5DDOC

Structural and dynamic basis for low affinity-high selectivity binding of l-glutamine by the gln-riboswitch
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Dynamic Basis for Low-Affinity, High-Selectivity Binding of L-Glutamine by the Glutamine Riboswitch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
molecule keywords L-glutamine riboswitch (58-MER)
total genus 19
structure length 87
sequence length 87
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5ddoC00
3J7YU 2MQNA 4J5OA 2KFYA 3P6YC 2I2YA 1FJCA 3SDEB 2DB1A 3US5A 3NMRA 2KXNB 1M5KC 2KI2A 3IWNC 1KOHA 3MUTP 2DNHA 3NNAA 1R8HA 4WCEQ 1VQKS 1YIJS 3NNCA 2L9WA 3BO4A 2MXYA 4ZKAA 4EGLA 3UCZP 4OZ1A 2E5JA 3H2UB 4FXVA 2M8DB 2DNOA 2MY7A 3HHNB 4Y0FA 2CQPA 3VF0B 1M5OC 3CCVS 3B4MA 2JRSA 2FHOB 1FJEB 3CCLS 1DBDA 2CPXA 5IM0A 3ZZZA 2DNGA 1UW4A 4CIOA 2MKKA 2LA4A 1M90T 1N52B 2RS2A 5GAHU 3MXHP 3TO8A 4C7QA 3P49B 4PR6A 5GMKa 2ZJQQ 2DO4A 5GAGU 4FXWA 3ULHA 3EGNA 3CTRA 4WFBQ 2RQ4A 2VODA 3VAKA 2NLWA 2JVOA 1YI2S 1NU4A 1RKJA 2HZCA 2DNMA 2M7SA 1U1RA 1DRZA 1U6FA 3DLLQ 1PO6A 2U1AA 1XN9A 2MHNA 1KOOA 2M88A 3PIOQ 1BY9A 1FJ7A 2MPUA 1H2VZ 4WFAQ 2F9DA 5GVQA 2DNQA 4LMZA 2VONA 3P5TL 3EX7B 4BS2A 2ERRA 1U1NA 3NS5A 3G4SS 3R1LA 3UE2A 4ED5A 3G9CA 1WF2A 1U1QA 1WF0A 5DM6Q 3VAIA 2DO0A 2G0CA 2MYFA 2M0GB 2XB2D 1UP1A 1X4EA 2ZJPQ 2PEHA 5DDPC 2N3OA 2DGUA 1D8ZA 1HD1A 4CH1A 3U1MA 1SJFA 3OW2R 3FEXB 3V4MA 2CPYA 2DISA 2K8GA 2DNZA 2E44A 2KRRA 2ADBA 3VAGA 2RUGA 2RNEA 3K0JA 1WHXA 1G2EA 3G8TA 1OO0B 2MJUA 2OJ3A 1VC5A 1UAWA 1Q82T 2RRBA 2FC9A 2HVZA 3S01A 5H1SV 3MURP 1HA1A 2RT3A 3TP2A 2DNYA 2MKJA 2OSQA 2X1GA 1NO8A 4WFNQ 1VQNS 3SDEA 2OTLS 3H2VE 2E5GA 1KQSR 2DHGA 2EVZA 2DNPA 2AYMA 3CMAS 3EGZA 1X4BA 1CVJA 1YHQS 2MZJA 4QU7A 3CXCR 3I56S 3DXBA 4CH0S 2CPFA 4PKDB 2MZ1A 1X4FA 4TU9A 3VAJA 5DDOC 1H6KX 1O0PA 1FXLA 1P27B 5MLCV 1VQMS 2CPHA 5IQQA 4Y00A 2K3KA 1X4HA 1OIAA 3CC2S 2KHCA 3VAMA 2CQHA 1X5OA 4UQTA 4CQ1A 2M70A 2MGZA 4IOAQ 1VQLS 2YH0A 2DK2A 2MQOA 2BZ2A 4LIRA 4QPTA 5JVGQ 3IRWP 2CQ1A 2MQMA 1F9FA 3BS9A 1P1TA 2RRAA 2AD9A 2LMIA 1X4AA 3N9UC 3S8SA 3CF5Q 3CMES 2VOPA 2J0SD 1WI6A 2DGWA 2MQQA 3CD6S 1X4CA 5HL7Q 4QU6A 1FNXH 3L3CA 2KN4A 2MSTA 3HI9A 2QFJA 4C0OC 1WEYA 2M8HA 2LKZA 4V19X 3NNHA 2KM8C 2DGTA 2OTJS 4TU7A 2L41A 2CQCA 2DH9A 2D9PA 3CCMS 2M52A 1YJNS 2M4MA 1WF1A 2LXUA 4C4WA 2N7CA 3SMZA 1A9NB 1U2FA 2MKCA 4A8XA 1DZ5A 2DHXA 2Q79A 4RU2A 4YOEA 2DIUA 2VOOA 2MQLA 2YWKA 2YKAA 1K9MT 2DNKA 2E5HA 2ADCA 1N88A 3CCJS 1VQ7S 2G4BA 1N8RT 5LJ3Y 1U1OA 4WF9Q 1VBZA 3S7RA 2DNRA 1WEXA 2X1AA 1S79A 5GAEU 1WHWA 2LA6A 2CQ3A 1W2BR 1OWXA 1VBYA 4UY8T 1WG1A 5LXRA 2FY1A 3BO3A 3S6EA 3J7ZT 1VQ9S 3CC7S 4OZ0A 2AYBA 2SXLA 2MQPA 5JVHQ 3TYTA 1N54B 4YB1P 1WELA 2EK1A 2MZSA 2MZQA 2F3JA 1JJHA 1X4GA 3CPWR 3I55S 1D9AA 3NS6A 2JWNA 1VC0A 3SXLA 2J8AA 1OPIA 1YJ9S 2CJKA 3MI7X 2JVRA 1Q81T 5DM7Q 3G71S 2LEBA 1IQTA 2EK6A 4ERDA 2CPIA 1KD1T 5DDRC 2UP1A 2XNRA 1VQ6S 2KU7A 2LECA 1WHVA 2DGQA 1WI8A 2G1DA 2HYIB 3MD3A 2CPEA 2KH9A 2N3LA 2LYVA 3MDFA 2HGMA 2CQ2A 1X0FA 2ZJRQ 1WHYA 1VQ8S 5D78A 3CCRS 2A3JA 1YWXA 5HO4A 3CCUS 2XS7A 5BJRA 1H2TZ 5CA5A 1R8PA 2KG0A 3LPYA 3CULA 1X5TA 3CCES 1X4DA 3Q2SC 3UCGA 1L3KA 2CQBA 2M9KA 2MJNA 2KT5A 2MKSA 5ITHA 2N82B 5D77A 2CQDA 2KRBA 2LCWA 2MZRA 2YH1A 2AYGA 3CUNA 1FT8A 1FO1A 1QM9A 2MZTA 1JJ4A 1UFWA 5FJ4A 4LJMA 1JJ2R 1U1KA 1SXLA 2DNLA 2QEXS 1SJ4P 2GO9A 5LXYA 2DH7A 1HL6A 4IO9Q 2CQGA 2WBRA 1WTBA 1X5PA 2XNQA 1M1KT 4TLQA 2J76E 1VQ4S 1YTYA 1ZZNA 4F25A 1Q86T 1WG4A 1QVFR 2QA4S 2CQ4A 5GADU 1RK8A 2MKIA 2J0QD 4PRFA 5EN1A 2LEAA 5LSOA 2DNNA 3PIPQ 2CPJA 3MD1A 3UCUP 2X1BA 3VAHA 2FC8A 1H2UX 1QVGR 1VQ5S 2RVJA 5LJ5Y 2XSFA 2HGLA 1URNA 2DGOA 2MKHA 1FHTA 3THPA 3UD3P 1PGZA 1M5VC 4U67Q 1B7FA 4YUDA 3D2WA 3FEYB 2I38A 2E5IA 2MSSA 2JX2A 4QQBA 1ZH5A 2GHPA 3B4DA 1WG5A 1Q7YT 1A7GE 3UWTA 1DHMA 3MOJB 4W90B 1U1LA 3RW7A 2CPDA 2F9JA 3R27A 3U1LA 1ZZFA 4IUFA 2CQIA 3G8SA 2L08A 4P6QA 5LSLA 1U1MA 5IM0B 4F26A 1U6BA 5CYJA 2KVIA 2CPZA 2KXHA 2LXIA 1HD0A 2DITA 3MUVP 4WIIA 2AYEA 4Z2XA 1SJRA 1K8AT 1U1PA 2XS5A 3Q2TC 1KC8T 1JMTA 4TU8A 2YTCA 2DGVA 3G96A 2RQCA 1NJIT 3VAFA 1SJQA 1VQPS 4WKRA 2DHSA 2B0GA 1VBXA 2NZ4A 1WEZA 1AUDA 2V94A 2U2FA 2DIVA 5CXTA 2MMYA 3P3DA 2XS2A 1VC6A 1YITS 3ZZYA 2DH8A 2OIHA 2DHAA 2KM8B 2DGSA 2O3DA 5DDQC 4IOCQ 2D3OR 2MY8A 3RW6A 3LQVA 2FPHX 2KXFA 5IFMA 3CCQS 1VQOS 4W92B 3MUMP 3BO2A 3R1HA 4M5DB 3UD4P 2RS8A 3THTA 2MB0B 2BOPA 3G6ES 3CCSS 2DGXA 3CC4S 2PE8A 2OSRA 5DETA 2KYXA 3JB9k 2X1FA 1S72S 1SJ3P 2HGNA 1K73T 4F02A 1YJWS 1WWHA 2MGZB 2LQ5A 3VALA 2M2BA 1X5SA 2RU3A 2KG1A 1M5PC 3BEGB 2D9OA 2CQ0A
chains in the Genus database with same CATH superfamily
4C8LA 2F5GA 5FDLB 1TKZA 4MKVA 4PWWA 1Z4UA 2GS8A 3C66A 1BLUA 2OFGX 3SDEB 4NCBA 1QJHA 2KXNB 1RAHB 5KFNA 2BQ3A 3MUTP 4ES2A 3DXSX 3NNAA 1G1XA 1FA0A 4NLYA 4WCEQ 1CQMA 2D3UA 2HSEB 1AZSA 1HW8A 1H72C 3NNCA 3DYAB 1FXRA 2F40A 2H9ZA 4EYHB 3T5KA 5KG7A 4FXVA 3OVBA 2DRDA 1NK8A 1SH3A 3BBBA 4Y0FA 4KH0B 1VRTB 1C1CB 4XK8C 3A3OB 3CJTA 2HFSA 3K8WA 3B4MA 2LU1A 2AGOA 4Q0BA 2ZH6A 3FQLA 1FJEB 3BB5A 2HBRB 4A8MP 3I0SB 2D7SA 5IV3A 4A4JA 1T9XA 2DNGA 1G3OA 4ZP8A 3ZZZA 1KHWA 3MPWA 4YHHF 1S99A 2R2SA 1SH0A 3EMTA 3L7PA 5F41A 2HWTA 1HMVB 1KQGB 3TO8A 5A76A 4RUAA 1HBMB 2BJ3A 3ENAA 4DL6A 3RRGA 1VISA 4URSA 5GAGU 1B70B 2YKNB 3EGNA 3CTRA 3T9NA 4CM0A 4R5PB 1HNVA 2FHJD 7FDRA 2QT7A 2WONB 4WFBQ 3TUZC 4DV6F 4AT1B 4N7TA 2B5JA 3QGHA 2HHHJ 4BC7A 4OYPA 2WVEA 4M5GA 1HBUB 2C3PA 3PZPA 3FBCA 1HBOA 2B56A 3C6UB 2JEIA 1ROFA 2RKIA 3IWXA 3MOZA 4H4MB 2M7SA 3QZ8A 1JLGB 2FUG9 3I82A 4RNFA 3O1LA 1E6YB 5T41A 1UJ4A 2QIFA 4CLLA 4DQQA 2FVRA 3DNCA 1NSAA 1KOOA 2M88A 2NUUG 3MAAB 3OTDA 4KB7A 2R4FA 4JI0F 2AJ1A 4ZLLA 4IQXA 1T9YA 4X4OA 2RKIB 4WFAQ 2F9DA 3T1HF 3ONQA 1JKHA 2DNQA 4A46A 4F50A 5HQ8A 1MU2A 5CH7B 2HIYA 1Q7LB 4FVMA 1SIWB 3TRGA 2IBOA 2JFDA 3G4SS 1N32J 3R1LA 3UE2A 2BKNA 2VL1A 4DSEA 4PWDA 1XR7A 2BRLA 1UEKA 1PKUA 4JI4F 2OO4A 5KT6A 2VFSA 4IDKA 4X64F 3TAMB 1GAOA 2E1PA 4I2PA 4CLTA 1JLBB 2DO0A 2EFOA 5J1EB 2ZBCA 2XLIA 5LMNJ 1T0TV 4M5IA 4K2JA 2CDQA 2BRKA 2WBMA 2ALYB 3CD7A 2ZJPQ 3TARA 4X4VA 1X9MA 2MHEA 3UFCX 1CJVA 1VRQC 4DX7A 1KS2A 5D4LA 2OI2A 3AD8C 3CW2C 4CH1A 1JLBA 5IWAF 1MLAA 4ECQA 4A8SA 4KGZB 4ID8A 2BR0A 2V4QA 1IKXB 1RWUA 3ZZOA 3OW2R 4N76A 4K59A 4HEA9 2DISA 2WVDA 1XMQJ 2E44A 2KRRA 2XGPA 1UVLA 3VAGA 1B0PA 4MMOA 1L3SA 5KG0A 2AZ3A 1S1WB 2P5VA 1WHXA 2VG5A 2YWEA 5IS2A 1FRHA 4RUBA 3G8TA 2W8LA 3K0JA 1OO0B 2CG4A 2RDJA 3QRPA 1FFSB 2GZOA 3FRZA 3B78A 2IDLA 2E66A 3KK3B 1LXJA 1SKUB 1UAWA 2VF3A 2ZBIA 2P6TA 4PG7A 2ZHOA 3HLUA 4LQ3A 2FC9A 4J9NA 1CJUB 3QT6A 4NEZA 4A48A 1D8YA 3EXCX 3KWMA 4MIBA 2DY1A 1WC3A 2RT3A 4MFBA 2DNYA 4DFKA 2ZOGA 5ADZA 2HQIA 4F2RA 4ILMA 1JLFA 3Q8QB 1NKBA 1FD2A 4DCPB 1GQEA 1PYTA 4ZIWA 2EWHA 3EPIA 1D3WA 2V2KA 1HR0F 3SDEA 4K4SA 4NLXA 2WCXA 4Y2KA 5KG2A 2DHGA 2XMAA 3H40A 1S97A 2DNPA 2AYMA 3BF4A 3CMAS 3FFIB 1RZMA 1QAJA 3MM6A 2YX1A 2A6OA 4WK3A 1CVJA 1SIZA 5C24A 2QV6A 2YWWA 1YHQS 1FDAA 4NRTA 3WC2A 4Z7YA 4DF4A 5E3RA 1T8EA 2POKA 1F2HA 2RMLA 3GTYX 4I56A 5E0OA 4DX5A 3JAMY 3LP2A 1HBMA 3DXBA 1J5EF 4CH0S 4ZA1A 2MZ1A 1LWXA 2CIMA 1S1VB 2YNFA 3SSQA 5DDOC 1ZA2B 2QFIA 1H6KX 2G0JA 3KHHA 4CO5A 1FXLA 1W25A 1FF2A 4J9QA 1KVKA 2CPHA 4DR2J 4Y00A 4QPXA 4UQGA 4RW8A 5KG1A 2VQEF 4F3QA 3OL9A 2YNFB 4O3RA 2CQHA 3ZO7A 4I6YA 3N28A 2YNHB 3DRYA 4IOAQ 4M63A 4TYAA 3C19A 5T7LA 2LVWA 3T1YJ 1U49A 1I51B 3M2VA 4MTPA 5KOWA 1UFKA 2NXEA 2BJ9A 1NPKA 1M1GA 2V8PA 4ZVPB 3BKFA 2HFVA 5HANA 4DU8A 4NZ7A 1F9FA 1X4AA 3QT7A 2VFRA 4RW9B 4N47A 4K4WA 4KGVB 5ETKA 1S9GB 3CMES 1UETA 2J0SD 2VOPA 4ECVA 5KFQA 4ZPBA 4IRCA 4YR0A 4K50A 1GX5A 4WZQA 3N0VA 2WB1D 4HVZA 3ZZPA 2J0QD 3QFWA 5A8RA 1WJ9A 2HK2A 1NSPA 2M8HA 4WU2A 1U6ZA 4KSEB 1UWBB 2J9CA 2OEJA 3NNHA 2OTJS 1CC8A 5B0GA 3FUYA 5H9FJ 2UU9F 3G6XA 1SUQB 1TKZB 2QLJB 3CNQP 3MM5B 5M2PA 2D9PA 5HQLA 3KXDA 1CJKA 3PM9A 2FGOA 2M52A 4I0WA 4IR9A 4KHPJ 1YJNS 3MR7A 3AQPA 1X8DA 1RYRA 3GV7B 1HWIA 2N7CA 3IG1A 1KVIA 2CRLA 4GVBB 1RKIA 1RWMB 1UVMA 4USJC 1JLEA 2PA8D 4ZVQB 2OGUA 2DHXA 2YXLA 2A2CA 3R5GA 4URQU 2W2NP 4CYUB 5KFEA 3LGHA 1Z1ZA 4X4PA 3MR5A 3EYZA 4WPAA 4LF6F 2J7WA 2CWKA 4KRWA 1JXLA 2V2VA 4LF5J 3JQJA 4RW6A 1KLMA 1SPBP 5LJ3Y 3GIIA 2H5EA 4IFYB 4NA1A 4DR5F 2HEKA 2XGQA 3E2EA 4WYLA 5F8MA 3ZTPA 5E33A 1ZTWA 3D7SB 4L3KA 4WWSA 1VDHA 2GJ2A 2LA6A 3WIUA 2W2OP 4E8UA 2UXBJ 1NBEB 3HVAA 2QRRA 4UY8T 3UCGA 2IVMA 5KT3A 4C0BA 3H59A 4DX6A 5LXRA 4FKYA 5J2PA 3ZC4A 1LWEB 1NXIA 2AYBA 3AJ1A 1RHRB 4I69A 2SXLA 3DRSA 5F8LA 4KT0C 3JYTB 4I68A 3M6VA 3W2VB 4OYIA 3RBEA 2YKPA 4DSIA 1WELA 1MN9A 2HNDA 2MZSA 4O3OA 4ECZA 4KFBB 3C16B 3KLHA 2AJFE 2GMHA 2F3JA 4PYAA 4MYUA 4TVAB 3CJ2A 4F04B 2ZH1A 2FVCA 1UKUA 2QO3A 1LQ9A 1SL2A 3CPWR 5RUBA 1RAOA 3G2XA 3HCXA 3LH2S 4IH6A 4ZN1A 2D74B 2GGPA 1FRJA 1U4BA 1S7HA 1TFWA 5KFWA 2DTJA 3OBIA 4P52A 1XK8A 3CE8A 3L4BC 4B9UA 1HNWF 4DR5J 3SCLE 4P7TA 2P9EA 2X3GA 3V6JA 2VA3A 3NGUA 3POTB 2NXNA 4RKUC 1RHQB 4J9UE 4YB5A 4LF2A 2BV3A 1RHJB 2UUWA 2PDAA 5DRKA 3KHLA 1PILA 3EM1A 1QAYA 3V6HA 2JVRA 1MMNA 2JHEA 1SKRA 3QMQA 2HK3A 1C0UA 5GMDA 4KGXB 5DM7Q 4ZVSB 5C24B 4JV5F 4CLFA 4TY8A 5D6GA 3G71S 4FF3A 2EK6A 3Q83A 4ICLA 1QY7A 5B0EA 2GIQA 1KD1T 1H7WA 1UTAA 2OD6A 3R5AA 1IM4A 1BD6A 1YLXA 3ITHA 3D0GE 2CJAA 3JS9A 3OQ2A 4NA2A 3BQ2A 3C6TA 2ZH5A 5HN0A 5EX3A 2ZM6J 2HFOA 3I5AA 3KHGA 2KZMA 4XTTA 2KH9A 3KDOA 1S1WA 2N3LA 1T9VA 4RR5A 4N56A 1RT3A 2FZGB 1SBRA 5AXNA 1WC5A 1FWKA 2GFFA 2AX0A 1X60A 3IRXB 4HI2A 3KMSA 2HG4A 4J9SA 3KK3A 3CCRS 2WRMA 4PCQA 2LU2A 3QZ7A 1N32F 1H2TZ 1LWEA 5U47A 1GX6A 2ZKUA 3AJ2A 2VG7A 4DMZA 2HMIA 2DJWA 1WC6A 2E1MC 3AH6A 3AXKA 1YQHA 3V6KA 1EKRA 1OYEA 4KTQA 4DSFA 3Q8YA 5DQHA 3M2VB 2HIQA 4ZHRB 2HWHA 3CCES 1X4DA 1HBNA 1XWLA 4KIAA 1NDLA 5KFBA 3GIJA 3MMJA 4ED4A 2IC3A 3IR5B 4KGKA 4ED7A 4ZDNA 5F8JA 2V4JB 3DGVA 3TWZA 5ITHA 2MQ8A 1XMOJ 2N82B 2ILZA 1FESA 2B4PA 3O8WA 1HR0J 4QIFA 2CQDA 2EXUA 3HM9A 1RACB 1TVRB 1JLEB 3DLGA 2UZAA 4KV8B 1K0VA 3J7AN 2FIUA 5E3QA 2R8HA 1FO1A 2J5AA 1ACMB 1VIXA 2XMTA 1QM9A 4DFMA 1JJ4A 1IBKJ 5C5JA 5SZTA 2NSCA 5J2MB 4KBIA 3SCIE 2E5LJ 1J5EJ 3R8YA 4K4VA 1TVRA 1V5VA 1S7IA 2GO9A 4R0EA 4QWCA 1HL6A 3UDEA 4IG0B 3HSJA 4LFCF 4DR4F 1F5BA 2CQGA 1FWPA 3JSMA 1RTHA 1J5OA 1G4CA 1MU2B 1XERA 2KKHA 4DL5A 3OSPA 5D0GA 1C1BA 1M1KT 4TLQA 1EQMA 3M1VA 1RDRA 3TUJC 2QA4G 4AD6A 5ETMA 4UF4A 2YKMA 1FX2A 4OZ3A 3TQEA 2WAQD 5B0AA 4ELUA 4BWJA 1WNEA 3OL7A 3V4IB 3Q22A 1WACA 1S4FA 1ZA1B 2RRNA 2XC9A 2IAJB 1TKTA 4H4OB 3GCXP 5L1JA 4USUA 1T11A 3R7BB 3RB6A 3VGUA 4AUKA 8ATCB 1HNIB 3TW0A 2P2CB 2NSBA 2HQCA 2DNNA 4RO0A 5HATA 5EN1A 4IKAA 3W5YA 1OY6A 2QSWA 4USKA 2BANA 3TVZA 2CPJA 2OD4A 2PGCA 3LWLA 3RAQA 3NBPB 4ZCMA 2F65A 3CO9A 1WKLA 2XLKA 3QRQA 2FC8A 1VQ5S 1G6BA 1S9EA 5ETLA 5I4MA 3IS9B 1VHIA 2HGLA 4UOHA 3KLGA 2FLLA 3WX4A 4K4TA 4B3SF 1MROA 1IXKA 2V2QA 3PTWA 3QLHA 4WU3A 3PW4A 4U67Q 1G7CB 1Q95G 1NDKA 1CG2A 2C3UA 3GYNA 3MECB 2C1EB 4GVLA 2I38A 5LMUJ 4DL3A 2NXCA 3QO9B 2XCPA 1WD6A 2GMLA 4B3TJ 4DR6J 4PQUA 5KFPA 4X66F 4ED5A 4QQBA 1QAIA 1WG5A 4B9VA 1Y9OA 4J91A 2HVHA 4JYAJ 3HHLA 3N6LA 1TFYA 2W24A 2I6WA 1X7VA 3U1LA 2F9JA 3R27A 4F0MA 5KFZA 3BN4A 4XPEA 1D9FA 2L08A 4OYXA 3AXMA 5A8RB 4K4XA 1RBAA 5AXMA 4PZVA 2CVIA 3DHWC 5HVGA 1U6BA 4B3OB 1PBAA 5CYJA 4F0KA 1T03B 2LXIA 1HD0A 3GU0A 1OYDA 4YDDB 5DS7A 1F1BB 1S9FA 2APOA 4MIWA 4U96A 3J81j 3GR1A 3GYXB 4URGA 1U1PA 2VFVA 2H1YA 5KFDA 2XHCA 1FJGJ 4TU8A 3EJMA 4P71A 2IBKA 5HSPA 2J9DA 4JI3F 4I6AA 1ZETA 1NJIT 1CULA 2ZDOA 1LW0A 1YZ6A 1ZAWA 2I5JB 2Y0SD 4WKRA 3UD5A 3HHKA 2DHSA 2B0GA 3QRRA 1M1HA 4A8YA 2HQGA 1VQSA 1ZAXA 1IBKF 3MEEA 1JQGA 3VWSA 2C3MA 5E41A 3NKYA 4DR1F 3DM2B 3L7UA 4F67A 2C2MB 1CBKA 3MM7A 1O8BA 5T14A 3S1TA 4U7UD 3MM8A 3UW1A 1B0VA 2KJVA 5K8MA 2C28A 3ETOA 2P9GA 3OXFA 3RTVA 3JSYA 5IOLA 5L1KA 2GAGC 4ZP7A 3BGUA 3KLFB 3W62A 2NYIA 2M3DA 3BDEA 4OYBA 3EE3A 1HQEB 2O3DA 5KTQA 3JTPA 5DDQC 2F63A 4IOCQ 1CPZA 3HD2A 2V6AA 3CCQS 2F8MA 2R7OA 2BJDA 2HHPA 3DU6A 3KLIB 1NB7A 1IBLJ 2EPIA 1FJGF 3F56A 3PJXA 1CS4B 4M5DB 3F73A 4JI1J 3MTKA 1FE4A 3THTA 3DRSB 3OV7A 3TR5A 1TL5A 2WVCA 1EJ7L 4UT4A 2Q6BA 3MTJA 2V67A 5HVHA 3BQ1A 4FXDA 2E1CA 1JNZB 5B08A 4Y6IA 1ZPWX 3UDVA 1WSRA 4G1QB 1HLWA 2KYXA 5DETA 1XC9A 4HH0A 4FYYB 2HGNA 4OQJA 4DR3F 3IM8A 2UUCF 1QDUB 4C8YA 3LUYA 1F3FA 2JJ4D 2Z2ZA 3PW2A 2AMCB 4I67A 3NCRA 1RAJA 2KTQA 5J2QB 2LQ5A 1M5HA 1X5SA 2M2BA 4EMDA 4KY3A 1KNZA 2RD5C 2BM0A 1KQKA 4N8NA 5LL6d 3J80Y 1TUWA 4HDHA 1M5PC 2CQ0A 2HHVA 1TQLA 3M8QB 3MPDA 3J7YU 1EP4A 2GW8A 1BGXT 3HSDA 1HQUB 4QBUA 2PN6A 4J5OA 5ETRA 2KFYA 3OR1A 1Z2LA 3M9OB 1I6JA 1OMSA 3P6YC 1FTCA 4OIXA 1DAXA 3US5A 5KFOA 3DYAA 2UP1A 2VPYB 3NMRA 3W9IA 1YG0A 3MM9A 1GXLA 1RA6A 4DF8A 3IWNC 2AW0A 3K17A 1HNWJ 3RU0A 2DNHA 4JI6J 2HHXA 3A1YG 1U24A 3HJVA 4D3GA 2LXFA 4FS1A 2W2MP 3J81U 2VHGA 3UDCA 2L9WA 3ZNJ1 3DOKA 1IN0A 3DRXA 2H5IB 3BJYA 3W63A 1EIYB 2DNOA 1UWBA 1EAYC 1Y0HA 3IR7B 3HHNB 4MH8A 4FDFA 4P2MA 3MR6A 1LWFA 1P9YA 5IC6B 3GWCA 2IYGA 2Q43A 4IR1A 1UEUA 3VF0B 4NLOA 1JJCB 4Y28C 2HW3A 1M5OC 3CCVS 4DQPA 1UVKA 3ISZA 3QSYB 2HFUA 2FHOB 2VBWA 3CCLS 1DBDA 2AT1B 4NLTA 5IM0A 3ILJA 1W26A 1NJYA 1FKOA 1M90T 4LF8F 2LA4A 4LFBF 2FJEB 1N52B 1NK9A 1S48A 3PR4A 2ZVIA 4QW8A 3D0IE 4NYPA 4C7QA 2N4DA 2O66A 1FRLA 1HHSA 3AHPA 3MPVA 1RTZA 2JL9A 1R8BA 2W01A 4P2SA 2DO4A 4U8YA 3ULHA 2ZBRA 4L72B 5DGBA 4KFBA 1CULB 1RB0A 4OX6A 2COLA 5G0RA 1EQ0A 2RQ4A 2VODA 2OPRB 4ZPAA 3PRBA 3KK1B 4OFZA 3R5CA 4DV0F 1TKXB 2NLWA 2YNIA 3FBBA 3TUIC 4DV1J 2B9WA 4IFYA 1CC7A 1YI2S 1NU4A 5KFIA 1PYSB 2R7WA 2G2YA 4NXNF 1U1RA 1U6FA 1S6UA 5HMXA 4KO0B 4U7CA 4WXWA 4DV2F 1XN9A 3AY0A 2KZZA 2XYPB 1I5OB 2YWGA 3RBZA 4RLEA 2HLUA 1NSQA 2Z58B 5I3QA 1WORA 2QMXA 4F8RA 1BY9A 3LALA 4NYOA 2VICA 3UVJB 4B02A 4DV5J 4NL5A 2MPUA 4FP9A 2VU5A 1RAFB 3BGFA 1RWNB 2VB6A 4FPRA 4CT8A 2GQCA 5DQIA 4LMZA 4P7VA 2Q1LA 1O6XA 1QUPA 3DLGB 3P5TL 2KJWA 2WVBA 3EZOA 1S10A 5J1PA 4M5DA 3N79A 1SV5A 1Y5IB 4FNIA 4E2FB 2ERRA 3OVAA 1U1NA 4NCAA 4I64A 4RX6A 1VS3A 3RZAA 3OUYA 1JIHA 1ZM4A 1XMBA 2ZD1B 3G9CA 2V2ZA 3M2RA 3HFKA 4O3PA 4E0DA 2CVEA 1KP6A 3VAIA 1JK9B 4ZPCA 1AT1B 2MYFA 3T6JA 2JDJA 2M0GB 1FTRA 3SQGB 3HZGA 1QUVA 2FTRA 2V4JA 3PYGA 4WXOA 3BR9A 3PKMA 5DDPC 5A2QY 5F3TA 1TV6B 3ADAC 4OI2A 5C25B 3TANA 1HNZJ 2CG8A 2E7VA 2LQ9A 4ZPTR 4F0HA 2KYZA 4F2SA 4IDKB 3QYYA 3T5HA 1BQNA 3D28A 4YFUA 4DV7F 4FKXA 2PO4A 4ZIVA 3K89A 1YRUA 3BGOP 3DDIA 4ZHRA 4K0KJ 1SJFA 3TQ1A 2DRBA 2OHDA 3OLAA 3FEXB 1TKTB 2CDRB 2DPIA 1N5SA 4DL7A 1Z2ZA 1BWVA 3TUPA 2W2PP 1U7LA 3UNGC 1HNXJ 4PPDA 3NOGA 4B9MA 2NCKL 4LVOP 4LRAA 4CTAA 1AZSB 4UUWA 3I5BA 3ENVA 3NGDA 3ZTQA 2AJQA 2HVZA 4HYKA 2CZ4A 3K58A 2JOQA 3MURP 4J9LA 2XMWA 2ZKTA 5A0YB 1AXQA 1A6LA 2MKJA 4K2XA 5M2RA 5AJ3J 4LFBJ 2QL9B 1NO8A 4ZN3A 1FFWB 4DQSA 4KR0B 1U47A 2EW9A 2CKWA 3ELHA 1S1TB 4MKAA 2YQ0A 3DGPB 1RTDB 1GMVA 2ATCB 4AFFA 3I6PA 4ZVOB 4PQUB 4F3OA 2IJFA 2V69A 2FJXA 2JEGA 2G0IA 3EGZA 1S57A 4RBTA 1VRUA 3R7SB 3GJSB 1UCNA 4JI8F 1R3NA 3K5LA 4B3MF 2ZITA 1Y5NB 4DZDA 5HMZA 2PMZD 4QU7A 1LW2A 3CXCR 3SI8A 1QSSA 4OI1A 4X4NA 4EBDA 2WSEC 5F8HA 4F4YA 3WQPA 3I9V9 1YK9A 5DZ7A 4BCAA 4R8UA 4EBEA 4TU9A 3FMWA 2ZBQA 3VAJA 4ED6A 4K5RA 1O0PA 4DN9A 3EZ5A 2QG9B 4F4KA 3N6NA 2WHOA 4DLEA 1VQMS 2F4VF 4ZP6A 3DOLA 4AL5A 1W2IA 1CQNA 1VRTA 4KYZA 3M8SA 2L3MA 3ZXWA 4C8ZA 3A4TA 1VJWA 3HX9A 2HKEA 5A2QU 3CC2S 1A0OB 2YKOA 1N34F 1MN7A 4Q2LA 5DG8A 1RU2A 3M8RA 4UQTA 1REGX 4CQ1A 2MGZA 3NL0A 4NLRA 4OV6A 4H4KA 5KG4A 1OQ6A 1N6QB 1UVJA 4MKBA 3OLBA 2JFKA 2YH0A 1L3UA 4XDDA 2DK2A 3RAMA 2IRXA 4M1KA 4RBVA 3RR8A 1QLNA 1YRTA 1JKHB 2BZ2A 3U1NA 2HURA 2LQ8A 3BV8A 4Z37A 5JXSA 3WX8A 2MKYA 2IRYA 2C2RA 2IM0A 3CCTA 2DR8A 2CQ1A 3BS9A 3NWGA 1XQIA 3PXGa 2LMIA 4CLPA 1T9TA 3IBWA 2H51B 3H90A 3CF5Q 1YJRA 3PO4A 3A3PB 1WI6A 2R3VA 2VPWB 1B99A 2GJIA 3CJ4A 3PJ9A 4QZVB 2MQQA 2NR0A 1EX8A 1LXNA 4WE1A 5KFYA 4B3RJ 2KN4A 3BZQA 4MT1A 5CCLA 4WTOB 3UR0A 1VFJA 3FNNA 4J9OA 3EDQB 3H5YA 4GKJF 4DLGA 1FNMA 4NPOA 3VHQA 3DI6A 3O3LA 1YJ7A 3TVYA 2D41A 1SB6A 3M8PB 3VZIA 5FIIA 3G6VA 4V19X 2KM8C 1CEZA 1CJVB 1KTVA 2R8KA 3HHDA 4YY3J 2L41A 4FZVA 3GJQB 2DH9A 3I4HX 1FWLA 2XMMA 4HACA 2EFVA 4AXIA 4CLSA 1NNDA 1HFEL 2C42A 1DLOA 4DUYJ 4DUZJ 9RUBA 4NYZA 1E6VB 3C46A 3CCMS 4HDGA 4OLOA 5CABA 1RWPB 2HS4A 4B3TF 4LF7F 3A8KA 3AQOA 1IKYA 4RWWA 1FRIA 5KG5A 5KFSA 1T95A 2YVSA 2HS0A 2V8HA 4FNHA 5L38A 5L39A 1FXDA 1NK0A 2Y8YA 1U2FA 2MKCA 1JLQB 3R5JB 5KFVA 1M0SA 3BBFA 3KG0A 4M5MA 4RU2A 1DZ5A 4CTAB 4FF2A 2VOOA 2YWKA 3HO1A 4YOEA 2YKAA 3G87A 3PYFA 3QJLA 4QR2A 3UN5A 5KFRA 4RBUA 1N88A 1V6HA 2R42A 1S1XA 1N8RT 2FVSA 1XNQJ 1VBZA 2BKPA 4G1QA 1TAQA 5I3UB 2X1AA 1RQ0A 3T1HJ 3V81B 1PJ7A 4PEOA 1RT5B 2NXJA 2CQ3A 1W2BR 1E6YA 1NK7A 3CMQA 1L3VA 2GX8A 1WG1A 4YHHJ 1YBTA 1JLAB 1RWWB 3M2UB 3N4WA 1HHQA 1UA1A 1CS4A 3NGKA 3HZEA 2XWXA 3M1VB 3S6EA 1JX4A 4LF6J 2PD1A 4C3KA 3T1YF 2MQPA 4QR0A 1B7YB 2BE9B 1FDBA 3IG1B 1XBWA 5DO2A 3KK2B 2KVQE 2EK1A 5JVHQ 2FVQA 1LEOA 4R5PA 4YMEA 1JJHA 1X4GA 1FNOA 3L9ZA 4RNHA 4ETXA 4ANCA 2N4CA 4A8KA 3MPYA 1PCAA 3H7HB 3JTNA 1EKSA 1PJ5A 4MK9A 4YN3B 4D3HA 1JLCA 1ZBTA 2BUNA 2FZCB 2HNDB 1OQ3A 1D9AA 2BVZA 4G65A 3Q8RB 2V4RA 2HBQB 3NS6A 3WHIA 3WIVA 4ECUA 1NRKA 3AOCA 1TL1A 2B3TB 2B4OA 5KFGA 2GQQA 4ANDA 1OPIA 2CJXB 2QA1A 4YS2A 1BQMB 3PEJA 4ZLPA 1YJ9S 3SBMA 3TNVA 2CJKA 1NK5A 3LAMA 3DMJA 2RHQB 3M05A 4N77A 3GIMA 4AQYJ 1MNEA 1TELA 4NLPA 4OX7A 1ITPA 2LEBA 1IQTA 1LOUA 1IR2A 1LK7A 2B8QA 2CPIA 3GSDA 3KFWX 4I1TA 4TXSA 2OPQA 2QJ3A 5ETSA 5DDRC 2KFZA 1KWMA 2GVZB 3FSIA 2VBZA 3VR1A 4M5KA 4I2QA 2I5JA 5E3AA 2XG8A 2LECA 4DR7J 2W7AA 2XZTB 3W2WB 4GKJJ 4NZ6A 1R31A 3MD3A 1W7WA 3CD5A 4CI0B 4CRJA 4LF9F 4CWBA 5LMNF 2CXEA 2ROPA 1KFDA 3LA0A 5IC4B 2CQ2A 4EZ9A 3FQKA 3ITHB 1EP4B 4CP5A 8RUCA 4GKKF 2ZJRQ 1WHYA 1VQ8S 2VG6B 2W9BA 1AA1B 4K4UA 1YBUA 2UUAF 4XIUA 4B3OA 2C2DA 4FYDA 2JNJA 5CYQA 3KOAA 1CJUA 2XS7A 1BQMA 5BJRA 2R7TA 1S0VA 1F5AA 1UJ6A 1O51A 4AE5A 3K8VA 2DPJA 3GCWP 4XPCA 2DEJA 2KG0A 1I3OB 3ETMA 4X62F 2XY6A 3K5OA 3M2RB 4OHYA 1FCAA 1SL1A 2VZ9A 3GFYA 4LUBA 3HVRA 3BM7A 4OLPA 2K3IA 1RTJA 1V3SA 2M9KA 1Y10A 3HULA 1CJKB 2LQBA 2KT5A 3R3TA 3KDNA 4HH1A 3E01B 2MKSA 4NEYA 2FQQB 1B0TA 3C6TB 5I42A 1DQAA 2BMBA 3T19A 5A8KB 4KHRA 4ED2A 5IZHA 2OMOA 1GXTA 4LRBA 2PA3A 3THVA 1TMMA 1GTEA 2FZKB 3MR3A 2V9KA 2YH1A 4MK8A 4ZITA 2KHDA 1NHUA 2AYGA 2D3ZA 2DHHA 2YNGB 3DU5A 3W65A 1FK9A 5JUMA 1F2GA 1HWUA 1GTHA 1Y11A 3BR8A 4QOTA 1Y3KA 3IN5A 4OYMA 4Y2IA 3VTIA 2IPOB 1UFWA 3DRRB 3PYDA 2OUGA 4ZPDA 5D3GB 5CYQB 2AQ4A 3RR7A 2BYCA 2HNYB 3V6DB 4LJMA 1JJ2R 1Y4ZB 1U1KA 2DNLA 3LPEA 4PXDA 2C2KB 2RILA 3A8EA 5KG6A 4U6PA 1SJ4P 2JEJA 4F7VA 1K0TA 4PG4A 4DEZA 1TUGB 1UJ5A 2XMJA 4X84A 3V2UC 1U2CA 5K8OA 2AIRB 1HQUA 3PACA 4ITSA 1ZM2A 2ZFHA 2GQ2A 3QNWB 1DTTB 8AT1B 3J7Z5 2YNHA 2VBYA 2J76E 3LANA 4CZCA 4OHVA 1R8AA 3OL8A 5KFCA 1DQ9A 2H65B 1SH2A 3MMCA 3DKDA 3CDAA 1FRXA 1GT8A 1WG4A 2WOMA 4O44A 2UVUA 1QVFR 4B9NA 2JC0A 4UZBA 3G6YA 1S0OA 4P72A 2QA4S 3C2PA 3P5BP 2CQ4A 2BBEA 5F3ZA 1RGVA 4CLYA 5LSOA 4LBPA 3RJMB 4NI2A 2LLZA 4QWDA 3GFXA 4Y3CA 3KTQA 2QE5A 3UCUP 2UU9J 1NJZA 2B9XA 2FB0A 2FLOA 4UTGA 2DR7A 1VLYA 1U8WA 2XYGB 3GONA 2ZWPA 4RW4B 4JI6F 3RYLA 2RVJA 5LJ5Y 1JB0C 3LF0A 4DS4A 2NREA 4AL7A 1BMQB 1URNA 3AB4B 4GC7A 5JMNA 2MKHA 5DQGA 4ZLNA 2DKOB 4HHJA 4IOBA 2VC0A 1M5VC 4X64J 4Y34A 4YUDA 3FDSA 3HSZA 4ZJOA 3D2WA 3OHAA 1WC0A 4UW2A 5AXKA 2YX7A 2E7WA 4C9DA 1FD8A 3MWBA 1YJVA 2JX2A 2JSXA 3BYPA 2V34A 1ZM9A 2W25A 2ZE2A 4QWEA 3UWTA 1HNIA 3MOJB 3DLEB 3N01A 7FD1A 3MFIA 3RW7A 5KFTA 3C15B 4C3MA 3Q23A 1ZZFA 2AJ2A 3N5FA 5HLFA 4K7QA 1KSPA 4C8OA 3R7NB 3D5MA 5CYMB 5BYRA 1IUJA 5J2NB 1NM2A 1MWQA 4L6V3 5E7OB 2KVIA 2CPZA 4USIA 2G2ZA 2OPPA 2IVFB 3UR3C 1TL7A 3MUVP 4K4ZA 1GMWA 2IFXA 2UVWA 2QN6B 2RU9A 2J0XA 4NLUA 2XS5A 1VMBA 1KC8T 3UN2A 1RT6B 1SC4B 5GAGI 4NX9A 3V4IA 4JI4J 4ZCLA 3Q8VA 1TUVA 4IG3B 1HNVB 1KHVA 3ISNC 3KJVA 3VAFA 1VQPS 4JI0J 2KDOA 2FLNA 1IKYB 4JI5F 2FGCA 1VBXA 4BBYA 3PO5A 2CJQA 3HFZB 4KJIA 4P2FA 1KQFB 6FDRA 1HBUA 1SC1B 1WEZA 5KFAA 4X4UA 1RT2A 2DBBA 3CDWA 2ASJA 5IT4A 4DSLA 2MMYA 4JV1A 3TEHB 4JYAF 3SCJE 3FRYA 3FK4A 2VKRA 1GK8A 4KPCA 3ZZRA 2HAIA 4USTA 3I0RB 3JAMU 3FGVA 2OIHA 2DHAA 2QLBB 2DGSA 2G9OA 2YQ1A 2V68A 4H4KC 4ZPWR 3UVJA 4JV5J 3CVKA 2RUSA 4ED3A 2D3OR 4CO1A 4X65F 2IY5B 1T9UA 2K1RA 2MY8A 4DZ6A 1KDNA 3LQVA 2XI3A 2E1RA 1HBNB 2FPHX 1HW9A 3GFHA 3TA2A 1XNRJ 2HBYB 1IWAA 2XMUA 1N36J 3D67A 3R1HA 3SFUA 2OKQA 1F9EB 3WBZA 5EWEA 2HNZB 2P6SA 2AJ0A 2BE2B 3T1AA 3G6ES 3LP1B 3FZBA 3CCSS 4JV0A 3CC4S 2RAQA 2YKMB 4J90A 5B0DA 1S1XB 1BWEA 4CLZA 1OPZA 3DOMB 4EFAC 1HIYA 2WOMB 1GNKA 2CAJA 3K7RA 1H0HB 1SKWA 4QWBA 1UWAA 4ALZA 2W7PA 2R7SA 4MAKA 5C7PA 4ZCKA 1R89A 2RE1A 1WWHA 3A8IA 2MGZB 2DR5A 3I5CA 3VALA 4JV2A 2RU3A 4EU0A 2XLJA 3MMAA 4Y2CA 3PHEA 2LFVA 1HBOB 3C6UA 5SUHA 2D9OA 2V8DA 4C48A 5CD4H 4N41A 2GC8A 3AJDA 4JI5J 2RHSB 2ZOFA 2XI2A 3CJRA 3EPGA 3I87A 3TX0A 4NLWA 4CO2A 2I2YA 2DB1A 4OZ2A 1XNRF 2R8JA 3AOBA 4B9LA 1QE1A 1KOHA 4JUZA 5EGYA 3VGVA 1R8HA 3TJ9A 1EETA 2B7CB 3BPDA 2AHOB 3Q86A 1VQKS 2GCFA 2VFUA 2ZM6F 5HROA 2EEYA 4RW7A 5B09A 3BO4A 4IH5A 1SV5B 2MXYA 2EI5A 4EGLA 1F6TA 4OZ1A 2X7IA 5I42B 2E5JA 1V9OA 2KT3A 3GG1A 3IMQJ 3PY8A 1WC4A 3W60A 1PG5B 1S1UB 3NWRA 2MLYA 3M32A 4X4RA 5HP1B 2CQPA 4RNOA 3QJPA 1QTMA 3E3XA 4KHPF 5F8GA 2JRSA 4S0MA 1BC6A 1DTQA 4OZNA 4DR7F 1KN6A 5LOQA 2CPXA 2IDEA 5FLXY 3P8BB 2NPFA 5D0RA 4DR3J 1UW4A 2Q66A 2WSFC 5H9FK 3K5PA 3NS7B 5KG3A 5GAHU 4OJ1A 1Q8BA 5DG7A 4IRKA 2NZCA 5GMKa 2DR6A 3GPAA 3RB4A 3GFZA 3OFFA 4RNMA 2XO6A 1RAEB 1OSDA 4FXWA 4H4MA 3QAUA 2UUAJ 3H5XA 4U95A 3PHTA 4C11B 2R2RA 3AT1B 4ECWA 3IGVA 3QT8A 3SIPB 2QL5B 3DMJB 3ICLA 4ER8A 4LF5F 1HWJA 3MMCB 1YJUA 2CZVC 2IIHA 1K44A 2Z56B 4CO0A 5AE1A 1UA0A 3TAPA 3JQMA 4MKYA 2HVIA 1ZAVA 2I1RA 2H4WB 3CJKB 1RKJA 2DNMA 2QLWA 1HWLA 1DRZA 3DLLQ 3IAS9 1PO6A 3MCOA 2QLFB 1KR4A 2IMWP 3POTA 2J6SA 4YEAA 4F36A 1Q53A 3MEDB 4QR1A 2MHNA 3CCWA 3H25A 3H4BA 1CLFA 5A8KA 3D3CJ 1FERA 1H2VZ 1JXVA 2DCLA 5GVQA 1N5YB 1XEZA 4NXMF 4P73A 2VONA 2Y9HA 4FN5A 1JXEA 4EYIB 3DCAA 3DGPA 1BE4A 5D0HA 1LW0B 3MEDA 3RRKA 4IFVA 3EX7B 4DFPA 1B3TA 1RLDA 4J9PA 2QYGA 2XHWA 3DOKB 4W4MA 4WK1A 1U0HA 4FBTA 1YGYA 2ZUGA 4OJGA 4L3NA 3RGIA 4L73A 3H5UA 3W5ZA 4O44B 4RZRA 1RJJA 2PEBA 1WF2A 3Q8SB 4EEYA 1VBKA 3CWJA 2UV8A 4WYWA 3MZIA 4G3IA 3CDUA 4X2BA 1R43A 2ZBPA 2W4DA 3ILOA 4NLSA 5DM6Q 2EC0A 3KNGA 2G0CA 3BKUA 3BSAA 4DUYF 4ELVA 4J9VA 3F0NA 2N3OA 4NXNJ 2ASLA 3EICA 1NK4A 3J7A1 2OH2A 2XM3A 1D8ZA 2E29A 3A13A 2CNOB 2KT2A 2VG5B 4QWAA 3PEHA 4RWXA 4DV0J 1DLOB 3U1MA 4J9RA 4YB6A 5D15A 2GVZA 4QJVA 1QTNB 2ZOMA 3R6GB 3PYEA 2CPYA 2GVDA 3DLKA 1DQ8A 1VIOA 3G8QA 4TNOA 4ZVTB 5CZXA 5E2QA 2R9LA 3U7JA 3PW0A 1KFSA 4GVBA 3CCZA 1OY8A 4X66J 4CCHA 5KFHA 1U0SA 1RWOB 4H54A 2J9DE 1D1UA 3GE9A 5H9EK 1XNQF 2GO8A 3GYGA 3TZWA 2B51A 1NEEA 1S6QB 1PBUA 1CSJA 1S9EB 4IQMA 4RW7B 1FX4A 2B4VA 3RG6A 3J7YI 2VJVA 4ECXA 2Y1LB 4QCLA 1HA1A 2D69A 1SVDA 5C25A 1RT2B 1HNXF 4ES3A 1S4EA 1C4AA 3L95X 4HLBA 3Q0AA 4WFNQ 1KBRA 2YX4A 3M6WA 3QSIA 1Q16B 3TZXA 2IHR1 3E51A 3G86A 4M95A 4EUVA 1IKWB 4LBHA 4G6VB 2E5GA 4WFZA 3HP6A 2OTLS 5D4OA 3HXMA 2R7RA 1TL3A 3H4DA 1FVQA 3O44A 3HFVA 3RBDA 1Q8IA 1RT6A 2QZ8A 1U02A 2JLGA 2MZJA 4USWA 1IBMF 5KT4A 4DV4F 3R2DJ 3JXOA 2J6TA 4DWIA 3I56S 2RSQA 3CDEA 2YPYA 2CPFA 4WKYA 1F9HA 1TTHB 2GA7A 2CNKB 2XQCA 1X4FA 4JI2J 3H98A 4M5HA 1LK5A 3FCHA 5HMWA 3FFIA 5IV4A 2AX1A 4CO3A 4ZPVR 1S9GA 2LP4A 1P27B 2JLFA 4NRUA 3HVTA 3KLVA 3W7BA 5DLFA 3MAHA 1WTFA 3IA0A 4B3MJ 2FDNA 3OD2A 3ZZYA 4BLGA 1N0VC 1OIAA 2B9YA 2LEPA 3JSMB 3PV8A 3ILLA 4ID5A 4X4TA 2M70A 5J2QA 1IKWA 2VH7A 3D6HB 4ECYA 1VQLS 1AFIA 2R7VA 2DXFA 3BBCA 4E98A 4IRDA 1BXNA 2D1CA 2K1RB 3IBFB 4DV3J 1HMVA 4A8QA 4KE5A 2MQOA 3RRHA 4CNZA 3EDRB 4LF9J 4OZ5A 1OS5A 4LSNB 2GHVC 2BACA 2X51A 2AEJA 2RIJA 2WONA 3DHXA 4WIQA 5JVGQ 1YSJA 2Y1IA 2MQMA 2BX6A 2AD9A 1P1TA 4LSLA 2OPSA 3B6BA 1R0BG 4R8UB 3HKWA 3S8SA 3KLFA 2RF2B 5K8NA 3M30B 3QATA 1MW7A 1RE1B 3CD6S 1X4CA 2CNNB 2ASYA 2CJBA 2Z2YB 3BSCA 5HL7Q 1VCTA 1FNXH 3L3CA 4QU6A 3TAMA 2IJNA 2MSTA 2RH3A 3VGTA 2QFJA 1HKAA 4JI8J 2UXCF 1VR6A 1UVIA 1WEYA 1RT4A 2OFHX 3NAIA 5K5MA 2HRUA 4YDXA 1FDNA 4R25A 3KLGB 4TYBA 4P75A 3LP0A 2B7BB 4GO7X 3J81Y 2DGTA 4USHA 4TU7A 5I3UA 5F8IA 2W9CB 2CQCA 3R5DA 1N56A 3D6FB 3IC1A 3OTOJ 1NLKL 4KHMA 1RA7A 3OXGA 3W61A 2YQ3A 4LSZB 5F8NA 1FKPA 1IKVA 1LFWA 3OPKA 3RB3A 2BQRA 3AD7C 3EZUA 4FBUA 4PUOA 4LT6A 5KFMA 2LXUA 3CGIA 5BR8J 4MJKA 4DV1F 1U48A 2ZH4A 1VK8A 2XYHB 5FLXU 2A10A 5ETVA 3KJFB 4HTJA 2QL7B 1FKPB 5AXLA 4C98A 1XIQA 1I94F 5IT9Y 3CD0A 3HJFA 4ED8A 4N8OA 1IR1A 2DNKA 3W2WA 3DRPB 2ZH9A 3UI3A 1VQ7S 2BOAA 1EB0A 2Z30B 3I0RA 2IVYA 2G4BA 2UXCJ 4I6WA 4WF9Q 4OV1A 2DNRA 4GO5X 1WEXA 4DN0A 3RB0A 2BQUA 3JSBA 4DXLA 4ES1A 1S79A 2C2EA 1IM6A 2A6MA 1WHWA 1S77D 3H8YA 2HHUA 1VBYA 2BXJA 1EETB 4DU7A 1APSA 4GMKA 1RTDA 2K7KA 4DR6F 3I31A 4KH1B 2ZVSA 1MROB 4OZ0A 3VZHA 2P8IA 1AUSL 2RF2A 2QSFA 4WFYA 2W2QP 3LGNA 1N5YA 3TYTA 2HBZB 2CA9A 2DVIA 2MZQA 2UV8G 3GV8B 2YY3A 3IAM9 2PSZA 1MWZA 4UOCA 2QYCA 2J0WA 4YY3F 5KFJA 2R7UA 1WKKA 3A12A 4WTYA 2IC3B 3OTCA 1K47A 3PW7A 2B9EA 2WK4A 2YNIB 1AROP 2JH3A 3AODA 4KGMA 4O4GB 4QIWD 4TKTA 5B0FA 1N4LA 4DV2J 3HVTB 3H5SA 3KLEA 5IQ6A 1XR6A 3M8ZA 3TA0A 3QT5A 4OX9F 1VC0A 2OEMA 3SXLA 1S1TA 3SEOA 4DJBA 3TX8A 4XAKA 2A0FB 2WB4A 3V81A 1ZYQA 1HPZA 3W3SA 1MSWD 2FLPA 4LR8A 3DRRA 2G1HA 5GMEA 2H3EB 3D54A 3MI7X 4YR3A 1Q81T 2OPPB 2OPRA 2EG1A 3HHEA 5A8WA 4X4SA 2G2OA 4ZVFA 3F44A 4JBCA 4C8MA 2XNRA 1RBOB 1FI4A 3EVOA 3QWPA 3MR2A 4YP3A 1VQ6S 4CYUA 2KU7A 3E01A 1WOSA 1VGYA 3BKTA 1WHVA 1VLOA 2DT9A 3DFEA 4OMFG 2ZE2B 5CZVA 1RISA 2HYIB 5AT1B 3KMQA 3T6BA 2CPEA 2FJDB 3W1YC 1Q78A 3AFGA 3M6XA 3GV5B 3MMBB 2LYVA 1VK3A 5AE2A 1DFDA 4O3NA 4GC6A 1S0MA 1VJQA 3FEZA 1X0FA 4ZJLA 1JNRB 4DFJA 1S6QA 2LDIA 1RAIB 2GIRA 3SSRA 4O0IA 2A3JA 4LIWA 1RT4B 2OP5A 7AT1B 5GAHI 2W7OA 2FY8A 3CCUS 1SCJB 4DBQA 2HQ3A 1SJ1A 1Y3JA 5HVFA 4HR2A 5KT5A 3QAEA 1HHTP 2ZC3A 2BANB 3OUYB 4ANEA 5A8WB 1NJWA 2CUYA 3LPYA 2GAHC 2J9EA 1X5TA 1H38A 1PSDA 1GH8A 3Q2SC 1L3KA 2CQBA 2BM1A 3NGTA 2UUCJ 3U27A 2MJNA 2YBVA 3CIMA 3W66A 1N48A 3C14A 4PG8A 2WW4A 4I7FB 3M4XA 4HHHA 4QYRA 2E9TA 2DYAA 3BH6B 2LCWA 1RT3B 1NJXA 2E7XA 3LWMA 4ZOSA 5AJ3F 1FT8A 1X9WA 3MGJA 3OFHA 4F4AA 1VHFA 4F3MA 1N36F 1YRXA 3T5LA 4C97A 1S6PA 1SXLA 3Q24A 2HZVA 1DARA 2DH7A 5L46A 2W1BA 4V1Ak 2YNGA 3W9HA 3V5RA 4FYXB 4IO9Q 2BDPA 4YQWA 2XMKA 2H54B 1VYAA 1KTQA 3N5BA 2AEMA 3HT0A 5J2PB 1NZAA 2HVDA 3CSKA 5E3PA 2HNYA 3ZTOA 3TZYA 3OXLA 3D1OA 3GILA 2NUHA 1TKXA 1YTYA 1ZZNA 1WDDA 1S5ZA 3G82B 1OSCA 5C2CA 2VQFJ 1Q86T 2ZUAA 2UUBF 1HARA 1DURA 3OR2A 5C42A 1TP7A 2JZ5A 3RBXA 1IWGA 3D1HA 4CLWA 1QSYA 4BC9A 4CT9A 1LV5A 2F8HA 4YR2A 1IQZA 3BGLA 1YKWA 1P1LA 3NRBA 4TLRA 2C2NA 2OPSB 3ET6B 2MKIA 1YVFA 2FHMA 3FBFA 5L9NA 2EBGA 2LEAA 3MEEB 1D0EA 2BA9A 2K7JA 5J2MA 4C3LA 3OJSA 3MM6B 5HQMA 3PIPQ 3H0PA 3K57A 3NGRA 2BW2A 2NXUA 1U45A 1H2UX 1HWKA 3ZFVA 3LP2B 1RHMB 2VDHA 4ECSA 2E9ZA 1DTQB 3M2UA 1S59A 4OZLA 5KOXA 2XCAA 3EGVA 4Q8EA 3IR6B 2LDYA 2O67A 2DGOA 2HFZA 3CJ8A 4NLVA 3MAQA 1U26A 1HI1A 3GG0A 2W9CA 2C2ZB 1B7FA 3D1QA 2QMWA 1QSLA 1CJTB 1T05B 3FEYB 1RHUB 2OPQB 4Z7CA 3BSNA 1PAUB 1IKVB 1LNQA 3BYRA 2XO7A 5G0RB 1T9WA 5KT7A 5J2NA 1R0AA 2EBEA 3FJ2A 3LP1A 1Q7YT 1A7GE 2VJUA 1S1UA 3QPIA 4ICLB 4DV7J 5HAOA 2FJWA 2R7XA 2L48A 2EKNA 4IUFA 2EFNA 2PI4A 1R6YA 2KO1A 4AXJA 5DGAA 1TL1B 1H7XA 3AA9A 4NZ0A 5LSLA 1U1MA 2BEFA 5IM0B 1RUSA 4LSNA 4WP3A 2VV5A 4PXEA 4MYTA 2KXHA 2WW8A 4DUZF 3SYZA 4Z2XA 2AYEA 5K8PA 3TI0A 1BUXA 1PAEX 1SJRA 2VQFF 2HVEA 4HACB 2Z2LA 5HI7A 1AB8A 1JMTA 1U8SA 1KKHA 1VRUB 2Y0BB 4LVNP 2ZNYA 4WFXA 2DGVA 3GJRB 4DL4A 2Y1JA 3MECA 4OHZA 3PX4A 3PR5B 4DS5A 1ZM3A 4ID5B 1SI9A 2Z2MA 4RL1A 5B0BA 1SJQA 4AL6A 4EO8A 1XMQF 1XTZA 3HPOA 1WUUA 4EWTA 3UQSA 1WSVA 3KNAA 2V50A 3B82A 1QE1B 5K9FA 1F0XA 4HHUA 4NOHA 1O5JA 1AUDA 4PWDB 3CO0P 4KQZA 2V94A 5CCMA 4ZS6A 3BGRA 2CWXA 3CJ0A 3D66A 3P3DA 3NBPA 4MK7A 5A6PA 4FPIA 2XS2A 5EDWA 1VC6A 2R2UA 2AGQA 1FRKA 3DRPA 4ZVGA 5K14A 4DPXA 3FMBA 3SFGA 2DR9A 1GMWD 1URRA 2DH8A 3FCWA 4LRCA 1YBAA 3I96A 1IJEB 2H48B 3MCSA 1RWVB 3D3BJ 3ENQA 3OFGA 5L1LA 4PABA 2VIHA 4PXBA 1RT5A 1GEHA 3ISND 3VVTA 1AW0A 1R0CB 5IFMA 5M2UA 3I32A 4QIVA 1FVSA 3ENWA 2IA0A 3WZ0A 4TQSA 2VASA 4A47A 5F9NA 4B9TA 1DTTA 2AV5A 1EHWA 4FVCA 1H74A 2Z0GA 1RYSA 2PI5A 5CHCB 3H20A 1FKOB 3JYTA 2BOPA 2DGXA 3EGWB 4I7FA 3HT3A 4B9SA 4TQRA 2DD8S 1PIEA 2KL8A 4YB7A 1T94A 4X65J 2OSRA 4KV8A 2QLXA 5EWGA 2OMLA 2N7YA 1FEHA 4LQ9A 1GFWB 2ZDPA 3CB4A 3SQGA 2B43A 2WZ1A 2XZDB 1NKCA 4NLDA 3DI6B 2ZEJA 1ELOA 3MMBA 1IVZA 4P74A 3BEGB 1REVA 1RADB 2CZ9A 1JLQA 2Y3YA 4IG0A 4BHQA 3ZTSA 1RT1B 2MQNA 2NYHA 3IO1A 1PC5A 4ZP9A 1S49A 4DOZA 2VQEJ 4M5NA 3K2YA 2ROGA 4UZCA 2R8IA 2HHHF 1MWYA 4DCJB 4ZK7M 4ZVUB 1QAXA 1FJCA 2WSCC 2ACYA 5HROB 1C0TA 1IJFB 1RT7A 3P4UB 5HJYA 2VDIA 2KI2A 1M5KC 4CLKA 2Y1RI 3QFHA 1UEVA 3DM2A 3FSYA 4AYBD 4UOGA 2E1AA 2B6AA 5HBMA 5C2GA 1D9DA 4OX9J 2PMWA 4A8OA 3X1LB 1YIJS 2LQJA 3KUEA 4NLQA 3ZZTA 1PYOB 1NAQA 3QGPA 1FFGB 4ZKAA 3UCZP 3IGNA 3MM9B 3NP5A 2HHSA 2BW7A 1R7IA 1RTIB 3H2UB 2MY7A 2FJBB 4DCOB 4J9KA 3FCVA 3NAHA 2ALZA 1FKAF 1XMOF 2B6AB 4O3QA 5IXUA 1ULRA 3IRXA 3W5XA 5H9EJ 3QIPA 4QYZJ 4XO0A 3M8QA 3D6TB 1NPRA 3QWUA 4ZVRB 4RUCA 1ZTTA 3DLJA 3CT9A 5BYQA 4C0HA 4X62J 3V6DA 4CIOA 2MKKA 4U9RA 2RS2A 4OJ3A 4PQAA 2XY5A 3PX6A 2GV1A 2V5HG 3P49B 3MXHP 4PR6A 1CJTA 3QJJA 3HF5A 3KUGA 3P45B 1D09B 2ZJQQ 1N5TA 1I1GA 4DPTA 2BJ1A 3MEGB 4A8FA 1FEEA 2O5DA 2XBPA 4OYWA 4L74A 2GMJA 3O5TB 3NLCA 3NGSA 4WP8A 1RWXB 1LWCB 3HHLC 3VAKA 2GIFA 1UPPA 1B64A 4EK2A 2JVOA 2IYIA 1UVNA 4IH7A 4M5JA 2RDIA 2XMVA 1X9SA 1FE0A 2HZCA 3HDSA 3MEGA 3NCQA 3R97A 3K5MA 2Y8WA 2U1AA 3K59A 1HI8A 1X0PA 4LFAJ 2DRAA 5ETOA 3TZZA 3K5NA 2C3YA 4Q43A 1JLAA 2AKWB 1LWCA 3D6MB 1H3DA 3VQSA 5IWAJ 4HKQA 3HKZD 1S0NA 3PIOQ 1Q8LA 1FJ7A 3ZZUA 5B0CA 3EVWA 2AF6A 4OYOA 3OL6A 4RJVA 3L7OA 4DPYA 4RUHA 2AP6A 2O01C 4GRSA 2VG6A 4L75A 1PJ6A 2HFNA 4Q7AA 1V5IB 3GIRA 4EZ6A 3SZ2A 4BS2A 1KVJA 3MAAA 3NS5A 4V19J 4JB8B 2VA2A 3AA8A 1R6VA 5THWA 1RTIA 4PG5A 4C8NA 3NG8A 4QW9A 5HP1A 1Y5LB 5DG9A 4WJBA 3D0HE 3BGRB 3KKFA 4OHXA 4PYDA 1U1QA 2J6UA 1WF0A 1WOPA 3IFEA 4X4QA 3QIPB 4ED1A 4FF4A 2EKYA 2A2DA 3M8YA 3QGGA 3DN9A 4HI1A 3X3UA 4NE9C 3ZTRA 1J5OB 2XB2D 1UP1A 1X4EA 4HT7A 4FF1A 1S12A 2IMOA 2PEHA 4OL8A 4MFBB 3TJAA 2DGUA 1VOMA 2RDDA 2VG7B 5IT0A 5GADI 4TY8B 1JWWA 2EFQA 2XEXA 2IM1A 3BREA 4CO4A 4FYVB 4O4RA 5BR8F 2NS1B 1FK9B 2AZ1A 2JEFA 5D8HB 6AT1B 1ICEB 3V4MA 2GHWA 1TL3B 3VVUA 2K8GA 2ASDA 1TV6A 1TK5A 2DNZA 1RT7B 2M5YA 3QBCA 2ADBA 3FC9A 2RUGA 1HD1A 2RNEA 3R9LA 1YX2A 2F8EX 3JSRA 4USMA 1G2EA 2MEWA 1V3ZA 2MJUA 2QX0A 3W9JA 2OJ3A 3OT9A 1VC5A 4CH7A 4DR2F 2W9BB 1P9QC 3CEDA 4JI1F 2V8GA 3VGSA 1Q82T 2ZZTA 1Q5VA 2RRBA 4M94A 4J7CA 1NH7A 3S01A 4RW9A 4XDCA 1OJ4A 5H1SV 4F4XA 4OX8A 3MMAB 3TP2A 1V3RA 5CQGA 4W98A 4Q44A 2OSQA 2X1GA 1RT1A 1FRMA 1BQXA 2IAJA 2Q3PA 4JI7F 2BJ8A 3NMAA 2X3DA 5D4NA 4PXCA 3VCDA 2E5LF 2DXDA 5LM7E 3DC2A 1VQNS 2YKQA 1ZOTA 3H2VE 1KQSR 3JTOA 2EVZA 3LTOA 4QIGA 2RQMA 4K8RA 3DLKB 5KT2A 3C3LA 3GR0A 1RI7A 1X4BA 3H42A 2HLTA 2W4PA 1NCLA 2AJ4A 2OAUA 1RABB 3LAKA 5HJXA 2HQDA 2L9NA 3DOLB 4DL2A 1SC3B 3C16A 3KLHB 3KG4A 3MCNA 4PKDB 2RQKA 4ED0A 2ILYA 4TN2A 3M7VA 3BQ0A 1UZDA 3OTBA 2YWHA 4Y2AA 1GXUA 3C8YA 1U09A 3KK1A 3HHLD 5MLCV 2ZWOA 1JLCB 1TMJA 1RSCA 3I4PA 3TA1A 1N0UA 4NMLA 5IQQA 5KAKA 3EUNA 1BHNA 3GSIA 3Q8UA 4DV4J 1MG7A 4OHWA 2K3KA 3LW5C 4ETZA 3HK2A 2H4YB 1X4HA 2KHCA 3VAMA 5A6WA 1X5OA 3SV4A 4Y2MA 2KB2A 1TK8A 1P6TA 5L1IA 2D3O1 3B8HA 1KLMB 1NMEB 1T7PA 4MIAA 4LRFA 4G1PA 1M5SA 4LF4J 2JC1A 2YPZA 1K1SA 3QGIA 4K4YA 1K1QA 2XY7A 4DSJA 4LIRA 4WE1B 3GZ7A 2BABA 4QPTA 3TEGA 2FJVA 1IBMJ 3SCKE 1RAGB 5BXIA 3IRWP 2RRAA 2VUGA 2C22A 3GMGA 2ACMA 2QTWA 3N9UC 4UOFA 2PIIA 3PRDA 2MLZA 5CAAA 2UXBF 2MLXA 1Q5YA 2DGWA 3DLEA 4K5SA 3AAWB 3CJKA 2W4CA 3T41A 4QYZK 1JLFB 2P9CA 3PFOA 3HI9A 2R2TA 2WTFA 1YZ7A 4C0OC 2MDAA 2ZH2A 4LR7A 5CYMA 5KFFA 4DL0C 2GJFA 2LKZA 4HL9A 4DPUA 2IA6A 3P96A 2IJRA 3KLEB 1X31C 5T7LB 1WDTA 1BQNB 1Q4RA 2CADA 2ZZMA 1TKDA 3NOCA 4TY9A 1GMUA 4P10A 1T05A 3PRVA 4JOUA 1KLNA 4ILLA 2UXDJ 1RP5A 1WOOA 3HMJG 3DLBA 3PW5A 4IFVB 1RTHB 1C0TB 4G1IA 2FD2A 3T5JA 2PC6A 1WKJA 2M4MA 3CJQA 3LP0B 4OI4A 5KFKA 1WF1A 1C0UB 4C4WA 1XJWB 2Z57B 5D0EA 3SMZA 5KFXA 5AE3A 1SKSA 4F4ZA 1A9NB 3IBCB 2V9WA 2J8SA 4A8XA 4IO1A 3KLIA 4RPFA 2KFNA 4I2PB 1E6VA 2Q79A 2VPZB 1WC1A 2DIUA 5J1EA 2MQLA 5FDLA 4ENOA 4WZMA 3J80U 2B8PA 2ABYA 4DX8H 2B4UA 1RXOB 1T3OA 2EC2A 4Y65A 2K06A 1K9MT 2CYYA 3TAQA 2E5HA 4PG6A 2ADCA 4DUTA 3CCJS 4ELTA 3R6LB 1U1OA 1IR0A 3M8PA 3FBEA 1F3VA 3S7RA 5MAOA 2F1FA 3VV2B 2VKZG 3UO0A 4DHVA 3KK2A 3D9BA 5GAEU 2ZC4A 1RCXB 4PWUA 3CJ5A 1OWXA 4O0NA 1C4CA 3UDLA 2HAFA 5ETTA 4KKOA 3IS9A 4LR9A 3BO3A 3TJ8A 2FY1A 3J7ZT 3CC7S 1L3TA 5J1NA 1VQ9S 2AWZA 1U25A 2IM2A 3UN3A 4Q45A 2BE2A 2IM3A 4DV3F 3LOUA 1J27A 3KJNB 1T02A 4HTIA 1N54B 3QIDA 4EI2A 5C42B 4YB1P 4DV5F 2HHQA 1AFJA 2HRYA 3OR1B 2UVVA 2CFXA 1VQYA 4C11A 2V8VA 4KKOB 4BDPA 3O2IA 2YWFA 3SQOP 2ZZNA 1HPZB 5K14B 3T9ZA 5B7WA 1IBCB 2XULA 2ZH8A 3EXYA 2BJEA 4DPWA 2XZWA 3UNYA 3I55S 2UXDF 3EVMA 3VQTA 3C15A 5CD4A 1JLGA 1TU0B 1RBLA 2JWNA 4NWBA 5ETPA 4ECTA 1DJ0A 5GAEI 3L09A 3D68A 4ILRA 2J8AA 2A18A 3PG9A 3NY0A 2CNLB 1Q1KA 3PJWA 5DZ6A 1I94J 4DPOA 2Z8QA 2Q6CA 4Q8FA 3GQCA 2K2PA 1T3NA 1TR0A 3CDBA 2MTLA 3AD9C 3DDNA 3OTOF 2NPIA 2HHTA 1Q0NA 4ERDA 4Q0BB 1S76D 3QO9A 4DDFA 1YJTA 5I3PA 5HBMB 1RTJB 2ZH7A 1KONA 1NHKL 1UZHA 2I0XA 2DGQA 1WI8A 2G1DA 2RJZA 3Q89A 3OHBA 1LKZA 4DR4J 3FSXA 5ETNA 2BKOA 3A8JA 1ZS6A 3M30A 4KAIA 1Y7PA 3MDFA 1ZPVA 3O6QA 2JLEA 1LWFB 3OJUA 1C2PA 2HGMA 4DI6A 2QGFB 2ROEA 2R7QA 1C1CA 1UFLA 2OELA 1NZ8A 4U8VA 5D78A 2VPXB 4I2QB 5KFLA 2DCUB 3OSNA 2XWYA 1YWXA 4NLGA 1RU1A 1RAAB 4BWMA 3A3NB 5HO4A 2GNKA 4DV6J 4M8LA 1TL7B 2PFDA 3I0SA 4ZVEA 1R8PA 5CA5A 4Q5VA 4FS2A 1RWKB 5A0YA 4B3SJ 5EHHA 4Q2MA 4NASA 3W64A 3EWGA 4OZJA 2OLWA 3W2VA 1Y00A 1Q8KA 3BDPA 4OYAA 3CULA 1HQ2A 1SUQA 3MM5A 3MCMA 4RNNA 3CIZA 3GLJA 4OYZA 3UPFA 4DQRA 4LF8J 4C8KA 2ZHAA 4USVA 1N33J 5FD1A 3W8GA 2QC3A 1QD1A 1EARA 4I4BA 4OI3A 4O4GA 4JI7J 2PMHA 2XTJP 1F5CA 4B17A 3B54A 1NH8A 5D77A 2FHJA 4LREA 2KRBA 4IYQA 2MZRA 3F41A 1U2RA 3OFEA 1RHKB 2C2OB 2VD3A 4L76A 3ZZ0A 3CUNA 4DQIA 5HMYA 3FKBA 3ET6A 4EO6A 3MEKA 2MZTA 3KHRA 1IKXA 1S6OA 1U0HB 2VBXA 1NK6A 5FJ4A 4DG1B 1C1BB 1N33F 2Z4PA 2ZD1A 3HHLB 4O23A 3R2CJ 2I9SA 3AB2B 3PNIA 2QEXS 1AYEA 4NCGB 3SSSA 4B3RF 3I9ZA 5LXYA 4FYWB 3G82A 3PKYA 4RW8B 2M8DB 1SQGA 2WBRA 3DDKA 5E3CA 2YKNA 4WBFA 5KFUA 3CJ3A 1WTBA 2FHKA 1X5PA 2XNQA 5DLGA 4JP8A 1YDLA 2H5JB 4NMXA 6FD1A 3QLHB 4NCGA 2B5JB 4JI2F 2J7KA 1VQ4S 2W9AA 1VI7A 3FZ2A 4C2MA 4F25A 3MHYA 2XSJB 3NXZA 5EUHA 1PC4A 1KEKA 2F7VA 1N5QA 2WVFA 1RLCL 1SC6A 1N5VA 4IG3A 4KC5A 4KO0A 4CM2A 4ZJQA 5L9XA 4R0JA 3KJVB 5GADU 5K20B 2AGPA 4LF7J 1RK8A 3IXQA 4PRFA 2I8EA 4RU9A 2HMIB 3HVWA 2UUBJ 2BJ7A 5HLFB 2HQFA 2E9RX 3IWLA 2QMUB 3MM7B 5ETQA 2AEFA 3MD1A 3NCPA 1HNZF 1TL4A 5LMUF 2X1BA 3VAHA 2HZAA 1SQEA 4H4OA 1NKEA 1QVGR 2F4VJ 1TAUA 1NHVA 3N6MA 2L9DA 4DSKA 2XSFA 1IBLF 1T03A 2PFFB 2HS3A 2OEKA 3HD1A 1FHTA 1R0AB 4OI0A 1Q79A 2IRUA 2VFTA 3M8WA 1FDDA 5F0WA 3THPA 3M9NB 2C3OA 3UD3P 1UL3A 1PGZA 4K0KF 2UVRA 2R8GA 1NDPA 3JQKA 4HT5A 2W8KA 3NEKA 4ZCIA 1NDCA 3M6UA 5BYSA 3U02A 3GJTB 4M5LA 2E5IA 3FVYA 2MSSA 4J37A 1F60B 4DR1J 3PVXA 3DLHA 4O3SA 3ILIA 1EZZB 1ZH5A 2GHPA 3B4DA 4F4WA 5LT5A 4PUOB 5D3GA 4LRDA 3KYLA 5EX0A 1DHMA 3GIKA 4LBIA 4W90B 3PDNA 5D4PA 4U7UK 4B08A 4ZVHA 1U1LA 4NI2B 2CPDA 4LF4F 1LW2B 3WDOA 1MMDA 4AQYF 4JI3J 4KPYA 2CQIA 2V0NA 3BN7A 3G8SA 4NXMJ 4P6QA 4CNYA 1J2VA 2FVPA 3IP0A 4QIEA 2HWIA 4RW4A 4CDIA 4C6AA 4F26A 2FYXA 2GVDB 3D4JA 1L5UA 1HQEA 9ATCB 4WIIA 4LSLB 5JJBA 1K8AT 1NSKL 1R8CA 3LGMA 3MPUB 3Q2TC 1REVB 4OI6A 5F9LA 1OY9A 3SV3A 5F0UA 5G4DA 2YTCA 3W8PA 5DJBA 3OR2B 3G96A 2ZHBA 2RQCA 4ZLJA 3MM8B 3GP9A 3CJSA 4OJHA 4N5SA 1KRPA 3E8OA 3ZNUA 1H98A 4J9MA 1P8GA 2RB7A 4A8WA 4P2XA 4GKKJ 1NB2A 1NUEA 2V63A 1HI0P 2NQPA 4WP9A 4LFAF 1TZ0A 1HYSA 2NZ4A 2CJ9A 2DXEA 2QA2A 1SQFA 5HK4A 2J7UA 3PX0A 2U2FA 3MF5A 2DIVA 2FJAB 4NA3A 3TVKA 4CLUA 3Q8PB 2PT0A 4P9SA 3BSOA 3RAXA 1H73A 3IM9A 2VC1A 3PCOB 5CXTA 4ATNA 1TK0A 3BPSP 4ECRA 1DY3A 1UPMB 3MFHA 1YITS 1SL0A 2O1PA 2BE7D 3BH7B 4RW6B 2HPUA 5L8RC 5EWFA 1N34J 2HNZA 4LF1A 3T3FA 2KM8B 1LFPA 1N6QA 3R5BA 3M32B 1B4SA 3RW6A 1MMLA 2DY9A 2ATLA 3DOMA 1VQOS 2KXFA 2EFPA 4W92B 3MUMP 3M9MB 3BO2A 2DEIA 3AOAA 2G13A 3WC0A 5LSRA 3UD4P 4UUXA 2RS8A 1S1VA 2UUTA 4PAAA 1RCOB 3C14B 2ZNZA 4ZMMA 2MB0B 5E5NA 2A1BA 5IT9U 4LFCJ 1XR5A 3OTEA 1HYSB 2PE8A 3RUBL 2F4FA 3KG1A 3KJQB 3LO3A 4UY85 2XSJA 4PPZA 2EG2A 3JB9k 3H2LA 1S72S 1SJ3P 2AU0A 3KUHA 2X1FA 1K73T 3TOQA 4F02A 2EFGA 1YJWS 3PFEA 2ZH3A 1UW9A 3GB0A 2HHWA 4DG1A 1UMJA 2GGPB 1NPPA 2HRTA 1R27B 4EBCA 1S6PB 3QQCD 3OVSA 2KG1A 2CJYB 3HSGA 2DITA
chains in the Genus database with same CATH topology
5FDLB 1TKZA 1Z4UA 3C66A 1BLUA 2OFGX 3SDEB 1QJHA 2KXNB 5KFNA 2BQ3A 3MUTP 4ES2A 3DXSX 3NNAA 1G1XA 1FA0A 4NLYA 4WCEQ 1CQMA 2D3UA 1HW8A 3NNCA 3DYAB 1FXRA 2F40A 2H9ZA 4EYHB 3T5KA 5KG7A 4FXVA 3OVBA 1NK8A 1SH3A 4Y0FA 1VRTB 1C1CB 4XK8C 3K8WA 3B4MA 2LU1A 2AGOA 4Q0BA 2ZH6A 3FQLA 1FJEB 3BB5A 4A8MP 3I0SB 2D7SA 4A4JA 3ZZZA 2DNGA 1G3OA 4ZP8A 1KHWA 3MPWA 4YHHF 1S99A 2R2SA 1SH0A 3TO8A 3L7PA 5F41A 2HWTA 1HMVB 1KQGB 4RUAA 1HBMB 4DL6A 3RRGA 4URSA 5GAGU 2YKNB 7FDRA 3EGNA 3CTRA 3T9NA 4R5PB 1HNVA 2FHJD 2QT7A 2WONB 4WFBQ 3TUZC 4DV6F 2B5JA 3QGHA 4BC7A 1HBUB 2C3PA 3PZPA 3C6UB 1HBOA 2B56A 2JEIA 1ROFA 2RKIA 3IWXA 3MOZA 4H4MB 2M7SA 3QZ8A 1JLGB 2FUG9 3I82A 4RNFA 3O1LA 1E6YB 5T41A 1UJ4A 2QIFA 4DQQA 2FVRA 3DNCA 1KOOA 2M88A 2NUUG 3OTDA 4KB7A 4JI0F 2R4FA 4IQXA 2AJ1A 4X4OA 2RKIB 4WFAQ 2F9DA 3T1HF 3ONQA 1JKHA 2DNQA 4A46A 4F50A 5HQ8A 1MU2A 5CH7B 1Q7LB 4FVMA 1SIWB 3TRGA 2IBOA 2JFDA 3G4SS 3R1LA 3UE2A 2VL1A 4DSEA 4PWDA 1XR7A 2BRLA 4JI4F 2OO4A 5KT6A 2VFSA 4IDKA 4X64F 3TAMB 1GAOA 4I2PA 5J1EB 1JLBB 2DO0A 2EFOA 2XLIA 2ZBCA 2CDQA 2BRKA 2WBMA 2ZJPQ 3CD7A 4X4VA 3TARA 1X9MA 2MHEA 3UFCX 1KS2A 5D4LA 4CH1A 1JLBA 5IWAF 4ECQA 4A8SA 4ID8A 2BR0A 2V4QA 1IKXB 1RWUA 3ZZOA 3OW2R 4N76A 4K59A 4HEA9 2DISA 2E44A 2KRRA 2XGPA 1UVLA 3VAGA 1B0PA 4MMOA 1L3SA 5KG0A 5IS2A 1S1WB 2P5VA 1WHXA 2VG5A 2YWEA 2W8LA 1FRHA 4JV2A 3G8TA 3K0JA 1OO0B 2CG4A 2RDJA 3FRZA 3B78A 2E66A 3KK3B 1LXJA 1UAWA 2ZBIA 4PG7A 2P6TA 2ZHOA 3HLUA 4LQ3A 2FC9A 4J9NA 4A48A 1D8YA 3EXCX 3KWMA 4MIBA 2RT3A 4MFBA 2DNYA 4DFKA 2ZOGA 5ADZA 2HQIA 4F2RA 4ILMA 1JLFA 3Q8QB 1NKBA 1FD2A 1GQEA 3EPIA 1HR0F 2EWHA 4K4SA 1D3WA 2V2KA 3SDEA 4NLXA 2WCXA 4Y2KA 5KG2A 2DHGA 3H40A 1S97A 2DNPA 2AYMA 3BF4A 3CMAS 3FFIB 1QAJA 1CVJA 3MM6A 2YX1A 4WK3A 1SIZA 5C24A 2QV6A 1YHQS 3WC2A 1FDAA 4NRTA 4DF4A 1T8EA 5E3RA 2POKA 2RMLA 4I56A 5E0OA 3JAMY 3LP2A 1HBMA 3DXBA 1J5EF 4CH0S 4ZA1A 2MZ1A 2CIMA 1S1VB 2YNFA 3SSQA 5DDOC 1H6KX 3KHHA 4CO5A 1FXLA 1W25A 1FF2A 4J9QA 2CPHA 4Y00A 4QPXA 4UQGA 4RW8A 5KG1A 2VQEF 4F3QA 3OL9A 2YNFB 4O3RA 2CQHA 4I6YA 3N28A 2YNHB 3DRYA 4IOAQ 4M63A 4TYAA 5T7LA 2LVWA 1U49A 3M2VA 4MTPA 5KOWA 4NZ7A 1F9FA 1X4AA 2VFRA 4RW9B 4N47A 4K4WA 1S9GB 3CMES 1UETA 2J0SD 2VOPA 4ECVA 5KFQA 4ZPBA 4IRCA 4YR0A 4K50A 1GX5A 4WZQA 3N0VA 2WB1D 4HVZA 3ZZPA 5A8RA 2M8HA 4WU2A 1U6ZA 4KSEB 1UWBB 2J9CA 3NNHA 2OTJS 1CC8A 5B0GA 5H9FJ 2UU9F 3G6XA 1SUQB 1TKZB 3MM5B 5M2PA 2D9PA 4I0WA 3PM9A 2FGOA 2M52A 4IR9A 1YJNS 3AQPA 1X8DA 1RYRA 3GV7B 1HWIA 2N7CA 3IG1A 1KVIA 2CRLA 1RKIA 1UVMA 4USJC 1JLEA 2PA8D 2DHXA 2A2CA 4URQU 4X4PA 5KFEA 3EYZA 1Z1ZA 3MR5A 4LF6F 2J7WA 4KRWA 1JXLA 4RW6A 1KLMA 5LJ3Y 3GIIA 4DR5F 2H5EA 4IFYB 4NA1A 3E2EA 2XGQA 4WYLA 5F8MA 5E33A 1ZTWA 2GJ2A 2LA6A 4E8UA 3HVAA 4UY8T 2QRRA 5KT3A 2IVMA 4C0BA 3H59A 5J2PA 5LXRA 3ZC4A 1LWEB 2AYBA 3AJ1A 4I69A 2SXLA 3DRSA 5F8LA 4KT0C 3JYTB 4I68A 3M6VA 3W2VB 3RBEA 2YKPA 4DSIA 1WELA 2HNDA 2MZSA 4O3OA 4ECZA 4KFBB 3KLHA 2AJFE 2GMHA 2F3JA 4MYUA 3CJ2A 2ZH1A 2FVCA 1UKUA 2QO3A 1LQ9A 1SL2A 3CPWR 3LH2S 4IH6A 2D74B 2GGPA 1FRJA 1U4BA 1S7HA 1TFWA 5KFWA 2DTJA 3OBIA 4B9UA 1XK8A 3CE8A 1HNWF 3SCLE 4P7TA 2P9EA 2X3GA 3V6JA 2VA3A 4RKUC 3POTB 4YB5A 3KHLA 5DRKA 2BV3A 2UUWA 2PDAA 3V6HA 1PILA 1QAYA 2JVRA 1MMNA 2JHEA 1SKRA 3QMQA 1C0UA 5DM7Q 5C24B 4JV5F 4TY8A 5D6GA 3G71S 4FF3A 2EK6A 4ICLA 1QY7A 5B0EA 2GIQA 1KD1T 1H7WA 2OD6A 3R5AA 2UP1A 1IM4A 1BD6A 4NA2A 3ITHA 3D0GE 2CJAA 3OQ2A 3BQ2A 3C6TA 2ZH5A 5HN0A 5EX3A 2HFOA 3I5AA 3KHGA 2KZMA 2KH9A 1S1WA 2N3LA 4N56A 1RT3A 1SBRA 5AXNA 3KMSA 4HI2A 4J9SA 2AX0A 2GFFA 3IRXB 2HG4A 3KK3A 3CCRS 2WRMA 4PCQA 2LU2A 3QZ7A 1N32F 1H2TZ 1LWEA 5U47A 1GX6A 3AJ2A 2ZKUA 2VG7A 4DMZA 2HMIA 2DJWA 2E1MC 3AH6A 3V6KA 4KTQA 1YQHA 4DSFA 5DQHA 3M2VB 2HIQA 4ZHRB 2HWHA 3CCES 1X4DA 1HBNA 1XWLA 4KIAA 5KFBA 3GIJA 3MMJA 2IC3A 3IR5B 4KGKA 4ED7A 4ZDNA 5F8JA 2V4JB 5ITHA 2N82B 2ILZA 1FESA 2B4PA 3O8WA 4QIFA 2CQDA 3HM9A 1TVRB 1JLEB 3DLGA 2UZAA 4KV8B 1K0VA 2FIUA 5E3QA 2R8HA 1FO1A 1VIXA 2J5AA 2XMTA 1QM9A 4DFMA 1JJ4A 5C5JA 5SZTA 2NSCA 5J2MB 4KBIA 3SCIE 4K4VA 1TVRA 4R0EA 2GO9A 4QWCA 1HL6A 4IG0B 4LFCF 4DR4F 1F5BA 2CQGA 3JSMA 1RTHA 1J5OA 1MU2B 1XERA 2KKHA 3OSPA 1C1BA 1M1KT 4TLQA 3M1VA 1RDRA 3TUJC 2QA4G 2YKMA 4ELUA 2WAQD 5B0AA 1WNEA 4BWJA 3OL7A 3V4IB 3Q22A 1WACA 1S4FA 2XC9A 2RRNA 2IAJB 1TKTA 4H4OB 5L1JA 3RB6A 4AUKA 3GILA 5EN1A 1HNIB 3TW0A 2NSBA 2DNNA 4IKAA 2QSWA 2BANA 3TVZA 2CPJA 2OD4A 2PGCA 3LWLA 3RAQA 3NBPB 4ZCMA 2XLKA 3CO9A 2FC8A 1VQ5S 1G6BA 1S9EA 5I4MA 3IS9B 2HGLA 3KLGA 2FLLA 3WX4A 4K4TA 4B3SF 1MROA 1IXKA 3QLHA 4WU3A 3PW4A 4U67Q 1G7CB 4ICLB 2C3UA 1CG2A 3GYNA 3MECB 2I38A 4DL3A 3QO9B 2XCPA 1WD6A 2GMLA 4PQUA 5KFPA 4X66F 4QQBA 1QAIA 1WG5A 4B9VA 1Y9OA 3HHLA 3N6LA 1TFYA 2W24A 1X7VA 3U1LA 2F9JA 3R27A 1D9FA 5KFZA