4OZJA

Glnk2 from haloferax mediterranei complexed with adp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
118
structure length
104
Chain Sequence
LPNDGGIKLVMAIIRPDKLADVKTALAEVGAPSLTVTNVSGRGSVDLHQKVKVECVVADTPAEDVADAIADAAHTGEKGDGKIFILPVENAIQVRTGKTGRDAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a PII signaling protein from a halophilic archaeon reveals novel traits and high-salt adaptations.
pubmed doi rcsb
source organism Haloferax mediterranei
molecule tags Signaling protein
molecule keywords Nitrogen regulatory protein P-II
total genus 21
structure length 104
sequence length 118
ec nomenclature
pdb deposition date 2014-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ozjA00
2GW8A 1PILA 2CZ4A 2VD3A 3DFEA 3GSDA 5D4OA 5D4LA 4Y6IA 1NH8A 3M05A 1O5JA 1UKUA 2NS1B 1V3RA 4CO0A 1H3DA 1UMJA 4R25A 3NCRA 4RWXA 3N5BA 5D4PA 2EG2A 2GX8A 3AA8A 1NAQA 4AFFA 5DS7A 3CE8A 4USJC 3MHYA 2NUUG 4RWWA 3TA2A 2J9EA 4C3LA 2Z0GA 2NUHA 3O8WA 4CO2A 4NYPA 4CO5A 1P1LA 2ZOMA 3L7PA 3LF0A 4RX6A 2J9DE 4C3KA 1KR4A 1J2VA 2GNKA 4NYOA 1V6HA 4WK3A 1XK8A 1VFJA 4D3GA 3O5TB 2J9CA 2DCLA 3OPKA 3AA9A 1V9OA 2J9DA 2XBPA 5DRKA 2O66A 3AHPA 1GNKA 4CO3A 1NZAA 4CNZA 2O67A 1UFLA 4YB6A 1OSCA 3NCQA 4E98A 4YB7A 4USHA 4OZJA 5L9NA 3AH6A 4CO1A 2ZFHA 3HLUA 1HWUA 4OZNA 4YB5A 1QY7A 2V5HG 1VHFA 4CNYA 1O51A 2XZWA 4WK1A 4OZLA 4RLEA 1Q1KA 1UL3A 3X3UA 3TA0A 4ZK7M 4C3MA 4D3HA 2XG8A 2JJ4D 3TA1A 3T9ZA 4IYQA 4Y65A 2RD5C 5D4NA 3NCPA 2E66A 2XULA 1V3SA 3BZQA 4USIA 2EG1A 1NH7A 2PIIA 4CO4A
chains in the Genus database with same CATH superfamily
1TELA 1W2BR 4CM2A 2J6UA 1OY8A 2HHHF 3CD6S 5IQQA 1LXJA 2K2PA 2Z58B 5C24A 1URNA 1FEHA 4WIIA 2A2DA 1B0TA 3BN7A 4DFKA 3V81B 3UNGC 4Y2KA 3IRXB 3K5MA 3SCIE 1S97A 1GH8A 3WZ0A 1RAOA 1E6VB 3NL0A 4OJGA 4ZVSB 3PYDA 5I42B 2J6SA 3OFFA 2VV5A 2JEGA 1CULB 2LEPA 3FDSA 1RWPB 3KHLA 1DRZA 1V5VA 4CLLA 4ED8A 1U0HB 3D1QA 1KRPA 3DOKB 4FZVA 1S7HA 4R25A 3UCGA 4CLFA 1D1UA 1IUJA 3ETOA 2PC6A 3O1LA 5KFVA 1WORA 3V4MA 3K5NA 3CULA 3TZZA 4C0OC 2GX8A 3M2RB 4B9LA 2HNZA 3FQKA 1VBKA 1S1UA 2DNYA 1XMBA 1FRIA 2CJBA 5M2RA 2CJKA 4OI0A 3SV3A 4KB7A 2W7AA 1KDNA 1EARA 3VTIA 5A8WA 3P3DA 3M1VA 3NGRA 2OFHX 4GO5X 4FKXA 1HBUB 4OYPA 4PG6A 1FK9B 2Y8YA 4DV1F 2QGFB 1DTTB 2UZAA 2VJUA 1KP6A 2EXUA 3CMES 3VHQA 4M5GA 3MMCB 4USTA 4Y2MA 3NLCA 3BREA 1IBCB 2B9EA 2RNEA 2VG6A 3MEKA 5E7OB 2Y1JA 1MNEA 5ETNA 4C2MA 3OTDA 4Y2CA 2OUGA 3U02A 5BYSA 5CCMA 3U1NA 2VONA 3R9LA 4C3KA 3BQ1A 1QE1B 2VFUA 1L5UA 3M32A 2ZEJA 1IBMF 4X64F 1UVMA 2BM0A 4ANCA 4A8OA 1REGX 2L9WA 3RGIA 4B08A 2HFOA 3KYLA 2V4RA 4IH5A 2Z2LA 3UFCX 1HYSA 2DCLA 3HF5A 1HWLA 2E5LF 2AYMA 1RT3A 1AW0A 2C2EA 2FJAB 5AE1A 3OR1A 4TKTA 5CABA 4F4XA 1SL1A 2HHWA 1S1VB 5EX3A 1NSPA 4IRKA 3CJ3A 3DLKB 4RBUA 2XSJA 3EXCX 4JBCA 3KUEA 2BZ2A 1LWEA 4OZ3A 1H7XA 2NCKL 5KT6A 3TZWA 3IC1A 2YQ0A 2J7KA 2HS3A 1S1TB 2IJFA 3FGVA 3IWLA 3LP0A 5AE2A 5J2PB 4QWEA 1RB0A 3KLFA 2C22A 1TK0A 4KPYA 3FZ2A 2JRSA 4YB7A 3VV2B 4LF6J 2HSEB 4ES2A 4OZJA 2WONB 1RCOB 3T1YF 2YKNB 2CPHA 2JEFA 1DHMA 1AZSB 3EXYA 4YHHJ 4LF6F 2L08A 4ICLB 3CC2S 4RW8B 1OQ3A 1VK8A 4L3KA 4Y2IA 3SSSA 3TW0A 3MD1A 4OFZA 4P10A 3R2CJ 2QN6B 5LXYA 1YVFA 4PYAA 4K50A 4K5RA 4YN3B 5GMEA 1NHVA 4B9SA 2ZD1A 2ZM6F 2F9DA 2HMIB 4ILMA 1KEKA 4DF8A 1RU1A 3AJ2A 2BKPA 2CQCA 2GVZB 5ETOA 2JEJA 4BBYA 1WD6A 1PJ7A 2A1BA 4ICLA 2OPRA 2HFVA 4J9UE 2W01A 1YRXA 4QIWD 1MMNA 3CMQA 3CSKA 3ILJA 4P2MA 1UTAA 3FC9A 1CSJA 1H0HB 2IJRA 3M8PA 3DRPA 3N0VA 3P4UB 4DEZA 3R2DJ 4YB1P 4OYAA 3BZQA 1F5AA 1CJUB 1EP4A 1RK8A 3BV8A 3DGVA 5I3PA 5EWEA 1NLKL 3JTOA 1XIQA 5E3PA 3MR7A 5DG9A 3FVYA 2R7RA 3DI6A 4F2RA 2M0GB 1RE1B 1UPMB 1U1KA 1SC6A 1F2GA 1RWOB 5D3GA 3RR7A 2CIMA 5D4OA 1A0OB 5KFAA 4U67Q 2G0JA 2ASDA 4B3SF 1MU2A 3AY0A 4OX6A 2N3OA 4ECVA 4X84A 1C1BB 2VFSA 2UUCJ 4DR4F 5EWGA 2HNDB 3VGTA 4CTAA 2IA6A 1RSCA 4B3SJ 2IBOA 1JXVA 2UUTA 5HVHA 1BQXA 3ZZZA 2IC3A 5GADU 1T02A 1RTJB 2PFDA 2ZH1A 2MEWA 1T9WA 3E3XA 1Y9OA 4DV5J 2QLWA 4ZPVR 4OYBA 2DNOA 2CQ0A 2UUBJ 2RH3A 2XCAA 4ID5B 1MROA 1SJFA 2CG4A 1QD1A 1NCLA 3T5KA 3RW7A 3NRBA 2WRMA 1HW9A 3DCAA 4URQU 5ETTA 4PQAA 2WSCC 3AFGA 3HHDA 1UEKA 3QFHA 1FE0A 5JJBA 4X65J 4DX7A 2CG8A 3CJ0A 3HD1A 4OI2A 5EX0A 4C3LA 3IMQJ 5DDRC 4DUZF 2BW2A 3MTJA 2E9RX 3MWBA 4NYPA 2ATCB 2CZVC 3A1YG 4IR9A 1CQMA 2B6AB 4MKVA 1VC5A 4WF9Q 2WCXA 3KHHA 1U1QA 3MMAB 5T7LA 1ZZNA 4A4JA 1ACMB 2GIQA 2J9DE 1BHNA 1MMLA 3AOCA 3AAWB 4TQRA 3AODA 3MD3A 3QWUA 4KSEB 1N0UA 4NWBA 4PXDA 4WFXA 1S99A 1WKKA 3CDEA 3LWMA 1VRUA 3CJRA 4PQUA 1RTIB 3JYTB 3H5SA 4M5DB 2DITA 3TUZC 3UWTA 3NNAA 1RBAA 3WC2A 4KY3A 1URRA 1M5SA 2CJ9A 2ZNZA 3PYEA 2W8LA 1UJ4A 3JTPA 5DRKA 2Q43A 4XDCA 2KL8A 1SC1B 4DCJB 2GJFA 4CO3A 3CWJA 3ISNC 2UV8G 1S5ZA 1X4FA 2FD2A 4CNZA 4H4KC 3V81A 4CT9A 1O8BA 4KH1B 3OV7A 2GAGC 3W7BA 4IR1A 3SSRA 2R7OA 3JTNA 3NCQA 2RVJA 4F4ZA 2QL7B 5IWAJ 1IQZA 1RT1B 1ZM2A 1AFJA 4RO0A 3AD9C 1GAOA 1X5TA 3CD5A 5K14A 3J7A1 1JNRB 4NXNF 2DNQA 2VQFJ 2MB0B 1MWYA 5L9NA 1IBKF 5IWAF 2OGUA 1NK6A 2HZCA 2V34A 1RU2A 3W9JA 4OZNA 3RBDA 4OHXA 2Z4PA 1NZ8A 1IKYB 1SV5B 4TYBA 4X2BA 2CDQA 3CEDA 2AYGA 2MKJA 1RTHB 1PYSB 4EU0A 1JLCB 2NSBA 2GGPB 1D3WA 2KYXA 4LSLB 3GB0A 4OHZA 3D54A 1QAXA 2DNKA 3N4WA 1GMWA 3K8WA 3R7BB 1IM4A 3M4XA 3R6LB 3W9HA 1RLCL 2QLJB 5LT5A 1NJXA 2UXBJ 2M9KA 2WW8A 1NDPA 3FSXA 4EK2A 2E29A 2YNFB 3AOBA 2EWHA 2PA8D 5EWFA 4OI3A 5E5NA 2YH1A 4LIWA 5SZTA 2YKMA 2B8PA 4B3RJ 4JI5F 1QUPA 2A0FB 2KU7A 2W2QP 1ZAWA 5B0EA 1U8SA 2FGCA 1ZAXA 4C11A 2FHOB 2QA4S 1NKEA 2A10A 1J5EF 2YY3A 3CCJS 3JQJA 5CYMB 2OIHA 4EZ9A 2DRBA 3W60A 1T7PA 4LFBJ 2H5IB 4ETZA 1ZS6A 5D3GB 1F9EB 1HPZA 2G2OA 3CCZA 4X64J 4B3OB 3RB3A 2YKOA 3CJKB 1I94J 5KFXA 3R1LA 1JLQB 1IKVA 2RUSA 2RB7A 3LQVA 4KQZA 4QIEA 5KFSA 1FFSB 5JUMA 2K8GA 2KN4A 3TJ9A 4Q7AA 3MEGA 4A47A 4DPWA 4USVA 1JWWA 4CQ1A 3TUJC 3MEDA 2GHPA 1XWLA 1RYSA 4DFMA 3K7RA 4U7CA 1VQ9S 2XI2A 4K4XA 3PKMA 1TL1A 3DLGB 1JJ4A 5IOLA 1Q81T 4GRSA 3DRSB 2NPFA 1IM6A 3OL9A 3DLBA 4ZLNA 3I56S 4F4KA 4W98A 3IR5B 3TNVA 5KT4A 4Q45A 1HBOA 1BXNA 1SBRA 2O01C 3T6BA 1LWXA 5U47A 2BUNA 2MZSA 3CCWA 2EKYA 1VJWA 2OPSB 5L38A 4Z7CA 2XY5A 2B56A 2AU0A 4O0IA 4LF8F 1QTMA 3OUYA 3M30A 2LQ8A 4DWIA 2AYEA 4DPTA 1M5KC 4QYRA 2AGQA 5KAKA 3HCXA 4PG7A 4NCBA 1GMWD 2R42A 2RF2A 1VMBA 1LW2A 4I6YA 3U1MA 3GV8B 3C8YA 2J9EA 3UVJB 3MR3A 1E6YA 2F40A 3DGPB 1F9HA 3SQGA 2QT7A 4RW7B 2EK1A 4CO2A 1PIEA 2C2OB 3FUYA 2CPFA 4P6QA 7AT1B 3ONQA 4CLTA 4ZIVA 2ZH3A 1P1LA 3HVTA 1KNZA 2KXNB 2PO4A 2BJ7A 2AT1B 2ZM6J 3C46A 2HRUA 2E7WA 2FVCA 1WC6A 3ENWA 3MM6A 4Q2MA 4ED4A 4DSEA 5LXRA 2BQ3A 3UQSA 4KBIA 1S6UA 3TAMA 3D0IE 2XMUA 1E6YB 3GR1A 3JAMY 2RS8A 1VFJA 2QIFA 2XMWA 3CB4A 4F25A 4ZN1A 2LMIA 4ELUA 1Q5YA 2DY9A 4RL1A 1CEZA 1D09B 1GQEA 3B78A 2DD8S 3NOGA 3Q8QB 4I6WA 5CYQA 1IBLF 4U7UD 3BDEA 2QSWA 4XPCA 5FDLB 3NNHA 4OI1A 4J9QA 4GKJJ 4C8ZA 2AEFA 2VODA 3H0PA 2ADBA 3V6KA 1GNKA 4MTPA 3B8HA 3G6ES 3AD8C 1NZAA 3HT0A 3LAKA 3M30B 4M8LA 4UUXA 1IBLJ 1UFLA 5HP1B 5ETMA 1QE1A 1Q7LB 2YKAA 4YB6A 4X62J 3TAQA 4J9PA 4MYUA 3MM9A 1K0VA 4LJMA 3LH2S 2WVDA 4DU8A 2R7SA 1VI7A 2DNMA 3IRWP 4RW9A 2XO7A 3H5YA 1JX4A 2Y0BB 4DQSA 2CPEA 2GO9A 3O3LA 4X62F 2QJ3A 2UUCF 1BD6A 2HHVA 2RRAA 2LXUA 3SYZA 1HD1A 1N5SA 2Q1LA 1R6VA 4GVBB 1WC5A 2C2KB 3QYYA 2O1PA 3GJTB 4LT6A 2NXEA 1S0MA 2KM8C 1ZAVA 4ECWA 3H20A 1WHVA 2IDEA 2Y1RI 1QY7A 2V5HG 1U4BA 3CC7S 2FZGB 4PEOA 1S4EA 2MMYA 4H4MA 1X31C 2J0SD 4DX8H 1PGZA 2Q6CA 2XZWA 2ZBCA 4PRFA 1KN6A 4K5SA 3I55S 1BQMB 2EC2A 2YNHB 3WIVA 1TKZB 2I9SA 2PSZA 3GPAA 5C2CA 4U7UK 3K2YA 5D0HA 4A8XA 4K2JA 4JUZA 2CQ3A 2WVEA 4MIAA 2J8SA 2ZH4A 2MKSA 2DHGA 4FS1A 3PEJA 4X65F 1XR6A 1T03A 2ZWOA 2JFKA 4OYOA 4MK9A 2BYCA 1HWIA 4LFAF 3GJSB 4K8RA 4Q5VA 1S6PA 1XC9A 4AUKA 1C1CB 5KFMA 4ED0A 3VF0B 1RA7A 3JS9A 4DV2J 1M1HA 4EYHB 1VQLS 2IPOB 1O6XA 4RR5A 2GW8A 3KLEA 1KVJA 2V9KA 3ZNUA 2KTQA 4WKYA 1YBUA 3EVOA 3KKFA 1FJGF 4DV2F 4OL8A 1X4BA 1RCXB 3LO3A 3MF5A 1SC3B 6FDRA 3T5HA 4NXMJ 2WB4A 3MM8B 1T8EA 2BRLA 1W26A 3GJQB 3MM7B 2OSQA 1C1CA 3RR8A 1L3KA 2DNGA 3M05A 1IKYA 1SV5A 1RQ0A 2WW4A 3JQKA 2E5IA 1SH3A 1FF2A 2LKZA 2ROEA 1S1WB 5LM7E 4ES3A 1B70B 4X4NA 2CPZA 1OMSA 5K8NA 4CO0A 1H3DA 2C3MA 5ADZA 2ZJPQ 3PZPA 4JB8B 1JLFA 1P8GA 1WEZA 3K8VA 4ZPWR 3EM1A 3TYTA 2U2FA 4ZLPA 5IT9Y 3UW1A 4KYZA 1C4AA 4QWBA 3GLJA 4J91A 1UJ5A 3ELHA 2ZKUA 1ZOTA 4I68A 3PIOQ 2P6TA 5FLXU 1NK7A 5HI7A 3CIMA 2ZBQA 1IBKJ 4B9TA 2FC8A 2HFSA 4H4KA 3BO3A 1Q82T 4RU2A 5C2GA 3PFEA 3PW4A 3HHNB 2DXFA 1NK4A 1TL4A 2KRRA 3CJ4A 4MK7A 2RIJA 3PW2A 2RQKA 3NGKA 1S0NA 2JVRA 3H8YA 4ED3A 3S8SA 4A8WA 1HR0J 2UXBF 2ZOFA 2CXEA 3MR5A 4I64A 4I1TA 4FPIA 2VUGA 2AJ0A 3MURP 1WDDA 2ACMA 4U8YA 4DV0J 2LFVA 4ZVHA 4DX5A 1FKAF 1KR4A 1RAGB 2QMUB 1REVA 4ZP7A 2J7UA 4NYOA 1ITPA 2ZITA 5CYMA 3TX8A 3HXMA 1A6LA 4DR3F 4JI5J 3MR6A 4KHRA 2H51B 4JI3F 1F5BA 4K0KJ 2G1HA 3DOLB 3PFOA 2CQIA 3BH6B 4ZOSA 1RXOB 1EB0A 2PMZD 3RU0A 3MUMP 2W8KA 4DR7J 2BACA 3G2XA 4F36A 4R8UB 4BWMA 1U25A 2C3PA 2RSQA 3OFHA 4LSZB 1G2EA 4DZDA 3DM2A 1N36J 3TARA 4ID5A 4X4SA 3RBXA 5J1NA 2R7TA 4O3RA 2K7JA 4UUWA 1M1KT 3RW6A 4MKBA 2IRXA 2NSCA 1RHKB 3N5FA 3MM6B 3PJ9A 2DRAA 2NXCA 1NKCA 3OTOF 1OS5A 1YSJA 2JVOA 2HQ3A 3CO9A 1YDLA 3FEZA 3HVTB 3OJSA 1XN9A 1VQYA 2ZJRQ 3D68A 2BQUA 1UVIA 3OXFA 4O44A 2WHOA 3CDAA 3IXQA 5D8HB 3C16B 2EFNA 3DM2B 4FYYB 2V4JB 1UA0A 2BM1A 3N6LA 4USHA 3SCLE 1YHQS 5HQLA 2ZH8A 2HNDA 5BYRA 4CTAB 4U96A 5H9EJ 1UVJA 3KG0A 4PCQA 3BSNA 1HNWF 2EFPA 4XPEA 2K06A 3GYNA 2QA1A 2V0NA 3QRPA 4DF4A 3W2WA 1L3SA 3RB6A 1HNWJ 1IKWA 4KGMA 4ZK7M 3G6YA 4USWA 4ED1A 1N32F 3F56A 4C7QA 5AT1B 1CJTA 3T9ZA 2D69A 3G6VA 3THVA 1BQNA 1LV5A 3VZHA 4C0BA 4ZITA 3Q24A 5D0GA 1SQEA 5KFBA 3K57A 3BYRA 1C2PA 3ILLA 1UP1A 1V3SA 3FBCA 2D3OR 4USIA 2HS4A 3DHWC 2P9GA 1X9MA 2VJVA 2H1YA 1BQNB 3GYXB 1CJTB 2DXDA 2FUG9 2DJWA 2VL1A 3HKZD 3ZNJ1 1JJCB 4IG3A 1XTZA 2RT3A 2WBMA 3GSDA 5KOXA 4TNOA 4A8YA 3W2WB 3BSCA 3MCNA 2YKNA 4OX9F 3AT1B 3BGOP 3BKUA 5KT3A 5L1JA 2F3JA 3RAQA 1AZSA 3OXLA 4L72B 1U1MA 2BE9B 2HVHA 1HHQA 1NKBA 1QAJA 5B0CA 2ROGA 3J80Y 5E41A 4L3NA 4CM0A 4ECRA 1LW0B 4F4AA 2DHAA 1RAJA 2C42A 1RACB 3KK1A 2XQCA 2LYVA 4EBEA 5B0GA 3LP0B 2JX2A 1T05A 1Y00A 4WP3A 3PO4A 2VB6A 1X4EA 4XK8C 3WDOA 1FRKA 5D0RA 1D8ZA 1DQ9A 1LW0A 1DQ8A 3KFWX 4LF4F 3MUVP 4ZPTR 3KK1B 3KLHA 2YQ3A 3I87A 1TU0B 2LA6A 1RT6A 2B4VA 1N52B 1Y4ZB 2P9CA 4OJ1A 4USJC 2HHXA 1R6YA 3U27A 2B5JA 2H9ZA 3HHKA 4M1KA 3AQPA 4NX9A 2M8HA 1UCNA 4K4TA 1GMUA 1WG4A 3UCZP 2ILYA 2HYIB 4QWCA 3VAHA 1M5HA 2HBYB 2YPZA 1GTHA 3NGSA 3P5BP 2JC1A 4YP3A 4FVMA 5I3UA 2DNZA 3T5JA 4EZ6A 4L6V3 1H6KX 4A8FA 2E1CA 2OD4A 2MQNA 3R3TA 3HK2A 2CYYA 2OP5A 3QLHB 4OHVA 3M8QB 3SCJE 3LWLA 4JV5F 1HBUA 1S48A 1VQMS 2NYHA 5K8MA 4ILRA 4J9VA 2FGOA 2DNLA 2GVDB 3FRYA 2UXDF 3ILOA 1PAUB 3QO9A 3QZ7A 3MAQA 1U1NA 2J9DA 2I6WA 1Y3KA 4QU7A 1GXTA 3ITHA 3RRGA 4F26A 3DLEA 4DSLA 2FHJA 3G82B 3EUNA 2GHVC 2XY6A 1RT5A 1Y5IB 4L76A 2MY8A 5HMYA 2HGNA 2MDAA 5DDPC 3JSMA 4GKJF 2E44A 1VRTA 3MPDA 4DS5A 2B4PA 3NBPA 2KVQE 1RAAB 5LL6d 4JYAJ 5DZ6A 3W5YA 1FEEA 2ZBRA 1YBAA 5F3TA 3IGNA 3FFIB 4I7FB 4HYKA 3UN5A 4Z37A 3CCTA 1WG1A 1ZZFA 3LA0A 3POTA 3GV5B 1P9QC 2GA7A 4ZVPB 3D5MA 4B17A 1DTQA 2BE2B 4ZKAA 4URGA 4DR5J 5I3QA 2MPUA 1SUQB 1RISA 2HGLA 3FCHA 4CNYA 2I38A 5D6GA 3W3SA 3C66A 2AJ1A 5K9FA 1O51A 2V4JA 3FSIA 1S1TA 3VAGA 4LRDA 1YBTA 4OMFG 3PHEA 3KWMA 3EZUA 4JI8F 3TAMB 2PN6A 3J7AN 4M5LA 2XCPA 2JJ4D 4YFUA 1IN0A 3PACA 3CT9A 4ILLA 1BC6A 2ERRA 4O4GB 1HNZJ 1FRHA 1RTJA 5KG5A 1N88A 2VFVA 1TL7A 2RDIA 1Q95G 2CQHA 1LW2B 3DMJA 1H2TZ 3KDOA 2LA4A 5IM0B 5K14B 2BE7D 4IUFA 4ZCIA 3R5JB 2MY7A 3RJMB 5KG7A 1X0PA 3TI0A 3TZXA 3UD4P 2HW3A 4N8NA 2W7OA 3K5LA 1G1XA 3QNWB 2X1AA 4GC6A 4R0EA 1L3UA 5HJYA 1HNXJ 3JXOA 1EIYB 2FVQA 2NPIA 4K7QA 4R0JA 2VD3A 4YR3A 2F8EX 4ED2A 4J9NA 3AB4B 1F9FA 5HLFA 1LQ9A 1Q8LA 1D8YA 1QVGR 2L41A 2K1RB 4RNHA 2V63A 3GFZA 4C6AA 4IRDA 3AJ1A 2CQGA 1WNEA 4QYZJ 1EP4B 2B0GA 5GAGU 3GSIA 2FJXA 2DO0A 1N0VC 1WC0A 2X1BA 5L46A 4KJIA 3N79A 4PQUB 4UZCA 1K9MT 1K0TA 1U48A 2F4FA 3KLVA 2L9NA 4BHQA 4NCGA 1L3TA 4EO8A 2IIHA 4IDKB 1VRUB 4ALZA 1ZH5A 2R3VA 2VFRA 2VG5B 3OTOJ 1UMJA 1BE4A 1BLUA 2E1AA 1EHWA 4DV3J 2OPPA 4CH1A 4F7VA 4WP8A 2R2RA 2P9EA 5HROA 2EKNA 1JLGA 3M6VA 2ZVIA 4PAAA 4NXNJ 1R8HA 3BBCA 4J7CA 4KGZB 4LBPA 3ZC4A 2WTFA 4WFYA 2EBEA 4UY8T 1VQ7S 3IBWA 3BSOA 4O0NA 1GK8A 4NA2A 4I4BA 4AYBD 3CCMS 5BJRA 3BO4A 3QJJA 3MHYA 1X9WA 2GMHA 1S6QA 3DDKA 3WX4A 1FNMA 2GS8A 2KO1A 3H2UB 3O8WA 5F8GA 4V1Ak 2HPUA 3OHAA 1DLOA 5FD1A 2DCUB 4OJHA 2AYBA 2EFOA 4HDHA 2QYGA 1F5CA 3ET6A 2BW7A 3FBFA 3L3CA 4YUDA 4X4PA 5KT7A 3MFIA 2MYFA 3EGZA 1RHJB 1JLCA 4DN0A 2AIRB 2XEXA 2J0QD 5GMDA 3VAIA 1SKWA 3BB5A 2MGZB 3UCUP 3HHLD 1U49A 1Z2LA 2DNHA 1BUXA 1FT8A 2VQEF 1TR0A 1WG5A 1VRQC 5A8RB 2CJXB 3RYLA 3RAMA 2FJWA 4J9LA 3DRRA 1YJ7A 1XQIA 4EI2A 1EZZB 4ECYA 4DR4J 2KJWA 2BBEA 1WI8A 2QA2A 2I5JB 4K4YA 4A8MP 1KLNA 4ANEA 1MU2B 4F4WA 1AT1B 1OY9A 3DKDA 1RWKB 2CA9A 2X3DA 4RW4A 4DCOB 1PSDA 1P9YA 2OPSA 4DUYF 4L75A 2B9YA 2KH9A 3N9UC 2NXUA 3SV4A 1NNDA 4EYIB 4GKKJ 2ZDPA 1TMJA 4CI0B 2DK2A 3TUPA 3AOAA 2I2YA 5E3CA 1B0VA 4KT0C 1WC4A 4P2FA 1DLOB 3VGUA 4DBQA 3GE9A 1UWAA 4C48A 1EAYC 2AGPA 2GQ2A 1IKXB 3CDWA 3CVKA 3VAKA 3M8PB 1OPIA 2HFUA 2OLWA 4M94A 3EPGA 3I0RB 1EETB 1EETA 2QFIA 3SXLA 4BC9A 2GVDA 3RB0A 1XEZA 3LGNA 2JEIA 4ZJLA 4FF4A 3BGRA 3Q8PB 3D6HB 1T9UA 4OZLA 5IZHA 4PXEA 2V8PA 3FMWA 1SVDA 4DPOA 1DZ5A 2WAQD 1PG5B 3BGLA 3NGUA 3X3UA 2HURA 1H98A 2K3IA 4J37A 4O4RA 4PWWA 4RPFA 3TQEA 4DHVA 5KT5A 3OVSA 4OHWA 4ZLJA 3V6JA 1L3VA 2QEXS 4X4VA 1YKWA 3AB2B 3GG0A 1FERA 3LP1A 4IYQA 2E7VA 1CULA 4RW8A 2KXFA 5D4NA 4I0WA 5CAAA 5HMXA 4DL3A 1JXLA 4Y2AA 4DR2J 1CPZA 3LPYA 5F3ZA 3Q8UA 3R5GA 2N7CA 3DDIA 2IVYA 2WONA 1RHRB 4NLVA 2QA4G 1S0OA 4ELVA 3PRDA 5KOWA 4IFVB 3A8EA 5G0RB 5FDLA 5F41A 2ASLA 3G9CA 2DYAA 1Z4UA 2PIIA 4HI1A 3O44A 5FIIA 3M8SA 5HO4A 2QZ8A 4CLKA 3HT3A 2LXIA 2AX0A 2YNFA 4ZCKA 2KFNA 2W2MP 5ETKA 5ETRA 3UDVA 1NB2A 2AP6A 2A6MA 3QIPB 1XJWB 4ZVRB 5C25A 2XWYA 2IA0A 1SJ1A 3J81j 1YJNS 2AJ2A 1CVJA 2HHQA 2C2DA 2ZH9A 4Y6IA 3KXDA 3R27A 1XMQJ 1NH8A 1RT2B 2B4OA 1T3OA 3D3CJ 3GIMA 5F8NA 5GAEU 4USUA 4CH0S 1ZTTA 3HHLC 1PKUA 1ZM3A 4R8UA 1IR1A 2VBZA 2EFQA 2RMLA 3UDCA 2VQFF 1C1BA 4GMKA 3A3OB 4OQJA 2KZZA 2BJ3A 2ZJQQ 5KFEA 1G3OA 1C0TB 1PYTA 2DT9A 3ZTRA 3MAHA 3PYGA 4M63A 4F50A 4Z7YA 3PTWA 2CJAA 3DLLQ 4ELTA 2MKCA 2XSFA 3QAEA 2XS2A 2J7WA 2CNKB 4TY8B 4QW9A 2CPIA 1KTVA 3CD0A 4NRTA 1NDKA 1OYEA 3L95X 2HLUA 2V4QA 3EE3A 1F60B 2DGTA 2JH3A 3MMCA 3KG1A 1U6BA 3QJPA 1M5PC 1JLBA 2ZH6A 3TVZA 4H4OB 3HJFA 4HVZA 2HFNA 4NXMF 1TUVA 2H5EA 2DH9A 2KM8B 2V8HA 1SQGA 2ZE2B 2V8VA 2N7YA 3F44A 3M2RA 4ZPDA 5KG1A 4HDGA 3QRRA 3QZ8A 1S1UB 2JDJA 4HACA 4K59A 4YQWA 3CDBA 4ZHRA 4P72A 1NDLA 1RJJA 4FYVB 5KG0A 4WPAA 4WJBA 4NLQA 4LF5J 1DY3A 1TAQA 1WOPA 2UU9F 4NLSA 2OJ3A 5I42A 4DPUA 1D0EA 1ELOA 2LU2A 2DTJA 3KMSA 1U2FA 4WYLA 2HHTA 2HRYA 3IG1B 1S1WA 3S01A 2UU9J 1R7IA 4PG8A 1IWGA 4DG1A 3K5OA 4O3NA 4J5OA 4RUBA 1DFDA 1TMMA 1FJGJ 4YOEA 3RG6A 3RUBL 3MPUB 3OSNA 3V6HA 3OFEA 3D6FB 2G2YA 2LU1A 1KTQA 2HHPA 4UOHA 3CW2C 2KYZA 2U1AA 3TRGA 3PR4A 2CQ4A 3N6MA 4M5IA 4QOTA 1RTHA 2H4YB 3TANA 1WF2A 1Y11A 2L3MA 3BM7A 3MEEB 5HATA 2PI4A 4LSLA 2FTRA 4K4ZA 4YMEA 3UR3C 4FBTA 4HTJA 1EX8A 1PJ6A 2DHXA 3UI3A 1AYEA 3AH6A 1AB8A 2KXHA 3W65A 5DLGA 4L73A 1HWUA 3Q2SC 2D7SA 3DOLA 5IFMA 3IA0A 4ZDNA 1U45A 4MMOA 4NLRA 1H2VZ 3TVKA 1R0AA 4BLGA 2MTLA 1CJKB 1WKLA 2OD6A 1REVB 1AA1B 1I6JA 5HBMB 5KFZA 1RBOB 1PC5A 2LEAA 1B64A 1XR7A 4NA3A 4IFYA 2I1RA 3NGDA 3SI8A 5H9EK 1Q86T 5A8KA 2NZ4A 1Z2ZA 1B7YB 2VG7B 1HNIA 4Y65A 5MAOA 1SJRA 2HBZB 3VAJA 2DGWA 1FRXA 5CQGA 5GVQA 1HQ2A 3KUGA 4H4MB 3W8GA 3PY8A 1FCAA 3DLEB 2IFXA 3IAM9 4ID8A 4WXWA 5L8RC 3PV8A 3DRPB 3BN4A 3PEHA 4KKOB 1R8AA 5D78A 1UZHA 3A3NB 4QR0A 3T1AA 5A6PA 3EJMA 3N6NA 2RKIA 2JHEA 2M5YA 3CJ5A 2DH8A 2IRUA 2HHSA 1FRJA 2GVZA 2ALYB 3M8YA 2J0XA 5CH7B 2LDIA 1S4FA 4NLYA 2QRRA 4LF7J 4B3MF 4S0MA 5ETSA 5F8HA 5BR8J 1CS4B 4MFBB 1RKJA 1HBNA 4FF2A 1NXIA 2IJNA 4EEYA 3T1HF 2M8DB 2HBQB 2MQLA 2VQEJ 4FXDA 4CCHA 1R43A 2NR0A 1TAUA 5KFDA 3V6DA 1YJWS 2VPZB 1HA1A 2HIYA 2LQ5A 1QSSA 2IAJB 2WVCA 3R5AA 3ADAC 1FD8A 3HO1A 4RW9B 4DUYJ 2ZNYA 3NMAA 4EGLA 1HNIB 3HSGA 2O5DA 4F2SA 4JV0A 4JI6F 4AQYF 4GKKF 1VQSA 3D2WA 1B4SA 2CQDA 4ENOA 5KFCA 3SSQA 3PXGa 1VGYA 1MROB 1ZM9A 5EDWA 4AL6A 3ISZA 4AQYJ 4JI6J 1FJ7A 1YLXA 2F7VA 4LSNA 1U0SA 5T14A 2W4PA 3ZZUA 4F04B 2YWEA 5L39A 1XNQF 1NPRA 2PMHA 3IBCB 3VGSA 1HQUA 1W2IA 3N28A 1NSQA 3QJLA 2ZH7A 2RHSB 5KFYA 3PX0A 1RT2A 2ZVSA 2XNRA 4ZP6A 4DSJA 4FDFA 4C8KA 4PZVA 4ANDA 2C2ZB 1N32J 1WEXA 2D1CA 3IR7B 5B7WA 1RHMB 2ZOMA 3QIPA 4LF2A 3TUIC 3S6EA 5C25B 2UVUA 3NOCA 4FP9A 3C6UA 4DQRA 3TJ8A 4K4UA 1DARA 4UW2A 2EW9A 1TK8A 3I31A 2DR9A 1NRKA 4X4OA 4IG3B 2GC8A 2QL9B 2AMCB 2QYCA 4RW7A 1S9FA 1KQGB 2OPQA 3BGFA 1U1LA 2MHEA 3MZIA 3CGIA 3MAAA 3TR5A 4RU9A 1S6QB 1HHSA 2GQQA 3ENAA 1V9OA 4RJVA 5KT2A 3EGVA 3ENVA 3M1VB 3K0JA 4NLUA 2YNGB 2V69A 2M4MA 3JSBA 5M2UA 1HMVB 3QGIA 1JLGB 3MEGB 2HZAA 2YPYA 4ECTA 5HQ8A 1T94A 1Q8KA 2B3TB 1X4HA 4DMZA 3BPSP 5DJBA 4KV8A 4DV5F 2DGOA 1YJTA 5IC6B 3SFGA 3QPIA 2IVFB 2VG5A 1GFWB 1TL1B 4NPOA 1YRUA 2HGMA 4USKA 3D4JA 3W8PA 3ZO7A 2VF3A 2W4CA 3W2VA 4E98A 1UVNA 3THPA 5F9NA 1FWLA 2SXLA 3HSDA 2FB0A 1TTHB 2RDJA 2X1FA 4C9DA 1FRMA 2HVIA 2XHWA 2KFZA 1KQFB 3PRBA 3G4SS 1KC8T 1S49A 3IRXA 2DGVA 3I32A 3T6JA 4EWTA 2VG7A 3OHBA 2W9AA 4ECXA 1A9NB 3D9BA 1WDTA 4IFYB 4N5SA 1YIJS 1M90T 1RAIB 3V4IA 2HWTA 4LF9F 1IKWB 1T9VA 1VJQA 2DY1A 2GZOA 1LWEB 1VS3A 3DRYA 4C3MA 3RB4A 1HR0F 3SZ2A 1H38A 3GIKA 4J9MA 3HHLA 5KTQA 4E8UA 4DV0F 1SL2A 3H25A 1R0AB 3ZZRA 4MH8A 3DRRB 4QW8A 2RUGA 1RKIA 2DIVA 1RT3B 3A4TA 3GTYX 4QIFA 2Z2YB 3ZTSA 2E9ZA 1TVRB 2WVFA 4YY3J 1KONA 5KFPA 2RJZA 1TL7B 1RZMA 3GU0A 4I2PB 1OPZA 2BOPA 4DQIA 3OL7A 1FWPA 1RAEB 3MM8A 4Y00A 4DFJA 1FA0A 2MKYA 2AZ3A 3M32B 4FS2A 3J7ZT 2X7IA 1T11A 3OTEA 1HWJA 1KOHA 1S9EA 2UV8A 3QIDA 1WF0A 5F8IA 1VDHA 2NLWA 2R4FA 4ECUA 1Y5NB 2AJFE 2HQDA 3G87A 3K17A 4KFBB 2MQPA 5HAOA 3K5PA 3PKYA 2XC9A 1JLAB 2H4WB 1HI8A 4AD6A 4F3OA 2GHWA 2HK2A 5D15A 4PWDA 3I0SB 1FDNA 3CUNA 1N34F 3GV7B 3MM5A 1UFKA 5AE3A 1HI0P 1Q78A 1IKVB 2PE8A 7FDRA 1RP5A 4ETXA 1N34J 2CADA 3NNCA 3U7JA 1N5YA 3CNQP 2FLPA 5DGAA 4DUTA 5C5JA 1S57A 5B09A 1I5OB 1UJ6A 3JSMB 2VOOA 1WOSA 2IM3A 4ZHRB 3MR2A 3NWRA 5DZ7A 2ZHBA 2CFXA 3MECA 5DS7A 2ZHAA 4C11B 3TP2A 2MQOA 4DR5F 2YBVA 2VICA 4U9RA 1TUWA 1SKSA 2PDAA 1JJ2R 4KHPF 1PBAA 4CYUA 3MUTP 2R8JA 5FJ4A 1IKXA 1VQOS 3CJSA 1UEVA 3QLHA 4NLOA 3H7HB 1SIWB 1VQPS 1U1PA 4JI8J 4LF1A 4ZVFA 1X60A 2JZ5A 3QWPA 1F1BB 2JWNA 4DFPA 1J5EJ 4UOCA 4M5MA 4CT8A 5BXIA 3J81U 4MIBA 2W9BA 4NA1A 4ZPCA 4O3PA 4DL2A 3BGUA 2HQGA 3T3FA 2UXCF 3H5XA 2R8IA 2IM0A 2K3KA 2XTJP 5ETVA 2E5GA 5HP1A 3GFYA 3D28A 5H1SV 4O3SA 4GVLA 2XMMA 3MXHP 1SL0A 5KFIA 4N76A 2UXCJ 1NUEA 1NJIT 2V2KA 4DV7F 2DKOB 3LGHA 4YDXA 3QMQA 5CYQB 2E5JA 1IJEB 2AEMA 2KT3A 4WFZA 1WI6A 3ZTQA 3HMJG 3LP2B 2R2UA 2NXNA 3AHPA 1MG7A 2JLEA 2WSFC 3M2VA 4QIVA 3TJAA 1RBLA 1H74A 1WUUA 3QBCA 4WWSA 3TX0A 3VWSA 4DOZA 5GAEI 4LBHA 3M8RA 3RRKA 3I9V9 1RWMB 3UO0A 4WTOB 3NKYA 1S9GB 2X51A 2CPJA 4G1IA 3QT8A 1TL3B 2VBWA 4ZCLA 5CA5A 4Q44A 4B9NA 2J0WA 4ED6A 3CCUS 2FQQB 3WX8A 5IXUA 1WC1A 4OV6A 1VBYA 2XZTB 3PW7A 1GXLA 4NI2A 5G0RA 2D9PA 4IFVA 5IC4B 1S72S 4LF8J 3H90A 2GJIA 5K20B 3CMAS 5KFTA 3PX6A 1TQLA 2MSSA 2EVZA 2ZUGA 3ZZ0A 4LF4J 2HS0A 2RILA 2DR8A 4M5DA 1TV6B 2YQ1A 2G0IA 3M9NB 5J1EA 3I4HX 1TKTB 4RLEA 4Q43A 1YQHA 4DR2F 1S12A 1VQNS 2MLZA 4ED5A 3NMRA 1BQMA 2APOA 2MXYA 3D0GE 3OFGA 1HI1A 1RADB 4I69A 4EUVA 2C28A 4NYZA 2GQCA 4PPZA 2R8HA 3QT5A 4HH1A 1HIYA 1NEEA 3GONA 5KFOA 2HEKA 2KI2A 4DR6F 1Q4RA 2MLYA 3DDNA 2AW0A 2OEJA 3IBFB 5KG3A 2MKIA 1FKPA 4FN5A 3KJVA 1N56A 2UXDJ 2DEIA 2DGSA 2R8KA 1YX2A 2EG1A 3PDNA 4OZ5A 5LSRA 4EBCA 1TFWA 2FYXA 2CRLA 2F5GA 3M8QA 3FCVA 1VBXA 3E2EA 2MZJA 4NI2B 5LJ3Y 4EBDA 2V8GA 2QSFA 1KKHA 3NS5A 1R27B 2QC3A 5A8KB 2J6TA 2IMWP 2CZ4A 4RNMA 2BJEA 4UOFA 1JNZB 2BV3A 5B0DA 1QSYA 5B0FA 2XS5A 3E01B 2CDRB 2POKA 2MJNA 3H59A 2VA3A 1FX4A 2CWXA 1JLEA 5D4LA 3FBEA 3DC2A 2XSJB 4F67A 2C3YA 3UDLA 2D3ZA 5HJXA 1GX6A 1WF1A 2NS1B 1GX5A 3JQMA 2VFTA 3LOUA 1WTBA 1GTEA 2YKMB 2W2NP 3IWXA 3L4BC 3NXZA 2RU3A 3KJFB 3MMBA 3A3PB 2FJEB 3UD3P 4R5PB 5K5MA 4IG0B 2PT0A 4I67A 2ZHOA 4OZ2A 4NLXA 2ZOGA 2HKEA 2KJVA 3M2UB 3D67A 2VH7A 1X0FA 2C3OA 4WFAQ 5FLXY 4K4SA 1NBEB 1YZ6A 2AD9A 2H48B 3GQCA 4K2XA 1HNVB 5T41A 4DUZJ 5IT9U 1SIZA 4FYXB 3TOQA 2XYHB 4OJ3A 2IAJA 4DG1B 1C0UA 1B7FA 2J8AA 3POTB 2Y8WA 4G65A 1S7IA 5KFRA 1K8AT 2Z0GA 1KQSR 4OLPA 4QPTA 3J7YU 2FLLA 3HM9A 1XNQJ 4IOAQ 4QZVB 4NASA 4ZJOA 5CXTA 1LWFA 1VQ6S 2ZZMA 4K4VA 4TN2A 1VIOA 3HZEA 3DXSX 1S1XA 2YWGA 4P2SA 3R1HA 2R9LA 1U1OA 1SJQA 5CCLA 4Z2XA 5J2QA 5KFNA 1JLQA 1NHUA 4X4UA 3Q89A 1VBZA 4OZ0A 2R7XA 4RBTA 2EFGA 1GMVA 3M6WA 2IM1A 1X8DA 3RRHA 4U8VA 1KQKA 4DL0C 5EGYA 3PW0A 1N36F 1FE4A 1IVZA 3QQCD 1H2UX 2FVSA 3MECB 2ZUAA 3MTKA 1MN7A 2A3JA 1JLBB 2FHJD 1LEOA 1IXKA 8ATCB 1MLAA 4CZCA 4DSFA 1VQ5S 2B8QA 4QJVA 1X4AA 2QMXA 4WP9A 4ZVOB 1N5YB 3GIRA 3OLAA 5AXLA 3QT7A 4LIRA 2OTLS 3AD7C 1V3ZA 1YRTA 1YZ7A 4IH6A 5ETQA 5I3UB 5ITHA 2BJ8A 2F65A 3I4PA 5HLFB 2R8GA 3LALA 1Q79A 5IV4A 3H4BA 2HVEA 5CD4A 1MWQA 3MPVA 3R7SB 2QTWA 1RWWB 1TP7A 4AT1B 2BA9A 3RTVA 1AUDA 2UUWA 2KHDA 2G9OA 4BCAA 1VLYA 2N3LA 4KO0A 5EHHA 4LR8A 5DLFA 5IT0A 3H98A 3M9MB 1PC4A 1SQFA 4LFCF 1RI7A 1RT1A 3HP6A 2M70A 4KIAA 4PXCA 4HHUA 3MFHA 1FXDA 2M52A 2LDYA 2QLXA 2RDDA 2XG8A 3KJNB 2W1BA 4DV4F 1EQ0A 4OLOA 2YNIB 2N4DA 2VPYB 3Q8YA 4KO0B 2NYIA 2C3UA 3QRQA 5A2QU 2XI3A 1RLDA 3BR9A 1Q0NA 3G86A 4RNOA 2W25A 3CJ2A 2BVZA 4DV1J 4I56A 4ZVGA 3P8BB 4DX6A 4JI3J 2RE1A 4NCAA 4K0KF 2XO6A 3DU6A 1RT7B 2WOMB 4PPDA 4WZMA 1RTDA 2R7VA 4O3QA 1FTCA 3J7YI 4UOGA 4DS4A 1Y5LB 4CO4A 4MK8A 2V9WA 2G13A 5J2MA 2DIUA 3MGJA 4IRCA 4B3RF 3CF5Q 1KSPA 2NQPA 3DU5A 1RTIA 2W24A 3BR8A 2DEJA 1U09A 1KHWA 3E01A 4NL5A 1XMOJ 3KNGA 2LQ9A 3W64A 1XERA 3NBPB 3OW2R 1T9TA 1CQNA 4WBFA 5D77A 4MYTA 1T9YA 1VCTA 4HACB 2VC0A 2Y0SD 1H73A 1LK7A 5T7LB 3Q86A 4A8KA 2UP1A 4BWJA 3KOAA 2ZE2A 4NCGB 4QPXA 2JLGA 2V2VA 1RHQB 2EI5A 4HEA9 3C14A 4FNHA 4OYIA 3W63A 3J81Y 1N8RT 1QSLA 4RNNA 2O3DA 5HK4A 1Y7PA 2E1RA 1MWZA 2ZZTA 2VPXB 3Q8VA 2DNPA 4FYWB 4NLWA 2JL9A 4OX8A 4N47A 3JYTA 4Q8EA 1N5VA 1FHTA 3HVWA 3V2UC 4DLEA 2YX7A 4Q2LA 4DZ6A 3BS9A 2VBYA 2LQJA 4FVCA 2G1DA 4JP8A 5C24B 4OZ1A 4ZVUB 3NCRA 2MQQA 2FHKA 3Q22A 2OTJS 1TZ0A 3A13A 4P73A 4DQPA 1FXLA 3BKFA 2LVWA 3DOMA 1F3VA 3NEKA 4TY9A 4USMA 5J2NA 2PMWA 4DV6F 1FESA 1QAIA 2FLOA 3F0NA 4CLYA 4HI2A 4NMLA 1XNRJ 4R5PA 4ZIWA 4OIXA 3OL6A 4NZ7A 4I2PA 2HNYB 2W9CB 3OSPA 1VQKS 5A8RA 3BQ2A 3I5CA 1YGYA 1XNRF 3HSZA 5A0YA 1EJ7L 1FD2A 1HQUB 3CCRS 2DHSA 1LWCA 1VISA 2P5VA 3BF4A 3ILIA 4RW6B 2OELA 4YS2A 3BH7B 3W5XA 4QWAA 3KHGA 1N6QA 4JI0J 5J1PA 4JV5J 1N48A 3OR2A 4B02A 4O23A 3O2IA 7FD1A 2OH2A 1Q8BA 3V4IB 1JXEA 4JI2J 3IWNC 5A0YB 3DLKA 4TQSA 1PYOB 4OX7A 4D3GA 1T0TV 2YVSA 2ZBIA 1RABB 2V50A 5JMNA 5JVGQ 4DR1F 2XY7A 4DN9A 1O0PA 3OVAA 3QGGA 5KFJA 4KC5A 2ZZNA 4U95A 1Z1ZA 3P45B 1WWHA 5GADI 1S6OA 1J5OA 4URSA 9ATCB 2HIQA 2WSEC 2I8EA 4I7FA 4LR9A 2KRBA 4XIUA 3KK2A 2A6OA 4F0KA 2O67A 2Y1LB 3QATA 1WOOA 1OY6A 3GFXA 2GO8A 2UVVA 1B99A 1VYAA 4ZMMA 1QTNB 1X4DA 1I1GA 1OSCA 2FC9A 2MZQA 2YWKA 4YDDB 2AV5A 3BO2A 4LQ3A 2B9XA 2P2CB 6AT1B 3B4DA 2BKOA 2ABYA 2DBBA 4FYDA 1SPBP 2E1PA 2ACYA 5E3AA 4P7TA 3SIPB 4B9UA 2HLTA 2G4BA 2MKKA 2FY8A 2RAQA 2OEMA 5B0BA 3FEYB 2OPRB 3NWGA 4YB5A 4WFBQ 1NB7A 1JKHA 1H72C 3T41A 5L1IA 1FXRA 4PG4A 2GFFA 2CQPA 3MCOA 2UUBF 1NJYA 2J5AA 1LK5A 3D6MB 2BDPA 1IJFB 2EFVA 3TA0A 1YWXA 2CWKA 4JI7F 4KR0B 3A8JA 2GCFA 2VU5A 1QUVA 3KJQB 3PRVA 4IQXA 1S0VA 1Q5VA 2RKIB 3IAS9 1R8CA 1OSDA 2QLFB 3HULA 5E0OA 3G71S 1S76D 1FNOA 2V68A 4QBUA 1SKUB 3IO1A 3BQ0A 2WBRA 2XULA 3DYAA 5IM0A 4BC7A 1NK5A 1X9SA 3F41A 1X4GA 2QX0A 4ZPAA 3EICA 2D3UA 5B0AA 1Q7YT 2K7KA 2MQ8A 2EBGA 1YTYA 3IR6B 1FVQA 4YEAA 1QAYA 4LFAJ 1KOOA 3R97A 2BQRA 4FF1A 1UWBB 2XNQA 2COLA 4H54A 5KG2A 1KFSA 4MJKA 4PKDB 3K58A 2FVPA 2YH0A 2DRDA 5KFQA 3FQLA 2KB2A 2CNLB 3B4MA 4X4QA 2XB2D 3UVJA 1SUQA 2CUYA 4BDPA 4LRAA 2IY5B 5E3RA 1FI4A 2XMTA 3CPWR 1X4CA 4UQGA 4J9OA 1VOMA 3HHEA 2XMKA 3D1HA 4XO0A 1G6BA 1R3NA 3W5ZA 4B3TF 4DI6A 1ROFA 2R7QA 1TL5A 3PJXA 4BS2A 2MSTA 3A12A 1KD1T 1CS4A 4MFBA 5A6WA 4YR0A 1FTRA 4UTGA 4RUAA 2QMWA 2N4CA 2MZ1A 2BANA 3N5BA 3UR0A 2VZ9A 4ECZA 3KMQA 3VZIA 3GYGA 4P52A 2DVIA 1DTTA 4CLPA 5LSLA 2Q3PA 5F0UA 1WTFA 3IG1A 3GIJA 1D9DA 1BWVA 3CE8A 4IDKA 4P9SA 3UN2A 4M5NA 3GCWP 4C0HA 2HVZA 2VBXA 3SFUA 1NK9A 2CQBA 1FNXH 4PUOB 4MIWA 1K44A 4RWWA 4QIGA 2HG4A 3T1YJ 1UZDA 3CTRA 3CC4S 1VR6A 2HNZB 4G1PA 1JLAA 3M6XA 4PXBA 5H9FJ 3P96A 4CO5A 3K59A 3G8TA 4ECSA 2JNJA 2MHNA 3CO0P 1SJ4P 2M2BA 2AX1A 2K1RA 4LRCA 2DB1A 1FFWB 3EMTA 4NE9C 2F63A 4RBVA 4RX6A 4DJBA 2OO4A 1J2VA 1U0HA 2ZDOA 1D9FA 2I0XA 1GEHA 3OQ2A 2RQMA 3C15A 3GG1A 3BKTA 3OD2A 3PCOB 5J2MB 1RAFB 3CD7A 2J9CA 4ZCMA 2V6AA 2N82B 5BYQA 5BR8F 4WCEQ 4N56A 1RTDB 2YTCA 1E6VA 1NSAA 5GAHU 2M88A 3DMJB 1KHVA 1QM9A 3DLHA 3GFHA 3T5LA 4DSIA 3W1YC 5KFUA 3HJVA 3C6TA 3EVMA 4F3QA 2CNOB 4DR3J 3NP5A 4UY85 2DO4A 3TZYA 3PM9A 2BXJA 2W4DA 5DQGA 4NLPA 3MM7A 2HHUA 3TEHB 1N33F 4CDIA 4I2QB 2PGCA 1CBKA 4FBUA 4XAKA 3OR2B 2E9TA 2CZ9A 4OYZA 3KLEB 4J9RA 3HX9A 3LAMA 3FK4A 4WIQA 3THTA 5DQHA 4IG0A 5LMUF 2UUAF 2VDHA 3NAIA 1FKOA 1WC3A 2JOQA 1HQEA 1CC7A 1WSVA 2QE5A 2MQMA 3I96A 3IFEA 4MAKA 1S6PB 4ZVEA 2C2RA 1M5VC 1DTQB 2PI5A 4TXSA 2KG0A 4DSKA 3DXBA 2UUAJ 3PJWA 2VASA 5CHCB 2PD1A 4IOCQ 5AJ3F 2Q6BA 3LUYA 3PO5A 2XWXA 5HL7Q 3FCWA 5AXNA 3TQ1A 2H54B 3KTQA 3QT6A 2C2MB 3FZBA 4L74A 1S59A 3WIUA 4C97A 3R5BA 3R5DA 1VRTB 2KKHA 3EYZA 4DV6J 2OEKA 4E0DA 1RT5B 4IQMA 3TA1A 3BSAA 2IDLA 2G2ZA 4C8OA 4LFCJ 4ZPBA 2HZVA 3FNNA 4KHPJ 1N54B 2OAUA 3NCPA 1CJUA 2R7UA 4WZQA 3QO9B 3ITHB 4PUOA 2XZDB 1MMDA 5JXSA 4HL9A 3F73A 4DL6A 2XM3A 2ADCA 4JI0F 1TK5A 2EC0A 1WJ9A 2YWHA 2FZKB 4M95A 1I3OB 4OHYA 4ATNA 3KG4A 4PYDA 3P49B 1IWAA 1N5QA 4G6VB 3Q2TC 1KFDA 3UNYA 5J2QB 2GMJA 3QGPA 3MMAA 5LSOA 1M1GA 1U2RA 1TKTA 3DNCA 1NM2A 1F0XA 1ZA2B 4K4WA 4HT7A 3PW5A 1PJ5A 1BWEA 2PFFB 1WACA 4DR1J 4Q0BA 2JC0A 3I0RA 3I6PA 1TKXB 5L9XA 1KVIA 1V5IB 2WOMA 2VC1A 2FZCB 4JOUA 3IS9B 5G4DA 2ATLA 2DPJA 1UKUA 6FD1A 4YR2A 5F8JA 2DGXA 2IM2A 4LRBA 1TFYA 2E7XA 2FY1A 3FKBA 3D1OA 3KLHB 2FJBB 4X66F 4DL5A 2XYPB 1UVLA 5J2PA 1RT6B 4C98A 1U47A 2AGOA 3C16A 4QR1A 5DO2A 2CPDA 3SDEB 5GMKa 4WU3A 1RYRA 3OBIA 3P5TL 4KGKA 1UWBA 2VIHA 4Y0FA 2W2OP 1N6QB 2LQBA 1MW7A 3MI7X 1X7VA 3ZZYA 3LP2A 3CJ8A 2IHR1 2FHMA 4DU7A 2C1EB 4EFAC 2XMVA 4DQQA 1F6TA 3US5A 1YJ9S 3Q8SB 1YI2S 2VA2A 4DL4A 5DDQC 5CZXA 2NUUG 3C2PA 3HI9A 3SQOP 1MN9A 2E5HA 4J90A 3HFZB 3RBZA 5DG8A 1QVFR 5HANA 4FXWA 3EDQB 4I6AA 3OUYB 4O3OA 1HD0A 1HKAA 4KGVB 5J2NB 2KFYA 3CCVS 1JK9B 2NXJA 2PA3A 3UE2A 2HHHJ 5HROB 1V6HA 2XLKA 2ALZA 3EGNA 3IGVA 4DPYA 3O5TB 3DRSA 2LECA 2HQIA 4B9MA 5IV3A 1NSKL 4V19X 3OPKA 1OQ6A 1RWXB 2XLJA 1BGXT 4P71A 4XDDA 1OIAA 4TVAB 4KTQA 4GVBA 2RQ4A 4NEZA 2LLZA 3BBBA 1BY9A 2AHOB 2C2NA 3C14B 3L7OA 1N4LA 2HWIA 2X3GA 3S7RA 2LEBA 2BEFA 4A48A 5DETA 3X1LB 1YJRA 4WTYA 4ZN3A 1N5TA 1HPZB 2BANB 1W25A 3WC0A 3MM9B 3MCSA 2A18A 3MOZA 4MKAA 2L48A 3M8WA 4TYAA 3CJKA 2B6AA 4HTIA 3EVWA 3SBMA 3I9ZA 1QDUB 2XYGB 3DOKA 4AE5A 1VC6A 4QQBA 1SB6A 3PX4A 4P2XA 2XGQA 3MM5B 3HSJA 2KT5A 5E3QA 1RT7A 4RUHA 4LMZA 3GJRB 3VVTA 1CC8A 1J5OB 3IN5A 1F2HA 1YK9A 4CO1A 2H5JB 1U24A 3BDPA 4FNIA 4E2FB 2MGZA 1HQEB 3EWGA 3OTBA 4QWDA 1B3TA 3KLGA 1IQTA 1RHUB 2XHCA 3QAUA 1HARA 4IKAA 2BKNA 3MEEA 5ETLA 5HVFA 1KBRA 5K8PA 1APSA 1UL3A 5HBMA 3TWZA 4N8OA 2DISA 2ZBPA 1EKRA 3PVXA 3GCXP 5C42B 2M3DA 2Z56B 4AL7A 1UW9A 1U8WA 2J76E 5KG4A 1VQ8S 3MMBB 5F8LA 3G96A 1M5OC 4JI7J 3EDRB 4DXLA 3KLGB 1S1VA 3R8YA 2R2TA 3C6TB 3KK3A 3KK3B 4LF5F 3C19A 1VIXA 4LVOP 3E8OA 4FPRA 5F8MA 1HNXF 1HYSB 3DHXA 1NH7A 2BABA 2B4UA 4WE1B 2HAIA 5F0WA 5C42A 8AT1B 1P6TA 1T95A 2H65B 4CP5A 3MCMA 1RWNB 2FDNA 4KRWA 3T1HJ 3VVUA 1SJ3P 1PILA 4ZP9A 3OVBA 1NMEB 4Y28C 1JB0C 2HQFA 4NLDA 2YXLA 1WHXA 2HRTA 2PEHA 5D0EA 2CVIA 3W9IA 5AXKA 4OI6A 3B6BA 2KHCA 3ICLA 1XBWA 2B7CB 4NLTA 1YITS 4C4WA 3G82A 4LQ9A 1FK9A 3GR0A 1G7CB 5K8OA 3H42A 3WBZA 1O5JA 3HVRA 3I82A 3OTCA 4DCPB 1AXQA 2OI2A 4A8QA 1WHWA 2FPHX 3WHIA 1ZETA 3L9ZA 3NY0A 3EX7B 2YWWA 5KFGA 1LKZA 2CKWA 3MDFA 5DGBA 1V3RA 4HLBA 1EQMA 4N77A 1N33J 3IM9A 3HDSA 3Q0AA 3MOJB 3VALA 1KWMA 2LCWA 1SKRA 2IYGA 3UN3A 2AZ1A 4RWXA 3LTOA 2IYIA 4TLRA 4JI1J 3FEXB 4B3TJ 2EG2A 2GMLA 2OKQA 1FDDA 4Q0BB 2ASYA 5LOQA 1S1XB 2OFGX 2OSRA 3AA8A 2Z30B 4AFFA 1PBUA 1FJCA 5B08A 3PHTA 1UPPA 5CD4H 2DNNA 3KK2B 4F0HA 4DLGA 3RZAA 4F02A 4FKYA 2AKWB 3HVAA 4TU7A 3ENQA 2NUHA 2OPQB 2OHDA 2CAJA 3MAAB 1MSWD 4MT1A 3S1TA 2DHHA 3NGTA 4ZS6A 2ASJA 2VPWB 2MZRA 4JI4F 4LREA 1R89A 1HNVA 2AEJA 3Q83A 3UD5A 2XGPA 4JV1A 4XTTA 2Z8QA 3NS7B 4PWUA 4DV4J 5KFKA 2A2CA 4NLGA 1OWXA 4V19J 1YJVA 3TEGA 1T3NA 4RW4B 2DH7A 2GNKA 2EK6A 1LFPA 1XK8A 1DBDA 1OO0B 3M2VB 4IH7A 2BOAA 1UFWA 2JLFA 5HQMA 4B3MJ 4Y34A 4WXOA 2IC3B 4WFNQ 4N41A 3DYAB 3HKWA 1RT4A 1RT4B 1R0BG 2RF2B 2X1GA 3JB9k 1VC0A 3BEGB 2GAHC 5GAHI 1DQAA 3SCKE 3U1LA 1SCJB 3DRXA 1FDAA 1X5OA 1TKXA 3DLJA 4C8NA 3JAMU 4DR7F 3NS6A 3TVYA 2VKZG 3DOMB 1T05B 2MLXA 1DAXA 3VGVA 2F4VF 2Y1IA 4F3MA 1I51B 5CZVA 3OLBA 3DI6B 1NU4A 1OJ4A 5JVHQ 2BJ1A 2GJ2A 3B54A 3J7Z5 4CH7A 1YJUA 2BR0A 4JV2A 4G1QB 3FJ2A 3IP0A 3ZZTA 2KG1A 1K73T 1U1RA 1HBMA 2XLIA 4X66J 2P6SA 4LR7A 1Y10A 1U6ZA 2FLNA 1IBMJ 2YKQA 1UAWA 1ZBTA 5F9LA 2F1FA 4PR6A 2IBKA 3GMGA 1BMQB 1D9AA 3T9NA 5CYJA 3W66A 3CXCR 3KLIB 2KT2A 4WK1A 2ZD1B 1HBMB 4CRJA 3CCQS 2FJVA 3OJUA 5KFWA 1FRLA 3MPYA 5M2PA 1PCAA 2OPPB 3TO8A 4D3HA 4F0MA 5DM7Q 3LPEA 2ZH5A 2M7SA 2HVDA 2CPXA 2CVEA 5J1EB 1X5SA 1HMVA 4CLZA 3H40A 3LW5C 1EKSA 1TUGB 2RD5C 3UDEA 4GC7A 2RQCA 3AQOA 3CJTA 1Q53A 1SH0A 2CQ1A 5HSPA 1KVKA 2P8IA 4DDFA 3OT9A 3VQTA 2HK3A 4G1QA 4KFBA 4NZ6A 3C3LA 1AFIA 4KE5A 2NREA 3EZ5A 2IVMA 3VCDA 5IT4A 3ZXWA 4J9KA 3LANA 5H9FK 4DL7A 4JI2F 3EZOA 1FFGB 3KLFB 2V2QA 1XMQF 1FO1A 4LUBA 1T9XA 2Z2MA 3DFEA 4DPXA 3G6XA 3EGWB 5L1KA 1LXNA 2ROPA 2WVBA 1HL6A 3JSYA 3ET6B 4PG5A 3SDEA 2DR7A 3A8KA 3G8SA 2DXEA 2GGPA 3RAXA 4RUCA 5LMNJ 4RW6A 5I4MA 1NHKL 2XMAA 4CWBA 1P1TA 2ZH2A 2CNNB 2RRNA 4G3IA 4Y3CA 3I5BA 4A8SA 2CQ2A 2HNYA 4RKUC 2W9CA 2VOPA 1W7WA 5LMNF 4OX9J 4OV1A 3FBBA 5MLCV 2QFJA 3D6TB 1K1QA 1NPKA 2XS7A 2DR6A 3HHLB 1ZPVA 1SI9A 1U02A 2DNRA 3SEOA 3BBFA 3C15B 4C8MA 2ZKTA 3HPOA 1HBOB 1U7LA 4NZ0A 1LOUA 2B43A 2GV1A 5D4PA 5KFFA 1VK3A 1GT8A 2BJDA 2CPYA 2Q79A 2QV6A 1NK8A 3JSRA 2AF6A 4ES1A 2W9BB 4LBIA 4TLQA 2WB1D 4CLSA 2RU9A 4AXIA 4F4YA 1WEYA 3DLGA 1FKPB 5RUBA 5EUHA 1U6FA 3GWCA 3TA2A 1KLMB 1ULRA 1VHIA 5ETPA 2VHGA 2HFZA 2HAFA 3FFIA 1JIHA 3KUHA 3J80U 4CIOA 4ED7A 1K47A 3E51A 4YY3F 1S77D 5AXMA 4HHJA 1R0CB 4M5KA 2KDOA 3L7PA 4LRFA 3FSYA 1ZM4A 1XMOF 2E5LJ 1GXUA 4WK3A 3ZTOA 3VQSA 3HD2A 3Q23A 1FVSA 1H7WA 1ICEB 4M5HA 4IO9Q 1UA1A 4HR2A 3R5CA 4PWDB 5C7PA 2KVIA 2YNGA 5KFHA 3BYPA 2D9OA 4WE1A 1HW8A 3AA9A 3M9OB 1NO8A 2IMOA 4Q8FA 2D41A 5HVGA 1NPPA 3L09A 2W2PP 3O6QA 1WKJA 2XBPA 2QG9B 2XMJA 2JSXA 3GIIA 3OXGA 1OYDA 2WK4A 2MZTA 4OYWA 2F8HA 4TY8A 4A46A 4QU6A 3L7UA 2OMOA 3D3BJ 2JFDA 2VDIA 3V5RA 4KHMA 1FWKA 2GIFA 2YNIA 2Q66A 3C6UB 1TL3A 1S9EB 1C0TA 1CJKA 8RUCA 4I2QA 4ZVTB 1UW4A 3H4DA 4ECQA 1AUSL 4NRUA 3BPDA 4KPCA 3BJYA 1Y0HA 1YG0A 4OYMA 3N01A 2FJDB 4YHHF 3D66A 4B9VA 1I94F 1X5PA 2BMBA 2QO3A 3NAHA 2ZFHA 4ZJQA 4JYAF 2KZMA 4IO1A 4P75A 1PO6A 4P7VA 1VHFA 2LP4A 3R6GB 4DV3F 2FVRA 2Y9HA 4KAIA 4LSNB 4W92B 4JI1F 1FDBA 2DGQA 3CJQA 4DR6J 5HN0A 4N7TA 2GIRA 1Q1KA 3AXKA 3EPIA 3RBEA 2DGUA 3Q8RB 4QYZK 1TKZA 2D74B 1DURA 4KGXB 4UQTA 5A76A 3QSYB 4WU2A 5L1LA 2BE2A 3FMBA 3I5AA 1NJZA 4M5JA 3HZGA 5A2QY 2E66A 4NMXA 1NDCA 1VLOA 1QJHA 1RWUA 4CYUB 1DJ0A 1IR2A 3KJVB 1HNZF 5DQIA 4DV7J 3W2VB 3V6DB 5A8WB 3D7SB 4UZBA 1PAEX 3HFVA 3M6UA 4LF7F 2RRBA 4EO6A 3HFKA 2D3O1 2YNHA 4CLWA 2QLBB 3H5UA 1LNQA 4ITSA 4KV8B 4EMDA 4TU9A 3CCES 1R31A 4W4MA 3KLIA 1FJEB 2EPIA 3M7VA 2AJ4A 3W61A 3SMZA 1VQ4S 2Y3YA 2L9DA 1CLFA 2HQCA 4GO7X 1LWFB 1TV6A 3NG8A 3QSIA 3OL8A 3GP9A 2ILZA 1B0PA 1F3FA 1HWKA 2PEBA 3D0HE 5THWA 2AWZA 2NZCA 1HLWA 2B5JB 3AXMA 5E33A 1R8PA 1A7GE 1KS2A 1RA6A 1AROP 2Z57B 3CIZA 1C0UB 2YX1A 3GZ7A 3K89A 3VR1A 5DM6Q 3CCSS 5DDOC 2QL5B 1FX2A 2F4VJ 3KDNA 5LMUJ 5DG7A 1JMTA 3M2UA 2B9WA 1JQGA 4UF4A 1WHYA 1U2CA 3MPWA 4P74A 3VAFA 5HMWA 3DN9A 3P6YC 1U26A 2VKRA 3B82A 2V8DA 2V67A 9RUBA 1NAQA 4C8YA 4X4RA 3ZZPA 1RTZA 5AJ3J 2R7WA 2DR5A 3AJDA 2R2SA 4AL5A 3PNIA 1TVRA 2V2ZA 4HT5A 5E2QA 2RS2A 4KH0B 1ZYQA 3ISND 1T03B 2F8MA 4HKQA 2FIUA 1JLEB 1HFEL 4NEYA 1FKOB 3GILA 5HMZA 3KNAA 2CJQA 3VAMA 4ERDA 2IRYA 4F8RA 1UEUA 2OMLA 1XR5A 1Y3JA 4C8LA 2B7BB 3PYFA 3LF0A 4OI4A 3W62A 5LJ5Y 2WZ1A 1LFWA 2AQ4A 2VG6B 1C4CA 4RNFA 1TKDA 1SH2A 4JI4J 2MKHA 3R7NB 4U6PA 2BJ9A 2EEYA 2BX6A 1JKHB 2Z2ZA 3ETMA 4NOHA 4ZLLA 1CG2A 2CJYB 1UETA 1JJHA 1WSRA 2BRKA 3IS9A 3WQPA 1NJWA 4CLUA 3MEDB 4B3OA 5IQ6A 1RUSA 2G0CA 2O66A 3M8ZA 1HBNB 4X4TA 1ZTWA 1M0SA 3LP1B 4FF3A 4QCLA 4W90B 1SC4B 1RGVA 1ZPWX 3CDUA 2RHQB 2H3EB 3QFWA 4PABA 4ZP8A 4FXVA 2AJQA 4TU8A 3CCLS 5KFLA 2YX4A 1CJVA 1CJVB 1RWVB 3H2VE 4WYWA 3G8QA 2HMIA 3ZTPA 5EN1A 2LXFA 2MJUA 1NK0A 3BGRB 5IS2A 1K1SA 2E1MC 1KLMA 2ZC4A 3I0SA 4LVNP 1Q8IA 4QR2A 1RAHB 1ZA1B 2V94A 3HLUA 4H4OA 4KKOA 3H2LA 3MMJA 3QGHA 3A8IA 5SUHA 3T19A 3PR5B 4J9SA 4LF9J 2F9JA 1G4CA 4UT4A 4WKRA 3KHRA 4MKYA 3UPFA 1HHTP 2DPIA 1S10A 3FRZA 1S9GA 4ZVQB 2ZWPA 2HWHA 2UVWA 1JLFB 1QLNA 4HH0A 2YWFA 4OYXA 1J27A 3PIPQ 2I5JA 1LWCB 3TAPA 2W7PA 4AXJA 3ULHA 4IOBA 3DGPA 3LGMA 1S79A 2B51A 1P27B 4HHHA 3SQGB 1R8BA 5GAGI 4RZRA 1Q16B 3ZZOA 2UVRA 2HBRB 4LFBF 3ZFVA 1IR0A 3IM8A 3OR1B 2YKPA 4O4GA 1SXLA 4O44B 1UVKA 3PG9A 4ZA1A 5KG6A 1RDRA 4ER8A 1WELA 2ZC3A
chains in the Genus database with same CATH topology
1W2BR 2J6UA 2HHHF 3CD6S 5IQQA 1LXJA 2K2PA 5C24A 1URNA 1FEHA 4WIIA 2A2DA 1B0TA 3BN7A 4DFKA 3V81B 3UNGC 4Y2KA 3IRXB 3K5MA 3SCIE 1S97A 1GH8A 3WZ0A 1E6VB 3NL0A 4OJGA 5I42B 2J6SA 3OFFA 2VV5A 2JEGA 1DRZA 2LEPA 3FDSA 3KHLA 4ED8A 3D1QA 1KRPA 3DOKB 4FZVA 1S7HA 4R25A 3UCGA 1D1UA 1IUJA 3ETOA 2PC6A 3O1LA 5KFVA 3V4MA 3K5NA 3CULA 4C0OC 2GX8A 3M2RB 4B9LA 2HNZA 3FQKA 2DNYA 1S1UA 1XMBA 1FRIA 2CJBA 5M2RA 2CJKA 4OI0A 3SV3A 4KB7A 2W7AA 3VTIA 5A8WA 3P3DA 3M1VA 4GO5X 2OFHX 1HBUB 4PG6A 1FK9B 4DV1F 1DTTB 2UZAA 3CMES 3MMCB 4Y2MA 3NLCA 3BREA 5E7OB 2RNEA 2Y1JA 2VG6A 3MEKA 1MNEA 4C2MA 5BYSA 3OTDA 4Y2CA 3U02A 5CCMA 3U1NA 2VONA 4C3KA 3BQ1A 1UVMA 1QE1B 2VFUA 1L5UA 3M32A 1IBMF 4X64F 2BM0A 4A8OA 2L9WA 4B08A 2HFOA 3KYLA 2V4RA 4IH5A 2Z2LA 3UFCX 1HYSA 2DCLA 3HF5A 1HWLA 2E5LF 2AYMA 1RT3A 1AW0A 2C2EA 2FJAB 5AE1A 3OR1A 4TKTA 2HHWA 4F4XA 1SL1A 1S1VB 5EX3A 4IRKA 3CJ3A 3DLKB 4RBUA 2XSJA 3EXCX 4JBCA 2BZ2A 1LWEA 1H7XA 5KT6A 3IC1A 2J7KA 2HS3A 1S1TB 2IJFA 3FGVA 3IWLA 3LP0A 5AE2A 5J2PB 4QWEA 3KLFA 2C22A 1TK0A 4KPYA 3FZ2A 2JRSA 4YB7A 4OZJA 2WONB 2YKNB 2CPHA 2JEFA 1DHMA 3EXYA 4LF6F 2L08A 4ICLB 3CC2S 4RW8B 1OQ3A 1VK8A 4Y2IA 3SSSA 3TW0A 3MD1A 4OFZA 5LXYA 1YVFA 4K50A 4K5RA 1NHVA 4B9SA 2ZD1A 2ZM6F 2F9DA 2HMIB 4ILMA 1KEKA 4DF8A 3AJ2A 2CQCA 2JEJA 4BBYA 1WD6A 2A1BA 4ICLA 2OPRA 4DOZA 1YRXA 4QIWD 1MMNA 3CSKA 4UUXA 4F67A 3P6YC 4DEZA 3M8PA 1CSJA 1H0HB 3DRPA 3N0VA 4YB1P 3BZQA 1F5AA 1EP4A 1RK8A 5I3PA 5EWEA 3JTOA 5E3PA 5DG9A 3FVYA 2R7RA 3DI6A 4F2RA 2M0GB 1U1KA 1SC6A 1F2GA 5D3GA 3RR7A 2CIMA 5D4OA 5KFAA 4U67Q 2ASDA 4B3SF 1MU2A 3AY0A 4OX6A 2N3OA 4ECVA 4X84A 1C1BB 2VFSA 4DR4F 5EWGA 2HNDB 4CTAA 2IA6A 2IBOA 2UUTA 1BQXA 3ZZZA 2IC3A 5GADU 1T02A 1RTJB 2ZH1A 3E3XA 1Y9OA 2QLWA 4ZPVR 2DNOA 2CQ0A 2RH3A 2XCAA 4ID5B 1MROA 1SJFA 2CG4A 3T5KA 3RW7A 3NRBA 2WRMA 1HW9A 3DCAA 4URQU 4PQAA 2WSCC 3HHDA 1FE0A 5JJBA 3GV5B 4DUZF 3CJ0A 4OI2A 5EX0A 4C3LA 5DDRC 2BW2A 3MTJA 2E9RX 3MWBA 4NYPA 2CZVC 3A1YG 4IR9A 1CQMA 2B6AB 1VC5A 4WF9Q 2WCXA 3KHHA 1U1QA 3MMAB 5T7LA 1ZZNA 4A4JA 2GIQA 2J9DE 1MMLA 4TQRA 3AAWB 3MD3A 3QWUA 4KSEB 1N0UA 4NWBA 4PXDA 4WFXA 1S99A 3CDEA 3LWMA 1VRUA 4PQUA 1RTIB 3JYTB 3H5SA 4M5DB 2DITA 3TUZC 3UWTA 3NNAA 3WC2A 1URRA 1M5SA 2CJ9A 2ZNZA 2W8LA 1UJ4A 3JTPA 5DRKA 2Q43A 4XDCA 4CO3A 3CWJA 3ISNC 2UV8G 2FD2A 1X4FA 4CNZA 3V81A 4H4KC 4CT9A 1O8BA 3OV7A 3W7BA 3SSRA 2R7OA 3JTNA 3NCQA 2RVJA 4F4ZA 1IQZA 1RT1B 1ZM2A 1AFJA 1GAOA 1X5TA 3CD5A 5K14A 3J7A1 1JNRB 4NXNF 2DNQA 2MB0B 1MWYA 5L9NA 1IBKF 5IWAF 1NK6A 2HZCA 4OZNA 3RBDA 4OHXA 2Z4PA 4X2BA 1IKYB 1SV5B 4TYBA 2CDQA 3CEDA 2AYGA 2MKJA 1RTHB 4EU0A 1JLCB 2NSBA 2GGPB 1D3WA 2KYXA 4LSLB 3GB0A 4OHZA 3D54A 1QAXA 2DNKA 3N4WA 3K8WA 1IM4A 3M4XA 5LT5A 1NJXA 2M9KA 2WW8A 3FSXA 2E29A 2YNFB 2EWHA 2PA8D 5EWFA 4OI3A 5E5NA 2YH1A 4LIWA 5SZTA 2YKMA 4JI5F 1QUPA 2KU7A 1ZAWA 5B0EA 1U8SA 2FGCA 1ZAXA 4C11A 2FHOB 2QA4S 1NKEA 2A10A 1J5EF 2YY3A 3CCJS 5CYMB 2OIHA 2DRBA 1T7PA 4ETZA 5D3GB 1HPZA 3CCZA 4B3OB 3RB3A 2YKOA 3CJKB 5KFXA 3R1LA 1JLQB 1IKVA 3LQVA 2RB7A 4KQZA 4QIEA 5JUMA 5KFSA 2K8GA 2KN4A 4Q7AA 3MEGA 4A47A 1JWWA 4CQ1A 3TUJC 3MEDA 2GHPA 1XWLA 1RYSA 4DFMA 3K7RA 4U7CA 1VQ9S 2XI2A 4K4XA 3PKMA 1TL1A 3DLGB 1JJ4A 1Q81T 3DRSB 2NPFA 3OL9A 4F4KA 3I56S 4Q45A 3IR5B 3TNVA 5KT4A 1HBOA 2O01C 1SBRA 3T6BA 5U47A 2BUNA 2MZSA 3CCWA 2EKYA 1VJWA 2OPSB 5L38A 2XY5A 2B56A 2AU0A 4O0IA 4LF8F 1QTMA 3OUYA 3M30A 4DWIA 2AYEA 1M5KC 4QYRA 2AGQA 5KAKA 4PG7A 4NCBA 2RF2A 3U1MA 1VMBA 1LW2A 4I6YA 3GV8B 3C8YA 2J9EA 3MR3A 1E6YA 2F40A 3SQGA 5HMXA 4CO2A 2QT7A 4RW7B 2EK1A 4DR6F 2CPFA 4P6QA 3ONQA 2ZH3A 1KNZA 1P1LA 3HVTA 2KXNB 2PO4A 3C46A 2HRUA 2E7WA 2FVCA 3ENWA 3MM6A 4Q2MA 4DSEA 5LXRA 2BQ3A 3UQSA 4KBIA 1S6UA 3TAMA 3D0IE 2XMUA 1E6YB 3GR1A 3JAMY 2RS8A 1VFJA 2QIFA 2XMWA 3CB4A 4F25A 4ELUA 2LMIA 1CEZA 3Q8QB 1GQEA 3B78A 2DD8S 4I6WA 5CYQA 1IBLF 3BDEA 2QSWA 4XPCA 5FDLB 4OI1A 4J9QA 4C8ZA 2VODA 2ADBA 3V6KA 1GNKA 4MTPA 3B8HA 3G6ES 3M30B 1NZAA 3LAKA 4M8LA 1UFLA 5HP1B 1QE1A 1Q7LB 2YKAA 4YB6A 3TAQA 4J9PA 4MYUA 3MM9A 1K0VA 4LJMA 3LH2S 2R7SA 1VI7A 2DNMA 3IRWP 4RW9A 2XO7A 3H5YA 1JX4A 4DQSA 2CPEA 2GO9A 3O3LA 4X62F 2UUCF 2HHVA 1BD6A 1HD1A 2RRAA 2LXUA 3SYZA 1N5SA 2Q1LA 3QYYA 2O1PA 4LT6A 1S0MA 2KM8C 1ZAVA 4ECWA 3H20A 1WHVA 2Y1RI 1QY7A 2V5HG 1U4BA 3CC7S 2MMYA 4H4MA 2J0SD 4DX8H 1PGZA 2Q6CA 2XZWA 2ZBCA 4PRFA 1KN6A 4K5SA 3I55S 1BQMB 2YNHB 1TKZB 2I9SA 2PSZA 4U7UK 3K2YA 4A8XA 4JUZA 2CQ3A 4MIAA 2ZH4A 2MKSA 2DHGA 4FS1A 3PEJA 4X65F 1XR6A 1T03A 2JFKA 4MK9A 2BYCA 1HWIA 4LFAF 4Q5VA 1S6PA 1XC9A 4AUKA 1C1CB 5KFMA 4ED0A 3VF0B 1RA7A 4EYHB 2GW8A 3KLEA 1KVJA 2V9KA 2KTQA 4WKYA 3KKFA 1FJGF 4DV2F 4OL8A 1X4BA 3LO3A 6FDRA 3MF5A 3T5HA 2WB4A 3MM8B 1T8EA 2BRLA 3MM7B 2OSQA 1C1CA 3RR8A 1L3KA 2DNGA 3M05A 1IKYA 1SV5A 1RQ0A 2E5IA 1SH3A 1FF2A 2LKZA 2ROEA 1S1WB 4ES3A 4X4NA 2CPZA 5K8NA 4CO0A 1H3DA 2C3MA 5ADZA 2ZJPQ 3PZPA 1JLFA 1P8GA 1WEZA 3K8VA 4ZPWR 4ZLPA 3TYTA 2U2FA 5IT9Y 3UW1A 1C4AA 4QWBA 1UJ5A 2ZKUA 1ZOTA 4I68A 3PIOQ 2P6TA 1NK7A 5HI7A 3CIMA 4B9TA 2FC8A 4H4KA 3BO3A 1Q82T 4RU2A 3PFEA 3PW4A 3HHNB 1NK4A 1TL4A 2KRRA 3CJ4A 4MK7A 2RIJA 3PW2A 2RQKA 3NGKA 1S0NA 2JVRA 3H8YA 4ED3A 3S8SA 4A8WA 2UXBF 2ZOFA 3MR5A 4I64A 4I1TA 3T1YF 2VUGA 2AJ0A 3MURP 1FKAF 4ZVHA 1KR4A 1REVA 4ZP7A 2J7UA 4NYOA 2ZITA 5CYMA 3TX8A 3HXMA 1A6LA 4DR3F 3MR6A 4KHRA 4JI3F 1F5BA 3DOLB 3PFOA 2CQIA 4ZOSA 3MUMP 3RU0A 2W8KA 2PMZD 2BACA 4R8UB 4BWMA 1U25A 2C3PA 2RSQA 3OFHA 1G2EA 3DM2A 3TARA 4ID5A 4X4SA 2R7TA 5J1NA 4O3RA 2K7JA 4UUWA 1M1KT 3RW6A 4MKBA 2IRXA 2NSCA 3N5FA 3MM6B 2DRAA 1NKCA 3OTOF 1OS5A 1YSJA 2JVOA 2HQ3A 3CO9A 3FEZA 3HVTB 3OJSA 2ZJRQ 1XN9A 1VQYA 1UVIA 2BQUA 3OXFA 4O44A 2WHOA 3CDAA 3IXQA 5D8HB 2EFNA 3DM2B 2V4JB 1UA0A 2BM1A 3N6LA 4USHA 3SCLE 1YHQS 2ZH8A 2HNDA 5BYRA 4CTAB 5H9EJ 1UVJA 3KG0A 4PCQA 3BSNA 1HNWF 2EFPA 4XPEA 3GYNA 2QA1A 2V0NA 4DF4A 3W2WA 1L3SA 3RB6A 1IKWA 4KGMA 4ZK7M 3G6YA 1N32F 4ED1A 3F56A 4C7QA 3T9ZA 3G6VA 3THVA 1BQNA 1LV5A 3VZHA 4C0BA 3Q24A 1SQEA 5KFBA 3K57A 1C2PA 1UP1A 1V3SA 2D3OR 4USIA 2HS4A 3DHWC 2P9GA 1X9MA 1BQNB 3GYXB 2FUG9 2DJWA 2VL1A 3HKZD 4IG3A 1XTZA 2RT3A 2WBMA 3GSDA 5KOXA 4TNOA 4A8YA 3W2WB 3BSCA 2YKNA 4OX9F 5KT3A 5L1JA 3RAQA 2F3JA 3OXLA 1U1MA 4L72B 2HVHA 1NKBA 1QAJA 5B0CA 2ROGA 3J80Y 5E41A 4L3NA 4ECRA 1LW0B 2DHAA 1RAJA 2C42A 3KK1A 2LYVA 4EBEA 5B0GA 3LP0B 2JX2A 1T05A 1Y00A 3PO4A 2VB6A 1X4EA 4XK8C 3WDOA 1FRKA 1D8ZA 1DQ9A 1LW0A 1DQ8A 3KFWX 4LF4F 3MUVP 4ZPTR 3KK1B 3KLHA 2YQ3A 3I87A 2LA6A 4USJC 1RT6A 2B4VA 1N52B 1Y4ZB 2P9CA 4OJ1A 2HHXA 1R6YA 3U27A 2B5JA 2H9ZA 3HHKA 4M1KA 3AQPA 4NX9A 2M8HA 4K4TA 1WG4A 3UCZP 2ILYA 2HYIB 4QWCA 3VAHA 1M5HA 4Q0BB 4YP3A 1GTHA 5I3UA 2JC1A 4FVMA 2DNZA 3T5JA 4EZ6A 4L6V3 1H6KX 4A8FA 2E1CA 2OD4A 2MQNA 3R3TA 3HK2A 2CYYA 2OP5A 3QLHB 4OHVA 3M8QB 3SCJE 3LWLA 4JV5F 1HBUA 1S48A 1VQMS 5K8MA 4ILRA 2FGOA 2DNLA 3FRYA 2UXDF 3QO9A 3QZ7A 3MAQA 1U1NA 2J9DA 1Y3KA 4QU7A 1GXTA 3ITHA 3RRGA 4F26A 3DLEA 4DSLA 2FHJA 3EUNA 2GHVC 2XY6A 1RT5A 1Y5IB 3JSMA 2MY8A 5HMYA 2HGNA 2MDAA 5DDPC 4GKJF 2E44A 1VRTA 4DS5A 2B4PA 3NBPA 5LL6d 1FEEA 1YBAA 5F3TA 3IGNA 3FFIB 4I7FB 4HYKA 4Z37A 3CCTA 1WG1A 1ZZFA 3POTA 1P9QC 2GA7A 4URGA 3D5MA 4B17A 1DTQA 2BE2B 4ZKAA 4ERDA 5I3QA 2MPUA 1SUQB 1RISA 2HGLA 3FCHA 4CNYA 2I38A 5D6GA 3W3SA 3C66A 2AJ1A 5K9FA 1O51A 2V4JA 3FSIA 1S1TA 3VAGA 4OMFG 4JI8F 3TAMB 3PHEA 3KWMA 3EZUA 2PN6A 2XCPA 2JJ4D 4YFUA 1IN0A 3PACA 3CT9A 4ILLA 1BC6A 2ERRA 4O4GB 1FRHA 1RTJA 5KG5A 1N88A 2VFVA 2RDIA 2CQHA 1LW2B 3DMJA 1H2TZ 5IM0B 2LA4A 5K14B 4IUFA 4ZCIA 2MY7A 5KG7A 1X0PA 3TI0A 3UD4P 2HW3A 4N8NA 2W7OA 3K5LA 1G1XA 2X1AA 4GC6A 1L3UA 4R0EA 2FVQA 2NPIA 4R0JA 2VD3A 4YR3A 2F8EX 4ED2A 4J9NA 3AB4B 1F9FA 5HLFA 1LQ9A 1Q8LA 1D8YA 1QVGR 2L41A 2K1RB 4RNHA 3GFZA 4IRDA 1WNEA 3AJ1A 2CQGA 4QYZJ 1EP4B 2B0GA 5GAGU 2FJXA 2DO0A 1N0VC 2X1BA 4KJIA 3N79A 4PQUB 1K0TA 1K9MT 1U48A 3KLVA 2L9NA 4BHQA 4NCGA 1L3TA 4EO8A 4IDKB 1VRUB 4ALZA 1ZH5A 2VFRA 2VG5B 4WZQA 1UMJA 1BLUA 2E1AA 5HROA 2OPPA 4CH1A 2R2RA 2P9EA 1JLGA 3M6VA 1R8HA 3ZC4A 2WTFA 4WFYA 2EBEA 4UY8T 1VQ7S 3IBWA 3BSOA 4NA2A 3CCMS 4I4BA 4AYBD 3BO4A</