA 4LF5F 4R25A 1DJ0A 2R8HA 4IDKA 2BUNA 3VAKA 2L9WA 5RUBA 5L9XA 2B43A 2JDJA 1QAYA 2Z30B 3CDWA 2JRSA 3MMJA 4MK9A 1RWKB 5HQLA 5L1LA 4DV2J 3DOLA 4LBHA 1NJZA 5HVGA 1S1WB 4WP3A 3HP6A 1ZPVA 2MYFA 1RTZA 1U2FA 2KG0A 1IBMF 2YWKA 2VC0A 2C1EB 2MQLA 4ES2A 2W9CB 4CYUB 2RRBA 3OSNA 4A8MP 2V8VA 3W7BA 3NG8A 2KXHA 4DPYA 3HK2A 1RTJA 2KB2A 1UAWA 2A3JA 2C3MA 3NWRA 1IXKA 1MLAA 2XCAA 2ZHAA 2X3GA 4DUYJ 3TP2A 4QWCA 3FC9A 4J5OA 4KTQA 5CCMA 3UR3C 1KBRA 3JQJA 1IKWA 2CZVC 4NEZA 5IV4A 3THVA 4RW6B 4O4GB 1X5TA 5M2PA 2FJAB 5LSOA 2XLJA 1IR1A 2PE8A 3I87A 3UNGC 3WDOA 1I3OB 4J9RA 3CMES 5ETKA 1F9EB 4RU9A 4RW8A 2OPQA 1Q7YT 3TX8A 4B3TJ 1S97A 1W26A 4P7TA 5CCLA 2OEMA 1F5BA 4L75A 1GAOA 2FVRA 1GMVA 1JLAB 4LR8A 5A2QY 3PW5A 3KNAA 4LBIA 4PKDB 4YY3J 3L3CA 1RTDA 3DM2A 2GGPB 2XMVA 3O2IA 3R5JB 1RISA 3FK4A 4WFYA 5DGAA 2WVDA 1U1MA 4O4GA 4HACA 2MY7A 1LW2A 4M5JA 2C28A 2HK3A 3T1YJ 4ATNA 3VVTA 1S10A 5CHCB 2ZE2B 1RTHB 1P9QC 1ZAWA 3FJ2A 4ECZA 1TMMA 1T05A 2IFXA 4NMLA 4CWBA 3IS9B 1FWLA 5J2PB 4DV4J 2XQCA 3CCVS 5EX0A 2W9AA 3T5JA 4NA1A 3PZPA 3FBCA 1FFWB 2RF2B 3TZYA 1VQ9S 2ZBRA 2DXFA 3TAMB 2K3KA 4M5KA 2XMAA 2E5GA 3QRQA 2KKHA 3JB9k 1F5AA 3I5CA 2ZFHA 1H73A 1K44A 2D9OA 1S1UA 1SC4B 2OH2A 1X4EA 4JUZA 1FWKA 3IAS9 4KRWA 5KFTA 4A8WA 3KLVA 1L5UA 1TL4A 5AT1B 2KVQE 1OY9A 1FTCA 2UUTA 4F3MA 4LFCJ 4ID5A 3ZTRA 2MKHA 3BN4A 1NEEA 1UFWA 3DYAA 4RL1A 3BKFA 5A6PA 3RAXA 1NLKL 2CDRB 3IWNC 3W63A 3IXQA 3NCRA 1T95A 2KDOA 3JSMA 1FA0A 1XR6A 5D4OA 3K5MA 3CJ5A 4EFAC 1CS4A 2W7PA 3D68A 1KQKA 5F3TA 4NRTA 4OYIA 4ENOA 5F8NA 4RUBA 4ZVUB 1KS2A 2OPRB 4MT1A 4RR5A 4L72B 4ZVSB 2KYZA 4WWSA 2M88A 4IFVB 2LU2A 2MTLA 3EMTA 4GVBB 3E01B 5ETMA 3I55S 3D1HA 3NP5A 5ITHA 2ZHBA 2MY8A 1D3WA 2VG6B 1RABB 2MXYA 1TL1B 5E5NA 4J9SA 4K2XA 4RBVA 1YRUA 1VCTA 3CT9A 3Q8SB 2XMKA 2YH1A 2X1FA 1KDNA 4DPWA 1S9FA 3KK1A 2MSTA 4DL3A 4G1QB 3ISNC 1WDDA 1D1UA 3RR7A 2CDQA 2MQQA 3V6JA 1N5YB 2C2MB 3VGSA 4EZ9A 1SI9A 4A8YA 3OHAA 1CC7A 4LRAA 2FY1A 2E9RX 4NLPA 3UVJB 4JI3J 2ZZMA 3TW0A 3F56A 1S6OA 2FJEB 4QW9A 2F9DA 2MHEA 2NPFA 2BM0A 1JMTA 1VS3A 3NAHA 1L3TA 3L9ZA 2A0FB 2ATCB 4DV1F 1VQOS 2OJ3A 4IRDA 1C1CB 2E7XA 4CLLA 2N7YA 4PG5A 4AFFA 2M4MA 2YPYA 4KO0B 2AV5A 1MN9A 2G0CA 3KG4A 4FNHA 1H72C 4DPTA 1GH8A 4ZPCA 1OJ4A 2MJUA 1V5IB 4OHYA 4CCHA 3CGIA 2JVRA 4RJVA 4PG8A 1CVJA 1HWLA 2HVZA 4LT6A 4FVMA 3CIMA 1YQHA 4K2JA 1Q53A 3M05A 2B56A 1HBMA 4KAIA 3ENQA 4P72A 5E33A 3RUBL 4X64F 4QIWD 1M5VC 3D5MA 3SFUA 3GE9A 4DR5F 2J6TA 3F41A 3U27A 2MKCA 3R6GB 4KPYA 2MZJA 3JS9A 1XNRJ 4WZMA 3HSJA 4IH5A 4F26A 2XSFA 3J80Y 2DNQA 2GX8A 3GYGA 2ZBQA 4ZOSA 3OV7A 4FN5A 2CJKA 4GO5X 2FJDB 1B0PA 3NGUA 3PDNA 3T41A 2PIIA 1MROA 4LREA 4DLEA 3QJPA 5AJ3F 3BO4A 1V9OA 1HBOA 2G0IA 4WXWA 2HFVA 2CJAA 4DPUA 4X4TA 4OI0A 1WUUA 1QY7A 4F4AA 2E1RA 3CD7A 1QTMA 3CD6S 4BLGA 5JVGQ 3JTNA 3ZZ0A 1TP7A 1WF0A 3CIZA 4ELUA 4G1QA 4PRFA 2HVEA 4ED3A 3QGIA 1U47A 1Q95G 1BQMB 2A2DA 3SFGA 4GMKA 1NDLA 1AW0A 3TA1A 1LWCA 5EWGA 1TKTB 3GR0A 4ZP6A 4ER8A 4X65F 2UXCF 5E3RA 3RG6A 2DGSA 1MROB 1K8AT 4LF9F 4H4MA 2HVDA 4KC5A 1YZ7A 5BR8J 3M8PB 4C8ZA 4HKQA 4C8NA 2CJBA 4I6AA 4IFVA 3MGJA 4FBTA 1FD2A 2YNGB 4JI0J 1WTBA 3HKWA 3HMJG 4UY8T 2F3JA 1SB6A 3ETOA 3A1YG 1X4CA 2V34A 3DRXA 3GPAA 4KKOB 5U47A 2MGZA 4DCJB 2XNRA 4CLPA 1E6YB 2ZH1A 2KL8A 2L41A 2UUAF 4DR3F 2HHSA 4BHQA 5L46A 3K0JA 4FPIA 4XTTA 3DLEB 5THWA 3CO9A 3HFKA 4ETZA 3GJRB 2NR0A 1FK9A 4FF4A 3Q2TC 4PWDB 4N8OA 1SC1B 1SIWB 2FZGB 3KUGA 3PJWA 4W4MA 4USVA 4I64A 4OZLA 4O3QA 1S59A 1RT6A 4Y0FA 1QSLA 1TKXA 2VUGA 5LMUJ 4PXDA 1A9NB 1RT4A 2V50A 3QQCD 3SCKE 4B9SA 4HDGA 2R8JA 1PJ6A 2D9PA 2P6SA 2CPDA 2I2YA 4U67Q 1Q8BA 3AJ1A 3H5SA 3CC4S 1CS4B 2PFDA 2QLJB 4CO5A 3MR2A 3KLHB 1HMVA 3HJFA 3EICA 4MKVA 3MUTP 5J2NA 5HMWA 1SXLA 2CPEA 3D9BA 3R27A 4OZ1A 5ETRA 2IHR1 4OX9F 3HXMA 2HRYA 1RI7A 4ZLJA 5AXLA 5DG8A 4F50A 4NASA 3FCVA 4JV5J 4IO1A 2ROEA 5DG7A 2V63A 2DD8S 3CDEA 3I82A 3QAEA 1TAUA 3AD7C 2HMIB 1QAXA 4Y2AA 5D15A 4Q45A 4LF7F 4IOCQ 2OEJA 1SUQA 1I6JA 3Q22A 4JV1A 5K14B 2IIHA 4F67A 2D1CA 2ZH8A 2UVWA 2QMXA 3MEGA 4D3HA 4HTIA 4X4QA 2WB4A 3U1LA 3A8EA 3CWJA 1IVZA 2D3O1 1M90T 3BSCA 4JBCA 1U4BA 3HULA 4KE5A 1SCJB 2WW4A 5HANA 2JWNA 5I42B 4RNFA 5E3AA 3GIMA 1ZH5A 4K4UA 2HNDA 2PDAA 2WONA 3MFIA 3H40A 3J81U 1RACB 2HFUA 4XAKA 5IM0B 5GAHU 2W8LA 3B78A 1YJRA 4EO8A 3Q24A 3J7Z5 1HI8A 2HZCA 2FHJD 4OJ3A 2ROPA 1WJ9A 1CJUB 3HHEA 4EUVA 4OL8A 4O3SA 1PJ7A 2YX7A 2GIFA 3UE2A 4DV0F 1W2IA 3ET6B 2WK4A 3MEDA 2ADCA 4EYHB 1FRLA 1X7VA 2HFZA 4JV0A 1N4LA 4ZVTB 2VL1A 2QEXS 1IKVB 3C16B 2UVRA 3O6QA 1C0UB 2RDIA 4L76A 1HNIB 2Y1IA 2Q6BA 3FBEA 2XO6A 3FEZA 2Z56B 4A4JA 2H4YB 4V19J 2CVEA 2KFYA 3MMAA 2HK2A 4PWWA 2O01C 3SDEB 2SXLA 3R2DJ 1KWMA 3HHDA 4M1KA 1KQSR 1RT2B 2QA2A 4Q2MA 5D6GA 1VIOA 1VDHA 2H5EA 3JYTB 2J8AA 2OD4A 2ZUAA 3TA2A 2DHAA 2MLZA 4BDPA 3NS6A 4DG1B 1NK0A 3BQ1A 2VPWB 1N0UA 2PA8D 3S01A 4GC6A 4JOUA 5K14A 5KFIA 2YH0A 3QWUA 1IM4A 1SVDA 4Y2KA 5F8GA 3FCWA 3LH2S 2XMJA 2H5JB 1QM9A 1UJ5A 3C19A 2Y1JA 4USTA 4IRCA 2NYHA 1MNEA 2KT3A 3GB0A 2QLBB 2NUUG 2ZZNA 2OPPB 3DI6B 3TUPA 4DL2A 2B7BB 2H3EB 5BXIA 2VFVA 4TY9A 4ZPWR 2YQ3A 1HNVB 3A8JA 3QLHB 3TJ8A 1TKZA 2CQDA 3H4DA 3HHNB 4B9VA 1RBLA 2JLGA 3KLHA 2MKJA 1UL3A 3MCOA 2HKEA 1DLOB 4PAAA 3MEGB 2J7UA 4KH1B 2UU9J 4KGXB 3PX6A 1R3NA 1Y5NB 4KSEB 2OUGA 3NLCA 5DETA 3MM6B 1S0OA 4ES3A 5E7OB 4QIVA 5E2QA 1SIZA 4H4KC 2AJ1A 2RKIA 2O67A 3L4BC 1FNOA 4K7QA 1K0TA 1PYSB 1NBEB 3DLKA 3IMQJ 1N34J 5KFDA 1UP1A 4DF8A 3BPDA 3LA0A 1HFEL 4WTOB 3GLJA 2IA6A 1HNIA 4NA3A 4OLPA 3K8WA 4UOFA 2ERRA 2ADBA 5A76A 1YJWS 3HT3A 2OELA 3W2WB 5A8WA 5HVHA 1ZTTA 4JI7J 4WFZA 4NLDA 1X4FA 3KLGB 4ZLNA 2ILZA 1DAXA 1CJVA 1BMQB 1OSDA 1P6TA 1U8WA 1ZAXA 2VFRA 1UEKA 3BDPA 3FKBA 1EP4A 2UZAA 5GMEA 3KMQA 2W4DA 3ZXWA 2VICA 2R7UA 5EX3A 1E6VA 7FD1A 2E1MC 2VA3A 2FLNA 2Y8YA 3KOAA 2HHTA 2XGPA 4DS4A 1NB7A 1H38A 4RNHA 3VAHA 3M1VA 1IJFB 4FZVA 4U8YA 3U7JA 2VH7A 3JAMU 5H9EK 3IM9A 1B7FA 4X4SA 4Y6IA 2CIMA 2PN6A 2MQPA 4X66F 2DVIA 4FXVA 4DR1J 1YGYA 3CCLS 4LMZA 2ZDOA 3FGVA 4ZPVR 4S0MA 1UZDA 4B17A 3R5BA 4Q7AA 4LF4F 1Y10A 4CO1A 1KONA 3WC2A 2DPIA 2RSQA 4FXDA 3FSIA 3B8HA 3NOGA 4F4YA 1X4BA 4WIIA 4RNMA 3CC2S 3ITHA 5IT4A 4LF5J 2BJ1A 3EPIA 2XSJB 4RW4B 2G2OA 4JI0F 2AJ4A 2QL5B 3OHBA 3F0NA 3A12A 5KFVA 4EI2A 3R7SB 1R0CB 3JSBA 1S9GB 3MEEA 4KGVB 3CPWR 1XMOJ 1VC0A 1UVIA 3BH7B 4XO0A 1M5PC 4I6WA 4I67A 2GC8A 1PYOB 3WHIA 3MM9B 3CCUS 4C98A 3VALA 1HPZB 3IBFB 4ZVOB 2PSZA 3BKTA 5KOXA 1YJNS 1FDBA 1VRTB 4R8UB 4YFUA 2ALYB 2CYYA 5J2NB 3QMQA 5D0RA 3EJMA 4IG0A 5DQGA 1QSSA 3CCQS 1IKYA 1IJEB 2YX1A 4RW7A 2NXJA 4XPCA 1ZM2A 1SV5A 4A46A 5GADU 1TK0A 1N5QA 4O3PA 1YX2A 5KOWA 5E3CA 4QZVB 2HQFA 3MM9A 2HPUA 2ZKUA 2CKWA 2CWKA 4YUDA 1N32J 1EETA 2C22A 4OJGA 4ZK7M 1Q8KA 2D3OR 5ETQA 2FJWA 1VQMS 1VQ4S 3MM8B 4N5SA 2PC6A 1N88A 1S1VA 4KHPJ 1URNA 2FZKB 3EVMA 5KT6A 2P9CA 1A7GE 3PFEA 3KG0A 3UQSA 4USHA 1YITS 2LU1A 2R9LA 4K0KJ 4CZCA 3TAQA 1FKAF 4I7FA 4CLTA 1DQ9A 2XMWA 2W4PA 3AQOA 4BCAA 3UD3P 1PKUA 4I69A 4GVBA 2BOAA 1VR6A 1KR4A 4O3NA 4B9LA 1JXLA 4I7FB 5H1SV 4Q5VA 3C6UB 2J9DA 2W01A 4FPRA 2HHPA 3TJ9A 4Q43A 1J5OB 2BRLA 3DRPA 3GJQB 3LP2B 4HLBA 4NOHA 1ELOA 2MZQA 3N79A 4EBDA 4H4KA 3QT7A 5KT5A 2XY6A 4N76A 2GIRA 1HR0F 4JI6J 5CH7B 5F9LA 4ETXA 3M7VA 1C1BB 4Y2CA 4AQYJ 1NHUA 5CQGA 5DG9A 1PSDA 1JB0C 2IRYA 4ECXA 1ZZNA 3CDUA 2MEWA 5GMKa 1OYEA 4RO0A 1EKSA 4ANDA 4M5LA 2LQJA 1RLDA 1WHVA 2H4WB 3NS5A 1U1LA 2DISA 3WQPA 2W2QP 2JC0A 4IH6A 4J90A 2J7KA 3VZHA 4QBUA 1FE0A 1T9VA 4RBUA 2WVCA 4OI4A 1FTRA 1QE1A 1WACA 3AJ2A 3X3UA 4ES1A 5IZHA 3QGPA 2YTCA 3T5HA 1GXLA 3DRSB 4ZS6A 2J0SD 3HI9A 2ATLA 5LT5A 1UVMA 3C14B 4EYIB 4DL5A 2DRBA 2RKIB 1HI0P 3QSYB 1ZBTA 2E5JA 1PC5A 3M1VB 1GQEA 2R7RA 4F8RA 1VQ8S 3ISZA 4CLWA 2U1AA 1BLUA 1RT7A 4FKXA 3T1YF 4CI0B 3H25A 4FF3A 2R4FA 5KT4A 3MR6A 1J5EF 2M70A 1JK9B 3IRXA 1P27B 3G86A 4DX7A 2JFKA 1EIYB 1FJGJ 1G4CA 3K7RA 4K4TA 1H3DA 3EGWB 4Y3CA 4DR4F 3BGRB 2GHWA 5K8OA 1HD1A 3D4JA 1RTIA 1UA1A 1OPZA 3I6PA 2M7SA 2XULA 2CNOB 4JI1J 3PM9A 1S1XA 1O5JA 1TL5A 1WDTA 2B4VA 4ZN3A 4UY85 4LUBA 2QSWA 4E98A 4WPAA 1BHNA 2LEBA 1RB0A 3SQGA 3T6BA 3ZTOA 1U25A 5CABA 1OY6A 1S6UA 2HGNA 2LXIA 3IR5B 4MIWA 4RX6A 3DFEA 2JH3A 3I0SB 4OYPA 4IQXA 3Q8VA 4ECSA 4JYAF 3NMAA 1R8AA 1R8PA 1MG7A 2J0XA 4KGMA 1UPPA 3KTQA 4F0KA 3KK3B 3V4IA 4B3OA 3EZOA 1RAIB 2BW2A 3DGVA 3G2XA 1JLFA 3IG1B 2MZSA 2UP1A 3M32A 2KFNA 3JSMB 1TKZB 3VAMA 2MQNA 4WFAQ 3H2UB 2IVYA 1W2BR 3TYTA 2UV8G 4CTAA 4TNOA 3GIJA 1C4AA 3T9NA 2M8DB 2NSCA 3N6MA 2ALZA 1U09A 3NGTA 2NUHA 1SH3A 4YDDB 3G96A 3AOAA 2KXFA 1WG4A 2WAQD 3H4BA 4RU2A 2KN4A 3W5YA 4CRJA 2DJWA 4USMA 5DQHA 5LXYA 3DXBA 4UT4A 2MKIA 4FS1A 3M8SA 3M8QA 4DUZJ 1CJKB 1X4GA 3AJDA 3OTEA 2FC9A 3H42A 2V0NA 1RWNB 3I0SA 1OS5A 2Q79A 3AHPA 3MUVP 3HSZA 1IR2A 2R42A 1VBXA 3GQCA 3EDRB 3IA0A 3Q8YA 4E2FB 2BJ3A 1NK7A 1NK8A 2ZVSA 2XHWA 1S9EB 2RQ4A 4RLEA 4ED4A 2HLTA 2DGQA 2WONB 3KLIB 2YKAA 4WIQA 2IY5B 2JHEA 3VAIA 2M9KA 3M8ZA 2WBMA 3GMGA 3SSRA 5FDLB 2DB1A 4ZLPA 3CXCR 1RTDB 2DPJA 5GAEI 3N4WA 2V4QA 2AMCB 4IKAA 4WFXA 3NWGA 2B51A 3QRRA 1DTQB 2B5JB 5J2MB 3OL6A 4DR3J 3IBWA 3PX0A 5DM6Q 1V3ZA 1HQEB 2R8IA 2W24A 2XS5A 2ZHOA 2IVFB 1X5SA 2Y9HA 4CYUA 2FVSA 2H1YA 2MZRA 4ECRA 1SKWA 3KJQB 1F9FA 4DR2F 3THPA 1ZM9A 1NK9A 5JJBA 3P49B 2L3MA 1JQGA 2G13A 3AXMA 3EWGA 4JI4F 1H6KX 4WXOA 2I8EA 4TYAA 1FXDA 1KLMB 4IFYA 4QWEA 1O8BA 3D2WA 4DR2J 4DSIA 1Z1ZA 4I0WA 1FD8A 1WC4A 3C8YA 4OZ3A 3CO0P 3DLEA 4O3RA 5LJ3Y 4HL9A 4J9NA 2Z2ZA 4IDKB 2B9XA 3Q8PB 1RLCL 1WEZA 2G1DA 2C3PA 3HJVA 3TUZC 3RB0A 1U1OA 1U48A 1E6YA 3DLBA 2QLXA 4ZDNA 3E51A 3HFVA 2QC3A 4DZ6A 4RUHA 3RBDA 4NMXA 3Q8QB 4C97A 4DR6J 1F2GA 3IGNA 5MLCV 4ALZA 4KBIA 3MWBA 1RWUA 3BZQA 3RAQA 4OLOA 5B0AA 4DN9A 4ICLA 4PQAA 2FUG9 2QA4G 3MCSA 1RAFB 2VBZA 1L3UA 3CJQA 5CD4A 2IMWP 2J5AA 2IVMA 3RBZA 2PMWA 1JLGA 5I3QA 1YHQS 2UXDF 2APOA 1MU2A 3ZFVA 2QJ3A 2LQ9A 3CE8A 4LSLA 3ZZOA 1XJWB 5BYRA 3ZZPA 4DL0C 4F4XA 4ED5A 5ETVA 5DGBA 4X4RA 1RCOB 2AKWB 4FS2A 3MUMP 4PPDA 1U2CA 3QFHA 4N8NA 4Y65A 4MYUA 1GXTA 4EK2A 2OMLA 1S7IA 1T9TA 5D8HB 2WSEC 2J6SA 1WC3A 1V5VA 3UI3A 2CQCA 1FJEB 4C4WA 2MSSA 3GSIA 1EB0A 2BQ3A 4IG0B 2HS4A 2ZH5A 5SUHA 3PY8A 2LQBA 2VBXA 4DV1J 2FGCA 4H54A 1QDUB 3TOQA 2GCFA 3MAQA 1JLBB 3MPYA 3ZNUA 2EG2A 1NSPA 1HLWA 2EW9A 3EUNA 4QWAA 4NXMF 2RQKA 3MCNA 1DZ5A 2IAJA 2FY8A 2ZOGA 4ZPTR 1SKRA 2WVFA 4NCGB 4NXMJ 3TVYA 3DNCA 3KLEB 3B54A 1HMVB 1YI2S 5D0EA 3LP2A 3Q89A 1WELA 1YWXA 4DX6A 1TV6B 2ZKTA 3EX7B 1PO6A 3M6VA 4JI8F 2GW8A 2V4JA 2V8GA 3DCAA 3K5NA 3S6EA 1RKJA 2VHGA 2V9WA 2HNYB 3DOMB 3WX4A 1NPRA 2HBQB 3MZIA 4ED8A 4ED1A 2VD3A 2GJ2A 1N36J 3H2VE 2PEBA 2JVOA 3CJ2A 1GT8A 2V6AA 3M2UA 4TY8B 5F3ZA 1U6FA 2IAJB 2CVIA 2F9JA 2RB7A 3TVKA 2MQOA 1BQMA 1X0PA 4DLGA 1SL0A 4L3KA 4J9QA 3R5CA 5LSLA 5DLGA 2BYCA 2CFXA 1Q16B 3EE3A 1TK8A 3LGHA 5HVFA 1KFSA 4C7QA 3OXLA 3PCOB 3IP0A 5KFJA 5KT3A 2BQUA 2VPXB 1Q82T 1G7CB 1JJ4A 4KR0B 3V6DB 3LANA 4HHJA 3SSQA 3RRHA 5D4LA 1XBWA 2F63A 2WVBA 5K8NA 3PACA 3LGMA 5K8MA 3PX4A 4WYLA 3V6DA 2W9BA 3KJNB 1LWCB 1U24A 5DM7Q 2DR5A 4DV0J 2KT2A 4J9VA 4YB6A 2R2TA 4MKYA 4NE9C 4DR4J 1XQIA 2KHDA 3W5ZA 5KFAA 3KNGA 3CULA 4LSZB 2AGPA 5DZ6A 3FMWA 5KFQA 4CDIA 3UCGA 4CLFA 2W8KA 2P2CB 4CNYA 1NAQA 2FHJA 3IO1A 4C11B 2Z2YB 4X2BA 1ZA1B 2R2RA 1HBOB 2BRKA 4TY8A 5KFPA 4ZKAA 4USWA 5T41A 4QJVA 1SL2A 3HDSA 2R2UA 1R6VA 3DC2A 1CC8A 3O44A 4JI6F 2MPUA 1HR0J 3IWLA 2DR7A 5D3GA 1OIAA 1FHTA 1L3VA 2EEYA 2CQBA 2QA4S 3AXKA 3OVSA 3T3FA 2UV8A 2Z57B 2XEXA 3LPEA 3OSPA 2HLUA 4FYDA 2FVCA 3HSGA 3W2WA 5A8WB 2POKA 2VOOA 2B7CB 5G4DA 4ERDA 4QU6A 4WYWA 1N33J 3HSDA 2DY9A 3L09A 5K9FA 3CJKA 1M5HA 2FYXA 2QIFA 5LL6d 3UVJA 4WFBQ 4OYXA 4PUOB 1RA7A 2VC1A 3KUEA 3UDLA 5F0UA 2VG5B 2R3VA 1XMBA 5E3QA 2FVPA 3HD1A 3TEHB 1VQLS 2NREA 4UW2A 4WU3A 2RUGA 3CDAA 1GX5A 1SQEA 1UEUA 2R7WA 4NEYA 3ULHA 4M5MA 2GGPA 3CMQA 3GZ7A 2XYGB 1NUEA 5C7PA 4B3RJ 1SQGA 4OMFG 4ZJOA 3LP0B 4UOCA 2W2MP 4F04B 3PW2A 4AXIA 2OI2A 3OTCA 2Q1LA 2RU9A 3UFCX 1V6HA 1KTQA 5CA5A 2GS8A 1N32F 1S7HA 4J9MA 2F8EX 4KPCA 4OHVA 2IPOB 2CZ9A 4QR2A 3GV5B 2CQ4A 2MKSA 2J8SA 1I5OB 3VQSA 3G6YA 2DR9A 2IYGA 2RQCA 3PO5A 3FEYB 1C4CA 1WC1A 1FX2A 2IDLA 1UEVA 1VIXA 2NSBA 3GJSB 1FKOB 2HBYB 3NY0A 3TNVA 3T9ZA 1GK8A 2OKQA 3W8PA 1DTTB 3P6YC 2CNNB 3CJ3A 2ZH3A 1YJTA 4DV3F 2G4BA 2CQGA 2RS2A 2VQFJ 3I4PA 2VQEJ 3CTRA 4OYZA 1JLGB 1NJXA 3MM5B 4CH7A 5E41A 2EKNA 1AUSL 3D6MB 3US5A 1VGYA 3EZUA 1JJCB 2BE7D 2CADA 3C16A 1HNZJ 1WD6A 3MECA 2DNHA 4P75A 2YXLA 2WTFA 3BJYA 4YQWA 1PILA 4Q2LA 4F4WA 1QJHA 4EU0A 3TZXA 4HVZA 3A13A 3PFOA 5E0OA 3D0IE 3SV3A 4ZIWA 1XMQF 1UJ4A 2B5JA 5J2MA 1L3KA 3QLHA 2E66A 3TZZA 2HHXA 2VPYB 1AB8A 1YKWA 3LP1A 3OFFA 5C2CA 3T1HJ 3GIRA 1YZ6A 3MMBA 4KYZA 4V1Ak 5ETLA 3RJMB 2IJFA 4LFCF 2IJNA 3C46A 3LOUA 1S9EA 3VGTA 4EBCA 4IG3B 2IDEA 2JL9A 2QRRA 2J0QD 3OTOF 4B9NA 1JWWA 2KI2A 5EWFA 2HS3A 3RYLA 2N7CA 2F5GA 1CEZA 4KIAA 4LVOP 2RMLA 4DFKA 3MD3A 1HWIA 1HBNB 4OV6A 4KHPF 5D4NA 1DLOA 1NO8A 3I5AA 1IR0A 1ZM3A 4G3IA 1SJQA 2F4FA 4I4BA 4K59A 3W62A 1WHXA 4HH1A 4LRCA 3ZZZA 4ZIVA 3A3NB 5GAHI 2EK6A 1RAHB 3R97A 2XMTA 3MM5A 2IYIA 5F8IA 4DF4A 2CPHA 6FDRA 1NKEA 3NL0A 4RWXA 1YBTA 3Q83A 4ECUA 2PD1A 4I6YA 3Q0AA 2BMBA 5IM0A 2OO4A 3DOKA 4J7CA 1S1XB 1XK8A 4FYXB 4HH0A 2VQFF 2DNOA 5HP1A 1RHJB 1RQ0A 1C0TB 1RAGB 2W2NP 3DRRB 4MKBA 4Z2XA 3NGKA 3M9NB 3QT8A 2ASJA 1VK3A 2EPIA 3FNNA 2AHOB 3UW1A 4ED7A 1WF1A 1WHYA 1IUJA 1G6BA 1Q8LA 2WBRA 2YKQA 4K5RA 1VBKA 4J9LA 3HZGA 1UVKA 3D1QA 3V6KA 1R0AB 4F7VA 2OTJS 3RW6A 4DUTA 4GKJJ 1WKJA 4QR0A 2XLIA 1CSJA 1TKXB 3JYTA 5IT9U 5D3GB 2IBOA 2ZH2A 1NZAA 3PTWA 5FIIA 4CO0A 3R9LA 4TU8A 3DOLB 3T1HF 1RDRA 2IRUA 2YNHA 2HQDA 5KG5A 5BJRA 5D0GA 2L08A 3PW0A 2E5IA 3LP1B 2HAIA 3FFIA 5H9EJ 2H54B 2OMOA 4OJHA 2B8PA 1F3FA 2DH8A 2OFHX 2QN6B 2Y1LB 4MKAA 4TXSA 2YKNB 5IC6B 3RU0A 4QYZJ 2NQPA 2V69A 2KFZA 2DGWA 3TX0A 2D69A 3HX9A 1B0VA 1RTIB 3BREA 1U6BA 4DU8A 2F65A 3AOCA 5I3UA 2MB0B 4B9UA 4DV6F 1KN6A 2YKPA 3MMCB 5AXKA 3W65A 3U1MA 1WG1A 5FLXY 2YNFB 4BWMA 3UO0A 1LWEB 3SQOP 1XR7A 3OR2A 2XYPB 2K3IA 2Z2LA 4ILLA 2XY7A 2EFVA 1YRTA 1NSKL 1I94J 1WOPA 1V3SA 1Y00A 1LWFA 2LDIA 3H90A 3OR1B 2OSQA 2B8QA 1JLCB 2XYHB 4L74A 4ECWA 3J7YU 4P2SA 4EEYA 1KRPA 4K4VA 2XHCA 1S6QB 2HHHF 3PHTA 1CJTA 4AD6A 4K4SA 2XI2A 3C6UA 1M0SA 1I51B 4JI5F 4X62J 1AZSA 5DDQC 1IWGA 3C6TA 3D3CJ 4FNIA 4RNOA 4Y28C 1FEHA 5K20B 3EPGA 1NDPA 4RBTA 3EVOA 3M2VB 2UXCJ 3V5RA 1FRKA 4UZBA 2COLA 1R0BG 1RT7B 4OX8A 4K4YA 4DPOA 4DV3J 2G9OA 1NJWA 1FE4A 4DX8H 2K1RA 2XC9A 2ZC4A 3WX8A 4U8VA 3PEJA 2YNIA 3FQKA 2HBZB 5D77A 3VHQA 1RYSA 3OFGA 2Z0GA 2ASYA 3H98A 1RT3A 1JXEA 2BKOA 3D7SB 1EETB 2IM0A 4ECTA 1IM6A 2R7SA 4A8QA 5A8KB 4B3MJ 2YKMB 1N33F 2VOPA 1KKHA 1VRUB 2P8IA 3VV2B 1NK5A 2UU9F 4JV2A 1VI7A 4YEAA 2ZWOA 4JI7F 2EG1A 4GKJF 5KFSA 5ETPA 2EWHA 1JLEB 4DI6A 2HNYA 2HNZB 3FDSA 4W90B 1DQ8A 5HROB 2W7OA 1WEYA 2M2BA 1C2PA 1Q0NA 2XG8A 1K9MT 4ZVRB 1NPPA 4MK8A 4PR6A 2DKOB 2ZWPA 2CA9A 4K8RA 5ETNA 5GMDA 1FJGF 4CLYA 4CM2A 1RGVA 2CQ3A 1S1VB 1N5YA 3OL9A 2V5HG 2IM2A 4LQ9A 4NZ6A 5KFEA 5I3PA 3MURP 2JEGA 1IBLF 4KO0A 1AFIA 1G1XA 1B70B 2DGUA 2EC2A 2HSEB 4HR2A 4PPZA 3W2VA 1Y3JA 1EJ7L 3D54A 1KQGB 1ZAVA 2VZ9A 2H5IB 4HT7A 2B4OA 4DV5J 3NBPB 4O0NA 3L7OA 2JSXA 3MMCA 1X0FA 2NXUA 2F40A 5F8JA 3TARA 2DNPA 2RRNA 1S48A 5IOLA 3VVUA 5SZTA 4USJC 4A8XA 1Q86T 4HT5A 1NSAA 5C24B 3G4SS 5KG0A 1AT1B 4ZVPB 4ANCA 4DX5A 4IUFA 4KV8A 1HBMB 3AA8A 3TA0A 2MZ1A 2X51A 2LFVA 4ID5B 3W9IA 1UKUA 3DLKB 2KJWA 1E6VB 1RAAB 2V67A 4GKKJ 5DRKA 2LCWA 2KG1A 4JYAJ 2HS0A 1TAQA 3DGPA 1BWEA 3M6XA 1IBKF 3S1TA 3ZO7A 2MHNA 1WSVA 1EQ0A 1TV6A 2G2YA 1WOOA 2J9EA 2NS1B 2PA3A 4JP8A 4PG6A 1RWXB 2AWZA 2LDYA 4ZPDA 4DXLA 4DFPA 5IQ6A 1JXVA 3HVTA 4X64J 3DMJB 4R8UA 2GO8A 4OI1A 4YOEA 1S12A 2HGMA 2V8HA 3UN3A 2XTJP 1UETA 1FX4A 1LWXA 3QJLA 1KEKA 2VA2A 4NI2B 4MTPA 1BQNB 1MN7A 5ETOA 1NZ8A 2H65B 4MK7A 2XWYA 5HAOA 5C42A 3OL8A 1KFDA 4IFYB 2XZTB 2ZEJA 2QFJA 2CPYA 1JLCA 2DIUA 3UCUP 4LSLB 5KFHA 2B9YA 5LSRA 3R1LA 4G1PA 1PBUA 1FKPB 4RUAA 1TL7B 1PYTA 2CJXB 2DCLA 2CQ1A 2AF6A 4NA2A 4K0KF 2P6TA 2QZ8A 2VB6A 2Y0SD 3VR1A 2Z2MA 3B4MA 4KH0B 3ENAA 3BO2A 1VQ7S 1F2HA 1FVQA 4DQSA 3H2LA 1J5EJ 1ULRA 5I3UB 3JSYA 3H8YA 3I9V9 1T11A 2DHSA 3RW7A 4ZPBA 3KXDA 2FJXA 1JLQB 1YLXA 2B6AB 3LO3A 5KG1A 1ZYQA 1KP6A 1HBUB 1QUVA 1WKKA 2LVWA 4G6VB 5CYMA 2VDHA 3R7NB 3UDCA 3CCJS 1TVRA 1S1TB 4FYVB 2AYGA 2WW8A 1HQ2A 4PWUA 4AUKA 3RR8A 3AT1B 4P7VA 2I38A 2OIHA 2FHMA 3J7AN 1FRHA 2AYEA 2FZCB 5GAGI 1FEEA 1PC4A 1R89A 2W2OP 3TRGA 1EP4B 1H74A 2DRAA 4RW8B 4K4WA 4OZJA 9ATCB 4DHVA 3NCQA 2B4UA 3TAMA 5LJ5Y 3RRGA 2AGQA 2A18A 3BO3A 2HZVA 2L48A 2A10A 2BKNA 3K17A 1UCNA 2GHVC 4WE1A 5CAAA 4QWDA 4PABA 2XGQA 4CTAB 2PI4A 2BE2A 3VF0B 5JUMA 4PG4A 2V4RA 2RIJA 2OPSA 3H7HB 5KFRA 4WE1B 3KLIA 4ZP8A 5CZXA 3W8GA 1HBUA 2XMUA 1QSYA 1BUXA 1OYDA 3I32A 2NYIA 1JLQA 1YK9A 2QT7A 4YN3B 3H0PA 3UWTA 3K58A 1XWLA 1X5OA 1CJKA 3O8WA 5JMNA 1HHSA 2ZH4A 2ROGA 1OMSA 4FVCA 4FP9A 3SV4A 1VQPS 1LQ9A 3BGFA 4I2QA 4KGKA 1K0VA 3HPOA 1IQZA 1D9AA 1T05B 5A0YB 3IR7B 4DSJA 1VBYA 2NLWA 4BC7A 1SKSA 1TVRB 1VC6A 1M1KT 1HYSA 2ZOFA 2F8HA 3QGHA 5DO2A 1TU0B 1UWAA 5A0YA 5BR8F 4NXNF 1ZPWX 1VK8A 3ILJA 3OD2A 4F3QA 2HHVA 3D66A 3O1LA 1HNZF 4F2RA 2AZ1A 5GAGU 2V8PA 4B9MA 2BANB 3M9MB 4M8LA 2LEAA 2PEHA 5M2UA 4C6AA 1S0MA 2WCXA 1RT4B 2EBEA 2ZUGA 5CD4H 3TJAA 3DGPB 1IKXB 2AJQA 1M1HA 2AJ0A 1Z2LA 2BXJA 3UR0A 3QRPA 2WOMB 3FUYA 3MFHA 1LV5A 3PEHA 3QSIA 2HIQA 2YWEA 3ZTQA 2BZ2A 3ZTSA 3KHHA 3MMBB 2HIYA 1S0NA 5KG3A 1ZOTA 2BE2B 2GMLA 3G6VA 4NLRA 4URSA 4ZP7A 3SQGB 2ZM6F 1FCAA 4PXCA 3I56S 1QE1B 4PUOA 4LRBA 1DARA 1XIQA 2WVEA 2DNKA 3JQMA 3LQVA 4MYTA 5C24A 4HHUA 3DHXA 3OUYB 4C8MA 1BQXA 1JLFB 3BBBA 3PW4A 1VOMA 3NRBA 1EX8A 3ZZRA 4YB7A 4C9DA 2ZNYA 5KFKA 3FEXB 2IA0A 1U6ZA 3I0RB 3RB6A 1TUWA 1RT1B 3GG0A 2BJ9A 3F44A 3VWSA 2BOPA 2RVJA 3K57A 2FLOA 4Z7CA 1R8BA 3HVRA 4DSEA 2YWGA 3C15A 1CJUA 4UTGA 4FF1A 1EKRA 2DH7A 2BACA 1WI8A 3W2VB 3OL7A 1P1TA 1HQUB 1Y5LB 1YG0A 3PJ9A 2CPXA 2GJFA 1PIEA 1YTYA 1N5VA 1NDCA 4ZCKA 2HMIA 2UXDJ 1H2VZ 5C5JA 4WBFA 5AXMA 2BKPA 2XM3A 1CPZA 2GNKA 3P96A 4X62F 4NI2A 4OZ0A 1S72S 2VG5A 5BYSA 4U7UD 2DNGA 2P5VA 2PGCA 3HLUA 5L8RC 4TLQA 1F5CA 2HG4A 2UUBF 4NLQA 3CD5A 1U0HA 3G87A 2HAFA 4ID8A 4LR9A 4O44B 1GX6A 4OZ2A 1UFKA 3EGNA 3MPVA 2OTLS 3Q8UA 3TQ1A 3LP0A 4G65A 4LFAF 1NB2A 1TL7A 1YJ7A 4NYPA 3GV7B 3QIDA 1JJHA 4BC9A 4ZHRB 1U02A 2IC3A 4X4OA 4DWIA 2VBYA 4Y2MA 2XY5A 4NCGA 1UWBA 1KVKA 3G8SA 1RWVB 1F60B 1X4HA 5GADI 2AU0A 5ETTA 2CQ0A 2DNYA 3SCJE 3PNIA 2KTQA 1AFJA 2BA9A 3GU0A 4DQRA 4BWJA 1P9YA 3OBIA 1ZA2B 4P2FA 4X4NA 5F41A 2AEMA 4YMEA 5F9NA 5HMZA 3J81Y 4AXJA 4WKRA 4WZQA 3CNQP 1MWYA 2FQQB 1RHRB 2XMMA 2ZBCA 3BBCA 3BQ0A 1UVLA 4JV5F 1HW8A 2E7VA 2X1AA 1S0VA 3R3TA 3CJTA 1M1GA 2ZBIA 4KJIA 3UPFA 3BH6B 2VFSA 2HFOA 5KFCA 3K59A 1U0HB 1LXJA 3BKUA 3FSXA 5DLFA 1YBAA 1VYAA 4TVAB 5A8KA 1RP5A 5KFZA 2GV1A 2B9EA 2E1PA 2HWTA 2IM1A 5J1EA 1I1GA 1Y11A 3BGUA 3IC1A 4IRKA 2JX2A 1FRJA 4P74A 2F1FA 3RTVA 4OV1A 1NK6A 2W7AA 4B3TF 1Y0HA 2R2SA 1HQUA 5LXRA 5KT7A 1T3NA 3HO1A 2DXEA 3CW2C 3LTOA 3FSYA 2QFIA 1DY3A 3THTA 4ZJQA 2H51B 3LF0A 1DQAA 2MKYA 8AT1B 4MIAA 1VBZA 3LW5C 2ACYA 4ICLB 5A8RB 2AW0A 3PHEA 3O5TB 1WC0A 4J9PA 1TKTA 4LF6F 1AROP 2HQCA 3WIVA 1BGXT 2WRMA 3QZ7A 1HHQA 4KGZB 5HI7A 2HW3A 3UN5A 2FD2A 3DU5A 4HHHA 3RGIA 3ZZYA 5J1PA 3CJSA 1RSCA 2DGTA 1A6LA 5D4PA 5D78A 2KH9A 2ZJRQ 1FNMA 1RHKB 5GVQA 3TO8A 1R31A 1WSRA 2YKMA 2FJBB 2XO7A 3MHYA 4C8LA 2C2KB 6FD1A 1O0PA 1SH2A 1PCAA 2V9KA 3MR7A 3P3DA 5DDPC 2KT5A 2OFGX 1LWEA 2MQMA 3N28A 3Q86A 4A47A 1WTFA 4G1IA 4ZVEA 1CQMA 4DV2F 2YWWA 4B08A 1A0OB 2MDAA 4DR7F 5HROA 2C2OB 2V4JB 1RU1A 3I96A 3PRDA 2ZC3A 2LECA 2QL9B 1YRXA 4DZDA 1SC3B 2ZDPA 3M2VA 4Z7YA 1FWPA 3AD8C 1VFJA 3VZIA 4AL5A 1KTVA 2BV3A 4C2MA 2LA4A 2ZH7A 2GHPA 2JNJA 2M5YA 1J2VA 3GFXA 2AP6A 3HHLD 5FDLA 2C42A 4K4XA 1SPBP 5HP1B 4DSLA 1RT3B 1N0VC 3B82A 1GXUA 1R43A 2H9ZA 3V4MA 2UXBJ 2DNLA 2DITA 2ZVIA 3OR1A 2RD5C 1MU2B 5B0FA 4C3LA 4DQQA 4NZ0A 2XSJA 1MWQA 1VISA 2DHHA 4RW4A 5HLFB 1NKBA 3CDBA 5DDOC 1S79A 1XN9A 3MEKA 4LF8F 5KFXA 2GVZB 5F0WA 4ELTA 2JLEA 2O3DA 1CG2A 4C0OC 3C6TB 5HJXA 1XNQF 4OX6A 1HNVA 1UVJA 3A4TA 1XC9A 1AUDA 2DGOA 3FQLA 3PR4A 3A3OB 2V2QA 4M5HA 2B3TB 1HW9A 2RRAA 1RT2A 2DNNA 4OYAA 4RW6A 1TR0A 2YQ1A 1EAYC 1NNDA 2QYCA 4ELVA 2E7WA 3MMAB 3J80U 2JJ4D 3DKDA 1RBAA 1S5ZA 2DY1A 2OLWA 2VKRA 3GP9A 4LJMA 5G0RA 1WORA 3CCWA 4OYMA 3MI7X 3N01A 1JLAA 2D74B 1KLMA 3QFWA 1WOSA 4ZCMA 2ZBPA 3E01A 1N6QA 5CXTA 4KQZA 2MMYA 4DPXA 3MR5A 4PEOA 3OW2R 1VJQA 2X1BA 2EKYA 2EXUA 1HBNA 3L7UA 4C3MA 4ECYA 1JX4A 4WKYA 3PO4A 4H4OA 2KM8C 2EC0A 2F4VF 4WFNQ 2Z8QA 3MF5A 3ZZUA 5EGYA 4DV7F 1G3OA 1VLOA 1FDDA 2YKNA 2LXFA 2B9WA 2ACMA 2DR6A 3P5BP 3VCDA 2C2EA 4IR9A 5J2PA 1T03A 2OPSB 2ZD1A 3CCZA 5CYQA 4DS5A 3K5PA 3LAMA 3T5LA 5J2QA 3W5XA 2IRXA 3FRYA 2C2DA 1HIYA 4DMZA 1GEHA 3AB4B 8ATCB 4P73A 3H20A 1IKXA 1RBOB 3N9UC 3G82B 2DHGA 2VPZB 4X84A 2GMJA 4OYWA 5IFMA 2GAGC 3JXOA 3CUNA 1ZETA 2W9CA 3QAUA 2Q66A 3R2CJ 5EDWA 1KD1T 1DRZA 3HZEA 1O51A 4OQJA 4RWWA 1HQEA 3DN9A 2BANA 5KTQA 1YDLA 2PMHA 3MAHA 2IMOA 4DFMA 2B0GA 3C66A 5HN0A 1T7PA 5B0EA 5HATA 2L9NA 2RT3A 3ZNJ1 4N56A 3L7PA 3CMAS 4NL5A 2V8DA 2HYIB 2X7IA 1LOUA 1C0TA 1RTHA 1SUQB 2QMUB 3DRRA 2V2KA 1YSJA 3FZ2A 4WP8A 4OZ5A 1TKDA 2FLPA 4PCQA 5KFFA 3I5BA 4LIRA 2E9ZA 1Q7LB 4NLXA 2HGLA 1BQNA 5KG4A 4CLSA 5LM7E 1J27A 2HFSA 2VG7B 5HL7Q 1T03B 2RJZA 5T14A 2QE5A 3DMJA 3BSNA 2QV6A 3FBBA 1HWUA 1IKVA 2GVZA 3M8WA 4TLRA 5B08A 3VAGA 2LA6A 1QAJA 1F3VA 2YPZA 5A2QU 3LWLA 3MR3A 1R7IA 1VMBA 1N52B 3M6WA 3M8YA 4CO3A 4FF2A 4XDDA 2WZ1A 5KG6A 2N82B 5LMUF 2ZH6A 3D6HB 1VQ6S 1RAEB 3QIPA 3BM7A 1U2RA 1GTHA 5J1NA 4PWDA 1QLNA 2XS2A 1AA1B 2D41A 4NLSA 4CO4A 3GWCA 1IWAA 1YVFA 1SC6A 1FFGB 3HT0A 4FYWB 4YB5A 3OXGA 1Q5YA 3I4HX 2GQQA 3SI8A 1DBDA 2V2VA 3IGVA 3JTOA 3HKZD 3UNYA 5LMNF 1K47A 3HHLA 2FVQA 2BJ7A 3F73A 2WSFC 4QCLA 3GFHA 3GYXB 4P6QA 2E5LF 9RUBA 2K7JA 1U8SA 3MECB 1EQMA 2M3DA 2GVDA 1FNXH 2GFFA 3D6FB 3KUHA 2V94A 1X4DA 4P10A 4ZCLA 4LSNA 4YY3F 2R8KA 2XBPA 1M5KC 4ZA1A 5JVHQ 4TN2A 4X65J 1N36F 2QTWA 4NLUA 4YDXA 4C11A 1RT5B 1FESA 4U9RA 4C48A 3G71S 1AYEA 1CULA 1I94F 4AT1B 1XEZA 4JB8B 1BE4A 3MM8A 2XZWA 3KJVA 1H2TZ 3QT5A 3D3BJ 1S4FA 3CJRA 1AXQA 3DRPB 3R7BB 5CYMB 1GNKA 2BJEA 2DHXA 1NHVA 4Y00A 4CIOA 2DEJA 2OGUA 4B9TA 4NCBA 3L95X 5IS2A 2R7OA 4DCPB 4QU7A 1SJFA 3I9ZA 1NRKA 4YHHJ 3S8SA 3JQKA 3KLFB 1QVGR 1U1PA 4CNZA 5AXNA 1IKYB 2R7TA 3MOJB 4HDHA 4F02A 3VAJA 2KO1A 3CSKA 3FVYA 4F25A 3KDNA 1VQ5S 4LF6J 1REGX 1RT6B 4A8KA 2PT0A 4CH0S 1X9MA 3LPYA 1JJ2R 4JI2J 1TZ0A 3DLLQ 3C14A 4B3MF 3N5FA 1TMJA 3FMBA 5C42B 4U6PA 4MFBB 3T19A 2QO3A 3MPDA 2BM1A 5L39A 2KM8B 3OVBA 1PBAA 4FKYA 2CNLB 1F9HA 4D3GA 1WI6A 5HO4A 4TU9A 3GONA 4DFJA 4K50A 3CJKB 4F4KA 1DURA 2M8HA 4DBQA 4DN0A 2RDJA 1RA6A 1Q5VA 1LFPA 1RE1B 1S6PB 1SV5B 3VAFA 4IO9Q 4KKOA 4NRUA 1RWMB 2HRTA 2LP4A 3PKMA 5B0CA 2DYAA 1PJ5A 3GCWP 3KHLA 3N6NA 3OQ2A 3OLBA 1VRQC 3ILOA 2U2FA 4JI8J 4DEZA 3OTBA 1HNXF 3NKYA 5HK4A 3KLEA 3KK2B 2ZM6J 1N5TA 1Y7PA 3GR1A 5HBMB 4AL7A 3N5BA 2UUCF 1VRUA 1NJYA 5KG7A 1REVA 1U7LA 1X9SA 4OJ1A 2EFOA 2EI5A 1KHWA 3IWXA 4WK1A 5KAKA 4TQSA 3V6HA 3ILIA 3PYGA 2ZH9A 1H7XA 5BYQA 4Q8EA 1YIJS 2D3UA 4EBEA 4UF4A 2K8GA 3HCXA 3RB3A 4LF4J 2WB1D 4FXWA 3VQTA 4ED0A 4P2MA 1KOOA 2VG6A 2W4CA 3P8BB 3AODA 2YNGA 3SIPB 2V68A 1D8YA 3QBCA 5M2RA 4RZRA 3NBPA 3ZTPA 2F8MA
chains in the Genus database with same CATH topology
2ILYA 4C8OA 1IN0A 2OPRA 4R0JA 2BQRA 2HNZA 3BDEA 1XMOF 2Q43A 5KFNA 4HEA9 3DLGA 3E8OA 1KNZA 4ECQA 1RKIA 4UQTA 3G6ES 3NMRA 4F3OA 3GYNA 7FDRA 5KFYA 3MTKA 5KFLA 3GIIA 2E5HA 3SSSA 2YNHB 4MIBA 4NLYA 1B64A 3BSOA 1FF2A 2YNFA 3DDNA 2L9DA 3W3SA 2C2RA 3M8RA 3P5TL 4RW7B 3CJ0A 4GKKF 3MM6A 4ITSA 2FJVA 4Q8FA 4EZ6A 4YR2A 2DTJA 3HF5A 4Q44A 2DK2A 4I68A 4QIGA 1S6PA 1V3RA 1U1QA 2IBKA 2RF2A 4YP3A 1X5PA 5F8MA 1N5SA 2DO0A 3FFIB 3UCZP 2RNEA 4ED2A 3MOZA 1R6YA 3DLHA 1HYSB 3HHKA 3POTB 2AGOA 2WOMA 4PQUA 4NPOA 4OHWA 2CQHA 1UA0A 3KK1B 1LWFB 2HHWA 1MSWD 1RT5A 3DM2B 3DLJA 3M2RB 5A6WA 1R0AA 4Q0BA 4QIEA 4CO2A 3D0HE 4AYBD 1KHVA 2J7WA 2RILA 4EWTA 4K5SA 2R7QA 5AE1A 4O44A 3UD4P 3U02A 4TYBA 4MH8A 5F8LA 2CPJA 2PO4A 3IS9A 3NAIA 5DQIA 3N0VA 4C0BA 4A48A 2P9EA 2XWXA 2Y1RI 4GO7X 3BF4A 1U26A 2PI5A 3MTJA 4J9KA 3K5OA 4AQYF 1GTEA 1XR5A 2HWIA 4XK8C 4I2QB 3AA9A 3R1HA 3QIPB 5T7LB 3I0RA 1TFYA 3H5UA 3D0GE 4O0IA 2HVIA 3MM7A 1Y5IB 1P1LA 4WU2A 3M6UA 3QO9B 4Y34A 2JEJA 1T3OA 1UJ6A 1D9DA 4KHMA 2ASDA 1FT8A 3K2YA 2O66A 3IRWP 1SJ3P 1QAIA 2GMHA 3G8QA 3SDEA 3S7RA 2ABYA 4RUCA 1YJUA 4ZP9A 4OHXA 2LQ5A 3SCLE 3DOKB 1LFWA 3CCSS 4DOZA 1X9WA 2VONA 4R0EA 3PIPQ 3QZ8A 4DQIA 3DXSX 4MAKA 1SH0A 4LFBF 3QO9A 1VQNS 3FRZA 4QW8A 3DU6A 3GSDA 4DUZF 2XB2D 5CYJA 1KSPA 3M2RA 4A8FA 2QA1A 1FKPA 4NYOA 4ZVHA 2HHQA 2AX0A 3VTIA 3MPWA 1DTTA 5KFWA 4NLTA 4J37A 2K2PA 4PXBA 4IH7A 1IKWB 3DHWC 1LK5A 1VJWA 1JKHA 3HVAA 1Y3KA 5HMYA 2KHCA 1ZM4A 4NLOA 4DV5F 4WK3A 4NYZA 4JI2F 2DO4A 1B0TA 1VQYA 2DNMA 3HVTB 4DL7A 3AAWB 4ILMA 3IG1A 2LKZA 4HI2A 4H4OB 2AQ4A 3QGGA 1FXLA 1CLFA 3MM7B 1NU4A 2GA7A 4I56A 3WBZA 2BDPA 1RK8A 2FC8A 2CPFA 5T7LA 5K8PA 3WZ0A 2DCUB 1LW0A 3OXFA 2E1AA 1W25A 2VFUA 4C3KA 1R8HA 3OTDA 3PVXA 1Q78A 4K4ZA 1S76D 2DIVA 3DLGB 3M30B 3LAKA 4RW9B 2NZ4A 2OP5A 4NLVA 5CZVA 1S99A 1LKZA 1NK4A 1UMJA 3MEDB 4I2PA 1HWKA 4E8UA 3M9OB 3FCHA 1BC6A 2HQ3A 2EFGA 2DGXA 4OI2A 2RS8A 1KOHA 4WCEQ 3LWMA 3IFEA 3PR5B 5L1JA 2UXBF 4DDFA 4IQMA 2D3ZA 1VQSA 3OJUA 3G8TA 3V81B 3FZBA 1D9FA 4ED6A 4TKTA 5ADZA 1TUVA 2HNDB 3TR5A 5KFOA 1ZTWA 1WG5A 2ZJPQ 2MZTA 2EFNA 4YHHF 4QIFA 3CD0A 4DR1F 2Q6CA 3SYZA 2QMWA 2R8GA 4O23A 4KHRA 4QPXA 1R8CA 1HARA 4UUXA 2VFTA 4MJKA 4X4VA 4Q0BB 2FHKA 2C3UA 1S49A 3MDFA 4XDCA 5I4MA 1SL1A 5HQ8A 3BB5A 3TVZA 1FVSA 1XERA 3TUJC 2M0GB 3RRKA 2HHUA 4URQU 3AB2B 4PG7A 4KV8B 4X4PA 4YR3A 3MD1A 1XNRF 4LQ3A 2YNIB 3CJ4A 2CJQA 4OI3A 1TL3B 2MKKA 5L9NA 1M5OC 4W92B 3MXHP 2KZMA 2BABA 4AE5A 2B4PA 4R5PB 5EHHA 1N34F 1FO1A 3BEGB 3JTPA 4DSFA 1M5SA 5A8RA 5IWAF 3QYYA 5DS7A 3SMZA 1KC8T 1D8ZA 1BY9A 3C3LA 4ZMMA 4NLWA 2EBGA 3BR9A 1K73T 1H98A 3KJVB 2J9CA 5IT0A 3BR8A 5HMXA 2MGZB 4F2SA 2R7XA 3H5YA 4JI3F 3ZZTA 3OFEA 2E29A 2FTRA 1TL1A 2LMIA 2GJIA 2X1GA 3SCIE 4B3RF 3LUYA 2JZ5A 3KLFA 3KK2A 3GG1A 3CEDA 1OQ6A 3DOMA 2VBWA 3QPIA 1BD6A 4AL6A 3NCPA 2N4CA 2HWHA 2A1BA 3I31A 5EWEA 3KMSA 5L1KA 3T5KA 3GV8B 4YR0A 1U1KA 3OUYA 1WHWA 2UVVA 1ROFA 1HPZA 3EGZA 3B4DA 3DYAB 4HYKA 1MWZA 1LW0B 2YX4A 4X4UA 1Z4UA 2RH3A 2RU3A 2JEIA 2C3OA 4LSNB 2AD9A 2KXNB 4OI6A 2IC3B 5GAEU 1HHTP 2R7VA 2QLWA 2N3OA 1S1UB 1ZZFA 5H9FJ 1OWXA 2O5DA 3R5AA 4OX7A 3K5LA 2FIUA 1Z2ZA 3M4XA 1X4AA 4RW9A 3KKFA 1P8GA 1TL3A 2EFQA 3PKYA 1TQLA 2K7KA 1VRTA 4KFBB 1JIHA 4M94A 4M95A 2KJVA 2ZE2A 2N4DA 1FXRA 3KG1A 5IT9Y 1IQTA 3TI0A 3V81A 4ZPAA 2QSFA 1SBRA 1MW7A 1SJ4P 1XTZA 4LVNP 5EN1A 1U49A 5FJ4A 2Q3PA 4DL6A 4IOBA 5L38A 1WWHA 1FJCA 1Q8IA 4CQ1A 3G9CA 2DR8A 2E9TA 2DGVA 1U45A 5F8HA 1WNEA 4PXEA 2YWHA 2BBEA 5B0BA 2EVZA 3K8VA 3OPKA 1FDAA 4B3SF 2EFPA 1K1QA 1FJ7A 2GQCA 3KHGA 3NNAA 1URRA 1S6QA 1DFDA 4JI1F 2FPHX 2RE1A 4UQGA 2GO9A 2P9GA 1N8RT 1G2EA 1OQ3A 3KFWX 4FBUA 2VQEF 3NNHA 1N54B 5E3PA 1U1NA 1RT1A 4DV4F 3M32B 3C2PA 1K1SA 4N77A 3E3XA 3AH6A 1LK7A 3O3LA 2BR0A 4O4RA 3RZAA 3GFZA 3SEOA 4ZVFA 2WHOA 4EGLA 1KVJA 4DUYF 4RKUC 1N6QB 3M30A 1VHFA 2J0WA 1VC5A 4Y2IA 2VKZG 2AX1A 2OD6A 4I1TA 1RYRA 4DSKA 2ZITA 5KFGA 1UW4A 1LW2B 1FKOA 5IQQA 5KG2A 1FDNA 5I42A 4NWBA 3N6LA 3TAPA 2WSCC 3ENWA 3KK3A 2BVZA 3V4IB 3D28A 2JC1A 4WTYA 2XS7A 2FDNA 4OIXA 2OPQB 1KVIA 2I1RA 2IM3A 2J76E 3QWPA 1T8EA 4NLGA 2JFDA 3BN7A 4ILRA 5HLFA 1F0XA 2KU7A 2VODA 1FRIA 1HD0A 3ZC4A 1Q4RA 3KHRA 4L6V3 3POTA 2DNRA 3PW7A 3D1OA 3JSRA 4PQUB 1LXNA 2CJ9A 1UFLA 1TK5A 1TFWA 3EXCX 3CC7S 4WJBA 5KFBA 3BGRA 2ZD1B 5CYQB 3V2UC 1UVNA 3PRBA 1Q1KA 4CT8A 2CZ4A 4U7UK 3H59A 3M8QB 4XPEA 4DG1A 1R27B 4DQPA 4URGA 2ASLA 3HVWA 1RJJA 3NGDA 2YY3A 2KRRA 1WEXA 2FHOB 3Q8RB 4A8SA 3X1LB 3ICLA 4C8KA 1RAJA 2ZOMA 1YJVA 1U1RA 1S1WA 1HNWF 2RQMA 2DBBA 4OFZA 1FK9B 4IOAQ 4EO6A 5J2QB 1Q79A 3CCMS 2BJDA 4QYRA 3JAMY 1T02A 2DNZA 3BSAA 4KFBA 1FRXA 4XIUA 3RBEA 1S1TA 1C0UA 1H2UX 1RTJB 2XCPA 4BS2A 5B09A 2B6AA 1YJ9S 4ECVA 4DR6F 1QUPA 2E1CA 3PJXA 3CCRS 1Y4ZB 3M8PA 4Z37A 3IRXB 1C1BA 1MMDA 1DHMA 3GIKA 4O3OA 4OL8A 5G0RB 1PGZA 3OLAA 5MAOA 2KRBA 5KFUA 2JLFA 3DDKA 1X8DA 3EYZA 3ENVA 4DJBA 1SJ1A 3SXLA 3TUIC 5J1EB 3Q2SC 2N3LA 2CQ2A 2VV5A 1J5OA 3DRSA 2I0XA 2I5JA 5C25A 4QR1A 2CPIA 2F7VA 3M2UB 4M63A 4M5DA 3CCES 2GIQA 2ZNZA 2FGOA 3IR6B 2AJFE 3RAMA 2FLLA 3GILA 3Q23A 2HVHA 4R5PA 5B0DA 2YKOA 3ONQA 2JEFA 1MMNA 3T6JA 4NCAA 1HWJA 2M52A 3AY0A 4MMOA 2YVSA 2Z4PA 4ZVGA 2NPIA 3HHLC 3BQ2A 3LALA 3PXGa 4CT9A 2UVUA 1NH8A 3RB4A 4UUWA 3J7ZT 2A2CA 1UWBB 1S9GA 3MEEB 4U7CA 1VLYA 2CPZA 3GFYA 1JNRB 2OSRA 3HM9A 1C1CA 2MJNA 3H5XA 2PFFB 3CCTA 1N56A 2VASA 5K5MA 1JLEA 4QPTA 2DT9A 4H4MB 3PIOQ 4E0DA 3J7A1 1HL6A 2FB0A 4M5DB 2DH9A 5B7WA 1FERA 4NX9A 2CRLA 1HI1A 2JOQA 3KWMA 1H0HB 4NZ7A 5AE3A 2LYVA 2D7SA 5AE2A 4TQRA 1QVFR 4KT0C 4KB7A 1OSCA 5EUHA 4QQBA 3OVAA 3KYLA 2HRUA 4OZNA 5FD1A 4V19X 4RNNA 3OFHA 1REVB 2W9BB 2AYMA 1APSA 5HBMA 2CQIA 5L1IA 4L3NA 2AYBA 3IAM9 3EZ5A 2KZZA 1MMLA 5JXSA 3TANA 2CG4A 4LIWA 3U1NA 3WC0A 1JNZB 4A8OA 2I5JB 1T94A 1OPIA 3T1AA 2LLZA 3BS9A 2CQPA 4CH1A 3HHLB 3PV8A 1Q81T 2KYXA 2I9SA 2KVIA 1CQNA 3ISND 4GC7A 1S77D 3IN5A 2O1PA 4J9OA 3QJJA 1NH7A 5KT2A 3NNCA 2J9DE 2XLKA 3LGNA 1HA1A 3CF5Q 3AQPA 1NJIT 1N48A 4N41A 4ZHRA 2K1RB 2GQ2A 2XNQA 3KLGA 4HTJA 3CB4A 3G6XA 2UUWA 2W25A 1SJRA 4TU7A 3SZ2A 4HI1A 3OJSA 2HQIA 3EXYA 3CVKA 3DRYA 1NKCA 1KQFB 2OAUA 5IXUA 4N47A 2J6UA 4B02A 4MFBA 2OPPA 1JKHB 3DI6A 2EK1A 4YB1P 1OO0B 5DJBA 1JLBA 2HFNA 2LEPA 2C3YA 2LXUA 4B3OB 2XI3A 1WF2A 4ZCIA 1VQKS 1Y9OA 3BGLA 4DL4A 3ITHB 3J7YI 4OHZA 3OR2B 4QOTA 4USIA 1H7WA 4I2PB 1FRMA 2YWFA 1D0EA 1KLNA 1L3SA 1DTQA 5C25B 2VG7A 4QWBA 5B0GA 4BBYA 4WF9Q 3R5DA 2E44A 4C0HA 4IG3A 5KFMA 4LF5F 4R25A 1DJ0A 2R8HA 4IDKA 2BUNA 2L9WA 5L9XA 2B43A 2JDJA 1QAYA 3CDWA 3MMJA 2JRSA 4MK9A 5L1LA 1NJZA 3DOLA 1S1WB 3HP6A 1ZPVA 2MYFA 1U2FA 2KG0A 1IBMF 2YWKA 2VC0A 2MQLA 4ES2A 2W9CB 3OSNA 2RRBA 4A8MP 2V8VA 3W7BA 3NG8A 2KXHA 3HK2A 1RTJA 2KB2A 1UAWA 2A3JA 2C3MA 1IXKA 2XCAA 2ZHAA 2X3GA 3TP2A 4QWCA 4J5OA 4KTQA 5CCMA 3UR3C 1IKWA 2CZVC 3THVA 4RW6B 4O4GB 1X5TA 5M2PA 2FJAB 5LSOA 2XLJA 2PE8A 3I87A 3UNGC 3WDOA 4J9RA 3CMES 4RU9A 4RW8A 2OPQA 1Q7YT 3TX8A 1S97A 4P7TA 5CCLA 1F5BA 1GAOA 2FVRA 1JLAB 5A2QY 3PW5A 3KNAA 4PKDB 3L3CA 1RTDA 3DM2A 2GGPB 2XMVA 3O2IA 5DGAA 1RISA 4WFYA 1U1MA 4O4GA 2MY7A 1LW2A 2C28A 4ATNA 1S10A 5CHCB 2ZE2B 1RTHB 1P9QC 1ZAWA 3FJ2A 4ECZA 1T05A 2IFXA 4NMLA 3IS9B 5J2PB 3PZPA 3T5JA 3CCVS 5EX0A