3H42A

Crystal structure of pcsk9 in complex with fab from ldlr competitive antibody
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title From the Cover: A proprotein convertase subtilisin/kexin type 9 neutralizing antibody reduces serum cholesterol in mice and nonhuman primates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 21
structure length 92
sequence length 92
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3h42A01
4K8RA 2QTWA 3CNQP 4NE9C 2W2QP 4YN3B 3H42A 2Z56B 2E1PA 1V5IB 2W2OP 2XTJP 1R6VA 2Z58B 1SPBP 3A3NB 3AFGA 4OV6A 3VV2B 2PMWA 3SQOP 2ZWOA 3VHQA 2W2NP 3WIUA 2W2MP 3A3OB 3A3PB 3WIVA 4NMXA 2W2PP 3QFHA 3GCWP 3BGOP 2Z57B 3BPSP 3CO0P 3GCXP 3P5BP 2Z30B 2Z2YB 3T41A 4JP8A 2Z2ZA 2ZWPA 1SCJB 3WHIA 1ITPA
chains in the Genus database with same CATH superfamily
3E2EA 1RT1B 1HD0A 2GO9A 1F6TA 2FY8A 3QQCD 2EXUA 2XG8A 2OFHX 3DRYA 4OI2A 3OXGA 1C0TA 4YHHF 3EGZA 2YKNA 1KVIA 4HR2A 4OJHA 4FNHA 2WVDA 2UXDJ 4FF2A 2XSJA 4EGLA 1M1GA 3CSKA 4DPXA 2G9OA 2CWKA 2M8DB 2WBMA 4EYHB 1S9EB 3OBIA 4P2SA 3MCOA 5CYQB 3HHLA 3QWPA 3ZZPA 1NRKA 3HVTA 3SZ2A 3IR7B 2FHJD 2B7BB 3R97A 2HSEB 1AYEA 1RHRB 2XEXA 2AGQA 2EFGA 2C2RA 4I68A 4P71A 2G1DA 1RAHB 2WVFA 2K3KA 3QZ8A 3K0JA 4M1KA 4ZVSB 1KDNA 4X66F 4CO4A 1NU4A 5LSLA 1LW2B 1LNQA 4I1TA 4N7TA 3JTPA 4DFKA 2YKPA 4NL5A 2LVWA 2RDIA 3A8EA 4QWBA 4KRWA 2JEFA 1TKZB 4TU9A 1WG5A 4O4GB 4NCGA 1AZSB 2NYHA 1RXOB 1EIYB 2H1YA 3CCVS 2ZWOA 2XY5A 3MD1A 3JQJA 3P8BB 1WTBA 3OL9A 2KL8A 4OLPA 4ID8A 1W7WA 4X4RA 5E3QA 5ADZA 4OI1A 1OQ3A 2L9WA 2YKOA 1VLOA 4CWBA 5J1EB 2XB2D 2FDNA 4ZVHA 4BC9A 4PUOB 2V8PA 4HTJA 5HQMA 5J2PB 3KHHA 2HNDA 4RWXA 3AA8A 4LR8A 3RBZA 2GVDB 3M2UA 2L9NA 3HULA 4DU8A 2I1RA 2BX6A 3NY0A 2M88A 3ZTQA 4PXCA 1VRTB 1U7LA 2YWHA 5KFVA 4WJBA 1VQ7S 2FHKA 3CDBA 2E5IA 2DNHA 3CJRA 3J81U 3O5TB 4QYZK 1CULA 3RJMB 1UVKA 3KLVA 2XYHB 5KG5A 2V4QA 2H48B 3VV2B 5F9LA 1VQSA 4FYXB 4LFAJ 1UAWA 2ZDPA 3DM2B 3DDKA 3C15B 3W64A 2MQLA 3NNCA 2QX0A 4JI7J 3IR5B 3JB9k 1KD1T 4MIAA 5GAGU 1CEZA 2PMWA 2VBWA 3ZTRA 1UVMA 2UVUA 4N47A 2SXLA 3VVUA 4DSKA 2HWHA 5IT9Y 4YB6A 1U1KA 2RT3A 3VQTA 4OZJA 2DCLA 4ED1A 1QSYA 1RK8A 3GONA 2O66A 1KR4A 3OW2R 1Q5YA 4UOHA 1YGYA 2IRXA 2XWXA 2XZWA 3SFGA 2NQPA 2VBYA 5LT5A 4N76A 2MMYA 3RR8A 3TQEA 3VAKA 1C1CA 5C24B 3MECB 2CPEA 2D69A 3ILJA 1IBMF 1Y00A 5ETPA 3MOJB 1L3SA 4DV2J 3DCAA 3AXKA 1U0HB 3FK4A 3B78A 2MB0B 4C7QA 3JQKA 4G6VB 1WF0A 4F25A 2ZC4A 2WW4A 3Q8QB 4JYAF 1RT4A 4KGVB 3CTRA 2DT9A 3VGVA 2YNIB 2RQ4A 3PDNA 2CJ9A 3MZIA 4QWCA 1T03B 2QEXS 2R8IA 4B3RF 2I5JB 1UZDA 3TO8A 4ZITA 3M7VA 4MKVA 4C11B 4U6PA 1Y5NB 4ED3A 3H4BA 1FX2A 2QL7B 3C46A 3AHPA 1SJ3P 4PWDA 3QIPA 4IDKB 1S77D 3W9IA 4RUBA 1F3FA 4P2FA 1RAOA 3D6MB 2CUYA 2LQ8A 5HJXA 3SSRA 2P5VA 2LQJA 3SCKE 1GTEA 2YBVA 5E3PA 2B4UA 1M1KT 2MHEA 4TYBA 3QAEA 3NKYA 1JJ2R 1FNMA 1R31A 1AW0A 4A8MP 5KFYA 4ZKAA 2ADCA 4O44B 2RMLA 5H9FJ 3ENAA 4NEYA 3VR1A 2V50A 1VC5A 4EBEA 4I7FA 1HPZA 3J80Y 3VF0B 3MM5A 5HROB 2N4CA 4E98A 2HVIA 1RQ0A 3P6YC 1IKWA 4IH6A 3G6ES 2HQGA 2RB7A 3TUIC 4DR2F 2N82B 3TARA 1TUGB 2HKEA 5KOXA 4GRSA 4RNNA 2EWHA 3CJ3A 5IOLA 4I67A 3D6FB 4EO6A 3LAMA 1GT8A 4B3SF 4LF5F 4OZ0A 5AE1A 4PR6A 5KG1A 4PCQA 4CLUA 3WIVA 2R3VA 2RVJA 1U1MA 2QFJA 3LP1B 1UFKA 4DCPB 2UU9F 4K5RA 1RYSA 4ECRA 4DV6F 3BS9A 1TVRA 3TR5A 1UFLA 4YOEA 3MCMA 1XTZA 4L6V3 2IRUA 5F0UA 1HHQA 1N88A 4RUHA 3AOBA 4LRBA 1KTQA 1DTQB 1KQGB 3SBMA 1KLMA 3KOAA 3DDNA 1HBNA 2ZH8A 2EI5A 1UJ4A 1HL6A 3BPSP 2ASJA 4O3NA 1T95A 3AY0A 3PYEA 5EHHA 1TU0B 3MEEA 2UUCJ 2MJNA 4C8ZA 2UV8G 1KRPA 1XMQF 1FRJA 4OYMA 3POTA 3IM8A 3CPWR 3PW5A 4KHPF 2KM8B 1NJYA 2Z4PA 1ZM3A 3HD2A 1GNKA 2BXJA 4RBVA 2ZOFA 2DNZA 4R5PA 2EBEA 3EPIA 4DUYF 2Z30B 2HS3A 4NEZA 3HO1A 2P6TA 4IG0B 1QUPA 3Q2TC 3ZZ0A 2IVFB 3M8PA 2MSSA 3DOKB 1QUVA 2V34A 1OPZA 1EP4B 3KYLA 3N6NA 4JI2J 4ZJLA 1HQEB 1S6QB 4MIWA 1B3TA 5F3TA 4KE5A 1B99A 2GMHA 2E5HA 5KFEA 4GKJJ 1F9EB 2R8JA 3LP0B 1K1QA 4M63A 3H5UA 3C66A 2C2EA 1C0UA 3CMQA 3DRSB 2MLYA 1ZPVA 2OD6A 2R2SA 5F9NA 1TQLA 4MIBA 3H5XA 2QE5A 4F02A 1RADB 1VFJA 2DEIA 4LFCF 2MQ8A 4CM2A 2LFVA 1C0TB 2CQPA 4P2XA 5HANA 3M2VB 5ETTA 3AB2B 3VVTA 2RDJA 2RHQB 2XSJB 3K5LA 2HRUA 3FFIA 4H4MA 1S97A 4PABA 1MSWD 4YY3F 5LSOA 3KMSA 2GJFA 3HHLB 1VJQA 2HWIA 4NZ0A 2H5JB 2MKIA 3UR3C 4UT4A 3HVTB 2ZH7A 3EICA 2HGLA 2VQEF 2BBEA 1X4GA 2GAGC 3I9V9 4TQRA 1R89A 2DR7A 3R3TA 3LWMA 1XNRJ 2IJFA 2YX7A 1VCTA 4DX5A 3BH6B 4NA1A 3T1YF 3DI6A 5HJYA 3C6UA 5KFNA 5GAHI 2VODA 4ZLJA 4KKOA 1R8PA 5KFDA 3SV4A 1FD8A 2IFXA 2X51A 4ZVRB 4Y2CA 4ED7A 1WHYA 4ECTA 3IGVA 3HKWA 2HAIA 4NCGB 4DEZA 3T1HJ 3FKBA 3ETOA 5C2CA 1TKXA 2J0WA 2VQFF 2CQ0A 1J5EJ 2FGOA 3W2WA 4ZPDA 4RBUA 4F4KA 5C2GA 4OYWA 4WU2A 2HK2A 2JH3A 4EUVA 4CCHA 4CLZA 3MDFA 5BR8J 1TUWA 4J9LA 4ZDNA 1U24A 4TU7A 3AXMA 3OXLA 3NL0A 2I0XA 2RRBA 1JKHA 5ETQA 4DL4A 3M2UB 4OYIA 3ZZOA 4J9QA 5M2RA 2W7PA 3SV3A 3CCES 1V5VA 1GMWD 1MU2A 2QSWA 2WSEC 1BWEA 1DTTA 4Y2MA 5E41A 4QWEA 3GP9A 4LF1A 5G4DA 1IR2A 2Y1IA 4WK1A 4NOHA 1KVJA 1KWMA 2BRLA 2YWKA 1CULB 2CQIA 4A47A 2DPIA 2YNHA 2ZBQA 2F4VJ 3BSCA 3FDSA 1HWJA 2CNOB 2C3PA 3PV8A 1IBLJ 4HHHA 3O2IA 2DYAA 3NS7B 1PJ6A 1VQMS 4X64F 1S59A 2HIYA 1OYEA 3DLGA 7FD1A 3DDIA 1GXUA 3RBEA 2UXBF 3VCDA 2OMLA 2IJNA 2YXLA 3HT3A 3WZ0A 4DXLA 2V68A 4Q0BA 2QA4S 4KH1B 4TVAB 4FKYA 4M5MA 4DN9A 2YH0A 4DR5F 3QRPA 3CC2S 3F73A 2NXUA 2HFNA 5AXNA 2VUGA 1C1CB 3EZUA 3LW5C 4QU6A 2WVCA 4DF8A 4NMXA 3T5JA 1N48A 4FS2A 2FVCA 1N8RT 3ZZUA 1RWWB 1KLNA 4I6AA 3MMCA 3VAMA 2H4WB 3OPKA 2BV3A 1FXLA 3DXSX 3H7HB 3EVMA 5J2QA 4DPUA 4DQRA 3FMWA 3OSNA 1PC5A 1ZH5A 2GZOA 3WQPA 5ETKA 2FPHX 3TVKA 4P6QA 2K1RA 2YH1A 5DETA 5EWEA 4I0WA 1KQSR 4MFBA 2KJWA 2ZKTA 3M9NB 3H90A 1M5PC 2HWTA 1KP6A 3PX0A 5IZHA 2GQCA 1MROA 3QIPB 5D0HA 4PWDB 2W4DA 2ZUGA 1R43A 2QL9B 3CWJA 3LO3A 5KFZA 2ATLA 5F8IA 5L1IA 4JI4J 2OP5A 1RT7A 4G3IA 4UY8T 1NSQA 3ZZZA 2LECA 2CADA 3JXOA 3MTKA 3NAIA 2ASYA 3ILOA 1TAUA 3US5A 4LRAA 2ZWPA 4FKXA 1CPZA 1TK8A 2CWXA 1RDRA 4WXOA 5C42A 3K5PA 3G6YA 3JYTA 2AW0A 2XMMA 4MT1A 2RQKA 4I7FB 5T7LA 3R2DJ 1HPZB 3MM5B 4M5LA 4RW4A 2DIUA 3MR5A 1Z2LA 4YP3A 1IKWB 1HNWJ 2W8LA 4K4TA 4RU2A 2FJWA 5AXMA 2HYIB 4ZCLA 3F41A 2B8QA 3VTIA 1EKSA 3I5CA 4F7VA 2VH7A 4J9UE 3W8PA 3GJQB 3QIDA 1A6LA 4LR7A 3CC4S 4GO5X 4DV0J 2O01C 3N79A 4TNOA 5KFUA 3ISNC 4PQUA 2HHQA 5JVGQ 2IM2A 2DTJA 3H25A 2GQQA 2M70A 3R27A 3LQVA 1UZHA 3TA1A 2XYPB 3BSNA 5HMWA 2Q6BA 1TVRB 4JV5J 4JP8A 3IRXA 2M0GB 2JEJA 1RA7A 4LRFA 2G1HA 3GR1A 3PR4A 2C2NA 2V8HA 2MEWA 4BLGA 1KLMB 1NKBA 1HBNB 5D77A 5KG0A 1H2TZ 3I55S 4J9MA 2FIUA 1FJCA 3OFFA 2VFTA 3MEEB 2YPZA 3WC0A 3IBWA 4BCAA 3BN7A 3POTB 3OSPA 2CG8A 3GIRA 4FDFA 1PCAA 5GVQA 3N5BA 3KJNB 2V8DA 1YIJS 2F9JA 2DBBA 3TJAA 2HURA 1S4EA 4NLTA 4Q7AA 4QQBA 4LF2A 4UQTA 1CC7A 3IWXA 2HFUA 3GSDA 4R5PB 3PFOA 1IXKA 3J7Z5 4AQYJ 3D6TB 4J91A 1FI4A 2AU0A 2LP4A 3DRPA 3HSZA 1WC6A 1SL2A 1M1HA 3M8PB 1AUSL 5AT1B 4FXDA 2FVRA 4MAKA 4DV4F 4HACA 4JI3F 1SL1A 3HM9A 4IQMA 5L39A 1R0AA 3C16A 1WTFA 2OLWA 2OD4A 1NJIT 4S0MA 4MKBA 4D3GA 1C0UB 5ETNA 1BC6A 1S9FA 3NXZA 5I3QA 3DRXA 4A8OA 2CNKB 5A6WA 3UDVA 4I56A 1FKAF 3MEKA 5C25A 2EVZA 3D66A 4ECWA 5L38A 1FEEA 2LU1A 4I2QA 1YZ6A 4ID5B 3HFVA 4W98A 3PW4A 2UUAF 1QVFR 4ANEA 1HHSA 2CQGA 2DH8A 1B70B 4W4MA 2M7SA 3D67A 2HAFA 2EK6A 3FFIB 2N3OA 4H4MB 3NGDA 2XO6A 2HHXA 4JI6F 3UDLA 4O3PA 3K58A 4B9NA 5CCMA 1XK8A 3ILIA 3J7ZT 1QTMA 1CC8A 2WSCC 1A7GE 3GQCA 5D8HB 2HK3A 2L08A 2R7TA 3TRGA 4W90B 2KI2A 1SCJB 4EFAC 1H0HB 3U7JA 5ETVA 2PD1A 4DOZA 3GG0A 4QWDA 3JAMY 2HQ3A 3A4TA 3SSSA 2W2PP 3AAWB 4A46A 4ZA1A 4QYRA 3M6UA 1SJ4P 3DN9A 4WU3A 4NYPA 1GXTA 3FQLA 4USWA 4ZLNA 2VC0A 3DI6B 2DNKA 2NUUG 2GGPA 1GMWA 4QIWD 3C6UB 1QSLA 3C3LA 1WC4A 3I5BA 4Y34A 3H2LA 1N33J 2ZBIA 2E44A 4KKOB 2MXYA 3BH7B 5KT2A 4ETXA 1K73T 4CTAA 5LMNF 1M5KC 4DV7F 2RUGA 3R1HA 3TAQA 1G7CB 1YJVA 1X9SA 3TZWA 1TKXB 5IC4B 4AFFA 2VA2A 2ACMA 4NYZA 2KRBA 3CB4A 2HHWA 1M5VC 2NS1B 3W2WB 1R7IA 5AE3A 3PHTA 3W60A 1X4FA 1RHUB 1OWXA 4Y6IA 3CD0A 1ZBTA 3UQSA 1RLDA 2APOA 2R7RA 4OYOA 1JKHB 2MGZA 3VHQA 1PKUA 5L8RC 5EDWA 3VQSA 1F60B 3UVJA 3W7BA 4V19J 3BJYA 3HDSA 1MU2B 3GV5B 2W7OA 4OLOA 1DTTB 4X62J 2B4OA 5HBMA 4PPDA 4A8FA 1RB0A 4LF9J 2PEBA 4CT8A 4IYQA 2YNHB 2HNYA 2FD2A 4P75A 1PYSB 5E33A 3CT9A 2ZH5A 1HNXJ 1Q7YT 3X3UA 2CJKA 1WSVA 5L9NA 2B4VA 1VOMA 1VQOS 4IR9A 2QMUB 3QT8A 3DLGB 1HBOA 1Q7LB 3TX0A 1RTDA 1DZ5A 2HVDA 5HMYA 1S1WA 2R7WA 1S1XA 2FLPA 1RAFB 2HEKA 1CBKA 4F67A 1WNEA 2ZM6F 1Q8IA 2B9WA 4DR4J 4K0KF 3D0IE 1KFSA 4BDPA 1EETB 1K44A 4PG4A 4B9UA 2IHR1 2R8HA 4XIUA 3BO4A 4Q0BB 2CPIA 3FNNA 3KJQB 1U1RA 4F50A 2E5LF 4YQWA 3MAQA 2VPXB 3FVYA 3CDUA 2MKJA 4RNHA 3Q8RB 3J81j 3EYZA 4C8MA 2UXCF 3GV7B 4C98A 3J7YI 2DJWA 3T19A 1TP7A 3Q83A 5LJ3Y 3HX9A 3KNAA 4OJ1A 3MMCB 4PG6A 4FF3A 4X65F 1PBAA 2MKYA 2H5EA 5J2QB 2BW7A 5K8NA 3PO4A 2FVPA 2PC6A 3GV8B 1LXJA 1I94F 5JJBA 2UV8A 4JV2A 3UCZP 3PW2A 1FT8A 3KKFA 2K1RB 4FS1A 2KFNA 4KBIA 5IT9U 3O3LA 4F36A 3E8OA 1EX8A 4M8LA 4JBCA 2GV1A 4USUA 4MKYA 1U26A 4ZS6A 3G8TA 3RRHA 3WHIA 4ZJOA 2JHEA 2QC3A 5K8OA 1MROB 4OZ5A 4Z2XA 3L7UA 3UWTA 2XBPA 5B0FA 3CD7A 4C48A 4ECXA 2ZUAA 4RWWA 1RT7B 1R8HA 4DSJA 4G65A 2CPDA 3RB3A 4M5DA 4DV1J 4KO0A 1RISA 2K3IA 4QYZJ 2N3LA 2DNNA 2RNEA 1D9FA 3M6WA 4NXMJ 2E66A 1RWOB 2P9CA 3OL7A 3KG0A 1PAUB 2DHGA 4NLWA 3BV8A 4J9SA 5C42B 1B0PA 2RAQA 2Y1LB 2CRLA 4DF4A 3JYTB 1XN9A 1IWGA 1PO6A 4DI6A 4OI4A 5T7LB 4OX7A 2DNPA 4XAKA 1U2FA 4WWSA 3KUGA 1QJHA 5LMUF 4RW4B 4CO1A 1RI7A 2HRTA 3X1LB 1RKIA 3D1OA 2M8HA 2VU5A 5ITHA 1IBKF 3GPAA 1YQHA 1WEXA 1BXNA 3PJ9A 2YWEA 4ER8A 4NZ7A 1HNIA 4P7VA 3GU0A 1S0MA 1X4DA 4P73A 1H3DA 3NMRA 3AJ1A 4DFJA 4NLQA 2ZDOA 2AJ0A 3D2WA 4J9OA 1Y7PA 2XGQA 2I6WA 4KC5A 4I69A 1R27B 5DLGA 2AJFE 4LF7J 2GHWA 2GNKA 2AD9A 2UXDF 3BGOP 3D28A 1HFEL 4DL7A 1NEEA 3IRXB 4FVMA 4YB5A 3AQPA 2QIFA 1J5OA 1F9HA 5LL6d 3J80U 2F40A 3OR1A 2NSBA 4MYTA 2ZH2A 1JMTA 2R9LA 1RBAA 5CQGA 5J2MA 4RPFA 4KSEB 4C0BA 4DQQA 1JB0C 4CO0A 4B3MJ 3OJUA 1TL1A 2VG5A 4NXNJ 2HFOA 1XWLA 2BM1A 1IM4A 4G1PA 1HWKA 2FQQB 1V3ZA 4J7CA 4X4OA 2RS2A 4OYZA 4IQXA 2DNRA 1IKXA 1KEKA 3DFEA 5B0GA 4YR3A 1FHTA 4OI3A 2AJ1A 3U1NA 1QTNB 1JXLA 3DRPB 2LQ9A 4DUTA 2ZNZA 2ADBA 3ISZA 3NP5A 2HHSA 3EGVA 5BXIA 1U48A 4HACB 1SI9A 1S6PA 3CJ8A 2PIIA 2QN6B 2E29A 2E9ZA 1NJWA 1UWAA 1VC0A 2HVEA 2CQ4A 1R0AB 1V3RA 3N6LA 1SIWB 3C16B 2Y1RI 5HQLA 1N5YA 1MWZA 5KT7A 1MNEA 2MKHA 2ACYA 3RRGA 1TL7A 1BD6A 2CVIA 4K4SA 3MFHA 2W2NP 2NZ4A 3BO3A 3MM7A 4DV3J 1WEYA 4Q8EA 5C25B 1RT5A 2DNOA 3VGSA 3TAMA 4K59A 1LQ9A 4I2QB 3UO0A 1WDTA 4PRFA 4A8WA 3CDAA 5KFXA 4UUWA 3LALA 1FESA 3TAPA 4K2XA 2Y0SD 4KPCA 4O3OA 2IAJA 2R7VA 2M9KA 3OQ2A 3GIJA 3G96A 1B64A 4WTYA 3GE9A 1X0FA 4OYBA 5KFQA 2AEFA 1CJKA 5DGAA 2KVQE 1VISA 4LFAF 2QLFB 4CO3A 1HA1A 4KR0B 2A6MA 2F8MA 1WOSA 3S7RA 4JI7F 3KUHA 1HYSA 3W63A 3DNCA 3OL8A 4HLBA 4I2PA 3C2PA 3HI9A 1F3VA 2GGPB 1PGZA 1Q8BA 2KYXA 3CULA 2EW9A 1PILA 3W9JA 3MF5A 1QAYA 4GC7A 1Y5IB 3MD3A 4CTAB 3H8YA 1RT3A 4M5NA 4IOAQ 2NR0A 4FXWA 2UUBF 1HQUA 4TN2A 5E3CA 1B0VA 1YBTA 3BN4A 4LRCA 2ZHAA 4F2RA 2XYGB 2ZH3A 2VDHA 2AX0A 3CIZA 2C42A 4OX9J 2U2FA 4DV2F 4UZBA 1NM2A 1QAXA 3N28A 1MLAA 3CCTA 3CW2C 3FUYA 3OFHA 2AGPA 1N34J 1SC6A 2XI3A 1U0SA 3THVA 1KS2A 4WXWA 1NXIA 3LAKA 2AYEA 4ZK7M 4HHJA 5HI7A 4I64A 4IFVA 2BW2A 3MHYA 5L9XA 1R6VA 2MGZB 1UPMB 5KFJA 1WWHA 2G2YA 1E6VA 3CF5Q 2MLXA 3KXDA 3UVJB 5I3UA 1I5OB 2AZ1A 3U1MA 3E01A 2OI2A 1BQNA 3BGLA 4Q45A 1CG2A 3IBCB 2AJ2A 3OVSA 3GSIA 5HBMB 1OSCA 1NAQA 1ZETA 1TKDA 1N0UA 2HS4A 1ITPA 2HNYB 2W2QP 3IGNA 3AFGA 2JSXA 3I31A 4DL0C 2V2QA 4K4XA 2Q3PA 4XPCA 3A8KA 2X1FA 2Z57B 3NGTA 4Y3CA 2MLZA 1GQEA 3T5HA 3C6TA 3RBXA 4NPOA 5DQIA 5AJ3J 1KOOA 2XGPA 1HBOB 1RYRA 1RTDB 1S1WB 1S1XB 3FSYA 2G0CA 3OJSA 2K06A 4KY3A 2ATCB 3CGIA 3QFWA 5EX0A 1A0OB 3TX8A 5G0RA 3TA2A 2KDOA 2V5HG 2X7IA 2W4PA 2V4JA 1UEUA 4DBQA 2QZ8A 4XDDA 2PA8D 3AA9A 4ZPCA 3OT9A 2POKA 2I38A 1RWKB 4BS2A 1H2VZ 4M5IA 3N4WA 3OTEA 8ATCB 3Q2SC 3BZQA 5IV4A 3M9OB 1BQMA 3QO9A 3MM6A 3BKTA 3IC1A 3PACA 4JV1A 4JV0A 4C3KA 4RW6A 4OZ2A 3T5LA 2KN4A 4CH0S 4HT7A 2YQ0A 1VMBA 2IJRA 4BC7A 3OL6A 1TAQA 4M5JA 2ZEJA 2ZKUA 1FDDA 3NCRA 4C0OC 2HQDA 4JOUA 1D9DA 2RILA 2NREA 3I4PA 2ZBCA 3TEGA 3HHNB 1VQLS 4B3RJ 5KG2A 4DR7J 2R8GA 2YQ3A 4USIA 3W5ZA 3KK1A 1RHJB 2XM3A 3M32B 3GFYA 3OFEA 5J2NA 5AXKA 5DRKA 1Y10A 3EUNA 3H42A 2XHCA 2UUCF 2LLZA 3VAFA 4F4WA 3AODA 3RB6A 5AE2A 1G2EA 1YRUA 1XMOJ 3AD9C 2D7SA 1RT2B 3R7BB 2IA0A 4DPTA 3F0NA 1KOHA 4M5DB 4KO0B 4B9MA 3IN5A 2J9CA 4JB8B 2XHWA 4LJMA 2JEGA 3DGPA 2HHHJ 1NZ8A 4URQU 2XZTB 1NO8A 1XNQJ 5HVGA 3CE8A 2MZTA 2NPFA 2JDJA 1FE4A 2XMAA 6AT1B 1X9MA 1N54B 2WOMA 2IDLA 3MCNA 1VQPS 1FF2A 4ANDA 5A8KA 1N52B 4ES2A 1EKRA 1SXLA 4N41A 3OVBA 4W92B 3DYAB 2VDIA 3BDPA 1D8YA 4TY9A 1FXRA 4JI2F 4KHMA 3UDCA 7FDRA 4PG8A 2D1CA 4XK8C 3J7A1 5IFMA 4BBYA 4CO2A 2A2CA 2C2OB 4ZP8A 1ZTTA 1HARA 1UETA 4GKJF 2PFDA 1VRUA 4DCOB 4LBIA 1EB0A 2HHPA 5IS2A 4CNYA 4LSNA 1ROFA 3PXGa 4B3SJ 4USMA 1HNIB 4L3KA 4ED4A 4PEOA 2DRDA 5L46A 3W5YA 1XJWB 5E3RA 4PG5A 1ACMB 2E9RX 3I9ZA 1JJHA 4V19X 1NB7A 3C8YA 2XS7A 3D0HE 2MZSA 3G8QA 1YTYA 3UDEA 3EPGA 1Q5VA 3HZGA 1X5TA 3B8HA 4KGZB 2VJVA 1VDHA 5A6PA 1YZ7A 1J5OB 3K5MA 4C6AA 1NB2A 2BE2A 3SXLA 1E6YA 1WC3A 4URGA 5J2MB 2HNZA 1S76D 1R3NA 3TVZA 2IC3A 3M05A 4E2FB 3SMZA 3ZZTA 3PZPA 4X4VA 2P6SA 3T5KA 1N36J 2RKIA 1URNA 5FJ4A 1TL1B 2VG5B 3M8SA 2WW8A 2GQ2A 4U7UD 3T9NA 3PRDA 1XNRF 4PG7A 3GIMA 1XBWA 1Y3JA 4WFXA 5CA5A 2J6UA 3OLBA 4X4PA 2DKOB 3NNAA 5CD4H 1IKXB 2ERRA 2QYCA 2P9GA 4AD6A 4DX8H 1XIQA 4O3RA 3ZTOA 1N6QB 3BBBA 3RZAA 2FTRA 2FJXA 2RQMA 5KFOA 3T1HF 1S6PB 1F9FA 1H2UX 5LSRA 2W8KA 3NGSA 3W8GA 4DG1A 1UCNA 1J5EF 1F2GA 3FEYB 1U1QA 4ELTA 2MZ1A 2BKPA 1N5YB 3TUZC 5BR8F 1T9TA 2ZH1A 2ROGA 2NUHA 2VB6A 3MMJA 4HHUA 3R8YA 1TK0A 3LGNA 4ED6A 4H4KA 4NCAA 4JI5J 1DFDA 3B82A 3M8QA 3MM7B 4KPYA 3Q8VA 3W65A 4CRJA 2ZOGA 3PEJA 2IDEA 1RT5B 4DR1J 5GAEU 4CLLA 3OV7A 1RBLA 4TXSA 3BGFA 4KT0C 4MJKA 2NXEA 5KFSA 2WZ1A 4DFPA 2KT2A 2B4PA 2V69A 4HH0A 4LF6J 1VR6A 4ZCMA 2PT0A 2IAJB 2BOAA 3AD8C 1FWKA 4IG3A 2Y8WA 3O6QA 2DGWA 3MPWA 4PXBA 2F4VF 1CJKB 2X1GA 1FTRA 1WI8A 2XY6A 5F8NA 2YWGA 2BQRA 1D1UA 4O23A 4C4WA 1VIXA 3GJRB 3FCVA 1TMMA 2PEHA 1UW9A 1JX4A 3SCJE 2A0FB 2IM1A 3D7SB 1HYSB 2V6AA 4I2PB 3H98A 3T1YJ 2B9EA 3I87A 1YJUA 3E3XA 3OXFA 3BQ1A 3CDWA 1FNXH 2G13A 2WK4A 5JVHQ 2XY7A 3GB0A 1HW8A 1GX5A 3L3CA 1FKOA 1IBCB 1RT3B 2B0GA 4ICLA 3BYPA 2OTJS 1HQUB 3BGUA 2CNLB 1UVLA 4QZVB 3OUYA 2VQFJ 3ELHA 4JI0F 1S6OA 2ZITA 2E1AA 3BO2A 4ZP7A 2XS5A 5D4OA 4NCBA 1F5CA 3PEHA 3QPIA 3NS6A 2JC0A 2E5JA 2M4MA 1Q81T 2Y8YA 4QR2A 1NK4A 3MR7A 2EFOA 4FF1A 1HBMA 2QT7A 4ZVUB 3ZFVA 1W2BR 3PRVA 4F26A 4IFVB 1U8SA 2B5JA 1OY9A 3JAMU 3GMGA 3GJSB 2WVBA 1SKRA 1KKHA 4U9RA 3DLKA 5I3UB 2DGUA 2KHCA 3E01B 1JNZB 1IKVA 2IYGA 3H59A 2MZQA 1FJEB 5KFCA 1FRHA 1BQNB 3LOUA 2FB0A 1F1BB 5KFTA 3FSXA 1CJTA 2LMIA 2XMJA 1V9OA 3FZBA 3DHWC 4JI4F 3HD1A 2DH9A 3KLEA 3M2RA 2GO8A 1FXDA 1DQ8A 3THTA 1PAEX 2JZ5A 4AL7A 2HFSA 1VK3A 1TV6A 3PRBA 2RSQA 3C6TB 2PI4A 1I3OB 2L41A 4EZ9A 3ZO7A 2HVHA 3HSJA 2QLWA 2DXFA 1FRIA 2DNGA 1WORA 4R8UB 1QD1A 3R5CA 5A8RA 2WB1D 1VQ4S 1Z2ZA 5G0RB 3PKYA 4LF4J 5EN1A 4PAAA 2HVZA 5JXSA 2DIVA 2LCWA 4EO8A 3CCQS 2V4JB 4F4ZA 2IRYA 1PBUA 2XNRA 3KJFB 5DG7A 4KYZA 2RHSB 1P1TA 4WYLA 1KNZA 4NLGA 2HQCA 1Q86T 4RUCA 1VHIA 4NWBA 3K17A 4MH8A 3HCXA 1BQMB 1Z4UA 2K7KA 3QO9B 3G87A 3MM6B 3DLHA 2BJDA 5HSPA 1H98A 1T9WA 4DV0F 3QGGA 4RW6B 1VQYA 4CT9A 2ZVIA 1VGYA 3LANA 2CKWA 5I42A 4RNFA 4L3NA 2A18A 1NDCA 2PN6A 1HR0J 1DLOA 4GVBA 2J5AA 4JV5F 4AXJA 4IRDA 2VKZG 4DZDA 4FYYB 2R7XA 2W9CA 3BB5A 4PYAA 2VOPA 4P72A 3KK1B 2Z2LA 3FZ2A 1WOPA 2VOOA 2LXUA 2QTWA 4J9PA 1SC1B 4DR6J 2CPYA 1K47A 2E1CA 2OEJA 4FYWB 2ZBPA 4LSLA 3OHAA 1TL3A 2LDYA 4ELUA 2W24A 1HNVA 3IAM9 3MEGA 5L1LA 2E7VA 5U47A 3SIPB 5CD4A 5J1PA 2P2CB 4ZVPB 5T14A 2ZJRQ 3RUBL 4CO5A 2HLTA 1SH3A 3CJSA 1ZYQA 3DGPB 4KH0B 3GCXP 3KK3A 3EXCX 4AQYF 4RNMA 2OPSA 4NLOA 5D4PA 2WB4A 2XMKA 4DX7A 1VQ6S 2F9DA 4QJVA 2WOMB 3NWGA 4U8VA 5A8KB 2F5GA 2JVOA 1NK9A 3KLGA 3MEDB 4Q2MA 2OH2A 3PVXA 2ZD1A 1H7XA 1MW7A 3BBFA 1HQ2A 2GW8A 4N8NA 2KFZA 4USJC 3V6DA 4C8KA 1QE1A 4DJBA 4ZVGA 1WKKA 4OX8A 1JLGA 3PY8A 2ZZTA 2QLBB 4XO0A 1K0TA 1VRUB 1PYTA 3GIKA 3T6JA 1FD2A 1NBEB 3TVYA 4IRCA 4YUDA 3NMAA 4LSNB 1RJJA 2DY9A 3CMES 2DD8S 4A8SA 2XC9A 4RKUC 3Q23A 2FZGB 3GZ7A 1DAXA 2BJ9A 5KG3A 2FYXA 4B9TA 1LWEA 2GHVC 4CLKA 2BQ3A 1HWUA 3JSYA 3PKMA 2HPUA 1K8AT 1C2PA 4XPEA 2DGXA 4ED8A 2RRNA 4ILRA 1S9EA 2ZHBA 3UD4P 2B56A 2BE2B 5HVFA 1E6YB 3D1HA 2VICA 4KTQA 1RHQB 1B0TA 2HNZB 3B4MA 2H5IB 1U4BA 1GMVA 2IC3B 4B3TJ 2YVSA 3RG6A 2LEAA 4DDFA 2RKIB 1D0EA 2R7UA 5KFGA 4DFMA 2CZ9A 4Y65A 4DUZJ 4RUAA 3BSAA 3KFWX 2EK1A 1H74A 4XDCA 4U7UK 3KMQA 1EARA 5DQGA 1N33F 4RBTA 2BJ7A 1NPRA 7AT1B 5M2PA 3LTOA 4GKKJ 2BABA 2HHUA 1WHWA 3V4MA 3HHEA 4I6WA 2KKHA 1KBRA 2JWNA 3TEHB 1G3OA 2XULA 3HHLC 1RHMB 3AJ2A 5KFAA 1X4EA 4MK8A 2EPIA 3GILA 4DG1B 4OHXA 4K4ZA 3DLLQ 2YY3A 3KNGA 1FJGJ 2RJZA 1F0XA 2XS2A 4P10A 4USHA 5KG6A 4X4TA 2DNMA 2F65A 3K5NA 1SC3B 1RBOB 1HI0P 4C2MA 2O1PA 2L48A 3DOLA 5KT3A 1NLKL 4FYDA 4OZLA 2BKOA 2FJBB 2EC2A 2KXHA 1LK5A 4Q44A 1SJQA 2IIHA 3M8QB 1JQGA 4QIEA 2O5DA 4CLTA 1U1PA 4EBDA 4EWTA 4LFBJ 4H54A 2F1FA 4KFBA 4F3QA 1OMSA 1YJ7A 3NOGA 2R7QA 1NH7A 3N6MA 3TI0A 1W25A 1WJ9A 4ENOA 4X62F 1IUJA 1MMLA 3NGKA 3UN5A 4X4UA 5CYJA 4IG3B 1CQMA 4CH7A 3RAXA 4P2MA 1Y0HA 2Z56B 4LF9F 2BKNA 2A10A 2Z58B 4NASA 2F4FA 5KOWA 4LREA 1M5OC 5B0CA 1KSPA 1HNXF 2QMWA 4KIAA 3GLJA 1N32J 5F8GA 2B51A 2FGCA 4LMZA 1EQMA 1CQNA 1BMQB 3G8SA 2QA1A 3KHLA 2DPJA 2HHVA 1NK5A 3PX6A 4N77A 1XR7A 3LP2A 3CJTA 1S4FA 2QJ3A 3HSGA 3ZTSA 1OO0B 4MK7A 3RB0A 4F4YA 1S48A 1NJZA 4DR4F 5HATA 1D9AA 6FDRA 2YKNB 2CQ1A 1FKOB 2GMJA 4ICLB 5B09A 4NYOA 1GTHA 3R1LA 3QNWB 2MQQA 3I0SA 4URSA 4WIQA 3CD6S 4ELVA 3D6HB 4Z7CA 1WC0A 3BKUA 1RKJA 3SI8A 1RHKB 3OUYB 1VIOA 2BM0A 1YJWS 3M8YA 4HDGA 3RTVA 1ZTWA 2C2ZB 2OJ3A 4KHRA 3SSQA 3QGHA 3ILLA 3UFCX 1NKEA 2OSRA 4EMDA 2RUSA 4NA2A 4DV5F 2AEMA 1OYDA 3T1AA 4RLEA 1HBMB 4U67Q 2Q1LA 2IBKA 1HLWA 1UVIA 2EFNA 2B5JB 3PG9A 5GMKa 3J7AN 3MI7X 3DLKB 1HW9A 3I82A 3OTOJ 1FERA 3EWGA 4CYUA 3Q8UA 4LF8J 4LIWA 3OFGA 4KGXB 1IKVB 2C2MB 3OTBA 1SPBP 4ZIVA 3FGVA 1FE0A 1CJTB 5F8LA 1Q1KA 3FEZA 4CLWA 3KLEB 4C97A 3HFZB 2Z8QA 4J37A 4DV1F 2EKNA 1TV6B 4UUXA 1U49A 3LF0A 1KVKA 2JFDA 1O6XA 2HNDB 4NXMF 1EJ7L 2CJXB 3K59A 3AOAA 4RW7A 5A8RB 1FRXA 2MTLA 3QJJA 1C4AA 1FRKA 4YB1P 1FVSA 4TYAA 5EWGA 3IM9A 5CCLA 3D4JA 3UD5A 1N5VA 2PMZD 1HI1A 2ABYA 2ZJPQ 2YWWA 3HFKA 1Y11A 4OHZA 1VRQC 3KK2A 1S1VA 4G1QA 2XNQA 2UXCJ 4TY8A 2FLNA 1FJ7A 3Q8PB 2KXFA 2EG1A 2DR6A 1ZA1B 3QFHA 2OHDA 2KYZA 3VAIA 4FN5A 3MCSA 5KFFA 4LQ9A 2AF6A 3AD7C 2M5YA 1RAGB 1CJVA 2DHSA 3HKZD 1XR5A 5I42B 4PXDA 3EXYA 4CNZA 1DHMA 4LF7F 2GFFA 1NKCA 1DLOB 4GVBB 5D0RA 2FHMA 3W1YC 1TKTA 2ZFHA 2I9SA 3H2UB 2FJVA 3R6GB 1B4SA 4J9VA 2V94A 1F5AA 3OHBA 3EMTA 2W9CB 4UY85 4YDDB 1OJ4A 1VBKA 4DPYA 2DRBA 2DITA 1YRXA 4WK3A 5CABA 2D3OR 3IO1A 3H0PA 2RU3A 3A12A 4LSLB 4ED2A 4ECSA 5BJRA 1OY6A 1TL3B 4B3MF 1KONA 2QMXA 4C8NA 1HNVB 4NX9A 2C28A 3MEGB 2WRMA 4NXNF 5LXYA 2OO4A 1SUQA 5B0EA 1NHUA 2BJ8A 3KDOA 2MZRA 2WTFA 2DR8A 2BRKA 3VZIA 3MR2A 1BY9A 3KK3B 2BJ3A 1S72S 1RT4B 2UUWA 2BJ1A 3ADAC 3UN3A 5EWFA 2OPSB 2U1AA 1LV5A 4HKQA 2C2DA 2QRRA 3HHDA 4C3MA 2VONA 4WP8A 2ZC3A 3IFEA 4I4BA 4ZVQB 1JLQA 3TANA 3KLGB 3HT0A 3C14A 4B9LA 2IVMA 1RWXB 5FDLA 2ZD1B 5B08A 4F3MA 4KQZA 4TLRA 2G0JA 3V6DB 1QE1B 1FFSB 1WSRA 2OUGA 1JLGB 2ZH9A 5D4LA 2CAJA 1OPIA 4Q2LA 5D0EA 3GR0A 3R5AA 3HVWA 1VLYA 3D5MA 4JI1J 2GIQA 4CLPA 4OHYA 4YN3B 1QY7A 1LWFA 2GC8A 3MPUB 1FDAA 2WHOA 1U6FA 2VPWB 4WYWA 4DV3F 1YDLA 1Y3KA 5H1SV 4YFUA 2WBRA 3MM9A 3D0GE 5D0GA 4DN0A 5K20B 1LWEB 3WDOA 3A3PB 1L3TA 3M2VA 1WHVA 4ZP6A 1JXEA 4KAIA 1NK0A 2K8GA 3TZXA 1RAAB 2G4BA 2J8AA 2YPYA 3CJ4A 5KFRA 4WTOB 2R7SA 3BBCA 4ZHRA 2LEPA 3FCWA 4E8UA 4ZVTB 1WEZA 3T6BA 1T9YA 5M2UA 4QW8A 3OTDA 2AT1B 4N5SA 2DNLA 1BLUA 2DHHA 2X3DA 1HHTP 1IN0A 1YBAA 1IKYA 4FYVB 1SJRA 1IJFB 3BR9A 3OD2A 4ZLPA 2VG7A 3KHGA 2Y9HA 3DGVA 1ZZFA 4DQSA 5HAOA 2IMWP 3N0VA 2Q43A 5CYMA 2JLGA 1ZAWA 3FRZA 4Q8FA 5KFLA 3NEKA 3ISND 2YQ1A 2Z2YB 2D41A 1JLAA 3ET6A 1MWQA 1X5PA 5E3AA 3HMJG 3D54A 3IBFB 1JLCA 2JOQA 1NUEA 4CZCA 2R42A 3IP0A 2MY7A 4OX9F 5F8JA 2LEBA 1JLFA 2E1PA 2Y1JA 1YI2S 2BANA 2DGTA 1N34F 5D6GA 3FBCA 2BEFA 1UFWA 3ZC4A 1UJ6A 3DOLB 2C22A 4LQ3A 3UCUP 4A8XA 5KT5A 4YEAA 3CJKA 2QL5B 4ZLLA 2M2BA 3WBZA 2XCPA 4KFBB 2PSZA 2RRAA 3V6JA 3JS9A 1X5SA 2VFVA 4A8YA 5H9EK 1WHXA 4WP3A 1N5SA 3LPYA 5IQ6A 2I8EA 3K7RA 2W9AA 1C1BA 3SDEA 4Y0FA 1MMDA 1TMJA 4ECYA 4EU0A 1FFGB 4ZPTR 2J8SA 3PHEA 4LT6A 1GK8A 3PIOQ 3J7YU 2MQNA 4O3QA 5DDOC 2PA3A 3TWZA 2D9OA 5IWAJ 5KAKA 4WIIA 4NE9C 3EJMA 5IT0A 5AJ3F 3LP2B 3CCWA 4OX6A 1LFWA 2HBYB 1YLXA 5GAEI 2WCXA 4I6YA 4QIGA 2QLXA 5C5JA 3QRQA 2LA4A 2UUBJ 1C4CA 2AP6A 1NSKL 3I0SB 5HMZA 2J76E 4DSIA 3DU6A 4F0MA 2J9EA 4ZCKA 2BOPA 1DRZA 4ES1A 1U8WA 4ECZA 2J7KA 1MN7A 4DLGA 1S79A 2Y3YA 3GFXA 3NGUA 3DKDA 2Z0GA 3AOCA 4HVZA 4UOFA 3DU5A 3PFEA 4RJVA 1L5UA 4FXVA 3IWLA 4B17A 5K5MA 1F2HA 3RGIA 1YX2A 4EYIB 2NZCA 3FSIA 3TQ1A 3PYDA 1S1TA 4O0NA 4Q43A 2HS0A 3AH6A 4K50A 2CA9A 3G2XA 2D3O1 5KFMA 3SQOP 1HWLA 1YK9A 4OL8A 5DG8A 3MGJA 3G9CA 3KWMA 3UE2A 2LXFA 1PJ5A 3DRRA 5KFBA 4CYUB 2O67A 4Y00A 4KGKA 3I56S 5FLXY 4DR7F 4AXIA 1RTJA 1S9GA 2PGCA 1WG1A 1S6UA 4QPXA 2BMBA 4J9NA 4ZMMA 4LIRA 1P8GA 3FJ2A 3MUVP 3KDNA 4Z7YA 4DSFA 3CCRS 4X2BA 2HQIA 1XMOF 2MZJA 3W2VA 5KG4A 3GG1A 1AFJA 1Q53A 3B54A 5MLCV 2PI5A 2WSFC 1GEHA 4QIFA 1NZAA 2MQMA 4NLPA 1S99A 3NAHA 3UI3A 2HHHF 4HEA9 2DO4A 1XEZA 1XNQF 8RUCA 4OI6A 4F3OA 3HXMA 4X4QA 2ZHOA 4RW7B 1U1NA 3GYNA 1N5QA 1P6TA 2I2YA 3CO9A 3GCWP 3KG1A 5I4MA 5A2QY 1LFPA 1XERA 1ICEB 3UW1A 3GWCA 3HPOA 5CZXA 1CLFA 3HVRA 2FC8A 3V81A 2J7WA 2KT3A 1U1LA 2BACA 1U09A 4ZOSA 3KK2B 1S1VB 4G1QB 4U95A 1YJ9S 2UZAA 4AE5A 3AQOA 4TY8B 2V4RA 2CQ3A 1UKUA 4A8QA 4NLXA 4L76A 3FEXB 2D3UA 2BQUA 3UNGC 1X4HA 3IXQA 3Q22A 1CJVB 2R2RA 1T9VA 1MG7A 4ZVFA 3H2VE 1VQ5S 3A3OB 3S6EA 4B9VA 5SZTA 2OIHA 3I96A 1Q8LA 2KRRA 4J9KA 4OFZA 4O0IA 1TKTB 3QT6A 2NXJA 3VAHA 2X1BA 3CJ5A 1YKWA 2KH9A 3GIIA 2FUG9 2VD3A 5KT6A 3R5GA 3RW7A 1Q95G 1RWPB 1HNZJ 4ZCIA 4WFYA 1N5TA 1M90T 3ZNUA 2UVWA 3RW6A 1N36F 4MK9A 1T9XA 2MQOA 3V2UC 2VBXA 1H38A 1R8AA 3UPFA 2DHXA 2WAQD 3UN2A 3D9BA 4CP5A 1AUDA 3HJFA 5GAGI 1SUQB 3IMQJ 1NH8A 3K2YA 2J9DA 1LWCA 1SB6A 1U45A 3R6LB 4TU8A 3FBEA 2IA6A 2MYFA 2HW3A 1Y9OA 4FBUA 2DGQA 3HP6A 3KHRA 1I51B 1JLQB 4MFBB 2AYGA 4LVOP 3C14B 3ZXWA 5FDLB 4F4XA 3KTQA 2VPZB 4HI2A 2FHJA 3AJDA 2FY1A 2CQCA 3VAJA 3EVWA 1SV5A 1DY3A 2H9ZA 5L1JA 1L3VA 1PG5B 4Z37A 2CQHA 1RACB 4F0HA 2HGNA 4DSLA 2B43A 3P5TL 5E7OB 2H65B 2HBQB 2W2OP 1LWFB 2CPXA 5DJBA 2OPQA 4JI5F 2FVQA 1RTIA 3MAHA 1X7VA 3G86A 3B6BA 2YKMA 3LUYA 3LGHA 2JEIA 3MM8A 4DR1F 2CYYA 3TOQA 1WG4A 3MM9B 4ID5A 1S57A 3MPYA 2QLJB 3ULHA 2EFPA 2C3OA 2DB1A 1VJWA 3VWSA 4Q5VA 1FVQA 1ZPWX 5JUMA 2O3DA 3P4UB 4LSZB 4LF6F 2H51B 2J9DE 1RABB 3WX4A 5T41A 2Q6CA 2IMOA 1G1XA 2AEJA 4ZHRB 2CPHA 2XMVA 1JJ4A 4M5GA 2NCKL 1JLEA 2BE9B 1TZ0A 1GMUA 3BR8A 4OYXA 3GJTB 5D78A 3K8WA 1TFYA 2LXIA 4CLFA 2W9BA 4NZ6A 2IYIA 2HBRB 1IKYB 1G6BA 4QW9A 3OR2A 1HIYA 2P9EA 4EK2A 1WC5A 2CJYB 2VG7B 3HK2A 1Q8KA 3OLAA 4PQUB 4FF4A 3FC9A 2KVIA 3HJVA 3NNHA 4CM0A 4X4NA 5CYMB 1P1LA 3ZZRA 2BZ2A 3G71S 1NDLA 2CJBA 2OELA 1RE1B 1V3SA 3TW0A 4P9SA 4LR9A 3FBFA 1JLAB 3ET6B 3RR7A 3EDQB 1UA1A 3QZ7A 3IS9A 1DARA 4LRDA 1JLCB 3I6PA 3HF5A 1U47A 3BGRA 4C9DA 2ZH6A 4DR3J 1DBDA 2GMLA 4ZIWA 1JLFB 4WZMA 3TP2A 2BANB 3DC2A 4ZN3A 2YNGA 4G1IA 3LA0A 4NLYA 2UUTA 2K2PA 2KXNB 2FZCB 2W2MP 1VBZA 2DH7A 4NI2A 2VFRA 2KFYA 4CLSA 3CJKB 5GADU 4A48A 1T8EA 1FDNA 1MN9A 4PWUA 1K9MT 1NNDA 1S1UA 3QLHA 2HIQA 1NMEB 5K8MA 4OHVA 1C1BB 3SDEB 2ZBRA 2DEJA 1BUXA 1XR6A 3ENVA 1IVZA 2EG2A 2VG6A 4K4YA 3QYYA 4NMLA 4JI8J 2IBOA 1YVFA 2JNJA 3CNQP 2GAHC 4RW9A 3PR5B 3H20A 3U1LA 2DXEA 1SH0A 3KLIA 2A6OA 2V2KA 1QM9A 2AIRB 1FRMA 2N7YA 4QCLA 4FPRA 4OIXA 4YHHJ 2R8KA 2X3GA 2B3TB 3R7SB 4RL1A 1EETA 4LF4F 4M94A 3B4DA 2OPRA 3IA0A 2DCUB 2VIHA 1OS5A 3NBPA 1Q16B 1KHVA 5F3ZA 4X84A 3LWLA 1Q82T 1AB8A 2V8VA 3VGUA 2W7AA 4JI0J 3TJ9A 2DHAA 2ROPA 2FLLA 2CNNB 3KLHA 2IY5B 2HFZA 2VJUA 2QG9B 1UP1A 3EZOA 4Y2KA 1ZAXA 5FD1A 3SQGA 1T3NA 3M6VA 3NS5A 3WIUA 3KJVA 3FMBA 4X66J 1RGVA 2OEMA 3GFZA 2CVEA 1LWXA 1S1TB 2YNFA 1JWWA 1HR0F 2VC1A 1VYAA 3A3NB 2V9KA 1T0TV 4DL6A 4DWIA 1RWMB 1EZZB 3CCSS 2QV6A 1N56A 3DRRB 1REVA 3JSMA 2FLOA 2F3JA 5IQQA 4J9RA 4U8YA 1WACA 1RTJB 1S9GB 3MMBA 3N5FA 3PCOB 4CDIA 3GYXB 3Q24A 4K4WA 2VA3A 3MMAA 2P8IA 4DR6F 1FTCA 5LM7E 2ZE2A 2B7CB 1RZMA 5A0YA 2JLFA 4ERDA 3T3FA 3W2VB 4DL2A 1JIHA 2KG0A 3K57A 3CMAS 2XLJA 4NLDA 1NHKL 3VZHA 2ALZA 2MPUA 2Z2ZA 2ASLA 4C8OA 3PM9A 4OMFG 3BQ2A 2UVVA 2J6TA 3N9UC 4Y2AA 4QBUA 5DDPC 1HWIA 2V2ZA 1K0VA 3V81B 1U02A 2OEKA 4PXEA 1YITS 2XI2A 2VKRA 1TL5A 2AJQA 4HL9A 3G6XA 2XSFA 3MPDA 4ATNA 4WFAQ 5E2QA 3CVKA 2CQ2A 4WP9A 1L3UA 4IH7A 1PC4A 1SQEA 2E7XA 4RZRA 9ATCB 5FIIA 1SKUB 1M0SA 1RU2A 4UQGA 4KV8A 3EE3A 2BUNA 1TK5A 4IUFA 2DRAA 3TZZA 3QT7A 1JLBA 3MURP 4WKRA 4OV1A 3I32A 1S7HA 1QVGR 4NA3A 1XMBA 3MXHP 2V9WA 3IG1A 2NPIA 4J5OA 3U02A 3EDRB 5HVHA 1KHWA 3BPDA 1IJEB 1U2RA 6FD1A 1LKZA 1IQTA 4ED0A 2J0QD 3I0RA 1HBUA 3DLEA 4IFYA 5GMDA 1HKAA 1VQNS 5K14A 2YWFA 1URRA 2AYMA 4DS5A 3TA0A 4GMKA 3SFUA 5BYQA 3A1YG 4B3TF 4C8LA 4A4JA 1IBMJ 2KB2A 2HG4A 2B8PA 2VFSA 1ZAVA 1Z1ZA 3P3DA 5HMXA 2L9DA 4DHVA 2OTLS 1S10A 2GJ2A 1OQ6A 1T9UA 3HLUA 1XQIA 3EX7B 4DUZF 4JYAJ 4ED5A 3EGWB 4ETZA 2J7UA 3EZ5A 1LWCB 2OAUA 1YHQS 1U1OA 1TFWA 1IR0A 3A8JA 4TQSA 3VAGA 3Q86A 3D68A 1WELA 2KJVA 4XTTA 4ZVEA 3PO5A 4GKKF 3RYLA 1JK9B 3ETMA 3CJQA 3RRKA 1ZM4A 5B0AA 1O0PA 3ONQA 2NYIA 2D74B 4C3LA 1J2VA 2IVYA 1FJGF 1SV5B 1GX6A 2R2TA 1S5ZA 4DMZA 2BVZA 2BA9A 3P96A 3T41A 2PE8A 2XZDB 5BYSA 2V67A 3QBCA 1RTHA 3M30A 4H4OA 3FCHA 2HLUA 3L9ZA 1CS4A 4ITSA 4IKAA 2OPQB 4C8YA 3D3BJ 5IC6B 3MPVA 2HGMA 2ZVSA 1P9QC 1RTIB 1T7PA 5DDRC 3MWBA 3V4IA 2YKMB 2GCFA 4QR1A 5IM0A 2DNYA 2BE7D 4NLRA 3MM8B 1FO1A 2AWZA 4MTPA 4M95A 1T3OA 4LFBF 1L3KA 3OVAA 3QJPA 5L1KA 1SKWA 2MJUA 3UR0A 3BEGB 4QOTA 3MFIA 4L73A 2AMCB 3QGPA 5HK4A 3L09A 1RSCA 5CHCB 2XO7A 2RF2A 5DM6Q 1FKPA 4DS4A 2JRSA 3TJ8A 4RNOA 4OYAA 3R5JB 4DR2J 3LPEA 1JLEB 4ZPWR 1AFIA 4LBHA 4OJGA 2RD5C 1AROP 1N32F 4WBFA 2YKAA 2W9BB 4LF5J 2D3ZA 3OR2B 3PW7A 1S49A 5SUHA 4F4AA 1UL3A 1SC4B 3I4HX 2UU9J 1PSDA 2NXCA 4DV6J 1H73A 2JVRA 2ZZNA 4IO1A 4PQAA 1B7YB 4YR2A 3NGRA 3AT1B 1ZZNA 1WKLA 4WFZA 1NDKA 3IS9B 1IR1A 2J6SA 5GMEA 2B9YA 3G82A 1HMVA 3OR1B 1SJ1A 3QJLA 1VS3A 3BGRB 4ZJQA 5KT4A 4WCEQ 1X31C 4ZPAA 3N01A 3JTOA 3PYFA 1XMQJ 4K4VA 1H72C 1BWVA 3CCZA 2YNGB 2ALYB 4KHPJ 5F41A 4PYDA 2MKKA 3U27A 1S12A 4WPAA 3CEDA 1UWBA 2DGOA 4RO0A 4ES3A 4NI2B 4DUYJ 5A76A 4YS2A 2H54B 3T9ZA 3QAUA 2H4YB 1I1GA 3OTOF 1OSDA 1TR0A 3LH2S 3AB4B 4LF8F 4WF9Q 3SCIE 3J81Y 4DSEA 5HLFA 3CCMS 1S1UB 3QLHB 1T02A 5AXLA 3W66A 2EBGA 5EX3A 2B9XA 2HZVA 1O5JA 2VG6B 1PIEA 3CUNA 1WDDA 2HMIA 1P27B 2KO1A 1YG0A 3Q0AA 2F8HA 4WFNQ 2VL1A 1TL7B 1R8BA 4NRUA 2JL9A 4P52A 3KUEA 2IM3A 4RW9B 1FX4A 1GFWB 2XMTA 2EFQA 4HDHA 3JSRA 3NWRA 1AXQA 1LOUA 3E51A 1RA6A 5KFIA 3M1VA 3KLIB 5BYRA 1X0PA 5HN0A 1BHNA 2KZMA 3DMJA 3R2CJ 2E1MC 4DQIA 5C7PA 2PO4A 4LFCJ 3TAMB 2QGFB 5DS7A 4QPTA 2GJIA 4IR1A 1RAEB 2CQDA 3K5OA 2C1EB 4ILMA 2CZ4A 5HQ8A 3QMQA 2OPRB 4C0HA 2XQCA 2CG4A 4YY3J 1UVJA 3NBPB 4AYBD 1XC9A 2F63A 2IPOB 1UW4A 4TKTA 4WE1A 1SJFA 1V6HA 3ICLA 1SVDA 3F56A 3G4SS 2VQEJ 3HVAA 4EZ6A 1X9WA 1HD1A 1ZM9A 2IM0A 5H9FK 3KLHB 1IBLF 5ETMA 2C2KB 3Q8YA 5DM7Q 2EC0A 3C19A 4FPIA 2DR5A 5DGBA 4DV5J 2RDDA 4L75A 3SQGB 3ZTPA 5HO4A 3KJVB 3QWUA 2DR9A 2HBZB 4RW8A 5DG9A 1RTZA 2V8GA 3H40A 2YNFB 3H5SA 5HP1A 1WF1A 4UF4A 4ANCA 4GO7X 1WOOA 2LA6A 1YBUA 1JJCB 4ZN1A 3UD3P 1REVB 2GIFA 3JSMB 3P49B 1RCOB 2AJ4A 3R9LA 3M32A 5B0BA 4IOCQ 1R0BG 2MHNA 2WVEA 1QAJA 2AZ3A 2YTCA 4PKDB 2DGVA 3MMBB 1NDPA 4R25A 1IM6A 3V5RA 3MMAB 3ENQA 2M52A 1AT1B 3RB4A 3CCLS 2ZE2B 4EBCA 1X60A 2JLEA 5A0YB 5H9EJ 3QSYB 1RT2A 1RT6A 4CIOA 2FJAB 1MWYA 2LQ5A 5LOQA 1LW0A 1Q4RA 5F8MA 4D3HA 4OZ3A 3ITHA 5EUHA 4O4RA 2RH3A 1DQAA 2KT5A 3WX8A 4X4SA 2KZZA 2RIJA 2XCAA 4IOBA 2ILZA 4TLQA 2OFGX 3PYGA 4PZVA 4EEYA 2B6AA 2E5GA 2DY1A 4B3OA 2F8EX 2W1BA 1E6VB 4HI1A 5ETLA 3QGIA 2CPZA 4PWWA 1T05A 3DYAA 1X8DA 4QU7A 1ELOA 1Y4ZB 5THWA 4YDXA 2OSQA 2DO0A 1VQ8S 5D15A 4ECQA 1U6ZA 2E9TA 4NRTA 2E1RA 2C3YA 5FLXU 3PJWA 5F8HA 1OIAA 4JI1F 1VQ9S 1UEVA 3MUMP 5B7WA 2XLIA 3D1QA 4KV8B 1I6JA 1RLCL 4X64J 1SKSA 4KGMA 2R2UA 3MOZA 1U25A 1JLBB 2XMUA 1FFWB 4UZCA 2Y0BB 3PJXA 3FQKA 2W25A 4ILLA 2UXBJ 1Y5LB 1EAYC 2V0NA 3EM1A 4USVA 3IG1B 3L7PA 1LXNA 1NSPA 4UTGA 3MR6A 3BM7A 1KFDA 1CVJA 4J90A 4DZ6A 1ZOTA 2FHOB 4CLYA 5ETSA 3I0RB 1HBUB 1FDBA 3DLEB 4IFYB 2RQCA 5A2QU 2COLA 4DR5J 1HNWF 5K14B 4OQJA 4M5HA 3SEOA 4U96A 8AT1B 3S1TA 1QDUB 3PX4A 3MAAA 2AHOB 2QYGA 1FA0A 1O8BA 1RWUA 4B08A 1WUUA 5K9FA 1VBYA 4OZ1A 1RAIB 4ZVOB 1R0CB 4UOGA 5D3GA 1U6BA 2MKCA 1GAOA 4LBPA 2DVIA 4KJIA 4V1Ak 4U7CA 3O44A 4QR0A 3CCJS 2D9PA 3BSOA 5J1NA 5DZ7A 2W01A 2PMHA 1NK7A 4R0EA 1N6QA 3M6XA 3M8WA 3KG4A 3IRWP 1IQZA 4DLEA 1BGXT 4DPWA 4K5SA 5J2NB 3BQ0A 2LQBA 2G2OA 5E5NA 4F04B 1RUSA 2H3EB 5IXUA 2N4DA 2GVZA 1GH8A 2KTQA 4JUZA 3DOMA 2UVRA 1APSA 2FVSA 3GFHA 2LDIA 2HZCA 2VF3A 5A8WA 1RTHB 4DCJB 3M30B 4H4OB 2V2VA 3JTNA 3NOCA 1CS4B 4NLVA 3RU0A 1FCAA 4RX6A 2N7CA 1O51A 1FK9A 1G4CA 3V4IB 2CPJA 5IM0B 1CJUA 2AYBA 1RP5A 1FEHA 3WC2A 1BE4A 2XWYA 1SL0A 1HI8A 4M5KA 3O1LA 3Q8SB 1NJXA 1ZS6A 4DL5A 1TL4A 3KLFA 1ULRA 1LK7A 2GS8A 4KB7A 1RWNB 2RF2B 2HRYA 1FKPB 2OPPA 1KN6A 1SH2A 2XMWA 1LEOA 2NLWA 1VHFA 5KG7A 2QSFA 1H6KX 2WONA 2KM8C 3RBDA 3DHXA 4B02A 5IWAF 1RT1A 1NSAA 4H4KC 4F2SA 2E7WA 3BDEA 2YKQA 4RU9A 4ZPBA 2X1AA 5KFKA 1FWLA 1RAJA 2AQ4A 4DL3A 5GAHU 3NCPA 2Q66A 2PFFB 3R5DA 4MMOA 4ALZA 2CFXA 5DDQC 2JX2A 1KQKA 2AGOA 1YWXA 5DO2A 2V63A 3W9HA 3L4BC 1PJ7A 4K8RA 2PDAA 5CYQA 3G82B 3M8RA 3SCLE 1HMVB 4AL5A 2HHTA 1NK8A 1D3WA 2W4CA 5F0WA 3D3CJ 2RU9A 1EHWA 2OKQA 2MY8A 1TTHB 2DGSA 3RAMA 2BJEA 2AV5A 4IH5A 4R0JA 4OJ3A 1ZA2B 3RAQA 2CZVC 2VPYB 3CD5A 1VI7A 1VC6A 2A3JA 1VK8A 1LW2A 1PYOB 1UWBB 4AT1B 3I5AA 5K8PA 5D4NA 1UJ5A 5ETRA 1SBRA 4OHWA 4IRKA 2G0IA 1TKZA 3QRRA 1B7FA 4O4GA 1AZSA 1D09B 2MSTA 3TYTA 1DQ9A 1H7WA 4P74A 1VBXA 5HLFB 4DV4J 1QAIA 5I3PA 4GC6A 4ECUA 4JI3J 3BF4A 2Q79A 4B9SA 1Q78A 2GHPA 5IT4A 5DQHA 4OZNA 2LU2A 1K1SA 2JC1A 4OYPA 2VHGA 2HMIB 3HHLD 1R6YA 3G6VA 2FC9A 5J1EA 1SQFA 5RUBA 5KFWA 5LXRA 2LKZA 1S7IA 5HL7Q 4PUOA 1N0VC 2ILYA 4QWAA 3TZYA 4CI0B 2QA2A 4FVCA 1FRLA 4QIVA 5J2PA 3FBBA 3IR6B 1TELA 1S0NA 2QFIA 4R8UA 3M1VB 2GVDA 2EKYA 3DMJB 2ZNYA 1X4CA 2HFVA 1SIZA 5GADI 1NCLA 1J27A 2ZH4A 3JQMA 2UUAJ 5JMNA 3DXBA 4HT5A 2CDQA 2R4FA 2MDAA 1D8ZA 3IWNC 1VRTA 5B0DA 2NSCA 4FBTA 3S01A 4JI6J 3CJ0A 4GVLA 1KC8T 5ETOA 3PW0A 4WE1B 3MUTP 3M8ZA 2VFUA 5E0OA 2DXDA 2FJDB 1JNRB 1FNOA 3CC7S 3HZEA 4DU7A 3CO0P 3DM2A 2UP1A 5KTQA 3C15A 2VZ9A 2R7OA 1MMNA 2ROEA 3NRBA 1V5IB 4YMEA 3LGMA 1WD6A 4OV6A 4ZPVR 2KG1A 1YSJA 2LYVA 2Z2MA 4RW8B 1IWAA 3ENWA 5HP1B 3PTWA 4BWMA 1U2CA 2J0XA 1FWPA 4MKAA 3F44A 5LMNJ 4RR5A 4DV7J 3DLBA 4HYKA 2AKWB 2CXEA 4USTA 3OTCA 1X5OA 2QO3A 2CQBA 3PIPQ 5C24A 3MECA 1HNZF 2ZZMA 4MYUA 2GX8A 1T94A 3CDEA 1T11A 1KQFB 1UPPA 3CCUS 1YRTA 2CIMA 3BREA 3JSBA 3TNVA 3EVOA 1U0HA 3Q89A 3NLCA 2RE1A 3L7OA 3ZNJ1 1RT6B 1WF2A 3BYRA 2CDRB 5IV3A 5CXTA 1UEKA 1LW0B 2J0SD 1M5HA 5DZ6A 4NLUA 4DPOA 2KHDA 3ITHB 1M5SA 4A8KA 1S0VA 4CQ1A 3HSDA 2A2DA 2YNIA 4HTIA 2B6AB 4L72B 4B3OB 2VBZA 1T03A 4BHQA 1T05B 1DURA 3MEDA 1YJRA 3M9MB 2I5JA 3W5XA 4C11A 1A9NB 3QATA 3V6HA 4K7QA 4IDKA 2YX4A 1ZM2A 3H4DA 4USKA 3CXCR 2OGUA 3EGNA 2MQPA 5CH7B 1Q0NA 3QT5A 3QSIA 2ZOMA 3M2RB 3UCGA 3NCQA 1OY8A 2EFVA 2DK2A 2C3MA 3SYZA 2JFKA 1NPKA 2HZAA 4K2JA 1KTVA 4LUBA 3L95X 4O44A 3PNIA 3CJ2A 2ZM6J 2C3UA 1UA0A 1RU1A 1BQXA 1NK6A 4FNIA 3GTYX 4K0KJ 1REGX 4WFBQ 2BDPA 4FZVA 1JXVA 5HROA 3TUPA 1X4BA 2BYCA 1W2IA 2XTJP 2EEYA 1QSSA 3FRYA 1UMJA 1YJTA 2E5LJ 5CAAA 2KU7A 4AUKA 3R7NB 1R8CA 3IAS9 4DX6A 3MAAB 4BWJA 4N56A 1SQGA 4O3SA 4EI2A 1TUVA 3BKFA 1CSJA 5EGYA 5KFHA 1RCXB 4X65J 4AL6A 4F8RA 2GIRA 2OMOA 5D3GB 2A1BA 4ZP9A 3LP1A 2GA7A 1WC1A 1I94J 2G2ZA 4L74A 3V6KA 1QLNA 4YB7A 2DNQA 2VV5A 2BR0A 2JJ4D 1WKJA 1S0OA 4FP9A 3DLJA 2DISA 1DTQA 4DQPA 2F7VA 4DR3F 4OI0A 2AX1A 2L3MA 2YX1A 5KFPA 2RS8A 3K8VA 3W3SA 2GVZB 9RUBA 2CJAA 5LJ5Y 3GYGA 3DOMB 4LVNP 3HHKA 2FJEB 1F5BA 2QA4G 3K89A 1N4LA 5A8WB 1P9YA 3VGTA 4PPZA 4N8OA 2XLKA 3A8IA 2FZKB 1WI6A 2K7JA 4CH1A 4ECVA 1NHVA 1W26A 4WKYA 1FK9B 3MTJA 3O8WA 1RWVB 2ZJQQ 3H5YA 3VALA 1Q79A 3W61A 3S8SA 1CJUB 3P5BP 4E0DA 3MR3A 3UNYA 4IG0A 3TUJC 3THPA 4UOCA 3A13A 4UW2A 4Y2IA 3P45B 3W62A 4K4UA 3DOKA 2M3DA 3ZZYA 1EQ0A 1GXLA 4F0KA 1EP4A 1DJ0A 3KLFB 2CPFA 3R5BA 5LMUJ 1VQKS 1HQEA 2VASA 1S6QA 2CJQA 2OPPB 4NLSA 4P7TA 1X4AA 2HQFA 2MKSA 2ASDA 5MAOA 3M4XA 4IO9Q 1NPPA 1YJNS 1UTAA 5CZVA 4HH1A 4YR0A 3LP0A 1IBKJ 4WZQA 4Y28C 3CIMA 2WONB 3DRSA 3NG8A 4JI8F 1UVNA 2NXNA 5DLFA 1AA1B
chains in the Genus database with same CATH topology
4K8RA 2QTWA 3CNQP 4NE9C 2W2QP 4YN3B 3H42A 2Z56B 2E1PA 1V5IB 2W2OP 2XTJP 1R6VA 2Z58B 1SPBP 3A3NB 3AFGA 4OV6A 3VV2B 2PMWA 3SQOP 2ZWOA 3VHQA 2W2NP 3WIUA 2W2MP 3A3OB 3A3PB 3WIVA 4NMXA 2W2PP 3QFHA 3GCWP 3BGOP 2Z57B 3BPSP 3CO0P 3GCXP 3P5BP 2Z30B 2Z2YB 3T41A 4JP8A 2Z2ZA 2ZWPA 1SCJB 3WHIA 1ITPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K8R A;  2QTW A;  3CNQ P;  4NE9 C;  2W2Q P;  4YN3 B;  3H42 A;  2Z56 B;  2E1P A;  1V5I B;  2W2O P;  2XTJ P;  1R6V A;  2Z58 B;  1SPB P;  3A3N B;  3AFG A;  4OV6 A;  3VV2 B;  2PMW A;  3SQO P;  2ZWO A;  3VHQ A;  2W2N P;  3WIU A;  2W2M P;  3A3O B;  3A3P B;  3WIV A;  4NMX A;  2W2P P;  3QFH A;  3GCW P;  3BGO P;  2Z57 B;  3BPS P;  3CO0 P;  3GCX P;  3P5B P;  2Z30 B;  2Z2Y B;  3T41 A;  4JP8 A;  2Z2Z A;  2ZWP A;  1SCJ B;  3WHI A;  1ITP A; 
#chains in the Genus database with same CATH topology
 3E2E A;  1RT1 B;  1HD0 A;  2GO9 A;  1F6T A;  2FY8 A;  3QQC D;  2EXU A;  2XG8 A;  2OFH X;  3DRY A;  4OI2 A;  3OXG A;  1C0T A;  4YHH F;  3EGZ A;  2YKN A;  1KVI A;  4HR2 A;  4OJH A;  4FNH A;  2WVD A;  2UXD J;  4FF2 A;  2XSJ A;  4EGL A;  1M1G A;  3CSK A;  4DPX A;  2G9O A;  2CWK A;  2M8D B;  2WBM A;  4EYH B;  1S9E B;  3OBI A;  4P2S A;  3MCO A;  5CYQ B;  3HHL A;  3QWP A;  3ZZP A;  1NRK A;  3HVT A;  3SZ2 A;  3IR7 B;  2FHJ D;  2B7B B;  3R97 A;  2HSE B;  1AYE A;  1RHR B;  2XEX A;  2AGQ A;  2EFG A;  2C2R A;  4I68 A;  4P71 A;  2G1D A;  1RAH B;  2WVF A;  2K3K A;  3QZ8 A;  3K0J A;  4M1K A;  4ZVS B;  1KDN A;  4X66 F;  4CO4 A;  1NU4 A;  5LSL A;  1LW2 B;  1LNQ A;  4I1T A;  4N7T A;  3JTP A;  4DFK A;  2YKP A;  4NL5 A;  2LVW A;  2RDI A;  3A8E A;  4QWB A;  4KRW A;  2JEF A;  1TKZ B;  4TU9 A;  1WG5 A;  4O4G B;  4NCG A;  1AZS B;  2NYH A;  1RXO B;  1EIY B;  2H1Y A;  3CCV S;  2ZWO A;  2XY5 A;  3MD1 A;  3JQJ A;  3P8B B;  1WTB A;  3OL9 A;  2KL8 A;  4OLP A;  4ID8 A;  1W7W A;  4X4R A;  5E3Q A;  5ADZ A;  4OI1 A;  1OQ3 A;  2L9W A;  2YKO A;  1VLO A;  4CWB A;  5J1E B;  2XB2 D;  2FDN A;  4ZVH A;  4BC9 A;  4PUO B;  2V8P A;  4HTJ A;  5HQM A;  5J2P B;  3KHH A;  2HND A;  4RWX A;  3AA8 A;  4LR8 A;  3RBZ A;  2GVD B;  3M2U A;  2L9N A;  3HUL A;  4DU8 A;  2I1R A;  2BX6 A;  3NY0 A;  2M88 A;  3ZTQ A;  4PXC A;  1VRT B;  1U7L A;  2YWH A;  5KFV A;  4WJB A;  1VQ7 S;  2FHK A;  3CDB A;  2E5I A;  2DNH A;  3CJR A;  3J81 U;  3O5T B;  4QYZ K;  1CUL A;  3RJM B;  1UVK A;  3KLV A;  2XYH B;  5KG5 A;  2V4Q A;  2H48 B;  3VV2 B;  5F9L A;  1VQS A;  4FYX B;  4LFA J;  1UAW A;  2ZDP A;  3DM2 B;  3DDK A;  3C15 B;  3W64 A;  2MQL A;  3NNC A;  2QX0 A;  4JI7 J;  3IR5 B;  3JB9 k;  1KD1 T;  4MIA A;  5GAG U;  1CEZ A;  2PMW A;  2VBW A;  3ZTR A;  1UVM A;  2UVU A;  4N47 A;  2SXL A;  3VVU A;  4DSK A;  2HWH A;  5IT9 Y;  4YB6 A;  1U1K A;  2RT3 A;  3VQT A;  4OZJ A;  2DCL A;  4ED1 A;  1QSY A;  1RK8 A;  3GON A;  2O66 A;  1KR4 A;  3OW2 R;  1Q5Y A;  4UOH A;  1YGY A;  2IRX A;  2XWX A;  2XZW A;  3SFG A;  2NQP A;  2VBY A;  5LT5 A;  4N76 A;  2MMY A;  3RR8 A;  3TQE A;  3VAK A;  1C1C A;  5C24 B;  3MEC B;  2CPE A;  2D69 A;  3ILJ A;  1IBM F;  1Y00 A;  5ETP A;  3MOJ B;  1L3S A;  4DV2 J;  3DCA A;  3AXK A;  1U0H B;  3FK4 A;  3B78 A;  2MB0 B;  4C7Q A;  3JQK A;  4G6V B;  1WF0 A;  4F25 A;  2ZC4 A;  2WW4 A;  3Q8Q B;  4JYA F;  1RT4 A;  4KGV B;  3CTR A;  2DT9 A;  3VGV A;  2YNI B;  2RQ4 A;  3PDN A;  2CJ9 A;  3MZI A;  4QWC A;  1T03 B;  2QEX S;  2R8I A;  4B3R F;  2I5J B;  1UZD A;  3TO8 A;  4ZIT A;  3M7V A;  4MKV A;  4C11 B;  4U6P A;  1Y5N B;  4ED3 A;  3H4B A;  1FX2 A;  2QL7 B;  3C46 A;  3AHP A;  1SJ3 P;  4PWD A;  3QIP A;  4IDK B;  1S77 D;  3W9I A;  4RUB A;  1F3F A;  4P2F A;  1RAO A;  3D6M B;  2CUY A;  2LQ8 A;  5HJX A;  3SSR A;  2P5V A;  2LQJ A;  3SCK E;  1GTE A;  2YBV A;  5E3P A;  2B4U A;  1M1K T;  2MHE A;  4TYB A;  3QAE A;  3NKY A;  1JJ2 R;  1FNM A;  1R31 A;  1AW0 A;  4A8M P;  5KFY A;  4ZKA A;  2ADC A;  4O44 B;  2RML A;  5H9F J;  3ENA A;  4NEY A;  3VR1 A;  2V50 A;  1VC5 A;  4EBE A;  4I7F A;  1HPZ A;  3J80 Y;  3VF0 B;  3MM5 A;  5HRO B;  2N4C A;  4E98 A;  2HVI A;  1RQ0 A;  3P6Y C;  1IKW A;  4IH6 A;  3G6E S;  2HQG A;  2RB7 A;  3TUI C;  4DR2 F;  2N82 B;  3TAR A;  1TUG B;  2HKE A;  5KOX A;  4GRS A;  4RNN A;  2EWH A;  3CJ3 A;  5IOL A;  4I67 A;  3D6F B;  4EO6 A;  3LAM A;  1GT8 A;  4B3S F;  4LF5 F;  4OZ0 A;  5AE1 A;  4PR6 A;  5KG1 A;  4PCQ A;  4CLU A;  3WIV A;  2R3V A;  2RVJ A;  1U1M A;  2QFJ A;  3LP1 B;  1UFK A;  4DCP B;  2UU9 F;  4K5R A;  1RYS A;  4ECR A;  4DV6 F;  3BS9 A;  1TVR A;  3TR5 A;  1UFL A;  4YOE A;  3MCM A;  1XTZ A;  4L6V 3;  2IRU A;  5F0U A;  1HHQ A;  1N88 A;  4RUH A;  3AOB A;  4LRB A;  1KTQ A;  1DTQ B;  1KQG B;  3SBM A;  1KLM A;  3KOA A;  3DDN A;  1HBN A;  2ZH8 A;  2EI5 A;  1UJ4 A;  1HL6 A;  3BPS P;  2ASJ A;  4O3N A;  1T95 A;  3AY0 A;  3PYE A;  5EHH A;  1TU0 B;  3MEE A;  2UUC J;  2MJN A;  4C8Z A;  2UV8 G;  1KRP A;  1XMQ F;  1FRJ A;  4OYM A;  3POT A;  3IM8 A;  3CPW R;  3PW5 A;  4KHP F;  2KM8 B;  1NJY A;  2Z4P A;  1ZM3 A;  3HD2 A;  1GNK A;  2BXJ A;  4RBV A;  2ZOF A;  2DNZ A;  4R5P A;  2EBE A;  3EPI A;  4DUY F;  2Z30 B;  2HS3 A;  4NEZ A;  3HO1 A;  2P6T A;  4IG0 B;  1QUP A;  3Q2T C;  3ZZ0 A;  2IVF B;  3M8P A;  2MSS A;  3DOK B;  1QUV A;  2V34 A;  1OPZ A;  1EP4 B;  3KYL A;  3N6N A;  4JI2 J;  4ZJL A;  1HQE B;  1S6Q B;  4MIW A;  1B3T A;  5F3T A;  4KE5 A;  1B99 A;  2GMH A;  2E5H A;  5KFE A;  4GKJ J;  1F9E B;  2R8J A;  3LP0 B;  1K1Q A;  4M63 A;  3H5U A;  3C66 A;  2C2E A;  1C0U A;  3CMQ A;  3DRS B;  2MLY A;  1ZPV A;  2OD6 A;  2R2S A;  5F9N A;  1TQL A;  4MIB A;  3H5X A;  2QE5 A;  4F02 A;  1RAD B;  1VFJ A;  2DEI A;  4LFC F;  2MQ8 A;  4CM2 A;  2LFV A;  1C0T B;  2CQP A;  4P2X A;  5HAN A;  3M2V B;  5ETT A;  3AB2 B;  3VVT A;  2RDJ A;  2RHQ B;  2XSJ B;  3K5L A;  2HRU A;  3FFI A;  4H4M A;  1S97 A;  4PAB A;  1MSW D;  4YY3 F;  5LSO A;  3KMS A;  2GJF A;  3HHL B;  1VJQ A;  2HWI A;  4NZ0 A;  2H5J B;  2MKI A;  3UR3 C;  4UT4 A;  3HVT B;  2ZH7 A;  3EIC A;  2HGL A;  2VQE F;  2BBE A;  1X4G A;  2GAG C;  3I9V 9;  4TQR A;  1R89 A;  2DR7 A;  3R3T A;  3LWM A;  1XNR J;  2IJF A;  2YX7 A;  1VCT A;  4DX5 A;  3BH6 B;  4NA1 A;  3T1Y F;  3DI6 A;  5HJY A;  3C6U A;  5KFN A;  5GAH I;  2VOD A;  4ZLJ A;  4KKO A;  1R8P A;  5KFD A;  3SV4 A;  1FD8 A;  2IFX A;  2X51 A;  4ZVR B;  4Y2C A;  4ED7 A;  1WHY A;  4ECT A;  3IGV A;  3HKW A;  2HAI A;  4NCG B;  4DEZ A;  3T1H J;  3FKB A;  3ETO A;  5C2C A;  1TKX A;  2J0W A;  2VQF F;  2CQ0 A;  1J5E J;  2FGO A;  3W2W A;  4ZPD A;  4RBU A;  4F4K A;  5C2G A;  4OYW A;  4WU2 A;  2HK2 A;  2JH3 A;  4EUV A;  4CCH A;  4CLZ A;  3MDF A;  5BR8 J;  1TUW A;  4J9L A;  4ZDN A;  1U24 A;  4TU7 A;  3AXM A;  3OXL A;  3NL0 A;  2I0X A;  2RRB A;  1JKH A;  5ETQ A;  4DL4 A;  3M2U B;  4OYI A;  3ZZO A;  4J9Q A;  5M2R A;  2W7P A;  3SV3 A;  3CCE S;  1V5V A;  1GMW D;  1MU2 A;  2QSW A;  2WSE C;  1BWE A;  1DTT A;  4Y2M A;  5E41 A;  4QWE A;  3GP9 A;  4LF1 A;  5G4D A;  1IR2 A;  2Y1I A;  4WK1 A;  4NOH A;  1KVJ A;  1KWM A;  2BRL A;  2YWK A;  1CUL B;  2CQI A;  4A47 A;  2DPI A;  2YNH A;  2ZBQ A;  2F4V J;  3BSC A;  3FDS A;  1HWJ A;  2CNO B;  2C3P A;  3PV8 A;  1IBL J;  4HHH A;  3O2I A;  2DYA A;  3NS7 B;  1PJ6 A;  1VQM S;  4X64 F;  1S59 A;  2HIY A;  1OYE A;  3DLG A;  7FD1 A;  3DDI A;  1GXU A;  3RBE A;  2UXB F;  3VCD A;  2OML A;  2IJN A;  2YXL A;  3HT3 A;  3WZ0 A;  4DXL A;  2V68 A;  4Q0B A;  2QA4 S;  4KH1 B;  4TVA B;  4FKY A;  4M5M A;  4DN9 A;  2YH0 A;  4DR5 F;  3QRP A;  3CC2 S;  3F73 A;  2NXU A;  2HFN A;  5AXN A;  2VUG A;  1C1C B;  3EZU A;  3LW5 C;  4QU6 A;  2WVC A;  4DF8 A;  4NMX A;  3T5J A;  1N48 A;  4FS2 A;  2FVC A;  1N8R T;  3ZZU A;  1RWW B;  1KLN A;  4I6A A;  3MMC A;  3VAM A;  2H4W B;  3OPK A;  2BV3 A;  1FXL A;  3DXS X;  3H7H B;  3EVM A;  5J2Q A;  4DPU A;  4DQR A;  3FMW A;  3OSN A;  1PC5 A;  1ZH5 A;  2GZO A;  3WQP A;  5ETK A;  2FPH X;  3TVK A;  4P6Q A;  2K1R A;  2YH1 A;  5DET A;  5EWE A;  4I0W A;  1KQS R;  4MFB A;  2KJW A;  2ZKT A;  3M9N B;  3H90 A;  1M5P C;  2HWT A;  1KP6 A;  3PX0 A;  5IZH A;  2GQC A;  1MRO A;  3QIP B;  5D0H A;  4PWD B;  2W4D A;  2ZUG A;  1R43 A;  2QL9 B;  3CWJ A;  3LO3 A;  5KFZ A;  2ATL A;  5F8I A;  5L1I A;  4JI4 J;  2OP5 A;  1RT7 A;  4G3I A;  4UY8 T;  1NSQ A;  3ZZZ A;  2LEC A;  2CAD A;  3JXO A;  3MTK A;  3NAI A;  2ASY A;  3ILO A;  1TAU A;  3US5 A;  4LRA A;  2ZWP A;  4FKX A;  1CPZ A;  1TK8 A;  2CWX A;  1RDR A;  4WXO A;  5C42 A;  3K5P A;  3G6Y A;  3JYT A;  2AW0 A;  2XMM A;  4MT1 A;  2RQK A;  4I7F B;  5T7L A;  3R2D J;  1HPZ B;  3MM5 B;  4M5L A;  4RW4 A;  2DIU A;  3MR5 A;  1Z2L A;  4YP3 A;  1IKW B;  1HNW J;  2W8L A;  4K4T A;  4RU2 A;  2FJW A;  5AXM A;  2HYI B;  4ZCL A;  3F41 A;  2B8Q A;  3VTI A;  1EKS A;  3I5C A;  4F7V A;  2VH7 A;  4J9U E;  3W8P A;  3GJQ B;  3QID A;  1A6L A;  4LR7 A;  3CC4 S;  4GO5 X;  4DV0 J;  2O01 C;  3N79 A;  4TNO A;  5KFU A;  3ISN C;  4PQU A;  2HHQ A;  5JVG Q;  2IM2 A;  2DTJ A;  3H25 A;  2GQQ A;  2M70 A;  3R27 A;  3LQV A;  1UZH A;  3TA1 A;  2XYP B;  3BSN A;  5HMW A;  2Q6B A;  1TVR B;  4JV5 J;  4JP8 A;  3IRX A;  2M0G B;  2JEJ A;  1RA7 A;  4LRF A;  2G1H A;  3GR1 A;  3PR4 A;  2C2N A;  2V8H A;  2MEW A;  4BLG A;  1KLM B;  1NKB A;  1HBN B;  5D77 A;  5KG0 A;  1H2T Z;  3I55 S;  4J9M A;  2FIU A;  1FJC A;  3OFF A;  2VFT A;  3MEE B;  2YPZ A;  3WC0 A;  3IBW A;  4BCA A;  3BN7 A;  3POT B;  3OSP A;  2CG8 A;  3GIR A;  4FDF A;  1PCA A;  5GVQ A;  3N5B A;  3KJN B;  2V8D A;  1YIJ S;  2F9J A;  2DBB A;  3TJA A;  2HUR A;  1S4E A;  4NLT A;  4Q7A A;  4QQB A;  4LF2 A;  4UQT A;  1CC7 A;  3IWX A;  2HFU A;  3GSD A;  4R5P B;  3PFO A;  1IXK A;  3J7Z 5;  4AQY J;  3D6T B;  4J91 A;  1FI4 A;  2AU0 A;  2LP4 A;  3DRP A;  3HSZ A;  1WC6 A;  1SL2 A;  1M1H A;  3M8P B;  1AUS L;  5AT1 B;  4FXD A;  2FVR A;  4MAK A;  4DV4 F;  4HAC A;  4JI3 F;  1SL1 A;  3HM9 A;  4IQM A;  5L39 A;  1R0A A;  3C16 A;  1WTF A;  2OLW A;  2OD4 A;  1NJI T;  4S0M A;  4MKB A;  4D3G A;  1C0U B;  5ETN A;  1BC6 A;  1S9F A;  3NXZ A;  5I3Q A;  3DRX A;  4A8O A;  2CNK B;  5A6W A;  3UDV A;  4I56 A;  1FKA F;  3MEK A;  5C25 A;  2EVZ A;  3D66 A;  4ECW A;  5L38 A;  1FEE A;  2LU1 A;  4I2Q A;  1YZ6 A;  4ID5 B;  3HFV A;  4W98 A;  3PW4 A;  2UUA F;  1QVF R;  4ANE A;  1HHS A;  2CQG A;  2DH8 A;  1B70 B;  4W4M A;  2M7S A;  3D67 A;  2HAF A;  2EK6 A;  3FFI B;  2N3O A;  4H4M B;  3NGD A;  2XO6 A;  2HHX A;  4JI6 F;  3UDL A;  4O3P A;  3K58 A;  4B9N A;  5CCM A;  1XK8 A;  3ILI A;  3J7Z T;  1QTM A;  1CC8 A;  2WSC C;  1A7G E;  3GQC A;  5D8H B;  2HK3 A;  2L08 A;  2R7T A;  3TRG A;  4W90 B;  2KI2 A;  1SCJ B;  4EFA C;  1H0H B;  3U7J A;  5ETV A;  2PD1 A;  4DOZ A;  3GG0 A;  4QWD A;  3JAM Y;  2HQ3 A;  3A4T A;  3SSS A;  2W2P P;  3AAW B;  4A46 A;  4ZA1 A;  4QYR A;  3M6U A;  1SJ4 P;  3DN9 A;  4WU3 A;  4NYP A;  1GXT A;  3FQL A;  4USW A;  4ZLN A;  2VC0 A;  3DI6 B;  2DNK A;  2NUU G;  2GGP A;  1GMW A;  4QIW D;  3C6U B;  1QSL A;  3C3L A;  1WC4 A;  3I5B A;  4Y34 A;  3H2L A;  1N33 J;  2ZBI A;  2E44 A;  4KKO B;  2MXY A;  3BH7 B;  5KT2 A;  4ETX A;  1K73 T;  4CTA A;  5LMN F;  1M5K C;  4DV7 F;  2RUG A;  3R1H A;  3TAQ A;  1G7C B;  1YJV A;  1X9S A;  3TZW A;  1TKX B;  5IC4 B;  4AFF A;  2VA2 A;  2ACM A;  4NYZ A;  2KRB A;  3CB4 A;  2HHW A;  1M5V C;  2NS1 B;  3W2W B;  1R7I A;  5AE3 A;  3PHT A;  3W60 A;  1X4F A;  1RHU B;  1OWX A;  4Y6I A;  3CD0 A;  1ZBT A;  3UQS A;  1RLD A;  2APO A;  2R7R A;  4OYO A;  1JKH B;  2MGZ A;  3VHQ A;  1PKU A;  5L8R C;  5EDW A;  3VQS A;  1F60 B;  3UVJ A;  3W7B A;  4V19 J;  3BJY A;  3HDS A;  1MU2 B;  3GV5 B;  2W7O A;  4OLO A;  1DTT B;  4X62 J;  2B4O A;  5HBM A;  4PPD A;  4A8F A;  1RB0 A;  4LF9 J;  2PEB A;  4CT8 A;  4IYQ A;  2YNH B;  2HNY A;  2FD2 A;  4P75 A;  1PYS B;  5E33 A;  3CT9 A;  2ZH5 A;  1HNX J;  1Q7Y T;  3X3U A;  2CJK A;  1WSV A;  5L9N A;  2B4V A;  1VOM A;  1VQO S;  4IR9 A;  2QMU B;  3QT8 A;  3DLG B;  1HBO A;  1Q7L B;  3TX0 A;  1RTD A;  1DZ5 A;  2HVD A;  5HMY A;  1S1W A;  2R7W A;  1S1X A;  2FLP A;  1RAF B;  2HEK A;  1CBK A;  4F67 A;  1WNE A;  2ZM6 F;  1Q8I A;  2B9W A;  4DR4 J;  4K0K F;  3D0I E;  1KFS A;  4BDP A;  1EET B;  1K44 A;  4PG4 A;  4B9U A;  2IHR 1;  2R8H A;  4XIU A;  3BO4 A;  4Q0B B;  2CPI A;  3FNN A;  3KJQ B;  1U1R A;  4F50 A;  2E5L F;  4YQW A;  3MAQ A;  2VPX B;  3FVY A;  3CDU A;  2MKJ A;  4RNH A;  3Q8R B;  3J81 j;  3EYZ A;  4C8M A;  2UXC F;  3GV7 B;  4C98 A;  3J7Y I;  2DJW A;  3T19 A;  1TP7 A;  3Q83 A;  5LJ3 Y;  3HX9 A;  3KNA A;  4OJ1 A;  3MMC B;  4PG6 A;  4FF3 A;  4X65 F;  1PBA A;  2MKY A;  2H5E A;  5J2Q B;  2BW7 A;  5K8N A;  3PO4 A;  2FVP A;  2PC6 A;  3GV8 B;  1LXJ A;  1I94 F;  5JJB A;  2UV8 A;  4JV2 A;  3UCZ P;  3PW2 A;  1FT8 A;  3KKF A;  2K1R B;  4FS1 A;  2KFN A;  4KBI A;  5IT9 U;  3O3L A;  4F36 A;  3E8O A;  1EX8 A;  4M8L A;  4JBC A;  2GV1 A;  4USU A;  4MKY A;  1U26 A;  4ZS6 A;  3G8T A;  3RRH A;  3WHI A;  4ZJO A;  2JHE A;  2QC3 A;  5K8O A;  1MRO B;  4OZ5 A;  4Z2X A;  3L7U A;  3UWT A;  2XBP A;  5B0F A;  3CD7 A;  4C48 A;  4ECX A;  2ZUA A;  4RWW A;  1RT7 B;  1R8H A;  4DSJ A;  4G65 A;  2CPD A;  3RB3 A;  4M5D A;  4DV1 J;  4KO0 A;  1RIS A;  2K3I A;  4QYZ J;  2N3L A;  2DNN A;  2RNE A;  1D9F A;  3M6W A;  4NXM J;  2E66 A;  1RWO B;  2P9C A;  3OL7 A;  3KG0 A;  1PAU B;  2DHG A;  4NLW A;  3BV8 A;  4J9S A;  5C42 B;  1B0P A;  2RAQ A;  2Y1L B;  2CRL A;  4DF4 A;  3JYT B;  1XN9 A;  1IWG A;  1PO6 A;  4DI6 A;  4OI4 A;  5T7L B;  4OX7 A;  2DNP A;  4XAK A;  1U2F A;  4WWS A;  3KUG A;  1QJH A;  5LMU F;  4RW4 B;  4CO1 A;  1RI7 A;  2HRT A;  3X1L B;  1RKI A;  3D1O A;  2M8H A;  2VU5 A;  5ITH A;  1IBK F;  3GPA A;  1YQH A;  1WEX A;  1BXN A;  3PJ9 A;  2YWE A;  4ER8 A;  4NZ7 A;  1HNI A;  4P7V A;  3GU0 A;  1S0M A;  1X4D A;  4P73 A;  1H3D A;  3NMR A;  3AJ1 A;  4DFJ A;  4NLQ A;  2ZDO A;  2AJ0 A;  3D2W A;  4J9O A;  1Y7P A;  2XGQ A;  2I6W A;  4KC5 A;  4I69 A;  1R27 B;  5DLG A;  2AJF E;  4LF7 J;  2GHW A;  2GNK A;  2AD9 A;  2UXD F;  3BGO P;  3D28 A;  1HFE L;  4DL7 A;  1NEE A;  3IRX B;  4FVM A;  4YB5 A;  3AQP A;  2QIF A;  1J5O A;  1F9H A;  5LL6 d;  3J80 U;  2F40 A;  3OR1 A;  2NSB A;  4MYT A;  2ZH2 A;  1JMT A;  2R9L A;  1RBA A;  5CQG A;  5J2M A;  4RPF A;  4KSE B;  4C0B A;  4DQQ A;  1JB0 C;  4CO0 A;  4B3M J;  3OJU A;  1TL1 A;  2VG5 A;  4NXN J;  2HFO A;  1XWL A;  2BM1 A;  1IM4 A;  4G1P A;  1HWK A;  2FQQ B;  1V3Z A;  4J7C A;  4X4O A;  2RS2 A;  4OYZ A;  4IQX A;  2DNR A;  1IKX A;  1KEK A;  3DFE A;  5B0G A;  4YR3 A;  1FHT A;  4OI3 A;  2AJ1 A;  3U1N A;  1QTN B;  1JXL A;  3DRP B;  2LQ9 A;  4DUT A;  2ZNZ A;  2ADB A;  3ISZ A;  3NP5 A;  2HHS A;  3EGV A;  5BXI A;  1U48 A;  4HAC B;  1SI9 A;  1S6P A;  3CJ8 A;  2PII A;  2QN6 B;  2E29 A;  2E9Z A;  1NJW A;  1UWA A;  1VC0 A;  2HVE A;  2CQ4 A;  1R0A B;  1V3R A;  3N6L A;  1SIW B;  3C16 B;  2Y1R I;  5HQL A;  1N5Y A;  1MWZ A;  5KT7 A;  1MNE A;  2MKH A;  2ACY A;  3RRG A;  1TL7 A;  1BD6 A;  2CVI A;  4K4S A;  3MFH A;  2W2N P;  2NZ4 A;  3BO3 A;  3MM7 A;  4DV3 J;  1WEY A;  4Q8E A;  5C25 B;  1RT5 A;  2DNO A;  3VGS A;  3TAM A;  4K59 A;  1LQ9 A;  4I2Q B;  3UO0 A;  1WDT A;  4PRF A;  4A8W A;  3CDA A;  5KFX A;  4UUW A;  3LAL A;  1FES A;  3TAP A;  4K2X A;  2Y0S D;  4KPC A;  4O3O A;  2IAJ A;  2R7V A;  2M9K A;  3OQ2 A;  3GIJ A;  3G96 A;  1B64 A;  4WTY A;  3GE9 A;  1X0F A;  4OYB A;  5KFQ A;  2AEF A;  1CJK A;  5DGA A;  2KVQ E;  1VIS A;  4LFA F;  2QLF B;  4CO3 A;  1HA1 A;  4KR0 B;  2A6M A;  2F8M A;  1WOS A;  3S7R A;  4JI7 F;  3KUH A;  1HYS A;  3W63 A;  3DNC A;  3OL8 A;  4HLB A;  4I2P A;  3C2P A;  3HI9 A;  1F3V A;  2GGP B;  1PGZ A;  1Q8B A;  2KYX A;  3CUL A;  2EW9 A;  1PIL A;  3W9J A;  3MF5 A;  1QAY A;  4GC7 A;  1Y5I B;  3MD3 A;  4CTA B;  3H8Y A;  1RT3 A;  4M5N A;  4IOA Q;  2NR0 A;  4FXW A;  2UUB F;  1HQU A;  4TN2 A;  5E3C A;  1B0V A;  1YBT A;  3BN4 A;  4LRC A;  2ZHA A;  4F2R A;  2XYG B;  2ZH3 A;  2VDH A;  2AX0 A;  3CIZ A;  2C42 A;  4OX9 J;  2U2F A;  4DV2 F;  4UZB A;  1NM2 A;  1QAX A;  3N28 A;  1MLA A;  3CCT A;  3CW2 C;  3FUY A;  3OFH A;  2AGP A;  1N34 J;  1SC6 A;  2XI3 A;  1U0S A;  3THV A;  1KS2 A;  4WXW A;  1NXI A;  3LAK A;  2AYE A;  4ZK7 M;  4HHJ A;  5HI7 A;  4I64 A;  4IFV A;  2BW2 A;  3MHY A;  5L9X A;  1R6V A;  2MGZ B;  1UPM B;  5KFJ A;  1WWH A;  2G2Y A;  1E6V A;  3CF5 Q;  2MLX A;  3KXD A;  3UVJ B;  5I3U A;  1I5O B;  2AZ1 A;  3U1M A;  3E01 A;  2OI2 A;  1BQN A;  3BGL A;  4Q45 A;  1CG2 A;  3IBC B;  2AJ2 A;  3OVS A;  3GSI A;  5HBM B;  1OSC A;  1NAQ A;  1ZET A;  1TKD A;  1N0U A;  2HS4 A;  1ITP A;  2HNY B;  2W2Q P;  3IGN A;  3AFG A;  2JSX A;  3I31 A;  4DL0 C;  2V2Q A;  4K4X A;  2Q3P A;  4XPC A;  3A8K A;  2X1F A;  2Z57 B;  3NGT A;  4Y3C A;  2MLZ A;  1GQE A;  3T5H A;  3C6T A;  3RBX A;  4NPO A;  5DQI A;  5AJ3 J;  1KOO A;  2XGP A;  1HBO B;  1RYR A;  1RTD B;  1S1W B;  1S1X B;  3FSY A;  2G0C A;  3OJS A;  2K06 A;  4KY3 A;  2ATC B;  3CGI A;  3QFW A;  5EX0 A;  1A0O B;  3TX8 A;  5G0R A;  3TA2 A;  2KDO A;  2V5H G;  2X7I A;  2W4P A;  2V4J A;  1UEU A;  4DBQ A;  2QZ8 A;  4XDD A;  2PA8 D;  3AA9 A;  4ZPC A;  3OT9 A;  2POK A;  2I38 A;  1RWK B;  4BS2 A;  1H2V Z;  4M5I A;  3N4W A;  3OTE A;  8ATC B;  3Q2S C;  3BZQ A;  5IV4 A;  3M9O B;  1BQM A;  3QO9 A;  3MM6 A;  3BKT A;  3IC1 A;  3PAC A;  4JV1 A;  4JV0 A;  4C3K A;  4RW6 A;  4OZ2 A;  3T5L A;  2KN4 A;  4CH0 S;  4HT7 A;  2YQ0 A;  1VMB A;  2IJR A;  4BC7 A;  3OL6 A;  1TAQ A;  4M5J A;  2ZEJ A;  2ZKU A;  1FDD A;  3NCR A;  4C0O C;  2HQD A;  4JOU A;  1D9D A;  2RIL A;  2NRE A;  3I4P A;  2ZBC A;  3TEG A;  3HHN B;  1VQL S;  4B3R J;  5KG2 A;  4DR7 J;  2R8G A;  2YQ3 A;  4USI A;  3W5Z A;  3KK1 A;  1RHJ B;  2XM3 A;  3M32 B;  3GFY A;  3OFE A;  5J2N A;  5AXK A;  5DRK A;  1Y10 A;  3EUN A;  3H42 A;  2XHC A;  2UUC F;  2LLZ A;  3VAF A;  4F4W A;  3AOD A;  3RB6 A;  5AE2 A;  1G2E A;  1YRU A;  1XMO J;  3AD9 C;  2D7S A;  1RT2 B;  3R7B B;  2IA0 A;  4DPT A;  3F0N A;  1KOH A;  4M5D B;  4KO0 B;  4B9M A;  3IN5 A;  2J9C A;  4JB8 B;  2XHW A;  4LJM A;  2JEG A;  3DGP A;  2HHH J;  1NZ8 A;  4URQ U;  2XZT B;  1NO8 A;  1XNQ J;  5HVG A;  3CE8 A;  2MZT A;  2NPF A;  2JDJ A;  1FE4 A;  2XMA A;  6AT1 B;  1X9M A;  1N54 B;  2WOM A;  2IDL A;  3MCN A;  1VQP S;  1FF2 A;  4AND A;  5A8K A;  1N52 B;  4ES2 A;  1EKR A;  1SXL A;  4N41 A;  3OVB A;  4W92 B;  3DYA B;  2VDI A;  3BDP A;  1D8Y A;  4TY9 A;  1FXR A;  4JI2 F;  4KHM A;  3UDC A;  7FDR A;  4PG8 A;  2D1C A;  4XK8 C;  3J7A 1;  5IFM A;  4BBY A;  4CO2 A;  2A2C A;  2C2O B;  4ZP8 A;  1ZTT A;  1HAR A;  1UET A;  4GKJ F;  2PFD A;  1VRU A;  4DCO B;  4LBI A;  1EB0 A;  2HHP A;  5IS2 A;  4CNY A;  4LSN A;  1ROF A;  3PXG a;  4B3S J;  4USM A;  1HNI B;  4L3K A;  4ED4 A;  4PEO A;  2DRD A;  5L46 A;  3W5Y A;  1XJW B;  5E3R A;  4PG5 A;  1ACM B;  2E9R X;  3I9Z A;  1JJH A;  4V19 X;  1NB7 A;  3C8Y A;  2XS7 A;  3D0H E;  2MZS A;  3G8Q A;  1YTY A;  3UDE A;  3EPG A;  1Q5V A;  3HZG A;  1X5T A;  3B8H A;  4KGZ B;  2VJV A;  1VDH A;  5A6P A;  1YZ7 A;  1J5O B;  3K5M A;  4C6A A;  1NB2 A;  2BE2 A;  3SXL A;  1E6Y A;  1WC3 A;  4URG A;  5J2M B;  2HNZ A;  1S76 D;  1R3N A;  3TVZ A;  2IC3 A;  3M05 A;  4E2F B;  3SMZ A;  3ZZT A;  3PZP A;  4X4V A;  2P6S A;  3T5K A;  1N36 J;  2RKI A;  1URN A;  5FJ4 A;  1TL1 B;  2VG5 B;  3M8S A;  2WW8 A;  2GQ2 A;  4U7U D;  3T9N A;  3PRD A;  1XNR F;  4PG7 A;  3GIM A;  1XBW A;  1Y3J A;  4WFX A;  5CA5 A;  2J6U A;  3OLB A;  4X4P A;  2DKO B;  3NNA A;  5CD4 H;  1IKX B;  2ERR A;  2QYC A;  2P9G A;  4AD6 A;  4DX8 H;  1XIQ A;  4O3R A;  3ZTO A;  1N6Q B;  3BBB A;  3RZA A;  2FTR A;  2FJX A;  2RQM A;  5KFO A;  3T1H F;  1S6P B;  1F9F A;  1H2U X;  5LSR A;  2W8K A;  3NGS A;  3W8G A;  4DG1 A;  1UCN A;  1J5E F;  1F2G A;  3FEY B;  1U1Q A;  4ELT A;  2MZ1 A;  2BKP A;  1N5Y B;  3TUZ C;  5BR8 F;  1T9T A;  2ZH1 A;  2ROG A;  2NUH A;  2VB6 A;  3MMJ A;  4HHU A;  3R8Y A;  1TK0 A;  3LGN A;  4ED6 A;  4H4K A;  4NCA A;  4JI5 J;  1DFD A;  3B82 A;  3M8Q A;  3MM7 B;  4KPY A;  3Q8V A;  3W65 A;  4CRJ A;  2ZOG A;  3PEJ A;  2IDE A;  1RT5 B;  4DR1 J;  5GAE U;  4CLL A;  3OV7 A;  1RBL A;  4TXS A;  3BGF A;  4KT0 C;  4MJK A;  2NXE A;  5KFS A;  2WZ1 A;  4DFP A;  2KT2 A;  2B4P A;  2V69 A;  4HH0 A;  4LF6 J;  1VR6 A;  4ZCM A;  2PT0 A;  2IAJ B;  2BOA A;  3AD8 C;  1FWK A;  4IG3 A;  2Y8W A;  3O6Q A;  2DGW A;  3MPW A;  4PXB A;  2F4V F;  1CJK B;  2X1G A;  1FTR A;  1WI8 A;  2XY6 A;  5F8N A;  2YWG A;  2BQR A;  1D1U A;  4O23 A;  4C4W A;  1VIX A;  3GJR B;  3FCV A;  1TMM A;  2PEH A;  1UW9 A;  1JX4 A;  3SCJ E;  2A0F B;  2IM1 A;  3D7S B;  1HYS B;  2V6A A;  4I2P B;  3H98 A;  3T1Y J;  2B9E A;  3I87 A;  1YJU A;  3E3X A;  3OXF A;  3BQ1 A;  3CDW A;  1FNX H;  2G13 A;  2WK4 A;  5JVH Q;  2XY7 A;  3GB0 A;  1HW8 A;  1GX5 A;  3L3C A;  1FKO A;  1IBC B;  1RT3 B;  2B0G A;  4ICL A;  3BYP A;  2OTJ S;  1HQU B;  3BGU A;  2CNL B;  1UVL A;  4QZV B;  3OUY A;  2VQF J;  3ELH A;  4JI0 F;  1S6O A;  2ZIT A;  2E1A A;  3BO2 A;  4ZP7 A;  2XS5 A;  5D4O A;  4NCB A;  1F5C A;  3PEH A;  3QPI A;  3NS6 A;  2JC0 A;  2E5J A;  2M4M A;  1Q81 T;  2Y8Y A;  4QR2 A;  1NK4 A;  3MR7 A;  2EFO A;  4FF1 A;  1HBM A;  2QT7 A;  4ZVU B;  3ZFV A;  1W2B R;  3PRV A;  4F26 A;  4IFV B;  1U8S A;  2B5J A;  1OY9 A;  3JAM U;  3GMG A;  3GJS B;  2WVB A;  1SKR A;  1KKH A;  4U9R A;  3DLK A;  5I3U B;  2DGU A;  2KHC A;  3E01 B;  1JNZ B;  1IKV A;  2IYG A;  3H59 A;  2MZQ A;  1FJE B;  5KFC A;  1FRH A;  1BQN B;  3LOU A;  2FB0 A;  1F1B B;  5KFT A;  3FSX A;  1CJT A;  2LMI A;  2XMJ A;  1V9O A;  3FZB A;  3DHW C;  4JI4 F;  3HD1 A;  2DH9 A;  3KLE A;  3M2R A;  2GO8 A;  1FXD A;  1DQ8 A;  3THT A;  1PAE X;  2JZ5 A;  4AL7 A;  2HFS A;  1VK3 A;  1TV6 A;  3PRB A;  2RSQ A;  3C6T B;  2PI4 A;  1I3O B;  2L41 A;  4EZ9 A;  3ZO7 A;  2HVH A;  3HSJ A;  2QLW A;  2DXF A;  1FRI A;  2DNG A;  1WOR A;  4R8U B;  1QD1 A;  3R5C A;  5A8R A;  2WB1 D;  1VQ4 S;  1Z2Z A;  5G0R B;  3PKY A;  4LF4 J;  5EN1 A;  4PAA A;  2HVZ A;  5JXS A;  2DIV A;  2LCW A;  4EO8 A;  3CCQ S;  2V4J B;  4F4Z A;  2IRY A;  1PBU A;  2XNR A;  3KJF B;  5DG7 A;  4KYZ A;  2RHS B;  1P1T A;  4WYL A;  1KNZ A;  4NLG A;  2HQC A;  1Q86 T;  4RUC A;  1VHI A;  4NWB A;  3K17 A;  4MH8 A;  3HCX A;  1BQM B;  1Z4U A;  2K7K A;  3QO9 B;  3G87 A;  3MM6 B;  3DLH A;  2BJD A;  5HSP A;  1H98 A;  1T9W A;  4DV0 F;  3QGG A;  4RW6 B;  1VQY A;  4CT9 A;  2ZVI A;  1VGY A;  3LAN A;  2CKW A;  5I42 A;  4RNF A;  4L3N A;  2A18 A;  1NDC A;  2PN6 A;  1HR0 J;  1DLO A;  4GVB A;  2J5A A;  4JV5 F;  4AXJ A;  4IRD A;  2VKZ G;  4DZD A;  4FYY B;  2R7X A;  2W9C A;  3BB5 A;  4PYA A;  2VOP A;  4P72 A;  3KK1 B;  2Z2L A;  3FZ2 A;  1WOP A;  2VOO A;  2LXU A;  2QTW A;  4J9P A;  1SC1 B;  4DR6 J;  2CPY A;  1K47 A;  2E1C A;  2OEJ A;  4FYW B;  2ZBP A;  4LSL A;  3OHA A;  1TL3 A;  2LDY A;  4ELU A;  2W24 A;  1HNV A;  3IAM 9;  3MEG A;  5L1L A;  2E7V A;  5U47 A;  3SIP B;  5CD4 A;  5J1P A;  2P2C B;  4ZVP B;  5T14 A;  2ZJR Q;  3RUB L;  4CO5 A;  2HLT A;  1SH3 A;  3CJS A;  1ZYQ A;  3DGP B;  4KH0 B;  3GCX P;  3KK3 A;  3EXC X;  4AQY F;  4RNM A;  2OPS A;  4NLO A;  5D4P A;  2WB4 A;  2XMK A;  4DX7 A;  1VQ6 S;  2F9D A;  4QJV A;  2WOM B;  3NWG A;  4U8V A;  5A8K B;  2F5G A;  2JVO A;  1NK9 A;  3KLG A;  3MED B;  4Q2M A;  2OH2 A;  3PVX A;  2ZD1 A;  1H7X A;  1MW7 A;  3BBF A;  1HQ2 A;  2GW8 A;  4N8N A;  2KFZ A;  4USJ C;  3V6D A;  4C8K A;  1QE1 A;  4DJB A;  4ZVG A;  1WKK A;  4OX8 A;  1JLG A;  3PY8 A;  2ZZT A;  2QLB B;  4XO0 A;  1K0T A;  1VRU B;  1PYT A;  3GIK A;  3T6J A;  1FD2 A;  1NBE B;  3TVY A;  4IRC A;  4YUD A;  3NMA A;  4LSN B;  1RJJ A;  2DY9 A;  3CME S;  2DD8 S;  4A8S A;  2XC9 A;  4RKU C;  3Q23 A;  2FZG B;  3GZ7 A;  1DAX A;  2BJ9 A;  5KG3 A;  2FYX A;  4B9T A;  1LWE A;  2GHV C;  4CLK A;  2BQ3 A;  1HWU A;  3JSY A;  3PKM A;  2HPU A;  1K8A T;  1C2P A;  4XPE A;  2DGX A;  4ED8 A;  2RRN A;  4ILR A;  1S9E A;  2ZHB A;  3UD4 P;  2B56 A;  2BE2 B;  5HVF A;  1E6Y B;  3D1H A;  2VIC A;  4KTQ A;  1RHQ B;  1B0T A;  2HNZ B;  3B4M A;  2H5I B;  1U4B A;  1GMV A;  2IC3 B;  4B3T J;  2YVS A;  3RG6 A;  2LEA A;  4DDF A;  2RKI B;  1D0E A;  2R7U A;  5KFG A;  4DFM A;  2CZ9 A;  4Y65 A;  4DUZ J;  4RUA A;  3BSA A;  3KFW X;  2EK1 A;  1H74 A;  4XDC A;  4U7U K;  3KMQ A;  1EAR A;  5DQG A;  1N33 F;  4RBT A;  2BJ7 A;  1NPR A;  7AT1 B;  5M2P A;  3LTO A;  4GKK J;  2BAB A;  2HHU A;  1WHW A;  3V4M A;  3HHE A;  4I6W A;  2KKH A;  1KBR A;  2JWN A;  3TEH B;  1G3O A;  2XUL A;  3HHL C;  1RHM B;  3AJ2 A;  5KFA A;  1X4E A;  4MK8 A;  2EPI A;  3GIL A;  4DG1 B;  4OHX A;  4K4Z A;  3DLL Q;  2YY3 A;  3KNG A;  1FJG J;  2RJZ A;  1F0X A;  2XS2 A;  4P10 A;  4USH A;  5KG6 A;  4X4T A;  2DNM A;  2F65 A;  3K5N A;  1SC3 B;  1RBO B;  1HI0 P;  4C2M A;  2O1P A;  2L48 A;  3DOL A;  5KT3 A;  1NLK L;  4FYD A;  4OZL A;  2BKO A;  2FJB B;  2EC2 A;  2KXH A;  1LK5 A;  4Q44 A;  1SJQ A;  2IIH A;  3M8Q B;  1JQG A;  4QIE A;  2O5D A;  4CLT A;  1U1P A;  4EBD A;  4EWT A;  4LFB J;  4H54 A;  2F1F A;  4KFB A;  4F3Q A;  1OMS A;  1YJ7 A;  3NOG A;  2R7Q A;  1NH7 A;  3N6M A;  3TI0 A;  1W25 A;  1WJ9 A;  4ENO A;  4X62 F;  1IUJ A;  1MML A;  3NGK A;  3UN5 A;  4X4U A;  5CYJ A;  4IG3 B;  1CQM A;  4CH7 A;  3RAX A;  4P2M A;  1Y0H A;  2Z56 B;  4LF9 F;  2BKN A;  2A10 A;  2Z58 B;  4NAS A;  2F4F A;  5KOW A;  4LRE A;  1M5O C;  5B0C A;  1KSP A;  1HNX F;  2QMW A;  4KIA A;  3GLJ A;  1N32 J;  5F8G A;  2B51 A;  2FGC A;  4LMZ A;  1EQM A;  1CQN A;  1BMQ B;  3G8S A;  2QA1 A;  3KHL A;  2DPJ A;  2HHV A;  1NK5 A;  3PX6 A;  4N77 A;  1XR7 A;  3LP2 A;  3CJT A;  1S4F A;  2QJ3 A;  3HSG A;  3ZTS A;  1OO0 B;  4MK7 A;  3RB0 A;  4F4Y A;  1S48 A;  1NJZ A;  4DR4 F;  5HAT A;  1D9A A;  6FDR A;  2YKN B;  2CQ1 A;  1FKO B;  2GMJ A;  4ICL B;  5B09 A;  4NYO A;  1GTH A;  3R1L A;  3QNW B;  2MQQ A;  3I0S A;  4URS A;  4WIQ A;  3CD6 S;  4ELV A;  3D6H B;  4Z7C A;  1WC0 A;  3BKU A;  1RKJ A;  3SI8 A;  1RHK B;  3OUY B;  1VIO A;  2BM0 A;  1YJW S;  3M8Y A;  4HDG A;  3RTV A;  1ZTW A;  2C2Z B;  2OJ3 A;  4KHR A;  3SSQ A;  3QGH A;  3ILL A;  3UFC X;  1NKE A;  2OSR A;  4EMD A;  2RUS A;  4NA2 A;  4DV5 F;  2AEM A;  1OYD A;  3T1A A;  4RLE A;  1HBM B;  4U67 Q;  2Q1L A;  2IBK A;  1HLW A;  1UVI A;  2EFN A;  2B5J B;  3PG9 A;  5GMK a;  3J7A N;  3MI7 X;  3DLK B;  1HW9 A;  3I82 A;  3OTO J;  1FER A;  3EWG A;  4CYU A;  3Q8U A;  4LF8 J;  4LIW A;  3OFG A;  4KGX B;  1IKV B;  2C2M B;  3OTB A;  1SPB P;  4ZIV A;  3FGV A;  1FE0 A;  1CJT B;  5F8L A;  1Q1K A;  3FEZ A;  4CLW A;  3KLE B;  4C97 A;  3HFZ B;  2Z8Q A;  4J37 A;  4DV1 F;  2EKN A;  1TV6 B;  4UUX A;  1U49 A;  3LF0 A;  1KVK A;  2JFD A;  1O6X A;  2HND B;  4NXM F;  1EJ7 L;  2CJX B;  3K59 A;  3AOA A;  4RW7 A;  5A8R B;  1FRX A;  2MTL A;  3QJJ A;  1C4A A;  1FRK A;  4YB1 P;  1FVS A;  4TYA A;  5EWG A;  3IM9 A;  5CCL A;  3D4J A;  3UD5 A;  1N5V A;  2PMZ D;  1HI1 A;  2ABY A;  2ZJP Q;  2YWW A;  3HFK A;  1Y11 A;  4OHZ A;  1VRQ C;  3KK2 A;  1S1V A;  4G1Q A;  2XNQ A;  2UXC J;  4TY8 A;  2FLN A;  1FJ7 A;  3Q8P B;  2KXF A;  2EG1 A;  2DR6 A;  1ZA1 B;  3QFH A;  2OHD A;  2KYZ A;  3VAI A;  4FN5 A;  3MCS A;  5KFF A;  4LQ9 A;  2AF6 A;  3AD7 C;  2M5Y A;  1RAG B;  1CJV A;  2DHS A;  3HKZ D;  1XR5 A;  5I42 B;  4PXD A;  3EXY A;  4CNZ A;  1DHM A;  4LF7 F;  2GFF A;  1NKC A;  1DLO B;  4GVB B;  5D0R A;  2FHM A;  3W1Y C;  1TKT A;  2ZFH A;  2I9S A;  3H2U B;  2FJV A;  3R6G B;  1B4S A;  4J9V A;  2V94 A;  1F5A A;  3OHB A;  3EMT A;  2W9C B;  4UY8 5;  4YDD B;  1OJ4 A;  1VBK A;  4DPY A;  2DRB A;  2DIT A;  1YRX A;  4WK3 A;  5CAB A;  2D3O R;  3IO1 A;  3H0P A;  2RU3 A;  3A12 A;  4LSL B;  4ED2 A;  4ECS A;  5BJR A;  1OY6 A;  1TL3 B;  4B3M F;  1KON A;  2QMX A;  4C8N A;  1HNV B;  4NX9 A;  2C28 A;  3MEG B;  2WRM A;  4NXN F;  5LXY A;  2OO4 A;  1SUQ A;  5B0E A;  1NHU A;  2BJ8 A;  3KDO A;  2MZR A;  2WTF A;  2DR8 A;  2BRK A;  3VZI A;  3MR2 A;  1BY9 A;  3KK3 B;  2BJ3 A;  1S72 S;  1RT4 B;  2UUW A;  2BJ1 A;  3ADA C;  3UN3 A;  5EWF A;  2OPS B;  2U1A A;  1LV5 A;  4HKQ A;  2C2D A;  2QRR A;  3HHD A;  4C3M A;  2VON A;  4WP8 A;  2ZC3 A;  3IFE A;  4I4B A;  4ZVQ B;  1JLQ A;  3TAN A;  3KLG B;  3HT0 A;  3C14 A;  4B9L A;  2IVM A;  1RWX B;  5FDL A;  2ZD1 B;  5B08 A;  4F3M A;  4KQZ A;  4TLR A;  2G0J A;  3V6D B;  1QE1 B;  1FFS B;  1WSR A;  2OUG A;  1JLG B;  2ZH9 A;  5D4L A;  2CAJ A;  1OPI A;  4Q2L A;  5D0E A;  3GR0 A;  3R5A A;  3HVW A;  1VLY A;  3D5M A;  4JI1 J;  2GIQ A;  4CLP A;  4OHY A;  4YN3 B;  1QY7 A;  1LWF A;  2GC8 A;  3MPU B;  1FDA A;  2WHO A;  1U6F A;  2VPW B;  4WYW A;  4DV3 F;  1YDL A;  1Y3K A;  5H1S V;  4YFU A;  2WBR A;  3MM9 A;  3D0G E;  5D0G A;  4DN0 A;  5K20 B;  1LWE B;  3WDO A;  3A3P B;  1L3T A;  3M2V A;  1WHV A;  4ZP6 A;  1JXE A;  4KAI A;  1NK0 A;  2K8G A;  3TZX A;  1RAA B;  2G4B A;  2J8A A;  2YPY A;  3CJ4 A;  5KFR A;  4WTO B;  2R7S A;  3BBC A;  4ZHR A;  2LEP A;  3FCW A;  4E8U A;  4ZVT B;  1WEZ A;  3T6B A;  1T9Y A;  5M2U A;  4QW8 A;  3OTD A;  2AT1 B;  4N5S A;  2DNL A;  1BLU A;  2DHH A;  2X3D A;  1HHT P;  1IN0 A;  1YBA A;  1IKY A;  4FYV B;  1SJR A;  1IJF B;  3BR9 A;  3OD2 A;  4ZLP A;  2VG7 A;  3KHG A;  2Y9H A;  3DGV A;  1ZZF A;  4DQS A;  5HAO A;  2IMW P;  3N0V A;  2Q43 A;  5CYM A;  2JLG A;  1ZAW A;  3FRZ A;  4Q8F A;  5KFL A;  3NEK A;  3ISN D;  2YQ1 A;  2Z2Y B;  2D41 A;  1JLA A;  3ET6 A;  1MWQ A;  1X5P A;  5E3A A;  3HMJ G;  3D54 A;  3IBF B;  1JLC A;  2JOQ A;  1NUE A;  4CZC A;  2R42 A;  3IP0 A;  2MY7 A;  4OX9 F;  5F8J A;  2LEB A;  1JLF A;  2E1P A;  2Y1J A;  1YI2 S;  2BAN A;  2DGT A;  1N34 F;  5D6G A;  3FBC A;  2BEF A;  1UFW A;  3ZC4 A;  1UJ6 A;  3DOL B;  2C22 A;  4LQ3 A;  3UCU P;  4A8X A;  5KT5 A;  4YEA A;  3CJK A;  2QL5 B;  4ZLL A;  2M2B A;  3WBZ A;  2XCP A;  4KFB B;  2PSZ A;  2RRA A;  3V6J A;  3JS9 A;  1X5S A;  2VFV A;  4A8Y A;  5H9E K;  1WHX A;  4WP3 A;  1N5S A;  3LPY A;  5IQ6 A;  2I8E A;  3K7R A;  2W9A A;  1C1B A;  3SDE A;  4Y0F A;  1MMD A;  1TMJ A;  4ECY A;  4EU0 A;  1FFG B;  4ZPT R;  2J8S A;  3PHE A;  4LT6 A;  1GK8 A;  3PIO Q;  3J7Y U;  2MQN A;  4O3Q A;  5DDO C;  2PA3 A;  3TWZ A;  2D9O A;  5IWA J;  5KAK A;  4WII A;  4NE9 C;  3EJM A;  5IT0 A;  5AJ3 F;  3LP2 B;  3CCW A;  4OX6 A;  1LFW A;  2HBY B;  1YLX A;  5GAE I;  2WCX A;  4I6Y A;  4QIG A;  2QLX A;  5C5J A;  3QRQ A;  2LA4 A;  2UUB J;  1C4C A;  2AP6 A;  1NSK L;  3I0S B;  5HMZ A;  2J76 E;  4DSI A;  3DU6 A;  4F0M A;  2J9E A;  4ZCK A;  2BOP A;  1DRZ A;  4ES1 A;  1U8W A;  4ECZ A;  2J7K A;  1MN7 A;  4DLG A;  1S79 A;  2Y3Y A;  3GFX A;  3NGU A;  3DKD A;  2Z0G A;  3AOC A;  4HVZ A;  4UOF A;  3DU5 A;  3PFE A;  4RJV A;  1L5U A;  4FXV A;  3IWL A;  4B17 A;  5K5M A;  1F2H A;  3RGI A;  1YX2 A;  4EYI B;  2NZC A;  3FSI A;  3TQ1 A;  3PYD A;  1S1T A;  4O0N A;  4Q43 A;  2HS0 A;  3AH6 A;  4K50 A;  2CA9 A;  3G2X A;  2D3O 1;  5KFM A;  3SQO P;  1HWL A;  1YK9 A;  4OL8 A;  5DG8 A;  3MGJ A;  3G9C A;  3KWM A;  3UE2 A;  2LXF A;  1PJ5 A;  3DRR A;  5KFB A;  4CYU B;  2O67 A;  4Y00 A;  4KGK A;  3I56 S;  5FLX Y;  4DR7 F;  4AXI A;  1RTJ A;  1S9G A;  2PGC A;  1WG1 A;  1S6U A;  4QPX A;  2BMB A;  4J9N A;  4ZMM A;  4LIR A;  1P8G A;  3FJ2 A;  3MUV P;  3KDN A;  4Z7Y A;  4DSF A;  3CCR S;  4X2B A;  2HQI A;  1XMO F;  2MZJ A;  3W2V A;  5KG4 A;  3GG1 A;  1AFJ A;  1Q53 A;  3B54 A;  5MLC V;  2PI5 A;  2WSF C;  1GEH A;  4QIF A;  1NZA A;  2MQM A;  4NLP A;  1S99 A;  3NAH A;  3UI3 A;  2HHH F;  4HEA 9;  2DO4 A;  1XEZ A;  1XNQ F;  8RUC A;  4OI6 A;  4F3O A;  3HXM A;  4X4Q A;  2ZHO A;  4RW7 B;  1U1N A;  3GYN A;  1N5Q A;  1P6T A;  2I2Y A;  3CO9 A;  3GCW P;  3KG1 A;  5I4M A;  5A2Q Y;  1LFP A;  1XER A;  1ICE B;  3UW1 A;  3GWC A;  3HPO A;  5CZX A;  1CLF A;  3HVR A;  2FC8 A;  3V81 A;  2J7W A;  2KT3 A;  1U1L A;  2BAC A;  1U09 A;  4ZOS A;  3KK2 B;  1S1V B;  4G1Q B;  4U95 A;  1YJ9 S;  2UZA A;  4AE5 A;  3AQO A;  4TY8 B;  2V4R A;  2CQ3 A;  1UKU A;  4A8Q A;  4NLX A;  4L76 A;  3FEX B;  2D3U A;  2BQU A;  3UNG C;  1X4H A;  3IXQ A;  3Q22 A;  1CJV B;  2R2R A;  1T9V A;  1MG7 A;  4ZVF A;  3H2V E;  1VQ5 S;  3A3O B;  3S6E A;  4B9V A;  5SZT A;  2OIH A;  3I96 A;  1Q8L A;  2KRR A;  4J9K A;  4OFZ A;  4O0I A;  1TKT B;  3QT6 A;  2NXJ A;  3VAH A;  2X1B A;  3CJ5 A;  1YKW A;  2KH9 A;  3GII A;  2FUG 9;  2VD3 A;  5KT6 A;  3R5G A;  3RW7 A;  1Q95 G;  1RWP B;  1HNZ J;  4ZCI A;  4WFY A;  1N5T A;  1M90 T;  3ZNU A;  2UVW A;  3RW6 A;  1N36 F;  4MK9 A;  1T9X A;  2MQO A;  3V2U C;  2VBX A;  1H38 A;  1R8A A;  3UPF A;  2DHX A;  2WAQ D;  3UN2 A;  3D9B A;  4CP5 A;  1AUD A;  3HJF A;  5GAG I;  1SUQ B;  3IMQ J;  1NH8 A;  3K2Y A;  2J9D A;  1LWC A;  1SB6 A;  1U45 A;  3R6L B;  4TU8 A;  3FBE A;  2IA6 A;  2MYF A;  2HW3 A;  1Y9O A;  4FBU A;  2DGQ A;  3HP6 A;  3KHR A;  1I51 B;  1JLQ B;  4MFB B;  2AYG A;  4LVO P;  3C14 B;  3ZXW A;  5FDL B;  4F4X A;  3KTQ A;  2VPZ B;  4HI2 A;  2FHJ A;  3AJD A;  2FY1 A;  2CQC A;  3VAJ A;  3EVW A;  1SV5 A;  1DY3 A;  2H9Z A;  5L1J A;  1L3V A;  1PG5 B;  4Z37 A;  2CQH A;  1RAC B;  4F0H A;  2HGN A;  4DSL A;  2B43 A;  3P5T L;  5E7O B;  2H65 B;  2HBQ B;  2W2O P;  1LWF B;  2CPX A;  5DJB A;  2OPQ A;  4JI5 F;  2FVQ A;  1RTI A;  3MAH A;  1X7V A;  3G86 A;  3B6B A;  2YKM A;  3LUY A;  3LGH A;  2JEI A;  3MM8 A;  4DR1 F;  2CYY A;  3TOQ A;  1WG4 A;  3MM9 B;  4ID5 A;  1S57 A;  3MPY A;  2QLJ B;  3ULH A;  2EFP A;  2C3O A;  2DB1 A;  1VJW A;  3VWS A;  4Q5V A;  1FVQ A;  1ZPW X;  5JUM A;  2O3D A;  3P4U B;  4LSZ B;  4LF6 F;  2H51 B;  2J9D E;  1RAB B;  3WX4 A;  5T41 A;  2Q6C A;  2IMO A;  1G1X A;  2AEJ A;  4ZHR B;  2CPH A;  2XMV A;  1JJ4 A;  4M5G A;  2NCK L;  1JLE A;  2BE9 B;  1TZ0 A;  1GMU A;  3BR8 A;  4OYX A;  3GJT B;  5D78 A;  3K8W A;  1TFY A;  2LXI A;  4CLF A;  2W9B A;  4NZ6 A;  2IYI A;  2HBR B;  1IKY B;  1G6B A;  4QW9 A;  3OR2 A;  1HIY A;  2P9E A;  4EK2 A;  1WC5 A;  2CJY B;  2VG7 B;  3HK2 A;  1Q8K A;  3OLA A;  4PQU B;  4FF4 A;  3FC9 A;  2KVI A;  3HJV A;  3NNH A;  4CM0 A;  4X4N A;  5CYM B;  1P1L A;  3ZZR A;  2BZ2 A;  3G71 S;  1NDL A;  2CJB A;  2OEL A;  1RE1 B;  1V3S A;  3TW0 A;  4P9S A;  4LR9 A;  3FBF A;  1JLA B;  3ET6 B;  3RR7 A;  3EDQ B;  1UA1 A;  3QZ7 A;  3IS9 A;  1DAR A;  4LRD A;  1JLC B;  3I6P A;  3HF5 A;  1U47 A;  3BGR A;  4C9D A;  2ZH6 A;  4DR3 J;  1DBD A;  2GML A;  4ZIW A;  1JLF B;  4WZM A;  3TP2 A;  2BAN B;  3DC2 A;  4ZN3 A;  2YNG A;  4G1I A;  3LA0 A;  4NLY A;  2UUT A;  2K2P A;  2KXN B;  2FZC B;  2W2M P;  1VBZ A;  2DH7 A;  4NI2 A;  2VFR A;  2KFY A;  4CLS A;  3CJK B;  5GAD U;  4A48 A;  1T8E A;  1FDN A;  1MN9 A;  4PWU A;  1K9M T;  1NND A;  1S1U A;  3QLH A;  2HIQ A;  1NME B;  5K8M A;  4OHV A;  1C1B B;  3SDE B;  2ZBR A;  2DEJ A;  1BUX A;  1XR6 A;  3ENV A;  1IVZ A;  2EG2 A;  2VG6 A;  4K4Y A;  3QYY A;  4NML A;  4JI8 J;  2IBO A;  1YVF A;  2JNJ A;  3CNQ P;  2GAH C;  4RW9 A;  3PR5 B;  3H20 A;  3U1L A;  2DXE A;  1SH0 A;  3KLI A;  2A6O A;  2V2K A;  1QM9 A;  2AIR B;  1FRM A;  2N7Y A;  4QCL A;  4FPR A;  4OIX A;  4YHH J;  2R8K A;  2X3G A;  2B3T B;  3R7S B;  4RL1 A;  1EET A;  4LF4 F;  4M94 A;  3B4D A;  2OPR A;  3IA0 A;  2DCU B;  2VIH A;  1OS5 A;  3NBP A;  1Q16 B;  1KHV A;  5F3Z A;  4X84 A;  3LWL A;  1Q82 T;  1AB8 A;  2V8V A;  3VGU A;  2W7A A;  4JI0 J;  3TJ9 A;  2DHA A;  2ROP A;  2FLL A;  2CNN B;  3KLH A;  2IY5 B;  2HFZ A;  2VJU A;  2QG9 B;  1UP1 A;  3EZO A;  4Y2K A;  1ZAX A;  5FD1 A;  3SQG A;  1T3N A;  3M6V A;  3NS5 A;  3WIU A;  3KJV A;  3FMB A;  4X66 J;  1RGV A;  2OEM A;  3GFZ A;  2CVE A;  1LWX A;  1S1T B;  2YNF A;  1JWW A;  1HR0 F;  2VC1 A;  1VYA A;  3A3N B;  2V9K A;  1T0T V;  4DL6 A;  4DWI A;  1RWM B;  1EZZ B;  3CCS S;  2QV6 A;  1N56 A;  3DRR B;  1REV A;  3JSM A;  2FLO A;  2F3J A;  5IQQ A;  4J9R A;  4U8Y A;  1WAC A;  1RTJ B;  1S9G B;  3MMB A;  3N5F A;  3PCO B;  4CDI A;  3GYX B;  3Q24 A;  4K4W A;  2VA3 A;  3MMA A;  2P8I A;  4DR6 F;  1FTC A;  5LM7 E;  2ZE2 A;  2B7C B;  1RZM A;  5A0Y A;  2JLF A;  4ERD A;  3T3F A;  3W2V B;  4DL2 A;  1JIH A;  2KG0 A;  3K57 A;  3CMA S;  2XLJ A;  4NLD A;  1NHK L;  3VZH A;  2ALZ A;  2MPU A;  2Z2Z A;  2ASL A;  4C8O A;  3PM9 A;  4OMF G;  3BQ2 A;  2UVV A;  2J6T A;  3N9U C;  4Y2A A;  4QBU A;  5DDP C;  1HWI A;  2V2Z A;  1K0V A;  3V81 B;  1U02 A;  2OEK A;  4PXE A;  1YIT S;  2XI2 A;  2VKR A;  1TL5 A;  2AJQ A;  4HL9 A;  3G6X A;  2XSF A;  3MPD A;  4ATN A;  4WFA Q;  5E2Q A;  3CVK A;  2CQ2 A;  4WP9 A;  1L3U A;  4IH7 A;  1PC4 A;  1SQE A;  2E7X A;  4RZR A;  9ATC B;  5FII A;  1SKU B;  1M0S A;  1RU2 A;  4UQG A;  4KV8 A;  3EE3 A;  2BUN A;  1TK5 A;  4IUF A;  2DRA A;  3TZZ A;  3QT7 A;  1JLB A;  3MUR P;  4WKR A;  4OV1 A;  3I32 A;  1S7H A;  1QVG R;  4NA3 A;  1XMB A;  3MXH P;  2V9W A;  3IG1 A;  2NPI A;  4J5O A;  3U02 A;  3EDR B;  5HVH A;  1KHW A;  3BPD A;  1IJE B;  1U2R A;  6FD1 A;  1LKZ A;  1IQT A;  4ED0 A;  2J0Q D;  3I0R A;  1HBU A;  3DLE A;  4IFY A;  5GMD A;  1HKA A;  1VQN S;  5K14 A;  2YWF A;  1URR A;  2AYM A;  4DS5 A;  3TA0 A;  4GMK A;  3SFU A;  5BYQ A;  3A1Y G;  4B3T F;  4C8L A;  4A4J A;  1IBM J;  2KB2 A;  2HG4 A;  2B8P A;  2VFS A;  1ZAV A;  1Z1Z A;  3P3D A;  5HMX A;  2L9D A;  4DHV A;  2OTL S;  1S10 A;  2GJ2 A;  1OQ6 A;  1T9U A;  3HLU A;  1XQI A;  3EX7 B;  4DUZ F;  4JYA J;  4ED5 A;  3EGW B;  4ETZ A;  2J7U A;  3EZ5 A;  1LWC B;  2OAU A;  1YHQ S;  1U1O A;  1TFW A;  1IR0 A;  3A8J A;  4TQS A;  3VAG A;  3Q86 A;  3D68 A;  1WEL A;  2KJV A;  4XTT A;  4ZVE A;  3PO5 A;  4GKK F;  3RYL A;  1JK9 B;  3ETM A;  3CJQ A;  3RRK A;  1ZM4 A;  5B0A A;  1O0P A;  3ONQ A;  2NYI A;  2D74 B;  4C3L A;  1J2V A;  2IVY A;  1FJG F;  1SV5 B;  1GX6 A;  2R2T A;  1S5Z A;  4DMZ A;  2BVZ A;  2BA9 A;  3P96 A;  3T41 A;  2PE8 A;  2XZD B;  5BYS A;  2V67 A;  3QBC A;  1RTH A;  3M30 A;  4H4O A;  3FCH A;  2HLU A;  3L9Z A;  1CS4 A;  4ITS A;  4IKA A;  2OPQ B;  4C8Y A;  3D3B J;  5IC6 B;  3MPV A;  2HGM A;  2ZVS A;  1P9Q C;  1RTI B;  1T7P A;  5DDR C;  3MWB A;  3V4I A;  2YKM B;  2GCF A;  4QR1 A;  5IM0 A;  2DNY A;  2BE7 D;  4NLR A;  3MM8 B;  1FO1 A;  2AWZ A;  4MTP A;  4M95 A;  1T3O A;  4LFB F;  1L3K A;  3OVA A;  3QJP A;  5L1K A;  1SKW A;  2MJU A;  3UR0 A;  3BEG B;  4QOT A;  3MFI A;  4L73 A;  2AMC B;  3QGP A;  5HK4 A;  3L09 A;  1RSC A;  5CHC B;  2XO7 A;  2RF2 A;  5DM6 Q;  1FKP A;  4DS4 A;  2JRS A;  3TJ8 A;  4RNO A;  4OYA A;  3R5J B;  4DR2 J;  3LPE A;  1JLE B;  4ZPW R;  1AFI A;  4LBH A;  4OJG A;  2RD5 C;  1ARO P;  1N32 F;  4WBF A;  2YKA A;  2W9B B;  4LF5 J;  2D3Z A;  3OR2 B;  3PW7 A;  1S49 A;  5SUH A;  4F4A A;  1UL3 A;  1SC4 B;  3I4H X;  2UU9 J;  1PSD A;  2NXC A;  4DV6 J;  1H73 A;  2JVR A;  2ZZN A;  4IO1 A;  4PQA A;  1B7Y B;  4YR2 A;  3NGR A;  3AT1 B;  1ZZN A;  1WKL A;  4WFZ A;  1NDK A;  3IS9 B;  1IR1 A;  2J6S A;  5GME A;  2B9Y A;  3G82 A;  1HMV A;  3OR1 B;  1SJ1 A;  3QJL A;  1VS3 A;  3BGR B;  4ZJQ A;  5KT4 A;  4WCE Q;  1X31 C;  4ZPA A;  3N01 A;  3JTO A;  3PYF A;  1XMQ J;  4K4V A;  1H72 C;  1BWV A;  3CCZ A;  2YNG B;  2ALY B;  4KHP J;  5F41 A;  4PYD A;  2MKK A;  3U27 A;  1S12 A;  4WPA A;  3CED A;  1UWB A;  2DGO A;  4RO0 A;  4ES3 A;  4NI2 B;  4DUY J;  5A76 A;  4YS2 A;  2H54 B;  3T9Z A;  3QAU A;  2H4Y B;  1I1G A;  3OTO F;  1OSD A;  1TR0 A;  3LH2 S;  3AB4 B;  4LF8 F;  4WF9 Q;  3SCI E;  3J81 Y;  4DSE A;  5HLF A;  3CCM S;  1S1U B;  3QLH B;  1T02 A;  5AXL A;  3W66 A;  2EBG A;  5EX3 A;  2B9X A;  2HZV A;  1O5J A;  2VG6 B;  1PIE A;  3CUN A;  1WDD A;  2HMI A;  1P27 B;  2KO1 A;  1YG0 A;  3Q0A A;  2F8H A;  4WFN Q;  2VL1 A;  1TL7 B;  1R8B A;  4NRU A;  2JL9 A;  4P52 A;  3KUE A;  2IM3 A;  4RW9 B;  1FX4 A;  1GFW B;  2XMT A;  2EFQ A;  4HDH A;  3JSR A;  3NWR A;  1AXQ A;  1LOU A;  3E51 A;  1RA6 A;  5KFI A;  3M1V A;  3KLI B;  5BYR A;  1X0P A;  5HN0 A;  1BHN A;  2KZM A;  3DMJ A;  3R2C J;  2E1M C;  4DQI A;  5C7P A;  2PO4 A;  4LFC J;  3TAM B;  2QGF B;  5DS7 A;  4QPT A;  2GJI A;  4IR1 A;  1RAE B;  2CQD A;  3K5O A;  2C1E B;  4ILM A;  2CZ4 A;  5HQ8 A;  3QMQ A;  2OPR B;  4C0H A;  2XQC A;  2CG4 A;  4YY3 J;  1UVJ A;  3NBP B;  4AYB D;  1XC9 A;  2F63 A;  2IPO B;  1UW4 A;  4TKT A;  4WE1 A;  1SJF A;  1V6H A;  3ICL A;  1SVD A;  3F56 A;  3G4S S;  2VQE J;  3HVA A;  4EZ6 A;  1X9W A;  1HD1 A;  1ZM9 A;  2IM0 A;  5H9F K;  3KLH B;  1IBL F;  5ETM A;  2C2K B;  3Q8Y A;  5DM7 Q;  2EC0 A;  3C19 A;  4FPI A;  2DR5 A;  5DGB A;  4DV5 J;  2RDD A;  4L75 A;  3SQG B;  3ZTP A;  5HO4 A;  3KJV B;  3QWU A;  2DR9 A;  2HBZ B;  4RW8 A;  5DG9 A;  1RTZ A;  2V8G A;  3H40 A;  2YNF B;  3H5S A;  5HP1 A;  1WF1 A;  4UF4 A;  4ANC A;  4GO7 X;  1WOO A;  2LA6 A;  1YBU A;  1JJC B;  4ZN1 A;  3UD3 P;  1REV B;  2GIF A;  3JSM B;  3P49 B;  1RCO B;  2AJ4 A;  3R9L A;  3M32 A;  5B0B A;  4IOC Q;  1R0B G;  2MHN A;  2WVE A;  1QAJ A;  2AZ3 A;  2YTC A;  4PKD B;  2DGV A;  3MMB B;  1NDP A;  4R25 A;  1IM6 A;  3V5R A;  3MMA B;  3ENQ A;  2M52 A;  1AT1 B;  3RB4 A;  3CCL S;  2ZE2 B;  4EBC A;  1X60 A;  2JLE A;  5A0Y B;  5H9E J;  3QSY B;  1RT2 A;  1RT6 A;  4CIO A;  2FJA B;  1MWY A;  2LQ5 A;  5LOQ A;  1LW0 A;  1Q4R A;  5F8M A;  4D3H A;  4OZ3 A;  3ITH A;  5EUH A;  4O4R A;  2RH3 A;  1DQA A;  2KT5 A;  3WX8 A;  4X4S A;  2KZZ A;  2RIJ A;  2XCA A;  4IOB A;  2ILZ A;  4TLQ A;  2OFG X;  3PYG A;  4PZV A;  4EEY A;  2B6A A;  2E5G A;  2DY1 A;  4B3O A;  2F8E X;  2W1B A;  1E6V B;  4HI1 A;  5ETL A;  3QGI A;  2CPZ A;  4PWW A;  1T05 A;  3DYA A;  1X8D A;  4QU7 A;  1ELO A;  1Y4Z B;  5THW A;  4YDX A;  2OSQ A;  2DO0 A;  1VQ8 S;  5D15 A;  4ECQ A;  1U6Z A;  2E9T A;  4NRT A;  2E1R A;  2C3Y A;  5FLX U;  3PJW A;  5F8H A;  1OIA A;  4JI1 F;  1VQ9 S;  1UEV A;  3MUM P;  5B7W A;  2XLI A;  3D1Q A;  4KV8 B;  1I6J A;  1RLC L;  4X64 J;  1SKS A;  4KGM A;  2R2U A;  3MOZ A;  1U25 A;  1JLB B;  2XMU A;  1FFW B;  4UZC A;  2Y0B B;  3PJX A;  3FQK A;  2W25 A;  4ILL A;  2UXB J;  1Y5L B;  1EAY C;  2V0N A;  3EM1 A;  4USV A;  3IG1 B;  3L7P A;  1LXN A;  1NSP A;  4UTG A;  3MR6 A;  3BM7 A;  1KFD A;  1CVJ A;  4J90 A;  4DZ6 A;  1ZOT A;  2FHO B;  4CLY A;  5ETS A;  3I0R B;  1HBU B;  1FDB A;  3DLE B;  4IFY B;  2RQC A;  5A2Q U;  2COL A;  4DR5 J;  1HNW F;  5K14 B;  4OQJ A;  4M5H A;  3SEO A;  4U96 A;  8AT1 B;  3S1T A;  1QDU B;  3PX4 A;  3MAA A;  2AHO B;  2QYG A;  1FA0 A;  1O8B A;  1RWU A;  4B08 A;  1WUU A;  5K9F A;  1VBY A;  4OZ1 A;  1RAI B;  4ZVO B;  1R0C B;  4UOG A;  5D3G A;  1U6B A;  2MKC A;  1GAO A;  4LBP A;  2DVI A;  4KJI A;  4V1A k;  4U7C A;  3O44 A;  4QR0 A;  3CCJ S;  2D9P A;  3BSO A;  5J1N A;  5DZ7 A;  2W01 A;  2PMH A;  1NK7 A;  4R0E A;  1N6Q A;  3M6X A;  3M8W A;  3KG4 A;  3IRW P;  1IQZ A;  4DLE A;  1BGX T;  4DPW A;  4K5S A;  5J2N B;  3BQ0 A;  2LQB A;  2G2O A;  5E5N A;  4F04 B;  1RUS A;  2H3E B;  5IXU A;  2N4D A;  2GVZ A;  1GH8 A;  2KTQ A;  4JUZ A;  3DOM A;  2UVR A;  1APS A;  2FVS A;  3GFH A;  2LDI A;  2HZC A;  2VF3 A;  5A8W A;  1RTH B;  4DCJ B;  3M30 B;  4H4O B;  2V2V A;  3JTN A;  3NOC A;  1CS4 B;  4NLV A;  3RU0 A;  1FCA A;  4RX6 A;  2N7C A;  1O51 A;  1FK9 A;  1G4C A;  3V4I B;  2CPJ A;  5IM0 B;  1CJU A;  2AYB A;  1RP5 A;  1FEH A;  3WC2 A;  1BE4 A;  2XWY A;  1SL0 A;  1HI8 A;  4M5K A;  3O1L A;  3Q8S B;  1NJX A;  1ZS6 A;  4DL5 A;  1TL4 A;  3KLF A;  1ULR A;  1LK7 A;  2GS8 A;  4KB7 A;  1RWN B;  2RF2 B;  2HRY A;  1FKP B;  2OPP A;  1KN6 A;  1SH2 A;  2XMW A;  1LEO A;  2NLW A;  1VHF A;  5KG7 A;  2QSF A;  1H6K X;  2WON A;  2KM8 C;  3RBD A;  3DHX A;  4B02 A;  5IWA F;  1RT1 A;  1NSA A;  4H4K C;  4F2S A;  2E7W A;  3BDE A;  2YKQ A;  4RU9 A;  4ZPB A;  2X1A A;  5KFK A;  1FWL A;  1RAJ A;  2AQ4 A;  4DL3 A;  5GAH U;  3NCP A;  2Q66 A;  2PFF B;  3R5D A;  4MMO A;  4ALZ A;  2CFX A;  5DDQ C;  2JX2 A;  1KQK A;  2AGO A;  1YWX A;  5DO2 A;  2V63 A;  3W9H A;  3L4B C;  1PJ7 A;  4K8R A;  2PDA A;  5CYQ A;  3G82 B;  3M8R A;  3SCL E;  1HMV B;  4AL5 A;  2HHT A;  1NK8 A;  1D3W A;  2W4C A;  5F0W A;  3D3C J;  2RU9 A;  1EHW A;  2OKQ A;  2MY8 A;  1TTH B;  2DGS A;  3RAM A;  2BJE A;  2AV5 A;  4IH5 A;  4R0J A;  4OJ3 A;  1ZA2 B;  3RAQ A;  2CZV C;  2VPY B;  3CD5 A;  1VI7 A;  1VC6 A;  2A3J A;  1VK8 A;  1LW2 A;  1PYO B;  1UWB B;  4AT1 B;  3I5A A;  5K8P A;  5D4N A;  1UJ5 A;  5ETR A;  1SBR A;  4OHW A;  4IRK A;  2G0I A;  1TKZ A;  3QRR A;  1B7F A;  4O4G A;  1AZS A;  1D09 B;  2MST A;  3TYT A;  1DQ9 A;  1H7W A;  4P74 A;  1VBX A;  5HLF B;  4DV4 J;  1QAI A;  5I3P A;  4GC6 A;  4ECU A;  4JI3 J;  3BF4 A;  2Q79 A;  4B9S A;  1Q78 A;  2GHP A;  5IT4 A;  5DQH A;  4OZN A;  2LU2 A;  1K1S A;  2JC1 A;  4OYP A;  2VHG A;  2HMI B;  3HHL D;  1R6Y A;  3G6V A;  2FC9 A;  5J1E A;  1SQF A;  5RUB A;  5KFW A;  5LXR A;  2LKZ A;  1S7I A;  5HL7 Q;  4PUO A;  1N0V C;  2ILY A;  4QWA A;  3TZY A;  4CI0 B;  2QA2 A;  4FVC A;  1FRL A;  4QIV A;  5J2P A;  3FBB A;  3IR6 B;  1TEL A;  1S0N A;  2QFI A;  4R8U A;  3M1V B;  2GVD A;  2EKY A;  3DMJ B;  2ZNY A;  1X4C A;  2HFV A;  1SIZ A;  5GAD I;  1NCL A;  1J27 A;  2ZH4 A;  3JQM A;  2UUA J;  5JMN A;  3DXB A;  4HT5 A;  2CDQ A;  2R4F A;  2MDA A;  1D8Z A;  3IWN C;  1VRT A;  5B0D A;  2NSC A;  4FBT A;  3S01 A;  4JI6 J;  3CJ0 A;  4GVL A;  1KC8 T;  5ETO A;  3PW0 A;  4WE1 B;  3MUT P;  3M8Z A;  2VFU A;  5E0O A;  2DXD A;  2FJD B;  1JNR B;  1FNO A;  3CC7 S;  3HZE A;  4DU7 A;  3CO0 P;  3DM2 A;  2UP1 A;  5KTQ A;  3C15 A;  2VZ9 A;  2R7O A;  1MMN A;  2ROE A;  3NRB A;  1V5I B;  4YME A;  3LGM A;  1WD6 A;  4OV6 A;  4ZPV R;  2KG1 A;  1YSJ A;  2LYV A;  2Z2M A;  4RW8 B;  1IWA A;  3ENW A;  5HP1 B;  3PTW A;  4BWM A;  1U2C A;  2J0X A;  1FWP A;  4MKA A;  3F44 A;  5LMN J;  4RR5 A;  4DV7 J;  3DLB A;  4HYK A;  2AKW B;  2CXE A;  4UST A;  3OTC A;  1X5O A;  2QO3 A;  2CQB A;  3PIP Q;  5C24 A;  3MEC A;  1HNZ F;  2ZZM A;  4MYU A;  2GX8 A;  1T94 A;  3CDE A;  1T11 A;  1KQF B;  1UPP A;  3CCU S;  1YRT A;  2CIM A;  3BRE A;  3JSB A;  3TNV A;  3EVO A;  1U0H A;  3Q89 A;  3NLC A;  2RE1 A;  3L7O A;  3ZNJ 1;  1RT6 B;  1WF2 A;  3BYR A;  2CDR B;  5IV3 A;  5CXT A;  1UEK A;  1LW0 B;  2J0S D;  1M5H A;  5DZ6 A;  4NLU A;  4DPO A;  2KHD A;  3ITH B;  1M5S A;  4A8K A;  1S0V A;  4CQ1 A;  3HSD A;  2A2D A;  2YNI A;  4HTI A;  2B6A B;  4L72 B;  4B3O B;  2VBZ A;  1T03 A;  4BHQ A;  1T05 B;  1DUR A;  3MED A;  1YJR A;  3M9M B;  2I5J A;  3W5X A;  4C11 A;  1A9N B;  3QAT A;  3V6H A;  4K7Q A;  4IDK A;  2YX4 A;  1ZM2 A;  3H4D A;  4USK A;  3CXC R;  2OGU A;  3EGN A;  2MQP A;  5CH7 B;  1Q0N A;  3QT5 A;  3QSI A;  2ZOM A;  3M2R B;  3UCG A;  3NCQ A;  1OY8 A;  2EFV A;  2DK2 A;  2C3M A;  3SYZ A;  2JFK A;  1NPK A;  2HZA A;  4K2J A;  1KTV A;  4LUB A;  3L95 X;  4O44 A;  3PNI A;  3CJ2 A;  2ZM6 J;  2C3U A;  1UA0 A;  1RU1 A;  1BQX A;  1NK6 A;  4FNI A;  3GTY X;  4K0K J;  1REG X;  4WFB Q;  2BDP A;  4FZV A;  1JXV A;  5HRO A;  3TUP A;  1X4B A;  2BYC A;  1W2I A;  2XTJ P;  2EEY A;  1QSS A;  3FRY A;  1UMJ A;  1YJT A;  2E5L J;  5CAA A;  2KU7 A;  4AUK A;  3R7N B;  1R8C A;  3IAS 9;  4DX6 A;  3MAA B;  4BWJ A;  4N56 A;  1SQG A;  4O3S A;  4EI2 A;  1TUV A;  3BKF A;  1CSJ A;  5EGY A;  5KFH A;  1RCX B;  4X65 J;  4AL6 A;  4F8R A;  2GIR A;  2OMO A;  5D3G B;  2A1B A;  4ZP9 A;  3LP1 A;  2GA7 A;  1WC1 A;  1I94 J;  2G2Z A;  4L74 A;  3V6K A;  1QLN A;  4YB7 A;  2DNQ A;  2VV5 A;  2BR0 A;  2JJ4 D;  1WKJ A;  1S0O A;  4FP9 A;  3DLJ A;  2DIS A;  1DTQ A;  4DQP A;  2F7V A;  4DR3 F;  4OI0 A;  2AX1 A;  2L3M A;  2YX1 A;  5KFP A;  2RS8 A;  3K8V A;  3W3S A;  2GVZ B;  9RUB A;  2CJA A;  5LJ5 Y;  3GYG A;  3DOM B;  4LVN P;  3HHK A;  2FJE B;  1F5B A;  2QA4 G;  3K89 A;  1N4L A;  5A8W B;  1P9Y A;  3VGT A;  4PPZ A;  4N8O A;  2XLK A;  3A8I A;  2FZK B;  1WI6 A;  2K7J A;  4CH1 A;  4ECV A;  1NHV A;  1W26 A;  4WKY A;  1FK9 B;  3MTJ A;  3O8W A;  1RWV B;  2ZJQ Q;  3H5Y A;  3VAL A;  1Q79 A;  3W61 A;  3S8S A;  1CJU B;  3P5B P;  4E0D A;  3MR3 A;  3UNY A;  4IG0 A;  3TUJ C;  3THP A;  4UOC A;  3A13 A;  4UW2 A;  4Y2I A;  3P45 B;  3W62 A;  4K4U A;  3DOK A;  2M3D A;  3ZZY A;  1EQ0 A;  1GXL A;  4F0K A;  1EP4 A;  1DJ0 A;  3KLF B;  2CPF A;  3R5B A;  5LMU J;  1VQK S;  1HQE A;  2VAS A;  1S6Q A;  2CJQ A;  2OPP B;  4NLS A;  4P7T A;  1X4A A;  2HQF A;  2MKS A;  2ASD A;  5MAO A;  3M4X A;  4IO9 Q;  1NPP A;  1YJN S;  1UTA A;  5CZV A;  4HH1 A;  4YR0 A;  3LP0 A;  1IBK J;  4WZQ A;  4Y28 C;  3CIM A;  2WON B;  3DRS A;  3NG8 A;  4JI8 F;  1UVN A;  2NXN A;  5DLF A;  1AA1 B; 
#chains in the Genus database with same CATH homology
 4K8R A;  2QTW A;  3CNQ P;  4NE9 C;  2W2Q P;  4YN3 B;  3H42 A;  2Z56 B;  2E1P A;  1V5I B;  2W2O P;  2XTJ P;  1R6V A;  2Z58 B;  1SPB P;  3A3N B;  3AFG A;  4OV6 A;  3VV2 B;  2PMW A;  3SQO P;  2ZWO A;  3VHQ A;  2W2N P;  3WIU A;  2W2M P;  3A3O B;  3A3P B;  3WIV A;  4NMX A;  2W2P P;  3QFH A;  3GCW P;  3BGO P;  2Z57 B;  3BPS P;  3CO0 P;  3GCX P;  3P5B P;  2Z30 B;  2Z2Y B;  3T41 A;  4JP8 A;  2Z2Z A;  2ZWP A;  1SCJ B;  3WHI A;  1ITP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...