4B3SF

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 19
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3sF00
4YHHF 4DR4F 1N33F 1QJHA 4JI6F 4OX9F 2KJWA 2B7BB 2F4VF 4DR2F 1J5EF 4JYAF 4NXMF 1VMBA 2ZM6F 2B7CB 2UUCF 1G7CB 4JI0F 4LFCF 1IBMF 4DV1F 4LF6F 2VQFF 1HNWF 4JI7F 2BVZA 2J5AA 1XMQF 1IBLF 1B64A 4DV2F 4JI4F 1RISA 1XNQF 2UU9F 4B3MF 4X65F 1GH8A 4JI8F 1FKAF 1CQMA 2RJZA 3ZZPA 4K0KF 2UUBF 4GKKF 4DUYF 5BR8F 1IJFB 1IBKF 4DV5F 4JI1F 4KHPF 5IWAF 4DR7F 4LF4F 1HNZF 4LF8F 4LFBF 4DUZF 1XMOF 4JV5F 5AJ3F 3T1YF 4DV0F 3OTOF 1HNXF 2HHHF 4B3SF 2E5LF 4DR3F 4LFAF 4B3TF 4AQYF 3R3TA 4DR6F 1CQNA 1I94F 4B3RF 4DV3F 4LF7F 2UUAF 1N34F 4X64F 4DV7F 2BXJA 2UXDF 1FJGF 4JI3F 4X66F 2KJVA 4LF5F 4DR5F 4GKJF 1XNRF 4NXNF 1HR0F 3T1HF 1G1XA 4X62F 4LF9F 4YY3F 5LMUF 2UXBF 2YY3A 5LMNF 1LOUA 2UXCF 4JI2F 1IJEB 1F60B 4DR1F 4DV6F 2VQEF 1N32F 4JI5F 1N36F 4DV4F
chains in the Genus database with same CATH superfamily
5HVGA 1TKXB 1QJHA 3BO3A 2DGQA 1F0XA 1M5OC 2XMVA 2C3MA 4RW4B 3DGPB 2B9EA 3C6UA 1R0BG 1RJJA 2ZZNA 3C16A 4J9RA 4FF2A 2ATLA 4PWWA 2D7SA 4OZJA 1Q0NA 1OYDA 1FRLA 1HBMB 4F0HA 1R0CB 2M8HA 1S1UA 5AXMA 2OPQB 1JNZB 5D4PA 2NXJA 1HNZF 1OWXA 2Q3PA 1N32J 3JSRA 2E9TA 1REGX 4ZLLA 1OMSA 4PEOA 2DGOA 5FD1A 1RTHA 2W2PP 2MKSA 2DNYA 3CJQA 1S5ZA 2Z2MA 2QFJA 3W2WA 2I0XA 4KH0B 4QWEA 1IKXB 4M5DA 1P9YA 2EK6A 3P45B 4LQ3A 3M32B 4LF8J 3CJTA 3DOLA 3Q2SC 4O3PA 3KJVA 4Z2XA 1JJHA 4NOHA 5T14A 1GXUA 5KFGA 2VG7A 1C2PA 3A8KA 3VGUA 5DG9A 2ASYA 3EE3A 4B3RJ 5J2NB 4IFVB 1J27A 3NAIA 4RBUA 9ATCB 3OTDA 1U1PA 3MEDA 1FKAF 4K0KF 4ED2A 1BQMA 4UT4A 1F9HA 1U0HB 3IG1A 3FBEA 3TZZA 2J6SA 3SQGB 1CS4A 4WU3A 4F3MA 2HFUA 4OX9J 3J81Y 4R25A 3IO1A 1ZZNA 2ZH4A 3KLEA 2B51A 4BLGA 2BRLA 1PAUB 3RBXA 4C8MA 2KKHA 1UVIA 1PC5A 4ZLNA 2ZJRQ 4TU8A 4IDKB 2OPSB 3HHLD 3ETOA 2Y8WA 1EKSA 2VQEF 2W01A 1PJ5A 2BKPA 1CC7A 1FK9A 1UVKA 2QMWA 2AP6A 4X4QA 3A3NB 3VQTA 2UUCF 1G4CA 2DH7A 1BWEA 1UFWA 5HMZA 2EFGA 2PE8A 3HO1A 2DGSA 2DH8A 1I94J 1JIHA 4NCGA 2F8EX 2JC1A 3HK2A 2HGLA 3MMAA 1D8ZA 1ROFA 4QIGA 4I1TA 3V6KA 3D68A 2KN4A 3DRPB 1YGYA 3KUEA 5BXIA 2MDAA 2DNQA 3C3LA 5EUHA 1CG2A 2E1PA 2G2OA 1WD6A 4OIXA 2XLKA 2OFHX 2DGVA 5HK4A 3S7RA 1YJ9S 1FHTA 2O66A 5F3TA 1HI1A 4F7VA 2ZH6A 3M8QA 3MPWA 5GADU 4IG3A 5KFSA 3H98A 4UOHA 4QR0A 3P5TL 3AQPA 1NM2A 2HVIA 2RKIB 5KG1A 5L9NA 1QSSA 4M5KA 4F04B 3KLIA 3FQLA 2EKYA 4FBUA 1RHMB 4G1QA 1VQ5S 3LF0A 2JEJA 2V8HA 4JI4F 1KBRA 2MGZB 3PX0A 2YX1A 3SYZA 1HD0A 4ZJLA 3HXMA 3LWMA 1TL7B 3OT9A 2OFGX 2KI2A 2BM0A 1ZM9A 2KRRA 2AQ4A 2CG8A 1S7IA 4UQTA 4CNZA 5LJ5Y 3KKFA 4FPIA 4DL0C 2FJVA 2AX1A 1X5SA 2NZ4A 4B3OB 1B70B 3G87A 3UDCA 2HFVA 1PYTA 3W5ZA 2M9KA 1N48A 2RSQA 1RTIB 4XAKA 5HLFB 2XHCA 5KFIA 3DDKA 3OFEA 3BQ2A 1F3FA 5F8LA 4MK8A 5HO4A 3OJSA 2XB2D 3GYXB 4FS2A 1NK7A 4RPFA 3PEHA 1ZM2A 2HHUA 1S77D 1U02A 4LF2A 4P2FA 5BR8J 1J5EF 3A8EA 3IBWA 1LW2A 4CM2A 3D28A 3KG0A 1U47A 2ZZMA 2DIUA 3BYPA 2DNNA 3LALA 1JXLA 1KHWA 5A8KB 3KLHA 1A6LA 1DLOB 2AHOB 2A6OA 1CVJA 2R2SA 3ENVA 4KFBB 3W66A 3NGRA 4PZVA 4CYUB 4ZK7M 2VG5A 4G3IA 4DHVA 5I3UB 1D9FA 5DLFA 3PRVA 2VG6A 2ZD1B 4JV5F 2AJ2A 2BQUA 1NPRA 3KLGB 5L9XA 4USVA 4ZP8A 1U49A 3DLBA 4NYPA 3QRQA 4J91A 4DPOA 3VAFA 2ABYA 2WONB 3CMQA 1NK5A 5KFQA 2E9ZA 1LWFA 3TANA 4RNFA 3OV7A 5IT9U 2B4PA 5KG4A 3RB0A 4I67A 1FFWB 1NH7A 3A12A 1Q8LA 2DNPA 1LWCA 3MTJA 4LF4J 2BX6A 5GAEU 4PXCA 3W3SA 5B0DA 3LANA 3DDNA 3PIPQ 3UN3A 5FLXU 1KLMA 2LQ5A 2WSEC 4DLEA 2RILA 5KFHA 1FJGJ 5E3RA 1HD1A 4DOZA 4MH8A 2MZSA 2ALZA 3JYTA 4O4GB 4HVZA 1FERA 1N6QB 3BGRB 5LM7E 4TNOA 4C0OC 5F41A 4C7QA 5E0OA 2XI2A 1J2VA 1RTJA 3THTA 1S7HA 1U6ZA 4WK3A 3GE9A 2E1CA 4MKYA 2MYFA 3IWLA 1TV6A 3C66A 1UFLA 1LOUA 5EWEA 3RB6A 4F0MA 2VONA 2DHHA 2A18A 4DWIA 2GQQA 3LPEA 3OBIA 2DIVA 4CT9A 2DPIA 2ROGA 3HP6A 1S9EB 2AX0A 3D1QA 4LBPA 1VBKA 5F8IA 1UWAA 4KE5A 3SDEB 4NL5A 3EXCX 1Z2LA 4LF7J 2R2RA 3W62A 5DLGA 1HWLA 2X1BA 2AEJA 1U48A 1C4CA 4GKJJ 2KVQE 1YZ6A 2UUBF 2LQJA 5HJYA 4ECUA 2PO4A 5AE3A 4L3NA 4JI2J 2MTLA 5ETVA 4DR1J 3BKTA 5AE2A 2KL8A 1HW8A 2XTJP 2XO6A 2HAFA 3LAMA 4ECSA 2CYYA 4NA3A 3X3UA 1L3VA 2F40A 3O44A 2P6TA 1VS3A 3MUMP 4G1PA 3IN5A 2ZDOA 4U8VA 3IWXA 2VJUA 2ZH3A 3TAPA 2C3PA 1Y5NB 1F60B 3RB3A 3M2VA 4EWTA 3VZHA 2GHVC 2DHSA 3OVBA 1IBKJ 3GPAA 2XLIA 1TAQA 3GG1A 4NXMF 4ZVPB 3KOAA 3E51A 2D9OA 4DV0J 2HHPA 4JP8A 3CCSS 1OYEA 4RR5A 4B3TJ 5D15A 3K58A 1FWLA 3HHLA 1AZSA 2BV3A 3T5KA 3I6PA 3HVWA 2CRLA 5KFUA 1OPZA 5LL6d 3H0PA 4LRBA 3FEXB 2BUNA 3DNCA 1AT1B 1VJQA 2YX4A 2M3DA 1LWEB 3PW5A 5E5NA 1BXNA 4PPZA 2OTLS 2HRUA 4YR0A 2VFTA 5L8RC 4N5SA 4EFAC 1RADB 3GJSB 2CIMA 4QWDA 5CXTA 1XTZA 3NCPA 4HHJA 3LWLA 1RWWB 3TRGA 5L38A 2N4CA 3QFWA 1IBLJ 3QGIA 4DV2J 3G9CA 5ETLA 3HM9A 4MIWA 2IAJA 1L3KA 5HSPA 4Y28C 5KG2A 1P1LA 3WX8A 4RU9A 4KGVB 1OSDA 1HMVA 4YR3A 3VF0B 4F2RA 1ZAWA 1YZ7A 1ZM4A 2A2DA 4AQYJ 3EZUA 2DRBA 3MCNA 1EZZB 3Q23A 1M5SA 4OJHA 3PJWA 1TUVA 3DLLQ 2CJKA 2LVWA 3TYTA 5DZ6A 1I1GA 4LRFA 4LFBF 4DU8A 2Z30B 1R7IA 4DV6J 1TL1B 4M5NA 2GQCA 2W7AA 4DV4J 1N36J 2AJ1A 2F5GA 1URNA 5B0AA 3I5BA 3GFZA 4RWXA 3GYGA 4TU9A 3RRHA 2FQQB 1RLDA 3CVKA 4NA2A 4E8UA 2OTJS 1H0HB 2K06A 1F2HA 1S6PB 4EO6A 2BDPA 1OY8A 3SV3A 1RP5A 4U6PA 1CJKA 1NSQA 3MXHP 3PV8A 1QDUB 1T05B 1NKEA 3HHNB 2DNOA 2OPPB 4WFZA 3UDLA 4GKKJ 1VI7A 2B5JA 3L7OA 1HNXJ 3CCES 2HFZA 3AAWB 4XDDA 3L7UA 2OLWA 1PGZA 1ZYQA 4O3NA 1EQMA 1RWVB 1XR7A 3K59A 2I2YA 4ED3A 1XNQF 2V4JA 1F3VA 1RT5B 1AYEA 4I64A 2Z2ZA 3GJTB 3NP5A 3FFIA 4M63A 2M88A 3Q8SB 1VJWA 4MYTA 3TVKA 4A8XA 1N33J 3W9HA 4NASA 4I6WA 4ANCA 1T9UA 4DR2J 3CJKA 1YSJA 4O3OA 2FTRA 2F63A 3FBCA 2VJVA 3CNQP 3SSQA 1FNMA 1M1HA 5D3GB 2OGUA 2BMBA 1OIAA 2GAHC 1HNWJ 3HKWA 3CDEA 1C4AA 4LRAA 2HYIB 2QGFB 4F67A 2EXUA 5JVGQ 5CCMA 2VHGA 3J7Z5 4DS5A 2HEKA 1HQ2A 2W24A 3QZ7A 2YPYA 4JYAF 3RBDA 1IR1A 1SC4B 3RAMA 2JLFA 4GVBA 2CJQA 1OY6A 2CQ1A 2RQ4A 2YPZA 3NL0A 1S1WB 2R8GA 5HMXA 4NCGB 5H9FJ 2YKMB 3BSAA 2R7TA 3HZEA 3FVYA 1ZAVA 1FVSA 3AJ1A 2KO1A 4MYUA 4BS2A 4U95A 3CCVS 2GJ2A 2L9NA 1UKUA 3T5LA 4JI5J 5F9NA 2DKOB 4ED5A 2JEIA 4ZLPA 1TFYA 1SBRA 3ZO7A 4MKBA 1IKYA 3KWMA 4DEZA 1C0UA 3BO2A 1T7PA 2XS7A 4I7FA 1S4FA 5J2MA 1WHVA 5KT2A 1FJ7A 3ZZ0A 2BACA 1K47A 2DT9A 2E1RA 2GIRA 4YB7A 3W2VB 3RU0A 5E41A 2JRSA 3RYLA 1N5TA 3VQSA 2HURA 4W98A 4KH1B 4KT0C 5AXNA 2FLPA 2MQPA 2V2QA 2W2NP 1SL2A 3NMAA 1FX4A 1L5UA 1RGVA 4RBTA 2A6MA 1PIEA 4OZNA 3LP1A 4FYWB 5DQIA 3MR5A 3TZYA 1S12A 2NXCA 4OHVA 5D4LA 4EO8A 1M1GA 4ZVUB 2EFNA 1RAAB 4LFCJ 3DLEB 3TUZC 1QE1A 2LKZA 1S1XA 4K4YA 1IKVB 4CO0A 3G71S 1DY3A 1JLCB 3HSZA 1WDTA 3DXBA 1M0SA 3TX8A 1RUSA 2ZBRA 1WC5A 3HT0A 4BCAA 2K7JA 4HEA9 4DV5J 4KHPJ 1U1KA 4W90B 2RS2A 1NK6A 5KFAA 4ZVHA 3TJ8A 3KK3B 1N5QA 2VFSA 5J1EB 3TEGA 3MR3A 2ZBCA 2E5IA 1S0MA 2P9EA 2VF3A 4B9TA 2CPFA 3S8SA 4X4RA 4BBYA 2AW0A 4X66J 3PFOA 1L3TA 4JI8F 1AUSL 2DHXA 2I6WA 4Y2MA 2DTJA 3CDAA 3PO5A 4WPAA 2QA2A 1Q5VA 2OEJA 3GCXP 1CJUB 4JB8B 2DO4A 3K5LA 2DXEA 2C28A 4OZ1A 4A8YA 3G2XA 4K4ZA 1RWUA 1MMLA 1JLFA 2HFNA 2GGPA 1FJCA 3LW5C 2MKCA 1J5OA 2IM3A 4LR8A 2OO4A 3Q83A 4NZ6A 5DG7A 2EG1A 2YY3A 5KFKA 4R5PB 3R2CJ 2M70A 2NSBA 3HMJG 3MPVA 3VALA 1UVJA 4DL4A 4B9LA 1QAJA 3RW7A 4YHHF 1L3SA 4RLEA 4ID5A 1VQ9S 1DFDA 3LP0A 5IC4B 4NI2A 3DRRB 3QAEA 3FZBA 4RW6B 3PX4A 1RT4A 2H4WB 4MK9A 3MUTP 2DNRA 1YQHA 3M6WA 4F8RA 2ILYA 2EC2A 1RT3B 3NS6A 2PFFB 2IHR1 2BA9A 4X4PA 4DX6A 3OPKA 4PRFA 1ZPVA 1FRMA 3QLHA 1NUEA 5C7PA 2G2YA 5LMUJ 3MM9A 2F8HA 2JVRA 4OZLA 3DLGB 5E3QA 3OTOF 1X4BA 4P74A 2QJ3A 2QSFA 4N41A 1FX2A 3Q86A 5HP1A 1ULRA 1DARA 3DI6A 1XC9A 1Y0HA 5B08A 3NCRA 2IFXA 4P72A 1B99A 2X3GA 3JSMB 1NB7A 2OAUA 3TX0A 1B4SA 1JB0C 1RK8A 4X62F 1N8RT 1T3NA 4FXVA 1UZHA 3P3DA 2K3KA 2RF2A 3RB4A 2VU5A 4CTAB 4TY8B 2FHMA 4DR4F 2DNKA 2L08A 1UVNA 1SKRA 3LH2S 4O3RA 2YWHA 4ZCKA 2PGCA 1V5VA 4DR3J 1PJ6A 4KKOA 3E8OA 4H4MB 1RTDB 4DPYA 3UCGA 5D0RA 4WE1B 2BVZA 3M2RA 4YB6A 2RH3A 3S6EA 1S99A 1R0AB 1X4FA 4QQBA 2IRUA 3BF4A 2LQ8A 4IKAA 5CZXA 5IT9Y 1MW7A 1VQPS 2MZRA 5IWAF 2R2UA 4FPRA 3M30B 4TYBA 1ZTWA 2RDJA 2J6UA 4ES3A 2HNDB 1YI2S 3CO9A 2DO0A 2KYXA 4CCHA 1YJNS 1Z4UA 3NNHA 2B6AA 2JZ5A 5D6GA 3BREA 5GVQA 4ATNA 3AXMA 3MCSA 5K9FA 3OFHA 4YEAA 4ALZA 5FLXY 1S57A 1SQEA 2E5HA 3M2VB 4KYZA 1TL3A 1NDCA 3HVTB 1S79A 3V6HA 2YWKA 3BN4A 4CH7A 2DBBA 2W9BA 3C15B 1NHVA 4F4XA 3TJ9A 4USWA 1T3OA 1HNZJ 4IG0B 1GMUA 4FXWA 3WDOA 5HANA 2VBXA 3GIMA 1KVKA 1X7VA 4WIIA 1Y4ZB 3HT3A 1MN9A 5DRKA 5F0WA 2PMWA 3NNAA 3G82B 4KAIA 2C42A 2AF6A 3GG0A 4O3SA 1FESA 2RRNA 4HR2A 1UVMA 1RT2A 2P9CA 1EETB 5KTQA 3I32A 1W26A 2X3DA 3BO4A 2RUGA 4PPDA 4YUDA 4C8ZA 3MM8B 1H6KX 1Q16B 4K5RA 4XPEA 1GFWB 5MLCV 2CPJA 2I1RA 4DV3F 2BRKA 3P4UB 1HKAA 1N54B 3EM1A 1XNRF 3MMBA 1PBAA 1HYSB 2ZJPQ 4I2QA 3J7ZT 3I4PA 2IYGA 1X9MA 4MT1A 3OJUA 4ZVGA 4K0KJ 1HMVB 4QWBA 2EC0A 2XG8A 5KT7A 1IM6A 3MOZA 3KLFB 4WYLA 1KD1T 5ETNA 2NS1B 3CJRA 1MMDA 4RBVA 3MR2A 3C6TA 1YIJS 4J90A 4OHXA 2W2QP 3OL9A 4Q8FA 2AT1B 3NAHA 2WW8A 3QIPA 1RKIA 3UW1A 2ZH9A 4E2FB 1Y7PA 3ISNC 4RL1A 5D78A 3I4HX 3PJXA 2CWKA 1HNIB 4TQRA 1XJWB 2VQEJ 4KPCA 1AW0A 1SJRA 4F4ZA 3DLHA 3HI9A 1SB6A 3AY0A 1VQSA 2CJXB 3T6JA 1WKLA 5KT4A 2WSCC 1VGYA 1WC6A 3MFHA 2UUCJ 3OXLA 3MM5B 3GV8B 4R0JA 2FJBB 1GTEA 3JSYA 4UY8T 1K73T 4K2XA 2C2EA 3U27A 2RNEA 5IV4A 3G6ES 3IAM9 4P6QA 3TAMA 2BE2B 5BYRA 5C2CA 4B9MA 5F8GA 3HPOA 3AJDA 3T6BA 3B8HA 2V94A 2DXFA 3DC2A 1FKOB 6FD1A 3G8QA 1KOOA 4DX5A 3I9V9 3NOCA 2J0SD 1AFJA 2RJZA 4ZVOB 4ELVA 2HQGA 4OX7A 3QBCA 3IS9B 3W5YA 3FSYA 2XYGB 1VQ4S 5B0CA 1R8CA 3KLVA 1WSRA 3QGHA 4ER8A 4LT6A 4QIWD 4WWSA 3MEGA 3GSDA 3CO0P 1T02A 1UZDA 2HBRB 8ATCB 3VAKA 4C0BA 1NJXA 1MG7A 2UVUA 2FLOA 3R5CA 4HACB 1GQEA 2ZVSA 4JI4J 4C2MA 3WIUA 2OP5A 1NK0A 1ELOA 1WI8A 2GCFA 1LW0B 3MM6A 1BQXA 1YBTA 4O0IA 3D66A 2ZH5A 2X1GA 2Z8QA 3Q22A 1T11A 5K14B 2W9AA 2C2RA 4CH1A 3UN2A 4WKYA 2MQ8A 1UCNA 3VVTA 3Q8YA 2HBZB 4I68A 4USMA 1CC8A 4J9LA 1R6YA 2ZUGA 2W7PA 3KMQA 2YNIB 1E6YB 4Y34A 2OPRA 3RTVA 3BSOA 2IJRA 1JJ4A 3CWJA 4Q7AA 3ZTRA 1KVJA 4ANEA 1MU2A 5EX3A 2ZH8A 2A0FB 1GTHA 1HHTP 3U02A 4PUOB 2FY1A 1J5EJ 2H1YA 4ED8A 1WTFA 1JLGA 4GC6A 3V2UC 1TR0A 3LGHA 2XI3A 2F3JA 4UUWA 4FKYA 1VQYA 5GADI 1CJVA 1S6QB 4USKA 2LMIA 2AMCB 3ILLA 2VPYB 4ES1A 2V8GA 2R2TA 1UEVA 2XYHB 3T3FA 1F2GA 3ZTOA 1KQGB 4C6AA 1TVRB 4JV5J 2LEAA 3RRKA 2WVDA 4C97A 4M5GA 1HARA 4QPXA 3G6XA 2KVIA 1VIXA 2P8IA 3H59A 4ZLJA 1FCAA 1T95A 2I8EA 2DGTA 2IBOA 4NPOA 1IWGA 4CO4A 4EYIB 4EBEA 2XMMA 3TEHB 3QNWB 3CULA 4Q43A 2XEXA 5KFMA 1WG4A 2HVZA 3FDSA 1MN7A 1X8DA 3C14A 3ETMA 5M2PA 3M9OB 1SKUB 1QE1B 2KZZA 1FT8A 3D54A 3AD8C 2GIFA 3POTB 4NE9C 1NZ8A 4WFNQ 3MD1A 4CQ1A 2XZTB 1HR0F 2HG4A 1WEXA 3T9ZA 1HBUB 2DR9A 1MWYA 1EIYB 5EN1A 2XGPA 3RAQA 4MFBB 2OEMA 4F02A 2XQCA 3EDQB 3MMCB 1RT7B 4F0KA 4ECZA 3CMES 3PO4A 1DJ0A 1YKWA 4JI6F 3LP2B 2HMIB 3G8SA 4KO0B 3H5SA 5EDWA 5KFOA 4JI0F 1WKKA 4QIEA 2RUSA 2ADBA 2MZTA 2FHOB 3B82A 3BDPA 3OQ2A 4O44A 4RW7B 2LXFA 1JLAB 4OV1A 2OEKA 1RHRB 4NLWA 2K1RA 1JJ2R 3G86A 1BQNA 4RW8A 3TZWA 2VOOA 1SL1A 1BGXT 1KHVA 3Q8QB 3ZZPA 2VKRA 1NO8A 4DR7F 3E3XA 1MWQA 2W7OA 4C8OA 3BJYA 4KGMA 5GMDA 4UQGA 3BH7B 2AEMA 1U8SA 5KFRA 2QA4S 2QZ8A 3ZZYA 4CZCA 3IC1A 2WBMA 4LSLA 3UDEA 1R8PA 2XSJB 3CC7S 4A8QA 2V5HG 1S6OA 4WJBA 3FC9A 2HQCA 5B0GA 2FB0A 2FLLA 2BJ1A 2VKZG 5C25B 2DR5A 2DYAA 3E01A 4ITSA 2UUBJ 3KHLA 2ZE2B 4TLRA 3KK1A 1EP4A 5HMYA 3E2EA 1FEHA 4OYBA 2W9CB 3EPIA 3OFGA 4K4XA 2V34A 2B56A 2RE1A 3DYAA 3HHLC 1VQ6S 1JLBA 1Q86T 5KFBA 3N6LA 1VLYA 1RWNB 4JV1A 2LXIA 1H7XA 3MCOA 4WZMA 3HFVA 4XK8C 5C5JA 3MM9B 3DOMA 4FF3A 2Y1JA 5KFPA 5AJ3F 1FTRA 2C2DA 2VBYA 3HKZD 3DGVA 2GAGC 3HFKA 2BJ9A 3TUJC 2MHNA 3M4XA 4ZVEA 3LUYA 4PXEA 4NXMJ 1UA1A 2C3YA 1O0PA 2R7VA 3GJQB 4C3MA 2YNHB 1CULB 1GX6A 1VCTA 5IZHA 1S9GB 4IUFA 1JLQA 2HNYA 3GIJA 3BBBA 1G2EA 2AIRB 2DNHA 3N4WA 4P75A 4C3LA 1RU2A 4DFKA 4LSNA 2AJ0A 2OJ3A 4NLTA 2MQQA 3CGIA 1NJIT 1QUVA 4WFBQ 4A8FA 2QFIA 4EBCA 2IC3A 3UQSA 2CPEA 2JLGA 5DG8A 3O8WA 2UV8G 2VODA 2RB7A 3CC4S 2YNFB 3PVXA 5D4NA 1R8HA 2NXEA 1I5OB 3QQCD 2NYIA 2ZKTA 1C1CA 3DMJB 4Y65A 3DRSA 4U96A 3H4DA 2YKNB 4B3MF 3IM9A 1D9DA 2DNLA 1NNDA 2WRMA 2I5JB 1V6HA 2YWWA 3B54A 1QUPA 4F4WA 1I3OB 1ZPWX 5I3QA 1K8AT 2ZOFA 2D3UA 3V81B 3TARA 5FIIA 3IGVA 1VIOA 2WB4A 1R89A 2GVDB 4M1KA 1K44A 5K5MA 1RHUB 1T9VA 2ZC3A 1TL3B 1VRTB 2CQGA 5CA5A 4FYYB 4ES2A 1WWHA 1DTTA 3N28A 1TAUA 4LIRA 2R4FA 1JMTA 1KONA 4DQRA 4IR9A 3ILIA 2BKOA 2MZ1A 3K5MA 1L3UA 4LFBJ 4CI0B 4NLUA 4WXOA 1TKZA 4D3GA 1VQ7S 4DPWA 2WOMA 5GAGI 3QSYB 4AXJA 2HHWA 1XMQF 2G13A 1NMEB 5KG7A 2DY1A 4RUAA 2N7YA 2F9DA 2MXYA 4LSZB 2XMAA 2W8LA 3R5JB 4AE5A 1YJWS 2EPIA 1WACA 5I42B 3V6DA 1KP6A 3QPIA 1GNKA 3DRYA 2FJWA 3CD5A 2BE9B 1ZBTA 1RABB 1HHSA 4ED1A 1M5HA 3QO9A 4B9VA 2GC8A 1VRUA 2V9WA 3BPDA 4MIBA 3A1YG 1XWLA 3TVYA 3EGVA 5K8OA 1D9AA 5D0GA 1U4BA 2QA4G 1XNQJ 4UOCA 2V2ZA 5J2PB 3IAS9 2BJ8A 1T9TA 2UV8A 3ZNUA 2APOA 4B02A 1VK3A 2AYMA 2R42A 2FIUA 3D6FB 3CDWA 4ZCIA 1ZH5A 4ZVFA 4C11A 1UJ6A 4IO1A 4HL9A 5HBMA 1Y00A 2WVBA 3NGUA 5IV3A 4QU7A 3UVJB 2ASDA 3MDFA 1D0EA 3SEOA 3DDIA 4ZVTB 4ZMMA 1FTCA 1H3DA 3PRDA 4JYAJ 3BKUA 2PEBA 2CQ4A 4L6V3 4K4SA 3U7JA 5A8WB 1GT8A 3MECB 3KHGA 2IMWP 2JC0A 4RO0A 1OQ6A 3CCQS 4ILLA 1ZETA 4CLFA 3HDSA 3TP2A 3K0JA 5H9EK 2HQDA 1LWXA 1JK9B 1GAOA 4FS1A 5JMNA 2CZ9A 2HS0A 1FDBA 1FNXH 2VUGA 4C3KA 1YRXA 2HPUA 2OUGA 3L95X 1WHWA 3K2YA 4CLKA 3F73A 4K59A 3GFYA 1HPZB 2ZH1A 3W64A 2PN6A 2DGWA 1RZMA 4FDFA 4WIQA 1WOOA 4EZ9A 4OZ5A 3MEEA 1DHMA 4A8WA 3TVZA 1Q95G 4PABA 5A0YA 1UW4A 1BHNA 3I31A 3VR1A 5FDLA 1FKPB 4DFPA 4P71A 2IRXA 2D1CA 3O1LA 3G8TA 3L09A 1JX4A 1MROB 3N01A 3KUHA 1FRIA 3RAXA 1MLAA 2RDIA 3U1NA 3ILJA 1VK8A 5F9LA 1XQIA 5ITHA 4KRWA 3ET6B 2FY8A 2ZBQA 1UEUA 2NPFA 4DSEA 2W25A 4KV8B 2HZCA 5LSRA 2LXUA 2IVYA 3FGVA 2A10A 4NEZA 4F2SA 4JV0A 2F9JA 1B7FA 3B4MA 4IQXA 1RWMB 1TKDA 4QYZJ 1NRKA 3PNIA 4UUXA 2E5JA 1RYSA 1R8AA 3Q89A 2MQOA 3T1YF 3H5XA 2ZKUA 4ZP7A 1JQGA 4B9UA 2DR6A 2J6TA 2VICA 1FE4A 4KSEB 3UCZP 1NCLA 1YJRA 1RT6A 1H38A 2VFUA 4Q8EA 3TA0A 5ETTA 2QLFB 3CD0A 5DZ7A 1HQEB 1CJTA 3CCMS 2H4YB 4JI8J 4X2BA 1KS2A 2W2OP 2BANB 4OX6A 5C42A 2VDHA 1VQKS 4GC7A 4ZHRA 1X4EA 4K50A 3B78A 4CLZA 1JLEA 1WC3A 4ZP9A 1S1VA 1H73A 4ICLA 5BJRA 2J5AA 1FFGB 1VBXA 5HQ8A 3D0HE 3MM7B 2C2MB 3EPGA 4R8UA 4CO5A 4OQJA 4I2PB 1HNVA 4LF1A 4ZJOA 4X65F 5J2QB 5GMKa 4V1Ak 2AGOA 1C0TB 4Y00A 3EMTA 1X4CA 2P2CB 2N7CA 3QRRA 3ZTSA 5THWA 3PM9A 4YHHJ 1AB8A 2CDQA 3CJ8A 1PBUA 3M8PB 1UPPA 4MMOA 4IFYA 4HTIA 3CC2S 4ILMA 3BZQA 5G0RB 3MAAB 1HBOA 2IDLA 1WC0A 2IYIA 2ZOGA 3AD7C 3DM2A 4TXSA 1P6TA 2GVZB 3UNGC 3CCWA 2OSRA 4HHUA 4K7QA 3F56A 4QW8A 3UI3A 1QAXA 2LCWA 3OTOJ 4Y2AA 1JNRB 4PCQA 3EZ5A 2V6AA 5GAHU 1U6FA 5DJBA 4RW8B 4BC7A 1O5JA 2C3UA 3NBPA 4ILRA 1S1TA 1RT1A 3OR2A 4DQIA 4X62J 1JKHB 1PKUA 5EX0A 3MTKA 4PQUA 5E3PA 2EI5A 4PG8A 2E5LF 3OR1A 4DR4J 2K2PA 2YWFA 4DR6F 4MJKA 4DZ6A 2DVIA 4LSLB 1NJYA 1BMQB 4M5JA 4Q5VA 4AYBD 3T1HF 3I0SA 4RW9A 1SKWA 4OZ0A 3CD7A 2LDIA 2CPZA 1HWUA 3UCUP 5HATA 3KXDA 1WEYA 4CNYA 4I0WA 5IWAJ 3BGLA 4CO1A 4PWDB 4Q2MA 4CT8A 4ZS6A 1REVB 1NDKA 5KFJA 3W61A 2V50A 2Y0BB 5CAAA 1S6UA 1B7YB 2CAJA 1G3OA 1HQUB 1WJ9A 1U0SA 3I9ZA 5C24B 1TKXA 1VQOS 1XK8A 4KC5A 3U1LA 3CMAS 3J80U 4Y6IA 1HWKA 3AXKA 2FVCA 4RW4A 3EYZA 3DGPA 1ITPA 2HWTA 5ETQA 4DUZF 5D8HB 1VQMS 3R97A 4TKTA 5HVHA 5IM0B 4RNNA 2O01C 3OLBA 3UWTA 4J9OA 5KT6A 1HBMA 4DZDA 3RBEA 2OMOA 1S9FA 2OPQA 1X4HA 2ZH7A 4H4OB 4V19X 4YY3F 2VL1A 2QRRA 2RRBA 2KT5A 5A2QU 4I56A 4ZCLA 3EICA 4M94A 3IGNA 1HHQA 1S49A 2O5DA 3ITHA 1WUUA 4CP5A 1VQLS 3MPDA 3OHAA 1BY9A 2ZBIA 2J7UA 2HSEB 2JDJA 3ZZOA 1C1CB 4DU7A 4DV1F 4J9NA 2M0GB 3FBFA 2HZVA 4JI7F 4OJ3A 2CA9A 1IKXA 4DV3J 5K8NA 2ZHOA 3HF5A 4DN9A 5ETPA 1IN0A 2J8SA 5DETA 2NZCA 1NSAA 1XNRJ 3M32A 4JI1F 4KIAA 1K9MT 4IO9Q 2JWNA 2YNGB 4N76A 1Q78A 1RA6A 3JB9k 2VD3A 1S59A 3AA9A 3CJ2A 3JQJA 2OHDA 4XTTA 5J2NA 4IFVA 1RYRA 1T03A 4NA1A 4EYHB 4DV7F 4IRKA 1NJZA 4BDPA 2DEJA 3I87A 1U0HA 4RZRA 3Q8PB 1KFDA 3SSRA 1DTTB 3K5OA 1IUJA 2ERRA 1NAQA 5DQGA 2UXCF 1HW9A 3G6YA 3SQGA 1Y5IB 2HQFA 3IA0A 3FK4A 3SMZA 3I5CA 3PFEA 2HLUA 2FVQA 2QV6A 4OYIA 2HZAA 1YDLA 4DG1B 1T9YA 4IDKA 3GP9A 1FRHA 2OPSA 1EJ7L 3RUBL 1QVFR 5DDQC 3DRXA 2IVFB 4OV6A 5CABA 1LXNA 2IA6A 2XS5A 4DDFA 4Q44A 1F5CA 5A8RA 3SCJE 1KNZA 1SV5B 2VASA 5KFXA 3MFIA 4YB5A 1NHKL 2CNOB 4X4OA 2QG9B 1JWWA 1KQFB 1VRUB 4UZCA 2WAQD 4KBIA 3W8GA 5IQ6A 3WC2A 1KVIA 1VC0A 1SI9A 1E6VB 1ICEB 4JI3F 1RE1B 3H20A 1LFWA 2W8KA 4NLPA 2AGQA 2HFSA 1CLFA 3AFGA 4NMLA 3DRPA 1WEZA 2Z2LA 3TA2A 4F4KA 4WTOB 4GMKA 2V4RA 2HBQB 3N9UC 5KG5A 2XY6A 1FDNA 3ZXWA 4UOGA 2VA2A 4M5IA 2NREA 1UMJA 3V4IB 2RRAA 3LPYA 3O3LA 3MF5A 1B0TA 3FMBA 2HWHA 2YH1A 3IBFB 1C1BB 1Y5LB 4B9NA 3ZZZA 2CQHA 2LEPA 3W63A 4ZPAA 1SKSA 2RKIA 2FC8A 2CKWA 3CJSA 3CCUS 1SIZA 1F9FA 2MKKA 1TK0A 4URSA 4U9RA 4J5OA 2B3TB 1SUQB 3D0IE 2FPHX 2ZDPA 2MGZA 2BYCA 2WZ1A 4QR1A 2GX8A 2YH0A 4X64F 5CYMB 4RU2A 2V8PA 2XNRA 1TL7A 2HNZB 2LFVA 1M90T 1HI0P 3MAHA 2UXBF 3M8RA 3M6VA 2Y0SD 4Q0BB 2GW8A 2GJFA 3FRZA 4RWWA 3GV5B 4KR0B 2R8JA 1UWBB 3H2VE 5CYQB 1GEHA 1R8BA 2KT3A 3EZOA 4B3OA 1HBNB 3DU6A 2ZM6F 1RBAA 1WI6A 1RTIA 3D1HA 5E3AA 5HLFA 2WTFA 4Z7CA 2EFPA 4IOCQ 2XZDB 2CQ3A 3C19A 3NGDA 1R43A 3EWGA 5DDRC 1WHYA 2XULA 1M5PC 1SCJB 2B4UA 1RACB 1RWOB 5A8KA 2GHWA 1TTHB 1DLOA 1DTQB 4NMXA 2J0QD 1WTBA 3OL8A 4B08A 4RNOA 4KFBA 1IKWA 1ZA1B 3OUYB 2M7SA 5KFVA 4CYUA 2HVEA 4ECXA 4LR9A 2VBWA 5I3UA 1Y11A 1GMWD 2ZD1A 2OIHA 1R27B 2GO8A 5L39A 1U1NA 3KLGA 4DF4A 2Z2YB 1W7WA 3A4TA 5GAGU 2KDOA 2X1AA 3UR0A 2BOAA 3KHRA 3HHDA 1NPPA 2CVEA 3NGSA 2WONA 5HROB 2E66A 2AKWB 3FBBA 1MMNA 3FMWA 3ZZUA 3I56S 1HLWA 2ATCB 2WBRA 5T7LB 2AGPA 4L3KA 4CM0A 3PCOB 4ED0A 1HR0J 1NK4A 4ZOSA 3TJAA 2Y9HA 2I9SA 5DS7A 2R7RA 3AODA 1B3TA 3W7BA 3JTOA 4RX6A 4NLGA 1NHUA 4B3SF 3M1VB 3I0RA 1LXJA 5ADZA 4YS2A 4JI6J 2GMLA 3P96A 2LYVA 5BYQA 2KT2A 2ZWPA 3IMQJ 4P7VA 4JI0J 4EBDA 3MGJA 3GB0A 4R0EA 2VFVA 2QX0A 3C6UB 2RMLA 4LJMA 3KK2A 3C16B 2UP1A 2BJDA 4O4GA 1N6QA 3QJJA 3NGKA 3BGRA 4L75A 2FGOA 4ETXA 3FSXA 1EHWA 3M8WA 1S1UB 4DR7J 3WIVA 2M2BA 4DL2A 3M6XA 3DCAA 1VYAA 3GU0A 4HDHA 1PYSB 2XMTA 2PDAA 1KR4A 2V9KA 1HNVB 4J9MA 1KLNA 3QFHA 2BW7A 1HI8A 1RTHB 4N77A 4DCOB 1U1LA 4ZITA 2FZCB 3GTYX 3CIZA 3G4SS 3RZAA 4I4BA 2JEFA 1U8WA 4QU6A 5B7WA 3ISZA 2BKNA 3W2WB 2DGXA 4DQPA 1PC4A 1S9EA 1VQNS 4M5DB 3W60A 1F9EB 2JOQA 3DOKA 2DISA 3SDEA 2ZBPA 3KNGA 1HL6A 4M5MA 3L4BC 1TUGB 2VOPA 4UOFA 2WSFC 4Y2KA 4TY9A 2VPWB 3DOLB 5L46A 3KJVB 4QOTA 3FCWA 2VG7B 1YWXA 5KFTA 4X4VA 1DZ5A 4OHYA 3QT5A 4X4TA 3MEDB 4N56A 2IJFA 4S0MA 2EFVA 1BQMB 2MJNA 3HSDA 2VPZB 5AJ3J 1U25A 2UVVA 3IG1B 2J9EA 3OFFA 3FCVA 4DXLA 1CS4B 2MLYA 3IWNC 4QCLA 3ZFVA 4MK7A 3TR5A 1S1TB 4MKAA 4PG5A 4EUVA 5BYSA 1NJWA 3X1LB 1P8GA 1VISA 3AT1B 2LA4A 4UF4A 3CT9A 3KLEB 1XR5A 3HSJA 3N5FA 4WCEQ 2CNLB 4DLGA 1CQMA 1YJVA 4P73A 1I6JA 5E33A 4EZ6A 3VAJA 1OPIA 5H1SV 4PYAA 4C8KA 4C4WA 1OY9A 3ENWA 3UR3C 4PQAA 2CPIA 1CQNA 4JV2A 1K1QA 2L41A 1FK9B 3VCDA 1YTYA 1DRZA 2UXDF 4H54A 5DDPC 2D3OR 4ZVQB 1EKRA 4WF9Q 2ZVIA 3P8BB 2XGQA 1S10A 4HI1A 4U8YA 4X4UA 3FKBA 4NLSA 3PEJA 3IXQA 1X9WA 4YP3A 4B3MJ 1GMVA 4DX8H 1P27B 2MLZA 1LWEA 3MMAB 2HW3A 1SJQA 4HT5A 2J76E 3CCRS 2J9CA 3N6NA 2E1AA 2AZ1A 3BBFA 1WELA 4KPYA 4O4RA 3SQOP 4W92B 2VQFF 1KRPA 2NCKL 5K8PA 2HIQA 2ZC4A 2UU9F 3ENAA 4NYZA 5F3ZA 2H5IB 2LU1A 3BSNA 3NCQA 2D3ZA 4KGKA 3BPSP 4OI0A 5HAOA 4F25A 4A8SA 2ROPA 4EK2A 4ERDA 3M8QB 1F5AA 4IG3B 3UDVA 2YKOA 4CIOA 4FNIA 2DCLA 1KC8T 4QYZK 3DLKA 4LVNP 2SXLA 3ZNJ1 2P5VA 4OI1A 2POKA 3QAUA 2PD1A 3KLIB 1P1TA 2JFDA 4X4NA 4G1QB 2XO7A 2D74B 4DPXA 3QRPA 2VC1A 2MHEA 1XMQJ 3ITHB 1TL1A 1O8BA 3OSNA 1RXOB 2R8KA 4RNHA 3EGZA 3EVMA 5KFDA 2H51B 1S6PA 4DI6A 1HWJA 2LLZA 1RAHB 3NWRA 4A48A 3LA0A 5HVFA 5KG6A 2NSCA 1T05A 1QM9A 4URQU 2OPPA 3QJPA 3BS9A 2FLNA 4XDCA 3M05A 1EB0A 5CQGA 5KFCA 3SZ2A 4DUYF 3DHWC 4OYAA 3SV4A 2JHEA 2HGNA 2CPDA 1VR6A 1BC6A 3SI8A 1T03B 5F0UA 1AXQA 1RWPB 5JJBA 3CEDA 3BR9A 4NYOA 1RT5A 4L73A 1LW2B 5HQMA 4BWMA 4ANDA 3Q8UA 3OVAA 1RBLA 4CO2A 1SJ3P 3KLHB 1RAJA 2XM3A 2CQ2A 3R7BB 1X4AA 1Y10A 1GXTA 3J80Y 4K8RA 2CQCA 2JNJA 1YRUA 4CDIA 2XHWA 2KJWA 3R6LB 2VG5B 2QLXA 5D3GA 2VG6B 2E44A 3CJ4A 2AU0A 1X60A 1GMWA 1UETA 4Z37A 3M8SA 1EX8A 1WKJA 5A6PA 5A8RB 4OI4A 5J1PA 4J9SA 2FJEB 1A0OB 3KJNB 3ONQA 1UTAA 1H2VZ 5A2QY 4PAAA 5AXKA 1LWFB 2PFDA 1S1WA 2E7XA 2IA0A 4K4WA 2YKMA 4USUA 4OZ3A 5B0BA 1TFWA 2LP4A 3ICLA 3H8YA 3P6YC 2XY5A 1N5VA 1FRXA 3FJ2A 1LWCB 1XIQA 1F5BA 5LOQA 4FVMA 4M5LA 2MKYA 2LDYA 3D67A 1X0PA 1KLMB 1VLOA 4A8KA 1U24A 4H4KC 2DY9A 2ZITA 1OSCA 3TUIC 3VAMA 4YMEA 3EVOA 1TK8A 5D77A 4WP3A 4GO7X 3JYTB 3QWUA 3TWZA 2ZFHA 2IM0A 3GV7B 3AHPA 2C2KB 5F8HA 2GV1A 2ASJA 2VPXB 1FO1A 4DBQA 2FJXA 1Q81T 3HZGA 1Q8BA 3F44A 4CLYA 2QL5B 1RTJB 5A6WA 2CFXA 2DNZA 3QIDA 1YJ7A 1X5TA 2JVOA 4IRDA 1KWMA 1TV6B 2MZQA 3S01A 3THVA 4NCAA 4C48A 3W2VA 4TYAA 1MNEA 2AV5A 3RGIA 2JX2A 3WC0A 2W4DA 1LKZA 4MKVA 3R9LA 4XPCA 3HVRA 2MSSA 1TQLA 4DR5F 4DL3A 2WB1D 2HBYB 3PW7A 1Q1KA 4RJVA 1NBEB 3K8VA 3BR8A 3EGWB 1U1OA 3MCMA 2JJ4D 3I55S 4WBFA 3T1YJ 3GIIA 3DLEA 2DRAA 3LGNA 5DDOC 1U7LA 2BZ2A 1IKVA 1FRKA 3F0NA 3PXGa 3A13A 3M8ZA 4Q2LA 4P7TA 2DD8S 1R6VA 5L1KA 1JLCA 2NQPA 1NK9A 2ZEJA 3RRGA 2P6SA 2HHSA 3PKYA 1URRA 3MHYA 3MMJA 4U7CA 2PMZD 1KQKA 1TMMA 3OD2A 3D6TB 3J7YU 3JXOA 3KK3A 5J1EA 1W25A 2FDNA 1IKWB 3KJFB 2R9LA 1YRTA 5AE1A 2XWXA 3MZIA 4QBUA 2HK3A 4AL7A 5DM6Q 1VFJA 1Y3KA 4C9DA 5ETRA 1PAEX 3QT8A 4J9KA 3CW2C 3PW2A 5CHCB 5EWFA 4Y3CA 3SFGA 3HHLB 2OH2A 3AH6A 1AZSB 3C8YA 1VHFA 4K5SA 1X31C 2V2KA 4CH0S 2L9WA 4X65J 3N0VA 1CJUA 3NNCA 1KQSR 2CJ9A 3PTWA 4IOAQ 2H48B 1QAIA 3AB2B 2FC9A 2HLTA 2OSQA 5KFNA 4PKDB 3PR5B 2QO3A 1WHXA 5K8MA 2YQ1A 1AUDA 4LUBA 5B09A 4R5PA 1Q5YA 2YQ3A 4HYKA 1Q53A 2Q66A 5CYJA 4GO5X 2EEYA 4YDDB 2XMJA 3DFEA 1IBCB 3NS7B 2DHGA 2QLWA 3DRRA 3FQKA 3R7SB 1QSLA 3I0RB 4RW6A 1XMOF 4OMFG 2DPJA 4NZ7A 2RQCA 2HAIA 1Q7YT 3PR4A 2C2OB 3CDUA 4FNHA 2IAJB 3VGTA 2QL9B 1RT3A 3K57A 2KH9A 3KK2B 1UJ4A 1B0VA 2P9GA 3FSIA 2PA3A 2U1AA 4EEYA 1PYOB 2KXFA 4O0NA 3DLGA 1M5KC 2DR7A 3M2UA 1FWPA 2O67A 4C8YA 3MOJB 3CCTA 5D0EA 1RLCL 4L74A 1QD1A 2UUWA 2NR0A 2N3LA 2O1PA 4ECWA 4F3OA 4TU7A 2R7WA 2E5LJ 3JSMA 4ZPBA 2CPHA 4DR6J 3A8IA 2Y1RI 1B64A 2FYXA 4CTAA 4TY8A 3GIKA 2HVHA 1IM4A 3OL7A 3T1HJ 4ZPDA 2OELA 4ZP6A 3CB4A 4A4JA 4QIVA 3T9NA 3HLUA 3DOKB 1HWIA 3OL6A 2GS8A 1CJKB 1LK5A 2L48A 4H4MA 3J81j 4KHMA 1RTDA 3JAMU 4WE1A 1RI7A 4LBHA 1R0AA 3MPUB 3HJFA 2B5JB 2W1BA 1P9QC 1RKJA 1DURA 2EW9A 2GZOA 2AJ4A 3M30A 4ZPCA 4M5HA 1ZOTA 1SJ4P 3CXCR 3U1MA 2FVPA 1Q8IA 3GONA 2HNDA 4OHWA 2XMKA 2JLEA 3NRBA 3TQEA 5KT5A 2V4JB 2CXEA 3V6JA 3FFIB 3KFWX 2LEBA 3RG6A 1VMBA 1FJEB 2R7QA 4DUZJ 1W2BR 3P49B 3JQKA 1N0VC 5GAHI 3GZ7A 7FDRA 2XC9A 3HVTA 3CJKB 2V0NA 2G2ZA 4G65A 5KFLA 4ELUA 2NPIA 4DL6A 4PG4A 3C15A 5CD4H 4YY3J 4IG0A 1BWVA 2IY5B 2FJDB 2RVJA 3UO0A 3GJRB 3H4BA 4A8MP 3G82A 2ALYB 3HHEA 3PYFA 4GRSA 3WHIA 3I82A 1NSKL 3HULA 2XNQA 3QMQA 4GVBB 4DSKA 2DB1A 4DV1J 1KEKA 2VA3A 1EETA 3EVWA 1IQZA 4JI7J 4PWUA 5LMNF 4ZCMA 2MJUA 4USHA 2V68A 1IR2A 4KGZB 3MM8A 4WYWA 1TMJA 1V3SA 3SIPB 2IM2A 1YVFA 2F4VF 1RHKB 2Y1LB 2RD5C 4JI1J 4OLOA 3OTBA 2NLWA 2RHQB 5CZVA 2QYCA 2QIFA 1HYSA 2ROEA 1V3ZA 2MQMA 2B9YA 2QLBB 4DMZA 3PIOQ 2XLJA 1N4LA 4DV7J 1TP7A 2D69A 1IKYB 4ZPWR 1GH8A 1M1KT 3BQ0A 4OI3A 2XCPA 4DPTA 1VHIA 1C0UB 2GNKA 5MAOA 3TO8A 2D3O1 5HI7A 1O6XA 3R2DJ 3R8YA 4HI2A 2AWZA 4NLOA 2UXCJ 3BQ1A 3KLFA 2CADA 1MSWD 1VBZA 1OQ3A 3D6HB 4X84A 3RR7A 1RB0A 4I7FB 5A76A 3R3TA 3W9JA 3GCWP 3DLKB 4HH1A 5J2MB 1V3RA 4OYXA 2WVFA 3EDRB 4U67Q 4A8OA 1SH3A 1KN6A 2LA6A 3NG8A 1Q82T 1LV5A 4NXNF 2QC3A 1JXEA 1SXLA 5E2QA 2V2VA 3D0GE 1HNIA 4NWBA 3R5DA 2A2CA 4QR2A 2MQNA 1UPMB 2NXNA 3MR6A 4P52A 3JQMA 3OLAA 1VOMA 3IFEA 3LTOA 4K4UA 4OLPA 3SSSA 3ELHA 3ZTQA 2B43A 2HGMA 3J7A1 2JEGA 4CLUA 2XZWA 1NDLA 3BKFA 3L9ZA 3MM5A 1NDPA 2EVZA 4LF6F 4J7CA 3LP1B 3L3CA 1SH2A 2RQKA 1GK8A 2MKHA 2YBVA 3FZ2A 2DXDA 1SPBP 3HFZB 3I96A 1RCXB 3Q0AA 4JI3J 2B8QA 4P10A 4RUCA 3QT6A 3CCZA 3AQOA 3PYEA 3FRYA 1S1XB 3LGMA 4QW9A 3QWPA 1U09A 2BE2A 4B9SA 2XYPB 3C2PA 3H2LA 3HD2A 1FF2A 4W4MA 3P5BP 3QSIA 1FKOA 2N4DA 5IOLA 3CPWR 2R8HA 4A47A 4DSJA 4DQQA 4LF5F 1CBKA 1LQ9A 4AXIA 3IS9A 2J9DA 1X4DA 3UE2A 2IPOB 4EI2A 4LBIA 3PYDA 2CNKB 4TLQA 1UL3A 2M8DB 2CUYA 2Z4PA 1PO6A 4NRUA 3A8JA 3TZXA 3QT7A 3G96A 1X5OA 3IRXA 3GLJA 1Y3JA 1IBMF 1N52B 2BW2A 1NU4A 1YK9A 4YR2A 2G1HA 4DF8A 4HACA 2BM1A 5F8MA 1SVDA 4X64J 1PCAA 2CG4A 1LW0A 2PA8D 1JLFB 4EU0A 1M5VC 2GGPB 1SL0A 4DSFA 1J5OB 2UXBJ 3SXLA 5DGAA 1QTNB 5K14A 1WC4A 2QTWA 2HHHF 1T9XA 2C2ZB 4LFAF 2Z0GA 1SIWB 4HLBA 5D4OA 4ID5B 2MLXA 4DSLA 1QAYA 2UUAF 5B0FA 3LP0B 2ZM6J 3CSKA 3H42A 2JFKA 1N34F 4ENOA 4NI2B 1A7GE 4EGLA 4G6VB 4E0DA 2I38A 4LREA 4LR7A 2YNIA 1E6YA 1RT4B 4AD6A 1T9WA 5T41A 4LF9F 4IOBA 4KTQA 5ETMA 2BQRA 3KUGA 5LT5A 5HJXA 2RDDA 1BD6A 1NK8A 2FHKA 3IR7B 1RDRA 3UNYA 4CLTA 4URGA 4PUOA 4PG7A 2EBEA 3QLHB 4ECRA 4QPTA 1TKTA 1CEZA 2MEWA 4YOEA 1DQAA 4O3QA 4C0HA 4DCPB 2GJIA 2CJAA 3B4DA 4HHHA 1S6QA 5H9FK 5HP1B 4A46A 4UY85 1FDAA 3DI6B 3NWGA 2CQPA 4USTA 1D1UA 3AOCA 3O2IA 4ZVSB 1B0PA 3TW0A 3PG9A 2J8AA 2WW4A 4O23A 5LJ3Y 3QGGA 2XCAA 1TVRA 3BGFA 2CQ0A 3HJVA 1WF2A 2RF2B 3UD4P 3GFXA 1KFSA 1EARA 3W5XA 3ULHA 1YBUA 1KDNA 1WOPA 5JXSA 5IS2A 2AYEA 2BXJA 4CLSA 3EUNA 4JBCA 4USJC 2NXUA 3EGNA 2V8VA 4ZA1A 4KKOB 5C2GA 3NY0A 3R1LA 4OI6A 2O3DA 2A3JA 3M2RB 2H5JB 1YG0A 3N6MA 2RS8A 2E5GA 3QGPA 5LXYA 3D5MA 4PXBA 3POTA 1FE0A 3AA8A 4B3SJ 1RWKB 1YLXA 2JSXA 2HK2A 1LNQA 2G1DA 2R7UA 1HBUA 4WP8A 4MAKA 1WSVA 2R7SA 1MWZA 1VBYA 4MFBA 2J0XA 3MMCA 1RT7A 5KFWA 2B6AB 2HRYA 1XR6A 3LP2A 2HMIA 2NUHA 1QY7A 4KO0A 2L9DA 2GHPA 2MQLA 1UAWA 1HIYA 3T41A 2H65B 4RW7A 1JLAA 3KTQA 4AUKA 1V9OA 5I4MA 2W9BB 4QJVA 3OSPA 3NEKA 3J7AN 1H72C 2GA7A 2HQ3A 4PYDA 2UUTA 2UVRA 2QA1A 3PDNA 1N0UA 2KM8B 1G1XA 2ZZTA 3JSBA 1N5YA 6AT1B 2E7WA 3PW0A 3DHXA 2BJ3A 2QEXS 3BDEA 1FD2A 1N32F 3KNAA 4NZ0A 2IM1A 5K20B 2VIHA 2RQMA 1WORA 2OD6A 4FYXB 4WTYA 2F8MA 2IVMA 3RJMB 2YVSA 3BH6B 1RT2B 2CJYB 2YTCA 4YB1P 2XSJA 4FZVA 4NX9A 3EX7B 4LRCA 4IH7A 2YKPA 5RUBA 1RISA 5C25A 2GIQA 2ZE2A 3FCHA 3MMBB 3MI7X 2Y8YA 3CJ5A 4ZIWA 4I2QB 2OMLA 4LF8F 2W9CA 4Q45A 4DJBA 4J9VA 3IBCB 2PMHA 3NS5A 2EFOA 5HL7Q 4B3RF 2V63A 4KJIA 4RKUC 3V5RA 4U7UD 4RUHA 3PRBA 2PIIA 5D0HA 1YJUA 3K17A 1H74A 3M2UB 3Q8VA 4FBTA 2IMOA 2KG1A 1UP1A 5H9EJ 3C6TB 4ZPVR 3L7PA 2Q6BA 4IRCA 4OX9F 3A3PB 1RWXB 3QIPB 4ZJQA 3M9NB 2L3MA 4RNMA 3HD1A 2K7KA 5SZTA 4LRDA 5LSLA 1NEEA 3THPA 2YNHA 1CULA 4PG6A 9RUBA 4DPUA 1U6BA 1S9GA 4F26A 1U1RA 2BJEA 4WFXA 2QSWA 5L1LA 3KDOA 2F1FA 2UXDJ 1FFSB 2F65A 2GFFA 4DQSA 2VDIA 4HTJA 3CTRA 4OL8A 3R27A 2YNFA 3QZ8A 2X7IA 2ADCA 5IT0A 2RU3A 2G9OA 3NMRA 3DMJA 3VAGA 4AFFA 4EMDA 5EHHA 2RHSB 1I94F 4KY3A 2YKNA 3EJMA 3TAMB 3D7SB 1K1SA 4F4YA 2I5JA 5HQLA 2IIHA 2VQFJ 3ADAC 5KG3A 1VC5A 4OX8A 3VAHA 2DJWA 3O5TB 2VC0A 2U2FA 2UU9J 3W1YC 4KGXB 4WU2A 3TI0A 3V81A 3GIRA 2GVDA 1G7CB 3H5YA 2Q1LA 4PR6A 4TN2A 1VRTA 1XBWA 4AL6A 3HX9A 1FXLA 3M7VA 2FVSA 1UA0A 1RTZA 1F1BB 1RAOA 3MEGB 3ZZRA 3VTIA 2Z56B 2WCXA 4KB7A 4WP9A 5DO2A 4ED4A 2Q6CA 4ECVA 1FWKA 1NB2A 6FDRA 5SUHA 2R3VA 1ZTTA 2CWXA 4FYVB 4IYQA 1H98A 1PG5B 1T8EA 3MM6B 3H5UA 5ETSA 3GR0A 4NLXA 2DGUA 3PHEA 1TUWA 1N88A 2CJBA 2B4OA 3MURP 1FNOA 2KJVA 3HHKA 2CPXA 4I6YA 4Y2CA 4MTPA 5I42A 1ZM3A 5DM7Q 4DX7A 2WVEA 4FF4A 4DL5A 4CLLA 2ZJQQ 1ZAXA 4BHQA 4DFMA 5CCLA 4DUYJ 2LQBA 2KFYA 2OPRB 4C8LA 1K0VA 3JAMY 2MPUA 2A1BA 3NLCA 3OW2R 2QLJB 4DSIA 4P2XA 2C2NA 1MU2B 1AA1B 2V8DA 5KOXA 3W8PA 3K89A 1PJ7A 3FEYB 2G0IA 2E29A 5J2PA 2DCUB 3US5A 3GSIA 4F50A 1FA0A 1JLGB 2KG0A 2ZUAA 1IVZA 3ENQA 5BR8F 1FRJA 3T5HA 3GMGA 4J37A 2QL7B 4CO3A 3R7NB 2ZH2A 1CJVB 2HHTA 1GXLA 5IFMA 4FF1A 2G0JA 1Y9OA 3D6MB 2IDEA 2B9WA 1IWAA 2UVWA 5CH7B 4YDXA 4F4AA 5IC6B 4M8LA 2V4QA 3AB4B 1FXRA 2H54B 3UVJA 4NLQA 1RBOB 1Q8KA 3GILA 3K5PA 3CCLS 3RR8A 3PACA 1VRQC 3SCLE 2QE5A 1DBDA 2UZAA 2M52A 5A8WA 3MECA 5AT1B 2KFZA 5ETKA 2JH3A 2OI2A 4FKXA 1LFPA 4P9SA 4BWJA 3C14B 3SBMA 3T19A 1XERA 3KJQB 1FDDA 3M6UA 4OYZA 4ETZA 3CUNA 1IXKA 2F4FA 1Z2ZA 3JTPA 4OYPA 4UTGA 2ZNYA 1H7WA 3CCJS 4LF4F 3SFUA 2ZOMA 2ZNZA 3WX4A 4QWCA 3ILOA 2FGCA 1OJ4A 1ZZFA 1S4EA 1TL4A 5HMWA 5E7OB 2QYGA 3HVAA 4ECYA 2CNNB 4OYOA 1HPZA 1FJGF 3VAIA 2DK2A 2HWIA 2ASLA 3MEKA 3LAKA 4O44B 4TQSA 2FUG9 4X4SA 3EXYA 1HA1A 3CJ3A 4D3HA 5B0EA 1LK7A 2K1RB 5E3CA 3D4JA 1XMBA 2IRYA 1BQNB 5L1JA 3G6VA 5IXUA 1FKPA 1UVLA 1S0NA 1SC3B 1GX5A 4NEYA 3IRXB 2GMHA 3IR6B 4TVAB 4K4TA 2C22A 5ETOA 4IQMA 1MROA 2RIJA 4N8OA 3IP0A 5KFYA 2MY8A 3UN5A 1AROP 1W2IA 2AZ3A 1NH8A 4KHRA 4J9UE 1X9SA 4V19J 4ED7A 3ET6A 1UJ5A 1DQ9A 3GR1A 4DR5J 4IR1A 1VQ8S 2RT3A 1JJCB 4ZIVA 4FYDA 1Q4RA 4OZ2A 3D1OA 4KV8A 4RUBA 4DS4A 4AT1B 3CJ0A 2BQ3A 2MB0B 1ZA2B 3H90A 2GQ2A 2R8IA 4BC9A 3E01B 3KYLA 4ZKAA 3KK1B 4LF7F 4QYRA 1EP4B 4C8NA 3TAQA 4DCJB 2HHQA 1RA7A 3PKMA 4LQ9A 4GKJF 3DXSX 1YHQS 3HSGA 3DYAB 3ZZTA 2KM8C 1JLBB 2YKQA 4JI2F 2CPYA 3PY8A 4DR1F 2V67A 3UFCX 1X4GA 1TKTB 1SC6A 2PC6A 1WOSA 1KOHA 2PI4A 2J0WA 1BUXA 4NLYA 1T0TV 3DOMB 3J81U 4FXDA 2AYGA 5EGYA 1RAFB 1U1MA 1WDDA 3MR7A 2N82B 1Q7LB 4QZVB 2KXNB 3W65A 2LU2A 2LQ9A 2ZHAA 2BR0A 1RSCA 5M2UA 3H7HB 2KHDA 2AYBA 1HQEA 2COLA 2V69A 2J7WA 1F6TA 2K3IA 1TZ0A 3VGSA 2BANA 1IBKF 5FJ4A 1UW9A 2W4CA 4ID8A 3PYGA 2B8PA 3CIMA 4DV0F 1JLQB 2HNYB 3UPFA 3GWCA 4B3TF 4N47A 2AEFA 4LSNB 3FNNA 1LEOA 1PSDA 3VZIA 1BLUA 2HS3A 3W9IA 3MM7A 3LOUA 4I2PA 2IC3B 2XSFA 2H9ZA 4OYWA 5J2QA 3AJ2A 3BEGB 3H40A 2XMUA 2MKJA 1C0TA 3CE8A 2PT0A 2PEHA 3BGOP 1S97A 4QIFA 3OXFA 3DRSB 4GVLA 2XY7A 3WBZA 1RU1A 3M8PA 4K2JA 1SQFA 2EWHA 2HRTA 3ZTPA 3HCXA 5G0RA 3MAAA 1XMOJ 4C98A 2AJFE 1QTMA 2J9DE 1NPKA 3R6GB 2FHJD 3VHQA 2CQDA 1IBLF 5L1IA 2LECA 4DV2F 2GVZA 2KYZA 2CDRB 1SH0A 2R7OA 2N3OA 5KFEA 4N7TA 3MWBA 4IH6A 3SCIE 3UD5A 1IJFB 5KOWA 2D41A 3J7YI 3PZPA 4ZN3A 2EFQA 2ACYA 2DITA 2BOPA 4HH0A 3MD3A 4AQYF 2VB6A 3GQCA 1ACMB 5KG0A 1U2RA 1NLKL 2VH7A 2DNMA 3O6QA 4L76A 3AOAA 5KFFA 2KU7A 2KB2A 1N5YB 3M8YA 1WF1A 2NUUG 1JKHA 1TKZB 2QT7A 2WOMB 4ELTA 4E98A 4NLRA 4DV6F 3Q2TC 8RUCA 2OD4A 1VC6A 1N36F 4DV4F 4DL7A 2X51A 3Q24A 1V5IB 1AFIA 4LIWA 3V6DB 3VGVA 2EK1A 1SJFA 2MMYA 4DN0A 3QO9B 1QSYA 1YITS 3T1AA 3DKDA 5GAEI 2KTQA 2H5EA 1NSPA 2YX7A 3GYNA 2B4VA 1T94A 4GKKF 5I3PA 2G4BA 1S0VA 1RHQB 4PWDA 2CZ4A 3H2UB 1REVA 1HNXF 1APSA 3BYRA 3AD9C 3BSCA 3WZ0A 3CD6S 1WG5A 1HQUA 3MAQA 5C24A 4P2SA 2FZGB 2KFNA 4LMZA 5F8JA 1WG1A 1KSPA 1NKCA 1R31A 4F3QA 3PJ9A 1RQ0A 4OJ1A 4Y2IA 1X0FA 2YWGA 4HT7A 5AXLA 2YXLA 2KZMA 3DN9A 4G1IA 2M4MA 4C11B 2IJNA 5HN0A 2F7VA 4F36A 3T5JA 1DQ8A 1H2UX 1RAGB 1NZAA 2ACMA 5IM0A 5HBMB 1N33F 1KKHA 1YJTA 4DR2F 8AT1B 2XBPA 3UD3P 2WK4A 2DRDA 1Q79A 3OHBA 2IBKA 4ED6A 2NYHA 4H4OA 2BE7D 3K8WA 3R5AA 4UZBA 1HNWF 1H2TZ 3WQPA 3M9MB 1Z1ZA 4HDGA 4FVCA 5DQHA 2AD9A 3VV2B 1FEEA 4XO0A 3BN7A 3VVUA 3BB5A 3QYYA 5LMNJ 2H3EB 4J9PA 2WVCA 2HFOA 3NGTA 2Z57B 4YFUA 2E1MC 2KHCA 3QATA 3FEZA 4WXWA 4NLDA 5M2RA 3C46A 2F4VJ 1SQGA 1OS5A 3TQ1A 1U45A 1N5SA 2FVRA 4N8NA 1S72S 5EWGA 4M95A 1RAEB 1QLNA 2EG2A 1U1QA 2YNGA 4PXDA 4DFJA 4JI5F 2YQ0A 3BBCA 3GFHA 2YKAA 2FZKB 2Y3YA 3VWSA 4ZN1A 1XEZA 4ECTA 4IH5A 4JOUA 1S76D 3FUYA 3MEEB 3BV8A 2B7CB 4HKQA 4QWAA 3QJLA 1K0TA 2B9XA 5A0YB 1TELA 3K5NA 2KRBA 4FN5A 4DUTA 5FDLB 2BBEA 4NLVA 3PW4A 2ZHBA 2X1FA 2MKIA 3JTNA 2VFRA 2YWEA 4ZPTR 1D3WA 4NXNJ 2DH9A 3F41A 4CLWA 2FJAB 1TK5A 2W4PA 1SC1B 4DG1A 1SJ1A 3AOBA 3CDBA 1U2CA 5JVHQ 5DGBA 1KTQA 1UFKA 3BM7A 2QMXA 3KG4A 3RW6A 2DHAA 3IR5B 2QN6B 3D9BA 4LF6J 1FVQA 1SV5A 1G6BA 2J7KA 4OJGA 1IJEB 1OO0B 1TL5A 4WKRA 4FP9A 4CLPA 2AJQA 2HHVA 3TNVA 1YBAA 4WZQA 2B7BB 1KTVA 1S0OA 2B0GA 4U7UK 2CQBA 1U2FA 1FD8A 2DNGA 2MZJA 3V4MA 2Y1IA 1WNEA 1E6VA 1RAIB 3KG1A 3BGUA 4YN3B 3ISND 2M5YA 2MSTA 4WK1A 4LFCF 5KFZA 5IQQA 5IT4A 2PSZA 1VDHA 7AT1B 1ZS6A 3OTEA 1IQTA 2HQIA 4CRJA 1U26A 5GMEA 2HVDA 3KDNA 4LF5J 1HFEL 1NKBA 4OI2A 2CQIA 3CF5Q 3D3CJ 4DV5F 4KHPF 2EKNA 3V4IA 1RT6B 2C3OA 1EQ0A 1CSJA 2JL9A 3N79A 4XIUA 4USIA 1C1BA 1CJTB 3K7RA 3TA1A 3KMSA 1FXDA 3I5AA 3B6BA 2VBZA 3KHHA 5C42B 2VZ9A 1N56A 3SCKE 4X66F 3OXGA 1IBMJ 4ZHRB 1XN9A 1JLEB 3IM8A 2BABA 3RBZA 3JS9A 4P2MA 1S1VB 4ICLB 2XMWA 2R7XA 2E9RX 2OKQA 4R8UB 1SUQA 2ILZA 1PILA 4LVOP 5CYMA 3NXZA 2HNZA 2HHHJ 2Q79A 4WFAQ 4ECQA 3LO3A 4LFAJ 1D8YA 3MUVP 3OVSA 3TUPA 2VV5A 4Q0BA 3D2WA 1CPZA 4K4VA 2GO9A 4IFYB 2UUAJ 1N34J 2CZVC 1UWBA 5CYQA 4CWBA 4I69A 4KQZA 1HBOB 3IRWP 1EAYC 1UEKA 4LF9J 1HBNA 1NXIA 1JXVA 5KAKA 5U47A 1BE4A 3DU5A 1A9NB 4AL5A 3DM2B 2HIYA 2KXHA 2ZWOA 4J9QA 2FHJA 3S1TA 5JUMA 2PI5A 4Y0FA 1O51A 3OTCA 4L72B 3LQVA 4JUZA 1X5PA 2DEIA 2W2MP 1RCOB 5J1NA 3MPYA 1IR0A 2DR8A 5F8NA 5LMUF 3NKYA 3Q8RB 2CVIA 2HHXA 5LSOA 2BJ7A 3NBPB 4NCBA 1RT1B 1DTQA 1WC1A 2FD2A 4WFYA 3OR2B 4MIAA 1QVGR 3R5GA 3OUYA 3PX6A 4I6AA 3D3BJ 1D09B 4OHZA 4PQUB 2G0CA 2E7VA 2HKEA 4ZVRB 1RHJB 5KT3A 5LXRA 1DAXA 3OR1B 3PHTA 3A3OB 1I51B 2XS2A 1S48A 4H4KA 4OYMA 1WF0A 2RU9A 1YX2A 1FI4A 2D9PA 4YQWA 2Q43A 5HROA 2GMJA 3DLJA 1TU0B 2C1EB 5G4DA 4UW2A 3I0SB 4RW9B 2K8GA 4DR3F 2XWYA 4NRTA 3TOQA 4ZDNA 1R3NA 3H25A 3NOGA 2RAQA 5T7LA 7FD1A 3R1HA 4Z7YA 4OFZA 3R5BA 2Z58B 5CD4A 2HS4A 2MY7A 3ZC4A 2QMUB 3N5BA 2BEFA 4B17A 2EBGA 2WHOA 3M1VA
chains in the Genus database with same CATH topology
1RDRA 4URGA 3OJUA 2XY6A 1FDNA 1TKXB 4PUOA 4ZVGA 4PG7A 1QJHA 1HMVB 2EBEA 3BO3A 2DGQA 2VA2A 4QWBA 3QLHB 4ECRA 2EC0A 1F0XA 1M5OC 2NREA 4QPTA 2XMVA 1UMJA 2C3MA 4RW4B 2XG8A 5KT7A 1TKTA 1CEZA 3V4IB 2RRAA 3MOZA 3LPYA 3C6UA 3O3LA 1RJJA 3KLFB 3MF5A 2ZZNA 4WYLA 4YOEA 1B0TA 3FMBA 2HWHA 1DQAA 4O3QA 4J9RA 1KD1T 2YH1A 4FF2A 4C0HA 2NS1B 2ATLA 1MMDA 2GJIA 2CJAA 3B4DA 1C1BB 1S6QA 1Y5LB 4RBVA 2D7SA 5HP1B 4OZJA 4A46A 3MR2A 4UY85 1FDAA 3DI6B 3NWGA 4B9NA 2CQPA 3C6TA 3ZZZA 3O2IA 1YIJS 1B0PA 2CQHA 2LEPA 1D1UA 3TW0A 4OHXA 2J8AA 3OL9A 4Q8FA 4O23A 1FRLA 1HBMB 5LJ3Y 4ZPAA 3QGGA 3NAHA 2WW8A 3QIPA 1RKIA 3UW1A 2ZH9A 1SKSA 2XCAA 2M8HA 1S1UA 1Y7PA 2RKIA 2FC8A 5AXMA 2OPQB 1TVRA 3ISNC 2CKWA 1JNZB 5D78A 3I4HX 3PJXA 3BGFA 5D4PA 1HNZF 1OWXA 2Q3PA 3CCUS 2CQ0A 1HNIB 4TQRA 1SIZA 1F9FA 2MKKA 1TK0A 4URSA 1WF2A 4U9RA 2RF2B 1AW0A 1SJRA 3UD4P 4F4ZA 3GFXA 4J5OA 3DLHA 3JSRA 2E9TA 2B3TB 3HI9A 1KFSA 1SB6A 3AY0A 1VQSA 1SUQB 3D0IE 2FPHX 2DGOA 3T6JA 3ULHA 2ZDPA 5FD1A 2MGZA 5KT4A 2WSCC 1RTHA 2BYCA 2MKSA 4QR1A 2DNYA 1VGYA 5JXSA 2GX8A 5IS2A 2YH0A 3MFHA 4X64F 5CYMB 2AYEA 2BXJA 4RU2A 2XNRA 3EUNA 3OXLA 4JBCA 4USJC 2HNZB 2NXUA 3EGNA 2V8VA 4ZA1A 3MM5B 3GV8B 1M90T 1HI0P 3MAHA 4R0JA 2FJBB 4KKOB 2UXBF 2Z2MA 3M8RA 2QFJA 3M6VA 1GTEA 3W2WA 2Y0SD 3R1LA 2I0XA 3JSYA 4Q0BB 4OI6A 4UY8T 2GW8A 2O3DA 2A3JA 4QWEA 3M2RB 3FRZA 4RWWA 1IKXB 1K73T 4K2XA 4M5DA 3GV5B 4KR0B 2C2EA 3U27A 2R8JA 4DQPA 1UWBB 2RNEA 3H2VE 5CYQB 1YG0A 2EK6A 3G6ES 3IAM9 3N6MA 2RS8A 4P6QA 1R8BA 2E5GA 2KT3A 3QGPA 3D5MA 5LXYA 4PXBA 4LQ3A 3M32B 3TAMA 4B3OA 1HBNB 3DU6A 2ZM6F 3DOLA 3POTA 1FE0A 3AA8A 1WI6A 2BE2B 3Q2SC 4O3PA 3KJVA 1RTIA 3D1HA 5E3AA 2JSXA 4Z2XA 5HLFA 5BYRA 2WTFA 2EFPA 1JJHA 2G1DA 4NOHA 4IOCQ 5T14A 1GXUA 2R7UA 1HBUA 5KFGA 2VG7A 4MAKA 1C2PA 2CQ3A 4B9MA 5F8GA 2R7SA 5DG9A 3HPOA 1MWZA 1VBYA 2ASYA 4MFBA 3T6BA 2J0XA 5J2NB 3B8HA 3MMCA 1RT7A 2V94A 4IFVB 5KFWA 2B6AB 3DC2A 2HRYA 3NAIA 1FKOB 4RBUA 6FD1A 3G8QA 3OTDA 1KOOA 1XR6A 3LP2A 3MEDA 3NGDA 1U1PA 2HMIA 3I9V9 2J0SD 1AFJA 1FKAF 2RJZA 1R43A 4K0KF 2NUHA 4ELVA 1QY7A 4KO0A 2L9DA 5DDRC 4ED2A 2GHPA 1BQMA 4OX7A 2MQLA 3IS9B 1UAWA 1WHYA 2XULA 3FSYA 3IG1A 2J6SA 1M5PC 2B4UA 3SQGB 1VQ4S 5A8KA 1R8CA 2GHWA 5B0CA 4RW7A 4WU3A 4F3MA 3KLVA 1JLAA 3KTQA 1DLOA 4AUKA 1DTQB 3QGHA 1V9OA 2J0QD 4LT6A 5I4MA 3J81Y 1WTBA 4QIWD 3OL8A 4R25A 2W9BB 3MEGA 3IO1A 4B08A 4RNOA 4QJVA 3GSDA 4KFBA 1IKWA 3OSPA 1ZZNA 2GA7A 2HQ3A 2ZH4A 3KLEA 3OUYB 2B51A 1T02A 2BRLA 2M7SA 5KFVA 3VAKA 2UUTA 4C0BA 1NJXA 4C8MA 2KKHA 1UVIA 2UVUA 2UVRA 2QA1A 4ECXA 1PC5A 2VBWA 5I3UA 3PDNA 2ZJRQ 1N0UA 2FLOA 3R5CA 2KM8B 1G1XA 4TU8A 3JSBA 4IDKB 1N5YA 2ZD1A 1GQEA 2ZVSA 2OIHA 2E7WA 1R27B 2OPSB 2GO8A 3HHLD 5L39A 3PW0A 3DHXA 3ETOA 4C2MA 1U1NA 2QEXS 3BDEA 1FD2A 3KLGA 2VQEF 2OP5A 3KNAA 1N32F 4NZ0A 4DF4A 2IM1A 1NK0A 1ELOA 1WI8A 2RQMA 2GCFA 1LW0B 5GAGU 1CC7A 2KDOA 2X1AA 2OD6A 3MM6A 1BQXA 3UR0A 3KHRA 3HHDA 1FK9A 4WTYA 1UVKA 2QMWA 4O0IA 2CVEA 2AP6A 2F8MA 2ZH5A 2IVMA 2X1GA 2Z8QA 3Q22A 2YVSA 4X4QA 1RT2B 3VQTA 2WONA 5HROB 2UUCF 2DH7A 2E66A 2YTCA 5K14B 4YB1P 1BWEA 2W9AA 2XSJA 1UFWA 1MMNA 3FMWA 5HMZA 4CH1A 2C2RA 3ZZUA 3I56S 2EFGA 3IWNC 4WKYA 2PE8A 4FZVA 4NX9A 3EX7B 3HO1A 2DGSA 2WBRA 2DH8A 1JIHA 4IH7A 2YKPA 4NCGA 5T7LB 2F8EX 4I68A 1RISA 2JC1A 3HK2A 2AGPA 5C25A 1CC8A 2HGLA 3MMAA 1D8ZA 1ROFA 4QIGA 2GIQA 4I1TA 4J9LA 2ZE2A 3FCHA 1R6YA 2ZUGA 4ED0A 2W7PA 1NK4A 4ZOSA 3KMQA 3V6KA 2YNIB 1E6YB 4Y34A 2I9SA 2OPRA 3MMBB 5DS7A 3MI7X 3RTVA 2KN4A 3DRPB 1YGYA 2R7RA 3BSOA 3CJ5A 2MDAA 2DNQA 4I2QB 2OMLA 4LF8F 2W9CA 3C3LA 3W7BA 5EUHA 4DJBA 1CG2A 3JTOA 4RX6A 4Q45A 1JJ4A 4NLGA 1NHUA 4B3SF 3CWJA 3I0RA 3M1VB 4Q7AA 1WD6A 4OIXA 1LXJA 5ADZA 1KVJA 1MU2A 2PMHA 5EX3A 2GMLA 2ZH8A 1GTHA 1HHTP 2XLKA 3U02A 4PUOB 2FY1A 2OFHX 3NS5A 2DGVA 3P96A 2EFOA 2LYVA 5HL7Q 5BYQA 4B3RF 2KT2A 4KJIA 1YJ9S 3S7RA 4ED8A 1WTFA 4P7VA 4RKUC 3V5RA 4EBDA 1FHTA 3MGJA 1JLGA 4RUHA 4GC6A 3PRBA 3V2UC 2PIIA 1FXLA 1TR0A 3GB0A 1YJUA 4R0EA 2VFVA 2O66A 3C6UB 2RMLA 4LJMA 2XI3A 5F3TA 3KK2A 1HI1A 2F3JA 2UP1A 3M2UB 4UUWA 1VQYA 2BJDA 4O4GA 2ZH6A 4FBTA 5GADI 2IMOA 2KG1A 1UP1A 1N6QA 3QJJA 1S6QB 3M8QA 3MPWA 3NGKA 2LMIA 3BGRA 5GADU 2VPYB 4ES1A 4IG3A 5KFSA 2FGOA 2V8GA 5H9EJ 3H98A 4ETXA 3C6TB 2R2TA 1UEVA 4ZPVR 3T3FA 3FSXA 3L7PA 4QR0A 2Q6BA 3P5TL 3AQPA 4IRCA 1F2GA 4OX9F 1KQGB 3QIPB 2HVIA 3M9NB 2L3MA 1S1UB 4RNMA 2RKIB 5KG1A 5L9NA 2K7KA 1QSSA 1TVRB 2M2BA 5SZTA 4DL2A 5LSLA 1NEEA 3THPA 3M6XA 3KLIA 2YNHA 2LEAA 3DCAA 4HDHA 3FQLA 2EKYA 4PG6A 4FBUA 2XMTA 1U6BA 3RRKA 1S9GA 4G1QA 4C97A 1VQ5S 1HARA 4F26A 4QPXA 3LF0A 2JEJA 2PDAA 3G6XA 1U1RA 1KR4A 2BJEA 2KVIA 2V9KA 1HNVB 4J9MA 2V8HA 1KLNA 1VIXA 4WFXA 4JI4F 3H59A 2QSWA 1HI8A 2MGZB 5L1LA 1RTHB 4N77A 1FCAA 1T95A 2F1FA 2I8EA 3PX0A 2DGTA 2IBOA 1U1LA 2YX1A 3SYZA 4NPOA 1HD0A 4CO4A 3HXMA 3LWMA 3CIZA 3G4SS 4EYIB 3RZAA 4I4BA 2JEFA 2GFFA 4EBEA 2OFGX 4QU6A 4DQSA 5B7WA 3ISZA 2KI2A 2BM0A 1ZM9A 2XMMA 2KRRA 4HTJA 3CTRA 3W2WB 2AQ4A 4OL8A 2DGXA 3R27A 3CULA 4Q43A 2XEXA 4UQTA 1PC4A 1S9EA 2YNFA 4CNZA 1WG4A 3KKFA 5KFMA 5LJ5Y 3QZ8A 2ADCA 1VQNS 4M5DB 4DL0C 5IT0A 2HVZA 2RU3A 3FDSA 2G9OA 1X8DA 2JOQA 3NMRA 3DMJA 2DISA 3DOKA 3VAGA 3SDEA 4AFFA 3KNGA 2FJVA 1HL6A 2AX1A 5M2PA 3M9OB 1X5SA 5EHHA 1I94F 2VOPA 2NZ4A 2YKNA 2WSFC 3TAMB 4Y2KA 1QE1B 4B3OB 4TY9A 1FT8A 3D54A 3UDCA 2KZZA 2VPWB 3DOLB 3POTB 1K1SA 2M9KA 4F4YA 1N48A 2I5JA 2RSQA 3KJVB 1RTIB 4WFNQ 3MD1A 4XAKA 4CQ1A 5HLFB 4QOTA 5KFIA 1HR0F 3DDKA 2HG4A 1WEXA 3OFEA 3T9ZA 3BQ2A 1HBUB 5KG3A 2DR9A 2VG7B 4OX8A 1VC5A 3VAHA 5F8LA 1MWYA 1YWXA 4MK8A 5KFTA 2DJWA 5EN1A 4X4VA 5HO4A 3OJSA 2XB2D 3GYXB 3O5TB 4FS2A 2XGPA 3RAQA 2VC0A 2U2FA 4MFBB 1NK7A 4F02A 3PEHA 1ZM2A 3MMCB 1RT7B 1DZ5A 4ECZA 4OHYA 2HHUA 3CMES 1S77D 3PO4A 1DJ0A 4X4TA 4JI6F 3LP2B 4WU2A 3MEDB 3TI0A 4N56A 2HMIB 3V81A 1J5EF 2IJFA 3A8EA 3IBWA 3G8SA 4KO0B 2EFVA 1LW2A 1BQMB 2MJNA 3H5SA 3D28A 3KG0A 5EDWA 5KFOA 2VPZB 1U47A 1U25A 1G7CB 2DIUA 4JI0F 3H5YA 2Q1LA 2UVVA 4QIEA 2ZZMA 3IG1B 2ADBA 2DNNA 4PR6A 2MZTA 2J9EA 2FHOB 3OFFA 4TN2A 1VRTA 1XBWA 3B82A 3LALA 4AL6A 3OQ2A 3HX9A 3ZFVA 1JXLA 3BDPA 1KHWA 4MK7A 5A8KB 3TR5A 4O44A 1S1TB 2LXFA 4RW7B 3KLHA 4MKAA 1JLAB 1A6LA 2FVSA 4OV1A 1UA0A 1DLOB 4PG5A 4EUVA 4NLWA 1CVJA 5BYSA 2R2SA 2K1RA 1NJWA 1JJ2R 3X1LB 3MEGB 3ENVA 3G86A 1P8GA 3ZZRA 1BQNA 4KFBB 4RW8A 3VTIA 2VOOA 2LA4A 3CT9A 2WCXA 3KLEB 1BGXT 1XR5A 1SL1A 4KB7A 3N5FA 1KHVA 4WCEQ 4DLGA 5DO2A 3Q8QB 1CQMA 3ZZPA 4ZK7M 1YJVA 2Q6CA 2VG5A 4G3IA 4DHVA 2VKRA 5I3UB 4ECVA 1D9FA 5DLFA 1NO8A 4DR7F 1I6JA 5E33A 4EZ6A 3VAJA 2VG6A 2ZD1B 4JV5F 1OPIA 3E3XA 6FDRA 5H1SV 2BQUA 5SUHA 3KLGB 2W7OA 5L9XA 1ZTTA 4C8KA 4C8OA 4ZP8A 3BJYA 4C4WA 3ENWA 1U49A 3DLBA 4NYPA 3UR3C 4KGMA 4IYQA 4PQAA 1H98A 2CPIA 1CQNA 4JV2A 1T8EA 1K1QA 4DPOA 3MM6B 4UQGA 2L41A 3H5UA 1FK9B 3GR0A 4NLXA 2DGUA 3VAFA 1U8SA 3VCDA 1YTYA 3PHEA 1DRZA 2UXDF 1N88A 4H54A 2ABYA 2CJBA 5KFRA 2WONB 2B4OA 5DDPC 2QA4S 3MURP 2QZ8A 2D3OR 1FNOA 1NK5A 2KJVA 3ZZYA 4CZCA 3IC1A 5KFQA 2WBMA 4LSLA 4WF9Q 3HHKA 2CPXA 1R8PA 2XSJB 2XGQA 3CC7S 2E9ZA 4I6YA 4A8QA 1LWFA 2V5HG 4Y2CA 1S10A 4MTPA 5I42A 3TANA 1ZM3A 4HI1A 4X4UA 4RNFA 3OV7A 5DM7Q 4NLSA 1S6OA 4WJBA 3PEJA 2B4PA 5KG4A 5B0GA 3IXQA 4FF4A 4DL5A 3RB0A 1X9WA 2ZJQQ 2FB0A 4YP3A 2FLLA 4I67A 1NH7A 2VKZG 4DX8H 5C25B 2DR5A 1P27B 1LWEA 1ZAXA 3MMAB 2HW3A 1SJQA 4HT5A 2J76E 4BHQA 1Q8LA 3E01A 4ITSA 5CCLA 4DFMA 2DNPA 3KHLA 2ZE2B 2LQBA 4TLRA 2KFYA 1LWCA 3KK1A 3CCRS 2J9CA 3N6NA 1EP4A 3MTJA 2E1AA 5HMYA 3E2EA 1FEHA 2OPRB 5GAEU 4C8LA 4PXCA 3W3SA 5B0DA 1K0VA 3JAMY 2W9CB 2MPUA 1WELA 3EPIA 4KPYA 2A1BA 3NLCA 3OFGA 4O4RA 4K4XA 3OW2R 3LANA 2B56A 2RE1A 3DDNA 3PIPQ 3DYAA 4DSIA 4W92B 3HHLC 2VQFF 1KRPA 1VQ6S 5K8PA 1MU2B 1JLBA 2V8DA 5KOXA 2HIQA 1Q86T 1KLMA 2LQ5A 2WSEC 5KFBA 3N6LA 4DLEA 2RILA 3FEYB 1VLYA 2E29A 2ZC4A 2DCUB 5J2PA 3US5A 5KFHA 4JV1A 2LXIA 4F50A 2UU9F 1H7XA 5E3RA 4WZMA 1FA0A 4NYZA 1HD1A 1JLGB 4XK8C 5C5JA 5F3ZA 3MM9B 2LU1A 2KG0A 3ENQA 4DOZA 3BSNA 4MH8A 3NCQA 2D3ZA 5BR8F 1FRJA 4KGKA 3T5HA 3DOMA 4FF3A 4OI0A 3GMGA 4J37A 2MZSA 2Y1JA 5KFPA 3JYTA 2ALZA 4O4GB 4HVZA 1FERA 1FTRA 4CO3A 5AJ3F 2ZH2A 2C2DA 2VBYA 4F25A 4A8SA 2ROPA