4HT7A

Co2 concentrating mechanism protein p, ccmp form 2
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
203
structure length
203
Chain Sequence
VELRSYVYLDNLQRQHASYIGTVATGFLTLPGDASVWIEISPGIEINRMMDIALKAAVVRPGVQFIERLYGLMEVHASNQGEVREAGRAVLSALGLTERDRLKPKIVSSQIIRNIDAHQAQLINRQRRGQMLLAGETLYVLEVQPAAYAALAANEAEKAALINILQVSAIGSFGRLFLGGEERDIIAGSRAAVAALENLSGRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of CcmP, a tandem bacterial microcompartment domain protein from the beta-carboxysome, forms a subcompartment within a microcompartment.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Protein binding
molecule keywords CO2 concentrating mechanism protein P
total genus 62
structure length 203
sequence length 203
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2012-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ht7A01
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ht7A02
3F56A 3FCHA 5L39A 5LSRA 5LT5A 3MPVA 4HT7A 3U27A 3I87A 3GFHA 3I82A 5SUHA 4HT5A
chains in the Genus database with same CATH superfamily
3T19A 2L48A 2FVRA 1BLUA 1CVJA 1S0VA 3LP2B 3KLGA 3BF4A 2H5JB 2W7OA 1CBKA 1ACMB 3QT6A 1KTVA 2B4PA 2K7JA 5H9EJ 3LF0A 5ETNA 2W9BB 1VC0A 2IA6A 4O3QA 3DGPA 4NLWA 1YI2S 5KFVA 2Y3YA 3HSJA 1YRXA 1YX2A 1YJWS 3AFGA 1L3VA 2OFGX 2XS5A 1HKAA 1I94J 2CPZA 5HL7Q 3MEDA 3RB0A 3CCTA 3DDNA 2FY8A 1FK9A 3S8SA 2VD3A 4PQUA 2IBKA 2J9DA 2XEXA 3CMES 1CJKA 3HSGA 4PCQA 5DLFA 3CUNA 4JI8F 3SIPB 1QE1A 2D9OA 1S76D 3R6LB 1FEEA 1N48A 3GZ7A 1HBMB 2O5DA 5LSRA 3CC7S 1I51B 4JI4F 3AJ1A 2KYZA 4DQIA 3AQPA 3Q8SB 2QLWA 1MN9A 2O1PA 2DR6A 1XBWA 2HG4A 3HVTA 1LWEA 1NK5A 4IYQA 3SSSA 1D8YA 1NM2A 2DNHA 3CCWA 3GSDA 4NLDA 4P6QA 3MPVA 4NI2A 5HBMA 2AU0A 4EWTA 1HNIA 2LYVA 2HHTA 2KZZA 3X1LB 4FN5A 3BQ1A 4ZVTB 2KN4A 2MKJA 3DYAB 3R5DA 2XMUA 2ZKTA 1WG5A 1M5SA 5AXKA 4OZ3A 4ID5B 3CJQA 4IG0B 3V5RA 4I67A 2NPIA 4YR3A 2ATCB 5IOLA 1X5SA 3BYRA 2W25A 4IH7A 3CCVS 3HVWA 3BSOA 4W98A 3OXFA 4ZP9A 5KFBA 1RT5B 2HQGA 3I5BA 4DI6A 5LMUF 3RBZA 3M8QA 2DHSA 4X64F 1N8RT 1FRJA 3EGZA 2BV3A 4J5OA 1RADB 1U1KA 2Q66A 4RBUA 5A0YB 1Q7LB 1OIAA 2XBPA 2ZUGA 1MROB 1XWLA 4ES3A 1UL3A 2ZBRA 3Q89A 4ZP7A 4NYOA 3UPFA 4J90A 4ANEA 4DZDA 1SI9A 2LQ5A 3POTA 5HROB 1KWMA 3OR1A 4JI0F 3QGGA 3T5JA 2JOQA 4IG3A 5GAHU 5HN0A 3CJSA 1RGVA 1JLAB 4MKYA 4X4VA 2GV1A 1N88A 1Q86T 4NLXA 5H9EK 4LSLA 4OYZA 2HGMA 3S7RA 3UR0A 4KT0C 2W4PA 1UMJA 4AE5A 3CCUS 1FNXH 3MF5A 3PVXA 3C14B 1FI4A 1HD1A 3CDWA 1VQSA 3KG1A 1HHQA 4DS5A 3LANA 1VC5A 1NB2A 4NYPA 1NDPA 4B3RF 2VFSA 2CNNB 3AJ2A 3H2UB 2NZCA 5G0RA 4NA3A 4LBHA 1I3OB 3H5UA 2GO8A 3P8BB 1RI7A 2E9RX 2R8GA 2FLOA 4I2PB 2ZD1B 1RK8A 1NUEA 4R8UA 4YY3J 3NCQA 2ZH2A 4X2BA 1R6VA 2F9DA 2DISA 2C3OA 5F8GA 3BGLA 3DRXA 3NNHA 2V9WA 1TL7B 3UD4P 4PWDA 3JAMU 4BHQA 1NZAA 3OVAA 4UT4A 1VLYA 2RIJA 2ZC4A 4KY3A 1HWJA 1SB6A 3OTCA 4OI1A 2HPUA 4YP3A 4F02A 2RMLA 3Q8PB 4DV5J 1IQTA 2IRXA 1HBNA 2K1RB 4F7VA 1ZM9A 4C97A 1E6YA 2EW9A 3CJ8A 5EN1A 3VALA 3MAAA 4X65F 3AT1B 1ZPVA 4AFFA 3PJWA 3R6GB 1FKOB 1C1CB 1JLBB 4FKYA 2J9CA 5JMNA 2VQFF 4NPOA 3THVA 1HD0A 3ENVA 5JXSA 3GB0A 2VU5A 4ED0A 3MM5A 4CLTA 4DFJA 2UVWA 2LA4A 3KHGA 2CJ9A 3I4HX 1N32J 5HROA 4LF4F 1WC1A 4I69A 2JRSA 3GPAA 1RISA 2B6AA 2IC3A 3AODA 2L3MA 3BDEA 4OFZA 4WFBQ 2BA9A 2I8EA 2KO1A 3D6MB 3W8GA 1U4BA 4FKXA 3S6EA 2W8LA 3T5KA 2KI2A 2CNLB 4NZ7A 3POTB 1WHXA 2DGQA 3MMBA 1NDCA 4QCLA 4YFUA 2CWXA 3DMJB 3PYDA 3IN5A 4PUOB 3GV5B 1S1XB 4HH0A 6FD1A 3OLAA 3KLEA 4PYAA 3GFYA 1W2BR 5KG2A 3TQ1A 1KN6A 5D0HA 3DLHA 4P71A 4WXWA 3V4IB 3M6UA 3CCRS 2AYEA 2ZOFA 3EXCX 2R42A 4ZPDA 5AJ3J 1KQGB 3G6YA 4UZCA 4M95A 3O8WA 4YDDB 1FTCA 4KJIA 2P9EA 1DQ8A 4MYTA 4NA1A 4J9VA 1U2RA 4DPUA 2LVWA 4OYMA 3DOLA 1O5JA 3K2YA 2L9DA 2W9CB 4NLSA 2VKZG 3RRKA 4CT9A 4XDDA 5DM6Q 3JTNA 3ISNC 4Y2AA 3C6UB 1R0AA 4ZVEA 3LW5C 2WB1D 1FKPA 4OZ2A 3VF0B 2CQGA 1SVDA 2Z2MA 4HT5A 2JNJA 2DT9A 2FJBB 1HBNB 2VF3A 3DLBA 1G2EA 1IVZA 1RSCA 2RJZA 3HHKA 4ZLNA 3J81j 4TQRA 2FVSA 1X60A 4ZIWA 2NQPA 3IWXA 3BGFA 4DL5A 2KT5A 5HI7A 2BQ3A 2J76E 4GC7A 2RKIB 2BW7A 3P45B 1T05A 1VBKA 1VLOA 1TKZB 3A8KA 3A8EA 4OX6A 4XAKA 4ERDA 2GHWA 1JJ2R 1LW0B 1WDTA 1UETA 2AGPA 2IMOA 4EYIB 1LWFA 1T9VA 1M5VC 3HHDA 2FVQA 2H3EB 1B0VA 3DHWC 4UF4A 1RWOB 2HHWA 2IDEA 3FNNA 3MCNA 3JYTB 3MR3A 1IWGA 3NGTA 2BABA 2VG5A 1TVRA 4MFBA 3QT8A 5C25B 4QWEA 4I7FA 1I6JA 2W2QP 3FVYA 1VR6A 3HP6A 2HNYA 4KAIA 1NXIA 4G1QB 3CSKA 5CD4A 2VPWB 3PV8A 4URSA 3KLEB 1P1TA 4Q7AA 3ZXWA 1RYSA 2OMLA 3NNCA 4ZCKA 5L8RC 2JL9A 4DV1J 5IT4A 3J81Y 3KLFA 1RHKB 1T02A 2IFXA 3HMJG 2OMOA 4DL4A 1RWMB 4OHZA 2AGQA 2MYFA 1J5EJ 4DR6J 4P2FA 2XMJA 4HACA 3CJKB 1SC1B 1JXEA 1NSPA 2IJRA 4WFYA 2GVDB 1HMVA 3J7ZT 4DV3F 1HQEB 1TK8A 4C4WA 4FS1A 2L41A 3IGVA 5KG7A 2HNZB 1U2FA 4K4XA 2J6UA 1S4EA 3FFIA 3R9LA 1QAYA 3EUNA 4DR3F 2ZH5A 2VFRA 2BKOA 2DNRA 4CI0B 3G9CA 1FJGF 2DIUA 2BJ7A 2FJDB 2MMYA 4EO8A 3D28A 2MQQA 3ZZUA 4MKVA 4RBVA 1RWNB 1WKLA 3SBMA 5ETKA 3TEHB 2DNNA 4MKAA 1Q81T 1XK8A 4KH1B 3KG4A 4O4RA 5IV4A 3JYTA 5IQ6A 2CQDA 4K4VA 3PFEA 2N3OA 4U6PA 4JI2J 4ED6A 3PW2A 2B5JB 2CXEA 3GR0A 1FRKA 4DQSA 2HHXA 5L38A 2LEBA 4BDPA 3NL0A 4FYWB 3BN4A 3K5MA 1DHMA 5EX3A 1TKZA 2DNMA 3DRSA 4JV5J 4IR1A 1B99A 3R2CJ 1T9UA 2PMWA 4NMXA 2G9OA 1PC5A 1W7WA 3M2RA 3ZTPA 2PEBA 2R7OA 3FRYA 1VMBA 4OJ1A 4YMEA 2YKNA 5IZHA 4U7CA 2DHHA 3Q8UA 1NKBA 3RYLA 5KG3A 2FC8A 3TR5A 1T95A 1DTQA 4ZMMA 6AT1B 1N5TA 3M1VA 5GAGU 4PXBA 5HVGA 4ECYA 3EM1A 4JI1F 3NBPB 2WOMA 1HNXJ 3I6PA 4TKTA 1GXLA 3OVSA 1XNRJ 2B8QA 1TAQA 2D69A 3BGOP 4NRUA 3M8ZA 2HMIA 2FC9A 3ICLA 2R7WA 4J9RA 2DKOB 4OQJA 1X4DA 1Q78A 3U1LA 2R2RA 4DR1F 3V6KA 1IKWB 5HMZA 5KOXA 1X9SA 1TMMA 3DDKA 5KFAA 1J5OA 2VFVA 3LGHA 4XTTA 2VZ9A 2Z58B 5KFSA 5KFUA 1X31C 3PO4A 1SL2A 2DEJA 3ONQA 4DR4J 3CJ2A 3B78A 3PYEA 3BH7B 4LVOP 5HATA 4OX9F 3KNAA 3O3LA 4TYBA 4ELTA 4DF8A 3R2DJ 3OFFA 4Q44A 3M7VA 3D6TB 2YNGA 3VHQA 2XZDB 3R5BA 3UN5A 5I3UA 3K17A 3N5FA 2Q6CA 3THTA 1N36J 3AB2B 1Q8IA 3AXKA 3W8PA 3QRRA 1FE0A 4QYRA 4F0MA 2MKSA 5KFMA 2CADA 2E44A 4RNMA 3RBEA 1KOHA 4LQ3A 1QVFR 1YZ7A 3OV7A 2LCWA 1IR1A 1EZZB 1MU2A 5D4NA 3HZGA 2VPXB 4K4ZA 3CCZA 4C8MA 1YLXA 3OSNA 4IOAQ 1SL1A 1T03A 4DSJA 2XZWA 2MHNA 1YSJA 3BKFA 1RP5A 1NHUA 2VIHA 1QDUB 4HT7A 4LFAJ 1S9FA 3QJPA 3N5BA 3N6MA 2IM3A 3BKTA 4JV1A 2MXYA 4PG5A 2X1FA 1H2TZ 2MKCA 3US5A 4J9QA 2ZH1A 4FXDA 1RDRA 3ZZYA 4YR2A 2R2SA 2JEJA 2RU3A 1SL0A 4X4RA 1PSDA 2P6SA 4WXOA 2C2ZB 1S9EB 4B9NA 3F56A 1YJNS 5D4PA 4ZK7M 1CULA 3OXLA 2BKNA 3FBCA 1TTHB 2J7UA 2M70A 1IQZA 2K8GA 2YQ3A 3GYGA 3IS9A 1P9YA 3OFHA 3U7JA 4LF6F 1U26A 3D6HB 4NOHA 2RDJA 3CPWR 3GYNA 4F4ZA 3D7SB 3Q8YA 1HNVB 2ZBCA 2OD4A 2HS3A 1N6QA 1T3NA 1Y9OA 5A0YA 4GVBA 4RWXA 2E1AA 2MSSA 4YB5A 4ZVFA 1GH8A 1WG1A 5DQHA 2M8HA 4KB7A 1UKUA 2XGPA 4C2MA 1K44A 1S1VB 4WYWA 4M1KA 1HBUB 3CJ4A 2HFUA 1MWYA 3QZ8A 2A18A 5A8RA 5K8MA 3HVRA 2FZGB 1TK0A 2ZNZA 2XI3A 4GMKA 1U8SA 4FPRA 3IFEA 5HO4A 3KK1B 1U1PA 2M7SA 3HD1A 3ETMA 2J8SA 2CJBA 4DCOB 2H54B 2K3KA 4DMZA 1JKHA 4M5KA 4ZN1A 2ADBA 3PG9A 2XULA 1KVKA 2G2ZA 4YN3B 3HFKA 4AUKA 5DQIA 2VJUA 4J9LA 1M5KC 3QWUA 4RW4A 5J1EA 1JK9B 8ATCB 4LF9J 2CQ3A 3PO5A 2BACA 4JI3F 2EXUA 1KBRA 2C2OB 1LKZA 1HWUA 4LT6A 4USIA 4HDHA 5DDQC 4RU9A 1AYEA 1LOUA 4ED7A 3PX6A 4N41A 4LQ9A 4LFBJ 2ILZA 4X4SA 1XTZA 1DY3A 1OSDA 3H2LA 3NRBA 4LUBA 1HYSB 4PXEA 4CH0S 4J9NA 1QJHA 4DPXA 1F5AA 5I3QA 4TY8A 3TUJC 3OJSA 5GADI 2CKWA 1OQ6A 2HZAA 2WW4A 4CQ1A 2DTJA 3EICA 1NDKA 4NLUA 2EEYA 3ZTQA 1RAEB 4IFVB 3DXSX 2JEFA 3ZO7A 2XWXA 4R0EA 1RWPB 2VB6A 1CULB 1PCAA 2V8DA 2V9KA 5L1KA 5A8KA 1H6KX 5A8WA 4QYZK 2WCXA 4I6AA 4M5JA 1VBXA 4Q0BA 1NSAA 3OFGA 2EG2A 3N6LA 5KFXA 3CDAA 1S1VA 2E7XA 2VDIA 1FEHA 1Q95G 4LFBF 3Q22A 2VV5A 3UE2A 4EYHB 1F2HA 2ZFHA 5LXRA 5L1JA 2XNRA 5IQQA 5FJ4A 2BRKA 2QX0A 3QYYA 3FJ2A 3C2PA 1JLCA 1HW9A 4RW6A 5D3GB 2B3TB 1IBLJ 3SMZA 4GKKF 4GKJJ 2ACMA 2HRYA 2YWGA 4E2FB 4PAAA 5CCMA 3EPGA 1WC0A 2QFIA 3FZ2A 4Y00A 1GMUA 4RW4B 5J1EB 3GFHA 2W9AA 1S6PB 1LXJA 2E9TA 1F5BA 3HT0A 4UOFA 3L7PA 1FK9B 1FKPB 3HFZB 3N79A 2R9LA 4NZ0A 3DM2A 1GX6A 3TA2A 5KFZA 1RTJB 2ROPA 1CJKB 1ULRA 5CAAA 3MMCA 2DIVA 4WTYA 1DLOB 2DRAA 1BQMA 4TNOA 1NEEA 3VGUA 4I64A 2UP1A 2PD1A 1JB0C 3G2XA 3N28A 1T11A 1SUQA 2B9XA 2PN6A 3FMBA 1NJYA 1KLNA 5J1NA 1RT4B 2DNZA 3SQGB 7FDRA 4O44B 5GADU 1SJ1A 3BJYA 1VBYA 3IWLA 4AQYJ 3RAQA 2GMHA 4ID8A 3AA9A 2VPZB 1MMLA 4I6YA 4M5DA 2N7CA 1WOSA 2GMLA 3PR5B 1YJ7A 5F9NA 4ED3A 1LNQA 2PIIA 1ZM2A 1ZTTA 5A2QU 2RNEA 3EX7B 1NJIT 2W24A 1EP4A 1S99A 3QO9A 3VWSA 5BR8J 1QSSA 2NREA 3E8OA 3OL7A 2YWHA 1PIEA 2GA7A 5FD1A 1DQ9A 3DLKA 1W2IA 4K5SA 3OUYA 1HHSA 3QIPB 2RQMA 4NCAA 4HL9A 4ZHRA 3O2IA 3MHYA 1VQPS 4LRBA 3CMQA 1M1KT 4UY85 1KVJA 1PC4A 1UFLA 4KV8A 4KC5A 4UOCA 4ZVOB 4JI6J 1C4CA 2HFOA 2N3LA 3JQJA 3C14A 3OTOJ 5HP1A 2FHMA 2ZDPA 3PM9A 2KKHA 2XCPA 1UVKA 2ZOGA 3MD3A 4LBPA 4QYZJ 4OHVA 1CC8A 1MW7A 1BQMB 3BPDA 3HSDA 2A2DA 3IG1A 2ZH3A 4GC6A 2AJQA 3TANA 2GMJA 2OPRA 1FX4A 3V6DB 4LR9A 1VBZA 1HMVB 1LK7A 1RLCL 1YG0A 4IG3B 4X4PA 3L3CA 3DM2B 3TVZA 3PNIA 4RNFA 3NEKA 4DU8A 4GKKJ 1JMTA 1UEUA 5I3UB 2VG6A 2GQCA 4O3OA 3UD3P 2EBGA 5E2QA 4DLEA 1X9MA 2QT7A 4RU2A 1YHQS 1FNMA 3NMRA 2FQQB 3E3XA 3QFWA 4DN0A 3M05A 4ZVHA 3SQGA 2J6TA 2HLUA 2YQ0A 2YNIA 2QV6A 3N01A 2JFDA 2O66A 3N6NA 1APSA 2W01A 3V81B 5D6GA 3CTRA 3LPYA 4ZPTR 4CM2A 2XGQA 1S12A 3CB4A 4RO0A 1PGZA 2Q1LA 4IFYA 2QZ8A 5KG0A 1U0HB 4DR2J 3ZZTA 1KD1T 1RTJA 2XYPB 1H38A 4KPCA 1FWKA 3NCPA 2CFXA 1UVNA 1YQHA 2YX1A 3CO0P 3JSRA 4USTA 5K14A 4FVCA 3ENWA 2HGLA 3UVJA 4EI2A 3QGHA 5F8MA 3PZPA 2BRLA 4RUHA 3KK3A 3SXLA 1FX2A 2FHJA 4OZ5A 3KLGB 3KHRA 2ZHBA 1RWUA 3R5CA 2J7KA 3M2RB 2KTQA 2V5HG 3DKDA 3EGWB 2ZE2A 4O3PA 3H42A 4K8RA 2IVYA 2Z4PA 3FCWA 3MPYA 1R7IA 2G4BA 1UFWA 3H8YA 1AFIA 4CP5A 3IR6B 5CYJA 2F1FA 4JV2A 3TZYA 2DR9A 2QFJA 2JEIA 2OEJA 1XMOF 4RWWA 1RABB 4YOEA 4CRJA 1O8BA 1WKKA 2HNDB 2X3GA 1JLFA 2M4MA 1N6QB 2KG0A 1FJGJ 2XC9A 1SQGA 2OPSA 4UW2A 1QD1A 4FF2A 4RBTA 4KGMA 2CDRB 1TL4A 4P72A 2UXBJ 2G0CA 1QVGR 2HFVA 2W2NP 2AYBA 4RUAA 4Y28C 2YKOA 4HHHA 2C1EB 5I42A 3PJ9A 3FQLA 2B8PA 2YKMB 4NCGA 1SXLA 2XWYA 2Y0BB 4FF1A 2RDIA 2OSQA 1XC9A 3TVKA 4B9SA 2Q6BA 5KFYA 4YUDA 3OBIA 2BDPA 1IBMF 4ILMA 3QLHA 5CH7B 2KHDA 2CPXA 2V94A 2F3JA 3GSIA 2QMXA 4DOZA 3CD6S 3VTIA 3HULA 2ZZMA 2F63A 1S49A 1YGYA 1B4SA 2B4VA 2CJXB 2MKYA 4B3OA 1PJ7A 1Y4ZB 3LWMA 5HQLA 2ZJRQ 3MFIA 4LRCA 1GQEA 3LH2S 3J7YI 3W62A 4PR6A 2PDAA 1X8DA 2ZZTA 1MN7A 4DQPA 4RW7B 2R7XA 3PW0A 5T14A 3L4BC 4AL7A 3BSCA 3W9JA 3T1YJ 5L46A 1XR5A 4YB1P 3QBCA 4PYDA 1NMEB 1SQFA 2NYIA 2Z8QA 2DJWA 1SKSA 4KSEB 4H4OA 4JI7J 4X84A 4CYUA 3NWGA 4FNHA 2AW0A 2HFSA 5FDLB 1C1BB 1SPBP 1UJ5A 2RQKA 2VG7A 3W66A 4C98A 4CT8A 1FWPA 3LP1B 3V6HA 1R8AA 1X5TA 3EDQB 1OPZA 4LSLB 4L6V3 1FA0A 1R31A 2DGOA 2OAUA 4EU0A 1V5IB 5HVHA 3WIVA 5KAKA 2ZHAA 3G8SA 1OYEA 2ILYA 2HWTA 1H0HB 2BE2B 3LPEA 4ED5A 4IRDA 3FQKA 2GVZA 3CDEA 4PEOA 1KEKA 1RXOB 2DO4A 4LF5J 2J0SD 2E5JA 1B7YB 2MGZA 3EDRB 4HKQA 5I3PA 1HI1A 3MR2A 3M32A 4JI2F 2W7AA 2CQIA 4AT1B 1SIWB 4CNYA 4DV4J 4I2PA 1QY7A 1UWBA 1WWHA 4BBYA 4OHXA 3AOCA 2M9KA 4O23A 4R5PA 2YH0A 4DL0C 1KP6A 5IT9Y 1TL7A 1XERA 4YB7A 3FC9A 3L09A 2DXDA 4CIOA 3M8PB 3UDCA 4ECXA 2MQOA 5AT1B 2XM3A 2ADCA 3QJLA 2VC0A 3TZWA 4JI6F 3HHEA 5C24A 1U1LA 4CO1A 2LDYA 3NS6A 4FPIA 2EFQA 3VQTA 2XMKA 3NOGA 1SH3A 2MY8A 2ZC3A 4RZRA 1TQLA 3JAMY 5DGBA 1KOOA 3UFCX 3P3DA 3NMAA 3OW2R 3JTPA 3G87A 6FDRA 1CJUA 1GK8A 1YRTA 5GMKa 4PXDA 3ZZRA 3D68A 4DV6F 2HHQA 2KVQE 2APOA 1SC3B 2C3YA 2CQ0A 4B3TF 1JLAA 3MUTP 3PEJA 3CGIA 1FHTA 2NSCA 1TK5A 4CYUB 4DSKA 2MPUA 4C8ZA 3EXYA 1AT1B 2OP5A 1EAYC 4QBUA 5HSPA 2D3OR 2M3DA 4ATNA 1LK5A 2VQFJ 2R7UA 4RR5A 2R8KA 1KS2A 2QL7B 4TYAA 2W1BA 1N0UA 1HARA 4QWAA 2ACYA 1P1LA 4MK9A 4OJGA 3H5YA 4DL2A 3LP0B 5ETRA 4YQWA 3Q8RB 3W5ZA 3M8RA 2FLNA 5IM0B 1GXTA 4PG4A 1L3TA 1LQ9A 3HKZD 4JYAJ 3ENAA 2VDHA 5ETLA 3VQSA 2G2YA 5KT6A 3DOMA 2HHSA 1ZTWA 5HAOA 4XPCA 3WC0A 1PILA 1JLQA 2RRNA 1PYSB 2V34A 2G1DA 2DK2A 2MZSA 3JS9A 4NASA 1C1BA 4DEZA 2W9CA 2E5LJ 2I1RA 1T9XA 1NSQA 3OR2B 3KFWX 4O3RA 4USWA 4ZJOA 3RG6A 4DR7J 2WK4A 3QAEA 4PG8A 5IT9U 5D8HB 4M5LA 2LXUA 1P9QC 1WHWA 2MLZA 1TUGB 4LF5F 3NBPA 2MLXA 3GR1A 5C24B 1VQ8S 1NZ8A 4LIWA 5HMXA 1P6TA 3PW7A 3BV8A 3T9NA 3W65A 2YKAA 4FYYB 4RKUC 3DMJA 1O6XA 3KG0A 4PUOA 2JVOA 1MG7A 4PWDB 3BO2A 2EWHA 5CZVA 2AYGA 4WFZA 1UWBB 3D54A 4AXJA 4WBFA 5A2QY 3ZTRA 2HVEA 4J9MA 1RT3B 2B6AB 1JNZB 2MKHA 3KLVA 2HYIB 2A6MA 3IWNC 5EWEA 3ZTOA 3K0JA 1YITS 3OQ2A 3PW5A 1ZPWX 3BR9A 5RUBA 3BSAA 1TL1A 1RKIA 1NK7A 3CDBA 5GAEI 1ZZFA 1Q82T 3AD9C 3PIOQ 1MSWD 4DPWA 3KLHA 5ETTA 1KDNA 2P6TA 2WB4A 5IM0A 4OLPA 4NWBA 3DGVA 1Q16B 8RUCA 3M8WA 3TX0A 2ROGA 5KFQA 2QA4G 3P49B 1Q0NA 3AOBA 3BBFA 4U96A 3GJSB 5E3RA 4EBDA 2H1YA 1UA0A 1KVIA 1ROFA 2DNKA 3WC2A 2HHPA 1RA6A 2J9DE 4QWBA 5J1PA 2XQCA 1HBMA 1D9AA 4USHA 5CYQB 5KFIA 2D7SA 5B0GA 1VQ4S 3THPA 2MB0B 4QIVA 1OO0B 3QFHA 5CYMB 2XCAA 4NCBA 1WC5A 2GVDA 3CD5A 1RAGB 3QRQA 3RR7A 3IG1B 4J7CA 1ZETA 1FXRA 2V8GA 5HQ8A 2HZVA 1LWCB 2FTRA 1NK0A 2VA3A 2E9ZA 2CZ4A 4X64J 2VODA 3O6QA 3BM7A 3UN2A 1M5OC 3QSIA 2ZJPQ 2MZQA 4HI2A 3O5TB 4IG0A 2HS0A 1KLMB 1SIZA 2LXIA 3H4BA 3I31A 4USMA 3BKUA 3H98A 2MZTA 3NLCA 5F8LA 3OHAA 1HBUA 1QUVA 3KJFB 4L3KA 2V4QA 3QMQA 4GO7X 3OJUA 1EX8A 1TZ0A 3FBFA 5DQGA 3VGSA 2XG8A 2ZH6A 1L5UA 2PC6A 5LT5A 3V6JA 1Y3KA 3UCUP 4XDCA 2HNDA 3VGVA 1Y11A 2XLIA 4F3OA 1RU1A 1R0CB 2C3MA 2J6SA 1FCAA 3TNVA 5LXYA 1RT3A 3R3TA 1TKTB 4B9TA 3UR3C 2XB2D 5KT3A 2Y1JA 1RAOA 3MOJB 3FUYA 1S0NA 3DNCA 2FJWA 2CQ1A 1KRPA 1RTDA 2HGNA 3CJ0A 4MH8A 5D4OA 4LF4J 2F8MA 2JC0A 5KFHA 1DTTA 4PG7A 5KFLA 1X7VA 4X62J 3I87A 5LJ3Y 3MCOA 1VQ9S 1CQMA 3PYGA 3FZBA 3VCDA 4G65A 5LMNJ 3UDLA 1HQUA 2BJ8A 3MTKA 4UZBA 1SJ3P 2ZE2B 3MCSA 3KJQB 3I55S 4CO4A 4URGA 5IWAJ 1WHYA 2MQ8A 2IMWP 3PX0A 4DL6A 3LP1A 2KYXA 3D0IE 3EMTA 3MM8A 4DQQA 4IOCQ 1RT1A 2NXNA 1ZA1B 3NWRA 1EB0A 1LFPA 1OS5A 1WEZA 1AUSL 3HPOA 4L74A 4UOGA 2DB1A 1TV6B 4J91A 2J9EA 2OEKA 2R8JA 1NO8A 4ZPBA 2XHWA 5D78A 1T9WA 4NLTA 1Q8LA 4MJKA 3Q8QB 3V2UC 3ISND 1DTQB 4ZJQA 3GQCA 2ALZA 4IH6A 5IXUA 1WDDA 3GILA 4A8SA 3KMSA 3GJRB 2WVDA 5U47A 4R5PB 2CWKA 1ZAXA 1VQYA 1KQKA 4YS2A 5C2GA 2NSBA 4LF1A 2GAHC 4ETZA 2LQBA 2RD5C 4JI7F 4A8QA 1UJ6A 1Q1KA 3Q8VA 1T7PA 4P10A 2MSTA 2B5JA 1DZ5A 3QLHB 3PACA 5G0RB 1CC7A 2WAQD 2HAIA 3D0GE 1T9TA 4ZCIA 2VQEJ 1C1CA 2IAJB 2D74B 4RNHA 5EGYA 4YR0A 2OUGA 4MYUA 4WIIA 1ZBTA 5A76A 3LWLA 3R1LA 2AGOA 2HHUA 1C2PA 3MM5B 3PHEA 4BC9A 3MMCB 2K1RA 4FZVA 2DR8A 4Z7CA 2BX6A 1GMWA 1XNQJ 3Q86A 1UZHA 3I5AA 1BC6A 3MTJA 3J7AN 2IDLA 1KONA 1P27B 2DCLA 4Y3CA 1M1HA 4DPOA 4DX5A 1R8CA 5CABA 4ZLJA 3CCQS 3G6XA 2QIFA 3DCAA 3KUGA 2RS2A 1RTDB 1UW9A 3IGNA 2C2MB 3JQMA 2KJVA 3I4PA 2DBBA 3BGRA 3LP2A 3MM7B 1CJVB 2CPJA 2YX7A 2ZBQA 3M32B 3MGJA 4NMLA 1S1XA 1YBTA 4UUXA 2C2RA 4CLLA 2F5GA 2QLFB 2HK3A 4OYIA 3CF5Q 1GEHA 4ED8A 1RWKB 2KU7A 3D1QA 3H2VE 3IMQJ 3K5LA 1CSJA 2VASA 1R6YA 2HAFA 1FFSB 2W2PP 3PR4A 2Y1LB 3C46A 1NH8A 3FSXA 1U6FA 5C5JA 3BR8A 3DRPB 1FNOA 1PJ6A 2QYCA 4M5DB 2AEJA 5E0OA 4CLUA 2QSWA 3D4JA 2VOPA 1CJTA 2YWKA 4J9UE 2NCKL 2A0FB 3EVOA 4Q45A 1ELOA 4NRTA 3MPWA 3HK2A 4UOHA 1LEOA 1BY9A 5AXNA 4WIQA 5HLFB 4B3MJ 4W90B 5T7LA 2U2FA 1T94A 3A3NB 1FVQA 5KG4A 1UTAA 2V2KA 2CQ4A 4WFXA 4ZKAA 2XY5A 4OI0A 1SQEA 1U25A 4H4KA 4Y65A 4CH7A 4NL5A 4C8OA 1HBOB 1OY6A 2D1CA 3BREA 1J5EF 4DR6F 4M5MA 5A6WA 3R27A 1JX4A 2YWEA 5M2PA 4MKBA 1RT2B 4DV1F 2Z56B 3CJTA 2DNLA 3T1HF 5K5MA 1YZ6A 3KLIB 4E98A 4EK2A 1U48A 2MDAA 1JJHA 5KFPA 2V8PA 4DV0F 4PWUA 3ZNUA 1FJCA 2MTLA 2Q3PA 5FLXY 4LRFA 1NSKL 2VG6B 3QT7A 2EFGA 1FRLA 2IPOB 1TL5A 4EMDA 4IQXA 3NNAA 2N4CA 3HF5A 1CPZA 2IHR1 3C6TA 4PRFA 2FB0A 2H65B 4ICLB 4I1TA 2VG5B 2H48B 2HWIA 3KK1A 1TAUA 2JH3A 2MKIA 4JI5F 2BE7D 3RRHA 3IM9A 2PO4A 2VA2A 4RW8A 1BMQB 2EKYA 1Q53A 4IFYB 4P2MA 2W4DA 4EFAC 1U49A 2CUYA 1U09A 1WKJA 1XJWB 4L72B 3PCOB 2V68A 4Y6IA 3ZZZA 1EARA 2BJDA 3DRRA 3ZFVA 2KJWA 3AXMA 3W2VB 5KFKA 1HW8A 1VJWA 3SDEB 2V50A 3CNQP 1MROA 1JLFB 4U8VA 1WORA 3HFVA 3KXDA 2R4FA 5KFOA 4DU7A 5AE3A 4RW6B 4XIUA 4LF8F 2SXLA 2VKRA 3BB5A 3AD8C 4ZVPB 3AY0A 3JSMA 3CCSS 2EC2A 3PXGa 4ZLPA 1QAJA 1U02A 1PAUB 1JLCB 2XS2A 5AJ3F 3EWGA 4JOUA 2DGVA 4Q0BB 1X0PA 5A8RB 2HZCA 3QWPA 4ECSA 3KK2A 3W3SA 4WK3A 3HHLB 1TP7A 5KFGA 3CVKA 2E1RA 1K47A 1NJZA 3B4DA 3EZOA 4L73A 4ZVGA 2E5HA 2CAJA 3GJQB 1SC4B 1VGYA 2KFYA 1RHQB 1HPZB 2P9CA 4UQTA 5DO2A 4I4BA 2AHOB 4FYXB 4CM0A 3OVBA 1U1RA 4DR7F 1EHWA 2VJVA 1RU2A 2VBWA 3GG1A 3TARA 2B51A 3AOAA 4IOBA 2LECA 4DUYJ 2V67A 2AYMA 2B7BB 3MPUB 2D3UA 2FVCA 2YKNB 3IBFB 1Y5IB 1EP4B 1PYOB 3GFXA 4DSEA 2QL9B 1VRUB 4TU8A 5CA5A 3EZUA 3BQ0A 3SZ2A 3MECB 2GIQA 2B4UA 2U1AA 3QAUA 4ILRA 3EZ5A 4RW8B 1M1GA 4G1IA 4J37A 4P75A 3RW7A 2OPPA 4IO1A 1H7WA 2HRUA 1T9YA 2X7IA 2GIFA 2AKWB 1HLWA 3K5PA 4NLYA 4ALZA 3IA0A 3WZ0A 1JLBA 1JQGA 1F9HA 2QA2A 4NXNF 2RHSB 2MKKA 2UXBF 3F73A 2JLEA 3L7UA 4LSNB 2GQ2A 5B09A 2UV8G 1FDNA 2YX4A 2GW8A 3DLKB 2XMMA 1N36F 2R8HA 2J0XA 1YTYA 2Y8YA 3K8WA 3D9BA 1HI8A 1FDBA 4WKRA 1DTTB 1OSCA 2B9WA 2RHQB 2VH7A 1Q4RA 3H7HB 5ADZA 5B0BA 1S1UA 4LFCJ 5DZ7A 1E6VA 2ALYB 1S1TA 4XO0A 2I6WA 3RAMA 2E7VA 3OUYB 2KH9A 3VAKA 2C2EA 1U6BA 2RRBA 4EEYA 3NS7B 3MCMA 1H74A 1WG4A 4DX6A 2AF6A 1TKTA 2Z2LA 1K1SA 2LMIA 4L75A 2OIHA 3UQSA 2BYCA 1LW2A 3W2VA 2MQNA 3CCMS 4FYDA 4V19X 2KM8B 1YJRA 4U9RA 4LF6J 2AZ3A 2AZ1A 1HWIA 1JJCB 4CWBA 3R97A 1UPPA 2QTWA 3KK2B 3T3FA 2HW3A 3NGUA 3FMWA 1OPIA 1F6TA 3JSBA 3AA8A 2LQJA 3BQ2A 2R2UA 1N32F 3M2UB 1SH2A 1Y3JA 2NUHA 2V4JA 5D4LA 3UCGA 3WBZA 2A6OA 4F8RA 3E01A 1SUQB 2YVSA 4DL7A 2IY5B 4ID5A 4J9PA 3HO1A 3VAFA 1NK4A 1Y5LB 2E1MC 1AW0A 1QTMA 4JP8A 4K4TA 2P5VA 3NY0A 4CCHA 4F3MA 4A8MP 1ICEB 3DLLQ 4YB6A 1FD2A 1RBAA 1YBUA 1S57A 2HLTA 3L95X 4ZA1A 4U7UK 5J2NB 1LW0A 1ZH5A 3MM7A 3PRDA 4R0JA 2WVCA 1M5HA 3D6FB 1U8WA 2KXHA 3CE8A 4B17A 2CJKA 1NPPA 1R43A 1TUWA 1SBRA 5I4MA 1B7FA 3AHPA 2XMAA 1FD8A 3DDIA 3DI6A 1F3VA 1U1NA 1F3FA 1RKJA 1SV5B 5F8JA 2WSFC 4F26A 4KO0A 3R7BB 3BBBA 4Y2KA 2MZJA 3W9IA 5EWFA 3G4SS 3D3BJ 2FDNA 4BCAA 1PYTA 2ERRA 5D0RA 1HWLA 1FESA 2OPQA 2R8IA 1SJ4P 5EUHA 3TEGA 4U95A 2MY7A 2WVEA 2YKMA 3HX9A 4NCGB 3SFGA 4ED4A 3G6VA 4F50A 4FXWA 3BO4A 2HIQA 4Y34A 4JI5J 4QIEA 3ENQA 2COLA 3W2WB 3MM8B 1YJUA 4F25A 1JLQB 2XSJB 1BGXT 2QSFA 2K06A 1X4AA 3ET6B 4TU7A 3F41A 1UAWA 1J2VA 2CPDA 5J2QB 1VQMS 1F9FA 3MD1A 4ECRA 3AAWB 1DQAA 2CPFA 3MM6A 3C16B 2JZ5A 3ILOA 2ZM6F 1NPKA 2NYHA 1S6QB 3FFIB 1AB8A 1W25A 2MEWA 2BJ3A 2XMTA 2O3DA 2QLXA 2V63A 1Z2LA 2GFFA 3B4MA 2D9PA 3I0RB 1RTIB 4AQYF 2G13A 2NZ4A 4LF8J 2WZ1A 4DV7F 3MMAA 4OZ0A 3U1MA 1GMVA 3GCXP 3T9ZA 3QRPA 1WF0A 2DD8S 3A8IA 5KFTA 4DFKA 2LKZA 1RTHA 2GAGC 2V2QA 3MEGB 4LSZB 5CCLA 2LQ9A 1N5YB 2PI5A 5GAGI 3M2UA 1HBOA 2IYIA 2PA3A 3JTOA 4CLPA 3TA1A 4OV1A 4FNIA 1JKHB 1OMSA 4LR7A 4X4UA 5E3CA 4H4MA 3PYFA 2WVFA 4IO9Q 2JFKA 4I68A 1XQIA 4WCEQ 1TMJA 2W4CA 2AEFA 3NS5A 3D66A 2FUG9 2HBQB 3DN9A 2XLKA 4IFVA 3OTOF 1RB0A 3E2EA 1VCTA 4DUYF 1N54B 4CLKA 4WKYA 3HDSA 5DG8A 1H72C 5EHHA 4DV2F 1YWXA 2WBMA 7FD1A 3OT9A 4QIFA 3VVTA 2DGWA 2P8IA 4DF4A 1LV5A 4B9VA 2HVDA 4MIWA 1R3NA 2FYXA 4RW9A 2L9WA 2EFPA 3A12A 2HVZA 4HH1A 1Q5YA 4O4GA 3D0HE 3MPDA 1D0EA 5DDPC 1SKUB 4CLYA 2UVRA 1S5ZA 2VOOA 1DFDA 2HRTA 1XIQA 5BYSA 4EZ9A 3CWJA 4K4SA 3MM9B 3J7Z5 2QN6B 5HANA 2BMBA 3QGIA 4X62F 1VQ5S 4WP9A 1MMDA 2YPYA 4Z7YA 3R7SB 3RB6A 4R25A 1S59A 1X5PA 2OTJS 2XZTB 4USJC 5KOWA 4Q2LA 5IV3A 1QTNB 2BZ2A 2QA4S 3ITHB 1RTHB 4QIWD 1E6YB 3HHLA 4LRAA 4X4OA 5HLFA 1T03B 5JVHQ 5F0UA 2ZH9A 1FVSA 2DPIA 4OMFG 3DOLB 3S01A 4YDXA 2R2TA 1NPRA 1I94F 1SJFA 2AX0A 4LVNP 4JYAF 2VG7B 2ASJA 3A13A 5LOQA 4C0OC 1X5OA 3KHHA 2RRAA 3IAM9 1WEYA 4X66J 3CIMA 2N7YA 2DCUB 4GRSA 1N5VA 3RR8A 3KDNA 3R5JB 5JUMA 2GGPB 1S6PA 4O0NA 5DJBA 1OY9A 1NCLA 2E5IA 2KXNB 1KC8T 3C16A 3GTYX 2KG1A 3K57A 1NK8A 4C8LA 3HM9A 2C28A 3ILLA 1C4AA 1Z4UA 4ZVSB 1NRKA 1YK9A 3W5YA 1EJ7L 2RS8A 5EX0A 3GU0A 4F4AA 1YJTA 2HFNA 3C19A 2M2BA 3LGNA 3SSQA 2B56A 3MAQA 1DRZA 4GO5X 3DXBA 5J2MA 1YJ9S 1VQ6S 2V0NA 4N7TA 3FGVA 1REVA 1OWXA 1FRMA 4WYLA 3H90A 4OJHA 1XMBA 4NXMJ 4KPYA 2IRYA 3MR5A 3HHLD 2DNPA 1N5YA 2X1BA 5K8OA 4QOTA 1S9GB 1FRHA 2ZH7A 5C7PA 4MFBB 2QO3A 2UXDJ 1M5PC 1JNRB 5IWAF 1EQMA 3IO1A 4OYWA 4C8YA 3RUBL 2QRRA 3MMBB 3K5NA 3UW1A 1H2VZ 2L08A 4NI2B 1NHVA 4BLGA 5HBMB 1SKRA 1AUDA 3OFEA 3SCKE 2F4VF 5MAOA 3J80U 1F9EB 2C2KB 3I0SB 1WUUA 3O44A 5KFFA 2Z2YB 3MFHA 1RCXB 1UEKA 3FBBA 3LO3A 1S7HA 4WP8A 2IVMA 1RACB 2QC3A 2AIRB 2DGUA 4DR2F 2F40A 2DITA 4A8FA 3G86A 2HURA 4YHHJ 5B08A 4DSLA 3QGPA 2DYAA 3KLFB 4MTPA 1HFEL 1VJQA 2YPZA 1BWVA 4QR0A 1FF2A 4ES2A 3VAGA 1CLFA 1U0HA 2LXFA 5B7WA 3DOMB 3FEZA 3RB3A 4G1QA 5KG1A 4DG1B 3C6UA 1R0AB 2EFVA 2HQDA 3QPIA 4B08A 3B54A 1IJFB 1N56A 2R7VA 1FWLA 4GKJF 4DS4A 2PT0A 4PXCA 4DV5F 4OI6A 4NZ6A 2OLWA 2OHDA 4WPAA 2O67A 1TKXA 3L9ZA 4A4JA 4C6AA 3HVTB 4L76A 2DXEA 3A3PB 4B9UA 4G6VB 3Q24A 3U1NA 1SJRA 1VK3A 2Y8WA 2ZHOA 1KFDA 4KKOA 5CYQA 3CCES 2H5EA 2RU9A 4USVA 1AZSB 4AYBD 2LA6A 4ZCMA 1S1TB 3WX4A 1VRQC 1TELA 4A8XA 3QSYB 5J2NA 1RUSA 3I9V9 4WZMA 2HWHA 4IUFA 3SQOP 1WI8A 1CJVA 1U45A 3JSYA 1RHUB 2GGPA 2RAQA 3KDOA 4P52A 2HNYB 4DZ6A 3KK3B 1KFSA 1M0SA 2OD6A 5AE2A 3GV7B 4DV6J 1PG5B 4NLPA 1NKCA 4LSNA 2NXJA 4BS2A 4KRWA 4ECZA 2F9JA 4OHWA 2YTCA 2X1GA 4F4WA 1UFKA 4F0HA 1ZYQA 3KJVB 1BWEA 2HHHF 2W2OP 2WSCC 3ULHA 2UU9J 2GC8A 3TRGA 1S0MA 2UUBJ 5GAHI 1WF2A 2WRMA 3FCVA 3SV3A 4NLGA 1K0VA 7AT1B 2PSZA 4JI3J 5ETSA 1VFJA 2CA9A 1U7LA 2IJFA 4USKA 3C3LA 2UUTA 3AD7C 4DN9A 3H40A 4JI8J 1KQFB 4BWJA 3MEKA 2GCFA 4N5SA 4U67Q 4ED1A 1FDDA 1WSVA 3Q2SC 3JB9k 1IBMJ 3LQVA 1QSYA 2XHCA 5GMDA 4J9SA 4LFCF 3KMQA 1V3RA 2E5GA 1XR6A 1WELA 2GX8A 2WVBA 5F3ZA 1X9WA 1ZAWA 2FIUA 4CO2A 3CEDA 3CJRA 3N9UC 3EPIA 1RTIA 4C7QA 2VFUA 3TUIC 5L1IA 2DR5A 4HLBA 1BE4A 1PJ5A 4C3KA 2R7RA 2KVIA 4X4NA 1F5CA 5JVGQ 4F0KA 4OHYA 2I38A 2ZD1A 4NLQA 3WIUA 4PKDB 1RHMB 4R8UB 2EG1A 3GV8B 2UUAJ 2JC1A 4KTQA 4K0KJ 1FKAF 1L3UA 1S1WA 2V2VA 3G82A 3ET6A 2M0GB 3UDEA 2RSQA 1GAOA 4M5GA 4ZS6A 1IUJA 1FTRA 2EI5A 4FYVB 4Y2CA 2OPQB 2WW8A 4OYBA 1AXQA 2F8EX 3S1TA 1Q5VA 3VZHA 1RT1B 5B0CA 2ASYA 4ZIVA 3EGVA 2PFFB 2DH7A 1WTFA 1VDHA 4DG1A 2XLJA 2HMIB 4X66F 1N0VC 5C42B 2Z2ZA 4Q8EA 1S10A 2A2CA 4M8LA 2ZKUA 4JB8B 5G4DA 2AQ4A 4MIBA 5LM7E 2W9BA 3M1VB 5SZTA 3P4UB 4P73A 1IKVB 4TVAB 3TI0A 1RBOB 1SV5A 1DARA 4BWMA 3OL9A 1XNRF 4KE5A 1QAXA 2Z0GA 4C11A 3R1HA 2XSFA 3I82A 3DOKA 4RW9B 4JI4J 3JQKA 2XSJA 2VONA 3SDEA 1LXNA 2XS7A 2HQFA 1RT7A 3KOAA 4KGXB 1N34F 4N8NA 3PKMA 2BANB 1BQNB 4LF7F 1CS4A 1DURA 1IKWA 3TAMA 4N76A 1GXUA 3GIRA 4KV8B 3H5XA 3PKYA 4DV2J 2MQPA 3DGPB 3OHBA 3PX4A 1FERA 2BBEA 2NS1B 1S1WB 1VK8A 3G82B 2K7KA 2DNOA 3ITHA 3QIPA 3RBDA 2E1CA 2E5LF 3GYXB 1WF1A 4LJMA 2XTJP 4QZVB 5KT2A 2NXEA 3DU5A 5AE1A 2M8DB 1RTZA 2QLBB 2Y0SD 3V81A 1QSLA 2CPEA 4J9OA 1HI0P 1N5QA 1A0OB 5F9LA 1FRXA 3R5GA 2QL5B 2WSEC 2YKQA 1CG2A 4ES1A 4PQAA 1KHVA 3EE3A 2ZJQQ 5F8HA 1G7CB 2ZH8A 2M52A 3LAKA 1GNKA 2JWNA 3BPSP 3I0RA 3KUHA 4N8OA 1S0OA 2OGUA 1OYDA 2FLLA 1WC4A 2KB2A 2B4OA 4OZ1A 4QJVA 5ETVA 2UVUA 2JJ4D 2E1PA 1UPMB 1NK6A 4H4MB 1D8ZA 1R8PA 3X3UA 4DUZJ 3M9NB 5H9FK 1WNEA 3W61A 2YNFB 1V9OA 5MLCV 2YXLA 1RT5A 2AJ0A 2BXJA 4DV0J 2CIMA 1CJUB 2LP4A 2OI2A 1N34J 1S7IA 1TL3B 3PDNA 4B02A 3VGTA 1X4GA 3H20A 4G3IA 2HQ3A 2P2CB 3A3OB 5HJXA 4ZN3A 1V3ZA 1LWXA 3RTVA 3BO3A 3MECA 2UU9F 3V4MA 9ATCB 1P8GA 3C15A 4ANCA 1G3OA 5DDRC 1CJTB 1WJ9A 2J8AA 2K2PA 3BS9A 3FSIA 2OPPB 1HNIB 1U2CA 2IM1A 4K5RA 2QYGA 2GHVC 5E3AA 1HYSA 4F2RA 1D1UA 1BQXA 3TJAA 3KYLA 2Q43A 3FSYA 3OR1B 3SCIE 3KLIA 1H7XA 4LRDA 1OJ4A 4ZP6A 4V19J 4QQBA 3TWZA 2JLGA 3M30B 3PRBA 4K2XA 5KFEA 2BE9B 4IH5A 2PGCA 1H2UX 4DCPB 4DX8H 2ZZNA 2GS8A 5BXIA 4KFBA 1N33J 3MUVP 1PKUA 3AJDA 4FBUA 1S6UA 2Y1RI 5DLGA 1K0TA 2LLZA 3M8YA 5DG7A 2FY1A 4N77A 1MWQA 3FEXB 3TX8A 1Z2ZA 3TZXA 3MI7X 1GX5A 3LA0A 1H3DA 2YKPA 3BYPA 2AJ4A 3M2VA 3IC1A 4I0WA 4V1Ak 2IAJA 2HBZB 2Q79A 3EGNA 3IXQA 1C0UA 1FRIA 4RLEA 3IAS9 5SUHA 2RT3A 4E8UA 1BQNA 2BANA 1VRTB 2B9YA 2FZKB 3M6XA 3WHIA 2GIRA 2DNYA 4A8WA 3KHLA 3GMGA 3TVYA 4CDIA 4I2QA 1N4LA 3MEEA 2WBRA 2AT1B 5I42B 3CO9A 4WFNQ 4TN2A 4M94A 1EQ0A 3DLGA 4KGKA 4K50A 2BOAA 1GTEA 2E7WA 4KGZB 1URRA 2GJIA 2RVJA 1B3TA 3GONA 4OX9J 2NLWA 4TY8B 4TLRA 9RUBA 4ECTA 1D9FA 2BUNA 5ETMA 2Y9HA 4DQRA 4D3HA 2XO6A 5D3GA 1HNWJ 1V6HA 2W2MP 3BN7A 4RUCA 2KXFA 1NK9A 1REGX 3Q2TC 3DRRB 1NHKL 1BHNA 1S9GA 4DJBA 5IC6B 5KG5A 3OL8A 4JI1J 4ECWA 3OTEA 4AD6A 3HXMA 1VHFA 1CEZA 1TR0A 2XI2A 5IFMA 1M90T 5KFJA 2HVIA 3HD2A 1UWAA 2CQPA 3G71S 1X4BA 1ZOTA 3IRXB 1JXLA 3M2VB 4K0KF 2AWZA 3C8YA 1SJQA 4WJBA 3WDOA 4KFBB 3P5TL 3TQEA 5LSLA 4C0BA 2XY7A 2POKA 1MU2B 2VC1A 2VBZA 3TA0A 4QPXA 4B9MA 1UJ4A 4IRCA 3CULA 1K1QA 2UUWA 3QT5A 3BZQA 5CYMA 3MURP 1NLKL 1Y10A 3JSMB 1L3KA 4K4YA 3PIPQ 2CYYA 5LMUJ 2JEGA 3KJNB 3MOZA 1IWAA 3GLJA 1CQNA 5H9FJ 1IBLF 3IP0A 3MXHP 3NGKA 1DJ0A 1OQ3A 1UP1A 4ZJLA 4UQGA 4LF7J 3DU6A 5DETA 1TKXB 3PTWA 2CQBA 2G1HA 3UN3A 2C2NA 3LTOA 4CO3A 3NKYA 4OL8A 1GT8A 3TJ8A 1UVLA 1QM9A 1ITPA 1IKYA 3CD7A 2DVIA 1Q7YT 1RAFB 5AXMA 1BUXA 2CPHA 4I56A 4ZOSA 3NGDA 1UW4A 1WI6A 2CZ9A 2DHAA 2HBYB 3G8QA 4OLOA 1U6ZA 2FHOB 4P7VA 2NPFA 3MEDB 4IQMA 2R7TA 2JHEA 2LEPA 2OKQA 4M5NA 3ZZ0A 3VAIA 4CTAB 5F8NA 4E0DA 2ZEJA 1VRUA 4OV6A 4DCJB 3TYTA 5K8NA 3M8SA 3RAXA 2FJEB 2RQ4A 4GVBB 3TAQA 3CC4S 1RJJA 2EBEA 3GIJA 3DRYA 3RZAA 3SCJE 3CW2C 4DUTA 4OIXA 4OYOA 2BM1A 4FDFA 3ZZPA 1HNZF 1WC6A 1JIHA 1PAEX 2H51B 4F4KA 1V3SA 5KFCA 2WTFA 4X65J 4ZPCA 2V69A 4FF3A 5D0EA 5EDWA 4QWCA 4LMZA 1E6VB 5KFNA 5L9XA 4IR9A 3B6BA 3QIDA 3J81U 3QZ7A 4F4YA 2OPRB 3V6DA 2YWFA 3Q83A 1NAQA 1AFJA 3MR6A 3OXGA 1S48A 2CJYB 3D1OA 1R8BA 3EVWA 1FXDA 4P2XA 5M2RA 3ILJA 3SSRA 3VZIA 3BBCA 3C66A 4M5IA 4RL1A 4S0MA 4KHRA 1WEXA 1D9DA 5HMWA 2XY6A 1ZS6A 2GZOA 1T3OA 5C25A 3UO0A 4C9DA 1VQKS 2F7VA 4LF9F 1O51A 3I32A 5GVQA 3TJ9A 2J0WA 1WTBA 3P6YC 1VYAA 1RBLA 3GFZA 1X0FA 3H5SA 1G4CA 5E41A 3TUZC 1IKXA 5DS7A 4USUA 3W7BA 2MLYA 1AROP 4DX7A 1WOPA 2R7SA 4OYXA 3HCXA 5K8PA 2EFNA 4FXVA 1IKVA 1RAIB 2VL1A 2ZITA 5T41A 3UD5A 2OTLS 4C11B 3M9MB 3VAHA 2ZBPA 3U27A 4MAKA 1AA1B 3R8YA 4Z2XA 1U24A 4BC7A 5C42A 4C8KA 3NGSA 4JBCA 1FJ7A 1HNWF 1J27A 2B7CB 3K7RA 4OZNA 3Q23A 4B3TJ 2C3UA 4WU2A 1ZM4A 4RUBA 1TKDA 1NKEA 5LJ5Y 4QW9A 1MLAA 4IDKA 5K14B 3UVJB 1CS4B 1H98A 4QR2A 2E66A 3TAMB 4Q8FA 1TFYA 2V4JB 1GTHA 1TL3A 2HS4A 2VFTA 2FLPA 2ZOMA 4KO0B 4KH0B 4KR0B 4K7QA 4EBEA 3R7NB 5A8WB 5A8KB 1FXLA 1MWZA 1UZDA 2OPSB 3ELHA 4K2JA 3DOKB 2WOMB 3D2WA 3IR7B 2UUCJ 3W9HA 4OZLA 2DNQA 2A3JA 3WQPA 1BXNA 1QUPA 1WACA 3MAHA 2Y1IA 2F65A 1SH0A 3MDFA 3UI3A 1VOMA 1U47A 3HT3A 2GJ2A 3M30A 3DRSB 2IVFB 4UY8T 3IR5B 3OD2A 3RRGA 1KNZA 3HHNB 3VV2B 1A6LA 4HHJA 1Y0HA 5CZXA 2ZWOA 3CXCR 3H59A 1Q8BA 2PFDA 3K89A 3IM8A 2CQCA 2EKNA 3GWCA 4N47A 4RNNA 1JLGB 3D5MA 1KSPA 2B9EA 2HQIA 3C15B 4ZPAA 4TLQA 3W60A 4DHVA 4ZDNA 5L9NA 4H4KC 2ZDOA 2F4VJ 3QNWB 2VHGA 5FDLA 1JLEB 5DRKA 1VQLS 1WHVA 4TY9A 1S6OA 3L7OA 2W8KA 1KLMA 2N82B 2R7QA 2UV8A 3MAAB 2JVRA 2DHGA 3C6TB 4ZVUB 4DPYA 2UXDF 4IKAA 2QMUB 2I5JB 3OLBA 1ZM3A 5FIIA 1D3WA 1IBKJ 5GAEU 5HVFA 2QEXS 4EGLA 3PY8A 3F0NA 4MK7A 3T1AA 4JV5F 3IS9B 4WE1A 5E3PA 3KKFA 3N0VA 1PO6A 3I5CA 2RKIA 4OX7A 2KRRA 5LL6d 4PPDA 2RH3A 4Z37A 2KM8C 2DPJA 2XNQA 2WONA 1AZSA 2RF2B 1S9EA 5HK4A 2RILA 4FP9A 2QLJB 3IRWP 2ZVSA 2DY1A 1RWWB 1WOOA 2ASDA 5KT5A 4EZ6A 5B0DA 4Q5VA 3PJXA 1VC6A 3K59A 4Y0FA 3DLEB 4PWWA 2ZVIA 4NEZA 3ZNJ1 5KFWA 2MGZB 3KJVA 1YIJS 1U1MA 2FGCA 1FKOA 5DG9A 1X4HA 4URQU 1RCOB 4F4XA 2GVZB 5BYRA 3EJMA 3MWBA 4C8NA 4TU9A 2ZH4A 4DV4F 2B0GA 5DM7Q 3TAPA 3V4IA 1OY8A 4OI2A 1VQNS 4P9SA 4AL5A 4PABA 2I2YA 1VS3A 1FFWB 1NU4A 2HK2A 3E51A 1FFGB 2RE1A 3IBCB 1UA1A 2FD2A 3M8PA 1PBUA 2D41A 4O4GB 2AJFE 4ZP8A 4Q2MA 4CZCA 1UVJA 1NNDA 4ZPWR 1LWFB 5HMYA 4DFMA 3ZZOA 5BJRA 1NB7A 3UNYA 3BEGB 2H9ZA 3D67A 2AMCB 2BW2A 5C2CA 4ECUA 2AD9A 2QJ3A 1QAIA 3BDPA 2GO9A 2IM2A 4KYZA 1HNVA 1ZA2B 2IJNA 3KTQA 1Y7PA 4C0HA 3R5AA 4DFPA 1HPZA 1DAXA 4M63A 3FK4A 1RQ0A 4Y2MA 4B9LA 4AXIA 1KQSR 2UXCJ 3Q0AA 3DLGB 1URNA 2VBXA 3HJVA 4WP3A 4NX9A 1UVMA 4ANDA 2YWWA 3MEEB 1F2GA 4KQZA 3TO8A 3DYAA 2DHXA 3ZTSA 1UEVA 2BVZA 4B3RJ 5B0EA 2XMWA 1JLGA 2EPIA 4I7FB 2JSXA 4OYPA 1WC3A 4LIRA 2OH2A 5THWA 3TW0A 2WONB 1T05B 5J2MB 4WF9Q 1UCNA 2KT3A 1HHTP 2GJFA 4WK1A 2VBYA 2FHKA 4P2SA 2M5YA 4F36A 8AT1B 1S72S 2UXCF 2VUGA 2HKEA 3HSZA 4HHUA 1NBEB 1F60B 2DEIA 1VIXA 4ZITA 2RF2A 3K8VA 5CD4H 2IBOA 4YEAA 4EUVA 5GMEA 5K20B 2W7PA 4DL3A 1X4FA 4D3GA 3G6ES 2FJVA 1G1XA 2H5IB 3BGUA 3W1YC 2PI4A 3D3CJ 3GIMA 2KL8A 4MMOA 4HR2A 5F41A 4MK8A 3ISZA 4A8YA 4FVMA 3PW4A 5IS2A 4DV7J 3KWMA 2IYGA 1REVB 5FLXU 3ILIA 2V8HA 2MQLA 3QQCD 1XMOJ 2OEMA 1B0TA 4OI4A 4RJVA 2EC0A 2LDIA 3OR2A 5E33A 3OPKA 1J5OB 2CG8A 4ETXA 3DLEA 2OO4A 2WHOA 4B3SF 5DDOC 1WD6A 2CJQA 2HFZA 1LWCA 2PMZD 3W5XA 1K8AT 5F3TA 4DR5F 2DO0A 4DR3J 2UUCF 1RHRB 2P9GA 3FEYB 2ROEA 5KG6A 4ZVQB 2EFOA 4LREA 5L1LA 2HHHJ 1FE4A 3NGRA 5CHCB 3CMAS 1NJXA 1C0TB 2A10A 4OI3A 1Q79A 4PZVA 1JJ4A 2AJ2A 5E7OB 1O0PA 1LW2B 2LU2A 5A6PA 5AXLA 5KT4A 2BR0A 2Z57B 1HQEA 1K73T 1IR0A 5F8IA 4B3OB 4RW7A 4ZPVR 3LUYA 4ZCLA 2YNHB 4JI0J 3MUMP 4KIAA 2CPYA 1IBKF 5B0AA 2FZCB 2GNKA 2V2ZA 2VICA 1U1OA 4DPTA 4KKOB 2F8HA 4QU6A 2BE2A 4W92B 4NXMF 3KLHB 2CNOB 4RNOA 1YBAA 1HL6A 2MQMA 3CJ5A 4HDGA 4WZQA 1WSRA 4LR8A 4C3LA 3VAJA 1XMQJ 3PFOA 3M9OB 3HKWA 3G8TA 2C2DA 1SKWA 1DLOA 1RHJB 3CDUA 4NXNJ 1Y00A 1UVIA 3BH6B 4NLOA 1K9MT 4U8YA 4CH1A 5HP1B 5D0GA 2CQHA 3J7A1 3SI8A 1RWVB 2B43A 2BKPA 3OTBA 4QWDA 2IRUA 3RW6A 4Q43A 2DRBA 1EETA 2GHPA 1IJEB 2L9NA 4F2SA 2NXCA 2KT2A 3JXOA 4HTJA 2A1BA 1IKXB 2ZBIA 5IT0A 3FRZA 3DI6B 3MMAB 2H4YB 1G6BA 3DFEA 1XN9A 5ITHA 3I9ZA 1XEZA 2UVVA 3MM6B 4K4UA 1BD6A 3P96A 1MMNA 4C3MA 4FF4A 4NE9C 5B0FA 4JV0A 1C0TA 3SEOA 1S6QA 4OJ3A 1A9NB 2HIYA 1RLDA 3A1YG 2HSEB 2LU1A 2YNGB 4I2QB 4O44A 4F67A 2IC3B 3G96A 2CDQA 4O3NA 4DXLA 3I56S 4ECQA 5DGAA 4KBIA 2IA0A 3T5LA 1KKHA 1RT6B 3OL6A 3PRVA 3QATA 4UUWA 5BR8F 2V6AA 5DZ6A 1C0UB 1Z1ZA 1S4FA 2C3PA 3D1HA 3DLJA 4A8OA 4CLFA 1F0XA 2YBVA 1B64A 1SCJB 3B82A 2QGFB 5ETOA 4YY3F 4X4TA 2C42A 3H25A 3TOQA 2DRDA 1U1QA 2M88A 3FCHA 5L39A 3CT9A 4WTOB 1U0SA 2HBRB 3NP5A 4ITSA 2CPIA 2ZM6J 3OSPA 1VQOS 1FO1A 1N52B 2BJ1A 2OSRA 5KFDA 3K58A 4ECVA 3MEGA 1YRUA 2CJAA 2I0XA 2ZUAA 4LBIA 2AEMA 3T1HJ 3KUEA 1KHWA 1Q8KA 2J7WA 4UTGA 1RAAB 1FJEB 2XYHB 5KTQA 2FJXA 1KTQA 4OX8A 3M8QB 3W63A 4K59A 1R89A 4NA2A 4A48A 3SV4A 2FGOA 2G0JA 2XMVA 5LSOA 3M6WA 3GJTB 3MR7A 5J2PB 4B3SJ 3MZIA 1TV6A 4ELUA 3LALA 4U7UD 1TU0B 4HVZA 4F3QA 1HWKA 1B70B 1HNXF 2BQUA 2KZMA 3EVMA 5CQGA 4CO0A 1RAHB 3OTDA 3CD0A 4KHPF 4ZLLA 1H73A 2Z30B 1IBCB 4G1PA 4EO6A 1SC6A 2RDDA 3MM9A 2XYGB 3ETOA 4CLWA 1RT6A 5H1SV 4J9KA 2HEKA 4OZJA 5BYQA 2DGXA 2HVHA 2G2OA 1V5VA 1IR2A 1X4EA 3I96A 3NAIA 3NG8A 3O1LA 3SFUA 3UDVA 4DV3J 3HHLC 1YJVA 2DNGA 3TZZA 1HR0J 4KHMA 1I1GA 2AX1A 2YNIB 1S77D 1XMQF 3GCWP 3FKBA 1VIOA 1GFWB 2DH9A 1HNZJ 2O01C 3F44A 2DY9A 2NUUG 4N56A 1NJWA 5E5NA 3RB4A 4RPFA 3CCJS 1JXVA 3U02A 3LGMA 3MMJA 3M6VA 4MIAA 5KFRA 3VR1A 1NDLA 3AH6A 1JWWA 2UUBF 2FPHX 1ZAVA 1MNEA 3IRXA 3FBEA 3QJJA 5ETQA 4YHHF 1RT2A 4A8KA 2HHVA 2HQCA 5T7LB 2NXUA 3J7YU 3SYZA 2RUSA 1HIYA 1IM6A 1FT8A 3DC2A 2FJAB 4NEYA 4PG6A 2BM0A 2QA1A 2IM0A 3NAHA 1Y5NB 3PHTA 2D3ZA 3WX8A 2V4RA 2FVPA 3B8HA 4ICLA 3DRPA 1RZMA 1S79A 3E01B 3GP9A 4CLZA 1EKRA 4H54A 4IRKA 4DR5J 2BJ9A 2MHEA 2MJNA 4QW8A 4CO5A 1R0BG 1RT7B 1TL1B 3BSNA 2D3O1 2NR0A 5J2PA 4ILLA 4A46A 5M2UA 4QU7A 3TP2A 2R3VA 4P7TA 2LQ8A 5E3QA 3ADAC 2QG9B 5HJYA 1EKSA 2YH1A 4WU3A 2MZRA 2BEFA 4KGVB 4WE1B 2N4DA 1T0TV 4QPTA 1KR4A 2PEHA 4CTAA 1RA7A 4M5HA 4QIGA 1YKWA 3UWTA 2JDJA 3RGIA 2BQRA 2QMWA 1LFWA 1PBAA 3W64A 3UCZP 4O3SA 2PA8D 2JLFA 2V8VA 2CQ2A 4DBQA 1FDAA 1X4CA 3M4XA 1TFWA 1HQ2A 2CNKB 2ZWPA 3J80Y 5J2QA 5LMNF 2MJUA 1YVFA 4XK8C 1L3SA 3CJ3A 1B0PA 3K5OA 3W2WA 4CNZA 4FS2A 2ATLA 4I6WA 3T6BA 3GIKA 2UUAF 2K3IA 1W26A 3T6JA 3T1YF 2VPYB 3T5HA 5EWGA 2AP6A 1DBDA 4MT1A 3VVUA 3PEHA 4H4OB 3CCLS 4ZHRB 1QLNA 3VAMA 1VHIA 3FDSA 4DSIA 3I0SA 2AJ1A 4DWIA 4DDFA 2KHCA 1IXKA 1T8EA 5D15A 2X51A 4CLSA 1RAJA 2CG4A 2GQQA 2JX2A 5HQMA 4LFAF 3QO9B 2KFZA 2MZ1A 1RE1B 1TUVA 4PPZA 3UNGC 4NLRA 4WFAQ 2F4FA 2H4WB 3A4TA 2AV5A 4ENOA 4C48A 2CVEA 1N5SA 1RT4A 5F0WA 1ZZNA 2OJ3A 4FBTA 2OELA 3RJMB 1IM4A 2EK6A 4HI1A 4GVLA 1VQ7S 2I9SA 5IC4B 3CC2S 1HR0F 4F04B 4ELVA 2YNFA 2RUGA 4PQUB 1XR7A 2C22A 1EIYB 5D77A 3AB4B 2YQ1A 2CRLA 1HQUB 4B3MF 3NOCA 2X3DA 3P5BP 4NLVA 4EBCA 4IDKB 4O0IA 2BJEA 4KHPJ 3LP0A 3IBWA 1YDLA 3A8JA 1A7GE 4DR4F 4L3NA 2YNHA 3DHXA 1RYRA 4ZVRB 3N4WA 3RU0A 4Y2IA 1XNQF 3GG0A 1VI7A 4DR1J 1D09B 1LWEB 1EETB 3HJFA 1N33F 2PMHA 3T41A 1S1UB 2J5AA 4ER8A 4DSFA 2UZAA 1NH7A 3TUPA 2DXFA 3NXZA 1S97A 4LF2A 4QR1A 4HTIA 2E29A 3CIZA 2VQEF 3GE9A 2CVIA 4XPEA 3AQOA 4X4QA 2DGSA 2DGTA 3RBXA 3HI9A 4DLGA 1QE1B 4NYZA 2DR7A 3HLUA 5ETPA 4RX6A 1I5OB 4HEA9 3HVAA 2DH8A 3HZEA 1TVRB 3EYZA 4W4MA 2EVZA 4TXSA 2PE8A 3ZC4A 5K9FA 1R8HA 1JLEA 1RWXB 4AL6A 2KRBA 1GMWD 4K4WA 4DUZF 4ED2A 2KDOA 1VRTA 4HYKA 1F1BB 2RB7A 2X1AA 2HNZA 3GIIA 3H0PA 2BOPA 3NCRA 2OFHX 2FHJD 1IKYB 2LEAA 3LAMA 4WWSA 4A47A 1IN0A 3LOUA 2ABYA 2CZVC 5KT7A 4HACB 4P74A 3CJKA 1VISA 2J0QD 3KNGA 2LFVA 5JJBA 3H4DA 2G0IA 2QE5A 3BGRB 1HA1A 1R27B 4TQSA 5CXTA 2ASLA 2EK1A 2ZNYA 2I5JA 4OYAA 4JUZA 2XO7A 2YY3A 2KFNA 2IIHA 2RQCA 3SCLE
chains in the Genus database with same CATH topology
3T19A 2L48A 2FVRA 1BLUA 1CVJA 1S0VA 3LP2B 3KLGA 3BF4A 2W7OA 1KTVA 2B4PA 2K7JA 5H9EJ 3LF0A 2W9BB 1VC0A 2IA6A 4O3QA 3DGPA 4NLWA 1YI2S 5KFVA 1YRXA 1YJWS 1L3VA 2OFGX 2XS5A 2CPZA 5HL7Q 3MEDA 3RB0A 3CCTA 3DDNA 1FK9A 3S8SA 2VD3A 4PQUA 2IBKA 2J9DA 2XEXA 3CMES 5DLFA 4PCQA 1S76D 3CUNA 4JI8F 1QE1A 2D9OA 1FEEA 1N48A 3GZ7A 1HBMB 2O5DA 5LSRA 3CC7S 4JI4F 3AJ1A 2KYZA 4DQIA 3AQPA 3Q8SB 2QLWA 2O1PA 3HVTA 1XBWA 2HG4A 1NK5A 1LWEA 4IYQA 3SSSA 1D8YA 2DNHA 3CCWA 3GSDA 4NLDA 4P6QA 3MPVA 5HBMA 2AU0A 4EWTA 1HNIA 2LYVA 2HHTA 2KZZA 3X1LB 4FN5A 3BQ1A 2KN4A 2MKJA 3DYAB 3R5DA 2XMUA 2ZKTA 1WG5A 1M5SA 5AXKA 4ID5B 4IG0B 3V5RA 2NPIA 4YR3A 1X5SA 2W25A 4IH7A 3CCVS 3HVWA 3BSOA 3OXFA 4ZP9A 5KFBA 1RT5B 3I5BA 5LMUF 3M8QA 2DHSA 4X64F 1N8RT 1FRJA 3EGZA 2BV3A 4J5OA 1U1KA 2Q66A 4RBUA 5A0YB 1Q7LB 1OIAA 2XBPA 2ZUGA 1MROB 1XWLA 4ES3A 1UL3A 4ZP7A 3UPFA 4NYOA 5HROB 1SI9A 2LQ5A 3POTA 3OR1A 4JI0F 3QGGA 3T5JA 2JOQA 4IG3A 5GAHU 5HN0A 1RGVA 1JLAB 4MKYA 4X4VA 2GV1A 1N88A 1Q86T 4NLXA 4LSLA 2HGMA 3S7RA 3UR0A 4KT0C 2W4PA 1UMJA 4AE5A 3CCUS 1FNXH 3MF5A 3PVXA 1HD1A 3CDWA 1VQSA 3KG1A 4DS5A 1VC5A 3LANA 4B3RF 4NYPA 2VFSA 3AJ2A 3H2UB 5G0RA 4NA3A 3H5UA 2GO8A 1RI7A 2E9RX 2R8GA 2FLOA 4I2PB 2ZD1B 1RK8A 4R8UA 4X2BA 3NCQA 2ZH2A 2C3OA 2F9DA 2DISA 5F8GA 3BGLA 3DRXA 3NNHA 2V9WA 4PWDA 3UD4P 4BHQA 1NZAA 3OVAA 4JYAF 1VLYA 2RIJA 2ZC4A 4OI1A 1HWJA 1SB6A 3OTCA 2HPUA 4YP3A 4F02A 2RMLA 3Q8PB 1IQTA 2IRXA 1HBNA 2K1RB 1ZM9A 4C97A 1E6YA 2EW9A 5EN1A 3VALA 4X65F 1ZPVA 4AFFA 3PJWA 2VQFF 1FKOB 1C1CB 1JLBB 4X4NA 2J9CA 3THVA 4NPOA 1HD0A 3ENVA 5JXSA 3GB0A 4ED0A 2UVWA 3MM5A 4DFJA 2LA4A 3KHGA 2CJ9A 3I4HX 5HROA 4LF4F 4I69A 2JRSA 1RISA 2B6AA 2IC3A 4OFZA 2L3MA 3BDEA 4WFBQ 3GV5B 2BA9A 2I8EA 2KO1A 1U4BA 3S6EA 2W8LA 3T5KA 2KI2A 4NZ7A 1DFDA 3POTB 1WHXA 2DGQA 3MMBA 4QCLA 4YFUA 3DMJB 3IN5A 4PUOB 1S1XB 4HH0A 6FD1A 3OLAA 3KLEA 1W2BR 3GFYA 1KN6A 5KG2A 3TQ1A 3DLHA 4WXWA 3V4IB 3M6UA 3CCRS 2AYEA 2ZOFA 3EXCX 3G6YA 4ZPDA 1KQGB 4M95A 3O8WA 4YDDB 1FTCA 4KJIA 2P9EA 1DQ8A 4MYTA 4NA1A 1U2RA 2LVWA 3DOLA 1O5JA 3K2YA 2L9DA 2W9CB 4NLSA 2VKZG 3RRKA 4CT9A 4XDDA 5DM6Q 3JTNA 3ISNC 4Y2AA 3C6UB 1R0AA 4ZVEA 3LW5C 2WB1D 1FKPA 3VF0B 2CQGA 2Z2MA 4HT5A 2DT9A 2FJBB 1HBNB 3DLBA 1G2EA 3HHKA 2RJZA 4TQRA 2FVSA 2NQPA 3IWXA 3BGFA 4DL5A 2KT5A 5HI7A 2BQ3A 2J76E 4GC7A 2RKIB 1T05A 2R7VA 1TKZB 3A8EA 4OX6A 4XAKA 4ERDA 2GHWA 1JJ2R 1LW0B 2AGPA 1UETA 2IMOA 4EYIB 1LWFA 1M5VC 3HHDA 2FVQA 1B0VA 3DHWC 2HHWA 3FNNA 3JYTB 3MR3A 4MFBA 2BABA 2VG5A 1TVRA 5C25B 4QWEA 4I7FA 1I6JA 3FVYA 3HP6A 2HNYA 4KAIA 4G1QB 3CSKA 2VPWB 3PV8A 4URSA 3KLEB 1P1TA 4Q7AA 3NNCA 1RYSA 2OMLA 4ZCKA 5L8RC 2JL9A 5IT4A 3J81Y 3KLFA 2IFXA 1T02A 3HMJG 2OMOA 4DL4A 2AGQA 4OHZA 2MYFA 2XMJA 3CJKB 3J7ZT 1JXEA 4WFYA 1TK8A 4DV3F 1HMVA 4C4WA 1HQEB 4FS1A 2L41A 3IGVA 5KG7A 2HNZB 1U2FA 4K4XA 2J6UA 3FFIA 1QAYA 3EUNA 4DR3F 2ZH5A 2VFRA 4CI0B 2DNRA 3G9CA 1FJGF 2DIUA 2FJDB 2MMYA 4EO8A 3D28A 2MQQA 3ZZUA 4RBVA 2DNNA 4MKAA 1Q81T 1XK8A 3KG4A 4O4RA 3JYTA 5IQ6A 2CQDA 4K4VA 3PFEA 2N3OA 4U6PA 4ED6A 3PW2A 2B5JB 3GR0A 1FRKA 4DQSA 2HHXA 5L38A 2LEBA 4BDPA 3NL0A 3BN4A 3K5MA 1DHMA 5EX3A 1TKZA 2DNMA 3DRSA 1MSWD 4IR1A 2G9OA 1PC5A 3M2RA 4YMEA 2R7OA 3FRYA 1VMBA 4OJ1A 5IZHA 2YKNA 4U7CA 1NKBA 3RYLA 5KG3A 2FC8A 3TR5A 1T95A 1DTQA 4ZMMA 1N5TA 3M1VA 5GAGU 4PXBA 4ECYA 4JI1F 3NBPB 2WOMA 3I6PA 4TKTA 1GXLA 3OVSA 1TAQA 4NRUA 2HMIA 2FC9A 3ICLA 2R7WA 4J9RA 4OQJA 2R2RA 1X4DA 1Q78A 3U1LA 4DR1F 1X9SA 3V6KA 1IKWB 5HMZA 5KOXA 3DDKA 1J5OA 5KFAA 2UP1A 2VFVA 5KFUA 2VZ9A 5KFSA 3PO4A 1SL2A 3ONQA 3CJ2A 3B78A 4LVOP 4OX9F 3KNAA 3O3LA 4TYBA 4ELTA 4DF8A 3OFFA 4Q44A 2YNGA 3R5BA 5I3UA 3N5FA 3THTA 2Q6CA 3AB2B 1Q8IA 1FE0A 4QYRA 5KFMA 2MKSA 4RNMA 4LQ3A 2E44A 1QVFR 3RBEA 1KOHA 3OV7A 2LCWA 1MU2A 5D4NA 3HZGA 2VPXB 4K4ZA 3CCZA 4C8MA 3OSNA 1SL1A 1T03A 4DSJA 2XZWA 2MHNA 1YSJA 1RP5A 1NHUA 1S9FA 4HT7A 3QJPA 3N5BA 3N6MA 2IM3A 4JV1A 2MXYA 4PG5A 2X1FA 1H2TZ 2MKCA 3US5A 4J9QA 2ZH1A 4FXDA 1RDRA 3ZZYA 4YR2A 2R2SA 2JEJA 2RU3A 1SL0A 4X4RA 1PSDA 2P6SA 4WXOA 4B9NA 1S9EB 3F56A 1YJNS 5D4PA 4ZK7M 3OXLA 2J7UA 2M70A 1IQZA 2K8GA 2YQ3A 3IS9A 3OFHA 3U7JA 4LF6F 1U26A 4NOHA 3CPWR 3GYNA 4F4ZA 1HNVB 2ZBCA 2OD4A 2HS3A 1N6QA 1T3NA 1Y9OA 5A0YA 4RWXA 2E1AA 2MSSA 4YB5A 4ZVFA 1GH8A 1WG1A 5DQHA 2M8HA 4KB7A 1UKUA 2XGPA 4C2MA 1S1VB 4WYWA 4M1KA 1HBUB 3CJ4A 3QZ8A 1MWYA 2A18A 5A8RA 5K8MA 3HVRA 1TK0A 2ZNZA 2XI3A 4GMKA 1U8SA 4FPRA 3IFEA 5HO4A 3KK1B 1U1PA 2M7SA 2CJBA 2K3KA 4DMZA 1JKHA 2ADBA 2XULA 5DQIA 4AUKA 3HFKA 4J9LA 3QWUA 4RW4A 5J1EA 1JK9B 2CQ3A 3PO5A 2BACA 4JI3F 5DDQC 1LKZA 1HWUA 4LT6A 4USIA 4HDHA 4ED7A 4RU9A 3PX6A 1LOUA 4N41A 4LQ9A 2ILZA 4X4SA 1XTZA 3H2LA 1OSDA 3NRBA 4LUBA 1HYSB 4PXEA 4CH0S 4J9NA 1QJHA 1F5AA 5I3QA 4TY8A 3TUJC 3OJSA 5GADI 2CKWA 1OQ6A 4CQ1A 2DTJA 4NLUA 4IFVB 3DXSX 2JEFA 2XWXA 4R0EA 2VB6A 2V8DA 2V9KA 5L1KA 5A8KA 1H6KX 5A8WA 2WCXA 4I6AA 1VBXA 4Q0BA 3OFGA 2EG2A 3N6LA 5KFXA 3CDAA 1S1VA 2E7XA 4LFBF 1FEHA 3Q22A 2VV5A 3UE2A 4EYHB 2ZFHA 5L1JA 5LXRA 2XNRA 5IQQA 5FJ4A 2BRKA 3QYYA 3FJ2A 3C2PA 1JLCA 1HW9A 4RW6A 5D3GB 2B3TB 3SMZA 4GKKF 2HRYA 2YWGA 5CCMA 3EPGA 3FZ2A 4Y00A 4RW4B 5J1EB 3GFHA 2W9AA 1S6PB 1LXJA 2E9TA 1F5BA 3L7PA 1FK9B 1FKPB 3N79A 2R9LA 4NZ0A 3DM2A 1GX6A 3TA2A 5KFZA 1RTJB 2ROPA 1ULRA 3MMCA 2DIVA 4WTYA 1DLOB 2DRAA 1BQMA 4TNOA 1NEEA 4I64A 2PD1A 1JB0C 3N28A 2B9XA 1SUQA 2PN6A 3FMBA 1NJYA 1KLNA 5J1NA 1RT4B 2DNZA 3SQGB 7FDRA 4O44B 5GADU 1SJ1A 3BJYA 1VBYA 3IWLA 3RAQA 2GMHA 4ID8A 3AA9A 2VPZB 1MMLA 4I6YA 4M5DA 2N7CA 2GMLA 3PR5B 5F9NA 4ED3A 2PIIA 1ZM2A 1ZTTA 2RNEA 3EX7B 1NJIT 2W24A 1EP4A 1S99A 3QO9A 3VWSA 1QSSA 2NREA 3E8OA 3OL7A 2YWHA 2GA7A 5FD1A 1DQ9A 3DLKA 1W2IA 4K5SA 3OUYA 1HHSA 3QIPB 2RQMA 4NCAA 4HL9A 4ZHRA 3O2IA 3MHYA 1VQPS 1M1KT 4UY85 1KVJA 1PC4A 1UFLA 4KV8A 4KC5A 4UOCA 1C4CA 2HFOA 2N3LA 5HP1A 2FHMA 2ZDPA 3PM9A 2KKHA 2XCPA 1UVKA 2ZOGA 3MD3A 4QYZJ 4OHVA 1CC8A 1MW7A 1BQMB 4GC6A 2A2DA 3IG1A 2ZH3A 2AJQA 3TANA 2GMJA 2OPRA 3V6DB 1VBZA 1HMVB 1LK7A 4IG3B 1YG0A 4X4PA 3L3CA 3DM2B 3TVZA 3PNIA 4RNFA 1JMTA 1UEUA 5I3UB 2VG6A 2GQCA 4O3OA 3UD3P 2EBGA 5E2QA 4DLEA 1X9MA 2QT7A 4RU2A 1YHQS 1FNMA 3E3XA 4DN0A 3M05A 4ZVHA 3SQGA 2J6TA 2HLUA 2YNIA 2QV6A 3N01A 2JFDA 2O66A 3N6NA 1APSA 3V81B 5D6GA 3CTRA 3LPYA 4ZPTR 2XGQA 1PGZA 3CB4A 2Q1LA 4IFYA 2QZ8A 5KG0A 1KD1T 3ZZTA 1RTJA 1H38A 3NCPA 2CFXA 1UVNA 1YQHA 2YX1A 3JSRA 5K14A 5F8MA 4FVCA 3ENWA 2HGLA 3PZPA 3QGHA 2BRLA 4RUHA 3KK3A 3SXLA 2ZHBA 2FHJA 4OZ5A 3KHRA 1RWUA 3R5CA 2J7KA 3M2RB 2KTQA 2V5HG 3EGWB 2ZE2A 4O3PA 1AFIA 2IVYA 2Z4PA 3MPYA 1R7IA 2G4BA 1UFWA 3H8YA 3IR6B 5CYJA 2F1FA 4JV2A 2DR9A 2JEIA 2QFJA 1XMOF 4RWWA 4YOEA 1O8BA 2HNDB 2X3GA 1JLFA 2M4MA 1N6QB 2KG0A 2XC9A 2OPSA 4UW2A 4FF2A 4RBTA 4KGMA 1TL4A 2G0CA 1QVGR 2AYBA 4RUAA 4Y28C 2YKOA 1VQNS 5I42A 3FQLA 2YKMB 4NCGA 1SXLA 2XWYA 4FF1A 2RDIA 2OSQA 1XC9A 3TVKA 4B9SA 2Q6BA 5KFYA 4YUDA 3OBIA 2BDPA 1IBMF 3QLHA 5CH7B 2KHDA 2CPXA 2V94A 2F3JA 2QMXA 4DOZA 3CD6S 3VTIA 2ZZMA 1S49A 1YGYA 4B3OA 2B4VA 1Y4ZB 3LWMA 2ZJRQ 3MFIA 1GQEA 3LH2S 3J7YI 4PR6A 2PDAA 1X8DA 4DQPA 4RW7B 2R7XA 3PW0A 5T14A 4AL7A 3BSCA 1XR5A 4YB1P 2NYIA 2Z8QA 2DJWA 4KSEB 4H4OA 4X84A 3NWGA 4FNHA 2AW0A 1D1UA 5FDLB 1C1BB 1UJ5A 2RQKA 2VG7A 4C98A 4CT8A 5KFFA 3LP1B 3V6HA 1R8AA 1X5TA 1OPZA 4LSLB 4L6V3 1FA0A 1R31A 2DGOA 2OAUA 4EU0A 2ZHAA 5KAKA 3G8SA 2ILYA 2HWTA 1H0HB 2BE2B 4ED5A 4IRDA 3FQKA 3CDEA 1KEKA 2DO4A 2J0SD 2E5JA 2MGZA 4HKQA 5I3PA 1HI1A 3MR2A 3M32A 4JI2F 2W7AA 2CQIA 4CNYA 1SIWB 4I2PA 1QY7A 1UWBA 1WWHA 4BBYA 4OHXA 2M9KA 4O23A 4R5PA 2YH0A 4DL0C 5IT9Y 1XERA 4YB7A 3L09A 4CIOA 4ECXA 3M8PB 3UDCA 2MQOA 2ADCA 3QJLA 2VC0A 4JI6F 3HHEA 5C24A 1U1LA 4CO1A 2LDYA 3NS6A 2EFQA 3VQTA 2XMKA 4RZRA 1SH3A 2MY8A 2ZC3A 1TQLA 3JAMY 5DGBA 1KOOA 3UFCX 3P3DA 3NMAA 3OW2R 3JTPA 6FDRA 1YRTA 5GMKa 4PXDA 3ZZRA 4DV6F 2HHQA 2APOA 2C3YA 2CQ0A 4B3TF 1JLAA 3MUTP 3PEJA 3CGIA 1FHTA 2NSCA 1TK5A 4DSKA 2MPUA 4C8ZA 3EXYA 2OP5A 4QBUA 2M3DA 4ATNA 1LK5A 2R7UA 2R8KA 1KS2A 4TYAA 1N0UA 1HARA 4QWAA 2ACYA 1P1LA 4MK9A 4OJGA 3H5YA 4DL2A 3LP0B 4YQWA 2FLNA 3Q8RB 3M8RA 5IM0B 1GXTA 4PG4A 1L3TA 1LQ9A 3HKZD 3VQSA 5KT6A 3DOMA 2HHSA 1ZTWA 4XPCA 3WC0A 1PILA 1JLQA 2RRNA 2G1DA 2DK2A 2MZSA 1C1BA 4DEZA 2W9CA 2I1RA 3OR2B 3KFWX 4O3RA 2WK4A 3QAEA 4PG8A 5D8HB 2LXUA 1P9QC 1WHWA 4LF5F 3NBPA 3GR1A 5C24B 1VQ8S 4LIWA 5HMXA 1P6TA 3PW7A 3T9NA 2YKAA 4RKUC 3DMJA 4PUOA 3KG0A 2JVOA 4PWDB 3BO2A 2EWHA 5CZVA 2AYGA 4WFZA 1UWBB 3D54A 4AXJA 5A2QY 4J9MA 3NMRA 3IWNC 1RT3B 2B6AB 1JNZB 2MKHA 3KLVA 2HYIB 5EWEA 3K0JA 1YITS 3OQ2A 3PW5A 1ZPWX 3BR9A 1NK7A 3BSAA 1TL1A 1RKIA 3CDBA 5GAEI 1ZZFA 1Q82T 3PIOQ 3KLHA 2P6TA 2WB4A 5IM0A 4OLPA 4NWBA 1Q16B 2QA4G 3P49B 2ROGA 5KFQA 4EBDA 5E3RA 1UA0A 1ROFA 2DNKA 3WC2A 2HHPA 1RA6A 2J9DE 4QWBA 5J1PA 1HBMA 1D9AA 4USHA 5CYQB 5KFIA 2D7SA 5B0GA