5DDOC

Structural and dynamic basis for low affinity-high selectivity binding of l-glutamine by the gln-riboswitch
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords L-glutamine riboswitch (58-MER)
publication title Structural and Dynamic Basis for Low-Affinity, High-Selectivity Binding of L-Glutamine by the Glutamine Riboswitch.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 87
sequence length 87
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5ddoC00
2E44A 3MUTP 1WG4A 1X4GA 4WKRA 2CPEA 4EGLA 2MZJA 1F9FA 1VC6A 2MKJA 3VAHA 2MGZA 1VQOS 1WF2A 4CQ1A 2ERRA 4Y0FA 2AD9A 3UWTA 1N52B 2YH1A 5FJ4A 2JWNA 4C7QA 2MJNA 2DNRA 5D77A 2ZJPQ 2OSRA 4P6QA 1OO0B 2J8AA 1U6BA 2DNNA 3UCGA 2ZJRQ 4IOAQ 3MUVP 2LKZA 3LPYA 4FXWA 2K8GA 2DIVA 1FJCA 2LXIA 2VODA 4TLQA 3B4DA 3NNHA 3N9UC 2G0CA 4ED5A 4TU9A 1VQ5S 2KG0A 1M5KC 1P27B 2EVZA 3G96A 1KOOA 4PKDB 5DDRC 2MQPA 2MSTA 2LA4A 2X1FA 2KRBA 1VC0A 4YOEA 1VBZA 4F26A 2M0GB 2VONA 2DH9A 1SXLA 1FNXH 3Q2TC 4V19X 1S79A 1DBDA 3TYTA 2ADCA 2N7CA 3CCUS 2WBRA 1X4EA 3CCVS 1FJEB 2G4BA 1UFWA 4OZ0A 2M70A 2CQGA 2CQCA 2CQPA 2GO9A 3ZZYA 1U1NA 2OIHA 2E5IA 1YITS 3IRWP 3CTRA 2MB0B 2ADBA 2QEXS 1WI8A 2MQOA 1URNA 2CPZA 1BY9A 1VQ6S 5GAEU 3L3CA 1VQ7S 1KC8T 2QA4S 3MOJB 4WFBQ 5GADU 5ITHA 4TU8A 3NS5A 1FXLA 2OJ3A 1U1PA 2DITA 5H1SV 4BS2A 1DRZA 2XNRA 2RQ4A 2G1DA 4PRFA 3CC7S 2MSSA 4YUDA 2MY8A 2CQHA 1OPIA 2MKKA 1SJ4P 2CPXA 2HVZA 2L41A 3UCUP 3BEGB 2X1AA 2DK2A 2M8DB 1X5PA 2PE8A 2Q79A 4IOCQ 3CMAS 1VBXA 3CC2S 3VAJA 1YJWS 5EN1A 3UE2A 1D8ZA 2DGVA 2M52A 1JJ4A 2FPHX 5HL7Q 2RRBA 3U1LA 2F3JA 3S7RA 1X4BA 3NNCA 5JVGQ 1Q82T 2DHXA 5GAGU 2KXFA 2DGSA 2MZQA 3CCSS 1WF1A 3LQVA 3P3DA 2DIUA 1FJ7A 1HD1A 1X5OA 2D9PA 2DNLA 2CPYA 2N82B 3UCZP 2M7SA 1X0FA 2FC8A 3CCQS 4A8XA 2AYGA 5LXYA 2L9WA 3EGNA 4Z2XA 1AUDA 1UAWA 3BO2A 3MD3A 1ZH5A 1NJIT 3P5TL 1VQ8S 1WHVA 1K9MT 1U1LA 1YIJS 2M2BA 1HL6A 3HHNB 2CQIA 1M5VC 4LMZA 4IUFA 1WHXA 3NS6A 5DETA 1UP1A 2MKSA 3IWNC 2RNEA 3K0JA 1OWXA 3S8SA 2V94A 1H2UX 2LCWA 2LYVA 2JX2A 1HA1A 2MQNA 2MZTA 2KM8C 3SXLA 2MQQA 2L08A 2GHPA 1YJNS 2VOPA 3FEYB 1ZZNA 1H2TZ 2HGNA 3R27A 2DHGA 5IM0B 1U1OA 4F02A 3H2UB 2CPJA 3TO8A 1X4CA 1X5TA 3CUNA 1N88A 1X5SA 3EX7B 1SJ3P 2AYMA 1VQPS 2DNKA 5DDPC 4WFAQ 4IO9Q 4FXVA 1YI2S 2DHAA 2DO4A 1FO1A 2LA6A 2ZJQQ 4ERDA 1H2VZ 4CH0S 1HD0A 2YKAA 3NNAA 4TU7A 3CCRS 2MKHA 1VQLS 4ZKAA 1Q81T 2HGMA 4QU7A 2KXHA 1PGZA 3BO4A 5DDQC 2DHSA 2NZ4A 2MZ1A 2KH9A 1A7GE 4C0OC 1SJFA 4YB1P 2CPIA 1U2FA 1SJRA 1WTBA 2YWKA 1PO6A 2KRRA 2AYBA 2DNPA 2LEBA 2OTLS 3CF5Q 2FHOB 2DGTA 4LIRA 3SDEB 4M5DB 1VQKS 5LXRA 2MQMA 1RK8A 1U1KA 3G9CA 1XN9A 1NO8A 2M88A 3VALA 1N8RT 5MLCV 2CPHA 3THTA 3VF0B 2MYFA 1X4DA 2B0GA 1M5OC 2UP1A 3EGZA 2KYXA 5IM0A 2KT5A 2DNZA 3CCJS 3SMZA 3BO3A 2DNYA 4QQBA 5JVHQ 1FHTA 2RT3A 5IFMA 2AYEA 2XB2D 1JMTA 1WHWA 4Y00A 3S01A 1VC5A 2CQ4A 3UD3P 1FT8A 2JVOA 2VOOA 1O0PA 2CQ1A 3I55S 2JRSA 1VQMS 4W92B 3MXHP 1K8AT 3NMRA 3VAMA 2MY7A 2CQ0A 3DXBA 1H6KX 3CULA 1R8PA 2MHNA 2LECA 3CC4S 2XS7A 2J0SD 2DGWA 2KFYA 5DM6Q 2JVRA 3UD4P 3DLLQ 2DGUA 4RU2A 1L3KA 2DO0A 2KU7A 2N3LA 1KOHA 3G8SA 1NU4A 3VAKA 3P6YC 3RW6A 3ZZZA 2YH0A 2I2YA 2F9JA 1U6FA 4CH1A 2M8HA 3Q2SC 5LSOA 1YJ9S 1R8HA 1M5PC 3B4MA 3J7YU 3CPWR 2RVJA 1WI6A 2HYIB 2CPFA 1B7FA 3SDEA 4UY8T 2LQ5A 3P49B 1WEZA 3OW2R 2KVIA 2FC9A 2CPDA 3FEXB 3H2VE 3TP2A 2CQ2A 1VBYA 2RUGA 5DDOC 2N3OA 2MKIA 2EK6A 3MD1A 1WHYA 1QVGR 2RS2A 2CQDA 4WCEQ 2F9DA 2MZSA 3BS9A 3CMES 2NLWA 2LEAA 2KN4A 4WIIA 1WEXA 3CCLS 2OSQA 5LSLA 1U1MA 4J5OA 2KXNB 1Q86T 2DGQA 1D9AA 2LMIA 1QM9A 2DH8A 2KI2A 3PIPQ 2U2FA 2DB1A 2MMYA 1QVFR 5CYJA 3US5A 1N54B 1M1KT 2XS2A 1SJQA 2E5GA 2MZRA 5GAHU 2X1GA 1JJHA 1WEYA 2HZCA 2OTJS 5BJRA 2FY1A 2MXYA 4WF9Q 5CA5A 5IQQA 2A3JA 2E5JA 1UW4A 2KG1A 5D78A 4OZ1A 2XNQA 1WF0A 3S6EA 3VAFA 5DM7Q 1YHQS 3RW7A 5GMKa 5LJ5Y 4QU6A 2O3DA 3VAIA 3CXCR 3PIOQ 4PR6A 4QPTA 2J76E 4U67Q 3G71S 2BZ2A 2MJUA 1S72S 1IQTA 2U1AA 2EK1A 2LXUA 1P1TA 1WG5A 1WWHA 2RU3A 2D3OR 2XS5A 1CVJA 4F25A 1YTYA 1WELA 1JJ2R 3J7ZT 1U1RA 3MURP 1M90T 3R1LA 2BOPA 2MQLA 4LJMA 2MPUA 1Q7YT 1W2BR 4C4WA 1YWXA 1VQ9S 2SXLA 3CD6S 2X1BA 1ZZFA 3CCMS 2CQ3A 2CJKA 2RRAA 3CCES 2RS8A 1K73T 2MGZB 2DNQA 2I38A 3THPA 2DISA 2E5HA 2DNMA 1VQ4S 2QFJA 4W90B 1G2EA 2D9OA 5GVQA 1VQNS 1U1QA 1X4FA 3ULHA 3HI9A 2DNOA 2HGLA 4CIOA 4UQTA 2KHCA 2DNHA 1OIAA 3G8TA 2J0QD 3VAGA 3R1HA 3MUMP 3V4MA 1X4HA 2PEHA 2CQBA 5HO4A 1X4AA 2YTCA 2K3KA 3JB9k 1RKJA 1A9NB 1WG1A 2MKCA 1DZ5A 2DGXA 3D2WA 5LJ3Y 1KQSR 5CXTA 3G4SS 4WFNQ 2DH7A 3U1MA 2M9KA 2DGOA 3MDFA 2XSFA 3MI7X 2M4MA 2DNGA 2RQCA 3G6ES 2KM8B 1DHMA 3I56S 1KD1T
chains in the Genus database with same CATH superfamily
4URGA 3N0VA 1N33F 1N36J 2OPQA 1IM4A 2FGCA 3WBZA 3LGHA 2PIIA 1ZPVA 3VAHA 3LP0A 1QE1B 4L76A 2W7OA 2HEKA 1D8YA 4RW9B 1ZS6A 4P6QA 4M63A 3QLHB 2DNNA 1BQNB 3EVOA 3KK1B 1ULRA 4OX9J 1CQNA 4RBUA 3WC2A 1G7CB 4ZN3A 3M1VB 3H40A 1FX2A 2V6AA 3I31A 1PBAA 4F4KA 5DDRC 1Y9OA 4YS2A 3PEJA 3E2EA 3SYZA 3K58A 3GE9A 3K5OA 2CQGA 4BHQA 4X62J 3G82A 1N56A 3GWCA 5HP1B 2BA9A 2D3O1 1IJFB 2LU2A 3BR8A 1HQUB 2ZD1B 3OXLA 2CJ9A 3ITHB 5C2CA 4EK2A 4USVA 1DTQB 3MOJB 3LAKA 4MFBA 2UXDF 5GADU 5J1EA 3N5FA 2F7VA 3QT5A 3TWZA 1HWUA 4KGXB 1SC6A 3MAAB 2MKKA 3GV8B 4N56A 2W9CA 5L1JA 4O3SA 4DU8A 4ZVEA 2C2NA 1FJGF 2Q1LA 5A0YB 1YJVA 1MROA 4H4KC 4GC6A 4B3MF 3MAQA 1D8ZA 3FSYA 4Z7CA 3KLGB 1RCXB 2V4JA 2FPHX 2ROPA 2RRNA 1I3OB 4PZVA 2RAQA 4G1IA 2DGSA 2XZWA 1CEZA 2E7XA 4Q8EA 4RW6A 2PMZD 4KPYA 4B3TJ 1Y4ZB 2F4FA 4RPFA 2Y1LB 3M8YA 3JSMA 1X9WA 4ZLNA 4Z2XA 2V67A 4JI5F 1W26A 2CIMA 2COLA 4C2MA 3P5TL 2XBPA 3NGTA 4CTAA 2YPZA 2CQIA 2XHCA 1M5SA 4WKYA 2HQDA 5K14B 2UUTA 4ZCLA 4YY3J 1CPZA 4PQAA 2MQQA 3JYTB 2AEMA 2O5DA 3E01A 2HNYB 2QMWA 4W4MA 3OV7A 2H9ZA 3D7SB 2BJ1A 3I6PA 1D9DA 4IO9Q 2UUAF 4FYYB 5F8HA 4YR2A 1EB0A 4DX6A 1X7VA 2MDAA 2MKHA 4WWSA 2VPWB 2O01C 4QU7A 2YPYA 3O6QA 4TVAB 4K4YA 2MHEA 2NZ4A 1MMNA 2NCKL 1U2FA 2I6WA 3SCIE 1PO6A 5L1LA 1IKXA 1T8EA 2OPPB 1XNQF 2V34A 3BN4A 1KQGB 3EPIA 2G0IA 4F2SA 2MYFA 1RADB 1S9FA 1MN7A 2WW4A 3MMCA 2DNYA 4IG3A 4DL3A 1K0TA 2P9EA 2WHOA 4PG7A 5AJ3J 1S9GB 1D1UA 1NDPA 5D3GA 2YKMB 2IVYA 2HS3A 3VGSA 5H9EK 2J0SD 5B0GA 4KH1B 2EBEA 2C2DA 1HNXF 3FSXA 2GMHA 8RUCA 1PC5A 3RB3A 4C8OA 3Q24A 2NUHA 3G86A 4K50A 5KOXA 2FC9A 4O3QA 5C2GA 3TP2A 1VBYA 3HKZD 2MKIA 2FZCB 1YLXA 5EX3A 1NMEB 1HNZJ 3KLFB 5ETVA 2NLWA 2WOMB 4QYZK 4J5OA 1JJCB 1H3DA 4ZLLA 1P9YA 2EG2A 3U02A 1P9QC 3VVUA 5KT3A 4ZA1A 2RDDA 3TUPA 2QO3A 5JJBA 4DR2F 4P2MA 4MKAA 3TQ1A 2XLKA 2W7PA 4DUTA 1V6HA 3P8BB 4FZVA 2GVZA 2ZE2B 1RAIB 3JAMY 3RG6A 2CWKA 1SH0A 3P5BP 4JI2J 2BOPA 5CHCB 2X1BA 4M1KA 2OPQB 4JV5F 1RT1A 2QYGA 2OGUA 2VQEJ 3LP0B 2DY1A 2BUNA 8ATCB 2VIHA 2QFJA 3SEOA 3PZPA 2C3PA 3ULHA 4K4UA 4F0MA 5JMNA 2FLLA 1FEEA 2VV5A 4OZ5A 2DEJA 3ZZOA 1TKZA 1U47A 2PEHA 2CQBA 3QZ8A 3JB9k 2Z30B 3TI0A 3CNQP 3EZ5A 4JV1A 3MDFA 2NREA 4ED4A 3MI7X 4A8FA 1X9SA 5DS7A 2CDRB 2VG5A 2BQUA 3D3CJ 3DDIA 1F5CA 3G82B 4NLOA 2HHWA 3MEEA 3D67A 1S77D 5D77A 2ZJPQ 4USHA 5HI7A 4IQMA 1K1SA 3AXMA 4MFBB 2IMWP 3IR5B 3VV2B 2XYHB 2K8GA 2DIVA 4V1Ak 4R0JA 3LUYA 4ELTA 3A8KA 3C3LA 4N8OA 3CD5A 4ES2A 2W9CB 1KOOA 2YQ3A 1MROB 3FBFA 2XWYA 1NH7A 3HXMA 4ZJOA 4U7UK 4X65J 1R0AB 1SL2A 1SQEA 1RWOB 1VFJA 2V4JB 1PJ5A 4F8RA 1SC4B 2WBRA 3QAEA 5HK4A 4QIVA 2G9OA 1D09B 2GO9A 5D4NA 4RUBA 4BC7A 2E66A 5GAEU 1RT2B 4HH0A 3JSMB 4C98A 1AROP 3BH6B 4DL5A 2HS4A 4KB7A 4BS2A 3MMBB 1YBTA 4CTAB 4WYLA 1GTEA 2FJXA 1IBLF 1CLFA 2HVZA 5KFNA 5F9LA 4A8WA 1J5EF 3GSDA 3NEKA 1XEZA 4JYAF 3MECA 2YKPA 3Q8QB 4DL6A 3UE2A 1EP4A 1Q8KA 3PO5A 4JI6J 3TJAA 5HL7Q 1X4BA 2DHXA 3E01B 2EPIA 2KXFA 1BWVA 2ZH4A 4CLUA 3K5MA 2R8KA 5GAHI 2HFSA 4CYUA 1E6VA 4IH7A 3ZZRA 4QW9A 4DV7F 1SH3A 3BPSP 1Q5VA 2C1EB 1SPBP 4Q43A 3HHNB 4I67A 1S48A 1IKXB 2DT9A 3BYRA 1UP1A 1T02A 3S8SA 4R0EA 2D7SA 4DV1F 4YEAA 3OXGA 2VOPA 2PO4A 3MMCB 4J9KA 1MU2A 4HHHA 3FGVA 2ZOFA 5I42A 2VG6A 3I5CA 1X0PA 5D3GB 2UUBJ 3K57A 6FDRA 1ZYQA 5IS2A 1PGZA 1N0VC 3EDQB 5KFLA 3ZFVA 3N79A 4WU2A 3N4WA 3W60A 3QSIA 3Q8YA 2VPXB 5D15A 1XN9A 4KGVB 2APOA 1C4AA 1HBNA 4TY9A 2HG4A 2HWHA 5IFMA 1EQ0A 2Q66A 3HSDA 1JMTA 3BBCA 4RNNA 3UD3P 1S59A 3I55S 3ZTRA 1XNRF 1RA6A 1EARA 4TN2A 4N41A 4WK3A 1H6KX 4U9RA 5E33A 2XS7A 3AJ2A 4X4OA 4KIAA 5DGBA 4WXWA 4ECXA 3GZ7A 2O66A 5A6WA 3VR1A 3LTOA 3H20A 3CPWR 1WI6A 1DURA 4DF4A 2GVZB 4J9PA 3TVKA 2R2SA 4ZPVR 2CPDA 3F41A 4D3HA 1R0BG 4DV0J 4V19J 1YZ6A 3CD0A 4RW8A 3W5XA 2XI2A 1N33J 1RT1B 4OI3A 2KN4A 1WEXA 4LVNP 1FRJA 3K89A 1XK8A 3OLAA 3ZTPA 4IO1A 3FBBA 4HT5A 2E5GA 3D1QA 4NLVA 3GIRA 4MJKA 4KYZA 1QAXA 4CO0A 3K8VA 2Z0GA 4UTGA 1HW9A 1TKZB 3IC1A 4NCGA 4OZ1A 3UN3A 5DQGA 1D0EA 4MKVA 4LRDA 2HFZA 1AFJA 4BWMA 3KOAA 4U95A 2J7UA 2LXUA 5GAGI 1YTYA 2JDJA 3M8WA 2HBQB 3T1YF 2VG5B 5BXIA 4QWEA 1LWFA 1LFWA 4Y2KA 4DSEA 5SZTA 1FRKA 2JEGA 3CO0P 3FDSA 4P71A 2E9RX 1CS4A 2DISA 3MEEB 4Y28C 3BGOP 4DG1A 5LM7E 1YZ7A 3AOBA 5D0GA 4CIOA 3QAUA 2UXDJ 3OTCA 3KTQA 1HR0F 5JUMA 4NA3A 1WOOA 1DARA 2VPYB 4YHHJ 1FJGJ 1VJQA 5A8KA 3BN7A 1S6UA 2RQCA 4NXMF 1JNRB 1NKBA 4CLZA 2E44A 1G6BA 4DI6A 1MNEA 2XM3A 1H38A 2NR0A 5AE3A 5CYQA 5E0OA 3RUBL 2W2PP 4H54A 3LPYA 4DUZF 4XIUA 4NLRA 2E1RA 1KHVA 3NNHA 2HHUA 1F60B 4C11B 1GMWD 1NBEB 1W2IA 2XLJA 1VBZA 1QDUB 3MECB 3T9ZA 3WHIA 7FD1A 3EXCX 1EP4B 1RWXB 3M6XA 4QOTA 2RDJA 3EMTA 4EMDA 4J9VA 1OS5A 3GMGA 4CYUB 4CO5A 2J0XA 4I68A 1E6VB 4ZPCA 2EFPA 2HVDA 1U6ZA 3MTKA 4LF1A 1U1PA 1Q0NA 4LBHA 2QYCA 1MWQA 3X1LB 4DFKA 3UQSA 5IZHA 1JX4A 2D69A 3RAQA 2DK2A 4CO4A 1X5PA 2X51A 3ZTQA 1XNQJ 3KJQB 2NXJA 1IVZA 4EYHB 1KQFB 4YB5A 4ED0A 4NCBA 4NLSA 4A8MP 2UUCF 1U7LA 3O8WA 3MCMA 1XR6A 1MU2B 3C14A 4C9DA 2MZQA 1WF1A 2B5JB 3M7VA 2PD1A 3DC2A 4I64A 2M7SA 5I42B 2VG6B 4A8XA 2V8PA 2CUYA 3CSKA 4M5JA 3MCNA 4OI6A 1A0OB 4HVZA 3TZZA 1X8DA 5B0CA 3U27A 2ZHOA 3AAWB 2ZOGA 3BM7A 1M5VC 2ZITA 4O3RA 3V6KA 4IUFA 1L3TA 2A10A 2B4VA 2NYIA 1VISA 1BXNA 5DETA 2KZZA 4WZMA 4XK8C 3MPYA 1H2UX 2VDIA 2MZTA 5B7WA 1RYSA 1HBNB 1HLWA 4Q45A 4I6WA 1WNEA 2HGNA 3LP2A 1U1OA 2DHGA 3M8PA 1N88A 3W5ZA 1C1CA 2IM1A 1V5VA 2FVCA 2XMJA 3QRRA 1H2VZ 1HD0A 1LXNA 4IRCA 3DLHA 1JQGA 5DDQC 4X64F 2QRRA 1Q1KA 3EZOA 4OHYA 4O4GA 1PJ6A 2YWKA 2D74B 4USTA 2GGPA 3H0PA 1WKJA 1EJ7L 3HULA 4DPYA 1RK8A 3PEHA 1UA1A 2XCPA 1UJ6A 4QWDA 4RW8B 1G1XA 4PG4A 1TUWA 3CCJS 3SMZA 4MKYA 1KTQA 2FVQA 3RBZA 3M8QA 1V5IB 4WU3A 2BYCA 1EHWA 4PEOA 3NMRA 3ET6A 2MY7A 3GJSB 2BVZA 3DXBA 5H9FK 4FNHA 4AE5A 2N3LA 1VK3A 2FJBB 5LSOA 1FWLA 2BQRA 2CJAA 1RABB 3WIVA 1CG2A 3TNVA 3KG1A 3SDEA 4UY8T 3P49B 3MPDA 4MYTA 2QLFB 4OI0A 2B4OA 4X66F 1LWFB 2Z4PA 4CLLA 4ZVQB 3H5XA 1Q78A 1YK9A 2HAIA 2GZOA 1CS4B 4ZP7A 2DPJA 5C5JA 2DB1A 2H51B 4DG1B 4X2BA 1X9MA 4DJBA 3CW2C 3TA0A 5KFBA 3BSAA 5CA5A 1ZTTA 4Z7YA 4RJVA 3DI6A 2MJUA 1HHSA 3QYYA 5A8KB 3B78A 3ELHA 4Y2MA 1HWKA 1W2BR 5KG3A 5KT4A 3NY0A 2VD3A 2RS8A 4DV3F 2I38A 1Z2LA 5CYQB 3I32A 3OFEA 1VQNS 1FWPA 3MMAB 1SJ1A 4PWWA 3M9OB 2CJQA 4DR4F 1AZSA 3CCZA 3FKBA 2EFVA 4HH1A 1UVLA 3VQSA 3KLIA 3R5AA 3THVA 2KYZA 1J5EJ 1H7WA 4TXSA 1N32F 1KKHA 1JB0C 4ECQA 2HWTA 3T5KA 2YNHA 1WG4A 3E51A 5LMNF 3UNGC 2MGZA 1VQOS 4C8ZA 1LKZA 3T3FA 2AD9A 4A4JA 3VZIA 3EVWA 4LSNA 2VA3A 4YN3B 3O44A 2BX6A 4FXWA 4MTPA 4DV7J 3NG8A 3HLUA 3QGPA 2K7KA 3DDNA 5KFQA 1FXRA 3KDOA 3B4DA 3UDLA 3JAMU 2HZVA 3CD7A 3V4IA 2ZBIA 1VDHA 4LR7A 5KFZA 2M0GB 2OD4A 2RJZA 3ENAA 1RYRA 1SV5A 2J6UA 2R3VA 1DTTB 3SQGA 2M70A 3TAQA 2JZ5A 3TJ9A 3E3XA 3I5BA 2YNIB 1OQ3A 1JLGA 1RT5B 2RD5C 3CTRA 3IFEA 1NNDA 1BY9A 2QGFB 2YX7A 3AQOA 4EU0A 2QFIA 3GSIA 4OI2A 2HQIA 4Z37A 1JLEA 4ICLA 5B0EA 3O2IA 1R7IA 4FBTA 4ID5A 4LF4F 2PSZA 2I1RA 2YKOA 2QMUB 3Q8RB 1UJ5A 3G8QA 1M5HA 2PE8A 2JH3A 3HX9A 1HPZA 2HNZA 2RIJA 5KG2A 3LP2B 1WSRA 3M8PB 1C1CB 2J7WA 2BABA 5LXYA 1XNRJ 2A2DA 1S4EA 5KFMA 3KXDA 5B08A 1VQ8S 4EO6A 4O4GB 3HT3A 3BR9A 4LSZB 2GGPB 1FDDA 2H3EB 1WJ9A 3RGIA 3IS9A 2L08A 1UTAA 2YWFA 3MCOA 2VPZB 1XBWA 2IM3A 4LF5F 3M8QB 4K4ZA 4ATNA 2QTWA 1FO1A 3WQPA 5ETPA 1BUXA 2I9SA 2V9WA 1EKSA 2DCLA 4OZJA 4IRDA 3EDRB 3V5RA 2PEBA 1TMJA 5AE1A 4LQ3A 3CIMA 2MZ1A 2HWIA 5K8OA 3OL7A 5HANA 3TAMA 4MIAA 4LIRA 3SDEB 3WDOA 5A8WA 4CLFA 2MQMA 3MMJA 4HLBA 4O3NA 1CJTA 3T1YJ 2YWWA 4MIBA 3PNIA 5K5MA 2ZVSA 2GCFA 3BO3A 1F1BB 4PUOA 1R8BA 4FF4A 3LALA 1RTDA 2X3GA 2VOOA 3TA1A 3QIDA 4LR9A 4J9NA 1QJHA 1TL7A 3GU0A 2KU7A 1KOHA 1I6JA 1M1GA 1YJ9S 3DI6B 2AZ3A 2DXEA 1QAIA 2HPUA 4NPOA 1QSLA 2HHTA 3K7RA 2R2UA 3DLBA 2L3MA 2ASLA 1JLCA 3NGUA 2IRXA 2HFVA 1QLNA 3QWPA 2XCAA 3EZUA 2WW8A 4XTTA 2OLWA 2U2FA 3R7SB 4ANEA 4DFPA 1SJQA 2MZRA 2OTJS 1UA0A 3FC9A 4DUZJ 1CULB 5H9EJ 1AZSB 1RBOB 2Y1IA 1N5SA 3BQ2A 2LVWA 3POTA 2M3DA 2ZH3A 3DGPB 1SKRA 1YHQS 3CGIA 4QU6A 2FHJD 2RUSA 2W9BA 1LNQA 4AXIA 3KLIB 3C19A 3H5YA 3OUYA 3D6TB 2RU3A 2H1YA 1JJ2R 1KONA 5ETQA 3MURP 4I6AA 3SIPB 4LJMA 1HBOA 3PR5B 2IFXA 5BR8F 3NCRA 1VQ9S 2CAJA 2YNHB 2YWEA 3MFHA 3W64A 2MGZB 5L1KA 2P6SA 1N48A 3CJ8A 3Q8UA 4LSNB 1JLBA 5L9NA 1AT1B 1UVJA 1WUUA 3DRSA 1OIAA 3PVXA 4ES3A 1NK8A 1LXJA 1IBKF 2J9EA 2GAGC 4LF9F 2VZ9A 2DGXA 2RQKA 3FBCA 3DRPA 3V4IB 2PT0A 1YQHA 4LFCF 3QRQA 3ZO7A 5I3UA 3PW5A 3H42A 4NI2A 1SV5B 5CH7B 4JV2A 4NLTA 3SZ2A 4QW8A 5K8PA 4UF4A 3SQGB 4DSIA 1JLGB 4Y2CA 2NZCA 1S10A 3UDCA 5HMWA 3Q8PB 2QZ8A 1NSPA 2J8AA 1RZMA 4JB8B 3MUVP 3IM9A 4K5RA 2C2KB 1JLEB 2V4RA 4URQU 1GT8A 2RHQB 4HEA9 4ID5B 1JLQA 1N4LA 1EETB 1P8GA 1MW7A 2JLEA 1HPZB 4F26A 4F3OA 2VONA 5FIIA 1SXLA 2HNZB 1BLUA 3L9ZA 4DL0C 2E1CA 3KUGA 3VTIA 1U25A 2ADCA 5EWGA 2V8DA 2G4BA 5T7LA 2Y8WA 3VQTA 5KAKA 3I96A 4F2RA 2QEXS 2EFOA 3G87A 5CAAA 4TU8A 4KGKA 4XDDA 4A47A 2DITA 5HQ8A 2OFGX 1U09A 2MLXA 2QG9B 3CC7S 3PV8A 3TAPA 1VS3A 3W2VA 5DJBA 4X64J 2C2EA 4Y2IA 3OTDA 1NKEA 3OJSA 3QRPA 3H90A 3PJXA 4RNHA 4C3KA 3IS9B 2VBZA 1TP7A 2F3JA 4M94A 2DJWA 1OJ4A 4UZCA 4UOCA 2FVRA 5DRKA 4UUWA 2D9PA 4NWBA 3D9BA 4ECRA 3CCQS 4FP9A 4DU7A 1CC7A 3EUNA 3V6HA 5CYMA 1GH8A 1ZH5A 3LOUA 4NYPA 1S1XA 2FJVA 1RJJA 4KHPJ 3BSOA 2IVFB 3TAMB 4F3MA 2F4VF 4I0WA 3K0JA 5A8WB 5FDLA 4RUAA 5ETSA 3WX8A 1ZAWA 2EWHA 4DBQA 3FMWA 2EC0A 2KM8C 1CJTB 3I0SA 2CNOB 4X66J 1RGVA 1HARA 3HMJG 2VFUA 4NLDA 3NOCA 4PUOB 2HRUA 3AXKA 4FXVA 2V2KA 1RTDB 2YXLA 4TU7A 3CCRS 2QMXA 2NXCA 3N6LA 1TL7B 2WB4A 5DO2A 3UN5A 4PPZA 2ZNYA 1SL1A 1TUVA 2GA7A 2DNPA 1A6LA 1ZA2B 2ZZTA 1NO8A 1UPMB 5MLCV 3CCTA 2PMWA 3VF0B 1JLCB 2OEMA 3GJQB 2AYEA 3IAM9 1WC3A 5IC6B 4OZ3A 1NEEA 3VAMA 5BYRA 4B3SF 2FLPA 1MSWD 2VH7A 2CJBA 3LWMA 2JLGA 4DR4J 4O3OA 3O1LA 3POTB 1KEKA 3H2LA 4NA2A 2C22A 2W9BB 1B7FA 3DLKA 4TNOA 5L39A 1U4BA 3OUYB 1VQYA 4RLEA 2QIFA 1HBOB 5HVFA 4BC9A 1U49A 2PA8D 1N32J 5KT5A 1PKUA 3CMES 2B9WA 2QA1A 1U1MA 2ZVIA 1Q86T 2LMIA 2GJIA 4X4TA 5DLFA 5EHHA 3V81A 1IJEB 1OY8A 4N8NA 1JLBB 2W9AA 1MN9A 2GMLA 4QWCA 3DRSB 1N5VA 1WSVA 1PYSB 1N5YA 2FGOA 5D78A 4ED8A 1TR0A 1KVKA 3P4UB 2J9CA 3DRPB 3N6NA 4QPTA 2RH3A 3KNGA 1PCAA 5KFRA 2EK1A 5I3UB 1CVJA 3T9NA 1KN6A 4NI2B 1AUSL 2MQLA 2ZHBA 4QIEA 3RBDA 2HK2A 3K8WA 3PHEA 1FK9A 1GXUA 4OJGA 1RHUB 1LW2A 4KE5A 2DNOA 1KDNA 4TY8A 3FQKA 1U2RA 4RNMA 1NK5A 5HLFA 4NYZA 3A8JA 5KFXA 1HQEA 3KLVA 2XYPB 1JLQB 1HW8A 2LDIA 2ALYB 2RF2A 4QWAA 5T7LB 4EEYA 2B9XA 3PX0A 2YH1A 1ZBTA 2ZZNA 2V8GA 5F0UA 3W3SA 3C16A 1B3TA 3BF4A 2J6TA 3DM2A 4K5SA 3HVWA 3LANA 3W2VB 2G0CA 4BDPA 3GCXP 1VR6A 3HVAA 2MQPA 3TW0A 1GQEA 1RQ0A 1ZM9A 4YOEA 1FNXH 1YDLA 3T1AA 3GFHA 1UWAA 1T9UA 2N7CA 3C15B 3MWBA 4OZ0A 2NYHA 1U1NA 2OIHA 3OTEA 2KTQA 3BV8A 2MQOA 4MMOA 3L3CA 4DWIA 2PDAA 4FPRA 5ITHA 4TKTA 2OJ3A 1UVIA 5CYMB 2J5AA 2QLWA 3WX4A 1S1XB 5F8GA 1AB8A 4NMLA 2VJVA 5CD4H 3PACA 2XWXA 5A2QY 1SKWA 5FDLB 1MWZA 3DOMA 4LIWA 1KSPA 3VAJA 1MMLA 3ILIA 1B0TA 3I0SB 5JVGQ 2DBBA 3W7BA 2RKIA 4CH7A 4IR9A 4QR1A 3BREA 4Y65A 5G0RA 1Y0HA 1NCLA 5HAOA 2DHHA 3IO1A 3JQMA 2ZH5A 3GQCA 1AFIA 1HL6A 5CZVA 3HD2A 3NS6A 3KMQA 3NXZA 2RNEA 3L7UA 4KPCA 3V2UC 2LXFA 3SXLA 2IC3A 1QAYA 2ATLA 1T95A 5DG9A 3FCWA 1FERA 3UR0A 5M2UA 2DTJA 2BJDA 3PKYA 4LFBJ 1S6QA 3DLGA 3BKUA 2HSEB 4PPDA 3CB4A 1NHUA 1S57A 1RTJA 4PG5A 5EWEA 3Q0AA 1RE1B 2KH9A 3MR5A 1RT3A 1RT4A 1ELOA 2R7QA 3DLKB 1E6YA 1TL3B 1TL4A 4LBPA 4F04B 3THTA 1YSJA 1M5OC 5BR8J 3KLHB 1RWKB 4HDHA 1T11A 3J81Y 3V81B 2XLIA 4PQUA 2JRSA 1VQMS 2KT2A 2W01A 4B3OA 3GTYX 2IA0A 2W2MP 1WC0A 1S97A 1EQMA 1REVA 5FD1A 4ES1A 4KO0A 5DM6Q 2VC1A 1PIEA 3ZZZA 1PILA 1N5YB 2M8HA 1HWLA 3ICLA 5BYSA 1WC4A 4L6V3 3J7YU 4CO3A 1X60A 3LGNA 4DR3F 2N3OA 5HSPA 2VBWA 1FD8A 1IM6A 2J6SA 1S99A 3BS9A 2LEAA 1CBKA 1HMVA 5LSLA 5KT7A 4AUKA 1TL1A 2R7OA 1FK9B 1RISA 5J2NB 1LW2B 3N5BA 4ECYA 5ETTA 1OQ6A 5BJRA 3C6TA 5H9FJ 4TY8B 1NDCA 5HLFB 2XMWA 3MEGA 1KWMA 3VAFA 5F8LA 2BKNA 1C0TA 2E5LF 5KG5A 4FF1A 3PIOQ 3TEHB 4OJ3A 3K5PA 1S72S 1P1TA 4USMA 5I3QA 1NDKA 1LK7A 3G6XA 2RF2B 4KKOA 4JI1F 2AV5A 1GTHA 2FTRA 5E2QA 4RW9A 1F9HA 4UW2A 2M5YA 2W2NP 1PAEX 1BQNA 3NOGA 3KK1A 4DV4F 4C8KA 5B0AA 4W90B 2QE5A 5DZ7A 3C16B 5KFJA 2YNGA 3DM2B 4OYXA 3ENWA 1GXLA 3KHRA 4WP3A 4N77A 4LT6A 5AXKA 2WZ1A 4HACA 4ZP8A 2KKHA 2A2CA 3OVAA 3NP5A 3MPWA 1VLYA 4NCAA 2ZUAA 5HP1A 4WP9A 3CDAA 4OQJA 3H5UA 3R5CA 2YKNB 3DU5A 2DCUB 2ZH1A 1F5BA 2BANA 3PXGa 3CJ3A 2MJNA 2DNRA 2CVIA 3IGNA 3RB6A 2LKZA 2HBYB 5LT5A 2BQ3A 1NPKA 1RLDA 5KFTA 2BMBA 1NK0A 2AJ0A 3W62A 2UXBF 1RLCL 4JP8A 2F63A 1PBUA 2OH2A 4X4QA 2Z8QA 2WSFC 2BKPA 4NLPA 4ED6A 1NJZA 1HBUA 3QSYB 3SCLE 3FRZA 4DUYF 1HIYA 3D5MA 2OO4A 4WJBA 2CRLA 2MB0B 5G0RB 1TTHB 3CJQA 5J1NA 1DQAA 2CJYB 2R8GA 3D66A 1S0OA 2MSSA 1JNZB 5K14A 4YUDA 1HYSA 5KFIA 2L41A 2R9LA 2EFNA 1H73A 4EO8A 1RHMB 2HNYA 3QT8A 4M5NA 2HRTA 1PSDA 4CO2A 5LMUF 2IC3B 1FFGB 3D68A 4R8UA 4PWDA 1FJ7A 1HD1A 2JFKA 4ZVTB 2DNLA 4RX6A 1S6QB 4HKQA 3DLGB 2FC8A 3DLJA 2VG7A 4NXNF 3IGVA 4HDGA 3GG1A 1RTJB 2JJ4D 1NZAA 2LQBA 2GJFA 1RT3B 1RT4B 4DV5J 1E6YB 1RWUA 2KL8A 1NSAA 4YFUA 4GKJJ 1J5OA 3FEYB 3M6UA 4F02A 1U8SA 3PHTA 3AJ1A 2WTFA 2UXCF 1HI1A 4J9SA 5DDPC 4EZ6A 4PQUB 4B3OB 1TFWA 3BDEA 1C0UA 1REVB 2NPIA 4KO0B 1HKAA 3OBIA 4ZVUB 5CCMA 1RKIA 4YB1P 3RB4A 5J2PB 2OTLS 4NLXA 3I9ZA 3A3OB 2WOMA 2E9TA 4L3NA 4ID8A 1S1WA 5A8RA 4O3PA 2DNZA 3PRDA 1K47A 3GG0A 1HMVB 2DRAA 3GIKA 3PYEA 1BWEA 1FFWB 1UKUA 5KTQA 3NAIA 4HT7A 4ECSA 3OFFA 4RW4A 1NKCA 3TUIC 2BW7A 1R8PA 3BYPA 3C6TB 2YQ0A 3MEKA 3RW6A 4OHVA 2YH0A 2PC6A 3MEGB 4JI3F 3Q2SC 1C0TB 1N34F 1M5PC 2D1CA 1XR7A 3ONQA 3PR4A 4MK8A 4U7CA 1WEZA 1Q8LA 4C8LA 5L8RC 4A8SA 4CLTA 3IP0A 2BM0A 4FKXA 2VA2A 4KKOB 4OFZA 1YJRA 1D9AA 3ZXWA 2KI2A 1KVJA 4XPCA 2DR7A 1XQIA 1QAJA 3MEDB 2YNGB 2X1GA 1CJKB 1YRUA 1JKHA 4KH0B 3EM1A 3WIUA 4QIFA 5M2RA 2E5JA 1UW4A 4LF8J 2PMHA 3DHXA 4HACB 3AD7C 3TARA 2FVPA 4EWTA 3QNWB 4N5SA 3HSGA 1UZHA 2AJ4A 3R8YA 4HI1A 4DDFA 1ZTWA 3KFWX 3B8HA 5KFDA 1UCNA 3RR8A 3GPAA 4ZCMA 3MHYA 2XY6A 2GFFA 4X4SA 3KJVA 4ILMA 1UMJA 4P2FA 2BANB 3KUEA 1U1QA 1FESA 3MOZA 4UQTA 3J80Y 3HFVA 4GRSA 3GFYA 4ITSA 4ZPWR 3RAXA 2VB6A 2GHWA 3HK2A 1R0AA 5CXTA 2KFZA 4FYXB 2AWZA 2DGOA 3BGRB 1T03B 2MQ8A 1HBUB 1KRPA 1I1GA 4RW7A 1S49A 1VC6A 1RT2A 3J7AN 3ISND 3F73A 1FTCA 4HI2A 5DQIA 4QIGA 4C8YA 3MMBA 4ED7A 4M5LA 1U6BA 4QPXA 1RHJB 4DR6F 4IOAQ 2AW0A 1Y5IB 3DRYA 3NCQA 1C1BB 3JS9A 1HYSB 4NYOA 1M5KC 2H4WB 4RWWA 1RHQB 4RR5A 3MM5A 2BBEA 4WIQA 2DY9A 1I51B 4M5MA 2CNLB 2DEIA 4J9UE 3CVKA 3CCVS 2NPFA 2E7WA 2CQCA 4R8UB 4PWDB 4OJ1A 4PXEA 2W24A 2EFGA 1S1TA 2HBZB 3AA9A 2LDYA 1URNA 4DSLA 3KK3A 2VG7B 1S0VA 2AMCB 3V6DA 4ZLPA 3KYLA 3ADAC 2G1DA 2XTJP 4LRAA 5KG7A 2JEIA 2KHDA 2IHR1 3VGTA 1FRIA 3ILLA 2V0NA 5I4MA 2DGVA 5ETKA 3CJKA 3TQEA 1J5OB 4QR0A 1NJXA 6FD1A 4LFAF 4OYBA 4ELUA 4QZVB 1SKUB 1IKWA 1T9TA 4DV6J 3UCZP 1S7IA 1DQ9A 4KY3A 1MWYA 1C0UB 3EPGA 3OL8A 3HKWA 2BE2A 4F67A 1WHVA 3PDNA 2M2BA 2LU1A 1UW9A 5RUBA 4LMZA 2H65B 4ECZA 2CZ4A 4DR3J 4DQRA 3M2RB 3CWJA 2Y0BB 3D6MB 5KFUA 2RSQA 1G3OA 1S1WB 3R27A 5A8RB 3CJ5A 4IG0A 1V3ZA 4OHWA 2IDLA 4QYRA 4RBVA 2VC0A 4I1TA 3I4PA 4RW4B 4ZKAA 2Q6CA 1XMOF 1HNWF 4CO1A 4HTIA 1KFDA 4CDIA 2W2QP 2CPIA 4DX5A 4CLYA 2E5LJ 1UVNA 2ZFHA 3L4BC 3BKFA 1ZETA 4K4TA 1S5ZA 4RZRA 4FS1A 1X4DA 3PJ9A 1REGX 3J7A1 4DL2A 2QT7A 4Q2MA 4RO0A 2FZGB 1GXTA 4NLUA 1NK9A 2RE1A 1L3VA 2BR0A 4QBUA 2F8EX 3M2UA 3MR6A 2V4QA 2MHNA 1JKHB 3Q8SB 4Y2AA 2G1HA 3HO1A 4Q2LA 4OX9F 4OIXA 3JXOA 2DRBA 2LEPA 3L7OA 2Y1RI 3BZQA 1FEHA 3DRRA 2V8HA 4NZ7A 2E7VA 1IWGA 1KLNA 3MD1A 2KFNA 2HHSA 2FJEB 2ZKUA 3D4JA 4JI8J 3M05A 3KJVB 3CCLS 3OTOF 5GAEI 2W4DA 2Z58B 4K7QA 4CNYA 3T1HF 5T41A 1YRTA 2MKYA 1D3WA 2HW3A 1YGYA 4X62F 1U26A 3LP1A 3HZGA 3NWGA 1FCAA 4RUHA 3R97A 1FFSB 3CJTA 3DKDA 5E3QA 3A8EA 3CXCR 3TR5A 2P6TA 1IQTA 1RTIA 1Q8BA 1L5UA 1RWMB 4UOGA 5CCLA 1WELA 3KG0A 2DYAA 2VF3A 3MM7A 4FS2A 2AIRB 3J81U 3CD6S 2SXLA 3AODA 4RW7B 2RRAA 2FZKB 2W4CA 3W8PA 1TQLA 1SH2A 4DUYJ 1T7PA 1VQ4S 2KZMA 2AEJA 4NE9C 1Q79A 2BOAA 5ETRA 2IY5B 2QV6A 3D0IE 3H7HB 1LFPA 2CXEA 5KOWA 2BRLA 2DNHA 4MYUA 4B3TF 4C11A 3MUMP 3CCWA 4K8RA 2GC8A 2BJ8A 1SIWB 1KQSR 3T5LA 4JI4F 2KDOA 3MM5B 3TUZC 2FIUA 2H5EA 3L95X 4F4XA 4EBCA 1X4GA 2ILZA 3P45B 4J9QA 1F9FA 3T41A 3H8YA 5C7PA 2LLZA 2ERRA 2K06A 3UWTA 1K44A 1HFEL 1S1TB 3IAS9 3FEZA 2E29A 3PYFA 1S0MA 2UV8A 3H4DA 2FVSA 3KK3B 1N0UA 3IRXA 3EJMA 3V6DB 2ASYA 4NL5A 1V3RA 2FJWA 2GMJA 2IYGA 3MZIA 5L9XA 3N9UC 1T9XA 1VQSA 1IUJA 4Y6IA 2EW9A 2JEJA 4AYBD 3FCHA 2B5JA 1DBDA 2EKYA 3CJKB 1B64A 3CCUS 3MF5A 3TEGA 4PCQA 1FE4A 2ZBRA 3BGUA 3BKTA 2C2ZB 2DR5A 3OR1A 2UXCJ 1ACMB 1N5TA 3KHLA 1IKWB 2GHVC 4LRFA 4RBTA 1VQ6S 1F5AA 3U1NA 5AJ3F 1BE4A 1Z1ZA 2XMTA 1RWNB 3HVRA 2BE2B 4EBDA 2R7VA 3VCDA 3T19A 3NMAA 2L9DA 2FLOA 3QMQA 4WP8A 1OPIA 4HHUA 2OP5A 3RAMA 4TYAA 2WAQD 2M8DB 2VBYA 2ZM6J 1JJ4A 2FY8A 3NNCA 2AF6A 2R7UA 4IG0B 4DR5F 3HHLD 1C2PA 3CCSS 2DIUA 1HWIA 2XMVA 5C25A 1I94J 1X31C 2Q6BA 5K9FA 1S9EA 4ZIWA 3EGNA 3SCJE 1LOUA 4MK9A 2XMKA 5KT2A 2G0JA 5EDWA 3KNAA 4USJC 4JI0F 3J7Z5 1ICEB 1YJUA 3ZZPA 1YX2A 3IWNC 2RHSB 3M8SA 4DOZA 2V94A 3OFHA 3PYDA 2H54B 2QSWA 4JI2F 7AT1B 1X5TA 1FE0A 1IR2A 2DNKA 2XEXA 4IOBA 4P9SA 3NKYA 1F2GA 1OSCA 5B0DA 2G2YA 1APSA 1PAUB 1VQLS 2ZEJA 3M2UB 4OYWA 1IKVA 2HGMA 1U48A 4FF3A 3W1YC 1UJ4A 3FSIA 2ZC3A 3KG4A 4ELVA 1G4CA 2KRRA 3CF5Q 3DFEA 3DRRB 1VQKS 1Y11A 5B0BA 4HTJA 3G9CA 2HVHA 1CSJA 1Q7LB 2M88A 2B0GA 3DRXA 3EGZA 2WVEA 1UFLA 2B8QA 3PX6A 4DR1F 2FDNA 2JVOA 5E5NA 4A8YA 3MXHP 3R2DJ 2UVRA 1TVRA 2F8HA 3CULA 3LP1B 1TV6B 2KFYA 1T05A 1K0VA 1NU4A 2I2YA 3W63A 1U6FA 5KG6A 1FKAF 3G6YA 3GIMA 2Z2ZA 4B3MJ 3JQJA 2HYIB 4B9NA 1RTIB 4MKBA 5D4LA 1RCOB 3K5NA 3R5DA 3SV4A 4WZQA 3UVJA 4DL4A 3MM7B 3M2VB 2Z56B 2OSQA 3MMAA 2DGQA 4DZDA 1U8WA 2DH8A 2X3DA 4MK7A 2Z57B 4DLEA 4JI5J 3OQ2A 4XAKA 1O6XA 3M4XA 1WEYA 3LPEA 2VHGA 4FKYA 3W65A 3MAHA 4F4ZA 1NK4A 1WWHA 2JFDA 3W9IA 3J7ZT 2JL9A 2HURA 2QN6B 2VU5A 2MPUA 3UO0A 1BQXA 3N28A 1UVMA 3W2WA 1FRLA 2UUAJ 1Q4RA 2HLUA 4O4RA 4GO7X 5GMEA 2Z2MA 2HHQA 2W2OP 2XMMA 2P8IA 2OMOA 4CI0B 3IRXB 4ZOSA 4QJVA 1TAUA 3PW2A 2ALZA 5HO4A 1QSYA 2BKOA 4L3KA 3N01A 3EGVA 4BCAA 1PYOB 2EKNA 2XQCA 3SQOP 1XR5A 2VFTA 1DTTA 1BMQB 2K7JA 2VDHA 2YNIA 1RT5A 1PG5B 1H72C 3HFKA 4OYAA 2PI4A 1R27B 4X4VA 4GVBA 4WKRA 4LFAJ 3DU6A 3FCVA 3OR1B 1Y00A 2HIYA 1N52B 4B17A 4ANCA 4Q5VA 4L75A 4NZ0A 1QUPA 1TELA 1S1UA 2AX0A 1HNXJ 1RT7A 5IT4A 4QIWD 3E8OA 5F0WA 4DQPA 2UUBF 3EYZA 5GMDA 4OYOA 2DRDA 4P2SA 2ZZMA 5D0RA 2MSTA 2YX1A 2XMUA 3GB0A 2QJ3A 5JXSA 5IV3A 4M8LA 1FJEB 3UD5A 2EBGA 3NWRA 1TU0B 3GJRB 1Z4UA 2OKQA 3DGVA 5C25B 2V2VA 2P9CA 2MTLA 5A6PA 4F36A 2IRUA 1IBCB 4IR1A 2QA4S 2QL7B 4DR2J 1S9EB 2IPOB 4DS5A 1S76D 4IYQA 3NGRA 2RQ4A 2MY8A 2CPXA 4U7UD 1FNMA 2IVMA 6AT1B 3BEGB 1IWAA 2X1AA 4K0KF 1ITPA 4OZLA 4OYZA 3BGLA 4H4MA 5LSRA 4JV5J 4G3IA 2AP6A 1NPRA 3TZXA 4DV0F 2GQ2A 1NB7A 3M6VA 3P3DA 1YJ7A 1FWKA 4J7CA 1TKDA 2N82B 3PY8A 2AGQA 1UEVA 2B4PA 2Q3PA 4F0HA 1IKVB 3LGMA 4AL7A 1TZ0A 1UAWA 1M0SA 3CDBA 4DPTA 4RNOA 2XSJA 3H59A 3IA0A 3G6VA 2JSXA 2B9YA 3KK2A 3BQ0A 3EGWB 1WHXA 2Z2YB 3GJTB 1T9VA 2OHDA 5ETNA 1FDNA 1HA1A 4EYIB 1ZZNA 1H2TZ 3PW4A 3H2UB 5KFEA 1X4CA 1X5SA 1SJ3P 2GO8A 3U7JA 4GC7A 3OTOJ 2KO1A 4WFYA 1BC6A 3MPVA 3T1HJ 3EE3A 2IM2A 1B70B 3NGKA 3NL0A 3DN9A 3KDNA 4C8MA 1TVRB 4NX9A 4R5PA 4MH8A 3K2YA 3NGDA 3PFEA 1T05B 4DZ6A 1RTHA 4ZP6A 4C8NA 1WTBA 1H0HB 4I69A 1N6QA 5ETOA 2DKOB 1T3NA 3SSQA 1HNIB 4YHHF 4MT1A 3VALA 2CPHA 4DLGA 2AQ4A 3UVJB 4WTOB 3HHLA 2F65A 1WHWA 3TZYA 1OPZA 2VL1A 3QGHA 2F40A 1O0PA 2CQ1A 3CJ4A 1CULA 2A6OA 2CQ0A 2G2OA 3DGPA 3HJFA 3CC4S 3B6BA 1IBLJ 2AGPA 3P6YC 2VFRA 2AHOB 1IR0A 4KJIA 4JYAJ 1U24A 2YVSA 4KV8A 3J81j 2CPFA 4KSEB 3QFHA 1NJWA 3C66A 4JI4J 1JK9B 3T5JA 5B0FA 4DPWA 3IG1B 4IQXA 2FHKA 4OX7A 3W2WB 3FQLA 5D0EA 4WIIA 4PXBA 1UPPA 4ZVFA 1Q16B 4ZVSB 2C28A 1T9YA 3RR7A 5CYJA 3DOKA 1XJWB 3D6HB 1WD6A 3MM9A 2EI5A 3LAMA 5IQQA 2A3JA 4U8YA 3RRKA 3DHWC 4CLPA 2ACYA 2ZBPA 5KT6A 1YJTA 2R8JA 3H25A 2I0XA 4U6PA 3QT7A 1VI7A 3RYLA 2YWGA 4DV1J 2AJ2A 3HM9A 4F25A 2R7WA 1GEHA 1NHVA 1T3OA 1OMSA 3GYNA 3RJMB 2VBXA 4C4WA 1ZZFA 3ZZTA 1UFKA 2CQ3A 4GVBB 3CCES 4O0IA 4DX8H 1LV5A 2BE7D 4DV2F 1S1UB 4ZLJA 1FVSA 3K59A 2GIQA 2OMLA 3VAGA 1RT7B 3UN2A 3V4MA 1EETA 5B09A 5F8IA 4TQSA 2UU9F 2DPIA 5KG4A 2EFQA 3OT9A 4WFXA 2ZC4A 4H4KA 1BD6A 1YVFA 3LO3A 2YWHA 3IWXA 3W5YA 1R6YA 2ZH8A 3MUTP 5DG8A 3AB4B 1IKYA 2LQ9A 4DR5J 1WF2A 4XO0A 3I4HX 2JWNA 2Q43A 1OO0B 5D4PA 1DLOA 2BJ9A 1FJCA 3UDEA 1TK5A 2VASA 1GMWA 2VODA 4ZIVA 4TLQA 4JI0J 4WPAA 4B9SA 2UVVA 2K3IA 5IQ6A 4LVOP 5L1IA 2DH9A 4PYAA 1SQGA 5HBMA 1EKRA 4H4MB 1S79A 2CG4A 4ZPTR 1UFWA 3ZZYA 1KVIA 3GILA 2R2RA 2GAHC 2V50A 3ETMA 3GR1A 1VQ7S 4FNIA 2KJVA 3ISZA 1UL3A 2GQQA 2XSJB 2W4PA 3KK2B 1L3UA 2VFVA 3AB2B 9ATCB 1FKPA 3IR6B 4XPEA 1CC8A 2CVEA 2BJ3A 4K59A 2AX1A 3U1LA 3BBFA 3K5LA 1KNZA 2HHXA 1TK8A 3MGJA 4OV1A 2QA2A 3W66A 3CDUA 4DR1J 1X0FA 1HBMA 3PJWA 2L9WA 4R5PB 3A3PB 1HR0J 3BH7B 3AA8A 2V5HG 1VRQC 3CJ0A 1LEOA 4PXDA 1RTHB 4D3GA 5J1EB 3A13A 1YIJS 4TQRA 2ASDA 1KTVA 4O0NA 4USIA 1N6QB 1WKKA 1UZDA 3NBPA 4NXMJ 2ZNZA 3FBEA 3OD2A 3FZBA 3W8GA 2JEFA 4JV0A 3P96A 1HHTP 2A18A 2GHPA 4IFVA 5HJYA 4P73A 1F0XA 2B9EA 4ALZA 3EX7B 3HHLB 5BYQA 1F6TA 1NH8A 1ZM2A 2DHAA 4J37A 4CH0S 1RHKB 2YKAA 3Q83A 3NNAA 3HF5A 4RW6B 2XYGB 2NSBA 1RAOA 3MTJA 5J1PA 1GFWB 1HWJA 2DHSA 4LREA 5HROA 1QSSA 2WRMA 4C0OC 1SJFA 4KV8B 1O51A 2PA3A 4BWJA 2O1PA 1CQMA 4KBIA 4UOHA 2W8KA 2B7BB 4LF2A 1N8RT 4Y3CA 4ZK7M 1BGXT 2HHVA 1FHTA 3DNCA 3HVTA 3CJ2A 2HMIA 3QGGA 5KFPA 2J7KA 4F3QA 2N7YA 3DOKB 1XWLA 1AYEA 2R7XA 5A76A 3MM9B 4QR2A 3DLLQ 3QJJA 4CT9A 1IBMF 4CCHA 4EI2A 2BACA 3MM6A 3PM9A 4I6YA 1R8HA 4E8UA 1OY6A 2LQ5A 4K4SA 5I3PA 5HQMA 4ED3A 3ILJA 2UUCJ 3BJYA 3GFXA 2B51A 2MEWA 3NGSA 2RUGA 4P74A 2NUUG 2EK6A 1XMQF 2YY3A 2RS2A 3SSRA 2LQ8A 2B43A 2NS1B 2JHEA 3TVYA 2HK3A 2IJRA 1RWVB 4TYBA 4IG3B 1RSCA 5GAHU 4YB6A 1AA1B 4WF9Q 2MXYA 2PN6A 4NRUA 3QFWA 3QIPA 5CQGA 4EBEA 4CLWA 2UVWA 5DM7Q 5KG1A 3HHEA 1JIHA 4PR6A 4GKKF 3G71S 3Q23A 3TX8A 1RAGB 4S0MA 1FVQA 1U1RA 4NMXA 1M90T 4DPOA 3GP9A 4J90A 4B9VA 1TL5A 3CCMS 3AT1B 4ZHRA 1K73T 1D9FA 1IKYB 1BQMA 5KFWA 3KMSA 3THPA 4ZVOB 2DNMA 3CIZA 4P10A 2JC0A 1DLOB 2XGPA 4A8KA 4DQSA 2KHCA 2C2RA 2N4DA 5DG7A 1XMBA 2CZ9A 4HR2A 3VWSA 1UETA 1X4HA 1LWCA 5E7OB 2YNFA 1A9NB 3M30A 4LUBA 8AT1B 3G4SS 4KTQA 2BM1A 1DJ0A 3C15A 4K0KJ 2CJXB 4M5GA 2M4MA 1OY9A 4ECWA 5HBMB 3OFGA 1NZ8A 3RBEA 2H5JB 1YRXA 2MZJA 2OEJA 1WOPA 2MKJA 4C7QA 2V2ZA 3R9LA 1N5QA 4NA1A 4G1QA 1UEUA 4A8QA 3ENQA 3CEDA 3S1TA 4M95A 1WDDA 3VGVA 1JWWA 5J2MA 2R8HA 5HATA 4PKDB 2VFSA 3H4BA 1FKPB 4NEYA 4OX8A 4PG8A 1WDTA 3PYGA 3ZTOA 1KQKA 2AJFE 1T0TV 3UI3A 2XO7A 1DY3A 2ADBA 1WI8A 4OZNA 2PGCA 3I87A 2CPZA 1HBMB 4P52A 1VIXA 4PWUA 4FYWB 5H1SV 4ZCIA 3KHGA 3L09A 2CQHA 1SJ4P 2QC3A 2CZVC 3F44A 3NBPB 4IH6A 4YR3A 2Q79A 4Q8FA 3CMAS 1RDRA 3CC2S 5EN1A 2M52A 2FLNA 4DV3J 1FF2A 2G2ZA 4IFVB 5GAGU 4U96A 2ROEA 4DQIA 1RU1A 4N47A 4PXCA 2AKWB 4R25A 3LQVA 1PYTA 1R3NA 1RAEB 5CABA 2C2OB 4CLKA 2AYGA 3DYAA 1FNOA 1NSQA 4C48A 4ZVGA 1NJIT 5HROB 1K9MT 4YB7A 1TL3A 1VRTA 3VZHA 4OMFG 1U2CA 9RUBA 2A0FB 5KG0A 4A46A 5HMYA 5E3RA 2MKSA 2R8IA 3KLHA 4KQZA 2ZH7A 3D54A 2HQCA 1VYAA 3W9HA 2MQNA 5LMNJ 3TO8A 2E1PA 4CNZA 3GYGA 5IOLA 3HVTB 2HMIB 3PFOA 1XTZA 4YMEA 3SFUA 4BLGA 3LF0A 3OHAA 3MM6B 4E2FB 1SJRA 4BBYA 4UY85 2HNDA 1Z2ZA 2LEBA 4FYVB 1B99A 5IC4B 2HFUA 3OSNA 4B3RF 4OYMA 2BW2A 3R6GB 2F8MA 2CADA 2C42A 3RZAA 2YKQA 5KFSA 3RB0A 4IRKA 1URRA 2UP1A 5IM0A 1TUGB 1DAXA 5J2NA 5KFAA 2JLFA 2XB2D 4Q0BA 2CQ4A 4ZJQA 1HI8A 1L3SA 1RT6A 2B4UA 1S4FA 4DV2J 2HZAA 1I5OB 2PI5A 4L74A 2GV1A 3UD4P 4LF4J 3VAKA 3QIPB 3D3BJ 3CDWA 1WC5A 3M8ZA 4I7FA 3QATA 2HHHF 5J2QA 1ZA1B 4E98A 2UU9J 5U47A 2HFNA 5DDOC 1KP6A 2BV3A 5K8MA 4P7TA 3ZTSA 2CQDA 1KHWA 1QTNB 4ZHRB 1BQMB 2P9GA 3DLEA 5L46A 3JSRA 4C3MA 3EWGA 2E1MC 2MMYA 5KFCA 3LH2S 1JJHA 2HZCA 4J9RA 1KBRA 4C0HA 3V6JA 2FHJA 3JSBA 1TAQA 1LWCB 4ZVRB 2YNFB 2CNNB 3I9V9 1PC4A 3M30B 3RW7A 2K2PA 2OUGA 2J76E 2VKZG 4U67Q 3M32A 3GLJA 1P1LA 2YKNA 3SBMA 3M9MB 4EUVA 2AU0A 4LF5J 4J91A 2CKWA 1RAJA 2B7CB 2DNQA 4YDDB 3R5JB 5GVQA 2QLBB 2OFHX 3EICA 3M8RA 3HPOA 2HGLA 2GW8A 4G1QB 2NSCA 3G8TA 2J0QD 2B56A 5KFKA 2X7IA 3HD1A 2YBVA 5J2MB 1WG1A 4F4WA 5LJ3Y 2PFDA 3QO9A 3KUHA 2DH7A 4NCGB 2ASJA 4KHPF 2C3YA 1SL0A 3D0HE 4N7TA 4NLQA 3RRGA 2BEFA 4WE1A 4DQQA 2HQGA 2OSRA 2LFVA 3HSZA 5C24A 4HL9A 2DR8A 4F4AA 1MG7A 4TU9A 2KG0A 3OL6A 1CJVA 2LA4A 4ZVHA 4KR0B 1BHNA 1Y3JA 2MLZA 5E3CA 2UV8G 4ZDNA 4FVCA 3Q22A 3I82A 3OR2A 4DXLA 4A48A 2CG8A 3CMQA 3I0RA 4B9MA 4B02A 4X4NA 3DYAB 4J9LA 1ZOTA 2AZ1A 4HHJA 4CM0A 3J7YI 3LA0A 3IWLA 3AJDA 1VRTB 3UCUP 2FQQB 1VBXA 2WVCA 2AJQA 3PW7A 2R42A 1UEKA 2J0WA 2V68A 3IN5A 4FBUA 3RBXA 3OVSA 1RAFB 2WVBA 3GIIA 1GMUA 4MAKA 5CZXA 2I8EA 2BJEA 1EX8A 2ATCB 4DN0A 2R2TA 4K4XA 1WACA 1AUDA 5J2PA 1IBKJ 4LF9J 1IBMJ 4LFCJ 2HNDB 4AQYF 1FRHA 1O8BA 3Q86A 2LYVA 2XZDB 2JX2A 3K17A 2P2CB 2ZUGA 3TRGA 4B9LA 1XMQJ 4KFBA 2RU9A 5IM0B 5LOQA 1VOMA 2AYMA 4WFAQ 4Q0BB 2LA6A 1VIOA 3C14B 1RT6B 2W25A 3D1HA 2CFXA 1WKLA 1NPPA 4ZCKA 2VICA 2O67A 3BO4A 1SUQA 4P72A 3QPIA 2YX4A 1P6TA 3D6FB 5FLXY 4I7FB 3OSPA 3GCWP 5J2QB 3W61A 4KRWA 4ILRA 4GKKJ 2BE9B 2XG8A 3T6BA 2DXFA 4F4YA 3AH6A 3ZNJ1 1WORA 3RRHA 2IM0A 2HAFA 3MEDA 1CJKA 3JTOA 1JLFA 3DLEB 4FXDA 3DMJA 1U45A 2LECA 2DGWA 2C3MA 4FYDA 4ER8A 4RU2A 2F9JA 2QX0A 3TJ8A 1RXOB 4K4WA 3B4MA 2RVJA 4ZJLA 5ETLA 4YR0A 2KB2A 1RB0A 2XHWA 1Y5LB 2KVIA 3M32B 4DPUA 4ZVPB 1Q8IA 3SSSA 2KT3A 2BDPA 1VHIA 2JNJA 4EZ9A 2H5IB 4WCEQ 2WCXA 2V63A 4OYIA 3IBCB 4I4BA 4RNFA 3LWLA 5EGYA 4LQ9A 3PIPQ 3TVZA 1OYDA 1N54B 4LRCA 1M1KT 2VUGA 3SCKE 2BXJA 2FHMA 2OELA 4ETXA 1YKWA 5F9NA 1B0VA 3ET6B 4RU9A 1FI4A 5E3PA 4UT4A 2F4VJ 3S6EA 1Q95G 5E41A 2IRYA 1GX6A 3M6WA 2VQFF 3QO9B 3BGRA 1T03A 2BZ2A 4LSLA 4NEZA 4OLOA 3QT6A 5F41A 1DFDA 2NXEA 5F8NA 2P5VA 1T9WA 1FTRA 3LW5C 3CJRA 4USWA 3NLCA 5IT9Y 1SBRA 1S1VA 4PABA 2HBRB 3Q8VA 3IM8A 2WBMA 4WE1B 3CT9A 1U02A 2E5HA 1SIZA 2F1FA 1UWBA 2F5GA 4NOHA 1X4FA 3WC0A 2HRYA 1C1BA 2HFOA 4ZMMA 2PFFB 1Y10A 5L38A 5C24B 3R1HA 3TZWA 1XERA 3HHDA 3OXFA 1F3FA 1JLAA 5F8MA 2YTCA 2DD8S 4QCLA 1S6PA 3D2WA 2B6AA 1CJVB 4X4UA 4WFNQ 2JOQA 1O5JA 5SUHA 2XSFA 2Y8YA 2DNGA 3UR3C 3G6ES 4F7VA 2ZDPA 3OR2B 4JUZA 3I5AA 4A8OA 4ECTA 4Y0FA 4B3SJ 2HQ3A 3I0RB 5FJ4A 2QLXA 4KGMA 2ZH2A 5E3AA 3UCGA 4LFBF 1VGYA 3Q89A 3A4TA 5AXLA 4AFFA 1J27A 5EWFA 4ED5A 1VQ5S 3G96A 4DL7A 3NCPA 1GAOA 1OSDA 2ROGA 2KRBA 1VC0A 4LF7F 3A1YG 2OEKA 4ED1A 4B9UA 4V19X 3TUJC 1RI7A 4LF6F 3ENVA 2AEFA 2V8VA 2RMLA 1R0CB 3C2PA 2CQPA 4ED2A 2E5IA 2I5JA 2AGOA 4FN5A 3IRWP 2IAJA 4WXOA 4PYDA 4WFBQ 3TOQA 4Q44A 5F8JA 4QYZJ 1FXLA 4IFYA 3DDKA 3ILOA 4PRFA 4DFMA 4LR8A 5D0HA 1IN0A 2Y3YA 3W9JA 4DPXA 2WVFA 2CNKB 4AD6A 3M2RA 1B0PA 3FVYA 4IH5A 4EFAC 4B3RJ 4IOCQ 1U0HA 4AL5A 1FX4A 2RRBA 1Q82T 4KFBB 2HHPA 2IIHA 3KJNB 1S0NA 2DR6A 4MIWA 4ENOA 3GONA 4DSFA 2WSEC 2OI2A 3GV5B 1HHQA 2XGQA 1YBUA 2XO6A 1SUQB 3NRBA 2JC1A 4JI7F 2WVDA 3PCOB 2OD6A 4CWBA 4RL1A 2IDEA 2N4CA 4ICLB 2HHHJ 2BJ7A 5KFVA 2GQCA 1F2HA 5HJXA 4P2XA 5GADI 1YJNS 3PG9A 2UZAA 4ILLA 2A6MA 2KJWA 4CT8A 5KFFA 5IT0A 1JLFB 3R5GA 3IXQA 1YI2S 3DMJB 3R7BB 4UUXA 3HSJA 4DR7F 3AY0A 4CLSA 2WONA 1NJYA 3VVTA 2B3TB 4JBCA 2KXHA 4DN9A 2IA6A 2ZWOA 2YQ1A 3PRBA 2AYBA 4G6VB 5KFHA 1RAAB 4UZBA 5LXRA 5ADZA 2RILA 4C6AA 4Q7AA 1NRKA 5IWAF 3FJ2A 3SFGA 1HI0P 2QA4G 1FKOA 4QQBA 1FRMA 4ZP9A 2H4YB 2HLTA 5DLGA 3MR7A 1NLKL 5HVHA 1LWEA 3MR2A 4OZ2A 1L3KA 2DO0A 4W98A 1AW0A 5THWA 1OYEA 1KS2A 1R6VA 1RBAA 4ZPDA 4LSLB 4DCOB 3IMQJ 5F3TA 2F9DA 3DOLA 2OPRA 2V9KA 4QWBA 1S1VB 3M9NB 3FZ2A 3WZ0A 1QM9A 2GX8A 3MCSA 4DX7A 1UWBB 1IR1A 2RB7A 3US5A 3AQPA 1ZM4A 5ETMA 4K2XA 3IBFB 5AXMA 1RACB 1H7XA 4ZS6A 1NUEA 2AJ1A 1V3SA 1JLAB 1AXQA 1S7HA 2HIQA 2O3DA 1S6PB 2B6AB 3MPUB 2Z2LA 4PAAA 3HHKA 1B4SA 2D3OR 1S12A 1Q7YT 1YWXA 3ETOA 3UW1A 1ZPWX 3PRVA 1ZAVA 2D9OA 3D1OA 1WC1A 1Q53A 1WC6A 1VCTA 2E1AA 3OTBA 4DEZA 1FDAA 3BB5A 2A1BA 3R7NB 3PW0A 4ZN1A 3KJFB 1RKJA 4C3LA 4IKAA 4XDCA 2NXNA 1RA7A 3HZEA 3U1MA 2M9KA 4DV5F 3A3NB 2CYYA 1TK0A 3GYXB 2GVDA 1QUVA 3QBCA 4DMZA 1DHMA 3G2XA 3AHPA 4JOUA 2ILYA 2CPEA 4EGLA 4KHRA 4GKJF 2R4FA 4WTYA 2I5JB 2IAJB 4I2PA 2ZHAA 4U8VA 2J9DE 1CJUA 4KGZB 4IFYB 2UVUA 2LXIA 2ZBQA 1Q5YA 4YDXA 3TANA 1P27B 3SV3A 3T6JA 5HMZA 3ZZ0A 3RU0A 3TX0A 4AQYJ 1U0HB 2GS8A 2H48B 2IJNA 4O44A 4X4RA 3TYTA 5D8HB 1X4EA 7FDRA 4RUCA 2RQMA 2QSFA 4CM2A 4B9TA 3MM8A 2XI3A 3EXYA 1RUSA 1ZM3A 1QTMA 4G65A 3UFCX 3JTPA 2VJUA 1SI9A 5A2QU 3FFIA 2Y0SD 4K2JA 4NZ6A 3EVMA 3QJPA 1R89A 2POKA 2NQPA 3QGIA 2V69A 1C4CA 1R8CA 1NXIA 2CDQA 2RDIA 3L7PA 4JI1J 2J8SA 1YJWS 4CP5A 3ZC4A 4ECUA 3OJUA 1UVKA 3HJVA 3S7RA 1N36F 4HYKA 1TKTA 4DV4J 4ANDA 1VBKA 4IDKA 1Y5NB 2GIFA 1TKXA 1LW0A 2NXUA 1FXDA 1TMMA 1GMVA 2WONB 2HKEA 5EX0A 4OHZA 4K4VA 3CDEA 3BO2A 3MD3A 1YBAA 2R7TA 3VGUA 2IYIA 4J9OA 1RTZA 4LF8F 3MFIA 1OWXA 1YG0A 4I2QA 4WBFA 4OI1A 3HCXA 1RWPB 2QLJB 1FKOB 5C42A 1VRUA 2ZKTA 5DZ6A 3R6LB 2D3ZA 3QJLA 1TV6A 3OLBA 1NK6A 5KFGA 4ERDA 3AD8C 2QL5B 5T14A 4P7VA 1LWEB 5IXUA 5EUHA 4OJHA 1V9OA 4ZPAA 2WB1D 2UXBJ 1K1QA 1A7GE 5K8NA 4YP3A 4LRBA 2V2QA 4C0BA 5CD4A 2DGTA 2VQFJ 1JXLA 4ECVA 4OHXA 4J9MA 3M2VA 3KLEA 2IBOA 4NRTA 4M5HA 2ZOMA 1SC3B 1NDLA 4USUA 3DOLB 2OPRB 5JVHQ 2E9ZA 3ISNC 3BQ1A 1FT8A 1H74A 4W92B 3AD9C 4G1PA 1SCJB 1U0SA 2K1RA 2QL9B 2DGUA 3G8SA 2W7AA 5DQHA 4H4OA 4CH1A 1F3VA 1VK8A 4NLGA 5LMUJ 4M5DA 4YY3F 2Y1JA 3OW2R 1VJWA 2XZTB 3FEXB 3TA2A 3C8YA 1NM2A 1WHYA 1QVGR 2MZSA 2G13A 4DSKA 2XMAA 1PJ7A 3R2CJ 1KFSA 2KXNB 5D6GA 3B82A 1IQZA 4Y34A 4NXNJ 1T94A 1W25A 1LK5A 2XS2A 3OHBA 5FLXU 4FDFA 3HFZB 3DXSX 3FMBA 2XNQA 1TFYA 2EC2A 5GMKa 5LJ5Y 1VLOA 5HMXA 2J9DA 4AT1B 3UNYA 3X3UA 2U1AA 3FUYA 2XS5A 5DGAA 1SB6A 4LF7J 2GVDB 4TLRA 3R1LA 3JTNA 4LF6J 5MAOA 2CJKA 3C6UA 1HNVA 3H98A 2D3UA 3BDPA 4I2PB 1G2EA 3HI9A 3N6MA 4RKUC 4DV6F 1LWXA 1CJUB 4WYWA 2HS0A 2AT1B 1KLMA 2CA9A 2MKCA 2LP4A 4C97A 1XIQA 1ZAXA 4NLYA 3GR0A 3JSYA 3QZ7A 2L9NA 5IV4A 3OL9A 3ZNUA 4O44B 4CZCA 1Y3KA 2KM8B 1HNZF 1KD1T 1EIYB 1MLAA 4F50A 3CO9A 2WK4A 3A8IA 2DVIA 4CRJA 4DSJA 3MM8B 2MLYA 3BSCA 4CQ1A 4DFJA 2HVEA 4M5IA 2UUWA 1R8AA 4O23A 3H5SA 3FFIB 2IBKA 1F9EB 2R7SA 2ZJRQ 1Y7PA 4JI3J 4AXJA 4ZITA 2WSCC 1N34J 2ABYA 2OPSA 3T5HA 4JI7J 4FVMA 3KKFA 3RTVA 2EVZA 2FJAB 1XC9A 2X1FA 4URSA 2DXDA 5IT9U 4DCPB 1HQEB 3Q2TC 4OV6A 5HN0A 1W7WA 3MR3A 4DHVA 3NAHA 1GX5A 3OVBA 2D41A 1TKTB 2L48A 4PG6A 2VQEF 2ACMA 4IDKB 1DQ8A 1QE1A 1YITS 2EXUA 3QWUA 1FRXA 1TKXB 1LW0B 3ZZUA 5D4OA 1RWWB 1KC8T 3QLHA 3PO4A 4DR7J 3NS5A 3GIJA 1DRZA 2XNRA 2EEYA 3M1VA 4UQGA 1ROFA 1NSKL 4DS4A 2GIRA 4UOFA 1SC1B 4I2QB 3PX4A 1HQ2A 4KT0C 2ZH9A 4ETZA 3BSNA 4AL6A 5IWAJ 5LL6d 1VMBA 3KWMA 4FF2A 5C42B 1VRUB 2FD2A 2ZDOA 3SI8A 1X5OA 4JI8F 2XY7A 1JXVA 5HVGA 4NLWA 2CPYA 1HQUA 2ZD1A 3R5BA 3ITHA 4RWXA 1DTQA 2LQJA 4USKA 1M1HA 3IBWA 1FA0A 3BPDA 3PTWA 3MAAA 5KFOA 1EZZB 1U1LA 3DCAA 3OPKA 4YQWA 1HNIA 5A0YA 4F0KA 2IMOA 3BBBA 5AE2A 4X65F 3KLEB 2LCWA 4FPIA 3KLGA 1J2VA 4OLPA 1MMDA 1SVDA 3DOMB 2CPJA 4OI4A 2FJDB 5F3ZA 3CUNA 1WTFA 3AFGA 1VQPS 2KVQE 4DR6J 3QQCD 1NB2A 2DO4A 2OAUA 2RKIB 1NHKL 2ZJQQ 2C3OA 2CWXA 3F56A 1EAYC 1Q81T 4OYPA 2K1RB 4DCJB 4LBIA 4I56A 4X4PA 4H4OB 3AOAA 3NS7B 2HVIA 1FDBA 4P75A 3FRYA 3IG1A 2FHOB 3BGFA 4M5DB 3D0GE 4E0DA 1U1KA 4JI6F 1FD2A 1GK8A 4ZPBA 2FB0A 3JYTA 1NAQA 2KYXA 2KT5A 1WOSA 3IR7B 3JQKA 2RT3A 3O5TB 4KAIA 1R31A 1RP5A 5HQLA 4Y00A 3S01A 1VC5A 5AT1B 3HP6A 3UPFA 1NK7A 1SKSA 1K8AT 4M5KA 3GFZA 2JVRA 1QD1A 1LQ9A 4GMKA 1GNKA 4NASA 3R3TA 1KR4A 1VHFA 3F0NA 3FK4A 2DR9A 2OPPA 2C2MB 3B54A 3O3LA 4WK1A 1JXEA 3H2VE 2B8PA 2CQ2A 4OX6A 3C46A 2ZBCA 3C6UB 1RBLA 1SQFA 4OL8A 1HNVB 4GO5X 3CJSA 1QVFR 1S9GA 2XC9A 2YKMA 3HT0A 2FY1A 2ZWPA 1B7YB 2Y9HA 2XY5A 1RHRB 1KLMB 3A12A 2KG1A 1WF0A 2GJ2A 1R43A 3VAIA 2VKRA 3AOCA 5G4DA 4B08A 3KHHA 4L72B 1WG5A 2GNKA 1S6OA 3UDVA 2EG1A 2IJFA 5AXNA 3HDSA 3KLFA 3J80U 2ZM6F 3HHLC 1RAHB 4KHMA 4X84A 2C3UA 1XMOJ 2ZH6A 5KFYA 1HNWJ 1RU2A 1IXKA 2XULA 3VHQA 4WFZA 4KC5A 1TL1B 1I94F 3FNNA 4L73A 4DF8A 2OPSB 2HQFA 2W1BA 3CE8A 1H98A 2W8LA 1X4AA 2K3KA 2R7RA 3D28A 2FUG9 1DZ5A 3GV7B 2BRKA 2ZE2A 3PKMA 4N76A 5K20B 4GVLA 1QY7A 5M2PA 3I56S 2FYXA
chains in the Genus database with same CATH topology
3RRGA 4URGA 3N0VA 4F4XA 1N33F 3SQGB 4EBCA 2OPQA 1X4GA 1IM4A 2FGCA 2ILZA 4DSIA 4J9QA 3WBZA 1F9FA 2PIIA 1JLGB 1ZPVA 3VAHA 3H8YA 3LP0A 2LLZA 1QE1B 2ERRA 4Y2CA 2W7OA 3UWTA 4WE1A 4DQQA 1HFEL 1S1TB 1S10A 3IAS9 3FEZA 1D8YA 2E29A 4RW9B 2OSRA 3UDCA 5HMWA 3Q8PB 2QZ8A 4P6QA 1S0MA 2J8AA 2UV8A 3H4DA 4M63A 2FVSA 3KK3B 3QLHB 2DNNA 1BQNB 1N0UA 3IRXA 3V6DB 3KK1B 3MUVP 2ASYA 1ULRA 4NL5A 4K5RA 5C24A 1V3RA 1CQNA 4RBUA 2FJWA 1JLEB 4HL9A 2V4RA 3WC2A 1G7CB 4URQU 3M1VB 1GT8A 2DR8A 3H40A 2GMJA 2IYGA 3MZIA 5L9XA 4HEA9 3N9UC 4ID5B 4TU9A 3I31A 2KG0A 3OL6A 4F4KA 5DDRC 1Y9OA 1JLQA 1N4LA 1EETB 1P8GA 1MW7A 1VQSA 2LA4A 4KR0B 4ZVHA 2JLEA 1IUJA 3PEJA 4Y6IA 2EW9A 1HPZB 4F26A 2JEJA 4F3OA 2VONA 5FIIA 1SXLA 4AYBD 2HNZB 1BLUA 4DL0C 2E1CA 3E2EA 3FCHA 1Y3JA 2B5JA 5E3CA 3VTIA 1U25A 1DBDA 2UV8G 3SYZA 2ADCA 5EWGA 2EKYA 3CJKB 2V8DA 3K58A 1B64A 3CCUS 3MF5A 2G4BA 4ZDNA 3GE9A 3K5OA 1FE4A 4FVCA 2CQGA 4PCQA 3Q22A 4BHQA 3BGUA 5T7LA 3I82A 3OR2A 3VQTA 1N56A 2DR5A 3OR1A 3GWCA 5KAKA 5HP1B 2BA9A 4A48A 1N5TA 3KHLA 1IKWB 1IJFB 2LU2A 3I0RA 3BR8A 4B9MA 3I96A 4F2RA 1HQUB 2GHVC 2QEXS 2ZD1B 4B02A 2EFOA 3OXLA 2CJ9A 4RBTA 3ITHB 1VQ6S 1DTQB 1F5AA 4X4NA 3DYAB 3LAKA 3U1NA 3MOJB 5AJ3F 4J9LA 4MFBA 2UXDF 5GADU 5J1EA 1Z1ZA 1ZOTA 2XMTA 4TU8A 3N5FA 2F7VA 4HHJA 3HVRA 1HWUA 4KGKA 4XDDA 4A47A 2DITA 5HQ8A 2OFGX 1U09A 2BE2B 3J7YI 4EBDA 2R7VA 1SC6A 3CC7S 3PV8A 3TAPA 3VCDA 1VS3A 3IWLA 3T19A 3W2VA 3NMAA 2L9DA 5DJBA 2FLOA 3QMQA 1OPIA 2C2EA 2MKKA 1VRTB 3GV8B 4N56A 4Y2IA 2W9CA 5L1JA 3OTDA 4O3SA 2OP5A 4ZVEA 1NKEA 3UCUP 3RAMA 1FJGF 2Q1LA 4TYAA 5A0YB 2WAQD 3OJSA 1YJVA 2M8DB 1MROA 4H4KC 2VBYA 1VBXA 4GC6A 4B3MF 3PJXA 3MAQA 1D8ZA 2AJQA 3FSYA 4RNHA 3KLGB 4C3KA 3IS9B 2V4JA 3PW7A 1JJ4A 2FPHX 2VBZA 1TP7A 2F3JA 4M94A 2DJWA 2J0WA 3NNCA 2ROPA 2RRNA 3IN5A 4FBUA 2AF6A 2R7UA 4UOCA 3OVSA 4IG0B 4DR5F 2FVRA 4G1IA 2DGSA 2XZWA 5DRKA 1CEZA 3HHLD 1C2PA 3CCSS 3GIIA 2E7XA 4UUWA 4Q8EA 2DIUA 1HWIA 2XMVA 4RW6A 4MAKA 2D9PA 4NWBA 5C25A 2PMZD 4ECRA 5CZXA 2I8EA 4KPYA 2Q6BA 1Y4ZB 5K9FA 3CCQS 2BJEA 4FP9A 3JSMA 4DN0A 1S9EA 1CC7A 3EUNA 2R2TA 4K4XA 1X9WA 3EGNA 4Z2XA 1WACA 3SCJE 3V6HA 1LOUA 1AUDA 4MK9A 5J2PA 5CYMA 4JI5F 1GH8A 1ZH5A 2CIMA 2COLA 2XMKA 3LOUA 5KT2A 4C2MA 3P5TL 4NYPA 5EDWA 3KNAA 1S1XA 2XBPA 4USJC 4CTAA 2FJVA 4JI0F 3J7Z5 1RJJA 2CQIA 1M5SA 3BSOA 1YJUA 2IVFB 3TAMB 4F3MA 2HNDB 3ZZPA 4WKYA 2F4VF 4AQYF 1FRHA 3IWNC 4I0WA 5K14B 3K0JA 5A8WB 5FDLA 4RUAA 2UUTA 3M8SA 1O8BA 1ZAWA 4ZCLA 2EWHA 2V94A 4DOZA 4DBQA 1CPZA 3FMWA 4PQAA 3OFHA 2LYVA 2EC0A 2JX2A 2KM8C 3I0SA 2ZUGA 2MQQA 3JYTB 3TRGA 4B9LA 2O5DA 4KFBA 2RU9A 1RGVA 1HARA 3E01A 2HNYB 2QSWA 5IM0B 4JI2F 3HMJG 2VFUA 1X5TA 4NLDA 1VOMA 1FE0A 2QMWA 3OV7A 2AYMA 2H9ZA 4PUOB 2HRUA 2DNKA 3I6PA 4WFAQ 1D9DA 2XEXA 4IO9Q 4FXVA 2UUAF 4Q0BB 2V2KA 1RTDB 4IOBA 5F8HA 2LA6A 1VIOA 3NKYA 4YR2A 1F2GA 1OSCA 1RT6B 1X7VA 2MDAA 2W25A 5B0DA 4TU7A 3CCRS 1APSA 3D1HA 2MKHA 2QMXA 1VQLS 2CFXA 3M2UB 3N6LA 2VPWB 1IKVA 2O01C 2WB4A 4ZCKA 2HGMA 4QU7A 1U48A 2O67A 3O6QA 3BO4A 1SUQA 4K4YA 2MHEA 4FF3A 1UJ4A 3QPIA 5DO2A 3FSIA 2ZC3A 2YX4A 4PPZA 2NZ4A 1MMNA 1P6TA 3KG4A 2ZNYA 1SL1A 4ELVA 1TUVA 2GA7A 5FLXY 1U2FA 3SCIE 1PO6A 4I7FB 5L1LA 3OSPA 2KRRA 5J2QB 1IKXA 2DNPA 1A6LA 3CF5Q 4KRWA 3DFEA 1T8EA 2OPPB 3DRRB 4ILRA 1VQKS 1XNQF 5B0BA 2XG8A 4HTJA 3BN4A 1KQGB 3EPIA 3G9CA 3T6BA 2HVHA 1CSJA 1Q7LB 1NO8A 2M88A 5MLCV 3CCTA 3VF0B 1JLCB 4F2SA 2MYFA 2B0GA 4F4YA 3AH6A 3DRXA 3EGZA 1S9FA 3MMCA 2DNYA 3RRHA 2IM0A 4IG3A 2AYEA 3MEDA 4DL3A 1UFLA 1K0TA 3IAM9 3JTOA 3PX6A 1JLFA 2P9EA 2WHOA 4PG7A 4DR1F 2FDNA 3DLEB 2JVOA 5E5NA 3DMJA 4FXDA 4A8YA 1U45A 1NEEA 1S9GB 3MXHP 1D1UA 2UVRA 1TVRA 3VAMA 5BYRA 5D3GA 4B3SF 2F8HA 2YKMB 2IVYA 2FLPA 3CULA 2HS3A 3LP1B 2LECA 2J0SD 1MSWD 5B0GA 2DGWA 2C3MA 1TV6B 2VH7A 2KFYA 4FYDA 2CJBA 3LWMA 1T05A 4RU2A 1K0VA 1NU4A 2EBEA 2I2YA 2F9JA 2C2DA 3FSXA 2JLGA 1U6FA 2GMHA 4O3OA 3O1LA 1HNXF 3POTB 1PC5A 1KEKA 3RB3A 5KG6A 3Q24A 4C8OA 3H2LA 4K4WA 4NA2A 1FKAF 3G6YA 3B4MA 3GIMA 2RVJA 2NUHA 2HYIB 2C22A 2W9BB 3G86A 4B9NA 4K50A 1B7FA 3DLKA 2KB2A 4YR0A 1RTIB 4TNOA 4MKBA 5KOXA 2XHWA 5L39A 1U4BA 1Y5LB 2KVIA 3M32B 3OUYB 2FC9A 4O3QA 3TP2A 1Q8IA 1VQYA 3SSSA 3HKZD 2KT3A 4RLEA 5D4LA 1VBYA 2BDPA 2MKIA 3K5NA 2QIFA 1HBOB 4BC9A 1U49A 2PA8D 3R5DA 3SV4A 4WZQA 4EZ9A 4DL4A 3MM7B 5EX3A 5KT5A 2WCXA 4WCEQ 3KLFB 3M2VB 3CMES 2NLWA 2WOMB 2B9WA 2QA1A 4I4BA 4RNFA 2OSQA 3LWLA 1U1MA 3MMAA 4J5OA 1Q86T 2DGQA 1H3DA 5EGYA 2LMIA 2GJIA 4X4TA 5DLFA 2DH8A 5EHHA 3V81A 1IJEB 2EG2A 4LQ9A 4MK7A 3U02A 3PIPQ 1P9QC 3TVZA 1N54B 4DLEA 1M1KT 4N8NA 1JLBB 3OQ2A 2W9AA 4XAKA 3M4XA 2VUGA 3SCKE 2GMLA 1WEYA 4QWCA 5KT3A 4ZA1A 2BXJA 2FHMA 3DRSB 1N5VA 4ETXA 2QO3A 5JJBA 5F9NA 4DR2F 1B0VA 4RU9A 5E3PA 1N5YA 2FGOA 5D78A 3S6EA 4ED8A 1TR0A 4MKAA