4HT7A

Co2 concentrating mechanism protein p, ccmp form 2
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
203
structure length
203
Chain Sequence
VELRSYVYLDNLQRQHASYIGTVATGFLTLPGDASVWIEISPGIEINRMMDIALKAAVVRPGVQFIERLYGLMEVHASNQGEVREAGRAVLSALGLTERDRLKPKIVSSQIIRNIDAHQAQLINRQRRGQMLLAGETLYVLEVQPAAYAALAANEAEKAALINILQVSAIGSFGRLFLGGEERDIIAGSRAAVAALENLSGRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CO2 concentrating mechanism protein P
publication title The structure of CcmP, a tandem bacterial microcompartment domain protein from the beta-carboxysome, forms a subcompartment within a microcompartment.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Protein binding
total genus 62
structure length 203
sequence length 203
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2012-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ht7A01
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ht7A02
3F56A 3U27A 5LSRA 4HT5A 3MPVA 3GFHA 3I82A 5L39A 3I87A 4HT7A 3FCHA 5SUHA 5LT5A
chains in the Genus database with same CATH superfamily
2F4FA 5J2MA 4UY8T 3IRWP 2MSTA 3CEDA 1SC1B 4PPDA 5M2RA 1D9DA 4PABA 1AB8A 4ECVA 4B3RF 4O3PA 4YDDB 1K8AT 1ZPVA 1N32J 2XLKA 1BQNA 5HVGA 3HKWA 4MYTA 3MXHP 3R6LB 3G82B 3CC4S 1MG7A 3R7BB 3KK3A 4LIWA 4LQ3A 2K06A 2XNQA 1RTDB 5KFJA 3VGUA 2YNHB 2PMHA 2KT2A 4EU0A 4WIIA 2ZM6F 5AJ3F 3OTCA 4O3QA 2IDLA 3C6UB 3SYZA 2R9LA 1JLCB 4YFUA 1RTIB 5A76A 4TYAA 3GYXB 2J0XA 4RNOA 3NBPB 4DPTA 3AT1B 5CYQA 3CE8A 4O23A 5JJBA 2NXNA 3VF0B 2K8GA 3NS5A 4A48A 1KVJA 2C2KB 4K5RA 2OPQB 3BYPA 3NS6A 1S99A 1RYSA 1K9MT 2HAFA 2V8PA 1HBNB 4H4OA 4OHVA 2BJDA 3J80Y 5GAHI 2FHJD 4NE9C 4DV7J 2EBEA 1KC8T 5HP1B 2BOPA 3CDEA 4FYYB 3RBXA 2YQ0A 4KFBA 3W3SA 4NLVA 4DUTA 1PYTA 3IN5A 3EDRB 1RAIB 4AXJA 3M8ZA 3LUYA 2ZH1A 3M8QB 3A3PB 4KGVB 1HI1A 4WPAA 4DPWA 2BW2A 4KY3A 1H98A 3HT3A 3D6FB 2VPYB 2ZFHA 4NCAA 3BB5A 3HO1A 2H65B 3IXQA 4O4RA 2Z2MA 1U47A 3OBIA 4IFVA 3QWUA 1X5SA 3AFGA 4NYZA 3Q22A 1NDPA 4DFKA 4ZP9A 2RQCA 2DR5A 3HVRA 1U8SA 4ED4A 2AQ4A 4JI8F 4LFAF 1U0HA 4HHJA 3JSMA 2HHHF 2YQ1A 1F9EB 1CULB 8ATCB 5KFBA 4A46A 1XNQJ 4LF4F 3EUNA 1R89A 2BKNA 2OELA 1NUEA 4TN2A 5D77A 3H98A 2ALZA 1N34F 2KVIA 2W25A 1Q95G 3OFFA 1FESA 1NJIT 3R2CJ 1SV5B 3I4PA 3SQGA 2UUCF 2KFZA 4IKAA 5KG7A 1CJKB 4UF4A 3MM7A 5J1EA 1QSLA 1HR0F 3J7YI 4DL5A 2F7VA 4B3MF 2C3YA 4P74A 3TAPA 4LF7F 2MKSA 1UL3A 3ICLA 2YNFB 4UUXA 3Q8UA 3SSQA 2FVSA 2P5VA 3VCDA 3PRDA 1FK9A 2VKRA 2P9CA 5ETQA 3HLUA 2HZCA 2DXDA 5DDQC 2FJAB 4WCEQ 4F7VA 1IJFB 3IRXB 3NGRA 5CXTA 1TU0B 5FJ4A 4IOAQ 1IR0A 5B0EA 3CPWR 3LP2B 4YOEA 4G3IA 3FQKA 4MIBA 3R7SB 3MAAA 4DL2A 2BRKA 1F3VA 1BQXA 4YHHJ 3GG0A 2VASA 2E5IA 5HVFA 5F3TA 1Q82T 4TU7A 3OL6A 4R5PB 4WF9Q 4KTQA 1LWFB 1BMQB 3CCQS 1P9QC 1RWKB 3CGIA 2W9BB 4AL5A 2HHQA 5LXYA 3G96A 3FBCA 1UJ6A 4F2SA 1NHUA 1CC8A 4C3LA 4J9NA 4HDGA 1U6FA 4U95A 1KFDA 3MR3A 5HSPA 3M8RA 3T5KA 3L95X 5BYQA 3BDEA 1T95A 2M4MA 1S9GB 2ZDPA 4CLZA 5DDRC 4ZN3A 3N4WA 4C8ZA 5KFMA 1W7WA 2N3LA 3MPVA 5ETNA 1GFWB 4V19J 1FT8A 3FEZA 2AV5A 3PKMA 5IT0A 2C2RA 3I9V9 3LANA 1NHKL 3LAMA 3EZOA 2U2FA 3O6QA 1BQMB 3GE9A 3RJMB 2D74B 1FE0A 1U4BA 4NZ0A 2N4DA 1KQFB 2AKWB 2FD2A 2WW8A 2M8DB 4HI2A 5SZTA 5B09A 1S6QA 2RQKA 3FRZA 3C15A 4HHHA 4IG0A 3PYEA 3QFWA 4FN5A 4U67Q 4NMLA 3ZZ0A 2W2NP 4ANCA 4FYVB 4JV5F 1C4CA 5FLXU 2Q3PA 2VZ9A 1FKAF 1IBLJ 2BABA 3TQEA 3MUTP 3BGFA 4EBCA 1VQSA 4UOGA 5HMXA 2C28A 3BKFA 4DV3J 3FDSA 3N5FA 2OEMA 1KFSA 2FHMA 1KD1T 4IR1A 5AE2A 2GX8A 3CIMA 2R2RA 5K8MA 1MNEA 2B4PA 2AYMA 2G0CA 2OO4A 3R9LA 2Y9HA 1WDDA 5ETKA 4Q5VA 3PO5A 4PUOB 5HJXA 1QD1A 4LRCA 3UQSA 2HHVA 4U8YA 2VA3A 1Q5VA 3ELHA 1JLCA 1H0HB 4KSEB 4TKTA 2MGZA 4HVZA 2CZ9A 2ATCB 4FNIA 3TJAA 1NSQA 3SI8A 1C1CB 4W98A 2V63A 3VQSA 2R7TA 3PYGA 5LSRA 1XTZA 3EPIA 4XAKA 3DGPB 5LJ3Y 4CT9A 2LXIA 4JP8A 1X4AA 3A1YG 3UN5A 2YTCA 5A2QY 1MMLA 1TKXB 4RL1A 3QJJA 5KG3A 5ETLA 3KHGA 2NLWA 3TUZC 2OFGX 4WP8A 3RAQA 4QIEA 5G4DA 4FF4A 1FI4A 1J5EF 1T9WA 3DLGA 4KV8B 1S1VB 1SC4B 2BRLA 2O66A 3K8WA 3CO9A 1VQOS 3RB6A 4K4ZA 4YY3F 5F8NA 2JZ5A 3AJ2A 4CLPA 1C1BB 3QRQA 2HK3A 4YR0A 3N6LA 2HBYB 3EGNA 4DV2F 2QL5B 3M8PB 5K5MA 1FJCA 1Z4UA 1Y7PA 2DNNA 3NGTA 3M8QA 1KTVA 3LW5C 3GIJA 2AYEA 4GMKA 1VR6A 4DSLA 3V2UC 3S1TA 4M5MA 1Q8KA 2R7VA 3TAQA 1OY8A 4OYAA 3MR6A 4DU7A 3T1YJ 3NOGA 1M5OC 3PJWA 4K4UA 1GXTA 1UVJA 1CQMA 2KN4A 2LA6A 2VQEF 2J9DE 2V0NA 3VV2B 3EYZA 3M8YA 1WG4A 4WP3A 2OD6A 2EPIA 4HL9A 1EP4A 5DQIA 2H48B 3KJVA 4HT5A 4S0MA 1JLFA 4I1TA 1FFWB 2J9DA 8AT1B 2MLXA 1JLEB 5DZ6A 1TKZB 4ES1A 1S1WB 2DK2A 3BR9A 1OSCA 3ZNJ1 1FJGJ 4EK2A 2VODA 4E0DA 1K0TA 3PTWA 2JOQA 1S0NA 1JLGB 1RKIA 2DHHA 3IGVA 3MMAA 4LF2A 3GIMA 3TW0A 1RBOB 2AMCB 1RXOB 3MZIA 1FDDA 2RRNA 2VFUA 1RT2B 1WDTA 1Y4ZB 1FWPA 2ZOGA 1SJFA 4QW9A 4E98A 4JI4J 2YNFA 1KQGB 2XNRA 3QWPA 2RDIA 1QE1B 4KJIA 4NZ7A 2FVQA 1FFSB 3T19A 3OJSA 1ICEB 2UXBJ 2NPFA 1MWQA 2V9KA 2HPUA 1JXLA 2MKKA 1OMSA 2XEXA 3T3FA 4MT1A 1AZSB 1REVB 4WFZA 5HANA 4CIOA 1HA1A 2FZCB 5DQHA 1TVRB 3LP2A 2E44A 2CQBA 5GAGI 4WK1A 3MEEB 5C25A 3GWCA 7FDRA 2MQMA 2AJ2A 2HNYB 2D3ZA 2IJRA 3PYFA 1D9AA 1TMJA 3AHPA 1V3ZA 3HDSA 2KG1A 4F4XA 3M2RB 3EVMA 1NJWA 1U02A 1RA6A 2IBKA 2GAHC 3GB0A 5F8GA 2KL8A 2KXNB 1MU2B 3ITHA 3V6DB 1HWLA 2CJXB 1RISA 2X51A 2CQ1A 4ES3A 1C0TB 3MECB 3M32B 1YLXA 2HYIB 1T11A 3PX6A 1FNOA 3L09A 2W2QP 3OLAA 4EUVA 1X4DA 3DLEA 1R7IA 1UPMB 2FHJA 3H4BA 3I5CA 3DOMA 2HG4A 2MQPA 4Y65A 3KK1B 1XMOF 2B9EA 2EVZA 1RTJB 1IBMF 2W24A 2ROPA 1RADB 2KXFA 2BOAA 3LP1B 1RWUA 4ZIVA 4X62F 2QGFB 2NS1B 1D8YA 2DCLA 1N5TA 1D0EA 1RU2A 1MSWD 3MGJA 2JFDA 2DGSA 4DV5F 5B0CA 1S49A 2LYVA 1KN6A 3MPDA 4I6WA 2UU9F 3S7RA 2ACYA 2ZZNA 4OZ0A 5F8HA 2CPEA 4DSIA 4EYHB 1RACB 1T7PA 2BKPA 2C2OB 3DRPA 3CCVS 3P4UB 2VBWA 2LXFA 5ETMA 2ASJA 1NCLA 2JNJA 4DV4J 1PCAA 1F3FA 5AT1B 4D3GA 4EO8A 5LM7E 4CO3A 2OPPB 1RT3B 1N56A 3V4IB 1U2RA 2F4VF 2POKA 3MCMA 1FWLA 4DR2J 4USVA 1O8BA 3PZPA 3MM8B 5CA5A 1ZAVA 3OR1B 1IN0A 1B70B 3W9HA 5HROB 1DJ0A 3C14A 1WNEA 3DMJA 2H5JB 1F60B 1ZM3A 4EWTA 3DGPA 4C9DA 4RW6A 5HJYA 1TKXA 4MJKA 2YPZA 2MKCA 1DTQA 4ECSA 1M1GA 2FUG9 5M2PA 2B9YA 3DLJA 2R7RA 4KGMA 1CLFA 1ZM2A 4DL6A 1RWOB 2H51B 4DUZJ 2W4DA 2B56A 1R8HA 2DPJA 4ED0A 3TEGA 2OH2A 2W4CA 2NR0A 3JSYA 4F0KA 1H2UX 2ZNYA 3SCLE 1QVGR 4C7QA 1DY3A 2XM3A 1N5QA 4HTJA 2W7OA 2EXUA 3D7SB 4RLEA 2UV8A 4OI0A 1GNKA 4GC6A 4YB7A 1WF1A 3UDVA 2M0GB 3IBFB 2GMLA 4QYZJ 3T9ZA 4KB7A 1U25A 3CTRA 4WIQA 1JJCB 1SQFA 4F3OA 2B6AB 3NG8A 4Z7CA 1KQKA 3OVBA 1KR4A 1E6YA 1TL3B 4A8KA 1NJYA 2RU9A 1P8GA 3FMWA 4F4ZA 1LW0B 2Q1LA 4TU9A 2VFTA 4JUZA 2CJBA 2HNZA 3MOZA 4Y34A 3HT0A 1FJEB 4EO6A 1RE1B 4N8NA 2BXJA 1SH2A 4X66F 2PSZA 3HMJG 3F0NA 4ELTA 5AXLA 2VUGA 1TKZA 3TUPA 1S1WA 3J7Z5 4KR0B 5E41A 2CJYB 2YNIB 2EKNA 3ZFVA 2HVIA 2HURA 3BGLA 5CD4H 1Z2LA 3C66A 3UD5A 3DOLB 4BDPA 4E8UA 3KLVA 2WSFC 1JLGA 3BKUA 2QLWA 3I4HX 2MSSA 1D09B 1SH3A 4QQBA 4M1KA 3QNWB 3D28A 4GKKF 2NQPA 1X0PA 4DXLA 2FZGB 2XBPA 4JB8B 5LSOA 2LQ8A 1RT2A 1KNZA 1KOOA 4GKJF 2HNDB 1I6JA 1K1QA 4MK8A 3C6TB 5L8RC 3DRRB 3BN7A 4DF4A 1QE1A 4ITSA 3NCRA 3UR3C 4M5JA 3O2IA 2IFXA 4IO1A 1VQPS 2CYYA 1KLMA 4DR7J 3PJXA 1I3OB 3GTYX 1REVA 1T8EA 2RF2B 1TVRA 3E01B 4DZDA 3M05A 3KMSA 3RGIA 4CDIA 2BE7D 2W1BA 5D3GB 3GSDA 3MEEA 4QWBA 4DR1J 2F63A 4ECUA 2R3VA 4N5SA 4I2QA 2HNYA 4PWDA 1N4LA 2BE2A 2GA7A 1SPBP 1HI8A 1ZPWX 4ZPVR 3K59A 1YBUA 1WC3A 4YEAA 4B3TF 3QQCD 1HWIA 4NXNJ 1FRJA 2V67A 4EGLA 1HD1A 5RUBA 3DLHA 4H54A 5E2QA 1DLOB 1MU2A 1XWLA 2L48A 4LVOP 3MMBB 3HFVA 1A6LA 3C3LA 2PFFB 3DXBA 2V2VA 2DR6A 2W2PP 3M32A 2P6TA 4WU3A 3KLEB 4JI2F 4JV0A 3BF4A 4NASA 4XO0A 2BW7A 3CCUS 2CJKA 2EFPA 1XJWB 3AH6A 2BMBA 2H3EB 4DR6F 3KK1A 3QGPA 4M95A 1IKVB 3M8SA 2VJUA 3FK4A 2F9JA 2R7WA 1YJVA 2EFNA 4HACA 3KWMA 2MQNA 4KHPJ 1HNWJ 1HWUA 1VLOA 3Q8RB 2OTJS 4NLOA 1NK7A 4URSA 1FWKA 1UVNA 2E9RX 2HWHA 4F0MA 3CWJA 1SJRA 2AF6A 4L74A 1EAYC 1HWJA 3KG4A 4I2PA 2W4PA 4J9SA 4IFYB 2AW0A 2CPHA 4MK9A 2I1RA 4LFCJ 4CM0A 4A8QA 3K5NA 5IT9Y 1VRQC 1PAUB 3JXOA 2VFVA 4DL0C 5DG9A 3HSGA 1CEZA 3W1YC 4LF8F 1PC4A 4C3MA 4NCGA 3AXMA 4NLQA 3OVAA 2WSCC 3ETMA 3IWLA 2NXCA 3VAGA 1LEOA 1RT3A 3IR5B 3WHIA 2D69A 2GVZA 1DTTA 3V4IA 1YDLA 1IQTA 4ILLA 1DARA 4OYZA 1VCTA 1KWMA 3MM8A 1W25A 4OX6A 3OR1A 4NLSA 3NNHA 2KYZA 4DPUA 1MWYA 4RBTA 1VRTB 5HROA 1TL4A 2JSXA 3QO9A 3PXGa 2H1YA 2M8HA 5E5NA 4FS2A 1SL1A 2G1HA 1NB2A 2CPJA 1H7WA 3AXKA 5I3QA 3SIPB 2Y1JA 2G2YA 3BS9A 1SUQB 5I3PA 1HNZF 4Y00A 1ACMB 1WF2A 4ALZA 2OI2A 3H5YA 4XPEA 2XHWA 2D3O1 3KG0A 3I0SA 2HS4A 4P9SA 3I5BA 2BJ9A 4UT4A 1HW8A 1HHQA 4ICLB 1RLCL 3O3LA 2VF3A 1S76D 2C2MB 4QR2A 2F40A 3AA8A 3NLCA 3DXSX 3SFUA 3G9CA 1TL1A 2B4OA 1IJEB 3MD3A 3UDEA 2DEJA 4O44B 1QJHA 5I42A 4NXMF 5B0BA 2V6AA 4J9UE 3AQPA 9ATCB 3M2VB 2YX1A 2LMIA 4RW9A 3W64A 2J0WA 1S6PB 4EMDA 2VHGA 1F9HA 3THTA 3TA2A 4ZVGA 3HK2A 5HAOA 4CH7A 1T05A 2BA9A 3TEHB 1CJTB 1JJ4A 3ZZPA 1X4FA 3BQ1A 1U1OA 5IXUA 2IA6A 5AE1A 1N5VA 1YWXA 1VQ4S 3H2LA 3UN2A 3U02A 2J0QD 3GILA 2KHDA 2CQPA 2Z2ZA 4O4GA 2CG4A 4C11A 4IH5A 1HHTP 2XGQA 4P2FA 1LW0A 2HQGA 5J2QB 2X1BA 3UCGA 3A8EA 1SKSA 4CLWA 1YJNS 4DQPA 1TKTA 5D4LA 1YZ6A 1CS4B 5KFQA 4NLXA 3GQCA 3U27A 2YKMA 3Q0AA 5HMYA 3ENQA 1PYOB 2OPRA 4BBYA 1BHNA 1PJ7A 4IG3B 2W2MP 4CH0S 3TA1A 3Q8PB 1U6BA 1U0SA 4Y28C 5LMUF 2EKYA 3J80U 1UP1A 4NLPA 4DHVA 4PG7A 2NXEA 1H2TZ 1X60A 3FFIB 2Z58B 3LGNA 1VGYA 2E5HA 1WSVA 1GQEA 4OZJA 3UDLA 2ALYB 3AD8C 1H73A 3RBZA 2VOPA 4DEZA 4X2BA 3QIPA 2Q79A 2WB1D 4KPCA 3DRRA 1JKHB 3CDAA 3N9UC 1P27B 1WI6A 1VC5A 3PW7A 3KLIA 1YQHA 2K2PA 5I3UB 3GR0A 5A0YB 4V19X 1ZTTA 3TP2A 2CWXA 3ZTRA 4LRAA 3DLLQ 2RF2A 2GHWA 2QFJA 1JJHA 1Y9OA 5D3GA 1JXVA 3KMQA 4CCHA 1ZH5A 3CJ0A 5HLFB 4HH0A 4DPOA 1YJWS 1QLNA 1FRLA 1U2FA 3SV4A 4ZPCA 4F25A 2CIMA 3Q89A 2GMJA 1WKLA 2NXJA 2HFVA 2IJFA 5EHHA 2XWXA 2COLA 2GFFA 1EJ7L 3L7OA 2HMIA 3FUYA 1HD0A 1FHTA 4P7VA 4JI8J 1H72C 4LFAJ 1JNRB 1R8PA 3HVTB 4ZVSB 3DRSA 1WHVA 3MMBA 1R0AB 4B9NA 4LRBA 4G6VB 3KLEA 1QVFR 1G4CA 3NCPA 4KO0B 3KDNA 2D3UA 1N34J 2MY8A 2B4VA 2P8IA 3EXCX 5KG0A 4RU2A 4LBIA 4HH1A 3WZ0A 4X64J 1UW4A 1HR0J 2DBBA 2JWNA 2K3IA 2BJ1A 1WHYA 2Q6BA 4JOUA 1FO1A 2FIUA 1JIHA 2QYGA 2Y3YA 2Y8WA 5IWAF 5FDLB 2KZMA 3GZ7A 4GO7X 2QL7B 2AGOA 2UXDF 4OI6A 3I82A 3UDCA 4YMEA 4RNFA 3J81j 2HBQB 2DH9A 4U8VA 2NXUA 3AB4B 1VBXA 4BHQA 5KG4A 1RWWB 2BANA 2IA0A 4I68A 4OYBA 3KLFB 1GH8A 3DRXA 3GV8B 3UN3A 2GS8A 1Q86T 4DQQA 2QIFA 3ZZOA 4CLLA 2A10A 5KT3A 2QYCA 1S97A 3V6KA 2DNPA 2R2SA 1WJ9A 5C24B 4A8YA 2AWZA 2PI5A 2XI3A 3QT8A 3ZZUA 1HFEL 3CCZA 5FIIA 1M5KC 2CADA 2H5EA 2RMLA 4HLBA 3DI6B 1OPZA 5G0RA 2ZOFA 5EWFA 3IG1B 3LO3A 3QRPA 1IUJA 3K17A 4TYBA 4ID5A 3JYTA 1GXLA 4OZ3A 1N8RT 4ICLA 2UZAA 2QSFA 5AE3A 2OIHA 2K1RB 1VC0A 3BPDA 1KBRA 1NSKL 1C2PA 1M5PC 4OQJA 3M2VA 1Q78A 1R8AA 4RJVA 3H7HB 2RIJA 3K5LA 2MXYA 3B78A 2DB1A 4H4KA 1B99A 3I96A 4PXDA 4KKOB 2WVEA 1L5UA 2KTQA 1T9VA 2M70A 2DGUA 2FLNA 4DV6F 4QWCA 2FVCA 4FYDA 1S4FA 2ZJRQ 1OQ3A 4C6AA 4LMZA 1VOMA 2LQBA 1CJVB 5E3CA 3DYAB 4IR9A 3OV7A 4LSNB 4C8KA 2LXUA 2W9CB 4NPOA 4WFAQ 2IYIA 4WKYA 1XK8A 4J9LA 3SCIE 4Z7YA 2EK6A 2FZKB 4OZ2A 1LV5A 2HZVA 1HYSA 2WTFA 5BYSA 3H2UB 1WTFA 5F3ZA 4F3QA 1CS4A 1H3DA 4USIA 1PG5B 1O5JA 3CJKB 1JB0C 3CD7A 1RWXB 4F8RA 3RB3A 3MMCA 2OPSB 4PAAA 4ANDA 3OJUA 3W2WB 1S6UA 3DCAA 5E7OB 3EDQB 3KLHB 3BH6B 5KT6A 3SBMA 4PG4A 4GVLA 3A8KA 3FFIA 3PIOQ 2DNQA 4CLFA 2MDAA 2BJ8A 3RRGA 5K8PA 2HFZA 2RS8A 4F2RA 1IKXA 1J5EJ 4OYIA 4JI1J 1TK5A 2F8EX 3PEHA 5JUMA 2MEWA 4DLGA 4YY3J 4PXEA 1BGXT 3DFEA 1JKHA 4NWBA 3QT6A 2VQFF 3MM6A 3I0RB 3JTNA 2LEBA 4BWJA 4I56A 4DV2J 1WC4A 3MTJA 3MPUB 4MKBA 4I7FA 4UOCA 5I3UA 4DWIA 3DM2B 5A0YA 3PRVA 3GFHA 4K4YA 3W2VA 5BXIA 1X5PA 3TVZA 2RB7A 2V8DA 1TELA 4IQXA 2IAJA 2HVZA 1SI9A 1RBLA 2QE5A 4C4WA 5ETVA 2PEBA 2GAGC 2WW4A 3GU0A 1VQLS 2CQ0A 3OR2B 1NK5A 3NXZA 3LA0A 1R6VA 2BR0A 4K59A 4BCAA 4ZCMA 2D9PA 2FC8A 4I0WA 2RRBA 1HMVA 3P5BP 2OKQA 3D0IE 3NNAA 3J81Y 2DVIA 3HVTA 4DMZA 2DTJA 5BR8J 4OYWA 1Y00A 1UFLA 4NRUA 2AP6A 1N5SA 1L3UA 4IYQA 2EFGA 4HYKA 5DETA 1WC0A 1NH7A 3AD7C 4KO0A 4RW8B 1UFWA 4RX6A 2VB6A 4C8NA 1K0VA 2H4WB 1OQ6A 4ZVUB 3P5TL 3V81A 1VISA 1HQEB 4C97A 2HRYA 4BC9A 2MY7A 4Z37A 2K3KA 4ELVA 2BJEA 2RNEA 2V50A 2GIQA 3POTB 3KG1A 4OLPA 1GX5A 1Q79A 4G1QB 4Y6IA 2E1RA 1D1UA 3CJ4A 2FJXA 1B0VA 2HK2A 3GONA 2N82B 1VLYA 2N4CA 1RT6B 3ILOA 3KK2A 2ZH4A 3GSIA 3UNGC 2CG8A 4W4MA 1T3OA 4OHWA 3AQOA 2DXEA 3G6XA 2KFYA 1N36F 5EGYA 6AT1B 3ISZA 3RYLA 2GJIA 5KFTA 4F50A 5C42B 3GG1A 3EGZA 2LCWA 3IBCB 1BWVA 3KLFA 1L3SA 2GO8A 4H4KC 4JI3J 2J8SA 4ETXA 2E1MC 1PJ6A 1NRKA 2HHPA 1RT5B 3BKTA 5IV4A 2YVSA 3CDUA 4X65J 3CULA 3A12A 5A8RB 5E33A 5BJRA 1PYSB 4NLWA 3D0HE 3X3UA 4OLOA 2DGWA 2A6OA 3I32A 3W8GA 2X3DA 4C48A 4WFYA 3KUEA 1UVMA 4RUAA 2CAJA 1K44A 2VG7A 1UEUA 3I31A 3SZ2A 3MM5A 3UO0A 3V6JA 3H42A 2KRBA 4QYRA 1TL5A 3TZYA 3ZNUA 3NMRA 1XMOJ 4EBEA 4PPZA 1IBMJ 3CJ2A 3BYRA 2AEJA 4BWMA 2UUWA 2X1AA 2JLFA 1BD6A 4X62J 1F1BB 2FLLA 3TJ8A 5KFNA 4PXCA 3A8IA 3HF5A 4ZLPA 2C2ZB 2BACA 3F73A 3IBWA 4KKOA 3D4JA 2I5JB 2DNKA 2GW8A 4CQ1A 5J1NA 2XMMA 3UVJB 3DU5A 3PJ9A 2UV8G 2CJAA 2UU9J 2ACMA 3Q8QB 4U6PA 2VC0A 5H9FK 3WQPA 5GAHU 3LP0B 1RA7A 3DYAA 3ET6B 2V4JB 3W65A 1WACA 1LK5A 2W9CA 2YWHA 5CHCB 2RE1A 1EETA 2IRYA 3PHEA 2XS2A 2CPXA 4GVBB 1KHWA 3P49B 1Q0NA 3BH7B 4DV7F 2YNGB 3QGGA 1K73T 1VMBA 2WRMA 3O44A 3IA0A 3T1HF 1ZETA 1YBAA 1M90T 4W92B 4ZCLA 1BC6A 2Q43A 2D41A 2QLBB 3CJKA 2I2YA 1FDNA 3DDNA 4K2JA 5LXRA 2NYHA 1URNA 4FKXA 3HHNB 2OPSA 4KPYA 3KUHA 4F02A 1HI0P 4USUA 1V5IB 2HVHA 4LF5F 2FQQB 3IO1A 3BZQA 1WUUA 2ROGA 1LWCB 3EVWA 2B3TB 2FHKA 3MEGB 5T14A 3KLHA 4XTTA 4A8MP 1PC5A 1TMMA 2JEIA 2XO6A 4YS2A 2B8QA 1AA1B 5ITHA 2ZH7A 3ONQA 3RB0A 2ABYA 2WOMA 1JX4A 1PO6A 2QG9B 2MLZA 2JVRA 4ZVFA 1BXNA 2E1PA 4UZBA 3T9NA 2QX0A 3TR5A 1RTZA 2KM8B 1MROB 2Q66A 5KG2A 4MFBB 4MH8A 2DGXA 2ZVIA 3MAQA 4K5SA 3MAHA 3GPAA 1SL2A 2XMKA 1J2VA 2OHDA 2BJ7A 2CNOB 3I0RA 3E8OA 1HARA 4LT6A 5C2CA 3LF0A 3MWBA 3FQLA 2V4QA 3VALA 4ECZA 2EK1A 2KZZA 2DYAA 2L9WA 3GFZA 4WJBA 1EQMA 1HBMA 3C46A 4F4AA 2GCFA 1X4CA 1S0VA 2GIFA 3JQJA 4O3OA 1FVQA 3NY0A 3VGVA 3SDEA 1UCNA 2F65A 3Q83A 4B9VA 1QSSA 3OR2A 2MQQA 3PEJA 5KG6A 3EE3A 1S12A 1XERA 2LDYA 3HD1A 1VHIA 2IC3B 2G4BA 4USWA 3PX0A 4J9QA 2GGPB 3RB4A 5DGAA 2WBRA 2KVQE 1F9FA 3M1VA 3W66A 5KG5A 2VDHA 3EZUA 1JLAA 4X66J 3KJNB 1RABB 3H25A 3EVOA 2FJEB 1NZAA 3D1OA 5D15A 4IUFA 4N8OA 1IR1A 4R25A 5CQGA 2FYXA 4QWAA 2X1FA 1NSPA 4P71A 1S6OA 2GQ2A 4R0EA 3KTQA 3TANA 3I5AA 2MZJA 4M5NA 4KYZA 1L3TA 1KOHA 3OXFA 2FJWA 2M2BA 2OGUA 2AIRB 5L1JA 5EN1A 1RCOB 1XR5A 2Z4PA 4JI5J 3CO0P 5ETSA 4DQIA 2J7KA 1H38A 5HL7Q 3G8TA 4GKJJ 4DR3F 4C0BA 4ZK7M 4PQUB 3BGRB 3KDOA 1X4BA 2MKYA 3GIKA 2IM1A 2IHR1 3MHYA 2HEKA 3BR8A 2N3OA 5GADU 2RKIB 3QPIA 1FRHA 2V4RA 2HGLA 2HFUA 1HBUA 4EI2A 3AB2B 4ECTA 2K7KA 1RT7B 2UUAF 2J76E 4DX5A 3M8WA 3ZTPA 2APOA 3IC1A 3LALA 3MM9B 2OMLA 2QMUB 1RB0A 3NOCA 5C42A 1WC5A 2V2QA 1QAXA 3GV7B 2JRSA 3B4DA 1I1GA 2ZUAA 1NM2A 3EPGA 1IBKJ 3P6YC 2MQOA 5T41A 3KUGA 5F8IA 3QAUA 2QT7A 1RT5A 1V9OA 4ZITA 4NOHA 3D67A 5A8RA 3R5DA 3WX4A 5LSLA 3IFEA 3HHDA 1TKDA 1IQZA 4DFJA 1DZ5A 1IBLF 2G0IA 4LF1A 5DQGA 4Q0BB 3UCUP 1HBOA 3CCWA 4JI2J 2YKQA 4DV3F 4ELUA 5FLXY 5DLFA 3GFXA 1NK6A 1IKYA 4DR6J 2B7BB 2MJUA 5BYRA 3WIVA 4ED2A 1CBKA 1IBCB 4KAIA 2FY8A 2A0FB 5CYMB 5KT4A 1L3KA 3BO4A 3CD0A 5LOQA 4DLEA 2GJ2A 1GMVA 4DSFA 3KHHA 1VIXA 1X9WA 1HL6A 1VJWA 1P6TA 4FPRA 2RU3A 2R8JA 1R8BA 4CI0B 2XY6A 3TUIC 2I5JA 5IT9U 1KP6A 1SJQA 5F41A 1RUSA 5A8KA 2YX7A 2QEXS 4ER8A 1T03A 3TWZA 3LP0A 1TUWA 3ET6A 5KFEA 4ECXA 2GQCA 1WC6A 2DH7A 4LF8J 4UW2A 4MKVA 4A47A 3R5JB 4MIAA 2E7XA 2P6SA 1CQNA 4JI7J 2CPFA 5A8WB 1T9TA 3HXMA 2MLYA 2FTRA 2L08A 4U96A 1QAIA 1VJQA 3OHAA 1SKWA 2GC8A 1J5OA 4CLUA 1HNIB 4UY85 2A3JA 3FSIA 4K4SA 3PR5B 4QZVB 2VICA 4USHA 3LPYA 4DR5J 4B3OB 1YGYA 3HHLB 3QATA 2XI2A 1PGZA 3T1YF 1HNZJ 2XYPB 5DRKA 2HQDA 4OV6A 1RT4A 2HKEA 1R0CB 2M88A 2HZAA 4CYUB 3I56S 1MROA 4OYPA 2UUBJ 4MFBA 2GZOA 3US5A 2KDOA 2C3OA 1ZZFA 4QIGA 3NAHA 2HHWA 3OFHA 2EG1A 3S8SA 2P9EA 2KH9A 1U8WA 4NMXA 1NKCA 1KHVA 3WC2A 4FVCA 4RWWA 2ASYA 1CSJA 5GAEI 3M2UB 3TVKA 1HQ2A 1Q8LA 2H5IB 4K4TA 3H90A 1R0BG 4OYXA 1SC6A 4DG1B 2VBZA 3TX8A 4KBIA 1WF0A 1JNZB 2KB2A 2Y1IA 1U7LA 4DV0J 3OSPA 4MAKA 3G8SA 2NSCA 1H74A 3JSBA 3EJMA 2IPOB 3MEKA 3PIPQ 3W9IA 1ZM9A 3CJ5A 1SIWB 3BPSP 4JI4F 1JQGA 3SQOP 3CMES 3TYTA 1NKEA 2LU2A 4ZP6A 1KTQA 1X9MA 3H2VE 4FF2A 3FEYB 2HBZB 2UXBF 1CJUB 7FD1A 3H59A 2NREA 3M9MB 1N6QA 3D6HB 4ETZA 3D5MA 1VDHA 1CG2A 2W2OP 4CNYA 2V68A 3L9ZA 3CJRA 4AUKA 4DCJB 5KFPA 2RVJA 3R5AA 3I6PA 2W8KA 2HAIA 1E6VA 3H0PA 1RAJA 1RAGB 4Q2LA 2VV5A 4ZP8A 2R8IA 4GC7A 3UD3P 1RHQB 2VPWB 3B8HA 3SXLA 3BGRA 1LWEB 1N33J 3H40A 1VBYA 1FVSA 2VDIA 2RILA 1EIYB 4L76A 3RAXA 3DN9A 3IM9A 5LL6d 1YVFA 1JLQB 1FRKA 4CO2A 1RAAB 4R8UA 2R2UA 2XGPA 3MM9A 2KKHA 4DI6A 2ZD1A 2CQGA 3IAM9 2VBYA 1RTHB 4DSKA 4ZVOB 2GJFA 5L9XA 1XNRF 1YG0A 2VPXB 2ILZA 4QU6A 3KXDA 3MUVP 2W01A 5F8MA 2JLEA 4NI2B 5DGBA 3G82A 3KJQB 3RBDA 3AOBA 4Q0BA 1RTDA 2O3DA 2YNHA 3C16B 8RUCA 2ZHOA 3MI7X 3OL8A 2DR8A 5LMNF 4F04B 5F8LA 4KQZA 4PZVA 3FC9A 2K7JA 4M5KA 1Q4RA 3U1LA 1PKUA 3O1LA 3EGWB 1REGX 2AJQA 1FX2A 3IS9B 3CB4A 4EZ9A 3C6UA 3MEDB 2R8HA 2XMUA 3KHLA 1RTIA 1S7HA 2QL9B 3CJ8A 3NBPA 5CYMA 2AD9A 4F4KA 4A8FA 2RHQB 2QA4S 2ZBPA 2HFSA 2ZH6A 4QWEA 2ZZTA 3UNYA 2OPQA 2KG0A 3UD4P 2MHNA 1Y5NB 2B5JB 1HBNA 1FCAA 1NJXA 1BUXA 2JFKA 2O1PA 4TNOA 1V3RA 3T41A 4I69A 3TUJC 3NEKA 2PT0A 2JEFA 5HP1A 4KIAA 2J5AA 2QO3A 4DFMA 2LEPA 4CO0A 3OXLA 4PYAA 2JJ4D 4C98A 2YXLA 5D0HA 5A8WA 2FJBB 4A8WA 1EHWA 2D3OR 3VGSA 2QZ8A 5J2MB 1HNIA 3GLJA 5CZVA 2DY9A 3FZ2A 4PWUA 1SBRA 4RBUA 2WAQD 3D0GE 1NPRA 4OYMA 3PO4A 2MB0B 2Z56B 5K8OA 1BQNB 3Q24A 3D3CJ 4OI1A 3CC7S 3R3TA 1ZZNA 4M5IA 3KK3B 2YWWA 1Y5LB 5K14B 4B3SF 3MF5A 1L3VA 5HQ8A 4WYWA 1KRPA 2IMWP 1CULA 2KRRA 2RUSA 1FFGB 4P73A 5JVGQ 4WBFA 2ZKUA 4Q2MA 2IBOA 4OIXA 2J9CA 4LRDA 5D4NA 1VHFA 2KU7A 4DR4F 2EFVA 1F5CA 2HQIA 1XC9A 1BLUA 1LKZA 3W60A 1SV5A 3NGSA 4Y2IA 2V94A 3U1NA 3RW7A 1CJKA 5KT7A 1Y3JA 3KFWX 3HCXA 2QA1A 3M30B 1O6XA 3K58A 3F56A 5CYQB 2I0XA 1D8ZA 2JDJA 3ZO7A 4EBDA 3NP5A 4DV6J 3HULA 1TFYA 2HQ3A 4I67A 1RAFB 5B7WA 1X8DA 3DNCA 3UR0A 4B02A 1U1LA 2VG6B 1UEVA 2VBXA 2XMWA 3K2YA 3MMJA 2BM1A 4NLGA 4LFBF 1OIAA 5E3QA 3BO2A 4N7TA 2HIQA 1CVJA 1ZBTA 4JV2A 3MOJB 1VQ8S 3IRXA 2MZQA 4OV1A 2AT1B 1FTCA 1HLWA 2B9WA 2OSRA 1FD8A 1VQNS 4FVMA 4KFBB 4OX9J 1G1XA 4Q8EA 3QJPA 2HVDA 1XBWA 4OI2A 1P1TA 4CT8A 2V8VA 3V4MA 4R5PA 3CDWA 5H1SV 1LWFA 3R5GA 2HIYA 4Q8FA 2QA4G 3R27A 2W9BA 4JYAF 2VA2A 3D3BJ 4DR1F 1RI7A 2FGCA 4DX8H 4I6YA 3IR6B 4UOFA 1RQ0A 5ETRA 3LAKA 1S9GA 2C2EA 2A6MA 3KNGA 2AU0A 2IM2A 3ZC4A 4AQYJ 2VPZB 3VZHA 1LWEA 2UVVA 4FP9A 4ED7A 3I9ZA 1DRZA 4I6AA 1FTRA 2EFOA 3L4BC 4IO9Q 2CFXA 2VOOA 2AYBA 1S72S 1QUPA 4RBVA 3SSSA 2DNYA 2E1AA 2LKZA 5IC4B 1Y11A 2ZZMA 4ENOA 3CCRS 2XY5A 1BQMA 5U47A 1ULRA 4TQRA 1M0SA 4B08A 1Q53A 3ISND 1S5ZA 3TX0A 4NYOA 1ZM4A 3HSZA 2GNKA 2I8EA 3SV3A 1C0UB 5HO4A 1S10A 1RDRA 3MM7B 3FSXA 2CVIA 3QZ8A 1P1LA 2DHAA 3J81U 3RRHA 1UETA 4N76A 1RHMB 2IRXA 1Y5IB 1LW2B 1HNWF 3D54A 1X9SA 2DR7A 4EZ6A 2KT3A 4F36A 2P9GA 1S9EB 5KFDA 2XCAA 4YB5A 3P45B 4WTYA 2OEJA 4WXWA 4RNNA 3OL7A 1WG1A 3QGHA 1WEZA 4QCLA 3CF5Q 4B9MA 1S77D 5A6PA 4ED1A 1BY9A 3VTIA 1FDBA 4USTA 2EG2A 1FNMA 1VIOA 1G3OA 4PUOA 4LFCF 1KVKA 3UW1A 3MAAB 3JTOA 2XS7A 1X5OA 2PMZD 3HSJA 1P9YA 4ED3A 1Q8BA 3IMQJ 4IH7A 4QOTA 1WG5A 3PYDA 1VBKA 4USMA 4IOCQ 1YJUA 1C1CA 2ERRA 4P6QA 2VG5B 5D0RA 4RPFA 3UE2A 2MYFA 2CNKB 4ZN1A 2M7SA 3HFZB 3CUNA 3EXYA 2RAQA 4LIRA 4K50A 3BQ0A 4KV8A 3NS7B 1H7XA 1S1VA 4TLRA 1S59A 3UPFA 1N36J 3B4MA 1B64A 1FEEA 1Z1ZA 3IWXA 1C1BA 3P8BB 4FYXB 3AOCA 1VBZA 3PNIA 3M8PA 3FCVA 1K47A 2PC6A 4K4WA 1YRTA 4DF8A 1GMWD 3T5HA 2A1BA 1KVIA 5H9FJ 3K89A 3IAS9 1FX4A 1S6QB 3GJTB 3OTOF 4IG0B 3TNVA 2XG8A 4NA3A 4DCPB 2GHVC 1GEHA 2Z8QA 2DY1A 2ZWOA 4WTOB 3NMAA 5IQ6A 1ZYQA 3HHKA 2LECA 1JLBB 4ED5A 5HQLA 3SFGA 4URQU 4WK3A 3ZZZA 2DO0A 4J5OA 4JV1A 5CAAA 3LWLA 1GTEA 2IYGA 5KT2A 2XMVA 2DXFA 5K14A 4LJMA 1JLEA 2J7UA 1NPPA 3WBZA 1UJ4A 5AXMA 1NK8A 5D8HB 4FPIA 1J27A 2YWGA 1T9XA 4IDKB 2DNOA 3FZBA 4RZRA 2JX2A 1GK8A 3NNCA 2L9DA 4PRFA 1NK0A 3GJSB 4KC5A 2MGZB 2DGVA 1RHKB 3M30A 3JQKA 2RSQA 4A4JA 4DPXA 3GCXP 3VVUA 5DZ7A 3QGIA 4PQAA 1WEXA 3VAJA 2GO9A 1IR2A 2VG6A 2RDJA 1EB0A 1HIYA 4KE5A 4DBQA 3Q2SC 3QSYB 1RKJA 2MZSA 2JEGA 4ZMMA 4TXSA 3TVYA 3DLGB 4AE5A 3M4XA 1DBDA 4G1PA 4Y2MA 1AZSA 3T1HJ 4ZA1A 3QBCA 4NLTA 4B17A 1D3WA 2BEFA 1XQIA 2QFIA 3PDNA 4LREA 3J7AN 1FKPB 4LF5J 4KT0C 3JAMU 3M9OB 1ZS6A 2B9XA 5CCLA 1S1UB 2DHXA 3OUYB 2BM0A 2E5LJ 2PD1A 4EEYA 3M2RA 4FNHA 3PM9A 3AJ1A 3G6YA 3CNQP 4X4RA 5J2PB 1OYDA 5L9NA 3W5YA 4C8MA 4N47A 3V6DA 2MKHA 4MTPA 2W8LA 1QAYA 2DNLA 2WONB 4FYWB 1VI7A 1C0TA 3MECA 3VAIA 1EP4B 3KJVB 2ZOMA 1UVLA 2F1FA 1CPZA 1JLFB 2V2ZA 3D1HA 1UWAA 1LNQA 5ETPA 3VWSA 1X7VA 1A0OB 2DGOA 2J7WA 2EFQA 1NB7A 3MR2A 3D6TB 2CXEA 4DOZA 1OS5A 1RTJA 4QJVA 4WE1B 3TZWA 1ZA2B 1UTAA 3LP1A 3MMAB 4OFZA 3ILIA 4KHMA 1M1KT 1C0UA 1XMQJ 1RGVA 4X64F 2C3PA 5T7LB 3JS9A 1I94F 2NUUG 6FDRA 1LW2A 1Q5YA 3D2WA 1OPIA 2CWKA 2Y1RI 3G8QA 1S9EA 1AW0A 1U49A 5KFAA 4DL7A 5E3RA 1FRXA 3Q8YA 3H5UA 1Q1KA 3N28A 2OP5A 5CD4A 2YWEA 5KFSA 4AXIA 4NX9A 4WXOA 1JXEA 4X4SA 2G2ZA 2DJWA 3KLGB 2OPPA 4FKYA 4DU8A 2ZUGA 5C25B 4AL6A 3M6VA 3DDIA 3FKBA 3NWGA 2DNRA 2FJVA 5KFOA 3ZTQA 5KFZA 1S9FA 4DR3J 2JC0A 1YJ7A 2GV1A 5GVQA 2VG5A 1GT8A 2EC0A 5B0AA 4DV1F 5KFXA 2IDEA 4OZ5A 3MCNA 4OHXA 3H5XA 1FNXH 3ITHB 2UUAJ 5SUHA 4KRWA 1SJ3P 4UQGA 1NMEB 4DL4A 2G0JA 2FGOA 5GADI 1TP7A 1PJ5A 3OVSA 4OX8A 3DLEB 3PKYA 2VC1A 2PN6A 4EFAC 3DOMB 1YJRA 4FBTA 1KDNA 4ZVTB 5HQMA 3N5BA 3SEOA 3CD5A 2YH1A 1F2HA 3TJ9A 4B3RJ 1T02A 5F0UA 4IRKA 3RG6A 4NA2A 2XMTA 4RW4B 2VFRA 2X1GA 2ZBCA 2LQ9A 2DGTA 2B6AA 5EUHA 1TL3A 3MFHA 4RWXA 2XULA 1Z2ZA 4ILMA 4HHUA 3U1MA 5CABA 1S79A 1JWWA 4B9TA 3CJSA 1JLBA 1X4GA 4C8YA 2BQUA 4JI0F 3M7VA 1HNXF 1K1SA 3LWMA 2E9ZA 2ZM6J 5AJ3J 2C42A 3DRPB 3MTKA 2IVFB 1NDCA 2HQCA 4I64A 5IT4A 3GJQB 4DX6A 1RWNB 1SC3B 2B4UA 2ZHAA 1IKWB 1D9FA 1FERA 2YNIA 2YWFA 3IGNA 5JVHQ 4L3NA 1WSRA 2QMWA 3A4TA 4IDKA 3DOLA 1FEHA 1GAOA 1S48A 4G1IA 3JQMA 4J9VA 3HFKA 2L41A 4M8LA 2D9OA 1WD6A 1U1NA 4ZPWR 2CDQA 1F6TA 2DNGA 1OWXA 1S1TB 2ILYA 3M9NB 3C14B 3DMJB 4HDHA 2ZH5A 3MDFA 2HNDA 2ZKTA 3RUBL 4RW6B 1YX2A 2F3JA 3C6TA 3PG9A 5D6GA 4GRSA 4F26A 4ZJOA 1DTQB 4UTGA 4B9LA 2XO7A 2UXCF 1FXDA 4M94A 4J7CA 3SSRA 4JI1F 4O3RA 3RW6A 3FCHA 4K0KF 1PAEX 1UFKA 4QIWD 1RAEB 3CW2C 4MYUA 3E01A 4OHZA 3AA9A 4AFFA 1RZMA 3MCSA 3RU0A 3PW5A 3PY8A 2CNNB 4PG6A 1S1XB 2W7AA 2WSEC 2LVWA 3LQVA 3ZXWA 3EZ5A 1FKPA 4QR0A 1V3SA 1S1UA 2OFHX 1HQUB 1TUGB 3W7BA 3R1HA 3OUYA 2AX1A 3R5CA 4P72A 4X4UA 4O0NA 2CQIA 3PRBA 1ZAWA 4UQTA 2HGMA 1E6YB 4LSZB 5J2PA 2HHUA 5KTQA 2DCUB 1DLOA 2HHHJ 1HPZB 3TO8A 4LF6F 4LF4J 2HNZB 3BGOP 2WONA 1KEKA 2DRDA 4OJHA 3T5LA 3VVTA 4WZQA 4CLYA 2FB0A 2IRUA 3CJQA 5KFRA 1VQ6S 1LK7A 4WFNQ 5BR8F 3IP0A 2CQHA 2J8AA 2UUCJ 3N6NA 1WEYA 2LP4A 4CM2A 4L3KA 3MPWA 3U7JA 2AZ3A 3FVYA 1F0XA 4WE1A 4GO5X 2HW3A 4B3MJ 1IKVA 3EWGA 2YH0A 3HX9A 5D4PA 3MD1A 4LF7J 3NGKA 1TUVA 4O3SA 1DURA 1U1RA 3TI0A 1FRIA 1GMWA 1B0TA 3PFEA 4OX7A 5J1PA 3GMGA 4HI1A 1SJ1A 3FJ2A 1WHWA 1S0MA 2I9SA 3ENWA 4URGA 3CMQA 2OAUA 5T7LA 5AXNA 2GQQA 4RO0A 3AODA 2RJZA 4TVAB 3TOQA 5H9EK 4NLYA 3OLBA 3P96A 4IFYA 2DEIA 3I87A 4KHRA 4G65A 4OJGA 1YK9A 4ZCKA 4OHYA 1RWPB 2DGQA 1U24A 3RAMA 4JI6F 1SCJB 4JBCA 4YN3B 2UP1A 1KLMB 2FLOA 4QIFA 4X84A 4FXDA 1HNVB 3C19A 1T3NA 4PEOA 1UPPA 3KLGA 4DN9A 3KOAA 2AGQA 2E7VA 4DS4A 2BUNA 5KFWA 2VIHA 2AYGA 1RYRA 1PSDA 4I2QB 1TFWA 2RQ4A 1AFIA 2W7PA 4X4QA 1TR0A 4PWDB 4JI3F 2BE2B 2QMXA 2JH3A 1AFJA 2HWIA 3FBBA 1VRTA 3EGVA 5IM0B 3RRKA 2RH3A 3BDPA 4X65F 1VQYA 4ECWA 4DSEA 1R27B 3ETOA 1SUQA 1VK3A 2KXHA 4O3NA 1U1MA 3N6MA 5MLCV 1G2EA 2AEFA 4NZ6A 2CRLA 4N56A 3PV8A 2HHSA 3HKZD 1T94A 1UJ5A 2FVPA 4O44A 5L1KA 4KGKA 4ECQA 4DDFA 4IH6A 3PW2A 1AXQA 5KFHA 3TA0A 4DUYF 4Y2KA 1U45A 2Z0GA 1NAQA 5DDPC 2LQ5A 3DRYA 1YKWA 1S6PA 1GTHA 1I51B 2M52A 3DOKB 2H54B 1OO0B 1XNRJ 4PG5A 3ISNC 1CJTA 3EM1A 2ZITA 1S7IA 2EEYA 2OD4A 4JV5J 4A8OA 3K7RA 1OY6A 1Y0HA 4HACB 3HZEA 2HHTA 1YJTA 2XYGB 4RW4A 4NRTA 3OQ2A 4QBUA 1IXKA 3CC2S 4BS2A 2RDDA 2QRRA 4RUCA 3WDOA 5J2QA 5LMNJ 2DIUA 4HEA9 3W63A 4I2PB 2YKNB 5L46A 2HSEB 4U7UK 2HVEA 3OTBA 5JMNA 4WKRA 3CDBA 2ASDA 1FKOB 1NU4A 2AJFE 3OW2R 3CCJS 2HLUA 5LT5A 3NAIA 1RP5A 2DR9A 4YP3A 4ZIWA 3J7ZT 4IG3A 4NCGB 3Q2TC 1IKWA 5A2QU 1WC1A 2E9TA 5JXSA 2NPIA 4X4TA 2GVZB 4QW8A 1DTTB 1X4HA 2LFVA 2XLIA 3L7PA 2KO1A 3G71S 1Q81T 2EW9A 4IQMA 1VQMS 3AAWB 4HR2A 3NRBA 4FXVA 1S1TA 3OTEA 3G87A 2H9ZA 4ID8A 3QO9B 5ETTA 3LPEA 4WP9A 3W8PA 4ZVEA 3VAHA 2G9OA 2R42A 2WVCA 3T1AA 1FA0A 2N7CA 3BQ2A 2UVRA 2XC9A 1JK9B 1FDAA 1UWBB 2CKWA 2EI5A 4H4MB 4TQSA 3D68A 1NEEA 5EDWA 3HJVA 2E7WA 4V1Ak 3I0SB 4O0IA 4ZP7A 3LGHA 2OJ3A 1NHVA 4CO1A 3DU6A 1RCXB 1T9UA 4P75A 5K20B 4OJ3A 4WFXA 3K5OA 3R8YA 1TL1B 2GMHA 5I42B 4B9UA 5IZHA 1HW9A 4CTAB 2JHEA 3K5PA 1AT1B 4LVNP 3RZAA 1DHMA 4X4NA 2RHSB 4RW9B 3D1QA 1S1XA 1HHSA 2CPYA 4Z2XA 3K57A 3VQTA 3MUMP 3PVXA 1LFWA 2UVUA 5HLFA 2BX6A 1T05B 1MN7A 3ENVA 1HQUA 4IRDA 2B8PA 4UUWA 2JL9A 2VQEJ 1O0PA 4DQSA 3JB9k 3TZXA 1QTNB 4ZDNA 2HRTA 2DD8S 4AL7A 3WC0A 4P10A 3WIUA 3NKYA 4O4GB 4Q45A 4C11B 3HHEA 3R7NB 4ZVPB 4ED8A 4B3SJ 1G6BA 1U1KA 1HPZA 4QPXA 4LF9F 1R0AA 4NLRA 4YB6A 1TKTB 4KH1B 5M2UA 1NZ8A 2ASLA 2MKJA 1DQ9A 4U9RA 1W26A 5DLGA 2YKMB 4DR4J 4PR6A 1R31A 2OPRB 1LFPA 4RR5A 2J6SA 1OJ4A 1YITS 1RBAA 4ZHRB 1N54B 4Y0FA 1NPKA 3MURP 1WKKA 2QC3A 2B7CB 3PCOB 1GMUA 2IIHA 4QPTA 2BV3A 3QAEA 4MKAA 4OJ1A 1N52B 1N88A 3TARA 3H8YA 5IFMA 2R7SA 4JI5F 4DN0A 4LFBJ 3ZTSA 1Q8IA 5KFFA 4RU9A 2XB2D 3RBEA 5D0GA 5FDLA 1WHXA 3GV5B 1RLDA 3NL0A 1RWVB 4NA1A 3OSNA 1QSYA 3QIPB 1RT1B 5F9LA 1RK8A 3NGUA 2ZE2B 1PILA 2AJ1A 3T6JA 3QIDA 3CCES 3W9JA 2MHEA 4Y2CA 2NYIA 2WBMA 2PEHA 3KLIB 2CNLB 1R3NA 2XWYA 2QLJB 2YKAA 1M5HA 1HNVA 3ZZTA 2NUHA 1KKHA 2YKOA 2U1AA 5ADZA 2AJ4A 4JYAJ 1QM9A 2DPIA 1XN9A 4J37A 2L3MA 5C24A 1TK8A 2XZTB 6FD1A 1IBKF 5IS2A 3CJ3A 5I4MA 3R1LA 3DGVA 3DLKB 1ZTWA 4ANEA 2AGPA 1R8CA 4NL5A 3ADAC 2KI2A 2DRBA 2VKZG 1VRUB 5KFVA 3FGVA 5IM0A 4FF1A 5KFKA 1N32F 4OMFG 4MK7A 3BJYA 3DI6A 2HMIB 4XDCA 2KFNA 3IG1A 4DZ6A 3F44A 1M5SA 4YR2A 9RUBA 4L75A 4FF3A 2CQ3A 3DRSB 2WZ1A 3IM8A 3VHQA 2K1RA 1RHUB 4DSJA 3BSAA 4LR8A 4MMOA 4Q43A 1WOPA 2B0GA 3DOKA 2XS5A 4RW7B 5KAKA 2IVMA 1T9YA 3OD2A 4RKUC 5HBMB 2V8HA 3I55S 2J6TA 4J90A 3QZ7A 1YRXA 2R7XA 4UZCA 4DV5J 3LTOA 1UW9A 2CDRB 2YY3A 4K2XA 3P3DA 3E2EA 1QDUB 3OXGA 1CJVA 2PO4A 2R7OA 4LSNA 2ZC4A 1UA0A 2OMOA 2ATLA 2HS0A 3UCZP 2A2CA 2XSFA 2QV6A 2RD5C 2YKNA 2XMAA 1YI2S 1NDKA 4C2MA 1FKOA 2BANB 3IWNC 2F4VJ 1R6YA 2BZ2A 2CPZA 4L6V3 4X4PA 3G6VA 2HBRB 4RUBA 4WWSA 4ZVQB 3CVKA 4WYLA 3W2WA 4JI7F 4PG8A 4IOBA 2BYCA 1SIZA 2L9NA 1QAJA 1MLAA 5E0OA 1SXLA 5AXKA 1Y3KA 2JEJA 3QFHA 1UMJA 4BC7A 4C0OC 2ZBRA 3CCSS 3FCWA 4DR5F 3QJLA 3HVAA 3CXCR 2CPDA 5B0GA 4PWWA 3A3OB 3TZZA 1CC7A 2GHPA 1TTHB 3CD6S 3A3NB 1UWBA 4H4MA 5G0RB 2R8KA 1NBEB 4AT1B 4MKYA 2KJVA 2EWHA 1NKBA 4ID5B 5KFUA 3JYTB 2QA2A 1LXNA 4Q7AA 4TY8B 4A8XA 2R8GA 3GIRA 3Q8SB 1XNQF 2UUBF 2ZVSA 2VD3A 3DM2A 2DHSA 3VAKA 5GAEU 1KSPA 4CTAA 4USKA 2DKOB 2KT5A 1AYEA 3Q23A 3ULHA 3OTOJ 3J7YU 2A18A 3MR7A 1ZOTA 4NCBA 1UVIA 3TAMB 2E5GA 1XMBA 2ZH8A 3JTPA 2MZ1A 2I38A 4ZJQA 1U48A 1A9NB 1PBAA 4ZJLA 3L7UA 4AYBD 4DV0F 3D9BA 2XHCA 1Y10A 2V8GA 2YX4A 2MPUA 3OPKA 4DQRA 4FDFA 2XYHB 1VK8A 1RAHB 1HKAA 5C2GA 1W2BR 2R4FA 4OI4A 1XR6A 1HYSB 5GMKa 5K8NA 2LU1A 3K0JA 2B51A 4RW8A 2IY5B 1F2GA 1KS2A 3HHLD 3K5MA 4YHHF 3MMCB 4GKKJ 3R2DJ 4M63A 5CZXA 5E3AA 2R7QA 2FVRA 1HQEA 1SJ4P 1VQ5S 4ZHRA 1LQ9A 3C8YA 2DIVA 3NCQA 1IM4A 2NSBA 2IMOA 2E5JA 3THPA 2WVDA 4QIVA 3H5SA 3POTA 2RS2A 5J2NB 4K7QA 5KFGA 3BSCA 4G1QA 4CRJA 1FF2A 1EARA 1NO8A 5ETOA 4B9SA 2C2DA 2CUYA 1GXUA 3C2PA 1VQ7S 2H4YB 2QLXA 1RT6A 3GP9A 3X1LB 5CH7B 4QWDA 1IKXB 2Z2LA 5DS7A 2AHOB 2XSJB 3BBBA 1N33F 2I6WA 3CCMS 1UAWA 1RT1A 2FDNA 2ZE2A 5KFLA 2VONA 2O01C 3EICA 3MM6B 1N5YB 5E3PA 1ELOA 2CVEA 2XCPA 1YHQS 1FJ7A 2P2CB 1FRMA 3BBCA 2LA4A 4I7FB 2OUGA 2KJWA 2D7SA 3W2VB 4CLTA 2F8HA 2UUTA 3EX7B 1Q7YT 3GFYA 2IAJB 3DHWC 4B3TJ 1T0TV 3ILLA 1FXRA 1SL0A 3BO3A 1I5OB 4P2MA 3K8VA 4P7TA 3DLKA 1WTBA 5HMWA 1VFJA 3IR7B 1SKRA 2PIIA 1VRUA 5K9FA 2DNZA 3MPYA 2XQCA 2GIRA 2R7UA 3PW4A 1WELA 2OTLS 1HMVB 5A6WA 4P2SA 1SH0A 1DQ8A 2AX0A 2F9DA 1ROFA 1SVDA 4ES2A 1W2IA 1GX6A 3BV8A 2ZBQA 2CPIA 4KGZB 2BJ3A 3HZGA 1U1PA 2HQFA 3DHXA 2CZVC 3MR5A 2QN6B 1U6ZA 3MFIA 1F5BA 3FRYA 5KFCA 3V81B 2ZEJA 3GR1A 2V9WA 4LUBA 4RW7A 4DX7A 2CJQA 1QUVA 2MJNA 3G4SS 5HBMA 2LLZA 2V2KA 2FC9A 1I94J 1WWHA 4CO5A 3GYNA 3UVJA 3SCJE 2ADBA 3HVWA 2C2NA 2HFOA 4J9RA 2C1EB 2V4JA 3V6HA 3NWRA 3KK2B 3GCWP 4XIUA 4L72B 4GVBA 3THVA 1S4EA 3OHBA 2VL1A 2A2DA 4ATNA 4J9MA 3PFOA 1PBUA 2YNGA 2BDPA 5L39A 5B0DA 3QLHB 4YUDA 2ZC3A 2DNMA 4Y2AA 2PE8A 3O8WA 2C3MA 3QSIA 2X7IA 1FD2A 1TZ0A 2ROEA 4KGXB 5KFYA 5D0EA 1LWCA 3MEGA 2G1DA 2DT9A 5THWA 3LOUA 5IQQA 2RUGA 1AUSL 3ENAA 1DQAA 4DV1J 3JSRA 4XPCA 1IVZA 3G86A 1NK9A 3OL9A 1Q7LB 2BQ3A 4M5GA 4U7UD 1MMNA 2VG7B 4ED6A 4NXMJ 3MM5B 5HVHA 1EZZB 4F67A 1R43A 1FXLA 2DHGA 2DITA 4TY8A 4CO4A 3CSKA 3J7A1 1PIEA 3NGDA 4C8OA 4J9PA 4K4XA 4KH0B 2EC2A 5B08A 1O51A 2Y0SD 1FJGF 2QLFB 2Y8YA 2YKPA 4CP5A 1OSDA 2F5GA 5IC6B 3BN4A 5D4OA 2RRAA 2FPHX 3PHTA 2MQ8A 2J6UA 2MZRA 2FY1A 3TAMA 1KONA 1YZ7A 3HI9A 1N48A 2ZNZA 4HTIA 2AEMA 5DG8A 4LBPA 3O5TB 2NZCA 2OSQA 4CZCA 2CZ4A 2IC3A 3QYYA 4JI0J 4DPYA 2LQJA 2F8MA 2UVWA 2GGPA 5FD1A 1HNXJ 4OZLA 1A7GE 1RU1A 4NEZA 5HI7A 5GMDA 2MZTA 4ZPAA 3UWTA 4YB1P 1EETB 1EKSA 2BQRA 2OEKA 1TAUA 3N0VA 1U26A 2ADCA 5GAGU 4ZLNA 2CJ9A 2O5DA 2CQCA 4X4VA 2XZWA 4YDXA 4J9OA 5LMUJ 3HP6A 2KYXA 1LWXA 4OX9F 3BGUA 3BBFA 5KFIA 2G13A 2SXLA 1MWZA 2GVDB 4OL8A 1X5TA 1MW7A 3CIZA 2HS3A 4ZPTR 2PFDA 4PKDB 1U09A 1VQ9S 5C7PA 3OFGA 5DO2A 1QY7A 4PQUA 3DC2A 3HPOA 1B7FA 5J2NA 1UA1A 1TV6B 3RR7A 1EQ0A 2WOMB 5EX3A 1B7YB 3A13A 2N7YA 4TU8A 2IM3A 2O67A 2PA8D 2RKIA 1M1HA 4CLSA 2UXCJ 2BKOA 1RT7A 4AQYF 1QTMA 2XSJA 1AROP 3AD9C 4ZOSA 4ECYA 4I4BA 4K0KJ 4LBHA 2XLJA 1HWKA 7AT1B 2MKIA 2DH8A 1N5YA 4C8LA 2HWTA 3GIIA 1SB6A 1TL7B 1ZA1B 1TK0A 3QT7A 1IWGA 3FSYA 2HFNA 5LJ5Y 2MMYA 3BREA 5H9EJ 2IVYA 1RAOA 3BEGB 2XMJA 4PXBA 4ZPBA 1NJZA 1HBMB 5CYJA 1RHRB 4LR9A 2JVOA 2NCKL 4IRCA 3CCTA 3RR8A 3SDEB 2LEAA 1SQEA 4F4YA 2J9EA 2PGCA 3B6BA 4M5LA 4X4OA 4LF6J 3D6MB 2YWKA 3M6XA 4ZLJA 2CQ2A 3VAFA 1VQKS 1UKUA 2PI4A 2M3DA 3TQ1A 3AOAA 3M1VB 4WFBQ 1V6HA 4F3MA 1Q16B 1JLAB 2OLWA 3CT9A 1C4AA 1V5VA 1NXIA 3DDKA 2QSWA 1YTYA 1WOSA 2Y0BB 1WORA 2Q6CA 4DJBA 3UFCX 4DV4F 2JLGA 2HLTA 1S57A 4ERDA 2V5HG 4M5DB 1S0OA 2DISA 4DR2F 3VGTA 2EBGA 4YR3A 2IJNA 1B0PA 1SKUB 2PA3A 3S6EA 5IWAJ 4DCOB 3OT9A 2KM8C 2UXDJ 1G7CB 1KQSR 2VU5A 1X4EA 4K8RA 2VJVA 1JJ2R 2XY7A 4LSLB 3BSNA 3W62A 1MN9A 1HBUB 3QT5A 5IV3A 2HHXA 4JI6J 5HN0A 2W9AA 5KOWA 3QMQA 3E51A 4DUZF 2WK4A 2MTLA 2PMWA 2Z2YB 1BWEA 3QLHA 3Q86A 3FEXB 1U1QA 2R2TA 4WZMA 3LGMA 3HM9A 5KT5A 5HK4A 5MAOA 3HD2A 5DG7A 3R6GB 4ZVRB 4B3OA 2G2OA 2FHOB 4FZVA 3ZZYA 3HHLA 2YQ3A 4CNZA 5B0FA 1N0UA 5IOLA 2ZH9A 3N79A 2ZDOA 3BSOA 2CQDA 2WVBA 1OY9A 4F0HA 1RHJB 3BM7A 4BLGA 3R5BA 4Q44A 5L1LA 4OZ1A 3S01A 2WVFA 4AD6A 3QRRA 4CYUA 3FBFA 1YBTA 4C3KA 1LXJA 1HBOB 4DL3A 2VFSA 1DAXA 3PR4A 2C3UA 3H20A 4R0JA 3WX8A 2QTWA 2E66A 2BE9B 4NYPA 4DUYJ 4W90B 3M6UA 2JC1A 4RNHA 4FS1A 1UVKA 3HJFA 4LR7A 1IKYB 5DJBA 3RTVA 3M2UA 5EWEA 2XTJP 1IM6A 4DG1A 3OFEA 4OI3A 1NSAA 4ZLLA 5EWGA 5HMZA 3F41A 5D78A 1DFDA 2ZBIA 3GJRB 1ZAXA 1VYAA 3E3XA 4ZS6A 5KG1A 3VR1A 1BE4A 2DRAA 1NK4A 2HRUA 2RQMA 4F4WA 1LOUA 4H4OB 4A8SA 2FLPA 1XIQA 5A8KB 2M5YA 3CCLS 4USJC 2DO4A 2X3GA 2WHOA 2ZJPQ 1YIJS 3KNAA 1OYEA 3FNNA 1T03B 3DLBA 2DNHA 2RT3A 4D3HA 1XR7A 1UZDA 4QYZK 4MIWA 3W5ZA 3B82A 2ZJQQ 4OYOA 1CJUA 3N01A 2J0SD 4DR7F 1EX8A 1JMTA 2BVZA 3SMZA 3V5RA 2YPYA 2HGNA 2CA9A 2E29A 2Z30B 4P52A 2MQLA 4NLDA 1NH8A 1RSCA 4P2XA 1J5OB 1UZHA 3W61A 4L73A 3CMAS 1VC6A 2AZ1A 4LQ9A 4IFVB 2V69A 2GVDA 2AJ0A 3KJFB 4QU7A 2WB4A 4HT7A 2E5LF 2WCXA 2KHCA 5L1IA 2B43A 3SCKE 1TV6A 2BBEA 4LRFA 4NXNF 5GMEA 4TY9A 1YSJA 3JAMY 2LDIA 2ZH3A 2VQFJ 1RT4B 1B3TA 1U0HB 3M6WA 4PCQA 1NLKL 3JSMB 3T6BA 4FBUA 3ZTOA 1JLQA 2Y1LB 4RUHA 1X31C 5HATA 4N41A 3W5XA 1H6KX 3GYGA 5DM6Q 3KKFA 4C0HA 4WU2A 2YBVA 4CH1A 1EKRA 3A8JA 4E2FB 1TL7A 1RTHA 1TAQA 3SQGB 3AY0A 3KYLA 1URRA 3G6ES 1U2CA 4FXWA 5J1EB 3PW0A 1UEKA 3UI3A 1FE4A 4Y3CA 2ZWPA 4ZVHA 1RWMB 2IM0A 3PX4A 1X0FA 4NLUA 4N77A 4J91A 4YQWA 1WKJA 1WOOA 3KHRA 3HSDA 4KHPF 4ECRA 3TRGA 4NI2A 4ZKAA 4K4VA 4ZPDA 5CCMA 4RNMA 4CWBA 1XMQF 4HKQA 4UOHA 4EYIB 1IWAA 1FK9B 3VAMA 3VZIA 4LF9J 2PDAA 3C16A 5KOXA 4J9KA 1WI8A 5F0WA 4XDDA 1SQGA 1YRUA 5EX0A 3IS9A 4U7CA 3MCOA 4OZNA 1AUDA 3MEDA 5F8JA 2C22A 2NZ4A 1N6QB 2XZDB 2FJDB 3ILJA 3L3CA 3HHLC 3R97A 4M5HA 1TQLA 3LH2S 4M5DA 1RJJA 1E6VB 4PYDA 4CLKA 2E1CA 2M9KA 1XEZA 3D66A 3T5JA 2ZH2A 1M5VC 1VS3A 1MMDA 1ITPA 4NEYA 3ZZRA 2B5JA 5DM7Q 3G2XA 1YJ9S 4XK8C 4ILRA 2V34A 3FBEA 1B4SA 2QJ3A 1NNDA 3OTDA 2ZHBA 1APSA 2VH7A 2CQ4A 4LSLA 5F9NA 3EMTA 3DKDA 5L38A 1NDLA 3PACA 3H4DA 4DFPA 3Q8VA 4QR1A 4R8UB 2Z57B 3AJDA 5DDOC 4DS5A 4ZCIA 1KLNA 3CJTA 1H2VZ 2ZD1B 3FMBA 3B54A 5C5JA 1N0VC 1F5AA 4TLQA 2D1CA 3C15B
chains in the Genus database with same CATH topology
4ED8A 3QIPA 2Q79A 2WB1D 3NBPA 5CYMA 5J2MA 2AD9A 1G6BA 1U1KA 4F4KA 3IRWP 4UY8T 1HPZA 3DRRA 4A8FA 4QPXA 2MSTA 1JKHB 3CEDA 4LF9F 4PPDA 5M2RA 1D9DA 2QA4S 1R0AA 4NLRA 3CDAA 3N9UC 4YB6A 1TKTB 4ECVA 1P27B 5M2UA 2ZH6A 4B3RF 4QWEA 2ASLA 1WI6A 1VC5A 3PW7A 3KLIA 4O3PA 4YDDB 1K8AT 1ZPVA 1YQHA 2OPQA 2KG0A 2K2PA 5I3UB 3UD4P 2MKJA 3GR0A 5A0YB 1DQ9A 4U9RA 2XLKA 1BQNA 5DLGA 3HKWA 2MHNA 2YKMB 4MYTA 4V19X 1ZTTA 1Y5NB 3TP2A 3MXHP 3DLLQ 2B5JB 2RF2A 4PR6A 2GHWA 1R31A 1HBNA 2QFJA 1JJHA 1FCAA 2OPRB 1LFPA 3CC4S 2J6SA 1NJXA 1Y9OA 1YITS 5D3GA 2JFKA 2O1PA 3KK3A 4ZHRB 1N54B 4LIWA 4Y0FA 4LQ3A 3KMQA 4CCHA 1ZH5A 4TNOA 1V3RA 4I69A 2XNQA 3TUJC 3MURP 1RTDB 3CJ0A 5KFJA 5HLFB 2YNHB 2PT0A 4HH0A 4DPOA 5HP1A 2JEFA 2B7CB 1YJWS 1QLNA 4KIAA 2J5AA 1FRLA 2QO3A 1U2FA 3SV4A 4ZPCA 2PMHA 4F25A 4DFMA 2KT2A 2LEPA 2CIMA 4CO0A 3OXLA 4QPTA 2BV3A 3QAEA 4MKAA 2JJ4D 2GMJA 4OJ1A 4EU0A 1N52B 1N88A 4C98A 3TARA 4WIIA 3H8YA 5IFMA 2ZM6F 2R7SA 5AJ3F 3OTCA 4JI5F 5A8WA 2IJFA 4DN0A 5EHHA 2XWXA 4O3QA 1Q8IA 5KFFA 2COLA 2GFFA 3L7OA 3C6UB 3SYZA 2FJBB 4RU9A 2R9LA 4A8WA 2HMIA 2XB2D 1JLCB 4YFUA 1RTIB 3RBEA 5FDLA 1WHXA 4TYAA 1HD0A 3GYXB 2D3OR 1FHTA 3GV5B 4P7VA 2J0XA 3NL0A 4NA1A 3OSNA 1QSYA 3QIPB 1JNRB 1R8PA 3HVTB 4RNOA 1RT1B 3NBPB 2QZ8A 5J2MB 5F9LA 1HNIA 1RK8A 2ZE2B 1PILA 3DRSA 1WHVA 3MMBA 2AJ1A 5CYQA 3T6JA 5CZVA 3CE8A 3QIDA 3CCES 1R0AB 4O23A 5JJBA 4B9NA 3FZ2A 2MHEA 4G6VB 4PWUA 3VF0B 4Y2CA 1SBRA 3KLEA 1QVFR 2K8GA 2NYIA 4RBUA 3NS5A 3NCPA 2WBMA 4A48A 1KVJA 2PEHA 2WAQD 3D0GE 3KLIB 4KO0B 1R3NA 2XWYA 4K5RA 2D3UA 2OPQB 3PO4A 2MB0B 3NS6A 5K8OA 1BQNB 2YKAA 1M5HA 1HNVA 3Q24A 1S99A 2MY8A 1RYSA 2B4VA 3ZZTA 1K9MT 3EXCX 4OI1A 2NUHA 3CC7S 3R3TA 1HBNB 2YKOA 2U1AA 4H4OA 5KG0A 5ADZA 4RU2A 4OHVA 2AJ4A 1ZZNA 2BJDA 3J80Y 5GAHI 2FHJD 3KK3B 1QM9A 1Y5LB 2DPIA 4HH1A 2EBEA 5K14B 1UW4A 3WZ0A 2DBBA 1XN9A 4B3SF 4J37A 2JWNA 2K3IA 1KC8T 3MF5A 1L3VA 2L3MA 5HQ8A 5C24A 4WYWA 1TK8A 1KRPA 2IMWP 5HP1B 6FD1A 2BOPA 1IBKF 5IS2A 3CJ3A 2KRRA 5I4MA 3R1LA 3CDEA 1WHYA 3DLKB 1ZTWA 2AGPA 1R8CA 5JVGQ 4KFBA 4NL5A 2KI2A 2Q6BA 2DRBA 3W3SA 2ZKUA 2VKZG 4JOUA 4NLVA 4Q2MA 1VRUB 5KFVA 3FGVA 2IBOA 3IN5A 5IM0A 4FF1A 4OIXA 1FO1A 5KFKA 2J9CA 1N32F 4AXJA 5D4NA 4OMFG 2FIUA 1VHFA 3LUYA 2ZH1A 2KU7A 3M8QB 4DR4F 2EFVA 4MK7A 3BJYA 1F5CA 3DI6A 2HQIA 1XC9A 1BLUA 2HMIB 1LKZA 1JIHA 1HI1A 1SV5A 4Y2IA 2V94A 2BW2A 3U1NA 5IWAF 5FDLB 4XDCA 2KFNA 3RW7A 2KZMA 3GZ7A 3IG1A 4GO7X 3F44A 1M5SA 2AGOA 1H98A 4YR2A 3HT3A 5KT7A 4OI6A 2UXDF 2VPYB 3I82A 1Y3JA 3UDCA 4YMEA 4RNFA 3KFWX 4FF3A 2ZFHA 4NCAA 2CQ3A 2QA1A 3BB5A 3HO1A 3DRSB 3M30B 2DH9A 3K58A 3F56A 5CYQB 3IXQA 2I0XA 1D8ZA 2JDJA 2NXUA 2Z2MA 4O4RA 3OBIA 1U47A 3AB4B 4EBDA 1VBXA 3NP5A 4IFVA 2K1RA 1TFYA 4DSJA 3BSAA 2HQ3A 3QWUA 4BHQA 5B7WA 5KG4A 4I67A 2BANA 1X5SA 2IA0A 1X8DA 3DNCA 4NYZA 4I68A 3UR0A 4MMOA 4B02A 2VG6B 1U1LA 3Q22A 4Q43A 3KLFB 1GH8A 3DRXA 3GV8B 1UEVA 2VBXA 2XMWA 4DFKA 3K2YA 3MMJA 2BM1A 4ZP9A 4NLGA 2B0GA 2RQCA 4LFBF 1OIAA 1Q86T 2DR5A 3HVRA 5E3QA 3BO2A 1U8SA 4DQQA 3DOKA 2QIFA 3ZZOA 2XS5A 2HIQA 4RW7B 5KAKA 2A10A 2IVMA 1CVJA 2AQ4A 1ZBTA 5KT3A 4JV2A 2QYCA 4JI8F 1S97A 4RKUC 3MOJB 1VQ8S 3IRXA 2MZQA 4OV1A 5HBMB 3V6KA 2V8HA 2DNPA 4LFAF 3I55S 4HHJA 2R2SA 3JSMA 2J6TA 3QZ7A 1YRXA 5C24B 2HHHF 4A8YA 2AWZA 1FTCA 2R7XA 5KFBA 4A46A 4LF4F 3EUNA 2PI5A 1R89A 2B9WA 2OSRA 2YY3A 1FD8A 2XI3A 1VQNS 4K2XA 3ZZUA 4FVMA 4KFBB 1G1XA 4Q8EA 3QJPA 1HFEL 3CCZA 3P3DA 1XBWA 4OI2A 1P1TA 4TN2A 5FIIA 4CT8A 3E2EA 1M5KC 5D77A 2V8VA 3H98A 2ALZA 1N34F 3V4MA 3OXGA 2KVIA 4R5PA 3CDWA 2W25A 2PO4A 5H1SV 3OFFA 2H5EA 2RMLA 2R7OA 1LWFA 1FESA 4HLBA 4LSNA 3DI6B 1OPZA 1NJIT 4Q8FA 5G0RA 2ZC4A 1SV5B 1UA0A 3I4PA 3SQGA 2OMOA 2UUCF 2KFZA 2ZOFA 2HS0A 4IKAA 5KG7A 2ATLA 5EWFA 3UCZP 2QA4G 3R27A 3IG1B 2W9BA 3LO3A 4JYAF 2A2CA 3MM7A 2XSFA 2VA2A 1IUJA 5J1EA 4DR1F 2QV6A 4TYBA 1QSLA 2RD5C 4ID5A 3JYTA 1GXLA 1RI7A 1HR0F 3J7YI 2FGCA 2YKNA 4DL5A 2F7VA 4DX8H 1N8RT 4ICLA 4B3MF 2UZAA 2QSFA 5AE3A 2C3YA 4I6YA 2OIHA 2K1RB 1YI2S 1VC0A 3TAPA 3IR6B 4LF7F 4C2MA 2MKSA 1FKOA 1RQ0A 1UL3A 3ICLA 2BANB 3IWNC 3LAKA 1C2PA 1M5PC 1R6YA 2BZ2A 2YNFB 1S9GA 2CPZA 4UUXA 2C2EA 4L6V3 4X4PA 3G6VA 3KNGA 3SSQA 4OQJA 2FVSA 2AU0A 2IM2A 3ZC4A 2P5VA 3CVKA 3VCDA 4WYLA 3W2WA 2VPZB 4JI7F 3M2VA 3VZHA 1LWEA 4PG8A 2UVVA 4FP9A 1Q78A 1R8AA 3PRDA 1FK9A 2VKRA 4IOBA 3I9ZA 4ED7A 1DRZA 2BYCA 1FTRA 1SIZA 4I6AA 2P9CA 2RIJA 3K5LA 2EFOA 2MXYA 3B78A 3HLUA 2HZCA 2DB1A 4IO9Q 2CFXA 4H4KA 2VOOA 2L9NA 1QAJA 3I96A 2FJAB 5E0OA 5DDQC 4WCEQ 1SXLA 2AYBA 1IJFB 1S72S 3IRXB 4PXDA 5AXKA 1Y3KA 2JEJA 5CXTA 1UMJA 4KKOB 1QUPA 4RBVA 5FJ4A 4BC7A 4IOAQ 1IR0A 5B0EA 3SSSA 1L5UA 4C0OC 2M70A 2DNYA 2KTQA 2E1AA 2DGUA 3CPWR 3LP2B 2FLNA 4YOEA 2LKZA 4G3IA 3FQKA 4DV6F 4MIBA 3CCSS 4QWCA 2ZZMA 2FVCA 4DR5F 3CCRS 4DL2A 1S4FA 2BRKA 2XY5A 3QJLA 4FYDA 1BQMA 3HVAA 1BQXA 2CPDA 5B0GA 3GG0A 5U47A 3CXCR 2ZJRQ 2VASA 1ULRA 1OQ3A 2E5IA 4TQRA 1CC7A 1M0SA 5F3TA 1Q82T 4TU7A 4B08A 4LMZA 3OL6A 1Q53A 1VOMA 3ISND 4R5PB 2GHPA 2LQBA 4KTQA 4WF9Q 5E3CA 3DYAB 4IR9A 3CD6S 1LWFB 4NYOA 3OV7A 4LSNB 4C8KA 2LXUA 3CCQS 1UWBA 2W9CB 1P9QC 4H4MA 1ZM4A 5G0RB 2R8KA 4NPOA 4WFAQ 2IYIA 2GNKA 2I8EA 3CGIA 4WKYA 1C0UB 1XK8A 2W9BB 3SV3A 4J9LA 3SCIE 5HO4A 1S10A 4AL5A 1RDRA 2EK6A 3MM7B 4MKYA 2HHQA 2KJVA 2EWHA 1NKBA 3FSXA 4ID5B 5KFUA 3JYTB 2QA2A 2CVIA 1LV5A 1HYSA 5LXYA 1P1LA 3QZ8A 2DHAA 3G96A 2WTFA 1LXNA 3RRHA 4Q7AA 4TY8B 1UJ6A 4F2SA 5BYSA 1NHUA 1CC8A 4C3LA 4J9NA 4HDGA 1U6FA 3MR3A 1KFDA 4A8XA 2R8GA 1UETA 3H2UB 4N76A 1WTFA 5F3ZA 4F3QA 4USIA 1H3DA 3Q8SB 1XNQF 2UUBF 2IRXA 1Y5IB 2VD3A 2ZVSA 2DHSA 1LW2B 1O5JA 3DM2A 3L95X 3CJKB 3M8RA 3T5KA 1HNWF 1JB0C 5BYQA 3BDEA 1T95A 2M4MA 3CD7A 1S9GB 2ZDPA 3D54A 1X9SA 3VAKA 2DR7A 4EZ6A 5GAEU 2KT3A 1KSPA 4F8RA 5DDRC 3RB3A 3N4WA 4CTAA 2P9GA 1S9EB 3MMCA 2OPSB 5KFDA 2XCAA 2KT5A 4C8ZA 4YB5A 4WTYA 3OJUA 3W2WB 4WXWA 3Q23A 5KFMA 1S6UA 4RNNA 2N3LA 3MPVA 3ULHA 3OL7A 3J7YU 3DCAA 5E7OB 1WG1A 3QGHA 1WEZA 2A18A 4V19J 4NCBA 1ZOTA 4QCLA 3KLHB 1UVIA 1FT8A 3FEZA 3TAMB 2AV5A 3PKMA 5KT6A 2E5GA 3CF5Q 4B9MA 5IT0A 4PG4A 1XMBA 5A6PA 1S77D 2ZH8A 4ED1A 2C2RA 1BY9A 3JTPA 3I9V9 3VTIA 3FFIA 2MZ1A 1FDBA 3LANA 3PIOQ 2I38A 2EG2A 2DNQA 3LAMA 1FNMA 1VIOA 2MDAA 1G3OA 1U48A 1A9NB 4PUOA 4LFCF 3UW1A 2U2FA 3JTOA 3O6QA 3RRGA 1X5OA 5K8PA 2XS7A 4AYBD 1BQMB 3GE9A 2D74B 1FE0A 2HFZA 2RS8A 2PMZD 4DV0F 1U4BA 4NZ0A 4F2RA 1IKXA 2N4DA 1KQFB 2V8GA 2YX4A 2MPUA 2FD2A 2WW8A 2M8DB 4ED3A 3OPKA 1Q8BA 4HI2A 4IH7A 4QOTA 1TK5A 1WG5A 2F8EX 5SZTA 3PEHA 5B09A 4DQRA 1S6QA 2RQKA 3FRZA 5JUMA 4IG0A 4DLGA 4IOCQ 4PXEA 1BGXT 1VK8A 1C1CA 1YJUA 3DFEA 4FN5A 4U67Q 1JKHA 1W2BR 4NWBA 4NMLA 3ZZ0A 2VQFF 2ERRA 4P6QA 3MM6A 2R4FA 4OI4A 2VG5B 3I0RB 1XR6A 3JTNA 2LEBA 1HYSB 5GMKa 5K8NA 4BWJA 4I56A 1C4CA 3UE2A 4JV5F 2LU1A 2MYFA 2Q3PA 2VZ9A 3MTJA 4MKBA 1FKAF 2BABA 3K0JA 2B51A 4RW8A 4I7FA 3MUTP 4UOCA 5I3UA 4DWIA 3DM2B 5A0YA 3BGFA 4EBCA 2M7SA 1F2GA 1KS2A 3GFHA 4K4YA 3W2VA 1VQSA 3CUNA 5HMXA 2C28A 3EXYA 3HHLD 3K5MA 4YHHF 1X5PA 3TVZA 3MMCB 2RB7A 3FDSA 2V8DA 3N5FA 4M63A 5CZXA 1KFSA 4LIRA 5E3AA 4K50A 4IQXA 2R7QA 2IAJA 2HVZA 1HQEA 1SI9A 2FHMA 1KD1T 2FVRA 4IR1A 5AE2A 3BQ0A 2GX8A 2QE5A 4KV8A 1SJ4P 3CIMA 1VQ5S 4ZHRA 1H7XA 4C4WA 1LQ9A 1S1VA 3C8YA 2R2RA 4TLRA 5K8MA 2DIVA 3UPFA 3NCQA 1IM4A 2NSBA 2IMOA 3B4MA 2E5JA 3THPA 1MNEA 1B64A 2B4PA 1FEEA 2AYMA 2G0CA 1Z1ZA 2OO4A 3IWXA 1C1BA 1VQLS 2CQ0A 3OR2B 4QIVA 1NK5A 3H5SA 3POTA 2RS2A 5J2NB 5KFGA 3BSCA 4G1QA 4Q5VA 2BR0A 1VBZA 3PNIA 1FF2A 3M8PA 1NO8A 4K59A 3PO5A 4B9SA 4BCAA 2C2DA 4PUOB 2PC6A 3UQSA 4K4WA 2HHVA 1YRTA 2VA3A 1GXUA 3C2PA 4ZCMA 4DF8A 2QLXA 1VQ7S 1RT6A 2D9PA 3X1LB 2FC8A 4I0WA 5CH7B 2RRBA 1IKXB 4QWDA 1HMVA 2A1BA 3T5HA 1JLCA 1KVIA 2Z2LA 2OKQA 5H9FJ 5DS7A 3D0IE 1H0HB 4KSEB 3IAS9 3NNAA 2XSJB 3J81Y 2DVIA 1S6QB 1N33F 4TKTA 3OTOF 4IG0B 3HVTA 1UAWA 3CCMS 3TNVA 2XG8A 1RT1A 4HVZA 2MGZA 4FNIA 4DMZA 4NA3A 2FDNA 3SI8A 1C1CB 2DTJA 2ZE2A 5KFLA 3VQSA 2VONA 2O01C 2GHVC 1Y00A 2R7TA 1UFLA 4NRUA 2Z8QA 3MM6B 5LSRA 1N5YB 1XTZA 5E3PA 3EPIA 2AP6A 1N5SA 4XAKA 5LJ3Y 1L3UA 1ELOA 2CVEA 4IYQA 4CT9A 2XCPA 2LXIA 2EFGA 1X4AA 3A1YG 5DETA 5IQ6A 4HYKA 1YHQS 3NMAA 1FJ7A 1NH7A 4RW8B 2YTCA 4KO0A 5A2QY 1FRMA 1UFWA 4RX6A 2LA4A 1MMLA 1TKXB 4I7FB 1ZYQA 3HHKA 2VB6A 2LECA 3QJJA 1JLBB 5KG3A 4C8NA 1K0VA 2KJWA 4ED5A 3KHGA 3SFGA 1OQ6A 2D7SA 4URQU 3W2VB 2NLWA 3TUZC 2OFGX 4WK3A 3RAQA 3ZZZA 3P5TL 2DO0A 2F8HA 4J5OA 3V81A 4JV1A 2UUTA 4QIEA 5G4DA 3EX7B 1Q7YT 4FF4A 3GFYA 1J5EF 2IAJB 3LWLA 1HQEB 3DHWC 4C97A 1GTEA 2HRYA 2IYGA 4BC9A 5KT2A 3DLGA 4KV8B 2XMVA 2MY7A 1S1VB 2BRLA 2O66A 5K14A 3K8WA 3CO9A 4LJMA 4Z37A 3RB6A 1VQOS 4K4ZA 1FXRA 2K3KA 1JLEA 2J7UA 4YY3F 5F8NA 2JZ5A 3WBZA 2BJEA 1SL0A 3AJ2A 2RNEA 4ELVA 3BO3A 1UJ4A 4P7TA 1C1BB 3K8VA 5AXMA 4YR0A 1NK8A 5D8HB 3N6LA 3DLKA 2GIQA 3POTB 1WTBA