2IVYA

Crystal structure of hypothetical protein sso1404 from sulfolobus solfataricus p2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
88
structure length
88
Chain Sequence
AMLYLIFYDITDDNLRNRVAEFLKKKGLDRIQYSVFMGDLNSSRLKDVEAGLKIIGNRKKLQEDERFFILIVPITENQFRERIVIGYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords HYPOTHETICAL PROTEIN SSO1404
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 25
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2006-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09827 CRISPR_Cas2 CRISPR associated protein Cas2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ivyA01
2I8EA 3OQ2A 2EFGA 3ZZTA 4ES3A 2BM1A 3B8HA 2IVYA 5G4DA 2KDOA 2NPFA 1ZM2A 1T95A 4QR1A 4ES1A 4MAKA 1ELOA 1KTVA 2BM0A 4M1KA 1ZM9A 2WBMA 1DARA 4QR2A 2E1RA 4QR0A 1ZM3A 1VI7A 3LH2S 2J7KA 1P9QC 4ZCMA 1N0UA 1ZPWX 3ZZ0A 3B78A 4ES2A 4ZCIA 2L9NA 2ZITA 3EXCX 3UI3A 4FN5A 2I0XA 1FNMA 4MYTA 1U2RA 2CVEA 2BV3A 3B82A 3ZZUA 2XEXA 4MYUA 4ZCLA 3E3XA 4TNOA 4ZCKA 1N0VC 1ZM4A
chains in the Genus database with same CATH superfamily
3M2VA 2XI2A 3R3TA 3W2VB 5B0BA 2RKIA 5F41A 4OX9J 1V3ZA 2LCWA 5GAHI 4NLDA 2FC8A 4P2MA 4HI2A 4A8FA 1VC6A 4ZVUB 2IHR1 3OHBA 4R8UB 4LSLB 2HS3A 4IFYA 1SH0A 4OV1A 2DEIA 2XEXA 4CO2A 1YRTA 1WI8A 2IY5B 1OQ6A 4PR6A 1L5UA 4O0IA 1WTFA 3UCUP 4UQGA 2J7UA 1QAXA 5LMUJ 2BE9B 3OXGA 4NRTA 2BRLA 2F1FA 5E33A 2KYZA 1S59A 3V4IB 1X7VA 2GGPB 3D1QA 3RU0A 2LA6A 2VFSA 3MMCB 1N36J 3CNQP 4MK7A 2LDIA 2QL5B 4YDXA 4CT8A 1ZM4A 4A8KA 2MDAA 2JFKA 4EU0A 1IJFB 2YVSA 5EWGA 1DFDA 2OUGA 2JEJA 4HI1A 1RYSA 3MFIA 5CXTA 4B3TF 2CPHA 4CCHA 4DR2J 3ZTPA 5LL6d 1WC0A 4KKOA 3DN9A 3ULHA 4G3IA 4CLLA 3A13A 5ETVA 2VBYA 4Y3CA 4KV8B 1JLGB 3EDQB 2HK3A 1T03A 4ID8A 4Q7AA 1B0VA 5BYRA 1HWIA 1Y5LB 1CEZA 4ZCLA 3P6YC 1B0PA 3K5PA 5KTQA 4LSZB 3EMTA 4FPRA 4USVA 3AJ1A 2R7SA 4OLPA 1HL6A 3MEDB 2LU1A 2WVFA 2QMUB 2JWNA 4QIGA 4ED6A 1HLWA 2HK2A 5HQMA 4ECYA 4V19J 4DDFA 3T5HA 3E51A 1FJEB 2OHDA 1AW0A 1SL1A 3A12A 3WZ0A 5D3GA 1U1PA 1UPMB 3W2WA 4AXIA 5KT7A 5KG7A 3MAAA 3RAQA 1TKZB 3NOGA 1DTTB 1NDKA 3KK2A 1LWCA 4K4UA 3T1AA 3NGTA 1ITPA 1VLYA 3NNCA 3M1VA 1TR0A 3BGFA 4NLXA 1T9WA 1B64A 2QGFB 2HQ3A 1S99A 3CDEA 3TZWA 3ZFVA 2MXYA 1UJ4A 2GW8A 3QNWB 3MM9B 4DR4F 1UVIA 2GIFA 4Y34A 2ZKTA 1PKUA 4DSLA 3FSIA 1HQUB 3CD5A 3TI0A 3DGPB 2XNQA 1TVRB 3FKBA 2OSRA 1U6FA 4OHVA 2ZD1A 4RZRA 2R9LA 2GQCA 4A47A 3POTA 1UAWA 4KGZB 2KVQE 3SV4A 4N5SA 3H5UA 2WVDA 1WG4A 1VDHA 4KSEB 3RR7A 2YNFA 2DITA 3RW7A 4ECTA 1LK5A 2IMOA 2V94A 4DV6F 3MMJA 2OMLA 3QWPA 5T14A 1PJ5A 5E3QA 3MR6A 3IC1A 1RSCA 2XB2D 2W01A 1S0MA 3GCWP 4ED4A 4ED8A 3JQKA 2HNDB 4XPCA 3HP6A 4U7CA 5I4MA 1RHRB 1KVJA 2E5GA 1E6YA 3R8YA 2ILYA 2EFQA 1YSJA 7FD1A 3TEGA 2CQ0A 2DGXA 1CULB 2ZOMA 4E0DA 3QT6A 2UXCF 1AROP 3UN5A 2L9WA 1S6PA 2DGTA 3HVAA 4ZS6A 4FNIA 1SKSA 3ZZRA 2XZDB 3EPIA 4IOCQ 1R6YA 1TL1B 2FDNA 2ADCA 2DNZA 5E3RA 2R3VA 4DSJA 4QJVA 4TQSA 3KHLA 5HMXA 3U1MA 5HN0A 1FJGF 5HVGA 5DGBA 2H51B 3EXYA 2BE2A 1CJKB 3CT9A 4DHVA 2LDYA 2F3JA 2DXEA 3D0HE 1Y00A 2OEMA 1VQ7S 2GAHC 1HW8A 1FWLA 2RVJA 4OLOA 1X5SA 2AD9A 2BACA 4CDIA 5HMYA 3NBPB 2OFHX 3DMJA 4HEA9 5FLXY 4ZPAA 1RT5B 1WC4A 5KFMA 1Y3KA 3DKDA 1KC8T 2I5JB 1DY3A 3UD4P 2XO7A 3ADAC 3O8WA 3H4DA 4URGA 3MM5B 1B7YB 3I55S 3NMAA 3DI6A 4PZVA 3NCPA 3CMQA 5CD4H 4QCLA 4PPZA 3IMQJ 1S7HA 1VR6A 4B9TA 3GFXA 1RKJA 4RR5A 4KHRA 1U4BA 2ZH1A 3OTEA 3HT0A 2BEFA 4W92B 4CIOA 2FD2A 1S6UA 5BR8F 2NUUG 3HKWA 2DH7A 2KRBA 3CCLS 5HSPA 2W4PA 4ZCMA 2F40A 3BREA 1KD1T 1WC1A 2DH9A 4JI1F 3KHGA 5EN1A 5L39A 1NK0A 1TKXA 2ASYA 2W7OA 3ISNC 1R6VA 1S9FA 3HLUA 5IV4A 2E1CA 1Z4UA 1UW9A 2KXHA 2MKJA 2NPIA 3T5JA 3W64A 1I94J 2FUG9 3ENVA 2CQDA 2VG6A 3SFGA 3DLLQ 4B9SA 1Q0NA 4QIFA 3BDEA 1RHKB 1KOHA 2ZHBA 4USTA 3SEOA 2BX6A 5F9LA 2V4JB 4USIA 1SL0A 3FCWA 3S7RA 4QR1A 4JI8F 3BO2A 3MGJA 1RWNB 1JLCB 4QR0A 2NSCA 4IG0B 2VJVA 1OY6A 4ZIVA 1VHIA 4ZJLA 5F3ZA 3GILA 4LR8A 2L41A 1V9OA 1WNEA 4WFYA 2PN6A 2WW4A 3MXHP 4DCOB 1RTIA 3I0RA 5HROA 1XTZA 2OD4A 2XMMA 3BEGB 5T7LB 5IWAF 5EWFA 3LWMA 4UW2A 2DR7A 2GQ2A 1RE1B 5HANA 4DOZA 4U9RA 1T0TV 5HJXA 1ZS6A 1Q5YA 1N5VA 5KFFA 3FMBA 4ICLB 2VASA 2ZDOA 1NKEA 1IBLF 5KFSA 2M52A 1C1CA 3TJAA 3ZZZA 1I3OB 1FVSA 3HF5A 3SXLA 2CWXA 2JLEA 2DNGA 2RE1A 4KGMA 1FHTA 4DL3A 5BJRA 2J6TA 2WSFC 4Y65A 4DV5F 1F60B 4DV3F 5A8WA 4A8XA 4LR9A 1HA1A 4TQRA 1CPZA 4USMA 1RAGB 3MTKA 1O51A 2IJRA 1S1UA 3CCUS 4O3SA 1I1GA 2HMIB 3FVYA 1WC5A 2AT1B 3RYLA 5LJ5Y 1SKRA 3R5DA 4GVBB 1N0UA 1IBKF 4CLPA 3PJWA 3CD6S 1HNVB 5HAOA 2DB1A 4ZJQA 3K8WA 2M4MA 3C16B 5JMNA 4DQSA 1IBCB 2C2KB 2CZ9A 4OZ2A 3DOLA 3NGKA 2QLWA 4RW4A 5I3UB 1QAYA 4LVOP 3DLKA 2P9CA 2RS2A 1RLCL 2GVDB 3J81Y 3O44A 4ZVQB 2HLTA 2E5LJ 3IP0A 5CABA 2Y1IA 1TK0A 2ZZNA 1U48A 4P72A 2MLZA 3SSQA 4I7FA 2KT3A 3CIMA 4DPOA 2KJWA 3DLEA 3H4BA 2I8EA 4HDHA 4Z7YA 3KG1A 2HWHA 4NLYA 3ET6B 2G2OA 4IG3B 1ZZNA 1YJRA 3Q8UA 4AYBD 1PYSB 3EZOA 3GE9A 3JSMA 1N5YA 2R2UA 1QUVA 4WP9A 1RHQB 2E66A 2HHUA 2BANB 2I0XA 1UW4A 2NUHA 5D4NA 2FZKB 1YJ7A 1N0VC 2B4UA 5H1SV 3GIMA 2E5JA 3TRGA 1KEKA 3GQCA 2MZRA 1MN7A 3VV2B 1AXQA 2B5JA 3W62A 2MZTA 2R42A 5L38A 2LQBA 3BPDA 4JI6F 1UA1A 5FIIA 2IMWP 3DRRB 1TFYA 4NX9A 3H2UB 1U8WA 3H25A 1HPZB 2K1RA 1RWKB 1PSDA 3AD7C 2X1AA 1PJ6A 4LF4F 3QJJA 3RRGA 5ETLA 1ULRA 1HYSB 5D15A 4KQZA 4DL2A 1A0OB 5A0YA 4TU9A 2L48A 1LKZA 3W8PA 5B0CA 3ZZOA 3EGWB 4WBFA 3IAM9 4EZ6A 1VYAA 3I0SB 3VTIA 4NZ6A 1HQEB 3LOUA 1VRTA 1FK9A 3Q8VA 1SJ1A 5HQLA 1RBAA 2MB0B 2YWFA 3DCAA 4ZIWA 1KLMA 4BHQA 1RWMB 2XSJA 1VQ9S 2E9ZA 3FEYB 5C2CA 4L74A 1X4GA 1T9TA 3BV8A 1RT3A 3H40A 1HNIA 3S01A 5KFCA 3BR9A 4PAAA 2RRNA 1UTAA 1RAIB 4M5IA 4DUTA 3A8KA 3KLIB 4C7QA 5DLFA 2Y1LB 2WTFA 3SQGB 2COLA 3PW2A 2HIYA 5C42B 5AXKA 3DRXA 4YR0A 4Y2IA 3ITHA 3GJTB 2H5EA 2FJBB 1HNZJ 1RT2B 2CJAA 3DYAB 2H1YA 2GVZA 4B3SJ 3TJ9A 2MLYA 3AXMA 2MTLA 4PWUA 1FKPA 1AYEA 2GO8A 1EP4A 1VHFA 4BC7A 4EWTA 2V34A 1RAFB 2DO0A 2R7UA 2Y0SD 5HP1A 1MMLA 2EI5A 2RQMA 1RISA 2DT9A 1SIZA 3BH7B 5FD1A 1AUSL 2GMJA 1T3NA 3CO9A 4ZHRA 2CPFA 3LGNA 4OJGA 4RNMA 1IKXA 4IO1A 1S9EB 1FEHA 1OPZA 2KKHA 3IR5B 3ILIA 3DM2A 2FTRA 3TUJC 1M5PC 4OZ0A 3H42A 2WW8A 1UZHA 1T9UA 3BN4A 4CM0A 1B0TA 1LOUA 1P6TA 5I3PA 2MZSA 4ZVHA 2BW2A 1YJUA 1VOMA 3G87A 3A1YG 2HGNA 3D6MB 3GZ7A 4N7TA 3FDSA 1YQHA 1NSKL 4U7UD 2HQIA 2DGSA 5IQQA 1GK8A 4FNHA 1RHJB 2W2MP 1TL3A 3QT8A 1SUQA 3KLFA 4HT7A 1BUXA 1REVB 2LP4A 4G1QB 3GJQB 3BZQA 1GT8A 4YOEA 1SJ4P 1EB0A 3THPA 2CUYA 1NPKA 4WFNQ 4HR2A 1J2VA 2EG1A 2DGUA 2ZE2A 1NH7A 3HK2A 1S9GA 4L75A 2UUAF 2OKQA 1NLKL 5AT1B 2QA2A 1U1NA 2O66A 2WVEA 3IRXB 2N3OA 1S76D 4WK1A 5KFWA 2BKNA 2YXLA 2AYBA 1F3VA 2GA7A 3VCDA 4RW8A 2F4VJ 4WU2A 2IM0A 2C2OB 4X65F 2AYGA 3FRZA 3EWGA 4MTPA 3PRDA 1AUDA 2LQ5A 5ETTA 1GTEA 3SSSA 2CJ9A 2BKPA 3SDEB 2LQ8A 3DRPA 1XQIA 2RAQA 3V6DA 1NMEB 2JLFA 3MM8B 2XLKA 5L1KA 2N82B 3PRBA 2YKNA 4QIWD 4F2RA 2MYFA 4M94A 3BKFA 3TANA 1RWUA 2BM0A 3ONQA 4WXWA 2WSEC 4X4QA 1SH2A 4J9OA 2C2MB 3UI3A 2JVOA 3I9V9 3KMQA 1UEUA 2BJ1A 5DETA 5KG4A 3BN7A 4NLVA 3NCQA 2UUCF 4OJ3A 2Y8WA 2PO4A 4J9NA 3PHTA 1LW0B 4X4VA 5KFGA 1C0UB 3SMZA 1TUWA 1T9VA 4LFCJ 3FBFA 2XS5A 2BM1A 2N4CA 2CQGA 2WBMA 2VG7B 4ECVA 3QAUA 4DR5F 3D2WA 3T3FA 1JLFB 4U96A 2E1PA 3BSNA 3FRYA 1KR4A 3V4MA 1IJEB 3PVXA 1VISA 1N88A 2WK4A 3R5BA 3VAHA 1YIJS 4FF2A 3CJKA 2ZZMA 3B82A 5GMDA 4LF2A 5E41A 4DX6A 4H4MB 2QLBB 3R1HA 2MSSA 2O1PA 3NS6A 1YGYA 1EQMA 1JLEB 4F4KA 2QN6B 4FF1A 4CZCA 2MY7A 3QGPA 4ID5B 1Y0HA 4ED7A 1VC5A 3HVWA 1RT6B 1WF1A 2AX0A 2A10A 2IRUA 1RAEB 5EX0A 3HHNB 2XYHB 4DWIA 2G2YA 3A4TA 5RUBA 2FJDB 4DR1J 1W2BR 5K8OA 2KDOA 3HXMA 2AGPA 1NJZA 4IRKA 3PW5A 5DZ6A 4LMZA 1RLDA 1W7WA 3CDBA 2V6AA 1KN6A 2N4DA 2VIHA 1GMVA 5HK4A 1HR0J 3CVKA 2P6TA 2JHEA 4KV8A 1LXJA 1JLGA 2XI3A 5HBMB 5KFLA 1NKCA 1WDDA 4EO8A 5ETQA 1F2GA 3CJ5A 2JEFA 4U67Q 1OYDA 1X4EA 2KG1A 3C14A 3R27A 3L09A 4DL6A 3R97A 4A8MP 2VG5B 1SC4B 3TP2A 3EXCX 3MEDA 2MZJA 1IBMF 2CIMA 4WU3A 3TEHB 4LRBA 3SCIE 4ZOSA 2OIHA 4P2SA 1NBEB 2CQCA 1X0FA 3ZZTA 4I64A 4F7VA 2FVSA 2HQDA 4NRUA 3NAHA 3CW2C 4ZP6A 1YZ6A 4B3OA 2B8QA 2F9DA 3LAMA 4NYPA 2CA9A 2ZEJA 1ZBTA 5L46A 2DGWA 1REGX 1Y11A 6FDRA 1VQ4S 1TKZA 3OV7A 4JI4J 4LF7J 3OHAA 1WKKA 1JWWA 1JJCB 4OYZA 3K59A 1RAOA 2R8GA 3M8WA 2FVPA 2VONA 3HHLA 1EKSA 1PAUB 4LFBF 1U45A 1C0TB 1AZSA 4NEZA 3CO0P 3DGVA 3TAPA 1S1VB 1VS3A 3DDKA 1LV5A 3MM9A 3V5RA 1ZAXA 4OJHA 3IBCB 1RGVA 1MWZA 3DGPA 1B99A 4R25A 5D6GA 1NB7A 3BQ1A 4DV2F 4ETZA 4CLWA 3DLJA 4KE5A 3M2VB 2RKIB 5HO4A 3VAMA 2RMLA 1EAYC 2AW0A 4F4XA 3QIPB 3IWNC 2R7VA 3HJVA 2ZJRQ 2GNKA 4Y0FA 2HFNA 5CZVA 4AQYJ 2BJDA 4IFYB 2IYGA 2UU9F 4O3QA 4ZVRB 3F56A 4OZJA 2Y8YA 2K3IA 1N4LA 1SJRA 3DHXA 1NZ8A 3NS7B 1SKUB 3PX6A 1U7LA 1Q5VA 2HNDA 2BBEA 1R8AA 4ZMMA 4ETXA 3NG8A 1NO8A 1L3VA 3Q23A 3PW0A 3MCMA 3FZ2A 3JQMA 3I87A 4QPTA 4HYKA 1HD0A 4MFBA 2UXDF 4WWSA 3KOAA 2VDIA 5F8JA 3ETMA 2QFIA 3TUIC 3N28A 3BBBA 2QV6A 2G2ZA 3GU0A 4EBEA 2EWHA 1Q16B 3D6TB 4B3MF 1I51B 2EPIA 2GCFA 2H3EB 4KKOB 5LOQA 4Q5VA 5H9FJ 3AT1B 2NXEA 4ZP7A 4ZN1A 3DFEA 1S6OA 1X4AA 4C8OA 1DARA 4PG8A 1NSPA 1T03B 1RB0A 1WF2A 2HLUA 3M30A 1ZTWA 3NL0A 1BD6A 1CJKA 5KT6A 2IIHA 3ILLA 4LF5J 1WORA 2PA8D 2FHOB 3BGRB 4ZVGA 5ETSA 3T1YF 4UOGA 1IN0A 1EIYB 3K8VA 5KT4A 3R7BB 2AGQA 4NA1A 1RT5A 5D0RA 5U47A 2I5JA 5L1IA 4QU6A 2IAJA 4YN3B 4X64J 3R1LA 3UDVA 3ENQA 4DQQA 3W2WB 2QYGA 2JEGA 5A6PA 1PG5B 4DQPA 3ILOA 1MMNA 1H0HB 4ZVPB 3CCQS 1JLQA 3MAAB 5A6WA 3GIJA 3KK2B 3MPWA 1LWCB 5ETRA 5KFQA 2ZWPA 5DDOC 4M5KA 2V69A 3HULA 3GV8B 2DR8A 2VBZA 3RJMB 3G6ES 2RT3A 5F3TA 1VQ5S 4HDGA 3N6LA 3GG0A 2SXLA 2B9XA 2X1FA 4OX9F 2L9NA 5KFBA 5K8PA 4OI1A 1VIOA 3SYZA 2D3UA 2OO4A 5LMNF 3JSYA 3ZO7A 4J90A 2MSTA 3WX4A 1TL4A 5KFJA 1GX5A 1DAXA 2WZ1A 4KHMA 2ZD1B 4V1Ak 5CD4A 1X4FA 1G7CB 1WD6A 2V67A 2OTLS 1U24A 2DK2A 1PO6A 1FD2A 3Q0AA 2M88A 4J9SA 2YNFB 2ABYA 3HFKA 1LFWA 2YX1A 2AHOB 3BSAA 3W9JA 5LMUF 4QWCA 2VU5A 1M5SA 2B8PA 2PFDA 2W4DA 3BKTA 3OFFA 3O2IA 4KH0B 3AD8C 4HLBA 4IQXA 2Q1LA 1JNZB 4ZPTR 4RUBA 2CZVC 1N36F 1VQKS 3LF0A 1HI8A 3BR8A 1L3TA 5M2PA 4ZPDA 2ZH3A 3A3NB 4K0KJ 5L1JA 4WFBQ 2HHHF 3QLHA 1JKHB 3NCRA 3CJ0A 4CLSA 1T7PA 1WKLA 3NNHA 3MR7A 4I2PA 4P2XA 2MJNA 2PA3A 4O44B 2C3UA 3AFGA 1E6YB 1VK3A 2AWZA 1NDLA 4YHHJ 3IS9B 4NZ7A 3M9NB 1K1SA 2YQ1A 4OYMA 4J9MA 2VFUA 3T9ZA 2CPJA 4C2MA 2ATLA 3KJFB 2IJNA 4WFAQ 4TY8A 4NCAA 1M1GA 2YNGA 3FEZA 3RBXA 3G2XA 1S6PB 3RAXA 4FBTA 2YNHB 2VF3A 4OX7A 3PW4A 2EEYA 5F8GA 4FKXA 4YP3A 1HFEL 1IWGA 4LF8J 4D3GA 1ZYQA 4OI4A 3PY8A 3OVBA 3T6JA 1TP7A 3H59A 3V81A 4UY85 1OWXA 2BE2B 5KFHA 2WVBA 2K8GA 2KM8B 3T5KA 1FFGB 1X60A 3NRBA 3QT5A 1BC6A 1RAJA 2IM2A 3QZ7A 1WEYA 2LVWA 1YZ7A 4K7QA 4OYAA 5F8HA 4JYAJ 4R0EA 1S0OA 2VC1A 2XMUA 1WG5A 5FDLA 3EUNA 3O5TB 1ZH5A 3VGUA 4TN2A 4K59A 2RJZA 1JIHA 4O0NA 3KHHA 2OPSA 2YH1A 1L3SA 9RUBA 5F0WA 4A8YA 4B9NA 2XGPA 4DR6J 3UDLA 3DI6B 2NPFA 5J2NA 3PG9A 3I4PA 2V9WA 3FBCA 2C3MA 3MM7A 1GEHA 3MMBA 5K14A 4AUKA 5JUMA 3HX9A 1XMBA 2BZ2A 2CNOB 3KJNB 1PJ7A 2QLJB 1IKVA 1APSA 5LSLA 4MIWA 2O5DA 2RRBA 2WB1D 4FBUA 4NL5A 4FXWA 3U02A 4QR2A 2APOA 4OIXA 3I5CA 3ET6A 4IG3A 4ZPCA 2GS8A 3C19A 2ASJA 2NXNA 4NLSA 2H5JB 2HEKA 1TKXB 4MAKA 3RG6A 1JJ2R 3C46A 2P9GA 4PQUB 3WX8A 3MEKA 3CGIA 4QZVB 5EGYA 4DR3J 1HWKA 3TVZA 5F8NA 2J0WA 1VQOS 2VG6B 3R5AA 1X8DA 2DNYA 3GJRB 1FFWB 1QLNA 2XNRA 2UUTA 3KDNA 2KO1A 2E7WA 2W9BA 1U6BA 1U47A 2DPIA 1FRMA 1YI2S 3R7NB 3DRRA 1KTQA 1UETA 1EHWA 4BBYA 3UCZP 1HPZA 4URQU 3ZTQA 2C42A 1K8AT 1HYSA 3FSYA 3VHQA 3W61A 4DL4A 4J9QA 4OHXA 1T3OA 2VV5A 2HRYA 2BOPA 1K0VA 3K5OA 1ZM9A 3Q86A 2Z2MA 3K5NA 3TAQA 2Z58B 1H2VZ 4NMXA 4Z37A 4LF9J 4OYPA 3M8RA 2JEIA 3IR7B 4NXMJ 3UVJA 4PWWA 4NZ0A 3JAMU 4ECWA 4Q8EA 3Q8PB 4M5LA 1XMOJ 1C1CB 5A76A 1RHUB 4KPCA 2CQ1A 4TU8A 3MWBA 3SQGA 4RUAA 5BXIA 4IRDA 1QM9A 1SC1B 2BJ7A 1SV5A 2QO3A 4JI7F 5HLFA 2QTWA 3HFVA 4ILRA 5A8WB 2ZBPA 1MG7A 2BUNA 1VRUB 1RT2A 2ADBA 2RQKA 4CNYA 2BJ3A 4E2FB 1FWPA 3P3DA 1S1UB 4ED3A 3HHKA 5CCLA 1FXDA 4L3KA 1H2TZ 3CC2S 3AB2B 4J9VA 3S6EA 3T41A 1NNDA 2FY8A 5GVQA 1BXNA 5GAEU 3CCRS 3H2VE 4ILMA 2UUBJ 1V3RA 3H2LA 3OL9A 3LW5C 4QBUA 4OI2A 3LANA 3VAJA 2LQJA 5E0OA 4OZ5A 2VBXA 1SXLA 3TOQA 4X4OA 4CH0S 1D3WA 5JXSA 4OL8A 1KONA 3UNYA 2CQ4A 1QUPA 2EW9A 2YWEA 4QPXA 1LWEA 5KG0A 1YX2A 3ZTOA 4WTOB 2VPWB 4DX7A 4RW4B 2CVEA 4KRWA 1RT4A 1UEKA 4CQ1A 1Q81T 1S10A 3M8QB 4ZVEA 1YHQS 5B0EA 2MKCA 2ROEA 2XC9A 3AA9A 3JTPA 3R5GA 4NCGA 4D3HA 3GV5B 1S4FA 4F0MA 4I7FB 2DCLA 2HFVA 4FDFA 3I31A 3MF5A 2ZC3A 3I5BA 2Q3PA 1NJIT 1YWXA 3IO1A 1HNWF 2L3MA 2OELA 4ES1A 1CC7A 5ETPA 1RKIA 3L9ZA 4XAKA 5DRKA 4WPAA 2MLXA 2E44A 3I96A 3JSMB 2AEMA 4G1QA 5IOLA 3GV7B 3R5JB 2ZH5A 4C0BA 4DR4J 2HBRB 2G9OA 5GAGI 5SZTA 4LVNP 4QIEA 3CMES 2Z8QA 3CC7S 4AL7A 5IS2A 5IQ6A 4DPWA 1S79A 3I4HX 3G8QA 3GPAA 4Z7CA 2KL8A 1Q8IA 2XQCA 2DR9A 4FXDA 1XR7A 3IRXA 1XEZA 4YB6A 2QJ3A 2PI5A 3GYNA 5T41A 2U2FA 4IH6A 1PBAA 1N6QB 1FNMA 4EMDA 1NRKA 5K20B 3UE2A 1I5OB 3EZ5A 2K1RB 4KGVB 5F8MA 1HWLA 5ETOA 4DV6J 2IPOB 2KHCA 3SDEA 3NXZA 4F02A 3O1LA 2VPZB 5A0YB 5KFRA 4QOTA 2H5IB 2NREA 3N5BA 4J9PA 1TTHB 2I2YA 2CJBA 4CO3A 4NWBA 1TZ0A 4DPUA 3RW6A 2IRYA 2MGZB 3V2UC 1CJTB 3UR3C 1KLMB 3MOJB 3OJUA 2CVIA 2XSJB 3WQPA 2K3KA 3QPIA 1JJHA 3PYFA 3X3UA 5DM7Q 1MNEA 2HVIA 4C0OC 1RT3B 4PXEA 1HNIB 5CA5A 4LQ9A 3RAMA 3CMAS 3AD9C 4FYVB 3NWRA 4JV2A 2QT7A 1CS4B 2B56A 2AZ3A 3KUEA 2UXCJ 3HVRA 2ACMA 5DS7A 1C0UA 2GO9A 1LFPA 3GJSB 4K4ZA 5F8LA 3Q22A 1KBRA 2FVRA 3W3SA 2OPQA 3AJ2A 1DJ0A 5A8KA 4DUZF 2W1BA 3DRYA 3M6VA 1OIAA 1FKPB 3TVKA 2HFZA 1FDNA 2ZJPQ 3JYTA 1MROA 1MW7A 2MQMA 3EGNA 5HP1B 1FD8A 3M6WA 4X66F 1V3SA 1OSDA 4DFJA 2Z4PA 3RBEA 3E8OA 1LK7A 1N33J 5A2QU 4F4YA 4OZLA 1JLEA 3QO9A 2QEXS 3D3CJ 4ID5A 2A1BA 2XMTA 1VQMS 3WDOA 5CCMA 1TK5A 4YB1P 3RBDA 3BBFA 3TO8A 3DM2B 5J2QB 1X5TA 1YJWS 2PSZA 4NA2A 3IBWA 1F3FA 3UD5A 2FQQB 4EGLA 2KYXA 1K9MT 2YPZA 2XZWA 1TKDA 3BO4A 1O0PA 4EO6A 3GYGA 4JB8B 5ETMA 2QLXA 2VC0A 2CQIA 3G96A 4IR1A 5BR8J 5G4DA 3GLJA 1SUQB 4USHA 3GFZA 5DM6Q 3P45B 3Q2SC 3D1OA 2GHVC 2F8EX 2GHWA 3IGNA 2ILZA 2D3OR 4JI1J 1FO1A 2FHJA 4ZP8A 2Z2ZA 2MKIA 3DOMB 4UTGA 4FP9A 1C4AA 1WG1A 5KG3A 2VQEF 4RBVA 2RDDA 2W9CA 3OXLA 2Q6CA 2XTJP 4JI2J 1N52B 4LRCA 2CKWA 2ZM6J 1MLAA 3E3XA 5F9NA 3D67A 4Y2AA 4ELUA 1LWXA 4Q0BB 1E6VB 3TA1A 3LAKA 1YK9A 2DNPA 4X62J 4RW8B 1GAOA 1D8YA 2CYYA 1S1TA 4RO0A 2HHPA 5CAAA 1D9DA 4YY3F 3V6DB 2XHCA 2RU3A 2XSFA 4WFXA 3L4BC 2FGOA 3C3LA 1QVFR 3LP1A 2DNKA 2Z56B 3HPOA 1YITS 2YKNB 3KFWX 1Q53A 3VVUA 1MWYA 4A46A 3OJSA 4WCEQ 3G86A 2CZ4A 5IC6B 2V8PA 3PR4A 1XMQF 1RK8A 4RU2A 1C0TA 3D68A 3CCMS 2JOQA 3TQ1A 3NGDA 3BDPA 2YH0A 2CPXA 1HNZF 2POKA 1FRKA 4B3SF 2AJ1A 2BQ3A 1JLAB 5KG1A 1GMWA 3NS5A 1IBLJ 2FHMA 1CQMA 1X9MA 4E8UA 2JC0A 5L8RC 2Q43A 2MKSA 2YKQA 3N9UC 2MY8A 2YWHA 4ELVA 3UCGA 1CBKA 1FRLA 1ZZFA 2V2QA 4DV5J 2ATCB 3FBEA 3CE8A 4DV3J 3D66A 3QIPA 1HBNB 2RD5C 2D7SA 3HT3A 4UQTA 4DF8A 4ANDA 3MHYA 2HZVA 1O5JA 1VLOA 3RR8A 4H4OA 3CJKB 3G6VA 1Z1ZA 4KFBA 3UW1A 1RXOB 4ZLPA 2AP6A 5DQIA 4C8ZA 3PO5A 3GG1A 3D6FB 1NEEA 1IBKJ 1VQNS 3HD1A 3RUBL 2QFJA 1VFJA 1HI1A 1CG2A 2Y1RI 5KFXA 1RACB 1GXLA 1UJ6A 4P52A 4XDDA 4ILLA 4TXSA 1J27A 1H98A 1GQEA 1CC8A 3B78A 3QBCA 3HI9A 3KKFA 4DZDA 3J7A1 2AJ4A 3THVA 1GMWD 1RABB 4J7CA 2EG2A 3W5ZA 2OEJA 1FRIA 2GHPA 4RW6B 1RWOB 4G1PA 4MKVA 1FWKA 1X4CA 1HBMA 1RU1A 2HBZB 1S48A 1ZETA 1U0SA 2ZVIA 1O6XA 5B0FA 5HQ8A 3NMRA 5GAGU 1DRZA 3G6XA 3RB0A 2W7PA 2HBYB 1R0AA 2RUGA 5CYQB 5KOWA 3ZZUA 2I38A 2GZOA 5EHHA 3C14B 2B0GA 3W5XA 4NA3A 4N41A 1WJ9A 4Z2XA 5E2QA 1DQ9A 3FSXA 4ZITA 3BGRA 4PXCA 2P8IA 2GJFA 3B4MA 4F3OA 1P1LA 5LM7E 1J5EJ 1XN9A 3MPVA 4HTJA 3M2RA 2Z0GA 4B3OB 1RADB 2UP1A 1QE1A 2A3JA 4FYWB 1KVIA 2YQ0A 2AYMA 1RDRA 5KT5A 2G1HA 2F4FA 4LF4J 5CH7B 3TUPA 1BQXA 3MCOA 1NK7A 1R43A 4DV7J 1XNQF 3DRSB 3CD0A 4IOBA 1XC9A 2R7QA 5H9FK 3HHLB 1RHMB 2LEAA 2Q66A 2LLZA 1XIQA 1UFWA 4CH7A 1AZSB 2OPPA 2D9PA 4RBUA 3N0VA 1Z2ZA 3P49B 1JX4A 2VQFF 1HMVA 5DLGA 2N7YA 4I67A 2Z30B 3D6HB 1TMMA 3G71S 1B3TA 1SIWB 5C2GA 5KFUA 2GMLA 3VAKA 2NS1B 3FC9A 5D4OA 2GC8A 2BJ9A 4A8WA 1JXVA 2CPYA 4A8SA 4XTTA 4XDCA 2NR0A 1JNRB 1S57A 2HNZB 4Y6IA 2EC0A 2NCKL 4ZN3A 5CHCB 1B7FA 4LFAJ 3PTWA 2GMHA 4K2JA 2BRKA 5L9XA 3N79A 4LR7A 4MK9A 2E9TA 4XPEA 2DYAA 5CZXA 1MU2B 3GP9A 3M8ZA 2YKAA 4DR1F 1KQGB 1JKHA 4C11B 2QX0A 2VD3A 3OW2R 4JUZA 1SQFA 3KMSA 1XBWA 1SJ3P 3HHEA 1ZA2B 2XM3A 4O44A 1WHVA 5J2PA 2UZAA 2OGUA 1KFDA 3TAMA 1HBOA 3IS9A 4DSIA 1W2IA 2E1RA 3T6BA 4MFBB 2L9DA 3M8SA 5HI7A 1T11A 3HHDA 1UEVA 3RTVA 4MMOA 1X9WA 2YNHA 2ZOGA 2V50A 1WSVA 3KG4A 1PBUA 5L9NA 5DGAA 2UVUA 1ZTTA 4CH1A 4CTAA 3W7BA 1R8HA 2IDEA 3CB4A 4F25A 2XS2A 1U2FA 1SC6A 2I6WA 2DNMA 1H74A 4OI3A 3M30B 2WOMA 1FE0A 1RI7A 3BSOA 4F4ZA 2AIRB 1LW2A 2WSCC 2EFNA 4N8NA 4CO0A 3LUYA 1BLUA 3J7YI 2JC1A 3IR6B 5GMKa 2LXUA 1FCAA 2DR5A 3KUGA 3RRKA 3KG0A 4GKJJ 4JI4F 4LF7F 1PC5A 5LJ3Y 4NLGA 4AD6A 3LALA 4ALZA 1NZAA 3SI8A 4CYUB 4P9SA 1VMBA 2R4FA 1RUSA 2IAJB 4OYOA 4X65J 2J9EA 1BWVA 4RUCA 1JLQB 4USKA 1PYOB 1NJWA 1H6KX 1DQ8A 5LXYA 5J1EB 4MJKA 4O4GA 4CT9A 1ZAWA 2XHWA 2VA3A 4ZPWR 3QRPA 3W8GA 4PXBA 3CCSS 4NEYA 4PWDB 1Y9OA 2EK6A 1EKRA 1NK5A 2HFSA 3TVYA 4LBPA 3VGSA 1RBLA 1N54B 2V2KA 3BGOP 3KK3A 3GIRA 2ASLA 3CEDA 3F0NA 3B54A 3M6XA 5KG2A 3F73A 2DRBA 5KG5A 2IJFA 4PQUA 3MR5A 3MEEA 4AQYF 4LREA 1RTJA 3AH6A 3GSDA 5B0GA 1TAUA 4C3LA 3QJLA 2X1BA 2ZH4A 2H54B 1RP5A 5GAHU 2M5YA 5KFVA 2NYHA 4DCPB 4UT4A 3MOZA 3VF0B 1KWMA 1OO0B 2RDJA 4Q45A 4M5NA 4C0HA 1QDUB 4USWA 2C3YA 3SCJE 1WWHA 5KFKA 3EVWA 2ZBIA 3PDNA 5J1PA 4NI2B 3GIKA 3N4WA 3RB6A 5IT0A 2J0XA 2R2SA 2B3TB 1NXIA 3AOBA 2KVIA 3QLHB 8AT1B 3ELHA 3SCLE 3DC2A 1RWVB 1D9FA 2DNLA 4I2PB 1F1BB 2WRMA 1UP1A 5M2UA 2QIFA 2PEBA 1PAEX 2PIIA 4EK2A 1QSYA 3U7JA 3KXDA 5C7PA 2E9RX 3PV8A 2V2VA 3CTRA 2DHSA 4GC6A 2J6SA 2DPJA 1VGYA 4TY8B 2QRRA 1UVNA 4M5DA 3VGVA 2YNGB 3OVAA 3NP5A 4KB7A 1U0HA 5HMZA 3SIPB 3K89A 2DY1A 4J9KA 2D9OA 2VOPA 4LF5F 1XERA 1J5OB 2MZ1A 1CJUB 2WCXA 3MUMP 1WOSA 2DNQA 2RRAA 1VRUA 3J7AN 3I56S 4RWWA 4L72B 2BYCA 3V81B 1O8BA 1OQ3A 1WI6A 2HRTA 4X64F 2VA2A 5GMEA 1F0XA 1GTHA 4LRAA 3DHWC 2PD1A 3HSJA 1BHNA 3KNGA 4PRFA 4DS5A 4DCJB 2HKEA 3K58A 3G6YA 2KZZA 2XBPA 2Q6BA 3DU6A 2DIUA 2J76E 1HQ2A 5FDLB 2HVZA 2VDHA 1JXLA 2GJIA 2NZ4A 3M8PA 1K0TA 4QWAA 1IR0A 4DR7J 1AFIA 2HURA 2OPSB 1TL5A 4BWJA 3CJRA 3TZYA 2DD8S 3UR0A 5AE1A 3W1YC 1GFWB 1YTYA 5K8NA 2G0CA 5J2NB 4X4TA 3MM7B 3M8QA 2P6SA 3MMBB 5K14B 4DV1J 1DTQA 3HZEA 1RWXB 3KNAA 5KT3A 1IKVB 2XG8A 3M32A 2J9DE 4TKTA 3CXCR 4I4BA 1NSAA 1OMSA 3KDOA 1OPIA 4GKKJ 1D0EA 3FCHA 4I2QA 2LU2A 4LF1A 3PX4A 4LFBJ 2CAJA 5LXRA 4C4WA 1WTBA 1SC3B 2AX1A 2C2ZB 1UFLA 4K4YA 3MR3A 1IQTA 2YBVA 2LQ9A 3J7Z5 4YB7A 3EGVA 3ZZ0A 4LUBA 3MURP 2I1RA 5AXNA 3MDFA 3AXKA 4TU7A 1N5SA 3V6JA 5KT2A 4K0KF 4YB5A 3CIZA 3AA8A 5B0AA 3CCJS 5CQGA 2N3LA 2W9BB 3HD2A 2HFOA 1N6QA 3SFUA 2UV8A 3PFEA 2ASDA 4FZVA 4KBIA 2MQQA 3G82A 1WUUA 2WVCA 1EETA 4NLOA 4IDKA 1FKAF 2ALYB 4RJVA 2ZH2A 4YHHF 2UU9J 3BH6B 2RQ4A 3LTOA 4ZK7M 2R2RA 4CLFA 3TX0A 2GAGC 2GX8A 3UDCA 2FVCA 2V5HG 1S1XA 4CRJA 2CG4A 2MGZA 1R31A 5JJBA 5DDPC 4P73A 1CJTA 3TYTA 2VJUA 3DXSX 4L3NA 2XCPA 4DL5A 4PEOA 4DU8A 3UVJB 3UN2A 3MD1A 2UXDJ 1DQAA 4G1IA 3EE3A 5EUHA 7AT1B 4CO4A 1CS4A 2DR6A 4DS4A 3KJVB 4B3RJ 2UXBF 3JSBA 1XR6A 2VB6A 1F9EB 2MHNA 2M8HA 4IFVA 2DHXA 3N5FA 2GQQA 1SV5B 4B3MJ 5HLFB 1XR5A 4HACA 3HO1A 1D9AA 2YNIB 2XMKA 1IKWA 3OLBA 4WZQA 1H73A 2XZTB 3G8SA 3RGIA 2K2PA 4WZMA 3PKYA 1S72S 3QZ8A 3KLHB 1URNA 2RF2A 3RB4A 1QY7A 2VH7A 4DMZA 2MPUA 5KAKA 1H3DA 4DEZA 1RAAB 4DR6F 5CYJA 5IFMA 2QMXA 3T1YJ 2BDPA 3PIOQ 2J0QD 4OYXA 4PG4A 4NOHA 4JV5F 4JBCA 4ZPBA 1IQZA 5ETNA 2QYCA 4Y00A 2UUWA 2ZUGA 3EZUA 2DBBA 4F04B 1LWEB 1VJQA 1IWAA 3TWZA 2AU0A 4KGXB 2B4OA 5J2QA 1RT4B 3ZTRA 4NCBA 3VWSA 4C6AA 1W25A 5E3CA 1SJQA 4M5HA 4NCGB 4ZVSB 2WONB 2J9CA 3MPDA 3OL6A 4TVAB 1TV6A 1IKYA 1WHYA 3PCOB 2ALZA 1FE4A 3OBIA 1VBKA 3Q8SB 3SZ2A 1FNOA 1XWLA 2ZBCA 1K1QA 9ATCB 1SQGA 3QRRA 4LF6J 3BGLA 3EGZA 1Q82T 2JSXA 1U25A 2LECA 4EI2A 3TW0A 3CJ8A 2H9ZA 2R2TA 1HWJA 1L3KA 5LMNJ 4KTQA 2VL1A 3DOMA 4DV4F 2BXJA 1KOOA 2AKWB 3MECA 2FY1A 3EDRB 1YJNS 1ZA1B 3CCES 3ZZPA 2BA9A 4NPOA 1HARA 4KY3A 3LA0A 3JQJA 4USJC 2MQNA 1SH3A 2Z2LA 1FKOB 3ZNUA 4DG1B 1R8PA 4Q0BA 1E6VA 4FF3A 2W24A 1Q8BA 2YKPA 2Y3YA 4DN0A 1Y5IB 1M0SA 4LF9F 2B7BB 3PEHA 4KHPF 2UVVA 1NH8A 4NXMF 5SUHA 5KG6A 2HYIB 2LKZA 1IM6A 4YR2A 3HSGA 4OQJA 2E29A 3T1HJ 4OJ1A 1X5OA 2XYGB 2DY9A 2HHHJ 4IR9A 5KFPA 1FDBA 2GJ2A 1XMOF 4G6VB 2RDIA 4M1KA 1BGXT 2GFFA 2XY6A 1XK8A 3LWLA 3EM1A 4OYBA 3ENAA 2VUGA 5HATA 4NMLA 3MI7X 4C8MA 4C48A 1QSSA 4KO0A 5DJBA 4ATNA 3MMAB 1HD1A 5HVFA 3CJQA 1JLAA 3LP2A 4EZ9A 3GB0A 2J8SA 1HIYA 3CJSA 3OR2A 3SCKE 2PI4A 4E98A 2DNHA 2UUBF 1P27B 5C25A 2OPQB 1K47A 2U1AA 2YX4A 5A8KB 1TK8A 4XK8C 4YDDB 2KM8C 1HBNA 1HKAA 4C9DA 4YMEA 4KIAA 2CQPA 1GXUA 7FDRA 1UVMA 3JYTB 1UVLA 1U49A 1MROB 4ELTA 1UMJA 1NAQA 2KI2A 1UWBA 2VPYB 4KPYA 1CVJA 1R3NA 2X7IA 3LO3A 5LT5A 1ICEB 3QO9B 1X5PA 4ZVFA 3FNNA 4DL0C 4C98A 4CLYA 2DGOA 4AL6A 2C2NA 3QSIA 5ITHA 1RYRA 1KDNA 2LYVA 2KFYA 2EKNA 4Y2KA 3JAMY 2V68A 3A8JA 1P9YA 1TKTA 4RW6A 2XY5A 3PW7A 2AZ1A 5FJ4A 2CQ3A 5MAOA 5GADI 3OL7A 2AJQA 4X84A 1RTHA 2C2RA 2DNOA 2FGCA 4WP3A 2HHQA 1FRJA 1OYEA 2R7RA 4NXNF 4I0WA 1SVDA 4I69A 3QATA 4FXVA 2ZHAA 3HM9A 3BQ2A 4RX6A 2HZCA 4F67A 2CJYB 3IM8A 2M9KA 5CYQA 4LRDA 4NLTA 2Z2YB 4A4JA 1H72C 4RLEA 2IRXA 3HCXA 5H9EJ 4O3RA 1SB6A 3DOKB 4K4WA 2ZNZA 2W9CB 5D0GA 4ZCIA 1DLOB 1RT7A 4B9UA 1VQLS 3R7SB 4I68A 1HNXJ 4RBTA 2A18A 3GONA 3LP0A 1FDDA 4FYXB 2FLPA 1XNRF 3G9CA 1WF0A 3QSYB 2BR0A 1RTZA 1X4DA 2YX7A 2LMIA 1R27B 1S1TB 4OZ3A 5AJ3F 5LSRA 2YTCA 3H5SA 2XMWA 4OX8A 2C2EA 2ZDPA 4CLKA 2V8HA 3D0GE 4O3OA 4M5MA 2VBWA 1NHKL 3HFZB 4RPFA 3LP1B 1N34F 2AMCB 4HKQA 1NDPA 3DRSA 2RB7A 4N77A 1AFJA 2W2NP 2BOAA 3PM9A 4L6V3 4JI0F 4F8RA 2QSWA 4I1TA 1UFKA 4M5GA 2ZVSA 4ED2A 4U95A 6AT1B 4PXDA 3GFHA 4WE1B 4JOUA 3X1LB 1HHSA 3FZBA 2PEHA 4PG5A 5IT9U 1N8RT 4DPYA 5MLCV 2M8DB 3MEGA 2OPRB 4DSEA 4BC9A 4WXOA 2G1DA 4C8LA 2FJVA 1Y5NB 4IQMA 1S1WA 1FXRA 3NLCA 4DUYJ 2KB2A 2DO4A 1VQSA 2HNZA 3UFCX 3C15B 3OSPA 1EJ7L 2OTJS 4HL9A 1N33F 3SQOP 4JI7J 3IA0A 4JI5F 3KHRA 4ZLNA 2HAIA 5ADZA 4HHJA 2X3DA 1WHXA 2CPDA 3FBBA 2AEJA 3D7SB 1YVFA 4H4OB 3QT7A 2R8KA 4KFBB 1MU2A 2ZWOA 2VKZG 2CWKA 4P75A 3VQTA 1YDLA 2UVRA 2CADA 1OY8A 3C6TA 3CJ3A 2CPZA 4C11A 2V8GA 1YRUA 3G8TA 3HHLD 4AT1B 3IBFB 4DXLA 4DSKA 3JS9A 3ENWA 4GO7X 3IM9A 2C3OA 2HPUA 4HHUA 4KT0C 4WYLA 1F9HA 2HGMA 3UWTA 1X0PA 4NLUA 5DZ7A 1FRXA 4OFZA 3G4SS 2ZUAA 1GNKA 3EX7B 1N32F 1JB0C 5D8HB 1VRQC 1YKWA 4A48A 1K73T 1KNZA 4P71A 2Y1JA 3QFHA 2AEFA 1HBMB 5THWA 2G0IA 1Y4ZB 2JVRA 4ZVTB 5A8RB 4JI2F 3OFGA 4UOHA 4QWDA 1HNWJ 5AXLA 2ZM6F 3VVTA 3HDSA 3H90A 3OR1A 4B02A 1ZPVA 2DHAA 4OZ1A 2R7WA 4H54A 3H5XA 1Y7PA 4F36A 2KT2A 1R0AB 3VAIA 4CWBA 4OX6A 4X62F 3DLGA 4PYAA 1WC3A 5CYMA 2EFVA 1P8GA 4EUVA 4JI3J 4I56A 4L73A 3OTOF 2HNYB 2XYPB 2QE5A 2CFXA 3B8HA 3QWUA 4C8YA 5D0HA 2MHEA 2VOOA 2HSEB 4OZNA 2RIJA 4RW9A 2A2CA 2WAQD 3AY0A 2ZOFA 5A2QY 3T19A 4BCAA 3WBZA 4DX8H 4ZKAA 2ZBRA 2JX2A 2DCUB 2IM1A 4R5PB 2B4VA 1SQEA 2MEWA 3MR2A 4CYUA 5HL7Q 2BW7A 3PRVA 2OSQA 3M2RB 4LBIA 2R8JA 1EZZB 2KJVA 2CDRB 3MCSA 1QE1B 4RWXA 3KK1A 4DFKA 2M2BA 4DV0J 1QD1A 1JJ4A 2P9EA 1G6BA 5ETKA 3VQSA 4GMKA 3NNAA 2V4QA 2FLNA 2R7XA 3H8YA 2R7TA 5J1EA 2BQRA 5IXUA 1V6HA 4EBDA 2G0JA 4AFFA 2JL9A 3KLEA 4TYAA 3M9OB 3CPWR 4ERDA 4J5OA 4PWDA 4XIUA 2B51A 1H7WA 2OPPB 1VBXA 2XCAA 4PPDA 2M70A 4FN5A 2O67A 1FT8A 2CRLA 5J2MB 1HMVB 4YQWA 1RZMA 8ATCB 2KG0A 3OT9A 1W26A 3C6UA 1FXLA 4QYZK 1BQMA 4X4PA 2C3PA 1IUJA 2QZ8A 3AQOA 4R0JA 2DHHA 3RZAA 3QGGA 3J80U 4RKUC 2ZBQA 1SBRA 2EVZA 3ZNJ1 2D1CA 2IM3A 2LXFA 3E01A 4BWMA 4DUZJ 4AL5A 2PMZD 4P6QA 3N6NA 1FESA 3AQPA 1K44A 1LWFA 5DG8A 4UY8T 2VPXB 4F2SA 1U1QA 2IVFB 3W9HA 1NB2A 1X9SA 3KTQA 4NI2A 5K5MA 1RAHB 2BJ8A 3ZZYA 4X66J 2E7VA 4FKYA 4F4WA 3UQSA 5I42B 2FHKA 2HWTA 3D9BA 3K2YA 1LNQA 3IG1A 2KZMA 3I82A 5J2PB 3Q8RB 4DR2F 3UDEA 2LA4A 3TA2A 2CJQA 2NSBA 3TAMB 1HBOB 2D3O1 3GWCA 3NOCA 3BS9A 3ISZA 4K50A 4YFUA 2IBKA 2OAUA 4P74A 3I9ZA 2H48B 4HVZA 4I6AA 5GADU 2KN4A 4HT5A 1WKJA 2BE7D 2XWXA 4IO9Q 1G2EA 1NDCA 1FNXH 1NK8A 2JLGA 1R89A 3AAWB 3R2CJ 4KJIA 1J5OA 4MH8A 4CTAB 1CJUA 4QIVA 1NHUA 1FFSB 2AYEA 1Q78A 3H0PA 3CF5Q 1WOPA 2PC6A 4ANEA 4Y2MA 1D8ZA 1VQ8S 1J5EF 3D28A 2NZCA 3U1LA 3BJYA 2WOMB 3NKYA 3TUZC 3P4UB 2IYIA 3UNGC 1NU4A 3P96A 1SL2A 4NASA 1LW2B 3JTOA 2VQEJ 1TL7A 1KTVA 2XMAA 3BPSP 3FCVA 4RL1A 1S4EA 3PIPQ 2JJ4D 1FTRA 4ITSA 2FJAB 4F3MA 4DV7F 2LEPA 2WB4A 1S6QA 3LGHA 3MZIA 4W98A 1OJ4A 5JVHQ 1TELA 3L7PA 4F0HA 2DGQA 1LQ9A 3PO4A 1NHVA 2X51A 4YY3J 3B6BA 4ED5A 2F8MA 3NGUA 4O4GB 4B08A 3AOCA 3BB5A 4J37A 3DXBA 5E5NA 1T95A 3E2EA 2VFVA 5KFIA 2C28A 3CC4S 1XMQJ 3QAEA 1P9QC 1S7IA 3BYPA 1M5KC 3I32A 3KK3B 4GC7A 1T8EA 3TZXA 2NXCA 1NSQA 4LFAF 3Q24A 2F8HA 3OUYA 3UPFA 4Q8FA 4UOCA 1Q8LA 2F63A 5G0RB 3MEEB 4FVMA 3CULA 3MUVP 5C24B 1RTJB 4CLTA 4LSNA 3ZC4A 5KFOA 2NXJA 1TU0B 1G4CA 3V6KA 1NPRA 2KTQA 2A6MA 2Z57B 2DRDA 1VI7A 4ED1A 1DZ5A 3MM6B 2WHOA 3QGIA 3PYDA 3CSKA 4QYRA 1KQKA 3DDIA 2MKKA 4Q44A 4NLPA 1KFSA 2HHXA 4N8OA 3P8BB 2E5HA 4FYYB 2WBRA 2GIRA 5IT4A 3BGUA 2FIUA 3SBMA 3HSZA 1LEOA 2XGQA 2ZH8A 3ILJA 4PUOB 5DDQC 3C8YA 4O23A 1KRPA 4H4KA 3FGVA 4NLQA 2RS8A 3BM7A 1IM4A 2HHVA 1S49A 1C2PA 4M5DB 1UWAA 1U0HB 3KJVA 2FPHX 5AE3A 3KLGB 3FMWA 4PG7A 2V9KA 1HBUB 4B3TJ 1UA0A 4MK8A 1G3OA 1WSRA 1YBAA 1TFWA 2XY7A 2ZJQQ 2YNIA 3K5LA 2CDQA 5D0EA 2VHGA 4GKJF 1EARA 3PHEA 2IC3B 2PGCA 2CQHA 1JLBB 2EXUA 3KLHA 1NK9A 1PILA 1BQNB 4ECUA 1RTDA 4MKBA 2HQCA 2B6AA 1X4BA 4DSFA 5DDRC 3CCZA 5JVGQ 2YPYA 1ZM2A 4NLRA 3CDWA 2FLLA 2IDLA 2PMHA 3Q2TC 5D77A 3M8PB 2QA1A 3R5CA 2QL7B 3MPUB 1NUEA 3IN5A 1F5AA 1TMJA 2J7KA 2ZITA 1RT1B 5IM0B 1C1BB 2JNJA 2DVIA 4ZA1A 2FYXA 3T5LA 2D74B 2VICA 1DTQB 2YKOA 3HHLC 5EWEA 2WONA 3GFYA 1PGZA 3M32B 1XNQJ 5L1LA 1H38A 3IXQA 3S1TA 2ZH9A 3U1NA 1I94F 4QU7A 5D4LA 3WC2A 3D3BJ 2VZ9A 3OPKA 4I2QB 2LXIA 4K4XA 2OFGX 1WC6A 1IR2A 2W8KA 3W2VA 1YJ9S 1R0CB 4J9RA 4AE5A 2A0FB 4DX5A 2B9WA 2V4RA 3FQKA 3M05A 3OTDA 2VQFJ 1S0NA 3DDNA 2CQBA 3Q8YA 4O4RA 1A9NB 2YKMB 3TARA 2Q79A 2OP5A 2MZQA 2C22A 4LJMA 2EFPA 4R8UA 4LSLA 3OVSA 1QTNB 4RU9A 1FF2A 3IWXA 1TUGB 4IUFA 2J8AA 1FKOA 1OS5A 1MSWD 4DG1A 2HAFA 2QA4G 2CG8A 3H7HB 2UVWA 3FFIB 5FLXU 4F4AA 3G82B 2H4WB 4HTIA 5F8IA 1YBUA 3HZGA 1EETB 2AJ0A 3V4IA 4KR0B 4IDKB 2GGPA 2RUSA 3DLHA 3MPYA 1ROFA 1Q7LB 2E5IA 3MMCA 2W4CA 1M90T 1U26A 3QRQA 1KSPA 4RW7B 2B4PA 2DIVA 4ENOA 2E7XA 2CXEA 5IC4B 5F0UA 3D1HA 1S1XB 4KH1B 4XO0A 4N47A 4DF4A 1NPPA 4ZJOA 3QYYA 4FYDA 2LFVA 3UN3A 3O3LA 4F3QA 1NJXA 1D09B 4PCQA 3K7RA 3MMAA 4HHHA 3KWMA 3GYXB 1SJFA 3US5A 2OD6A 2DNNA 1SCJB 4IFVB 2BABA 1NM2A 3HVTB 2DISA 3H98A 3QFWA 1T05B 2H65B 1FEEA 1UVJA 4HACB 2HVHA 2DXFA 3PNIA 5KOXA 4EBCA 1IKWB 1SPBP 2M3DA 2V8VA 4UUWA 4WIIA 1HW9A 2ROPA 4P7VA 3H20A 4DR7F 2RF2B 1FJGJ 3EVMA 3W5YA 3TR5A 3OXFA 2L08A 4QQBA 5B09A 1VIXA 3AODA 4QW8A 3JB9k 3M2UB 2CQ2A 4F0KA 1Q1KA 3TX8A 4CO1A 4DV1F 1CJVB 2PFFB 1WHWA 2E5LF 1DTTA 4J9UE 4DQIA 1GX6A 1U8SA 3LPEA 2CNLB 1WEZA 2EK1A 4IYQA 4GKKF 4ED0A 1B70B 1MWQA 1WDTA 3W9IA 2R8IA 4C8KA 2DGVA 1T94A 4LQ3A 4MYUA 2AJ2A 3M4XA 4X4SA 2KXNB 1ELOA 3OLAA 1TV6B 3R6LB 1LXNA 1HQUA 3CCWA 1N5QA 1IKYB 4C3MA 3W65A 2W7AA 1TVRA 3AJDA 4OYWA 5KFYA 4UF4A 3DU5A 4N76A 4RNHA 3W60A 4L76A 3CDUA 1GXTA 3H5YA 5KFTA 2NLWA 1RJJA 1U2CA 3MECB 3CD7A 4X4NA 3Q8QB 2W25A 4F26A 3DOKA 1VBYA 2MQ8A 2V8DA 3TA0A 3ZXWA 5K9FA 1DLOA 3MD3A 1NCLA 2MKYA 4WF9Q 4DN9A 3BO3A 5C5JA 4KYZA 1JQGA 4FF4A 4M5JA 2PT0A 2VKRA 1U02A 3PKMA 1M5HA 3CJ2A 4JI8J 2I9SA 2RH3A 2EFOA 3NGRA 1GMUA 1F5BA 2B43A 4O3NA 2KU7A 2F65A 1OY9A 1KHVA 4M8LA 4KC5A 2P5VA 1KP6A 3WC0A 3LGMA 1CULA 3GCXP 3J81U 1FX2A 4B3RF 3VAGA 2J9DA 1FI4A 2LEBA 1P1TA 4GRSA 2MQOA 1H7XA 2RQCA 5IWAJ 4K4VA 2H4YB 2B9YA 2FHJD 4WE1A 1TL1A 4KO0B 2OPRA 5H9EK 2W2QP 5KFNA 4OHZA 3LP2B 2OI2A 5B08A 1IR1A 1S77D 1NK4A 4LT6A 3OTBA 4P2FA 2YY3A 3U27A 3OR2B 5D4PA 1ZM3A 5C25B 4ECZA 3C15A 3IFEA 1Q8KA 4I6WA 4IRCA 2GIQA 3TZZA 5GAEI 3B4DA 3NBPA 2KFNA 3T9NA 4USUA 2XO6A 4A8QA 5E3PA 3OFEA 1HHQA 2QLFB 4WKRA 1CSJA 3QJPA 4DZ6A 3MM5A 3RB3A 4MT1A 5D3GB 4M63A 2RILA 4WP8A 3PZPA 1UWBB 5DO2A 3KUHA 2PMWA 2NXUA 4JP8A 1PIEA 4CLUA 2ZZTA 1FJ7A 5HMWA 3PYEA 3VR1A 8RUCA 4ZLLA 2EC2A 1F9FA 3JSRA 1CLFA 5BYSA 4J91A 4HH0A 3P5BP 2HIQA 2DRAA 3K5MA 1DBDA 3C66A 3NGSA 3M1VB 2KH9A 4NE9C 4JV1A 4LF6F 3W66A 1U09A 4IH5A 3IRWP 2HHWA 2ZHOA 3QMQA 3CDAA 1TKTB 2QL9B 1KS2A 2DKOB 3IGVA 1VC0A 2IA6A 4QWBA 1KVKA 1BY9A 2DEJA 2MQLA 4PKDB 4GO5X 1M5OC 3M7VA 2FLOA 3BSCA 1RTHB 3S8SA 2FC9A 1VJWA 4TNOA 5A8RA 5D78A 3O6QA 1MN9A 3POTB 2J7WA 4DQRA 4EYIB 2EFGA 4PYDA 4N56A 3K17A 4X2BA 3LH2S 2HHSA 2IBOA 2F4VF 3D0IE 1U1RA 5IZHA 4BDPA 1M1HA 2HNYA 2V4JA 5J1NA 2D69A 2HW3A 2A6OA 1JLCA 1RT7B 3AOAA 4P7TA 1H2UX 2F5GA 4IG0A 1RQ0A 1Q4RA 3T1HF 1Q79A 3OQ2A 3LP0B 4R5PA 2JH3A 3BKUA 1FDAA 1DHMA 1OSCA 2W9AA 5AE2A 2RHSB 5DG9A 1G1XA 2M7SA 4JI6J 2E1MC 4B9MA 4MYTA 4UZBA 1Y3JA 5T7LA 3KYLA 3M8YA 2BKOA 4ICLA 1T9XA 4QW9A 1YLXA 1UKUA 4H4KC 3WIUA 3MTJA 5DG7A 2A2DA 4ZPVR 1QAIA 4LFCF 3TNVA 3THTA 3OD2A 1DURA 1FVQA 2HVDA 3CJTA 1S12A 1VQPS 1JMTA 2MKHA 1PCAA 3CJ4A 1CQNA 5J2MA 4O3PA 4CM2A 2Y9HA 3MEGB 2X3GA 2ZNYA 2RU9A 1U1MA 4DLEA 1QVGR 3QIDA 3ETOA 1Q95G 4CI0B 1NKBA 3L7OA 2UXBJ 1S1WB 2HMIA 3LPYA 2X1GA 5K8MA 1KKHA 4GVBA 3GR0A 4TYBA 2XMJA 1C4CA 3DMJB 3VZHA 4IH7A 4J9LA 3EJMA 2C2DA 2CPIA 2ZH7A 2JZ5A 1HNVA 1R8BA 1F2HA 2QA4S 1RWWB 2FVQA 1R7IA 4DPXA 3C16A 2HFUA 3FK4A 3MAHA 5I3UA 2HRUA 3C6TB 3N01A 3Q89A 2E1AA 3L3CA 2GVDA 5I42A 4CO5A 3D54A 4JV5J 4MIAA 1RA6A 4K8RA 3OFHA 4MIBA 1V5VA 1HR0F 4P10A 1Y10A 4NYOA 2HS4A 3SSRA 2K7KA 2W2OP 3RRHA 2PE8A 3NWGA 4ZLJA 4DFPA 2V0NA 1XJWB 5KFAA 2ZC4A 1IXKA 1QAJA 2RHQB 1BE4A 4UOFA 4URSA 4CP5A 2AQ4A 2O01C 2BANA 1FX4A 3AHPA 3PFOA 3PJ9A 3OR1B 1M1KT 3L7UA 1HNXF 4ES3A 4MKYA 2IVYA 3MCNA 1TQLA 1N56A 3JTNA 1JK9B 2J6UA 2K06A 2MQPA 5KFZA 3GTYX 4Q2MA 3DLGB 1PYTA 1HWUA 5CYMB 4X4UA 1B4SA 1AB8A 4DV4J 4OI0A 2ZH6A 4RW9B 5KFDA 3SV3A 3QQCD 4QYZJ 4IOAQ 2CJKA 4QWEA 2UUAJ 1EX8A 2QG9B 2RSQA 4DL7A 3ZTSA 3EICA 3FJ2A 2XS7A 2MMYA 5HJYA 1KHWA 4BLGA 3QGHA 1L3UA 3I5AA 4GVLA 3NAIA 3I0SA 1T9YA 1GH8A 1HQEA 1HI0P 1RTIB 3I0RB 5HROB 3I6PA 3KK1B 2JDJA 4KHPJ 2M0GB 1SI9A 1F6TA 4CLZA 2PDAA 2VODA 3F44A 2ERRA 1U1LA 1KQFB 1KLNA 3KLEB 2HWIA 2ZKUA 3KJQB 4K5SA 5B0DA 2IFXA 1WEXA 4UZCA 4ER8A 1FTCA 3MAQA 4B9VA 3KLIA 4KGKA 4WYWA 3PYGA 3F41A 5C42A 4DUYF 1BMQB 2DH8A 4C8NA 3EYZA 4AXJA 2UUCJ 1R8CA 4JV0A 2XMVA 1RWPB 5AXMA 3C6UB 3DYAA 1UJ5A 2HQGA 1BQMB 5G0RA 2XULA 3BF4A 4ES2A 3MUTP 1NK6A 5C24A 1RCOB 4ECXA 1YG0A 2W2PP 1WELA 4LRFA 4U6PA 4DR5J 2VFTA 3P5TL 1F5CA 1QSLA 3E01B 3MM6A 3Q83A 4RNNA 1LWFB 3FEXB 4LIRA 1YJTA 1S9EA 3OL8A 4HH1A 1AA1B 3PR5B 3DOLB 3M9MB 4K4SA 2EKYA 3DLKB 4Q2LA 5EX3A 3PACA 2DNRA 4RNOA 4PUOA 5E7OB 2JFDA 2HHTA 2J5AA 3IG1B 1RBOB 1S0VA 2AF6A 4ECQA 2IVMA 2B7CB 3DLEB 1MMDA 4FVCA 4IKAA 5LSOA 5IT9Y 4YEAA 2R8HA 3FUYA 1REVA 3OTCA 2EBEA 1UVKA 3L95X 4WFZA 1BWEA 4DPTA 1HHTP 4ZVOB 1N5YB 2YWKA 4OHWA 4RNFA 5KFEA 4JI3F 5IV3A 3CUNA 3KLGA 4WTYA 2MJUA 4YR3A 3DLBA 2EBGA 3JXOA 1HBUA 2OH2A 2XLJA 2DXDA 4W90B 4OYIA 3FQLA 1UPPA 3PJXA 2C1EB 4WK3A 2V63A 4NXNJ 1D1UA 1WACA 2CNKB 4K5RA 2IC3A 3GR1A 1JLBA 2B5JB 3UO0A 2O3DA 2G4BA 3WIVA 2HZAA 4PQAA 1BQNA 1JXEA 2XLIA 3KLVA 3J7ZT 4OMFG 1TL7B 2VFRA 2XWYA 4DI6A 4DU7A 4DV0F 1VBZA 3HJFA 3VALA 3BQ0A 2JRSA 3CWJA 1Q86T 2KXFA 3VGTA 1IBMJ 1PC4A 4KAIA 4C97A 2KRRA 3D5MA 2FJWA 2ROGA 2FB0A 2CNNB 3MM8A 1QJHA 1S6QB 4ZCKA 4DBQA 4WKYA 1UZDA 1VK8A 2D41A 4W4MA 1U1OA 1XNRJ 3AB4B 3LQVA 3J81j 1VRTB 1FK9B 2B9EA 3PXGa 2R7OA 1RT1A 3TQEA 2D3ZA 1U2RA 5AJ3J 3ICLA 5IM0A 1C1BA 2Y0BB 1QTMA 3A8IA 2FJXA 4G65A 6FD1A 2HGLA 1R0BG 4YS2A 4U7UK 3DNCA 1I6JA 3GSIA 2OEKA 4EEYA 4BS2A 1TUVA 4B9LA 1LW0A 1N34J 3UD3P 3BBCA 2QC3A 1RCXB 1T02A 4OI6A 1FA0A 4JI0J 3IWLA 4A8OA 1Z2LA 3TJ8A 2DJWA 2VG7A 3ITHB 4FS2A 4FPIA 1TAQA 3EVOA 3OSNA 2OJ3A 2W8LA 3VZIA 3RBZA 2KFZA 4V19X 1U6ZA 2FJEB 2FZCB 4C3KA 2DHGA 1JLFA 2CJXB 3OUYB 2YKMA 2GVZB 1V5IB 3M6UA 2V2ZA 2G13A 1URRA 2HQFA 2P2CB 1EP4B 4LSNB 3R6GB 4PABA 2UV8G 4DV2J 1UCNA 4LBHA 2J0SD 1X4HA 2F7VA 3GMGA 4LIWA 1ACMB 3PEJA 4H4MA 1ZPWX 4RUHA 3K0JA 4PG6A 3A8EA 4JI5J 4B17A 3A3PB 5DQHA 4ZHRB 1SKWA 4EFAC 4M95A 3FFIA 1IVZA 1KQSR 1S97A 1YJVA 1N5TA 1RT6A 3C2PA 1IKXB 2N7CA 3WHIA 3W63A 2CPEA 4U8VA 4K4TA 1WOOA 4S0MA 1X31C 4RW7A 2YQ3A 1FERA 3EPGA 3ISND 3R2DJ 3PX0A 1ZOTA 5EDWA 1U1KA 1N48A 4WIQA 4F50A 3BYRA 4ECSA 1Q7YT 1TL3B 4LF8F 2YWGA 1A7GE 3KLFB 5E3AA 4ANCA 4NLWA 2QMWA 1EQ0A 4ECRA 2YWWA 5HBMA 3IAS9 4WJBA 1N32J 3D4JA 2ACYA 3GIIA 2HG4A 1VQYA 2BVZA 2ZE2B 3HVTA 4U8YA 4DLGA 5I3QA 2VG5A 1S9GB 1T05A 3J80Y 2KHDA 4TY9A 2AV5A 3NEKA 4JYAF 2NQPA 4UUXA 2AGOA 3HSDA 2OMOA 2F9JA 2KT5A 4X4RA 3NY0A 2BQUA 4K2XA 1RTDB 3V6HA 2B6AB 4ZP9A 4MKAA 3J7YU 2DTJA 1UL3A 3OTOJ 1AT1B 3A3OB 4TLQA 4YUDA 2HS0A 1VQ6S 4DJBA 5BYQA 3N6MA 1A6LA 5HVHA 4DFMA 2BMBA 3M2UA 1FJCA 3DRPB 4OHYA 1CJVA 4Y28C 2AJFE 2NYIA 5M2RA 1YRXA 2HBQB 2ZFHA 2BJEA 3CCTA 4FS1A 3HMJG 4CNZA 2IA0A 2FZGB 2K7JA 1FRHA 1YBTA 4NYZA 1S5ZA 1RU2A 4Y2CA 1ZAVA 4Q43A 3CCVS 3MFHA 4OV6A 4I6YA 2QSFA 4TLRA 4ZDNA 2RNEA 2BV3A 2OLWA 3K57A 3HKZD 5B7WA 1VCTA 1S1VA 4EYHB 3R9LA 1NJYA 1M5VC 1RA7A 3VAFA 2GV1A 2HVEA 5DQGA 4DR3F
chains in the Genus database with same CATH topology
3KLGB 4ZP7A 3M6XA 5KG2A 3DFEA 1S6OA 1X4AA 3FMWA 3F73A 4PG7A 3M2VA 2XI2A 3R3TA 4C8OA 2DRBA 3W2VB 5B0BA 1DARA 2RKIA 5F41A 5KG5A 2V9KA 1HBUB 2IJFA 4PQUA 1UA0A 1V3ZA 4MK8A 3MR5A 4PG8A 1T03B 1G3OA 2LCWA 1WF2A 1YBAA 2HLUA 3MEEA 1TFWA 2XY7A 4AQYF 3M30A 2ZJQQ 1RTJA 2YNIA 3AH6A 1ZTWA 3K5LA 2CDQA 5GAHI 3GSDA 4NLDA 5B0GA 3NL0A 1TAUA 4C3LA 4GKJF 1BD6A 2FC8A 3QJLA 2X1BA 2ZH4A 5KT6A 3PHEA 1RP5A 5GAHU 2M5YA 2IC3B 5KFVA 2PGCA 2CQHA 1JLBB 3MOZA 2PA8D 4HI2A 2FHOB 3KLHA 1NK9A 4A8FA 1PILA 1VC6A 3VF0B 3BGRB 2IHR1 4ZVGA 1BQNB 4ECUA 3OHBA 1RTDA 4MKBA 4LSLB 4R8UB 3T1YF 2B6AA 2HS3A 1OO0B 4IFYA 2RDJA 1X4BA 1IN0A 1SH0A 4DSFA 4Q45A 4OV1A 3K8VA 2XEXA 5DDRC 4CO2A 4C0HA 3CCZA 5KT4A 2AGQA 2C3YA 1YRTA 1WI8A 3SCJE 5JVGQ 1OQ6A 4PR6A 4NA1A 1RT5A 1L5UA 1WWHA 5KFKA 1ZM2A 4O0IA 1WTFA 5U47A 3UCUP 2ZBIA 4UQGA 4NLRA 2J7UA 3PDNA 2I5JA 5J1PA 5L1IA 1QAXA 4QU6A 3CDWA 2FLLA 2IAJA 3N4WA 3GIKA 3RB6A 2PMHA 3Q2TC 3OXGA 5IT0A 4NRTA 2J0XA 3R1LA 2BRLA 2R2SA 2F1FA 2B3TB 5D77A 5E33A 3ENQA 3M8PB 2QA1A 2KVIA 2KYZA 3R5CA 3V4IB 4DQQA 1X7VA 3QLHB 2GGPB 3W2WB 2JEGA 5A6PA 4DQPA 3IN5A 1F5AA 1MMNA 3SCLE 1H0HB 3CCQS 3DC2A 1JLQA 5A6WA 3D1QA 3GIJA 3RU0A 2LA6A 2J7KA 3KK2B 3MPWA 1LWCB 1D9FA 2VFSA 3MMCB 5KFQA 2ZITA 5DDOC 2DNLA 1RT1B 4I2PB 5IM0B 1C1BB 2WRMA 1UP1A 3GV8B 5M2UA 2QIFA 2DR8A 4MK7A 2LDIA 2PIIA 4YDXA 4CT8A 2VBZA 1ZM4A 4A8KA 2DVIA 2MDAA 4ZA1A 2RT3A 3G6ES 3U7JA 1QSYA 2JFKA 4EU0A 2E9RX 5F3TA 3T5LA 1IJFB 2D74B 2YVSA 3PV8A 1DTQB 1VQ5S 4HDGA 5EWGA 1DFDA 3N6LA 3GG0A 2YKOA 2JEJA 3CTRA 3HHLC 4HI1A 5EWEA 2SXLA 2WONA 2B9XA 1RYSA 2DHSA 3MFIA 2X1FA 4GC6A 5CXTA 2J6SA 3GFYA 4OX9F 2DPJA 2L9NA 1VGYA 3M32B 5KFBA 5L1LA 1PGZA 5K8PA 4B3TF 2CPHA 4TY8B 4CCHA 2QRRA 1UVNA 4M5DA 1H38A 4OI1A 3IXQA 2YNGB 3OVAA 5LL6d 3NP5A 4KB7A 3S1TA 2ZH9A 3U1NA 1I94F 1VIOA 3SYZA 5D4LA 5HMZA 4QU7A 4KKOA 3WC2A 3DN9A 2D3UA 2OO4A 2VZ9A 3OPKA 4I2QB 2LXIA 3ULHA 5LMNF 4K4XA 4G3IA 3JSYA 2OFGX 2VBYA 4Y3CA 4KV8B 4J9KA 2W8KA 2D9OA 2VOPA 4LF5F 2MSTA 3W2VA 1YJ9S 3WX4A 1TL4A 5KFJA 1JLGB 1XERA 1GX5A 1J5OB 4J9RA 2MZ1A 4AE5A 1T03A 1DAXA 4ID8A 4Q7AA 1B0VA 5BYRA 1HWIA 1Y5LB 2B9WA 4KHMA 2V4RA 2ZD1B 3FQKA 1CEZA 4ZCLA 3M05A 3P6YC 3OTDA 2WCXA 1S0NA 3MUMP 1X4FA 3DDNA 1G7CB 2CQBA 1B0PA 3K5PA 1WD6A 4O4RA 5KTQA 1A9NB 2YKMB 2OTLS 1U24A 2DNQA 2RRAA 2DK2A 1VRUA 1PO6A 4FPRA 3AJ1A 1FD2A 3I56S 3TARA 2R7SA 4RWWA 3Q0AA 4OLPA 2M88A 2Q79A 2OP5A 4J9SA 4L72B 2BYCA 2YNFB 2MZQA 2ABYA 3V81B 3HFKA 1HL6A 2C22A 1O8BA 4LJMA 1LFWA 2YX1A 3MEDB 3BSAA 1OQ3A 2EFPA 5LMUF 2LU1A 4R8UA 4LSLA 4QWCA 1WI6A 3OVSA 4X64F 1M5SA 2VA2A 1F0XA 1GTHA 2JWNA 3DHWC 4QIGA 4RU9A 1FF2A 2PD1A 3IWXA 4ED6A 2W4DA 3KNGA 4IUFA 2J8AA 4DS5A 4PRFA 3OFFA 1FKOA 3O2IA 1OS5A 1MSWD 4DG1A 4ECYA 2QA4G 4V19J 3K58A 3G6YA 4DDFA 4HLBA 2KZZA 2XBPA 3T5HA 4IQXA 2Q1LA 2Q6BA 2UVWA 3E51A 3DU6A 2DIUA 1FJEB 2J76E 1AW0A 1JNZB 4ZPTR 3FFIB 2CZVC 1N36F 5FDLB 1SL1A 1VQKS 3LF0A 2HVZA 1HI8A 3BR8A 1L3TA 3WZ0A 4HTIA 5M2PA 1JXLA 2GJIA 5F8IA 4ZPDA 5D3GA 2NZ4A 3M8PA 2ZH3A 1K0TA 4QWAA 1IR0A 3HZGA 1EETB 2AJ0A 5L1JA 3V4IA 4KR0B 1U1PA 1AFIA 4WFBQ 2HHHF 4IDKB 3QLHA 2GGPA 3W2WA 1JKHB 2OPSB 4AXIA 3DLHA 1TL5A 5KT7A 4BWJA 3NCRA 3MPYA 5KG7A 2DD8S 3CJ0A 3RAQA 1ROFA 1TKZB 3UR0A 1DTTB 5AE1A 3KK2A 1Q7LB 1LWCA 2E5IA 3MMCA 2W4CA 4K4UA 1T7PA 1M90T 1YTYA 5K8NA 1U26A 3NNHA 2G0CA 4I2PA 4RW7B 1KSPA 2B4PA 2MJNA 2DIVA 2PA3A 4O44B 5J2NB 2C3UA 2E7XA 4X4TA 1E6YB 3MM7B 3M8QA 2P6SA 3MMBB 5K14B 5F0UA 1VK3A 2AWZA 3D1HA 1S1XB 3IS9B 3T1AA 1DTQA 4NZ7A 3HZEA 3M9NB 1K1SA 1VLYA 3KNAA 3NNCA 5KT3A 4J9MA 3M1VA 4XO0A 1TR0A 1IKVB 2VFUA 3BGFA 4NLXA 3T9ZA 2CPJA 4C2MA 2XG8A 3M32A 2J9DE 4TKTA 4WFAQ 2IJNA 2ATLA 1B64A 4TY8A 4N47A 4DF4A 4NCAA 4Q5VA 3CXCR 2HQ3A 1S99A 2YNGA 3CDEA 4I4BA 3ZFVA 3FEZA 3QYYA 4FYDA 2MXYA 1OPIA 1UJ4A 2GW8A 1D0EA 3MM9B 1S6PB 3O3LA 3FCHA 4DR4F 1UVIA 4I2QA 3RAXA 4F3QA 4FBTA 2LU2A 2YNHB 4Y34A 2ZKTA 4DSLA 3FSIA 4OX7A 3PX4A 1NJXA 3PW4A 5F8GA 1HQUB 4PCQA 3K7RA 3MMAA 3CD5A 3KWMA 3TI0A 3GYXB 2XNQA 1TVRB 5LXRA 1SJFA 2OSRA 4C4WA 4YP3A 1U6FA 3US5A 2OD6A 4OHVA 2DNNA 2ZD1A 1WTBA 4RZRA 2R9LA 2AX1A 2GQCA 4A47A 3POTA 1HFEL 1UAWA 4D3GA 3SV4A 1UFLA 4K4YA 4IFVB 3MR3A 2BABA 4OI4A 1ZYQA 3HVTB 4N5SA 3PY8A 3H5UA 3OVBA 1IQTA 2DISA 3H98A 1WG4A 2LQ9A 3T6JA 1TP7A 1T05B 3J7Z5 4KSEB 4YB7A 1FEEA 3RR7A 2YNFA 3H59A 3ZZ0A 1UVJA 4LUBA 2HVHA 3V81A 3PNIA 5KOXA 4EBCA 3MURP 4UY85 1OWXA 1IKWB 2I1RA 2M3DA 2BE2B 5KFHA 2K8GA 5AXNA 2KM8B 3MDFA 2V8VA 2DITA 4TU7A 4UUWA 1N5SA 3T5KA 3RW7A 4WIIA 4ECTA 1HW9A 3V6JA 3NRBA 1LK5A 2ROPA 4P7VA 2IMOA 3H20A 5KT2A 4YB5A 3CIZA 4DR7F 4K0KF 1BC6A 3AA8A 5B0AA 2RF2B 1RAJA 2IM2A 3QZ7A 3CCJS 1WEYA 5CQGA 2N3LA 2LVWA 2V94A 4DV6F 5F8HA 3MMJA 2W9BB 3TR5A 2OMLA 3QWPA 2HFOA 4R0EA 1N6QA 1S0OA 2VC1A 3SFUA 2UV8A 2XMUA 3OXFA 1WG5A 3PFEA 5T14A 2ASDA 5FDLA 2L08A 4FZVA 4KBIA 3EUNA 2MQQA 3O5TB 4QQBA 1ZH5A 5E3QA 5B09A 3MR6A 3IC1A 4TN2A 1VIXA 4K59A 2RJZA 4QW8A 1EETA 1JIHA 3KHHA 4NLOA 3JB9k 3M2UB 2CQ2A 2XB2D 4IDKA 1Q1KA 2OPSA 3TX8A 1S0MA 2YH1A 1L3SA 4CO1A 1FKAF 2ZH2A 4YHHF 4DV1F 4ED8A 5F0WA 2PFFB 1WHWA 2HNDB 2E5LF 2RQ4A 4A8YA 4XPCA 4B9NA 4ZK7M 2R2RA 1DTTA 3HP6A 4DQIA 2XGPA 1GX6A 3UDLA 4U7CA 3DI6B 2NPFA 5I4MA 5J2NA 1U8SA 1KVJA 2E5GA 1E6YA 3I4PA 1WEZA 2GX8A 2V9WA 2EK1A 2C3MA 3MM7A 4IYQA 3MMBA 5K14A 3UDCA 2ILYA 4AUKA 5JUMA 3HX9A 2FVCA 2EFQA 4GKKF 1YSJA 2V5HG 1S1XA 1XMBA 7FD1A 4ED0A 2BZ2A 2CG4A 2MGZA 1R31A 5JJBA 5DDPC 2CQ0A 2DGXA 2R8IA 4C8KA 1IKVA 2DGVA 1T94A 3TYTA 5LSLA 4LQ3A 1APSA 4MYUA 3DXSX 4MIWA 2O5DA 2ZOMA 4E0DA 2RRBA 4L3NA 2UXCF 2XCPA 1AROP 4DL5A 2WB1D 2L9WA 3M4XA 4X4SA 2KXNB 1ELOA 1S6PA 4NL5A 4FXWA 2DGTA 3U02A 3OLAA 3HVAA 4FBUA 3MD1A 4QR2A 4ZS6A 1TV6B 2APOA 4FNIA 4OIXA 3I5CA 1DQAA 1SKSA 1LXNA 4G1IA 1HQUA 3CCWA 4IG3A 4ZPCA 5EUHA 3ZZRA 3EPIA 1N5QA 1IKYB 4C3MA 2ASJA 4CO4A 2W7AA 1TVRA 4NLSA 4IOCQ 4DS4A 3KJVB 1R6YA 1TKXB 4MAKA 1TL1B 2FDNA 2UXBF 2ADCA 3JSBA 1JJ2R 3C46A 1XR6A 2DNZA 5E3RA 5KFYA 2VB6A 1XC9A 2MHNA 2M8HA 4DSJA 3DU5A 4IFVA 4QJVA 4TQSA 2P9GA 5HMXA 3KHLA 3U1MA 4PQUB 2DHXA 4N76A 3N5FA 2GQQA 5HN0A 1FJGF 1SV5B 3MEKA 3CGIA 5HLFB 4RNHA 1XR5A 3HO1A 5DGBA 1D9AA 2YNIB 3CDUA 1GXTA 4QZVB 5EGYA 3H5YA 1HWKA 3TVZA 5F8NA 5KFTA 2J0WA 2XMKA 1IKWA 3EXYA 3OLBA 2NLWA 2BE2A 1RJJA 4WZQA 1VQOS 2VG6B 3R5AA 1X8DA 3G8SA 2DNYA 2K2PA 3CT9A 4DHVA 2LDYA 3MECB 4WZMA 3CD7A 2F3JA 3PKYA 1QLNA 2XNRA 4X4NA 3D0HE 1S72S 3QZ8A 3KLHB 2UUTA 3Q8QB 2W25A 4F26A 1Y00A 1URNA 2KO1A 3DOKA 2RF2A 3RB4A 1VQ7S 1VBYA 1QY7A 1HW8A 2V8DA 2E7WA 3TA0A 5K9FA 1DLOA 2RVJA 2VH7A 2W9BA 4OLOA 1X5SA 1U6BA 4DMZA 2MPUA 3MD3A 2BACA 2AD9A 1U47A 5HMYA 4WF9Q 3NBPB 2DPIA 1FRMA 2OFHX 3DMJA 1YI2S 4HEA9 4DN9A 5KAKA 5FLXY 1H3DA 3DRRA 1KTQA 1UETA 4DEZA 3BO3A 4ZPAA 4DR6F 1RT5B 5CYJA 5KFMA 4BBYA 1Y3KA 3UCZP 1HPZA 5C5JA 1KC8T 2I5JB 3UD4P 4URQU 5IFMA 2XO7A 2QMXA 4FF4A 3O8WA 2BDPA 3PIOQ 2C42A 2PT0A 3H4DA 4URGA 3MM5B 1K8AT 2VKRA 1HYSA 3FSYA 2J0QD 3PKMA 3I55S 1M5HA 4PG4A 3CJ2A 4DL4A 4NOHA 4JV5F 3NMAA 4J9QA 4JBCA 1T3OA 3DI6A 1IQZA 2HRYA 2I9SA 2QYCA 2VV5A 4OHXA 3NCPA 4ZPBA 4Y00A 2RH3A 2UUWA 2BOPA 2ZUGA 2EFOA 3EZUA 5CD4H 1K0VA 3K5OA 2DBBA 1ZM9A 1F5BA 2B43A 4QCLA 1LWEB 2Z2MA 4O3NA 3K5NA 2KU7A 4PPZA 2AU0A 1KHVA 3TAQA 2B4OA 1S7HA 4M8LA 4KC5A 4B9TA 3GFXA 5J2QA 1RKJA 1RT4B 4KHRA 2P5VA 3WC0A 1U4BA 3LGMA 2ZH1A 1H2VZ 4Z37A 4NCBA 3OTEA 3VWSA 1W25A 5E3CA 4W92B 4CIOA 2FD2A 3M8RA 2JEIA 3IR7B 1S6UA 4B3RF 3VAGA 5BR8F 2J9DA 2NUUG 3HKWA 2LEBA 1SJQA 4NCGB 2DH7A 2KRBA 3CCLS 2WONB 2J9CA 4NZ0A 2W4PA 4ZCMA 3OL6A 1TV6A 1P1TA 4ECWA 2MQOA 2F40A 1H7XA 4Q8EA 3BREA 2RQCA 1KD1T 2DH9A 3Q8PB 4K4VA 1IKYA 4JI1F 1C1CB 1WHYA 3KHGA 5EN1A 5L39A 2B9YA 1NK0A 2FHJD 2ALZA 1FE4A 1TKXA 4WE1A 2ASYA 1TL1A 2CQ1A 3OBIA 2W7OA 3ISNC 3Q8SB 4TU8A 4KO0B 1S9FA 3SZ2A 3HLUA 1FNOA 2E1CA 3MWBA 3SQGA 1XWLA 4RUAA 2ZBCA 2OPRA 1K1QA 1Z4UA 5KFNA 3BGLA 3EGZA 4IRDA 1Q82T 1QM9A 2JSXA 1U25A 3LP2B 2KXHA 2MKJA 2NPIA 4OHZA 3T5JA 2LECA 1SV5A 2QO3A 3TW0A 5B08A 4JI7F 5HLFA 1S77D 1NK4A 2H9ZA 2R2TA 4LT6A 3OTBA 2FUG9 3ENVA 4ILRA 1HWJA 2YY3A 5A8WB 1L3KA 3U27A 2CQDA 3OR2B 2VL1A 2BUNA 2VG6A 3DOMA 4DV4F 4KTQA 1VRUB 5D4PA 2BXJA 1RT2A 1KOOA 3SFGA 2ADBA 2RQKA 3MECA 3DLLQ 4CNYA 4B9SA 2FY1A 4QIFA 3BDEA 1ZM3A 1KOHA 1YJNS 3CCES 3P3DA 3ZZPA 2ZHBA 1S1UB 5C25B 2BA9A 4ECZA 3IFEA 4NPOA 4ED3A 1HARA 3HHKA 5CCLA 4I6WA 1FXDA 4IRCA 3SEOA 2GIQA 1H2TZ 3CC2S 5F9LA 5GAEI 3AB2B 2V4JB 3B4DA 4USIA 1SL0A 3S6EA 4USJC 3NBPA 2MQNA 1SH3A 2KFNA 3T9NA 1NNDA 2Z2LA 5GVQA 3CCRS 5GAEU 3H2VE 4ILMA 1FKOB 4A8QA