2DNZA

Solution structure of the second rna binding domain of rna binding motif protein 23
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
95
structure length
95
Chain Sequence
GSSGSSGLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRALEQLNGFELAGRPMRVGHVTERLDGGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Probable RNA-binding protein 23
publication title Solution structure of the second RNA binding domain of RNA binding motif protein 23
rcsb
source organism Homo sapiens
total genus 10
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dnzA01
3G8SA 5DDQC 5GMKa 3G96A 2VODA 2KHCA 5D77A 4ED5A 2I2YA 2DGUA 1S72S 1URNA 4WIIA 4TLQA 1UP1A 1ZZNA 1YI2S 2ZJQQ 4IUFA 1YHQS 3CULA 3BO2A 1VQ7S 2RS8A 2JWNA 1NU4A 3TP2A 2U2FA 3NS6A 3RW7A 3CCLS 5JVHQ 2HGMA 2A3JA 2KM8B 1JJ4A 1DZ5A 2X1AA 2EK6A 2MJNA 3TO8A 4C7QA 2LYVA 2CPXA 2PE8A 1QVFR 1WI6A 2CPZA 1X5SA 3P5TL 2MQQA 3CC7S 5DDRC 5CXTA 5EN1A 1WEYA 2G0CA 1YWXA 4M5DB 2RNEA 1FO1A 2MKCA 4EGLA 1N88A 3CTRA 2D3OR 2LXIA 3EGNA 1HA1A 2DISA 1YJNS 2MSTA 2FC8A 3CD6S 4UY8T 2N82B 1U1LA 3IRWP 1A7GE 2DNMA 2XS7A 4QU7A 2KXHA 1X4FA 1VQNS 2CQCA 2K8GA 2DHGA 2BZ2A 4Y0FA 2ZJPQ 2RS2A 5GADU 1VC5A 1VBXA 3R1HA 4PR6A 3VAJA 1U1PA 3NNHA 1N52B 1VQ5S 1CVJA 5BJRA 2GO9A 2DNYA 2OSRA 3BO4A 2DGTA 1R8PA 2MZQA 1WI8A 2CJKA 2DHSA 2RRAA 1P27B 1R8HA 2M9KA 3CMAS 2XS5A 1U2FA 2X1FA 2J76E 4YUDA 1OIAA 2M8HA 5ITHA 2KXNB 3CPWR 3DLLQ 3CXCR 2CQ4A 4CQ1A 2OTJS 2M70A 1HD1A 2N7CA 1ZH5A 2MZSA 2EVZA 2RU3A 2CPIA 4IOAQ 3ZZYA 3UCUP 1OO0B 2DNGA 3SMZA 5LXYA 1X4EA 3VAFA 2CQ3A 1KOHA 1WWHA 2MY8A 3THPA 5LXRA 2CQ1A 2KRRA 3J7YU 1DBDA 2MPUA 2QA4S 2VOPA 1XN9A 1SJRA 1VQ9S 1YIJS 1FNXH 3G4SS 1NJIT 3P3DA 3R1LA 1WHWA 2CQGA 1JJ2R 1U6FA 4LMZA 2F9JA 1K8AT 4V19X 3CUNA 1NO8A 2N3OA 1M5PC 4YB1P 2EK1A 2MZJA 1IQTA 5DDOC 3VF0B 3MURP 2ADCA 4FXWA 3BS9A 2MYFA 4Y00A 4ZKAA 5IQQA 2DIUA 4UQTA 5D78A 5IFMA 2DH7A 4WF9Q 1AUDA 1PGZA 1VBZA 1X4BA 1X4DA 1O0PA 1X4CA 2DO4A 2KM8C 3TYTA 1RKJA 2OTLS 4F02A 1X4GA 2KG0A 2MQMA 4TU7A 3US5A 1M1KT 2CQDA 4WKRA 2DNNA 1M5VC 1N8RT 2J0SD 1W2BR 1H2VZ 2KFYA 3VALA 4YOEA 2XB2D 2DH9A 2MSSA 5LJ3Y 2XS2A 2AYMA 3S6EA 4CH0S 3CCMS 2YH1A 5DETA 3H2VE 1UAWA 3JB9k 1ZZFA 1FJCA 1VQ4S 3CCSS 3NNAA 1SXLA 3B4DA 2ZJRQ 5CYJA 4P6QA 4BS2A 1WHVA 2LXUA 3CCQS 2N3LA 3S7RA 3VAIA 4J5OA 1WEZA 5MLCV 2AYEA 2MKKA 5HL7Q 2DGSA 2KT5A 2MKHA 3EX7B 3SDEB 1KD1T 2G1DA 1UFWA 4OZ0A 2DGWA 3P6YC 2CPFA 2MQOA 2M88A 2RRBA 3U1MA 1VQ6S 2MZRA 2MB0B 2DO0A 2M8DB 2RUGA 2GHPA 3K0JA 2M0GB 3CCES 5GAHU 2M7SA 2RQ4A 1U1OA 2YTCA 2MGZB 2L41A 1FHTA 2Q79A 3CCRS 5GAEU 2HGLA 4Z2XA 1VQKS 4PRFA 1H6KX 2LA6A 2U1AA 3SXLA 4FXVA 4TU9A 2KU7A 3UD3P 2HYIB 2FY1A 2WBRA 1KOOA 5HO4A 1YTYA 2DGVA 5DM7Q 2E5JA 3IWNC 1D8ZA 2DNOA 1F9FA 4U67Q 2DHXA 2UP1A 4OZ1A 3UE2A 1Q86T 1M5OC 2VOOA 1VQPS 1L3KA 2L08A 1SJ4P 2NLWA 5DDPC 2CQHA 2MMYA 3CCUS 2DITA 1KC8T 3NNCA 2L9WA 2M2BA 4A8XA 1WHYA 3HI9A 2DGXA 1VC6A 3D2WA 2MJUA 2QEXS 2CQ2A 3VAHA 2MXYA 1VQMS 2AD9A 2VONA 3NS5A 2LEAA 3EGZA 1DRZA 4QU6A 3B4MA 1OWXA 3ULHA 1YJWS 1U1KA 4F25A 3FEYB 2D9OA 4CIOA 1Q82T 3N9UC 2DNPA 2OSQA 2KYXA 4C4WA 3ZZZA 3H2UB 3MXHP 3UCZP 2MQLA 2CPDA 3FEXB 4WFNQ 3VAMA 1FJ7A 2DNHA 2E5IA 2J8AA 3MUMP 5CA5A 3VAGA 3BEGB 1VQLS 1HL6A 2CQBA 1A9NB 3MI7X 1M90T 2AYGA 2KVIA 3MUTP 2MQPA 2YKAA 1BY9A 2MQNA 1WG4A 1X5OA 1WF0A 2X1BA 5H1SV 3S01A 1FT8A 4RU2A 4ERDA 2DGQA 3UCGA 2LQ5A 1X4AA 1VQ8S 2B0GA 4WCEQ 2DH8A 2MZ1A 5IM0A 1D9AA 1H2UX 2DK2A 1SJ3P 2CPYA 1YITS 2M52A 3G8TA 1WTBA 1U1QA 3J7ZT 3UWTA 1VC0A 4LIRA 4WFBQ 2QFJA 1JJHA 5FJ4A 2HVZA 4WFAQ 2ADBA 1HD0A 3CMES 1FXLA 3CC4S 4F26A 2FHOB 2M4MA 1QM9A 2JX2A 1OPIA 2LEBA 2F3JA 3VAKA 3U1LA 4W92B 1H2TZ 2F9DA 1UW4A 3MD1A 2KG1A 3R27A 4C0OC 2NZ4A 2MKSA 3PIOQ 2CQPA 2I38A 1RK8A 4PKDB 3G71S 2LECA 2FPHX 3MOJB 2LA4A 2KXFA 3SDEA 2RT3A 4QQBA 2CPEA 1WG1A 2XNQA 5LSLA 2MZTA 4CH1A 3CCVS 1P1TA 2JRSA 3UD4P 3RW6A 3THTA 1WG5A 1N54B 2FC9A 1K9MT 3BO3A 2RQCA 2D9PA 2MGZA 4W90B 3G9CA 1VBYA 3V4MA 2LCWA 3I56S 2E5HA 5GVQA 5JVGQ 2MKIA 2E5GA 2SXLA 3P49B 1Q7YT 2BOPA 1X0FA 1G2EA 2HGNA 2RVJA 2J0QD 2LMIA 2PEHA 1U1NA 3G6ES 2DHAA 5GAGU 3LQVA 2DNKA 2KH9A 3NMRA 2YWKA 2OJ3A 1SJFA 2DIVA 3Q2SC 2XNRA 3MD3A 3CF5Q 1M5KC 1KQSR 1JMTA 4IO9Q 1X5PA 2CPJA 1YJ9S 2G4BA 2DGOA 2DNRA 4LJMA 4QPTA 5DM6Q 3I55S 2JVRA 2CQIA 2MY7A 5LSOA 4IOCQ 3LPYA 1DHMA 2OIHA 1B7FA 3OW2R 1S79A 2X1GA 5LJ5Y 1SJQA 1X5TA 2XSFA 2KN4A 3Q2TC 2ERRA 2CQ0A 1U6BA 1QVGR 1Q81T 2MKJA 1PO6A 3MDFA 3S8SA 1FJEB 1WHXA 2YH0A 2CPHA 1WF1A 2KI2A 1WELA 2E44A 2DNLA 1U1MA 1U1RA 3L3CA 2O3DA 2AYBA 2DNQA 2MHNA 1VQOS 3DXBA 2DB1A 3CCJS 2JVOA 2V94A 3PIPQ 2LKZA 1WF2A 4TU8A 3MUVP 1X4HA 1WEXA 2KRBA 3HHNB 5IM0B 2HZCA 3CC2S 1K73T 2K3KA 2DNZA
chains in the Genus database with same CATH superfamily
3BSOA 1BE4A 4KYZA 4ZVEA 3R6GB 1Y0HA 2D3UA 3CJKA 5C2CA 1I6JA 4WPAA 3ETMA 4Q45A 4IQXA 2CKWA 4P52A 3DOLB 3GJSB 3R5GA 2P2CB 2J9EA 2B3TB 1C0TB 2C3OA 2PD1A 2J7KA 2OPQA 2HBYB 2XSJA 4ECTA 1IBLF 3EGWB 1QE1B 3ILJA 1ZA2B 1TAUA 4FPRA 4DPXA 4AT1B 2BXJA 3MMCA 2EI5A 3A8EA 1H38A 3T9ZA 3U7JA 1SKWA 2VG6B 1NSQA 2VB6A 2NPFA 2A2DA 2V2VA 4OHXA 3PX0A 1WUUA 2EVZA 5KFQA 2VJUA 5LXYA 1GXLA 1NRKA 4JI7F 1KSPA 2FQQB 2W24A 1S49A 4Q8EA 3N28A 2NSCA 4Z37A 5CABA 2J7WA 8RUCA 4V19X 3RJMB 8ATCB 4DV6J 3MURP 2ADCA 1IBKF 1RT2B 4ECQA 5AXNA 2YWEA 1O0PA 1X4GA 4CYUA 2VFVA 2XG8A 3WQPA 1RCXB 5HANA 4WYLA 2XB2D 3KLIB 1RP5A 4DL3A 4CH0S 4BHQA 1C1CA 2NREA 2MHEA 3QIDA 2JL9A 1FCAA 5CYQB 4OJHA 4P10A 5K8PA 1T0TV 1WHVA 3D0HE 3M05A 1UKUA 2B9EA 1VQ6S 1T7PA 3NXZA 4DI6A 1NPRA 1U6ZA 2RDJA 2YTCA 4F50A 1WDTA 3QRPA 2VL1A 2ZH4A 4LFAF 4ITSA 3I82A 3AAWB 2VIHA 1SC1B 2OLWA 3Q8SB 1YTYA 1DQ8A 5KFJA 2CWKA 5AJ3J 4U67Q 4J9MA 4JUZA 1FK9B 1VQPS 2KT3A 2XYGB 1UVIA 2IRUA 3IC1A 3IWXA 1OSCA 3K5PA 5D3GB 1S7HA 2C2MB 4DL4A 1V3RA 4DR7J 3PW7A 3ULHA 1IWGA 1FDAA 2D9OA 1UFLA 2ZOGA 4C4WA 2Q66A 3ZZZA 4DV0F 3R7BB 2CPDA 2E5IA 1JLEA 5HBMB 3SBMA 2CQBA 2ZH5A 2OPSA 2KVIA 1X5OA 4N8OA 4GKKF 3S01A 5M2PA 3I5BA 2WHOA 4JI4J 2V6AA 2HQ3A 2Z0GA 2J0XA 4FVMA 2VQFJ 2AMCB 2POKA 1A0OB 2FDNA 2YNGB 1PKUA 4FF1A 2RDDA 2R8JA 3ICLA 2OGUA 2CZVC 1T05B 1HQUB 4DV3F 2F9DA 3I0RA 1RADB 2AJ2A 2P8IA 1VI7A 5J2MB 2ZBQA 5BR8J 1EJ7L 3SDEA 5KFXA 1WG1A 5LSLA 4O3PA 3CCVS 3THTA 3TUIC 2FC9A 4E98A 2D9PA 2IVYA 3S1TA 3G9CA 1CQNA 5L46A 2XMWA 3QLHB 2ASDA 5F3TA 3UFCX 4DFMA 2EW9A 1S57A 1TAQA 4N41A 4QWEA 2OJ3A 4NLYA 2XBPA 3TA0A 5KG6A 4X65F 2CNLB 3M8QA 4MH8A 4F3OA 4OFZA 2V34A 4QIEA 3BJYA 1NJZA 2JVRA 3LPYA 2MKYA 4PWWA 1X5TA 2FLLA 1QVGR 3MGJA 4QR1A 1Y9OA 4ZPVR 5F0UA 1U1MA 1IXKA 3SSRA 2BJ1A 1VQOS 4DV2J 3T5LA 4X66J 2UUAJ 4ECSA 1WC0A 4ZK7M 1WEXA 3W2VB 1RAEB 1IVZA 4EUVA 5LM7E 5FD1A 2RB7A 2HWHA 3I0SA 1IBKJ 4M94A 2B4VA 2BACA 3MTJA 3TP2A 5KFAA 3NS6A 2UUCF 1JLQB 2BW7A 2QL5B 3D0GE 4WU2A 5J1NA 2ZH1A 1JLCB 5K14A 2PI5A 4KB7A 2NXUA 4LF6F 3I31A 4UY8T 1U1LA 3DOMB 3CCZA 2GIRA 3LWLA 4YDXA 3OPKA 3DC2A 4J9KA 2QN6B 3R1HA 1NPKA 2ABYA 3OSPA 1X60A 3PEHA 3MMBB 2AEMA 1OIAA 2ZFHA 1HNVA 2YNIA 3SI8A 4JI2F 1SH2A 4X4NA 3ENQA 1SQFA 3DOKB 4IOAQ 2ILZA 1X4EA 2AWZA 1NB2A 1D0EA 1DBDA 4ZPWR 1U02A 1URRA 1RT5A 1NJIT 2HMIB 4R8UB 1EKSA 1JK9B 1F2GA 4YDDB 4LMZA 1VOMA 4CO2A 2XLJA 1VHIA 4LBPA 3POTA 3TVZA 3AFGA 3H5YA 3RYLA 4ILRA 4LFCJ 1RTJB 4UQTA 2VUGA 1EZZB 1VRUB 2Y1LB 1NM2A 4NXMF 1PG5B 3RG6A 1ZS6A 4HI1A 5KFMA 3J80Y 5B7WA 2AEFA 3S6EA 2HFNA 3CCMS 4JI1F 3MM8A 4YR3A 3NNAA 3TRGA 2GO8A 2I6WA 2DCUB 5T14A 4K0KJ 4BS2A 1ULRA 1L5UA 2LXUA 4MAKA 4ECUA 1YJRA 4RNMA 3AQOA 2IHR1 5CZXA 1VJWA 4DPTA 4ZPDA 4UUXA 3CDEA 1T3NA 2CPFA 2B5JB 3OFGA 2OO4A 4CP5A 2FVCA 4CLTA 2GHPA 1TKZB 3DXSX 1U1OA 1HQEB 4M5JA 1FHTA 2JLFA 4YB5A 2Q79A 1XK8A 3BSAA 2XHCA 3X1LB 2IMWP 5DGBA 2KU7A 2HYIB 2WBRA 1KOOA 1S9GA 4ZVRB 4OZ1A 3K8VA 2VOOA 4ATNA 5KFYA 4Q44A 3DLBA 4JV5F 2MQ8A 4RW6B 2QEXS 1UEVA 3OLBA 3EGZA 3FEYB 4R25A 2ZDOA 1SJ1A 2XY6A 3UCZP 3EDQB 3VAMA 1NSKL 4NYOA 2KO1A 2DD8S 1HIYA 1S1UB 4LIWA 5F8IA 1U8WA 2J6TA 5HSPA 3SCKE 5B0AA 3AD8C 3TI0A 5B0EA 2AJFE 5IM0A 2KB2A 3O2IA 2HHPA 1RT1A 1N5VA 1N33F 5J2QB 1NH7A 3G8TA 2HNYB 1YX2A 4OYOA 4L6V3 4ID5B 1VC0A 2BE2B 1HWJA 2HVZA 1R89A 2ADBA 1LQ9A 3QZ8A 3DNCA 2DR5A 1QM9A 4H4KA 1HNWF 1RHKB 3AB2B 3ZFVA 2YKMA 2WW8A 1QAYA 1TVRA 4I2QA 1OSDA 1I5OB 2ZDPA 3FQKA 1CJUB 4PQUA 1J5EJ 2UUCJ 1GTEA 2MKIA 1SC4B 3DRYA 4N47A 2HGNA 2MLXA 2HS4A 1FEEA 2IAJA 1U1NA 4M5IA 1E6YA 1SC3B 4DUTA 5AT1B 1TL4A 2HQIA 4LF6J 1SJFA 3RU0A 3T5KA 4ANDA 1LWCB 2ATCB 5F8MA 1Q7LB 4KPCA 4JI5F 2D3ZA 2JFKA 4LJMA 4WK3A 2FLPA 3I55S 1B0VA 1U49A 4DWIA 2OPPA 1EARA 3W1YC 2FUG9 3M9MB 1YRUA 1PO6A 2VBWA 5KG1A 3M30B 4DSIA 2YH0A 3TARA 4M5MA 4CM2A 2LDYA 3L3CA 3R9LA 4YB6A 2DB1A 2VKZG 1S99A 4EEYA 2DNZA 2B7CB 3G8SA 3MPVA 1UEUA 1RBOB 5HQMA 5A8WA 2DTJA 1ZZNA 4HACB 2XGPA 3BGUA 3OR2B 3RW7A 2GJFA 4C0BA 3M4XA 1Q8IA 3V6KA 2KZZA 3P5TL 5SZTA 4RU9A 2MQQA 3T5HA 2ZNZA 2G0CA 2CJYB 2O5DA 3LW5C 4S0MA 4OZLA 2MSTA 2FC8A 3G2XA 2KXHA 2PFFB 1QAJA 4BBYA 2CADA 3NNHA 1Q16B 3FJ2A 2OHDA 1KP6A 2F4FA 5IOLA 2CJKA 4IG0B 4NXNF 1WSVA 2I8EA 5KT4A 2IYIA 2KXNB 4ZDNA 3DLLQ 3CXCR 1BLUA 5FIIA 4LF4J 1S1VA 1OMSA 1OO0B 2V2KA 2CQ1A 4FPIA 2OFHX 2BANB 1QDUB 4KO0A 3P96A 3HMJG 4H54A 4DHVA 5IZHA 3IMQJ 4JV2A 2EK1A 2ALYB 2GVZA 2XMUA 3UR0A 2J9DA 1KBRA 4GC6A 3OL9A 3LP0B 3EZOA 4NOHA 2GQQA 3VVUA 3US5A 3HD1A 1QJHA 2VG7A 4YOEA 1SH3A 5CD4A 2R8IA 3RBEA 2EXUA 4JI6J 3GFHA 4ED3A 3GB0A 2PT0A 3BR9A 1CJVB 1LW0B 3NOCA 4PXDA 1R0BG 2HZVA 3RRKA 2VBXA 3V81A 2BKPA 2MTLA 3NGTA 1CULA 4KH1B 2N3LA 4ZA1A 3BQ1A 2UXCJ 3DOLA 1JLFA 4P7VA 2J0WA 2UV8G 4OI1A 3T1YF 4DX6A 4EYIB 5EDWA 4X62F 4JYAF 4PWDB 2YX1A 2HNDB 4RBTA 1QE1A 4URSA 2AJ0A 2OEKA 3BREA 1I51B 2W7OA 2E5JA 4KGZB 4IDKB 2UXBF 4WTYA 4PYDA 2VG6A 1N5YB 1UWAA 4K59A 5HMZA 4HI2A 1KC8T 3CJ8A 3HI9A 3D2WA 4L74A 1FERA 2CQ2A 4PG4A 3VHQA 3HHLD 1FD2A 1U1KA 2V2QA 4OZNA 4ZHRB 2AJ1A 1GK8A 3OJSA 4MK7A 1RTHB 2W9CA 4KV8B 2CJQA 3CDWA 5CA5A 3CD0A 1RT7A 1RT2A 2E9TA 4FYWB 3D1QA 1FT8A 3RBXA 4C98A 2W2OP 1VQ8S 1M5SA 1K1SA 1IBMJ 2HHHJ 2IIHA 3HVAA 3MPUB 5KFNA 1MWZA 1SB6A 3KLIA 1SQGA 1KQGB 1QAXA 2QT7A 1JJHA 2J8SA 4EWTA 3QGHA 3LGNA 5CYQA 1OPIA 3MCSA 3N6NA 4O4GA 1WNEA 4K2XA 2BKNA 3DMJB 5KG7A 4NRTA 5D0EA 4P7TA 2C2OB 4OI4A 4USKA 4B9NA 5KG5A 4UW2A 3RTVA 2BA9A 3J81Y 1YJ7A 3HVTB 3LF0A 3DI6B 3I4HX 3MCNA 1G2EA 1F3VA 2ZKUA 5G0RB 3QJLA 1Q5YA 3ZTSA 3KK3B 4DZDA 3CF5Q 1EX8A 3KK2B 2VKRA 1NZAA 3LGHA 4BWJA 4YHHJ 5D3GA 3W2WB 2VC0A 3DCAA 4RNOA 1LXNA 3QFWA 5HROB 4D3HA 1V9OA 3TAQA 1FKOA 5D4PA 1V3ZA 3OHBA 2V9KA 3M8ZA 3TZXA 4ED1A 4DQRA 4KFBB 1CJKB 2HIQA 4RZRA 1PC4A 1FFWB 4LF9J 2LKZA 2Z2ZA 2YKPA 5L1JA 3KOAA 3OSNA 3CC2S 2ASJA 1ZETA 1KWMA 1WDDA 3A13A 2G0IA 4B3TJ 3OL7A 1IQZA 1R8CA 1VQ7S 2ZUGA 5H9FJ 4UTGA 1F5CA 2AW0A 3KJQB 1JXEA 3UVJB 1T05A 4ETZA 1HQUA 3M8SA 3BPSP 1WI6A 1MLAA 1Y3KA 2CPZA 3D67A 5CXTA 3BKFA 1WEYA 5J2MA 1EETB 2YPYA 1NCLA 2EBGA 1HA1A 2DNMA 1SUQB 3HHKA 4FS2A 1TL5A 3EPGA 4U9RA 1BQNA 1DLOB 2YWFA 3RBZA 1GFWB 1Y5NB 3A3NB 2GO9A 5F8GA 4CDIA 3QLHA 2DGTA 3MMAB 4LR8A 1NHUA 3QT7A 1E6VA 1UFKA 2RIJA 4X62J 1I3OB 4F3QA 2RU3A 2DNGA 3EXYA 3EVMA 3VAFA 3SCLE 4NE9C 2H4YB 5F9LA 5BYRA 5C7PA 2RQKA 4DV5J 2M3DA 3P3DA 3GILA 1WHWA 2FJXA 1UJ5A 1TL1B 1JJ2R 4GRSA 3CUNA 1M5PC 4FXDA 2B51A 3GE9A 2FVPA 5KFKA 3AH6A 4BCAA 4RW4B 3NAIA 3IFEA 1RBLA 2XWYA 2OTLS 1YBAA 3QBCA 1JXLA 4B3SF 4L75A 1KEKA 5HMYA 1RHQB 2FHJA 3J81U 1F9EB 2JH3A 1FTCA 1VHFA 1VIOA 2H54B 3EDRB 2KZMA 4XIUA 4P9SA 3H5XA 5I42B 2W4CA 5J1EB 1MROA 1N36J 3W8GA 3CCQS 3KG4A 1JLQA 4J91A 2XO7A 4ILMA 2FJDB 2IC3B 2MKHA 2ZOMA 3ISZA 2JDJA 1JLCA 1MMNA 4JP8A 4X64F 2QL7B 1T11A 3DOMA 3TNVA 1S6PB 1RT3B 1IBCB 1SCJB 3BR8A 3SXLA 3MM5B 4TU9A 1AROP 4MKAA 2FY1A 3ZTQA 1D09B 3FEZA 1YZ7A 1OQ3A 2G13A 3MMBA 2CYYA 1G6BA 4NLXA 2PN6A 3UW1A 2CZ4A 1T9YA 2CFXA 1RWKB 3OTCA 1L3TA 5HVFA 1NXIA 1GMWA 4QZVB 2DGXA 3DOKA 3VAHA 2AT1B 2WOMA 5DG8A 3CIMA 4DR3J 1IKWB 1OS5A 3KUHA 4F25A 2OH2A 1TELA 1HWKA 2HMIA 4R8UA 1TL7B 1DY3A 2FHJD 3IR7B 5KT3A 1H98A 5L8RC 1FKAF 2A6OA 2YKAA 1RTJA 5CYMB 3U02A 1VRUA 2FYXA 3QIPB 5K8OA 1M0SA 3CMQA 4HH1A 4Y34A 2HSEB 3D1HA 4U7UK 2BYCA 4QW8A 4C11B 1XR5A 1B3TA 5EX0A 1DJ0A 5F41A 2F4VF 3A1YG 2UU9F 4PEOA 4WP9A 1LXJA 3M6WA 1LFPA 1HD0A 2GHWA 3ILLA 1UVNA 4KHMA 4W92B 1H2TZ 1UW4A 2H9ZA 4HLBA 2QG9B 4LRBA 3PIOQ 3M6XA 5C25B 4QIFA 1SV5B 4J9OA 3SV4A 1JKHB 2EKYA 1HI0P 4NYPA 3IRXA 3P4UB 1KRPA 1WOSA 1TKZA 2DXDA 1GMWD 1HQEA 3BO3A 3LANA 3V4MA 5GVQA 1MWQA 3QT6A 2HBRB 4GVBB 2ZVIA 1S1WA 3G6ES 4YR0A 1AFJA 2DNKA 2R2UA 2C2DA 3JTNA 1QSSA 1RTIB 1FA0A 1IR2A 4MIBA 3KMQA 5A6WA 4B9TA 1JMTA 1IWAA 5E3PA 1MSWD 3RR7A 4RW6A 3TEHB 1HWIA 4WZQA 1F5BA 1XR7A 3HHLC 3X3UA 1RBAA 1YJUA 3AD9C 1DHMA 4DUYF 2ZBCA 3MAHA 2GMHA 3SIPB 3AXKA 4ZVTB 4Y65A 1YBUA 4K4YA 2JC0A 2BKOA 3KFWX 1UWBB 2QV6A 2FGOA 3I6PA 3N4WA 4Y2KA 1HNXF 2C2RA 2MHNA 1C2PA 2JVOA 4I69A 3FKBA 3EUNA 4TU8A 5ETKA 2DVIA 3OR1B 3D68A 1NUEA 4PPDA 5J2QA 3MECB 2GGPB 1HR0J 4ID5A 2DGUA 1S72S 4Q0BA 3KLGB 2BE2A 3C19A 3EYZA 3HXMA 2XY7A 1NU4A 1TR0A 4QOTA 2GC8A 2IM0A 3ZZPA 4A8QA 1S76D 4C7QA 2XLKA 3PVXA 2YKOA 1GH8A 3PFEA 4Z7CA 4A46A 1HQ2A 3K5NA 2YX4A 2RNEA 3AJ1A 2ZBIA 3DRSB 4IFVB 4ZP9A 5E0OA 2DY1A 1VQNS 1QAIA 5IT9Y 1CJUA 4WIQA 5GADU 2W2MP 1IR0A 5EWFA 3FSYA 1NK0A 1U1PA 3RUBL 2OSRA 3BV8A 1JJCB 2ILYA 4H4OA 1WC6A 4F04B 4USUA 3BGLA 1HFEL 5C2GA 3HZGA 4WXOA 2XGQA 1C0UB 3DLGB 4DS5A 3H4BA 2M70A 2GZOA 2VU5A 4ZOSA 1LWCA 1FEHA 4UOHA 4NI2B 4CNZA 3FFIA 3V6DA 4F8RA 1SJRA 3G4SS 3GU0A 1DURA 4G1QB 1YG0A 2F9JA 1GX6A 3TAMA 3CE8A 1SQEA 4LUBA 2N4CA 5DRKA 3DRRB 4DMZA 1AUDA 2DO4A 4O3OA 2ZOFA 2H5EA 4LRFA 4RW7B 1Y5LB 3ZZRA 1W2BR 2OKQA 2W1BA 3VALA 2VFTA 2BV3A 2YH1A 3OD2A 3JB9k 5A8RA 3G86A 2MDAA 1OY8A 2WVFA 4HACA 3OR2A 3CJKB 4I64A 3EVWA 1N4LA 3N5FA 4DV4F 3L7PA 3ILIA 3GV7B 3VAIA 1HW8A 4KY3A 1J2VA 4P74A 4HH0A 4EO6A 2ZH6A 2F63A 2G1DA 2HRUA 2MZRA 1MN9A 2OPQB 4I68A 4CM0A 2UU9J 1U2RA 2P9CA 3WDOA 3M8RA 2HGLA 4DCOB 4NLPA 1JQGA 3R5BA 1TKTA 2DGVA 3MMCB 5DM7Q 4F0MA 4G6VB 3IWNC 3MFIA 4J9PA 1JX4A 1NDKA 2XLIA 3PRBA 3PXGa 2JNJA 2NUUG 4C8LA 4IG0A 3JSMB 4DDFA 5HMXA 1MU2B 3BQ2A 4AE5A 4DFPA 1UVLA 1CC8A 2XMJA 2HBZB 2YWGA 4OHVA 2MXYA 5DO2A 1T9TA 2BANA 3N9UC 2DNPA 1NDPA 5IC6B 4AQYF 3MUMP 1TP7A 4K4VA 3AQPA 3UI3A 4CLWA 2Q6CA 1WG4A 2E7VA 1T9WA 3LP0A 3QJPA 4CNYA 4HKQA 1HBNB 1SJ3P 4CYUB 2B4PA 4DL7A 1HHTP 4RPFA 1C1CB 5KFOA 5FJ4A 1CJVA 4K2JA 4CLLA 2H3EB 1HNXJ 1UEKA 2LVWA 3OT9A 1Y5IB 2E9RX 3PYFA 4B3RJ 5F8LA 1SPBP 2CPEA 3EM1A 4DV7J 2MZTA 2PMWA 1TUVA 3FDSA 2VPYB 4OLOA 2HQCA 5L1IA 2ROEA 3QO9B 4W90B 1K0TA 2KFNA 5JVGQ 2E5GA 4LF8J 2EC0A 3PCOB 3BYPA 2E1MC 4O23A 5KG2A 4IOBA 1EQ0A 2CA9A 3C14B 4NLTA 3TQEA 1RAFB 4ZITA 1C4AA 4DR4J 4QPTA 1FESA 2W01A 4QPXA 4OLPA 1IR1A 3CVKA 4ZHRA 2EKNA 1SJQA 1HBUB 4KV8A 4N77A 1JLEB 1Q81T 8AT1B 1WHXA 2KVQE 2V4RA 3BN7A 3ZNJ1 2FY8A 2R7RA 4ZPBA 2ZH2A 4N56A 2PI4A 2QTWA 4OI2A 4I6WA 2KHCA 4TQRA 2D7SA 1TFYA 4NLGA 4OX8A 4N76A 2Q1LA 3CJ2A 4XO0A 3SFGA 2QX0A 3TZZA 5JJBA 1YI2S 4LSNA 1S10A 1D9DA 2EK6A 4K4SA 4KAIA 3PYDA 4RJVA 3I0RB 3AHPA 3PHTA 2DXEA 5EN1A 4MT1A 1RI7A 2MKCA 2ZM6J 2D3OR 4RUCA 4URQU 2F7VA 4X4PA 3O6QA 3HSZA 1WD6A 2PSZA 3CT9A 3QWUA 5KFGA 4MTPA 4C8OA 4G3IA 4YR2A 3LP1B 1TFWA 3HVTA 4Q2MA 4QYZJ 4DV4J 4IR9A 4P72A 2FJEB 2ROPA 4CZCA 2RRAA 2X1FA 2J76E 3BGRB 5L9XA 2Z4PA 3GIKA 1ZAWA 3CD5A 2W9AA 3O5TB 1OJ4A 5GMDA 2OPRA 1W7WA 3W2WA 3TWZA 4YFUA 4K4UA 1LWFB 2WCXA 3PRVA 4DU7A 1Q8BA 2YPZA 5IFMA 1UVJA 2YNHB 3RAQA 4KFBA 1CJKA 2KM8C 5I3QA 4USTA 2J9CA 4WKRA 4NLVA 4TYAA 4LRAA 2C2NA 1T9UA 5DETA 1J5OA 4OI6A 4HDHA 2EC2A 2H1YA 4N5SA 2RKIB 2G0JA 4JI0F 5LT5A 2DRAA 2V4QA 4Y3CA 1CLFA 3IR5B 3S7RA 5KFPA 3IS9B 3UDEA 5ETMA 4F4KA 5ETOA 2AZ1A 1KD1T 1FE4A 5T41A 2AF6A 2M88A 1V5VA 5HAOA 2QRRA 3BYRA 4OI0A 3HJFA 1SUQA 3UD3P 2GCFA 1TMJA 4KH0B 1D8ZA 3MMAA 4RW8B 4P2XA 2O01C 3CD7A 4PG8A 1KONA 4A8XA 1YZ6A 4HVZA 2KJVA 2AD9A 1SKSA 3HSDA 3MMJA 1U48A 2IDEA 2ZZMA 2OSQA 2KYXA 1TL1A 3JSBA 2MQLA 5DG7A 3RR8A 1N5TA 3POTB 1SC6A 4RW4A 4ERDA 4FKXA 3H40A 1FVSA 2LQ5A 1VBKA 1Y4ZB 1CQMA 3KHRA 2DH8A 1D9AA 3E51A 5F0WA 4QYZK 2QLFB 4DSLA 4MK9A 1OYEA 1JNZB 1GXUA 3GYXB 2IJNA 4A8MP 2GMLA 4ZVHA 4KIAA 1BWEA 2P5VA 3EWGA 5J1EA 2XCAA 3KLFB 4QWCA 4RWXA 4MFBA 4LF7J 3I5AA 3G71S 1RYSA 2IC3A 3AJ2A 3WIUA 3RBDA 1VLOA 2RT3A 2KFZA 3KJFB 3QWPA 1P1TA 2YY3A 3B54A 2HWIA 2CDRB 2RQCA 1S6PA 4RO0A 3GQCA 3HT0A 3MM5A 1RHRB 2R42A 2UUBF 1FFGB 1N0VC 2DJWA 1VR6A 1JB0C 3QGGA 3T1HF 1KQSR 2O67A 1I94F 2UVRA 2W2NP 3QJJA 4DR2F 4ZJLA 4KHPF 1Q8KA 1NK7A 2ZH9A 5LSOA 4OJGA 1TL7A 1HMVB 1Z2LA 3BH7B 3IM8A 1RCOB 3Q2TC 3C46A 1HBMB 1RT4B 4H4KC 4C8YA 2CNKB 2KI2A 5CYMA 1RAOA 5KFRA 1O8BA 3QRQA 4PXEA 2C3YA 2V94A 3KG1A 3PTWA 3KHLA 3GV8B 3LAMA 3BDPA 1X4HA 4F67A 4C11A 2HZCA 5IM0B 2VODA 5CH7B 3MR2A 5D15A 4JI8J 3CJTA 3CJ3A 4ILLA 4ZCKA 1UP1A 2YVSA 1ZM3A 2I0XA 5JVHQ 2IM3A 2HGMA 4ALZA 3PR5B 5D4NA 2ZD1A 3VGTA 2LP4A 1MW7A 2CPXA 2W7AA 4XDCA 4J9QA 1Q53A 5C25A 1SV5A 5HP1B 1JKHA 4DFKA 2P9GA 3N6MA 2YKMB 2LQBA 5RUBA 4I2QB 2CQCA 4DQQA 3OUYB 5D8HB 4N8NA 1VC5A 1CVJA 4D3GA 3F0NA 3ET6B 2JJ4D 4NMXA 3K58A 1AUSL 2IAJB 4J9SA 1R8HA 3L7OA 1E6YB 4GMKA 2OI2A 4J9LA 4K50A 3NY0A 4DV6F 2LEPA 3L95X 2P6TA 3W9HA 1RTIA 1VRQC 2GHVC 2N7CA 4A8SA 3RGIA 4M5HA 3OXGA 1RGVA 1WWHA 2MY8A 4ZCIA 5K5MA 3DLJA 4U6PA 3LH2S 1U6FA 1K8AT 2BUNA 4DL5A 3K2YA 1RJJA 1FDBA 3MM6A 3NAHA 3GJRB 4HEA9 5D78A 1HPZA 4DX7A 3MR6A 1CJTB 4ZLJA 2AJ4A 1TQLA 2BJ7A 3AA8A 1RZMA 1M1KT 1C4CA 2CQDA 2R7XA 1M5VC 6FDRA 3CW2C 3O3LA 2KFYA 4GC7A 2GIQA 3OR1A 5L1LA 3MECA 4KGMA 4ZMMA 3CSKA 2GGPA 1UAWA 3KLGA 2H5JB 5A8WB 3B4DA 3PY8A 2QL9B 2GNKA 5CYJA 4WK1A 4P6QA 3W9JA 2V50A 3VV2B 3NGRA 2F40A 4OYBA 5DGAA 2VZ9A 5G4DA 2M5YA 3E2EA 5AJ3F 3DRSA 4IFVA 3CCES 4O44B 2C42A 2RQ4A 3V2UC 3C15B 2HRTA 2VF3A 3SEOA 4PRFA 4UOCA 1N48A 4ED0A 1BWVA 1FX4A 2FVQA 3BF4A 4LBIA 2DNOA 1Q95G 5HQLA 2W9BA 2C1EB 4ZIVA 2L08A 2R8KA 3Q22A 3HT3A 1C0UA 3DDNA 3DLGA 3ITHB 1K47A 3EXCX 2FZKB 2ASLA 2M2BA 2IMOA 1S1VB 1MNEA 3KJVB 4NEZA 1Q78A 3NKYA 4NLOA 2VONA 4FYDA 2RF2A 4F4XA 3KHGA 1H7XA 1YK9A 5CCMA 4G1QA 4KO0B 3DGPB 4PG5A 3QSYB 3MXHP 1DQ9A 2VQFF 1KFSA 3Q89A 3VAGA 5IV4A 4FP9A 2WZ1A 1Q79A 4B02A 5LMUJ 1W2IA 1XERA 5SUHA 4DR2J 1NK9A 3FMBA 2DGQA 3DRRA 4HT5A 2HURA 2ZZNA 3HHLB 5DLFA 2LXFA 3DHWC 4A4JA 5M2UA 2NQPA 2V8PA 5BR8F 2NPIA 3UWTA 3QAUA 3D6TB 5GADI 1FX2A 1JIHA 4MJKA 3PJXA 1B64A 1GAOA 3CO9A 3J7Z5 1N6QA 3V81B 1CULB 3H20A 4C0OC 3QMQA 3H42A 3HJVA 1JLFB 2Z2MA 5IV3A 1IM4A 5T7LB 1RWVB 1ZPWX 1RUSA 2NXJA 3M2UB 4RBVA 3A8JA 1RQ0A 4PABA 1G1XA 1LFWA 5KFTA 3OTBA 3LAKA 3K59A 5IXUA 1VBYA 4B9VA 2UUTA 5KFFA 4LFBJ 2R2RA 2BQUA 3M8PB 2QA1A 3IBCB 3JSMA 2I5JB 1MU2A 2F8HA 5IC4B 4ZN1A 1X5PA 1YJ9S 4KSEB 5H9EJ 2DGOA 1EP4B 5D0GA 2F65A 3FSIA 2UVVA 1HKAA 1B0TA 3IAS9 4MK8A 3NGKA 4E2FB 1S6OA 2N4DA 3W3SA 4DV2F 1NSAA 5ADZA 2EFGA 3DKDA 4X66F 2UUAF 4RUHA 3J81j 1FWPA 4B3OB 1U6BA 2W9CB 3M8WA 2HS3A 4DR1J 1RT7B 4B9UA 4DBQA 5A2QY 2WVBA 3A4TA 2E1AA 1ZBTA 3HKWA 3D54A 3L09A 3HHNB 1HBNA 1K73T 1KQKA 1CEZA 4ZVSB 2HLTA 5U47A 4Q8FA 2A3JA 2R2SA 1N0UA 2ZBPA 2QGFB 1RWPB 1C1BB 1GMUA 4WZMA 2NSBA 4O4GB 3LA0A 1U25A 4M5GA 4AYBD 3ILOA 3W63A 4QU7A 1X4FA 4LSLA 2AQ4A 2K8GA 2AIRB 2OMLA 1TKDA 3QNWB 1WKLA 3QO9A 2K2PA 5JUMA 3FBEA 2DHSA 3HX9A 1S6QA 3C14A 1HD1A 1D1UA 2BE9B 1LK5A 3ZZYA 1MMLA 3SMZA 4C6AA 4LFCF 2FB0A 3ENVA 2Y8WA 2QA4S 3W5ZA 4OJ1A 2CQGA 3ZTRA 5ETTA 5KT5A 1HYSB 1IQTA 5ETPA 4ELVA 1LEOA 1FKOB 1VGYA 4ZKAA 1HBUA 1PGZA 3T9NA 3TYTA 3JAMU 3CCTA 3UO0A 4DQPA 4K0KF 1ZPVA 1N8RT 3QYYA 1GNKA 3V5RA 4CTAA 1XNRJ 1T02A 2JSXA 3TX8A 5HN0A 3GCWP 5ETSA 5H9EK 2IJRA 2AYEA 4V1Ak 5KFDA 1FE0A 1RTDA 1GTHA 2KL8A 3GPAA 4Q7AA 4OZ0A 2MQOA 4I6AA 3K0JA 5CD4H 1PBAA 3NEKA 2WONA 4DPUA 4L3KA 4CLZA 2L41A 4UY85 4JV0A 3FNNA 1VQKS 1DAXA 3G82A 1BQNB 4DOZA 1HBOB 1S12A 3LP1A 4MYUA 2K3IA 5ETQA 3NCQA 3L4BC 3KK1A 2CZ9A 2R7OA 2UP1A 3IN5A 4OYXA 4QJVA 3JYTA 5KOXA 1E6VB 4K4TA 5A2QU 5LSRA 5DDPC 1F9HA 3BGRA 4F2SA 2GVDB 4HT7A 3CO0P 3N01A 2IPOB 3U27A 4QU6A 2GX8A 1YJWS 3KDNA 3SFUA 2L48A 2HHQA 2KHDA 2IM1A 2K7KA 4WFNQ 2J8AA 2F5GA 3FC9A 2FGCA 5CZVA 2B8PA 1LWFA 1RAHB 3BSCA 2X1BA 2YNHA 1XTZA 4ZLNA 1X4AA 5ETNA 3CJRA 1FRLA 2RD5C 3KYLA 2DK2A 4DL2A 2RE1A 2L3MA 4OQJA 2GW8A 1GX5A 4WBFA 1PSDA 2Y1RI 4KGXB 2B9YA 3K57A 3R8YA 3DU5A 1JWWA 2RKIA 4M5LA 2PO4A 2Y0SD 1MROB 1J5EF 3LP2A 3HM9A 4KPYA 3OV7A 2NZ4A 3IS9A 5A76A 1IKXA 3NOGA 4URGA 3B8HA 4I56A 3TZYA 4K4XA 1ZM9A 1U09A 4DN9A 3MF5A 1KLNA 2RSQA 4DN0A 1ACMB 2RVJA 2J6SA 2HHSA 4CO3A 3ZZ0A 3NG8A 2FD2A 1T94A 3QT8A 1ZM2A 4RW8A 2YWKA 4I67A 3MD3A 2YX7A 4KKOB 2HAFA 2CNOB 5K9FA 1U2CA 2WOMB 3DN9A 5KAKA 2KN4A 1B99A 1RHUB 4ZVFA 5B09A 4YY3J 2V2ZA 3MR5A 1WF1A 3HD2A 3QATA 4F36A 2O3DA 1S1XA 3CCJS 3SCIE 1S9FA 1ICEB 3MPYA 4ZP6A 3ETOA 5L1KA 2XMAA 3H7HB 2HHWA 5D77A 4FBUA 3W60A 4JI3J 2YWHA 1Z4UA 2D69A 3QFHA 4TLQA 1FTRA 1TL3B 3GFXA 1Q1KA 4IKAA 3LO3A 2KM8B 1JJ4A 1DZ5A 3MAAB 1DTQB 2MJNA 2HNZB 5B0DA 4KJIA 1RISA 5E3AA 3KLFA 2W8LA 5KFSA 4M5DB 2WB1D 1R31A 3IRXB 3IRWP 2BQRA 2XS7A 4X4QA 2LU2A 4OZ5A 4AL7A 3R97A 3FMWA 4ETXA 4Y0FA 4LF4F 4EK2A 4O3NA 2OD4A 2X7IA 5DLGA 2VHGA 1S1WB 1P27B 2YKQA 4P71A 2LFVA 1QSYA 2G2ZA 3BKUA 2GV1A 4DEZA 2J6UA 2QMWA 2LQ9A 3THPA 3GIIA 1PYSB 1Z2ZA 3T3FA 2IM2A 1IKYA 3JXOA 3R1LA 4GKJJ 2H65B 5HK4A 2QLWA 4A8YA 5IQ6A 1NJXA 1HMVA 2MZJA 3VF0B 4OHZA 1HBMA 1RT4A 4JI6F 1YBTA 1S59A 3M6VA 1X4DA 3DLEB 5E7OB 4DL6A 5FLXU 4DSKA 2UZAA 3NWGA 3MEGA 1JLBB 3Q0AA 2UXCF 3SV3A 2QJ3A 3I32A 1FJCA 1TTHB 4Q0BB 1S0NA 1HNZJ 3RB0A 4UZCA 2ZJRQ 4QIGA 3I9V9 2FZCB 3HFVA 3M6UA 2B9WA 3WC2A 4J5OA 3C2PA 2XZWA 5HP1A 1BC6A 3K5LA 4ICLA 3QAEA 2AV5A 2JC1A 3HVRA 2DT9A 2ZUAA 1NB7A 2DBBA 5GAEU 3OUYA 4I4BA 4TYBA 3A12A 2B56A 4OL8A 1UJ6A 3ET6A 4USJC 3FK4A 2K1RB 2PGCA 4H4OB 2R7QA 2QA2A 2Z56B 2CQHA 2MMYA 4IFYB 2C3PA 2BJDA 3AB4B 1NH8A 4PUOB 1XJWB 2MJUA 4X4TA 4O3QA 2GA7A 2ZZTA 3PHEA 5KG0A 2HHUA 3FFIB 3V6DB 2XCPA 1ZOTA 4LRCA 1TMMA 4NL5A 3SYZA 3H2UB 4FNHA 3D5MA 1IBMF 2HHHF 5AE3A 4GO5X 3TAMB 1VYAA 2P9EA 2FJAB 1CS4B 4USIA 1RACB 1HNIB 2GQ2A 3RRHA 1EIYB 3HVWA 2E1PA 4AFFA 4WWSA 2Y1IA 4RU2A 5HJXA 3GONA 1CJTA 4ES3A 4PWUA 1EB0A 3ZZOA 3H8YA 3OFEA 2B0GA 3FBBA 3CDAA 3C8YA 2A1BA 3R7NB 3M2VA 1YITS 4WU3A 1FJGJ 2QSWA 3AA9A 3DFEA 5F3ZA 2QFJA 1FWKA 4IG3B 5A8RB 4P75A 3CMES 2RH3A 1FXLA 4DS4A 1RA7A 2CDQA 3U1NA 4CWBA 3VAKA 3NGDA 5EWEA 3RZAA 1PBUA 4LF1A 3TA2A 2HPUA 2VDIA 1BUXA 3HFKA 4U96A 2XTJP 1RWOB 4DPYA 2JRSA 4DSEA 2OFGX 1WG5A 1P9YA 1N54B 4O44A 5DQHA 4U95A 1K9MT 3C15A 4O0NA 2H48B 1KLMB 3DLKB 1HI8A 2BOPA 5FDLB 4YHHF 5IWAJ 2LQJA 1TKTB 2XWXA 3LQVA 3DYAB 3HULA 4CLYA 5J2PB 1R0AB 3ITHA 5K8MA 1XMBA 2E1CA 4XK8C 3OL8A 2I1RA 5E33A 4ZN3A 2CJXB 4IO1A 4DUZJ 3KJVA 4TY8A 3FCVA 4LF9F 3FZ2A 4L3NA 4LT6A 2EFQA 3TVKA 3DGPA 4B3MF 3D7SB 5LJ5Y 2CJ9A 1REVA 3UDCA 1PCAA 2R4FA 1VMBA 3J7A1 4LBHA 3K5OA 1XMQJ 5KFEA 2YQ0A 4B3TF 1U1RA 1S48A 4M1KA 3D3CJ 2DNQA 3HK2A 2EFPA 1SVDA 3HHLA 3K5MA 5HLFA 2FTRA 5DDQC 4C97A 5HQ8A 5CHCB 2KDOA 4ZCMA 4EFAC 1OY6A 1NPPA 3DGVA 3QPIA 3BH6B 5F9NA 2DXFA 2PE8A 3RAMA 1NDLA 4FYYB 9ATCB 3CTRA 5T7LA 1YJNS 1NK8A 2E66A 2GS8A 3L7UA 3IXQA 3M2UA 2WW4A 2CAJA 4QCLA 1UVMA 3HPOA 4ZLPA 3O8WA 2FVSA 1SBRA 4HTIA 4TLRA 4EZ9A 4DV5F 3BGOP 1MMDA 5HATA 4DG1B 2V5HG 3M8PA 1U2FA 2M8HA 2DEJA 3CPWR 2I5JA 3G87A 2IBKA 5GMEA 3TEGA 1DARA 3IBWA 1ZYQA 1EP4A 3IG1A 1VQ9S 1BQMB 2H5IB 2HFZA 2ZE2B 2VA3A 4MYTA 1N34F 4HDGA 1APSA 3PR4A 2YQ1A 3PV8A 3CJ5A 5CQGA 2BMBA 4FBTA 4Y2MA 3LUYA 4DL0C 3IA0A 4B3OA 4F0KA 4OHWA 4LQ3A 5EX3A 2ALZA 1KQFB 5F8HA 5KFWA 3FZBA 1N36F 3IP0A 1F60B 1RWNB 5GAHI 4G1IA 2MSSA 2HQGA 2O66A 2W2PP 2G9OA 3PFOA 3VTIA 2GAHC 2VD3A 4RUAA 1SXLA 1VRTB 4LSNB 3MPWA 1T9VA 2DY9A 1DQAA 5MLCV 2MKKA 1C1BA 3JQMA 3NMAA 3IR6B 2DGWA 4OJ3A 3P6YC 3GCXP 2CUYA 2MB0B 2DO0A 2M8DB 3UDVA 2M0GB 3SQOP 2HQFA 2MGZB 2C3MA 4PYAA 2KKHA 4NCGB 2U1AA 4C0HA 1RHMB 2XI3A 1EQMA 2IA0A 4IH5A 2MLZA 3CJQA 4ED4A 3Q8VA 4DR3F 2O1PA 2GJIA 1GEHA 1KFDA 3CJ0A 1L3UA 3CCUS 5I3PA 4A47A 5ETLA 3W5YA 4ZPCA 4K4ZA 2HVHA 4GO7X 1OWXA 4IR1A 2OPRB 4FYXB 2QFIA 3FEXB 4AL5A 1HYSA 1HL6A 4DX5A 3MI7X 4BWMA 1M90T 3M32B 2B4OA 1WF0A 5H1SV 3UCGA 4AXJA 2I9SA 2WAQD 1ZTTA 4HR2A 2JHEA 1YJTA 1LW2B 3CWJA 3QGPA 2ZC3A 6FD1A 4B3MJ 4W4MA 3GFZA 3J7ZT 5IT4A 1RLCL 1J5OB 4J37A 4WFAQ 3C6TA 3CC4S 4J7CA 4AD6A 4DR6J 4LF5J 2JX2A 3PW4A 5J1PA 3HDSA 2DR8A 3VGUA 2R9LA 1S0VA 1JLAB 3HCXA 2LA4A 3W9IA 1CG2A 1BQXA 2E5LJ 2R3VA 3R5DA 5MAOA 2HVDA 1KNZA 4KGVB 3OTOJ 2QYGA 3PG9A 4CLUA 1S4EA 1HBOA 1X0FA 3PJ9A 3Q8PB 2VDHA 2LMIA 3OVBA 2ZH3A 4WFYA 4ZLLA 2HWTA 4C8ZA 1YRTA 5HMWA 2COLA 3VQSA 1NMEB 4I2PB 2GVDA 4HTJA 2JEIA 5E3CA 1VDHA 3AOAA 2Y1JA 3T1AA 1RA6A 5DM6Q 3H98A 3NCPA 2Z2YB 1YJVA 2HIYA 1LWXA 5C24B 1TUWA 1HR0F 1SH0A 3ISNC 4I0WA 3O1LA 3OLAA 5I4MA 5IT0A 4Q2LA 1N34J 4KTQA 1OY9A 1S7IA 2X51A 2XI2A 2FJVA 2VASA 3W66A 2LQ8A 2BM0A 2BRKA 4OX9J 2CXEA 3H0PA 3NS7B 3DU6A 4C8KA 2JWNA 2D3O1 1V3SA 3V4IA 3KXDA 3T6BA 1T03B 3ZTPA 1XWLA 1X5SA 1TK0A 5DDRC 4TY9A 1YWXA 4MFBB 1FO1A 2GAGC 4B9MA 4Q43A 2R7UA 4ID8A 3PW2A 3OJUA 4A8WA 4I1TA 2RS2A 3R2CJ 1FRXA 4X4RA 1H7WA 3Q23A 2DNYA 4USVA 2M9KA 3F73A 3IAM9 3EJMA 1IBLJ 2CQ4A 2CG8A 2CPIA 2C2KB 4C8NA 4KKOA 1RT6B 4U7CA 3DRPB 3DHXA 5J2NB 4KT0C 2FZGB 3OFFA 3GP9A 5H9FK 3CIZA 1NLKL 3GR0A 2B8QA 4EYHB 3FQLA 1T9XA 4OYZA 2NYHA 3GV5B 1UTAA 4JI7J 2PIIA 3Q83A 4KGKA 1UPPA 2IFXA 4FF4A 2J0SD 4M95A 4HHUA 2V8GA 5LJ3Y 5D4OA 4F4YA 1QTMA 3H2VE 3GTYX 1XBWA 4Z7YA 1U0HB 1TL3A 5LL6d 3R5AA 5B0BA 2VC1A 2QMXA 2XYHB 3MAAA 1NZ8A 1DTQA 4OZ2A 2HNZA 1RAIB 2ZD1B 1WSRA 5L38A 4EZ6A 1CPZA 1WC3A 3EX7B 4P2FA 4NLQA 4IRDA 2AZ3A 4M5DA 2A10A 2CG4A 2RUGA 2IVFB 4O3RA 1F3FA 3WZ0A 3T5JA 4NWBA 4KC5A 3TJAA 1H74A 3PRDA 4F4ZA 3BZQA 2NUHA 4Q5VA 3HP6A 5BYSA 2FHKA 1GXTA 1W26A 2DRBA 2ZNYA 3CGIA 4LFAJ 3LTOA 2L9WA 3L9ZA 4DSJA 5B08A 1GT8A 1VC6A 3EE3A 4ECRA 3ZXWA 5KT2A 3KJNB 4IYQA 5F8JA 4R5PA 5L39A 3NRBA 2B4UA 2PMZD 2Y3YA 3H5SA 3UN2A 5KFIA 2BVZA 1VK3A 2IBOA 3QT5A 1BGXT 3PDNA 2AGQA 4E0DA 3K7RA 3HF5A 5KFBA 4DLEA 2RHQB 3MUTP 3MM6B 2UXDF 5AXKA 1HPZB 3DLEA 1KKHA 4FZVA 2MZ1A 2R7TA 1H2UX 1VQYA 3NLCA 4DV0J 2AHOB 2PA8D 1O6XA 1JLBA 2QSFA 4B3RF 1YGYA 4GKKJ 2EFNA 2JOQA 4DV7F 5KG3A 1S9EB 2M4MA 5A0YB 1PC5A 2MKSA 2I38A 4LF8F 4WP3A 3MOJB 2CWXA 1FRJA 1RWXB 2OD6A 4UOGA 2XNQA 4CH1A 4DR5F 2HBQB 1QY7A 2FIUA 5DZ7A 3NBPB 3DM2B 3GSIA 4B9LA 4DV3J 4ECVA 4QIWD 3VQTA 2LCWA 3I56S 2F1FA 3LGMA 3KNGA 4O3SA 4DR4F 3UNGC 1YSJA 4X4SA 2HQDA 2KH9A 1TZ0A 2K1RA 2W9BB 3NMRA 5E2QA 2DPJA 2DIVA 2ACYA 3TAPA 2L9NA 2DR9A 4IFYA 4DQSA 4ANCA 4L76A 1F1BB 4PUOA 3HLUA 2BRLA 2JZ5A 3VWSA 3C66A 2MY7A 4KRWA 2RF2B 6AT1B 2DPIA 3M2RB 4C8MA 4FKYA 1SIZA 3C6UB 4YEAA 5C42B 4X65J 4HYKA 3BM7A 1CS4A 3S8SA 1HNIA 2QMUB 3NWRA 4A8FA 1KTVA 2HVEA 3GIJA 2EWHA 2K06A 4ANEA 3AT1B 4MIAA 3JSYA 4DZ6A 2NXEA 2I2YA 4BC7A 2V0NA 3TQ1A 3HHDA 3IWLA 2ZM6F 1R3NA 4OX6A 5GAEI 2ZJQQ 3FGVA 4HL9A 4XTTA 4IG3A 2U2FA 3CCLS 1G7CB 2HHXA 1MN7A 5E3RA 2HK3A 3B78A 3CCWA 2LYVA 4ED7A 7FD1A 1N6QB 2ZH7A 4ENOA 1Y7PA 2ZKTA 4ZCLA 1S0OA 3N79A 1D9FA 1N88A 3EGNA 3D6HB 3AODA 2VH7A 3WHIA 3KTQA 2LDIA 4J9VA 2BZ2A 2BDPA 2VQEF 4NMLA 1N52B 3HHEA 1VQ5S 1KLMA 3DLKA 5FDLA 1L3SA 4UQGA 4CCHA 2KJWA 5C5JA 4YP3A 1KS2A 2XS5A 4DXLA 1CBKA 3FVYA 3DYAA 1Y00A 3J80U 5J2PA 4CQ1A 4NA1A 1WACA 1VLYA 1R0AA 2QLXA 3BPDA 2YKNB 3MZIA 1KOHA 5LXRA 3P5BP 3J7YU 1LWEB 1PJ7A 2L9DA 1F5AA 5AXMA 2OEMA 4YQWA 2NXCA 3TX0A 4OHYA 2AKWB 4JI2J 1G4CA 2EG1A 4FXWA 1XQIA 2V4JA 1TV6A 4C9DA 2R7VA 3H59A 2WK4A 1HI1A 3VZHA 3MPDA 4F02A 4ZP7A 2MQMA 2H51B 2FVRA 5DQGA 5D6GA 3GIRA 4RKUC 3ZZUA 3JSRA 2WVCA 4WP8A 3R7SB 3GR1A 1N5SA 1LOUA 1M5HA 1ZZFA 4MMOA 1TUGB 4NXMJ 3CCSS 2YWWA 3RB4A 2ZC4A 3UDLA 1KHWA 2YQ3A 2Z2LA 4QWBA 2UXDJ 3HKZD 3PJWA 2A0FB 3C3LA 4DF8A 1ROFA 4ZPTR 1WEZA 3CDUA 3MEEA 4DU8A 4JI1J 2WTFA 1WJ9A 1DTTA 1HARA 3PEJA 4NYZA 2VBYA 3PYGA 7FDRA 4W98A 1F6TA 2YXLA 5E3QA 4LSLB 5EWGA 2FJWA 2Q6BA 3KG0A 1H6KX 2E7WA 3BB5A 4MKVA 4DPWA 2AU0A 2W25A 3THVA 4N7TA 1NJYA 1K44A 4FN5A 3TOQA 3HFZB 1TKXA 4DG1A 3C16B 4DR5J 1S6QB 1R43A 3IM9A 4PPZA 3DRXA 4PZVA 2ZWOA 2X3GA 3MEDA 3QQCD 2LEAA 4QBUA 5DG9A 4ED8A 1NBEB 4UUWA 4OZ3A 4AUKA 1BQMA 2ZE2A 4WFXA 2D74B 2RU9A 3K89A 3E8OA 4JV5J 1RTZA 4CH7A 4RNFA 1BY9A 4RLEA 2VFUA 4RX6A 2DYAA 2DKOB 1IKVA 3SCJE 3ZC4A 1RLDA 3D9BA 4TQSA 1NHKL 2RQMA 4LF7F 4QWDA 4DCPB 2WSEC 3WBZA 1CSJA 2CJBA 2MLYA 4CTAB 2IDLA 3OFHA 1VRTA 3ONQA 3NL0A 2F3JA 1Y3JA 3JTPA 4PG7A 1C0TA 3KLEB 1N33J 3PACA 3M8YA 4PKDB 3E3XA 2R7WA 2FPHX 1FKPB 2CRLA 4QQBA 1RTDB 4F4AA 2BJ3A 3LWMA 1UPMB 1QUVA 3RW6A 3R3TA 4FDFA 1NDCA 1T8EA 4ZVOB 2WONB 1HNWJ 3AJDA 2MGZA 3TW0A 3BBCA 2HS0A 4NCGA 3OTDA 3G82B 4USHA 2CJAA 5K8NA 2CIMA 3GG1A 5GAGU 1VISA 4U7UD 3ADAC 3KK1B 1B4SA 1FVQA 3JYTB 2VFSA 4F7VA 3Q2SC 4IO9Q 2YBVA 2G4BA 2DNRA 2VQEJ 1U8SA 5BYQA 4ES2A 1REGX 4JBCA 9RUBA 2C2ZB 1S1TB 4EMDA 2CQIA 4NX9A 1X0PA 1U24A 1WOPA 2EFOA 4ZPAA 3WC0A 2XSFA 4NA2A 4MIWA 5M2RA 4EBDA 4QR0A 4JI8F 4JI5J 3MDFA 3M32A 1PJ5A 4ZP8A 3QRRA 4F0HA 2APOA 3PIPQ 4PXBA 1GQEA 2UV8A 2EPIA 1WOOA 1LW2A 3AXMA 3G96A 1AW0A 4NEYA 3A8KA 5EUHA 1M1GA 3KLHB 4PXCA 3ZTOA 5DQIA 3HSJA 2RS8A 2DRDA 2QZ8A 1B0PA 3RRGA 3WX4A 1RHJB 3M9NB 3F41A 3LP2B 1JLAA 2Z30B 1FXDA 1IKXB 4EGLA 5EHHA 1FXRA 1VFJA 2C3UA 4EO8A 4B17A 1VBXA 4PR6A 3VAJA 2WVDA 3Q24A 3KHHA 3EZ5A 2MZQA 1FK9A 3CMAS 3GIMA 4DX8H 3SZ2A 2C22A 1W25A 3I96A 3B6BA 4CLKA 4I2PA 2RHSB 4ZS6A 3UCUP 1X8DA 3Q8YA 3DDIA 5I3UB 2HG4A 3GLJA 2XM3A 2G1HA 2RDIA 2NS1B 3OL6A 3IO1A 4U8VA 5B0CA 2V8DA 4OIXA 4NXNJ 2HEKA 1RXOB 4G65A 4K5RA 1UMJA 1NO8A 5HBMA 1UA1A 2A18A 5AXLA 2Q3PA 3BS9A 1Q5VA 3V6HA 5C24A 1XMOF 2HHVA 4WF9Q 1VBZA 1X4BA 2BX6A 1X4CA 1S1XB 1PIEA 4LRDA 2V63A 2KYZA 4TKTA 1H2VZ 1WC5A 3CDBA 2YNGA 1DFDA 2AYMA 4IRCA 4AXIA 4UF4A 3UD5A 1VQ4S 4LVOP 1P9QC 1YVFA 2RUSA 4A8KA 1UW9A 3UN5A 2JEGA 4Y2AA 2FJBB 1T03A 2BQ3A 1D3WA 2KT5A 3IBFB 3GYGA 3G6XA 1PYTA 3E01B 1S4FA 1FF2A 3MR3A 2R2TA 1S0MA 4IH6A 3MM9B 1YDLA 1KDNA 1O5JA 2B43A 2AEJA 4BLGA 1O51A 1U0SA 3T1YJ 1RKIA 1YQHA 4H4MB 3D1OA 4JYAJ 1L3KA 1SJ4P 2CVEA 3BKTA 2VG5B 1RYRA 1JLGB 1UA0A 2NR0A 2B6AB 4RW9B 5LMUF 1VQMS 2UXBJ 1RT6A 2ZBRA 3DRPA 5J2NA 4CT8A 3LALA 1IKYB 3M9OB 3A3OB 1AFIA 1R6YA 1LK7A 1VQLS 1Q8LA 2MQPA 3HSGA 4DCJB 4ECZA 4TVAB 3Q8RB 4WCEQ 1NK4A 3W2VA 2HK2A 3MEGB 3PO5A 3T41A 3M1VB 2BEFA 1U0HA 2VJVA 1FDDA 1KN6A 1VQSA 4LR9A 3A8IA 3VGSA 3R27A 2Q43A 3P45B 5KFHA 4L72B 1RE1B 2LECA 4LFBF 3GYNA 2GIFA 4LR7A 2KXFA 2ZHBA 3VR1A 4NRUA 3UD4P 4ICLB 3BBFA 3MM7B 1YKWA 2PC6A 3PKYA 4KE5A 2E5HA 2B7BB 4J9RA 1Q7YT 3EGVA 1LNQA 3SSSA 2VPWB 3KNAA 4DPOA 1JXVA 4J9UE 2H4WB 4F4WA 3BGFA 4I6YA 1PAUB 1WKKA 2JEFA 2XQCA 4OYAA 4P2SA 2XNRA 1M5KC 2ATLA 4C3MA 4DR1F 3PZPA 2QLJB 2QO3A 3KUEA 2GFFA 1UZDA 1FNOA 3KDOA 1PAEX 4EI2A 4XPEA 4B08A 4M63A 2BR0A 4G1PA 2CQ0A 5KFVA 1T3OA 2BBEA 3W5XA 2MKJA 1FJEB 3QGIA 1WELA 1RWMB 3F44A 3GWCA 3KMSA 2RAQA 3NGUA 3JQJA 2WVEA 5B0GA 4RUBA 2CVIA 3MUVP 2VFRA 2HFSA 1IM6A 2E1RA 2PMHA 2AX1A 4R0EA 5GMKa 3Q86A 5E41A 3M2VB 1R0CB 4ED5A 4FF3A 4YMEA 2IVMA 1QTNB 1QD1A 1HHSA 1NSPA 1IN0A 4UT4A 1YHQS 3CULA 1XMOJ 5D0RA 1S9EA 4WKYA 2X1AA 1ZTWA 4PAAA 1AT1B 3N6LA 5A0YA 3GG0A 4UOFA 2B5JA 3MWBA 2YNFB 1U47A 2XMVA 4PG6A 2LXIA 2N82B 4C3KA 4WE1B 3OQ2A 4A8OA 2DHGA 2ZJPQ 3NBPA 3DM2A 4NZ6A 4HHHA 2BJ9A 4M5NA 4PCQA 3AY0A 4CLPA 1WI8A 4MKYA 2R7SA 3R6LB 4OYIA 4L73A 4WXWA 3RAXA 1N32F 4XDDA 3W8PA 3J7AN 3TUPA 4KR0B 4ZVGA 4LQ9A 1AZSB 2MZSA 5KFCA 3D28A 5KFZA 1WC1A 4K7QA 2DEIA 4OYMA 3TANA 1B70B 1XN9A 1YLXA 2QLBB 5HVHA 4TY8B 1XNQF 2EBEA 2RRNA 3M2RA 3C6UA 4F2RA 3JQKA 4OI3A 3SQGB 5C42A 4O4RA 2MYFA 1S1UA 1REVB 1WC4A 2XULA 2ZH8A 1H72C 2XYPB 1XNRF 2DH7A 4ED6A 4WJBA 1V5IB 2XHWA 3ZZTA 4TN2A 4ECWA 4KQZA 4WTOB 3PW0A 4ZVPB 4AL6A 2FLNA 2DNNA 5A8KB 4YB7A 2HNYA 1UJ4A 1H73A 2DH9A 2XS2A 1KR4A 5HLFB 5DS7A 2NCKL 1L3VA 3FUYA 1EKRA 1UZHA 3FRZA 2V67A 3D6FB 4B3SJ 2C2EA 3M7VA 1RDRA 5HL7Q 5EGYA 1JNRB 1IUJA 2RRBA 3ENAA 2PEBA 2WSCC 3JAMY 5GAHU 4RNHA 5LOQA 5HI7A 3A3PB 2V9WA 1RWUA 1KVKA 3TZWA 2UVUA 4NLDA 1XEZA 4ZVUB 2NZCA 4X64J 1XIQA 2DHXA 3UE2A 1Q86T 3D0IE 1M5OC 3JTOA 4HHJA 2VPXB 2NLWA 4ZIWA 4C3LA 3PO4A 2DITA 3FBFA 2VBZA 3NNCA 1AYEA 3WIVA 3W61A 3N5BA 1R8AA 1UVKA 2BJ8A 1WHYA 1FWLA 3ELHA 4QR2A 2YKNA 1RB0A 2ACMA 1LKZA 3NS5A 4DF4A 1LWEA 3IG1B 1Q82T 1P1LA 2OAUA 7AT1B 4I7FB 4OV1A 2HKEA 1BHNA 3M30A 1NEEA 2Z8QA 4XPCA 1A9NB 2MQNA 1N5QA 2HAIA 1MWYA 3LOUA 3FBCA 4DJBA 4FVCA 3AOBA 2OMOA 4WFZA 2CPYA 4IRKA 3ZO7A 1U1QA 4C2MA 2ROGA 2HRYA 1FRHA 1H0HB 1TK8A 3D3BJ 4OZJA 2ZITA 1GMVA 4RBUA 5DZ6A 4JB8B 4F26A 1ZA1B 5AE1A 4EU0A 2IJFA 3OVAA 2F4VJ 1ZAVA 1SL0A 1NKBA 1HWLA 1IJFB 2IRXA 2XSJB 5B0FA 4NZ0A 3J7YI 5HJYA 4OX7A 2HVIA 1AA1B 1RAGB 2BE7D 2EEYA 3MTKA 3P49B 3EICA 5AE2A 2PEHA 1Z1ZA 2BOAA 2XY5A 4NLUA 4ELTA 3EVOA 2EFVA 3GZ7A 3C16A 4YS2A 4ECYA 2OEJA 1AXQA 4YY3F 4JOUA 2RJZA 1F0XA 3BDEA 1QLNA 1Q4RA 4U8YA 1P8GA 1YRXA 2NYIA 1B7FA 2X1GA 2ZHAA 2IRYA 1KHVA 1N32J 4KHRA 4ZJQA 1I1GA 4JI3F 2CPHA 5KFLA 2HHTA 2E44A 2DNLA 2XC9A 1S77D 2ZHOA 3RB6A 3AOCA 3K17A 1CC7A 1KTQA 4FS1A 3PYEA 3W7BA 5IT9U 4DUYJ 3UNYA 1B7YB 1XNQJ 3GFYA 4KBIA 4ECXA 4OMFG 2E9ZA 3NP5A 1LW0A 2BABA 1URNA 2UUWA 3FCWA 3C6TB 2B9XA 3K8WA 1XC9A 3TO8A 5D4LA 1QVFR 3KLEA 3CC7S 1BXNA 3B82A 1FKPA 2HW3A 4PWDA 1OYDA 2GJ2A 1NJWA 2DISA 3CD6S 1FI4A 2HNDA 2HFVA 4CO5A 3W64A 3H5UA 1WORA 3T6JA 4IQMA 4RNNA 3D4JA 3TUJC 4Y2IA 3PKMA 4IDKA 2E7XA 1R8PA 3I4PA 1WTFA 3DLHA 1N5YA 2F8MA 3JS9A 5K20B 2X3DA 4GKJF 4YUDA 5ITHA 2QE5A 5LMNF 5HVGA 1NAQA 2OTJS 2DR6A 5JXSA 1BMQB 2RMLA 1NKEA 2LU1A 2PA3A 2VOPA 4WYWA 1YIJS 2DHHA 3PX4A 1ZAXA 1S1TA 3W65A 1RTHA 1NK6A 4CLSA 1Y11A 3HZEA 4QWAA 5ETVA 4YB1P 5DDOC 4IH7A 4OYWA 2OPSB 3VGVA 5ETRA 2MEWA 1MG7A 3ENWA 3AD7C 4M5KA 1HNZF 4FF2A 2KG0A 3G6YA 4TU7A 3T19A 4DV1F 1R8BA 4EBCA 2QYCA 4O0IA 1T95A 1K0VA 2AX0A 4K4WA 3GJTB 2GMJA 4CO1A 3RB3A 4LREA 3KLHA 4TNOA 2KT2A 3V4IB 3DMJA 3TUZC 4DLGA 2R8GA 2OELA 5GAGI 1WKJA 4B9SA 3G6VA 4XAKA 2DGSA 4JV1A 4J9NA 3SDEB 4R0JA 1UFWA 1S97A 2XZTB 2BM1A 2E29A 5FLXY 2OP5A 1RABB 1UCNA 3MEKA 3DI6A 4Z2XA 2LA6A 1NHVA 3PNIA 2D1CA 5KFUA 5HO4A 1NKCA 1HWUA 5G0RA 3VVTA 1U45A 3PM9A 4CRJA 1F9FA 2FHMA 1M1HA 2CNNB 3UQSA 3KK3A 1RWWB 3KK2A 3M8QB 1QUPA 2Y9HA 4FYVB 2XO6A 3QSIA 1SKUB 2AJQA 3IGVA 2VA2A 5I3UA 1DRZA 2W7PA 3B4MA 1X9WA 5CCLA 4ED2A 5HROA 1F2HA 2F8EX 1FJGF 3BEGB 2Z57B 1Y10A 2AYGA 3OVSA 4NZ7A 2V8HA 3TJ9A 3H2LA 1SI9A 1FRIA 1NK5A 4AQYJ 3BQ0A 2M52A 3BSNA 3I0SB 3KLVA 4X4OA 4P73A 4WFBQ 3EPIA 2BJEA 4Y28C 4RL1A 3UVJA 2WSFC 1HW9A 4NA3A 2GQCA 5KG4A 5K14B 1EETA 3I5CA 1QSLA 3HO1A 2VPZB 2J7UA 5IWAF 1KVJA 4NCAA 3E01A 4X2BA 2NXNA 1DLOA 2A6MA 3MM9A 2HLUA 1ITPA 3G8QA 3H4DA 2W4DA 1OQ6A 4QW9A 2J9DE 4DUZF 2J5AA 3EZUA 2V68A 4K5SA 1VK8A 4LF2A 4H4MA 5THWA 1HNVB 2YNIB 1OPZA 2JLEA 4DFJA 2VG5A 2CPJA 3MR7A 1JLGA 2XMKA 1XMQF 2B6AA 3FSXA 4RW9A 3KUGA 1FRKA 4CT9A 1RT5B 1H3DA 1TU0B 3VCDA 4R5PB 3KKFA 4IOCQ 1RU1A 2VV5A 3OW2R 1S79A 2ERRA 4EBEA 5LMNJ 5D0HA 2AGOA 2G2OA 3CJ4A 3W62A 2AYBA 1SL2A 2RILA 3CJSA 1VCTA 1WF2A 2R8HA 2KRBA 2WB4A 3NGSA 2K3KA 2HZAA 1VS3A 2IA6A 4DSFA 3GJQB 5DJBA 4CO4A 3MM8B 4WIIA 5I42A 4IUFA 3M1VA 3BO2A 3D66A 4K8RA 1SKRA 4ZJOA 5F8NA 2G2YA 4GVLA 4DV1J 2XMMA 5KTQA 4A48A 1NNDA 1SL1A 1A7GE 1KVIA 2QIFA 1RT3A 4NASA 3R5JB 3MM7A 2P6SA 3O44A 3NCRA 3FCHA 4DQIA 4X4VA 3I87A 2ASYA 3MAQA 5BJRA 1S9GB 3BO4A 4QIVA 3UPFA 3MFHA 3V6JA 5BXIA 2A2CA 1AB8A 1BD6A 1ZH5A 4LSZB 2CQ3A 4NLSA 2JEJA 2KRRA 1IKWA 2MPUA 5KOWA 1FNXH 5JMNA 1ZM4A 4NLWA 1U26A 1FDNA 3LPEA 3F56A 4CI0B 2XMTA 3H25A 2N3OA 4USMA 4F3MA 4Y00A 4Y6IA 3TJ8A 1X9MA 3UN3A 5IQQA 2DIUA 1VIXA 3QIPA 4OV6A 4BC9A 1VJQA 4CO0A 3ISND 1RKJA 1V6HA 2D41A 3N0VA 2K7JA 1RAJA 1RT1B 2V8VA 1RU2A 2PDAA 1S6UA 2C28A 1FNMA 1X9SA 4P2MA 2WRMA 2OUGA 2JLGA 1X7VA 2Y8YA 1XR6A 3TR5A 4M8LA 4NLRA 1HHQA 2ZEJA 1PJ6A 2ZWPA 4BDPA 2FLOA 1Q0NA 1TVRB 1K1QA 2YNFA 4RR5A 3U1MA 3GMGA 2LLZA 3I9ZA 1FD8A 2M7SA 4ELUA 4JI0J 4PQUB 4WE1A 3CB4A 3CCRS 4GVBA 3QZ7A 4OYPA 4USWA 1X31C 2HFOA 2UVWA 4FXVA 2PFDA 4E8UA 5IS2A 2W8KA 2IYGA 2EG2A 1S5ZA 3MCMA 1AZSA 4ZVQB 3WX8A 1P6TA 4TXSA 2DCLA 2W2QP 4YN3B 1FRMA 4X4UA 1J27A 4V19J 3PX6A 2OPPB 3D6MB 4CIOA 5L9NA 3GSDA 1R27B 3MHYA 3TA1A 4CLFA 1RAAB 1FJ7A 2DNHA 2QC3A 4X84A 4J90A 5CAAA 4LVNP 3SQGA 4C48A 1UL3A 3UR3C 1UWBA 2V4JB 1TV6B 1UETA 4ER8A 2W4PA 3OHAA 2HFUA 3P8BB 2DR7A 4DR6F 2XZDB 2Y0BB 1A6LA 4LF5F 3BN4A 3MOZA 2ZVSA 2BW2A 1D8YA 5A8KA 2KTQA 1WTBA 3VZIA 5KT6A 1N56A 1PILA 1U7LA 3BBBA 4LIRA 3OXFA 3Q8QB 2E5LF 4FNIA 1PYOB 1G3OA 2WBMA 3EMTA 2FHOB 4NCBA 3ZNUA 1U4BA 2QA4G 1IJEB 2LEBA 3OTOF 3U1LA 2JFDA 1R7IA 3MD1A 3OTEA 3FRYA 2KG1A 3PW5A 2AP6A 4UZBA 2CQPA 3CEDA 1RK8A 1EAYC 5E5NA 3MEEB 4PQAA 3R2DJ 2XEXA 1DTTB 1ELOA 3H90A 2AGPA 5A6PA 3CNQP 3TVYA 1EHWA 3DDKA 2SXLA 4DR7F 2Z58B 2VICA 2J0QD 2DHAA 3R5CA 2IY5B 3Q8UA 4RWWA 1TKXB 4QYRA 2N7YA 3MCOA 4NPOA 1TK5A 3OXLA 4ES1A 4NI2A 3IGNA 5KT7A 4JI4F 3SSQA 3MEDB 2UUBJ 1HLWA 3OBIA 2OIHA 3T1HJ 1RSCA 4MKBA 2GVZB 4I7FA 3KWMA 1I94J 4KHPJ 1FFSB 1R6VA 4OX9F 4RW7A 3DXBA 1SIWB 1IKVB 2VG7B 1LV5A 2V69A 4Y2CA
chains in the Genus database with same CATH topology
3BSOA 3G96A 1AW0A 4PPDA 5J2QA 3MECB 4ZVEA 1Y0HA 2HHWA 5D77A 2GGPB 4FBUA 4ID5A 2DGUA 1S72S 2YWHA 4Q0BA 3KLGB 1Z4UA 4TLQA 5EUHA 1FTRA 2BE2A 2D3UA 1TL3B 3KLHB 4PXCA 3CJKA 1I6JA 5DQIA 3EYZA 3GFXA 3HXMA 1Q1KA 2RS8A 2XY7A 1NU4A 4IKAA 4Q45A 1TR0A 4IQXA 3LO3A 4QOTA 2KM8B 2CKWA 2GC8A 2QZ8A 2IM0A 3ZZPA 4A8QA 1JJ4A 1DTQB 1DZ5A 1B0PA 2HNZB 2MJNA 1S76D 4B3TF 5B0DA 3DOLB 4C7QA 3RRGA 2XLKA 3PVXA 2YKOA 1GH8A 3WX4A 1RISA 4KJIA 5E3AA 2J9EA 3PFEA 2B3TB 3M9NB 3F41A 3KLFA 1C0TB 2C3OA 4A46A 2W8LA 3LP2B 5KFSA 2PD1A 1JLAA 3K5NA 2YX4A 2J7KA 2OPQA 4M5DB 1FXDA 2RNEA 3AJ1A 1IKXB 4EGLA 2ZBIA 3DRSB 2WB1D 1R31A 4IFVB 3IRXB 3IRWP 2BQRA 2XS7A 4X4QA 2LU2A 4ZP9A 4OZ5A 2XSJA 5EHHA 4AL7A 4ECTA 1IBLF 3EGWB 5E0OA 1VQNS 1QE1B 3FMWA 1FXRA 4ETXA 4Y0FA 1QAIA 5IT9Y 1VFJA 5GADU 4LF4F 2C3UA 1IR0A 4EO8A 1TAUA 5EWFA 4B17A 4O3NA 1VBXA 3FSYA 4PR6A 3VAJA 4FPRA 1U1PA 1NK0A 2BXJA 3MMCA 2OD4A 3Q24A 5DLGA 2OSRA 3KHHA 3EZ5A 2EI5A 3A8EA 2MZQA 2ILYA 4H4OA 1H38A 1S1WB 3T9ZA 3BGLA 3U7JA 1P27B 1FK9A 1SKWA 1HFEL 3CMAS 3GIMA 4DX8H 2VG6B 3SZ2A 3HZGA 4WXOA 2VB6A 2XGQA 1C0UB 2NPFA 2C22A 2YKQA 3DLGB 4DS5A 3H4BA 2A2DA 1W25A 2M70A 4OHXA 3PX0A 3I96A 2EVZA 5KFQA 4ZOSA 1QSYA 4I2PA 1LWCA 4ZS6A 3UCUP 1FEHA 2GV1A 5LXYA 1X8DA 4DEZA 2J6UA 1GXLA 1NRKA 4CNZA 2QMWA 3FFIA 5I3UB 2HG4A 2LQ9A 3THPA 4JI7F 3GIIA 2RDIA 2NS1B 1KSPA 3V6DA 1Z2ZA 2W24A 1S49A 4F8RA 1SJRA 3OL6A 3IO1A 3T3FA 3G4SS 4Q8EA 3N28A 1DURA 2NSCA 2IM2A 4Z37A 4G1QB 5B0CA 1IKYA 2V8DA 4OIXA 3R1LA 2J7WA 4K5RA 1YG0A 2F9JA 1GX6A 4V19X 3TAMA 1UMJA 1NO8A 5HBMA 2QLWA 1UA1A 4A8YA 5IQ6A 2A18A 1NJXA 1HMVA 2MZJA 3VF0B 3CE8A 3MURP 1SQEA 5AXLA 2ADCA 2Q3PA 1IBKF 1RT2B 3BS9A 4OHZA 4LUBA 1HBMA 4ECQA 2N4CA 1RT4A 3V6HA 5C24A 4JI6F 1XMOF 5AXNA 2YWEA 2HHVA 5DRKA 4WF9Q 3DRRB 4DMZA 1AUDA 3M6VA 1VBZA 1X4BA 1X4DA 1O0PA 1X4CA 2DO4A 3DLEB 5E7OB 1S1XB 4DL6A 4O3OA 2ZOFA 1X4GA 4DSKA 2H5EA 4RW7B 1Y5LB 2UZAA 3NWGA 2VFVA 2KYZA 2XG8A 3MEGA 3ZZRA 4TKTA 1JLBB 1H2VZ 2OKQA 3Q0AA 3VALA 1W2BR 2UXCF 4WYLA 3CDBA 2YNGA 2XB2D 3KLIB 1DFDA 2VFTA 1RP5A 2AYMA 4IRCA 2BV3A 4AXIA 4DL3A 3SV3A 4CH0S 4BHQA 1C1CA 2YH1A 3JB9k 2NREA 5A8RA 3I32A 1FJCA 3G86A 2MHEA 2MDAA 1VQ4S 4LVOP 4Q0BB 3QIDA 1P9QC 1YVFA 2JL9A 1S0NA 1FCAA 3RB0A 2ZJRQ 5CYQB 4OJHA 3OR2A 3CJKB 4A8KA 4I64A 5K8PA 4QIGA 2JEGA 3I9V9 1WHVA 1N4LA 3N5FA 4Y2AA 4DV4F 3L7PA 3M6UA 2B9WA 3D0HE 3GV7B 3VAIA 1HW8A 4J5OA 3WC2A 2FJBB 1T03A 2BQ3A 1J2VA 3C2PA 1D3WA 2KT5A 4HH0A 4EO6A 2XZWA 3M05A 2ZH6A 1UKUA 2G1DA 5HP1A 3G6XA 1BC6A 3E01B 1S4FA 2HRUA 1VQ6S 3K5LA 2MZRA 2OPQB 4I68A 1FF2A 1T7PA 4ICLA 3MR3A 3QAEA 2AV5A 2JC1A 3HVRA 1U6ZA 2R2TA 2RDJA 1S0MA 4IH6A 3MM9B 2DT9A 2YTCA 1U2RA 2P9CA 3WDOA 3M8RA 4F50A 1NB7A 2VL1A 2ZH4A 4LFAF 2DBBA 4ITSA 3I82A 5GAEU 2HGLA 3AAWB 3OUYA 1O5JA 4I4BA 2B43A 4NLPA 3R5BA 2OLWA 3Q8SB 4TYBA 2B56A 4OL8A 1YTYA 1O51A 1DQ8A 1TKTA 2DGVA 3MMCB 5KFJA 5DM7Q 4G6VB 3IWNC 1UJ6A 3MFIA 4J9PA 1JX4A 4USJC 2XLIA 1RKIA 3PRBA 1YQHA 4H4MB 4U67Q 3PXGa 2K1RB 2PGCA 4H4OB 4JUZA 4J9MA 2NUUG 4C8LA 4IG0A 3D1OA 3JSMB 2R7QA 4DDFA 1FK9B 5HMXA 1MU2B 1VQPS 1L3KA 2KT3A 1SJ4P 2QA2A 3BQ2A 2CQHA 2MMYA 4IFYB 4AE5A 2CVEA 2IRUA 3IC1A 4DFPA 1UVIA 3IWXA 1UVLA 1CC8A 1OSCA 2XMJA 2VG5B 2C3PA 2BJDA 3AB4B 1RYRA 1JLGB 1UA0A 2NR0A 1NH8A 2B6AB 4PUOB 4RW9B 2YWGA 2MJUA 3K5PA 4OHVA 5LMUF 4X4TA 4O3QA 2MXYA 2GA7A 1VQMS 5DO2A 5D3GB 1S7HA 3PHEA 5KG0A 2HHUA 3FFIB 1V3RA 4DL4A 1RT6A 3PW7A 3ULHA 3V6DB 2XCPA 3DRPA 1ZOTA 1FDAA 2BANA 2D9OA 5J2NA 4CT8A 3LALA 1UFLA 2DNPA 3N9UC 2ZOGA 4NL5A 3SYZA 1IKYB 4C4WA 2Q66A 3ZZZA 3H2UB 3M9OB 4FNHA 4DV0F 3D5MA 1IBMF 2HHHF 2CPDA 5AE3A 1AFIA 4GO5X 1R6YA 1JLEA 2E5IA 3TAMB 3MUMP 5HBMB 1LK7A 1TP7A 4AQYF 2P9EA 4K4VA 2FJAB 3AQPA 4USIA 1VQLS 1HNIB 2GQ2A 3RRHA 2CQBA 3UI3A 2ZH5A 2OPSA 2KVIA 1Q8LA 3HVWA 2MQPA 4AFFA 2Q6CA 1WG4A 1X5OA 4N8OA 4GKKF 3LP0A 2Y1IA 3S01A 4RU2A 3QJPA 5M2PA 3I5BA 4ECZA 2WHOA 4ES3A 4CNYA 4HKQA 2HQ3A 4PWUA 3ZZOA 3H8YA 3OFEA 2B0GA 3Q8RB 4WCEQ 1NK4A 3W2VA 2Z0GA 3CDAA 3C8YA 2J0XA 1HBNB 1SJ3P 4FVMA 2A1BA 3M2VA 1YITS 2B4PA 4WU3A 3MEGB 2POKA 3PO5A 2FDNA 4DL7A 2QSWA 2YNGB 3AA9A 3DFEA 4FF1A 1HHTP 5F3ZA 2R8JA 2QFJA 1C1CB 3M1VB 4IG3B 3ICLA 5KFOA 5FJ4A 5A8RB 3CMES 1FXLA 2RH3A 4DS4A 1RA7A 2CDQA 1FDDA 2CZVC 1KN6A 3U1NA 1T05B 1HQUB 1VQSA 2LVWA 3NGDA 3VAKA 1Y5IB 4DV3F 2F9DA 3I0RA 5EWEA 2E9RX 3R27A 2Q43A 3RZAA 1VI7A 5KFHA 4L72B 5J2MB 2LECA 4LFBF 3GYNA 5F8LA 3TA2A 2KXFA 3SDEA 2HPUA 2CPEA 5KFXA 2ZHBA 1WG1A 3VR1A 5LSLA 2MZTA 4O3PA 3HFKA 1TUVA 4NRUA 3CCVS 3FDSA 2VPYB 4OLOA 2JRSA 4DSEA 3UD4P 4ICLB 3THTA 3TUIC 2OFGX 1WG5A 5L1IA 3MM7B 1N54B 2FC9A 2PC6A 2ROEA 4O44A 4E98A 5DQHA 1K9MT 3QO9B 2D9PA 2IVYA 3PKYA 3S1TA 4W90B 3G9CA 4KE5A 1K0TA 2KFNA 2E5HA 1KLMB 1CQNA 5JVGQ 3DLKB 2B7BB 1HI8A 2XMWA 2E5GA 4J9RA 2EC0A 3QLHB 1Q7YT 2BOPA 2ASDA 5F3TA 3UFCX 5FDLB 4DFMA 4YHHF 2E1MC 3SSSA 2EW9A 2VPWB 3KNAA 2LQJA 1TKTB 4O23A 4DPOA