4HT7A

Co2 concentrating mechanism protein p, ccmp form 2
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
203
structure length
203
Chain Sequence
VELRSYVYLDNLQRQHASYIGTVATGFLTLPGDASVWIEISPGIEINRMMDIALKAAVVRPGVQFIERLYGLMEVHASNQGEVREAGRAVLSALGLTERDRLKPKIVSSQIIRNIDAHQAQLINRQRRGQMLLAGETLYVLEVQPAAYAALAANEAEKAALINILQVSAIGSFGRLFLGGEERDIIAGSRAAVAALENLSGRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords CO2 concentrating mechanism protein P
publication title The structure of CcmP, a tandem bacterial microcompartment domain protein from the beta-carboxysome, forms a subcompartment within a microcompartment.
pubmed doi rcsb
source organism Synechococcus elongatus
total genus 62
structure length 203
sequence length 203
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2012-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ht7A01
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ht7A02
3GFHA 3I82A 5SUHA 3FCHA 3MPVA 3U27A 5LSRA 5L39A 5LT5A 4HT5A 4HT7A 3I87A 3F56A
chains in the Genus database with same CATH superfamily
3ET6B 3UR0A 3CD0A 3SCLE 5HO4A 1HI1A 5J2NB 3CNQP 2KHCA 4I2PA 3N01A 1TL1B 3I31A 4AFFA 4QYZK 2LXUA 2OMOA 3MAAA 1OQ3A 2P9CA 3CTRA 5B0FA 1Y7PA 3KJVA 1WHYA 4R5PB 2I38A 3LUYA 4CYUA 3GIKA 4J9PA 4MFBB 3OFEA 4HDGA 2W2MP 4ECSA 4ED2A 4LF7J 1Y10A 2QSWA 4LBIA 2FC9A 1Z1ZA 1FKPB 4GC6A 4QU7A 3MM5A 2XLIA 1YJTA 3KG4A 4X2BA 3SV4A 2VFRA 4C3LA 1BQXA 3BPSP 4E0DA 2DXEA 4DR5F 2HBYB 1JJ2R 4FF2A 3L7OA 3FSXA 3TYTA 2DHAA 2UUTA 4WWSA 1FRIA 2XI3A 3MUTP 3EVWA 2CNNB 3D0IE 4O3QA 2K1RB 4NCBA 2MQLA 2B7CB 1WOSA 4RKUC 4P71A 1S1WB 4QPTA 4RR5A 1U24A 3SXLA 3THTA 3A1YG 2OO4A 4H4KA 4CLPA 3QRQA 3DLHA 2D9OA 5D4NA 2ZKTA 4DR2J 1RWKB 1IKVB 1YJ9S 5JVGQ 1W7WA 2MKIA 4G1PA 2IDEA 3B54A 4DI6A 3CUNA 5KFCA 3HT3A 3PYEA 2UVVA 1LEOA 1TU0B 2XBPA 2OUGA 4PAAA 2OPRA 5F8JA 5KFNA 5I42A 3IS9B 1VJQA 2DNZA 2KT2A 4OZNA 3NEKA 3KLVA 2HGLA 1K0TA 2ZDOA 3AAWB 4JI2J 3GIMA 2CAJA 4P2SA 2RUGA 1MSWD 2GGPB 2QFIA 3EXCX 2R7RA 3J81j 2BUNA 1R8AA 3GCWP 3Q8SB 3JS9A 1A7GE 2DEJA 4PR6A 1HHTP 1KS2A 1FRXA 3DLKA 2A6MA 1FRKA 3MUVP 2YQ3A 3DGPB 3M32A 2IIHA 4B08A 1TL3B 5LXRA 2GAHC 5KG2A 1VC5A 3BQ0A 5L9XA 2ATLA 3I32A 1EQ0A 3NOGA 3W7BA 1KNZA 4DF8A 4ETXA 3CVKA 3MMCA 3KG0A 2EC2A 3LWLA 2XCAA 1WC1A 2CPXA 1VHFA 2AYEA 2DPJA 5K5MA 3KK3B 2MLXA 1MN9A 3TAPA 1Q4RA 2V8PA 2DB1A 1CJUB 2BANB 2WTFA 4L3KA 3W9IA 4DUZJ 2OGUA 3RYLA 1RT5A 2EG2A 4DWIA 2OPSA 2A0FB 1V3RA 2YKPA 3KK2A 3CJ5A 2BJDA 4I2PB 1ZBTA 1QAJA 2XYGB 4DV7J 2HG4A 1LXNA 4YR2A 1WTFA 2BBEA 2J8SA 2EBGA 2M8HA 3MAAB 1SVDA 2F63A 2WRMA 2UP1A 4IRDA 3KJNB 4RW8A 3KJVB 1TL7A 3OTOF 3GIRA 1RAHB 4Y2CA 2HFOA 2BKNA 1RA7A 4CYUB 1HNWJ 3RGIA 2VFTA 4K2JA 2E7VA 1RT3A 2M8DB 1NAQA 4J37A 4AL6A 1YDLA 4KB7A 2EKYA 1KVJA 2MGZA 3MEEA 4YEAA 5DGBA 5GAEU 3ZTSA 4NXNJ 5CYJA 2HNZA 1OPZA 3MM5B 4OI3A 4U96A 2IYGA 3MR7A 2RDDA 6FDRA 1FWPA 5FD1A 4UT4A 3C16A 3BM7A 1X60A 3N79A 4RWXA 2VIHA 1S6UA 5JJBA 3TR5A 3UI3A 2G2YA 3ADAC 3C2PA 1XJWB 4OHVA 1TKTA 3NGDA 2AGQA 1NNDA 2DNMA 3QAUA 3ENAA 3M8YA 2CPIA 4NLYA 4WXOA 3IN5A 4DR5J 4YY3F 1H2VZ 3DMJA 2RS8A 1OY8A 4J90A 3H20A 5E3CA 3JXOA 3RAMA 1OSDA 1X4HA 3Q8QB 5J1PA 2LQ8A 3K8WA 3H90A 4C4WA 2P9EA 3T1YF 4NOHA 3VGSA 3HFKA 5LJ5Y 2OPRB 5KG0A 2YPYA 3PRVA 5I42B 2OPPA 2DGWA 2XZWA 2H5EA 4PG5A 3Q2TC 2C2RA 4IO1A 4KR0B 3DLGA 3FSYA 4NCGA 3WC0A 2F65A 1U7LA 3RAXA 3R1LA 2BMBA 2CQ4A 1C1CA 1ZPVA 2XY6A 3K0JA 4XIUA 4BCAA 3KMQA 1MROB 4BLGA 1GMVA 2K3KA 1F9HA 3CCWA 4OZJA 4B02A 3DLKB 3LO3A 4LRFA 5HVGA 2CYYA 2CJYB 2JZ5A 3PFOA 1DTTA 3C46A 2VPXB 1YQHA 1X5TA 1FXRA 2AZ1A 3M32B 3ZTPA 2D3OR 3TOQA 5HMWA 2AMCB 1RISA 1N8RT 3IR5B 1HNXF 3FCHA 2HHQA 2PMWA 2WW8A 3KFWX 1YI2S 3MMCB 1I94F 1UEUA 4LRCA 1YKWA 1T9WA 4OZ5A 3PM9A 4B3TF 2OP5A 2K8GA 4EEYA 1J5EF 2M70A 3QO9A 2JVOA 4HTJA 1C4CA 2UVUA 1S79A 2GC8A 5J2QA 4QWBA 1I51B 3AQPA 1RUSA 4UY8T 3A8JA 2JFDA 4ILMA 3BYRA 3UD5A 2MZRA 1RT5B 5GAHI 1FFWB 2OPSB 2PFDA 2DHSA 1SL1A 2YKAA 3KK2B 2N4CA 4X4TA 3OTCA 4P6QA 4Z2XA 4ZS6A 4HVZA 3Q8YA 1T9XA 3GPAA 1TL7B 3PJ9A 2YWWA 1WC0A 3KNGA 2DO0A 2LXIA 2R2UA 4ZPDA 1RT3B 4LF5F 3NS6A 4ZPWR 1R6VA 1WHVA 1HW9A 1OY6A 4JV2A 4O4GA 1LQ9A 2MGZB 4ZJQA 3MEEB 4GO7X 2YNFA 2HNZB 1REVA 3OTOJ 3P6YC 2JNJA 4HLBA 1JLBA 2KT5A 2G1DA 3C16B 3GG1A 3KDNA 2QLBB 3Q22A 5E0OA 2E44A 2CJXB 4C8ZA 1SKSA 2HRYA 1VGYA 2O3DA 2CFXA 4IH6A 2IJRA 1IN0A 1TKTB 4GKJF 3I96A 4KGXB 2N4DA 3CCVS 2V2KA 3WX4A 3KUGA 3R2CJ 4MT1A 3MCMA 1RADB 4J9LA 4CH7A 4RU2A 2DHHA 4TLRA 1KLNA 1YJUA 2CJBA 2Q1LA 4UF4A 4C0BA 2KXHA 4MMOA 4DV3F 4YB7A 2Z4PA 1QAYA 2B43A 3OUYA 3AB4B 4L75A 1VRTA 4ED6A 2UVWA 2DH8A 3R97A 3G4SS 1G1XA 3G71S 3MAQA 2OPPB 2IY5B 3N5BA 4X66F 2EWHA 3W62A 1R89A 1ZH5A 3DLGB 4PG6A 4NCGB 3OFGA 3CDUA 3NAIA 4F25A 3JSYA 1LWCA 1C4AA 2FPHX 1UFKA 4WYWA 2LLZA 2I5JA 2COLA 5CXTA 2EVZA 3M7VA 3M4XA 3CD5A 3IAM9 2ZM6F 4C8KA 1FHTA 2MY7A 2VL1A 2OHDA 5D8HB 2DR7A 1X0FA 3IRXA 2VG7A 1RWWB 4EYHB 3EXYA 1MNEA 1DTTB 1IJFB 3RW7A 3ENWA 5AXLA 5L1IA 2HNYA 3K8VA 5LOQA 3Q8PB 3CO9A 1U2CA 2MSTA 2XG8A 4MTPA 2R8JA 1QTNB 1BWVA 4OJ1A 3EGWB 1DHMA 5F3TA 4FYXB 1H74A 1WC4A 1KVIA 5I3UA 3R7BB 2AZ3A 3IA0A 3J7YU 4C8NA 5K8PA 3NLCA 1H2UX 1NK4A 1B0VA 4QR0A 5LMNJ 1TFWA 2MQ8A 5AE2A 1HNXJ 1ZTWA 1WKJA 5J2QB 1X4BA 3R27A 4ED7A 1C0TA 3EGZA 5CABA 1XN9A 2DGVA 1KP6A 3NS7B 1HPZA 5ETMA 2F3JA 1I94J 4X4UA 2VC0A 3RUBL 1B7YB 2ZBIA 3TVYA 4B3TJ 1J5EJ 5L39A 3H25A 1S72S 4RBVA 4DSFA 3CJ3A 3UO0A 1KN6A 5LM7E 1QSLA 2VQFJ 3FRYA 2UXDF 3MPUB 1ZAVA 3WQPA 3MM6A 1S49A 3U1MA 1Z2ZA 3BB5A 3DM2B 1LNQA 2OELA 4CQ1A 3HKWA 1VK3A 1RAFB 2YNFB 4ELVA 1FTRA 1AB8A 1REVB 1KC8T 1P1TA 4I68A 3B8HA 4ZKAA 1AFJA 1JLBB 4X4PA 1IKWA 3VQTA 1TVRB 2KKHA 3Q24A 2WONA 1XNQF 3AD9C 4ALZA 3EGNA 3H2LA 1KR4A 4Y0FA 1RQ0A 1RABB 2BDPA 1T7PA 1KKHA 1VQ7S 1BC6A 3HHEA 3Q23A 2JL9A 1PAEX 4KYZA 4ED0A 3MCSA 4ES1A 4JI7J 4FF1A 2MZ1A 3F44A 3O5TB 3MOZA 3K89A 2NZCA 2Y3YA 6FD1A 3F56A 3BBCA 2NXNA 3VTIA 3MPVA 3LGNA 2Z56B 4O44A 3D6MB 2HAFA 2PT0A 2VDIA 1VI7A 2HGNA 2ZUGA 4IUFA 3BGUA 3IM9A 4LRDA 3H42A 3OUYB 1RAEB 2XO7A 4NLOA 1SL0A 1VRTB 5RUBA 4O3SA 2HWHA 4DL2A 1S6QB 3DLBA 3P4UB 3GJRB 1U6FA 2C42A 3T5HA 2MKJA 3VAHA 1GMUA 1NPRA 3BGLA 1XIQA 1KEKA 3GIIA 1U6ZA 1LWCB 4DPYA 2HFUA 2I5JB 5IM0B 3EZUA 4DV6F 1S5ZA 4A8KA 1R3NA 4WXWA 2CNOB 4X66J 4Z7CA 3HJFA 1FDBA 2A3JA 3IRXB 2VG7B 4N8NA 4ZJOA 4F7VA 4DLGA 1WF1A 3OSNA 3ZZUA 1B99A 2HNYB 3AJDA 3VALA 4OYWA 3M6UA 3PV8A 2E9ZA 2V34A 3IP0A 3T5LA 2ZM6J 2NR0A 1N54B 2FTRA 3IMQJ 1PCAA 7AT1B 2XZDB 3M2UA 4OX7A 3KTQA 1IUJA 5I3UB 1W25A 3PEJA 2ZOFA 4WK3A 4D3HA 4FVCA 3LQVA 5F41A 1IBLJ 2CNLB 5CZVA 4CCHA 3M2RA 2WVCA 3NXZA 4DL7A 1C0TB 4R0JA 1DQ8A 4B9SA 1RTHA 8AT1B 3H8YA 3OL9A 3Q83A 2ZHAA 1ZYQA 1T9YA 2GMHA 4FXDA 3C15A 3CF5Q 2C3UA 4B3SJ 4C2MA 2XMVA 2GHWA 5IWAF 3TAQA 3QJLA 4JI1F 2NREA 5J1EA 3MM6B 2VODA 1UA0A 3Q8UA 2PE8A 1BWEA 3H2UB 2V8VA 4B9MA 2X51A 3GSIA 2WVEA 1SH3A 2XB2D 2RRNA 1B0TA 8ATCB 4J9MA 1Q95G 1UW4A 3PYFA 2UXDJ 2OTJS 1FE0A 2UV8G 2WONB 4Y34A 3W5ZA 2MYFA 1NBEB 4P52A 2DY1A 2WOMA 4CLLA 5FIIA 2RQKA 4DF4A 2RS2A 5DETA 1RT1A 2VV5A 4BC9A 5K8MA 1PAUB 2JDJA 4DS4A 2R7QA 4BHQA 1RTIA 1RZMA 3KYLA 2RHQB 1XNQJ 2IC3A 4A8OA 2VC1A 1RSCA 4TXSA 1UVJA 3GR1A 1J27A 1M5KC 2POKA 4KHRA 4O44B 4EK2A 5GADU 2D1CA 4Q8FA 2IJFA 1DZ5A 1FF2A 4RO0A 2B8PA 4ZCLA 4AL7A 3NGUA 1T05B 2WW4A 4PQUA 3DNCA 4UOGA 5HROB 5J1NA 3I55S 3P5BP 4WP8A 1UKUA 2CQ0A 4IOAQ 3RBXA 2A10A 3BDEA 4R8UA 2OLWA 3ENQA 3HHDA 2OEKA 4YS2A 4EO6A 4A46A 1GNKA 4F3QA 4NRTA 3A13A 1Q79A 3NWGA 4PYAA 4DJBA 1IWGA 2BJ9A 2E1RA 4EMDA 3SFUA 3I9V9 3M8WA 3QMQA 2ZC4A 4OJGA 1RHMB 2HW3A 2QTWA 1TK0A 3ZXWA 2V8GA 4NPOA 3GV8B 1V3ZA 4DV6J 1SKUB 4ZPTR 4WZQA 4MK9A 3H40A 1Q1KA 1NJYA 2E29A 1EIYB 4V19X 2YY3A 3CT9A 3I4HX 2HK2A 2IDLA 1S0VA 3M2UB 3ILOA 3VGTA 3AB2B 3QYYA 1FNMA 2EFQA 2D69A 2BABA 2R7TA 2UXCJ 2JLGA 1F9FA 2D41A 2B9YA 1CC7A 1XMOF 2V5HG 3E2EA 3M2RB 2HHTA 4QIFA 1S6PA 4ZK7M 4Y2KA 1SIWB 1DBDA 2LDYA 3CJRA 1R0BG 1RTHB 1VQSA 2MHNA 2H48B 2GJFA 2FZGB 2OKQA 4O23A 2DIUA 4FS2A 2YKOA 3BZQA 3MTJA 4B9NA 2RJZA 1QE1A 3C15B 3HLUA 1UJ5A 4KQZA 1OYDA 3TVKA 1X4DA 2DGXA 3BKUA 2AJ4A 2R8GA 2MJUA 1VCTA 3KDOA 5CYMA 4XPCA 3PNIA 3ZZTA 4ZN1A 3QLHA 2DTJA 3I87A 1Y5IB 2HVIA 1HNZF 1MG7A 4WIIA 3B78A 2BE9B 3R3TA 4YFUA 3HM9A 2R8IA 3UCGA 2PD1A 2C1EB 5I4MA 4ZOSA 1XR5A 3MPWA 1VMBA 3JSRA 2H5JB 5KG7A 3NCQA 4DFMA 4ITSA 4YR3A 5IWAJ 1F9EB 3OVAA 4JI1J 2MB0B 1N32F 9ATCB 3EM1A 1NSPA 4PXBA 3KJQB 1KLMA 2ZITA 1D9DA 1CULA 4M8LA 2WOMB 1IR0A 2UU9F 2RUSA 4DX5A 2WSEC 2BJ7A 1UEKA 5E33A 3QRPA 3THVA 1U02A 2RDJA 1RT1B 2XSJA 1T95A 4QR1A 1VYAA 2V9KA 2F7VA 2HVZA 2AKWB 5A2QU 4CO5A 1F60B 1RTIB 5ITHA 4WTOB 4KE5A 3TP2A 3OJSA 3T3FA 2IC3B 5B0GA 1SKWA 3WIUA 1HLWA 1TKXA 2J6SA 2DJWA 3TANA 1HBOA 2BV3A 2PA3A 1PC5A 1KD1T 2H65B 2CG8A 1Q81T 3J7Z5 2MY8A 1NLKL 2ZDPA 1HARA 2RH3A 3EGVA 3PX4A 4ZMMA 1S1UA 4G1QA 2RHSB 3G8QA 1TMMA 3HHLD 2XGPA 2DGQA 1D0EA 2R3VA 4NZ6A 3NGRA 5BXIA 4M5IA 1R27B 1QLNA 5D15A 2EFOA 1B0PA 3QRRA 4QZVB 3DRSB 2GO8A 3OSPA 4ECRA 2Z57B 2HFVA 2R8HA 3CCQS 2UZAA 4GC7A 3DDKA 2E5GA 1WD6A 3RBEA 4J9OA 1Q82T 2NUHA 3RR8A 4R8UB 2UUBF 2AEJA 4OIXA 3AH6A 1V6HA 3W2WA 3LGHA 1XC9A 1ZPWX 1JLGB 2J76E 1CJKA 2IM3A 3TA0A 4WP3A 2HBQB 2JC0A 2WB1D 5D0GA 2AYBA 3IC1A 4OL8A 3RRKA 2EFGA 1UMJA 3BSNA 3TO8A 2L9DA 3TJAA 2DNOA 1N56A 4P75A 2L3MA 4IO9Q 1N34F 4ZP6A 2IFXA 2LEAA 4N47A 2FJBB 2YX4A 3KMSA 3T5JA 5H9FK 2R7SA 3CO0P 3ILLA 3QGHA 1TUWA 4LF9F 1S6PB 5LXYA 3D54A 2KB2A 2OD4A 5H1SV 1CJVA 2XNQA 4LRAA 3FGVA 3HULA 3E51A 2ZH6A 3VAGA 5KFEA 3OVBA 2DNGA 3K58A 1S76D 2W9AA 4FDFA 3GCXP 3I0SA 2EFPA 3D9BA 3LTOA 4FVMA 4OLOA 2HLTA 4JBCA 1PJ7A 3G82A 4AT1B 4EGLA 4DQIA 2NLWA 2Q6CA 4RJVA 5CYMB 5KFMA 3QLHB 3L3CA 1NH8A 2EBEA 3DGVA 2C3PA 3H7HB 2CQBA 1OQ6A 1RCXB 1LK5A 1KONA 2BACA 3CMQA 3QJPA 3GJSB 2XWXA 2NYHA 4JI0F 2VPYB 4ECTA 3IBFB 4W98A 4DV0F 3T6JA 1U1NA 2MQOA 4FYDA 1FD8A 4BWJA 3EJMA 4NEZA 1HNZJ 3NGTA 4NLWA 3HSZA 3W2VA 3SV3A 2CJ9A 1KLMB 4PUOA 2YX7A 1CULB 4NMXA 9RUBA 1X9WA 1S10A 1GEHA 5HP1A 4J7CA 3RAQA 2F5GA 1IKXA 3ETMA 1IKYA 2OSRA 4OI1A 2XSJB 1X0PA 4DV5F 4NX9A 2KG0A 3MD1A 2J0SD 4DFJA 1R43A 1MWYA 2F9JA 4TU7A 1FWLA 2H4WB 2YWHA 1N32J 2VKRA 4DFKA 2MMYA 4JI4F 1BQNA 2FJVA 1TKXB 4WP9A 2V9WA 1HBOB 1NDCA 3GV7B 4IQXA 4AXIA 2ZBQA 5IZHA 1ELOA 5D0EA 2PEBA 3PDNA 1P9YA 3OLBA 2D3O1 2ABYA 2YPZA 3OL6A 1S1UB 2D3UA 4F4KA 1N5SA 3W60A 3IG1A 2CQDA 1NK5A 1PKUA 5EWGA 2AJQA 1S9EA 1FXLA 4YDXA 4DZDA 5C42A 1U45A 3VZIA 5L38A 3EICA 2W2OP 2RNEA 2BR0A 3UW1A 1N5TA 3CD6S 3MR2A 3W2WB 2ZFHA 5A2QY 2HRUA 2CQ1A 5CQGA 3FMBA 3HVAA 5LSLA 1T3OA 1A0OB 3PCOB 1IJEB 4ZLJA 4FNIA 1CJKB 4NLTA 5F8MA 1UA1A 3QFWA 2UUBJ 2V63A 5GAGI 2MKCA 3P5TL 3X1LB 4FS1A 4ZLNA 1XK8A 4K4UA 1NKBA 3CJSA 3BSAA 2XULA 3IRWP 3FBCA 2HHUA 2R2SA 3DOKA 3DDIA 1O5JA 1P9QC 3R6GB 2PC6A 1N33F 3GFZA 1U1MA 2IRYA 1TP7A 3MAHA 3VAMA 1FE4A 2I1RA 2Z58B 2AJ2A 3D6FB 2NYIA 1CJVB 2DH7A 1TFYA 4DU8A 4KPYA 2QIFA 4K4YA 3GQCA 1NK8A 2VU5A 3AD8C 4HL9A 2GHVC 4M5DB 3I0SB 4LF9J 2CKWA 4NLRA 3N6LA 1H6KX 3G82B 2JOQA 1X31C 5HMXA 4QWEA 2IM1A 1WELA 3RB3A 2CQIA 1U4BA 1HBUA 2D3ZA 1F0XA 4NWBA 4KFBA 2QL5B 2MQPA 3QAEA 1RYSA 4W92B 4QOTA 2PFFB 3SCJE 4R0EA 4KO0A 4WE1A 3AXMA 3C66A 1L3KA 1P1LA 2QLWA 4JI3F 1WNEA 3GYXB 2BX6A 3W2VB 4ZITA 4OI4A 5GMDA 4PUOB 2GIQA 4CLYA 2DVIA 1OS5A 1DJ0A 3FC9A 3HKZD 2FGOA 4DV0J 5BYQA 2E5LF 3A8EA 1IXKA 1M1HA 1YX2A 3OLAA 4DX6A 1IKYB 1OMSA 2HAIA 1U8SA 4ZCMA 5BYRA 3K5PA 1R8BA 2HHWA 4C8MA 3R6LB 1U1OA 1FK9A 2R42A 4YMEA 3DU5A 1BQNB 4KY3A 3W65A 3LALA 1VFJA 1K73T 2IVYA 2ATCB 3LWMA 2BE2A 3GSDA 3MEKA 4M5NA 4MAKA 1LWXA 4CP5A 5LSOA 1FRLA 2FD2A 5IV4A 4F04B 4X4SA 2CPEA 3EX7B 2HS4A 1GQEA 2W2PP 3T1HF 1SI9A 2VG6A 1ZAWA 3BF4A 3IG1B 5A0YA 3UPFA 1UWAA 2R7OA 3UR3C 1DURA 1S9EB 1T9VA 3HCXA 3ICLA 4CLFA 1DQAA 2FJWA 2QLXA 2HHPA 5K9FA 1S9GA 3D1OA 3PY8A 4MK8A 5DDPC 2N3OA 2MLYA 4HT5A 2XLKA 3GYNA 1KTQA 3E3XA 2BJ8A 2ZD1A 1F2GA 4H54A 1VQ8S 4Q8EA 2QYCA 1ZM2A 3M2VA 5SUHA 3Q0AA 4KAIA 4DSKA 4K4VA 4DSIA 1EHWA 2VPWB 3CW2C 1NDKA 4ZIWA 2CVEA 4DR7F 5DG9A 4LF4F 2B4VA 2G0CA 2YH0A 5L1JA 2ROEA 3I6PA 1G4CA 1FVSA 4Y6IA 1QTMA 1RK8A 4CH1A 2IBKA 4DOZA 3DOKB 4FZVA 1R31A 4KH0B 4CLWA 3NNCA 4PPDA 3ZC4A 4OX9F 3X3UA 1NB7A 4WFXA 1RBLA 4NLDA 4HI1A 2B0GA 3DOMA 4ZVQB 3J7ZT 3ZTRA 1FERA 4NLGA 1ULRA 5LL6d 1URNA 5F8GA 3QNWB 3K5MA 4UUXA 4JV0A 2O01C 2RQMA 4FN5A 2GS8A 2MZQA 1N33J 2G4BA 5HLFA 3O44A 1UWBB 2GFFA 4QWAA 4PG8A 5B0CA 1C1BA 1QSYA 1VISA 5LMUF 4ED3A 3W64A 5IV3A 5AT1B 1HBUB 5EWEA 4OX6A 3GZ7A 3HD1A 4KFBB 4B9TA 3DOLB 4TKTA 4KC5A 3A8KA 4KO0B 3RRHA 3AJ1A 4WE1B 4ZPAA 4ZPVR 1QAXA 4ZVOB 3G6YA 4K7QA 3M6WA 1FJGJ 3TUPA 2ZVIA 4F0MA 2V8HA 4OYAA 2ZWOA 2FYXA 5T14A 5L8RC 3OFFA 3KK1A 1U2FA 4Y28C 2GVDA 2W24A 4KHPF 4ANEA 4J9SA 3UDLA 3A3NB 1WF0A 2RU3A 1KWMA 1FK9B 2E5HA 2Z2MA 4EBDA 4IQMA 4BBYA 4K5RA 3I5CA 4PWDA 1N0VC 4DR1J 2E5LJ 1K1SA 2YBVA 1WG5A 1UVNA 2FJDB 4ZVEA 2VICA 3HF5A 1YRXA 3EPIA 3CJKA 4K59A 1UTAA 2E5IA 3PHEA 5E2QA 1QAIA 5FJ4A 3MDFA 2VG6B 2DXFA 4I67A 1SJQA 3CPWR 4EUVA 5A0YB 3CC4S 4B9VA 2IYIA 2LU1A 3DC2A 3VCDA 5BYSA 2X1GA 2V6AA 3S8SA 4UW2A 4FF4A 4O0IA 1M5SA 1UFLA 2Q66A 1U1LA 2XZTB 5EX3A 3S6EA 4FXWA 4UQGA 2HFNA 5T7LA 3T1HJ 2DNYA 2E7XA 3FRZA 4J9NA 5ETNA 2BM0A 1S4FA 4LREA 2J6TA 4C11A 3B82A 3R1HA 2ZD1B 3PW7A 1RBAA 4J9KA 1RWMB 4A8XA 2J5AA 2LECA 4ID5A 3M2VB 4QBUA 5KFXA 4C98A 4M63A 2KRRA 1XMQJ 1RU2A 4K0KJ 4LF7F 1Z4UA 1H73A 1X5SA 3U1NA 1FDAA 1WOPA 1RWXB 4Z37A 2KVQE 1GFWB 2AD9A 1VJWA 1DAXA 4RW6A 1D8ZA 3VGUA 2ZBCA 1NU4A 4O3OA 2C2NA 2HFZA 3T41A 1AXQA 2DGUA 1U0HA 2FVSA 1JIHA 1PBUA 2UV8A 4QR2A 4U95A 4LF4J 4JI6J 3DOMB 3UNGC 5LJ3Y 3E01B 3NCRA 5JUMA 2W4CA 2UUAJ 3HFZB 3VVUA 2YNGA 2J7KA 1I6JA 3RB4A 4ZVRB 3Q89A 1XQIA 5B0AA 3KLFA 3QWUA 1KHVA 2DNHA 3R9LA 4OX9J 3T6BA 1C2PA 3EWGA 2A6OA 5HLFB 4O3RA 1NHUA 2OMLA 3O3LA 4I6YA 2ROGA 2CQ3A 4N77A 3CDAA 1HL6A 5ETPA 4URGA 3BGFA 3NGKA 3BH7B 1NHVA 3CJTA 1JJCB 1RKIA 3W8GA 1AROP 1NK7A 3F0NA 2AJ0A 2V4QA 2XTJP 3FK4A 2JEIA 4NXMJ 4JI2F 2KH9A 1K8AT 4IFVB 1WEXA 1N6QA 3GMGA 4ZP8A 2DNQA 1OYEA 2YKNA 2QA1A 1ZTTA 4WKYA 4UQTA 2J9EA 1PJ5A 2AQ4A 3LF0A 3KK1B 2IA0A 3GWCA 2GVDB 3HHLA 3CIMA 1YBUA 1SC6A 2XMKA 2P6TA 3C14A 3TWZA 3F73A 3ZZRA 2HHHF 3M8SA 4PWDB 2BE7D 1H72C 5E3QA 5GVQA 1OY9A 2B9WA 2QT7A 2XY7A 3AFGA 1ZM3A 3TQ1A 1BY9A 4YB5A 2Y1IA 3CJKB 1UPMB 1NPPA 4WKRA 3FFIB 1CQMA 1LK7A 2FY1A 2KT3A 3DGPA 2W2NP 2DGSA 1LW0B 2Y8WA 3GFYA 5D4PA 4DPWA 4F3MA 5A8KA 3L95X 4K4SA 5DZ7A 1YK9A 1XBWA 4NE9C 4URSA 2A18A 3PIOQ 3KLIA 1NEEA 2QFJA 1N48A 3BBFA 5T7LB 4P74A 3WZ0A 4C11B 2Q79A 5KT7A 1NMEB 3TX0A 1L3VA 3P96A 4ID5B 4S0MA 4WFZA 4ZPBA 3FVYA 3ILJA 2HS3A 4GMKA 3EPGA 2NXCA 2PDAA 4NLQA 3OT9A 4NXNF 5EWFA 2UUCF 2HLUA 3EDRB 4RW6B 3BO4A 2J8AA 2F8EX 1TUVA 1LXJA 2GO9A 1RT2A 4B3RF 3JYTA 4QIGA 2FHMA 1U0HB 2H54B 1YITS 2ACYA 5DRKA 2QYGA 2WAQD 2AJFE 2DNLA 3R5CA 2DCUB 4P2MA 3OHBA 5M2PA 4OFZA 2YNGB 4ZA1A 4N7TA 1YBAA 3DRRA 3KLFB 3FZBA 2HIYA 3RB6A 2AP6A 3MM7A 3N5FA 2AGOA 2FLPA 2X1AA 3UDEA 2ZOMA 1X8DA 2R7WA 2ZWPA 1U1QA 3TW0A 2KL8A 2VOPA 2X3GA 1SCJB 2GQCA 1VRUA 2R2TA 2KXNB 3N28A 4DL6A 1RWUA 1WSRA 2BVZA 4FKYA 1M0SA 4OJHA 2L9WA 3DCAA 2W25A 5B7WA 1K1QA 5IS2A 3H4DA 2EI5A 1KOOA 5E3AA 3PIPQ 1SH0A 2C3YA 2UUWA 1Q7LB 1X4FA 4ZJLA 4OZ1A 1N6QB 5DG7A 2VD3A 1HMVA 2YKNB 3CCRS 1KDNA 1RB0A 1URRA 2G2ZA 1HR0F 5EUHA 3L9ZA 3HHLB 1XERA 4CO3A 5CA5A 4WFNQ 2ZH3A 3MR3A 4LBPA 2KFYA 3C14B 3M9MB 3HT0A 4EYIB 2LEBA 2FVPA 5HJXA 3DHWC 3UFCX 2H1YA 2YWEA 3NY0A 3P8BB 3FCWA 3L09A 4OZ2A 1HWLA 2C2EA 1MROA 1W26A 2G0JA 4BWMA 2GVZB 3PW2A 2MZTA 3NOCA 3A4TA 2V8DA 4U8VA 3R8YA 3G6XA 2CRLA 4HYKA 4L3NA 5F9LA 1UJ4A 4X62F 1Q7YT 1RHJB 4B9UA 1TAUA 2OPQA 2HHHJ 4DL0C 4C6AA 4FBUA 1X9MA 4C3KA 5A8KB 3G6VA 4DL5A 2MQNA 1JX4A 1PILA 2ZHOA 1S97A 1PYOB 4GO5X 2XEXA 3KLIB 4KKOA 2BQUA 3G9CA 4MK7A 3PKMA 1PO6A 2V2QA 3TEHB 2QEXS 4Y3CA 3AA8A 2HURA 2YQ0A 3L4BC 1JKHA 1V3SA 1YBTA 1KQSR 1ZZNA 1H98A 5JMNA 1SV5A 4DG1A 4OHYA 3T9NA 8RUCA 1ZM9A 4KTQA 2QMUB 3PW0A 3CJQA 2MKHA 1S1XA 3NMAA 4O4RA 4EZ6A 3QFHA 5KOXA 1RT2B 3JYTB 5DM6Q 2M2BA 3W9HA 1HQUA 3UN2A 3GLJA 1ZZFA 2UUCJ 4OZ3A 1Q8LA 2F4FA 4DQSA 2QE5A 4DX7A 1ZS6A 3DRRB 2LMIA 5L46A 2XLJA 3MR5A 3RBZA 2FY8A 3G96A 3V81A 4B3RJ 3MM7B 4DLEA 1H38A 3RB0A 3OL8A 1U25A 2CWXA 4F4AA 1VQ9S 3VR1A 3LH2S 5IQ6A 1YRTA 4LF6F 4F67A 5F8HA 3GV5B 3U02A 1B4SA 5KFYA 2BW2A 4TY8A 1JNZB 4RUAA 4E2FB 1SQEA 5KG3A 3HX9A 1VRUB 4EU0A 5CD4A 3D0GE 3PW4A 5GAHU 5J2PA 1H7XA 3PRDA 3HD2A 3G86A 3MEDA 3TARA 1JLCA 2D9PA 4C9DA 3DN9A 3C6TA 3IWLA 4LJMA 4CLZA 2XMUA 2CQPA 3DLLQ 1RYRA 4JI8J 4P73A 2KFZA 3D66A 3D4JA 1HMVB 1YJ7A 4CM2A 1FNXH 2HMIB 4FF3A 4OYOA 2CPZA 3H0PA 4UOHA 1FCAA 4GVBA 1U1PA 1SQGA 2DH9A 1M5HA 4L74A 3T5KA 2VUGA 3JQMA 5DLFA 1HWJA 2DR5A 4AL5A 2QRRA 5AE3A 1MN7A 1FJEB 2V2ZA 4WU3A 3HVRA 2AIRB 1DY3A 1HR0J 5HATA 2ZZMA 1Q53A 3MTKA 5IT4A 2HZVA 4ZLLA 4IG3A 3KJFB 2IMWP 1RT6A 2OFGX 2HBZB 4WYLA 4AXJA 4NYOA 2ZHBA 3D68A 1GH8A 1M1GA 1QUVA 2K3IA 2OPQB 1L5UA 2AV5A 2PI5A 3LP2A 4DCOB 2FVCA 5LMNF 2VG5A 4PABA 1NZAA 1UFWA 1RHQB 2CVIA 2AX1A 2R7VA 1W2BR 1TAQA 1XMBA 4KKOB 5KOWA 3UN5A 3FBEA 4PEOA 5A76A 1WACA 4M5JA 4X62J 1EX8A 4ES2A 2QSFA 1D3WA 4KBIA 4K5SA 3ZTOA 4B3MF 4E8UA 4F4WA 3CE8A 1TL4A 4DR4J 4DN0A 1JKHB 4A47A 2X7IA 1F3FA 2HIQA 4ER8A 4TYBA 5C7PA 2ILZA 5HQ8A 2M5YA 3RBDA 2VQFF 3S01A 1SV5B 4DG1B 2JLEA 2B9EA 4TU9A 4DQQA 4F2SA 1N4LA 2AU0A 3MMAB 1MLAA 5KT5A 2JHEA 2W9CA 2O66A 1N0UA 4CO4A 3O8WA 1NM2A 4JV5J 5B0EA 1S1XB 3B6BA 5EGYA 4JP8A 1I5OB 1REGX 2WSFC 2EK6A 3VAKA 4ICLA 2CJQA 4WFBQ 4DSLA 4FYYB 2YKMA 1U26A 4ZIVA 1WEZA 1U8WA 1GXTA 4USKA 3DM2A 1HQUB 3VGVA 2QMWA 1CVJA 3GE9A 5D3GB 2BXJA 5KFZA 4CT8A 3IR6B 4Y2IA 5C2GA 1WHWA 1TVRA 3V81B 1G7CB 1RWNB 4JI7F 5KFBA 4K4WA 2QX0A 4L72B 2HEKA 1PYSB 1JXLA 2JEJA 2K7KA 2IVMA 4F3OA 1OWXA 4IYQA 4ZVPB 4TY8B 5DG8A 2QMXA 3MFHA 3AJ2A 1RTDA 5J2PB 2ZEJA 1S6OA 4RUCA 4F50A 4RLEA 2Q43A 3A12A 1EQMA 2ADCA 3MEDB 5K14A 2BA9A 1JLCB 4LF6J 2H5IB 4ZPCA 5KG1A 1TKDA 1YJVA 3C6TB 2DNPA 1NRKA 1VQ6S 4UZCA 2PEHA 1CS4A 3IFEA 1ICEB 1PYTA 3DRYA 2KDOA 1MWZA 1NCLA 2BQRA 4DPXA 3EZ5A 4KGZB 1S6QA 2PO4A 1Q8KA 4GVBB 1KVKA 4MKAA 3A3PB 5EDWA 2C28A 3DI6A 2ALYB 5KFPA 4NYPA 1CG2A 2R4FA 2NXEA 4UOFA 5C5JA 3NGSA 5IM0A 4H4MA 4K4XA 2BYCA 2KZZA 4IG3B 3HK2A 5I3PA 4PPZA 3ZTQA 4P7VA 1RT6B 1APSA 2EKNA 5IT9Y 2GHPA 4CRJA 1HNVA 3RJMB 4NA3A 3R7NB 3GB0A 4WIQA 3I5AA 4Y2MA 1NDLA 2VJVA 3I5BA 3C6UA 1IBLF 3LP2B 2KVIA 1X4GA 5M2RA 2VG5B 5KFGA 5K8NA 3EYZA 4LF8F 2QA4G 4CO2A 4OHXA 2O67A 2DPIA 5HN0A 3OL7A 4DN9A 1WDDA 4CO1A 1TQLA 4RW9B 4QIEA 1FI4A 4J91A 4DFPA 1PBAA 3N6NA 4OI0A 2VQEF 1NB2A 1GXLA 1WUUA 4B3SF 3FNNA 4URQU 3MFIA 3JTPA 4TQSA 2IAJA 3D1QA 3D2WA 2M52A 3WC2A 1VIOA 3IR7B 3ISZA 3LAKA 2F8MA 4U8YA 1VC6A 3M9NB 2DR9A 1HBNA 4RNNA 3UCZP 2CG4A 4PXEA 1F3VA 4K8RA 5HBMA 2R7XA 2HHXA 2W9CB 4B3MJ 1T8EA 2Z30B 5DQGA 4PXCA 1VIXA 4WFYA 2GQ2A 2AYMA 5F9NA 3QZ7A 4M5KA 1NK0A 2E9RX 4ICLB 4RWWA 2MTLA 4KGMA 1PGZA 1FX4A 2IPOB 2YKMB 2U2FA 5KFWA 1RAAB 1T3NA 4DXLA 4Q43A 3EZOA 4W4MA 4NLSA 4RNMA 2YTCA 4I2QA 2BOPA 2DBBA 4MIAA 5D77A 4G65A 4CI0B 1RTJA 1RU1A 3ITHA 4LR7A 2W2QP 4DL4A 2APOA 1F5BA 2CA9A 2DR8A 2AYGA 1Q5YA 4RW4A 4DZ6A 1U48A 4EFAC 2HBRB 4P9SA 3RRGA 2JH3A 1RA6A 4JOUA 3CCES 3JQJA 1HFEL 2ZOGA 1YRUA 3UDVA 1F1BB 4B9LA 2RRAA 1N88A 2LXFA 3JQKA 1JLQB 5DQIA 4IH5A 4DPUA 4DQPA 3UDCA 2VASA 1RTDB 2YNIB 1MW7A 4JI5J 2LEPA 3HZGA 5K14B 7FD1A 4K4TA 5CZXA 5KFOA 3LPYA 3NAHA 2ACMA 1RWOB 3VVTA 4ECYA 2M3DA 1IR2A 3OTBA 1CS4B 5IC4B 2QL7B 3KHGA 4DQRA 3Q2SC 1GX6A 1PG5B 2ASDA 4PYDA 4IOCQ 2QO3A 4O3PA 4I4BA 4W90B 1HBMA 3PFEA 2FHJD 2GAGC 4WZMA 3M8RA 2CQGA 2XMJA 1T05A 2V4RA 4X4RA 1FEHA 5HROA 4BC7A 3DI6B 3RU0A 1CPZA 2Z2LA 2QLFB 3MM9A 2RIJA 2DIVA 3N4WA 4WU2A 1FWKA 2OSQA 2C22A 5B0BA 3RZAA 2D74B 3HFVA 4H4MB 1YHQS 3F41A 2AT1B 3R7SB 3RW6A 3W8PA 2NSBA 2RQ4A 2MEWA 5C24A 4YDDB 1IQTA 3A3OB 4LUBA 3CCMS 3QZ8A 3SYZA 1HNVB 2ILYA 4AQYJ 1SUQA 2UXCF 4YQWA 2HQDA 1WC5A 3MPYA 3C6UB 2VPZB 4USUA 4HACA 1RHRB 4WFAQ 4F2RA 1WG1A 3PX0A 4IDKA 4YB1P 4USVA 2Y9HA 4K2XA 2G13A 4I1TA 1I1GA 2MKSA 3DHXA 2XYPB 3NNAA 2I8EA 4OZ0A 4HH0A 4DV4J 1GTHA 4EBEA 2CJAA 3OXFA 2IA6A 1GMWD 4LF8J 1DFDA 2IAJB 1UCNA 4CDIA 1QM9A 2HKEA 2OEMA 1HBNB 2HNDA 1CC8A 2J7UA 4OJ3A 3H5UA 5HBMB 1RGVA 2W9BA 2MHEA 3BEGB 2DRDA 5BR8J 2VQEJ 2LU2A 3LA0A 4N56A 1RACB 3H98A 4C8LA 2W4DA 2NSCA 3AXKA 3LANA 4NLXA 3ENVA 1FRHA 2DITA 1OPIA 3QT6A 2KHDA 2X1FA 1HHQA 1VRQC 4I6WA 2AGPA 5H9EJ 5ETTA 2QN6B 4LFAJ 3UN3A 2GIFA 3CD7A 1G2EA 1ZAXA 3HI9A 2JEFA 5E3PA 2B3TB 3PYDA 4I2QB 3PG9A 3KG1A 2GZOA 5ETLA 3GR0A 1RTJB 3GYGA 5IQQA 4G3IA 3ITHB 2PIIA 4MH8A 4YUDA 5KG6A 4RW4B 4KGVB 3FBBA 2MKYA 4NZ0A 2R8KA 2J0WA 3KWMA 4CLSA 5G4DA 1VQNS 2IMOA 1U6BA 5HVFA 2HSEB 1JLAB 1NJWA 4BS2A 3MCNA 2NXJA 3I9ZA 1RWPB 4ECQA 2RVJA 3OXGA 3DKDA 4DV1F 4EWTA 5A8WA 1X4AA 2W4PA 3OR1A 2ADBA 3HZEA 2ZJQQ 2W7PA 4UTGA 2OAUA 1NHKL 4IRKA 2E1MC 2CUYA 1NK9A 2FHKA 4U7UD 4DX8H 2W01A 1RBOB 4ZVGA 4DR6F 3D6HB 3IM8A 2PMZD 2MXYA 1TKZA 2N3LA 3TUIC 3MD3A 1HBMB 3BH6B 2DHGA 3PZPA 3FEYB 1OJ4A 3TQEA 1FNOA 3DRSA 5DDQC 2C2MB 4N76A 4CTAA 2AWZA 5KFAA 3N9UC 2I2YA 1U09A 1HWKA 3OR2A 4X84A 3MM9B 1HA1A 2EG1A 3J80Y 5ETVA 4C0HA 4ERDA 5DJBA 4ZVSB 3NP5A 4LR8A 2HQ3A 1FDNA 4QYRA 3BQ2A 1FX2A 1VQ4S 3PO5A 3ELHA 1JLGA 5C24B 1L3SA 1NSAA 4FYWB 3TZYA 2KZMA 3AD7C 4DDFA 4M94A 3IAS9 5HVHA 5KT2A 5ADZA 1SUQB 3IWXA 1WSVA 1GXUA 1FJ7A 3BGOP 1S4EA 3MF5A 2XHCA 3ZNJ1 4HACB 1P27B 4ZHRA 1HQ2A 5KAKA 4QW9A 4IDKB 2ASJA 3US5A 1EB0A 2FIUA 3AY0A 2FJEB 2IRUA 3H2VE 4KIAA 1RTZA 2ALZA 2G0IA 3D6TB 3GJTB 2Q6BA 4QU6A 1TTHB 2RB7A 1KQGB 2Y0BB 1Q8IA 2ZC3A 1JK9B 2DD8S 2VBYA 4N8OA 3AA9A 3RG6A 5KFQA 3MUMP 1ZM4A 2K7JA 2HNDB 4QIVA 2BJ3A 2W9BB 3MPDA 2AX0A 2N82B 3I4PA 4X4VA 1CJTA 3SCIE 3FEXB 1EP4A 3KLEA 5HAOA 3E8OA 1N36F 2W8KA 3KHLA 3BYPA 3MR6A 1SPBP 4PWUA 4A8MP 3QT8A 1T02A 3OTEA 2ASLA 2OH2A 4L6V3 2XM3A 1UEVA 4ZVUB 2JX2A 2JEGA 3VAFA 2M4MA 4MJKA 2XS7A 1H7WA 1KQFB 2J7WA 1YIJS 3DDNA 4F8RA 3EMTA 1F2HA 3D3CJ 1MMLA 4DCPB 3T19A 3PHTA 4H4OA 1R6YA 1MMDA 4BDPA 1A6LA 4G6VB 1RHUB 3U7JA 3HP6A 3V6KA 2FDNA 4PRFA 1HKAA 4PG4A 5B08A 1NUEA 2F9DA 3POTA 3HSDA 1J5OA 3GTYX 2HVHA 2MQMA 3CJ2A 4MIWA 3PR4A 3T9ZA 3N6MA 2LQJA 2VBWA 4A8FA 1I3OB 4ENOA 5MLCV 4GVLA 5A8WB 2B4PA 2P8IA 3OR1B 1VQMS 4HTIA 3DRXA 5KFHA 1Q0NA 1QUPA 2AHOB 2WVDA 3UD4P 4FNHA 1U2RA 2HHSA 2OJ3A 5CAAA 4ID8A 3HSJA 2JFKA 1TKZB 3CCLS 5E5NA 1QY7A 1N5QA 4N5SA 4USHA 4DV1J 3TA2A 5EX0A 2LQ9A 4FKXA 4MKVA 1B7FA 5THWA 3TA1A 3D0HE 4CTAB 3SBMA 2IRXA 1VBYA 1E6VA 4LF2A 3OR2B 5L1LA 3P49B 3WHIA 3R2DJ 1VLYA 4DR6J 1SJ3P 5GAEI 2B56A 2ZBPA 2NS1B 2HPUA 4C97A 4F4ZA 4NL5A 1BHNA 1Y3KA 1ROFA 4OI6A 3ZNUA 1RLDA 3V6JA 1Y3JA 2WVBA 1YTYA 3TJ8A 3UE2A 1HWUA 1XR6A 1SC1B 3K7RA 1YZ7A 1NXIA 4WCEQ 3P45B 4F0HA 4B3OA 2AEMA 2GCFA 5EHHA 3QIDA 3BDPA 3OW2R 2ZZNA 5M2UA 2C2DA 3GONA 4ZHRB 2FHOB 3HO1A 5D6GA 1Q78A 1EJ7L 1AZSA 4PXDA 1P8GA 4F36A 4U6PA 4YP3A 1RAGB 4RPFA 1F6TA 1R7IA 3C19A 3CSKA 2V0NA 1X5OA 1NJZA 4RW8B 2GQQA 3SSSA 1YSJA 4ANCA 3I56S 2GA7A 4ETZA 1M5VC 3TRGA 1OSCA 5E7OB 2QA2A 2QC3A 4RUHA 3U1LA 3SQGA 4ECVA 1UETA 4RZRA 4DR3F 5I3QA 4PG7A 4M5DA 1BD6A 1RAIB 2CZ4A 1CJTB 2KG1A 1EP4B 1O6XA 3KLEB 3K2YA 1DQ9A 2P9GA 3D5MA 3T1AA 4X4OA 4DBQA 3CJ8A 5C2CA 3MHYA 3WIVA 2A1BA 2HK3A 1S0OA 2KM8B 1HHSA 4K50A 3SZ2A 3L7PA 4IR9A 2RQCA 3R5AA 4UOCA 5GAGU 2XMTA 4R25A 4CWBA 2VHGA 3C8YA 2WSCC 1LV5A 1U1KA 2YWGA 3PEHA 4HI2A 1B64A 1N36J 1D1UA 2ASYA 3CIZA 3DMJB 4WTYA 4IRCA 1NZ8A 3KXDA 5KG4A 2I9SA 1XWLA 1IQZA 4H4OB 2VFSA 3TX8A 2ZNZA 1YZ6A 2E66A 4J5OA 2QL9B 4LFCF 1QDUB 4YY3J 2HQGA 3POTB 1J5OB 5D4OA 5KFTA 4X65F 2VFUA 1GX5A 4K4ZA 1U49A 4AYBD 4IR1A 1QVFR 3WX8A 2LKZA 4USMA 2FLNA 4C8OA 2HS0A 2WCXA 3M8ZA 3VQSA 3KLHA 3T1YJ 3N0VA 4X4NA 3K5OA 4XDDA 1R8CA 1SC4B 2WB4A 1C1CB 2E1PA 1FD2A 2LP4A 2G2OA 3PVXA 2MDAA 5DZ6A 1Q5VA 2XMMA 2M0GB 4MKBA 1S0NA 3FKBA 5KTQA 3IXQA 1SJ4P 2ZH4A 4EZ9A 7FDRA 4M95A 1E6VB 2VH7A 1FFGB 5DDOC 4ZP7A 1FT8A 2B6AA 3AOCA 1ACMB 1TUGB 2D7SA 3MI7X 4Q5VA 3R5GA 1RAOA 3LP0A 3NBPA 2KRBA 2LVWA 1KFDA 2Q3PA 1PSDA 4OI2A 3QO9B 2KYZA 5AE1A 1KHWA 4B3OB 2EK1A 2I0XA 2NPFA 4DPTA 1TV6A 5DM7Q 3UCUP 1G3OA 1M5OC 1EAYC 3HHNB 4WJBA 2V68A 4IOBA 1AZSB 1NSQA 4A8QA 2W7OA 3OVSA 1DTQA 1VS3A 2JRSA 5B0DA 1BLUA 2CQHA 3QT5A 4RUBA 1FKOA 2I6WA 3CC2S 3TZWA 2RT3A 1O51A 3M6XA 2LCWA 3PR5B 3SQOP 2ZH1A 1Y4ZB 3CJ4A 2NUUG 2BJ1A 1VBKA 4JB8B 3FQKA 1YG0A 2YXLA 2CPDA 1S57A 4OYMA 3TAMA 2V50A 3FUYA 4O4GB 1WI6A 4XO0A 1SH2A 3SQGB 2V2VA 3DLEA 3VF0B 4ECZA 1AT1B 1F5CA 3DYAA 4DEZA 1FO1A 1UWBA 4Q0BA 3PX6A 4QW8A 2QG9B 4LF5J 1UVKA 3M9OB 4A8YA 2ZJPQ 4A8WA 2DK2A 1M90T 1VDHA 3D28A 1FJGF 1WF2A 1NO8A 3JSMA 2CNKB 4DR3J 3SDEA 5KFRA 2DNRA 3DOLA 2BRKA 3D7SB 3IGNA 3MXHP 2E9TA 4ZCKA 2JJ4D 2BOAA 4J9RA 1ITPA 3HHLC 1CSJA 4LR9A 4QYZJ 2XGQA 2KFNA 2AEFA 4Q2LA 2CQ2A 2Z8QA 4LIWA 1PC4A 3OPKA 4DR1F 4NASA 4OYXA 4GKJJ 2KJWA 2QJ3A 1RDRA 4WBFA 3SMZA 2DNNA 4NRUA 2FHJA 2IBOA 4ECWA 3J7YI 3LGMA 2HYIB 1UP1A 3BBBA 3ONQA 5KT3A 2GJ2A 1RWVB 5DQHA 4DV3J 2LFVA 4Y2AA 3MEGA 3ISND 5KFUA 1WWHA 4M5MA 4L76A 3D67A 1KTVA 4CO0A 2AW0A 3GFXA 2RRBA 1AA1B 3KLHB 4LFCJ 3TVZA 4Q7AA 3AOBA 2FVQA 4X65J 3QBCA 5C25A 4HR2A 4F4YA 1S1TA 2DY9A 3CJ0A 2BZ2A 2UVRA 1RE1B 1TL5A 3OFHA 3PO4A 2Z2ZA 2CIMA 4HHUA 3OBIA 4IFYA 2FQQB 3GILA 3ETOA 5A8RA 4LSNA 5D0HA 4Q2MA 1NKEA 3FSIA 1FJCA 1DARA 1H0HB 3CB4A 3V4IA 2LA4A 1XMQF 2B6AB 1UAWA 3ZZOA 3JAMU 4K0KF 3MECA 4NCAA 2ZH7A 1CQNA 3H4BA 3LP0B 5GMEA 3NBPB 2KJVA 2Y0SD 4HT7A 4F02A 3NMRA 3AODA 1XR7A 2XMAA 5AJ3F 4NLVA 2KO1A 4DU7A 3MCOA 3ZZZA 1S99A 3G6ES 1R0AA 3CDWA 1GMWA 4I0WA 1TV6B 4ANDA 3CCSS 4JI6F 1CBKA 3FZ2A 4YR0A 4F26A 3W5YA 3PACA 4RBUA 2UUAF 1HPZB 4M5LA 1WTBA 1X5PA 4DUTA 4ILRA 2L08A 1UL3A 4DL3A 1DTQB 6AT1B 1NPKA 4WK1A 1K9MT 4XK8C 1FKOB 2KI2A 3BN7A 5KFJA 2DCLA 3E01A 5IXUA 2ZH5A 3L7UA 5KFSA 1VQLS 3VAJA 3TAMB 2LYVA 1FFSB 3KUEA 2CZ9A 2EC0A 1FDDA 3DLEB 2XS2A 2F8HA 2JLFA 2P5VA 5BJRA 3DYAB 3QPIA 3W66A 2YQ1A 4Q0BB 4U7CA 3W61A 1OO0B 4RNHA 4NXMF 4EI2A 1IKWB 1AUDA 1RXOB 3VV2B 2K2PA 2B4UA 2ERRA 3NWRA 5F3ZA 2N7CA 2H4YB 4ELTA 3B4MA 1KRPA 4YN3B 3W63A 4O0NA 1FEEA 5KT6A 1NSKL 3SI8A 1V5IB 3JSMB 1B3TA 3SDEB 2J0QD 2ZUAA 2H51B 3J81U 3GG0A 3PKYA 1FXDA 3QGPA 5HI7A 2WBRA 4IFVA 2DXDA 5KFDA 2AJ1A 1XNRF 2YWKA 2CDRB 4PKDB 4PCQA 5ETKA 5FLXU 1AYEA 2L48A 4O3NA 2E7WA 2OEJA 1MMNA 2JSXA 5HMYA 3EE3A 4YHHF 4I64A 3EDQB 1K0VA 1YJNS 2LDIA 4OYZA 3V2UC 2V67A 1KQKA 4X64F 2NQPA 2HZAA 3WDOA 3AQOA 1UPPA 2BRLA 5HQLA 1EKRA 2XYHB 1NDPA 3MEGB 2CWKA 4QCLA 1KFSA 5CHCB 5U47A 5DLGA 1QJHA 3BSOA 2GMLA 5D0RA 2DISA 3BJYA 4JUZA 1GAOA 4QWDA 4TVAB 2A2CA 2RKIA 2VDHA 3FFIA 3IGVA 1Y5NB 2YKQA 4CLTA 5C25B 1S1TB 3QJJA 1LW0A 4IFYB 5CH7B 5A8RB 4M5HA 4LSNB 1ZA1B 3J7A1 5AXKA 2B9XA 2L9NA 3BS9A 2E1CA 1N52B 3MZIA 3V4IB 1IBMF 1ZA2B 3KKFA 1WHXA 3BKTA 4LRBA 3MECB 1VC0A 1RT7A 4KHMA 3QGIA 3ZO7A 3CMES 2VONA 4A8SA 1NKCA 5ETSA 2X1BA 2W8LA 1PJ6A 1SQFA 3VAIA 1VQ5S 4LT6A 3O1LA 4NA1A 2C2OB 2DR6A 3GU0A 1DLOA 3M05A 1R0AB 1UVIA 4J9QA 5KFLA 3PYGA 4U7UK 1T94A 2DT9A 2FLOA 2OIHA 5AJ3J 4OYIA 2M7SA 5LSRA 2MPUA 5T41A 4I6AA 2HZCA 1IBCB 4FXVA 3R5JB 4USIA 1R8PA 5KFIA 1JB0C 5GADI 4XTTA 3JAMY 4UUWA 4KH1B 2Y1RI 3DXSX 4OQJA 1BXNA 4AE5A 2GX8A 5J1EB 4M5GA 4TNOA 4NMLA 2BQ3A 2XHWA 2KYXA 3W5XA 4CNZA 4P2XA 5MAOA 2DHXA 3HVTA 3EVOA 3J7AN 2K06A 4NYZA 1R8HA 4Y00A 2G9OA 4DUYF 1TK8A 3FMWA 2J9CA 3RR7A 4ED8A 3FCVA 2XI2A 2VKZG 3ISNC 2CXEA 4OMFG 2WK4A 3M1VA 1Q16B 1BQMA 4TN2A 3DLJA 3NG8A 1M1KT 4FBTA 4HEA9 2VZ9A 2XNRA 3CDBA 1HIYA 5A6WA 3MOJB 1AUSL 4QWCA 2RF2A 3SSQA 3PJWA 1TZ0A 4RL1A 2EFVA 4D3GA 3VZHA 3QWPA 1HW8A 2FLLA 3HMJG 4KRWA 4C48A 1XNRJ 1X4CA 1VQPS 3UQSA 5KFKA 3CCJS 1T9TA 2HQFA 3DXBA 4PQUB 4N41A 4I7FA 1IVZA 2MJNA 1HNIA 4QQBA 4YHHJ 3ULHA 4IKAA 5IC6B 2MZSA 2GVZA 4QIWD 5HANA 2JVRA 5DO2A 3J81Y 1LW2A 2W7AA 1JJHA 4OV6A 4X64J 1Q86T 3K17A 2RKIB 3LAMA 3UD3P 1Q8BA 4C8YA 1Z2LA 5FLXY 3BSCA 3ZZPA 4LMZA 4DSEA 3HXMA 5F8LA 1UVMA 1OIAA 3LPEA 2PA8D 3U27A 1WJ9A 3HPOA 2KU7A 2U1AA 3IO1A 4Q45A 2EFNA 4DS5A 1EZZB 3BKFA 3I0RA 1RT7B 2A2DA 2R9LA 1FRMA 1M5PC 2YH1A 3IWNC 3TNVA 2WBMA 2GV1A 4LSZB 4LQ9A 4L73A 2OI2A 1N5VA 2VA2A 1V5VA 1IBMJ 1DLOB 2XWYA 1HWIA 1HYSA 3QATA 4CIOA 2VB6A 2B7BB 4U67Q 1F5AA 1HD0A 3BREA 1RLCL 1WEYA 3FQLA 4NA2A 5HQMA 4TU8A 2NCKL 4P2FA 2YX1A 3OHAA 1T9UA 5SZTA 3R5DA 4DCJB 1S1VA 5HMZA 4P72A 1FTCA 1VQYA 4LVOP 2GW8A 1QE1B 2FGCA 3M8PA 2ZJRQ 4QJVA 1XMOJ 1S0MA 4JV1A 2BKPA 2B8QA 3CDEA 2F40A 2V69A 3D1HA 4ED5A 1O8BA 2HHVA 4KT0C 3IBCB 2CADA 2HQIA 3TUZC 3WBZA 2Z2YB 1LKZA 2CJKA 4OV1A 1T03A 2KXFA 3O2IA 3HVTB 2E5JA 4NI2A 3G8TA 2OTLS 3HSGA 3SSRA 4F0KA 1DRZA 4JI8F 3AHPA 2Z0GA 2O5DA 1WKLA 1KOHA 2GMJA 3M1VB 3M30A 4AD6A 3R5BA 4CLUA 2RMLA 2RE1A 3CGIA 4CM0A 1BMQB 1S59A 1BQMB 1E6YA 3CCZA 4DUYJ 1JQGA 1V9OA 4A48A 1SKRA 2W1BA 2C2ZB 2UU9J 2X3DA 3BO2A 1LFPA 2RF2B 3P3DA 2VA3A 1S9FA 2HMIA 1AFIA 2P2CB 2CPFA 2DYAA 4FP9A 3EUNA 1IM4A 3M8QA 4G1QB 4XAKA 3PXGa 3PW5A 4CT9A 2XC9A 2G1HA 2Y1LB 5K20B 1SJ1A 1VHIA 1RP5A 3V6HA 4I7FB 1P6TA 1EETA 4J9VA 1HNIB 2EEYA 1D09B 1RHKB 1S12A 2V4JA 3BV8A 1FESA 4YOEA 3BR9A 1LW2B 4IH7A 1K47A 2MLZA 1Y5LB 3GIJA 2DGOA 1KBRA 1UW9A 2BEFA 1Y11A 5H9EK 3ZZ0A 2RDIA 5IFMA 4GRSA 4RNFA 1WG4A 2XO6A 4DR4F 5DDRC 4RW7A 3MMBA 4USWA 1U47A 1U1RA 2ROPA 3OD2A 2YWFA 1FRJA 4XPEA 5KFFA 4P10A 3S1TA 3LW5C 3I0RB 2H9ZA 3CULA 1HD1A 1JMTA 3KNAA 2ZE2A 2ZKUA 2ZH2A 4JV5F 2CPYA 2HVEA 4C7QA 1L3TA 3TEGA 4ZCIA 4LQ3A 2JWNA 4ZVTB 1N5YA 3K57A 3KUHA 1HYSB 4Y65A 1S7HA 1YWXA 3MMAA 4ATNA 2ZH9A 1C0UA 4GKKF 1N34J 5KG5A 1A9NB 3JSBA 3UVJA 4HKQA 2EW9A 2F1FA 1S48A 1S1VB 2WHOA 2LQBA 1SXLA 2HWIA 2CPHA 3M8PB 3BQ1A 1NJIT 5J2MA 1GK8A 3CEDA 4LSLA 2CPJA 2FB0A 4TQRA 4MYUA 1WKKA 3QT7A 5D3GA 1IR1A 2ZZTA 3I82A 5CCLA 4NEYA 4PQAA 5HJYA 2UXBF 2C2KB 3HHKA 1MWQA 3W9JA 1T03B 2VBXA 1JJ4A 2XS5A 2N7YA 3ZZYA 1SBRA 2DGTA 4NI2B 3QSYB 4EBCA 2J6UA 1SL2A 1SB6A 4CNYA 3KHHA 1AW0A 1Y0HA 3MM8A 1RAJA 3UWTA 5G0RA 4JI0J 2CQCA 5HP1B 3M30B 3CCUS 1IKXB 1YJRA 1D8YA 3MWBA 5ETRA 3JTOA 1E6YB 3Q8RB 5IT9U 1VK8A 4TYAA 4USTA 2YVSA 3DU6A 1QD1A 3THPA 4Q44A 5HL7Q 3LP1A 5CYQA 1LFWA 1UVLA 5EN1A 4FPIA 1VBXA 4V19J 2FJXA 3CXCR 1R0CB 1RI7A 2SXLA 1JXVA 2IVFB 5E41A 4MYTA 2VBZA 3AOAA 2XMWA 3BPDA 5FDLA 4DV5J 2XSFA 1K44A 2EXUA 4P7TA 1G6BA 1NH7A 4IG0A 2IM0A 3LOUA 5F8IA 4OHZA 3BO3A 3M8QB 3PJXA 3HDSA 5AXNA 1LOUA 4JI4J 1RT4A 1WOOA 2MZJA 5C42B 2RSQA 1FVQA 1EETB 4TLQA 2DRAA 1TELA 2F4VF 1VBZA 4KSEB 1SJRA 2V4JB 3NL0A 3QIPA 2RILA 4DV2F 5ETQA 1X4EA 4ECXA 2IJNA 4OYBA 2WVFA 2VOOA 2XCPA 1NJXA 1LWFA 2KN4A 1W2IA 3TZXA 2MQQA 1RCOB 5F8NA 4ZVHA 4WPAA 3V4MA 4LFBF 4V1Ak 1YVFA 4DMZA 3KOAA 3IBWA 2M9KA 3Q86A 4RW7B 4TY9A 1YJWS 4ELUA 4E98A 2VFVA 3VHQA 3MMBB 1SC3B 5KFVA 1EKSA 4JYAF 1ZOTA 4C0OC 2GIRA 2R7UA 4RW9A 1TR0A 3V6DA 4RNOA 1S77D 2ZE2B 5IOLA 3OV7A 1UZDA 3NKYA 2KTQA 2FUG9 5HK4A 5AXMA 4FPRA 1YGYA 3NRBA 3UNYA 4C3MA 1N5YB 1JNRB 2GJIA 4ZN3A 4EO8A 1BGXT 1RJJA 4USJC 5B09A 5GMKa 1C0UB 3JB9k 3K59A 1QSSA 2RD5C 3UVJB 4KV8A 5L9NA 3CC7S 3PTWA 1VQKS 1EARA 5F0WA 3K5LA 4H4KC 3RTVA 1CEZA 1WORA 2O1PA 5J2MB 2BKOA 3OXLA 4LSLB 1IBKF 2HVDA 4GKKJ 4M1KA 2HFSA 1FA0A 1LWEA 3H5SA 4OZLA 3KLGA 4RX6A 3FBFA 4JI5F 2GNKA 3D3BJ 1JLEA 1JLQA 2YNHA 1O0PA 3MM8B 1SJFA 2UXBJ 3Q8VA 1GT8A 2FJAB 2ZVSA 3DRPA 5DS7A 1UZHA 5G0RB 3K5NA 2YNIA 4U9RA 2DNKA 2QZ8A 3TJ9A 1QVGR 3OTDA 2QA4S 2DRBA 4NLUA 3QGGA 5ETOA 3TI0A 1HI0P 4LVNP 3VWSA 4RBTA 4ES3A 4KJIA 1JXEA 1D9FA 4JI3J 1FKAF 3LP1B 5CYQB 5D78A 3OJUA 3TZZA 2M88A 2PSZA 1H3DA 2AF6A 4HDHA 2XQCA 1BE4A 1JLFA 2BE2B 3BN4A 1HQEA 1TK5A 1VQOS 3B4DA 4ED1A 5FDLB 2PI4A 2R2RA 3OQ2A 3H59A 4IG0B 2C3MA 2PGCA 2VJUA 3W1YC 4CLKA 4DSJA 1H2TZ 4AQYF 2QGFB 2MSSA 1RT4B 3BGRA 2OFHX 3CCTA 3H5YA 1MU2A 3KHRA 5D4LA 2OD6A 1S9GB 3QIPB 1U0SA 4HHHA 3FDSA 4ZLPA 3SEOA 1LWFB 1TMJA 4MIBA 2XY5A 1KSPA 4I56A 1RKJA 4DV4F 2F4VJ 2B5JA 4ZDNA 4YB6A 1T0TV 1T11A 2Y8YA 2RAQA 3ET6A 5CD4H 3SCKE 2FVRA 2QV6A 3FEZA 4I69A 5J2NA 5HSPA 4LBHA 2CDQA 4DV2J 1TL1A 2HRTA 3QQCD 2FZKB 4J9UE 1L3UA 1X9SA 2NZ4A 3V6DB 4ZP9A 4Z7YA 4R5PA 5LT5A 2IHR1 5BR8F 4LFBJ 4MFBA 3A8IA 4CH0S 2WZ1A 4ZVFA 3CWJA 4DR7J 4JYAJ 2J9DA 2VF3A 2KM8C 1FKPA 2H3EB 3ZFVA 5JVHQ 4LFAF 4F4XA 2Y1JA 3GP9A 2ZBRA 4KPCA 2P6SA 3CMAS 2J0XA 1UJ6A 3AT1B 4KV8B 2B4OA 3PRBA 1CLFA 4UZBA 3H5XA 2NPIA 2DKOB 3V5RA 4DR2F 2PMHA 2HQCA 2CZVC 1WI8A 4LIRA 2EPIA 3GFHA 1C1BB 2E1AA 2K1RA 1SIZA 2B51A 4B17A 3M6VA 5CCMA 1S1WA 5F0UA 1LWEB 1S7IA 2FC8A 4LF1A 1VLOA 2NXUA 3MURP 4RU9A 1J2VA 2BW7A 3NS5A 1IKVA 1IM6A 3KLGB 3EVMA 4ECUA 4QPXA 2HGMA 1IBKJ 3GJQB 5LMUJ 2FZCB 1JLEB 1WC3A 2DEIA 5H9FJ 2BJEA 4DHVA 2YNHB 3J80U 3JTNA 4UY85 1X7VA 3ILIA 3DRPB 3IS9A 1JLAA 3C3LA 5E3RA 3FJ2A 2PN6A 4NLPA 1HI8A 2V94A 1BUXA 1D9AA 4OYPA 4ED4A 1XEZA 2JC1A 3G2XA 4ILLA 2GGPA 4X4QA 2ZH8A 2J9DE 1PIEA 3HVWA 4AUKA 3S7RA 3BR8A 3NNHA 2QLJB 4PZVA 1VR6A 3HJVA 3G87A 1VOMA 1JLFB 2C3OA 5K8OA 1HQEB 4KHPJ 1B70B 2ZNYA 4G1IA 1GTEA 3SIPB 4XDCA 2BM1A 3NCPA 3DFEA 4KGKA 2LQ5A 1Y00A 2RU9A 4FYVB 2LA6A 1Y9OA 4HH1A 1ZETA 2MKKA 1TL3A 3MGJA 1WC6A 5IT0A 4DPOA 4OX8A 4MKYA 3QSIA 3BGRB 1WDTA 1NK6A 2IM2A 1IWAA 4DUZF 2HWTA 5DGAA 1MU2B 4PWWA 2DO4A 4OLPA 5JXSA 1YLXA 3G8SA 4WF9Q 4OHWA 4DV7F 3W3SA 4CZCA 5KT4A 3KK3A 4A4JA 3SFGA 3TUJC 5L1KA 1CJUA 3O6QA 2BANA 4NZ7A 4HHJA 2B5JB 1XTZA 5A6PA 1HNWF 1JWWA 2L41A 3MMJA
chains in the Genus database with same CATH topology
4KBIA 4K5SA 3UR0A 1N56A 3CD0A 3ZZZA 3SCLE 5HO4A 1S99A 4B3MF 1HI1A 4E8UA 3G6ES 1R0AA 3CDWA 5J2NB 2KHCA 2L3MA 4F4WA 4I2PA 3N01A 3CE8A 1TL4A 1TL1B 3I31A 2IFXA 4I0WA 4ZP6A 1N34F 1TV6B 2LEAA 4DN0A 1JKHB 4N47A 4A47A 2HIQA 3CCSS 4JI6F 4TYBA 2FJBB 3FZ2A 2ILZA 5HQ8A 2YX4A 4AFFA 3KMSA 2LXUA 2OMOA 4YR0A 3T5JA 4F26A 1OQ3A 2P9CA 2M5YA 2R7SA 3CTRA 3PACA 3RBDA 2VQFF 4RBUA 2UUAF 1HPZB 1WTBA 3S01A 1SV5B 5B0FA 1Y7PA 3KJVA 1WHYA 3QGHA 4DG1B 4R5PB 2JLEA 2I38A 1X5PA 3LUYA 4ILRA 2L08A 1UL3A 4TU9A 1DTQB 3GIKA 4DQQA 4J9PA 4DL3A 4F2SA 1S6PB 4LF9F 4MFBB 1N4LA 4WK1A 2AU0A 3OFEA 1K9MT 4HDGA 3MMAB 5LXYA 4XK8C 5KT5A 2JHEA 2W9CA 3D54A 1FKOB 2KB2A 4ECSA 2OD4A 2O66A 5H1SV 1N0UA 4ED2A 4CO4A 3O8WA 2XNQA 2KI2A 3BN7A 5B0EA 3FGVA 1S1XB 2QSWA 3E51A 2ZH6A 5EGYA 2FC9A 5KFJA 1Z1ZA 3VAGA 1FKPB 2DCLA 5KFEA 2WSFC 2EK6A 3E01A 3OVBA 2DNGA 3K58A 4GC6A 4QU7A 3VAKA 5IXUA 3MM5A 4ICLA 2ZH5A 2W9AA 2CJQA 1S76D 2XLIA 1YJTA 4WFBQ 5KFSA 3KG4A 4DSLA 4X2BA 3SV4A 1VQLS 2YKMA 3VAJA 3TAMB 1U26A 2EFPA 2LYVA 3I0SA 4FVMA 4OLOA 1WEZA 2HLTA 4JBCA 2VFRA 2OJ3A 1GXTA 4C3LA 3DM2A 1HQUB 4EGLA 1BQXA 4DQIA 2NLWA 2Q6CA 4E0DA 2EC0A 5CYMB 2QMWA 1FDDA 3DLEB 5KFMA 1CVJA 2XS2A 4DR5F 3QLHB 3GE9A 5D3GB 2F8HA 2BXJA 5KFZA 1JJ2R 4CT8A 3L3CA 3L7OA 2JLFA 2P5VA 3FSXA 1NH8A 2DHAA 3IR6B 2UUTA 2EBEA 3TYTA 5BJRA 3DYAB 3QPIA 4Y2IA 1FRIA 2C3PA 2XI3A 4Q0BB 3MUTP 4U7CA 2CQBA 1OQ6A 1OO0B 1WHWA 3D0IE 4RNHA 4NXMF 1IKWB 1LK5A 1TVRA 4O3QA 1KONA 2BACA 3QJPA 1AUDA 2XWXA 2K1RB 3V81B 4NCBA 2MQLA 1G7CB 4JI0F 2B7CB 2K2PA 2B4UA 2VPYB 4JI7F 2ERRA 4ECTA 5KFBA 4K4WA 4DV0F 4L72B 4RKUC 3T6JA 5F3ZA 2N7CA 4ELTA 1U1NA 1S1WB 4QPTA 1JXLA 3B4MA 2MQOA 1KRPA 1U24A 3SXLA 2JEJA 4FYDA 2K7KA 1FD8A 3THTA 3A1YG 2OO4A 1FEEA 2IVMA 4H4KA 4F3OA 1OWXA 4IYQA 5KT6A 3DLHA 2D9OA 3SI8A 4BWJA 3JSMB 5D4NA 3SDEB 2ZKTA 2J0QD 4TY8B 1IKVB 1YJ9S 5DG8A 5JVGQ 4NLWA 3GG0A 2QMXA 3MFHA 3PKYA 3W2VA 3SV3A 2CJ9A 1KLMB 3AJ2A 4PUOA 1FXDA 2YX7A 3QGPA 1RTDA 5HI7A 5J2PB 2WBRA 1X9WA 1S6OA 2MKIA 4RUCA 4IFVA 4F50A 1S10A 4RLEA 5HP1A 4G1PA 3RAQA 2Q43A 1IKXA 5KFDA 2AJ1A 2ADCA 1XNRF 3CUNA 2YWKA 3MEDB 5KFCA 5K14A 3HT3A 1IKYA 4PKDB 2BA9A 4PCQA 1JLCB 2OSRA 4OI1A 2UVVA 2XSJB 4ZPCA 5KG1A 1TKDA 2L48A 4O3NA 1X0PA 1YJVA 2XBPA 4DV5F 2E7WA 3C6TB 4NX9A 2KG0A 2DNPA 2OPRA 1MMNA 3MD1A 2J0SD 5F8JA 2JSXA 5HMYA 4DFJA 1R43A 1MWYA 2F9JA 5KFNA 4TU7A 3IS9B 1NRKA 5I42A 4YHHF 2YWHA 4I64A 1VQ6S 2DNZA 2KT2A 2PEHA 4OZNA 3KLVA 2HGLA 2VKRA 1K0TA 2ZDOA 3AAWB 4DFKA 1K0VA 2MMYA 4JI4F 1BQNA 2FJVA 1YJNS 3GIMA 2LDIA 3IFEA 1TKXB 2V9WA 3V2UC 4P2SA 2RUGA 3DRYA 2KDOA 1MSWD 1HBOB 1MWZA 2BQRA 2GGPB 3EXCX 2R7RA 3EZ5A 1KQKA 4X64F 3GV7B 2NQPA 4IQXA 4AXIA 3WDOA 3AQOA 5IZHA 2BUNA 1S6QA 2BRLA 1R8AA 2PO4A 1ELOA 3PDNA 4MKAA 3OLBA 5EDWA 3MEGB 4QCLA 2C28A 3Q8SB 1KFSA 2ABYA 3DI6A 3OL6A 1S1UB 2D3UA 4F4KA 5KFPA 1N5SA 5CHCB 1A7GE 4NYPA 5U47A 1CG2A 3IG1A 5DLGA 2CQDA 4PR6A 1QJHA 1NK5A 1HHTP 2R4FA 3BSOA 2GMLA 1KS2A 5EWGA 2AJQA 1S9EA 1FRXA 1FXLA 4YDXA 2DISA 3DLKA 5C42A 5C5JA 3BJYA 4JUZA 1GAOA 5IM0A 4QWDA 4H4MA 1U45A 4K4XA 3VZIA 2RKIA 2A2CA 3FFIA 5L38A 1FRKA 3IGVA 3MUVP 1Y5NB 2YQ3A 2YKQA 2BYCA 3M32A 5C25B 2KZZA 4B08A 2RNEA 1S1TB 2BR0A 4IG3B 1TL3B 3UW1A 5LXRA 3QJJA 5KG2A 1N5TA 1LW0A 3HK2A 5I3PA 4PPZA 1VC5A 4P7VA 1RT6B 3BQ0A 1APSA 3CD6S 5IT9Y 3MR2A 5L9XA 4IFYB 2GHPA 5CH7B 3W2WB 2ZFHA 5A8RB 5A2QY 2HRUA 2ATLA 3I32A 4LSNB 2CQ1A 5CQGA 3FMBA 1HNVA 3W7BA 3J7A1 4NA3A 1KNZA 3GB0A 2B9XA 2L9NA 3HVAA 3I5AA 5AXKA 3BS9A 4DF8A 4Y2MA 4ETXA 2E1CA 3CVKA 5LSLA 1T3OA 3MMCA 1N52B 3KG0A 1IJEB 3MZIA 3I5BA 3V4IB 1IBMF 3C6UA 1IBLF 3LP2B 4FNIA 2KVIA 3KKFA 3LWLA 1X4GA 5M2RA 2VG5B 1WHXA 2XCAA 3MECB 2CPXA 1VC0A 1VHFA 2AYEA 4NLTA 5F8MA 1RT7A 4KHMA 2DPJA 1UA1A 5KFGA 3QGIA 3CMES 2VONA 5K8NA 5K5MA 3KK3B 3EYZA 4A8SA 4LF8F 1NKCA 2QA4G 4CO2A 4OHXA 5GAGI 3TAPA 2MKCA 1Q4RA 2O67A 2DPIA 5HN0A 2X1BA 3P5TL 3X1LB 2W8LA 4FS1A 3OL7A 2DB1A 4DN9A 4CO1A 2BANB 1XK8A 2WTFA 3VAIA 1VQ5S 1TQLA 4RW9B 4LT6A 4QIEA 3O1LA 4K4UA 4DFPA 1NKBA 3RYLA 1RT5A 2EG2A 3BSAA 4NA1A 4DWIA 3N6NA 2OPSA 2XULA 1V3RA 2YKPA 3IRWP 1DLOA 3M05A 1R0AB 3KK2A 4OI0A 1UVIA 2VQEF 2HHUA 3CJ5A 2BJDA 4I2PB 4J9QA 1GXLA 1ZBTA 1QAJA 4B3SF 2R2SA 2HG4A 3DOKA 1LXNA 4YR2A 1WTFA 2BBEA 3FNNA 4URQU 1O5JA 5KFLA 1P9QC 3MFIA 3JTPA 2EBGA 2PC6A 2IAJA 2M8HA 3D1QA 4TQSA 3D2WA 2M52A 3WC2A 4U7UK 1N33F 1T94A 2DT9A 2WRMA 2UP1A 4IRDA 3GFZA 1U1MA 2IRYA 4RW8A 1VIOA 3KJVB 3IR7B 3ISZA 3LAKA 3OTOF 2F8MA 1VC6A 1TP7A 2FLOA 3M9NB 3MAHA 4Y2CA 2DR9A 1HBNA 2HFOA 4RNNA 3VAMA 1RA7A 3UCZP 2OIHA 2CG4A 4PXEA 2VFTA 2M7SA 1FE4A 1RT3A 5LSRA 2M8DB 2I1RA 5HBMA 2R7XA 1NAQA 2HHXA 2W9CB 4J37A 2MPUA 2NYIA 1T8EA 5T41A 4AL6A 5DQGA 4I6AA 4PXCA 4KB7A 1VIXA 2HZCA 4FXVA 4WFYA 2DH7A 2EKYA 1TFYA 1KVJA 2GQ2A 2AYMA 2MGZA 4USIA 1R8PA 5F9NA 3MEEA 5KFIA 1JB0C 4YEAA 3QZ7A 5GADI 4KPYA 5DGBA 3JAMY 4UUWA 5GAEU 2QIFA 4K4YA 1NK0A 5CYJA 2Y1RI 3DXSX 2E9RX 2HNZA 1OPZA 3MM5B 4ICLB 4OI3A 4OQJA 3GQCA 1NK8A 2IYGA 4RWWA 4AE5A 4KGMA 6FDRA 1PGZA 4HL9A 2GHVC 4M5DB 2GX8A 5J1EB 2YKMB 5FD1A 2U2FA 3I0SB 4TNOA 5KFWA 3BM7A 2CKWA 4NMLA 4NLRA 3N6LA 1H6KX 2XHWA 2BQ3A 1T3NA 2KYXA 3N79A 4RWXA 4CNZA 4Q43A 2JOQA 5MAOA 5HMXA 4QWEA 2DHXA 4NLSA 2IM1A 1WELA 3HVTA 4RNMA 1S6UA 2YTCA 3RB3A 4I2QA 2CQIA 2BOPA 5JJBA 1U4BA 4NYZA 2DBBA 1HBUA 2D3ZA 4MIAA 5D77A 3TR5A 1R8HA 4Y00A 2G9OA 4DUYF 1TK8A 3FMWA 2J9CA 1F0XA 3UI3A 4CI0B 1RTJA 4NWBA 3RR7A 4KFBA 3C2PA 4ED8A 3ITHA 4DL4A 2MQPA 2XI2A 4OHVA 1TKTA 3NGDA 2AGQA 3QAEA 1NNDA 1RYSA 2VKZG 2APOA 4W92B 1F5BA 4QOTA 2DNMA 2DR8A 3QAUA 2PFFB 2AYGA 4RW4A 3ISNC 1U48A 4EFAC 4OMFG 3SCJE 3RRGA 2WK4A 2JH3A 1RA6A 2CPIA 4NLYA 4R0EA 4JOUA 3CCES 4KO0A 1HFEL 2ZOGA 3M1VA 1YRUA 4WXOA 4WE1A 4B9LA 3IN5A 1Q16B 2RRAA 1N88A 4YY3F 3C66A 2LXFA 1L3KA 1JLQB 1H2VZ 1P1LA 3DMJA 2RS8A 5DQIA 1BQMA 2QLWA 4JI3F 1WNEA 3GYXB 4IH5A 4TN2A 4DQPA 3W2VB 4OI4A 3UDCA 4PUOB 3H20A 2GIQA 2VASA 3DLJA 5E3CA 3RAMA 1OSDA 1RTDB 1X4HA 2DVIA 1OS5A 3NG8A 4FF2A 3Q8QB 5J1PA 1DJ0A 2YNIB 1M1KT 4FBTA 3HKZD 1MW7A 4HEA9 2FGOA 5BYQA 3K8WA 2E5LF 2VZ9A 2LEPA 3A8EA 1IXKA 4C4WA 3HZGA 2XNRA 2P9EA 5K14B 3OLAA 1IKYB 2HAIA 7FD1A 3T1YF 4NOHA 3CDBA 4K4TA 1U8SA 3HFKA 5LJ5Y 5A6WA 4ZCMA 3MOJB 5CZXA 5KFOA 3LPYA 4QWCA 5BYRA 2OPRB 2RF2A 3K5PA 1R8BA 3NAHA 2HHWA 4C8MA 5KG0A 4ECYA 1U1OA 3SSQA 2M3DA 1FK9A 5I42B 2OPPA 3OTBA 3PJWA 1TZ0A 2EFVA 2DGWA 2XZWA 4D3GA 2H5EA 4YMEA 3DU5A 3VZHA 3QWPA 1BQNB 1HW8A 3LALA 2FLLA 1VFJA 4PG5A 3KHGA 3HMJG 4DQRA 3Q2SC 1K73T 1GX6A 4KRWA 3Q2TC 2C2RA 2IVYA 2ASDA 4IO1A 4IOCQ 3LWMA 2BE2A 2QO3A 3DLGA 4KR0B 4O3PA 3FSYA 3GSDA 1X4CA 3MEKA 4NCGA 4I4BA 1VQPS 3UQSA 1HBMA 3WC0A 5KFKA 4W90B 3PFEA 2FHJD 4MAKA 1U7LA 4WZMA 3CCJS 3RAXA 3R1LA 3M8RA 2CQGA 2CQ4A 2XMJA 1T05A 5LSOA 1FRLA 3DXBA 2FD2A 2V4RA 4PQUB 1C1CA 4X4RA 1FEHA 5HROA 4N41A 4I7FA 1ZPVA 2MJNA 1HNIA 4QQBA 2XY6A 4BC7A 4X4SA 2CPEA 3EX7B 3DI6B 2HS4A 1GQEA 3K0JA 4XIUA 3RU0A 3T1HF 1CPZA 2Z2LA 3ULHA 1SI9A 2VG6A 4BCAA 3KMQA 1MROB 3MM9A 2RIJA 1ZAWA 4IKAA 3BF4A 3IG1B 5A0YA 2DIVA 3N4WA 2MZSA 4WU2A 3UPFA 2K3KA 4QIWD 2R7OA 3CCWA 4OZJA 2JVRA 5DO2A 3UR3C 3J81Y 1LW2A 4B02A 1DURA 1S9EB 2OSQA 5B0BA 2C22A 3RZAA 2W7AA 2D74B 3DLKB 3LO3A 1JJHA 2CYYA 3ICLA 4H4MB 2JZ5A 1YHQS 1Q86T 1DQAA 3PFOA 1DTTA 2RKIB 2VPXB 3F41A 3C46A 1YQHA 2FJWA 1X5TA 3RW6A 2QLXA 1FXRA 3M32B 3LAMA 2HHPA 5K9FA 1Q8BA 3UD3P 4C8YA 2NSBA 2D3OR 1Z2LA 1S9GA 2RQ4A 3D1OA 1IQTA 5C24A 4YDDB 3TOQA 4MK8A 3PY8A 5DDPC 5HMWA 5FLXY 1RISA 2N3OA 3BSCA 4HT5A 1N8RT 4LUBA 3ZZPA 4LMZA 3CCMS 4DSEA 2XLKA 3HXMA 3IR5B 5F8LA 3GYNA 1HNXF 3QZ8A 3SYZA 1KTQA 1OIAA 3E3XA 2PA8D 1UVMA 3U27A 1HNVB 2ILYA 3FCHA 3HPOA 2ZD1A 1SUQA 2KU7A 2HHQA 2U1AA 2WW8A 2UXCF 3KFWX 4YQWA 1F2GA 1YI2S 4H54A 1VQ8S 3IO1A 4Q8EA 3MMCB 1I94F 3MPYA 1UEUA 3C6UB 4Q45A 2QYCA 1ZM2A 2EFNA 2VPZB 3M2VA 5SUHA 3Q0AA 4OZ5A 4DS5A 3PM9A 4KAIA 4B3TF 2OP5A 2K8GA 4WFAQ 4DSKA 3I0RA 4K4VA 4EEYA 4F2RA 1WG1A 1J5EF 2M70A 3QO9A 3PX0A 1RT7B 4IDKA 2JVOA 4DSIA 4YB1P 2VPWB 4HTJA 2A2DA 1C4CA 2R9LA 1FRMA 2UVUA 4K2XA 1M5PC 2G13A 2CVEA 1S79A 2YH1A 4DR7F 5DG9A 3IWNC 3TNVA 4I1TA 2GC8A 4LF4F 2WBMA 5J2QA 4QWBA 3AQPA 2GV1A 4LQ9A 2B4VA 1I1GA 2MKSA 4UY8T 3DHXA 2JFDA 1N5VA 2G0CA 4ILMA 2YH0A 2VA2A 3NNAA 5L1JA 2I8EA 2MZRA 1RT5B 4OZ0A 5GAHI 2ROEA 2OPSB 3I6PA 4HH0A 2DHSA 1FVSA 1DLOB 2YKAA 1SL1A 2XWYA 3KK2B 1GTHA 1HWIA 4EBEA 2N4CA 4Y6IA 1HYSA 1QTMA 1RK8A 4X4TA 4CH1A 2IBKA 2CJAA 4CIOA 2VB6A 3OTCA 3OXFA 4DOZA 2B7BB 4P6QA 4U67Q 1F5AA 3DOKB 1HD0A 4FZVA 1R31A 3BREA 2IA6A 3NNCA 4PPDA 3ZC4A 1WEYA 3FQLA 2IAJB 4OX9F 4NA2A 1DFDA 4TU8A 3X3UA 4Z2XA 2YX1A 4ZS6A 4HVZA 4WFXA 1NB7A 3OHAA 5SZTA 4NLDA 1QM9A 4HI1A 2B0GA 3DOMA 3J7ZT 3R5DA 1HBNB 1S1VA 3KNGA 2DO0A 2HNDA 2LXIA 5HMZA 1FERA 2R2UA 1CC8A 1FTCA 1VQYA 4ZPDA 2J7UA 4LVOP 1RT3B 2GW8A 4LF5F 4NLGA 4OJ3A 3H5UA <