4B3SF

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 19
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3sF00
2J5AA 4GKKF 2UUAF 2UXCF 1HNWF 4DV3F 1XMQF 4JI0F 4DR2F 2BVZA 1IJEB 4YY3F 5LMNF 1I94F 4LF4F 1LOUA 4GKJF 4DR1F 4DR6F 4DV6F 4JI6F 1GH8A 4LF9F 4JI8F 4LFCF 1XMOF 1FJGF 2UU9F 2HHHF 2VQFF 4DV2F 3ZZPA 4DV1F 1RISA 1F60B 1XNQF 2UXBF 4JI2F 4DV5F 1N33F 1IBLF 1N32F 2F4VF 1G1XA 1B64A 4OX9F 5AJ3F 2UUBF 2BXJA 4JI5F 1G7CB 2B7CB 2VQEF 4DUZF 4LF5F 1CQNA 1CQMA 2YY3A 1IBMF 4AQYF 1FKAF 4LFBF 4B3MF 1N34F 4DV0F 2E5LF 4K0KF 1HNXF 5IWAF 1HNZF 4JI3F 1HR0F 4DR7F 1J5EF 4KHPF 2RJZA 4DR5F 4NXMF 4LF8F 4JI1F 3T1HF 4DR4F 4NXNF 1N36F 1IBKF 4X62F 4LF7F 4LF6F 3R3TA 2UXDF 4JYAF 4B3SF 4X66F 1IJFB 2KJWA 4YHHF 4B3RF 3T1YF 2ZM6F 4B3TF 5BR8F 1XNRF 4JI4F 4DV4F 4DUYF 2B7BB 4X64F 3OTOF 4JV5F 2KJVA 4DR3F 4X65F 5LMUF 4JI7F 1VMBA 4LFAF 4DV7F 2UUCF 1QJHA
chains in the Genus database with same CATH superfamily
3GFZA 2GVDA 2VFTA 3W8GA 1YJVA 1XTZA 3DHWC 3R5AA 3K5LA 2UUBJ 4O3OA 1FJ7A 4QR0A 4K50A 4OX9J 3GWCA 2B5JA 3DLHA 1B4SA 1IR1A 3BBBA 2EK1A 4H4KA 4YDXA 3JAMY 3T5HA 1IJEB 3GR0A 5KG1A 4M5MA 4YB6A 4BHQA 3T5JA 4DL0C 1ZM3A 2CZ9A 2P5VA 2GVDB 3Q8YA 1APSA 4XAKA 2J6SA 1NLKL 2XWXA 2GIFA 4ID5A 5E7OB 1LXJA 1NDLA 2F4FA 3GTYX 2KFZA 4LQ3A 5HN0A 5C25B 1HWIA 1NM2A 2XYPB 2JLGA 2LYVA 1GH8A 1NB2A 3W62A 1JLQB 3J7A1 4RW6B 5ETOA 2BRKA 4Q8FA 5LXRA 3KJQB 1RAGB 1VR6A 2JSXA 2W2QP 3WBZA 1EJ7L 4J9PA 2ZDOA 3J80U 4TQSA 1X4FA 2OTLS 3H7HB 3EPGA 4AL6A 4I68A 3PTWA 3PKYA 1VQ9S 2UUAJ 3G8SA 1GMUA 5DQGA 3ZNJ1 5J2PA 4RW9B 4BCAA 5F8NA 1RT2A 4OZ5A 2VD3A 4TY9A 3SCKE 2FB0A 2PEHA 4NLWA 3G6VA 3G6XA 4KRWA 1DJ0A 2HQDA 1IBLJ 1N6QA 1LKZA 5IXUA 3HSDA 4XDDA 5JUMA 3D4JA 1SB6A 4K4WA 2AEJA 4IDKB 2L3MA 2BR0A 3BB5A 1RT6B 1TV6A 5E3QA 4QW8A 1HQEB 2RVJA 1FD8A 3M6WA 3SIPB 1FFGB 2IDLA 2BBEA 5KFBA 2W1BA 1X9SA 3B6BA 5G0RB 3H5XA 4RW7B 1RTJA 2WRMA 4J9LA 2BMBA 3IWNC 3UW1A 3OR1B 2O1PA 3LP0B 4E98A 1VQKS 4TYBA 4FBTA 4U67Q 3OLBA 3T6JA 1NK5A 2XZDB 2JC1A 2CA9A 1R27B 4M5NA 3IS9B 4KV8B 3MTKA 4QCLA 1CPZA 2NR0A 1TK8A 3Q8QB 4JI4J 3MECA 3NXZA 4J90A 4WK1A 4AQYF 3SI8A 4EYHB 3KLEA 1WKKA 1FXDA 1WACA 4QYRA 4FKXA 2KRBA 2KZMA 2QE5A 2RB7A 3VAIA 4LSLB 3HSJA 4ILLA 2DRAA 2CQ3A 1Z4UA 2O66A 4I7FB 3AD9C 4USWA 2VBZA 1HNXF 4DSKA 2N4DA 2X3DA 3KJFB 2XY7A 1HNZF 1Q79A 2LDIA 2KB2A 2N7YA 5I42A 3TUPA 5FD1A 5L9NA 4QIWD 1GEHA 2QYGA 1UZHA 4ANEA 1J5EF 4J9RA 3VVUA 4E2FB 1ZOTA 5H9EJ 1B3TA 3GG0A 2RKIA 2CPYA 5ADZA 2EW9A 3KFWX 2YKNA 2DHSA 4O4RA 1Y3KA 3O1LA 3WX8A 5RUBA 4TXSA 3DLEA 4LF7F 3Q23A 2Z2YB 4X64J 2DNMA 3D5MA 4KSEB 4OYBA 2GMJA 2WOMA 3OBIA 5D4PA 5IV4A 3D1HA 5A6PA 1VC6A 1JXLA 2VA3A 4DXLA 3DLLQ 2UXDF 3RBXA 4NL5A 2RT3A 1L3TA 2CDRB 2QT7A 2DH8A 2HHHJ 2RKIB 2AJQA 8AT1B 2L9WA 2ASYA 2BOPA 3NS5A 4A8KA 3SSRA 5AXNA 2DIVA 3UDCA 2WOMB 2XSFA 3SQGB 2IMWP 2Y0BB 2RS8A 2ALYB 3J7AN 1HBOA 3ZO7A 2ZZMA 3CIZA 4ZJQA 2HVHA 1RADB 2BJEA 3IC1A 3P45B 2C2ZB 3TZYA 4WTYA 3BQ1A 3SDEA 5T14A 2DXEA 3PYEA 2V8HA 1WG4A 2D3O1 5HI7A 5DDOC 1VK8A 1SKSA 5B0GA 4MKYA 2VKRA 2C3UA 2DNOA 2ADCA 2C28A 4P75A 4WK3A 5D6GA 1FD2A 1KS2A 1UA0A 2LQBA 3IBFB 1MSWD 4DN0A 2HBZB 3W64A 1X4EA 1TKTA 3QT7A 3GIRA 4LFAJ 2IJRA 4CLLA 2HBQB 2P9GA 5DDQC 2XI3A 1QAXA 1RA7A 3AQPA 4C8NA 2GVZB 3ENVA 4YS2A 2Q79A 4Z37A 3L4BC 3CC4S 1X5TA 1WUUA 1YBTA 1F1BB 1ICEB 1P6TA 3BZQA 4LRFA 4UZCA 2MKKA 3OVAA 4FF4A 5HBMB 3BH6B 3QZ8A 1TKTB 2YKPA 4WFNQ 5B0BA 4DUYJ 1Q16B 2DR6A 2F5GA 2F65A 4DCJB 4CQ1A 5IT4A 4ZN3A 2L48A 3JQMA 1WTFA 5DGBA 3TANA 1FJGF 2ZNYA 3R5CA 3LPYA 4DUZJ 2G2ZA 1BUXA 2DNKA 4FVMA 4F3QA 3H40A 1R0AB 1U48A 4F4XA 1SL0A 2XHWA 4OLOA 2IY5B 5EX3A 3KJVB 1FWLA 3GYXB 5CZVA 2IJFA 4DU7A 3M6UA 2HFSA 3OJSA 2WCXA 3RR8A 2UXBF 1Y4ZB 5D78A 5ETPA 3VHQA 1IBMJ 1P8GA 1Y00A 1J5OA 4PRFA 4IFVA 4DDFA 2CXEA 3AB2B 3GP9A 5IS2A 3BN4A 2CG8A 3NLCA 4KKOA 4OYZA 5DJBA 3VAFA 3EZUA 3U1LA 4OX7A 1T03B 2IRXA 2VZ9A 2DO4A 4XDCA 3M2UA 1WG1A 4MK7A 2KT3A 4ZA1A 1MMDA 3DCAA 2WB4A 3TVZA 4F0MA 1Q7YT 1S6PB 1S6UA 3ZTOA 3GFXA 3PRDA 1N5QA 4RL1A 3PIOQ 2VQEF 2DITA 4JI8J 3UWTA 3HKWA 4GMKA 3SFUA 3N6NA 3TA2A 4Y0FA 1WG5A 5HQ8A 2IFXA 1CC8A 4IH5A 3G71S 3DLGA 4FYXB 3SV3A 1N32J 4ZIVA 1Q7LB 3IWLA 1Q95G 2B4PA 4PABA 5KFGA 1HFEL 2V9KA 2KXHA 1LWCB 4KGMA 5J2NA 3MEGA 3TX8A 1WKJA 3OTOF 4CTAB 1WOOA 3AB4B 2NSBA 2NUHA 3MM8B 1RA6A 3TEHB 3ZZUA 2MZ1A 1D1UA 4YB1P 4WZQA 2R9LA 2NQPA 2EVZA 3RRGA 2HVEA 4NLSA 4C8KA 1IKWB 1FT8A 3DLJA 1SXLA 1WOSA 4PG6A 3KK1A 1N8RT 3QRRA 2SXLA 4YB5A 4CI0B 1KBRA 2W9BB 1FJCA 1RYSA 1HR0F 3RR7A 4PWUA 2MZQA 1JKHA 3GZ7A 4DL3A 2WW8A 8RUCA 1N54B 3I0RB 1FK9B 2XGQA 3SEOA 1SL1A 2XGPA 3FBFA 1ACMB 3T1HF 1BY9A 3DKDA 1Z1ZA 4YQWA 4KGKA 1YJNS 4L75A 4NXNF 2OEJA 4WF9Q 3DOMA 1JKHB 1FWKA 2KRRA 1K1QA 4QW9A 1U1LA 1Y5LB 4F8RA 2RD5C 1FK9A 1CS4B 4PKDB 4B17A 3PW0A 2XYGB 3QSIA 2D9OA 3UVJA 2CQDA 3BYRA 3HHLB 4AD6A 2DVIA 1DTQA 3M2RA 1YIJS 1GFWB 4OI4A 3A3PB 4WE1B 4OYOA 1RTIA 1FVQA 4X4RA 2CNOB 3QO9B 4CLYA 4DUYF 1VIOA 4ECQA 4JI4F 2NZ4A 1BQXA 2Z58B 1AFJA 3I56S 2DXFA 3FCHA 1DTQB 3OTOJ 1JLFB 1WI8A 2BKNA 4C11B 3QYYA 2VFRA 4CP5A 3MOJB 2W4DA 4DV7F 3QIPA 5KFKA 1RTZA 2X1GA 2ZKUA 2DJWA 3DU6A 3HX9A 5D4OA 3K5NA 2DHGA 1Q0NA 2CVIA 3IRXA 2OD4A 1VQ8S 1Y7PA 1QSLA 2ATCB 3L09A 5KT6A 1HMVB 2CWKA 3DHXA 3ITHB 2G1DA 5LL6d 1S99A 3NCRA 2J6UA 3I4PA 1VBYA 1SV5A 2UUCJ 5DG8A 2MKCA 3H98A 3N28A 4KB7A 1CJKA 1F2HA 3S8SA 4JI1J 2HW3A 4F3OA 1FE0A 5KFSA 3K17A 3BO3A 3KMQA 2R7WA 2ZHOA 4DG1A 3MPUB 4LREA 4CNYA 5L46A 2MGZB 3MR5A 3I5BA 1DFDA 4JI8F 4Q8EA 4RWXA 4WIIA 3VF0B 1FI4A 5U47A 3MEDB 5HMZA 3PHEA 4YY3J 2HHHF 3AH6A 2ZH6A 4KGZB 3LWMA 1HNXJ 3OUYA 4PUOA 1AYEA 1F60B 2CQGA 3CDWA 3WX4A 4Z7CA 5D0RA 4Y2AA 3GIKA 3PFOA 4I69A 1JMTA 2DCLA 2CADA 3R7NB 1TMJA 2N7CA 2WAQD 3PO4A 2VB6A 1Y9OA 1PG5B 1WWHA 2G13A 4PXDA 1VQOS 4B3TJ 1IBLF 4X4NA 1TUWA 2D69A 2G2YA 2I8EA 3JTPA 2CQHA 4P52A 2EC0A 1M5SA 5GAGU 1H2UX 1V9OA 1HYSB 3D54A 2IRYA 4NCBA 1UP1A 1IVZA 2OFHX 3OQ2A 1OY8A 2HNZB 4DPXA 2VOPA 4M5IA 4OX8A 4YHHJ 3DRSB 2G2OA 3QT8A 3C15B 3DOLA 3Q2TC 1RTHB 4WP9A 5KG3A 2U2FA 3W66A 2DNPA 2EK6A 2K3KA 1HLWA 2MHNA 1GMWD 1JLAA 4NA1A 1X5OA 4OZ2A 1DRZA 1QSYA 4OZ0A 4RJVA 1U0HB 5IT0A 3PX4A 3RBEA 4KAIA 1FTCA 2B4VA 3DOLB 1AW0A 1FF2A 2E5HA 2MQLA 5DM7Q 4CH0S 2ZBCA 1NO8A 2UV8A 6FD1A 3CPWR 2FHKA 1NDKA 4DR2J 4DR5J 3MFHA 2BA9A 1TELA 4ED2A 2XEXA 3HT3A 1R89A 1SUQB 3EXCX 4PXCA 1L3VA 3FRYA 1C4AA 1Z2ZA 3KJNB 3DI6B 4OI3A 3TVYA 5A76A 1FX2A 2Z0GA 2NXNA 2BJ8A 4A8SA 2PFFB 4KJIA 4ECSA 4DSFA 1QLNA 3ILIA 1RBLA 3J81Y 4JI7J 5C2GA 4QR2A 1HA1A 4LIRA 4DR4F 4EEYA 1HYSA 2DGQA 1SH2A 1LW0A 4ETZA 1IBKF 3A4TA 1RT2B 3TJAA 4RNOA 2JZ5A 3AAWB 2HQIA 3BGUA 3BGOP 1XERA 3HFVA 3QWUA 2W9CA 3UCUP 3IGNA 2M8HA 4N8OA 1NPRA 1PAEX 2JJ4D 1F0XA 2LKZA 3ISND 3QPIA 4HHHA 4ZVGA 5A8WB 4NX9A 4OIXA 1RT3B 4X4TA 2V8PA 3WC2A 3OL9A 1FKOA 4U96A 3SMZA 3G4SS 1FO1A 1PSDA 3I5CA 1ZM2A 3K89A 3M9OB 5HL7Q 3M8SA 5G0RA 1CJTB 4QWDA 3PVXA 1WHYA 2QA2A 4RKUC 5DETA 4ER8A 2GJFA 4E8UA 2H1YA 3NRBA 3NMAA 2ZBPA 1SCJB 2C3OA 1RGVA 5C24A 3ET6B 4U95A 1CSJA 3JYTB 1R8HA 3BPDA 4HI1A 2W8LA 4UQGA 3EMTA 3ICLA 4MMOA 2GCFA 3PR5B 4BWJA 1VBZA 1S9EA 3VAKA 4G1IA 4YUDA 1N4LA 1JWWA 2EG2A 3OR2B 2E7XA 3MM6B 2XC9A 2CQ2A 2FTRA 4LSNB 1U45A 1NKCA 3D9BA 3NY0A 2YNIB 3CF5Q 3KK3A 3I0SA 3P96A 1AROP 1X9MA 2ZJQQ 2R42A 2GFFA 3MPVA 3P4UB 2PMZD 2J0QD 4KPYA 2AJ4A 3PYGA 1N33J 2VA2A 1HQ2A 1LW2B 1M90T 3CDBA 3I32A 4OHYA 3K5OA 4QQBA 1FEHA 4LF9F 4MK8A 2AGPA 3T3FA 2M8DB 2K06A 3HVRA 3D0IE 1BLUA 5KFTA 5H9FK 2AZ1A 1FJGJ 4LF5J 2R7VA 1JLEB 1URNA 4NRUA 3P5TL 3FRZA 4ED1A 1M1KT 5KFEA 3QJPA 3GJSB 2H54B 1ZA2B 2FLLA 3DYAA 1HW8A 1U6FA 2RMLA 2JEJA 2XMKA 2IVMA 1KVJA 3RAQA 1R8PA 3DFEA 4QOTA 3VZHA 3RB4A 1U47A 2QL5B 2R2RA 1VQ4S 2C2NA 3QGPA 4A4JA 4OV1A 1DHMA 1H0HB 2RIJA 3A13A 2MZRA 1EQ0A 4ICLA 1HQUB 5IM0B 2VKZG 1NJWA 3DDKA 4DF8A 4DR6J 2V8GA 2VFUA 1ZAVA 2P8IA 1NZAA 2M0GB 3ADAC 1JJCB 3FFIB 3GYGA 4V1Ak 5IWAJ 1NSAA 3DGPB 3B4DA 2MDAA 3CVKA 3H42A 3ISZA 4I6AA 1HQUA 5BJRA 5IM0A 2I1RA 4USMA 1N5TA 4JI7F 4EUVA 1G3OA 2EBGA 1K47A 1KNZA 1CQMA 4DCPB 4U6PA 4Y3CA 3H5SA 1KR4A 2CJYB 1O0PA 3BSNA 1EETB 3EX7B 1CG2A 4O4GA 5K20B 2UP1A 4URGA 3D6MB 2AJ0A 3V4IB 4LFBF 4F4KA 2VU5A 4QPXA 3TAMA 5F3ZA 1RTDA 5KFHA 4P2XA 2NS1B 1NKEA 1Y11A 3WHIA 3PCOB 2YWWA 3HVWA 2XCAA 4MYTA 2OPRA 4J9UE 3M30A 5LSOA 2DPJA 2E5LF 2EKNA 4X4UA 1UWBB 3T5LA 3SDEB 4DZDA 5T7LA 4PQAA 3OV7A 3I9ZA 1NK7A 2CNKB 1R0BG 1UEVA 3OTEA 2LEAA 2QA1A 1TL7B 4E0DA 2YNHA 3JSRA 4OYAA 3NGRA 4KHPF 3FMBA 2VG5A 3H2VE 1WC1A 3IP0A 3JSBA 3P8BB 1WC4A 5CHCB 4ES1A 4USVA 3G8QA 3RUBL 2IIHA 3UPFA 3B78A 5F8LA 3BSOA 3PY8A 5K8OA 4X4PA 3BEGB 3HZGA 4OLPA 2I5JB 3T1HJ 2C2DA 2KYZA 2HHTA 1Q5YA 5DG7A 2YNHB 3OD2A 3LOUA 2IM1A 1PC4A 4CCHA 1FRHA 1EAYC 3CCZA 4RW9A 3MAQA 4PAAA 1T94A 2YKMA 3MMAB 3MMBA 5KFYA 4YHHF 2CJBA 3LP1A 4LIWA 4O0IA 5HLFB 3O44A 1XMOJ 2ZUAA 2DEJA 1T95A 4ID5B 4CH1A 2UVRA 3KDOA 4NZ0A 2FDNA 1JLBB 4C98A 2OH2A 1S6PA 3LP2B 3KNGA 2PDAA 4WZMA 2AV5A 5KFLA 1S0OA 2C2RA 1VJQA 4WXOA 4IOBA 1TVRB 3NS6A 3EXYA 3CCLS 4DR1F 1GT8A 5FLXU 1RT6A 3LTOA 4LFAF 1U7LA 1RWUA 3RB6A 4QU7A 3HT0A 4HHJA 5EWEA 3U7JA 5ETQA 2R2UA 1KFDA 3C3LA 1UVNA 2VL1A 3BGRB 4DV4J 2HBYB 2PGCA 3NP5A 3BN7A 1VQ6S 2AJ1A 3HD2A 4OI6A 3NWGA 2VV5A 4WP3A 1NKBA 2GQQA 2ROGA 3UE2A 1TVRA 5KT4A 1XMQF 4LRBA 4EFAC 5LJ3Y 3ETOA 2AX0A 3ZXWA 4Z7YA 1GX6A 2UUCF 1N6QB 4RW8A 3H5UA 1HBNA 1RT1B 2C3YA 5M2UA 1Z2LA 4LF4F 2AMCB 3KLEB 2E29A 2GIRA 3FCVA 2F3JA 3BGRA 4PPZA 3ULHA 4UT4A 1SPBP 4DR6F 1ZH5A 4X4VA 2F1FA 4DR4J 5IQQA 2ZH7A 1RAIB 3MXHP 3MD3A 2R7TA 3QATA 3FZ2A 2VUGA 1Y3JA 2KN4A 3D7SB 4IG0B 3R2CJ 2B3TB 1J5EJ 1JXVA 4HLBA 5HROB 3NWRA 5LMNJ 5I3UB 3TVKA 1NDCA 2XCPA 4ZVTB 1T8EA 1AFIA 5LJ5Y 1NJZA 1M5PC 3UQSA 3KG0A 5DQIA 3RJMB 4N41A 4O3RA 1U1KA 4JI6J 2IDEA 1IWAA 3PYFA 2W9BA 3IXQA 2CPEA 4AXJA 3C2PA 4UW2A 1I6JA 3R6GB 3C66A 3K5PA 4RU2A 4M5KA 4YEAA 3IBCB 1C0UB 3NGUA 4C8MA 3W2WA 3QO9A 1N36J 4ELVA 3EPIA 2R7SA 2F4VF 2VBXA 4FYWB 1HNZJ 3RAXA 1QVFR 3FDSA 1L3UA 3EUNA 3OJUA 1R43A 3W61A 3HJVA 3GIJA 3KTQA 5C42B 3RYLA 3M9NB 1RT4A 5KFVA 3T1AA 3TOQA 4RO0A 2UVVA 4NWBA 5F9NA 1WKLA 1FKPA 2QV6A 4F7VA 3RW7A 4NOHA 3HF5A 2CZ4A 5F8MA 4K4XA 2OI2A 3FCWA 2XSJB 5D0EA 1T05A 3MDFA 2Y9HA 1RT4B 2HLUA 2CRLA 4USKA 4G65A 4ERDA 1FKPB 1UKUA 4K2JA 2R8JA 1Q1KA 2DY9A 3IG1A 1RLCL 4KBIA 3VZIA 1U1NA 3OFGA 2B9YA 2E1RA 5GAEU 2KHDA 3TA1A 5C5JA 1DQ9A 4KFBA 2H3EB 3QFWA 2HGLA 2H5JB 4J5OA 5KFWA 1S0NA 1HBOB 3GJQB 2MKSA 3NNAA 1GXTA 5J2MA 1S6QA 1DTTB 2GGPB 3I96A 1XWLA 4JI5J 1X0FA 1HNIB 2XMUA 1ZZFA 4FF3A 5K9FA 5CABA 4M5HA 2BDPA 3J7YU 2EXUA 1NCLA 4KY3A 4DQIA 1HMVA 3ITHA 3W7BA 2FHJA 1VOMA 2AD9A 1MN9A 3KG1A 3O5TB 2AZ3A 2QLXA 4A48A 1KLMA 3CCRS 2GO8A 5ETVA 2P2CB 1RKJA 3QJJA 1JLCB 3QLHA 3US5A 2MY7A 3IO1A 4Q2MA 3PNIA 2VJVA 5J2QB 4LF4J 4X66F 1SKRA 5KFFA 4LF1A 1VRUB 2LXIA 4C9DA 3ZC4A 1WDDA 3PKMA 3P49B 4CLSA 2QN6B 4UOHA 2ABYA 1VRQC 4M5DA 3W63A 4J9NA 4DBQA 4ZLNA 1PYTA 2GAHC 1OY6A 3OUYB 1OSDA 3E51A 4HACB 4OHWA 3BQ0A 1IBCB 1MU2A 1TAQA 1RTHA 2HPUA 2NZCA 3A12A 2K1RB 4QIGA 4QIFA 1C1CA 5E33A 4DR3F 2HQFA 1IKVA 1RI7A 1JLAB 5A8KB 2KHCA 4Q45A 2MTLA 1VBXA 2VQEJ 4X4OA 4ZLLA 1HHTP 2MQPA 3CD7A 3E3XA 1RWXB 4IYQA 4TY8B 4F36A 5F8GA 1MNEA 2R8IA 4CO3A 3NOCA 1TUVA 3H2LA 5KFRA 3CCQS 3MR2A 4ECXA 5KG5A 3V4MA 2B8QA 4Q2LA 3TYTA 3VAJA 1FRJA 2KG0A 2C2OB 3ZZTA 4PYDA 5LMUJ 4QJVA 2RDDA 1PBUA 2F4VJ 2AHOB 2XNQA 3Q0AA 3PFEA 2FHJD 4AL7A 3D1QA 1LK7A 4DU8A 1S1TB 4GO5X 4A8QA 3KK1B 2W7AA 2U1AA 1R8AA 4UOFA 2H65B 2FLPA 2VBYA 2LMIA 3BYPA 1UCNA 1FXLA 2A2CA 4P7VA 2YWHA 3BO4A 4QIEA 5B09A 4DS4A 4EO8A 2VG6B 2QFJA 2VODA 2W25A 1C0TA 2DY1A 3DM2B 3GSDA 1KWMA 4KHMA 3EZOA 3L7PA 4GO7X 4DX7A 4XIUA 3G96A 3DNCA 5D0HA 4U7UK 4ES3A 3OFFA 1XNQF 4URQU 1FCAA 1IWGA 1C1BB 2OD6A 2DO0A 2RHSB 3MAAA 4UUWA 4R5PB 5DZ6A 5EHHA 4F4YA 4DL4A 3GCWP 3PX6A 3DOKB 3QIDA 4OV6A 1AZSB 2BE2A 2I0XA 1UFKA 1TFWA 3I5AA 1O5JA 1UPMB 2MQ8A 3UN2A 5KFQA 1YRUA 1PJ6A 2HHUA 4C0HA 4WFAQ 1VC5A 1WF1A 4HL9A 4QWAA 1Q78A 4WIQA 3EICA 3VALA 3C14B 5AJ3F 4HHUA 2D74B 1U2CA 3GE9A 1P27B 2LXUA 5KFNA 4LF2A 4K59A 2XMWA 3ET6A 3ISNC 3H0PA 2BACA 3R5GA 4YMEA 2DGVA 1RAJA 1X0PA 2EFQA 2J7UA 1CQNA 3MAHA 3J7Z5 4C11A 3CCVS 2NREA 5BYSA 4NXNJ 2PA3A 2YY3A 3LAMA 3OTBA 1HHSA 1E6VB 1GAOA 3QFHA 1UVMA 3DDNA 3QRPA 3CJTA 2IC3A 2ACMA 1NJYA 2KO1A 1UA1A 1YJ7A 2PI5A 2W2NP 2PT0A 4DL5A 2ASLA 1OMSA 1H7XA 1N34F 3M2RB 4DX5A 3DLKB 1AB8A 3T6BA 4X2BA 1S57A 1B0VA 1K44A 2EWHA 3UR3C 2V50A 3OL6A 1YZ6A 3KHGA 2E5LJ 2G0IA 2KL8A 2ZM6J 5HMYA 5K14A 1FXRA 5IWAF 4ELUA 2CQ0A 4F02A 1NNDA 4OQJA 2MYFA 1S9EB 1BE4A 3CJ4A 4DPUA 3QJLA 3D3BJ 4BC9A 1HI0P 2CPHA 4RUBA 3D1OA 4NXMF 2Y8WA 4YDDB 3DYAB 4RBTA 5K14B 2MXYA 2MEWA 1N36F 2WVFA 1BHNA 3C46A 4JI2J 1KD1T 1R6VA 2YNFA 2N82B 4LF6F 1V3RA 2V5HG 2ZVIA 1A9NB 3HSZA 1ULRA 2FYXA 2NYHA 3AT1B 2KJWA 4NCGB 3EDQB 1TK0A 4USUA 2HNDA 1BC6A 2FGOA 3C16B 3FEYB 2JRSA 5HO4A 3ELHA 3PYDA 4B9UA 3H8YA 3LALA 4ZPDA 1R6YA 2BE7D 4QBUA 3MM5B 1JNRB 2B7BB 2I6WA 3W5YA 3ZTQA 1YITS 2HHXA 2DEIA 1HBUB 1T9TA 1GQEA 4FZVA 2Y0SD 2FJEB 2GV1A 4ECUA 1FX4A 3MPWA 4D3HA 3QRQA 2KT2A 4U8VA 4LBPA 3PW7A 3C15A 3V6KA 2BW7A 3AHPA 2FJAB 3QSYB 2FC9A 1FDDA 2WSFC 4CLTA 4GKKJ 3KKFA 1K0VA 1GXUA 1KQGB 1HARA 2YH0A 3JS9A 4I1TA 1FEEA 1F6TA 3NG8A 1XIQA 3HVAA 1ZPWX 1VQLS 3BKUA 4OZNA 2V94A 1TAUA 2QTWA 2JFDA 3C6UA 1FA0A 2ZE2B 3MTJA 5ETSA 4ZCMA 3MUMP 5IT9U 4RUAA 2JVRA 3QGGA 4ZPVR 4ECVA 2WVEA 2XNRA 3RBDA 1AXQA 1GX5A 2VC0A 1SH3A 2OPQA 3IMQJ 3R6LB 3AFGA 4CLUA 1HNWJ 2YXLA 3THTA 2A6MA 2HRYA 3D68A 2GHWA 4NLOA 4NCAA 2MMYA 2HSEB 1U1MA 1SIWB 3I82A 3M4XA 1Q8IA 5B0AA 4WFYA 1HW9A 4DPYA 4DQPA 1W25A 3PRVA 2IM2A 3J81j 1B7YB 1FWPA 4ED6A 1NJIT 2E9TA 1LW0B 3PX0A 4OZ3A 3DRXA 5T7LB 1VDHA 1YJRA 2VIHA 3C8YA 1P9YA 3UDLA 3LP1B 5HLFA 3MF5A 2E44A 4JV1A 1IUJA 2MY8A 3MM9B 4UZBA 2FJVA 4C8YA 1NHUA 2VONA 2B9WA 3DI6A 2M3DA 4DZ6A 4ZPCA 1LWEA 1MWYA 4O3SA 1B99A 2PFDA 2C3PA 5HVGA 3H25A 2I5JA 5DLGA 4Q0BA 5CCLA 4MKBA 4ED0A 5CYQB 1TU0B 3RB0A 4DUZF 1H38A 4P2SA 4G1PA 2EFVA 1B0PA 4F3MA 2W7OA 4DSJA 1Q5VA 1X8DA 3OL7A 3FGVA 5CD4H 2R7QA 3N79A 1OO0B 3NGDA 4TNOA 1LV5A 4J9VA 4K8RA 4Q0BB 2CJKA 1CJUA 1QSSA 1IBMF 1FKAF 3IGVA 5F8IA 4I2QA 2VPYB 3OR1A 2IJNA 2QZ8A 2RF2B 3WDOA 4B3OA 4KHPJ 4WBFA 2OIHA 5HQMA 4J9QA 2J9CA 3KNAA 1FKOB 2GMLA 1CVJA 3MMJA 4K4VA 1IKYB 2CQ4A 2PA8D 3HZEA 4PQUB 4J9KA 4QPTA 1LK5A 1BWVA 2BEFA 3W5ZA 2J7KA 4I2QB 4DFPA 2J9DE 1UJ5A 3KLVA 3OXLA 4ZPAA 5LOQA 4IDKA 4ANDA 3G87A 4EZ6A 3N6MA 3NCQA 2FQQB 1U49A 3TARA 1TV6B 1U26A 2UZAA 4ZVQB 3FZBA 5KG0A 2HHVA 1LFPA 1HBNB 1RT1A 4OHXA 3BDPA 3RB3A 1KOHA 4P10A 3UD4P 5I42B 4NA2A 5CZXA 2VFVA 2KDOA 2KVQE 2M70A 3BBCA 3HHNB 1OIAA 2GNKA 4LSZB 4KT0C 2ZBIA 3KK3B 2AGQA 3E2EA 4DSIA 4A8XA 2B6AA 3T19A 2BANA 2P6TA 2RQ4A 2XMTA 2HWTA 4FNHA 4IG0A 4ZJLA 3GV8B 1T3NA 2BOAA 1VQ5S 2X1FA 3O2IA 2AKWB 1I3OB 2E7WA 5HJYA 4DV4F 1JJ4A 2BJ3A 4ALZA 2J9EA 4DL2A 2C2EA 2GHPA 1RJJA 2Y8YA 4P2MA 3MOZA 1BQNA 1JLEA 1U2RA 1KOOA 5IZHA 4F2SA 1N88A 3K8WA 3J7YI 1RQ0A 3JSMB 3KUEA 4YN3B 1X5SA 2V8DA 4L72B 2Q6BA 3HHLD 4I6YA 1BD6A 3VWSA 5H9FJ 1RBOB 4Q7AA 4JB8B 2KTQA 1DURA 4O44A 5AJ3J 5A6WA 4O4GB 1RHMB 3BSCA 4QWBA 4KTQA 5IT9Y 2QJ3A 2B51A 1GMWA 1HHQA 2C2KB 2ZITA 2N3LA 4N56A 3ZZYA 4LF8J 3VTIA 1LOUA 1KTVA 3I9V9 2LXFA 1R7IA 1HBMB 1YQHA 1DBDA 1F5BA 4KIAA 5FDLA 4Y00A 4PXBA 4K5SA 1S6QB 4TKTA 3DGPA 1HNIA 4N8NA 3H59A 4Y2CA 3THVA 1VLYA 2B43A 4RNMA 1UWBA 1ZAWA 3F56A 3ZZZA 2V2VA 2XMVA 4DMZA 5I3QA 4CZCA 2VASA 1PKUA 2QYCA 1N52B 3TRGA 1V5IB 2JC0A 2YNGA 3U1MA 5DDPC 2W8KA 2XY6A 1OQ3A 4Y2IA 2XLJA 1FHTA 3HPOA 4ED3A 4K0KJ 2ZDPA 1KLMB 3TR5A 2ZH3A 3V4IA 3A3OB 5E5NA 1Q81T 2GJ2A 1EARA 4ZP9A 4EBCA 1YRTA 4C97A 2GJIA 2W7PA 2PC6A 4CO1A 4ED7A 3OSPA 1K73T 4WXWA 4CNZA 5IQ6A 1T3OA 4F25A 1S1XA 4TYAA 2E5JA 4DV5F 4ECZA 1I94J 1RB0A 2HRUA 3MEEB 1RCOB 1N32F 2QO3A 2J9DA 3CJ8A 4ZN1A 3D67A 1RE1B 4MIAA 2K1RA 3F44A 3FQKA 2BJ9A 3HDSA 4OFZA 4TLRA 2ZH8A 2IAJB 2HNYA 4ZVSB 2AYGA 1YSJA 1HWUA 4TY8A 3TO8A 2FVPA 2W2OP 3LUYA 3RG6A 4A46A 1D09B 3DDIA 3H5YA 1UVJA 3LANA 1YHQS 2HHPA 2O67A 1FRMA 3W2VA 1REGX 1MN7A 1CBKA 1QM9A 1YX2A 2PE8A 3MD1A 4G1QB 3GV5B 4MFBB 2RRAA 1QAJA 4M5DB 4ZCLA 4B3MJ 2YKMB 3MMAA 4ZIWA 2K8GA 1AUDA 1K0TA 3UD3P 2VG7B 3K5MA 4EMDA 1SQGA 3BR9A 3FBBA 4KC5A 4ZHRA 5F8HA 1VRTA 3OHBA 1HPZA 5D3GB 4DV0F 2ZHBA 1J5OB 1JLBA 2RE1A 2A1BA 1YKWA 2E66A 2DNHA 2BM1A 4ZP6A 3OPKA 3KK2B 2FUG9 1NUEA 3AD8C 3MEGB 1NH8A 3SCIE 2C42A 1NMEB 4N76A 3CMES 4FPRA 4DR7F 2VG6A 1U02A 1NZ8A 3BGFA 1C0TB 3DM2A 2L08A 2LQ8A 2Y1IA 4PG4A 4ZVFA 2ADBA 4KYZA 2YX4A 3DRYA 4A8OA 4DCOB 4Q43A 4JUZA 3THPA 1C1BA 3AJ1A 3M6VA 4USJC 3U1NA 4R5PA 2M2BA 4OI1A 1K8AT 5L1KA 3QQCD 5M2RA 1FESA 2D7SA 2HVIA 4B3SF 1A6LA 1RTJB 4NZ6A 3LP0A 4B3RJ 1RDRA 1E6YB 4C48A 5A8RB 1CEZA 2XHCA 5KT3A 4XPCA 3KLFA 4ANCA 3PW2A 2ZM6F 2HS3A 3HJFA 2QX0A 3UDEA 1WF0A 3CO9A 3MECB 3JB9k 2CPZA 3PACA 4HT5A 1PGZA 1RYRA 3I4HX 1KC8T 1EKSA 4CM2A 2QEXS 3G9CA 2HIYA 2UXDJ 4X65F 3NAIA 2QLFB 2GAGC 4P7TA 4DX6A 4MIBA 4I7FA 2NXJA 4ZP7A 2MQOA 3EDRB 4FPIA 2W24A 5AE3A 5LSLA 1S10A 2VHGA 1SC3B 2LECA 3BS9A 3QBCA 2GX8A 4Q44A 4K4TA 2XB2D 3F41A 4PYAA 3OVBA 5K8NA 2HK2A 1NU4A 3H20A 5KFOA 4YY3F 1YJTA 2MKHA 4XK8C 5L8RC 5AE2A 4IRKA 1TL4A 2V4JA 3SCLE 1GXLA 4MAKA 3HHLA 4GKJF 1YWXA 2LQ9A 5EX0A 1H2VZ 4LF7J 3W5XA 2Q6CA 1S12A 2KI2A 1KLNA 1S7IA 1QE1A 1S1WB 4IO1A 1SC6A 2DR5A 4LMZA 5C42A 5L38A 1TKXB 1AA1B 4G6VB 2XMAA 2JDJA 2XY5A 1EQMA 1SV5B 4DI6A 2XS7A 2MZSA 4LRAA 5EUHA 4HYKA 1NK0A 4LFCF 2XS2A 3ZZOA 1H73A 1JLFA 1FNMA 2OMOA 4I2PB 4M63A 4WYWA 1KQFB 1S49A 1FTRA 1QE1B 2FVSA 3PZPA 1RWMB 1TKXA 4MT1A 4UUXA 3CO0P 1MMLA 3KG4A 3VGSA 1KQKA 3J81U 2MGZA 4C4WA 2DYAA 2UUTA 3DLBA 3GR1A 3VAHA 3GIIA 1F9FA 4KHRA 1FNXH 2DR7A 2YPYA 5DG9A 1RT7A 1QDUB 1WEXA 1CJVA 1YI2S 3L3CA 5KT2A 1DAXA 1TL1B 1KP6A 3TI0A 1QVGR 4NLGA 1N33F 2BJ1A 3MM5A 4J9MA 2RRNA 3IM8A 1DTTA 2GGPA 2KYXA 4C2MA 1CJKB 3D6TB 5D4NA 2CNLB 3DMJA 3MR3A 4PWDB 1ITPA 2DR8A 2NSCA 3HVTA 1N0UA 2B9EA 3FSXA 1U1PA 4DR7J 1S9FA 2YNFB 3IR5B 2Y3YA 3HKZD 2A0FB 4LF5F 5IOLA 2CPJA 1RKIA 1GTHA 3UCGA 3V6DB 3F73A 4PUOB 1ZM4A 3FBEA 2WZ1A 3NGTA 5C7PA 1B7FA 1YJUA 3R7BB 2DNZA 2DHXA 1LWXA 3TA0A 1WC0A 3Q8VA 1SJQA 2GZOA 2D1CA 4AT1B 2OUGA 4O3QA 4PWWA 4U7CA 4RZRA 3NBPB 4DV6J 1IQTA 3PRBA 4K0KF 5KOWA 4WFBQ 3Q8RB 2HQGA 2RNEA 1M5VC 8ATCB 1WOPA 5HAOA 1S76D 2DHAA 2H4YB 4NZ7A 3V81A 1XMBA 1WHVA 2XMMA 4LF6J 1OYDA 2PN6A 3FEZA 3ONQA 2HLTA 4NE9C 1ZS6A 1A7GE 1SBRA 4IQXA 2DNGA 2IYGA 4I0WA 1BXNA 1QTNB 1YGYA 2AEFA 3PIPQ 4KGVB 3C6UB 5CAAA 4MJKA 3NKYA 5KG2A 2HYIB 1L3KA 2EG1A 4JYAF 4ZKAA 4CLKA 3N5BA 2YWKA 1PBAA 2R7OA 2YBVA 2CPXA 4CO2A 1JLQA 4DFMA 2CKWA 2ZHAA 1AZSA 3T1YF 5A2QY 3BV8A 2MJUA 5HK4A 3KUGA 4B3TF 1GNKA 2FVCA 4IKAA 2CDQA 2CG4A 2EFOA 4QIVA 3WIUA 2ZH9A 1VGYA 2HAFA 2OEKA 1FFWB 4JV5F 2H4WB 5D8HB 1S9GA 5ETLA 4NASA 3ZTPA 2BUNA 3LPEA 2WSEC 2HFZA 3VGTA 4WWSA 4DWIA 1L3SA 5KFUA 3CULA 2XLKA 2NPIA 4ED5A 2RUSA 1BMQB 2X1AA 3FMWA 4AFFA 3CCSS 2UXCJ 4IFYB 2FPHX 3JXOA 3VAGA 4M95A 2FC8A 4TU7A 4NLUA 2H51B 4NLPA 4XTTA 2RDJA 4DV3F 2WTFA 2EEYA 4DPTA 1VQMS 3IWXA 4F26A 4AL5A 3ENAA 1MROB 1IKYA 4OJ3A 1HQEA 4PZVA 1ZETA 4PQUA 4BLGA 1NRKA 3DOMB 4IFYA 3CCES 1J2VA 5JVHQ 1EB0A 1JLGA 3MWBA 3JQKA 2XTJP 2HZVA 3OXFA 2HHQA 2FZKB 4OYWA 2CNNB 1PYOB 2MSSA 5F0WA 3T41A 2RQCA 3M8QA 1LEOA 3PEJA 2XM3A 4CYUA 1W2BR 4JI0J 5G4DA 1CJUB 1R3NA 4HDGA 2AYMA 1T9VA 2VC1A 4X4SA 3KLHA 3N5FA 5MAOA 2LU1A 4WE1A 4H4MA 2O5DA 1OJ4A 2B56A 2IC3B 5D15A 5F8JA 3A8JA 3MGJA 3QAEA 3W65A 3NNHA 1F9EB 2JWNA 2HVDA 1UJ4A 1GMVA 1X5PA 2V0NA 3A3NB 1H72C 3IAS9 5CQGA 3C6TB 2NPFA 5KFXA 3KLHB 4FVCA 4FYYB 1WTBA 2CWXA 1DQ8A 3OXGA 4OYIA 4DLGA 3O8WA 1A0OB 1HL6A 4LSNA 4WPAA 4C0BA 3SSQA 4DV5J 4C8OA 2AYEA 5BXIA 3EGVA 4W90B 3FVYA 1LNQA 2DT9A 4HTIA 1D0EA 2MLXA 2V6AA 2NYIA 2Z8QA 3DRPA 4M5JA 4TLQA 1S0VA 1FNOA 2FJBB 1WELA 4PR6A 3RAMA 3V5RA 3ZFVA 4C0OC 1HKAA 2QL9B 1HBUA 2HHWA 2A3JA 5IC6B 3D0HE 1WSRA 4A8YA 2XZWA 2HK3A 2OSRA 2HIQA 2DR9A 3KOAA 3BO2A 1DY3A 1DZ5A 4XPEA 3AD7C 1T11A 1AUSL 1TKZB 2GIQA 3D6HB 2DNYA 2Z57B 4FKYA 2G9OA 4KO0B 4NEZA 1HWJA 4MH8A 4ED8A 1IKXB 3L95X 3HFZB 4USTA 4KH0B 4LUBA 1HBMA 1YK9A 2ZOGA 2GQ2A 3C16A 1KFSA 1KVKA 2OJ3A 2DK2A 2B4OA 3CSKA 3I55S 1CC7A 1RHKB 2OPSA 1X7VA 1WC5A 4RX6A 4ZVEA 4P71A 1F3FA 5DM6Q 2Z2LA 1JNZB 4HKQA 4TQRA 3M30B 2CFXA 1BGXT 2BRLA 2QLBB 4NPOA 4DR5F 1S1UB 2LLZA 3FSYA 2GQCA 1HWLA 1YBUA 1VQPS 1XJWB 3MFIA 1Q8KA 3U27A 4W4MA 3J7ZT 1YLXA 2BX6A 2LEPA 4FXWA 3Q2SC 2ZD1A 4CDIA 1VK3A 3I31A 2AX1A 3R97A 1WD6A 2FHOB 3OFEA 4FN5A 2R2SA 2YNGB 1F3VA 2DNLA 4B3RF 4OYXA 1TZ0A 2IA0A 2ERRA 2B8PA 4OYMA 4F50A 2ASDA 1WEZA 5KOXA 2A6OA 1RABB 3PDNA 2HNYB 1IQZA 3GB0A 1UFLA 4PEOA 5L1JA 3KMSA 3TEGA 2ZD1B 3H4DA 4WTOB 1EIYB 1C2PA 3KJVA 2MLYA 2R7XA 1D9AA 2UVWA 2V63A 2R4FA 1S79A 5AXMA 3LAKA 4N5SA 2DCUB 4Q5VA 4F2RA 3H90A 4LVNP 4LF8F 3M8PA 4FF1A 2Z2ZA 3QWPA 1PO6A 4ILMA 5B0CA 4DHVA 1T03A 5FIIA 1OWXA 3MCMA 1L5UA 3M2UB 1GTEA 1VRTB 4F67A 1JQGA 2MPUA 2BVZA 4DPWA 5C25A 2LA6A 3LW5C 3Q8UA 3BDEA 4X4QA 2IBOA 5LMNF 4V19X 4QWCA 3HM9A 1PJ7A 5T41A 3OLAA 3KLIB 3FNNA 5K8PA 4U7UD 1UMJA 3EYZA 4V19J 1U24A 2ZWPA 5EWGA 1H7WA 1D8ZA 3QGHA 1TL3A 3PJXA 4JI6F 5L1LA 4X65J 1WF2A 3OTCA 4EWTA 2W9CB 3NGSA 1X4AA 3BH7B 3KUHA 2ZBQA 3GU0A 4CT9A 3CUNA 1N0VC 3F0NA 1LWCA 2BJ7A 1RWPB 2BKPA 2ZC4A 3CJQA 4ZVHA 4CLZA 4ZJOA 5EN1A 1LFWA 1V6HA 4CTAA 5GADU 4DV1F 2DGWA 3M8YA 4ECTA 5A0YA 1RISA 1R0CB 4IRDA 1XQIA 1XK8A 2DXDA 4I64A 2MKIA 4R0JA 3OTDA 3KK2A 5GAHI 3SYZA 1NHVA 5F0UA 4B3OB 1FFSB 1Q8BA 2HFOA 5A8RA 2LP4A 3KLFB 2NUUG 2AYBA 2EC2A 1CLFA 4FDFA 4N7TA 3R1HA 1SJRA 2XG8A 4X84A 2E1CA 2NXCA 3MCOA 1XNRJ 1XBWA 3CNQP 3EM1A 4HVZA 3EGZA 4IOAQ 4OX9F 4ZMMA 2XLIA 4JI3J 2VJUA 3M9MB 2P9CA 2X51A 5GMDA 1JXEA 4L74A 3Q8SB 1C0UA 4NLQA 2F63A 2XWYA 1M1GA 3GMGA 3LGMA 2WW4A 3DRRB 3M32A 4Y65A 1FRLA 4DR1J 4LSLA 4OI2A 4IRCA 2H48B 4LBHA 1S59A 3TUJC 2PMHA 5KAKA 2M9KA 2K7KA 1XMQJ 1S4EA 2DBBA 2HEKA 2HRTA 2FLNA 1NPPA 4F0HA 4A8WA 1C4CA 2QSFA 2NXEA 1NPKA 3CJ0A 5SUHA 3MM7A 3UI3A 4B9MA 3V2UC 4RUHA 2W4PA 2VDIA 1S1WA 3M1VB 3ILOA 4M5LA 1G6BA 2JHEA 2LU2A 3CGIA 4C3MA 2M7SA 3W3SA 5LXYA 2W4CA 1KONA 1NHKL 1BQNB 4ZP8A 3DLEB 3E01A 2HURA 5LM7E 4X66J 4IOCQ 2FY8A 4DL6A 2Q3PA 4AQYJ 2ZZNA 3IRXB 3MM7B 4BBYA 3CB4A 4ITSA 3M1VA 2CQ1A 3MUTP 2DRDA 2CJ9A 2RS2A 4NXMJ 4B3SJ 2QRRA 5J2MB 3CJSA 4ID8A 3CCJS 1D3WA 2J7WA 1D8YA 1EKRA 3R5JB 1JX4A 3TJ9A 1D9FA 1SIZA 2JLEA 1RHJB 5L1IA 3DXSX 2R8HA 2JVOA 4UF4A 1G2EA 1TL1A 3CJ3A 1X4CA 1KTQA 3HCXA 3QT6A 1QAYA 4ZPTR 5DO2A 5HP1A 1W26A 2YX7A 3SSSA 3GV7B 1VHIA 2HGMA 3DGVA 2Z30B 4OZ1A 1S1XB 1Y10A 3QAUA 3S6EA 5JMNA 5GMEA 4NA3A 2RU9A 4NMXA 4X64F 4RW4B 3SBMA 3NEKA 4AUKA 2KU7A 4CLFA 3R2DJ 5ETMA 4IUFA 1NSKL 5E0OA 1UETA 3K59A 5JVGQ 5F3TA 2QSWA 1PILA 3MZIA 2GVZA 3UD5A 3CMAS 4NLRA 3MUVP 3CTRA 1N5YA 4DX8H 1GK8A 1VS3A 9RUBA 3BM7A 4GKKF 2X3GA 3M7VA 4URSA 3W2VB 1RWOB 2NLWA 3DMJB 4ZK7M 4HEA9 5A8KA 3HP6A 3GONA 2KG1A 2ZBRA 3FJ2A 2Y1RI 4OJ1A 3Q24A 4RU9A 1I94F 2HNZA 3DRSA 3N9UC 5B0FA 3CJ2A 3S1TA 1RWNB 2KXNB 1SJ3P 2W01A 3RBZA 4DV0J 1SI9A 2A18A 2XS5A 2I38A 2IAJA 3IN5A 1RP5A 2W2PP 5I3PA 1HI1A 5B08A 4FXDA 4MYUA 1NK6A 1VQ7S 1V3ZA 4FYDA 4HACA 4USIA 5KFAA 1XMOF 1TKDA 3VV2B 3M2VA 3RRHA 2EFPA 3MCSA 2VQFF 1S1TA 2AT1B 1KVIA 2BV3A 1RBAA 1MWZA 1U6ZA 2HS4A 3LP2A 4MFBA 4CLWA 2E9RX 2F7VA 1SUQA 5DS7A 3UNYA 3T9ZA 3AXMA 4ZHRB 5D3GA 5A2QU 2UVUA 2KXFA 1S77D 4K4SA 1KHWA 4Y6IA 3DXBA 3V81B 2HFUA 3PV8A 4A8FA 3GCXP 5KTQA 4DPOA 4ZVPB 1NDPA 1RXOB 3CC7S 2ZH1A 1Q53A 1RHUB 5D4LA 4ZOSA 3TAPA 4WKRA 6FDRA 2GMHA 2EPIA 3G82B 4IG3A 1S9GB 3HFKA 1UJ6A 3DOKA 5H9EK 5AXLA 2RDIA 2FZGB 4YP3A 4RW8B 2P9EA 2MQNA 3W1YC 3M8RA 1OSCA 1VYAA 2B7CB 2VDHA 4J9OA 1YTYA 4ZVUB 4GVBA 4HTJA 4NI2B 1DLOB 1UW4A 3N6LA 1S1VB 1BQMB 3CJKA 3HK2A 2BQ3A 3PJWA 3C14A 2CPDA 1DQAA 3FQLA 2V34A 4LJMA 1CS4A 2VH7A 2YWEA 2P6SA 3VCDA 5E3RA 2ALZA 3NL0A 1LQ9A 2DKOB 2XYHB 4JBCA 5HROA 4H4OB 1E6YA 1MROA 3A1YG 3EE3A 5I3UA 2HBRB 2ATLA 1BQMA 2IMOA 3O6QA 3DU5A 2BE2B 2PD1A 1WC3A 3FC9A 1IM4A 1MW7A 9ATCB 2V4JB 2B0GA 2ZNZA 4LVOP 4RUCA 1M5KC 4MIWA 3EJMA 5FLXY 3S7RA 4C7QA 3CT9A 2CQPA 2D41A 4TN2A 3CDAA 4L6V3 2UU9J 5JXSA 2ZH2A 2HKEA 2CPIA 3MM6A 4MTPA 3SCJE 3ILJA 1RWKB 3UVJB 4PG8A 3V6JA 4WYLA 5ETRA 1SQFA 2AWZA 4DOZA 2XO6A 3C6TA 1WSVA 2COLA 2UUWA 1M5HA 4N47A 2KFNA 3BSAA 1E6VA 1HD0A 2V2QA 3LGNA 1JLGB 1KKHA 2QLWA 1NSPA 2YTCA 4I6WA 1F5CA 4UTGA 4B02A 4C6AA 4DJBA 1HNVA 2N3OA 4YR2A 1U1QA 4JV5J 2KKHA 3FUYA 1IJFB 3M8QB 4NEYA 4CWBA 5BYQA 3SQOP 1FDBA 4C3KA 3WIVA 5EWFA 1YJWS 5DDRC 4C8LA 3OT9A 1H6KX 1OS5A 3FK4A 4ZS6A 4D3GA 5J1EB 3DRPB 3T9NA 1YJ9S 2LEBA 3N01A 2R7UA 5IC4B 1EP4B 1PC5A 1U1OA 1HNVB 3AJ2A 1B0TA 2MZTA 1UFWA 3ILLA 4EBDA 2HMIA 1UTAA 2POKA 1X4BA 3C19A 3HXMA 2E5GA 2WVBA 4RPFA 4DFJA 1BWEA 2DNNA 4OJGA 2MQMA 3RU0A 1IM6A 1X9WA 3R9LA 3G86A 1JJ2R 1SJ1A 2DGXA 3ZZ0A 4F4ZA 1IKXA 4CO0A 4BDPA 2KZZA 3AA9A 3B4MA 3TQEA 3W9IA 4HDHA 2KT5A 5HATA 2Q43A 3CC2S 2D3OR 4JI0F 1CJVB 3AOCA 4CLPA 4DG1B 3IAM9 3M6XA 5L9XA 3SZ2A 2DRBA 1OQ6A 4P74A 5K8MA 2PMWA 2GC8A 3IBWA 3EVMA 3HHEA 4KGXB 2YH1A 2QA4G 4NCGA 3D3CJ 2LDYA 1NBEB 1XEZA 2GA7A 1R8CA 3CJ5A 2H5IB 4LT6A 2RQKA 3N4WA 4DV6F 2V2ZA 3BR8A 3NCPA 2OLWA 2PSZA 3CDEA 3QLHB 4OZJA 4OYPA 4ZPBA 5J2QA 5KT7A 4FXVA 2WVCA 1HI8A 1NB7A 1YG0A 5KFCA 1VRUA 4EO6A 1SKUB 1YBAA 3TUIC 1NK9A 3SFGA 5GVQA 1S1UA 2DNQA 3A8KA 2CVEA 2H5EA 1VQSA 5E3PA 3TAMB 4ZVRB 2OO4A 3POTA 2RH3A 5KG7A 2HFNA 2AGOA 3HHDA 2K3IA 4P72A 3UN5A 1U0HA 1ZM9A 2VPZB 2OPQB 2MKYA 2AF6A 4ILRA 1C1CB 3D6FB 5DRKA 3OL8A 3G8TA 4DR3J 1Q8LA 3MMCB 3GG1A 2R8GA 2HZCA 4ATNA 3NBPA 3MPDA 5E41A 1WJ9A 2B5JB 2BQRA 1HD1A 3ZZRA 1FDAA 3MI7X 4NLTA 1KEKA 1U0SA 5AXKA 1M0SA 3T1YJ 3BPSP 3CCTA 4USHA 1VHFA 2B4UA 3AA8A 4ETXA 3HHKA 5KFIA 3EWGA 2KH9A 2WK4A 2ZFHA 2ZE2A 3G2XA 3WQPA 1RCXB 2KVIA 2D3ZA 3D28A 1CULB 3NS7B 4RBVA 3LF0A 1SC1B 1ZZNA 4ECRA 2IVYA 2AEMA 3IR7B 4QYZK 2HHSA 4N77A 3B82A 5DLFA 1RT5B 5B0DA 3JQJA 2LCWA 1UEKA 2GS8A 3UNGC 1IN0A 3KXDA 3VQTA 1W7WA 1Y5IB 3MMBB 2NXUA 5CCMA 2HFVA 3QMQA 3TZZA 4CH7A 5GAGI 5GADI 3KDNA 3FEXB 1ROFA 4YR0A 3OHAA 1NH7A 1M5OC 1RT5A 2M5YA 2YWFA 4B3MF 2G1HA 3BGLA 3TQ1A 4GC7A 1ZTWA 1U8SA 1REVB 2HVZA 4AE5A 1YZ7A 2HQCA 4NYPA 5A8WA 4JV2A 2R2TA 4DFKA 1RT3A 2VQFJ 1F5AA 2XZTB 2VOOA 1TL3B 3MAAB 4I67A 2C3MA 3G6YA 4JI3F 3L7UA 2RRBA 1I5OB 2HAIA 1LWEB 4K2XA 5LT5A 4UY85 2BZ2A 2ZKTA 4UOCA 4Y2KA 5I4MA 2DTJA 3Q8PB 1IR0A 1WHWA 1S5ZA 2J76E 2YQ3A 3X3UA 2E1AA 4Y28C 5CYQA 1K9MT 2CPFA 2ZEJA 1P1LA 4DV7J 4DLEA 5IV3A 2ASJA 4RW7A 5J2PB 2GHVC 3CD5A 4OX6A 3TUZC 3SV4A 1IR2A 2OPPB 4OHVA 4J7CA 3ENWA 3R3TA 3IS9A 3LO3A 4KV8A 4OMFG 2BJDA 2Y1LB 4U8YA 1T9XA 2E1PA 1NJXA 2R8KA 4KR0B 2FD2A 2DH7A 2CJQA 5D77A 3PJ9A 3Q86A 1NXIA 2M88A 5CH7B 2RF2A 4W98A 2MZJA 2QGFB 4M94A 3OVSA 1XR7A 5A0YB 1QUPA 2CQCA 2XULA 1S0MA 2ZUGA 1FERA 2AIRB 3QT5A 2IPOB 2B6AB 3CCUS 1O8BA 1RACB 5THWA 4H4MB 2E7VA 3OR2A 2F8EX 4IH7A 1RUSA 2DNRA 2WONA 1H2TZ 2OELA 2Z56B 4PPDA 4RNFA 1NSQA 2OMLA 3CD6S 2OTJS 2YNIA 4L76A 1HWKA 1N5VA 1Q4RA 1FRXA 5ETNA 3RW6A 2BW2A 3AJDA 3D2WA 1UW9A 2YKOA 1XR6A 3LH2S 5KFPA 1FJEB 4FNIA 2LQ5A 2RQMA 3GILA 4A8MP 2HZAA 1OY9A 1DARA 1ZPVA 3M8ZA 2VFSA 4ZCIA 3ZTRA 2LQJA 4GRSA 3IA0A 5CYMB 4GC6A 2HWHA 2AJFE 2QMWA 4CYUB 1Y0HA 3PG9A 3GJRB 1TR0A 2V2KA 1H74A 3K8VA 2AU0A 2IBKA 4DV2J 1TUGB 2DGTA 1SJ4P 1UVIA 3TZXA 3B8HA 1VQYA 4KO0A 5HVFA 3UFCX 1SC4B 1QTMA 3FBCA 3ETMA 3HHLC 4KQZA 1ZA1B 1KQSR 2OAUA 1AT1B 1S72S 4B9TA 3ENQA 4C3LA 5GMKa 2JEFA 1VBKA 3IFEA 2DPIA 4O44B 4DUTA 5B7WA 4DQQA 1T9YA 1TK5A 3A8IA 1KHVA 3E01B 3K58A 1R8BA 3D66A 1ZAXA 5CD4A 1NAQA 4S0MA 3VGVA 4DQSA 2CJAA 3EGNA 2XMJA 3MURP 3RRKA 1RAEB 3GFYA 3RGIA 1U1RA 3R8YA 3PR4A 3DC2A 2VPXB 5J1PA 4ZITA 1N56A 1EETA 1IXKA 1N5SA 1B64A 1FVSA 2FIUA 1SKWA 1KSPA 2WSCC 3VVTA 2FY1A 1JLCA 2IM3A 1VLOA 5ITHA 1NK8A 1WORA 3CJRA 4CM0A 4FS2A 3UCZP 4LR8A 3WZ0A 5HP1B 4CT8A 7FD1A 3TW0A 3CCMS 4YOEA 5DZ7A 3M8PB 3CJKB 3PM9A 1UZDA 4U9RA 5EGYA 4H4KC 4IH6A 4K7QA 2ILYA 4YB7A 4LF9J 1RAAB 3W60A 1U4BA 4F0KA 4GVLA 3H4BA 4BC7A 1MU2B 2N4CA 4DSEA 2MB0B 4B9SA 1B70B 2H9ZA 3R7SB 3PHTA 1TL7A 4ENOA 2C22A 2AP6A 3WC0A 3B54A 4JP8A 2VG5B 3LQVA 4EBEA 1TFYA 1U8WA 3KYLA 1FDNA 4LRDA 5GAHU 3W9HA 3VGUA 3CXCR 4NLXA 3MEEA 3KLIA 1VISA 3GFHA 4JV0A 2VG7A 4Z2XA 3AODA 2CIMA 1RAOA 4OZLA 1X4DA 2UV8G 3N0VA 1HPZB 1OPZA 2WBRA 3CWJA 3HD1A 4LFBJ 4RW6A 5M2PA 1URRA 3MHYA 4EYIB 1ZYQA 4NYOA 2K2PA 2ROPA 4X62J 4YFUA 3HULA 4WCEQ 4JI1F 3ZTSA 4O3PA 2QC3A 5C2CA 4RNNA 2DISA 6AT1B 1TP7A 4QYZJ 3U02A 1VC0A 4NLDA 4QU6A 4G1QA 1SL2A 4WU2A 4KKOB 3QGIA 2GW8A 1RK8A 1TTHB 2QLJB 4HH1A 2XO7A 3CW2C 3RTVA 3I87A 2BM0A 1U25A 1S7HA 1S97A 5KT5A 3M05A 4IG3B 1H98A 1NEEA 4WFXA 1WNEA 1RU2A 3TJ8A 4ZCKA 3BBFA 1XNRF 1M1HA 1O51A 5IFMA 3OSNA 2Q1LA 2YQ0A 2PI4A 2F40A 2F9DA 2FGCA 2J8SA 2JNJA 1PJ5A 3MPYA 4EU0A 5LMUF 4K4YA 4ZPWR 3TAQA 1FRKA 2RHQB 2EFNA 4O23A 4DL7A 2M4MA 1ELOA 2HWIA 1UAWA 3AY0A 1QJHA 2IRUA 3DLGB 2ZJRQ 1EHWA 2O3DA 4P73A 2G4BA 2J0XA 5AT1B 2DIUA 2DGSA 1S4FA 5KFJA 2ZWOA 2UUAF 4UOGA 3RZAA 1Y5NB 4ES2A 2UXCF 4RNHA 2ZJPQ 2HS0A 3MCNA 3K2YA 4HH0A 2Q66A 2V4QA 1XR5A 4CRJA 3W2WB 2YKNB 5HMWA 2JX2A 1IKWA 2ZOFA 3JTOA 4KE5A 1V3SA 2ROEA 1WC6A 4LR7A 4P2FA 4R25A 1FE4A 3HSGA 3W9JA 1DLOA 3R5BA 1N48A 3BJYA 3PEHA 4I4BA 4K4UA 4BS2A 4ELTA 4J91A 1RLDA 4NLYA 3VQSA 2VPWB 4R0EA 1RHQB 1U09A 3M32B 2BANB 4KH1B 3DRRA 3W8PA 2JL9A 4WP8A 1H3DA 4CO5A 3QZ7A 2OHDA 3T5KA 2CYYA 3GJTB 2AJ2A 3SQGA 2FHMA 3DLKA 1JK9B 2XSJA 2G0CA 2ZOMA 2Y1JA 1WI6A 1T05B 1SVDA 4C8ZA 1XC9A 4H54A 3KHRA 1KN6A 5MLCV 4LRCA 5HVHA 4NMLA 2WHOA 4G3IA 3P6YC 4CO4A 5CYJA 1EX8A 4HI2A 3JSMA 2MHEA 2FVRA 3OW2R 3NNCA 2QIFA 3HLUA 4I2PA 4JI2F 5LSRA 2FZCB 3D0GE 2EKYA 5J1EA 4DEZA 1LXNA 2W2MP 2VICA 4MKVA 1EP4A 3QNWB 1RWWB 5DGAA 3CCWA 4A47A 3NOGA 1UEUA 5HSPA 1J27A 4NYZA 3KLGB 4B9VA 2RAQA 1HIYA 3AOBA 1VQNS 1G1XA 2MLZA 1D9DA 2UUBF 1WEYA 1X60A 2YKAA 2BXJA 4R8UA 3AQOA 4JYAJ 5E2QA 2L9NA 1MMNA 4ECYA 1FRIA 3QIPB 4EGLA 3LA0A 3NGKA 3KWMA 2LA4A 3HI9A 1MWQA 5AE1A 2I2YA 2XI2A 3IG1B 1T02A 2ZH4A 1VJWA 2HNDB 2PIIA 3R5DA 3L9ZA 3MEDA 3KLGA 1UL3A 2V67A 4K5RA 5JJBA 4R8UB 3Q83A 4F4AA 1SJFA 4KFBB 3ZNUA 4L3NA 4BWMA 4FP9A 1QD1A 5D0GA 1N5YB 2L9DA 2YKQA 4J37A 4UY8T 2DHHA 5CA5A 1PIEA 2HMIB 4OL8A 1R0AA 1LWFB 5B0EA 3TWZA 5E3CA 5HQLA 1QY7A 2CAJA 3JAMU 2J0SD 4FYVB 2MQQA 2W9AA 2ZH5A 2M52A 4GKJJ 3K7RA 4RW4A 4Y2MA 3BREA 2V8VA 2E1MC 3P5BP 2VF3A 3CD0A 1JJHA 3VR1A 3M8WA 4IFVB 5HBMA 1K1SA 1LWFA 3BQ2A 1JIHA 1I51B 1KDNA 3HVTB 1T9UA 1UPPA 1YDLA 5K5MA 4P6QA 1RHRB 2LFVA 2F9JA 4LFCJ 2DGOA 4IR9A 3UN3A 3AOAA 2F8MA 2J6TA 2YQ1A 7FDRA 3M2VB 4QR1A 2HGNA 2OFGX 2J0WA 2X7IA 1V5VA 3P3DA 2CZVC 2RU3A 4K4ZA 3MMCA 1HR0J 2C2MB 2MJNA 4EK2A 1TQLA 4NLVA 4NRTA 1X4HA 2IHR1 2QA4S 2YX1A 2IVFB 5KG4A 4YR3A 3OFHA 4M5GA 4AXIA 1XNQJ 2RILA 1TL5A 3EZ5A 4LBIA 1IKVB 2I9SA 4FS1A 3TNVA 1JB0C 2R3VA 1TMMA 2C1EB 1U2FA 2OEMA 3POTB 5HMXA 3LWLA 3KHHA 1VIXA 3SXLA 2KM8C 3EVWA 4ZLPA 4B9NA 3X1LB 4WFZA 1Q82T 1YRXA 2KJVA 5FJ4A 2QFIA 1UVKA 4IO9Q 1UVLA 2D9PA 5KFDA 3JSYA 4FBUA 1RAHB 4FF2A 2X1BA 2WVDA 1T9WA 4I56A 3S01A 4LR9A 4GVBB 4NI2A 1S48A 2A2DA 3MM9A 2ZZTA 4O0NA 3TX0A 1RAFB 3GPAA 4M8LA 4ZLJA 1S1VA 2J5AA 2QG9B 3IRWP 2E5IA 2QMXA 5HANA 3E8OA 1HNWF 2EI5A 3IM9A 1N34J 2MSTA 2XBPA 1Q86T 4W92B 1PCAA 3NAHA 2RUGA 4F04B 4CIOA 1G4CA 1CULA 2IM0A 4DR2F 1WDTA 4O3NA 4UQTA 3HMJG 3GSIA 3R1LA 5BYRA 1PAUB 1EZZB 3CEDA 3K0JA 1QUVA 1W2IA 3G82A 5ETTA 2V68A 2VBWA 2K7JA 3MM8A 2OKQA 4TU9A 1R31A 2EFGA 2NCKL 1F2GA 2JFKA 2O01C 5BR8J 4PG7A 2FLOA 5DQHA 3NMRA 4L73A 2HG4A 2HQ3A 5F41A 2CQBA 1YVFA 3BKFA 1T7PA 2JLFA 2DD8S 2R7RA 5CXTA 2YVSA 1KRPA 2UU9F 1CJTA 1P9QC 3DN9A 3PXGa 1U6BA 1UWAA 1RWVB 3I0RA 1REVA 4TVAB 3ZZPA 2OPPA 4DV2F 4DQRA 5C24B 1P1TA 4DV1J 3BKTA 4P9SA 1ZTTA 3HO1A 2ILZA 3JYTA 4H4OA 2JH3A 3PW5A 2AW0A 1MLAA 2AQ4A 2F8HA 3G6ES 2XQCA 4ZVOB 3IR6B 3TZWA 3GIMA 1PYSB 2YPZA 2QMUB 3FKBA 3H2UB 2IA6A 3MR6A 3CIMA 3VAMA 4F4WA 2OP5A 2ZC3A 2BE9B 2BKOA 3EGWB 4JOUA 4Y34A 3I0SB 3KHLA 4RWWA 2J8AA 3J80Y 4RLEA 4ECWA 2PEBA 4EZ9A 1OPIA 4HR2A 3EVOA 5H1SV 1RTIB 4HT7A 4JI5F 4IQMA 2UXBJ 1G7CB 1RU1A 2BQUA 2DB1A 4M1KA 3TP2A 4DN9A 1F9HA 3R27A 4DSLA 2MKJA 2QL7B 4B08A 4DF4A 1O6XA 1RZMA 1ZBTA 3CE8A 3I6PA 3PW4A 3BF4A 1QAIA 2WBMA 2FVQA 2JEIA 2OSQA 4MK9A 3GQCA 5KFMA 5ETKA 2YWGA 4ZDNA 5EDWA 3CDUA 5L39A 2KFYA 4DV3J 3AXKA 1VI7A 1S6OA 1T0TV 2Z2MA 2KM8B 4OJHA 2V4RA 3O3LA 3K57A 1LW2A 2BYCA 2WONB 4WJBA 4PG5A 3UDVA 2FJWA 4TU8A 3LGHA 5KFZA 3GYNA 2PO4A 1RT7B 4RBUA 3Q22A 5J1NA 4WU3A 2BABA 3L7OA 3FFIA 5KG6A 3PO5A 2JOQA 2RJZA 2OPSB 3A8EA 4L3KA 3JTNA 3Q89A 4PWDA 2ACYA 4MKAA 1NK4A 2Z4PA 4X62F 4PXEA 5F9LA 2GO9A 1X4GA 2FJDB 5E3AA 5FDLB 3UO0A 4ED4A 4XO0A 4DS5A 4WKYA 2FJXA 2L41A 2OGUA 1TKZA 3MR7A 5CYMA 7AT1B 4OHZA 4QWEA 4J9SA 4ICLB 5J2NB 1VCTA 1XN9A 1WHXA 2CJXB 2WB1D 2ZVSA 2A10A 1RTDB 4B9LA 2B9XA 2JEGA 3FSIA 1IBKJ 1VFJA 4AYBD 2IYIA 5HJXA 3V6DA 2DGUA 2V9WA 2LVWA 1X31C 2OPRB 5GAEI 5BR8F 4IR1A 4PCQA 3V6HA 2APOA 2CUYA 1RSCA 2DH9A 4KPCA 2G0JA 1SH0A 4LQ9A 2V69A 4EI2A 5SZTA 4OI0A 2E9ZA 1SQEA 3CMQA 1OYEA 2CQIA 1VMBA 4RR5A 3MEKA 1MG7A 2EBEA 4QZVB 3UR0A 1I1GA 3GLJA 2D3UA 2RSQA
chains in the Genus database with same CATH topology
3GFZA 2VFTA 1YJVA 1XTZA 3DHWC 3R5AA 3K5LA 4O3OA 1FJ7A 4QR0A 4K50A 3GWCA 2B5JA 3DLHA 4H4KA 2EK1A 4YDXA 3JAMY 3T5HA 1IJEB 3GR0A 5KG1A 4BHQA 4YB6A 3T5JA 4DL0C 1ZM3A 2P5VA 1APSA 4XAKA 2J6SA 2XWXA 4ID5A 5E7OB 1LXJA 2KFZA 4LQ3A 5HN0A 5C25B 1HWIA 2JLGA 2LYVA 1GH8A 1JLQB 3J7A1 4RW6B 2BRKA 4Q8FA 5LXRA 2JSXA 3WBZA 4J9PA 2OTLS 2ZDOA 4TQSA 1X4FA 3EPGA 4AL6A 4I68A 3PKYA 1VQ9S 3G8SA 5DQGA 5J2PA 4RW9B 4BCAA 5F8NA 1RT2A 4OZ5A 2VD3A 4TY9A 3SCKE 2FB0A 2PEHA 4NLWA 3G6VA 3G6XA 4KRWA 1DJ0A 1N6QA 1LKZA 5IXUA 4XDDA 5JUMA 1SB6A 4K4WA 4IDKB 2L3MA 2BR0A 3BB5A 1RT6B 1TV6A 5E3QA 4QW8A 1HQEB 2RVJA 1FD8A 3M6WA 5KFBA 1X9SA 2E9RX 2BBEA 3H5XA 5G0RB 4RW7B 1RTJA 2WRMA 4J9LA 3IWNC 3UW1A 3OR1B 2O1PA 3LP0B 4E98A 1VQKS 4TYBA 4U67Q 3OLBA 3T6JA 1NK5A 2JC1A 1R27B 3IS9B 4KV8B 3MTKA 4QCLA 1CPZA 2NR0A 1TK8A 3Q8QB 3MECA 4AQYF 4WK1A 3SI8A 4EYHB 3KLEA 1FXDA 1WACA 4QYRA 2KRBA 2KZMA 2QE5A 2RB7A 3VAIA 4LSLB 4ILLA 2DRAA 2CQ3A 1Z4UA 2O66A 4I7FB 1HNXF 4DSKA 2VBZA 2N4DA 1HNZF 2XY7A 1Q79A 2LDIA 2KB2A 2N7YA 5I42A 5FD1A 5L9NA 4QIWD 1J5EF 4J9RA 1ZOTA 5H9EJ 3GG0A 2RKIA 2CPYA 5ADZA 2EW9A 3KFWX 2YKNA 2DHSA 4O4RA 1Y3KA 3O1LA 3CCJS 2HHTA 4TXSA 3DLEA 4LF7F 3Q23A 2DNMA 3D5MA 4KSEB 5SZTA 2GMJA 2WOMA 3OBIA 5D4PA 1VC6A 3D1HA 5A6PA 1JXLA 2VA3A 2UXDF 3DLLQ 4NL5A 2RT3A 1L3TA 2QT7A 2DH8A 2RKIB 2AJQA 2L9WA 2ASYA 2BOPA 3NS5A 4A8KA 3SSRA 5AXNA 2DIVA 3UDCA 2WOMB 2XSFA 3SQGB 2IMWP 2RS8A 1HBOA 2ZZMA 3CIZA 2HVHA 2BJEA 3IC1A 3BQ1A 4WTYA 3SDEA 5T14A 2V8HA 1WG4A 5HI7A 5DDOC 1VK8A 1SKSA 5B0GA 4MKYA 2VKRA 2C3UA 2DNOA 2ADCA 2C28A 4WK3A 5D6GA 1FD2A 1KS2A 1UA0A 2LQBA 1MSWD 4DN0A 1X4EA 1TKTA 2P9GA 5DDQC 2XI3A 1QAXA 1RA7A 3AQPA 4C8NA 3ENVA 4Z37A 2Q79A 3CC4S 1X5TA 1Q82T 3BZQA 4FF4A 1P6TA 2MKKA 3OVAA 5HBMB 3QZ8A 1TKTB 2YKPA 4WFNQ 5B0BA 4B9UA 1Q16B 4CQ1A 5IT4A 2L48A 1WTFA 5DGBA 3TANA 1FJGF 2ZNYA 3R5CA 3LPYA 2DNKA 4FVMA 1R0AB 4F3QA 3H40A 1U48A 1SL0A 4F4XA 2XHWA 4OLOA 5EX3A 3KJVB 3GYXB 5CZVA 3OJSA 2IJFA 3M6UA 3RR8A 2WCXA 2UXBF 1Y4ZB 5D78A 1P8GA 1Y00A 1J5OA 4PRFA 4IFVA 4DDFA 5IS2A 3AB2B 3BN4A 3VAFA 3NLCA 4KKOA 5DJBA 3EZUA 3U1LA 4OX7A 1T03B 2IRXA 2VZ9A 2DO4A 4XDCA 3M2UA 1WG1A 4MK7A 2KT3A 4ZA1A 1MMDA 3DCAA 2WB4A 3TVZA 1Q7YT 1S6PB 1S6UA 3GFXA 3PRDA 1N5QA 3PIOQ 2VQEF 2DITA 3UWTA 3HKWA 4GMKA 3SFUA 3N6NA 3TA2A 4Y0FA 1WG5A 5HQ8A 2IFXA 1CC8A 4IH5A 3G71S 3DLGA 3SV3A 1Q7LB 3IWLA 2B4PA 5KFGA 1HFEL 2V9KA 2KXHA 1LWCB 4KGMA 3MEGA 3TX8A 4CTAB 3AB4B 2NSBA 2NUHA 3MM8B 1RA6A 3ZZUA 2MZ1A 1D1UA 4WZQA 4YB1P 2R9LA 2NQPA 2EVZA 3RRGA 4NLSA 4C8KA 1IKWB 1FT8A 3DLJA 1SXLA 4PG6A 3KK1A 1N8RT 2SXLA 4YB5A 4CI0B 2W9BB 1FJCA 1RYSA 1HR0F 3RR7A 4PWUA 2MZQA 1JKHA 3GZ7A 4DL3A 2WW8A 1N54B 3I0RB 1FK9B 2XGQA 3SEOA 1SL1A 2XGPA 3T1HF 1BY9A 1Z1ZA 4YQWA 4KGKA 1YJNS 4NXNF 4WF9Q 3DOMA 1JKHB 1U1LA 2KRRA 1K1QA 4QW9A 4F8RA 1Y5LB 2RD5C 1FK9A 4PKDB 4B17A 3PW0A 2D9OA 2CQDA 3HHLB 2DVIA 1DTQA 3M2RA 1YIJS 4OI4A 4WE1B 1RTIA 1FVQA 4X4RA 3QO9B 4DUYF 4JI4F 1VIOA 4ECQA 2NZ4A 1BQXA 1AFJA 3I56S 3FCHA 1DTQB 1JLFB 1WI8A 4C11B 3QYYA 2VFRA 2W4DA 4DV7F 3QIPA 5KFKA 2X1GA 2ZKUA 2DJWA 3DU6A 3HX9A 5D4OA 3K5NA 2DHGA 2CVIA 3IRXA 2OD4A 1VQ8S 1Y7PA 1QSLA 5KT6A 3L09A 1HMVB 3ITHB 3DHXA 2G1DA 5LL6d 1S99A 3NCRA 2J6UA 3I4PA 1VBYA 1SV5A 5DG8A 2MKCA 3H98A 3N28A 4KB7A 3S8SA 2HW3A 4F3OA 1FE0A 5KFSA 3BO3A 3KMQA 2R7WA 2ZHOA 4DG1A 4CNYA 2MGZB 3MR5A 3I5BA 1DFDA 4JI8F 4Q8EA 4RWXA 4WIIA 3VF0B 5HMZA 5U47A 3MEDB 2HHHF 3PHEA 3AH6A 2ZH6A 3LWMA 3OUYA 4PUOA 3CDWA 1F60B 2CQGA 3WX4A 3GIKA 4Y2AA 3PFOA 4I69A 1JMTA 2DCLA 2N7CA 2WAQD 3PO4A 2VB6A 1Y9OA 1WWHA 2G13A 4PXDA 1VQOS 1IBLF 4X4NA 2I8EA 3JTPA 2CQHA 2EC0A 1M5SA 5GAGU 1H2UX 1V9OA 3D54A 2IRYA 4NCBA 1UP1A 2OFHX 3OQ2A 2HNZB 2VOPA 4OX8A 3Q2TC 3DRSB 3DOLA 1RTHB 5KG3A 2U2FA 2DNPA 2EK6A 2K3KA 4NA1A 2MHNA 1JLAA 1X5OA 1DRZA 1QSYA 4OZ0A 3PX4A 5IT0A 3RBEA 4KAIA 1FTCA 2B4VA 3DOLB 1AW0A 1FF2A 2E5HA 2MQLA 5DM7Q 4CH0S 2ZBCA 1NO8A 2UV8A 6FD1A 3CPWR 2FHKA 3MFHA 2BA9A 4ED2A 2XEXA 3HT3A 1R89A 1SUQB 3EXCX 4PXCA 1L3VA 3FRYA 1C4AA 1Z2ZA 4OI3A 3DI6B 3TVYA 2Z0GA 4A8SA 2PFFB 4KJIA 4ECSA 4DSFA 1QLNA 3J81Y 4QR2A 1HA1A 4LIRA 4DR4F 4EEYA 1HYSA 2DGQA 1SH2A 1LW0A 4ETZA 1IBKF 1RT2B 4RNOA 2JZ5A 3AAWB 2HQIA 3BGUA 1XERA 3QWUA 2W9CA 3UCUP 3IGNA 2M8HA 4N8OA 2JJ4D 4ZVGA 5A8WB 1F0XA 2LKZA 3ISND 3QPIA 3OL9A 4NX9A 4OIXA 1RT3B 4X4TA 3WC2A 1FKOA 3SMZA 3G4SS 1FO1A 1PSDA 3I5CA 1ZM2A 3M9OB 5HL7Q 3M8SA 5G0RA 4QWDA 3PVXA 1WHYA 2QA2A 4RKUC 5DETA 4E8UA 3NMAA 3NRBA 5C24A 2C3OA 1RGVA 1CSJA 3JYTB 1R8HA 4HI1A 4UQGA 3ICLA 4MMOA 2GCFA 3PR5B 4BWJA 1VBZA 1S9EA 3VAKA 4G1IA 4YUDA 1N4LA 1JWWA 2EG2A 3OR2B 2E7XA 3MM6B 2XC9A 2CQ2A 2FTRA 4LSNB 1NKCA 2YNIB 3CF5Q 3KK3A 3I0SA 3P96A 1AROP 1X9MA 2ZJQQ 2GFFA 3MPVA 2J0QD 2PMZD 4KPYA 2AJ4A 2VA2A 1LW2B 1M90T 3CDBA 3I32A 4OHYA 3K5OA 4QQBA 1FEHA 4LF9F 4MK8A 2AGPA 3T3FA 2M8DB 3HVRA 3D0IE 1BLUA 5KFTA 2R7VA 1JLEB 1URNA 4NRUA 3P5TL 3FRZA 4ED1A 1M1KT 5KFEA 3QJPA 2FLLA 3DYAA 1HW8A 1U6FA 2RMLA 2JEJA 2XMKA 2IVMA 1KVJA 3RAQA 1R8PA 3DFEA 4QOTA 3VZHA 3RB4A 1U47A 2R2RA 1VQ4S 3QGPA 4A4JA 4OV1A 1DHMA 1H0HB 2RIJA 2MZRA 4ICLA 1HQUB 5IM0B 2VKZG 1NJWA 3DDKA 4DF8A 2V8GA 2VFUA 1ZAVA 1NZAA 2M0GB 3FFIB 3B4DA 2MDAA 3CVKA 3ISZA 4I6AA 5BJRA 1HQUA 5IM0A 2I1RA 1N5TA 4EUVA 1G3OA 2EBGA 1KNZA 1CQMA 4U6PA 4Y3CA 3H5SA 1KR4A 3BSNA 1O0PA 1EETB 3EX7B 1CG2A 4O4GA 2UP1A 4URGA 2AJ0A 3V4IB 4LFBF 4F4KA 5F3ZA 4QPXA 3TAMA 1RTDA 5KFHA 2NS1B 1NKEA 2XCAA 3HVWA 4MYTA 2OPRA 2DPJA 3M30A 5LSOA 2E5LF 4X4UA 1UWBB 3T5LA 3SDEB 5T7LA 4PQAA 3OV7A 3I9ZA 1NK7A 3OTEA 1UEVA 2LEAA 2QA1A 4E0DA 2YNHA 3JSRA 4KHPF 3FMBA 2VG5A 3H2VE 3JSBA 5CHCB 4ES1A 4JI1F 5F8LA 3UPFA 3G8QA 3BSOA 3B78A 4C8YA 5K8OA 4X4PA 3BEGB 3HZGA 4OLPA 2I5JB 2C2DA 2KYZA 5DG7A 2YNHB 3LOUA 2IM1A 1PC4A 4CCHA 1FRHA 3CCZA 4RW9A 3MAQA 4IQXA 4YHHF 1T94A 2YKMA 3MMAB 3MMBA 5KFYA 4O0IA 2CJBA 3LP1A 4LIWA 5HLFB 3O44A 4ID5B 1T95A 4CH1A 2UVRA 4NZ0A 2FDNA 1JLBB 4C98A 2OH2A 1S6PA 3LP2B 3KNGA 2PDAA 4WZMA 2AV5A 5KFLA 1S0OA 2C2RA 4WXOA 4IOBA 1TVRB 3NS6A 3EXYA 3CCLS 1GT8A 4LFAF 1RT6A 1U7LA 1RWUA 3RB6A 4QU7A 4HHJA 5EWEA 1UVNA 3U7JA 2R2UA 3C3LA 1KFDA 2VL1A 3BGRB 1VQ6S 2PGCA 3NP5A 3BN7A 2AJ1A 4OI6A 3NWGA 2VV5A 1NKBA 2GQQA 2ROGA 3UE2A 1TVRA 5KT4A 1XMQF 4EFAC 5LJ3Y 3ETOA 2AX0A 1GX6A 4LF4F 1N6QB 4RW8A 3H5UA 1HBNA 1RT1B 2C3YA 5M2UA 1Z2LA 3KLEB 2E29A 2GIRA 3ULHA 2F3JA 3BGRA 4PPZA 4DR6F 1ZH5A 4X4VA 2F1FA 5IQQA 2ZH7A 3MD3A 2R7TA 3FZ2A 2VUGA 1Y3JA 2KN4A 4IG0B 2B3TB 4HLBA 5HROB 5I3UB 3TVKA 2XCPA 1T8EA 1AFIA 5LJ5Y 1NJZA 1M5PC 3UQSA 3KG0A 5DQIA 4N41A 4O3RA 1U1KA 2W9BA 3IXQA 2CPEA 4AXJA 3C2PA 4UW2A 1I6JA 3C66A 3K5PA 4RU2A 4YEAA 1C0UB 4C8MA 3W2WA 4ELVA 3QO9A 2R7SA 3EPIA 2F4VF 2VBXA 3RAXA 1QVFR 3FDSA 1L3UA 3EUNA 3OJUA 1R43A 3GIJA 3KTQA 5C42B 3RYLA 3M9NB 1RT4A 5KFVA 3T1AA 3TOQA 2UVVA 4NWBA 5F9NA 1FKPA 2QV6A 3RW7A 4NOHA 3HF5A 2CZ4A 5F8MA 4K4XA 2XSJB 1T05A 3MDFA 1RT4B 2HLUA 2CRLA 4ERDA 1FKPB 1UKUA 2R8JA 1Q1KA 3IG1A 4KBIA 1U1NA 3VZIA 3OFGA 2B9YA 2E1RA 5GAEU 2KHDA 3TA1A 5C5JA 1DQ9A 4KFBA 1S0NA 2E9TA 2HGLA 4J5OA 5KFWA 1HBOB 2MKSA 3NNAA 1GXTA 5J2MA 1S6QA 1DTTB 2GGPB 3I96A 1XWLA 1X0FA 1HNIB 2XMUA 1ZZFA 4FF3A 5K9FA 2BDPA 3J7YU 4DQIA 1HMVA 3ITHA 3W7BA 2FHJA 1VOMA 2AD9A 3KG1A 3O5TB 4A48A 2QLXA 3CCRS 1KLMA 2GO8A 3QJJA 1RKJA 1JLCB 3QLHA 3US5A 2MY7A 3IO1A 4Q2MA 3PNIA 5J2QB 4X66F 1SKRA 5KFFA 1VRUB 2LXIA 4C9DA 3ZC4A 3PKMA 3P49B 2ABYA 4M5DA 4J9NA 4DBQA 3OUYB 3BQ0A 1OSDA 3E51A 4OHWA 1MU2A 2HPUA 1TAQA 1RTHA 4QIFA 5E33A 3U02A 2K1RB 4QIGA 4DR3F 1C1CA 4EBCA 2AGOA 1IKVA 1RI7A 1JLAB 5A8KB 2KHCA 4Q45A 1VBXA 4JI7F 4X4OA 1HHTP 2MQPA 3CD7A 3E3XA 4IYQA 4TY8B 5F8GA 2R8IA 2UUCF 1MNEA 4CO3A 1TUVA 3H2LA 5KFRA 3CCQS 3MR2A 4ECXA 5KG5A 3V4MA 4Q2LA 3TYTA 3VAJA 1FRJA 2KG0A 3ZZTA 4QJVA 2XNQA 3Q0AA 4AL7A 3PFEA 2FHJD 3D1QA 1LK7A 1S1TB 4GO5X 4A8QA 3KK1B 2W7AA 2U1AA 1R8AA 2FLPA 2VBYA 2LMIA 1FXLA 2A2CA 4P7VA 2YWHA 3BO4A 4QIEA 5B09A 4DS4A 4EO8A 2VG6B 2QFJA 2VODA 2W25A 1C0TA 3DM2B 3GSDA 4KHMA 4GO7X 3L7PA 4XIUA 3G96A 3DNCA 4U7UK 4ES3A 3OFFA 1XNQF 4URQU 1FCAA 4QWCA 1C1BB 2OD6A 2DO0A 4UUWA 4R5PB 5EHHA 4F4YA 4DL4A 3PX6A 3DOKB 3QIDA 2BE2A 2I0XA 1TFWA 3I5AA 1O5JA 5KFQA