1BMQB

Crystal structure of the complex of interleukin-1beta converting enzyme (ice) with a peptide based inhibitor, (3s )-n-methanesulfonyl-3-({1-[n-(2-naphtoyl)-l-valyl]-l-prolyl }amino)-4-oxobutanamide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (INTERLEUKIN-1 BETA CONVERTASE)
publication title Peptide based interleukin-1 beta converting enzyme (ICE) inhibitors: synthesis, structure activity relationships and crystallographic study of the ICE-inhibitor complex.
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 1998-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1bmqB00
2H5IB 2CNLB 3GJQB 4ZVSB 3R6GB 2H65B 2XYGB 1F9EB 4ZVPB 2H48B 1I51B 2HBYB 2CNOB 3P45B 2FQQB 1RHMB 2H4WB 1RWKB 5IC4B 1NMEB 3QNWB 1RWMB 2H4YB 2XZDB 4DCOB 3D6MB 3GJTB 3SIPB 4JB8B 2C2ZB 3R7SB 1RHQB 3RJMB 4DCPB 2CJXB 3EDRB 1SC4B 3IBCB 2HBZB 2CDRB 1BMQB 2HBQB 2XZTB 1RHUB 4ZVQB 1ICEB 1SC1B 2XYPB 2QLFB 1RWOB 3R5JB 1QTNB 3EDQB 5K20B 3GJSB 1RWVB 3NS7B 1RHJB 1GFWB 3R7NB 2DKOB 2CNKB 3IBFB 1RWXB 3KJNB 4LSZB 2QL5B 2QLBB 1RWNB 2H51B 4ZVOB 3GJRB 1RHKB 1SC3B 3KJQB 4DCJB 2C2MB 2H54B 4ZVTB 2C2KB 1PYOB 2QL7B 1RWWB 2C2OB 2QLJB 3P4UB 1I3OB 3D6FB 2C1EB 1IBCB 1PAUB 2P2CB 1RWPB 2H5JB 1RE1B 5IC6B 3D6HB 3R6LB 4ZVUB 2CNNB 2Y0BB 3KJFB 4ZVRB 1RHRB 3R7BB 2XYHB 2HBRB 1QDUB 2QL9B 2CJYB 2Y1LB
chains in the Genus database with same CATH superfamily
1DTTA 1A6LA 3MM5A 2J6SA 3QBCA 3UVJA 3DRPB 5G4DA 4CM2A 5IT0A 3MM8A 3UDEA 3LPYA 2RKIA 5EN1A 4O44B 2V9WA 5KG3A 3G6XA 3AQPA 4ZPTR 5ETVA 4C9DA 1RHQB 1NRKA 4B3RF 4FBTA 4MK8A 2IJNA 2RIJA 2XGQA 4F4XA 3LO3A 2LQJA 4B3TF 3AODA 1XMOF 4ZDNA 2JEGA 4X66F 3HI9A 1RJJA 4CLPA 2HQFA 2A6MA 5AE3A 3JSMB 2NSCA 5B0BA 4I68A 4URSA 3I31A 1IQTA 2V2QA 1I5OB 2BE9B 4N56A 2VDHA 5E7OB 2VV5A 1HR0J 5H9EJ 5D8HB 4RO0A 2ZWOA 4F04B 4I64A 3WX4A 4HKQA 5KFXA 4LR7A 5HMWA 3BH6B 4IRKA 4IG0A 4BC7A 1P9YA 2ROEA 2MQLA 4QIWD 4A8XA 3GMGA 4GKKF 2JFKA 1I94F 2BUNA 4ZP9A 1F9EB 2VBWA 4HHUA 3A13A 3FSXA 1RHMB 3DGVA 1RLCL 1NO8A 2H4YB 3W5ZA 4OI3A 3D6MB 2HRUA 3MPUB 4RPFA 2CQ1A 3CIZA 1FVSA 3EVMA 4M95A 4LSLA 3M7VA 1BMQB 3HVWA 3K17A 3I6PA 4PXEA 3SDEB 4WU3A 3GONA 1TFWA 4DR6J 4Q5VA 3JS9A 3PW0A 3RUBL 4J9PA 2ZBPA 5HQLA 4UQTA 3Q83A 2DD8S 4X62F 1YBTA 2XMJA 1NH8A 1VBXA 2W4DA 3KK3A 4AXJA 1ZA2B 1HNZJ 5LMNF 1FI4A 1U1KA 3N6MA 4DV7F 3OT9A 5KFMA 1FNOA 2AZ3A 4IUFA 1RT3B 4LREA 1DLOB 2AMCB 1N88A 1YJRA 2M5YA 4K4UA 2E7XA 3U1LA 3A8JA 2KJWA 5DG8A 2JEIA 1U2FA 4C6AA 5HROB 2HIYA 5CZXA 1YZ6A 3FVYA 4I2PA 3BYRA 5IXUA 2ZE2B 4CIOA 1JLFB 3BF4A 3GV5B 4WYWA 3OL6A 5FDLB 2VPYB 3C8YA 5K14A 1X4HA 3WIUA 1HHSA 1C1BA 2XG8A 3MCMA 4RUBA 3CVKA 1RTZA 4UOFA 2I5JB 4ZPDA 2XCAA 2LDIA 3ENVA 1SC1B 1SV5A 2UVWA 1T0TV 2I1RA 2WW4A 3ENQA 2VKZG 3R3TA 3CNQP 4DMZA 4X4TA 3T6JA 2M0GB 3HVTB 2XY5A 2MKKA 3OTCA 1HW8A 2D3O1 4P74A 2ZBQA 1JJCB 4C98A 1RTDB 2DBBA 2RU3A 2R7WA 1S6PB 1RP5A 4NPOA 2UXDF 4C8ZA 4K4TA 3K89A 3PHTA 1DZ5A 2ZNZA 3ELHA 2WAQD 2CJYB 4YQWA 2HSEB 1O8BA 3UDCA 2X1FA 3O8WA 4ZKAA 2CZ4A 5E41A 4UTGA 4IFVB 3MI7X 2Z0GA 3UE2A 2DNMA 3L7OA 4PPZA 4WE1A 3V6JA 1UVJA 1NMEB 1B64A 2J0XA 4KPYA 4AQYJ 3R1HA 2CQPA 2Z8QA 4KO0B 3NNHA 4PCQA 3IGNA 3FBBA 3TRGA 3W61A 1ICEB 5DO2A 1DQ9A 1ZETA 1MW7A 5A8KA 5E3RA 3VZHA 3EGZA 2J7KA 4N8NA 1YTYA 3MEEB 4M5KA 1CULA 1KOOA 3KJVA 3I0SB 1ROFA 4FYWB 4KV8B 1OYEA 3GILA 5HO4A 5L1JA 1O6XA 1A0OB 1CJUB 1S79A 3D54A 2WB4A 3EUNA 2FJAB 3VZIA 2AKWB 1FEEA 1N34F 1DTQA 4J9RA 5IC6B 5A0YA 1S6QB 2CZ9A 2Z2MA 2CG4A 2JEJA 1OY8A 3CCUS 1MU2B 5B7WA 5DQIA 3EPGA 1VQNS 1NH7A 2JC1A 5E0OA 2VFRA 4R0EA 2O3DA 3T1YJ 2OTLS 2A18A 1JJ4A 3R7SB 3T5JA 4DV1J 1N6QB 2QGFB 5DZ6A 4KH1B 3W63A 1SC4B 2OPSA 4NLVA 2W7OA 3ZZPA 3BGFA 5EX0A 1SL1A 4C3LA 4PG4A 4UY8T 2Z57B 1FTRA 3FZ2A 2LCWA 2FZGB 3F73A 2ADCA 3RBXA 3M05A 4LMZA 5FD1A 3GFYA 2FJXA 1UP1A 1YI2S 4DL2A 1VBKA 3DNCA 2MHEA 4M5GA 2LKZA 3W5XA 2HIQA 5B0AA 3MAHA 2AGOA 3VGSA 2Q6CA 5KFDA 2HYIB 5F8MA 4ES2A 1NB7A 4URGA 2HFZA 3CIMA 1U1OA 2HFSA 4TKTA 3CE8A 5KG6A 5KT3A 2JNJA 1SH3A 1XTZA 5CZVA 3OR2A 1ZM4A 4U8VA 3ZZRA 1NK4A 5BXIA 1UZHA 4RW4A 3M8RA 2X51A 2YNIB 1RTIA 2RQKA 3K5LA 2FJEB 4OI1A 2OH2A 2HS3A 2DXFA 2GVZB 4G1QB 3DRYA 2QLFB 4QPXA 2YH1A 4PYDA 4R25A 3DOMB 5F0UA 1H72C 4RNFA 1F9FA 1HKAA 4U7UK 1REVA 2GQ2A 1NU4A 1VRQC 1CJVB 1SKRA 4KKOA 2DGTA 4C3KA 4DN0A 3PV8A 4LF6F 4DQIA 1FVQA 5J1NA 3DU6A 2NYHA 1VQLS 3M6UA 3PCOB 2C2KB 1PILA 5DGBA 2OTJS 2VICA 2BR0A 1L3KA 1PAUB 4B9LA 2F4VF 2V9KA 2G13A 9ATCB 5E5NA 4CDIA 1Y3KA 4QWEA 4LBHA 2B5JB 1PGZA 1UFKA 4JI7F 2IMWP 4OYIA 4I7FB 4NLPA 2FQQB 1XNRF 3W3SA 2YKMA 2IDEA 5F8NA 1VISA 3CB4A 4NCGB 3QNWB 5HBMB 4DSEA 1VQ5S 3V4IA 3QFHA 2B8PA 1Q16B 2FYXA 4ICLB 1YVFA 2BJDA 5A2QY 3WDOA 5I4MA 1ZAWA 1LWCA 2R8KA 3S6EA 4L6V3 5T41A 1ZYQA 3MM7B 1HBNB 4A8SA 1RWVB 2JRSA 2RF2B 1WSVA 3TAQA 4RW6B 2ZM6J 1N8RT 2XLJA 1KLMA 2OI2A 4O4GA 2JOQA 2AYGA 4DDFA 3CD5A 1UFWA 3B78A 1HIYA 4N8OA 1BQNB 4G6VB 5LXYA 2F4FA 4QR0A 4CLFA 4YUDA 2XS7A 3R27A 4OLPA 5HJYA 1OYDA 2DYAA 4A8KA 5E3AA 3T6BA 1QSYA 2HVEA 4HT7A 1E6VB 2W2QP 2MMYA 2YVSA 1LK7A 1UA0A 2FZKB 1Y4ZB 1WDTA 1UW9A 4PQUA 2WTFA 3MR2A 3WC0A 1AFJA 3KLVA 5CD4A 5DM7Q 1ZAXA 4CTAB 4PWDB 2NXNA 3JQMA 8AT1B 4PUOA 4K0KJ 1FRHA 2DNGA 2DY1A 4KHPJ 1FRIA 4TU7A 2OJ3A 2DHSA 1ZZNA 3GLJA 1TU0B 1U1QA 3PJWA 1HNWJ 1IR0A 3AQOA 2UUCJ 2YWWA 1PCAA 2HFVA 2XS2A 2P6TA 2OEJA 4BWMA 5IZHA 3CJ0A 1L3UA 4B3MJ 3W8PA 1RAHB 2XNQA 4ZJQA 4N76A 5KG1A 3HMJG 2GW8A 2AW0A 1MN9A 4ZLPA 2DK2A 3U7JA 5A8RB 3I56S 4KHMA 4TN2A 4CLWA 1C0TB 4L74A 4ED1A 3DKDA 2HZAA 4LF2A 1NJYA 4DUTA 3HK2A 1HFEL 1F5AA 4RL1A 2Z2YB 2LQ8A 3D3CJ 2H1YA 1YRUA 3TEHB 4EK2A 3C6TB 4JP8A 2K06A 2G1HA 3JAMU 3DU5A 3FKBA 3Q86A 4PPDA 6AT1B 4CYUA 5KFNA 1U1PA 5KFPA 3FDSA 2LA4A 2BRLA 1FJEB 3PR4A 3MEGB 2VASA 1K44A 1D1UA 2YNHB 3D3BJ 4KIAA 1YK9A 3UCUP 4MKAA 2J9EA 4WXWA 4PEOA 2E9TA 3IRWP 4JI5F 3M8SA 3ZTOA 2IRXA 4CH1A 2M70A 1MWZA 1PJ7A 1Q8KA 1PIEA 1XNQJ 1FKAF 2VQFF 2VOPA 2BBEA 4KFBA 4UUWA 2WW8A 2DR8A 4I69A 2OD4A 3PIPQ 4WZQA 1B3TA 2RT3A 2ZOMA 3MD1A 4JI3J 3MMCA 4J7CA 3JTNA 4G65A 3A8EA 2QL9B 3NAHA 3IMQJ 4DV2J 1KTQA 1FXLA 3RR8A 4ANDA 4QYZJ 2VKRA 1VQ4S 1JLGB 5JJBA 4Q0BB 2Z4PA 3N5BA 2AV5A 2LYVA 3O2IA 1LW2B 2AZ1A 3LAKA 3NBPB 3M8PA 1IM6A 3DGPB 2GAHC 2HGLA 3P6YC 2R8JA 5B08A 2XB2D 3RRGA 1T3OA 2DCUB 2CG8A 4UW2A 1H2VZ 2RU9A 2R7OA 1IKXB 1PG5B 2JWNA 2V2ZA 4QR1A 4M5DB 1HYSB 4I1TA 3VTIA 3ETOA 4M5NA 1HI8A 2FVSA 2QLBB 3AD9C 3CJ2A 1HA1A 1LEOA 4DV3F 2W9BA 3GJRB 4B9MA 3RAMA 2NUHA 5KT6A 2DY9A 4P10A 3KK1B 2MQQA 4I2QB 2QA2A 4C4WA 3RR7A 3NCPA 4H4KC 3VR1A 2I2YA 3GIRA 2ASYA 1HMVA 3JYTB 2H5JB 1HLWA 3DRRA 5A8WB 2M9KA 2BXJA 4DR4J 3PJ9A 3KLGA 3DLKA 3V4MA 1JLEA 3EZ5A 2DIVA 3K2YA 1LW0B 2C3UA 1V6HA 3K58A 5J2PB 2R7QA 4ZHRA 2OELA 3NS6A 2YTCA 5T7LA 1MWYA 2VG7B 1KHVA 3PDNA 3K5MA 2I38A 3HD2A 4JI8F 2X3GA 5EWFA 4HACB 1T8EA 2BANA 3NGRA 1TL1A 4ECZA 1KC8T 1ZZFA 2Y8YA 3OUYA 3A3OB 2N7YA 2J0SD 5BYSA 3H98A 4HDGA 2BOAA 1UL3A 3S01A 3U27A 1FJGJ 3H5XA 3NXZA 4NYZA 3PZPA 1LXNA 5T14A 1EP4B 1P9QC 3AOCA 3KG1A 4DG1B 4OJ3A 4L75A 1TQLA 1M1HA 1QJHA 4PAAA 3KMSA 5HATA 4DR7J 2LVWA 2BYCA 1JKHA 3TP2A 1RT7B 3W60A 1T11A 4DCPB 2CJXB 1OWXA 1JIHA 2DRAA 2Y1IA 2E1CA 1IUJA 1QUVA 5I42A 4N77A 3GFXA 2GIQA 1U25A 3SMZA 5CABA 1JNRB 4LFAF 4DL0C 3FEZA 1RAIB 4F0HA 1S0VA 4HTJA 3TNVA 1QAIA 4NZ7A 1Y0HA 1AB8A 1RDRA 1V3SA 5ETNA 2F40A 5IM0B 3GFHA 4B02A 3MMJA 4H4OB 2DNHA 1MLAA 1URRA 2UUWA 2EI5A 2XM3A 4WFXA 5CH7B 4BCAA 1J5EF 3D68A 3ZXWA 2DT9A 3L7PA 3AD7C 3G8TA 2ZH5A 2IFXA 3BKFA 4DF8A 4LQ3A 4OZNA 5HANA 4DFPA 3POTB 1JB0C 1FKPB 3IRXA 4DR3J 5KFFA 2BE2B 2GS8A 4KY3A 4C8OA 1F9HA 1S72S 1U2RA 1RAGB 1S1UB 3FQLA 3D0IE 1OQ3A 2ZITA 1HWKA 2UP1A 3AA8A 2QMXA 2XWXA 1LKZA 4DQRA 5DRKA 1N4LA 3CULA 2RVJA 3NAIA 3THVA 1RZMA 1FD8A 2XGPA 4JI6J 4WKYA 3BR8A 5B0GA 3PX6A 1HWLA 3DLGA 1NSQA 1UCNA 4URQU 1N32F 2KJVA 4USIA 4GVLA 5GMEA 2ASLA 2Y9HA 2HNDA 4TNOA 1HQUB 3TAMB 4NI2A 1RWUA 1UVKA 2CNNB 2NUUG 3W2WB 1IR2A 1R0AA 4IDKB 5IWAJ 4ZIWA 2XULA 1EETA 2U2FA 4ZPVR 2W2PP 1AYEA 3VV2B 2BACA 3SQGB 2PMHA 1OS5A 1VRUB 3J81Y 1QAJA 2XCPA 3DXBA 3VAHA 1XJWB 3V5RA 5HSPA 2KRRA 3RU0A 1T9TA 3FJ2A 3SIPB 2QIFA 3CJKB 5KG0A 3BS9A 4GRSA 1FFGB 3QT8A 1RBOB 5CYJA 3J7A1 3FK4A 3PM9A 1RAOA 1ZH5A 3G96A 1FDBA 4ID5B 4OX7A 5L39A 1YLXA 2G2OA 1N33F 1EKRA 3FMWA 1UA1A 4ALZA 3D28A 5C2CA 5D4OA 3BDEA 5DG7A 1FD2A 4R8UB 4K5SA 3FCWA 4LF5F 1R31A 4L76A 1SKWA 3M2UA 1S0NA 2MZ1A 3JAMY 1NKBA 4ZLLA 1YQHA 1V3RA 5KFJA 2X1BA 3LOUA 3MTKA 3WHIA 3OXFA 2YBVA 5J2QA 1IBLF 2NCKL 4C0HA 4OI6A 4HH0A 4C8LA 5I3UA 2QSFA 2O5DA 2Y0BB 2IVMA 4Y2KA 3J7YI 3A3PB 1TUWA 2Y1LB 3UDVA 3CEDA 1CLFA 4C8NA 5J2NB 3CDBA 1CPZA 3L95X 4B3RJ 1G3OA 3GZ7A 2BJ7A 5H9EK 3PX4A 2HMIB 1YIJS 3VCDA 4B3TJ 3GJTB 2JX2A 1XMOJ 4X4PA 2V69A 4AE5A 3HM9A 4KTQA 4YEAA 4X66J 1WWHA 3TOQA 3RTVA 3MMBB 3LWMA 2DNKA 4DEZA 4MK9A 1F5CA 5IOLA 2FVRA 4I6AA 1QM9A 4DN9A 4LQ9A 1R8CA 3DLJA 4ERDA 1NK6A 4B9UA 1U6BA 1X4AA 1JLCB 3R7NB 3QSYB 3M8ZA 3LTOA 4Y34A 3BO4A 5L1KA 3CCQS 2HAFA 2BW7A 3LAMA 4GKKJ 4MIWA 1I94J 4YS2A 2P2CB 5HP1B 2MB0B 1VIXA 2PEHA 1A7GE 4A46A 2GHPA 4RR5A 2ZBRA 3FEYB 3VWSA 4YY3F 2YWGA 3H90A 2B7BB 3IAS9 3K57A 4NLQA 3L9ZA 2HHTA 4CO3A 4FVMA 3DRSA 1RAEB 2D1CA 2MEWA 4ILMA 2AF6A 5HVFA 2RQCA 1QTMA 1Y3JA 3Q8RB 3KK2A 2HNYB 3K5OA 3MAQA 2ALZA 5HAOA 3TWZA 2UUBF 4NEYA 3LP0A 4AXIA 3OR1B 1UVNA 1D9FA 1Q7LB 1SUQB 1D09B 1QAYA 3PX0A 3GYXB 4G1IA 1QLNA 3EDQB 2HVHA 2UVRA 4X62J 2AYMA 4K2XA 2LXFA 1TL7B 2DKOB 2NREA 3QYYA 2LLZA 5LMNJ 4MYUA 3AJ2A 2ZOGA 4DV7J 3KG0A 4X4UA 3OFFA 4J9LA 4J9QA 5F8LA 1FHTA 3GCXP 3M1VB 2Z2ZA 5IV3A 5F8GA 4P9SA 4UZCA 3R2DJ 4G3IA 2CQDA 4DJBA 3JB9k 2ZH1A 3UO0A 1H0HB 2DGSA 3W5YA 1R27B 2PDAA 4N47A 2ATCB 1QY7A 5FLXU 4KH0B 4RZRA 2HKEA 1D8YA 1JK9B 1WC1A 1P1LA 4FP9A 2H4WB 1J5OB 4ED8A 4JI2F 2GO9A 2PT0A 4LRAA 4NASA 5AT1B 4NLXA 2RUGA 1REGX 4QZVB 4WZMA 4QPTA 3KHHA 4HI1A 1TKZA 2YX4A 2WHOA 1GK8A 3TX8A 1T03A 2D41A 2XLIA 5JUMA 3JTOA 1LV5A 2MY7A 1GEHA 3BSCA 4OZJA 4BWJA 2ZH7A 4DUYF 4BC9A 5JVHQ 3CPWR 4XPEA 1RWNB 2UXDJ 3N0VA 3UN2A 1NHVA 5CXTA 2WVCA 1XMQF 2B0GA 4C0BA 2H54B 1LWXA 3PVXA 2KI2A 3LGNA 3OXGA 1M5OC 3LP2A 2M8HA 3BBFA 1FNXH 4WWSA 4LSNA 2AX0A 1HW9A 5IFMA 2MQMA 3NMRA 1EZZB 3CJ4A 3FFIA 3HDSA 4LF8J 2K1RA 5C7PA 1ZM2A 2N3LA 2VFTA 2IM2A 5I3PA 4HHJA 4ETZA 1NAQA 3DI6A 1C1CA 4KR0B 1NK7A 1FRKA 5G0RB 4ZIVA 1CC7A 3DOKB 1Q78A 3LH2S 1TUVA 1VS3A 2AEMA 4BBYA 4NMXA 2EK1A 2Z30B 3FGVA 1HBNA 1X4CA 5LL6d 3GJSB 3M6XA 1VI7A 3LA0A 2MZTA 1WI6A 3M8QB 3VGTA 4Y2IA 4IO9Q 3DFEA 3P8BB 3KLFB 3CDWA 1SIZA 1N34J 4J9VA 4UY85 3SEOA 2DRDA 3CD6S 3GG0A 4DWIA 3TUPA 1S57A 4ECYA 3E01A 2I6WA 3C16A 3HO1A 2OPQB 3Q0AA 1WJ9A 2Q79A 3PW4A 1K1SA 2E1PA 1JXVA 2IAJB 1V9OA 4YFUA 3MXHP 3UD3P 2QZ8A 2CIMA 1R8HA 3RZAA 5M2RA 2B51A 1U1MA 4K59A 1OPZA 2KXNB 1VYAA 2VFSA 2LDYA 2HEKA 2HGNA 3PJXA 2Z56B 2VA2A 3VAKA 7FDRA 1N5YA 3HJFA 3AOAA 2N7CA 5GAHU 2HFUA 4DQSA 4KSEB 2NXJA 1KRPA 1NPPA 3C19A 3EE3A 3ISND 3CCVS 2KH9A 4Z7YA 1HBOA 3PYGA 5L8RC 2CWXA 4OHVA 4O0IA 1O5JA 1SC6A 1Q7YT 2IM3A 2OMOA 4M5JA 2AGQA 1T05A 3H7HB 3V6DA 3THPA 1TKXA 2D7SA 3E8OA 1N5QA 1RT4A 2EEYA 5D0GA 5HJXA 3IP0A 3BV8A 3OTEA 2QEXS 4ZVEA 1TV6A 1HQEA 2OPRB 3RB6A 2CQ4A 1X0PA 1WD6A 2HBRB 2P9EA 3M8YA 4EYIB 3D4JA 3SCJE 2VFVA 1T9YA 2FHOB 2W25A 3KUGA 3M9MB 4ZVPB 2NXEA 3OBIA 5E3CA 1B4SA 4H4MA 1FTCA 1FEHA 3HKWA 4LFCF 1PO6A 2ILYA 4HI2A 1RWMB 1WHXA 5CCLA 2LEPA 2LU2A 5DLGA 2XSJA 2BX6A 3LALA 5E2QA 3KLHA 5KFUA 3MUTP 1APSA 4MKVA 1RT5B 3QAEA 2OUGA 4WJBA 2FVPA 4OL8A 2GJIA 4HVZA 2UU9F 3VQTA 4LUBA 4LF6J 2Q1LA 4NL5A 3UR0A 2CPIA 2ZZMA 1BE4A 4ZPCA 5I3QA 3H5SA 2ZD1A 3NOGA 1M5SA 2HGMA 2F4VJ 5F41A 3THTA 1Q82T 2ZH3A 1H3DA 3UQSA 1RYRA 5C5JA 2CQGA 5ADZA 3KLEA 5MAOA 1VMBA 2KT5A 2MKSA 4R5PB 4USHA 4JI7J 3NWRA 4LF7F 5KG2A 3CSKA 1XNRJ 3IXQA 2PGCA 3DM2A 3AXKA 1UKUA 2R2RA 3EXYA 2FPHX 3G87A 2XMMA 4TY8A 4DV6F 2R3VA 1H38A 2FZCB 2MKYA 1R7IA 2DEIA 3CO0P 1RQ0A 3ISNC 5LJ3Y 3GIIA 3TVYA 1S59A 4J9OA 2FJWA 2YKQA 4ZP8A 2JVOA 2RDIA 5BJRA 1TL3B 2LQ5A 1S7HA 5EWEA 3HKZD 1U1NA 2E66A 2HHHF 4M5DA 2J5AA 5KG4A 2JLGA 1GFWB 3EJMA 3M30A 4OV1A 2QO3A 1R0BG 1HNVB 5KFAA 1TMMA 3MEDA 2Q6BA 4DX5A 3BN7A 4Y2MA 4FXVA 1NJXA 1D0EA 1VHIA 4NLOA 3GR0A 3NNAA 4F50A 1U6FA 2NZCA 1RE1B 1WOPA 3KJFB 1FJCA 3CJ5A 1EIYB 2Z2LA 1M5HA 3RAQA 2AYEA 4FF1A 1S9GA 2UXCF 1DBDA 2HPUA 3S1TA 2H48B 1S1TB 1FDDA 2KT2A 4I0WA 5C24B 2BRKA 4CRJA 4XPCA 1RU1A 2YWKA 4RBVA 4OYMA 4Y28C 3MPYA 1L5UA 3ONQA 3HJVA 1NJIT 2F63A 3DCAA 4L3NA 1YHQS 2ZWPA 5KFBA 3IG1B 4USKA 1HBUA 3Q8VA 4ZLJA 1U0HA 4AL6A 2GGPA 1QD1A 4LR9A 5AJ3F 4TLRA 3VAMA 5IS2A 2V8DA 3NS7B 1XMBA 3V81B 2KFZA 4Q43A 2JVRA 4QU6A 1CG2A 3I82A 1GXLA 5FLXY 4KAIA 4OYZA 2UV8G 3QJJA 2V4JB 4C2MA 1CJKA 5CAAA 3PFOA 1FXDA 1HWUA 5HLFB 4F36A 4HL9A 4DU7A 3QGIA 3LWLA 2FHMA 3AAWB 3LGMA 1YJNS 1OMSA 4P72A 1T94A 3AHPA 4QWDA 1Z2ZA 3BR9A 1YKWA 3JXOA 3P5TL 2MGZB 3N01A 1RT2A 5KG7A 4R0JA 5SZTA 3MGJA 3AJ1A 2BM1A 2A3JA 3HHLB 3ZC4A 3CCZA 3OL9A 3TO8A 1NKCA 2EG2A 4WFBQ 1SKSA 2EFNA 5KFGA 1ZOTA 4QIVA 3ENWA 3QO9B 2D3UA 4LBPA 3AH6A 2ZHOA 3C15A 4RW9B 3C14B 1Y5LB 4IG3A 3IBCB 4JI5J 1IBMF 4NLYA 3J80U 4C7QA 2ZH9A 2KT3A 3QRRA 1Z2LA 3MOJB 2VQFJ 2RDDA 4QYZK 2CNKB 3OD2A 4A8YA 3ZZYA 2RRNA 2VPWB 4LF4F 2UVVA 3AJDA 3AY0A 1B7FA 4LRBA 4ED3A 1Q0NA 3MEKA 1LWFA 1RTHA 5ETPA 5L46A 2W01A 1NK5A 4DZ6A 4RW8A 3CD7A 2MLXA 1M1GA 3QZ8A 1YBUA 2VA3A 4MKBA 4OYPA 1GQEA 1HWIA 3J7ZT 2LECA 1R3NA 4FYYB 2DGXA 3QPIA 2DITA 1SXLA 4A48A 1QSSA 3CCRS 3G71S 1OJ4A 5LOQA 2P5VA 3G6ES 5K8PA 1JLBA 1R0CB 2GQCA 3X1LB 4O3RA 4O0NA 4U7UD 3PG9A 2D9OA 2E1MC 2DH8A 3I5CA 3MURP 1AT1B 1YJ7A 2UUTA 2W2NP 5CYQB 4IRCA 1GXTA 4TU8A 2DNNA 4RNHA 2EK6A 1KVKA 4M63A 2J7WA 1S9EA 2DGQA 3UN3A 4NE9C 2OPPB 4YR0A 4WFNQ 4IFYA 3NRBA 4DV3J 2MKCA 4LF1A 1VR6A 1BUXA 1MROB 2FLLA 3TYTA 3CMES 2HZVA 3W2VA 4OHWA 3RB3A 1B0PA 3GG1A 2KG0A 4ECWA 1GX6A 2P8IA 2L9WA 2HHPA 1GX5A 4G1PA 5M2UA 4AT1B 1DHMA 2R7XA 4OX8A 1FXRA 3MMAB 5JMNA 4Z2XA 4CO0A 3SSQA 4Q8FA 3O44A 1JLQB 3RB4A 5DDQC 4K7QA 4QIEA 2CADA 3ZNUA 4QW8A 3WC2A 3QWUA 3UFCX 4KGXB 5IT9U 1XR6A 2YKNB 2BJ9A 3FNNA 3D5MA 3MHYA 1FRMA 2RH3A 2XY6A 4MFBB 1P1TA 1RT6A 5LT5A 1T3NA 5J2MB 2M8DB 5ETTA 2VG5B 1BWEA 1IKWB 4JI8J 1CC8A 4A47A 2VBXA 2HBQB 4F2RA 5BYQA 2DR7A 1LFPA 1QTNB 5K20B 1XR7A 1PBAA 1VLYA 2R9LA 3B8HA 2XHWA 5ETLA 3E51A 1ITPA 5HQ8A 2ADBA 2MLYA 3PYDA 2J76E 1U6ZA 5HK4A 2QYGA 3Q8QB 3KXDA 5D0RA 4QU7A 2X1GA 3MECB 1S12A 1HBMB 3OHAA 3G82B 4WFZA 2ALYB 2UUAF 5IT4A 3R9LA 3M8WA 2HNZB 3AB2B 4XK8C 2PI4A 5KT4A 4FF3A 3C6UB 2R2TA 4C0OC 4DPUA 2Y1RI 4ZITA 5KT2A 1PJ6A 3DLEA 4B3OA 1Y9OA 1UWBB 3M2RA 2HWHA 1TKTB 5FIIA 2BEFA 2ZOFA 4I6YA 1YZ7A 4ANEA 1TFYA 2YKPA 2B6AB 2OEKA 4LFAJ 3WIVA 3M6WA 2DNRA 3OL8A 2HS0A 2HQ3A 4RW7A 3CC2S 3AB4B 2XI2A 3SQOP 3TUIC 1W2BR 4UOHA 1TVRB 4PG6A 2BQRA 4DL4A 4FYDA 2IDLA 1RT1A 3ZZUA 4JI1F 2VQEF 2IM1A 2ZBCA 1NCLA 3ET6B 2W4PA 3T41A 3IAM9 5J1PA 2V50A 1J5EJ 3EGWB 3UNGC 3ZO7A 3MAAA 1RBAA 4A8OA 3M2VB 2RMLA 3PRBA 2DR6A 3KLIA 2IC3B 1NNDA 1LWEB 3TQ1A 3R2CJ 3RGIA 3TVKA 1WEZA 1CS4A 3OHBA 2B4OA 2YWHA 1FCAA 1KWMA 3GV7B 3DRXA 2WSFC 1BC6A 3C2PA 1DTTB 4JV5F 2LMIA 3MM5B 3UVJB 2LEAA 3HHEA 2VUGA 2CDRB 3MM8B 3PHEA 3OV7A 4NLSA 3W9HA 4NLGA 2W8KA 1RB0A 2ZNYA 1TMJA 4U9RA 4ZN3A 1S77D 3NL0A 2PMZD 3ZTRA 5K9FA 3MM9A 2ATLA 3EICA 4F4AA 3F41A 5ETKA 3VGVA 1N32J 5HMXA 2KHDA 4DL5A 3CC7S 2G2ZA 3GFZA 2C2NA 2CJAA 1HD1A 2IVYA 4W98A 4PXBA 4Y6IA 3EZUA 4IRDA 4EZ6A 1ACMB 4ZCMA 4ITSA 1BQXA 4K4YA 3PW5A 1FK9A 4LR8A 4YB6A 3NOCA 3HXMA 1NHKL 4DV5F 5HL7Q 1CJTA 1UEUA 1KBRA 4OMFG 2B7CB 2HHUA 1HHQA 1WDDA 4F02A 1IBKF 1SL2A 1QVFR 2XYGB 2OMLA 2FY1A 3BM7A 3C3LA 1GTEA 4IG0B 4O3SA 4HHHA 1XBWA 2K7JA 2WOMA 1QUPA 1XK8A 1K47A 1S6OA 4D3HA 1UJ5A 1WG5A 4KRWA 4LT6A 2E9RX 4DV0F 3K5NA 1LK5A 5CYMA 3MM6A 2P6SA 3O1LA 4MIAA 5A2QU 2D3ZA 5DDRC 1UMJA 1IBLJ 3W66A 2XMKA 4LSLB 2YNGA 4JI0F 2C2MB 3I5AA 4DV1F 1WTFA 4B3SF 4NRUA 3PKMA 2NPIA 2JEFA 2BV3A 3TZXA 3W8GA 5CQGA 4RBTA 2BMBA 3OVBA 2J6TA 2CJ9A 3J80Y 3UNYA 3HHKA 2RUSA 4ED5A 1RSCA 3R5GA 3KK3B 3MWBA 3U1MA 3CDUA 3KNAA 4PKDB 5K8MA 2CWKA 3I55S 1K0TA 3B4MA 2L48A 3O6QA 3JSYA 2B4UA 5ITHA 2IMOA 5C42A 4JYAF 1NJZA 4BDPA 4ETXA 4I2PB 4ENOA 4ELTA 4ILLA 4DS5A 3FSIA 1S1VA 4OQJA 1TZ0A 1P27B 4NA2A 1AZSA 3GSIA 5K14B 1QAXA 5ETOA 5GMKa 3LP1A 1C1BB 2JLFA 4DU8A 4F3OA 2M52A 2Q66A 4RU9A 3BB5A 2MZRA 3QT5A 3SV4A 1SV5B 2KVQE 4OV6A 1F3VA 2IA0A 2XWYA 2GMLA 4YY3J 2ASJA 2C1EB 3QFWA 3I0RA 4M5HA 1HD0A 1VC6A 4EWTA 5AXMA 1AUSL 1NXIA 3N28A 4KQZA 2JJ4D 4OI2A 3EZOA 4K8RA 2GMHA 2OKQA 3T9NA 3RB0A 1IQZA 4ZVFA 2FTRA 3ILOA 2F8MA 2UUBJ 1WF0A 2MJNA 3P3DA 4USMA 2IRYA 3SSSA 5EUHA 4ED7A 1RACB 3IM9A 1SQFA 1S76D 1VOMA 2RILA 4FXDA 1T9VA 2OSQA 3UD4P 2IIHA 2ZEJA 3MCSA 4WE1B 5A76A 3KDNA 2OIHA 4LBIA 3EX7B 2Q43A 4ZPAA 4N5SA 3BGLA 5IT9Y 3D2WA 5LMUF 1IWAA 4J90A 3NGTA 1FDNA 1NK0A 3MCOA 5A8KB 4F3MA 3N79A 4CH0S 1C4CA 4WK1A 3LQVA 1QE1A 4LVNP 1N36F 4DUZF 1ZA1B 3KJVB 4ED0A 3H2UB 2KHCA 4WP9A 1SIWB 4KGZB 3MR7A 5IQ6A 1R8BA 2W1BA 4JI2J 1NEEA 1Q86T 3MTJA 1AW0A 5THWA 2MKHA 2EBGA 1IXKA 1DTQB 1KOHA 3FCVA 3R97A 1T95A 1BWVA 1S1WA 3TX0A 2FGOA 1HNXF 3D9BA 2B4PA 4XAKA 2XHCA 4DUYJ 2B8QA 2V2VA 3QJPA 2W8LA 3QQCD 2UXBF 1XMQJ 2HRTA 2YNFA 3DMJA 4C11A 4F25A 4OZ3A 2OPSB 5H9FK 3VVUA 1GNKA 5AE2A 4ZVOB 2G4BA 4CLSA 5KFIA 2GIRA 1FKOA 4H54A 2QLJB 2IHR1 3VGUA 3EGNA 4RX6A 1Y11A 3VF0B 2AEJA 4F7VA 1XEZA 1NM2A 1RI7A 3NMAA 2AJ2A 3S7RA 3FBEA 5F3TA 2YY3A 4X64J 3MUMP 3W9IA 1R6VA 3HSJA 2I0XA 2Y3YA 1VQMS 2LU1A 4X4OA 4USTA 2RS2A 1TL3A 2HLUA 3W7BA 4RUAA 3OR2B 4C3MA 4IR9A 2AU0A 1RAJA 3EYZA 3HVAA 1JLAA 3T9ZA 3DLHA 4DI6A 2KRBA 2JFDA 4RW4B 5EHHA 4DX6A 1Y5IB 1I6JA 2ZJPQ 2KTQA 2DIUA 4TXSA 1UTAA 5KTQA 1RTIB 2IBKA 1XIQA 2QA1A 5F0WA 4EO8A 1XR5A 1N0VC 3IWXA 5HQMA 2CPJA 4NYOA 2DJWA 2RD5C 1VQOS 2ZVIA 4MAKA 3BGOP 1REVB 4M1KA 2CPFA 2E7VA 3MOZA 2EXUA 4CH7A 1L3TA 1TR0A 4KKOB 3BO2A 2CVEA 1YSJA 5KFCA 3A12A 3PEJA 2C3PA 1H2UX 2QX0A 2YKAA 5D3GA 2A0FB 3CMAS 2H3EB 2DCLA 2V2KA 3QLHA 1GMUA 1L3SA 2FLPA 1B70B 4QWAA 1HNIA 4FDFA 2VG6A 1ZM9A 4BHQA 3HULA 1MN7A 2KU7A 2GHVC 5F3ZA 1UVIA 3BSNA 2QT7A 2JHEA 4NXMF 3D67A 2VBZA 4KGKA 4ZCIA 1S0OA 2O66A 4X4SA 1O0PA 3PACA 2YKMB 5EWGA 3QIPB 1WOSA 5KFRA 1D9AA 1F60B 3VAIA 3V4IB 1BD6A 1U49A 2FGCA 2YKOA 1SPBP 3DYAA 3MFIA 1RA7A 3NGUA 1LWCB 3IS9A 3OTBA 3EM1A 1SJQA 2KFYA 3HPOA 2PA3A 2DPJA 2O01C 2EFPA 1X4BA 2DO0A 2WVDA 2MDAA 2XMTA 1F2HA 4F0KA 1WI8A 4YP3A 4OHXA 2A6OA 2WK4A 4O4GB 3J7YU 1U45A 4GO5X 1H7WA 2F5GA 1SJ3P 4LFCJ 3H4DA 1HPZA 5LSLA 2FUG9 1OSCA 2EFGA 3NCRA 1Q1KA 1NSKL 4GC6A 2WRMA 3P45B 3R1LA 3MR3A 1IKYA 4HYKA 4ANCA 4RWWA 1Q8LA 1S1XA 4FKYA 4CWBA 2N3OA 1BQMA 3FBCA 3FC9A 2JSXA 4GC7A 5IV4A 2LXIA 2UU9J 1RAAB 4EZ9A 4PQUB 4Y3CA 4P2FA 2CUYA 2ZC4A 4NLUA 3TZWA 3LANA 1SJFA 4PUOB 1VRTA 4FXWA 2YH0A 3HF5A 2VZ9A 4QYRA 3QT7A 4TQSA 4OJHA 1HL6A 1Q5VA 3CCSS 1U2CA 4USWA 2HHWA 3DOLA 5KFQA 2E5HA 3BYPA 3FCHA 1RTJA 4NZ0A 4A8MP 4LF7J 3X3UA 5L1IA 3OJUA 1H2TZ 1KNZA 4DV6J 2ZHAA 3G8SA 1KQSR 5LSRA 3G4SS 1WKLA 5KFEA 3CUNA 4P6QA 4YDDB 5ETQA 1PJ5A 3MR6A 4CO4A 1U8SA 2AJ4A 4CZCA 2HHHJ 1PBUA 5B0CA 3H42A 3HSZA 1KDNA 3J81U 4YR3A 2A2CA 2A2DA 2G1DA 3GIMA 4EYHB 4CYUB 3NKYA 2CYYA 4B9TA 1JNZB 4B9VA 3GWCA 2BM0A 4Q2MA 1F0XA 2H51B 1K1QA 5DQHA 2B9YA 4ZN1A 4M5IA 1PYOB 2C42A 2C2OB 2FD2A 1FRJA 3A8KA 4CCHA 3TA2A 1KSPA 5DS7A 4WXOA 2UXCJ 4ZVUB 3D0HE 2QC3A 1CQMA 3H4BA 4KHRA 3D1OA 3Q2TC 3R7BB 2MQOA 3NCQA 2XQCA 5LXRA 4KFBB 3LF0A 1JLQA 3UW1A 1X7VA 1NDKA 3QGPA 4X65F 5AXNA 1G1XA 4FF4A 1T02A 2C3OA 1U1RA 1E6YA 2R7TA 1VQKS 2HVDA 3K7RA 3MMCB 3N6LA 1JQGA 2QJ3A 4X4QA 2DHXA 1IKWA 4KT0C 1X9WA 5F8JA 4ZK7M 1YJ9S 2J6UA 1UPMB 3M8PB 1YJVA 2ERRA 4AYBD 4ECRA 4ZJLA 4NCBA 2CQIA 4UOGA 4KGMA 3OSNA 1WHVA 4ZMMA 3KJNB 2ZZTA 4QBUA 3BGUA 6FDRA 2DNZA 3BPSP 3WBZA 4ZVTB 2M2BA 5GMDA 3EMTA 1F1BB 2W9CA 2DGUA 2XMAA 3CCJS 2G0JA 1YBAA 3ITHA 4MH8A 2QLWA 3ZZOA 4DLEA 2DH9A 2W9BB 2ZH8A 4XTTA 3W65A 2R2UA 2BKOA 1S99A 3BO3A 1U7LA 2XI3A 2MSSA 1ELOA 1M1KT 4MIBA 1DRZA 1HMVB 4NOHA 4S0MA 2OGUA 1IBMJ 4L72B 4F4YA 1WG4A 2EW9A 3DDNA 4LF9F 3DRRB 3O3LA 4IH6A 4X84A 4U67Q 3V6KA 5BYRA 2QE5A 2HQIA 4NEZA 4DR2F 2E9ZA 3KLGB 2YQ1A 4GVBA 4RNMA 3DLKB 2XZTB 1MWQA 3BGRA 1JLEB 4LF4J 5D4NA 1EQMA 1RHJB 2QMUB 1C0UA 2XY7A 3QT6A 5C25A 1SQEA 3RBDA 4ZHRB 4IOAQ 2OO4A 5T7LB 3CT9A 4U95A 2AD9A 4DFMA 5J1EA 1YX2A 4OZ2A 4A8WA 1IKVA 3MPDA 3ET6A 4K4SA 3RYLA 4ZVHA 1O51A 2BANB 4QIFA 3VVTA 1TL1B 1OSDA 2QRRA 1CBKA 1UAWA 2NYIA 4OYWA 2F9JA 4J91A 3OUYB 4UF4A 1N5TA 3C46A 5A6PA 2BJEA 2E29A 2NPFA 4AFFA 4V19J 3IC1A 4DQPA 5D78A 3R5BA 1G2EA 3EXCX 3RJMB 5KFLA 4EI2A 3H5YA 4FNHA 3OSPA 2V94A 2WONA 2XMVA 3QIDA 3PW7A 2XTJP 3HT0A 2QTWA 3KDOA 2ZVSA 1JKHB 2BJ1A 2XMWA 3PYEA 3DDKA 1QVGR 4LSZB 2E44A 3MCNA 4F67A 1Q95G 2BVZA 3ZFVA 5I42B 2O1PA 2PFDA 1VFJA 3T1HF 3IBWA 4CO5A 3CJSA 3SXLA 3DRPA 1FE0A 2XO7A 4F26A 2KM8C 3VQSA 2BW2A 4O44A 4ECQA 4FYXB 2ZDOA 1U4BA 1RAFB 5B0DA 4WIQA 4W90B 1VC5A 1UEVA 3OVAA 4J9KA 1SCJB 1RWKB 1EJ7L 4CNYA 4JV0A 4NLWA 1NK9A 5KFTA 2V68A 4DCOB 3FUYA 5BR8F 5JXSA 1WEYA 4L3KA 3JSMA 3WX8A 4ZVGA 5EGYA 1CEZA 4EMDA 1DURA 2P9CA 2R2SA 2QA4G 3BSOA 3OFGA 3IRXB 4P2SA 5AXLA 1PC5A 5CA5A 2HVZA 2NR0A 3NEKA 4OYAA 4ECSA 3KJQB 4UOCA 2AT1B 5E33A 2UUAJ 1OQ6A 1PAEX 3QGGA 1YJUA 2MLZA 4Q8EA 2DHAA 4P73A 3IR5B 3DLGB 1WEXA 4JUZA 3PKYA 2G0CA 2OHDA 3R6GB 2D69A 4DR5F 2HNDB 2FLOA 2LP4A 4B9NA 1S7IA 4E8UA 1ZTWA 4NI2B 3ZNJ1 3SCIE 3UD5A 3SDEA 3HCXA 1R0AB 4EO6A 1EETB 1X0FA 2R8GA 1EHWA 2ABYA 4WPAA 3QRPA 2L9NA 2AJ1A 1RU2A 2E1AA 4ZP7A 4PWWA 4JI1J 3MPWA 2VQEJ 1NKEA 3ENAA 1PYSB 1RUSA 1RT3A 1DLOA 2F3JA 1NLKL 4LJMA 1XERA 1VQYA 1WF2A 3SFUA 3GE9A 2HQGA 1VQ7S 5GAEI 2MKJA 2EFOA 4CO2A 2X3DA 4EGLA 2FIUA 4LFBF 1SC3B 3Q8UA 1WG1A 2V34A 3A8IA 2CRLA 3W64A 5HROA 4JI4F 2V0NA 5EX3A 5L9NA 2ZE2A 2HZCA 2RRAA 1JLFA 3M2UB 4KBIA 5FDLA 1RHRB 5KFSA 3M32B 1FE4A 2AYBA 1NPRA 2B9WA 3ADAC 1X60A 2GC8A 3ICLA 5J2QB 2VDIA 2BKNA 1KS2A 4Q44A 2V6AA 2YX7A 4Y00A 2I5JA 4JV5J 2ACMA 5I3UB 2ZC3A 3GTYX 4FS2A 1S6UA 1SH2A 4O3NA 2CPEA 2GIFA 4YB5A 1OY9A 2R7VA 3HVTA 3IR6B 1U0SA 3UR3C 4F4KA 1ZBTA 1VQPS 5K5MA 5GAGI 4I4BA 1RTDA 3GYNA 3QMQA 4LF8F 2ZKUA 1S6PA 4J37A 3MR5A 2VH7A 3RRKA 3CJQA 3Q24A 2GZOA 2O67A 2J7UA 1Y7PA 1VK3A 2XNRA 4GMKA 3TEGA 2C28A 1FESA 2D9PA 1R8AA 3EVOA 2DGOA 4DFJA 1AA1B 4DV5J 1N56A 3SSRA 1C4AA 4IFVA 2XMUA 1IN0A 1R89A 3LW5C 1IBKJ 4QWBA 4ZCKA 4IOCQ 4KO0A 9RUBA 1U26A 2A1BA 2WBRA 3H20A 4U6PA 2I8EA 3E2EA 5H1SV 2FHKA 4OYOA 1AROP 2KB2A 5IC4B 4FKXA 1CQNA 3DDIA 3Q23A 4D3GA 2RHSB 4DV0J 4A8FA 4F0MA 3MEEA 4KE5A 5B09A 5GADI 3DRSB 3I0SA 5KFHA 2VPZB 4KV8A 2ZDPA 2ZH4A 3JTPA 3UDLA 3OXLA 3KK2B 1XC9A 1CJUA 3AA9A 4JI0J 4HTIA 5HN0A 2RJZA 5D6GA 3G9CA 3SCLE 2VJVA 4B3SJ 3F56A 3LP0B 2D3OR 5L9XA 3BKTA 4DPWA 2C3MA 1S6QA 2D74B 2WBMA 1HQ2A 3GPAA 2KYZA 1EB0A 1RK8A 1MU2A 1VJQA 2Y0SD 2MQNA 3KWMA 3UCZP 1X4GA 1VQ6S 3R6LB 2PE8A 2OLWA 1SJ4P 1YWXA 2KVIA 5KT7A 1WF1A 2GNKA 3CDAA 4DLGA 4K4XA 1N6QA 2M7SA 2WSEC 3QATA 3ZZTA 4JYAJ 2AHOB 4F4WA 1VGYA 2CPZA 4Y2AA 1UW4A 4FBUA 2AQ4A 1KQFB 2RQMA 2MY8A 4DR1F 1V5IB 4WIIA 3F44A 3TA1A 3BN4A 1WC5A 1M5KC 3H2VE 1X4EA 3M9OB 3CTRA 4NZ6A 4B17A 2I9SA 2CJQA 2IVFB 1ZTTA 3O5TB 1TKZB 3TW0A 4HDHA 3NS5A 2DHHA 4NA3A 1T03B 1X5TA 3HHDA 1Z4UA 2ZBIA 4A8QA 1H73A 3DLBA 3LGHA 2VODA 2VIHA 2RDJA 4ED6A 1LOUA 4NRTA 3QZ7A 1RWPB 2PIIA 5DG9A 1OO0B 3ILJA 2VU5A 3FBFA 3CO9A 3I9V9 2YNIA 3LP2B 2W2MP 3I32A 4IH7A 2GVZA 4G1QA 4LSNB 2FVCA 1H6KX 1Y00A 3DOMA 4C8MA 2RHQB 1RISA 3FFIB 2ZFHA 4JB8B 2GMJA 4MKYA 2K1RB 4TU9A 1GXUA 1CJVA 1T9UA 2DGWA 1GAOA 2GQQA 3DI6B 1C1CB 2OSRA 3QIPA 1MMDA 3B82A 5LMUJ 4ED4A 1HHTP 3DHWC 1R8PA 1RGVA 2YWEA 5E3QA 2A10A 3IWNC 4GKJF 3Q8YA 1N36J 4DUZJ 3SCKE 2B5JA 1I3OB 1B99A 2J9DE 3H0PA 4DSLA 3UI3A 4I7FA 1X31C 2MZSA 4K2JA 3D6HB 4NXNF 4NCGA 5HBMA 3UWTA 3EGVA 3CDEA 3SZ2A 1S10A 1V3ZA 4Y0FA 4ICLA 2B9XA 3E01B 4P52A 2K3IA 4X4NA 1WC4A 3C16B 2PEBA 2KG1A 1U02A 1HNXJ 4ECVA 3FMBA 4E2FB 3MM7A 5C2GA 2FLNA 3G2XA 4AL7A 2E5GA 2ZUAA 1Q79A 4AL5A 2RF2A 4RW6A 1KKHA 3GR1A 1FA0A 2UXBJ 1WOOA 5E3PA 4Z7CA 2E5LF 4DSFA 4J9UE 2V8PA 1BQNA 1FWKA 4FN5A 3Q2SC 5KT5A 3CGIA 4I6WA 1VQSA 4CM0A 2HFOA 1N5YB 1SVDA 5U47A 1SQGA 2YXLA 1VBYA 1E6VA 3OFEA 1HWJA 2SXLA 2WVEA 1V5VA 4GO7X 1HBOB 1L3VA 2IJFA 5D77A 4CTAA 4PWDA 4Q45A 2ZH6A 4M5LA 5DGAA 2KZMA 2HHQA 2ROPA 1T05B 2GVDB 3V6DB 1TKXB 2YWFA 1RT4B 4O3OA 4ILRA 1I51B 1TV6B 3ZZ0A 2CQCA 4DF4A 1HQEB 4H4KA 1YRTA 2CDQA 4B9SA 1U48A 4QWCA 4WBFA 3BJYA 3PXGa 2JC0A 2CPHA 1VLOA 3AOBA 4H4MB 1SB6A 5SUHA 1X9MA 4OHYA 1BHNA 2FY8A 1N5VA 3AXMA 1VQ8S 1JMTA 4ELVA 1LQ9A 2XSJB 3MPVA 1BY9A 5A8RA 3KLHB 1VDHA 1C0TA 2F9DA 2J8AA 2W7PA 2V8HA 3UCGA 2GO8A 2XBPA 4RWXA 3CCTA 3MFHA 1TK8A 5D15A 2IY5B 2MQ8A 8ATCB 3IO1A 1X4FA 5AE1A 4YHHF 4DV4F 2OEMA 1VC0A 1UVLA 3C6TA 1D3WA 1KLNA 2F7VA 1P8GA 1JJHA 3U02A 2ZD1B 4C48A 3BZQA 2CNLB 1M0SA 4WFAQ 3HSGA 3MEGA 3GIKA 1TTHB 3KLEB 2BZ2A 3JSBA 2YNHA 3CXCR 4OX9F 2DPIA 3RBEA 1M5VC 4O4RA 1RKIA 4NXMJ 2HK2A 3OTOF 5DLFA 4YMEA 3DM2B 1JX4A 3BSAA 2RS8A 1KFSA 1BXNA 3RG6A 3TUJC 4UUXA 3IR7B 2YQ0A 3MD3A 4TY8B 3ILIA 5HVHA 4ECTA 1RWOB 3R5JB 4RBUA 3RW6A 2FDNA 2H9ZA 3PO4A 3P49B 4DX8H 2FJBB 4PYAA 1X9SA 1FWLA 4LIWA 2WVBA 1TK0A 1SKUB 4NLDA 3W9JA 2VJUA 2F1FA 3BREA 5HMZA 1YDLA 1JLGA 3M30B 4Q0BA 3CW2C 2FVQA 1LW2A 3NBPA 1BGXT 3DGPA 2IRUA 4DL7A 2MQPA 3MEDB 1OPIA 1QDUB 1MG7A 3TJ8A 2DNYA 2H5IB 3TANA 2N4DA 1F2GA 1NJWA 5ETRA 3RW7A 1RA6A 2CPXA 4DBQA 4QJVA 2BKPA 2VF3A 1IKXA 1RBLA 3HVRA 4O3PA 4DPYA 4UT4A 3EPIA 3T5KA 3HFVA 1HYSA 4PXDA 4I67A 2U1AA 5K8NA 3K0JA 2C2ZB 1S9GB 1WNEA 3MF5A 2AEFA 1J27A 2KXFA 2HBZB 7AT1B 3KK1A 1OY6A 3B6BA 3R5CA 2AIRB 4I2QA 4DPTA 3BPDA 4DOZA 1WC6A 2CJKA 4LRDA 3JYTA 3RAXA 1GT8A 1HBUB 3N9UC 2R42A 4CP5A 1U0HB 2PC6A 2GGPB 1GTHA 3P5BP 4DL6A 4U7CA 5A8WA 1IM4A 3MDFA 5DDOC 1B0VA 1K8AT 4K4WA 1EKSA 3TA0A 1URNA 5ETMA 3N4WA 2CQ0A 3LUYA 4KB7A 4V1Ak 3NNCA 4O3QA 3PO5A 2JDJA 2NQPA 2DRBA 4ZOSA 2F65A 2AX1A 1CJKB 1NBEB 1U09A 1NPKA 2EPIA 4LIRA 1LW0A 1VK8A 3D0GE 5J2PA 3AT1B 5D4LA 2VG7A 1CVJA 1RT2B 3N6NA 3QAUA 1UWAA 5KFZA 2CXEA 2HHVA 2XZDB 3KHGA 2BQUA 4HACA 1N5SA 8RUCA 2CQ2A 3G6VA 3OLBA 3BDPA 4Q2LA 3FQKA 2KFNA 4ZPWR 3KUEA 1SJRA 2CAJA 2UZAA 4K4VA 3HZGA 4CLKA 2JZ5A 2GCFA 2IJRA 1WELA 4CLYA 3C15B 2J0QD 4IG3B 3GB0A 4DSIA 1EP4A 2RSQA 2ZH2A 3CF5Q 2GJFA 4DQQA 4DG1A 3R8YA 3DC2A 3A3NB 4OZ1A 1RKJA 4X65J 2MKIA 1I1GA 2BOPA 3OFHA 3T3FA 2J8SA 1RT7A 4ID8A 1B0TA 1EX8A 1LWFB 1RTHB 2EG1A 1HI1A 2HVIA 1IVZA 1TUGB 4RW8B 1FX2A 1S9FA 5D4PA 4KYZA 2IM0A 4ED2A 3H8YA 1NZAA 4EFAC 3DXSX 3EVWA 3ZTQA 1ZS6A 3KFWX 1Z1ZA 1R43A 3I87A 2AGPA 2GX8A 3TAPA 4W4MA 1JLBB 5LJ5Y 1AXQA 1YJTA 1Q81T 4DHVA 1Y10A 5IM0A 2XLKA 1TAUA 2KKHA 3RRHA 1ZM3A 4H4OA 3B54A 5DQGA 1S9EB 1IR1A 3QJLA 4DCJB 3U1NA 1PYTA 4PABA 4IFYB 3SV3A 1U24A 1UPPA 2PSZA 2CJBA 2NS1B 3W2VB 5KFYA 4KJIA 3M9NB 3POTA 1KONA 1VQ9S 1FKPA 2VHGA 1VHFA 3QRQA 2BE2A 2EC2A 1U8WA 2MTLA 1S1UA 4LF9J 4M94A 1WHYA 2Y1JA 2MYFA 5B0FA 1T9XA 1DFDA 3ZTSA 5HMYA 4OI4A 4DR2J 3TQEA 4YB7A 2QYCA 5DDPC 4IR1A 4XIUA 4PG7A 2WZ1A 4I56A 2NXUA 2R8HA 4QOTA 3TZZA 2VONA 1RT6B 4F4ZA 4K5RA 1G7CB 3K59A 1HQUA 3PR5B 3TAMA 2EKYA 1N52B 2OFHX 3W2WA 1YRXA 4IDKA 3M4XA 1SL0A 2F8EX 3QSIA 3HT3A 3NY0A 3MZIA 3VAFA 1AFIA 2K8GA 4CLLA 3SQGA 2EFQA 2K3KA 4M8LA 2LQBA 3DN9A 1VRUA 1HR0F 1FRXA 2LA6A 1NSPA 3CWJA 4ZP6A 3M32A 4RKUC 3HHNB 2E5IA 2JLEA 3CJKA 2CZVC 4ZPBA 3WQPA 1HARA 3H59A 1W26A 3JSRA 2KDOA 4DXLA 1RLDA 4UZBA 2R8IA 2C2DA 2XS5A 4ID5A 3I4HX 4OYBA 1S49A 2PMWA 3H2LA 5K8OA 1KN6A 3OVSA 4R8UA 4WP3A 3TJ9A 4PG5A 4F8RA 3PIOQ 2K2PA 2W2OP 3P96A 3KUHA 1S48A 3DLEB 4B3OB 3D1HA 4RUCA 4OLOA 3M2RB 3T1HJ 4YOEA 3CCES 1H98A 2N4CA 3IWLA 3D7SB 3LPEA 4DR6F 3BBBA 4IOBA 4ES1A 4P2MA 4RW7B 1X5OA 2KL8A 5J2NA 4CLZA 2BDPA 1UJ6A 5LM7E 4OZ5A 4KGVB 4J9MA 4FZVA 2HMIA 1RT1B 1HNZF 2B3TB 5IQQA 3FRZA 5EDWA 3MMBA 4FVCA 5BR8J 2VB6A 1TAQA 4Y2CA 3CCWA 3JQKA 3MAAB 3FEXB 4X4VA 2EBEA 5DM6Q 2GFFA 1NK8A 1LXJA 4ATNA 1JLCA 3KLIB 3TZYA 2HWIA 3L09A 1ZPVA 1CS4B 2LFVA 2BJ8A 4CLUA 4USVA 2GHWA 3KHRA 2B4VA 2PN6A 4W92B 1EAYC 4PR6A 4ZLNA 3IBFB 2CKWA 2K7KA 5HP1A 3TI0A 4CNZA 3ZZZA 2QG9B 1FO1A 1PC4A 2B56A 3J81j 4WCEQ 1YGYA 2XC9A 2FB0A 1S0MA 4OYXA 3MM9B 3Q8SB 2IYGA 3D66A 4UQGA 1FT8A 2HNYA 5CCMA 2IPOB 2WSCC 4J5OA 4DR5J 4PG8A 3KYLA 2R4FA 4U8YA 2DNOA 2RQ4A 4EEYA 1F5BA 3OR1A 3SI8A 4WKRA 2C2RA 1WTBA 4C97A 1SUQA 4DSKA 1FK9B 2YPZA 2X7IA 2RKIB 5KFWA 4OX6A 1CJTB 4NYPA 1TL7A 2GA7A 4P2XA 3F0NA 2HG4A 2IA6A 2QN6B 5L38A 2ILZA 2ROGA 5B0EA 2ASDA 2HQCA 2ZUGA 3CD0A 4AQYF 4X2BA 3L4BC 1XWLA 4OJGA 2CPDA 4ZCLA 3M1VA 5KFOA 3CC4S 4LFBJ 2WOMB 2CVIA 2NSBA 4JI4J 3SBMA 1WHWA 2FJDB 3G6YA 5CYMB 3K8WA 3MM6B 2DVIA 4JV1A 2GV1A 2MZJA 2P9GA 2EC0A 4FS1A 3K5PA 5DZ7A 3AD8C 1TL4A 1J5OA 2V63A 2CFXA 3B4DA 2YNGB 1IJFB 3M6VA 4E98A 4FPRA 4ZS6A 2W9AA 3GP9A 2G2YA 2AJFE 4ZVSB 1FDAA 4FNIA 2RNEA 3ETMA 3V2UC 1N33J 3D6TB 2MSTA 2OFGX 4P7TA 3T19A 4LRCA 4LF5J 2KO1A 5KOXA 1UZDA 2QSWA 4NWBA 1FFSB 1XN9A 4RNOA 2YQ3A 1HI0P 2HWTA 3SYZA 3T1YF 4MMOA 5H9FJ 2DB1A 2HHXA 4IKAA 2DISA 2FJVA 4QQBA 1K9MT 3Q89A 4WTYA 4IQXA 4X64F 5C42B 5JVGQ 3PEHA 5D0HA 3IM8A 1TKDA 4QR2A 3I9ZA 2PO4A 2RE1A 5CD4H 1S1VB 1D9DA 1AZSB 5AXKA 3NG8A 1Q53A 2EWHA 3MUVP 1IBCB 3H5UA 1NZ8A 3LP1B 1SH0A 3PFEA 3JQJA 1YG0A 5GVQA 2F8HA 4ES3A 1G4CA 2VC1A 4V19X 2DXDA 3VALA 4PXCA 4RLEA 1KP6A 5G0RA 2AWZA 1D8ZA 4DFKA 4EBDA 3DOKA 4AUKA 2H65B 4NA1A 1GMWA 3I0RB 4Y65A 1M5PC 1WKJA 1GMWD 4IH5A 1WACA 1ZAVA 3HLUA 4AD6A 1EQ0A 1DJ0A 3J7AN 3M8QA 3NGKA 4ER8A 1KTVA 4L73A 3KLFA 1RHUB 4NLTA 1TL5A 4MTPA 1WUUA 3HD1A 4ELUA 2C22A 1NUEA 3PRVA 1DAXA 2L3MA 4IYQA 2OPQA 2HHSA 4QW9A 2IBOA 2VBYA 1GH8A 2ZHBA 1IWGA 4OJ1A 2IAJA 2Z58B 1RHKB 5F9LA 3CMQA 4N7TA 4CO1A 4MT1A 1A9NB 3CJ3A 2GVDA 3PTWA 2B43A 2DR5A 3RBZA 4P7VA 4PRFA 1QE1B 2RAQA 4DR1J 4ECXA 5KFKA 4DS4A 1KEKA 4BLGA 2HK3A 4P75A 3L3CA 3TJAA 1KQGB 4OZ0A 3Q22A 1KD1T 1DARA 2ZZNA 1Y5NB 2QLXA 2HFNA 3ZTPA 3HFKA 3E3XA 2R7SA 3KOAA 1MNEA 1S1WB 4ECUA 1FFWB 1IJEB 1EARA 2NZ4A 1PKUA 2YX1A 1CULB 2HQDA 3NP5A 1LFWA 4EBEA 2EFVA 4JOUA 3GCWP 2OPRA 4WU2A 1C2PA 2HW3A 2ZM6F 1RWWB 2AP6A 1NB2A 2R7RA 2V4QA 2YNFB 1UVMA 3DMJB 2LXUA 3IGVA 2M3DA 4C11B 1WORA 4KPCA 2COLA 4HH1A 3W1YC 5A0YB 2DR9A 3KNGA 2MJUA 4ZJOA 1FKOB 3KTQA 1VJWA 4WK3A 1RT5A 2KN4A 1FNMA 2HBYB 3SFGA 4BS2A 2CNOB 4DPXA 2PA8D 3BQ2A 4HLBA 1FX4A 1KVIA 2QFIA 3CJ8A 4CI0B 4TVAB 2KXHA 2XZWA 3ILLA 3TR5A 4MK7A 1WC0A 2M88A 2W4CA 2EVZA 4K0KF 4YB1P 5F9NA 1N0UA 3OPKA 1BLUA 4KHPF 4PQAA 1SBRA 3BEGB 1M90T 3BKUA 4GKJJ 1Q8IA 1T9WA 3G8QA 4EUVA 4OI0A 4K50A 4R5PA 2CQHA 1TELA 4XO0A 1GMVA 4TY9A 2QL5B 1HNWF 2G9OA 2NLWA 1MSWD 1U1LA 5CHCB 2UUCF 3CJTA 3OLAA 1JLAB 4NXNJ 2M4MA 4MJKA 3OTDA 4B3MF 5KFVA 1NSAA 2QA4S 2AJQA 2CA9A 4ZVRB 2VFUA 3TUZC 1S97A 3D1QA 4TLQA 4WYLA 3FRYA 5L1LA 3HFZB 3TARA 3QGHA 4DL3A 1RXOB 2CPYA 1J2VA 2E5LJ 2VD3A 4A4JA 2DO4A 5LSOA 2GJ2A 3OJSA 3KG4A 3HX9A 1WKKA 2Q3PA 3EDRB 3GSDA 4EBCA 1HNVA 3AFGA 1OIAA 5D3GB 2J0WA 2BE7D 3QLHB 1TK5A 3HSDA 3NGDA 1CSJA 1YITS 1HNIB 1AUDA 2VG6B 5KG5A 1JXEA 1UEKA 1RWXB 4O23A 2ACYA 2CQ3A 5GAEU 2HAIA 1FF2A 2V5HG 4MYTA 1KQKA 1RCXB 3P4UB 3PW2A 1S4EA 1S1TA 1N54B 1LNQA 1XNQF 5C24A 4IO1A 4HT5A 3DYAB 3IS9B 2N82B 3GV8B 2B9EA 3GJQB 4JI3F 2DHGA 3IG1A 1U47A 1RABB 2ZJQQ 4DV2F 3FZBA 1SI9A 5RUBA 2L41A 3V81A 3VHQA 3DLLQ 2BABA 1HPZB 2DGVA 1VCTA 1P6TA 2DXEA 5A6WA 1RCOB 2JL9A 2V4JA 1KVJA 4TQRA 5HLFA 3I96A 5GAGU 3GU0A 4HR2A 2BQ3A 4U96A 3H40A 3UPFA 4J9SA 1G6BA 2XYPB 4WFYA 2FHJA 1X8DA 3IN5A 1IKYB 1S1XB 4NLRA 3IA0A 1YJWS 1BQMB 3CJRA 2FHJD 4YDXA 1FJ7A 2MGZA 3PRDA 3R5DA 1KLMB 4OZLA 3CCLS 4YHHJ 4DV4J 3CCMS 2UV8A 2PFFB 3NGSA 3HZEA 3A1YG 2JH3A 4CT8A 2LEBA 5KOWA 2J9CA 3HHLA 2QL7B 5M2PA 1VRTB 3PYFA 4JV2A 3KKFA 4USJC 4IQMA 5F8HA 3HHLD 1FRLA 2VL1A 3I5BA 1W2IA 2DEJA 5MLCV 4OX9J 3DOLB 1PSDA 2EKNA 5DJBA 2E7WA 3BBCA 1WSRA 2Y8WA 3QO9A 3K8VA 1RTJB 4RW9A 3OTOJ 4C8KA 3C14A 2H5EA 2PI5A 3GIJA 4NMLA 4TYBA 3ULHA 4NCAA 2UVUA 1F6TA 4WF9Q 1Q5YA 3KHLA 3QWPA 4DR4F 5GADU 4E0DA 2HS4A 4OIXA 1FWPA 3BQ0A 2L08A 2DNPA 3TVZA 2WB1D 1Q8BA 1W7WA 4DZDA 1NDLA 1T7PA 4FF2A 4X4RA 2CQBA 3VAGA 3Q8PB 4CLTA 2MZQA 2C2EA 3EWGA 1UETA 4RUHA 3FSYA 4Q7AA 1WC3A 3D6FB 1KHWA 3BQ1A 4XDCA 3V6HA 3OL7A 4WTOB 1KFDA 4PZVA 1NDCA 2HURA 2APOA 1Q4RA 4USUA 2E5JA 4ZA1A 1TP7A 4P71A 5FJ4A 1RYSA 1DQAA 2OP5A 3UN5A 5CYQA 1FJGF 1KR4A 2W7AA 4HEA9 1K0VA 4K4ZA 4FYVB 1X5SA 2OPPA 3GYGA 3C66A 3H25A 2V8VA 2KYXA 1MROA 5KAKA 2NXCA 2ZJRQ 2VOOA 4DR7F 4ZVQB 1E6YB 2L9DA 4LVOP 2HRYA 4CT9A 1DY3A 4OFZA 1DQ8A 2E1RA 1MMNA 1FERA 3N5FA 1VBZA 2RB7A 2QMWA 3MMAA 3T1AA 3HHLC 6FD1A 2RRBA 5HI7A 4RNNA 5F8IA 3W62A 1JWWA 4CQ1A 4J9NA 1XQIA 3VAJA 4NX9A 4FPIA 2YKNA 4PWUA 1R6YA 2XSFA 3OW2R 4MFBA 4WP8A 2X1AA 5J2MA 4YN3B 2OD6A 5AJ3J 7FD1A 2QFJA 2C3YA 2VG5A 1UJ4A 2W9CB 4QCLA 4LRFA 3T5HA 1JXLA 3S8SA 4DSJA 2KZZA 4EU0A 4C8YA 3T5LA 3ITHB 1UFLA 3WZ0A 3NLCA 2KM8B 4XDDA 1H74A 2J9DA 1ULRA 1H7XA 4QIGA 2IYIA 4OHZA 4DR3F 2DNQA 1JJ2R 3I4PA 4RU2A 2DTJA 3G86A 3MECA 1HBMA 2LQ9A 4YR2A 3G82A 3DHXA 1MMLA 2MXYA 4GVBB 1QSLA 4F2SA 3BGRB 1S4FA 5DETA 2HNZA 2W24A 4DPOA 2PD1A 3C6UA 1C0UB 5C25B 4JI6F 5HVGA 3J7Z5 3BH7B 3PY8A 3GQCA 1ZPWX 1UWBA 5J1EB 1IKVB 4JBCA 1TKTA 2V67A 3PNIA 1SJ1A 4B08A 2B6AA 2VPXB 5IWAF 1W25A 4RJVA 2WCXA 2WVFA 3L7UA 4DX7A 3US5A 4Z37A 2OAUA 4M5MA 3OQ2A 2XO6A 1F3FA 3ISZA 1TVRA 2AJ0A 4KC5A 3R5AA 2ZKTA 5GAHI 2YPYA 1S5ZA 1NHUA 3A4TA 2BJ3A 2DNLA 2POKA 1N48A 4TYAA 2BA9A 2MHNA 3HP6A 4N41A 1RADB 3M2VA 2HLTA 2WONB 3NWGA 1B7YB 2FC8A 2GAGC 2VC0A 2XEXA 2IC3A 4F3QA 1LWEA 2FC9A 3IFEA 1K73T 1X5PA 5ETSA 2QV6A 2V4RA 2MPUA 1VIOA 2V8GA 3KMQA 2G0IA 1X4DA 5D0EA 2XYHB 1NDPA 2R7UA 2DH7A
chains in the Genus database with same CATH topology
2H5IB 2CNLB 3GJQB 4ZVSB 3R6GB 2H65B 2XYGB 1F9EB 4ZVPB 2H48B 1I51B 2HBYB 2CNOB 3P45B 2FQQB 1RHMB 2H4WB 1RWKB 5IC4B 1NMEB 3QNWB 1RWMB 2H4YB 2XZDB 4DCOB 3D6MB 3GJTB 3SIPB 4JB8B 2C2ZB 3R7SB 1RHQB 3RJMB 4DCPB 2CJXB 3EDRB 1SC4B 3IBCB 2HBZB 2CDRB 1BMQB 2HBQB 2XZTB 1RHUB 4ZVQB 1ICEB 1SC1B 2XYPB 2QLFB 1RWOB 3R5JB 1QTNB 3EDQB 5K20B 3GJSB 1RWVB 3NS7B 1RHJB 1GFWB 3R7NB 2DKOB 2CNKB 3IBFB 1RWXB 3KJNB 4LSZB 2QL5B 2QLBB 1RWNB 2H51B 4ZVOB 3GJRB 1RHKB 1SC3B 3KJQB 4DCJB 2C2MB 2H54B 4ZVTB 2C2KB 1PYOB 2QL7B 1RWWB 2C2OB 2QLJB 3P4UB 1I3OB 3D6FB 2C1EB 1IBCB 1PAUB 2P2CB 1RWPB 2H5JB 1RE1B 5IC6B 3D6HB 3R6LB 4ZVUB 2CNNB 2Y0BB 3KJFB 4ZVRB 1RHRB 3R7BB 2XYHB 2HBRB 1QDUB 2QL9B 2CJYB 2Y1LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H5I B;  2CNL B;  3GJQ B;  4ZVS B;  3R6G B;  2H65 B;  2XYG B;  1F9E B;  4ZVP B;  2H48 B;  1I51 B;  2HBY B;  2CNO B;  3P45 B;  2FQQ B;  1RHM B;  2H4W B;  1RWK B;  5IC4 B;  1NME B;  3QNW B;  1RWM B;  2H4Y B;  2XZD B;  4DCO B;  3D6M B;  3GJT B;  3SIP B;  4JB8 B;  2C2Z B;  3R7S B;  1RHQ B;  3RJM B;  4DCP B;  2CJX B;  3EDR B;  1SC4 B;  3IBC B;  2HBZ B;  2CDR B;  1BMQ B;  2HBQ B;  2XZT B;  1RHU B;  4ZVQ B;  1ICE B;  1SC1 B;  2XYP B;  2QLF B;  1RWO B;  3R5J B;  1QTN B;  3EDQ B;  5K20 B;  3GJS B;  1RWV B;  3NS7 B;  1RHJ B;  1GFW B;  3R7N B;  2DKO B;  2CNK B;  3IBF B;  1RWX B;  3KJN B;  4LSZ B;  2QL5 B;  2QLB B;  1RWN B;  2H51 B;  4ZVO B;  3GJR B;  1RHK B;  1SC3 B;  3KJQ B;  4DCJ B;  2C2M B;  2H54 B;  4ZVT B;  2C2K B;  1PYO B;  2QL7 B;  1RWW B;  2C2O B;  2QLJ B;  3P4U B;  1I3O B;  3D6F B;  2C1E B;  1IBC B;  1PAU B;  2P2C B;  1RWP B;  2H5J B;  1RE1 B;  5IC6 B;  3D6H B;  3R6L B;  4ZVU B;  2CNN B;  2Y0B B;  3KJF B;  4ZVR B;  1RHR B;  3R7B B;  2XYH B;  2HBR B;  1QDU B;  2QL9 B;  2CJY B;  2Y1L B; 
#chains in the Genus database with same CATH topology
 1DTT A;  1A6L A;  3MM5 A;  2J6S A;  3QBC A;  3UVJ A;  3DRP B;  5G4D A;  4CM2 A;  5IT0 A;  3MM8 A;  3UDE A;  3LPY A;  2RKI A;  5EN1 A;  4O44 B;  2V9W A;  5KG3 A;  3G6X A;  3AQP A;  4ZPT R;  5ETV A;  4C9D A;  1RHQ B;  1NRK A;  4B3R F;  4FBT A;  4MK8 A;  2IJN A;  2RIJ A;  2XGQ A;  4F4X A;  3LO3 A;  2LQJ A;  4B3T F;  3AOD A;  1XMO F;  4ZDN A;  2JEG A;  4X66 F;  3HI9 A;  1RJJ A;  4CLP A;  2HQF A;  2A6M A;  5AE3 A;  3JSM B;  2NSC A;  5B0B A;  4I68 A;  4URS A;  3I31 A;  1IQT A;  2V2Q A;  1I5O B;  2BE9 B;  4N56 A;  2VDH A;  5E7O B;  2VV5 A;  1HR0 J;  5H9E J;  5D8H B;  4RO0 A;  2ZWO A;  4F04 B;  4I64 A;  3WX4 A;  4HKQ A;  5KFX A;  4LR7 A;  5HMW A;  3BH6 B;  4IRK A;  4IG0 A;  4BC7 A;  1P9Y A;  2ROE A;  2MQL A;  4QIW D;  4A8X A;  3GMG A;  4GKK F;  2JFK A;  1I94 F;  2BUN A;  4ZP9 A;  1F9E B;  2VBW A;  4HHU A;  3A13 A;  3FSX A;  1RHM B;  3DGV A;  1RLC L;  1NO8 A;  2H4Y B;  3W5Z A;  4OI3 A;  3D6M B;  2HRU A;  3MPU B;  4RPF A;  2CQ1 A;  3CIZ A;  1FVS A;  3EVM A;  4M95 A;  4LSL A;  3M7V A;  1BMQ B;  3HVW A;  3K17 A;  3I6P A;  4PXE A;  3SDE B;  4WU3 A;  3GON A;  1TFW A;  4DR6 J;  4Q5V A;  3JS9 A;  3PW0 A;  3RUB L;  4J9P A;  2ZBP A;  5HQL A;  4UQT A;  3Q83 A;  2DD8 S;  4X62 F;  1YBT A;  2XMJ A;  1NH8 A;  1VBX A;  2W4D A;  3KK3 A;  4AXJ A;  1ZA2 B;  1HNZ J;  5LMN F;  1FI4 A;  1U1K A;  3N6M A;  4DV7 F;  3OT9 A;  5KFM A;  1FNO A;  2AZ3 A;  4IUF A;  1RT3 B;  4LRE A;  1DLO B;  2AMC B;  1N88 A;  1YJR A;  2M5Y A;  4K4U A;  2E7X A;  3U1L A;  3A8J A;  2KJW A;  5DG8 A;  2JEI A;  1U2F A;  4C6A A;  5HRO B;  2HIY A;  5CZX A;  1YZ6 A;  3FVY A;  4I2P A;  3BYR A;  5IXU A;  2ZE2 B;  4CIO A;  1JLF B;  3BF4 A;  3GV5 B;  4WYW A;  3OL6 A;  5FDL B;  2VPY B;  3C8Y A;  5K14 A;  1X4H A;  3WIU A;  1HHS A;  1C1B A;  2XG8 A;  3MCM A;  4RUB A;  3CVK A;  1RTZ A;  4UOF A;  2I5J B;  4ZPD A;  2XCA A;  2LDI A;  3ENV A;  1SC1 B;  1SV5 A;  2UVW A;  1T0T V;  2I1R A;  2WW4 A;  3ENQ A;  2VKZ G;  3R3T A;  3CNQ P;  4DMZ A;  4X4T A;  3T6J A;  2M0G B;  3HVT B;  2XY5 A;  2MKK A;  3OTC A;  1HW8 A;  2D3O 1;  4P74 A;  2ZBQ A;  1JJC B;  4C98 A;  1RTD B;  2DBB A;  2RU3 A;  2R7W A;  1S6P B;  1RP5 A;  4NPO A;  2UXD F;  4C8Z A;  4K4T A;  3K89 A;  3PHT A;  1DZ5 A;  2ZNZ A;  3ELH A;  2WAQ D;  2CJY B;  4YQW A;  2HSE B;  1O8B A;  3UDC A;  2X1F A;  3O8W A;  4ZKA A;  2CZ4 A;  5E41 A;  4UTG A;  4IFV B;  3MI7 X;  2Z0G A;  3UE2 A;  2DNM A;  3L7O A;  4PPZ A;  4WE1 A;  3V6J A;  1UVJ A;  1NME B;  1B64 A;  2J0X A;  4KPY A;  4AQY J;  3R1H A;  2CQP A;  2Z8Q A;  4KO0 B;  3NNH A;  4PCQ A;  3IGN A;  3FBB A;  3TRG A;  3W61 A;  1ICE B;  5DO2 A;  1DQ9 A;  1ZET A;  1MW7 A;  5A8K A;  5E3R A;  3VZH A;  3EGZ A;  2J7K A;  4N8N A;  1YTY A;  3MEE B;  4M5K A;  1CUL A;  1KOO A;  3KJV A;  3I0S B;  1ROF A;  4FYW B;  4KV8 B;  1OYE A;  3GIL A;  5HO4 A;  5L1J A;  1O6X A;  1A0O B;  1CJU B;  1S79 A;  3D54 A;  2WB4 A;  3EUN A;  2FJA B;  3VZI A;  2AKW B;  1FEE A;  1N34 F;  1DTQ A;  4J9R A;  5IC6 B;  5A0Y A;  1S6Q B;  2CZ9 A;  2Z2M A;  2CG4 A;  2JEJ A;  1OY8 A;  3CCU S;  1MU2 B;  5B7W A;  5DQI A;  3EPG A;  1VQN S;  1NH7 A;  2JC1 A;  5E0O A;  2VFR A;  4R0E A;  2O3D A;  3T1Y J;  2OTL S;  2A18 A;  1JJ4 A;  3R7S B;  3T5J A;  4DV1 J;  1N6Q B;  2QGF B;  5DZ6 A;  4KH1 B;  3W63 A;  1SC4 B;  2OPS A;  4NLV A;  2W7O A;  3ZZP A;  3BGF A;  5EX0 A;  1SL1 A;  4C3L A;  4PG4 A;  4UY8 T;  2Z57 B;  1FTR A;  3FZ2 A;  2LCW A;  2FZG B;  3F73 A;  2ADC A;  3RBX A;  3M05 A;  4LMZ A;  5FD1 A;  3GFY A;  2FJX A;  1UP1 A;  1YI2 S;  4DL2 A;  1VBK A;  3DNC A;  2MHE A;  4M5G A;  2LKZ A;  3W5X A;  2HIQ A;  5B0A A;  3MAH A;  2AGO A;  3VGS A;  2Q6C A;  5KFD A;  2HYI B;  5F8M A;  4ES2 A;  1NB7 A;  4URG A;  2HFZ A;  3CIM A;  1U1O A;  2HFS A;  4TKT A;  3CE8 A;  5KG6 A;  5KT3 A;  2JNJ A;  1SH3 A;  1XTZ A;  5CZV A;  3OR2 A;  1ZM4 A;  4U8V A;  3ZZR A;  1NK4 A;  5BXI A;  1UZH A;  4RW4 A;  3M8R A;  2X51 A;  2YNI B;  1RTI A;  2RQK A;  3K5L A;  2FJE B;  4OI1 A;  2OH2 A;  2HS3 A;  2DXF A;  2GVZ B;  4G1Q B;  3DRY A;  2QLF B;  4QPX A;  2YH1 A;  4PYD A;  4R25 A;  3DOM B;  5F0U A;  1H72 C;  4RNF A;  1F9F A;  1HKA A;  4U7U K;  1REV A;  2GQ2 A;  1NU4 A;  1VRQ C;  1CJV B;  1SKR A;  4KKO A;  2DGT A;  4C3K A;  4DN0 A;  3PV8 A;  4LF6 F;  4DQI A;  1FVQ A;  5J1N A;  3DU6 A;  2NYH A;  1VQL S;  3M6U A;  3PCO B;  2C2K B;  1PIL A;  5DGB A;  2OTJ S;  2VIC A;  2BR0 A;  1L3K A;  1PAU B;  4B9L A;  2F4V F;  2V9K A;  2G13 A;  9ATC B;  5E5N A;  4CDI A;  1Y3K A;  4QWE A;  4LBH A;  2B5J B;  1PGZ A;  1UFK A;  4JI7 F;  2IMW P;  4OYI A;  4I7F B;  4NLP A;  2FQQ B;  1XNR F;  3W3S A;  2YKM A;  2IDE A;  5F8N A;  1VIS A;  3CB4 A;  4NCG B;  3QNW B;  5HBM B;  4DSE A;  1VQ5 S;  3V4I A;  3QFH A;  2B8P A;  1Q16 B;  2FYX A;  4ICL B;  1YVF A;  2BJD A;  5A2Q Y;  3WDO A;  5I4M A;  1ZAW A;  1LWC A;  2R8K A;  3S6E A;  4L6V 3;  5T41 A;  1ZYQ A;  3MM7 B;  1HBN B;  4A8S A;  1RWV B;  2JRS A;  2RF2 B;  1WSV A;  3TAQ A;  4RW6 B;  2ZM6 J;  1N8R T;  2XLJ A;  1KLM A;  2OI2 A;  4O4G A;  2JOQ A;  2AYG A;  4DDF A;  3CD5 A;  1UFW A;  3B78 A;  1HIY A;  4N8O A;  1BQN B;  4G6V B;  5LXY A;  2F4F A;  4QR0 A;  4CLF A;  4YUD A;  2XS7 A;  3R27 A;  4OLP A;  5HJY A;  1OYD A;  2DYA A;  4A8K A;  5E3A A;  3T6B A;  1QSY A;  2HVE A;  4HT7 A;  1E6V B;  2W2Q P;  2MMY A;  2YVS A;  1LK7 A;  1UA0 A;  2FZK B;  1Y4Z B;  1WDT A;  1UW9 A;  4PQU A;  2WTF A;  3MR2 A;  3WC0 A;  1AFJ A;  3KLV A;  5CD4 A;  5DM7 Q;  1ZAX A;  4CTA B;  4PWD B;  2NXN A;  3JQM A;  8AT1 B;  4PUO A;  4K0K J;  1FRH A;  2DNG A;  2DY1 A;  4KHP J;  1FRI A;  4TU7 A;  2OJ3 A;  2DHS A;  1ZZN A;  3GLJ A;  1TU0 B;  1U1Q A;  3PJW A;  1HNW J;  1IR0 A;  3AQO A;  2UUC J;  2YWW A;  1PCA A;  2HFV A;  2XS2 A;  2P6T A;  2OEJ A;  4BWM A;  5IZH A;  3CJ0 A;  1L3U A;  4B3M J;  3W8P A;  1RAH B;  2XNQ A;  4ZJQ A;  4N76 A;  5KG1 A;  3HMJ G;  2GW8 A;  2AW0 A;  1MN9 A;  4ZLP A;  2DK2 A;  3U7J A;  5A8R B;  3I56 S;  4KHM A;  4TN2 A;  4CLW A;  1C0T B;  4L74 A;  4ED1 A;  3DKD A;  2HZA A;  4LF2 A;  1NJY A;  4DUT A;  3HK2 A;  1HFE L;  1F5A A;  4RL1 A;  2Z2Y B;  2LQ8 A;  3D3C J;  2H1Y A;  1YRU A;  3TEH B;  4EK2 A;  3C6T B;  4JP8 A;  2K06 A;  2G1H A;  3JAM U;  3DU5 A;  3FKB A;  3Q86 A;  4PPD A;  6AT1 B;  4CYU A;  5KFN A;  1U1P A;  5KFP A;  3FDS A;  2LA4 A;  2BRL A;  1FJE B;  3PR4 A;  3MEG B;  2VAS A;  1K44 A;  1D1U A;  2YNH B;  3D3B J;  4KIA A;  1YK9 A;  3UCU P;  4MKA A;  2J9E A;  4WXW A;  4PEO A;  2E9T A;  3IRW P;  4JI5 F;  3M8S A;  3ZTO A;  2IRX A;  4CH1 A;  2M70 A;  1MWZ A;  1PJ7 A;  1Q8K A;  1PIE A;  1XNQ J;  1FKA F;  2VQF F;  2VOP A;  2BBE A;  4KFB A;  4UUW A;  2WW8 A;  2DR8 A;  4I69 A;  2OD4 A;  3PIP Q;  4WZQ A;  1B3T A;  2RT3 A;  2ZOM A;  3MD1 A;  4JI3 J;  3MMC A;  4J7C A;  3JTN A;  4G65 A;  3A8E A;  2QL9 B;  3NAH A;  3IMQ J;  4DV2 J;  1KTQ A;  1FXL A;  3RR8 A;  4AND A;  4QYZ J;  2VKR A;  1VQ4 S;  1JLG B;  5JJB A;  4Q0B B;  2Z4P A;  3N5B A;  2AV5 A;  2LYV A;  3O2I A;  1LW2 B;  2AZ1 A;  3LAK A;  3NBP B;  3M8P A;  1IM6 A;  3DGP B;  2GAH C;  2HGL A;  3P6Y C;  2R8J A;  5B08 A;  2XB2 D;  3RRG A;  1T3O A;  2DCU B;  2CG8 A;  4UW2 A;  1H2V Z;  2RU9 A;  2R7O A;  1IKX B;  1PG5 B;  2JWN A;  2V2Z A;  4QR1 A;  4M5D B;  1HYS B;  4I1T A;  3VTI A;  3ETO A;  4M5N A;  1HI8 A;  2FVS A;  2QLB B;  3AD9 C;  3CJ2 A;  1HA1 A;  1LEO A;  4DV3 F;  2W9B A;  3GJR B;  4B9M A;  3RAM A;  2NUH A;  5KT6 A;  2DY9 A;  4P10 A;  3KK1 B;  2MQQ A;  4I2Q B;  2QA2 A;  4C4W A;  3RR7 A;  3NCP A;  4H4K C;  3VR1 A;  2I2Y A;  3GIR A;  2ASY A;  1HMV A;  3JYT B;  2H5J B;  1HLW A;  3DRR A;  5A8W B;  2M9K A;  2BXJ A;  4DR4 J;  3PJ9 A;  3KLG A;  3DLK A;  3V4M A;  1JLE A;  3EZ5 A;  2DIV A;  3K2Y A;  1LW0 B;  2C3U A;  1V6H A;  3K58 A;  5J2P B;  2R7Q A;  4ZHR A;  2OEL A;  3NS6 A;  2YTC A;  5T7L A;  1MWY A;  2VG7 B;  1KHV A;  3PDN A;  3K5M A;  2I38 A;  3HD2 A;  4JI8 F;  2X3G A;  5EWF A;  4HAC B;  1T8E A;  2BAN A;  3NGR A;  1TL1 A;  4ECZ A;  1KC8 T;  1ZZF A;  2Y8Y A;  3OUY A;  3A3O B;  2N7Y A;  2J0S D;  5BYS A;  3H98 A;  4HDG A;  2BOA A;  1UL3 A;  3S01 A;  3U27 A;  1FJG J;  3H5X A;  3NXZ A;  4NYZ A;  3PZP A;  1LXN A;  5T14 A;  1EP4 B;  1P9Q C;  3AOC A;  3KG1 A;  4DG1 B;  4OJ3 A;  4L75 A;  1TQL A;  1M1H A;  1QJH A;  4PAA A;  3KMS A;  5HAT A;  4DR7 J;  2LVW A;  2BYC A;  1JKH A;  3TP2 A;  1RT7 B;  3W60 A;  1T11 A;  4DCP B;  2CJX B;  1OWX A;  1JIH A;  2DRA A;  2Y1I A;  2E1C A;  1IUJ A;  1QUV A;  5I42 A;  4N77 A;  3GFX A;  2GIQ A;  1U25 A;  3SMZ A;  5CAB A;  1JNR B;  4LFA F;  4DL0 C;  3FEZ A;  1RAI B;  4F0H A;  1S0V A;  4HTJ A;  3TNV A;  1QAI A;  4NZ7 A;  1Y0H A;  1AB8 A;  1RDR A;  1V3S A;  5ETN A;  2F40 A;  5IM0 B;  3GFH A;  4B02 A;  3MMJ A;  4H4O B;  2DNH A;  1MLA A;  1URR A;  2UUW A;  2EI5 A;  2XM3 A;  4WFX A;  5CH7 B;  4BCA A;  1J5E F;  3D68 A;  3ZXW A;  2DT9 A;  3L7P A;  3AD7 C;  3G8T A;  2ZH5 A;  2IFX A;  3BKF A;  4DF8 A;  4LQ3 A;  4OZN A;  5HAN A;  4DFP A;  3POT B;  1JB0 C;  1FKP B;  3IRX A;  4DR3 J;  5KFF A;  2BE2 B;  2GS8 A;  4KY3 A;  4C8O A;  1F9H A;  1S72 S;  1U2R A;  1RAG B;  1S1U B;  3FQL A;  3D0I E;  1OQ3 A;  2ZIT A;  1HWK A;  2UP1 A;  3AA8 A;  2QMX A;  2XWX A;  1LKZ A;  4DQR A;  5DRK A;  1N4L A;  3CUL A;  2RVJ A;  3NAI A;  3THV A;  1RZM A;  1FD8 A;  2XGP A;  4JI6 J;  4WKY A;  3BR8 A;  5B0G A;  3PX6 A;  1HWL A;  3DLG A;  1NSQ A;  1UCN A;  4URQ U;  1N32 F;  2KJV A;  4USI A;  4GVL A;  5GME A;  2ASL A;  2Y9H A;  2HND A;  4TNO A;  1HQU B;  3TAM B;  4NI2 A;  1RWU A;  1UVK A;  2CNN B;  2NUU G;  3W2W B;  1IR2 A;  1R0A A;  4IDK B;  5IWA J;  4ZIW A;  2XUL A;  1EET A;  2U2F A;  4ZPV R;  2W2P P;  1AYE A;  3VV2 B;  2BAC A;  3SQG B;  2PMH A;  1OS5 A;  1VRU B;  3J81 Y;  1QAJ A;  2XCP A;  3DXB A;  3VAH A;  1XJW B;  3V5R A;  5HSP A;  2KRR A;  3RU0 A;  1T9T A;  3FJ2 A;  3SIP B;  2QIF A;  3CJK B;  5KG0 A;  3BS9 A;  4GRS A;  1FFG B;  3QT8 A;  1RBO B;  5CYJ A;  3J7A 1;  3FK4 A;  3PM9 A;  1RAO A;  1ZH5 A;  3G96 A;  1FDB A;  4ID5 B;  4OX7 A;  5L39 A;  1YLX A;  2G2O A;  1N33 F;  1EKR A;  3FMW A;  1UA1 A;  4ALZ A;  3D28 A;  5C2C A;  5D4O A;  3BDE A;  5DG7 A;  1FD2 A;  4R8U B;  4K5S A;  3FCW A;  4LF5 F;  1R31 A;  4L76 A;  1SKW A;  3M2U A;  1S0N A;  2MZ1 A;  3JAM Y;  1NKB A;  4ZLL A;  1YQH A;  1V3R A;  5KFJ A;  2X1B A;  3LOU A;  3MTK A;  3WHI A;  3OXF A;  2YBV A;  5J2Q A;  1IBL F;  2NCK L;  4C0H A;  4OI6 A;  4HH0 A;  4C8L A;  5I3U A;  2QSF A;  2O5D A;  2Y0B B;  2IVM A;  4Y2K A;  3J7Y I;  3A3P B;  1TUW A;  2Y1L B;  3UDV A;  3CED A;  1CLF A;  4C8N A;  5J2N B;  3CDB A;  1CPZ A;  3L95 X;  4B3R J;  1G3O A;  3GZ7 A;  2BJ7 A;  5H9E K;  3PX4 A;  2HMI B;  1YIJ S;  3VCD A;  4B3T J;  3GJT B;  2JX2 A;  1XMO J;  4X4P A;  2V69 A;  4AE5 A;  3HM9 A;  4KTQ A;  4YEA A;  4X66 J;  1WWH A;  3TOQ A;  3RTV A;  3MMB B;  3LWM A;  2DNK A;  4DEZ A;  4MK9 A;  1F5C A;  5IOL A;  2FVR A;  4I6A A;  1QM9 A;  4DN9 A;  4LQ9 A;  1R8C A;  3DLJ A;  4ERD A;  1NK6 A;  4B9U A;  1U6B A;  1X4A A;  1JLC B;  3R7N B;  3QSY B;  3M8Z A;  3LTO A;  4Y34 A;  3BO4 A;  5L1K A;  3CCQ S;  2HAF A;  2BW7 A;  3LAM A;  4GKK J;  4MIW A;  1I94 J;  4YS2 A;  2P2C B;  5HP1 B;  2MB0 B;  1VIX A;  2PEH A;  1A7G E;  4A46 A;  2GHP A;  4RR5 A;  2ZBR A;  3FEY B;  3VWS A;  4YY3 F;  2YWG A;  3H90 A;  2B7B B;  3IAS 9;  3K57 A;  4NLQ A;  3L9Z A;  2HHT A;  4CO3 A;  4FVM A;  3DRS A;  1RAE B;  2D1C A;  2MEW A;  4ILM A;  2AF6 A;  5HVF A;  2RQC A;  1QTM A;  1Y3J A;  3Q8R B;  3KK2 A;  2HNY B;  3K5O A;  3MAQ A;  2ALZ A;  5HAO A;  3TWZ A;  2UUB F;  4NEY A;  3LP0 A;  4AXI A;  3OR1 B;  1UVN A;  1D9F A;  1Q7L B;  1SUQ B;  1D09 B;  1QAY A;  3PX0 A;  3GYX B;  4G1I A;  1QLN A;  3EDQ B;  2HVH A;  2UVR A;  4X62 J;  2AYM A;  4K2X A;  2LXF A;  1TL7 B;  2DKO B;  2NRE A;  3QYY A;  2LLZ A;  5LMN J;  4MYU A;  3AJ2 A;  2ZOG A;  4DV7 J;  3KG0 A;  4X4U A;  3OFF A;  4J9L A;  4J9Q A;  5F8L A;  1FHT A;  3GCX P;  3M1V B;  2Z2Z A;  5IV3 A;  5F8G A;  4P9S A;  4UZC A;  3R2D J;  4G3I A;  2CQD A;  4DJB A;  3JB9 k;  2ZH1 A;  3UO0 A;  1H0H B;  2DGS A;  3W5Y A;  1R27 B;  2PDA A;  4N47 A;  2ATC B;  1QY7 A;  5FLX U;  4KH0 B;  4RZR A;  2HKE A;  1D8Y A;  1JK9 B;  1WC1 A;  1P1L A;  4FP9 A;  2H4W B;  1J5O B;  4ED8 A;  4JI2 F;  2GO9 A;  2PT0 A;  4LRA A;  4NAS A;  5AT1 B;  4NLX A;  2RUG A;  1REG X;  4QZV B;  4WZM A;  4QPT A;  3KHH A;  4HI1 A;  1TKZ A;  2YX4 A;  2WHO A;  1GK8 A;  3TX8 A;  1T03 A;  2D41 A;  2XLI A;  5JUM A;  3JTO A;  1LV5 A;  2MY7 A;  1GEH A;  3BSC A;  4OZJ A;  4BWJ A;  2ZH7 A;  4DUY F;  4BC9 A;  5JVH Q;  3CPW R;  4XPE A;  1RWN B;  2UXD J;  3N0V A;  3UN2 A;  1NHV A;  5CXT A;  2WVC A;  1XMQ F;  2B0G A;  4C0B A;  2H54 B;  1LWX A;  3PVX A;  2KI2 A;  3LGN A;  3OXG A;  1M5O C;  3LP2 A;  2M8H A;  3BBF A;  1FNX H;  4WWS A;  4LSN A;  2AX0 A;  1HW9 A;  5IFM A;  2MQM A;  3NMR A;  1EZZ B;  3CJ4 A;  3FFI A;  3HDS A;  4LF8 J;  2K1R A;  5C7P A;  1ZM2 A;  2N3L A;  2VFT A;  2IM2 A;  5I3P A;  4HHJ A;  4ETZ A;  1NAQ A;  3DI6 A;  1C1C A;  4KR0 B;  1NK7 A;  1FRK A;  5G0R B;  4ZIV A;  1CC7 A;  3DOK B;  1Q78 A;  3LH2 S;  1TUV A;  1VS3 A;  2AEM A;  4BBY A;  4NMX A;  2EK1 A;  2Z30 B;  3FGV A;  1HBN A;  1X4C A;  5LL6 d;  3GJS B;  3M6X A;  1VI7 A;  3LA0 A;  2MZT A;  1WI6 A;  3M8Q B;  3VGT A;  4Y2I A;  4IO9 Q;  3DFE A;  3P8B B;  3KLF B;  3CDW A;  1SIZ A;  1N34 J;  4J9V A;  4UY8 5;  3SEO A;  2DRD A;  3CD6 S;  3GG0 A;  4DWI A;  3TUP A;  1S57 A;  4ECY A;  3E01 A;  2I6W A;  3C16 A;  3HO1 A;  2OPQ B;  3Q0A A;  1WJ9 A;  2Q79 A;  3PW4 A;  1K1S A;  2E1P A;  1JXV A;  2IAJ B;  1V9O A;  4YFU A;  3MXH P;  3UD3 P;  2QZ8 A;  2CIM A;  1R8H A;  3RZA A;  5M2R A;  2B51 A;  1U1M A;  4K59 A;  1OPZ A;  2KXN B;  1VYA A;  2VFS A;  2LDY A;  2HEK A;  2HGN A;  3PJX A;  2Z56 B;  2VA2 A;  3VAK A;  7FDR A;  1N5Y A;  3HJF A;  3AOA A;  2N7C A;  5GAH U;  2HFU A;  4DQS A;  4KSE B;  2NXJ A;  1KRP A;  1NPP A;  3C19 A;  3EE3 A;  3ISN D;  3CCV S;  2KH9 A;  4Z7Y A;  1HBO A;  3PYG A;  5L8R C;  2CWX A;  4OHV A;  4O0I A;  1O5J A;  1SC6 A;  1Q7Y T;  2IM3 A;  2OMO A;  4M5J A;  2AGQ A;  1T05 A;  3H7H B;  3V6D A;  3THP A;  1TKX A;  2D7S A;  3E8O A;  1N5Q A;  1RT4 A;  2EEY A;  5D0G A;  5HJX A;  3IP0 A;  3BV8 A;  3OTE A;  2QEX S;  4ZVE A;  1TV6 A;  1HQE A;  2OPR B;  3RB6 A;  2CQ4 A;  1X0P A;  1WD6 A;  2HBR B;  2P9E A;  3M8Y A;  4EYI B;  3D4J A;  3SCJ E;  2VFV A;  1T9Y A;  2FHO B;  2W25 A;  3KUG A;  3M9M B;  4ZVP B;  2NXE A;  3OBI A;  5E3C A;  1B4S A;  4H4M A;  1FTC A;  1FEH A;  3HKW A;  4LFC F;  1PO6 A;  2ILY A;  4HI2 A;  1RWM B;  1WHX A;  5CCL A;  2LEP A;  2LU2 A;  5DLG A;  2XSJ A;  2BX6 A;  3LAL A;  5E2Q A;  3KLH A;  5KFU A;  3MUT P;  1APS A;  4MKV A;  1RT5 B;  3QAE A;  2OUG A;  4WJB A;  2FVP A;  4OL8 A;  2GJI A;  4HVZ A;  2UU9 F;  3VQT A;  4LUB A;  4LF6 J;  2Q1L A;  4NL5 A;  3UR0 A;  2CPI A;  2ZZM A;  1BE4 A;  4ZPC A;  5I3Q A;  3H5S A;  2ZD1 A;  3NOG A;  1M5S A;  2HGM A;  2F4V J;  5F41 A;  3THT A;  1Q82 T;  2ZH3 A;  1H3D A;  3UQS A;  1RYR A;  5C5J A;  2CQG A;  5ADZ A;  3KLE A;  5MAO A;  1VMB A;  2KT5 A;  2MKS A;  4R5P B;  4USH A;  4JI7 J;  3NWR A;  4LF7 F;  5KG2 A;  3CSK A;  1XNR J;  3IXQ A;  2PGC A;  3DM2 A;  3AXK A;  1UKU A;  2R2R A;  3EXY A;  2FPH X;  3G87 A;  2XMM A;  4TY8 A;  4DV6 F;  2R3V A;  1H38 A;  2FZC B;  2MKY A;  1R7I A;  2DEI A;  3CO0 P;  1RQ0 A;  3ISN C;  5LJ3 Y;  3GII A;  3TVY A;  1S59 A;  4J9O A;  2FJW A;  2YKQ A;  4ZP8 A;  2JVO A;  2RDI A;  5BJR A;  1TL3 B;  2LQ5 A;  1S7H A;  5EWE A;  3HKZ D;  1U1N A;  2E66 A;  2HHH F;  4M5D A;  2J5A A;  5KG4 A;  2JLG A;  1GFW B;  3EJM A;  3M30 A;  4OV1 A;  2QO3 A;  1R0B G;  1HNV B;  5KFA A;  1TMM A;  3MED A;  2Q6B A;  4DX5 A;  3BN7 A;  4Y2M A;  4FXV A;  1NJX A;  1D0E A;  1VHI A;  4NLO A;  3GR0 A;  3NNA A;  4F50 A;  1U6F A;  2NZC A;  1RE1 B;  1WOP A;  3KJF B;  1FJC A;  3CJ5 A;  1EIY B;  2Z2L A;  1M5H A;  3RAQ A;  2AYE A;  4FF1 A;  1S9G A;  2UXC F;  1DBD A;  2HPU A;  3S1T A;  2H48 B;  1S1T B;  1FDD A;  2KT2 A;  4I0W A;  5C24 B;  2BRK A;  4CRJ A;  4XPC A;  1RU1 A;  2YWK A;  4RBV A;  4OYM A;  4Y28 C;  3MPY A;  1L5U A;  3ONQ A;  3HJV A;  1NJI T;  2F63 A;  3DCA A;  4L3N A;  1YHQ S;  2ZWP A;  5KFB A;  3IG1 B;  4USK A;  1HBU A;  3Q8V A;  4ZLJ A;  1U0H A;  4AL6 A;  2GGP A;  1QD1 A;  4LR9 A;  5AJ3 F;  4TLR A;  3VAM A;  5IS2 A;  2V8D A;  3NS7 B;  1XMB A;  3V81 B;  2KFZ A;  4Q43 A;  2JVR A;  4QU6 A;  1CG2 A;  3I82 A;  1GXL A;  5FLX Y;  4KAI A;  4OYZ A;  2UV8 G;  3QJJ A;  2V4J B;  4C2M A;  1CJK A;  5CAA A;  3PFO A;  1FXD A;  1HWU A;  5HLF B;  4F36 A;  4HL9 A;  4DU7 A;  3QGI A;  3LWL A;  2FHM A;  3AAW B;  3LGM A;  1YJN S;  1OMS A;  4P72 A;  1T94 A;  3AHP A;  4QWD A;  1Z2Z A;  3BR9 A;  1YKW A;  3JXO A;  3P5T L;  2MGZ B;  3N01 A;  1RT2 A;  5KG7 A;  4R0J A;  5SZT A;  3MGJ A;  3AJ1 A;  2BM1 A;  2A3J A;  3HHL B;  3ZC4 A;  3CCZ A;  3OL9 A;  3TO8 A;  1NKC A;  2EG2 A;  4WFB Q;  1SKS A;  2EFN A;  5KFG A;  1ZOT A;  4QIV A;  3ENW A;  3QO9 B;  2D3U A;  4LBP A;  3AH6 A;  2ZHO A;  3C15 A;  4RW9 B;  3C14 B;  1Y5L B;  4IG3 A;  3IBC B;  4JI5 J;  1IBM F;  4NLY A;  3J80 U;  4C7Q A;  2ZH9 A;  2KT3 A;  3QRR A;  1Z2L A;  3MOJ B;  2VQF J;  2RDD A;  4QYZ K;  2CNK B;  3OD2 A;  4A8Y A;  3ZZY A;  2RRN A;  2VPW B;  4LF4 F;  2UVV A;  3AJD A;  3AY0 A;  1B7F A;  4LRB A;  4ED3 A;  1Q0N A;  3MEK A;  1LWF A;  1RTH A;  5ETP A;  5L46 A;  2W01 A;  1NK5 A;  4DZ6 A;  4RW8 A;  3CD7 A;  2MLX A;  1M1G A;  3QZ8 A;  1YBU A;  2VA3 A;  4MKB A;  4OYP A;  1GQE A;  1HWI A;  3J7Z T;  2LEC A;  1R3N A;  4FYY B;  2DGX A;  3QPI A;  2DIT A;  1SXL A;  4A48 A;  1QSS A;  3CCR S;  3G71 S;  1OJ4 A;  5LOQ A;  2P5V A;  3G6E S;  5K8P A;  1JLB A;  1R0C B;  2GQC A;  3X1L B;  4O3R A;  4O0N A;  4U7U D;  3PG9 A;  2D9O A;  2E1M C;  2DH8 A;  3I5C A;  3MUR P;  1AT1 B;  1YJ7 A;  2UUT A;  2W2N P;  5CYQ B;  4IRC A;  1GXT A;  4TU8 A;  2DNN A;  4RNH A;  2EK6 A;  1KVK A;  4M63 A;  2J7W A;  1S9E A;  2DGQ A;  3UN3 A;  4NE9 C;  2OPP B;  4YR0 A;  4WFN Q;  4IFY A;  3NRB A;  4DV3 J;  2MKC A;  4LF1 A;  1VR6 A;  1BUX A;  1MRO B;  2FLL A;  3TYT A;  3CME S;  2HZV A;  3W2V A;  4OHW A;  3RB3 A;  1B0P A;  3GG1 A;  2KG0 A;  4ECW A;  1GX6 A;  2P8I A;  2L9W A;  2HHP A;  1GX5 A;  4G1P A;  5M2U A;  4AT1 B;  1DHM A;  2R7X A;  4OX8 A;  1FXR A;  3MMA B;  5JMN A;  4Z2X A;  4CO0 A;  3SSQ A;  4Q8F A;  3O44 A;  1JLQ B;  3RB4 A;  5DDQ C;  4K7Q A;  4QIE A;  2CAD A;  3ZNU A;  4QW8 A;  3WC2 A;  3QWU A;  3UFC X;  4KGX B;  5IT9 U;  1XR6 A;  2YKN B;  2BJ9 A;  3FNN A;  3D5M A;  3MHY A;  1FRM A;  2RH3 A;  2XY6 A;  4MFB B;  1P1T A;  1RT6 A;  5LT5 A;  1T3N A;  5J2M B;  2M8D B;  5ETT A;  2VG5 B;  1BWE A;  1IKW B;  4JI8 J;  1CC8 A;  4A47 A;  2VBX A;  2HBQ B;  4F2R A;  5BYQ A;  2DR7 A;  1LFP A;  1QTN B;  5K20 B;  1XR7 A;  1PBA A;  1VLY A;  2R9L A;  3B8H A;  2XHW A;  5ETL A;  3E51 A;  1ITP A;  5HQ8 A;  2ADB A;  2MLY A;  3PYD A;  2J76 E;  1U6Z A;  5HK4 A;  2QYG A;  3Q8Q B;  3KXD A;  5D0R A;  4QU7 A;  2X1G A;  3MEC B;  1S12 A;  1HBM B;  3OHA A;  3G82 B;  4WFZ A;  2ALY B;  2UUA F;  5IT4 A;  3R9L A;  3M8W A;  2HNZ B;  3AB2 B;  4XK8 C;  2PI4 A;  5KT4 A;  4FF3 A;  3C6U B;  2R2T A;  4C0O C;  4DPU A;  2Y1R I;  4ZIT A;  5KT2 A;  1PJ6 A;  3DLE A;  4B3O A;  1Y9O A;  1UWB B;  3M2R A;  2HWH A;  1TKT B;  5FII A;  2BEF A;  2ZOF A;  4I6Y A;  1YZ7 A;  4ANE A;  1TFY A;  2YKP A;  2B6A B;  2OEK A;  4LFA J;  3WIV A;  3M6W A;  2DNR A;  3OL8 A;  2HS0 A;  2HQ3 A;  4RW7 A;  3CC2 S;  3AB4 B;  2XI2 A;  3SQO P;  3TUI C;  1W2B R;  4UOH A;  1TVR B;  4PG6 A;  2BQR A;  4DL4 A;  4FYD A;  2IDL A;  1RT1 A;  3ZZU A;  4JI1 F;  2VQE F;  2IM1 A;  2ZBC A;  1NCL A;  3ET6 B;  2W4P A;  3T41 A;  3IAM 9;  5J1P A;  2V50 A;  1J5E J;  3EGW B;  3UNG C;  3ZO7 A;  3MAA A;  1RBA A;  4A8O A;  3M2V B;  2RML A;  3PRB A;  2DR6 A;  3KLI A;  2IC3 B;  1NND A;  1LWE B;  3TQ1 A;  3R2C J;  3RGI A;  3TVK A;  1WEZ A;  1CS4 A;  3OHB A;  2B4O A;  2YWH A;  1FCA A;  1KWM A;  3GV7 B;  3DRX A;  2WSF C;  1BC6 A;  3C2P A;  1DTT B;  4JV5 F;  2LMI A;  3MM5 B;  3UVJ B;  2LEA A;  3HHE A;  2VUG A;  2CDR B;  3MM8 B;  3PHE A;  3OV7 A;  4NLS A;  3W9H A;  4NLG A;  2W8K A;  1RB0 A;  2ZNY A;  1TMJ A;  4U9R A;  4ZN3 A;  1S77 D;  3NL0 A;  2PMZ D;  3ZTR A;  5K9F A;  3MM9 A;  2ATL A;  3EIC A;  4F4A A;  3F41 A;  5ETK A;  3VGV A;  1N32 J;  5HMX A;  2KHD A;  4DL5 A;  3CC7 S;  2G2Z A;  3GFZ A;  2C2N A;  2CJA A;  1HD1 A;  2IVY A;  4W98 A;  4PXB A;  4Y6I A;  3EZU A;  4IRD A;  4EZ6 A;  1ACM B;  4ZCM A;  4ITS A;  1BQX A;  4K4Y A;  3PW5 A;  1FK9 A;  4LR8 A;  4YB6 A;  3NOC A;  3HXM A;  1NHK L;  4DV5 F;  5HL7 Q;  1CJT A;  1UEU A;  1KBR A;  4OMF G;  2B7C B;  2HHU A;  1HHQ A;  1WDD A;  4F02 A;  1IBK F;  1SL2 A;  1QVF R;  2XYG B;  2OML A;  2FY1 A;  3BM7 A;  3C3L A;  1GTE A;  4IG0 B;  4O3S A;  4HHH A;  1XBW A;  2K7J A;  2WOM A;  1QUP A;  1XK8 A;  1K47 A;  1S6O A;  4D3H A;  1UJ5 A;  1WG5 A;  4KRW A;  4LT6 A;  2E9R X;  4DV0 F;  3K5N A;  1LK5 A;  5CYM A;  3MM6 A;  2P6S A;  3O1L A;  4MIA A;  5A2Q U;  2D3Z A;  5DDR C;  1UMJ A;  1IBL J;  3W66 A;  2XMK A;  4LSL B;  2YNG A;  4JI0 F;  2C2M B;  3I5A A;  4DV1 F;  1WTF A;  4B3S F;  4NRU A;  3PKM A;  2NPI A;  2JEF A;  2BV3 A;  3TZX A;  3W8G A;  5CQG A;  4RBT A;  2BMB A;  3OVB A;  2J6T A;  2CJ9 A;  3J80 Y;  3UNY A;  3HHK A;  2RUS A;  4ED5 A;  1RSC A;  3R5G A;  3KK3 B;  3MWB A;  3U1M A;  3CDU A;  3KNA A;  4PKD B;  5K8M A;  2CWK A;  3I55 S;  1K0T A;  3B4M A;  2L48 A;  3O6Q A;  3JSY A;  2B4U A;  5ITH A;  2IMO A;  5C42 A;  4JYA F;  1NJZ A;  4BDP A;  4ETX A;  4I2P B;  4ENO A;  4ELT A;  4ILL A;  4DS5 A;  3FSI A;  1S1V A;  4OQJ A;  1TZ0 A;  1P27 B;  4NA2 A;  1AZS A;  3GSI A;  5K14 B;  1QAX A;  5ETO A;  5GMK a;  3LP1 A;  1C1B B;  2JLF A;  4DU8 A;  4F3O A;  2M52 A;  2Q66 A;  4RU9 A;  3BB5 A;  2MZR A;  3QT5 A;  3SV4 A;  1SV5 B;  2KVQ E;  4OV6 A;  1F3V A;  2IA0 A;  2XWY A;  2GML A;  4YY3 J;  2ASJ A;  2C1E B;  3QFW A;  3I0R A;  4M5H A;  1HD0 A;  1VC6 A;  4EWT A;  5AXM A;  1AUS L;  1NXI A;  3N28 A;  4KQZ A;  2JJ4 D;  4OI2 A;  3EZO A;  4K8R A;  2GMH A;  2OKQ A;  3T9N A;  3RB0 A;  1IQZ A;  4ZVF A;  2FTR A;  3ILO A;  2F8M A;  2UUB J;  1WF0 A;  2MJN A;  3P3D A;  4USM A;  2IRY A;  3SSS A;  5EUH A;  4ED7 A;  1RAC B;  3IM9 A;  1SQF A;  1S76 D;  1VOM A;  2RIL A;  4FXD A;  1T9V A;  2OSQ A;  3UD4 P;  2IIH A;  2ZEJ A;  3MCS A;  4WE1 B;  5A76 A;  3KDN A;  2OIH A;  4LBI A;  3EX7 B;  2Q43 A;  4ZPA A;  4N5S A;  3BGL A;  5IT9 Y;  3D2W A;  5LMU F;  1IWA A;  4J90 A;  3NGT A;  1FDN A;  1NK0 A;  3MCO A;  5A8K B;  4F3M A;  3N79 A;  4CH0 S;  1C4C A;  4WK1 A;  3LQV A;  1QE1 A;  4LVN P;  1N36 F;  4DUZ F;  1ZA1 B;  3KJV B;  4ED0 A;  3H2U B;  2KHC A;  4WP9 A;  1SIW B;  4KGZ B;  3MR7 A;  5IQ6 A;  1R8B A;  2W1B A;  4JI2 J;  1NEE A;  1Q86 T;  3MTJ A;  1AW0 A;  5THW A;  2MKH A;  2EBG A;  1IXK A;  1DTQ B;  1KOH A;  3FCV A;  3R97 A;  1T95 A;  1BWV A;  1S1W A;  3TX0 A;  2FGO A;  1HNX F;  3D9B A;  2B4P A;  4XAK A;  2XHC A;  4DUY J;  2B8Q A;  2V2V A;  3QJP A;  2W8L A;  3QQC D;  2UXB F;  1XMQ J;  2HRT A;  2YNF A;  3DMJ A;  4C11 A;  4F25 A;  4OZ3 A;  2OPS B;  5H9F K;  3VVU A;  1GNK A;  5AE2 A;  4ZVO B;  2G4B A;  4CLS A;  5KFI A;  2GIR A;  1FKO A;  4H54 A;  2QLJ B;  2IHR 1;  3VGU A;  3EGN A;  4RX6 A;  1Y11 A;  3VF0 B;  2AEJ A;  4F7V A;  1XEZ A;  1NM2 A;  1RI7 A;  3NMA A;  2AJ2 A;  3S7R A;  3FBE A;  5F3T A;  2YY3 A;  4X64 J;  3MUM P;  3W9I A;  1R6V A;  3HSJ A;  2I0X A;  2Y3Y A;  1VQM S;  2LU1 A;  4X4O A;  4UST A;  2RS2 A;  1TL3 A;  2HLU A;  3W7B A;  4RUA A;  3OR2 B;  4C3M A;  4IR9 A;  2AU0 A;  1RAJ A;  3EYZ A;  3HVA A;  1JLA A;  3T9Z A;  3DLH A;  4DI6 A;  2KRB A;  2JFD A;  4RW4 B;  5EHH A;  4DX6 A;  1Y5I B;  1I6J A;  2ZJP Q;  2KTQ A;  2DIU A;  4TXS A;  1UTA A;  5KTQ A;  1RTI B;  2IBK A;  1XIQ A;  2QA1 A;  5F0W A;  4EO8 A;  1XR5 A;  1N0V C;  3IWX A;  5HQM A;  2CPJ A;  4NYO A;  2DJW A;  2RD5 C;  1VQO S;  2ZVI A;  4MAK A;  3BGO P;  1REV B;  4M1K A;  2CPF A;  2E7V A;  3MOZ A;  2EXU A;  4CH7 A;  1L3T A;  1TR0 A;  4KKO B;  3BO2 A;  2CVE A;  1YSJ A;  5KFC A;  3A12 A;  3PEJ A;  2C3P A;  1H2U X;  2QX0 A;  2YKA A;  5D3G A;  2A0F B;  3CMA S;  2H3E B;  2DCL A;  2V2K A;  3QLH A;  1GMU A;  1L3S A;  2FLP A;  1B70 B;  4QWA A;  1HNI A;  4FDF A;  2VG6 A;  1ZM9 A;  4BHQ A;  3HUL A;  1MN7 A;  2KU7 A;  2GHV C;  5F3Z A;  1UVI A;  3BSN A;  2QT7 A;  2JHE A;  4NXM F;  3D67 A;  2VBZ A;  4KGK A;  4ZCI A;  1S0O A;  2O66 A;  4X4S A;  1O0P A;  3PAC A;  2YKM B;  5EWG A;  3QIP B;  1WOS A;  5KFR A;  1D9A A;  1F60 B;  3VAI A;  3V4I B;  1BD6 A;  1U49 A;  2FGC A;  2YKO A;  1SPB P;  3DYA A;  3MFI A;  1RA7 A;  3NGU A;  1LWC B;  3IS9 A;  3OTB A;  3EM1 A;  1SJQ A;  2KFY A;  3HPO A;  2PA3 A;  2DPJ A;  2O01 C;  2EFP A;  1X4B A;  2DO0 A;  2WVD A;  2MDA A;  2XMT A;  1F2H A;  4F0K A;  1WI8 A;  4YP3 A;  4OHX A;  2A6O A;  2WK4 A;  4O4G B;  3J7Y U;  1U45 A;  4GO5 X;  1H7W A;  2F5G A;  1SJ3 P;  4LFC J;  3H4D A;  1HPZ A;  5LSL A;  2FUG 9;  1OSC A;  2EFG A;  3NCR A;  1Q1K A;  1NSK L;  4GC6 A;  2WRM A;  3P45 B;  3R1L A;  3MR3 A;  1IKY A;  4HYK A;  4ANC A;  4RWW A;  1Q8L A;  1S1X A;  4FKY A;  4CWB A;  2N3O A;  1BQM A;  3FBC A;  3FC9 A;  2JSX A;  4GC7 A;  5IV4 A;  2LXI A;  2UU9 J;  1RAA B;  4EZ9 A;  4PQU B;  4Y3C A;  4P2F A;  2CUY A;  2ZC4 A;  4NLU A;  3TZW A;  3LAN A;  1SJF A;  4PUO B;  1VRT A;  4FXW A;  2YH0 A;  3HF5 A;  2VZ9 A;  4QYR A;  3QT7 A;  4TQS A;  4OJH A;  1HL6 A;  1Q5V A;  3CCS S;  1U2C A;  4USW A;  2HHW A;  3DOL A;  5KFQ A;  2E5H A;  3BYP A;  3FCH A;  1RTJ A;  4NZ0 A;  4A8M P;  4LF7 J;  3X3U A;  5L1I A;  3OJU A;  1H2T Z;  1KNZ A;  4DV6 J;  2ZHA A;  3G8S A;  1KQS R;  5LSR A;  3G4S S;  1WKL A;  5KFE A;  3CUN A;  4P6Q A;  4YDD B;  5ETQ A;  1PJ5 A;  3MR6 A;  4CO4 A;  1U8S A;  2AJ4 A;  4CZC A;  2HHH J;  1PBU A;  5B0C A;  3H42 A;  3HSZ A;  1KDN A;  3J81 U;  4YR3 A;  2A2C A;  2A2D A;  2G1D A;  3GIM A;  4EYH B;  4CYU B;  3NKY A;  2CYY A;  4B9T A;  1JNZ B;  4B9V A;  3GWC A;  2BM0 A;  4Q2M A;  1F0X A;  2H51 B;  1K1Q A;  5DQH A;  2B9Y A;  4ZN1 A;  4M5I A;  1PYO B;  2C42 A;  2C2O B;  2FD2 A;  1FRJ A;  3A8K A;  4CCH A;  3TA2 A;  1KSP A;  5DS7 A;  4WXO A;  2UXC J;  4ZVU B;  3D0H E;  2QC3 A;  1CQM A;  3H4B A;  4KHR A;  3D1O A;  3Q2T C;  3R7B B;  2MQO A;  3NCQ A;  2XQC A;  5LXR A;  4KFB B;  3LF0 A;  1JLQ A;  3UW1 A;  1X7V A;  1NDK A;  3QGP A;  4X65 F;  5AXN A;  1G1X A;  4FF4 A;  1T02 A;  2C3O A;  1U1R A;  1E6Y A;  2R7T A;  1VQK S;  2HVD A;  3K7R A;  3MMC B;  3N6L A;  1JQG A;  2QJ3 A;  4X4Q A;  2DHX A;  1IKW A;  4KT0 C;  1X9W A;  5F8J A;  4ZK7 M;  1YJ9 S;  2J6U A;  1UPM B;  3M8P B;  1YJV A;  2ERR A;  4AYB D;  4ECR A;  4ZJL A;  4NCB A;  2CQI A;  4UOG A;  4KGM A;  3OSN A;  1WHV A;  4ZMM A;  3KJN B;  2ZZT A;  4QBU A;  3BGU A;  6FDR A;  2DNZ A;  3BPS P;  3WBZ A;  4ZVT B;  2M2B A;  5GMD A;  3EMT A;  1F1B B;  2W9C A;  2DGU A;  2XMA A;  3CCJ S;  2G0J A;  1YBA A;  3ITH A;  4MH8 A;  2QLW A;  3ZZO A;  4DLE A;  2DH9 A;  2W9B B;  2ZH8 A;  4XTT A;  3W65 A;  2R2U A;  2BKO A;  1S99 A;  3BO3 A;  1U7L A;  2XI3 A;  2MSS A;  1ELO A;  1M1K T;  4MIB A;  1DRZ A;  1HMV B;  4NOH A;  4S0M A;  2OGU A;  1IBM J;  4L72 B;  4F4Y A;  1WG4 A;  2EW9 A;  3DDN A;  4LF9 F;  3DRR B;  3O3L A;  4IH6 A;  4X84 A;  4U67 Q;  3V6K A;  5BYR A;  2QE5 A;  2HQI A;  4NEZ A;  4DR2 F;  2E9Z A;  3KLG B;  2YQ1 A;  4GVB A;  4RNM A;  3DLK B;  2XZT B;  1MWQ A;  3BGR A;  1JLE B;  4LF4 J;  5D4N A;  1EQM A;  1RHJ B;  2QMU B;  1C0U A;  2XY7 A;  3QT6 A;  5C25 A;  1SQE A;  3RBD A;  4ZHR B;  4IOA Q;  2OO4 A;  5T7L B;  3CT9 A;  4U95 A;  2AD9 A;  4DFM A;  5J1E A;  1YX2 A;  4OZ2 A;  4A8W A;  1IKV A;  3MPD A;  3ET6 A;  4K4S A;  3RYL A;  4ZVH A;  1O51 A;  2BAN B;  4QIF A;  3VVT A;  1TL1 B;  1OSD A;  2QRR A;  1CBK A;  1UAW A;  2NYI A;  4OYW A;  2F9J A;  4J91 A;  3OUY B;  4UF4 A;  1N5T A;  3C46 A;  5A6P A;  2BJE A;  2E29 A;  2NPF A;  4AFF A;  4V19 J;  3IC1 A;  4DQP A;  5D78 A;  3R5B A;  1G2E A;  3EXC X;  3RJM B;  5KFL A;  4EI2 A;  3H5Y A;  4FNH A;  3OSP A;  2V94 A;  2WON A;  2XMV A;  3QID A;  3PW7 A;  2XTJ P;  3HT0 A;  2QTW A;  3KDO A;  2ZVS A;  1JKH B;  2BJ1 A;  2XMW A;  3PYE A;  3DDK A;  1QVG R;  4LSZ B;  2E44 A;  3MCN A;  4F67 A;  1Q95 G;  2BVZ A;  3ZFV A;  5I42 B;  2O1P A;  2PFD A;  1VFJ A;  3T1H F;  3IBW A;  4CO5 A;  3CJS A;  3SXL A;  3DRP A;  1FE0 A;  2XO7 A;  4F26 A;  2KM8 C;  3VQS A;  2BW2 A;  4O44 A;  4ECQ A;  4FYX B;  2ZDO A;  1U4B A;  1RAF B;  5B0D A;  4WIQ A;  4W90 B;  1VC5 A;  1UEV A;  3OVA A;  4J9K A;  1SCJ B;  1RWK B;  1EJ7 L;  4CNY A;  4JV0 A;  4NLW A;  1NK9 A;  5KFT A;  2V68 A;  4DCO B;  3FUY A;  5BR8 F;  5JXS A;  1WEY A;  4L3K A;  3JSM A;  3WX8 A;  4ZVG A;  5EGY A;  1CEZ A;  4EMD A;  1DUR A;  2P9C A;  2R2S A;  2QA4 G;  3BSO A;  3OFG A;  3IRX B;  4P2S A;  5AXL A;  1PC5 A;  5CA5 A;  2HVZ A;  2NR0 A;  3NEK A;  4OYA A;  4ECS A;  3KJQ B;  4UOC A;  2AT1 B;  5E33 A;  2UUA J;  1OQ6 A;  1PAE X;  3QGG A;  1YJU A;  2MLZ A;  4Q8E A;  2DHA A;  4P73 A;  3IR5 B;  3DLG B;  1WEX A;  4JUZ A;  3PKY A;  2G0C A;  2OHD A;  3R6G B;  2D69 A;  4DR5 F;  2HND B;  2FLO A;  2LP4 A;  4B9N A;  1S7I A;  4E8U A;  1ZTW A;  4NI2 B;  3ZNJ 1;  3SCI E;  3UD5 A;  3SDE A;  3HCX A;  1R0A B;  4EO6 A;  1EET B;  1X0F A;  2R8G A;  1EHW A;  2ABY A;  4WPA A;  3QRP A;  2L9N A;  2AJ1 A;  1RU2 A;  2E1A A;  4ZP7 A;  4PWW A;  4JI1 J;  3MPW A;  2VQE J;  1NKE A;  3ENA A;  1PYS B;  1RUS A;  1RT3 A;  1DLO A;  2F3J A;  1NLK L;  4LJM A;  1XER A;  1VQY A;  1WF2 A;  3SFU A;  3GE9 A;  2HQG A;  1VQ7 S;  5GAE I;  2MKJ A;  2EFO A;  4CO2 A;  2X3D A;  4EGL A;  2FIU A;  4LFB F;  1SC3 B;  3Q8U A;  1WG1 A;  2V34 A;  3A8I A;  2CRL A;  3W64 A;  5HRO A;  4JI4 F;  2V0N A;  5EX3 A;  5L9N A;  2ZE2 A;  2HZC A;  2RRA A;  1JLF A;  3M2U B;  4KBI A;  5FDL A;  1RHR B;  5KFS A;  3M32 B;  1FE4 A;  2AYB A;  1NPR A;  2B9W A;  3ADA C;  1X60 A;  2GC8 A;  3ICL A;  5J2Q B;  2VDI A;  2BKN A;  1KS2 A;  4Q44 A;  2V6A A;  2YX7 A;  4Y00 A;  2I5J A;  4JV5 J;  2ACM A;  5I3U B;  2ZC3 A;  3GTY X;  4FS2 A;  1S6U A;  1SH2 A;  4O3N A;  2CPE A;  2GIF A;  4YB5 A;  1OY9 A;  2R7V A;  3HVT A;  3IR6 B;  1U0S A;  3UR3 C;  4F4K A;  1ZBT A;  1VQP S;  5K5M A;  5GAG I;  4I4B A;  1RTD A;  3GYN A;  3QMQ A;  4LF8 F;  2ZKU A;  1S6P A;  4J37 A;  3MR5 A;  2VH7 A;  3RRK A;  3CJQ A;  3Q24 A;  2GZO A;  2O67 A;  2J7U A;  1Y7P A;  1VK3 A;  2XNR A;  4GMK A;  3TEG A;  2C28 A;  1FES A;  2D9P A;  1R8A A;  3EVO A;  2DGO A;  4DFJ A;  1AA1 B;  4DV5 J;  1N56 A;  3SSR A;  1C4A A;  4IFV A;  2XMU A;  1IN0 A;  1R89 A;  3LW5 C;  1IBK J;  4QWB A;  4ZCK A;  4IOC Q;  4KO0 A;  9RUB A;  1U26 A;  2A1B A;  2WBR A;  3H20 A;  4U6P A;  2I8E A;  3E2E A;  5H1S V;  2FHK A;  4OYO A;  1ARO P;  2KB2 A;  5IC4 B;  4FKX A;  1CQN A;  3DDI A;  3Q23 A;  4D3G A;  2RHS B;  4DV0 J;  4A8F A;  4F0M A;  3MEE A;  4KE5 A;  5B09 A;  5GAD I;  3DRS B;  3I0S A;  5KFH A;  2VPZ B;  4KV8 A;  2ZDP A;  2ZH4 A;  3JTP A;  3UDL A;  3OXL A;  3KK2 B;  1XC9 A;  1CJU A;  3AA9 A;  4JI0 J;  4HTI A;  5HN0 A;  2RJZ A;  5D6G A;  3G9C A;  3SCL E;  2VJV A;  4B3S J;  3F56 A;  3LP0 B;  2D3O R;  5L9X A;  3BKT A;  4DPW A;  2C3M A;  1S6Q A;  2D74 B;  2WBM A;  1HQ2 A;  3GPA A;  2KYZ A;  1EB0 A;  1RK8 A;  1MU2 A;  1VJQ A;  2Y0S D;  2MQN A;  3KWM A;  3UCZ P;  1X4G A;  1VQ6 S;  3R6L B;  2PE8 A;  2OLW A;  1SJ4 P;  1YWX A;  2KVI A;  5KT7 A;  1WF1 A;  2GNK A;  3CDA A;  4DLG A;  4K4X A;  1N6Q A;  2M7S A;  2WSE C;  3QAT A;  3ZZT A;  4JYA J;  2AHO B;  4F4W A;  1VGY A;  2CPZ A;  4Y2A A;  1UW4 A;  4FBU A;  2AQ4 A;  1KQF B;  2RQM A;  2MY8 A;  4DR1 F;  1V5I B;  4WII A;  3F44 A;  3TA1 A;  3BN4 A;  1WC5 A;  1M5K C;  3H2V E;  1X4E A;  3M9O B;  3CTR A;  4NZ6 A;  4B17 A;  2I9S A;  2CJQ A;  2IVF B;  1ZTT A;  3O5T B;  1TKZ B;  3TW0 A;  4HDH A;  3NS5 A;  2DHH A;  4NA3 A;  1T03 B;  1X5T A;  3HHD A;  1Z4U A;  2ZBI A;  4A8Q A;  1H73 A;  3DLB A;  3LGH A;  2VOD A;  2VIH A;  2RDJ A;  4ED6 A;  1LOU A;  4NRT A;  3QZ7 A;  1RWP B;  2PII A;  5DG9 A;  1OO0 B;  3ILJ A;  2VU5 A;  3FBF A;  3CO9 A;  3I9V 9;  2YNI A;  3LP2 B;  2W2M P;  3I32 A;  4IH7 A;  2GVZ A;  4G1Q A;  4LSN B;  2FVC A;  1H6K X;  1Y00 A;  3DOM A;  4C8M A;  2RHQ B;  1RIS A;  3FFI B;  2ZFH A;  4JB8 B;  2GMJ A;  4MKY A;  2K1R B;  4TU9 A;  1GXU A;  1CJV A;  1T9U A;  2DGW A;  1GAO A;  2GQQ A;  3DI6 B;  1C1C B;  2OSR A;  3QIP A;  1MMD A;  3B82 A;  5LMU J;  4ED4 A;  1HHT P;  3DHW C;  1R8P A;  1RGV A;  2YWE A;  5E3Q A;  2A10 A;  3IWN C;  4GKJ F;  3Q8Y A;  1N36 J;  4DUZ J;  3SCK E;  2B5J A;  1I3O B;  1B99 A;  2J9D E;  3H0P A;  4DSL A;  3UI3 A;  4I7F A;  1X31 C;  2MZS A;  4K2J A;  3D6H B;  4NXN F;  4NCG A;  5HBM A;  3UWT A;  3EGV A;  3CDE A;  3SZ2 A;  1S10 A;  1V3Z A;  4Y0F A;  4ICL A;  2B9X A;  3E01 B;  4P52 A;  2K3I A;  4X4N A;  1WC4 A;  3C16 B;  2PEB A;  2KG1 A;  1U02 A;  1HNX J;  4ECV A;  3FMB A;  4E2F B;  3MM7 A;  5C2G A;  2FLN A;  3G2X A;  4AL7 A;  2E5G A;  2ZUA A;  1Q79 A;  4AL5 A;  2RF2 A;  4RW6 A;  1KKH A;  3GR1 A;  1FA0 A;  2UXB J;  1WOO A;  5E3P A;  4Z7C A;  2E5L F;  4DSF A;  4J9U E;  2V8P A;  1BQN A;  1FWK A;  4FN5 A;  3Q2S C;  5KT5 A;  3CGI A;  4I6W A;  1VQS A;  4CM0 A;  2HFO A;  1N5Y B;  1SVD A;  5U47 A;  1SQG A;  2YXL A;  1VBY A;  1E6V A;  3OFE A;  1HWJ A;  2SXL A;  2WVE A;  1V5V A;  4GO7 X;  1HBO B;  1L3V A;  2IJF A;  5D77 A;  4CTA A;  4PWD A;  4Q45 A;  2ZH6 A;  4M5L A;  5DGA A;  2KZM A;  2HHQ A;  2ROP A;  1T05 B;  2GVD B;  3V6D B;  1TKX B;  2YWF A;  1RT4 B;  4O3O A;  4ILR A;  1I51 B;  1TV6 B;  3ZZ0 A;  2CQC A;  4DF4 A;  1HQE B;  4H4K A;  1YRT A;  2CDQ A;  4B9S A;  1U48 A;  4QWC A;  4WBF A;  3BJY A;  3PXG a;  2JC0 A;  2CPH A;  1VLO A;  3AOB A;  4H4M B;  1SB6 A;  5SUH A;  1X9M A;  4OHY A;  1BHN A;  2FY8 A;  1N5V A;  3AXM A;  1VQ8 S;  1JMT A;  4ELV A;  1LQ9 A;  2XSJ B;  3MPV A;  1BY9 A;  5A8R A;  3KLH B;  1VDH A;  1C0T A;  2F9D A;  2J8A A;  2W7P A;  2V8H A;  3UCG A;  2GO8 A;  2XBP A;  4RWX A;  3CCT A;  3MFH A;  1TK8 A;  5D15 A;  2IY5 B;  2MQ8 A;  8ATC B;  3IO1 A;  1X4F A;  5AE1 A;  4YHH F;  4DV4 F;  2OEM A;  1VC0 A;  1UVL A;  3C6T A;  1D3W A;  1KLN A;  2F7V A;  1P8G A;  1JJH A;  3U02 A;  2ZD1 B;  4C48 A;  3BZQ A;  2CNL B;  1M0S A;  4WFA Q;  3HSG A;  3MEG A;  3GIK A;  1TTH B;  3KLE B;  2BZ2 A;  3JSB A;  2YNH A;  3CXC R;  4OX9 F;  2DPI A;  3RBE A;  1M5V C;  4O4R A;  1RKI A;  4NXM J;  2HK2 A;  3OTO F;  5DLF A;  4YME A;  3DM2 B;  1JX4 A;  3BSA A;  2RS8 A;  1KFS A;  1BXN A;  3RG6 A;  3TUJ C;  4UUX A;  3IR7 B;  2YQ0 A;  3MD3 A;  4TY8 B;  3ILI A;  5HVH A;  4ECT A;  1RWO B;  3R5J B;  4RBU A;  3RW6 A;  2FDN A;  2H9Z A;  3PO4 A;  3P49 B;  4DX8 H;  2FJB B;  4PYA A;  1X9S A;  1FWL A;  4LIW A;  2WVB A;  1TK0 A;  1SKU B;  4NLD A;  3W9J A;  2VJU A;  2F1F A;  3BRE A;  5HMZ A;  1YDL A;  1JLG A;  3M30 B;  4Q0B A;  3CW2 C;  2FVQ A;  1LW2 A;  3NBP A;  1BGX T;  3DGP A;  2IRU A;  4DL7 A;  2MQP A;  3MED B;  1OPI A;  1QDU B;  1MG7 A;  3TJ8 A;  2DNY A;  2H5I B;  3TAN A;  2N4D A;  1F2G A;  1NJW A;  5ETR A;  3RW7 A;  1RA6 A;  2CPX A;  4DBQ A;  4QJV A;  2BKP A;  2VF3 A;  1IKX A;  1RBL A;  3HVR A;  4O3P A;  4DPY A;  4UT4 A;  3EPI A;  3T5K A;  3HFV A;  1HYS A;  4PXD A;  4I67 A;  2U1A A;  5K8N A;  3K0J A;  2C2Z B;  1S9G B;  1WNE A;  3MF5 A;  2AEF A;  1J27 A;  2KXF A;  2HBZ B;  7AT1 B;  3KK1 A;  1OY6 A;  3B6B A;  3R5C A;  2AIR B;  4I2Q A;  4DPT A;  3BPD A;  4DOZ A;  1WC6 A;  2CJK A;  4LRD A;  3JYT A;  3RAX A;  1GT8 A;  1HBU B;  3N9U C;  2R42 A;  4CP5 A;  1U0H B;  2PC6 A;  2GGP B;  1GTH A;  3P5B P;  4DL6 A;  4U7C A;  5A8W A;  1IM4 A;  3MDF A;  5DDO C;  1B0V A;  1K8A T;  4K4W A;  1EKS A;  3TA0 A;  1URN A;  5ETM A;  3N4W A;  2CQ0 A;  3LUY A;  4KB7 A;  4V1A k;  3NNC A;  4O3Q A;  3PO5 A;  2JDJ A;  2NQP A;  2DRB A;  4ZOS A;  2F65 A;  2AX1 A;  1CJK B;  1NBE B;  1U09 A;  1NPK A;  2EPI A;  4LIR A;  1LW0 A;  1VK8 A;  3D0G E;  5J2P A;  3AT1 B;  5D4L A;  2VG7 A;  1CVJ A;  1RT2 B;  3N6N A;  3QAU A;  1UWA A;  5KFZ A;  2CXE A;  2HHV A;  2XZD B;  3KHG A;  2BQU A;  4HAC A;  1N5S A;  8RUC A;  2CQ2 A;  3G6V A;  3OLB A;  3BDP A;  4Q2L A;  3FQK A;  2KFN A;  4ZPW R;  3KUE A;  1SJR A;  2CAJ A;  2UZA A;  4K4V A;  3HZG A;  4CLK A;  2JZ5 A;  2GCF A;  2IJR A;  1WEL A;  4CLY A;  3C15 B;  2J0Q D;  4IG3 B;  3GB0 A;  4DSI A;  1EP4 A;  2RSQ A;  2ZH2 A;  3CF5 Q;  2GJF A;  4DQQ A;  4DG1 A;  3R8Y A;  3DC2 A;  3A3N B;  4OZ1 A;  1RKJ A;  4X65 J;  2MKI A;  1I1G A;  2BOP A;  3OFH A;  3T3F A;  2J8S A;  1RT7 A;  4ID8 A;  1B0T A;  1EX8 A;  1LWF B;  1RTH B;  2EG1 A;  1HI1 A;  2HVI A;  1IVZ A;  1TUG B;  4RW8 B;  1FX2 A;  1S9F A;  5D4P A;  4KYZ A;  2IM0 A;  4ED2 A;  3H8Y A;  1NZA A;  4EFA C;  3DXS X;  3EVW A;  3ZTQ A;  1ZS6 A;  3KFW X;  1Z1Z A;  1R43 A;  3I87 A;  2AGP A;  2GX8 A;  3TAP A;  4W4M A;  1JLB B;  5LJ5 Y;  1AXQ A;  1YJT A;  1Q81 T;  4DHV A;  1Y10 A;  5IM0 A;  2XLK A;  1TAU A;  2KKH A;  3RRH A;  1ZM3 A;  4H4O A;  3B54 A;  5DQG A;  1S9E B;  1IR1 A;  3QJL A;  4DCJ B;  3U1N A;  1PYT A;  4PAB A;  4IFY B;  3SV3 A;  1U24 A;  1UPP A;  2PSZ A;  2CJB A;  2NS1 B;  3W2V B;  5KFY A;  4KJI A;  3M9N B;  3POT A;  1KON A;  1VQ9 S;  1FKP A;  2VHG A;  1VHF A;  3QRQ A;  2BE2 A;  2EC2 A;  1U8W A;  2MTL A;  1S1U A;  4LF9 J;  4M94 A;  1WHY A;  2Y1J A;  2MYF A;  5B0F A;  1T9X A;  1DFD A;  3ZTS A;  5HMY A;  4OI4 A;  4DR2 J;  3TQE A;  4YB7 A;  2QYC A;  5DDP C;  4IR1 A;  4XIU A;  4PG7 A;  2WZ1 A;  4I56 A;  2NXU A;  2R8H A;  4QOT A;  3TZZ A;  2VON A;  1RT6 B;  4F4Z A;  4K5R A;  1G7C B;  3K59 A;  1HQU A;  3PR5 B;  3TAM A;  2EKY A;  1N52 B;  2OFH X;  3W2W A;  1YRX A;  4IDK A;  3M4X A;  1SL0 A;  2F8E X;  3QSI A;  3HT3 A;  3NY0 A;  3MZI A;  3VAF A;  1AFI A;  2K8G A;  4CLL A;  3SQG A;  2EFQ A;  2K3K A;  4M8L A;  2LQB A;  3DN9 A;  1VRU A;  1HR0 F;  1FRX A;  2LA6 A;  1NSP A;  3CWJ A;  4ZP6 A;  3M32 A;  4RKU C;  3HHN B;  2E5I A;  2JLE A;  3CJK A;  2CZV C;  4ZPB A;  3WQP A;  1HAR A;  3H59 A;  1W26 A;  3JSR A;  2KDO A;  4DXL A;  1RLD A;  4UZB A;  2R8I A;  2C2D A;  2XS5 A;  4ID5 A;  3I4H X;  4OYB A;  1S49 A;  2PMW A;  3H2L A;  5K8O A;  1KN6 A;  3OVS A;  4R8U A;  4WP3 A;  3TJ9 A;  4PG5 A;  4F8R A;  3PIO Q;  2K2P A;  2W2O P;  3P96 A;  3KUH A;  1S48 A;  3DLE B;  4B3O B;  3D1H A;  4RUC A;  4OLO A;  3M2R B;  3T1H J;  4YOE A;  3CCE S;  1H98 A;  2N4C A;  3IWL A;  3D7S B;  3LPE A;  4DR6 F;  3BBB A;  4IOB A;  4ES1 A;  4P2M A;  4RW7 B;  1X5O A;  2KL8 A;  5J2N A;  4CLZ A;  2BDP A;  1UJ6 A;  5LM7 E;  4OZ5 A;  4KGV B;  4J9M A;  4FZV A;  2HMI A;  1RT1 B;  1HNZ F;  2B3T B;  5IQQ A;  3FRZ A;  5EDW A;  3MMB A;  4FVC A;  5BR8 J;  2VB6 A;  1TAQ A;  4Y2C A;  3CCW A;  3JQK A;  3MAA B;  3FEX B;  4X4V A;  2EBE A;  5DM6 Q;  2GFF A;  1NK8 A;  1LXJ A;  4ATN A;  1JLC A;  3KLI B;  3TZY A;  2HWI A;  3L09 A;  1ZPV A;  1CS4 B;  2LFV A;  2BJ8 A;  4CLU A;  4USV A;  2GHW A;  3KHR A;  2B4V A;  2PN6 A;  4W92 B;  1EAY C;  4PR6 A;  4ZLN A;  3IBF B;  2CKW A;  2K7K A;  5HP1 A;  3TI0 A;  4CNZ A;  3ZZZ A;  2QG9 B;  1FO1 A;  1PC4 A;  2B56 A;  3J81 j;  4WCE Q;  1YGY A;  2XC9 A;  2FB0 A;  1S0M A;  4OYX A;  3MM9 B;  3Q8S B;  2IYG A;  3D66 A;  4UQG A;  1FT8 A;  2HNY A;  5CCM A;  2IPO B;  2WSC C;  4J5O A;  4DR5 J;  4PG8 A;  3KYL A;  2R4F A;  4U8Y A;  2DNO A;  2RQ4 A;  4EEY A;  1F5B A;  3OR1 A;  3SI8 A;  4WKR A;  2C2R A;  1WTB A;  4C97 A;  1SUQ A;  4DSK A;  1FK9 B;  2YPZ A;  2X7I A;  2RKI B;  5KFW A;  4OX6 A;  1CJT B;  4NYP A;  1TL7 A;  2GA7 A;  4P2X A;  3F0N A;  2HG4 A;  2IA6 A;  2QN6 B;  5L38 A;  2ILZ A;  2ROG A;  5B0E A;  2ASD A;  2HQC A;  2ZUG A;  3CD0 A;  4AQY F;  4X2B A;  3L4B C;  1XWL A;  4OJG A;  2CPD A;  4ZCL A;  3M1V A;  5KFO A;  3CC4 S;  4LFB J;  2WOM B;  2CVI A;  2NSB A;  4JI4 J;  3SBM A;  1WHW A;  2FJD B;  3G6Y A;  5CYM B;  3K8W A;  3MM6 B;  2DVI A;  4JV1 A;  2GV1 A;  2MZJ A;  2P9G A;  2EC0 A;  4FS1 A;  3K5P A;  5DZ7 A;  3AD8 C;  1TL4 A;  1J5O A;  2V63 A;  2CFX A;  3B4D A;  2YNG B;  1IJF B;  3M6V A;  4E98 A;  4FPR A;  4ZS6 A;  2W9A A;  3GP9 A;  2G2Y A;  2AJF E;  4ZVS B;  1FDA A;  4FNI A;  2RNE A;  3ETM A;  3V2U C;  1N33 J;  3D6T B;  2MST A;  2OFG X;  4P7T A;  3T19 A;  4LRC A;  4LF5 J;  2KO1 A;  5KOX A;  1UZD A;  2QSW A;  4NWB A;  1FFS B;  1XN9 A;  4RNO A;  2YQ3 A;  1HI0 P;  2HWT A;  3SYZ A;  3T1Y F;  4MMO A;  5H9F J;  2DB1 A;  2HHX A;  4IKA A;  2DIS A;  2FJV A;  4QQB A;  1K9M T;  3Q89 A;  4WTY A;  4IQX A;  4X64 F;  5C42 B;  5JVG Q;  3PEH A;  5D0H A;  3IM8 A;  1TKD A;  4QR2 A;  3I9Z A;  2PO4 A;  2RE1 A;  5CD4 H;  1S1V B;  1D9D A;  1AZS B;  5AXK A;  3NG8 A;  1Q53 A;  2EWH A;  3MUV P;  1IBC B;  3H5U A;  1NZ8 A;  3LP1 B;  1SH0 A;  3PFE A;  3JQJ A;  1YG0 A;  5GVQ A;  2F8H A;  4ES3 A;  1G4C A;  2VC1 A;  4V19 X;  2DXD A;  3VAL A;  4PXC A;  4RLE A;  1KP6 A;  5G0R A;  2AWZ A;  1D8Z A;  4DFK A;  4EBD A;  3DOK A;  4AUK A;  2H65 B;  4NA1 A;  1GMW A;  3I0R B;  4Y65 A;  1M5P C;  1WKJ A;  1GMW D;  4IH5 A;  1WAC A;  1ZAV A;  3HLU A;  4AD6 A;  1EQ0 A;  1DJ0 A;  3J7A N;  3M8Q A;  3NGK A;  4ER8 A;  1KTV A;  4L73 A;  3KLF A;  1RHU B;  4NLT A;  1TL5 A;  4MTP A;  1WUU A;  3HD1 A;  4ELU A;  2C22 A;  1NUE A;  3PRV A;  1DAX A;  2L3M A;  4IYQ A;  2OPQ A;  2HHS A;  4QW9 A;  2IBO A;  2VBY A;  1GH8 A;  2ZHB A;  1IWG A;  4OJ1 A;  2IAJ A;  2Z58 B;  1RHK B;  5F9L A;  3CMQ A;  4N7T A;  4CO1 A;  4MT1 A;  1A9N B;  3CJ3 A;  2GVD A;  3PTW A;  2B43 A;  2DR5 A;  3RBZ A;  4P7V A;  4PRF A;  1QE1 B;  2RAQ A;  4DR1 J;  4ECX A;  5KFK A;  4DS4 A;  1KEK A;  4BLG A;  2HK3 A;  4P75 A;  3L3C A;  3TJA A;  1KQG B;  4OZ0 A;  3Q22 A;  1KD1 T;  1DAR A;  2ZZN A;  1Y5N B;  2QLX A;  2HFN A;  3ZTP A;  3HFK A;  3E3X A;  2R7S A;  3KOA A;  1MNE A;  1S1W B;  4ECU A;  1FFW B;  1IJE B;  1EAR A;  2NZ4 A;  1PKU A;  2YX1 A;  1CUL B;  2HQD A;  3NP5 A;  1LFW A;  4EBE A;  2EFV A;  4JOU A;  3GCW P;  2OPR A;  4WU2 A;  1C2P A;  2HW3 A;  2ZM6 F;  1RWW B;  2AP6 A;  1NB2 A;  2R7R A;  2V4Q A;  2YNF B;  1UVM A;  3DMJ B;  2LXU A;  3IGV A;  2M3D A;  4C11 B;  1WOR A;  4KPC A;  2COL A;  4HH1 A;  3W1Y C;  5A0Y B;  2DR9 A;  3KNG A;  2MJU A;  4ZJO A;  1FKO B;  3KTQ A;  1VJW A;  4WK3 A;  1RT5 A;  2KN4 A;  1FNM A;  2HBY B;  3SFG A;  4BS2 A;  2CNO B;  4DPX A;  2PA8 D;  3BQ2 A;  4HLB A;  1FX4 A;  1KVI A;  2QFI A;  3CJ8 A;  4CI0 B;  4TVA B;  2KXH A;  2XZW A;  3ILL A;  3TR5 A;  4MK7 A;  1WC0 A;  2M88 A;  2W4C A;  2EVZ A;  4K0K F;  4YB1 P;  5F9N A;  1N0U A;  3OPK A;  1BLU A;  4KHP F;  4PQA A;  1SBR A;  3BEG B;  1M90 T;  3BKU A;  4GKJ J;  1Q8I A;  1T9W A;  3G8Q A;  4EUV A;  4OI0 A;  4K50 A;  4R5P A;  2CQH A;  1TEL A;  4XO0 A;  1GMV A;  4TY9 A;  2QL5 B;  1HNW F;  2G9O A;  2NLW A;  1MSW D;  1U1L A;  5CHC B;  2UUC F;  3CJT A;  3OLA A;  1JLA B;  4NXN J;  2M4M A;  4MJK A;  3OTD A;  4B3M F;  5KFV A;  1NSA A;  2QA4 S;  2AJQ A;  2CA9 A;  4ZVR B;  2VFU A;  3TUZ C;  1S97 A;  3D1Q A;  4TLQ A;  4WYL A;  3FRY A;  5L1L A;  3HFZ B;  3TAR A;  3QGH A;  4DL3 A;  1RXO B;  2CPY A;  1J2V A;  2E5L J;  2VD3 A;  4A4J A;  2DO4 A;  5LSO A;  2GJ2 A;  3OJS A;  3KG4 A;  3HX9 A;  1WKK A;  2Q3P A;  3EDR B;  3GSD A;  4EBC A;  1HNV A;  3AFG A;  1OIA A;  5D3G B;  2J0W A;  2BE7 D;  3QLH B;  1TK5 A;  3HSD A;  3NGD A;  1CSJ A;  1YIT S;  1HNI B;  1AUD A;  2VG6 B;  5KG5 A;  1JXE A;  1UEK A;  1RWX B;  4O23 A;  2ACY A;  2CQ3 A;  5GAE U;  2HAI A;  1FF2 A;  2V5H G;  4MYT A;  1KQK A;  1RCX B;  3P4U B;  3PW2 A;  1S4E A;  1S1T A;  1N54 B;  1LNQ A;  1XNQ F;  5C24 A;  4IO1 A;  4HT5 A;  3DYA B;  3IS9 B;  2N82 B;  3GV8 B;  2B9E A;  3GJQ B;  4JI3 F;  2DHG A;  3IG1 A;  1U47 A;  1RAB B;  2ZJQ Q;  4DV2 F;  3FZB A;  1SI9 A;  5RUB A;  2L41 A;  3V81 A;  3VHQ A;  3DLL Q;  2BAB A;  1HPZ B;  2DGV A;  1VCT A;  1P6T A;  2DXE A;  5A6W A;  1RCO B;  2JL9 A;  2V4J A;  1KVJ A;  4TQR A;  5HLF A;  3I96 A;  5GAG U;  3GU0 A;  4HR2 A;  2BQ3 A;  4U96 A;  3H40 A;  3UPF A;  4J9S A;  1G6B A;  2XYP B;  4WFY A;  2FHJ A;  1X8D A;  3IN5 A;  1IKY B;  1S1X B;  4NLR A;  3IA0 A;  1YJW S;  1BQM B;  3CJR A;  2FHJ D;  4YDX A;  1FJ7 A;  2MGZ A;  3PRD A;  3R5D A;  1KLM B;  4OZL A;  3CCL S;  4YHH J;  4DV4 J;  3CCM S;  2UV8 A;  2PFF B;  3NGS A;  3HZE A;  3A1Y G;  2JH3 A;  4CT8 A;  2LEB A;  5KOW A;  2J9C A;  3HHL A;  2QL7 B;  5M2P A;  1VRT B;  3PYF A;  4JV2 A;  3KKF A;  4USJ C;  4IQM A;  5F8H A;  3HHL D;  1FRL A;  2VL1 A;  3I5B A;  1W2I A;  2DEJ A;  5MLC V;  4OX9 J;  3DOL B;  1PSD A;  2EKN A;  5DJB A;  2E7W A;  3BBC A;  1WSR A;  2Y8W A;  3QO9 A;  3K8V A;  1RTJ B;  4RW9 A;  3OTO J;  4C8K A;  3C14 A;  2H5E A;  2PI5 A;  3GIJ A;  4NML A;  4TYB A;  3ULH A;  4NCA A;  2UVU A;  1F6T A;  4WF9 Q;  1Q5Y A;  3KHL A;  3QWP A;  4DR4 F;  5GAD U;  4E0D A;  2HS4 A;  4OIX A;  1FWP A;  3BQ0 A;  2L08 A;  2DNP A;  3TVZ A;  2WB1 D;  1Q8B A;  1W7W A;  4DZD A;  1NDL A;  1T7P A;  4FF2 A;  4X4R A;  2CQB A;  3VAG A;  3Q8P B;  4CLT A;  2MZQ A;  2C2E A;  3EWG A;  1UET A;  4RUH A;  3FSY A;  4Q7A A;  1WC3 A;  3D6F B;  1KHW A;  3BQ1 A;  4XDC A;  3V6H A;  3OL7 A;  4WTO B;  1KFD A;  4PZV A;  1NDC A;  2HUR A;  2APO A;  1Q4R A;  4USU A;  2E5J A;  4ZA1 A;  1TP7 A;  4P71 A;  5FJ4 A;  1RYS A;  1DQA A;  2OP5 A;  3UN5 A;  5CYQ A;  1FJG F;  1KR4 A;  2W7A A;  4HEA 9;  1K0V A;  4K4Z A;  4FYV B;  1X5S A;  2OPP A;  3GYG A;  3C66 A;  3H25 A;  2V8V A;  2KYX A;  1MRO A;  5KAK A;  2NXC A;  2ZJR Q;  2VOO A;  4DR7 F;  4ZVQ B;  1E6Y B;  2L9D A;  4LVO P;  2HRY A;  4CT9 A;  1DY3 A;  4OFZ A;  1DQ8 A;  2E1R A;  1MMN A;  1FER A;  3N5F A;  1VBZ A;  2RB7 A;  2QMW A;  3MMA A;  3T1A A;  3HHL C;  6FD1 A;  2RRB A;  5HI7 A;  4RNN A;  5F8I A;  3W62 A;  1JWW A;  4CQ1 A;  4J9N A;  1XQI A;  3VAJ A;  4NX9 A;  4FPI A;  2YKN A;  4PWU A;  1R6Y A;  2XSF A;  3OW2 R;  4MFB A;  4WP8 A;  2X1A A;  5J2M A;  4YN3 B;  2OD6 A;  5AJ3 J;  7FD1 A;  2QFJ A;  2C3Y A;  2VG5 A;  1UJ4 A;  2W9C B;  4QCL A;  4LRF A;  3T5H A;  1JXL A;  3S8S A;  4DSJ A;  2KZZ A;  4EU0 A;  4C8Y A;  3T5L A;  3ITH B;  1UFL A;  3WZ0 A;  3NLC A;  2KM8 B;  4XDD A;  1H74 A;  2J9D A;  1ULR A;  1H7X A;  4QIG A;  2IYI A;  4OHZ A;  4DR3 F;  2DNQ A;  1JJ2 R;  3I4P A;  4RU2 A;  2DTJ A;  3G86 A;  3MEC A;  1HBM A;  2LQ9 A;  4YR2 A;  3G82 A;  3DHX A;  1MML A;  2MXY A;  4GVB B;  1QSL A;  4F2S A;  3BGR B;  1S4F A;  5DET A;  2HNZ A;  2W24 A;  4DPO A;  2PD1 A;  3C6U A;  1C0U B;  5C25 B;  4JI6 F;  5HVG A;  3J7Z 5;  3BH7 B;  3PY8 A;  3GQC A;  1ZPW X;  1UWB A;  5J1E B;  1IKV B;  4JBC A;  1TKT A;  2V67 A;  3PNI A;  1SJ1 A;  4B08 A;  2B6A A;  2VPX B;  5IWA F;  1W25 A;  4RJV A;  2WCX A;  2WVF A;  3L7U A;  4DX7 A;  3US5 A;  4Z37 A;  2OAU A;  4M5M A;  3OQ2 A;  2XO6 A;  1F3F A;  3ISZ A;  1TVR A;  2AJ0 A;  4KC5 A;  3R5A A;  2ZKT A;  5GAH I;  2YPY A;  1S5Z A;  1NHU A;  3A4T A;  2BJ3 A;  2DNL A;  2POK A;  1N48 A;  4TYA A;  2BA9 A;  2MHN A;  3HP6 A;  4N41 A;  1RAD B;  3M2V A;  2HLT A;  2WON B;  3NWG A;  1B7Y B;  2FC8 A;  2GAG C;  2VC0 A;  2XEX A;  2IC3 A;  4F3Q A;  1LWE A;  2FC9 A;  3IFE A;  1K73 T;  1X5P A;  5ETS A;  2QV6 A;  2V4R A;  2MPU A;  1VIO A;  2V8G A;  3KMQ A;  2G0I A;  1X4D A;  5D0E A;  2XYH B;  1NDP A;  2R7U A;  2DH7 A; 
#chains in the Genus database with same CATH homology
 2H5I B;  2CNL B;  3GJQ B;  4ZVS B;  3R6G B;  2H65 B;  2XYG B;  1F9E B;  4ZVP B;  2H48 B;  1I51 B;  2HBY B;  2CNO B;  3P45 B;  2FQQ B;  1RHM B;  2H4W B;  1RWK B;  5IC4 B;  1NME B;  3QNW B;  1RWM B;  2H4Y B;  2XZD B;  4DCO B;  3D6M B;  3GJT B;  3SIP B;  4JB8 B;  2C2Z B;  3R7S B;  1RHQ B;  3RJM B;  4DCP B;  2CJX B;  3EDR B;  1SC4 B;  3IBC B;  2HBZ B;  2CDR B;  1BMQ B;  2HBQ B;  2XZT B;  1RHU B;  4ZVQ B;  1ICE B;  1SC1 B;  2XYP B;  2QLF B;  1RWO B;  3R5J B;  1QTN B;  3EDQ B;  5K20 B;  3GJS B;  1RWV B;  3NS7 B;  1RHJ B;  1GFW B;  3R7N B;  2DKO B;  2CNK B;  3IBF B;  1RWX B;  3KJN B;  4LSZ B;  2QL5 B;  2QLB B;  1RWN B;  2H51 B;  4ZVO B;  3GJR B;  1RHK B;  1SC3 B;  3KJQ B;  4DCJ B;  2C2M B;  2H54 B;  4ZVT B;  2C2K B;  1PYO B;  2QL7 B;  1RWW B;  2C2O B;  2QLJ B;  3P4U B;  1I3O B;  3D6F B;  2C1E B;  1IBC B;  1PAU B;  2P2C B;  1RWP B;  2H5J B;  1RE1 B;  5IC6 B;  3D6H B;  3R6L B;  4ZVU B;  2CNN B;  2Y0B B;  3KJF B;  4ZVR B;  1RHR B;  3R7B B;  2XYH B;  2HBR B;  1QDU B;  2QL9 B;  2CJY B;  2Y1L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...