4OZJA

Glnk2 from haloferax mediterranei complexed with adp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
118
structure length
104
Chain Sequence
LPNDGGIKLVMAIIRPDKLADVKTALAEVGAPSLTVTNVSGRGSVDLHQKVKVECVVADTPAEDVADAIADAAHTGEKGDGKIFILPVENAIQVRTGKTGRDAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogen regulatory protein P-II
publication title The structure of a PII signaling protein from a halophilic archaeon reveals novel traits and high-salt adaptations.
pubmed doi rcsb
source organism Haloferax mediterranei
molecule tags Signaling protein
total genus 21
structure length 104
sequence length 118
ec nomenclature
pdb deposition date 2014-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ozjA00
3O5TB 1QY7A 4CO4A 1V3RA 2GW8A 3LF0A 1HWUA 4OZLA 4E98A 1V9OA 3OPKA 2PIIA 4C3MA 2V5HG 3CE8A 2NS1B 1O51A 5D4PA 4CO1A 3BZQA 3TA2A 3DFEA 3T9ZA 4NYOA 3HLUA 2JJ4D 4WK1A 1V3SA 1OSCA 1NH8A 3MHYA 1V6HA 1Q1KA 1VFJA 3N5BA 4CO3A 2ZOMA 2DCLA 2NUUG 4Y65A 4CO0A 4C3LA 4ZK7M 4RWWA 4CNZA 4C3KA 3AH6A 2J9EA 5D4OA 1H3DA 2J9DE 3NCQA 2CZ4A 4YB7A 1PILA 2E66A 3AA8A 2XG8A 2J9DA 3TA0A 4D3GA 2XULA 4YB6A 4CO2A 1NAQA 1GNKA 4CNYA 3AHPA 3GSDA 4OZJA 3NCPA 4WK3A 2EG2A 2ZFHA 2O66A 5DRKA 4USJC 2O67A 1UFLA 5D4LA 1NZAA 4RLEA 4NYPA 2VD3A 2XZWA 2GNKA 3X3UA 3M05A 1UMJA 4RWXA 4AFFA 1XK8A 4CO5A 3TA1A 1P1LA 2XBPA 4R25A 5D4NA 1UL3A 1UKUA 2EG1A 4IYQA 4OZNA 5DS7A 4D3HA 5L9NA 4Y6IA 3NCRA 2GX8A 1NH7A 2NUHA 2Z0GA 1J2VA 2RD5C 3L7PA 4YB5A 1O5JA 4USHA 1KR4A 2J9CA 4USIA 1VHFA 3AA9A 4RX6A 3O8WA
chains in the Genus database with same CATH superfamily
2GVZB 4DPWA 4OIXA 3QRRA 2JLFA 1K1SA 2RSQA 3O44A 2NXEA 4EU0A 4F4WA 4WFYA 4EO8A 2XB2D 3KNAA 2HGLA 2AWZA 4MAKA 4USVA 1H98A 3GR1A 5KT4A 4PWDA 2RNEA 1VI7A 2IA6A 4CO3A 1K0VA 1GXLA 3LQVA 2GGPB 1NKEA 3KK1A 5CCMA 2J9EA 2GQQA 1F3FA 1KVKA 3C46A 1PKUA 2AGPA 1PBUA 3MMCB 4LSZB 4JI5F 3M4XA 2HVEA 2FHKA 1XMOJ 2DISA 5LMUF 4USJC 4BLGA 1WF2A 5DZ6A 2VG6A 2HK3A 3OR1A 2OFHX 3CCWA 4WFNQ 3VZIA 1JX4A 4B9SA 2UUBF 4FYXB 2IIHA 2EC0A 2VC0A 3SQGA 1NLKL 5DS7A 3I9V9 2HURA 2CZVC 2E7WA 1QSSA 3BM7A 5H9EK 3UE2A 5A8WA 2DRAA 4NLRA 2ALZA 3DI6B 1VRTA 2XGPA 3Q8RB 4ZPVR 3MM7B 2XWXA 4I6WA 1GXUA 3RU0A 3FZ2A 4DV7F 1RT5A 2VBZA 3HSDA 1S9EA 1FKAF 1V5VA 2RH3A 2J7KA 4J90A 1F9EB 2FJAB 2B4PA 2NUUG 3IS9B 1DLOA 4CLKA 5D78A 2F1FA 1FFGB 3LO3A 5H9FK 3LOUA 2POKA 1ZOTA 2C2NA 4K59A 4OX7A 3ONQA 5E33A 1WNEA 3W66A 1IM4A 1I5OB 4ZCKA 4RUHA 3MAHA 2XI2A 3W3SA 1S6QB 1TVRA 1S4EA 1PSDA 3ZFVA 2E1CA 4IFYA 4ZP6A 4NYPA 1BC6A 3MEDA 3QWPA 1UEKA 4WXWA 4OJHA 3A8KA 4CDIA 2HVZA 2J0XA 2QTWA 3MCOA 1KWMA 2B9XA 4DV2F 1QUVA 4USTA 1M1HA 1RT2A 3MR6A 1HHSA 3RRHA 4LSLA 1SC3B 1RJJA 3NNHA 3KUGA 4RW7B 4ZPWR 2HNZB 1NXIA 3K8VA 2Q79A 1RSCA 2J6SA 3US5A 4LVOP 5BR8J 1NDPA 6FD1A 3BH7B 2KTQA 1XQIA 3FVYA 2PEHA 1IBMJ 4E2FB 2VG5A 4ZVSB 1IJFB 1HYSA 4KFBB 3GP9A 2HRUA 1HNIB 3C66A 3Q2SC 3F41A 2Z8QA 2VICA 3JQKA 1X5PA 3PV8A 4ECZA 1IKVA 4IFVB 3FGVA 2B8QA 3JYTA 1NO8A 2HWTA 2F4VF 2E1MC 2A6OA 1NAQA 1MWYA 4DR5J 4JI1J 3GB0A 1QAXA 5K5MA 4F36A 1R6VA 5IV3A 8ATCB 3UD5A 4TY9A 1TL3B 5B08A 4P10A 1VIOA 2Z30B 3SFGA 3BQ0A 3NXZA 1G3OA 2M5YA 2KRBA 4X2BA 4ZHRB 5F41A 4H4MA 4C8LA 2JEGA 2Z0GA 3IN5A 3PCOB 2EFVA 4C8KA 1JWWA 2PA3A 4FF4A 5KG0A 1HI1A 4G1QA 1ZAVA 1Y5IB 3PEJA 1NJYA 1VRQC 1UVNA 3MEGB 2WW8A 3BSOA 2KT5A 4J5OA 1TFWA 1CEZA 2D41A 5BYRA 4RU9A 1Q78A 1RCXB 4QR2A 2OPSB 2A1BA 4LRAA 2PA8D 3J7YI 1NHVA 4DUZF 5KG6A 1QSLA 5M2UA 5IQ6A 2FJDB 3TNVA 2F4FA 2ZNZA 1YGYA 2E29A 4IH6A 2K1RB 1ZTTA 1KFDA 3RW6A 3BBFA 4CLUA 3W64A 1RTJB 1YX2A 2FHMA 1TKXA 2CDRB 3KDNA 2R8HA 1SL0A 4IG3B 1TU0B 4BCAA 3CXCR 5LL6d 1RYRA 2QIFA 4XDCA 3FFIA 1PYSB 2DGUA 3M8PB 5IT9U 7AT1B 4GVBA 1Q8BA 5DG9A 4Z7CA 3DN9A 1FX4A 4FNIA 4R0EA 1VYAA 3OL9A 1RT6A 3G8SA 1VQSA 3DGVA 4IR1A 3UDCA 1RQ0A 1JLGB 3D6HB 1V9OA 3PJXA 3ZC4A 4HTIA 2H65B 1HBMB 3J80U 2VJVA 4PKDB 4EGLA 3FKBA 3POTB 2PI5A 1B0PA 3QMQA 3MFIA 1Q1KA 2DITA 1CQMA 3PX6A 1U2RA 5C24B 4BC7A 4NLWA 1RT4A 1TKZB 3TP2A 3KDOA 5I42A 2HS0A 3M32B 3SI8A 2QMUB 3AQPA 1JLEB 2WHOA 3PXGa 3R97A 3SSQA 2UXDF 4ES3A 3ET6B 4UUXA 2HQGA 1F1BB 2MY7A 2G9OA 3KK3A 1RWWB 1A0OB 2Q3PA 2J0WA 2XC9A 2F7VA 2RAQA 3IWNC 1P1LA 2XBPA 1FNOA 1FNXH 3W2VA 4MTPA 3JSBA 3NCRA 3VAKA 2FLNA 3X1LB 1WC0A 5HMZA 4HI1A 4DDFA 1WKLA 2KI2A 2H5EA 3NGTA 3KLGA 2AEMA 5K8NA 3C16B 2WAQD 3OPKA 3SDEB 2XS5A 2I5JB 1M5PC 1AB8A 3R3TA 4URSA 5E3QA 2CJQA 3MEKA 1W26A 2XMKA 3R5JB 5IWAF 4TLRA 2DGTA 4NLPA 3MUMP 1D9DA 4FP9A 3FC9A 1VQYA 1X4BA 5L1IA 1HBUB 1LW2B 2VFUA 2DHGA 4WZQA 2VQFF 5DO2A 3V6JA 3VAIA 2DGQA 1KS2A 1S7HA 3MCSA 5G0RB 4UT4A 2FD2A 4HDHA 2HK2A 4I2QB 1ULRA 1RZMA 4YEAA 3J7Z5 1F9FA 5DLGA 1CJVA 1UKUA 4IYQA 3D66A 2GFFA 4OZNA 2CJKA 4ZPCA 4NLTA 1VCTA 4I6AA 1WUUA 2OPPA 2XI3A 1VQNS 2FLOA 5E2QA 1MWZA 2GW8A 4P2MA 4CO1A 4WCEQ 1S49A 4K4SA 1S1UA 4ER8A 4NYOA 3KNGA 1XIQA 3UWTA 1T03B 3J81j 3C6TA 1NK5A 1KEKA 3DM2B 2Z4PA 1QD1A 3GJTB 4K5SA 2M2BA 2XG8A 1D09B 4BS2A 1R0AB 1GAOA 5LXRA 3EPGA 1JLCB 2GMJA 4FXDA 4UOHA 2IDEA 4H54A 1I94F 4KHMA 4K2JA 4JI2J 1NUEA 1KNZA 1VDHA 2OSQA 2FJWA 1NSPA 2P9EA 2ZH4A 4WFZA 2MQPA 1BLUA 3GQCA 1KVJA 1OY6A 5D4NA 4P7TA 1HQUA 1K8AT 2PMZD 3K5MA 1RAOA 2QO3A 2HFSA 2CJBA 1HMVB 3N5FA 3NL0A 4LF4J 3QJPA 3PY8A 5IZHA 1M1GA 4JI7J 5IFMA 3LP2B 3D7SB 4NZ6A 5HATA 2YKPA 4G3IA 3DDIA 1S79A 1Q16B 1HNVA 2DGXA 1V5IB 5E7OB 3R2CJ 3M1VA 3CJ2A 3TARA 3NKYA 4G1PA 2ZJQQ 1DTTB 2M52A 3TAQA 1A6LA 4KBIA 4ID5A 3V6KA 3G6XA 3CCVS 3EJMA 3W2WB 1U7LA 2HNYB 2FHJD 5EX0A 1X9WA 2CQ4A 3ZZZA 3THPA 2KZZA 1BQXA 2RQ4A 3HVWA 1SH3A 2UV8G 3GV7B 4WKRA 2RUSA 3CDUA 3DLKA 4HDGA 1VK8A 5IT0A 5E3PA 4NA3A 3TZZA 3C3LA 1IBKF 3FBEA 1K9MT 3Q83A 4M5DB 2G1DA 1MG7A 4Y28C 1C1CB 5J2PB 4I69A 3KLHB 4DLGA 1JJCB 5CCLA 1TTHB 4C97A 1MWQA 4L76A 4F3MA 3H2VE 4AQYF 3I0SB 5HVHA 1ZH5A 3QT5A 2OJ3A 1KTVA 1VRUA 4GKKJ 2H9ZA 2QL5B 4N47A 2IBOA 2ABYA 2VBYA 4CNZA 3Q89A 2J9DE 1HBNA 3OD2A 2B9WA 4NASA 4TQRA 1C0TB 1I1GA 1KLNA 4DCPB 4DR6J 4BDPA 2OEJA 2HZCA 5F3ZA 1UW4A 1L3TA 3GSIA 5CQGA 3MDFA 4RW9A 2JHEA 1DTQB 5B0AA 1IR2A 2V4RA 4ANDA 2UXCF 2CQDA 3IG1A 4TU8A 5HMYA 4A4JA 1FVQA 2RRAA 1C1BA 3AA9A 3O2IA 1NJXA 4MKAA 1URRA 4X65F 4DPYA 3CWJA 1N0UA 3I6PA 2F9DA 4PG7A 2XCPA 1TKDA 3I0RA 5B7WA 1HARA 2KT3A 2ZDPA 2ERRA 2QA4G 2AJ2A 2HBQB 5GADU 5HJXA 5KFAA 3VGSA 5KFJA 2EFGA 2RU3A 4RW8A 2D3ZA 5GAEI 1FWLA 2ZWOA 3CCZA 1JLAA 4MK7A 4C3KA 4LQ3A 1P9QC 4WE1B 1XR7A 2VOOA 3BREA 3R5BA 2HYIB 5D0HA 3OT9A 4U7CA 1BUXA 4LVNP 3DDNA 2DPJA 3J7ZT 2DR5A 2MQQA 3K59A 3BR8A 3M05A 1SUQA 3W9HA 4OZ2A 1VQ9S 3V6DB 4KH0B 4JI5J 2E5GA 4N77A 3R1LA 3H0PA 5LMUJ 3PW5A 5L9NA 2XM3A 2IDLA 1UP1A 4AXIA 1RTIB 4ED7A 2W24A 2F8MA 1VQOS 4PUOB 4KR0B 4FPIA 2HKEA 3VV2B 2MTLA 2UUBJ 2RKIB 4OZ3A 5KG4A 4N76A 1YZ7A 1QAJA 4ZCMA 1EETB 3A4TA 3D3CJ 2H5IB 3TVYA 5D3GA 3CVKA 3H2LA 2EBGA 1LV5A 4URGA 4K4ZA 1V3SA 4RNOA 2DNQA 1CULB 2CNKB 5K14A 4KE5A 2IAJB 4CLZA 1Z1ZA 4QCLA 1FFSB 2BEFA 1P8GA 4NLGA 3PO4A 2BMBA 1CJUA 2R2TA 4RZRA 4MMOA 1G1XA 4ZCLA 1MNEA 1YBAA 2LEBA 2VKRA 4I2PB 4QYRA 2ROPA 3FEYB 4QR1A 1FRJA 3D6MB 4C11A 3KLIB 4J7CA 5KFDA 2XSJB 4J9LA 3LGHA 2J7UA 3GV8B 3NS6A 1B4SA 3H5YA 5DGBA 5KG1A 3GFYA 2ILYA 1HPZB 4ES1A 3RR8A 4FBTA 3E01B 2ZE2A 4EZ9A 4DV2J 1E6YB 2SXLA 2MKYA 3DU5A 4O3SA 5B0GA 4Z7YA 1EQ0A 2AMCB 4F4KA 5KFGA 3O6QA 4P2FA 2HLUA 3HSZA 4M1KA 3EZOA 3E2EA 2WB4A 1RK8A 1L3KA 5L38A 1VC0A 4OLOA 3IC1A 4TKTA 4ZDNA 2ZUAA 1S6UA 2HQFA 1U09A 3CCTA 3LAMA 2LDIA 1X7VA 1SJRA 4KGZB 4ED6A 1S6PA 2ZFHA 3TR5A 4NA1A 3HZGA 4PWWA 3KK1B 4I6YA 4Y00A 3GV5B 5F8NA 2VBXA 4OX8A 3OTCA 4J9UE 1SJ4P 1QDUB 1I3OB 5GAHU 1X9MA 4DSIA 2NREA 2RIJA 4FN5A 1IKWA 2IVFB 1PYTA 2FVRA 1KN6A 3M30A 3KOAA 3FDSA 3OR1B 1WHYA 2FHOB 2AF6A 4X4NA 3EGZA 2GAHC 1WI6A 1IKXA 2KU7A 2JVRA 3JAMU 2A2CA 2MKJA 3SQGB 3QGGA 3J7AN 1PCAA 4JI8F 1O51A 1X4CA 1R43A 4A8KA 3HHKA 2Q6BA 2MDAA 2PN6A 3M8ZA 1YLXA 4DV1J 1KVIA 4JI0F 5I3PA 5A8WB 1IM6A 5CYQA 1NB7A 2WVBA 4DSJA 4JV5F 2CADA 1B0VA 3ELHA 1VRTB 1RU2A 2IA0A 4CZCA 2UVVA 3CJ0A 2W4PA 1AFIA 1Q95G 2C22A 1S57A 5EWFA 5BYSA 3MR5A 3PX0A 3KLFA 4IRKA 1RT5B 5LXYA 1S9EB 2LVWA 3BKUA 5ADZA 5GAGI 4AUKA 3V2UC 4WP8A 1KHVA 2B4VA 1RADB 3TZWA 1FT8A 2YVSA 2A0FB 4DCJB 4QPXA 3VGUA 5HSPA 2X3GA 4GC6A 1Q82T 4IO1A 1TVRB 2Z2YB 2PMHA 3VVUA 5ETVA 4IFYB 1DQ8A 4CYUA 3MEDB 2KT2A 2LA4A 1YJUA 2FTRA 2R8JA 3DOMA 1HHTP 1NBEB 2OI2A 2QG9B 2H5JB 1RT2B 4LSLB 5E3CA 1B64A 5JMNA 1Q8LA 4UZCA 3BO3A 2KJWA 4WU2A 5LMNF 3N4WA 3FQLA 4DL2A 3DMJA 4O4RA 2VG5B 1HR0F 3L9ZA 1T3NA 3BO2A 1RA6A 4KGXB 4LRDA 3SCJE 1BHNA 3UD3P 2VB6A 4U67Q 4RW4A 1Q7LB 4OHXA 3FCWA 2XYGB 2DKOB 3BO4A 1IKVB 5D4LA 1W7WA 1SIZA 1U26A 3FNNA 5ETSA 3KJFB 3IA0A 3JYTB 3SYZA 4BWMA 1X4AA 4DQSA 3BBBA 2B8PA 1YK9A 2YNHA 4IRCA 4A8WA 1N5YB 4C98A 3HMJG 2DY9A 1SQFA 5ITHA 1BGXT 1D1UA 3I32A 4KV8A 1D0EA 1S9GA 1AYEA 3CJSA 1EJ7L 4C0HA 1VGYA 3GFZA 3FK4A 3CUNA 3HVAA 1WHXA 2BXJA 4DWIA 4C3MA 1NPKA 4GO5X 4X84A 2NS1B 4H4MB 1H2TZ 2OGUA 5DDRC 2LCWA 2QX0A 1L3SA 1YJVA 4C8OA 3RBXA 4G1QB 4EO6A 3HSJA 3DYAA 2IC3A 1YRTA 2GJ2A 4I67A 2K7JA 4YB7A 2PI4A 1RABB 1S1WA 5IT4A 3CO0P 2GS8A 4CLWA 3AY0A 3FMWA 3RRGA 3CMAS 2VJUA 5IWAJ 2KN4A 2KM8C 4K0KF 3G2XA 2A2DA 3VR1A 2G2ZA 3RW7A 3DRRA 3H4BA 1H74A 2Y1LB 5AE1A 2CQ0A 3ISNC 2Y1JA 2EXUA 1TKXB 3H4DA 2DO4A 3HHNB 2DIVA 3V4MA 3CDAA 3CC2S 2Z2LA 3IGNA 4PQUA 2EKNA 3PIOQ 1JIHA 2HFNA 3RB3A 1I51B 3LANA 4RX6A 3O8WA 4A48A 1RTDA 5CAAA 2W9AA 1JLFA 1V3RA 3CO9A 3OSPA 3ENVA 2CAJA 4DV5F 4GVBB 1RAHB 3DFEA 4CM2A 1RT6B 5HQ8A 2IM3A 3LGMA 1RLDA 1MN9A 3OTDA 4V19X 3DDKA 4PWUA 2XLKA 2MLYA 4ILRA 8AT1B 1YTYA 3TA0A 3M6UA 4ERDA 3PYDA 1DHMA 4OZJA 3H7HB 2B5JA 3RRKA 1HNWF 4UZBA 2G0JA 1EP4A 3AD7C 3W7BA 3ZO7A 3N9UC 3D1QA 3TQ1A 5F8LA 1N34F 2FLPA 1RT4B 5I42B 3HKWA 3KG4A 2I2YA 1OMSA 4P72A 2RJZA 3ENAA 2V69A 1Y3KA 1N32J 3JTNA 1I94J 4TXSA 5HROA 5K20B 4K5RA 2OIHA 4M95A 4FF1A 4PQAA 3KK3B 1ROFA 2AU0A 1M5OC 2X3DA 3KKFA 2V2VA 2Y3YA 4AE5A 1F5BA 3W2VB 1HWUA 1FD8A 3D0GE 5B0CA 4KJIA 2I38A 1FF2A 4DQQA 2CWKA 2EWHA 2LMIA 2VFSA 3CB4A 2HVDA 4AL5A 4WKYA 4YDXA 1SCJB 4YR3A 4LJMA 2W2NP 3J81Y 3KLGB 3GLJA 1IQZA 3D68A 4ZN1A 4YQWA 2KH9A 3P49B 2AEFA 2DGOA 1P9YA 3EGWB 3QGHA 3LAKA 3NGRA 3BYPA 4AL7A 4DG1A 1CSJA 4FXVA 2FC9A 5L39A 2FUG9 5LOQA 1Z4UA 2ZZTA 4CO5A 4PG8A 1S0MA 2I8EA 4X64F 3AT1B 1FFWB 2MKIA 4F0KA 1UPMB 3HF5A 1ZM3A 3VGTA 2L48A 1BQMA 3GU0A 1KQSR 2GO9A 4B3RF 4USIA 3OFGA 3BGRA 2J0QD 2JVOA 2FZCB 4C8YA 2CQCA 1CJVB 3B54A 2IYGA 4GC7A 1SKRA 3IMQJ 1FEEA 4EYHB 1LOUA 4RNFA 2VA3A 1IBKJ 1M0SA 4NL5A 2FLLA 2OPPB 1EAYC 4OI3A 2CYYA 3PTWA 3T1AA 2Y0SD 2R7VA 1R31A 4C8MA 4KGKA 1S1UB 1T0TV 3HD2A 5F8MA 2NLWA 2HHXA 2YPZA 2L9NA 4M5LA 1BE4A 3HKZD 4AQYJ 3C6TB 3BQ1A 2R42A 2P6SA 4WK3A 1LEOA 3ZZ0A 2AYGA 3AD9C 4OI0A 4PPDA 2OKQA 3I87A 3P5BP 4R25A 1S6OA 1GMVA 3ZTPA 2E7VA 2IM1A 1FEHA 3Q0AA 4YB5A 1TV6A 1YJNS 1XMOF 4UTGA 4KHPF 2N7CA 4OYXA 2PC6A 3EE3A 2D3UA 4X62J 1WACA 1NDLA 2HZAA 4LFBF 1RBAA 1N88A 1ZPWX 2DRDA 4E98A 1HQUB 4KT0C 2JZ5A 4EZ6A 3LPYA 3BZQA 5CYJA 3SCLE 2OPRA 5FJ4A 4J9RA 3DHXA 3F44A 3Q8SB 1RT3A 4NLYA 4DQIA 2Y8YA 4FYYB 3HULA 3D5MA 4IDKA 3MCNA 2LDYA 3LALA 4QU7A 2OD4A 4MH8A 3M8SA 2MHEA 1QVFR 3PHTA 1VBYA 3BKTA 3MMAA 3SV3A 3TUZC 1HNVB 2JEIA 4DFMA 3GJSB 1ZM9A 3M1VB 5CHCB 3G6VA 3HVTA 2YX4A 2CA9A 1F60B 2XMJA 1X4HA 4QWBA 4DI6A 4ID5B 3N6MA 2V9KA 1UW9A 2DHAA 3OQ2A 4I4BA 2ZC3A 3T41A 4ZVEA 1O5JA 2E5JA 2GJFA 3NP5A 3CIMA 3I5AA 2I1RA 1WG4A 3NMAA 3CDEA 3DLKB 3ZTOA 2R2SA 1URNA 3GYNA 3RR7A 4RO0A 1YRUA 2O01C 2WB1D 2QA2A 2BBEA 1KQKA 3GIRA 4ETXA 2NR0A 5HAOA 2QSWA 2CG8A 1GXTA 1CS4A 2R8KA 3DRPA 2ZHBA 4Q2MA 3B4MA 2U1AA 4EI2A 1FJGF 4M5MA 2E1RA 4USWA 1X4DA 3CF5Q 3NS5A 1X5TA 2LXIA 3CDBA 3GSDA 1QVGR 1N4LA 1VRUB 4Q2LA 1HQEA 3W8GA 4PXEA 2ROEA 1HNZF 4ZVFA 2MZ1A 4USUA 3BGUA 4LREA 1VQKS 4LR8A 3UDVA 4DS4A 3ZZPA 4OI1A 4Y0FA 3SV4A 1DJ0A 3LP1B 2ASYA 1IJEB 2YWEA 3BJYA 3Q22A 2MJUA 2MHNA 5JXSA 4B9LA 4JI1F 3NGKA 4RW9B 1VBKA 3D1OA 3QSYB 3FBCA 2YQ3A 4WFAQ 2F3JA 4IG0A 3CE8A 1FKPA 1T94A 3PZPA 3C14A 3IG1B 2P8IA 1Y5NB 4TN2A 1YBTA 2MQNA 1C1BB 2OAUA 1ZA2B 4R8UA 2YX7A 2K2PA 3DNCA 2V0NA 3OW2R 1CC8A 4RWWA 5HANA 3I0RB 3R5CA 2WRMA 2D74B 1R0CB 3EDRB 3G86A 4B3TF 2BJ8A 4YB6A 2ZM6J 3CCJS 1AROP 4NCGA 4RW8B 4NLOA 2XLIA 2E1PA 1RCOB 4O0NA 3JB9k 1JLAB 4AT1B 2HMIB 1LWEA 1RXOB 1KP6A 1FXLA 4F02A 1NKBA 5HVFA 1DURA 2YH1A 1X5SA 1T02A 2CVEA 2BE7D 1FA0A 4WYWA 5CABA 4KKOB 1BY9A 4WYLA 1REVA 1FX2A 3AJDA 2E9RX 1WEYA 3M7VA 4I68A 1NSQA 5HQLA 3EYZA 1SUQB 4QR0A 2BKNA 2ZEJA 3ILIA 1TELA 3DHWC 2YWFA 1WJ9A 2KHCA 1XR6A 4UQTA 2DHXA 5A6WA 1TK8A 3BGFA 5KT3A 2WVFA 2AZ3A 2C2EA 2YKMA 2DNOA 3R1HA 5GMKa 2DXFA 5D3GB 4CM0A 4YY3J 3UDEA 2C2RA 5DDQC 5D6GA 1TZ0A 1U0SA 1RT1A 5J2QB 5K14B 3PG9A 3RBEA 2GJIA 5IT9Y 4J9SA 4JV5J 2G13A 1DY3A 4P6QA 3CJ3A 3KJVA 2F9JA 3IP0A 3BSCA 2J6UA 4BBYA 1CJUB 5IOLA 4YR2A 4A8SA 1PBAA 2QRRA 1JKHA 4NZ0A 2LU2A 4EK2A 3B6BA 3RB0A 5DLFA 4S0MA 1W25A 2D7SA 3MOZA 3PKYA 5AXNA 2GV1A 2YKQA 1RWXB 4N7TA 2V4JA 3J80Y 2ZKTA 4C11B 2OP5A 2CFXA 3CJ4A 2L41A 4K4VA 2CJAA 3F56A 2DPIA 3G96A 1RHQB 3G71S 4JI4F 3OVAA 1G6BA 2GCFA 4OHWA 2ZE2B 2E5IA 1PJ7A 5LJ5Y 2G1HA 1NDKA 1H3DA 4CLTA 3M6VA 2HPUA 3MCMA 4P7VA 1PG5B 4YS2A 4K4WA 1F2HA 1RISA 4RUCA 3IBWA 4ZN3A 5LMNJ 4CQ1A 3W62A 3CCQS 1FTCA 3C6UA 4JYAJ 1G2EA 2YKNA 1HR0J 3MM6A 3TA1A 2C3MA 2XTJP 4WIIA 1OY9A 3IXQA 3MZIA 1ACMB 1S6PB 5J1EA 2QE5A 3BPSP 2EFOA 1SC1B 2W4DA 4IH7A 2RS8A 1LWCA 3PDNA 4X4TA 3S7RA 4MKYA 2HAFA 3R7SB 1PC4A 4FF2A 1IKWB 4DHVA 2CQ2A 4KGVB 3EMTA 4O3PA 2BE2A 2QYCA 2E44A 4WZMA 4GMKA 1IKXB 2G4BA 3WIUA 4J9MA 3UN3A 3UN2A 3S8SA 1KRPA 1QJHA 4C0OC 3AA8A 5FLXU 1WG1A 4PR6A 2EC2A 1WTBA 3A13A 4QIWD 5CYQB 1X4FA 3TAMB 4CLPA 2ZH5A 5SUHA 5DRKA 4E8UA 2XMMA 2DNGA 3P8BB 4WU3A 2KYXA 1XMBA 4RU2A 2XSFA 2GNKA 1C4AA 5KFKA 4DFJA 5K8PA 4LF8J 1TL5A 3W9JA 3KLFB 3D1HA 1WOPA 4ECWA 3N01A 4DL4A 4ES2A 1FJEB 4R0JA 2QZ8A 4OJGA 4ED4A 4JV2A 1RHKB 2CNLB 4K0KJ 2EI5A 2QA4S 3RAMA 2GO8A 2P2CB 1KBRA 3EICA 2XEXA 2L08A 3J7YU 3H40A 2UVWA 1JXEA 1TP7A 4CYUB 2HGMA 4X4VA 5EHHA 4L75A 3T9NA 3BSAA 1TAUA 1RHJB 1FD2A 4DR4J 4QIFA 2LQ9A 2BR0A 4DV5J 3QO9A 4M5GA 3HD1A 5HBMA 1HL6A 4JI7F 3Q8YA 5A8KA 5KT2A 2WTFA 4PYDA 4ZA1A 2EG2A 5H9EJ 4CIOA 3DMJB 1XNQF 4OZ0A 1TMJA 1ZETA 4HHJA 3R7NB 1XBWA 1EB0A 4RW4B 2RU9A 4G65A 3KMSA 3LWLA 4PXDA 3VAHA 4ZCIA 5KFBA 1HNWJ 2YWWA 1ZS6A 2IVYA 3FBBA 3F73A 2HHQA 2EEYA 1N34J 4IQXA 3ZNUA 1ZTWA 2YNHB 3U1LA 3W8PA 2FVPA 3MAAA 4LRFA 4KV8B 3VGVA 4J9QA 3LPEA 3KJQB 2HHVA 1S9GB 2EFQA 1S1XA 4B08A 3PRVA 2VC1A 3L7OA 3NS7B 1RP5A 2DTJA 2BQ3A 1J27A 5KG5A 1CQNA 4MJKA 3CJQA 3H5UA 1MROA 5BYQA 1U8WA 4OMFG 2XULA 2RILA 3DYAB 2VFTA 2IC3B 4Q8FA 2C3PA 1FJCA 3L4BC 2KXHA 2OMOA 1YBUA 4P75A 5GADI 1C4CA 4L72B 1PO6A 3ETOA 2DNLA 3CW2C 1S1WB 1TL7A 2MQMA 2HQIA 3P4UB 3QRQA 4C8NA 2W8KA 4ECSA 2VOPA 1R7IA 3HFVA 1M5VC 4CRJA 2FZGB 5HMXA 4CLSA 3DRRB 4LUBA 4Q45A 3WC2A 4G6VB 3RJMB 3CTRA 4A8YA 2QLXA 3FUYA 1R0BG 4JI6J 4CH1A 1FWPA 4X64J 4NXMF 2FIUA 3VCDA 3W5XA 1NU4A 4DOZA 4PQUB 2MB0B 3UN5A 2GHPA 3CSKA 3G82A 1JMTA 4H4KA 4F67A 2DXDA 2VASA 4B3RJ 1WC1A 1RTDB 1JLFB 3N5BA 5JUMA 3JS9A 2HBZB 1RBOB 2HWHA 1R8HA 3QAUA 3L95X 2FY1A 4DQPA 1T95A 3G9CA 4J9KA 1X0PA 4F8RA 3T19A 4I7FA 4ECXA 3ILOA 2FJXA 4WFXA 2JDJA 3PFOA 1XWLA 5BXIA 1RWVB 3EVWA 2B5JB 5GVQA 1EP4B 1N33F 2HQDA 4Q0BA 1CBKA 2DNKA 1WOOA 5G4DA 2H1YA 1QAYA 1YRXA 4ED3A 2V8HA 4ENOA 1XNRJ 4KTQA 2QYGA 4ICLA 4W98A 3T5KA 2YWGA 1PYOB 2MSSA 3MM7A 5RUBA 5T7LA 4ZP9A 5HROB 3R9LA 4R5PB 3KXDA 3THVA 4A47A 3DCAA 4KHPJ 2XWYA 2LKZA 4YMEA 4ECQA 1KC8T 2MY8A 2ASLA 3ADAC 4LFBJ 4NMLA 3IS9A 4ELTA 2DJWA 2XO6A 3PYGA 3UVJA 2Z2ZA 3HO1A 4KYZA 3RAQA 1BXNA 1HWIA 1S6QA 2VHGA 5ETMA 2LXFA 1SL2A 1FTRA 3CD0A 2OH2A 4DPUA 1F2GA 3DC2A 4HI2A 1UVJA 2ZBIA 2BW7A 4WXOA 2QV6A 1NHUA 2QFJA 1U8SA 3SIPB 2BKPA 2V50A 1G7CB 3CCLS 2GIRA 2RQKA 2UZAA 4DF4A 1X5OA 3B82A 1BQMB 3VF0B 3A8EA 1UVLA 2CJXB 1B3TA 3TAPA 3ENWA 4FNHA 4WP9A 4C4WA 1SJ1A 3PW7A 3BGRB 2XY5A 2HS4A 2DEJA 2CZ9A 3AOAA 1OQ3A 4ELVA 2V9WA 3MXHP 2ASDA 4ELUA 1GMUA 3T6JA 4HVZA 4LF5J 4OYWA 5KOXA 4EBEA 2NQPA 4DZ6A 2OFGX 2KXFA 1H7XA 1U45A 2LLZA 2F63A 5HQMA 1F5AA 2MQOA 3JSMA 1UMJA 1UCNA 1EKRA 1FJGJ 2QC3A 3L09A 3AD8C 4C7QA 2VDHA 3TWZA 4ZHRA 4ZVPB 2H3EB 2AJ1A 3U7JA 4USHA 5LSOA 3OVSA 1HNZJ 4DS5A 3JTPA 4O3OA 2V8DA 3DLHA 2ZOGA 5B0EA 3AB2B 2EPIA 4M5NA 5D8HB 3S6EA 2GHVC 1WG5A 1HQ2A 2RUGA 3ENQA 5D4PA 3RZAA 4X4PA 2IMOA 1TV6B 2RS2A 2E9TA 3IAM9 3BS9A 1YI2S 4B9UA 1JJ4A 2KB2A 3THTA 3HDSA 4CTAA 4IOCQ 2L3MA 1T11A 2OPRB 1WHVA 2IFXA 1VQ6S 1OYEA 4NLSA 3MMBA 1RT3B 4ZVRB 2MZSA 3Q8UA 4IDKB 4ZKAA 3MD3A 3BH6B 1UVKA 2BRLA 5KFXA 4IG3A 3VZHA 1S48A 1NK6A 4DV1F 4NZ7A 2LFVA 3TEHB 2DR9A 1GQEA 2UP1A 3MMAB 1XK8A 2OELA 2HW3A 4ZVHA 3K58A 1H72C 4B3TJ 1X9SA 3KFWX 5HO4A 1BWVA 1RLCL 3HVTB 3DRYA 1K47A 4YP3A 3DLBA 4EUVA 2KHDA 1TUVA 2PIIA 3OJSA 5KFTA 4F4AA 7FDRA 3D4JA 5GAEU 3VAJA 1U0HA 4OHZA 2A10A 4B17A 5C25A 1CG2A 3IRXA 5FDLA 1KOOA 3EX7B 3NOGA 2QL7B 4DV6J 1U1RA 2CZ4A 2JRSA 2VH7A 3C8YA 3CD6S 3WZ0A 4OYZA 4CNYA 4A8MP 2YH0A 2X7IA 1MMLA 2CQ3A 1CS4B 4ZLLA 3DRPB 2V2QA 2DB1A 3CJ5A 1P27B 2XZWA 2MZQA 4DR2F 5A76A 2M0GB 4OYMA 1HWLA 3R5AA 1HQEB 2LA6A 4ZPTR 1VQLS 3MTKA 5KFPA 2WONA 2HFUA 1FXDA 1GT8A 3PNIA 4GO7X 3SDEA 1S4FA 1PAEX 3KMQA 3O1LA 1U24A 5AXLA 5C5JA 4EWTA 3PR5B 2FVSA 3GMGA 2PD1A 2MEWA 4IG0B 2DNHA 1MLAA 4G1IA 3C14B 2X1FA 3GZ7A 3ULHA 1X31C 2KFNA 1RWNB 5LM7E 2MZRA 3OR2A 4R8UB 1F0XA 5KG2A 3ITHA 4TNOA 4JI4J 1MSWD 4ITSA 3IR5B 3SBMA 3M6XA 4P74A 4HT7A 1LKZA 2XZDB 3K5PA 1UFKA 5JVGQ 4NCGB 3KLEA 3OTBA 4D3HA 4X4UA 4LIWA 1LWEB 3AJ1A 1ZAXA 3CJTA 4UY85 3U27A 3MI7X 3ICLA 2Z58B 1JJ2R 4F3QA 1HBOA 3DLEA 4EBCA 2VQEJ 3NLCA 1REVB 1IKYA 3UW1A 3QBCA 3RGIA 3PVXA 4DSKA 1GMWD 2ZH3A 1GH8A 2AYBA 3R6GB 2F5GA 4OYAA 2B51A 1QLNA 2GQCA 4PRFA 4URQU 5A2QY 1YHQS 1JXLA 2IRYA 2HIQA 3UCZP 1PILA 4B9NA 2XNRA 2JSXA 2FHJA 3M9MB 2AJFE 2HLTA 2DNRA 1R8PA 2H51B 2YKMB 3BDPA 3KYLA 2D3O1 2JH3A 5DQHA 4DF8A 2L9WA 4YUDA 1RT7A 3NWGA 1ZM2A 4DR1J 4K50A 2BUNA 1RT1B 3OUYA 1NK0A 1TKTA 2XY6A 3EWGA 2VA2A 5B0BA 3EPIA 3KJVB 4FS1A 1YKWA 2C3UA 2ZD1A 2YKOA 2KG1A 1QY7A 1JB0C 1M5KC 3HZEA 1JKHB 3TJAA 1KONA 5M2PA 1Q53A 5L1KA 4WF9Q 5F0UA 3OTOF 3IAS9 3MEEA 4DU7A 5HI7A 4DR7J 2B43A 3HHDA 3NAIA 2DH8A 2V4JB 3QPIA 5KFCA 1HLWA 1N32F 2HHWA 4NE9C 3BQ2A 1Q4RA 5ETRA 5ETLA 2HAIA 5D4OA 5GAGU 4L73A 4KH1B 4D3GA 1UVIA 1EIYB 2WSFC 4XPCA 3PX4A 1WEZA 1FHTA 2QEXS 4DSFA 4FF3A 4RUAA 4QWAA 1NZAA 3FCVA 4RLEA 3OL6A 4J37A 3CD7A 3FSYA 1S76D 3W5ZA 2R2RA 2BRKA 3QT8A 5A6PA 2R7WA 5L46A 4U95A 1TUWA 2FGCA 3CMQA 3AQOA 3CCMS 3OFHA 1VQ4S 3C6UB 1XNQJ 2YKNB 2QMXA 1IXKA 3MM6B 1Q79A 2DXEA 2NYIA 2XYHB 3ZNJ1 2MKHA 3T1YJ 5J1EB 3PHEA 5D0EA 1HD0A 1R8CA 2VV5A 4ED1A 1AFJA 1LWCB 2UUTA 3RBDA 1U2CA 2C2ZB 2BV3A 4TLQA 1V6HA 3PFEA 2ZHAA 2BOAA 3I55S 3NEKA 4C3LA 3GG0A 2AGOA 3R5GA 4OV6A 4XIUA 1EQMA 4TYAA 4ALZA 1RYSA 2BE2B 1ZYQA 3UFCX 2AJQA 3D0HE 3FEZA 3TJ9A 2XMUA 3MM5A 1DTQA 4RKUC 4QOTA 2B6AA 2FY8A 1U47A 4NLUA 5AJ3F 1UAWA 2GX8A 1NH7A 1NEEA 4OI2A 2QA1A 1MW7A 2RD5C 4MIAA 1ZAWA 4QZVB 3D67A 1XN9A 4ZS6A 4B9TA 2FB0A 5I3UA 1NCLA 3NBPA 1OQ6A 1LFPA 2M8HA 2WOMB 2NPFA 3H98A 4QIVA 3KG0A 3WX8A 2JNJA 1FRLA 1FRKA 4DPTA 3QIDA 4ZLPA 5KFHA 2LECA 2Z57B 4OYOA 1XERA 5A0YB 2BJ7A 2HQ3A 1YSJA 5EN1A 2N7YA 4X62F 3DKDA 4NXMJ 1Y4ZB 4OI6A 1DQAA 4UOCA 3FRYA 2DCUB 3TO8A 4X4RA 3UNYA 3EGVA 5DG8A 2MPUA 3QT6A 2RDDA 3BEGB 3V6HA 3W1YC 4ZLJA 2KDOA 4LIRA 1BWEA 1JK9B 3KWMA 4X66J 3RBZA 1X4GA 3DRSA 2D69A 4AXJA 1TK5A 3QO9B 5HBMB 2CDQA 3M9NB 1NK9A 1KD1T 3J81U 5A8KB 3EGNA 5F9LA 4UY8T 3GIJA 1M1KT 1L3UA 3MMJA 1K0TA 5J2MA 3D6TB 4HHUA 4JI3J 1HHQA 3IFEA 3PACA 5J2NA 3J7A1 3B8HA 1REGX 1WF1A 3E8OA 5KOWA 3GR0A 1N48A 4N8NA 1N33J 1XTZA 2FPHX 2M3DA 1FDDA 2WVDA 1OSCA 2ZZMA 2RMLA 1NZ8A 3A8JA 2W2PP 1QAIA 4NI2A 1RWMB 2AIRB 3CULA 4PABA 1D8YA 2HNDA 3MAAB 3ILJA 2YWKA 1C0UA 3GE9A 1ELOA 2I0XA 4Y34A 1S1XB 4H4KC 4CO2A 2ZHOA 5DJBA 2KRRA 5IC6B 2MZJA 1BQNA 1Q7YT 2BJ9A 4J9NA 2MLZA 2W01A 3NNAA 3GYXB 4LF6F 4ILMA 1FVSA 3H90A 1D9FA 3B78A 1MROB 4IO9Q 1XMQF 2MSTA 3GIMA 2DHHA 1YVFA 4FYDA 1M5HA 4RPFA 2BACA 3QSIA 3GG1A 5M2RA 3KUEA 3TVKA 1N5TA 5DETA 5KTQA 1TL7B 1VIXA 2QGFB 3GJQB 4OJ1A 1U2FA 1RAAB 1VHIA 2XHCA 3DOKA 4A8OA 4TY8B 1LWFA 2ADCA 1EX8A 1S10A 1U02A 2CQHA 1VR6A 3HI9A 3W61A 3EVOA 5JVHQ 4V1Ak 3ILLA 2DH9A 1FJ7A 1IBLJ 5I4MA 1LK7A 2JC0A 3G82B 1FESA 2E9ZA 1TQLA 4L3NA 3D54A 2V34A 1HW9A 1NKCA 3NG8A 3TOQA 4GRSA 5HJYA 2N82B 2VPXB 4K4XA 1T05A 3S1TA 4A8FA 4A8QA 2XMAA 2CQPA 3C15A 2BM0A 4I7FB 3VVTA 5CZVA 1U25A 4KQZA 2VODA 2ZM6F 4NCAA 4IH5A 4ED5A 3K57A 2NZCA 2OPQA 5KFEA 3OVBA 4F7VA 4F04B 3R8YA 1OPZA 3BDEA 4C9DA 5EGYA 2W4CA 2R7QA 2FYXA 3OFFA 4F0HA 1U6FA 3QT7A 3V5RA 4Q0BB 3DOLA 4KRWA 1WC6A 5D15A 1AXQA 3TI0A 4KB7A 5KAKA 2W9CA 4PWDB 4M5JA 1DFDA 1N5VA 4ICLB 1QTNB 4CO0A 1SXLA 3HX9A 2VPZB 3PJWA 2NSCA 1JLBA 5T7LB 5AXKA 2Q43A 1VMBA 1U1PA 4ZLNA 2GZOA 4JBCA 3AAWB 3RTVA 4USMA 1GNKA 4Z37A 4ECRA 1SKWA 3PW2A 3H25A 2CJ9A 4DX8H 5HLFA 1HNXF 1N5QA 2VG6B 3A8IA 3QIPA 2XY7A 1MU2A 2BZ2A 2BE9B 4LFCF 1AW0A 4W92B 1IR1A 3Q86A 4MK8A 3UVJB 1OSDA 4ZVOB 4IOAQ 2OMLA 3TZYA 4DV3F 5H1SV 1VBXA 3ZZOA 1YDLA 4LQ9A 3FEXB 5LSRA 3VAFA 4W90B 2EVZA 2DNNA 4YY3F 2Y1RI 5KT6A 2WK4A 3MR3A 2ZNYA 5HN0A 4J9PA 4DL3A 5IM0A 1HFEL 1F5CA 4TQSA 3LGNA 1WORA 4LFAJ 2MXYA 2V8VA 4NLDA 4LT6A 3BGOP 2YNFA 4V19J 1GFWB 3C19A 2HQCA 1SQGA 2RT3A 2N3OA 1UPPA 3S01A 4IKAA 4J9VA 3MURP 4N56A 4RR5A 1UEUA 2NXNA 1PC5A 1DLOB 2VIHA 1O8BA 2OLWA 2GC8A 3EZUA 4J91A 1WDDA 4K4YA 3T5LA 2DO0A 2WZ1A 1TAQA 1S12A 3MM8A 3EM1A 5ETPA 4QPTA 2VPWB 4W4MA 3N6LA 1AT1B 3I4PA 3M8QA 1RACB 3FMBA 2B9EA 4B9MA 3BYRA 2B7CB 1AUSL 7FD1A 1N5YA 1SB6A 2Z56B 5C2CA 3IM9A 4K7QA 5EX3A 3N79A 1UJ4A 2J9CA 3JSMB 2XZTB 2W2QP 4DR2J 1UWBA 3V4IA 4B3OA 5L8RC 3K5OA 3M2UA 2PE8A 3K0JA 1L3VA 4JYAF 2CPIA 1XR5A 2AT1B 2AEJA 1NRKA 3D9BA 5AE3A 1HYSB 1O6XA 1OO0B 4ZPDA 4ANCA 2CUYA 2IJNA 1S72S 2F8EX 1IUJA 3DLGA 2UXBJ 2W2OP 4DV4F 4QW8A 2DCLA 1YJ7A 2X1GA 2K06A 1F9HA 1SC4B 2YX1A 3Q8QB 4Y2IA 1T8EA 2D9PA 4O44A 5ETKA 4PPZA 3MWBA 4RJVA 3IGVA 1AZSA 4UF4A 2E1AA 2O66A 5EWEA 2KL8A 1VISA 3KHRA 2OTJS 4CTAB 4CT8A 1VQ7S 4HL9A 2H4YB 4HT5A 4B9VA 4OI4A 2CKWA 3HPOA 3PYFA 3DRXA 3MMBB 1VLOA 1XEZA 3M8WA 1FKOA 1RTHA 2JWNA 4DV0J 3SSSA 1L5UA 4ECUA 2EBEA 4I1TA 3UPFA 2EK1A 5LT5A 5B0DA 2U2FA 2BDPA 4DUYF 3OLBA 5EDWA 1WD6A 4Y2AA 2KVIA 5F8JA 3GCXP 3RB4A 4ATNA 2F8HA 1H0HB 3QWUA 4LF8F 3F0NA 3M6WA 1NPPA 2YXLA 2XNQA 4OHYA 5FLXY 1R89A 4DL5A 3KUHA 1NMEB 1NK4A 4CI0B 3BKFA 4N41A 2CJYB 1U0HB 1XJWB 1RAFB 2R7OA 5C25B 1T9TA 3JQJA 4XO0A 3IRXB 5FDLB 1H2UX 2WSEC 1H2VZ 4CLFA 1WSVA 3W5YA 3BPDA 3TJ8A 4MT1A 3UCUP 1TFYA 3H42A 3FFIB 2IJRA 2ZWPA 1FXRA 2YNGA 2HS3A 2LQ8A 4B3SF 2O1PA 2EW9A 4DR4F 4YR0A 2ZJRQ 2UUWA 1N6QA 4KGMA 2HVHA 2ZITA 2AV5A 2AGQA 3BGLA 2HRTA 3WX4A 3OL7A 4ZVUB 3W63A 4ZITA 1WTFA 4KC5A 2BM1A 2PFDA 1IR0A 2E5LF 4O0IA 2WONB 3CT9A 2QJ3A 2UUCF 4DN9A 3V81A 4NXNJ 4I56A 2KM8B 1JLQA 2FZKB 1RDRA 1LFWA 3AXMA 1TUGB 5KFYA 1C2PA 5AE2A 1NSKL 3OTOJ 3PW0A 4AL6A 3TQEA 3KHLA 2HZVA 1LQ9A 2VF3A 2CPDA 2CPFA 2VFRA 1WKKA 1NPRA 2I9SA 2WBMA 3OR2B 3BN7A 5SZTA 2IVMA 2QMWA 3ITHB 3GCWP 1IVZA 3AB4B 1S5ZA 1IWGA 2C2KB 2Q6CA 1OIAA 1RTZA 2R8IA 4ZJQA 2CIMA 1GK8A 4BHQA 5CZXA 2R3VA 3KLEB 2A3JA 8RUCA 3IM8A 1WC5A 1FRXA 1Q8KA 3FSIA 4IR9A 4ZPAA 2DD8S 2HHUA 1WHWA 1H38A 2V2ZA 1U4BA 1WWHA 5J1NA 2M88A 3QFHA 1DAXA 2RQCA 2GMHA 3UQSA 3M2VA 1R6YA 5E3AA 3MOJB 1HBOB 3DLEB 3I5CA 1IKYB 1WC4A 3NCQA 3AOBA 1FO1A 2DGWA 4HTJA 4ZJLA 4NRTA 5L9XA 3Q2TC 4JI6F 2JEFA 2ZH2A 3H8YA 2BQRA 1HKAA 4KSEB 2ATCB 3N28A 3ISND 1OJ4A 2DVIA 2VD3A 4NEYA 3QJLA 2W25A 1HWKA 3EDQB 4TU7A 4YB1P 2HGNA 1SVDA 3T1HJ 3HM9A 3VTIA 4DL0C 3GWCA 4OQJA 1N5SA 4HHHA 4MK9A 1TMMA 1CC7A 1KR4A 1N52B 3C2PA 4CT9A 3WBZA 2VONA 2G2YA 4DLEA 1S0VA 1QM9A 3T3FA 3TX0A 3D3BJ 1RT7B 3CMES 1M5SA 5K8OA 4LSNA 3FZBA 4KY3A 2V63A 3OUYB 1QE1A 4OYPA 1TKTB 2KJVA 5AJ3J 2IPOB 3D6FB 2W1BA 4PEOA 2ZD1B 4A46A 3PM9A 4GKJJ 5A8RA 4FKYA 3ZTRA 3ZZUA 4C0BA 1K44A 3G6ES 4CH7A 2BJ1A 3AH6A 4QWCA 1XNRF 3MEEB 3I4HX 4B02A 2Y9HA 3W65A 4KO0A 4OYBA 4O4GA 1S1VA 3ZZTA 3L7UA 3KK2A 4LBPA 4OJ3A 2VG7A 3GYGA 5F8GA 3OL8A 1ZZFA 3MPWA 3SEOA 4U6PA 3MPYA 4EMDA 2PMWA 4DPXA 1ZA1B 2LYVA 2HBRB 2R9LA 3SCKE 4QQBA 1PGZA 4WJBA 1EARA 2ZBRA 5F0WA 3G8TA 1JQGA 1YIJS 3NGUA 2DGVA 4NLQA 5FD1A 4QU6A 4PXCA 4U8YA 1FI4A 2E5HA 5DM6Q 4OZ1A 3GFXA 2PDAA 1HD1A 3O5TB 1S1TA 4IOBA 1VJQA 2B56A 4KPYA 2BJ3A 1VQPS 2G0CA 5J1PA 1U6BA 4LBHA 3UDLA 1FDBA 1T9WA 1H6KX 1UTAA 3M8RA 5U47A 2KXNB 4FPRA 4QBUA 2MZTA 2GVDA 3TEGA 1Q81T 5FIIA 1TR0A 1A7GE 1RAEB 3B4DA 3VWSA 4Y2CA 3MECA 2LQ5A 3AHPA 1U1MA 1LK5A 3GILA 1SJFA 1FK9A 3R2DJ 2DR6A 1LW0A 4MYTA 4DR3F 3MR7A 3IR6B 1D9AA 5MLCV 2AQ4A 4QYZJ 2ZUGA 1KHWA 3QNWB 4LR9A 3LUYA 3LP1A 3HHLA 3RYLA 1WC3A 2AD9A 4NCBA 2I6WA 1FRHA 3NWRA 4M63A 4ECVA 4LF5F 4LF6J 1B99A 3MM5B 4Y3CA 1NB2A 3KTQA 4ZMMA 1KFSA 2B6AB 1QSYA 2BA9A 1MN7A 2ZH8A 3TRGA 1XMQJ 4WTOB 3NRBA 2OD6A 3D0IE 5KFMA 3AFGA 1Z2LA 2LP4A 4WK1A 4P2SA 3HCXA 2R2UA 4OX6A 2VUGA 3DGPA 5I3UB 3NBPB 4RL1A 2DNZA 5F8HA 1UWAA 2CPJA 4K8RA 3QGIA 2G2OA 4HACA 4OX9F 2UV8A 1VQ8S 4MIWA 3P45B 4IUFA 2OHDA 4RNMA 1HBNB 3OBIA 2DHSA 1Z2ZA 2HMIA 3OV7A 2YBVA 4PG4A 5E5NA 4F26A 1UA0A 4DMZA 5C42A 2VBWA 3P96A 3R5DA 3MM9A 1U49A 2VFVA 3K89A 4KKOA 4Y6IA 1PAUB 2WSCC 3P5TL 5D0RA 1JJHA 2YKAA 1K73T 3DRSB 2QT7A 1ZBTA 5KFIA 5DM7Q 3MGJA 5JJBA 4PCQA 2V8PA 2R7TA 1Q5YA 3LP0A 5KFZA 3LF0A 4C2MA 4F50A 3DLLQ 2JFKA 2R7UA 3HLUA 3MTJA 3K7RA 5J2MB 5KFVA 2J8AA 2YY3A 4B3MF 5J2NB 3TUIC 2JLGA 5DG7A 1QUPA 3HXMA 2DYAA 3PRDA 2FDNA 3GONA 4MFBA 2XMVA 4ZOSA 5HP1A 4U9RA 5F3TA 4NI2B 5J2QA 3VHQA 3OJUA 2OEMA 2BANA 2B4OA 1UFLA 4IQMA 2HNDB 4WPAA 4F4YA 4ED0A 4FYVB 1C0UB 1LXJA 1IN0A 1X60A 5DQIA 1IWAA 5IS2A 2UU9F 4ZIVA 4DV6F 1T9UA 1UL3A 3NOCA 3ZTQA 1BQNB 2J8SA 3NNCA 4DV7J 1KDNA 2XQCA 2KFZA 1TL4A 4FVCA 1S9FA 1UEVA 3K5LA 3CJKA 2ZH1A 3MD1A 5E41A 1HNXJ 1KLMA 4P73A 1LWXA 2AJ4A 4FXWA 4LFCJ 1FDAA 1S97A 4KPCA 3ETMA 3T6BA 4DV3J 1RE1B 4NLXA 2XO7A 4XTTA 1WDTA 1NH8A 3FCHA 2AX1A 1Y10A 3CCUS 2AYEA 1MMDA 3EZ5A 2CPYA 2J76E 3DOKB 2PT0A 3BF4A 1LWFB 1GTHA 3H5XA 2HVIA 9RUBA 2P9GA 3HVRA 4LRBA 2X1AA 1N54B 1BD6A 2O67A 3M8YA 4JP8A 3VAMA 3IWLA 3WIVA 2W9BA 2CNNB 4DJBA 4ECYA 2K8GA 2PSZA 4XK8C 4QYZK 3HFKA 1H73A 3W9IA 2WW4A 5AXMA 5IV4A 2HHHF 1T05B 1R8AA 5KFOA 2F4VJ 2XS2A 3AXKA 3C15B 4WIQA 1SL1A 4Q8EA 2YWHA 2LEAA 2D3OR 4EFAC 4TU9A 4O23A 2CPEA 2XS7A 2ROGA 2OPQB 2WBRA 4DSEA 3QLHA 1HW8A 1QTMA 3LW5C 3K5NA 2CWXA 3MAQA 1S59A 2V2KA 4RW6A 4DX5A 1BMQB 3DOLB 1YJ9S 1SV5A 3CGIA 4F0MA 2J0SD 2G0IA 4P2XA 3GFHA 5IQQA 2VQEF 1Q86T 2W9CB 1GEHA 3TAMA 2NSBA 2MMYA 3PO5A 3OLAA 3CEDA 4DV4J 3GPAA 1JLBB 2CQBA 4RWXA 2ADBA 2KFYA 3N0VA 2OSRA 2CVIA 1DBDA 3IRWP 1CJKA 3DLJA 5EWGA 4U7UD 2GIQA 2NUHA 3CIZA 3M30B 4DUZJ 5HLFB 3PYEA 3QIPB 4LF7F 3ZZYA 1MU2B 1CJTA 4DCOB 1RKJA 3U02A 4BC9A 4ZP7A 1VC5A 2R7SA 2ILZA 4UOGA 4YOEA 2HHSA 2AHOB 2IM2A 2NZ4A 2ZBPA 1S0NA 1TL1A 1NJZA 1RWUA 2M7SA 3MPVA 4DR1F 4A8XA 1RU1A 5IM0B 4QIGA 2MQLA 4DUYJ 4WTYA 2ZH9A 2M8DB 4U8VA 4WP3A 2YNFB 2RDJA 3GJRB 2IHR1 4EYIB 3I56S 3EXYA 3U1NA 2OTLS 4KIAA 2FC8A 4YHHF 2M70A 4DR7F 1RWKB 3KG1A 1HIYA 2DR7A 2BABA 1P1TA 4C8ZA 1SC6A 1HI0P 3PJ9A 3R27A 4F3OA 3JXOA 1UA1A 1S0OA 2WVCA 1U1NA 2C3YA 1MMNA 1OY8A 3MM8B 2M4MA 2VKZG 1ITPA 1U1KA 2BX6A 3M8QB 3CDWA 1RHMB 3M2RA 3UR3C 3UNGC 3D28A 2BJDA 2JX2A 3DOMB 5T14A 1SH2A 4HH0A 2LXUA 1VK3A 4B3SJ 2DBBA 2FQQB 4NX9A 5KFNA 4USKA 2KYZA 4ZVGA 2UXDJ 4ILLA 2COLA 4NYZA 1N0VC 1E6VA 3CCES 1WEXA 5HK4A 1F3VA 2Z2MA 1UWBB 3V4IB 4B3OB 4P9SA 4IRDA 2V4QA 3M2UB 1SIWB 1SH0A 4U7UK 2B0GA 5K8MA 1T9YA 2NXCA 2HEKA 3LWMA 4ZK7M 5LSLA 4QWDA 2FVCA 1X8DA 5T41A 1Q8IA 1FRIA 2DT9A 2OO4A 1RHUB 4RNHA 3G87A 3FJ2A 3HT3A 3DLGB 3T1YF 2BYCA 4ZIWA 2HBYB 2RF2A 4HLBA 6AT1B 2E5LJ 4RUBA 1JNZB 4NEZA 2UUCJ 2KKHA 2XMWA 4WWSA 3TX8A 4XAKA 4H4OA 4UQGA 1U6ZA 4O44B 1J5OA 2CXEA 2DEIA 3UCGA 3SQOP 1AZSB 5A2QU 4JV0A 5DDOC 3BR9A 2VDIA 1SPBP 3HSGA 2MGZA 3UD4P 1FKOB 1RTHB 2J6TA 1Y5LB 3GIIA 2R8GA 4DPOA 3G8QA 2YQ0A 2GAGC 2VQFJ 3TA2A 3LA0A 2AKWB 3T9ZA 2QLWA 4LR7A 3TUPA 3P3DA 4QWEA 4YFUA 1W2IA 4JUZA 2ZOMA 4ZPBA 5KFQA 5EUHA 3MUVP 3QZ7A 3G4SS 3JSYA 2V6AA 3OTEA 5CYMA 3K8WA 4M5HA 2HFOA 2NXUA 9ATCB 3FQKA 3TANA 2RHSB 3GTYX 2YNIA 4AD6A 1B7FA 1WSRA 3QATA 2RRBA 1B7YB 2V68A 1VOMA 4DL7A 1Y00A 2BW2A 3FSXA 4LRCA 3Q8VA 2GVZA 5KT5A 2X51A 1PJ6A 2ASJA 3H20A 1AA1B 3SSRA 3MUTP 4F25A 1RWOB 3L7PA 3CCSS 4WFBQ 3JTOA 3QQCD 2JLEA 4J9OA 4MIBA 2C2MB 3Q24A 3CPWR 2XHWA 2QL9B 2YNGB 4RBUA 4X66F 2R7RA 2RRNA 4K2XA 2GGPA 5K9FA 3TYTA 5MAOA 1N6QB 4R5PA 2LEPA 2NPIA 2B4UA 3MMCA 2DRBA 4M94A 3SZ2A 1G4CA 1GX6A 2VPYB 3NAHA 2D1CA 4LF2A 4M8LA 3CJ8A 1CLFA 4JI3F 2ZC4A 4ANEA 4M5KA 3DXBA 2GA7A 4TVAB 4NMXA 3U1MA 2MKSA 3V81B 1W2BR 1FERA 1JLQB 3OHBA 4AFFA 3HK2A 2A18A 2IYIA 2DNMA 2FJBB 3TZXA 4UUWA 2ZH6A 1T3OA 4CWBA 4L6V3 1RKIA 5CXTA 3T5HA 3DI6A 2EG1A 2PO4A 2AYMA 1WF0A 3MFHA 2O5DA 2UUAF 1J5EF 2NYHA 2PGCA 2YPYA 4LF9F 3QGPA 2A6MA 3RAXA 4I64A 1CVJA 1S7IA 5HVGA 4CLYA 4OL8A 2ZVSA 1YZ6A 4F2RA 3A3OB 1N8RT 1DARA 1HI8A 1JXVA 3TVZA 4NOHA 1WI8A 2NCKL 2N4CA 3HJVA 1NDCA 3PIPQ 2ZZNA 3OFEA 3PRBA 1N36F 3HT0A 2L9DA 3PW4A 5GMDA 1FE0A 4DG1B 4F2SA 3M2VB 2C2OB 2CPXA 2JFDA 3K17A 4RW7A 2HNZA 2Q1LA 2IRUA 2APOA 1IBLF 4N5SA 1I6JA 2PFFB 2P9CA 4KFBA 4Q7AA 1HNIA 2W7AA 5GAHI 4DEZA 5B0FA 4DR3J 4OZ5A 2RDIA 1NM2A 1FE4A 4RNNA 3OXLA 4QJVA 3UO0A 4IFVA 5DQGA 1U1LA 1OS5A 1T7PA 4LF1A 4OHVA 1EZZB 3PKMA 4LSNB 5CD4A 3UR0A 3SCIE 2HWIA 2DIUA 3H5SA 4KHRA 2F40A 4DU8A 1QE1B 2BQUA 5L1JA 3E51A 1S99A 2UXCJ 1TL3A 1Y0HA 4O3RA 2C42A 1H7WA 4X4SA 5A8RB 3OXGA 4PXBA 4X65J 4FKXA 3NGDA 4CP5A 4OX9J 2EK6A 4KO0B 4O4GB 1S1VB 3KK2B 1YJTA 2VG7B 4Z2XA 2ZH7A 3MEGA 4NPOA 3WQPA 1LNQA 1DZ5A 1IBCB 1VHFA 1Y3JA 2OPSA 1UZHA 2MKKA 3KHGA 1ZZNA 3HHLC 4Y2MA 3Q23A 1ZPVA 2WCXA 1V3ZA 2K1RA 2ACMA 1U1QA 3BSNA 1SJ3P 2KZMA 1RTJA 2V94A 1S1TB 2XMTA 2JL9A 4KAIA 2CNOB 1SKUB 2GIFA 1B0TA 5HMWA 3L3CA 4LFAF 2C28A 2UVRA 1UJ5A 3TW0A 1YWXA 3M8PA 1VBZA 1YJRA 3JAMY 4B3MJ 2LU1A 2GVDB 2EKYA 2DNPA 4GVLA 2ZBQA 2W7OA 5BR8F 4RBTA 1JLGA 3MECB 1IBMF 1TK0A 2FJVA 2RVJA 1DQ9A 1FK9B 2BJEA 5I3QA 1HBMA 1LW0B 2W2MP 4LBIA 3POTA 2ZKUA 3CC7S 1S77D 1N56A 1FCAA 4P52A 2UU9J 3HHLB 1GMWA 1X4EA 5IXUA 5C24A 5C7PA 4MKVA 2CPZA 4EBDA 1HWJA 1OPIA 1TKZA 4DR5F 4NLVA 2J7WA 3M32A 4JOUA 2H4WB 1JLEA 5CD4H 3VQSA 1Q5VA 4HYKA 1SI9A 3ET6A 4NA2A 3OXFA 3ZTSA 1JNRB 2E66A 4P71A 5E3RA 2J9DA 4DUTA 3MPUB 1YQHA 3DGPB 2DY1A 2Y0BB 2JC1A 2QLJB 3O3LA 4HACB 3BB5A 2C2DA 1FWKA 2UXBF 4JV1A 3DU6A 3HFZB 3NMRA 2GHWA 2AX0A 4ZVQB 2QSFA 3C16A 4U96A 4FYWB 2GMLA 1P6TA 2I5JA 2AJ0A 2OEKA 3H2UB 1FRMA 1U48A 5ETNA 2XCAA 5DDPC 5GMEA 5C42B 2UVUA 3MM9B 2VZ9A 3LTOA 1FKPB 3G6YA 1B70B 2RHQB 3HHLD 1HBUA 1LW2A 4DV0F 2MKCA 3LP0B 3IWXA 4CH0S 1NK8A 2M9KA 2HHHJ 1VQMS 5G0RA 2V8GA 1VJWA 2MJNA 2ALYB 4I2QA 3DXSX 1A9NB 3H59A 2E7XA 4PZVA 3FBFA 3IO1A 2HSEB 3BN4A 3FRZA 4F4XA 1F6TA 5DGAA 4JI8J 1Y7PA 3BV8A 4Q43A 1X0FA 4FDFA 4MFBB 5HP1B 2QLBB 4JI0J 3RUBL 6FDRA 4NWBA 2B7BB 4LMZA 2BANB 2HHPA 1YG0A 3K2YA 2HRYA 3RG6A 1T03A 1UVMA 2HFZA 4UW2A 3I31A 4MYUA 3DM2A 3LH2S 1KQGB 2RE1A 1NK7A 2LQBA 1NSAA 3IBFB 2V5HG 3OHAA 1R27B 3QYYA 5L1LA 2QLFB 3CJKB 1KQFB 4DFKA 1R0AA 4HKQA 3CC4S 2RB7A 1JLCA 1KLMB 4LF7J 3P6YC 1RAJA 1RUSA 2RQMA 2ACYA 3SFUA 5LJ3Y 3M9OB 3KHHA 3T5JA 2FGOA 4DX6A 1FDNA 1SKSA 2AP6A 2LQJA 3BBCA 1R3NA 3AOCA 3CCRS 3CD5A 4DZDA 4MKBA 2H54B 2HFVA 1KSPA 1R8BA 2DGSA 1HMVA 5KFLA 2P5VA 4JB8B 1PJ5A 5ETOA 4NXNF 4ED8A 3OSNA 1GTEA 4XPEA 3LP2A 1NHKL 1NJIT 4YDDB 1OWXA 4YHHJ 4PAAA 3I96A 1WELA 2W9BB 4PYAA 4QIEA 1SBRA 2P6TA 1Y9OA 1DTTA 2K3KA 1K1QA 2R7XA 2JJ4D 4DX7A 3W2WA 3EUNA 2YQ1A 3A12A 2HNYA 1PIEA 4X4OA 4UOFA 4Y65A 5KFFA 4DFPA 4DN0A 4FVMA 4EEYA 5B09A 1HA1A 1M90T 1RHRB 3NY0A 2BOPA 2EFPA 1NJWA 1AUDA 5AT1B 3QLHB 3NCPA 1UZDA 2IBKA 5CA5A 4DQRA 1RBLA 4RW6B 3JSRA 4M5DA 5IC4B 3JQMA 1C1CA 1SV5B 4OLPA 4PG6A 3QJJA 5J2PA 3KLHA 4ZP8A 1IQTA 5KG3A 5F8IA 2HIYA 4O3QA 1RWPB 2N4DA 5D0GA 4ECTA 1EHWA 1FNMA 4DSLA 1J2VA 5KFUA 4TYBA 3RB6A 4ETZA 4QW9A 3I0SA 2HHTA 2AZ1A 3ISZA 3CJRA 3AJ2A 5KFWA 3D2WA 1OYDA 4OZLA 1CJKB 2WOMA 4Y2KA 1SJQA 4AYBD 5HL7Q 2XLJA 1CJTB 1KOHA 5BJRA 3T1HF 3A3PB 4JI2F 2W7PA 1C0TA 4NRUA 1LXNA 1VFJA 2Q66A 3CNQP 4ID8A 2J5AA 3NGSA 5A0YA 4RBVA 5ETTA 2F65A 2VU5A 5E0OA 1TL1B 4C6AA 3WDOA 3PR4A 2D9OA 3HJFA 3MR2A 2DR8A 2ZDOA 2NXJA 3A1YG 3E3XA 2ZVIA 5ETQA 5KG7A 2IRXA 3UI3A 2HG4A 1RAGB 3MPDA 3W60A 2ZBCA 4OYIA 3KLVA 4LF4F 2CG4A 1WKJA 3R6LB 2JEJA 3Q8PB 2AW0A 1KTQA 2ZOFA 4GKJF 2VL1A 3ZXWA 2DH7A 3R7BB 1O0PA 2BKOA 2MQ8A 2R4FA 1YITS 3I9ZA 2C3OA 1VC6A 2O3DA 4XDDA 4L3KA 2IM0A 2KO1A 2C1EB 3SMZA 3GIKA 4WE1A 3QRPA 3EVMA 3WC0A 2QN6B 1GX5A 2DNYA 2FJEB 3M2RB 2ATLA 3A3NB 2H48B 2CQIA 2GQ2A 4WBFA 3WHIA 5THWA 5H9FJ 3VALA 4FZVA 1ICEB 1WOSA 4HEA9 2KG0A 2EFNA 3V6DA 1XC9A 1RB0A 1E6VB 1YJWS 2FVQA 4PG5A 3IR7B 4Q5VA 1DRZA 2PEBA 1T9VA 3VQTA 3TUJC 4DBQA 5KFSA 1UJ6A 4CCHA 1RTIA 4OFZA 4ZVTB 3X3UA 1RAIB 2B9YA 2DK2A 4PUOA 2XGQA 4YN3B 5C2GA 2X1BA 2KVQE 2RF2B 4FBUA 3HP6A 1CPZA 2RKIA 1NNDA 1EETA 1ZM4A 4H4OB 4O3NA 3SXLA 4ZJOA 4GKKF 2Y1IA 4HR2A 5KT7A 1KKHA 3HHEA 1CULA 1D8ZA 1J5OB 4CO4A 4M5IA 2K3IA 3QFWA 2IAJA 3ZZRA 1Y11A 2XYPB 1UFWA 1EKSA 2CQ1A 4TY8A 3IBCB 4C48A 2CRLA 2JOQA 2YTCA 1U1OA 4E0DA 1RGVA 2UUAJ 4K4TA 4DR6F 1J5EJ 3MHYA 3EXCX 4BWJA 2N3LA 2MGZB 4I0WA 5DZ7A 4Q44A 1RI7A 4F4ZA 2K7KA 4LF9J 1VLYA 1RA7A 1VS3A 5CH7B 4I2PA 1Q0NA 1T9XA 3I82A 2WVEA 5D77A 2ZJPQ 1VQ5S 3QZ8A 2MLXA 1APSA 4FS2A 1SQEA 3KLIA 2IMWP 2IY5B 3AODA 2XSJA 2CQGA 3QAEA 4CLLA 3KJNB 1UETA 4N8OA 5KFRA 4DL6A 2OUGA 2MYFA 5CYMB 2QFIA 1HPZA 1D3WA 3PEHA 2BVZA 4OV1A 5F9NA 2YNIB 2B3TB 3MF5A 4DXLA 3VAGA 3E01A 1N36J 4K4UA 4ED2A 2W8LA 2CPHA 2IJFA 2Y8WA 1E6YA 2V67A 3N6NA 4L74A 4X4QA 4HH1A 3I5BA
chains in the Genus database with same CATH topology
1S97A 4AE5A 1F5BA 3W2VB 1HWUA 1JJ2R 1FD8A 4F3QA 3D0GE 4OIXA 5B0CA 2JLFA 4KJIA 2I38A 1HBOA 1K1SA 3DLEA 1FF2A 2RSQA 3T6BA 3O44A 4EBCA 4DQQA 3NLCA 1REVB 1IKYA 4NLXA 3UW1A 4EU0A 4F4WA 2XO7A 3PVXA 4WFYA 2EWHA 2LMIA 2VFSA 3CB4A 4DSKA 4EO8A 2ZH3A 4AL5A 4WKYA 2XB2D 3KNAA 4YDXA 2HGLA 4YR3A 2AWZA 1GH8A 2AYBA 4MAKA 4LJMA 1H98A 3GR1A 5KT4A 1NH8A 4PWDA 3FCHA 2B51A 2RNEA 3J81Y 3KLGB 1VI7A 2IA6A 4CO3A 1QLNA 2GQCA 2AX1A 4PRFA 1K0VA 1IQZA 1GXLA 3LQVA 4URQU 3CCUS 2AYEA 4YQWA 1MMDA 2GGPB 1NKEA 3KK1A 3EZ5A 2CPYA 5A2QY 1YHQS 1JXLA 2J76E 5CCMA 2IRYA 2J9EA 2GQQA 3DOKB 2KH9A 3P49B 2HIQA 2PT0A 3BF4A 3UCZP 1PILA 4B9NA 3C46A 2XNRA 1LWFB 2AGPA 2DGOA 1GTHA 3MMCB 4JI5F 2JSXA 3EGWB 3M4XA 2FHJA 3QGHA 3M9MB 3LAKA 2FHKA 3H5XA 2HVIA 2P9GA 2DISA 5LMUF 3HVRA 2AJFE 2HLTA 2X1AA 2DNRA 1R8PA 4AL7A 2YKMB 4DG1A 3BDPA 1N54B 4USJC 1BD6A 2O67A 1WF2A 1CSJA 3KYLA 2VG6A 4FXVA 2FC9A 5L39A 2FUG9 3OR1A 2JH3A 2OFHX 3CCWA 5DQHA 4WFNQ 3VZIA 2L9WA 4DF8A 3VAMA 1Z4UA 3IWLA 4CO5A 4PG8A 4YUDA 1JX4A 2UUBF 2W9BA 1S0MA 2EC0A 4DJBA 1RT7A 4ECYA 2K8GA 2PSZA 3NWGA 1ZM2A 2I8EA 4X64F 4K50A 2BUNA 4XK8C 1RT1B 2VC0A 3SQGA 2MKIA 3HFKA 5DS7A 3OUYA 1NK0A 3HF5A 1ZM3A 3I9V9 2CZVC 2L48A 1TKTA 2E7WA 2XY6A 2VA2A 1QSSA 1BQMA 5B0BA 3EPIA 3BM7A 3KJVB 4FS1A 3UE2A 1KQSR 2GO9A 4B3RF 4USIA 5A8WA 2C3UA 3OFGA 2ZD1A 3BGRA 5AXMA 2YKOA 2J0QD 2DRAA 2JVOA 4NLRA 2KG1A 1QY7A 2ALZA 2HHHF 1T05B 1R8AA 1JB0C 5KFOA 4C8YA 1M5KC 3HZEA 1JKHB 2CQCA 2XS2A 1KONA 2IYGA 3DI6B 4GC7A 1VRTA 5M2PA 1SKRA 2XGPA 1Q53A 1FEEA 5L1KA 4EYHB 3Q8RB 1LOUA 1SL1A 4ZPVR 3MM7B 4WF9Q 5F0UA 4RNFA 2VA3A 4Q8EA 2YWHA 3IAS9 3OTOF 2LEAA 2XWXA 1M0SA 3MEEA 4I6WA 5HI7A 4EFAC 2D3OR 4NL5A 2FLLA 2B43A 2OPPB 3HHDA 4TU9A 4O23A 2CPEA 1GXUA 3NAIA 2DH8A 2XS7A 3RU0A 3FZ2A 2ROGA 2V4JB 2OPQB 4OI3A 2WBRA 3QPIA 1RT5A 2VBZA 4DV7F 5KFCA 3QLHA 4DSEA 1N32F 1HW8A 1S9EA 1FKAF 2CYYA 3LW5C 2RH3A 1QTMA 2J7KA 2Y0SD 3T1AA 3K5NA 2HHWA 2R7VA 3MAQA 2FJAB 2B4PA 2NUUG 3BQ2A 3IS9B 1DLOA 1Q4RA 1R31A 2V2KA 4C8MA 5D78A 2F1FA 4RW6A 2HAIA 5D4OA 3LO3A 4KGKA 1S1UB 5GAGU 5F8MA 3DOLB 3LOUA 1YJ9S 2NLWA 2HHXA 1SV5A 3CGIA 2POKA 4D3GA 1UVIA 1ZOTA 4K59A 2J0SD 2L9NA 2WSFC 3ONQA 3HKZD 4OX7A 5E33A 4XPCA 3PX4A 1WNEA 3GFHA 1IM4A 3C6TB 5IQQA 2VQEF 1WEZA 3BQ1A 2W9CB 1Q86T 1FHTA 2P6SA 3TAMA 2NSBA 2QEXS 4DSFA 4WK3A 4ZCKA 4FF3A 2MMYA 4RUHA 3MAHA 2XI2A 4RUAA 4QWAA 3W3SA 1S6QB 3PO5A 1TVRA 3OLAA 2HW3A 3CEDA 1NZAA 1PSDA 3ZFVA 2E1CA 4RLEA 4IFYA 4J37A 4NYPA 4ZP6A 3ZZ0A 1JLBB 3CD7A 3FSYA 3OL6A 1BC6A 2AYGA 2CQBA 1S76D 3MEDA 3QWPA 4RWXA 4OI0A 4WXWA 2R2RA 2ADBA 4OJHA 2KFYA 4PPDA 2HVZA 2J0XA 2OKQA 3I87A 3N0VA 4R25A 2OSRA 2BRKA 2B9XA 1DBDA 2CVIA 3IRWP 1S6OA 4DV2F 1QUVA 3DLJA 5A6PA 2R7WA 5EWGA 2FGCA 2IM1A 1RT2A 2GIQA 3MR6A 1HHSA 2NUHA 3CIZA 3RRHA 4LSLA 3AQOA 3M30B 1FEHA 3Q0AA 4YB5A 3CCMS 1TV6A 5HLFB 1YJNS 1RJJA 3OFHA 3QIPB 4LF7F 1VQ4S 3ZZYA 1MU2B 1XMOF 3NNHA 4KHPF 2N7CA 4RW7B 1RKJA 3U02A 4BC9A 4ZPWR 3C6UB 2HNZB 2YKNB 4ZP7A 2PC6A 2QMXA 2D3UA 3K8VA 1VC5A 1WACA 1IXKA 2Q79A 1Q79A 3MM6B 2R7SA 2ILZA 2J6SA 4LFBF 1N88A 3US5A 4LVOP 1ZPWX 2NYIA 4E98A 1HQUB 4YOEA 6FD1A 2MKHA 2HHSA 4KT0C 2KTQA 2JZ5A 2IM2A 2PEHA 3FVYA 3LPYA 4EZ6A 2NZ4A 5J1EB 2VG5A 3PHEA 1IJFB 3BZQA 1S0NA 1TL1A 1NJZA 5CYJA 1RWUA 3SCLE 2OPRA 5FJ4A 4J9RA 1HD0A 2M7SA 1R8CA 1HYSA 2VV5A 3MPVA 3DHXA 4ED1A 3F44A 4KFBB 4DR1F 2HRUA 3Q8SB 1RT3A 1HNIB 3C66A 4NLYA 4A8XA 4DQIA 1AFJA 1LWCB 2UUTA 3Q2SC 3RBDA 5IM0B 3F41A 2Z8QA 3D5MA 4IDKA 4QIGA 2LDYA 2MQLA 2BV3A 4TLQA 3LALA 1V6HA 1X5PA 3PFEA 2ZHAA 3PV8A 4WTYA 4QU7A 3I55S 2ZH9A 4ECZA 2M8DB 1IKVA 2OD4A 4MH8A 4IFVB 4C3LA 3M8SA 3FGVA 2MHEA 3GG0A 2AGOA 1QVFR 2YNFB 2RDJA 1VBYA 2IHR1 4XIUA 3JYTA 3MMAA 3SV3A 4EYIB 3TUZC 1NO8A 2HWTA 2F4VF 1HNVB 2E1MC 2JEIA 4TYAA 3I56S 3EXYA 1NAQA 4ALZA 4DFMA 1MWYA 1RYSA 2BE2B 1ZYQA 3U1NA 3GB0A 1ZM9A 3M1VB 2OTLS 4KIAA 2FC8A 3UFCX 4YHHF 2AJQA 2M70A 4DR7F 3D0HE 1QAXA 5CHCB 3G6VA 3HVTA 5K5MA 2YX4A 3KG1A 3FEZA 1F60B 2XMUA 2XMJA 1X4HA 2DR7A 4TY9A 3MM5A 1TL3B 5B08A 1DTQA 1P1TA 2BABA 4QWBA 4C8ZA 4ID5B 3N6MA 2V9KA 4RKUC 1VIOA 4QOTA 2B6AA 2DHAA 3OQ2A 1SC6A 1HI0P 3SFGA 3R27A 3BQ0A 4F3OA 4I4BA 1UA1A 1S0OA 1G3OA 1U1NA 2ZC3A 2M5YA 2C3YA 1U47A 2KRBA 4NLUA 4ZHRB 4X2BA 1MMNA 5F41A 4H4MA 3MM8B 5AJ3F 4C8LA 1UAWA 2M4MA 2GX8A 2VKZG 1NH7A 4ZVEA 1NEEA 4OI2A 2Z0GA 2QA1A 1MW7A 2RD5C 3IN5A 4MIAA 2JEGA 1ZAWA 4QZVB 1O5JA 1XN9A 2E5JA 2EFVA 3NP5A 3CIMA 2PA3A 3I5AA 4C8KA 1JWWA 4FF4A 4ZS6A 1U1KA 3M8QB 5KG0A 4B9TA 2I1RA 3CDWA 3M2RA 2FB0A 1HI1A 4G1QA 3UR3C 3UNGC 1ZAVA 1WG4A 3D28A 3NBPA 5I3UA 2BJDA 3NMAA 3CDEA 1Y5IB 3DLKB 1OQ6A 2JX2A 5T14A 1SH2A 3PEJA 2LXUA 4HH0A 2R2SA 1NJYA 1URNA 1VK3A 1UVNA 1LFPA 2M8HA 2WOMB 2DBBA 3GYNA 2NPFA 4NX9A 5KFNA 3MEGB 3RR7A 2WW8A 3H98A 2KYZA 4QIVA 1YRUA 4ZVGA 2O01C 3BSOA 2KT5A 4J5OA 1TFWA 4ILLA 1CEZA 2D41A 5BYRA 2WB1D 2QA2A 2COLA 2BBEA 3KG0A 1Q78A 4RU9A 4NYZA 1N0VC 1KQKA 1E6VA 1FRLA 4QR2A 3CCES 2OPSB 1WEXA 2A1BA 2Z2MA 1FRKA 1UWBB 3QIDA 4ETXA 3V4IB 2PA8D 4B3OB 2NR0A 4ZLPA 5KFHA 2LECA 4IRDA 3J7YI 2V4QA 1NHVA 4DUZF 3M2UB 1SIWB 2QSWA 5KG6A 1SH0A 1XERA 4U7UK 2B0GA 5A0YB 5K8MA 1QSLA 5M2UA 1GXTA 2HQ3A 3LWMA 5IQ6A 4ZK7M 2R8KA 2FJDB 5LSLA 1YSJA 5EN1A 3DRPA 2N7YA 3TNVA 2ZHBA 4Q2MA 4X62F 4QWDA 3B4MA 2FVCA 2U1AA 1YGYA 2ZNZA 1X8DA 1FJGF 5T41A 1Q8IA 1Y4ZB 2E29A 4IH6A 1FRIA 4OI6A 2E1RA 1DQAA 2DT9A 2K1RB 2OO4A 1X4DA 4UOCA 1ZTTA 3FRYA 2DCUB 3TO8A 4X4RA 3CF5Q 3NS5A 1KFDA 1X5TA 2LXIA 4RNHA 3RW6A 3FJ2A 5DG8A 3HT3A 3CDBA 2MPUA 3DLGB 1RTJB 3T1YF 3BEGB 2BYCA 3GSDA 3V6HA 1QVGR 1VRUB 1N4LA 2RF2A 4HLBA 2FHMA 1TKXA 4Q2LA 1HQEA 1JNZB 2KDOA 2R8HA 4PXEA 1SL0A 4LIRA 2ROEA 2KKHA 2XMWA 4IG3B 1BWEA 1JK9B 3KWMA 1HNZF 3TX8A 1X4GA 3DRSA 4BCAA 4ZVFA 4XAKA 3CXCR 4H4OA 2MZ1A 5LL6d 1RYRA 2QIFA 4AXJA 1TK5A 3BGUA 3QO9B 4XDCA 5HBMB 3FFIA 4UQGA 1U6ZA 1VQKS 2CDQA 3M9NB 1NK9A 1KD1T 4DS4A 4O44B 3ZZPA 1J5OA 4OI1A 4Y0FA 3SV4A 1DJ0A 5A8KB 3UCGA 3EGNA 2DGUA 3LP1B 3M8PB 2ASYA 1IJEB 2YWEA 3BJYA 1Q8BA 5F9LA 5DG9A 4JV0A 3Q22A 4UY8T 3DN9A 5DDOC 2MJUA 2MHNA 5JXSA 4FNIA 3GIJA 1M1KT 4R0EA 1L3UA 3BR9A 4B9LA 4JI1F 3NGKA 1RT6A 3MMJA 4RW9B 3OL9A 3G8SA 1VQSA 1K0TA 5J2MA 3D1OA 4IR1A 3UDCA 2YQ3A 1RQ0A 4WFAQ 3IFEA 3PACA 2MGZA 5J2NA 1FKOB 1RTHB 2F3JA 3UD4P 1JLGB 1Y5LB 3GIIA 2J6TA 3J7A1 2R8GA 4DPOA 3G8QA 4IG0A 1V9OA 3PJXA 3CE8A 1FKPA 1T94A 3ZC4A 3PZPA 3B8HA 1WF1A 3E8OA 5KOWA 3TA2A 3GR0A 3IG1B 1N48A 3T9ZA 4N8NA 4HTIA 2QLWA 1HBMB 1XTZA 1Y5NB 2FPHX 4TN2A 4PKDB 2MQNA 1C1BB 1FDDA 2M3DA 3P3DA 2OAUA 4EGLA 3POTB 2PI5A 4R8UA 2YX7A 1OSCA 4QWEA 2ZZMA 2RMLA 2K2PA 3DNCA 4YFUA 1B0PA 3QMQA 1QAIA 1W2IA 2V0NA 3OW2R 3MFIA 1CC8A 4JUZA 1Q1KA 2DITA 2ZOMA 1CQMA 4ZPBA 5KFQA 3CULA 3PX6A 1U2RA 1D8YA 5EUHA 2HNDA 3MUVP 5C24B 4BC7A 3QZ7A 4RWWA 3G4SS 2YWKA 3I0RB 3JSYA 1C0UA 3GE9A 3R5CA 2WRMA 4NLWA 1ELOA 2I0XA 2D74B 3OTEA 5CYMA 3K8WA 2HFOA 3G86A 1RT4A 1TKZB 3TP2A 4B3TF 4Y34A 5I42A 1S1XB 2NXUA 4H4KC 4YB6A 4CO2A 3FQKA 2HS0A 3TANA 3M32B 3CCJS 3SI8A 2YNIA 3AQPA 1AROP 1JLEB 2ZHOA 4NCGA 2WHOA 4RW8B 2KRRA 5DJBA 2MZJA 1BQNA 4NLOA 1Q7YT 1B7FA 2XLIA 3PXGa 4J9NA 3SSQA 2UXDF 4ES3A 2RRBA 4UUXA 2MY7A 3JB9k 2G9OA 1JLAB 1VOMA 4DL7A 3GYXB 4LF6F 2HMIB 3NNAA 1FVSA 1Y00A 4ILMA 1LWEA 1D9FA 3KK3A 2BW2A 3B78A 1MROB 1FXLA 4IO9Q 4F02A 3FSXA 2Q3PA 1XMQF 1NKBA 2J0WA 2XC9A 2F7VA 2MSTA 1DURA 5KT5A 3GIMA 2YH1A 1X5SA 1P1LA 2XBPA 1FNOA 1FNXH 3IWNC 1YVFA 3W2VA 2X51A 4FYDA 1M5HA 1T02A 2CVEA 1FA0A 4WYWA 4MTPA 4KKOB 1BY9A 3JSBA 2ASJA 3H20A 2BACA 4WYLA 3SSRA 3MUTP 1REVA 2E9RX 3GG1A 3NCRA 4F25A 3VAKA 2FLNA 3X1LB 1WEYA 5HMZA 3L7PA 4I68A 5M2RA 3CCSS 4WFBQ 4HI1A 3JTOA 4DDFA 3TVKA 2KI2A 2JLEA 1N5TA 4J9OA 4MIBA 5DETA 5KTQA 3EYZA 1SUQB 3Q24A 4QR0A 1VIXA 2H5EA 3KLGA 3CPWR 2XHWA 4X66F 2YNGB 4RBUA 2R7RA 2RRNA 4OJ1A 5K8NA 1U2FA 4K2XA 2WAQD 3OPKA 3SDEB 2GGPA 2XS5A 5K9FA 3DHWC 2I5JB 3TYTA 2YWFA 1M5PC 3DOKA 4A8OA 2KHCA 5MAOA 1N6QB 1XR6A 4TY8B 4UQTA 3R3TA 4R5PA 1LWFA 2ADCA 2DHXA 2LEPA 2NPIA 5A6WA 2B4UA 3MMCA 4URSA 1TK8A 2DRBA 5E3QA 3BGFA 2CJQA 5KT3A 1S10A 4M94A 3MEKA 3SZ2A 2XMKA 5IWAF 2C2EA 2CQHA 4TLRA 2DGTA