3H42A

Crystal structure of pcsk9 in complex with fab from ldlr competitive antibody
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From the Cover: A proprotein convertase subtilisin/kexin type 9 neutralizing antibody reduces serum cholesterol in mice and nonhuman primates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
molecule keywords Proprotein convertase subtilisin/kexin type 9
total genus 21
structure length 92
sequence length 92
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3h42A01
3CO0P 4JP8A 3VV2B 3SQOP 3A3NB 3A3OB 1R6VA 3T41A 1SCJB 3GCXP 4YN3B 2W2QP 2W2NP 4NMXA 3WHIA 1ITPA 3BGOP 3WIUA 2W2MP 2W2PP 2Z30B 2ZWOA 2PMWA 3WIVA 3AFGA 2W2OP 2Z56B 2Z58B 2Z57B 3GCWP 2Z2YB 4K8RA 3H42A 3A3PB 3VHQA 1SPBP 3P5BP 2XTJP 4NE9C 2Z2ZA 4OV6A 2ZWPA 3CNQP 3QFHA 1V5IB 2QTWA 2E1PA 3BPSP
chains in the Genus database with same CATH superfamily
1SC1B 3PJWA 1R7IA 2AMCB 2F7VA 3UD5A 2D9OA 4X4QA 4IRCA 1T94A 2IVMA 3OTDA 1X5PA 3TYTA 4IQXA 4DCPB 2KT3A 2MY7A 4OHWA 5KFJA 1C4AA 1R27B 1XEZA 4NLPA 1SJRA 1OWXA 5A6WA 1CPZA 2BDPA 4NYZA 3BN7A 2UUCF 3CDUA 4NCGB 2C3MA 3LGNA 4DMZA 5K14A 2XO7A 4LQ3A 2R7UA 3LOUA 4ZOSA 3WIVA 4PAAA 3BKFA 2NR0A 3ISND 1WI8A 1YJRA 4C2MA 2BA9A 1Q0NA 2ZEJA 2HQ3A 1RA6A 3RGIA 3MM8B 3OL9A 5K8PA 3TA2A 3I0SA 1ZTWA 1GEHA 2E9TA 3I5BA 4F4AA 1Y3JA 2GGPB 4U8VA 2WZ1A 2FC9A 1N0VC 2PN6A 1PG5B 2J7WA 4TU8A 3G96A 3RRGA 3OVBA 2IDLA 2GVZB 5HQ8A 4K4XA 1RTIA 1NCLA 1BE4A 2CJQA 1QLNA 1QE1A 1BUXA 1JXEA 1NPKA 2FVCA 2AF6A 5ETKA 4LIRA 3OUYA 1CJTA 2HBZB 3CCMS 2G2ZA 4WKRA 1VDHA 2HZAA 4I68A 3OFHA 4FZVA 4KH1B 4DPTA 3SSSA 5IT9Y 1LWCB 1DQ9A 1FDAA 2QX0A 3WHIA 3MMBB 3CMQA 5H9EK 2ATLA 1BQMA 2M8HA 3PFOA 4LBPA 1LK7A 2OPSA 1NHUA 2LDIA 4ZKAA 3M9OB 3HZEA 5KFZA 1N6QB 3P49B 2RNEA 4N56A 2VODA 4N41A 4QR1A 2W7AA 4CLKA 1HQUA 2COLA 1X4AA 1HWJA 4H4MB 2E66A 2VKZG 5KFLA 4DR3F 1RLCL 1MMLA 1R0BG 2GGPA 3FQKA 1RT3B 1SH0A 3A4TA 2EC0A 3P3DA 1HYSA 1F6TA 3CC4S 1T3OA 2HGLA 4MKBA 1WSRA 3GYXB 3IRXA 2C2NA 3Q8QB 4F2SA 2RHSB 5D3GB 4OI4A 4PR6A 3H2UB 2QT7A 3M9MB 2DYAA 2HNYA 5GAEI 1Q8LA 2YWEA 3KJVA 1NJZA 4DV1F 2KTQA 2MSSA 2DNKA 4QYRA 1R31A 2BX6A 2IMWP 3RW7A 1MROB 2AX0A 3NGUA 2KO1A 2RUGA 3H5UA 3A13A 1X60A 3QATA 3GTYX 4P75A 4GC6A 5J1EB 3GZ7A 3UDVA 1RTZA 3W65A 4FF3A 2VZ9A 2CJBA 1H3DA 1X5OA 2IHR1 4OX6A 5JVGQ 5IM0A 5HL7Q 1NXIA 1NB7A 2MKKA 1VMBA 3K58A 1TUVA 1ZM3A 1QTNB 2ZC4A 2AJQA 4F4KA 3M8QA 3Q8SB 3I4HX 1T0TV 5KT7A 1RBLA 2F3JA 3HF5A 1TUWA 1RAEB 2LU2A 1S1TB 3LAKA 3M2RB 4WIQA 4NYPA 4J9NA 3T1HF 4RUBA 1IR0A 4K59A 2HHUA 4ZJLA 3KJNB 4HL9A 4X4VA 4MTPA 4JI4F 3GB0A 1NPRA 2L41A 3G6YA 3X3UA 4OYAA 2W4DA 3UDEA 2ZKTA 4HR2A 3CCJS 5CABA 4NLWA 2R8HA 2BE2B 5ETVA 2HAFA 4RUCA 8AT1B 3VQTA 1WUUA 3DOMA 3DDIA 5DZ6A 3M30A 1RWPB 2KRRA 2VH7A 1CJUB 3MOZA 4ED6A 2FJEB 3AT1B 3M2VB 2ZH9A 2HQCA 4FPIA 3PV8A 4QZVB 4RW9A 3L9ZA 2M9KA 4NZ0A 4LFCF 1VR6A 2DY1A 2GMHA 2ZD1A 3HFKA 3U1LA 1U1PA 3CCVS 2PC6A 4AT1B 2FVSA 3PO4A 3D1QA 4L76A 2XSJA 5HROA 5DQIA 1Q5VA 4YB7A 3DXBA 1TL1A 4PWUA 5T7LA 3TW0A 3US5A 1HBNA 2DGSA 2XM3A 2XWYA 1CLFA 4JP8A 1RHQB 2GHPA 3PW0A 4OHYA 2HNDB 4I7FA 4NCAA 2UXDJ 4DV6F 4ECSA 5A0YB 3LANA 1VQ8S 1FKPB 1WWHA 2VG7B 5C24B 3VZHA 2CPFA 4I2QA 3TUPA 2IRUA 2MJNA 2NSCA 3H25A 4JI7F 2CA9A 1SI9A 1VK8A 1FFGB 3SCIE 2DD8S 1YBAA 2W2PP 3AOAA 2XMKA 3HVWA 1JJHA 6FDRA 1DTQB 2YKQA 1F2HA 3HHDA 3THPA 2N3OA 4X65F 2AJ4A 1BHNA 2RS8A 3SSQA 3O8WA 5KFFA 1S7IA 3UD3P 4MAKA 2BQ3A 4XDCA 2VQEF 2MDAA 2PFFB 4LR7A 2GJFA 3NMRA 1SL0A 2VQFJ 2Z2YB 5K20B 5GAEU 1T03B 2D69A 4KB7A 3SMZA 4Y34A 1FE0A 2CZ4A 4Z7YA 2VOPA 1FRHA 2EC2A 1NRKA 1XMQF 2DNZA 2OLWA 3CO0P 1HR0J 2ZBIA 4FXVA 2EFQA 4LRFA 1AYEA 5T14A 1S6UA 2YNHA 3CWJA 4DCOB 4H4KC 5BR8F 1S1VA 3D6TB 1WF2A 1RBAA 1RE1B 1OQ6A 1OQ3A 2JHEA 3R6LB 4KKOB 4WFAQ 3I87A 4PXEA 3N5FA 1QAXA 2JZ5A 3ZTQA 5IS2A 4ENOA 2GAHC 2H5IB 2X51A 3OV7A 3MCOA 1EKSA 2MQPA 3PG9A 4Z7CA 4L3KA 4K4TA 1S72S 5I3QA 3PIPQ 3HKZD 2YQ3A 4KIAA 3ICLA 4J9KA 2FJBB 2GV1A 5D4PA 5C2CA 3NOCA 3KDNA 3MM9A 3UPFA 1HI8A 4Q2MA 4FNIA 1ZPVA 3H42A 3MMCB 1LFWA 4AL6A 1W2IA 3ZO7A 1XMQJ 3H2VE 3NGSA 4B3SF 1HQ2A 2CG8A 2QTWA 5IQ6A 2OEJA 4X62F 3Q8VA 3Q83A 1RT7A 5FDLA 3NXZA 3VAKA 4UY8T 2KRBA 1H72C 5DDQC 2QMXA 1A7GE 2B4OA 2WB4A 5KG4A 3Q89A 4B9LA 4ZLNA 1SCJB 2QYCA 3ETMA 5IZHA 3NKYA 5CYMB 3W2WB 2DXEA 3K89A 2V4QA 3BSNA 3F0NA 3V81B 2D3ZA 4W98A 5ETPA 5A76A 1R0CB 1VRUB 5ITHA 1PBUA 3OVSA 2MKYA 5EGYA 1SQEA 4P52A 2AJ1A 3SXLA 3QGPA 3TEHB 3J80U 2HHVA 1WG5A 2R4FA 4JOUA 2H65B 2LMIA 3HZGA 4EEYA 4DUZJ 3KXDA 4FF2A 1P27B 3FBEA 1UW4A 1YJNS 4KH0B 4WU2A 4RZRA 1V3ZA 2X1AA 2BJDA 2UXCJ 1RUSA 2L48A 3M8YA 1SKSA 3ZZ0A 3VAIA 1NK0A 4O3SA 3L7PA 3OXGA 1Y4ZB 3EUNA 3MCSA 2LQ9A 3MM7A 3Q8PB 3DRSA 3EGNA 4FYWB 1CSJA 2DRDA 1R6VA 5K8MA 4DHVA 4M95A 2K2PA 5KTQA 3OTOJ 2CQHA 3OLAA 1O6XA 4QIWD 1NK6A 1BD6A 5IV4A 1RKJA 4JI6F 2YVSA 1M1KT 1U1NA 1MU2A 4X64J 4X66F 1RABB 3FRZA 3DLEB 2VU5A 3LP1B 4C8MA 4DN0A 2R8KA 1TFWA 1RTJA 1Q16B 3KLHB 2XB2D 1D9FA 3MAHA 3GSIA 5F8HA 3JYTA 4ICLB 4PCQA 2HEKA 4O4GA 3TVYA 1V6HA 2QMWA 5D4NA 3SCJE 4DUYJ 1S9FA 4DV5F 4ZCKA 5RUBA 1PYTA 2HQIA 3MUMP 4DZ6A 1Q8BA 4CLYA 3PKMA 1ZA1B 4OYWA 1FWLA 1UZDA 3T19A 1VC5A 1S76D 1ACMB 3KYLA 4YY3J 5L46A 4DQRA 1UMJA 4L75A 2QC3A 3KLEB 3KK1A 3QSYB 5JMNA 3QJJA 4LMZA 3UVJB 1UPPA 5AXMA 1MLAA 2PIIA 2VFTA 2X3GA 1RT4B 2QLFB 4CO0A 4KGXB 2OPSB 1YJWS 1FRKA 2B51A 3MAQA 3GIJA 5KFOA 1RHKB 3L7UA 3OR2B 1NLKL 3GU0A 4DV3F 5E5NA 2DXFA 3OHBA 2QA4S 5I3UA 5DGBA 4X84A 5KFUA 5HANA 3IR5B 3K5NA 1IQTA 4B9VA 1VIXA 2R9LA 1H0HB 3TAMA 1IWAA 2IAJA 3S7RA 1XMOF 4B9NA 2PFDA 3PYEA 2KG0A 2AHOB 3RRHA 3GE9A 4UTGA 3B4DA 1U26A 3IM8A 1PJ6A 3NLCA 1C1CB 2HZCA 2W9CA 2G1DA 5HSPA 4KGVB 4Q44A 2ASDA 1WKLA 3LP1A 1OMSA 5B0CA 4X4TA 2CFXA 3HHLA 2XI3A 5BJRA 3W7BA 2BV3A 2W2QP 3OFFA 2IY5B 2IA6A 1Y0HA 1YQHA 2CQBA 2DNLA 3EICA 3SDEB 3ZNUA 2HNZA 3MCNA 1S7HA 2Z30B 4RL1A 2ROPA 3DOLB 5I3UB 1PKUA 1S99A 4DL6A 3PX4A 4ZPDA 3K5LA 2HVHA 1U45A 3TUZC 1PIEA 4NOHA 1GMVA 2BKOA 2HAIA 3BR8A 3GCWP 4PYAA 1OPIA 2ILZA 2M5YA 4IFYA 4WP9A 4IFYB 4RW7B 3UVJA 4O3OA 2PSZA 5KFQA 3NNHA 8RUCA 1CQNA 3A1YG 4NRUA 2NREA 3OSPA 1YWXA 3M6UA 3V2UC 5HVGA 4HYKA 4DS5A 2L9NA 1S1XB 5LSOA 1N34J 4JI7J 4PQUB 4LRDA 3FEXB 3UQSA 2ZBPA 2C2EA 2MQLA 1NSPA 4WF9Q 1UVNA 1S12A 1APSA 3NEKA 4QIEA 4USKA 2FJAB 4LSNA 2MB0B 2UVVA 3ENQA 2MQOA 1R8HA 2V67A 5HO4A 4ECXA 2RILA 2KXFA 1UEVA 2H48B 2JLEA 4KQZA 3IAS9 3E2EA 1RHJB 4OZNA 2H4WB 3SEOA 5HVFA 4M5DA 2IDEA 3R5DA 2YBVA 4JI0F 1RT2B 2NYIA 4F67A 3M8SA 4AL7A 5J2MA 4OI1A 1HI1A 1D1UA 2BJ8A 2ZH5A 1MMDA 3EDRB 3KUHA 2ASYA 1SL2A 3BPSP 4NA2A 4FN5A 4C11B 1TK8A 4JV5F 1Z2LA 2UXBF 4A8YA 1VCTA 4X62J 1UTAA 1WC4A 4Y2CA 4FPRA 2EFNA 3D4JA 5CYQA 1RU1A 3NWRA 2DEJA 4ZCLA 4DV4J 4P73A 4QR0A 2OD4A 3BBBA 4IG0A 2CPZA 2FHKA 2N7CA 3DU5A 4KPYA 1FE4A 1K8AT 1FJ7A 1HPZA 4D3GA 5DG8A 1NSAA 3EWGA 4QQBA 3KHRA 1KR4A 1NH8A 4DR5J 2LEBA 1NDCA 4IRKA 1FRMA 3IGNA 1GK8A 2GNKA 1U6FA 4C8LA 4OZ1A 4PG6A 1C0UA 1N36J 5LMUF 2IM3A 3CDAA 3TJAA 1L3TA 3BM7A 3MGJA 4AQYJ 1TL5A 4K5SA 1O5JA 2KYZA 4WFXA 4C97A 2EG2A 2V94A 4ZVSB 4ID8A 4ZN3A 3CCQS 4EBEA 2YH1A 1VQ5S 2ZDPA 5K5MA 3M1VB 4CM0A 3KKFA 2Q6BA 1KQFB 3CJ4A 2NXJA 3EGVA 2R7RA 3GP9A 4RWWA 4YR0A 1AXQA 5A8WA 3AOCA 1HBMB 5DETA 4K0KF 4ECRA 1QSSA 2RDDA 3BF4A 4UT4A 2J76E 4LF2A 4TYAA 1NBEB 3CEDA 2QLXA 3MPUB 3JQJA 1IM4A 3CCUS 4LSZB 2W24A 2VBZA 1K44A 5DRKA 1N33J 4DUTA 1LW2B 2CPIA 3QFWA 2DNYA 5CH7B 2P8IA 3NGTA 2NCKL 2PEBA 5HAOA 5C5JA 1LWFB 1JLBB 4NLRA 3WDOA 2KG1A 1IBLF 1DTTA 3CO9A 5HJXA 3VWSA 1KQGB 1S1WA 1BLUA 2LKZA 2VIHA 1NUEA 1JLEB 4NCBA 4B08A 2X1FA 1HHTP 2YKMA 4ECWA 3VGVA 2BM0A 3S1TA 1WKJA 2D3UA 2J9DA 2WCXA 4NASA 4FS2A 2E7VA 1U25A 3EX7B 2BR0A 1NPPA 3IWNC 4ZPBA 1FX4A 2V2VA 2AKWB 1MWQA 2C2ZB 3LH2S 3DLJA 3EGWB 3TAMB 2W9BB 4JI6J 2A3JA 2W2NP 2P2CB 4LR8A 5AXLA 1EIYB 1QM9A 1JKHB 2GMJA 3GMGA 3PFEA 5F9NA 2PEHA 5KOXA 2F8HA 1F5AA 1WACA 3DLEA 2KH9A 4CT8A 4Y2KA 5FDLB 2QSWA 2WW8A 5M2RA 2VPXB 4CLLA 2G4BA 1SJQA 3PNIA 5FJ4A 4PG8A 3LO3A 1VJQA 2NZCA 5E3AA 2DPIA 1FHTA 1RWMB 4MK7A 1FEHA 4USWA 4WU3A 4DBQA 4F3OA 3HVTB 2IFXA 3ULHA 3CJTA 5E3PA 2WSEC 3TO8A 2HK3A 3FC9A 2N3LA 3CNQP 4CWBA 1EX8A 1N5TA 3PHEA 4M5MA 3CD6S 3T3FA 1C0TA 3C16B 3W2VB 1IKVA 3Q22A 3ENAA 2VL1A 1CG2A 4I2PA 4I2PB 4Y2MA 1G6BA 5DS7A 4ECZA 3JTNA 2V9KA 3I5CA 5KFEA 1REVA 1UVLA 2SXLA 2VHGA 3C2PA 2KXHA 4BC7A 4ANCA 1N32J 3GPAA 4M94A 2DR5A 1IQZA 1RAFB 3VAHA 2AYBA 4K5RA 4U7UD 4GKJJ 4OYXA 1ZH5A 3RRKA 4OV1A 3I5AA 3UO0A 4HLBA 2HBRB 3T5LA 2HSEB 2IMOA 3ILIA 2E7WA 4QJVA 3SQGB 1Q7LB 4ZLLA 1DBDA 3BYPA 3IRXB 6FD1A 2QLBB 4WE1B 3WQPA 4DV7F 3UI3A 2MKHA 3J81U 3AXKA 4PXDA 4Y2AA 2MQ8A 4HEA9 3SYZA 1L5UA 4JI4J 2XZDB 4KHMA 4NLVA 4YY3F 2MEWA 3EZOA 1TKTB 4USIA 4AUKA 3J7Z5 4G65A 5F41A 1LWXA 3T1YJ 3RBDA 2CNNB 3JYTB 1YRXA 3G8TA 2W9AA 1IBCB 2FC8A 3Q24A 4N47A 2A2DA 3BKUA 4WIIA 3W64A 3TZXA 2ZFHA 3IBWA 3BV8A 2LQBA 2E5HA 2KI2A 4GO5X 3NGDA 1RB0A 4QOTA 1SVDA 1WEXA 1EARA 5IM0B 1N56A 1FXLA 1B99A 5HMXA 4B3OB 3HVAA 2A0FB 3KNGA 3GR0A 3V4IA 1RXOB 5M2UA 1PC5A 2E5IA 3CD0A 1SB6A 3H5SA 4C8NA 4F7VA 4PUOB 1FRXA 1IJFB 2UU9F 3D0HE 2M7SA 4OZ0A 5KT3A 1G4CA 1B4SA 1JLGB 2O01C 3C19A 4MFBB 4CYUA 5KFYA 1IKYB 3KWMA 5DGAA 3PO5A 4ELTA 2RQKA 2JEIA 1V5IB 2WONA 2J6SA 3LWLA 4DR4F 2YKNB 1MN7A 3MPVA 4DV2J 1LW0A 1N5YB 2CNOB 3IXQA 2B9YA 2RF2B 1S79A 2J6UA 3NCRA 3M8QB 2DR9A 4BCAA 3AOBA 1ITPA 1B0PA 3FCWA 1KN6A 1QAIA 4DR7J 3K57A 4OHZA 2ZOFA 4FXWA 3UR3C 3RB3A 1RACB 2L9DA 4M5JA 3G6ES 2XULA 1KSPA 2OP5A 4C6AA 3OVAA 1VQMS 1EKRA 3PHTA 4NYOA 2K1RA 4IR1A 2E5LF 1OIAA 1YJVA 3W9IA 4HDHA 2KDOA 1RYSA 5GAHU 2UP1A 2FLOA 3LPEA 2R8GA 3TZYA 4DV2F 4I6YA 1FJGJ 1S49A 4ES2A 4B3OA 1Q81T 5DG9A 1FJCA 1NAQA 1TP7A 1IBMJ 3MZIA 2RRAA 3E01B 5F0WA 2BXJA 1VBXA 2G0IA 1GFWB 1WNEA 4X65J 1S5ZA 4KBIA 2BJ7A 5CA5A 3RZAA 3ZZOA 2JJ4D 3HHEA 2Q79A 4ALZA 2IBOA 3G8QA 4Q0BB 3UE2A 2W9BA 2YXLA 4M5NA 4LF5F 4HHUA 3TQEA 3GQCA 1ZETA 2BE2A 2AT1B 2Y1IA 2BW7A 4YQWA 4O3RA 1SC4B 2VG7A 1FDNA 2XMVA 3U1MA 1U7LA 4QWEA 1I1GA 1CQMA 3KLGA 2PA3A 3M32A 1HQUB 3GYNA 2EPIA 3PKYA 3I0RB 4F04B 3M2UB 5BR8J 2XQCA 1N54B 1N8RT 3QGGA 1EQ0A 4FYXB 2HVZA 2JNJA 2V9WA 1JIHA 4QU6A 2PO4A 2VFVA 4IDKA 4QPXA 4A8SA 4HT5A 5EX3A 1M5SA 1VFJA 2RRNA 3TEGA 1Q8IA 4NLYA 3D0IE 5B09A 4M1KA 2V8DA 3ZTSA 3OR1A 1RWWB 3T6BA 1Q53A 4ZCIA 1S1UB 3CB4A 2WB1D 3TRGA 3N01A 1H2VZ 4O0IA 3GIIA 5U47A 3EPGA 1HMVB 2H5JB 1LK5A 5B7WA 1XC9A 3CMES 2EBGA 1LWFA 2YQ1A 4B9MA 4KHPF 1VQNS 1F2GA 4MKAA 4PXCA 1WOSA 3H59A 3MFIA 1MWYA 4PXBA 3S8SA 5AE2A 1HNWJ 2MKIA 3ZTOA 4OX9F 2C2KB 5J2NB 4TY8B 4Q8EA 5C42A 3H8YA 3CJ8A 4JI5F 2ZHOA 3NRBA 2C2DA 5E3RA 2ZHBA 1WC1A 3GYGA 4NLSA 3KLVA 4A46A 5IT4A 2W8KA 1BGXT 1VBKA 3MMCA 5IV3A 2AU0A 4WPAA 4B3MF 1S1UA 2F4VF 3MPYA 1UFLA 4N8OA 4GC7A 1QDUB 1Y00A 4ED8A 1GT8A 1N32F 2Y1RI 3R5CA 1YJUA 3K59A 5F3ZA 1NZAA 2CPJA 1M1HA 3DRPA 4XPCA 3MHYA 2MZ1A 3OL8A 2CKWA 2RS2A 3SQGA 2Y1JA 3KNAA 2I5JA 1QE1B 3V4IB 1FA0A 3QRQA 3AQOA 4ED7A 4NWBA 1T9VA 4HTIA 4LF7J 2V50A 3QT6A 3GWCA 1UWBB 2V68A 2D74B 3I0SB 3R7SB 5L9XA 2KXNB 2DGUA 4DF8A 2XNRA 2GVDA 2JSXA 4UUWA 4RUAA 5KFSA 1VQ7S 3QWUA 2RU9A 4ZA1A 1U24A 5T41A 5DDPC 3HT3A 3KK2B 1U47A 2OMOA 1TK5A 1NNDA 3LP2B 5HP1A 3VZIA 3KUGA 4ZP9A 1S1XA 2R3VA 5LSRA 3EZ5A 2L9WA 2IVYA 3MMAA 2OJ3A 3DXSX 1QVFR 2CZ9A 5A6PA 1TR0A 2EK1A 4L73A 3CCWA 2VB6A 3CJ2A 3L4BC 2VBYA 2FZCB 2XZWA 1Q4RA 5IC4B 5KT4A 4LIWA 2QIFA 4NXNJ 1RK8A 1T9TA 2ZBCA 1IKVB 2DB1A 2ZBRA 2HQGA 1EETA 3MM5B 3R5GA 4P9SA 3D66A 4USHA 5HK4A 2NPFA 4B3RF 3AD9C 4U7UK 5HBMA 2AEFA 1AT1B 4PABA 2LQ5A 5KFGA 1SL1A 2JVRA 1JJ2R 1SUQB 1RU2A 3IRWP 4DV6J 1IJEB 2GIQA 2HWHA 5LM7E 3HPOA 2AGPA 4CO4A 4OJ3A 5H9FK 5KFAA 4BWMA 2BBEA 3LAMA 3G9CA 3R2CJ 4DR7F 1C0TB 3C16A 3W2VA 4F3QA 4NLOA 2KVQE 2NUUG 2OKQA 3AHPA 4ELVA 3MUVP 2QMUB 2W4CA 3QRRA 2MJUA 1FI4A 2NYHA 2VG5A 4BBYA 1XMOJ 3MDFA 2WSCC 4FYYB 4CDIA 1LV5A 4K2XA 4Q45A 2BUNA 3G2XA 3R5AA 4DLGA 2HG4A 2ZOGA 4J9PA 2XZTB 1IR1A 2RDJA 2DNGA 4B9TA 3FBBA 4P2MA 2ZKUA 3OW2R 1J2VA 5JJBA 1G1XA 1FJGF 3Q8UA 1U0HB 1YX2A 3W63A 1HL6A 2GO9A 2J0XA 5I3PA 3PW4A 2HHHF 4CNZA 4UQGA 1X0FA 2GHWA 1S1TA 3OTBA 2QL7B 4NCGA 1HQEB 4CLPA 4OX7A 1C1CA 3CJ5A 3ZFVA 2J0QD 2WVEA 1NSKL 4QWAA 1UAWA 1D09B 2Y0BB 3HCXA 4DX7A 3T1AA 2YY3A 3FKBA 3I6PA 5SZTA 4A8WA 2E29A 5CD4H 4DR5F 4RX6A 1C1BB 4DUZF 4MKVA 3R27A 2CZVC 2HGNA 2QE5A 4AFFA 7FDRA 4DN9A 3OR1B 3J7A1 5AJ3J 1T05B 3AQPA 1ZZFA 2HRTA 2XTJP 3GJSB 1V9OA 1TKZA 4NRTA 4RKUC 4PQAA 3ITHA 2BABA 3RBZA 2QL9B 2AD9A 1W2BR 4CNYA 2KHCA 2UV8G 4JI1J 4ZS6A 3KFWX 4PKDB 4RO0A 2HHTA 1IWGA 3A3NB 1ROFA 3ILLA 4GKKF 4N5SA 2HLTA 3AODA 4FNHA 4MYUA 1RAOA 1XBWA 3NWGA 1WELA 2ZZTA 4ZPAA 4WFBQ 4NMXA 3OTOF 2O3DA 4ILRA 3G71S 1DURA 1O8BA 1SV5B 1HW9A 2FPHX 4J9LA 4B9SA 2W01A 4I6WA 1U1KA 1KNZA 2OGUA 4YEAA 3FBFA 2F9DA 2H1YA 1IXKA 4RNNA 4WJBA 5LMUJ 3OD2A 3QSIA 2VICA 2BRKA 1U1OA 1SKWA 1VRQC 3V6DB 1C0UB 4C7QA 5ETQA 2IRXA 5BYSA 3F44A 2DNHA 5KFTA 1RP5A 2FJWA 1GQEA 1N5QA 2Z2ZA 3RB4A 4FYVB 2C3UA 1HNWF 3K2YA 2Y9HA 3MF5A 1P1LA 3HO1A 1EZZB 2YNIB 1HBOB 3MUTP 4QYZJ 3O1LA 1Y5NB 2B4PA 1HFEL 1ICEB 1LEOA 1UJ6A 2QO3A 3R3TA 1OY8A 5F8NA 4P74A 3QIDA 2CPYA 4LVOP 4OI2A 3IBFB 5HROB 3TANA 4OYMA 4ANDA 2BVZA 3N4WA 3UWTA 5E3CA 1AFJA 3TA1A 2EFVA 2QSFA 4C0BA 3MR5A 3Q2SC 1T7PA 1N36F 4ID5B 3QBCA 2VV5A 3QO9A 2ZE2B 5EX0A 3RU0A 3QLHB 1CJKB 3G82A 5KFVA 1HLWA 2HQDA 1RHRB 3C14B 2HMIA 4LF4J 1A6LA 4ZJQA 3QGIA 1X4HA 5DJBA 5THWA 4ED1A 1JJ4A 2QFIA 3GJQB 2XGQA 3VQSA 2V69A 1F60B 2UUAF 3CCRS 5KG2A 2B43A 3GG1A 2R2TA 3W2WA 3HFVA 2GC8A 3M8PA 2YWFA 2DISA 1OSDA 3MD1A 2P6TA 1NK5A 4K0KJ 1KTQA 2LVWA 1HNVB 1WC5A 3VR1A 1JKHA 4LF6F 1KS2A 2YPZA 2XMTA 2VUGA 3CCTA 4NI2A 4NI2B 3B82A 1S9GA 2V63A 1SIZA 5D8HB 3SFGA 5LJ3Y 1Q82T 4I6AA 5LSLA 2FJXA 2XLKA 2BYCA 3G82B 3QZ7A 1FERA 5IFMA 3HKWA 4TQSA 1YIJS 1BWVA 1KLMA 5FLXU 4K4UA 1VRTB 4RBUA 1X31C 2BQRA 1FVSA 3A3PB 3N6MA 4USVA 5LMNJ 2NLWA 4I0WA 4JI5J 3ZNJ1 2PMZD 1YZ6A 3MEDB 4RLEA 2CQCA 2AZ3A 2XO6A 4K4VA 1QUVA 1VIOA 2H5EA 1PCAA 4EGLA 4CLTA 2WOMA 2XEXA 3KLIA 4OI6A 2AGQA 2ZE2A 2I0XA 1CEZA 4MH8A 4ANEA 2CQ4A 2B8QA 5G0RB 5K8OA 5GAGI 1SQFA 1R8PA 1WC0A 1ZM2A 2FIUA 4JI2F 2X1BA 3LGHA 4MIWA 4FKYA 1RT3A 1WF1A 4J37A 2JOQA 4M5HA 4WWSA 5L39A 4OMFG 2MSTA 3TVKA 4W92B 2DO4A 3MEGA 4IYQA 3EPIA 1TV6A 2G2OA 2GFFA 1UFWA 2DK2A 4ES1A 3NBPA 5LMNF 1RQ0A 2H3EB 3VGSA 1RGVA 3EE3A 4U96A 5AE1A 4ZLPA 3G87A 4R8UA 1KVKA 4IO9Q 1KWMA 5H9FJ 2UUBJ 2HZVA 5C7PA 4P2SA 1WJ9A 2ACYA 2HFVA 2HRUA 3AD7C 1RCXB 3VAJA 3GV8B 2BKPA 4C4WA 4CRJA 2E44A 2V8VA 3MM6A 2IA0A 3GJTB 3M30B 3RB6A 4O0NA 2FZGB 3BQ1A 2DGTA 2CQPA 1ULRA 1FK9B 3LP0A 1ZYQA 1UP1A 1YBUA 4KO0A 3PDNA 4PG4A 3W1YC 3NNCA 4DPUA 3BGRA 3CIZA 2F65A 1GXUA 2M0GB 2WTFA 4B3TF 1TFYA 1JXVA 4ED3A 5A2QY 3IM9A 1CULB 4N76A 1VHFA 2D3OR 2JEFA 2NXUA 2L3MA 3SV4A 3DRYA 2RKIA 2OPQB 5J2QA 2IYGA 3S01A 1NK9A 2OTLS 2FTRA 4QYZK 1RTJB 4GRSA 4X4RA 3FSYA 4CCHA 2R7SA 4B3SJ 1R89A 3TX8A 2MYFA 4ELUA 1KP6A 1X5SA 3K7RA 1FXRA 4DX6A 3LTOA 2FLPA 4OQJA 1CC7A 4C0OC 1KFSA 2YNGA 1UA0A 4WK1A 1R0AA 3D5MA 2XI2A 1GX6A 2XMWA 3DHXA 3VALA 3I32A 1NM2A 1WDDA 4LF9J 1RADB 4EMDA 1RT7B 3U1NA 1YTYA 2DRAA 1KDNA 4B9UA 2GJ2A 3OBIA 4OJHA 3NMAA 1HHQA 4OJGA 3UCZP 2QL5B 5HJYA 2CQGA 3LF0A 5CYMA 4DU7A 1SUQA 2U1AA 2XSJB 4PYDA 3ZZYA 4ZDNA 2GW8A 2XNQA 4EK2A 1EHWA 1P8GA 2JWNA 1VBZA 2HBQB 5J2PB 1YI2S 2RQ4A 1IBLJ 2X3DA 4DS4A 3CW2C 1WHWA 1W26A 3E8OA 1KFDA 1M5KC 1MN9A 3IC1A 2ZBQA 2R7WA 2OSRA 3H90A 1M90T 2CWKA 1UWAA 2J7KA 2MLXA 2P9EA 5KFMA 4LFAF 1HW8A 4DV4F 1RAIB 1E6YB 2DGWA 4JV1A 1FXDA 4ZK7M 2IM1A 4EUVA 2VG5B 1D8ZA 3PYGA 2ZH7A 1L3UA 4WP8A 2V5HG 1TL4A 2VD3A 1IR2A 2ZH3A 4ZVQB 4DR2J 5FLXY 3W62A 2O5DA 1CULA 1ZM9A 2UUTA 2HBYB 1TL7B 2EI5A 4ZHRB 1U09A 2GJIA 1KOOA 2NXNA 4G1QB 5KFNA 5DM6Q 2PMHA 3RBEA 2IJNA 3HT0A 2C42A 5HLFA 1ZOTA 4DPYA 3E51A 4TXSA 1RTDB 4F8RA 3K0JA 4AXIA 1OSCA 3FJ2A 4TU7A 1FD8A 3RW6A 1D9DA 3C14A 2HMIB 1UPMB 2B56A 4WYLA 2M70A 3HI9A 4HKQA 2OEMA 1EP4A 2VPZB 3DLGA 3FBCA 1UVIA 4HTJA 4CT9A 4J9OA 3IS9A 1MWZA 3MD3A 3G86A 2J0WA 1WG4A 3QYYA 1XR6A 3M8WA 3HP6A 3TQ1A 3PRVA 2VONA 4M63A 3J7AN 1CS4B 4F0MA 3CJ0A 1RT2A 1RAJA 3M8RA 4ECTA 3KHHA 1VJWA 5KFXA 3WX4A 4DV0J 2DCUB 4F36A 1JJCB 1REGX 2ZH4A 3H2LA 4KRWA 4A8OA 1CJUA 4B3MJ 4G1QA 3CTRA 4X66J 3Q8RB 2F4VJ 2KFYA 3V5RA 1LW0B 4DL3A 4O23A 4E8UA 1KC8T 2BEFA 1Q95G 2CJKA 1U2CA 2ZH2A 4ILMA 4MMOA 5C24A 3M4XA 3O5TB 3DC2A 4DU8A 1BMQB 3RUBL 1D8YA 5ADZA 1MW7A 4U7CA 3SIPB 2QJ3A 3MPDA 2CNLB 3N5BA 1JMTA 3IBCB 2MGZB 3KHLA 1SJ3P 3OXFA 4JI8F 3SQOP 5ETRA 2RQMA 3MEDA 4ZMMA 4IUFA 1NKEA 5DQHA 1IVZA 2J9CA 4XDDA 4OHXA 1U48A 2IYIA 2FGOA 4K4ZA 3IA0A 3DI6B 5F3TA 2Y8WA 2HK2A 3CCZA 4KJIA 1FX2A 3M6WA 2MLYA 2W25A 1LW2A 3NCQA 5DQGA 1AUDA 2VF3A 1PGZA 1QUPA 2BE9B 4RW4B 1M0SA 4LUBA 1JB0C 3M8ZA 4OL8A 3C6UB 3C6UA 3OXLA 4ZCMA 1GTEA 4IH6A 4DV7J 1NK7A 3P45B 1UETA 5L9NA 5EDWA 1Y11A 4NE9C 4ZVGA 1VBYA 4QIGA 5C42B 2Q1LA 5A8WB 4NMLA 2RMLA 4DJBA 3ILOA 2HHPA 2XY5A 5LL6d 3BDPA 4NL5A 2OAUA 1SH3A 4EU0A 2VA3A 1FKOA 4ZVEA 1U1QA 4J9UE 3TOQA 2AV5A 2ALZA 4Y2IA 4LF6J 2APOA 2XMAA 2DBBA 1TMMA 5EWEA 5E3QA 4ECVA 3ET6B 1JNRB 2DT9A 3IR7B 3MM6B 5I42A 3P96A 2R8JA 1DTQA 1O51A 2YKNA 5BYQA 4WFNQ 3KK2A 1YSJA 3PX6A 2ZJQQ 4A47A 1I94F 1UVMA 1U0HA 1NH7A 2YWKA 1Z4UA 1U2RA 2RD5C 1OY6A 3AY0A 3NAHA 1IUJA 3K5PA 3NCPA 3UDCA 5GADU 2JVOA 1R8CA 3OFGA 1IBKJ 4YDDB 3KLFA 1A9NB 4F25A 2WAQD 3N9UC 4DR1J 1X8DA 4FVCA 1H98A 2BJ3A 2AEJA 2R2SA 3KJVB 3VAMA 4B3RJ 5C2GA 2XLIA 5EN1A 4HI1A 2VFUA 3RAXA 5D78A 4CLFA 3KMQA 2DR7A 2FHJA 2HHXA 1D9AA 2GIRA 3JSBA 3SCLE 5BYRA 4CO5A 3O2IA 1NKBA 2DNMA 4YFUA 3GR1A 4BDPA 1F3VA 3LA0A 1F1BB 3I4PA 3VGTA 1MSWD 3PW5A 3WIUA 5CAAA 2XYPB 1S57A 4J9VA 1RTIB 3PM9A 4U67Q 4EBCA 2NQPA 1LWEB 2CQ2A 1E6VB 3TA0A 4EZ6A 2V2ZA 4FP9A 5KT5A 4OZ3A 2V2KA 1QD1A 1QSLA 3MR6A 4RPFA 1QTMA 2R7OA 1SV5A 1LNQA 1UWBA 2C3PA 3MM8A 4Y65A 3IN5A 3BYRA 4DQPA 3LQVA 1N52B 1MU2B 3CCSS 2H9ZA 2QGFB 2AZ1A 2EKYA 2FY8A 2K3IA 2E1PA 1MMNA 1Q1KA 1TAQA 2CJAA 2OPRB 2IVFB 2DCLA 2GVZA 3MPWA 5JXSA 2NPIA 5EWGA 1B3TA 3QRPA 2N4DA 3CC2S 2HYIB 5LOQA 3BGFA 2B5JA 4RJVA 3O3LA 2WBRA 3DRSB 4Q8FA 2WRMA 5GMKa 1FNMA 1SBRA 2AIRB 3BQ0A 4GKKJ 1E6YA 4GMKA 3W9HA 3CDBA 3M05A 4B17A 1PJ7A 1X4EA 2MY8A 1RLDA 2B6AA 2ZNZA 4JYAJ 4O44A 3FNNA 4ES3A 4ZITA 2QG9B 2X1GA 4C3MA 2LEAA 1HWUA 3AB2B 2G0JA 2KFZA 4P72A 1NMEB 1JLGA 1RTHA 2GCFA 2Z56B 4CYUB 1H2TZ 2G13A 3GFXA 4DDFA 3FSIA 4DX8H 2AYMA 3AJ2A 1NSQA 3ZZUA 4LF5J 1TL1B 5J2QB 2OPPB 5L1JA 3EVOA 1WHVA 3GIMA 2HNZB 3A8EA 2R2UA 1T05A 4FF1A 4OI3A 2OH2A 1NZ8A 2J8AA 1EJ7L 1AROP 3TJ8A 4ECUA 1GXTA 4IG3B 2XSFA 1KLNA 2ASJA 3MI7X 1AA1B 3HXMA 4BC9A 1WSVA 1XTZA 2HHHJ 2OI2A 3T41A 3C8YA 3G6VA 4X2BA 2QZ8A 1K0TA 2WVBA 1JXLA 4OHVA 1UL3A 4R0EA 1HHSA 1XQIA 1OYDA 1M5HA 4UOCA 3VAFA 2G9OA 4NXMJ 5L38A 2ZZMA 2M4MA 5K9FA 3BGLA 1SJ1A 3I96A 2DHXA 2DKOB 4M5GA 5KFBA 4X64F 1R43A 1T9YA 1WOPA 2E1RA 2RKIB 2DH7A 2DGXA 3EXYA 3IO1A 3DLLQ 1SC6A 5B0BA 4OYZA 4DFPA 4LFBF 4IR9A 2JLFA 4Y28C 2KHDA 1GMUA 1ZAXA 3PJ9A 1WKKA 2BZ2A 2ZWPA 1TKDA 1GMWA 4MK8A 2KJVA 3GFHA 3HX9A 4ZN1A 3PW2A 4F0KA 3JSMB 3MTJA 1U0SA 3KK1B 4DQSA 2OIHA 2HW3A 2XMJA 3HHLC 2JX2A 4I69A 5LJ5Y 2YPYA 1MNEA 3V6JA 2NZ4A 1KOHA 4FS1A 2LYVA 1U1LA 5J1EA 3QZ8A 1QSYA 5KT6A 1N33F 2HFSA 4YP3A 1NK8A 2DNOA 5IC6B 5L1KA 5C25B 2V8HA 5L1LA 3HHLD 4C48A 3ADAC 3E01A 2P9CA 2ZNYA 4PWDA 4CM2A 4NLXA 4TN2A 4TYBA 4ZPVR 1HNXF 4OV6A 3EJMA 2QFJA 2GHVC 3CJ3A 3MCMA 4Q5VA 4U8YA 3JXOA 1UEUA 4BHQA 4A4JA 1N5SA 3EGZA 1K1QA 2DJWA 3PXGa 1B0VA 4L72B 3W61A 4KTQA 2FQQB 3RR8A 5DLGA 3CE8A 4I7FB 2O66A 1NHKL 2GIFA 3J7YU 4YN3B 1UFKA 4PQUA 1RCOB 4EO6A 4TLRA 3RG6A 3SDEA 3KK3A 3SCKE 1YDLA 2LQJA 3L09A 2GAGC 3HJFA 4FVMA 4CLUA 4FF4A 3SSRA 2Y0SD 4J5OA 5K8NA 3DLGB 4DR3J 4C11A 1PSDA 2I38A 3RAQA 3TWZA 4P7VA 4TKTA 5ETOA 4Y0FA 1CJVA 3H98A 3Q23A 1ELOA 3PZPA 1DLOB 4LF4F 1IN0A 4IOCQ 2ATCB 2M52A 3C66A 4XO0A 1TL3A 4RU2A 3HVTA 4MIAA 1S77D 4IFVA 3K5OA 1VHIA 3OPKA 2EFGA 1KTVA 1RWXB 4P71A 5IOLA 3MFHA 5D15A 3Q0AA 5AXKA 1VQLS 2BJ1A 2QYGA 1X4BA 3FCVA 2EWHA 1S4EA 1J27A 4P7TA 2VJUA 2F63A 2DGQA 3QWPA 3CULA 4WFZA 3AXMA 2J5AA 3FMBA 4K50A 2B9WA 3EVWA 3QPIA 2DEIA 3QT7A 1S0OA 1Y7PA 1U6BA 3B8HA 1JLCA 3ET6A 4MIBA 4KGKA 4OZ5A 4JI2J 2XHCA 4QWCA 2NXCA 1URNA 1XNRJ 2AWZA 2QA2A 4NPOA 1FO1A 1DLOA 4ZP6A 2YNIA 1ZTTA 1FD2A 2DHAA 1TVRA 1X7VA 5GAHI 3C46A 2C2MB 4KAIA 3I82A 3PY8A 3IWXA 3TVZA 1J5EJ 4IQMA 3RYLA 4OYBA 3PR4A 4RU9A 2B6AB 4W90B 1FWKA 3T1YF 1RA7A 3BO2A 2LEPA 1UCNA 2QA1A 4R8UB 4K4WA 4URQU 1NDLA 4J9MA 1RISA 1WG1A 2F9JA 2C28A 1MROA 4RW4A 4ICLA 4ZPTR 1RSCA 1S1VB 5HBMB 1IKWA 2HFOA 4PPDA 2PT0A 2BANA 4ZP8A 2AP6A 4IOAQ 2QRRA 3BS9A 1WEYA 4E98A 2F1FA 4CZCA 4A8XA 4DZDA 2M2BA 5CZXA 3D28A 2MZRA 4JI3F 3K8VA 1HPZB 2MHEA 2JC1A 2WSFC 1FVQA 4NX9A 4KT0C 2BOPA 2O1PA 5D6GA 1Q86T 3FFIB 3GILA 1KBRA 1WHXA 3NBPB 2R8IA 2B4UA 2WOMB 3HD1A 4XIUA 1F5CA 4CLWA 1S9EA 1DZ5A 1F0XA 4BLGA 3MMBA 2E9ZA 3CC7S 4TQRA 2V0NA 2POKA 1JWWA 1BQMB 4U9RA 4U95A 4K4SA 2AX1A 2FDNA 3HD2A 4KFBB 2ZDOA 3DRRB 4WXOA 3U7JA 4QBUA 4H54A 3C6TB 5G0RA 3PYFA 1Y5IB 4H4OA 1BQNA 4O3PA 3H40A 1RWVB 3R7NB 4DPWA 1N34F 4AL5A 2HVIA 2R7XA 2ZJRQ 1VQYA 3AD8C 3MWBA 1VISA 4HI2A 1GTHA 3V6HA 1I5OB 3GSDA 3MEGB 1Q78A 3FEYB 3B78A 1NB2A 1PO6A 3KLFB 3KJQB 2EKNA 4YUDA 1R3NA 5D0GA 2NUHA 3KOAA 2Z4PA 4A8QA 2ZD1B 2EVZA 2DNRA 2E5LJ 3CDEA 2MZJA 4N7TA 1KEKA 3BEGB 4ER8A 1NJWA 2V4JB 1N5VA 1XJWB 5AJ3F 1VC0A 5CD4A 2MMYA 1S0NA 4IH7A 5F8LA 2OEKA 2OHDA 3CJKA 2KYXA 3FVYA 2L08A 3D68A 1YITS 3BDEA 3LALA 4C0HA 4OX9J 4L74A 1FJEB 3PR5B 1CJKA 1X4GA 2XGPA 1S6PA 4C8ZA 3H4DA 4QW9A 3BGRB 3DLHA 2XMMA 4HH0A 3MECA 8ATCB 1K1SA 3M2RA 2V34A 5HQMA 2ZH8A 4JYAF 3HM9A 4KHRA 5J1NA 2F4FA 1HARA 3AJDA 2W9CB 3RTVA 3L3CA 2Q66A 3JAMU 3IWLA 1JQGA 3AFGA 3DMJB 1N5YA 1IKXB 3W8GA 3N28A 5I4MA 4A8KA 1RT5B 1T8EA 3Q8YA 1G7CB 2JFDA 1K0VA 1DJ0A 3HFZB 3BN4A 1NHVA 1OY9A 2VC1A 3FZBA 4F4XA 2PA8D 3NS5A 2AYGA 2WW4A 1SC3B 2VC0A 1ZAVA 5F8IA 1TAUA 2H4YB 1L3KA 2EG1A 2ILYA 3DGPB 3FMWA 4DSJA 4MJKA 3W5ZA 2F8MA 1KVJA 1RI7A 3ETOA 2MZTA 3FK4A 2XYGB 2KM8B 2UUAJ 4KKOA 2KT2A 5FD1A 7AT1B 3MECB 2UUCJ 1RT4A 4LRCA 5E33A 9RUBA 3IMQJ 4NEZA 4YHHF 2JFKA 2OUGA 4M5IA 2DPJA 1HBUA 3A8IA 5LT5A 1YJ9S 3LGMA 1VQ6S 4OYIA 4ZPWR 1JLFB 4OI0A 2DIVA 2RUSA 4Y00A 2UVWA 3D9BA 1F3FA 2OMLA 3BH7B 4NLDA 1KQSR 2D9PA 4LVNP 2HWTA 4TU9A 5EHHA 4RNOA 1VQSA 5DG7A 4M5LA 1HNXJ 3MR7A 4EI2A 5F8GA 3QLHA 3BSOA 5KG1A 4PG7A 4I64A 3TR5A 4X4OA 3JAMY 3D0GE 3P5TL 4CP5A 4NXNF 3T5HA 4C8OA 4ZVTB 5ETTA 1WC6A 4URSA 2VASA 1X0PA 3AA8A 2CUYA 2OSQA 4I4BA 1WOOA 2QA4G 4V19J 2FGCA 3VGUA 1CJTB 3H5XA 3PVXA 3NY0A 1FF2A 1DAXA 1C1BA 1AFIA 2XCPA 4DV0F 1PC4A 4R25A 5D0HA 2XC9A 2CPXA 1FDBA 1FKPA 4DLEA 4URGA 1S10A 2ABYA 5KG5A 2D3O1 2M8DB 4ILLA 5KT2A 1RTDA 2YX7A 5L8RC 2C2OB 1V3RA 2A6MA 1YZ7A 1TU0B 2B7BB 4LSNB 2Z2LA 1D3WA 4ATNA 2RRBA 3G8SA 1NU4A 2ZVIA 3HSJA 4G1IA 2VFSA 4NA3A 3FUYA 4DV5J 4C8YA 2LA6A 4DSKA 4WP3A 4K8RA 4B02A 4Z2XA 2H51B 2OFGX 4KGZB 3RB0A 2V2QA 4LFCJ 4PPZA 1FTRA 4M5DB 2LLZA 2CVIA 4HVZA 2MXYA 3SI8A 3KTQA 3GG0A 5KFWA 1Y9OA 2P5VA 4DSEA 3BQ2A 2WVFA 3JSRA 1RJJA 1UVKA 3PYDA 3PX0A 2UUBF 3UN5A 2LXFA 4CH7A 4PEOA 2HHSA 4TVAB 2DH8A 1JLAA 3E3XA 1DY3A 1PYOB 2W2MP 4HACB 3QT5A 4DXLA 1S9GB 3FGVA 1NDKA 5J2NA 1N88A 1N0UA 4LJMA 4I1TA 2B5JB 2MKJA 2YX4A 3I56S 3VF0B 2DHHA 1KONA 5HN0A 2RU3A 5JUMA 5A2QU 4LBIA 1DFDA 4FBUA 1XMBA 2HRYA 1V3SA 2YQ0A 2RSQA 4F4ZA 3DI6A 3VHQA 2K06A 2RB7A 3OT9A 3BKTA 2I1RA 2E5GA 4Y6IA 2R7QA 1FFSB 5SUHA 3VTIA 4EYHB 3GONA 4CLZA 2IBKA 2HS0A 1S97A 2IM2A 1VS3A 4TY9A 2PI5A 3X1LB 3CJQA 2UVUA 1ZS6A 2WVDA 4XTTA 3CCLS 2YWWA 2WHOA 3SZ2A 2DXDA 4ZIWA 2YWHA 3DRXA 2HIQA 4HACA 4QR2A 1IBMF 3LPYA 3KJFB 4ECQA 5IT0A 1HD0A 5MAOA 1LXJA 3BSCA 3TUJC 2ZOMA 2DR8A 2D7SA 2Y3YA 2FVRA 3VAGA 5H9EJ 2YKPA 1WHYA 4TY8A 2K3KA 3CT9A 1O0PA 2JLGA 4DR2F 2LECA 3L7OA 4FBTA 4KO0B 3DOKB 1Q79A 2UU9J 3OUYB 4AE5A 2K8GA 2VDIA 4GO7X 3T6JA 2XWXA 2Z58B 2LQ8A 4HH1A 4K4YA 2ASLA 2U2FA 3NGKA 3A12A 4LF8J 4RWXA 1RT6A 2YKOA 1RT6B 1ZPWX 2V8GA 2CQDA 1JK9B 2IPOB 2A6OA 2KN4A 5GADI 1HBNB 4IOBA 3V6KA 3DRRA 1N6QA 2KT5A 4CO1A 4ZVRB 3MEKA 4WKYA 2VBWA 4HT7A 1Q7YT 2JDJA 4PG5A 4LT6A 3GCXP 3EYZA 3HHNB 1Q8KA 1TVRB 3N6LA 5E41A 2VBXA 4RW6B 2ZUAA 2ZC3A 5J1PA 1F9HA 1PYSB 3GFZA 4XPEA 1S59A 2CJXB 1VQPS 3QJPA 1YG0A 1QJHA 2EXUA 2W1BA 4F26A 2J7UA 2A10A 1QAJA 1U1RA 5IQQA 2HNYB 4E0DA 2RQCA 4L6V3 4MT1A 1RDRA 2E1AA 2CQ1A 3FQLA 3KLEA 3QIPA 2E1CA 2I8EA 4DSLA 2OO4A 4CH0S 2K1RB 3ISNC 2Y1LB 3TAPA 3THVA 4PWWA 2IC3A 3DYAA 4V1Ak 2CPHA 4JI1F 2XY7A 2HQFA 1NEEA 1PAEX 1T95A 2CYYA 3CJRA 4FKXA 4C3LA 2ROEA 2B8PA 4C8KA 2GX8A 2D41A 2YTCA 4DF4A 3R1HA 5HP1B 4UOGA 3D54A 1OJ4A 1RYRA 3QT8A 4PUOA 1WORA 2VG6B 1FFWB 3PTWA 5D0EA 3FZ2A 4D3HA 5DDOC 2J9DE 3IR6B 1LWCA 3M9NB 4F0HA 4R5PA 3DLKA 3OL7A 5F8JA 1SXLA 3DLBA 4HHJA 4I67A 2HFUA 1F9EB 2B0GA 3JB9k 3CDWA 2RDIA 1ZAWA 1RHMB 2GA7A 1TKXB 3KG4A 3K17A 4IH5A 2CQ0A 3GV5B 2DHSA 1VQ9S 1IKXA 3CSKA 1RZMA 2LFVA 3D6HB 1W25A 5HQLA 4OLPA 1KKHA 1S48A 2OELA 3OQ2A 3R5BA 1TKZB 4MK9A 1D0EA 1EAYC 3UN2A 3LW5C 4WXWA 4KYZA 2CDRB 2HFNA 2OTJS 4RW9B 3M32B 2FD2A 2W4PA 4ZVPB 4F2RA 4YB6A 2B7CB 2J0SD 1S6PB 3TJ9A 1M5PC 1U1MA 1HNIA 3VVUA 3DLKB 3KG0A 4IFVB 1YRTA 2FUG9 4IDKB 4LF7F 1RTHB 1B70B 1YLXA 1FRLA 2MQQA 1B7YB 5CQGA 3V81A 2DVIA 1SKUB 1NJYA 1L3VA 1NJXA 4DWIA 2EW9A 4FDFA 4IG3A 4N77A 3PACA 4USUA 5CCLA 1I94J 2DNNA 1Y3KA 1T9XA 3TZWA 4ID5A 4I2QB 4YDXA 5F8MA 2CPDA 4GVLA 4LFBJ 1QAYA 4LBHA 2DIUA 1PBAA 5KOWA 2M88A 4P6QA 4KE5A 1WEZA 3GIRA 4X4SA 3M6VA 3GLJA 2EFPA 3T9ZA 5KFDA 2ZITA 5KG7A 3WC2A 1X9WA 4KSEB 3O6QA 4O44B 2CIMA 3D7SB 3KMSA 3P6YC 1W7WA 2DGVA 1DQ8A 2CVEA 4DL5A 1CS4A 1T03A 2GS8A 2ADCA 2ZHAA 1B0TA 4OLOA 4DV3J 3OJUA 1FDDA 2A18A 2BE7D 3MTKA 1F5BA 3VCDA 1NO8A 3KK3B 3KDOA 5J2MB 2C3OA 4F4WA 2MZSA 3EDQB 1NDPA 4J9SA 4RW8A 5GVQA 5KFRA 2D1CA 4DQIA 2KZZA 1H7WA 1FNXH 4DPOA 1Y10A 3W60A 3RBXA 1HBOA 2FHOB 2YNHB 3QAUA 2J9EA 3DDKA 2N82B 3HVRA 4EBDA 1XNRF 4J9RA 3GIKA 4J90A 4HDGA 2C1EB 4UUXA 3R7BB 4WK3A 1U02A 1RKIA 1HNIB 5EUHA 5CXTA 3T1HJ 1JLEA 3M6XA 1MG7A 5KG6A 1JNZB 5ETNA 1UZHA 2AJ0A 1GMWD 5LXYA 2RJZA 1E6VA 2WONB 2AJ2A 2XBPA 3BBFA 3I9ZA 4G6VB 1AZSA 5ETMA 3FCHA 3Q86A 4JI8J 4Q0BA 1B7FA 4KGMA 5C25A 5HVHA 1HR0F 2B9EA 1ZZNA 4DR4J 2FB0A 3HULA 2LXUA 1P9QC 1HIYA 2KU7A 2RF2A 3VVTA 3EXCX 3NOGA 1U49A 3W5YA 1KHWA 2LDYA 2MTLA 2RHQB 2CRLA 3DKDA 3HJVA 3OFEA 4ZJOA 3IG1A 5B08A 3I55S 2F40A 3C15A 1OPZA 3H7HB 4DFMA 3H4BA 2ZM6J 4EO8A 3G4SS 4Q7AA 2ZH1A 1UEKA 5E0OA 3KUEA 1SH2A 2J6TA 2BKNA 3M1VA 1J5EF 2VJVA 2CG4A 1BQXA 1B64A 1PILA 2MQMA 3PCOB 4DI6A 1YRUA 2AW0A 2XG8A 1VRUA 3CGIA 2HFZA 1HNVA 2LXIA 2IRYA 4GVBA 3J80Y 1SJ4P 5E7OB 4UZBA 1AZSB 5AT1B 3HSGA 4LF8F 4O4RA 1TKTA 1UW9A 3ILJA 1GXLA 5B0GA 4ZVUB 5H1SV 4CQ1A 3QJLA 1LXNA 3EZUA 3TARA 2GQCA 1HA1A 2CXEA 2P6SA 2QN6B 4X4UA 1WC3A 1K9MT 1FKAF 3CJKB 4UW2A 1JX4A 1VYAA 1KRPA 4Q43A 4DQQA 3H0PA 2FY1A 3TUIC 2O67A 2A2CA 2ACMA 5KFHA 2XMUA 2VQEJ 1RAHB 3ENVA 4NXMF 2R7VA 3D1OA 1YHQS 4FYDA 5FIIA 1DARA 2YX1A 1S6OA 4ZP7A 5DLFA 5D77A 3UR0A 4EFAC 9ATCB 3ONQA 3PIOQ 1U8SA 3BH6B 1CC8A 3A8KA 3UD4P 3OR2A 2VOOA 2FJVA 4IO1A 1WI6A 3PRBA 4LF1A 4RBVA 4CO3A 6AT1B 1U8WA 2OPRA 1I3OB 2N4CA 3JS9A 2UXDF 3R97A 1LKZA 3VV2B 1BQNB 1CJVB 1OYEA 4LRBA 1WTBA 1UA1A 1DQAA 4HHHA 1QVGR 4WE1A 5BXIA 3UN3A 2YNGB 2CADA 3ZZZA 4KR0B 2GQQA 4XK8C 4RR5A 3FDSA 3GFYA 4JUZA 2QLJB 1GNKA 5K14B 5KG3A 5D0RA 4YR3A 4TNOA 3BO3A 2HIYA 5A8RB 3FFIA 3DN9A 4ECYA 2W8LA 3TAQA 3TI0A 4ZVFA 5IXUA 2VQFF 1UVJA 4CI0B 2UVRA 3WX8A 3UCUP 3UW1A 3ZC4A 3ZXWA 1WF0A 1REVB 3A8JA 1SJFA 3I9V9 3JTOA 3PEJA 5M2PA 2ZJPQ 2Q3PA 3OJSA 1SPBP 2UUWA 3WC0A 4NLTA 3NS6A 3BGUA 2YKMB 2UXCF 4H4KA 1FK9A 1YVFA 3LP0B 4UOHA 2MLZA 2VPWB 4Y3CA 4OYOA 1VK3A 3DCAA 3MMAB 3U27A 1LWEA 4KV8A 3MXHP 4USTA 4RW6A 4CLSA 4RBTA 3H5YA 2MKSA 5DM7Q 4OIXA 4V19X 2BRLA 3BGOP 3FRYA 2AEMA 2HVEA 3F41A 5T7LB 3CD7A 1NJIT 1M5OC 1RT1A 4J91A 2HWIA 4BWJA 7FD1A 5DDRC 2Z2MA 3RR7A 4QCLA 1HKAA 4DL0C 2YNFB 3BSAA 4CTAA 1FT8A 2YH0A 1F9FA 1OO0B 3T9NA 3MAAA 1I6JA 4ETZA 3SFUA 4LSLB 1KD1T 2DTJA 5ETSA 5HMYA 2BACA 4OZ2A 3AA9A 1HQEA 2IAJB 4UOFA 3CIMA 1Q5YA 2VKRA 2KM8C 4USMA 5B0EA 3CF5Q 1JLQA 1PJ5A 1UKUA 5MLCV 4YOEA 5F9LA 2VPYB 1EQMA 4G3IA 3KLIB 3QIPB 3CJSA 3HHLB 4JV2A 3CVKA 3U02A 3UFCX 4UY85 1TTHB 3W8PA 2DO0A 3W9JA 3BO4A 3DOMB 1CBKA 3DU6A 2OPPA 1RBOB 2M3DA 3HDSA 2RIJA 5CHCB 3MAAB 2ERRA 3FSXA 3D1HA 1FCAA 1XN9A 2BM1A 2F8EX 4KHPJ 5B0FA 5CYQB 1X4CA 4RNHA 2FLNA 1S6QA 3IG1B 1P6TA 2VG6A 1TQLA 4MYTA 3OTCA 1FWPA 1EP4B 4MFBA 3RAMA 4UZCA 2VA2A 2RT3A 2OPQA 1N4LA 3R2DJ 1H2UX 1OS5A 3AH6A 1TKXA 5HLFB 1I51B 5EWFA 5HI7A 2AYEA 3N6NA 1AW0A 2PI4A 4NLUA 1UJ5A 3KLGB 4DPXA 4G1PA 2OFHX 3BPDA 2B4VA 1J5OA 2BW2A 2CPEA 2FZKB 5DO2A 4RUHA 2QV6A 4ZPCA 3DM2A 5AE3A 1GX5A 2CQ3A 3B4MA 4DR6F 4WBFA 2LCWA 3AAWB 1XR5A 2CJYB 2N7YA 5IWAF 4X4NA 3JSMA 2NS1B 2WVCA 3BB5A 2W7OA 4ZVOB 2FJDB 4IKAA 4A8MP 3HLUA 3F56A 4A8FA 1G2EA 3BJYA 4B3TJ 1G3OA 1RWOB 2DGOA 1WDTA 3QGHA 2YWGA 4DOZA 4EYIB 1VLOA 1C2PA 4F3MA 3R5JB 4U6PA 1BXNA 2HGMA 2HPUA 2RAQA 1T9WA 4LREA 4YR2A 1JLFA 2LA4A 4ED2A 2EK6A 4CIOA 1Y5LB 5IT9U 1T9UA 5A0YA 1S0VA 1K47A 3UDLA 4JV5J 4FXDA 2HS3A 1RT5A 1YGYA 4R0JA 3NGRA 2FHMA 4P2XA 4CH1A 1LQ9A 2XS5A 1JLCB 2ZM6F 3OTEA 3TP2A 4DFKA 1PAUB 4H4OB 3DHWC 2GO8A 3DGPA 4JV0A 4OFZA 2JC0A 3ZTRA 3EVMA 2V6AA 3DRPB 3C3LA 3IS9B 1BWEA 2HKEA 1VRTA 5E2QA 3KHGA 4QWBA 2AQ4A 4DR1F 1X5TA 3CMAS 4DG1B 3ZZRA 1AB8A 3OHAA 3W5XA 2GQ2A 1FESA 3B6BA 4GVBB 2IJRA 1RWKB 4EWTA 1BY9A 2Q6CA 1LFPA 4AXJA 5AXNA 4DSFA 3LUYA 3KLHA 3MOJB 1FKOB 4M8LA 2YKAA 4OX8A 4PZVA 3QAEA 3M7VA 3I31A 3DDNA 1DRZA 5A8KB 3IFEA 1DTTB 4WYWA 4YMEA 1KLMB 2R2RA 1JLBA 5D4LA 1U2FA 3ISZA 5I42B 3C15B 4JI3J 2MPUA 3HHKA 3T5JA 5F0UA 2RE1A 3NAIA 4UQTA 1HWIA 3WZ0A 3R8YA 2KL8A 1T02A 2PMWA 1GAOA 2CJ9A 3MM7B 3J81j 4QIVA 1NK4A 2DRBA 1SIWB 3N0VA 2DHGA 2PGCA 3R9LA 1NKCA 3NP5A 1LOUA 3J81Y 4JI0J 1K73T 2WK4A 3L95X 3MM9B 3M8PB 2KJWA 4KPCA 5ETLA 1VLYA 2E1MC 3QO9B 3POTA 2XYHB 4F02A 2BQUA 1X9SA 2R7TA 2YNFA 4CTAB 1X4FA 5LXRA 3IAM9 3JSYA 4AQYF 1HYSB 3HMJG 3P8BB 4H4MA 3MR2A 4J9QA 5D4OA 3NL0A 1A0OB 1AUSL 1TV6B 1TZ0A 1V5VA 1H6KX 2QLWA 1Z2ZA 1SQGA 3WBZA 3J7ZT 4KV8B 4O3NA 2X7IA 2MQNA 2XY6A 2C22A 1KHVA 5D3GA 1HBMA 3K8WA 4WZMA 2V8PA 3BREA 3IP0A 4YHHJ 1IM6A 2CQIA 4X4PA 4EZ9A 2XS2A 1JLQB 4K2JA 1RHUB 3HK2A 1KVIA 3ZZPA 3P4UB 2CNKB 2P9GA 1T3NA 1S9EB 2G2YA 2BANB 2RH3A 2ALYB 3BR9A 4BS2A 4I56A 1IKWB 4PRFA 1FRIA 2K7JA 2EEYA 3D67A 3JQKA 4LSLA 3Q2TC 2E7XA 3RJMB 3MR3A 1H74A 2I5JB 2UXBJ 1RAAB 3ITHB 3D3CJ 1HWLA 4LR9A 4LFAJ 3ZTPA 4LRAA 4AYBD 5KG0A 1HWKA 2XHWA 2IIHA 4QWDA 2XLJA 3DGVA 3EM1A 3QQCD 4K7QA 1S6QB 2DR6A 4OYPA 3TX0A 4NLGA 4QU7A 2J8SA 1BC6A 3SBMA 2W7PA 3O44A 5GAGU 4YB5A 3CXCR 1R8BA 3DFEA 2B3TB 4RNFA 4JB8B 4RNMA 1UJ4A 3T5KA 2DH9A 1R6YA 2UZAA 3C6TA 2FHJD 2GMLA 2KB2A 1XIQA 3ENWA 3HSZA 3DNCA 4KFBA 5DZ7A 2BOAA 5HATA 4ZHRA 5G4DA 4DL7A 1XNQJ 3CD5A 4C98A 4ZVHA 5B0DA 5CYJA 2PE8A 5JVHQ 1R8AA 2HURA 3D2WA 1M1GA 2R42A 2WBMA 1XR7A 3FEZA 1XK8A 3PRDA 3V6DA 1KQKA 4DL2A 4DFJA 1HNZF 4NZ7A 2ZZNA 4QIFA 3PJXA 4NEYA 4ETXA 3OSNA 2BJ9A 1H38A 4F50A 2NSBA 3M2VA 5A8RA 4ED4A 1S0MA 4WZQA 1TUGB 4ED0A 5KFKA 3DOKA 4Q2LA 4ZLJA 2NXEA 4M5KA 2PDAA 3GJRB 2V4JA 5KAKA 4WTYA 4DV1J 2JEJA 1YKWA 3ZZTA 2GVDB 4MKYA 1IKYA 3NS7B 3N79A 1YBTA 4J7CA 5J2PA 3W3SA 4DL4A 3EMTA 3CPWR 1RAGB 1FRJA 2IM0A 5CCMA 1WTFA 1QY7A 2HNDA 2Y8YA 2DITA 1XNQF 1H73A 3DOLA 2KKHA 2JH3A 2LP4A 2ROGA 5B0AA 3UNYA 5HMWA 4OJ1A 4DUYF 1P1TA 1HNZJ 2CDQA 2EFOA 4W4MA 4QW8A 1XWLA 2G1HA 3THTA 1C4CA 5IWAJ 3OL6A 1YK9A 2KVIA 4ITSA 5L1IA 3W66A 2BJEA 2RVJA 3K5MA 4R5PB 2DNPA 3R1LA 4DSIA 3V4MA 1ZA2B 1T11A 1EETB 2LU1A 3QFHA 2HVDA 1S4FA 2AJFE 1P9YA 3AB4B 4AD6A 1RT1B 3TNVA 3UNGC 3BZQA 3ELHA 1CVJA 2MGZA 3D6MB 1ZM4A 3GV7B 4UF4A 4F4YA 4DG1A 1TELA 2KFNA 2VDHA 3TZZA 3D6FB 5HMZA 4O4GB 4WFYA 1EB0A 3NG8A 3MEEB 2IC3B 3DYAB 4GKJF 2XCAA 1ZBTA 2ZWOA 2F5GA 2PD1A 1R0AB 4USJC 3I0RA 1J5OB 4YS2A 2XS7A 5A8KA 2V4RA 2IJFA 3PEHA 1U6ZA 5KFIA 4WTOB 2I2YA 1YJ7A 1GH8A 2B9XA 1TL3B 1DHMA 2JRSA 4WCEQ 2Z8QA 3CUNA 4P10A 4C9DA 3H20A 2DY9A 2G0CA 2C3YA 3MMJA 4XAKA 2H54B 4OZJA 4DEZA 1L3SA 3A3OB 1TMJA 1HD1A 2Z0GA 1Z1ZA 3QNWB 2A1BA 1URRA 1VQOS 3JTPA 4PWDB 4A48A 4KY3A 3OLBA 1FTCA 4KC5A 5KFCA 1U4BA 2CWXA 2QEXS 1VI7A 1RWNB 4L3NA 3UCGA 5KFPA 4NA1A 4IG0B 5GMEA 4DR6J 3DM2B 2MHNA 1M5VC 3LP2A 4LF9F 3M2UA 1VOMA 2DNQA 3BBCA 2BMBA 3B54A 3MM5A 4DCJB 3LWMA 2KZMA 1WD6A 3SV3A 3MURP 1TL7A 2GZOA 4C3KA 4ZIVA 1SKRA 3CCES 1IBKF 1XERA 2HHQA 2Z57B 4N8NA 4NLQA 2I6WA 4TLQA 1HBUB 3P5BP 3QMQA 1VQ4S 1FNOA 4NZ6A 2E5JA 2JEGA 3MEEA 5CZVA 4CO2A 2E9RX 3R6GB 3J7YI 4O3QA 1H7XA 4OZLA 2ZVSA 2VFRA 4RW8B 4S0MA 2K7KA 4YB1P 1RWUA 3KG1A 2MZQA 1VQKS 2ZUGA 2FLLA 1HI0P 2HLUA 4DX5A 5GMDA 2Q43A 1VC6A 1N48A 4ED5A 3JQMA 4RW7A 1S1WB 2AGOA 2HHWA 2FYXA 3PW7A 4E2FB 2EBEA 2ADBA 1YJTA 2UV8A 2C2RA 3DMJA 3AJ1A 3G6XA 1TK0A 2FVQA 2OD6A 2W2OP 3HSDA 2JL9A 2MKCA 4QPTA 2FVPA 1X9MA 1FEEA 1HMVA 2I9SA 4LQ9A 3NNAA 4JBCA 4Z37A 4ERDA 3POTB 4P2FA 2CAJA 3F73A 2ZH6A 3S6EA 1VGYA 1JLAB 4IRDA 3D3BJ 2HS4A 1X4DA 3IGVA
chains in the Genus database with same CATH topology
3CO0P 4JP8A 3VV2B 3SQOP 3A3NB 3A3OB 1R6VA 3T41A 1SCJB 3GCXP 4YN3B 2W2QP 2W2NP 4NMXA 3WHIA 1ITPA 3BGOP 3WIUA 2W2MP 2W2PP 2Z30B 2ZWOA 2PMWA 3WIVA 3AFGA 2W2OP 2Z56B 2Z58B 2Z57B 3GCWP 2Z2YB 4K8RA 3H42A 3A3PB 3VHQA 1SPBP 3P5BP 2XTJP 4NE9C 2Z2ZA 4OV6A 2ZWPA 3CNQP 3QFHA 1V5IB 2QTWA 2E1PA 3BPSP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CO0 P;  4JP8 A;  3VV2 B;  3SQO P;  3A3N B;  3A3O B;  1R6V A;  3T41 A;  1SCJ B;  3GCX P;  4YN3 B;  2W2Q P;  2W2N P;  4NMX A;  3WHI A;  1ITP A;  3BGO P;  3WIU A;  2W2M P;  2W2P P;  2Z30 B;  2ZWO A;  2PMW A;  3WIV A;  3AFG A;  2W2O P;  2Z56 B;  2Z58 B;  2Z57 B;  3GCW P;  2Z2Y B;  4K8R A;  3H42 A;  3A3P B;  3VHQ A;  1SPB P;  3P5B P;  2XTJ P;  4NE9 C;  2Z2Z A;  4OV6 A;  2ZWP A;  3CNQ P;  3QFH A;  1V5I B;  2QTW A;  2E1P A;  3BPS P; 
#chains in the Genus database with same CATH topology
 1SC1 B;  3PJW A;  1R7I A;  2AMC B;  2F7V A;  3UD5 A;  2D9O A;  4X4Q A;  4IRC A;  1T94 A;  2IVM A;  3OTD A;  1X5P A;  3TYT A;  4IQX A;  4DCP B;  2KT3 A;  2MY7 A;  4OHW A;  5KFJ A;  1C4A A;  1R27 B;  1XEZ A;  4NLP A;  1SJR A;  1OWX A;  5A6W A;  1CPZ A;  2BDP A;  4NYZ A;  3BN7 A;  2UUC F;  3CDU A;  4NCG B;  2C3M A;  3LGN A;  4DMZ A;  5K14 A;  2XO7 A;  4LQ3 A;  2R7U A;  3LOU A;  4ZOS A;  3WIV A;  4PAA A;  3BKF A;  2NR0 A;  3ISN D;  1WI8 A;  1YJR A;  4C2M A;  2BA9 A;  1Q0N A;  2ZEJ A;  2HQ3 A;  1RA6 A;  3RGI A;  3MM8 B;  3OL9 A;  5K8P A;  3TA2 A;  3I0S A;  1ZTW A;  1GEH A;  2E9T A;  3I5B A;  4F4A A;  1Y3J A;  2GGP B;  4U8V A;  2WZ1 A;  2FC9 A;  1N0V C;  2PN6 A;  1PG5 B;  2J7W A;  4TU8 A;  3G96 A;  3RRG A;  3OVB A;  2IDL A;  2GVZ B;  5HQ8 A;  4K4X A;  1RTI A;  1NCL A;  1BE4 A;  2CJQ A;  1QLN A;  1QE1 A;  1BUX A;  1JXE A;  1NPK A;  2FVC A;  2AF6 A;  5ETK A;  4LIR A;  3OUY A;  1CJT A;  2HBZ B;  3CCM S;  2G2Z A;  4WKR A;  1VDH A;  2HZA A;  4I68 A;  3OFH A;  4FZV A;  4KH1 B;  4DPT A;  3SSS A;  5IT9 Y;  1LWC B;  1DQ9 A;  1FDA A;  2QX0 A;  3WHI A;  3MMB B;  3CMQ A;  5H9E K;  2ATL A;  1BQM A;  2M8H A;  3PFO A;  4LBP A;  1LK7 A;  2OPS A;  1NHU A;  2LDI A;  4ZKA A;  3M9O B;  3HZE A;  5KFZ A;  1N6Q B;  3P49 B;  2RNE A;  4N56 A;  2VOD A;  4N41 A;  4QR1 A;  2W7A A;  4CLK A;  1HQU A;  2COL A;  1X4A A;  1HWJ A;  4H4M B;  2E66 A;  2VKZ G;  5KFL A;  4DR3 F;  1RLC L;  1MML A;  1R0B G;  2GGP A;  3FQK A;  1RT3 B;  1SH0 A;  3A4T A;  2EC0 A;  3P3D A;  1HYS A;  1F6T A;  3CC4 S;  1T3O A;  2HGL A;  4MKB A;  1WSR A;  3GYX B;  3IRX A;  2C2N A;  3Q8Q B;  4F2S A;  2RHS B;  5D3G B;  4OI4 A;  4PR6 A;  3H2U B;  2QT7 A;  3M9M B;  2DYA A;  2HNY A;  5GAE I;  1Q8L A;  2YWE A;  3KJV A;  1NJZ A;  4DV1 F;  2KTQ A;  2MSS A;  2DNK A;  4QYR A;  1R31 A;  2BX6 A;  2IMW P;  3RW7 A;  1MRO B;  2AX0 A;  3NGU A;  2KO1 A;  2RUG A;  3H5U A;  3A13 A;  1X60 A;  3QAT A;  3GTY X;  4P75 A;  4GC6 A;  5J1E B;  3GZ7 A;  3UDV A;  1RTZ A;  3W65 A;  4FF3 A;  2VZ9 A;  2CJB A;  1H3D A;  1X5O A;  2IHR 1;  4OX6 A;  5JVG Q;  5IM0 A;  5HL7 Q;  1NXI A;  1NB7 A;  2MKK A;  1VMB A;  3K58 A;  1TUV A;  1ZM3 A;  1QTN B;  2ZC4 A;  2AJQ A;  4F4K A;  3M8Q A;  3Q8S B;  3I4H X;  1T0T V;  5KT7 A;  1RBL A;  2F3J A;  3HF5 A;  1TUW A;  1RAE B;  2LU2 A;  1S1T B;  3LAK A;  3M2R B;  4WIQ A;  4NYP A;  4J9N A;  3T1H F;  4RUB A;  1IR0 A;  4K59 A;  2HHU A;  4ZJL A;  3KJN B;  4HL9 A;  4X4V A;  4MTP A;  4JI4 F;  3GB0 A;  1NPR A;  2L41 A;  3G6Y A;  3X3U A;  4OYA A;  2W4D A;  3UDE A;  2ZKT A;  4HR2 A;  3CCJ S;  5CAB A;  4NLW A;  2R8H A;  2BE2 B;  5ETV A;  2HAF A;  4RUC A;  8AT1 B;  3VQT A;  1WUU A;  3DOM A;  3DDI A;  5DZ6 A;  3M30 A;  1RWP B;  2KRR A;  2VH7 A;  1CJU B;  3MOZ A;  4ED6 A;  2FJE B;  3AT1 B;  3M2V B;  2ZH9 A;  2HQC A;  4FPI A;  3PV8 A;  4QZV B;  4RW9 A;  3L9Z A;  2M9K A;  4NZ0 A;  4LFC F;  1VR6 A;  2DY1 A;  2GMH A;  2ZD1 A;  3HFK A;  3U1L A;  1U1P A;  3CCV S;  2PC6 A;  4AT1 B;  2FVS A;  3PO4 A;  3D1Q A;  4L76 A;  2XSJ A;  5HRO A;  5DQI A;  1Q5V A;  4YB7 A;  3DXB A;  1TL1 A;  4PWU A;  5T7L A;  3TW0 A;  3US5 A;  1HBN A;  2DGS A;  2XM3 A;  2XWY A;  1CLF A;  4JP8 A;  1RHQ B;  2GHP A;  3PW0 A;  4OHY A;  2HND B;  4I7F A;  4NCA A;  2UXD J;  4DV6 F;  4ECS A;  5A0Y B;  3LAN A;  1VQ8 S;  1FKP B;  1WWH A;  2VG7 B;  5C24 B;  3VZH A;  2CPF A;  4I2Q A;  3TUP A;  2IRU A;  2MJN A;  2NSC A;  3H25 A;  4JI7 F;  2CA9 A;  1SI9 A;  1VK8 A;  1FFG B;  3SCI E;  2DD8 S;  1YBA A;  2W2P P;  3AOA A;  2XMK A;  3HVW A;  1JJH A;  6FDR A;  1DTQ B;  2YKQ A;  1F2H A;  3HHD A;  3THP A;  2N3O A;  4X65 F;  2AJ4 A;  1BHN A;  2RS8 A;  3SSQ A;  3O8W A;  5KFF A;  1S7I A;  3UD3 P;  4MAK A;  2BQ3 A;  4XDC A;  2VQE F;  2MDA A;  2PFF B;  4LR7 A;  2GJF A;  3NMR A;  1SL0 A;  2VQF J;  2Z2Y B;  5K20 B;  5GAE U;  1T03 B;  2D69 A;  4KB7 A;  3SMZ A;  4Y34 A;  1FE0 A;  2CZ4 A;  4Z7Y A;  2VOP A;  1FRH A;  2EC2 A;  1NRK A;  1XMQ F;  2DNZ A;  2OLW A;  3CO0 P;  1HR0 J;  2ZBI A;  4FXV A;  2EFQ A;  4LRF A;  1AYE A;  5T14 A;  1S6U A;  2YNH A;  3CWJ A;  4DCO B;  4H4K C;  5BR8 F;  1S1V A;  3D6T B;  1WF2 A;  1RBA A;  1RE1 B;  1OQ6 A;  1OQ3 A;  2JHE A;  3R6L B;  4KKO B;  4WFA Q;  3I87 A;  4PXE A;  3N5F A;  1QAX A;  2JZ5 A;  3ZTQ A;  5IS2 A;  4ENO A;  2GAH C;  2H5I B;  2X51 A;  3OV7 A;  3MCO A;  1EKS A;  2MQP A;  3PG9 A;  4Z7C A;  4L3K A;  4K4T A;  1S72 S;  5I3Q A;  3PIP Q;  3HKZ D;  2YQ3 A;  4KIA A;  3ICL A;  4J9K A;  2FJB B;  2GV1 A;  5D4P A;  5C2C A;  3NOC A;  3KDN A;  3MM9 A;  3UPF A;  1HI8 A;  4Q2M A;  4FNI A;  1ZPV A;  3H42 A;  3MMC B;  1LFW A;  4AL6 A;  1W2I A;  3ZO7 A;  1XMQ J;  3H2V E;  3NGS A;  4B3S F;  1HQ2 A;  2CG8 A;  2QTW A;  5IQ6 A;  2OEJ A;  4X62 F;  3Q8V A;  3Q83 A;  1RT7 A;  5FDL A;  3NXZ A;  3VAK A;  4UY8 T;  2KRB A;  1H72 C;  5DDQ C;  2QMX A;  1A7G E;  2B4O A;  2WB4 A;  5KG4 A;  3Q89 A;  4B9L A;  4ZLN A;  1SCJ B;  2QYC A;  3ETM A;  5IZH A;  3NKY A;  5CYM B;  3W2W B;  2DXE A;  3K89 A;  2V4Q A;  3BSN A;  3F0N A;  3V81 B;  2D3Z A;  4W98 A;  5ETP A;  5A76 A;  1R0C B;  1VRU B;  5ITH A;  1PBU A;  3OVS A;  2MKY A;  5EGY A;  1SQE A;  4P52 A;  2AJ1 A;  3SXL A;  3QGP A;  3TEH B;  3J80 U;  2HHV A;  1WG5 A;  2R4F A;  4JOU A;  2H65 B;  2LMI A;  3HZG A;  4EEY A;  4DUZ J;  3KXD A;  4FF2 A;  1P27 B;  3FBE A;  1UW4 A;  1YJN S;  4KH0 B;  4WU2 A;  4RZR A;  1V3Z A;  2X1A A;  2BJD A;  2UXC J;  1RUS A;  2L48 A;  3M8Y A;  1SKS A;  3ZZ0 A;  3VAI A;  1NK0 A;  4O3S A;  3L7P A;  3OXG A;  1Y4Z B;  3EUN A;  3MCS A;  2LQ9 A;  3MM7 A;  3Q8P B;  3DRS A;  3EGN A;  4FYW B;  1CSJ A;  2DRD A;  1R6V A;  5K8M A;  4DHV A;  4M95 A;  2K2P A;  5KTQ A;  3OTO J;  2CQH A;  3OLA A;  1O6X A;  4QIW D;  1NK6 A;  1BD6 A;  5IV4 A;  1RKJ A;  4JI6 F;  2YVS A;  1M1K T;  1U1N A;  1MU2 A;  4X64 J;  4X66 F;  1RAB B;  3FRZ A;  3DLE B;  2VU5 A;  3LP1 B;  4C8M A;  4DN0 A;  2R8K A;  1TFW A;  1RTJ A;  1Q16 B;  3KLH B;  2XB2 D;  1D9F A;  3MAH A;  3GSI A;  5F8H A;  3JYT A;  4ICL B;  4PCQ A;  2HEK A;  4O4G A;  3TVY A;  1V6H A;  2QMW A;  5D4N A;  3SCJ E;  4DUY J;  1S9F A;  4DV5 F;  4ZCK A;  5RUB A;  1PYT A;  2HQI A;  3MUM P;  4DZ6 A;  1Q8B A;  4CLY A;  3PKM A;  1ZA1 B;  4OYW A;  1FWL A;  1UZD A;  3T19 A;  1VC5 A;  1S76 D;  1ACM B;  3KYL A;  4YY3 J;  5L46 A;  4DQR A;  1UMJ A;  4L75 A;  2QC3 A;  3KLE B;  3KK1 A;  3QSY B;  5JMN A;  3QJJ A;  4LMZ A;  3UVJ B;  1UPP A;  5AXM A;  1MLA A;  2PII A;  2VFT A;  2X3G A;  1RT4 B;  2QLF B;  4CO0 A;  4KGX B;  2OPS B;  1YJW S;  1FRK A;  2B51 A;  3MAQ A;  3GIJ A;  5KFO A;  1RHK B;  3L7U A;  3OR2 B;  1NLK L;  3GU0 A;  4DV3 F;  5E5N A;  2DXF A;  3OHB A;  2QA4 S;  5I3U A;  5DGB A;  4X84 A;  5KFU A;  5HAN A;  3IR5 B;  3K5N A;  1IQT A;  4B9V A;  1VIX A;  2R9L A;  1H0H B;  3TAM A;  1IWA A;  2IAJ A;  3S7R A;  1XMO F;  4B9N A;  2PFD A;  3PYE A;  2KG0 A;  2AHO B;  3RRH A;  3GE9 A;  4UTG A;  3B4D A;  1U26 A;  3IM8 A;  1PJ6 A;  3NLC A;  1C1C B;  2HZC A;  2W9C A;  2G1D A;  5HSP A;  4KGV B;  4Q44 A;  2ASD A;  1WKL A;  3LP1 A;  1OMS A;  5B0C A;  4X4T A;  2CFX A;  3HHL A;  2XI3 A;  5BJR A;  3W7B A;  2BV3 A;  2W2Q P;  3OFF A;  2IY5 B;  2IA6 A;  1Y0H A;  1YQH A;  2CQB A;  2DNL A;  3EIC A;  3SDE B;  3ZNU A;  2HNZ A;  3MCN A;  1S7H A;  2Z30 B;  4RL1 A;  2ROP A;  3DOL B;  5I3U B;  1PKU A;  1S99 A;  4DL6 A;  3PX4 A;  4ZPD A;  3K5L A;  2HVH A;  1U45 A;  3TUZ C;  1PIE A;  4NOH A;  1GMV A;  2BKO A;  2HAI A;  3BR8 A;  3GCW P;  4PYA A;  1OPI A;  2ILZ A;  2M5Y A;  4IFY A;  4WP9 A;  4IFY B;  4RW7 B;  3UVJ A;  4O3O A;  2PSZ A;  5KFQ A;  3NNH A;  8RUC A;  1CQN A;  3A1Y G;  4NRU A;  2NRE A;  3OSP A;  1YWX A;  3M6U A;  3V2U C;  5HVG A;  4HYK A;  4DS5 A;  2L9N A;  1S1X B;  5LSO A;  1N34 J;  4JI7 J;  4PQU B;  4LRD A;  3FEX B;  3UQS A;  2ZBP A;  2C2E A;  2MQL A;  1NSP A;  4WF9 Q;  1UVN A;  1S12 A;  1APS A;  3NEK A;  4QIE A;  4USK A;  2FJA B;  4LSN A;  2MB0 B;  2UVV A;  3ENQ A;  2MQO A;  1R8H A;  2V67 A;  5HO4 A;  4ECX A;  2RIL A;  2KXF A;  1UEV A;  2H48 B;  2JLE A;  4KQZ A;  3IAS 9;  3E2E A;  1RHJ B;  4OZN A;  2H4W B;  3SEO A;  5HVF A;  4M5D A;  2IDE A;  3R5D A;  2YBV A;  4JI0 F;  1RT2 B;  2NYI A;  4F67 A;  3M8S A;  4AL7 A;  5J2M A;  4OI1 A;  1HI1 A;  1D1U A;  2BJ8 A;  2ZH5 A;  1MMD A;  3EDR B;  3KUH A;  2ASY A;  1SL2 A;  3BPS P;  4NA2 A;  4FN5 A;  4C11 B;  1TK8 A;  4JV5 F;  1Z2L A;  2UXB F;  4A8Y A;  1VCT A;  4X62 J;  1UTA A;  1WC4 A;  4Y2C A;  4FPR A;  2EFN A;  3D4J A;  5CYQ A;  1RU1 A;  3NWR A;  2DEJ A;  4ZCL A;  4DV4 J;  4P73 A;  4QR0 A;  2OD4 A;  3BBB A;  4IG0 A;  2CPZ A;  2FHK A;  2N7C A;  3DU5 A;  4KPY A;  1FE4 A;  1K8A T;  1FJ7 A;  1HPZ A;  4D3G A;  5DG8 A;  1NSA A;  3EWG A;  4QQB A;  3KHR A;  1KR4 A;  1NH8 A;  4DR5 J;  2LEB A;  1NDC A;  4IRK A;  1FRM A;  3IGN A;  1GK8 A;  2GNK A;  1U6F A;  4C8L A;  4OZ1 A;  4PG6 A;  1C0U A;  1N36 J;  5LMU F;  2IM3 A;  3CDA A;  3TJA A;  1L3T A;  3BM7 A;  3MGJ A;  4AQY J;  1TL5 A;  4K5S A;  1O5J A;  2KYZ A;  4WFX A;  4C97 A;  2EG2 A;  2V94 A;  4ZVS B;  4ID8 A;  4ZN3 A;  3CCQ S;  4EBE A;  2YH1 A;  1VQ5 S;  2ZDP A;  5K5M A;  3M1V B;  4CM0 A;  3KKF A;  2Q6B A;  1KQF B;  3CJ4 A;  2NXJ A;  3EGV A;  2R7R A;  3GP9 A;  4RWW A;  4YR0 A;  1AXQ A;  5A8W A;  3AOC A;  1HBM B;  5DET A;  4K0K F;  4ECR A;  1QSS A;  2RDD A;  3BF4 A;  4UT4 A;  2J76 E;  4LF2 A;  4TYA A;  1NBE B;  3CED A;  2QLX A;  3MPU B;  3JQJ A;  1IM4 A;  3CCU S;  4LSZ B;  2W24 A;  2VBZ A;  1K44 A;  5DRK A;  1N33 J;  4DUT A;  1LW2 B;  2CPI A;  3QFW A;  2DNY A;  5CH7 B;  2P8I A;  3NGT A;  2NCK L;  2PEB A;  5HAO A;  5C5J A;  1LWF B;  1JLB B;  4NLR A;  3WDO A;  2KG1 A;  1IBL F;  1DTT A;  3CO9 A;  5HJX A;  3VWS A;  1KQG B;  1S1W A;  1BLU A;  2LKZ A;  2VIH A;  1NUE A;  1JLE B;  4NCB A;  4B08 A;  2X1F A;  1HHT P;  2YKM A;  4ECW A;  3VGV A;  2BM0 A;  3S1T A;  1WKJ A;  2D3U A;  2J9D A;  2WCX A;  4NAS A;  4FS2 A;  2E7V A;  1U25 A;  3EX7 B;  2BR0 A;  1NPP A;  3IWN C;  4ZPB A;  1FX4 A;  2V2V A;  2AKW B;  1MWQ A;  2C2Z B;  3LH2 S;  3DLJ A;  3EGW B;  3TAM B;  2W9B B;  4JI6 J;  2A3J A;  2W2N P;  2P2C B;  4LR8 A;  5AXL A;  1EIY B;  1QM9 A;  1JKH B;  2GMJ A;  3GMG A;  3PFE A;  5F9N A;  2PEH A;  5KOX A;  2F8H A;  1F5A A;  1WAC A;  3DLE A;  2KH9 A;  4CT8 A;  4Y2K A;  5FDL B;  2QSW A;  2WW8 A;  5M2R A;  2VPX B;  4CLL A;  2G4B A;  1SJQ A;  3PNI A;  5FJ4 A;  4PG8 A;  3LO3 A;  1VJQ A;  2NZC A;  5E3A A;  2DPI A;  1FHT A;  1RWM B;  4MK7 A;  1FEH A;  4USW A;  4WU3 A;  4DBQ A;  4F3O A;  3HVT B;  2IFX A;  3ULH A;  3CJT A;  5E3P A;  2WSE C;  3TO8 A;  2HK3 A;  3FC9 A;  2N3L A;  3CNQ P;  4CWB A;  1EX8 A;  1N5T A;  3PHE A;  4M5M A;  3CD6 S;  3T3F A;  1C0T A;  3C16 B;  3W2V B;  1IKV A;  3Q22 A;  3ENA A;  2VL1 A;  1CG2 A;  4I2P A;  4I2P B;  4Y2M A;  1G6B A;  5DS7 A;  4ECZ A;  3JTN A;  2V9K A;  3I5C A;  5KFE A;  1REV A;  1UVL A;  2SXL A;  2VHG A;  3C2P A;  2KXH A;  4BC7 A;  4ANC A;  1N32 J;  3GPA A;  4M94 A;  2DR5 A;  1IQZ A;  1RAF B;  3VAH A;  2AYB A;  4K5R A;  4U7U D;  4GKJ J;  4OYX A;  1ZH5 A;  3RRK A;  4OV1 A;  3I5A A;  3UO0 A;  4HLB A;  2HBR B;  3T5L A;  2HSE B;  2IMO A;  3ILI A;  2E7W A;  4QJV A;  3SQG B;  1Q7L B;  4ZLL A;  1DBD A;  3BYP A;  3IRX B;  6FD1 A;  2QLB B;  4WE1 B;  3WQP A;  4DV7 F;  3UI3 A;  2MKH A;  3J81 U;  3AXK A;  4PXD A;  4Y2A A;  2MQ8 A;  4HEA 9;  3SYZ A;  1L5U A;  4JI4 J;  2XZD B;  4KHM A;  4NLV A;  4YY3 F;  2MEW A;  3EZO A;  1TKT B;  4USI A;  4AUK A;  3J7Z 5;  4G65 A;  5F41 A;  1LWX A;  3T1Y J;  3RBD A;  2CNN B;  3JYT B;  1YRX A;  3G8T A;  2W9A A;  1IBC B;  2FC8 A;  3Q24 A;  4N47 A;  2A2D A;  3BKU A;  4WII A;  3W64 A;  3TZX A;  2ZFH A;  3IBW A;  3BV8 A;  2LQB A;  2E5H A;  2KI2 A;  4GO5 X;  3NGD A;  1RB0 A;  4QOT A;  1SVD A;  1WEX A;  1EAR A;  5IM0 B;  1N56 A;  1FXL A;  1B99 A;  5HMX A;  4B3O B;  3HVA A;  2A0F B;  3KNG A;  3GR0 A;  3V4I A;  1RXO B;  5M2U A;  1PC5 A;  2E5I A;  3CD0 A;  1SB6 A;  3H5S A;  4C8N A;  4F7V A;  4PUO B;  1FRX A;  1IJF B;  2UU9 F;  3D0H E;  2M7S A;  4OZ0 A;  5KT3 A;  1G4C A;  1B4S A;  1JLG B;  2O01 C;  3C19 A;  4MFB B;  4CYU A;  5KFY A;  1IKY B;  3KWM A;  5DGA A;  3PO5 A;  4ELT A;  2RQK A;  2JEI A;  1V5I B;  2WON A;  2J6S A;  3LWL A;  4DR4 F;  2YKN B;  1MN7 A;  3MPV A;  4DV2 J;  1LW0 A;  1N5Y B;  2CNO B;  3IXQ A;  2B9Y A;  2RF2 B;  1S79 A;  2J6U A;  3NCR A;  3M8Q B;  2DR9 A;  4BCA A;  3AOB A;  1ITP A;  1B0P A;  3FCW A;  1KN6 A;  1QAI A;  4DR7 J;  3K57 A;  4OHZ A;  2ZOF A;  4FXW A;  3UR3 C;  3RB3 A;  1RAC B;  2L9D A;  4M5J A;  3G6E S;  2XUL A;  1KSP A;  2OP5 A;  4C6A A;  3OVA A;  1VQM S;  1EKR A;  3PHT A;  4NYO A;  2K1R A;  4IR1 A;  2E5L F;  1OIA A;  1YJV A;  3W9I A;  4HDH A;  2KDO A;  1RYS A;  5GAH U;  2UP1 A;  2FLO A;  3LPE A;  2R8G A;  3TZY A;  4DV2 F;  4I6Y A;  1FJG J;  1S49 A;  4ES2 A;  4B3O A;  1Q81 T;  5DG9 A;  1FJC A;  1NAQ A;  1TP7 A;  1IBM J;  3MZI A;  2RRA A;  3E01 B;  5F0W A;  2BXJ A;  1VBX A;  2G0I A;  1GFW B;  1WNE A;  4X65 J;  1S5Z A;  4KBI A;  2BJ7 A;  5CA5 A;  3RZA A;  3ZZO A;  2JJ4 D;  3HHE A;  2Q79 A;  4ALZ A;  2IBO A;  3G8Q A;  4Q0B B;  3UE2 A;  2W9B A;  2YXL A;  4M5N A;  4LF5 F;  4HHU A;  3TQE A;  3GQC A;  1ZET A;  2BE2 A;  2AT1 B;  2Y1I A;  2BW7 A;  4YQW A;  4O3R A;  1SC4 B;  2VG7 A;  1FDN A;  2XMV A;  3U1M A;  1U7L A;  4QWE A;  1I1G A;  1CQM A;  3KLG A;  2PA3 A;  3M32 A;  1HQU B;  3GYN A;  2EPI A;  3PKY A;  3I0R B;  4F04 B;  3M2U B;  5BR8 J;  2XQC A;  1N54 B;  1N8R T;  3QGG A;  1EQ0 A;  4FYX B;  2HVZ A;  2JNJ A;  2V9W A;  1JIH A;  4QU6 A;  2PO4 A;  2VFV A;  4IDK A;  4QPX A;  4A8S A;  4HT5 A;  5EX3 A;  1M5S A;  1VFJ A;  2RRN A;  3TEG A;  1Q8I A;  4NLY A;  3D0I E;  5B09 A;  4M1K A;  2V8D A;  3ZTS A;  3OR1 A;  1RWW B;  3T6B A;  1Q53 A;  4ZCI A;  1S1U B;  3CB4 A;  2WB1 D;  3TRG A;  3N01 A;  1H2V Z;  4O0I A;  3GII A;  5U47 A;  3EPG A;  1HMV B;  2H5J B;  1LK5 A;  5B7W A;  1XC9 A;  3CME S;  2EBG A;  1LWF A;  2YQ1 A;  4B9M A;  4KHP F;  1VQN S;  1F2G A;  4MKA A;  4PXC A;  1WOS A;  3H59 A;  3MFI A;  1MWY A;  4PXB A;  3S8S A;  5AE2 A;  1HNW J;  2MKI A;  3ZTO A;  4OX9 F;  2C2K B;  5J2N B;  4TY8 B;  4Q8E A;  5C42 A;  3H8Y A;  3CJ8 A;  4JI5 F;  2ZHO A;  3NRB A;  2C2D A;  5E3R A;  2ZHB A;  1WC1 A;  3GYG A;  4NLS A;  3KLV A;  4A46 A;  5IT4 A;  2W8K A;  1BGX T;  1VBK A;  3MMC A;  5IV3 A;  2AU0 A;  4WPA A;  4B3M F;  1S1U A;  2F4V F;  3MPY A;  1UFL A;  4N8O A;  4GC7 A;  1QDU B;  1Y00 A;  4ED8 A;  1GT8 A;  1N32 F;  2Y1R I;  3R5C A;  1YJU A;  3K59 A;  5F3Z A;  1NZA A;  2CPJ A;  1M1H A;  3DRP A;  4XPC A;  3MHY A;  2MZ1 A;  3OL8 A;  2CKW A;  2RS2 A;  3SQG A;  2Y1J A;  3KNA A;  2I5J A;  1QE1 B;  3V4I B;  1FA0 A;  3QRQ A;  3AQO A;  4ED7 A;  4NWB A;  1T9V A;  4HTI A;  4LF7 J;  2V50 A;  3QT6 A;  3GWC A;  1UWB B;  2V68 A;  2D74 B;  3I0S B;  3R7S B;  5L9X A;  2KXN B;  2DGU A;  4DF8 A;  2XNR A;  2GVD A;  2JSX A;  4UUW A;  4RUA A;  5KFS A;  1VQ7 S;  3QWU A;  2RU9 A;  4ZA1 A;  1U24 A;  5T41 A;  5DDP C;  3HT3 A;  3KK2 B;  1U47 A;  2OMO A;  1TK5 A;  1NND A;  3LP2 B;  5HP1 A;  3VZI A;  3KUG A;  4ZP9 A;  1S1X A;  2R3V A;  5LSR A;  3EZ5 A;  2L9W A;  2IVY A;  3MMA A;  2OJ3 A;  3DXS X;  1QVF R;  2CZ9 A;  5A6P A;  1TR0 A;  2EK1 A;  4L73 A;  3CCW A;  2VB6 A;  3CJ2 A;  3L4B C;  2VBY A;  2FZC B;  2XZW A;  1Q4R A;  5IC4 B;  5KT4 A;  4LIW A;  2QIF A;  4NXN J;  1RK8 A;  1T9T A;  2ZBC A;  1IKV B;  2DB1 A;  2ZBR A;  2HQG A;  1EET A;  3MM5 B;  3R5G A;  4P9S A;  3D66 A;  4USH A;  5HK4 A;  2NPF A;  4B3R F;  3AD9 C;  4U7U K;  5HBM A;  2AEF A;  1AT1 B;  4PAB A;  2LQ5 A;  5KFG A;  1SL1 A;  2JVR A;  1JJ2 R;  1SUQ B;  1RU2 A;  3IRW P;  4DV6 J;  1IJE B;  2GIQ A;  2HWH A;  5LM7 E;  3HPO A;  2AGP A;  4CO4 A;  4OJ3 A;  5H9F K;  5KFA A;  4BWM A;  2BBE A;  3LAM A;  3G9C A;  3R2C J;  4DR7 F;  1C0T B;  3C16 A;  3W2V A;  4F3Q A;  4NLO A;  2KVQ E;  2NUU G;  2OKQ A;  3AHP A;  4ELV A;  3MUV P;  2QMU B;  2W4C A;  3QRR A;  2MJU A;  1FI4 A;  2NYH A;  2VG5 A;  4BBY A;  1XMO J;  3MDF A;  2WSC C;  4FYY B;  4CDI A;  1LV5 A;  4K2X A;  4Q45 A;  2BUN A;  3G2X A;  3R5A A;  4DLG A;  2HG4 A;  2ZOG A;  4J9P A;  2XZT B;  1IR1 A;  2RDJ A;  2DNG A;  4B9T A;  3FBB A;  4P2M A;  2ZKU A;  3OW2 R;  1J2V A;  5JJB A;  1G1X A;  1FJG F;  3Q8U A;  1U0H B;  1YX2 A;  3W63 A;  1HL6 A;  2GO9 A;  2J0X A;  5I3P A;  3PW4 A;  2HHH F;  4CNZ A;  4UQG A;  1X0F A;  2GHW A;  1S1T A;  3OTB A;  2QL7 B;  4NCG A;  1HQE B;  4CLP A;  4OX7 A;  1C1C A;  3CJ5 A;  3ZFV A;  2J0Q D;  2WVE A;  1NSK L;  4QWA A;  1UAW A;  1D09 B;  2Y0B B;  3HCX A;  4DX7 A;  3T1A A;  2YY3 A;  3FKB A;  3I6P A;  5SZT A;  4A8W A;  2E29 A;  5CD4 H;  4DR5 F;  4RX6 A;  1C1B B;  4DUZ F;  4MKV A;  3R27 A;  2CZV C;  2HGN A;  2QE5 A;  4AFF A;  7FDR A;  4DN9 A;  3OR1 B;  3J7A 1;  5AJ3 J;  1T05 B;  3AQP A;  1ZZF A;  2HRT A;  2XTJ P;  3GJS B;  1V9O A;  1TKZ A;  4NRT A;  4RKU C;  4PQA A;  3ITH A;  2BAB A;  3RBZ A;  2QL9 B;  2AD9 A;  1W2B R;  4CNY A;  2KHC A;  2UV8 G;  4JI1 J;  4ZS6 A;  3KFW X;  4PKD B;  4RO0 A;  2HHT A;  1IWG A;  3A3N B;  1ROF A;  3ILL A;  4GKK F;  4N5S A;  2HLT A;  3AOD A;  4FNH A;  4MYU A;  1RAO A;  1XBW A;  3NWG A;  1WEL A;  2ZZT A;  4ZPA A;  4WFB Q;  4NMX A;  3OTO F;  2O3D A;  4ILR A;  3G71 S;  1DUR A;  1O8B A;  1SV5 B;  1HW9 A;  2FPH X;  4J9L A;  4B9S A;  2W01 A;  4I6W A;  1U1K A;  1KNZ A;  2OGU A;  4YEA A;  3FBF A;  2F9D A;  2H1Y A;  1IXK A;  4RNN A;  4WJB A;  5LMU J;  3OD2 A;  3QSI A;  2VIC A;  2BRK A;  1U1O A;  1SKW A;  1VRQ C;  3V6D B;  1C0U B;  4C7Q A;  5ETQ A;  2IRX A;  5BYS A;  3F44 A;  2DNH A;  5KFT A;  1RP5 A;  2FJW A;  1GQE A;  1N5Q A;  2Z2Z A;  3RB4 A;  4FYV B;  2C3U A;  1HNW F;  3K2Y A;  2Y9H A;  3MF5 A;  1P1L A;  3HO1 A;  1EZZ B;  2YNI B;  1HBO B;  3MUT P;  4QYZ J;  3O1L A;  1Y5N B;  2B4P A;  1HFE L;  1ICE B;  1LEO A;  1UJ6 A;  2QO3 A;  3R3T A;  1OY8 A;  5F8N A;  4P74 A;  3QID A;  2CPY A;  4LVO P;  4OI2 A;  3IBF B;  5HRO B;  3TAN A;  4OYM A;  4AND A;  2BVZ A;  3N4W A;  3UWT A;  5E3C A;  1AFJ A;  3TA1 A;  2EFV A;  2QSF A;  4C0B A;  3MR5 A;  3Q2S C;  1T7P A;  1N36 F;  4ID5 B;  3QBC A;  2VV5 A;  3QO9 A;  2ZE2 B;  5EX0 A;  3RU0 A;  3QLH B;  1CJK B;  3G82 A;  5KFV A;  1HLW A;  2HQD A;  1RHR B;  3C14 B;  2HMI A;  4LF4 J;  1A6L A;  4ZJQ A;  3QGI A;  1X4H A;  5DJB A;  5THW A;  4ED1 A;  1JJ4 A;  2QFI A;  3GJQ B;  2XGQ A;  3VQS A;  2V69 A;  1F60 B;  2UUA F;  3CCR S;  5KG2 A;  2B43 A;  3GG1 A;  2R2T A;  3W2W A;  3HFV A;  2GC8 A;  3M8P A;  2YWF A;  2DIS A;  1OSD A;  3MD1 A;  2P6T A;  1NK5 A;  4K0K J;  1KTQ A;  2LVW A;  1HNV B;  1WC5 A;  3VR1 A;  1JKH A;  4LF6 F;  1KS2 A;  2YPZ A;  2XMT A;  2VUG A;  3CCT A;  4NI2 A;  4NI2 B;  3B82 A;  1S9G A;  2V63 A;  1SIZ A;  5D8H B;  3SFG A;  5LJ3 Y;  1Q82 T;  4I6A A;  5LSL A;  2FJX A;  2XLK A;  2BYC A;  3G82 B;  3QZ7 A;  1FER A;  5IFM A;  3HKW A;  4TQS A;  1YIJ S;  1BWV A;  1KLM A;  5FLX U;  4K4U A;  1VRT B;  4RBU A;  1X31 C;  2BQR A;  1FVS A;  3A3P B;  3N6M A;  4USV A;  5LMN J;  2NLW A;  4I0W A;  4JI5 J;  3ZNJ 1;  2PMZ D;  1YZ6 A;  3MED B;  4RLE A;  2CQC A;  2AZ3 A;  2XO6 A;  4K4V A;  1QUV A;  1VIO A;  2H5E A;  1PCA A;  4EGL A;  4CLT A;  2WOM A;  2XEX A;  3KLI A;  4OI6 A;  2AGQ A;  2ZE2 A;  2I0X A;  1CEZ A;  4MH8 A;  4ANE A;  2CQ4 A;  2B8Q A;  5G0R B;  5K8O A;  5GAG I;  1SQF A;  1R8P A;  1WC0 A;  1ZM2 A;  2FIU A;  4JI2 F;  2X1B A;  3LGH A;  4MIW A;  4FKY A;  1RT3 A;  1WF1 A;  4J37 A;  2JOQ A;  4M5H A;  4WWS A;  5L39 A;  4OMF G;  2MST A;  3TVK A;  4W92 B;  2DO4 A;  3MEG A;  4IYQ A;  3EPI A;  1TV6 A;  2G2O A;  2GFF A;  1UFW A;  2DK2 A;  4ES1 A;  3NBP A;  5LMN F;  1RQ0 A;  2H3E B;  3VGS A;  1RGV A;  3EE3 A;  4U96 A;  5AE1 A;  4ZLP A;  3G87 A;  4R8U A;  1KVK A;  4IO9 Q;  1KWM A;  5H9F J;  2UUB J;  2HZV A;  5C7P A;  4P2S A;  1WJ9 A;  2ACY A;  2HFV A;  2HRU A;  3AD7 C;  1RCX B;  3VAJ A;  3GV8 B;  2BKP A;  4C4W A;  4CRJ A;  2E44 A;  2V8V A;  3MM6 A;  2IA0 A;  3GJT B;  3M30 B;  3RB6 A;  4O0N A;  2FZG B;  3BQ1 A;  2DGT A;  2CQP A;  1ULR A;  1FK9 B;  3LP0 A;  1ZYQ A;  1UP1 A;  1YBU A;  4KO0 A;  3PDN A;  4PG4 A;  3W1Y C;  3NNC A;  4DPU A;  3BGR A;  3CIZ A;  2F65 A;  1GXU A;  2M0G B;  2WTF A;  4B3T F;  1TFY A;  1JXV A;  4ED3 A;  5A2Q Y;  3IM9 A;  1CUL B;  4N76 A;  1VHF A;  2D3O R;  2JEF A;  2NXU A;  2L3M A;  3SV4 A;  3DRY A;  2RKI A;  2OPQ B;  5J2Q A;  2IYG A;  3S01 A;  1NK9 A;  2OTL S;  2FTR A;  4QYZ K;  1RTJ B;  4GRS A;  4X4R A;  3FSY A;  4CCH A;  2R7S A;  4B3S J;  1R89 A;  3TX8 A;  2MYF A;  4ELU A;  1KP6 A;  1X5S A;  3K7R A;  1FXR A;  4DX6 A;  3LTO A;  2FLP A;  4OQJ A;  1CC7 A;  4C0O C;  1KFS A;  2YNG A;  1UA0 A;  4WK1 A;  1R0A A;  3D5M A;  2XI2 A;  1GX6 A;  2XMW A;  3DHX A;  3VAL A;  3I32 A;  1NM2 A;  1WDD A;  4LF9 J;  1RAD B;  4EMD A;  1RT7 B;  3U1N A;  1YTY A;  2DRA A;  1KDN A;  4B9U A;  2GJ2 A;  3OBI A;  4OJH A;  3NMA A;  1HHQ A;  4OJG A;  3UCZ P;  2QL5 B;  5HJY A;  2CQG A;  3LF0 A;  5CYM A;  4DU7 A;  1SUQ A;  2U1A A;  2XSJ B;  4PYD A;  3ZZY A;  4ZDN A;  2GW8 A;  2XNQ A;  4EK2 A;  1EHW A;  1P8G A;  2JWN A;  1VBZ A;  2HBQ B;  5J2P B;  1YI2 S;  2RQ4 A;  1IBL J;  2X3D A;  4DS4 A;  3CW2 C;  1WHW A;  1W26 A;  3E8O A;  1KFD A;  1M5K C;  1MN9 A;  3IC1 A;  2ZBQ A;  2R7W A;  2OSR A;  3H90 A;  1M90 T;  2CWK A;  1UWA A;  2J7K A;  2MLX A;  2P9E A;  5KFM A;  4LFA F;  1HW8 A;  4DV4 F;  1RAI B;  1E6Y B;  2DGW A;  4JV1 A;  1FXD A;  4ZK7 M;  2IM1 A;  4EUV A;  2VG5 B;  1D8Z A;  3PYG A;  2ZH7 A;  1L3U A;  4WP8 A;  2V5H G;  1TL4 A;  2VD3 A;  1IR2 A;  2ZH3 A;  4ZVQ B;  4DR2 J;  5FLX Y;  3W62 A;  2O5D A;  1CUL A;  1ZM9 A;  2UUT A;  2HBY B;  1TL7 B;  2EI5 A;  4ZHR B;  1U09 A;  2GJI A;  1KOO A;  2NXN A;  4G1Q B;  5KFN A;  5DM6 Q;  2PMH A;  3RBE A;  2IJN A;  3HT0 A;  2C42 A;  5HLF A;  1ZOT A;  4DPY A;  3E51 A;  4TXS A;  1RTD B;  4F8R A;  3K0J A;  4AXI A;  1OSC A;  3FJ2 A;  4TU7 A;  1FD8 A;  3RW6 A;  1D9D A;  3C14 A;  2HMI B;  1UPM B;  2B56 A;  4WYL A;  2M70 A;  3HI9 A;  4HKQ A;  2OEM A;  1EP4 A;  2VPZ B;  3DLG A;  3FBC A;  1UVI A;  4HTJ A;  4CT9 A;  4J9O A;  3IS9 A;  1MWZ A;  3MD3 A;  3G86 A;  2J0W A;  1WG4 A;  3QYY A;  1XR6 A;  3M8W A;  3HP6 A;  3TQ1 A;  3PRV A;  2VON A;  4M63 A;  3J7A N;  1CS4 B;  4F0M A;  3CJ0 A;  1RT2 A;  1RAJ A;  3M8R A;  4ECT A;  3KHH A;  1VJW A;  5KFX A;  3WX4 A;  4DV0 J;  2DCU B;  4F36 A;  1JJC B;  1REG X;  2ZH4 A;  3H2L A;  4KRW A;  4A8O A;  1CJU A;  4B3M J;  4G1Q A;  3CTR A;  4X66 J;  3Q8R B;  2F4V J;  2KFY A;  3V5R A;  1LW0 B;  4DL3 A;  4O23 A;  4E8U A;  1KC8 T;  2BEF A;  1Q95 G;  2CJK A;  1U2C A;  2ZH2 A;  4ILM A;  4MMO A;  5C24 A;  3M4X A;  3O5T B;  3DC2 A;  4DU8 A;  1BMQ B;  3RUB L;  1D8Y A;  5ADZ A;  1MW7 A;  4U7C A;  3SIP B;  2QJ3 A;  3MPD A;  2CNL B;  3N5B A;  1JMT A;  3IBC B;  2MGZ B;  3KHL A;  1SJ3 P;  3OXF A;  4JI8 F;  3SQO P;  5ETR A;  2RQM A;  3MED A;  4ZMM A;  4IUF A;  1NKE A;  5DQH A;  1IVZ A;  2J9C A;  4XDD A;  4OHX A;  1U48 A;  2IYI A;  2FGO A;  4K4Z A;  3IA0 A;  3DI6 B;  5F3T A;  2Y8W A;  2HK2 A;  3CCZ A;  4KJI A;  1FX2 A;  3M6W A;  2MLY A;  2W25 A;  1LW2 A;  3NCQ A;  5DQG A;  1AUD A;  2VF3 A;  1PGZ A;  1QUP A;  2BE9 B;  4RW4 B;  1M0S A;  4LUB A;  1JB0 C;  3M8Z A;  4OL8 A;  3C6U B;  3C6U A;  3OXL A;  4ZCM A;  1GTE A;  4IH6 A;  4DV7 J;  1NK7 A;  3P45 B;  1UET A;  5L9N A;  5EDW A;  1Y11 A;  4NE9 C;  4ZVG A;  1VBY A;  4QIG A;  5C42 B;  2Q1L A;  5A8W B;  4NML A;  2RML A;  4DJB A;  3ILO A;  2HHP A;  2XY5 A;  5LL6 d;  3BDP A;  4NL5 A;  2OAU A;  1SH3 A;  4EU0 A;  2VA3 A;  1FKO A;  4ZVE A;  1U1Q A;  4J9U E;  3TOQ A;  2AV5 A;  2ALZ A;  4Y2I A;  4LF6 J;  2APO A;  2XMA A;  2DBB A;  1TMM A;  5EWE A;  5E3Q A;  4ECV A;  3ET6 B;  1JNR B;  2DT9 A;  3IR7 B;  3MM6 B;  5I42 A;  3P96 A;  2R8J A;  1DTQ A;  1O51 A;  2YKN A;  5BYQ A;  4WFN Q;  3KK2 A;  1YSJ A;  3PX6 A;  2ZJQ Q;  4A47 A;  1I94 F;  1UVM A;  1U0H A;  1NH7 A;  2YWK A;  1Z4U A;  1U2R A;  2RD5 C;  1OY6 A;  3AY0 A;  3NAH A;  1IUJ A;  3K5P A;  3NCP A;  3UDC A;  5GAD U;  2JVO A;  1R8C A;  3OFG A;  1IBK J;  4YDD B;  3KLF A;  1A9N B;  4F25 A;  2WAQ D;  3N9U C;  4DR1 J;  1X8D A;  4FVC A;  1H98 A;  2BJ3 A;  2AEJ A;  2R2S A;  3KJV B;  3VAM A;  4B3R J;  5C2G A;  2XLI A;  5EN1 A;  4HI1 A;  2VFU A;  3RAX A;  5D78 A;  4CLF A;  3KMQ A;  2DR7 A;  2FHJ A;  2HHX A;  1D9A A;  2GIR A;  3JSB A;  3SCL E;  5BYR A;  4CO5 A;  3O2I A;  1NKB A;  2DNM A;  4YFU A;  3GR1 A;  4BDP A;  1F3V A;  3LA0 A;  1F1B B;  3I4P A;  3VGT A;  1MSW D;  3PW5 A;  3WIU A;  5CAA A;  2XYP B;  1S57 A;  4J9V A;  1RTI B;  3PM9 A;  4U67 Q;  4EBC A;  2NQP A;  1LWE B;  2CQ2 A;  1E6V B;  3TA0 A;  4EZ6 A;  2V2Z A;  4FP9 A;  5KT5 A;  4OZ3 A;  2V2K A;  1QD1 A;  1QSL A;  3MR6 A;  4RPF A;  1QTM A;  2R7O A;  1SV5 A;  1LNQ A;  1UWB A;  2C3P A;  3MM8 A;  4Y65 A;  3IN5 A;  3BYR A;  4DQP A;  3LQV A;  1N52 B;  1MU2 B;  3CCS S;  2H9Z A;  2QGF B;  2AZ1 A;  2EKY A;  2FY8 A;  2K3I A;  2E1P A;  1MMN A;  1Q1K A;  1TAQ A;  2CJA A;  2OPR B;  2IVF B;  2DCL A;  2GVZ A;  3MPW A;  5JXS A;  2NPI A;  5EWG A;  1B3T A;  3QRP A;  2N4D A;  3CC2 S;  2HYI B;  5LOQ A;  3BGF A;  2B5J A;  4RJV A;  3O3L A;  2WBR A;  3DRS B;  4Q8F A;  2WRM A;  5GMK a;  1FNM A;  1SBR A;  2AIR B;  3BQ0 A;  4GKK J;  1E6Y A;  4GMK A;  3W9H A;  3CDB A;  3M05 A;  4B17 A;  1PJ7 A;  1X4E A;  2MY8 A;  1RLD A;  2B6A A;  2ZNZ A;  4JYA J;  4O44 A;  3FNN A;  4ES3 A;  4ZIT A;  2QG9 B;  2X1G A;  4C3M A;  2LEA A;  1HWU A;  3AB2 B;  2G0J A;  2KFZ A;  4P72 A;  1NME B;  1JLG A;  1RTH A;  2GCF A;  2Z56 B;  4CYU B;  1H2T Z;  2G13 A;  3GFX A;  4DDF A;  3FSI A;  4DX8 H;  2AYM A;  3AJ2 A;  1NSQ A;  3ZZU A;  4LF5 J;  1TL1 B;  5J2Q B;  2OPP B;  5L1J A;  3EVO A;  1WHV A;  3GIM A;  2HNZ B;  3A8E A;  2R2U A;  1T05 A;  4FF1 A;  4OI3 A;  2OH2 A;  1NZ8 A;  2J8A A;  1EJ7 L;  1ARO P;  3TJ8 A;  4ECU A;  1GXT A;  4IG3 B;  2XSF A;  1KLN A;  2ASJ A;  3MI7 X;  1AA1 B;  3HXM A;  4BC9 A;  1WSV A;  1XTZ A;  2HHH J;  2OI2 A;  3T41 A;  3C8Y A;  3G6V A;  4X2B A;  2QZ8 A;  1K0T A;  2WVB A;  1JXL A;  4OHV A;  1UL3 A;  4R0E A;  1HHS A;  1XQI A;  1OYD A;  1M5H A;  4UOC A;  3VAF A;  2G9O A;  4NXM J;  5L38 A;  2ZZM A;  2M4M A;  5K9F A;  3BGL A;  1SJ1 A;  3I96 A;  2DHX A;  2DKO B;  4M5G A;  5KFB A;  4X64 F;  1R43 A;  1T9Y A;  1WOP A;  2E1R A;  2RKI B;  2DH7 A;  2DGX A;  3EXY A;  3IO1 A;  3DLL Q;  1SC6 A;  5B0B A;  4OYZ A;  4DFP A;  4LFB F;  4IR9 A;  2JLF A;  4Y28 C;  2KHD A;  1GMU A;  1ZAX A;  3PJ9 A;  1WKK A;  2BZ2 A;  2ZWP A;  1TKD A;  1GMW A;  4MK8 A;  2KJV A;  3GFH A;  3HX9 A;  4ZN1 A;  3PW2 A;  4F0K A;  3JSM B;  3MTJ A;  1U0S A;  3KK1 B;  4DQS A;  2OIH A;  2HW3 A;  2XMJ A;  3HHL C;  2JX2 A;  4I69 A;  5LJ5 Y;  2YPY A;  1MNE A;  3V6J A;  2NZ4 A;  1KOH A;  4FS1 A;  2LYV A;  1U1L A;  5J1E A;  3QZ8 A;  1QSY A;  5KT6 A;  1N33 F;  2HFS A;  4YP3 A;  1NK8 A;  2DNO A;  5IC6 B;  5L1K A;  5C25 B;  2V8H A;  5L1L A;  3HHL D;  4C48 A;  3ADA C;  3E01 A;  2P9C A;  2ZNY A;  4PWD A;  4CM2 A;  4NLX A;  4TN2 A;  4TYB A;  4ZPV R;  1HNX F;  4OV6 A;  3EJM A;  2QFJ A;  2GHV C;  3CJ3 A;  3MCM A;  4Q5V A;  4U8Y A;  3JXO A;  1UEU A;  4BHQ A;  4A4J A;  1N5S A;  3EGZ A;  1K1Q A;  2DJW A;  3PXG a;  1B0V A;  4L72 B;  3W61 A;  4KTQ A;  2FQQ B;  3RR8 A;  5DLG A;  3CE8 A;  4I7F B;  2O66 A;  1NHK L;  2GIF A;  3J7Y U;  4YN3 B;  1UFK A;  4PQU A;  1RCO B;  4EO6 A;  4TLR A;  3RG6 A;  3SDE A;  3KK3 A;  3SCK E;  1YDL A;  2LQJ A;  3L09 A;  2GAG C;  3HJF A;  4FVM A;  4CLU A;  4FF4 A;  3SSR A;  2Y0S D;  4J5O A;  5K8N A;  3DLG B;  4DR3 J;  4C11 A;  1PSD A;  2I38 A;  3RAQ A;  3TWZ A;  4P7V A;  4TKT A;  5ETO A;  4Y0F A;  1CJV A;  3H98 A;  3Q23 A;  1ELO A;  3PZP A;  1DLO B;  4LF4 F;  1IN0 A;  4IOC Q;  2ATC B;  2M52 A;  3C66 A;  4XO0 A;  1TL3 A;  4RU2 A;  3HVT A;  4MIA A;  1S77 D;  4IFV A;  3K5O A;  1VHI A;  3OPK A;  2EFG A;  1KTV A;  1RWX B;  4P71 A;  5IOL A;  3MFH A;  5D15 A;  3Q0A A;  5AXK A;  1VQL S;  2BJ1 A;  2QYG A;  1X4B A;  3FCV A;  2EWH A;  1S4E A;  1J27 A;  4P7T A;  2VJU A;  2F63 A;  2DGQ A;  3QWP A;  3CUL A;  4WFZ A;  3AXM A;  2J5A A;  3FMB A;  4K50 A;  2B9W A;  3EVW A;  3QPI A;  2DEI A;  3QT7 A;  1S0O A;  1Y7P A;  1U6B A;  3B8H A;  1JLC A;  3ET6 A;  4MIB A;  4KGK A;  4OZ5 A;  4JI2 J;  2XHC A;  4QWC A;  2NXC A;  1URN A;  1XNR J;  2AWZ A;  2QA2 A;  4NPO A;  1FO1 A;  1DLO A;  4ZP6 A;  2YNI A;  1ZTT A;  1FD2 A;  2DHA A;  1TVR A;  1X7V A;  5GAH I;  3C46 A;  2C2M B;  4KAI A;  3I82 A;  3PY8 A;  3IWX A;  3TVZ A;  1J5E J;  4IQM A;  3RYL A;  4OYB A;  3PR4 A;  4RU9 A;  2B6A B;  4W90 B;  1FWK A;  3T1Y F;  1RA7 A;  3BO2 A;  2LEP A;  1UCN A;  2QA1 A;  4R8U B;  4K4W A;  4URQ U;  1NDL A;  4J9M A;  1RIS A;  1WG1 A;  2F9J A;  2C28 A;  1MRO A;  4RW4 A;  4ICL A;  4ZPT R;  1RSC A;  1S1V B;  5HBM B;  1IKW A;  2HFO A;  4PPD A;  2PT0 A;  2BAN A;  4ZP8 A;  2AP6 A;  4IOA Q;  2QRR A;  3BS9 A;  1WEY A;  4E98 A;  2F1F A;  4CZC A;  4A8X A;  4DZD A;  2M2B A;  5CZX A;  3D28 A;  2MZR A;  4JI3 F;  3K8V A;  1HPZ B;  2MHE A;  2JC1 A;  2WSF C;  1FVQ A;  4NX9 A;  4KT0 C;  2BOP A;  2O1P A;  5D6G A;  1Q86 T;  3FFI B;  3GIL A;  1KBR A;  1WHX A;  3NBP B;  2R8I A;  2B4U A;  2WOM B;  3HD1 A;  4XIU A;  1F5C A;  4CLW A;  1S9E A;  1DZ5 A;  1F0X A;  4BLG A;  3MMB A;  2E9Z A;  3CC7 S;  4TQR A;  2V0N A;  2POK A;  1JWW A;  1BQM B;  4U9R A;  4U95 A;  4K4S A;  2AX1 A;  2FDN A;  3HD2 A;  4KFB B;  2ZDO A;  3DRR B;  4WXO A;  3U7J A;  4QBU A;  4H54 A;  3C6T B;  5G0R A;  3PYF A;  1Y5I B;  4H4O A;  1BQN A;  4O3P A;  3H40 A;  1RWV B;  3R7N B;  4DPW A;  1N34 F;  4AL5 A;  2HVI A;  2R7X A;  2ZJR Q;  1VQY A;  3AD8 C;  3MWB A;  1VIS A;  4HI2 A;  1GTH A;  3V6H A;  1I5O B;  3GSD A;  3MEG B;  1Q78 A;  3FEY B;  3B78 A;  1NB2 A;  1PO6 A;  3KLF B;  3KJQ B;  2EKN A;  4YUD A;  1R3N A;  5D0G A;  2NUH A;  3KOA A;  2Z4P A;  4A8Q A;  2ZD1 B;  2EVZ A;  2DNR A;  2E5L J;  3CDE A;  2MZJ A;  4N7T A;  1KEK A;  3BEG B;  4ER8 A;  1NJW A;  2V4J B;  1N5V A;  1XJW B;  5AJ3 F;  1VC0 A;  5CD4 A;  2MMY A;  1S0N A;  4IH7 A;  5F8L A;  2OEK A;  2OHD A;  3CJK A;  2KYX A;  3FVY A;  2L08 A;  3D68 A;  1YIT S;  3BDE A;  3LAL A;  4C0H A;  4OX9 J;  4L74 A;  1FJE B;  3PR5 B;  1CJK A;  1X4G A;  2XGP A;  1S6P A;  4C8Z A;  3H4D A;  4QW9 A;  3BGR B;  3DLH A;  2XMM A;  4HH0 A;  3MEC A;  8ATC B;  1K1S A;  3M2R A;  2V34 A;  5HQM A;  2ZH8 A;  4JYA F;  3HM9 A;  4KHR A;  5J1N A;  2F4F A;  1HAR A;  3AJD A;  2W9C B;  3RTV A;  3L3C A;  2Q66 A;  3JAM U;  3IWL A;  1JQG A;  3AFG A;  3DMJ B;  1N5Y A;  1IKX B;  3W8G A;  3N28 A;  5I4M A;  4A8K A;  1RT5 B;  1T8E A;  3Q8Y A;  1G7C B;  2JFD A;  1K0V A;  1DJ0 A;  3HFZ B;  3BN4 A;  1NHV A;  1OY9 A;  2VC1 A;  3FZB A;  4F4X A;  2PA8 D;  3NS5 A;  2AYG A;  2WW4 A;  1SC3 B;  2VC0 A;  1ZAV A;  5F8I A;  1TAU A;  2H4Y B;  1L3K A;  2EG1 A;  2ILY A;  3DGP B;  3FMW A;  4DSJ A;  4MJK A;  3W5Z A;  2F8M A;  1KVJ A;  1RI7 A;  3ETO A;  2MZT A;  3FK4 A;  2XYG B;  2KM8 B;  2UUA J;  4KKO A;  2KT2 A;  5FD1 A;  7AT1 B;  3MEC B;  2UUC J;  1RT4 A;  4LRC A;  5E33 A;  9RUB A;  3IMQ J;  4NEZ A;  4YHH F;  2JFK A;  2OUG A;  4M5I A;  2DPJ A;  1HBU A;  3A8I A;  5LT5 A;  1YJ9 S;  3LGM A;  1VQ6 S;  4OYI A;  4ZPW R;  1JLF B;  4OI0 A;  2DIV A;  2RUS A;  4Y00 A;  2UVW A;  3D9B A;  1F3F A;  2OML A;  3BH7 B;  4NLD A;  1KQS R;  2D9P A;  4LVN P;  2HWT A;  4TU9 A;  5EHH A;  4RNO A;  1VQS A;  5DG7 A;  4M5L A;  1HNX J;  3MR7 A;  4EI2 A;  5F8G A;  3QLH A;  3BSO A;  5KG1 A;  4PG7 A;  4I64 A;  3TR5 A;  4X4O A;  3JAM Y;  3D0G E;  3P5T L;  4CP5 A;  4NXN F;  3T5H A;  4C8O A;  4ZVT B;  5ETT A;  1WC6 A;  4URS A;  2VAS A;  1X0P A;  3AA8 A;  2CUY A;  2OSQ A;  4I4B A;  1WOO A;  2QA4 G;  4V19 J;  2FGC A;  3VGU A;  1CJT B;  3H5X A;  3PVX A;  3NY0 A;  1FF2 A;  1DAX A;  1C1B A;  1AFI A;  2XCP A;  4DV0 F;  1PC4 A;  4R25 A;  5D0H A;  2XC9 A;  2CPX A;  1FDB A;  1FKP A;  4DLE A;  4URG A;  1S10 A;  2ABY A;  5KG5 A;  2D3O 1;  2M8D B;  4ILL A;  5KT2 A;  1RTD A;  2YX7 A;  5L8R C;  2C2O B;  1V3R A;  2A6M A;  1YZ7 A;  1TU0 B;  2B7B B;  4LSN B;  2Z2L A;  1D3W A;  4ATN A;  2RRB A;  3G8S A;  1NU4 A;  2ZVI A;  3HSJ A;  4G1I A;  2VFS A;  4NA3 A;  3FUY A;  4DV5 J;  4C8Y A;  2LA6 A;  4DSK A;  4WP3 A;  4K8R A;  4B02 A;  4Z2X A;  2H51 B;  2OFG X;  4KGZ B;  3RB0 A;  2V2Q A;  4LFC J;  4PPZ A;  1FTR A;  4M5D B;  2LLZ A;  2CVI A;  4HVZ A;  2MXY A;  3SI8 A;  3KTQ A;  3GG0 A;  5KFW A;  1Y9O A;  2P5V A;  4DSE A;  3BQ2 A;  2WVF A;  3JSR A;  1RJJ A;  1UVK A;  3PYD A;  3PX0 A;  2UUB F;  3UN5 A;  2LXF A;  4CH7 A;  4PEO A;  2HHS A;  4TVA B;  2DH8 A;  1JLA A;  3E3X A;  1DY3 A;  1PYO B;  2W2M P;  4HAC B;  3QT5 A;  4DXL A;  1S9G B;  3FGV A;  1NDK A;  5J2N A;  1N88 A;  1N0U A;  4LJM A;  4I1T A;  2B5J B;  2MKJ A;  2YX4 A;  3I56 S;  3VF0 B;  2DHH A;  1KON A;  5HN0 A;  2RU3 A;  5JUM A;  5A2Q U;  4LBI A;  1DFD A;  4FBU A;  1XMB A;  2HRY A;  1V3S A;  2YQ0 A;  2RSQ A;  4F4Z A;  3DI6 A;  3VHQ A;  2K06 A;  2RB7 A;  3OT9 A;  3BKT A;  2I1R A;  2E5G A;  4Y6I A;  2R7Q A;  1FFS B;  5SUH A;  3VTI A;  4EYH B;  3GON A;  4CLZ A;  2IBK A;  2HS0 A;  1S97 A;  2IM2 A;  1VS3 A;  4TY9 A;  2PI5 A;  3X1L B;  3CJQ A;  2UVU A;  1ZS6 A;  2WVD A;  4XTT A;  3CCL S;  2YWW A;  2WHO A;  3SZ2 A;  2DXD A;  4ZIW A;  2YWH A;  3DRX A;  2HIQ A;  4HAC A;  4QR2 A;  1IBM F;  3LPY A;  3KJF B;  4ECQ A;  5IT0 A;  1HD0 A;  5MAO A;  1LXJ A;  3BSC A;  3TUJ C;  2ZOM A;  2DR8 A;  2D7S A;  2Y3Y A;  2FVR A;  3VAG A;  5H9E J;  2YKP A;  1WHY A;  4TY8 A;  2K3K A;  3CT9 A;  1O0P A;  2JLG A;  4DR2 F;  2LEC A;  3L7O A;  4FBT A;  4KO0 B;  3DOK B;  1Q79 A;  2UU9 J;  3OUY B;  4AE5 A;  2K8G A;  2VDI A;  4GO7 X;  3T6J A;  2XWX A;  2Z58 B;  2LQ8 A;  4HH1 A;  4K4Y A;  2ASL A;  2U2F A;  3NGK A;  3A12 A;  4LF8 J;  4RWX A;  1RT6 A;  2YKO A;  1RT6 B;  1ZPW X;  2V8G A;  2CQD A;  1JK9 B;  2IPO B;  2A6O A;  2KN4 A;  5GAD I;  1HBN B;  4IOB A;  3V6K A;  3DRR A;  1N6Q A;  2KT5 A;  4CO1 A;  4ZVR B;  3MEK A;  4WKY A;  2VBW A;  4HT7 A;  1Q7Y T;  2JDJ A;  4PG5 A;  4LT6 A;  3GCX P;  3EYZ A;  3HHN B;  1Q8K A;  1TVR B;  3N6L A;  5E41 A;  2VBX A;  4RW6 B;  2ZUA A;  2ZC3 A;  5J1P A;  1F9H A;  1PYS B;  3GFZ A;  4XPE A;  1S59 A;  2CJX B;  1VQP S;  3QJP A;  1YG0 A;  1QJH A;  2EXU A;  2W1B A;  4F26 A;  2J7U A;  2A10 A;  1QAJ A;  1U1R A;  5IQQ A;  2HNY B;  4E0D A;  2RQC A;  4L6V 3;  4MT1 A;  1RDR A;  2E1A A;  2CQ1 A;  3FQL A;  3KLE A;  3QIP A;  2E1C A;  2I8E A;  4DSL A;  2OO4 A;  4CH0 S;  2K1R B;  3ISN C;  2Y1L B;  3TAP A;  3THV A;  4PWW A;  2IC3 A;  3DYA A;  4V1A k;  2CPH A;  4JI1 F;  2XY7 A;  2HQF A;  1NEE A;  1PAE X;  1T95 A;  2CYY A;  3CJR A;  4FKX A;  4C3L A;  2ROE A;  2B8P A;  4C8K A;  2GX8 A;  2D41 A;  2YTC A;  4DF4 A;  3R1H A;  5HP1 B;  4UOG A;  3D54 A;  1OJ4 A;  1RYR A;  3QT8 A;  4PUO A;  1WOR A;  2VG6 B;  1FFW B;  3PTW A;  5D0E A;  3FZ2 A;  4D3H A;  5DDO C;  2J9D E;  3IR6 B;  1LWC A;  3M9N B;  4F0H A;  4R5P A;  3DLK A;  3OL7 A;  5F8J A;  1SXL A;  3DLB A;  4HHJ A;  4I67 A;  2HFU A;  1F9E B;  2B0G A;  3JB9 k;  3CDW A;  2RDI A;  1ZAW A;  1RHM B;  2GA7 A;  1TKX B;  3KG4 A;  3K17 A;  4IH5 A;  2CQ0 A;  3GV5 B;  2DHS A;  1VQ9 S;  1IKX A;  3CSK A;  1RZM A;  2LFV A;  3D6H B;  1W25 A;  5HQL A;  4OLP A;  1KKH A;  1S48 A;  2OEL A;  3OQ2 A;  3R5B A;  1TKZ B;  4MK9 A;  1D0E A;  1EAY C;  3UN2 A;  3LW5 C;  4WXW A;  4KYZ A;  2CDR B;  2HFN A;  2OTJ S;  4RW9 B;  3M32 B;  2FD2 A;  2W4P A;  4ZVP B;  4F2R A;  4YB6 A;  2B7C B;  2J0S D;  1S6P B;  3TJ9 A;  1M5P C;  1U1M A;  1HNI A;  3VVU A;  3DLK B;  3KG0 A;  4IFV B;  1YRT A;  2FUG 9;  4IDK B;  4LF7 F;  1RTH B;  1B70 B;  1YLX A;  1FRL A;  2MQQ A;  1B7Y B;  5CQG A;  3V81 A;  2DVI A;  1SKU B;  1NJY A;  1L3V A;  1NJX A;  4DWI A;  2EW9 A;  4FDF A;  4IG3 A;  4N77 A;  3PAC A;  4USU A;  5CCL A;  1I94 J;  2DNN A;  1Y3K A;  1T9X A;  3TZW A;  4ID5 A;  4I2Q B;  4YDX A;  5F8M A;  2CPD A;  4GVL A;  4LFB J;  1QAY A;  4LBH A;  2DIU A;  1PBA A;  5KOW A;  2M88 A;  4P6Q A;  4KE5 A;  1WEZ A;  3GIR A;  4X4S A;  3M6V A;  3GLJ A;  2EFP A;  3T9Z A;  5KFD A;  2ZIT A;  5KG7 A;  3WC2 A;  1X9W A;  4KSE B;  3O6Q A;  4O44 B;  2CIM A;  3D7S B;  3KMS A;  3P6Y C;  1W7W A;  2DGV A;  1DQ8 A;  2CVE A;  4DL5 A;  1CS4 A;  1T03 A;  2GS8 A;  2ADC A;  2ZHA A;  1B0T A;  4OLO A;  4DV3 J;  3OJU A;  1FDD A;  2A18 A;  2BE7 D;  3MTK A;  1F5B A;  3VCD A;  1NO8 A;  3KK3 B;  3KDO A;  5J2M B;  2C3O A;  4F4W A;  2MZS A;  3EDQ B;  1NDP A;  4J9S A;  4RW8 A;  5GVQ A;  5KFR A;  2D1C A;  4DQI A;  2KZZ A;  1H7W A;  1FNX H;  4DPO A;  1Y10 A;  3W60 A;  3RBX A;  1HBO A;  2FHO B;  2YNH B;  3QAU A;  2J9E A;  3DDK A;  2N82 B;  3HVR A;  4EBD A;  1XNR F;  4J9R A;  3GIK A;  4J90 A;  4HDG A;  2C1E B;  4UUX A;  3R7B B;  4WK3 A;  1U02 A;  1RKI A;  1HNI B;  5EUH A;  5CXT A;  3T1H J;  1JLE A;  3M6X A;  1MG7 A;  5KG6 A;  1JNZ B;  5ETN A;  1UZH A;  2AJ0 A;  1GMW D;  5LXY A;  2RJZ A;  1E6V A;  2WON B;  2AJ2 A;  2XBP A;  3BBF A;  3I9Z A;  4G6V B;  1AZS A;  5ETM A;  3FCH A;  3Q86 A;  4JI8 J;  4Q0B A;  1B7F A;  4KGM A;  5C25 A;  5HVH A;  1HR0 F;  2B9E A;  1ZZN A;  4DR4 J;  2FB0 A;  3HUL A;  2LXU A;  1P9Q C;  1HIY A;  2KU7 A;  2RF2 A;  3VVT A;  3EXC X;  3NOG A;  1U49 A;  3W5Y A;  1KHW A;  2LDY A;  2MTL A;  2RHQ B;  2CRL A;  3DKD A;  3HJV A;  3OFE A;  4ZJO A;  3IG1 A;  5B08 A;  3I55 S;  2F40 A;  3C15 A;  1OPZ A;  3H7H B;  4DFM A;  3H4B A;  2ZM6 J;  4EO8 A;  3G4S S;  4Q7A A;  2ZH1 A;  1UEK A;  5E0O A;  3KUE A;  1SH2 A;  2J6T A;  2BKN A;  3M1V A;  1J5E F;  2VJV A;  2CG4 A;  1BQX A;  1B64 A;  1PIL A;  2MQM A;  3PCO B;  4DI6 A;  1YRU A;  2AW0 A;  2XG8 A;  1VRU A;  3CGI A;  2HFZ A;  1HNV A;  2LXI A;  2IRY A;  4GVB A;  3J80 Y;  1SJ4 P;  5E7O B;  4UZB A;  1AZS B;  5AT1 B;  3HSG A;  4LF8 F;  4O4R A;  1TKT A;  1UW9 A;  3ILJ A;  1GXL A;  5B0G A;  4ZVU B;  5H1S V;  4CQ1 A;  3QJL A;  1LXN A;  3EZU A;  3TAR A;  2GQC A;  1HA1 A;  2CXE A;  2P6S A;  2QN6 B;  4X4U A;  1WC3 A;  1K9M T;  1FKA F;  3CJK B;  4UW2 A;  1JX4 A;  1VYA A;  1KRP A;  4Q43 A;  4DQQ A;  3H0P A;  2FY1 A;  3TUI C;  2O67 A;  2A2C A;  2ACM A;  5KFH A;  2XMU A;  2VQE J;  1RAH B;  3ENV A;  4NXM F;  2R7V A;  3D1O A;  1YHQ S;  4FYD A;  5FII A;  1DAR A;  2YX1 A;  1S6O A;  4ZP7 A;  5DLF A;  5D77 A;  3UR0 A;  4EFA C;  9ATC B;  3ONQ A;  3PIO Q;  1U8S A;  3BH6 B;  1CC8 A;  3A8K A;  3UD4 P;  3OR2 A;  2VOO A;  2FJV A;  4IO1 A;  1WI6 A;  3PRB A;  4LF1 A;  4RBV A;  4CO3 A;  6AT1 B;  1U8W A;  2OPR A;  1I3O B;  2N4C A;  3JS9 A;  2UXD F;  3R97 A;  1LKZ A;  3VV2 B;  1BQN B;  1CJV B;  1OYE A;  4LRB A;  1WTB A;  1UA1 A;  1DQA A;  4HHH A;  1QVG R;  4WE1 A;  5BXI A;  3UN3 A;  2YNG B;  2CAD A;  3ZZZ A;  4KR0 B;  2GQQ A;  4XK8 C;  4RR5 A;  3FDS A;  3GFY A;  4JUZ A;  2QLJ B;  1GNK A;  5K14 B;  5KG3 A;  5D0R A;  4YR3 A;  4TNO A;  3BO3 A;  2HIY A;  5A8R B;  3FFI A;  3DN9 A;  4ECY A;  2W8L A;  3TAQ A;  3TI0 A;  4ZVF A;  5IXU A;  2VQF F;  1UVJ A;  4CI0 B;  2UVR A;  3WX8 A;  3UCU P;  3UW1 A;  3ZC4 A;  3ZXW A;  1WF0 A;  1REV B;  3A8J A;  1SJF A;  3I9V 9;  3JTO A;  3PEJ A;  5M2P A;  2ZJP Q;  2Q3P A;  3OJS A;  1SPB P;  2UUW A;  3WC0 A;  4NLT A;  3NS6 A;  3BGU A;  2YKM B;  2UXC F;  4H4K A;  1FK9 A;  1YVF A;  3LP0 B;  4UOH A;  2MLZ A;  2VPW B;  4Y3C A;  4OYO A;  1VK3 A;  3DCA A;  3MMA B;  3U27 A;  1LWE A;  4KV8 A;  3MXH P;  4UST A;  4RW6 A;  4CLS A;  4RBT A;  3H5Y A;  2MKS A;  5DM7 Q;  4OIX A;  4V19 X;  2BRL A;  3BGO P;  3FRY A;  2AEM A;  2HVE A;  3F41 A;  5T7L B;  3CD7 A;  1NJI T;  1M5O C;  1RT1 A;  4J91 A;  2HWI A;  4BWJ A;  7FD1 A;  5DDR C;  2Z2M A;  3RR7 A;  4QCL A;  1HKA A;  4DL0 C;  2YNF B;  3BSA A;  4CTA A;  1FT8 A;  2YH0 A;  1F9F A;  1OO0 B;  3T9N A;  3MAA A;  1I6J A;  4ETZ A;  3SFU A;  4LSL B;  1KD1 T;  2DTJ A;  5ETS A;  5HMY A;  2BAC A;  4OZ2 A;  3AA9 A;  1HQE A;  2IAJ B;  4UOF A;  3CIM A;  1Q5Y A;  2VKR A;  2KM8 C;  4USM A;  5B0E A;  3CF5 Q;  1JLQ A;  1PJ5 A;  1UKU A;  5MLC V;  4YOE A;  5F9L A;  2VPY B;  1EQM A;  4G3I A;  3KLI B;  3QIP B;  3CJS A;  3HHL B;  4JV2 A;  3CVK A;  3U02 A;  3UFC X;  4UY8 5;  1TTH B;  3W8P A;  2DO0 A;  3W9J A;  3BO4 A;  3DOM B;  1CBK A;  3DU6 A;  2OPP A;  1RBO B;  2M3D A;  3HDS A;  2RIJ A;  5CHC B;  3MAA B;  2ERR A;  3FSX A;  3D1H A;  1FCA A;  1XN9 A;  2BM1 A;  2F8E X;  4KHP J;  5B0F A;  5CYQ B;  1X4C A;  4RNH A;  2FLN A;  1S6Q A;  3IG1 B;  1P6T A;  2VG6 A;  1TQL A;  4MYT A;  3OTC A;  1FWP A;  1EP4 B;  4MFB A;  3RAM A;  4UZC A;  2VA2 A;  2RT3 A;  2OPQ A;  1N4L A;  3R2D J;  1H2U X;  1OS5 A;  3AH6 A;  1TKX A;  5HLF B;  1I51 B;  5EWF A;  5HI7 A;  2AYE A;  3N6N A;  1AW0 A;  2PI4 A;  4NLU A;  1UJ5 A;  3KLG B;  4DPX A;  4G1P A;  2OFH X;  3BPD A;  2B4V A;  1J5O A;  2BW2 A;  2CPE A;  2FZK B;  5DO2 A;  4RUH A;  2QV6 A;  4ZPC A;  3DM2 A;  5AE3 A;  1GX5 A;  2CQ3 A;  3B4M A;  4DR6 F;  4WBF A;  2LCW A;  3AAW B;  1XR5 A;  2CJY B;  2N7Y A;  5IWA F;  4X4N A;  3JSM A;  2NS1 B;  2WVC A;  3BB5 A;  2W7O A;  4ZVO B;  2FJD B;  4IKA A;  4A8M P;  3HLU A;  3F56 A;  4A8F A;  1G2E A;  3BJY A;  4B3T J;  1G3O A;  1RWO B;  2DGO A;  1WDT A;  3QGH A;  2YWG A;  4DOZ A;  4EYI B;  1VLO A;  1C2P A;  4F3M A;  3R5J B;  4U6P A;  1BXN A;  2HGM A;  2HPU A;  2RAQ A;  1T9W A;  4LRE A;  4YR2 A;  1JLF A;  2LA4 A;  4ED2 A;  2EK6 A;  4CIO A;  1Y5L B;  5IT9 U;  1T9U A;  5A0Y A;  1S0V A;  1K47 A;  3UDL A;  4JV5 J;  4FXD A;  2HS3 A;  1RT5 A;  1YGY A;  4R0J A;  3NGR A;  2FHM A;  4P2X A;  4CH1 A;  1LQ9 A;  2XS5 A;  1JLC B;  2ZM6 F;  3OTE A;  3TP2 A;  4DFK A;  1PAU B;  4H4O B;  3DHW C;  2GO8 A;  3DGP A;  4JV0 A;  4OFZ A;  2JC0 A;  3ZTR A;  3EVM A;  2V6A A;  3DRP B;  3C3L A;  3IS9 B;  1BWE A;  2HKE A;  1VRT A;  5E2Q A;  3KHG A;  4QWB A;  2AQ4 A;  4DR1 F;  1X5T A;  3CMA S;  4DG1 B;  3ZZR A;  1AB8 A;  3OHA A;  3W5X A;  2GQ2 A;  1FES A;  3B6B A;  4GVB B;  2IJR A;  1RWK B;  4EWT A;  1BY9 A;  2Q6C A;  1LFP A;  4AXJ A;  5AXN A;  4DSF A;  3LUY A;  3KLH A;  3MOJ B;  1FKO B;  4M8L A;  2YKA A;  4OX8 A;  4PZV A;  3QAE A;  3M7V A;  3I31 A;  3DDN A;  1DRZ A;  5A8K B;  3IFE A;  1DTT B;  4WYW A;  4YME A;  1KLM B;  2R2R A;  1JLB A;  5D4L A;  1U2F A;  3ISZ A;  5I42 B;  3C15 B;  4JI3 J;  2MPU A;  3HHK A;  3T5J A;  5F0U A;  2RE1 A;  3NAI A;  4UQT A;  1HWI A;  3WZ0 A;  3R8Y A;  2KL8 A;  1T02 A;  2PMW A;  1GAO A;  2CJ9 A;  3MM7 B;  3J81 j;  4QIV A;  1NK4 A;  2DRB A;  1SIW B;  3N0V A;  2DHG A;  2PGC A;  3R9L A;  1NKC A;  3NP5 A;  1LOU A;  3J81 Y;  4JI0 J;  1K73 T;  2WK4 A;  3L95 X;  3MM9 B;  3M8P B;  2KJW A;  4KPC A;  5ETL A;  1VLY A;  2E1M C;  3QO9 B;  3POT A;  2XYH B;  4F02 A;  2BQU A;  1X9S A;  2R7T A;  2YNF A;  4CTA B;  1X4F A;  5LXR A;  3IAM 9;  3JSY A;  4AQY F;  1HYS B;  3HMJ G;  3P8B B;  4H4M A;  3MR2 A;  4J9Q A;  5D4O A;  3NL0 A;  1A0O B;  1AUS L;  1TV6 B;  1TZ0 A;  1V5V A;  1H6K X;  2QLW A;  1Z2Z A;  1SQG A;  3WBZ A;  3J7Z T;  4KV8 B;  4O3N A;  2X7I A;  2MQN A;  2XY6 A;  2C22 A;  1KHV A;  5D3G A;  1HBM A;  3K8W A;  4WZM A;  2V8P A;  3BRE A;  3IP0 A;  4YHH J;  1IM6 A;  2CQI A;  4X4P A;  4EZ9 A;  2XS2 A;  1JLQ B;  4K2J A;  1RHU B;  3HK2 A;  1KVI A;  3ZZP A;  3P4U B;  2CNK B;  2P9G A;  1T3N A;  1S9E B;  2G2Y A;  2BAN B;  2RH3 A;  2ALY B;  3BR9 A;  4BS2 A;  4I56 A;  1IKW B;  4PRF A;  1FRI A;  2K7J A;  2EEY A;  3D67 A;  3JQK A;  4LSL A;  3Q2T C;  2E7X A;  3RJM B;  3MR3 A;  1H74 A;  2I5J B;  2UXB J;  1RAA B;  3ITH B;  3D3C J;  1HWL A;  4LR9 A;  4LFA J;  3ZTP A;  4LRA A;  4AYB D;  5KG0 A;  1HWK A;  2XHW A;  2IIH A;  4QWD A;  2XLJ A;  3DGV A;  3EM1 A;  3QQC D;  4K7Q A;  1S6Q B;  2DR6 A;  4OYP A;  3TX0 A;  4NLG A;  4QU7 A;  2J8S A;  1BC6 A;  3SBM A;  2W7P A;  3O44 A;  5GAG U;  4YB5 A;  3CXC R;  1R8B A;  3DFE A;  2B3T B;  4RNF A;  4JB8 B;  4RNM A;  1UJ4 A;  3T5K A;  2DH9 A;  1R6Y A;  2UZA A;  3C6T A;  2FHJ D;  2GML A;  2KB2 A;  1XIQ A;  3ENW A;  3HSZ A;  3DNC A;  4KFB A;  5DZ7 A;  2BOA A;  5HAT A;  4ZHR A;  5G4D A;  4DL7 A;  1XNQ J;  3CD5 A;  4C98 A;  4ZVH A;  5B0D A;  5CYJ A;  2PE8 A;  5JVH Q;  1R8A A;  2HUR A;  3D2W A;  1M1G A;  2R42 A;  2WBM A;  1XR7 A;  3FEZ A;  1XK8 A;  3PRD A;  3V6D A;  1KQK A;  4DL2 A;  4DFJ A;  1HNZ F;  4NZ7 A;  2ZZN A;  4QIF A;  3PJX A;  4NEY A;  4ETX A;  3OSN A;  2BJ9 A;  1H38 A;  4F50 A;  2NSB A;  3M2V A;  5A8R A;  4ED4 A;  1S0M A;  4WZQ A;  1TUG B;  4ED0 A;  5KFK A;  3DOK A;  4Q2L A;  4ZLJ A;  2NXE A;  4M5K A;  2PDA A;  3GJR B;  2V4J A;  5KAK A;  4WTY A;  4DV1 J;  2JEJ A;  1YKW A;  3ZZT A;  2GVD B;  4MKY A;  1IKY A;  3NS7 B;  3N79 A;  1YBT A;  4J7C A;  5J2P A;  3W3S A;  4DL4 A;  3EMT A;  3CPW R;  1RAG B;  1FRJ A;  2IM0 A;  5CCM A;  1WTF A;  1QY7 A;  2HND A;  2Y8Y A;  2DIT A;  1XNQ F;  1H73 A;  3DOL A;  2KKH A;  2JH3 A;  2LP4 A;  2ROG A;  5B0A A;  3UNY A;  5HMW A;  4OJ1 A;  4DUY F;  1P1T A;  1HNZ J;  2CDQ A;  2EFO A;  4W4M A;  4QW8 A;  1XWL A;  2G1H A;  3THT A;  1C4C A;  5IWA J;  3OL6 A;  1YK9 A;  2KVI A;  4ITS A;  5L1I A;  3W66 A;  2BJE A;  2RVJ A;  3K5M A;  4R5P B;  2DNP A;  3R1L A;  4DSI A;  3V4M A;  1ZA2 B;  1T11 A;  1EET B;  2LU1 A;  3QFH A;  2HVD A;  1S4F A;  2AJF E;  1P9Y A;  3AB4 B;  4AD6 A;  1RT1 B;  3TNV A;  3UNG C;  3BZQ A;  3ELH A;  1CVJ A;  2MGZ A;  3D6M B;  1ZM4 A;  3GV7 B;  4UF4 A;  4F4Y A;  4DG1 A;  1TEL A;  2KFN A;  2VDH A;  3TZZ A;  3D6F B;  5HMZ A;  4O4G B;  4WFY A;  1EB0 A;  3NG8 A;  3MEE B;  2IC3 B;  3DYA B;  4GKJ F;  2XCA A;  1ZBT A;  2ZWO A;  2F5G A;  2PD1 A;  1R0A B;  4USJ C;  3I0R A;  1J5O B;  4YS2 A;  2XS7 A;  5A8K A;  2V4R A;  2IJF A;  3PEH A;  1U6Z A;  5KFI A;  4WTO B;  2I2Y A;  1YJ7 A;  1GH8 A;  2B9X A;  1TL3 B;  1DHM A;  2JRS A;  4WCE Q;  2Z8Q A;  3CUN A;  4P10 A;  4C9D A;  3H20 A;  2DY9 A;  2G0C A;  2C3Y A;  3MMJ A;  4XAK A;  2H54 B;  4OZJ A;  4DEZ A;  1L3S A;  3A3O B;  1TMJ A;  1HD1 A;  2Z0G A;  1Z1Z A;  3QNW B;  2A1B A;  1URR A;  1VQO S;  3JTP A;  4PWD B;  4A48 A;  4KY3 A;  3OLB A;  1FTC A;  4KC5 A;  5KFC A;  1U4B A;  2CWX A;  2QEX S;  1VI7 A;  1RWN B;  4L3N A;  3UCG A;  5KFP A;  4NA1 A;  4IG0 B;  5GME A;  4DR6 J;  3DM2 B;  2MHN A;  1M5V C;  3LP2 A;  4LF9 F;  3M2U A;  1VOM A;  2DNQ A;  3BBC A;  2BMB A;  3B54 A;  3MM5 A;  4DCJ B;  3LWM A;  2KZM A;  1WD6 A;  3SV3 A;  3MUR P;  1TL7 A;  2GZO A;  4C3K A;  4ZIV A;  1SKR A;  3CCE S;  1IBK F;  1XER A;  2HHQ A;  2Z57 B;  4N8N A;  4NLQ A;  2I6W A;  4TLQ A;  1HBU B;  3P5B P;  3QMQ A;  1VQ4 S;  1FNO A;  4NZ6 A;  2E5J A;  2JEG A;  3MEE A;  5CZV A;  4CO2 A;  2E9R X;  3R6G B;  3J7Y I;  4O3Q A;  1H7X A;  4OZL A;  2ZVS A;  2VFR A;  4RW8 B;  4S0M A;  2K7K A;  4YB1 P;  1RWU A;  3KG1 A;  2MZQ A;  1VQK S;  2ZUG A;  2FLL A;  1HI0 P;  2HLU A;  4DX5 A;  5GMD A;  2Q43 A;  1VC6 A;  1N48 A;  4ED5 A;  3JQM A;  4RW7 A;  1S1W B;  2AGO A;  2HHW A;  2FYX A;  3PW7 A;  4E2F B;  2EBE A;  2ADB A;  1YJT A;  2UV8 A;  2C2R A;  3DMJ A;  3AJ1 A;  3G6X A;  1TK0 A;  2FVQ A;  2OD6 A;  2W2O P;  3HSD A;  2JL9 A;  2MKC A;  4QPT A;  2FVP A;  1X9M A;  1FEE A;  1HMV A;  2I9S A;  4LQ9 A;  3NNA A;  4JBC A;  4Z37 A;  4ERD A;  3POT B;  4P2F A;  2CAJ A;  3F73 A;  2ZH6 A;  3S6E A;  1VGY A;  1JLA B;  4IRD A;  3D3B J;  2HS4 A;  1X4D A;  3IGV A; 
#chains in the Genus database with same CATH homology
 3CO0 P;  4JP8 A;  3VV2 B;  3SQO P;  3A3N B;  3A3O B;  1R6V A;  3T41 A;  1SCJ B;  3GCX P;  4YN3 B;  2W2Q P;  2W2N P;  4NMX A;  3WHI A;  1ITP A;  3BGO P;  3WIU A;  2W2M P;  2W2P P;  2Z30 B;  2ZWO A;  2PMW A;  3WIV A;  3AFG A;  2W2O P;  2Z56 B;  2Z58 B;  2Z57 B;  3GCW P;  2Z2Y B;  4K8R A;  3H42 A;  3A3P B;  3VHQ A;  1SPB P;  3P5B P;  2XTJ P;  4NE9 C;  2Z2Z A;  4OV6 A;  2ZWP A;  3CNQ P;  3QFH A;  1V5I B;  2QTW A;  2E1P A;  3BPS P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...