3H42A

Crystal structure of pcsk9 in complex with fab from ldlr competitive antibody
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title From the Cover: A proprotein convertase subtilisin/kexin type 9 neutralizing antibody reduces serum cholesterol in mice and nonhuman primates.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 92
sequence length 92
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3h42A01
2Z57B 3SQOP 1R6VA 2E1PA 3A3PB 2W2QP 2ZWPA 3T41A 4NMXA 1SPBP 2Z56B 2W2MP 3GCWP 3A3OB 2QTWA 2Z2YB 2ZWOA 3CO0P 4K8RA 2XTJP 3CNQP 3GCXP 3VHQA 2Z58B 2PMWA 3WIUA 3AFGA 3P5BP 1ITPA 4NE9C 3WHIA 3BPSP 4YN3B 2Z30B 1SCJB 2W2NP 2W2OP 3A3NB 3H42A 3WIVA 3VV2B 2Z2ZA 4JP8A 2W2PP 1V5IB 3QFHA 4OV6A 3BGOP
chains in the Genus database with same CATH superfamily
4QWDA 2I6WA 4CYUB 4YB5A 5IWAJ 2R7QA 4EO8A 1IR2A 1N32J 3WX8A 3BB5A 1JXLA 2GVZA 3M9NB 2E44A 1HBMA 2RKIB 3BV8A 3EZUA 5K8OA 2YNIA 3TZYA 4G6VB 5CYQA 1IBKF 5EUHA 1AFJA 1VK3A 1M5VC 1HNIA 3UDCA 2B4PA 1RTJB 2RB7A 4JI8J 2R7TA 4DSFA 1YBTA 1U6BA 3ZXWA 3THVA 2YQ0A 1TL7A 2CXEA 2CNNB 2DGWA 1GMVA 3QIDA 3HSJA 2JEJA 3HD2A 1CQMA 1A0OB 1UW9A 5CD4H 1V6HA 3KLEB 2KYZA 4M5DA 1S1UA 4ED4A 4QYRA 4F0KA 1LK7A 3R5CA 2FY8A 1X8DA 3VV2B 4ED5A 4UQGA 2NS1B 2DIVA 2IJRA 5KFKA 2VHGA 1Q4RA 2OO4A 3BDPA 1CJTA 2DXEA 4DL0C 3H59A 3ZZYA 4USTA 2H5JB 4ZLJA 2MQNA 4LBIA 3KLIA 2CQCA 2BV3A 4DL4A 4NZ6A 3IXQA 2WOMB 1GFWB 5E5NA 3QIPB 2DHXA 3QT8A 5AXMA 4U7CA 2CPIA 2YWWA 5D4NA 1IWGA 5E0OA 3M1VA 3GCWP 2ZHAA 2XG8A 3LQVA 4DF8A 5B0AA 3QATA 1S49A 1W2IA 3LGMA 4LSLA 1DTQA 1VQ8S 4RUCA 4MKBA 4GVLA 2HFNA 2C42A 4A8FA 2RF2A 1KVIA 3DLEB 4Y28C 1RABB 2BJ7A 2DH9A 4A8OA 1TKZB 2AYBA 2WCXA 3O6QA 1HL6A 1IBMJ 1ZS6A 1XIQA 3OXLA 3PJWA 5HMXA 3MAAA 1TV6B 4C7QA 3DNCA 2LXIA 2OFHX 3FJ2A 3A3PB 2J7WA 2EC0A 3A1YG 2J6TA 4LVOP 1KFDA 4O3PA 3CGIA 2NZ4A 2ZDPA 1CVJA 2GCFA 4RUHA 5IZHA 3IS9B 4UZBA 4DSJA 5H1SV 3DRRB 1REGX 2M8HA 4MTPA 3WDOA 2ZH2A 1MLAA 2EFOA 5IQ6A 4I2QA 1F9EB 2IC3B 2CQHA 2YNHA 4DX5A 1DARA 3J81U 4USHA 2ZOFA 2KT5A 7FD1A 1NH7A 1RAFB 2FVRA 1SXLA 3TR5A 3QZ8A 3C46A 2MZ1A 3LO3A 3RBZA 3V81A 4PXCA 1WG1A 5M2RA 1KFSA 4FBUA 1NXIA 2BACA 3UD5A 1V3ZA 3B8HA 2HW3A 3OTBA 2B9XA 5K9FA 4CLTA 2K1RA 4JI6F 5AE3A 1A9NB 1TKTB 1JLEB 3MOZA 3SDEB 3OVBA 3OL7A 2BW7A 5B7WA 3PCOB 3CCLS 4RBUA 2MLYA 1HA1A 4OI6A 3HO1A 1WC5A 5A6WA 1U1OA 1VBYA 1XMBA 4M63A 2IIHA 4B9TA 4J9MA 1GXLA 4ID5B 1PJ5A 3G86A 4FP9A 3H5SA 1RGVA 1SJRA 1S59A 5E3AA 4QW9A 1YK9A 3D6TB 4DR2J 4X4RA 3JAMU 4X4SA 1PO6A 3MMAB 2B51A 2HFVA 3RAXA 1X4BA 4X4PA 2LEAA 2DBBA 2VA3A 3BO2A 3NGSA 1VRTB 2YWEA 4PXBA 2QRRA 5L38A 5B0BA 3GG1A 3OUYB 3K8VA 4AD6A 2FUG9 2CQIA 3KUEA 2V5HG 1TAQA 1UFKA 2ZWPA 3G8QA 2HRYA 1H73A 1F9FA 2CPEA 2GHWA 5KG4A 1M1GA 2VC1A 1IKXB 4ILRA 3KWMA 2RT3A 1RHUB 2XQCA 1Q8KA 3B54A 1HQUA 1WC0A 2EKNA 4OYPA 2IA0A 1TL3B 3IR5B 3SYZA 1QSLA 3AB4B 2DGXA 4PG6A 4Q8EA 1BWVA 2QV6A 4P75A 6FDRA 3PRDA 5EX3A 1XMQF 3W61A 3L09A 5ETRA 4CDIA 2D74B 1QE1B 5KFIA 1F9HA 3R9LA 2V4RA 4YB1P 4LSNB 2M7SA 3IM9A 4RW8B 1V3RA 4DUTA 4OI4A 4ZPWR 3KHGA 4X65F 4LREA 4HVZA 3D6MB 2C1EB 4F4AA 4NA1A 3UO0A 4CNYA 4IG3B 1H2TZ 5A8KA 3MM9A 4NLRA 1FXRA 3P45B 4LR7A 4PPZA 4OI0A 1AA1B 1E6YB 4J9SA 3GR0A 3QFHA 5I42A 2UUTA 4FF4A 3AD8C 2ZJRQ 1WC3A 4QIWD 2IDEA 1WTBA 4X62F 2HS3A 2FJBB 5J2PA 4R0EA 3ZTOA 2KVQE 4H4KA 1ZBTA 1WD6A 2JC0A 2FHJA 3I5CA 1S0NA 1QJHA 2RU3A 3MEEA 4MMOA 2CA9A 3FNNA 1TKTA 3Q83A 4LF7F 3GFXA 3GJTB 3AA8A 4Q45A 1FWPA 2V8DA 4CM0A 1LKZA 2VG7B 2LU1A 3L95X 1RTHB 1YRTA 3PACA 4KSEB 1MG7A 4JB8B 4X4VA 4G1QA 1T9YA 3PEJA 2DK2A 1RTDB 3IRXA 2VPWB 1LQ9A 2AV5A 2HHTA 3H7HB 3EGNA 4QYZK 4C3LA 2QZ8A 4JI4F 2E5LF 4NRTA 4FKXA 1Q0NA 4OYBA 4FXDA 1X0FA 5F8NA 4RPFA 4EO6A 1RWXB 2HQ3A 2BQUA 2QLXA 1ZM9A 1XERA 2QL5B 1S1XA 3CCSS 2DNLA 4JI1J 3TEHB 4DX7A 3KJNB 4GVBB 2CIMA 4UTGA 1Q86T 3KJVA 3BO4A 3CB4A 2A2DA 2R7VA 1S12A 1WHWA 4YDXA 4KHMA 2BE7D 4OX8A 4PR6A 2HBRB 5H9EJ 5A76A 2PMHA 3VALA 4NL5A 5GMDA 3QO9A 1IR0A 1CJVB 3MR3A 2LFVA 4M94A 3JAMY 3KK2A 1C0UA 1S10A 4N41A 3Q89A 4ELTA 3UI3A 4F0MA 4DR1J 3DCAA 4RNMA 4DWIA 1TVRA 1N52B 4KY3A 1X5SA 2NCKL 5G0RA 3HVAA 3PFOA 1S4FA 2W01A 1VLYA 2BW2A 4NA2A 2H5EA 3QWPA 1TKXB 1RT2A 1L3TA 1LW2B 1KTVA 5IWAF 1N32F 5LSRA 3I56S 2B5JA 2AKWB 4I6WA 4WTOB 2OELA 4C11B 2GQ2A 2O3DA 2AF6A 5E3CA 1QLNA 4JI8F 2H4WB 3UR3C 1WG4A 3K0JA 3KUGA 3RUBL 4LF9J 1X4DA 3D3BJ 4LRFA 3TP2A 1L5UA 3UR0A 3L3CA 3DXSX 1S77D 2KB2A 3A3NB 2WONB 2Z8QA 2D1CA 5KT7A 4QU7A 4ECWA 3NL0A 2P8IA 2ZVSA 2R7WA 5HBMB 5GMEA 2DGTA 3MD3A 1Q7YT 5KOWA 3BPSP 3CJ4A 4C8MA 2WSFC 5KFRA 5SZTA 4AYBD 2NREA 2HNDA 1FKPA 4RW7A 3O1LA 4NXMF 4NYOA 4O3OA 2R8JA 3UVJB 1TMJA 2NZCA 3WC0A 3JYTA 1WF2A 1RWMB 2XGPA 1H7XA 3NOGA 1I94J 4TLQA 1C1CA 3AY0A 5A6PA 1R0AB 4PKDB 4CT8A 2CQGA 3ELHA 1HNWJ 4RNFA 1N48A 4DSIA 3TYTA 5F8HA 1NJXA 5IC6B 3LWLA 4WFBQ 4UUWA 2HZAA 4M5NA 3GQCA 1KQSR 3C14A 2V0NA 2BE9B 3HKWA 3VHQA 1TL1B 4GC6A 4IUFA 3BS9A 4KGVB 3BM7A 5AE2A 4YB7A 1Y3JA 4P2XA 1IBMF 1QY7A 1UVNA 2GNKA 3DDNA 3CULA 3GE9A 4LF5J 4EBDA 4WU3A 1VIXA 4HHJA 2GJFA 2RVJA 4DDFA 3PXGa 2KHDA 1HYSA 2DGOA 1KQKA 5KFHA 4WZMA 1RWPB 2YX7A 4X4NA 2JL9A 4P10A 4ETZA 5CYMB 4XPEA 5C25B 3THPA 5EGYA 1UZHA 5IOLA 3RBDA 3HKZD 3G9CA 2XMVA 4OYIA 3DOMB 5BYRA 2Q43A 1RAOA 1RTZA 3DRXA 2M88A 4O3RA 1TUGB 3O2IA 3LANA 1G6BA 4LBPA 2IRYA 1EHWA 2DGVA 2FB0A 4YS2A 5GAHI 1F5BA 4QWEA 3PYGA 3P5TL 2V8GA 3EE3A 2DEIA 2KO1A 4KBIA 2UVVA 1YQHA 1QVGR 2MSSA 1HQEB 1RT7A 2BANA 4KQZA 4DV2J 2YNGA 1NDKA 1X9WA 1IKVA 4PQUA 1VLOA 5KFBA 1S76D 1QDUB 2V34A 4OX7A 2RU9A 4JI3J 2B56A 2IBOA 2O01C 4DPYA 2CZ9A 2AHOB 3R6LB 5IM0A 4NCGB 2A3JA 3DRSB 5J2MA 4NLYA 3KNAA 4Y65A 1FTRA 4K8RA 4NWBA 1WNEA 4DR2F 5E41A 1RAAB 3LP2B 5F0WA 3V6KA 1BE4A 3UDLA 4A8QA 3CCES 3T5KA 5FDLB 5F3TA 3FFIB 1ZPVA 4WJBA 3SIPB 2RQCA 5AXKA 2E9ZA 2DIUA 4ZIWA 1NM2A 4U96A 4U6PA 1XQIA 4BS2A 2HNZB 1HWKA 3IWLA 2CJXB 2WK4A 2XLIA 3OL6A 1S1WA 5A0YA 2LYVA 3HCXA 3CJKB 4DFPA 1QAIA 1WG5A 1MU2B 3MCSA 2HKEA 3MECA 2YY3A 2NQPA 2GO8A 4X4UA 3H42A 3QGGA 1VC6A 1NPKA 1C1BA 2ROPA 1FRMA 1AUDA 1RAGB 1WSRA 1Y5LB 4V19X 1WKLA 3D0GE 2JVRA 2HWIA 1FDAA 3HT3A 1X4CA 3UNGC 1A6LA 2GMHA 1QSSA 4NI2A 4CO0A 3FSYA 3TZXA 4B17A 4ZP8A 5KFVA 2HG4A 4FS2A 1U1LA 1NK6A 1I6JA 1WOOA 3KFWX 3H4DA 2EC2A 1VC0A 2LQBA 2PMWA 2R8KA 3M30A 5F8GA 3TQ1A 1JJ4A 5C25A 2NXNA 3LP1B 3MCOA 2QMXA 4PPDA 2FLLA 2XY6A 2J6UA 4I6YA 2WW4A 3P5BP 4F3OA 2MZRA 3US5A 1RAJA 2UUAJ 4K4XA 2UXBJ 4QIGA 1RBLA 3TUIC 2QN6B 2APOA 1OMSA 3ENAA 3K5LA 1R6YA 1TTHB 2DISA 3CD7A 1RYSA 3WQPA 2B4VA 1GMUA 4JV5J 4OMFG 2GFFA 5E3QA 2B7BB 3E2EA 2KXHA 2P6TA 2PO4A 3KXDA 3HZGA 3UQSA 2QMUB 4DXLA 3GIMA 4DI6A 4TLRA 2D3ZA 4LRAA 5EWFA 4F4ZA 3D54A 2G2OA 5CZXA 1QTNB 1I1GA 1WSVA 3CDUA 2F9DA 1PCAA 1FHTA 2H5IB 1M0SA 2E7VA 4NCGA 3HSGA 3K89A 3JTNA 4B9SA 1XNRJ 4DCJB 1FVSA 6FD1A 4KPYA 1UA1A 3KUHA 2EK1A 2ADCA 3T1YJ 3FFIA 2QLWA 4QPXA 3M2VA 2ZJQQ 2DNKA 2ZD1A 3NWRA 1IUJA 2F4FA 3QAEA 1VHFA 1ZM4A 1ZTTA 1PIEA 2JOQA 2RDIA 2XO6A 2YWHA 1XNQJ 3IGVA 5KG6A 2KRRA 2YNFB 2HVIA 4JI1F 2ZH6A 4QU6A 1LXNA 1PAUB 1VI7A 5AE1A 1U2CA 2KZZA 4C3KA 5L46A 5JJBA 3M2UA 2DPJA 4C3MA 3HHNB 4GKKJ 1IKWB 2XMUA 4W4MA 3PRBA 1ULRA 1F60B 3M6VA 2Q66A 5D8HB 4DPOA 4ZP6A 2XS2A 1X4FA 2EG1A 3TUJC 1U1RA 1N5YB 1DAXA 3R1LA 1NUEA 3MZIA 2FHKA 4CLFA 2CQBA 1U2FA 4J9VA 4CLZA 4KE5A 2FQQB 5C5JA 2HRUA 2O67A 3EDRB 1VHIA 3PRVA 3C3LA 4I1TA 2KZMA 1HNVA 1FK9B 2FDNA 2IJNA 2B8QA 3WZ0A 4LIRA 2A10A 2KYXA 3MPVA 3R7NB 1SC6A 4DV4J 3P6YC 4KPCA 4O4GA 4AXIA 3U27A 4CO2A 4PG7A 3IG1A 2GGPB 1CJKA 4LF9F 3UD3P 1V9OA 1P27B 3SXLA 4ELVA 3MD1A 3QGIA 1RWWB 5C24A 4IR1A 3RAMA 2MTLA 3CC7S 4OZ5A 1X5TA 4RUAA 1VJWA 4DU8A 4B3TJ 3ZZPA 5AXLA 2ROEA 3MWBA 2OPQA 4BWMA 1FJEB 5GMKa 3GV7B 4C8KA 1OWXA 1NCLA 3OT9A 1H2UX 4A8MP 3D4JA 1KN6A 1NSKL 3BZQA 1DQAA 3V6DB 4LFAF 2G4BA 4ETXA 2MYFA 3N79A 3LH2S 4DFMA 1S79A 1BMQB 2B6AA 4DV0J 2XHWA 4C0HA 3MF5A 3MEGA 3D0IE 1VIOA 2K3IA 4DHVA 1ACMB 1YZ7A 2DNHA 3EYZA 3TJAA 4WK1A 1SH0A 2XSJB 2UVRA 1KTQA 1HNWF 1FKOB 2VOOA 1VQ6S 1U7LA 2Y3YA 4I2PA 2WSEC 1CS4A 3CD0A 3I9ZA 4KV8B 4DCPB 3I32A 2QA4S 5B0GA 4OJHA 3BGOP 1HBOB 1SJ1A 1HHSA 3TA2A 1EETA 1KEKA 3SV4A 3AD9C 3IBFB 3WX4A 5K20B 2CQPA 4FDFA 1Y7PA 7AT1B 1YJ9S 5EN1A 4MT1A 4LF5F 3TW0A 4K4SA 3KHHA 2V8VA 4TQRA 3GCXP 4EWTA 5KFWA 2CADA 1FFWB 5A8WB 1RHMB 4USVA 5B0CA 3C6UB 4JP8A 1SV5B 4DV6J 2YKQA 5EDWA 2FZKB 2NPFA 2K7JA 1NNDA 1YJVA 3TVKA 2M52A 2KXNB 2PIIA 3IBWA 3SCJE 4DV7J 3U1MA 2A2CA 2OEKA 3QT5A 5D78A 3C16B 4YDDB 2IY5B 1XJWB 3RB4A 3KHRA 1IKYA 1S1VB 2Y1IA 4TY8B 2ALZA 2F4VJ 4KJIA 5J1EB 1OSCA 4ED2A 4H4KC 3BYRA 3VAIA 2HHWA 4DQIA 1Q79A 1X60A 3ZTSA 2KTQA 5KG2A 1WI8A 3LGHA 1L3UA 5SUHA 2GGPA 2YBVA 1BC6A 1SJFA 1NK4A 2ZE2B 3ISNC 5IV3A 2W2PP 3IR7B 1UWBA 1GMWD 4R5PB 5HJYA 3G71S 1OO0B 4DV2F 3C15A 3EMTA 2F8MA 4JI3F 4OI2A 2LKZA 4WTYA 4I7FA 2DRAA 4CLKA 1FJ7A 2NPIA 2Y0SD 3V4MA 3PW5A 3RYLA 4ZVOB 1JLGA 3GFYA 3KMQA 3N6LA 1SPBP 2QTWA 2G1DA 5M2UA 1C0TA 3EPIA 3KLFB 5C42A 4WE1B 3MFIA 3SQGA 4MIAA 5CZVA 3Q2SC 3HHEA 5HL7Q 2PFFB 1V5VA 4GC7A 1RLDA 2HQGA 4O3SA 3CPWR 1HHQA 1FNOA 1HWLA 2LA6A 1RHRB 2OPPA 2IMOA 2X3DA 3M8RA 5HJXA 1KWMA 2LMIA 1YX2A 2DNRA 2FJDB 3B6BA 2VC0A 1VC5A 4LFBF 3L9ZA 1RCOB 1DLOB 3J7ZT 1HBUB 5A2QY 3CDBA 4O0IA 3JSMB 5HQMA 1F2HA 4OZ3A 1FWKA 3GJSB 5HAOA 2AGQA 4KV8A 3QZ7A 3M8SA 1VBXA 2OKQA 1PC4A 4WBFA 2HLTA 2MZJA 5KT5A 1KD1T 3GTYX 4IH6A 3J7AN 1NHVA 1FRKA 1GXUA 5DETA 2MPUA 3V2UC 5DM6Q 1UEUA 1P1TA 3I31A 1HBNA 2XTJP 2H1YA 4OIXA 2I2YA 3BBFA 1CBKA 4F26A 5KFPA 1R8HA 1S6OA 4KT0C 1KLMA 3M9MB 1Q53A 2ZOMA 4IO1A 1WJ9A 4UQTA 2LEPA 3FQKA 4NA3A 4ZVFA 4Q7AA 2G0JA 1EP4B 3MGJA 1RHJB 1C2PA 3RTVA 4CT9A 4DQSA 4ES3A 3V6JA 1KS2A 4DPTA 4TY8A 4JYAJ 5J1EA 2YQ3A 3FBEA 2JVOA 2UUAF 2UXBF 2QJ3A 4ZKAA 1WKKA 2XY5A 4EEYA 1NBEB 5HMWA 4I56A 3M32B 2G9OA 4JV5F 2BJ9A 3VAGA 3AQOA 1ZPWX 1SQFA 3NGKA 5GADU 2YKPA 1EZZB 3T19A 3DLKB 3EVOA 1NMEB 2GO9A 3FVYA 4J91A 1RI7A 1RBOB 5J1PA 1M5HA 2GVDB 3F41A 4NLUA 4CI0B 1RU2A 5HLFA 4ED6A 5GAGU 1KLNA 2BE2B 3T1HJ 1XNRF 3EVWA 2OP5A 4CLPA 2VDIA 3CDEA 5KFFA 1VGYA 2RE1A 3SZ2A 1FD8A 5EX0A 3D9BA 4EZ6A 2GJIA 2F65A 1MW7A 1GH8A 4R25A 3T1YF 5IQQA 2UUBJ 3MPWA 4B08A 1U0HA 3VGVA 3I55S 2ZVIA 5HANA 3RGIA 2XZWA 1F6TA 2NLWA 5K5MA 3CC2S 4M1KA 1XNQF 3R6GB 5EWEA 2ASLA 2HYIB 2V8PA 1KBRA 4TYAA 2OH2A 3Q86A 2W2QP 2DCLA 2W9CB 1KOOA 1D1UA 3ILLA 3G87A 1TK5A 3JQJA 1DLOA 2WW8A 2WVBA 5JMNA 2Z2ZA 1D0EA 1SC3B 3HSZA 4GKKF 1LNQA 2OSRA 2BEFA 1CJUA 2RJZA 3PV8A 2XZDB 2WB4A 1BUXA 3GFHA 1JKHB 4OJGA 5BR8J 1O51A 2EWHA 1K1SA 1S9EB 2EEYA 1BLUA 2E66A 1W25A 4KB7A 4XO0A 3D66A 4PWDB 4M8LA 1L3SA 4J9OA 4A8SA 3PW2A 3HHKA 1YJRA 2L41A 4WCEQ 4AL7A 5ETMA 3JQMA 2VZ9A 4M5GA 4OYOA 2B4UA 4MFBB 4DV4F 3DGPA 1SC4B 2F1FA 4DBQA 4GO5X 1B0VA 2W9BA 3H2LA 2QYGA 5BYQA 2SXLA 2MEWA 3GWCA 2AU0A 1B70B 3K2YA 4U67Q 1SUQB 3AOCA 3I5AA 4V19J 2CPYA 3U7JA 3M2RB 2V4JA 5RUBA 3QRPA 4B3TF 3DOKB 2CDQA 2EKYA 3D7SB 4DL3A 3BJYA 4LJMA 4IDKA 2I1RA 4BLGA 4DLGA 3AA9A 3SEOA 2FZCB 4FXWA 4NEYA 2MZTA 2XB2D 1BQXA 1B99A 2LP4A 1SKWA 3I87A 4DV0F 2OPRB 2GVDA 2HSEB 4DR4J 3BN4A 1RT1B 3CO0P 4WXOA 1W26A 3B78A 2OJ3A 3D6HB 3IWXA 2J0XA 4RNNA 1PJ6A 1NDPA 4QWAA 2P5VA 2WVEA 1IM6A 2IVFB 3H2VE 5LMNJ 1B0TA 1TZ0A 1ZTWA 3I0SB 5J2NB 3AJ2A 4I6AA 4K4YA 4OHVA 2N7YA 1HFEL 4WFZA 1DQ8A 4RL1A 1OS5A 3DMJB 2AYMA 5CHCB 2EVZA 4WKRA 3HXMA 4K5SA 2QIFA 2JHEA 1HW9A 4DJBA 1U1QA 2HZVA 2CG8A 3E01B 2W9CA 1FI4A 3OD2A 4N47A 4UZCA 4HYKA 1KNZA 1N6QA 3MMBA 4AXJA 4IYQA 2MGZA 2OPSB 5D15A 1ZETA 1MWQA 3DN9A 3I6PA 3ILJA 4NLWA 4F04B 5EHHA 3EVMA 5KOXA 3DHWC 2DEJA 1TP7A 3CCVS 4DV6F 3KLVA 5KFJA 4AE5A 2HIQA 1XR6A 4IFVB 2W1BA 1DJ0A 1IBCB 3A8EA 4DV7F 3NCRA 3OFFA 1YKWA 2R42A 2B9WA 1WWHA 2IHR1 4OQJA 4WF9Q 3KJFB 1HR0F 3J7YU 2XO7A 2F4VF 4YFUA 3T9ZA 3HVWA 2YVSA 1NDCA 4RO0A 3W2VB 3OBIA 1U49A 4DQRA 1WF1A 2RQ4A 3LPEA 3H0PA 1DTTA 4QYZJ 2CPJA 1JLBB 3DLGB 3M6WA 2V2ZA 2XS5A 1X31C 1YLXA 3BSAA 3R2CJ 1SUQA 5D3GA 2D3O1 3RZAA 2BMBA 4N56A 1OYEA 2FTRA 3HVTB 2K7KA 3CUNA 1BHNA 2FVQA 3K7RA 4C98A 2EFPA 2DY1A 1QSYA 3D0HE 4Y34A 4ZJQA 4C97A 4RWWA 1X5PA 4OL8A 1LWXA 2FHMA 4UOCA 4J9LA 2O66A 1S1TA 2CNLB 2Z2YB 3GYNA 1SL0A 2H3EB 3ZTPA 3M8QA 1RT3A 3C6TB 3DM2A 2E9RX 3R1HA 5KFCA 3LW5C 3NNCA 2UXDJ 4Z7CA 3PYDA 4UUXA 4ZJLA 3BQ2A 2BVZA 2V2QA 4U95A 4ZP9A 1XN9A 1G7CB 3EZ5A 5DM7Q 2ABYA 4OZJA 4ECSA 2HMIB 3MI7X 3MM6A 4ELUA 2VUGA 3BKUA 3HFZB 3L4BC 2COLA 1RYRA 4OHYA 4O0NA 3EWGA 2DHSA 3VQSA 2KJWA 3IAM9 4IQMA 2J9DA 2C28A 3CC4S 2HAFA 4RW9B 3N5FA 3BH7B 4Z2XA 4FYWB 2HS0A 1NZAA 2EFQA 2X51A 4FPIA 3DMJA 2QLJB 2ZH3A 2RHQB 1PYTA 4LF8J 2C2NA 1PBUA 2DGUA 2FC9A 1FJCA 4ECYA 2KL8A 2HWHA 2IBKA 1MSWD 3FEXB 1OQ3A 3MHYA 4Q2MA 2XI2A 2VBWA 3M8ZA 1JLFB 1PG5B 5LSOA 2DR7A 1YHQS 2IA6A 5IT9U 4Q2LA 4P6QA 4C8OA 3AQPA 2PI5A 2PGCA 1S6QA 1VBZA 1M90T 3MR2A 3O44A 2E29A 4X64J 1OQ6A 3CTRA 3R5GA 4C8ZA 1GNKA 4F25A 4YB6A 2ZM6J 1KHWA 2C2DA 4PXDA 4X2BA 2KH9A 3R97A 2M70A 5K14B 3BYPA 3CCUS 1TAUA 2W4DA 4ZPAA 1FF2A 1S6PA 2ZH5A 2BBEA 3OVSA 2DNYA 2F9JA 1HLWA 4JYAF 3UNYA 3D1HA 1DQ9A 2AZ1A 4MK8A 1T03B 4H4OA 4DU7A 5IC4B 1CG2A 4R0JA 3H90A 3BGRB 2V9WA 3LGNA 5IFMA 3QFWA 4ES1A 4PEOA 1HPZB 3IN5A 1JLAB 1U02A 2XMKA 3T9NA 1RT5B 1YVFA 4I64A 2J0QD 3MR7A 4PABA 2MHEA 3IAS9 4NCBA 1RDRA 2HHHJ 4FNIA 2IVMA 4TXSA 4ZPBA 2P9GA 1MMNA 2ZZTA 3D5MA 5BXIA 4ZPVR 1IQTA 2R2SA 1QUPA 3R7BB 2XCAA 3PO4A 2CPXA 3K8WA 2RUSA 3DI6B 3T1HF 1CC7A 2LECA 4A47A 2JSXA 1FCAA 5H9FK 4ZLLA 4F4YA 3J7Z5 1T3NA 1W2BR 2PT0A 5HROA 1Y9OA 4NLXA 3AAWB 1SIZA 5ITHA 1T9WA 2ZUAA 2UUBF 2FJAB 2MZQA 4ZHRA 2HS4A 1JLQA 2OD4A 2QO3A 3EXCX 4Y2AA 4FN5A 5A8RA 1CLFA 2ZBIA 1RT6A 3P3DA 4ZJOA 1TFWA 5L8RC 1DHMA 2C2ZB 3TQEA 3PTWA 3R27A 3MAQA 4OYZA 3W63A 1IM4A 3MM5B 2V94A 4QW8A 3OPKA 4URQU 4IKAA 1P9QC 4ZCMA 5BR8F 3G6VA 3GPAA 2H9ZA 1HHTP 2PN6A 1BQMB 2CJKA 4EK2A 1N36J 1FRLA 4JV2A 4R8UB 3SCKE 2NUUG 1OY9A 5C7PA 5D0GA 2FZGB 2F5GA 2C3UA 3VVUA 1PJ7A 1RT4B 2R9LA 3RBXA 1RXOB 1REVA 3HF5A 2CZVC 4OYXA 2C2RA 1B7YB 3AB2B 4RW4B 3BO3A 2AQ4A 4K4ZA 4I68A 3FSXA 3OVAA 4JI0J 4IO9Q 2N82B 2KFYA 1LFPA 3HMJG 3RW6A 3MMCB 9RUBA 2CUYA 2FHJD 3MM7A 2QEXS 1M5KC 2YKNA 4UOGA 4K4UA 3K58A 1Y0HA 3JSYA 3DLHA 4MK7A 4LR9A 2R7RA 2DD8S 5H9EK 4Q0BB 1PKUA 2NYIA 4K59A 2DGQA 4NPOA 2ZUGA 1JK9B 2I5JA 3OXFA 2XYHB 2NUHA 4KKOB 1UAWA 2D9OA 2V9KA 2H4YB 4Z7YA 1R43A 4DR4F 3PKYA 2AWZA 2V6AA 3EUNA 4USWA 1R8CA 1WI6A 1YITS 3RRGA 3GV5B 2VFUA 1VRUB 4DS5A 3GIRA 2OHDA 2W2OP 2F8HA 1BQNB 5DDRC 1RB0A 5LMNF 4ZVRB 2CJ9A 5KFLA 4L73A 2PEBA 3D6FB 3JTOA 3I0RA 1GEHA 1YDLA 3E51A 4NLPA 3Q22A 4NXMJ 4CTAB 3BEGB 1LW0B 2XZTB 3HHLD 3TNVA 4DEZA 4DR5J 3M8PA 2CNKB 1B0PA 4CLSA 1EKSA 4DSLA 2R8IA 2B4OA 2CQDA 4HLBA 1KOHA 1UA0A 3POTA 1S7HA 3FCVA 3N28A 2JNJA 2D3UA 2N4DA 5KFMA 3G6ES 1SC1B 1JJCB 2HVDA 1T7PA 3OR1B 4L3KA 4Y3CA 3DDIA 3TANA 5J2QA 4JUZA 1U8SA 2OFGX 4AL6A 4BC7A 2HBZB 4C8LA 2D7SA 2VQFF 1FRJA 1UWAA 2ZH9A 5KFQA 2QLFB 1M5PC 1Z2LA 3ZNUA 5ETSA 4B9VA 4HTIA 3W9HA 3KG4A 2Q79A 2WVDA 1GAOA 2DY9A 2PI4A 1S97A 3I4HX 4MKVA 1NB2A 1JNRB 4ANDA 1E6VB 4OYMA 4OHZA 1O0PA 1TUWA 1N4LA 4O4RA 1RACB 2GV1A 4RW4A 4OZNA 3CSKA 4WP3A 2KG0A 2UV8G 1IWAA 4M5IA 1UVLA 2I0XA 1X4EA 5GAEU 3FMBA 4XTTA 2IYIA 3MEDA 1TQLA 3BH6B 1ZAVA 1FRIA 2H65B 4LQ9A 1XR7A 4A8YA 4LF4J 2DR9A 3CJSA 3ITHA 5KFOA 2CQ1A 1YBAA 4CYUA 5KG0A 2Z4PA 4Y0FA 4HR2A 1UMJA 2RKIA 2YWGA 1JQGA 3CJ2A 3T5HA 2AZ3A 3BPDA 5I3QA 1JNZB 2UXDF 1JB0C 3P49B 4ZPDA 3LALA 1RTJA 5F3ZA 2GIQA 4ER8A 5DJBA 4C8NA 4DUZJ 2KG1A 1UFWA 1HIYA 2HGLA 4RW6B 2QGFB 2CAJA 2FGCA 3KLEA 1NKBA 2DXDA 2MDAA 3M05A 2ACMA 1Q8BA 2YPZA 4XPCA 2WAQD 1RE1B 5F9LA 1JXEA 1YSJA 2IM1A 4U9RA 3G4SS 2VODA 4LF8F 2HHXA 2YKMB 1R31A 4P52A 1CEZA 5DZ6A 3H2UB 4HKQA 3W9IA 2OTJS 4OI1A 3BF4A 4WKYA 5FIIA 3PHEA 1GTEA 2EW9A 3PJXA 4HH0A 2ZNYA 2WOMA 2MKYA 3GFZA 5KFUA 4EGLA 4KAIA 1RP5A 2CJAA 3QIPA 3OR2B 4DX6A 1J27A 2FVCA 5GVQA 4WZQA 1ZM2A 1S48A 4PUOB 2AX1A 3HSDA 3LAMA 1TU0B 1UL3A 4X64F 2NXCA 3OLBA 2ZM6F 3T5JA 3SSRA 4YMEA 1M1KT 1YGYA 1UVJA 2OEJA 4ZVGA 3EGVA 3IR6B 5F8LA 3DLEA 3HX9A 1TKZA 3B4DA 4G3IA 5ADZA 2YWKA 3M8WA 1PAEX 1E6VA 1LWFB 4FKYA 1YJ7A 1TV6A 2L3MA 1P9YA 1UPPA 3LF0A 1FEEA 1X0PA 1DFDA 3DOLB 3GR1A 4DG1B 2HNYB 4L76A 2B0GA 4ZP7A 2HHHF 3CO9A 1NJIT 5BYSA 3IS9A 1MROB 1WOSA 2KJVA 4URGA 3DRRA 3RB0A 1WHXA 2MHNA 4ICLB 2EFVA 2IC3A 3FZ2A 1HNXJ 2IM2A 1U48A 1VQYA 3OLAA 4YHHF 1Y5NB 3QSYB 1HARA 4ED8A 2KT3A 4H4MB 3DLBA 2L08A 3EM1A 3OSNA 2DVIA 1O8BA 2HHVA 4KFBB 5D4OA 3EPGA 3RJMB 3GMGA 4DCOB 3UN2A 3Q2TC 2VD3A 5ETLA 3A13A 4JOUA 2AEJA 2HHUA 2JLFA 3W2WB 5B0DA 4CO4A 1JLEA 3SDEA 1FXLA 3KLGB 4BC9A 1B3TA 2ZEJA 2D9PA 3HK2A 2ALYB 4LBHA 4XIUA 5E3PA 1EJ7L 3OJSA 5KG1A 3J81Y 1YJTA 4USJC 2KN4A 3MTKA 3JSRA 3JB9k 2XMWA 3V4IB 4ID5A 4ZIVA 4ED7A 1F2GA 3QWUA 3CIZA 1J5OB 2DGSA 2CQ3A 5HP1B 2W8LA 2CWKA 1NSPA 1HI0P 1SBRA 2ZFHA 2L9WA 2NSBA 2X7IA 1N36F 3MMAA 3RW7A 1S99A 4C6AA 4DZDA 2M8DB 3H98A 2BRLA 2FLOA 3Q23A 1YIJS 3KLHB 3VAJA 1VRTA 1Q8LA 2HFSA 1QVFR 5CABA 1XC9A 3IA0A 3FQLA 3VWSA 1KP6A 3OUYA 5JVHQ 1YTYA 5FLXU 4OI3A 4P7VA 5HMYA 4PUOA 1HW8A 3PIPQ 4UY8T 2ZBQA 1IKXA 2CQ4A 1FD2A 4K0KF 2VG6B 2KXFA 3LP0B 2RMLA 4JI0F 1TL3A 1JLCB 2Z58B 3MM8B 3FC9A 3DFEA 3PFEA 1RAHB 1NK7A 1T05B 3VCDA 2PA8D 2KI2A 2BABA 1D09B 1NHUA 5CA5A 5KT3A 4A4JA 2VJVA 4KO0B 1LWFA 1RBAA 1VQKS 2J0WA 2WRMA 1QE1A 3BGFA 3DOLA 1N5VA 2QA2A 4K50A 3TUZC 4FVCA 1YJNS 4LSNA 2X1AA 4FF2A 3S8SA 4BHQA 4RW8A 3MUTP 2XNRA 2GHVC 3HPOA 2NR0A 1B7FA 3PEHA 4F4XA 4IG3A 2JRSA 2CNOB 5CAAA 3TVYA 4KGXB 2XLKA 3ET6B 1E6YA 1AXQA 2P9CA 2XHCA 4ZN1A 1RWOB 4G65A 3OHBA 1UP1A 4P2MA 3BDEA 3T5LA 2Q3PA 2OIHA 4S0MA 1FA0A 2FHOB 5K8MA 2AJ1A 4UF4A 4DS4A 3UCUP 2VDHA 3CD5A 1FFSB 3CCZA 4FYDA 4L74A 1VISA 3AHPA 2PDAA 2EFGA 3MCMA 4W92B 4ECUA 5HK4A 4WPAA 3KK1B 4LMZA 4ED1A 2JEFA 4HACB 4TVAB 3NNAA 1S7IA 3HP6A 2IAJB 5L9XA 4ECZA 2QFIA 4CRJA 1SI9A 1S9GB 3J80U 4DR5F 1U8WA 1JIHA 4LFAJ 2VG7A 1RTHA 2KU7A 4DSKA 4ZPCA 2FLNA 3LOUA 1EAYC 4CNZA 5U47A 1MNEA 1RTDA 3NGDA 3MR6A 3UW1A 2ATLA 2Z0GA 1VDHA 2BM0A 1YG0A 3DYAB 2W9AA 1J5OA 4X66J 2BKPA 2QG9B 2K06A 2MMYA 1WC1A 2WHOA 1LEOA 2Y8YA 4B3OB 3PW0A 2NXUA 2UUWA 2VF3A 2XC9A 4P2FA 2H54B 2AT1B 1TUVA 1PBAA 1URRA 3AJDA 1SKSA 4EZ9A 2HQIA 3HJVA 3PHTA 2MB0B 3G8TA 2MQMA 3K5NA 1UKUA 1KKHA 2ASDA 4O44B 3Q8YA 2GJ2A 3HI9A 2VA2A 1HMVB 1SKUB 4GVBA 2XM3A 4TKTA 1S0VA 2CPZA 2GVZB 2E9TA 5B09A 2MQLA 2KVIA 2YNIB 3J7A1 3VF0B 5CYQB 1DBDA 1G1XA 5F0UA 2O1PA 3RB6A 1HNIB 1RWVB 1CJVA 4QCLA 2B7CB 2MKJA 2BJ8A 4KYZA 1LWCB 4J90A 1TL7B 3WBZA 3AT1B 2JEIA 4L6V3 4P2SA 4URSA 4KO0A 2MZSA 5F8MA 4YN3B 4LF4F 5C2GA 2C3PA 3NLCA 4Q8FA 3R5BA 4WP8A 1TKXA 4DX8H 4M5DB 1LW2A 1NSAA 1T11A 2HGNA 3IBCB 1AROP 4C11A 2HVZA 4RKUC 1SCJB 3PVXA 3GG0A 2VPYB 2PA3A 2BJ3A 4KH1B 3SCIE 3MFHA 1FE0A 1H2VZ 4Y2MA 2ZITA 5KFGA 4LF6J 1CJTB 3W8PA 1MWYA 3UN3A 4ERDA 1EKRA 3HZEA 3M7VA 4IRKA 1M1HA 4DUZF 3NBPB 2WONA 4L75A 4UOFA 4ATNA 1IBLJ 3L7UA 2F7VA 4DFKA 2DJWA 4RU2A 5HBMA 3T3FA 2WVCA 1S6UA 1UVMA 3UFCX 1YZ6A 1U45A 2Z30B 4NXNJ 4ILLA 4JBCA 4X4QA 3M1VB 3AD7C 2CPFA 2G13A 3RR7A 6AT1B 2IAJA 1DTQB 4ECQA 3UVJA 2BKOA 4B9LA 1NU4A 2F3JA 2RF2B 4OYWA 3O5TB 1H98A 4RBTA 2MKKA 1MWZA 4N8OA 1R0AA 3MAAB 2FJXA 4NRUA 4CO1A 4EMDA 1TMMA 1Q1KA 3PR5B 3QGPA 4LFBJ 1R8AA 1KONA 1AFIA 1AB8A 1SH3A 1BD6A 3CF5Q 2VKRA 1Q81T 1VQ4S 1X9MA 2ILYA 3T41A 2QYCA 3J80Y 2QA1A 4I2QB 2B3TB 1B4SA 3N5BA 2YNHB 3EZOA 2JLGA 2MY8A 3K5MA 1TL1A 5KG5A 1HMVA 4E98A 1NK5A 1YWXA 4M5KA 3W65A 2VB6A 4IH7A 3V81B 3IRWP 4EFAC 4USIA 4USKA 1T8EA 3MURP 2KFZA 1ZM3A 2V68A 2MKSA 4OHWA 2K1RB 2YKAA 3X3UA 1LWCA 3MAHA 1RWNB 2DPIA 2FY1A 4NLGA 4ZDNA 3H40A 1BY9A 1UJ4A 2KM8C 4RWXA 4WP9A 3K5PA 1SKRA 4CLYA 1ELOA 4IR9A 4W98A 5CYMA 2LA4A 4ANCA 1OYDA 4TN2A 4OZLA 1HNXF 4F0HA 3ZTRA 4P73A 5LJ3Y 2HHQA 3DOMA 3ADAC 1S72S 2MJNA 2ZKTA 2AP6A 2YKOA 1VR6A 4J9PA 3GJRB 2ZOGA 2LXFA 1KVKA 5ETTA 3TO8A 5LOQA 4NASA 3QBCA 3W62A 5CCMA 3C19A 5HVGA 1K44A 1ZAWA 3NBPA 2W24A 1FERA 1U09A 1HQEA 1G3OA 4ZITA 2FC8A 2MJUA 2Q1LA 1JJHA 8RUCA 5CCLA 1WEYA 5K8PA 1VFJA 3RRHA 4Q5VA 1N34J 3DRSA 5KG3A 3NOCA 2DNNA 2CJYB 2GS8A 2IM3A 1HQUB 3QAUA 5CQGA 3LP2A 2M9KA 3H25A 3Q8SB 2VASA 4WK3A 2CPDA 5FDLA 3W8GA 3CW2C 2L48A 1EQ0A 3EGWB 3ZTQA 2HNZA 2XBPA 1T3OA 3WIVA 3G8SA 4CP5A 5IT0A 1U1NA 3CJKA 3AJ1A 4JI7F 1H7WA 2F8EX 3OTOJ 4NLQA 2VQEJ 1RA7A 1MU2A 4OFZA 4CO3A 2Y1JA 4NLTA 1YBUA 4X4OA 4C0OC 3U1NA 4E0DA 4J9KA 4J9UE 4DQQA 4JV0A 1WACA 3R8YA 2C2EA 5LXYA 3OXGA 3M6XA 5A8KB 3MM9B 1APSA 1NHKL 3AXKA 1RWUA 5I42B 1EX8A 2AX0A 1RLCL 3MMJA 5E7OB 4CH7A 2QLBB 1K47A 3RG6A 4PG8A 2YQ1A 4TU9A 3EX7B 3F56A 4OX6A 1WOPA 5HVHA 5J2PB 4C9DA 4ZVTB 3TI0A 3GP9A 3IM8A 5KAKA 4OZ1A 4KR0B 2AD9A 3SV3A 5C2CA 4ECVA 3DGVA 3L7PA 3I96A 4K5RA 3WC2A 3B4MA 5I3UB 3MEEB 2IRXA 1D9FA 2POKA 4DLEA 3FKBA 4AL5A 4DL5A 1TL5A 2V50A 3LP1A 2RHSB 3DXBA 4M5MA 4G1QB 2ZBCA 1IQZA 1ZOTA 2B8PA 3IRXB 4C4WA 1T9TA 2XMMA 1QM9A 2A6OA 2FJEB 2CJBA 2CQ2A 1VQ9S 1FNXH 3ETMA 5CD4A 4LRDA 3CWJA 4LFCJ 4ES2A 3PX6A 2PE8A 2PFDA 3FSIA 4LSZB 2ZBRA 4RBVA 2Y0BB 4LVNP 1UJ6A 1X4GA 3R5JB 3TZZA 4NLSA 2M2BA 1S1XB 2C2OB 1VK8A 5B0EA 4DV3J 2DR5A 3KJVB 3IWNC 3HHLB 4UY85 4O23A 3JXOA 4X66F 2Y9HA 4ZLNA 3SQOP 4DMZA 3V6HA 1R6VA 5DG7A 2D3OR 1J5EJ 4LUBA 3QO9B 2ADBA 3QJJA 3KK2B 1U47A 1C0UB 1S4EA 4ENOA 3UCZP 4F4KA 2RDDA 4K4WA 3IGNA 2NXEA 2VKZG 1U0SA 1CPZA 1TVRB 1SJ3P 3SSSA 4HI1A 2DHGA 5G0RB 2YNFA 3BBCA 3KDOA 2J8AA 1OPIA 2RRBA 4A8WA 1RT2B 4ZVQB 5H9FJ 2JZ5A 2B5JB 1D9DA 4DQPA 1XK8A 2ROGA 2LDYA 2OMLA 4YOEA 4WXWA 1QD1A 1F3FA 3QT6A 1IKWA 2ZC4A 3A8JA 4KHPJ 1U25A 1I5OB 5GAHU 4N5SA 2J9EA 1Y11A 4N77A 4X4TA 4FF1A 4LF2A 1RJJA 4AFFA 4M5JA 2NXJA 4PWUA 1N5YA 4LRBA 3DRYA 1PSDA 2DNGA 4GMKA 4IRDA 1O6XA 2BX6A 1P6TA 2GAGC 3BBBA 4CCHA 2O5DA 5K8NA 2AMCB 4YR2A 3ULHA 3TARA 5KFEA 1HR0J 3VAMA 1FK9A 4QBUA 3MXHP 2N7CA 3ZZOA 1RISA 5I3UA 3U02A 3N6NA 3ILIA 2HNDB 1FKPB 3R5AA 3BQ0A 4RW7B 2A6MA 2C2KB 3SFGA 2A1BA 4LF6F 3GONA 2MLXA 2HHSA 3JYTB 4NX9A 3BGLA 3DLLQ 2FJVA 1FKAF 3R2DJ 3R3TA 3CVKA 3CJ5A 3UPFA 3I5BA 5HI7A 4XDCA 2Z2MA 5IXUA 1C1CB 2ZZNA 1FX2A 1IBLF 2FYXA 3PX0A 1AT1B 3MDFA 3K59A 3SSQA 4NLOA 2DYAA 1RTIB 1Y5IB 4NXNF 3Q8PB 2I9SA 3JQKA 2JC1A 5JUMA 1L3KA 2HBYB 2BJ1A 3NAHA 3UE2A 2X3GA 3PNIA 3TEGA 1XEZA 1Q16B 4OZ0A 2AJQA 3FBCA 3V6DA 2OTLS 4WFAQ 1SL2A 2FJWA 4DR7J 5ETOA 2E5JA 2EBGA 2VFTA 2BA9A 2E5IA 3GIIA 2RIJA 3C14B 4DFJA 2Z56B 3F73A 1G4CA 2WBMA 3PKMA 2M5YA 2R2RA 2CPHA 1IJFB 1U6ZA 2DNOA 3HHLA 2UUCJ 2YXLA 5LM7E 1CQNA 2XSJA 3H20A 4IQXA 1OIAA 1FKOA 1VRQC 3ZFVA 3OL8A 3ZZTA 1N5TA 1FEHA 2ZHOA 3MEKA 1HYSB 3H4BA 1RWKB 1Q5YA 2KKHA 2XMJA 3CMAS 4OLPA 3KKFA 1HBOA 3MUVP 1Z4UA 4NLVA 3NS7B 4C2MA 3CE8A 2V67A 3GU0A 3R5DA 1Y4ZB 4EYIB 3JSBA 4OV1A 4ALZA 2GQQA 4A46A 4JV1A 1VJQA 3M8YA 1HNZJ 3NGUA 2MY7A 3OTEA 2R7OA 5BJRA 2ZNZA 1F5CA 4CH1A 4FYVB 5A8WA 1X4AA 3NCPA 2W4CA 3C6UA 4DR6J 4ED0A 4B3MJ 2BOPA 1T0TV 4PAAA 2J6SA 3NMRA 1SV5A 4K4TA 2BQ3A 1JWWA 2CFXA 1R7IA 4E2FB 2KT2A 4CO5A 1VCTA 2QC3A 1RT7B 2BANB 3H8YA 2YNGB 4PQUB 1IKVB 2ASJA 3C16A 5ETVA 2CVIA 1TELA 1KVJA 1S1VA 4NE9C 4P71A 3S6EA 3NAIA 5IM0B 2LQ8A 4NLDA 3GLJA 4GKJJ 1X9SA 1S9FA 1F5AA 4X84A 3IMQJ 5J2MB 2CKWA 4RX6A 2F63A 2DCUB 2Y1RI 1XWLA 4E8UA 3LPYA 2VG5B 3QJPA 1NJYA 3G6XA 4FNHA 1X7VA 5T14A 4CIOA 2R7SA 2ZE2A 4ZMMA 4QR0A 1SVDA 1R89A 4HHUA 2JLEA 4R5PA 1RHQB 2CRLA 2N4CA 2W2MP 3QJLA 1NJWA 1S1WB 4A8XA 2V2KA 2JDJA 5A0YB 4QR1A 1RTIA 3ONQA 2UXCJ 2ZZMA 2PMZD 5L1JA 1ZYQA 3OJUA 1N34F 3MECB 4GO7X 3TAPA 3VQTA 1JMTA 3FDSA 1ITPA 2FVSA 1N56A 3KLFA 2HGMA 5DGAA 4U8YA 4WE1A 3W64A 1UJ5A 1C1BB 2HQCA 3VAHA 3VR1A 3AOAA 1FFGB 2BJDA 1FJGJ 1JX4A 2XS7A 4LRCA 5G4DA 2MQOA 3UD4P 1NK0A 2ILZA 2GC8A 3ENVA 4TU7A 2CJQA 4JI5J 4A8KA 3VGTA 2V4QA 3IP0A 4NI2B 1RZMA 3CCTA 4DV5J 1WEZA 3F0NA 4K7QA 3OTOF 2PSZA 2VQEF 2D69A 4HT5A 4G1PA 3W5YA 3IC1A 1VQ5S 4XAKA 1HBUA 2ERRA 2OSQA 3JSMA 2HIYA 4H54A 2IPOB 2C3YA 2VBXA 3UDEA 3ZZ0A 3M30B 2UU9J 1NZ8A 1KR4A 2R7XA 4F67A 2LLZA 2GIRA 4ZVHA 3BR8A 5D4LA 3PIOQ 1HQ2A 4Q44A 3DU5A 1UW4A 3D3CJ 4IG0B 2CZ4A 3MPDA 4CLLA 2DR8A 2XCPA 2VFRA 4DPXA 1PYSB 1FRXA 1QAJA 4HHHA 2OGUA 4M5HA 5LMUJ 1EP4A 1T95A 3FBBA 4TNOA 1FT8A 2NYHA 4HTJA 1M5SA 2EFNA 3HFVA 1FVQA 1OJ4A 2OMOA 1UEVA 2A18A 5FD1A 1PILA 2J9DE 4EU0A 2MQ8A 1K1QA 4F4WA 4DN0A 2VG5A 4ZLPA 2I38A 4JI2J 3M32A 3DC2A 1NLKL 4NCAA 2Q6CA 2MKIA 2A0FB 4LFCF 1LXJA 1KC8T 2RRNA 4HI2A 1MN7A 3M2VB 3MCNA 2ZD1B 3FMWA 4TQSA 3OFEA 5AXNA 1QUVA 5T7LB 4PYDA 2G2ZA 3DLKA 4QR2A 3BSOA 3VZHA 2CG4A 2YX4A 4DV3F 3OSPA 3PG9A 3LWMA 3CCWA 2BE2A 4DZ6A 3VAKA 4YR0A 4B3SJ 3EDQB 1N0UA 4AT1B 2FGOA 5F8IA 5E33A 3NNHA 2LXUA 3M2UB 5KFTA 9ATCB 1IN0A 1VQPS 1J5EF 3DHXA 3B82A 4ILMA 1XR5A 5F41A 5T41A 4FXVA 4IOCQ 4PXEA 3ISZA 2JWNA 2EXUA 3DKDA 3I4PA 3TAMB 2ATCB 3UN5A 1VQNS 4C8YA 3OTDA 2EK6A 2AIRB 3M4XA 3TA1A 3D28A 3OHAA 2J0SD 3N9UC 2EG2A 3FBFA 3PR4A 2CVEA 2X1GA 2RD5C 3X1LB 5ETKA 1LOUA 1UPMB 3PW7A 5CH7B 2MKHA 2BDPA 1HNVB 3KYLA 4ZK7M 5L1LA 4ZN3A 2QFJA 3H5XA 1OY8A 4KHPF 5CYJA 2W4PA 1TKDA 4O4GB 2DRBA 3NXZA 4UT4A 4F2RA 1JKHA 3IG1B 5L39A 2HFOA 1CJKB 4ZVUB 3FRYA 4RZRA 3M9OB 2AEFA 4ZA1A 2C3OA 1S9EA 3GSIA 8ATCB 3HT0A 1SH2A 5F8JA 5C24B 3A4TA 4YEAA 1U1PA 4PWDA 1DZ5A 2JFDA 1OSDA 1TR0A 1NPPA 5AJ3J 2VQFJ 4IG0A 1YRXA 4ED3A 3Q8QB 3ICLA 1ZZFA 2OPQB 4G1IA 1NKCA 2XLJA 1RHKB 2KHCA 2OLWA 4MFBA 2W7AA 1NH8A 3BGUA 2R8HA 1RUSA 4AUKA 5HSPA 5LSLA 4FYXB 2ZH1A 3VGSA 5B08A 1HKAA 3KDNA 1MN9A 2B6AB 2HVEA 3MEGB 3M2RA 4P7TA 4ZS6A 1SJ4P 2W7OA 2ZWOA 3GSDA 2ZC3A 2XWYA 3DOKA 3NCQA 1DURA 3ENWA 2K2PA 2HURA 1N88A 3RRKA 1FDNA 4YUDA 1P1LA 1RK8A 4I2PB 1CS4B 3VZIA 1Q95G 4MIBA 3KNGA 3NGRA 2X1BA 1CSJA 4DR7F 5T7LA 2XULA 1YRUA 2HBQB 3ZZRA 5GADI 1EETB 2G0IA 2RDJA 3W5ZA 5LT5A 3AXMA 2BZ2A 2OPRA 4NMXA 1U1KA 2P2CB 1F3VA 5L9NA 1RT1A 2XWXA 3EICA 2XNQA 2UUCF 4USUA 5GAGI 1Q5VA 4IH5A 3E3XA 3QMQA 2Z57B 3OQ2A 1T9VA 3PW4A 1MMLA 1HWJA 2YH0A 1R8PA 5F9NA 5DDPC 4DOZA 4ZPTR 4ANEA 1N33J 2QA4G 3CMES 3I0SA 5J2NA 4IRCA 2ZKUA 5L1IA 3TAMA 4DR1F 1WHVA 3ETOA 5KFSA 3BR9A 4FS1A 3NWGA 2OAUA 2QL9B 4TYBA 4OYAA 2HWTA 1FXDA 4KTQA 4AQYJ 1RCXB 3E01A 2N3LA 1IKYB 4ZCIA 3CJ3A 2OPSA 1HNZF 4DN9A 1WUUA 3TX0A 3CJ8A 1NK8A 5FJ4A 3RU0A 4L3NA 2AYGA 5THWA 2W2NP 2VL1A 1CC8A 4DR6F 4B3MF 2RRAA 5D0EA 2R8GA 8AT1B 5JVGQ 4F50A 3PDNA 3NS6A 4P74A 4IFVA 2F40A 5KFAA 5DLGA 2KFNA 3ZNJ1 1UWBB 1RADB 4ZCKA 3CCQS 2L9DA 2LQJA 1FDDA 2IVYA 1Y10A 3W9JA 5KFYA 2XY7A 4USMA 1WC6A 3CCMS 3C15B 1R27B 4N8NA 2EPIA 1XTZA 3G96A 4HT7A 3FEZA 3F44A 2BR0A 1TK8A 4I7FB 7FDRA 3CJ0A 2V63A 4WIIA 1AW0A 5A2QU 4GKJF 2ASYA 3GV8B 3VVTA 1JLGB 3W2VA 1FWLA 4YY3J 1C0TB 2ZHBA 3K17A 5C42B 3SQGB 1JLBA 3DLGA 1TL4A 3QSIA 2QX0A 3LA0A 3T1AA 1I94F 3IFEA 2MQQA 4HL9A 3ZC4A 3P8BB 4QWBA 2OPPB 2JH3A 2J9CA 3HVTA 3TZWA 3W66A 2QSFA 2UXCF 3AODA 1UFLA 2XMTA 3FCWA 1H74A 1T9UA 5D6GA 4YHHJ 2GW8A 3N4WA 2HFZA 5IS2A 2R4FA 1D8ZA 1Y3KA 2XI3A 1U1MA 3MTJA 2MSTA 1W7WA 4NYZA 5KT4A 1MMDA 1VQSA 2KDOA 3C6TA 1EARA 1FJGF 1U6FA 4CZCA 4ITSA 4DSEA 1KRPA 4JI5F 1VQ7S 4QIVA 1A7GE 2HMIA 4DV5F 4F8RA 2HQDA 1HBNB 5J1NA 1D3WA 3BKFA 1R8BA 1NJZA 5ETPA 2U2FA 3TVZA 4YP3A 4UW2A 4Y6IA 5LL6d 2RH3A 4DUYJ 1XMOJ 4RW9A 1WELA 1KLMB 2GAHC 4LT6A 2LEBA 1OPZA 1NEEA 2WZ1A 2UU9F 4DPWA 4F36A 4F3QA 4J37A 4KC5A 3MR5A 5KFZA 2HZCA 1WORA 4DL7A 4EYHB 3OW2R 1PGZA 5DDQC 2GQCA 5I4MA 4B9NA 4RLEA 4DV1J 4TU8A 3BQ1A 1Q82T 1JLFA 2E5GA 3QLHB 1S0MA 4Y2IA 1R0BG 2DR6A 3KG0A 1U26A 2LQ5A 2HLUA 1NPRA 2DB1A 1ZA1B 4DPUA 2DNZA 5E3RA 5LMUF 4D3GA 1D9AA 4MH8A 1AYEA 3LTOA 3ENQA 4K0KJ 1PYOB 2ACYA 3SFUA 4BBYA 1NK9A 2GMLA 5K14A 4PCQA 3I82A 2Y1LB 4DL2A 5HLFB 1Z2ZA 5B0FA 3QQCD 3RR8A 1IR1A 3MPUB 3J7YI 1T03A 4IOBA 1NSQA 1WKJA 4Z37A 5DZ7A 1AZSB 4WWSA 1Z1ZA 3BGRA 5MAOA 2Q6BA 2LU2A 3WIUA 1IVZA 2M4MA 3CEDA 4JI2F 1NB7A 1HPZA 5IT9Y 1Y00A 1JLAA 4C48A 3PYEA 4OHXA 2BM1A 3ISND 4QZVB 3THTA 3FCHA 1RT5A 1URNA 3QGHA 1U0HB 1ZA2B 1UZDA 5HATA 4J7CA 1HD0A 2VBZA 3JS9A 2ZJPQ 1SL1A 4RJVA 4QWCA 1VS3A 1VMBA 2E1AA 2QSWA 4N7TA 5JXSA 1YI2S 3DI6A 2GMJA 3HHLC 4NOHA 4B3SF 4QPTA 1FE4A 2GZOA 1ZZNA 2OD6A 2V2VA 5KFDA 2E5HA 4PZVA 3K57A 2RUGA 2J76E 1CJUB 1VQOS 2VJUA 2D41A 3TAQA 2W8KA 1KHVA 3GIJA 2C3MA 4TY9A 4QIEA 1EIYB 1N8RT 3CJTA 1UEKA 4MAKA 4WFNQ 4C0BA 1X5OA 2DNPA 3CIMA 4IFYB 2FD2A 2DHAA 1HI8A 3K5OA 2BXJA 2MLZA 1EQMA 2WBRA 3NEKA 2AGPA 1XBWA 4FZVA 3MM5A 4OX9J 5HQ8A 1RAIB 4HH1A 4MYUA 4O3NA 1GK8A 3AFGA 3DGPB 2V69A 1GX5A 1BWEA 1KQGB 3P96A 4RNHA 2CDRB 3LAKA 3VTIA 2W9BB 4MKAA 1TFYA 4WYWA 1BQMA 5DLFA 1M5OC 4KGMA 4ZVPB 1NO8A 2W25A 1GXTA 4F3MA 2QT7A 1FDBA 4R8UA 3CCRS 5AJ3F 3PJ9A 2YX1A 2V4JB 3BREA 1GTHA 5D0RA 1FX4A 3QLHA 3NS5A 4FPRA 4UOHA 3C66A 2UVWA 3CT9A 1RT4A 2GIFA 3HULA 3HFKA 2OUGA 4LIWA 4IDKB 2P6SA 3TRGA 4P9SA 1HWUA 2AJ0A 1VQLS 3QNWB 2Z2LA 4K2JA 3BSCA 4K4VA 3PZPA 1T94A 1L3VA 3MMCA 3GILA 2IM0A 4P72A 1GQEA 4GRSA 2BYCA 4Y2CA 1AZSA 3RAQA 1D8YA 5IV4A 1UVIA 4KH0B 3VAFA 4Q0BA 1X4HA 2WB1D 5DGBA 1RAEB 2AJFE 3NY0A 1U4BA 2GA7A 4D3HA 5DG9A 3AOBA 5HMZA 4BWJA 3HD1A 1S57A 2HHPA 2RQKA 3Q0AA 4KKOA 2UZAA 3RB3A 1QTMA 3TJ9A 2RAQA 2HPUA 2PD1A 1N6QB 1FTCA 3MMBB 3OFHA 1VRUA 2MGZB 4PG4A 1ZAXA 2P9EA 2HK2A 2OI2A 3KOAA 4KHRA 3TWZA 4KGZB 1BQNA 3FRZA 1IJEB 1VBKA 2EBEA 1S0OA 4EBCA 1RKJA 1N33F 3ZZUA 3CMQA 2FLPA 2I8EA 4QOTA 2U1AA 2J8SA 3O8WA 4MK9A 4B9MA 4ZOSA 4B3RJ 4IFYA 2DO4A 5IT4A 1K73T 4CH0S 2HVHA 4CTAA 4F02A 4AQYF 1LW0A 2HEKA 4O3QA 2XSFA 1P8GA 1K0VA 3W60A 4ECTA 3BN7A 2HFUA 3S7RA 2HQFA 1KDNA 3D1QA 1U24A 2L9NA 2GX8A 2E7XA 1YJUA 3UCGA 1WDDA 4RU9A 2C22A 4CLWA 2YH1A 4OZ2A 3NMAA 5DO2A 4XK8C 1DTTB 2YPYA 3N01A 2BQRA 3KTQA 3OR1A 4I69A 3BKTA 1N5SA 3P4UB 4WFYA 2RS8A 5D77A 5D3GB 3GYGA 3SI8A 2JJ4D 3W1YC 4DR3J 1N0VC 4MYTA 1VOMA 3A8KA 1B64A 1WTFA 1GT8A 5ETNA 1JJ2R 1I51B 1TK0A 1Q78A 4WYLA 2ZDOA 2RQMA 4YY3F 1S1TB 4QIFA 2GHPA 2J7UA 2X1FA 3N6MA 2NSCA 4KGKA 3GJQB 4CQ1A 1V3SA 1O5JA 3D68A 4XDDA 4I0WA 5KFNA 4PYAA 3M8QB 1RT3B 1WF0A 1DRZA 4N76A 1N54B 3HLUA 4ZCLA 2N3OA 3OV7A 3DM2B 3PX4A 2JFKA 3PO5A 1IBKJ 4A48A 2MQPA 3HJFA 3FZBA 2DRDA 3UDVA 4OLOA 1R0CB 3KJQB 1H0HB 2VFSA 3A3OB 2QL7B 3D67A 3CNQP 4J9QA 2DXFA 3TUPA 2UP1A 4EBEA 3MM6B 3MPYA 1QAXA 1WDTA 5DRKA 1HWIA 2IMWP 4U8VA 4NZ0A 3SBMA 1GMWA 2MXYA 3VGUA 2CYYA 4FBTA 3H5YA 1WEXA 4Q43A 1LWEB 4NZ7A 3EGZA 2LCWA 5DQIA 2AYEA 5I3PA 2YTCA 2B9EA 1VQMS 3QRQA 2G1HA 2E1CA 1H72C 3W3SA 2HAIA 1VYAA 1CULB 2M3DA 4RW6A 5HN0A 3DU6A 2OEMA 1WC4A 2G0CA 2IYGA 4DUYF 2QMWA 1XMOF 1LK5A 3CDWA 3FGVA 1UVKA 5DG8A 1S6QB 4WFXA 2PEHA 4MJKA 2XEXA 4RNOA 4FVMA 2CWXA 3OFGA 4U7UD 1LFWA 1K0TA 3R7SB 2YKMA 2ZH7A 2QE5A 2VPZB 3N0VA 4F7VA 1S6PB 3QT7A 4DV1F 2BRKA 2K3KA 2AEMA 1OY6A 3Q8UA 1BXNA 4PRFA 3ZZZA 1ICEB 1RSCA 4H4OB 2R7UA 4W90B 3NP5A 2UV8A 1AUSL 4KRWA 2K8GA 3OR2A 2E1RA 2VBYA 3EJMA 2WVFA 2CQ0A 2VIHA 4JI7J 1RQ0A 1H6KX 3BSNA 4DL6A 1R3NA 4QJVA 2RILA 2HRTA 2DH8A 2VICA 3C8YA 2W7PA 5HQLA 5DQGA 2DH7A 3CCJS 4L72B 2DT9A 4CLUA 1SQGA 3W5XA 3KHLA 3G2XA 3PYFA 2XMAA 2LVWA 1SQEA 1UTAA 4M5LA 5HROB 5LJ5Y 1KQFB 1S5ZA 1WHYA 1FESA 2MKCA 2XYGB 3S1TA 2DNMA 3T6JA 1C4CA 3LUYA 3HVRA 4DG1A 2HNYA 3KK3B 3NGTA 4ZHRB 2ZH4A 1FO1A 1GX6A 1JLQB 2UVUA 1ROFA 3I9V9 4DF4A 4JI6J 1MROA 4K2XA 3W7BA 5A8RB 2VU5A 3GYXB 1J2VA 5KFXA 5GAEI 4J9RA 1RT6B 3CJRA 3ZO7A 1V5IB 3GIKA 1RKIA 2VV5A 4ICLA 2BUNA 4BDPA 3HHDA 4J9NA 2C2MB 4H4MA 2DKOB 2VOPA 4NYPA 4KFBA 5LXRA 5EWGA 4WIQA 1F0XA 3Q8RB 2J5AA 2R2TA 3CD6S 2IFXA 3PM9A 1U2RA 1LWEA 3D1OA 4KIAA 1Q7LB 2BKNA 1NKEA 1RU1A 4HEA9 5KG7A 2VH7A 1NRKA 3W2WA 3Q24A 3V5RA 3G82B 3KLGA 3MUMP 1UETA 2PC6A 4CM2A 1CULA 2ZBPA 1H38A 1BGXT 3FK4A 3ILOA 1PC5A 2EI5A 2DHHA 3A12A 4OX9F 3OL9A 3SMZA 1REVB 4I4BA 3V4IA 4NMLA 2R3VA 5HVFA 4F2SA 2RNEA 4ECRA 5MLCV 5HP1A 1C4AA 3DRPB 3GZ7A 2BJEA 3WHIA 3MM7B 1EB0A 3KLHA 4LF1A 1T9XA 2YKNB 3H5UA 2DO0A 1XMQJ 5ETQA 3HDSA 3U1LA 4ZVEA 2BOAA 3DDKA 4FYYB 3TX8A 4B9UA 3CDAA 3MOJB 3L7OA 4LQ3A 1K9MT 2E7WA 5KT2A 3C2PA 4QQBA 2R2UA 2XGQA 2VONA 2JEGA 1T02A 5HO4A 4OV6A 3Q8VA 3KG1A 2B43A 1HI1A 1HBMB 3OTCA 3S01A 4X65J 2VG6A 4YQWA 2I5JB 3LP0A 4V1Ak 3T6BA 5KT6A 5M2PA 1I3OB 1G2EA 1HD1A 1JLCA 2KM8B 3MM8A 1N5QA 3NKYA 4YR3A 3IO1A 1NDLA 1T05A 4U7UK 5CXTA 4NEZA 4J5OA 4ECXA 1SIWB 2DTJA 3DLJA 4FF3A 3AH6A 3QRRA 4RR5A 3D2WA 2XYPB 2DNQA 3KMSA 2AJ2A 5DS7A 2FVPA 4X62J 3SCLE 2VFVA 1S1UB 4PWWA 5E2QA 5DQHA 2E1PA 5FLXY 3TA0A 2JX2A 3G6YA 3KK3A 3HM9A 2J7KA 2KRBA 3I0RB 4PQAA 2AW0A 1ZH5A 4EUVA 4B02A 3CJQA 2LQ9A 1UCNA 4I67A 3NG8A 3ET6A 2Y8WA 4LF7J 3PY8A 3M8PB 2G2YA 3O3LA 2RS2A 3A8IA 3TJ8A 1RA6A 4MIWA 3KLIB 3TOQA 3RBEA 5AT1B 3FEYB 3POTB 2V8HA 3JTPA 4LR8A 2WTFA 1H3DA 1SB6A 1JXVA 4IOAQ 4ZVSB 4RUBA 1FRHA 4ID8A 2FIUA 3CXCR 3QYYA 3UWTA 5KTQA 3KK1A 4JI4J 4HACA 2E5LJ 4B3RF 2M0GB 5J2QB 1K8AT 4EI2A 3G82A 4LSLB 4OJ1A 1S9GA 4PG5A 2YWFA 2E1MC 4OJ3A 3M6UA 1NAQA 2B9YA 2FPHX 3QPIA 1DY3A 2IDLA 5D4PA 4BCAA 3EXYA 2WSCC 1QAYA 2HK3A 2AJ4A 4HDGA 1KSPA 2LDIA 3DYAA 5DDOC 3NRBA 4HDHA 4M95A 4Y2KA 5L1KA 2RSQA 4B3OA 1Q8IA 3DRPA 4MKYA 5D0HA 2H48B 1IXKA 1YJWS 1F1BB 2VPXB 2IJFA 2IRUA 2AGOA 1FNMA 4DR3F 3E8OA 1SJQA 3GB0A 3FUYA 1LV5A 3MEDB 4WU2A 3J81j 2H51B 4CWBA 2ZH8A 4O44A 4Y00A 2DITA 3ITHB
chains in the Genus database with same CATH topology
2Z57B 3SQOP 1R6VA 2E1PA 3A3PB 2W2QP 2ZWPA 3T41A 4NMXA 1SPBP 2Z56B 2W2MP 3GCWP 3A3OB 2QTWA 2Z2YB 2ZWOA 3CO0P 4K8RA 2XTJP 3CNQP 3GCXP 3VHQA 2Z58B 2PMWA 3WIUA 3AFGA 3P5BP 1ITPA 4NE9C 3WHIA 3BPSP 4YN3B 2Z30B 1SCJB 2W2NP 2W2OP 3A3NB 3H42A 3WIVA 3VV2B 2Z2ZA 4JP8A 2W2PP 1V5IB 3QFHA 4OV6A 3BGOP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z57 B;  3SQO P;  1R6V A;  2E1P A;  3A3P B;  2W2Q P;  2ZWP A;  3T41 A;  4NMX A;  1SPB P;  2Z56 B;  2W2M P;  3GCW P;  3A3O B;  2QTW A;  2Z2Y B;  2ZWO A;  3CO0 P;  4K8R A;  2XTJ P;  3CNQ P;  3GCX P;  3VHQ A;  2Z58 B;  2PMW A;  3WIU A;  3AFG A;  3P5B P;  1ITP A;  4NE9 C;  3WHI A;  3BPS P;  4YN3 B;  2Z30 B;  1SCJ B;  2W2N P;  2W2O P;  3A3N B;  3H42 A;  3WIV A;  3VV2 B;  2Z2Z A;  4JP8 A;  2W2P P;  1V5I B;  3QFH A;  4OV6 A;  3BGO P; 
#chains in the Genus database with same CATH topology
 4QWD A;  2I6W A;  4CYU B;  4YB5 A;  5IWA J;  2R7Q A;  4EO8 A;  1IR2 A;  1N32 J;  3WX8 A;  3BB5 A;  1JXL A;  2GVZ A;  3M9N B;  2E44 A;  1HBM A;  2RKI B;  3BV8 A;  3EZU A;  5K8O A;  2YNI A;  3TZY A;  4G6V B;  5CYQ A;  1IBK F;  5EUH A;  1AFJ A;  1VK3 A;  1M5V C;  1HNI A;  3UDC A;  2B4P A;  1RTJ B;  2RB7 A;  4JI8 J;  2R7T A;  4DSF A;  1YBT A;  1U6B A;  3ZXW A;  3THV A;  2YQ0 A;  1TL7 A;  2CXE A;  2CNN B;  2DGW A;  1GMV A;  3QID A;  3HSJ A;  2JEJ A;  3HD2 A;  1CQM A;  1A0O B;  1UW9 A;  5CD4 H;  1V6H A;  3KLE B;  2KYZ A;  4M5D A;  1S1U A;  4ED4 A;  4QYR A;  4F0K A;  1LK7 A;  3R5C A;  2FY8 A;  1X8D A;  3VV2 B;  4ED5 A;  4UQG A;  2NS1 B;  2DIV A;  2IJR A;  5KFK A;  2VHG A;  1Q4R A;  2OO4 A;  3BDP A;  1CJT A;  2DXE A;  4DL0 C;  3H59 A;  3ZZY A;  4UST A;  2H5J B;  4ZLJ A;  2MQN A;  4LBI A;  3KLI A;  2CQC A;  2BV3 A;  4DL4 A;  4NZ6 A;  3IXQ A;  2WOM B;  1GFW B;  5E5N A;  3QIP B;  2DHX A;  3QT8 A;  5AXM A;  4U7C A;  2CPI A;  2YWW A;  5D4N A;  1IWG A;  5E0O A;  3M1V A;  3GCW P;  2ZHA A;  2XG8 A;  3LQV A;  4DF8 A;  5B0A A;  3QAT A;  1S49 A;  1W2I A;  3LGM A;  4LSL A;  1DTQ A;  1VQ8 S;  4RUC A;  4MKB A;  4GVL A;  2HFN A;  2C42 A;  4A8F A;  2RF2 A;  1KVI A;  3DLE B;  4Y28 C;  1RAB B;  2BJ7 A;  2DH9 A;  4A8O A;  1TKZ B;  2AYB A;  2WCX A;  3O6Q A;  1HL6 A;  1IBM J;  1ZS6 A;  1XIQ A;  3OXL A;  3PJW A;  5HMX A;  3MAA A;  1TV6 B;  4C7Q A;  3DNC A;  2LXI A;  2OFH X;  3FJ2 A;  3A3P B;  2J7W A;  2EC0 A;  3A1Y G;  2J6T A;  4LVO P;  1KFD A;  4O3P A;  3CGI A;  2NZ4 A;  2ZDP A;  1CVJ A;  2GCF A;  4RUH A;  5IZH A;  3IS9 B;  4UZB A;  4DSJ A;  5H1S V;  3DRR B;  1REG X;  2M8H A;  4MTP A;  3WDO A;  2ZH2 A;  1MLA A;  2EFO A;  5IQ6 A;  4I2Q A;  1F9E B;  2IC3 B;  2CQH A;  2YNH A;  4DX5 A;  1DAR A;  3J81 U;  4USH A;  2ZOF A;  2KT5 A;  7FD1 A;  1NH7 A;  1RAF B;  2FVR A;  1SXL A;  3TR5 A;  3QZ8 A;  3C46 A;  2MZ1 A;  3LO3 A;  3RBZ A;  3V81 A;  4PXC A;  1WG1 A;  5M2R A;  1KFS A;  4FBU A;  1NXI A;  2BAC A;  3UD5 A;  1V3Z A;  3B8H A;  2HW3 A;  3OTB A;  2B9X A;  5K9F A;  4CLT A;  2K1R A;  4JI6 F;  5AE3 A;  1A9N B;  1TKT B;  1JLE B;  3MOZ A;  3SDE B;  3OVB A;  3OL7 A;  2BW7 A;  5B7W A;  3PCO B;  3CCL S;  4RBU A;  2MLY A;  1HA1 A;  4OI6 A;  3HO1 A;  1WC5 A;  5A6W A;  1U1O A;  1VBY A;  1XMB A;  4M63 A;  2IIH A;  4B9T A;  4J9M A;  1GXL A;  4ID5 B;  1PJ5 A;  3G86 A;  4FP9 A;  3H5S A;  1RGV A;  1SJR A;  1S59 A;  5E3A A;  4QW9 A;  1YK9 A;  3D6T B;  4DR2 J;  4X4R A;  3JAM U;  4X4S A;  1PO6 A;  3MMA B;  2B51 A;  2HFV A;  3RAX A;  1X4B A;  4X4P A;  2LEA A;  2DBB A;  2VA3 A;  3BO2 A;  3NGS A;  1VRT B;  2YWE A;  4PXB A;  2QRR A;  5L38 A;  5B0B A;  3GG1 A;  3OUY B;  3K8V A;  4AD6 A;  2FUG 9;  2CQI A;  3KUE A;  2V5H G;  1TAQ A;  1UFK A;  2ZWP A;  3G8Q A;  2HRY A;  1H73 A;  1F9F A;  2CPE A;  2GHW A;  5KG4 A;  1M1G A;  2VC1 A;  1IKX B;  4ILR A;  3KWM A;  2RT3 A;  1RHU B;  2XQC A;  1Q8K A;  3B54 A;  1HQU A;  1WC0 A;  2EKN A;  4OYP A;  2IA0 A;  1TL3 B;  3IR5 B;  3SYZ A;  1QSL A;  3AB4 B;  2DGX A;  4PG6 A;  4Q8E A;  1BWV A;  2QV6 A;  4P75 A;  6FDR A;  3PRD A;  5EX3 A;  1XMQ F;  3W61 A;  3L09 A;  5ETR A;  4CDI A;  2D74 B;  1QE1 B;  5KFI A;  1F9H A;  3R9L A;  2V4R A;  4YB1 P;  4LSN B;  2M7S A;  3IM9 A;  4RW8 B;  1V3R A;  4DUT A;  4OI4 A;  4ZPW R;  3KHG A;  4X65 F;  4LRE A;  4HVZ A;  3D6M B;  2C1E B;  4F4A A;  4NA1 A;  3UO0 A;  4CNY A;  4IG3 B;  1H2T Z;  5A8K A;  3MM9 A;  4NLR A;  1FXR A;  3P45 B;  4LR7 A;  4PPZ A;  4OI0 A;  1AA1 B;  1E6Y B;  4J9S A;  3GR0 A;  3QFH A;  5I42 A;  2UUT A;  4FF4 A;  3AD8 C;  2ZJR Q;  1WC3 A;  4QIW D;  2IDE A;  1WTB A;  4X62 F;  2HS3 A;  2FJB B;  5J2P A;  4R0E A;  3ZTO A;  2KVQ E;  4H4K A;  1ZBT A;  1WD6 A;  2JC0 A;  2FHJ A;  3I5C A;  1S0N A;  1QJH A;  2RU3 A;  3MEE A;  4MMO A;  2CA9 A;  3FNN A;  1TKT A;  3Q83 A;  4LF7 F;  3GFX A;  3GJT B;  3AA8 A;  4Q45 A;  1FWP A;  2V8D A;  4CM0 A;  1LKZ A;  2VG7 B;  2LU1 A;  3L95 X;  1RTH B;  1YRT A;  3PAC A;  4KSE B;  1MG7 A;  4JB8 B;  4X4V A;  4G1Q A;  1T9Y A;  3PEJ A;  2DK2 A;  1RTD B;  3IRX A;  2VPW B;  1LQ9 A;  2AV5 A;  2HHT A;  3H7H B;  3EGN A;  4QYZ K;  4C3L A;  2QZ8 A;  4JI4 F;  2E5L F;  4NRT A;  4FKX A;  1Q0N A;  4OYB A;  4FXD A;  1X0F A;  5F8N A;  4RPF A;  4EO6 A;  1RWX B;  2HQ3 A;  2BQU A;  2QLX A;  1ZM9 A;  1XER A;  2QL5 B;  1S1X A;  3CCS S;  2DNL A;  4JI1 J;  3TEH B;  4DX7 A;  3KJN B;  4GVB B;  2CIM A;  4UTG A;  1Q86 T;  3KJV A;  3BO4 A;  3CB4 A;  2A2D A;  2R7V A;  1S12 A;  1WHW A;  4YDX A;  4KHM A;  2BE7 D;  4OX8 A;  4PR6 A;  2HBR B;  5H9E J;  5A76 A;  2PMH A;  3VAL A;  4NL5 A;  5GMD A;  3QO9 A;  1IR0 A;  1CJV B;  3MR3 A;  2LFV A;  4M94 A;  3JAM Y;  3KK2 A;  1C0U A;  1S10 A;  4N41 A;  3Q89 A;  4ELT A;  3UI3 A;  4F0M A;  4DR1 J;  3DCA A;  4RNM A;  4DWI A;  1TVR A;  1N52 B;  4KY3 A;  1X5S A;  2NCK L;  5G0R A;  3HVA A;  3PFO A;  1S4F A;  2W01 A;  1VLY A;  2BW2 A;  4NA2 A;  2H5E A;  3QWP A;  1TKX B;  1RT2 A;  1L3T A;  1LW2 B;  1KTV A;  5IWA F;  1N32 F;  5LSR A;  3I56 S;  2B5J A;  2AKW B;  4I6W A;  4WTO B;  2OEL A;  4C11 B;  2GQ2 A;  2O3D A;  2AF6 A;  5E3C A;  1QLN A;  4JI8 F;  2H4W B;  3UR3 C;  1WG4 A;  3K0J A;  3KUG A;  3RUB L;  4LF9 J;  1X4D A;  3D3B J;  4LRF A;  3TP2 A;  1L5U A;  3UR0 A;  3L3C A;  3DXS X;  1S77 D;  2KB2 A;  3A3N B;  2WON B;  2Z8Q A;  2D1C A;  5KT7 A;  4QU7 A;  4ECW A;  3NL0 A;  2P8I A;  2ZVS A;  2R7W A;  5HBM B;  5GME A;  2DGT A;  3MD3 A;  1Q7Y T;  5KOW A;  3BPS P;  3CJ4 A;  4C8M A;  2WSF C;  5KFR A;  5SZT A;  4AYB D;  2NRE A;  2HND A;  1FKP A;  4RW7 A;  3O1L A;  4NXM F;  4NYO A;  4O3O A;  2R8J A;  3UVJ B;  1TMJ A;  2NZC A;  3WC0 A;  3JYT A;  1WF2 A;  1RWM B;  2XGP A;  1H7X A;  3NOG A;  1I94 J;  4TLQ A;  1C1C A;  3AY0 A;  5A6P A;  1R0A B;  4PKD B;  4CT8 A;  2CQG A;  3ELH A;  1HNW J;  4RNF A;  1N48 A;  4DSI A;  3TYT A;  5F8H A;  1NJX A;  5IC6 B;  3LWL A;  4WFB Q;  4UUW A;  2HZA A;  4M5N A;  3GQC A;  1KQS R;  3C14 A;  2V0N A;  2BE9 B;  3HKW A;  3VHQ A;  1TL1 B;  4GC6 A;  4IUF A;  3BS9 A;  4KGV B;  3BM7 A;  5AE2 A;  4YB7 A;  1Y3J A;  4P2X A;  1IBM F;  1QY7 A;  1UVN A;  2GNK A;  3DDN A;  3CUL A;  3GE9 A;  4LF5 J;  4EBD A;  4WU3 A;  1VIX A;  4HHJ A;  2GJF A;  2RVJ A;  4DDF A;  3PXG a;  2KHD A;  1HYS A;  2DGO A;  1KQK A;  5KFH A;  4WZM A;  1RWP B;  2YX7 A;  4X4N A;  2JL9 A;  4P10 A;  4ETZ A;  5CYM B;  4XPE A;  5C25 B;  3THP A;  5EGY A;  1UZH A;  5IOL A;  3RBD A;  3HKZ D;  3G9C A;  2XMV A;  4OYI A;  3DOM B;  5BYR A;  2Q43 A;  1RAO A;  1RTZ A;  3DRX A;  2M88 A;  4O3R A;  1TUG B;  3O2I A;  3LAN A;  1G6B A;  4LBP A;  2IRY A;  1EHW A;  2DGV A;  2FB0 A;  4YS2 A;  5GAH I;  1F5B A;  4QWE A;  3PYG A;  3P5T L;  2V8G A;  3EE3 A;  2DEI A;  2KO1 A;  4KBI A;  2UVV A;  1YQH A;  1QVG R;  2MSS A;  1HQE B;  1RT7 A;  2BAN A;  4KQZ A;  4DV2 J;  2YNG A;  1NDK A;  1X9W A;  1IKV A;  4PQU A;  1VLO A;  5KFB A;  1S76 D;  1QDU B;  2V34 A;  4OX7 A;  2RU9 A;  4JI3 J;  2B56 A;  2IBO A;  2O01 C;  4DPY A;  2CZ9 A;  2AHO B;  3R6L B;  5IM0 A;  4NCG B;  2A3J A;  3DRS B;  5J2M A;  4NLY A;  3KNA A;  4Y65 A;  1FTR A;  4K8R A;  4NWB A;  1WNE A;  4DR2 F;  5E41 A;  1RAA B;  3LP2 B;  5F0W A;  3V6K A;  1BE4 A;  3UDL A;  4A8Q A;  3CCE S;  3T5K A;  5FDL B;  5F3T A;  3FFI B;  1ZPV A;  4WJB A;  3SIP B;  2RQC A;  5AXK A;  2E9Z A;  2DIU A;  4ZIW A;  1NM2 A;  4U96 A;  4U6P A;  1XQI A;  4BS2 A;  2HNZ B;  1HWK A;  3IWL A;  2CJX B;  2WK4 A;  2XLI A;  3OL6 A;  1S1W A;  5A0Y A;  2LYV A;  3HCX A;  3CJK B;  4DFP A;  1QAI A;  1WG5 A;  1MU2 B;  3MCS A;  2HKE A;  3MEC A;  2YY3 A;  2NQP A;  2GO8 A;  4X4U A;  3H42 A;  3QGG A;  1VC6 A;  1NPK A;  1C1B A;  2ROP A;  1FRM A;  1AUD A;  1RAG B;  1WSR A;  1Y5L B;  4V19 X;  1WKL A;  3D0G E;  2JVR A;  2HWI A;  1FDA A;  3HT3 A;  1X4C A;  3UNG C;  1A6L A;  2GMH A;  1QSS A;  4NI2 A;  4CO0 A;  3FSY A;  3TZX A;  4B17 A;  4ZP8 A;  5KFV A;  2HG4 A;  4FS2 A;  1U1L A;  1NK6 A;  1I6J A;  1WOO A;  3KFW X;  3H4D A;  2EC2 A;  1VC0 A;  2LQB A;  2PMW A;  2R8K A;  3M30 A;  5F8G A;  3TQ1 A;  1JJ4 A;  5C25 A;  2NXN A;  3LP1 B;  3MCO A;  2QMX A;  4PPD A;  2FLL A;  2XY6 A;  2J6U A;  4I6Y A;  2WW4 A;  3P5B P;  4F3O A;  2MZR A;  3US5 A;  1RAJ A;  2UUA J;  4K4X A;  2UXB J;  4QIG A;  1RBL A;  3TUI C;  2QN6 B;  2APO A;  1OMS A;  3ENA A;  3K5L A;  1R6Y A;  1TTH B;  2DIS A;  3CD7 A;  1RYS A;  3WQP A;  2B4V A;  1GMU A;  4JV5 J;  4OMF G;  2GFF A;  5E3Q A;  2B7B B;  3E2E A;  2KXH A;  2P6T A;  2PO4 A;  3KXD A;  3HZG A;  3UQS A;  2QMU B;  4DXL A;  3GIM A;  4DI6 A;  4TLR A;  2D3Z A;  4LRA A;  5EWF A;  4F4Z A;  3D54 A;  2G2O A;  5CZX A;  1QTN B;  1I1G A;  1WSV A;  3CDU A;  2F9D A;  1PCA A;  1FHT A;  2H5I B;  1M0S A;  2E7V A;  4NCG A;  3HSG A;  3K89 A;  3JTN A;  4B9S A;  1XNR J;  4DCJ B;  1FVS A;  6FD1 A;  4KPY A;  1UA1 A;  3KUH A;  2EK1 A;  2ADC A;  3T1Y J;  3FFI A;  2QLW A;  4QPX A;  3M2V A;  2ZJQ Q;  2DNK A;  2ZD1 A;  3NWR A;  1IUJ A;  2F4F A;  3QAE A;  1VHF A;  1ZM4 A;  1ZTT A;  1PIE A;  2JOQ A;  2RDI A;  2XO6 A;  2YWH A;  1XNQ J;  3IGV A;  5KG6 A;  2KRR A;  2YNF B;  2HVI A;  4JI1 F;  2ZH6 A;  4QU6 A;  1LXN A;  1PAU B;  1VI7 A;  5AE1 A;  1U2C A;  2KZZ A;  4C3K A;  5L46 A;  5JJB A;  3M2U A;  2DPJ A;  4C3M A;  3HHN B;  4GKK J;  1IKW B;  2XMU A;  4W4M A;  3PRB A;  1ULR A;  1F60 B;  3M6V A;  2Q66 A;  5D8H B;  4DPO A;  4ZP6 A;  2XS2 A;  1X4F A;  2EG1 A;  3TUJ C;  1U1R A;  1N5Y B;  1DAX A;  3R1L A;  1NUE A;  3MZI A;  2FHK A;  4CLF A;  2CQB A;  1U2F A;  4J9V A;  4CLZ A;  4KE5 A;  2FQQ B;  5C5J A;  2HRU A;  2O67 A;  3EDR B;  1VHI A;  3PRV A;  3C3L A;  4I1T A;  2KZM A;  1HNV A;  1FK9 B;  2FDN A;  2IJN A;  2B8Q A;  3WZ0 A;  4LIR A;  2A10 A;  2KYX A;  3MPV A;  3R7N B;  1SC6 A;  4DV4 J;  3P6Y C;  4KPC A;  4O4G A;  4AXI A;  3U27 A;  4CO2 A;  4PG7 A;  3IG1 A;  2GGP B;  1CJK A;  4LF9 F;  3UD3 P;  1V9O A;  1P27 B;  3SXL A;  4ELV A;  3MD1 A;  3QGI A;  1RWW B;  5C24 A;  4IR1 A;  3RAM A;  2MTL A;  3CC7 S;  4OZ5 A;  1X5T A;  4RUA A;  1VJW A;  4DU8 A;  4B3T J;  3ZZP A;  5AXL A;  2ROE A;  3MWB A;  2OPQ A;  4BWM A;  1FJE B;  5GMK a;  3GV7 B;  4C8K A;  1OWX A;  1NCL A;  3OT9 A;  1H2U X;  4A8M P;  3D4J A;  1KN6 A;  1NSK L;  3BZQ A;  1DQA A;  3V6D B;  4LFA F;  2G4B A;  4ETX A;  2MYF A;  3N79 A;  3LH2 S;  4DFM A;  1S79 A;  1BMQ B;  2B6A A;  4DV0 J;  2XHW A;  4C0H A;  3MF5 A;  3MEG A;  3D0I E;  1VIO A;  2K3I A;  4DHV A;  1ACM B;  1YZ7 A;  2DNH A;  3EYZ A;  3TJA A;  4WK1 A;  1SH0 A;  2XSJ B;  2UVR A;  1KTQ A;  1HNW F;  1FKO B;  2VOO A;  1VQ6 S;  1U7L A;  2Y3Y A;  4I2P A;  2WSE C;  1CS4 A;  3CD0 A;  3I9Z A;  4KV8 B;  4DCP B;  3I32 A;  2QA4 S;  5B0G A;  4OJH A;  3BGO P;  1HBO B;  1SJ1 A;  1HHS A;  3TA2 A;  1EET A;  1KEK A;  3SV4 A;  3AD9 C;  3IBF B;  3WX4 A;  5K20 B;  2CQP A;  4FDF A;  1Y7P A;  7AT1 B;  1YJ9 S;  5EN1 A;  4MT1 A;  4LF5 F;  3TW0 A;  4K4S A;  3KHH A;  2V8V A;  4TQR A;  3GCX P;  4EWT A;  5KFW A;  2CAD A;  1FFW B;  5A8W B;  1RHM B;  4USV A;  5B0C A;  3C6U B;  4JP8 A;  1SV5 B;  4DV6 J;  2YKQ A;  5EDW A;  2FZK B;  2NPF A;  2K7J A;  1NND A;  1YJV A;  3TVK A;  2M52 A;  2KXN B;  2PII A;  3IBW A;  3SCJ E;  4DV7 J;  3U1M A;  2A2C A;  2OEK A;  3QT5 A;  5D78 A;  3C16 B;  4YDD B;  2IY5 B;  1XJW B;  3RB4 A;  3KHR A;  1IKY A;  1S1V B;  2Y1I A;  4TY8 B;  2ALZ A;  2F4V J;  4KJI A;  5J1E B;  1OSC A;  4ED2 A;  4H4K C;  3BYR A;  3VAI A;  2HHW A;  4DQI A;  1Q79 A;  1X60 A;  3ZTS A;  2KTQ A;  5KG2 A;  1WI8 A;  3LGH A;  1L3U A;  5SUH A;  2GGP A;  2YBV A;  1BC6 A;  1SJF A;  1NK4 A;  2ZE2 B;  3ISN C;  5IV3 A;  2W2P P;  3IR7 B;  1UWB A;  1GMW D;  4R5P B;  5HJY A;  3G71 S;  1OO0 B;  4DV2 F;  3C15 A;  3EMT A;  2F8M A;  4JI3 F;  4OI2 A;  2LKZ A;  4WTY A;  4I7F A;  2DRA A;  4CLK A;  1FJ7 A;  2NPI A;  2Y0S D;  3V4M A;  3PW5 A;  3RYL A;  4ZVO B;  1JLG A;  3GFY A;  3KMQ A;  3N6L A;  1SPB P;  2QTW A;  2G1D A;  5M2U A;  1C0T A;  3EPI A;  3KLF B;  5C42 A;  4WE1 B;  3MFI A;  3SQG A;  4MIA A;  5CZV A;  3Q2S C;  3HHE A;  5HL7 Q;  2PFF B;  1V5V A;  4GC7 A;  1RLD A;  2HQG A;  4O3S A;  3CPW R;  1HHQ A;  1FNO A;  1HWL A;  2LA6 A;  1RHR B;  2OPP A;  2IMO A;  2X3D A;  3M8R A;  5HJX A;  1KWM A;  2LMI A;  1YX2 A;  2DNR A;  2FJD B;  3B6B A;  2VC0 A;  1VC5 A;  4LFB F;  3L9Z A;  1RCO B;  1DLO B;  3J7Z T;  1HBU B;  5A2Q Y;  3CDB A;  4O0I A;  3JSM B;  5HQM A;  1F2H A;  4OZ3 A;  1FWK A;  3GJS B;  5HAO A;  2AGQ A;  4KV8 A;  3QZ7 A;  3M8S A;  1VBX A;  2OKQ A;  1PC4 A;  4WBF A;  2HLT A;  2MZJ A;  5KT5 A;  1KD1 T;  3GTY X;  4IH6 A;  3J7A N;  1NHV A;  1FRK A;  1GXU A;  5DET A;  2MPU A;  3V2U C;  5DM6 Q;  1UEU A;  1P1T A;  3I31 A;  1HBN A;  2XTJ P;  2H1Y A;  4OIX A;  2I2Y A;  3BBF A;  1CBK A;  4F26 A;  5KFP A;  1R8H A;  1S6O A;  4KT0 C;  1KLM A;  3M9M B;  1Q53 A;  2ZOM A;  4IO1 A;  1WJ9 A;  4UQT A;  2LEP A;  3FQK A;  4NA3 A;  4ZVF A;  4Q7A A;  2G0J A;  1EP4 B;  3MGJ A;  1RHJ B;  1C2P A;  3RTV A;  4CT9 A;  4DQS A;  4ES3 A;  3V6J A;  1KS2 A;  4DPT A;  4TY8 A;  4JYA J;  5J1E A;  2YQ3 A;  3FBE A;  2JVO A;  2UUA F;  2UXB F;  2QJ3 A;  4ZKA A;  1WKK A;  2XY5 A;  4EEY A;  1NBE B;  5HMW A;  4I56 A;  3M32 B;  2G9O A;  4JV5 F;  2BJ9 A;  3VAG A;  3AQO A;  1ZPW X;  1SQF A;  3NGK A;  5GAD U;  2YKP A;  1EZZ B;  3T19 A;  3DLK B;  3EVO A;  1NME B;  2GO9 A;  3FVY A;  4J91 A;  1RI7 A;  1RBO B;  5J1P A;  1M5H A;  2GVD B;  3F41 A;  4NLU A;  4CI0 B;  1RU2 A;  5HLF A;  4ED6 A;  5GAG U;  1KLN A;  2BE2 B;  3T1H J;  1XNR F;  3EVW A;  2OP5 A;  4CLP A;  2VDI A;  3CDE A;  5KFF A;  1VGY A;  2RE1 A;  3SZ2 A;  1FD8 A;  5EX0 A;  3D9B A;  4EZ6 A;  2GJI A;  2F65 A;  1MW7 A;  1GH8 A;  4R25 A;  3T1Y F;  5IQQ A;  2UUB J;  3MPW A;  4B08 A;  1U0H A;  3VGV A;  3I55 S;  2ZVI A;  5HAN A;  3RGI A;  2XZW A;  1F6T A;  2NLW A;  5K5M A;  3CC2 S;  4M1K A;  1XNQ F;  3R6G B;  5EWE A;  2ASL A;  2HYI B;  2V8P A;  1KBR A;  4TYA A;  2OH2 A;  3Q86 A;  2W2Q P;  2DCL A;  2W9C B;  1KOO A;  1D1U A;  3ILL A;  3G87 A;  1TK5 A;  3JQJ A;  1DLO A;  2WW8 A;  2WVB A;  5JMN A;  2Z2Z A;  1D0E A;  1SC3 B;  3HSZ A;  4GKK F;  1LNQ A;  2OSR A;  2BEF A;  1CJU A;  2RJZ A;  3PV8 A;  2XZD B;  2WB4 A;  1BUX A;  3GFH A;  1JKH B;  4OJG A;  5BR8 J;  1O51 A;  2EWH A;  1K1S A;  1S9E B;  2EEY A;  1BLU A;  2E66 A;  1W25 A;  4KB7 A;  4XO0 A;  3D66 A;  4PWD B;  4M8L A;  1L3S A;  4J9O A;  4A8S A;  3PW2 A;  3HHK A;  1YJR A;  2L41 A;  4WCE Q;  4AL7 A;  5ETM A;  3JQM A;  2VZ9 A;  4M5G A;  4OYO A;  2B4U A;  4MFB B;  4DV4 F;  3DGP A;  1SC4 B;  2F1F A;  4DBQ A;  4GO5 X;  1B0V A;  2W9B A;  3H2L A;  2QYG A;  5BYQ A;  2SXL A;  2MEW A;  3GWC A;  2AU0 A;  1B70 B;  3K2Y A;  4U67 Q;  1SUQ B;  3AOC A;  3I5A A;  4V19 J;  2CPY A;  3U7J A;  3M2R B;  2V4J A;  5RUB A;  3QRP A;  4B3T F;  3DOK B;  2CDQ A;  2EKY A;  3D7S B;  4DL3 A;  3BJY A;  4LJM A;  4IDK A;  2I1R A;  4BLG A;  4DLG A;  3AA9 A;  3SEO A;  2FZC B;  4FXW A;  4NEY A;  2MZT A;  2XB2 D;  1BQX A;  1B99 A;  2LP4 A;  1SKW A;  3I87 A;  4DV0 F;  2OPR B;  2GVD A;  2HSE B;  4DR4 J;  3BN4 A;  1RT1 B;  3CO0 P;  4WXO A;  1W26 A;  3B78 A;  2OJ3 A;  3D6H B;  3IWX A;  2J0X A;  4RNN A;  1PJ6 A;  1NDP A;  4QWA A;  2P5V A;  2WVE A;  1IM6 A;  2IVF B;  3H2V E;  5LMN J;  1B0T A;  1TZ0 A;  1ZTW A;  3I0S B;  5J2N B;  3AJ2 A;  4I6A A;  4K4Y A;  4OHV A;  2N7Y A;  1HFE L;  4WFZ A;  1DQ8 A;  4RL1 A;  1OS5 A;  3DMJ B;  2AYM A;  5CHC B;  2EVZ A;  4WKR A;  3HXM A;  4K5S A;  2QIF A;  2JHE A;  1HW9 A;  4DJB A;  1U1Q A;  2HZV A;  2CG8 A;  3E01 B;  2W9C A;  1FI4 A;  3OD2 A;  4N47 A;  4UZC A;  4HYK A;  1KNZ A;  1N6Q A;  3MMB A;  4AXJ A;  4IYQ A;  2MGZ A;  2OPS B;  5D15 A;  1ZET A;  1MWQ A;  3DN9 A;  3I6P A;  3ILJ A;  4NLW A;  4F04 B;  5EHH A;  3EVM A;  5KOX A;  3DHW C;  2DEJ A;  1TP7 A;  3CCV S;  4DV6 F;  3KLV A;  5KFJ A;  4AE5 A;  2HIQ A;  1XR6 A;  4IFV B;  2W1B A;  1DJ0 A;  1IBC B;  3A8E A;  4DV7 F;  3NCR A;  3OFF A;  1YKW A;  2R42 A;  2B9W A;  1WWH A;  2IHR 1;  4OQJ A;  4WF9 Q;  3KJF B;  1HR0 F;  3J7Y U;  2XO7 A;  2F4V F;  4YFU A;  3T9Z A;  3HVW A;  2YVS A;  1NDC A;  4RO0 A;  3W2V B;  3OBI A;  1U49 A;  4DQR A;  1WF1 A;  2RQ4 A;  3LPE A;  3H0P A;  1DTT A;  4QYZ J;  2CPJ A;  1JLB B;  3DLG B;  3M6W A;  2V2Z A;  2XS5 A;  1X31 C;  1YLX A;  3BSA A;  3R2C J;  1SUQ A;  5D3G A;  2D3O 1;  3RZA A;  2BMB A;  4N56 A;  1OYE A;  2FTR A;  3HVT B;  2K7K A;  3CUN A;  1BHN A;  2FVQ A;  3K7R A;  4C98 A;  2EFP A;  2DY1 A;  1QSY A;  3D0H E;  4Y34 A;  4ZJQ A;  4C97 A;  4RWW A;  1X5P A;  4OL8 A;  1LWX A;  2FHM A;  4UOC A;  4J9L A;  2O66 A;  1S1T A;  2CNL B;  2Z2Y B;  3GYN A;  1SL0 A;  2H3E B;  3ZTP A;  3M8Q A;  1RT3 A;  3C6T B;  3DM2 A;  2E9R X;  3R1H A;  5KFC A;  3LW5 C;  3NNC A;  2UXD J;  4Z7C A;  3PYD A;  4UUX A;  4ZJL A;  3BQ2 A;  2BVZ A;  2V2Q A;  4U95 A;  4ZP9 A;  1XN9 A;  1G7C B;  3EZ5 A;  5DM7 Q;  2ABY A;  4OZJ A;  4ECS A;  2HMI B;  3MI7 X;  3MM6 A;  4ELU A;  2VUG A;  3BKU A;  3HFZ B;  3L4B C;  2COL A;  1RYR A;  4OHY A;  4O0N A;  3EWG A;  2DHS A;  3VQS A;  2KJW A;  3IAM 9;  4IQM A;  2J9D A;  2C28 A;  3CC4 S;  2HAF A;  4RW9 B;  3N5F A;  3BH7 B;  4Z2X A;  4FYW B;  2HS0 A;  1NZA A;  2EFQ A;  2X51 A;  4FPI A;  3DMJ A;  2QLJ B;  2ZH3 A;  2RHQ B;  1PYT A;  4LF8 J;  2C2N A;  1PBU A;  2DGU A;  2FC9 A;  1FJC A;  4ECY A;  2KL8 A;  2HWH A;  2IBK A;  1MSW D;  3FEX B;  1OQ3 A;  3MHY A;  4Q2M A;  2XI2 A;  2VBW A;  3M8Z A;  1JLF B;  1PG5 B;  5LSO A;  2DR7 A;  1YHQ S;  2IA6 A;  5IT9 U;  4Q2L A;  4P6Q A;  4C8O A;  3AQP A;  2PI5 A;  2PGC A;  1S6Q A;  1VBZ A;  1M90 T;  3MR2 A;  3O44 A;  2E29 A;  4X64 J;  1OQ6 A;  3CTR A;  3R5G A;  4C8Z A;  1GNK A;  4F25 A;  4YB6 A;  2ZM6 J;  1KHW A;  2C2D A;  4PXD A;  4X2B A;  2KH9 A;  3R97 A;  2M70 A;  5K14 B;  3BYP A;  3CCU S;  1TAU A;  2W4D A;  4ZPA A;  1FF2 A;  1S6P A;  2ZH5 A;  2BBE A;  3OVS A;  2DNY A;  2F9J A;  1HLW A;  4JYA F;  3UNY A;  3D1H A;  1DQ9 A;  2AZ1 A;  4MK8 A;  1T03 B;  4H4O A;  4DU7 A;  5IC4 B;  1CG2 A;  4R0J A;  3H90 A;  3BGR B;  2V9W A;  3LGN A;  5IFM A;  3QFW A;  4ES1 A;  4PEO A;  1HPZ B;  3IN5 A;  1JLA B;  1U02 A;  2XMK A;  3T9N A;  1RT5 B;  1YVF A;  4I64 A;  2J0Q D;  3MR7 A;  4PAB A;  2MHE A;  3IAS 9;  4NCB A;  1RDR A;  2HHH J;  4FNI A;  2IVM A;  4TXS A;  4ZPB A;  2P9G A;  1MMN A;  2ZZT A;  3D5M A;  5BXI A;  4ZPV R;  1IQT A;  2R2S A;  1QUP A;  3R7B B;  2XCA A;  3PO4 A;  2CPX A;  3K8W A;  2RUS A;  3DI6 B;  3T1H F;  1CC7 A;  2LEC A;  4A47 A;  2JSX A;  1FCA A;  5H9F K;  4ZLL A;  4F4Y A;  3J7Z 5;  1T3N A;  1W2B R;  2PT0 A;  5HRO A;  1Y9O A;  4NLX A;  3AAW B;  1SIZ A;  5ITH A;  1T9W A;  2ZUA A;  2UUB F;  2FJA B;  2MZQ A;  4ZHR A;  2HS4 A;  1JLQ A;  2OD4 A;  2QO3 A;  3EXC X;  4Y2A A;  4FN5 A;  5A8R A;  1CLF A;  2ZBI A;  1RT6 A;  3P3D A;  4ZJO A;  1TFW A;  5L8R C;  1DHM A;  2C2Z B;  3TQE A;  3PTW A;  3R27 A;  3MAQ A;  4OYZ A;  3W63 A;  1IM4 A;  3MM5 B;  2V94 A;  4QW8 A;  3OPK A;  4URQ U;  4IKA A;  1P9Q C;  4ZCM A;  5BR8 F;  3G6V A;  3GPA A;  2H9Z A;  1HHT P;  2PN6 A;  1BQM B;  2CJK A;  4EK2 A;  1N36 J;  1FRL A;  4JV2 A;  4R8U B;  3SCK E;  2NUU G;  1OY9 A;  5C7P A;  5D0G A;  2FZG B;  2F5G A;  2C3U A;  3VVU A;  1PJ7 A;  1RT4 B;  2R9L A;  3RBX A;  1RXO B;  1REV A;  3HF5 A;  2CZV C;  4OYX A;  2C2R A;  1B7Y B;  3AB2 B;  4RW4 B;  3BO3 A;  2AQ4 A;  4K4Z A;  4I68 A;  3FSX A;  3OVA A;  4JI0 J;  4IO9 Q;  2N82 B;  2KFY A;  1LFP A;  3HMJ G;  3RW6 A;  3MMC B;  9RUB A;  2CUY A;  2FHJ D;  3MM7 A;  2QEX S;  1M5K C;  2YKN A;  4UOG A;  4K4U A;  3K58 A;  1Y0H A;  3JSY A;  3DLH A;  4MK7 A;  4LR9 A;  2R7R A;  2DD8 S;  5H9E K;  4Q0B B;  1PKU A;  2NYI A;  4K59 A;  2DGQ A;  4NPO A;  2ZUG A;  1JK9 B;  2I5J A;  3OXF A;  2XYH B;  2NUH A;  4KKO B;  1UAW A;  2D9O A;  2V9K A;  2H4Y B;  4Z7Y A;  1R43 A;  4DR4 F;  3PKY A;  2AWZ A;  2V6A A;  3EUN A;  4USW A;  1R8C A;  1WI6 A;  1YIT S;  3RRG A;  3GV5 B;  2VFU A;  1VRU B;  4DS5 A;  3GIR A;  2OHD A;  2W2O P;  2F8H A;  1BQN B;  5DDR C;  1RB0 A;  5LMN F;  4ZVR B;  2CJ9 A;  5KFL A;  4L73 A;  2PEB A;  3D6F B;  3JTO A;  3I0R A;  1GEH A;  1YDL A;  3E51 A;  4NLP A;  3Q22 A;  4NXM J;  4CTA B;  3BEG B;  1LW0 B;  2XZT B;  3HHL D;  3TNV A;  4DEZ A;  4DR5 J;  3M8P A;  2CNK B;  1B0P A;  4CLS A;  1EKS A;  4DSL A;  2R8I A;  2B4O A;  2CQD A;  4HLB A;  1KOH A;  1UA0 A;  3POT A;  1S7H A;  3FCV A;  3N28 A;  2JNJ A;  2D3U A;  2N4D A;  5KFM A;  3G6E S;  1SC1 B;  1JJC B;  2HVD A;  1T7P A;  3OR1 B;  4L3K A;  4Y3C A;  3DDI A;  3TAN A;  5J2Q A;  4JUZ A;  1U8S A;  2OFG X;  4AL6 A;  4BC7 A;  2HBZ B;  4C8L A;  2D7S A;  2VQF F;  1FRJ A;  1UWA A;  2ZH9 A;  5KFQ A;  2QLF B;  1M5P C;  1Z2L A;  3ZNU A;  5ETS A;  4B9V A;  4HTI A;  3W9H A;  3KG4 A;  2Q79 A;  2WVD A;  1GAO A;  2DY9 A;  2PI4 A;  1S97 A;  3I4H X;  4MKV A;  1NB2 A;  1JNR B;  4AND A;  1E6V B;  4OYM A;  4OHZ A;  1O0P A;  1TUW A;  1N4L A;  4O4R A;  1RAC B;  2GV1 A;  4RW4 A;  4OZN A;  3CSK A;  4WP3 A;  2KG0 A;  2UV8 G;  1IWA A;  4M5I A;  1UVL A;  2I0X A;  1X4E A;  5GAE U;  3FMB A;  4XTT A;  2IYI A;  3MED A;  1TQL A;  3BH6 B;  1ZAV A;  1FRI A;  2H65 B;  4LQ9 A;  1XR7 A;  4A8Y A;  4LF4 J;  2DR9 A;  3CJS A;  3ITH A;  5KFO A;  2CQ1 A;  1YBA A;  4CYU A;  5KG0 A;  2Z4P A;  4Y0F A;  4HR2 A;  1UMJ A;  2RKI A;  2YWG A;  1JQG A;  3CJ2 A;  3T5H A;  2AZ3 A;  3BPD A;  5I3Q A;  1JNZ B;  2UXD F;  1JB0 C;  3P49 B;  4ZPD A;  3LAL A;  1RTJ A;  5F3Z A;  2GIQ A;  4ER8 A;  5DJB A;  4C8N A;  4DUZ J;  2KG1 A;  1UFW A;  1HIY A;  2HGL A;  4RW6 B;  2QGF B;  2CAJ A;  2FGC A;  3KLE A;  1NKB A;  2DXD A;  2MDA A;  3M05 A;  2ACM A;  1Q8B A;  2YPZ A;  4XPC A;  2WAQ D;  1RE1 B;  5F9L A;  1JXE A;  1YSJ A;  2IM1 A;  4U9R A;  3G4S S;  2VOD A;  4LF8 F;  2HHX A;  2YKM B;  1R31 A;  4P52 A;  1CEZ A;  5DZ6 A;  3H2U B;  4HKQ A;  3W9I A;  2OTJ S;  4OI1 A;  3BF4 A;  4WKY A;  5FII A;  3PHE A;  1GTE A;  2EW9 A;  3PJX A;  4HH0 A;  2ZNY A;  2WOM A;  2MKY A;  3GFZ A;  5KFU A;  4EGL A;  4KAI A;  1RP5 A;  2CJA A;  3QIP A;  3OR2 B;  4DX6 A;  1J27 A;  2FVC A;  5GVQ A;  4WZQ A;  1ZM2 A;  1S48 A;  4PUO B;  2AX1 A;  3HSD A;  3LAM A;  1TU0 B;  1UL3 A;  4X64 F;  2NXC A;  3OLB A;  2ZM6 F;  3T5J A;  3SSR A;  4YME A;  1M1K T;  1YGY A;  1UVJ A;  2OEJ A;  4ZVG A;  3EGV A;  3IR6 B;  5F8L A;  3DLE A;  3HX9 A;  1TKZ A;  3B4D A;  4G3I A;  5ADZ A;  2YWK A;  3M8W A;  1PAE X;  1E6V A;  1LWF B;  4FKY A;  1YJ7 A;  1TV6 A;  2L3M A;  1P9Y A;  1UPP A;  3LF0 A;  1FEE A;  1X0P A;  1DFD A;  3DOL B;  3GR1 A;  4DG1 B;  2HNY B;  4L76 A;  2B0G A;  4ZP7 A;  2HHH F;  3CO9 A;  1NJI T;  5BYS A;  3IS9 A;  1MRO B;  1WOS A;  2KJV A;  4URG A;  3DRR A;  3RB0 A;  1WHX A;  2MHN A;  4ICL B;  2EFV A;  2IC3 A;  3FZ2 A;  1HNX J;  2IM2 A;  1U48 A;  1VQY A;  3OLA A;  4YHH F;  1Y5N B;  3QSY B;  1HAR A;  4ED8 A;  2KT3 A;  4H4M B;  3DLB A;  2L08 A;  3EM1 A;  3OSN A;  2DVI A;  1O8B A;  2HHV A;  4KFB B;  5D4O A;  3EPG A;  3RJM B;  3GMG A;  4DCO B;  3UN2 A;  3Q2T C;  2VD3 A;  5ETL A;  3A13 A;  4JOU A;  2AEJ A;  2HHU A;  2JLF A;  3W2W B;  5B0D A;  4CO4 A;  1JLE A;  3SDE A;  1FXL A;  3KLG B;  4BC9 A;  1B3T A;  2ZEJ A;  2D9P A;  3HK2 A;  2ALY B;  4LBH A;  4XIU A;  5E3P A;  1EJ7 L;  3OJS A;  5KG1 A;  3J81 Y;  1YJT A;  4USJ C;  2KN4 A;  3MTK A;  3JSR A;  3JB9 k;  2XMW A;  3V4I B;  4ID5 A;  4ZIV A;  4ED7 A;  1F2G A;  3QWU A;  3CIZ A;  1J5O B;  2DGS A;  2CQ3 A;  5HP1 B;  2W8L A;  2CWK A;  1NSP A;  1HI0 P;  1SBR A;  2ZFH A;  2L9W A;  2NSB A;  2X7I A;  1N36 F;  3MMA A;  3RW7 A;  1S99 A;  4C6A A;  4DZD A;  2M8D B;  3H98 A;  2BRL A;  2FLO A;  3Q23 A;  1YIJ S;  3KLH B;  3VAJ A;  1VRT A;  1Q8L A;  2HFS A;  1QVF R;  5CAB A;  1XC9 A;  3IA0 A;  3FQL A;  3VWS A;  1KP6 A;  3OUY A;  5JVH Q;  1YTY A;  5FLX U;  4OI3 A;  4P7V A;  5HMY A;  4PUO A;  1HW8 A;  3PIP Q;  4UY8 T;  2ZBQ A;  1IKX A;  2CQ4 A;  1FD2 A;  4K0K F;  2VG6 B;  2KXF A;  3LP0 B;  2RML A;  4JI0 F;  1TL3 A;  1JLC B;  2Z58 B;  3MM8 B;  3FC9 A;  3DFE A;  3PFE A;  1RAH B;  1NK7 A;  1T05 B;  3VCD A;  2PA8 D;  2KI2 A;  2BAB A;  1D09 B;  1NHU A;  5CA5 A;  5KT3 A;  4A4J A;  2VJV A;  4KO0 B;  1LWF A;  1RBA A;  1VQK S;  2J0W A;  2WRM A;  1QE1 A;  3BGF A;  3DOL A;  1N5V A;  2QA2 A;  4K50 A;  3TUZ C;  4FVC A;  1YJN S;  4LSN A;  2X1A A;  4FF2 A;  3S8S A;  4BHQ A;  4RW8 A;  3MUT P;  2XNR A;  2GHV C;  3HPO A;  2NR0 A;  1B7F A;  3PEH A;  4F4X A;  4IG3 A;  2JRS A;  2CNO B;  5CAA A;  3TVY A;  4KGX B;  2XLK A;  3ET6 B;  1E6Y A;  1AXQ A;  2P9C A;  2XHC A;  4ZN1 A;  1RWO B;  4G65 A;  3OHB A;  1UP1 A;  4P2M A;  3BDE A;  3T5L A;  2Q3P A;  2OIH A;  4S0M A;  1FA0 A;  2FHO B;  5K8M A;  2AJ1 A;  4UF4 A;  4DS4 A;  3UCU P;  2VDH A;  3CD5 A;  1FFS B;  3CCZ A;  4FYD A;  4L74 A;  1VIS A;  3AHP A;  2PDA A;  2EFG A;  3MCM A;  4W92 B;  4ECU A;  5HK4 A;  4WPA A;  3KK1 B;  4LMZ A;  4ED1 A;  2JEF A;  4HAC B;  4TVA B;  3NNA A;  1S7I A;  3HP6 A;  2IAJ B;  5L9X A;  4ECZ A;  2QFI A;  4CRJ A;  1SI9 A;  1S9G B;  3J80 U;  4DR5 F;  1U8W A;  1JIH A;  4LFA J;  2VG7 A;  1RTH A;  2KU7 A;  4DSK A;  4ZPC A;  2FLN A;  3LOU A;  1EAY C;  4CNZ A;  5U47 A;  1MNE A;  1RTD A;  3NGD A;  3MR6 A;  3UW1 A;  2ATL A;  2Z0G A;  1VDH A;  2BM0 A;  1YG0 A;  3DYA B;  2W9A A;  1J5O A;  4X66 J;  2BKP A;  2QG9 B;  2K06 A;  2MMY A;  1WC1 A;  2WHO A;  1LEO A;  2Y8Y A;  4B3O B;  3PW0 A;  2NXU A;  2UUW A;  2VF3 A;  2XC9 A;  4P2F A;  2H54 B;  2AT1 B;  1TUV A;  1PBA A;  1URR A;  3AJD A;  1SKS A;  4EZ9 A;  2HQI A;  3HJV A;  3PHT A;  2MB0 B;  3G8T A;  2MQM A;  3K5N A;  1UKU A;  1KKH A;  2ASD A;  4O44 B;  3Q8Y A;  2GJ2 A;  3HI9 A;  2VA2 A;  1HMV B;  1SKU B;  4GVB A;  2XM3 A;  4TKT A;  1S0V A;  2CPZ A;  2GVZ B;  2E9T A;  5B09 A;  2MQL A;  2KVI A;  2YNI B;  3J7A 1;  3VF0 B;  5CYQ B;  1DBD A;  1G1X A;  5F0U A;  2O1P A;  3RB6 A;  1HNI B;  1RWV B;  1CJV A;  4QCL A;  2B7C B;  2MKJ A;  2BJ8 A;  4KYZ A;  1LWC B;  4J90 A;  1TL7 B;  3WBZ A;  3AT1 B;  2JEI A;  4L6V 3;  4P2S A;  4URS A;  4KO0 A;  2MZS A;  5F8M A;  4YN3 B;  4LF4 F;  5C2G A;  2C3P A;  3NLC A;  4Q8F A;  3R5B A;  4WP8 A;  1TKX A;  4DX8 H;  4M5D B;  1LW2 A;  1NSA A;  1T11 A;  2HGN A;  3IBC B;  1ARO P;  4C11 A;  2HVZ A;  4RKU C;  1SCJ B;  3PVX A;  3GG0 A;  2VPY B;  2PA3 A;  2BJ3 A;  4KH1 B;  3SCI E;  3MFH A;  1FE0 A;  1H2V Z;  4Y2M A;  2ZIT A;  5KFG A;  4LF6 J;  1CJT B;  3W8P A;  1MWY A;  3UN3 A;  4ERD A;  1EKR A;  3HZE A;  3M7V A;  4IRK A;  1M1H A;  4DUZ F;  3NBP B;  2WON A;  4L75 A;  4UOF A;  4ATN A;  1IBL J;  3L7U A;  2F7V A;  4DFK A;  2DJW A;  4RU2 A;  5HBM A;  3T3F A;  2WVC A;  1S6U A;  1UVM A;  3UFC X;  1YZ6 A;  1U45 A;  2Z30 B;  4NXN J;  4ILL A;  4JBC A;  4X4Q A;  3M1V B;  3AD7 C;  2CPF A;  2G13 A;  3RR7 A;  6AT1 B;  2IAJ A;  1DTQ B;  4ECQ A;  3UVJ A;  2BKO A;  4B9L A;  1NU4 A;  2F3J A;  2RF2 B;  4OYW A;  3O5T B;  1H98 A;  4RBT A;  2MKK A;  1MWZ A;  4N8O A;  1R0A A;  3MAA B;  2FJX A;  4NRU A;  4CO1 A;  4EMD A;  1TMM A;  1Q1K A;  3PR5 B;  3QGP A;  4LFB J;  1R8A A;  1KON A;  1AFI A;  1AB8 A;  1SH3 A;  1BD6 A;  3CF5 Q;  2VKR A;  1Q81 T;  1VQ4 S;  1X9M A;  2ILY A;  3T41 A;  2QYC A;  3J80 Y;  2QA1 A;  4I2Q B;  2B3T B;  1B4S A;  3N5B A;  2YNH B;  3EZO A;  2JLG A;  2MY8 A;  3K5M A;  1TL1 A;  5KG5 A;  1HMV A;  4E98 A;  1NK5 A;  1YWX A;  4M5K A;  3W65 A;  2VB6 A;  4IH7 A;  3V81 B;  3IRW P;  4EFA C;  4USI A;  4USK A;  1T8E A;  3MUR P;  2KFZ A;  1ZM3 A;  2V68 A;  2MKS A;  4OHW A;  2K1R B;  2YKA A;  3X3U A;  1LWC A;  3MAH A;  1RWN B;  2DPI A;  2FY1 A;  4NLG A;  4ZDN A;  3H40 A;  1BY9 A;  1UJ4 A;  2KM8 C;  4RWX A;  4WP9 A;  3K5P A;  1SKR A;  4CLY A;  1ELO A;  4IR9 A;  4W98 A;  5CYM A;  2LA4 A;  4ANC A;  1OYD A;  4TN2 A;  4OZL A;  1HNX F;  4F0H A;  3ZTR A;  4P73 A;  5LJ3 Y;  2HHQ A;  3DOM A;  3ADA C;  1S72 S;  2MJN A;  2ZKT A;  2AP6 A;  2YKO A;  1VR6 A;  4J9P A;  3GJR B;  2ZOG A;  2LXF A;  1KVK A;  5ETT A;  3TO8 A;  5LOQ A;  4NAS A;  3QBC A;  3W62 A;  5CCM A;  3C19 A;  5HVG A;  1K44 A;  1ZAW A;  3NBP A;  2W24 A;  1FER A;  1U09 A;  1HQE A;  1G3O A;  4ZIT A;  2FC8 A;  2MJU A;  2Q1L A;  1JJH A;  8RUC A;  5CCL A;  1WEY A;  5K8P A;  1VFJ A;  3RRH A;  4Q5V A;  1N34 J;  3DRS A;  5KG3 A;  3NOC A;  2DNN A;  2CJY B;  2GS8 A;  2IM3 A;  1HQU B;  3QAU A;  5CQG A;  3LP2 A;  2M9K A;  3H25 A;  3Q8S B;  2VAS A;  4WK3 A;  2CPD A;  5FDL A;  3W8G A;  3CW2 C;  2L48 A;  1EQ0 A;  3EGW B;  3ZTQ A;  2HNZ A;  2XBP A;  1T3O A;  3WIV A;  3G8S A;  4CP5 A;  5IT0 A;  1U1N A;  3CJK A;  3AJ1 A;  4JI7 F;  1H7W A;  2F8E X;  3OTO J;  4NLQ A;  2VQE J;  1RA7 A;  1MU2 A;  4OFZ A;  4CO3 A;  2Y1J A;  4NLT A;  1YBU A;  4X4O A;  4C0O C;  3U1N A;  4E0D A;  4J9K A;  4J9U E;  4DQQ A;  4JV0 A;  1WAC A;  3R8Y A;  2C2E A;  5LXY A;  3OXG A;  3M6X A;  5A8K B;  3MM9 B;  1APS A;  1NHK L;  3AXK A;  1RWU A;  5I42 B;  1EX8 A;  2AX0 A;  1RLC L;  3MMJ A;  5E7O B;  4CH7 A;  2QLB B;  1K47 A;  3RG6 A;  4PG8 A;  2YQ1 A;  4TU9 A;  3EX7 B;  3F56 A;  4OX6 A;  1WOP A;  5HVH A;  5J2P B;  4C9D A;  4ZVT B;  3TI0 A;  3GP9 A;  3IM8 A;  5KAK A;  4OZ1 A;  4KR0 B;  2AD9 A;  3SV3 A;  5C2C A;  4ECV A;  3DGV A;  3L7P A;  3I96 A;  4K5R A;  3WC2 A;  3B4M A;  5I3U B;  3MEE B;  2IRX A;  1D9F A;  2POK A;  4DLE A;  3FKB A;  4AL5 A;  4DL5 A;  1TL5 A;  2V50 A;  3LP1 A;  2RHS B;  3DXB A;  4M5M A;  4G1Q B;  2ZBC A;  1IQZ A;  1ZOT A;  2B8P A;  3IRX B;  4C4W A;  1T9T A;  2XMM A;  1QM9 A;  2A6O A;  2FJE B;  2CJB A;  2CQ2 A;  1VQ9 S;  1FNX H;  3ETM A;  5CD4 A;  4LRD A;  3CWJ A;  4LFC J;  4ES2 A;  3PX6 A;  2PE8 A;  2PFD A;  3FSI A;  4LSZ B;  2ZBR A;  4RBV A;  2Y0B B;  4LVN P;  1UJ6 A;  1X4G A;  3R5J B;  3TZZ A;  4NLS A;  2M2B A;  1S1X B;  2C2O B;  1VK8 A;  5B0E A;  4DV3 J;  2DR5 A;  3KJV B;  3IWN C;  3HHL B;  4UY8 5;  4O23 A;  3JXO A;  4X66 F;  2Y9H A;  4ZLN A;  3SQO P;  4DMZ A;  3V6H A;  1R6V A;  5DG7 A;  2D3O R;  1J5E J;  4LUB A;  3QO9 B;  2ADB A;  3QJJ A;  3KK2 B;  1U47 A;  1C0U B;  1S4E A;  4ENO A;  3UCZ P;  4F4K A;  2RDD A;  4K4W A;  3IGN A;  2NXE A;  2VKZ G;  1U0S A;  1CPZ A;  1TVR B;  1SJ3 P;  3SSS A;  4HI1 A;  2DHG A;  5G0R B;  2YNF A;  3BBC A;  3KDO A;  2J8A A;  1OPI A;  2RRB A;  4A8W A;  1RT2 B;  4ZVQ B;  5H9F J;  2JZ5 A;  2B5J B;  1D9D A;  4DQP A;  1XK8 A;  2ROG A;  2LDY A;  2OML A;  4YOE A;  4WXW A;  1QD1 A;  1F3F A;  3QT6 A;  1IKW A;  2ZC4 A;  3A8J A;  4KHP J;  1U25 A;  1I5O B;  5GAH U;  4N5S A;  2J9E A;  1Y11 A;  4N77 A;  4X4T A;  4FF1 A;  4LF2 A;  1RJJ A;  4AFF A;  4M5J A;  2NXJ A;  4PWU A;  1N5Y A;  4LRB A;  3DRY A;  1PSD A;  2DNG A;  4GMK A;  4IRD A;  1O6X A;  2BX6 A;  1P6T A;  2GAG C;  3BBB A;  4CCH A;  2O5D A;  5K8N A;  2AMC B;  4YR2 A;  3ULH A;  3TAR A;  5KFE A;  1HR0 J;  3VAM A;  1FK9 A;  4QBU A;  3MXH P;  2N7C A;  3ZZO A;  1RIS A;  5I3U A;  3U02 A;  3N6N A;  3ILI A;  2HND B;  1FKP B;  3R5A A;  3BQ0 A;  4RW7 B;  2A6M A;  2C2K B;  3SFG A;  2A1B A;  4LF6 F;  3GON A;  2MLX A;  2HHS A;  3JYT B;  4NX9 A;  3BGL A;  3DLL Q;  2FJV A;  1FKA F;  3R2D J;  3R3T A;  3CVK A;  3CJ5 A;  3UPF A;  3I5B A;  5HI7 A;  4XDC A;  2Z2M A;  5IXU A;  1C1C B;  2ZZN A;  1FX2 A;  1IBL F;  2FYX A;  3PX0 A;  1AT1 B;  3MDF A;  3K59 A;  3SSQ A;  4NLO A;  2DYA A;  1RTI B;  1Y5I B;  4NXN F;  3Q8P B;  2I9S A;  3JQK A;  2JC1 A;  5JUM A;  1L3K A;  2HBY B;  2BJ1 A;  3NAH A;  3UE2 A;  2X3G A;  3PNI A;  3TEG A;  1XEZ A;  1Q16 B;  4OZ0 A;  2AJQ A;  3FBC A;  3V6D A;  2OTL S;  4WFA Q;  1SL2 A;  2FJW A;  4DR7 J;  5ETO A;  2E5J A;  2EBG A;  2VFT A;  2BA9 A;  2E5I A;  3GII A;  2RIJ A;  3C14 B;  4DFJ A;  2Z56 B;  3F73 A;  1G4C A;  2WBM A;  3PKM A;  2M5Y A;  2R2R A;  2CPH A;  1IJF B;  1U6Z A;  2DNO A;  3HHL A;  2UUC J;  2YXL A;  5LM7 E;  1CQN A;  2XSJ A;  3H20 A;  4IQX A;  1OIA A;  1FKO A;  1VRQ C;  3ZFV A;  3OL8 A;  3ZZT A;  1N5T A;  1FEH A;  2ZHO A;  3MEK A;  1HYS B;  3H4B A;  1RWK B;  1Q5Y A;  2KKH A;  2XMJ A;  3CMA S;  4OLP A;  3KKF A;  1HBO A;  3MUV P;  1Z4U A;  4NLV A;  3NS7 B;  4C2M A;  3CE8 A;  2V67 A;  3GU0 A;  3R5D A;  1Y4Z B;  4EYI B;  3JSB A;  4OV1 A;  4ALZ A;  2GQQ A;  4A46 A;  4JV1 A;  1VJQ A;  3M8Y A;  1HNZ J;  3NGU A;  2MY7 A;  3OTE A;  2R7O A;  5BJR A;  2ZNZ A;  1F5C A;  4CH1 A;  4FYV B;  5A8W A;  1X4A A;  3NCP A;  2W4C A;  3C6U A;  4DR6 J;  4ED0 A;  4B3M J;  2BOP A;  1T0T V;  4PAA A;  2J6S A;  3NMR A;  1SV5 A;  4K4T A;  2BQ3 A;  1JWW A;  2CFX A;  1R7I A;  4E2F B;  2KT2 A;  4CO5 A;  1VCT A;  2QC3 A;  1RT7 B;  2BAN B;  3H8Y A;  2YNG B;  4PQU B;  1IKV B;  2ASJ A;  3C16 A;  5ETV A;  2CVI A;  1TEL A;  1KVJ A;  1S1V A;  4NE9 C;  4P71 A;  3S6E A;  3NAI A;  5IM0 B;  2LQ8 A;  4NLD A;  3GLJ A;  4GKJ J;  1X9S A;  1S9F A;  1F5A A;  4X84 A;  3IMQ J;  5J2M B;  2CKW A;  4RX6 A;  2F63 A;  2DCU B;  2Y1R I;  1XWL A;  4E8U A;  3LPY A;  2VG5 B;  3QJP A;  1NJY A;  3G6X A;  4FNH A;  1X7V A;  5T14 A;  4CIO A;  2R7S A;  2ZE2 A;  4ZMM A;  4QR0 A;  1SVD A;  1R89 A;  4HHU A;  2JLE A;  4R5P A;  1RHQ B;  2CRL A;  2N4C A;  2W2M P;  3QJL A;  1NJW A;  1S1W B;  4A8X A;  2V2K A;  2JDJ A;  5A0Y B;  4QR1 A;  1RTI A;  3ONQ A;  2UXC J;  2ZZM A;  2PMZ D;  5L1J A;  1ZYQ A;  3OJU A;  1N34 F;  3MEC B;  4GO7 X;  3TAP A;  3VQT A;  1JMT A;  3FDS A;  1ITP A;  2FVS A;  1N56 A;  3KLF A;  2HGM A;  5DGA A;  4U8Y A;  4WE1 A;  3W64 A;  1UJ5 A;  1C1B B;  2HQC A;  3VAH A;  3VR1 A;  3AOA A;  1FFG B;  2BJD A;  1FJG J;  1JX4 A;  2XS7 A;  4LRC A;  5G4D A;  2MQO A;  3UD4 P;  1NK0 A;  2ILZ A;  2GC8 A;  3ENV A;  4TU7 A;  2CJQ A;  4JI5 J;  4A8K A;  3VGT A;  2V4Q A;  3IP0 A;  4NI2 B;  1RZM A;  3CCT A;  4DV5 J;  1WEZ A;  3F0N A;  4K7Q A;  3OTO F;  2PSZ A;  2VQE F;  2D69 A;  4HT5 A;  4G1P A;  3W5Y A;  3IC1 A;  1VQ5 S;  4XAK A;  1HBU A;  2ERR A;  2OSQ A;  3JSM A;  2HIY A;  4H54 A;  2IPO B;  2C3Y A;  2VBX A;  3UDE A;  3ZZ0 A;  3M30 B;  2UU9 J;  1NZ8 A;  1KR4 A;  2R7X A;  4F67 A;  2LLZ A;  2GIR A;  4ZVH A;  3BR8 A;  5D4L A;  3PIO Q;  1HQ2 A;  4Q44 A;  3DU5 A;  1UW4 A;  3D3C J;  4IG0 B;  2CZ4 A;  3MPD A;  4CLL A;  2DR8 A;  2XCP A;  2VFR A;  4DPX A;  1PYS B;  1FRX A;  1QAJ A;  4HHH A;  2OGU A;  4M5H A;  5LMU J;  1EP4 A;  1T95 A;  3FBB A;  4TNO A;  1FT8 A;  2NYH A;  4HTJ A;  1M5S A;  2EFN A;  3HFV A;  1FVQ A;  1OJ4 A;  2OMO A;  1UEV A;  2A18 A;  5FD1 A;  1PIL A;  2J9D E;  4EU0 A;  2MQ8 A;  1K1Q A;  4F4W A;  4DN0 A;  2VG5 A;  4ZLP A;  2I38 A;  4JI2 J;  3M32 A;  3DC2 A;  1NLK L;  4NCA A;  2Q6C A;  2MKI A;  2A0F B;  4LFC F;  1LXJ A;  1KC8 T;  2RRN A;  4HI2 A;  1MN7 A;  3M2V B;  3MCN A;  2ZD1 B;  3FMW A;  4TQS A;  3OFE A;  5AXN A;  1QUV A;  5T7L B;  4PYD A;  2G2Z A;  3DLK A;  4QR2 A;  3BSO A;  3VZH A;  2CG4 A;  2YX4 A;  4DV3 F;  3OSP A;  3PG9 A;  3LWM A;  3CCW A;  2BE2 A;  4DZ6 A;  3VAK A;  4YR0 A;  4B3S J;  3EDQ B;  1N0U A;  4AT1 B;  2FGO A;  5F8I A;  5E33 A;  3NNH A;  2LXU A;  3M2U B;  5KFT A;  9ATC B;  1IN0 A;  1VQP S;  1J5E F;  3DHX A;  3B82 A;  4ILM A;  1XR5 A;  5F41 A;  5T41 A;  4FXV A;  4IOC Q;  4PXE A;  3ISZ A;  2JWN A;  2EXU A;  3DKD A;  3I4P A;  3TAM B;  2ATC B;  3UN5 A;  1VQN S;  4C8Y A;  3OTD A;  2EK6 A;  2AIR B;  3M4X A;  3TA1 A;  3D28 A;  3OHA A;  2J0S D;  3N9U C;  2EG2 A;  3FBF A;  3PR4 A;  2CVE A;  2X1G A;  2RD5 C;  3X1L B;  5ETK A;  1LOU A;  1UPM B;  3PW7 A;  5CH7 B;  2MKH A;  2BDP A;  1HNV B;  3KYL A;  4ZK7 M;  5L1L A;  4ZN3 A;  2QFJ A;  3H5X A;  1OY8 A;  4KHP F;  5CYJ A;  2W4P A;  1TKD A;  4O4G B;  2DRB A;  3NXZ A;  4UT4 A;  4F2R A;  1JKH A;  3IG1 B;  5L39 A;  2HFO A;  1CJK B;  4ZVU B;  3FRY A;  4RZR A;  3M9O B;  2AEF A;  4ZA1 A;  2C3O A;  1S9E A;  3GSI A;  8ATC B;  3HT0 A;  1SH2 A;  5F8J A;  5C24 B;  3A4T A;  4YEA A;  1U1P A;  4PWD A;  1DZ5 A;  2JFD A;  1OSD A;  1TR0 A;  1NPP A;  5AJ3 J;  2VQF J;  4IG0 A;  1YRX A;  4ED3 A;  3Q8Q B;  3ICL A;  1ZZF A;  2OPQ B;  4G1I A;  1NKC A;  2XLJ A;  1RHK B;  2KHC A;  2OLW A;  4MFB A;  2W7A A;  1NH8 A;  3BGU A;  2R8H A;  1RUS A;  4AUK A;  5HSP A;  5LSL A;  4FYX B;  2ZH1 A;  3VGS A;  5B08 A;  1HKA A;  3KDN A;  1MN9 A;  2B6A B;  2HVE A;  3MEG B;  3M2R A;  4P7T A;  4ZS6 A;  1SJ4 P;  2W7O A;  2ZWO A;  3GSD A;  2ZC3 A;  2XWY A;  3DOK A;  3NCQ A;  1DUR A;  3ENW A;  2K2P A;  2HUR A;  1N88 A;  3RRK A;  1FDN A;  4YUD A;  1P1L A;  1RK8 A;  4I2P B;  1CS4 B;  3VZI A;  1Q95 G;  4MIB A;  3KNG A;  3NGR A;  2X1B A;  1CSJ A;  4DR7 F;  5T7L A;  2XUL A;  1YRU A;  2HBQ B;  3ZZR A;  5GAD I;  1EET B;  2G0I A;  2RDJ A;  3W5Z A;  5LT5 A;  3AXM A;  2BZ2 A;  2OPR A;  4NMX A;  1U1K A;  2P2C B;  1F3V A;  5L9N A;  1RT1 A;  2XWX A;  3EIC A;  2XNQ A;  2UUC F;  4USU A;  5GAG I;  1Q5V A;  4IH5 A;  3E3X A;  3QMQ A;  2Z57 B;  3OQ2 A;  1T9V A;  3PW4 A;  1MML A;  1HWJ A;  2YH0 A;  1R8P A;  5F9N A;  5DDP C;  4DOZ A;  4ZPT R;  4ANE A;  1N33 J;  2QA4 G;  3CME S;  3I0S A;  5J2N A;  4IRC A;  2ZKU A;  5L1I A;  3TAM A;  4DR1 F;  1WHV A;  3ETO A;  5KFS A;  3BR9 A;  4FS1 A;  3NWG A;  2OAU A;  2QL9 B;  4TYB A;  4OYA A;  2HWT A;  1FXD A;  4KTQ A;  4AQY J;  1RCX B;  3E01 A;  2N3L A;  1IKY B;  4ZCI A;  3CJ3 A;  2OPS A;  1HNZ F;  4DN9 A;  1WUU A;  3TX0 A;  3CJ8 A;  1NK8 A;  5FJ4 A;  3RU0 A;  4L3N A;  2AYG A;  5THW A;  2W2N P;  2VL1 A;  1CC8 A;  4DR6 F;  4B3M F;  2RRA A;  5D0E A;  2R8G A;  8AT1 B;  5JVG Q;  4F50 A;  3PDN A;  3NS6 A;  4P74 A;  4IFV A;  2F40 A;  5KFA A;  5DLG A;  2KFN A;  3ZNJ 1;  1UWB B;  1RAD B;  4ZCK A;  3CCQ S;  2L9D A;  2LQJ A;  1FDD A;  2IVY A;  1Y10 A;  3W9J A;  5KFY A;  2XY7 A;  4USM A;  1WC6 A;  3CCM S;  3C15 B;  1R27 B;  4N8N A;  2EPI A;  1XTZ A;  3G96 A;  4HT7 A;  3FEZ A;  3F44 A;  2BR0 A;  1TK8 A;  4I7F B;  7FDR A;  3CJ0 A;  2V63 A;  4WII A;  1AW0 A;  5A2Q U;  4GKJ F;  2ASY A;  3GV8 B;  3VVT A;  1JLG B;  3W2V A;  1FWL A;  4YY3 J;  1C0T B;  2ZHB A;  3K17 A;  5C42 B;  3SQG B;  1JLB A;  3DLG A;  1TL4 A;  3QSI A;  2QX0 A;  3LA0 A;  3T1A A;  1I94 F;  3IFE A;  2MQQ A;  4HL9 A;  3ZC4 A;  3P8B B;  4QWB A;  2OPP B;  2JH3 A;  2J9C A;  3HVT A;  3TZW A;  3W66 A;  2QSF A;  2UXC F;  3AOD A;  1UFL A;  2XMT A;  3FCW A;  1H74 A;  1T9U A;  5D6G A;  4YHH J;  2GW8 A;  3N4W A;  2HFZ A;  5IS2 A;  2R4F A;  1D8Z A;  1Y3K A;  2XI3 A;  1U1M A;  3MTJ A;  2MST A;  1W7W A;  4NYZ A;  5KT4 A;  1MMD A;  1VQS A;  2KDO A;  3C6T A;  1EAR A;  1FJG F;  1U6F A;  4CZC A;  4ITS A;  4DSE A;  1KRP A;  4JI5 F;  1VQ7 S;  4QIV A;  1A7G E;  2HMI A;  4DV5 F;  4F8R A;  2HQD A;  1HBN B;  5J1N A;  1D3W A;  3BKF A;  1R8B A;  1NJZ A;  5ETP A;  2U2F A;  3TVZ A;  4YP3 A;  4UW2 A;  4Y6I A;  5LL6 d;  2RH3 A;  4DUY J;  1XMO J;  4RW9 A;  1WEL A;  1KLM B;  2GAH C;  4LT6 A;  2LEB A;  1OPZ A;  1NEE A;  2WZ1 A;  2UU9 F;  4DPW A;  4F36 A;  4F3Q A;  4J37 A;  4KC5 A;  3MR5 A;  5KFZ A;  2HZC A;  1WOR A;  4DL7 A;  4EYH B;  3OW2 R;  1PGZ A;  5DDQ C;  2GQC A;  5I4M A;  4B9N A;  4RLE A;  4DV1 J;  4TU8 A;  3BQ1 A;  1Q82 T;  1JLF A;  2E5G A;  3QLH B;  1S0M A;  4Y2I A;  1R0B G;  2DR6 A;  3KG0 A;  1U26 A;  2LQ5 A;  2HLU A;  1NPR A;  2DB1 A;  1ZA1 B;  4DPU A;  2DNZ A;  5E3R A;  5LMU F;  4D3G A;  1D9A A;  4MH8 A;  1AYE A;  3LTO A;  3ENQ A;  4K0K J;  1PYO B;  2ACY A;  3SFU A;  4BBY A;  1NK9 A;  2GML A;  5K14 A;  4PCQ A;  3I82 A;  2Y1L B;  4DL2 A;  5HLF B;  1Z2Z A;  5B0F A;  3QQC D;  3RR8 A;  1IR1 A;  3MPU B;  3J7Y I;  1T03 A;  4IOB A;  1NSQ A;  1WKJ A;  4Z37 A;  5DZ7 A;  1AZS B;  4WWS A;  1Z1Z A;  3BGR A;  5MAO A;  2Q6B A;  2LU2 A;  3WIU A;  1IVZ A;  2M4M A;  3CED A;  4JI2 F;  1NB7 A;  1HPZ A;  5IT9 Y;  1Y00 A;  1JLA A;  4C48 A;  3PYE A;  4OHX A;  2BM1 A;  3ISN D;  4QZV B;  3THT A;  3FCH A;  1RT5 A;  1URN A;  3QGH A;  1U0H B;  1ZA2 B;  1UZD A;  5HAT A;  4J7C A;  1HD0 A;  2VBZ A;  3JS9 A;  2ZJP Q;  1SL1 A;  4RJV A;  4QWC A;  1VS3 A;  1VMB A;  2E1A A;  2QSW A;  4N7T A;  5JXS A;  1YI2 S;  3DI6 A;  2GMJ A;  3HHL C;  4NOH A;  4B3S F;  4QPT A;  1FE4 A;  2GZO A;  1ZZN A;  2OD6 A;  2V2V A;  5KFD A;  2E5H A;  4PZV A;  3K57 A;  2RUG A;  2J76 E;  1CJU B;  1VQO S;  2VJU A;  2D41 A;  3TAQ A;  2W8K A;  1KHV A;  3GIJ A;  2C3M A;  4TY9 A;  4QIE A;  1EIY B;  1N8R T;  3CJT A;  1UEK A;  4MAK A;  4WFN Q;  4C0B A;  1X5O A;  2DNP A;  3CIM A;  4IFY B;  2FD2 A;  2DHA A;  1HI8 A;  3K5O A;  2BXJ A;  2MLZ A;  1EQM A;  2WBR A;  3NEK A;  2AGP A;  1XBW A;  4FZV A;  3MM5 A;  4OX9 J;  5HQ8 A;  1RAI B;  4HH1 A;  4MYU A;  4O3N A;  1GK8 A;  3AFG A;  3DGP B;  2V69 A;  1GX5 A;  1BWE A;  1KQG B;  3P96 A;  4RNH A;  2CDR B;  3LAK A;  3VTI A;  2W9B B;  4MKA A;  1TFY A;  4WYW A;  1BQM A;  5DLF A;  1M5O C;  4KGM A;  4ZVP B;  1NO8 A;  2W25 A;  1GXT A;  4F3M A;  2QT7 A;  1FDB A;  4R8U A;  3CCR S;  5AJ3 F;  3PJ9 A;  2YX1 A;  2V4J B;  3BRE A;  1GTH A;  5D0R A;  1FX4 A;  3QLH A;  3NS5 A;  4FPR A;  4UOH A;  3C66 A;  2UVW A;  3CT9 A;  1RT4 A;  2GIF A;  3HUL A;  3HFK A;  2OUG A;  4LIW A;  4IDK B;  2P6S A;  3TRG A;  4P9S A;  1HWU A;  2AJ0 A;  1VQL S;  3QNW B;  2Z2L A;  4K2J A;  3BSC A;  4K4V A;  3PZP A;  1T94 A;  1L3V A;  3MMC A;  3GIL A;  2IM0 A;  4P72 A;  1GQE A;  4GRS A;  2BYC A;  4Y2C A;  1AZS A;  3RAQ A;  1D8Y A;  5IV4 A;  1UVI A;  4KH0 B;  3VAF A;  4Q0B A;  1X4H A;  2WB1 D;  5DGB A;  1RAE B;  2AJF E;  3NY0 A;  1U4B A;  2GA7 A;  4D3H A;  5DG9 A;  3AOB A;  5HMZ A;  4BWJ A;  3HD1 A;  1S57 A;  2HHP A;  2RQK A;  3Q0A A;  4KKO A;  2UZA A;  3RB3 A;  1QTM A;  3TJ9 A;  2RAQ A;  2HPU A;  2PD1 A;  1N6Q B;  1FTC A;  3MMB B;  3OFH A;  1VRU A;  2MGZ B;  4PG4 A;  1ZAX A;  2P9E A;  2HK2 A;  2OI2 A;  3KOA A;  4KHR A;  3TWZ A;  4KGZ B;  1BQN A;  3FRZ A;  1IJE B;  1VBK A;  2EBE A;  1S0O A;  4EBC A;  1RKJ A;  1N33 F;  3ZZU A;  3CMQ A;  2FLP A;  2I8E A;  4QOT A;  2U1A A;  2J8S A;  3O8W A;  4MK9 A;  4B9M A;  4ZOS A;  4B3R J;  4IFY A;  2DO4 A;  5IT4 A;  1K73 T;  4CH0 S;  2HVH A;  4CTA A;  4F02 A;  4AQY F;  1LW0 A;  2HEK A;  4O3Q A;  2XSF A;  1P8G A;  1K0V A;  3W60 A;  4ECT A;  3BN7 A;  2HFU A;  3S7R A;  2HQF A;  1KDN A;  3D1Q A;  1U24 A;  2L9N A;  2GX8 A;  2E7X A;  1YJU A;  3UCG A;  1WDD A;  4RU9 A;  2C22 A;  4CLW A;  2YH1 A;  4OZ2 A;  3NMA A;  5DO2 A;  4XK8 C;  1DTT B;  2YPY A;  3N01 A;  2BQR A;  3KTQ A;  3OR1 A;  4I69 A;  3BKT A;  1N5S A;  3P4U B;  4WFY A;  2RS8 A;  5D77 A;  5D3G B;  3GYG A;  3SI8 A;  2JJ4 D;  3W1Y C;  4DR3 J;  1N0V C;  4MYT A;  1VOM A;  3A8K A;  1B64 A;  1WTF A;  1GT8 A;  5ETN A;  1JJ2 R;  1I51 B;  1TK0 A;  1Q78 A;  4WYL A;  2ZDO A;  2RQM A;  4YY3 F;  1S1T B;  4QIF A;  2GHP A;  2J7U A;  2X1F A;  3N6M A;  2NSC A;  4KGK A;  3GJQ B;  4CQ1 A;  1V3S A;  1O5J A;  3D68 A;  4XDD A;  4I0W A;  5KFN A;  4PYA A;  3M8Q B;  1RT3 B;  1WF0 A;  1DRZ A;  4N76 A;  1N54 B;  3HLU A;  4ZCL A;  2N3O A;  3OV7 A;  3DM2 B;  3PX4 A;  2JFK A;  3PO5 A;  1IBK J;  4A48 A;  2MQP A;  3HJF A;  3FZB A;  2DRD A;  3UDV A;  4OLO A;  1R0C B;  3KJQ B;  1H0H B;  2VFS A;  3A3O B;  2QL7 B;  3D67 A;  3CNQ P;  4J9Q A;  2DXF A;  3TUP A;  2UP1 A;  4EBE A;  3MM6 B;  3MPY A;  1QAX A;  1WDT A;  5DRK A;  1HWI A;  2IMW P;  4U8V A;  4NZ0 A;  3SBM A;  1GMW A;  2MXY A;  3VGU A;  2CYY A;  4FBT A;  3H5Y A;  1WEX A;  4Q43 A;  1LWE B;  4NZ7 A;  3EGZ A;  2LCW A;  5DQI A;  2AYE A;  5I3P A;  2YTC A;  2B9E A;  1VQM S;  3QRQ A;  2G1H A;  2E1C A;  1H72 C;  3W3S A;  2HAI A;  1VYA A;  1CUL B;  2M3D A;  4RW6 A;  5HN0 A;  3DU6 A;  2OEM A;  1WC4 A;  2G0C A;  2IYG A;  4DUY F;  2QMW A;  1XMO F;  1LK5 A;  3CDW A;  3FGV A;  1UVK A;  5DG8 A;  1S6Q B;  4WFX A;  2PEH A;  4MJK A;  2XEX A;  4RNO A;  4FVM A;  2CWX A;  3OFG A;  4U7U D;  1LFW A;  1K0T A;  3R7S B;  2YKM A;  2ZH7 A;  2QE5 A;  2VPZ B;  3N0V A;  4F7V A;  1S6P B;  3QT7 A;  4DV1 F;  2BRK A;  2K3K A;  2AEM A;  1OY6 A;  3Q8U A;  1BXN A;  4PRF A;  3ZZZ A;  1ICE B;  1RSC A;  4H4O B;  2R7U A;  4W90 B;  3NP5 A;  2UV8 A;  1AUS L;  4KRW A;  2K8G A;  3OR2 A;  2E1R A;  2VBY A;  3EJM A;  2WVF A;  2CQ0 A;  2VIH A;  4JI7 J;  1RQ0 A;  1H6K X;  3BSN A;  4DL6 A;  1R3N A;  4QJV A;  2RIL A;  2HRT A;  2DH8 A;  2VIC A;  3C8Y A;  2W7P A;  5HQL A;  5DQG A;  2DH7 A;  3CCJ S;  4L72 B;  2DT9 A;  4CLU A;  1SQG A;  3W5X A;  3KHL A;  3G2X A;  3PYF A;  2XMA A;  2LVW A;  1SQE A;  1UTA A;  4M5L A;  5HRO B;  5LJ5 Y;  1KQF B;  1S5Z A;  1WHY A;  1FES A;  2MKC A;  2XYG B;  3S1T A;  2DNM A;  3T6J A;  1C4C A;  3LUY A;  3HVR A;  4DG1 A;  2HNY A;  3KK3 B;  3NGT A;  4ZHR B;  2ZH4 A;  1FO1 A;  1GX6 A;  1JLQ B;  2UVU A;  1ROF A;  3I9V 9;  4DF4 A;  4JI6 J;  1MRO A;  4K2X A;  3W7B A;  5A8R B;  2VU5 A;  3GYX B;  1J2V A;  5KFX A;  5GAE I;  4J9R A;  1RT6 B;  3CJR A;  3ZO7 A;  1V5I B;  3GIK A;  1RKI A;  2VV5 A;  4ICL A;  2BUN A;  4BDP A;  3HHD A;  4J9N A;  2C2M B;  4H4M A;  2DKO B;  2VOP A;  4NYP A;  4KFB A;  5LXR A;  5EWG A;  4WIQ A;  1F0X A;  3Q8R B;  2J5A A;  2R2T A;  3CD6 S;  2IFX A;  3PM9 A;  1U2R A;  1LWE A;  3D1O A;  4KIA A;  1Q7L B;  2BKN A;  1NKE A;  1RU1 A;  4HEA 9;  5KG7 A;  2VH7 A;  1NRK A;  3W2W A;  3Q24 A;  3V5R A;  3G82 B;  3KLG A;  3MUM P;  1UET A;  2PC6 A;  4CM2 A;  1CUL A;  2ZBP A;  1H38 A;  1BGX T;  3FK4 A;  3ILO A;  1PC5 A;  2EI5 A;  2DHH A;  3A12 A;  4OX9 F;  3OL9 A;  3SMZ A;  1REV B;  4I4B A;  3V4I A;  4NML A;  2R3V A;  5HVF A;  4F2S A;  2RNE A;  4ECR A;  5MLC V;  5HP1 A;  1C4A A;  3DRP B;  3GZ7 A;  2BJE A;  3WHI A;  3MM7 B;  1EB0 A;  3KLH A;  4LF1 A;  1T9X A;  2YKN B;  3H5U A;  2DO0 A;  1XMQ J;  5ETQ A;  3HDS A;  3U1L A;  4ZVE A;  2BOA A;  3DDK A;  4FYY B;  3TX8 A;  4B9U A;  3CDA A;  3MOJ B;  3L7O A;  4LQ3 A;  1K9M T;  2E7W A;  5KT2 A;  3C2P A;  4QQB A;  2R2U A;  2XGQ A;  2VON A;  2JEG A;  1T02 A;  5HO4 A;  4OV6 A;  3Q8V A;  3KG1 A;  2B43 A;  1HI1 A;  1HBM B;  3OTC A;  3S01 A;  4X65 J;  2VG6 A;  4YQW A;  2I5J B;  3LP0 A;  4V1A k;  3T6B A;  5KT6 A;  5M2P A;  1I3O B;  1G2E A;  1HD1 A;  1JLC A;  2KM8 B;  3MM8 A;  1N5Q A;  3NKY A;  4YR3 A;  3IO1 A;  1NDL A;  1T05 A;  4U7U K;  5CXT A;  4NEZ A;  4J5O A;  4ECX A;  1SIW B;  2DTJ A;  3DLJ A;  4FF3 A;  3AH6 A;  3QRR A;  4RR5 A;  3D2W A;  2XYP B;  2DNQ A;  3KMS A;  2AJ2 A;  5DS7 A;  2FVP A;  4X62 J;  3SCL E;  2VFV A;  1S1U B;  4PWW A;  5E2Q A;  5DQH A;  2E1P A;  5FLX Y;  3TA0 A;  2JX2 A;  3G6Y A;  3KK3 A;  3HM9 A;  2J7K A;  2KRB A;  3I0R B;  4PQA A;  2AW0 A;  1ZH5 A;  4EUV A;  4B02 A;  3CJQ A;  2LQ9 A;  1UCN A;  4I67 A;  3NG8 A;  3ET6 A;  2Y8W A;  4LF7 J;  3PY8 A;  3M8P B;  2G2Y A;  3O3L A;  2RS2 A;  3A8I A;  3TJ8 A;  1RA6 A;  4MIW A;  3KLI B;  3TOQ A;  3RBE A;  5AT1 B;  3FEY B;  3POT B;  2V8H A;  3JTP A;  4LR8 A;  2WTF A;  1H3D A;  1SB6 A;  1JXV A;  4IOA Q;  4ZVS B;  4RUB A;  1FRH A;  4ID8 A;  2FIU A;  3CXC R;  3QYY A;  3UWT A;  5KTQ A;  3KK1 A;  4JI4 J;  4HAC A;  2E5L J;  4B3R F;  2M0G B;  5J2Q B;  1K8A T;  4EI2 A;  3G82 A;  4LSL B;  4OJ1 A;  1S9G A;  4PG5 A;  2YWF A;  2E1M C;  4OJ3 A;  3M6U A;  1NAQ A;  2B9Y A;  2FPH X;  3QPI A;  1DY3 A;  2IDL A;  5D4P A;  4BCA A;  3EXY A;  2WSC C;  1QAY A;  2HK3 A;  2AJ4 A;  4HDG A;  1KSP A;  2LDI A;  3DYA A;  5DDO C;  3NRB A;  4HDH A;  4M95 A;  4Y2K A;  5L1K A;  2RSQ A;  4B3O A;  1Q8I A;  3DRP A;  4MKY A;  5D0H A;  2H48 B;  1IXK A;  1YJW S;  1F1B B;  2VPX B;  2IJF A;  2IRU A;  2AGO A;  1FNM A;  4DR3 F;  3E8O A;  1SJQ A;  3GB0 A;  3FUY A;  1LV5 A;  3MED B;  4WU2 A;  3J81 j;  2H51 B;  4CWB A;  2ZH8 A;  4O44 A;  4Y00 A;  2DIT A;  3ITH B; 
#chains in the Genus database with same CATH homology
 2Z57 B;  3SQO P;  1R6V A;  2E1P A;  3A3P B;  2W2Q P;  2ZWP A;  3T41 A;  4NMX A;  1SPB P;  2Z56 B;  2W2M P;  3GCW P;  3A3O B;  2QTW A;  2Z2Y B;  2ZWO A;  3CO0 P;  4K8R A;  2XTJ P;  3CNQ P;  3GCX P;  3VHQ A;  2Z58 B;  2PMW A;  3WIU A;  3AFG A;  3P5B P;  1ITP A;  4NE9 C;  3WHI A;  3BPS P;  4YN3 B;  2Z30 B;  1SCJ B;  2W2N P;  2W2O P;  3A3N B;  3H42 A;  3WIV A;  3VV2 B;  2Z2Z A;  4JP8 A;  2W2P P;  1V5I B;  3QFH A;  4OV6 A;  3BGO P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...