3CJKB

Crystal structure of the adduct hah1-cd(ii)-mnk1.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
75
structure length
75
Chain Sequence
VNSVTISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGFDAVIHNIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport/hydrolase
molecule keywords Copper transport protein ATOX1
publication title Copper(I)-mediated protein-protein interactions result from suboptimal interaction surfaces.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 75
sequence length 75
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cjkB00
2LQ9A 2K2PA 2GA7A 2AP6A 2XMVA 2BJDA 2XMKA 1X8DA 2ZDPA 1N5SA 1S6OA 2HFNA 2OMOA 3DCAA 4Y2MA 5IXUA 4OIXA 4Y2KA 2W4CA 2XMWA 3KG1A 1R6YA 4OJHA 2K7JA 1SB6A 3KKFA 2BJEA 1V3ZA 1CC8A 1FVSA 3KNGA 1JWWA 2LDIA 4A4JA 4A47A 1YJUA 1YJVA 1KVJA 5B09A 2AW0A 4HI1A 4Q2MA 2FHMA 1VQSA 2FB0A 1URRA 1Y9OA 2GGPA 3HHLC 4HI2A 3HHLD 3F44A 4A48A 5A6PA 1YG0A 3I9ZA 1Q4RA 3TOQA 1RJJA 1Q8LA 2FTRA 4U9RA 3IWXA 2Q3PA 2RILA 4Y2IA 2AJ1A 1OPZA 2IYIA 2BUNA 5F0UA 2KYZA 2PGCA 3BB5A 2ROGA 2HFOA 3LGNA 3HFKA 2HLTA 2GGPB 3MCSA 3TRGA 1APSA 5B0FA 4DPOA 1AFIA 5B0DA 3BF4A 2OD4A 3FMBA 3FGVA 3CJKA 2GV1A 1FESA 1S6UA 4ZA1A 5A6WA 1AW0A 1TUVA 3LO3A 2QLWA 5T7LA 1N5TA 1QUPA 2XMTA 1Y3KA 2HQIA 2OFHX 1WD6A 1N5VA 2ACYA 2XMUA 1KQKA 3TNVA 2K7KA 4ZOSA 1TL5A 3CJKB 2OFGX 1U7LA 1W2IA 2VV5A 2W4PA 1YRXA 3BR8A 4OJ3A 2ASYA 5B0EA 5T7LB 4DL0C 1VQYA 3WDOA 2N4CA 4Q2LA 1N5QA 2KT3A 5KAKA 2GCFA 2XMMA 3BGUA 1YJRA 1Y3JA 2OD6A 3MZIA 5K9FA 1YJTA 4OJ1A 1TL4A 1MWYA 1K0VA 1FD8A 1FE4A 1CC7A 2OP5A 4YEAA 5B0BA 3VTIA 2LXFA 2K1RA 3HHLA 3KG0A 2KT2A 3K7RA 2PD1A 1KVIA 2HLUA 1XBWA 1Q8BA 1MWZA 4QOTA 1IUJA 1X0PA 3BN7A 3QMQA 3E8OA 4FNIA 2K1RB 2RU9A 3HHLB 4EFAC 2AJ0A 4YDXA 1X7VA 2VH7A 1P6TA 1ULRA 2ROEA 1SI9A 5B08A 4FNHA 4NPOA 4DN9A 1FEEA 2GO8A 2QIFA 2IFXA 2ZDOA 2BBEA 3T9NA 2JDJA 1Q53A 1SQEA 1AFJA 2OKQA 2XMJA 1OSDA 3HF5A 2RMLA 1GXUA 2G9OA 2HIQA 4A46A 5B0GA 1P8GA 1FE0A 4NL5A 1TR0A 1JK9B 2L3MA 2KKHA 1Y0HA 2LQBA 1CPZA 3DXSX 1OQ3A 3HDSA 3BM7A 5F0WA 3IWLA 2QYCA 5B0AA 1FVQA 3BDEA 2N4DA 3UDCA 2OAUA 2N7YA 1LQ9A 2EW9A 2QLXA 2ROPA 3FRYA 2RSQA 2W4DA 1TZ0A 2CRLA 2GFFA 1GXTA 4HH1A 3HX9A 4HH0A 4OJGA 4HL9A 3GZ7A 2BYCA 2FIUA 4F67A 5B0CA 2IYGA 1OQ6A 3LGMA 3QGPA
chains in the Genus database with same CATH superfamily
1M5HA 1T9XA 1OMSA 1RACB 2A0FB 2BOAA 3GPAA 1FVSA 3K2YA 1L3SA 2JNJA 2XMAA 4IR9A 2F4FA 2AWZA 3PG9A 1V9OA 3IXQA 1S9GB 4Y2IA 2PC6A 1F2GA 2E9RX 3CDAA 3GMGA 1APSA 1RTDA 3X3UA 4C11A 4PUOB 2HHPA 3D28A 1U1MA 3CJSA 2GHVC 5J2PA 1S5ZA 2W2QP 2Z30B 2IMOA 4DLGA 1Z1ZA 4P71A 4RPFA 4DV0F 1UWAA 2BEFA 5HROB 2RH3A 2OUGA 2DGWA 4ECTA 3PYGA 5E7OB 2FJDB 4LRBA 3U1MA 1WTFA 4RKUC 2KT5A 2DCLA 3QGHA 3RG6A 2B6AB 5E2QA 3MFHA 5HLFA 1C0TA 2ROPA 1MLAA 2GAGC 3PACA 5AJ3J 2HBQB 4KFBA 3M8SA 4MMOA 3MM7B 3CPWR 2UUAJ 3MM5A 2VQEJ 4WK3A 2VA2A 1YSJA 2Z2YB 2K3KA 1WUUA 4WFZA 3I9V9 1HNIB 3MEDB 4DL5A 3SI8A 3CD6S 3OXFA 3G96A 1IBCB 3LP0B 2QL7B 4M8LA 4U8YA 2NPFA 2HFZA 3GJRB 3T5KA 1VQOS 5DGAA 3BSNA 2IRYA 3L9ZA 3G4SS 1QTNB 2OD6A 4DUZJ 1GQEA 3QSIA 5GVQA 1SH2A 3GYNA 1H2TZ 2MQQA 4J9VA 1NMEB 4I69A 2CJBA 3D68A 5HBMB 5L8RC 3M6WA 3JTNA 1VBZA 5CA5A 2G13A 4Y00A 3P5TL 1N56A 4G1QA 4DL6A 5D4NA 2W01A 3W8GA 1SC3B 1PAEX 3WZ0A 5AXKA 2LECA 2CPIA 4HH0A 1HQUA 4KHRA 3MR3A 9ATCB 3MDFA 2GIRA 1NK5A 4RUHA 2V67A 1HI0P 1IBKF 1FTRA 1RISA 5HMZA 2HHXA 4EYHB 4U7CA 1Q7YT 4X4QA 2KO1A 1LWEA 4OYWA 5F8GA 2G1HA 3OTBA 1FWKA 2WSFC 2CQ2A 1A9NB 1J2VA 3HZGA 2D3ZA 3C14B 1N33J 3AOCA 2MZTA 1K47A 5B0EA 3UQSA 3QWPA 4B3SF 1VRQC 3RB0A 3BO4A 5L38A 2E7XA 4G3IA 2MSTA 3FBCA 5CAAA 1XK8A 1X7VA 2W8KA 4RR5A 3ENVA 3LAKA 4IRKA 3DLBA 5EWFA 4F4XA 3PIOQ 3RBDA 4NCAA 1P8GA 4C8OA 3V6JA 1SIZA 3VQTA 4GMKA 4KT0C 1SXLA 2HK2A 2HNZB 1CEZA 1VMBA 4NLVA 3HX9A 1UVLA 4WFXA 1RLCL 4I7FB 2GJ2A 3H5XA 4IOCQ 2AJQA 1RTIB 5JUMA 2R8HA 3ELHA 4KGXB 3TA2A 4NZ0A 3HSZA 3IM8A 4Y28C 1HPZB 1EB0A 4F7VA 1Q5YA 2OSQA 4ZHRA 1T3OA 4R5PA 1FHTA 3EPIA 1IVZA 5DM7Q 5J1PA 1KNZA 3VV2B 3I0RB 1VQ5S 1XMQF 1IJEB 3THTA 2WCXA 4O44A 4ES2A 2IJRA 2LYVA 1R27B 3NL0A 1RBLA 1JXEA 5KFUA 5C24B 1DRZA 3UNGC 3SMZA 2DK2A 2XNRA 2B8PA 3GILA 4BDPA 2NYHA 2DNNA 1JB0C 3IRXB 4ZVOB 2KVQE 3GFYA 2QFJA 3J7AN 2OTLS 1AXQA 1ZAVA 4QR1A 2CYYA 2B5JA 2L48A 2NSCA 5HMYA 1RHJB 2HK3A 4MYTA 1DTTB 2ZH8A 3FCVA 2DEIA 2HQGA 2VJVA 3SQOP 5CZXA 4RUCA 4DR4F 4URQU 2ZOMA 4C0BA 3HHLC 3F0NA 2KXFA 1ZZNA 3TX0A 4JI1J 4X62F 3CCVS 4XO0A 1QD1A 4MIWA 1FT8A 4JI2F 1JJHA 5DG8A 3KLHA 1P27B 2CNLB 3UD4P 4JUZA 4E0DA 1RLDA 3QWUA 2NSBA 5CQGA 1RAFB 1PYSB 2LFVA 2MZJA 1EAYC 2O67A 4X65F 1Q95G 1DQ9A 2B7CB 4K4UA 4OYZA 3HVTB 1NPKA 3IS9A 1HBUB 2HMIA 1HD1A 4J9SA 1T3NA 3R5GA 4HT7A 3T6JA 1T02A 2H5JB 1RHMB 2RAQA 4EZ6A 1RTZA 3KJQB 4TVAB 3DXBA 4F8RA 2RQ4A 2HIQA 4ECYA 2BJ9A 1OS5A 3RAQA 3MPDA 2QGFB 4OYMA 3PO5A 2H9ZA 4WBFA 4RWXA 2YVSA 2OPSB 4WYLA 4K50A 2ZH1A 1AUDA 2VG7A 3MMCB 2F8MA 3ZZZA 4DXLA 4LBIA 5C2GA 2Z4PA 4OL8A 2JVRA 1RI7A 3I9ZA 1HHQA 2MPUA 1FDNA 1U6ZA 2ZC4A 2N7CA 1MROB 3FEXB 4K4ZA 1IM4A 4JV5F 1IKVA 1NJIT 4FPIA 1KWMA 3BN4A 3M05A 2WVBA 1HNWJ 2AF6A 2K3IA 1KLNA 3QFWA 4JI8J 5F8MA 3FZBA 1RKJA 1LW2B 5KG1A 1RWVB 3HJFA 5HK4A 2MXYA 3HP6A 2VQFJ 2YKPA 4CNZA 4TQSA 4EBEA 1VISA 4E98A 2YKMA 2VKZG 2JDJA 1S1WB 1HQEB 5LJ3Y 2FJBB 2X1FA 1UVKA 1LW0A 4LR8A 3W2WB 5GMDA 3MM8A 4G1PA 5KFOA 1T11A 1TZ0A 2GFFA 4A8OA 3H5SA 3BQ0A 2UV8A 5LXRA 3KJNB 2C2NA 4Y2KA 3HK2A 5ETRA 1C0UA 3O3LA 1CQMA 2FHKA 2C2EA 3SV4A 5A8WB 4JP8A 5B0DA 1JLCB 4ILLA 1TL7B 3G6VA 3X1LB 4KJIA 4WJBA 1Z2LA 1PILA 4I64A 1KQKA 4Z7CA 3W9IA 3MURP 3KLEB 3ZZ0A 2WOMA 1S1VA 3PRDA 2XB2D 2JEJA 3T5HA 4JV0A 3RBXA 3UD3P 4FP9A 3BN7A 3QO9B 1WEXA 5BJRA 2B43A 2OGUA 1LWXA 2HHHF 2BDPA 4PXEA 2NXNA 1A6LA 4MK9A 4ILMA 1KP6A 3DGPB 1UVNA 3M30A 3QJJA 3UFCX 4CH7A 2AD9A 2VU5A 2IVYA 2XHWA 1KRPA 2HVHA 4TYAA 2AJFE 4LF5J 2Y9HA 1HR0F 3NXZA 4O4RA 2MKHA 3GJQB 5KFAA 2OPRB 4OJGA 2D3OR 4IDKB 4YQWA 3AD8C 4TYBA 2HNYB 4LSLB 4W98A 4FYYB 4Y2MA 4GVBB 3DNCA 4Q45A 5DS7A 1LV5A 3EZOA 1H0HB 4PPDA 2V2VA 1K1QA 4JI5F 2QA1A 2F63A 2L9NA 4DV3F 1TUVA 3W1YC 3UVJB 4LJMA 2YY3A 2M7SA 3FVYA 1J5EF 2W7AA 2AGPA 2M3DA 4EO8A 1L3KA 1SPBP 3JSRA 3ISNC 3HMJG 1WHWA 5LOQA 5ETQA 4UY8T 4HKQA 2BANA 3J7YI 4R0EA 2IFXA 4F02A 4DL3A 1LKZA 1PO6A 2FGCA 2YPYA 1U1QA 2MKJA 3H2UB 2CNNB 1MSWD 2B7BB 1EIYB 5B0AA 1CJTA 2X1AA 4RBUA 1OQ6A 2ZFHA 4WYWA 1VQPS 2HW3A 2ZDPA 2RE1A 4WXOA 1JJ4A 3NNAA 2Q6BA 5DGBA 4OHZA 4TU9A 4LMZA 3LGNA 3ZTPA 3GR0A 1WC1A 3AJDA 3BGLA 4QIEA 5C25B 2MQPA 4DFJA 3KJFB 2NQPA 5LJ5Y 5MAOA 1R89A 3QT8A 4ICLB 1V3SA 2CQCA 5IFMA 3MR7A 5LSRA 5RUBA 4PKDB 4LRFA 2RD5C 5EWEA 4EFAC 4K5RA 5LM7E 2EPIA 1RB0A 1UEUA 1T05B 2V4JA 4NLDA 3TAQA 3VR1A 4HLBA 2OHDA 3TA1A 1UEVA 3VGTA 2PFFB 2A10A 4M5HA 3TVKA 3WIVA 2XULA 3DRSA 3MEGB 1RU1A 2EC2A 1MNEA 3PJ9A 1FEHA 4DV1J 1Q0NA 1OY8A 4X2BA 2DCUB 4NXMJ 1JLBB 2YNGB 3KK2B 3SDEA 4CLFA 2IDLA 1CJKA 4PG4A 4S0MA 4OYIA 3UDEA 2BE7D 2F9JA 3HVWA 1RBAA 4CO5A 2EVZA 3RYLA 3EE3A 3OHBA 4KSEB 2HFSA 5K8MA 4RW7B 1RYRA 3TVZA 2ZOFA 2DNYA 1YDLA 3Q2TC 2K06A 1NUEA 2YWEA 4G1IA 1I6JA 4ZS6A 2IA0A 4CT8A 1FERA 5K8OA 5LSOA 1K1SA 3KLVA 3V81B 5B0GA 2FZKB 3OFEA 1OQ3A 1U2CA 2CQPA 2JFKA 1X5TA 3KMSA 2WHOA 2MQOA 5A2QY 3D66A 2V4RA 3IG1B 2JX2A 3D6FB 2FVCA 1S6QB 1S9GA 1R0AB 2I1RA 2BKOA 4L75A 5D8HB 1N36J 3DDIA 4PUOA 2VICA 2FC9A 5AJ3F 3BB5A 2X7IA 1CS4A 1Q1KA 2UUAF 1WDTA 2VQEF 1F5BA 3SSSA 5HROA 1F6TA 4QJVA 3H25A 4LT6A 4WIIA 2IM2A 3MWBA 3N01A 3VVUA 5H9EK 2LCWA 3DLKB 5DG9A 1OYDA 1U6BA 4LIWA 1QE1B 2B6AA 2BE2B 5LMUJ 4ZVTB 1YRTA 2DXEA 2R7OA 2AHOB 3DOKB 4DUTA 1XR6A 1URNA 4DUZF 3HKWA 2Z2LA 1TL3B 4MYUA 1S72S 4C8YA 3M6VA 1TV6B 4AXJA 5GMEA 4RO0A 1FNXH 3MM7A 3D6MB 4AL6A 1VJWA 2FVPA 3PEHA 1T94A 4ITSA 2VASA 2V9KA 4ES1A 4USJC 2C1EB 1HNIA 3MEDA 3BKUA 1FI4A 2XLIA 2HVIA 5ETLA 3K5PA 4XDDA 1FJ7A 5E3CA 2IYIA 1TP7A 2V2QA 5THWA 3MF5A 4RBVA 2VC0A 4GO5X 4RW4B 2KDOA 2NPIA 2Z0GA 2NUHA 2P9GA 2RQMA 5KG0A 5HMWA 2HS3A 5HBMA 3SEOA 4P2MA 4K7QA 1N48A 2E1RA 5E41A 3E51A 1N33F 4KHMA 4ZCMA 2HZAA 1ZAXA 4J9LA 1PJ6A 1FFWB 2OKQA 3PR4A 1YBUA 3K5OA 5HMXA 1FE0A 3M9NB 4K4VA 1AYEA 4I2QB 2RRNA 3BM7A 1P1LA 3D5MA 2DPIA 4NOHA 1EKSA 1D8YA 3JTPA 3FMWA 2DNZA 2DB1A 3R27A 4ENOA 3MHYA 3KTQA 4DU7A 4B17A 1FDDA 1IQTA 1SQFA 4FVMA 3CMAS 3G6ES 1VBKA 4TN2A 3GG0A 1U49A 3C14A 1IQZA 4NZ6A 1ZS6A 2BX6A 2ZBIA 4DLEA 3UDLA 1QAXA 4K5SA 5ADZA 3M8ZA 3UO0A 1Z2ZA 3DLEB 5DO2A 3KK3B 4XTTA 2FY8A 2QA2A 1FX4A 2V8DA 3IBCB 2XZTB 3G6YA 4A8XA 3QMQA 1TAUA 3JSBA 4FYVB 3GJSB 3PM9A 1XJWB 1ULRA 4K59A 3J80U 3OHAA 1SJFA 2C28A 1M5VC 1F5CA 3KWMA 4DS4A 2LEPA 4WP3A 5JXSA 4L3KA 1WTBA 1FKPA 1ICEB 2HNZA 1RGVA 5KFYA 3OD2A 4PWWA 4I7FA 4QIWD 5HATA 2EFOA 2A6OA 4DV2J 1RTIA 3A8IA 4X4UA 3OW2R 2NXJA 2CA9A 3MUTP 4FF4A 1NAQA 3PY8A 3PW2A 4DR2J 1SJQA 3PVXA 3H5UA 2Q3PA 3OUYB 1U47A 4DL2A 2R2RA 3I0RA 4ED2A 3BH6B 4DUYJ 3C66A 4DV4J 2XMTA 2OFHX 3W3SA 2H65B 2AEFA 4ZJLA 4X4SA 4OJ3A 1WNEA 2Y1JA 5FDLB 3LA0A 4C3MA 2XGQA 1X4HA 4DSFA 4ETZA 4JI1F 5C24A 4CLSA 1RT7B 3NWRA 3BGRA 2FZGB 2WVFA 4YB7A 2E9ZA 2DR5A 4U7UD 1C2PA 3K5MA 2AYEA 3IRXA 1RCXB 3KUEA 3QT5A 3CE8A 1GNKA 2CJAA 3J81Y 4BC7A 2FQQB 1R7IA 2F9DA 2JWNA 4N76A 4TLRA 1SH0A 2WRMA 1UA1A 3KJVB 5KG6A 1DTTA 4C8ZA 3BZQA 1VQLS 2W4DA 2QN6B 4AE5A 5C42B 2C2OB 4KE5A 2LQ5A 2CADA 4OJHA 1U1OA 3QRRA 4KO0B 2E5HA 5BYRA 4WU3A 2FB0A 3VAGA 5D4OA 4FYWB 1OPZA 3TVYA 1WELA 1UL3A 2YBVA 3EXYA 1KD1T 2QJ3A 3C3LA 3ITHB 4DX8H 2B9XA 4D3HA 5IT9Y 5KFXA 5J2MB 3BR8A 3HVTA 1HBUA 4NLRA 2V9WA 2KT3A 3V6HA 2ZWPA 4WU2A 1LXJA 2FLLA 5E5NA 3FBFA 2F5GA 1ZTWA 2B0GA 4M94A 3JSMB 3LAMA 3CVKA 2AEJA 3FK4A 2P9CA 3P96A 4JI3J 1U1PA 4USWA 2CQGA 5BYSA 1HNWF 2DTJA 1D9FA 2UP1A 5SZTA 4JI8F 1WC6A 3JSYA 4AUKA 5KFKA 1RWWB 4I6WA 3AJ1A 1HNZJ 3H8YA 2VQFF 3H2VE 2OPSA 3FSIA 3LUYA 1IBLJ 1YI2S 3MMCA 5E3PA 5ETPA 4BS2A 3G8TA 1PC5A 4OIXA 1XR5A 1H38A 3QT7A 5E33A 4CRJA 4ECUA 2PMWA 4WF9Q 1JLAA 2NZCA 4NASA 1MROA 2VOPA 5IS2A 1RAGB 4EK2A 2ASLA 2CQIA 3VGUA 3SCKE 4HHJA 2OPQA 4KRWA 5AT1B 5J1EB 1RHUB 1N5VA 3GU0A 4X4NA 4WPAA 1LW2A 2O5DA 2MZSA 1QSSA 4PEOA 3MZIA 3EMTA 2XWXA 2OP5A 4F4KA 4DG1A 2LDYA 2QLJB 3C19A 5FJ4A 4M5NA 1N54B 1S1WA 1HQEA 4ZLJA 3W64A 3NAHA 1SJRA 3QZ7A 3W2WA 2NUUG 3NGUA 4WTOB 4FYDA 1PCAA 1SC6A 2XQCA 4DL4A 3N6NA 2JJ4D 3MCMA 4LF1A 4ELTA 1UZHA 2RHQB 3LGMA 4Q0BB 3H5YA 2HYIB 2GVZB 2CWXA 1VC5A 2KM8B 2UZAA 4OYPA 1WC3A 4J91A 2GC8A 5A8WA 4LF5F 3K5NA 5D0RA 8AT1B 3FCWA 1JLCA 2DR6A 1TL7A 1M90T 5HI7A 5KFFA 3DKDA 3NGDA 2C2ZB 3UN3A 1FJEB 2L9WA 2XS2A 5GADU 3KLEA 2CPZA 2HRTA 3D3CJ 1JLQB 4ZOSA 2AJ4A 2E29A 2EG2A 3ZZRA 3OTDA 3TZYA 3KYLA 5L1KA 3RW7A 4LR9A 4B02A 3QATA 3DGPA 4FXVA 1JQGA 2MMYA 3MM6B 1VK3A 1BQXA 2ZDOA 2DNKA 3UCGA 4YY3J 4GRSA 4ZPCA 4ZLPA 2OPRA 2GQQA 4O0NA 4DZDA 3BSOA 3IO1A 1VHFA 2HNYA 4LSLA 1XNRJ 2AYMA 1Y11A 4GVBA 2BACA 3SV3A 3OTEA 3SFUA 2RQKA 2JLFA 1OIAA 1CC8A 4DSJA 1J5OA 4ZPTR 4AL5A 1LWFB 3E01B 4I2PB 1U25A 2XI2A 1Y7PA 2HBYB 4RW6B 1FDAA 3IM9A 3UVJA 5H9FK 3J7Z5 5CYMB 4QW9A 3CNQP 5DJBA 2H4YB 4DPUA 4MKBA 2V5HG 2AJ2A 2ZKTA 5GAHU 2LQJA 1FJCA 5KFQA 2FGOA 1SC4B 2C2MB 3FSXA 4X4PA 2DRBA 4W90B 1LEOA 3PHEA 1VQ8S 4NPOA 4AD6A 3PX6A 2VFUA 2BJ3A 2PMZD 3U7JA 2DBBA 3Q23A 5EX3A 3TJAA 3NGSA 1QAIA 1C4CA 3RW6A 3Q2SC 4KGKA 1SCJB 3V5RA 2NREA 2BJDA 1YKWA 2WAQD 1VRTB 1OO0B 1RHQB 2AV5A 4C3KA 3ET6B 5A0YB 1S49A 2RILA 3I4PA 3WHIA 5C25A 2EFNA 5KT4A 2VFVA 2E1CA 1XERA 4IFYB 4O23A 1ACMB 1Q79A 4ICLA 4RNMA 3LQVA 1RAOA 2I5JB 4DV1F 3GV5B 2EBGA 1HHSA 4NXMF 5KFTA 2V94A 3EGNA 2ADBA 2EWHA 1FRLA 4RJVA 3R5DA 3SCIE 1T05A 2MSSA 3MFIA 2KL8A 4G1QB 1PGZA 3TAMB 4ECVA 4J9OA 1TUWA 1X4FA 2NS1B 2XC9A 2P6SA 4A8MP 5LSLA 1NDCA 2QO3A 1VYAA 3DLHA 5K5MA 1F1BB 2DKOB 2UU9J 2IVFB 3MEGA 4ZVFA 1UCNA 2JL9A 2LU2A 4NLGA 4Z2XA 2CJQA 2HFUA 2DIVA 3HVAA 2BJEA 4M5GA 5E3AA 4DF8A 1JLBA 2YNGA 2M52A 3KK2A 3MEEB 2ZBPA 3HHLD 4TNOA 2JEFA 4X4VA 3QIDA 3UR3C 1WACA 5KT2A 3UE2A 1QJHA 4I1TA 5A6WA 3K5LA 2HWTA 2KYXA 3KHGA 2HRYA 1N36F 5KFJA 4RW7A 4PQUB 4NE9C 1YJTA 4NCBA 2VPYB 1TKXB 2ZH6A 2HRUA 4DR6J 3V81A 3B6BA 2UVVA 2N3LA 3IMQJ 3Q8VA 1S9EB 4ANDA 2WB1D 3A8JA 2V4QA 2C3PA 1GXLA 1OPIA 3SZ2A 1X9WA 3N28A 3IG1A 1YJ9S 2ZJPQ 1H2VZ 4PRFA 3D7SB 1BE4A 2BA9A 1S6QA 5LMUF 3IFEA 1R0AA 2L08A 3N4WA 1R43A 5LXYA 1L5UA 1SQGA 1RT6B 3EVOA 2J5AA 1PAUB 3GWCA 1NRKA 4J9RA 4OHYA 1Y5NB 2VG6B 3VAMA 4HTJA 4K4XA 3MMJA 3CUNA 3EUNA 2Q79A 1XMOJ 4F2SA 2QLWA 2QLFB 2P2CB 4JOUA 8RUCA 3GYXB 1KC8T 1UKUA 1N6QB 3OPKA 1IM6A 4KKOB 5HVGA 4WFYA 5CD4A 3DLKA 2LXFA 3HFVA 3R8YA 1QE1A 1M1GA 2BE2A 2M70A 3DOKA 3R9LA 1SUQB 1B3TA 5KG2A 4O3OA 1TL3A 4B3OB 2YWHA 3Q24A 2PDAA 2R7UA 1RAEB 5KFCA 4LF8J 3VWSA 2DNHA 2HPUA 3LPEA 1VHIA 4OMFG 5D0GA 1ZPWX 2RSQA 3CCQS 1HIYA 1FXDA 4RU9A 2CZ9A 2VG5B 3AOBA 3VAIA 5M2PA 3VAFA 4QQBA 4A48A 3U02A 2POKA 1NH8A 2PN6A 4CNYA 2HHWA 3BREA 4DV6J 4HHHA 4DPOA 1D3WA 4RW4A 2HQIA 2RUGA 3R1LA 1ZETA 5F8JA 2DNOA 1BUXA 4P73A 2KFNA 3TUIC 2HZCA 3TWZA 3LP2A 1X4BA 3A4TA 1T9YA 4WFAQ 2ZVSA 3SSRA 1KTQA 1JLGB 4KGZB 1HLWA 1FRKA 4I2QA 2BQUA 2B8QA 2ILYA 2HQDA 3LW5C 4ECQA 3DRXA 1S9FA 4CLKA 2MDAA 2OEJA 4P52A 4FYXB 3FKBA 4C97A 3RR7A 4JI4J 3U27A 5D0EA 4A8KA 2Q43A 1TUGB 3K57A 4HTIA 2QMWA 3KNGA 3N5FA 1WF0A 3KDOA 4WTYA 1U1RA 1U26A 2O1PA 2OSRA 3O44A 2H5IB 5IQQA 4DV2F 4CP5A 2HFOA 4LR7A 1T7PA 4C98A 3DLEA 1P1TA 2AIRB 1N5TA 2WVCA 1W7WA 3GIMA 2MQLA 3KK3A 3T9ZA 2M2BA 4DR2F 2V6AA 2ASYA 3IR7B 3NBPB 5T7LB 1S0NA 2VHGA 2QX0A 1FWPA 1Y3JA 2VPZB 5B0BA 4PWUA 2CPJA 1UFLA 2FJEB 1HWLA 5ETVA 2MZRA 4DUYF 4DV4F 2KJWA 2B9WA 3ISND 3UN5A 1P6TA 1I94F 2MQNA 2BZ2A 2QRRA 4DN9A 2QIFA 1Y5IB 4WKYA 3OVAA 1GXUA 1ZM4A 4N8NA 1X4AA 3R7SB 4ECXA 2XZWA 4PG7A 3THPA 5I42A 5DDPC 1K9MT 4ZVGA 3VF0B 4OI3A 2MHEA 2SXLA 1OY9A 4AFFA 3BV8A 3NNCA 3OUYA 1NZAA 5AE3A 2YQ1A 2ZE2B 4LSZB 2H51B 1VJQA 3EGVA 2PGCA 2LA6A 2G2YA 5KT5A 1SJ4P 4FF1A 3LO3A 1GT8A 4IOBA 1GMWD 4BLGA 3FRZA 1U7LA 2W4PA 1WC0A 1RT7A 4USHA 2J9DE 3EGWB 3P4UB 4DEZA 2MKKA 4EEYA 5DQIA 2KT2A 2PD1A 4QWDA 2H3EB 1EKRA 2GQCA 1BQNB 5K14B 4P2SA 2ZBQA 4HT5A 2W9AA 4YS2A 2H5EA 3CC2S 4ANCA 2XWYA 1XN9A 1E6YB 1KKHA 4FKYA 3KJVA 2Z2MA 3CGIA 5KFHA 1M5PC 2BQRA 5C42A 4JI3F 5D4LA 4C0HA 1DQAA 2VFTA 1YIJS 1KOHA 4KO0A 5KFIA 3TEGA 4UZCA 2YNFB 3R5AA 3EDQB 2V34A 2J6UA 1SJ3P 1Q4RA 1IBLF 2VFRA 1U48A 4QPTA 4M5KA 3ITHA 1RA6A 4YR2A 5J2MA 2V2ZA 3BH7B 2LEBA 1NJXA 4NLWA 3SSQA 1FFSB 3GCWP 4ATNA 2B9YA 4LF9F 4HR2A 4EBDA 3JSMA 4N7TA 1N32J 4MJKA 4ZPAA 1MWZA 4IQXA 3OL6A 5KFBA 4OYBA 2DHSA 3RGIA 4CO0A 1YITS 1CJTB 2DHAA 3OFHA 4DF4A 2PO4A 4CLWA 5DQGA 1NU4A 4CT9A 3ETOA 3MAQA 1LFPA 3SXLA 4ZLLA 5KTQA 3GCXP 5HAOA 4USIA 1QVFR 1GXTA 2BYCA 3R2CJ 2R2SA 1VQNS 2LQ9A 2K2PA 3HHDA 1N5SA 5HL7Q 1UPMB 2MGZA 1IBMJ 2Y0SD 3IGNA 2VIHA 3D6TB 4ED8A 1N4LA 1VGYA 4KBIA 1JX4A 5J1EA 2YX4A 5HQLA 1UEKA 2ZM6J 1WEZA 2BM0A 4YP3A 2G2ZA 1S1TB 4MAKA 5HJXA 1HYSA 2OPPB 3QQCD 4JBCA 1FTCA 1HI1A 5MLCV 3GONA 2J7WA 2PIIA 2BE9B 3HFZB 2KHDA 2FJVA 3JB9k 3QRPA 1H98A 2FJXA 4UUXA 3OSNA 2HURA 3BO2A 4XIUA 5KFRA 3P6YC 3V4IB 4Q0BA 3PXGa 2WW8A 2GVZA 2CJXB 2ZWOA 4KHPJ 4M63A 4EWTA 3CT9A 3EYZA 4P10A 3M8QB 1NH7A 2HHTA 3TZXA 3O2IA 9RUBA 2G2OA 3O8WA 2IA6A 1XNQJ 2WSEC 1DAXA 2L9DA 1YX2A 1XNRF 2ZBRA 1NKEA 1S1XB 4LFAJ 4DR3J 3L3CA 1DARA 3HJVA 1KDNA 1JLQA 2R2UA 4ETXA 1S6UA 5JVGQ 1UVJA 2ASJA 1R8CA 1VQ6S 2MLXA 3CD0A 3V6KA 1ZAWA 2E5GA 5KG3A 3NS6A 4ZVUB 3CD5A 1N34J 3CMES 3MM6A 1Q8BA 4X64J 4QOTA 4ED1A 3G8SA 4ECRA 3HHLB 1U8SA 4M95A 2ROEA 1T0TV 3DFEA 1O5JA 3GIRA 3CJ4A 1IWGA 4UOHA 1JNRB 1DURA 2ZBCA 1H6KX 2MKCA 3CC7S 3F41A 2G0CA 3PKYA 1VLYA 5EGYA 1N52B 2PEBA 3GZ7A 2O3DA 5L1JA 4IRCA 4CCHA 2D3UA 1LWFA 3E01A 4I2PA 4GKKJ 2CPXA 1VR6A 3MI7X 4RW6A 1CS4B 1KVJA 3ZNUA 4PXBA 4OI1A 1CSJA 5CYMA 1MG7A 2PI4A 2Y3YA 4O3NA 3AT1B 4FS1A 4GC7A 1GTHA 2VUGA 5HANA 3H90A 5ITHA 5J2QB 4N5SA 1ZA1B 1KR4A 2VBZA 2QEXS 1IN0A 5GAEI 1RAHB 3P3DA 3OFFA 2C2RA 1U1KA 3FFIA 1GX6A 2RKIB 3NOCA 2Y0BB 2A6MA 3Q8QB 2J9EA 1NCLA 3LOUA 2P6TA 1KN6A 3EWGA 1Q53A 2EC0A 4MIBA 3OVSA 3T41A 3T5JA 4A8YA 4CLYA 2BQ3A 2BKNA 1EHWA 3SQGB 2E5LJ 2RNEA 3GSIA 3H40A 1U0SA 2OAUA 1SH3A 1VRTA 2IC3A 3THVA 1HWKA 3MD3A 3ET6A 5A0YA 1WKLA 4J9QA 1DQ8A 2MB0B 4PYDA 4R25A 1QAJA 3EJMA 2UU9F 2IMWP 1XQIA 1IJFB 4IFYA 4FN5A 3D9BA 3KMQA 1AFIA 2YX7A 2I5JA 3V6DB 1TK0A 1DHMA 2KTQA 2YXLA 2PEHA 2W8LA 3J81j 2EFGA 3D0GE 3C2PA 3EPGA 2APOA 3VTIA 3DHWC 1XR7A 3DC2A 4ECZA 3TAMA 3CSKA 1M5OC 3CJ3A 2J6SA 1CBKA 1SI9A 1S4EA 1JKHB 2M8HA 5CYQB 5JJBA 3UW1A 2DGOA 4J37A 1OSDA 2HVZA 1VC6A 3WIUA 3M2UA 3CO9A 1UA0A 4BHQA 4H4KA 1AT1B 3OQ2A 4O4GB 4DR6F 3PKMA 3CJ5A 2WTFA 3MEEA 1O51A 4O3SA 3KKFA 2KFYA 4A47A 2VA3A 4NLTA 3H2LA 4HEA9 1RJJA 5HVFA 1RZMA 3M1VB 2W7OA 2BR0A 2HKEA 2O66A 3PNIA 4PQUA 4YN3B 3ETMA 5T14A 1TKXA 1S10A 5CXTA 4RWWA 1PJ5A 2F65A 2J8SA 4EO6A 1N0VC 1XMOF 1IKYB 1S9EA 1FKPB 1XIQA 3VZIA 2NZ4A 3NAIA 4MFBB 2AMCB 4DCOB 5CABA 3CCLS 1NHVA 1BD6A 2H54B 2D3O1 2FY1A 1R8BA 3T19A 3GSDA 2CDQA 2DNQA 1RT6A 4DN0A 4PXCA 3V2UC 2XO7A 2CVEA 2VG6A 4LF8F 1RT4B 3OR1B 3AFGA 3R6GB 2X3DA 4F0KA 2QYGA 1F9FA 2BJ7A 2LA4A 4N56A 4LSNA 4MKYA 2J9DA 2KYZA 5E0OA 1WC5A 3M6UA 3UN2A 1N6QA 3AOAA 3R5CA 1FKOB 1ITPA 4KKOA 4J7CA 4LIRA 1NSAA 3H4DA 3BGRB 1KTVA 1V5VA 4Y34A 1KHVA 4V19X 4OI4A 3MOZA 1YJRA 3Q8SB 4TY8B 4PAAA 4DV6F 4KY3A 1SUQA 1O0PA 4B3OA 3JQMA 1Q86T 2I2YA 2W2OP 4K4SA 3TZWA 1WKKA 5KG4A 1UJ5A 4QIVA 3TJ9A 2F7VA 1RDRA 3OT9A 1EETB 2DVIA 4X66J 2KM8C 3D4JA 4PR6A 2MJUA 1ZBTA 1CULB 3IBWA 1NK4A 3TUPA 4OHXA 2B56A 3I5CA 2XBPA 5DRKA 2VG5A 1TQLA 2GZOA 3FJ2A 3ZTRA 4KAIA 4PXDA 3M32B 3DRRB 4MK7A 1I1GA 2HGNA 3L95X 3PJXA 2RS8A 4YOEA 4DFMA 4XPCA 3RTVA 4ZCKA 1WSVA 4FXWA 1VK8A 1RQ0A 2FC8A 1T9UA 4JI4F 1RWXB 2EKYA 1ZPVA 5KFGA 1FD2A 3MEKA 1VI7A 5IM0B 1RAAB 4GO7X 3W60A 5AE2A 4QWBA 4USTA 2CVIA 4C0OC 3D0HE 1B0VA 4U7UK 1N5QA 4J9PA 2QMUB 1LXNA 2RDIA 4C8LA 2ILZA 1JXLA 3M9MB 4KGMA 3R7NB 1JLGA 2G1DA 1TL1B 2Y1IA 4JV2A 4IFVB 1TFYA 2GX8A 3ONQA 4TY9A 3HLUA 1AROP 4L76A 4M5LA 2WZ1A 1D0EA 1QDUB 1AZSB 1HKAA 2R2TA 5IV4A 1Y0HA 2YH0A 4UZBA 4F36A 2VF3A 3Q83A 4KYZA 2XYGB 5K8NA 5CD4H 2NXUA 1JLAB 4CM0A 1G7CB 2J7KA 1Z4UA 1CG2A 4M5DB 2HS4A 1D8ZA 5F9NA 2OPQB 2KH9A 3OLAA 4X4OA 4BC9A 1L3UA 3ZZYA 2CXEA 1X60A 1LOUA 2Y1RI 1AW0A 3NBPA 5T7LA 2R8JA 4LVOP 3CD7A 3QJPA 4DG1B 3ENQA 2C3YA 3MM9B 4NYOA 2BW7A 3DHXA 3DLLQ 1F0XA 3BQ2A 5L9XA 3BSCA 1MWYA 3C8YA 1HNXJ 3HM9A 3NGKA 3ADAC 3SYZA 3TP2A 2ADCA 3FBBA 2ATCB 3Q86A 3HF5A 5ETTA 2QLBB 3VAHA 2Z2ZA 2DRAA 3GV7B 4I4BA 4Q44A 1TK5A 3B54A 2LP4A 1GH8A 2JZ5A 4OZ0A 1SKWA 5M2UA 2C3MA 2F8EX 2JLEA 1RHKB 1RAJA 1WF2A 3MR2A 3DCAA 3N6LA 3DI6B 3KG1A 2ZE2A 4GC6A 1BQMB 4CLZA 4OI0A 4USVA 5GMKa 4MKVA 3T3FA 2VKRA 2M0GB 4CO2A 4KC5A 2W9CB 3PW4A 2QL5B 4XPEA 3OBIA 2DHXA 4LFCJ 3T5LA 1NDLA 3IAM9 2Y8YA 5EUHA 1X4GA 4WWSA 4O3QA 5A8RB 3HT3A 4P75A 3QBCA 1BQNA 3PFEA 5L9NA 3U1LA 2YKOA 1BHNA 5K14A 3T6BA 3EVMA 3N6MA 3I56S 3MUVP 1E6YA 1SKSA 4OYOA 4TXSA 1R8AA 3G9CA 1MMLA 3GFHA 2YWKA 1N32F 3G6XA 3B4MA 1DJ0A 2WBRA 3DDKA 1VQ7S 3C46A 1B7YB 3JXOA 3TZZA 2FPHX 2YNFA 1J5OB 4HL9A 1KS2A 2B51A 3NCRA 4BWMA 1M5SA 1X9SA 2F8HA 4CH0S 1DFDA 1PSDA 2KXNB 2AW0A 3QT6A 4LF2A 3HI9A 4ZN1A 3CDUA 3IC1A 5GAGU 3HFKA 3IA0A 2I6WA 1NNDA 2CNOB 1IBMF 1GMVA 2ABYA 1UWBB 3ILJA 4R8UB 2ZJQQ 5F8LA 4CIOA 2MY7A 1YWXA 3BYPA 4I0WA 3DYAB 3QAUA 2RIJA 3CCSS 5GADI 2HBRB 1KFSA 3M6XA 2YTCA 2ZM6F 5HSPA 1WOPA 3BBFA 4NLOA 3L7UA 1VDHA 4FNHA 4F2RA 2IPOB 3JAMU 3BGOP 3G86A 5D77A 5BXIA 1TR0A 1G3OA 4ZVQB 2V69A 5D6GA 2DGTA 2MJNA 4DHVA 2N7YA 2OEMA 4ERDA 2V50A 1RA7A 1RAIB 2CZ4A 1FRMA 1S7HA 3BQ1A 4RNFA 3BO3A 3SIPB 5KFPA 1R0BG 2Y8WA 2AKWB 2YKNB 2OLWA 3FDSA 2VC1A 4QU6A 4YFUA 1YJUA 1EQ0A 4K2JA 4HI2A 1URRA 4H4MB 3TR5A 2PI5A 3DMJB 4KHPF 2AGQA 3HZEA 4UTGA 1CVJA 3HD1A 1T9VA 3NP5A 2L41A 1FESA 1S4FA 4RNOA 3LF0A 1NJWA 3Q8UA 1S1TA 1XNQF 1WD6A 2OPPA 1OWXA 1V3RA 1LK7A 1FWLA 2GQ2A 4LF4J 1KBRA 1U0HB 4LFAF 3J7ZT 4RU2A 4DR3F 1VRUB 5EWGA 3TJ8A 4P9SA 3CJ0A 4P74A 1VIOA 3MMBB 1RUSA 2QL9B 2ZNYA 2JH3A 1TKZB 2PA3A 2BBEA 3T1HJ 5I3QA 2VONA 4NCGB 2IBOA 3V4IA 5GAHI 3TQ1A 1TFWA 4ZVPB 4ZVSB 1N34F 5F8NA 1Q78A 4X64F 4CO4A 1TELA 2N4DA 4J9MA 4DPYA 2QLXA 4BBYA 3M8QA 2CRLA 3M2VA 1NK0A 2ZHAA 1S0VA 2RHSB 2VFSA 3A1YG 4HACB 2H48B 5GAEU 1R6YA 2EFVA 2KU7A 4Q5VA 1S1XA 2LDIA 4A4JA 4ZITA 4B3MJ 4EZ9A 2XHCA 1PYTA 4RL1A 3HVRA 1RADB 2B4VA 3KLFB 2UUWA 3W2VB 5C2CA 2UVWA 4A8WA 1UPPA 2YWGA 4U96A 4GKKF 4KR0B 4Q8FA 1YRUA 5DLGA 2F3JA 3KHLA 1FNMA 4ZPDA 2GS8A 2HBZB 3NS7B 3HHLA 4J9KA 2RT3A 4NRUA 1B7FA 1VQ9S 2R7QA 4C8MA 4CQ1A 4B9SA 4YUDA 1REGX 3R5BA 1BLUA 1FXRA 1UW9A 3CCMS 2QE5A 3N0VA 1FA0A 1IXKA 3VVTA 4DCPB 1SV5B 2DH8A 5DZ6A 2ZH3A 1VS3A 3CCES 2ZITA 1QM9A 2OH2A 4B3RJ 2OI2A 1HARA 4F50A 1B70B 1VQMS 3R97A 5CCLA 4WZMA 5J2NA 3EDRB 2IIHA 1R0CB 4CLPA 4CLUA 5D0HA 3QIPB 3W5ZA 2E5LF 1Y4ZB 4UW2A 3TRGA 2ZH2A 1REVB 2ZNZA 5IC4B 1RBOB 4JI6F 1ZOTA 3DRPB 4DSEA 2VBYA 4FVCA 5KFWA 1R3NA 2GJFA 3EZ5A 5J2QA 2KZMA 2DHHA 1MWQA 4RUBA 1F5AA 1ROFA 3NY0A 3DLJA 5CCMA 1IR1A 5A76A 1GEHA 2RKIA 4OHVA 4L74A 1VQ4S 2B4UA 4R0JA 1UW4A 1RT2B 4DQRA 3T1YJ 4WKRA 3VQSA 2C2DA 1NJYA 2AZ3A 4RBTA 1HMVB 1TKTB 4QW8A 1D9DA 3SQGA 1D09B 1WG4A 4RX6A 1FVQA 1NHKL 2MLZA 5DDOC 4DPXA 3BDPA 4RNHA 1TMMA 2E7WA 5H1SV 2R7XA 4TU8A 3HHKA 1FJGJ 1X5PA 3D1QA 2UUBJ 2JC0A 3V6DA 3PZPA 5L1LA 3PYFA 4RW9B 2CPHA 1RWOB 1NXIA 1YBAA 1EQMA 3FGVA 4LRCA 5AXLA 4N47A 3I87A 4Z37A 3N5BA 4WFBQ 4CO1A 4JYAJ 4C7QA 4ALZA 3SCLE 2VDIA 3LP2B 3R3TA 5ETSA 3JQJA 4IO9Q 3S1TA 4QWEA 1U4BA 3CIMA 4PCQA 3FC9A 1NDKA 2ZH5A 1JKHA 2HIYA 5CYQA 4ILRA 4OX7A 2DNRA 2AJ0A 4YDXA 1R6VA 4TQRA 1WOSA 1DY3A 1UJ6A 1UZDA 5D3GB 1JLEB 2XMJA 3LGHA 3QYYA 2B9EA 3CCJS 3BR9A 3CDWA 2FJAB 2RS2A 4O4GA 4Y6IA 2ASDA 3NCQA 2WONB 4YR3A 1VOMA 3TO8A 2IJNA 4NI2A 3KLGB 1X5SA 3HPOA 2OIHA 3IGVA 3KG4A 2DXDA 2IYGA 3CDBA 4ZP9A 1RABB 3LPYA 5G4DA 2R3VA 5DM6Q 2Q1LA 3UI3A 2XY7A 5EN1A 2B4PA 2HHVA 1RP5A 1RT5B 3M1VA 3GIJA 3RBEA 1IKWB 1XC9A 3CB4A 1G1XA 3DM2B 3IWXA 3M9OB 4Y2CA 4C6AA 4XK8C 2YQ3A 1ZTTA 2NXEA 1F60B 4IR1A 4CTAB 4U8VA 1FK9B 1R8HA 3D1HA 5BR8J 1R8PA 2YKAA 3HO1A 3MUMP 1XMBA 3B8HA 4URSA 4X4RA 1PJ7A 2FLPA 1IKYA 5KT6A 1FFGB 3CIZA 1YBTA 1UFWA 2D9OA 2I0XA 3CJQA 1BGXT 2PSZA 4MFBA 1EX8A 1NKBA 1Q81T 2GO8A 4GVLA 3NMAA 5I42B 3CMQA 4QYZJ 4Y65A 1AFJA 1BC6A 4I6YA 4PABA 5ETKA 3PO4A 2V8VA 4ZDNA 4IH5A 2IY5B 3CJ8A 3FSYA 3W63A 4ZVHA 2AT1B 2CQ0A 2R8IA 3FBEA 2KHCA 1RT4A 4PWDB 3OR1A 4A8SA 1S6OA 4B3TJ 3BPDA 4X66F 1JWWA 2EFQA 1I94J 1RU2A 4LRDA 1FKOA 1N8RT 3I55S 4A8FA 1BWVA 2K8GA 1FDBA 1ZH5A 3D1OA 1C1CB 3QZ8A 1FRHA 4TY8A 1EZZB 3CJKB 4NLPA 3TX8A 2NR0A 3UCZP 2N4CA 1EARA 1A7GE 2E9TA 2FLOA 3GG1A 2ZZTA 4ZLNA 2DYAA 2LQ8A 4OI6A 2YH1A 1RSCA 5B7WA 2HLUA 3JYTB 1MU2B 3BSAA 5I3PA 3EZUA 4NLXA 4ZPBA 2LKZA 1GFWB 4LFBJ 1SL1A 3GFXA 2BVZA 2AX1A 4OLPA 4KTQA 2HHUA 1EETA 2XLJA 1B99A 1GMWA 3PHTA 1CULA 3DRYA 4DSKA 3CCZA 4FF3A 5J1NA 4QBUA 1HQ2A 4X4TA 3M32A 2CUYA 3DRRA 2KRRA 3D3BJ 1RXOB 2V68A 1TU0B 2W25A 3KOAA 5IXUA 1H74A 3FUYA 4NXNJ 4NWBA 1T95A 2ZC3A 2QTWA 2DGUA 4HDHA 1RKIA 1UETA 3MR5A 5IM0A 1KQFB 2AJ1A 2A2DA 3HD2A 1U8WA 2ATLA 4C9DA 1DTQB 5IZHA 2HQFA 5L39A 4EUVA 3FEZA 2ZVIA 2DNGA 2Z8QA 5CH7B 2EXUA 2N3OA 2I8EA 5K9FA 4DR7F 1TL1A 2BRKA 4IFVA 2W7PA 3NRBA 4KH0B 1UJ4A 3E8OA 4C8KA 2GHWA 4QCLA 1AZSA 2DGVA 2VH7A 4F4YA 3C6TB 3EM1A 2HAIA 3G82B 1RTHB 1A0OB 3VZHA 3R6LB 4ID8A 4LF9J 1HNXF 4W4MA 2HGMA 2MGZB 3BS9A 4DX5A 1HBOB 4M5DA 2BRLA 1QSYA 1FXLA 2RDDA 3H42A 2F1FA 3UR0A 3QGIA 1V3ZA 2R7RA 4U95A 1VC0A 1CJVA 3LALA 4Q2MA 2G0JA 2YKQA 1NB2A 5C7PA 5HJYA 3MCSA 1QY7A 2WBMA 2CQBA 1RTJB 2BW2A 3MM9A 3SCJE 1HYSB 4F0MA 3W9HA 4DL7A 2KG0A 4WE1B 2D7SA 2DJWA 2MLYA 1NJZA 2VV5A 2DEJA 2DNPA 2DXFA 2X1GA 3RU0A 2CAJA 5DZ7A 1U2FA 4LFCF 1HW9A 5T41A 4I67A 4H4OB 4P2FA 3IRWP 4PG8A 4O3RA 3IAS9 2FYXA 4ID5B 4DQIA 4IQMA 5L1IA 4IG3A 4KQZA 3R7BB 3FNNA 2JOQA 1KSPA 4OQJA 1NK7A 2DH7A 3DI6A 4DU8A 3GYGA 2RF2A 2V2KA 4CH1A 1BQMA 2R42A 2WW4A 1XWLA 2BKPA 2HFNA 2AU0A 3GB0A 3OTOJ 3D0IE 3W62A 1SB6A 2CWKA 2R7SA 2VZ9A 2XZDB 3RB4A 2OMLA 2W9CA 1UVIA 4I68A 3C6UB 3HSJA 3GFZA 4I6AA 3KNAA 1H72C 1U02A 5KT3A 3TEHB 1GK8A 4B9MA 4WIQA 3VHQA 2UXCJ 2LXUA 5A8RA 2FHJD 3HT0A 4RW8B 3UPFA 2IAJA 2OFGX 4F04B 3WDOA 1SKRA 4USKA 3PRBA 3M8PB 2OJ3A 2ZUAA 1B0TA 3CEDA 5A8KB 4DV7J 1TVRB 1KFDA 3NGRA 1UAWA 2HQCA 4IO1A 4LBHA 4DPTA 3OSPA 2H1YA 3AA8A 2VBXA 1NSKL 4QYRA 3I0SB 3ZZPA 5C5JA 2IDEA 2NCKL 2KVIA 3BBCA 2MZ1A 2JSXA 1RWNB 4QU7A 4NA3A 5KFLA 2BOPA 4ZIVA 1TKDA 1WKJA 2W2MP 3DOLB 2AEMA 3SFGA 4P7VA 4CZCA 1I3OB 3POTB 3H98A 2GJIA 2EKNA 5KOWA 2CFXA 3HSGA 2CQDA 2GGPB 5IQ6A 2JFDA 1TMJA 1UWBA 2EK6A 5L46A 4R8UA 5AXNA 1HHTP 4OYXA 2EEYA 3ILIA 4L73A 4NEZA 3OXGA 4YB5A 3DYAA 1VQYA 1AUSL 3FFIB 1RWPB 1T8EA 4UF4A 5IT0A 2HZVA 3MPWA 2JHEA 3CW2C 2KG1A 4N8OA 2DITA 2NXCA 2IM1A 3EX7B 1QSLA 4NYZA 3OFGA 4NEYA 5G0RB 4Y0FA 4LF4F 2YNIA 1S1UB 4OZNA 2IC3B 3CTRA 3DN9A 3PW0A 3FQKA 5F0WA 3BDEA 1VCTA 3S8SA 1JMTA 2FZCB 1ZA2B 2J0XA 2QFIA 1YLXA 2YKNA 5CZVA 3MECB 2C42A 3T1HF 3H20A 4CLLA 4H4MA 2E1MC 4DPWA 1KHWA 4NLUA 3DMJA 4K4TA 4YDDB 3ZFVA 1VQSA 2ZKUA 5KFZA 1WHVA 1YG0A 4C8NA 3G87A 3QGGA 2UUCF 1J27A 4YB1P 5B0FA 2J76E 3GIKA 2J0WA 5IWAJ 4DS5A 3IWNC 1UVMA 5FD1A 1Y5LB 2ACYA 1W2BR 2R7TA 1U0HA 4B3MF 1W2IA 2E44A 5ETOA 1VRUA 4F3OA 1FD8A 3MMBA 4M5MA 1HBMB 2D69A 3PIPQ 1HD0A 1TKZA 3TI0A 2LVWA 4E8UA 4N41A 3RRHA 1H7WA 2K1RB 2RU9A 4NCGA 3M2UB 1JJ2R 4KB7A 1BY9A 4ECSA 1P9QC 3T9NA 4GKJF 2I38A 2ALZA 4WZQA 5HQ8A 3H4BA 2BMBA 1PKUA 5FLXU 1SKUB 5CYJA 4X84A 2XS5A 5F8IA 4HACA 3MAAB 1WDDA 4OZ1A 2HWHA 5ETNA 1G2EA 4ANEA 3KLFA 1K44A 4JB8B 1RT3B 3W2VA 1YJVA 1T9TA 1WI6A 2LLZA 3AB2B 4B3RF 4TKTA 4DDFA 1U1LA 4DX7A 2B4OA 4PQAA 1F9HA 3K8WA 4ZVRB 4ZVEA 3TNVA 2DNLA 3MGJA 2FUG9 4G6VB 1TL4A 3WBZA 2XCAA 2I9SA 5AXMA 3VCDA 5KFDA 3S7RA 5KT7A 4KGVB 4ELUA 3MAHA 1SV5A 4QR0A 2ZH7A 3DLGB 1EP4B 3M2RB 3MPUB 3HKZD 5KFSA 4ZIWA 1SVDA 3Q8RB 3AA9A 1BXNA 2LEAA 3A8EA 1IR2A 4DJBA 4NA1A 3KFWX 3UDCA 2XEXA 3T1YF 2E5JA 2X51A 2CQ3A 3QIPA 4HYKA 3I4HX 4LSNB 3KHRA 2W4CA 2HAFA 3RR8A 3G2XA 4NMLA 4WCEQ 4ED5A 4IH7A 2UXBJ 1KQGB 3QJLA 1H73A 3ZC4A 1REVA 3DRPA 1GAOA 2HQ3A 4DR5J 2HNDB 3NNHA 3H7HB 4DR1J 1NO8A 1FCAA 2R7VA 3AH6A 5I3UB 3E3XA 3QLHB 1FJGF 4LVNP 1ELOA 2UUBF 2BABA 1B0PA 4P7TA 1WEYA 2GCFA 4ED7A 1YHQS 1FE4A 1RT2A 3KG0A 1RT1B 3W5YA 2RRAA 1UMJA 1HMVA 1WJ9A 1TKTA 4WP8A 4JYAF 2A2CA 2MHNA 2WVEA 1SJ1A 2DPJA 3M7VA 1L3VA 1KQSR 4NZ7A 3TQEA 2RVJA 2UUTA 1HBNB 5LMNJ 1JK9B 3ZTQA 1HWJA 2CG8A 1Q8KA 3OR2B 1S6PB 1HWIA 1B4SA 1VBXA 2ZH9A 1WF1A 4NMXA 2D1CA 4ZJQA 4YMEA 3RRGA 1U6FA 1YZ6A 2CQ1A 1NK8A 1RK8A 4RW9A 1KVKA 1IWAA 3F44A 1KOOA 1JLFB 4DMZA 1DZ5A 4PPZA 5CHCB 2J0QD 2M5YA 2DISA 2XTJP 1RCOB 3NLCA 1F9EB 4Q8EA 1X4CA 1VLOA 4B9UA 3AQPA 3LP0A 3ZTSA 2W9BB 3GP9A 1QLNA 2KRBA 2VBWA 2RJZA 3PV8A 2XO6A 3IR5B 1LK5A 5U47A 3W7BA 2MEWA 2JLGA 2YNHB 5BR8F 4HHUA 5BYQA 5D3GA 1JLEA 5B08A 1LWCB 4DX6A 1OY6A 2WONA 4A46A 2JRSA 3NCPA 2DHGA 1GTEA 3KLGA 4ZJOA 2FVSA 3WC0A 4F3QA 4KPCA 2G4BA 2UXDJ 1VFJA 3OTCA 2E66A 1RT5A 4O0IA 1IKWA 1IKXB 4K0KJ 3DM2A 3P49B 4AQYJ 2DT9A 4UOGA 2VPXB 4B9LA 2O01C 4CTAA 1FK9A 2CQ4A 1X4DA 3PDNA 3O5TB 3J7A1 4B3TF 1YJ7A 4DSLA 5E3QA 5DQHA 4CYUB 3MMAB 2K7KA 2ZHBA 3GQCA 3BYRA 3O1LA 1YK9A 4KIAA 1PYOB 2KB2A 1CQNA 4OZ2A 2JEIA 3MPYA 1U2RA 4P6QA 4F4ZA 3I5AA 2QMXA 4OV1A 2J7UA 4MH8A 3CJRA 2MZQA 2UVUA 2Q6CA 2HGLA 2M4MA 1BWEA 4EYIB 3VAJA 3K8VA 3NOGA 3KDNA 3AJ2A 4IKAA 2FD2A 2KKHA 1ZM9A 3RZAA 1CJUB 5D4PA 4PWDA 4LF7J 4F26A 4LFBF 1LQ9A 3I82A 1T03B 4FS2A 3MOJB 3NWGA 4F25A 4F67A 2IM0A 6FD1A 3ISZA 5F8HA 3ENWA 2LU1A 2CJ9A 3CULA 2MQMA 3SBMA 4QWAA 3US5A 3ILOA 4DQSA 2WK4A 3K17A 1G6BA 1C1CA 2IVMA 4RZRA 3JTOA 1N5YB 2OD4A 3CJKA 2F4VJ 1HPZA 4NXNF 2COLA 3BBBA 3U1NA 4PG6A 4DWIA 1M1KT 3JYTA 1MU2A 3UD5A 3BGUA 4FZVA 2H4WB 1V5IB 2J9CA 4IG0B 1U24A 2A3JA 3H59A 2EG1A 4FNIA 2NYIA 5KFMA 2D9PA 5D15A 3BKFA 3ZNJ1 1DBDA 2ZZNA 3Q8YA 1M1HA 3DU5A 3ZZOA 4G65A 3CCTA 2Q66A 5DDQC 2QA4G 2DGXA 4IUFA 1D9AA 1NDPA 3M8RA 5F3TA 3N9UC 3TYTA 4L72B 1X8DA 2FVRA 3D6HB 2K7JA 1ZZFA 4UQGA 2XG8A 1DTQA 6FDRA 2UV8G 3CCUS 1QUVA 4JI7J 3ZTOA 4H54A 2RUSA 4FXDA 1E6VB 1L3TA 3CJ2A 4ZP6A 4AYBD 3CXCR 2E1AA 1Y3KA 1T9WA 4JI0J 4AT1B 2KXHA 4DQQA 4L6V3 1FO1A 3HCXA 4Y2AA 2XSJB 3JQKA 1YZ7A 3K0JA 2VJUA 3C6TA 1JXVA 3G82A 1RTHA 4IYQA 3MPVA 4JV1A 3PEJA 3B78A 3WQPA 2ZD1B 5AE1A 4RNNA 1UTAA 1M0SA 3ZZTA 4UT4A 2A18A 1QVGR 2DH9A 1HBOA 1C1BB 1WOOA 1HNVB 2JVOA 4UQTA 2EW9A 2HS0A 1X9MA 1I5OB 2GW8A 2QG9B 2DR8A 2VODA 5B0CA 4UOFA 4C4WA 3RAMA 2XY6A 3I31A 1FNOA 3FCHA 4ZCIA 1WSRA 3JAMY 3MCNA 2DGSA 2QSFA 5IC6B 2HEKA 1RTJA 1MN7A 3K58A 1O6XA 3AODA 4WE1A 2HVEA 3QFHA 4ZA1A 4OX9J 3NGTA 3OTOF 3BJYA 5KOXA 2IHR1 3C15B 4LBPA 2R9LA 4ZP7A 2AZ1A 2DRDA 4AXIA 3C16B 2MKYA 4MT1A 5GAGI 3F73A 3QPIA 4H4OA 2D74B 3FQLA 2UXCF 3KK1B 4OZ5A 3LWMA 3IP0A 4BWJA 1H2UX 4ID5A 3A3OB 1JJCB 3LP1B 3VGSA 2ACMA 3KXDA 2XNQA 5EHHA 2J0SD 2MTLA 2G9OA 3M2VB 4F0HA 3EGZA 1RHRB 3L4BC 3NS5A 4C48A 1WG1A 4ZP8A 4ZPWR 3PTWA 4KV8B 4LQ9A 3BGFA 2KZZA 2CQHA 4WK1A 3JS9A 4DV7F 4DBQA 4J9UE 1NPPA 4U6PA 3Q8PB 4EGLA 3C6UA 4V1Ak 2ZUGA 2GVDB 3RAXA 4MTPA 2OEKA 3UDVA 4URGA 5B09A 5EX0A 2FTRA 1YTYA 2RB7A 2BJ1A 2B3TB 4RW8A 4FKXA 3Q0AA 3K59A 3DOMB 3TW0A 3L7PA 1DLOB 2OO4A 5HO4A 1GX5A 1WWHA 4ZMMA 3J7YU 2KI2A 3M8PA 4EI2A 1KLMB 4OFZA 1F3FA 3V4MA 4UY85 1U1NA 3HHNB 3RB3A 3CO0P 2GIFA 4YR0A 5A8KA 4NA2A 4QWCA 2ALYB 3Q89A 5SUHA 1KVIA 1TVRA 3AB4B 2BV3A 2IRXA 3I6PA 4ZPVR 4W92B 4DV5J 4YHHJ 4CM2A 3I0SA 5E3RA 2Y1LB 3QO9A 2MKSA 4AL7A 5HP1B 5J2NB 3RUBL 2CJKA 3BPSP 2LQBA 4FF2A 3WC2A 1V6HA 3TAPA 1Q5VA 4N77A 1PIEA 4LF6J 3DOLA 3T1AA 4MK8A 2FIUA 5EDWA 5LT5A 1FX2A 2BXJA 6AT1B 1S57A 2ZJRQ 2AP6A 2VD3A 1UFKA 3POTA 3M8WA 4CWBA 3KLIB 2DD8S 4IDKA 2LXIA 4EBCA 2FHMA 2GGPA 2V8GA 4NX9A 4U9RA 4O3PA 3F56A 3OVBA 5F0UA 2CPEA 1S77D 1S76D 3I32A 4U67Q 3FMBA 4CLTA 1PBUA 2CZVC 3QSYB 1S79A 1Q8IA 2XMUA 1RTDB 2EBEA 2CNKB 4C11B 2J8AA 1WG5A 2YWWA 1NBEB 5J2PB 2FJWA 2C2KB 2IRUA 2ZEJA 1MMDA 3AQOA 5IWAF 2V8PA 2FLNA 4F4WA 3A12A 3RBZA 4XAKA 5G0RA 1S1UA 3PRVA 1GMUA 4OYAA 1RWMB 4JI6J 5F3ZA 1S7IA 1NB7A 1MMNA 1N0UA 1WORA 1NM2A 3NKYA 4DI6A 5IOLA 3DXSX 2QSWA 3MECA 5F9LA 3M8YA 5HLFB 2HG4A 1FKAF 3GE9A 4DCJB 2CPDA 1C0TB 1NLKL 2OMOA 4KFBB 1N88A 2PMHA 2IJFA 2XS7A 4QPXA 3MM5B 2DO0A 3ZO7A 4DV0J 3TOQA 3D67A 3D2WA 1D1UA 3EXCX 2HLTA 2XCPA 3OJUA 4UUWA 3PW7A 3PJWA 2EK1A 8ATCB 3OXLA 3D54A 2KFZA 3QAEA 1OJ4A 3M4XA 3MD1A 1NKCA 4TU7A 3S01A 1HBMA 4YB6A 2WVDA 3UWTA 1SL0A 1X31C 4P72A 2XGPA 2K1RA 4TLQA 2CG4A 2DIUA 3P45B 5DLFA 1PG5B 1SL2A 1W26A 3PFOA 2R8GA 5LL6d 1U09A 4USMA 2HHQA 2CKWA 2HVDA 4NI2B 1F3VA 3MAAA 4UOCA 1BMQB 2AQ4A 1RE1B 2R7WA 1YGYA 4KPYA 1RT3A 3GLJA 2XM3A 1HQUB 1NSQA 2M88A 2RQCA 3EVWA 2F40A 1Y00A 1G4CA 2ZZMA 5K8PA 2W24A 4WXWA 1LWEB 2YQ0A 1YVFA 4PG5A 2UXBF 1HI8A 2EFPA 4NLYA 2N82B 2GNKA 3PX0A 2AYBA 2E7VA 1FRJA 2VOOA 1NPRA 1YJNS 4DR5F 3ZXWA 5KFVA 5A2QU 2W2PP 2PT0A 5JMNA 4Q43A 3DLGA 4DR1F 1EP4A 3M2RA 2UVRA 1TK8A 2XLKA 7AT1B 3J80Y 1NEEA 4ES3A 4ED3A 1IBKJ 3ENAA 4MKAA 4ER8A 4QZVB 2QYCA 1IR0A 3B4DA 4K4WA 3DU6A 3W66A 2XMVA 2XMKA 4QYZK 1K8AT 1TAQA 3OV7A 5LMNF 2CJYB 3RRKA 2HNDA 7FDRA 5H9EJ 2KJVA 2GMJA 2YPZA 2DO4A 4B3SJ 5I3UA 3AD7C 3QLHA 2MYFA 3GR1A 1S48A 2GIQA 3DDNA 2GMHA 4ZHRB 3W9JA 1P9YA 2X3GA 4R5PB 3BKTA 4C3LA 1RT1A 2FHOB 4HDGA 5KFEA 4DOZA 3G71S 2FDNA 3ZZUA 3AAWB 3K7RA 1XBWA 2J6TA 1IUJA 4ZN3A 4O44B 1S59A 2DY9A 2DY1A 3MCOA 1S0OA 4OI2A 4OX6A 3PX4A 1HBNA 3PR5B 2HHSA 3OJSA 2KN4A 3IBFB 3OR2A 2U1AA 1S6PA 1I51B 1FRIA 4KH1B 4L3NA 4MIAA 4QR2A 3W8PA 4HH1A 2MKIA 3KHHA 1EJ7L 1TV6A 2B5JB 5M2RA 1AB8A 4QIGA 2XMWA 4F3MA 4QIFA 1JLFA 3TUZC 2MQ8A 4HI1A 1XMQJ 1NSPA 5IV3A 3HXMA 2C22A 4DFPA 2UXDF 4DFKA 1Q82T 2M9KA 2VPWB 2ZHOA 3QRQA 3LTOA 4K0KF 2W9BA 2P9EA 4AQYF 3KLHB 2XSFA 1LNQA 1CC7A 2YNHA 4YEAA 5KG5A 1HA1A 1MW7A 4ED0A 2XYPB 1LWCA 3H0PA 3WX8A 3TUJC 3IS9B 3CF5Q 1F2HA 2CPYA 2HMIB 2ERRA 1XTZA 1M5KC 4J5OA 4ED6A 3BEGB 4B9NA 4FPRA 4NL5A 4DR4J 2XYHB 4LRAA 4B08A 3ICLA 3LWLA 5HVHA 4DR7J 3AD9C 3GJTB 1IKXA 4J9NA 4X62J 1CJVB 1VIXA 4JI2J 3I5BA 3ILLA 5D78A 2RRBA 4I56A 2VG7B 2LMIA 5DDRC 4X65J 3TANA 4NYPA 3W5XA 3AY0A 4LF7F 3GV8B 2BUNA 2D41A 3EICA 1S0MA 1QAYA 2DR9A 4CYUA 2RDJA 3MMAA 1C4AA 5HQMA 1ZM2A 4PZVA 2GHPA 2DR7A 2BM1A 5ETMA 1YRXA 4DL0C 4Q2LA 1IKVB 1Y10A 1RWUA 1HL6A 4ECWA 1FRXA 2F4VF 2DGQA 3OL7A 4IG3B 2ZOGA 2AGOA 1HW8A 3UNYA 5K20B 1SQEA 3E2EA 2U2FA 1CJUA 2RMLA 2QA4S 3PYEA 1YJWS 1SBRA 2RF2B 1T03A 2YKMB 1KEKA 3I96A 1CPZA 3HDSA 1VBYA 3A3NB 1Q16B 2EI5A 2R4FA 4M1KA 2X1BA 1LW0B 3R1HA 2R8KA 1SC1B 2G0IA 3MM8B 2GA7A 2PA8D 4LREA 1MN9A 2YWFA 2VDHA 4JV5J 3AXMA 1X0FA 1NK9A 3CCRS 1Y9OA 4IOAQ 3TA0A 2W1BA 1N5YA 4DZ6A 4B9VA 2VL1A 3GTYX 1Q8LA 1W25A 3KUGA 4ZKAA 1C0UB 2IAJB 3AXKA 1U45A 5KG7A 3N79A 4ELVA 2GV1A 4DQPA 1QUPA 2Z58B 1WHXA 2V0NA 1NK6A 3OLBA 1HFEL 4IG0A 3J81U 1OSCA 2RU3A 4OX8A 4JI7F 4DSIA 3L09A 2A1BA 4H4KC 1ZYQA 4WFNQ 4P2XA 4V19J 2WOMB 5FIIA 3NEKA 7FD1A 2V63A 1X0PA 1S1VB 2HFVA 4NRTA 5FDLA 3HSDA 4Q7AA 4FDFA 3HHEA 2HWIA 4IH6A 4JI0F 4LQ3A 3W65A 4WP9A 4RUAA 3P8BB 1FEEA 4OLOA 2FHJA 1WI8A 4HVZA 3LH2S 5I4MA 1VQKS 2MY8A 4EMDA 4FBUA 2L3MA 3M30B 2C3UA 2PE8A 4E2FB 3FRYA 3CC4S 3A3PB 1ZM3A 2CIMA 1X5OA 2C3OA 5IT9U 4ED4A 3MTKA 3MR6A 4OZLA 2CPFA 4C2MA 2E1PA 4XDCA 2PFDA 5A6PA 1QTMA 1E6VA 1TTHB 4OV6A 3VAKA 1UP1A 2W2NP 1CLFA 2ROGA 1WHYA 1Q7LB 2VB6A 3HULA 2XSJA 2HHHJ 2AX0A 1NHUA 3IN5A 1PBAA 2P5VA 1HNZF 2WSCC 4F4AA 2XMMA 4OJ1A 2QV6A 1K0VA 3IR6B 2GAHC 4M5JA 3FEYB 1SIWB 4OX9F 3GIIA 4K4YA 1HR0J 4CI0B 2AYGA 2YNIB 1RWKB 3R2DJ 2ZD1A 4CO3A 4D3GA 1R31A 1X4EA 3W61A 1HWUA 1C1BA 2OELA 1S99A 1HNVA 2Z57B 3VGVA 2BANB 3K89A 5DETA 5F41A 4JI5J 3Q22A 1K0TA 4LUBA 1LFWA 2CDRB 3G8QA 4J90A 4OZJA 4ZCLA 1AA1B 4DV3J 1H7XA 2E5IA 4BCAA 5HN0A 3A13A 3S6EA 1XEZA 4EU0A 3ULHA 1J5EJ 4M5IA 2JEGA 4Y3CA 3VALA 1H3DA 3C15A 4B9TA 2WB4A 2YX1A 4K8RA 3OL9A 3NG8A 3C16A 3LANA 2QC3A 4OZ3A 3A8KA 2DNMA 2NLWA 2Z56B 5KAKA 4RLEA 3DGVA 3KK1A 1PC4A 3LP1A 3PYDA 3B82A 5JVHQ 2UUCJ 3KUHA 1OYEA 4KV8A 3OL8A 1S12A 3UCUP 1NZ8A 3L7OA 2V4JB 3IWLA 3O6QA 4USUA 5DG7A 3QNWB 3MTJA 3AHPA 2ZH4A 4DV5F 4YHHF 2GVDA 1WC4A 5KFNA 4PYAA 3DRSB 2M8DB 2OTJS 3CWJA 1K73T 2HSEB 2XI3A 4NLSA 4K2XA 3TARA 5FLXY 4GKJJ 4ZK7M 3NMRA 3DOMA 4LF6F 1DLOA 2IM3A 3PW5A 3CCWA 3BF4A 2BJ8A 3P5BP 4YY3F 1YQHA 2IBKA 1KLMA 1FF2A 3SDEB 1RYSA 3MXHP 1JNZB 1CJKB 1TL5A 5IT4A 2FVQA 2P8IA 4FBTA 4A8QA 1JIHA 4IRDA 3PCOB 3RJMB 4CDIA 5HP1A 2QZ8A 3WX4A 4Z7YA 3CJTA 3RB6A 3R5JB 2V8HA 2GO9A 4NLQA 1KONA 4OHWA 2XY5A 2QT7A 1B64A 1S97A 1O8BA 3FZ2A 3KLIA 2GMLA 3CDEA 2JC1A 3QGPA 5H9FJ
chains in the Genus database with same CATH topology
2HYIB 1JLAB 1M5HA 1G7CB 2J7KA 1Z4UA 4YMEA 2KM8B 1VC5A 1CG2A 2UZAA 4M5DB 3RRGA 1U6FA 2CQ1A 2HS4A 1FVSA 1NK8A 1D8ZA 2GC8A 1RK8A 3K2YA 1L3SA 5A8WA 4RW9A 5F9NA 4LF5F 3K5NA 4IR9A 2AWZA 2OPQB 1V9OA 3F44A 2KH9A 1JLCA 1KOOA 3IXQA 1S9GB 3OLAA 1JLFB 1M90T 4Y2IA 4DMZA 2PC6A 4PPZA 5HI7A 1DZ5A 4X4OA 5KFFA 1F2GA 3NGDA 4BC9A 2E9RX 1L3UA 3CDAA 3GMGA 3ZZYA 1APSA 5CHCB 1LOUA 2J0QD 1FJEB 1RTDA 2Y1RI 3X3UA 2M5YA 4C11A 2HHPA 4PUOB 2L9WA 2XS2A 1AW0A 5GADU 3NBPA 3D28A 5T7LA 3KLEA 1U1MA 2GHVC 5J2PA 2R8JA 2CPZA 4LVOP 3CD7A 3QJPA 2DISA 1JLQB 4DG1B 3NLCA 4ZOSA 2IMOA 2C3YA 2AJ4A 3ENQA 4Q8EA 1X4CA 4DLGA 1Z1ZA 3MM9B 2E29A 4B9UA 3AQPA 4NYOA 2EG2A 4DV0F 3DHXA 3LP0A 3DLLQ 1F0XA 3ZZRA 2W9BB 5HROB 3BQ2A 3OTDA 1QLNA 2KRBA 2VBWA 3BSCA 1MWYA 5L9XA 2RH3A 3KYLA 5L1KA 2RJZA 3RW7A 3PV8A 2DGWA 4ECTA 3IR5B 1LK5A 3C8YA 5E7OB 4B02A 5U47A 3W7BA 2JLGA 3HM9A 3DGPA 2YNHB 2FJDB 4FXVA 3NGKA 5BR8F 5BYQA 3U1MA 1WTFA 1JLEA 4RKUC 2KT5A 2MMYA 3SYZA 3TP2A 5D3GA 3MM6B 1VK3A 1BQXA 5B08A 2ADCA 2DCLA 2ZDOA 3QGHA 1LWCB 2DNKA 3UCGA 2B6AB 3HF5A 2WONA 4A46A 2JRSA 3VAHA 3NCPA 5E2QA 2DHGA 3MFHA 4ZPCA 4ZLPA 1GTEA 3KLGA 5HLFA 2OPRA 2DRAA 2GQQA 2FVSA 3WC0A 3GV7B 4F3QA 3BSOA 4I4BA 3IO1A 1VHFA 2HNYA 4Q44A 4LSLA 1TK5A 2G4BA 1C0TA 2ROPA 2AYMA 1VFJA 1GH8A 2JZ5A 3OTCA 3PACA 4OZ0A 2BACA 5M2UA 1SKWA 2C3MA 4KFBA 2E66A 2F8EX 3M8SA 2JLEA 4MMOA 3MM7B 1RT5A 1RAJA 1WF2A 3MR2A 3CPWR 3SV3A 3OTEA 3DCAA 3MM5A 3N6LA 4O0IA 1IKWA 3DI6B 3SFUA 1IKXB 3KG1A 2RQKA 2JLFA 3DM2A 4WK3A 1OIAA 2ZE2A 4GC6A 1BQMB 2VA2A 1CC8A 1YSJA 4DSJA 4OI0A 3P49B 5GMKa 1J5OA 2DT9A 4ZPTR 2K3KA 2VPXB 4AL5A 1LWFB 3E01B 4I2PB 4WFZA 4B9LA 1U25A 3I9V9 3T3FA 2O01C 4CTAA 2VKRA 2M0GB 2XI2A 1FK9A 4KC5A 1Y7PA 4CO2A 1HNIB 3MEDB 2CQ4A 1X4DA 2W9CB 4RW6B 3PW4A 4DL5A 4XPEA 3OBIA 3SI8A 2DHXA 3PDNA 3CD6S 1FDAA 3OXFA 3G96A 3LP0B 3J7Z5 5CYMB 3O5TB 4QW9A 3T5LA 5DJBA 3J7A1 4B3TF 4M8LA 4DSLA 5E3QA 5DQHA 3IAM9 2NPFA 2HFZA 3MMAB 2K7KA 3T5KA 1VQOS 5DGAA 5EUHA 3BSNA 2ZHBA 1X4GA 2IRYA 4O3QA 4MKBA 5A8RB 3GQCA 3HT3A 3O1LA 3G4SS 2OD6A 1BQNA 1GQEA 2V5HG 3PFEA 4KIAA 2ZKTA 5GVQA 1SH2A 3U1LA 5L9NA 2YKOA 5K14A 3GYNA 3T6BA 5GAHU 2LQJA 1H2TZ 2KB2A 2MQQA 3N6MA 1FJCA 4I69A 1CQNA 5KFQA 3I56S 2JEIA 3MPYA 2CJBA 2FGOA 1U2RA 3MUVP 3FSXA 4P6QA 1E6YA 4X4PA 4F4ZA 5HBMB 1SKSA 3I5AA 5L8RC 2QMXA 2DRBA 4OV1A 2J7UA 4W90B 3M6WA 3PHEA 4MH8A 3JTNA 1VQ8S 1VBZA 4NPOA 4TXSA 5CA5A 2G13A 2MZQA 1R8AA 4Y00A 2UVUA 3PX6A 2VFUA 3P5TL 1MMLA 3G9CA 2Q6CA 2HGLA 2M4MA 3GFHA 2PMZD 1BWEA 2YWKA 4EYIB 1N32F 1N56A 3G6XA 3VAJA 3K8VA 4G1QA 3B4MA 3U7JA 3AJ2A 1DJ0A 2DBBA 2FD2A 2KKHA 4IKAA 5D4NA 3Q23A 2WBRA 3DDKA 5EX3A 1VQ7S 1ZM9A 3RZAA 3C46A 1QAIA 5D4PA 4PWDA 4F26A 1C4CA 3WZ0A 5AXKA 4LFBF 2FPHX 3RW6A 1LQ9A 3I82A 1T03B 4FS2A 2YNFA 3MOJB 2LECA 3Q2SC 2CPIA 3NWGA 1J5OB 4HH0A 4F25A 4HL9A 4F67A 1HQUA 2IM0A 1KS2A 4KHRA 4KGKA 6FD1A 3MR3A 3MDFA 3ISZA 2GIRA 2B51A 3V5RA 3ENWA 2BJDA 2LU1A 2CJ9A 2WAQD 3NCRA 4RUHA 4BWMA 2NREA 1M5SA 1X9SA 1VRTB 1OO0B 1HI0P 1IBKF 3CULA 2AV5A 2MQMA 1FTRA 1RISA 5HMZA 2F8HA 4CH0S 4QWAA 4C3KA 1DFDA 2HHXA 4EYHB 3US5A 1PSDA 4U7CA 2AW0A 2KXNB 1Q7YT 5A0YB 4X4QA 1S49A 2KO1A 4DQSA 2WK4A 1LWEA 2RILA 3HI9A 1G6BA 3I4PA 1C1CA 3OTBA 5F8GA 2IVMA 3CDUA 3IC1A 4RZRA 5GAGU 5C25A 2EFNA 3HFKA 3JTOA 5KT4A 2VFVA 2E1CA 1XERA 1N5YB 2OD4A 4IFYB 3IA0A 3CJKA 2WSFC 1NNDA 4O23A 2CQ2A 1A9NB 1HPZA 1J2VA 3HZGA 4NXNF 1Q79A 2D3ZA 1IBMF 2COLA 4ICLA 4RNMA 3LQVA 2I5JB 2ABYA 1UWBB 2MZTA 3U1NA 4DV1F 3GV5B 4PG6A 5B0EA 2EBGA 4DWIA 4R8UB 2ZJQQ 1M1KT 3JYTA 1MU2A 5F8LA 3BGUA 2MY7A 4FZVA 4CIOA 1HHSA 1YWXA 3UQSA 3QWPA 4NXMF 2J9CA 5KFTA 4B3SF 2V94A 4IG0B 4I0WA 1U24A 3RB0A 3DYAB 3BO4A 3QAUA 5L38A 2A3JA 2RIJA 3H59A 2E7XA 3EGNA 2ADBA 2EWHA 2EG1A 5GADI 3CCSS 1FRLA 3R5DA 3SCIE 4G3IA 1KFSA 1T05A 2MSSA 3MFIA 4FNIA 2MSTA 3M6XA 2NYIA 5KFMA 2YTCA 2D9PA 1XK8A 1X7VA 2ZM6F 4G1QB 2W8KA 4NLOA 1PGZA 3TAMB 4FNHA 4ECVA 3ENVA 4J9OA 4F2RA 3LAKA 4IRKA 1DBDA 1X4FA 3DLBA 2NS1B 5EWFA 2ZZNA 3G86A 5D77A 4F4XA 2XC9A 2P6SA 3PIOQ 4A8MP 3RBDA 4NCAA 1P8GA 5LSLA 1TR0A 4C8OA 2QO3A 1G3OA 3V6JA 1SIZA 3VQTA 3DU5A 5D6GA 2DGTA 2MJNA 4GMKA 3DLHA 3ZZOA 5K5MA 4KT0C 1SXLA 4DHVA 2IVFB 2HNZB 1CEZA 2N7YA 3MEGA 4ERDA 1RA7A 3CCTA 1VMBA 4NLVA 2Q66A 3HX9A 4ZVFA 1UVLA 4WFXA 5DDQC 2QA4G 2CZ4A 2DGXA 4IUFA 4I7FB 2JL9A 1FRMA 1D9AA 2GJ2A 3H5XA 1S7HA 3M8RA 2LU2A 5F3TA 4RNFA 3BQ1A 3BO3A 3N9UC 4NLGA 3TYTA 4L72B 1X8DA 4IOCQ 2FVRA 4Z2XA 2AJQA 2CJQA 5KFPA 1RTIB 2DIVA 3HVAA 5JUMA 2R8HA 2YKNB 2OLWA 3FDSA 2K7JA 1ZZFA 4UQGA 2BJEA 2VC1A 2XG8A 4QU6A 5E3AA 4DF8A 1JLBA 2YNGA 1YJUA 4NZ0A 3TA2A 2M52A 4YFUA 3KK2A 1DTQA 3MEEB 6FDRA 4Y28C 4HI2A 1URRA 4H4MB 1HPZB 3HHLD 2UV8G 3CCUS 1QUVA 3TR5A 4TNOA 2PI5A 2JEFA 4H54A 3DMJB 4X4VA 4KHPF 2AGQA 3HZEA 2OSQA 4FXDA 1E6VB 1CVJA 1L3TA 3CJ2A 3QIDA 4ZP6A 1T3OA 4ZHRA 3UR3C 1WACA 3NP5A 5KT2A 2L41A 1FESA 4AYBD 3UE2A 1QJHA 4I1TA 5A6WA 4R5PA 3K5LA 1FHTA 1S4FA 2HWTA 2KYXA 4RNOA 3LF0A 3KHGA 3CXCR 2E1AA 1Y3KA 1NJWA 1S1TA 3EPIA 1XNQF 1WD6A 5DM7Q 2OPPA 5J1PA 1OWXA 1KNZA 3I0RB 1V3RA 2HRYA 2KXHA 1VQ5S 4DQQA 1N36F 5KFJA 4L6V3 1IJEB 1XMQF 1FO1A 4RW7A 1LK7A 4PQUB 2GQ2A 4Y2AA 2XSJB 1YJTA 4LFAF 4NCBA 3THTA 3J7ZT 4RU2A 2WCXA 2VPYB 4DR3F 4O44A 1VRUB 4ES2A 1TKXB 5EWGA 2LYVA 3K0JA 1R27B 3NL0A 3CJ0A 1JXEA 5KFUA 2ZH6A 1VIOA 3C6TA 5F8HA 3MMBB 5C24B 2ZNYA 1DRZA 3UNGC 3SMZA 2JH3A 2DK2A 2XNRA 2HRUA 1RTHA 3GILA 4IYQA 1TKZB 4BDPA 3MPVA 3V81A 2PA3A 2BBEA 4JV1A 3PEJA 2DNNA 2N3LA 3B78A 5I3QA 1S9EB 4NCGB 2WB1D 2UVVA 2VONA 1JB0C 2IBOA 2ZD1B 2V4QA 3V4IA 5AE1A 3IRXB 4RNNA 1M0SA 2C3PA 3GFYA 3ZZTA 5GAHI 1GXLA 1OPIA 2A18A 3TQ1A 1TFWA 2QFJA 3SZ2A 1QVGR 2DH9A 1X9WA 1N34F 1HBOA 2OTLS 1C1BB 3N28A 3IG1A 1YJ9S 5F8NA 2ZJPQ 1Q78A 4X64F 1AXQA 1HNVB 4CO4A 1H2VZ 4PRFA 1ZAVA 2BA9A 2N4DA 2JVOA 4UQTA 4J9MA 4QR1A 2CYYA 2B5JA 2EW9A 2QLXA 4BBYA 2HS0A 1X9MA 2L48A 3M8QA 2DR8A 2CRLA 2GW8A 1S6QA 2NSCA 5LMUF 5HMYA 3M2VA 2VODA 5B0CA 3IFEA 1R0AA 4C4WA 3RAMA 2L08A 1NK0A 2ZHAA 4MYTA 1S0VA 1DTTB 2ZH8A 3I31A 2VFSA 1FNOA 3A1YG 3N4WA 2XY6A 1R43A 3FCHA 5LXYA 1L5UA 5GAEU 1RT6B 4ZCIA 1R6YA 2J5AA 2EFVA 2KU7A 4Q5VA 3GWCA 3JAMY 1NRKA 4J9RA 1NK5A 1S1XA 2LDIA 5CZXA 4A4JA 4RUCA 4EZ9A 2DGSA 4DR4F 4URQU 2ZOMA 4OHYA 4C0BA 2QSFA 1Y5NB 3HHLC 2VG6B 3HVRA 1RTJA 2KXFA 2B4VA 3KLFB 4HTJA 2UUWA 3K58A 3VAMA 1ZZNA 4K4XA 3W2VB 4X62F 3CCVS 3MMJA 4XO0A 3CUNA 2UVWA 4A8WA 3EUNA 2Q79A 4WE1A 4MIWA 1FT8A 2YWGA 1JJHA 4JI2F 5DG8A 4ZA1A 3KLHA 4F2SA 1P27B 2QLWA 3BJYA 3OTOF 4GKKF 4JOUA 3UD4P 4JUZA 3GYXB 4E0DA 4KR0B 1KC8T 5KOXA 4Q8FA 2IHR1 3QWUA 1UKUA 2NSBA 1N6QB 5CQGA 2R9LA 1YRUA 3OPKA 2MZJA 5DLGA 4KKOB 4ZP7A 2F3JA 2O67A 4WFYA 4X65F 3KHLA 1FNMA 1DQ9A 4AXIA 4ZPDA 2B7CB 3DLKA 4K4UA 5GAGI 3F73A 3HVTB 3QPIA 2LXFA 3IS9A 3HHLA 4H4OA 2RT3A 1QE1A 4NRUA 4J9KA 1B7FA 1HBUB 2D74B 2HMIA 2BE2A 1HD1A 4J9SA 3FQLA 1T3NA 4HT7A 3T6JA 2M70A 2UXCF 1T02A 1VQ9S 3KK1B 4OZ5A 3LWMA 3DOKA 2R7QA 4BWJA 1H2UX 4ID5A 4EZ6A 1SUQB 4C8MA 4CQ1A 4B9SA 4YUDA 5KG2A 3LP1B 4O3OA 1TL3A 3R5BA 1BLUA 1FXRA 3DXBA 4B3OB 2XNQA 2QE5A 2YWHA 5EHHA 3CCMS 3N0VA 4F8RA 2J0SD 3Q24A 2RQ4A 2PDAA 1FA0A 2R7UA 1IXKA 2G9OA 2HIQA 4ECYA 5KFCA 1SV5B 2DH8A 2ZH3A 3M2VB 3EGZA 1VS3A