4OZJA

Glnk2 from haloferax mediterranei complexed with adp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
118
structure length
104
Chain Sequence
LPNDGGIKLVMAIIRPDKLADVKTALAEVGAPSLTVTNVSGRGSVDLHQKVKVECVVADTPAEDVADAIADAAHTGEKGDGKIFILPVENAIQVRTGKTGRDAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Nitrogen regulatory protein P-II
publication title The structure of a PII signaling protein from a halophilic archaeon reveals novel traits and high-salt adaptations.
pubmed doi rcsb
source organism Haloferax mediterranei
total genus 21
structure length 104
sequence length 118
ec nomenclature
pdb deposition date 2014-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ozjA00
4USHA 4C3MA 1NH8A 5L9NA 4RX6A 4YB7A 3TA0A 2ZOMA 1GNKA 4CO2A 2J9CA 3BZQA 4WK1A 1O5JA 2GW8A 3AHPA 4NYOA 4CO0A 4E98A 2XULA 2J9DE 2CZ4A 3TA1A 2ZFHA 3CE8A 1NZAA 3LF0A 4CNYA 5D4LA 2EG2A 1UKUA 4Y65A 2PIIA 4Y6IA 4CO4A 2J9DA 1VFJA 4WK3A 4CO1A 1V6HA 4OZJA 3X3UA 2NUUG 2J9EA 3OPKA 2O67A 5D4PA 2XZWA 1XK8A 2E66A 2NS1B 2JJ4D 2XBPA 3HLUA 5DRKA 3M05A 1Q1KA 4C3KA 2EG1A 4RWWA 5D4OA 3GSDA 1UFLA 1NAQA 3DFEA 1NH7A 1PILA 4C3LA 4D3GA 1UL3A 1V3SA 1HWUA 3NCQA 1VHFA 4CO5A 2VD3A 1V9OA 3O5TB 4RWXA 5D4NA 3O8WA 4NYPA 1KR4A 1J2VA 2NUHA 2Z0GA 3L7PA 4IYQA 4OZNA 4CO3A 1V3RA 5DS7A 1QY7A 1UMJA 3AA9A 4USJC 2XG8A 3NCRA 1O51A 4AFFA 2DCLA 4USIA 1H3DA 2RD5C 4OZLA 4ZK7M 3AH6A 4YB6A 3T9ZA 4D3HA 2V5HG 3TA2A 4YB5A 4CNZA 3MHYA 4RLEA 2GX8A 3NCPA 2GNKA 3AA8A 4R25A 1OSCA 3N5BA 1P1LA 2O66A
chains in the Genus database with same CATH superfamily
2CQPA 5A8WB 4NCGA 3TZYA 1FRHA 1SBRA 4I2PB 4QCLA 2VICA 5HBMB 4BLGA 3TOQA 2E44A 4EZ6A 2BE2A 4IQMA 2CJKA 3CT9A 3PX0A 4M95A 2B5JB 4TVAB 4DFPA 2QLBB 2FTRA 1LWCA 2DR9A 1GX5A 2OPQA 3PYGA 1N88A 1RGVA 3PCOB 1JLGB 1WORA 2EBEA 1S1UA 2I38A 5J2NA 1R0BG 4ER8A 4ES1A 2M3DA 1S6QA 2IVYA 1RWKB 2R2TA 1JLCA 3BGFA 1XNRJ 2HAFA 3CF5Q 1WHYA 1RU2A 1Y10A 4JV0A 4N76A 3OJSA 4JI1J 1HQUB 1UWBB 4RJVA 3ENVA 2WVBA 3IR7B 3IBWA 3FDSA 4NLXA 3NGTA 3QJJA 2BJ8A 4A8YA 2D9PA 3GFHA 2NXCA 1RT6A 3CC4S 3T5KA 2QLFB 1UCNA 3FCVA 4A8XA 2H5IB 3G82A 3FK4A 4J9RA 1A0OB 2J0WA 3PNIA 2OTLS 1TAUA 1LXJA 3EVOA 1FT8A 1PYSB 2JL9A 3D1OA 4FYVB 3ZZ0A 3Q8SB 2J6SA 2CPEA 4ZP6A 4TN2A 2UU9F 5KG4A 2HVIA 3HO1A 3RRGA 3GSDA 1SB6A 3QPIA 2DNOA 4MFBA 4DV0F 3MI7X 2B51A 3K89A 4RKUC 1EX8A 3QGIA 5I42A 2FUG9 3MR5A 2U2FA 1FERA 5CZVA 1FNMA 1UZHA 4ZP8A 1JLQA 1VK3A 4YR2A 5EHHA 1Z2ZA 4CLUA 4NLOA 2IY5B 4DSFA 2CVIA 4U7CA 1QTMA 4HYKA 1IKXA 1BE4A 4PKDB 1VOMA 1XTZA 1ZAVA 1RADB 4YY3J 2N82B 3ISND 4CP5A 4LF2A 3TZZA 3FNNA 4DX7A 2OH2A 1BMQB 3R2CJ 1T94A 3EE3A 4WFNQ 2UUAJ 4UUWA 4NLSA 1WI8A 3I5BA 2K7KA 4ES3A 2EG2A 3CCUS 3RW7A 4U7UK 3I87A 2MQOA 3R1LA 3PACA 4N47A 1K9MT 3M1VA 3MURP 2F8HA 3IG1B 4HACA 3ISZA 3QIPA 4OLPA 3PG9A 4F4XA 1XMQF 2EPIA 2YX4A 1S1WB 1JKHA 2G0IA 1H74A 3BN4A 2HBZB 4JI3J 1BGXT 5E3QA 2K2PA 2WB4A 1LW0B 3A4TA 5B0EA 3BO3A 4LRDA 1UVMA 2CDQA 1ZM9A 4IFVB 1VRUA 1EP4B 3T1YF 4L73A 1IJFB 1Q53A 1HMVA 5DO2A 4LF8J 3CSKA 3MHYA 3NBPB 5HK4A 4Y2CA 3UCGA 2E5IA 4NA3A 4ZIVA 2QE5A 3M9NB 4ZPTR 4ZVTB 1H7XA 4GVBA 4IKAA 1DURA 5HP1A 5CCLA 4KO0B 3TUIC 3HCXA 2B0GA 1XEZA 4I4BA 1X5OA 1FCAA 1Q8IA 1X31C 5AE3A 3UN2A 4LF1A 2ZE2B 4DG1B 2LXFA 2VJUA 3KK2A 3P4UB 4HI2A 1X0FA 1KFDA 2HVHA 1N33J 2AYGA 2B4PA 2BVZA 4K7QA 4B3MJ 1S10A 3OR2A 1JK9B 2VD3A 1TKXB 3FBEA 4C4WA 3MM8A 5C2CA 3CDAA 1HL6A 2IJNA 2ZBPA 2HEKA 5A8RA 2OHDA 3MM9B 1S72S 2XSJA 1J27A 1WJ9A 1ZAWA 3H90A 4ZPBA 3V5RA 1K47A 2V2KA 1N0UA 1M1KT 2DY9A 3DOMB 3FMWA 3HSZA 1FDAA 4CNZA 1HHQA 2DT9A 4CLSA 2BJ3A 5J2PA 3M2VA 2IM1A 4Y2IA 1KS2A 5KFVA 3MF5A 4R5PB 4IUFA 2FLLA 1GNKA 3NGKA 2YTCA 4ZJLA 3D1QA 1X8DA 5DZ6A 5C2GA 2DNQA 4DOZA 3W61A 2HWTA 4Y65A 1NDCA 1S4EA 5D4PA 4OYAA 1CQMA 3GR0A 2QFJA 3Q8VA 4Q43A 2UXCF 3VGVA 5CYMB 1H6KX 2RRAA 1HWUA 5MLCV 2E7XA 4IRDA 1V9OA 3KDNA 4WIIA 4NPOA 4XDDA 4RWXA 2W1BA 5J2QB 2IMOA 2J0SD 3TO8A 1TK0A 5EN1A 4DV3J 1QSYA 1FNXH 2OEKA 3Q89A 1SH2A 5T14A 4F0KA 3V4IB 1GMVA 4RNHA 4DPTA 3P96A 3M2UB 3W9HA 2DRAA 2HHQA 1V3ZA 2UUCF 5LOQA 4F67A 1TQLA 3H5SA 2FHJD 3UPFA 4TQSA 3GG1A 4PUOB 1URNA 1N36J 1Y5IB 4OHZA 2H5JB 3DLKA 2RU3A 4C6AA 5BR8J 1HNXF 1NM2A 3OHBA 1IKWB 3U1LA 3WIUA 3JTOA 1Q7YT 1HD0A 3TWZA 1HQEB 4IOCQ 3F41A 2V68A 5D78A 2CQHA 2MJUA 1H2TZ 2E5JA 3V6DA 3NNHA 5KT4A 2XMVA 4DL6A 2CXEA 2NR0A 1FD8A 1W26A 2JVRA 2GVDB 3ZNJ1 3TVZA 4CRJA 3PZPA 1KC8T 3CCMS 3FSYA 3KLIA 5HQLA 2ZJQQ 4DQIA 4D3HA 3GE9A 5THWA 2HS3A 1QAYA 3NS5A 3OT9A 5FJ4A 2CA9A 2YH0A 3CD5A 4X66J 1KHVA 3MM6B 1SJRA 4PXDA 4H4OA 1Y3JA 3A1YG 4XTTA 3ELHA 4ZLNA 3U02A 1VQLS 1RUSA 3FCWA 1QAIA 5BJRA 2DHAA 2CDRB 3UNGC 1WDTA 7AT1B 5KG3A 1IUJA 1RP5A 5LSLA 3IP0A 1U1RA 1VYAA 1U0HB 2X1GA 4IRKA 4PWWA 2BKOA 1FWPA 5L1JA 1V3SA 4F0HA 4K0KF 2QN6B 2ZNZA 3LGMA 1FRJA 3TAQA 4QYZK 1J2VA 3SSQA 4DV0J 3GV7B 1RSCA 2NYHA 5KFZA 3EWGA 3CDEA 3QGPA 4DSJA 2PC6A 4E2FB 4MT1A 4AFFA 1WEZA 3I0RB 4R0JA 1WEYA 3MCSA 1FO1A 3UN3A 3D4JA 1HBNB 1M5PC 2CJQA 2XMAA 1RT1A 3GSIA 5FLXU 4F4AA 3U1NA 1R7IA 1ZM3A 2AWZA 2XCAA 3QT5A 3T1AA 1LXNA 4USHA 3FBCA 5AT1B 2DNRA 2GQ2A 2DH7A 4OHYA 1N32F 4EMDA 4X4QA 3I6PA 4JOUA 4FKYA 3L7OA 2J9DE 3ZZRA 2GO9A 4DBQA 2M2BA 1FJGJ 4LF6J 3VHQA 1VFJA 4RW7A 3CCQS 1QSLA 4JI7F 4JYAF 4MK7A 3TX8A 4FDFA 1FEEA 3DFEA 4KB7A 5LSOA 3M8SA 3NCQA 2KU7A 5J1EB 2HS0A 3ILIA 1Z4UA 2HAIA 2M88A 3E3XA 1C0UB 3TUJC 3IR5B 1EB0A 4C2MA 2OO4A 1NK9A 4DHVA 3QO9B 3RBXA 2ZH8A 3PFEA 2ZBIA 3I31A 4QIFA 2LP4A 1RCOB 4OYOA 4ZIWA 3US5A 2FZKB 5AXMA 1ELOA 2EK6A 1ZYQA 3AY0A 4JI4J 3VR1A 3V4MA 4M5IA 1R8PA 1X5PA 1H2VZ 1DAXA 3TJAA 4DPOA 1IVZA 1ZS6A 2ZC4A 2C3MA 2KO1A 4CNYA 1SV5A 3MEEB 1XR7A 4QU6A 4ZVEA 4FBTA 1MU2A 3KJVA 2NYIA 2IAJB 1B3TA 2FJWA 4DEZA 2YQ1A 2K3IA 1XN9A 3AFGA 2NXUA 1GT8A 4L6V3 2JX2A 2X7IA 2R3VA 2V8PA 4WBFA 2MJNA 3V81B 4UY85 2CJ9A 1KKHA 2HURA 4WPAA 4X64F 1F0XA 1YZ6A 4FN5A 2CQDA 4DQPA 1I5OB 4RU9A 3C14B 4DR2J 4ZHRA 1HNIA 2R42A 2KN4A 2BBEA 1HBUB 4OJ3A 1N6QA 1B7YB 2Q1LA 1U1KA 4MIAA 3MECA 4FYDA 3HMJG 5BYSA 2R8HA 3IO1A 3HSDA 2C2RA 5ETNA 3J80U 2CJXB 3THVA 2D3OR 2VQFF 2SXLA 4NXMJ 1YGYA 4PQUB 4X65F 2EK1A 1KOHA 1LWEA 1KLMB 4S0MA 1JLAB 4LFBF 3SZ2A 3IR6B 4FPRA 3FRZA 3DM2A 3EGZA 3EZOA 4WTOB 2L41A 4KRWA 4DR3F 1ROFA 2QL7B 2G13A 4YEAA 1CJKA 2W7PA 5DDQC 2WW4A 3I96A 2F9JA 4F2SA 3CO9A 2XZTB 3LP2B 2P6SA 4CLTA 2VBXA 4B3SJ 2E1AA 2AX0A 4A48A 4ZPAA 3FRYA 2DH8A 4F25A 2B9EA 3SDEB 1PBUA 3T5LA 2HQDA 2L08A 1X4EA 4ELTA 3M8QA 4ZK7M 4DFJA 2V5HG 3OTOJ 3H2UB 2UXDF 2HQFA 4QIEA 1RZMA 4I1TA 2GIQA 4OX9J 4QIWD 2HRUA 3MEDB 4FVMA 1EARA 1K0VA 4DL5A 1LQ9A 2LA4A 4J9SA 2YNIB 1KQKA 4KPYA 3PHEA 1WOPA 4U7UD 3MXHP 2H5EA 5LMNJ 4CO4A 1FF2A 3UVJA 5ITHA 3NOGA 4ECRA 2Y9HA 3OV7A 1GX6A 4AL7A 2FZGB 4KGKA 2A6OA 2ROGA 1NSPA 1KFSA 3AJDA 2AKWB 4UQTA 2HHXA 5DG9A 1WC0A 4GC7A 1T11A 1X5TA 5I3QA 3K8VA 1RAGB 2NZCA 1D09B 2N7CA 1T05A 3WC2A 2QSWA 3MPDA 5K14B 2ADCA 5LXRA 1FDBA 3N6NA 2YWEA 3M4XA 1N4LA 3E51A 1S1XA 1F6TA 3HF5A 2OPPA 4ECTA 1W7WA 4LBHA 2GFFA 3RAQA 2DHSA 5KTQA 5GMKa 3N5BA 1RCXB 2DISA 2HBRB 5C25A 1RA6A 1VQ8S 1RTDB 3J7ZT 5K9FA 2EKNA 3FZ2A 1HR0F 3J7YI 2DXEA 1L5UA 3ET6B 3MEKA 2YNFB 1VQYA 4ED4A 4QIGA 4PG6A 2RU9A 4M5KA 2HMIA 2MZSA 3KK1B 3WC0A 2XO7A 2QV6A 1TMJA 3PX4A 3RRHA 3QQCD 3QLHB 1JJCB 4IOAQ 4HI1A 4PABA 2QO3A 2PI4A 1NLKL 2DK2A 2HHUA 4GKJJ 1GMWD 1CJUA 4L75A 3PRDA 4QW9A 4NEZA 1VQKS 2XYGB 1JXVA 2CQ2A 4YB6A 3TVKA 3CPWR 3HT0A 3TAMB 3L9ZA 2Z8QA 1F9EB 3H2VE 1EKRA 3K5PA 2YWHA 3PKYA 2MYFA 2KJWA 4F7VA 3PR5B 2HFZA 2HGMA 5IZHA 2C2EA 4KFBB 2HQIA 4QR2A 1T9WA 1JIHA 4I67A 1NU4A 2PSZA 1REGX 3B8HA 1HBMB 1X4GA 1S9GB 3BQ0A 1UTAA 1P9QC 3T6JA 4UW2A 3QFWA 2UUTA 1D8ZA 4JV5J 4F50A 3BPSP 2PFDA 2BKNA 3DI6B 1NBEB 3DMJA 2YKNB 4Q8FA 3AOCA 1TKZA 5ETMA 2OFGX 2P5VA 1EQ0A 2IRYA 5K8OA 1UEUA 1TL1B 2ALYB 3T6BA 4I7FB 3LP1B 4DV2F 3AA9A 2CPJA 1CJTA 4Z2XA 4V1Ak 4R8UA 4CLLA 1NK5A 3OR1B 2MZQA 1N8RT 3T5JA 2PI5A 4J9NA 3MZIA 2P2CB 4OV1A 4V19X 4O3RA 5BXIA 3LPYA 3MUTP 4BCAA 2WCXA 2QMUB 1MMLA 2HK2A 2W9CA 1NUEA 4B3RJ 4V19J 4I6WA 2JC1A 2ZC3A 1MWYA 3DDKA 2GJ2A 2J9DA 4J37A 3W5YA 1CJVB 3Q86A 1WACA 1Q16B 4LRBA 3CVKA 5JXSA 3CJ2A 4EWTA 2ZZTA 3SIPB 4QWCA 5D3GA 4URGA 4RW9A 4HHUA 4LT6A 4Y2KA 3J81U 4H4KC 4DPWA 2P9CA 4RNMA 2YKQA 5CCMA 4OX7A 2I5JB 4UY8T 2OPRB 4DV6F 1SQEA 2ZWOA 2NUHA 1U8SA 1UVIA 3U7JA 3D9BA 4URQU 3C15B 3CDWA 4X4UA 2QJ3A 3R8YA 3SCKE 1JJ4A 2W8KA 3J81Y 1OYDA 1NPPA 3WZ0A 4BC9A 2RUSA 1YVFA 3S7RA 1UAWA 3ITHB 1APSA 4B9NA 1RT5A 1RISA 5A6PA 2X3DA 2AJFE 1JJ2R 3MAAB 1W2IA 1LW2A 4N41A 4K4WA 3CCZA 1FEHA 1JNZB 4NRUA 1YX2A 4CLWA 1DTTA 4CYUA 3NLCA 2JOQA 1MROA 4NX9A 4G1QB 3LAKA 4MIBA 3OTEA 3ZFVA 4RW8A 1Y11A 1IM4A 5KFCA 1ZZFA 3W8PA 5KFYA 3M8RA 2DHXA 2CPDA 4KKOB 1GTEA 4F8RA 4KYZA 3JSRA 2CQ1A 2DHGA 2CPHA 4PZVA 3CJ5A 2D41A 2DGUA 1T8EA 4OYWA 4CO5A 3POTB 4ZMMA 4MKBA 3HVAA 2YNGB 3CC2S 4PG8A 1C2PA 3I32A 4CM2A 1KR4A 4DSEA 2KT2A 2HNYA 3Q24A 1RBAA 4C0BA 4OL8A 1IN0A 3FMBA 3HHEA 2BV3A 5E3PA 4USKA 3SQGA 3IM8A 2BXJA 2FVPA 2C3UA 4U9RA 2I8EA 2P8IA 4RNFA 2C2DA 3D2WA 3TEGA 5E5NA 2BW7A 2HNDA 4OX6A 1GEHA 2LXIA 3BO2A 2D9OA 4USWA 4LJMA 5F0UA 1H73A 2VIHA 3TA0A 2C2KB 3DOLA 2FY1A 2ZH7A 1E6VA 3HZEA 1YJUA 1R43A 4PEOA 3RB4A 2HRYA 8ATCB 2ZD1B 1R0AB 1S57A 2EFNA 4MYTA 1PC4A 4OZ1A 2F8EX 2VBYA 1J5EF 4UUXA 3G9CA 5KFIA 2EEYA 4NCBA 2XY6A 1NNDA 4QQBA 1R0CB 2R8KA 2ACYA 2W2MP 4FF4A 2GIRA 4KR0B 1NH7A 3DCAA 2UVVA 5KFMA 1IM6A 3W7BA 2QFIA 3QNWB 4J9KA 4DJBA 3I0SA 1U1QA 2AMCB 1YRTA 2E5HA 4OHWA 1ITPA 4X4RA 1HI8A 3DLEA 3L7PA 2VFSA 3I4HX 2OELA 1WWHA 1RT2A 2RMLA 4GC6A 2I6WA 2V9WA 4XDCA 1RTZA 4A8QA 3O3LA 4WFZA 1L3TA 4FYWB 4KH1B 3DRPB 4RW6B 5F3ZA 4JI8J 3EDQB 2XI2A 2HKEA 2GNKA 2O01C 2RE1A 2WSEC 3ZTRA 3FEXB 2NXEA 2HHHJ 2AYBA 1F2HA 4B9VA 2NQPA 5EX3A 5JVHQ 3AHPA 1HBOA 2DR8A 1O0PA 2MKKA 1EZZB 2IBKA 3GILA 3X3UA 2DCUB 1QE1A 5F8LA 3QGGA 3M6WA 4RNOA 3MPWA 1AZSB 2GHPA 2RDIA 5IV3A 3BSOA 4NLQA 4RU2A 2AJ4A 3JSMA 2OPSA 3R5GA 2MHNA 4TU7A 1DLOA 4WP8A 4C3LA 4OI3A 2YKMA 3CJ0A 4M1KA 4A8FA 1IBMF 3CMAS 1AYEA 3P5BP 1PAUB 3G6XA 4N77A 2IRUA 1FKOB 3PR4A 3BM7A 3CCTA 4O4GA 1U1OA 1X4HA 1O51A 3K0JA 3NS7B 2APOA 4ZP7A 3PM9A 5DZ7A 2ZDOA 4J9MA 3BDEA 4DV4F 1RTIA 1FHTA 3K57A 5IWAF 5GADI 2WTFA 1OSCA 3BH6B 4K4XA 3PW0A 1BQNB 5JMNA 1B64A 3GMGA 3X1LB 5C42B 3MR2A 3MM7A 4OJ1A 1IR2A 2R7RA 3T19A 1HA1A 1X9MA 2RAQA 4LFAJ 4LSLB 1HYSB 4K5SA 2I2YA 2XWXA 2BOAA 2LVWA 2DR5A 1N5YB 4K2JA 3R27A 1N5VA 3DOKA 2FYXA 1C1CB 4J5OA 3KLHB 3QAEA 4M5DB 1ZM2A 2D3O1 4WXOA 4ZVUB 3IRWP 3HHNB 2DGOA 4QU7A 2QMWA 3IFEA 2QT7A 2QMXA 1RB0A 2IDEA 2VUGA 3K59A 2GMLA 2C42A 2RB7A 1RJJA 2DGXA 2IA6A 5D0EA 3GJTB 4TU8A 3E01A 4IYQA 3J7A1 1SIWB 2F1FA 2FQQB 2DJWA 4CCHA 4L74A 2DBBA 3PVXA 2BE2B 4LF4J 2MEWA 2UV8A 4KHPF 1NO8A 4UF4A 1SH3A 2IJFA 2R7TA 4YB5A 3D0GE 5CYQA 3ZZUA 1RK8A 2IC3A 4B9MA 4R25A 1IBCB 1RWPB 2ZDPA 3EGWB 2C2NA 2OPQB 2GMHA 2GMJA 2DITA 4I64A 4K8RA 4O3OA 3VQSA 5L9NA 4ZLPA 3ZZYA 3D3BJ 5DQIA 2C1EB 3CC7S 1QTNB 3CIZA 1XMOJ 1NDLA 5DJBA 4PXCA 4AQYF 2ZUGA 1RAHB 4QW8A 5JVGQ 4YUDA 3HHLD 3I5CA 5DLFA 2K7JA 2DGTA 5KFDA 2LDIA 2XSFA 4J9QA 5E2QA 2GHWA 3AD8C 3TX0A 3WIVA 2RDJA 2VBZA 4DZ6A 2G2ZA 2E29A 4I6YA 4QR0A 2HHPA 3G82B 3QBCA 4F3OA 3ENQA 3NWGA 2AGPA 3M2RA 2A2DA 4LR7A 4N56A 3DLLQ 3KFWX 2RD5C 4LVNP 3WX8A 1K8AT 3JS9A 2RSQA 2MDAA 4XPCA 3KMSA 2CQ0A 2VONA 2DPJA 2R7QA 1Q8LA 2J0XA 2DR6A 1N5SA 1Y3KA 3D6HB 3G6YA 5AXLA 4ZP9A 1F5CA 4HHJA 1P1TA 3TP2A 3HD1A 5HQMA 3KHGA 2YWGA 2XULA 4WKYA 2BJ7A 1K1SA 3B82A 1FA0A 1HW8A 3UD3P 1P9YA 2Y1JA 3CXCR 5D8HB 2GVZA 2RILA 2MKHA 2LYVA 4KGVB 4YHHF 2NS1B 5CAAA 3OVAA 5E41A 1U1LA 3KHRA 3EGVA 5ETVA 4KGMA 2LEAA 1IKXB 5DETA 2IJRA 5SZTA 1B4SA 3W60A 2AIRB 2AYEA 3CJRA 2MSSA 1ZTTA 4L72B 1XNQF 2VPYB 2Z2LA 2J0QD 2R7WA 2ASDA 1T03A 4NYZA 1PJ7A 4LR8A 2K06A 1ZA1B 4NLTA 1V5IB 2K8GA 3AH6A 4ED7A 5D15A 3RRKA 4P52A 4URSA 4I2PA 5HBMA 1YJ9S 5IM0A 2ZBRA 1NHKL 3FBFA 3M1VB 4LR9A 5HAOA 4ECQA 4UTGA 2IA0A 1X9WA 2OI2A 2B5JA 3RTVA 5ETLA 3M8WA 4KC5A 1G4CA 5J2MB 1UPPA 5G0RB 1ZZNA 2JRSA 4OZ2A 4J90A 4CO0A 5KOWA 1NKCA 4JI6F 3HULA 3N6LA 1JLGA 4P7TA 3AQPA 3GJSB 4X4VA 3HKZD 1U1MA 4Y2AA 1S6UA 2PGCA 2BKPA 4LBIA 4AUKA 1HNZJ 4CH0S 2V9KA 2F7VA 3MEGB 2G0CA 1SC4B 5B0AA 1UL3A 5HLFB 4DS4A 1HQUA 3FCHA 1UWBA 2ZHBA 2WVDA 4Y00A 4I2QB 3FQLA 4FBUA 5HP1B 2AF6A 4LREA 2NXNA 2BE7D 4LF7J 2BANA 2A10A 4ZCKA 2UZAA 3TVYA 2GA7A 4NA2A 1SH0A 5HSPA 3UR0A 2V34A 1UW4A 5BYRA 3CCVS 2VPWB 3KK2B 1DQ8A 3AA8A 3TARA 3GIJA 1ZAXA 3O44A 2DNKA 4EBCA 4QZVB 2ZWPA 2B4OA 5GAGI 2MHEA 2V8VA 5ETQA 3MM8B 3DN9A 5A8RB 2JEFA 3KUEA 2JSXA 2ZH3A 3R6GB 2AD9A 4MK8A 4YOEA 4OI0A 4NLGA 4AD6A 4LIWA 1B99A 4Q7AA 1C1BA 2E7VA 4ZPDA 2CUYA 4BS2A 2CQGA 3TQEA 5HL7Q 4X2BA 4DR5J 1VS3A 2CPXA 2K3KA 4QPTA 1NPKA 1IKVB 1N5QA 1WC1A 4PR6A 1NKEA 1RWUA 4ZKAA 1FVQA 3N9UC 2O5DA 5ETKA 2A3JA 2FLPA 5GMEA 4WE1B 3JQKA 3MMAB 4M63A 4LF9J 4LSNB 1QAXA 2VKRA 3D54A 1BQMA 5DDRC 1REVA 2CIMA 3CD6S 2FJDB 4NI2A 4ECSA 1KVKA 2MZRA 1T9UA 1KP6A 4RX6A 4YB7A 3CWJA 3AAWB 3IG1A 3Q8QB 2JDJA 4CQ1A 2E5LJ 3HP6A 3AD7C 2V6AA 1HI0P 3H40A 4K5RA 4QYRA 2B7CB 3I5AA 1S1WA 1S76D 1MMDA 1FX4A 5LL6d 4ANEA 3PW4A 1XNRF 1LW0A 3AB2B 1VQOS 4RWWA 3PW2A 1T02A 5C24B 2DO0A 4JI1F 3RYLA 5E0OA 4IFVA 2V4JB 4CT9A 1VQSA 1DBDA 1HQ2A 2CWKA 1M5SA 2W9AA 2F65A 8RUCA 4X4NA 3O5TB 1SPBP 1IWGA 5F8JA 1SVDA 3NBPA 1JWWA 1T9XA 1FFSB 4YR0A 1X4AA 2P6TA 3KLFA 2XCPA 2LDYA 2RVJA 1UVNA 3CW2C 5ETTA 4O0IA 3DLKB 2PEHA 2RQ4A 1BY9A 2VDHA 1B0VA 1RT7B 3GLJA 5HJXA 2KVIA 1BWEA 1S1TB 3D3CJ 4DG1A 3JXOA 1KD1T 1SC1B 1WUUA 2DNMA 1PC5A 1LK7A 3H20A 1C0TB 2KXNB 1S1VB 3KK3B 4NLRA 3GQCA 1PJ6A 5D0RA 3HHLB 4TY9A 1TKXA 3KWMA 1NK4A 3KLIB 2AYMA 3OL6A 2MKIA 1IBKJ 3MM9A 3CCES 5A2QU 3RBEA 1VQ5S 2OFHX 2VQEJ 3DOMA 4ECZA 2VH7A 4O3PA 5KFTA 1M5HA 3OTBA 1FXDA 1VGYA 4OLOA 1RABB 4YY3F 3G96A 4DPXA 1S0OA 2DPIA 5B0GA 1KLNA 2HW3A 2EFGA 2HNZB 4U6PA 5KFKA 4YFUA 5A2QY 4MKVA 1OY9A 2UUAF 1NJXA 3GWCA 2GJIA 4C8NA 2DHHA 4EO6A 5KFLA 4KBIA 3IN5A 3ENWA 2R9LA 1SJ4P 1D9FA 3PRVA 2X1FA 3BBCA 3UFCX 1KRPA 4DUZJ 5CYMA 1J5OA 1S99A 3NAIA 3OFEA 3OFGA 3SV4A 4RUBA 4JI3F 2ZH6A 5EUHA 5J2QA 2HGLA 4NOHA 4LQ9A 5D4OA 4TXSA 3WX4A 4IR9A 4LF8F 1JLBB 2N4DA 3DKDA 2I1RA 4N8OA 3GV8B 3F0NA 4DLGA 3V4IA 3M2UA 2V69A 4C9DA 3K58A 4ZDNA 3EJMA 3TZWA 2RH3A 2XYHB 2LMIA 4C8ZA 2XEXA 4NL5A 1F5AA 4RW7B 4FP9A 4M5GA 2X1AA 1WD6A 3ZTQA 2DO4A 3MWBA 1S0NA 2O1PA 4DV5J 4WFBQ 1VQ9S 2FZCB 1RT4B 1IKWA 1XERA 3MTKA 3PDNA 4LFCJ 2RRBA 1N33F 1N56A 3V6KA 1HQEA 5A8KA 5DQGA 4B3MF 1SL1A 4DSIA 4E98A 1I6JA 2J6TA 2MQNA 1UFWA 1M1GA 1V6HA 2BUNA 1X60A 5F8HA 2A2CA 2MLXA 2GVDA 5HROB 2GGPB 3D6FB 4WF9Q 3KUHA 1S48A 2ZOGA 3K5LA 1SKSA 4IFYB 2OGUA 3N79A 4PCQA 2C22A 2RKIB 4B17A 2BDPA 2UP1A 2CYYA 1WKLA 1SV5B 2LU1A 4CT8A 4DQRA 4C98A 3FC9A 1MU2B 3KJVB 3TAPA 3BQ2A 4JI2J 1SIZA 3EGNA 1RYRA 4X4TA 4Y3CA 2V2QA 4B08A 2CKWA 2YX7A 1U45A 4P2SA 1XWLA 4DMZA 3JQMA 3BQ1A 2VHGA 1VIXA 4WK1A 4A8KA 2FLNA 1U0HA 1XBWA 2RJZA 3HX9A 4F0MA 3G71S 4ED0A 4ZHRB 1HNIB 3KLEA 2QC3A 4USVA 2DNYA 4DV3F 3RU0A 1IBLF 3DLBA 2PT0A 2VZ9A 1UWAA 1KVIA 2OEMA 2J8AA 3I0RA 2DNNA 2F63A 1CBKA 1Q78A 3PHTA 4GKKJ 1VR6A 1HBNA 5ETSA 2HK3A 1D9AA 1D0EA 4ES2A 5CXTA 1VI7A 2QLXA 3KKFA 4OFZA 1LWEB 1PO6A 2BQ3A 5L39A 1N36F 1XQIA 1AFIA 2WVEA 3S8SA 1X4CA 1P27B 2MZ1A 2MQMA 1CSJA 2WBMA 5BR8F 1G1XA 4ZVPB 4DV1J 2FB0A 2DNPA 2QYCA 2O66A 1YLXA 3Q23A 1VCTA 2B4UA 1RWOB 2KFNA 4ECYA 4X62J 3O6QA 3PX6A 2R7XA 4EGLA 4ZOSA 4DFKA 1U1PA 3VCDA 1TKTB 3RBZA 2Y8WA 3GCXP 2JLFA 2KZZA 3DXSX 3MPYA 5K8MA 5J1EA 2CQIA 3UNYA 3N01A 3M8QB 1VBYA 1C4AA 1U2RA 1RAAB 2Y8YA 1P8GA 4DCJB 3G86A 1RTHB 1Q81T 1SQFA 3QO9A 3EPGA 2LEBA 3A8KA 2W2NP 3OUYB 4X66F 1S0MA 2ATLA 3OL7A 2HVDA 1HPZB 4DUYJ 3MCNA 4Y28C 1S59A 2A1BA 4IDKB 4ETZA 4KQZA 4USIA 3ZXWA 3TR5A 3JTNA 2AT1B 3DRXA 4X4SA 1IQTA 4Q0BB 4NE9C 3VF0B 3LANA 4FS2A 3BN7A 2X1BA 3MEEA 2XHWA 1HD1A 3R6LB 1EIYB 2XS7A 1JLFB 4C8MA 4LIRA 4J9PA 2XLKA 4WP9A 3W2VB 4ITSA 5K8PA 2AV5A 2IAJA 2QA4G 3LWLA 2J7KA 1FDNA 2V94A 1SCJB 3B78A 4EYHB 3QT7A 3R3TA 2KDOA 1FFGB 5EWFA 3NGRA 2AQ4A 3JAMU 2KL8A 5KG5A 4IR1A 4MKAA 5KFUA 4C97A 3FUYA 4EU0A 1HBUA 1RTJA 4DS5A 3E8OA 2CNOB 2BX6A 4QJVA 3EICA 2V0NA 2FHOB 4NEYA 4WCEQ 4CH7A 1HARA 2DRBA 1YRXA 4NRTA 4ID5B 4EZ9A 3JAMY 2DGVA 3QRQA 4PQUA 4YDXA 2CVEA 1RQ0A 3G2XA 2UV8G 4DXLA 3IRXA 3PYDA 1FJGF 1PYOB 4LF6F 2JLEA 4KY3A 4KJIA 1UFKA 1JLAA 1QLNA 4IH5A 1GMUA 3UQSA 4DL0C 5KG2A 1IXKA 1T95A 2FJBB 3VAMA 4OYPA 4YR3A 2ALZA 3MCMA 3BV8A 1UW9A 5B08A 1F60B 3ZZTA 4WYWA 2ZJRQ 2ASLA 2CQ3A 3OXGA 1CJUB 4DWIA 1WKKA 2FVSA 2IDLA 2RDDA 3SDEA 2M8HA 5AE2A 4EEYA 2L3MA 3UR3C 2CAJA 2VG7B 3GYGA 3VGSA 2J7WA 2GIFA 3SI8A 2CPZA 4RPFA 1UETA 4JI4F 3MEDA 4CLKA 4O3QA 3THPA 2FHJA 4O23A 3I9V9 4CWBA 1YJWS 4G1PA 3R5JB 3PEHA 2YY3A 3QJLA 2EFVA 2WONB 2Z2MA 3PW7A 1JLEA 4OMFG 4QR1A 2DGQA 1T0TV 4ED1A 2MZTA 2IYIA 5C5JA 4F3MA 2PMHA 4CO2A 4HH0A 3MUVP 4ZVGA 4NZ7A 2WSCC 1WF0A 1KHWA 1FXLA 1I51B 2K1RB 5EGYA 2VC0A 3F73A 1AW0A 5K14A 3DRSA 1UJ5A 4DR2F 2UUBJ 2YKPA 2R2RA 1WOSA 2OJ3A 1DQAA 4TLQA 5J1NA 9RUBA 2W25A 2ZH5A 3DDIA 5L1LA 4ENOA 2WSFC 3KG1A 2KYXA 4N5SA 5DLGA 4CH1A 1F1BB 4NXMF 5CQGA 3CEDA 1RTDA 2KRRA 2QZ8A 1FTRA 4ECWA 3W63A 2ZKUA 1YITS 1EQMA 1M0SA 3C46A 2DY1A 2YNFA 5IOLA 3JTPA 2A18A 1P1LA 1I94F 1TL7A 1YKWA 3QWPA 2BYCA 1KSPA 1YJTA 4DR4J 1WKJA 3KK1A 1KEKA 3C6UB 2IVFB 3UD4P 2Y3YA 2HBYB 4B3SF 3ILLA 3UDVA 3C19A 2MKCA 3QLHA 3LA0A 1KDNA 2MGZA 2GJFA 4U95A 4CIOA 2YVSA 2BJ9A 1NMEB 1U2CA 4NMXA 2WVCA 4OI2A 2G0JA 1PILA 2WVFA 1AA1B 3A3NB 5IXUA 1IBLJ 5DDOC 1RT5B 3PY8A 3HVTB 3OTOF 4B3OA 4LMZA 1HWLA 4TU9A 3PYFA 5AXNA 4OX9F 1LW2B 2W24A 4Q2MA 2NCKL 3HZGA 3CJSA 3L95X 5DS7A 4WZMA 3QFHA 1DTTB 3DYAB 3EZUA 3UD5A 1MROB 4ZCMA 4RUAA 4KFBA 5DGAA 2IIHA 2AZ3A 4HDGA 5LMNF 3D1HA 4RLEA 2W7OA 4MTPA 1AUSL 1HBMA 1S9GA 3NNCA 3DLHA 4QOTA 2MLYA 4WWSA 2HRTA 3ZTSA 3D68A 2F4VJ 1OSDA 3FEZA 4WFYA 2VJVA 3ETOA 1UVKA 2YKNA 3HXMA 2KH9A 3BR9A 1U02A 1BQXA 3BO4A 4USUA 2G1HA 2L9DA 2VF3A 3L3CA 1VRTB 1XIQA 1TL1A 4BWJA 3SQGB 4LQ3A 2JFDA 3HKWA 3UE2A 3C6TB 1TV6A 2W2QP 4I7FA 4M5MA 3AD9C 3KLVA 4CM0A 1MNEA 3LP1A 4ZLLA 5CHCB 1BHNA 3SCLE 2ROEA 1FRXA 1RHMB 1TL4A 2B6AB 4JUZA 1S7IA 1XMBA 2DXFA 4I0WA 2R2SA 2ILYA 1Q8KA 1GTHA 4DL7A 1NJIT 4P2FA 4OZNA 2LFVA 3FFIB 4ERDA 2M5YA 3BGOP 1U2FA 2QLJB 3H4BA 1NZ8A 4P7VA 5A76A 2IM2A 3J7Z5 4J9UE 6FDRA 3DRRB 4J91A 1FKAF 1S7HA 4DDFA 5MAOA 4IO9Q 2B8QA 2KYZA 2D7SA 5A0YB 3EDRB 3M8PB 2FJXA 1VBKA 3MMCB 4BBYA 4ID8A 3W64A 4LF5J 3NGUA 4K4TA 2JFKA 3DLEB 3IBCB 3L4BC 3CD7A 2QX0A 1OJ4A 1TTHB 5B0CA 2I5JA 1MWQA 5M2RA 2OPRA 2QTWA 4GKJF 2DKOB 1PG5B 4CLFA 1QVGR 1S6PB 4AXIA 2YKAA 2VA3A 3RAMA 2RHQB 2YQ0A 5FD1A 2WZ1A 1YQHA 1FRLA 2Y1LB 4C48A 2Z4PA 4C0OC 1PIEA 2PD1A 4DV7F 3M32B 3TUPA 3ITHA 5GMDA 1ZPWX 3N28A 1P6TA 5F9NA 1R31A 3KDOA 2XMUA 1T3NA 1I3OB 4ILRA 4LUBA 3NMRA 1MMNA 2WK4A 1CG2A 2FD2A 2M0GB 2XGQA 3ZZOA 4KT0C 3J81j 4HT7A 3TA2A 4GRSA 3G8SA 2YPZA 1W2BR 1FK9B 1Y5NB 3HHKA 1JB0C 2N7YA 5FLXY 1X7VA 2XMMA 4JV5F 5FDLB 1YJVA 2VG6B 4NXNJ 4I69A 2VU5A 1Y0HA 3ZC4A 4KKOA 3F44A 3CJTA 3CIMA 4AXJA 3N5FA 1MW7A 4O4GB 2CZ4A 2MQLA 4RW4B 2WBRA 2KXHA 3POTA 3M6VA 5HN0A 2YNGA 2HZVA 3P8BB 1FE0A 1XK8A 4OI6A 3I9ZA 2LEPA 1MN9A 2BW2A 2YKOA 1RBLA 2RT3A 1O6XA 4C3KA 2CNKB 4MJKA 1SJ1A 4OHVA 3MAQA 3VVTA 3AQOA 4AYBD 2LQ5A 3SFGA 2YBVA 5LMUJ 4YS2A 2ZUAA 4OYXA 4UOGA 5LM7E 4QPXA 1U25A 2M9KA 1LWFA 4N7TA 1X5SA 3RB6A 4JI5J 3I55S 1Y00A 1KTQA 2VFVA 4PG4A 2B7BB 4B3RF 2WOMB 2MKYA 2B9WA 2ERRA 5KAKA 1Q7LB 2BJ1A 3QSYB 5F8MA 3BGRB 4O3SA 3PYEA 4EBDA 4NZ0A 5I3PA 2FVQA 5E3RA 3CJKA 2ZH4A 1M1HA 5HMZA 5B0DA 2CQCA 4DL4A 3P49B 4CO1A 2EBGA 4DR1J 1R6YA 5KG1A 3MGJA 2FIUA 3GJQB 3BF4A 3EPIA 3S1TA 1L3UA 1TUGB 2MPUA 1B0PA 3CMQA 3MM5B 3LUYA 3DNCA 3QAUA 3DHWC 1ZTWA 5LXYA 4CDIA 2ZH1A 4RW6A 4ZCLA 1S12A 4OJHA 2ACMA 1UMJA 1RLCL 4C11B 1W25A 2VG5B 4PYAA 3DGPB 4HTIA 3KJFB 5J1PA 3T9NA 4FNHA 5KFOA 3PJ9A 3CTRA 4FXDA 5AJ3J 2KVQE 2PA3A 4Q2LA 1OYEA 3QRRA 1NHUA 3M30A 2KT5A 4ZJQA 5K5MA 1AZSA 2MY7A 1I94J 3J80Y 2GZOA 1R8BA 1TK5A 4FZVA 1R6VA 2YPYA 3M2RB 1PAEX 4QWAA 3PW5A 1OS5A 3NEKA 1WF1A 1S9EB 1FKOA 1HNWF 2E9ZA 3RBDA 4XAKA 1GMWA 4W4MA 2W4PA 4FYXB 2FJVA 3KMQA 5A6WA 4JI0J 1IWAA 3KLGB 1RBOB 2E1RA 1VHFA 5KOXA 2XMKA 1T3OA 1IKYA 5IV4A 2XHCA 3DLJA 2L48A 5GAHI 3D28A 5H9FJ 5T7LB 4MAKA 1OY6A 2L9WA 2VBWA 4WTYA 5C42A 3GONA 4CTAB 2V8GA 2ASYA 2UXBJ 1RE1B 1YI2S 1U47A 4DZDA 2AP6A 4PWUA 3GFZA 1PYTA 2HG4A 1B0TA 1N5YA 3MOJB 2ZM6J 1HLWA 2BQUA 1H38A 3KLHA 2CWXA 1XR6A 2VB6A 3TRGA 3EXYA 2R8GA 3FSIA 2KM8C 2ZFHA 2HHWA 2E1MC 3W2WA 4AE5A 3HT3A 3SFUA 2G4BA 1MN7A 4ED5A 2CZ9A 4G65A 3HLUA 2M7SA 1VQMS 2GQQA 5IM0B 4WJBA 5KT2A 1SKWA 1DFDA 4DN9A 2YH1A 4JI8F 4U67Q 2MZJA 1YJRA 1VQ6S 2HHHF 2KM8B 2XTJP 5KFSA 5KFBA 3GV5B 1WG4A 4NLVA 3GIIA 3OLAA 5E33A 4Q44A 1SKRA 6FD1A 1U0SA 1AFJA 4KGXB 3DGVA 4ANDA 1L3SA 4YP3A 5ETOA 4C8LA 2FGCA 3CDBA 2BJEA 3R7NB 2VPZB 2FHMA 2Q79A 4U8VA 1TP7A 3HFKA 1X4FA 1G7CB 4CI0B 3CD0A 4PRFA 4TKTA 2BM1A 1YBTA 2A6MA 1Q8BA 5EWEA 4DN0A 3QZ8A 5L1KA 2BANB 4GO7X 4RUCA 1Q82T 1ZETA 1K73T 2HIYA 2CPIA 2Z58B 3GIKA 3N6MA 3LGHA 3V6JA 1VBZA 5HMWA 4DFMA 1IR0A 2DXDA 1QAJA 1KBRA 2PDAA 1U7LA 2OSQA 4ZJOA 3IS9B 1EETB 3H98A 2HLTA 4DV7J 3A8EA 3HSGA 3Q8UA 3D0IE 3NG8A 2ZOFA 2F3JA 4LFAF 3BBFA 4EI2A 1VISA 4JV1A 5EWGA 1ZH5A 4ELUA 4W90B 5K20B 2M52A 1ZBTA 2HFUA 2XNQA 1WDDA 1C1BB 1U8WA 2XO6A 2XGPA 3QATA 5D6GA 2CG4A 5H9FK 4UZBA 1VJWA 1TK8A 5E7OB 4Q5VA 2DNLA 1FJ7A 2BABA 3VZHA 3LW5C 2HWHA 3MAHA 4Y6IA 3HFZB 3C16A 2BQRA 2JEJA 2IM3A 2JZ5A 4CLZA 3Q0AA 4RUHA 5CABA 5D0GA 4LF4F 3IWXA 1BQMB 1RAEB 4E8UA 1Q86T 3QJPA 3Q8PB 2H51B 1REVB 5KT6A 2FJAB 1NK0A 4NI2B 4OYIA 1NCLA 4NLDA 4A46A 1HWKA 3NGDA 3R5DA 2B3TB 2W4DA 5ETRA 4A8SA 2RQCA 1NB7A 5J2MA 2XY7A 1XMOF 4B3TJ 5G0RA 4AL5A 4DPYA 1N34J 2N3OA 3LTOA 2DYAA 1FRMA 1U24A 4GO5X 4A47A 2OEJA 3W66A 3T1HJ 5HATA 4WFXA 5IT4A 2ZJPQ 3MR3A 2BRKA 4Q8EA 1JJHA 1BLUA 4DR6J 5HVHA 3MEGA 3W9JA 3DXBA 4CZCA 4B9SA 1C4CA 3DLGB 5HLFA 3MMBB 3W3SA 2VA2A 3SV3A 3ETMA 3KLFB 4I2QA 2ZH2A 5IC4B 3ICLA 1RI7A 3B6BA 3MCOA 4ILLA 2V63A 4NA1A 1NDPA 2HFVA 3UN5A 4HLBA 1WG5A 3V6HA 3O8WA 4DQQA 3BB5A 1TR0A 3A8IA 2Z2ZA 3GG0A 1FXRA 2ZKTA 1U6BA 2C28A 5DGBA 2ASJA 2DNHA 4PWDA 2F4FA 4OZLA 1RKIA 3NOCA 3LH2S 3T3FA 3LPEA 1NK7A 3JYTB 2GX8A 3OXFA 3W1YC 1SJQA 1R27B 1TL3B 3KTQA 1CULB 2H65B 5KT3A 3KYLA 4KHRA 1FKPB 5I3UB 4AT1B 3E2EA 4J7CA 4IG0B 4OZ5A 4ICLB 5IQ6A 4ZVFA 3CO0P 4HDHA 2YNHB 3GYXB 2L9NA 2XWYA 3LP0B 1VHIA 1IKVA 3HPOA 4M5LA 2E5GA 3TYTA 3PIPQ 1RAOA 3GYNA 4QYZJ 1HNWJ 1PJ5A 5HQ8A 4P71A 4R0EA 1UZDA 1KONA 4WE1A 1HHTP 3MMAA 2DB1A 4LSZB 4LSNA 4ECXA 2C3PA 4BHQA 5D4NA 2XMJA 3EUNA 3BKFA 4DX6A 2HHSA 4ED2A 1J5OB 1N52B 4PXBA 4Z7YA 1BWVA 2ZNYA 1RT3B 2W9BB 4K2XA 2HGNA 4DR7J 1QSSA 5H9EJ 4M5NA 4DUTA 1DZ5A 1PKUA 2LLZA 4H4MB 1M5VC 1FFWB 1HNZF 1OPIA 3RJMB 4XO0A 2H4YB 5LJ5Y 4NASA 3OHAA 5C24A 4MYUA 3Q8RB 1QD1A 1ZA2B 1CPZA 3K7RA 2D3ZA 1X4DA 2V4JA 4P2MA 1UKUA 1KTVA 1WHWA 3TQ1A 2AX1A 2ZZNA 2RUGA 2MMYA 5F41A 2V2VA 4LF7F 3BSNA 1Q4RA 5KFFA 2QRRA 3GZ7A 3K5NA 3CJ3A 2XYPB 4KV8B 3H5YA 3OLBA 2CQBA 3PRBA 2KXFA 1VLYA 1DRZA 1RT7A 3OXLA 5A8KB 4DF8A 2J7UA 3AB4B 3HVWA 1S1TA 2XG8A 1E6YA 1SL0A 3BDPA 2KTQA 3OVSA 3K17A 3Q8YA 3V2UC 2KB2A 1RWMB 2R4FA 1C0TA 1S1VA 1T9TA 3KK3A 4M5JA 1HNVB 2QA1A 1TAQA 3HHLA 1RWWB 4FF1A 2CQ4A 4KGZB 4ILMA 3UO0A 1LEOA 2HVZA 1WTBA 4ZPVR 3PXGa 3IAS9 3S01A 3OL9A 2QGFB 4DR5F 1CS4B 2J5AA 3JSBA 2HYIB 3Q83A 3TZXA 2XS2A 1WC5A 4FXVA 4C8YA 4HT5A 1SUQB 1ZOTA 1FNOA 2HNZA 4O44B 4ZA1A 2AGOA 2B56A 1NXIA 3NAHA 3MDFA 1ACMB 1K44A 1U09A 4LF9F 4O4RA 4WU3A 4F4YA 4J9VA 3K8WA 3OFHA 1FJEB 4RBUA 4TY8B 4KSEB 1V3RA 1KNZA 5KFHA 7FD1A 3RZAA 2MKSA 3ISNC 4MMOA 1DTQB 2PMZD 2UU9J 2X51A 3TJ9A 1QVFR 3T9ZA 4QWBA 2E5LF 3GIRA 2Z2YB 3KLEB 2NSBA 1URRA 4DX8H 1RAFB 2AEFA 4F36A 5KFAA 3VQTA 4DX5A 5DQHA 1TVRB 1OO0B 4ZITA 3PO5A 2GS8A 3L7UA 3C66A 3GB0A 1A6LA 2RF2B 1IR1A 2OAUA 2BR0A 1S49A 5KFPA 3GFYA 2ZH9A 4IG3B 3FSXA 3LO3A 1JLBA 9ATCB 3FBBA 5GVQA 1KOOA 1S6OA 2DGSA 5H9EK 2KZMA 5ADZA 2J8SA 4NCGB 3NGSA 3M8YA 4O3NA 1QUVA 2AEMA 4Z7CA 3WBZA 2KHCA 1LWCB 3EX7B 1RT4A 2IYGA 4YQWA 2OIHA 5FIIA 3P45B 3OTDA 1S1UB 2OD6A 5J2NB 1JXLA 1XMQJ 1U1NA 1UEVA 1H0HB 5CD4H 3IXQA 1OMSA 4L3KA 1S6QB 3CGIA 3IWNC 1JLCB 1IBKF 3RB0A 1RHQB 2IM0A 3RB3A 4DF4A 5KG7A 1VMBA 3NL0A 3BS9A 5HROA 1RAIB 2LXUA 2VQEF 3QT6A 3T1YJ 2GGPA 5B7WA 3CB4A 1B7FA 2GQCA 1VQNS 5KFWA 2AU0A 1JX4A 2B43A 4UOHA 3M6UA 4IFYA 1RT6B 1YIJS 2PN6A 4JP8A 2RKIA 2O3DA 3AXKA 1U49A 1X4BA 3UDEA 1H7WA 1GQEA 3GP9A 1U6ZA 4TNOA 4ZVOB 2NZ4A 1NJZA 4IOBA 4I68A 1TFWA 2AW0A 4HH1A 3THTA 3AT1B 1BXNA 4KHMA 2DIVA 2JHEA 1H3DA 1X9SA 4DUZF 2VOPA 4MFBB 5DM7Q 5KG6A 3VVUA 2CPYA 5I42B 1IQZA 4ECVA 1EHWA 3SSSA 1VQ7S 1JLQB 2E7WA 1OIAA 1RTJB 1YG0A 4YB1P 1R89A 4UOFA 2Q6CA 2E9RX 1VQ4S 3OW2R 3I56S 2QSFA 4NWBA 1DQ9A 3QWUA 2LQ9A 1KWMA 4GMKA 1ZM4A 2MQ8A 3IRXB 3D6MB 1G2EA 3HJFA 2XLJA 2C2ZB 1SI9A 2Y1RI 5A8WA 1BUXA 1YJNS 3T41A 4ECUA 4UZCA 4DV5F 2IMWP 5KFXA 1PGZA 2GHVC 1Y5LB 1SL2A 2Y0BB 1UA1A 4B9TA 2IFXA 3BKUA 4LFCF 4HACB 2UXCJ 3IBFB 2DNGA 3QIPB 3FKBA 1F2GA 1ZPVA 3M6XA 1F3VA 1SJFA 3FZBA 4WKRA 1TKTA 3MOZA 2AEJA 5E3CA 1SC6A 1JKHB 1UPMB 3GJRB 3AOBA 5IT0A 1WG1A 2B4VA 3TW0A 2HBQB 3HJVA 2C3YA 4C3MA 1VRUB 1RTHA 1CC8A 1N54B 1HMVB 1Y7PA 4NYOA 3HI9A 2PA8D 2G2YA 2RIJA 5CZXA 3SYZA 2NPIA 4XPEA 3D0HE 3OUYA 3I4PA 2NUUG 3KUGA 5KT7A 4X4PA 1HPZA 2DIUA 1HW9A 4GVBB 4Q45A 1WI6A 2UUCJ 4IDKA 4QWDA 2QLWA 2XNRA 2HS4A 4ZPCA 1GXUA 2BM0A 2V4RA 1JLEB 4DI6A 2DGWA 3G8TA 3FJ2A 3N0VA 4JI2F 1OY8A 4Q0BA 3A13A 4NMLA 5HANA 1HNXJ 3EMTA 1HWIA 3R5BA 3ILOA 1JLFA 4F4WA 1WHXA 4RNNA 4OI4A 4ZLJA 5I4MA 2U1AA 3W2VA 3PKMA 1NB2A 3OR2B 2EFOA 3CULA 2ZHOA 2MXYA 2NSCA 4DCPB 2C2OB 4OIXA 1PBAA 2XI3A 3DRSB 4OX8A 3NKYA 2DTJA 2XSJB 5KT5A 2QG9B 5BYQA 3VZIA 5F0WA 2M4MA 3JSYA 2XC9A 3VWSA 5KFGA 1FRKA 1TUVA 4GKKF 3OSNA 2FC8A 4UQGA 3PIOQ 4GVLA 1NEEA 5J2PB 4O0NA 2B8PA 5CH7B 3M2VB 2HIQA 1CLFA 2FDNA 1FRIA 4DU7A 1VQPS 3BSAA 3H7HB 5DRKA 1RWNB 4ID5A 1RAJA 5F8IA 1Q79A 3DRYA 3D66A 1TL7B 4WYLA 2KI2A 3SEOA 5GAEI 4DV1F 3D7SB 1AB8A 1UVJA 2QA4S 2V2ZA 2IVMA 4RBTA 3Q2TC 2Q43A 2DRDA 2EC2A 3EZ5A 4X62F 1R8CA 4WFAQ 2J6UA 2G2OA 1NKBA 2Z56B 2MGZB 4DLEA 2MSTA 4K0KJ 4F04B 2E9TA 4EO8A 2EVZA 2H1YA 3CCWA 2F9DA 2HLUA 3ONQA 3QIDA 2KKHA 1WC3A 3ZZZA 3ENAA 2PMWA 1VLOA 4IQXA 4RZRA 3R1HA 2P9GA 4B3OB 1VC6A 2AJ2A 4I56A 4AL6A 3A8JA 3O1LA 2VG7A 2LQ8A 1EP4A 3UDCA 2ZVSA 2KT3A 4DUYF 2VV5A 1VC5A 4FF3A 3GCWP 3CJ8A 2PEBA 4UOCA 1FESA 5HI7A 1RACB 4ZVHA 4YN3B 3G6VA 1S9FA 1N32J 3BH7B 2CG8A 2OUGA 1FI4A 1X0PA 2WONA 2HZAA 4KO0A 3UDLA 4JI7J 4JYAJ 5D0HA 4TQRA 1VIOA 3LGNA 2Y1IA 3VAKA 2MQQA 2DH9A 5SUHA 4BDPA 2KG0A 1AT1B 2ZE2A 3NXZA 3V6DB 3H2LA 1TV6B 1M90T 5KFQA 3IM9A 4A4JA 4IO1A 1MG7A 4JV2A 3OD2A 3H25A 1OWXA 2H3EB 4PXEA 2K1RA 1AROP 2H4WB 2F5GA 5F9LA 2RRNA 5F8NA 5GAHU 1TMMA 2BA9A 3BJYA 4G1IA 3KHLA 1A7GE 4K4VA 3VAHA 3D67A 5L8RC 1KN6A 4UT4A 4K4UA 4LRFA 4JB8B 1YRUA 4H4OB 2YWKA 2XZWA 4P2XA 2R8JA 2F40A 3MPVA 4F2RA 2HQCA 2W7AA 3M7VA 3LQVA 3P3DA 3EVWA 2ZVIA 4R5PA 1N5TA 4B9UA 2IPOB 4P9SA 4FNIA 3K5MA 2ZZMA 2QEXS 1WHVA 3GIMA 2WHOA 3U1MA 4DSKA 4P72A 1K1QA 2CJBA 4WU2A 2JEIA 3SCIE 1SJ3P 2BMBA 2R7UA 1DARA 3LAMA 3C6UA 1RLDA 4ED8A 4ED6A 2HWIA 3QYYA 4LBPA 4X64J 5IQQA 1WELA 2VFTA 5HMYA 2H54B 4OYMA 1UEKA 3CUNA 3TUZC 2GW8A 4ZVRB 4PAAA 2KRBA 1RT1B 3A12A 3TNVA 3MFIA 3HVTA 1KQSR 4WZQA 3A3PB 5HVGA 4EBEA 4G3IA 2GCFA 2O67A 2Q66A 2R7OA 3MPUB 2DEJA 2JEGA 3D5MA 1NPRA 3J7YU 4YDDB 3DYAA 2VQFJ 3G87A 4D3GA 3VAJA 4X65J 4X4OA 1MSWD 2MQPA 4PUOA 4LFBJ 3IC1A 1LWXA 4X84A 4DR3J 1M5OC 2XS5A 1KQGB 3R7BB 1CEZA 3H59A 1NSQA 3VTIA 1H2UX 3BEGB 4USTA 2C3OA 3WQPA 4NZ6A 3Q22A 1VC0A 4MIWA 4E0DA 1WOOA 2XB2D 3NCPA 4KAIA 3KNGA 1VRTA 1GXTA 1BC6A 2FLOA 3VGTA 1PSDA 4USMA 2H9ZA 3C6TA 2UUBF 2KHDA 4KTQA 2AJ1A 2C2MB 1NJWA 3WHIA 2ZITA 2DVIA 3PFOA 1LFPA 1SQGA 1LWFB 2B6AA 2EXUA 2GO8A 2UXDJ 2JH3A 2MTLA 3MR6A 3DDNA 3MUMP 2VODA 3FFIA 3MM6A 5DM6Q 1VJQA 3W5ZA 2J76E 2LQJA 4A8MP 3OJUA 5HVFA 3DRRA 2ZBQA 3VAIA 3BGLA 1EJ7L 1TL5A 4USJC 5A0YA 3M8PA 4ZVSB 3MMCA 4DR4F 3DC2A 2DCLA 3CJKB 2WW8A 4QIVA 4OHXA 5G4DA 2V4QA 1Q5VA 3RW6A 2RHSB 2AJQA 4U96A 4ZN3A 2BZ2A 3IGNA 3CJ4A 2EKYA 2AGQA 2JWNA 2KJVA 3T5HA 3HHDA 3PJWA 1RWVB 2QL5B 1RU1A 3ZZPA 1S6PA 3RAXA 1N6QB 5LJ3Y 1T9VA 3C2PA 4WIQA 3SCJE 3MECB 3JB9k 3QMQA 3H42A 1Y9OA 3LF0A 3VAGA 1YBAA 1SKUB 4DSLA 3R7SB 6AT1B 1GH8A 3M32A 3R5CA 3ADAC 2D3UA 1HR0J 4P10A 1YZ7A 4ZPWR 1U4BA 3DM2B 3M30B 4OI1A 5L46A 2VL1A 3DU6A 5HJYA 1RKJA 1CJKB 1U26A 2EI5A 1FK9A 4HVZA 3OSPA 2F4VF 3B4DA 1CC7A 2GV1A 5FDLA 2VG6A 2FVRA 2JLGA 4IH6A 3EVMA 3LWMA 4FYYB 1UJ6A 4OJGA 5B09A 5L38A 2BEFA 4RW4A 1S79A 2IRXA 2QA2A 4A8WA 1VRQC 4DL3A 3CMES 1C0UA 1NH8A 2KFYA 4P74A 1GXLA 3MMJA 2FJEB 2RQKA 1H98A 1IKYB 5RUBA 3BYRA 3BSCA 3D6TB 4MKYA 4HHHA 3ULHA 2FGOA 2OMLA 5JUMA 3FGVA 3H5UA 4F4KA 1O8BA 2MLZA 2DEIA 2M8DB 2E66A 2XZDB 3I82A 1RHKB 2XY5A 2EW9A 4C8OA 1OQ6A 1UFLA 1KQFB 2NXJA 3OBIA 3GU0A 2HQ3A 1LK5A 1RDRA 3ZNUA 2WOMA 2R7SA 1YK9A 3BGUA 3UVJB 3W65A 1JQGA 4NYPA 5M2PA 2W8LA 2Z0GA 3NWRA 2AZ1A 3BGRA 3HVRA 3CCJS 1WNEA 3IA0A 4LF5F 3W2WB 1FD2A 3ZTPA 5T41A 1WEXA 1T05B 3UWTA 1KVJA 2V8HA 1DJ0A 3CJQA 1RYSA 1QM9A 4M8LA 2FY8A 2EC0A 1S1XB 1AXQA 4DV2J 4MH8A 3V81A 3NY0A 2OPPB 2UVRA 3BZQA 1D9DA 1T9YA 2ZBCA 3MM5A 1FDDA 2UVUA 3C14A 5L1IA 5CD4A 1GK8A 2W4CA 2NPFA 1FVSA 4B02A 4P75A 1FWKA 4WK3A 1MWZA 5C25B 1CVJA 2ABYA 4PPZA 3M05A 2EG1A 4C11A 1NAQA 2VG5A 3DGPA 3LOUA 3S6EA 2LKZA 2HVEA 1RHUB 4WP3A 3KJNB 4ALZA 2E1PA 4FF2A 2LCWA 1MLAA 1RA7A 1KLMA 4ED3A 4Y2MA 1R8HA 5IS2A 3VALA 4NXNF 2B9XA 4I6AA 4NLYA 2HMIB 1A9NB 4Y34A 3SSRA 1YTYA 2OLWA 4L3NA 2YX1A 1TFYA 3MTJA 4PG5A 3HDSA 2MB0B 3LP2A 3NNAA 2JNJA 4DV6J 1RHJB 4ZS6A 2Z57B 3R97A 1NK6A 4B9LA 1GAOA 1S9EA 3BKTA 4ELVA 1EKSA 4RR5A 1O5JA 2R2UA 3BBBA 2QL9B 3KLGA 5LMUF 2RNEA 3EM1A 4RO0A 1UVLA 3OQ2A 3K5OA 4JI5F 1EAYC 5F8GA 2D74B 5T7LA 3NMAA 1JXEA 4U8YA 2XQCA 1TZ0A 3P5TL 5EDWA 5U47A 4CTAA 1JMTA 3EYZA 4TLRA 1K0TA 8AT1B 4J9LA 5K8NA 2YNIA 2QYGA 4P6QA 2VC1A 1Z2LA 4ZN1A 1UA0A 3TI0A 1D1UA 1YDLA 3DMJB 3NCRA 1AUDA 5LSRA 1VK8A 3CCSS 1TKZB 2GAHC 4PYDA 1PCAA 3SXLA 3C16B 5AE1A 2B9YA 2XLIA 3JQJA 4TYAA 2JC0A 2OP5A 2BE9B 1SC3B 4DR1F 2DR7A 3WDOA 1CJTB 1TELA 1TKDA 4R8UB 3HD2A 4BWMA 4LRAA 4KH0B 5JJBA 5GADU 4ZVQB 1NZAA 3AOAA 1V5VA 1LNQA 5IC6B 4OZJA 3RR8A 3OPKA 4DPUA 3CNQP 3C8YA 3UCZP 4EK2A 1Q1KA 1R3NA 3CCLS 4C8KA 2FHKA 5IFMA 1HFEL 3TEHB 2W9CB 2KFZA 5AJ3F 3R9LA 5KG0A 3P6YC 4Z37A 4K59A 1S77D 4FKXA 2XMWA 2YQ3A 5D77A 1QJHA 1J5EJ 1HKAA 4BC7A 1UP1A 4CO3A 3ET6A 2XMTA 2I0XA 2YWFA 5D3GB 1Z1ZA 2VFRA 3Q2SC 4RW9B 2XM3A 3VV2B 2FPHX 1LOUA 2EFPA 3UW1A 1BD6A 4ETXA 1WC6A 4Y0FA 3GFXA 3BPDA 1U48A 2LECA 3L09A 3CCRS 3H4DA 1L3KA 4HL9A 1NJYA 1NK8A 3VAFA 2KG1A 2Z30B 2EFQA 4JI0F 4CLYA 2HHVA 2LQBA 3HSJA 1GFWB 2H48B 4NCAA 1G6BA 3ILJA 3TA1A 4K4SA 2ROPA 2VDIA 2ADBA 3LALA 2FVCA 3B54A 4PWDB 1QDUB 3PEJA 1F9HA 1YHQS 3IS9A 3TAMA 1EETA 3H0PA 2AHOB 1R8AA 5B0BA 2P9EA 2UXBF 2COLA 1WC4A 4CYUB 3FEYB 3TJ8A 1H72C 4ATNA 3AJ2A 4RW8B 1YBUA 4IH7A 5ETPA 1Q95G 3RG6A 3H5XA 2NLWA 2ZM6F 4HKQA 1ULRA 4F26A 1DY3A 4DCOB 4EYIB 2BRLA 2RS2A 1XR5A 3C3LA 2M70A 3IAM9 5CYJA 4NLPA 4WXWA 5E3AA 3AXMA 2R7VA 3DI6A 3ZO7A 1IBMJ 5EX0A 2PE8A 5L9XA 3UCUP 4OQJA 2HNYB 3PV8A 2PO4A 2YXLA 2HZCA 1RWXB 1G3OA 2HSEB 4JBCA 2ATCB 1FE4A 4C7QA 2J9CA 3KHHA 2Q3PA 1NSKL 2FC9A 1NSAA 3QSIA 2HNDB 4DV4J 3NRBA 1WSRA 5IWAJ 3OR1A 3W5XA 1HI1A 3W9IA 2W2OP 1FWLA 3EXCX 3OL8A 4RBVA 4K50A 3HK2A 3G8QA 2VPXB 3DOLB 5F3TA 1E6VB 1TUWA 1YJ7A 2RS8A 2YWWA 4YMEA 2CJAA 2CNNB 3RGIA 4CLPA 3U27A 1DHMA 3SBMA 2VASA 1CJVA 2W2PP 3FQKA 3J7AN 1FJCA 3M8ZA 3KXDA 1M5KC 5KFJA 2BJDA 4FXWA 4TYBA 2LU2A 3I0SB 1F3FA 5B0FA 4M94A 3DLGA 3MMBA 4MK9A 1RXOB 3QZ7A 3O2IA 1RT2B 3HHLC 2I9SA 3RR7A 5DG7A 2DD8S 1IJEB 2V8DA 1T7PA 3ZTOA 4N8NA 2WRMA 3UI3A 3G4SS 1TU0B 1WF2A 4LRCA 4DQSA 2CRLA 2ZEJA 4KHPJ 4PG7A 2HFOA 4OZ3A 3C15A 2NREA 1S5ZA 4OV6A 5DG8A 1E6YB 1OPZA 3SQOP 2IHR1 1F5BA 2A0FB 1QUPA 1N48A 2V50A 5H1SV 1SXLA 2Y0SD 3MAAA 4DL2A 4HR2A 4H4KA 2G9OA 1HBOB 2D1CA 1F9FA 2LA6A 3VGUA 4AQYJ 3AODA 3HFVA 3QGHA 1QE1B 3IGVA 3JYTA 2QIFA 3W8GA 1I1GA 1UJ4A 1TL3A 1CULA 1NRKA 1YWXA 2BACA 4G1QA 1CQNA 3JSMB 2OPSB 1FKPA 1DLOB 4G6VB 5I3UA 2YKMB 3OVBA 4NLUA 4J9OA 4IG0A 3SMZA 4ICLA 2D69A 2JVOA 3NP5A 3B4MA 2WB1D 1FTCA 2PFFB 4EUVA 5IT9U 1Q0NA 1HWJA 2YNHA 3MD1A 2HHTA 3TANA 1D3WA 2UVWA 3LP0A 2GAGC 4ZCIA 3NS6A 4KIAA 3KNAA 5DDPC 1RTIB 3RUBL 2MY8A 1LV5A 3FVYA 3CE8A 4KE5A 5IT9Y 2GC8A 2MKJA 2F8MA 2Q6BA 4NLWA 2OTJS 3AJ1A 1XC9A 3MM7B 1S0VA 5GAGU 2XBPA 4HTJA 2CJYB 1D8YA 3BREA 2POKA 3A3OB 4B3TF 1N34F 1WTFA 1Y4ZB 4C0HA 1N0VC 1RT3A 3DOKB 3GTYX 2W9BA 4K4YA 3T1HF 1YSJA 2AJ0A 2ZD1A 3QRPA 4ANCA 1R0AA 5HO4A 2CPFA 2CZVC 3GR1A 4H4MA 4YHHJ 4PPDA 3MD3A 2HFNA 1RHRB 3R2DJ 4DR6F 4XK8C 3PJXA 4OYBA 1LKZA 3QT8A 5M2UA 3E01B 4KPCA 1XNQJ 4OYZA 3DHXA 4HEA9 3OFFA 1ICEB 2IBOA 3MR7A 2ZOMA 2VKZG 5GAEU 2EWHA 2OKQA 1S4FA 2VFUA 5CYQB 1NDKA 2IC3B 5D4LA 4OZ0A 3IWLA 2E1CA 2ILZA 5AXKA 4M5HA 2PIIA 3PTWA 2UUWA 4KV8A 4W98A 2J9EA 3DRPA 2G1DA 1Q5YA 2BOPA 2JJ4D 3PO4A 5HMXA 2RQMA 1U6FA 5KFRA 4JI6J 2R8IA 5KFEA 4FPIA 4F02A 1NHVA 4QWEA 3KJQB 1FX2A 3OTCA 1HNVA 4L76A 3IMQJ 1OQ3A 3M9OB 4RL1A 3KG0A 3W62A 1S97A 2OD4A 3F56A 3KG4A 5C7PA 2DNZA 2CFXA 4P73A 1CS4A 1HHSA 3CDUA 1LFWA 3DU5A 2N3LA 3K2YA 4DU8A 7FDRA 4W92B 4F4ZA 4FVCA 1SUQA 3BYPA 4H54A 3KOAA 4O44A 1L3VA 2OMOA 2VOOA 2HFSA 2ZHAA 2WAQD 5LT5A 3H8YA 4TY8A 2CNLB 1BQNA 4EFAC 1DTQA 2HQGA 3R5AA 4PQAA 1B70B 2CADA 4LVOP 4DR7F 1WSVA 5KFNA 4LSLA 1HYSA 2GVZB 2V67A 1JNRB 3GPAA 4A8OA 1XJWB 1QY7A 4F3QA 2HPUA 2X3GA 1TVRA 3MFHA 3G6ES 1C1CA 4XIUA 4M5DA 4FS1A 5CA5A 2RF2A 2OSRA 3BR8A 2N4CA 3N4WA 1T03B 4IG3A 3HM9A 3M9MB 4K4ZA 2W01A 4IRCA 1VDHA 1HIYA 1VBXA 4QBUA
chains in the Genus database with same CATH topology
4QOTA 5BYQA 2CQPA 3VZIA 5F0WA 4B9VA 2M4MA 3JSYA 5A8WB 2NQPA 1OSDA 3FEZA 5EX3A 4WFYA 2XC9A 4NCGA 3VWSA 5KFGA 1FRKA 1UVKA 3ETOA 1FRHA 5JVHQ 1SBRA 2YKNA 3AHPA 1TUVA 3BR9A 4I2PB 2KH9A 3HXMA 4QCLA 1BQXA 3BO4A 5HBMB 4GKKF 3TOQA 2E44A 3OSNA 2FC8A 4UQGA 4EZ6A 2BE2A 3PIOQ 2L9DA 1HBOA 2DR8A 1O0PA 1NEEA 5J2PB 2MKKA 4IQMA 5CH7B 3M2VB 3L3CA 1VRTB 2CJKA 3CT9A 3PX0A 2HIQA 2IBKA 4M95A 1TL1A 2B5JB 4BWJA 3GILA 3SQGB 4LQ3A 3X3UA 2JFDA 3HKWA 2DCUB 1QE1A 3C6TB 3UE2A 4DFPA 1TV6A 3QGGA 5F8LA 3M6WA 4I7FA 4RNOA 1CLFA 3MPWA 2FDNA 3KLVA 2FTRA 1FRIA 1VQPS 1MNEA 3BSAA 3LP1A 2GHPA 2RDIA 5DRKA 1LWCA 4ID5A 3BSOA 2DR9A 4NLQA 4RU2A 2AJ4A 1GX5A 2OPQA 3JSMA 2OPSA 5CHCB 1RAJA 2MHNA 3SCLE 2ROEA 1DLOA 4TU7A 4C3LA 5F8IA 1N88A 1Q79A 4OI3A 1RGVA 1FRXA 2YKMA 3CJ0A 3DRYA 4M1KA 4A8FA 1IBMF 1TL4A 2B6AB 3CMAS 4JUZA 1JLGB 1XMBA 4WYLA 2KI2A 3SEOA 2EBEA 1S1UA 4I0WA 5GAEI 4DV1F 2I38A 5J2NA 2R2SA 1UVJA 3G6XA 4N77A 2IRUA 1FKOB 3PR4A 2ILYA 3BM7A 2QA4S 3CCTA 1GTHA 4O4GA 2IVMA 4DL7A 4ES1A 1U1OA 1NJIT 4RBTA 4OZNA 2M3DA 3Q2TC 2Q43A 3FFIB 1S6QA 2IVYA 3EZ5A 4ERDA 2M5YA 2R2TA 1JLCA 1X4HA 4X62F 1R8CA 1O51A 3BGFA 3K0JA 1U2FA 3CF5Q 4WFAQ 1WHYA 2APOA 4ZP7A 3H4BA 2J6UA 1NKBA 4JV0A 4N76A 3PM9A 3OJSA 2ZDOA 4P7VA 4J9MA 1HQUB 1UWBB 2IM2A 3BDEA 4DV4F 2MGZB 1RTIA 3J7Z5 4DLEA 3K57A 1FHTA 2MSTA 6FDRA 5IWAF 3DRRB 3ENVA 2E9TA 5GADI 2WTFA 1FKAF 3IR7B 1S7HA 2EVZA 3IBWA 4DDFA 4EO8A 1OSCA 3FDSA 5MAOA 4NLXA 3CCWA 4K4XA 4IO9Q 3PW0A 3QJJA 2F9DA 1BQNB 2HLUA 2KYZA 3ONQA 4A8YA 2D9PA 3GFHA 3QIDA 2D7SA 5A0YB 2FJXA 3M8PB 1B64A 3MMCB 2KKHA 3GMGA 4BBYA 3X1LB 1RT6A 3ZZZA 3MM7A 5C42B 4OJ1A 3MR2A 4ID8A 4RZRA 3T5KA 3R1HA 3CC4S 4IQXA 2P9GA 2R7RA 3T19A 4B3OB 4A8XA 1VC6A 4J9RA 1HA1A 2J0WA 3PNIA 1X9MA 2OTLS 4I56A 1TAUA 4LSLB 1HYSB 1LXJA 4K5SA 4K4TA 4AL6A 2JFKA 2XWXA 3O1LA 2I2YA 2VG7A 3DLEB 3CD7A 2LVWA 1FT8A 2DR5A 1N5YB 1EP4A 3R27A 2ZVSA 3UDCA 2JL9A 1N5VA 2NZ4A 3D1OA 2KT3A 4DUYF 5B0CA 2VV5A 1VC5A 3DOKA 4FF3A 2I5JA 3ZZ0A 5M2RA 3Q8SB 1C1CB 2J6SA 4J5OA 2OPRA 4GKJF 3KLHB 3QAEA 4UOCA 4M5DB 1FESA 2CPEA 1ZM2A 4ZP6A 4WXOA 4TN2A 5HI7A 1QVGR 1S6PB 4AXIA 4ZVHA 2YKAA 2UU9F 5KG4A 3IRWP 2VA3A 3HHNB 2DGOA 3G6VA 4QU7A 2HVIA 3HO1A 3RRGA 2QMWA 3GSDA 3IFEA 2QT7A 3RAMA 1S9FA 2QMXA 5FD1A 2VUGA 3K59A 2GMLA 1YQHA 1SB6A 3QPIA 1FRLA 2C42A 2DNOA 2RB7A 2Z4PA 4MFBA 4C0OC 4DV0F 3MI7X 1RJJA 2PD1A 2B51A 2DGXA 4DV7F 2IA6A 4RKUC 1X0PA 2WONA 4KO0A 3QGIA 3M32B 5I42A 4TU8A 2FUG9 3MR5A 3E01A 4IYQA 3ITHA 2U2FA 3UDLA 3J7A1 1FERA 1ZPWX 3N28A 5CZVA 1FNMA 1SIWB 1P6TA 5F9NA 1R31A 2F1FA 2XMUA 4TQRA 1T3NA 2DJWA 4ZP8A 1VIOA 3LGNA 2Y1IA 4CCHA 2DBBA 1JLQA 4ILRA 3VAKA 3PVXA 2BE2B 2MQQA 2DH9A 5SUHA 4LUBA 3NMRA 4BDPA 1VK3A 1MMNA 4YR2A 2KG0A 2WK4A 2UV8A 2ZE2A 4KHPF 5EHHA 1CG2A 1Z2ZA 2FD2A 2M0GB 1NO8A 4NLOA 2XGQA 3ZZOA 4DSFA 2CVIA 3V6DB 4U7CA 1SH3A 4KT0C 4HYKA 1QTMA 3H2LA 4HT7A 3TA2A 2IJFA 2R7TA 1TV6B 4YB5A 3D0GE 5CYQA 1M90T 5KFQA 3ZZUA 1RK8A 1IKXA 2IC3A 4A4JA 3G8SA 4IO1A 4B9MA 4JV2A 4R25A 1W2BR 2ZDPA 1FK9B 1Y5NB 3EGWB 3HHKA 4PKDB 1VOMA 1JB0C 1XTZA 1ZAVA 2N7YA 5FLXY 3H25A 2N82B 2OPQB 1OWXA 2GMHA 2GMJA 4PXEA 2DITA 2K1RA 1X7VA 2XMMA 4JV5F 3ISND 5FDLB 1AROP 1YJVA 4I64A 2VG6B 4O3OA 3VQSA 5L9NA 4I69A 4ZLPA 5F9LA 3ZZYA 1Y0HA 5DQIA 3FNNA 3ZC4A 2OH2A 4KKOA 3F44A 2RRNA 5F8NA 1T94A 3CIMA 3CC7S 3CIZA 4WFNQ 5GAHU 4AXJA 2BA9A 3N5FA 1MW7A 3BJYA 4G1IA 4UUWA 3KHLA 4NLSA 4O4GB 2CZ4A 1A7GE 4K4VA 5DJBA 1WI8A 3VAHA 2MQLA 4PXCA 4RW4B 2WBRA 3I5BA 2K7KA 5L8RC 4AQYF 2ZUGA 2EG2A 4ES3A 3CCUS 1KN6A 2KXHA 3POTA 3M6VA 3RW7A 4K4UA 4QW8A 5JVGQ 4YUDA 4U7UK 5HN0A 2YNGA 3I87A 1YRUA 3HHLD 4H4OB 2MQOA 1FE0A 3PACA 3R1LA 2YWKA 2XZWA 2R8JA 2F40A 3I5CA 4N47A 1XK8A 5DLFA 3MPVA 4OI6A 1K9MT 4F2RA 3M1VA 3I9ZA 3MURP 2LEPA 2K7JA 2F8HA 2W7AA 2BW2A 2DGTA 2YKOA 3LQVA 3P3DA 2RT3A 5KFDA 3IG1B 4C3KA 2LDIA 2XSFA 4J9QA 4MJKA 1SJ1A 4OHVA 5E2QA 3ISZA 3QIPA 4R5PA 4OLPA 3MAQA 3AQOA 1N5TA 2GHWA 4F4XA 4B9UA 4AYBD 2LQ5A 3SFGA 1XMQF 4FNIA 2EPIA 2RDJA 2VBZA 2YX4A 3K5MA 1S1WB 2ZZMA 1JKHA 2QEXS 1WHVA 3GIMA 2WHOA 3U1MA 2E29A 3BN4A 4I6YA 4QR0A 2HHPA 4QPXA 1BGXT 1U25A 5E3QA 2M9KA 2K2PA 1LWFA 3RB6A 1X5SA 4F3OA 3I55S 2WB4A 1LW0B 4DSKA 3ENQA 3NWGA 1Y00A 2AGPA 3M2RA 2A2DA 1K1QA 5B0EA 1KTQA 2CJBA 4N56A 2VFVA 3BO3A 3DLLQ 3KFWX 4WU2A 1UVMA 2CDQA 4PG4A 1ZM9A 2B7BB 2RD5C 4IFVB 2JEIA 1VRUA 3SCIE 1EP4B 4LVNP 4B3RF 3T1YF 2WOMB 2ERRA 2B9WA 1SJ3P 1IJFB 1Q53A 2R7UA 1HMVA 1K8AT 1DARA 2RSQA 3LAMA 2MDAA 5KAKA 5DO2A 3C6UA 4XPCA 3CSKA 1Q7LB 3KMSA 4ED8A 4ED6A 3MHYA 3NBPB 2HWIA 4Y2CA 3UCGA 2CQ0A 2E5IA 3QYYA 2VONA 4NA3A 5F8MA 3BGRB 2DPJA 2QE5A 4O3SA 5IQQA 2R7QA 3M9NB 1Q8LA 4ZPTR 1H7XA 1WELA 2J0XA 2VFTA 5HMYA 1N5SA 1Y3KA 3G6YA 4EBDA 5AXLA 4IKAA 1DURA 3CUNA 4NZ0A 5I3PA 3TUZC 4ZP9A 2GW8A 1F5CA 5HP1A 5CCLA 4HHJA 1P1TA 4KO0B 3TP2A 3TUIC 3KHGA 2FVQA 2B0GA 1XEZA 2KRBA 2YWGA 4I4BA 2XULA 5E3RA 1RT1B 1X5OA 4WKYA 3TNVA 3CJKA 3MFIA 2ZH4A 1FCAA 1Q8IA 3HVTA 1KQSR 5HMZA 5B0DA 1K1SA 3B82A 4WZQA 4EBEA 1FA0A 4G3IA 2CQCA 4DL4A 1HW8A 3P49B 5AE3A 3UD3P 4CO1A 2GCFA 2Y1JA 3CXCR 2EBGA 5D8HB 2O67A 2RILA 2Q66A 2R7OA 2MKHA 1R6YA 2LYVA 2ZE2B 4DG1B 2JEGA 2LXFA 4YHHF 2NS1B 5KG1A 3OVAA 5E41A 3MGJA 3KK2A 3D5MA 3KHRA 1U1LA 2FIUA 4HI2A 1X0FA 3BF4A 3EPIA 3J7YU 3S1TA 1L3UA 4KGMA 1KFDA 4YDDB 2HVHA 3DYAA 2LEAA 2MPUA 2AYGA 1B0PA 2B4PA 3MM5B 1IKXB 3LUYA 5DETA 3DNCA 3QAUA 3DHWC 5SZTA 1ZTWA 4D3GA 3VAJA 2BVZA 2AYEA 4X4OA 1S10A 3OR2A 5LXYA 1JK9B 1MSWD 2MQPA 4PUOA 2VD3A 1TKXB 2MSSA 1ZTTA 4L72B 4C4WA 1XNQF 2ZH1A 2VPYB 3IC1A 4RW6A 4ZCLA 2Z2LA 2J0QD 3MM8A 2R7WA 4X84A 2ASDA 1T03A 3CDAA 1HL6A 2IJNA 4NYZA 4OJHA 1M5OC 2XS5A 5A8RA 3MM9B 1UMJA 1S72S 2XSJA 1KQGB 1CEZA 4C11B 3H59A 1W25A 4NLTA 3VTIA 2VG5B 1ZAWA 4ZPBA 3V5RA 1H2UX 3BEGB 4HTIA 5J1PA 3T9NA 4FNHA 2V2KA 2K8GA 1N0UA 3AH6A 4ED7A 5KFOA 2C3OA 3RRKA 1M1KT 3FMWA 3CTRA 4FXDA 4NZ6A 3Q22A 4URSA 4I2PA 1VC0A 1FDAA 5HBMA 4MIWA 4CNZA 2DT9A 5IM0A 1YJ9S 4E0DA 2XB2D 3M1VB 2PA3A 5J2PA 3NCPA 4KAIA 4Q2LA 4ECQA 3KNGA 3M2VA 1VRTA 2IM1A 1NHUA 2IA0A 3M30A 4Y2IA 1X9WA 1KS2A 1GXTA 2KT5A 2B5JA 1BC6A 3RTVA 5KFVA 2FLOA 1PSDA 3MF5A 2H9ZA 3C6TA 4R5PB 2UUBF 4KC5A 4IUFA 5J2MB 2FLLA 5K5MA 2KHDA 4KTQA 1GNKA 2MY7A 3NGKA 2YTCA 5G0RB 1ZZNA 3J80Y 2JRSA 1X8DA 3D1QA 2AJ1A 4CO0A 1NJWA 5KOWA 2DNQA 2ZITA 4DOZA 1NKCA 2DVIA 1R8BA 3PFOA 1LFPA 4JI6F 1TK5A 2HWTA 1LWFB 3N6LA 2B6AA 4FZVA 2GO8A 1JLGA 4Y65A 4P7TA 3M2RB 2JH3A 4QWAA 3PW5A 1OS5A 3AQPA 1WF1A 1S9EB 5D4PA 4X4VA 1FKOA 3MR6A 1HNWF 2E9ZA 3DDNA 3HKZD 1CQMA 3GR0A 4XAKA 3RBDA 1U1MA 3MUMP 4Y2AA 2VODA 1S6UA 2QFJA 2PGCA 4Q43A 4AUKA 2UXCF 2W4PA 3FFIA 4CH0S 3MM6A 2V9KA 5DM6Q 2F7VA 3MEGB 2G0CA 2FJVA 5CYMB 3KMQA 5A6WA 5B0AA 3KLGB 1H6KX 1UL3A 2RRAA 1HWUA 5MLCV 2E7XA 2E1RA 5HLFB 4IRDA 1VHFA 2J76E 4DS4A 1HQUA 3FCHA 1UWBA 2LQJA 2ZHBA 1V9OA 5KOXA 2XMKA 1T3OA 4WIIA 4NPOA 4XDDA 4Y00A 4RWXA 4A8MP 3OJUA 1IKYA 4I2QB 3DRRA 3DLJA 3FQLA 2L48A 5GAHI 5J2QB 4FBUA 3D28A 5H9FJ 3VAIA 5T7LB 2IMOA 2J0SD 4MAKA 3BGLA 3TO8A 1TK0A 5HP1B 2AF6A 1TL5A 4USJC 2L9WA 2VBWA 3M8PA 5A0YA 5EN1A 3MMCA 4WTYA 4DR4F 1QSYA 3DC2A 2DCLA 3CJKB 5C42A 2BANA 2WW8A 2A10A 2V8GA 4ZCKA 4CTAB 2ASYA 2UZAA 1FNXH 4QIVA 4OHXA 5G4DA 2V4QA 3RW6A 3TVYA 2GA7A 4NA2A 1YI2S 1U47A 1SH0A 3UR0A 2AJQA 2BZ2A 1UW4A 5BYRA 3CCVS 1SH2A 3IGNA 2AP6A 4PWUA 3GFZA 3CJ4A 2EKYA 2VPWB 2AGQA 2JWNA 5T14A 3V4IB 3KK2B 1DQ8A 3AA8A 2HG4A 1B0TA 2KJVA 3T5HA 3HHDA 3PJWA 4RNHA 3TARA 1N5YA 3NNCA 3P96A 3M2UB 3MOJB 3GIJA 1ZAXA 2DRAA 2HHQA 1V3ZA 2BQUA 3O44A 2DNKA 2UUCF 4EBCA 4QZVB 3KLHA 1H38A 4F67A 1TQLA 3H5SA 3ZZPA 2FHJD 1XR6A 2VB6A 2B4OA 3UPFA 4TQSA 1S6PA 3GG1A 3RAXA 1N6QB 3TRGA 5LJ3Y 4PUOB 3EXYA 5GAGI 3C2PA 2R8GA 2MHEA 3FSIA 1URNA 3SCJE 2KM8C 2V8VA 3MECB 1Y5IB 3MM8B 3JB9k 4OHZA 3QMQA 2ZFHA 3DN9A 1Y9OA 3LF0A 5A8RB 3VAGA 2JEFA 1YBAA 3DLKA 2HHWA 2E1MC 3W2WA 2JSXA 4AE5A 3HT3A 2ZH3A 3SFUA 2RU3A 2AD9A 4DSLA 4MK8A 1HNXF 3OHBA 1GH8A 1IKWB 2G4BA 3U1LA 3M32A 3R5CA 3JTOA 4ED5A 4OI0A 4YOEA 1Q7YT 4NLGA 1HD0A 3HLUA 2M7SA 1HQEB 1VQMS 4LIWA 4IOCQ 4Q7AA 3F41A 1C1BA 2GQQA 4ZPDA 2D3UA 5IM0B 4WJBA 4BS2A 5KT2A