2DNZA

Solution structure of the second rna binding domain of rna binding motif protein 23
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
95
structure length
95
Chain Sequence
GSSGSSGLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRALEQLNGFELAGRPMRVGHVTERLDGGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the second RNA binding domain of RNA binding motif protein 23
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Probable RNA-binding protein 23
total genus 10
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dnzA01
3VAFA 2PE8A 2KRBA 3CD6S 3TO8A 1P1TA 2KG1A 3RW6A 4Y00A 5HL7Q 5LJ3Y 4WFAQ 3BO4A 2N3LA 2X1FA 2RVJA 2KXNB 2G0CA 3MDFA 1WELA 3MXHP 2RRBA 3I55S 3EGZA 2FHOB 2JVOA 3UE2A 5IM0B 3L3CA 2A3JA 1F9FA 5DETA 2M7SA 2MPUA 1M90T 1WG1A 2VOOA 1M1KT 2DHXA 2CQ2A 5H1SV 1VQMS 1WWHA 4QPTA 1X4HA 2XNQA 2YH1A 2KYXA 2MQQA 1VQOS 5CXTA 4QU6A 1N88A 3VAGA 2DGOA 1OIAA 1U1PA 2YH0A 4TU9A 1S72S 5GAHU 2DO0A 3VAIA 2DITA 1A9NB 3G96A 2FY1A 3NNHA 2VOPA 1URNA 1YJ9S 2I2YA 2MQNA 3CCQS 2NZ4A 2OTJS 3CCVS 2KXHA 3P5TL 2RRAA 2XS7A 3IRWP 2MJUA 1VBZA 3IWNC 4YOEA 5GAEU 2YTCA 2M9KA 1O0PA 1YWXA 2DNMA 1H6KX 5BJRA 5LSOA 1U6FA 2MZQA 2D9OA 5D78A 1X4AA 1WHVA 2G4BA 1X4CA 2DNHA 1H2UX 2XSFA 2AYBA 1A7GE 3RW7A 2CPJA 1HD1A 2QEXS 1CVJA 3TYTA 1SJ3P 2AYEA 4Y0FA 3CCSS 1FJ7A 2RQ4A 3MURP 1VQKS 1Q7YT 2HGLA 3CMES 2DNLA 1L3KA 1N52B 4OZ0A 1FNXH 1Q82T 1PO6A 4W92B 1FO1A 3LQVA 1ZH5A 3H2VE 1RKJA 5GAGU 2NLWA 1K8AT 1X5OA 3VAJA 4TLQA 1DZ5A 2E5IA 3US5A 2CPYA 2ZJPQ 2K3KA 2PEHA 1NU4A 1WG5A 2CQ4A 2KU7A 1UFWA 2EVZA 2RS2A 3UCUP 4UQTA 1KQSR 3D2WA 1U1QA 4IOCQ 3THTA 2D3OR 2G1DA 3ZZYA 2J76E 4RU2A 2F9JA 1YJWS 1VQPS 1YI2S 4PRFA 2E5JA 3ULHA 3UCGA 2ZJRQ 1WI6A 3FEXB 1VQ6S 2CPHA 2RUGA 4U67Q 1N54B 2DNKA 2KHCA 3MD3A 2DB1A 2JVRA 1QVFR 4FXWA 3G6ES 1HA1A 2E5HA 4C7QA 2HGMA 2XS2A 2M2BA 4TU8A 5IM0A 4WFNQ 3CXCR 3EGNA 4IOAQ 3JB9k 3G4SS 2DGWA 3HI9A 3NS6A 1SXLA 1X5TA 2M0GB 2VODA 2DNRA 1OO0B 1WF1A 1D9AA 4J5OA 2DNQA 2OTLS 2KXFA 2LXUA 2BZ2A 2MSTA 5MLCV 2MQOA 2BOPA 1WF2A 3MUMP 1NJIT 4M5DB 2KVIA 2I38A 2X1GA 1X5PA 4IUFA 3MUTP 2LCWA 3CC7S 1X4GA 2E44A 1YJNS 2CQHA 2XNRA 2DHAA 1WEZA 2Q79A 4F26A 1KC8T 3P49B 2DISA 2D9PA 5DM6Q 2MKSA 1WEXA 2KM8C 2KFYA 2DH8A 2DNZA 1DHMA 2MY7A 2XB2D 2DGTA 1VQ8S 2FC9A 1WHYA 2OSRA 2ERRA 3SMZA 1SJQA 4YB1P 1N8RT 2MZTA 3S01A 1QM9A 5HO4A 1ZZNA 2N82B 4LMZA 3CULA 2CQCA 3PIPQ 1VQ5S 5LJ5Y 5LXRA 1WTBA 2O3DA 1FHTA 2CQ0A 3FEYB 3LPYA 1WG4A 2CQPA 3S8SA 2OIHA 4WFBQ 3R1LA 2RQCA 1VBXA 2HGNA 4ERDA 2CPDA 1Q86T 1S79A 1PGZA 2MGZB 2GHPA 3UD4P 1G2EA 4A8XA 4WCEQ 1YTYA 2E5GA 4TU7A 2MQLA 3S7RA 3H2UB 2M8DB 1JJ4A 5GMKa 2CPEA 2MZRA 5LXYA 2DNPA 3CTRA 3P6YC 2DNOA 3BS9A 2L9WA 2DO4A 5DDOC 2F9DA 4P6QA 4QU7A 2DGXA 2RT3A 2RU3A 3G8SA 2LEAA 3CCUS 2LECA 2ADBA 5LSLA 3K0JA 2DIUA 4Z2XA 2HVZA 3SDEA 1BY9A 2SXLA 2KM8B 1FJEB 1X4EA 4WKRA 1FXLA 2DH9A 2DNYA 2MZJA 1VC0A 1M5KC 3G71S 2M52A 3V4MA 3CUNA 4ZKAA 1VQ7S 2QA4S 1UAWA 2DIVA 3CC2S 4LIRA 2HYIB 3R27A 3P3DA 1OWXA 1KOHA 2DNNA 4FXVA 2J0SD 2CQBA 4WF9Q 2MJNA 1X0FA 2YKAA 4PR6A 3U1MA 2MYFA 2AYGA 3MOJB 2ZJQQ 5EN1A 1ZZFA 2MKIA 3VAKA 3CCJS 1H2VZ 3G8TA 2M88A 4OZ1A 1WEYA 2MKJA 4YUDA 1KOOA 2DNGA 2MHNA 4CH1A 3R1HA 1YITS 3U1LA 1AUDA 2MZSA 5GVQA 1U6BA 1YIJS 2VONA 4WIIA 1U1KA 2KH9A 1X4FA 3NS5A 2CQIA 3UWTA 1UW4A 3MI7X 3HHNB 3B4MA 2LMIA 2LEBA 3BO3A 1U1OA 5FJ4A 1R8PA 3NMRA 2LKZA 1M5PC 1VQ4S 3N9UC 2CPXA 2LXIA 2FPHX 2N7CA 3BO2A 2RS8A 1XN9A 2M4MA 3DXBA 2B0GA 3VAHA 1VQLS 2CQDA 1VQ9S 2X1AA 1SJRA 5DDRC 3CC4S 2CQGA 2DK2A 2L41A 2CJKA 3CCRS 2LQ5A 5GADU 2FC8A 1R8HA 2ADCA 4EGLA 2LA4A 1JJHA 3CCMS 1QVGR 1JJ2R 2JX2A 4CH0S 5CA5A 2XS5A 1DRZA 3CPWR 2EK6A 3S6EA 2M70A 2MZ1A 2UP1A 4BS2A 2DGSA 2DGUA 2MGZA 2KRRA 2MXYA 1X4BA 1RK8A 2OSQA 1H2TZ 2QFJA 1M5OC 1DBDA 5IFMA 1U1LA 1W2BR 3VF0B 1FT8A 2HZCA 4QQBA 5DDQC 5DM7Q 1P27B 3CCLS 3J7YU 2MB0B 2OJ3A 1X4DA 1KD1T 1IQTA 2DHSA 3VAMA 3TP2A 3CMAS 2K8GA 2U1AA 3SXLA 1D8ZA 2MQMA 1M5VC 1WF0A 2MQPA 1SJ4P 2N3OA 1YHQS 1WHXA 3BEGB 3B4DA 4CIOA 1HL6A 1VC5A 2MKKA 3UCZP 2CQ1A 2U2FA 2EK1A 2KI2A 2CPZA 4IO9Q 3OW2R 2J8AA 3Q2SC 2DH7A 1K9MT 1VQNS 2MSSA 1WHWA 4CQ1A 5CYJA 4C4WA 2YWKA 1B7FA 1SJFA 2DHGA 2GO9A 4W90B 4F02A 5IQQA 2MMYA 1VBYA 4LJMA 4F25A 3NNAA 1U1RA 3ZZZA 3EX7B 3CF5Q 5ITHA 2CQ3A 1X5SA 3UD3P 2MKHA 1HD0A 3I56S 2DGVA 2LA6A 1UP1A 1WI8A 2F3JA 2WBRA 3THPA 2CPIA 2LYVA 2KN4A 3SDEB 5JVGQ 3NNCA 2KT5A 3PIOQ 1VC6A 1NO8A 2AYMA 2CPFA 3VALA 1Q81T 2MKCA 5D77A 1FJCA 2MY8A 1K73T 2KG0A 5DDPC 2JRSA 2M8HA 4V19X 1U1NA 3CCES 4ED5A 2J0QD 4PKDB 2X1BA 2V94A 1U1MA 5JVHQ 4C0OC 3Q2TC 2RNEA 3DLLQ 1JMTA 1U2FA 3G9CA 4UY8T 2DGQA 2L08A 3MD1A 3MUVP 2AD9A 1OPIA 2JWNA 3J7ZT
chains in the Genus database with same CATH superfamily
2NUHA 2D3O1 2KRBA 3JQMA 5C42A 2FGCA 3TO8A 1KTQA 3OSPA 3RW6A 3O1LA 4UOCA 4ZVPB 5D3GA 2RVJA 3BGUA 4CLKA 3MDFA 3UDLA 3TR5A 1HBOB 2BJ7A 2V67A 2FVRA 2ZC3A 2ZWOA 4M5GA 3E01A 1KEKA 3OXFA 2BKNA 2ZBQA 2ZD1B 2YKMB 1S77D 2FJWA 4B3RF 3TQ1A 3PTWA 1U26A 2YPYA 2Z56B 2VICA 5ETPA 2CNNB 1XMOF 3KJVB 1UEKA 2HBRB 2YKMA 2HZVA 3MCSA 1MROA 4ZPTR 1S1UA 3EJMA 3WBZA 5DETA 3EWGA 3I6PA 4KRWA 1D9DA 4RNHA 4CTAB 4FYWB 2DHXA 4IH7A 2CQ2A 4CO0A 1LNQA 4MKVA 4PG6A 1RI7A 4Y65A 2UXCF 3CDAA 4NI2B 2RJZA 3JYTB 4QPTA 3W8GA 1X4HA 4OV6A 4K4VA 4YDDB 5K20B 4LSLA 4DX6A 4ZCMA 3I9ZA 2KYXA 2POKA 3EMTA 4UF4A 3UQSA 4DL7A 2AX0A 4PQAA 5KFAA 4MK8A 4NRUA 4WWSA 5KFLA 2HIYA 1HI1A 4L3NA 3HLUA 3M9MB 1HBNA 2OAUA 1G7CB 2EEYA 4P2SA 4LBHA 3R5BA 1S57A 3DLKB 2AJQA 5AT1B 1NPPA 2KB2A 4HR2A 5E3RA 1AA1B 1NSQA 3SFUA 4N8NA 3FMBA 5J2QB 4K5SA 1FDNA 3GFHA 1OSCA 4C11B 1RT5A 3NNHA 4HYKA 2B6AA 2FJXA 4UY85 4OMFG 1CG2A 1DTQB 2KXHA 1UPMB 2VDIA 1T9TA 3QGIA 5AXNA 5HVGA 1HNWF 2J6TA 3HFKA 3I0RA 1N4LA 1RYSA 2V4RA 2YNIA 3RJMB 2V4JA 5GAEU 4K4UA 1HBUB 1FDBA 2DNMA 4F0KA 1S0NA 4KJIA 3BPSP 4O3OA 5GMEA 1SIWB 1WHVA 4X62F 4JI0F 1X4CA 1OY6A 3GFYA 4OI2A 4DV7F 1Y7PA 4M1KA 1XBWA 4LR7A 1A7GE 2OMOA 1RABB 4RKUC 3MMJA 3RW7A 2HHSA 1EP4B 4LF5J 3OL7A 2CPJA 1KQKA 1BHNA 2HK3A 1FFSB 2VUGA 1SJ3P 2V50A 3OSNA 3W3SA 2R7UA 4LUBA 3MURP 4NEYA 1ZBTA 1N32F 3DC2A 4DV1F 3PEHA 1UPPA 4USIA 2GJIA 1WTFA 1S9GB 2HGLA 3CMES 2F63A 4FYVB 3F0NA 1L3KA 3R6LB 2LU2A 2HFZA 2IYIA 4OZ0A 3AB4B 3CJTA 3D7SB 1D0EA 2YKOA 1RHUB 2HBYB 1PJ7A 1R27B 2BMBA 3T5LA 4DL6A 1Q82T 3LQVA 3MM8A 4DSJA 3D1QA 5CH7B 2W9CB 4ZIWA 2IAJA 1ZH5A 2B9EA 4HHJA 1SUQA 2DR8A 1JLCA 3RG6A 5J2NB 1FKPA 2YY3A 3BH7B 4F4AA 3VAJA 2VG7A 2CJXB 5L38A 4TLQA 3R5DA 3US5A 1PKUA 3DN9A 3MZIA 3SSQA 4B3OB 2H5EA 2BE2A 2ZJPQ 4O3QA 1FRHA 2PEHA 3A1YG 4DS5A 4LF6F 1UFWA 3LP1A 3WIVA 3KG0A 2YNHB 3NGSA 4NLGA 2E1RA 2ROGA 3D2WA 5L1KA 3EGWB 3G86A 1RTDB 3I82A 5KFIA 3IAS9 2QFIA 3I31A 2F7VA 2HIQA 5CCLA 4IOCQ 3H7HB 2YNHA 3THTA 5KFEA 2G1DA 3J80U 1RAEB 1Q1KA 2EFGA 3ZZRA 4NCAA 2HHHF 3DOKB 1U45A 1SL1A 4LF1A 1VIXA 4LBPA 4X65F 5I3UA 4M95A 1FRJA 4R8UB 1KFSA 1J27A 3Q8QB 2X3DA 5DQGA 3TA1A 4YY3J 1YJWS 4C3MA 1L3VA 4FF2A 5HP1B 2OFGX 2V2VA 3H42A 4KY3A 5IS2A 2B4OA 2OPPB 3TOQA 3UCGA 2DEJA 2PSZA 2ZJRQ 2ROPA 3E3XA 3BB5A 1HI8A 1VQ6S 1W2IA 2F5GA 1KLMA 3LGHA 3T5JA 4CDIA 1JLAB 2FY8A 4FN5A 4YB6A 3A3OB 2F8EX 1UVKA 2DNKA 3C14B 2KHCA 1TL1B 1F60B 4GVLA 4JOUA 2DY9A 5A6WA 5M2UA 5KFPA 1S1UB 2Y8WA 1WSRA 4X64F 1KVIA 2C3YA 3ZZ0A 5F8JA 1Z1ZA 2ZKTA 4P75A 2YNFA 4RW8A 2Q1LA 2H5IB 3F44A 3J7Z5 2M2BA 5DQIA 4TU8A 3WX8A 1HW8A 1SBRA 2NZCA 3MGJA 1FWLA 4EO8A 3V6DB 3C66A 2YWFA 3I5AA 3I0SB 2DGWA 3G4SS 3JB9k 2ALYB 4E8UA 2HFSA 1ACMB 4DQRA 4LF6J 3EYZA 1FEHA 1X5TA 2AHOB 2CKWA 4ZJLA 2ZHAA 4KHRA 3V6JA 2UXBF 2GVDA 2M0GB 3M6XA 2DNRA 1OO0B 3I0SA 4OI3A 3UDVA 4PEOA 4X4UA 3M8YA 3IO1A 2AV5A 4RU9A 2A6MA 2DYAA 1S1TB 4FP9A 3N4WA 4KH0B 3L09A 5MLCV 2OH2A 4TVAB 4A8KA 1U4BA 2I38A 1S6QB 4U6PA 3QIPB 3L4BC 3CC7S 4WFXA 3M7VA 2E44A 4RNFA 1NEEA 1RT5B 1SC6A 1U24A 4HACA 1S9EB 3GFXA 3VZIA 2Q79A 2Y3YA 2ROEA 3ZZOA 4F26A 5D3GB 1YKWA 2WOMA 1LWCB 3CJQA 2A6OA 3T5HA 1NJZA 3DLKA 4IH5A 1HQUA 1OS5A 1WEXA 3F56A 3QLHB 4RW7A 2KFYA 4OX9J 5LMNF 2IJNA 2FUG9 4ZK7M 1XNRJ 1V3SA 4V1Ak 2ZD1A 1B64A 2DCUB 3DM2A 2XB2D 1YJTA 4ZS6A 1HWKA 5KFTA 2DGTA 4QZVB 3PDNA 3WX4A 3D66A 1P1LA 3M2RA 4BC7A 2HVEA 4RO0A 3EICA 1NNDA 1NZAA 4IFYA 1SJQA 3MEGA 3WQPA 2P2CB 3C6TB 3HHKA 4ES1A 1N8RT 4K4XA 1JIHA 1RT4A 3DLHA 4OHYA 1AB8A 1TQLA 1EQMA 1TL3A 4GO5X 2JLGA 1J5EF 1BQMA 2YWHA 4RBVA 4C8KA 2GIQA 3R7NB 1B0PA 3M6VA 3PX4A 1VQ5S 2EWHA 4ZVGA 1NSAA 4JI1J 3IA0A 4AXJA 1AROP 4Q44A 1WTBA 4Q5VA 1JLGB 4PCQA 4TXSA 2BQRA 3G6XA 2HWHA 2XZWA 3N79A 3LP2B 4LSZB 1T9VA 3HHDA 4U7UD 3S8SA 5HANA 2UVVA 5IC4B 1X7VA 1NBEB 4YR2A 3GYXB 3QPIA 4F7VA 2BACA 2CJQA 2BDPA 1UCNA 3FBEA 3HT3A 2HGNA 4ERDA 4ZDNA 1RU2A 3LW5C 4RNMA 1SUQB 4EYIB 4DN0A 2BJEA 4MIBA 3UVJB 5KAKA 1VDHA 1TMMA 3VWSA 2HNYB 3CIMA 5E5NA 1Y0HA 3OHBA 4URQU 3OR2B 1N5VA 3I0RB 5L1IA 1HHSA 3JSBA 2E5GA 2BKOA 1KHVA 1PC4A 1ZOTA 3AFGA 3W9HA 4ZN3A 5KFJA 5J2MA 4DWIA 1APSA 3GLJA 1XC9A 2GIRA 1LW2B 3KLIB 2M8DB 1J5EJ 3PEJA 2FIUA 3OW2R 4C6AA 1TP7A 5GMKa 3ILOA 5LXYA 1QDUB 1QSLA 3VCDA 2NR0A 4A8QA 4B9MA 1U2RA 1FERA 1KKHA 2DNOA 2L9WA 3CD5A 4NX9A 2CFXA 2PMHA 3UN3A 1N33J 4BWJA 3QFHA 4M5JA 4M8LA 1KBRA 5D4NA 4R5PA 1WOSA 4F50A 3Q89A 2BJ8A 4UOFA 5DDOC 2F9DA 2WTFA 4DR5F 2DGXA 2RU3A 2CAJA 2ADBA 4QWDA 1IBLF 2P5VA 3FUYA 1FRLA 4M5DA 4HEA9 4F0HA 5KG2A 2HVZA 3SDEA 2IJRA 4EBDA 1SC3B 1URRA 5CYQA 1FJEB 2OEMA 3FZ2A 4G1QA 4OX6A 3TAMB 3DU6A 1QAYA 1R3NA 1S6PB 1WD6A 2YWGA 5CYMB 2CUYA 1XTZA 2CIMA 1VC0A 1XERA 1M5HA 4ILMA 2UZAA 1VFJA 3AD7C 2DD8S 3K5NA 3ENVA 2XHCA 1S6PA 3CC2S 5DGAA 2B4PA 2Y0SD 5KFUA 1N48A 2M5YA 4Q43A 3LOUA 3FCHA 1IKVA 2J7UA 3R27A 1D9FA 3P3DA 3PYEA 5E33A 5FD1A 1O6XA 3NCRA 4A8OA 4DZDA 5IZHA 1BLUA 4FXVA 4R25A 5LOQA 1S1WB 3BDEA 2R2SA 3HSJA 1QSYA 4I67A 2W25A 2EG2A 1S1VB 3JTOA 4MH8A 1RT3A 4ZVQB 2AYGA 4IG3B 3ENAA 4LRBA 1N6QB 2ASLA 2ZJQQ 5IV3A 1C1BB 3L9ZA 1EAYC 5KFOA 1HW9A 3H0PA 3M8QB 3NCQA 4H4OB 5KT4A 2HMIB 4F3QA 1ZZFA 3KLEB 3VAKA 5L46A 4X64J 3CCJS 3LGMA 2VBYA 2MHNA 3HVWA 2L9DA 5K8NA 2OPPA 5H9EJ 1S48A 2BANB 1FWPA 5GVQA 2WZ1A 3NWGA 5B0BA 2VONA 4WIIA 1X4FA 2ATCB 3BN4A 1AT1B 3MEEB 4PPZA 5DJBA 3TX8A 1ZM9A 3C16A 3UWTA 3HHNB 1QTNB 3B4MA 2HK2A 1X0PA 5J1EA 5FLXY 4LFCJ 3V81A 5E3PA 3BO3A 2XGPA 2R8HA 1R8PA 4Q45A 4F4KA 2HAFA 5E2QA 3VQTA 5GADI 1JLQA 1NM2A 1KHWA 3QRRA 2AZ3A 2UVUA 3DLJA 1Q5VA 3H25A 3G8QA 4TYBA 5ETOA 3ZZPA 1S5ZA 4MAKA 3CVKA 4QWAA 1PSDA 2OKQA 1SI9A 4DPXA 3PYGA 5D4PA 1HBMA 1Q7LB 3MEKA 3VAHA 4IQXA 2L48A 3L7PA 4I2PB 4DCJB 3W5ZA 2F1FA 3I5CA 2GAGC 1ELOA 1WC5A 2ZZTA 2DK2A 2VKZG 2L41A 2V68A 3ISNC 4A47A 2CJKA 1GMVA 2C2RA 5E3QA 3EZUA 2AJ4A 2QZ8A 5EWEA 2W2OP 1VRTB 3GJTB 4HDGA 2VC1A 3VVTA 1GMUA 2XY6A 3T5KA 4RZRA 4DV6F 3DRXA 3PW0A 1R6VA 1V6HA 2RQKA 3MM6A 1RHMB 3B54A 4WZQA 2B9XA 1XMQF 3OJUA 5HN0A 3CPWR 1PYSB 2NCKL 2QL7B 4A8SA 1U0HA 2EBGA 5HSPA 2H3EB 5ETTA 4HKQA 1BD6A 3BREA 1HQEB 2KO1A 2RQMA 7FDRA 1HNWJ 4Q0BB 2UUAF 1HNXF 3OD2A 4WYWA 2V4JB 4K5RA 2G1HA 3HX9A 2RUSA 1PAUB 1N36J 3TUJC 3KMSA 2HRUA 3OFGA 3LAKA 5IFMA 3EE3A 3HULA 4JV5F 5B0GA 2J9EA 4MK7A 4ZPDA 1W2BR 2HHVA 2HHWA 4I56A 3LGNA 3PCOB 1N5YB 1H7XA 1JLEB 2GQQA 3FFIB 3FRYA 2YBVA 1JK9B 3IBWA 3MMBB 1UETA 4OFZA 5DM7Q 3QZ8A 3QGGA 4ANCA 2K2PA 1IM6A 2BJ1A 2A2CA 2OPSB 3FFIA 4HT5A 1KD1T 1Y11A 5G4DA 3HD1A 2YWEA 1TL7A 3B6BA 3TP2A 4A46A 4DV4F 2RDJA 1FVQA 1FX4A 1K44A 1ICEB 2K8GA 3NWRA 4RUCA 1D8ZA 2X51A 2IM3A 1M5VC 1S1XA 1WF0A 3BKUA 3FQKA 4CLYA 3CCZA 4D3GA 1H38A 4ZLJA 4QW9A 1SJ4P 1PJ5A 4HT7A 3BQ1A 4C0BA 2E1AA 3BEGB 4Y2CA 2ZM6F 1HPZA 1HL6A 3FRZA 3KHRA 1WJ9A 2CQ1A 2RRNA 2OELA 4ED0A 1N33F 3HJVA 2EK1A 5F8MA 2ZNYA 2CPZA 1YQHA 1FKPB 4K0KF 1JNZB 3OR2A 2VBWA 1N34J 4ID5A 3HHLD 4KBIA 3J80Y 1RDRA 5BR8J 2AW0A 4CQ1A 1UJ5A 1RT3B 3TZYA 1RHQB 3M6WA 3MECB 1XR6A 5GMDA 1EX8A 2YQ0A 5D4LA 1JKHA 4USUA 2HFVA 4Y28C 4X2BA 1BWEA 3KNGA 4ZPVR 2FVQA 5KG0A 1JLBB 1YSJA 2VG6B 1BQXA 5KG5A 4PUOA 1PC5A 2FJBB 2HAIA 2VV5A 3DCAA 3GWCA 3K8VA 5IWAF 1C4CA 4Y2IA 2VA2A 2CQ3A 4O4RA 3TRGA 3MR2A 4IR9A 4DV5F 3M30B 4DV2J 3MPVA 3W2WB 4OI1A 2LA6A 2IM2A 1Y9OA 4Z7YA 3GV8B 3BSCA 2LYVA 3KLFB 4DCPB 2B8PA 2KN4A 5B0CA 3PACA 1GMWD 2FLLA 3BGFA 3SDEB 3MMCA 1JNRB 2NXUA 3GR0A 3KG4A 2LXFA 2QO3A 3T9NA 1IR2A 3N0VA 3RTVA 2ZH6A 4I6AA 4ZVUB 2HVDA 1SB6A 3ZC4A 3FBFA 2UXCJ 1WC6A 4L75A 5B09A 3KHGA 1S6OA 1KQGB 4XIUA 4EEYA 4HI1A 5D8HB 1K73T 2FJVA 2BRLA 2JRSA 3MWBA 4GVBB 3M2VB 3NKYA 1IBLJ 1JLQB 4MKBA 2J0QD 1OPZA 2XMVA 2XSJA 1GQEA 3V6KA 1W7WA 3O2IA 4KAIA 4NLSA 4C0OC 4HDHA 1Q8LA 2DT9A 5M2PA 3Q2TC 3J7YI 1FRKA 1HNZF 2VQFF 1HHQA 4Y3CA 4LFCF 2BR0A 3D6HB 4KT0C 4ZVOB 4JI0J 3M8ZA 3D9BA 1GNKA 5A8WA 3QIPA 3LP0B 2HBZB 2QMWA 3ZNUA 4LF8J 2WVFA 4IYQA 4HHUA 4WFZA 1REVA 2HFUA 3GONA 2GGPB 4LSLB 2LEPA 3G82A 4DBQA 2PE8A 2W2NP 2IA0A 4ZLNA 3UNGC 2R7XA 1PJ6A 1FKOA 5AE3A 2X1FA 3H4DA 4WFAQ 3BO4A 3DOMB 7FD1A 4OZNA 2E7XA 4ELVA 2G0CA 2QLWA 4TY8B 1U1RA 3EDRB 4KSEB 3MEEA 3MAAB 1OYEA 4DX8H 1P9YA 4GKJF 1QLNA 3QZ7A 4AL6A 3V81B 2QC3A 1LWCA 4Q2LA 4DG1A 3I55S 3EGZA 1ZTTA 4PRFA 2JVOA 3UE2A 2B6AB 1FKAF 2A3JA 1AYEA 1QJHA 4DG1B 1FD8A 4ED2A 1IKXB 2C28A 1EARA 2KJVA 5HROA 4DLGA 2M7SA 4MKAA 1F6TA 4MK9A 2YNIB 1FTCA 5HJXA 2AEJA 5H1SV 1VQMS 4ECVA 2PMZD 4WTOB 3DFEA 3C6TA 4NLPA 3QRPA 1WWHA 4QR0A 2OP5A 4DV1J 3RZAA 4E2FB 2Z2YB 2XNQA 1CULA 1HFEL 2CNLB 5CXTA 4PG8A 2FJAB 4QU6A 2AMCB 4DQIA 3EVOA 4OHWA 2DGOA 3W60A 1OIAA 4PAAA 5CD4H 2YH0A 3QSYB 2KYZA 3EM1A 4EU0A 4LF5F 2RE1A 4TU9A 4J9RA 1KRPA 4LF9J 3SCIE 2IMOA 4OYWA 4YQWA 3GJSB 2DITA 5B08A 3NRBA 5C24A 1HNVB 2HBQB 2IAJB 2CNKB 4OZJA 1KP6A 2EI5A 2ZVIA 2Y0BB 2C2KB 3CJ5A 5HJYA 3RB0A 4ILLA 1Y5IB 2NZ4A 3CCQS 1PCAA 1LWEA 4PWDA 3CCVS 5C24B 4LF2A 4KO0B 2DRBA 3P5TL 1EHWA 2RRAA 3KUGA 4RUBA 4F2RA 5IC6B 1FRMA 1D3WA 1LWEB 5HMZA 3IWNC 1FJGJ 3DRSA 2VFVA 2ZEJA 3PFOA 4NA2A 4YEAA 3SQOP 2CG4A 4ZP9A 3VGSA 2J8SA 1SL0A 2VPXB 3SZ2A 1ZPWX 3ENWA 1RE1B 1ZAWA 3DGPA 4I7FB 2RB7A 4AFFA 4DN9A 3JAMU 3MTJA 2RDIA 4QW8A 5D78A 2C2EA 4CLZA 3D0IE 3SFGA 2P9GA 3PHEA 3Q23A 3JTNA 2GJFA 4HH1A 3W62A 2G4BA 3UN5A 1QAXA 1D09B 2QL9B 3LH2S 3I4HX 5IXUA 1C4AA 1RISA 5L9NA 2HHUA 2GQCA 4I2QA 4N8OA 2GMJA 3PW2A 1G1XA 1BXNA 2GAHC 1UL3A 2Q6CA 2HHQA 4OHZA 4PQUA 3KDNA 2FHKA 1RT1B 5E0OA 4DL2A 2IC3A 3TYTA 4K8RA 2PIIA 3CCSS 3EZ5A 1UZDA 4DV0J 1IM4A 1PG5B 1RADB 2A0FB 4K4WA 1T03A 3R7BB 3BBCA 1Q7YT 4OYOA 3AXKA 1RBAA 3J7AN 2HS4A 1SV5A 3E8OA 3FDSA 3M2VA 1B4SA 2ZH7A 1PYOB 2AEMA 2HQ3A 3EPIA 4FNIA 4URSA 4ZIVA 3DYAA 3H2VE 3QATA 4LF7F 2QLFB 3ADAC 3K2YA 3N5BA 4OHXA 2FZKB 1K8AT 4ICLB 2ZBIA 4W98A 1NKEA 2AIRB 4P7TA 3NGUA 2HNZB 2D3UA 1Q8IA 3GCWP 4DV5J 1DZ5A 2OPQA 4PG4A 3M8PB 1Z2LA 2K3KA 1NU4A 2CQ4A 3LP0A 4XPEA 2D7SA 5E3CA 8ATCB 2L9NA 3TVKA 2OPQB 2AT1B 1RAHB 2RIJA 3ZNJ1 2JOQA 1RHRB 2MKYA 1GX6A 2VBXA 3G82B 3PG9A 2O5DA 3UR0A 2HHHJ 2DRAA 2ZBCA 2D3OR 2BW2A 4F4YA 5IT9U 4P74A 1DY3A 1CJVA 1IR0A 2I5JA 4BBYA 5A8WB 4RU2A 3W61A 4DR5J 3KTQA 5D0GA 3H5YA 1PAEX 4M5LA 2F4VF 4NWBA 3EVMA 3DDNA 1S6QA 2GHVC 1YI2S 1WSVA 2IVFB 2EKYA 1LW0A 3PRDA 3ULHA 2HMIA 3WDOA 4CYUB 2K1RA 3C3LA 4PXCA 3H20A 1G4CA 4GMKA 2IMWP 1R0CB 4U67Q 4DU8A 2XYPB 4ES2A 5EDWA 1GFWB 1R43A 1XK8A 2GQ2A 2ACYA 4NLOA 1QVFR 1RTHB 3FKBA 1FE4A 1NJYA 1S0VA 5BYSA 4DFPA 3HK2A 4CZCA 1W25A 2E7WA 5AJ3F 4DQSA 1U49A 2GZOA 4AL5A 1H3DA 3AA8A 3PKMA 1OY9A 1CJTA 2KHDA 1TR0A 3HI9A 3NS6A 2G13A 2YX7A 5A2QY 5KFXA 2I6WA 2YWWA 1RUSA 4TQRA 1WF1A 1D9AA 3K5MA 4NXMJ 2O01C 1GMWA 4HVZA 2KXFA 2OTLS 5H9FK 5EUHA 4XDDA 4ZJOA 1RBOB 4OV1A 3TANA 2BOPA 1RWWB 1DAXA 4USHA 1WF2A 3PNIA 5F41A 1TMJA 2X1GA 2D74B 2F4VJ 2ALZA 1FK9A 3T6JA 2PMWA 2R2TA 2QTWA 4DSKA 5C5JA 2XNRA 1FCAA 5ETSA 4NL5A 2FJDB 3EUNA 1YLXA 2DISA 4M63A 5DM6Q 3RR7A 2MKSA 3QFWA 3OUYA 9ATCB 2HVIA 3O5TB 3TW0A 3DGVA 1NUEA 2BUNA 1RT2A 2BA9A 4JB8B 3RGIA 5D0RA 5KG3A 3VGVA 5C25A 3AJ1A 1WKJA 2VFRA 1LW2A 3KLIA 2ZH2A 1UVLA 2XMTA 1TUWA 4UOHA 3SMZA 2HZAA 2H51B 1KWMA 3WIUA 4F3MA 3M2UA 2W7PA 1ZZNA 1B0TA 3GPAA 2QYCA 2VB6A 4F04B 1VMBA 2CQCA 3H2LA 4PWUA 3MEDB 4ZPCA 4KKOA 1PIEA 4DXLA 5LJ5Y 3MOZA 3KUEA 1EKSA 2E9ZA 2EKNA 4CO5A 1RAAB 2E29A 1Y10A 3GFZA 3NP5A 2ZHBA 2WAQD 5FIIA 3SV3A 3KJNB 3FEYB 1NKBA 1YVFA 2UUCF 1DURA 2CDRB 2E1MC 4RW4A 3R8YA 2OIHA 1Q78A 2CJYB 5BYQA 2XYGB 2Z2MA 4UOGA 4YDXA 3Q83A 1NDCA 3T3FA 1U7LA 1Q86T 1S79A 1DLOB 2O67A 3PRVA 1PGZA 1ZM4A 2ATLA 4J9QA 1PILA 4IFVA 2GHPA 5L8RC 2MGZB 1D1UA 4A8XA 1VRQC 2H65B 3UNYA 3HCXA 1YG0A 4LFAF 2Z58B 3PYDA 5MAOA 3ZZTA 3DLGA 2AZ1A 4TU7A 2MQLA 3DLEB 1VJQA 5F0WA 3MCOA 3H2UB 3DU5A 4ELUA 3LP1B 1MW7A 4HLBA 1JJ4A 2XTJP 3M8PA 2GVDB 1C0UB 2DNPA 2XLIA 2BV3A 3KLEA 4O3RA 4X4NA 5H9EK 5K14A 1T3OA 2JEFA 2F8MA 1P9QC 2VPZB 1RT7A 1Q8KA 3PJWA 4OLOA 2XQCA 3LWMA 3T1HF 4YR3A 1EIYB 1HMVA 2RAQA 3D3BJ 5HMYA 4QU7A 2IC3B 4X4TA 1FNMA 3OV7A 1E6YA 2RT3A 1HR0F 2PGCA 1H72C 2ZZMA 2RHQB 3CW2C 1VK8A 3KG1A 2NYHA 5IV4A 5DZ7A 3M8WA 2J6SA 1HMVB 1U0SA 1I5OB 2DIUA 1JLAA 5J1PA 1JLFB 4CO3A 4EYHB 4KGVB 3C15B 1X4EA 1IWGA 2Z8QA 2IM1A 4RWWA 4WKRA 2H54B 1RB0A 4X4PA 2D41A 2IRYA 2MZJA 5CD4A 3OLAA 1KLNA 4RR5A 2IIHA 5HP1A 3NAHA 4RW8B 3GIMA 4UUXA 3G71S 4QR2A 3V4MA 1VQ7S 2PI4A 1KONA 1HBOA 1C1CB 1V3RA 2YNGB 3NLCA 4I6WA 3ZTQA 1NHVA 4O4GB 3RRKA 5J2PB 1R8CA 3IM8A 4H4KC 3NCPA 3H40A 4QYRA 1UEVA 2WVDA 4EK2A 2ILYA 2YNGA 5SUHA 3K8WA 2WVBA 2I8EA 3K5PA 1SJ1A 1RAIB 1GXTA 1HWUA 4NEZA 4F0MA 3JYTA 1NHKL 4WF9Q 3F73A 1IKYA 3DI6B 1RWPB 1P8GA 4PYDA 1L5UA 1X0FA 3ETOA 3OT9A 1X9MA 2V34A 3D1HA 2YKAA 3ILIA 4JI5F 4DFKA 2ZNZA 3MM7B 1RWVB 5ETNA 2LLZA 2QN6B 3DI6A 1O8BA 1Q8BA 1XNRF 2JEJA 3MM5B 1JLGA 2Y1LB 2VJUA 2L3MA 3THVA 4JI7J 5EN1A 1H2VZ 3G8TA 2RD5C 3BSNA 1S1TA 2M88A 2OPRA 2MKJA 2UUTA 3K17A 4YUDA 1MNEA 1YITS 1LW0B 3OFFA 4P71A 3U1LA 1T0TV 2B56A 2MZSA 3OPKA 2RKIA 1GTHA 2VG5B 2Y8YA 3HSGA 4MJKA 5DRKA 2ZH1A 1B0VA 2KH9A 3PJXA 2HLTA 3W66A 4LRAA 2CQIA 3MI7X 3NS5A 1UW4A 4NLUA 5ETKA 4ZVFA 4WJBA 2ZVSA 3RB4A 4NCGA 2UXDF 2AJ1A 1SKUB 3VHQA 4NXMF 5T14A 5FJ4A 4TKTA 5JUMA 4ECRA 1RT6B 3OTBA 4N7TA 2LKZA 5DG9A 2CZVC 2Y1RI 5KT3A 1T05A 1VQ4S 4CT8A 4FS2A 2CPXA 1CLFA 3U27A 3LAMA 4NA3A 1R0BG 2X3GA 3OTCA 3X3UA 3KHHA 5HBMB 1VHIA 3G87A 3OFEA 4WP3A 2APOA 4LSNB 3PO4A 2W2PP 4E0DA 1WORA 4UTGA 1NZ8A 3R6GB 3BO2A 1XMQJ 4G1IA 2A18A 1XN9A 2B7CB 1FF2A 3WHIA 3DXBA 3H4BA 3Q8UA 1YBUA 1VQLS 1F3FA 3NS7B 1WKLA 3HD2A 1VQ9S 1EP4A 1I1GA 3HVTB 4OI4A 3GV7B 4DR7F 2R7TA 3E51A 2CQGA 1Q79A 4K2JA 2OFHX 3RB6A 2A1BA 3TUZC 3AJDA 4XPCA 3CCRS 2FY1A 5GADU 3Q8SB 1TAQA 4AD6A 1WDDA 4EGLA 2AGQA 2FVSA 2MLYA 1UTAA 4ZVRB 3R5JB 4FZVA 1RACB 2QE5A 2XS5A 2KTQA 4N5SA 2BQ3A 1IVZA 2HFOA 2D1CA 2OD6A 8AT1B 3QAUA 4CNYA 3GIIA 1DRZA 2W9BB 2B9WA 3CJKB 2C1EB 3W9IA 4JV1A 5KFFA 4GKJJ 4NYZA 5FDLB 3JAMY 3D28A 1VRUA 3CJ4A 2LVWA 1IN0A 2R4FA 1JLCB 1T9UA 3P8BB 3ISND 5CYMA 2HWTA 4QOTA 4WYLA 2DGSA 2DTJA 2HQIA 3D0GE 3FCWA 2JFDA 4UW2A 3UD5A 4ECXA 4KHPJ 4IFVB 2MGZA 3OVAA 5LMUJ 3RB3A 2MXYA 2GNKA 3V5RA 1RK8A 3NEKA 2G0JA 5T7LB 4N56A 2QFJA 1NK5A 1DBDA 2V0NA 3A13A 6FDRA 1M5OC 3W5YA 1EB0A 3H8YA 2MDAA 2ZITA 3DRPA 3VTIA 1U1LA 4DR3F 1S99A 1MWZA 2JEIA 1XQIA 2HZCA 3CJSA 4QQBA 5B0DA 4XO0A 2I9SA 3IRXA 2JC1A 3R3TA 5DDQC 4KKOB 2VQFJ 1JKHB 1IUJA 1UVMA 3D4JA 4I7FA 2AGOA 2WW4A 4N77A 2DXFA 1N0VC 3AXMA 5F8LA 2IVYA 3IRXB 1X4DA 4DUTA 2H48B 2E1CA 2BM1A 2QMUB 2V6AA 5KFBA 3Q8PB 1I6JA 4PUOB 1X8DA 3HHLB 3IFEA 2EFQA 4LFBF 2U1AA 3SXLA 4BC9A 5A8RB 3QMQA 2NXJA 1GK8A 1HLWA 2QV6A 1RCOB 2XI3A 3E01B 2MQPA 4RWXA 4IRDA 4ZCLA 2XLKA 4ZCKA 5C2CA 3UPFA 2QSFA 4F4XA 2WVEA 4CIOA 3I96A 4LF4J 4Q2MA 2GW8A 2OMLA 5KFGA 4HI2A 2U2FA 2UVWA 4B3TF 2PFFB 1WC3A 2W2MP 3FSYA 5K8MA 2LQBA 1UJ6A 5KT2A 5E7OB 2AKWB 1KSPA 2ACMA 3M4XA 4NLVA 4B02A 2MSSA 1WHWA 3M32A 3KK3A 4NLQA 2BE9B 3NL0A 4NASA 5HQ8A 2GO9A 2DPIA 2R7VA 1RHKB 4DL0C 2MMYA 2V63A 4PXBA 4W90B 2JC0A 2YVSA 3I32A 1SPBP 1ZAXA 1JXLA 4IG0A 4I0WA 5BXIA 5A2QU 1VHFA 4B9SA 1MU2A 4PWDB 4F25A 3DHXA 4DX5A 3ZTOA 3NNAA 1NH8A 1NHUA 1UWBB 3KFWX 3ZZZA 1CJVB 1RLDA 4WBFA 5K14B 3HMJG 3EX7B 3CF5Q 1N5QA 2FZCB 1FKOB 2EC2A 1HD0A 1HWIA 3QT5A 2DGVA 2VL1A 2LDYA 1HNIA 1RWKB 4UZCA 4EBCA 4TY8A 2F3JA 2GVZA 4OX8A 1S10A 3LUYA 5DG8A 5KFHA 4WK3A 4P72A 4K50A 2CJAA 2WONB 2AJFE 1N0UA 3QO9A 4JV5J 1TKZB 3C6UA 4H4MA 2BKPA 2OEJA 2CJBA 1RT6A 3NNCA 2UVRA 2C2MB 2KT5A 4K59A 3D1OA 3UDEA 3PIOQ 1NDPA 2C3MA 4J91A 1R0AB 4IQMA 4OJ1A 5J1EB 2AWZA 2C22A 3DOLA 5B7WA 4MFBA 1FX2A 1OQ6A 4BDPA 2V8GA 3QLHA 5T41A 5KFWA 3PV8A 1IKWB 1TV6A 4ECQA 1U1NA 3Q0AA 1MROB 3HHEA 2DPJA 1YJVA 2IRUA 1IKWA 1M1GA 2X1BA 4X4VA 3D54A 3N6NA 1ROFA 1UW9A 3IG1B 1F2HA 4H4KA 4ZOSA 1IKYB 2HFNA 5LM7E 4ZPBA 2ASDA 1ZETA 3MEGB 1UA0A 3DLLQ 1RCXB 1VI7A 1JMTA 1U2FA 2J7KA 2YPZA 5FLXU 1SKWA 3A8KA 2JNJA 3IG1A 2PA8D 3MM7A 2L08A 4CP5A 4QIFA 4UY8T 5KG7A 3ELHA 4HTJA 4NMLA 5F8GA 4B3RJ 5KT7A 3HVTA 5JJBA 1R31A 3VGTA 4N41A 4DR4J 1RWXB 1XR5A 3VAFA 1VRTA 1Q5YA 1TL4A 1ZM3A 2DR6A 2OUGA 1MSWD 1CJUB 3HPOA 3T6BA 3CD6S 3RUBL 2KG1A 3M1VA 4Y00A 5HL7Q 2VG5A 5LJ3Y 4I64A 2N3LA 1T7PA 2B4VA 2EFOA 2IJFA 3FGVA 2BYCA 4GO7X 1JQGA 4M5MA 3R97A 1WELA 2W9CA 4F2SA 3MCMA 5ADZA 1YJRA 5IQ6A 3M6UA 2ZH4A 5KFQA 4NRTA 5DG7A 2LQ9A 5L1JA 2R8JA 4WFYA 3GIKA 4DUYJ 3QT6A 3OTDA 3W5XA 2GMLA 4QR1A 1BQNA 1HKAA 1PYTA 3EDQB 4FVCA 4DPYA 1NK4A 4M94A 1EETA 1R7IA 2PC6A 3CCWA 2XZTB 4DDFA 5HVFA 5IM0B 3BPDA 3MM8B 4DUYF 4E98A 1XEZA 2PT0A 3U7JA 5LMUF 3CNQP 2JL9A 4UT4A 1KDNA 4FBTA 4JI3F 4KV8A 2K7JA 2XCAA 2FB0A 3FK4A 4ECWA 3KK1B 3G6VA 1WG1A 2GV1A 1M90T 3Q24A 1M1KT 5BYRA 1UA1A 1N5YA 1VLOA 4RW6B 2RILA 2FGOA 3IBCB 3MAHA 4R0JA 3BM7A 3ZTRA 3V4IB 3RRGA 2LDIA 3I4PA 1TAUA 4G6VB 2N7YA 4ZHRA 3FEZA 4WK1A 1LV5A 2F40A 2EPIA 1VQOS 4Q7AA 3IN5A 1KVJA 3HFZB 5B0FA 1WOOA 4J9NA 3ENQA 1U1PA 1UVJA 4EBEA 2ZHOA 1R6YA 1FTRA 3MCNA 4DR3J 1S72S 4NZ0A 3CGIA 3R5AA 5K9FA 4K4TA 4PPDA 3ZTPA 1Q0NA 3CJKA 4RNOA 2R9LA 4WKYA 4FNHA 1A9NB 2VPYB 2FHMA 2W8KA 4QYZK 1L3SA 4LF4F 4O3SA 3DDKA 5C7PA 4DR7J 2VOPA 1URNA 2W9AA 1YJ9S 2DBBA 2MQNA 2I2YA 5ETQA 2OTJS 3RAMA 4OJGA 3UDCA 3SYZA 1SV5B 2LQ8A 5A8KB 4X4QA 5ETLA 3NAIA 4Y2KA 2HVHA 2MJUA 1VBZA 1B7YB 4KGXB 4YOEA 1OY8A 2QA2A 2E9RX 1F1BB 4K4ZA 4AQYF 1VLYA 2YTCA 2DJWA 3BR8A 2M9KA 3H5UA 2VZ9A 3SIPB 4IDKB 4EMDA 3HVRA 3X1LB 1H74A 3UW1A 5BJRA 5LSOA 3BBFA 1ZAVA 1X4AA 3DLGB 2NSBA 3ISZA 3VR1A 4DPOA 3N28A 2JH3A 3I9V9 4KQZA 4NI2A 2XSFA 2W7OA 3CJ3A 4OQJA 3TUIC 2AYBA 3BQ0A 1YRXA 2R2RA 2KVQE 2V8VA 3BYRA 3IR7B 1AFIA 1IJFB 4QIVA 2FVCA 4J9PA 1HD1A 2AYEA 4P7VA 4Y0FA 4WP8A 3KLGB 2RQ4A 4B3MJ 3C15A 1RTIA 5JXSA 2V9WA 1RT7B 2IDLA 3EZOA 3SQGA 4G3IA 4KC5A 5KT6A 3HFVA 2EC0A 4MYTA 2FJEB 1FDAA 2WOMB 2DNLA 3AY0A 1BUXA 5HAOA 3GV5B 1N52B 3ILLA 3OFHA 5AJ3J 5ETVA 2C3OA 3DHWC 4DZ6A 4W92B 1FO1A 3I5BA 2ZOGA 5AE1A 4RLEA 3IP0A 2NLWA 2J0WA 1MN9A 4FKYA 3HXMA 4ER8A 2J9DA 5A0YA 3PW5A 5B0AA 3RAQA 3M2RB 5D4OA 2E5IA 3QT8A 2CPYA 2QLXA 1FESA 1FXRA 4NLXA 5KG4A 1WG5A 2EVZA 6AT1B 4UQTA 3W65A 1TK5A 2FVPA 1S4EA 2H9ZA 1HARA 1EZZB 1Y3JA 3R9LA 4QYZJ 2B9YA 4ZMMA 1XR7A 3AQOA 5F3TA 1U1QA 3CCTA 4DR2J 1IJEB 3N6MA 2ASYA 4USJC 5E3AA 3ZZYA 5DLFA 2B43A 2IA6A 5KTQA 3QWUA 2J76E 4CO1A 1TKXA 2F9JA 1HNIB 1S12A 2B7BB 2B8QA 2WVCA 1NDKA 5IT0A 3OUYB 1YBTA 2FD2A 3AAWB 3UVJA 2E5JA 4KFBB 4OYZA 2BXJA 3GSDA 5ETRA 1WI6A 3FEXB 4NA1A 2EG1A 4ANEA 1CJKB 3F41A 1G6BA 2RUGA 3P4UB 2AP6A 3K58A 1TU0B 2ZDOA 1UWAA 4O0NA 1TUGB 3OTEA 1YX2A 2V2QA 3BKTA 1DTQA 2JVRA 5HI7A 4O3PA 4FXWA 2ZOMA 4Z7CA 3DM2B 1T05B 2E5HA 3NY0A 4B08A 3OL6A 4G65A 4FDFA 2CXEA 2VC0A 2VFTA 3A8IA 4IKAA 2XS2A 1EETB 2W2QP 2WK4A 5IM0A 5F9LA 1N5TA 4NCGB 2EFPA 1IR1A 4IFYB 4WFNQ 3CXCR 4DL4A 3NGKA 2P8IA 1T9WA 1SXLA 2QA1A 1TL3B 3BSAA 1NJWA 4JI1F 3DGPB 3TAPA 2ZH8A 2VODA 2NYIA 3A3PB 2LQJA 2HHTA 4DEZA 5KFKA 5KFZA 3CMQA 4DSFA 2MQOA 3TJAA 4JI2J 3UN2A 3MUMP 3V4IA 4LQ9A 4M5DB 4ED7A 4OYXA 1NJXA 2CZ4A 1X5PA 4IUFA 3MMBA 4I68A 4LF7J 1E6VB 5CYQB 1UFKA 2VIHA 2OEKA 4R8UA 1X4GA 4X66J 3T1YJ 1ZA1B 2CQHA 2N4DA 2ZUGA 2OPSA 2ZFHA 3LF0A 4R5PB 3MR6A 4DV2F 1EKRA 3KJQB 1WEZA 5U47A 4DCOB 3QNWB 4J9SA 3PM9A 1RYRA 4DQPA 3G2XA 3ITHA 3SSSA 2D9PA 2BVZA 2ZDPA 3SCKE 1S76D 1RJJA 4OZ5A 3ICLA 2DH8A 2KM8C 4CLTA 1T3NA 1FNOA 2DNZA 4DOZA 4L6V3 1HWJA 1WKKA 1BQNB 1DHMA 2FYXA 4ID5B 2MY7A 2XZDB 1LXJA 3OXLA 2E5LF 3LWLA 3W2VA 2JEGA 2FHJA 2YQ3A 4OZLA 3DLEA 2Y9HA 4JYAF 4KGMA 4I4BA 2FC9A 1QY7A 1WHYA 5E41A 4DV3J 4DQQA 1YJNS 2OSRA 1UKUA 2ERRA 5AXKA 3CJ8A 4DX7A 4LF9F 2DCLA 1GH8A 3RBXA 2MHEA 2OLWA 5ETMA 1NK6A 1QM9A 1SVDA 2N82B 5KG1A 4LMZA 1ITPA 2QT7A 3CULA 3UR3C 2VG7B 1A6LA 2WRMA 3WZ0A 4ZVTB 2W8LA 1KS2A 1U8SA 3JSYA 4PXDA 4R0EA 2DR7A 4U7CA 2VA3A 1XIQA 2BE2B 3GG0A 1FI4A 3HHLA 1CC8A 2O3DA 1RTIB 5KFYA 4C2MA 1WDTA 2EW9A 8RUCA 5KFCA 2BQUA 1YGYA 4LFBJ 1FHTA 1RTDA 2ZH5A 1Y4ZB 1RT1A 1WG4A 3LPYA 4ZLPA 5F3ZA 2NPIA 2YXLA 3GMGA 3OTOJ 4JBCA 4NXNF 4HACB 4WFBQ 3R1LA 2WSEC 2RQCA 3CEDA 3MM9B 1DTTA 3DOKA 4J9MA 2UUBF 3GILA 2K1RB 4DJBA 4B9VA 1MG7A 4CWBA 2CPDA 3NBPB 1L3TA 5D6GA 4TN2A 3BSOA 3JQKA 4D3HA 2HQGA 1FVSA 2EXUA 2Z57B 4AYBD 3UD4P 1NK0A 4KHPF 2P9EA 1RHJB 4QIGA 1Q95G 2AX1A 3IR6B 5DGBA 1T11A 2BW7A 5EX0A 5SZTA 4WCEQ 1MWQA 1SC4B 1LFWA 1JXVA 4IO9Q 3EXCX 1CJTB 2XMKA 4OX9F 1S7IA 1B3TA 2VKRA 4OYBA 4P2XA 3JSMA 2FLOA 3MAQA 4DR6J 1U09A 1UWBA 2CPEA 1AW0A 2MZRA 3KK3B 1XNQJ 2E9TA 2RDDA 3T41A 4DUZF 3CTRA 2HPUA 1W26A 1RWUA 3P6YC 4LF8F 3BS9A 4DU7A 2VQEJ 3LTOA 3GG1A 1V3ZA 3B8HA 3M8QA 3CWJA 2KT3A 2RMLA 1MU2B 2CZ9A 2JLEA 2V5HG 4J7CA 4TLRA 3GTYX 1WOPA 4WP9A 4FF3A 3W7BA 3CCUS 2LEAA 5H9FJ 2XLJA 3GQCA 4L76A 4I1TA 1T02A 2MQ8A 5GAEI 1F5AA 3GYNA 5L39A 4NCBA 2OPRB 3W9JA 1VS3A 4LRCA 1BY9A 2I5JB 1HWLA 1LOUA 2SXLA 4JI6J 1CS4A 1CJKA 3DOLB 1FXLA 2JHEA 2H5JB 3DMJA 1KQFB 2HNDA 3POTB 4NMXA 4YHHJ 2ZH3A 1QAJA 4YR0A 3CO0P 1LKZA 2W01A 3GU0A 5DZ6A 1M5KC 5F8HA 3K5LA 2R3VA 3LO3A 4CO4A 2W4PA 4KIAA 2QA4S 1NB7A 2DIVA 3TUPA 1IQZA 3TQEA 3OJSA 2HYIB 3TEGA 1JLEA 3ZFVA 5HLFA 2YKQA 3AT1B 2FTRA 3PJ9A 4L74A 9RUBA 1NK8A 2CADA 3MFIA 1TK8A 2DNNA 4CM2A 1TKDA 1HNZJ 2J0SD 4U8VA 5LT5A 4DFMA 2CQBA 5HMXA 1R89A 2MJNA 4YFUA 1CPZA 2WCXA 1TL7B 2YKNB 4PZVA 1X31C 1TK0A 3EGVA 3U1MA 2MYFA 4P73A 2IYGA 4U95A 4ZP6A 3GJQB 1RBLA 4CNZA 1TKTA 2ASJA 1CJUA 2W7AA 2MKIA 4C3LA 3GCXP 4B9TA 3AQPA 3D3CJ 4OZ1A 1WEYA 2CVEA 4CH1A 1KOOA 2VHGA 4OIXA 3R1HA 5HMWA 4HTIA 1AUDA 1MMLA 1QTMA 2C3UA 4FYYB 4RX6A 4BCAA 3SI8A 1I94J 2VFUA 3HDSA 2W9BA 4IRCA 2IHR1 2LEBA 2DR9A 4GKKJ 4O44B 3OVBA 3DKDA 1U1OA 1RP5A 4F4WA 3KHLA 1HQ2A 2J0XA 5J2MB 3NMRA 2J7WA 5DS7A 2AQ4A 2P6TA 4JYAJ 2PO4A 3N9UC 4N76A 2ABYA 4NYPA 3Q8RB 1RTZA 2JZ5A 2PD1A 3FQLA 4U7UK 1JJCB 2LXIA 2N4CA 3QYYA 3PY8A 3AD9C 3AJ2A 3RBZA 2N7CA 2RS8A 3JQJA 1GX5A 2ZZNA 3M30A 2M4MA 2UV8A 3MEDA 2FLPA 2B0GA 3BBBA 4KV8B 2CQDA 2XGQA 2HWIA 3C2PA 3R5CA 5DDRC 3CC4S 5HVHA 3M2UB 2QJ3A 1YJ7A 3HT0A 1SKSA 1RTJA 3GB0A 1HYSB 4JI3J 2FC8A 1R8HA 1RAFB 5G0RB 2AEFA 2QLJB 3WC0A 2XI2A 3BQ2A 5I42A 2ADCA 2R42A 2LA4A 5LSRA 3CCMS 1WACA 1QVGR 1HYSA 4EUVA 2ZE2A 4I2QB 4LFAJ 1IBCB 4CH0S 4N47A 2OHDA 1M5SA 3LALA 1R8BA 4NZ7A 2R7SA 4CLWA 4ECTA 3BYPA 4Y6IA 4EWTA 1TFYA 1AZSB 3S6EA 2PFDA 1RSCA 4NLRA 1QAIA 4J9VA 2UP1A 4BS2A 4DR6F 3B78A 2UUWA 2O1PA 1RWMB 3EXYA 4IOBA 2HHXA 5AXMA 4DV4J 5K8PA 2DGUA 3DRRB 4WU2A 2R8IA 1QUVA 4PXEA 2XY7A 5HLFB 1J5OA 2KRRA 4C0HA 3DLBA 1ZA2B 5A6PA 1X4BA 3R7SB 2QYGA 3DXSX 3QAEA 4USTA 4WPAA 4DR1J 1NXIA 2W4DA 1QD1A 3OR1B 5A8KA 5EGYA 5I3UB 2FQQB 3V6DA 2AU0A 3VF0B 3OXGA 1X60A 1N6QA 3LPEA 4C3KA 5RUBA 4NLDA 1XNQF 3TNVA 2NQPA 4IH6A 3MPWA 2HQFA 1ZTWA 4DL5A 4H4OA 2CWXA 1CEZA 1NH7A 4WXWA 1Z2ZA 3N01A 2MB0B 4DSLA 1S7HA 3Q8YA 4YHHF 4F36A 1REGX 1C2PA 3FC9A 3QO9B 3RYLA 3SSRA 4DPWA 4UZBA 3VAMA 2K3IA 2VASA 1NCLA 2ZBRA 3MM5A 4CYUA 1NRKA 3KLGA 1SH2A 3Q22A 2QA4G 1ZYQA 4B3MF 3KLHB 5IT9Y 2XULA 5AE2A 2Z4PA 1N5SA 4ED1A 2KKHA 3QGPA 3TZZA 1HBNB 4J9UE 1YHQS 4NPOA 3MMCB 1WHXA 1RTHA 3MTKA 5IOLA 1UEUA 3JXOA 1NK9A 1VC5A 4X62J 3IGNA 4GRSA 1CS4B 2H1YA 1R8AA 4DL3A 1HQUB 4RW7B 2V8PA 3UFCX 3CE8A 3U02A 4C8MA 3HZGA 2C2DA 1CQNA 4HL9A 1NAQA 1LK5A 2CNOB 2CA9A 3KK2A 5CYJA 4DR1F 3CJRA 4AQYJ 2EBEA 4DSIA 1B7FA 3V6HA 1SJFA 1SKRA 4BHQA 4F02A 5IQQA 1KNZA 1TV6B 4J9OA 5HROB 1HBMB 3ET6A 2XO7A 2CG8A 2BABA 2RSQA 1LWXA 4DS4A 4KYZA 4F3OA 3Q86A 4LJMA 2KFZA 1G3OA 1FFWB 4EI2A 2GCFA 4C98A 4DR2F 2RH3A 4X4SA 4C97A 1FK9B 5EWFA 4C8OA 2XC9A 1JB0C 1X5SA 4AT1B 3UD3P 4WIQA 3RU0A 4USMA 3I56S 5EWGA 5KFDA 4AUKA 4LVOP 2GGPA 1WI8A 4I69A 5CZVA 2WBRA 3THPA 2CPIA 2XO6A 1LWFB 2OGUA 1F3VA 3CB4A 3CO9A 4WXOA 3BKFA 2GHWA 4ELTA 3GYGA 3PFEA 2DKOB 3M9OB 3KJFB 4FBUA 2BJ3A 1VC6A 4QCLA 3JS9A 1S9GA 4ID8A 1H7WA 1QE1A 2HG4A 1RQ0A 3PX6A 3NMAA 1SQGA 4FS1A 4B3OA 4QWEA 3TEHB 3VALA 1Q81T 2XMUA 3PHTA 2QL5B 2MY8A 4NLYA 1QE1B 2KG0A 2HURA 3PO5A 1V9OA 2DXEA 5C25B 4LT6A 3CCES 1HBUA 5EX3A 1RZMA 2CWKA 3GE9A 4B17A 4JI8J 5C2GA 2BM0A 4A4JA 1H73A 3IGVA 4GKKF 2ZM6J 3BV8A 2XEXA 2Z30B 3MD1A 2AD9A 2AJ0A 4LSNA 5I4MA 2UUCJ 3CJ2A 2JWNA 1F9HA 2VH7A 3J7ZT 3NG8A 4K2XA 2C2OB 1KR4A 1CQMA 2V2KA 3PRBA 1P1TA 5A8RA 3A8JA 3TAMA 3TAQA 4USWA 4JI4F 2ZBPA 3KXDA 2KXNB 1F0XA 4ECZA 3DYAB 2WW8A 1OQ3A 4OJHA 4ATNA 3OHAA 2DY1A 5I3PA 3MXHP 2FZGB 3CSKA 2RRBA 2WSCC 4ZN1A 4V19J 1B70B 4Z37A 4ZPAA 4DF8A 3AHPA 4BWMA 4F67A 4O44A 1TL1A 1IBKJ 3ITHB 4YP3A 4K0KJ 2QSWA 5HQLA 4G1QB 2FHOB 1OMSA 1C0TA 3PXGa 4YY3F 3L3CA 4YN3B 2YNFB 2K7KA 3PX0A 1N56A 1FEEA 2JFKA 1F9FA 1KTVA 3MPDA 1U47A 3SCLE 3E2EA 2X7IA 1GT8A 2ZC4A 3BGRB 2GA7A 3VGUA 2A10A 2MPUA 2VOOA 4RNNA 4DPTA 4ED3A 1KN6A 1F2GA 2VG6A 1LFPA 2RF2B 2B3TB 1RU1A 1NMEB 5D0HA 2R8GA 1S9FA 1UVNA 3D67A 1S1WA 4NYOA 5KFNA 2PEBA 1GXLA 2W24A 3A12A 4L72B 1S97A 2J6UA 1S9EA 4IO1A 3W2WA 3RBEA 2YH1A 1OJ4A 2V9KA 4I6YA 5AXLA 1BWVA 2MQQA 3PW7A 4ENOA 4FVMA 3OVSA 2BANA 1N88A 4USKA 3VAGA 2IBKA 2NXCA 1RWOB 2ZE2B 2GVZB 3T1HJ 3K59A 3P96A 4OJ3A 5GAHU 2B5JB 3MHYA 2DO0A 2ILZA 3NBPA 4CLSA 2RHSB 1K1SA 3MR5A 1T94A 3VAIA 3JTPA 4HHHA 3U1NA 1UFLA 3C14A 3SV4A 1NK7A 3CDBA 3K89A 3QQCD 3I87A 5J2PA 3TJ9A 4CT9A 5L9XA 1S6UA 5KOXA 4DUZJ 1AFJA 4ECSA 4ZPWR 4GVBA 2XS7A 3IRWP 5M2RA 3ET6B 3LA0A 1YK9A 3N5FA 4FYDA 1TUVA 1LK7A 2GJ2A 1YZ6A 3CD0A 2WHOA 2HLUA 4I2PA 1O0PA 1YWXA 1H6KX 2VFSA 2VDHA 1U6FA 3UO0A 3KJVA 2DRDA 2MZQA 2D9OA 4ETXA 2IBOA 3ZZUA 6FD1A 4OHVA 3TJ8A 4NLTA 2DNHA 3TX0A 1H2UX 3CD7A 5KG6A 3OBIA 2H4YB 5KFRA 1DFDA 2XY5A 3HO1A 1ZS6A 1LQ9A 2G0IA 2F65A 3IAM9 3GIJA 1UMJA 2RKIB 1K0TA 4CM0A 1U48A 2C2NA 3KLHA 3LP2A 3KWMA 2WONA 4LVNP 2DR5A 2QEXS 1CVJA 1FJ7A 1RT2B 4JUZA 2HSEB 4KGZB 1U0HB 4JI6F 2KZZA 4OYIA 1VQKS 4LQ3A 3PKYA 1REVB 1QUPA 1AUSL 3AODA 3MR7A 4TNOA 4C48A 1H98A 3MM6B 1FNXH 1DQAA 2HKEA 1PO6A 1VCTA 3JSRA 3OQ2A 2HNYA 4DV7J 1DQ8A 1Q53A 2F4FA 2VD3A 3KDOA 1RKJA 5GAGU 3OL9A 5HBMA 4Q8FA 3AB2B 3ZTSA 4KGKA 1X5OA 1S0OA 2JLFA 1WC4A 4MFBB 5JMNA 2J9CA 2YKNA 3ILJA 1IBMF 2NUUG 2HEKA 2KU7A 4M5HA 1AXQA 3AOBA 2RS2A 3FSIA 3UCUP 1KQSR 4LRFA 2JSXA 4GC7A 3RAXA 4JI4J 3QJPA 1O51A 2QG9B 1M1HA 2VU5A 4KHMA 1TKTB 3M8RA 2BX6A 1RXOB 1FJGF 2HRYA 1SCJB 4RPFA 4P10A 1Z4UA 1NPKA 1S49A 3D5MA 5K8OA 4CRJA 2HW3A 5DLGA 4B3SJ 4K4YA 4X84A 1VQPS 4XK8C 1FWKA 1SC1B 2RU9A 4X66F 2J5AA 1FRXA 3L7OA 4DV3F 2IFXA 2CPHA 5D15A 3T1AA 4GC6A 1T03B 4C9DA 3PVXA 2P6SA 4CLUA 1I94F 2BE7D 3VVUA 1N54B 4KR0B 1TVRB 2WB4A 5F8IA 3J81U 3G6YA 2Y1JA 3MD3A 2DB1A 3QT7A 2UUAJ 2R7OA 2YX1A 3BGRA 3G6ES 1HA1A 4UUWA 4C7QA 3NGDA 1TVRA 2HGMA 4ED8A 1UVIA 4XDCA 2BBEA 2KJWA 2Q66A 2AJ2A 1S1VA 3LANA 3NGRA 4J90A 4PG7A 3DRPB 4PABA 4ES3A 2B4UA 4J9LA 3HKZD 3EGNA 4IOAQ 3GSIA 2C2ZB 2IRXA 4ZCIA 4JP8A 2W4CA 1C1BA 4XAKA 4CO2A 5BR8F 3TA2A 4A8YA 2IDEA 1VBKA 2D69A 2DEIA 3EPGA 1SH0A 4J5OA 1FDDA 1ULRA 2DNQA 2LXUA 2BZ2A 2MSTA 2RF2A 1LEOA 3HSDA 3TARA 1U8WA 1YZ7A 4ZHRB 3M8SA 5C42B 1F9EB 3RR8A 1NJIT 5I42B 3O44A 3J81Y 1YJUA 2KVIA 3AOAA 2VQEF 2V8HA 2WBMA 3MMAB 3PZPA 3MUTP 3ZO7A 2UUBJ 4QIEA 4A48A 2LCWA 1SIZA 1WC0A 3P45B 3MR3A 4OYMA 1JWWA 3IWLA 2DHAA 3TZWA 4ETZA 3OTOF 3KLVA 2CYYA 2AF6A 3MMAA 4X65J 1KC8T 3P49B 3O6QA 3IR5B 1VGYA 2B5JA 3FZBA 2ZH9A 4FPIA 4OLPA 1DTTB 4M5NA 4O23A 1JLFA 3AOCA 5K5MA 1VQSA 2B51A 3H90A 4URGA 3QJLA 2ZOFA 4DMZA 2HS0A 3DRRA 4Q8EA 3IXQA 2QX0A 2HS3A 3K5OA 4KB7A 1N34F 1T9XA 4WTYA 1FE0A 4P2FA 1TTHB 3H5SA 1VQ8S 5EHHA 2COLA 1FA0A 1PBUA 1RAGB 1U6ZA 1KVKA 3DNCA 4OX7A 1X9WA 1IKVB 5A0YB 5CZXA 3A8EA 4YB1P 2KDOA 3KYLA 2IY5B 2MZTA 1NLKL 3S01A 4KH1B 4ED6A 3J7A1 3WC2A 5HO4A 3FBCA 4KPCA 5D0EA 3D68A 1TZ0A 2OI2A 5CCMA 4K7QA 4F4ZA 2NS1B 4RJVA 1B99A 2MEWA 5IWAJ 3PIPQ 3VQSA 4NZ6A 5KT5A 1CBKA 3IS9B 4P52A 3JSMB 3A3NB 3BR9A 2R2UA 5F8NA 2XMJA 5LXRA 2R8KA 4JV0A 1YRUA 3IM9A 4ITSA 3ETMA 3HHLC 2G2ZA 2HQDA 4ALZA 2CQ0A 2VF3A 3AH6A 3CDWA 2CQPA 1MMNA 4P9SA 1E6YB 4YB5A 3HVAA 3QSIA 4RW9A 3PW4A 3HSZA 4S0MA 3SEOA 4ZITA 3G96A 1VBXA 2WB1D 4OI0A 1FRIA 2WSFC 4Y2MA 1JXEA 3TA0A 3C16B 1KFDA 4U9RA 2QMXA 4QJVA 3W8PA 3HM9A 1ZM2A 4A8FA 3S1TA 4WZMA 3DDIA 2XM3A 3MF5A 4ZVEA 2E7VA 1TKZA 3C6UB 4G1PA 4H4MB 1EQ0A 4C11A 3FVYA 5A76A 3PR5B 3KK2B 1G2EA 4O4GA 1Y5LB 4DLEA 2VPWB 3KNAA 1I3OB 3BF4A 1Q4RA 3K57A 1Y3KA 2D3ZA 5HQMA 5DQHA 3H59A 4CCHA 1OYDA 4OZ2A 1P6TA 2XWXA 4CLLA 3S7RA 1GEHA 1T8EA 1U25A 1BMQB 2V2ZA 4QWBA 1GXUA 1NSPA 4MIAA 1CULB 2NXEA 2YQ1A 4DV6J 2NSCA 2V69A 3BH6B 3EVWA 3IMQJ 1RT4B 1VQYA 4DPUA 4QBUA 3DRYA 3MPUB 4KPYA 2QLBB 5L1LA 4TQSA 2KZMA 3FBBA 1NPRA 1XMBA 2BEFA 1Y00A 2GFFA 2DO4A 2ZUAA 4Y34A 3TVYA 4M5KA 4P6QA 2XMAA 4KFBA 2LECA 3G8SA 1UJ4A 5LSLA 1T95A 3K0JA 2FDNA 2BJDA 4Z2XA 4EO6A 5I3QA 2Q3PA 1VR6A 2G2OA 1TKXB 2E1PA 4O3NA 2KM8B 1NDLA 5LMNJ 3TI0A 1N32J 1LWFA 2DH9A 2DNYA 2XWYA 1XJWB 2NXNA 1WC1A 3C19A 4CH7A 4OL8A 3K7RA 3ONQA 3QIDA 2QGFB 3O8WA 3MECA 1VRUB 2M52A 4ZP7A 5T7LA 4CI0B 4ZKAA 3CUNA 2MLZA 1K47A 3W2VB 1RKIA 3W64A 1UAWA 3R2DJ 1VISA 4LIRA 1HI0P 2PI5A 4EZ9A 2IM0A 3BGOP 4DF4A 4PWWA 1FXDA 1OWXA 1TELA 1KOHA 4J9KA 3RRHA 1J2VA 3NOCA 2LU1A 4LRDA 2Q43A 4MT1A 1TL5A 5THWA 1F5CA 1RTJB 3KKFA 2FLNA 1GTEA 1H0HB 1RGVA 3GR1A 4M5IA 4PR6A 3D0HE 4MYUA 4U8YA 3MOJB 1JLBA 4HH0A 2XYHB 3TVZA 2UU9F 3KOAA 1RAOA 2EFVA 4A8MP 2O66A 2W1BA 4B9LA 2KL8A 3ZXWA 2FHJD 1LXNA 2E66A 1YTYA 1KLMB 2BJ9A 3D6TB 5CABA 1BC6A 1XWLA 2HQCA 3TWZA 5LL6d 2DNGA 3KK1A 1NKCA 3T9ZA 1RAJA 4PQUB 2R7QA 3B82A 1U6BA 3HJFA 1HR0J 3P5BP 1YIJS 1U1KA 2CRLA 3FMWA 1FD2A 1SH3A 1O5JA 2DHHA 2J9DE 2GX8A 1J5OB 3GJRB 4ICLA 2GIFA 1T9YA 2UV8G 1M0SA 1PBAA 1VOMA 2LMIA 3A4TA 2GO8A 3UI3A 5J2QA 3M9NB 4DHVA 3L7UA 4EZ6A 1AZSA 2XMMA 1C1CA 2P9CA 3CT9A 1HIYA 2JDJA 3FNNA 2BRKA 5GAHI 1M5PC 4NXNJ 3H5XA 1SQEA 1DLOA 1MWYA 2PDAA 4IDKA 3NOGA 3W1YC 4JI7F 3OL8A 2G2YA 3BZQA 5B0EA 4TY9A 1RA6A 2FPHX 3TZXA 1C0TB 4ECUA 5KOWA 2ZWPA 3CDEA 2XSJB 2HNZA 3PR4A 4CTAA 4WE1A 4ED4A 2DVIA 3OR1A 4ILRA 4RL1A 1BGXT 4KE5A 2R7WA 4FPRA 4A8WA 1Y5NB 3FJ2A 2Q6BA 2Y1IA 4LR8A 1SJRA 2X1AA 4WE1B 2QIFA 5J1NA 5KFSA 2H4WB 5F0UA 3R5GA 1I51B 2Z2LA 2HRTA 1NB2A 4KTQA 2G9OA 3AD8C 1U2CA 2LQ5A 3H98A 4MIWA 4BLGA 2XCPA 2DXDA 1L3UA 2GMHA 2KT2A 2CDQA 4OI6A 1FFGB 1YBAA 1A0OB 1JJHA 4NOHA 2OD4A 1R0AA 1JX4A 3MM9A 1JJ2R 1WNEA 2JX2A 4AXIA 4IRKA 4QIWD 5CA5A 4RW9B 2MLXA 3D6FB 4ANDA 1DJ0A 2PN6A 3DOMA 4FKXA 4AE5A 3IC1A 2EK6A 1RLCL 2M70A 3SQGB 3CJ0A 2MZ1A 4FF1A 2HNDB 3POTA 4QWCA 3BDPA 5HATA 4DI6A 4IR1A 4FXDA 2UXDJ 3R2CJ 4UQGA 1V5VA 4C8NA 4OYPA 1SQFA 2K06A 3BN7A 1DQ9A 1XMOJ 5CQGA 4B9NA 3M32B 5IT4A 3FSXA 1VYAA 2I1RA 1VIOA 2OSQA 1H2TZ 3AA9A 1VK3A 4OZ3A 4X4OA 1IKXA 4F8RA 2NREA 5CHCB 4CLFA 1FT8A 4J37A 4LBIA 5CAAA 5GAGI 2GS8A 1DARA 2HHPA 1YDLA 3FCVA 3IS9A 1S4FA 4JI8F 5F9NA 3MFHA 4B3TJ 1P27B 4MKYA 1BQMB 1ZPVA 3J7YU 3CCLS 1HHTP 2V4QA 2OJ3A 2BOAA 4LIWA 1IQTA 2DHSA 1UZHA 3CMAS 1HNVA 3SCJE 3VZHA 4QPXA 5KFVA 4DR4F 3QWPA 2ZKUA 2MQMA 2M3DA 4YB7A 4Y2AA 3CDUA 2IVMA 4X4RA 3T1YF 2KFNA 4XTTA 4C8YA 2N3OA 3D6MB 1TFWA 3GIRA 3MAAA 1IWAA 3B4DA 4RUAA 4JI5J 2A2DA 1IBMJ 3RBDA 1Q16B 3DMJB 4LREA 2MKKA 4RBTA 3UCZP 1HQEA 2GC8A 4Q0BA 3HZEA 1MMDA 4EFAC 3BGLA 1CSJA 4ZLLA 2CJ9A 1YRTA 4ZVSB 1MN7A 3HF5A 2KI2A 2JJ4D 3C8YA 5DO2A 1OSDA 1CC7A 2F8HA 2J8AA 2XMWA 3Q2SC 2DH7A 2XBPA 2Z0GA 4KO0A 1RA7A 4LR9A 3T19A 1SL2A 1N36F 1K9MT 2E5LJ 3GP9A 4RW6A 1S59A 4TYAA 3IWXA 1VQNS 4C4WA 2XG8A 1V5IB 1WUUA 2YWKA 5HK4A 2C3PA 3DRSB 4WU3A 2DHGA 1GAOA 4RUHA 4MTPA 1HNXJ 4H54A 3HKWA 4U96A 3OLBA 3QGHA 1VBYA 1X9SA 4MMOA 3IBFB 3KMQA 4ZJQA 4O0IA 4DSEA 4CLPA 2I0XA 3SBMA 2VBZA 5KFMA 1F5BA 3J81j 2Z2ZA 1E6VA 4AL7A 4RW4B 5ITHA 4DFJA 2QRRA 4FF4A 2V8DA 2MKHA 4NE9C 1K0VA 4FYXB 4W4MA 3V2UC 4C8ZA 1UP1A 1IBKF 3PYFA 5G0RA 3BJYA 1S0MA 2NPFA 3VV2B 2EFNA 3M1VB 1HPZB 3QRQA 3MPYA 5JVGQ 4OYAA 4RBUA 3NXZA 2LFVA 3QBCA 4C8LA 2UXBJ 3Q8VA 2PA3A 1QSSA 1S1XB 3L95X 2IPOB 3CIZA 1NO8A 2YX4A 4L3KA 2C42A 2XHWA 4YS2A 2AYMA 2CPFA 4ECYA 3W63A 7AT1B 2MKCA 5D77A 3HP6A 1NSKL 1FJCA 5FDLA 5DDPC 1EJ7L 2VJVA 2M8HA 3N6LA 4USVA 2MTLA 4DV0F 2UU9J 4PYAA 4V19X 1RWNB 4ED5A 1U02A 4PKDB 3M05A 1C0UA 2YKPA 2V94A 4IG3A 1U1MA 5JVHQ 3QJJA 2AGPA 4K4SA 1BE4A 4L73A 4JV2A 2RNEA 3KUHA 4IG0B 2LP4A 1VJWA 4P2MA 5J2NA 3O3LA 3GZ7A 4PG5A 4JI2F 1MLAA 3G9CA 4NLWA 4ZVHA 2DGQA 3MUVP 2CVIA 4ZP8A 3NGTA 4B9UA 1OPIA 4ZA1A 3KLFA 1D8YA 1IXKA 2OO4A 1K1QA 4B3SF 3C46A 4YMEA 2R7RA
chains in the Genus database with same CATH topology
2NUHA 2KRBA 5C42A 2FGCA 3TO8A 1KTQA 3OSPA 3RW6A 3O1LA 4UOCA 5D3GA 2RVJA 3BGUA 3MDFA 3UDLA 3TR5A 1HBOB 2FVRA 2ZC3A 3E01A 1KEKA 3OXFA 2ZD1B 2YKMB 1S77D 2FJWA 4B3RF 3TQ1A 1U26A 1XMOF 3KJVB 2YKMA 3MCSA 1MROA 4ZPTR 1S1UA 3WBZA 5DETA 4KRWA 3I6PA 1D9DA 4RNHA 4CTAB 2DHXA 4IH7A 2CQ2A 4CO0A 4Y65A 4PG6A 1RI7A 2UXCF 3CDAA 2RJZA 3JYTB 4QPTA 1X4HA 4K4VA 4YDDB 4LSLA 4ZCMA 3I9ZA 2KYXA 2POKA 4DL7A 3UQSA 2AX0A 4PQAA 5KFAA 4MK8A 4NRUA 5KFLA 1HI1A 4L3NA 3HLUA 3M9MB 1HBNA 2OAUA 1G7CB 4P2SA 3R5BA 3DLKB 2AJQA 2KB2A 5E3RA 3SFUA 4N8NA 3FMBA 5J2QB 4K5SA 1FDNA 3GFHA 1OSCA 4C11B 1RT5A 3NNHA 4HYKA 2B6AA 2FJXA 4UY85 4OMFG 1CG2A 1DTQB 2KXHA 3QGIA 5AXNA 1HNWF 2J6TA 3HFKA 3I0RA 1N4LA 1RYSA 2V4RA 2YNIA 2V4JA 5GAEU 4K4UA 1HBUB 1FDBA 2DNMA 1S0NA 4KJIA 4O3OA 1SIWB 1WHVA 4X62F 4JI0F 1X4CA 3GFYA 4OI2A 4DV7F 1Y7PA 4M1KA 1XBWA 2HHSA 1A7GE 2OMOA 4RKUC 3RW7A 3MMJA 1EP4B 3OL7A 2CPJA 1KQKA 2VUGA 1SJ3P 3OSNA 3W3SA 2R7UA 4LUBA 3MURP 1ZBTA 1N32F 3DC2A 4DV1F 3PEHA 4USIA 2GJIA 1WTFA 1S9GB 2HGLA 3CMES 1L3KA 2LU2A 2HFZA 2IYIA 4OZ0A 3AB4B 1D0EA 2YKOA 1Q82T 3T5LA 4DL6A 1R27B 3LQVA 3MM8A 4DSJA 3D1QA 5CH7B 2W9CB 1ZH5A 2IAJA 4HHJA 1SUQA 2DR8A 1JLCA 5J2NB 1FKPA 2YY3A 3VAJA 2VG7A 5L38A 4TLQA 3R5DA 3US5A 3DN9A 3MZIA 3SSQA 4B3OB 2H5EA 2BE2A 2ZJPQ 4O3QA 1FRHA 2PEHA 3A1YG 4DS5A 4LF6F 1UFWA 3LP1A 3KG0A 2YNHB 4NLGA 2E1RA 2ROGA 3D2WA 5L1KA 3EGWB 3G86A 1RTDB 3I82A 5KFIA 3IAS9 3I31A 2F7VA 2HIQA 5CCLA 4IOCQ 2YNHA 3THTA 5KFEA 2G1DA 2EFGA 1Q1KA 3ZZRA 4NCAA 2HHHF 3DOKB 1SL1A 4M95A 1VIXA 4X65F 1FRJA 4R8UB 1KFSA 1YJWS 3Q8QB 5DQGA 4LFAF 3TA1A 1L3VA 4FF2A 4C3MA 5HP1B 2OFGX 4PRFA 5IS2A 2B4OA 2OPPB 3TOQA 3UCGA 2PSZA 2ZJRQ 2ROPA 3E3XA 3BB5A 1HI8A 1VQ6S 1W2IA 1KLMA 3T5JA 1JLAB 4FN5A 4YB6A 1X9MA 2F8EX 1UVKA 2DNKA 4JOUA 2KHCA 1TL1B 1F60B 5A6WA 5KFPA 5M2UA 1S1UB 4X64F 1KVIA 2C3YA 3ZZ0A 5F8JA 1Z1ZA 2ZKTA 4RW8A 2YNFA 2Q1LA 3F44A 3J7Z5 2M2BA 5DQIA 4TU8A 1HW8A 1SBRA 3MGJA 4EO8A 3V6DB 3C66A 2YWFA 3I5AA 3I0SB 2DGWA 3G4SS 3JB9k 4E8UA 4DQRA 3EYZA 1FEHA 1X5TA 2CKWA 2ZHAA 3V6JA 4KHRA 2UXBF 2M0GB 3M6XA 2DNRA 1OO0B 3I0SA 4OI3A 4X4UA 3IO1A 2AV5A 4RU9A 1S1TB 4FP9A 3N4WA 3L09A 5MLCV 2OH2A 4A8KA 1U4BA 2I38A 1S6QB 4U6PA 3QIPB 3CC7S 4WFXA 2E44A 4RNFA 1NEEA 1RT5B 1SC6A 1U24A 1S9EB 3GFXA 3VZIA 2Q79A 3ZZOA 2ROEA 4F26A 5D3GB 1T7PA 2WOMA 1NJZA 1LWCB 3T5HA 3DLKA 4IH5A 1HQUA 1OS5A 1WEXA 3F56A 3QLHB 4RW7A 2KFYA 5LMNF 2IJNA 2FUG9 4ZK7M 1V3SA 2ZD1A 2DCUB 3DM2A 2XB2D 1YJTA 4ZS6A 1HWKA 2DGTA 4QZVB 3PDNA 3WX4A 1P1LA 3M2RA 4BC7A 1NNDA 1NZAA 4IFYA 1SJQA 3MEGA 1N8RT 3C6TB 3HHKA 4ES1A 4K4XA 1JIHA 1RT4A 3DLHA 4OHYA 1TQLA 1TL3A 4GO5X 2JLGA 1J5EF 2YWHA 1BQMA 4RBVA 4C8KA 2GIQA 2UXDF 1B0PA 3M6VA 3PX4A 1VQ5S 2EWHA 4ZVGA 3IA0A 4AXJA 1AROP 4Q44A 1WTBA 4Q5VA 1JLGB 4PCQA 4TXSA 3G6XA 2HWHA 2XZWA 3N79A 3LP2B 3HHDA 3S8SA 2UVVA 1X7VA 4YR2A 3GYXB 3QPIA 2BACA 2CJQA 2BDPA 3HT3A 2HGNA 4ERDA 4ZDNA 3LW5C 4RNMA 1SUQB 4EYIB 4DN0A 2BJEA 4MIBA 5KAKA 3VWSA 2HNYB 3CIMA 5E5NA 1Y0HA 3OHBA 4URQU 3OR2B 1N5VA 3I0RB 5L1IA 1HHSA 3JSBA 2E5GA 5J2MA 1KHVA 1PC4A 1ZOTA 5KFJA 1U45A 1B64A 4DWIA 1APSA 1XC9A 2GIRA 1LW2B 3KLIB 2M8DB 3PEJA 2FIUA 3OW2R 1TP7A 5GMKa 5LXYA 1QSLA 3VCDA 2NR0A 4A8QA 4B9MA 1U2RA 1FERA 2DNOA 2L9WA 3CD5A 4NX9A 2CFXA 2PMHA 4BWJA 4M8LA 5D4NA 4R5PA 4F50A 5DDOC 4DR5F 2WTFA 2F9DA 2DGXA 2RU3A 2ADBA 4QWDA 1IBLF 2P5VA 1FRLA 4M5DA 4HEA9 5KG2A 2HVZA 3SDEA 4EBDA 1URRA 5CYQA 1FJEB 3FZ2A 4G1QA 4OX6A 3TAMB 3DU6A 1QAYA 1R3NA 1S6PB 1WD6A 2YWGA 5CYMB 1XTZA 2CIMA 1VC0A 1XERA 1M5HA 4ILMA 2UZAA 1VFJA 2DD8S 3ENVA 1S6PA 3CC2S 5DGAA 2B4PA 2Y0SD 5KFUA 1N48A 2M5YA 4Q43A 3LOUA 3FCHA 1IKVA 2J7UA 3R27A 1D9FA 3P3DA 5E33A 5FD1A 4A8OA 3NCRA 2ZH4A 4MKYA 5IZHA 2R2SA 1BLUA 4FXVA 4R25A 1S1WB 3BDEA 1QSYA 4I67A 2W25A 2EG2A 1S1VB 3JTOA 4MH8A 1RT3A 2AYGA 4IG3B 1N6QB 2ASLA 2ZJQQ 1C1BB 5KFOA 1HW9A 3M8QB 3NCQA 4H4OB 2HMIB 5KT4A 4F3QA 1ZZFA 3KLEB 3VAKA 3CCJS 3LGMA 2VBYA 2MHNA 3HVWA 2L9DA 5K8NA 2OPPA 5H9EJ 1S48A 2BANB 5GVQA 3NWGA 5B0BA 2VONA 4WIIA 1X4FA 3BN4A 3MEEB 4PPZA 5DJBA 3TX8A 3UWTA 1ZM9A 3HHNB 3B4MA 1X0PA 5J1EA 5FLXY 3V81A 5E3PA 3BO3A 2XGPA 2R8HA 1R8PA 4Q45A 4F4KA 5E2QA 3VQTA 5GADI 1JLQA 1KHWA 2UVUA 3DLJA 3H25A 3G8QA 4TYBA 3ZZPA 4MAKA 3CVKA 4QWAA 1PSDA 2OKQA 1SI9A 5D4PA 1HBMA 1Q7LB 3MEKA 3VAHA 4IQXA 2L48A 3L7PA 4I2PB 2F1FA 3I5CA 1ELOA 2DK2A 2VKZG 2L41A 4A47A 3ISNC 2CJKA 2C2RA 5E3QA 3EZUA 2AJ4A 2QZ8A 5EWEA 1VRTB 4HDGA 2XY6A 2VC1A 3T5KA 4RZRA 4DV6F 3DRXA 3PW0A 1V6HA 2RQKA 3MM6A 4WZQA 2B9XA 1XMQF 3OJUA 5HN0A 3CPWR 4A8SA 2EBGA 4HKQA 3BREA 1BD6A 1HQEB 2KO1A 2RQMA 7FDRA 4Q0BB 2UUAF 1HNXF 4WYWA 2V4JB 4K5RA 3HX9A 3TUJC 3KMSA 2HRUA 3OFGA 3LAKA 5IFMA 4JV5F 5B0GA 2J9EA 4MK7A 4ZPDA 1W2BR 2HHVA 2HHWA 4I56A 3LGNA 1N5YB 1H7XA 1JLEB 2GQQA 3FFIB 3FRYA 1JK9B 3IBWA 3MMBB 1UETA 4OFZA 5DM7Q 3QZ8A 3QGGA 2K2PA 2A2CA 2OPSB 3FFIA 4HT5A 1KD1T 5G4DA 4A46A 2YWEA 4DV4F