3CJKB

Crystal structure of the adduct hah1-cd(ii)-mnk1.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
75
structure length
75
Chain Sequence
VNSVTISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGFDAVIHNIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper transport protein ATOX1
publication title Copper(I)-mediated protein-protein interactions result from suboptimal interaction surfaces.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport/hydrolase
total genus 19
structure length 75
sequence length 75
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cjkB00
2BYCA 4YDXA 3TOQA 2LDIA 3KG1A 2AW0A 1AW0A 3HHLC 5T7LB 1FESA 4A48A 2ROGA 2PGCA 1OPZA 1Q4RA 2FIUA 3TRGA 4OJGA 4F67A 2OD6A 2W4CA 2KT3A 2XMMA 3LGMA 1N5VA 1P8GA 1Y3JA 1P6TA 2RU9A 1CPZA 1FVSA 1OQ3A 4Y2MA 4ZA1A 5K9FA 2OKQA 2RSQA 5B08A 4DL0C 2ASYA 1JWWA 2K7KA 2GGPA 2ZDOA 3HHLD 3HFKA 2XMKA 2OMOA 1APSA 1GXTA 1S6OA 4Y2KA 1RJJA 2GFFA 2ZDPA 1TUVA 4FNHA 3FGVA 2BJEA 3GZ7A 5F0UA 4HL9A 4HI1A 3UDCA 2XMUA 3WDOA 2N7YA 2QIFA 1FE4A 1CC8A 1FVQA 3FRYA 1N5SA 1AFJA 2BJDA 3DCAA 1S6UA 1VQYA 2BUNA 2GA7A 1Q8LA 2AJ1A 2XMTA 3F44A 5B0DA 5KAKA 3KNGA 1U7LA 5B0EA 5B0FA 4NPOA 5B0AA 3LGNA 2AP6A 4EFAC 3BB5A 5IXUA 2JDJA 3HX9A 1KVJA 3HHLB 1TL4A 4A4JA 2OP5A 3QGPA 1N5QA 1GXUA 1R6YA 4QOTA 2FB0A 1OQ6A 4Q2LA 2W4PA 2HLTA 3KG0A 4DN9A 1SQEA 2K7JA 1OSDA 3CJKA 3T9NA 1YJTA 2LXFA 3TNVA 1AFIA 2GGPB 2XMJA 2RILA 4Y2IA 4ZOSA 2ACYA 1FEEA 2IYGA 3HF5A 3IWXA 3QMQA 1URRA 3BR8A 2BBEA 2RMLA 2XMVA 4Q2MA 1TL5A 1VQSA 1WD6A 2IYIA 1CC7A 3BN7A 2GO8A 2GV1A 1QUPA 2KYZA 2HQIA 2OD4A 1TR0A 4OJ3A 1Y3KA 2EW9A 2LQ9A 1YJUA 2LQBA 4FNIA 4A46A 1LQ9A 1TZ0A 2N4DA 1X7VA 1XBWA 1YG0A 2K1RA 3DXSX 4YEAA 1X0PA 4DPOA 1KQKA 3BDEA 1YJRA 2PD1A 2FHMA 1X8DA 3BGUA 5T7LA 3E8OA 2ROPA 3MZIA 2QYCA 1Q53A 1V3ZA 4NL5A 1KVIA 1MWZA 1K0VA 1Y0HA 3HDSA 1FD8A 2KT2A 2HLUA 2GCFA 3HHLA 2XMWA 2N4CA 1Y9OA 3CJKB 2HFOA 3FMBA 3I9ZA 5B0GA 5B0CA 2HIQA 2W4DA 4HH0A 2L3MA 4A47A 1YRXA 1Q8BA 2VV5A 2QLWA 1YJVA 4OIXA 5F0WA 5A6WA 2IFXA 2Q3PA 4OJ1A 1N5TA 3VTIA 4OJHA 2AJ0A 4HH1A 2G9OA 3K7RA 1JK9B 2CRLA 2OFHX 4HI2A 2K2PA 2QLXA 4U9RA 5B0BA 2HFNA 1FE0A 2FTRA 3KKFA 2ROEA 1ULRA 3MCSA 2VH7A 1SB6A 1W2IA 1SI9A 2KKHA 1MWYA 2OAUA 3BF4A 3LO3A 3IWLA 3BM7A 1IUJA 5B09A 2OFGX 5A6PA 2K1RB
chains in the Genus database with same CATH superfamily
1HPZA 3O8WA 4DSKA 2M5YA 3DMJB 3TVYA 1VQLS 5H9FJ 2VASA 3VAHA 1N32J 3DLJA 1FRXA 4BDPA 4IDKA 1RSCA 3MM5B 2LEPA 2QLBB 1HBMA 2DGTA 3WZ0A 4OHVA 2N7YA 1HNIA 2IDLA 2H4YB 4C11A 3MHYA 3AOBA 3O2IA 2KG1A 3JTOA 2QSWA 4ZLPA 1K47A 1TK8A 4DR2F 4ZP8A 3VGSA 4PAAA 2FZKB 2W1BA 3VGUA 1SIWB 1SJ4P 1PBAA 3N0VA 5L1JA 2CPHA 3CJ2A 4WYWA 2HQCA 3MZIA 3DLGB 2QO3A 3US5A 2FC8A 1VIXA 1N5TA 2DNYA 4DQPA 3MDFA 5KFLA 1DTTA 4C9DA 2W24A 1S9GA 3MGJA 1H2TZ 1G3OA 1JLFA 2K1RB 3QQCD 2IM0A 3JQMA 1N52B 2OD6A 1HNXF 5K8NA 1ELOA 4DR3J 1Y11A 2C3PA 4DDFA 3M8YA 2R8GA 2VA2A 3VVUA 3DI6A 2NXUA 2XHCA 4JI2F 1LEOA 4K59A 1HWLA 1UWBB 1XK8A 2L41A 2AP6A 4Q45A 1Z2LA 1RT6A 2HLTA 5F8JA 1HNZJ 3D6TB 3FEYB 3CJTA 2DGUA 3DRRA 1ZH5A 1URRA 4OHYA 1U2FA 3MEDB 3GV7B 2A18A 5F3ZA 3PV8A 2DT9A 2G2OA 3V4IA 3CF5Q 2DGVA 5EUHA 5HQLA 1WHVA 2IVMA 5JUMA 2V4RA 1W26A 3W7BA 4H4KC 1C1BA 1OYDA 1LXJA 1U25A 2EK1A 2CJKA 2KKHA 3BF4A 1EX8A 2B9WA 3QGHA 2A6MA 3I6PA 1Z4UA 1VS3A 4MIAA 4RNNA 2GVZB 1H0HB 3T5LA 3FBEA 4J9PA 3DGPA 1QLNA 2LLZA 2BJEA 2BRKA 4TY8A 3MR6A 5CXTA 4UQGA 1R0AA 1SH2A 2VZ9A 5FD1A 5I4MA 1KHWA 2MEWA 2B6AB 3TUIC 1U48A 3RGIA 2JH3A 1UZHA 3NOCA 2O1PA 2PMHA 2MMYA 3QBCA 3M30A 4WK3A 1Y3KA 3OR2B 3OUYA 5ETQA 4LJMA 3EICA 4O3NA 3IP0A 2PMWA 4O3OA 2GCFA 4J91A 3EDQB 4USIA 1D09B 3TJ9A 4MKAA 2HQDA 3A13A 5A6PA 4PG6A 3PO4A 3M2VA 3MD3A 3EVOA 1V3SA 1FRLA 2W7OA 1NHKL 4P9SA 2ZDOA 2MQMA 1S6OA 4F0MA 4DR3F 1M0SA 1SUQA 3WDOA 3FGVA 4RBTA 1FWKA 1HR0F 4F36A 1HI8A 1PYOB 4L72B 1GFWB 1IN0A 1RAOA 3W66A 5GADU 5E5NA 3KHRA 2ZH3A 4BHQA 4WZMA 1KLNA 5HROA 3R97A 1RABB 4DZ6A 2RF2A 1YQHA 4IKAA 1X4HA 2VL1A 4PQUA 3CDAA 3BR8A 2J0XA 4ES3A 1QAYA 2GV1A 1TL3A 2VQFJ 2GVDB 2ZBIA 2VJVA 2OPSB 4M1KA 2BJ1A 4PXBA 5HMZA 9RUBA 4DV6J 3EGNA 2WB1D 4WJBA 2NCKL 1BC6A 4NXNJ 2OEJA 2M4MA 1QM9A 2VONA 3NMAA 1WC3A 4GRSA 3CD0A 1MWQA 1S49A 3KYLA 3N6LA 2VH7A 3QFHA 2J6TA 3PX0A 2OSQA 2KDOA 1U47A 1SC1B 4HTIA 3TOQA 4ED8A 5D0EA 1X5OA 5F9NA 3R5JB 3R5AA 4FYVB 3FSIA 5DZ7A 3CCMS 4O3PA 1AFJA 4UUXA 4NCGB 3QATA 2MPUA 4CTAB 1Q79A 2BXJA 1HMVB 2X1BA 3AQOA 2ZHBA 3TWZA 3HHLB 4B3RF 4Q0BB 1RA6A 1DTQB 3P6YC 2LEAA 3K57A 1B7YB 3VAGA 3UCZP 2CUYA 3NEKA 2QJ3A 2BQUA 1LFPA 3G82B 2IDEA 1TUWA 1X5TA 5KFOA 2EEYA 2XQCA 4ED1A 2YWEA 4HACA 3I4HX 1MSWD 3HJVA 1VHIA 2HS3A 2YKPA 1M1KT 5I3UB 3UN3A 4MK9A 4DR4J 1W25A 3TEHB 2RIJA 3T1YJ 4RL1A 2CWKA 1ITPA 4F67A 2JSXA 1C2PA 2ADCA 2DGWA 1IKYB 2IVYA 4A8YA 1N5YB 2MSTA 3HVWA 5J2QB 2VB6A 2RUGA 4GKJJ 3PJXA 3GLJA 4YDDB 3OT9A 2XGQA 2OPPA 5KFPA 4DF8A 2A2DA 3H7HB 1OQ6A 2XI3A 4WIQA 3AJDA 1JQGA 2QA1A 4HT7A 1R8BA 4O3QA 1O8BA 3LP2A 4KGXB 2OPRB 3IRXA 3ETOA 4AE5A 4Z7CA 4RNOA 2J7KA 3DRSA 2JEFA 2OH2A 2IHR1 2VQFF 2BV3A 2GC8A 4CLSA 3AB2B 2MLXA 2F5GA 4DV6F 4IOAQ 3GYXB 2E7VA 1Y10A 4ITSA 3IS9A 3MTKA 4DEZA 2P9GA 1IKVB 4QCLA 4I1TA 3MM6A 2YKAA 2ROEA 3MCSA 4PG5A 1KR4A 2JVOA 2DIUA 2B9XA 3EGVA 2QV6A 4PWUA 1BWEA 4K4VA 1HHQA 3I4PA 1PILA 1SBRA 5L1IA 1N56A 3LALA 4BS2A 4KH1B 3HSDA 2FHKA 2HS4A 4WCEQ 1TP7A 2CA9A 3AA8A 3QAUA 4OZNA 7AT1B 4M5DA 3L7PA 3GQCA 2QIFA 2QN6B 3DLHA 2YH0A 2RKIA 1NB2A 2VICA 2IA6A 2G1DA 3DLLQ 1GT8A 2VBXA 2FQQB 5A2QU 2ZH6A 2XG8A 2UUCJ 2DRAA 3LUYA 1E6YA 4DCOB 2L9DA 1S1TA 4JBCA 3BDPA 4KIAA 2VQEJ 3SQGB 2LMIA 4OLOA 4DS4A 3FSYA 4NE9C 5EWGA 2ILYA 3BGUA 2ZJQQ 3PKMA 4RPFA 1U1MA 4B9MA 2R7WA 1Y9OA 3NWGA 3GTYX 4W4MA 2DPJA 3C6UA 1FTRA 3PW0A 2M7SA 4ECSA 2Y3YA 4ZVGA 5B0BA 4DR7J 5AXMA 5EX0A 2Z57B 1Q82T 3T1YF 3BGOP 1GMWD 2XY6A 2E5IA 5D4PA 4ECRA 1PAEX 4AFFA 3HFKA 3R8YA 2WK4A 2LYVA 3Q83A 4OYZA 4F4KA 3D0GE 4DV0F 5AE2A 4DL3A 4IFVA 4KFBA 3T1HJ 1ZM9A 2V2KA 5KFZA 4MTPA 3BBCA 3PR5B 2Q6CA 2NZCA 5KFVA 2FJEB 1RK8A 3BR9A 4WWSA 5AXLA 3R5BA 4KV8B 1FEHA 2NPIA 4JI0J 1F5BA 3MR7A 1ICEB 4HKQA 2AZ3A 3K5MA 3TQ1A 3KLFA 4KO0B 4N77A 4CYUB 4AL6A 3T5KA 3I31A 1NLKL 3WC0A 4RW9B 1OSCA 4RO0A 2KXHA 2MKYA 3I0RA 3LAKA 2QFJA 3QSIA 1LK7A 3GPAA 2AT1B 2GQ2A 3KFWX 3R5CA 2QMWA 1SB6A 2VFTA 1ACMB 1N0VC 1K73T 3HD2A 1TKZB 3EZOA 1R8PA 1UFLA 3QWPA 4NASA 4ATNA 4OI2A 2C2ZB 1AROP 1CJUA 1APSA 5DRKA 3CSKA 4ED4A 2YPYA 4DR6J 1ZZNA 2X1GA 3TA1A 2LEBA 3PW7A 1CS4A 1SPBP 5DG9A 3I0SA 3BBBA 4K7QA 1NHUA 4JYAJ 2AQ4A 3QJPA 1SJQA 1WI6A 2BE2B 2UUCF 2XC9A 4Y34A 4ZCLA 2LXUA 2XBPA 3NKYA 4MJKA 2J9CA 1ZAWA 2ILZA 3ISND 4P2FA 1BE4A 2F9JA 2GS8A 1K44A 3MCOA 4YHHJ 1FRHA 3JQJA 2FVPA 2BE9B 1MW7A 1PJ6A 2AJ0A 2VU5A 4ZN3A 3DGVA 2MKJA 1RT4B 5E3QA 2VFSA 4ZVEA 1Z2ZA 2W9CA 3RRGA 1T03B 2MB0B 2WSFC 2OGUA 5A0YB 2FLPA 4O4GB 1J2VA 3MR5A 3U27A 4R0EA 2KT3A 4ZVQB 3QT5A 1N8RT 4KRWA 3UDVA 3KWMA 1NCLA 5L9XA 3KDOA 2Z2YB 3H90A 5DDPC 4CO4A 4YR3A 1CULB 3KXDA 2NXNA 1SKUB 3S8SA 1WNEA 2Y8WA 4A8KA 3L9ZA 3K5LA 3FJ2A 3H20A 3FVYA 3HHNB 3EE3A 1NPPA 2VG6B 2H3EB 2WOMA 2HYIB 3PG9A 4IR9A 3W61A 2R7VA 4FP9A 4CLPA 2MGZA 1GH8A 4GC7A 1VMBA 4FNIA 3QNWB 4DL6A 5KFUA 5FDLB 2VPWB 1R31A 1IWGA 1JMTA 3ZZTA 1RA7A 3D6HB 3ILLA 4Z7YA 1I94F 4L73A 4UY8T 2CAJA 4GMKA 1NK7A 1NK4A 2CNLB 1RXOB 3VTIA 2V8HA 3MMAA 3M8QA 3ZTPA 2CQIA 4TLRA 1XNQJ 1RTDB 1T9XA 1EJ7L 4DUYJ 3GR0A 4JOUA 1D9FA 5KFYA 2DHGA 2MZQA 2EC0A 4KGVB 3C16B 1IKXA 2IJNA 5HLFB 4WTYA 3KNAA 5M2RA 1W2BR 3OD2A 4O3SA 1TKXB 4JI3F 3TYTA 1DHMA 1NUEA 2BW7A 1NXIA 2WB4A 4NPOA 1IKWA 2HNDA 2YX4A 4WKRA 5KT4A 2CQ1A 2RE1A 2HPUA 3JYTB 2ZM6J 1FRMA 1S5ZA 3JAMY 1U0HA 3T9NA 2DNRA 4LF7F 4JYAF 2OTJS 2C3YA 2IYIA 1JLAA 1EB0A 5KG3A 4DUTA 1T02A 1SC6A 4J9UE 2YXLA 4ZMMA 3POTB 4TXSA 1S1UB 4IG3B 2Z58B 4PZVA 3D68A 4I2QB 1QE1A 4LF8J 2QE5A 1EARA 3NOGA 3AD9C 2M88A 1T3NA 1WEZA 1GNKA 2A1BA 5DZ6A 4C8NA 1JLBB 1KVKA 2V94A 3LO3A 5G0RA 2ZBCA 5C42B 3ONQA 2RQCA 2ATCB 4RLEA 2HHPA 2EKYA 2Q79A 4B3TJ 4YMEA 3I5AA 3CVKA 4C3MA 5KAKA 1XMOF 1RT5B 4DSLA 2JFDA 2BJ3A 2OUGA 2XEXA 1UEUA 5L9NA 4H4MB 3QMQA 3ITHB 2KFNA 3HHKA 5HVFA 4DMZA 1RACB 1SC3B 1VRTB 1E6VA 5AXNA 3OL9A 2FC9A 1REVB 1XMBA 3R27A 1VLOA 4UQTA 2JJ4D 3I56S 1N88A 3NL0A 2XS5A 4J9LA 2RJZA 3OTDA 1QD1A 4I67A 1V3RA 3K5PA 2PGCA 4RW4A 4NYPA 3CIZA 3PYGA 3CW2C 1FKOA 1RWOB 2MDAA 2LDYA 3IM8A 3CJQA 4Q44A 2XZWA 4OHXA 1O51A 1VLYA 5IT0A 4WU3A 2RRBA 4FF2A 1X4CA 3Q8PB 4ZVPB 4X2BA 2AKWB 1D8YA 3UFCX 1D8ZA 2BX6A 2KXNB 2LU2A 2ZFHA 1JLGB 2IY5B 2CQDA 2QGFB 3TA2A 4I7FA 4UUWA 4P72A 1OWXA 1ZM4A 1WUUA 3PHTA 2B4PA 4X4SA 4G1IA 1RISA 3NCQA 1Z1ZA 4A8QA 4N5SA 3I9V9 1DQ9A 3FBBA 4DL5A 4LF6F 4EEYA 3KLIA 2R9LA 1RU2A 2XYHB 3CCWA 2C2RA 4RUBA 4CM0A 2P2CB 4F2SA 2H1YA 5LL6d 1ZPWX 5ETVA 1TVRA 1NSKL 1WELA 2CPIA 3BKFA 3WBZA 2FGCA 1IBMF 1FJGJ 1FNXH 2EFOA 3UR3C 2YNGA 3LP0A 4KGKA 3T6JA 5LMUF 2ASYA 3O5TB 3W8GA 2DIVA 1NDKA 2LVWA 4LSZB 2W25A 3OW2R 1S6UA 5CD4H 1OY8A 2E1CA 4CO0A 4MMOA 1HPZB 2D69A 2F40A 3BPSP 2FHJA 4S0MA 5J1EA 2JEGA 4FBUA 2DNQA 4X4NA 2V34A 1ZS6A 2XB2D 3W2VA 4IDKB 2MQLA 1D0EA 1HBMB 5KTQA 4HVZA 1F60B 2NUHA 3VGTA 4NYOA 5T41A 1H74A 1HNIB 1FFSB 2CPDA 1J5OA 4DL4A 4C6AA 4K2JA 4C11B 4EBDA 1AXQA 1ROFA 5T14A 4ZP9A 2HHVA 1TMJA 3ZTOA 4DU8A 3O44A 3HT3A 2L3MA 3PVXA 3KK3A 2DNKA 2ZKUA 2UV8G 3PDNA 3OTOF 3UD5A 3NG8A 4Y2AA 2XCPA 1YHQS 2MKCA 3QLHA 4ERDA 2V5HG 1Y3JA 1U6BA 2AIRB 2BW2A 4RR5A 5KT2A 2WVFA 2L08A 1DTTB 4ZPWR 4C8LA 2AGQA 4URQU 2QL5B 4X65J 1S9GB 2GJFA 2RDIA 1JLFB 4EK2A 5K8OA 4ZVHA 1CVJA 4CH7A 1GXUA 5D6GA 2I9SA 1EKRA 1RHQB 1U02A 3NGDA 1P1LA 2MXYA 2FLLA 1B0TA 3NS7B 3LPEA 3DI6B 4M5GA 5IQQA 4A8MP 3PYFA 4OZ0A 4WXWA 5HVHA 2GQCA 1FDAA 3W9JA 1KFDA 2LQBA 1Q7YT 1TZ0A 4WE1A 4DI6A 5T7LA 1RT6B 2NXCA 3D3CJ 4GC6A 1Q81T 4NXMF 4UOCA 2KTQA 1FA0A 3DRRB 1C1CA 2CWXA 2CZ4A 1T9VA 1VCTA 3Q2TC 4PG7A 2Y8YA 2RU3A 4ECVA 3V4IB 4CO2A 2E5LF 2FZGB 1H7XA 5CZXA 2CPXA 2JHEA 3BQ2A 2HHTA 5GAHU 3JS9A 4DV1J 1C1BB 1FJGF 3LH2S 3PR4A 3GCWP 1H72C 2M8HA 3VHQA 2OMOA 3T41A 3K8WA 1MMDA 3HP6A 3AOAA 2N7CA 2G4BA 1LW2A 5F3TA 3MM7A 1NU4A 3MECA 2ZZNA 3A8IA 1KVJA 1NK8A 4QBUA 5F41A 1RBOB 4TY9A 4LFCJ 5IV4A 3ZZ0A 4QIWD 3ZZUA 3DHWC 3DGPB 2F65A 5A8WA 4TY8B 1QUPA 4OX8A 5DM7Q 4K4TA 1R0AB 5DGBA 2FVCA 2FJWA 3H2VE 5GVQA 4EMDA 1IR0A 4QIGA 1FI4A 1RTJA 4ENOA 3M6UA 1K0VA 2BJ7A 2R8JA 3Q2SC 4V19J 3W65A 1C4AA 4OZJA 4XO0A 4OJ1A 4FZVA 3FKBA 3KLGA 1BGXT 2W8KA 1A6LA 4HH1A 3TX0A 1FX4A 3OTCA 3M30B 3OUYB 3P5BP 4NYZA 1SXLA 4R8UA 2L9NA 3MD1A 2P8IA 3FCWA 1WACA 5KFEA 1FVSA 5B08A 3AD8C 4ZPVR 4B3OA 3HHLD 4LF4F 4MKBA 4B9NA 5CQGA 2DCUB 4P75A 4CLWA 2KT5A 4X65F 3Q8UA 1UA1A 4NLPA 3M2VB 2OSRA 5GAEU 2DHSA 4KJIA 4RNFA 2MZJA 1KTQA 1RAIB 2R8KA 4ED7A 1SUQB 2WCXA 4OI6A 1UAWA 4P52A 2HQIA 1I3OB 2ZJPQ 3R6GB 2EFGA 3QFWA 2QZ8A 4RJVA 3GP9A 3NRBA 3UN5A 4U7UK 3RBEA 5HROB 4TU9A 2LQJA 4HYKA 3CJ0A 3W3SA 2OI2A 2RF2B 4DS5A 4LVOP 4PG4A 4PQUB 4RW8A 4LUBA 1NEEA 4YP3A 2FJVA 1QTMA 1TL3B 1H3DA 3M7VA 1FE0A 1JNRB 1NPKA 1UCNA 2D3ZA 3PW4A 2HBRB 4AQYJ 1R8HA 5I42A 2R2RA 1SC4B 2C22A 3NAIA 3OXLA 4PQAA 1Q4RA 2CNNB 3G2XA 4ZVUB 4NCBA 4CRJA 2XMMA 3BSAA 2VHGA 3V6HA 3IXQA 2B0GA 4Z2XA 4C8MA 3U1LA 3ISZA 1RQ0A 1WKKA 3QT7A 3PEHA 2ZD1A 4LREA 4OYPA 5H9EK 3PIPQ 1WOPA 3MEEA 4ZOSA 2IYGA 3KJQB 3CCSS 2HHXA 3HJFA 5D78A 3R1LA 4IRCA 1K1QA 5GAHI 4RW6A 9ATCB 4ES1A 3MEKA 2DNZA 1KHVA 5C24A 2KM8C 4WXOA 4G6VB 4ZITA 3KK1A 1V5IB 3HHLA 3V6DA 3O1LA 4ED3A 1FRKA 2E29A 1Q8BA 3GJSB 1YRUA 4PRFA 1JX4A 4WF9Q 3Q24A 2D1CA 2CFXA 1U6FA 2BM1A 2JRSA 5KFNA 4ECXA 5AXKA 2HRYA 4HACB 2IJFA 5KFKA 3FQLA 4NRTA 3H42A 2ZBRA 2J9EA 3SSRA 1B3TA 1GAOA 3NXZA 3WHIA 2HQFA 1Q1KA 5KG6A 3C6TA 3EDRB 4ZVTB 2DNLA 4OX9F 2I2YA 1OY9A 1NDLA 2HBYB 3ZFVA 5LXYA 5IT4A 4CZCA 2CIMA 4IO9Q 4OL8A 3UCUP 4ZPBA 3S6EA 4XTTA 2RQKA 1SQEA 4FYDA 2LXFA 3CPWR 4ECTA 2XMVA 5F8HA 3QGGA 4NLXA 3MXHP 2YH1A 4LR9A 2OPPB 1Y7PA 3HT0A 3OFFA 3CO9A 2YQ1A 4JB8B 3FMBA 4LF9F 2IJRA 3LP2B 2A10A 3IRXB 4ELVA 4QYZK 4KAIA 5GAEI 1LOUA 4YR0A 3PKYA 1L3VA 3DRSB 2CQ4A 3AD7C 2VJUA 4B9VA 2MJNA 1RTIA 2D3O1 3HXMA 3ELHA 1FK9A 2YY3A 1AZSA 2KI2A 5FLXY 3IS9B 3JQKA 4DHVA 1GXTA 4MYTA 5IT9Y 3RR7A 3D0IE 5DG8A 2WONA 4HHJA 5BYRA 3MM6B 5KFCA 1X9MA 1S59A 3T1AA 5HP1A 4AL5A 4A8XA 1CJTA 1C0TA 1U6ZA 5HVGA 3HSZA 4NA3A 1G7CB 5IC6B 1T0TV 1XMQJ 2DR9A 1K9MT 4M5DB 1WTFA 2AEJA 1HYSA 4PG8A 3W9IA 1GQEA 4C3LA 2RKIB 1EP4A 2KYXA 2QA4S 2UVWA 1B4SA 2PC6A 1X0PA 3EMTA 2XYGB 3KG4A 2KJVA 1DRZA 3B6BA 2AEFA 2KM8B 3FC9A 2RT3A 2MZ1A 2JC0A 5GAGU 2Q1LA 3UO0A 5D0HA 1E6YB 1S1TB 4CLUA 2I6WA 3Q0AA 2CXEA 4OI3A 3QRRA 3S1TA 3EPGA 4XPCA 2Z2ZA 4N8NA 3C14A 2JZ5A 1SJFA 4X84A 2DO0A 2V2VA 4C0HA 4I64A 3C6UB 4MIBA 2ZUAA 3BS9A 2E9TA 2MQPA 2V4JA 3IG1A 3CJ5A 4Z37A 5A8KA 4JV5J 1NKBA 1U1OA 4WZQA 3QGPA 1R6VA 4C2MA 5HMYA 1IVZA 2YWFA 4ID5A 1RLCL 1X5SA 4P73A 2ATLA 3AA9A 3Q23A 4LBIA 4YY3J 1S48A 2XO6A 4M63A 4KHRA 3ENQA 5LSOA 1KNZA 4IFVB 4KFBB 3BH7B 2MQQA 4DV3J 5DDQC 1X7VA 1YITS 1GMVA 4F2RA 2HRUA 1HWIA 2DO4A 1ZTWA 4MH8A 1QVGR 1JXVA 2ZITA 3GFZA 2VDIA 1FRIA 4XAKA 2CPJA 2DRDA 2R7UA 2HFNA 3D54A 4TN2A 1T9WA 4PABA 4Y0FA 4DV7F 4ELTA 3KLFB 3N9UC 5C2GA 3GJQB 4MIWA 1VBYA 1N5VA 3I0RB 2UVVA 2OJ3A 4P10A 3QO9A 2MKKA 1EETA 2UXBF 4F50A 3UN2A 3HCXA 2ZWOA 2KVIA 4ICLA 1OYEA 3IBWA 4UW2A 1LFWA 1U49A 4FKYA 4U95A 1TMMA 2RAQA 2DHHA 1LW0A 1CJUB 4KHPJ 4LF2A 2RMLA 5D4NA 1WD6A 3ISNC 3GCXP 4DX8H 4UOGA 2D9PA 3CCLS 1CS4B 4FS1A 1F9FA 3ZZRA 3Q8QB 3I0SB 3ZTSA 4B3SJ 3G6VA 1YZ7A 5DQGA 2P6TA 2FVSA 1KD1T 2ZBQA 4W92B 4ILLA 2HVZA 5KFHA 2PFFB 1WEYA 2QA2A 4NLTA 3OVBA 1CJKA 3IR5B 3LWLA 3SV4A 3E01A 1H6KX 4DLEA 3KK2A 1D9DA 5KFGA 1PCAA 3VV2B 4KR0B 1VBZA 1YSJA 4DLGA 4QR0A 3BQ0A 2WVCA 4X64F 2BKNA 4JUZA 4PKDB 3VQSA 2LFVA 3C66A 2E7XA 1GMUA 3DCAA 4OZ1A 1BXNA 3MWBA 4ZVFA 2W9CB 2DNMA 2EI5A 5GAGI 3HHEA 1HBUA 1RHMB 3FZBA 2W9BA 2R2UA 2VUGA 3G96A 3SXLA 2BKOA 4USJC 1VHFA 1WSVA 4ZKAA 3UE2A 1S0VA 4ER8A 1LKZA 1FEEA 3C19A 3CO0P 3D6MB 3R2CJ 4QU6A 3OPKA 3BSCA 3FBCA 2D41A 3M05A 3OSPA 4JI4J 1GXLA 2CJQA 4LRBA 2D3UA 2PD1A 4DV3F 5KFWA 3R1HA 1HLWA 1UVKA 5HQ8A 2WOMB 2YKQA 4U96A 1RAHB 1UZDA 2HNYA 3BO3A 4DV2J 2R7TA 2Z56B 4F0HA 2MGZB 2FLOA 4OYWA 1ZYQA 1FXLA 2EWHA 3E51A 4C8YA 2W01A 7FD1A 3AAWB 1AW0A 2MY8A 1FESA 1ZA2B 1WTBA 2LA6A 2RB7A 5J2MA 3PJWA 2KHDA 2XO7A 3FFIA 3HMJG 4EU0A 3NGRA 4NX9A 1U4BA 4U7UD 3MMAB 3M8QB 3M9NB 3T19A 5M2UA 1WF0A 4ZLJA 1X9WA 2R7SA 2G0JA 4L6V3 3NY0A 1IM4A 5KG4A 1IKXB 3NNHA 1SVDA 3CJKA 3GIKA 2W9AA 4BLGA 1UFKA 2WVBA 4DV5F 2KYZA 3GG1A 2Q6BA 1RAGB 3G6ES 1MN9A 1IKWB 2Z0GA 1FDBA 2HNDB 3DU6A 4UZBA 1N48A 1WHYA 3GWCA 3E8OA 4DJBA 2JFKA 3D7SB 3LA0A 1U0HB 4I56A 4LFBJ 4U67Q 4HDHA 2LA4A 2XZDB 4JI8F 5SUHA 1UVJA 1JLAB 1NK5A 3WX4A 1ZTTA 2DEJA 4YOEA 3MPWA 1Q5VA 1QE1B 3M8WA 2K7KA 4F4WA 3H5XA 4ECWA 3U1NA 3D1OA 3R5GA 4TLQA 4W98A 1UL3A 5G0RB 3ET6A 4L74A 5IXUA 3N01A 2KB2A 4EGLA 4J9MA 3CCVS 1YJTA 3VWSA 1FNOA 1FFWB 3MOZA 4UOFA 4LIWA 4YB1P 5J2NA 5D15A 1YDLA 2EW9A 2LECA 4IH5A 3OR1A 4EO8A 2PSZA 2C3UA 2DPIA 3HKWA 3G71S 1XR6A 1PSDA 4PYAA 3DDKA 3Q86A 4LF5J 1YJ7A 1Q8KA 4NLGA 4CLYA 5DLFA 1M5HA 4J9QA 4I0WA 5B09A 5KFRA 2CQ3A 3MMCA 2YBVA 2XS2A 5CAAA 4OMFG 4DR1F 1RWVB 4ZS6A 4DL2A 4ZIWA 3EJMA 1PIEA 3K0JA 1E6VB 2OMLA 4X4QA 1N6QA 4K0KJ 2VOOA 4DCPB 1VR6A 2R7QA 4W90B 1FHTA 2QFIA 3M9MB 2ASJA 2ZEJA 3DM2A 3J81U 1F9HA 4RU2A 1JNZB 2ZJRQ 3HM9A 4RW4B 2RQ4A 1FKOB 2AYMA 4F04B 3LQVA 2ZHOA 5AJ3J 2XMJA 4EYHB 2ACYA 4ECQA 2OIHA 3WQPA 4ED2A 1RHUB 1JB0C 3PRVA 3NGTA 3H59A 2DXDA 4X62J 4M5JA 4QIEA 2POKA 5KFXA 4CLKA 4XIUA 4LR8A 1Y0HA 3BYPA 2ZBPA 2R4FA 2VF3A 2VG5A 2F8EX 4I7FB 4NZ7A 1G2EA 4RUAA 3K2YA 2BM0A 1I6JA 3IWLA 3LTOA 3MPYA 4FYYB 1WKLA 5KG1A 4HR2A 4X4VA 3GSIA 2I38A 4TYBA 1YZ6A 3KLIB 2HEKA 1XEZA 2QG9B 4QIFA 2F4VF 3PJ9A 1IBLJ 2PIIA 2LP4A 3M2UA 2ERRA 3UDCA 2VFRA 4NLRA 5E3PA 4TVAB 1TVRB 1TTHB 3N6NA 4FF4A 1CQNA 3X1LB 1QTNB 3BB5A 1IBKF 5DLGA 3LANA 3ENAA 4USVA 4QOTA 4GKKF 4LSLA 2YNGB 5BR8F 3LP0B 2W7PA 3D66A 1U1PA 4RW7A 4L3NA 3CCQS 2MQOA 1KFSA 2OTLS 2DCLA 2I1RA 1SJ3P 2N3LA 5J1EB 3WC2A 1KLMA 4USWA 4A8SA 3AXMA 3W2VB 2DH9A 3Q89A 1L3TA 4NI2A 1KQFB 4D3HA 1N34J 4QQBA 3D4JA 1TFYA 3KKFA 2UUBF 1ULRA 2BOPA 1J5OB 2CPYA 1B0VA 3G87A 2XHWA 2PI4A 4AXIA 3I82A 4JI5F 2C2KB 4OX7A 1PYSB 2J6UA 1XNRJ 2MQNA 2HRTA 3KK3B 3ZXWA 5E3CA 4K0KF 5KT5A 1P1TA 3HX9A 4DR5J 1TL7A 5LJ5Y 2O66A 3QLHB 2BA9A 2VBWA 2G1HA 3L09A 3QJJA 2HZVA 3PYDA 2YX1A 2V6AA 2BBEA 3TJ8A 5EX3A 2JEIA 3GYGA 3VCDA 4ZJOA 1S7HA 3A1YG 2B51A 2RHSB 1WEXA 4X62F 3LAMA 3LP1A 3M1VA 3FDSA 1PGZA 2DXFA 1U2CA 3ILIA 2DGQA 4LSNA 3SFUA 3EPIA 2C2DA 4JI6F 2L9WA 2G9OA 3RBDA 1S99A 2FTRA 3R3TA 1X4BA 2J9DA 2HHHJ 3K5NA 4KE5A 2VBZA 1X4AA 1NKCA 4WE1B 4B3MJ 2WW4A 5T7LB 4C7QA 3LGHA 1Q7LB 1C1CB 1KRPA 2BANA 4LR7A 5IWAJ 5H9FK 2V69A 5CZVA 4NLSA 4ZVSB 4FF3A 4O3RA 1UVLA 2ZH1A 2R2SA 1NJXA 4B08A 4OV1A 4LMZA 3MUMP 5D4LA 2WW8A 1S0MA 3HF5A 2ZOGA 5L1LA 2RD5C 2XWXA 4OYBA 1LW2B 2C3OA 3ILOA 3MM7B 3MECB 1HNWF 4J9NA 2GW8A 5IOLA 2FDNA 4U7CA 3CB4A 3W5ZA 2I8EA 3S01A 3EGZA 1KVIA 1N33J 5ETKA 2AMCB 3EZUA 5ETOA 2QLWA 5A8WB 1YBAA 1FJEB 1N32F 1BY9A 3PIOQ 3E2EA 3TX8A 3AFGA 4C8KA 4JI1J 2LXIA 4HLBA 3NCRA 1RTJB 3HHLC 3NGKA 4J9VA 2X1FA 2ZOMA 3UVJA 4ZA1A 3FRZA 1LXNA 2FHOB 1UPPA 3JB9k 2Y1IA 3KLGB 2ZZTA 3QWUA 4PUOA 2XM3A 5KFSA 4KHMA 3M2RA 3GYNA 1KONA 4R8UB 4X4PA 2IM3A 1Q95G 3HO1A 1NB7A 5KFFA 1ZBTA 4ILRA 4B3OB 5ETSA 2QL9B 2UVUA 1VJWA 2XSFA 3L7OA 2VFVA 3HPOA 2YPZA 3CTRA 4DUZJ 3W1YC 2V9KA 5HQMA 3G4SS 1L3UA 4GO7X 1VK8A 2PE8A 4ZPTR 4M5HA 3A8KA 5KFQA 2GNKA 6AT1B 2PN6A 1FD8A 4I2PA 4I6AA 3MFIA 4CH0S 1QUVA 2UP1A 2QMUB 3DNCA 3BKTA 2K3KA 1UETA 4H54A 3OFGA 5L8RC 3HFZB 4U9RA 2VPYB 2GJIA 1U1RA 1UA0A 1UJ6A 5ETPA 3AJ2A 4ZPCA 2JNJA 1NK0A 4Y00A 2XMAA 4XK8C 4P7VA 3PY8A 1WC4A 1YK9A 4RW8B 5J2PA 2FJDB 4ZPAA 1UWAA 1HNZF 4Q7AA 3IM9A 2AYEA 2VG7A 1TKTA 5I42B 1VFJA 5KG2A 2EG1A 1VQ4S 4RZRA 1ZZFA 5HBMA 2WTFA 2KFYA 2DNPA 4BWJA 1HBNA 5KOXA 2AGOA 4DPTA 3K59A 4PPDA 3KMQA 3EUNA 4IOCQ 3I87A 5DS7A 2IBKA 2I5JA 4KB7A 1M5PC 3H0PA 2ZH5A 1R0BG 3F0NA 1SL2A 4LBPA 1XBWA 1DQ8A 2ZD1B 4FN5A 5L46A 1RTHA 2EVZA 2I0XA 2B8QA 1MG7A 1DZ5A 1WC5A 3PNIA 3MEEB 4FPIA 3PCOB 4RW6B 2H5IB 3FNNA 1SJRA 3SMZA 1HQEA 4OYXA 5KFBA 5C24B 3I5CA 1MROA 1C0UA 2AW0A 3P3DA 3OHBA 4JI1F 2C1EB 1M5KC 3KK1B 2A0FB 3V6DB 1PG5B 3PTWA 4AXJA 2ZDPA 1GEHA 5F0UA 2ZVSA 5L38A 3P8BB 5C5JA 2HNZA 2XY5A 3FQKA 1S79A 1U1LA 4LIRA 3BN4A 3EVWA 2MZSA 3C6TB 4P7TA 1L5UA 5IFMA 1LNQA 1O0PA 3M6XA 2IVFB 4PCQA 3KUGA 4J9SA 3H5SA 1UW4A 4QWCA 3HI9A 3MR2A 4KQZA 3TZWA 2XYPB 2ROPA 1V3ZA 1S9EA 4KPYA 2Z4PA 1UW9A 1UEVA 3BBFA 3I55S 3VAJA 4JV0A 3MOJB 4DV4J 4OQJA 3THVA 2HIYA 2EFQA 3GFHA 4GVBA 1JJCB 1HI1A 5KT7A 2RUSA 1B70B 2H65B 1FERA 5BXIA 5A2QY 4M5NA 1U24A 4LFAJ 4I68A 3OFHA 2V67A 4DL0C 3AOCA 1DARA 3L4BC 1RWWB 4FNHA 1KTVA 1N5SA 3IRWP 2D3OR 2LQ5A 3NP5A 3VZHA 1Q8LA 5HI7A 4X4UA 1RTIB 3SZ2A 2C2OB 3D5MA 1VYAA 1LWFA 2MYFA 3ILJA 2PDAA 1PC4A 1FK9B 1AZSB 4CLTA 2K7JA 3CD6S 1Q0NA 4X66J 2B4OA 3B4MA 2WONB 3JTNA 5GADI 4DFMA 1ZM3A 4NXNF 1J5EJ 1SL0A 1Q8IA 3KJFB 5HP1B 3TZYA 3KUEA 4L76A 3SV3A 2PI5A 1CJTB 1C0TB 1X8DA 5HMWA 2G2YA 2WSEC 2PO4A 1U1KA 2HLUA 1CG2A 4MFBA 2GJ2A 3PO5A 4PWDA 1NZAA 1HYSB 2V8VA 5D3GA 4CLZA 2C2EA 1EP4B 1SI9A 4DSFA 4CT8A 2MKHA 4URGA 3CCUS 1TFWA 4M5MA 1XN9A 4CNZA 3EWGA 3M9OB 1FX2A 3LGMA 4ZJQA 2K8GA 3AH6A 4A8OA 3GFXA 4C98A 2D9OA 3IN5A 2DEIA 3TAPA 3NBPA 3GJTB 4ANDA 2B4VA 1LWCA 4KPCA 5K5MA 1HD0A 1S4EA 3J7A1 4KBIA 3T6BA 5KFIA 3OXGA 1P9YA 2EC2A 4K4UA 3C14B 5GMDA 4WU2A 3CCES 1YGYA 2M0GB 1UTAA 3NNAA 2AWZA 1WF1A 1URNA 3IC1A 5D4OA 1RLDA 2V4JB 3J7YU 3OJUA 3IG1B 2ZHAA 4B17A 2DTJA 3CMES 2XI2A 5A8KB 1TAUA 3JSRA 4UT4A 4ZP6A 2HQ3A 1YJRA 2Z8QA 1HARA 4DR4F 1V5VA 3IBFB 4M8LA 2H51B 2HWHA 4KKOA 2YWHA 4ID5B 3V81A 3GV5B 1KEKA 3Q8YA 2HFOA 3OBIA 2DGOA 1VQ9S 1JKHA 3TUZC 2J5AA 3Q8VA 3K5OA 2HGLA 2XY7A 3B8HA 2YKMA 4G1QA 3H2LA 3T5JA 3OL6A 2C42A 2RVJA 4GKJF 3O3LA 4OJGA 3CJSA 1H2VZ 1NNDA 2R8HA 2HAFA 4OZ2A 2ZE2A 3RTVA 4KSEB 4UTGA 1LWXA 1U7LA 5B0FA 4BWMA 3MF5A 4WIIA 2KFZA 3DDNA 2F9DA 2FD2A 1FF2A 3IWNC 5C7PA 2VBYA 2GMLA 4IOBA 1OSDA 4FS2A 1AFIA 4QU7A 1WG5A 3BO4A 3QO9B 2YKNA 3GIRA 1NHVA 1EETB 1D3WA 1T95A 3N5FA 2YVSA 4ICLB 1FFGB 4ZHRA 1HQUA 4LRFA 3IA0A 2VODA 4FYWB 1KOHA 3SCLE 3BKUA 1CEZA 4L75A 2KT2A 2HAIA 2ZNZA 1LW0B 4RUHA 2AYBA 4N76A 1F2GA 3DDIA 1RU1A 3MMBA 3MM8A 1X4DA 3D6FB 4DX6A 4NA1A 3CD5A 4I69A 1RWNB 4FDFA 2M52A 3RZAA 2GIRA 2BOAA 2HFVA 1DLOA 1RTZA 2IA0A 4LVNP 4F3QA 3VVTA 1FXDA 1M5SA 3CGIA 1CJKB 4A4JA 3E01B 2VQEF 1WDDA 3KK2B 3V6KA 2WBRA 3ZZOA 1QAXA 1RT1A 2CNKB 3W2WA 2RILA 1H73A 3QIDA 2V8DA 1VRUA 3HK2A 2QMXA 4RX6A 2ZH8A 2J6SA 1YRTA 2WHOA 1HBUB 2W9BB 4DR2J 2FHMA 3NMRA 5E3AA 3QIPA 3UNYA 2MY7A 4DR7F 2CPEA 3G6YA 5B0CA 1RP5A 1U8WA 2DNNA 2ZUGA 3HVAA 2HFUA 1HHTP 1QDUB 2GO9A 4RKUC 3Q22A 3UPFA 4EI2A 3BEGB 3SSQA 4QPXA 5K8MA 3ADAC 4CI0B 1REGX 4DFKA 3T1HF 2W8LA 2KH9A 4EUVA 3C8YA 3A3PB 4F7VA 3BQ1A 2HNYB 2FJXA 1X9SA 1NH7A 4AT1B 2JWNA 1HNXJ 3U02A 4PWWA 2IIHA 2V4QA 4ED6A 3TJAA 3OL8A 2R42A 3TANA 4JI0F 3VF0B 3VGVA 4RWXA 2PT0A 1GX6A 2WSCC 5J2MB 2NQPA 2E1MC 5MAOA 3FFIB 5ETNA 2W2QP 3HSJA 5EWEA 1S6PA 3UDEA 4R0JA 2NZ4A 2QT7A 1NO8A 4K5RA 3BREA 2H5JB 2DR8A 3OVAA 2E5HA 2EPIA 2GHPA 3IGNA 2DBBA 1IR1A 1S1WA 3CJKB 3DOMA 3ZNUA 4OV6A 1U2RA 3TA0A 3A4TA 2AD9A 1WDTA 1L3SA 3IAS9 4HI2A 3O6QA 2KU7A 4KYZA 4I6YA 4L3KA 4CCHA 4YDXA 1U1QA 2DY1A 1R7IA 4HEA9 3HZEA 4DR6F 1WWHA 2BVZA 2IC3A 1RWKB 4F3OA 1QSSA 2F4FA 5KFMA 4YFUA 1NSPA 2QLJB 4CLLA 3R7BB 5KFAA 2J0WA 5JJBA 1TQLA 1RAEB 4NOHA 4ZPDA 2R7XA 3EYZA 3JSBA 3IWXA 1RI7A 2FY8A 1HW9A 1CBKA 2A6OA 4K4ZA 1F5CA 1XWLA 4YHHF 1S97A 3ET6B 1X0FA 3EX7B 3ZO7A 5HO4A 2MLZA 1WOOA 4TU7A 1T9UA 3RR8A 3KLVA 2DK2A 1YJVA 2BACA 3OL7A 3NAHA 4OZ3A 2CRLA 5J2NB 5I3QA 4C8ZA 1MWYA 2Z2MA 5HN0A 1WORA 1X60A 3OR1B 4ZVRB 2X7IA 1WC6A 2C3MA 3S7RA 3AB4B 1S12A 4IH7A 2VIHA 3BZQA 1YJ9S 5IV3A 1XJWB 2ASLA 1Q16B 2V0NA 3BGFA 4AYBD 2DH7A 3GV8B 3T5HA 2FJBB 5DQIA 5B0AA 3ENVA 1RT3A 3MMCB 2OPQA 1HQ2A 2LKZA 1N4LA 2OP5A 2XZTB 2EKNA 5ETTA 3QGIA 1HR0J 2DR6A 1EIYB 3SEOA 1N6QB 1XC9A 4IG0A 3TNVA 1RYRA 1S57A 2FHJD 2HWIA 5LMNJ 3D1QA 1FCAA 2PA3A 2B7BB 2VKRA 2ZVIA 1HD1A 2E1PA 3TUPA 3KHLA 3B78A 3DM2B 3OQ2A 3L7UA 5FIIA 1HA1A 1XNQF 3I32A 2NS1B 5IM0A 2DHAA 4DUYF 8ATCB 4USKA 5DQHA 4RNMA 2XNQA 5A6WA 1QSLA 4E0DA 2NUUG 2HSEB 4ZJLA 4HHUA 4QW8A 4R5PA 3BM7A 2DHXA 2ZH4A 1BQMA 1A0OB 2GIFA 4ZLLA 2RHQB 2AV5A 4DZDA 1SCJB 5F9LA 1RE1B 4OHWA 1CPZA 4OYOA 1VC6A 1P9QC 2VG5B 4FBTA 1TUVA 1KQGB 4F8RA 1Y5IB 2ZM6F 6FD1A 4MK7A 2VOPA 4EO6A 1RCOB 3RBXA 3TEGA 2AJ1A 1R0CB 2Q66A 1T9TA 2J7WA 3QAEA 1Q5YA 3CJ3A 3UI3A 1U0SA 5HK4A 5CYQA 5U47A 2CJXB 3SCJE 2JL9A 1YBUA 3M2UB 1JJHA 1HBOA 4B3RJ 5D0GA 5MLCV 4BBYA 1UKUA 4LF8F 2J0QD 2WAQD 5LSRA 4M94A 2EFVA 1T3OA 5AT1B 2QYCA 1BQNA 4LSLB 3CCTA 1SKSA 1N54B 3RW7A 3KHHA 4RW7B 1VQPS 2LU1A 1QVFR 4QWAA 2KHCA 3DRYA 2HHQA 4WFAQ 3MCMA 3A8EA 1T94A 4O44A 4B3TF 1B7FA 4BC7A 1UP1A 1WHWA 3KG1A 2YQ0A 1KLMB 1YBTA 4B9LA 2EXUA 5CCMA 5IZHA 5E7OB 1TV6A 4C0BA 3B82A 5HL7Q 4MYUA 1RJJA 2GAGC 4NI2B 3GZ7A 4HL9A 4KY3A 2XMUA 2UUAJ 1FE4A 2CQGA 3PX6A 4R25A 1U09A 2GA7A 1QSYA 5GMEA 1PC5A 2O67A 3K17A 3HVTA 4QPTA 4CO1A 4F25A 2HMIA 1PKUA 3FSXA 2RNEA 4DG1A 4PXDA 3TVZA 1CC7A 2ALZA 2B9YA 3OTBA 2HZAA 3HLUA 1VDHA 5LMNF 1SQGA 2AF6A 2DGSA 3MM9A 2JLGA 1U45A 1TL7B 2B3TB 3N4WA 5CCLA 2QL7B 1ZPVA 4XDCA 2ABYA 5DM6Q 2F3JA 3G8QA 3CDBA 1S4FA 2WVDA 3TI0A 2YNIA 1VQKS 3HKZD 4DF4A 1NH8A 1WKJA 2B5JA 2YX7A 2YTCA 3M1VB 3LP1B 2RDJA 2ZH7A 1DJ0A 1OS5A 1FJ7A 4LSNB 4KGZB 4ED0A 2DH8A 3EGWB 5KFTA 1U26A 1FVQA 2E7WA 1VQYA 1I51B 3DU5A 5B0DA 2JDJA 2H4WB 1MU2A 2HVDA 5J1PA 1NMEB 4DU7A 3DRXA 3SYZA 1EHWA 3GILA 1SQFA 2DKOB 2NLWA 3JTPA 4FYXB 4HT5A 4BC9A 2E5JA 2BANB 1A7GE 2JC1A 4DSJA 4NRUA 4IRKA 3CDUA 3ZNJ1 2GQQA 3R9LA 4H4OA 3EZ5A 3CEDA 1RT2A 2VD3A 3J7ZT 5JXSA 4NL5A 1LWEA 5CYMA 3SIPB 5JMNA 4Y3CA 3NGSA 2HIQA 2VV5A 2XS7A 3RB3A 3M8PA 1CJVA 4K8RA 1JK9B 3NLCA 3NGUA 5EGYA 3K8VA 3TZZA 1JLCA 4QJVA 3A3NB 4F3MA 1PYTA 4KTQA 5JVGQ 1T7PA 3DYAA 2NSBA 1N0UA 4Q8EA 1B0PA 2XMKA 3OHAA 4DL7A 4Y2KA 3KLEA 4HI1A 2MHNA 4B02A 4OX6A 4M5IA 2SXLA 4F0KA 1SV5A 4DQSA 2BEFA 2W2OP 5BYQA 1RWUA 2UUAF 4DPUA 3BGLA 1JJ2R 4X4RA 2FVQA 3AXKA 1K0TA 3UVJB 4DV0J 1NK6A 4G3IA 2RQMA 3RYLA 2GO8A 4PUOB 3RB4A 3M2RB 1YJUA 3EVMA 4F4XA 2AJ2A 2ACMA 3V6JA 3OXFA 3DOLA 4C8OA 2FY1A 1SIZA 1EQMA 4A47A 1R3NA 2P9CA 4WPAA 2HURA 3Q8SB 3P45B 1BUXA 4MAKA 4E98A 3AY0A 1WSRA 2X3DA 2F1FA 2HBZB 4I2PB 2CVEA 5CYJA 4QYRA 4WP8A 5E0OA 3IFEA 4J9KA 2GGPA 2UU9J 2DXEA 4QWBA 4UOHA 5DGAA 5HJYA 3KJNB 3DLEA 3LGNA 4JI7J 2Y9HA 3PRDA 3MAHA 3D2WA 3VAFA 2O3DA 3DLKA 4DN9A 2IM1A 5E33A 1IJEB 5J2PB 4A8WA 3B4DA 3R6LB 3AT1B 2KZZA 4FVMA 2KO1A 2VG7B 1TKTB 4CO5A 3N79A 5KFDA 1DURA 5HBMB 3KLHA 5F8GA 5C25A 1HBNB 1S6QA 1S1XA 5AE3A 3H4DA 3RB6A 3I9ZA 1NSQA 2IFXA 4LRAA 1S0NA 2I5JB 4DV1F 1SH0A 2BJ8A 2Y0SD 1IUJA 2FPHX 1BWVA 3D1HA 2IAJA 1RTHB 1OPZA 1KBRA 1R8AA 4NLVA 1BD6A 3ZZPA 2P5VA 1VQOS 3OVSA 5FJ4A 3G8TA 1FRJA 4LFCF 1HQEB 2CPFA 2HHUA 4FXDA 3KTQA 2HG4A 1MROB 1C0UB 3KJVA 3RRKA 4HHHA 2JVRA 2AX0A 3CJ4A 4C48A 1RWPB 1EQ0A 3V4MA 4CO3A 1F1BB 5F8IA 2DNHA 2E1RA 1RAFB 4MT1A 3TO8A 1KP6A 1RT7A 3P96A 2HK3A 2HNZB 3QZ7A 4DXLA 1TAQA 2PEHA 1EAYC 3WX8A 1WG1A 1VQNS 2P6SA 1JLQA 3JSMA 2YNHA 5EHHA 5JVHQ 2M3DA 2A3JA 3GFYA 1I94J 1W2IA 3MAQA 2CJYB 2H48B 1N36J 1S9EB 2AEMA 3BJYA 1OJ4A 1RGVA 5E2QA 2KJWA 3SDEA 3LWMA 2UV8A 5E41A 3KUHA 4ZCKA 2UU9F 4GVBB 3GJRB 2YNFA 3THTA 4YB6A 4ECUA 3MCNA 2R8IA 5DDRC 2RH3A 7FDRA 3LF0A 2YKOA 3TAQA 3ZTQA 2D74B 3M32A 2H9ZA 4JI3J 3UW1A 4JI7F 2W4PA 3A12A 3HZGA 1Y00A 1W7WA 1X5PA 1FWPA 1RHKB 3BGRA 1X4FA 4RBVA 4DQQA 4LF7J 5ETLA 1AT1B 3GIIA 3MAAA 1LWFB 3H40A 3H98A 2K06A 3CC2S 1VQ5S 3HDSA 1FD2A 4TKTA 2KL8A 4YR2A 4OYIA 4LRDA 4AQYF 5B0GA 3U1MA 5HJXA 4PXEA 1JJ4A 1FWLA 1JXLA 3QT8A 2K3IA 1GMWA 3ETMA 2PA8D 4YUDA 1R89A 3F41A 4DSEA 3CE8A 2QRRA 1RADB 5CHCB 2CG4A 1P8GA 2Z30B 4NLWA 4Y65A 4ECYA 4MFBB 1ZM2A 4PWDB 5D3GB 3M8ZA 1NKEA 4OYMA 3GR1A 1ZAVA 2BUNA 3HULA 1NAQA 5D8HB 1D9AA 2H54B 1HHSA 3P5TL 3CCRS 2FB0A 4OI4A 2XTJP 3UNGC 3OLBA 3P49B 2CQHA 1YWXA 2V2ZA 3KMSA 3CDEA 4LRCA 3NBPB 1XMOJ 4P2XA 1LWCB 4WP3A 1BQXA 4AL7A 4J90A 2RRAA 1LK5A 1IM6A 1T05A 3KOAA 1B99A 1TL1A 2LQ9A 1WC1A 2AJQA 1JLEA 4IFYA 1O6XA 4K50A 1EZZB 4J5OA 3ZZZA 4K4WA 3DOKA 2X1AA 2JLFA 2BJ9A 1VQMS 3KHGA 3H5UA 3X3UA 1FXRA 2CYYA 4KKOB 3V81B 5EWFA 1N36F 3HHDA 2XWYA 1JKHB 1IQTA 5IC4B 3W63A 2U1AA 4WFNQ 1HWKA 3F44A 1R43A 2YKMB 4G1QB 3RUBL 4G65A 3UD4P 3LOUA 1N5QA 3OFEA 4Q2LA 4ZVOB 2N3OA 3Q8RB 3QPIA 1KC8T 2ZE2B 3G86A 2DY9A 2ZH9A 1F3FA 2MSSA 2XSJA 3IAM9 2JEJA 3VAIA 1TR0A 2IMWP 4OI0A 1C4CA 1PJ7A 6FDRA 2NXEA 1RZMA 1YG0A 4DPOA 3OTEA 5M2PA 2ZNYA 3FCHA 3PZPA 4P2SA 3UDLA 5SZTA 2UZAA 4CWBA 4ETXA 4QIVA 1S10A 3TAMA 4WP9A 2YKNB 1NRKA 3W64A 4DPYA 4ZHRB 4LF6J 1HNVA 1HQUB 3C3LA 3GMGA 4A48A 3PFEA 3MI7X 2HVHA 4XDDA 1EKSA 4ZK7M 4Y2MA 4UY85 1UJ5A 4TYAA 1GX5A 1IXKA 3PM9A 2JOQA 4USUA 1IBMJ 3MMBB 3MM8B 3MUVP 5A8RA 1XMQF 5LMUJ 2QTWA 2IRYA 5DG7A 2HHSA 3CC7S 4P71A 3K89A 1DLOB 1VQSA 1WC0A 3DKDA 4N56A 5F8MA 2MQ8A 4FXWA 1M1GA 1LQ9A 4PXCA 4ZDNA 1KQKA 3RW6A 3F73A 3MUTP 1VQ8S 2KZMA 4CT9A 1RT1B 1TELA 3W2WB 3JAMU 5LOQA 4IYQA 1OY6A 3BYRA 1O5JA 4J37A 1VRUB 5HATA 1ZA1B 2Y1JA 4DFPA 2GZOA 4ZLNA 1OMSA 4NLDA 3QIPB 2ROGA 3N28A 3QZ8A 4NLQA 4JV5F 3CWJA 3OTOJ 3QRPA 4HDGA 4X4TA 5D77A 2CDQA 1OIAA 1VI7A 2HS0A 4Q43A 1S77D 1HFEL 2XMTA 2CZ9A 1TK5A 4YY3F 2GHWA 1RAAB 2CJBA 4B9UA 1Y5NB 2NPFA 4O4RA 1SKRA 2CG8A 5K14A 1S9FA 2MLYA 4OI1A 1VK3A 2Z2LA 3SSSA 3UR0A 4WTOB 2QA4G 4A46A 1FKPA 2CQ2A 4C97A 4JV2A 5ITHA 3OLAA 1YJWS 4YQWA 2BR0A 3FMWA 4LBHA 3AQPA 1S1VA 2Y1LB 4DQRA 2BABA 1S6PB 1M5VC 4QW9A 1XR5A 2R3VA 4NXMJ 2OAUA 2DNGA 2BYCA 3CD7A 3MEGA 4ANEA 3W5XA 1HWJA 3WIVA 2F63A 1S1WB 1OQ3A 2E5LJ 3DOMB 3SCIE 2VPZB 5HSPA 2HHWA 1X4GA 3IGVA 2CJ9A 4DPWA 2DISA 2H5EA 2QX0A 1B64A 2VKZG 4KHPF 2B7CB 4KC5A 2IC3B 2A2CA 3GIMA 4Y28C 2MZTA 2E5GA 2J9DE 1KS2A 3BN7A 3DRPA 2XNRA 4IO1A 4B3SF 4J9RA 3C15A 2KG0A 2AJFE 5J1NA 4PEOA 5KG0A 1SKWA 5I3PA 1JXEA 4CIOA 4QR1A 3DMJA 3CXCR 3BSOA 4N47A 2W4DA 2G2ZA 3MM5A 1CQMA 4WBFA 2NYHA 1KWMA 3HD1A 5D0RA 2F8HA 2NYIA 1V9OA 2MKIA 4DCJB 1S7IA 3KDNA 3J81Y 4K4YA 4F02A 3D3BJ 2ZZMA 4E2FB 1G6BA 4K4SA 1XQIA 3R7SB 1BHNA 5K9FA 1JWWA 2RSQA 2M70A 1R27B 3G8SA 1D1UA 1HWUA 4WFZA 1CC8A 1VRQC 2AHOB 1YVFA 5B0EA 3LW5C 2G0CA 4LF4J 1TL4A 1R6YA 3DC2A 2EK6A 3CCJS 1MN7A 3DLGA 4JI4F 3TQEA 2MTLA 4EYIB 4Y2IA 3DHXA 2CNOB 3OJSA 1AB8A 1FNMA 4CLFA 1RT3B 2K1RA 2OPQB 4DV2F 1GK8A 3BDEA 2X3GA 4RBUA 1ZETA 4ZN1A 1FKAF 3D28A 4IG0B 4URSA 2YWKA 5CD4A 5E3RA 2MZRA 1SJ1A 2M2BA 5A76A 5HAOA 5ETRA 1R8CA 2ASDA 3QJLA 2LQ8A 3GU0A 1H2UX 1UWBA 2E66A 2OFGX 4KH0B 1KSPA 1Q78A 1PAUB 4DQIA 3BV8A 3HSGA 2W4CA 5IM0B 1WI8A 3VAKA 2PFDA 4RUCA 2VC1A 3M8SA 1UJ4A 3MEDA 2XULA 4OLPA 3FRYA 3C46A 4ID8A 2QEXS 4R5PB 3JSYA 4AD6A 4FVCA 1BQMB 1U8SA 2XGPA 4IQMA 1RWXB 3KG0A 1X31C 2VA3A 2V8PA 3W8PA 3GG0A 2XLIA 3UQSA 3G9CA 4LQ3A 1OPIA 3N6MA 3W62A 1X4EA 1F3VA 1IQZA 4YB5A 1XTZA 4LFBF 5DETA 1HI0P 3BH6B 1NSAA 4P6QA 1VISA 1MWZA 5CYQB 2GVZA 4WK1A 4WFBQ 1FJCA 4N7TA 2O5DA 4ELUA 1HBOB 3PYEA 4OJHA 3TARA 3K7RA 4PYDA 2QLXA 4Y2CA 4YN3B 3MR3A 4B9SA 2ZOFA 1G4CA 4NZ6A 1NJYA 1BQNB 2FIUA 3NS6A 1KDNA 1RDRA 2DNOA 4CH1A 2B6AA 2GMJA 3DFEA 1NZ8A 4JV1A 4P2MA 5DJBA 1IJFB 1KOOA 3EXYA 3SBMA 4TQRA 2V8GA 2ZWPA 1IWAA 5H9EJ 3OR2A 4O44B 2IRXA 3J7Z5 2EBGA 4M5KA 1PO6A 3GE9A 4USMA 3ZZYA 1RHRB 5LXRA 2HFSA 4OX9J 8RUCA 1TV6B 3PRBA 4OHZA 4KGMA 1S0OA 4G1PA 4K4XA 4C0OC 4Q2MA 1UVMA 2CDRB 1CSJA 4XPEA 1UEKA 5CH7B 1T11A 2JX2A 2E9ZA 4QR2A 4LF5F 3HVTB 2BQRA 3GB0A 4Q5VA 2QC3A 2V63A 4CM2A 3I96A 2NR0A 1YKWA 3SQOP 3PW5A 1TUGB 5B7WA 2HMIB 3UWTA 4NZ0A 3NS5A 1T9YA 4DG1B 4GO5X 1XR7A 2UXCJ 2FJAB 3MM9B 1NPRA 4LF9J 1PBUA 2IMOA 2KVQE 2F7VA 4N41A 1SL1A 5BYSA 2MHEA 2YNIB 4HTJA 3HFVA 2GVDA 2OPSA 5AJ3F 4D3GA 1IBCB 2B5JB 3E3XA 4K2XA 3VR1A 3BO2A 1VGYA 1HKAA 1AUSL 4MKVA 2YWWA 4H4KA 1UVIA 8AT1B 5IS2A 3D9BA 3FEZA 3IR7B 3RG6A 3RAXA 4IR1A 1RKIA 1QJHA 1WF2A 3C2PA 2J76E 1MU2B 3W60A 5LSLA 4NEYA 4QYZJ 3RBZA 1IR2A 2HBQB 3MURP 3M8RA 2CKWA 2ALYB 5KFJA 3WIUA 2Q43A 4NCGA 2AU0A 4H4OB 2AX1A 1RAJA 4CTAA 1HMVA 1IBLF 4O0IA 4WKYA 1RT2B 5GMKa 2UUTA 2QSFA 1F2HA 1LWEB 5CYMB 4Q0BA 1DTQA 3PEJA 2HGMA 3RB0A 4NWBA 5THWA 3M8PB 1CJVB 3G82A 1OO0B 1T8EA 3QT6A 3M6VA 4EBEA 3IBCB 2EG2A 3FCVA 1JLCB 4EFAC 3QYYA 3MTJA 2ZC3A 2FUG9 4USTA 3DYAB 1Y4ZB 4NMLA 4U6PA 5I3UA 2M9KA 4OFZA 3KLEB 2OHDA 2DRBA 1SV5B 1YI2S 2N4DA 3MPVA 1F0XA 3CCZA 1HW8A 1N34F 3EXCX 5F8LA 4DPXA 2HGNA 2N4CA 2BQ3A 1FDNA 1IKYA 1YRXA 1N5YA 3R7NB 5J2QA 3AJ1A 1UMJA 2FLNA 3A3OB 1XNRF 4DN0A 2UXCF 3THPA 4ALZA 5IQ6A 3IR6B 3DOLB 3VQTA 3FEXB 3MFHA 4DV7J 2EFNA 3V5RA 4DR5F 4DX7A 2OPRA 2FVRA 1M1HA 4ED5A 1I1GA 3ULHA 5F8NA 2HK2A 4K5SA 3J7AN 2HWTA 2MKSA 3IMQJ 2UXBJ 2RRNA 2GGPB 4YS2A 4DSIA 1VC0A 1IKVA 1S76D 2RS8A 3CDWA 3DLEB 2VFUA 4TU8A 5G4DA 4AUKA 1K8AT 4CP5A 1RWMB 4N8OA 3H5YA 3DLKB 2HHHF 4ES2A 1M5OC 4C3KA 2BE7D 3L3CA 2ZKTA 4B3MF 4FF1A 2HKEA 4OYAA 3PW2A 3MMJA 4V1Ak 2E1AA 3H25A 4PR6A 4ECZA 5EDWA 5IWAF 3TUJC 3KLHB 5C25B 4IRDA 1S6QB 1S1XB 3K58A 2RU9A 1HIYA 3ENWA 4I6WA 4WFXA 3SQGA 4DFJA 1VJQA 1BMQB 1DBDA 1RBAA 2IAJB 4X64J 3H8YA 4OZ5A 2OEKA 2V50A 1MNEA 3SFGA 1FO1A 2R2TA 3CMAS 1GTHA 3CIMA 5FLXU 2CQ0A 2GAHC 4FKXA 4CDIA 3BPDA 5IT9U 2W2PP 1N33F 2GHVC 2KRBA 3CUNA 3CNQP 3RU0A 1NM2A 1LV5A 1VBXA 2J7UA 3KJVB 1AYEA 1WHXA 2EFPA 2VPXB 4EZ9A 2XLJA 3DXBA 2N82B 2P9EA 3U7JA 1RT7B 2DYAA 2X51A 1GTEA 2COLA 1XERA 4V19X 2HVIA 4IQXA 3H2UB 2C2NA 4U8VA 2FGOA 1JLQB 2HFZA 4KV8A 3JSMB 3DLBA 1NDPA 2YNHB 2W2NP 4A8FA 4ZCMA 1ZOTA 2G0IA 3KNGA 4LF1A 4EZ6A 4KO0A 4OZLA 4I4BA 4CYUA 1KN6A 3CJRA 4RW9A 4DUZF 4ZCIA 1VBKA 3SDEB 4MK8A 2F8MA 1TU0B 5CABA 2HW3A 2DB1A 3M6WA 2GX8A 1VQ7S 2IPOB 2YNFB 3J80Y 1VQ6S 4OJ3A 1KQSR 1NJZA 2B9EA 1YJNS 3R2DJ 3M32B 3M4XA 3UCGA 2Y0BB 2CPZA 4DV5J 3ZC4A 1TKZA 4ILMA 1QY7A 2FZCB 3RJMB 4PPZA 2PMZD 1S72S 2DJWA 3BGRB 3TVKA 1H38A 4O0NA 1DAXA 4F26A 5CA5A 2MJUA 5KT3A 3FBFA 3AODA 3MAAB 5ETMA 4J9OA 4JI8J 3VAMA 1DY3A 2GIQA 2QLFB 2B8PA 2BE2A 2GFFA 1RBLA 1RUSA 3FUYA 4FPRA 5DDOC 1SH3A 3NCPA 3RRHA 4Y6IA 4NCAA 1WOSA 1XIQA 2C2MB 4M95A 2BDPA 1NK9A 2BRLA 2WBMA 3L95X 4CQ1A 3T9ZA 1TL5A 1MMLA 3D67A 5DO2A 1RT4A 3FZ2A 1JIHA 1T03A 2M8DB 3J80U 3JXOA 4EBCA 5A0YA 4O4GA 1M90T 3CJ8A 5ADZA 2W2MP 2UXDJ 2IM2A 3I5BA 4HH0A 3CMQA 1RYSA 4OIXA 1NBEB 2EBEA 2J8SA 3TZXA 1CULA 1T05B 2GMHA 2DD8S 1TL1B 5L39A 4ZP7A 1JLEB 4IFYB 3TRGA 2RS2A 1MMNA 1P6TA 2IRUA 2VG6A 2CQPA 2KN4A 4DX5A 3VZIA 4DR1J 3DOKB 3ZTRA 2OEMA 4GVLA 1DFDA 2BKPA 3OSNA 2L48A 5H1SV 2W7AA 2V9WA 2B4UA 2U2FA 5FDLA 4ANCA 2CZVC 3D0HE 2V2QA 3PFOA 4NEZA 1KKHA 4P74A 1FTCA 3DN9A 3AHPA 4J7CA 2WZ1A 3P4UB 4C4WA 4RU9A 1RTDA 1U1NA 4NLYA 5EN1A 3QRQA 2CVIA 2KXFA 4UF4A 1UFWA 3H4BA 2R7RA 1BLUA 2CQBA 4DV4F 3IO1A 3TW0A 3C16A 2DVIA 5HLFA 2XMWA 3R5DA 2RDDA 5LM7E 3EM1A 4EWTA 4F4ZA 1NDCA 2Q3PA 2WVEA 1TKXA 2NREA 1MLAA 3W5YA 4LFAF 2XSJB 2BMBA 3G6XA 2CQCA 2OLWA 3QSYB 4QZVB 2UUWA 2NXJA 3V2UC 2LDIA 4U8YA 3JYTA 1YLXA 1NJIT 5L1KA 2OKQA 4CNYA 3A8JA 2UVRA 3TAMB 4YB7A 5BJRA 1DQAA 1YX2A 3MPUB 1HNVB 4X66F 2HQGA 2F4VJ 4QWEA 1VC5A 3POTA 1S1UA 4IG3A 3PACA 3BSNA 2DITA 2LCWA 1VOMA 2VDHA 1J5EF 4NLUA 4I2QA 2D7SA 2AJ4A 4TNOA 4USHA 1IBKJ 3SI8A 1AUDA 4M5LA 4GKKJ 1F5AA 3GIJA 1RHJB 2OD4A 5A8RB 4LT6A 1JLBA 5BR8J 2ZC4A 2KRRA 3DXSX 1WG4A 4ETZA 5C42A 2PEBA 1Q53A 4IUFA 2OELA 2J8AA 2JLEA 2VC0A 2QYGA 2WRMA 2OO4A 1CLFA 2B56A 1FT8A 1RKJA 5C2CA 1K1SA 2UXDF 2YWGA 2HZCA 2K2PA 2AZ1A 4NMXA 1F9EB 1TKDA 1P27B 1RT5A 4H4MA 2UUBJ 1WJ9A 2HVEA 2XLKA 3ITHA 4RNHA 3TR5A 3SCKE 1L3KA 3FK4A 4JI5J 2BJDA 5KOWA 3PX4A 3NNCA 4MKYA 2ADBA 3F56A 2E44A 2R7OA 1VRTA 2APOA 1REVA 1QAIA 4WYLA 1PJ5A 2IBOA 1AA1B 1I5OB 3MPDA 2DR7A 5K8PA 3CULA 4ZIVA 3W9HA 4YEAA 3GONA 2V68A 2J0SD 3CC4S 3UD3P 3PXGa 5KG5A 3J7YI 1UVNA 1H7WA 5K14B 4DBQA 5F0WA 4X4OA 5HMXA 4E8UA 3OV7A 1Q86T 3ICLA 1F6TA 1FKPB 1Y5LB 1RB0A 5LT5A 3VALA 4JI6J 1YTYA 3CT9A 4UZCA 5K20B 5KG7A 4TQSA 2C28A 3NWRA 2G13A 1S1VB 2NSCA 4JI2J 1JLGA 4Q8FA 2ZH2A 4RWWA 3T3FA 1NJWA 4WFYA 2B43A 2CADA 3N5BA 3PHEA 2DR5A 1YIJS 4O23A 3MEGB 3TP2A 2CJAA 3RAQA 3J81j 2FYXA 5KT6A 4NA2A 4LQ9A 3GSDA 3RAMA 4F4AA 1UPMB 2XCAA 1G1XA 1VIOA 2BZ2A 1J27A 5HANA 4BCAA 1FDDA 4KT0C 4JP8A 1QAJA 2YQ3A 4NLOA 4F4YA 1A9NB 1RCXB 5AE1A 4DWIA 4QWDA 3HVRA 5LJ3Y 1HNWJ 4B9TA 3LPYA 2E9RX 1HL6A 5RUBA 2O01C 2AGPA 3DRPB 4DOZA 2DGXA 1H98A 1TK0A 3B54A 1V6HA 2OFHX 4IH6A 2AYGA 3C15B 1ZAXA 2Y1RI 4FXVA
chains in the Genus database with same CATH topology
1HPZA 2L9NA 3O8WA 4DSKA 1FERA 3MD1A 2M5YA 4A48A 3DMJB 5A2QY 3PFEA 3TVYA 1VQLS 1WACA 3MI7X 1U24A 5H9FJ 5KFEA 2HVHA 2VASA 4XDDA 3VAHA 4I68A 4ZK7M 1FVSA 5B08A 4Y2MA 4ZPVR 3OFHA 3DLJA 1FRXA 4B3OA 4DL0C 4BDPA 4IDKA 1DARA 4UY85 3HHLD 3MM5B 2LEPA 4LF4F 1UJ5A 1HBMA 4TYAA 2DGTA 1GX5A 1IXKA 4MKBA 3WZ0A 4B9NA 5CQGA 3PM9A 4FNHA 2DCUB 4OHVA 2JOQA 2N7YA 1KTVA 1N5SA 1HNIA 3MMBB 3MM8B 3MUVP 3IRWP 2D3OR 2LQ5A 3NP5A 3VZHA 5A8RA 2KT5A 1Q8LA 1XMQF 5HI7A 4X4UA 4C11A 3MHYA 1RTIB 2IRYA 4X65F 3SZ2A 5DG7A 3D5MA 1UA1A 3CC7S 2HHSA 1LWFA 2MYFA 2OSRA 3M2VB 4NLPA 2PDAA 5GAEU 1PC4A 1FK9B 3O2IA 2KG1A 3JTOA 2DHSA 4KJIA 2K7JA 4RNFA 2MZJA 3CD6S 2QSWA 4ZLPA 1TK8A 1KTQA 4DR2F 2B4OA 1DLOB 4ZP8A 2R8KA 4ED7A 3B4MA 1SUQB 1VQSA 2WCXA 2WONB 4OI6A 3JTNA 5GADI 4DFMA 1UAWA 1ZM3A 1SIWB 2HQIA 4NXNF 4N56A 5F8MA 1SJ4P 2ZJPQ 2EFGA 3N0VA 4FXWA 1SL0A 1Q8IA 5L1JA 1LQ9A 2CPHA 2QZ8A 4PXCA 3CJ2A 4ZDNA 5HP1B 4WYWA 3NRBA 1KQKA 4U7UK 3RW6A 2PI5A 3SV3A 3RBEA 5HROB 4TU9A 3F73A 1C0TB 1X8DA 2LQJA 3MUTP 4HYKA 3MZIA 5HMWA 3CJ0A 1VQ8S 2KZMA 3W3SA 2WSEC 3DLGB 2RF2B 2PO4A 4CT9A 1U1KA 2HLUA 2QO3A 4DS5A 1CG2A 1RT1B 4LVOP 3W2WB 4MFBA 4PG4A 2GJ2A 3US5A 2FC8A 4PQUB 3PO5A 4RW8A 4LUBA 1NEEA 4IYQA 4YP3A 1VIXA 2FJVA 4PWDA 1NZAA 1N5TA 1QTMA 2DNYA 4DQPA 3MDFA 1HYSB 1O5JA 2V8VA 4J37A 5KFLA 5D3GA 1VRUB 1DTTA 1TL3B 4C9DA 1H3DA 2C2EA 2W24A 1FE0A 1JNRB 1S9GA 2D3ZA 3PW4A 1EP4B 3MGJA 1H2TZ 1SI9A 1G3OA 1JLFA 2Y1JA 1R8HA 5I42A 2R2RA 2K1RB 4DFPA 2C22A 4DSFA 3NAIA 2MKHA 4CT8A 4URGA 3OXLA 4NLDA 4PQAA 3CCUS 1TFWA 3QIPB 1XN9A 2ROGA 4CNZA 2IM0A 1Q4RA 3N28A 1N52B 4NCBA 2OD6A 1HNXF 3QZ8A 4NLQA 2XMMA 3LGMA 3M9OB 4JV5F 2K8GA 5K8NA 3AH6A 3BSAA 3CWJA 1ELOA 4A8OA 3GFXA 4C98A 2D9OA 2C3PA 4DDFA 4HDGA 3IN5A 3TAPA 3NBPA 2R8GA 2VA2A 3V6HA 3IXQA 3DI6A 2NXUA 4X4TA 5D77A 2B0GA 2B4VA 2CDQA 1LWCA 1OIAA 1VI7A 2HS0A 4Z2XA 5K5MA 1HD0A 4C8MA 3J7A1 4Q43A 1S77D 3U1LA 1HFEL 3ISZA 4KBIA 4JI2F 2XMTA 4K59A 1TK5A 1HWLA 1UWBB 1RQ0A 3T6BA 1XK8A 5KFIA 2L41A 2AP6A 3OXGA 3PEHA 4YY3F 4Q45A 1Z2LA 2GHWA 2ZD1A 4K4UA 2CJBA 1RT6A 4WU2A 4B9UA 1Y5NB 2NPFA 3CCES 2HLTA 1YGYA 2M0GB 3PIPQ 4O4RA 5F8JA 1SKRA 3FEYB 2DGUA 3NNAA 3DRRA 2AWZA 5K14A 1WF1A 1S9FA 1URNA 3IC1A 1ZH5A 3MEEA 4ZOSA 5D4OA 4OI1A 2IYGA 1URRA 3CCSS 4OHYA 1U2FA 3MEDB 3HJFA 2V4JB 2HHXA 3J7YU 1VK3A 3GV7B 3OJUA 2A18A 3IG1B 2Z2LA 5F3ZA 5D78A 3PV8A 2DT9A 2ZHAA 3R1LA 4IRCA 1K1QA 5GAHI 4RW6A 4B17A 2DTJA 3SSSA 3CMES 2XI2A 5A8KB 1TAUA 3V4IA 3UR0A 3JSRA 3CF5Q 2DGVA 2QA4G 5EUHA 4ES1A 4A46A 3MEKA 2DNZA 4ZP6A 1FKPA 2CQ2A 1KHVA 1WHVA 2IVMA 5C24A 4C97A 4JV2A 2HQ3A 5ITHA 1YJRA 2Z8QA 1HARA 3OLAA 4WXOA 2KM8C 4DR4F 1YJWS 4G6VB 4YQWA 2BR0A 5JUMA 4M8LA 2HWHA 3FMWA 2V4RA 3W7BA 3KK1A 4H4KC 4KKOA 2YWHA 3HHLA 4ID5B 3V81A 3GV5B 1C1BA 3V6DA 1KEKA 2HFOA 3O1LA 3OBIA 1LXJA 4ED3A 1FRKA 3AQPA 2E29A 1Q8BA 2DGOA 1YRUA 1VQ9S 1JKHA 1S1VA 4PRFA 1JX4A 4WF9Q 4DQRA 3TUZC 3Q24A 2D1CA 2J5AA 2CFXA 2BABA 1S6PB 1U6FA 2BM1A 4QW9A 3K5OA 1M5VC 1XR5A 2JRSA 1U25A 2EK1A 5KFNA 4ECXA 2CJKA 2HGLA 2XY7A 5AXKA 3B8HA 2KKHA 2HRYA 2OAUA 2YKMA 3BF4A 4G1QA 3H2LA 2IJFA 2DNGA 2B9WA 5KFKA 3FQLA 2BYCA 3T5JA 3CD7A 3QGHA 3OL6A 4NRTA 2C42A 3MEGA 3I6PA 2J9EA 1Z4UA 2RVJA 3SSRA 1GAOA 1VS3A 4GKJF 3O3LA 4MIAA 4OJGA 4RNNA 1HWJA 1H0HB 1H2VZ 1S1WB 3T5LA 1Q1KA 1OQ3A 5KG6A 1NNDA 3SCIE 3C6TA 2VPZB 2R8HA 2HHWA 1X4GA 2ZE2A 4J9PA 3DGPA 3IGVA 2CJ9A 2LLZA 1QLNA 2DNLA 3RTVA 2BJEA 2BRKA 4TY8A 4OX9F 3MR6A 2DISA 2H5EA 2I2YA 5CXTA 4UQGA 1R0AA 1B64A 4KSEB 2VKZG 1U7LA 5B0FA 4BWMA 3ZFVA 3MF5A 4WIIA 5LXYA 4KHPF 5IT4A 1SH2A 4CZCA 2KFZA 2B7CB 2CIMA 3DDNA 4KC5A 2VZ9A 2F9DA 5FD1A 4IO9Q 2FD2A 1FF2A 4OL8A 3UCUP 4ZPBA 3S6EA 3IWNC 5I4MA 2IC3B 2A2CA 2VBYA 2RQKA 1KHWA 3GIMA 1SQEA 2GMLA 4FYDA 2B6AB 3TUIC 4Y28C 1U48A 4IOBA 1OSDA 2LXFA 2MZTA 4FS2A 1AFIA 3CPWR 2JH3A 2E5GA 4QU7A 1WG5A 3BO4A 4ECTA 2XMVA 3QO9B 2J9DE 1KS2A 3BN7A 2YKNA 3DRPA 5F8HA 1NHVA 2XNRA 4IO1A 1EETB 1D3WA 1T95A 2O1PA 3N5FA 4B3SF 4J9RA 2PMHA 2MMYA 2YVSA 3QGGA 4ICLB 3M30A 4ZHRA 4NLXA 4WK3A 1Y3KA 2KG0A 3MXHP 2AJFE 3OR2B 3OUYA 5J1NA 1HQUA 5KG0A 1SKWA 5I3PA 3IA0A 4LJMA 2VODA 3T5HA 1JXEA 4O3NA 2YH1A 1KOHA 3SCLE 2OPPB 1CEZA 4O3OA 4CIOA 4QR1A 3DMJA 1Y7PA 3OFFA 2KT2A 2HAIA 3CO9A 2GCFA 2ZNZA 3CXCR 3BSOA 1LW0B 3FMBA 4LF9F 4N47A 4RUHA 2W4DA 3MM5A 2AYBA 4N76A 3LP2B 1CQMA 1F2GA 2A10A 3IRXB 4ELVA 4USIA 4KAIA 5GAEI 1LOUA 4YR0A 3PKYA 2F8HA 3MMBA 3MM8A 5KT7A 3DRSB 1L3VA 2CQ4A 2NYIA 1V9OA 4B9VA 2MKIA 2MJNA 1X4DA 4MKAA 3J81Y 4K4YA 4F02A 5A6PA 4PG6A 1RTIA 2ZZMA 1G6BA 3PO4A 4NA1A 3CD5A 4K4SA 3M2VA 3HXMA 4I69A 1FK9A 3MD3A 2YY3A 1V3SA 2KI2A 2M52A 3RZAA 1FRLA 5K9FA 1JWWA 2GIRA 2RSQA 5FLXY 2M70A 2W7OA 3IS9B 2ZDOA 1R27B 1DLOA 3G8SA 4DHVA 1GXTA 2MQMA 1S6OA 4MYTA 5IT9Y 2IA0A 3RR7A 3D0IE 1M0SA 1SUQA 5DG8A 3WDOA 2WONA 3FGVA 4DR3F 4LVNP 4RBTA 4HHJA 1HWUA 4WFZA 1CC8A 1D1UA 1HR0F 5BYRA 3MM6B 5KFCA 1HI8A 4L72B 4F3QA 1YVFA 1X9MA 1IN0A 1FXDA 5B0EA 5GADU 5E5NA 3KHRA 1M5SA 3CGIA 3T1AA 2ZH3A 4BHQA 5HP1A 4WZMA 3LW5C 1KLNA 2G0CA 4AL5A 4A4JA 1TL4A 4A8XA 3E01B 5HROA 2VQEF 1R6YA 1C0TA 3DC2A 2EK6A 3KK2B 3CCJS 1U6ZA 3V6KA 3DLGA 2RF2A 2WBRA 3ZZOA 1YQHA 4IKAA 4NA3A 1QAXA 4JI4F 1RT1A 1G7CB 1X4HA 2DR9A 3W2WA 4EYIB 2RILA 4Y2IA 2VL1A 1K9MT 4PQUA 3CDAA 3BR8A 4M5DB 3QIDA 1WTFA 2J0XA 2V8DA 4ES3A 3DHXA 1HYSA 4PG8A 1QAYA 2GV1A 1GQEA 1VRUA 3HK2A 1TL3A 4C3LA 3OJSA 2QMXA 4RX6A 2ZBIA 2ZH8A 2RKIB 2J6SA 1FNMA 1EP4A 1YRTA 2KYXA 2OPSB 2QA4S 2UVWA 2WHOA 1RT3B 1HBUB 2PC6A 4M1KA 2K1RA 4PXBA 5HMZA 2OPQB 1X0PA 2W9BB 4DV2F 3KG4A 3BDEA 2WB1D 3EGNA 2KJVA 2FHMA 1DRZA 5E3AA 2X3GA 3NMRA 4RBUA 4WJBA 3QIPA 1ZETA 2MY7A 4DR7F 2CPEA 1BC6A 2KM8B 1FKAF 3G6YA 2RT3A 2MZ1A 2JC0A 3D28A 4IG0B 5GAGU 4URSA 2YWKA 2Q1LA 2M4MA 5B0CA 1RP5A 1E6YB 5E3RA 1S1TB 2MZRA 1SJ1A 1QM9A 2VONA 2M2BA 2DNNA 2ZUGA 3HVAA 3NMAA 3Q0AA 3CD0A 1S49A 4OI3A 3KYLA 1HHTP 2GO9A 3N6LA 1R8CA 2VH7A 2ASDA 2J6TA 3QJLA 3S1TA 1H2UX 1UWBA 3PX0A 2E66A 4RKUC 2OSQA 2OFGX 3EPGA 2KDOA 4XPCA 1U47A 4HTIA 4N8NA 3TOQA 4ED8A 3Q22A 1KSPA 1Q78A 3UPFA 3BEGB 3SSQA 4QPXA 4DQIA 2JZ5A 5K8MA 2W4CA 4CI0B 5IM0B 1WI8A 1SJFA 1X5OA 3VAKA 4DFKA 5F9NA 4X84A 3T1HF 3R5AA 2W8LA 2DO0A 2KH9A 4EUVA 4C0HA 4I64A 3FSIA 3C8YA 4RUCA 3C6UB 4MIBA 3BQ1A 2HNYB 3BS9A 2E9TA 2VC1A 3M8SA 2FJXA 1UJ4A 3MEDA 2V4JA 2MQPA 1X9SA 2XULA 3IG1A 1NH7A 3CCMS 3CJ5A 2JWNA 4OLPA 4O3PA 4Z37A 3FRYA 3C46A 5A8KA 1AFJA 4ID8A 2QEXS 4UUXA 4NCGB 3U02A 1NKBA 4R5PB 1U1OA 2MPUA 4CTAB 1Q79A 2BXJA 1HMVB 2X1BA 3AQOA 3JSYA 2V4QA 4ED6A 4FVCA 3OL8A 2ZHBA 4WZQA 3TANA 3HHLB 1BQMB 4B3RF 4JI0F 1U8SA 3QGPA 3VF0B 4RWXA 2PT0A 1GX6A 2XGPA 4C2MA 4Q0BB 1RA6A 1DTQB 2WSCC 4IQMA 5HMYA 3KG0A 3P6YC 5J2MB 2YWFA 4ID5A 2NQPA 2E1MC 5MAOA 2LEAA 3FFIB 3K57A 2VA3A 1X5SA 2ATLA 3VAGA 3AA9A 3GG0A 3UCZP 3Q23A 2XLIA 1S48A 3UQSA 3G9CA 2BQUA 4LQ3A 1OPIA 1LFPA 4M63A 4KHRA 3N6MA 5EWEA 1S6PA 3ENQA 1X5TA 5LSOA 5KFOA 4ED1A 1KNZA 4R0JA 2NZ4A 2QT7A 4IFVB 4KFBB 1NO8A 2YWEA 4K5RA 2MQQA 1X4EA 3BREA 5DDQC 1X7VA 1IQZA 4YB5A 3I4HX 1YITS 2DR8A 1MSWD 1XTZA 4F2RA 4LFBF 3OVAA 2HRUA 1HWIA 2E5HA 5DETA 1HI0P 2EPIA 2GHPA 3IGNA 2DO4A 1ZTWA 4P6QA 1MWZA 4MH8A 2DBBA 2HS3A 1QVGR 2YKPA 5CYQB 4WFBQ 4WK1A 1S1WA 1FJCA 1M1KT