5DDOC

Structural and dynamic basis for low affinity-high selectivity binding of l-glutamine by the gln-riboswitch
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
b'TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-glutamine riboswitch (58-MER)
publication title Structural and Dynamic Basis for Low-Affinity, High-Selectivity Binding of L-Glutamine by the Glutamine Riboswitch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 19
structure length 87
sequence length 87
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5ddoC00
2G1DA 5MLCV 1WHYA 4CQ1A 3UD4P 5IQQA 2MZTA 1FXLA 4F26A 4PKDB 2OSQA 3G9CA 2RQCA 1NO8A 1WEXA 1WI6A 1WG4A 2G0CA 4FXWA 4IUFA 5DETA 2GHPA 3CD6S 2KFYA 2E5GA 3VAGA 1U1QA 3D2WA 2KM8B 3HI9A 2SXLA 2KXNB 5LSLA 3CCQS 1G2EA 5EN1A 1JJHA 2HZCA 4A8XA 3CTRA 1ZZNA 2DISA 1YI2S 1SXLA 3P6YC 1DBDA 1H2UX 3SDEB 3P3DA 2M52A 1U1KA 5H1SV 2RQ4A 4J5OA 5GAHU 5CXTA 3BO2A 2VONA 2CPHA 1ZH5A 2DK2A 2J0SD 2M7SA 1VC5A 1F9FA 2DHXA 1M1KT 1N88A 2PE8A 3ULHA 2V94A 4TU7A 3EX7B 1WELA 3VAIA 4F25A 1K9MT 2MKIA 4RU2A 2F9JA 3S7RA 2KG1A 2BZ2A 1B7FA 3G4SS 3H2VE 2DGXA 1X5OA 2MQQA 2YH0A 4P6QA 3MD1A 2X1FA 1VC0A 1R8PA 2DNPA 2M9KA 2DH7A 2KI2A 1VBXA 2CQ3A 2XNQA 1X4DA 5DM7Q 2E5JA 3CCMS 3DXBA 1M5PC 5DM6Q 1X5SA 3Q2SC 1K8AT 1WEZA 4LIRA 2N3OA 2MGZB 2CQ2A 4QPTA 1WF0A 4W90B 1VQ8S 3CMAS 2JWNA 1WI8A 1H6KX 5CYJA 1M90T 2NLWA 1N8RT 3UWTA 2MJUA 3CMES 2DNMA 5FJ4A 2XS2A 2DNZA 4TLQA 1VQOS 1H2TZ 3I56S 5HL7Q 3EGNA 2DGTA 2E5HA 2MMYA 2N82B 1WTBA 3TP2A 2JVRA 1YJ9S 2RUGA 3LQVA 3CCSS 1SJFA 4W92B 2KVIA 1VQ9S 3P49B 2JRSA 1D9AA 5LJ5Y 4U67Q 4CIOA 2RVJA 1IQTA 4ERDA 2XNRA 1P1TA 4WIIA 2RRAA 2FC9A 3MXHP 2E5IA 4OZ0A 1U1PA 2DO0A 2F3JA 2DNOA 3CCLS 1FHTA 3R1LA 1UFWA 5IM0A 2QEXS 1VQ5S 4WFBQ 4C7QA 4QU7A 5JVGQ 1P27B 3VAHA 2CPFA 2AYBA 2HGMA 1U1MA 1S72S 4TU8A 2DNKA 2MSTA 1YIJS 4QQBA 2M88A 2CQBA 2MQMA 3CXCR 1Q82T 2MB0B 3MUTP 2CPYA 1KQSR 2M0GB 3G8SA 2JVOA 3MDFA 5GMKa 1X4CA 3BO3A 3SDEA 2DNGA 3U1LA 2K3KA 3US5A 5IM0B 2DNYA 2XSFA 2I38A 3ZZZA 2LQ5A 1R8HA 2FY1A 2KM8C 5HO4A 3B4MA 2MYFA 5LSOA 1M5VC 1HD1A 2LEAA 3MUMP 4F02A 3RW6A 1QVGR 3J7ZT 1U1OA 2AYMA 1NJIT 2CQ1A 3K0JA 3FEXB 2CPZA 2KXHA 5GAGU 2KG0A 1U2FA 3SXLA 5DDRC 2MXYA 4Y00A 2VODA 1NU4A 3U1MA 2YTCA 2DNQA 4YUDA 3DLLQ 1UW4A 2DNHA 2HGLA 1X5PA 2DNLA 1N52B 2KYXA 2X1GA 2CPEA 5LXRA 2MGZA 3V4MA 2MSSA 2MJNA 3EGZA 1WEYA 2AYEA 3BS9A 4M5DB 2J0QD 2ZJRQ 3N9UC 2EK1A 2L08A 3FEYB 1FT8A 2RS2A 1YJWS 3VAMA 1JJ2R 2DGQA 1CVJA 4PR6A 1X4FA 1PO6A 4YB1P 4C4WA 1YHQS 2OTJS 1PGZA 1S79A 1VQ7S 2O3DA 2MHNA 3CCUS 2D9PA 2DH8A 1JMTA 1X4BA 2MKCA 3S01A 2DGSA 3CCJS 2I2YA 4CH0S 4ED5A 1BY9A 1X4GA 3I55S 2PEHA 1KC8T 3G6ES 2YKAA 2RT3A 3TO8A 2L41A 4WFAQ 3CCRS 1U6BA 4WKRA 1OIAA 5D78A 2KRBA 2OSRA 2FHOB 2KH9A 1X0FA 2OIHA 2MKHA 1FO1A 4IOCQ 2B0GA 2MKJA 1VQNS 2MZRA 2KU7A 4V19X 2DHSA 3UD3P 2J8AA 4Y0FA 2OTLS 2QA4S 3LPYA 2ADCA 1RKJA 2RU3A 2LA6A 2CQIA 2MZQA 2ZJQQ 2D9OA 2MQOA 2CQPA 1KD1T 2EK6A 2KRRA 1M5OC 1FJEB 5LXYA 1SJ4P 1OO0B 1HA1A 1X5TA 2EVZA 2DHGA 1OWXA 1Q86T 3S8SA 1SJQA 2CQ4A 1D8ZA 3CCVS 4PRFA 1DZ5A 1XN9A 1VC6A 1L3KA 4OZ1A 4Z2XA 1YTYA 1X4AA 1WHVA 1URNA 2MZSA 2D3OR 1YJNS 3G8TA 2XS5A 1N54B 4IOAQ 2DIVA 4BS2A 3G71S 3OW2R 1A9NB 3NNAA 2J76E 3MURP 2UP1A 1H2VZ 2DB1A 2ZJPQ 5JVHQ 3SMZA 1Q7YT 1VQKS 4WCEQ 2MKSA 1U6FA 2YWKA 2LXIA 2A3JA 2DITA 3THPA 1DRZA 5CA5A 3R27A 2K8GA 4UY8T 5DDPC 1JJ4A 2DHAA 5GADU 2XB2D 4UQTA 2LKZA 3PIOQ 4LMZA 1SJRA 2M8DB 3BO4A 3VALA 3MOJB 1HL6A 2DH9A 2F9DA 1YITS 1KOOA 3B4DA 2BOPA 1RK8A 2DGUA 5BJRA 3CUNA 3VF0B 2CQ0A 2MZJA 2DO4A 2N3LA 2MQLA 4LJMA 4TU9A 4WFNQ 1QVFR 2CPDA 2KN4A 3NS6A 2CQCA 2NZ4A 3PIPQ 4IO9Q 2LXUA 1FJ7A 2CQDA 4FXVA 2WBRA 2ERRA 3CCES 3MD3A 1OPIA 1WF1A 3RW7A 1VBZA 5DDOC 4YOEA 2CPXA 2CPIA 2DIUA 2M4MA 2MPUA 2RNEA 1WWHA 3VAFA 1VQMS 1Q81T 2HVZA 3UCZP 2YH1A 2VOOA 2U2FA 3CF5Q 3HHNB 2DGOA 3NNCA 1UP1A 1WHXA 3UE2A 4C0OC 3MUVP 3H2UB 1W2BR 5LJ3Y 3IWNC 3CC7S 2N7CA 1A7GE 1FJCA 1VQ4S 3IRWP 2ADBA 2VOPA 5D77A 1YWXA 2G4BA 2U1AA 2CQHA 1VQLS 2X1AA 1M5KC 3NNHA 5ITHA 1WG1A 1VQ6S 1UAWA 2DNNA 1ZZFA 3NMRA 3ZZYA 2KXFA 3VAKA 3CC4S 2E44A 2MY7A 1VBYA 2Q79A 2CJKA 2MQNA 2LCWA 2M8HA 2FC8A 2M70A 3G96A 3UCUP 4EGLA 1U1LA 1X4EA 2FPHX 2MKKA 3L3CA 2DNRA 3THTA 3VAJA 2HYIB 2JX2A 2KT5A 3CC2S 4ZKAA 5DDQC 2DGVA 2M2BA 3CULA 2RRBA 1FNXH 3BEGB 2L9WA 1K73T 1DHMA 1AUDA 3S6EA 1X4HA 2QFJA 2LEBA 1U1NA 1HD0A 2CPJA 3P5TL 3TYTA 1SJ3P 3Q2TC 2LYVA 5GAEU 2HGNA 3NS5A 5IFMA 4WF9Q 1WG5A 1U1RA 1WF2A 2RS8A 4QU6A 5GVQA 2DGWA 2AD9A 2AYGA 2GO9A 2KHCA 2CQGA 1O0PA 2MZ1A 3JB9k 3J7YU 2LECA 1KOHA 2LA4A 2XS7A 1VQPS 1WHWA 3MI7X 3UCGA 3R1HA 1QM9A 3CPWR 2OJ3A 2MQPA 2MY8A 2X1BA 4CH1A 2LMIA
chains in the Genus database with same CATH superfamily
2ZKTA 2ALZA 1LWEA 2UVVA 4F26A 4FXDA 4WK3A 5HSPA 4J9KA 2DY9A 3VAGA 4HACA 4OI4A 3H42A 3L4BC 5E3PA 2GMLA 2VJUA 4A8XA 4ZPAA 4IQXA 1GXLA 3TARA 4Q2LA 2W24A 4X62J 3BO2A 3D1HA 2CUYA 2VONA 4AE5A 3ILIA 3ZZ0A 1M1KT 5IT4A 2F8HA 4J7CA 1WELA 3VAIA 2ZOGA 5MAOA 1VYAA 3FMWA 4NZ0A 3FCVA 3X1LB 4ZVRB 3GIMA 1VBXA 1VISA 3HJVA 3ZZOA 1RLDA 2JSXA 2HZAA 2HQGA 2IM0A 4NXNF 2ZNZA 4TY8A 4F04B 5ETNA 2NLWA 3MTKA 3PNIA 2UUAJ 2DNZA 3ET6A 1JLGB 4CP5A 1Y10A 3RBEA 2ZH5A 1V3ZA 3BJYA 4H4OB 4M5LA 4DL2A 2KTQA 4KHRA 2VU5A 3OLAA 4PXBA 2XGPA 1QY7A 4WFXA 2BEFA 4Z37A 4YFUA 2DNOA 1IKYB 9RUBA 5KT6A 3H7HB 2OEMA 2HGMA 1NDPA 1NSKL 1NK6A 1NDKA 4OJ1A 4TU8A 5H9FK 5K14B 5HROA 2GV1A 2MB0B 4DV5F 1RXOB 3MR6A 1X4CA 4FS1A 5F0WA 2I0XA 4GC6A 2BA9A 1IM4A 5H9FJ 3WZ0A 2J0XA 4U6PA 2HHQA 2FJWA 5KFHA 2LEAA 1MMDA 3PO5A 2NQPA 4PPDA 4DR6J 2V8DA 4BDPA 2KG0A 1GMVA 5EWGA 1UVLA 4DR7J 3G82B 2BANA 4JV5F 4ZPCA 2LQJA 3T5KA 3NCQA 3DLLQ 2Z57B 4ICLA 1RU2A 3CJ0A 1H98A 2IIHA 5B0EA 1PBUA 4EBEA 3DN9A 3N9UC 3WBZA 4ZVSB 3FBFA 2OTJS 3M4XA 4N7TA 3KNAA 1T02A 1BY9A 2LVWA 5JXSA 3MM8B 2ACYA 3I31A 4K8RA 2EBGA 2B0GA 1R89A 2IDEA 3LPYA 4MYUA 2ADCA 1RKJA 2RU3A 3MEGA 2ZJQQ 4FPRA 2MQOA 4JI7J 2CQPA 2ZH3A 1DTQB 2IRYA 2KRRA 3UFCX 4IQMA 4NX9A 3E8OA 2JEJA 1RHKB 5KFBA 3O1LA 1L3KA 1N0UA 2MZSA 3W63A 1N54B 2GCFA 4W4MA 1B0VA 4WYWA 1VJQA 3DKDA 2DB1A 5JVHQ 1VQKS 3OTCA 3PG9A 3NGUA 2CJQA 3I5BA 1KRPA 2F7VA 3PR4A 5GADU 1UVKA 2XLKA 2VBXA 4Y2CA 1XQIA 2BYCA 2VQFJ 4DV7F 1F3VA 3C16A 3M2VA 4OMFG 5BJRA 1BE4A 3VF0B 3TAPA 1RSCA 2X51A 4KTQA 4FF1A 3R5BA 3KG4A 2Q6BA 2FVCA 4F67A 4FNHA 3H25A 1WC6A 2JOQA 2U2FA 1DAXA 4ED2A 4EZ6A 5A0YA 2OKQA 1TL3A 3AXKA 4DCPB 1S1TA 3IFEA 1VQ6S 4MFBA 3ZZYA 4Y2AA 2AJ4A 2KZMA 1NEEA 3G96A 1NAQA 4LFCF 4I7FB 5DG7A 2DVIA 1EKSA 1H0HB 1OJ4A 3TUIC 1N33F 5DDQC 2M2BA 1GFWB 4H54A 3M8RA 1X4HA 3N4WA 1HD0A 1YZ7A 1GMWD 4ITSA 3OT9A 3QRRA 1JXVA 2VH7A 3HSZA 1M1GA 4O3RA 2JHEA 4X4OA 1DFDA 1ZM2A 2FY8A 1HWIA 1GMUA 2CQGA 3OTBA 4WFYA 3ENWA 2HWIA 3OTOJ 5AT1B 3UCGA 4H4MB 1QM9A 5HLFB 2X7IA 2DY1A 4J9OA 4CH1A 4CQ1A 3OUYA 4ECSA 1QAYA 1RAEB 1FXLA 3W60A 1NO8A 1B99A 4ANDA 1HBUA 5LOQA 4L74A 4DPOA 4U7UD 2HHXA 1S1XA 2ZM6F 4D3GA 1FRKA 3GIJA 5EN1A 1FE4A 3OD2A 3NRBA 3F44A 1DBDA 3KUGA 1C1CA 4DR1J 3MOZA 2VASA 1U1KA 5DGAA 2NS1B 4OZNA 2JNJA 4Q8FA 1NK8A 3IBFB 4K2JA 5AXMA 2DYAA 2F9JA 1XMQJ 1SUQB 2NCKL 1UW9A 2X1FA 1KWMA 3KJNB 2Y1RI 2OHDA 3W9HA 2NR0A 2VPZB 3TJAA 4ZN3A 1RWXB 3MFHA 2VICA 2L3MA 2XS2A 1H2TZ 1OY8A 2FJVA 5C42A 1TFWA 3LQVA 4CLWA 1VQ9S 4BBYA 4ZHRB 1G6BA 3BQ1A 4WTOB 3Q23A 1P27B 2EFPA 1KNZA 4H4KA 3MM9B 4KO0A 4P73A 1RE1B 1N36J 5D4LA 2CG4A 3C2PA 1RAJA 3IXQA 3EUNA 2BJEA 2QSFA 2M0GB 2Y8WA 2VB6A 3U1LA 2I38A 2LQ5A 4URGA 5HO4A 4RPFA 2VC1A 2RAQA 3B8HA 2YXLA 1SC4B 1WC0A 2XC9A 1SKUB 4A8QA 5C2GA 5T14A 2RF2B 4J9UE 4F2RA 1KDNA 2FIUA 2YTCA 4RUBA 4LBPA 1QLNA 5LXRA 1BQXA 2ZBRA 3K17A 3PW7A 5GMEA 2RQKA 2ZJRQ 5K20B 3PYFA 4FNIA 4ETZA 2GHVC 4NA2A 1PO6A 3JQMA 5AE1A 1PGZA 1S79A 4I0WA 2E7XA 1KBRA 2FHJA 3MF5A 2XI3A 3RR7A 3QMQA 1LW0B 1J5EF 3GG1A 2YKAA 4X4SA 1REVA 2V8PA 2ZITA 4O3NA 1S1WB 3DLEA 4PZVA 3DU6A 5KOXA 1TQLA 2EWHA 1XC9A 1HNWF 4XK8C 2FJXA 2ZWOA 4HR2A 2JLFA 1BQNB 1M5OC 1JLCA 4OI1A 2V9KA 4JYAF 2EVZA 3M1VA 1QE1B 2IBKA 3TQEA 3D68A 4PRFA 3AB4B 2HRTA 1T94A 3IG1B 4WZQA 1AZSA 2P8IA 2J76E 3N5FA 1U0HA 1KKHA 2BBEA 4DR2J 1S59A 2YWKA 3NG8A 3CB4A 2UUCJ 3J81j 2L9NA 2OPSB 3BH6B 4WIQA 1Q8IA 3NLCA 4P52A 4UQTA 2LKZA 3PIOQ 1TFYA 2J9CA 1UMJA 1RK8A 2DCLA 4OV6A 1HW8A 3KJVB 4MIAA 5DS7A 2J6SA 4LF6J 2DKOB 1RAIB 4M8LA 4DEZA 2Y1IA 2UXCJ 4C8ZA 4FXVA 1RKIA 3MD3A 2BJDA 1RTDB 4QIGA 2Z2MA 2DIUA 3VAFA 2MPUA 1Q81T 5J2PB 2C2OB 2LQ8A 3CF5Q 2Z4PA 3W65A 3LGNA 3W8GA 2QLWA 1T8EA 3IRWP 3MAAA 2HNYA 4UUWA 1YWXA 3M7VA 2IMWP 3KKFA 4NEYA 3NMRA 2EXUA 4NLRA 5IS2A 2DEIA 4AUKA 2CJ9A 1PYSB 4RW7B 3M8PA 3TVKA 5HMWA 1GT8A 2PFFB 2WZ1A 1FNXH 3QT7A 2YQ1A 3TYTA 3ZZTA 1O5JA 4DQRA 4LSLA 3MR7A 3T3FA 4NLWA 1IBKJ 1DLOA 4WE1A 4KQZA 2AD9A 3E01B 1RAGB 1Q0NA 1PIEA 3LTOA 4QWCA 1IJEB 1FVSA 1WSVA 4B08A 1KSPA 4GRSA 2OP5A 4I2PA 1RT2B 2CRLA 1XTZA 2NPIA 1XR7A 2V2VA 2AIRB 1IR0A 2VA2A 2R7QA 4ZP8A 2IDLA 2BXJA 4USIA 1ZAVA 1H7XA 3HHLC 3HI9A 4M5KA 4QW9A 4B02A 4DG1B 2AZ1A 3IR6B 4IR1A 3TZYA 1Q5VA 1H2UX 3DLHA 2YNGB 2CNKB 5HMXA 3HT3A 5A6WA 1IBLF 2J6TA 3CJQA 3DOMB 5L9NA 3AOCA 1FVQA 3PDNA 4IH6A 2MKIA 3CJ8A 3OSPA 4QIWD 2HHUA 3PKMA 4HI2A 3ZTRA 1SC6A 3GR1A 1FWLA 1R8AA 3C3LA 1VRUA 3FMBA 5KT5A 5ETQA 3FKBA 2P9EA 1RT1A 5FIIA 2EKNA 5C24B 2HKEA 4X84A 4JI8J 3EE3A 3NWRA 3KK3A 3MEEB 3KLFA 1T0TV 4YDXA 4NLXA 4KAIA 1NK7A 3SCJE 1L3VA 1AXQA 3QO9B 1S6QA 3JAMU 2ROEA 1UPMB 4R25A 4DV0F 3TJ8A 1U1PA 4K4WA 3MECB 3DHXA 4OYXA 5KFEA 1R0BG 1S72S 1YIJS 1VHIA 4QR1A 4N47A 3AFGA 3BGLA 5JJBA 4WU3A 1SL0A 2C42A 3M9OB 2R7VA 4X2BA 5DRKA 2ZKUA 3T1HJ 2FY1A 2PFDA 4LBIA 1FK9A 5AE2A 3NCPA 2B6AB 1LWFB 4F02A 1HR0J 1QVGR 3W2VA 3AODA 2HFUA 2AYMA 3VZHA 1WOOA 1NLKL 3HKZD 2F4FA 2NUUG 1NPRA 4ZIWA 2X1GA 2Q66A 2BABA 1FKOA 5HP1B 1R43A 3K5OA 4EYIB 2ZD1B 1L3SA 2YX7A 5IWAF 3H59A 4C4WA 2O3DA 1CC8A 1LWCA 3CCJS 2I2YA 4KGMA 3GYGA 4A8SA 2OMOA 4DX6A 1C2PA 4RNOA 4DZ6A 5LMUF 3SSQA 2OIHA 1D3WA 1RBAA 1UFLA 2GX8A 3TAQA 1RB0A 1KR4A 1N5SA 3AJ2A 2W2QP 4Y65A 3NXZA 5F9NA 1LOUA 2CNLB 1VFJA 1FDAA 4PAAA 2HNZA 3D28A 1XMBA 4L75A 3FQLA 3LP2A 3MAQA 5DJBA 3G8TA 5F41A 3UDEA 1KP6A 2XS5A 1RTHA 2OLWA 7AT1B 2ZJPQ 4NE9C 4ED6A 4RW8A 3HSJA 3BSNA 4LRCA 2V9WA 4ZK7M 2YPZA 3RTVA 4G6VB 2XLIA 3C46A 4JP8A 5A76A 3W61A 1HKAA 2RHQB 5KFGA 1Q4RA 4LVNP 2WSFC 3VALA 1WC3A 3BGRA 2DH9A 3GE9A 2FLOA 1TL7B 2RKIA 4N77A 4PYAA 1JKHA 4K5RA 3OHBA 3QFWA 2WBRA 4KGKA 3K8VA 5KG5A 5BYQA 2CPIA 3ZTQA 3EVOA 1NJXA 3L95X 2RDJA 3IWNC 4C3KA 4RWWA 2UU9F 1UPPA 3PW2A 2DCUB 3BH7B 3NNHA 4RUCA 2HFZA 3C15A 2HQDA 2C1EB 3DM2A 1LK7A 2HYIB 2KT5A 2DGVA 3CULA 3GLJA 3R7SB 2GNKA 4JB8B 2QFJA 5J1NA 2CPJA 3C14B 5GAEU 3JSMA 2NUHA 2W4DA 4LR9A 1T11A 3NS5A 2FGCA 1WG5A 3DLGB 1WF2A 3BGFA 2CZ4A 1CJTB 2IY5B 4ER8A 3AAWB 3M30A 4AL6A 2LA4A 2HVIA 1ZAWA 3CO9A 2LLZA 2GA7A 2CDQA 3AB2B 4UOGA 2H5EA 2YWEA 1X31C 1WG4A 1ICEB 1WC4A 2SXLA 1YX2A 2DTJA 4RW4A 1YI2S 2QYGA 5A8WB 2RQ4A 2BE2A 3IAM9 4N5SA 3SV4A 4ELTA 3ULHA 4NMXA 3A1YG 3RAQA 1JLFB 5AE3A 1V9OA 2CQ3A 3K8WA 3Q2SC 1K8AT 1XERA 3I6PA 2CQ2A 2XSJA 2C2DA 4A8FA 1E6YB 5K8NA 1AFIA 2MJUA 4KFBA 2FHMA 3TA2A 1SI9A 4KV8A 2OPRB 2XMTA 4LF8J 4O44B 4DOZA 4J9SA 1Q8BA 5F8NA 1KLMB 1HBNB 1Y9OA 3FFIA 3P49B 3LF0A 4U67Q 1RLCL 2CAJA 3O5TB 1BWEA 2Z2ZA 1EETB 2FC9A 2GIFA 4HT7A 3VV2B 2XLJA 2F3JA 3IRXB 3CCLS 1RCXB 3W8PA 4WFBQ 4C7QA 5JVGQ 1NCLA 2BKNA 1ACMB 2MQMA 3CCWA 2W4CA 2OELA 2E7VA 3QZ8A 2BRLA 3PEHA 2QG9B 2BOAA 2MTLA 1PC5A 2XBPA 2HBZB 1RT5B 3PV8A 3MUMP 2IAJB 1KLNA 3BR8A 2DRBA 5U47A 4DL5A 5EWEA 1DQAA 4ILMA 2XWXA 2HGLA 1N52B 5EWFA 4DFPA 1YZ6A 2ZH2A 1N56A 4JUZA 2XY5A 1MMLA 3MM6A 3M32B 2R2TA 4I4BA 2EK1A 2L08A 2RS2A 4C0HA 3SI8A 3TW0A 1J5OA 1RT3A 1HNIB 1SC3B 2E66A 3D5MA 1LFPA 1KQGB 3CCUS 2D9PA 4TKTA 2XZTB 3W1YC 2A10A 2ZH6A 4X62F 2R8HA 4KGVB 5G0RB 2VPYB 1DTQA 1X60A 3NS7B 1NM2A 2HURA 4TXSA 2QO3A 1WOSA 3OTDA 5F8MA 2APOA 4V19X 3LGHA 3UD3P 3K89A 2OTLS 4LF2A 3BR9A 3PXGa 2W7OA 2L48A 3C66A 4MT1A 4J9VA 1BLUA 4AT1B 5D0RA 3V5RA 3DRPB 4PG7A 2DHGA 1Q86T 1C1BA 3LANA 2CQ4A 2UUAF 3T6BA 3VZIA 4ETXA 2QV6A 4GVLA 2VG6B 2UVRA 1QUVA 2RJZA 1R0AB 1WDDA 3HM9A 4M5IA 5IT0A 2ZUGA 4R8UB 1VHFA 3IM8A 1FWKA 2Z8QA 4HVZA 2EI5A 3UN2A 3GJQB 3THPA 3FVYA 3VHQA 2C3UA 3HSGA 2HZVA 2JEGA 4OYWA 1KVKA 4Z7CA 2HRYA 2HAIA 2DGUA 2YWWA 1R27B 1LNQA 2HBQB 1LWEB 4ECZA 4K59A 1RAFB 2JFDA 2HVZA 4LUBA 4HACB 3GYXB 5L8RC 3UDCA 1RJJA 4DR7F 1FJCA 2HHPA 3R5AA 1VJWA 2Y0BB 2YKNA 1VQLS 1IKWA 3HMJG 4G1PA 4E98A 1EP4B 4DFKA 2Z30B 3ZNJ1 3WIVA 3ZZPA 3UCUP 4EGLA 1BGXT 5DZ6A 4PUOA 4AL5A 1RHUB 5F8JA 2H4YB 1G4CA 1K73T 1WKLA 1NPKA 2AWZA 3DOKA 3SZ2A 2P2CB 4H4MA 4TY8B 5HLFA 5BXIA 4QWBA 2MZ1A 6FD1A 3JB9k 3HZEA 3ET6B 1HNVB 3UNGC 1U48A 3GP9A 1MNEA 1LQ9A 2YKMA 4NI2A 4JI7F 1NSQA 3RR8A 4DL0C 4NYPA 5G4DA 3EJMA 3CE8A 3QJJA 5E5NA 4HTJA 2W2OP 2HQIA 3D2WA 1SKWA 3PTWA 1RYRA 2V2QA 1R8BA 2HMIA 1REGX 1RQ0A 3OQ2A 4CI0B 5HROB 5I4MA 3LA0A 5LL6d 1GXTA 4X4NA 1JB0C 5J2NA 5H1SV 1YJVA 1X9SA 2VF3A 3LWMA 3NGDA 3QZ7A 4NCGB 4RU2A 2BZ2A 3G4SS 4G3IA 4R5PB 1QD1A 2QA1A 2VQFF 1FNMA 2BANB 2XNQA 4YY3J 5DM7Q 1U45A 2E1AA 1ULRA 3O8WA 3CDBA 4LIWA 4E8UA 3M8SA 3F73A 2DHHA 1K47A 4USWA 1WEZA 4YR2A 4QPTA 4K0KJ 4ICLB 1U8SA 1M90T 3I0SA 3EDRB 3RAXA 1DURA 4B3RJ 5HVFA 2J9DE 3IA0A 1V6HA 2Y1JA 4ELUA 2JVRA 2RUGA 3I87A 1V3SA 4W92B 3W3SA 5LJ5Y 1UKUA 2I6WA 2BVZA 5DG9A 4NLTA 3V2UC 2I9SA 3ITHA 1JLAA 4QU7A 3NAHA 2CPFA 2AYBA 5KFJA 2COLA 1NHVA 4JV0A 4DPTA 2XMKA 4F7VA 3CXCR 4NASA 3GG0A 2W8LA 3MEGB 1Q1KA 4ZVQB 4ZOSA 3W2WB 3RRKA 1TZ0A 2HIYA 3D0GE 2FLLA 3EWGA 5E33A 2WOMB 1T9VA 3J7ZT 1U7LA 4P10A 2YNHB 3H5SA 2YNFA 2DNLA 3VWSA 1U09A 2CZVC 1FCAA 3HD2A 4J9RA 3EGZA 2QA2A 2B9XA 3QWUA 3CDWA 3PO4A 5KFRA 1YJWS 2QLBB 4OQJA 1TK8A 3NGTA 1X4FA 3C16B 3M2VB 1KQKA 3SCIE 3KK1B 1S1WA 4GO7X 2AT1B 3O44A 3K7RA 2F65A 4DR1F 1P8GA 3G6XA 1SH3A 1VDHA 3C6TA 2FVPA 4IYQA 4YHHF 1ZOTA 4KH0B 1FXRA 3NMAA 3W5XA 5LMNJ 5DQGA 3SEOA 1XMQF 1U8WA 5A0YB 4KBIA 2RD5C 2VG5A 2H3EB 1TL3B 2IVFB 4DSJA 4A8OA 1S1TB 3H2LA 4URSA 4ZVOB 3HFZB 2DBBA 4MFBB 5KFWA 4RZRA 4X65J 4LRFA 2LEPA 4DQQA 2AX1A 1TK0A 5I3UA 5CD4A 3H90A 3QWPA 3TVZA 4DX7A 5B0BA 3KLIA 1HARA 4N8OA 4NZ6A 3SMZA 2HFOA 1U6FA 3KJVA 2G2YA 1FRXA 4X4QA 4ES3A 4DN0A 2K8GA 2YQ3A 4NLSA 2XB2D 2ZEJA 3V6HA 3MAHA 4ZN1A 2NXNA 4GVBA 5J2PA 2V6AA 3HHLB 1PJ6A 2J0WA 2N3LA 4TU9A 3OUYB 5C7PA 2QMWA 3RW7A 1HBUB 2CPXA 2CKWA 3CD7A 3F41A 1FWPA 4AQYJ 1S1XB 1TL5A 1TKTA 4UUXA 1C1CB 5D77A 4NZ7A 4EBDA 2G4BA 2X1AA 3QGPA 1WG1A 2CVIA 4OLPA 3BBFA 4X4PA 3GTYX 1YBTA 3FQKA 2I1RA 2NZCA 4OYIA 1UZDA 3M6WA 3HVAA 2BJ3A 5IQ6A 2HQ3A 2EW9A 2DR5A 1YDLA 3L3CA 2DNRA 2J7UA 1S9EB 3K2YA 3E01A 1IKVA 1KFSA 4HYKA 2WBMA 5F8GA 1AB8A 3Q2TC 4F0KA 4OZ2A 3EICA 3KJFB 2KZZA 2DJWA 5CD4H 2XZWA 3DLKB 4FZVA 2AYGA 3K5LA 1ZS6A 2V0NA 1GXUA 5E2QA 1UFKA 4MMOA 1TL1A 3H40A 4DUYJ 3MEKA 4MK9A 2C3YA 1XBWA 1CJUA 3M8WA 3ZXWA 3PR5B 2YNGA 4EYHB 4QYZK 2FJAB 2OI2A 2W2MP 4KO0B 5LSLA 1CJVB 3BGOP 4P7TA 3EYZA 4PWWA 3P6YC 6FDRA 3DGVA 2BQRA 3HX9A 3S1TA 4QYZJ 2B4OA 4J5OA 5KT2A 2UUCF 4AXJA 1N88A 1B0PA 2A2DA 4NLDA 1N5VA 3ETOA 2H9ZA 4DBQA 2DGXA 2QX0A 4XPCA 3QSIA 1IVZA 1F5BA 3WX4A 2R42A 1NDCA 2YY3A 4CDIA 4YQWA 2RH3A 2JDJA 1WI8A 2G1HA 1H72C 4IOBA 3UWTA 2B4VA 4CO4A 1S6PB 3KWMA 1HHQA 1U2CA 2RHSB 2UUWA 2K7KA 1D9AA 4C6AA 2XY6A 5BYSA 5I3QA 3EPGA 1UVMA 1YRXA 3A4TA 3V6KA 2DO0A 3CD0A 2K1RB 1UWBA 3DXSX 2R2UA 4ECXA 2FZKB 1NKEA 4OJGA 2AGQA 1XNQJ 4B9UA 3DLEB 2ATCB 2M88A 2HRUA 1SC1B 1KQSR 5GMKa 2F4VJ 2B9WA 3SQGA 5KAKA 1S57A 3O6QA 4LF9F 1JLCB 1GTEA 2KYZA 4CLFA 3M1VB 2FQQB 2MYFA 3A3PB 3VGTA 3NOCA 4K4VA 1QAIA 5CZVA 5EGYA 2KT3A 3QIDA 1AZSB 5GAGU 1MMNA 4DR5J 5DDRC 5F9LA 1U0HB 2BW2A 3F56A 2ZH9A 2M5YA 4LVOP 1NK5A 4QWEA 1JIHA 2MSSA 1VIXA 1TAQA 2AYEA 2IRUA 3PJWA 2D41A 4IDKA 4BC9A 4FYVB 3M2RA 2W2NP 1R7IA 4DZDA 3PRBA 1TMMA 4DR3F 2BW7A 3J7Z5 3KMSA 2V34A 1HWKA 4G65A 4ED1A 4NLGA 1JLEA 4GKJJ 3HZGA 4IG0A 5B08A 2GIRA 2XO7A 4Y6IA 4NPOA 3MCSA 3NGRA 4LRAA 2QSWA 4B3MJ 2UV8A 4DF8A 2FHOB 1X0FA 4IOCQ 4C8KA 2MKJA 4B9MA 4RW6A 4CYUA 2W9CB 4CLSA 3OTEA 2IM1A 2HNYB 2JFKA 2YVSA 3M9MB 3Q22A 3P4UB 4PCQA 1VRTA 1SJ4P 4JI8F 3OJUA 1D8ZA 4UF4A 4DV3F 4NLQA 3M8PB 5KFMA 1S0NA 2V4JA 1YTYA 5L1JA 4OX8A 1SB6A 3G71S 4USJC 4OIXA 4LSLB 4PQUA 2NYIA 2H65B 1DLOB 1DRZA 4DPXA 2HW3A 3H98A 3DDNA 4K4TA 4LF7F 4URQU 4NCAA 3J81U 1FA0A 4ED8A 3CUNA 1JK9B 2POKA 3A8IA 2CIMA 3U7JA 4L3NA 1TL4A 3NS6A 4CO0A 3T1HF 4PG8A 4M5GA 4A47A 1VBZA 4C2MA 3V81A 3BBCA 4ZVGA 3PJ9A 2M4MA 2RNEA 2VOOA 1BWVA 4C0OC 3GCWP 1Q7LB 1JLQA 3H2UB 4WXOA 2PEBA 2OAUA 2RE1A 1I1GA 2C3PA 3LGMA 7FDRA 3CC4S 2MKYA 3IC1A 5GAGI 2M8HA 2IMOA 5A2QY 1P6TA 2CJXB 4QR0A 3PJXA 3CC2S 1MWQA 5KG1A 3BEGB 3Q8QB 2W7PA 5EHHA 4KJIA 3MPVA 1SJ3P 2LYVA 3FSYA 1RT4B 2PDAA 4M95A 1RT1B 3PEJA 3KDOA 4OI3A 4QU6A 2VD3A 2DGWA 2ZOFA 3KK3B 2KHCA 3SSRA 3SQOP 4U7CA 4MKVA 3FRYA 1XMOF 3KLFB 4OHVA 4FBTA 3D9BA 2XS7A 3OXLA 2VUGA 4Z7YA 1PSDA 2FGOA 1R0CB 1V5IB 1S6QB 4K5SA 3KG1A 3QATA 4OYPA 3DGPB 5IV3A 2M3DA 5A8WA 3KTQA 1VCTA 1U49A 1DJ0A 3OXFA 3MCOA 1IKXA 2HG4A 3PRVA 1R3NA 4NYOA 4I6AA 4WBFA 3R97A 4Q43A 1FDBA 2XMMA 3T1YJ 3ZTSA 4F50A 4NXNJ 2C2KB 3RUBL 4LF4J 4F4YA 3EXYA 5GAHU 4USUA 3QPIA 1FK9B 1NSPA 4DWIA 1K44A 5H9EK 3W2VB 5C25A 4DN9A 1LKZA 1X5OA 2MQQA 4P6QA 1RWUA 4FVCA 1R8PA 3M05A 5ETOA 5H9EJ 2EPIA 1OQ3A 5B0FA 2AV5A 1D1UA 3CMAS 2HVEA 1FKOB 2EFNA 1ITPA 2VBZA 5IOLA 3RGIA 4MH8A 2NREA 2ZZMA 1UL3A 2MMYA 3I4PA 4QBUA 4DJBA 4NLVA 1X8DA 1PJ5A 4JI5J 2AJQA 1RWMB 2DR6A 1ZM4A 3BSCA 1LWCB 1NRKA 3KHGA 1FXDA 2V4RA 2VPWB 2XNRA 1TTHB 1VOMA 2ZUAA 2IYGA 4Y2KA 4X4TA 2VFTA 2W1BA 3Q83A 4DCOB 1UFWA 1YSJA 1U1MA 4QQBA 2ZH8A 4JV5J 2QE5A 3KLEA 2BACA 3OBIA 3SDEA 2ROPA 1Y4ZB 3US5A 2Z0GA 1TKXA 3ZZZA 2LDIA 4IRKA 4C97A 2HNZB 2GQQA 1M5VC 4DQPA 5KT3A 3RW6A 1HPZA 2XI2A 1YKWA 3LP2B 2AEJA 3K0JA 1FFGB 2CQ1A 4ZLPA 5CYQA 3SCLE 1RTHB 2OD6A 1NU4A 4RJVA 1YRUA 5IT9U 1GK8A 4YUDA 1HNIA 3L7PA 4RW8B 2DNHA 2HIQA 3D66A 4DHVA 4I1TA 4J9QA 1IBMF 2HWHA 2FVSA 1N0VC 3BGRB 3SYZA 2RKIB 1VQSA 5I3PA 4AFFA 1JMTA 2Q3PA 1CJKA 1JKHB 4J9LA 1X4GA 4NLPA 3KHHA 2ZBCA 2F8MA 4WFAQ 1JX4A 3DRPA 1HBOA 1T3NA 4DL6A 2XM3A 1OYEA 4EI2A 4JI6J 5GAHI 1KFDA 2RMLA 3D6MB 1D9FA 4EBCA 2E1RA 3LAKA 2P6SA 4C8YA 4B9VA 2Y0SD 3DM2B 4F3MA 1DZ5A 4DV7J 4USVA 4LF8F 1A6LA 4LQ9A 3SIPB 3GV7B 1A9NB 3DOLA 2DR8A 3JSMB 5J2QB 1ZA1B 3IMQJ 2MKSA 4BLGA 2J9DA 1TUVA 2XWYA 2CXEA 1NZ8A 1HW9A 5HJYA 2G2OA 4ZITA 4C0BA 2DHAA 3WHIA 1XR5A 1RABB 3M30B 1NZAA 3OFGA 2M8DB 1DQ8A 3UI3A 2HNDA 1OS5A 4XTTA 3H5YA 2F9DA 2CDRB 5KFPA 4DS5A 2MQLA 1GEHA 1IWGA 2V2KA 3DHWC 2CPDA 2LU1A 1FJ7A 4LFCJ 1EHWA 1S77D 2WW4A 2ERRA 1MN7A 3L7OA 1EP4A 1N33J 4UW2A 1GQEA 2IYIA 2XYPB 1VQMS 2YH1A 4CLPA 3R2CJ 4HHUA 3G6YA 4DV2F 2PT0A 3FZBA 4RW4B 4CH7A 4NXMJ 8ATCB 1XNRF 4LFBJ 3A8KA 2VOPA 2JL9A 2ALYB 1C0UA 2NXUA 1H7WA 2JZ5A 5LM7E 1RT6A 2BE2B 3CSKA 3W9IA 1ZZFA 2Q79A 3RBZA 2MQNA 4DU8A 4DSEA 2UVUA 3RRGA 1AUSL 1CPZA 4ZKAA 2UVWA 4JI1F 3HPOA 1S1VA 2VFUA 1IWAA 3P5TL 1HNVA 5IZHA 2R4FA 1Q8LA 2XSJB 2VHGA 3R9LA 4KFBB 3OPKA 2OUGA 4HEA9 2ZM6J 1BD6A 4KV8B 1E6VA 4NMLA 1VQPS 1BMQB 3HFKA 3FFIB 2FVRA 1RBOB 2AGOA 2HPUA 2V50A 4ZJOA 2DPJA 3I0RB 1GH8A 3PW5A 3IBCB 3TRGA 1HHSA 1RWOB 5FLXU 3EGWB 3SFUA 2RQCA 4ALZA 1EJ7L 4FXWA 5DETA 1IQZA 1JNRB 5THWA 2NXJA 2KFNA 3BSAA 3IWXA 2Q1LA 4NCGA 2HZCA 4O0IA 1X7VA 3ILOA 5FDLA 4IRDA 4IFYB 4R5PA 1FTRA 2HK3A 4L76A 1O6XA 1EKRA 3NKYA 1VC5A 2PE8A 3KHLA 2G0JA 3MD1A 4ED0A 3T9ZA 2KI2A 4OV1A 1X4DA 3HK2A 2Z2YB 3OL8A 5CAAA 3PYEA 2PA8D 3MM6B 4Q44A 4KIAA 1GNKA 1O51A 2N82B 4JI3F 1J5OB 1RT3B 3ZNUA 1R8CA 4K4YA 2YX1A 5HQ8A 1SJFA 1VLOA 1G3OA 3BGUA 3CD5A 1RAHB 2RRAA 1QSYA 3W2WA 4LQ3A 1F5CA 1FHTA 2GC8A 3MR2A 4UZCA 3U27A 5ETKA 3GIRA 3TX0A 2WOMA 3THVA 5D4NA 3OR2A 4PXEA 5T7LA 4J9PA 1VRQC 2CPYA 3JQKA 2YNHA 3FBEA 2OO4A 9ATCB 3A12A 4RU9A 5I42B 3B4MA 1C1BB 5A6PA 1PYTA 3LAMA 1U1OA 1S1UB 3QYYA 3JXOA 3HT0A 1Q8KA 3A3NB 4X64J 1HIYA 1U25A 3JYTA 3N0VA 1J5EJ 3CNQP 3KK1A 2XG8A 2DR9A 3GFYA 5CQGA 5HANA 2N4DA 2HFSA 3ZZRA 4FP9A 3JTNA 2QMXA 3JSYA 1Y5IB 1F6TA 3BN7A 3FBBA 4XDDA 1S7IA 3HLUA 4YB1P 3MPYA 4U96A 4ZCLA 1VQ7S 1LWXA 2XQCA 5AXKA 2A1BA 1FDDA 2VBWA 3Q24A 1UVJA 3B6BA 2AJ1A 4PWDA 1NUEA 2RT3A 2L41A 1F5AA 3KNGA 4PXCA 2MLYA 2Y3YA 3HVTA 3NBPA 4DXLA 4KB7A 4MYTA 4Y0FA 5L38A 2LA6A 2CQIA 5IC6B 2A18A 2J6UA 1FF2A 4DR4F 2YKNB 1IKWB 3U02A 4IR9A 1T03A 4ZPBA 3I9V9 4M5MA 3BKUA 4PUOB 4Z2XA 4B3RF 1WHVA 1URNA 2E9RX 1U6ZA 4B3TF 5L39A 2DIVA 3DOKB 3GPAA 4MKBA 1RDRA 3HHLA 1KVJA 3POTB 3PYGA 3ENAA 1D8YA 1ZBTA 1FRHA 5B0GA 3AD8C 5DDPC 4DSFA 4CTAA 2DT9A 3MM5B 2GVDA 2HHSA 3CVKA 1RT7B 1XWLA 4HKQA 4F8RA 3I4HX 2MQ8A 4NLOA 2BUNA 4ZA1A 2ZE2A 3WIUA 2YKMB 4NI2B 5F3TA 3PHTA 2DRAA 2HS0A 3RG6A 1Q53A 1WWHA 4RUHA 4MKYA 3I5CA 1NK4A 2HMIB 4WP3A 2VG7A 1WACA 2XZDB 2MDAA 1S9EA 1KEKA 4USKA 5J2NB 2VFSA 2CQHA 1N5QA 4KY3A 1WUUA 3MHYA 2ILZA 2MY7A 5GADI 4DV4J 2BRKA 3V6DA 3TEHB 1FKAF 3DLKA 3DLJA 4JV2A 2YQ0A 1L3UA 4B9LA 3UPFA 4YN3B 2F63A 5E3RA 1NSAA 2RDIA 4C8MA 4LSZB 1ZAXA 1JXLA 3TWZA 3I0SB 3W64A 2QFIA 1N48A 1HQ2A 1ZM3A 3KLGA 2F1FA 5CCLA 4HDHA 3FC9A 1WHWA 3CPWR 1IBLJ 1OMSA 1CJVA 2LMIA 1JJCB 3UD4P 2Q6CA 5IQQA 4PKDB 5HMZA 3G9CA 3K59A 5HVGA 4X65F 3ITHB 3LP0A 4IUFA 1JLAB 3ICLA 3KMQA 1HQEA 4C48A 4HT5A 2E5GA 4BCAA 4QPXA 4KT0C 4PG6A 4XO0A 1M1HA 3IWLA 2CFXA 4MJKA 3Q8YA 2ACMA 3CDUA 2M52A 3QNWB 3HFVA 2CPHA 1VBKA 5HI7A 4DV1J 2MHEA 3PACA 2FVQA 3EXCX 4YB5A 3AHPA 1QJHA 1SV5A 1S6PA 2KJWA 3D3CJ 2YNFB 3UQSA 3Q8SB 2C22A 2B4PA 2DXDA 1NBEB 1VQ8S 4KE5A 1H6KX 3I96A 2H1YA 3MZIA 1DY3A 5LT5A 2K1RA 5J2MA 5A8KA 3TUZC 2AF6A 5D3GA 3D0HE 4M63A 4BHQA 1GX5A 2ROGA 2LQ9A 2GAGC 2O66A 2ZNYA 3BPSP 4CIOA 2RVJA 1D0EA 2PIIA 3MEDA 1RBLA 3C6TB 2Z2LA 3MXHP 1JWWA 2B9YA 4P74A 1SBRA 4OYZA 4BWJA 2XMWA 1HI1A 5KFXA 3ZZUA 3DDIA 3J7A1 4ECYA 2AZ3A 4TY9A 2VG5B 8AT1B 2IVMA 2B8QA 3PKYA 1OQ6A 3K5PA 3G8SA 3MDFA 2RRNA 3BO3A 3GYNA 1YLXA 1FTCA 5E3AA 3R3TA 5AJ3J 5LSOA 1LEOA 3QJLA 2GZOA 1UCNA 5IWAJ 3EDQB 5I3UB 1ZM9A 4AYBD 3KLIB 4DUYF 2DNQA 3HHDA 4ZPTR 2MGZA 1FI4A 3MR5A 2D69A 4ECQA 5KFSA 1RISA 1TKDA 1Z2LA 2JC1A 1NB7A 2XHWA 4GVBB 4PR6A 3FK4A 4L72B 3D1OA 1U26A 5SZTA 2DH8A 2W9CA 2HQCA 5F8IA 4CH0S 1KC8T 3W5ZA 3K58A 4Q45A 4WKRA 3AT1B 4UOCA 5D78A 2OSRA 4NA1A 2PD1A 1D09B 1WKKA 3N01A 2L9DA 1NB2A 4ZP7A 1TKTB 3MTJA 2YBVA 4NOHA 4K4XA 2HVDA 1FJEB 3TX8A 1VI7A 1HA1A 3AOBA 2AQ4A 1VLYA 2VFRA 1TUGB 4J9NA 1VC6A 2JLEA 1IKVB 4DLEA 4YEAA 4IH5A 4IOAQ 3OW2R 2P6TA 3MURP 1MWZA 4ID8A 1Q7YT 4WCEQ 1MU2B 4WTYA 4LBHA 4ENOA 1PBAA 3NAIA 1JJ4A 4WXWA 1QTNB 2XGQA 3DRXA 4ECWA 3BO4A 1XNQF 2GJIA 1TL1B 4QYRA 1KOOA 2ASDA 3TA0A 3HULA 1RAOA 2XMVA 1CJUB 4LJMA 2ASYA 1Q78A 1QVFR 2ZVSA 3QSYB 2ZHOA 2YKQA 4WK1A 4YB7A 4R0EA 4RR5A 3LH2S 4ELVA 2HHWA 2DGOA 1WHXA 3UE2A 1IN0A 2E1PA 4TN2A 2CJBA 3CC7S 4RNMA 4HI1A 4AD6A 2UXDJ 3H5UA 2KXFA 1RT4A 3T5HA 1VQYA 2LCWA 5M2RA 2FC8A 1FRLA 1X4EA 2WVDA 3EGVA 5E0OA 3L7UA 3SSSA 5KFOA 3CJTA 2IA6A 2HEKA 4P75A 3KLHA 1FFWB 2GGPA 4J37A 2QLXA 2QC3A 1OY6A 3DGPA 1AFJA 4B3MF 1P1LA 1CULA 2X3DA 3MWBA 3WDOA 4DX8H 4OX9F 3I32A 1W26A 5B0AA 5HMYA 2X1BA 8RUCA 2R3VA 3OSNA 1QTMA 4PQAA 5M2PA 4WP8A 2MZTA 3FCHA 5E3QA 1UWBB 3G86A 2GQ2A 4CLUA 3J80Y 1DQ9A 2PI5A 3CJSA 2J7WA 3QAUA 4I69A 3P45B 2QIFA 3GSDA 4P2FA 3BKTA 1ZTTA 1SXLA 4G1QA 4FKYA 1H73A 3SQGB 5C5JA 1V3RA 4ZPVR 4ZCIA 1EARA 2ZDOA 4USTA 3PM9A 2EFGA 2VZ9A 1ZH5A 3ISND 4KC5A 3TOQA 4TU7A 4C8NA 4JI0J 2KG1A 1HI0P 1RHRB 1MN9A 3G87A 4O3OA 1I5OB 1U2RA 3DRSB 2M9KA 3KFWX 4C9DA 2QT7A 3CCMS 4JI4F 4CZCA 2XMJA 1RUSA 5KFZA 3FSIA 1RTIA 4JI2F 4IDKB 4GMKA 4TLQA 5E3CA 1HWLA 3FCWA 3M2RB 4EUVA 1SVDA 2OFGX 1R6YA 2A0FB 1JLEB 3IBWA 4IG0B 3M8YA 3IGNA 1SQGA 2CVEA 2E5IA 3ETMA 2W01A 1A0OB 4ZCKA 4JV1A 4L73A 2EFOA 1UTAA 4CYUB 2MSTA 4RW6B 2ZFHA 2VDIA 1HWUA 1UVNA 4DUZJ 3C8YA 2PMZD 3GIKA 4DCJB 1VRTB 4KKOB 3QT6A 1Z1ZA 1R8HA 3ILJA 4MK7A 3UR0A 2D74B 4V1Ak 1IR2A 2V4JB 1QAXA 2WCXA 1NJIT 2C2RA 2JJ4D 1U2FA 5IV4A 1RZMA 1FJGF 4KGXB 1UW4A 2GVZA 4FS2A 4AXIA 4PQUB 1NXIA 2CPEA 2RUSA 3CW2C 1WEYA 4ZLJA 2CNOB 1Z2ZA 4IFVA 1N32F 1RWPB 2ILYA 2NXEA 2DGQA 2B9EA 4ILLA 3T1YF 1YHQS 5D8HB 2ZZNA 5DZ7A 2HFNA 4LF4F 1YG0A 3E2EA 4ED5A 3BPDA 2DR7A 1VK8A 1IXKA 1RP5A 4ZMMA 3V81B 4LF5F 3OFFA 2KRBA 2BX6A 2QMUB 1FO1A 5DGBA 4F0HA 3R2DJ 1JLQB 3C19A 3MMAA 4QIEA 4FVMA 2MZQA 2H51B 5K9FA 4B3OA 2HSEB 5J2QA 4CO5A 1OWXA 2YKOA 1MG7A 4XAKA 4ZP9A 2A2CA 4OZ1A 2B51A 3N6NA 4A46A 3LPEA 1HMVB 1H38A 1SH0A 2GQCA 3B78A 4JI5F 3D7SB 4NWBA 2ZBIA 2HS4A 3EMTA 3ELHA 2W9BA 5E41A 1L3TA 2HBRB 3UNYA 1UA0A 2KVQE 3CJ2A 1SJRA 1AA1B 1HNZJ 1HL6A 3T9NA 4WZMA 1BQMA 2WSCC 2BQUA 1HYSB 1TR0A 4B17A 4KSEB 1PC4A 4PEOA 4IO9Q 2VQEF 5BR8J 4P71A 4YDDB 4KHPJ 1OPIA 2EC2A 1Y5LB 1DTTA 4OJHA 1FKPA 1IKXB 4TNOA 3HHNB 4MAKA 1VR6A 5LJ3Y 4LR8A 3PHEA 1YRTA 3CO0P 1YJRA 5JMNA 3R8YA 3P5BP 3UDLA 1HHTP 5IC4B 1M5KC 3JSRA 1N6QA 4ZLNA 5C25B 3PFOA 4EFAC 4G1IA 2H54B 4XDCA 5KTQA 1DHMA 1RTZA 2V8HA 5FD1A 1KQFB 4KH1B 4A4JA 3BZQA 4ES1A 4C3LA 2XCPA 3WX8A 4CO2A 3TVYA 3PW4A 5GVQA 1UETA 5KFIA 2QL5B 3I0RA 1O0PA 1UEUA 4N8NA 2HS3A 3E51A 5ETPA 1NJZA 4I67A 4RW9A 1JLBA 1YGYA 4JI6F 2XTJP 2RB7A 1LFWA 2MY8A 1OY9A 4M94A 2KKHA 1TP7A 4I56A 2WAQD 4CNZA 4IFYA 2KJVA 2OSQA 4OX6A 4ED7A 1P9QC 1UA1A 1WI6A 3R5GA 4WP9A 3D6FB 4DDFA 3GWCA 3J80U 4ZVEA 5K8OA 4WJBA 1WC5A 2FDNA 3CJ4A 4P72A 3LO3A 5GAEI 3KLEB 3D0IE 3SDEB 1TKXB 5CXTA 4K2XA 3QRPA 4PYDA 3MCMA 1HPZB 2CWXA 3MMBB 4C8LA 4F25A 2Z56B 2OEJA 1UJ4A 5CYQB 3OL6A 2E7WA 3RB6A 3H2VE 2IFXA 4ILRA 3A3OB 1VGYA 2FJEB 1M5PC 2E9ZA 4LIRA 4K50A 1WF0A 2VIHA 5KG0A 1S9FA 3IS9A 2AEFA 1LV5A 2O67A 3AJ1A 3I56S 3GONA 2C2EA 1EZZB 3OLBA 3BQ2A 3TP2A 3Q8VA 3GR0A 4O3PA 3QGGA 1XIQA 1EQ0A 5K5MA 3GMGA 3CCSS 4NXMF 2KVIA 3NGSA 4LFBF 1CJKB 3MMJA 5CZXA 3R7BB 1T9TA 1P1TA 2FB0A 4OZ0A 5KOWA 4O3QA 4EK2A 2R8JA 1SCJB 1HBOB 5I42A 3DDKA 1WTFA 1XEZA 6AT1B 4MIBA 1Y7PA 1YBAA 1S1UA 4UZBA 2LDYA 3QJPA 2KM8C 4Q8EA 5B0CA 1HD1A 1C4CA 5F8HA 1LK5A 1U47A 3HF5A 3A8EA 2WTFA 2N7YA 3OVSA 3SXLA 3H5XA 2MXYA 3KDNA 1KTVA 3DOLB 4RBVA 4YHHJ 1DARA 5CCMA 4X66J 3J7AN 1TUWA 5E7OB 3MM7A 4KYZA 2KHDA 5AXLA 2H5IB 2HNDB 4OYMA 2GMHA 1HLWA 4DR6F 1X4BA 1FNOA 3S01A 2DGSA 4U7UK 2PEHA 3N28A 1SL2A 3KK2B 3R6GB 5DG8A 4CLZA 2WONA 3JAMY 2OH2A 3HVRA 4GKKJ 1C0UB 4RL1A 1TKZA 1JXEA 4YS2A 1RT6B 3EZUA 3MR3A 2V63A 3R5CA 3H4BA 3ZTPA 4KRWA 1MLAA 3W7BA 1X5TA 1MW7A 3S8SA 2B43A 3POTA 3PFEA 2R7WA 2BMBA 3D54A 3HHEA 3FDSA 4MIWA 1S1VB 4E0DA 4NYZA 1HI8A 3MM5A 3VQSA 1RT7A 3QRQA 4P2SA 4DFMA 3CIMA 3M2UA 1KHVA 2K2PA 4HLBA 1ELOA 4I68A 5EDWA 2AHOB 3GZ7A 3M6VA 1T7PA 2CJAA 1IR1A 2Y8YA 4CO1A 4O4GA 2PI4A 4UY8T 1ZA2B 2IC3A 1MROA 1E6VB 3CJKA 2IPOB 3RZAA 4DSKA 2IM3A 2Z58B 4ZVHA 2KN4A 3KLVA 2NZ4A 3HCXA 4OHXA 4OHWA 5DDOC 2XCAA 5KFYA 5SUHA 3UCZP 1SL1A 1X9MA 1C0TB 3DFEA 1SQFA 5FDLB 2VA3A 4X64F 2CYYA 3QIPA 4FBUA 2HWTA 1ROFA 5F0UA 5KG2A 1F3FA 1B4SA 4ID5A 1U1LA 2FPHX 3UO0A 1LXNA 3VAJA 3THTA 3MCNA 4RKUC 1EAYC 4B9NA 1I94J 2R7TA 3V6JA 2FJDB 1SIZA 2F8EX 1U1NA 1HQUA 3MMCA 2BM0A 2GJFA 4HHJA 2V8VA 1TELA 3D3BJ 1U1RA 3TI0A 4F4AA 2QZ8A 3J7YU 4HHHA 3DCAA 1ZPWX 1CBKA 1ZPVA 1RTJB 2GS8A 4I2QA 5HBMB 4OYOA 4I6WA 5KG4A 1I51B 1X9WA 5CYMA 4KHMA 2R7UA 1WEXA 2G0CA 1FRJA 2QL9B 2V5HG 3BB5A 1S6UA 4RNFA 1HFEL 3OR2B 5T7LB 3KUEA 3OTOF 1CS4B 3NEKA 3L9ZA 3TANA 3BQ0A 1D9DA 2DK2A 2M7SA 4NLYA 1F9FA 5L1IA 3HJFA 2NYHA 4RWXA 2V94A 4LSNA 4CWBA 5J1EA 1B7FA 1PJ7A 2MLXA 2D1CA 2B5JA 1HWJA 1VC0A 1KVIA 2DH7A 3HHLD 3JYTB 4CLLA 2AW0A 4YP3A 2UV8G 3DMJA 4IG3A 2R7RA 1EB0A 3Q8PB 1U24A 2O5DA 5CYJA 3K5NA 1N8RT 1HBMB 2VBYA 2BM1A 2EG1A 2VDHA 2DGTA 2E5HA 2YPYA 5D0EA 1U4BA 1S99A 1RA7A 4ZJQA 4J90A 3TEGA 4LF9J 7FD1A 2JRSA 1W2IA 5D4OA 2W7AA 3LW5C 5KFQA 2BJ1A 1UZHA 2JEFA 4Q2MA 4PWDB 4DV4F 4NA3A 3GQCA 1WSRA 2GJ2A 3NBPB 1NDLA 3HVTB 3VAHA 2XMAA 1TV6A 1JNZB 2QN6B 2CQBA 4USMA 1GTHA 4CLKA 4S0MA 2ZZTA 3NP5A 1T03B 5IM0B 4RX6A 1V5VA 2DNYA 4FYYB 2CWKA 4PWUA 5ADZA 4U95A 2AJ0A 4EZ9A 2QRRA 4DR3J 4WPAA 4N76A 1R6VA 4QWAA 3TUJC 1FEHA 1ZETA 1N36F 1F60B 1TAUA 1FESA 2CJYB 3J7YI 1QSLA 3CCTA 3V4MA 2JEIA 4BWMA 3PZPA 4Q7AA 3BS9A 4FYXB 2HQFA 4CTAB 3I9ZA 2GVDB 3DYAA 2FD2A 2NXCA 3DC2A 2MEWA 1S10A 2ZE2B 1I6JA 1VMBA 4U8VA 2MKCA 1SH2A 2UUBJ 2H48B 4O0NA 2XULA 4DV3J 2YWHA 3CCRS 2BJ8A 4PXDA 3QT5A 4DV1F 2FHKA 3U1NA 2AKWB 2VG7B 5A8RA 2HHVA 4EWTA 3QLHA 4Q0BB 5HQMA 1UWAA 5KFVA 2E1CA 1U0SA 4K4UA 4F3OA 1S9GA 4DX5A 2RU9A 3T41A 4LF7J 2QA4G 2OMLA 1MU2A 3V6DB 1LW2A 2BE7D 3OR1A 1XN9A 2GAHC 1S6OA 3DRRA 4NRUA 5B7WA 4WYLA 2FHJD 1OSCA 3BBBA 2VFVA 4H4KC 4TQRA 3EZ5A 4M5DA 4W98A 3R5DA 2EC0A 2O1PA 2QGFB 3KLGB 2V2ZA 5BYRA 2ZH4A 1FRIA 4I6YA 2P5VA 3NY0A 2GIQA 2EBEA 1HNXJ 4HH0A 5AJ3F 4DR2F 3LP0B 4IRCA 3T1AA 1M5HA 1HQEB 4ANCA 1YVFA 1N34J 1BXNA 3KYLA 1UP1A 2EKYA 4OL8A 1W2BR 4OJ3A 3EM1A 1W25A 4UY85 1NH7A 2RDDA 1F2HA 4B9SA 3AQOA 3D6TB 4B3SJ 3M8QA 2YWFA 3H4DA 2E44A 4LF6F 1XMOJ 3SV3A 2ZHAA 4RO0A 2UXCF 3TNVA 3NL0A 1SJ1A 1SV5B 1AUDA 3PCOB 3S6EA 2LEBA 2K7JA 5D15A 1T05A 2OPPA 1QSSA 5HN0A 3G8QA 2GO9A 1Q16B 5J2MB 5A8KB 3QGIA 1N5YA 4KPCA 2VC0A 5D3GB 4FDFA 2HAFA 3MI7X 1S12A 4P9SA 4USHA 2VPXB 3W62A 3MGJA 3R1HA 2OJ3A 3QT8A 2MQPA 3MEDB 5MLCV 2CG8A 1WHYA 3R6LB 4QW8A 1M5SA 3UW1A 1URRA 2XHCA 3D67A 2BQ3A 1TVRA 3CEDA 3GJTB 2YNIA 3BM7A 2R7XA 2HHHJ 3CD6S 1FX4A 1IBKF 2CNNB 1U1QA 2KXNB 2OEKA 4QJVA 2WVCA 1OSDA 4ED3A 2HK2A 4UT4A 3A8JA 3DRSA 4L6V3 2HBYB 3IP0A 2IA0A 4A8KA 3GFZA 4D3HA 4HDGA 2DHXA 1UJ5A 2H5JB 4ZVUB 3PRDA 3UVJA 1C4AA 3FEZA 4ZPDA 4F36A 2PN6A 1WNEA 2MGZB 4F4ZA 3C6UA 1AT1B 5HAOA 2MLZA 5CHCB 2HHTA 1WKJA 3ZO7A 1IJFB 3BKFA 2E5LJ 2HFVA 4Y2MA 2OPQA 2FLNA 2I5JA 3CT9A 4OI2A 4FPIA 3DI6A 3HP6A 4QIVA 2UXDF 2QJ3A 1J2VA 3HSDA 1NKCA 1F2GA 1RCOB 2UXBJ 4KKOA 2QEXS 3GILA 1AROP 4OYBA 4CNYA 3FGVA 4NCBA 2P9CA 2DNKA 2NSCA 4OYAA 1M0SA 1K1QA 2VKRA 5KFDA 1IBMJ 1PCAA 1Y3KA 3KOAA 1WJ9A 3G6VA 4ED4A 4M5JA 1FD2A 4Y00A 3HO1A 1XK8A 4LFAJ 4DV6J 4O4RA 4LF1A 4DLGA 4IKAA 5KFFA 3BN4A 2QLFB 3B82A 2BJ7A 3FEYB 1Y00A 4OLOA 5ETTA 5L9XA 2ZOMA 1JLGA 5HATA 1HR0F 1CVJA 3IM9A 2C2NA 2XEXA 2MHNA 4H4OA 2WW8A 4RUAA 3TO8A 3RYLA 1IKYA 1T95A 1OIAA 2MKHA 4C11B 1NK9A 4JI0F 3W66A 5KT7A 1VQNS 3N6LA 3RRHA 5K14A 3LWLA 5DQHA 3OJSA 1HMVA 1T9UA 5HQLA 1SKSA 3R5JB 3OVAA 3ONQA 2WHOA 1OO0B 1FDNA 1NNDA 3A13A 1SJQA 3IR7B 2DPIA 1IM6A 4DI6A 1X4AA 2VV5A 4JOUA 2DRDA 2D3OR 2N4CA 2LXFA 4P2MA 4XIUA 2WK4A 3G82A 2UP1A 1O8BA 3CJRA 3KLHB 1HYSA 4X4RA 2GGPB 4OHZA 3FSXA 2PGCA 5L1LA 2A3JA 2DITA 5CA5A 1S0VA 4DV2J 1CULB 3TZWA 4EU0A 4PG5A 1XNRJ 1YITS 5GMDA 4DUZF 3WQPA 3LALA 1SQEA 3AOAA 2DO4A 1QUPA 4CLTA 4F4WA 4RBUA 3AQPA 3OV7A 2CQCA 2OD4A 2IJNA 3CCES 3MM8A 4JI1J 4Y28C 4YOEA 5CH7B 4N56A 1RYSA 3RBXA 2IHR1 5F3ZA 1PG5B 3LP1B 4DPYA 4KR0B 4G1QB 2ADBA 2G9OA 3NOGA 1RHJB 2B3TB 4OI6A 2ASJA 2BDPA 2V67A 3V4IB 2M70A 3MPDA 1Y11A 2F40A 2JC0A 2RILA 3ENQA 2R8KA 2JX2A 5IXUA 2WSEC 4FF2A 3KXDA 4ECUA 3E3XA 3IR5B 4DV5J 3UR3C 4RBTA 1RHQB 4EO8A 4Y3CA 3P8BB 4CRJA 3SBMA 5IFMA 3KUHA 1RTIB 3JTPA 4M1KA 5KT4A 3ISZA 4PABA 4RLEA 2LECA 2AJ2A 4ECVA 1IBCB 2HLTA 3O2IA 3UN3A 4P7VA 4YMEA 4A8YA 3BDEA 1AYEA 4A48A 3OL9A 2C3OA 2YWGA 2ASLA 2KFYA 1PAEX 2E9TA 3TAMB 2J7KA 3SFGA 2V69A 2KM8B 2IJFA 1FX2A 2D7SA 3WC0A 3MMBA 4UQGA 2PSZA 3CTRA 1ZZNA 4IO1A 2QLJB 1CQMA 3TA1A 3Q0AA 1S76D 5KFLA 3N6MA 4A8MP 4DL7A 4MTPA 1WDTA 1XR6A 2DXEA 1Y3JA 4JI3J 3GB0A 2GO8A 4I7FA 2RIJA 1K9MT 3S7RA 3W9JA 4F0MA 1HNZF 4RNHA 2FLPA 3HXMA 2DNPA 3GFHA 4QR2A 1BHNA 2IRXA 4EMDA 3DXBA 5ETSA 2GVZB 2G2ZA 1X5SA 3QAEA 3PW0A 2C2MB 5BR8F 4TLRA 4KHPF 3CGIA 3VGVA 2C2ZB 2DNMA 3F0NA 4IFVB 4F4KA 3EPIA 1NH8A 5EX3A 3PX4A 4DU7A 3GIIA 4DFJA 1G1XA 3CMQA 3GSIA 5KG7A 1RI7A 3ZC4A 1VQ5S 2LP4A 3TR5A 3MMAB 2V4QA 3GJRB 5ETRA 1PILA 1YJUA 4ECRA 2V68A 1IUJA 4B3OB 2DNGA 4WKYA 2OGUA 1RAAB 2ABYA 1EQMA 5ETLA 2R8GA 1K0TA 2GW8A 5KFCA 3T19A 3FEXB 2A6MA 4QWDA 2KXHA 1SUQA 3X3UA 1G7CB 4DPWA 3CIZA 4A8WA 1X5PA 3O3LA 2AX0A 3MFIA 2W9BB 1GMWA 2EG2A 2MJNA 3BF4A 3QBCA 3OFHA 5KG3A 1U02A 4UOFA 5DLGA 1TMJA 3H0PA 5JUMA 1JJ2R 1FE0A 3EVMA 4FYWB 1BQMB 4DR4J 2CA9A 3KK2A 1SIWB 3BDPA 2IVYA 3ADAC 5HK4A 4ZHRA 5DQIA 1RWNB 1DTTB 4EO6A 3GV5B 5D0GA 4B3TJ 4ZIVA 1FKPB 5A2QU 2VKZG 4MK8A 3MM9A 2KU7A 1UEKA 2DHSA 2J8AA 3FJ2A 1K1SA 2IBOA 4LR7A 3VVUA 4O3SA 4FF3A 1VIOA 4UOHA 4WWSA 3AD9C 2ZHBA 1N6QB 2B7BB 2R9LA 3GCXP 3N5BA 3PYDA 2RF2A 3B54A 2ZBQA 2ZC3A 1RACB 3FUYA 5DLFA 4Y34A 2LXIA 4WFZA 4ZVTB 3R27A 2BV3A 3GFXA 4GC7A 2EEYA 1KONA 4DPUA 4CT8A 2ZDPA 4RW9B 1JLBB 4OZLA 2BOPA 5KG6A 2D3UA 2R7SA 4K7QA 2CADA 1C0TA 4WFNQ 2CQDA 1LW0A 4FF4A 3JTOA 1WF1A 4ZPWR 4LREA 3H20A 1AW0A 3MUVP 1NHUA 4TYAA 2N7CA 1A7GE 1QDUB 5HVHA 4ZLLA 2AU0A 1YJTA 4DQIA 1UAWA 4X66F 2KT2A 1BQNA 3VVTA 2V8GA 1Y5NB 1VBYA 2CJKA 2WVEA 2GHWA 1QE1A 1P9YA 2LQBA 3UN5A 2EFQA 3IG1A 4LT6A 2PMHA 2L9WA 1NJWA 1QAJA 1B0TA 3NCRA 5C2CA 2QTWA 3L09A 3Q8UA 1RTJA 5HBMA 1J27A 5DO2A 1APSA 3VGUA 3RB4A 3IS9B 2OPSA 1CQNA 1S5ZA 3FBCA 3AJDA 3RB3A 3CCZA 1KOHA 3GV8B 2VJVA 3Q8RB 2W4PA 3AA8A 4HH1A 1RWVB 4DUTA 2R8IA 4OZJA 4YR3A 2OFHX 4GKKF 2G1DA 1B7YB 1CS4A 3CJ3A 1S49A 3NGKA 1OYDA 2LU2A 1RTDA 2GHPA 3K57A 3I5AA 2J9EA 3J81Y 2BKOA 1XJWB 2PO4A 4BC7A 1JJHA 5L46A 4NEZA 2VL1A 4CT9A 3AD7C 3IN5A 1ZTWA 3P3DA 2J0SD 2WB4A 3EX7B 4RW7A 1N4LA 1HBMA 2YH0A 1HNWJ 3DNCA 2E5JA 2UUTA 3OVBA 4QCLA 1K0VA 4ZS6A 4W90B 2AP6A 4JYAJ 3MM7B 3CMES 1B64A 4QIFA 3EGNA 1WTBA 1YJ9S 3AXMA 5KFUA 4DSIA 1BUXA 4DF4A 3VQTA 1RT2A 2W2PP 1IQTA 1RWWB 4YY3F 4N41A 3EZOA 3JS9A 3R1LA 5IM0A 1UJ6A 4K0KF 5C42B 2ZVIA 4FKXA 1TK5A 4OZ5A 3KHRA 5ETVA 1I94F 2WONB 1F0XA 3BSOA 1Q82T 4DG1A 2IM2A 4K4SA 3IGVA 2JVOA 1S4EA 3W5YA 1TKZB 3M9NB 1NKBA 4P2XA 4KGZB 5ETMA 3DOMA 3AA9A 3EVWA 1S7HA 1Z4UA 2C3MA 3D1QA 3UDVA 2NSBA 2ZC4A 4LRBA 1MWYA 4NLUA 1EX8A 2VODA 1KS2A 1RADB 3M2UB 1GAOA 2CZ9A 3U1MA 4TQSA 2W9AA 4DL4A 1FFSB 2KYXA 2Y9HA 4E2FB 3OL7A 5C24A 4J91A 2XMUA 3T5LA 4O4GB 4K4ZA 2IC3B 3MEEA 1MROB 4OZ3A 3CJKB 3CJ5A 1FT8A 1S0OA 4ECTA 3FRZA 3T5JA 1T9XA 5LSRA 3QGHA 2K3IA 4Q0BA 3QO9A 2P9GA 3G6ES 3RAMA 1CLFA 1I3OB 1KHWA 4ES2A 4F3QA 4HL9A 3MECA 4J9MA 3HVWA 3UD5A 2MZRA 4CO3A 3NWGA 2GFFA 5D4PA 2WB1D 2XYGB 5T41A 2F5GA 1KD1T 1REVB 2EK6A 3QIPB 3Q89A 5LXYA 4ID5B 1ZYQA 2B6AA 1LWFA 2WVBA 5D6GA 1YJNS 4U9RA 2W8KA 5LMNF 1HQUB 3MMCB 4CM2A 3NNAA 1VS3A 3ZFVA 3TZZA 5K8MA 2ZWPA 2J5AA 5M2UA 2ZH1A 4I64A 2B56A 1R31A 2UZAA 2KFZA 4NL5A 1FERA 5HP1A 3ZTOA 4EEYA 1SKRA 1B70B 1Q79A 1KN6A 1NK0A 4LMZA 2ZD1A 5EUHA 3DLBA 5IT9Y 4I2QB 4QOTA 1YK9A 2CQ0A 4M5NA 5CYMB 3PIPQ 1NPPA 2J8SA 2PA3A 3QFHA 2DD8S 3NNCA 3CDEA 2G0IA 4X4VA 3RB0A 3QQCD 2QYCA 1RA6A 2R7OA 1L5UA 1WORA 2AJFE 2U1AA 4DV0J 2DNNA 3AH6A 1N5TA 1F9HA 1Q5YA 1YJ7A 4OX9J 1FRMA 2MKKA 4LSNB 5D0HA 5J1EB 2YX4A 2B5JB 1KTQA 3MAAB 4R0JA 4AQYF 5KFKA 3PX0A 4PG4A 2HGNA 3DMJB 4IG3B 3SCKE 3TJ9A 5CABA 2W25A 4DQSA 2UUBF 2Y1LB 3LUYA 3JSBA 2RS8A 2AGPA 3T6JA 1W7WA 1F1BB 4OX7A 3VTIA 3IAS9 2G13A 2ZH7A 1TL7A 3VGSA 4WE1B 1NJYA 2B8PA 2FZCB 4M5HA 1S4FA 1B3TA 4PPZA 3HKWA 4Q5VA 1Q95G 4KPYA 1TV6B 2I8EA 2FYXA 4JI4J 4I2PB 1FD8A 3CCQS 1G2EA 1CG2A 4ZP6A 2DISA 1H3DA 1WC1A 2D3ZA 3FZ2A 1FEEA 4JI2J 3RBDA 2BR0A 2H4WB 4GO5X 5LMUJ 3M8ZA 4DSLA 1T9YA 2RQMA 4F2SA 1CC7A 2E1MC 2R2RA 4ZDNA 2X3GA 1GX6A 3DRYA 4WU2A 2K06A 3MPUB 3C14A 4MKAA 1HNXF 5DM6Q 2N3OA 2R2SA 2JWNA 1H74A 3D6HB 3DLGA 2WRMA 1CJTA 2XO6A 5FJ4A 3DYAB 1VQOS 3TQ1A 1N34F 5HL7Q 4OI0A 3FNNA 3N79A 4OFZA 3M6UA 3AY0A 1VRUB 3OXGA 1PKUA 3RJMB 4B3SF 3KG0A 2PMWA 3LOUA 4ERDA 4WIIA 3IO1A 2DXFA 1UVIA 3D4JA 4Y2IA 4L3KA 4OHYA 2HVHA 3BYRA 4ZCMA 3MPWA 5A8RB 1FJGJ 4CCHA 1YBUA 2XYHB 3QLHB 3GU0A 4JBCA 2HLUA 1PYOB 1WD6A 4V19J 3MUTP 3VR1A 1BC6A 1CEZA 1S9GB 1F9EB 3Q86A 5FLXY 4F4XA 2FUG9 4O23A 2K3KA 2XSFA 1SPBP 1N32J 4ANEA 1LW2B 4C98A 3VCDA 3OR1B 3HDSA 1EIYB 4CLYA 3DRRB 4X4UA 2CPZA 2AMCB 2KO1A 3WC2A 5KFTA 4AL7A 3P96A 4HTIA 1JLFA 2B7CB 3BREA 3PVXA 2UU9J 2BE9B 2PC6A 4LF5J 1E6YA 5J1PA 2F4VF 3BYPA 3KJQB 4XPEA 4B9TA 2IJRA 4M5DB 5K8PA 2J0QD 4DL3A 2HHHF 4YR0A 3DU5A 2OPRA 3VAMA 4O44A 3M6XA 1RU1A 1KLMA 4C11A 2JLGA 1HBNA 2O01C 2KL8A 1YQHA 2C28A 1X0PA 4IH7A 2XY7A 4DR5F 4RNNA 1S0MA 4DS4A 3I55S 1EETA 4NRTA 3CWJA 1RWKB 2Q43A 3IRXA 1U6BA 3K5MA 2KH9A 2NPFA 1NMEB 2WVFA 5F8LA 2QA4S 2YKPA 4YB6A 2D9OA 3M8QB 1S48A 5KFAA 4LRDA 2ATLA 5B0DA 4GKJF 1RT5A 1VK3A 3CCVS 2IAJA 4DMZA 2ZBPA 3TZXA 2RSQA 2E5LF 4ZVFA 4BS2A 1OPZA 3ILLA 4FYDA 1H2VZ 1RHMB 1T05B 2GMJA 4U8YA 2VQEJ 4FN5A 2BJ9A 2OPPB 4ZVPB 1WOPA 3JQJA 2QL7B 5B09A 2UXBF 3H8YA 3M32A 1S97A 1N5YB 5HJXA 2EFVA 4QZVB 4CM0A 3MOJB 1TU0B 3B4DA 2MZJA 2BKPA 4TVAB 4ZJLA 2D3O1 2KDOA 3R7NB 3LP1A 2AEMA 3RU0A 3G2XA 2LXUA 1TVRB 2YNIB 1LXJA 5G0RA 3CDAA 4ATNA 2KB2A 3OFEA 3V4IA 2DEJA 3HHKA 1JQGA 5KFNA 3PX6A 1VQ4S 4LFAF 4DV6F 2FTRA 3BV8A 5EX0A 1RGVA 5ITHA 3I82A 1T9WA 5L1KA 3VAKA 4UTGA 2FZGB 1NHKL 2LFVA 4TYBA 3HD1A 5RUBA 1PAUB 1CSJA 3UVJB 3TUPA 2RRBA 2VG6A 3PY8A 2FJBB 2A6OA 1Y0HA 1R0AA 1T3OA 3C15B 4R8UA 5AXNA 3C6UB 4WF9Q 1UEVA 3ENVA 4C3MA 3TAMA 2E29A 2OPQB 4C8OA 3GJSB 1MSWD 2I5JB 2JH3A 3OHAA 3DI6B 3ISNC 2B4UA
chains in the Genus database with same CATH topology
4DL0C 2ZKTA 5MLCV 2ALZA 1WHYA 4QW8A 1LWEA 1M5SA 4NYPA 1URRA 3UW1A 2BQ3A 3UD4P 2UVVA 2Q6CA 5IQQA 5G4DA 1TVRA 4F26A 4PKDB 5HMZA 3G9CA 3CEDA 3CE8A 3K59A 4FXDA 2YNIA 3BM7A 3QJJA 4WK3A 2R7XA 4X65F 3ITHB 3LP0A 4IUFA 1JLAB 3ICLA 5E5NA 4HTJA 4J9KA 3CD6S 3KMQA 1HQEA 1IBKF 4HT5A 2E5GA 3VAGA 1U1QA 2HQIA 3D2WA 1SKWA 1RYRA 4BCAA 4QPXA 1R8BA 2HMIA 4OI4A 4KT0C 4PG6A 5E3PA 2KXNB 1RQ0A 4QJVA 3OQ2A 4XO0A 4CI0B 5HROB 2GMLA 5I4MA 1OSDA 4ED3A 4A8XA 5LL6d 3IWLA 1GXTA 2CFXA 4X4NA 4ZPAA 4IQXA 1JB0C 1GXLA 4MJKA 3DRSA 3TARA 3CDUA 2M52A 5J2NA 4Q2LA 4L6V3 5H1SV 2W24A 1YJVA 3BO2A 2IA0A 3D1HA 4A8KA 2VONA 3GFZA 4D3HA 2CPHA 4AE5A 4HDGA 5HI7A 3ZZ0A 2DHXA 1UJ5A 1X9SA 5IT4A 1M1KT 2F8HA 3LWMA 3NGDA 1WELA 3PRDA 2MHEA 3QZ7A 3VAIA 3PACA 4NCGB 2FVQA 4RU2A 2BZ2A 3G4SS 2ZOGA 5MAOA 4G3IA 3EXCX 4YB5A 3AHPA 4R5PB 1QJHA 2QA1A 1SV5A 3FMWA 4NZ0A 1S6PA 1C4AA 2VQFF 3X1LB 3GIMA 1VBXA 1FNMA 2BANB 2KJWA 2XNQA 3FEZA 4ZPDA 5DM7Q 2YNFB 1U45A 2E1AA 1ULRA 3UQSA 3O8WA 3Q8SB 2C22A 3ZZOA 2PN6A 3CDBA 4LIWA 4E8UA 3M8SA 3F73A 2B4PA 2JSXA 1WEZA 1WNEA 2IM0A 4NXNF 2ZNZA 2MGZB 4YR2A 4QPTA 4ICLB 4F4ZA 1U8SA 1VQ8S 4TY8A 4KE5A 3C6UA 1H6KX 1M90T 3I0SA 2NLWA 3I96A 3MTKA 3RAXA 3PNIA 1DURA 5CHCB 2DNZA 2HHTA 3MZIA 5LT5A 2K1RA 5J2MA 2J9DE 5A8KA 3IA0A 1V6HA 1IJFB 1JLGB 3TUZC 2Y1JA 4ELUA 2AF6A 2JVRA 3RBEA 5D3GA 2ZH5A 3D0HE 4M63A 4Y2MA 2RUGA 1GX5A 2ROGA 2LQ9A 1V3ZA 3I87A 4BHQA 1V3SA 2OPQA 4W92B 3BJYA 3W3SA 4H4OB 5LJ5Y 2O66A 2ZNYA 2FLNA 4DL2A 2I5JA 2KTQA 4CIOA 1UKUA 3CT9A 4KHRA 4OI2A 2RVJA 3DI6A 4PXBA 2PIIA 3OLAA 2XGPA 1D0EA 3MEDA 3C6TB 3HP6A 2BVZA 4QIVA 2UXDF 2Z2LA 1QY7A 4WFXA 1J2VA 4Z37A 3MXHP 1JWWA 2B9YA 5DG9A 4NLTA 1SBRA 4YFUA 3V2UC 1NKCA 2DNOA 1F2GA 1IKYB 4BWJA 2I9SA 5KT6A 2XMWA 3ITHA 4KKOA 2QEXS 1JLAA 1HI1A 5KFXA 3NAHA 3ZZUA 4QU7A 3GILA 1AROP 2CPFA 2AYBA 2HGMA 4CNYA 5KFJA 3FGVA 4NCBA 3J7A1 2P9CA 1NK6A 4ECYA 2COLA 4OJ1A 4TU8A 2DNKA 2NSCA 1NHVA 4TY9A 4JV0A 5K14B 2VG5B 5HROA 1M0SA 2XMKA 3CXCR 2GV1A 2IVMA 2MB0B 3GG0A 2W8LA 3MEGB 3PKYA 1K1QA 1OQ6A 1Q1KA 3K5PA 4DV5F 3G8SA 3MR6A 3MDFA 2RRNA 1X4CA 2VKRA 3BO3A 5KFDA 3GYNA 4FS1A 4ZOSA 3W2WB 5F0WA 3RRKA 1TZ0A 2I0XA 4GC6A 1FTCA 3D0GE 5E3AA 3R3TA 2BA9A 1IM4A 5H9FJ 2FLLA 3WZ0A 1Y3KA 2J0XA 5E33A 4U6PA 2HHQA 2FJWA 5LSOA 5KFHA 2LEAA 3KOAA 2WOMB 1MMDA 3QJLA 3J7ZT 3G6VA 3PO5A 2NQPA 4PPDA 1U7LA 2V8DA 5I3UB 2YNHB 4BDPA 2KG0A 5EWGA 1FD2A 1UVLA 4Y00A 3HO1A 1XK8A 3H5SA 1ZM9A 4AYBD 2BANA 3KLIB 4DUYF 4JV5F 4ZPCA 2DNQA 2YNFA 2LQJA 3T5KA 3NCQA 3DLLQ 3HHDA 4O4RA 2DNLA 3VWSA 4ZPTR 1U09A 2MGZA 4DLGA 2CZVC 4ICLA 1FCAA 4J9RA 4IKAA 5KFFA 3EGZA 3BN4A 3MR5A 2QA2A 3CJ0A 2B9XA 3QWUA 4ECQA 5KFSA 1RISA 1H98A 3CDWA 1TKDA 3PO4A 5B0EA 4EBEA 3DN9A 3N9UC 5KFRA 3B82A 1Z2LA 3FEYB 1Y00A 2JC1A 4OLOA 3WBZA 2XHWA 1YJWS 1NB7A 4OQJA 1TK8A 5L9XA 2ZOMA 1JLGA 1HR0F 1CVJA 4PR6A 1X4FA 4L72B 3M2VB 3D1OA 1U26A 1KQKA 3SCIE 2OTJS 3M4XA 1S1WA 5SZTA 3KK1B 2XEXA 4GO7X 2MHNA 3KNAA 2DH8A 4H4OA 2W9CA 3O44A 3K7RA 5F8IA 4DR1F 1T02A 1P8GA 4CH0S 2WW8A 3G6XA 1SH3A 1BY9A 3C6TA 1KC8T 4IYQA 2LVWA 2FVPA 4RUAA 4YHHF 5JXSA 1ZOTA 3K58A 3MM8B 3TO8A 3RYLA 1IKYA 4Q45A 1FXRA 4WKRA 3NMAA 1T95A 1OIAA 4UOCA 5D78A 2ACYA 2OSRA 3I31A 4NA1A 2PD1A 2MKHA 4C11B 5DQGA 2EBGA 1NK9A 4JI0F 2B0GA 3SEOA 5KT7A 1XMQF 1VQNS 3N6LA 3N01A 2L9DA 4ZP7A 5A0YB 4KBIA 1TKTB 3MTJA 1R89A 2RD5C 3RRHA 5K14A 2VG5A 3LWLA 3LPYA 4MYUA 4NOHA 2ADCA 1RKJA 2RU3A 1TL3B 3MEGA 5DQHA 2ZJQQ 4K4XA 4FPRA 2MQOA 3OJSA 2IVFB 1HMVA 2CQPA 1SKSA 2ZH3A 4DSJA 3OVAA 4A8OA 1S1TB 3ONQA 3H2LA 1DTQB 4URSA 2WHOA 2IRYA 2DBBA 4MFBB 2KRRA 5KFWA 3UFCX 1FJEB 3TX8A 4RZRA 1OO0B 1VI7A 1FDNA 1HA1A 4IQMA 1NNDA 4NX9A 3E8OA 2AQ4A 2JEJA 2LEPA 1SJQA 1VLYA 3IR7B 4DQQA 2AX1A 2VFRA 4J9NA 1VC6A 2DPIA 5KFBA 3O1LA 1L3KA 1X4AA 2JLEA 2VV5A 1TK0A 1N0UA 2MZSA 1IKVB 4JOUA 2D3OR 4DLEA 5I3UA 2N4CA 4YEAA 2LXFA 1N54B 4IH5A 2GCFA 3QWPA 3TVZA 4IOAQ 1B0VA 3OW2R 5B0BA 4XIUA 2P6TA 4WYWA 3MURP 2WK4A 2UP1A 1O8BA 1MWZA 3KLIA 1HARA 2DB1A 4N8OA 5JVHQ 4NZ6A 4ID8A 3SMZA 1Q7YT 1VQKS 4WCEQ 2HFOA 1MU2B 3KLHB 1U6FA 1HYSA 4WTYA 3OTCA 4X4RA 2GGPB 4OHZA 3KJVA 3FSXA 2PGCA 1FRXA 4X4QA 2CJQA 5L1LA 4ES3A 2A3JA 2DITA 3NAIA 4DN0A 3I5BA 5CA5A 1S0VA 1KRPA 2F7VA 2K8GA 3PR4A 1JJ4A 4WXWA 5GADU 2YQ3A 4NLSA 2XB2D 1UVKA 2XLKA 2XGQA 3DRXA 3V6HA 4ECWA 4EU0A 2VBXA 3MAHA 4PG5A 4Y2CA 3BO4A 1XNQF 2GJIA 2BYCA 5J2PA 1TL1B 4QYRA 1YITS 1KOOA 2ASDA 4DUZF 3TA0A 4DV7F 3M2VA 4OMFG 3LALA 1SQEA 3HHLB 5BJRA 3VF0B 3TAPA 2X51A 4KTQA 2J0WA 2DO4A 1QUPA 2N3LA 4FF1A 2XMVA 4LJMA 4TU9A 4F4WA 2ASYA 1Q78A 1QVFR 4RBUA 3OUYB 2ZVSA 3AQPA 3OV7A 2CQCA 3R5BA 2OD4A 2QMWA 3KG4A 2IJNA 2Q6BA 3CCES 2FVCA 4F67A 4FNHA 3MM8A 3RW7A 3H25A 2ZHOA 2YKQA 1HBUB 4WK1A 4YB7A 4Y28C 2CPXA 2CKWA 4YOEA 4R0EA 3LH2S 4ELVA 3CD7A 2JOQA