4HT7A

Co2 concentrating mechanism protein p, ccmp form 2
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
203
structure length
203
Chain Sequence
b'VELRSYVYLDNLQRQHASYIGTVATGFLTLPGDASVWIEISPGIEINRMMDIALKAAVVRPGVQFIERLYGLMEVHASNQGEVREAGRAVLSALGLTERDRLKPKIVSSQIIRNIDAHQAQLINRQRRGQMLLAGETLYVLEVQPAAYAALAANEAEKAALINILQVSAIGSFGRLFLGGEERDIIAGSRAAVAALENLSGRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CO2 concentrating mechanism protein P
molecule tags Protein binding
source organism Synechococcus elongatus
publication title The structure of CcmP, a tandem bacterial microcompartment domain protein from the beta-carboxysome, forms a subcompartment within a microcompartment.
pubmed doi rcsb
total genus 62
structure length 203
sequence length 203
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2012-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ht7A01
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ht7A02
3F56A 4HT7A 3I87A 3I82A 5SUHA 5LSRA 4HT5A 5L39A 3GFHA 5LT5A 3U27A 3MPVA 3FCHA
chains in the Genus database with same CATH superfamily
2FJAB 4Y2MA 1GQEA 3RB3A 5T7LA 3IGVA 3NCQA 4F0MA 2JLEA 4QYZK 4Q43A 3RG6A 5IV3A 1R0AB 3PRBA 3DDIA 3GV7B 3OTBA 2C3YA 1X4HA 4RKUC 5KFGA 2E5IA 3VAFA 2AMCB 5G0RB 1VQ5S 2A0FB 5L38A 1EQ0A 3PFEA 2LVWA 1WC1A 3QZ7A 3S6EA 3JYTB 1U8WA 1M5VC 3M32B 3SSSA 1PJ6A 3VAMA 3JSMB 1JLEB 1N36F 2UXDF 4GKJF 2KVIA 2J5AA 3KDNA 4ATNA 2VHGA 1GMWD 4QCLA 5L1IA 1ZS6A 1SV5A 1HLWA 4N5SA 1JK9B 1X5OA 2KT3A 2KZMA 1RTZA 5CYMA 1C0UA 2J9DE 3FQLA 3EVWA 4Q2LA 4XDCA 3UWTA 2RHQB 2YNIA 3EMTA 3TVYA 5A76A 2DXDA 1SJ1A 2HAFA 1D09B 3AA8A 4ED6A 4ZLLA 1S4EA 4ZVHA 2I5JA 1SI9A 1Y5LB 5B0AA 4OJ1A 4A8OA 1WTBA 1FFSB 1S1WA 1EIYB 2EFOA 4GC7A 1KLNA 4RU2A 1BQXA 2UU9F 1RWWB 2MY8A 3L4BC 1NLKL 2YWFA 1RTJB 2FYXA 3LTOA 4NLQA 1N0VC 4WE1A 1MROB 4P2MA 4KAIA 3BGOP 4B08A 4R5PA 3CCRS 4CM0A 1RK8A 3HFVA 3WX8A 4XPEA 4DLEA 3I0SB 3CJ2A 1MNEA 4G1QB 2CJQA 1VQ9S 2Q66A 3LP2B 2MZ1A 5LMUJ 2J7KA 4JI4J 1VJWA 4QYZJ 1WTFA 1FO1A 5DG9A 2BJ1A 2KXNB 3QFHA 2CQDA 1S9GA 3KFWX 1FKOB 1UKUA 2QL7B 1WOPA 2QTWA 4WKYA 3GV5B 3L7UA 4ZVFA 2WRMA 2X1BA 4GKJJ 2BEFA 2VV5A 4O44A 5KTQA 4C4WA 5LOQA 1FJGF 4USJC 2B6AA 2IM0A 1HNZF 4I6AA 5GAGU 2ILZA 1NB2A 2PT0A 1HWIA 4NL5A 2VF3A 3NWRA 3ETMA 4ECTA 3M2RB 3Q8YA 4B9NA 5HQ8A 3PACA 1OQ6A 4QIVA 1BC6A 3W9JA 4GVBB 5B0EA 1HMVA 3V4MA 1PAEX 3HSDA 2POKA 4FS1A 3PG9A 1XMOF 5KFKA 1NDKA 5C42B 3KKFA 1TKXA 3C14B 1G3OA 1X60A 3FEXB 1MU2A 3RYLA 3GLJA 3CE8A 1VC5A 1IBMF 4N47A 4CIOA 3DOLA 1NJYA 3D54A 5DO2A 2Y1IA 3PKMA 1Y0HA 4M5KA 2G13A 4IQXA 3D6HB 2VG6B 4LQ3A 4PQUB 1GXTA 4DR4F 3ZTPA 1IBKF 4CYUA 2R4FA 1C4CA 3D3BJ 2H48B 4OZ2A 2D3O1 1FDBA 2Z30B 1NNDA 2HK2A 4RPFA 2HW3A 4BHQA 5K8PA 4CLKA 2LQ8A 1XNQJ 5CZVA 1TL7A 4EWTA 1GXUA 2YY3A 3PJ9A 4JV2A 5C24A 2BE7D 3D1OA 4HHJA 3KLVA 2QL9B 2F8EX 2RS8A 1JLEA 2E5JA 4DUTA 5HK4A 1RGVA 2V4JA 2FLPA 3GYNA 1RT2B 3OR2A 1FNXH 1ROFA 5MLCV 4J9PA 2B8PA 2OEKA 1SB6A 3BKTA 1ZAWA 3GTYX 3T41A 3THTA 5C2CA 2R9LA 3EE3A 4Q0BA 3N79A 1VBYA 3MDFA 2J0WA 3Q8QB 2ZUAA 5L9NA 4A46A 2AX1A 1R0CB 5CH7B 1APSA 3MEEA 4LSLB 4F36A 2LDIA 3DLKB 2GFFA 2CNNB 1UFKA 2HWHA 3N5BA 4C8MA 3QRQA 4K0KJ 2B9YA 3F44A 2YX1A 3HDSA 5J1PA 1GX6A 3CVKA 3KHRA 4FP9A 4WFZA 2E5LJ 2ZH3A 1R8HA 3BDEA 3DLEA 1AFIA 1S0MA 3NWGA 3J80Y 1X4FA 2VODA 5HJXA 4ILLA 2PFFB 1VRUA 4F4AA 2CQIA 1XK8A 3MUTP 1QSLA 5KG5A 3H42A 5ETKA 1X7VA 2QYGA 3B6BA 3KNGA 3I0SA 3NGRA 2NCKL 5DRKA 2IBKA 2YBVA 4F7VA 5CHCB 3IRXA 4ENOA 1ZZNA 2P9GA 2ZH9A 2DNMA 3JSMA 5D8HB 1RWOB 4DV0F 3D3CJ 2LP4A 4TNOA 1FKPB 5KOXA 2E29A 3ZC4A 5AE2A 1UFWA 3BDPA 1NDCA 2H5IB 3LF0A 5I3UA 2FGOA 4W4MA 1NSQA 3W9IA 1HR0F 3C15A 2HHTA 1UW9A 4ANCA 2EG2A 3RUBL 5FJ4A 1S1VA 1F9HA 3HI9A 1DAXA 2RUGA 3Q23A 3SZ2A 4Y00A 3M1VA 3P3DA 3A1YG 4G65A 3PJXA 1M5OC 4N8OA 2UXBJ 2IA0A 1DQ8A 2R2RA 3D4JA 1EQMA 2OUGA 3GR1A 5JVGQ 1U1NA 2BANA 2IVYA 4IH7A 4RL1A 5I4MA 2XNRA 3KLIA 5HLFA 3FKBA 5HANA 4E2FB 1YJRA 4A48A 3G8SA 4LF5J 2HHXA 4K4YA 2IM1A 2DHSA 4LF8F 3HSJA 2RB7A 2ZBRA 4NLWA 3LGMA 4DQIA 2VQEF 5D4OA 3LH2S 4M5JA 2E5LF 3PX0A 4W92B 4ED3A 1GMVA 1IR1A 1REVB 4LR7A 2R7TA 4QWAA 3K7RA 1E6YB 3CCLS 1LOUA 4YB5A 2NSBA 3WHIA 1NK5A 2XYPB 4FZVA 3GONA 5D0HA 2MKIA 1S0OA 1RA6A 2W7OA 1R7IA 1X4DA 3DGVA 3NP5A 1FD8A 5D4NA 1KQFB 2MZRA 1VISA 4O3NA 3TO8A 5HQLA 2BQRA 2MHNA 4JV1A 2ZBIA 2G2ZA 2PMWA 2XSJB 3ZTSA 3FBFA 5ETRA 3VALA 4ANEA 5F8JA 4LF6J 1KVJA 3NOCA 4PAAA 3QGIA 3KUEA 5M2PA 2B3TB 1TQLA 2LEBA 4ICLA 1RLCL 4K4ZA 3SSRA 3PW4A 2I0XA 2BJDA 2YX4A 3OQ2A 5F3TA 5LM7E 4ZVEA 1S1VB 1JLAB 2V34A 6AT1B 3OL9A 3OTOJ 2JC0A 4KGZB 2EG1A 3OFHA 2ZM6F 4EO8A 4OI1A 4ZS6A 5H9FK 1N5YA 1QM9A 4PQAA 2DGWA 5GMKa 1VQSA 2RF2A 3HHEA 3L95X 5KFXA 4DZ6A 3HLUA 5H9EK 5D0EA 4AL7A 2EBGA 1HNIA 3MI7X 2Y1LB 2V8DA 4OZ1A 4TQSA 2OMLA 2V68A 3N6MA 2BVZA 3GJRB 2E1RA 4CO3A 3Q89A 3HULA 3M30B 3UVJB 4DV3F 1UPMB 1WEXA 4RNNA 4YR0A 3HM9A 2CQGA 4OZNA 2WSCC 2WCXA 4TU9A 2C2OB 2XY5A 3MM9A 4KHRA 4WJBA 5HVFA 4NCGB 5D4LA 4HACB 3L3CA 1D0EA 1S1XB 1FD2A 3D6MB 4JI5F 4NA1A 1U2CA 2QL5B 4IG0A 2DPIA 4DSFA 3CCJS 4YB7A 1WC3A 3CD7A 5LL6d 4ZIVA 3OW2R 4NXNF 2XGQA 3KOAA 5BYRA 3CCUS 4UUXA 5ETPA 4LF6F 5EX3A 2X7IA 1WD6A 2CRLA 2G1DA 4DR1F 2FLLA 2F4VJ 4F3MA 1DJ0A 2CFXA 4DR6F 2EEYA 4ZPCA 3NL0A 2RDIA 3MM6B 2AV5A 5J1EB 1UZDA 5F9NA 5LT5A 5D3GB 4DR7F 4C8OA 2KN4A 2KJVA 1J2VA 4I69A 2CAJA 4B3SJ 3I87A 1S57A 5CD4H 3OL7A 1LWEB 2V2KA 3J7Z5 4I7FB 2BXJA 2YNGB 1NHVA 5DQIA 1F3VA 2PFDA 2QG9B 2ZDPA 1A0OB 4NOHA 4B9VA 1UVMA 1Q95G 3MCOA 3TAMA 2B4OA 2J7WA 1FNOA 4DR5J 1VQPS 3UDEA 4Y28C 1Q82T 1HHTP 3DMJA 4KH0B 1VCTA 1B4SA 1WC0A 2QX0A 1RB0A 2DGVA 2NXCA 1FRXA 3IA0A 4U9RA 2YNHB 5GADU 2VICA 1VBKA 2XG8A 1KOHA 3DRPA 2R7UA 4KV8A 1IBCB 1RTHB 4KFBA 1GXLA 4X4NA 5ETOA 2HLTA 2UUBF 4ITSA 5DZ7A 5BXIA 4WFBQ 4NI2A 2HS0A 2OPRA 3K5LA 1UEVA 3QATA 4M8LA 3BO3A 5KFUA 1FKPA 1FFGB 1W7WA 1TU0B 2W25A 2BABA 1IKWB 2E1AA 2AWZA 4AL6A 2QA2A 3HFKA 5FDLA 2DEJA 1XR7A 3DLKA 4OFZA 3OHAA 3P5TL 3BQ2A 1OSCA 2W7PA 4ES1A 3ZZ0A 1RBOB 1UTAA 5K5MA 1HW8A 2XI2A 1CG2A 2YKMB 2WONB 2MGZA 3LP1A 3QRRA 4NA2A 1SL1A 3H2LA 1EETB 4P2XA 2AGQA 1O8BA 1RACB 2GQQA 2R3VA 2VG5A 4OX7A 1NK6A 5J2NB 4ALZA 4RNHA 2JEGA 3CJ5A 4DSIA 1O0PA 1RHKB 1GX5A 4ZCKA 2HAIA 2W4DA 2JLGA 2ZE2B 2HGNA 2HNZA 4C11B 4OZJA 5D0GA 2LCWA 2XZWA 9ATCB 3E51A 4C98A 3U27A 4QWDA 4DV6J 3VGTA 3SCKE 4F8RA 3IRXB 2DVIA 8RUCA 2G0JA 2XI3A 1ICEB 4BC7A 2F7VA 2V4RA 1N0UA 3MPVA 2BJ3A 5IOLA 5F8GA 3X1LB 4JI8F 1XR6A 2Z57B 4HYKA 1NBEB 4WFYA 3TW0A 3HHLC 4URGA 3D6FB 1W2IA 3I6PA 4JI3F 1AXQA 5HAOA 4JI6F 3VR1A 3WBZA 1P27B 3DRPB 5AXNA 2COLA 4IRKA 3JSBA 3THVA 3CF5Q 4DFMA 5IT4A 3CJSA 3TX0A 2ZH6A 5A2QY 1CBKA 3VWSA 5C42A 1HNXJ 3AB4B 4IKAA 1S76D 3W3SA 2JOQA 2EWHA 5IFMA 3G9CA 1IXKA 1VJQA 2HYIB 3OXLA 2R8HA 3FCVA 4DL5A 1SKWA 2JJ4D 3GCWP 2B9XA 3Q83A 5RUBA 1VIOA 3BGLA 4I68A 3KMSA 3FBEA 1FKAF 3DLBA 2Z2LA 2OH2A 2C2MB 2V9WA 1O51A 5KFRA 1H98A 1XEZA 4HTJA 4WFAQ 4WP3A 1WF2A 2VG7B 4NASA 3EXCX 4KSEB 5E2QA 1WHYA 5HVHA 3CXCR 5HROA 4C8LA 2ROGA 1IWAA 3CMES 1TV6A 4UOHA 4GC6A 2YXLA 2MQLA 5E5NA 1BQNB 3KYLA 2PSZA 3GIJA 4ZCLA 1PBAA 2VPYB 4JI2F 2KI2A 2PMHA 3BKUA 2QJ3A 2XMAA 1UVKA 1LQ9A 1H38A 1HNXF 2HQFA 3J81j 4LREA 2QFJA 4GO5X 2H4YB 1P9QC 2R7RA 3FNNA 1KOOA 4RW9B 4DQQA 4PWUA 2VA2A 4B9TA 2MKHA 3HHDA 1SV5B 4JI8J 3MMAB 2CDRB 3AXKA 3CJ8A 1VQ7S 3W9HA 4LFBJ 3EGVA 4KV8B 2MZQA 5CD4A 1T9WA 1N32F 1K47A 5F8NA 1WOSA 2CPHA 2QLXA 2VD3A 4RW7A 2IJRA 4K8RA 1PJ7A 1NRKA 5F41A 3W2WB 2JDJA 2AEFA 4J5OA 2AJ4A 4DQPA 4ZA1A 3PRVA 5KFVA 4PG6A 2FQQB 1E6VB 2HQGA 2R8IA 1U0HB 4DPWA 2H5EA 1T9TA 2F4FA 2B43A 3FJ2A 3LAKA 1J27A 2U1AA 2RUSA 2A3JA 2HZVA 3AY0A 2FHMA 2HZAA 1NKEA 4LF9F 1Z2ZA 1SIWB 2K3IA 1Q8BA 4F3QA 4R8UB 2ACMA 1YK9A 3HP6A 1VHFA 1LWEA 4KE5A 5KFWA 1GEHA 4XAKA 3N6NA 4OYAA 4JB8B 3SV4A 2HRTA 4P10A 1IM6A 1SJ3P 2KRBA 3SBMA 3MEGB 4EFAC 5M2UA 3BEGB 2V8PA 3QSYB 3TAPA 1UJ4A 2CQCA 1SC4B 2DJWA 1NPKA 5F8IA 1RWMB 4QWEA 1U4BA 5HI7A 1RYRA 2DNZA 4CH7A 1YRTA 1YJ9S 3FQKA 4A8XA 4V19X 5DDOC 1YGYA 2PI4A 3QLHA 2HQCA 3HVAA 4RW9A 2B6AB 8AT1B 2YQ3A 4PG7A 1QD1A 4S0MA 2VFRA 2D3ZA 1RHRB 1S1TB 4RW4A 5K9FA 1RT5B 3T6BA 2FVQA 3W1YC 4LF7F 3J7ZT 3BSCA 4FBTA 4DL7A 2LECA 2AT1B 2A6OA 4R0EA 3FGVA 3M2VA 1KVKA 4CZCA 1GTHA 2UVRA 2R7XA 3I9V9 4RW7B 3THPA 2AJ0A 2H65B 4DL4A 1TKDA 3M8QB 1BY9A 2IPOB 3LP1B 4ID8A 4LSNB 1Y4ZB 3R97A 2X51A 3CMQA 4NWBA 1PSDA 5E0OA 3SFUA 1CJKA 4YDDB 3PM9A 1KTVA 2J9EA 3LP0B 3H8YA 3TAMB 1WF0A 3WX4A 3MR6A 3CPWR 2FVSA 1MROA 1U45A 2HHPA 2XEXA 2N4CA 1B64A 3DHWC 1NHUA 3J80U 2IYIA 2HBYB 4CNYA 4ZLNA 3H0PA 3AT1B 4F02A 1QAYA 2L41A 4KFBB 1N34F 2KXFA 1DRZA 3OVBA 1N6QA 1LWFB 1VIXA 3T19A 4ZHRB 3UD4P 4C8YA 1TV6B 4JOUA 3D28A 3C19A 1EKRA 2HHHF 4Q44A 2XQCA 3AJ2A 3PR5B 4ED8A 2VOOA 1CC7A 2CNKB 3PDNA 3N6LA 1JWWA 2OEMA 4ZPDA 2RU3A 3CCVS 2J6SA 2WVDA 4F04B 2R8GA 1IKXA 2LU1A 2YKNB 4JYAJ 2ZWPA 4PYAA 2XMUA 1RLDA 4H54A 1NEEA 5DG7A 4YR3A 2G2OA 2FGCA 2RJZA 2YWKA 1QY7A 1LFPA 3B54A 3MCSA 3M8SA 1RSCA 4PG8A 4X84A 1X5PA 2V6AA 3TARA 2IFXA 3HX9A 2HNZB 3P4UB 4H4MA 3KNAA 1IJFB 1N4LA 4P7TA 1KC8T 2RE1A 4LRFA 1FT8A 3NCRA 2VQFJ 1U2RA 5AXMA 1JXEA 4DSJA 2ZD1A 1NO8A 2GMJA 4HT5A 4HT7A 3HZEA 5KFOA 1VGYA 1VBXA 1SKSA 5ETTA 1KDNA 3PXGa 2EFNA 4DR4J 2HS4A 4ZP6A 4O4GB 3VCDA 4B9SA 3I5BA 3KXDA 4G6VB 2X1FA 4LR9A 4YN3B 1S1XA 4AT1B 4A8QA 2B4UA 4P75A 1N5YB 4JYAF 1WORA 4NYOA 2YVSA 2C2EA 2JEIA 4I1TA 3IC1A 3K59A 5DDPC 2B56A 2QA4S 4CO4A 1GNKA 4ZPBA 3TVKA 2MQ8A 4TY8B 1IM4A 1FE4A 2LYVA 2NREA 5BR8J 2HNDB 4XO0A 3HJFA 3QQCD 3R7SB 1R8AA 3E8OA 4CLZA 4CO2A 3EPIA 2GVDB 3AD9C 1T8EA 1UA1A 3M8RA 2OPPA 3J7AN 3MD3A 4NYPA 4DPXA 3KK3A 1IBKJ 2V67A 1ACMB 4UQGA 3GP9A 3CDAA 1KONA 2Z56B 4HI1A 3MFHA 3IFEA 2OSQA 4OI0A 1X4BA 1S12A 5KFFA 2XB2D 1FXLA 1TL1B 4U8YA 2FHOB 4O3QA 4ANDA 4XIUA 4ZCMA 3D9BA 1ZM9A 4ZVPB 4LJMA 4YP3A 2FJBB 4ZJLA 3MMJA 3UDVA 1H2VZ 2RRAA 4C8ZA 2ALYB 4OYZA 3PO4A 5K8MA 4USHA 3KHLA 2J8SA 4O3PA 2LA4A 3S8SA 5DS7A 1TKZA 2BJEA 3BGUA 5KT6A 3W60A 3VAIA 2GAHC 1KLMB 4CLLA 3OR1B 3NS5A 5KFSA 2MJUA 4X4OA 1R8BA 5KFLA 3BH6B 2MZSA 1T05B 4I7FA 4WIQA 1YITS 4FF4A 1AA1B 4Y34A 4ES2A 4DV1F 4DV0J 3KUGA 1YJ7A 3LGHA 2ASDA 4Q8FA 1YZ6A 1RT2A 1T95A 1S0VA 1RU2A 1LXJA 4MTPA 3WDOA 5BR8F 4FYDA 1Q5VA 5K14A 3R3TA 2KH9A 4FF2A 1GAOA 3R7NB 3TZWA 1RU1A 1XMQJ 1S0NA 1M5KC 1JLGA 2YWGA 4CRJA 2OPSA 4NPOA 3V6HA 2D9OA 3PW0A 1S49A 4M95A 2KKHA 1SQEA 3H4BA 3KG4A 1VK8A 5DG8A 4Q2MA 2MPUA 1MW7A 2DNHA 1AYEA 1JXVA 3BSAA 1RWPB 2RF2B 3ENQA 5K20B 3PVXA 1IKYB 3BH7B 1CJKB 2ROEA 2VBXA 4DPOA 3CJ4A 5LSRA 3CC2S 3US5A 1SJRA 1WELA 1YG0A 3Q8SB 1LNQA 1JLBA 1QTNB 3HKWA 5IS2A 5EWGA 4YEAA 4OV1A 3KTQA 4OJHA 2CNLB 4RO0A 2N3LA 1X5SA 4QPXA 3SYZA 2ZBQA 3NY0A 4NEZA 2HRYA 7FD1A 1REGX 4QYRA 4FPIA 2GJIA 3C6TB 3D0GE 4IH6A 4X64F 3WC2A 1AW0A 3DRYA 2OO4A 1HQEA 3D67A 3DDKA 2UXBF 1X5TA 4YDXA 3KJNB 2QN6B 5DQGA 4I4BA 2HFUA 3I96A 1FNMA 2Z0GA 3BN4A 3EVMA 4O3OA 4CI0B 5KG0A 2W4PA 4A8KA 3KWMA 2O5DA 1XTZA 1X4AA 3MOJB 4WE1B 3I4PA 2HNDA 3JQKA 2RRNA 5KAKA 4K4SA 3MM8B 1YHQS 3MECA 1KTQA 5KFPA 4CLYA 2Y1JA 4DN9A 1XNRJ 3FZBA 4WXWA 3H5XA 3B82A 2VUGA 2W4CA 3H5UA 3M6UA 2YNIB 5EDWA 2DT9A 3BGRB 3JAMY 3NCPA 4Y2KA 1C1CA 2JVRA 2HFOA 4GMKA 2IJNA 3RB6A 3RW7A 1Y9OA 2AYEA 1AZSB 2ZOGA 1NDLA 2AGPA 3QFWA 1PYTA 3QJPA 4DF4A 2VC1A 2DHGA 3CJ0A 3KHHA 3EX7B 3CO9A 1I3OB 2CJKA 3DDNA 1HW9A 1JLBB 4IOCQ 1NSPA 1UZHA 4RW8B 4DDFA 4YY3F 1T7PA 2QLJB 2V0NA 2IAJB 1I5OB 2FDNA 1DBDA 2ZM6J 3TYTA 3MR5A 1SJ4P 4LF4J 1GTEA 4DS5A 2XSJA 1VQ8S 2XS7A 1OWXA 2HQDA 2X3DA 2D9PA 4EYHB 2J0SD 4LF7J 1YIJS 2CG4A 1UEUA 2V94A 2HBQB 2GVDA 3R9LA 1HA1A 5KFNA 4KH1B 2DIVA 3DI6A 4NRTA 3HF5A 4ZVOB 3GJTB 1UETA 3F56A 3ILIA 1RXOB 3BSOA 5IV4A 2GX8A 4FXDA 2ZD1B 1NHKL 4KB7A 2MJNA 5KG3A 4DR6J 2GV1A 3T5LA 1ZPWX 1FRLA 3MMAA 2ZDOA 2CVEA 3CCES 4WTOB 3CSKA 3LAMA 3HT0A 3Q0AA 2MKKA 2MQMA 3MF5A 2XSFA 3DRRA 4UW2A 3IWXA 5C7PA 2DNLA 2XULA 5D78A 2OHDA 4WBFA 3M4XA 2QMUB 4YUDA 4QQBA 2V4JB 2YKOA 3SCJE 4BCAA 2F5GA 1ZTWA 2J7UA 2CPEA 2EFQA 4I0WA 2EXUA 3NS6A 4USVA 2UUAF 3FUYA 3UW1A 2O1PA 1RTIA 2E9RX 3IP0A 4USMA 1RDRA 1A7GE 3CJKB 3IM9A 2RKIB 1S7IA 2IA6A 1X4CA 2W9CA 2Y8WA 4DPTA 3U1NA 4DCOB 4Z2XA 3VV2B 3MUVP 1T05A 1FWLA 1RTDB 2UUBJ 8ATCB 3PR4A 2XO7A 1BHNA 2DR6A 2GHPA 2DH8A 2WVEA 3FEYB 3VVUA 1RE1B 4ED2A 2JL9A 2HNYB 2NYHA 1RHMB 2A2DA 2KYXA 3GE9A 2BQUA 2DR5A 2BOAA 2XHWA 3DXSX 3TAQA 2GIRA 2CPXA 1VRUB 1S1UB 2V8GA 1MMDA 4HTIA 1AROP 2BKOA 2YH1A 4CH0S 3UDLA 4ZN3A 2AQ4A 5D3GA 4X2BA 3AXMA 2EC2A 3QPIA 3DOMB 3OUYA 4KQZA 4FS2A 1YSJA 5L1KA 4IRCA 2EPIA 3OL6A 1OO0B 3NKYA 4DJBA 4IR1A 1R0AA 1RBLA 2C1EB 1FK9B 2ZHOA 3W64A 1ZPVA 4NXMF 2HHWA 4H4KA 2J0QD 3OR1A 4BWMA 3OFGA 3AODA 2DNRA 4ECZA 1P6TA 3W63A 5KFDA 3DRRB 1UJ5A 4OLOA 1F2HA 1TKTA 2C3OA 2LEAA 1NJXA 3AD8C 1S7HA 5EHHA 3IR5B 3R7BB 4ZPAA 5EWFA 3PFOA 2W2QP 1U25A 2VFTA 2ADCA 3M8YA 4C6AA 2ZHBA 1GMWA 5C25B 2VU5A 5B0FA 2R7QA 2OPRB 3KJFB 2EKYA 1X0PA 4IH5A 1Z4UA 4IFVB 2RKIA 3R2CJ 1Y5IB 2XO6A 2CZ4A 4YR2A 3UO0A 2E1MC 2BQ3A 3AQPA 3NMRA 2HVHA 3TEHB 3G8QA 5GVQA 5KT4A 3ONQA 1N5SA 3JTPA 3U7JA 1RT7B 4NXMJ 1WF1A 2QMWA 4K59A 4WU3A 4OYXA 4AE5A 2ASJA 4NLRA 5IWAJ 4AUKA 1YKWA 2D7SA 3CO0P 4K4XA 4FBUA 2FZKB 3KLEA 4U7UD 3GSDA 1U0HA 2PGCA 3GYXB 1RT6A 2DH7A 4JI1J 1JKHB 2C3PA 1F3FA 3MWBA 4F4XA 3NOGA 1XN9A 1J5EJ 1SC3B 2Z4PA 3M1VB 3R5BA 4NYZA 2ZE2A 5BJRA 1RT3A 4JI3J 1BGXT 1Q7YT 2ZC4A 4OI2A 1N52B 2NXUA 2CQBA 3UCGA 1PCAA 1SKUB 4Q5VA 3QZ8A 3W2VA 1WUUA 2EFVA 2VASA 4TY8A 3K57A 4CLUA 4GO7X 3CCQS 2HHQA 1SC6A 3I82A 2W8LA 4C8NA 3IMQJ 3OVAA 3RBEA 2K3KA 5KFHA 2LQJA 3D0IE 1RABB 3BR9A 1C0UB 3HHLD 3WZ0A 2IAJA 3HXMA 3GMGA 4RNMA 2GQCA 2QLFB 2QYCA 3V6KA 2MHEA 1HI0P 3QO9B 4ZP7A 2JFDA 2H3EB 4J7CA 3CD5A 3JQMA 4KRWA 4ZN1A 1JJ4A 4JI1F 1M0SA 5D0RA 1N32J 2M5YA 2LKZA 2OMOA 1NZAA 2JVOA 5B0DA 3DGPA 4ZVUB 2AYBA 1KSPA 1WI6A 2B0GA 1C0TB 2D3UA 3AA9A 3IG1A 2RT3A 5A8KB 1TL1A 1HBOB 2OI2A 2EVZA 2ATLA 4AYBD 4G1IA 1TTHB 1U26A 3GFHA 1PYSB 4TN2A 2IBOA 1KEKA 2LQBA 4NLTA 1WKLA 1JLFB 2HFNA 2Q79A 3HO1A 5IWAF 2DXFA 4KJIA 1EZZB 4PQUA 3V4IB 2OTJS 3OTCA 1XMOJ 4DLGA 2FPHX 4L75A 2FC9A 3FFIA 5KG4A 4ZP8A 5JMNA 3HSGA 2OJ3A 3KJQB 2DGUA 4GKKJ 2BACA 1BQNA 1TUVA 1PC5A 3JQJA 3QIDA 4CTAA 3SMZA 4WFNQ 4DV7J 1Q79A 1TUWA 2E7VA 4P74A 1NK8A 2GCFA 3DCAA 4P2FA 4C3KA 4QR0A 4ZHRA 3V5RA 3RAQA 1IVZA 4C8KA 3VGUA 3JAMU 1ZA1B 4CLFA 2CJYB 3KJVA 3FEZA 4Y2CA 5HJYA 2B4VA 3U1MA 1ZOTA 4M63A 3PO5A 1RKIA 4BWJA 1YDLA 4NLGA 2CUYA 1UVJA 1RWXB 1NKBA 1RTDA 3FVYA 1IJEB 1LW0A 2IM3A 3I0RB 3M6XA 3JXOA 1T0TV 2KB2A 4Y2IA 4DL0C 1SQGA 4NE9C 2K7KA 2GHWA 2C3UA 4DX5A 3H5YA 1F2GA 4IDKB 4AL5A 4CLPA 2VQFF 1RKJA 3KK1B 3A3NB 1C0TA 3K58A 2UU9J 1UFLA 3J81U 1TELA 2GVZB 3DOKA 3QGHA 1S5ZA 3LPYA 4KT0C 4R5PB 2PEHA 1DTTB 2L9DA 3IAM9 2KJWA 2DGOA 1TAUA 4TLQA 1YWXA 4G1QA 3QIPA 3HHLA 4CO5A 2R2UA 1L3VA 1PYOB 5AXKA 3OL8A 5B0CA 4NEYA 1VQ4S 2XS2A 2HVZA 2WVFA 4I6WA 5GAEI 3PW7A 5KFEA 3AJ1A 3CJKA 2QC3A 1R8CA 1FKOA 2AKWB 3PYGA 4OZLA 4WYLA 4NLXA 2WW4A 4CT8A 1U1KA 2VC0A 3FMWA 2N7YA 2Y0BB 1Q7LB 4WCEQ 3CCSS 2HG4A 1UVLA 2P6TA 4NCBA 1CSJA 2XMWA 4WU2A 1M1GA 2YKMA 3H7HB 4U8VA 5I3UB 2JZ5A 1XR5A 3QLHB 2PIIA 5A0YA 2E1CA 2DRDA 2J76E 4IR9A 4MMOA 5LSOA 4J9UE 2UUCJ 4GVBA 2Z2ZA 2IC3A 1H72C 1UWBA 1NPPA 2DHXA 4D3GA 2JHEA 1JJ2R 4RZRA 4QU7A 1B0VA 1ZM4A 3C6TA 3TX8A 3GZ7A 3GIRA 2BR0A 1Q53A 3TA2A 1HQUB 1U48A 1HR0J 4M5DA 4TYAA 4LBPA 1RT7A 1Q4RA 4B3OA 2JWNA 3CDBA 1MU2B 2XMTA 2CPFA 5C2GA 4WWSA 5KFIA 2YNFB 2W2MP 3BF4A 2DYAA 4NLYA 1HBUA 3G2XA 4OHVA 5A8KA 3M9MB 4EBDA 1N33F 1WG5A 4OJGA 3Q8PB 1V3RA 2F1FA 3VGVA 1NZ8A 4CLWA 2G4BA 1A6LA 1HNZJ 2U2FA 3NG8A 2DNKA 3KLHB 1HNVA 1YVFA 3HVWA 3PV8A 1FHTA 3R6LB 4CH1A 1VMBA 3H90A 1RAJA 5KFZA 1FX2A 1TAQA 1RP5A 2FTRA 5CAAA 1F0XA 5DM6Q 3W2VB 5LJ5Y 3BBBA 2MZTA 1NKCA 4KGMA 5J2PB 4C11A 2AYMA 5CQGA 3HJVA 2BE9B 2HZCA 2HHUA 4DCJB 3EDRB 3M32A 2V69A 2M88A 1YRXA 3LPEA 5EWEA 1U2FA 1FEHA 2VPWB 4K5SA 4URSA 3T9NA 1F1BB 4FVCA 4ED5A 2OSRA 1S79A 1XMBA 1NSKL 1SH0A 1SXLA 4ED1A 3KLEB 1FDAA 2MXYA 2CJBA 2AP6A 3TJ8A 3FRYA 3K5OA 5DM7Q 2AJQA 1PILA 2QA1A 3GB0A 3V81B 5CYQA 2EFPA 1Y00A 3CJQA 2LXIA 4NX9A 2IYGA 2M4MA 2FIUA 3BM7A 3P5BP 1MMNA 4ED4A 2VFUA 3SEOA 3G6VA 4B9LA 1EP4A 1JJHA 2AW0A 1KHVA 3EZUA 3P96A 4KGXB 4MK9A 4D3HA 1QSYA 3NAIA 2QLBB 2CDQA 5HSPA 1NUEA 2L9WA 1HBUB 3UN3A 4BC9A 5JJBA 1TFYA 1R0BG 3FSYA 4C0OC 3ZXWA 4TU8A 3NGUA 3K0JA 2V8VA 2ZNZA 4JI7F 4C9DA 1YLXA 3F0NA 1WI8A 2H51B 4CWBA 3D2WA 4F0HA 2YKPA 2XLJA 5L1JA 1U1LA 1JLCA 4OL8A 1SKRA 2BM1A 1OY8A 3IGNA 3NXZA 4F4YA 1VRQC 2DNQA 3IN5A 1NK9A 2ZKUA 4DSLA 5A2QU 4ECWA 4UZCA 5THWA 1HBMA 4FNIA 1B7FA 3BV8A 1IUJA 5T14A 4ILMA 2WHOA 5IC6B 1VYAA 2YH0A 3ET6A 4QOTA 5HVGA 5ITHA 2UUTA 2MTLA 1HBOA 4WF9Q 2CPZA 2RQKA 3NGTA 2C2KB 1WSRA 2QSFA 3BYPA 1H3DA 3R5AA 4R0JA 2WBMA 4RW6A 2ATCB 1RAGB 2VBYA 2JFKA 3SCLE 3M2RA 1U1RA 4JV5F 3ILOA 4NLDA 5U47A 2OPSB 5A6PA 1HMVB 4WK3A 3PKYA 3KLGA 2WOMA 3QWPA 2PA8D 3VZHA 3TJ9A 3RBZA 1KNZA 2NZCA 4NCAA 4OHYA 1H2TZ 1MG7A 1N88A 1QDUB 1LWCB 1NAQA 1WDDA 3DKDA 3DLGA 3DLJA 3GJSB 4UF4A 4X66J 1S9EB 3EXYA 4Q45A 3D5MA 3IWLA 1OJ4A 1WHXA 4DR2F 3TP2A 1T3NA 4DFPA 2BA9A 3MM5A 3MMBA 3VAGA 3WC0A 5C25A 2RDJA 3C8YA 2W8KA 1QE1B 3C16B 2W1BA 3UQSA 1S97A 1KLMA 4ZK7M 5L9XA 4P6QA 1UP1A 5LMNF 1NMEB 4H4OA 3W8GA 4IG0B 2WB4A 1YBTA 1D9DA 4NA3A 3MR2A 2W9BA 1OIAA 2R2TA 4TQRA 2SXLA 3A8KA 3MTJA 4ZVQB 1KD1T 4HHHA 1HI1A 2J9CA 2I38A 3QAEA 2DPJA 2C2ZB 2DXEA 4Y3CA 4I2PA 4LR8A 3KK1A 1S6QB 2DGSA 3UI3A 3CD6S 4K7QA 4M1KA 3AAWB 1F5BA 1K44A 2XY7A 5KFAA 3POTA 3OV7A 3M2UB 1EAYC 2IIHA 3ZTOA 2RQCA 4MIBA 1URRA 3PHTA 1SH3A 1RHUB 4OLPA 3G71S 1S1TA 4RW4B 4IYQA 2YNGA 3MXHP 2GMHA 3QT5A 3IR6B 2HHSA 1HBNB 1Y10A 2A10A 2F9JA 3OFEA 4CLSA 3EYZA 3ADAC 1FERA 4NMLA 3W8PA 3MURP 2ZZMA 4F4KA 3JYTA 5KG7A 4LSNA 4MFBB 1BWVA 2IMWP 1PIEA 4UZBA 1S6UA 2KM8B 1N56A 1SC1B 3KK2A 2ZZNA 2F40A 3PEJA 3HK2A 1FEEA 2HKEA 1YJTA 4DV3J 1Q1KA 3K5PA 3EPGA 2H5JB 3BPSP 1RT6B 1S10A 2FZGB 4RW8A 3N9UC 2LFVA 3ZTQA 5CYJA 3MMCB 2VH7A 5J1NA 5H1SV 3R2DJ 5ETLA 4B17A 3VQTA 4DV5F 3CDWA 1RZMA 1UW4A 2YWEA 2AIRB 3CW2C 4H4OB 3OT9A 2N3OA 1S4FA 4N7TA 1KVIA 3TJAA 1ZM2A 3JSYA 4C97A 4F3OA 2K06A 2DNNA 3ILLA 2DNYA 3IO1A 1Q8KA 2DTJA 2IRXA 3GCXP 3L7PA 3ETOA 3NBPB 3GWCA 4WP9A 4WP8A 4DMZA 4X4SA 3OLBA 1RWKB 3EJMA 1NU4A 4ZDNA 1XJWB 4E8UA 2DGXA 4KHPF 3PYFA 2NPFA 3EZOA 1U1PA 2DITA 2MMYA 1WSVA 2KDOA 5KFCA 1PKUA 4CTAB 4EU0A 4PXEA 1T9UA 1TMJA 1LK5A 3MM7B 2QFIA 1NH8A 2CQ4A 3RR8A 4DV5J 3M8WA 2D74B 2EC0A 1P9YA 1NCLA 2OKQA 3KLIB 2O3DA 2EK1A 4JV0A 3VAKA 3TVZA 1U7LA 2OP5A 1G2EA 4LFAJ 3G6YA 4CYUB 4OYWA 3VAHA 2WSFC 4F26A 4ECQA 1VQYA 1Y3KA 2PO4A 4KYZA 5IZHA 3IRWP 2ZUGA 3Q24A 4CQ1A 4NI2B 3E01A 3GFYA 3M6WA 3ISND 4HHUA 4DFKA 1TR0A 1YI2S 1HWLA 3AFGA 2GNKA 5C24B 3EGWB 2KL8A 2FB0A 2DIUA 1JNZB 3D1HA 4FYWB 1HPZB 4NLVA 4WYWA 2BM0A 3BBFA 1RA7A 5IC4B 3MPDA 4F2RA 3LW5C 2V2ZA 4DOZA 5CZXA 3GIIA 2KXHA 3QJLA 4HI2A 2XMVA 2DK2A 5B08A 3FBCA 4DR5F 3RBDA 1DTTA 1VC0A 2EW9A 4DG1B 1VRTB 5L8RC 4PG5A 3KJVB 3CCMS 1NJZA 1M1KT 3RW6A 3PX6A 3A8EA 3S7RA 5LXRA 2B4PA 3CNQP 3RGIA 2F4VF 4UTGA 3UNGC 3G87A 1TP7A 2HBZB 3ZO7A 1U6FA 2RD5C 3VQSA 4ECVA 1G4CA 4R8UA 5EGYA 1S48A 4ETZA 2KFZA 1I94F 3Q2TC 4KY3A 3CCTA 4I56A 4X62J 1K0VA 2HHVA 3GFZA 5ETVA 2KHCA 4XDDA 1B0PA 1SIZA 2I1RA 1BMQB 1MN9A 3ISNC 4AQYF 3ITHB 1N54B 1QUPA 4ZVTB 2XM3A 2DHHA 2ASYA 1F60B 2MQNA 2MLYA 4DXLA 3QMQA 1RAEB 1FF2A 2RMLA 2VDIA 3C16A 4MKYA 1MMLA 2KRRA 4LRAA 1SPBP 4I6YA 5JUMA 1SQFA 4P72A 4AXIA 3CIMA 5ETMA 4ZJOA 1EARA 3GPAA 3J81Y 3T1YJ 1JQGA 1BUXA 2ASLA 3G82A 1B0TA 2JH3A 2V2QA 4UOFA 3TQ1A 1IWGA 2EK6A 2X3GA 4IFVA 1LK7A 4PG4A 1U49A 1KFSA 1H74A 1CULA 1Q0NA 4PRFA 3ENAA 1YJNS 3BQ0A 4J9SA 2GMLA 2WOMB 3KUHA 1UPPA 4NLUA 3V6DA 5GADI 2HFVA 2KU7A 1FRIA 1JB0C 1Y11A 2CQPA 2PD1A 2YX7A 4USIA 5IXUA 2ZH8A 2VJUA 4AQYJ 1VQLS 2FJWA 3M2UA 3CC7S 2KT5A 3LANA 2Y8YA 5IT9Y 2LQ5A 3V6JA 4USTA 3TA1A 1H0HB 3G8TA 3MM5B 5A8RA 1F9EB 3SSQA 2CPJA 2C2RA 4LMZA 1N5TA 2VONA 4RLEA 3H25A 2ZH7A 2J6TA 1X9SA 4QIWD 2QSWA 4DPYA 1GK8A 2NUHA 1D8ZA 3MAAB 2XYHB 3DNCA 2WW8A 4QJVA 5HQMA 4ID5A 5DDQC 4OI3A 1VLYA 4DV2J 3K8WA 2I8EA 2RSQA 1DQAA 1MSWD 1ZAVA 2M7SA 3M05A 5EN1A 4ZPWR 4CLTA 3MFIA 4UT4A 2ZH4A 4C7QA 1G6BA 3MAQA 1IQZA 3OHBA 1TL5A 2ZOFA 3B4DA 3UD5A 4RNFA 1RTHA 3POTB 2LXFA 4MYUA 1FX4A 3W2WA 4X65F 2GQ2A 3IBFB 4B3TF 3M9OB 1HFEL 1WEZA 3DXBA 3FZ2A 4YMEA 1QAIA 3C14A 2NXNA 3AD7C 2GA7A 2FHKA 1YZ7A 4ZVRB 4CO0A 2BJ8A 3C6UB 3L9ZA 3HVRA 5J2MA 1FRKA 1AUSL 2HEKA 4Y2AA 3OTEA 1JJCB 1KHWA 2MZJA 4OI4A 3TWZA 4WXOA 2VPZB 3V6DB 3CJRA 2M8HA 2MGZB 2GVZA 3DOKB 2F3JA 4DCPB 2FVRA 3Q8RB 5D4PA 4TLRA 1QSSA 2CYYA 2RILA 2CQ3A 3FDSA 4K2JA 2ALZA 3LWMA 2CQ0A 2BJ7A 5T41A 4TU7A 3J7YI 3TUIC 3QNWB 5J2NA 4U7UK 3N4WA 3Q8UA 3MMCA 4GKKF 5G0RA 1ZAXA 4X65J 1GH8A 3NS7B 6FDRA 1L3SA 4CCHA 1IQTA 4GRSA 4E98A 1EKSA 1H6KX 2DHAA 4IG3A 3NRBA 5HO4A 4JUZA 2E44A 1I1GA 2QLWA 3PJWA 4FKXA 4DI6A 2Z2MA 2UUCF 1SL2A 3B8HA 2J0XA 1VS3A 2AHOB 3BSNA 2EI5A 5J2QB 3CUNA 3S1TA 3A4TA 3DM2B 5A0YB 2OPPB 2J9DA 2GIFA 2FD2A 2P9EA 2C22A 4LF9J 3EUNA 1HYSB 4KC5A 1HQ2A 2LMIA 5AE3A 3HFZB 5D15A 2BBEA 3D0HE 2X1GA 2AX0A 2Q3PA 1MWZA 3DN9A 4H4MB 5I42A 4H4KC 1M5PC 4A4JA 4M5DB 4DV7F 2CPIA 4J9NA 1PO6A 2P5VA 4LUBA 2VFVA 3DLEB 4EO6A 6FD1A 5KOWA 1VRTA 2OGUA 2YNFA 1Q16B 3P45B 2XNQA 3QBCA 2H1YA 4OMFG 2CPDA 2EFGA 4MJKA 2OEJA 1K8AT 4C3MA 4XPCA 3DFEA 2GJ2A 2EKNA 3X3UA 1DQ9A 1RADB 5T7LB 3MR7A 4P9SA 2F9DA 1OYEA 4DFJA 1TK8A 4AD6A 3TUPA 5GAEU 1OYDA 2VIHA 2AEJA 4M5MA 3FCHA 3N5FA 2GW8A 2R7WA 1ZTTA 4HACA 2W01A 3A13A 1SUQB 2XWXA 1R8PA 4IFYB 3IBWA 5SZTA 1R27B 3DMJB 1S9GB 1LWCA 4NZ6A 3LGNA 2YWWA 3BO2A 1XC9A 2UZAA 3N28A 4ECUA 1HHQA 2D69A 1KFDA 2CQ1A 2HFSA 3PCOB 3WIVA 4ECXA 1YX2A 1MWQA 3A3PB 5JXSA 2FLNA 1RCOB 4PKDB 3T1AA 5F0UA 3OJUA 2VJVA 2VKRA 2A6MA 3MGJA 4DG1A 4QWCA 4RWXA 1PG5B 3ZZUA 3DM2A 3O2IA 4JP8A 1O6XA 1RAHB 1IKWA 2XC9A 3PNIA 2ZZTA 3TEGA 3UCUP 1OQ3A 2GZOA 3CEDA 4M5HA 3GILA 3SI8A 4QWBA 3Q2SC 1UJ6A 2I6WA 2DO0A 4B3OB 2HHHJ 1ITPA 3EVOA 3OTDA 1BXNA 3IAS9 4L3NA 1IKYA 4M94A 3P49B 2R7VA 3R8YA 2B9EA 2L3MA 1UCNA 2P9CA 2FJDB 2QZ8A 3OBIA 4I2PB 4MIWA 4P52A 3ITHA 1FWPA 2B5JA 4YB6A 5KFTA 1CS4A 2QMXA 1RQ0A 5A8WA 3VGSA 5L39A 3NEKA 4YHHF 4ELVA 4OV6A 3LA0A 2ZNYA 4I2QA 1CC8A 1JMTA 1U1MA 3QWUA 4JBCA 2CPYA 4PZVA 1YJWS 2KVQE 1CJUA 3A3OB 5CCLA 4ERDA 1OMSA 1HQEB 3Q86A 3PEHA 1TL4A 5LSLA 4ZPTR 3UFCX 4TVAB 4HH1A 2VBWA 3QT7A 1K1SA 2HLUA 1WACA 3O8WA 4ICLB 1SUQA 4TXSA 3NAHA 2CZ9A 3TNVA 2ZJRQ 3PX4A 5K14B 1N36J 4B9UA 4CDIA 2DKOB 4MFBA 4KKOB 4IUFA 2BKNA 3ZNUA 2J6UA 2KG1A 4JV5J 1UAWA 3TZXA 3ZNJ1 4OYPA 5I3QA 1B3TA 3EWGA 2P8IA 4NZ7A 2PN6A 3DLLQ 1FWKA 2H54B 4YHHJ 3K5NA 1HYSA 4IO1A 2CVIA 3IM8A 1ZH5A 3G96A 4ED7A 3T1HF 4X66F 3HHKA 4K0KF 3DHXA 4LIWA 3SCIE 5LMUF 1Q8LA 4J9LA 1EHWA 2N7CA 1H7XA 3PIPQ 1DTQB 4K4UA 1N5QA 1EP4B 1L3UA 2FVPA 4ZOSA 5E3PA 4J9MA 2NLWA 1YQHA 3RBXA 3EM1A 4OZ3A 4X4RA 2VG7A 2ZBCA 3AQOA 3T9ZA 2KTQA 1X31C 3B78A 2QIFA 1NH7A 1TL3B 4J9VA 3H5SA 1RT4A 3HPOA 2MQQA 4JI7J 3VVTA 5AE1A 2ZJQQ 4ECYA 4IOBA 4U7CA 2FJVA 2B8QA 2DR8A 4LF2A 4HEA9 2HURA 4OHXA 4DQRA 4XTTA 2Z58B 2L48A 2MQPA 3PW2A 4I64A 4Z7YA 1D1UA 3CB4A 4FF3A 4WZQA 4LF8J 4OX8A 2ZH2A 4IFYA 2WZ1A 4PWWA 5IQQA 1FTCA 2BMBA 3KLFA 4YY3J 3RR7A 3PY8A 3MM8A 1T02A 5FIIA 3SXLA 2AJ2A 1KKHA 3LQVA 2BRLA 4C0BA 5CXTA 3MM6A 4B3RJ 1VK3A 1JLQB 1MWYA 4LRCA 2V63A 4FDFA 1CQMA 2M3DA 4F0KA 3HD1A 3CDEA 2ZJPQ 1B99A 3FFIB 1C1BB 5EUHA 3QO9A 1KRPA 1ZBTA 2YKNA 1NJWA 3QJJA 1LXNA 1FCAA 3CJ3A 3R1HA 4CO1A 2V50A 3M8PB 2R7SA 1VHIA 3IG1B 1R6YA 2K8GA 4PYDA 5ETQA 3I4HX 4BBYA 5FD1A 1L3TA 1U6ZA 2FC8A 1SH2A 2K1RB 5IM0A 1TK5A 2GC8A 4RJVA 4DSKA 2YNHA 1DTQA 3J7A1 3F73A 2ZVSA 4EUVA 3OD2A 5ETSA 2P6SA 1FRMA 2JLFA 1IR0A 2IMOA 1WG1A 2Q6BA 3MMBB 2XWYA 2PE8A 3H2UB 2IDEA 5B0GA 1N8RT 3M8ZA 4NRUA 2GHVC 2CWXA 1HKAA 5HBMB 1B7YB 1TFWA 3TANA 5B0BA 3R1LA 3O6QA 4DWIA 3CTRA 1GT8A 1KR4A 4LF5F 1DARA 1W26A 5BYQA 3G86A 1RAAB 2KT2A 1I94J 4P71A 3JSRA 3ELHA 5DJBA 5GAGI 5DQHA 4PWDA 1UL3A 4HR2A 5E41A 2AF6A 3RZAA 3OLAA 2W24A 1FJEB 3KLFB 2UVVA 2MEWA 2XBPA 4M5LA 2W7AA 3GR0A 5HMXA 2PEBA 1KBRA 1N5VA 1NDPA 3FCWA 2BRKA 1W25A 2BE2A 1R31A 3DOMA 2M70A 1G7CB 1L3KA 1LFWA 2QV6A 2V8HA 1DLOA 2WB1D 4JI5J 2IJFA 1QVGR 2HS3A 3MOZA 1BQMB 4O0NA 4QPTA 4X4QA 2XCPA 4KGVB 2YQ1A 4ID5B 4F25A 1VQOS 3UNYA 2LU2A 4NMXA 3N0VA 3RRGA 1I51B 1BLUA 2GGPB 1XIQA 1ZM3A 3BZQA 2XMJA 3CIZA 3H98A 3BYRA 2LXUA 2AZ3A 4UUWA 3GSIA 1WOOA 2WK4A 4MKBA 5HMWA 1VQ6S 1CJVB 3RRHA 4BLGA 1QE1A 1RTIB 1M1HA 2JRSA 3FK4A 4V19J 4WK1A 1T03B 3RRKA 3KK2B 3GQCA 3DYAB 1VQNS 2JEJA 4QW8A 4DUZJ 3O5TB 3M30A 2CNOB 4DX6A 1CJUB 2DNGA 1LWFA 3IR7B 2XGPA 3FRZA 4MKAA 4FF1A 1KQGB 1U47A 4DV4F 5B09A 2QE5A 2XHCA 4ECSA 1TVRB 3ULHA 5KT2A 1Q5YA 3MAAA 3T5HA 1X8DA 1CJTB 3RAXA 1X4EA 1FESA 3ICLA 3WIUA 3ZTRA 1U1QA 3M8QA 1KN6A 3UE2A 4DR1J 2MKSA 1K9MT 1NK4A 3HMJG 4FVMA 5GMEA 2VA3A 3C2PA 3MUMP 1UEKA 2HRUA 3MHYA 4PR6A 2XY6A 3LUYA 5DGAA 3GV8B 3JB9k 3TZZA 3PIOQ 2MLZA 5HL7Q 2Y0SD 1ELOA 4ZLJA 1FA0A 1XWLA 2YKQA 1S59A 4J9QA 3QGGA 2HIYA 1WC5A 3M6VA 2ADBA 4EEYA 4HDHA 2RQ4A 2MKJA 3MM7A 3ZZOA 4OX9J 2ROPA 2Q1LA 1TKTB 1FI4A 4EBCA 5HP1B 4QR2A 4WKRA 4PEOA 2UXCJ 1U1OA 1T3OA 1SJFA 2C28A 2RHSB 2RNEA 2NSCA 1K1QA 3UVJA 2K2PA 2QRRA 1SVDA 3GJQB 4RBUA 4XK8C 3HVTB 4K2XA 3W5YA 3DYAA 2W9CB 3L09A 1AB8A 4QZVB 3ZFVA 3B4MA 3OTOF 4X4UA 3PW5A 2NQPA 3SQOP 4YFUA 2G1HA 1F9FA 2M9KA 5CCMA 2RVJA 2Z2YB 3NBPA 4J37A 5KT5A 5I42B 4FYVB 2BDPA 1E6VA 4K4VA 2VOPA 1BWEA 4J9RA 5EX0A 1U24A 3V2UC 2FJEB 4OX9F 4ZCIA 2QEXS 2H4WB 5F8HA 2VG6A 1VR6A 3G4SS 3OXFA 2ZC3A 2VL1A 1YJVA 4RR5A 2MSTA 4F2SA 2A1BA 2Q43A 4USUA 3MECB 3QAUA 2WTFA 3NMAA 1H7WA 1RT3B 5KFYA 1RHQB 4L74A 3ISZA 4KGKA 4M5NA 4WPAA 2HQIA 2CXEA 2YKAA 5E3QA 1RUSA 2PMZD 2VG5B 2GO8A 4FYXB 1TL7B 2L9NA 5CA5A 1R43A 4O23A 3TOQA 5E7OB 2A18A 1KS2A 3OPKA 5AJ3F 4ECRA 1VLOA 2BV3A 3UCZP 2PC6A 2HWTA 4MAKA 2DRBA 1R3NA 1S6PA 2A2CA 4IRDA 1T11A 4UOCA 5KG6A 2XLIA 5DLFA 2OPQB 4OIXA 4DU7A 3PHEA 4MIAA 4J9OA 2ZOMA 3MAHA 1PBUA 4K5RA 1TKZB 2GJFA 2NUUG 2FVCA 3GYGA 4OZ5A 4UY85 3R27A 3CGIA 2IRYA 4N56A 2X1AA 1Q81T 4B9MA 4JI6J 4NZ0A 4EGLA 2CWKA 3L7OA 5E33A 1Z2LA 1ZYQA 1M90T 1D9FA 3IS9B 1OSDA 4J90A 3I0RA 4RU9A 4DR7J 2R8KA 4QW9A 3HHNB 5SUHA 4WIIA 4OYMA 4ETXA 1H73A 2F65A 2AGOA 4B3SF 3Q22A 1TVRA 2DGQA 1Q8IA 2JC1A 2QGFB 7FDRA 2CA9A 2F63A 4PPZA 2E9TA 4OYIA 2W2PP 5J2MB 1CS4B 5A8WB 5KG2A 2HMIB 4UY8T 1XERA 1LW2A 1UWAA 4USKA 5E3AA 2BE2B 2MLXA 2M2BA 4DX7A 3NNCA 3JTNA 4LFBF 4GVLA 3TR5A 4MYTA 1LKZA 4RW6B 4PXBA 3QGPA 1N6QB 4PUOB 3MEKA 1FDDA 2O01C 2MSSA 4DSEA 5HROB 2GGPA 1HL6A 2BKPA 2NXEA 4X4PA 1ULRA 1X4GA 3S01A 4DN0A 4Z37A 4ZLPA 3DLGB 3HKZD 3K89A 3T5KA 2JEFA 1TUGB 3H20A 4DV2F 2RIJA 4IG3B 5CABA 3ZZTA 4LFCF 2Y9HA 2YPYA 3DRXA 4EI2A 5MAOA 3BGFA 2CZVC 1AUDA 2FJXA 2UVWA 1RBAA 1NXIA 3AB2B 3M7VA 3MEDA 4USWA 3K2YA 1U02A 1WWHA 5D6GA 1S77D 4R25A 4YQWA 4QIGA 5L1LA 3NLCA 4EYIB 4OYBA 3LOUA 4OHZA 3QT8A 2I5JB 3C66A 3BJYA 4BS2A 3EDQB 1JX4A 2XCAA 3ENVA 1S1WB 2VB6A 4JI0J 1JLFA 3LWLA 1NSAA 3H40A 4ED0A 3SFGA 3DLHA 2VFSA 3ZZPA 3J7YU 1Y3JA 3V4IA 3QIPB 3MPYA 1P1LA 1HHSA 3BGRA 4KO0B 4AXJA 2HK3A 4LRDA 3HCXA 4DR3F 1UA0A 1X9WA 4N8NA 4A8FA 1HNVB 3SIPB 3ZZYA 4FNHA 2OLWA 4IO9Q 4DHVA 1NB7A 2M8DB 1EX8A 2HFZA 4Z7CA 2F8HA 3BKFA 2YWHA 4N76A 2E9ZA 1N33J 2R8JA 2ZITA 4EK2A 4RBVA 3W5ZA 1CEZA 2CIMA 2D41A 3WQPA 4RNOA 5HLFB 5DZ6A 5F8LA 3QYYA 5I3PA 3AOBA 4FPRA 1B70B 2ZKTA 2CG8A 2OFHX 2E5HA 3PYEA 4TKTA 3AJDA 5GAHU 1FJ7A 1MN7A 1V3ZA 3RJMB 1LV5A 1PJ5A 1CJTA 3D68A 4B3MJ 3FSIA 2FZCB 1PAUB 1V5VA 4ILRA 2PA3A 4DUYJ 1TL3A 3PZPA 2LQ9A 3H2VE 2C2DA 1WHWA 2RH3A 1FXRA 3K17A 1WC4A 4TY9A 2V5HG 4C2MA 3AOAA 5LJ3Y 4DR3J 3RTVA 4DL6A 2HGLA 4ZITA 1UMJA 1FVQA 1VFJA 2EBEA 3BB5A 4LT6A 2E7XA 9RUBA 3T3FA 3OXGA 4EBEA 5KFBA 1WKKA 1V6HA 1Y7PA 4QIEA 4B02A 4OI6A 2KO1A 3CCZA 3LO3A 2G0IA 3RU0A 1RYSA 1FJGJ 4W90B 1RI7A 5HP1A 2M52A 1Q86T 1K0TA 3TUJC 5ETNA 3JS9A 4J9KA 2HMIA 2RDDA 4I67A 1GFWB 2CADA 2RU9A 2Y3YA 3F41A 2RAQA 4B3MF 1RAIB 2VKZG 1FDNA 4NCGA 4JI4F 2FUG9 4UQTA 4P7VA 3EICA 4M5GA 1WG4A 2W9AA 2HVEA 1NPRA 1HPZA 4LRBA 4PCQA 2DY1A 2C3MA 2R42A 4O4RA 2DH9A 4ZVSB 3MEGA 2O66A 1IBMJ 1T9XA 4G1PA 3UN5A 4CM2A 1T94A 2NXJA 2W2NP 3AH6A 2K1RA 5IM0B 1U6BA 3M9NB 3NGSA 2IC3B 3PTWA 3DI6B 1RISA 2DNOA 2CJ9A 4PXDA 1NJIT 2WSEC 4X4TA 3E3XA 1VDHA 4EMDA 5D77A 4KR0B 3T5JA 3FBBA 1MLAA 1IBLJ 1IKXB 1C4AA 2OD4A 5KT3A 4DUYF 2NPIA 3C3LA 4TYBA 4ZPVR 2IDLA 2CQHA 2G0CA 4LQ9A 4C0HA 3MTKA 2JNJA 1TKXB 2DISA 1QVFR 1WHVA 3CJTA 3DGPB 4MK7A 4PPDA 1WDTA 5HATA 5KT7A 2ERRA 2DRAA 3DOLB 3BS9A 2HVDA 4KIAA 4A8SA 5DDRC 4PWDB 4LVNP 3MPWA 3CCWA 2V4QA 2DCLA 2AEMA 4KO0A 1SL0A 1G1XA 3W5XA 2V2VA 3CT9A 2C42A 1XNQF 1FK9A 4O4GA 1RAFB 2HBRB 4HL9A 4I2QB 1HNWF 2KHDA 3U1LA 2BJ9A 1IBLF 1CULB 2XTJP 2DBBA 5FDLB 4DR2J 2ZBPA 2HIQA 1EB0A 4O44B 5M2RA 4QU6A 1S99A 3VAJA 1UVIA 2O67A 2YTCA 2UUWA 4YB1P 1PGZA 2B9WA 4DL3A 4P73A 5LMNJ 1U8SA 2WBRA 4KPYA 1EJ7L 2KYZA 2IHR1 4OHWA 5A8RB 3KG0A 1H2UX 1RT5A 1S1UA 2CQ2A 1W2BR 1PC4A 1LW2B 2H9ZA 4LVOP 1BE4A 1WJ9A 4OJ3A 3KK3B 3V81A 1C1CB 3RB4A 1C1BA 5GAHI 3CULA 3W61A 4LBIA 1F5AA 2OFGX 2ZFHA 4M5IA 2HPUA 1V9OA 2VBZA 5C5JA 4DV1J 1YTYA 1JNRB 1CLFA 2Y1RI 4QBUA 5KFJA 5F9LA 1N34J 1AFJA 2ZWOA 1FTRA 1M5HA 3NGDA 4K4WA 3HSZA 3NNAA 1D9AA 3MD1A 3DU5A 4MT1A 1JKHA 1OPZA 1FE0A 2WONA 4L72B 5JVHQ 1ZA2B 2DR9A 1XMQF 2QT7A 3C46A 1EETA 2E7WA 5F0WA 3HHLB 4FKYA 4DPUA 3K5MA 1QAJA 3U02A 3FC9A 4O3SA 5KFMA 5HBMA 2B51A 5G4DA 1DZ5A 1S9FA 1HNWJ 4P2SA 1FFWB 5BYSA 3C15B 3EZ5A 2ZH1A 2QA4G 2RS2A 2VQEJ 5DGBA 2XZDB 1S72S 2I2YA 2KFNA 2K7JA 1T9YA 3KDOA 5AXLA 4UOGA 1VI7A 1OY9A 2L08A 3VZIA 2AD9A 4Y0FA 1V3SA 4C3LA 4HDGA 5GMDA 3OVSA 4ZKAA 1NM2A 2RQMA 3H4DA 1JIHA 4PXCA 5CYMB 2DR7A 4X64J 2G2YA 1R89A 3LP2A 1F6TA 1UWBB 2AJ1A 2MDAA 4LSZB 3OSNA 2E5GA 3PRDA 4ZVGA 4RUAA 3R5CA 3VHQA 4ER8A 1I6JA 1DLOB 3H59A 3MZIA 1URNA 3KG1A 4WTYA 1CPZA 3CDUA 1X9MA 2MB0B 1U0SA 4KHPJ 1RWVB 2LLZA 3HZGA 2KZZA 3I32A 4C48A 1IN0A 2DCUB 4RWWA 3CWJA 4LBHA 3ZZZA 2ZHAA 3W66A 3I55S 2BZ2A 1CQNA 1YRUA 3G6ES 3SDEA 2UV8G 4E0DA 4Y65A 1XNRF 4B3RF 3I56S 2UP1A 3RAMA 3P8BB 4MKVA 1IR2A 2VPXB 1OS5A 1P8GA 2HQ3A 2XLKA 4WZMA 2W9BB 2APOA 3BN7A 1O5JA 4KHMA 5F3ZA 4U95A 4LFAF 2D3OR 1HIYA 3HT3A 2LA6A 4DQSA 1J5OA 1QTMA 2IVFB 2JSXA 2HSEB 3W62A 3I9ZA 1JLQA 4DS4A 1FVSA 2LEPA 4IQMA 3OUYB 2B7CB 3DRSB 1IKVA 2J8AA 2YQ0A 3PYDA 4L6V3 2ZH5A 4EZ9A 4RUCA 1NK0A 2XMKA 2MYFA 3BREA 3CD0A 5H9FJ 4MH8A 3TUZC 3FSXA 1RWNB 5A6WA 3GIKA 3QT6A 4LF4F 1HWKA 3OJSA 1D8YA 1HBNA 2BUNA 4LIRA 2XZTB 4A47A 1HNIB 2IY5B 3O44A 1Z1ZA 1HWJA 2XYGB 2P2CB 3Q8VA 2OAUA 5CYQB 3UR3C 4DZDA 1DY3A 4YS2A 5ADZA 2E1PA 3R5GA 2DNPA 1VQKS 1WC6A 2BW7A 2OIHA 2HGMA 4ZIWA 5IT0A 7AT1B 2GS8A 1VBZA 5AT1B 4CNZA 3FMBA 1CJVA 1RT1B 2G9OA 1OPIA 4U67Q 2BOPA 2OD6A 1KQSR 4G3IA 1T03A 4RBTA 2CJAA 3BR8A 1N48A 5FLXU 5B7WA 2CKWA 1VC6A 1V5IB 5FLXY 1K73T 3MEEB 4LSLA 3K8VA 4AFFA 5KFQA 4K50A 2UUAJ 1LW0B 2UVUA 2NZ4A 3NGKA 3MCNA 3RB0A 2M0GB 5KG1A 1YBUA 3D66A 4F67A 1NK7A 1F5CA 3A8IA 3D6TB 4A8WA 4F4WA 2ABYA 4DEZA 1FXDA 2D1CA 3LP0A 5HMYA 2Q6CA 4U6PA 2B5JB 3I5AA 1JLGB 3T6JA 1D3WA 3GIMA 5IT9U 3DC2A 2FY1A 3IXQA 2IM2A 3VF0B 1IKVB 1RAOA 3KHGA 3O1LA 2NR0A 2AZ1A 4DUZF 2KFYA 5E3RA 2V9KA 2OTLS 2RRBA 1KP6A 3TQEA 1L5UA 1BQMA 3P6YC 4DL2A 1TK0A 4KTQA 3KLGB 2OELA 2MKCA 1LWXA 4DV4J 4CP5A 1RTJA 1SCJB 3TA0A 1WKJA 2B7BB 1AZSA 4A8YA 2BX6A 2AJFE 2R2SA 3GG1A 4ZMMA 4OQJA 4URQU 1S6PB 1QJHA 3ENWA 2DEIA 1RCXB 4HLBA 2MQOA 2HVIA 2UXCF 4Y6IA 3IWNC 3HD2A 2MY7A 3E01B 2PDAA 2YPZA 2VZ9A 5LXYA 3SDEB 3O3LA 3G82B 1OY6A 2Z8QA 3HVTA 1KQKA 3UDCA 3R6GB 3QSIA 3AHPA 4DV6F 1R6VA 2DD8S 1YJUA 2DY9A 4FYYB 4RUHA 5HN0A 1TMMA 1AT1B 3SV3A 1HQUA 2XS5A 4Q8EA 1JXLA 1VOMA 4L76A 3SQGB 3D1QA 4NLOA 3A8JA 5DLGA 4KBIA 3UN2A 1XBWA 1C2PA 3QRPA 3C6UA 3MPUB 3GU0A 2N4DA 4NXNJ 2WAQD 4HKQA 4DX8H 5J1EA 4KKOA 1E6YA 1SJQA 3OFFA 4CT9A 1KWMA 1RT4B 3DRSA 4DU8A 2FHJD 1HARA 4F50A 4B3TJ 1T9VA 4DF8A 1QAXA 3W7BA 4N41A 4K4TA 1A9NB 3N01A 3DU6A 3EGZA 3E2EA 4ZJQA 2N82B 1DURA 1QUVA 2IRUA 2ZVIA 2JX2A 4L73A 4BDPA 4X62F 1LEOA 3I31A 2BANB 4HH0A 4LF1A 3D7SB 1GMUA 1RHJB 2NS1B 4A8MP 1HD1A 2GAGC 4LFCJ 4EZ6A 4KPCA 4NLPA 2AU0A 5K8NA 4O0IA 1Y5NB 5F8MA 2ACYA 2FLOA 3T1HJ 1U09A 1M5SA 3CMAS 4F4ZA 4FXVA 1JLAA 1JLCB 4N77A 1HI8A 1REVA 2GO9A 1RT1A 2VDHA 2R7OA 5H9EJ 1J5EF 4IOAQ 4DBQA 4J91A 4U96A 2QO3A 1S6OA 3MEDB 3JTOA 4IDKA 4RX6A 1J5OB 3EGNA 5DETA 4ELUA 4JI2J 3ET6B 4OYOA 3AOCA 5AJ3J 3MR3A 4O3RA 4FN5A 3W65A 2WVBA 2HWIA 1CVJA 2FY8A 3ZZRA 1DFDA 2HNYA 4QIFA 4RUBA 3SQGA 1FRJA 4L3KA 2W2OP 1RJJA 1P1TA 4Q7AA 1XQIA 3BQ1A 2IVMA 3TI0A 1VQMS 4Q0BB 3UR0A 2DO4A 3GFXA 2FHJA 3UPFA 2DB1A 3VTIA 1X0FA 3MM9B 3A12A 3T1YF 4WFXA 5E3CA 3TZYA 2MKYA 3CC4S 4X4VA 1FJCA 1SBRA 4PUOA 2UXDJ 3NNHA 3ILJA 1HWUA 3R5JB 4YOEA 1S9EA 3R5DA 1UVNA 2UV8A 2I9SA 3M8PA 4PABA 2F8MA 4ELTA 2OPQA 3I5CA 4HVZA 4ZP9A 3KMQA 1HBMB 4FXWA 3BO4A 3OSPA 1WEYA 2BYCA 5L46A 2PI5A 4QR1A 3LALA 2GIQA 3BBCA 3TRGA 5J2PA 2NYIA 5J2QA 1HD0A 1BD6A 2KM8C 3OR2B 3IS9A 5IQ6A 1RWUA 2BW2A 2E66A 3MCMA 4ES3A 5K8OA 1DHMA 2KG0A 4NLSA 1ZETA 4OX6A 2C2NA 2ZEJA 4MK8A 2AYGA 1WNEA 3BPDA 1TZ0A 3M2VB 1Q78A 3GG0A 4OZ0A 3G6XA 2ILYA 1S6QA 1YBAA 1FRHA 3IBCB 5HMZA 2XMMA 2LDYA 1QLNA 4JI0F 4V1Ak 2DGTA 1ZZFA 4W98A 2CJXB 2WVCA 3UD3P 3KLHA
chains in the Genus database with same CATH topology
2FJAB 4Y2MA 1GQEA 3RB3A 5T7LA 3IGVA 3NCQA 2JLEA 4Q43A 1R0AB 3PRBA 3GV7B 3OTBA 2C3YA 1X4HA 4RKUC 5KFGA 2E5IA 3VAFA 5G0RB 1VQ5S 5L38A 3PFEA 2LVWA 3QZ7A 3S6EA 3JYTB 1M5VC 3M32B 3SSSA 3VAMA 1N36F 3JSMB 1JLEB 2UXDF 4GKJF 2KVIA 2J5AA 4ATNA 4QCLA 5L1IA 1SV5A 2KZMA 4N5SA 1JK9B 1X5OA 2KT3A 5CYMA 1C0UA 2J9DE 3FQLA 4Q2LA 4XDCA 3UWTA 2YNIA 3TVYA 1SJ1A 4ED6A 3AA8A 4ZVHA 2I5JA 1SI9A 1Y5LB 5B0AA 4OJ1A 4A8OA 1WTBA 1S1WA 2EFOA 1KLNA 4RU2A 1BQXA 2UU9F 2MY8A 2YWFA 1RTJB 4WE1A 4NLQA 1N0VC 1MROB 4KAIA 4B08A 4R5PA 3CCRS 1RK8A 4DLEA 4XPEA 3I0SB 3CJ2A 1MNEA 4G1QB 2CJQA 1VQ9S 2Q66A 3LP2B 2MZ1A 2J7KA 1VJWA 4QYZJ 1WTFA 1FO1A 5DG9A 2KXNB 2CQDA 1S9GA 3KFWX 1FKOB 1UKUA 4WKYA 3GV5B 4ZVFA 2WRMA 2X1BA 2VV5A 4O44A 5KTQA 4C4WA 1FJGF 4USJC 2B6AA 2IM0A 1HNZF 4I6AA 5GAGU 2ILZA 2PT0A 1HWIA 4NL5A 4ECTA 3M2RB 4B9NA 5HQ8A 3PACA 1OQ6A 4QIVA 1BC6A 5B0EA 1HMVA 3V4MA 2POKA 4FS1A 1XMOF 5KFKA 5C42B 3KKFA 1TKXA 3FEXB 1G3OA 3RYLA 1MU2A 1IBMF 3CE8A 4N47A 4CIOA 3DOLA 1NJYA 3D54A 5DO2A 2Y1IA 3PKMA 1Y0HA 2G13A 4IQXA 4LQ3A 2VG6B 4PQUB 1GXTA 4DR4F 1IBKF 2R4FA 1C4CA 1FDBA 1NNDA 2HW3A 4BHQA 5K8PA 5CZVA 4EWTA 1GXUA 2YY3A 4JV2A 5C24A 3D1OA 4HHJA 3KLVA 2F8EX 2RS8A 1JLEA 2E5JA 1RGVA 2V4JA 2FLPA 3GYNA 1RT2B 3OR2A 1FNXH 1ROFA 5MLCV 4J9PA 1SB6A 3THTA 1ZAWA 2R9LA 4Q0BA 3N79A 1VBYA 3MDFA 2J0WA 3Q8QB 4A46A 2AX1A 5CH7B 1APSA 3MEEA 4LSLB 2LDIA 3DLKB 2GFFA 2HWHA 3N5BA 4C8MA 2B9YA 3F44A 2YX1A 3HDSA 5J1PA 1GX6A 3CVKA 3KHRA 4FP9A 4WFZA 2ZH3A 1R8HA 3BDEA 3DLEA 1AFIA 1S0MA 3NWGA 3J80Y 1X4FA 2VODA 4ILLA 2PFFB 1VRUA 2CQIA 1XK8A 3MUTP 1QSLA 5KG5A 1X7VA 3KNGA 2IBKA 3I0SA 5DRKA 5CHCB 3IRXA 1ZZNA 2P9GA 2ZH9A 2DNMA 3JSMA 5D8HB 4DV0F 4TNOA 1FKPB 5KOXA 2E29A 3ZC4A 3BDPA 1UFWA 3LF0A 5I3UA 1HR0F 2FGOA 2HHTA 2EG2A 5FJ4A 1S1VA 3HI9A 1DAXA 2RUGA 3Q23A 3SZ2A 4Y00A 3M1VA 3P3DA 3A1YG 3PJXA 1M5OC 4N8OA 2IA0A 1DQ8A 2R2RA 3GR1A 5JVGQ 1U1NA 2BANA 2IVYA 4IH7A 2XNRA 5I4MA 3KLIA 5HLFA 2HHXA 1YJRA 4A48A 3G8SA 4K4YA 2IM1A 2DHSA 4LF8F 2RB7A 4NLWA 3LGMA 4DQIA 2VQEF 5D4OA 3LH2S 2E5LF 3PX0A 4W92B 4ED3A 2R7TA 1REVB 4QWAA 3K7RA 1E6YB 3CCLS 1LOUA 4YB5A 2NSBA 1NK5A 4FZVA 2MKIA 1S0OA 1RA6A 2W7OA 1R7IA 1X4DA 3NP5A 5D4NA 1FD8A 4K4TA 1KQFB 2MZRA 4O3NA 2BQRA 3TO8A 4JV1A 2MHNA 2ZBIA 2XSJB 3VALA 5F8JA 1KVJA 3QGIA 5M2PA 2B3TB 1TQLA 2LEBA 4ICLA 4K4ZA 3SSRA 3PW4A 2I0XA 2BJDA 2YX4A 3OQ2A 5F3TA 4ZVEA 1S1VB 1JLAB 3OL9A 2JC0A 2EG1A 3OFHA 2ZM6F 4EO8A 4OI1A 4ZS6A 1N5YA 1QM9A 4PQAA 2DGWA 5GMKa 1VQSA 2RF2A 3HHEA 3L95X 5KFXA 3HLUA 4AL7A 2EBGA 1HNIA 3MI7X 2V8DA 4OZ1A 4TQSA 2OMLA 3N6MA 2BVZA 2E1RA 4CO3A 3M30B 4DV3F 1WEXA 4RNNA 4YR0A 2CQGA 4OZNA 2WSCC 2WCXA 4TU9A 2XY5A 3MM9A 4KHRA 4WJBA 4NCGB 5D4LA 3L3CA 1D0EA 1S1XB 1FD2A 4JI5F 4NA1A 2DPIA 4IG0A 4DSFA 3CCJS 4YB7A 3CD7A 5LL6d 4NXNF 2XGQA 3KOAA 5BYRA 3CCUS 4UUXA 4LF6F 5EX3A 1WD6A 2CRLA 2G1DA 4DR1F 2FLLA 4F3MA 1DJ0A 2CFXA 4DR6F 4ZPCA 3NL0A 2RDIA 3MM6B 2AV5A 5J1EB 4DR7F 5F9NA 5LT5A 5D3GB 4C8OA 2KN4A 2KJVA 1J2VA 4I69A 3I87A 5CD4H 3OL7A 1LWEB 2V2KA 3J7Z5 4I7FB 2BXJA 2YNGB 1NHVA 5DQIA 2ZDPA 4B9VA 4NOHA 1UVMA 3TAMA 2B4OA 2J7WA 1FNOA 1VQPS 1Q82T 4Y28C 1HHTP 3DMJA 5AE2A 5GADU 2DGVA 1FRXA 3IA0A 4U9RA 2YNHB 2XG8A 1KOHA 3DRPA 4KV8A 1RTHB 4KFBA 1GXLA 4X4NA 2HLTA 2UUBF 4ITSA 4WFBQ 2HS0A 2OPRA 3K5LA 1UEVA 3BO3A 4M8LA 5KFUA 1FKPA 2W25A 2BABA 1IKWB 2E1AA 2AWZA 4AL6A 2QA2A 3HFKA 5FDLA 3DLKA 1XR7A 4OFZA 3OHAA 3P5TL 3BQ2A 1OSCA 2W7PA 4ES1A 3ZZ0A 5K5MA 1HW8A 2XI2A 1CG2A 2YKMB 2WONB 2MGZA 3LP1A 4NA2A 1SL1A 3H2LA 1EETB 2AGQA 1O8BA 2GQQA 2VG5A 1NK6A 4OX7A 5J2NB 4ALZA 4RNHA 2JEGA 3CJ5A 4DSIA 1O0PA 1GX5A 4ZCKA 2HAIA 2W4DA 2JLGA 2ZE2B 2HGNA 2HNZA 4C11B 4OZJA 2LCWA 2XZWA 4QWDA 3E51A 4C98A 3U27A 4F8RA 3SCKE 3IRXB 2DVIA 2XI3A 4BC7A 2F7VA 2V4RA 1N0UA 3MPVA 5F8GA 3X1LB 4JI8F 1XR6A 4HYKA 4WFYA 3TW0A 3HHLC 4URGA 4JI3F 1W2IA 3I6PA 1AXQA 4JI6F 3VR1A 3WBZA 1P27B 3DRPB 5AXNA 2COLA 4IRKA 3JSBA 3THVA 3CF5Q 4DFMA 5IT4A 2ZH6A 5A2QY 3VWSA 5C42A 3AB4B 4IKAA 1S76D 3W3SA 2JOQA 2EWHA 5IFMA 3G9CA 1IXKA 2HYIB 3OXLA 2R8HA 4DL5A 1SKWA 2JJ4D 2B9XA 1VIOA 3BGLA 4I68A 3KMSA 3DLBA 1FKAF 2Z2LA 2OH2A 2V9WA 1O51A 5KFRA 1H98A 1XEZA 4HTJA 4WFAQ 1WF2A 2VG7B 3EXCX 4KSEB 5E2QA 1WHYA 3CXCR 5HROA 4C8LA 2ROGA 3CMES 1TV6A 4GC6A 2MQLA 5E5NA 1BQNB 3KYLA 2PSZA 3GIJA 4ZCLA 2VPYB 4JI2F 2KI2A 2PMHA 1H38A 1HNXF 2R7UA 1UVKA 1LQ9A 2QFJA 4GO5X 1P9QC 2R7RA 3FNNA 1KOOA 4RW9B 4DQQA 4PWUA 2VA2A 4B9TA 2MKHA 3HHDA 1SV5B 3MMAB 1VQ7S 4KV8B 2MZQA 1N32F 5F8NA 2QLXA 2CPHA 2VD3A 4RW7A 5F41A 1NRKA 3W2WB 2JDJA 4J5OA 2AJ4A 4DQPA 4ZA1A 5KFVA 4PG6A 1E6VB 2R8IA 2H5EA 2B43A 3FJ2A 3LAKA 2U1AA 2A3JA 3AY0A 2FHMA 4LF9F 1NKEA 1Z2ZA 1SIWB 2K3IA 1Q8BA 4F3QA 4R8UB 3HP6A 1VHFA 1LWEA 4KE5A 5KFWA 4XAKA 3N6NA 3SV4A 1SJ3P 2KRBA 3MEGB 4EFAC 5M2UA 3BEGB 3TAPA 1UJ4A 2CQCA 2DJWA 5F8IA 4QWEA 1U4BA 5HI7A 1RYRA 2DNZA 4CH7A 1YRTA 1YJ9S 3FQKA 4A8XA 4V19X 5DDOC 1YGYA 2PI4A 3QLHA 3HVAA 4RW9A 2B6AB 2YQ3A 4PG7A 2VFRA 2D3ZA 3T6BA 1S1TB 4RW4A 5K9FA 1RT5B 2FVQA 3J7ZT 3BSCA 4FBTA 2LECA 4R0EA 3FGVA 3M2VA 4CZCA 2R7XA 1GTHA 2UVRA 3I9V9 4RW7B 3THPA 2AJ0A 4DL4A 1TKDA 3M8QB 1BY9A 4LSNB 3LP1B 4ID8A 1Y4ZB 2X51A 5E0OA 4NWBA 1PSDA 3SFUA 1X9SA 4YDDB 3PM9A 1KTVA 2J9EA 3LP0B 3H8YA 3TAMB 1WF0A 3WX4A 3MR6A 3CPWR 2FVSA 1MROA 1U45A 2HHPA 2XEXA 2N4CA 1B64A 3DHWC 1NHUA 2IYIA 4CNYA 4F02A 1QAYA 2L41A 4KFBB 1N34F 2KXFA 1DRZA 3OVBA 1N6QA 1LWFB 1VIXA 3T19A 4ZHRB 3UD4P 4C8YA 1TV6B 4JOUA 3D28A 2HHHF 4Q44A 3AJ2A 3PR5B 4ED8A 2VOOA 1CC7A 3PDNA 3N6LA 1JWWA 4ZPDA 2RU3A 2J6SA 3CCVS 2R8GA 1IKXA 2LU1A 2YKNB 2XMUA 4H54A 1NEEA 5DG7A 4YR3A 3M8SA 2FGCA 2RJZA 2YWKA 1QY7A 1LFPA 3MCSA 4PG8A 4X84A 1X5PA 3TARA 2IFXA 3HX9A 2HNZB 4H4MA 3KNAA 1IJFB 1N4LA 4P7TA 1KC8T 2RE1A 1FT8A 3NCRA 1U2RA 5AXMA 1JXEA 4DSJA 2ZD1A 1NO8A 2GMJA 4HT5A 4HT7A 3HZEA 5KFOA 1VGYA 1VBXA 1SKSA 3PXGa 2EFNA 2HS4A 4ZP6A 4O4GB 3VCDA 4B9SA 3I5BA 4G6VB 2X1FA 1S1XA 4A8QA 2B4UA 1N5YB 4JYAF 4NYOA 2JEIA 2YVSA 2C2EA 4I1TA 3IC1A 3K59A 5DDPC 2B56A 2QA4S 4CO4A 1GNKA 4ZPBA 3TVKA 4TY8B 1IM4A 1FE4A 2LYVA 2NREA 3HJFA 2HNDB 4XO0A 1R8AA 3E8OA 4CO2A 3EPIA 1T8EA 1UA1A 3M8RA 2OPPA 3MD3A 4NYPA 3KK3A 4UQGA 3CDAA 1KONA 4HI1A 3MFHA 3IFEA 2OSQA 4OI0A 1X4BA 5KFFA 2XB2D 1FXLA 1TL1B 4XIUA 2FHOB 4O3QA 4ZCMA 1ZM9A 4LJMA 4YP3A 2FJBB 3MMJA 1H2VZ 2RRAA 4C8ZA 3PO4A 5K8MA 4USHA 3KHLA 4O3PA 2LA4A 3S8SA 5DS7A 1TKZA 2BJEA 3BGUA 5KT6A 3VAIA 1KLMB 3OR1B 3NS5A 5KFSA 2MJUA 4X4OA 1R8BA 5KFLA 2MZSA 1T05B 4I7FA 1YITS 4FF4A 4Y34A 4ES2A 4DV1F 2ASDA 4Q8FA 1RT2A 1T95A 1S0VA 1LXJA 4MTPA 3WDOA 5BR8F 4FYDA 5K14A 3R3TA 2KH9A 4FF2A 1GAOA 1S0NA 1M5KC 1JLGA 2YWGA 2OPSA 4NPOA 3V6HA 2D9OA 3PW0A 1S49A 4M95A 2KKHA 1SQEA 3H4BA 3KG4A 1VK8A 5DG8A 4Q2MA 2MPUA 1MW7A 2DNHA 3BSAA 2RF2B 3ENQA 3PVXA 1IKYB 2ROEA 2VBXA 4DPOA 3CJ4A 5LSRA 3CC2S 3US5A 1SJRA 1WELA 1YG0A 3Q8SB 1JLBA 3HKWA 5IS2A 5EWGA 4YEAA 4OV1A 3KTQA 4OJHA 4QPXA 2N3LA 1X5SA 3SYZA 7FD1A 2HRYA 4QYRA 2GJIA 3C6TB 3D0GE 4IH6A 4X64F 3WC2A 1AW0A 3DRYA 2OO4A 1HQEA 3DDKA 2UXBF 1X5TA 4YDXA 5DQGA 4I4BA 3I96A 4O3OA 1FNMA 2Z0GA 3BN4A 4CI0B 5KG0A 2W4PA 4A8KA 3KWMA 2O5DA 1XTZA 1X4AA 3MOJB 4WE1B 3I4PA 2HNDA 2RRNA 5KAKA 4K4SA 3MM8B 1YHQS 3MECA 1KTQA 5KFPA 2Y1JA 4DN9A 3FZBA 4WXWA 3H5XA 3B82A 2VUGA 2W4CA 3H5UA 3M6UA 2YNIB 5EDWA 2DT9A 3BGRB 3JAMY 3NCPA 4Y2KA 1C1CA 2JVRA 2HFOA 4GMKA 2IJNA 3RB6A 3RW7A 1Y9OA 2AYEA 2ZOGA 2AGPA 3QJPA 4DF4A 2VC1A 2DHGA 3CJ0A 3KHHA 3EX7B 3CO9A 2CJKA 3DDNA 1HW9A 1JLBB 4IOCQ 4RW8B 4DDFA 4YY3F 1T7PA 2V0NA 2IAJB 2FDNA 1DBDA 1SJ4P 3TYTA 3MR5A 1GTEA 4DS5A 2XSJA 1VQ8S 2XS7A 1OWXA 2D9PA 4EYHB 2J0SD 1YIJS 2CG4A 1UEUA 2V94A 1HA1A 5KFNA 2DIVA 3DI6A 4NRTA 3HF5A 1UETA 3F56A 3BSOA 2GX8A 4FXDA 2ZD1B 5KG3A 4KB7A 2MJNA 2GV1A 3T5LA 1ZPWX 1FRLA 3MMAA 2ZDOA 2CVEA 3CCES 3CSKA 3LAMA 3Q0AA 2MKKA 2MQMA 3MF5A 2XSFA 3DRRA 4UW2A 3IWXA 2DNLA 2XULA 5D78A 3M4XA 4YUDA 4QQBA 2V4JB 2YKOA 3SCJE 4BCAA 1ZTWA 2J7UA 2CPEA 2EFQA 4I0WA 3NS6A 2UUAF 3UW1A 2O1PA 1RTIA 2E9RX 1RDRA 1A7GE 3CJKB 2RKIB 2IA6A 1X4CA 2W9CA 3U1NA 4Z2XA 1T05A 3MUVP 1RTDB 3PR4A 2XO7A 2GHPA 2DH8A 3FEYB 4ED2A 2JL9A 2HNYB 2A2DA 2KYXA 3GE9A 2BQUA 2DR5A 2XHWA 3DXSX 3TAQA 2GIRA 2CPXA 1VRUB 1S1UB 2V8GA 1MMDA 4HTIA 1AROP 2AQ4A 2YH1A 4CH0S 3UDLA 4X2BA 5D3GA 3OUYA 3QPIA 4FS2A 4KQZA 1YSJA 5L1KA 4IRCA 2EPIA 3OL6A 1OO0B 3NKYA 4DJBA 4IR1A 1R0AA 2ZHOA 1FK9B 1ZPVA 4NXMF 2HHWA 4H4KA 2J0QD 3OR1A 4BWMA 3OFGA 4ECZA 2DNRA 1P6TA 5KFDA 3DRRB 1UJ5A 4OLOA 2C3OA 1TKTA 2LEAA 1NJXA 5EHHA 1S7HA 3IR5B 4ZPAA 5EWFA 3PFOA 1U25A 2VFTA 2ADCA 2ZHBA 5C25B 5B0FA 2R7QA 2OPRB 2EKYA 1X0PA 4IH5A 1Z4UA 4IFVB 2RKIA 4YOEA 1Y5IB 2CZ4A 2BQ3A 2E1MC 3AQPA 3NMRA 2HVHA 3G8QA 5GVQA 5KT4A 3ONQA 1N5SA 3JTPA 3U7JA 1RT7B 1WF1A 2QMWA 4K59A 4WU3A 4AE5A 2ASJA 4NLRA 4AUKA 2D7SA 4K4XA 3KLEA 3GSDA 2PGCA 3GYXB 1RT6A 2DH7A