3H42A

Crystal structure of pcsk9 in complex with fab from ldlr competitive antibody
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
b'TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title From the Cover: A proprotein convertase subtilisin/kexin type 9 neutralizing antibody reduces serum cholesterol in mice and nonhuman primates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 21
structure length 92
sequence length 92
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3h42A01
2Z58B 2W2NP 1SCJB 3BGOP 3CO0P 4K8RA 3WIVA 2W2OP 2W2PP 3A3PB 1ITPA 2Z30B 3VHQA 2Z2YB 3WHIA 2W2MP 4OV6A 2XTJP 3QFHA 2Z2ZA 2ZWOA 1V5IB 3GCWP 4NMXA 1R6VA 2W2QP 4YN3B 4JP8A 3AFGA 3T41A 4NE9C 3GCXP 3VV2B 2QTWA 2PMWA 3A3NB 3SQOP 3P5BP 2Z57B 3BPSP 2Z56B 3H42A 2E1PA 3WIUA 3CNQP 2ZWPA 3A3OB 1SPBP
chains in the Genus database with same CATH superfamily
3DDIA 3E51A 2W2PP 2CVEA 2XY7A 4JI6J 2GV1A 4MYTA 4TY8B 3EX7B 1FKAF 1X7VA 1XTZA 5CYJA 2Y0SD 3MM9A 3SCIE 1S1WB 3CJ2A 1CJVB 1TL3A 1SQFA 1HNVA 3UN5A 1NK0A 2IRXA 2V4JB 4ZPBA 5KFLA 1PKUA 2XTJP 2IMOA 3M6UA 2KG0A 5LXYA 2FZKB 4OJ1A 1S97A 5L1KA 5HMYA 3TX8A 3OT9A 3BGUA 2DEIA 2V63A 3FQLA 1KLNA 2DHSA 2DNQA 1HYSB 3PXGa 4BWMA 1EARA 5IQQA 9ATCB 1HBMA 4ANCA 5CABA 2ZBRA 1G7CB 1RCXB 1N56A 1NSPA 3CCVS 4DR1J 4U7UD 3IRXB 4DFMA 2RDDA 3MZIA 3G8SA 4I7FA 2JRSA 4ALZA 2CJKA 4ILMA 4HTIA 1KVJA 1VMBA 2K7JA 2LXFA 1UPMB 1YRUA 1A6LA 4IYQA 4LMZA 1AFJA 1UJ5A 1M5PC 5AJ3J 1QAXA 3DC2A 2NR0A 1H7WA 4MFBB 4RU2A 2FD2A 5DQIA 1ITPA 1U1PA 3MMCA 2RSQA 2B7BB 1FA0A 3SSSA 4J37A 4OHYA 2RH3A 1N48A 2DGUA 4XPCA 4K4WA 4ELUA 1T9VA 2Y0BB 4P6QA 4J5OA 3PY8A 2ZNYA 4DV4F 3VV2B 3KNAA 2K8GA 5KFUA 1ZTWA 3MPVA 1YJRA 1SPBP 2ZHBA 3VQSA 3P4UB 2E9ZA 3S1TA 4PCQA 5KFYA 5BR8F 2BA9A 1VHFA 3IAS9 2NREA 2UUCF 3G8QA 3E01B 2E44A 1HFEL 3UR3C 3RBXA 4MTPA 3HSDA 1XIQA 4K8RA 1VRTA 2RMLA 1CBKA 3FBFA 2FHOB 4X2BA 5KG5A 4TXSA 1KEKA 1HWIA 4LREA 4LF9F 2H5JB 3K58A 1IBMJ 2QA1A 1FDBA 2ZD1B 3RRKA 2K1RB 1RAIB 2MKSA 3BDEA 5KFEA 4HYKA 3TAMA 1VBYA 4DN9A 3N79A 2XCPA 3MUMP 3R9LA 2DPIA 3MPUB 2IRUA 2KHCA 3F56A 2C3UA 3PJWA 4QYRA 2G0IA 2FJEB 2AJ1A 4L3NA 4RZRA 1HD1A 3OR1B 4X4PA 2Z56B 4ZP9A 4RR5A 1U1KA 2HQDA 2RF2A 2RILA 2ZE2B 4R0EA 3KG0A 3PTWA 1WDTA 1GX5A 2GVDB 2AYBA 5B7WA 1YJ7A 4WWSA 1H38A 2VA2A 3H40A 3D3BJ 5LMNJ 4PWDA 1IBKJ 2NXJA 1WC0A 1IJFB 2EWHA 2MJUA 2FJDB 4QQBA 4AQYF 4DSJA 5I4MA 1BQNA 3F73A 1HI1A 2P2CB 1YBTA 5KFFA 2AU0A 3DI6A 3AA8A 1RCOB 1XN9A 4EZ6A 4DR3F 3GP9A 3HHLD 3OLBA 3UR0A 1U2CA 3GIMA 2KG1A 3MUVP 1ZM2A 2OD6A 2VG7B 3MFHA 4OHZA 4UOCA 4UF4A 3M32A 3MOJB 5ETRA 3PV8A 4DR2F 1E6VA 4NMLA 5G0RA 5A8KB 1MMDA 2PGCA 5L1IA 5HMZA 3BN4A 2DY9A 3G8TA 4OYZA 4RBUA 2OEJA 4F0MA 1XNRJ 4OZ5A 3I9ZA 2EBGA 3Q2TC 5A76A 2VBYA 4JYAJ 1EZZB 2W4DA 5EX0A 5KG1A 2BOAA 1T9XA 4ZVQB 2I5JB 4RW6A 4ZOSA 1VQKS 4WK1A 1SH2A 4KFBA 4E2FB 4JI4J 1BLUA 2RT3A 3EXCX 1OO0B 3UNYA 1LXJA 2BXJA 1TFWA 3J7Z5 5F9LA 5CCMA 1B7YB 3K5MA 3QT7A 3KLVA 3QGIA 3D67A 1RP5A 2AZ3A 1RB0A 4I68A 4LQ9A 5KFNA 5KG4A 2OPQB 4TU7A 5D4OA 4NWBA 5D0HA 2G1HA 2DNMA 2OAUA 3QO9B 1NAQA 2GVZB 1CJTA 1NEEA 1XMOF 5CCLA 3BGFA 3ULHA 1X5SA 2Y8WA 3NL0A 1B7FA 4WF9Q 2MPUA 4WIQA 4DR6J 2MLYA 1MSWD 4LSNA 1M5KC 2CQDA 3KDOA 3IBWA 3DKDA 1QE1B 2QG9B 1RWXB 1U8WA 5L8RC 2C2MB 2HZAA 4USMA 3CD7A 4PXBA 4NYPA 4DOZA 3V6JA 4USKA 4BS2A 4LF4F 3E8OA 3QSYB 1RHMB 3QRRA 1LW2B 1T8EA 2KFNA 3NS5A 4DI6A 2RVJA 2ROEA 3ZTOA 5LM7E 4GVBA 4A8OA 3L7OA 2EFGA 3ZNUA 3M7VA 1RAEB 3GQCA 1NH7A 1IKYA 4KKOA 5DETA 4Q45A 4LFAF 1LW0A 5D4NA 3NBPA 1IKVA 4TN2A 3PRDA 2GCFA 3MM7A 2ZDPA 2UXDJ 4O4RA 3LP1A 1KN6A 2CQBA 3HD1A 2P6TA 4RWXA 5F8NA 4KQZA 4KHRA 2VH7A 2G4BA 2W9CA 3DGPB 1UVLA 1CPZA 3D66A 4H4MA 3EICA 5FLXU 5DG8A 2YH0A 3CT9A 4K4SA 2FHKA 4DV5J 2GX8A 2ZOFA 1QTNB 2DHAA 1IR2A 5A8RA 1S49A 4WP9A 2QO3A 3A3PB 3KK1A 3T6BA 3TYTA 1KTVA 3JSMB 2ZOGA 4DV3F 2DHGA 4Y6IA 2J0WA 4LFCJ 3HM9A 1SVDA 2GHPA 2WONB 1RBLA 5KFIA 1EETA 1WACA 1Y3KA 3UO0A 4JI8J 2PC6A 4Q2LA 1JKHA 3GU0A 3D2WA 4QJVA 2DNHA 4AFFA 2W4PA 4RUCA 4ERDA 5HROA 1VK3A 2GNKA 4PQAA 3CB4A 4USIA 1NKEA 4PXCA 3W60A 4X4RA 3S6EA 1X0FA 1NHUA 4J9OA 4IRKA 5DO2A 1HA1A 3TJ8A 1RWNB 5M2RA 2YX7A 3E2EA 2CXEA 4NXMJ 1IN0A 1RQ0A 3W2WA 1CQNA 2KXNB 3CUNA 1VQ6S 3OVBA 2BMBA 3MHYA 4CO2A 3QGHA 1TKTA 2VQEJ 2ZKUA 4LJMA 3BZQA 1TAQA 1S57A 4W92B 2RU9A 2HFSA 3H42A 1DRZA 4CLPA 3M8QA 3IA0A 3T9NA 3OTBA 2IC3A 3G9CA 1Q8IA 2QFJA 1ZTTA 3DYAA 5GAEU 3KHHA 2DYAA 3D9BA 2B5JA 3S7RA 1GX6A 4F36A 2HGLA 1S1VA 1RT7A 2CJYB 3U27A 3OHBA 1FX4A 4E0DA 5IM0A 3GYNA 4HI1A 3LO3A 4B9MA 2V5HG 2ZH8A 1FRLA 4QOTA 1REGX 4NLPA 7FDRA 3A8JA 3SFUA 3SXLA 2JVOA 1QY7A 1TL7B 4PXDA 3IXQA 3HHLA 2D9OA 2JEIA 5GAEI 2F5GA 4ID5A 2DGOA 3ITHB 2WVCA 2BKOA 2HEKA 2RKIB 3WDOA 4JI6F 3J80U 5DG7A 2QT7A 1NJXA 4M5MA 3T6JA 2V9KA 3P5BP 1UA0A 4UW2A 3I87A 2GHVC 3PYFA 4ED0A 1S10A 1B70B 3M8RA 2R7QA 5F8JA 3TW0A 4F3QA 5AXKA 3IAM9 2L3MA 2ZNZA 4FKXA 1R0AB 3J7A1 2G2OA 2B9EA 1VHIA 4OQJA 2KM8C 2KXFA 2PDAA 2DT9A 3T9ZA 1AA1B 4DX8H 4UOHA 3TVKA 3QWUA 3J80Y 2MGZA 4DL7A 5THWA 2BX6A 3OR2A 3I0RA 1NDLA 1O6XA 4USTA 1E6YB 4PXEA 3M2VB 2FGOA 1TQLA 2KYXA 5KG6A 3P6YC 3QMQA 3CJSA 2J0XA 3I4PA 2CJ9A 3RR8A 2OI2A 4G65A 1JLQA 3FCWA 4DR1F 1NPPA 1JJ4A 4OYXA 1FI4A 1EJ7L 2PIIA 2BEFA 5K20B 3MPDA 1TUGB 5EWGA 3D4JA 4ZN1A 4H54A 3PRVA 3UWTA 4M95A 2JEFA 3MUTP 3A12A 4J9KA 2UU9J 5AJ3F 1RYRA 3EVOA 2PEBA 1WOOA 3WC0A 2DPJA 1M5OC 2DO4A 3RU0A 3TZZA 1RTJA 2Y1RI 4J9PA 3EYZA 4TKTA 1Y00A 2HWIA 4RBVA 4MYUA 5IV3A 2DNLA 3NOCA 2ABYA 2XQCA 3FRZA 1SKSA 1BQXA 3IMQJ 3MMAB 5ETOA 2JOQA 1RT1B 2JC1A 1RTDB 5HBMB 1YI2S 5F8HA 7FD1A 3DM2B 4NMXA 4DUTA 2JC0A 2MKJA 2A1BA 2VBWA 4UUWA 1Q86T 2RAQA 5ADZA 3C16B 4ZVRB 3VZIA 4MK9A 3IRWP 4FF1A 1XMBA 2HNZA 2J7KA 3H5YA 5J1NA 2DXEA 4IG0A 1WF2A 3OTEA 3V4IB 1S9EA 3DCAA 4DFKA 1J2VA 5ETVA 3GR1A 4WCEQ 2O66A 3HT3A 1HMVB 3FC9A 2E9RX 2KVIA 2N82B 3C46A 3MMBA 4KB7A 1FJCA 2L48A 2DNRA 3OPKA 2HFVA 4CIOA 1IBMF 1HWKA 4F02A 1NZ8A 1LWCA 5KFVA 5MLCV 1KS2A 2OSQA 5DDOC 3VTIA 2HLUA 2VPWB 3V81B 5B0FA 1Q1KA 1TVRA 3SBMA 2B8QA 3H7HB 5KFPA 4U8YA 5SUHA 3G96A 4FYDA 1KQKA 2H48B 2YKAA 4J9UE 3R5AA 4NLWA 3BH7B 5DZ6A 2QLFB 3DHWC 4O3NA 2BANA 4NCBA 1QVGR 4CI0B 4ZLPA 2HHPA 2C3YA 3R6GB 4C8YA 3CJRA 1WHYA 3O3LA 1K9MT 4OYIA 2CAJA 5J2MA 3UVJA 4OI2A 1N5YB 2VD3A 4YP3A 5LMNF 1IBKF 3P8BB 4EBCA 4LF7J 3PACA 3CJTA 2LA4A 1OPIA 1Q5YA 2LU1A 4JI2J 3CD6S 3B4MA 1S77D 3MEGA 3MXHP 1PSDA 1EHWA 2XZTB 5C24A 4HLBA 3UE2A 2CYYA 4CLKA 1U0HB 4MKYA 4R8UA 3LP0B 3R97A 5IFMA 2D1CA 6FD1A 4RNFA 1Q8BA 3D0HE 3QIDA 4P52A 4F25A 1U48A 4NLDA 2EVZA 3DDNA 2BJDA 3QFHA 4TY8A 1YG0A 3GILA 2HAIA 4J9VA 3Q8PB 4AL5A 3DLGB 5GAHI 3KFWX 2V4JA 2MZQA 3UDVA 1J27A 4RW7B 4M5HA 1XNRF 1JXLA 3W5YA 4ZVEA 5I3UB 3GFXA 3LP2A 4QW8A 5C42A 4JYAF 2I0XA 4KH1B 4OL8A 1HWUA 3KLGA 1A0OB 1LV5A 3BO4A 2HBZB 1RT5B 4JI4F 3G6XA 2XM3A 2A6MA 2N4DA 3PJ9A 3VGUA 4I1TA 4L72B 2WSEC 1YQHA 1H98A 1XBWA 2CUYA 1HYSA 3CJKB 4NA1A 2HWHA 2IBOA 4P72A 4RJVA 2IVYA 4GRSA 1Z2ZA 2C2KB 4WK3A 3IRXA 2VB6A 4IG3B 3G87A 2AWZA 3EPGA 2RDIA 4V19J 2WSCC 2EC2A 4CDIA 4OI0A 1FFWB 2BE2A 4XIUA 1QDUB 2OLWA 1NDPA 5B0AA 2EPIA 4DR6F 2MQLA 4HI2A 1C1CB 3D28A 3I82A 4ELTA 3NS6A 4RKUC 4NI2B 1WG1A 2KYZA 2YX1A 5K8OA 3CJ5A 3H2UB 2RIJA 2VU5A 5C7PA 4QU6A 3G82B 3NP5A 2RD5C 5KG3A 1NB2A 1S6QB 5KFAA 3N0VA 1V5IB 4URQU 2IDEA 3QAUA 5KFWA 1NSKL 4P9SA 1N5TA 4KAIA 2X1GA 1FNMA 3JQMA 3ZXWA 4IR1A 5HVFA 3N01A 5KT2A 4FF2A 2UXDF 3TJAA 1FT8A 1TKXB 1I6JA 4QIEA 4V19X 2PMWA 1SC6A 3SV3A 2QLJB 2R8IA 5E3AA 4DF8A 2RUSA 3AD7C 1HNWJ 1N5SA 1U49A 5ITHA 2C2EA 1R6VA 3HF5A 4RNOA 4I69A 2NXNA 1MROB 1ZA1B 4DV5F 3OL6A 4ETXA 4J91A 2G13A 3NS7B 3R7NB 3P3DA 1X4CA 2ZD1A 3R3TA 2K1RA 2CJBA 3HO1A 2ZJQQ 1SV5B 1RU1A 1RXOB 1RJJA 5CH7B 2AD9A 2MKCA 3N28A 2UVUA 4QIVA 3IWLA 5E0OA 2RRBA 4F4WA 4LFCF 4K50A 4DPXA 2WW8A 4DCOB 1G3OA 3DRSA 1OQ6A 2HHVA 4C97A 2ZZTA 3MFIA 4JI8F 2XMVA 2RS2A 1GTEA 2R7OA 1CULB 4IH7A 3CTRA 1JJHA 4ANEA 1U1NA 3O44A 2DR9A 3OXFA 1JQGA 1VLYA 2C1EB 4PWUA 3CC2S 1S1TB 3MCSA 1K0TA 4IRDA 2B56A 3NGDA 3F41A 3GZ7A 1YK9A 2ZE2A 2GC8A 3C15A 2GVDA 4C8MA 1S1UB 3IR5B 4NPOA 1UZHA 1N88A 4ZP8A 1M90T 1N5QA 4OX9J 2F4VJ 2WTFA 4NXMF 3UN3A 1OIAA 4LSLB 1VJQA 2ZZNA 2BE7D 3WX4A 4OIXA 2VFSA 4CLWA 2VQEF 5A2QU 2HS0A 2MB0B 4UZCA 3I5AA 2OPPA 1NXIA 2MHEA 4F2RA 3BO3A 2U1AA 3TI0A 3V5RA 3QIPA 3TARA 2R7UA 4NE9C 2XGPA 2Z4PA 4DUYJ 1CQMA 3RB6A 3ISND 3CEDA 2VG7A 1FE0A 4EK2A 1KLMA 3PG9A 1VRUA 2MKKA 4KSEB 5A8KA 1HBNB 5HQ8A 4CH7A 5HO4A 3KMQA 2VG6B 2C2NA 5A2QY 4W4MA 4K4YA 2HLTA 1TL1B 1PYTA 4PPDA 1N54B 4CH0S 4CLLA 2XI2A 3SIPB 2LA6A 5CYMB 1AZSA 2AEMA 4LF8J 4QYZJ 4QR0A 1LEOA 3L7PA 1T05B 3PCOB 2GW8A 3M2RB 4DL4A 2AP6A 4WZQA 2OMLA 3EZOA 2OPQA 3FBBA 1IKWB 1NZAA 4DV7J 3EJMA 4DR7J 2DNGA 1HHQA 3RB3A 3QO9A 1GNKA 1XJWB 4OYBA 5CZXA 3SQGB 2RE1A 3V2UC 2OIHA 3DU5A 4D3HA 2MQNA 3UW1A 2E5IA 2VZ9A 2YNHA 3FKBA 3W63A 4FXDA 4ECTA 2UUWA 4QPTA 2XMAA 2Q6CA 3KJVB 1YRTA 1QE1A 1CS4B 2FJWA 2CFXA 1NJWA 2YWFA 3IM8A 3DXSX 4C3MA 3ENVA 3CXCR 4ED3A 2CKWA 3KHGA 2YTCA 3H4DA 4IKAA 3VALA 4A8XA 1RTIB 4EI2A 2V50A 1LW2A 5HSPA 1KWMA 1HNVB 2GHWA 3HK2A 1LWFB 4HDGA 3R6LB 1XQIA 4YB6A 1VCTA 2IJRA 4UY8T 1WD6A 2VUGA 2XWYA 2HYIB 1JNZB 5KFTA 2UXCJ 4J90A 4CYUB 1SL2A 4RW4B 3RUBL 2UU9F 5D78A 3Q22A 2QA4S 1M5SA 2BJ7A 2J6SA 1T0TV 1HQUB 3FEXB 3UPFA 3K5PA 2AYGA 3OVAA 2YQ1A 2LLZA 4KO0B 2IFXA 2EFPA 3OTDA 4LBPA 3ZZOA 2K2PA 5L9XA 4USUA 1FWKA 2WZ1A 3LA0A 4NZ6A 1TL5A 2RJZA 1HNXJ 4Z2XA 4IUFA 1G1XA 1WOSA 3JSMA 1K1SA 3GV7B 2FJAB 2D3UA 3D0GE 2E5HA 2R9LA 3LQVA 4C0OC 3C66A 1GQEA 1GTHA 3GIJA 1UW9A 3Q86A 1SKRA 2BBEA 2BZ2A 3CDEA 4UQGA 1WI8A 1JLAA 3WZ0A 4CTAA 1TV6A 3R5CA 1D3WA 3BREA 2P6SA 2I38A 4HHJA 2JH3A 2UUBJ 2MQOA 1MG7A 3HSZA 4EZ9A 1RWMB 5E3RA 4G1IA 4J9RA 1K44A 1VFJA 4LFBJ 4O44B 1D9AA 4ID8A 4OI3A 2SXLA 2HHSA 5KFXA 1VC5A 2QZ8A 1KR4A 5LSRA 3W8PA 1DTQB 3PRBA 1OSDA 2CPXA 4OX6A 1W2IA 2JVRA 2J6UA 3RG6A 2EEYA 1S0VA 4F3MA 2BJ9A 3EGWB 2RHQB 1VRTB 1U6FA 2DRBA 2X3GA 5L1LA 2LDIA 4GC7A 3PHTA 5B09A 1WUUA 2EKYA 1BUXA 1T03A 9RUBA 1LK5A 2GS8A 2GIFA 3BPSP 3SSQA 3THPA 5LL6d 4QWBA 4TYBA 2ASJA 5H9EJ 1OPZA 2ZC3A 2Q66A 1B0TA 2V8HA 4N47A 3TAMB 3L3CA 4LF7F 2YKMA 1PILA 2R42A 4DL0C 4JI2F 3PFEA 1LK7A 3HHKA 1X9MA 1TL7A 4G6VB 1LWEB 4ZJQA 5HVGA 3W9HA 4DV2J 1EIYB 3ITHA 2G1DA 2LQ5A 2YNFA 2H4YB 4O3QA 2F9DA 2RF2B 2RKIA 3MMJA 4XAKA 3CO9A 4E8UA 4RO0A 4QIGA 4PWDB 1Q16B 3HHEA 3OXLA 3J7YI 2F40A 3FSXA 4LQ3A 1YSJA 2DR5A 3FSIA 4M94A 1V9OA 4Y2IA 1BQNB 5FD1A 1VQSA 4P75A 1ULRA 2CQCA 3J81j 1HW8A 1R0AA 2QN6B 2KXHA 3RR7A 4DQIA 1SL1A 2B9WA 2MKIA 1U1QA 3M30B 4HL9A 2CJAA 1WG4A 2EW9A 1HD0A 2XSJA 1URNA 4KE5A 3M2VA 2FLNA 1DLOB 4PQUA 3I5CA 4ANDA 2V4RA 3M32B 2DGQA 3BSAA 4F3OA 2BVZA 3D1HA 1E6VB 1N4LA 5G0RB 3I32A 4NLYA 2E1CA 2GFFA 3HULA 1FTCA 2UUAJ 1UW4A 1WG5A 3G4SS 1U4BA 5ETTA 5EWFA 3WIUA 2VASA 2WW4A 2UVWA 4MK7A 3VCDA 2BQ3A 3Q24A 3U1MA 2DRAA 1M1KT 1FNOA 4GKKF 2LP4A 4DQPA 1V5VA 1PBAA 4A8WA 2XZDB 1ZZNA 1V6HA 2I6WA 2ZH4A 4RW6B 4U8VA 4KFBB 4NASA 1HNZJ 3QSIA 2C3PA 2KM8B 3RB4A 4ZPTR 5CD4A 3ZZUA 3PYDA 3VVUA 1UFKA 1WC3A 4YN3B 2I9SA 4RUHA 5LMUJ 1FFGB 2MY7A 5AXMA 3ZNJ1 3NXZA 2FIUA 1QM9A 2FZGB 1DBDA 1NB7A 3KTQA 4ECZA 3D3CJ 4PRFA 1NK5A 2YBVA 2LDYA 1CJTB 3TO8A 3DOMB 4NLVA 2KVQE 3M8YA 1A9NB 4UOGA 2H4WB 1RT1A 2V2QA 2DGWA 1R3NA 2E1RA 1I94J 4B3SJ 1RTDA 1WC1A 2WB4A 2OGUA 1RAJA 4ZIWA 2DCUB 5CXTA 1UPPA 3BPDA 4NXNJ 3VAIA 3BO2A 2HBRB 2HQGA 1FXDA 1NHKL 3NGTA 1FK9B 1HNWF 1ZBTA 3BH6B 2R7SA 4UOFA 4OJGA 2W25A 4IO1A 3OLAA 3MPYA 1YJVA 3M05A 2CQ0A 1HMVA 2GJ2A 2IYIA 1L3SA 1KHWA 1X4GA 4Q7AA 5H9FJ 2V6AA 1D09B 4DF4A 4BWJA 1IKYB 1SIZA 4MIBA 4ECRA 4CLUA 2COLA 2XB2D 3AQOA 2NUUG 1IKVB 5D0GA 4Y34A 2HURA 2B9XA 4DPOA 1Q78A 4BC9A 2XS5A 2LVWA 3TUJC 1C0UA 1RDRA 2XMWA 3FNNA 3JTOA 3H2LA 1HHSA 4ZLNA 2W9CB 2HQIA 4OYOA 1Q82T 3SZ2A 3FDSA 4NL5A 4A8KA 5IT0A 3JXOA 1XR7A 4EYIB 3B4DA 2C2DA 1JLBA 1T02A 5A8RB 1F3VA 2AYMA 1N5YA 2CQ2A 4DLEA 1PYOB 3CMAS 2M9KA 3KK1B 4KTQA 2VFRA 1VK8A 4OX9F 1RBOB 2F4VF 1YDLA 3DOLB 2PFFB 1TMJA 3HKWA 1QLNA 4AXIA 2LQ8A 3KNGA 3Q8VA 4WU3A 2CZVC 1RACB 5E3CA 4U96A 1NK4A 2HHUA 4DPYA 2MLZA 2F1FA 1JKHB 5B08A 3BKFA 3A8KA 4W90B 1U0HA 3BBFA 3HX9A 3LP0A 4LT6A 4DZDA 2FB0A 2HVZA 4NLXA 3IG1A 1G4CA 1RAHB 4DUYF 2HS3A 1NK9A 3VAFA 2XY6A 2OEMA 3HI9A 4R0JA 2B0GA 2MSTA 4JB8B 3MTJA 5KT6A 1NRKA 3GG0A 3UQSA 3CMQA 4WFYA 2PSZA 1C4AA 4OZ2A 1GXUA 2IJFA 1XR6A 3FVYA 2V8VA 4X66J 4RUBA 4WXWA 3LUYA 4ZPAA 3BBCA 1S0MA 2HHTA 3CDUA 4RW7A 3HZGA 1SJQA 1R43A 2PA8D 3N6NA 3NWGA 3ELHA 2CNOB 3GJQB 1CC7A 2ZJRQ 1D0EA 2YKNB 1R7IA 4LRFA 4N8NA 2IC3B 5HLFA 4LF8F 2KU7A 1AT1B 3KDNA 3MOZA 2K7KA 2QEXS 1Q8LA 2DITA 3CJKA 4NLUA 2B5JB 3ZZZA 3CMES 2ZVSA 1DTTB 1ZAWA 1IR0A 1B4SA 5IQ6A 1YJUA 3DFEA 3K7RA 1FRMA 4OHXA 2C28A 4X4TA 4DV7F 1SQEA 4DR7F 1FRKA 3EVWA 5EGYA 1O8BA 3R2CJ 5F8GA 4IG3A 2CNKB 2V94A 4OI1A 2POKA 1ICEB 1YZ7A 3LW5C 3OW2R 4DCPB 2GMJA 3B54A 1WELA 3EMTA 2FTRA 2K3IA 4NA2A 1C1CA 1M5VC 2D7SA 4ZVTB 3L4BC 2HFUA 1D8YA 3BSNA 1U26A 3W8GA 1RTZA 1Q4RA 3MPWA 1NH8A 2ZH6A 3G82A 2YH1A 4Y3CA 3AY0A 1S6QA 4NRTA 2GAHC 2QMXA 3KHRA 3LF0A 4PAAA 3J81U 3OFGA 4ZP6A 2KI2A 1PJ5A 3T5LA 3K0JA 1LXNA 2RRAA 1B3TA 3UCUP 2UXCF 4TQSA 4KR0B 3P45B 2HSEB 2CPDA 1HWLA 1HR0J 2MGZB 3AJDA 3B82A 2K06A 3OR2B 3I0RB 2N7YA 3T41A 1FKOB 2FLPA 2W9BB 1N6QA 2E7VA 2H54B 1VBXA 1BY9A 4LR9A 2MY8A 5DGAA 1U1MA 1RLDA 4ZLJA 2V8DA 2HVHA 3I96A 5EWEA 4K4UA 3J81Y 1JIHA 2E1AA 3Q23A 4FVCA 2HRUA 1SJ3P 4AE5A 4B3OB 4ECQA 2XHCA 1DZ5A 3ENAA 2HW3A 1HNXF 4QWAA 1FE4A 2VIHA 2VDHA 1NM2A 2XWXA 2F63A 5HP1A 1XEZA 4CNZA 1JNRB 3MCNA 1WC5A 3EZUA 2CADA 1NBEB 3WIVA 4ZMMA 3VAGA 4ES1A 1I51B 1W26A 1S9FA 4WZMA 4RW8B 3DLEB 3FEZA 3GCWP 2DH7A 1CULA 3LGHA 2N3OA 4KHPJ 3HJFA 4FS2A 2VPZB 1WKJA 2UUBF 5G4DA 5K8NA 2MMYA 1S1TA 2R8KA 4CWBA 4FPRA 2DH9A 2NCKL 1UVIA 2WB1D 4LFBF 5E3QA 3UD4P 3AJ1A 4CCHA 2QMWA 2H3EB 4ZIVA 4O0IA 3NEKA 5KFZA 1D9FA 2DNKA 4F04B 3PHEA 2Q43A 2HNZB 3IC1A 5JVGQ 2R2SA 3T19A 1S7HA 3MEDB 1N0VC 3CCUS 3JQKA 4WP3A 1PIEA 2V9WA 1I3OB 3GB0A 1P1LA 1HBNA 3OD2A 2GQQA 2VG6A 4C8KA 2RQKA 3NNHA 3PM9A 1OWXA 5L1JA 5DS7A 3G86A 2QMUB 2GIRA 3RJMB 4LVNP 4C8OA 1FFSB 4DZ6A 3Q8RB 4FXWA 4P7VA 2BANB 1G6BA 2OKQA 2RRNA 4DV2F 2MEWA 1PYSB 3V4MA 3GONA 5D4PA 1S4FA 4CQ1A 3AODA 4MIWA 3QFWA 1CJUA 1WI6A 1TP7A 5J2MB 3UVJB 2NYIA 2CQ4A 1RISA 2ZDOA 5BJRA 1YJ9S 2IVFB 1UWBB 1WKLA 4OLPA 2EG2A 1IKWA 3CO0P 1FHTA 2KTQA 4DLGA 5IXUA 2WOMA 3TOQA 2BW7A 4K7QA 3RB0A 3H2VE 3SQGA 3L7UA 3HMJG 4E98A 1TUWA 1FF2A 5EDWA 1U6BA 5KFMA 3WHIA 2MZJA 4YDDB 4I2PB 1VLOA 2DGTA 3ILJA 1FEHA 3K89A 2FQQB 2G0JA 2MJNA 2XI3A 3HHNB 2XBPA 1WHWA 5KFSA 2PD1A 3HSGA 1L3TA 4UY85 3M8ZA 1RTIA 2GQCA 1F60B 3GTYX 4JI1J 2Q6BA 2UUAF 1RWWB 1OJ4A 3NKYA 3VAKA 4OYAA 3KG4A 1LWFA 2C2ZB 3LP2B 2X1AA 2X51A 5C42B 4CO3A 1IBLJ 3OL9A 1X4AA 5H1SV 1U02A 3D5MA 3DLJA 3KLGB 4O23A 1WHVA 4QU7A 1SJFA 1PJ6A 4CYUA 1HNZF 1DJ0A 4RW4A 1IM4A 1KSPA 2AHOB 3FK4A 2L41A 4P74A 3D54A 4ECSA 2BUNA 3PYGA 2QYCA 1HQUA 4MKVA 3MM6B 3G71S 2MSSA 3GWCA 5LMUF 1CVJA 4KO0A 1D8ZA 3M8PA 1L5UA 5LXRA 2ZUGA 4ZDNA 2DXDA 2XYPB 2BJ1A 1HHTP 3NMRA 3NGSA 1L3UA 1S6UA 1XK8A 4DR4J 5GVQA 8AT1B 4NYOA 3KLFB 4J9SA 3LWLA 3K59A 4S0MA 2BE2B 4G1QA 3MWBA 2V2ZA 3ZZRA 1I94F 1PC4A 4B3SF 4WPAA 3CDAA 1B64A 1Q7YT 4ENOA 3BGLA 1IBCB 4YOEA 3THVA 3HVRA 4WBFA 1NKBA 4NXNF 1U1OA 2MQ8A 4C8ZA 3DU6A 1FRHA 2W2OP 2VONA 1VQ7S 3OJSA 2J9DA 2OMOA 4ZVGA 5B0EA 2VA3A 1NPRA 2Q1LA 5DLFA 2V67A 2NZ4A 3D6TB 5L39A 2ACMA 2UV8A 1UL3A 3SSRA 2A2CA 4O44A 3M1VB 4OMFG 3CGIA 4CLTA 3V6DA 4JI3J 3NCRA 4WFNQ 3X1LB 1SKWA 3OFEA 5T41A 5J1EA 1KRPA 3EDQB 4LF2A 1VISA 1RSCA 2LEAA 5E5NA 2V2VA 4N77A 1DTQA 2RHSB 3QYYA 3KJQB 2V0NA 2JFDA 2EFQA 1MWQA 3LALA 2VFVA 4M5LA 3F44A 1KNZA 2MYFA 2MZTA 3DNCA 2P9EA 5RUBA 1QSSA 3ZFVA 2C42A 3W7BA 3AH6A 2AIRB 2XO6A 3GJRB 5DJBA 1DFDA 3KLEB 4KYZA 3C2PA 3KUGA 3T1AA 4IFVB 4ED2A 2M8DB 1VQYA 3C6UB 1RHJB 2AEFA 2ZH1A 5HI7A 5D3GB 1TKZB 5AT1B 3DRSB 3A4TA 4DPTA 4I67A 1C1BB 1X5TA 4WJBA 1WWHA 1LWEA 1YLXA 1S6OA 3M9NB 4HVZA 3K8VA 4HHUA 3US5A 4KJIA 4OHVA 4OZ3A 4DQRA 2GZOA 2W01A 1X9SA 2LQBA 4USWA 5AE3A 1G2EA 3C15B 3OVSA 4WP8A 2MKHA 4C6AA 2VQFJ 1KD1T 3IR7B 1PCAA 3ILOA 1Q5VA 2BRKA 2G9OA 4X66F 1FJEB 2CDQA 3CWJA 3HCXA 4L6V3 4QWEA 1RT4B 1H2VZ 4YDXA 3TQEA 4M5DB 2EC0A 1F5BA 3K2YA 1DARA 4HACB 2NSCA 2OPPB 4DQQA 4U95A 4OZ0A 4NLTA 3M30A 1V3SA 3QIPB 3I0SA 3FGVA 1J5EJ 2CPYA 3DDKA 3C6TB 3BR9A 1HI8A 1XWLA 1KLMB 2MDAA 4CNYA 1DLOA 1VRUB 4LRCA 5I3PA 1XNQJ 3RBEA 4ECYA 3OL7A 1Q7LB 1VQ4S 3PKYA 3H5SA 2HQ3A 1F2GA 5F3ZA 3IBFB 2ZVIA 3TZWA 2ACYA 2CQIA 3CDBA 4DXLA 1GK8A 1VQPS 1RK8A 3M9OB 1MNEA 4Y00A 4WTOB 3KYLA 1TMMA 1C2PA 2XULA 4FNHA 2IIHA 1UP1A 2C2OB 1HPZA 2JJ4D 2XYHB 2AGQA 3RW7A 4F8RA 1AZSB 4ZP7A 4RNHA 3K5OA 2R7TA 3QJPA 4UZBA 1Q95G 4ES2A 3MF5A 3TVYA 2NPIA 1RAOA 4ILRA 2QFIA 2LYVA 4KGKA 2QTWA 3KUHA 3A13A 2DEJA 2PT0A 1WDDA 4ECWA 4MAKA 2GIQA 2ZKTA 1JK9B 4P2FA 4PG4A 2E5GA 5D6GA 1N8RT 2HNYA 3DOMA 4PEOA 2YNHB 2J8AA 1FERA 3FEYB 1LKZA 4HR2A 4X65J 4HHHA 1KQFB 5KG2A 1HR0F 1AROP 1Y3JA 4MH8A 4Y0FA 3EE3A 4TNOA 2PMZD 1FK9A 3TX0A 2ASYA 3EGVA 4LUBA 2VODA 3JYTB 3JTNA 1D1UA 4FXVA 1YITS 4FN5A 4GMKA 2BE9B 2Y1IA 1OY8A 5GADU 1D9DA 1HW9A 4KBIA 4V1Ak 2ROGA 4X4OA 2VC0A 3OUYB 2V34A 4M5NA 4X4VA 1Y10A 3VR1A 3S8SA 3W1YC 5E7OB 4KV8B 5DRKA 3JQJA 2YQ3A 3CW2C 4A8SA 2KJWA 3HLUA 1XC9A 3GPAA 3V6KA 3QATA 4WFBQ 2PMHA 3FUYA 2VG5B 2WVFA 5GADI 4A4JA 5HQLA 4KHPF 4ZA1A 3KXDA 2XMKA 1X31C 3TWZA 1RU2A 3GJSB 4AXJA 3T5HA 4U6PA 3QZ8A 2BQRA 4ZCMA 1EAYC 2D3O1 2NS1B 3HVTB 1HLWA 3R5DA 5FIIA 1IUJA 1JLFA 3QGGA 1WTBA 1V3RA 4QBUA 2PI4A 4ED4A 3DOLA 1WF0A 2FC8A 2NPFA 3UDCA 1WF1A 2QL7B 3K5LA 1KVKA 3S01A 3Q8QB 1KTQA 1SL0A 1JLAB 1LNQA 4WXOA 1UTAA 4CTAB 1TV6B 2HKEA 1TAUA 5FLXY 2FJXA 2OH2A 4O3PA 2HQCA 4K5RA 2BACA 3CC4S 3LGMA 2VJVA 4TY9A 3UCGA 3OBIA 4ZPWR 3CJ8A 3SQOP 3R27A 1GXLA 4FPIA 4DJBA 1FWPA 2KFYA 3SDEA 1KONA 3NY0A 3ZZTA 5KFDA 5JVHQ 3NAHA 4DSLA 2R7WA 4DMZA 2QLBB 3PKMA 4Q8FA 2VJUA 4PG6A 4F2SA 2YKNA 5D8HB 2F65A 4C0BA 1LOUA 2I1RA 1S12A 2UVVA 2VPXB 1Y4ZB 6AT1B 5F8IA 2FVRA 3AB4B 4CT9A 1T03B 3PW4A 5IS2A 4EBDA 3I56S 3TEGA 5C2GA 1UZDA 1DTTA 1Y5LB 2VICA 1LWXA 4EO6A 5CD4H 1IJEB 3EUNA 2L9DA 1FESA 5E33A 5IT4A 2DO0A 2YKMB 4USHA 4XDDA 5D4LA 3PR4A 3KK3B 4B9TA 2ROPA 4XK8C 2V68A 1KQSR 2IRYA 2UXBJ 5JMNA 3GLJA 3VAMA 1VJWA 5J1PA 4FYXB 1YJTA 2YNFB 4YUDA 4OJ3A 2VHGA 2HVIA 4WYLA 1RWVB 5KFHA 2ZH5A 1WEYA 3TZYA 3IBCB 4JI1F 1RTHB 3R5GA 4WIIA 1VQLS 1ZM4A 2HZCA 4NLSA 1CJKA 1IBLF 2A18A 1FXRA 3RAXA 1OS5A 1QAIA 1NUEA 1QUPA 1JMTA 2OD4A 2YPYA 5B0BA 1VRQC 4X62J 2XSJB 1FKOA 4Y2MA 2FLOA 1GH8A 4PQUB 2W9BA 5LOQA 3BYRA 1KDNA 1CG2A 4PPZA 3MTKA 4YY3J 1HNIB 2WAQD 1VQOS 3NCQA 1IM6A 5KT5A 2G2ZA 4DR4F 3PJXA 4B3OA 5T7LA 2HK3A 4DFJA 1FVQA 2ZHAA 1SQGA 4AT1B 1GMVA 3IS9A 2WCXA 1CLFA 2YNIB 4JV5J 4QZVB 1HQEA 2H65B 4RW8A 3DLEA 5L38A 3FBEA 1S72S 4ZPCA 1PG5B 4PYAA 2BM1A 1TK5A 3SCJE 1N52B 1FDNA 2ILYA 1SUQA 5J2QB 3PX4A 2ZWOA 2VFUA 3ZZYA 4CO4A 2O67A 2R7VA 4JOUA 1Z4UA 1UVMA 4JI3F 2FZCB 3QT8A 1ZETA 4FP9A 1FJGJ 4QWDA 5BYQA 1YBAA 2WBMA 3GSIA 3ENWA 4WFZA 1L3VA 1B0PA 2U2FA 4I2QA 5L46A 3M8WA 4Y2KA 3IGVA 3MAHA 4G1PA 4HDHA 3GIIA 3MEDA 4F7VA 4U67Q 2M88A 2HWTA 3TRGA 4QYZK 1RT2A 1MLAA 4KGVB 4TVAB 2DCLA 2IM2A 2EFOA 4BHQA 1SC4B 4DS4A 3BQ1A 3M6XA 2QE5A 1RT6A 5ETSA 2I2YA 1WC4A 2AMCB 3EXYA 1C0UB 2P8IA 2KZZA 2DGVA 4ZN3A 3W2VA 4IH5A 1UEUA 4F4YA 5E2QA 3CJ0A 2B3TB 5HANA 4JI5J 2LKZA 2XLIA 2GA7A 2XS2A 5AE2A 2H1YA 5DDPC 2HZVA 1SI9A 2R2RA 4P2XA 1JLBB 4RWWA 2XMUA 1UWBA 2RS8A 2VQFF 3Q2SC 2RUGA 3H8YA 4DSKA 2R8HA 1T9UA 2AJ4A 5A0YA 1JJ2R 4NCGB 4ZVSB 3QRQA 2M0GB 2NSBA 3CCZA 3IP0A 4N56A 1GMWD 5LSLA 4ZKAA 4I2PA 1VR6A 1CSJA 2AJFE 3TUZC 3IG1B 2YY3A 1VIOA 4CT8A 4WE1B 1J5EF 2DVIA 4IQXA 3FZBA 3PIOQ 3KK2A 3M6WA 4LBHA 2XNQA 4HH1A 1XNQF 1R0BG 3GFZA 3SEOA 4DUZJ 2KHDA 3CCRS 4IDKA 2QLWA 2R7XA 4OHWA 1FEEA 3TP2A 4CM2A 2VDIA 3CJQA 1MW7A 2IAJB 4RW9B 4DCJB 2FPHX 2DTJA 2MQMA 2MLXA 3D1OA 4ED1A 1JLCB 4F4KA 2XMJA 1H74A 2OHDA 4L76A 3UD3P 3I9V9 2FVPA 3ZZ0A 1FKPA 4F50A 2UP1A 4F0KA 5HLFB 3NG8A 4BDPA 3HT0A 5FJ4A 5D77A 3NGRA 3AFGA 3M2UB 3TZXA 3DGVA 3MM6A 3T3FA 1QSYA 4LF5J 4NLOA 1WTFA 2HHHJ 1IKXA 1S9GA 5D15A 1MN7A 1VBZA 1FD8A 4LR7A 4Q0BA 3KLFA 4GKKJ 3W65A 4Q8EA 4C2MA 3BV8A 3OHAA 1F1BB 3HKZD 4IOAQ 3MEEB 3CF5Q 4IR9A 5FDLA 4X65F 4CLSA 4XPEA 1IVZA 2CRLA 3BKTA 2FDNA 2KT5A 2Z57B 4EGLA 2E1PA 1YRXA 3ETOA 4DV6J 2DHHA 2R4FA 3GR0A 3IWXA 4OYMA 4YR3A 4GKJJ 1SC1B 3AD8C 3JB9k 4FKYA 3G2XA 3AQPA 2EK1A 2FY1A 1FDDA 2BV3A 2HIQA 1VQ8S 4EWTA 4MT1A 2PFDA 2DK2A 4ZJOA 5IWAJ 2JX2A 3M1VA 3MAAB 2DNPA 3EGZA 2XMMA 4PZVA 3POTB 4PKDB 5H9EK 2JLEA 3LOUA 2LCWA 2VBXA 3QBCA 3H59A 3Q8YA 1P8GA 2OP5A 2CQ1A 3CVKA 5KFJA 1N6QB 2VV5A 4EFAC 1JXEA 2Z2YB 4MKAA 4FYVB 3P96A 3PDNA 4DL5A 4TQRA 3MD1A 2B7CB 1NLKL 2HQFA 2QL5B 2DBBA 4ZK7M 4Q5VA 3KLEA 4IRCA 4IFVA 3C6UA 2DR6A 1JX4A 1YKWA 2XNRA 5HP1B 4LRDA 4C8LA 4F67A 2PN6A 2W7AA 3MURP 5F41A 5D3GA 1TKZA 2DXFA 3QNWB 3KKFA 2DGXA 3FZ2A 1UA1A 4JI0J 2AT1B 1S0NA 1C1BA 2E66A 2YWGA 3VQTA 1X9WA 2IM0A 3LPYA 1Y9OA 2V4QA 2CWKA 2HHQA 1EP4A 4LSZB 4O3OA 3A3OB 4RL1A 1RT3B 3DLLQ 4DU7A 3AD9C 3NCPA 2YWHA 3W5ZA 1X4DA 3EDRB 5K9FA 2D69A 4M5JA 5CYQB 3CIZA 1GMUA 1NHVA 5HL7Q 2XC9A 2Z58B 1I5OB 2IM1A 5GMEA 3B8HA 1F2HA 2F3JA 4B3TJ 2V8GA 3IO1A 3H4BA 4GO5X 1FTRA 3DRRB 1RT4A 2OPSA 3CCLS 2YWKA 1SH0A 3GCXP 3KLIA 2ZBCA 1NSAA 2BJ8A 3GFHA 5KG7A 2GMLA 1WC6A 4M5DA 2DIVA 4HACA 4YS2A 1JLEA 1FX2A 4DPUA 2HFOA 5D0RA 5E41A 4EBEA 4CRJA 1X60A 3TAQA 3RBZA 2BQUA 2DD8S 3N6LA 2HK2A 3C6TA 1RHQB 2QYGA 2J9CA 4DX6A 1RHRB 3OTCA 1C4CA 2XO7A 4A8YA 2OTJS 3CJ4A 4L73A 1MMNA 1HI0P 2RQ4A 1BE4A 3LTOA 5HJYA 1OY6A 2AW0A 5KFKA 3FFIA 2B9YA 4O3SA 3W62A 1KOOA 1VS3A 1N34J 1Y7PA 2UXBF 3FMBA 1GMWA 1BWEA 3DN9A 2JLFA 2GGPA 2W7OA 5ETLA 3TA2A 4M63A 3QQCD 2ADCA 4MJKA 2J0SD 1NMEB 3M9MB 2XLJA 1CJUB 5F9NA 3OTOJ 2KT3A 2CIMA 1T7PA 2LECA 1BMQB 5ETPA 2IJNA 4JV1A 2VBZA 5IV4A 2WOMB 4K5SA 4OYPA 2W7PA 4JV0A 4UUXA 2VF3A 2ZC4A 3A3NB 3PW0A 5GMKa 5I3QA 3D6MB 3C14B 4M1KA 2BR0A 1QD1A 5EHHA 5H9FK 2J0QD 2W1BA 5C2CA 2LEPA 3RGIA 4X84A 3TNVA 2CNNB 2JEGA 2Z2ZA 1RAFB 4YMEA 2GO8A 2OEKA 4A47A 4ZPDA 3OQ2A 2WBRA 4X62F 4MK8A 4K0KJ 4FS1A 2M5YA 1K0VA 3O5TB 3GIRA 5BYRA 2ASDA 3RRGA 1UJ6A 4DPWA 3JYTA 3JS9A 3W9JA 3NRBA 4EO8A 4YY3F 3EGNA 1X5PA 1T9WA 4MIAA 2QA4G 1YJNS 3IFEA 2NXEA 4WU2A 2N7CA 2E5JA 1UJ4A 3R7BB 3OUYA 1TU0B 3ZO7A 1S7IA 1EB0A 2M70A 4KV8A 1U7LA 2PO4A 3VWSA 3RW6A 5KG0A 2G2YA 4JV5F 3LAKA 2F8EX 3AHPA 4DSEA 2VG5A 5HQMA 4DSIA 2M2BA 1UVJA 1IQTA 2ZWPA 3M8PB 2BOPA 2QRRA 1RAGB 4J9MA 1Y5IB 1WSVA 2L9WA 1RABB 2XS7A 3UNGC 4FZVA 3HVTA 4WKYA 4BBYA 1A7GE 2BW2A 4G1QB 4K4TA 4ZITA 1FWLA 1FJGF 4QIFA 2EI5A 4EYHB 1GEHA 1QTMA 4LF6J 1RADB 2HMIB 2L9NA 1RYSA 3R7SB 3EM1A 5K14A 1JJCB 2M7SA 2OO4A 1XR5A 3C3LA 3P49B 1FO1A 3IM9A 4A8QA 3D68A 5C25A 3R5JB 2BABA 4OI4A 5JJBA 1IQZA 4URGA 4RUAA 3K17A 1RZMA 4B3RJ 3NGKA 4F4ZA 2ZZMA 3NNCA 4ZCKA 3BSOA 1T94A 4KGMA 4DG1B 2H51B 3V6DB 2BRLA 1F9HA 4DN0A 2A2DA 5J1EB 3D6FB 5HJXA 2ZBIA 2XY5A 3CNQP 1VC6A 1OYDA 2VPYB 1NDCA 1HBOB 3HZEA 3PO5A 3PIPQ 3QJLA 2J7UA 3PVXA 4D3GA 3I6PA 3PW2A 1RAAB 5KOXA 5HVHA 4M8LA 1N32J 4LRBA 4N7TA 4IO9Q 4JI5F 4O4GB 2JL9A 4LIWA 3PO4A 2DR7A 3PZPA 4CM0A 4FBUA 4QCLA 1R8CA 3U02A 4OX7A 2AV5A 2ZH2A 3R8YA 4BCAA 1FXLA 4DL6A 1R0CB 5BYSA 2D41A 1M1GA 1SB6A 2IDLA 1MWZA 3KK3A 5LSOA 2MZRA 3VAHA 2ZITA 3SYZA 2B6AB 2EXUA 3MCMA 2HFNA 3ET6A 3W66A 3KLHB 3I55S 3GE9A 1UVKA 2W8LA 4HKQA 4X4QA 1U8SA 3JAMU 4ICLA 3V6HA 1IWAA 3BGRB 1DY3A 1NKCA 4H4OA 3H90A 5JUMA 2BDPA 1X4BA 2DIUA 3MR2A 3GG1A 1FRXA 3DRPB 1MWYA 1YHQS 4K4VA 1NU4A 4DUZF 2FY8A 1TKDA 3DRYA 3U1NA 3MR3A 5DM6Q 1RTHA 2YVSA 4AL6A 3JAMY 3DLKB 2R8GA 3GSDA 3T5JA 2BKNA 2E9TA 2CQGA 3ADAC 4PG5A 3MAQA 1LFPA 1U0SA 4HT5A 2M3DA 3TUPA 1FCAA 1RWPB 2W24A 3I0SB 1HIYA 8ATCB 3QLHB 2DB1A 4FF3A 8RUCA 4LF1A 1RHUB 3NOGA 4B9VA 3GV5B 1RE1B 2OPRB 1ZAVA 4G3IA 1SJRA 1KFDA 1HBUA 4LF5F 2AJ2A 3MECB 2HHHF 3N4WA 4B3MJ 1VBKA 4K2XA 1U2FA 1ACMB 1H3DA 2UV8G 1HNIA 5A8WA 1FDAA 2YPZA 3T1HJ 2R7RA 2KB2A 3MM8B 4I64A 2DNZA 3CCSS 2WK4A 2CPZA 2JSXA 3O1LA 4CO1A 4ILLA 3RBDA 1HPZB 4FYWB 1K73T 2YNIA 3L9ZA 2FJBB 4YB1P 2CQHA 4DV6F 3KJFB 3HD2A 1KQGB 2LU2A 2EBEA 1O5JA 4WKRA 4JI7J 3BSCA 4X64J 4GKJF 2OFHX 1AXQA 4A8FA 4Q2MA 3IN5A 4ER8A 4U7UK 3N5FA 3MCOA 2E7WA 2CQPA 1TTHB 4KH0B 2V69A 4F4XA 2JHEA 4ZHRA 5J2QA 5IWAF 4C11B 2IBKA 3ZTRA 2LFVA 2HNYB 3U1LA 3W64A 2HNDB 5J2NA 2BKPA 4Y65A 2DY1A 4DWIA 4L74A 3FQKA 7AT1B 4N41A 1OSCA 1R8BA 4K4XA 4ED7A 3QZ7A 2G0CA 3PR5B 4RPFA 5ETNA 2Q3PA 1V3ZA 2UVRA 1NO8A 1RHKB 4P2SA 3MR7A 4PUOB 2ALYB 1I1GA 2I8EA 2J5AA 4ED5A 5B0CA 1Q79A 2AJQA 1YX2A 2N3LA 3BYPA 2E5LJ 4R5PB 2D74B 4I6WA 1NDKA 3BR8A 4DX7A 2IHR1 5KFOA 3W5XA 5KFRA 1IR1A 4ELVA 1UWAA 5U47A 2Z0GA 5AXNA 2ATCB 1Z2LA 2OFGX 2Z30B 4KGZB 1ZOTA 1FRIA 4JI0F 1H6KX 2ZM6J 1JLGB 2F9JA 3BQ0A 4DV0J 2H9ZA 3D0IE 4GVLA 3K8WA 5GAHU 1BQMA 1Z1ZA 4I56A 5F0UA 1P27B 4I0WA 4WYWA 4FNIA 3AXMA 2N4CA 1JXVA 1X4HA 3UN2A 3KJNB 5K8PA 1JLFB 2KKHA 5DDRC 2OSRA 2R8JA 2A3JA 2PE8A 2NXUA 2GJIA 1W25A 3SMZA 1PAEX 2Y9HA 4B3TF 1OY9A 4X4SA 1S1WA 1NJIT 4NCGA 1CJVA 2O3DA 4LVOP 2YKQA 2ZFHA 1O0PA 3QJJA 1AUDA 5ETMA 3DLHA 2EFVA 2BJEA 3HHLC 1DAXA 3DOKB 4ZVOB 4WE1A 3CCMS 1RKJA 4PR6A 1X0PA 3JSYA 4YFUA 1U6ZA 2YNGB 3LWMA 4P10A 1N36J 2CZ4A 3FBCA 3ZTSA 2JFKA 3BF4A 4H4KA 2IAJA 4DX5A 4B02A 3CCJS 3SDEB 1URRA 3AAWB 1UMJA 1IWGA 1YWXA 4RW9A 5J2PB 1XERA 1TK8A 1PBUA 1CC8A 1N34F 1JLCA 2ADBA 2J9DE 2FJVA 4ZVHA 4RLEA 4HTJA 4ZPVR 1S59A 4P2MA 2ZOMA 4U9RA 3QRPA 3J7AN 4LBIA 3N9UC 4ETZA 3TANA 1U47A 5DZ7A 3BQ2A 2HHXA 4CH1A 3M2UA 1IXKA 3OTOF 2JDJA 4DL2A 1AUSL 4MFBA 1K47A 1N0UA 1RLCL 3TVZA 3O8WA 4UTGA 5CHCB 4UT4A 3OSNA 2RB7A 2A6OA 3Q8SB 1WJ9A 1WEXA 4ZLLA 5HMXA 2W2MP 4ZJLA 4YB5A 3MEEA 1JB0C 2OJ3A 5LJ3Y 2W2QP 2MTLA 4NX9A 3FCVA 2E1MC 4ZVFA 1S6PB 4ED8A 4ECVA 4K0KF 3VGTA 1F5CA 1ZPWX 1BXNA 3W3SA 2A10A 1RI7A 4JBCA 1Q8KA 3HVAA 2CVIA 3E01A 4AL7A 2FHMA 5I42B 4DS5A 3ICLA 3PX6A 1SXLA 2D3OR 1NK8A 2BYCA 2V2KA 2ZJPQ 2PI5A 1EQMA 4QW9A 4IFYB 1CJKB 1S1XB 2ATLA 3MAAA 4X4NA 1VC0A 3TA0A 2Z2MA 3POTA 3TJ9A 1HKAA 3DMJB 3SI8A 3N6MA 5B0GA 2HPUA 3RAQA 3WC2A 2ZBPA 5IC4B 2EK6A 3HFVA 4KY3A 4EU0A 2DJWA 1YJWS 4OV6A 4YEAA 3BBBA 2YWEA 1TZ0A 5AXLA 2YXLA 1FNXH 3OR1A 2XHWA 5HK4A 5CA5A 5DG9A 3D7SB 4O3RA 5T7LB 5KFGA 4DQSA 4CO0A 4DR5J 1RWUA 3HXMA 1W7WA 3IS9B 2GJFA 2FC9A 4UQTA 2B8PA 3ISZA 4WFXA 2IMWP 4LF6F 2AGOA 2NXCA 1F6TA 1HQEB 1REVB 5DGBA 4PYDA 4IOCQ 3RRHA 3B6BA 5M2PA 5K8MA 3GIKA 5ETKA 2UUTA 2CZ9A 2FGCA 4HH0A 5BXIA 5B0DA 2F4FA 4I4BA 2IA6A 2WRMA 4CO5A 2M8HA 1RT3A 1SUQB 4B3RF 1OMSA 5F8LA 1F5AA 1B0VA 4DHVA 1EKSA 4C8NA 5CYQA 2AX1A 4NYZA 1S5ZA 4ES3A 2BM0A 3QPIA 4DSFA 3D1QA 1LFWA 4M5KA 1DQ8A 4NRUA 3H5UA 4TYAA 2Y8YA 1U09A 3VGSA 3DRRA 3M6VA 1WKKA 4YR0A 4I2QB 4GO7X 2ZUAA 3I4HX 2EKNA 3MM5B 2QC3A 1Y11A 2XMTA 3BGOP 1VQ5S 1N32F 5IOLA 2DR8A 2IY5B 4DV1J 3DXBA 2I5JA 1R89A 3W9IA 1FRJA 1F9EB 4YQWA 2EG1A 1AW0A 4NLQA 2ASLA 1YIJS 4P73A 2KJVA 1RT2B 3GJTB 2HGMA 3GYGA 4FDFA 2IYGA 1KFSA 2VL1A 1RWKB 3L09A 4OZJA 3NNAA 2H5EA 1K1QA 1J5OB 3CD5A 1ZM9A 1VOMA 2F8HA 4KPCA 2W4CA 1C0TB 3NAIA 4ZCIA 2OUGA 1RT6B 2HRYA 2HRTA 1HL6A 2VOOA 1NK7A 2D3ZA 3T1YJ 4Y28C 3MR6A 1S79A 5C5JA 3TA1A 4KHMA 2B4UA 4MKBA 3PW5A 1UCNA 2CPEA 1TL4A 3W2VB 2GVZA 4W98A 3I5BA 3QWPA 3FMWA 1WNEA 2HAFA 4PWWA 4OZ1A 3HSJA 1S99A 1H7XA 1MU2B 3F0NA 3G6VA 1ZYQA 4H4KC 1T9TA 1EQ0A 4IQMA 3KG1A 4OLOA 3KOAA 2VOPA 1ZA2B 4CLYA 3MM9B 5A0YB 3R2DJ 1TL3B 1PJ7A 1TFYA 3R5BA 2B4VA 3C14A 1ROFA 1S76D 5KT4A 1R8AA 2VC1A 4B17A 1UETA 3CD0A 4B9NA 2RQMA 3CCTA 2FYXA 4FBTA 4Y2AA 4BLGA 2MZ1A 4USVA 1P9YA 2PEHA 2KL8A 2W2NP 3KK2B 1R8HA 2OELA 3GFYA 3FRYA 4IDKB 3I31A 2AQ4A 1U25A 4B3MF 1GT8A 2Y1LB 1NJZA 1JWWA 3P5TL 1KOHA 3RZAA 2QL9B 5EN1A 4XTTA 1T11A 3T1HF 1HBMB 2JLGA 1Y0HA 2CWXA 3VGVA 3DGPA 4CLZA 1F3FA 3JSRA 2KT2A 1TELA 2WVBA 4X4UA 2XG8A 2NZCA 3ILLA 2J8SA 3LAMA 4I7FB 1FKPB 3CCES 1ELOA 1DQAA 4ZCLA 5F8MA 2NYHA 2W9AA 1X4EA 2APOA 4USJC 4PABA 5EX3A 1QAYA 2C3MA 4JI7F 1SKUB 4X64F 2WONA 2CPHA 1IKXB 1S9GB 2K3KA 3MMCB 3PYEA 2BJ3A 1H73A 1WOPA 1VQMS 2AYEA 4Q0BB 2WSFC 3FSYA 1AFIA 1VGYA 3TUIC 3HHDA 3AJ2A 3Q83A 2AZ1A 2YKPA 5FDLB 1X4FA 5IT9U 1XMQJ 1VIXA 1L3KA 2CDRB 3OXGA 3OFFA 1QUVA 2HMIA 4N5SA 2C22A 1YTYA 3CIMA 6FDRA 3MGJA 4K4ZA 4LRAA 4EUVA 3AXKA 1UEKA 1EX8A 2W8KA 4ECXA 3ENQA 5KFBA 4FF4A 3K57A 5KT3A 2E5LF 2XSFA 4C4WA 4DG1A 1PO6A 2MHNA 5IT9Y 3MDFA 4KC5A 1UVNA 1GAOA 1RGVA 3JTPA 1YGYA 3OL8A 1BGXT 1SBRA 1HQ2A 4KRWA 1WHXA 2GQ2A 5IZHA 4CLFA 3WX8A 4RBTA 4NA3A 1SIWB 1Y5NB 1HBOA 2X7IA 3IWNC 2O5DA 4RNNA 2B43A 4B9UA 2DGSA 5DDQC 1SJ4P 5CAAA 2ZM6F 1ZH5A 4DV0F 3J7YU 1SCJB 5MAOA 4O4GA 2XCAA 3BB5A 3R1LA 4C3LA 1SC3B 3TAPA 3CCWA 2KZMA 1R8PA 1ZS6A 4C98A 3H98A 4Z7CA 3SV4A 3THTA 1S0OA 2JEJA 2IVMA 3C19A 3Q0AA 2AF6A 2DKOB 3A8IA 2B6AA 3KLHA 2LXUA 4QR1A 2X1FA 2DRDA 1FD2A 4O0NA 1NJYA 2FUG9 4K2JA 4ED6A 4NCAA 3BGRA 4ZVUB 3Q89A 4K59A 1N33J 1EP4B 3G6ES 3DI6B 2XGQA 3M4XA 3DRPA 4YHHJ 5HATA 2JZ5A 1N5VA 4DU8A 4N8OA 1ZZFA 1E6YA 1RA6A 1N36F 2LMIA 3HFKA 3HFZB 3DLKA 1FJ7A 1MN9A 3UDEA 4DEZA 2OPSB 2YX4A 3EVMA 3SFGA 3FCHA 3KLIB 5D0EA 4NZ0A 4MMOA 5K5MA 4L75A 1JLEB 5DLGA 2FHJD 1NSQA 1R27B 1P9QC 1YBUA 4OJHA 4A48A 2ERRA 3QLHA 3H5XA 1ZM3A 1RA7A 3C8YA 4C9DA 3E3XA 3FJ2A 3ILIA 2MKYA 2OPRA 2C2RA 2HGNA 4WFAQ 2F8MA 2V8PA 1RBAA 4WTYA 3MECA 2YKOA 1NK6A 4NLGA 4M5GA 5KFQA 2JWNA 2QGFB 1GXTA 1BD6A 3FFIB 2CG4A 2RNEA 3Q8UA 3MM8A 2A0FB 2HFZA 4R25A 4NZ7A 4A8MP 3O6QA 3ONQA 3AOAA 3J7ZT 2R2TA 2J7WA 2GGPB 3RAMA 4TU9A 1T3NA 3MMAA 4Y2CA 5HBMA 2HVDA 2YWWA 3SCLE 4LSNB 3DM2A 3HPOA 1R31A 3DRXA 3C16A 4IH6A 1VI7A 1KBRA 4EEYA 4RNMA 2JNJA 5CZVA 3R1HA 5HN0A 3G6YA 2DNOA 1AYEA 2P9GA 4OV1A 1VYAA 4C11A 3V4IA 3CPWR 1S4EA 4AYBD 1WEZA 2CQ3A 3NMAA 3TEHB 2NUHA 2QSFA 3PEHA 4GVBB 2HNDA 3VHQA 3RTVA 3BJYA 3KHLA 3LH2S 4EMDA 1P1TA 1M1HA 4DV4J 4KKOB 2ZBQA 1LW0B 3HP6A 1H2UX 1RKIA 2IM3A 2VKZG 2WVEA 3NBPB 2XZWA 4B9LA 5BR8J 3V81A 1Q0NA 3MM7B 2KRRA 2CNLB 5T14A 4KT0C 2MXYA 3LP1B 4BC7A 4PUOA 2UUCJ 4L3KA 4AUKA 2LEBA 4ITSA 1T95A 2Y1JA 4IOBA 5GMDA 2VFTA 1UKUA 3OSPA 4NEYA 4R5PA 2QJ3A 2MZSA 2M52A 4H4MB 4DL3A 1KC8T 2UZAA 4DR5F 2KO1A 1OQ3A 2X1BA 1Q53A 1HARA 1YZ6A 3T5KA 4LF9J 1F0XA 2Y3YA 3MI7X 1M0SA 1K8AT 3CULA 2HHWA 3SCKE 2B51A 1JLGA 5F0WA 3OFHA 3H25A 4GC6A 1EETB 4HT7A 4NEZA 2YQ0A 3PNIA 3CDWA 2GO9A 4NLRA 2HBYB 2F7VA 3JSBA 5HROB 3CC7S 1DURA 2DNYA 3CCQS 2WVDA 4RU9A 4PG8A 4U7CA 1WSRA 1T9YA 4A46A 2RQCA 4XDCA 1BC6A 2QIFA 2B4OA 1QJHA 1U2RA 2C3OA 3QGPA 3W2WB 3DLGA 3QAEA 2R3VA 5K14B 3UFCX 2QX0A 4AQYJ 3VAJA 1VQ9S 1QVFR 2GAGC 1TKTB 5I3UA 4KGXB 4DV1F 5C25B 3MEKA 4OZNA 4FVMA 5A6PA 3DOKA 1WORA 4LIRA 3ISNC 1RT5A 1ZAXA 3M8QB 5IC6B 5LJ5Y 4DR3J 2D9PA 4CZCA 3U7JA 1U45A 2QSWA 2ZH9A 3DYAB 2MQQA 3UCZP 2YNGA 3B78A 2J76E 4M5IA 1UAWA 2LXIA 4DR2J 1S1VB 2CPFA 3GMGA 4QR2A 1RT7B 1VDHA 1UEVA 3T1YF 5J2PA 1DHMA 2LQJA 4TLQA 5IM0B 2X3DA 1H72C 4YB7A 3AT1B 2O1PA 2HS4A 1PC5A 3GV8B 5DQHA 1M5HA 2Z8QA 4ATNA 4Q43A 2DH8A 3K5NA 2ILZA 3UDLA 3HHLB 1MMLA 2AKWB 2XYGB 4C3KA 3UD5A 4ID5B 1S48A 4PG7A 2HIYA 4LR8A 3ZTPA 2O01C 2KFZA 2QLXA 3DLBA 5KOWA 3TR5A 5KAKA 4NI2A 4OI6A 4KIAA 2NQPA 5DQGA 3QT6A 1TK0A 1HWJA 3X3UA 3WBZA 4I6AA 2FLLA 3ET6B 4TLRA 3A1YG 2R2UA 1UFLA 3IR6B 2KDOA 4ICLB 1H2TZ 3CJ3A 4DDFA 1XMOJ 2FHJA 2FVSA 1BWVA 2KRBA 5L9NA 4H4OB 4ZS6A 5HAOA 1LQ9A 1S6PA 5GAGU 4Q44A 3HVWA 2ZH3A 4OYWA 3HJVA 1FVSA 2DNNA 1TKXA 1TR0A 5CQGA 1PGZA 3OV7A 2ZHOA 3L95X 2KH9A 2AJ0A 4AD6A 5I42A 1KHVA 4C48A 5KT7A 3QT5A 3NGUA 4LF4J 3ETMA 3LGNA 3WQPA 1RUSA 1RWOB 4KPYA 1U1LA 4IFYA 4XO0A 4J7CA 4N76A 1JLQB 1S1XA 4CP5A 1GFWB 1SH3A 1OYEA 3N5BA 1MROA 2B4PA 2GMHA 4TU8A 3BM7A 5GAGI 4RX6A 3DMJA 1Q81T 2CA9A 2AGPA 1X5OA 4LFAJ 3EPIA 1SV5A 3NWRA 2E29A 3PFOA 4YR2A 1B99A 3CSKA 1X8DA 2CJXB 1HBUB 2NLWA 5DM7Q 3ZZPA 2HVEA 3EZ5A 3AA9A 5M2UA 1NNDA 1RTJB 4I6YA 5A8WB 1O51A 4JV2A 3AOCA 1CEZA 3M8SA 3MD3A 2FVQA 3HDSA 2P5VA 2CG8A 3GYXB 2H5IB 3LANA 3UI3A 2QV6A 3H20A 3MR5A 2RDJA 1KP6A 3AOBA 2EFNA 2MQPA 2IPOB 2DISA 1S1UA 1W2BR 1XMQF 3BDPA 1KVIA 4DFPA 3TQ1A 4DV3J 1REVA 3VF0B 4F0HA 3H0PA 4J9NA 3KMSA 3O2IA 4LSLA 1PAUB 2HBQB 2J6TA 3VVTA 2ZEJA 3DHXA 3W61A 2DHXA 2IA0A 1P6TA 3VZHA 3RYLA 1U24A 3D6HB 4ZHRB 1YVFA 4IG0B 5JXSA 4QPXA 4B08A 1H0HB 3IGNA 3KUEA 4C7QA 1S9EB 2FVCA 4ECUA 4URSA 1KKHA 5F3TA 4F4AA 5J2NB 4B9SA 4ZVPB 5ETQA 5LT5A 1APSA 3MMBB 2E7XA 3PW7A 1R6YA 2OTLS 1BHNA 4DBQA 1QSLA 1UFWA 2HG4A 4Z37A 2XLKA 1EKRA 1LWCB 2WHOA 4NOHA 3LPEA 3ZC4A 4C0HA 1ZPVA 2CPIA 2AEJA 1QAJA 2CPJA 1TVRB 3MM5A 5SZTA 1F9FA 1DQ9A 4J9LA 5AE1A 1T3OA 3EWGA 1TL1A 3OJUA 2Q79A 3KWMA 4OX8A 4P7TA 4JP8A 2LQ9A 2ZH7A 5CYMA 2QA2A 2ALZA 1AB8A 4OFZA 4HEA9 3AB2B 4Z7YA 1T05A 1J5OA 3M2RA 5HMWA 4FYYB 1C0TA 4QIWD 3PEJA 3BKUA 2M4MA 4OZLA 3ZTQA 3PX0A 3BN7A 1U1RA 2VKRA 5KTQA 2J9EA 5A6WA 2AX0A 2Z2LA 1VQNS 2P9CA 2KN4A 1NPKA 1TUVA 2CJQA 3NLCA 1SJ1A 1N33F 5E3PA 1BQMB 2L08A 3MEGB 5EUHA 4JUZA 2RU3A 5C24B 4F26A 4R8UB 3KJVA 3BEGB 2XEXA 1MU2A 3CE8A 3A8EA 5KFCA 4YHHF 1NCLA 4QWCA 2PA3A 4P71A 1CS4A 4J9QA 3BS9A
chains in the Genus database with same CATH topology
2Z58B 2W2NP 1SCJB 3BGOP 3CO0P 4K8RA 3WIVA 2W2OP 2W2PP 3A3PB 1ITPA 2Z30B 3VHQA 2Z2YB 3WHIA 2W2MP 4OV6A 2XTJP 3QFHA 2Z2ZA 2ZWOA 1V5IB 3GCWP 4NMXA 1R6VA 2W2QP 4YN3B 4JP8A 3AFGA 3T41A 4NE9C 3GCXP 3VV2B 2QTWA 2PMWA 3A3NB 3SQOP 3P5BP 2Z57B 3BPSP 2Z56B 3H42A 2E1PA 3WIUA 3CNQP 2ZWPA 3A3OB 1SPBP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z58 B;  2W2N P;  1SCJ B;  3BGO P;  3CO0 P;  4K8R A;  3WIV A;  2W2O P;  2W2P P;  3A3P B;  1ITP A;  2Z30 B;  3VHQ A;  2Z2Y B;  3WHI A;  2W2M P;  4OV6 A;  2XTJ P;  3QFH A;  2Z2Z A;  2ZWO A;  1V5I B;  3GCW P;  4NMX A;  1R6V A;  2W2Q P;  4YN3 B;  4JP8 A;  3AFG A;  3T41 A;  4NE9 C;  3GCX P;  3VV2 B;  2QTW A;  2PMW A;  3A3N B;  3SQO P;  3P5B P;  2Z57 B;  3BPS P;  2Z56 B;  3H42 A;  2E1P A;  3WIU A;  3CNQ P;  2ZWP A;  3A3O B;  1SPB P; 
#chains in the Genus database with same CATH topology
 3DDI A;  3E51 A;  2W2P P;  2CVE A;  2XY7 A;  4JI6 J;  2GV1 A;  4MYT A;  4TY8 B;  3EX7 B;  1FKA F;  1X7V A;  1XTZ A;  5CYJ A;  2Y0S D;  3MM9 A;  3SCI E;  1S1W B;  3CJ2 A;  1CJV B;  1TL3 A;  1SQF A;  1HNV A;  3UN5 A;  1NK0 A;  2IRX A;  2V4J B;  4ZPB A;  5KFL A;  1PKU A;  2XTJ P;  2IMO A;  3M6U A;  2KG0 A;  5LXY A;  2FZK B;  4OJ1 A;  1S97 A;  5L1K A;  5HMY A;  3TX8 A;  3OT9 A;  3BGU A;  2DEI A;  2V63 A;  3FQL A;  1KLN A;  2DHS A;  2DNQ A;  1HYS B;  3PXG a;  4BWM A;  1EAR A;  5IQQ A;  9ATC B;  1HBM A;  4ANC A;  5CAB A;  2ZBR A;  1G7C B;  1RCX B;  1N56 A;  1NSP A;  3CCV S;  4DR1 J;  4U7U D;  3IRX B;  4DFM A;  2RDD A;  3MZI A;  3G8S A;  4I7F A;  2JRS A;  4ALZ A;  2CJK A;  4ILM A;  4HTI A;  1KVJ A;  1VMB A;  2K7J A;  2LXF A;  1UPM B;  1YRU A;  1A6L A;  4IYQ A;  4LMZ A;  1AFJ A;  1UJ5 A;  1M5P C;  5AJ3 J;  1QAX A;  3DC2 A;  2NR0 A;  1H7W A;  4MFB B;  4RU2 A;  2FD2 A;  5DQI A;  1ITP A;  1U1P A;  3MMC A;  2RSQ A;  2B7B B;  1FA0 A;  3SSS A;  4J37 A;  4OHY A;  2RH3 A;  1N48 A;  2DGU A;  4XPC A;  4K4W A;  4ELU A;  1T9V A;  2Y0B B;  4P6Q A;  4J5O A;  3PY8 A;  2ZNY A;  4DV4 F;  3VV2 B;  3KNA A;  2K8G A;  5KFU A;  1ZTW A;  3MPV A;  1YJR A;  1SPB P;  2ZHB A;  3VQS A;  3P4U B;  2E9Z A;  3S1T A;  4PCQ A;  5KFY A;  5BR8 F;  2BA9 A;  1VHF A;  3IAS 9;  2NRE A;  2UUC F;  3G8Q A;  3E01 B;  2E44 A;  1HFE L;  3UR3 C;  3RBX A;  4MTP A;  3HSD A;  1XIQ A;  4K8R A;  1VRT A;  2RML A;  1CBK A;  3FBF A;  2FHO B;  4X2B A;  5KG5 A;  4TXS A;  1KEK A;  1HWI A;  4LRE A;  4LF9 F;  2H5J B;  3K58 A;  1IBM J;  2QA1 A;  1FDB A;  2ZD1 B;  3RRK A;  2K1R B;  1RAI B;  2MKS A;  3BDE A;  5KFE A;  4HYK A;  3TAM A;  1VBY A;  4DN9 A;  3N79 A;  2XCP A;  3MUM P;  3R9L A;  2DPI A;  3MPU B;  2IRU A;  2KHC A;  3F56 A;  2C3U A;  3PJW A;  4QYR A;  2G0I A;  2FJE B;  2AJ1 A;  4L3N A;  4RZR A;  1HD1 A;  3OR1 B;  4X4P A;  2Z56 B;  4ZP9 A;  4RR5 A;  1U1K A;  2HQD A;  2RF2 A;  2RIL A;  2ZE2 B;  4R0E A;  3KG0 A;  3PTW A;  1WDT A;  1GX5 A;  2GVD B;  2AYB A;  5B7W A;  1YJ7 A;  4WWS A;  1H38 A;  2VA2 A;  3H40 A;  3D3B J;  5LMN J;  4PWD A;  1IBK J;  2NXJ A;  1WC0 A;  1IJF B;  2EWH A;  2MJU A;  2FJD B;  4QQB A;  4AQY F;  4DSJ A;  5I4M A;  1BQN A;  3F73 A;  1HI1 A;  2P2C B;  1YBT A;  5KFF A;  2AU0 A;  3DI6 A;  3AA8 A;  1RCO B;  1XN9 A;  4EZ6 A;  4DR3 F;  3GP9 A;  3HHL D;  3OLB A;  3UR0 A;  1U2C A;  3GIM A;  2KG1 A;  3MUV P;  1ZM2 A;  2OD6 A;  2VG7 B;  3MFH A;  4OHZ A;  4UOC A;  4UF4 A;  3M32 A;  3MOJ B;  5ETR A;  3PV8 A;  4DR2 F;  1E6V A;  4NML A;  5G0R A;  5A8K B;  1MMD A;  2PGC A;  5L1I A;  5HMZ A;  3BN4 A;  2DY9 A;  3G8T A;  4OYZ A;  4RBU A;  2OEJ A;  4F0M A;  1XNR J;  4OZ5 A;  3I9Z A;  2EBG A;  3Q2T C;  5A76 A;  2VBY A;  4JYA J;  1EZZ B;  2W4D A;  5EX0 A;  5KG1 A;  2BOA A;  1T9X A;  4ZVQ B;  2I5J B;  4RW6 A;  4ZOS A;  1VQK S;  4WK1 A;  1SH2 A;  4KFB A;  4E2F B;  4JI4 J;  1BLU A;  2RT3 A;  3EXC X;  1OO0 B;  3UNY A;  1LXJ A;  2BXJ A;  1TFW A;  3J7Z 5;  5F9L A;  5CCM A;  1B7Y B;  3K5M A;  3QT7 A;  3KLV A;  3QGI A;  3D67 A;  1RP5 A;  2AZ3 A;  1RB0 A;  4I68 A;  4LQ9 A;  5KFN A;  5KG4 A;  2OPQ B;  4TU7 A;  5D4O A;  4NWB A;  5D0H A;  2G1H A;  2DNM A;  2OAU A;  3QO9 B;  1NAQ A;  2GVZ B;  1CJT A;  1NEE A;  1XMO F;  5CCL A;  3BGF A;  3ULH A;  1X5S A;  2Y8W A;  3NL0 A;  1B7F A;  4WF9 Q;  2MPU A;  4WIQ A;  4DR6 J;  2MLY A;  1MSW D;  4LSN A;  1M5K C;  2CQD A;  3KDO A;  3IBW A;  3DKD A;  1QE1 B;  2QG9 B;  1RWX B;  1U8W A;  5L8R C;  2C2M B;  2HZA A;  4USM A;  3CD7 A;  4PXB A;  4NYP A;  4DOZ A;  3V6J A;  4USK A;  4BS2 A;  4LF4 F;  3E8O A;  3QSY B;  1RHM B;  3QRR A;  1LW2 B;  1T8E A;  2KFN A;  3NS5 A;  4DI6 A;  2RVJ A;  2ROE A;  3ZTO A;  5LM7 E;  4GVB A;  4A8O A;  3L7O A;  2EFG A;  3ZNU A;  3M7V A;  1RAE B;  3GQC A;  1NH7 A;  1IKY A;  4KKO A;  5DET A;  4Q45 A;  4LFA F;  1LW0 A;  5D4N A;  3NBP A;  1IKV A;  4TN2 A;  3PRD A;  2GCF A;  3MM7 A;  2ZDP A;  2UXD J;  4O4R A;  3LP1 A;  1KN6 A;  2CQB A;  3HD1 A;  2P6T A;  4RWX A;  5F8N A;  4KQZ A;  4KHR A;  2VH7 A;  2G4B A;  2W9C A;  3DGP B;  1UVL A;  1CPZ A;  3D66 A;  4H4M A;  3EIC A;  5FLX U;  5DG8 A;  2YH0 A;  3CT9 A;  4K4S A;  2FHK A;  4DV5 J;  2GX8 A;  2ZOF A;  1QTN B;  2DHA A;  1IR2 A;  5A8R A;  1S49 A;  4WP9 A;  2QO3 A;  3A3P B;  3KK1 A;  3T6B A;  3TYT A;  1KTV A;  3JSM B;  2ZOG A;  4DV3 F;  2DHG A;  4Y6I A;  2J0W A;  4LFC J;  3HM9 A;  1SVD A;  2GHP A;  2WON B;  1RBL A;  5KFI A;  1EET A;  1WAC A;  1Y3K A;  3UO0 A;  4JI8 J;  2PC6 A;  4Q2L A;  1JKH A;  3GU0 A;  3D2W A;  4QJV A;  2DNH A;  4AFF A;  2W4P A;  4RUC A;  4ERD A;  5HRO A;  1VK3 A;  2GNK A;  4PQA A;  3CB4 A;  4USI A;  1NKE A;  4PXC A;  3W60 A;  4X4R A;  3S6E A;  1X0F A;  1NHU A;  4J9O A;  4IRK A;  5DO2 A;  1HA1 A;  3TJ8 A;  1RWN B;  5M2R A;  2YX7 A;  3E2E A;  2CXE A;  4NXM J;  1IN0 A;  1RQ0 A;  3W2W A;  1CQN A;  2KXN B;  3CUN A;  1VQ6 S;  3OVB A;  2BMB A;  3MHY A;  4CO2 A;  3QGH A;  1TKT A;  2VQE J;  2ZKU A;  4LJM A;  3BZQ A;  1TAQ A;  1S57 A;  4W92 B;  2RU9 A;  2HFS A;  3H42 A;  1DRZ A;  4CLP A;  3M8Q A;  3IA0 A;  3T9N A;  3OTB A;  2IC3 A;  3G9C A;  1Q8I A;  2QFJ A;  1ZTT A;  3DYA A;  5GAE U;  3KHH A;  2DYA A;  3D9B A;  2B5J A;  3S7R A;  1GX6 A;  4F36 A;  2HGL A;  1S1V A;  1RT7 A;  2CJY B;  3U27 A;  3OHB A;  1FX4 A;  4E0D A;  5IM0 A;  3GYN A;  4HI1 A;  3LO3 A;  4B9M A;  2V5H G;  2ZH8 A;  1FRL A;  4QOT A;  1REG X;  4NLP A;  7FDR A;  3A8J A;  3SFU A;  3SXL A;  2JVO A;  1QY7 A;  1TL7 B;  4PXD A;  3IXQ A;  3HHL A;  2D9O A;  2JEI A;  5GAE I;  2F5G A;  4ID5 A;  2DGO A;  3ITH B;  2WVC A;  2BKO A;  2HEK A;  2RKI B;  3WDO A;  4JI6 F;  3J80 U;  5DG7 A;  2QT7 A;  1NJX A;  4M5M A;  3T6J A;  2V9K A;  3P5B P;  1UA0 A;  4UW2 A;  3I87 A;  2GHV C;  3PYF A;  4ED0 A;  1S10 A;  1B70 B;  3M8R A;  2R7Q A;  5F8J A;  3TW0 A;  4F3Q A;  5AXK A;  3IAM 9;  2L3M A;  2ZNZ A;  4FKX A;  1R0A B;  3J7A 1;  2G2O A;  2B9E A;  1VHI A;  4OQJ A;  2KM8 C;  2KXF A;  2PDA A;  2DT9 A;  3T9Z A;  1AA1 B;  4DX8 H;  4UOH A;  3TVK A;  3QWU A;  3J80 Y;  2MGZ A;  4DL7 A;  5THW A;  2BX6 A;  3OR2 A;  3I0R A;  1NDL A;  1O6X A;  4UST A;  1E6Y B;  4PXE A;  3M2V B;  2FGO A;  1TQL A;  2KYX A;  5KG6 A;  3P6Y C;  3QMQ A;  3CJS A;  2J0X A;  3I4P A;  2CJ9 A;  3RR8 A;  2OI2 A;  4G65 A;  1JLQ A;  3FCW A;  4DR1 F;  1NPP A;  1JJ4 A;  4OYX A;  1FI4 A;  1EJ7 L;  2PII A;  2BEF A;  5K20 B;  3MPD A;  1TUG B;  5EWG A;  3D4J A;  4ZN1 A;  4H54 A;  3PRV A;  3UWT A;  4M95 A;  2JEF A;  3MUT P;  3A12 A;  4J9K A;  2UU9 J;  5AJ3 F;  1RYR A;  3EVO A;  2PEB A;  1WOO A;  3WC0 A;  2DPJ A;  1M5O C;  2DO4 A;  3RU0 A;  3TZZ A;  1RTJ A;  2Y1R I;  4J9P A;  3EYZ A;  4TKT A;  1Y00 A;  2HWI A;  4RBV A;  4MYU A;  5IV3 A;  2DNL A;  3NOC A;  2ABY A;  2XQC A;  3FRZ A;  1SKS A;  1BQX A;  3IMQ J;  3MMA B;  5ETO A;  2JOQ A;  1RT1 B;  2JC1 A;  1RTD B;  5HBM B;  1YI2 S;  5F8H A;  7FD1 A;  3DM2 B;  4NMX A;  4DUT A;  2JC0 A;  2MKJ A;  2A1B A;  2VBW A;  4UUW A;  1Q86 T;  2RAQ A;  5ADZ A;  3C16 B;  4ZVR B;  3VZI A;  4MK9 A;  3IRW P;  4FF1 A;  1XMB A;  2HNZ A;  2J7K A;  3H5Y A;  5J1N A;  2DXE A;  4IG0 A;  1WF2 A;  3OTE A;  3V4I B;  1S9E A;  3DCA A;  4DFK A;  1J2V A;  5ETV A;  3GR1 A;  4WCE Q;  2O66 A;  3HT3 A;  1HMV B;  3FC9 A;  2E9R X;  2KVI A;  2N82 B;  3C46 A;  3MMB A;  4KB7 A;  1FJC A;  2L48 A;  2DNR A;  3OPK A;  2HFV A;  4CIO A;  1IBM F;  1HWK A;  4F02 A;  1NZ8 A;  1LWC A;  5KFV A;  5MLC V;  1KS2 A;  2OSQ A;  5DDO C;  3VTI A;  2HLU A;  2VPW B;  3V81 B;  5B0F A;  1Q1K A;  1TVR A;  3SBM A;  2B8Q A;  3H7H B;  5KFP A;  4U8Y A;  5SUH A;  3G96 A;  4FYD A;  1KQK A;  2H48 B;  2YKA A;  4J9U E;  3R5A A;  4NLW A;  3BH7 B;  5DZ6 A;  2QLF B;  3DHW C;  4O3N A;  2BAN A;  4NCB A;  1QVG R;  4CI0 B;  4ZLP A;  2HHP A;  2C3Y A;  3R6G B;  4C8Y A;  3CJR A;  1WHY A;  3O3L A;  1K9M T;  4OYI A;  2CAJ A;  5J2M A;  3UVJ A;  4OI2 A;  1N5Y B;  2VD3 A;  4YP3 A;  5LMN F;  1IBK F;  3P8B B;  4EBC A;  4LF7 J;  3PAC A;  3CJT A;  2LA4 A;  1OPI A;  1Q5Y A;  2LU1 A;  4JI2 J;  3CD6 S;  3B4M A;  1S77 D;  3MEG A;  3MXH P;  1PSD A;  1EHW A;  2XZT B;  5C24 A;  4HLB A;  3UE2 A;  2CYY A;  4CLK A;  1U0H B;  4MKY A;  4R8U A;  3LP0 B;  3R97 A;  5IFM A;  2D1C A;  6FD1 A;  4RNF A;  1Q8B A;  3D0H E;  3QID A;  4P52 A;  4F25 A;  1U48 A;  4NLD A;  2EVZ A;  3DDN A;  2BJD A;  3QFH A;  4TY8 A;  1YG0 A;  3GIL A;  2HAI A;  4J9V A;  3Q8P B;  4AL5 A;  3DLG B;  5GAH I;  3KFW X;  2V4J A;  2MZQ A;  3UDV A;  1J27 A;  4RW7 B;  4M5H A;  1XNR F;  1JXL A;  3W5Y A;  4ZVE A;  5I3U B;  3GFX A;  3LP2 A;  4QW8 A;  5C42 A;  4JYA F;  2I0X A;  4KH1 B;  4OL8 A;  1HWU A;  3KLG A;  1A0O B;  1LV5 A;  3BO4 A;  2HBZ B;  1RT5 B;  4JI4 F;  3G6X A;  2XM3 A;  2A6M A;  2N4D A;  3PJ9 A;  3VGU A;  4I1T A;  4L72 B;  2WSE C;  1YQH A;  1H98 A;  1XBW A;  2CUY A;  1HYS A;  3CJK B;  4NA1 A;  2HWH A;  2IBO A;  4P72 A;  4RJV A;  2IVY A;  4GRS A;  1Z2Z A;  2C2K B;  4WK3 A;  3IRX A;  2VB6 A;  4IG3 B;  3G87 A;  2AWZ A;  3EPG A;  2RDI A;  4V19 J;  2WSC C;  2EC2 A;  4CDI A;  4OI0 A;  1FFW B;  2BE2 A;  4XIU A;  1QDU B;  2OLW A;  1NDP A;  5B0A A;  2EPI A;  4DR6 F;  2MQL A;  4HI2 A;  1C1C B;  3D28 A;  3I82 A;  4ELT A;  3NS6 A;  4RKU C;  4NI2 B;  1WG1 A;  2KYZ A;  2YX1 A;  5K8O A;  3CJ5 A;  3H2U B;  2RIJ A;  2VU5 A;  5C7P A;  4QU6 A;  3G82 B;  3NP5 A;  2RD5 C;  5KG3 A;  1NB2 A;  1S6Q B;  5KFA A;  3N0V A;  1V5I B;  4URQ U;  2IDE A;  3QAU A;  5KFW A;  1NSK L;  4P9S A;  1N5T A;  4KAI A;  2X1G A;  1FNM A;  3JQM A;  3ZXW A;  4IR1 A;  5HVF A;  3N01 A;  5KT2 A;  4FF2 A;  2UXD F;  3TJA A;  1FT8 A;  1TKX B;  1I6J A;  4QIE A;  4V19 X;  2PMW A;  1SC6 A;  3SV3 A;  2QLJ B;  2R8I A;  5E3A A;  4DF8 A;  2RUS A;  3AD7 C;  1HNW J;  1N5S A;  1U49 A;  5ITH A;  2C2E A;  1R6V A;  3HF5 A;  4RNO A;  4I69 A;  2NXN A;  1MRO B;  1ZA1 B;  4DV5 F;  3OL6 A;  4ETX A;  4J91 A;  2G13 A;  3NS7 B;  3R7N B;  3P3D A;  1X4C A;  2ZD1 A;  3R3T A;  2K1R A;  2CJB A;  3HO1 A;  2ZJQ Q;  1SV5 B;  1RU1 A;  1RXO B;  1RJJ A;  5CH7 B;  2AD9 A;  2MKC A;  3N28 A;  2UVU A;  4QIV A;  3IWL A;  5E0O A;  2RRB A;  4F4W A;  4LFC F;  4K50 A;  4DPX A;  2WW8 A;  4DCO B;  1G3O A;  3DRS A;  1OQ6 A;  2HHV A;  4C97 A;  2ZZT A;  3MFI A;  4JI8 F;  2XMV A;  2RS2 A;  1GTE A;  2R7O A;  1CUL B;  4IH7 A;  3CTR A;  1JJH A;  4ANE A;  1U1N A;  3O44 A;  2DR9 A;  3OXF A;  1JQG A;  1VLY A;  2C1E B;  4PWU A;  3CC2 S;  1S1T B;  3MCS A;  1K0T A;  4IRD A;  2B56 A;  3NGD A;  3F41 A;  3GZ7 A;  1YK9 A;  2ZE2 A;  2GC8 A;  3C15 A;  2GVD A;  4C8M A;  1S1U B;  3IR5 B;  4NPO A;  1UZH A;  1N88 A;  4ZP8 A;  1M90 T;  1N5Q A;  4OX9 J;  2F4V J;  2WTF A;  4NXM F;  3UN3 A;  1OIA A;  4LSL B;  1VJQ A;  2ZZN A;  2BE7 D;  3WX4 A;  4OIX A;  2VFS A;  4CLW A;  2VQE F;  5A2Q U;  2HS0 A;  2MB0 B;  4UZC A;  3I5A A;  2OPP A;  1NXI A;  2MHE A;  4F2R A;  3BO3 A;  2U1A A;  3TI0 A;  3V5R A;  3QIP A;  3TAR A;  2R7U A;  4NE9 C;  2XGP A;  2Z4P A;  4DUY J;  1CQM A;  3RB6 A;  3ISN D;  3CED A;  2VG7 A;  1FE0 A;  4EK2 A;  1KLM A;  3PG9 A;  1VRU A;  2MKK A;  4KSE B;  5A8K A;  1HBN B;  5HQ8 A;  4CH7 A;  5HO4 A;  3KMQ A;  2VG6 B;  2C2N A;  5A2Q Y;  4W4M A;  4K4Y A;  2HLT A;  1TL1 B;  1PYT A;  4PPD A;  1N54 B;  4CH0 S;  4CLL A;  2XI2 A;  3SIP B;  2LA6 A;  5CYM B;  1AZS A;  2AEM A;  4LF8 J;  4QYZ J;  4QR0 A;  1LEO A;  3L7P A;  1T05 B;  3PCO B;  2GW8 A;  3M2R B;  4DL4 A;  2AP6 A;  4WZQ A;  2OML A;  3EZO A;  2OPQ A;  3FBB A;  1IKW B;  1NZA A;  4DV7 J;  3EJM A;  4DR7 J;  2DNG A;  1HHQ A;  3RB3 A;  3QO9 A;  1GNK A;  1XJW B;  4OYB A;  5CZX A;  3SQG B;  2RE1 A;  3V2U C;  2OIH A;  3DU5 A;  4D3H A;  2MQN A;  3UW1 A;  2E5I A;  2VZ9 A;  2YNH A;  3FKB A;  3W63 A;  4FXD A;  4ECT A;  2UUW A;  4QPT A;  2XMA A;  2Q6C A;  3KJV B;  1YRT A;  1QE1 A;  1CS4 B;  2FJW A;  2CFX A;  1NJW A;  2YWF A;  3IM8 A;  3DXS X;  4C3M A;  3ENV A;  3CXC R;  4ED3 A;  2CKW A;  3KHG A;  2YTC A;  3H4D A;  4IKA A;  3VAL A;  4A8X A;  1RTI B;  4EI2 A;  2V50 A;  1LW2 A;  5HSP A;  1KWM A;  1HNV B;  2GHW A;  3HK2 A;  1LWF B;  4HDG A;  3R6L B;  1XQI A;  4YB6 A;  1VCT A;  2IJR A;  4UY8 T;  1WD6 A;  2VUG A;  2XWY A;  2HYI B;  1JNZ B;  5KFT A;  2UXC J;  4J90 A;  4CYU B;  1SL2 A;  4RW4 B;  3RUB L;  2UU9 F;  5D78 A;  3Q22 A;  2QA4 S;  1M5S A;  2BJ7 A;  2J6S A;  1T0T V;  1HQU B;  3FEX B;  3UPF A;  3K5P A;  2AYG A;  3OVA A;  2YQ1 A;  2LLZ A;  4KO0 B;  2IFX A;  2EFP A;  3OTD A;  4LBP A;  3ZZO A;  2K2P A;  5L9X A;  4USU A;  1FWK A;  2WZ1 A;  3LA0 A;  4NZ6 A;  1TL5 A;  2RJZ A;  1HNX J;  4Z2X A;  4IUF A;  1G1X A;  1WOS A;  3JSM A;  1K1S A;  3GV7 B;  2FJA B;  2D3U A;  3D0G E;  2E5H A;  2R9L A;  3LQV A;  4C0O C;  3C66 A;  1GQE A;  1GTH A;  3GIJ A;  1UW9 A;  3Q86 A;  1SKR A;  2BBE A;  2BZ2 A;  3CDE A;  4UQG A;  1WI8 A;  1JLA A;  3WZ0 A;  4CTA A;  1TV6 A;  3R5C A;  1D3W A;  3BRE A;  2P6S A;  2I38 A;  4HHJ A;  2JH3 A;  2UUB J;  2MQO A;  1MG7 A;  3HSZ A;  4EZ9 A;  1RWM B;  5E3R A;  4G1I A;  4J9R A;  1K44 A;  1VFJ A;  4LFB J;  4O44 B;  1D9A A;  4ID8 A;  4OI3 A;  2SXL A;  2HHS A;  5KFX A;  1VC5 A;  2QZ8 A;  1KR4 A;  5LSR A;  3W8P A;  1DTQ B;  3PRB A;  1OSD A;  2CPX A;  4OX6 A;  1W2I A;  2JVR A;  2J6U A;  3RG6 A;  2EEY A;  1S0V A;  4F3M A;  2BJ9 A;  3EGW B;  2RHQ B;  1VRT B;  1U6F A;  2DRB A;  2X3G A;  5L1L A;  2LDI A;  4GC7 A;  3PHT A;  5B09 A;  1WUU A;  2EKY A;  1BUX A;  1T03 A;  9RUB A;  1LK5 A;  2GS8 A;  2GIF A;  3BPS P;  3SSQ A;  3THP A;  5LL6 d;  4QWB A;  4TYB A;  2ASJ A;  5H9E J;  1OPZ A;  2ZC3 A;  2Q66 A;  1B0T A;  2V8H A;  4N47 A;  3TAM B;  3L3C A;  4LF7 F;  2YKM A;  1PIL A;  2R42 A;  4DL0 C;  4JI2 F;  3PFE A;  1LK7 A;  3HHK A;  1X9M A;  1TL7 A;  4G6V B;  1LWE B;  4ZJQ A;  5HVG A;  3W9H A;  4DV2 J;  1EIY B;  3ITH A;  2G1D A;  2LQ5 A;  2YNF A;  2H4Y B;  4O3Q A;  2F9D A;  2RF2 B;  2RKI A;  3MMJ A;  4XAK A;  3CO9 A;  4E8U A;  4RO0 A;  4QIG A;  4PWD B;  1Q16 B;  3HHE A;  3OXL A;  3J7Y I;  2F40 A;  3FSX A;  4LQ3 A;  1YSJ A;  2DR5 A;  3FSI A;  4M94 A;  1V9O A;  4Y2I A;  1BQN B;  5FD1 A;  1VQS A;  4P75 A;  1ULR A;  2CQC A;  3J81 j;  1HW8 A;  1R0A A;  2QN6 B;  2KXH A;  3RR7 A;  4DQI A;  1SL1 A;  2B9W A;  2MKI A;  1U1Q A;  3M30 B;  4HL9 A;  2CJA A;  1WG4 A;  2EW9 A;  1HD0 A;  2XSJ A;  1URN A;  4KE5 A;  3M2V A;  2FLN A;  1DLO B;  4PQU A;  3I5C A;  4AND A;  2V4R A;  3M32 B;  2DGQ A;  3BSA A;  4F3O A;  2BVZ A;  3D1H A;  1E6V B;  1N4L A;  5G0R B;  3I32 A;  4NLY A;  2E1C A;  2GFF A;  3HUL A;  1FTC A;  2UUA J;  1UW4 A;  1WG5 A;  3G4S S;  1U4B A;  5ETT A;  5EWF A;  3WIU A;  2VAS A;  2WW4 A;  2UVW A;  4MK7 A;  3VCD A;  2BQ3 A;  3Q24 A;  3U1M A;  2DRA A;  1M1K T;  1FNO A;  4GKK F;  2LP4 A;  4DQP A;  1V5V A;  1PBA A;  4A8W A;  2XZD B;  1ZZN A;  1V6H A;  2I6W A;  2ZH4 A;  4RW6 B;  4U8V A;  4KFB B;  4NAS A;  1HNZ J;  3QSI A;  2C3P A;  2KM8 B;  3RB4 A;  4ZPT R;  5CD4 A;  3ZZU A;  3PYD A;  3VVU A;  1UFK A;  1WC3 A;  4YN3 B;  2I9S A;  4RUH A;  5LMU J;  1FFG B;  2MY7 A;  5AXM A;  3ZNJ 1;  3NXZ A;  2FIU A;  1QM9 A;  2FZG B;  1DBD A;  1NB7 A;  3KTQ A;  4ECZ A;  3D3C J;  4PRF A;  1NK5 A;  2YBV A;  2LDY A;  1CJT B;  3TO8 A;  3DOM B;  4NLV A;  2KVQ E;  3M8Y A;  1A9N B;  4UOG A;  2H4W B;  1RT1 A;  2V2Q A;  2DGW A;  1R3N A;  2E1R A;  1I94 J;  4B3S J;  1RTD A;  1WC1 A;  2WB4 A;  2OGU A;  1RAJ A;  4ZIW A;  2DCU B;  5CXT A;  1UPP A;  3BPD A;  4NXN J;  3VAI A;  3BO2 A;  2HBR B;  2HQG A;  1FXD A;  1NHK L;  3NGT A;  1FK9 B;  1HNW F;  1ZBT A;  3BH6 B;  2R7S A;  4UOF A;  4OJG A;  2W25 A;  4IO1 A;  3OLA A;  3MPY A;  1YJV A;  3M05 A;  2CQ0 A;  1HMV A;  2GJ2 A;  2IYI A;  1L3S A;  1KHW A;  1X4G A;  4Q7A A;  5H9F J;  2V6A A;  1D09 B;  4DF4 A;  4BWJ A;  1IKY B;  1SIZ A;  4MIB A;  4ECR A;  4CLU A;  2COL A;  2XB2 D;  3AQO A;  2NUU G;  1IKV B;  5D0G A;  4Y34 A;  2HUR A;  2B9X A;  4DPO A;  1Q78 A;  4BC9 A;  2XS5 A;  2LVW A;  3TUJ C;  1C0U A;  1RDR A;  2XMW A;  3FNN A;  3JTO A;  3H2L A;  1HHS A;  4ZLN A;  2W9C B;  2HQI A;  4OYO A;  1Q82 T;  3SZ2 A;  3FDS A;  4NL5 A;  4A8K A;  5IT0 A;  3JXO A;  1XR7 A;  4EYI B;  3B4D A;  2C2D A;  1JLB A;  1T02 A;  5A8R B;  1F3V A;  2AYM A;  1N5Y A;  2CQ2 A;  4DLE A;  1PYO B;  3CMA S;  2M9K A;  3KK1 B;  4KTQ A;  2VFR A;  1VK8 A;  4OX9 F;  1RBO B;  2F4V F;  1YDL A;  3DOL B;  2PFF B;  1TMJ A;  3HKW A;  1QLN A;  4AXI A;  2LQ8 A;  3KNG A;  3Q8V A;  4WU3 A;  2CZV C;  1RAC B;  5E3C A;  4U96 A;  1NK4 A;  2HHU A;  4DPY A;  2MLZ A;  2F1F A;  1JKH B;  5B08 A;  3BKF A;  3A8K A;  4W90 B;  1U0H A;  3BBF A;  3HX9 A;  3LP0 A;  4LT6 A;  4DZD A;  2FB0 A;  2HVZ A;  4NLX A;  3IG1 A;  1G4C A;  1RAH B;  4DUY F;  2HS3 A;  1NK9 A;  3VAF A;  2XY6 A;  2OEM A;  3HI9 A;  4R0J A;  2B0G A;  2MST A;  4JB8 B;  3MTJ A;  5KT6 A;  1NRK A;  3GG0 A;  3UQS A;  3CMQ A;  4WFY A;  2PSZ A;  1C4A A;  4OZ2 A;  1GXU A;  2IJF A;  1XR6 A;  3FVY A;  2V8V A;  4X66 J;  4RUB A;  4WXW A;  3LUY A;  4ZPA A;  3BBC A;  1S0M A;  2HHT A;  3CDU A;  4RW7 A;  3HZG A;  1SJQ A;  1R43 A;  2PA8 D;  3N6N A;  3NWG A;  3ELH A;  2CNO B;  3GJQ B;  1CC7 A;  2ZJR Q;  1D0E A;  2YKN B;  1R7I A;  4LRF A;  4N8N A;  2IC3 B;  5HLF A;  4LF8 F;  2KU7 A;  1AT1 B;  3KDN A;  3MOZ A;  2K7K A;  2QEX S;  1Q8L A;  2DIT A;  3CJK A;  4NLU A;  2B5J B;  3ZZZ A;  3CME S;  2ZVS A;  1DTT B;  1ZAW A;  1IR0 A;  1B4S A;  5IQ6 A;  1YJU A;  3DFE A;  3K7R A;  1FRM A;  4OHX A;  2C28 A;  4X4T A;  4DV7 F;  1SQE A;  4DR7 F;  1FRK A;  3EVW A;  5EGY A;  1O8B A;  3R2C J;  5F8G A;  4IG3 A;  2CNK B;  2V94 A;  4OI1 A;  2POK A;  1ICE B;  1YZ7 A;  3LW5 C;  3OW2 R;  4DCP B;  2GMJ A;  3B54 A;  1WEL A;  3EMT A;  2FTR A;  2K3I A;  4NA2 A;  1C1C A;  1M5V C;  2D7S A;  4ZVT B;  3L4B C;  2HFU A;  1D8Y A;  3BSN A;  1U26 A;  3W8G A;  1RTZ A;  1Q4R A;  3MPW A;  1NH8 A;  2ZH6 A;  3G82 A;  2YH1 A;  4Y3C A;  3AY0 A;  1S6Q A;  4NRT A;  2GAH C;  2QMX A;  3KHR A;  3LF0 A;  4PAA A;  3J81 U;  3OFG A;  4ZP6 A;  2KI2 A;  1PJ5 A;  3T5L A;  3K0J A;  1LXN A;  2RRA A;  1B3T A;  3UCU P;  2UXC F;  4TQS A;  4KR0 B;  3P45 B;  2HSE B;  2CPD A;  1HWL A;  1HR0 J;  2MGZ B;  3AJD A;  3B82 A;  2K06 A;  3OR2 B;  3I0R B;  2N7Y A;  3T41 A;  1FKO B;  2FLP A;  2W9B B;  1N6Q A;  2E7V A;  2H54 B;  1VBX A;  1BY9 A;  4LR9 A;  2MY8 A;  5DGA A;  1U1M A;  1RLD A;  4ZLJ A;  2V8D A;  2HVH A;  3I96 A;  5EWE A;  4K4U A;  3J81 Y;  1JIH A;  2E1A A;  3Q23 A;  4FVC A;  2HRU A;  1SJ3 P;  4AE5 A;  4B3O B;  4ECQ A;  2XHC A;  1DZ5 A;  3ENA A;  2HW3 A;  1HNX F;  4QWA A;  1FE4 A;  2VIH A;  2VDH A;  1NM2 A;  2XWX A;  2F63 A;  5HP1 A;  1XEZ A;  4CNZ A;  1JNR B;  3MCN A;  1WC5 A;  3EZU A;  2CAD A;  1NBE B;  3WIV A;  4ZMM A;  3VAG A;  4ES1 A;  1I51 B;  1W26 A;  1S9F A;  4WZM A;  4RW8 B;  3DLE B;  3FEZ A;  3GCW P;  2DH7 A;  1CUL A;  3LGH A;  2N3O A;  4KHP J;  3HJF A;  4FS2 A;  2VPZ B;  1WKJ A;  2UUB F;  5G4D A;  5K8N A;  2MMY A;  1S1T A;  2R8K A;  4CWB A;  4FPR A;  2DH9 A;  2NCK L;  1UVI A;  2WB1 D;  4LFB F;  5E3Q A;  3UD4 P;  3AJ1 A;  4CCH A;  2QMW A;  2H3E B;  4ZIV A;  4O0I A;  3NEK A;  5KFZ A;  1D9F A;  2DNK A;  4F04 B;  3PHE A;  2Q43 A;  2HNZ B;  3IC1 A;  5JVG Q;  2R2S A;  3T19 A;  1S7H A;  3MED B;  1N0V C;  3CCU S;  3JQK A;  4WP3 A;  1PIE A;  2V9W A;  1I3O B;  3GB0 A;  1P1L A;  1HBN A;  3OD2 A;  2GQQ A;  2VG6 A;  4C8K A;  2RQK A;  3NNH A;  3PM9 A;  1OWX A;  5L1J A;  5DS7 A;  3G86 A;  2QMU B;  2GIR A;  3RJM B;  4LVN P;  4C8O A;  1FFS B;  4DZ6 A;  3Q8R B;  4FXW A;  4P7V A;  2BAN B;  1G6B A;  2OKQ A;  2RRN A;  4DV2 F;  2MEW A;  1PYS B;  3V4M A;  3GON A;  5D4P A;  1S4F A;  4CQ1 A;  3AOD A;  4MIW A;  3QFW A;  1CJU A;  1WI6 A;  1TP7 A;  5J2M B;  3UVJ B;  2NYI A;  2CQ4 A;  1RIS A;  2ZDO A;  5BJR A;  1YJ9 S;  2IVF B;  1UWB B;  1WKL A;  4OLP A;  2EG2 A;  1IKW A;  3CO0 P;  1FHT A;  2KTQ A;  4DLG A;  5IXU A;  2WOM A;  3TOQ A;  2BW7 A;  4K7Q A;  3RB0 A;  3H2V E;  3SQG A;  3L7U A;  3HMJ G;  4E98 A;  1TUW A;  1FF2 A;  5EDW A;  1U6B A;  5KFM A;  3WHI A;  2MZJ A;  4YDD B;  4I2P B;  1VLO A;  2DGT A;  3ILJ A;  1FEH A;  3K89 A;  2FQQ B;  2G0J A;  2MJN A;  2XI3 A;  3HHN B;  2XBP A;  1WHW A;  5KFS A;  2PD1 A;  3HSG A;  1L3T A;  4UY8 5;  3M8Z A;  1RTI A;  2GQC A;  1F60 B;  3GTY X;  4JI1 J;  2Q6B A;  2UUA F;  1RWW B;  1OJ4 A;  3NKY A;  3VAK A;  4OYA A;  3KG4 A;  1LWF A;  2C2Z B;  3LP2 B;  2X1A A;  2X51 A;  5C42 B;  4CO3 A;  1IBL J;  3OL9 A;  1X4A A;  5H1S V;  1U02 A;  3D5M A;  3DLJ A;  3KLG B;  4O23 A;  1WHV A;  4QU7 A;  1SJF A;  1PJ6 A;  4CYU A;  1HNZ F;  1DJ0 A;  4RW4 A;  1IM4 A;  1KSP A;  2AHO B;  3FK4 A;  2L41 A;  4P74 A;  3D54 A;  4ECS A;  2BUN A;  3PYG A;  2QYC A;  1HQU A;  4MKV A;  3MM6 B;  3G71 S;  2MSS A;  3GWC A;  5LMU F;  1CVJ A;  4KO0 A;  1D8Z A;  3M8P A;  1L5U A;  5LXR A;  2ZUG A;  4ZDN A;  2DXD A;  2XYP B;  2BJ1 A;  1HHT P;  3NMR A;  3NGS A;  1L3U A;  1S6U A;  1XK8 A;  4DR4 J;  5GVQ A;  8AT1 B;  4NYO A;  3KLF B;  4J9S A;  3LWL A;  3K59 A;  4S0M A;  2BE2 B;  4G1Q A;  3MWB A;  2V2Z A;  3ZZR A;  1I94 F;  1PC4 A;  4B3S F;  4WPA A;  3CDA A;  1B64 A;  1Q7Y T;  4ENO A;  3BGL A;  1IBC B;  4YOE A;  3THV A;  3HVR A;  4WBF A;  1NKB A;  4NXN F;  1U1O A;  2MQ8 A;  4C8Z A;  3DU6 A;  1FRH A;  2W2O P;  2VON A;  1VQ7 S;  3OJS A;  2J9D A;  2OMO A;  4ZVG A;  5B0E A;  2VA3 A;  1NPR A;  2Q1L A;  5DLF A;  2V67 A;  2NZ4 A;  3D6T B;  5L39 A;  2ACM A;  2UV8 A;  1UL3 A;  3SSR A;  2A2C A;  4O44 A;  3M1V B;  4OMF G;  3CGI A;  4CLT A;  3V6D A;  4JI3 J;  3NCR A;  4WFN Q;  3X1L B;  1SKW A;  3OFE A;  5T41 A;  5J1E A;  1KRP A;  3EDQ B;  4LF2 A;  1VIS A;  1RSC A;  2LEA A;  5E5N A;  2V2V A;  4N77 A;  1DTQ A;  2RHS B;  3QYY A;  3KJQ B;  2V0N A;  2JFD A;  2EFQ A;  1MWQ A;  3LAL A;  2VFV A;  4M5L A;  3F44 A;  1KNZ A;  2MYF A;  2MZT A;  3DNC A;  2P9E A;  5RUB A;  1QSS A;  3ZFV A;  2C42 A;  3W7B A;  3AH6 A;  2AIR B;  2XO6 A;  3GJR B;  5DJB A;  1DFD A;  3KLE B;  4KYZ A;  3C2P A;  3KUG A;  3T1A A;  4IFV B;  4ED2 A;  2M8D B;  1VQY A;  3C6U B;  1RHJ B;  2AEF A;  2ZH1 A;  5HI7 A;  5D3G B;  1TKZ B;  5AT1 B;  3DRS B;  3A4T A;  4DPT A;  4I67 A;  1C1B B;  1X5T A;  4WJB A;  1WWH A;  1LWE A;  1YLX A;  1S6O A;  3M9N B;  4HVZ A;  3K8V A;  4HHU A;  3US5 A;  4KJI A;  4OHV A;  4OZ3 A;  4DQR A;  2GZO A;  2W01 A;  1X9S A;  2LQB A;  4USW A;  5AE3 A;  1G2E A;  3C15 B;  3OVS A;  4WP8 A;  2MKH A;  4C6A A;  2VQF J;  1KD1 T;  3IR7 B;  1PCA A;  3ILO A;  1Q5V A;  2BRK A;  2G9O A;  4X66 F;  1FJE B;  2CDQ A;  3CWJ A;  3HCX A;  4L6V 3;  4QWE A;  1RT4 B;  1H2V Z;  4YDX A;  3TQE A;  4M5D B;  2EC0 A;  1F5B A;  3K2Y A;  1DAR A;  4HAC B;  2NSC A;  2OPP B;  4DQQ A;  4U95 A;  4OZ0 A;  4NLT A;  3M30 A;  1V3S A;  3QIP B;  3I0S A;  3FGV A;  1J5E J;  2CPY A;  3DDK A;  3C6T B;  3BR9 A;  1HI8 A;  1XWL A;  1KLM B;  2MDA A;  4CNY A;  1DLO A;  1VRU B;  4LRC A;  5I3P A;  1XNQ J;  3RBE A;  4ECY A;  3OL7 A;  1Q7L B;  1VQ4 S;  3PKY A;  3H5S A;  2HQ3 A;  1F2G A;  5F3Z A;  3IBF B;  2ZVI A;  3TZW A;  2ACY A;  2CQI A;  3CDB A;  4DXL A;  1GK8 A;  1VQP S;  1RK8 A;  3M9O B;  1MNE A;  4Y00 A;  4WTO B;  3KYL A;  1TMM A;  1C2P A;  2XUL A;  4FNH A;  2IIH A;  1UP1 A;  2C2O B;  1HPZ A;  2JJ4 D;  2XYH B;  2AGQ A;  3RW7 A;  4F8R A;  1AZS B;  4ZP7 A;  4RNH A;  3K5O A;  2R7T A;  3QJP A;  4UZB A;  1Q95 G;  4ES2 A;  3MF5 A;  3TVY A;  2NPI A;  1RAO A;  4ILR A;  2QFI A;  2LYV A;  4KGK A;  2QTW A;  3KUH A;  3A13 A;  2DEJ A;  2PT0 A;  1WDD A;  4ECW A;  4MAK A;  2GIQ A;  2ZKT A;  1JK9 B;  4P2F A;  4PG4 A;  2E5G A;  5D6G A;  1N8R T;  2HNY A;  3DOM A;  4PEO A;  2YNH B;  2J8A A;  1FER A;  3FEY B;  1LKZ A;  4HR2 A;  4X65 J;  4HHH A;  1KQF B;  5KG2 A;  1HR0 F;  1ARO P;  1Y3J A;  4MH8 A;  4Y0F A;  3EE3 A;  4TNO A;  2PMZ D;  1FK9 A;  3TX0 A;  2ASY A;  3EGV A;  4LUB A;  2VOD A;  3JYT B;  3JTN A;  1D1U A;  4FXV A;  1YIT S;  4FN5 A;  4GMK A;  2BE9 B;  2Y1I A;  1OY8 A;  5GAD U;  1D9D A;  1HW9 A;  4KBI A;  4V1A k;  2ROG A;  4X4O A;  2VC0 A;  3OUY B;  2V34 A;  4M5N A;  4X4V A;  1Y10 A;  3VR1 A;  3S8S A;  3W1Y C;  5E7O B;  4KV8 B;  5DRK A;  3JQJ A;  2YQ3 A;  3CW2 C;  4A8S A;  2KJW A;  3HLU A;  1XC9 A;  3GPA A;  3V6K A;  3QAT A;  4WFB Q;  2PMH A;  3FUY A;  2VG5 B;  2WVF A;  5GAD I;  4A4J A;  5HQL A;  4KHP F;  4ZA1 A;  3KXD A;  2XMK A;  1X31 C;  3TWZ A;  1RU2 A;  3GJS B;  4AXJ A;  3T5H A;  4U6P A;  3QZ8 A;  2BQR A;  4ZCM A;  1EAY C;  2D3O 1;  2NS1 B;  3HVT B;  1HLW A;  3R5D A;  5FII A;  1IUJ A;  1JLF A;  3QGG A;  1WTB A;  1V3R A;  4QBU A;  2PI4 A;  4ED4 A;  3DOL A;  1WF0 A;  2FC8 A;  2NPF A;  3UDC A;  1WF1 A;  2QL7 B;  3K5L A;  1KVK A;  3S01 A;  3Q8Q B;  1KTQ A;  1SL0 A;  1JLA B;  1LNQ A;  4WXO A;  1UTA A;  4CTA B;  1TV6 B;  2HKE A;  1TAU A;  5FLX Y;  2FJX A;  2OH2 A;  4O3P A;  2HQC A;  4K5R A;  2BAC A;  3CC4 S;  3LGM A;  2VJV A;  4TY9 A;  3UCG A;  3OBI A;  4ZPW R;  3CJ8 A;  3SQO P;  3R27 A;  1GXL A;  4FPI A;  4DJB A;  1FWP A;  2KFY A;  3SDE A;  1KON A;  3NY0 A;  3ZZT A;  5KFD A;  5JVH Q;  3NAH A;  4DSL A;  2R7W A;  4DMZ A;  2QLB B;  3PKM A;  4Q8F A;  2VJU A;  4PG6 A;  4F2S A;  2YKN A;  5D8H B;  2F65 A;  4C0B A;  1LOU A;  2I1R A;  1S12 A;  2UVV A;  2VPX B;  1Y4Z B;  6AT1 B;  5F8I A;  2FVR A;  3AB4 B;  4CT9 A;  1T03 B;  3PW4 A;  5IS2 A;  4EBD A;  3I56 S;  3TEG A;  5C2G A;  1UZD A;  1DTT A;  1Y5L B;  2VIC A;  1LWX A;  4EO6 A;  5CD4 H;  1IJE B;  3EUN A;  2L9D A;  1FES A;  5E33 A;  5IT4 A;  2DO0 A;  2YKM B;  4USH A;  4XDD A;  5D4L A;  3PR4 A;  3KK3 B;  4B9T A;  2ROP A;  4XK8 C;  2V68 A;  1KQS R;  2IRY A;  2UXB J;  5JMN A;  3GLJ A;  3VAM A;  1VJW A;  5J1P A;  4FYX B;  1YJT A;  2YNF B;  4YUD A;  4OJ3 A;  2VHG A;  2HVI A;  4WYL A;  1RWV B;  5KFH A;  2ZH5 A;  1WEY A;  3TZY A;  3IBC B;  4JI1 F;  1RTH B;  3R5G A;  4WII A;  1VQL S;  1ZM4 A;  2HZC A;  4NLS A;  1CJK A;  1IBL F;  2A18 A;  1FXR A;  3RAX A;  1OS5 A;  1QAI A;  1NUE A;  1QUP A;  1JMT A;  2OD4 A;  2YPY A;  5B0B A;  1VRQ C;  4X62 J;  2XSJ B;  1FKO A;  4Y2M A;  2FLO A;  1GH8 A;  4PQU B;  2W9B A;  5LOQ A;  3BYR A;  1KDN A;  1CG2 A;  4PPZ A;  3MTK A;  4YY3 J;  1HNI B;  2WAQ D;  1VQO S;  3NCQ A;  1IM6 A;  5KT5 A;  2G2Z A;  4DR4 F;  3PJX A;  4B3O A;  5T7L A;  2HK3 A;  4DFJ A;  1FVQ A;  2ZHA A;  1SQG A;  4AT1 B;  1GMV A;  3IS9 A;  2WCX A;  1CLF A;  2YNI B;  4JV5 J;  4QZV B;  1HQE A;  2H65 B;  4RW8 A;  3DLE A;  5L38 A;  3FBE A;  1S72 S;  4ZPC A;  1PG5 B;  4PYA A;  2BM1 A;  1TK5 A;  3SCJ E;  1N52 B;  1FDN A;  2ILY A;  1SUQ A;  5J2Q B;  3PX4 A;  2ZWO A;  2VFU A;  3ZZY A;  4CO4 A;  2O67 A;  2R7V A;  4JOU A;  1Z4U A;  1UVM A;  4JI3 F;  2FZC B;  3QT8 A;  1ZET A;  4FP9 A;  1FJG J;  4QWD A;  5BYQ A;  1YBA A;  2WBM A;  3GSI A;  3ENW A;  4WFZ A;  1L3V A;  1B0P A;  2U2F A;  4I2Q A;  5L46 A;  3M8W A;  4Y2K A;  3IGV A;  3MAH A;  4G1P A;  4HDH A;  3GII A;  3MED A;  4F7V A;  4U67 Q;  2M88 A;  2HWT A;  3TRG A;  4QYZ K;  1RT2 A;  1MLA A;  4KGV B;  4TVA B;  2DCL A;  2IM2 A;  2EFO A;  4BHQ A;  1SC4 B;  4DS4 A;  3BQ1 A;  3M6X A;  2QE5 A;  1RT6 A;  5ETS A;  2I2Y A;  1WC4 A;  2AMC B;  3EXY A;  1C0U B;  2P8I A;  2KZZ A;  2DGV A;  4ZN3 A;  3W2V A;  4IH5 A;  1UEU A;  4F4Y A;  5E2Q A;  3CJ0 A;  2B3T B;  5HAN A;  4JI5 J;  2LKZ A;  2XLI A;  2GA7 A;  2XS2 A;  5AE2 A;  2H1Y A;  5DDP C;  2HZV A;  1SI9 A;  2R2R A;  4P2X A;  1JLB B;  4RWW A;  2XMU A;  1UWB A;  2RS8 A;  2VQF F;  3Q2S C;  2RUG A;  3H8Y A;  4DSK A;  2R8H A;  1T9U A;  2AJ4 A;  5A0Y A;  1JJ2 R;  4NCG B;  4ZVS B;  3QRQ A;  2M0G B;  2NSB A;  3CCZ A;  3IP0 A;  4N56 A;  1GMW D;  5LSL A;  4ZKA A;  4I2P A;  1VR6 A;  1CSJ A;  2AJF E;  3TUZ C;  3IG1 B;  2YY3 A;  1VIO A;  4CT8 A;  4WE1 B;  1J5E F;  2DVI A;  4IQX A;  3FZB A;  3PIO Q;  3KK2 A;  3M6W A;  4LBH A;  2XNQ A;  4HH1 A;  1XNQ F;  1R0B G;  3GFZ A;  3SEO A;  4DUZ J;  2KHD A;  3CCR S;  4IDK A;  2QLW A;  2R7X A;  4OHW A;  1FEE A;  3TP2 A;  4CM2 A;  2VDI A;  3CJQ A;  1MW7 A;  2IAJ B;  4RW9 B;  4DCJ B;  2FPH X;  2DTJ A;  2MQM A;  2MLX A;  3D1O A;  4ED1 A;  1JLC B;  4F4K A;  2XMJ A;  1H74 A;  2OHD A;  4L76 A;  3UD3 P;  3I9V 9;  2FVP A;  3ZZ0 A;  1FKP A;  4F50 A;  2UP1 A;  4F0K A;  5HLF B;  3NG8 A;  4BDP A;  3HT0 A;  5FJ4 A;  5D77 A;  3NGR A;  3AFG A;  3M2U B;  3TZX A;  3DGV A;  3MM6 A;  3T3F A;  1QSY A;  4LF5 J;  4NLO A;  1WTF A;  2HHH J;  1IKX A;  1S9G A;  5D15 A;  1MN7 A;  1VBZ A;  1FD8 A;  4LR7 A;  4Q0B A;  3KLF A;  4GKK J;  3W65 A;  4Q8E A;  4C2M A;  3BV8 A;  3OHA A;  1F1B B;  3HKZ D;  4IOA Q;  3MEE B;  3CF5 Q;  4IR9 A;  5FDL A;  4X65 F;  4CLS A;  4XPE A;  1IVZ A;  2CRL A;  3BKT A;  2FDN A;  2KT5 A;  2Z57 B;  4EGL A;  2E1P A;  1YRX A;  3ETO A;  4DV6 J;  2DHH A;  2R4F A;  3GR0 A;  3IWX A;  4OYM A;  4YR3 A;  4GKJ J;  1SC1 B;  3AD8 C;  3JB9 k;  4FKY A;  3G2X A;  3AQP A;  2EK1 A;  2FY1 A;  1FDD A;  2BV3 A;  2HIQ A;  1VQ8 S;  4EWT A;  4MT1 A;  2PFD A;  2DK2 A;  4ZJO A;  5IWA J;  2JX2 A;  3M1V A;  3MAA B;  2DNP A;  3EGZ A;  2XMM A;  4PZV A;  3POT B;  4PKD B;  5H9E K;  2JLE A;  3LOU A;  2LCW A;  2VBX A;  3QBC A;  3H59 A;  3Q8Y A;  1P8G A;  2OP5 A;  2CQ1 A;  3CVK A;  5KFJ A;  1N6Q B;  2VV5 A;  4EFA C;  1JXE A;  2Z2Y B;  4MKA A;  4FYV B;  3P96 A;  3PDN A;  4DL5 A;  4TQR A;  3MD1 A;  2B7C B;  1NLK L;  2HQF A;  2QL5 B;  2DBB A;  4ZK7 M;  4Q5V A;  3KLE A;  4IRC A;  4IFV A;  3C6U A;  2DR6 A;  1JX4 A;  1YKW A;  2XNR A;  5HP1 B;  4LRD A;  4C8L A;  4F67 A;  2PN6 A;  2W7A A;  3MUR P;  5F41 A;  5D3G A;  1TKZ A;  2DXF A;  3QNW B;  3KKF A;  2DGX A;  3FZ2 A;  1UA1 A;  4JI0 J;  2AT1 B;  1S0N A;  1C1B A;  2E66 A;  2YWG A;  3VQT A;  1X9W A;  2IM0 A;  3LPY A;  1Y9O A;  2V4Q A;  2CWK A;  2HHQ A;  1EP4 A;  4LSZ B;  4O3O A;  3A3O B;  4RL1 A;  1RT3 B;  3DLL Q;  4DU7 A;  3AD9 C;  3NCP A;  2YWH A;  3W5Z A;  1X4D A;  3EDR B;  5K9F A;  2D69 A;  4M5J A;  5CYQ B;  3CIZ A;  1GMU A;  1NHV A;  5HL7 Q;  2XC9 A;  2Z58 B;  1I5O B;  2IM1 A;  5GME A;  3B8H A;  1F2H A;  2F3J A;  4B3T J;  2V8G A;  3IO1 A;  3H4B A;  4GO5 X;  1FTR A;  3DRR B;  1RT4 A;  2OPS A;  3CCL S;  2YWK A;  1SH0 A;  3GCX P;  3KLI A;  2ZBC A;  1NSA A;  2BJ8 A;  3GFH A;  5KG7 A;  2GML A;  1WC6 A;  4M5D A;  2DIV A;  4HAC A;  4YS2 A;  1JLE A;  1FX2 A;  4DPU A;  2HFO A;  5D0R A;  5E41 A;  4EBE A;  4CRJ A;  1X60 A;  3TAQ A;  3RBZ A;  2BQU A;  2DD8 S;  3N6L A;  2HK2 A;  3C6T A;  1RHQ B;  2QYG A;  2J9C A;  4DX6 A;  1RHR B;  3OTC A;  1C4C A;  2XO7 A;  4A8Y A;  2OTJ S;  3CJ4 A;  4L73 A;  1MMN A;  1HI0 P;  2RQ4 A;  1BE4 A;  3LTO A;  5HJY A;  1OY6 A;  2AW0 A;  5KFK A;  3FFI A;  2B9Y A;  4O3S A;  3W62 A;  1KOO A;  1VS3 A;  1N34 J;  1Y7P A;  2UXB F;  3FMB A;  1GMW A;  1BWE A;  3DN9 A;  2JLF A;  2GGP A;  2W7O A;  5ETL A;  3TA2 A;  4M63 A;  3QQC D;  2ADC A;  4MJK A;  2J0S D;  1NME B;  3M9M B;  2XLJ A;  1CJU B;  5F9N A;  3OTO J;  2KT3 A;  2CIM A;  1T7P A;  2LEC A;  1BMQ B;  5ETP A;  2IJN A;  4JV1 A;  2VBZ A;  5IV4 A;  2WOM B;  4K5S A;  4OYP A;  2W7P A;  4JV0 A;  4UUX A;  2VF3 A;  2ZC4 A;  3A3N B;  3PW0 A;  5GMK a;  5I3Q A;  3D6M B;  3C14 B;  4M1K A;  2BR0 A;  1QD1 A;  5EHH A;  5H9F K;  2J0Q D;  2W1B A;  5C2C A;  2LEP A;  3RGI A;  4X84 A;  3TNV A;  2CNN B;  2JEG A;  2Z2Z A;  1RAF B;  4YME A;  2GO8 A;  2OEK A;  4A47 A;  4ZPD A;  3OQ2 A;  2WBR A;  4X62 F;  4MK8 A;  4K0K J;  4FS1 A;  2M5Y A;  1K0V A;  3O5T B;  3GIR A;  5BYR A;  2ASD A;  3RRG A;  1UJ6 A;  4DPW A;  3JYT A;  3JS9 A;  3W9J A;  3NRB A;  4EO8 A;  4YY3 F;  3EGN A;  1X5P A;  1T9W A;  4MIA A;  2QA4 G;  1YJN S;  3IFE A;  2NXE A;  4WU2 A;  2N7C A;  2E5J A;  1UJ4 A;  3R7B B;  3OUY A;  1TU0 B;  3ZO7 A;  1S7I A;  1EB0 A;  2M70 A;  4KV8 A;  1U7L A;  2PO4 A;  3VWS A;  3RW6 A;  5KG0 A;  2G2Y A;  4JV5 F;  3LAK A;  2F8E X;  3AHP A;  4DSE A;  2VG5 A;  5HQM A;  4DSI A;  2M2B A;  1UVJ A;  1IQT A;  2ZWP A;  3M8P B;  2BOP A;  2QRR A;  1RAG B;  4J9M A;  1Y5I B;  1WSV A;  2L9W A;  1RAB B;  2XS7 A;  3UNG C;  4FZV A;  3HVT A;  4WKY A;  4BBY A;  1A7G E;  2BW2 A;  4G1Q B;  4K4T A;  4ZIT A;  1FWL A;  1FJG F;  4QIF A;  2EI5 A;  4EYH B;  1GEH A;  1QTM A;  4LF6 J;  1RAD B;  2HMI B;  2L9N A;  1RYS A;  3R7S B;  3EM1 A;  5K14 A;  1JJC B;  2M7S A;  2OO4 A;  1XR5 A;  3C3L A;  3P49 B;  1FO1 A;  3IM9 A;  4A8Q A;  3D68 A;  5C25 A;  3R5J B;  2BAB A;  4OI4 A;  5JJB A;  1IQZ A;  4URG A;  4RUA A;  3K17 A;  1RZM A;  4B3R J;  3NGK A;  4F4Z A;  2ZZM A;  3NNC A;  4ZCK A;  3BSO A;  1T94 A;  4KGM A;  4DG1 B;  2H51 B;  3V6D B;  2BRL A;  1F9H A;  4DN0 A;  2A2D A;  5J1E B;  3D6F B;  5HJX A;  2ZBI A;  2XY5 A;  3CNQ P;  1VC6 A;  1OYD A;  2VPY B;  1NDC A;  1HBO B;  3HZE A;  3PO5 A;  3PIP Q;  3QJL A;  2J7U A;  3PVX A;  4D3G A;  3I6P A;  3PW2 A;  1RAA B;  5KOX A;  5HVH A;  4M8L A;  1N32 J;  4LRB A;  4N7T A;  4IO9 Q;  4JI5 F;  4O4G B;  2JL9 A;  4LIW A;  3PO4 A;  2DR7 A;  3PZP A;  4CM0 A;  4FBU A;  4QCL A;  1R8C A;  3U02 A;  4OX7 A;  2AV5 A;  2ZH2 A;  3R8Y A;  4BCA A;  1FXL A;  4DL6 A;  1R0C B;  5BYS A;  2D41 A;  1M1G A;  1SB6 A;  2IDL A;  1MWZ A;  3KK3 A;  5LSO A;  2MZR A;  3VAH A;  2ZIT A;  3SYZ A;  2B6A B;  2EXU A;  3MCM A;  2HFN A;  3ET6 A;  3W66 A;  3KLH B;  3I55 S;  3GE9 A;  1UVK A;  2W8L A;  4HKQ A;  4X4Q A;  1U8S A;  3JAM U;  4ICL A;  3V6H A;  1IWA A;  3BGR B;  1DY3 A;  1NKC A;  4H4O A;  3H90 A;  5JUM A;  2BDP A;  1X4B A;  2DIU A;  3MR2 A;  3GG1 A;  1FRX A;  3DRP B;  1MWY A;  1YHQ S;  4K4V A;  1NU4 A;  4DUZ F;  2FY8 A;  1TKD A;  3DRY A;  3U1N A;  3MR3 A;  5DM6 Q;  1RTH A;  2YVS A;  4AL6 A;  3JAM Y;  3DLK B;  2R8G A;  3GSD A;  3T5J A;  2BKN A;  2E9T A;  2CQG A;  3ADA C;  4PG5 A;  3MAQ A;  1LFP A;  1U0S A;  4HT5 A;  2M3D A;  3TUP A;  1FCA A;  1RWP B;  2W24 A;  3I0S B;  1HIY A;  8ATC B;  3QLH B;  2DB1 A;  4FF3 A;  8RUC A;  4LF1 A;  1RHU B;  3NOG A;  4B9V A;  3GV5 B;  1RE1 B;  2OPR B;  1ZAV A;  4G3I A;  1SJR A;  1KFD A;  1HBU A;  4LF5 F;  2AJ2 A;  3MEC B;  2HHH F;  3N4W A;  4B3M J;  1VBK A;  4K2X A;  1U2F A;  1ACM B;  1H3D A;  2UV8 G;  1HNI A;  5A8W A;  1FDA A;  2YPZ A;  3T1H J;  2R7R A;  2KB2 A;  3MM8 B;  4I64 A;  2DNZ A;  3CCS S;  2WK4 A;  2CPZ A;  2JSX A;  3O1L A;  4CO1 A;  4ILL A;  3RBD A;  1HPZ B;  4FYW B;  1K73 T;  2YNI A;  3L9Z A;  2FJB B;  4YB1 P;  2CQH A;  4DV6 F;  3KJF B;  3HD2 A;  1KQG B;  2LU2 A;  2EBE A;  1O5J A;  4WKR A;  4JI7 J;  3BSC A;  4X64 J;  4GKJ F;  2OFH X;  1AXQ A;  4A8F A;  4Q2M A;  3IN5 A;  4ER8 A;  4U7U K;  3N5F A;  3MCO A;  2E7W A;  2CQP A;  1TTH B;  4KH0 B;  2V69 A;  4F4X A;  2JHE A;  4ZHR A;  5J2Q A;  5IWA F;  4C11 B;  2IBK A;  3ZTR A;  2LFV A;  2HNY B;  3U1L A;  3W64 A;  2HND B;  5J2N A;  2BKP A;  4Y65 A;  2DY1 A;  4DWI A;  4L74 A;  3FQK A;  7AT1 B;  4N41 A;  1OSC A;  1R8B A;  4K4X A;  4ED7 A;  3QZ7 A;  2G0C A;  3PR5 B;  4RPF A;  5ETN A;  2Q3P A;  1V3Z A;  2UVR A;  1NO8 A;  1RHK B;  4P2S A;  3MR7 A;  4PUO B;  2ALY B;  1I1G A;  2I8E A;  2J5A A;  4ED5 A;  5B0C A;  1Q79 A;  2AJQ A;  1YX2 A;  2N3L A;  3BYP A;  2E5L J;  4R5P B;  2D74 B;  4I6W A;  1NDK A;  3BR8 A;  4DX7 A;  2IHR 1;  5KFO A;  3W5X A;  5KFR A;  1IR1 A;  4ELV A;  1UWA A;  5U47 A;  2Z0G A;  5AXN A;  2ATC B;  1Z2L A;  2OFG X;  2Z30 B;  4KGZ B;  1ZOT A;  1FRI A;  4JI0 F;  1H6K X;  2ZM6 J;  1JLG B;  2F9J A;  3BQ0 A;  4DV0 J;  2H9Z A;  3D0I E;  4GVL A;  3K8W A;  5GAH U;  1BQM A;  1Z1Z A;  4I56 A;  5F0U A;  1P27 B;  4I0W A;  4WYW A;  4FNI A;  3AXM A;  2N4C A;  1JXV A;  1X4H A;  3UN2 A;  3KJN B;  5K8P A;  1JLF B;  2KKH A;  5DDR C;  2OSR A;  2R8J A;  2A3J A;  2PE8 A;  2NXU A;  2GJI A;  1W25 A;  3SMZ A;  1PAE X;  2Y9H A;  4B3T F;  1OY9 A;  4X4S A;  1S1W A;  1NJI T;  4NCG A;  1CJV A;  2O3D A;  4LVO P;  2YKQ A;  2ZFH A;  1O0P A;  3QJJ A;  1AUD A;  5ETM A;  3DLH A;  2EFV A;  2BJE A;  3HHL C;  1DAX A;  3DOK B;  4ZVO B;  4WE1 A;  3CCM S;  1RKJ A;  4PR6 A;  1X0P A;  3JSY A;  4YFU A;  1U6Z A;  2YNG B;  3LWM A;  4P10 A;  1N36 J;  2CZ4 A;  3FBC A;  3ZTS A;  2JFK A;  3BF4 A;  4H4K A;  2IAJ A;  4DX5 A;  4B02 A;  3CCJ S;  3SDE B;  1URR A;  3AAW B;  1UMJ A;  1IWG A;  1YWX A;  4RW9 A;  5J2P B;  1XER A;  1TK8 A;  1PBU A;  1CC8 A;  1N34 F;  1JLC A;  2ADB A;  2J9D E;  2FJV A;  4ZVH A;  4RLE A;  4HTJ A;  4ZPV R;  1S59 A;  4P2M A;  2ZOM A;  4U9R A;  3QRP A;  3J7A N;  4LBI A;  3N9U C;  4ETZ A;  3TAN A;  1U47 A;  5DZ7 A;  3BQ2 A;  2HHX A;  4CH1 A;  3M2U A;  1IXK A;  3OTO F;  2JDJ A;  4DL2 A;  1AUS L;  4MFB A;  1K47 A;  1N0U A;  1RLC L;  3TVZ A;  3O8W A;  4UTG A;  5CHC B;  4UT4 A;  3OSN A;  2RB7 A;  2A6O A;  3Q8S B;  1WJ9 A;  1WEX A;  4ZLL A;  5HMX A;  2W2M P;  4ZJL A;  4YB5 A;  3MEE A;  1JB0 C;  2OJ3 A;  5LJ3 Y;  2W2Q P;  2MTL A;  4NX9 A;  3FCV A;  2E1M C;  4ZVF A;  1S6P B;  4ED8 A;  4ECV A;  4K0K F;  3VGT A;  1F5C A;  1ZPW X;  1BXN A;  3W3S A;  2A10 A;  1RI7 A;  4JBC A;  1Q8K A;  3HVA A;  2CVI A;  3E01 A;  4AL7 A;  2FHM A;  5I42 B;  4DS5 A;  3ICL A;  3PX6 A;  1SXL A;  2D3O R;  1NK8 A;  2BYC A;  2V2K A;  2ZJP Q;  2PI5 A;  1EQM A;  4QW9 A;  4IFY B;  1CJK B;  1S1X B;  2ATL A;  3MAA A;  4X4N A;  1VC0 A;  3TA0 A;  2Z2M A;  3POT A;  3TJ9 A;  1HKA A;  3DMJ B;  3SI8 A;  3N6M A;  5B0G A;  2HPU A;  3RAQ A;  3WC2 A;  2ZBP A;  5IC4 B;  2EK6 A;  3HFV A;  4KY3 A;  4EU0 A;  2DJW A;  1YJW S;  4OV6 A;  4YEA A;  3BBB A;  2YWE A;  1TZ0 A;  5AXL A;  2YXL A;  1FNX H;  3OR1 A;  2XHW A;  5HK4 A;  5CA5 A;  5DG9 A;  3D7S B;  4O3R A;  5T7L B;  5KFG A;  4DQS A;  4CO0 A;  4DR5 J;  1RWU A;  3HXM A;  1W7W A;  3IS9 B;  2GJF A;  2FC9 A;  4UQT A;  2B8P A;  3ISZ A;  4WFX A;  2IMW P;  4LF6 F;  2AGO A;  2NXC A;  1F6T A;  1HQE B;  1REV B;  5DGB A;  4PYD A;  4IOC Q;  3RRH A;  3B6B A;  5M2P A;  5K8M A;  3GIK A;  5ETK A;  2UUT A;  2CZ9 A;  2FGC A;  4HH0 A;  5BXI A;  5B0D A;  2F4F A;  4I4B A;  2IA6 A;  2WRM A;  4CO5 A;  2M8H A;  1RT3 A;  1SUQ B;  4B3R F;  1OMS A;  5F8L A;  1F5A A;  1B0V A;  4DHV A;  1EKS A;  4C8N A;  5CYQ A;  2AX1 A;  4NYZ A;  1S5Z A;  4ES3 A;  2BM0 A;  3QPI A;  4DSF A;  3D1Q A;  1LFW A;  4M5K A;  1DQ8 A;  4NRU A;  3H5U A;  4TYA A;  2Y8Y A;  1U09 A;  3VGS A;  3DRR A;  3M6V A;  1WKK A;  4YR0 A;  4I2Q B;  4GO7 X;  2ZUA A;  3I4H X;  2EKN A;  3MM5 B;  2QC3 A;  1Y11 A;  2XMT A;  3BGO P;  1VQ5 S;  1N32 F;  5IOL A;  2DR8 A;  2IY5 B;  4DV1 J;  3DXB A;  2I5J A;  1R89 A;  3W9I A;  1FRJ A;  1F9E B;  4YQW A;  2EG1 A;  1AW0 A;  4NLQ A;  2ASL A;  1YIJ S;  4P73 A;  2KJV A;  1RT2 B;  3GJT B;  2HGM A;  3GYG A;  4FDF A;  2IYG A;  1KFS A;  2VL1 A;  1RWK B;  3L09 A;  4OZJ A;  3NNA A;  2H5E A;  1K1Q A;  1J5O B;  3CD5 A;  1ZM9 A;  1VOM A;  2F8H A;  4KPC A;  2W4C A;  1C0T B;  3NAI A;  4ZCI A;  2OUG A;  1RT6 B;  2HRY A;  2HRT A;  1HL6 A;  2VOO A;  1NK7 A;  2D3Z A;  3T1Y J;  4Y28 C;  3MR6 A;  1S79 A;  5C5J A;  3TA1 A;  4KHM A;  2B4U A;  4MKB A;  3PW5 A;  1UCN A;  2CPE A;  1TL4 A;  3W2V B;  2GVZ A;  4W98 A;  3I5B A;  3QWP A;  3FMW A;  1WNE A;  2HAF A;  4PWW A;  4OZ1 A;  3HSJ A;  1S99 A;  1H7X A;  1MU2 B;  3F0N A;  3G6V A;  1ZYQ A;  4H4K C;  1T9T A;  1EQ0 A;  4IQM A;  3KG1 A;  4OLO A;  3KOA A;  2VOP A;  1ZA2 B;  4CLY A;  3MM9 B;  5A0Y B;  3R2D J;  1TL3 B;  1PJ7 A;  1TFY A;  3R5B A;  2B4V A;  3C14 A;  1ROF A;  1S76 D;  5KT4 A;  1R8A A;  2VC1 A;  4B17 A;  1UET A;  3CD0 A;  4B9N A;  2RQM A;  3CCT A;  2FYX A;  4FBT A;  4Y2A A;  4BLG A;  2MZ1 A;  4USV A;  1P9Y A;  2PEH A;  2KL8 A;  2W2N P;  3KK2 B;  1R8H A;  2OEL A;  3GFY A;  3FRY A;  4IDK B;  3I31 A;  2AQ4 A;  1U25 A;  4B3M F;  1GT8 A;  2Y1L B;  1NJZ A;  1JWW A;  3P5T L;  1KOH A;  3RZA A;  2QL9 B;  5EN1 A;  4XTT A;  1T11 A;  3T1H F;  1HBM B;  2JLG A;  1Y0H A;  2CWX A;  3VGV A;  3DGP A;  4CLZ A;  1F3F A;  3JSR A;  2KT2 A;  1TEL A;  2WVB A;  4X4U A;  2XG8 A;  2NZC A;  3ILL A;  2J8S A;  3LAM A;  4I7F B;  1FKP B;  3CCE S;  1ELO A;  1DQA A;  4ZCL A;  5F8M A;  2NYH A;  2W9A A;  1X4E A;  2APO A;  4USJ C;  4PAB A;  5EX3 A;  1QAY A;  2C3M A;  4JI7 F;  1SKU B;  4X64 F;  2WON A;  2CPH A;  1IKX B;  1S9G B;  2K3K A;  3MMC B;  3PYE A;  2BJ3 A;  1H73 A;  1WOP A;  1VQM S;  2AYE A;  4Q0B B;  2WSF C;  3FSY A;  1AFI A;  1VGY A;  3TUI C;  3HHD A;  3AJ2 A;  3Q83 A;  2AZ1 A;  2YKP A;  5FDL B;  1X4F A;  5IT9 U;  1XMQ J;  1VIX A;  1L3K A;  2CDR B;  3OXG A;  3OFF A;  1QUV A;  2HMI A;  4N5S A;  2C22 A;  1YTY A;  3CIM A;  6FDR A;  3MGJ A;  4K4Z A;  4LRA A;  4EUV A;  3AXK A;  1UEK A;  1EX8 A;  2W8K A;  4ECX A;  3ENQ A;  5KFB A;  4FF4 A;  3K57 A;  5KT3 A;  2E5L F;  2XSF A;  4C4W A;  4DG1 A;  1PO6 A;  2MHN A;  5IT9 Y;  3MDF A;  4KC5 A;  1UVN A;  1GAO A;  1RGV A;  3JTP A;  1YGY A;  3OL8 A;  1BGX T;  1SBR A;  1HQ2 A;  4KRW A;  1WHX A;  2GQ2 A;  5IZH A;  4CLF A;  3WX8 A;  4RBT A;  4NA3 A;  1SIW B;  1Y5N B;  1HBO A;  2X7I A;  3IWN C;  2O5D A;  4RNN A;  2B43 A;  4B9U A;  2DGS A;  5DDQ C;  1SJ4 P;  5CAA A;  2ZM6 F;  1ZH5 A;  4DV0 F;  3J7Y U;  1SCJ B;  5MAO A;  4O4G A;  2XCA A;  3BB5 A;  3R1L A;  4C3L A;  1SC3 B;  3TAP A;  3CCW A;  2KZM A;  1R8P A;  1ZS6 A;  4C98 A;  3H98 A;  4Z7C A;  3SV4 A;  3THT A;  1S0O A;  2JEJ A;  2IVM A;  3C19 A;  3Q0A A;  2AF6 A;  2DKO B;  3A8I A;  2B6A A;  3KLH A;  2LXU A;  4QR1 A;  2X1F A;  2DRD A;  1FD2 A;  4O0N A;  1NJY A;  2FUG 9;  4K2J A;  4ED6 A;  4NCA A;  3BGR A;  4ZVU B;  3Q89 A;  4K59 A;  1N33 J;  1EP4 B;  3G6E S;  3DI6 B;  2XGQ A;  3M4X A;  3DRP A;  4YHH J;  5HAT A;  2JZ5 A;  1N5V A;  4DU8 A;  4N8O A;  1ZZF A;  1E6Y A;  1RA6 A;  1N36 F;  2LMI A;  3HFK A;  3HFZ B;  3DLK A;  1FJ7 A;  1MN9 A;  3UDE A;  4DEZ A;  2OPS B;  2YX4 A;  3EVM A;  3SFG A;  3FCH A;  3KLI B;  5D0E A;  4NZ0 A;  4MMO A;  5K5M A;  4L75 A;  1JLE B;  5DLG A;  2FHJ D;  1NSQ A;  1R27 B;  1P9Q C;  1YBU A;  4OJH A;  4A48 A;  2ERR A;  3QLH A;  3H5X A;  1ZM3 A;  1RA7 A;  3C8Y A;  4C9D A;  3E3X A;  3FJ2 A;  3ILI A;  2MKY A;  2OPR A;  2C2R A;  2HGN A;  4WFA Q;  2F8M A;  2V8P A;  1RBA A;  4WTY A;  3MEC A;  2YKO A;  1NK6 A;  4NLG A;  4M5G A;  5KFQ A;  2JWN A;  2QGF B;  1GXT A;  1BD6 A;  3FFI B;  2CG4 A;  2RNE A;  3Q8U A;  3MM8 A;  2A0F B;  2HFZ A;  4R25 A;  4NZ7 A;  4A8M P;  3O6Q A;  3ONQ A;  3AOA A;  3J7Z T;  2R2T A;  2J7W A;  2GGP B;  3RAM A;  4TU9 A;  1T3N A;  3MMA A;  4Y2C A;  5HBM A;  2HVD A;  2YWW A;  3SCL E;  4LSN B;  3DM2 A;  3HPO A;  1R31 A;  3DRX A;  3C16 A;  4IH6 A;  1VI7 A;  1KBR A;  4EEY A;  4RNM A;  2JNJ A;  5CZV A;  3R1H A;  5HN0 A;  3G6Y A;  2DNO A;  1AYE A;  2P9G A;  4OV1 A;  1VYA A;  4C11 A;  3V4I A;  3CPW R;  1S4E A;  4AYB D;  1WEZ A;  2CQ3 A;  3NMA A;  3TEH B;  2NUH A;  2QSF A;  3PEH A;  4GVB B;  2HND A;  3VHQ A;  3RTV A;  3BJY A;  3KHL A;  3LH2 S;  4EMD A;  1P1T A;  1M1H A;  4DV4 J;  4KKO B;  2ZBQ A;  1LW0 B;  3HP6 A;  1H2U X;  1RKI A;  2IM3 A;  2VKZ G;  2WVE A;  3NBP B;  2XZW A;  4B9L A;  5BR8 J;  3V81 A;  1Q0N A;  3MM7 B;  2KRR A;  2CNL B;  5T14 A;  4KT0 C;  2MXY A;  3LP1 B;  4BC7 A;  4PUO A;  2UUC J;  4L3K A;  4AUK A;  2LEB A;  4ITS A;  1T95 A;  2Y1J A;  4IOB A;  5GMD A;  2VFT A;  1UKU A;  3OSP A;  4NEY A;  4R5P A;  2QJ3 A;  2MZS A;  2M52 A;  4H4M B;  4DL3 A;  1KC8 T;  2UZA A;  4DR5 F;  2KO1 A;  1OQ3 A;  2X1B A;  1Q53 A;  1HAR A;  1YZ6 A;  3T5K A;  4LF9 J;  1F0X A;  2Y3Y A;  3MI7 X;  1M0S A;  1K8A T;  3CUL A;  2HHW A;  3SCK E;  2B51 A;  1JLG A;  5F0W A;  3OFH A;  3H25 A;  4GC6 A;  1EET B;  4HT7 A;  4NEZ A;  2YQ0 A;  3PNI A;  3CDW A;  2GO9 A;  4NLR A;  2HBY B;  2F7V A;  3JSB A;  5HRO B;  3CC7 S;  1DUR A;  2DNY A;  3CCQ S;  2WVD A;  4RU9 A;  4PG8 A;  4U7C A;  1WSR A;  1T9Y A;  4A46 A;  2RQC A;  4XDC A;  1BC6 A;  2QIF A;  2B4O A;  1QJH A;  1U2R A;  2C3O A;  3QGP A;  3W2W B;  3DLG A;  3QAE A;  2R3V A;  5K14 B;  3UFC X;  2QX0 A;  4AQY J;  3VAJ A;  1VQ9 S;  1QVF R;  2GAG C;  1TKT B;  5I3U A;  4KGX B;  4DV1 F;  5C25 B;  3MEK A;  4OZN A;  4FVM A;  5A6P A;  3DOK A;  1WOR A;  4LIR A;  3ISN C;  1RT5 A;  1ZAX A;  3M8Q B;  5IC6 B;  5LJ5 Y;  4DR3 J;  2D9P A;  4CZC A;  3U7J A;  1U45 A;  2QSW A;  2ZH9 A;  3DYA B;  2MQQ A;  3UCZ P;  2YNG A;  3B78 A;  2J76 E;  4M5I A;  1UAW A;  2LXI A;  4DR2 J;  1S1V B;  2CPF A;  3GMG A;  4QR2 A;  1RT7 B;  1VDH A;  1UEV A;  3T1Y F;  5J2P A;  1DHM A;  2LQJ A;  4TLQ A;  5IM0 B;  2X3D A;  1H72 C;  4YB7 A;  3AT1 B;  2O1P A;  2HS4 A;  1PC5 A;  3GV8 B;  5DQH A;  1M5H A;  2Z8Q A;  4ATN A;  4Q43 A;  2DH8 A;  3K5N A;  2ILZ A;  3UDL A;  3HHL B;  1MML A;  2AKW B;  2XYG B;  4C3K A;  3UD5 A;  4ID5 B;  1S48 A;  4PG7 A;  2HIY A;  4LR8 A;  3ZTP A;  2O01 C;  2KFZ A;  2QLX A;  3DLB A;  5KOW A;  3TR5 A;  5KAK A;  4NI2 A;  4OI6 A;  4KIA A;  2NQP A;  5DQG A;  3QT6 A;  1TK0 A;  1HWJ A;  3X3U A;  3WBZ A;  4I6A A;  2FLL A;  3ET6 B;  4TLR A;  3A1Y G;  2R2U A;  1UFL A;  3IR6 B;  2KDO A;  4ICL B;  1H2T Z;  3CJ3 A;  4DDF A;  1XMO J;  2FHJ A;  2FVS A;  1BWV A;  2KRB A;  5L9N A;  4H4O B;  4ZS6 A;  5HAO A;  1LQ9 A;  1S6P A;  5GAG U;  4Q44 A;  3HVW A;  2ZH3 A;  4OYW A;  3HJV A;  1FVS A;  2DNN A;  1TKX A;  1TR0 A;  5CQG A;  1PGZ A;  3OV7 A;  2ZHO A;  3L95 X;  2KH9 A;  2AJ0 A;  4AD6 A;  5I42 A;  1KHV A;  4C48 A;  5KT7 A;  3QT5 A;  3NGU A;  4LF4 J;  3ETM A;  3LGN A;  3WQP A;  1RUS A;  1RWO B;  4KPY A;  1U1L A;  4IFY A;  4XO0 A;  4J7C A;  4N76 A;  1JLQ B;  1S1X A;  4CP5 A;  1GFW B;  1SH3 A;  1OYE A;  3N5B A;  1MRO A;  2B4P A;  2GMH A;  4TU8 A;  3BM7 A;  5GAG I;  4RX6 A;  3DMJ A;  1Q81 T;  2CA9 A;  2AGP A;  1X5O A;  4LFA J;  3EPI A;  1SV5 A;  3NWR A;  2E29 A;  3PFO A;  4YR2 A;  1B99 A;  3CSK A;  1X8D A;  2CJX B;  1HBU B;  2NLW A;  5DM7 Q;  3ZZP A;  2HVE A;  3EZ5 A;  3AA9 A;  5M2U A;  1NND A;  1RTJ B;  4I6Y A;  5A8W B;  1O51 A;  4JV2 A;  3AOC A;  1CEZ A;  3M8S A;  3MD3 A;  2FVQ A;  3HDS A;  2P5V A;  2CG8 A;  3GYX B;  2H5I B;  3LAN A;  3UI3 A;  2QV6 A;  3H20 A;  3MR5 A;  2RDJ A;  1KP6 A;  3AOB A;  2EFN A;  2MQP A;  2IPO B;  2DIS A;  1S1U A;  1W2B R;  1XMQ F;  3BDP A;  1KVI A;  4DFP A;  3TQ1 A;  4DV3 J;  1REV A;  3VF0 B;  4F0H A;  3H0P A;  4J9N A;  3KMS A;  3O2I A;  4LSL A;  1PAU B;  2HBQ B;  2J6T A;  3VVT A;  2ZEJ A;  3DHX A;  3W61 A;  2DHX A;  2IA0 A;  1P6T A;  3VZH A;  3RYL A;  1U24 A;  3D6H B;  4ZHR B;  1YVF A;  4IG0 B;  5JXS A;  4QPX A;  4B08 A;  1H0H B;  3IGN A;  3KUE A;  4C7Q A;  1S9E B;  2FVC A;  4ECU A;  4URS A;  1KKH A;  5F3T A;  4F4A A;  5J2N B;  4B9S A;  4ZVP B;  5ETQ A;  5LT5 A;  1APS A;  3MMB B;  2E7X A;  3PW7 A;  1R6Y A;  2OTL S;  1BHN A;  4DBQ A;  1QSL A;  1UFW A;  2HG4 A;  4Z37 A;  2XLK A;  1EKR A;  1LWC B;  2WHO A;  4NOH A;  3LPE A;  3ZC4 A;  4C0H A;  1ZPV A;  2CPI A;  2AEJ A;  1QAJ A;  2CPJ A;  1TVR B;  3MM5 A;  5SZT A;  1F9F A;  1DQ9 A;  4J9L A;  5AE1 A;  1T3O A;  3EWG A;  1TL1 A;  3OJU A;  2Q79 A;  3KWM A;  4OX8 A;  4P7T A;  4JP8 A;  2LQ9 A;  2ZH7 A;  5CYM A;  2QA2 A;  2ALZ A;  1AB8 A;  4OFZ A;  4HEA 9;  3AB2 B;  4Z7Y A;  1T05 A;  1J5O A;  3M2R A;  5HMW A;  4FYY B;  1C0T A;  4QIW D;  3PEJ A;  3BKU A;  2M4M A;  4OZL A;  3ZTQ A;  3PX0 A;  3BN7 A;  1U1R A;  2VKR A;  5KTQ A;  2J9E A;  5A6W A;  2AX0 A;  2Z2L A;  1VQN S;  2P9C A;  2KN4 A;  1NPK A;  1TUV A;  2CJQ A;  3NLC A;  1SJ1 A;  1N33 F;  5E3P A;  1BQM B;  2L08 A;  3MEG B;  5EUH A;  4JUZ A;  2RU3 A;  5C24 B;  4F26 A;  4R8U B;  3KJV A;  3BEG B;  2XEX A;  1MU2 A;  3CE8 A;  3A8E A;  5KFC A;  4YHH F;  1NCL A;  4QWC A;  2PA3 A;  4P71 A;  1CS4 A;  4J9Q A;  3BS9 A; 
#chains in the Genus database with same CATH homology
 2Z58 B;  2W2N P;  1SCJ B;  3BGO P;  3CO0 P;  4K8R A;  3WIV A;  2W2O P;  2W2P P;  3A3P B;  1ITP A;  2Z30 B;  3VHQ A;  2Z2Y B;  3WHI A;  2W2M P;  4OV6 A;  2XTJ P;  3QFH A;  2Z2Z A;  2ZWO A;  1V5I B;  3GCW P;  4NMX A;  1R6V A;  2W2Q P;  4YN3 B;  4JP8 A;  3AFG A;  3T41 A;  4NE9 C;  3GCX P;  3VV2 B;  2QTW A;  2PMW A;  3A3N B;  3SQO P;  3P5B P;  2Z57 B;  3BPS P;  2Z56 B;  3H42 A;  2E1P A;  3WIU A;  3CNQ P;  2ZWP A;  3A3O B;  1SPB P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...