1BMQB

Crystal structure of the complex of interleukin-1beta converting enzyme (ice) with a peptide based inhibitor, (3s )-n-methanesulfonyl-3-({1-[n-(2-naphtoyl)-l-valyl]-l-prolyl }amino)-4-oxobutanamide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (INTERLEUKIN-1 BETA CONVERTASE)
publication title Peptide based interleukin-1 beta converting enzyme (ICE) inhibitors: synthesis, structure activity relationships and crystallographic study of the ICE-inhibitor complex.
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 1998-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1bmqB00
1RWPB 3R7BB 4DCOB 1RWVB 1RWXB 2CJYB 2CNOB 2XYHB 3P45B 2QLJB 1RHUB 3KJFB 1ICEB 3D6FB 1RWMB 2H48B 2CDRB 2HBQB 1NMEB 2H4YB 1QDUB 1RWKB 2C1EB 3KJQB 1RHKB 3GJTB 2HBZB 2H51B 3SIPB 2CNLB 2CJXB 4ZVSB 2H5IB 3R5JB 1RWNB 3R6GB 4LSZB 2H4WB 2XZDB 1I3OB 1SC4B 3EDRB 3QNWB 2H65B 5IC6B 1IBCB 2P2CB 4ZVRB 4JB8B 3EDQB 2C2ZB 5IC4B 1SC3B 1BMQB 3IBCB 2C2OB 3KJNB 3P4UB 1RWOB 2Y1LB 1SC1B 2FQQB 1RE1B 4ZVUB 1PYOB 2CNNB 3D6HB 1RWWB 1RHRB 4ZVQB 4ZVPB 2XYGB 1QTNB 2XYPB 1F9EB 1RHJB 2Y0BB 4ZVTB 1GFWB 2C2KB 2QL5B 3NS7B 3GJSB 2QL7B 4ZVOB 5K20B 3RJMB 1RHQB 2H5JB 2DKOB 2QLBB 3GJRB 1PAUB 1RHMB 1I51B 2HBYB 3IBFB 3D6MB 2HBRB 4DCJB 3R7SB 3GJQB 4DCPB 2QL9B 3R7NB 2CNKB 3R6LB 2QLFB 2H54B 2XZTB 2C2MB
chains in the Genus database with same CATH superfamily
3FZ2A 2BJ3A 5GMDA 1AUSL 3UI3A 1OSDA 2FGOA 3U1NA 2IYGA 4NLSA 2UUBJ 3JQKA 2DEJA 2N4DA 2R4FA 2QSWA 3JTOA 1DLOA 1VGYA 3D6FB 2YX7A 2HBQB 3BKUA 2V4RA 3TUJC 2CQBA 1LWFB 4IO1A 3KK2A 2BE7D 1I94J 2RUGA 4KFBB 1WOSA 2FHOB 1BWVA 2UUTA 2ZKTA 2JL9A 3EDRB 4Q8FA 1G2EA 2HVIA 1RT1B 2X1AA 3FVYA 1S1VA 1W7WA 5B0FA 1FE0A 1F3VA 9ATCB 2ZHAA 4JOUA 1RWOB 4XAKA 1VCTA 4JI4J 1IKVB 1Q16B 1QAYA 4FVCA 3OHAA 4OI0A 3NS7B 1TELA 3MMAB 1S57A 4O3NA 1L3VA 1S4EA 5L38A 4LQ9A 4DL7A 3W9IA 3G82B 2QJ3A 1APSA 3ZTPA 2QT7A 4OZJA 1UEKA 2OPQA 2VFSA 4A8WA 4YHHJ 2YWHA 3RRKA 2UV8G 4YQWA 1KFSA 2U1AA 4MKYA 3FBBA 3IBWA 8RUCA 2NXUA 4NLWA 3VF0B 3GV5B 3LGMA 4U6PA 2MB0B 2KYXA 3J7AN 1MLAA 1NSPA 3SQOP 1MWZA 2IFXA 3WC0A 4LF4F 2H4WB 4P71A 3JSMB 2ASYA 5D0GA 4B9VA 1AZSA 4PWWA 3I82A 3GIIA 1D1UA 4WP8A 5CYQA 2PFDA 3VTIA 2MSSA 2J5AA 1PJ7A 3TJ8A 2VPYB 1T9VA 1LKZA 3BGFA 4MFBB 3HF5A 1DZ5A 1RT5A 1Y3JA 1ZZNA 2AJ4A 4IH6A 4NZ0A 2YKMB 2MKIA 5HMWA 4NLTA 1NH8A 2XEXA 4U7UD 1WJ9A 4DV4J 4OHYA 1N5YA 1JLEB 2QSFA 2V63A 1PBAA 3D9BA 4EBEA 2OH2A 3B4MA 2HFNA 4OZ5A 4NX9A 4USTA 1QD1A 3QT7A 3HVTB 4FF3A 2YNHA 3HK2A 4EZ9A 4Q43A 2W2QP 2VQEF 4RW4A 1B0TA 3HMJG 2Q1LA 5DLGA 4WFZA 4I6YA 3SFGA 1FKPB 1VFJA 4MMOA 1HBUB 2GHPA 4LT6A 2FHJD 2AW0A 2Z30B 4G65A 2ZBRA 4ICLA 3HZEA 1Y00A 4W4MA 3MUVP 4LF8F 4PABA 4DV2J 1KSPA 4OV6A 5A76A 3A8KA 4M95A 1ZM9A 4I56A 2GA7A 1CEZA 4ZVUB 2KXNB 1QE1A 3BQ1A 1FRKA 2CPJA 4L72B 2E9ZA 2Z8QA 1KONA 1D9AA 5JVGQ 1TVRA 2HEKA 3V81A 1TL1A 3ZC4A 1JJ4A 4IG0A 5F8LA 4WF9Q 3O1LA 4KHPF 1UJ6A 3GQCA 2AJFE 3TZXA 2VFUA 5CCLA 4F0KA 4IDKA 1H7XA 3TJ9A 4JI8J 1U26A 4USJC 4X62J 4XO0A 2JEIA 1NZ8A 4NLQA 1LQ9A 3MD3A 4Z2XA 3NBPA 4GVBA 4EBDA 2R8JA 4LUBA 2ZNYA 3CO9A 3IA0A 1S4FA 3OVBA 2A2DA 3FFIB 2ZD1B 1SPBP 3PHTA 2ZKUA 4CZCA 4J90A 2OTLS 3AHPA 4O3PA 2D69A 4C97A 2DR5A 3F73A 4C0HA 2F40A 1LOUA 3RTVA 2CJQA 1FDDA 5K8OA 1FTRA 1R8AA 4M5KA 5IFMA 1RAEB 1U1RA 3W1YC 3PFEA 1CSJA 2W2PP 4CYUB 2M9KA 4DV6F 4TU7A 2R2SA 3CW2C 3NWGA 4ERDA 5FD1A 1M1HA 1ZM3A 3BQ0A 2DT9A 1IVZA 1U1MA 1RTDA 1EX8A 3NGRA 2MKKA 1KOOA 4RBTA 1D8ZA 1HWKA 1JNZB 1T05B 2AX0A 3CJSA 4WBFA 2E1MC 2XYHB 3UW1A 2APOA 4OV1A 4OZ3A 1A6LA 2Q43A 4FYWB 1R0BG 1RCOB 4RW7B 5LOQA 3G4SS 3H25A 4QIVA 4XTTA 3M9MB 3ISND 3J7YI 4IO9Q 4HI2A 5DZ7A 4USVA 1C0UA 2VODA 3OQ2A 1CQNA 3C46A 5A2QU 3CJ2A 1HNZJ 1KP6A 3QNWB 3W2VB 1U24A 4ECZA 1RLDA 2OUGA 3K58A 1NHUA 5G0RB 1IKYB 1TU0B 4DR6J 2B51A 4CNYA 4NRUA 2BANB 1F9FA 1Y5NB 3DM2B 2RSQA 3LP1B 1Q53A 4YR3A 4IH5A 3CCLS 4NXMJ 4ECQA 1CLFA 4CQ1A 1HHQA 3W8GA 4B3SJ 3GP9A 3Q8VA 4LF6J 3C66A 5D4PA 1NKEA 3NGDA 5U47A 1OPZA 4JI4F 3VAIA 3H5SA 5GAGU 1E6VB 4TYAA 4FNIA 1FT8A 1S7HA 2YNFA 1GXTA 1REGX 2HRUA 4ZKAA 3TP2A 3D2WA 2B9XA 5IQ6A 2C28A 1RB0A 3LW5C 3KTQA 2YX4A 2K06A 2HLTA 3O44A 1TMJA 3HFVA 2FVRA 1KHVA 1H6KX 3IWNC 5B0EA 5J1EB 5KFAA 2EFGA 2H51B 3SIPB 4CO5A 2E5IA 2F8MA 2ZOMA 5DJBA 4IG3A 3EWGA 5I3PA 2KB2A 3NS5A 2DY1A 3MEDA 4Y3CA 3O8WA 4OLPA 5FLXY 4A4JA 1NK7A 2XO7A 2DK2A 1RTJA 5AE2A 2LQJA 4RR5A 3SBMA 2G0IA 2FZCB 2F3JA 2YQ0A 5LXRA 3DI6A 4UZCA 2W4DA 2H5JB 2LQ5A 1HMVA 1O8BA 4CM2A 5KFLA 3DYAB 2DR8A 3UDVA 3OUYA 2YKQA 1LXNA 5CZXA 3UNYA 3QGGA 3CF5Q 3DFEA 2VFRA 2RKIB 3R2DJ 2R7QA 2D3ZA 3FQLA 4DV4F 1J27A 1RAJA 3MGJA 4DS4A 2CDRB 4LJMA 3NKYA 3KLFA 2AP6A 4ZLNA 2PI5A 2FHKA 2LQBA 3BQ2A 4N76A 2PMWA 1YJNS 4AUKA 3R5JB 3KHLA 3LH2S 3M7VA 2XZDB 1S9EB 2G1DA 3TVKA 5BYRA 2VG6B 2DEIA 2NR0A 5I3UA 2VD3A 2BUNA 2KG1A 1VQOS 3TEGA 4ZN1A 1UEVA 1MU2B 1JLFA 4P2SA 3FMWA 3IR7B 1HPZA 1CJKA 2X1FA 4ED7A 3KK1B 3PR4A 2RDJA 1J5OA 4ZVGA 2BBEA 3Q8YA 1M5SA 2DR7A 2RIJA 5DDPC 2HRYA 2HVZA 2EK1A 2NXCA 2QG9B 1RAHB 3EZ5A 2V8PA 1BWEA 2G2ZA 2MHEA 1JJCB 4HHUA 1LWCA 3E3XA 4HR2A 1HQEB 3D6TB 1SV5B 5KFRA 2D7SA 1QSSA 2J0QD 5AJ3F 3I56S 4B9SA 2VIHA 2AV5A 3G8TA 2VC0A 2C2DA 3M4XA 4NOHA 2XNRA 3EICA 4PPDA 1SJ3P 3NOCA 5HK4A 4UW2A 4X62F 2BJEA 3UE2A 3DDKA 2MKCA 1WF1A 3G87A 2D74B 5ETQA 3RB0A 4P10A 2XSJB 1PJ6A 2DGSA 2ASJA 4J9QA 2DNOA 4OZLA 1WHYA 1NO8A 1WDDA 3PYFA 3R97A 4IRKA 3PIPQ 1L3KA 3V5RA 1FRLA 3CCES 3Q8PB 1CS4B 1PSDA 4E0DA 4I2QA 2DNNA 1WOPA 2B5JB 3LAMA 1HBOA 2EW9A 2OSQA 1VI7A 3J7ZT 4YP3A 3RRHA 2ZITA 3MR2A 3E01B 4NL5A 3K59A 1RAGB 2E9TA 4OX6A 1Q8IA 1UJ5A 1FXLA 4PR6A 2MEWA 3T1YJ 1PYTA 4LBIA 3MOJB 2ZH7A 2OMLA 2BR0A 2CPYA 1HNXF 4OYAA 3KMQA 3IP0A 1VR6A 4MKVA 4M5JA 1LWFA 4BC7A 3QRRA 3DKDA 4ECUA 2N82B 1HNWJ 3AOBA 4BBYA 1R7IA 5IZHA 4JI7J 2G4BA 1D0EA 2A6OA 3HX9A 2QA4G 2MZTA 2KKHA 3S1TA 4FYYB 4MTPA 1HQUB 2PSZA 3SSQA 5K8PA 1IKVA 4H4OA 2FYXA 1RAOA 4ZVTB 1FESA 1NLKL 4DR6F 4JV0A 3IC1A 3T6JA 1KDNA 4O4GA 4DPXA 1Q95G 5D15A 3G82A 3PR5B 4LFBJ 1NPRA 1S72S 4NLDA 2KJWA 2EG1A 4B3SF 2CDQA 4ZCKA 4NLGA 2W2OP 2I5JB 4LF6F 1B64A 5L9NA 3ZZUA 3VVUA 4V19X 2OPRB 4K8RA 3M2VB 3MM6B 1RHUB 2CPEA 2M8DB 1URRA 4BLGA 1LEOA 2W2MP 3ILLA 2KDOA 2RS2A 1FEEA 2DD8S 4NLPA 1PJ5A 4GVLA 3GFZA 1UAWA 5L1IA 1NZAA 3Q83A 9RUBA 3TOQA 1U2FA 1IXKA 2JVRA 1F6TA 3OV7A 3JSMA 3R5GA 3BGRA 2B4OA 3ISZA 5KG5A 1X9WA 1LWEB 4CP5A 5B7WA 5BR8F 3DDNA 1U6BA 1S9FA 2KXHA 3K57A 4NE9C 1HQ2A 4P2XA 3SQGA 4JI3J 1N33J 2VA2A 2GCFA 3CMES 4AFFA 5KFUA 4HT7A 3WDOA 2BJ9A 2KXFA 3EE3A 3AD7C 2YKMA 2HS0A 2DXFA 3GFHA 1YTYA 2QL9B 4B3TJ 1JLEA 4WPAA 4U7UK 3HSZA 2KM8B 1SH3A 3CWJA 3ENWA 3MECB 2B0GA 2EFNA 1SH2A 5KFIA 1AFIA 1X4FA 2XLIA 3RB3A 4LQ3A 2MZQA 5HVGA 2MJUA 3RUBL 1KVJA 3T3FA 3DRSB 1ZAVA 1SQFA 3I5AA 5A8WB 1NK9A 1NXIA 3I5CA 4ED8A 1FKPA 2UXDJ 3POTB 1QJHA 2CJXB 1MNEA 2RQKA 4HT5A 4DJBA 4OJ1A 3GFXA 3CPWR 4ED3A 3AD8C 7FDRA 5B08A 3MMJA 1ACMB 1VS3A 3BKTA 3G2XA 2QMWA 2D3UA 3QSYB 4ZPAA 2P5VA 3B78A 4KH0B 2XC9A 2OTJS 1KTQA 4ZIVA 1AT1B 1VLOA 1MN7A 1DQ8A 3DRXA 3ONQA 3SDEB 3PJXA 5GMEA 5HANA 1FFSB 1WKLA 4ENOA 2DGTA 3HD2A 4HLBA 3NXZA 3HM9A 3GMGA 2ATCB 1N0UA 1HWJA 5C42B 3IGVA 3QRQA 1XR6A 3BZQA 3U02A 1CJTA 3UD3P 5J2NB 4AD6A 1JK9B 2J9DE 2IRUA 3FJ2A 4J91A 3W5YA 3L3CA 1ZS6A 2O66A 4UUXA 3FFIA 2XMMA 1V3RA 3UN3A 3QZ8A 2F4VJ 2LKZA 1JLCB 3DC2A 2YKNB 4WCEQ 2X1BA 1R6YA 4BDPA 5F9NA 1WEZA 3VQTA 1FXDA 1VQ9S 3SCLE 1C1BB 2KI2A 4WIIA 1GMVA 4NASA 2QYCA 4DQSA 3LWLA 5HVHA 4LBHA 3K5PA 3IR5B 4JUZA 4CYUA 5JUMA 3LGNA 1GFWB 2ZFHA 3BH6B 2OSRA 2HWIA 5HMZA 2N3OA 4I6AA 2EEYA 2VBYA 3DRPB 4WYWA 1FFGB 1CJVB 1K47A 3NCPA 1S1TB 1NKBA 3PZPA 1RT7A 2DYAA 4JV5F 1RJJA 1P1TA 2V8GA 4DR2J 1R0AB 5F3ZA 4OI2A 1T05A 3H20A 3I9V9 4F4AA 3FSXA 3OW2R 3W64A 1F2GA 1X4DA 3H59A 1WI8A 2VDIA 4C6AA 5BXIA 3NY0A 1H0HB 5ETPA 4LIRA 1RHKB 1FXRA 3OXFA 3RB6A 4KB7A 1Z2LA 3DRRB 2W25A 4B9MA 1MMNA 5KG1A 3T1YF 3M8PA 1P9YA 3OTDA 4WFYA 5L46A 2V8VA 3GIMA 3BN7A 1BHNA 3HT0A 3W2WA 5G0RA 3GTYX 1RTHA 2FTRA 2VL1A 4WP3A 3G6VA 1TL5A 4P9SA 3QO9B 1HNWF 1UJ4A 2BANA 3M2RB 3BEGB 3DM2A 1O51A 5ETVA 5GAHU 3QAEA 2JX2A 3LP1A 1U1OA 2IA6A 1FWLA 1H2UX 2BZ2A 4JI7F 2XYPB 3A8EA 4GRSA 2WW4A 2DGQA 3I4HX 1SJ1A 2DBBA 2RQMA 4DUZF 4M8LA 1PIEA 3MPYA 2VU5A 3A8JA 2HGLA 1IKWB 1YHQS 4Y2AA 4TVAB 2V8HA 3UR0A 2DXEA 2CQPA 2DGUA 3EXYA 5KG0A 1N6QA 2B9WA 1WC4A 5ETLA 2XO6A 2DNKA 1YJVA 4YB5A 5IV3A 2DNGA 3RAXA 5DETA 4X4QA 3C6UB 5J1EA 1RZMA 3IAS9 4OFZA 1X31C 3I4PA 2WSFC 3BJYA 2ZH2A 3VZIA 4UTGA 2KG0A 5D4LA 2C42A 2WVBA 2B8QA 2DHAA 2VHGA 4A8SA 1WI6A 4HACB 4DV3F 4F4WA 1W25A 1R8CA 4OYOA 4TY9A 3PW5A 3UN5A 1V6HA 2RU3A 1UMJA 1WF0A 2DKOB 1RUSA 3EPIA 1U1PA 1U4BA 4PQAA 3OFHA 1SUQB 2AYMA 4FPRA 4IUFA 2DHHA 3HHKA 2RS8A 4K4XA 4JI3F 1N33F 4DPUA 4GO5X 5GVQA 2JDJA 3CJ4A 3QT5A 2RKIA 3FCHA 2JEGA 1WG4A 1S0VA 4XDCA 3TR5A 5KFCA 1DURA 4F0MA 3NL0A 2UV8A 1SKUB 5D4OA 1B3TA 2JWNA 3C8YA 1WF2A 2MMYA 4LR8A 2MKYA 1F3FA 3CJ0A 2CAJA 2Y1IA 3RU0A 4ED0A 4F8RA 1S9EA 2HS4A 3ZFVA 5JVHQ 4JV1A 1RT6B 4RW6B 1H73A 4JB8B 2NZCA 2NUUG 2IM2A 1BY9A 1YJWS 1A7GE 4ID8A 1EARA 5KFVA 4FNHA 2FQQB 1DTTA 2Q6CA 2W8LA 2K1RA 1NKCA 3KK1A 1EQMA 1Y3KA 3RG6A 1FTCA 1SXLA 2P6SA 4LRFA 2E5HA 2ZVSA 3PG9A 2PA3A 6FD1A 4EBCA 4X64J 4FXWA 2V0NA 4ED4A 1VK3A 4ZPCA 4PG6A 4RO0A 1HQEA 3MM7B 4WWSA 3IR6B 5JMNA 2L3MA 1RI7A 4N5SA 4RL1A 4DV0J 2D1CA 4B3OB 2I0XA 4ES2A 5EHHA 1S5ZA 3DOKB 5FDLB 2GAGC 2R7RA 3C3LA 1OS5A 2KRRA 1QAIA 3IWXA 1RBLA 1HWIA 1SH0A 2WSCC 1SIWB 2IM3A 2AIRB 1HR0J 3DGVA 2P6TA 2QV6A 2XSJA 2A10A 4X4VA 2F8HA 4HDHA 2NUHA 2M70A 3BDPA 1QSYA 4UZBA 5DG8A 5CZVA 3FEYB 5IM0B 5K14B 3HSJA 1SCJB 4G1QB 1FNXH 4F3QA 2V5HG 2CQ2A 2B5JA 2JH3A 3MMCB 3IG1B 4L73A 1GXUA 1MN9A 3WBZA 1UA0A 5GADI 1XN9A 3EUNA 1UPMB 2OEKA 4P74A 1NEEA 3A3PB 3QJLA 3E01A 4JYAF 3W7BA 1HYSB 1GMWA 3CJTA 1VC0A 5DM7Q 2CPZA 5A6PA 2M88A 2ZEJA 3QGHA 6FDRA 1VBXA 2ROGA 2KT3A 2QA2A 4FF1A 4OZ1A 3T5LA 2WCXA 2Y9HA 3OR1B 4CDIA 2XMUA 3C6TB 3CDAA 1EQ0A 4DR2F 4QIWD 3EM1A 5C24B 3MTKA 2HAIA 3KLIB 3M8QB 2YPYA 3TUIC 2CJAA 2CQDA 4C98A 4PWDB 2AJQA 3MM8B 1D8YA 3I96A 4PG7A 1VISA 2OD6A 3K17A 2FVCA 2NSCA 1AA1B 4V1Ak 2OEMA 5HMXA 2ZVIA 4Q0BB 2N3LA 1T03B 4WKYA 1WC0A 4JP8A 4J9RA 1BLUA 3D54A 3V6DA 3AODA 1XNRJ 1X0FA 3AQPA 5ETTA 1JLQB 1VQKS 1T9YA 3H40A 4ED2A 3P45B 3KNAA 3HHDA 3DDIA 3O6QA 2OPRA 3M2VA 3MM6A 2GAHC 3J81j 4RPFA 2RRAA 3U1MA 2V2QA 2KFNA 5J1NA 5LSRA 5I3QA 4FF4A 3HDSA 1YJ9S 1X5OA 3DLGA 1U2RA 2ZZTA 4X4TA 3AA9A 4JI5F 2AJ1A 3CTRA 3NAIA 4I7FB 1U45A 4LRDA 1F9HA 3IGNA 1UFKA 2AGQA 5DLFA 4HYKA 5B0GA 5LMUF 2ZDPA 1S7IA 2K8GA 1R6VA 1O0PA 2OO4A 3AT1B 3I31A 1S6UA 1N36J 2AU0A 5L9XA 3NAHA 1HNVB 5F8IA 2KYZA 3L4BC 1IKXA 3MECA 5L8RC 3CULA 4ZS6A 1HWUA 3OR2B 3W62A 3DRSA 3QFHA 2UUWA 1HW8A 3OTOJ 3AJ1A 2R7TA 4ZP6A 3SXLA 3POTA 4C3MA 2HVHA 1FWPA 3PO4A 2RU9A 2AEFA 4OX9J 3M8RA 1YSJA 3N0VA 1UPPA 4TY8B 2OPSB 5F8HA 2R7XA 2X3GA 1X9SA 4IOBA 2W24A 4WE1B 3AY0A 1IBKJ 1RHRB 3C15B 1VRTA 1YBUA 1QTNB 4C8ZA 3MM9B 2J9DA 1U49A 3KMSA 3GJSB 3R5CA 1LXJA 2CWXA 5IS2A 1ITPA 2CKWA 3SDEA 2KM8C 3D5MA 2NYIA 1H38A 2CQ0A 3VZHA 5KFEA 1BXNA 2IRXA 4IR9A 3MR5A 3N01A 4DWIA 3JTPA 2HGMA 1FCAA 5C42A 1Q0NA 4URQU 3J7A1 4WIQA 3SSSA 4WTYA 1NJZA 3D7SB 5J2NA 1S49A 2G0JA 2O3DA 2J8SA 1RABB 4LF2A 5LM7E 4CWBA 2OIHA 1VIXA 4G1PA 1N34F 4FXVA 1XJWB 3KLGA 3JS9A 3KUHA 1E6YB 2YWWA 3OFEA 1JLCA 2YKNA 4NCAA 2P9GA 1X4EA 1JQGA 2LLZA 4AL6A 3CCWA 1M5VC 2WW8A 4P52A 3ZZTA 1SBRA 4OYPA 4H4KA 2E44A 4MJKA 2M7SA 5EWGA 3BR8A 2DGWA 1HR0F 3ILIA 3SYZA 4CNZA 4ZVPB 1Q1KA 1SKSA 4KE5A 3MPUB 4DI6A 4IYQA 1IQZA 1NH7A 1CJVA 4BC9A 2V34A 1S1TA 1GX5A 4J9LA 2BJ1A 1EP4B 4R8UB 1H2TZ 2C2NA 3T1HF 1R0AA 4NPOA 2P9EA 3HJVA 5IT4A 3MD1A 3TEHB 2HWHA 4WTOB 1CULB 3CJKB 1JMTA 3M6WA 2HWTA 3QGIA 4NRTA 3R9LA 1JLGA 5F8NA 4EMDA 3PRVA 1RP5A 3CCZA 2FLNA 4C11B 4F7VA 3FC9A 3DRRA 1C0TB 1HD1A 1RWNB 1N56A 4DN9A 1YX2A 3HO1A 5EWEA 4M5HA 3TJAA 3W5XA 2QMXA 1PG5B 1U09A 3CXCR 3CDEA 4YR2A 3QO9A 4DV5J 3UCUP 3G6YA 3M2RA 4YB6A 4ZMMA 1Q82T 4NA2A 4DG1A 2RAQA 2RHQB 2KT2A 2DO0A 3BSNA 2HNDB 3JXOA 1XC9A 4K2XA 2MQLA 4RW8A 1KC8T 4QZVB 1VQ7S 4DCPB 2IC3B 2MTLA 2AMCB 3LPEA 2AQ4A 1IKWA 3AB2B 3EZUA 1HHTP 3BR9A 5HLFB 4KQZA 3MDFA 2E7XA 4Y2MA 2MY7A 4YUDA 4B02A 4EO6A 2AZ3A 4JBCA 2DJWA 2YVSA 2HMIB 3VGTA 3QATA 4QW8A 4C7QA 5T14A 4ELVA 2NPIA 4CT8A 3C6UA 3UWTA 2I38A 3NMRA 4NXNJ 1OYDA 5GAEI 1R0CB 2KN4A 4K0KJ 1U02A 2RHSB 4DQPA 5KFQA 1FEHA 4Z7CA 4P73A 3IS9B 3LALA 5HMYA 2LA6A 5DRKA 3UDLA 2DITA 5E0OA 4QR1A 4BS2A 1VRUB 2R8GA 2W9BB 1SUQA 4BHQA 1IM6A 3H5YA 4CT9A 4U8YA 3NNCA 1OSCA 3Q2SC 2GGPB 1UA1A 1OQ6A 1TR0A 1B99A 3PYEA 1N36F 2FJBB 4DX7A 1D09B 2DB1A 1R8PA 5CA5A 3CJQA 2BDPA 1O5JA 5D3GB 2IYIA 4LFAJ 3DLJA 3LP2B 2BE2B 3TZWA 3GV7B 3CMAS 3DGPB 1SI9A 4C3LA 2VB6A 4O23A 1VQSA 4OMFG 2DO4A 4DHVA 1SC4B 1U1KA 1RBOB 4RW6A 3KK3B 3OTOF 4K4SA 2E5GA 3NCQA 1KQSR 3OJSA 2IJFA 2VA3A 3GYXB 2KTQA 4ZOSA 2HIYA 3QLHB 1KRPA 1SC6A 2BM0A 2XTJP 3RB4A 2R8KA 3UN2A 3RR7A 4DR5F 4TN2A 3H2LA 1HKAA 5IWAF 4PYAA 3OXGA 4DN0A 2HRTA 2DY9A 3IRXB 2LQ8A 2CZ4A 5CAAA 4QIEA 2HQIA 3MMBB 3GONA 4FP9A 2CQGA 2C22A 4KGMA 2H54B 3TNVA 4P2FA 5EUHA 4N7TA 3L7OA 2OAUA 2OD4A 3A13A 4ECTA 3QGPA 1ZBTA 2CVEA 2B6AA 4B3OA 1N4LA 3DOKA 4GC7A 4IRCA 4CH0S 2UU9J 2HBZB 3GIRA 2ASDA 4NYZA 4ETZA 5LMNJ 2RQCA 2VZ9A 4LSZB 2LXIA 2ZHBA 1VC6A 1F0XA 1ZA1B 2PFFB 4RNOA 1G1XA 4KJIA 4WXWA 2ZE2B 4OJHA 3QT6A 4B17A 5J2MB 3KJNB 1C1CB 2K2PA 5DGBA 2POKA 1SL1A 3QPIA 5IT0A 2DGXA 2IA0A 3I0RB 5IM0A 3DLHA 5HSPA 4G1QA 3GSIA 3M32B 3IM8A 5E3CA 2C2KB 3EJMA 5KFNA 1S76D 3AOAA 3HFKA 4HHJA 3IG1A 3AD9C 2B7BB 2EFQA 4F2SA 4P7VA 4EK2A 1FHTA 4DR7J 3MR3A 1KNZA 4X4OA 4OYMA 2QLXA 4PG8A 2E7WA 4QQBA 1X9MA 4PXEA 1HBMB 3MI7X 1VDHA 2XLKA 1YITS 4PG5A 1M1KT 1ICEB 2ERRA 1AXQA 3OR1A 2X7IA 3OLBA 2KH9A 3OTCA 5C24A 3A1YG 2FLPA 3TUPA 2ZHOA 4KKOA 4R0JA 1DHMA 3KLIA 2K7JA 4CO2A 2Z56B 1WTFA 2QTWA 3QJPA 5HQMA 1UFWA 2OPPB 4TU8A 2VG5A 4PWDA 4ANCA 2Y8WA 4OYXA 5CCMA 1YZ6A 3Q24A 4FBTA 1CJUB 2WOMB 4EU0A 2SXLA 4ED1A 4DZDA 5LJ5Y 1NDKA 5C25A 4RUAA 2QEXS 2LU1A 2JSXA 3CCTA 4DV5F 4Q0BA 5KTQA 2RRBA 2H5EA 3W63A 2KL8A 2HNZB 4YR0A 1LNQA 5F8JA 1M5OC 1EETB 4BWMA 1U6FA 1S48A 2F4FA 1LW0B 4OLOA 3BB5A 1UCNA 3NS6A 3MCMA 2CJYB 4FF2A 4TKTA 4LRBA 2W01A 4FS2A 2Z57B 1WSRA 3LANA 1XMOF 2GVZB 2L41A 1PYSB 5J1PA 4M5DB 3TRGA 4TXSA 1I1GA 4YB7A 2HFUA 1SJRA 2YPZA 2OEJA 3P5BP 4ZVHA 1YIJS 4ETXA 2GNKA 3GE9A 1GTEA 5MAOA 4HH0A 4ATNA 4M94A 3MURP 3CVKA 3HPOA 4GKJJ 2XGPA 4WKRA 2VASA 4CTAB 2ZOFA 4R5PA 2VJVA 1FDAA 4CLWA 4K0KF 1YBTA 2C3YA 2ATLA 3RBDA 1RYSA 2VF3A 1S99A 1TKXB 5IOLA 1RHMB 1Y11A 2I2YA 1RT2B 3MAAB 4RW9B 3CSKA 2D3OR 1FF2A 1XR7A 1UL3A 1HNVA 5FLXU 2DXDA 3MR7A 3JSRA 1NSAA 2Z58B 3KJVA 1LW2A 1RT4B 4WU3A 3ZTRA 3EVWA 3PO5A 2CQ3A 2FVPA 4DSLA 1KWMA 4YOEA 1X4BA 3DU6A 3M8SA 3ZTSA 2DCLA 3HT3A 2LXFA 4LF5J 2DGOA 3NLCA 1NJWA 1U48A 5KFGA 2CZ9A 3RBXA 1VQ6S 2WK4A 3MHYA 2A1BA 4LFAF 1ZPVA 4TY8A 4RNHA 2M0GB 2OPSA 5THWA 5IT9Y 1EHWA 4ZVEA 2UVRA 5HROB 2BOAA 1HNIB 1F5CA 5GADU 3LF0A 1YLXA 3C15A 4I2PB 2KFZA 1VQ4S 3T5KA 4NMLA 2HK2A 5H1SV 2Z0GA 3PW4A 3F0NA 4B3RJ 3OD2A 4KPYA 1TL3B 1QUPA 4K4WA 3VCDA 1RGVA 1IQTA 1RLCL 1GMUA 1OYEA 4LFCF 2CJKA 3J80Y 4B3MJ 3X3UA 2BQ3A 3I9ZA 5J2QB 2B56A 2XULA 3N79A 2JEJA 5K9FA 2DRAA 5F3TA 1F60B 1UW9A 4RNFA 1JLBB 4QYZK 1G4CA 1NMEB 3TANA 2PEHA 2HW3A 2VV5A 3P3DA 5HP1B 3HCXA 2B9EA 4Q45A 4OYIA 1FKOB 3UR3C 3O5TB 3EMTA 1JXLA 3QBCA 3FGVA 3G8QA 3QIDA 4IFVA 2UU9F 4C8NA 1WNEA 5LMNF 1JXVA 4YDXA 5A8KB 1PYOB 5E41A 1VC5A 5FJ4A 4DQQA 1Q7YT 1X5PA 5LSLA 1FJGF 3BPDA 1V5VA 4OJGA 1FE4A 4CRJA 4DEZA 4ILMA 2YBVA 3MAQA 4EO8A 1PAUB 2OELA 2RUSA 3CGIA 1ZPWX 4I6WA 1EP4A 4ES1A 4R8UA 3HHEA 3R7BB 4RU9A 1X5SA 3K8VA 4JI1J 2KHDA 2EC2A 1CULA 2YWFA 3CJKA 4ZDNA 4A8XA 2AYEA 2FZGB 4DR7F 2E1RA 1LV5A 2ZZNA 1QAJA 1U7LA 3T9NA 2H9ZA 2Y1RI 3CE8A 3E51A 2PGCA 4JI0J 2W4CA 2CXEA 4QYZJ 1NPPA 1C0TA 3R6GB 2BXJA 4KT0C 3CO0P 3OVAA 3HVWA 4ECSA 3TA2A 1NUEA 2HG4A 3H7HB 4L76A 4DR4J 1MG7A 5AXMA 4QU7A 1KKHA 5K5MA 3DLLQ 2VG7B 1GAOA 3R3TA 3MCNA 1UVNA 4NCBA 1UVMA 3CJ3A 4ELUA 4DX8H 3HKZD 1Q4RA 1UTAA 2HNDA 3CDWA 4RNNA 4M5IA 5I42B 4B9LA 1T3NA 2XLJA 5I4MA 1NK5A 2NZ4A 3AA8A 3R7SB 2LU2A 2I8EA 3M8YA 4IFYA 1LK5A 2V68A 2BX6A 4PQUA 3LA0A 2PMZD 3B4DA 2AF6A 5HLFA 1FO1A 3EGZA 4O4RA 1FRXA 2QLJB 4DL4A 2QX0A 3M8ZA 1FA0A 2QFJA 4X66J 3W9HA 2HMIA 1S6OA 5KOWA 1B7YB 5KT4A 4RZRA 1FRMA 2IJNA 5DQIA 4OL8A 2C1EB 4KBIA 2VUGA 3H4BA 1WEYA 4ZPDA 2BYCA 1F5BA 3M6XA 2MPUA 4MYTA 4M5MA 5J2PB 3ITHB 4C8MA 1QSLA 1MWQA 4ED5A 4MH8A 3FBEA 4DR3J 4LF7J 2IM1A 1YRUA 3L95X 4O44B 2UZAA 3WX4A 2RMLA 3HKWA 1YI2S 4PUOB 2XM3A 2M3DA 3MM5B 4GKJF 4CIOA 1VRUA 3SCIE 2XY6A 2BACA 1EAYC 2ALYB 4FYVB 3TAMB 2GJIA 3DHXA 3DLKA 5KT3A 3JAMU 2LEBA 3WIUA 2DIUA 5E3RA 2GGPA 1S0NA 4ZPTR 2GMHA 5A0YA 3PKYA 4KHMA 2GMLA 3JTNA 4WFBQ 1OQ3A 4M5NA 2MY8A 1PKUA 2XS2A 4CLSA 5T7LB 2YTCA 1NJIT 5D3GA 2BE2A 1X4CA 1ROFA 3DGPA 2CNLB 4JV2A 3H4DA 1ZZFA 5GMKa 3T1AA 4NCGA 1NK0A 4ES3A 4I0WA 4O0NA 3KK3A 2B7CB 3MXHP 2ZBIA 4U8VA 1S9GA 2HHSA 1Q8BA 3DXBA 3V6JA 2E5LJ 1SC1B 1TK0A 2P9CA 2B3TB 4F04B 3M1VB 3K5LA 3CC4S 3P8BB 4AQYF 2CJ9A 3RAMA 1SKRA 1HA1A 3CD7A 4OJ3A 3B54A 4DBQA 3BSCA 3IRXA 5KAKA 4C0BA 2M8HA 3MMBA 3ISNC 2VFVA 3Q0AA 4IOAQ 2C2MB 1HWLA 4LF1A 3DOMA 2UUBF 5SUHA 2ZUAA 3LUYA 3ETOA 4B9UA 1JKHA 3K5OA 5DO2A 1LWXA 5ADZA 3CIZA 4MK9A 4UF4A 2I1RA 1OWXA 3VALA 4EYHB 4B3MF 4OI1A 2Q3PA 2YKOA 1K73T 5DQGA 2I6WA 4X4UA 1I94F 2UXCJ 5F0WA 1X7VA 2HHHJ 1X60A 3IM9A 3ADAC 1BQMA 3U27A 2L9DA 3OFGA 4ECYA 4MK7A 5GAGI 5RUBA 2XY5A 2BA9A 3OL7A 1VQ8S 1Y0HA 4ZHRA 2ZE2A 2HHQA 5IC4B 2FY8A 2IPOB 4Y2KA 1Q8KA 1NRKA 1AROP 3VQSA 3GV8B 4BCAA 4OX8A 4OQJA 4ICLB 3I0RA 2UUAJ 3HHLC 3M32A 3HHLD 2R7WA 2E1AA 1XMQJ 2PC6A 3ENAA 5IV4A 2HPUA 3GJRB 2XGQA 4RUBA 3R6LB 4F67A 3PTWA 3V81B 3D1QA 3P96A 3P49B 3O2IA 1TL1B 4IOCQ 4YHHF 5C2GA 2CQHA 2XMWA 4IG0B 3GIJA 1HBMA 4CO4A 4O3OA 3CD6S 5HATA 3VGVA 2E1CA 1YJRA 1HL6A 3OJUA 1V3ZA 2A18A 4IDKB 4YDDB 2M5YA 2XCAA 1NU4A 4WK1A 1WG1A 3CCQS 1RKIA 4JI1F 3V2UC 3SCKE 4DLGA 2F65A 1S0OA 1WHVA 3AXMA 4YY3J 3K7RA 2OPPA 1CBKA 1RA7A 2MZJA 3PRDA 2OKQA 4AE5A 3UVJB 2MQMA 2PI4A 4GO7X 4JI0F 1CJUA 2VBWA 2WOMA 4USWA 2CPDA 1F9EB 5KFKA 1XIQA 5F0UA 4DR4F 3A12A 4E2FB 1L3UA 2E7VA 3ZO7A 2JC0A 2MGZB 2OLWA 2CADA 5AE3A 2ACMA 1RTIB 1KLMB 2HNZA 4NLXA 1EETA 2HKEA 4N8OA 2X51A 1XK8A 1DARA 4KO0A 1TAUA 2XWYA 2GVZA 3O3LA 1YDLA 1X4AA 1RTDB 5B09A 1P1LA 1L5UA 4OHWA 1KVKA 4MK8A 4M5DA 1UFLA 1K8AT 1WD6A 2QN6B 2WBMA 3VAFA 1FNMA 4DV2F 4DPWA 3UCGA 4QOTA 4LBPA 2CVIA 4KGXB 5F8GA 4F36A 4CTAA 2CYYA 1VQYA 3OSNA 1HBNB 3BM7A 3SMZA 3KYLA 2GO8A 1UEUA 5HQLA 5F9LA 2IDLA 4NLYA 1TKXA 1N5SA 1FERA 4C8KA 3LPYA 1RT2A 3P5TL 4NEZA 1FX2A 1FFWB 2W4PA 2XZTB 2HFSA 2P8IA 4JI8F 2KJVA 4HHHA 2XS5A 3ZXWA 2W8KA 1TAQA 3GPAA 4HL9A 3G86A 1RT4A 4QWBA 1FX4A 5KFJA 2JLEA 2ZOGA 5HQ8A 4Q2LA 1FI4A 2JLGA 2V67A 3TAQA 2AJ0A 1IBMJ 3TI0A 3M6VA 4ALZA 2YQ3A 4USMA 3CCUS 4J9PA 2ZH3A 2VFTA 3QMQA 2WVEA 3L9ZA 2V2VA 2J6UA 3M9OB 4DSEA 2XCPA 2XMVA 4IQMA 1RT3A 3CC2S 4WYLA 4ILRA 2W9AA 4I2PA 3MPDA 3MZIA 1OMSA 3DHWC 3MR6A 1I6JA 2R3VA 2A6MA 4KTQA 5KT2A 2DPJA 2V2KA 2E5LF 4X4SA 1LK7A 5B0AA 1TL3A 5D0HA 4DFKA 2HBRB 2ADBA 3GJQB 3OBIA 3TO8A 4U95A 2JOQA 1WC6A 4DCOB 2MQOA 1RWXB 1U2CA 3QYYA 2LEAA 2CNOB 1HMVB 5KOXA 4KFBA 2LP4A 2FDNA 1JLBA 4W90B 2VQEJ 1RT1A 2BJ8A 3TQEA 1DTQB 1S1UB 1NK8A 3NEKA 2XHCA 1HNZF 2F8EX 2Y8YA 3H5XA 5IC6B 3CT9A 3D3CJ 3MMAA 2MJNA 2UXCF 2GO9A 2BRLA 5A8KA 2HZAA 2CNNB 2FJAB 4ECRA 2FIUA 4NXMF 3OPKA 2Y0BB 2QL5B 2F63A 3OSPA 3V4IB 4HDGA 1VYAA 3N6NA 4LSLB 4C8YA 3IBFB 4K4UA 4Q8EA 2DNMA 2K3IA 4RBUA 1RWPB 3NNHA 5KG7A 1XMQF 1GT8A 3J81U 1URNA 2L48A 3AJ2A 4Q44A 2EG2A 1VK8A 4ID5B 1N8RT 1D3WA 3CMQA 1LWCB 4A8MP 3L7PA 2RQ4A 1PC4A 4CLUA 2O1PA 1M5KC 4EFAC 1MMDA 1NSKL 4ZVSB 4RKUC 3ICLA 5HI7A 3C2PA 3A3NB 1JNRB 4I68A 4MFBA 4DUTA 2D9OA 3VAMA 5KFXA 4DQRA 1NAQA 1BUXA 4KHRA 3QIPB 2N7CA 3PYDA 3CD5A 3R1HA 2MLYA 2EFVA 2VG7A 4QWCA 3D6HB 1RWWB 3F56A 4YY3F 1UW4A 2AZ1A 4U96A 2H3EB 2RDIA 5I42A 3GYNA 1KVIA 4LR7A 1TUGB 1XEZA 1TFWA 2KRBA 3HVTA 4PEOA 5D0EA 2W9CB 4NLUA 1FRJA 2GJ2A 4L75A 3BBBA 1HBUA 2AKWB 3R2CJ 5M2PA 1QM9A 5ETKA 2ZJPQ 3PX4A 3MPVA 3KUGA 2HQCA 3TUZC 2DPIA 3BPSP 2ZH4A 1KQFB 1KLNA 4JI6J 1VBKA 2CUYA 3OFFA 4K7QA 2FLLA 4X4NA 1WC3A 5HO4A 3IRWP 2WVCA 3BKFA 2HLUA 5J2PA 3ITHA 4DL2A 3UCZP 1BMQB 4LREA 1IJFB 2GVDB 2MLZA 1R27B 5KG4A 1Z2ZA 2NPFA 4OZ0A 3FRZA 3QWPA 4O44A 5E3AA 2ZUGA 4NEYA 1Q86T 4QWEA 3UPFA 4ELTA 3TA1A 4PUOA 4CO0A 3MM5A 3GG0A 3FEZA 1SVDA 1ZAWA 1AUDA 3D0IE 2YX1A 3TAMA 2CNKB 2ZWOA 2XZWA 4H4OB 2DR9A 5DG9A 2FUG9 2ZD1A 2OHDA 3E8OA 2BM1A 2ZH8A 4Y34A 4UQGA 1UZHA 3K89A 4O4GB 3MUMP 2GIRA 2WTFA 2RVJA 5T7LA 3ET6B 4XDDA 4I64A 5ETSA 4YS2A 3PACA 7AT1B 4OI6A 3AH6A 2FJDB 2IAJB 3M2UB 1I3OB 2ZNZA 4CCHA 4IQXA 4CLYA 2BW2A 1IUJA 1IBMF 5DS7A 5E3QA 3HVRA 1FNOA 3ZZOA 2W7AA 1X0PA 4WFAQ 2RNEA 3U1LA 3M1VA 1YJUA 3ZNUA 1N54B 1S97A 3DNCA 3BGRB 4NI2B 4C2MA 2E66A 4I69A 2O67A 4FPIA 2R9LA 2PT0A 1FJEB 3M30B 4A8FA 4RW7A 3SQGB 5DDRC 4MKAA 2D3O1 3QAUA 4NLRA 1MW7A 2FC9A 3PYGA 4DL6A 4P2MA 3RBZA 3D3BJ 5HL7Q 3RYLA 1JX4A 2CQCA 4U67Q 4J9MA 2AGOA 2Y1JA 5GAHI 2HURA 3W2VA 4DPTA 1SIZA 2WONB 3OL9A 2IVYA 3ULHA 1IKYA 1C2PA 2VKZG 2R7SA 1RQ0A 2JLFA 1PILA 4CO3A 1WC5A 2MXYA 4P7TA 2J6SA 1KQGB 4Z7YA 2K3KA 1VQMS 4LRAA 1SJQA 4XPCA 4OX7A 4J5OA 2OGUA 3FK4A 2FJVA 5IXUA 4ANEA 4CLTA 1N0VC 4G6VB 1EIYB 1E6VA 2CA9A 3HZGA 1H74A 3PEJA 1UVLA 2VQFJ 1SJFA 2UVWA 3CJRA 3BGOP 4HTJA 3RJMB 4CLKA 3MCOA 4RJVA 2WZ1A 1S59A 4LFBF 2DISA 4AL7A 1OY9A 1SJ4P 2F1FA 3UQSA 3R7NB 1T9XA 1A9NB 4F4XA 4UY8T 3PCOB 2BW7A 2V4JB 5DQHA 4E8UA 4K5RA 2HNYB 1HIYA 5SZTA 5B0DA 4LRCA 3QFWA 3BN4A 2WHOA 2MKJA 5E2QA 3PNIA 5AJ3J 3HP6A 1N88A 3OTBA 1YJ7A 5DG7A 2GIQA 2HIQA 1T9TA 3BYPA 4F25A 1CJTB 2HFZA 2MSTA 3QWUA 1GXLA 2EK6A 3GZ7A 2J7WA 1HD0A 1YRTA 3JYTB 4AXIA 5KT6A 2J9EA 1Y9OA 4MIAA 1IM4A 2G9OA 4TYBA 4XK8C 3UVJA 1Q78A 2V9KA 1RSCA 3OTEA 2RILA 2FVSA 3DYAA 3IFEA 2Z2MA 1H3DA 2ZH1A 1KR4A 3FNNA 4KGZB 4HVZA 4EWTA 1J5EJ 2V2ZA 1ZTWA 3H90A 2ALZA 3PFOA 2MGZA 1HHSA 2XB2D 1RTIA 4URGA 4B3TF 1KLMA 1BQXA 5E3PA 4LF9J 3HXMA 2BABA 3OXLA 3RAQA 2QLFB 4A8QA 4KC5A 1OY8A 5EX3A 1FD8A 2CJBA 4EGLA 2FC8A 4KAIA 4RLEA 2O5DA 4N8NA 4AYBD 1P9QC 1F5AA 3LWMA 1RT7B 4ZN3A 1K1QA 2VG6A 3DRYA 2WSEC 5AE1A 4DFJA 1O6XA 1HNXJ 5KFMA 4FYDA 1TKZB 3NCRA 2UXDF 2XS7A 3CNQP 4DQIA 2NLWA 2D41A 5JXSA 3I0SB 3GIKA 5DDQC 1MU2A 1R8BA 2AEJA 2MDAA 1VOMA 2XBPA 1FVQA 4USHA 2B8PA 3KHHA 2RH3A 1SQGA 4M63A 4FBUA 3KHRA 3V4MA 4WU2A 4JI6F 1U8WA 2J7KA 2DNQA 1PO6A 3HD1A 1OY6A 2AD9A 2I9SA 2KO1A 3M8PB 1CG2A 1HBNA 2HGNA 4C9DA 3J7YU 3W2WB 2IJRA 1QY7A 1X4GA 1RTHB 1JWWA 1SV5A 3G6ES 3M8WA 1SL2A 1RADB 2HHPA 2R7OA 1RISA 2HS3A 3G8SA 3T41A 1R31A 5F8MA 2AWZA 4KPCA 3TWZA 3PDNA 1BD6A 2E5JA 3UD4P 1RWMB 1Y10A 4PZVA 2FJWA 2EWHA 5E5NA 3HHNB 1CC8A 2F4VF 1KBRA 1KOHA 4CLLA 3EGVA 1IJEB 1BQNB 2CQ4A 4OZNA 5KFOA 1N6QB 1JLAB 5D78A 2QO3A 4S0MA 3PW2A 4RU2A 3QRPA 4L3KA 4Y2IA 4QIFA 2ADCA 1CS4A 2RF2B 1UVKA 5BR8J 2DVIA 1HLWA 1NJXA 4V19J 3T5JA 2VOPA 4HEA9 3CDUA 2QZ8A 1XNQJ 1NDPA 2RD5C 4G3IA 3N6LA 4KRWA 5HVFA 2C3MA 2UXBJ 4KSEB 3CCVS 3ZTQA 1X8DA 2YH0A 3TX8A 4F26A 3TARA 2B9YA 4RNMA 4OHZA 3OL8A 1UVJA 3NGKA 4AT1B 2W1BA 2VC1A 3KG0A 4ZIWA 4DX6A 2YH1A 2C3OA 1BC6A 1QTMA 2E9RX 3EGWB 2QA1A 3DLEB 1CQMA 2BV3A 4EEYA 4J37A 4FZVA 3VAGA 1VJWA 1DTQA 1S1UA 1QVFR 1HQUA 1TQLA 2QMUB 1Q5YA 1IBCB 2QC3A 4ZVRB 1CPZA 1YG0A 3ENVA 5E33A 2LDIA 4AL5A 2BJ7A 2LFVA 3CD0A 5HJXA 5D6GA 1OPIA 1VQLS 1U6ZA 2BVZA 3I5BA 2VBZA 5KFFA 5K20B 2I5JA 3V4IA 5HBMB 3DMJB 2XNQA 4LSLA 2EKNA 3MTJA 2GZOA 1DTTB 3PW0A 2DHXA 1MROB 4H4MB 1MSWD 2K1RB 3DOLB 2MQPA 3D68A 2IMWP 4K5SA 2VQFF 3A4TA 3VHQA 2Z2LA 1VQPS 3I6PA 2VOOA 2V9WA 4WP9A 1ZAXA 4FVMA 1TL4A 2KT5A 3DN9A 3OLAA 5HJYA 2CQ1A 2HFOA 4ID5A 2QYGA 3VV2B 3VAKA 1LWEA 3K5NA 8AT1B 4TLQA 4O3RA 4KV8B 4ZLJA 1S6QB 1M5PC 2QIFA 3CJ8A 3FUYA 2J0XA 2VJUA 2DNLA 1S77D 3KKFA 3R27A 4TLRA 4ZITA 4ZCMA 2H65B 1VMBA 1FVSA 3Q8SB 2HQDA 4WZQA 2LCWA 2C2EA 2MKHA 3PY8A 1NPKA 4YMEA 2GV1A 3QIPA 1ZM4A 2Y1LB 5L1JA 4CLZA 3HSGA 1H72C 2VPXB 4MT1A 4Q7AA 4Y2CA 1VIOA 3THPA 3TAPA 1X5TA 3CEDA 4DZ6A 4ZVOB 1KD1T 4KR0B 2GQCA 4HH1A 5LXYA 2KZMA 1Q8LA 4UOFA 3HI9A 1U47A 2W9CA 1NB7A 2F7VA 4ZPVR 5A8WA 1J5EF 4JV5J 3R5AA 3AJDA 3CCJS 3CIMA 1NK4A 4DFMA 1TUWA 4IH7A 5C7PA 4DFPA 3VVTA 2EVZA 3NGUA 3S6EA 4LF9F 1U1LA 2XI2A 5HAOA 1G3OA 3CDBA 3H0PA 3UO0A 1NNDA 3IN5A 3DCAA 5AXNA 2EKYA 4RX6A 3S01A 1Q79A 3FBCA 2Q6BA 4LIWA 2ILZA 3S8SA 3N6MA 4O3QA 2QGFB 2X3DA 3AQOA 4LVNP 1T95A 2GVDA 4ED6A 4LVOP 3T5HA 4IRDA 3QSIA 2NQPA 1RXOB 1YZ7A 4MAKA 3KDOA 3X1LB 4HKQA 5C5JA 1B7FA 1NK6A 4DUZJ 2G0CA 4FYXB 4OHVA 4X64F 1UZDA 1I51B 4KGKA 2LEPA 2FGCA 3N28A 4R25A 3MEEB 2G2OA 3R1LA 2LA4A 4WK3A 1K9MT 1KS2A 3ZZ0A 1L3TA 3IXQA 3FQKA 1RYRA 4MYUA 4DV0F 1RCXB 5C2CA 2CIMA 5AXKA 4DV1J 1TKTB 3PV8A 3US5A 3V6DB 3HLUA 3ET6A 4ZP8A 1C1BA 1M5HA 2VH7A 4OHXA 2KVQE 4EUVA 2HHWA 1ZH5A 1Q81T 3JQJA 2IAJA 3ETMA 3M2UA 1TTHB 2DH7A 2JRSA 3BV8A 3R5DA 5ITHA 1CC7A 2Z2YB 4Q2MA 3DRPA 1U1NA 2LQ9A 2V69A 4K50A 4DV3J 4NI2A 4RWWA 3DLGB 4QBUA 3ZZRA 1D9DA 3JAMY 3BO3A 4XIUA 2V8DA 3EVOA 3GILA 1FRHA 3M30A 4DSIA 2ZJQQ 1XNQF 4A46A 3B6BA 1HFEL 1S79A 5IT9U 3PM9A 2ZM6J 2UXBF 2C3UA 1RWVB 4ECXA 4DF4A 2V50A 5LL6d 1REVB 4C8OA 3ZNJ1 2GQ2A 3PJ9A 4ZP7A 2R8HA 1SQEA 1YVFA 2JC1A 1KHWA 1TKDA 1XMBA 4P72A 2WONA 4MIWA 2EPIA 1S6PB 2MZSA 1IKXB 2FLOA 4CH1A 4Y65A 3RBEA 4EI2A 5D0RA 2JHEA 3LOUA 5HN0A 4PCQA 1NJYA 3J80U 2HFVA 4X2BA 2JNJA 2VKRA 4ZCLA 1VBZA 4A47A 8ATCB 1YWXA 3M9NB 3A8IA 5BJRA 5CQGA 5CD4H 3HJFA 1AB8A 4FS1A 3BH7B 2COLA 3HFZB 4ZCIA 1KEKA 4UY85 3NP5A 5CYJA 4E98A 1RHQB 4DSKA 3WHIA 4PG4A 3VAHA 1TL7B 3PHEA 4F3OA 5A2QY 1XNRF 3D1OA 1VRTB 2GQQA 2V4JA 1P8GA 4DL5A 1DBDA 2HNYA 1T02A 4AXJA 1M90T 3H2VE 3N9UC 1U8SA 1TFYA 2UP1A 1LFPA 2DTJA 2YWKA 2QFIA 4J7CA 1B0PA 7FD1A 5ETRA 4Y00A 1RWKB 3GFYA 2RDDA 5K8MA 3FKBA 4B08A 4DX5A 2NXEA 5EGYA 2HVDA 2KHCA 4D3GA 4NYOA 5L1LA 1QVGR 4HACA 3JYTA 2J0SD 2BKNA 4P6QA 4DU7A 4Y0FA 4F4YA 1EZZB 3EDQB 1N52B 2JVOA 3IO1A 1SB6A 3KLGB 2AX1A 1ZTTA 2YKPA 4MKBA 3AOCA 5T41A 1IWGA 3T6BA 4J9SA 1XTZA 3MEGB 2CPXA 2ZH9A 5IQQA 3KLEB 4FN5A 3QQCD 3JB9k 1P6TA 3K0JA 1S1WB 3A3OB 3F44A 3KUEA 3C16B 5CYMB 3S7RA 1C4AA 3D4JA 2MZRA 1FDBA 4B9TA 4JYAJ 5KFHA 2CZVC 2DIVA 2IBOA 2NREA 2PMHA 2AYBA 2DNYA 2LMIA 3PRBA 5EWFA 1RT6A 2CQIA 2HVEA 1XERA 2YXLA 1TKZA 2CRLA 1WC1A 3I0SA 4OX9F 2IBKA 1C4CA 4TU9A 3PJWA 4UOCA 1VBYA 1JLGB 4USKA 2FPHX 5H9EK 4JI2J 1N32J 1VRQC 3HHLB 1IBKF 1T8EA 4ZVQB 1WOOA 4F4KA 2UVVA 4DR1J 4MIBA 4DMZA 4DV7J 2NSBA 1D9FA 3SZ2A 2AT1B 3MM7A 2OFHX 4K59A 3I32A 5KT7A 2Q66A 1S1XB 1EB0A 5DDOC 5FDLA 4DG1B 2VPWB 2ZC3A 2UVUA 1HW9A 3PEHA 3N4WA 4RW8B 4O3SA 2HYIB 3NNAA 4XPEA 1GK8A 3ZZZA 4F4ZA 1KTVA 3BF4A 4QW9A 3EVMA 4DF8A 2Y3YA 5KG2A 1R3NA 1WUUA 3UNGC 3GU0A 5DGAA 1K1SA 1BQNA 4ZVFA 1VLYA 4DV1F 1XWLA 1JLAA 4ZPBA 1YRXA 5K14A 5M2RA 3D0HE 3RR8A 1FK9B 2XMTA 2C2ZB 4JI5J 2EXUA 2RF2A 1SC3B 3ILOA 1WORA 5KFSA 3MMCA 1U0SA 2CWKA 1TV6B 4USUA 5LMUJ 1RAAB 2JEFA 5H9EJ 1HYSA 2QL7B 1RAIB 4C4WA 4LSNB 2ZH5A 2UUCJ 1SKWA 2BMBA 5A6WA 1YKWA 2XMKA 5KG3A 3GR0A 3MPWA 3C6TA 5KFDA 1IR0A 4YFUA 3L09A 4L6V3 1CVJA 3FMBA 3PX6A 4FKXA 3GSDA 4GC6A 1AFJA 1H98A 2RJZA 2GIFA 3THTA 3M8QA 3DLEA 3OT9A 4K4TA 2HAFA 4WFNQ 3KLVA 3I55S 3W60A 2ZM6F 3MM8A 2OMOA 4QU6A 3D1HA 3DLBA 4PXDA 2ZBCA 3UDEA 4NZ7A 2G1HA 2WAQD 2D9PA 1LFWA 1T03A 2R2TA 4UOHA 4ITSA 2CG4A 4ZLPA 2CPHA 1TZ0A 3W9JA 3G96A 2ILYA 1XR5A 4QR2A 2V94A 2LXUA 4J9NA 1G6BA 1QAXA 1JLQA 5F41A 5HBMA 3DMJA 3T9ZA 2WB1D 5D77A 3N5BA 2NS1B 1MROA 4H4MA 1M1GA 2F5GA 1JIHA 3DOLA 2NXNA 2BEFA 4GKKJ 1ELOA 3IMQJ 4D3HA 2GJFA 3B82A 3NMAA 3KG4A 4ILLA 4QWDA 3KJFB 3Q8UA 1T94A 1NSQA 2EFPA 1U0HB 1JXEA 1N34J 4KV8A 3WC2A 3K8WA 3FCWA 4I7FA 1WEXA 1S6QA 5K8NA 5CH7B 1DFDA 4QYRA 5KFBA 4NXNF 2B6AB 3B8HA 1AW0A 3OVSA 3IWLA 3SSRA 3JSBA 2R8IA 3SV4A 4NLOA 4N47A 1F2HA 2NCKL 3TYTA 4QIGA 3BSOA 2XYGB 3SFUA 4ZP9A 3N5FA 4TQSA 4J9VA 1ZETA 1K0TA 3SI8A 2PEBA 3OR2A 3J81Y 3LQVA 2B4PA 3J7Z5 2H1YA 4UT4A 3T1HJ 2QE5A 3WZ0A 2HHVA 3KDNA 3TW0A 1TK8A 3M6UA 3AB4B 3RZAA 3IAM9 4N77A 3D0GE 1UP1A 4H54A 4GMKA 3H8YA 5B0BA 1NB2A 1UWBB 3WIVA 3VWSA 4WE1A 2RT3A 1NDCA 1ZA2B 3Q2TC 4X4PA 4W92B 2GW8A 4BWJA 3MM9A 1WELA 1IN0A 2YNIB 3EXCX 4QPTA 2ROPA 2ABYA 2BKPA 4KKOB 2N4CA 1V5IB 2HQGA 1N5VA 2IDEA 1GQEA 1Q5VA 3MFHA 2VG5B 3SCJE 1WKKA 2M4MA 1Z1ZA 2HQ3A 1Y7PA 3GWCA 1IBLJ 4NWBA 4DLEA 2OI2A 2B43A 3FDSA 4JI2F 1N32F 1HI8A 2FVQA 1V9OA 4PKDB 3D6MB 2F9DA 4ZPWR 4DR1F 3MEEA 3CCRS 4DV7F 1PGZA 5DM6Q 4G1IA 1NCLA 2OJ3A 1DAXA 2AGPA 5C25B 1VQNS 2YQ1A 3KXDA 3KLHB 1E6YA 1DQAA 4K2JA 4TQRA 2MQQA 4DSFA 1TKTA 1N5TA 2GMJA 4Q5VA 1GMWD 3C14B 2MYFA 5BYSA 1B0VA 1QDUB 2QLWA 4IKAA 1Y5LB 2B4VA 2JFKA 5FIIA 3BBFA 3EX7B 4X65J 2J0WA 2P2CB 1EJ7L 2YWEA 2GS8A 2GHWA 3ILJA 4ZJOA 3GG1A 4WFXA 4F2RA 4X84A 2AEMA 1QUVA 3H2UB 1WHXA 2LECA 2BE9B 4NLVA 2IVMA 3ZZYA 4CM0A 2WBRA 2G2YA 1WACA 2ZBQA 4ZJLA 2X1GA 4EZ6A 2FHJA 4DPOA 1WG5A 4R5PB 2ZC4A 4ER8A 3TQ1A 1ULRA 1NDLA 1WHWA 3KFWX 1J2VA 3MWBA 1RDRA 4C11A 4DDFA 1RKJA 2UUCF 4C8LA 1REVA 4U9RA 2FZKB 1G7CB 4I1TA 1M0SA 5E7OB 4L3NA 2V4QA 3KJQB 1S6PA 3G9CA 2MQNA 2IMOA 2ZJRQ 1IWAA 1ZOTA 4A48A 3KJVB 2CPIA 4LR9A 1LW2B 4ECWA 5A8RB 4KH1B 2FD2A 2J9CA 2XQCA 2FB0A 4NMXA 1EKRA 5EDWA 4F3MA 1MMLA 4C3KA 2ZWPA 2CG8A 2OFGX 2YNGB 3LP0B 4FKYA 3KWMA 3P4UB 1V3SA 3HSDA 1RBAA 3OL6A 2HSEB 2IC3A 3LO3A 4OYZA 2XMJA 4DR5J 4QJVA 5IWAJ 2JZ5A 2LYVA 2HHUA 4NZ6A 1N48A 3QJJA 3Q8QB 4DSJA 5AXLA 3CCMS 1TL7A 2CPFA 4DCJB 4LMZA 2YWGA 3GYGA 3H42A 1R43A 3ELHA 2E1PA 3R8YA 4F50A 4WXOA 3VGUA 1NHKL 2DGVA 3GCWP 1DLOB 2RE1A 3Q8RB 2XSFA 3KNGA 1TK5A 2DR6A 4GKKF 1FD2A 1S10A 3GJTB 4UQTA 3KK2B 4DPYA 5MLCV 4OIXA 3IS9A 3BS9A 2WB4A 3AFGA 2PN6A 1S1VB 2Z4PA 4ZK7M 3BBCA 5KFPA 2HQFA 5D8HB 4ANDA 2W9BA 5KFWA 5AT1B 2FHMA 1PAEX 3FSYA 3MUTP 4OI3A 1PC5A 2A0FB 3MEGA 2VONA 3UDCA 1K0VA 4IFVB 1I5OB 4EYIB 5M2UA 5KFZA 3BDEA 2G13A 2LVWA 2XHWA 4UOGA 3KLEA 2HHTA 1S1WA 2IIHA 2ZDOA 3C16A 5LJ3Y 3PKMA 5EX0A 5CYMA 4O0IA 1B4SA 3LP2A 2OPQB 3V6HA 2DRDA 5ETNA 1EKSA 3DXSX 1AYEA 2HZVA 2GC8A 4RUHA 1B70B 3BO4A 1SL0A 3W61A 3F41A 2BQUA 4LF5F 3HVAA 2DNRA 1KQKA 2MQ8A 3QLHA 2B4UA 1RWUA 1AZSB 4UUWA 1KFDA 4CI0B 2CFXA 5CYQB 2HHXA 1QLNA 2RB7A 5KFYA 3HHLA 3MF5A 3RRGA 4QPXA 2L9WA 2VICA 3NWRA 4FXDA 4H4KC 1RU1A 3WX8A 3NG8A 2GHVC 4DL3A 2PO4A 3EZOA 4OYBA 3GLJA 2BKOA 1RT5B 3D28A 2VPZB 4B3RF 4K4YA 2EBGA 1FDNA 2FY1A 3BGUA 3VR1A 3LAKA 2ZZMA 1S1XA 1N5YB 4PYDA 4KIAA 4C0OC 1BGXT 3KG1A 1Y5IB 1NBEB 1HI1A 2KFYA 5L39A 2R7VA 3PX0A 3RW6A 2U2FA 1IBLF 4K4VA 1L3SA 5DZ6A 3UD5A 4CH7A 4DUYJ 3THVA 4OZ2A 2YNHB 3MOZA 3Q86A 4ECVA 3E2EA 1RAFB 2DHGA 1XMOJ 2LDYA 1YJTA 4IFYB 4RW4B 1R89A 3TZZA 4PQUB 4N56A 3CUNA 5J2MA 1C1CA 2H5IB 1U1QA 4RWXA 2EC0A 2MHNA 3T19A 2W2NP 1T3OA 1FK9A 3BSAA 2C2OB 5CXTA 4P75A 4X65F 3CB4A 2R42A 3AXKA 1RE1B 2J7UA 1DQ9A 4TNOA 1QE1B 4Y6IA 1S12A 4X4RA 2VBXA 1TV6A 1ZYQA 4KY3A 2DNPA 2WRMA 4DL0C 1TVRB 2QRRA 1W2BR 3DU5A 3BGLA 3FEXB 1X4HA 3SV3A 4LSNA 4HTIA 2ASLA 5KFTA 4F0HA 2MLXA 4W98A 1IR1A 5GAEU 2KVIA 2JFDA 3MFIA 1FRIA 2AJ2A 2DHSA 3PVXA 5KG6A 1YK9A 4M1KA 1UKUA 3NBPB 4GVBB 4IR1A 4I4BA 1WTBA 3DLKB 4QR0A 1HI0P 4KGVB 3G71S 2IRYA 2YY3A 2N7YA 4FDFA 3TVZA 1YBAA 4OI4A 5A0YB 2ZBPA 3GB0A 4I67A 2W7OA 1NHVA 2AYGA 2EI5A 2DNZA 1GX6A 2ROEA 3PXGa 1JJHA 4J9OA 4DXLA 2A2CA 2PD1A 3FZBA 5CD4A 1OJ4A 2KZZA 1ZM2A 1A0OB 3Q23A 1VHIA 3KHGA 4NCGB 2Y0SD 1UWAA 3K5MA 1LW0A 1W26A 2MKSA 2C2RA 1DJ0A 4PXCA 1S9GB 1YGYA 1FJCA 4K4ZA 3W5ZA 4A8YA 3ZZPA 3GCXP 5BYQA 2RRNA 2DH9A 4WJBA 4ZLLA 1T11A 3H98A 4LFCJ 2L9NA 4KYZA 2E29A 1WKJA 3VAJA 2F9JA 4J9UE 4M5GA 4PXBA 2BQRA 4B9NA 1UETA 4X66F 2IHR1 5ETMA 1PCAA 1WSVA 4YEAA 2OP5A 3LTOA 1U0HA 2M52A 3DOMB 1C0UB 2WVFA 1GEHA 3TA0A 3BREA 1RK8A 1R8HA 1JKHB 3PW7A 1XBWA 1T9UA 5ETOA 3W3SA 3MAHA 3Q89A 2K7KA 3RW7A 1TP7A 2IM0A 2M2BA 4DR3F 1BQMB 4LF7F 2DH8A 2KU7A 3MAAA 5G4DA 4RW9A 2R7UA 5H9FK 5B0CA 1WDTA 1K44A 4ZHRB 1N5QA 2XWXA 1FJGJ 1OIAA 3FCVA 4NYPA 1BE4A 4PAAA 2MZ1A 5KT5A 2EFOA 2HBYB 1MWYA 3NOGA 4CLFA 1F1BB 1WWHA 1TMMA 4N41A 3QZ7A 1P27B 3L7UA 4R0EA 2YNFB 5LT5A 2O01C 2GX8A 4LF4J 2WVDA 4PPZA 4CO1A 4WZMA 1Y4ZB 4URSA 4DOZA 2QA4S 5HROA 3EYZA 4Z37A 4RBVA 1UWBA 1H7WA 1HNIA 1NM2A 2FJEB 3FSIA 4IG3B 3LGHA 3MCSA 3U7JA 2BOPA 3JSYA 2JJ4D 2IY5B 2YNIA 3MEDB 4OYWA 1RACB 3TVYA 1GH8A 2J76E 1U25A 4ZJQA 1RTJB 1HARA 1VJQA 5CHCB 1RHJB 5JJBA 3DI6B 1DRZA 5J2QA 5D4NA 2ACYA 2BJDA 2VDHA 3GR1A 2DNHA 2QLBB 4CLPA 5H9FJ 5CABA 2EBEA 1PBUA 1Z4UA 3OUYB 2A3JA 2DRBA 2AHOB 5HP1A 4USIA 3TX0A 3G6XA 3KLHA 1FJ7A 1FKOA 2ZH6A 1GTHA 5EN1A 3M05A 4ZA1A 1H2VZ 1TUVA 2H48B 3C14A 2W7PA 1VQ5S 4J9KA 3P6YC 3KLFB 4LF8J 2C3PA 3FBFA 4HI1A 3D67A 1KN6A 2HHHF 4RUCA 1FKAF 4DUYF 1DY3A 4KO0B 3AAWB 1JB0C 4PWUA 3W8PA 2XY7A 1OO0B 2L08A 3NRBA 4QWAA 1XQIA 5L1KA 2PIIA 4A8OA 5I3UB 4F02A 4Y28C 3K2YA 2R2UA 3ENQA 2GFFA 2IVFB 1JLFB 1S0MA 3BYRA 3C19A 4KHPJ 1HPZB 3BO2A 1IR2A 2UUAF 1CJKB 3H5UA 3NGSA 1J5OB 5LSOA 2Z2ZA 3QT8A 4YB1P 3Q22A 1RTZA 1FWKA 3UFCX 2NYHA 4QCLA 4M5LA 4PRFA 2R2RA 1RU2A 3V6KA 1UVIA 2DCUB 4L74A 4A8KA 1GNKA 3EGNA 1T7PA 2HZCA 2PE8A 3SEOA 1JJ2R 2V6AA 4YN3B 6AT1B 4C48A 2H4YB 2J8AA 1T0TV 3EPGA 3FRYA 4NA3A 3CCSS 2NXJA 1Q7LB 4DS5A 5A8RA 3MEKA 2YKAA 3RGIA 2XI3A 4NA1A 3W65A 2XG8A 2PA8D 1VHFA 4DV6J 2XMAA 2YNGA 3IBCB 3LP0A 1YQHA 2Q79A 3NGTA 4DU8A 3KOAA 2FJXA 4U7CA 3D66A 3WQPA 2PDAA 3TZYA 3R5BA 2BRKA 1W2IA 1T9WA 3VGSA 4AQYJ 3HULA 3JQMA 4I2QB 1HBOB 3OHBA 2HK3A 3CJ5A 3I87A 1RT3B 2J6TA 3CC7S 3PIOQ 1RA6A 3ZTOA 3W66A
chains in the Genus database with same CATH topology
1RWPB 3R7BB 4DCOB 1RWVB 1RWXB 2CJYB 2CNOB 2XYHB 3P45B 2QLJB 1RHUB 3KJFB 1ICEB 3D6FB 1RWMB 2H48B 2CDRB 2HBQB 1NMEB 2H4YB 1QDUB 1RWKB 2C1EB 3KJQB 1RHKB 3GJTB 2HBZB 2H51B 3SIPB 2CNLB 2CJXB 4ZVSB 2H5IB 3R5JB 1RWNB 3R6GB 4LSZB 2H4WB 2XZDB 1I3OB 1SC4B 3EDRB 3QNWB 2H65B 5IC6B 1IBCB 2P2CB 4ZVRB 4JB8B 3EDQB 2C2ZB 5IC4B 1SC3B 1BMQB 3IBCB 2C2OB 3KJNB 3P4UB 1RWOB 2Y1LB 1SC1B 2FQQB 1RE1B 4ZVUB 1PYOB 2CNNB 3D6HB 1RWWB 1RHRB 4ZVQB 4ZVPB 2XYGB 1QTNB 2XYPB 1F9EB 1RHJB 2Y0BB 4ZVTB 1GFWB 2C2KB 2QL5B 3NS7B 3GJSB 2QL7B 4ZVOB 5K20B 3RJMB 1RHQB 2H5JB 2DKOB 2QLBB 3GJRB 1PAUB 1RHMB 1I51B 2HBYB 3IBFB 3D6MB 2HBRB 4DCJB 3R7SB 3GJQB 4DCPB 2QL9B 3R7NB 2CNKB 3R6LB 2QLFB 2H54B 2XZTB 2C2MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RWP B;  3R7B B;  4DCO B;  1RWV B;  1RWX B;  2CJY B;  2CNO B;  2XYH B;  3P45 B;  2QLJ B;  1RHU B;  3KJF B;  1ICE B;  3D6F B;  1RWM B;  2H48 B;  2CDR B;  2HBQ B;  1NME B;  2H4Y B;  1QDU B;  1RWK B;  2C1E B;  3KJQ B;  1RHK B;  3GJT B;  2HBZ B;  2H51 B;  3SIP B;  2CNL B;  2CJX B;  4ZVS B;  2H5I B;  3R5J B;  1RWN B;  3R6G B;  4LSZ B;  2H4W B;  2XZD B;  1I3O B;  1SC4 B;  3EDR B;  3QNW B;  2H65 B;  5IC6 B;  1IBC B;  2P2C B;  4ZVR B;  4JB8 B;  3EDQ B;  2C2Z B;  5IC4 B;  1SC3 B;  1BMQ B;  3IBC B;  2C2O B;  3KJN B;  3P4U B;  1RWO B;  2Y1L B;  1SC1 B;  2FQQ B;  1RE1 B;  4ZVU B;  1PYO B;  2CNN B;  3D6H B;  1RWW B;  1RHR B;  4ZVQ B;  4ZVP B;  2XYG B;  1QTN B;  2XYP B;  1F9E B;  1RHJ B;  2Y0B B;  4ZVT B;  1GFW B;  2C2K B;  2QL5 B;  3NS7 B;  3GJS B;  2QL7 B;  4ZVO B;  5K20 B;  3RJM B;  1RHQ B;  2H5J B;  2DKO B;  2QLB B;  3GJR B;  1PAU B;  1RHM B;  1I51 B;  2HBY B;  3IBF B;  3D6M B;  2HBR B;  4DCJ B;  3R7S B;  3GJQ B;  4DCP B;  2QL9 B;  3R7N B;  2CNK B;  3R6L B;  2QLF B;  2H54 B;  2XZT B;  2C2M B; 
#chains in the Genus database with same CATH topology
 3FZ2 A;  2BJ3 A;  5GMD A;  1AUS L;  3UI3 A;  1OSD A;  2FGO A;  3U1N A;  2IYG A;  4NLS A;  2UUB J;  3JQK A;  2DEJ A;  2N4D A;  2R4F A;  2QSW A;  3JTO A;  1DLO A;  1VGY A;  3D6F B;  2YX7 A;  2HBQ B;  3BKU A;  2V4R A;  3TUJ C;  2CQB A;  1LWF B;  4IO1 A;  3KK2 A;  2BE7 D;  1I94 J;  2RUG A;  4KFB B;  1WOS A;  2FHO B;  1BWV A;  2UUT A;  2ZKT A;  2JL9 A;  3EDR B;  4Q8F A;  1G2E A;  2HVI A;  1RT1 B;  2X1A A;  3FVY A;  1S1V A;  1W7W A;  5B0F A;  1FE0 A;  1F3V A;  9ATC B;  2ZHA A;  4JOU A;  1RWO B;  4XAK A;  1VCT A;  4JI4 J;  1IKV B;  1Q16 B;  1QAY A;  4FVC A;  3OHA A;  4OI0 A;  3NS7 B;  1TEL A;  3MMA B;  1S57 A;  4O3N A;  1L3V A;  1S4E A;  5L38 A;  4LQ9 A;  4DL7 A;  3W9I A;  3G82 B;  2QJ3 A;  1APS A;  3ZTP A;  2QT7 A;  4OZJ A;  1UEK A;  2OPQ A;  2VFS A;  4A8W A;  4YHH J;  2YWH A;  3RRK A;  2UV8 G;  4YQW A;  1KFS A;  2U1A A;  4MKY A;  3FBB A;  3IBW A;  8RUC A;  2NXU A;  4NLW A;  3VF0 B;  3GV5 B;  3LGM A;  4U6P A;  2MB0 B;  2KYX A;  3J7A N;  1MLA A;  1NSP A;  3SQO P;  1MWZ A;  2IFX A;  3WC0 A;  4LF4 F;  2H4W B;  4P71 A;  3JSM B;  2ASY A;  5D0G A;  4B9V A;  1AZS A;  4PWW A;  3I82 A;  3GII A;  1D1U A;  4WP8 A;  5CYQ A;  2PFD A;  3VTI A;  2MSS A;  2J5A A;  1PJ7 A;  3TJ8 A;  2VPY B;  1T9V A;  1LKZ A;  3BGF A;  4MFB B;  3HF5 A;  1DZ5 A;  1RT5 A;  1Y3J A;  1ZZN A;  2AJ4 A;  4IH6 A;  4NZ0 A;  2YKM B;  2MKI A;  5HMW A;  4NLT A;  1NH8 A;  2XEX A;  4U7U D;  1WJ9 A;  4DV4 J;  4OHY A;  1N5Y A;  1JLE B;  2QSF A;  2V63 A;  1PBA A;  3D9B A;  4EBE A;  2OH2 A;  3B4M A;  2HFN A;  4OZ5 A;  4NX9 A;  4UST A;  1QD1 A;  3QT7 A;  3HVT B;  4FF3 A;  2YNH A;  3HK2 A;  4EZ9 A;  4Q43 A;  2W2Q P;  2VQE F;  4RW4 A;  1B0T A;  3HMJ G;  2Q1L A;  5DLG A;  4WFZ A;  4I6Y A;  3SFG A;  1FKP B;  1VFJ A;  4MMO A;  1HBU B;  2GHP A;  4LT6 A;  2FHJ D;  2AW0 A;  2Z30 B;  4G65 A;  2ZBR A;  4ICL A;  3HZE A;  1Y00 A;  4W4M A;  3MUV P;  4LF8 F;  4PAB A;  4DV2 J;  1KSP A;  4OV6 A;  5A76 A;  3A8K A;  4M95 A;  1ZM9 A;  4I56 A;  2GA7 A;  1CEZ A;  4ZVU B;  2KXN B;  1QE1 A;  3BQ1 A;  1FRK A;  2CPJ A;  4L72 B;  2E9Z A;  2Z8Q A;  1KON A;  1D9A A;  5JVG Q;  1TVR A;  2HEK A;  3V81 A;  1TL1 A;  3ZC4 A;  1JJ4 A;  4IG0 A;  5F8L A;  4WF9 Q;  3O1L A;  4KHP F;  1UJ6 A;  3GQC A;  2AJF E;  3TZX A;  2VFU A;  5CCL A;  4F0K A;  4IDK A;  1H7X A;  3TJ9 A;  4JI8 J;  1U26 A;  4USJ C;  4X62 J;  4XO0 A;  2JEI A;  1NZ8 A;  4NLQ A;  1LQ9 A;  3MD3 A;  4Z2X A;  3NBP A;  4GVB A;  4EBD A;  2R8J A;  4LUB A;  2ZNY A;  3CO9 A;  3IA0 A;  1S4F A;  3OVB A;  2A2D A;  3FFI B;  2ZD1 B;  1SPB P;  3PHT A;  2ZKU A;  4CZC A;  4J90 A;  2OTL S;  3AHP A;  4O3P A;  2D69 A;  4C97 A;  2DR5 A;  3F73 A;  4C0H A;  2F40 A;  1LOU A;  3RTV A;  2CJQ A;  1FDD A;  5K8O A;  1FTR A;  1R8A A;  4M5K A;  5IFM A;  1RAE B;  1U1R A;  3W1Y C;  3PFE A;  1CSJ A;  2W2P P;  4CYU B;  2M9K A;  4DV6 F;  4TU7 A;  2R2S A;  3CW2 C;  3NWG A;  4ERD A;  5FD1 A;  1M1H A;  1ZM3 A;  3BQ0 A;  2DT9 A;  1IVZ A;  1U1M A;  1RTD A;  1EX8 A;  3NGR A;  2MKK A;  1KOO A;  4RBT A;  1D8Z A;  1HWK A;  1JNZ B;  1T05 B;  2AX0 A;  3CJS A;  4WBF A;  2E1M C;  2XYH B;  3UW1 A;  2APO A;  4OV1 A;  4OZ3 A;  1A6L A;  2Q43 A;  4FYW B;  1R0B G;  1RCO B;  4RW7 B;  5LOQ A;  3G4S S;  3H25 A;  4QIV A;  4XTT A;  3M9M B;  3ISN D;  3J7Y I;  4IO9 Q;  4HI2 A;  5DZ7 A;  4USV A;  1C0U A;  2VOD A;  3OQ2 A;  1CQN A;  3C46 A;  5A2Q U;  3CJ2 A;  1HNZ J;  1KP6 A;  3QNW B;  3W2V B;  1U24 A;  4ECZ A;  1RLD A;  2OUG A;  3K58 A;  1NHU A;  5G0R B;  1IKY B;  1TU0 B;  4DR6 J;  2B51 A;  4CNY A;  4NRU A;  2BAN B;  1F9F A;  1Y5N B;  3DM2 B;  2RSQ A;  3LP1 B;  1Q53 A;  4YR3 A;  4IH5 A;  3CCL S;  4NXM J;  4ECQ A;  1CLF A;  4CQ1 A;  1HHQ A;  3W8G A;  4B3S J;  3GP9 A;  3Q8V A;  4LF6 J;  3C66 A;  5D4P A;  1NKE A;  3NGD A;  5U47 A;  1OPZ A;  4JI4 F;  3VAI A;  3H5S A;  5GAG U;  1E6V B;  4TYA A;  4FNI A;  1FT8 A;  1S7H A;  2YNF A;  1GXT A;  1REG X;  2HRU A;  4ZKA A;  3TP2 A;  3D2W A;  2B9X A;  5IQ6 A;  2C28 A;  1RB0 A;  3LW5 C;  3KTQ A;  2YX4 A;  2K06 A;  2HLT A;  3O44 A;  1TMJ A;  3HFV A;  2FVR A;  1KHV A;  1H6K X;  3IWN C;  5B0E A;  5J1E B;  5KFA A;  2EFG A;  2H51 B;  3SIP B;  4CO5 A;  2E5I A;  2F8M A;  2ZOM A;  5DJB A;  4IG3 A;  3EWG A;  5I3P A;  2KB2 A;  3NS5 A;  2DY1 A;  3MED A;  4Y3C A;  3O8W A;  4OLP A;  5FLX Y;  4A4J A;  1NK7 A;  2XO7 A;  2DK2 A;  1RTJ A;  5AE2 A;  2LQJ A;  4RR5 A;  3SBM A;  2G0I A;  2FZC B;  2F3J A;  2YQ0 A;  5LXR A;  3DI6 A;  4UZC A;  2W4D A;  2H5J B;  2LQ5 A;  1HMV A;  1O8B A;  4CM2 A;  5KFL A;  3DYA B;  2DR8 A;  3UDV A;  3OUY A;  2YKQ A;  1LXN A;  5CZX A;  3UNY A;  3QGG A;  3CF5 Q;  3DFE A;  2VFR A;  2RKI B;  3R2D J;  2R7Q A;  2D3Z A;  3FQL A;  4DV4 F;  1J27 A;  1RAJ A;  3MGJ A;  4DS4 A;  2CDR B;  4LJM A;  3NKY A;  3KLF A;  2AP6 A;  4ZLN A;  2PI5 A;  2FHK A;  2LQB A;  3BQ2 A;  4N76 A;  2PMW A;  1YJN S;  4AUK A;  3R5J B;  3KHL A;  3LH2 S;  3M7V A;  2XZD B;  1S9E B;  2G1D A;  3TVK A;  5BYR A;  2VG6 B;  2DEI A;  2NR0 A;  5I3U A;  2VD3 A;  2BUN A;  2KG1 A;  1VQO S;  3TEG A;  4ZN1 A;  1UEV A;  1MU2 B;  1JLF A;  4P2S A;  3FMW A;  3IR7 B;  1HPZ A;  1CJK A;  2X1F A;  4ED7 A;  3KK1 B;  3PR4 A;  2RDJ A;  1J5O A;  4ZVG A;  2BBE A;  3Q8Y A;  1M5S A;  2DR7 A;  2RIJ A;  5DDP C;  2HRY A;  2HVZ A;  2EK1 A;  2NXC A;  2QG9 B;  1RAH B;  3EZ5 A;  2V8P A;  1BWE A;  2G2Z A;  2MHE A;  1JJC B;  4HHU A;  1LWC A;  3E3X A;  4HR2 A;  1HQE B;  3D6T B;  1SV5 B;  5KFR A;  2D7S A;  1QSS A;  2J0Q D;  5AJ3 F;  3I56 S;  4B9S A;  2VIH A;  2AV5 A;  3G8T A;  2VC0 A;  2C2D A;  3M4X A;  4NOH A;  2XNR A;  3EIC A;  4PPD A;  1SJ3 P;  3NOC A;  5HK4 A;  4UW2 A;  4X62 F;  2BJE A;  3UE2 A;  3DDK A;  2MKC A;  1WF1 A;  3G87 A;  2D74 B;  5ETQ A;  3RB0 A;  4P10 A;  2XSJ B;  1PJ6 A;  2DGS A;  2ASJ A;  4J9Q A;  2DNO A;  4OZL A;  1WHY A;  1NO8 A;  1WDD A;  3PYF A;  3R97 A;  4IRK A;  3PIP Q;  1L3K A;  3V5R A;  1FRL A;  3CCE S;  3Q8P B;  1CS4 B;  1PSD A;  4E0D A;  4I2Q A;  2DNN A;  1WOP A;  2B5J B;  3LAM A;  1HBO A;  2EW9 A;  2OSQ A;  1VI7 A;  3J7Z T;  4YP3 A;  3RRH A;  2ZIT A;  3MR2 A;  3E01 B;  4NL5 A;  3K59 A;  1RAG B;  2E9T A;  4OX6 A;  1Q8I A;  1UJ5 A;  1FXL A;  4PR6 A;  2MEW A;  3T1Y J;  1PYT A;  4LBI A;  3MOJ B;  2ZH7 A;  2OML A;  2BR0 A;  2CPY A;  1HNX F;  4OYA A;  3KMQ A;  3IP0 A;  1VR6 A;  4MKV A;  4M5J A;  1LWF A;  4BC7 A;  3QRR A;  3DKD A;  4ECU A;  2N82 B;  1HNW J;  3AOB A;  4BBY A;  1R7I A;  5IZH A;  4JI7 J;  2G4B A;  1D0E A;  2A6O A;  3HX9 A;  2QA4 G;  2MZT A;  2KKH A;  3S1T A;  4FYY B;  4MTP A;  1HQU B;  2PSZ A;  3SSQ A;  5K8P A;  1IKV A;  4H4O A;  2FYX A;  1RAO A;  4ZVT B;  1FES A;  1NLK L;  4DR6 F;  4JV0 A;  3IC1 A;  3T6J A;  1KDN A;  4O4G A;  4DPX A;  1Q95 G;  5D15 A;  3G82 A;  3PR5 B;  4LFB J;  1NPR A;  1S72 S;  4NLD A;  2KJW A;  2EG1 A;  4B3S F;  2CDQ A;  4ZCK A;  4NLG A;  2W2O P;  2I5J B;  4LF6 F;  1B64 A;  5L9N A;  3ZZU A;  3VVU A;  4V19 X;  2OPR B;  4K8R A;  3M2V B;  3MM6 B;  1RHU B;  2CPE A;  2M8D B;  1URR A;  4BLG A;  1LEO A;  2W2M P;  3ILL A;  2KDO A;  2RS2 A;  1FEE A;  2DD8 S;  4NLP A;  1PJ5 A;  4GVL A;  3GFZ A;  1UAW A;  5L1I A;  1NZA A;  3Q83 A;  9RUB A;  3TOQ A;  1U2F A;  1IXK A;  2JVR A;  1F6T A;  3OV7 A;  3JSM A;  3R5G A;  3BGR A;  2B4O A;  3ISZ A;  5KG5 A;  1X9W A;  1LWE B;  4CP5 A;  5B7W A;  5BR8 F;  3DDN A;  1U6B A;  1S9F A;  2KXH A;  3K57 A;  4NE9 C;  1HQ2 A;  4P2X A;  3SQG A;  4JI3 J;  1N33 J;  2VA2 A;  2GCF A;  3CME S;  4AFF A;  5KFU A;  4HT7 A;  3WDO A;  2BJ9 A;  2KXF A;  3EE3 A;  3AD7 C;  2YKM A;  2HS0 A;  2DXF A;  3GFH A;  1YTY A;  2QL9 B;  4B3T J;  1JLE A;  4WPA A;  4U7U K;  3HSZ A;  2KM8 B;  1SH3 A;  3CWJ A;  3ENW A;  3MEC B;  2B0G A;  2EFN A;  1SH2 A;  5KFI A;  1AFI A;  1X4F A;  2XLI A;  3RB3 A;  4LQ3 A;  2MZQ A;  5HVG A;  2MJU A;  3RUB L;  1KVJ A;  3T3F A;  3DRS B;  1ZAV A;  1SQF A;  3I5A A;  5A8W B;  1NK9 A;  1NXI A;  3I5C A;  4ED8 A;  1FKP A;  2UXD J;  3POT B;  1QJH A;  2CJX B;  1MNE A;  2RQK A;  4HT5 A;  4DJB A;  4OJ1 A;  3GFX A;  3CPW R;  4ED3 A;  3AD8 C;  7FDR A;  5B08 A;  3MMJ A;  1ACM B;  1VS3 A;  3BKT A;  3G2X A;  2QMW A;  2D3U A;  3QSY B;  4ZPA A;  2P5V A;  3B78 A;  4KH0 B;  2XC9 A;  2OTJ S;  1KTQ A;  4ZIV A;  1AT1 B;  1VLO A;  1MN7 A;  1DQ8 A;  3DRX A;  3ONQ A;  3SDE B;  3PJX A;  5GME A;  5HAN A;  1FFS B;  1WKL A;  4ENO A;  2DGT A;  3HD2 A;  4HLB A;  3NXZ A;  3HM9 A;  3GMG A;  2ATC B;  1N0U A;  1HWJ A;  5C42 B;  3IGV A;  3QRQ A;  1XR6 A;  3BZQ A;  3U02 A;  1CJT A;  3UD3 P;  5J2N B;  4AD6 A;  1JK9 B;  2J9D E;  2IRU A;  3FJ2 A;  4J91 A;  3W5Y A;  3L3C A;  1ZS6 A;  2O66 A;  4UUX A;  3FFI A;  2XMM A;  1V3R A;  3UN3 A;  3QZ8 A;  2F4V J;  2LKZ A;  1JLC B;  3DC2 A;  2YKN B;  4WCE Q;  2X1B A;  1R6Y A;  4BDP A;  5F9N A;  1WEZ A;  3VQT A;  1FXD A;  1VQ9 S;  3SCL E;  1C1B B;  2KI2 A;  4WII A;  1GMV A;  4NAS A;  2QYC A;  4DQS A;  3LWL A;  5HVH A;  4LBH A;  3K5P A;  3IR5 B;  4JUZ A;  4CYU A;  5JUM A;  3LGN A;  1GFW B;  2ZFH A;  3BH6 B;  2OSR A;  2HWI A;  5HMZ A;  2N3O A;  4I6A A;  2EEY A;  2VBY A;  3DRP B;  4WYW A;  1FFG B;  1CJV B;  1K47 A;  3NCP A;  1S1T B;  1NKB A;  3PZP A;  1RT7 A;  2DYA A;  4JV5 F;  1RJJ A;  1P1T A;  2V8G A;  4DR2 J;  1R0A B;  5F3Z A;  4OI2 A;  1T05 A;  3H20 A;  3I9V 9;  4F4A A;  3FSX A;  3OW2 R;  3W64 A;  1F2G A;  1X4D A;  3H59 A;  1WI8 A;  2VDI A;  4C6A A;  5BXI A;  3NY0 A;  1H0H B;  5ETP A;  4LIR A;  1RHK B;  1FXR A;  3OXF A;  3RB6 A;  4KB7 A;  1Z2L A;  3DRR B;  2W25 A;  4B9M A;  1MMN A;  5KG1 A;  3T1Y F;  3M8P A;  1P9Y A;  3OTD A;  4WFY A;  5L46 A;  2V8V A;  3GIM A;  3BN7 A;  1BHN A;  3HT0 A;  3W2W A;  5G0R A;  3GTY X;  1RTH A;  2FTR A;  2VL1 A;  4WP3 A;  3G6V A;  1TL5 A;  4P9S A;  3QO9 B;  1HNW F;  1UJ4 A;  2BAN A;  3M2R B;  3BEG B;  3DM2 A;  1O51 A;  5ETV A;  5GAH U;  3QAE A;  2JX2 A;  3LP1 A;  1U1O A;  2IA6 A;  1FWL A;  1H2U X;  2BZ2 A;  4JI7 F;  2XYP B;  3A8E A;  4GRS A;  2WW4 A;  2DGQ A;  3I4H X;  1SJ1 A;  2DBB A;  2RQM A;  4DUZ F;  4M8L A;  1PIE A;  3MPY A;  2VU5 A;  3A8J A;  2HGL A;  1IKW B;  1YHQ S;  4Y2A A;  4TVA B;  2V8H A;  3UR0 A;  2DXE A;  2CQP A;  2DGU A;  3EXY A;  5KG0 A;  1N6Q A;  2B9W A;  1WC4 A;  5ETL A;  2XO6 A;  2DNK A;  1YJV A;  4YB5 A;  5IV3 A;  2DNG A;  3RAX A;  5DET A;  4X4Q A;  3C6U B;  5J1E A;  1RZM A;  3IAS 9;  4OFZ A;  1X31 C;  3I4P A;  2WSF C;  3BJY A;  2ZH2 A;  3VZI A;  4UTG A;  2KG0 A;  5D4L A;  2C42 A;  2WVB A;  2B8Q A;  2DHA A;  2VHG A;  4A8S A;  1WI6 A;  4HAC B;  4DV3 F;  4F4W A;  1W25 A;  1R8C A;  4OYO A;  4TY9 A;  3PW5 A;  3UN5 A;  1V6H A;  2RU3 A;  1UMJ A;  1WF0 A;  2DKO B;  1RUS A;  3EPI A;  1U1P A;  1U4B A;  4PQA A;  3OFH A;  1SUQ B;  2AYM A;  4FPR A;  4IUF A;  2DHH A;  3HHK A;  2RS8 A;  4K4X A;  4JI3 F;  1N33 F;  4DPU A;  4GO5 X;  5GVQ A;  2JDJ A;  3CJ4 A;  3QT5 A;  2RKI A;  3FCH A;  2JEG A;  1WG4 A;  1S0V A;  4XDC A;  3TR5 A;  5KFC A;  1DUR A;  4F0M A;  3NL0 A;  2UV8 A;  1SKU B;  5D4O A;  1B3T A;  2JWN A;  3C8Y A;  1WF2 A;  2MMY A;  4LR8 A;  2MKY A;  1F3F A;  3CJ0 A;  2CAJ A;  2Y1I A;  3RU0 A;  4ED0 A;  4F8R A;  1S9E A;  2HS4 A;  3ZFV A;  5JVH Q;  4JV1 A;  1RT6 B;  4RW6 B;  1H73 A;  4JB8 B;  2NZC A;  2NUU G;  2IM2 A;  1BY9 A;  1YJW S;  1A7G E;  4ID8 A;  1EAR A;  5KFV A;  4FNH A;  2FQQ B;  1DTT A;  2Q6C A;  2W8L A;  2K1R A;  1NKC A;  3KK1 A;  1EQM A;  1Y3K A;  3RG6 A;  1FTC A;  1SXL A;  2P6S A;  4LRF A;  2E5H A;  2ZVS A;  3PG9 A;  2PA3 A;  6FD1 A;  4EBC A;  4X64 J;  4FXW A;  2V0N A;  4ED4 A;  1VK3 A;  4ZPC A;  4PG6 A;  4RO0 A;  1HQE A;  3MM7 B;  4WWS A;  3IR6 B;  5JMN A;  2L3M A;  1RI7 A;  4N5S A;  4RL1 A;  4DV0 J;  2D1C A;  4B3O B;  2I0X A;  4ES2 A;  5EHH A;  1S5Z A;  3DOK B;  5FDL B;  2GAG C;  2R7R A;  3C3L A;  1OS5 A;  2KRR A;  1QAI A;  3IWX A;  1RBL A;  1HWI A;  1SH0 A;  2WSC C;  1SIW B;  2IM3 A;  2AIR B;  1HR0 J;  3DGV A;  2P6T A;  2QV6 A;  2XSJ A;  2A10 A;  4X4V A;  2F8H A;  4HDH A;  2NUH A;  2M70 A;  3BDP A;  1QSY A;  4UZB A;  5DG8 A;  5CZV A;  3FEY B;  5IM0 B;  5K14 B;  3HSJ A;  1SCJ B;  4G1Q B;  1FNX H;  4F3Q A;  2V5H G;  2CQ2 A;  2B5J A;  2JH3 A;  3MMC B;  3IG1 B;  4L73 A;  1GXU A;  1MN9 A;  3WBZ A;  1UA0 A;  5GAD I;  1XN9 A;  3EUN A;  1UPM B;  2OEK A;  4P74 A;  1NEE A;  3A3P B;  3QJL A;  3E01 A;  4JYA F;  3W7B A;  1HYS B;  1GMW A;  3CJT A;  1VC0 A;  5DM7 Q;  2CPZ A;  5A6P A;  2M88 A;  2ZEJ A;  3QGH A;  6FDR A;  1VBX A;  2ROG A;  2KT3 A;  2QA2 A;  4FF1 A;  4OZ1 A;  3T5L A;  2WCX A;  2Y9H A;  3OR1 B;  4CDI A;  2XMU A;  3C6T B;  3CDA A;  1EQ0 A;  4DR2 F;  4QIW D;  3EM1 A;  5C24 B;  3MTK A;  2HAI A;  3KLI B;  3M8Q B;  2YPY A;  3TUI C;  2CJA A;  2CQD A;  4C98 A;  4PWD B;  2AJQ A;  3MM8 B;  1D8Y A;  3I96 A;  4PG7 A;  1VIS A;  2OD6 A;  3K17 A;  2FVC A;  2NSC A;  1AA1 B;  4V1A k;  2OEM A;  5HMX A;  2ZVI A;  4Q0B B;  2N3L A;  1T03 B;  4WKY A;  1WC0 A;  4JP8 A;  4J9R A;  1BLU A;  3D54 A;  3V6D A;  3AOD A;  1XNR J;  1X0F A;  3AQP A;  5ETT A;  1JLQ B;  1VQK S;  1T9Y A;  3H40 A;  4ED2 A;  3P45 B;  3KNA A;  3HHD A;  3DDI A;  3O6Q A;  2OPR A;  3M2V A;  3MM6 A;  2GAH C;  3J81 j;  4RPF A;  2RRA A;  3U1M A;  2V2Q A;  2KFN A;  5J1N A;  5LSR A;  5I3Q A;  4FF4 A;  3HDS A;  1YJ9 S;  1X5O A;  3DLG A;  1U2R A;  2ZZT A;  4X4T A;  3AA9 A;  4JI5 F;  2AJ1 A;  3CTR A;  3NAI A;  4I7F B;  1U45 A;  4LRD A;  1F9H A;  3IGN A;  1UFK A;  2AGQ A;  5DLF A;  4HYK A;  5B0G A;  5LMU F;  2ZDP A;  1S7I A;  2K8G A;  1R6V A;  1O0P A;  2OO4 A;  3AT1 B;  3I31 A;  1S6U A;  1N36 J;  2AU0 A;  5L9X A;  3NAH A;  1HNV B;  5F8I A;  2KYZ A;  3L4B C;  1IKX A;  3MEC A;  5L8R C;  3CUL A;  4ZS6 A;  1HWU A;  3OR2 B;  3W62 A;  3DRS A;  3QFH A;  2UUW A;  1HW8 A;  3OTO J;  3AJ1 A;  2R7T A;  4ZP6 A;  3SXL A;  3POT A;  4C3M A;  2HVH A;  1FWP A;  3PO4 A;  2RU9 A;  2AEF A;  4OX9 J;  3M8R A;  1YSJ A;  3N0V A;  1UPP A;  4TY8 B;  2OPS B;  5F8H A;  2R7X A;  2X3G A;  1X9S A;  4IOB A;  2W24 A;  4WE1 B;  3AY0 A;  1IBK J;  1RHR B;  3C15 B;  1VRT A;  1YBU A;  1QTN B;  4C8Z A;  3MM9 B;  2J9D A;  1U49 A;  3KMS A;  3GJS B;  3R5C A;  1LXJ A;  2CWX A;  5IS2 A;  1ITP A;  2CKW A;  3SDE A;  2KM8 C;  3D5M A;  2NYI A;  1H38 A;  2CQ0 A;  3VZH A;  5KFE A;  1BXN A;  2IRX A;  4IR9 A;  3MR5 A;  3N01 A;  4DWI A;  3JTP A;  2HGM A;  1FCA A;  5C42 A;  1Q0N A;  4URQ U;  3J7A 1;  4WIQ A;  3SSS A;  4WTY A;  1NJZ A;  3D7S B;  5J2N A;  1S49 A;  2G0J A;  2O3D A;  2J8S A;  1RAB B;  4LF2 A;  5LM7 E;  4CWB A;  2OIH A;  1VIX A;  4G1P A;  1N34 F;  4FXV A;  1XJW B;  3KLG A;  3JS9 A;  3KUH A;  1E6Y B;  2YWW A;  3OFE A;  1JLC A;  2YKN A;  4NCA A;  2P9G A;  1X4E A;  1JQG A;  2LLZ A;  4AL6 A;  3CCW A;  1M5V C;  2WW8 A;  4P52 A;  3ZZT A;  1SBR A;  4OYP A;  4H4K A;  2E44 A;  4MJK A;  2M7S A;  5EWG A;  3BR8 A;  2DGW A;  1HR0 F;  3ILI A;  3SYZ A;  4CNZ A;  4ZVP B;  1Q1K A;  1SKS A;  4KE5 A;  3MPU B;  4DI6 A;  4IYQ A;  1IQZ A;  1NH7 A;  1CJV A;  4BC9 A;  2V34 A;  1S1T A;  1GX5 A;  4J9L A;  2BJ1 A;  1EP4 B;  4R8U B;  1H2T Z;  2C2N A;  3T1H F;  1R0A A;  4NPO A;  2P9E A;  3HJV A;  5IT4 A;  3MD1 A;  3TEH B;  2HWH A;  4WTO B;  1CUL B;  3CJK B;  1JMT A;  3M6W A;  2HWT A;  3QGI A;  4NRT A;  3R9L A;  1JLG A;  5F8N A;  4EMD A;  3PRV A;  1RP5 A;  3CCZ A;  2FLN A;  4C11 B;  4F7V A;  3FC9 A;  3DRR A;  1C0T B;  1HD1 A;  1RWN B;  1N56 A;  4DN9 A;  1YX2 A;  3HO1 A;  5EWE A;  4M5H A;  3TJA A;  3W5X A;  2QMX A;  1PG5 B;  1U09 A;  3CXC R;  3CDE A;  4YR2 A;  3QO9 A;  4DV5 J;  3UCU P;  3G6Y A;  3M2R A;  4YB6 A;  4ZMM A;  1Q82 T;  4NA2 A;  4DG1 A;  2RAQ A;  2RHQ B;  2KT2 A;  2DO0 A;  3BSN A;  2HND B;  3JXO A;  1XC9 A;  4K2X A;  2MQL A;  4RW8 A;  1KC8 T;  4QZV B;  1VQ7 S;  4DCP B;  2IC3 B;  2MTL A;  2AMC B;  3LPE A;  2AQ4 A;  1IKW A;  3AB2 B;  3EZU A;  1HHT P;  3BR9 A;  5HLF B;  4KQZ A;  3MDF A;  2E7X A;  4Y2M A;  2MY7 A;  4YUD A;  4B02 A;  4EO6 A;  2AZ3 A;  4JBC A;  2DJW A;  2YVS A;  2HMI B;  3VGT A;  3QAT A;  4QW8 A;  4C7Q A;  5T14 A;  4ELV A;  2NPI A;  4CT8 A;  3C6U A;  3UWT A;  2I38 A;  3NMR A;  4NXN J;  1OYD A;  5GAE I;  1R0C B;  2KN4 A;  4K0K J;  1U02 A;  2RHS B;  4DQP A;  5KFQ A;  1FEH A;  4Z7C A;  4P73 A;  3IS9 B;  3LAL A;  5HMY A;  2LA6 A;  5DRK A;  3UDL A;  2DIT A;  5E0O A;  4QR1 A;  4BS2 A;  1VRU B;  2R8G A;  2W9B B;  1SUQ A;  4BHQ A;  1IM6 A;  3H5Y A;  4CT9 A;  4U8Y A;  3NNC A;  1OSC A;  3Q2S C;  2GGP B;  1UA1 A;  1OQ6 A;  1TR0 A;  1B99 A;  3PYE A;  1N36 F;  2FJB B;  4DX7 A;  1D09 B;  2DB1 A;  1R8P A;  5CA5 A;  3CJQ A;  2BDP A;  1O5J A;  5D3G B;  2IYI A;  4LFA J;  3DLJ A;  3LP2 B;  2BE2 B;  3TZW A;  3GV7 B;  3CMA S;  3DGP B;  1SI9 A;  4C3L A;  2VB6 A;  4O23 A;  1VQS A;  4OMF G;  2DO4 A;  4DHV A;  1SC4 B;  1U1K A;  1RBO B;  4RW6 A;  3KK3 B;  3OTO F;  4K4S A;  2E5G A;  3NCQ A;  1KQS R;  3OJS A;  2IJF A;  2VA3 A;  3GYX B;  2KTQ A;  4ZOS A;  2HIY A;  3QLH B;  1KRP A;  1SC6 A;  2BM0 A;  2XTJ P;  3RB4 A;  2R8K A;  3UN2 A;  3RR7 A;  4DR5 F;  4TN2 A;  3H2L A;  1HKA A;  5IWA F;  4PYA A;  3OXG A;  4DN0 A;  2HRT A;  2DY9 A;  3IRX B;  2LQ8 A;  2CZ4 A;  5CAA A;  4QIE A;  2HQI A;  3MMB B;  3GON A;  4FP9 A;  2CQG A;  2C22 A;  4KGM A;  2H54 B;  3TNV A;  4P2F A;  5EUH A;  4N7T A;  3L7O A;  2OAU A;  2OD4 A;  3A13 A;  4ECT A;  3QGP A;  1ZBT A;  2CVE A;  2B6A A;  4B3O A;  1N4L A;  3DOK A;  4GC7 A;  4IRC A;  4CH0 S;  2UU9 J;  2HBZ B;  3GIR A;  2ASD A;  4NYZ A;  4ETZ A;  5LMN J;  2RQC A;  2VZ9 A;  4LSZ B;  2LXI A;  2ZHB A;  1VC6 A;  1F0X A;  1ZA1 B;  2PFF B;  4RNO A;  1G1X A;  4KJI A;  4WXW A;  2ZE2 B;  4OJH A;  3QT6 A;  4B17 A;  5J2M B;  3KJN B;  1C1C B;  2K2P A;  5DGB A;  2POK A;  1SL1 A;  3QPI A;  5IT0 A;  2DGX A;  2IA0 A;  3I0R B;  5IM0 A;  3DLH A;  5HSP A;  4G1Q A;  3GSI A;  3M32 B;  3IM8 A;  5E3C A;  2C2K B;  3EJM A;  5KFN A;  1S76 D;  3AOA A;  3HFK A;  4HHJ A;  3IG1 A;  3AD9 C;  2B7B B;  2EFQ A;  4F2S A;  4P7V A;  4EK2 A;  1FHT A;  4DR7 J;  3MR3 A;  1KNZ A;  4X4O A;  4OYM A;  2QLX A;  4PG8 A;  2E7W A;  4QQB A;  1X9M A;  4PXE A;  1HBM B;  3MI7 X;  1VDH A;  2XLK A;  1YIT S;  4PG5 A;  1M1K T;  1ICE B;  2ERR A;  1AXQ A;  3OR1 A;  2X7I A;  3OLB A;  2KH9 A;  3OTC A;  5C24 A;  3A1Y G;  2FLP A;  3TUP A;  2ZHO A;  4KKO A;  4R0J A;  1DHM A;  3KLI A;  2K7J A;  4CO2 A;  2Z56 B;  1WTF A;  2QTW A;  3QJP A;  5HQM A;  1UFW A;  2OPP B;  4TU8 A;  2VG5 A;  4PWD A;  4ANC A;  2Y8W A;  4OYX A;  5CCM A;  1YZ6 A;  3Q24 A;  4FBT A;  1CJU B;  2WOM B;  4EU0 A;  2SXL A;  4ED1 A;  4DZD A;  5LJ5 Y;  1NDK A;  5C25 A;  4RUA A;  2QEX S;  2LU1 A;  2JSX A;  3CCT A;  4DV5 F;  4Q0B A;  5KTQ A;  2RRB A;  2H5E A;  3W63 A;  2KL8 A;  2HNZ B;  4YR0 A;  1LNQ A;  5F8J A;  1M5O C;  1EET B;  4BWM A;  1U6F A;  1S48 A;  2F4F A;  1LW0 B;  4OLO A;  3BB5 A;  1UCN A;  3NS6 A;  3MCM A;  2CJY B;  4FF2 A;  4TKT A;  4LRB A;  2W01 A;  4FS2 A;  2Z57 B;  1WSR A;  3LAN A;  1XMO F;  2GVZ B;  2L41 A;  1PYS B;  5J1P A;  4M5D B;  3TRG A;  4TXS A;  1I1G A;  4YB7 A;  2HFU A;  1SJR A;  2YPZ A;  2OEJ A;  3P5B P;  4ZVH A;  1YIJ S;  4ETX A;  2GNK A;  3GE9 A;  1GTE A;  5MAO A;  4HH0 A;  4ATN A;  4M94 A;  3MUR P;  3CVK A;  3HPO A;  4GKJ J;  2XGP A;  4WKR A;  2VAS A;  4CTA B;  2ZOF A;  4R5P A;  2VJV A;  1FDA A;  4CLW A;  4K0K F;  1YBT A;  2C3Y A;  2ATL A;  3RBD A;  1RYS A;  2VF3 A;  1S99 A;  1TKX B;  5IOL A;  1RHM B;  1Y11 A;  2I2Y A;  1RT2 B;  3MAA B;  4RW9 B;  3CSK A;  2D3O R;  1FF2 A;  1XR7 A;  1UL3 A;  1HNV A;  5FLX U;  2DXD A;  3MR7 A;  3JSR A;  1NSA A;  2Z58 B;  3KJV A;  1LW2 A;  1RT4 B;  4WU3 A;  3ZTR A;  3EVW A;  3PO5 A;  2CQ3 A;  2FVP A;  4DSL A;  1KWM A;  4YOE A;  1X4B A;  3DU6 A;  3M8S A;  3ZTS A;  2DCL A;  3HT3 A;  2LXF A;  4LF5 J;  2DGO A;  3NLC A;  1NJW A;  1U48 A;  5KFG A;  2CZ9 A;  3RBX A;  1VQ6 S;  2WK4 A;  3MHY A;  2A1B A;  4LFA F;  1ZPV A;  4TY8 A;  4RNH A;  2M0G B;  2OPS A;  5THW A;  5IT9 Y;  1EHW A;  4ZVE A;  2UVR A;  5HRO B;  2BOA A;  1HNI B;  1F5C A;  5GAD U;  3LF0 A;  1YLX A;  3C15 A;  4I2P B;  2KFZ A;  1VQ4 S;  3T5K A;  4NML A;  2HK2 A;  5H1S V;  2Z0G A;  3PW4 A;  3F0N A;  4B3R J;  3OD2 A;  4KPY A;  1TL3 B;  1QUP A;  4K4W A;  3VCD A;  1RGV A;  1IQT A;  1RLC L;  1GMU A;  1OYE A;  4LFC F;  2CJK A;  3J80 Y;  4B3M J;  3X3U A;  2BQ3 A;  3I9Z A;  5J2Q B;  2B56 A;  2XUL A;  3N79 A;  2JEJ A;  5K9F A;  2DRA A;  5F3T A;  1F60 B;  1UW9 A;  4RNF A;  1JLB B;  4QYZ K;  1G4C A;  1NME B;  3TAN A;  2PEH A;  2HW3 A;  2VV5 A;  3P3D A;  5HP1 B;  3HCX A;  2B9E A;  4Q45 A;  4OYI A;  1FKO B;  3UR3 C;  3O5T B;  3EMT A;  1JXL A;  3QBC A;  3FGV A;  3G8Q A;  3QID A;  4IFV A;  2UU9 F;  4C8N A;  1WNE A;  5LMN F;  1JXV A;  4YDX A;  5A8K B;  1PYO B;  5E41 A;  1VC5 A;  5FJ4 A;  4DQQ A;  1Q7Y T;  1X5P A;  5LSL A;  1FJG F;  3BPD A;  1V5V A;  4OJG A;  1FE4 A;  4CRJ A;  4DEZ A;  4ILM A;  2YBV A;  3MAQ A;  4EO8 A;  1PAU B;  2OEL A;  2RUS A;  3CGI A;  1ZPW X;  4I6W A;  1EP4 A;  4ES1 A;  4R8U A;  3HHE A;  3R7B B;  4RU9 A;  1X5S A;  3K8V A;  4JI1 J;  2KHD A;  2EC2 A;  1CUL A;  2YWF A;  3CJK A;  4ZDN A;  4A8X A;  2AYE A;  2FZG B;  4DR7 F;  2E1R A;  1LV5 A;  2ZZN A;  1QAJ A;  1U7L A;  3T9N A;  2H9Z A;  2Y1R I;  3CE8 A;  3E51 A;  2PGC A;  4JI0 J;  2W4C A;  2CXE A;  4QYZ J;  1NPP A;  1C0T A;  3R6G B;  2BXJ A;  4KT0 C;  3CO0 P;  3OVA A;  3HVW A;  4ECS A;  3TA2 A;  1NUE A;  2HG4 A;  3H7H B;  4L76 A;  4DR4 J;  1MG7 A;  5AXM A;  4QU7 A;  1KKH A;  5K5M A;  3DLL Q;  2VG7 B;  1GAO A;  3R3T A;  3MCN A;  1UVN A;  4NCB A;  1UVM A;  3CJ3 A;  4ELU A;  4DX8 H;  3HKZ D;  1Q4R A;  1UTA A;  2HND A;  3CDW A;  4RNN A;  4M5I A;  5I42 B;  4B9L A;  1T3N A;  2XLJ A;  5I4M A;  1NK5 A;  2NZ4 A;  3AA8 A;  3R7S B;  2LU2 A;  2I8E A;  3M8Y A;  4IFY A;  1LK5 A;  2V68 A;  2BX6 A;  4PQU A;  3LA0 A;  2PMZ D;  3B4D A;  2AF6 A;  5HLF A;  1FO1 A;  3EGZ A;  4O4R A;  1FRX A;  2QLJ B;  4DL4 A;  2QX0 A;  3M8Z A;  1FA0 A;  2QFJ A;  4X66 J;  3W9H A;  2HMI A;  1S6O A;  5KOW A;  1B7Y B;  5KT4 A;  4RZR A;  1FRM A;  2IJN A;  5DQI A;  4OL8 A;  2C1E B;  4KBI A;  2VUG A;  3H4B A;  1WEY A;  4ZPD A;  2BYC A;  1F5B A;  3M6X A;  2MPU A;  4MYT A;  4M5M A;  5J2P B;  3ITH B;  4C8M A;  1QSL A;  1MWQ A;  4ED5 A;  4MH8 A;  3FBE A;  4DR3 J;  4LF7 J;  2IM1 A;  1YRU A;  3L95 X;  4O44 B;  2UZA A;  3WX4 A;  2RML A;  3HKW A;  1YI2 S;  4PUO B;  2XM3 A;  2M3D A;  3MM5 B;  4GKJ F;  4CIO A;  1VRU A;  3SCI E;  2XY6 A;  2BAC A;  1EAY C;  2ALY B;  4FYV B;  3TAM B;  2GJI A;  3DHX A;  3DLK A;  5KT3 A;  3JAM U;  2LEB A;  3WIU A;  2DIU A;  5E3R A;  2GGP A;  1S0N A;  4ZPT R;  2GMH A;  5A0Y A;  3PKY A;  4KHM A;  2GML A;  3JTN A;  4WFB Q;  1OQ3 A;  4M5N A;  2MY8 A;  1PKU A;  2XS2 A;  4CLS A;  5T7L B;  2YTC A;  1NJI T;  5D3G A;  2BE2 A;  1X4C A;  1ROF A;  3DGP A;  2CNL B;  4JV2 A;  3H4D A;  1ZZF A;  5GMK a;  3T1A A;  4NCG A;  1NK0 A;  4ES3 A;  4I0W A;  4O0N A;  3KK3 A;  2B7C B;  3MXH P;  2ZBI A;  4U8V A;  1S9G A;  2HHS A;  1Q8B A;  3DXB A;  3V6J A;  2E5L J;  1SC1 B;  1TK0 A;  2P9C A;  2B3T B;  4F04 B;  3M1V B;  3K5L A;  3CC4 S;  3P8B B;  4AQY F;  2CJ9 A;  3RAM A;  1SKR A;  1HA1 A;  3CD7 A;  4OJ3 A;  3B54 A;  4DBQ A;  3BSC A;  3IRX A;  5KAK A;  4C0B A;  2M8H A;  3MMB A;  3ISN C;  2VFV A;  3Q0A A;  4IOA Q;  2C2M B;  1HWL A;  4LF1 A;  3DOM A;  2UUB F;  5SUH A;  2ZUA A;  3LUY A;  3ETO A;  4B9U A;  1JKH A;  3K5O A;  5DO2 A;  1LWX A;  5ADZ A;  3CIZ A;  4MK9 A;  4UF4 A;  2I1R A;  1OWX A;  3VAL A;  4EYH B;  4B3M F;  4OI1 A;  2Q3P A;  2YKO A;  1K73 T;  5DQG A;  2I6W A;  4X4U A;  1I94 F;  2UXC J;  5F0W A;  1X7V A;  2HHH J;  1X60 A;  3IM9 A;  3ADA C;  1BQM A;  3U27 A;  2L9D A;  3OFG A;  4ECY A;  4MK7 A;  5GAG I;  5RUB A;  2XY5 A;  2BA9 A;  3OL7 A;  1VQ8 S;  1Y0H A;  4ZHR A;  2ZE2 A;  2HHQ A;  5IC4 B;  2FY8 A;  2IPO B;  4Y2K A;  1Q8K A;  1NRK A;  1ARO P;  3VQS A;  3GV8 B;  4BCA A;  4OX8 A;  4OQJ A;  4ICL B;  3I0R A;  2UUA J;  3HHL C;  3M32 A;  3HHL D;  2R7W A;  2E1A A;  1XMQ J;  2PC6 A;  3ENA A;  5IV4 A;  2HPU A;  3GJR B;  2XGQ A;  4RUB A;  3R6L B;  4F67 A;  3PTW A;  3V81 B;  3D1Q A;  3P96 A;  3P49 B;  3O2I A;  1TL1 B;  4IOC Q;  4YHH F;  5C2G A;  2CQH A;  2XMW A;  4IG0 B;  3GIJ A;  1HBM A;  4CO4 A;  4O3O A;  3CD6 S;  5HAT A;  3VGV A;  2E1C A;  1YJR A;  1HL6 A;  3OJU A;  1V3Z A;  2A18 A;  4IDK B;  4YDD B;  2M5Y A;  2XCA A;  1NU4 A;  4WK1 A;  1WG1 A;  3CCQ S;  1RKI A;  4JI1 F;  3V2U C;  3SCK E;  4DLG A;  2F65 A;  1S0O A;  1WHV A;  3AXM A;  4YY3 J;  3K7R A;  2OPP A;  1CBK A;  1RA7 A;  2MZJ A;  3PRD A;  2OKQ A;  4AE5 A;  3UVJ B;  2MQM A;  2PI4 A;  4GO7 X;  4JI0 F;  1CJU A;  2VBW A;  2WOM A;  4USW A;  2CPD A;  1F9E B;  5KFK A;  1XIQ A;  5F0U A;  4DR4 F;  3A12 A;  4E2F B;  1L3U A;  2E7V A;  3ZO7 A;  2JC0 A;  2MGZ B;  2OLW A;  2CAD A;  5AE3 A;  2ACM A;  1RTI B;  1KLM B;  2HNZ A;  4NLX A;  1EET A;  2HKE A;  4N8O A;  2X51 A;  1XK8 A;  1DAR A;  4KO0 A;  1TAU A;  2XWY A;  2GVZ A;  3O3L A;  1YDL A;  1X4A A;  1RTD B;  5B09 A;  1P1L A;  1L5U A;  4OHW A;  1KVK A;  4MK8 A;  4M5D A;  1UFL A;  1K8A T;  1WD6 A;  2QN6 B;  2WBM A;  3VAF A;  1FNM A;  4DV2 F;  4DPW A;  3UCG A;  4QOT A;  4LBP A;  2CVI A;  4KGX B;  5F8G A;  4F36 A;  4CTA A;  2CYY A;  1VQY A;  3OSN A;  1HBN B;  3BM7 A;  3SMZ A;  3KYL A;  2GO8 A;  1UEU A;  5HQL A;  5F9L A;  2IDL A;  4NLY A;  1TKX A;  1N5S A;  1FER A;  4C8K A;  3LPY A;  1RT2 A;  3P5T L;  4NEZ A;  1FX2 A;  1FFW B;  2W4P A;  2XZT B;  2HFS A;  2P8I A;  4JI8 F;  2KJV A;  4HHH A;  2XS5 A;  3ZXW A;  2W8K A;  1TAQ A;  3GPA A;  4HL9 A;  3G86 A;  1RT4 A;  4QWB A;  1FX4 A;  5KFJ A;  2JLE A;  2ZOG A;  5HQ8 A;  4Q2L A;  1FI4 A;  2JLG A;  2V67 A;  3TAQ A;  2AJ0 A;  1IBM J;  3TI0 A;  3M6V A;  4ALZ A;  2YQ3 A;  4USM A;  3CCU S;  4J9P A;  2ZH3 A;  2VFT A;  3QMQ A;  2WVE A;  3L9Z A;  2V2V A;  2J6U A;  3M9O B;  4DSE A;  2XCP A;  2XMV A;  4IQM A;  1RT3 A;  3CC2 S;  4WYL A;  4ILR A;  2W9A A;  4I2P A;  3MPD A;  3MZI A;  1OMS A;  3DHW C;  3MR6 A;  1I6J A;  2R3V A;  2A6M A;  4KTQ A;  5KT2 A;  2DPJ A;  2V2K A;  2E5L F;  4X4S A;  1LK7 A;  5B0A A;  1TL3 A;  5D0H A;  4DFK A;  2HBR B;  2ADB A;  3GJQ B;  3OBI A;  3TO8 A;  4U95 A;  2JOQ A;  1WC6 A;  4DCO B;  2MQO A;  1RWX B;  1U2C A;  3QYY A;  2LEA A;  2CNO B;  1HMV B;  5KOX A;  4KFB A;  2LP4 A;  2FDN A;  1JLB A;  4W90 B;  2VQE J;  1RT1 A;  2BJ8 A;  3TQE A;  1DTQ B;  1S1U B;  1NK8 A;  3NEK A;  2XHC A;  1HNZ F;  2F8E X;  2Y8Y A;  3H5X A;  5IC6 B;  3CT9 A;  3D3C J;  3MMA A;  2MJN A;  2UXC F;  2GO9 A;  2BRL A;  5A8K A;  2HZA A;  2CNN B;  2FJA B;  4ECR A;  2FIU A;  4NXM F;  3OPK A;  2Y0B B;  2QL5 B;  2F63 A;  3OSP A;  3V4I B;  4HDG A;  1VYA A;  3N6N A;  4LSL B;  4C8Y A;  3IBF B;  4K4U A;  4Q8E A;  2DNM A;  2K3I A;  4RBU A;  1RWP B;  3NNH A;  5KG7 A;  1XMQ F;  1GT8 A;  3J81 U;  1URN A;  2L48 A;  3AJ2 A;  4Q44 A;  2EG2 A;  1VK8 A;  4ID5 B;  1N8R T;  1D3W A;  3CMQ A;  1LWC B;  4A8M P;  3L7P A;  2RQ4 A;  1PC4 A;  4CLU A;  2O1P A;  1M5K C;  4EFA C;  1MMD A;  1NSK L;  4ZVS B;  4RKU C;  3ICL A;  5HI7 A;  3C2P A;  3A3N B;  1JNR B;  4I68 A;  4MFB A;  4DUT A;  2D9O A;  3VAM A;  5KFX A;  4DQR A;  1NAQ A;  1BUX A;  4KHR A;  3QIP B;  2N7C A;  3PYD A;  3CD5 A;  3R1H A;  2MLY A;  2EFV A;  2VG7 A;  4QWC A;  3D6H B;  1RWW B;  3F56 A;  4YY3 F;  1UW4 A;  2AZ1 A;  4U96 A;  2H3E B;  2RDI A;  5I42 A;  3GYN A;  1KVI A;  4LR7 A;  1TUG B;  1XEZ A;  1TFW A;  2KRB A;  3HVT A;  4PEO A;  5D0E A;  2W9C B;  4NLU A;  1FRJ A;  2GJ2 A;  4L75 A;  3BBB A;  1HBU A;  2AKW B;  3R2C J;  5M2P A;  1QM9 A;  5ETK A;  2ZJP Q;  3PX4 A;  3MPV A;  3KUG A;  2HQC A;  3TUZ C;  2DPI A;  3BPS P;  2ZH4 A;  1KQF B;  1KLN A;  4JI6 J;  1VBK A;  2CUY A;  3OFF A;  4K7Q A;  2FLL A;  4X4N A;  1WC3 A;  5HO4 A;  3IRW P;  2WVC A;  3BKF A;  2HLU A;  5J2P A;  3ITH A;  4DL2 A;  3UCZ P;  1BMQ B;  4LRE A;  1IJF B;  2GVD B;  2MLZ A;  1R27 B;  5KG4 A;  1Z2Z A;  2NPF A;  4OZ0 A;  3FRZ A;  3QWP A;  4O44 A;  5E3A A;  2ZUG A;  4NEY A;  1Q86 T;  4QWE A;  3UPF A;  4ELT A;  3TA1 A;  4PUO A;  4CO0 A;  3MM5 A;  3GG0 A;  3FEZ A;  1SVD A;  1ZAW A;  1AUD A;  3D0I E;  2YX1 A;  3TAM A;  2CNK B;  2ZWO A;  2XZW A;  4H4O B;  2DR9 A;  5DG9 A;  2FUG 9;  2ZD1 A;  2OHD A;  3E8O A;  2BM1 A;  2ZH8 A;  4Y34 A;  4UQG A;  1UZH A;  3K89 A;  4O4G B;  3MUM P;  2GIR A;  2WTF A;  2RVJ A;  5T7L A;  3ET6 B;  4XDD A;  4I64 A;  5ETS A;  4YS2 A;  3PAC A;  7AT1 B;  4OI6 A;  3AH6 A;  2FJD B;  2IAJ B;  3M2U B;  1I3O B;  2ZNZ A;  4CCH A;  4IQX A;  4CLY A;  2BW2 A;  1IUJ A;  1IBM F;  5DS7 A;  5E3Q A;  3HVR A;  1FNO A;  3ZZO A;  2W7A A;  1X0P A;  4WFA Q;  2RNE A;  3U1L A;  3M1V A;  1YJU A;  3ZNU A;  1N54 B;  1S97 A;  3DNC A;  3BGR B;  4NI2 B;  4C2M A;  2E66 A;  4I69 A;  2O67 A;  4FPI A;  2R9L A;  2PT0 A;  1FJE B;  3M30 B;  4A8F A;  4RW7 A;  3SQG B;  5DDR C;  4MKA A;  2D3O 1;  3QAU A;  4NLR A;  1MW7 A;  2FC9 A;  3PYG A;  4DL6 A;  4P2M A;  3RBZ A;  3D3B J;  5HL7 Q;  3RYL A;  1JX4 A;  2CQC A;  4U67 Q;  4J9M A;  2AGO A;  2Y1J A;  5GAH I;  2HUR A;  3W2V A;  4DPT A;  1SIZ A;  2WON B;  3OL9 A;  2IVY A;  3ULH A;  1IKY A;  1C2P A;  2VKZ G;  2R7S A;  1RQ0 A;  2JLF A;  1PIL A;  4CO3 A;  1WC5 A;  2MXY A;  4P7T A;  2J6S A;  1KQG B;  4Z7Y A;  2K3K A;  1VQM S;  4LRA A;  1SJQ A;  4XPC A;  4OX7 A;  4J5O A;  2OGU A;  3FK4 A;  2FJV A;  5IXU A;  4ANE A;  4CLT A;  1N0V C;  4G6V B;  1EIY B;  1E6V A;  2CA9 A;  3HZG A;  1H74 A;  3PEJ A;  1UVL A;  2VQF J;  1SJF A;  2UVW A;  3CJR A;  3BGO P;  4HTJ A;  3RJM B;  4CLK A;  3MCO A;  4RJV A;  2WZ1 A;  1S59 A;  4LFB F;  2DIS A;  4AL7 A;  1OY9 A;  1SJ4 P;  2F1F A;  3UQS A;  3R7N B;  1T9X A;  1A9N B;  4F4X A;  4UY8 T;  3PCO B;  2BW7 A;  2V4J B;  5DQH A;  4E8U A;  4K5R A;  2HNY B;  1HIY A;  5SZT A;  5B0D A;  4LRC A;  3QFW A;  3BN4 A;  2WHO A;  2MKJ A;  5E2Q A;  3PNI A;  5AJ3 J;  3HP6 A;  1N88 A;  3OTB A;  1YJ7 A;  5DG7 A;  2GIQ A;  2HIQ A;  1T9T A;  3BYP A;  4F25 A;  1CJT B;  2HFZ A;  2MST A;  3QWU A;  1GXL A;  2EK6 A;  3GZ7 A;  2J7W A;  1HD0 A;  1YRT A;  3JYT B;  4AXI A;  5KT6 A;  2J9E A;  1Y9O A;  4MIA A;  1IM4 A;  2G9O A;  4TYB A;  4XK8 C;  3UVJ A;  1Q78 A;  2V9K A;  1RSC A;  3OTE A;  2RIL A;  2FVS A;  3DYA A;  3IFE A;  2Z2M A;  1H3D A;  2ZH1 A;  1KR4 A;  3FNN A;  4KGZ B;  4HVZ A;  4EWT A;  1J5E J;  2V2Z A;  1ZTW A;  3H90 A;  2ALZ A;  3PFO A;  2MGZ A;  1HHS A;  2XB2 D;  1RTI A;  4URG A;  4B3T F;  1KLM A;  1BQX A;  5E3P A;  4LF9 J;  3HXM A;  2BAB A;  3OXL A;  3RAQ A;  2QLF B;  4A8Q A;  4KC5 A;  1OY8 A;  5EX3 A;  1FD8 A;  2CJB A;  4EGL A;  2FC8 A;  4KAI A;  4RLE A;  2O5D A;  4N8N A;  4AYB D;  1P9Q C;  1F5A A;  3LWM A;  1RT7 B;  4ZN3 A;  1K1Q A;  2VG6 A;  3DRY A;  2WSE C;  5AE1 A;  4DFJ A;  1O6X A;  1HNX J;  5KFM A;  4FYD A;  1TKZ B;  3NCR A;  2UXD F;  2XS7 A;  3CNQ P;  4DQI A;  2NLW A;  2D41 A;  5JXS A;  3I0S B;  3GIK A;  5DDQ C;  1MU2 A;  1R8B A;  2AEJ A;  2MDA A;  1VOM A;  2XBP A;  1FVQ A;  4USH A;  2B8P A;  3KHH A;  2RH3 A;  1SQG A;  4M63 A;  4FBU A;  3KHR A;  3V4M A;  4WU2 A;  4JI6 F;  1U8W A;  2J7K A;  2DNQ A;  1PO6 A;  3HD1 A;  1OY6 A;  2AD9 A;  2I9S A;  2KO1 A;  3M8P B;  1CG2 A;  1HBN A;  2HGN A;  4C9D A;  3J7Y U;  3W2W B;  2IJR A;  1QY7 A;  1X4G A;  1RTH B;  1JWW A;  1SV5 A;  3G6E S;  3M8W A;  1SL2 A;  1RAD B;  2HHP A;  2R7O A;  1RIS A;  2HS3 A;  3G8S A;  3T41 A;  1R31 A;  5F8M A;  2AWZ A;  4KPC A;  3TWZ A;  3PDN A;  1BD6 A;  2E5J A;  3UD4 P;  1RWM B;  1Y10 A;  4PZV A;  2FJW A;  2EWH A;  5E5N A;  3HHN B;  1CC8 A;  2F4V F;  1KBR A;  1KOH A;  4CLL A;  3EGV A;  1IJE B;  1BQN B;  2CQ4 A;  4OZN A;  5KFO A;  1N6Q B;  1JLA B;  5D78 A;  2QO3 A;  4S0M A;  3PW2 A;  4RU2 A;  3QRP A;  4L3K A;  4Y2I A;  4QIF A;  2ADC A;  1CS4 A;  2RF2 B;  1UVK A;  5BR8 J;  2DVI A;  1HLW A;  1NJX A;  4V19 J;  3T5J A;  2VOP A;  4HEA 9;  3CDU A;  2QZ8 A;  1XNQ J;  1NDP A;  2RD5 C;  4G3I A;  3N6L A;  4KRW A;  5HVF A;  2C3M A;  2UXB J;  4KSE B;  3CCV S;  3ZTQ A;  1X8D A;  2YH0 A;  3TX8 A;  4F26 A;  3TAR A;  2B9Y A;  4RNM A;  4OHZ A;  3OL8 A;  1UVJ A;  3NGK A;  4AT1 B;  2W1B A;  2VC1 A;  3KG0 A;  4ZIW A;  4DX6 A;  2YH1 A;  2C3O A;  1BC6 A;  1QTM A;  2E9R X;  3EGW B;  2QA1 A;  3DLE B;  1CQM A;  2BV3 A;  4EEY A;  4J37 A;  4FZV A;  3VAG A;  1VJW A;  1DTQ A;  1S1U A;  1QVF R;  1HQU A;  1TQL A;  2QMU B;  1Q5Y A;  1IBC B;  2QC3 A;  4ZVR B;  1CPZ A;  1YG0 A;  3ENV A;  5E33 A;  2LDI A;  4AL5 A;  2BJ7 A;  2LFV A;  3CD0 A;  5HJX A;  5D6G A;  1OPI A;  1VQL S;  1U6Z A;  2BVZ A;  3I5B A;  2VBZ A;  5KFF A;  5K20 B;  2I5J A;  3V4I A;  5HBM B;  3DMJ B;  2XNQ A;  4LSL A;  2EKN A;  3MTJ A;  2GZO A;  1DTT B;  3PW0 A;  2DHX A;  1MRO B;  4H4M B;  1MSW D;  2K1R B;  3DOL B;  2MQP A;  3D68 A;  2IMW P;  4K5S A;  2VQF F;  3A4T A;  3VHQ A;  2Z2L A;  1VQP S;  3I6P A;  2VOO A;  2V9W A;  4WP9 A;  1ZAX A;  4FVM A;  1TL4 A;  2KT5 A;  3DN9 A;  3OLA A;  5HJY A;  2CQ1 A;  2HFO A;  4ID5 A;  2QYG A;  3VV2 B;  3VAK A;  1LWE A;  3K5N A;  8AT1 B;  4TLQ A;  4O3R A;  4KV8 B;  4ZLJ A;  1S6Q B;  1M5P C;  2QIF A;  3CJ8 A;  3FUY A;  2J0X A;  2VJU A;  2DNL A;  1S77 D;  3KKF A;  3R27 A;  4TLR A;  4ZIT A;  4ZCM A;  2H65 B;  1VMB A;  1FVS A;  3Q8S B;  2HQD A;  4WZQ A;  2LCW A;  2C2E A;  2MKH A;  3PY8 A;  1NPK A;  4YME A;  2GV1 A;  3QIP A;  1ZM4 A;  2Y1L B;  5L1J A;  4CLZ A;  3HSG A;  1H72 C;  2VPX B;  4MT1 A;  4Q7A A;  4Y2C A;  1VIO A;  3THP A;  3TAP A;  1X5T A;  3CED A;  4DZ6 A;  4ZVO B;  1KD1 T;  4KR0 B;  2GQC A;  4HH1 A;  5LXY A;  2KZM A;  1Q8L A;  4UOF A;  3HI9 A;  1U47 A;  2W9C A;  1NB7 A;  2F7V A;  4ZPV R;  5A8W A;  1J5E F;  4JV5 J;  3R5A A;  3AJD A;  3CCJ S;  3CIM A;  1NK4 A;  4DFM A;  1TUW A;  4IH7 A;  5C7P A;  4DFP A;  3VVT A;  2EVZ A;  3NGU A;  3S6E A;  4LF9 F;  1U1L A;  2XI2 A;  5HAO A;  1G3O A;  3CDB A;  3H0P A;  3UO0 A;  1NND A;  3IN5 A;  3DCA A;  5AXN A;  2EKY A;  4RX6 A;  3S01 A;  1Q79 A;  3FBC A;  2Q6B A;  4LIW A;  2ILZ A;  3S8S A;  3N6M A;  4O3Q A;  2QGF B;  2X3D A;  3AQO A;  4LVN P;  1T95 A;  2GVD A;  4ED6 A;  4LVO P;  3T5H A;  4IRD A;  3QSI A;  2NQP A;  1RXO B;  1YZ7 A;  4MAK A;  3KDO A;  3X1L B;  4HKQ A;  5C5J A;  1B7F A;  1NK6 A;  4DUZ J;  2G0C A;  4FYX B;  4OHV A;  4X64 F;  1UZD A;  1I51 B;  4KGK A;  2LEP A;  2FGC A;  3N28 A;  4R25 A;  3MEE B;  2G2O A;  3R1L A;  2LA4 A;  4WK3 A;  1K9M T;  1KS2 A;  3ZZ0 A;  1L3T A;  3IXQ A;  3FQK A;  1RYR A;  4MYU A;  4DV0 F;  1RCX B;  5C2C A;  2CIM A;  5AXK A;  4DV1 J;  1TKT B;  3PV8 A;  3US5 A;  3V6D B;  3HLU A;  3ET6 A;  4ZP8 A;  1C1B A;  1M5H A;  2VH7 A;  4OHX A;  2KVQ E;  4EUV A;  2HHW A;  1ZH5 A;  1Q81 T;  3JQJ A;  2IAJ A;  3ETM A;  3M2U A;  1TTH B;  2DH7 A;  2JRS A;  3BV8 A;  3R5D A;  5ITH A;  1CC7 A;  2Z2Y B;  4Q2M A;  3DRP A;  1U1N A;  2LQ9 A;  2V69 A;  4K50 A;  4DV3 J;  4NI2 A;  4RWW A;  3DLG B;  4QBU A;  3ZZR A;  1D9D A;  3JAM Y;  3BO3 A;  4XIU A;  2V8D A;  3EVO A;  3GIL A;  1FRH A;  3M30 A;  4DSI A;  2ZJQ Q;  1XNQ F;  4A46 A;  3B6B A;  1HFE L;  1S79 A;  5IT9 U;  3PM9 A;  2ZM6 J;  2UXB F;  2C3U A;  1RWV B;  4ECX A;  4DF4 A;  2V50 A;  5LL6 d;  1REV B;  4C8O A;  3ZNJ 1;  2GQ2 A;  3PJ9 A;  4ZP7 A;  2R8H A;  1SQE A;  1YVF A;  2JC1 A;  1KHW A;  1TKD A;  1XMB A;  4P72 A;  2WON A;  4MIW A;  2EPI A;  1S6P B;  2MZS A;  1IKX B;  2FLO A;  4CH1 A;  4Y65 A;  3RBE A;  4EI2 A;  5D0R A;  2JHE A;  3LOU A;  5HN0 A;  4PCQ A;  1NJY A;  3J80 U;  2HFV A;  4X2B A;  2JNJ A;  2VKR A;  4ZCL A;  1VBZ A;  4A47 A;  8ATC B;  1YWX A;  3M9N B;  3A8I A;  5BJR A;  5CQG A;  5CD4 H;  3HJF A;  1AB8 A;  4FS1 A;  3BH7 B;  2COL A;  3HFZ B;  4ZCI A;  1KEK A;  4UY8 5;  3NP5 A;  5CYJ A;  4E98 A;  1RHQ B;  4DSK A;  3WHI A;  4PG4 A;  3VAH A;  1TL7 B;  3PHE A;  4F3O A;  5A2Q Y;  1XNR F;  3D1O A;  1VRT B;  2GQQ A;  2V4J A;  1P8G A;  4DL5 A;  1DBD A;  2HNY A;  1T02 A;  4AXJ A;  1M90 T;  3H2V E;  3N9U C;  1U8S A;  1TFY A;  2UP1 A;  1LFP A;  2DTJ A;  2YWK A;  2QFI A;  4J7C A;  1B0P A;  7FD1 A;  5ETR A;  4Y00 A;  1RWK B;  3GFY A;  2RDD A;  5K8M A;  3FKB A;  4B08 A;  4DX5 A;  2NXE A;  5EGY A;  2HVD A;  2KHC A;  4D3G A;  4NYO A;  5L1L A;  1QVG R;  4HAC A;  3JYT A;  2J0S D;  2BKN A;  4P6Q A;  4DU7 A;  4Y0F A;  4F4Y A;  1EZZ B;  3EDQ B;  1N52 B;  2JVO A;  3IO1 A;  1SB6 A;  3KLG B;  2AX1 A;  1ZTT A;  2YKP A;  4MKB A;  3AOC A;  5T41 A;  1IWG A;  3T6B A;  4J9S A;  1XTZ A;  3MEG B;  2CPX A;  2ZH9 A;  5IQQ A;  3KLE B;  4FN5 A;  3QQC D;  3JB9 k;  1P6T A;  3K0J A;  1S1W B;  3A3O B;  3F44 A;  3KUE A;  3C16 B;  5CYM B;  3S7R A;  1C4A A;  3D4J A;  2MZR A;  1FDB A;  4B9T A;  4JYA J;  5KFH A;  2CZV C;  2DIV A;  2IBO A;  2NRE A;  2PMH A;  2AYB A;  2DNY A;  2LMI A;  3PRB A;  5EWF A;  1RT6 A;  2CQI A;  2HVE A;  1XER A;  2YXL A;  1TKZ A;  2CRL A;  1WC1 A;  3I0S A;  4OX9 F;  2IBK A;  1C4C A;  4TU9 A;  3PJW A;  4UOC A;  1VBY A;  1JLG B;  4USK A;  2FPH X;  5H9E K;  4JI2 J;  1N32 J;  1VRQ C;  3HHL B;  1IBK F;  1T8E A;  4ZVQ B;  1WOO A;  4F4K A;  2UVV A;  4DR1 J;  4MIB A;  4DMZ A;  4DV7 J;  2NSB A;  1D9F A;  3SZ2 A;  2AT1 B;  3MM7 A;  2OFH X;  4K59 A;  3I32 A;  5KT7 A;  2Q66 A;  1S1X B;  1EB0 A;  5DDO C;  5FDL A;  4DG1 B;  2VPW B;  2ZC3 A;  2UVU A;  1HW9 A;  3PEH A;  3N4W A;  4RW8 B;  4O3S A;  2HYI B;  3NNA A;  4XPE A;  1GK8 A;  3ZZZ A;  4F4Z A;  1KTV A;  3BF4 A;  4QW9 A;  3EVM A;  4DF8 A;  2Y3Y A;  5KG2 A;  1R3N A;  1WUU A;  3UNG C;  3GU0 A;  5DGA A;  1K1S A;  1BQN A;  4ZVF A;  1VLY A;  4DV1 F;  1XWL A;  1JLA A;  4ZPB A;  1YRX A;  5K14 A;  5M2R A;  3D0H E;  3RR8 A;  1FK9 B;  2XMT A;  2C2Z B;  4JI5 J;  2EXU A;  2RF2 A;  1SC3 B;  3ILO A;  1WOR A;  5KFS A;  3MMC A;  1U0S A;  2CWK A;  1TV6 B;  4USU A;  5LMU J;  1RAA B;  2JEF A;  5H9E J;  1HYS A;  2QL7 B;  1RAI B;  4C4W A;  4LSN B;  2ZH5 A;  2UUC J;  1SKW A;  2BMB A;  5A6W A;  1YKW A;  2XMK A;  5KG3 A;  3GR0 A;  3MPW A;  3C6T A;  5KFD A;  1IR0 A;  4YFU A;  3L09 A;  4L6V 3;  1CVJ A;  3FMB A;  3PX6 A;  4FKX A;  3GSD A;  4GC6 A;  1AFJ A;  1H98 A;  2RJZ A;  2GIF A;  3THT A;  3M8Q A;  3DLE A;  3OT9 A;  4K4T A;  2HAF A;  4WFN Q;  3KLV A;  3I55 S;  3W60 A;  2ZM6 F;  3MM8 A;  2OMO A;  4QU6 A;  3D1H A;  3DLB A;  4PXD A;  2ZBC A;  3UDE A;  4NZ7 A;  2G1H A;  2WAQ D;  2D9P A;  1LFW A;  1T03 A;  2R2T A;  4UOH A;  4ITS A;  2CG4 A;  4ZLP A;  2CPH A;  1TZ0 A;  3W9J A;  3G96 A;  2ILY A;  1XR5 A;  4QR2 A;  2V94 A;  2LXU A;  4J9N A;  1G6B A;  1QAX A;  1JLQ A;  5F41 A;  5HBM A;  3DMJ A;  3T9Z A;  2WB1 D;  5D77 A;  3N5B A;  2NS1 B;  1MRO A;  4H4M A;  1M1G A;  2F5G A;  1JIH A;  3DOL A;  2NXN A;  2BEF A;  4GKK J;  1ELO A;  3IMQ J;  4D3H A;  2GJF A;  3B82 A;  3NMA A;  3KG4 A;  4ILL A;  4QWD A;  3KJF B;  3Q8U A;  1T94 A;  1NSQ A;  2EFP A;  1U0H B;  1JXE A;  1N34 J;  4KV8 A;  3WC2 A;  3K8W A;  3FCW A;  4I7F A;  1WEX A;  1S6Q A;  5K8N A;  5CH7 B;  1DFD A;  4QYR A;  5KFB A;  4NXN F;  2B6A B;  3B8H A;  1AW0 A;  3OVS A;  3IWL A;  3SSR A;  3JSB A;  2R8I A;  3SV4 A;  4NLO A;  4N47 A;  1F2H A;  2NCK L;  3TYT A;  4QIG A;  3BSO A;  2XYG B;  3SFU A;  4ZP9 A;  3N5F A;  4TQS A;  4J9V A;  1ZET A;  1K0T A;  3SI8 A;  2PEB A;  3OR2 A;  3J81 Y;  3LQV A;  2B4P A;  3J7Z 5;  2H1Y A;  4UT4 A;  3T1H J;  2QE5 A;  3WZ0 A;  2HHV A;  3KDN A;  3TW0 A;  1TK8 A;  3M6U A;  3AB4 B;  3RZA A;  3IAM 9;  4N77 A;  3D0G E;  1UP1 A;  4H54 A;  4GMK A;  3H8Y A;  5B0B A;  1NB2 A;  1UWB B;  3WIV A;  3VWS A;  4WE1 A;  2RT3 A;  1NDC A;  1ZA2 B;  3Q2T C;  4X4P A;  4W92 B;  2GW8 A;  4BWJ A;  3MM9 A;  1WEL A;  1IN0 A;  2YNI B;  3EXC X;  4QPT A;  2ROP A;  2ABY A;  2BKP A;  4KKO B;  2N4C A;  1V5I B;  2HQG A;  1N5V A;  2IDE A;  1GQE A;  1Q5V A;  3MFH A;  2VG5 B;  3SCJ E;  1WKK A;  2M4M A;  1Z1Z A;  2HQ3 A;  1Y7P A;  3GWC A;  1IBL J;  4NWB A;  4DLE A;  2OI2 A;  2B43 A;  3FDS A;  4JI2 F;  1N32 F;  1HI8 A;  2FVQ A;  1V9O A;  4PKD B;  3D6M B;  2F9D A;  4ZPW R;  4DR1 F;  3MEE A;  3CCR S;  4DV7 F;  1PGZ A;  5DM6 Q;  4G1I A;  1NCL A;  2OJ3 A;  1DAX A;  2AGP A;  5C25 B;  1VQN S;  2YQ1 A;  3KXD A;  3KLH B;  1E6Y A;  1DQA A;  4K2J A;  4TQR A;  2MQQ A;  4DSF A;  1TKT A;  1N5T A;  2GMJ A;  4Q5V A;  1GMW D;  3C14 B;  2MYF A;  5BYS A;  1B0V A;  1QDU B;  2QLW A;  4IKA A;  1Y5L B;  2B4V A;  2JFK A;  5FII A;  3BBF A;  3EX7 B;  4X65 J;  2J0W A;  2P2C B;  1EJ7 L;  2YWE A;  2GS8 A;  2GHW A;  3ILJ A;  4ZJO A;  3GG1 A;  4WFX A;  4F2R A;  4X84 A;  2AEM A;  1QUV A;  3H2U B;  1WHX A;  2LEC A;  2BE9 B;  4NLV A;  2IVM A;  3ZZY A;  4CM0 A;  2WBR A;  2G2Y A;  1WAC A;  2ZBQ A;  4ZJL A;  2X1G A;  4EZ6 A;  2FHJ A;  4DPO A;  1WG5 A;  4R5P B;  2ZC4 A;  4ER8 A;  3TQ1 A;  1ULR A;  1NDL A;  1WHW A;  3KFW X;  1J2V A;  3MWB A;  1RDR A;  4C11 A;  4DDF A;  1RKJ A;  2UUC F;  4C8L A;  1REV A;  4U9R A;  2FZK B;  1G7C B;  4I1T A;  1M0S A;  5E7O B;  4L3N A;  2V4Q A;  3KJQ B;  1S6P A;  3G9C A;  2MQN A;  2IMO A;  2ZJR Q;  1IWA A;  1ZOT A;  4A48 A;  3KJV B;  2CPI A;  4LR9 A;  1LW2 B;  4ECW A;  5A8R B;  4KH1 B;  2FD2 A;  2J9C A;  2XQC A;  2FB0 A;  4NMX A;  1EKR A;  5EDW A;  4F3M A;  1MML A;  4C3K A;  2ZWP A;  2CG8 A;  2OFG X;  2YNG B;  3LP0 B;  4FKY A;  3KWM A;  3P4U B;  1V3S A;  3HSD A;  1RBA A;  3OL6 A;  2HSE B;  2IC3 A;  3LO3 A;  4OYZ A;  2XMJ A;  4DR5 J;  4QJV A;  5IWA J;  2JZ5 A;  2LYV A;  2HHU A;  4NZ6 A;  1N48 A;  3QJJ A;  3Q8Q B;  4DSJ A;  5AXL A;  3CCM S;  1TL7 A;  2CPF A;  4DCJ B;  4LMZ A;  2YWG A;  3GYG A;  3H42 A;  1R43 A;  3ELH A;  2E1P A;  3R8Y A;  4F50 A;  4WXO A;  3VGU A;  1NHK L;  2DGV A;  3GCW P;  1DLO B;  2RE1 A;  3Q8R B;  2XSF A;  3KNG A;  1TK5 A;  2DR6 A;  4GKK F;  1FD2 A;  1S10 A;  3GJT B;  4UQT A;  3KK2 B;  4DPY A;  5MLC V;  4OIX A;  3IS9 A;  3BS9 A;  2WB4 A;  3AFG A;  2PN6 A;  1S1V B;  2Z4P A;  4ZK7 M;  3BBC A;  5KFP A;  2HQF A;  5D8H B;  4AND A;  2W9B A;  5KFW A;  5AT1 B;  2FHM A;  1PAE X;  3FSY A;  3MUT P;  4OI3 A;  1PC5 A;  2A0F B;  3MEG A;  2VON A;  3UDC A;  1K0V A;  4IFV B;  1I5O B;  4EYI B;  5M2U A;  5KFZ A;  3BDE A;  2G13 A;  2LVW A;  2XHW A;  4UOG A;  3KLE A;  2HHT A;  1S1W A;  2IIH A;  2ZDO A;  3C16 A;  5LJ3 Y;  3PKM A;  5EX0 A;  5CYM A;  4O0I A;  1B4S A;  3LP2 A;  2OPQ B;  3V6H A;  2DRD A;  5ETN A;  1EKS A;  3DXS X;  1AYE A;  2HZV A;  2GC8 A;  4RUH A;  1B70 B;  3BO4 A;  1SL0 A;  3W61 A;  3F41 A;  2BQU A;  4LF5 F;  3HVA A;  2DNR A;  1KQK A;  2MQ8 A;  3QLH A;  2B4U A;  1RWU A;  1AZS B;  4UUW A;  1KFD A;  4CI0 B;  2CFX A;  5CYQ B;  2HHX A;  1QLN A;  2RB7 A;  5KFY A;  3HHL A;  3MF5 A;  3RRG A;  4QPX A;  2L9W A;  2VIC A;  3NWR A;  4FXD A;  4H4K C;  1RU1 A;  3WX8 A;  3NG8 A;  2GHV C;  4DL3 A;  2PO4 A;  3EZO A;  4OYB A;  3GLJ A;  2BKO A;  1RT5 B;  3D28 A;  2VPZ B;  4B3R F;  4K4Y A;  2EBG A;  1FDN A;  2FY1 A;  3BGU A;  3VR1 A;  3LAK A;  2ZZM A;  1S1X A;  1N5Y B;  4PYD A;  4KIA A;  4C0O C;  1BGX T;  3KG1 A;  1Y5I B;  1NBE B;  1HI1 A;  2KFY A;  5L39 A;  2R7V A;  3PX0 A;  3RW6 A;  2U2F A;  1IBL F;  4K4V A;  1L3S A;  5DZ6 A;  3UD5 A;  4CH7 A;  4DUY J;  3THV A;  4OZ2 A;  2YNH B;  3MOZ A;  3Q86 A;  4ECV A;  3E2E A;  1RAF B;  2DHG A;  1XMO J;  2LDY A;  1YJT A;  4IFY B;  4RW4 B;  1R89 A;  3TZZ A;  4PQU B;  4N56 A;  3CUN A;  5J2M A;  1C1C A;  2H5I B;  1U1Q A;  4RWX A;  2EC0 A;  2MHN A;  3T19 A;  2W2N P;  1T3O A;  1FK9 A;  3BSA A;  2C2O B;  5CXT A;  4P75 A;  4X65 F;  3CB4 A;  2R42 A;  3AXK A;  1RE1 B;  2J7U A;  1DQ9 A;  4TNO A;  1QE1 B;  4Y6I A;  1S12 A;  4X4R A;  2VBX A;  1TV6 A;  1ZYQ A;  4KY3 A;  2DNP A;  2WRM A;  4DL0 C;  1TVR B;  2QRR A;  1W2B R;  3DU5 A;  3BGL A;  3FEX B;  1X4H A;  3SV3 A;  4LSN A;  4HTI A;  2ASL A;  5KFT A;  4F0H A;  2MLX A;  4W98 A;  1IR1 A;  5GAE U;  2KVI A;  2JFD A;  3MFI A;  1FRI A;  2AJ2 A;  2DHS A;  3PVX A;  5KG6 A;  1YK9 A;  4M1K A;  1UKU A;  3NBP B;  4GVB B;  4IR1 A;  4I4B A;  1WTB A;  3DLK B;  4QR0 A;  1HI0 P;  4KGV B;  3G71 S;  2IRY A;  2YY3 A;  2N7Y A;  4FDF A;  3TVZ A;  1YBA A;  4OI4 A;  5A0Y B;  2ZBP A;  3GB0 A;  4I67 A;  2W7O A;  1NHV A;  2AYG A;  2EI5 A;  2DNZ A;  1GX6 A;  2ROE A;  3PXG a;  1JJH A;  4J9O A;  4DXL A;  2A2C A;  2PD1 A;  3FZB A;  5CD4 A;  1OJ4 A;  2KZZ A;  1ZM2 A;  1A0O B;  3Q23 A;  1VHI A;  3KHG A;  4NCG B;  2Y0S D;  1UWA A;  3K5M A;  1LW0 A;  1W26 A;  2MKS A;  2C2R A;  1DJ0 A;  4PXC A;  1S9G B;  1YGY A;  1FJC A;  4K4Z A;  3W5Z A;  4A8Y A;  3ZZP A;  3GCX P;  5BYQ A;  2RRN A;  2DH9 A;  4WJB A;  4ZLL A;  1T11 A;  3H98 A;  4LFC J;  2L9N A;  4KYZ A;  2E29 A;  1WKJ A;  3VAJ A;  2F9J A;  4J9U E;  4M5G A;  4PXB A;  2BQR A;  4B9N A;  1UET A;  4X66 F;  2IHR 1;  5ETM A;  1PCA A;  1WSV A;  4YEA A;  2OP5 A;  3LTO A;  1U0H A;  2M52 A;  3DOM B;  1C0U B;  2WVF A;  1GEH A;  3TA0 A;  3BRE A;  1RK8 A;  1R8H A;  1JKH B;  3PW7 A;  1XBW A;  1T9U A;  5ETO A;  3W3S A;  3MAH A;  3Q89 A;  2K7K A;  3RW7 A;  1TP7 A;  2IM0 A;  2M2B A;  4DR3 F;  1BQM B;  4LF7 F;  2DH8 A;  2KU7 A;  3MAA A;  5G4D A;  4RW9 A;  2R7U A;  5H9F K;  5B0C A;  1WDT A;  1K44 A;  4ZHR B;  1N5Q A;  2XWX A;  1FJG J;  1OIA A;  3FCV A;  4NYP A;  1BE4 A;  4PAA A;  2MZ1 A;  5KT5 A;  2EFO A;  2HBY B;  1MWY A;  3NOG A;  4CLF A;  1F1B B;  1WWH A;  1TMM A;  4N41 A;  3QZ7 A;  1P27 B;  3L7U A;  4R0E A;  2YNF B;  5LT5 A;  2O01 C;  2GX8 A;  4LF4 J;  2WVD A;  4PPZ A;  4CO1 A;  4WZM A;  1Y4Z B;  4URS A;  4DOZ A;  2QA4 S;  5HRO A;  3EYZ A;  4Z37 A;  4RBV A;  1UWB A;  1H7W A;  1HNI A;  1NM2 A;  2FJE B;  3FSI A;  4IG3 B;  3LGH A;  3MCS A;  3U7J A;  2BOP A;  3JSY A;  2JJ4 D;  2IY5 B;  2YNI A;  3MED B;  4OYW A;  1RAC B;  3TVY A;  1GH8 A;  2J76 E;  1U25 A;  4ZJQ A;  1RTJ B;  1HAR A;  1VJQ A;  5CHC B;  1RHJ B;  5JJB A;  3DI6 B;  1DRZ A;  5J2Q A;  5D4N A;  2ACY A;  2BJD A;  2VDH A;  3GR1 A;  2DNH A;  2QLB B;  4CLP A;  5H9F J;  5CAB A;  2EBE A;  1PBU A;  1Z4U A;  3OUY B;  2A3J A;  2DRB A;  2AHO B;  5HP1 A;  4USI A;  3TX0 A;  3G6X A;  3KLH A;  1FJ7 A;  1FKO A;  2ZH6 A;  1GTH A;  5EN1 A;  3M05 A;  4ZA1 A;  1H2V Z;  1TUV A;  2H48 B;  3C14 A;  2W7P A;  1VQ5 S;  4J9K A;  3P6Y C;  3KLF B;  4LF8 J;  2C3P A;  3FBF A;  4HI1 A;  3D67 A;  1KN6 A;  2HHH F;  4RUC A;  1FKA F;  4DUY F;  1DY3 A;  4KO0 B;  3AAW B;  1JB0 C;  4PWU A;  3W8P A;  2XY7 A;  1OO0 B;  2L08 A;  3NRB A;  4QWA A;  1XQI A;  5L1K A;  2PII A;  4A8O A;  5I3U B;  4F02 A;  4Y28 C;  3K2Y A;  2R2U A;  3ENQ A;  2GFF A;  2IVF B;  1JLF B;  1S0M A;  3BYR A;  3C19 A;  4KHP J;  1HPZ B;  3BO2 A;  1IR2 A;  2UUA F;  1CJK B;  3H5U A;  3NGS A;  1J5O B;  5LSO A;  2Z2Z A;  3QT8 A;  4YB1 P;  3Q22 A;  1RTZ A;  1FWK A;  3UFC X;  2NYH A;  4QCL A;  4M5L A;  4PRF A;  2R2R A;  1RU2 A;  3V6K A;  1UVI A;  2DCU B;  4L74 A;  4A8K A;  1GNK A;  3EGN A;  1T7P A;  2HZC A;  2PE8 A;  3SEO A;  1JJ2 R;  2V6A A;  4YN3 B;  6AT1 B;  4C48 A;  2H4Y B;  2J8A A;  1T0T V;  3EPG A;  3FRY A;  4NA3 A;  3CCS S;  2NXJ A;  1Q7L B;  4DS5 A;  5A8R A;  3MEK A;  2YKA A;  3RGI A;  2XI3 A;  4NA1 A;  3W65 A;  2XG8 A;  2PA8 D;  1VHF A;  4DV6 J;  2XMA A;  2YNG A;  3IBC B;  3LP0 A;  1YQH A;  2Q79 A;  3NGT A;  4DU8 A;  3KOA A;  2FJX A;  4U7C A;  3D66 A;  3WQP A;  2PDA A;  3TZY A;  3R5B A;  2BRK A;  1W2I A;  1T9W A;  3VGS A;  4AQY J;  3HUL A;  3JQM A;  4I2Q B;  1HBO B;  3OHB A;  2HK3 A;  3CJ5 A;  3I87 A;  1RT3 B;  2J6T A;  3CC7 S;  3PIO Q;  1RA6 A;  3ZTO A;  3W66 A; 
#chains in the Genus database with same CATH homology
 1RWP B;  3R7B B;  4DCO B;  1RWV B;  1RWX B;  2CJY B;  2CNO B;  2XYH B;  3P45 B;  2QLJ B;  1RHU B;  3KJF B;  1ICE B;  3D6F B;  1RWM B;  2H48 B;  2CDR B;  2HBQ B;  1NME B;  2H4Y B;  1QDU B;  1RWK B;  2C1E B;  3KJQ B;  1RHK B;  3GJT B;  2HBZ B;  2H51 B;  3SIP B;  2CNL B;  2CJX B;  4ZVS B;  2H5I B;  3R5J B;  1RWN B;  3R6G B;  4LSZ B;  2H4W B;  2XZD B;  1I3O B;  1SC4 B;  3EDR B;  3QNW B;  2H65 B;  5IC6 B;  1IBC B;  2P2C B;  4ZVR B;  4JB8 B;  3EDQ B;  2C2Z B;  5IC4 B;  1SC3 B;  1BMQ B;  3IBC B;  2C2O B;  3KJN B;  3P4U B;  1RWO B;  2Y1L B;  1SC1 B;  2FQQ B;  1RE1 B;  4ZVU B;  1PYO B;  2CNN B;  3D6H B;  1RWW B;  1RHR B;  4ZVQ B;  4ZVP B;  2XYG B;  1QTN B;  2XYP B;  1F9E B;  1RHJ B;  2Y0B B;  4ZVT B;  1GFW B;  2C2K B;  2QL5 B;  3NS7 B;  3GJS B;  2QL7 B;  4ZVO B;  5K20 B;  3RJM B;  1RHQ B;  2H5J B;  2DKO B;  2QLB B;  3GJR B;  1PAU B;  1RHM B;  1I51 B;  2HBY B;  3IBF B;  3D6M B;  2HBR B;  4DCJ B;  3R7S B;  3GJQ B;  4DCP B;  2QL9 B;  3R7N B;  2CNK B;  3R6L B;  2QLF B;  2H54 B;  2XZT B;  2C2M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...