3H42A

Crystal structure of pcsk9 in complex with fab from ldlr competitive antibody
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title From the Cover: A proprotein convertase subtilisin/kexin type 9 neutralizing antibody reduces serum cholesterol in mice and nonhuman primates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 21
structure length 92
sequence length 92
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3h42A01
2PMWA 2W2OP 3VV2B 2W2MP 3WHIA 2Z58B 4NMXA 2E1PA 3CO0P 2W2PP 3H42A 1SCJB 3GCXP 3A3OB 3VHQA 2W2NP 1R6VA 2Z2ZA 3WIUA 2ZWPA 2XTJP 3A3PB 4YN3B 2Z2YB 3BGOP 3GCWP 2Z56B 2QTWA 4K8RA 3CNQP 1V5IB 1SPBP 2ZWOA 4OV6A 4NE9C 3A3NB 4JP8A 2W2QP 3T41A 3AFGA 3BPSP 3QFHA 3WIVA 2Z30B 3SQOP 1ITPA 2Z57B 3P5BP
chains in the Genus database with same CATH superfamily
1R8BA 1RT3A 1F9EB 4RW6B 3A13A 4DWIA 3W5XA 3EDQB 3MECB 1UFLA 4AUKA 3DLLQ 1I6JA 1NZAA 2K8GA 5GAGU 3HSZA 1BQNB 4XK8C 2YPYA 2IJRA 3OFEA 2DR8A 3CDAA 3VAMA 5KFKA 3LANA 3QRPA 3MZIA 4DL4A 3CT9A 1RK8A 3K2YA 5AJ3J 2IMOA 3GWCA 3PJWA 1H2TZ 3PTWA 5KT6A 2J9DA 2QT7A 4DFKA 5B08A 3LP0B 4UY85 4DMZA 4NRTA 1D9DA 5T41A 2GMJA 4ES2A 5D6GA 3TOQA 1NKCA 3DLKA 2A6MA 2FVPA 4AD6A 1NDPA 1HHQA 2ZBRA 4CIOA 4ZN1A 3AH6A 3MOZA 2V34A 3GIJA 4J9KA 2DEJA 2C3OA 3ILLA 2Q6CA 2ASJA 2NYHA 4GKJJ 1WG1A 1RT1B 3NBPA 2DR9A 3HKZD 1H3DA 1J5OB 4RPFA 2RF2A 2H48B 2QG9B 3H90A 4K4VA 2HVHA 2E5HA 3QIPB 4ZP6A 3R6LB 2EFOA 3Q0AA 3KLHA 2NXEA 5J2MA 4KH0B 3KLGA 4ZPAA 4YN3B 2BANB 3E8OA 1NB7A 3HDSA 4K8RA 5AE2A 1IR1A 1DZ5A 4M5NA 3TA1A 1RA7A 2RU3A 4OYZA 1V3SA 1HBNB 1VRTA 3DLGB 3R5CA 4ANEA 2UVVA 4OZ3A 1NJXA 2XY7A 7FD1A 2DNMA 5AXLA 3PHTA 3U27A 2YH1A 2XMVA 3GLJA 2JL9A 3MPUB 1SVDA 1RT5B 1RWOB 4FN5A 2CVEA 4DS5A 4ES3A 4JBCA 2X1AA 1ZA2B 5D4PA 1XBWA 1T3OA 5KG7A 2AGPA 2QYCA 1AZSA 3IM8A 3MI7X 1Y9OA 4ED5A 5ETRA 5RUBA 5K5MA 1X5OA 3BPSP 2FY8A 1R0AA 3DLBA 4RLEA 5DQHA 3GB0A 3T1HJ 1OYDA 2QV6A 2OPSA 3Q8YA 2HS4A 1SPBP 5T7LB 4QYRA 2HQDA 4LF8J 4DX8H 2E5LF 2CQCA 2D41A 4A47A 2DNRA 2HNYB 2HFUA 4O44B 1NMEB 3MMBB 5E33A 4LF4F 3T9ZA 3IBWA 3O5TB 1BQMB 5L9NA 4C9DA 4USTA 1SJRA 5IS2A 2M70A 4FYYB 1Q7LB 2OKQA 3AQPA 3PHEA 2PI4A 2F3JA 1PKUA 1YZ6A 3LAMA 4C0BA 3CMES 1MROA 3RJMB 3MURP 2L9WA 4DCJB 4FF4A 2KTQA 3PRVA 3UI3A 5K14A 1PAEX 2EG2A 2M9KA 4EI2A 2E44A 4MKYA 2AJQA 1WHYA 2ATCB 2XS2A 1UPMB 1APSA 4U9RA 4IG0A 5HVHA 4WYWA 4ED7A 1X4DA 3VQSA 3CCTA 4AL7A 2KYXA 2ZH8A 3TX8A 5JJBA 4GO7X 2F7VA 4DV1J 1RWVB 2ZWPA 3PX0A 3B4DA 4F4AA 3EXCX 3EJMA 2ZH5A 1EQMA 1U1LA 4IOCQ 4IOAQ 3ZZOA 1CJKA 2PN6A 2I2YA 2W7OA 5HL7Q 4IDKB 3OL6A 3ET6A 2FD2A 2XTJP 2JWNA 3NCRA 3MCNA 4AL5A 1HMVA 4DV2F 3EICA 1MU2A 2ZZMA 4JI7F 2GW8A 2B9WA 2DRDA 2FJDB 3R5GA 3DRPB 4PWDA 3UD3P 1VGYA 4HDHA 3GIRA 2VPYB 2A2CA 4KHRA 4F4XA 2QL5B 4X4UA 3DRYA 1T9UA 3W2VA 2XSJA 4RW9B 4JI3F 1X4HA 3C19A 4CRJA 4OQJA 2VQFJ 1QM9A 5D0GA 2EC2A 4ZVEA 1FVSA 3QWUA 2ZH7A 4ED1A 3QT5A 1IKYB 5EUHA 4OX7A 3V2UC 3AB2B 1U26A 3M8QA 1Q78A 2R2RA 4HHHA 2Y0BB 3DGPB 1WACA 4PZVA 1X60A 2FLPA 3ISNC 4JV1A 1M5VC 2AEMA 4UUXA 4K2JA 4DR3J 2JX2A 3IR7B 1FFSB 4LREA 1RT6A 3ZXWA 2AX1A 5E3CA 2OPQA 2GHPA 5DM7Q 3IXQA 3M6VA 1U0HB 2RQMA 2ZH2A 2WB1D 2OPRA 3R7BB 4JI6J 2ZKTA 5D77A 4KRWA 4USUA 4EBEA 4OI4A 4DV0J 4MIBA 4WK3A 4ATNA 2VB6A 4FYVB 5F8MA 1UP1A 3D54A 1RACB 4TLRA 4Y28C 3S1TA 4DL6A 4I69A 4RJVA 1HL6A 4JI1J 2MSSA 3BQ2A 3KXDA 2BUNA 1SQFA 1D0EA 4KJIA 2F5GA 1D8ZA 2DGTA 1N88A 2EKYA 4DV5F 2VOPA 1PIEA 3M32B 5DDQC 1T05B 1KQFB 4EUVA 2KU7A 2R7VA 1YSJA 1J5EF 3G82A 2X3DA 4B9NA 4OZJA 2M3DA 3M05A 4Y2CA 3VF0B 3L95X 4PXBA 2OIHA 1SUQA 2CIMA 3UCGA 4WP3A 1QE1B 2HLUA 4K4XA 4C8LA 2ZBCA 4FXVA 1IJFB 2Y9HA 3D9BA 1JLEA 2I6WA 1XWLA 3ITHB 4NLXA 1V3ZA 2RNEA 2CA9A 1RHRB 3EPGA 5HP1B 4DOZA 2ASYA 4FS2A 2J6UA 4ECQA 1RTIB 2GHVC 2AJ2A 1IBMJ 2Z4PA 1MSWD 3H4DA 3CJQA 1N5VA 4EO6A 3BGRA 2OTLS 5A8WB 1FJGJ 1NKEA 2RUGA 4W90B 2D9OA 3MR7A 1FEHA 3ZNJ1 3TUIC 4WXOA 4H4KC 1KQSR 3IGNA 1N52B 4JP8A 3ZC4A 3H0PA 4CNZA 3TANA 5DS7A 3NEKA 1NLKL 2OFHX 3CCSS 2Z56B 2BABA 5HQ8A 2D69A 1RYRA 3CIZA 2H54B 3W61A 2LP4A 1RWPB 1EX8A 3C14A 3IWXA 3A3OB 1REVA 3RBDA 3P3DA 1X5SA 1QSYA 2AQ4A 3IBFB 2GVDA 2JLFA 1WOPA 1XMOF 4GC7A 1HHTP 2LQ5A 4LF6J 3I32A 2OP5A 2AJFE 3MR6A 3R97A 3H59A 3TVZA 1JNRB 1FK9A 3RYLA 3TYTA 1IKVA 3FNNA 4USKA 1IWAA 5C25A 1UJ4A 4DR7J 1YQHA 4Q2MA 4DR6J 1RTHA 2HW3A 2I0XA 4DU8A 3KDNA 4DN0A 4F50A 1TKXB 3QJPA 5BR8J 2F40A 1B7FA 4GVLA 2CPDA 2RT3A 2XWYA 4MK9A 1RUSA 3ADAC 4MMOA 4M5DA 1VHIA 3HHKA 2RSQA 3QBCA 1S79A 3HPOA 2WTFA 3UDCA 1YJRA 1EZZB 3CIMA 1VQSA 2R2TA 3BGUA 1ZETA 1N32F 4UTGA 1QY7A 2R7SA 1HI8A 1WI8A 2C3UA 2WBRA 1VLYA 2KXNB 1P9YA 3BBCA 3NP5A 2DD8S 4ED2A 2XLIA 3R5BA 1SKSA 3TJ9A 2GIRA 1P6TA 3C6UA 2KHDA 3M8WA 1TK0A 4CLLA 2ZHOA 2CAJA 2K1RB 3TQEA 1S99A 3M6UA 2F8EX 5HROB 2YNIB 4KGZB 4DUZJ 1SJFA 3J7YU 2DITA 4RUAA 1XK8A 3WDOA 3N79A 1U24A 2PFFB 2FJXA 2HHPA 2ZVIA 2LMIA 1KVIA 1NZ8A 2EC0A 4DUTA 3I4PA 2QFJA 1FVQA 1LFPA 2DXDA 4NPOA 4NRUA 4JI0F 5H9EJ 4WU3A 2C28A 4MFBB 4YDDB 2Y8WA 3KUGA 2AYBA 3ISZA 4YR0A 3DOMA 4OYXA 5IT0A 2KJVA 2J7WA 4URGA 4X4VA 3WC0A 2UUTA 4DSFA 2HGMA 2WCXA 1HQEB 4RW4A 4PQAA 2FJBB 4F8RA 3BREA 1QUVA 3EVMA 1FXDA 1Q8LA 4DPTA 1RZMA 4KSEB 3E01B 4ZVPB 3LUYA 4FBUA 1FRHA 3UPFA 1Q86T 4H4KA 3SFUA 1P27B 2VV5A 3K89A 1NK8A 2OUGA 1FD8A 2I1RA 3OJSA 3DRRB 4WPAA 3HD2A 2CZ9A 3O8WA 4ZA1A 2DGUA 1KLMA 3IG1B 4JV2A 1RB0A 2HVDA 4L72B 3BKTA 4ETXA 5IWAJ 4DG1B 1TAQA 5C42B 1N34F 4DV3F 4QIGA 4M5KA 2XSFA 2W9AA 2O1PA 5C24A 3L3CA 4DR5F 1X9MA 3AA8A 5DZ7A 2CG4A 3GSDA 4JI5F 3JTOA 5HBMA 3TAMA 1PBAA 1SCJB 1WKJA 4KBIA 3DDKA 1M1HA 2IHR1 4C6AA 4ZCIA 1RAIB 4PWWA 1XTZA 5H1SV 3D7SB 2GJFA 1SL0A 1SC1B 3M2VB 1PGZA 1UZDA 3FRYA 5CABA 4M5IA 4NA1A 1S9FA 1GK8A 5KFGA 4F3MA 3B4MA 2OI2A 1WELA 2VPWB 1HWJA 2XHWA 2G2YA 3M30B 3KJVA 2WSEC 4IKAA 4F4YA 4F4KA 3CCUS 2R7TA 2QLJB 3KMQA 4NLPA 2JFKA 5HK4A 2XCPA 4AQYF 1IKWB 3QO9B 2F4FA 4ZJLA 4WXWA 2HQ3A 2G2ZA 4HYKA 2JFDA 3TEHB 2FLOA 2BW2A 1OIAA 4DFPA 3MM8B 2XC9A 4NL5A 1HLWA 3HVTA 5IV4A 2F9DA 4DU7A 3MPVA 4GO5X 1WI6A 3T1AA 2EVZA 4EBCA 2HBQB 4I2QA 3LH2S 1UEVA 2PGCA 1YBTA 4DPYA 2N3LA 3TAPA 3IMQJ 3PKYA 1HNZJ 1RHJB 1YRXA 2JLGA 1Y3KA 1L3TA 1OPZA 3FCVA 5EWEA 1OWXA 4JI8J 4YB6A 2DPIA 2XEXA 1FKPA 1C0TA 3FSIA 1Q53A 1NUEA 1YBUA 1FKOA 2V8HA 3VAJA 3AFGA 1RWWB 2GJIA 4QIFA 3I87A 2ZOMA 2DGOA 4B3MJ 3HT3A 4AT1B 2MHEA 4FXDA 1FFWB 1Q8KA 5ETLA 4QPXA 1SKRA 4L6V3 3SQOP 5HLFB 1LW2B 1UWBB 3ISND 3C16B 5B0GA 4DV4J 2GC8A 3TO8A 4ZIVA 2OH2A 1XR6A 1IKXB 4X84A 2IRYA 5LSOA 4B9VA 4OZ5A 3Q8VA 4ICLB 4DQIA 2V8VA 2VIHA 1UKUA 1JLBB 2CQGA 2IDLA 3CD0A 4FZVA 1VQLS 4GVBA 4URSA 5DO2A 2IDEA 2XLKA 2MMYA 4HL9A 2IY5B 3QFHA 4FNHA 4NWBA 2LQJA 4NLYA 3P49B 3S8SA 2KL8A 3E51A 4OYPA 1SKUB 2E5GA 1UETA 4IH5A 2XMJA 3M8ZA 2OEKA 5HQLA 3MTJA 2YKAA 5F0WA 3U1LA 1VRUB 3CDUA 4NYOA 4YR2A 1FCAA 2V9KA 1TMJA 1JKHB 3HFVA 5F8JA 4JI2J 3FVYA 3MUTP 3BGFA 2MXYA 4M5GA 4LSZB 2HWTA 2UV8A 3UDLA 3MEKA 3V81B 5FDLB 2WSCC 4WU2A 1BUXA 3WZ0A 1WWHA 5A2QY 4CWBA 1PJ5A 2FHJA 3GU0A 5I3QA 3R5JB 5F41A 1JLAA 4DR4F 3GTYX 4QWAA 3PX6A 2CQPA 1A7GE 5HANA 3RR7A 2EXUA 4FDFA 4UZBA 3OV7A 4FPIA 1M5PC 1S1WB 2UXDF 2QSFA 4C11A 1NXIA 2PSZA 1NSAA 1KEKA 1HWKA 2YKMB 2MLXA 1SC3B 2BXJA 3D0HE 3O1LA 2VFVA 4C8OA 3PEHA 8RUCA 4OFZA 4RU9A 2YQ3A 3O2IA 3CJSA 2OMOA 4NLQA 2WVDA 2GQQA 3ZZ0A 1HW9A 4Y3CA 3UN3A 3MPDA 2M4MA 2ZBQA 1SIWB 2DK2A 1U47A 2M52A 2HHHF 4G1PA 2DNZA 2V2KA 4MIWA 5L1JA 4QYZJ 2ZNYA 1D9FA 2R3VA 4G1IA 1NK4A 4KYZA 2AP6A 4YDXA 3HZEA 1EB0A 3EPIA 3PX4A 2EG1A 4S0MA 1JLFA 3PVXA 5L46A 4ERDA 2UVWA 3GCXP 3HHLA 5GAEI 4L74A 4H54A 4CO4A 1LV5A 1T9XA 2CQ1A 2BDPA 2ZNZA 1GFWB 3CJKB 1TFYA 3CD5A 3QLHA 3W2WA 2DHHA 2NUHA 3FMWA 2PD1A 3V4MA 2ZM6J 1VJQA 3AAWB 2C1EB 3P8BB 3KHLA 1XNQF 1FXLA 1YRUA 1LW0B 3QSYB 3X1LB 2CQ2A 2XO7A 3R27A 5KG1A 5A8KB 4URQU 1PCAA 3BBFA 5G0RB 3UDEA 2H65B 3PY8A 3OR1A 1L3VA 2M8HA 4G1QA 2ALYB 2FIUA 4HH1A 1NPRA 5IFMA 4Q45A 1AUSL 1S1TA 3DOLB 2AEFA 3U1MA 1EP4A 3QIDA 3M1VA 4PXEA 5HSPA 4Z7YA 4IG3A 2ZH4A 4OV1A 2OJ3A 2W9CA 4PQUB 4ELVA 4TU8A 4B02A 5D15A 1RT3B 5MAOA 4NZ0A 3VAIA 2QIFA 2B9EA 3GILA 3BR9A 1YJ7A 2DJWA 3MEGA 1QTMA 1S48A 1LKZA 4KO0A 3KHHA 3TA2A 4ILLA 2MKSA 3OUYA 4WZMA 3IRXA 4ZLJA 4LVOP 4P74A 3WQPA 2WVBA 4OYOA 1PO6A 1M5HA 3K5NA 2PO4A 4P7VA 4CLZA 4I56A 2ZITA 4AFFA 5I4MA 3ILIA 3CCJS 4P73A 3P6YC 4ZVHA 3LO3A 2J0QD 2EFQA 2C2RA 5C5JA 2HVZA 1NK9A 3VHQA 4R8UA 1FA0A 2OGUA 1KWMA 2VUGA 2I5JA 3DLKB 4C8ZA 4A8MP 4YEAA 4QWBA 3CJTA 4N8OA 3J7Z5 4QR2A 2FTRA 3OHAA 4A8YA 2Z0GA 2Y0SD 1LXNA 3NBPB 2MLZA 2ZUAA 3W60A 2RF2B 3RAMA 3QT7A 4O3OA 2C2MB 4QIVA 2G13A 3EMTA 1G3OA 3J7A1 7AT1B 4WFNQ 1RU1A 1DAXA 1HYSA 5J2MB 2YKPA 3KLGB 3MAHA 2ZE2A 3GFYA 3MMAA 1KFSA 1MMDA 3AXMA 3T5JA 1QAXA 2EKNA 2QN6B 2RS8A 1YKWA 1GTHA 3SFGA 3F41A 3V6DA 5KFMA 2KRBA 5ITHA 1URNA 3ETMA 3V6KA 5J2QA 4ALZA 4OI3A 1VRTB 2QA2A 1NDKA 3G4SS 2VD3A 1WKKA 1O6XA 3FQLA 2BQUA 1T94A 1FT8A 3GG0A 1KHWA 1VQ4S 2JJ4D 3LWLA 3NWGA 3RW7A 3Q22A 3OBIA 2V8GA 3S7RA 1GNKA 2CWKA 1DHMA 3D5MA 2GS8A 2WVEA 3C6TA 3HVAA 2QA4S 5C2GA 2PMWA 1NK6A 2Z58B 3FKBA 2IVFB 3MR3A 5KFPA 2YKNA 4R5PA 4ZVTB 2VFUA 3OL9A 3C46A 5B0BA 2AJ0A 3EZOA 2LXIA 1AZSB 2K2PA 2ZHAA 5AXNA 2C2NA 3CD6S 4YOEA 1FRIA 1ZA1B 1R0AB 3HMJG 4JI4F 4ITSA 2KZZA 3RG6A 1PG5B 4F25A 2W4CA 3TX0A 1DTTA 2OPSB 3SCKE 2Q1LA 4XDDA 2RAQA 2KT2A 4ZJQA 1RCOB 4N77A 1H98A 1WC6A 4KKOA 3O44A 3SZ2A 3TR5A 2J0SD 2FC9A 4OV6A 3BB5A 4B08A 3M7VA 4HKQA 4YQWA 2R9LA 5F8HA 5G4DA 2VKZG 4WKYA 2FDNA 2C3PA 1YI2S 2NCKL 3TZXA 3QFWA 4YMEA 1OQ3A 1S9GB 4DR2F 1T9TA 1VJWA 4O4RA 5CQGA 1IM4A 1L3KA 3W65A 1A9NB 2IM3A 2DKOB 1HR0F 4DX7A 3I82A 3JAMY 5K14B 3MR2A 4P72A 4K5SA 3OXFA 1NSPA 4EZ6A 1RA6A 2J8AA 4IG0B 1FF2A 3AJDA 4L3NA 1TKZB 1TELA 5THWA 2D1CA 3K17A 4OYMA 3WC2A 4RWXA 1S5ZA 4EK2A 5BJRA 3W66A 1Q5VA 2YWHA 3TA0A 1YK9A 1C1BB 1F60B 2LECA 4PWUA 1R43A 3HZGA 1AB8A 2XMTA 3I4HX 4IRCA 1CJKB 3LP2A 4N41A 3UW1A 2V50A 3ET6B 2FZCB 2EFPA 4ID8A 4ZLPA 3CE8A 2BKNA 4UOGA 1HMVB 1MU2B 1HW8A 3GIIA 4AL6A 4IFYB 4PWDB 2I38A 2IVYA 4OHYA 2MKJA 1AUDA 3QWPA 3BJYA 2X51A 4NLUA 5HJXA 2RDDA 3W2VB 4DS4A 2XSJB 4J9LA 4X65F 2BRKA 2QTWA 4BWJA 2UU9F 4X4TA 1HBOB 3MEEB 8AT1B 2ZH1A 1F5BA 3B6BA 4C8KA 3TP2A 5DDOC 2V6AA 2IM1A 2HIYA 3G6XA 1U6FA 2IIHA 1VMBA 4WFBQ 1CC8A 4C98A 1WC5A 4B9LA 1X4EA 4CLWA 1JLCA 2BJ9A 2E5LJ 2BE7D 2LXUA 1TKDA 3J81j 5FLXU 2MQOA 3QSIA 3NS7B 1JJ2R 3E2EA 1DTQA 1MMNA 4X62F 2JSXA 2NXNA 3W7BA 4X64F 4FS1A 4WFYA 2CNOB 1RT6B 4NEYA 2OPQB 2VFTA 4C8YA 2OPRB 2FZGB 3L09A 3R5AA 5A6WA 4ANCA 2DGVA 1VC5A 1HBMA 1U0SA 5GADU 4X4OA 3L9ZA 5LOQA 1RHQB 3BN4A 3TQ1A 5B0CA 1S7IA 1CJTA 2ZBPA 4FKXA 5DDRC 1GMUA 2HSEB 1RQ0A 2J9CA 1V9OA 5GAHI 3CC7S 3H4BA 3MOJB 5KFDA 1S72S 4I1TA 2KT5A 5LMUJ 3CJ8A 3D66A 1YJWS 1IVZA 2GA7A 2VC0A 5K8MA 2FZKB 5LSLA 5HATA 3GV7B 1F1BB 3LQVA 3S6EA 3G82B 2Y8YA 3MUVP 3OSNA 3H5XA 3CDBA 3MXHP 2J6SA 1SUQB 3N6MA 1NHVA 5ETSA 3P96A 4JI7J 4KV8A 4UF4A 1JLEB 2Z57B 2DH8A 1ROFA 2FJEB 2V4JA 4ZJOA 2CPJA 1D09B 3W1YC 3OVAA 3JB9k 1JLGA 3PR4A 3BH6B 2U2FA 2Q43A 2RIJA 4F2SA 1FRXA 1WKLA 4JI3J 4OX9F 4MKVA 4DBQA 2QSWA 3DU6A 1I1GA 5IQ6A 2V4RA 4NCAA 4HTIA 5FD1A 3M8RA 5DGBA 2IC3A 5FIIA 2N3OA 4U8YA 5KFTA 3IR6B 3HFKA 4ECSA 4LRDA 1QTNB 1T9YA 1N0UA 1WHVA 3T9NA 3RR8A 3C2PA 4ZDNA 2HFSA 4KHPJ 3TJ8A 5ETPA 4A8WA 3HSJA 4DN9A 4A48A 2BX6A 5LJ3Y 2L41A 1FRLA 3C14B 1DARA 1VQOS 5CH7B 1REVB 4KGMA 4ZLNA 3B54A 4I68A 2W7AA 4O0NA 2OTJS 3M9OB 2CYYA 1YDLA 2GVDB 4ID5A 1MW7A 1B0VA 4LSLA 2WVCA 4QWDA 1VLOA 4WYLA 4J5OA 1XJWB 1FK9B 2Y3YA 1IKVB 4JB8B 2L08A 3DDIA 5C25B 3MGJA 3PFOA 4Q8EA 3SXLA 1GMWD 3B8HA 1G2EA 1RTHB 2HLTA 4DV5J 4Q8FA 4USWA 3HJVA 2LDIA 2JC1A 3GJRB 4GKJF 3NOGA 4M5DB 1AW0A 1J5EJ 3CULA 5HJYA 3FFIA 4DL7A 1R0CB 1SBRA 4NCGA 1BD6A 2FLNA 2P9EA 4C3MA 1R27B 3NNAA 4U8VA 2VODA 4O0IA 4TY8A 1RAGB 4UZCA 2G0IA 4P6QA 4O3PA 1QDUB 4Q43A 1YIJS 2HNZA 2KJWA 4C7QA 2AYMA 4PEOA 1FE0A 2HIQA 3GJTB 1BXNA 4FNIA 4ZPWR 2VKRA 5DQGA 2LQ8A 2BOPA 4DPOA 3C6UB 5KFZA 3ETOA 3A8IA 2UUBJ 4U95A 1IBKJ 1KC8T 2B9XA 1RJJA 1JXEA 2DEIA 3FRZA 1TKTB 3TWZA 2A1BA 4YR3A 2HBYB 4N5SA 5KFXA 1HNIB 3MCSA 3J81U 2E29A 1B0PA 1WF2A 1KN6A 2MEWA 1K47A 2YX1A 1WC3A 4J9UE 2KH9A 3PW2A 2PFDA 3KK2A 3M8PA 1R7IA 4XDCA 1Q82T 1X4AA 2WONA 1SIZA 2QRRA 1A6LA 3NXZA 1HNVA 1YJ9S 3G9CA 3T1HF 1RT4A 3DOMB 2C2EA 1KLNA 1KOHA 3BKUA 3O3LA 4LF8F 4LF5J 1XMOJ 1RAJA 4R25A 5D0HA 2GCFA 3EZUA 4RW4B 1YITS 4NASA 4FXWA 1U6BA 2GIQA 4BBYA 1RCXB 4DSJA 1HD1A 5EWGA 2RILA 2GAHC 2HURA 1QSLA 1BWVA 1NH8A 2EFGA 5KFLA 1UPPA 3Q83A 2BJ1A 4PPZA 1K8AT 3G6YA 2AF6A 4OZNA 4IRDA 3OFFA 2MQNA 3Q8UA 1XQIA 3ZZZA 1R3NA 5ETTA 3DMJB 2BJ7A 1QUPA 2QZ8A 1KLMB 4GRSA 3I5AA 2V2VA 3GV5B 3N28A 2W7PA 4I7FA 2ZJRQ 4ZMMA 5C2CA 1U1KA 4YHHJ 3R2DJ 3N01A 1N32J 2RQCA 2DGQA 5F8IA 1JIHA 3LOUA 4DV1F 1OPIA 3AOCA 1HNWJ 4DEZA 4DXLA 5GMEA 3AD9C 4YY3J 2DH9A 3RW6A 4LR8A 2IMWP 3MTKA 5C24B 3GFZA 3UCZP 3DLGA 2XS5A 4IFVA 4ELUA 5L1IA 3BO3A 4L75A 4C97A 5HBMB 3DLHA 2DY9A 1U1MA 2ILZA 5D0EA 3BO4A 3UWTA 3PZPA 2DNNA 4H4OB 4FKYA 2HRTA 2F1FA 5E2QA 3BKFA 2E1PA 4DF4A 1YJUA 2DXEA 4PUOA 2MZQA 4LUBA 2RUSA 1RAFB 2YNFA 1UTAA 5GAEU 2CJBA 4PG4A 3D6HB 3GFXA 4EZ9A 1RHUB 4KAIA 3KJVB 3KTQA 1IBLF 1M1KT 3NMRA 4NYPA 3BSOA 4JI0J 4TKTA 1C4CA 1SJ4P 5AT1B 3LA0A 4OX8A 1NKBA 3JYTA 2YKQA 2CFXA 3G6ES 3ZFVA 4Z2XA 5D4NA 3HVTB 5E3QA 3RBXA 2HAIA 4ZKAA 4V19X 2RS2A 4O44A 2F4VJ 4QU6A 1ELOA 4I2QB 1TL7B 1ZAWA 4DR3F 3HHDA 1T95A 1ZZFA 5D78A 2XMWA 5JVGQ 3EWGA 4HH0A 4NXNJ 2NPFA 4CM2A 1VDHA 4CDIA 4PXDA 4D3HA 2NR0A 1FKPB 3NGTA 4C2MA 1FKOB 2DPJA 4TN2A 2N7CA 4ILRA 4JI6F 5KFEA 3NGKA 2B0GA 1U2FA 4RU2A 2PI5A 4ZK7M 4DV0F 4WFZA 1X7VA 3I55S 1UEUA 3PYDA 1WORA 2HGNA 3QRRA 5ETVA 4ECWA 5B0DA 1NBEB 2CXEA 1F2HA 1N5SA 4F4WA 3AD8C 1SJ3P 3NWRA 1H72C 4MK7A 1NJZA 3BDPA 4DV3J 2VASA 3BSCA 3CNQP 2DO0A 4DR5J 3K58A 2NSBA 4GVBB 4OX6A 1OSDA 5EX3A 4A8FA 4Y34A 4JI5J 3EGWB 2HGLA 1OYEA 3FZBA 4WTOB 1W25A 5GAGI 2RKIA 3ZO7A 2W8LA 1S57A 3OSPA 1JXLA 1TZ0A 2DHGA 4ED8A 1RAOA 3K57A 3NGDA 2VONA 3JSYA 3PO5A 3KKFA 2BA9A 2W2QP 2RDJA 1FJGF 2W2NP 2DVIA 4RW8A 4TU9A 1UWAA 5BYSA 3VCDA 1IKYA 1LNQA 1JLAB 2GZOA 3CCRS 1KHVA 5KFSA 2C22A 2JH3A 4C48A 4PR6A 4K50A 1YJNS 3DGPA 5DLGA 1N8RT 3U02A 3HCXA 2GHWA 1ZM2A 3LWMA 3MD3A 3GYGA 1S4FA 4WWSA 3I0SA 2FJVA 3GYXB 1B4SA 4KGXB 2GV1A 2M7SA 5LMNJ 4C11B 2EPIA 2YQ0A 3NKYA 1KKHA 4DPWA 2DT9A 3VVTA 1U09A 3KHRA 3JXOA 3VR1A 1VQ7S 2AJ4A 4X66F 1VQ9S 3Q8QB 1P9QC 4O3SA 2UXBJ 1Q7YT 4QWEA 5D3GA 1N5YA 2H5EA 2R8KA 1MMLA 1NNDA 2F65A 1UL3A 1ULRA 1SH2A 3A8EA 1Y5LB 3MM9A 2KO1A 4Z7CA 1LFWA 1SH3A 5IT9U 5GMKa 2HQCA 1TFWA 3T1YF 1WF0A 4DR7F 3VGUA 4DR6F 2ABYA 3V6HA 3G2XA 3HSDA 1R8HA 1XNRF 2W9BA 3FEXB 2CJQA 5BR8F 4OZ1A 2R7XA 3CJ0A 1AXQA 2LKZA 2HZCA 4F4ZA 2VL1A 2DIUA 2DNHA 1JLFB 4WE1A 1WC1A 4B3TJ 1NDLA 5IM0A 2FB0A 3DC2A 3QZ7A 5ETQA 3HHLB 3A4TA 1QE1A 4F0MA 2QL9B 5J1NA 4NLTA 2CDQA 2M88A 4U96A 2OD4A 4C0HA 2CNKB 1T8EA 3QLHB 3W2WB 5T14A 4ECYA 1VCTA 2F8HA 4JYAJ 3V4IA 1U8SA 2ZC4A 4ECTA 2ZEJA 1CBKA 3AJ2A 5KG2A 4ZOSA 2V94A 2AV5A 2ZD1B 5DQIA 3H25A 3HJFA 3KLVA 2AGOA 1IN0A 2B51A 2VA2A 3U7JA 3OR1B 4CYUA 4K4TA 1RTJA 2LEBA 4M5JA 4G1QB 3G6VA 4DV7F 1Y5IB 4PG8A 3W3SA 4ZVSB 5U47A 4DSKA 1G4CA 3IGVA 1S1TB 1LWFA 1HWUA 1TL1A 1EP4B 3L7OA 3M1VB 4N76A 4NLSA 5F3TA 4KFBA 4IG3B 3WIUA 1GH8A 2W9CB 1H73A 1AT1B 3DDNA 2OEMA 4KR0B 4JV5F 2Z30B 3BGLA 5E3AA 4C3KA 2GJ2A 3RRGA 1VQ6S 2H4WB 2QEXS 3MEGB 4TLQA 2YKOA 4ZPDA 3LTOA 1UAWA 3JSMA 4NYZA 4KO0B 1QD1A 1CS4A 2CJAA 4O3RA 6FDRA 2R8GA 2P6SA 5CYQA 3OUYB 3QATA 5CA5A 3IRXB 2FPHX 2K7KA 3Q89A 3CEDA 2MGZA 1U1QA 4IH6A 1S59A 2JDJA 3M8SA 1J27A 4UW2A 2HHHJ 1G1XA 2Q3PA 4N47A 1UVNA 2N4DA 4Y0FA 1NPPA 2B9YA 3FBEA 1VQPS 3FK4A 2QLWA 2DTJA 3FBCA 4QU7A 5CXTA 1RWMB 3R9LA 4CCHA 1I94J 2QL7B 2HMIA 3T6BA 2I5JB 4RL1A 4L3KA 4NLGA 4O3QA 1IM6A 5E41A 1HI0P 1NDCA 2HS0A 4YFUA 2VFRA 1OJ4A 2HBZB 1P8GA 1RTDA 4CH0S 1CJVA 2PEHA 3OXGA 3D6FB 1RGVA 5IWAF 3IWNC 4B3RJ 4HI2A 3F0NA 2COLA 5IZHA 2ZJPQ 2ASLA 4TYAA 4PG6A 2C2KB 1NRKA 3I9V9 2LU1A 2C42A 1ZYQA 2OPPA 1HYSB 4R0JA 1UZHA 3QAUA 2LDYA 4ECVA 3QT8A 3LW5C 4WJBA 2MZRA 2ZE2B 3F56A 2C2DA 5F0UA 3MMAB 4HT7A 5AXKA 3GCWP 2D7SA 2JVOA 2MKIA 3US5A 2NSCA 3V6DB 5J2QB 4KGVB 2XS7A 1GQEA 2C3YA 4A46A 3THVA 3KG1A 2F9JA 2DHAA 1N36J 3SIPB 3H40A 2YX4A 4DL5A 3UD5A 3GJSB 3J80U 2LLZA 3OVSA 4GKKJ 2G1HA 2MKKA 3LGMA 3O6QA 3C6TB 2ZHBA 4HR2A 4MFBA 1TVRA 2YKNB 4R5PB 2QFIA 4P52A 2MZTA 3RBEA 1NAQA 5KFUA 2MTLA 1CULA 4W92B 4F26A 4QPTA 2ZJQQ 2CPFA 3HLUA 3G8TA 4K0KJ 1NK7A 5EWFA 1HQUA 3N5BA 4PG7A 4BC7A 3D6MB 1E6VA 1BLUA 2Q79A 2G0JA 4I0WA 1DTTB 3HHNB 4WCEQ 3GIMA 3CCMS 2M8DB 1FRMA 1SKWA 2HFZA 4EO8A 4DLGA 4DLEA 4ED3A 4KKOB 3KDOA 2UUCJ 5EHHA 3RAQA 3EZ5A 4B3SJ 1TTHB 2CPHA 4B3MF 2CQ0A 1N0VC 4EWTA 1VQ8S 2QMXA 3IG1A 2WBMA 3AHPA 2BMBA 2I9SA 5HQMA 2HK2A 2E5IA 1M5KC 3MEDA 1S4EA 2R7RA 2RRNA 2B56A 2VBXA 6FD1A 1C1CA 2HQFA 5J1EA 4ZIWA 2HHQA 2CQHA 1TUVA 2Q66A 3T5KA 4LFCF 3GSIA 2YY3A 2PC6A 4NLDA 4DUYJ 2GMLA 3NY0A 3CMAS 4FBTA 2YNGA 2POKA 1HWLA 4J9PA 2W2MP 1EAYC 2ZZNA 3BBBA 4LRCA 3BH7B 2VOOA 1OQ6A 3LP2B 2H5JB 5HMWA 1WTBA 3ZZUA 2FGOA 3NOCA 4CLPA 1H2UX 4A8SA 1EJ7L 4X4PA 4DV6J 1YRTA 3PFEA 1OY9A 3WIVA 1GAOA 1AA1B 1PAUB 1S6QA 4XPCA 4C4WA 3QGPA 1DURA 3VTIA 1RAHB 4I4BA 1WF1A 2HZAA 4QW8A 3UVJA 1BGXT 3PEJA 3SEOA 3VAKA 3R1HA 5E5NA 1R8PA 4IH7A 2B4UA 2Z2ZA 3HKWA 4GMKA 1PYSB 3SI8A 5KFIA 1SQGA 1KRPA 2HQGA 1TK5A 2ALZA 1IQZA 3UR3C 1FRKA 3EGNA 2H4YB 2VF3A 1WG4A 5EDWA 1JLCB 4M5MA 4Y2MA 2D3O1 1ICEB 1FNOA 4PCQA 1LWCA 5IC6B 2UXCJ 1DTQB 3DI6A 3ELHA 2KM8B 3VGVA 4DSLA 2NQPA 1DJ0A 3GFHA 4RUBA 2NXJA 1U25A 3K7RA 5A0YA 3FEYB 1IWGA 3QGGA 1KBRA 3CCES 2HQIA 3RB3A 1Q8IA 3C16A 4A4JA 4QZVB 3W8PA 1H7XA 4DR2J 1S6OA 4NA3A 4DJBA 1Q4RA 4DZDA 1RWNB 3F44A 1CJTB 4PKDB 4CO3A 4IQXA 2B7BB 2DH7A 5K8NA 1I3OB 1FDAA 2XMUA 2H51B 3PDNA 4P10A 3KLIA 3J7YI 2N82B 1C0UA 4OYIA 5KFYA 4WKRA 2VC1A 5E7OB 2ZVSA 3FEZA 5F8LA 5KAKA 2D3OR 1HPZA 1UVKA 2FGCA 4I2PB 1KVKA 4LJMA 2BV3A 2GO8A 3PJ9A 5A76A 1WDTA 4LRBA 3VVUA 1O5JA 5I42A 2AU0A 2VU5A 1Q0NA 2ZM6F 2UUWA 4FYDA 1VRUA 2BKPA 5IC4B 1FXRA 3TEGA 3VALA 1RDRA 2EW9A 2M5YA 4DR1F 3VGSA 3VV2B 1T3NA 1RT2A 3N0VA 4J9OA 1ZOTA 4K4YA 4K4UA 3RRHA 1QAIA 1TMMA 4Z37A 2VG6A 3PW4A 2V4JB 3LGNA 4M8LA 1XMQF 4LR9A 2RRBA 1JLGB 2IYGA 5M2PA 1RLDA 1VIXA 2GQCA 2HS3A 1FERA 4QWCA 3OJUA 1FTRA 2VH7A 4C3LA 2UU9J 3F73A 3L7UA 1XERA 2VG7A 2CJXB 3CUNA 2GVZA 1WEYA 4MYTA 4OHWA 4YB1P 3D1OA 3CCZA 1UMJA 2Q6BA 2CNNB 2IC3B 3IM9A 1B99A 3PYEA 3LALA 1L3UA 2XQCA 1RKIA 3RTVA 4XPEA 2E1RA 4DQRA 2V63A 2KVQE 1RXOB 2N4CA 1NSKL 3M6WA 2A2DA 4Y2KA 3I0RA 3T3FA 5A8RA 2DGXA 2J9EA 4DZ6A 3Q2SC 3U1NA 4ES1A 2OO4A 2JEIA 2XHCA 1CQNA 2E1MC 3KNAA 3M2RA 2K06A 1EARA 2B8QA 4CNYA 4QW9A 4FYXB 2BOAA 3OR2A 4B9SA 3TAQA 1U1OA 2AW0A 2ZOGA 1URRA 3G8QA 3MFHA 5D4LA 1N6QB 2C3MA 1E6YA 5HMZA 1XN9A 1U45A 3C15A 4LSLB 1B7YB 1S10A 4OLPA 4RNFA 3DOKA 4LF7J 3EXYA 5DGAA 1NPKA 1RI7A 1KQKA 5A6PA 4KC5A 5M2RA 3MM7A 2YWKA 4NLRA 1EKSA 1IUJA 4RZRA 3FCHA 2WAQD 3EYZA 2DHSA 3CC4S 1KDNA 2VBYA 2VPXB 2OHDA 2VBZA 3GIKA 1FRJA 1LOUA 3N6NA 2Y1LB 5I3PA 2IRUA 3FFIB 2XLJA 2MQ8A 4NCGB 3QZ8A 3EDRB 3GR1A 5JVHQ 1YBAA 1FFGB 4AYBD 2XYHB 1S76D 1VS3A 2WZ1A 3I96A 4TY8B 4CLTA 2FHKA 1T02A 1U1NA 1U2RA 2HNZB 4G65A 4LBPA 5L1LA 1TUWA 1RT7A 3FUYA 4Y65A 2W4DA 4FYWB 1DRZA 4OX9J 1JLQA 5E3RA 3DLEA 3DYAA 3PG9A 4G3IA 3UNYA 3UE2A 1QJHA 2E1AA 3CSKA 4WIQA 1BWEA 1T7PA 3DHXA 4J7CA 4WFAQ 2AX0A 2LVWA 3RB4A 3P5TL 2E7XA 4OZ2A 2X7IA 1D3WA 2VG5A 3PRBA 3KK2B 3K0JA 3M8PB 4IYQA 1EKRA 4Y2IA 1T03A 3UQSA 5DG8A 4EBDA 3OQ2A 4ZCMA 3BO2A 2WONB 4QIEA 1WDDA 2Y1JA 1VC0A 1HNVB 4CI0B 3UO0A 1RT4B 2CADA 3KJFB 2GNKA 4XTTA 1NHKL 2CKWA 2V9WA 2ZH3A 1S1VB 2YXLA 2Z2YB 3TUZC 3NAHA 5KT7A 1S6PA 4ZS6A 3BV8A 4ZVOB 1BY9A 4UOCA 2O66A 3CJ3A 2LQBA 1NCLA 3NNHA 1RWKB 3N9UC 4K59A 3PKMA 2JOQA 4DCOB 2W8KA 4OYAA 1F5CA 5A2QU 2E5JA 2DY1A 3J7ZT 3M2UB 5KFBA 2Z8QA 2J7KA 4OJGA 3EX7B 2OLWA 2XCAA 1RHMB 3D3CJ 4OLOA 1UW4A 1UJ6A 2MB0B 4PXCA 1HFEL 5EGYA 4I7FB 4RNMA 2U1AA 3Q8RB 1HD0A 1UVJA 2YH0A 1DFDA 4PG5A 1N54B 3GZ7A 3C66A 1WG5A 1RSCA 1YHQS 3MM6A 1ZAXA 2AEJA 2GIFA 4RNHA 4TQRA 1Z2ZA 1SV5A 4DL2A 3FSXA 4IFVB 1JXVA 2ADBA 4I6WA 3KK3A 2BVZA 4EYHB 3CPWR 2KXHA 1F2GA 2B5JA 2HHVA 3OLBA 4NXMJ 1FWKA 1OY8A 3OTOJ 1RADB 1JMTA 3EGZA 1Y10A 2QC3A 2MKCA 5IT9Y 4DSEA 5KT4A 4PUOB 1LWEA 2VJVA 2HFVA 4NLWA 2CQ3A 3BPDA 4DX5A 5BXIA 2YNFB 4TVAB 2X1FA 1KFDA 2UUAF 2O01C 4HI1A 2B43A 2D74B 2WVFA 1KVJA 4U6PA 2E7VA 3LPYA 1FDBA 4HHJA 1TL3B 1X5PA 1TL5A 5AE3A 3JYTB 2UP1A 4DL3A 3J7AN 5DJBA 3UCUP 1IQTA 3A1YG 2XNRA 4KT0C 5J2NA 2C2OB 4ZP8A 2CPXA 2IAJA 1EHWA 2MJNA 2OSRA 5KFHA 3CCLS 3DFEA 1Q16B 4NLVA 1QVFR 4DFJA 5B09A 1FDDA 3MHYA 5IT4A 2EFNA 5H9EK 3GMGA 3A8KA 3T6JA 4LFBF 1SQEA 4J9RA 2LYVA 2UVRA 1S9GA 3H5YA 5SZTA 1HNXJ 1FI4A 5E3PA 2CQIA 4EEYA 4LQ9A 2E1CA 3THPA 4QOTA 4EMDA 4H4MA 4UQTA 1Y00A 5I3UA 4RNNA 3TVKA 1UVIA 2B8PA 2HHXA 2PT0A 5DZ6A 1TKZA 4OL8A 2X1BA 2F8MA 4ZP9A 1CSJA 1RLCL 1U1PA 3R2CJ 3DU5A 5LMUF 1JK9B 3I6PA 2FC8A 4J9VA 4NZ7A 3WX4A 3SQGA 3OXLA 4ZPBA 1C1BA 1H7WA 5ADZA 4F3OA 1CVJA 4Q2LA 1K0VA 2EI5A 1PJ6A 4DQQA 1QVGR 4O3NA 3BSAA 1NJYA 5HVGA 5KFJA 3OTEA 4D3GA 1X9WA 4IR9A 2RKIB 1QLNA 3SCIE 5DETA 1HIYA 3OPKA 4IFYA 2NREA 3RB0A 2EK1A 4NLOA 4ER8A 2DO4A 2P9CA 1PC5A 4F7VA 1S1UA 2VDIA 2R2SA 2K3KA 2H1YA 2DXFA 2V2QA 3AB4B 2JNJA 1IBLJ 1JX4A 2CZ4A 1HBOA 3MEEA 3LP1A 2EBEA 4LFAJ 3NGUA 2XG8A 5KG4A 1FWPA 1ZTTA 4RW8B 3KK1A 4M63A 1GT8A 2IBKA 1N5TA 5L39A 2CPYA 2V2ZA 4KHPF 5DM6Q 3K5MA 4USJC 2MHNA 3RZAA 1RABB 3CMQA 5BYRA 1ITPA 4F36A 2MQPA 2QMUB 3LGHA 2WW4A 1FNXH 1NJIT 3I0SB 3WX8A 1VQ5S 4TXSA 1VOMA 2MQMA 4ZVFA 1B0TA 2XGQA 4HLBA 1B64A 2XZTB 5J2PA 4ECXA 2B4PA 2MPUA 4TNOA 3NL0A 4BCAA 1O8BA 1D9AA 1S77D 2DR5A 1U1RA 1KNZA 5D3GB 1QSSA 1LXJA 2CJYB 1N5YB 5CYMA 1ZH5A 1UJ5A 4NI2A 3VZHA 2HG4A 3A12A 5B0AA 2V0NA 3MM9B 3DM2A 3HHEA 4Q0BA 3J80Y 2LEPA 3BGOP 3PV8A 4RX6A 1CG2A 2X1GA 2W9BB 2MDAA 4B9TA 3A8JA 4DDFA 3WBZA 1F5AA 3KLHB 3W5YA 2BJEA 1NM2A 2YQ1A 3DHWC 3NGSA 1R89A 4WE1B 5F8NA 1MWQA 5IM0B 1PJ7A 2MQLA 2IFXA 4OYBA 1DLOA 4ZPVR 2W2OP 3S01A 1K1SA 3NNCA 1GX6A 1K44A 2RQKA 1KSPA 2PA8D 4ZVQB 3ZNUA 3H5SA 1B3TA 3CC2S 1GXTA 1GEHA 2HEKA 2BE2A 3W9IA 4ZVUB 1WNEA 1TU0B 3FCWA 3JSBA 2QJ3A 1NSQA 1WJ9A 2H5IB 1VK8A 3V4IB 1CPZA 4HT5A 2ACYA 1X0PA 4CLSA 1FNMA 3RB6A 2ZOFA 3R1LA 1A0OB 2CJ9A 2FVSA 2UUBF 1IBKF 1L5UA 4OYWA 3KLFA 3MMCA 1VQNS 2GAGC 1YWXA 4CYUB 3MPWA 5KG0A 3KMSA 1RTJB 3IBCB 2WHOA 2AYEA 2ZDPA 4LR7A 3SSQA 4ZLLA 5IV3A 3JAMU 1YG0A 4K4ZA 4L76A 3BR8A 2DRAA 1LWFB 4RBTA 4X2BA 3N6LA 1TL1B 3ENQA 1MG7A 1N56A 3IA0A 3EVOA 3HSGA 1P1TA 4KFBB 3FDSA 2IA0A 2M2BA 1FX4A 2XYGB 3G86A 3AA9A 3SYZA 2G2OA 4DHVA 3UD4P 3ZTOA 3GP9A 2KRRA 1R8CA 3JSMB 4FF2A 4X66J 2BM1A 3RGIA 4P2XA 1CS4B 1CJUA 1NEEA 4LF5F 4BWMA 3QT6A 1YZ7A 2DB1A 2HVIA 2A10A 5CYQB 2O5DA 1TUGB 1F3VA 2FVQA 2CRLA 3JQMA 3W64A 4ETZA 2MGZB 1IR2A 1FE4A 1MROB 2K7JA 3H20A 5KFNA 2AT1B 3AD7C 3T5HA 1TR0A 3T1YJ 2HHUA 4YP3A 3SSRA 1JNZB 3UN2A 1WC4A 1X5TA 4E2FB 1DQ9A 1Y7PA 4PPDA 1XNRJ 3MF5A 3PIOQ 2CNLB 4MKAA 1UCNA 2CPZA 4CO2A 3DCAA 1TV6A 3IRWP 1GMWA 1RHKB 4USMA 3MFIA 3VGTA 2HMIB 3G8SA 4NCBA 3SCLE 4B17A 2FHOB 4XO0A 2AD9A 1Z1ZA 1V3RA 2DYAA 1RTDB 5B7WA 1CJVB 4YHHF 3EVWA 4QYZK 4EYIB 2LU2A 4TYBA 1V5IB 4M95A 1HNWF 1NU4A 4X4NA 4YY3F 3MM5A 2CWXA 9ATCB 2OPPB 3KHGA 2E7WA 3AJ1A 3M4XA 2IM0A 4RO0A 2Z2MA 3M9MB 3W9HA 1RTZA 2ACMA 1M5OC 2G0CA 4V1Ak 1TKTA 2PA3A 4USVA 3JTNA 1LQ9A 3SV3A 2XMMA 4P71A 3RBZA 1HARA 3I5BA 3CW2C 4DV7J 1HNIA 2RHQB 1WD6A 3LPEA 4UUWA 3MUMP 1KOOA 1D8YA 1FJ7A 3CDEA 1B70B 1YLXA 3PW5A 1S0MA 4UT4A 4ZITA 2DCUB 1Z2LA 3QPIA 4N56A 5GADI 4WF9Q 3SDEA 1EETA 1VBXA 3M8QB 4BHQA 2VZ9A 3BYRA 4JV5J 1TVRB 2HNDA 2V4QA 1CULB 2I8EA 4IOBA 2PMHA 4LF4J 4LRFA 3ZTSA 4IO1A 4WIIA 3K5OA 1SH0A 3HP6A 2BR0A 3MAQA 5SUHA 3FSYA 5B0EA 4O4GA 3PM9A 1HQUB 2F4VF 3ZTPA 1E6VB 1GX5A 1KS2A 2XZWA 2ZH9A 1S6UA 3GR0A 1KR4A 4NXNF 5C7PA 3AY0A 1N33F 4RUHA 4QQBA 1XMBA 3VAGA 2RJZA 3GONA 2HWHA 3W5ZA 1O51A 2RD5C 2YPZA 1HI1A 2OELA 4LF9F 1VC6A 4DI6A 3DMJA 5JXSA 3AODA 5AXMA 1AROP 2RVJA 2YVSA 4CH7A 1RE1B 2XO6A 2KN4A 1R6VA 3IS9A 3TZYA 4HTJA 3MEDB 5K20B 1V6HA 4HHUA 3HT0A 3K5LA 4LSNA 1C1CB 5J1EB 2XBPA 3CJ5A 2HHSA 1F3FA 1FEEA 1IR0A 4CTAA 3PIPQ 3BN7A 1S12A 4DV2J 2XWXA 3A3NB 3TZWA 2ROEA 3HD1A 2RDIA 2EWHA 2ROPA 4NMXA 2YNGB 1W2BR 3ZZYA 5KFCA 3ZZTA 3KLEA 4YUDA 1NH7A 3ONQA 1NK5A 2MZ1A 2YNHA 2FHMA 2FVCA 4H4OA 4WFXA 4EU0A 2G9OA 1NB2A 1X8DA 3KUHA 3OTBA 4J9SA 2VQEF 3MR5A 2RB7A 2HAFA 3BGRB 4E8UA 5DG7A 2HRYA 3CWJA 4C0OC 3M9NB 3JQJA 3R6GB 1FKAF 3DRSA 1S1XA 3WHIA 4F3QA 1HQ2A 2GGPA 5D0RA 2J0XA 1S6QB 4OJ1A 2WOMA 2OAUA 2AMCB 2B6AA 2QE5A 2FQQB 2ILYA 2VBWA 1N48A 2JEJA 3N4WA 3UVJB 3CO0P 4LVNP 3BF4A 2HRUA 7FDRA 6AT1B 2RQ4A 3GV8B 4QR1A 5CYJA 1WHXA 2YTCA 4P9SA 5ETNA 1TL7A 5B0FA 4O23A 3HHLC 5AJ3F 2DBBA 5LXYA 5LMNF 3BSNA 1VIOA 4CT9A 4QIWD 4J90A 1LWCB 3ILJA 3JQKA 1ZAVA 3DI6B 1CQMA 2R4FA 3ILOA 4K7QA 4ZHRA 1RBLA 3KNGA 4P7TA 2UXBF 5A0YB 2XB2D 2XMAA 3BYPA 4NX9A 1S9EA 3CDWA 2R8JA 2IM2A 2KB2A 1VRQC 1S0VA 3R7SB 1GXUA 3POTA 5HAOA 2AJ1A 2HK3A 1HBUA 4M94A 2BBEA 2XY5A 2QLXA 4RW7A 2DNLA 1BC6A 4HDGA 4HACA 4QR0A 3H7HB 5JUMA 3X3UA 1Y4ZB 2MZSA 4JV0A 2A3JA 4LFCJ 4C8MA 2HZVA 2OMLA 4QCLA 4B3TF 1DQ8A 3KLIB 3FBBA 1KONA 3D1HA 1H2VZ 1C0UB 2P2CB 4OI2A 2MQQA 4B3OA 1Y0HA 3R3TA 3W9JA 1HPZB 2H9ZA 4LF1A 3Q86A 2KFZA 2QYGA 5KFRA 1PC4A 3TW0A 4W98A 4I67A 3IC1A 5I42B 1FD2A 4LF2A 1FHTA 1REGX 4ED4A 4JYAF 3MAAA 2MY7A 3CGIA 4WZQA 3BQ0A 5L8RC 3Q8PB 2KFYA 4UOHA 2RE1A 2XM3A 1CEZA 2H3EB 4F2RA 1RT2B 1RP5A 1JJCB 1N4LA 1JB0C 4RW6A 2CDRB 5H9FK 4XAKA 4CQ1A 2VG6B 2CZVC 3MECA 5F8GA 1T9VA 1HA1A 4N8NA 3UFCX 4AXIA 5KG6A 3OW2R 2AYGA 1BQNA 3PACA 5KFFA 2CPIA 4ILMA 2B3TB 4P2MA 3ZTRA 2D3UA 3NRBA 3CO9A 2VG7B 3HVRA 2W2PP 2GVZB 4KTQA 4XIUA 2EEYA 2LCWA 3NGRA 5GVQA 2R7OA 3L7PA 3FMBA 1FTCA 4E0DA 3AOAA 2FY1A 4MT1A 3D68A 5M2UA 1VQYA 4Y00A 1XR7A 5CD4A 4OZ0A 4TY9A 3LP0A 4BC9A 2W01A 2O67A 3I0RB 5A8RB 1VYAA 1U49A 4UY8T 1KP6A 3DN9A 3DKDA 2NUUG 3W8GA 1P1LA 4P2FA 3M2RB 2E9RX 2FJWA 2X3GA 3OR2B 2ZWOA 4PRFA 3R8YA 3AT1B 1RT1A 1E6YB 1RWXB 1J5OA 3C15B 3TUPA 3V5RA 1ZS6A 2RHSB 3TUJC 4DFMA 4OMFG 3DOKB 3QIPA 3Q2TC 5EX0A 1FJEB 5K8PA 1I94F 3K8VA 2V8DA 2WSFC 4NOHA 1S0OA 4KB7A 2DR6A 1SJQA 2BANA 3MM7B 4CP5A 2G4BA 1DQAA 5KG5A 2F63A 2W1BA 3D0IE 4Q7AA 1SB6A 1GTEA 1HBNA 3NG8A 2BW7A 4CLKA 5KFOA 4F67A 2MYFA 4B3RF 1ZZNA 2P6TA 3TAMB 4C8NA 4FVCA 3T41A 2YWFA 1K0TA 3NCPA 1T9WA 2IPOB 9RUBA 4DR1J 1H74A 4K5RA 1S49A 2BZ2A 2ZD1A 5K9FA 1RT5A 1SC4B 1YX2A 3MDFA 2IJFA 2R42A 1PYOB 2QLFB 2GFFA 1XMQJ 4ZPCA 1UFWA 5F3ZA 4PYAA 1RT7B 4F04B 4F0HA 3P5BP 5L9XA 4K4WA 3HM9A 2Z2LA 4KPCA 4KE5A 2R8HA 1LEOA 1Q79A 2NXCA 3K8WA 1N36F 1BMQB 2DNQA 2JC0A 2VQFF 4ANDA 3D2WA 1JLQB 2DGWA 3DLEB 3DYAB 4CZCA 2AIRB 4CT8A 1VQMS 2J5AA 4I6YA 4GKKF 1W7WA 4U7UK 5T7LA 2XULA 1XEZA 3PYFA 1U02A 4LIWA 1MLAA 2B7CB 2L3MA 4EGLA 2HNYA 3QAEA 4IRKA 4E98A 1YTYA 3OTCA 3B82A 3MMBA 2FYXA 1LK5A 2RU9A 2QA4G 1NJWA 3GE9A 4Y6IA 2VG5B 4WP8A 2ZFHA 3UR0A 1F9FA 1BQMA 2J7UA 4K0KF 1IJEB 3DLJA 1T03B 1Y3JA 2LFVA 3ULHA 3OFGA 3V6JA 2DRBA 3G96A 3BZQA 3CVKA 1U7LA 1YGYA 1C0TB 2D9PA 5FJ4A 2P5VA 2DNYA 3M8YA 1F0XA 3I9ZA 1ZM9A 1CLFA 1VQKS 2A6OA 4I64A 4U67Q 1F9HA 4PABA 2BYCA 1S6PB 1LWXA 2UUCF 4CO5A 1WSRA 2IBOA 2EK6A 4B3SF 5KT2A 3NS6A 2HHWA 2DIVA 4IO9Q 4JI1F 4CLUA 2YWWA 1BE4A 4MYUA 2V67A 2KG0A 4OI0A 3IAS9 1N34J 1EIYB 4J9MA 3AXKA 3H42A 2UVUA 1U8WA 3RUBL 2FJAB 4FP9A 1N5QA 4FVMA 4MH8A 4J37A 2VDHA 2J0WA 1Q1KA 4OJ3A 5KT5A 3DGVA 5LSRA 4IDKA 2KI2A 5BYQA 5ETMA 5CCLA 2UZAA 3UN5A 3IR5B 1G7CB 4DUYF 1IXKA 3DRPA 1ZBTA 1VFJA 3CJ2A 3H5UA 3FQKA 2MY8A 1EQ0A 2MZJA 3MM6B 5HN0A 3IO1A 3ENVA 1IBMF 4RW9A 1SV5B 4AXJA 1NHUA 4OHVA 4Q44A 2MKHA 2KM8C 2AWZA 3KK3B 2ASDA 2FHJD 4DX6A 1YJVA 2NLWA 1UVLA 1Z4UA 1QAJA 2B5JB 3QYYA 4AQYJ 2AZ3A 4WTYA 4DV6F 1ZTWA 1UEKA 3D6TB 5KOWA 1UW9A 2W4PA 2LQ9A 3R7NB 3CCQS 3DXBA 1FESA 1LWEB 1HKAA 1TL4A 3NS5A 2RH3A 4LT6A 2VFSA 3ZTQA 4U7UD 3R5DA 3HI9A 2L9NA 5F9LA 2R7WA 1PYTA 5KFQA 4W4MA 5CZVA 4IUFA 2N7YA 2CQDA 1UA0A 1ZM4A 1I51B 1Q8BA 2PE8A 3JTPA 1U0HA 2ZH6A 1MN9A 3DXSX 1C2PA 3PRDA 4KQZA 2R2UA 3FC9A 1SI9A 3NCQA 4JOUA 4LF6F 5J2NB 3RU0A 2L48A 3IAM9 2IAJB 1Y5NB 1IBCB 1U4BA 3VWSA 3FGVA 4L73A 4DSIA 2RMLA 4FF3A 4LRAA 2UXCF 1TQLA 3NMAA 2KXFA 2A0FB 2YWGA 5E0OA 2DCLA 4WP9A 1BQXA 2EFVA 1VBYA 3N5FA 2J76E 3MCMA 1FWLA 2NS1B 3M32A 2B4OA 4MJKA 2CG8A 1T05A 4B9UA 1RISA 3HHLD 4DQSA 4RBVA 1FJCA 3CXCR 3QGHA 1WOOA 4DL0C 4H4MB 4M1KA 4Y2AA 2W24A 3EGVA 4CLYA 5ETOA 5I3UB 1T0TV 4RUCA 2HKEA 1YVFA 3OHBA 2MSTA 5H9FJ 1L3SA 3NLCA 3PW7A 2DNOA 3ITHA 2HWIA 3SSSA 2DNPA 4DF8A 4G6VB 3QMQA 3KWMA 2LA4A 5DG9A 5HP1A 3SQGB 1SXLA 3PW0A 2IRXA 1AYEA 1VBKA 1FDNA 2MLYA 1RTIA 4B9MA 1KTQA 3PYGA 3ICLA 4OZLA 4ZCLA 2B4VA 5A8WA 2KG1A 4ZVRB 1WEXA 2IVMA 3W63A 2E9TA 5KFAA 3DRXA 3KG0A 3QRQA 2ADCA 4DUZF 5GMDA 4ENOA 2AGQA 1WOSA 4DR4J 2HHTA 5DLFA 2XY6A 4NMLA 2BM0A 4X4SA 2JLEA 1ACMB 3ZZPA 2UUAJ 1S1UB 3JS9A 3TJAA 3C8YA 2CQ4A 4J9QA 2UXDJ 1PILA 2KYZA 3T5LA 3HO1A 5HMXA 3LP1B 2JHEA 1KTVA 4ZP7A 5LJ5Y 3Q8SB 1CC7A 3CCWA 3KK1B 1Q5YA 3T19A 2GO9A 4USHA 2HFNA 4R0EA 3PNIA 4NZ6A 3C3LA 2KFNA 5LXRA 2J6TA 4BDPA 3QJLA 3SV4A 4MIAA 2PEBA 1ZPWX 4UOFA 3TZZA 2BJ8A 3IFEA 2ZBIA 2ZKUA 2OD6A 2JZ5A 2IYIA 1K1QA 1W2IA 4CM0A 3VAHA 2HPUA 1TKXA 4QJVA 4N7TA 4A8OA 5J2PB 2QA1A 4LFBJ 2L9DA 2XGPA 3OVBA 5KT3A 4R8UB 4NE9C 1I5OB 5IQQA 5L1KA 2R7QA 3GPAA 3BEGB 4X4QA 2NZ4A 5CYMB 1M0SA 4LF7F 2OSQA 4NI2B 4BLGA 2E9ZA 1JJHA 3NAIA 3DM2B 4Q0BB 2LXFA 5KTQA 3GQCA 2D3ZA 1NK0A 2LA6A 3KOAA 5J1PA 2PIIA 4I2PA 1O0PA 4Q5VA 1XNQJ 5FLXY 3GYNA 2DR7A 3I5CA 3HVWA 1U2CA 3KFWX 2A18A 2LEAA 2IJNA 4ECUA 1H6KX 1S7HA 1DLOB 1M1GA 3H2UB 3I56S 3BS9A 1VK3A 2E66A 4ECZA 1JJ4A 3B78A 2K1RA 4ZCKA 5GAHU 5IXUA 3I31A 1JQGA 5HROA 2YNIA 4QBUA 2SXLA 3SMZA 3K5PA 2BE2B 2ATLA 1S97A 3OL8A 4LBHA 1Q81T 4USIA 2VJUA 4ED0A 2R8IA 4OHZA 1UFKA 3G87A 2KKHA 2VPZB 2VICA 2Y1RI 1G6BA 1H38A 1SC6A 2V69A 8ATCB 2UV8G 1U48A 5ETKA 4YB5A 4V19J 4PAAA 3KLFB 5JMNA 4X4RA 3MMCB 5LL6d 1RU2A 2PDAA 4OI6A 3HX9A 2JVRA 3IWLA 2V5HG 5LT5A 1SJ1A 2AHOB 2Y1IA 4F02A 1DY3A 4DCPB 4KGKA 3D4JA 1HQEA 4ZVGA 1KQGB 3BM7A 2ERRA 4ED6A 1U6ZA 2BKOA 3VZIA 1TAUA 1AFJA 3PR5B 2GMHA 4OHXA 3CJ4A 1HNZF 3KJNB 2CJKA 2G1DA 1BHNA 3RRKA 4JI8F 2MKYA 3E01A 1TP7A 4TQSA 2BJDA 2CQBA 2JEFA 1MNEA 2JEGA 3M6XA 1RYSA 2C2ZB 4M5LA 2CUYA 1N6QA 1PSDA 2YWEA 3H2VE 5HO4A 2DHXA 1CJUB 3DRRA 3A3PB 1M5SA 1OO0B 1SL2A 5IOLA 5KFVA 3GJQB 1MWYA 1W26A 4RR5A 3MWBA 1HHSA 2QMWA 1X0FA 4DV4F 1NO8A 1V5VA 1RWUA 2NPIA 5DRKA 2DNGA 4DG1A 3UNGC 1S0NA 5C42A 4F0KA 3OFHA 5CHCB 1H0HB 1TV6B 3RAXA 4WK1A 2DNKA 4P2SA 3LAKA 5HI7A 3MMJA 1RAAB 4IQMA 3HF5A 2XZDB 3IN5A 3VQTA 2FUG9 1RAEB 3IP0A 4A8KA 1F6TA 3OTDA 4ZPTR 1C4AA 2J8SA 2YX7A 5KG3A 2XI2A 3M2VA 2P9GA 2QLBB 3Q24A 3DNCA 3HK2A 3H98A 5F9NA 4J91A 4OJHA 1VISA 1R31A 3BDEA 3HXMA 2ZUGA 2GX8A 5L38A 3MM5B 3M30A 2CVIA 1ZPVA 4JI2F 2HFOA 1X4CA 3EUNA 1UA1A 1OSCA 2BQ3A 3TI0A 4KH1B 4NXMF 1X4BA 1IKWA 5KOXA 3QO9A 5CZXA 3H8YA 3W62A 3OTOF 3P4UB 3E3XA 4P75A 3MM8A 2JRSA 2VHGA 4RWWA 4U7CA 2FVRA 2NXUA 4FPRA 3QJJA 4LIRA 1FO1A 5CD4H 4JI4J 1YJTA 3SCJE 2PMZD 4CLFA 1Q95G 2VA3A 3PJXA 5LM7E 1HWIA 1RBAA 3SDEB 1EETB 2ZDOA 4MTPA 3TVYA 1VI7A 2BQRA 3HULA 2XYPB 3TARA 2HNDB 1R6YA 2BRLA 3D67A 2BE9B 1TK8A 1Y11A 2DGSA 2M0GB 3K59A 4M5HA 4KY3A 1OY6A 2QO3A 1S1VA 2NZCA 3D0GE 4J9NA 4LMZA 2P8IA 4AE5A 4O4GB 2O3DA 2WW8A 1MN7A 1GMVA 3CF5Q 5HVFA 5HLFA 1LW2A 4PYDA 1UWBA 4OI1A 4YB7A 1RBOB 5EN1A 1MWZA 3MPYA 1HBMB 1XC9A 1IKXA 4LQ3A 3J81Y 1HR0J 2ZC3A 1PBUA 4A8XA 4ICLA 1HNXF 1JLBA 1WEZA 4RBUA 3M2UA 2BJ3A 1VR6A 4KHMA 4YS2A 3KUEA 2ROGA 4NA2A 4GC6A 4DPUA 3QNWB 2XI3A 3PCOB 2QX0A 1XIQA 3JSRA 4K4SA 3IS9B 1XR5A 4ECRA 3ENWA 2OEJA 1ZM3A 3OL7A 4LSNB 2HYIB 3TNVA 1J2VA 4TU7A 3QQCD 2WB4A 3GG1A 3L4BC 4CTAB 1JKHA 4KV8B 5D4OA 1QAYA 1X9SA 3D1QA 3D28A 4RNOA 4A8QA 1WC0A 3KLEB 2GQ2A 2KHCA 3V81A 4CO1A 5FDLA 4MKBA 3AOBA 2YNHB 5CCMA 2MJUA 2KDOA 1X4GA 5KFWA 2CPEA 1RKJA 3FJ2A 5CAAA 4X65J 1T11A 3UDVA 2BEFA 2YBVA 1R0BG 3D3BJ 1S1WA 4MAKA 3DRSB 3HFZB 1S1XB 1TL3A 4NEZA 4WBFA 2GGPB 2WK4A 3THTA 2YKMA 1D1UA 3KJQB 3KG4A 1UVMA 4LFAF 2WOMB 3ENAA 2NYIA 3CD7A 5MLCV 2B6AB 3PXGa 3CCVS 4X62J 2XNQA 3P45B 1AFIA 1K73T 2FLLA 2EBGA 4OIXA 4X64J 2V68A 3PO4A 2K3IA 4K2XA 1VBZA 1DBDA 2R7UA 1SL1A 4BS2A 1WHWA 2BACA 4KIAA 2OFGX 4ID5B 3KYLA 1N33J 1WTFA 2KVIA 1OMSA 4KPYA 1X4FA 3QGIA 2W25A 4I6AA 4RKUC 3MCOA 2V8PA 4ELTA 4LF9J 4ZHRB 3CB4A 3ZZRA 4IR1A 1X31C 3AQOA 3LF0A 4JUZA 5DDPC 1S9EB 3VAFA 4ZN3A 5AE1A 3POTB 3FBFA 3SBMA 1FX2A 2AKWB 3CJKA 4LBIA 2DISA 1HBUB 4RW7B 3CTRA 3FZ2A 4DPXA 1OS5A 4CO0A 3Q23A 5D8HB 2APOA 5HMYA 4HACB 3TRGA 3G71S 1LW0A 5K8OA 2WRMA 2RRAA 4DQPA 1K9MT 4HVZA 5A8KA 2QGFB 1WUUA 3MD1A 2HBRB 4B3OB 4MK8A 1R8AA 2J9DE 5G0RA 2HVEA 2IA6A 1KD1T 2ZZTA 2KT3A 2KZMA 3H2LA 3BQ1A 3EM1A 4HEA9 1WSVA 1LK7A 2AZ1A 2VQEJ 3DOLA 3EE3A 4UQGA 2XMKA 4EFAC 4FF1A 3MAAB 1JWWA 1VHFA 3OT9A 3OD2A 4CH1A 1GXLA 4PQUA 1M90T 3OLAA 3CJRA
chains in the Genus database with same CATH topology
2PMWA 2W2OP 3VV2B 2W2MP 3WHIA 2Z58B 4NMXA 2E1PA 3CO0P 2W2PP 3H42A 1SCJB 3GCXP 3A3OB 3VHQA 2W2NP 1R6VA 2Z2ZA 3WIUA 2ZWPA 2XTJP 3A3PB 4YN3B 2Z2YB 3BGOP 3GCWP 2Z56B 2QTWA 4K8RA 3CNQP 1V5IB 1SPBP 2ZWOA 4OV6A 4NE9C 3A3NB 4JP8A 2W2QP 3T41A 3AFGA 3BPSP 3QFHA 3WIVA 2Z30B 3SQOP 1ITPA 2Z57B 3P5BP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMW A;  2W2O P;  3VV2 B;  2W2M P;  3WHI A;  2Z58 B;  4NMX A;  2E1P A;  3CO0 P;  2W2P P;  3H42 A;  1SCJ B;  3GCX P;  3A3O B;  3VHQ A;  2W2N P;  1R6V A;  2Z2Z A;  3WIU A;  2ZWP A;  2XTJ P;  3A3P B;  4YN3 B;  2Z2Y B;  3BGO P;  3GCW P;  2Z56 B;  2QTW A;  4K8R A;  3CNQ P;  1V5I B;  1SPB P;  2ZWO A;  4OV6 A;  4NE9 C;  3A3N B;  4JP8 A;  2W2Q P;  3T41 A;  3AFG A;  3BPS P;  3QFH A;  3WIV A;  2Z30 B;  3SQO P;  1ITP A;  2Z57 B;  3P5B P; 
#chains in the Genus database with same CATH topology
 1R8B A;  1RT3 A;  1F9E B;  4RW6 B;  3A13 A;  4DWI A;  3W5X A;  3EDQ B;  3MEC B;  1UFL A;  4AUK A;  3DLL Q;  1I6J A;  1NZA A;  2K8G A;  5GAG U;  3HSZ A;  1BQN B;  4XK8 C;  2YPY A;  2IJR A;  3OFE A;  2DR8 A;  3CDA A;  3VAM A;  5KFK A;  3LAN A;  3QRP A;  3MZI A;  4DL4 A;  3CT9 A;  1RK8 A;  3K2Y A;  5AJ3 J;  2IMO A;  3GWC A;  3PJW A;  1H2T Z;  3PTW A;  5KT6 A;  2J9D A;  2QT7 A;  4DFK A;  5B08 A;  3LP0 B;  4UY8 5;  4DMZ A;  4NRT A;  1D9D A;  5T41 A;  2GMJ A;  4ES2 A;  5D6G A;  3TOQ A;  1NKC A;  3DLK A;  2A6M A;  2FVP A;  4AD6 A;  1NDP A;  1HHQ A;  2ZBR A;  4CIO A;  4ZN1 A;  3AH6 A;  3MOZ A;  2V34 A;  3GIJ A;  4J9K A;  2DEJ A;  2C3O A;  3ILL A;  2Q6C A;  2ASJ A;  2NYH A;  4GKJ J;  1WG1 A;  1RT1 B;  3NBP A;  2DR9 A;  3HKZ D;  1H3D A;  1J5O B;  4RPF A;  2RF2 A;  2H48 B;  2QG9 B;  3H90 A;  4K4V A;  2HVH A;  2E5H A;  3QIP B;  4ZP6 A;  3R6L B;  2EFO A;  3Q0A A;  3KLH A;  2NXE A;  5J2M A;  4KH0 B;  3KLG A;  4ZPA A;  4YN3 B;  2BAN B;  3E8O A;  1NB7 A;  3HDS A;  4K8R A;  5AE2 A;  1IR1 A;  1DZ5 A;  4M5N A;  3TA1 A;  1RA7 A;  2RU3 A;  4OYZ A;  1V3S A;  1HBN B;  1VRT A;  3DLG B;  3R5C A;  4ANE A;  2UVV A;  4OZ3 A;  1NJX A;  2XY7 A;  7FD1 A;  2DNM A;  5AXL A;  3PHT A;  3U27 A;  2YH1 A;  2XMV A;  3GLJ A;  2JL9 A;  3MPU B;  1SVD A;  1RT5 B;  1RWO B;  4FN5 A;  2CVE A;  4DS5 A;  4ES3 A;  4JBC A;  2X1A A;  1ZA2 B;  5D4P A;  1XBW A;  1T3O A;  5KG7 A;  2AGP A;  2QYC A;  1AZS A;  3IM8 A;  3MI7 X;  1Y9O A;  4ED5 A;  5ETR A;  5RUB A;  5K5M A;  1X5O A;  3BPS P;  2FY8 A;  1R0A A;  3DLB A;  4RLE A;  5DQH A;  3GB0 A;  3T1H J;  1OYD A;  2QV6 A;  2OPS A;  3Q8Y A;  2HS4 A;  1SPB P;  5T7L B;  4QYR A;  2HQD A;  4LF8 J;  4DX8 H;  2E5L F;  2CQC A;  2D41 A;  4A47 A;  2DNR A;  2HNY B;  2HFU A;  4O44 B;  1NME B;  3MMB B;  5E33 A;  4LF4 F;  3T9Z A;  3IBW A;  3O5T B;  1BQM B;  5L9N A;  4C9D A;  4UST A;  1SJR A;  5IS2 A;  2M70 A;  4FYY B;  1Q7L B;  2OKQ A;  3AQP A;  3PHE A;  2PI4 A;  2F3J A;  1PKU A;  1YZ6 A;  3LAM A;  4C0B A;  3CME S;  1MRO A;  3RJM B;  3MUR P;  2L9W A;  4DCJ B;  4FF4 A;  2KTQ A;  3PRV A;  3UI3 A;  5K14 A;  1PAE X;  2EG2 A;  2M9K A;  4EI2 A;  2E44 A;  4MKY A;  2AJQ A;  1WHY A;  2ATC B;  2XS2 A;  1UPM B;  1APS A;  4U9R A;  4IG0 A;  5HVH A;  4WYW A;  4ED7 A;  1X4D A;  3VQS A;  3CCT A;  4AL7 A;  2KYX A;  2ZH8 A;  3TX8 A;  5JJB A;  4GO7 X;  2F7V A;  4DV1 J;  1RWV B;  2ZWP A;  3PX0 A;  3B4D A;  4F4A A;  3EXC X;  3EJM A;  2ZH5 A;  1EQM A;  1U1L A;  4IOC Q;  4IOA Q;  3ZZO A;  1CJK A;  2PN6 A;  2I2Y A;  2W7O A;  5HL7 Q;  4IDK B;  3OL6 A;  3ET6 A;  2FD2 A;  2XTJ P;  2JWN A;  3NCR A;  3MCN A;  4AL5 A;  1HMV A;  4DV2 F;  3EIC A;  1MU2 A;  2ZZM A;  4JI7 F;  2GW8 A;  2B9W A;  2DRD A;  2FJD B;  3R5G A;  3DRP B;  4PWD A;  3UD3 P;  1VGY A;  4HDH A;  3GIR A;  2VPY B;  2A2C A;  4KHR A;  4F4X A;  2QL5 B;  4X4U A;  3DRY A;  1T9U A;  3W2V A;  2XSJ A;  4RW9 B;  4JI3 F;  1X4H A;  3C19 A;  4CRJ A;  4OQJ A;  2VQF J;  1QM9 A;  5D0G A;  2EC2 A;  4ZVE A;  1FVS A;  3QWU A;  2ZH7 A;  4ED1 A;  3QT5 A;  1IKY B;  5EUH A;  4OX7 A;  3V2U C;  3AB2 B;  1U26 A;  3M8Q A;  1Q78 A;  2R2R A;  4HHH A;  2Y0B B;  3DGP B;  1WAC A;  4PZV A;  1X60 A;  2FLP A;  3ISN C;  4JV1 A;  1M5V C;  2AEM A;  4UUX A;  4K2J A;  4DR3 J;  2JX2 A;  3IR7 B;  1FFS B;  4LRE A;  1RT6 A;  3ZXW A;  2AX1 A;  5E3C A;  2OPQ A;  2GHP A;  5DM7 Q;  3IXQ A;  3M6V A;  1U0H B;  2RQM A;  2ZH2 A;  2WB1 D;  2OPR A;  3R7B B;  4JI6 J;  2ZKT A;  5D77 A;  4KRW A;  4USU A;  4EBE A;  4OI4 A;  4DV0 J;  4MIB A;  4WK3 A;  4ATN A;  2VB6 A;  4FYV B;  5F8M A;  1UP1 A;  3D54 A;  1RAC B;  4TLR A;  4Y28 C;  3S1T A;  4DL6 A;  4I69 A;  4RJV A;  1HL6 A;  4JI1 J;  2MSS A;  3BQ2 A;  3KXD A;  2BUN A;  1SQF A;  1D0E A;  4KJI A;  2F5G A;  1D8Z A;  2DGT A;  1N88 A;  2EKY A;  4DV5 F;  2VOP A;  1PIE A;  3M32 B;  5DDQ C;  1T05 B;  1KQF B;  4EUV A;  2KU7 A;  2R7V A;  1YSJ A;  1J5E F;  3G82 A;  2X3D A;  4B9N A;  4OZJ A;  2M3D A;  3M05 A;  4Y2C A;  3VF0 B;  3L95 X;  4PXB A;  2OIH A;  1SUQ A;  2CIM A;  3UCG A;  4WP3 A;  1QE1 B;  2HLU A;  4K4X A;  4C8L A;  2ZBC A;  4FXV A;  1IJF B;  2Y9H A;  3D9B A;  1JLE A;  2I6W A;  1XWL A;  3ITH B;  4NLX A;  1V3Z A;  2RNE A;  2CA9 A;  1RHR B;  3EPG A;  5HP1 B;  4DOZ A;  2ASY A;  4FS2 A;  2J6U A;  4ECQ A;  1RTI B;  2GHV C;  2AJ2 A;  1IBM J;  2Z4P A;  1MSW D;  3H4D A;  3CJQ A;  1N5V A;  4EO6 A;  3BGR A;  2OTL S;  5A8W B;  1FJG J;  1NKE A;  2RUG A;  4W90 B;  2D9O A;  3MR7 A;  1FEH A;  3ZNJ 1;  3TUI C;  4WXO A;  4H4K C;  1KQS R;  3IGN A;  1N52 B;  4JP8 A;  3ZC4 A;  3H0P A;  4CNZ A;  3TAN A;  5DS7 A;  3NEK A;  1NLK L;  2OFH X;  3CCS S;  2Z56 B;  2BAB A;  5HQ8 A;  2D69 A;  1RYR A;  3CIZ A;  2H54 B;  3W61 A;  2LP4 A;  1RWP B;  1EX8 A;  3C14 A;  3IWX A;  3A3O B;  1REV A;  3RBD A;  3P3D A;  1X5S A;  1QSY A;  2AQ4 A;  3IBF B;  2GVD A;  2JLF A;  1WOP A;  1XMO F;  4GC7 A;  1HHT P;  2LQ5 A;  4LF6 J;  3I32 A;  2OP5 A;  2AJF E;  3MR6 A;  3R97 A;  3H59 A;  3TVZ A;  1JNR B;  1FK9 A;  3RYL A;  3TYT A;  1IKV A;  3FNN A;  4USK A;  1IWA A;  5C25 A;  1UJ4 A;  4DR7 J;  1YQH A;  4Q2M A;  4DR6 J;  1RTH A;  2HW3 A;  2I0X A;  4DU8 A;  3KDN A;  4DN0 A;  4F50 A;  1TKX B;  3QJP A;  5BR8 J;  2F40 A;  1B7F A;  4GVL A;  2CPD A;  2RT3 A;  2XWY A;  4MK9 A;  1RUS A;  3ADA C;  4MMO A;  4M5D A;  1VHI A;  3HHK A;  2RSQ A;  3QBC A;  1S79 A;  3HPO A;  2WTF A;  3UDC A;  1YJR A;  1EZZ B;  3CIM A;  1VQS A;  2R2T A;  3BGU A;  1ZET A;  1N32 F;  4UTG A;  1QY7 A;  2R7S A;  1HI8 A;  1WI8 A;  2C3U A;  2WBR A;  1VLY A;  2KXN B;  1P9Y A;  3BBC A;  3NP5 A;  2DD8 S;  4ED2 A;  2XLI A;  3R5B A;  1SKS A;  3TJ9 A;  2GIR A;  1P6T A;  3C6U A;  2KHD A;  3M8W A;  1TK0 A;  4CLL A;  2ZHO A;  2CAJ A;  2K1R B;  3TQE A;  1S99 A;  3M6U A;  2F8E X;  5HRO B;  2YNI B;  4KGZ B;  4DUZ J;  1SJF A;  3J7Y U;  2DIT A;  4RUA A;  1XK8 A;  3WDO A;  3N79 A;  1U24 A;  2PFF B;  2FJX A;  2HHP A;  2ZVI A;  2LMI A;  1KVI A;  1NZ8 A;  2EC0 A;  4DUT A;  3I4P A;  2QFJ A;  1FVQ A;  1LFP A;  2DXD A;  4NPO A;  4NRU A;  4JI0 F;  5H9E J;  4WU3 A;  2C28 A;  4MFB B;  4YDD B;  2Y8W A;  3KUG A;  2AYB A;  3ISZ A;  4YR0 A;  3DOM A;  4OYX A;  5IT0 A;  2KJV A;  2J7W A;  4URG A;  4X4V A;  3WC0 A;  2UUT A;  4DSF A;  2HGM A;  2WCX A;  1HQE B;  4RW4 A;  4PQA A;  2FJB B;  4F8R A;  3BRE A;  1QUV A;  3EVM A;  1FXD A;  1Q8L A;  4DPT A;  1RZM A;  4KSE B;  3E01 B;  4ZVP B;  3LUY A;  4FBU A;  1FRH A;  3UPF A;  1Q86 T;  4H4K A;  3SFU A;  1P27 B;  2VV5 A;  3K89 A;  1NK8 A;  2OUG A;  1FD8 A;  2I1R A;  3OJS A;  3DRR B;  4WPA A;  3HD2 A;  2CZ9 A;  3O8W A;  4ZA1 A;  2DGU A;  1KLM A;  3IG1 B;  4JV2 A;  1RB0 A;  2HVD A;  4L72 B;  3BKT A;  4ETX A;  5IWA J;  4DG1 B;  1TAQ A;  5C42 B;  1N34 F;  4DV3 F;  4QIG A;  4M5K A;  2XSF A;  2W9A A;  2O1P A;  5C24 A;  3L3C A;  4DR5 F;  1X9M A;  3AA8 A;  5DZ7 A;  2CG4 A;  3GSD A;  4JI5 F;  3JTO A;  5HBM A;  3TAM A;  1PBA A;  1SCJ B;  1WKJ A;  4KBI A;  3DDK A;  1M1H A;  2IHR 1;  4C6A A;  4ZCI A;  1RAI B;  4PWW A;  1XTZ A;  5H1S V;  3D7S B;  2GJF A;  1SL0 A;  1SC1 B;  3M2V B;  1PGZ A;  1UZD A;  3FRY A;  5CAB A;  4M5I A;  4NA1 A;  1S9F A;  1GK8 A;  5KFG A;  4F3M A;  3B4M A;  2OI2 A;  1WEL A;  2VPW B;  1HWJ A;  2XHW A;  2G2Y A;  3M30 B;  3KJV A;  2WSE C;  4IKA A;  4F4Y A;  4F4K A;  3CCU S;  2R7T A;  2QLJ B;  3KMQ A;  4NLP A;  2JFK A;  5HK4 A;  2XCP A;  4AQY F;  1IKW B;  3QO9 B;  2F4F A;  4ZJL A;  4WXW A;  2HQ3 A;  2G2Z A;  4HYK A;  2JFD A;  3TEH B;  2FLO A;  2BW2 A;  1OIA A;  4DFP A;  3MM8 B;  2XC9 A;  4NL5 A;  1HLW A;  3HVT A;  5IV4 A;  2F9D A;  4DU7 A;  3MPV A;  4GO5 X;  1WI6 A;  3T1A A;  2EVZ A;  4EBC A;  2HBQ B;  4I2Q A;  3LH2 S;  1UEV A;  2PGC A;  1YBT A;  4DPY A;  2N3L A;  3TAP A;  3IMQ J;  3PKY A;  1HNZ J;  1RHJ B;  1YRX A;  2JLG A;  1Y3K A;  1L3T A;  1OPZ A;  3FCV A;  5EWE A;  1OWX A;  4JI8 J;  4YB6 A;  2DPI A;  2XEX A;  1FKP A;  1C0T A;  3FSI A;  1Q53 A;  1NUE A;  1YBU A;  1FKO A;  2V8H A;  3VAJ A;  3AFG A;  1RWW B;  2GJI A;  4QIF A;  3I87 A;  2ZOM A;  2DGO A;  4B3M J;  3HT3 A;  4AT1 B;  2MHE A;  4FXD A;  1FFW B;  1Q8K A;  5ETL A;  4QPX A;  1SKR A;  4L6V 3;  3SQO P;  5HLF B;  1LW2 B;  1UWB B;  3ISN D;  3C16 B;  5B0G A;  4DV4 J;  2GC8 A;  3TO8 A;  4ZIV A;  2OH2 A;  1XR6 A;  1IKX B;  4X84 A;  2IRY A;  5LSO A;  4B9V A;  4OZ5 A;  3Q8V A;  4ICL B;  4DQI A;  2V8V A;  2VIH A;  1UKU A;  1JLB B;  2CQG A;  2IDL A;  3CD0 A;  4FZV A;  1VQL S;  4GVB A;  4URS A;  5DO2 A;  2IDE A;  2XLK A;  2MMY A;  4HL9 A;  2IY5 B;  3QFH A;  4FNH A;  4NWB A;  2LQJ A;  4NLY A;  3P49 B;  3S8S A;  2KL8 A;  3E51 A;  4OYP A;  1SKU B;  2E5G A;  1UET A;  4IH5 A;  2XMJ A;  3M8Z A;  2OEK A;  5HQL A;  3MTJ A;  2YKA A;  5F0W A;  3U1L A;  1VRU B;  3CDU A;  4NYO A;  4YR2 A;  1FCA A;  2V9K A;  1TMJ A;  1JKH B;  3HFV A;  5F8J A;  4JI2 J;  3FVY A;  3MUT P;  3BGF A;  2MXY A;  4M5G A;  4LSZ B;  2HWT A;  2UV8 A;  3UDL A;  3MEK A;  3V81 B;  5FDL B;  2WSC C;  4WU2 A;  1BUX A;  3WZ0 A;  1WWH A;  5A2Q Y;  4CWB A;  1PJ5 A;  2FHJ A;  3GU0 A;  5I3Q A;  3R5J B;  5F41 A;  1JLA A;  4DR4 F;  3GTY X;  4QWA A;  3PX6 A;  2CQP A;  1A7G E;  5HAN A;  3RR7 A;  2EXU A;  4FDF A;  4UZB A;  3OV7 A;  4FPI A;  1M5P C;  1S1W B;  2UXD F;  2QSF A;  4C11 A;  1NXI A;  2PSZ A;  1NSA A;  1KEK A;  1HWK A;  2YKM B;  2MLX A;  1SC3 B;  2BXJ A;  3D0H E;  3O1L A;  2VFV A;  4C8O A;  3PEH A;  8RUC A;  4OFZ A;  4RU9 A;  2YQ3 A;  3O2I A;  3CJS A;  2OMO A;  4NLQ A;  2WVD A;  2GQQ A;  3ZZ0 A;  1HW9 A;  4Y3C A;  3UN3 A;  3MPD A;  2M4M A;  2ZBQ A;  1SIW B;  2DK2 A;  1U47 A;  2M52 A;  2HHH F;  4G1P A;  2DNZ A;  2V2K A;  4MIW A;  5L1J A;  4QYZ J;  2ZNY A;  1D9F A;  2R3V A;  4G1I A;  1NK4 A;  4KYZ A;  2AP6 A;  4YDX A;  3HZE A;  1EB0 A;  3EPI A;  3PX4 A;  2EG1 A;  4S0M A;  1JLF A;  3PVX A;  5L46 A;  4ERD A;  2UVW A;  3GCX P;  3HHL A;  5GAE I;  4L74 A;  4H54 A;  4CO4 A;  1LV5 A;  1T9X A;  2CQ1 A;  2BDP A;  2ZNZ A;  1GFW B;  3CJK B;  1TFY A;  3CD5 A;  3QLH A;  3W2W A;  2DHH A;  2NUH A;  3FMW A;  2PD1 A;  3V4M A;  2ZM6 J;  1VJQ A;  3AAW B;  2C1E B;  3P8B B;  3KHL A;  1XNQ F;  1FXL A;  1YRU A;  1LW0 B;  3QSY B;  3X1L B;  2CQ2 A;  2XO7 A;  3R27 A;  5KG1 A;  5A8K B;  4URQ U;  1PCA A;  3BBF A;  5G0R B;  3UDE A;  2H65 B;  3PY8 A;  3OR1 A;  1L3V A;  2M8H A;  4G1Q A;  2ALY B;  2FIU A;  4HH1 A;  1NPR A;  5IFM A;  4Q45 A;  1AUS L;  1S1T A;  3DOL B;  2AEF A;  3U1M A;  1EP4 A;  3QID A;  3M1V A;  4PXE A;  5HSP A;  4Z7Y A;  4IG3 A;  2ZH4 A;  4OV1 A;  2OJ3 A;  2W9C A;  4PQU B;  4ELV A;  4TU8 A;  4B02 A;  5D15 A;  1RT3 B;  5MAO A;  4NZ0 A;  3VAI A;  2QIF A;  2B9E A;  3GIL A;  3BR9 A;  1YJ7 A;  2DJW A;  3MEG A;  1QTM A;  1S48 A;  1LKZ A;  4KO0 A;  3KHH A;  3TA2 A;  4ILL A;  2MKS A;  3OUY A;  4WZM A;  3IRX A;  4ZLJ A;  4LVO P;  4P74 A;  3WQP A;  2WVB A;  4OYO A;  1PO6 A;  1M5H A;  3K5N A;  2PO4 A;  4P7V A;  4CLZ A;  4I56 A;  2ZIT A;  4AFF A;  5I4M A;  3ILI A;  3CCJ S;  4P73 A;  3P6Y C;  4ZVH A;  3LO3 A;  2J0Q D;  2EFQ A;  2C2R A;  5C5J A;  2HVZ A;  1NK9 A;  3VHQ A;  4R8U A;  1FA0 A;  2OGU A;  1KWM A;  2VUG A;  2I5J A;  3DLK B;  4C8Z A;  4A8M P;  4YEA A;  4QWB A;  3CJT A;  4N8O A;  3J7Z 5;  4QR2 A;  2FTR A;  3OHA A;  4A8Y A;  2Z0G A;  2Y0S D;  1LXN A;  3NBP B;  2MLZ A;  2ZUA A;  3W60 A;  2RF2 B;  3RAM A;  3QT7 A;  4O3O A;  2C2M B;  4QIV A;  2G13 A;  3EMT A;  1G3O A;  3J7A 1;  7AT1 B;  4WFN Q;  1RU1 A;  1DAX A;  1HYS A;  5J2M B;  2YKP A;  3KLG B;  3MAH A;  2ZE2 A;  3GFY A;  3MMA A;  1KFS A;  1MMD A;  3AXM A;  3T5J A;  1QAX A;  2EKN A;  2QN6 B;  2RS8 A;  1YKW A;  1GTH A;  3SFG A;  3F41 A;  3V6D A;  5KFM A;  2KRB A;  5ITH A;  1URN A;  3ETM A;  3V6K A;  5J2Q A;  4ALZ A;  4OI3 A;  1VRT B;  2QA2 A;  1NDK A;  3G4S S;  2VD3 A;  1WKK A;  1O6X A;  3FQL A;  2BQU A;  1T94 A;  1FT8 A;  3GG0 A;  1KHW A;  1VQ4 S;  2JJ4 D;  3LWL A;  3NWG A;  3RW7 A;  3Q22 A;  3OBI A;  2V8G A;  3S7R A;  1GNK A;  2CWK A;  1DHM A;  3D5M A;  2GS8 A;  2WVE A;  3C6T A;  3HVA A;  2QA4 S;  5C2G A;  2PMW A;  1NK6 A;  2Z58 B;  3FKB A;  2IVF B;  3MR3 A;  5KFP A;  2YKN A;  4R5P A;  4ZVT B;  2VFU A;  3OL9 A;  3C46 A;  5B0B A;  2AJ0 A;  3EZO A;  2LXI A;  1AZS B;  2K2P A;  2ZHA A;  5AXN A;  2C2N A;  3CD6 S;  4YOE A;  1FRI A;  1ZA1 B;  1R0A B;  3HMJ G;  4JI4 F;  4ITS A;  2KZZ A;  3RG6 A;  1PG5 B;  4F25 A;  2W4C A;  3TX0 A;  1DTT A;  2OPS B;  3SCK E;  2Q1L A;  4XDD A;  2RAQ A;  2KT2 A;  4ZJQ A;  1RCO B;  4N77 A;  1H98 A;  1WC6 A;  4KKO A;  3O44 A;  3SZ2 A;  3TR5 A;  2J0S D;  2FC9 A;  4OV6 A;  3BB5 A;  4B08 A;  3M7V A;  4HKQ A;  4YQW A;  2R9L A;  5F8H A;  5G4D A;  2VKZ G;  4WKY A;  2FDN A;  2C3P A;  1YI2 S;  2NCK L;  3TZX A;  3QFW A;  4YME A;  1OQ3 A;  1S9G B;  4DR2 F;  1T9T A;  1VJW A;  4O4R A;  5CQG A;  1IM4 A;  1L3K A;  3W65 A;  1A9N B;  2IM3 A;  2DKO B;  1HR0 F;  4DX7 A;  3I82 A;  3JAM Y;  5K14 B;  3MR2 A;  4P72 A;  4K5S A;  3OXF A;  1NSP A;  4EZ6 A;  1RA6 A;  2J8A A;  4IG0 B;  1FF2 A;  3AJD A;  4L3N A;  1TKZ B;  1TEL A;  5THW A;  2D1C A;  3K17 A;  4OYM A;  3WC2 A;  4RWX A;  1S5Z A;  4EK2 A;  5BJR A;  3W66 A;  1Q5V A;  2YWH A;  3TA0 A;  1YK9 A;  1C1B B;  1F60 B;  2LEC A;  4PWU A;  1R43 A;  3HZG A;  1AB8 A;  2XMT A;  3I4H X;  4IRC A;  1CJK B;  3LP2 A;  4N41 A;  3UW1 A;  2V50 A;  3ET6 B;  2FZC B;  2EFP A;  4ID8 A;  4ZLP A;  3CE8 A;  2BKN A;  4UOG A;  1HMV B;  1MU2 B;  1HW8 A;  3GII A;  4AL6 A;  4IFY B;  4PWD B;  2I38 A;  2IVY A;  4OHY A;  2MKJ A;  1AUD A;  3QWP A;  3BJY A;  2X51 A;  4NLU A;  5HJX A;  2RDD A;  3W2V B;  4DS4 A;  2XSJ B;  4J9L A;  4X65 F;  2BRK A;  2QTW A;  4BWJ A;  2UU9 F;  4X4T A;  1HBO B;  3MEE B;  8AT1 B;  2ZH1 A;  1F5B A;  3B6B A;  4C8K A;  3TP2 A;  5DDO C;  2V6A A;  2IM1 A;  2HIY A;  3G6X A;  1U6F A;  2IIH A;  1VMB A;  4WFB Q;  1CC8 A;  4C98 A;  1WC5 A;  4B9L A;  1X4E A;  4CLW A;  1JLC A;  2BJ9 A;  2E5L J;  2BE7 D;  2LXU A;  1TKD A;  3J81 j;  5FLX U;  2MQO A;  3QSI A;  3NS7 B;  1JJ2 R;  3E2E A;  1DTQ A;  1MMN A;  4X62 F;  2JSX A;  2NXN A;  3W7B A;  4X64 F;  4FS1 A;  4WFY A;  2CNO B;  1RT6 B;  4NEY A;  2OPQ B;  2VFT A;  4C8Y A;  2OPR B;  2FZG B;  3L09 A;  3R5A A;  5A6W A;  4ANC A;  2DGV A;  1VC5 A;  1HBM A;  1U0S A;  5GAD U;  4X4O A;  3L9Z A;  5LOQ A;  1RHQ B;  3BN4 A;  3TQ1 A;  5B0C A;  1S7I A;  1CJT A;  2ZBP A;  4FKX A;  5DDR C;  1GMU A;  2HSE B;  1RQ0 A;  2J9C A;  1V9O A;  5GAH I;  3CC7 S;  3H4B A;  3MOJ B;  5KFD A;  1S72 S;  4I1T A;  2KT5 A;  5LMU J;  3CJ8 A;  3D66 A;  1YJW S;  1IVZ A;  2GA7 A;  2VC0 A;  5K8M A;  2FZK B;  5LSL A;  5HAT A;  3GV7 B;  1F1B B;  3LQV A;  3S6E A;  3G82 B;  2Y8Y A;  3MUV P;  3OSN A;  3H5X A;  3CDB A;  3MXH P;  2J6S A;  1SUQ B;  3N6M A;  1NHV A;  5ETS A;  3P96 A;  4JI7 J;  4KV8 A;  4UF4 A;  1JLE B;  2Z57 B;  2DH8 A;  1ROF A;  2FJE B;  2V4J A;  4ZJO A;  2CPJ A;  1D09 B;  3W1Y C;  3OVA A;  3JB9 k;  1JLG A;  3PR4 A;  3BH6 B;  2U2F A;  2Q43 A;  2RIJ A;  4F2S A;  1FRX A;  1WKL A;  4JI3 J;  4OX9 F;  4MKV A;  4DBQ A;  2QSW A;  3DU6 A;  1I1G A;  5IQ6 A;  2V4R A;  4NCA A;  4HTI A;  5FD1 A;  3M8R A;  5DGB A;  2IC3 A;  5FII A;  2N3O A;  4U8Y A;  5KFT A;  3IR6 B;  3HFK A;  4ECS A;  4LRD A;  1QTN B;  1T9Y A;  1N0U A;  1WHV A;  3T9N A;  3RR8 A;  3C2P A;  4ZDN A;  2HFS A;  4KHP J;  3TJ8 A;  5ETP A;  4A8W A;  3HSJ A;  4DN9 A;  4A48 A;  2BX6 A;  5LJ3 Y;  2L41 A;  1FRL A;  3C14 B;  1DAR A;  1VQO S;  5CH7 B;  1REV B;  4KGM A;  4ZLN A;  3B54 A;  4I68 A;  2W7A A;  4O0N A;  2OTJ S;  3M9O B;  2CYY A;  1YDL A;  2GVD B;  4ID5 A;  1MW7 A;  1B0V A;  4LSL A;  2WVC A;  4QWD A;  1VLO A;  4WYL A;  4J5O A;  1XJW B;  1FK9 B;  2Y3Y A;  1IKV B;  4JB8 B;  2L08 A;  3DDI A;  5C25 B;  3MGJ A;  3PFO A;  4Q8E A;  3SXL A;  1GMW D;  3B8H A;  1G2E A;  1RTH B;  2HLT A;  4DV5 J;  4Q8F A;  4USW A;  3HJV A;  2LDI A;  2JC1 A;  3GJR B;  4GKJ F;  3NOG A;  4M5D B;  1AW0 A;  1J5E J;  3CUL A;  5HJY A;  3FFI A;  4DL7 A;  1R0C B;  1SBR A;  4NCG A;  1BD6 A;  2FLN A;  2P9E A;  4C3M A;  1R27 B;  3NNA A;  4U8V A;  2VOD A;  4O0I A;  4TY8 A;  1RAG B;  4UZC A;  2G0I A;  4P6Q A;  4O3P A;  1QDU B;  4Q43 A;  1YIJ S;  2HNZ A;  2KJW A;  4C7Q A;  2AYM A;  4PEO A;  1FE0 A;  2HIQ A;  3GJT B;  1BXN A;  4FNI A;  4ZPW R;  2VKR A;  5DQG A;  2LQ8 A;  2BOP A;  4DPO A;  3C6U B;  5KFZ A;  3ETO A;  3A8I A;  2UUB J;  4U95 A;  1IBK J;  1KC8 T;  2B9X A;  1RJJ A;  1JXE A;  2DEI A;  3FRZ A;  1TKT B;  3TWZ A;  2A1B A;  4YR3 A;  2HBY B;  4N5S A;  5KFX A;  1HNI B;  3MCS A;  3J81 U;  2E29 A;  1B0P A;  1WF2 A;  1KN6 A;  2MEW A;  1K47 A;  2YX1 A;  1WC3 A;  4J9U E;  2KH9 A;  3PW2 A;  2PFD A;  3KK2 A;  3M8P A;  1R7I A;  4XDC A;  1Q82 T;  1X4A A;  2WON A;  1SIZ A;  2QRR A;  1A6L A;  3NXZ A;  1HNV A;  1YJ9 S;  3G9C A;  3T1H F;  1RT4 A;  3DOM B;  2C2E A;  1KLN A;  1KOH A;  3BKU A;  3O3L A;  4LF8 F;  4LF5 J;  1XMO J;  1RAJ A;  4R25 A;  5D0H A;  2GCF A;  3EZU A;  4RW4 B;  1YIT S;  4NAS A;  4FXW A;  1U6B A;  2GIQ A;  4BBY A;  1RCX B;  4DSJ A;  1HD1 A;  5EWG A;  2RIL A;  2GAH C;  2HUR A;  1QSL A;  1BWV A;  1NH8 A;  2EFG A;  5KFL A;  1UPP A;  3Q83 A;  2BJ1 A;  4PPZ A;  1K8A T;  3G6Y A;  2AF6 A;  4OZN A;  4IRD A;  3OFF A;  2MQN A;  3Q8U A;  1XQI A;  3ZZZ A;  1R3N A;  5ETT A;  3DMJ B;  2BJ7 A;  1QUP A;  2QZ8 A;  1KLM B;  4GRS A;  3I5A A;  2V2V A;  3GV5 B;  3N28 A;  2W7P A;  4I7F A;  2ZJR Q;  4ZMM A;  5C2C A;  1U1K A;  4YHH J;  3R2D J;  3N01 A;  1N32 J;  2RQC A;  2DGQ A;  5F8I A;  1JIH A;  3LOU A;  4DV1 F;  1OPI A;  3AOC A;  1HNW J;  4DEZ A;  4DXL A;  5GME A;  3AD9 C;  4YY3 J;  2DH9 A;  3RW6 A;  4LR8 A;  2IMW P;  3MTK A;  5C24 B;  3GFZ A;  3UCZ P;  3DLG A;  2XS5 A;  4IFV A;  4ELU A;  5L1I A;  3BO3 A;  4L75 A;  4C97 A;  5HBM B;  3DLH A;  2DY9 A;  1U1M A;  2ILZ A;  5D0E A;  3BO4 A;  3UWT A;  3PZP A;  2DNN A;  4H4O B;  4FKY A;  2HRT A;  2F1F A;  5E2Q A;  3BKF A;  2E1P A;  4DF4 A;  1YJU A;  2DXE A;  4PUO A;  2MZQ A;  4LUB A;  2RUS A;  1RAF B;  2YNF A;  1UTA A;  5GAE U;  2CJB A;  4PG4 A;  3D6H B;  3GFX A;  4EZ9 A;  1RHU B;  4KAI A;  3KJV B;  3KTQ A;  1IBL F;  1M1K T;  3NMR A;  4NYP A;  3BSO A;  4JI0 J;  4TKT A;  1C4C A;  1SJ4 P;  5AT1 B;  3LA0 A;  4OX8 A;  1NKB A;  3JYT A;  2YKQ A;  2CFX A;  3G6E S;  3ZFV A;  4Z2X A;  5D4N A;  3HVT B;  5E3Q A;  3RBX A;  2HAI A;  4ZKA A;  4V19 X;  2RS2 A;  4O44 A;  2F4V J;  4QU6 A;  1ELO A;  4I2Q B;  1TL7 B;  1ZAW A;  4DR3 F;  3HHD A;  1T95 A;  1ZZF A;  5D78 A;  2XMW A;  5JVG Q;  3EWG A;  4HH0 A;  4NXN J;  2NPF A;  4CM2 A;  1VDH A;  4CDI A;  4PXD A;  4D3H A;  2NR0 A;  1FKP B;  3NGT A;  4C2M A;  1FKO B;  2DPJ A;  4TN2 A;  2N7C A;  4ILR A;  4JI6 F;  5KFE A;  3NGK A;  2B0G A;  1U2F A;  4RU2 A;  2PI5 A;  4ZK7 M;  4DV0 F;  4WFZ A;  1X7V A;  3I55 S;  1UEU A;  3PYD A;  1WOR A;  2HGN A;  3QRR A;  5ETV A;  4ECW A;  5B0D A;  1NBE B;  2CXE A;  1F2H A;  1N5S A;  4F4W A;  3AD8 C;  1SJ3 P;  3NWR A;  1H72 C;  4MK7 A;  1NJZ A;  3BDP A;  4DV3 J;  2VAS A;  3BSC A;  3CNQ P;  2DO0 A;  4DR5 J;  3K58 A;  2NSB A;  4GVB B;  4OX6 A;  1OSD A;  5EX3 A;  4A8F A;  4Y34 A;  4JI5 J;  3EGW B;  2HGL A;  1OYE A;  3FZB A;  4WTO B;  1W25 A;  5GAG I;  2RKI A;  3ZO7 A;  2W8L A;  1S57 A;  3OSP A;  1JXL A;  1TZ0 A;  2DHG A;  4ED8 A;  1RAO A;  3K57 A;  3NGD A;  2VON A;  3JSY A;  3PO5 A;  3KKF A;  2BA9 A;  2W2Q P;  2RDJ A;  1FJG F;  2W2N P;  2DVI A;  4RW8 A;  4TU9 A;  1UWA A;  5BYS A;  3VCD A;  1IKY A;  1LNQ A;  1JLA B;  2GZO A;  3CCR S;  1KHV A;  5KFS A;  2C22 A;  2JH3 A;  4C48 A;  4PR6 A;  4K50 A;  1YJN S;  3DGP A;  5DLG A;  1N8R T;  3U02 A;  3HCX A;  2GHW A;  1ZM2 A;  3LWM A;  3MD3 A;  3GYG A;  1S4F A;  4WWS A;  3I0S A;  2FJV A;  3GYX B;  1B4S A;  4KGX B;  2GV1 A;  2M7S A;  5LMN J;  4C11 B;  2EPI A;  2YQ0 A;  3NKY A;  1KKH A;  4DPW A;  2DT9 A;  3VVT A;  1U09 A;  3KHR A;  3JXO A;  3VR1 A;  1VQ7 S;  2AJ4 A;  4X66 F;  1VQ9 S;  3Q8Q B;  1P9Q C;  4O3S A;  2UXB J;  1Q7Y T;  4QWE A;  5D3G A;  1N5Y A;  2H5E A;  2R8K A;  1MML A;  1NND A;  2F65 A;  1UL3 A;  1ULR A;  1SH2 A;  3A8E A;  1Y5L B;  3MM9 A;  2KO1 A;  4Z7C A;  1LFW A;  1SH3 A;  5IT9 U;  5GMK a;  2HQC A;  1TFW A;  3T1Y F;  1WF0 A;  4DR7 F;  3VGU A;  4DR6 F;  2ABY A;  3V6H A;  3G2X A;  3HSD A;  1R8H A;  1XNR F;  2W9B A;  3FEX B;  2CJQ A;  5BR8 F;  4OZ1 A;  2R7X A;  3CJ0 A;  1AXQ A;  2LKZ A;  2HZC A;  4F4Z A;  2VL1 A;  2DIU A;  2DNH A;  1JLF B;  4WE1 A;  1WC1 A;  4B3T J;  1NDL A;  5IM0 A;  2FB0 A;  3DC2 A;  3QZ7 A;  5ETQ A;  3HHL B;  3A4T A;  1QE1 A;  4F0M A;  2QL9 B;  5J1N A;  4NLT A;  2CDQ A;  2M88 A;  4U96 A;  2OD4 A;  4C0H A;  2CNK B;  1T8E A;  3QLH B;  3W2W B;  5T14 A;  4ECY A;  1VCT A;  2F8H A;  4JYA J;  3V4I A;  1U8S A;  2ZC4 A;  4ECT A;  2ZEJ A;  1CBK A;  3AJ2 A;  5KG2 A;  4ZOS A;  2V94 A;  2AV5 A;  2ZD1 B;  5DQI A;  3H25 A;  3HJF A;  3KLV A;  2AGO A;  1IN0 A;  2B51 A;  2VA2 A;  3U7J A;  3OR1 B;  4CYU A;  4K4T A;  1RTJ A;  2LEB A;  4M5J A;  4G1Q B;  3G6V A;  4DV7 F;  1Y5I B;  4PG8 A;  3W3S A;  4ZVS B;  5U47 A;  4DSK A;  1G4C A;  3IGV A;  1S1T B;  1LWF A;  1HWU A;  1TL1 A;  1EP4 B;  3L7O A;  3M1V B;  4N76 A;  4NLS A;  5F3T A;  4KFB A;  4IG3 B;  3WIU A;  1GH8 A;  2W9C B;  1H73 A;  1AT1 B;  3DDN A;  2OEM A;  4KR0 B;  4JV5 F;  2Z30 B;  3BGL A;  5E3A A;  4C3K A;  2GJ2 A;  3RRG A;  1VQ6 S;  2H4W B;  2QEX S;  3MEG B;  4TLQ A;  2YKO A;  4ZPD A;  3LTO A;  1UAW A;  3JSM A;  4NYZ A;  4KO0 B;  1QD1 A;  1CS4 A;  2CJA A;  4O3R A;  6FDR A;  2R8G A;  2P6S A;  5CYQ A;  3OUY B;  3QAT A;  5CA5 A;  3IRX B;  2FPH X;  2K7K A;  3Q89 A;  3CED A;  2MGZ A;  1U1Q A;  4IH6 A;  1S59 A;  2JDJ A;  3M8S A;  1J27 A;  4UW2 A;  2HHH J;  1G1X A;  2Q3P A;  4N47 A;  1UVN A;  2N4D A;  4Y0F A;  1NPP A;  2B9Y A;  3FBE A;  1VQP S;  3FK4 A;  2QLW A;  2DTJ A;  3FBC A;  4QU7 A;  5CXT A;  1RWM B;  3R9L A;  4CCH A;  1I94 J;  2QL7 B;  2HMI A;  3T6B A;  2I5J B;  4RL1 A;  4L3K A;  4NLG A;  4O3Q A;  1IM6 A;  5E41 A;  1HI0 P;  1NDC A;  2HS0 A;  4YFU A;  2VFR A;  1OJ4 A;  2HBZ B;  1P8G A;  1RTD A;  4CH0 S;  1CJV A;  2PEH A;  3OXG A;  3D6F B;  1RGV A;  5IWA F;  3IWN C;  4B3R J;  4HI2 A;  3F0N A;  2COL A;  5IZH A;  2ZJP Q;  2ASL A;  4TYA A;  4PG6 A;  2C2K B;  1NRK A;  3I9V 9;  2LU1 A;  2C42 A;  1ZYQ A;  2OPP A;  1HYS B;  4R0J A;  1UZH A;  3QAU A;  2LDY A;  4ECV A;  3QT8 A;  3LW5 C;  4WJB A;  2MZR A;  2ZE2 B;  3F56 A;  2C2D A;  5F0U A;  3MMA B;  4HT7 A;  5AXK A;  3GCW P;  2D7S A;  2JVO A;  2MKI A;  3US5 A;  2NSC A;  3V6D B;  5J2Q B;  4KGV B;  2XS7 A;  1GQE A;  2C3Y A;  4A46 A;  3THV A;  3KG1 A;  2F9J A;  2DHA A;  1N36 J;  3SIP B;  3H40 A;  2YX4 A;  4DL5 A;  3UD5 A;  3GJS B;  3J80 U;  2LLZ A;  3OVS A;  4GKK J;  2G1H A;  2MKK A;  3LGM A;  3O6Q A;  3C6T B;  2ZHB A;  4HR2 A;  4MFB A;  1TVR A;  2YKN B;  4R5P B;  2QFI A;  4P52 A;  2MZT A;  3RBE A;  1NAQ A;  5KFU A;  2MTL A;  1CUL A;  4W92 B;  4F26 A;  4QPT A;  2ZJQ Q;  2CPF A;  3HLU A;  3G8T A;  4K0K J;  1NK7 A;  5EWF A;  1HQU A;  3N5B A;  4PG7 A;  4BC7 A;  3D6M B;  1E6V A;  1BLU A;  2Q79 A;  2G0J A;  4I0W A;  1DTT B;  3HHN B;  4WCE Q;  3GIM A;  3CCM S;  2M8D B;  1FRM A;  1SKW A;  2HFZ A;  4EO8 A;  4DLG A;  4DLE A;  4ED3 A;  4KKO B;  3KDO A;  2UUC J;  5EHH A;  3RAQ A;  3EZ5 A;  4B3S J;  1TTH B;  2CPH A;  4B3M F;  2CQ0 A;  1N0V C;  4EWT A;  1VQ8 S;  2QMX A;  3IG1 A;  2WBM A;  3AHP A;  2BMB A;  2I9S A;  5HQM A;  2HK2 A;  2E5I A;  1M5K C;  3MED A;  1S4E A;  2R7R A;  2RRN A;  2B56 A;  2VBX A;  6FD1 A;  1C1C A;  2HQF A;  5J1E A;  4ZIW A;  2HHQ A;  2CQH A;  1TUV A;  2Q66 A;  3T5K A;  4LFC F;  3GSI A;  2YY3 A;  2PC6 A;  4NLD A;  4DUY J;  2GML A;  3NY0 A;  3CMA S;  4FBT A;  2YNG A;  2POK A;  1HWL A;  4J9P A;  2W2M P;  1EAY C;  2ZZN A;  3BBB A;  4LRC A;  3BH7 B;  2VOO A;  1OQ6 A;  3LP2 B;  2H5J B;  5HMW A;  1WTB A;  3ZZU A;  2FGO A;  3NOC A;  4CLP A;  1H2U X;  4A8S A;  1EJ7 L;  4X4P A;  4DV6 J;  1YRT A;  3PFE A;  1OY9 A;  3WIV A;  1GAO A;  1AA1 B;  1PAU B;  1S6Q A;  4XPC A;  4C4W A;  3QGP A;  1DUR A;  3VTI A;  1RAH B;  4I4B A;  1WF1 A;  2HZA A;  4QW8 A;  3UVJ A;  1BGX T;  3PEJ A;  3SEO A;  3VAK A;  3R1H A;  5E5N A;  1R8P A;  4IH7 A;  2B4U A;  2Z2Z A;  3HKW A;  4GMK A;  1PYS B;  3SI8 A;  5KFI A;  1SQG A;  1KRP A;  2HQG A;  1TK5 A;  2ALZ A;  1IQZ A;  3UR3 C;  1FRK A;  3EGN A;  2H4Y B;  2VF3 A;  1WG4 A;  5EDW A;  1JLC B;  4M5M A;  4Y2M A;  2D3O 1;  1ICE B;  1FNO A;  4PCQ A;  1LWC A;  5IC6 B;  2UXC J;  1DTQ B;  3DI6 A;  3ELH A;  2KM8 B;  3VGV A;  4DSL A;  2NQP A;  1DJ0 A;  3GFH A;  4RUB A;  2NXJ A;  1U25 A;  3K7R A;  5A0Y A;  3FEY B;  1IWG A;  3QGG A;  1KBR A;  3CCE S;  2HQI A;  3RB3 A;  1Q8I A;  3C16 A;  4A4J A;  4QZV B;  3W8P A;  1H7X A;  4DR2 J;  1S6O A;  4NA3 A;  4DJB A;  1Q4R A;  4DZD A;  1RWN B;  3F44 A;  1CJT B;  4PKD B;  4CO3 A;  4IQX A;  2B7B B;  2DH7 A;  5K8N A;  1I3O B;  1FDA A;  2XMU A;  2H51 B;  3PDN A;  4P10 A;  3KLI A;  3J7Y I;  2N82 B;  1C0U A;  4OYI A;  5KFY A;  4WKR A;  2VC1 A;  5E7O B;  2ZVS A;  3FEZ A;  5F8L A;  5KAK A;  2D3O R;  1HPZ A;  1UVK A;  2FGC A;  4I2P B;  1KVK A;  4LJM A;  2BV3 A;  2GO8 A;  3PJ9 A;  5A76 A;  1WDT A;  4LRB A;  3VVU A;  1O5J A;  5I42 A;  2AU0 A;  2VU5 A;  1Q0N A;  2ZM6 F;  2UUW A;  4FYD A;  1VRU A;  2BKP A;  5IC4 B;  1FXR A;  3TEG A;  3VAL A;  1RDR A;  2EW9 A;  2M5Y A;  4DR1 F;  3VGS A;  3VV2 B;  1T3N A;  1RT2 A;  3N0V A;  4J9O A;  1ZOT A;  4K4Y A;  4K4U A;  3RRH A;  1QAI A;  1TMM A;  4Z37 A;  2VG6 A;  3PW4 A;  2V4J B;  3LGN A;  4M8L A;  1XMQ F;  4LR9 A;  2RRB A;  1JLG B;  2IYG A;  5M2P A;  1RLD A;  1VIX A;  2GQC A;  2HS3 A;  1FER A;  4QWC A;  3OJU A;  1FTR A;  2VH7 A;  4C3L A;  2UU9 J;  3F73 A;  3L7U A;  1XER A;  2VG7 A;  2CJX B;  3CUN A;  2GVZ A;  1WEY A;  4MYT A;  4OHW A;  4YB1 P;  3D1O A;  3CCZ A;  1UMJ A;  2Q6B A;  2CNN B;  2IC3 B;  3IM9 A;  1B99 A;  3PYE A;  3LAL A;  1L3U A;  2XQC A;  1RKI A;  3RTV A;  4XPE A;  2E1R A;  4DQR A;  2V63 A;  2KVQ E;  1RXO B;  2N4C A;  1NSK L;  3M6W A;  2A2D A;  4Y2K A;  3I0R A;  3T3F A;  5A8R A;  2DGX A;  2J9E A;  4DZ6 A;  3Q2S C;  3U1N A;  4ES1 A;  2OO4 A;  2JEI A;  2XHC A;  1CQN A;  2E1M C;  3KNA A;  3M2R A;  2K06 A;  1EAR A;  2B8Q A;  4CNY A;  4QW9 A;  4FYX B;  2BOA A;  3OR2 A;  4B9S A;  3TAQ A;  1U1O A;  2AW0 A;  2ZOG A;  1URR A;  3G8Q A;  3MFH A;  5D4L A;  1N6Q B;  2C3M A;  1E6Y A;  5HMZ A;  1XN9 A;  1U45 A;  3C15 A;  4LSL B;  1B7Y B;  1S10 A;  4OLP A;  4RNF A;  3DOK A;  4LF7 J;  3EXY A;  5DGA A;  1NPK A;  1RI7 A;  1KQK A;  5A6P A;  4KC5 A;  5M2R A;  3MM7 A;  2YWK A;  4NLR A;  1EKS A;  1IUJ A;  4RZR A;  3FCH A;  2WAQ D;  3EYZ A;  2DHS A;  3CC4 S;  1KDN A;  2VBY A;  2VPX B;  2OHD A;  2VBZ A;  3GIK A;  1FRJ A;  1LOU A;  3N6N A;  2Y1L B;  5I3P A;  2IRU A;  3FFI B;  2XLJ A;  2MQ8 A;  4NCG B;  3QZ8 A;  3EDR B;  3GR1 A;  5JVH Q;  1YBA A;  1FFG B;  4AYB D;  2XYH B;  1S76 D;  1VS3 A;  2WZ1 A;  3I96 A;  4TY8 B;  4CLT A;  2FHK A;  1T02 A;  1U1N A;  1U2R A;  2HNZ B;  4G65 A;  4LBP A;  5L1L A;  1TUW A;  1RT7 A;  3FUY A;  4Y65 A;  2W4D A;  4FYW B;  1DRZ A;  4OX9 J;  1JLQ A;  5E3R A;  3DLE A;  3DYA A;  3PG9 A;  4G3I A;  3UNY A;  3UE2 A;  1QJH A;  2E1A A;  3CSK A;  4WIQ A;  1BWE A;  1T7P A;  3DHX A;  4J7C A;  4WFA Q;  2AX0 A;  2LVW A;  3RB4 A;  3P5T L;  2E7X A;  4OZ2 A;  2X7I A;  1D3W A;  2VG5 A;  3PRB A;  3KK2 B;  3K0J A;  3M8P B;  4IYQ A;  1EKR A;  4Y2I A;  1T03 A;  3UQS A;  5DG8 A;  4EBD A;  3OQ2 A;  4ZCM A;  3BO2 A;  2WON B;  4QIE A;  1WDD A;  2Y1J A;  1VC0 A;  1HNV B;  4CI0 B;  3UO0 A;  1RT4 B;  2CAD A;  3KJF B;  2GNK A;  4XTT A;  1NHK L;  2CKW A;  2V9W A;  2ZH3 A;  1S1V B;  2YXL A;  2Z2Y B;  3TUZ C;  3NAH A;  5KT7 A;  1S6P A;  4ZS6 A;  3BV8 A;  4ZVO B;  1BY9 A;  4UOC A;  2O66 A;  3CJ3 A;  2LQB A;  1NCL A;  3NNH A;  1RWK B;  3N9U C;  4K59 A;  3PKM A;  2JOQ A;  4DCO B;  2W8K A;  4OYA A;  1F5C A;  5A2Q U;  2E5J A;  2DY1 A;  3J7Z T;  3M2U B;  5KFB A;  2Z8Q A;  2J7K A;  4OJG A;  3EX7 B;  2OLW A;  2XCA A;  1RHM B;  3D3C J;  4OLO A;  1UW4 A;  1UJ6 A;  2MB0 B;  4PXC A;  1HFE L;  5EGY A;  4I7F B;  4RNM A;  2U1A A;  3Q8R B;  1HD0 A;  1UVJ A;  2YH0 A;  1DFD A;  4PG5 A;  1N54 B;  3GZ7 A;  3C66 A;  1WG5 A;  1RSC A;  1YHQ S;  3MM6 A;  1ZAX A;  2AEJ A;  2GIF A;  4RNH A;  4TQR A;  1Z2Z A;  1SV5 A;  4DL2 A;  3FSX A;  4IFV B;  1JXV A;  2ADB A;  4I6W A;  3KK3 A;  2BVZ A;  4EYH B;  3CPW R;  2KXH A;  1F2G A;  2B5J A;  2HHV A;  3OLB A;  4NXM J;  1FWK A;  1OY8 A;  3OTO J;  1RAD B;  1JMT A;  3EGZ A;  1Y10 A;  2QC3 A;  2MKC A;  5IT9 Y;  4DSE A;  5KT4 A;  4PUO B;  1LWE A;  2VJV A;  2HFV A;  4NLW A;  2CQ3 A;  3BPD A;  4DX5 A;  5BXI A;  2YNF B;  4TVA B;  2X1F A;  1KFD A;  2UUA F;  2O01 C;  4HI1 A;  2B43 A;  2D74 B;  2WVF A;  1KVJ A;  4U6P A;  2E7V A;  3LPY A;  1FDB A;  4HHJ A;  1TL3 B;  1X5P A;  1TL5 A;  5AE3 A;  3JYT B;  2UP1 A;  4DL3 A;  3J7A N;  5DJB A;  3UCU P;  1IQT A;  3A1Y G;  2XNR A;  4KT0 C;  5J2N A;  2C2O B;  4ZP8 A;  2CPX A;  2IAJ A;  1EHW A;  2MJN A;  2OSR A;  5KFH A;  3CCL S;  3DFE A;  1Q16 B;  4NLV A;  1QVF R;  4DFJ A;  5B09 A;  1FDD A;  3MHY A;  5IT4 A;  2EFN A;  5H9E K;  3GMG A;  3A8K A;  3T6J A;  4LFB F;  1SQE A;  4J9R A;  2LYV A;  2UVR A;  1S9G A;  3H5Y A;  5SZT A;  1HNX J;  1FI4 A;  5E3P A;  2CQI A;  4EEY A;  4LQ9 A;  2E1C A;  3THP A;  4QOT A;  4EMD A;  4H4M A;  4UQT A;  1Y00 A;  5I3U A;  4RNN A;  3TVK A;  1UVI A;  2B8P A;  2HHX A;  2PT0 A;  5DZ6 A;  1TKZ A;  4OL8 A;  2X1B A;  2F8M A;  4ZP9 A;  1CSJ A;  1RLC L;  1U1P A;  3R2C J;  3DU5 A;  5LMU F;  1JK9 B;  3I6P A;  2FC8 A;  4J9V A;  4NZ7 A;  3WX4 A;  3SQG A;  3OXL A;  4ZPB A;  1C1B A;  1H7W A;  5ADZ A;  4F3O A;  1CVJ A;  4Q2L A;  1K0V A;  2EI5 A;  1PJ6 A;  4DQQ A;  1QVG R;  4O3N A;  3BSA A;  1NJY A;  5HVG A;  5KFJ A;  3OTE A;  4D3G A;  1X9W A;  4IR9 A;  2RKI B;  1QLN A;  3SCI E;  5DET A;  1HIY A;  3OPK A;  4IFY A;  2NRE A;  3RB0 A;  2EK1 A;  4NLO A;  4ER8 A;  2DO4 A;  2P9C A;  1PC5 A;  4F7V A;  1S1U A;  2VDI A;  2R2S A;  2K3K A;  2H1Y A;  2DXF A;  2V2Q A;  3AB4 B;  2JNJ A;  1IBL J;  1JX4 A;  2CZ4 A;  1HBO A;  3MEE A;  3LP1 A;  2EBE A;  4LFA J;  3NGU A;  2XG8 A;  5KG4 A;  1FWP A;  1ZTT A;  4RW8 B;  3KK1 A;  4M63 A;  1GT8 A;  2IBK A;  1N5T A;  5L39 A;  2CPY A;  2V2Z A;  4KHP F;  5DM6 Q;  3K5M A;  4USJ C;  2MHN A;  3RZA A;  1RAB B;  3CMQ A;  5BYR A;  1ITP A;  4F36 A;  2MQP A;  2QMU B;  3LGH A;  2WW4 A;  1FNX H;  1NJI T;  3I0S B;  3WX8 A;  1VQ5 S;  4TXS A;  1VOM A;  2MQM A;  4ZVF A;  1B0T A;  2XGQ A;  4HLB A;  1B64 A;  2XZT B;  5J2P A;  4ECX A;  2B4P A;  2MPU A;  4TNO A;  3NL0 A;  4BCA A;  1O8B A;  1D9A A;  1S77 D;  2DR5 A;  1U1R A;  1KNZ A;  5D3G B;  1QSS A;  1LXJ A;  2CJY B;  1N5Y B;  5CYM A;  1ZH5 A;  1UJ5 A;  4NI2 A;  3VZH A;  2HG4 A;  3A12 A;  5B0A A;  2V0N A;  3MM9 B;  3DM2 A;  3HHE A;  4Q0B A;  3J80 Y;  2LEP A;  3BGO P;  3PV8 A;  4RX6 A;  1CG2 A;  2X1G A;  2W9B B;  2MDA A;  4B9T A;  3A8J A;  4DDF A;  3WBZ A;  1F5A A;  3KLH B;  3W5Y A;  2BJE A;  1NM2 A;  2YQ1 A;  3DHW C;  3NGS A;  1R89 A;  4WE1 B;  5F8N A;  1MWQ A;  5IM0 B;  1PJ7 A;  2MQL A;  2IFX A;  4OYB A;  1DLO A;  4ZPV R;  2W2O P;  3S01 A;  1K1S A;  3NNC A;  1GX6 A;  1K44 A;  2RQK A;  1KSP A;  2PA8 D;  4ZVQ B;  3ZNU A;  3H5S A;  1B3T A;  3CC2 S;  1GXT A;  1GEH A;  2HEK A;  2BE2 A;  3W9I A;  4ZVU B;  1WNE A;  1TU0 B;  3FCW A;  3JSB A;  2QJ3 A;  1NSQ A;  1WJ9 A;  2H5I B;  1VK8 A;  3V4I B;  1CPZ A;  4HT5 A;  2ACY A;  1X0P A;  4CLS A;  1FNM A;  3RB6 A;  2ZOF A;  3R1L A;  1A0O B;  2CJ9 A;  2FVS A;  2UUB F;  1IBK F;  1L5U A;  4OYW A;  3KLF A;  3MMC A;  1VQN S;  2GAG C;  1YWX A;  4CYU B;  3MPW A;  5KG0 A;  3KMS A;  1RTJ B;  3IBC B;  2WHO A;  2AYE A;  2ZDP A;  4LR7 A;  3SSQ A;  4ZLL A;  5IV3 A;  3JAM U;  1YG0 A;  4K4Z A;  4L76 A;  3BR8 A;  2DRA A;  1LWF B;  4RBT A;  4X2B A;  3N6L A;  1TL1 B;  3ENQ A;  1MG7 A;  1N56 A;  3IA0 A;  3EVO A;  3HSG A;  1P1T A;  4KFB B;  3FDS A;  2IA0 A;  2M2B A;  1FX4 A;  2XYG B;  3G86 A;  3AA9 A;  3SYZ A;  2G2O A;  4DHV A;  3UD4 P;  3ZTO A;  3GP9 A;  2KRR A;  1R8C A;  3JSM B;  4FF2 A;  4X66 J;  2BM1 A;  3RGI A;  4P2X A;  1CS4 B;  1CJU A;  1NEE A;  4LF5 F;  4BWM A;  3QT6 A;  1YZ7 A;  2DB1 A;  2HVI A;  2A10 A;  5CYQ B;  2O5D A;  1TUG B;  1F3V A;  2FVQ A;  2CRL A;  3JQM A;  3W64 A;  4ETZ A;  2MGZ B;  1IR2 A;  1FE4 A;  1MRO B;  2K7J A;  3H20 A;  5KFN A;  2AT1 B;  3AD7 C;  3T5H A;  1TR0 A;  3T1Y J;  2HHU A;  4YP3 A;  3SSR A;  1JNZ B;  3UN2 A;  1WC4 A;  1X5T A;  4E2F B;  1DQ9 A;  1Y7P A;  4PPD A;  1XNR J;  3MF5 A;  3PIO Q;  2CNL B;  4MKA A;  1UCN A;  2CPZ A;  4CO2 A;  3DCA A;  1TV6 A;  3IRW P;  1GMW A;  1RHK B;  4USM A;  3MFI A;  3VGT A;  2HMI B;  3G8S A;  4NCB A;  3SCL E;  4B17 A;  2FHO B;  4XO0 A;  2AD9 A;  1Z1Z A;  1V3R A;  2DYA A;  1RTD B;  5B7W A;  1CJV B;  4YHH F;  3EVW A;  4QYZ K;  4EYI B;  2LU2 A;  4TYB A;  1V5I B;  4M95 A;  1HNW F;  1NU4 A;  4X4N A;  4YY3 F;  3MM5 A;  2CWX A;  9ATC B;  2OPP B;  3KHG A;  2E7W A;  3AJ1 A;  3M4X A;  2IM0 A;  4RO0 A;  2Z2M A;  3M9M B;  3W9H A;  1RTZ A;  2ACM A;  1M5O C;  2G0C A;  4V1A k;  1TKT A;  2PA3 A;  4USV A;  3JTN A;  1LQ9 A;  3SV3 A;  2XMM A;  4P71 A;  3RBZ A;  1HAR A;  3I5B A;  3CW2 C;  4DV7 J;  1HNI A;  2RHQ B;  1WD6 A;  3LPE A;  4UUW A;  3MUM P;  1KOO A;  1D8Y A;  1FJ7 A;  3CDE A;  1B70 B;  1YLX A;  3PW5 A;  1S0M A;  4UT4 A;  4ZIT A;  2DCU B;  1Z2L A;  3QPI A;  4N56 A;  5GAD I;  4WF9 Q;  3SDE A;  1EET A;  1VBX A;  3M8Q B;  4BHQ A;  2VZ9 A;  3BYR A;  4JV5 J;  1TVR B;  2HND A;  2V4Q A;  1CUL B;  2I8E A;  4IOB A;  2PMH A;  4LF4 J;  4LRF A;  3ZTS A;  4IO1 A;  4WII A;  3K5O A;  1SH0 A;  3HP6 A;  2BR0 A;  3MAQ A;  5SUH A;  3FSY A;  5B0E A;  4O4G A;  3PM9 A;  1HQU B;  2F4V F;  3ZTP A;  1E6V B;  1GX5 A;  1KS2 A;  2XZW A;  2ZH9 A;  1S6U A;  3GR0 A;  1KR4 A;  4NXN F;  5C7P A;  3AY0 A;  1N33 F;  4RUH A;  4QQB A;  1XMB A;  3VAG A;  2RJZ A;  3GON A;  2HWH A;  3W5Z A;  1O51 A;  2RD5 C;  2YPZ A;  1HI1 A;  2OEL A;  4LF9 F;  1VC6 A;  4DI6 A;  3DMJ A;  5JXS A;  3AOD A;  5AXM A;  1ARO P;  2RVJ A;  2YVS A;  4CH7 A;  1RE1 B;  2XO6 A;  2KN4 A;  1R6V A;  3IS9 A;  3TZY A;  4HTJ A;  3MED B;  5K20 B;  1V6H A;  4HHU A;  3HT0 A;  3K5L A;  4LSN A;  1C1C B;  5J1E B;  2XBP A;  3CJ5 A;  2HHS A;  1F3F A;  1FEE A;  1IR0 A;  4CTA A;  3PIP Q;  3BN7 A;  1S12 A;  4DV2 J;  2XWX A;  3A3N B;  3TZW A;  2ROE A;  3HD1 A;  2RDI A;  2EWH A;  2ROP A;  4NMX A;  2YNG B;  1W2B R;  3ZZY A;  5KFC A;  3ZZT A;  3KLE A;  4YUD A;  1NH7 A;  3ONQ A;  1NK5 A;  2MZ1 A;  2YNH A;  2FHM A;  2FVC A;  4H4O A;  4WFX A;  4EU0 A;  2G9O A;  1NB2 A;  1X8D A;  3KUH A;  3OTB A;  4J9S A;  2VQE F;  3MR5 A;  2RB7 A;  2HAF A;  3BGR B;  4E8U A;  5DG7 A;  2HRY A;  3CWJ A;  4C0O C;  3M9N B;  3JQJ A;  3R6G B;  1FKA F;  3DRS A;  1S1X A;  3WHI A;  4F3Q A;  1HQ2 A;  2GGP A;  5D0R A;  2J0X A;  1S6Q B;  4OJ1 A;  2WOM A;  2OAU A;  2AMC B;  2B6A A;  2QE5 A;  2FQQ B;  2ILY A;  2VBW A;  1N48 A;  2JEJ A;  3N4W A;  3UVJ B;  3CO0 P;  4LVN P;  3BF4 A;  2HRU A;  7FDR A;  6AT1 B;  2RQ4 A;  3GV8 B;  4QR1 A;  5CYJ A;  1WHX A;  2YTC A;  4P9S A;  5ETN A;  1TL7 A;  5B0F A;  4O23 A;  3HHL C;  5AJ3 F;  2DBB A;  5LXY A;  5LMN F;  3BSN A;  1VIO A;  4CT9 A;  4QIW D;  4J90 A;  1LWC B;  3ILJ A;  3JQK A;  1ZAV A;  3DI6 B;  1CQM A;  2R4F A;  3ILO A;  4K7Q A;  4ZHR A;  1RBL A;  3KNG A;  4P7T A;  2UXB F;  5A0Y B;  2XB2 D;  2XMA A;  3BYP A;  4NX9 A;  1S9E A;  3CDW A;  2R8J A;  2IM2 A;  2KB2 A;  1VRQ C;  1S0V A;  3R7S B;  1GXU A;  3POT A;  5HAO A;  2AJ1 A;  2HK3 A;  1HBU A;  4M94 A;  2BBE A;  2XY5 A;  2QLX A;  4RW7 A;  2DNL A;  1BC6 A;  4HDG A;  4HAC A;  4QR0 A;  3H7H B;  5JUM A;  3X3U A;  1Y4Z B;  2MZS A;  4JV0 A;  2A3J A;  4LFC J;  4C8M A;  2HZV A;  2OML A;  4QCL A;  4B3T F;  1DQ8 A;  3KLI B;  3FBB A;  1KON A;  3D1H A;  1H2V Z;  1C0U B;  2P2C B;  4OI2 A;  2MQQ A;  4B3O A;  1Y0H A;  3R3T A;  3W9J A;  1HPZ B;  2H9Z A;  4LF1 A;  3Q86 A;  2KFZ A;  2QYG A;  5KFR A;  1PC4 A;  3TW0 A;  4W98 A;  4I67 A;  3IC1 A;  5I42 B;  1FD2 A;  4LF2 A;  1FHT A;  1REG X;  4ED4 A;  4JYA F;  3MAA A;  2MY7 A;  3CGI A;  4WZQ A;  3BQ0 A;  5L8R C;  3Q8P B;  2KFY A;  4UOH A;  2RE1 A;  2XM3 A;  1CEZ A;  2H3E B;  4F2R A;  1RT2 B;  1RP5 A;  1JJC B;  1N4L A;  1JB0 C;  4RW6 A;  2CDR B;  5H9F K;  4XAK A;  4CQ1 A;  2VG6 B;  2CZV C;  3MEC A;  5F8G A;  1T9V A;  1HA1 A;  4N8N A;  3UFC X;  4AXI A;  5KG6 A;  3OW2 R;  2AYG A;  1BQN A;  3PAC A;  5KFF A;  2CPI A;  4ILM A;  2B3T B;  4P2M A;  3ZTR A;  2D3U A;  3NRB A;  3CO9 A;  2VG7 B;  3HVR A;  2W2P P;  2GVZ B;  4KTQ A;  4XIU A;  2EEY A;  2LCW A;  3NGR A;  5GVQ A;  2R7O A;  3L7P A;  3FMB A;  1FTC A;  4E0D A;  3AOA A;  2FY1 A;  4MT1 A;  3D68 A;  5M2U A;  1VQY A;  4Y00 A;  1XR7 A;  5CD4 A;  4OZ0 A;  4TY9 A;  3LP0 A;  4BC9 A;  2W01 A;  2O67 A;  3I0R B;  5A8R B;  1VYA A;  1U49 A;  4UY8 T;  1KP6 A;  3DN9 A;  3DKD A;  2NUU G;  3W8G A;  1P1L A;  4P2F A;  3M2R B;  2E9R X;  2FJW A;  2X3G A;  3OR2 B;  2ZWO A;  4PRF A;  3R8Y A;  3AT1 B;  1RT1 A;  1E6Y B;  1RWX B;  1J5O A;  3C15 B;  3TUP A;  3V5R A;  1ZS6 A;  2RHS B;  3TUJ C;  4DFM A;  4OMF G;  3DOK B;  3QIP A;  3Q2T C;  5EX0 A;  1FJE B;  5K8P A;  1I94 F;  3K8V A;  2V8D A;  2WSF C;  4NOH A;  1S0O A;  4KB7 A;  2DR6 A;  1SJQ A;  2BAN A;  3MM7 B;  4CP5 A;  2G4B A;  1DQA A;  5KG5 A;  2F63 A;  2W1B A;  3D0I E;  4Q7A A;  1SB6 A;  1GTE A;  1HBN A;  3NG8 A;  2BW7 A;  4CLK A;  5KFO A;  4F67 A;  2MYF A;  4B3R F;  1ZZN A;  2P6T A;  3TAM B;  4C8N A;  4FVC A;  3T41 A;  2YWF A;  1K0T A;  3NCP A;  1T9W A;  2IPO B;  9RUB A;  4DR1 J;  1H74 A;  4K5R A;  1S49 A;  2BZ2 A;  2ZD1 A;  5K9F A;  1RT5 A;  1SC4 B;  1YX2 A;  3MDF A;  2IJF A;  2R42 A;  1PYO B;  2QLF B;  2GFF A;  1XMQ J;  4ZPC A;  1UFW A;  5F3Z A;  4PYA A;  1RT7 B;  4F04 B;  4F0H A;  3P5B P;  5L9X A;  4K4W A;  3HM9 A;  2Z2L A;  4KPC A;  4KE5 A;  2R8H A;  1LEO A;  1Q79 A;  2NXC A;  3K8W A;  1N36 F;  1BMQ B;  2DNQ A;  2JC0 A;  2VQF F;  4AND A;  3D2W A;  1JLQ B;  2DGW A;  3DLE B;  3DYA B;  4CZC A;  2AIR B;  4CT8 A;  1VQM S;  2J5A A;  4I6Y A;  4GKK F;  1W7W A;  4U7U K;  5T7L A;  2XUL A;  1XEZ A;  3PYF A;  1U02 A;  4LIW A;  1MLA A;  2B7C B;  2L3M A;  4EGL A;  2HNY A;  3QAE A;  4IRK A;  4E98 A;  1YTY A;  3OTC A;  3B82 A;  3MMB A;  2FYX A;  1LK5 A;  2RU9 A;  2QA4 G;  1NJW A;  3GE9 A;  4Y6I A;  2VG5 B;  4WP8 A;  2ZFH A;  3UR0 A;  1F9F A;  1BQM A;  2J7U A;  4K0K F;  1IJE B;  3DLJ A;  1T03 B;  1Y3J A;  2LFV A;  3ULH A;  3OFG A;  3V6J A;  2DRB A;  3G96 A;  3BZQ A;  3CVK A;  1U7L A;  1YGY A;  1C0T B;  2D9P A;  5FJ4 A;  2P5V A;  2DNY A;  3M8Y A;  1F0X A;  3I9Z A;  1ZM9 A;  1CLF A;  1VQK S;  2A6O A;  4I64 A;  4U67 Q;  1F9H A;  4PAB A;  2BYC A;  1S6P B;  1LWX A;  2UUC F;  4CO5 A;  1WSR A;  2IBO A;  2EK6 A;  4B3S F;  5KT2 A;  3NS6 A;  2HHW A;  2DIV A;  4IO9 Q;  4JI1 F;  4CLU A;  2YWW A;  1BE4 A;  4MYU A;  2V67 A;  2KG0 A;  4OI0 A;  3IAS 9;  1N34 J;  1EIY B;  4J9M A;  3AXK A;  3H42 A;  2UVU A;  1U8W A;  3RUB L;  2FJA B;  4FP9 A;  1N5Q A;  4FVM A;  4MH8 A;  4J37 A;  2VDH A;  2J0W A;  1Q1K A;  4OJ3 A;  5KT5 A;  3DGV A;  5LSR A;  4IDK A;  2KI2 A;  5BYQ A;  5ETM A;  5CCL A;  2UZA A;  3UN5 A;  3IR5 B;  1G7C B;  4DUY F;  1IXK A;  3DRP A;  1ZBT A;  1VFJ A;  3CJ2 A;  3H5U A;  3FQK A;  2MY8 A;  1EQ0 A;  2MZJ A;  3MM6 B;  5HN0 A;  3IO1 A;  3ENV A;  1IBM F;  4RW9 A;  1SV5 B;  4AXJ A;  1NHU A;  4OHV A;  4Q44 A;  2MKH A;  2KM8 C;  2AWZ A;  3KK3 B;  2ASD A;  2FHJ D;  4DX6 A;  1YJV A;  2NLW A;  1UVL A;  1Z4U A;  1QAJ A;  2B5J B;  3QYY A;  4AQY J;  2AZ3 A;  4WTY A;  4DV6 F;  1ZTW A;  1UEK A;  3D6T B;  5KOW A;  1UW9 A;  2W4P A;  2LQ9 A;  3R7N B;  3CCQ S;  3DXB A;  1FES A;  1LWE B;  1HKA A;  1TL4 A;  3NS5 A;  2RH3 A;  4LT6 A;  2VFS A;  3ZTQ A;  4U7U D;  3R5D A;  3HI9 A;  2L9N A;  5F9L A;  2R7W A;  1PYT A;  5KFQ A;  4W4M A;  5CZV A;  4IUF A;  2N7Y A;  2CQD A;  1UA0 A;  1ZM4 A;  1I51 B;  1Q8B A;  2PE8 A;  3JTP A;  1U0H A;  2ZH6 A;  1MN9 A;  3DXS X;  1C2P A;  3PRD A;  4KQZ A;  2R2U A;  3FC9 A;  1SI9 A;  3NCQ A;  4JOU A;  4LF6 F;  5J2N B;  3RU0 A;  2L48 A;  3IAM 9;  2IAJ B;  1Y5N B;  1IBC B;  1U4B A;  3VWS A;  3FGV A;  4L73 A;  4DSI A;  2RML A;  4FF3 A;  4LRA A;  2UXC F;  1TQL A;  3NMA A;  2KXF A;  2A0F B;  2YWG A;  5E0O A;  2DCL A;  4WP9 A;  1BQX A;  2EFV A;  1VBY A;  3N5F A;  2J76 E;  3MCM A;  1FWL A;  2NS1 B;  3M32 A;  2B4O A;  4MJK A;  2CG8 A;  1T05 A;  4B9U A;  1RIS A;  3HHL D;  4DQS A;  4RBV A;  1FJC A;  3CXC R;  3QGH A;  1WOO A;  4DL0 C;  4H4M B;  4M1K A;  4Y2A A;  2W24 A;  3EGV A;  4CLY A;  5ETO A;  5I3U B;  1T0T V;  4RUC A;  2HKE A;  1YVF A;  3OHB A;  2MST A;  5H9F J;  1L3S A;  3NLC A;  3PW7 A;  2DNO A;  3ITH A;  2HWI A;  3SSS A;  2DNP A;  4DF8 A;  4G6V B;  3QMQ A;  3KWM A;  2LA4 A;  5DG9 A;  5HP1 A;  3SQG B;  1SXL A;  3PW0 A;  2IRX A;  1AYE A;  1VBK A;  1FDN A;  2MLY A;  1RTI A;  4B9M A;  1KTQ A;  3PYG A;  3ICL A;  4OZL A;  4ZCL A;  2B4V A;  5A8W A;  2KG1 A;  4ZVR B;  1WEX A;  2IVM A;  3W63 A;  2E9T A;  5KFA A;  3DRX A;  3KG0 A;  3QRQ A;  2ADC A;  4DUZ F;  5GMD A;  4ENO A;  2AGQ A;  1WOS A;  4DR4 J;  2HHT A;  5DLF A;  2XY6 A;  4NML A;  2BM0 A;  4X4S A;  2JLE A;  1ACM B;  3ZZP A;  2UUA J;  1S1U B;  3JS9 A;  3TJA A;  3C8Y A;  2CQ4 A;  4J9Q A;  2UXD J;  1PIL A;  2KYZ A;  3T5L A;  3HO1 A;  5HMX A;  3LP1 B;  2JHE A;  1KTV A;  4ZP7 A;  5LJ5 Y;  3Q8S B;  1CC7 A;  3CCW A;  3KK1 B;  1Q5Y A;  3T19 A;  2GO9 A;  4USH A;  2HFN A;  4R0E A;  3PNI A;  4NZ6 A;  3C3L A;  2KFN A;  5LXR A;  2J6T A;  4BDP A;  3QJL A;  3SV4 A;  4MIA A;  2PEB A;  1ZPW X;  4UOF A;  3TZZ A;  2BJ8 A;  3IFE A;  2ZBI A;  2ZKU A;  2OD6 A;  2JZ5 A;  2IYI A;  1K1Q A;  1W2I A;  4CM0 A;  3VAH A;  2HPU A;  1TKX A;  4QJV A;  4N7T A;  4A8O A;  5J2P B;  2QA1 A;  4LFB J;  2L9D A;  2XGP A;  3OVB A;  5KT3 A;  4R8U B;  4NE9 C;  1I5O B;  5IQQ A;  5L1K A;  2R7Q A;  3GPA A;  3BEG B;  4X4Q A;  2NZ4 A;  5CYM B;  1M0S A;  4LF7 F;  2OSQ A;  4NI2 B;  4BLG A;  2E9Z A;  1JJH A;  3NAI A;  3DM2 B;  4Q0B B;  2LXF A;  5KTQ A;  3GQC A;  2D3Z A;  1NK0 A;  2LA6 A;  3KOA A;  5J1P A;  2PII A;  4I2P A;  1O0P A;  4Q5V A;  1XNQ J;  5FLX Y;  3GYN A;  2DR7 A;  3I5C A;  3HVW A;  1U2C A;  3KFW X;  2A18 A;  2LEA A;  2IJN A;  4ECU A;  1H6K X;  1S7H A;  1DLO B;  1M1G A;  3H2U B;  3I56 S;  3BS9 A;  1VK3 A;  2E66 A;  4ECZ A;  1JJ4 A;  3B78 A;  2K1R A;  4ZCK A;  5GAH U;  5IXU A;  3I31 A;  1JQG A;  5HRO A;  2YNI A;  4QBU A;  2SXL A;  3SMZ A;  3K5P A;  2BE2 B;  2ATL A;  1S97 A;  3OL8 A;  4LBH A;  1Q81 T;  4USI A;  2VJU A;  4ED0 A;  2R8I A;  4OHZ A;  1UFK A;  3G87 A;  2KKH A;  2VPZ B;  2VIC A;  2Y1R I;  1G6B A;  1H38 A;  1SC6 A;  2V69 A;  8ATC B;  2UV8 G;  1U48 A;  5ETK A;  4YB5 A;  4V19 J;  4PAA A;  3KLF B;  5JMN A;  4X4R A;  3MMC B;  5LL6 d;  1RU2 A;  2PDA A;  4OI6 A;  3HX9 A;  2JVR A;  3IWL A;  2V5H G;  5LT5 A;  1SJ1 A;  2AHO B;  2Y1I A;  4F02 A;  1DY3 A;  4DCP B;  4KGK A;  3D4J A;  1HQE A;  4ZVG A;  1KQG B;  3BM7 A;  2ERR A;  4ED6 A;  1U6Z A;  2BKO A;  3VZI A;  1TAU A;  1AFJ A;  3PR5 B;  2GMH A;  4OHX A;  3CJ4 A;  1HNZ F;  3KJN B;  2CJK A;  2G1D A;  1BHN A;  3RRK A;  4JI8 F;  2MKY A;  3E01 A;  1TP7 A;  4TQS A;  2BJD A;  2CQB A;  2JEF A;  1MNE A;  2JEG A;  3M6X A;  1RYS A;  2C2Z B;  4M5L A;  2CUY A;  1N6Q A;  1PSD A;  2YWE A;  3H2V E;  5HO4 A;  2DHX A;  1CJU B;  3DRR A;  3A3P B;  1M5S A;  1OO0 B;  1SL2 A;  5IOL A;  5KFV A;  3GJQ B;  1MWY A;  1W26 A;  4RR5 A;  3MWB A;  1HHS A;  2QMW A;  1X0F A;  4DV4 F;  1NO8 A;  1V5V A;  1RWU A;  2NPI A;  5DRK A;  2DNG A;  4DG1 A;  3UNG C;  1S0N A;  5C42 A;  4F0K A;  3OFH A;  5CHC B;  1H0H B;  1TV6 B;  3RAX A;  4WK1 A;  2DNK A;  4P2S A;  3LAK A;  5HI7 A;  3MMJ A;  1RAA B;  4IQM A;  3HF5 A;  2XZD B;  3IN5 A;  3VQT A;  2FUG 9;  1RAE B;  3IP0 A;  4A8K A;  1F6T A;  3OTD A;  4ZPT R;  1C4A A;  2J8S A;  2YX7 A;  5KG3 A;  2XI2 A;  3M2V A;  2P9G A;  2QLB B;  3Q24 A;  3DNC A;  3HK2 A;  3H98 A;  5F9N A;  4J91 A;  4OJH A;  1VIS A;  1R31 A;  3BDE A;  3HXM A;  2ZUG A;  2GX8 A;  5L38 A;  3MM5 B;  3M30 A;  2CVI A;  1ZPV A;  4JI2 F;  2HFO A;  1X4C A;  3EUN A;  1UA1 A;  1OSC A;  2BQ3 A;  3TI0 A;  4KH1 B;  4NXM F;  1X4B A;  1IKW A;  5KOX A;  3QO9 A;  5CZX A;  3H8Y A;  3W62 A;  3OTO F;  3P4U B;  3E3X A;  4P75 A;  3MM8 A;  2JRS A;  2VHG A;  4RWW A;  4U7C A;  2FVR A;  2NXU A;  4FPR A;  3QJJ A;  4LIR A;  1FO1 A;  5CD4 H;  4JI4 J;  1YJT A;  3SCJ E;  2PMZ D;  4CLF A;  1Q95 G;  2VA3 A;  3PJX A;  5LM7 E;  1HWI A;  1RBA A;  3SDE B;  1EET B;  2ZDO A;  4MTP A;  3TVY A;  1VI7 A;  2BQR A;  3HUL A;  2XYP B;  3TAR A;  2HND B;  1R6Y A;  2BRL A;  3D67 A;  2BE9 B;  1TK8 A;  1Y11 A;  2DGS A;  2M0G B;  3K59 A;  4M5H A;  4KY3 A;  1OY6 A;  2QO3 A;  1S1V A;  2NZC A;  3D0G E;  4J9N A;  4LMZ A;  2P8I A;  4AE5 A;  4O4G B;  2O3D A;  2WW8 A;  1MN7 A;  1GMV A;  3CF5 Q;  5HVF A;  5HLF A;  1LW2 A;  4PYD A;  1UWB A;  4OI1 A;  4YB7 A;  1RBO B;  5EN1 A;  1MWZ A;  3MPY A;  1HBM B;  1XC9 A;  1IKX A;  4LQ3 A;  3J81 Y;  1HR0 J;  2ZC3 A;  1PBU A;  4A8X A;  4ICL A;  1HNX F;  1JLB A;  1WEZ A;  4RBU A;  3M2U A;  2BJ3 A;  1VR6 A;  4KHM A;  4YS2 A;  3KUE A;  2ROG A;  4NA2 A;  4GC6 A;  4DPU A;  3QNW B;  2XI3 A;  3PCO B;  2QX0 A;  1XIQ A;  3JSR A;  4K4S A;  3IS9 B;  1XR5 A;  4ECR A;  3ENW A;  2OEJ A;  1ZM3 A;  3OL7 A;  4LSN B;  2HYI B;  3TNV A;  1J2V A;  4TU7 A;  3QQC D;  2WB4 A;  3GG1 A;  3L4B C;  4CTA B;  1JKH A;  4KV8 B;  5D4O A;  1QAY A;  1X9S A;  3D1Q A;  3D28 A;  4RNO A;  4A8Q A;  1WC0 A;  3KLE B;  2GQ2 A;  2KHC A;  3V81 A;  4CO1 A;  5FDL A;  4MKB A;  3AOB A;  2YNH B;  5CCM A;  2MJU A;  2KDO A;  1X4G A;  5KFW A;  2CPE A;  1RKJ A;  3FJ2 A;  5CAA A;  4X65 J;  1T11 A;  3UDV A;  2BEF A;  2YBV A;  1R0B G;  3D3B J;  1S1W A;  4MAK A;  3DRS B;  3HFZ B;  1S1X B;  1TL3 A;  4NEZ A;  4WBF A;  2GGP B;  2WK4 A;  3THT A;  2YKM A;  1D1U A;  3KJQ B;  3KG4 A;  1UVM A;  4LFA F;  2WOM B;  3ENA A;  2NYI A;  3CD7 A;  5MLC V;  2B6A B;  3PXG a;  3CCV S;  4X62 J;  2XNQ A;  3P45 B;  1AFI A;  1K73 T;  2FLL A;  2EBG A;  4OIX A;  4X64 J;  2V68 A;  3PO4 A;  2K3I A;  4K2X A;  1VBZ A;  1DBD A;  2R7U A;  1SL1 A;  4BS2 A;  1WHW A;  2BAC A;  4KIA A;  2OFG X;  4ID5 B;  3KYL A;  1N33 J;  1WTF A;  2KVI A;  1OMS A;  4KPY A;  1X4F A;  3QGI A;  2W25 A;  4I6A A;  4RKU C;  3MCO A;  2V8P A;  4ELT A;  4LF9 J;  4ZHR B;  3CB4 A;  3ZZR A;  4IR1 A;  1X31 C;  3AQO A;  3LF0 A;  4JUZ A;  5DDP C;  1S9E B;  3VAF A;  4ZN3 A;  5AE1 A;  3POT B;  3FBF A;  3SBM A;  1FX2 A;  2AKW B;  3CJK A;  4LBI A;  2DIS A;  1HBU B;  4RW7 B;  3CTR A;  3FZ2 A;  4DPX A;  1OS5 A;  4CO0 A;  3Q23 A;  5D8H B;  2APO A;  5HMY A;  4HAC B;  3TRG A;  3G71 S;  1LW0 A;  5K8O A;  2WRM A;  2RRA A;  4DQP A;  1K9M T;  4HVZ A;  5A8K A;  2QGF B;  1WUU A;  3MD1 A;  2HBR B;  4B3O B;  4MK8 A;  1R8A A;  2J9D E;  5G0R A;  2HVE A;  2IA6 A;  1KD1 T;  2ZZT A;  2KT3 A;  2KZM A;  3H2L A;  3BQ1 A;  3EM1 A;  4HEA 9;  1WSV A;  1LK7 A;  2AZ1 A;  2VQE J;  3DOL A;  3EE3 A;  4UQG A;  2XMK A;  4EFA C;  4FF1 A;  3MAA B;  1JWW A;  1VHF A;  3OT9 A;  3OD2 A;  4CH1 A;  1GXL A;  4PQU A;  1M90 T;  3OLA A;  3CJR A; 
#chains in the Genus database with same CATH homology
 2PMW A;  2W2O P;  3VV2 B;  2W2M P;  3WHI A;  2Z58 B;  4NMX A;  2E1P A;  3CO0 P;  2W2P P;  3H42 A;  1SCJ B;  3GCX P;  3A3O B;  3VHQ A;  2W2N P;  1R6V A;  2Z2Z A;  3WIU A;  2ZWP A;  2XTJ P;  3A3P B;  4YN3 B;  2Z2Y B;  3BGO P;  3GCW P;  2Z56 B;  2QTW A;  4K8R A;  3CNQ P;  1V5I B;  1SPB P;  2ZWO A;  4OV6 A;  4NE9 C;  3A3N B;  4JP8 A;  2W2Q P;  3T41 A;  3AFG A;  3BPS P;  3QFH A;  3WIV A;  2Z30 B;  3SQO P;  1ITP A;  2Z57 B;  3P5B P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...