1BMQB

Crystal structure of the complex of interleukin-1beta converting enzyme (ice) with a peptide based inhibitor, (3s )-n-methanesulfonyl-3-({1-[n-(2-naphtoyl)-l-valyl]-l-prolyl }amino)-4-oxobutanamide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Peptide based interleukin-1 beta converting enzyme (ICE) inhibitors: synthesis, structure activity relationships and crystallographic study of the ICE-inhibitor complex.
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords PROTEIN (INTERLEUKIN-1 BETA CONVERTASE)
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 1998-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1bmqB00
3GJTB 4ZVUB 3SIPB 2H65B 2C2ZB 2H54B 4ZVPB 3GJRB 2CNKB 3D6FB 3RJMB 1F9EB 2XYPB 4ZVTB 1BMQB 3EDRB 2CNNB 3D6HB 3R6LB 2HBQB 3EDQB 2CDRB 3QNWB 3R5JB 3NS7B 2QLJB 4ZVSB 2QL9B 2C2KB 1PYOB 1PAUB 3R7NB 4DCPB 2H5JB 2CNLB 2FQQB 1RHKB 1RWXB 2QL7B 2HBYB 4ZVQB 1RWPB 1RWMB 2QL5B 3IBCB 1RE1B 4LSZB 1RWWB 1SC3B 2XYHB 2C2MB 3GJQB 2H4YB 1RWKB 1RWNB 2C1EB 1RHJB 2H48B 2C2OB 3R6GB 1ICEB 2CNOB 2CJYB 3KJNB 1SC1B 2XZDB 4DCOB 2CJXB 1RHMB 5K20B 1QDUB 1SC4B 1I3OB 3P4UB 4ZVOB 5IC4B 3KJQB 1GFWB 2H51B 1RHRB 2QLFB 2P2CB 2XYGB 1RHQB 3KJFB 1QTNB 3P45B 3R7BB 2Y0BB 2Y1LB 3D6MB 3R7SB 1RHUB 4DCJB 5IC6B 2H5IB 3GJSB 2HBRB 1IBCB 4JB8B 2H4WB 1RWOB 3IBFB 4ZVRB 2QLBB 1NMEB 2XZTB 2DKOB 1RWVB 1I51B 2HBZB
chains in the Genus database with same CATH superfamily
1RT4A 2HFVA 2HWIA 2XY5A 1NNDA 4WK1A 2AYMA 2YTCA 2PGCA 1S6OA 2HW3A 3CCZA 2CAJA 3I4HX 4DV4J 4OI2A 1YTYA 2BQRA 4LVOP 4C8MA 3I0SB 1MN9A 1WKKA 2FLPA 1K1SA 2KRRA 1G6BA 1SQGA 2DISA 3JYTB 2KXHA 4YR0A 2ROGA 2NR0A 2KI2A 3U02A 4WTOB 4ZN3A 3KLEB 1VQMS 3KUEA 4M8LA 3TZZA 5DDPC 1VK8A 3HVTA 3ZZOA 2W9CA 1CEZA 2ZZTA 3BPSP 1JLEB 2AJFE 5FLXU 3OFFA 2YX4A 1RZMA 3RGIA 1EP4B 3G6YA 2AEJA 2Z56B 3UD5A 1UAWA 1XJWB 4WFXA 3H7HB 1NAQA 3C16A 5KFJA 1IKYA 5HROA 2RT3A 4N5SA 2LU1A 3H20A 4RW8B 3TAMA 1S0NA 4RW9A 3M8YA 5IT9Y 2LYVA 1JIHA 4DSJA 1D9AA 4JI0F 1XNRF 4WZMA 1IM6A 1WC5A 2CJBA 2V69A 1UVLA 1SL0A 4NMXA 2B5JA 2W9CB 4QQBA 4ES1A 4OYMA 3FZBA 2YNFA 3THVA 3RB4A 2E5LJ 2X1BA 3JYTA 1GQEA 1DY3A 4F0MA 2CQDA 1S1WA 3IC1A 4C98A 3RZAA 3CXCR 4OV1A 2BYCA 1F5CA 4MAKA 2HPUA 2DXEA 1U1KA 1S76D 2WW8A 2M52A 1BWVA 1BD6A 1URRA 1N5YB 3KLHA 1VBZA 2M8HA 3CJ0A 3TYTA 4K4WA 1VQ8S 1RWWB 2GW8A 3MM9B 4B3RF 2HAIA 4B3OA 1RAFB 3AQOA 4NCBA 4H4OA 2CWXA 2J9CA 5KT3A 2RU9A 2ALYB 1IBMJ 1S99A 4AL5A 3BH7B 5AXMA 3M8PB 5HMYA 5A8WB 2JOQA 1ICEB 2W4CA 3SV4A 4A8FA 2UXBJ 4NASA 3TJ8A 2Q66A 2JH3A 2RVJA 1VHIA 1X31C 2QSWA 2XHWA 2XZWA 4XK8C 3GB0A 1NHVA 1CQMA 2Z57B 3VZIA 1JX4A 4DSIA 3IO1A 1D8ZA 2V34A 3RBEA 1TVRB 1RBLA 1SUQA 3SSQA 4F7VA 3TANA 3R2CJ 3RB6A 5KFCA 2G0IA 2EBEA 4Q44A 3FCHA 5D0GA 2DGOA 2ZJPQ 1T9YA 3B8HA 1JNZB 1U48A 3POTA 2IC3A 1F5AA 3U1LA 1VGYA 3K0JA 2CPFA 1TKTB 5GAGI 3NNAA 1XR5A 4DHVA 4D3HA 5ETKA 5DG9A 2HHVA 4Y2MA 2ZH1A 2QV6A 4GKJF 3P4UB 3DRSB 2N4CA 2FTRA 1TK8A 3BZQA 3OTOJ 4NXNF 3M7VA 4ECXA 1IR1A 2RNEA 3GTYX 2GIQA 5GMDA 5CAAA 2Z8QA 5A2QY 2QLFB 4YS2A 3EVOA 2AGOA 1T02A 1RHQB 4U8YA 3R3TA 2AX0A 2ZBQA 2NPIA 1YSJA 2M9KA 1TKXA 9ATCB 1NB2A 1D1UA 2DGSA 2V8VA 5LOQA 1O5JA 5LSOA 5C24B 4DFKA 3MAAB 3MD3A 4ALZA 3BDPA 2KVIA 3D6MB 2HHHJ 1KEKA 2WSCC 1S9GA 1MU2A 1WHXA 3IAM9 2LQ9A 4O0IA 4UZCA 2HRTA 1WKLA 1U1OA 2ZWOA 3H4DA 1IBMF 3QQCD 4JV2A 1P9YA 2UXBF 2FY8A 3QT5A 4IUFA 4GVLA 5D15A 3MMBA 3G87A 2HZCA 2JEGA 1QVFR 1ZM3A 2W7PA 4LF4F 4KGVB 5CHCB 3BSAA 2JNJA 5EHHA 4ZVUB 1N5YA 2UVRA 2LXUA 2GFFA 2C2RA 5C5JA 4QBUA 4RO0A 4X84A 2IAJB 1ZM9A 2DHHA 4PG4A 3W5ZA 4A48A 1J5OA 3AT1B 2DXDA 3T5HA 1OS5A 2BUNA 2HQFA 2KRBA 4ZVPB 3EMTA 3LA0A 3WDOA 3G8QA 3QGHA 2GV1A 1UEUA 1QUVA 5KT2A 1MROB 2V8HA 5F8NA 3MEEB 4TN2A 2ZC3A 3A8IA 3NS7B 3SQOP 3OVBA 3PV8A 1QD1A 4RW8A 5LSRA 3CC2S 5HQ8A 3CJKA 3DGPB 1D8YA 4P2XA 1V3ZA 2B4OA 1RAJA 2J0WA 3NRBA 4IQMA 1PAUB 4P71A 3H2UB 1AW0A 1C0UB 1XK8A 1VRUB 3C14A 3R8YA 2BM1A 2RQ4A 3DU6A 4B08A 4ITSA 5HVGA 2V50A 3HVTB 1QAIA 1RGVA 3TEGA 3JAMY 4YR2A 3HLUA 2ZUAA 1Y3KA 1FJ7A 1NLKL 2ZBIA 4OLPA 1U2CA 1MWQA 3MM8A 1UZHA 1X4GA 2RQMA 4WTYA 2HHHF 4MK9A 2DR7A 4JI2F 3EWGA 3K57A 2PMWA 2RUSA 4OI4A 4N76A 1VRUA 3WZ0A 2ZZNA 1AROP 3DHWC 2JFKA 4LIRA 4RBTA 3VTIA 5BYSA 4JI3J 2MHNA 3BBCA 1S0OA 2OI2A 3D1OA 3NS6A 3KKFA 4ZCKA 5BR8F 4C3LA 1GEHA 4J9MA 3MWBA 1N5TA 4QJVA 2KJWA 4UQTA 5T14A 1WG5A 3VAFA 3CD7A 2BJ9A 4FYWB 3VAKA 4MKYA 2WVEA 3BJYA 3H90A 1OQ6A 4IRCA 2WVBA 1QVGR 3CW2C 5EUHA 4ANDA 1KC8T 2KHCA 4TU9A 5ETNA 2ROPA 2V63A 1F3FA 2IBKA 5HMWA 3G6ES 4ECWA 4CQ1A 1HHSA 4OJ1A 1RTDB 2E66A 2FB0A 2HFZA 3W5YA 5I3QA 4S0MA 2ZOGA 4PKDB 2E1MC 2L41A 3EYZA 4EUVA 1HD1A 3HSZA 4CZCA 1JJCB 3N01A 4KFBA 3MMBB 3V6JA 1TK0A 2N82B 2ZH2A 1Q82T 4JV1A 2KG1A 3MECB 2GA7A 4HT7A 2KVQE 4EBCA 4EEYA 3D1QA 2WOMB 4UUXA 2P5VA 2R7TA 1X4CA 2XS2A 3DGVA 3PVXA 3PYEA 3TVKA 3GE9A 1NDPA 3DLKA 1H7WA 3TZWA 1CJTB 1PBUA 2G13A 2HNZB 3GR1A 9RUBA 1V9OA 2XMJA 2X1AA 2FVPA 4G3IA 1DQ8A 1HQEB 2UVUA 2UUAJ 2ZH7A 2DNZA 3A3PB 5EWGA 5GADU 2LQ5A 2X51A 3EGVA 1X5PA 2HNYA 3LP2A 4WXOA 3T9NA 4Y00A 1K0VA 2ZH8A 1NSQA 2LCWA 3J7Z5 2WVDA 3UN5A 1F5BA 5J2PA 4QZVB 5HLFB 3HZEA 3N0VA 3M2VB 4MMOA 3TX8A 5BR8J 5F3TA 2PE8A 3UDLA 2A6OA 2VASA 3J81U 1C4CA 2JRSA 3RUBL 4E8UA 2GNKA 2VFUA 1G2EA 4PQAA 2IA0A 1BQNB 2CJQA 3AQPA 3ENQA 3IFEA 3OR2B 2I0XA 2HFNA 3SBMA 2A18A 5A76A 4Y2IA 4KHPJ 3BM7A 2V0NA 1FK9B 2BE2B 3GV7B 2ZC4A 5ETOA 4ED0A 1U7LA 1U47A 2RRBA 1HW8A 1H3DA 2R9LA 1KWMA 1O6XA 1RT7B 3IWLA 3Q83A 4DFPA 5IV4A 3PACA 4ZOSA 1FDAA 1Y5LB 2IPOB 4PG5A 3Q24A 4NA3A 4RUAA 5H1SV 2L9WA 1MLAA 5A6PA 3RBDA 1YLXA 4ZVTB 1KHWA 2WHOA 4U7CA 4P52A 3NL0A 1MG7A 3GFXA 2EG2A 2LECA 5J2NA 1WC0A 4ID8A 3V81B 2F40A 1YJVA 2HNDB 4YB5A 1VI7A 4DDFA 2MQLA 4J9SA 2ZH9A 2HNYB 1KDNA 1HBUB 5FJ4A 1T8EA 4LBPA 3DRRB 3TO8A 3MR2A 2KL8A 2O67A 1VQLS 1N32J 2J9DA 4M63A 3VHQA 5GAGU 1NB7A 2IJRA 1OQ3A 3DXSX 3FUYA 4FXVA 3HFKA 1X0FA 3T1YJ 1DLOB 4DQSA 1R6YA 1S6QB 3PRDA 1WD6A 2FGCA 4K4SA 1RHKB 1RWXB 2HHWA 2XC9A 4ZVQB 2ZJQQ 1NZAA 3LF0A 5D0HA 3PRVA 3IG1A 4U95A 4OX9J 4KPYA 1X4AA 4ICLB 1PJ5A 1N34J 3UDVA 4JI1F 2YNHA 1WSVA 4DPTA 1FXDA 4X62J 5HROB 5C7PA 1ULRA 3SDEB 4KHPF 1LWEA 4Q0BA 2AYEA 3PJXA 1B0PA 3RAMA 1NU4A 4P7TA 4DL4A 2C2OB 4UT4A 1KVKA 2ASJA 2HWHA 1LWXA 4FBUA 2B7BB 3CNQP 4CO5A 1YRXA 2CJ9A 1KD1T 1IBLJ 1R8CA 1F3VA 3W2WB 4IQXA 4ELUA 3H59A 5DZ6A 1UPPA 3PDNA 2PI4A 1M90T 2ZOMA 4LT6A 4RNFA 4LFAF 4AXJA 3SDEA 3O5TB 3GILA 4BS2A 3BN4A 2F3JA 2NCKL 1U45A 1C1CB 1FKPB 4DCOB 4V19J 2AD9A 2VB6A 1N5QA 4RWWA 1WEYA 3QBCA 4USWA 4DPWA 3UI3A 5K8NA 2F63A 1FNMA 2CZ9A 3KFWX 3SCIE 2V8PA 4X4SA 1CJUA 2XLKA 4IOAQ 2HHPA 3GPAA 2BJ1A 2IMOA 1Q81T 4F36A 1R7IA 3HVAA 2BKPA 1DURA 5IWAF 1N56A 4NLPA 4JI8J 3UW1A 1N32F 2ZZMA 2AP6A 2PSZA 2K3IA 4L76A 1EHWA 3RBXA 4WWSA 2QIFA 2VFRA 3DRRA 5D3GB 2UZAA 3FFIB 1Y00A 3DGPA 2G2YA 1S59A 5HVHA 2GVDB 4DR2J 1XMBA 2ZBRA 1DRZA 3P45B 2DNHA 3M1VA 3W5XA 3ZNJ1 2DNPA 5HP1A 1NJZA 1SL1A 1UVMA 2GVZA 4K5SA 3TEHB 4AXIA 1D3WA 1K47A 4F67A 2CQBA 2OKQA 4CH1A 4HL9A 4Y0FA 4NLUA 1LKZA 1NZ8A 4QYZJ 2NXNA 5KOXA 8ATCB 1PAEX 3SCLE 1PBAA 4DG1B 2HURA 1FRHA 2J0QD 4DX6A 2H9ZA 3N6NA 4TYBA 5A0YB 3ZZ0A 3HZGA 1UCNA 2GQCA 2XY6A 2Y9HA 4ZJOA 3IGVA 7FD1A 1C0TA 5ITHA 1RADB 2EXUA 3CD0A 4X4RA 5LMUJ 1URNA 2NZ4A 4RZRA 2QRRA 6FD1A 1YJNS 2W7AA 1ZBTA 1S7IA 4ZJLA 4LFAJ 3THPA 2KDOA 2B4UA 3SIPB 4Y28C 2XMVA 2HGNA 2XCPA 4ZLLA 2MDAA 3LH2S 4RKUC 4IRDA 4NXMF 5KT7A 2OPPA 3AD9C 4UTGA 1X0PA 2IYIA 3TQEA 4G1QB 1LV5A 3BGRB 1X4HA 3DOLB 3W1YC 3SYZA 3KLFA 2ABYA 4LF7J 2ERRA 3MUVP 3Q22A 3G4SS 4RNOA 3G8TA 4K7QA 5IWAJ 3R6LB 1ZETA 4UF4A 3F56A 3H42A 1KLMA 1HR0J 3JSBA 1TKXB 2KG0A 2VG7B 3HO1A 1FRMA 4NLDA 5ETMA 3CCWA 2XNRA 2QLJB 5DRKA 4B17A 4FKYA 1HQEA 1T9VA 4HI2A 3RG6A 5F8GA 3A8KA 2ALZA 2UXDJ 1HWUA 4ZVGA 4R25A 2G1HA 2VPXB 3DLKB 4TYAA 4Q43A 3VGTA 3IM8A 2VG7A 2B8QA 5DG8A 5C42A 2W9BA 4DLGA 5DGBA 4I6YA 2DD8S 5B09A 3OHBA 4ETZA 3DM2A 2QL7B 2WOMA 3CSKA 5JVHQ 1KRPA 1CJTA 2GAGC 2EKNA 2HBYB 3CIZA 3O1LA 4HDGA 5HJYA 2IC3B 4DSFA 1OSCA 3THTA 4I67A 3UFCX 4KTQA 2N7CA 3IBWA 2R8IA 3PO4A 1X7VA 4HACB 4KO0B 4DLEA 1KVIA 3ILLA 2DVIA 1SC3B 1TL7A 3HHLD 5LMUF 2FC9A 3BGUA 5C2GA 5KOWA 1U1RA 1U8SA 2MLZA 3KG0A 1RHJB 3MMAB 4I2QB 4CIOA 1LWCB 2M2BA 3BEGB 3KLIA 3OFGA 5CA5A 4K4TA 1XR6A 1C0TB 2D9PA 1NPKA 4U67Q 1T05B 2VL1A 3CCTA 4PG7A 1TR0A 3UR0A 2C42A 4FZVA 2CJYB 1RTHA 4DG1A 3VAGA 2YXLA 2VA2A 1KNZA 3MOJB 2O66A 1FERA 4OZ2A 2Y1JA 2MZQA 4MT1A 4OZLA 3MM9A 3GIIA 3QIPA 3W65A 2M0GB 2MQNA 3VAJA 2RRNA 1I94J 4ILMA 1GXTA 4I68A 1WHYA 1XN9A 1A7GE 5HO4A 4CWBA 1UWBA 4DPYA 5ETLA 4LUBA 1TUWA 2VPZB 1IKVB 2W2OP 5GMKa 4DFMA 3W2VB 1FDBA 2CJXB 2V8DA 1KOOA 3M8RA 1V6HA 2HHTA 1RHMB 1Y9OA 3L95X 3OTCA 4HTJA 5D0RA 4PEOA 1N0VC 2DY9A 3HHLA 1EX8A 4NI2B 4AQYJ 1FDDA 2V4QA 1H7XA 5K20B 4RNHA 1HNVB 5KFBA 2KXFA 5B0CA 3UO0A 5KFGA 5FDLB 1ZTTA 1RYSA 3QRPA 3PYFA 1RBOB 2QMUB 3TQ1A 4PUOB 1FEEA 2PT0A 3MD1A 4PQUB 2C3UA 1IWAA 3HHLB 1VRQC 4PYDA 4RNMA 2OTLS 3D6TB 3AOAA 1FT8A 5KFYA 1CJUB 5K8PA 2AEMA 2P2CB 3RAQA 1R89A 2EFGA 1HD0A 1Q7LB 4TU7A 1QTNB 2HHXA 1KP6A 1C0UA 2VU5A 3PHEA 1KKHA 3KK1B 1LW2B 1LWFB 5CD4A 4LR8A 4DOZA 5HVFA 1TKZA 3OR1B 4H4MA 4DR7F 4RJVA 2MKJA 4B3SJ 1QUPA 4ZPVR 5ETSA 2O1PA 3DRYA 1RHUB 2HVHA 1SJ3P 3FSIA 4RW4A 1FTRA 2FD2A 4PXDA 1SKUB 2FHJD 3EVMA 3SEOA 3OHAA 3P49B 3M2UA 3V2UC 3D1HA 5JXSA 2A2DA 1JKHA 4DI6A 1JXEA 4LRDA 1EKRA 2OPQA 4ILLA 2XMTA 2DGWA 4J37A 4PXBA 2YKQA 3NCRA 4USJC 4UOHA 2MZ1A 2DKOB 3K2YA 1B64A 2W2PP 2RMLA 4FN5A 2FGOA 2KJVA 4HACA 2EWHA 4N8NA 1CJVA 4P2SA 1YJWS 1L3SA 1T9WA 4PYAA 2OGUA 2E5GA 3EVWA 3F44A 5F0UA 2DPIA 5FD1A 3BB5A 1HL6A 2BX6A 3A8JA 3AAWB 4F04B 3VALA 1PG5B 2DHSA 3GYXB 4UQGA 3HJVA 2RF2A 4A8XA 4ZP7A 2GJFA 1BMQB 4FYXB 2N3LA 3EDRB 3BBBA 3S01A 3CMES 3NGDA 3CMQA 2CKWA 3D6HB 1ZPWX 2NPFA 4F3QA 4DR1J 3GV5B 4CLZA 3FVYA 1B0TA 4LF8J 4KIAA 1AUSL 3DU5A 3RB0A 4KBIA 1A9NB 3FSXA 3PCOB 2D69A 4B3TJ 3V6HA 5ETQA 2NLWA 3R1HA 3DLBA 1PYOB 4FYVB 1TV6B 4ZIWA 3MAHA 4UW2A 2ZM6F 2CPIA 1R0CB 4NZ7A 2JWNA 4N7TA 2QLXA 3CD5A 4OI0A 3MGJA 4QPTA 4WCEQ 5HMXA 4TU8A 3V81A 4DSEA 4GVBA 3ET6B 4CLKA 1N0UA 1UFWA 3H2VE 5CYQA 4B3SF 2JL9A 4KGMA 3BV8A 2ZH6A 1CLFA 3KOAA 3AJ2A 5J2QB 1FX2A 3A1YG 1S1UA 2N7YA 3MTJA 4DL7A 2ZH4A 4IG3A 2IRXA 1ZAXA 4IDKB 3IBCB 1KQSR 2VFTA 2VKRA 1JLFB 3C6UA 3FBCA 4QIEA 1XWLA 5EX3A 4LFBF 2DNOA 1IUJA 4RR5A 4W98A 2IJNA 4KHMA 1PJ7A 2BACA 1TELA 1CJKA 1Y4ZB 3WHIA 3PXGa 2UVVA 4LF9J 1TL1A 1CG2A 2IM0A 3BN7A 1B0VA 1S6UA 4N47A 4C0HA 4DL6A 2Y1IA 3R6GB 4NLSA 2DGVA 4DV4F 3R5GA 1RT2A 3UCGA 2RRAA 2RJZA 3MDFA 3IWXA 4X62F 4OZNA 1Q78A 4J9PA 4EMDA 2J9DE 3PKYA 3C2PA 1UJ4A 1WEZA 4J9NA 1PO6A 3A3NB 2I9SA 2PFDA 4F0HA 4M5KA 3D0HE 1SIWB 4F02A 5AXLA 3ZZPA 1AZSB 3IP0A 5KG1A 1D9FA 4LF6F 2VZ9A 3P6YC 4CDIA 1WWHA 1KVJA 4QIGA 3NMAA 2AJQA 4FNIA 2APOA 1Q16B 4QWBA 2UP1A 1TFWA 1RJJA 2AWZA 3BF4A 2B5JB 4TLRA 1GTHA 1MMLA 2RDJA 2ZM6J 4KV8A 5A2QU 4C8YA 2A3JA 1K73T 1IJEB 2ATCB 4MYUA 1SJRA 1BLUA 3SSSA 1S77D 2DGXA 2YX1A 3R97A 2ZHAA 3JSMB 3PKMA 1U1NA 3FEYB 1IKYB 1MWZA 4F4YA 4DWIA 4PZVA 2YWWA 5DDOC 4MJKA 1Q0NA 2KKHA 2JZ5A 4NYOA 5B0GA 1R6VA 4I64A 2I1RA 1RKIA 2CDQA 4LRCA 5HSPA 2DH7A 1U6ZA 3KHLA 4ZJQA 4ZCMA 2VG6B 2DEJA 5KG2A 1HYSA 1WELA 2NXCA 3W60A 4PWDA 4C8KA 1OSDA 1JLAA 4C11A 3NGTA 1KTQA 1RTDA 3KNAA 5J2MA 5IC6B 4OHYA 3F41A 1ZAVA 1SQFA 3K5NA 1RT5B 5KFIA 1YDLA 1UEKA 4MFBA 5BYRA 5DG7A 2PC6A 1RT3A 4UY85 2XWXA 3B78A 4K8RA 1TMMA 3QRRA 4BWJA 3PR4A 2R2SA 1J2VA 2GMJA 1KR4A 1YIJS 3DOMB 2H54B 2I2YA 5E33A 1NK5A 2V9WA 4NLTA 4YHHF 4R5PB 1R0AB 1UEVA 4NCGA 4HH1A 4IRKA 4JI5F 2WW4A 1XEZA 7FDRA 3FQKA 2BANA 1NPRA 1VBYA 1RTHB 2NXEA 2YWKA 2AGQA 3MR3A 5ETPA 3HT3A 3HDSA 1CS4A 5DZ7A 1F9EB 2Y0SD 1DTTB 1JNRB 3W8PA 4UUWA 2COLA 5E0OA 3DLHA 2J7UA 1XMQJ 5D8HB 3NY0A 3KLGB 2V8GA 2P6SA 3NWRA 4MKVA 3PR5B 1SIZA 1KBRA 4KH1B 3M8QA 2IIHA 1HWJA 2H5EA 1JLQA 3K58A 3C14B 4LSNB 3NP5A 4XO0A 3MURP 2B9WA 1VK3A 5B08A 2R42A 3PG9A 4NEZA 3OJSA 2OHDA 2R2TA 2L3MA 3D5MA 3PJWA 2KXNB 2RS8A 4NX9A 5IT0A 3LUYA 1MMNA 4KRWA 3BSCA 4NMLA 2Q6BA 1SV5A 2E5HA 4WBFA 3RBZA 2CJKA 1FKOB 2W9BB 2BXJA 2X7IA 3M2RA 2WONA 2H3EB 3ZZTA 2PDAA 1H0HB 3N28A 3OD2A 4GC7A 1SVDA 1CULA 2IAJA 3W9IA 4WFBQ 2Z2LA 3LPEA 4ID5B 3ITHB 5D4LA 1YX2A 3OBIA 2DR9A 4XDCA 3HF5A 3DKDA 4HI1A 2YWHA 2OIHA 3PHTA 4DUYJ 3ZZYA 3LTOA 1A6LA 1NUEA 3TNVA 5L9XA 1WDDA 4WJBA 1UVKA 3DI6A 4YHHJ 2FUG9 1JLAB 3W7BA 4C6AA 2KT5A 3T5KA 1IQTA 3NXZA 4JI5J 4HVZA 2RHSB 4G1QA 1XNQJ 3I6PA 3OQ2A 2AW0A 3VAIA 2DTJA 5AE1A 3UDCA 1QY7A 1UETA 4HT5A 1WDTA 3N4WA 4QCLA 1OYDA 2KM8B 5KFWA 1HQ2A 2XZDB 3C66A 4CLWA 4Q7AA 3RYLA 3CVKA 1WOPA 3UN2A 2MKCA 4ZPCA 3VVUA 1XMQF 3CC7S 3PO5A 4F4ZA 5IFMA 3O3LA 1HNXF 2VV5A 4YQWA 4F4XA 2DR5A 5KFKA 1WC3A 2R4FA 3O6QA 4F3MA 3M9NB 4DQIA 2NYHA 4WZQA 1BC6A 1VIOA 3FEZA 4OI6A 1CULB 2MLYA 1M1GA 5HK4A 3FRYA 1XR7A 4IH5A 3CDBA 1RKJA 2F7VA 1C2PA 3K5LA 2QYGA 2VG5B 2D3UA 3DXBA 1RT6A 2HAFA 4ZPTR 4DQPA 2DRDA 3MPVA 3NGRA 4AL6A 3Q8VA 1CVJA 4DX5A 2VH7A 4YR3A 4DR4J 1TKTA 4DV3F 1SH3A 2HRUA 4CTAA 4J9UE 5LXYA 4QW9A 4AYBD 2LEPA 2GVDA 4KSEB 3BO4A 4JI3F 2G9OA 2QTWA 2AF6A 1VIXA 3MCNA 3Q8UA 3PX0A 2AZ1A 3JXOA 4IO1A 1SUQB 2Y1LB 3MEGB 4O3QA 2ZHBA 3GCXP 2FYXA 2K06A 1FDNA 1YVFA 3GG1A 5HBMA 1O8BA 2AJ4A 4M94A 2OD6A 1IKWB 3Q8PB 1M1HA 4LSLA 2Q79A 4LF1A 3AA8A 1U26A 3E2EA 3S6EA 4CLFA 5F8HA 2FPHX 1ZA2B 2KH9A 1DQ9A 5HATA 2LU2A 3J7YI 1BQMB 2OMLA 1GMVA 4ECUA 2QLBB 1SJQA 4H4OB 2CPDA 3Q8QB 2DO0A 1T11A 1VQ5S 2HQIA 4OYOA 4F3OA 1UVNA 5J2QA 1D0EA 4IO9Q 3SCKE 2DITA 1S10A 2BA9A 3OXFA 3NBPB 1QJHA 5CYQB 1FRXA 1AYEA 4OZ5A 3DOMA 3NAIA 5E2QA 2OJ3A 1JWWA 2CZVC 2XNQA 2C2ZB 1R8BA 2D7SA 5KG7A 1FWLA 3D67A 3D6FB 2W1BA 2CPZA 3ILJA 2FLLA 2NUUG 2BKOA 3MMCA 2RAQA 3T3FA 5I3UB 2EC2A 3GG0A 3G8SA 3R5JB 3UNGC 3MOZA 2R8HA 2O3DA 1Z2ZA 2VODA 2XCAA 1F60B 3GFYA 4DV1J 4EBEA 4CLYA 3M6WA 2R8GA 2QYCA 3TAMB 1FWPA 1GNKA 2ZKTA 2QL9B 2XULA 1H6KX 4NLQA 4L3KA 3TA2A 2UUAF 4PABA 4HDHA 3PZPA 3RAXA 4JI7J 3GZ7A 3HFVA 1BUXA 1HBMA 2OEMA 3BBFA 2J0SD 3H40A 1ZPVA 2BEFA 2E1AA 4OIXA 1U1MA 3LAKA 5F8MA 1IJFB 4NEYA 3KK3B 2VKZG 4ZPBA 4ECRA 4K0KF 3OTDA 4DMZA 2V4JB 3N79A 4NLVA 5KFRA 2I5JA 3W64A 1YHQS 1CJVB 1HMVA 2YWFA 4I2PA 3UCUP 1N48A 1EJ7L 4CNZA 5KT6A 2BW2A 3T9ZA 2VJVA 2CPXA 3I0SA 2HQDA 4KE5A 5GMEA 4P9SA 1F9HA 4LBIA 1WTFA 1HBUA 3NGUA 3V4MA 3W9JA 3UPFA 3N6MA 1RT4B 2B56A 2C2MB 4Y2AA 4ZHRB 4K59A 5I3PA 5LSLA 1RB0A 3B82A 3HHDA 4M5DA 4XPCA 1GX5A 5KG5A 2H48B 5J2NB 1VOMA 3ZO7A 2LEAA 2ASLA 3AB2B 4FF2A 1HBOA 3QLHB 1M5HA 3EGNA 5G4DA 4FS1A 1T0TV 2AV5A 3D66A 1SJFA 1HNWF 2HIYA 2XMKA 4KAIA 1S9GB 4EWTA 3MTKA 4OI1A 1HBMB 5GADI 2ZITA 3EX7B 4LQ9A 1FRLA 3I9V9 2R7WA 4ZP8A 4ED8A 2W8LA 4OZ1A 3RB3A 5GAHU 3MM5A 2BJEA 2NZCA 5KFZA 2E1RA 1Q8IA 2R7RA 4L6V3 3TVYA 1QE1A 2DHXA 2V5HG 2ZKUA 3HSJA 4MYTA 2IDLA 4DV1F 1AUDA 5LMNF 1BWEA 2KZZA 3HCXA 2VONA 2GGPA 1R8HA 1WC4A 3C6UB 3LANA 2B3TB 2ZD1B 2D3O1 2L9DA 1Z2LA 1HWKA 4NI2A 2QGFB 4C9DA 3PW0A 3MFIA 5IT9U 5I4MA 3GQCA 1SL2A 2JEJA 4FXDA 3T1YF 4FKXA 2RHQB 1TL3A 3HKWA 4BCAA 4K0KJ 2CQHA 1UWBB 2L08A 1WI8A 2GHWA 1S9EB 3ZZZA 3DCAA 3PW4A 3N6LA 5KFNA 3UR3C 4YB7A 4RPFA 1N5SA 1SI9A 5F9NA 1ROFA 1SCJB 4USUA 1N34F 1NSPA 4ZLNA 1KLNA 4JI1J 2GJIA 4UOFA 1RT1A 1Y11A 3Q8SB 4G65A 1RAOA 2X3DA 2XS7A 1VHFA 2DBBA 3V4IB 2AIRB 3DRPB 3QWUA 2BRKA 4LR7A 4KY3A 2NREA 1VRTA 1U1PA 2BZ2A 2KO1A 1WUUA 1X60A 2ZEJA 1F1BB 4J91A 5DO2A 3OLAA 4B9UA 4C8LA 4J5OA 2YNGA 4USIA 4ELVA 2F4VJ 5D4PA 2DNGA 3M8PA 1NJYA 1NJXA 3E3XA 1HNWJ 3T19A 4EGLA 1GK8A 5D4NA 1KSPA 4ZPAA 1Y5IB 3CJ5A 3DMJB 2WTFA 2V4RA 3TI0A 3FBBA 1RWUA 3KLHB 1NO8A 2X3GA 4QOTA 2ZHOA 4CT9A 3CTRA 2MGZA 2F9JA 3MCOA 2R7QA 1TUGB 2OPQB 4KYZA 4P2MA 3VQSA 5IXUA 5AJ3J 2FVSA 2KZMA 3QGGA 1SKSA 5LMNJ 4UOCA 1N54B 3QWPA 4R0JA 3DLEB 1DAXA 3CO9A 3D28A 1NK9A 4HKQA 2BMBA 5DETA 2GO9A 1U2RA 1IR0A 1TUVA 1HWLA 2B6AA 3HD1A 1NM2A 2UU9J 5CZVA 4IFVA 1UVJA 2MZTA 3HK2A 1RSCA 4C2MA 5J1EB 4YB6A 3TUIC 1VQPS 3HD2A 2MQQA 2G0CA 2JDJA 1EP4A 5C2CA 3G82A 3I5BA 3EXYA 1JLBB 3BGRA 3DOLA 2EW9A 1Q95G 1HARA 2A1BA 2DJWA 1WC1A 3KLEA 3OV7A 5CYMB 1TAQA 2HRYA 4NLYA 3RRHA 1B70B 1IBKF 2HHSA 3QYYA 3P3DA 3VV2B 3KUGA 1E6YA 2ACMA 4H4KC 2LQJA 3P5BP 2CQIA 2R2UA 3DI6B 1UFKA 1RWMB 2I6WA 4DXLA 3HXMA 4ECYA 1S0VA 1WOOA 2YPYA 1NSKL 1U02A 2F1FA 4GO7X 4URGA 2B9EA 3ZZUA 2RS2A 2F4VF 4ED7A 4NLGA 2ACYA 2AYGA 3LPYA 5KFFA 4FF3A 3BKTA 4X66J 2BQ3A 2GAHC 2JVOA 2DPJA 2WRMA 3AJ1A 1U1QA 2GJ2A 3UVJB 2CNOB 5AE2A 2C28A 5KFMA 4O3SA 1FKOA 2HIQA 3FSYA 1HBNB 2NXJA 2W4PA 3H5XA 2FIUA 2QJ3A 4F4AA 4Y65A 5AJ3F 2QMWA 3G6VA 4DR3F 3GCWP 1N6QA 4ZHRA 2DNKA 4TY9A 4WU3A 4LF7F 4YEAA 1M1KT 2ZE2A 3M32A 5DQGA 1UL3A 3MMAA 4L3NA 4ED4A 2ZUGA 4LSNA 1UJ6A 4AFFA 5J1PA 3SXLA 1T3NA 1HR0F 4BDPA 4CLPA 1S4FA 2N3OA 2LXFA 3KMSA 3LGHA 1QDUB 5GVQA 1V3SA 4KR0B 1NJWA 2RD5C 2HYIB 1SC4B 1I3OB 2UXDF 3D4JA 3HVRA 3HT0A 4X65J 4DSLA 2AX1A 5I42B 2FVQA 2HMIA 2GQ2A 3MAAA 2W9AA 3CDWA 2CPEA 3F73A 3PW7A 4ZCIA 5GAEI 1RXOB 4IFVB 1VBKA 4ZCLA 2AJ1A 3TUJC 3CMAS 4O23A 5M2PA 3KLVA 3DDIA 4HHUA 3D68A 4OX6A 1FE4A 4QPXA 1VQ6S 2E9RX 5K8OA 2FJWA 2QMXA 4M5IA 2BM0A 1SH2A 3LGMA 2CQ3A 5A8RA 4X66F 2YH1A 1U1LA 3J7AN 4C97A 1U25A 2V67A 3PTWA 3MUMP 3MAQA 4WP8A 1FRKA 4BHQA 3CJ2A 2H5IB 1U0SA 2YWEA 2MHEA 1WOSA 2CG4A 2XQCA 5CXTA 4WKRA 3NCPA 2IY5B 1AFIA 5B0AA 2HGMA 1HYSB 4K5RA 2V9KA 3PX4A 3IWNC 2M7SA 1HI1A 3WQPA 1VLOA 2C3PA 3PYGA 1FVSA 1R27B 3IG1B 3IAS9 4X2BA 1U0HA 3KXDA 1I94F 5HQLA 1YRTA 3WC2A 1N8RT 4NE9C 3SMZA 1AB8A 3K8VA 2E9ZA 2MMYA 2YNGB 1M0SA 2RILA 2QA2A 4ANEA 1EZZB 1RAGB 1ZM2A 4GRSA 4IG0B 4ZPWR 4XTTA 4JI6J 4ZKAA 1S57A 3DOKB 4V1Ak 3W3SA 5A8WA 2J6SA 4AQYF 1TP7A 1SC6A 1S79A 2CNNB 3N5BA 3PM9A 3MM6B 1NHUA 3EDQB 3NAHA 3CJRA 5BXIA 3ZXWA 4A8QA 3ZNUA 3I56S 1OMSA 2GIFA 1S72S 3PY8A 1N88A 4USTA 3KUHA 1NK8A 3V6DA 4CTAB 2HNDA 2HS0A 1P1TA 2MZRA 2IYGA 3BDEA 1AZSA 5KFAA 2AT1B 3MPUB 3O44A 2KM8C 1JXLA 1NH7A 3AOBA 3M1VB 1PSDA 3RW7A 5HP1B 4IFYA 2H5JB 5B7WA 2Y8WA 2CNLB 4WPAA 1RTJA 3RRKA 1W7WA 1HQUA 5M2UA 3L3CA 3NNHA 5KFPA 4DR7J 1X5OA 4GKKJ 3ZTSA 5DQIA 1TKDA 2M5YA 2G0JA 2GIRA 2E7VA 2IFXA 1EETB 1RWPB 3D54A 3TARA 5C25A 4EK2A 3FNNA 2KT2A 3K17A 1T94A 4A8WA 1VQNS 1YJUA 1NK4A 2F8HA 4ERDA 2XYHB 2CXEA 3SQGB 3J7ZT 4HHHA 2UVWA 2W2QP 3QATA 5K9FA 2M70A 2H4YB 4IDKA 3CJ8A 5KG6A 2VBXA 4NPOA 3RU0A 4BBYA 1FKPA 3EJMA 1C1CA 1LK7A 4ILRA 2HSEB 4U8VA 1FF2A 3A8EA 3TUZC 3ENWA 2EKYA 5K14A 2B0GA 1YGYA 3QGPA 3T6BA 4CO0A 2BDPA 5DS7A 4DX8H 1OO0B 2V2KA 2FC8A 4L72B 4M5GA 3OJUA 1T03B 1GT8A 4OYPA 1FJGJ 5KFLA 2MY8A 4MKBA 3QAUA 4DV2F 2YQ3A 1H2TZ 4I4BA 2VQEF 1TV6A 5KFUA 4DR1F 3IR7B 4KGKA 1NBEB 4LF8F 2UXCF 4DR6F 1S49A 4Z2XA 3M2RB 4DV5F 2YY3A 1FHTA 1ZOTA 3DC2A 4J9RA 3AOCA 4JOUA 1Q5YA 1M5PC 1IBKJ 2DGQA 4HLBA 5CQGA 4W90B 3KK3A 4A46A 1ZS6A 3EE3A 4DEZA 1C4AA 3GMGA 3F0NA 2ILYA 2XWYA 5ETRA 1Y0HA 3VZHA 3EPGA 1NXIA 3MECA 3QSYB 4C0BA 2GS8A 4K2XA 1L3VA 2DGTA 3NGSA 1YI2S 4GO5X 2B7CB 4KFBB 1S6QA 2WK4A 3HFZB 3HX9A 3CCES 1RAAB 1SB6A 4J9QA 1X8DA 1ZA1B 1UFLA 3NOGA 2ZNZA 1F0XA 1JLQB 3IGNA 1KFDA 2RSQA 3KLGA 4G1PA 3VAHA 2HQ3A 4RUHA 4FVMA 3OT9A 4CO2A 4LFBJ 2LVWA 4DS4A 2QFIA 5IQ6A 2FDNA 2SXLA 3FRZA 1WNEA 4LF9F 1S1VB 2NSBA 5F9LA 2XBPA 5EN1A 1N4LA 2HFUA 3TW0A 2B8PA 1UP1A 2J8AA 4DV0F 1N33J 1IBCB 3BO2A 2BABA 2FZKB 1TKZB 2H4WB 3OR1A 2HS3A 3T1HF 3PRBA 3CJ4A 3L09A 4FYDA 1FJEB 4C8ZA 1BE4A 2OFGX 3ELHA 4YFUA 1VJWA 3Q89A 3HJFA 5IT4A 4WP9A 1VQYA 3TVZA 1N5VA 2EEYA 3AXMA 3L9ZA 1GMUA 1Y7PA 1HI8A 2VQEJ 4IOCQ 2OELA 2HHQA 4LF6J 1RTIB 3BKFA 3JSYA 3LAMA 2U2FA 4G1IA 5JUMA 4XPEA 3A12A 2Z2MA 2UXCJ 2BRLA 1HKAA 3SFGA 5HBMB 3KJVB 4DR6J 2V94A 3U27A 5RUBA 1B4SA 3GJRB 4C11B 2ZH3A 1MSWD 5EX0A 1N52B 2XYPB 4MIBA 2CUYA 1X4EA 2G1DA 1FNOA 1R31A 2FZGB 2J7KA 2WSEC 2XO6A 1LXJA 2M8DB 1DJ0A 3C6TA 3I0RA 1T9UA 1FXRA 4M1KA 2YKAA 3QNWB 2RB7A 4CLTA 1G7CB 2ZWPA 2BJ8A 3WX4A 3OXGA 3CEDA 2EFPA 4C4WA 1V3RA 4YY3J 4ELTA 1DQAA 3KDOA 3TJAA 2BV3A 2E5IA 3I96A 3QO9B 2EFNA 4ZA1A 1GH8A 2GMLA 4ECVA 5F8JA 1IM4A 3CDUA 3PFEA 5J1EA 4N8OA 3H5SA 5KAKA 1U6BA 1WF1A 4C0OC 3MM6A 4MH8A 3B6BA 1J5OB 2MKIA 2F4FA 1HNIA 3A13A 3W62A 4OX7A 1T05A 3CGIA 1OYEA 2ZBCA 1OIAA 1OY6A 3D7SB 3FC9A 1FNXH 1SKRA 1HIYA 1MNEA 1S4EA 3HHEA 1NPPA 4A4JA 4IG0A 4L75A 3DNCA 4USVA 2MQMA 3QT8A 4C7QA 3OSNA 4C3KA 2KYXA 2ASYA 1O51A 1RE1B 2MTLA 2YNIB 3OPKA 2E1PA 2YWGA 3CJSA 4HHJA 2HK3A 4LRAA 3VVTA 3KK2A 4DV0J 3CD6S 5HI7A 4X4QA 4M95A 3AD8C 4PPDA 3VQTA 4GC6A 5T41A 4BLGA 2VDIA 4RU9A 3I0RB 3UQSA 4J9OA 5DLFA 3K59A 3FMBA 3LWLA 4H54A 3DRPA 2ROEA 1FD8A 2HK2A 3DM2B 4Y2CA 3ICLA 1SXLA 4ZPDA 5C24A 4A47A 3CCLS 5T7LA 1TL1B 1GX6A 2B4VA 3BR9A 4I6AA 4O4RA 4WE1A 5AT1B 3CIMA 2PMZD 2CADA 1NEEA 1RCOB 4M5MA 4TLQA 5HL7Q 1CJKB 2A6MA 1H74A 4OHVA 5KG3A 3WBZA 1YJ7A 3ZTRA 1G4CA 4Z7YA 3V4IA 4WU2A 3CCVS 4ID5A 3QO9A 1XC9A 4Q2LA 1G1XA 4BC7A 4QWAA 3M4XA 4Q8FA 2XI3A 1JLGB 2Y1RI 2YKNB 2JC1A 3ENAA 3I87A 2AKWB 5IZHA 4FYYB 3TA0A 4YY3F 1VQKS 1S48A 3N5FA 2VHGA 1SV5B 3WIVA 3H5YA 4YOEA 4DU8A 2CVIA 2C22A 3P96A 3Q0AA 2GGPB 5DGAA 2HMIB 1X4FA 4LFCJ 3R1LA 5E5NA 4ZVOB 4ZVHA 3D0GE 2M3DA 2WZ1A 3KJQB 2K8GA 5DDQC 3TZYA 2OO4A 1CPZA 2BE7D 3OUYA 4DPOA 2FVCA 3EXCX 2VC0A 5FLXY 4A8SA 4X4UA 4UOGA 1UVIA 1TVRA 4RL1A 4ZN1A 2UUTA 1WG4A 3IM9A 3M8QB 4D3GA 2ASDA 2Z2YB 3GWCA 4M5HA 3MF5A 2F5GA 2XMAA 2OPSA 4LIWA 4YMEA 2WVCA 1ZTWA 1WEXA 2C2NA 2IBOA 2FHKA 4JV0A 1HBOB 1U24A 1TL4A 2B9XA 2LLZA 2WCXA 3OVSA 4DUYF 4DFJA 3C3LA 2VC1A 1N6QB 4LRBA 2WVFA 1S7HA 4R0EA 4B3MJ 1Q4RA 3WIUA 4PR6A 3JTOA 3PJ9A 4IKAA 7AT1B 1L3UA 1XNQF 3C15A 5ADZA 1VC6A 5F8IA 3UNYA 3OVAA 2K2PA 3R27A 4FPRA 4ZVRB 4CRJA 2AMCB 2GVZB 5SUHA 1NMEB 4DU7A 2DH8A 2RKIB 1Q1KA 2DGUA 4N77A 4ENOA 5B0DA 4ECZA 1I6JA 2FLNA 1TZ0A 3GJTB 2IRUA 1PC5A 4ED2A 1OPIA 4MIAA 4PG6A 1RT5A 1U09A 1VS3A 4KGZB 1T7PA 4U7UK 2IRYA 2DY1A 2Q3PA 3PEHA 2XY7A 5D3GA 3J80U 1YRUA 1YJRA 2H65B 2FJDB 1REVA 2DB1A 2UV8G 1HNXJ 4B9MA 3AFGA 4LQ3A 2G4BA 3D3BJ 2CNKB 4X4NA 3M30B 1HMVB 4NLRA 1Q8BA 4QR1A 2WSFC 4RW9B 3ZZRA 1I1GA 1RAHB 3BPDA 3AH6A 3QAEA 4H4MB 1PCAA 5IM0A 4HYKA 1SJ1A 2CDRB 4O3OA 1LWFA 2J9EA 4U7UD 3G82B 2UV8A 1FRJA 2EFVA 2R8JA 1R43A 1YJTA 1QM9A 4H4KA 4AE5A 4C8NA 3TRGA 1MN7A 3AY0A 1B7YB 3EUNA 1S5ZA 5I3UA 4ANCA 2AU0A 4WF9Q 3I82A 2GO8A 3NKYA 1BY9A 5CH7B 4DV3J 1NK6A 4CM0A 1ZM4A 2MSTA 2EG1A 1EKSA 1REGX 2O01C 4ZVEA 4CCHA 2V2QA 3E01B 5FDLA 4IR9A 2XB2D 2DNYA 4C8OA 1H73A 2DHAA 4KH0B 2FJBB 3DLEA 4CLSA 3MHYA 3VR1A 5H9EK 4O3RA 5KFVA 4OJHA 4CO1A 1VC0A 2O5DA 4DL0C 4DR5F 4QWDA 2U1AA 1YZ7A 1RCXB 3NBPA 2W8KA 5DJBA 3CPWR 2HFOA 4EZ9A 2XHCA 3DRXA 4A8MP 2MB0B 3KTQA 5A8KA 3ISNC 3OSPA 1EAYC 1EETA 2PD1A 3GYNA 2WAQD 1KTVA 2J6UA 3MEGA 3TR5A 3DOKA 3LWMA 1KONA 1B99A 3T41A 2GX8A 3CWJA 4WP3A 4PRFA 5LJ3Y 5L1JA 5ETVA 3LP0B 3KJNB 2DR8A 3NOCA 4MKAA 2GHPA 3FDSA 4LRFA 2JSXA 2NUHA 2DXFA 4ZVFA 1VISA 3KG4A 1Q86T 1RBAA 1YQHA 2YNIA 5GAHI 1Y5NB 3I5AA 5D0EA 2R7UA 3IRXA 4B3OB 4OFZA 1U2FA 1NHKL 2Y8YA 4YP3A 3K5PA 5LL6d 3MPDA 2OH2A 3Q2SC 1E6VB 5THWA 5IS2A 1FI4A 1QLNA 3W8GA 5DM7Q 2W01A 1TL3B 2EK1A 4JI7F 2DNMA 4AUKA 2RDIA 5E3CA 1RT6B 3NWGA 1EQMA 5KT5A 3KHRA 2MKHA 3HHNB 4P10A 4ECTA 1GFWB 2XI2A 4I6WA 3G71S 3T5LA 3V6KA 1RT7A 4OYIA 2MLXA 2YBVA 1X9SA 4RW7B 1ZYQA 2IDEA 3FBFA 4XAKA 1EB0A 3VGVA 3W66A 1OPZA 4P6QA 4ZITA 1S0MA 3GP9A 4ZK7M 4X4VA 5AXKA 1FK9A 2DNLA 3GSDA 3C16B 3ILOA 4DR5J 4KT0C 4QU7A 3JSRA 2R7OA 5F3ZA 3BYPA 2WBRA 3MR7A 4U6PA 1PKUA 1REVB 3H98A 1KN6A 3VAMA 3OLBA 4QIFA 1NKEA 4PWWA 1H72C 2BOAA 2MQPA 3C8YA 5IM0B 2XSFA 3M8SA 4DQQA 2XGQA 4NCAA 2L9NA 4CP5A 2KYZA 3UE2A 3RR7A 5A8RB 3AHPA 4X64F 2F65A 1HI0P 3NMRA 1K1QA 3EZUA 1CC7A 1PYTA 1XERA 2JC0A 1UTAA 3D3CJ 1TU0B 2XZTB 2XEXA 3LP2B 1YWXA 2BQUA 3EM1A 4DN0A 1R0BG 3M8ZA 1A0OB 1J27A 3IS9A 4EBDA 1NDLA 2A10A 3M6XA 4ETXA 3J81Y 2DNNA 4RW6A 3SI8A 2QG9B 1FO1A 1J5EJ 3HULA 3MEDA 2Q6CA 2XSJA 3QT7A 3RJMB 3SV3A 2V4JA 3QT6A 4I7FA 1QAJA 2MQ8A 3AA9A 5EGYA 2YKMB 2DH9A 2CQ1A 4KB7A 1DZ5A 3JQMA 1IKXA 3A4TA 2ZVIA 2NYIA 3ONQA 2VICA 1YBTA 4O4GA 4WFYA 4ZS6A 4I1TA 3SFUA 1S1TA 4TNOA 3R7NB 4QYRA 2OLWA 5JJBA 3D0IE 5JMNA 4OYXA 3KMQA 1PYSB 3TUPA 4QR2A 4NXMJ 2ATLA 4YB1P 5KFHA 2G2OA 1HW9A 2QC3A 3GSIA 2BBEA 4I56A 4A8OA 1VQ7S 4DV6J 3J81j 1M5VC 2DO4A 3UVJA 2VQFF 4K4VA 1RU2A 1Q8KA 4JI4F 1NCLA 2JLEA 1C1BA 1L3TA 1JJHA 1XBWA 3IS9B 1BHNA 1WHWA 2FHJA 3P8BB 3QZ8A 3IN5A 2BVZA 4CLLA 1QSSA 1RT3B 2HWTA 2IVYA 4Z37A 4MFBB 2VPYB 1IWGA 1HPZB 4R5PA 1R0AA 2KFZA 1JLGA 3GJQB 1T03A 1FJCA 3JB9k 2C1EB 1ZZNA 5H9EJ 3MEKA 3PIPQ 3ETMA 3MI7X 3B4MA 1WJ9A 2ZJRQ 6FDRA 2VOOA 3GIJA 3EGWB 2LA6A 4NLOA 4EYHB 3CCUS 4CLUA 3PW5A 2RDDA 4LSLB 1LWCA 5CYMA 5D6GA 1ZAWA 1EQ0A 5J2MB 2PEHA 1KQFB 2W2MP 4NA2A 1J5EF 1X9WA 3TWZA 4DZDA 2AJ0A 4FDFA 1R3NA 1IN0A 2JX2A 2YNHB 1F9FA 3DMJA 4OHZA 3CJKB 1MMDA 3CDEA 2F9DA 3HHKA 2JJ4D 4EO8A 3QSIA 1PJ6A 5L1KA 2UU9F 1GMWA 1WACA 1M5OC 2CWKA 3H5UA 5HJXA 3QZ7A 3IR6B 1FA0A 2DCLA 2OEJA 4NLWA 1KS2A 1HWIA 4Q2MA 4OLOA 1RTJB 2VG5A 5CD4H 2XMMA 5DDRC 2KFNA 3BKUA 3EGZA 6AT1B 4IFYB 1TQLA 2E44A 2K1RB 4ZDNA 3ISND 2J5AA 2LKZA 1RHRB 2VFVA 1HNIB 1RK8A 4RWXA 5KFEA 4OHWA 1UKUA 5GAEU 1RISA 1E6VA 4NRTA 1VDHA 2XYGB 4OYAA 5E3RA 1XMOF 2X1FA 2VUGA 4JI4J 3DDNA 3EPIA 4DSKA 2PA3A 4JI0J 2Z0GA 1XNRJ 1WSRA 4FBTA 2HZAA 3LO3A 1SQEA 4CH7A 5AXNA 4E0DA 5KFTA 1G3OA 2E5LF 4TQRA 4WIQA 2F8MA 2C3MA 3AD7C 1X4DA 4ES3A 4QWEA 3I4PA 2FHOB 3TX0A 3JQKA 4OYZA 2WBMA 4USKA 3GV8B 2EPIA 5KG4A 3W63A 1RTIA 1MU2B 2MQOA 1JQGA 4USHA 3S7RA 2MY7A 2JLGA 3CJTA 1LW0B 3G86A 4KQZA 1UW4A 3PYDA 2W4DA 5A6WA 3D2WA 3KJVA 2BW7A 3CCRS 3RR8A 1S6PB 4DR3J 2DIVA 4IG3B 3PNIA 1F2GA 3R5CA 4K4ZA 1I51B 2EVZA 3E8OA 3CCSS 4UY8T 1YG0A 2V2ZA 2ZFHA 2ZH5A 5B0BA 4F2RA 5M2RA 1RUSA 5L1IA 1UA1A 1X9MA 1BQNA 1F2HA 2K7KA 3OR2A 3LW5C 5MAOA 3S8SA 3FEXB 4OZ3A 2B51A 1HFEL 2J7WA 3OXLA 5KFOA 4DV7F 4TKTA 5IOLA 4L74A 4DL2A 3O2IA 2F8EX 2DRAA 2KTQA 3NLCA 5E3AA 2Z30B 1P8GA 4AD6A 2AEFA 1PILA 4CNYA 1H98A 5F0WA 4Q5VA 1RA6A 4A8YA 2QA4S 5HMZA 1JLCA 4NZ0A 1LOUA 4X65F 4NLXA 1VJQA 1LNQA 4ZVSB 2Q1LA 2JVRA 2W25A 1AT1B 1VYAA 3AJDA 3MR5A 3FFIA 4IOBA 3DYAB 1VMBA 1IQZA 1XMOJ 2QA1A 4FXWA 1NK7A 1IKXB 4GKJJ 3TA1A 2ZDPA 5I42A 3OTOF 4NXNJ 2VJUA 2YKMA 4NZ6A 4Y3CA 2I5JB 3J7A1 3HSGA 4K50A 2HVIA 1SJ4P 1DTTA 3QLHA 4EYIB 1X5TA 5DQHA 2XSJB 1VR6A 3CCMS 2J8SA 2RF2B 3CT9A 3JTNA 4LREA 2RQCA 2IHR1 4B9NA 3FZ2A 4F8RA 4PWUA 2HEKA 2UUWA 3VWSA 2D41A 5LJ5Y 3R5DA 3TP2A 3DYAA 4JP8A 1JXVA 1KOHA 2D9OA 2OUGA 4LSZB 4CI0B 2E7WA 1M5KC 3NG8A 4Q45A 1U4BA 1JMTA 2CA9A 4O3NA 1ELOA 2K7JA 2RQKA 2E7XA 2RKIA 4O0NA 4F26A 5CCLA 3CCQS 2M88A 2P8IA 4ECQA 4J9VA 4URSA 1BXNA 2BJ3A 1HBNA 4OJGA 1YKWA 3VF0B 4E98A 3QRQA 1H2VZ 8AT1B 4DV7J 4NL5A 4P72A 2IM3A 2LFVA 2K3KA 1UWAA 2VD3A 4JI6F 1LWEB 5HQMA 3BQ1A 4N41A 4LF4J 4DPUA 1TK5A 4PWDB 4Q0BB 3VGSA 2FJVA 1NRKA 1VC5A 4Y6IA 2OP5A 2OFHX 2HVEA 1HA1A 4B9LA 4FF1A 3LP1B 3HHLC 4EI2A 1FD2A 4PG8A 4F2SA 2D1CA 5F8LA 1Y10A 1LW2A 1S6PA 3BR8A 4OZJA 4X4OA 1RAIB 3GU0A 2DK2A 2E5JA 5LXRA 4RW7A 1JB0C 3MUTP 1HNVA 1OWXA 2XMWA 2QFJA 4ED6A 1HQUB 3WX8A 1CC8A 1RU1A 4WFNQ 3GFHA 3JSMA 1IKWA 3LGNA 3TJ9A 4X4PA 4ED1A 2HGLA 2J0XA 4J9KA 5H9FK 3I9ZA 5HANA 2R7SA 2EK6A 1JJ4A 3X3UA 2EBGA 3FCVA 3FKBA 1IKVA 1H2UX 1Q53A 2GC8A 3H8YA 4K4UA 4QYZK 4FPIA 2H1YA 2R8KA 2YPZA 1FEHA 5CYJA 4R8UB 2ZOFA 4GKKF 4K4YA 4ES2A 3QIPB 4OJ3A 4PCQA 3V6DB 1FWKA 2DRBA 1HHQA 4M5NA 2YKNA 2NQPA 1T3OA 1YZ6A 3MEEA 3QGIA 1BQMA 1K9MT 4EFAC 1SBRA 2JHEA 1UJ5A 3K5OA 1H38A 1KHVA 2K1RA 4RUBA 3X1LB 2CQ2A 4JI2J 3J80Y 4CYUB 3B4DA 4NYPA 4OZ0A 3KLIB 1FX4A 1FVQA 2W2NP 3KWMA 1S9FA 2NSCA 1QAYA 2LDYA 3H25A 4IR1A 2AQ4A 4IH6A 4KO0A 1FFGB 1IR2A 5HAOA 2CQ0A 3QJPA 3T5JA 2FZCB 4I2QA 1RDRA 5CABA 2LXIA 1P6TA 4EU0A 3HM9A 1D09B 4AT1B 1FJGF 1TL7B 1RTZA 2RE1A 4DV2J 4DL5A 2AYBA 4JV5J 2HLTA 4LBHA 3KK2B 1JLFA 1M5SA 2BE9B 3CCJS 2MZJA 2LEBA 1VFJA 4JYAJ 3HSDA 4E2FB 3K7RA 2OSRA 3ADAC 3K8WA 3BH6B 3GYGA 1L5UA 3BGLA 2QA4G 4DV5J 1FKAF 2EI5A 2KU7A 2HKEA 1ZZFA 3U7JA 2BJ7A 1JJ2R 4B9TA 1R8AA 2OEKA 4TY8A 3DLLQ 4EZ6A 2R3VA 3M6VA 4GVBB 4QIVA 5KTQA 2HBQB 5C42B 2D3ZA 4ED3A 3JAMU 4J90A 4ZP6A 2DNRA 3GLJA 2BR0A 3BQ2A 2IM2A 2L48A 4Y2KA 4USMA 3JS9A 2BJDA 1S9EA 2PI5A 4CM2A 3MCMA 4TY8B 3PW2A 2WB4A 1C1BB 1P27B 3ILIA 3O8WA 1Q7YT 1GXLA 1Z4UA 1AA1B 1RYRA 5G0RB 2KHDA 3PEJA 3OW2R 1EIYB 4WIIA 3QFHA 1KLMB 5K8MA 2AGPA 2FQQB 2Y3YA 5DLGA 3C6TB 3R5BA 2E29A 4FF4A 1UPMB 1L3KA 2QO3A 2XLJA 1WI6A 3OFEA 1P9QC 1BQXA 1N36J 4P73A 4DL3A 3Q2TC 1DARA 3ENVA 4BWMA 3QJJA 2HQGA 5EWFA 4BC9A 2VBZA 4KGXB 4DUTA 2DHGA 3FBEA 1GXUA 1NKBA 5D78A 3QFWA 2E9TA 3EZ5A 3T1HJ 5L38A 2XM3A 2DNQA 3M8WA 1FCAA 2XO7A 4P75A 1RWKB 4GMKA 1SPBP 2NXUA 4LF2A 5J1NA 1ACMB 3NGKA 2ZE2B 3M32B 2CQPA 4JV5F 5KT4A 3M2UB 1UMJA 1CS4B 1MWYA 3H2LA 4DN9A 3M6UA 1HNZF 2E1CA 3KHHA 4RW4B 2HLUA 4DPXA 4RW6B 5L9NA 4JYAF 4MTPA 4U9RA 4DZ6A 3IMQJ 3M9MB 4J9LA 4OV6A 3DLJA 1P1LA 1FE0A 2AHOB 3I32A 3QMQA 2CIMA 3FK4A 4NCGB 3C46A 2YX7A 4R8UA 5E7OB 3I5CA 4MIWA 1MW7A 3SCJE 2OPSB 2B9YA 1U49A 3S1TA 3KK1A 2QN6B 5EWEA 2VBYA 2AJ2A 2HVDA 1S1WB 3IR5B 4YUDA 3HP6A 4ED5A 3JTPA 3ZC4A 2JLFA 4IH7A 2Q43A 2MKYA 5BJRA 3BREA 3OUYB 1FFSB 3E51A 3NCQA 1QSLA 4PUOA 2PFFB 2QX0A 3NS5A 4NYZA 3MCSA 4DJBA 2P6TA 1JLBA 2XLIA 3JQJA 1E6YB 1NK0A 3NNCA 4U96A 2H51B 3UD4P 2CFXA 1WC6A 1KQKA 2FJXA 1KFSA 3I55S 2OPRB 3DHXA 3A3OB 1FFWB 3MPWA 5FIIA 3ZTOA 4F4KA 3BGFA 4PXEA 2HFSA 4DX7A 2V2VA 3U1NA 1N36F 3CO0P 4CH0S 3FCWA 3BYRA 4ZLJA 3FJ2A 1R8PA 2OD4A 3ZFVA 1OY8A 1MROA 2NS1B 2D3OR 1DTQB 1OJ4A 4DQRA 4HTIA 2GHVC 2B6AB 2P9EA 2YKPA 3GONA 1RABB 4XIUA 4N56A 1RACB 4OX9F 4KV8B 1OY9A 1T9TA 4YDXA 3W2WA 3UDEA 1W2IA 4P74A 4FVCA 2V68A 1V5VA 3B54A 1RAEB 2HBRB 4IYQA 4OYWA 2W24A 4PPZA 4WYWA 5K14B 3UN3A 3DLGA 4DS5A 1RA7A 3CB4A 4A8KA 1RLDA 2GZOA 4JB8B 1VBXA 1NJIT 1HNZJ 3GIMA 2UUCF 4ICLA 4B3RJ 2R7VA 2AZ3A 4RX6A 2KN4A 1LK5A 2HBZB 4B02A 3Q8YA 3SQGA 3M9OB 3RTVA 1LEOA 1NDKA 2CQCA 2CYYA 2C3OA 1AXQA 2PIIA 3OFHA 4OI3A 5E3PA 4C48A 1IBLF 1NDCA 2EC0A 4MK8A 2CQ4A 3MM7A 4OX8A 1Z1ZA 5LM7E 4HH0A 1VRTB 2DCUB 1K8AT 3L7UA 2PEBA 3IXQA 3LALA 4KJIA 2OMOA 2CJAA 2DT9A 3W61A 2IM1A 4QWCA 3GR0A 5B0FA 5A8KB 3AB4B 1U8WA 4F50A 3CC4S 4WYLA 1FRIA 1PC4A 2IA6A 4LFCF 1SH0A 4KKOB 1DHMA 3CDAA 3LQVA 5AE3A 1YJ9S 1CSJA 4W4MA 1UZDA 3CJ3A 4G6VB 1JLCB 2CQGA 4TVAB 5IV3A 2OTJS 1RT1B 4QR0A 2C2KB 2C3YA 3T1AA 3SZ2A 4PAAA 3OL9A 4Q8EA 4JI8F 3PIOQ 1S1UB 1Q5VA 4QW8A 4LF5F 3DDKA 4DCPB 2Z58B 5E41A 1S97A 4ZIVA 4OHXA 3DRSA 3OTEA 1FTCA 4ZLPA 4RU2A 4YN3B 5KFSA 2XMUA 2ZD1A 2GCFA 4ATNA 4WKYA 2MXYA 1WKJA 3E01A 3MPYA 5EDWA 4F4WA 4DR2F 3EICA 4Z7CA 4XDDA 4F0KA 3R9LA 2ZDOA 3NEKA 2QL5B 3P5TL 4B3MF 3QPIA 2RIJA 2VPWB 5LT5A 2POKA 3L4BC 1ZH5A 5L46A 2PO4A 1I5OB 3HPOA 1WTBA 3FMWA 1QE1B 1U0HB 1LQ9A 2JFDA 4FS2A 3KHGA 2UUCJ 2ILZA 3QJLA 1K0TA 1U6FA 2CRLA 3G6XA 2A2CA 3CJQA 3LP1A 4RNNA 1UA0A 5SZTA 2LDIA 2MYFA 4HR2A 4CO3A 2I8EA 8RUCA 2ZVSA 1DFDA 3M30A 2MKKA 2QZ8A 3M2VA 1S1VA 3MMJA 3OL7A 4NWBA 5J2PB 5HLFA 3RW6A 3ISZA 2DIUA 4M5LA 1N33F 4LMZA 1QTMA 2PN6A 4X4TA 4RBUA 2RH3A 2QSFA 1SC1B 1PGZA 4ZMMA 3GIKA 1X5SA 1ITPA 2I38A 4AL7A 4W92B 3KNGA 3ITHA 5D77A 3US5A 1EARA 2HG4A 3EZOA 1D9DA 1FESA 2YKOA 2CPJA 3UWTA 2MEWA 2HVZA 2HNZA 1QAXA 2P9GA 4O3PA 3VCDA 4I2PB 3C15B 1YBAA 4MK7A 2YNFB 4TXSA 2QT7A 3HKZD 2B4PA 1IXKA 3ETOA 3Q23A 1XTZA 5L1LA 2A0FB 4LF5J 5KFDA 3BGOP 1K44A 4KC5A 4M5JA 1T95A 1VQSA 2UUBJ 1X4BA 4WFAQ 3M05A 5DM6Q 1APSA 3C19A 2FHMA 1CQNA 2OAUA 3MM7B 2VF3A 2XG8A 2D74B 2MJUA 3W9HA 4B9SA 4JBCA 3KJFB 4I69A 1JLEA 2DYAA 3FGVA 1DBDA 4QIWD 3MXHP 5K5MA 3MMCB 2MKSA 2XGPA 2ADBA 1JKHB 3CE8A 4FNHA 4PQUA 1VQ9S 3DLGB 2RUGA 5L39A 3TZXA 4UZBA 3KYLA 3R7SB 4TQSA 2QE5A 2RU3A 3HVWA 2W7OA 2LQ8A 4ZP9A 3BS9A 3Q86A 3FQLA 3H0PA 1W25A 3GJSB 2BANB 3IRWP 1GAOA 3KDNA 5KG0A 2IJFA 1W26A 2ADCA 2YQ0A 1DTQA 3IBFB 3W2VA 1T9XA 2MZSA 1SKWA 4RLEA 2IVMA 4J7CA 1PIEA 4NOHA 1KQGB 4OQJA 2B43A 2M4MA 1YK9A 2MSSA 3DN9A 4F25A 4HEA9 4I0WA 2OPRA 3ZTPA 3TAQA 1O0PA 1VCTA 2PMHA 4KPCA 4WE1B 1VQOS 5C25B 3K5MA 2J76E 5T7LB 3HMJG 4WK3A 4LR9A 1LW0A 1NSAA 1TAUA 3G2XA 3SSRA 1QSYA 1TMJA 2JEFA 2QEXS 3MM8B 1AFJA 3WC0A 2VG6A 1DLOA 2N4DA 3OL8A 3T6JA 1F6TA 1YBUA 3ULHA 3BSOA 4QU6A 2UUBF 4OYBA 4JUZA 2MJNA 2HZVA 4L73A 3I31A 1S1XB 4O44A 3ZTQA 2C2DA 3QIDA 5H9FJ 4CT8A 2J6TA 1VQ4S 3IA0A 1S12A 2EFQA 5D4OA 5U47A 2FJEB 3MEDB 3MFHA 4V19X 4Y34A 2C2EA 1GMWD 3BO3A 1JK9B 1VLYA 1RQ0A 3L7OA 3BQ0A 1RI7A 5F41A 3TOQA 4C3MA 2BOPA 1XIQA 3KG1A 3G96A 1RP5A 2YH0A 3K89A 4EO6A 2YVSA 2MGZB 4DF8A 3CUNA 4DBQA 1CBKA 2DR6A 3GIRA 5KFXA 5CZXA 3V5RA 3MR6A 5CCMA 2V6AA 4X64J 2BKNA 2KFYA 2HHUA 2LP4A 1UW9A 2BE2A 3LOUA 3OTBA 1RWNB 4CO4A 1NKCA 1IVZA 5L8RC 1RT2B 3CF5Q 4LJMA 4KHRA 1GTEA 2KT3A 3KLFB 1LFWA 1Q79A 1LFPA 2CG8A 4RBVA 1WF2A 1HLWA 2WB1D 4WFZA 3VGUA 4DUZF 4ECSA 3CULA 1B7FA 2Z2ZA 3U1MA 3TAPA 2FVRA 3RRGA 2HS4A 3L7PA 5G0RA 2VFSA 4YDDB 1NH8A 2ZNYA 3UCZP 5ETTA 2JEIA 1Q8LA 4PXCA 4DR4F 3DFEA 4K4XA 4P2FA 2WONB 1HPZA 1WG1A 4FP9A 5IQQA 2IVFB 2VA3A 3N9UC 4B9VA 2XS5A 2VOPA 2ZBPA 1RLCL 5BYQA 3ET6A 2QLWA 5MLCV 4LVNP 2R2RA 5JVGQ 4OL8A 2CVEA 4ER8A 3GFZA 2PA8D 5IC4B 1HHTP 3POTB 2OPPB 3J7YU 1FXLA 2GMHA 3IRXB 4B3TF 1TL5A 3UD3P 2EFOA 4DV6F 2G2ZA 5E3QA 3OL6A 2CZ4A 3PX6A 1Y3JA 1TTHB 1S1XA 2LA4A 2X1GA 2YQ1A 3MZIA 4O44B 2LMIA 3Q8RB 2KB2A 2VQFJ 4RUCA 3BSNA 2FY1A 2VBWA 2CPYA 3R7BB 4KKOA 3LP0A 1S1TB 3MM5B 4WXWA 4DF4A 4O4GB 2OSQA 2HQCA 5HN0A 2Y0BB 2VDHA 4K2JA 2R7XA 2FJAB 4URQU 3PFOA 2MPUA 3AXKA 4NRUA 5A0YA 1LXNA 1WORA 3AODA 4OMFG 1V5IB 2Z4PA 4P7VA 5B0EA 4DCJB 1BGXT 5KFQA 2VIHA 3G9CA 1WHVA 2P9CA 4CYUA 4I7FB 1W2BR 3H4BA 1WF0A 1XQIA 3R5AA 4DUZJ 3HI9A 1B3TA 2LQBA 2DEIA 1RWOB 2CPHA 2FLOA 1YITS 2XTJP 1TFYA 2GQQA 2IMWP 4M5DB 3R2DJ 4NA1A 1RWVB 3D9BA
chains in the Genus database with same CATH topology
3GJTB 4ZVUB 3SIPB 2H65B 2C2ZB 2H54B 4ZVPB 3GJRB 2CNKB 3D6FB 3RJMB 1F9EB 2XYPB 4ZVTB 1BMQB 3EDRB 2CNNB 3D6HB 3R6LB 2HBQB 3EDQB 2CDRB 3QNWB 3R5JB 3NS7B 2QLJB 4ZVSB 2QL9B 2C2KB 1PYOB 1PAUB 3R7NB 4DCPB 2H5JB 2CNLB 2FQQB 1RHKB 1RWXB 2QL7B 2HBYB 4ZVQB 1RWPB 1RWMB 2QL5B 3IBCB 1RE1B 4LSZB 1RWWB 1SC3B 2XYHB 2C2MB 3GJQB 2H4YB 1RWKB 1RWNB 2C1EB 1RHJB 2H48B 2C2OB 3R6GB 1ICEB 2CNOB 2CJYB 3KJNB 1SC1B 2XZDB 4DCOB 2CJXB 1RHMB 5K20B 1QDUB 1SC4B 1I3OB 3P4UB 4ZVOB 5IC4B 3KJQB 1GFWB 2H51B 1RHRB 2QLFB 2P2CB 2XYGB 1RHQB 3KJFB 1QTNB 3P45B 3R7BB 2Y0BB 2Y1LB 3D6MB 3R7SB 1RHUB 4DCJB 5IC6B 2H5IB 3GJSB 2HBRB 1IBCB 4JB8B 2H4WB 1RWOB 3IBFB 4ZVRB 2QLBB 1NMEB 2XZTB 2DKOB 1RWVB 1I51B 2HBZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GJT B;  4ZVU B;  3SIP B;  2H65 B;  2C2Z B;  2H54 B;  4ZVP B;  3GJR B;  2CNK B;  3D6F B;  3RJM B;  1F9E B;  2XYP B;  4ZVT B;  1BMQ B;  3EDR B;  2CNN B;  3D6H B;  3R6L B;  2HBQ B;  3EDQ B;  2CDR B;  3QNW B;  3R5J B;  3NS7 B;  2QLJ B;  4ZVS B;  2QL9 B;  2C2K B;  1PYO B;  1PAU B;  3R7N B;  4DCP B;  2H5J B;  2CNL B;  2FQQ B;  1RHK B;  1RWX B;  2QL7 B;  2HBY B;  4ZVQ B;  1RWP B;  1RWM B;  2QL5 B;  3IBC B;  1RE1 B;  4LSZ B;  1RWW B;  1SC3 B;  2XYH B;  2C2M B;  3GJQ B;  2H4Y B;  1RWK B;  1RWN B;  2C1E B;  1RHJ B;  2H48 B;  2C2O B;  3R6G B;  1ICE B;  2CNO B;  2CJY B;  3KJN B;  1SC1 B;  2XZD B;  4DCO B;  2CJX B;  1RHM B;  5K20 B;  1QDU B;  1SC4 B;  1I3O B;  3P4U B;  4ZVO B;  5IC4 B;  3KJQ B;  1GFW B;  2H51 B;  1RHR B;  2QLF B;  2P2C B;  2XYG B;  1RHQ B;  3KJF B;  1QTN B;  3P45 B;  3R7B B;  2Y0B B;  2Y1L B;  3D6M B;  3R7S B;  1RHU B;  4DCJ B;  5IC6 B;  2H5I B;  3GJS B;  2HBR B;  1IBC B;  4JB8 B;  2H4W B;  1RWO B;  3IBF B;  4ZVR B;  2QLB B;  1NME B;  2XZT B;  2DKO B;  1RWV B;  1I51 B;  2HBZ B; 
#chains in the Genus database with same CATH topology
 1RT4 A;  2HFV A;  2HWI A;  2XY5 A;  1NND A;  4WK1 A;  2AYM A;  2YTC A;  2PGC A;  1S6O A;  2HW3 A;  3CCZ A;  2CAJ A;  3I4H X;  4DV4 J;  4OI2 A;  1YTY A;  2BQR A;  4LVO P;  4C8M A;  3I0S B;  1MN9 A;  1WKK A;  2FLP A;  1K1S A;  2KRR A;  1G6B A;  1SQG A;  2DIS A;  3JYT B;  2KXH A;  4YR0 A;  2ROG A;  2NR0 A;  2KI2 A;  3U02 A;  4WTO B;  4ZN3 A;  3KLE B;  1VQM S;  3KUE A;  4M8L A;  3TZZ A;  5DDP C;  1VK8 A;  3HVT A;  3ZZO A;  2W9C A;  1CEZ A;  2ZZT A;  3BPS P;  1JLE B;  2AJF E;  5FLX U;  3OFF A;  2YX4 A;  1RZM A;  3RGI A;  1EP4 B;  3G6Y A;  2AEJ A;  2Z56 B;  3UD5 A;  1UAW A;  1XJW B;  4WFX A;  3H7H B;  1NAQ A;  3C16 A;  5KFJ A;  1IKY A;  5HRO A;  2RT3 A;  4N5S A;  2LU1 A;  3H20 A;  4RW8 B;  3TAM A;  1S0N A;  4RW9 A;  3M8Y A;  5IT9 Y;  2LYV A;  1JIH A;  4DSJ A;  1D9A A;  4JI0 F;  1XNR F;  4WZM A;  1IM6 A;  1WC5 A;  2CJB A;  2V69 A;  1UVL A;  1SL0 A;  4NMX A;  2B5J A;  2W9C B;  4QQB A;  4ES1 A;  4OYM A;  3FZB A;  2YNF A;  3THV A;  3RB4 A;  2E5L J;  2X1B A;  3JYT A;  1GQE A;  1DY3 A;  4F0M A;  2CQD A;  1S1W A;  3IC1 A;  4C98 A;  3RZA A;  3CXC R;  4OV1 A;  2BYC A;  1F5C A;  4MAK A;  2HPU A;  2DXE A;  1U1K A;  1S76 D;  2WW8 A;  2M52 A;  1BWV A;  1BD6 A;  1URR A;  1N5Y B;  3KLH A;  1VBZ A;  2M8H A;  3CJ0 A;  3TYT A;  4K4W A;  1VQ8 S;  1RWW B;  2GW8 A;  3MM9 B;  4B3R F;  2HAI A;  4B3O A;  1RAF B;  3AQO A;  4NCB A;  4H4O A;  2CWX A;  2J9C A;  5KT3 A;  2RU9 A;  2ALY B;  1IBM J;  1S99 A;  4AL5 A;  3BH7 B;  5AXM A;  3M8P B;  5HMY A;  5A8W B;  2JOQ A;  1ICE B;  2W4C A;  3SV4 A;  4A8F A;  2UXB J;  4NAS A;  3TJ8 A;  2Q66 A;  2JH3 A;  2RVJ A;  1VHI A;  1X31 C;  2QSW A;  2XHW A;  2XZW A;  4XK8 C;  3GB0 A;  1NHV A;  1CQM A;  2Z57 B;  3VZI A;  1JX4 A;  4DSI A;  3IO1 A;  1D8Z A;  2V34 A;  3RBE A;  1TVR B;  1RBL A;  1SUQ A;  3SSQ A;  4F7V A;  3TAN A;  3R2C J;  3RB6 A;  5KFC A;  2G0I A;  2EBE A;  4Q44 A;  3FCH A;  5D0G A;  2DGO A;  2ZJP Q;  1T9Y A;  3B8H A;  1JNZ B;  1U48 A;  3POT A;  2IC3 A;  1F5A A;  3U1L A;  1VGY A;  3K0J A;  2CPF A;  1TKT B;  5GAG I;  3NNA A;  1XR5 A;  4DHV A;  4D3H A;  5ETK A;  5DG9 A;  2HHV A;  4Y2M A;  2ZH1 A;  2QV6 A;  4GKJ F;  3P4U B;  3DRS B;  2N4C A;  2FTR A;  1TK8 A;  3BZQ A;  3OTO J;  4NXN F;  3M7V A;  4ECX A;  1IR1 A;  2RNE A;  3GTY X;  2GIQ A;  5GMD A;  5CAA A;  2Z8Q A;  5A2Q Y;  2QLF B;  4YS2 A;  3EVO A;  2AGO A;  1T02 A;  1RHQ B;  4U8Y A;  3R3T A;  2AX0 A;  2ZBQ A;  2NPI A;  1YSJ A;  2M9K A;  1TKX A;  9ATC B;  1NB2 A;  1D1U A;  2DGS A;  2V8V A;  5LOQ A;  1O5J A;  5LSO A;  5C24 B;  4DFK A;  3MAA B;  3MD3 A;  4ALZ A;  3BDP A;  2KVI A;  3D6M B;  2HHH J;  1KEK A;  2WSC C;  1S9G A;  1MU2 A;  1WHX A;  3IAM 9;  2LQ9 A;  4O0I A;  4UZC A;  2HRT A;  1WKL A;  1U1O A;  2ZWO A;  3H4D A;  1IBM F;  3QQC D;  4JV2 A;  1P9Y A;  2UXB F;  2FY8 A;  3QT5 A;  4IUF A;  4GVL A;  5D15 A;  3MMB A;  3G87 A;  2HZC A;  2JEG A;  1QVF R;  1ZM3 A;  2W7P A;  4LF4 F;  4KGV B;  5CHC B;  3BSA A;  2JNJ A;  5EHH A;  4ZVU B;  1N5Y A;  2UVR A;  2LXU A;  2GFF A;  2C2R A;  5C5J A;  4QBU A;  4RO0 A;  4X84 A;  2IAJ B;  1ZM9 A;  2DHH A;  4PG4 A;  3W5Z A;  4A48 A;  1J5O A;  3AT1 B;  2DXD A;  3T5H A;  1OS5 A;  2BUN A;  2HQF A;  2KRB A;  4ZVP B;  3EMT A;  3LA0 A;  3WDO A;  3G8Q A;  3QGH A;  2GV1 A;  1UEU A;  1QUV A;  5KT2 A;  1MRO B;  2V8H A;  5F8N A;  3MEE B;  4TN2 A;  2ZC3 A;  3A8I A;  3NS7 B;  3SQO P;  3OVB A;  3PV8 A;  1QD1 A;  4RW8 A;  5LSR A;  3CC2 S;  5HQ8 A;  3CJK A;  3DGP B;  1D8Y A;  4P2X A;  1V3Z A;  2B4O A;  1RAJ A;  2J0W A;  3NRB A;  4IQM A;  1PAU B;  4P71 A;  3H2U B;  1AW0 A;  1C0U B;  1XK8 A;  1VRU B;  3C14 A;  3R8Y A;  2BM1 A;  2RQ4 A;  3DU6 A;  4B08 A;  4ITS A;  5HVG A;  2V50 A;  3HVT B;  1QAI A;  1RGV A;  3TEG A;  3JAM Y;  4YR2 A;  3HLU A;  2ZUA A;  1Y3K A;  1FJ7 A;  1NLK L;  2ZBI A;  4OLP A;  1U2C A;  1MWQ A;  3MM8 A;  1UZH A;  1X4G A;  2RQM A;  4WTY A;  2HHH F;  4MK9 A;  2DR7 A;  4JI2 F;  3EWG A;  3K57 A;  2PMW A;  2RUS A;  4OI4 A;  4N76 A;  1VRU A;  3WZ0 A;  2ZZN A;  1ARO P;  3DHW C;  2JFK A;  4LIR A;  4RBT A;  3VTI A;  5BYS A;  4JI3 J;  2MHN A;  3BBC A;  1S0O A;  2OI2 A;  3D1O A;  3NS6 A;  3KKF A;  4ZCK A;  5BR8 F;  4C3L A;  1GEH A;  4J9M A;  3MWB A;  1N5T A;  4QJV A;  2KJW A;  4UQT A;  5T14 A;  1WG5 A;  3VAF A;  3CD7 A;  2BJ9 A;  4FYW B;  3VAK A;  4MKY A;  2WVE A;  3BJY A;  3H90 A;  1OQ6 A;  4IRC A;  2WVB A;  1QVG R;  3CW2 C;  5EUH A;  4AND A;  1KC8 T;  2KHC A;  4TU9 A;  5ETN A;  2ROP A;  2V63 A;  1F3F A;  2IBK A;  5HMW A;  3G6E S;  4ECW A;  4CQ1 A;  1HHS A;  4OJ1 A;  1RTD B;  2E66 A;  2FB0 A;  2HFZ A;  3W5Y A;  5I3Q A;  4S0M A;  2ZOG A;  4PKD B;  2E1M C;  2L41 A;  3EYZ A;  4EUV A;  1HD1 A;  3HSZ A;  4CZC A;  1JJC B;  3N01 A;  4KFB A;  3MMB B;  3V6J A;  1TK0 A;  2N82 B;  2ZH2 A;  1Q82 T;  4JV1 A;  2KG1 A;  3MEC B;  2GA7 A;  4HT7 A;  2KVQ E;  4EBC A;  4EEY A;  3D1Q A;  2WOM B;  4UUX A;  2P5V A;  2R7T A;  1X4C A;  2XS2 A;  3DGV A;  3PVX A;  3PYE A;  3TVK A;  3GE9 A;  1NDP A;  3DLK A;  1H7W A;  3TZW A;  1CJT B;  1PBU A;  2G13 A;  2HNZ B;  3GR1 A;  9RUB A;  1V9O A;  2XMJ A;  2X1A A;  2FVP A;  4G3I A;  1DQ8 A;  1HQE B;  2UVU A;  2UUA J;  2ZH7 A;  2DNZ A;  3A3P B;  5EWG A;  5GAD U;  2LQ5 A;  2X51 A;  3EGV A;  1X5P A;  2HNY A;  3LP2 A;  4WXO A;  3T9N A;  4Y00 A;  1K0V A;  2ZH8 A;  1NSQ A;  2LCW A;  3J7Z 5;  2WVD A;  3UN5 A;  1F5B A;  5J2P A;  4QZV B;  5HLF B;  3HZE A;  3N0V A;  3M2V B;  4MMO A;  3TX8 A;  5BR8 J;  5F3T A;  2PE8 A;  3UDL A;  2A6O A;  2VAS A;  3J81 U;  1C4C A;  2JRS A;  3RUB L;  4E8U A;  2GNK A;  2VFU A;  1G2E A;  4PQA A;  2IA0 A;  1BQN B;  2CJQ A;  3AQP A;  3ENQ A;  3IFE A;  3OR2 B;  2I0X A;  2HFN A;  3SBM A;  2A18 A;  5A76 A;  4Y2I A;  4KHP J;  3BM7 A;  2V0N A;  1FK9 B;  2BE2 B;  3GV7 B;  2ZC4 A;  5ETO A;  4ED0 A;  1U7L A;  1U47 A;  2RRB A;  1HW8 A;  1H3D A;  2R9L A;  1KWM A;  1O6X A;  1RT7 B;  3IWL A;  3Q83 A;  4DFP A;  5IV4 A;  3PAC A;  4ZOS A;  1FDA A;  1Y5L B;  2IPO B;  4PG5 A;  3Q24 A;  4NA3 A;  4RUA A;  5H1S V;  2L9W A;  1MLA A;  5A6P A;  3RBD A;  1YLX A;  4ZVT B;  1KHW A;  2WHO A;  4U7C A;  4P52 A;  3NL0 A;  1MG7 A;  3GFX A;  2EG2 A;  2LEC A;  5J2N A;  1WC0 A;  4ID8 A;  3V81 B;  2F40 A;  1YJV A;  2HND B;  4YB5 A;  1VI7 A;  4DDF A;  2MQL A;  4J9S A;  2ZH9 A;  2HNY B;  1KDN A;  1HBU B;  5FJ4 A;  1T8E A;  4LBP A;  3DRR B;  3TO8 A;  3MR2 A;  2KL8 A;  2O67 A;  1VQL S;  1N32 J;  2J9D A;  4M63 A;  3VHQ A;  5GAG U;  1NB7 A;  2IJR A;  1OQ3 A;  3DXS X;  3FUY A;  4FXV A;  3HFK A;  1X0F A;  3T1Y J;  1DLO B;  4DQS A;  1R6Y A;  1S6Q B;  3PRD A;  1WD6 A;  2FGC A;  4K4S A;  1RHK B;  1RWX B;  2HHW A;  2XC9 A;  4ZVQ B;  2ZJQ Q;  1NZA A;  3LF0 A;  5D0H A;  3PRV A;  3IG1 A;  4U95 A;  4OX9 J;  4KPY A;  1X4A A;  4ICL B;  1PJ5 A;  1N34 J;  3UDV A;  4JI1 F;  2YNH A;  1WSV A;  4DPT A;  1FXD A;  4X62 J;  5HRO B;  5C7P A;  1ULR A;  3SDE B;  4KHP F;  1LWE A;  4Q0B A;  2AYE A;  3PJX A;  1B0P A;  3RAM A;  1NU4 A;  4P7T A;  4DL4 A;  2C2O B;  4UT4 A;  1KVK A;  2ASJ A;  2HWH A;  1LWX A;  4FBU A;  2B7B B;  3CNQ P;  4CO5 A;  1YRX A;  2CJ9 A;  1KD1 T;  1IBL J;  1R8C A;  1F3V A;  3W2W B;  4IQX A;  4ELU A;  3H59 A;  5DZ6 A;  1UPP A;  3PDN A;  2PI4 A;  1M90 T;  2ZOM A;  4LT6 A;  4RNF A;  4LFA F;  4AXJ A;  3SDE A;  3O5T B;  3GIL A;  4BS2 A;  3BN4 A;  2F3J A;  2NCK L;  1U45 A;  1C1C B;  1FKP B;  4DCO B;  4V19 J;  2AD9 A;  2VB6 A;  1N5Q A;  4RWW A;  1WEY A;  3QBC A;  4USW A;  4DPW A;  3UI3 A;  5K8N A;  2F63 A;  1FNM A;  2CZ9 A;  3KFW X;  3SCI E;  2V8P A;  4X4S A;  1CJU A;  2XLK A;  4IOA Q;  2HHP A;  3GPA A;  2BJ1 A;  2IMO A;  1Q81 T;  4F36 A;  1R7I A;  3HVA A;  2BKP A;  1DUR A;  5IWA F;  1N56 A;  4NLP A;  4JI8 J;  3UW1 A;  1N32 F;  2ZZM A;  2AP6 A;  2PSZ A;  2K3I A;  4L76 A;  1EHW A;  3RBX A;  4WWS A;  2QIF A;  2VFR A;  3DRR A;  5D3G B;  2UZA A;  3FFI B;  1Y00 A;  3DGP A;  2G2Y A;  1S59 A;  5HVH A;  2GVD B;  4DR2 J;  1XMB A;  2ZBR A;  1DRZ A;  3P45 B;  2DNH A;  3M1V A;  3W5X A;  3ZNJ 1;  2DNP A;  5HP1 A;  1NJZ A;  1SL1 A;  1UVM A;  2GVZ A;  4K5S A;  3TEH B;  4AXI A;  1D3W A;  1K47 A;  4F67 A;  2CQB A;  2OKQ A;  4CH1 A;  4HL9 A;  4Y0F A;  4NLU A;  1LKZ A;  1NZ8 A;  4QYZ J;  2NXN A;  5KOX A;  8ATC B;  1PAE X;  3SCL E;  1PBA A;  4DG1 B;  2HUR A;  1FRH A;  2J0Q D;  4DX6 A;  2H9Z A;  3N6N A;  4TYB A;  5A0Y B;  3ZZ0 A;  3HZG A;  1UCN A;  2GQC A;  2XY6 A;  2Y9H A;  4ZJO A;  3IGV A;  7FD1 A;  1C0T A;  5ITH A;  1RAD B;  2EXU A;  3CD0 A;  4X4R A;  5LMU J;  1URN A;  2NZ4 A;  4RZR A;  2QRR A;  6FD1 A;  1YJN S;  2W7A A;  1ZBT A;  1S7I A;  4ZJL A;  4LFA J;  3THP A;  2KDO A;  2B4U A;  3SIP B;  4Y28 C;  2XMV A;  2HGN A;  2XCP A;  4ZLL A;  2MDA A;  3LH2 S;  4RKU C;  4IRD A;  4NXM F;  5KT7 A;  2OPP A;  3AD9 C;  4UTG A;  1X0P A;  2IYI A;  3TQE A;  4G1Q B;  1LV5 A;  3BGR B;  1X4H A;  3DOL B;  3W1Y C;  3SYZ A;  3KLF A;  2ABY A;  4LF7 J;  2ERR A;  3MUV P;  3Q22 A;  3G4S S;  4RNO A;  3G8T A;  4K7Q A;  5IWA J;  3R6L B;  1ZET A;  4UF4 A;  3F56 A;  3H42 A;  1KLM A;  1HR0 J;  3JSB A;  1TKX B;  2KG0 A;  2VG7 B;  3HO1 A;  1FRM A;  4NLD A;  5ETM A;  3CCW A;  2XNR A;  2QLJ B;  5DRK A;  4B17 A;  4FKY A;  1HQE A;  1T9V A;  4HI2 A;  3RG6 A;  5F8G A;  3A8K A;  2ALZ A;  2UXD J;  1HWU A;  4ZVG A;  4R25 A;  2G1H A;  2VPX B;  3DLK B;  4TYA A;  4Q43 A;  3VGT A;  3IM8 A;  2VG7 A;  2B8Q A;  5DG8 A;  5C42 A;  2W9B A;  4DLG A;  5DGB A;  4I6Y A;  2DD8 S;  5B09 A;  3OHB A;  4ETZ A;  3DM2 A;  2QL7 B;  2WOM A;  3CSK A;  5JVH Q;  1KRP A;  1CJT A;  2GAG C;  2EKN A;  2HBY B;  3CIZ A;  3O1L A;  4HDG A;  5HJY A;  2IC3 B;  4DSF A;  1OSC A;  3THT A;  4I67 A;  3UFC X;  4KTQ A;  2N7C A;  3IBW A;  2R8I A;  3PO4 A;  1X7V A;  4HAC B;  4KO0 B;  4DLE A;  1KVI A;  3ILL A;  2DVI A;  1SC3 B;  1TL7 A;  3HHL D;  5LMU F;  2FC9 A;  3BGU A;  5C2G A;  5KOW A;  1U1R A;  1U8S A;  2MLZ A;  3KG0 A;  1RHJ B;  3MMA B;  4I2Q B;  4CIO A;  1LWC B;  2M2B A;  3BEG B;  3KLI A;  3OFG A;  5CA5 A;  4K4T A;  1XR6 A;  1C0T B;  2D9P A;  1NPK A;  4U67 Q;  1T05 B;  2VL1 A;  3CCT A;  4PG7 A;  1TR0 A;  3UR0 A;  2C42 A;  4FZV A;  2CJY B;  1RTH A;  4DG1 A;  3VAG A;  2YXL A;  2VA2 A;  1KNZ A;  3MOJ B;  2O66 A;  1FER A;  4OZ2 A;  2Y1J A;  2MZQ A;  4MT1 A;  4OZL A;  3MM9 A;  3GII A;  3QIP A;  3W65 A;  2M0G B;  2MQN A;  3VAJ A;  2RRN A;  1I94 J;  4ILM A;  1GXT A;  4I68 A;  1WHY A;  1XN9 A;  1A7G E;  5HO4 A;  4CWB A;  1UWB A;  4DPY A;  5ETL A;  4LUB A;  1TUW A;  2VPZ B;  1IKV B;  2W2O P;  5GMK a;  4DFM A;  3W2V B;  1FDB A;  2CJX B;  2V8D A;  1KOO A;  3M8R A;  1V6H A;  2HHT A;  1RHM B;  1Y9O A;  3L95 X;  3OTC A;  4HTJ A;  5D0R A;  4PEO A;  1N0V C;  2DY9 A;  3HHL A;  1EX8 A;  4NI2 B;  4AQY J;  1FDD A;  2V4Q A;  1H7X A;  5K20 B;  4RNH A;  1HNV B;  5KFB A;  2KXF A;  5B0C A;  3UO0 A;  5KFG A;  5FDL B;  1ZTT A;  1RYS A;  3QRP A;  3PYF A;  1RBO B;  2QMU B;  3TQ1 A;  4PUO B;  1FEE A;  2PT0 A;  3MD1 A;  4PQU B;  2C3U A;  1IWA A;  3HHL B;  1VRQ C;  4PYD A;  4RNM A;  2OTL S;  3D6T B;  3AOA A;  1FT8 A;  5KFY A;  1CJU B;  5K8P A;  2AEM A;  2P2C B;  3RAQ A;  1R89 A;  2EFG A;  1HD0 A;  1Q7L B;  4TU7 A;  1QTN B;  2HHX A;  1KP6 A;  1C0U A;  2VU5 A;  3PHE A;  1KKH A;  3KK1 B;  1LW2 B;  1LWF B;  5CD4 A;  4LR8 A;  4DOZ A;  5HVF A;  1TKZ A;  3OR1 B;  4H4M A;  4DR7 F;  4RJV A;  2MKJ A;  4B3S J;  1QUP A;  4ZPV R;  5ETS A;  2O1P A;  3DRY A;  1RHU B;  2HVH A;  1SJ3 P;  3FSI A;  4RW4 A;  1FTR A;  2FD2 A;  4PXD A;  1SKU B;  2FHJ D;  3EVM A;  3SEO A;  3OHA A;  3P49 B;  3M2U A;  3V2U C;  3D1H A;  5JXS A;  2A2D A;  1JKH A;  4DI6 A;  1JXE A;  4LRD A;  1EKR A;  2OPQ A;  4ILL A;  2XMT A;  2DGW A;  4J37 A;  4PXB A;  2YKQ A;  3NCR A;  4USJ C;  4UOH A;  2MZ1 A;  2DKO B;  3K2Y A;  1B64 A;  2W2P P;  2RML A;  4FN5 A;  2FGO A;  2KJV A;  4HAC A;  2EWH A;  4N8N A;  1CJV A;  4P2S A;  1YJW S;  1L3S A;  1T9W A;  4PYA A;  2OGU A;  2E5G A;  3EVW A;  3F44 A;  5F0U A;  2DPI A;  5FD1 A;  3BB5 A;  1HL6 A;  2BX6 A;  3A8J A;  3AAW B;  4F04 B;  3VAL A;  1PG5 B;  2DHS A;  3GYX B;  4UQG A;  3HJV A;  2RF2 A;  4A8X A;  4ZP7 A;  2GJF A;  1BMQ B;  4FYX B;  2N3L A;  3EDR B;  3BBB A;  3S01 A;  3CME S;  3NGD A;  3CMQ A;  2CKW A;  3D6H B;  1ZPW X;  2NPF A;  4F3Q A;  4DR1 J;  3GV5 B;  4CLZ A;  3FVY A;  1B0T A;  4LF8 J;  4KIA A;  1AUS L;  3DU5 A;  3RB0 A;  4KBI A;  1A9N B;  3FSX A;  3PCO B;  2D69 A;  4B3T J;  3V6H A;  5ETQ A;  2NLW A;  3R1H A;  3DLB A;  1PYO B;  4FYV B;  1TV6 B;  4ZIW A;  3MAH A;  4UW2 A;  2ZM6 F;  2CPI A;  1R0C B;  4NZ7 A;  2JWN A;  4N7T A;  2QLX A;  3CD5 A;  4OI0 A;  3MGJ A;  4QPT A;  4WCE Q;  5HMX A;  4TU8 A;  3V81 A;  4DSE A;  4GVB A;  3ET6 B;  4CLK A;  1N0U A;  1UFW A;  3H2V E;  5CYQ A;  4B3S F;  2JL9 A;  4KGM A;  3BV8 A;  2ZH6 A;  1CLF A;  3KOA A;  3AJ2 A;  5J2Q B;  1FX2 A;  3A1Y G;  1S1U A;  2N7Y A;  3MTJ A;  4DL7 A;  2ZH4 A;  4IG3 A;  2IRX A;  1ZAX A;  4IDK B;  3IBC B;  1KQS R;  2VFT A;  2VKR A;  1JLF B;  3C6U A;  3FBC A;  4QIE A;  1XWL A;  5EX3 A;  4LFB F;  2DNO A;  1IUJ A;  4RR5 A;  4W98 A;  2IJN A;  4KHM A;  1PJ7 A;  2BAC A;  1TEL A;  1CJK A;  1Y4Z B;  3WHI A;  3PXG a;  2UVV A;  4LF9 J;  1TL1 A;  1CG2 A;  2IM0 A;  3BN7 A;  1B0V A;  1S6U A;  4N47 A;  4C0H A;  4DL6 A;  2Y1I A;  3R6G B;  4NLS A;  2DGV A;  4DV4 F;  3R5G A;  1RT2 A;  3UCG A;  2RRA A;  2RJZ A;  3MDF A;  3IWX A;  4X62 F;  4OZN A;  1Q78 A;  4J9P A;  4EMD A;  2J9D E;  3PKY A;  3C2P A;  1UJ4 A;  1WEZ A;  4J9N A;  1PO6 A;  3A3N B;  2I9S A;  2PFD A;  4F0H A;  4M5K A;  3D0H E;  1SIW B;  4F02 A;  5AXL A;  3ZZP A;  1AZS B;  3IP0 A;  5KG1 A;  1D9F A;  4LF6 F;  2VZ9 A;  3P6Y C;  4CDI A;  1WWH A;  1KVJ A;  4QIG A;  3NMA A;  2AJQ A;  4FNI A;  2APO A;  1Q16 B;  4QWB A;  2UP1 A;  1TFW A;  1RJJ A;  2AWZ A;  3BF4 A;  2B5J B;  4TLR A;  1GTH A;  1MML A;  2RDJ A;  2ZM6 J;  4KV8 A;  5A2Q U;  4C8Y A;  2A3J A;  1K73 T;  1IJE B;  2ATC B;  4MYU A;  1SJR A;  1BLU A;  3SSS A;  1S77 D;  2DGX A;  2YX1 A;  3R97 A;  2ZHA A;  3JSM B;  3PKM A;  1U1N A;  3FEY B;  1IKY B;  1MWZ A;  4F4Y A;  4DWI A;  4PZV A;  2YWW A;  5DDO C;  4MJK A;  1Q0N A;  2KKH A;  2JZ5 A;  4NYO A;  5B0G A;  1R6V A;  4I64 A;  2I1R A;  1RKI A;  2CDQ A;  4LRC A;  5HSP A;  2DH7 A;  1U6Z A;  3KHL A;  4ZJQ A;  4ZCM A;  2VG6 B;  2DEJ A;  5KG2 A;  1HYS A;  1WEL A;  2NXC A;  3W60 A;  4PWD A;  4C8K A;  1OSD A;  1JLA A;  4C11 A;  3NGT A;  1KTQ A;  1RTD A;  3KNA A;  5J2M A;  5IC6 B;  4OHY A;  3F41 A;  1ZAV A;  1SQF A;  3K5N A;  1RT5 B;  5KFI A;  1YDL A;  1UEK A;  4MFB A;  5BYR A;  5DG7 A;  2PC6 A;  1RT3 A;  4UY8 5;  2XWX A;  3B78 A;  4K8R A;  1TMM A;  3QRR A;  4BWJ A;  3PR4 A;  2R2S A;  1J2V A;  2GMJ A;  1KR4 A;  1YIJ S;  3DOM B;  2H54 B;  2I2Y A;  5E33 A;  1NK5 A;  2V9W A;  4NLT A;  4YHH F;  4R5P B;  1R0A B;  1UEV A;  4NCG A;  4HH1 A;  4IRK A;  4JI5 F;  2WW4 A;  1XEZ A;  7FDR A;  3FQK A;  2BAN A;  1NPR A;  1VBY A;  1RTH B;  2NXE A;  2YWK A;  2AGQ A;  3MR3 A;  5ETP A;  3HT3 A;  3HDS A;  1CS4 A;  5DZ7 A;  1F9E B;  2Y0S D;  1DTT B;  1JNR B;  3W8P A;  4UUW A;  2COL A;  5E0O A;  3DLH A;  2J7U A;  1XMQ J;  5D8H B;  3NY0 A;  3KLG B;  2V8G A;  2P6S A;  3NWR A;  4MKV A;  3PR5 B;  1SIZ A;  1KBR A;  4KH1 B;  3M8Q A;  2IIH A;  1HWJ A;  2H5E A;  1JLQ A;  3K58 A;  3C14 B;  4LSN B;  3NP5 A;  4XO0 A;  3MUR P;  2B9W A;  1VK3 A;  5B08 A;  2R42 A;  3PG9 A;  4NEZ A;  3OJS A;  2OHD A;  2R2T A;  2L3M A;  3D5M A;  3PJW A;  2KXN B;  2RS8 A;  4NX9 A;  5IT0 A;  3LUY A;  1MMN A;  4KRW A;  3BSC A;  4NML A;  2Q6B A;  1SV5 A;  2E5H A;  4WBF A;  3RBZ A;  2CJK A;  1FKO B;  2W9B B;  2BXJ A;  2X7I A;  3M2R A;  2WON A;  2H3E B;  3ZZT A;  2PDA A;  1H0H B;  3N28 A;  3OD2 A;  4GC7 A;  1SVD A;  1CUL A;  2IAJ A;  3W9I A;  4WFB Q;  2Z2L A;  3LPE A;  4ID5 B;  3ITH B;  5D4L A;  1YX2 A;  3OBI A;  2DR9 A;  4XDC A;  3HF5 A;  3DKD A;  4HI1 A;  2YWH A;  2OIH A;  3PHT A;  4DUY J;  3ZZY A;  3LTO A;  1A6L A;  1NUE A;  3TNV A;  5L9X A;  1WDD A;  4WJB A;  1UVK A;  3DI6 A;  4YHH J;  2FUG 9;  1JLA B;  3W7B A;  4C6A A;  2KT5 A;  3T5K A;  1IQT A;  3NXZ A;  4JI5 J;  4HVZ A;  2RHS B;  4G1Q A;  1XNQ J;  3I6P A;  3OQ2 A;  2AW0 A;  3VAI A;  2DTJ A;  5AE1 A;  3UDC A;  1QY7 A;  1UET A;  4HT5 A;  1WDT A;  3N4W A;  4QCL A;  1OYD A;  2KM8 B;  5KFW A;  1HQ2 A;  2XZD B;  3C66 A;  4CLW A;  4Q7A A;  3RYL A;  3CVK A;  1WOP A;  3UN2 A;  2MKC A;  4ZPC A;  3VVU A;  1XMQ F;  3CC7 S;  3PO5 A;  4F4Z A;  5IFM A;  3O3L A;  1HNX F;  2VV5 A;  4YQW A;  4F4X A;  2DR5 A;  5KFK A;  1WC3 A;  2R4F A;  3O6Q A;  4F3M A;  3M9N B;  4DQI A;  2NYH A;  4WZQ A;  1BC6 A;  1VIO A;  3FEZ A;  4OI6 A;  1CUL B;  2MLY A;  1M1G A;  5HK4 A;  3FRY A;  1XR7 A;  4IH5 A;  3CDB A;  1RKJ A;  2F7V A;  1C2P A;  3K5L A;  2QYG A;  2VG5 B;  2D3U A;  3DXB A;  1RT6 A;  2HAF A;  4ZPT R;  4DQP A;  2DRD A;  3MPV A;  3NGR A;  4AL6 A;  3Q8V A;  1CVJ A;  4DX5 A;  2VH7 A;  4YR3 A;  4DR4 J;  1TKT A;  4DV3 F;  1SH3 A;  2HRU A;  4CTA A;  4J9U E;  5LXY A;  4QW9 A;  4AYB D;  2LEP A;  2GVD A;  4KSE B;  3BO4 A;  4JI3 F;  2G9O A;  2QTW A;  2AF6 A;  1VIX A;  3MCN A;  3Q8U A;  3PX0 A;  2AZ1 A;  3JXO A;  4IO1 A;  1SUQ B;  2Y1L B;  3MEG B;  4O3Q A;  2ZHB A;  3GCX P;  2FYX A;  2K06 A;  1FDN A;  1YVF A;  3GG1 A;  5HBM A;  1O8B A;  2AJ4 A;  4M94 A;  2OD6 A;  1IKW B;  3Q8P B;  1M1H A;  4LSL A;  2Q79 A;  4LF1 A;  3AA8 A;  1U26 A;  3E2E A;  3S6E A;  4CLF A;  5F8H A;  2FPH X;  1ZA2 B;  2KH9 A;  1DQ9 A;  5HAT A;  2LU2 A;  3J7Y I;  1BQM B;  2OML A;  1GMV A;  4ECU A;  2QLB B;  1SJQ A;  4H4O B;  2CPD A;  3Q8Q B;  2DO0 A;  1T11 A;  1VQ5 S;  2HQI A;  4OYO A;  4F3O A;  1UVN A;  5J2Q A;  1D0E A;  4IO9 Q;  3SCK E;  2DIT A;  1S10 A;  2BA9 A;  3OXF A;  3NBP B;  1QJH A;  5CYQ B;  1FRX A;  1AYE A;  4OZ5 A;  3DOM A;  3NAI A;  5E2Q A;  2OJ3 A;  1JWW A;  2CZV C;  2XNQ A;  2C2Z B;  1R8B A;  2D7S A;  5KG7 A;  1FWL A;  3D67 A;  3D6F B;  2W1B A;  2CPZ A;  3ILJ A;  2FLL A;  2NUU G;  2BKO A;  3MMC A;  2RAQ A;  3T3F A;  5I3U B;  2EC2 A;  3GG0 A;  3G8S A;  3R5J B;  3UNG C;  3MOZ A;  2R8H A;  2O3D A;  1Z2Z A;  2VOD A;  2XCA A;  1F60 B;  3GFY A;  4DV1 J;  4EBE A;  4CLY A;  3M6W A;  2R8G A;  2QYC A;  3TAM B;  1FWP A;  1GNK A;  2ZKT A;  2QL9 B;  2XUL A;  1H6K X;  4NLQ A;  4L3K A;  3TA2 A;  2UUA F;  4PAB A;  4HDH A;  3PZP A;  3RAX A;  4JI7 J;  3GZ7 A;  3HFV A;  1BUX A;  1HBM A;  2OEM A;  3BBF A;  2J0S D;  3H40 A;  1ZPV A;  2BEF A;  2E1A A;  4OIX A;  1U1M A;  3LAK A;  5F8M A;  1IJF B;  4NEY A;  3KK3 B;  2VKZ G;  4ZPB A;  4ECR A;  4K0K F;  3OTD A;  4DMZ A;  2V4J B;  3N79 A;  4NLV A;  5KFR A;  2I5J A;  3W64 A;  1YHQ S;  1CJV B;  1HMV A;  2YWF A;  4I2P A;  3UCU P;  1N48 A;  1EJ7 L;  4CNZ A;  5KT6 A;  2BW2 A;  3T9Z A;  2VJV A;  2CPX A;  3I0S A;  2HQD A;  4KE5 A;  5GME A;  4P9S A;  1F9H A;  4LBI A;  1WTF A;  1HBU A;  3NGU A;  3V4M A;  3W9J A;  3UPF A;  3N6M A;  1RT4 B;  2B56 A;  2C2M B;  4Y2A A;  4ZHR B;  4K59 A;  5I3P A;  5LSL A;  1RB0 A;  3B82 A;  3HHD A;  4M5D A;  4XPC A;  1GX5 A;  5KG5 A;  2H48 B;  5J2N B;  1VOM A;  3ZO7 A;  2LEA A;  2ASL A;  3AB2 B;  4FF2 A;  1HBO A;  3QLH B;  1M5H A;  3EGN A;  5G4D A;  4FS1 A;  1T0T V;  2AV5 A;  3D66 A;  1SJF A;  1HNW F;  2HIY A;  2XMK A;  4KAI A;  1S9G B;  4EWT A;  3MTK A;  4OI1 A;  1HBM B;  5GAD I;  2ZIT A;  3EX7 B;  4LQ9 A;  1FRL A;  3I9V 9;  2R7W A;  4ZP8 A;  4ED8 A;  2W8L A;  4OZ1 A;  3RB3 A;  5GAH U;  3MM5 A;  2BJE A;  2NZC A;  5KFZ A;  2E1R A;  1Q8I A;  2R7R A;  4L6V 3;  3TVY A;  1QE1 A;  2DHX A;  2V5H G;  2ZKU A;  3HSJ A;  4MYT A;  2IDL A;  4DV1 F;  1AUD A;  5LMN F;  1BWE A;  2KZZ A;  3HCX A;  2VON A;  2GGP A;  1R8H A;  1WC4 A;  3C6U B;  3LAN A;  2B3T B;  2ZD1 B;  2D3O 1;  2L9D A;  1Z2L A;  1HWK A;  4NI2 A;  2QGF B;  4C9D A;  3PW0 A;  3MFI A;  5IT9 U;  5I4M A;  3GQC A;  1SL2 A;  2JEJ A;  4FXD A;  3T1Y F;  4FKX A;  2RHQ B;  1TL3 A;  3HKW A;  4BCA A;  4K0K J;  2CQH A;  1UWB B;  2L08 A;  1WI8 A;  2GHW A;  1S9E B;  3ZZZ A;  3DCA A;  3PW4 A;  3N6L A;  5KFN A;  3UR3 C;  4YB7 A;  4RPF A;  1N5S A;  1SI9 A;  5F9N A;  1ROF A;  1SCJ B;  4USU A;  1N34 F;  1NSP A;  4ZLN A;  1KLN A;  4JI1 J;  2GJI A;  4UOF A;  1RT1 A;  1Y11 A;  3Q8S B;  4G65 A;  1RAO A;  2X3D A;  2XS7 A;  1VHF A;  2DBB A;  3V4I B;  2AIR B;  3DRP B;  3QWU A;  2BRK A;  4LR7 A;  4KY3 A;  2NRE A;  1VRT A;  1U1P A;  2BZ2 A;  2KO1 A;  1WUU A;  1X60 A;  2ZEJ A;  1F1B B;  4J91 A;  5DO2 A;  3OLA A;  4B9U A;  4C8L A;  4J5O A;  2YNG A;  4USI A;  4ELV A;  2F4V J;  5D4P A;  2DNG A;  3M8P A;  1NJY A;  1NJX A;  3E3X A;  1HNW J;  3T19 A;  4EGL A;  1GK8 A;  5D4N A;  1KSP A;  4ZPA A;  1Y5I B;  3CJ5 A;  3DMJ B;  2WTF A;  2V4R A;  3TI0 A;  3FBB A;  1RWU A;  3KLH B;  1NO8 A;  2X3G A;  4QOT A;  2ZHO A;  4CT9 A;  3CTR A;  2MGZ A;  2F9J A;  3MCO A;  2R7Q A;  1TUG B;  2OPQ B;  4KYZ A;  4P2M A;  3VQS A;  5IXU A;  5AJ3 J;  2FVS A;  2KZM A;  3QGG A;  1SKS A;  5LMN J;  4UOC A;  1N54 B;  3QWP A;  4R0J A;  3DLE B;  1DAX A;  3CO9 A;  3D28 A;  1NK9 A;  4HKQ A;  2BMB A;  5DET A;  2GO9 A;  1U2R A;  1IR0 A;  1TUV A;  1HWL A;  2B6A A;  3HD1 A;  1NM2 A;  2UU9 J;  5CZV A;  4IFV A;  1UVJ A;  2MZT A;  3HK2 A;  1RSC A;  4C2M A;  5J1E B;  4YB6 A;  3TUI C;  1VQP S;  3HD2 A;  2MQQ A;  2G0C A;  2JDJ A;  1EP4 A;  5C2C A;  3G82 A;  3I5B A;  3EXY A;  1JLB B;  3BGR A;  3DOL A;  2EW9 A;  1Q95 G;  1HAR A;  2A1B A;  2DJW A;  1WC1 A;  3KLE A;  3OV7 A;  5CYM B;  1TAQ A;  2HRY A;  4NLY A;  3RRH A;  1B70 B;  1IBK F;  2HHS A;  3QYY A;  3P3D A;  3VV2 B;  3KUG A;  1E6Y A;  2ACM A;  4H4K C;  2LQJ A;  3P5B P;  2CQI A;  2R2U A;  3DI6 B;  1UFK A;  1RWM B;  2I6W A;  4DXL A;  3HXM A;  4ECY A;  1S0V A;  1WOO A;  2YPY A;  1NSK L;  1U02 A;  2F1F A;  4GO7 X;  4URG A;  2B9E A;  3ZZU A;  2RS2 A;  2F4V F;  4ED7 A;  4NLG A;  2ACY A;  2AYG A;  3LPY A;  5KFF A;  4FF3 A;  3BKT A;  4X66 J;  2BQ3 A;  2GAH C;  2JVO A;  2DPJ A;  2WRM A;  3AJ1 A;  1U1Q A;  2GJ2 A;  3UVJ B;  2CNO B;  5AE2 A;  2C28 A;  5KFM A;  4O3S A;  1FKO A;  2HIQ A;  3FSY A;  1HBN B;  2NXJ A;  2W4P A;  3H5X A;  2FIU A;  2QJ3 A;  4F4A A;  4Y65 A;  5AJ3 F;  2QMW A;  3G6V A;  4DR3 F;  3GCW P;  1N6Q A;  4ZHR A;  2DNK A;  4TY9 A;  4WU3 A;  4LF7 F;  4YEA A;  1M1K T;  2ZE2 A;  3M32 A;  5DQG A;  1UL3 A;  3MMA A;  4L3N A;  4ED4 A;  2ZUG A;  4LSN A;  1UJ6 A;  4AFF A;  5J1P A;  3SXL A;  1T3N A;  1HR0 F;  4BDP A;  4CLP A;  1S4F A;  2N3O A;  2LXF A;  3KMS A;  3LGH A;  1QDU B;  5GVQ A;  1V3S A;  4KR0 B;  1NJW A;  2RD5 C;  2HYI B;  1SC4 B;  1I3O B;  2UXD F;  3D4J A;  3HVR A;  3HT0 A;  4X65 J;  4DSL A;  2AX1 A;  5I42 B;  2FVQ A;  2HMI A;  2GQ2 A;  3MAA A;  2W9A A;  3CDW A;  2CPE A;  3F73 A;  3PW7 A;  4ZCI A;  5GAE I;  1RXO B;  4IFV B;  1VBK A;  4ZCL A;  2AJ1 A;  3TUJ C;  3CMA S;  4O23 A;  5M2P A;  3KLV A;  3DDI A;  4HHU A;  3D68 A;  4OX6 A;  1FE4 A;  4QPX A;  1VQ6 S;  2E9R X;  5K8O A;  2FJW A;  2QMX A;  4M5I A;  2BM0 A;  1SH2 A;  3LGM A;  2CQ3 A;  5A8R A;  4X66 F;  2YH1 A;  1U1L A;  3J7A N;  4C97 A;  1U25 A;  2V67 A;  3PTW A;  3MUM P;  3MAQ A;  4WP8 A;  1FRK A;  4BHQ A;  3CJ2 A;  2H5I B;  1U0S A;  2YWE A;  2MHE A;  1WOS A;  2CG4 A;  2XQC A;  5CXT A;  4WKR A;  3NCP A;  2IY5 B;  1AFI A;  5B0A A;  2HGM A;  1HYS B;  4K5R A;  2V9K A;  3PX4 A;  3IWN C;  2M7S A;  1HI1 A;  3WQP A;  1VLO A;  2C3P A;  3PYG A;  1FVS A;  1R27 B;  3IG1 B;  3IAS 9;  4X2B A;  1U0H A;  3KXD A;  1I94 F;  5HQL A;  1YRT A;  3WC2 A;  1N8R T;  4NE9 C;  3SMZ A;  1AB8 A;  3K8V A;  2E9Z A;  2MMY A;  2YNG B;  1M0S A;  2RIL A;  2QA2 A;  4ANE A;  1EZZ B;  1RAG B;  1ZM2 A;  4GRS A;  4IG0 B;  4ZPW R;  4XTT A;  4JI6 J;  4ZKA A;  1S57 A;  3DOK B;  4V1A k;  3W3S A;  5A8W A;  2J6S A;  4AQY F;  1TP7 A;  1SC6 A;  1S79 A;  2CNN B;  3N5B A;  3PM9 A;  3MM6 B;  1NHU A;  3EDQ B;  3NAH A;  3CJR A;  5BXI A;  3ZXW A;  4A8Q A;  3ZNU A;  3I56 S;  1OMS A;  2GIF A;  1S72 S;  3PY8 A;  1N88 A;  4UST A;  3KUH A;  1NK8 A;  3V6D A;  4CTA B;  2HND A;  2HS0 A;  1P1T A;  2MZR A;  2IYG A;  3BDE A;  1AZS A;  5KFA A;  2AT1 B;  3MPU B;  3O44 A;  2KM8 C;  1JXL A;  1NH7 A;  3AOB A;  3M1V B;  1PSD A;  3RW7 A;  5HP1 B;  4IFY A;  2H5J B;  5B7W A;  2Y8W A;  2CNL B;  4WPA A;  1RTJ A;  3RRK A;  1W7W A;  1HQU A;  5M2U A;  3L3C A;  3NNH A;  5KFP A;  4DR7 J;  1X5O A;  4GKK J;  3ZTS A;  5DQI A;  1TKD A;  2M5Y A;  2G0J A;  2GIR A;  2E7V A;  2IFX A;  1EET B;  1RWP B;  3D54 A;  3TAR A;  5C25 A;  4EK2 A;  3FNN A;  2KT2 A;  3K17 A;  1T94 A;  4A8W A;  1VQN S;  1YJU A;  1NK4 A;  2F8H A;  4ERD A;  2XYH B;  2CXE A;  3SQG B;  3J7Z T;  4HHH A;  2UVW A;  2W2Q P;  3QAT A;  5K9F A;  2M70 A;  2H4Y B;  4IDK A;  3CJ8 A;  5KG6 A;  2VBX A;  4NPO A;  3RU0 A;  4BBY A;  1FKP A;  3EJM A;  1C1C A;  1LK7 A;  4ILR A;  2HSE B;  4U8V A;  1FF2 A;  3A8E A;  3TUZ C;  3ENW A;  2EKY A;  5K14 A;  2B0G A;  1YGY A;  3QGP A;  3T6B A;  4CO0 A;  2BDP A;  5DS7 A;  4DX8 H;  1OO0 B;  2V2K A;  2FC8 A;  4L72 B;  4M5G A;  3OJU A;  1T03 B;  1GT8 A;  4OYP A;  1FJG J;  5KFL A;  2MY8 A;  4MKB A;  3QAU A;  4DV2 F;  2YQ3 A;  1H2T Z;  4I4B A;  2VQE F;  1TV6 A;  5KFU A;  4DR1 F;  3IR7 B;  4KGK A;  1NBE B;  4LF8 F;  2UXC F;  4DR6 F;  1S49 A;  4Z2X A;  3M2R B;  4DV5 F;  2YY3 A;  1FHT A;  1ZOT A;  3DC2 A;  4J9R A;  3AOC A;  4JOU A;  1Q5Y A;  1M5P C;  1IBK J;  2DGQ A;  4HLB A;  5CQG A;  4W90 B;  3KK3 A;  4A46 A;  1ZS6 A;  3EE3 A;  4DEZ A;  1C4A A;  3GMG A;  3F0N A;  2ILY A;  2XWY A;  5ETR A;  1Y0H A;  3VZH A;  3EPG A;  1NXI A;  3MEC A;  3QSY B;  4C0B A;  2GS8 A;  4K2X A;  1L3V A;  2DGT A;  3NGS A;  1YI2 S;  4GO5 X;  2B7C B;  4KFB B;  1S6Q A;  2WK4 A;  3HFZ B;  3HX9 A;  3CCE S;  1RAA B;  1SB6 A;  4J9Q A;  1X8D A;  1ZA1 B;  1UFL A;  3NOG A;  2ZNZ A;  1F0X A;  1JLQ B;  3IGN A;  1KFD A;  2RSQ A;  3KLG A;  4G1P A;  3VAH A;  2HQ3 A;  4RUH A;  4FVM A;  3OT9 A;  4CO2 A;  4LFB J;  2LVW A;  4DS4 A;  2QFI A;  5IQ6 A;  2FDN A;  2SXL A;  3FRZ A;  1WNE A;  4LF9 F;  1S1V B;  2NSB A;  5F9L A;  2XBP A;  5EN1 A;  1N4L A;  2HFU A;  3TW0 A;  2B8P A;  1UP1 A;  2J8A A;  4DV0 F;  1N33 J;  1IBC B;  3BO2 A;  2BAB A;  2FZK B;  1TKZ B;  2H4W B;  3OR1 A;  2HS3 A;  3T1H F;  3PRB A;  3CJ4 A;  3L09 A;  4FYD A;  1FJE B;  4C8Z A;  1BE4 A;  2OFG X;  3ELH A;  4YFU A;  1VJW A;  3Q89 A;  3HJF A;  5IT4 A;  4WP9 A;  1VQY A;  3TVZ A;  1N5V A;  2EEY A;  3AXM A;  3L9Z A;  1GMU A;  1Y7P A;  1HI8 A;  2VQE J;  4IOC Q;  2OEL A;  2HHQ A;  4LF6 J;  1RTI B;  3BKF A;  3JSY A;  3LAM A;  2U2F A;  4G1I A;  5JUM A;  4XPE A;  3A12 A;  2Z2M A;  2UXC J;  2BRL A;  1HKA A;  3SFG A;  5HBM B;  3KJV B;  4DR6 J;  2V94 A;  3U27 A;  5RUB A;  1B4S A;  3GJR B;  4C11 B;  2ZH3 A;  1MSW D;  5EX0 A;  1N52 B;  2XYP B;  4MIB A;  2CUY A;  1X4E A;  2G1D A;  1FNO A;  1R31 A;  2FZG B;  2J7K A;  2WSE C;  2XO6 A;  1LXJ A;  2M8D B;  1DJ0 A;  3C6T A;  3I0R A;  1T9U A;  1FXR A;  4M1K A;  2YKA A;  3QNW B;  2RB7 A;  4CLT A;  1G7C B;  2ZWP A;  2BJ8 A;  3WX4 A;  3OXG A;  3CED A;  2EFP A;  4C4W A;  1V3R A;  4YY3 J;  4ELT A;  1DQA A;  3KDO A;  3TJA A;  2BV3 A;  2E5I A;  3I96 A;  3QO9 B;  2EFN A;  4ZA1 A;  1GH8 A;  2GML A;  4ECV A;  5F8J A;  1IM4 A;  3CDU A;  3PFE A;  5J1E A;  4N8O A;  3H5S A;  5KAK A;  1U6B A;  1WF1 A;  4C0O C;  3MM6 A;  4MH8 A;  3B6B A;  1J5O B;  2MKI A;  2F4F A;  1HNI A;  3A13 A;  3W62 A;  4OX7 A;  1T05 A;  3CGI A;  1OYE A;  2ZBC A;  1OIA A;  1OY6 A;  3D7S B;  3FC9 A;  1FNX H;  1SKR A;  1HIY A;  1MNE A;  1S4E A;  3HHE A;  1NPP A;  4A4J A;  4IG0 A;  4L75 A;  3DNC A;  4USV A;  2MQM A;  3QT8 A;  4C7Q A;  3OSN A;  4C3K A;  2KYX A;  2ASY A;  1O51 A;  1RE1 B;  2MTL A;  2YNI B;  3OPK A;  2E1P A;  2YWG A;  3CJS A;  4HHJ A;  2HK3 A;  4LRA A;  3VVT A;  3KK2 A;  4DV0 J;  3CD6 S;  5HI7 A;  4X4Q A;  4M95 A;  3AD8 C;  4PPD A;  3VQT A;  4GC6 A;  5T41 A;  4BLG A;  2VDI A;  4RU9 A;  3I0R B;  3UQS A;  4J9O A;  5DLF A;  3K59 A;  3FMB A;  3LWL A;  4H54 A;  3DRP A;  2ROE A;  1FD8 A;  2HK2 A;  3DM2 B;  4Y2C A;  3ICL A;  1SXL A;  4ZPD A;  5C24 A;  4A47 A;  3CCL S;  5T7L A;  1TL1 B;  1GX6 A;  2B4V A;  3BR9 A;  4I6A A;  4O4R A;  4WE1 A;  5AT1 B;  3CIM A;  2PMZ D;  2CAD A;  1NEE A;  1RCO B;  4M5M A;  4TLQ A;  5HL7 Q;  1CJK B;  2A6M A;  1H74 A;  4OHV A;  5KG3 A;  3WBZ A;  1YJ7 A;  3ZTR A;  1G4C A;  4Z7Y A;  3V4I A;  4WU2 A;  3CCV S;  4ID5 A;  3QO9 A;  1XC9 A;  4Q2L A;  1G1X A;  4BC7 A;  4QWA A;  3M4X A;  4Q8F A;  2XI3 A;  1JLG B;  2Y1R I;  2YKN B;  2JC1 A;  3ENA A;  3I87 A;  2AKW B;  5IZH A;  4FYY B;  3TA0 A;  4YY3 F;  1VQK S;  1S48 A;  3N5F A;  2VHG A;  1SV5 B;  3WIV A;  3H5Y A;  4YOE A;  4DU8 A;  2CVI A;  2C22 A;  3P96 A;  3Q0A A;  2GGP B;  5DGA A;  2HMI B;  1X4F A;  4LFC J;  3R1L A;  5E5N A;  4ZVO B;  4ZVH A;  3D0G E;  2M3D A;  2WZ1 A;  3KJQ B;  2K8G A;  5DDQ C;  3TZY A;  2OO4 A;  1CPZ A;  2BE7 D;  3OUY A;  4DPO A;  2FVC A;  3EXC X;  2VC0 A;  5FLX Y;  4A8S A;  4X4U A;  4UOG A;  1UVI A;  1TVR A;  4RL1 A;  4ZN1 A;  2UUT A;  1WG4 A;  3IM9 A;  3M8Q B;  4D3G A;  2ASD A;  2Z2Y B;  3GWC A;  4M5H A;  3MF5 A;  2F5G A;  2XMA A;  2OPS A;  4LIW A;  4YME A;  2WVC A;  1ZTW A;  1WEX A;  2C2N A;  2IBO A;  2FHK A;  4JV0 A;  1HBO B;  1U24 A;  1TL4 A;  2B9X A;  2LLZ A;  2WCX A;  3OVS A;  4DUY F;  4DFJ A;  3C3L A;  2VC1 A;  1N6Q B;  4LRB A;  2WVF A;  1S7H A;  4R0E A;  4B3M J;  1Q4R A;  3WIU A;  4PR6 A;  3JTO A;  3PJ9 A;  4IKA A;  7AT1 B;  1L3U A;  1XNQ F;  3C15 A;  5ADZ A;  1VC6 A;  5F8I A;  3UNY A;  3OVA A;  2K2P A;  3R27 A;  4FPR A;  4ZVR B;  4CRJ A;  2AMC B;  2GVZ B;  5SUH A;  1NME B;  4DU7 A;  2DH8 A;  2RKI B;  1Q1K A;  2DGU A;  4N77 A;  4ENO A;  5B0D A;  4ECZ A;  1I6J A;  2FLN A;  1TZ0 A;  3GJT B;  2IRU A;  1PC5 A;  4ED2 A;  1OPI A;  4MIA A;  4PG6 A;  1RT5 A;  1U09 A;  1VS3 A;  4KGZ B;  1T7P A;  4U7U K;  2IRY A;  2DY1 A;  2Q3P A;  3PEH A;  2XY7 A;  5D3G A;  3J80 U;  1YRU A;  1YJR A;  2H65 B;  2FJD B;  1REV A;  2DB1 A;  2UV8 G;  1HNX J;  4B9M A;  3AFG A;  4LQ3 A;  2G4B A;  3D3B J;  2CNK B;  4X4N A;  3M30 B;  1HMV B;  4NLR A;  1Q8B A;  4QR1 A;  2WSF C;  4RW9 B;  3ZZR A;  1I1G A;  1RAH B;  3BPD A;  3AH6 A;  3QAE A;  4H4M B;  1PCA A;  5IM0 A;  4HYK A;  1SJ1 A;  2CDR B;  4O3O A;  1LWF A;  2J9E A;  4U7U D;  3G82 B;  2UV8 A;  1FRJ A;  2EFV A;  2R8J A;  1R43 A;  1YJT A;  1QM9 A;  4H4K A;  4AE5 A;  4C8N A;  3TRG A;  1MN7 A;  3AY0 A;  1B7Y B;  3EUN A;  1S5Z A;  5I3U A;  4ANC A;  2AU0 A;  4WF9 Q;  3I82 A;  2GO8 A;  3NKY A;  1BY9 A;  5CH7 B;  4DV3 J;  1NK6 A;  4CM0 A;  1ZM4 A;  2MST A;  2EG1 A;  1EKS A;  1REG X;  2O01 C;  4ZVE A;  4CCH A;  2V2Q A;  3E01 B;  5FDL A;  4IR9 A;  2XB2 D;  2DNY A;  4C8O A;  1H73 A;  2DHA A;  4KH0 B;  2FJB B;  3DLE A;  4CLS A;  3MHY A;  3VR1 A;  5H9E K;  4O3R A;  5KFV A;  4OJH A;  4CO1 A;  1VC0 A;  2O5D A;  4DL0 C;  4DR5 F;  4QWD A;  2U1A A;  1YZ7 A;  1RCX B;  3NBP A;  2W8K A;  5DJB A;  3CPW R;  2HFO A;  4EZ9 A;  2XHC A;  3DRX A;  4A8M P;  2MB0 B;  3KTQ A;  5A8K A;  3ISN C;  3OSP A;  1EAY C;  1EET A;  2PD1 A;  3GYN A;  2WAQ D;  1KTV A;  2J6U A;  3MEG A;  3TR5 A;  3DOK A;  3LWM A;  1KON A;  1B99 A;  3T41 A;  2GX8 A;  3CWJ A;  4WP3 A;  4PRF A;  5LJ3 Y;  5L1J A;  5ETV A;  3LP0 B;  3KJN B;  2DR8 A;  3NOC A;  4MKA A;  2GHP A;  3FDS A;  4LRF A;  2JSX A;  2NUH A;  2DXF A;  4ZVF A;  1VIS A;  3KG4 A;  1Q86 T;  1RBA A;  1YQH A;  2YNI A;  5GAH I;  1Y5N B;  3I5A A;  5D0E A;  2R7U A;  3IRX A;  4B3O B;  4OFZ A;  1U2F A;  1NHK L;  2Y8Y A;  4YP3 A;  3K5P A;  5LL6 d;  3MPD A;  2OH2 A;  3Q2S C;  1E6V B;  5THW A;  5IS2 A;  1FI4 A;  1QLN A;  3W8G A;  5DM7 Q;  2W01 A;  1TL3 B;  2EK1 A;  4JI7 F;  2DNM A;  4AUK A;  2RDI A;  5E3C A;  1RT6 B;  3NWG A;  1EQM A;  5KT5 A;  3KHR A;  2MKH A;  3HHN B;  4P10 A;  4ECT A;  1GFW B;  2XI2 A;  4I6W A;  3G71 S;  3T5L A;  3V6K A;  1RT7 A;  4OYI A;  2MLX A;  2YBV A;  1X9S A;  4RW7 B;  1ZYQ A;  2IDE A;  3FBF A;  4XAK A;  1EB0 A;  3VGV A;  3W66 A;  1OPZ A;  4P6Q A;  4ZIT A;  1S0M A;  3GP9 A;  4ZK7 M;  4X4V A;  5AXK A;  1FK9 A;  2DNL A;  3GSD A;  3C16 B;  3ILO A;  4DR5 J;  4KT0 C;  4QU7 A;  3JSR A;  2R7O A;  5F3Z A;  3BYP A;  2WBR A;  3MR7 A;  4U6P A;  1PKU A;  1REV B;  3H98 A;  1KN6 A;  3VAM A;  3OLB A;  4QIF A;  1NKE A;  4PWW A;  1H72 C;  2BOA A;  2MQP A;  3C8Y A;  5IM0 B;  2XSF A;  3M8S A;  4DQQ A;  2XGQ A;  4NCA A;  2L9N A;  4CP5 A;  2KYZ A;  3UE2 A;  3RR7 A;  5A8R B;  3AHP A;  4X64 F;  2F65 A;  1HI0 P;  3NMR A;  1K1Q A;  3EZU A;  1CC7 A;  1PYT A;  1XER A;  2JC0 A;  1UTA A;  3D3C J;  1TU0 B;  2XZT B;  2XEX A;  3LP2 B;  1YWX A;  2BQU A;  3EM1 A;  4DN0 A;  1R0B G;  3M8Z A;  1A0O B;  1J27 A;  3IS9 A;  4EBD A;  1NDL A;  2A10 A;  3M6X A;  4ETX A;  3J81 Y;  2DNN A;  4RW6 A;  3SI8 A;  2QG9 B;  1FO1 A;  1J5E J;  3HUL A;  3MED A;  2Q6C A;  2XSJ A;  3QT7 A;  3RJM B;  3SV3 A;  2V4J A;  3QT6 A;  4I7F A;  1QAJ A;  2MQ8 A;  3AA9 A;  5EGY A;  2YKM B;  2DH9 A;  2CQ1 A;  4KB7 A;  1DZ5 A;  3JQM A;  1IKX A;  3A4T A;  2ZVI A;  2NYI A;  3ONQ A;  2VIC A;  1YBT A;  4O4G A;  4WFY A;  4ZS6 A;  4I1T A;  3SFU A;  1S1T A;  4TNO A;  3R7N B;  4QYR A;  2OLW A;  5JJB A;  3D0I E;  5JMN A;  4OYX A;  3KMQ A;  1PYS B;  3TUP A;  4QR2 A;  4NXM J;  2ATL A;  4YB1 P;  5KFH A;  2G2O A;  1HW9 A;  2QC3 A;  3GSI A;  2BBE A;  4I56 A;  4A8O A;  1VQ7 S;  4DV6 J;  3J81 j;  1M5V C;  2DO4 A;  3UVJ A;  2VQF F;  4K4V A;  1RU2 A;  1Q8K A;  4JI4 F;  1NCL A;  2JLE A;  1C1B A;  1L3T A;  1JJH A;  1XBW A;  3IS9 B;  1BHN A;  1WHW A;  2FHJ A;  3P8B B;  3QZ8 A;  3IN5 A;  2BVZ A;  4CLL A;  1QSS A;  1RT3 B;  2HWT A;  2IVY A;  4Z37 A;  4MFB B;  2VPY B;  1IWG A;  1HPZ B;  4R5P A;  1R0A A;  2KFZ A;  1JLG A;  3GJQ B;  1T03 A;  1FJC A;  3JB9 k;  2C1E B;  1ZZN A;  5H9E J;  3MEK A;  3PIP Q;  3ETM A;  3MI7 X;  3B4M A;  1WJ9 A;  2ZJR Q;  6FDR A;  2VOO A;  3GIJ A;  3EGW B;  2LA6 A;  4NLO A;  4EYH B;  3CCU S;  4CLU A;  3PW5 A;  2RDD A;  4LSL B;  1LWC A;  5CYM A;  5D6G A;  1ZAW A;  1EQ0 A;  5J2M B;  2PEH A;  1KQF B;  2W2M P;  4NA2 A;  1J5E F;  1X9W A;  3TWZ A;  4DZD A;  2AJ0 A;  4FDF A;  1R3N A;  1IN0 A;  2JX2 A;  2YNH B;  1F9F A;  3DMJ A;  4OHZ A;  3CJK B;  1MMD A;  3CDE A;  2F9D A;  3HHK A;  2JJ4 D;  4EO8 A;  3QSI A;  1PJ6 A;  5L1K A;  2UU9 F;  1GMW A;  1WAC A;  1M5O C;  2CWK A;  3H5U A;  5HJX A;  3QZ7 A;  3IR6 B;  1FA0 A;  2DCL A;  2OEJ A;  4NLW A;  1KS2 A;  1HWI A;  4Q2M A;  4OLO A;  1RTJ B;  2VG5 A;  5CD4 H;  2XMM A;  5DDR C;  2KFN A;  3BKU A;  3EGZ A;  6AT1 B;  4IFY B;  1TQL A;  2E44 A;  2K1R B;  4ZDN A;  3ISN D;  2J5A A;  2LKZ A;  1RHR B;  2VFV A;  1HNI B;  1RK8 A;  4RWX A;  5KFE A;  4OHW A;  1UKU A;  5GAE U;  1RIS A;  1E6V A;  4NRT A;  1VDH A;  2XYG B;  4OYA A;  5E3R A;  1XMO F;  2X1F A;  2VUG A;  4JI4 J;  3DDN A;  3EPI A;  4DSK A;  2PA3 A;  4JI0 J;  2Z0G A;  1XNR J;  1WSR A;  4FBT A;  2HZA A;  3LO3 A;  1SQE A;  4CH7 A;  5AXN A;  4E0D A;  5KFT A;  1G3O A;  2E5L F;  4TQR A;  4WIQ A;  2F8M A;  2C3M A;  3AD7 C;  1X4D A;  4ES3 A;  4QWE A;  3I4P A;  2FHO B;  3TX0 A;  3JQK A;  4OYZ A;  2WBM A;  4USK A;  3GV8 B;  2EPI A;  5KG4 A;  3W63 A;  1RTI A;  1MU2 B;  2MQO A;  1JQG A;  4USH A;  3S7R A;  2MY7 A;  2JLG A;  3CJT A;  1LW0 B;  3G86 A;  4KQZ A;  1UW4 A;  3PYD A;  2W4D A;  5A6W A;  3D2W A;  3KJV A;  2BW7 A;  3CCR S;  3RR8 A;  1S6P B;  4DR3 J;  2DIV A;  4IG3 B;  3PNI A;  1F2G A;  3R5C A;  4K4Z A;  1I51 B;  2EVZ A;  3E8O A;  3CCS S;  4UY8 T;  1YG0 A;  2V2Z A;  2ZFH A;  2ZH5 A;  5B0B A;  4F2R A;  5M2R A;  1RUS A;  5L1I A;  1UA1 A;  1X9M A;  1BQN A;  1F2H A;  2K7K A;  3OR2 A;  3LW5 C;  5MAO A;  3S8S A;  3FEX B;  4OZ3 A;  2B51 A;  1HFE L;  2J7W A;  3OXL A;  5KFO A;  4DV7 F;  4TKT A;  5IOL A;  4L74 A;  4DL2 A;  3O2I A;  2F8E X;  2DRA A;  2KTQ A;  3NLC A;  5E3A A;  2Z30 B;  1P8G A;  4AD6 A;  2AEF A;  1PIL A;  4CNY A;  1H98 A;  5F0W A;  4Q5V A;  1RA6 A;  4A8Y A;  2QA4 S;  5HMZ A;  1JLC A;  4NZ0 A;  1LOU A;  4X65 F;  4NLX A;  1VJQ A;  1LNQ A;  4ZVS B;  2Q1L A;  2JVR A;  2W25 A;  1AT1 B;  1VYA A;  3AJD A;  3MR5 A;  3FFI A;  4IOB A;  3DYA B;  1VMB A;  1IQZ A;  1XMO J;  2QA1 A;  4FXW A;  1NK7 A;  1IKX B;  4GKJ J;  3TA1 A;  2ZDP A;  5I42 A;  3OTO F;  4NXN J;  2VJU A;  2YKM A;  4NZ6 A;  4Y3C A;  2I5J B;  3J7A 1;  3HSG A;  4K50 A;  2HVI A;  1SJ4 P;  1DTT A;  3QLH A;  4EYI B;  1X5T A;  5DQH A;  2XSJ B;  1VR6 A;  3CCM S;  2J8S A;  2RF2 B;  3CT9 A;  3JTN A;  4LRE A;  2RQC A;  2IHR 1;  4B9N A;  3FZ2 A;  4F8R A;  4PWU A;  2HEK A;  2UUW A;  3VWS A;  2D41 A;  5LJ5 Y;  3R5D A;  3TP2 A;  3DYA A;  4JP8 A;  1JXV A;  1KOH A;  2D9O A;  2OUG A;  4LSZ B;  4CI0 B;  2E7W A;  1M5K C;  3NG8 A;  4Q45 A;  1U4B A;  1JMT A;  2CA9 A;  4O3N A;  1ELO A;  2K7J A;  2RQK A;  2E7X A;  2RKI A;  4O0N A;  4F26 A;  5CCL A;  3CCQ S;  2M88 A;  2P8I A;  4ECQ A;  4J9V A;  4URS A;  1BXN A;  2BJ3 A;  1HBN A;  4OJG A;  1YKW A;  3VF0 B;  4E98 A;  3QRQ A;  1H2V Z;  8AT1 B;  4DV7 J;  4NL5 A;  4P72 A;  2IM3 A;  2LFV A;  2K3K A;  1UWA A;  2VD3 A;  4JI6 F;  1LWE B;  5HQM A;  3BQ1 A;  4N41 A;  4LF4 J;  4DPU A;  1TK5 A;  4PWD B;  4Q0B B;  3VGS A;  2FJV A;  1NRK A;  1VC5 A;  4Y6I A;  2OP5 A;  2OFH X;  2HVE A;  1HA1 A;  4B9L A;  4FF1 A;  3LP1 B;  3HHL C;  4EI2 A;  1FD2 A;  4PG8 A;  4F2S A;  2D1C A;  5F8L A;  1Y10 A;  1LW2 A;  1S6P A;  3BR8 A;  4OZJ A;  4X4O A;  1RAI B;  3GU0 A;  2DK2 A;  2E5J A;  5LXR A;  4RW7 A;  1JB0 C;  3MUT P;  1HNV A;  1OWX A;  2XMW A;  2QFJ A;  4ED6 A;  1HQU B;  3WX8 A;  1CC8 A;  1RU1 A;  4WFN Q;  3GFH A;  3JSM A;  1IKW A;  3LGN A;  3TJ9 A;  4X4P A;  4ED1 A;  2HGL A;  2J0X A;  4J9K A;  5H9F K;  3I9Z A;  5HAN A;  2R7S A;  2EK6 A;  1JJ4 A;  3X3U A;  2EBG A;  3FCV A;  3FKB A;  1IKV A;  1H2U X;  1Q53 A;  2GC8 A;  3H8Y A;  4K4U A;  4QYZ K;  4FPI A;  2H1Y A;  2R8K A;  2YPZ A;  1FEH A;  5CYJ A;  4R8U B;  2ZOF A;  4GKK F;  4K4Y A;  4ES2 A;  3QIP B;  4OJ3 A;  4PCQ A;  3V6D B;  1FWK A;  2DRB A;  1HHQ A;  4M5N A;  2YKN A;  2NQP A;  1T3O A;  1YZ6 A;  3MEE A;  3QGI A;  1BQM A;  1K9M T;  4EFA C;  1SBR A;  2JHE A;  1UJ5 A;  3K5O A;  1H38 A;  1KHV A;  2K1R A;  4RUB A;  3X1L B;  2CQ2 A;  4JI2 J;  3J80 Y;  4CYU B;  3B4D A;  4NYP A;  4OZ0 A;  3KLI B;  1FX4 A;  1FVQ A;  2W2N P;  3KWM A;  1S9F A;  2NSC A;  1QAY A;  2LDY A;  3H25 A;  4IR1 A;  2AQ4 A;  4IH6 A;  4KO0 A;  1FFG B;  1IR2 A;  5HAO A;  2CQ0 A;  3QJP A;  3T5J A;  2FZC B;  4I2Q A;  1RDR A;  5CAB A;  2LXI A;  1P6T A;  4EU0 A;  3HM9 A;  1D09 B;  4AT1 B;  1FJG F;  1TL7 B;  1RTZ A;  2RE1 A;  4DV2 J;  4DL5 A;  2AYB A;  4JV5 J;  2HLT A;  4LBH A;  3KK2 B;  1JLF A;  1M5S A;  2BE9 B;  3CCJ S;  2MZJ A;  2LEB A;  1VFJ A;  4JYA J;  3HSD A;  4E2F B;  3K7R A;  2OSR A;  3ADA C;  3K8W A;  3BH6 B;  3GYG A;  1L5U A;  3BGL A;  2QA4 G;  4DV5 J;  1FKA F;  2EI5 A;  2KU7 A;  2HKE A;  1ZZF A;  3U7J A;  2BJ7 A;  1JJ2 R;  4B9T A;  1R8A A;  2OEK A;  4TY8 A;  3DLL Q;  4EZ6 A;  2R3V A;  3M6V A;  4GVB B;  4QIV A;  5KTQ A;  2HBQ B;  5C42 B;  2D3Z A;  4ED3 A;  3JAM U;  4J90 A;  4ZP6 A;  2DNR A;  3GLJ A;  2BR0 A;  3BQ2 A;  2IM2 A;  2L48 A;  4Y2K A;  4USM A;  3JS9 A;  2BJD A;  1S9E A;  2PI5 A;  4CM2 A;  3MCM A;  4TY8 B;  3PW2 A;  2WB4 A;  1C1B B;  1P27 B;  3ILI A;  3O8W A;  1Q7Y T;  1GXL A;  1Z4U A;  1AA1 B;  1RYR A;  5G0R B;  2KHD A;  3PEJ A;  3OW2 R;  1EIY B;  4WII A;  3QFH A;  1KLM B;  5K8M A;  2AGP A;  2FQQ B;  2Y3Y A;  5DLG A;  3C6T B;  3R5B A;  2E29 A;  4FF4 A;  1UPM B;  1L3K A;  2QO3 A;  2XLJ A;  1WI6 A;  3OFE A;  1P9Q C;  1BQX A;  1N36 J;  4P73 A;  4DL3 A;  3Q2T C;  1DAR A;  3ENV A;  4BWM A;  3QJJ A;  2HQG A;  5EWF A;  4BC9 A;  2VBZ A;  4KGX B;  4DUT A;  2DHG A;  3FBE A;  1GXU A;  1NKB A;  5D78 A;  3QFW A;  2E9T A;  3EZ5 A;  3T1H J;  5L38 A;  2XM3 A;  2DNQ A;  3M8W A;  1FCA A;  2XO7 A;  4P75 A;  1RWK B;  4GMK A;  1SPB P;  2NXU A;  4LF2 A;  5J1N A;  1ACM B;  3NGK A;  2ZE2 B;  3M32 B;  2CQP A;  4JV5 F;  5KT4 A;  3M2U B;  1UMJ A;  1CS4 B;  1MWY A;  3H2L A;  4DN9 A;  3M6U A;  1HNZ F;  2E1C A;  3KHH A;  4RW4 B;  2HLU A;  4DPX A;  4RW6 B;  5L9N A;  4JYA F;  4MTP A;  4U9R A;  4DZ6 A;  3IMQ J;  3M9M B;  4J9L A;  4OV6 A;  3DLJ A;  1P1L A;  1FE0 A;  2AHO B;  3I32 A;  3QMQ A;  2CIM A;  3FK4 A;  4NCG B;  3C46 A;  2YX7 A;  4R8U A;  5E7O B;  3I5C A;  4MIW A;  1MW7 A;  3SCJ E;  2OPS B;  2B9Y A;  1U49 A;  3S1T A;  3KK1 A;  2QN6 B;  5EWE A;  2VBY A;  2AJ2 A;  2HVD A;  1S1W B;  3IR5 B;  4YUD A;  3HP6 A;  4ED5 A;  3JTP A;  3ZC4 A;  2JLF A;  4IH7 A;  2Q43 A;  2MKY A;  5BJR A;  3BRE A;  3OUY B;  1FFS B;  3E51 A;  3NCQ A;  1QSL A;  4PUO A;  2PFF B;  2QX0 A;  3NS5 A;  4NYZ A;  3MCS A;  4DJB A;  2P6T A;  1JLB A;  2XLI A;  3JQJ A;  1E6Y B;  1NK0 A;  3NNC A;  4U96 A;  2H51 B;  3UD4 P;  2CFX A;  1WC6 A;  1KQK A;  2FJX A;  1KFS A;  3I55 S;  2OPR B;  3DHX A;  3A3O B;  1FFW B;  3MPW A;  5FII A;  3ZTO A;  4F4K A;  3BGF A;  4PXE A;  2HFS A;  4DX7 A;  2V2V A;  3U1N A;  1N36 F;  3CO0 P;  4CH0 S;  3FCW A;  3BYR A;  4ZLJ A;  3FJ2 A;  1R8P A;  2OD4 A;  3ZFV A;  1OY8 A;  1MRO A;  2NS1 B;  2D3O R;  1DTQ B;  1OJ4 A;  4DQR A;  4HTI A;  2GHV C;  2B6A B;  2P9E A;  2YKP A;  3GON A;  1RAB B;  4XIU A;  4N56 A;  1RAC B;  4OX9 F;  4KV8 B;  1OY9 A;  1T9T A;  4YDX A;  3W2W A;  3UDE A;  1W2I A;  4P74 A;  4FVC A;  2V68 A;  1V5V A;  3B54 A;  1RAE B;  2HBR B;  4IYQ A;  4OYW A;  2W24 A;  4PPZ A;  4WYW A;  5K14 B;  3UN3 A;  3DLG A;  4DS5 A;  1RA7 A;  3CB4 A;  4A8K A;  1RLD A;  2GZO A;  4JB8 B;  1VBX A;  1NJI T;  1HNZ J;  3GIM A;  2UUC F;  4ICL A;  4B3R J;  2R7V A;  2AZ3 A;  4RX6 A;  2KN4 A;  1LK5 A;  2HBZ B;  4B02 A;  3Q8Y A;  3SQG A;  3M9O B;  3RTV A;  1LEO A;  1NDK A;  2CQC A;  2CYY A;  2C3O A;  1AXQ A;  2PII A;  3OFH A;  4OI3 A;  5E3P A;  4C48 A;  1IBL F;  1NDC A;  2EC0 A;  4MK8 A;  2CQ4 A;  3MM7 A;  4OX8 A;  1Z1Z A;  5LM7 E;  4HH0 A;  1VRT B;  2DCU B;  1K8A T;  3L7U A;  2PEB A;  3IXQ A;  3LAL A;  4KJI A;  2OMO A;  2CJA A;  2DT9 A;  3W61 A;  2IM1 A;  4QWC A;  3GR0 A;  5B0F A;  5A8K B;  3AB4 B;  1U8W A;  4F50 A;  3CC4 S;  4WYL A;  1FRI A;  1PC4 A;  2IA6 A;  4LFC F;  1SH0 A;  4KKO B;  1DHM A;  3CDA A;  3LQV A;  5AE3 A;  1YJ9 S;  1CSJ A;  4W4M A;  1UZD A;  3CJ3 A;  4G6V B;  1JLC B;  2CQG A;  4TVA B;  5IV3 A;  2OTJ S;  1RT1 B;  4QR0 A;  2C2K B;  2C3Y A;  3T1A A;  3SZ2 A;  4PAA A;  3OL9 A;  4Q8E A;  4JI8 F;  3PIO Q;  1S1U B;  1Q5V A;  4QW8 A;  4LF5 F;  3DDK A;  4DCP B;  2Z58 B;  5E41 A;  1S97 A;  4ZIV A;  4OHX A;  3DRS A;  3OTE A;  1FTC A;  4ZLP A;  4RU2 A;  4YN3 B;  5KFS A;  2XMU A;  2ZD1 A;  2GCF A;  4ATN A;  4WKY A;  2MXY A;  1WKJ A;  3E01 A;  3MPY A;  5EDW A;  4F4W A;  4DR2 F;  3EIC A;  4Z7C A;  4XDD A;  4F0K A;  3R9L A;  2ZDO A;  3NEK A;  2QL5 B;  3P5T L;  4B3M F;  3QPI A;  2RIJ A;  2VPW B;  5LT5 A;  2POK A;  3L4B C;  1ZH5 A;  5L46 A;  2PO4 A;  1I5O B;  3HPO A;  1WTB A;  3FMW A;  1QE1 B;  1U0H B;  1LQ9 A;  2JFD A;  4FS2 A;  3KHG A;  2UUC J;  2ILZ A;  3QJL A;  1K0T A;  1U6F A;  2CRL A;  3G6X A;  2A2C A;  3CJQ A;  3LP1 A;  4RNN A;  1UA0 A;  5SZT A;  2LDI A;  2MYF A;  4HR2 A;  4CO3 A;  2I8E A;  8RUC A;  2ZVS A;  1DFD A;  3M30 A;  2MKK A;  2QZ8 A;  3M2V A;  1S1V A;  3MMJ A;  3OL7 A;  4NWB A;  5J2P B;  5HLF A;  3RW6 A;  3ISZ A;  2DIU A;  4M5L A;  1N33 F;  4LMZ A;  1QTM A;  2PN6 A;  4X4T A;  4RBU A;  2RH3 A;  2QSF A;  1SC1 B;  1PGZ A;  4ZMM A;  3GIK A;  1X5S A;  1ITP A;  2I38 A;  4AL7 A;  4W92 B;  3KNG A;  3ITH A;  5D77 A;  3US5 A;  1EAR A;  2HG4 A;  3EZO A;  1D9D A;  1FES A;  2YKO A;  2CPJ A;  3UWT A;  2MEW A;  2HVZ A;  2HNZ A;  1QAX A;  2P9G A;  4O3P A;  3VCD A;  4I2P B;  3C15 B;  1YBA A;  4MK7 A;  2YNF B;  4TXS A;  2QT7 A;  3HKZ D;  2B4P A;  1IXK A;  3ETO A;  3Q23 A;  1XTZ A;  5L1L A;  2A0F B;  4LF5 J;  5KFD A;  3BGO P;  1K44 A;  4KC5 A;  4M5J A;  1T95 A;  1VQS A;  2UUB J;  1X4B A;  4WFA Q;  3M05 A;  5DM6 Q;  1APS A;  3C19 A;  2FHM A;  1CQN A;  2OAU A;  3MM7 B;  2VF3 A;  2XG8 A;  2D74 B;  2MJU A;  3W9H A;  4B9S A;  4JBC A;  3KJF B;  4I69 A;  1JLE A;  2DYA A;  3FGV A;  1DBD A;  4QIW D;  3MXH P;  5K5M A;  3MMC B;  2MKS A;  2XGP A;  2ADB A;  1JKH B;  3CE8 A;  4FNH A;  4PQU A;  1VQ9 S;  3DLG B;  2RUG A;  5L39 A;  3TZX A;  4UZB A;  3KYL A;  3R7S B;  4TQS A;  2QE5 A;  2RU3 A;  3HVW A;  2W7O A;  2LQ8 A;  4ZP9 A;  3BS9 A;  3Q86 A;  3FQL A;  3H0P A;  1W25 A;  3GJS B;  2BAN B;  3IRW P;  1GAO A;  3KDN A;  5KG0 A;  2IJF A;  1W26 A;  2ADC A;  2YQ0 A;  1DTQ A;  3IBF B;  3W2V A;  1T9X A;  2MZS A;  1SKW A;  4RLE A;  2IVM A;  4J7C A;  1PIE A;  4NOH A;  1KQG B;  4OQJ A;  2B43 A;  2M4M A;  1YK9 A;  2MSS A;  3DN9 A;  4F25 A;  4HEA 9;  4I0W A;  2OPR A;  3ZTP A;  3TAQ A;  1O0P A;  1VCT A;  2PMH A;  4KPC A;  4WE1 B;  1VQO S;  5C25 B;  3K5M A;  2J76 E;  5T7L B;  3HMJ G;  4WK3 A;  4LR9 A;  1LW0 A;  1NSA A;  1TAU A;  3G2X A;  3SSR A;  1QSY A;  1TMJ A;  2JEF A;  2QEX S;  3MM8 B;  1AFJ A;  3WC0 A;  2VG6 A;  1DLO A;  2N4D A;  3OL8 A;  3T6J A;  1F6T A;  1YBU A;  3ULH A;  3BSO A;  4QU6 A;  2UUB F;  4OYB A;  4JUZ A;  2MJN A;  2HZV A;  4L73 A;  3I31 A;  1S1X B;  4O44 A;  3ZTQ A;  2C2D A;  3QID A;  5H9F J;  4CT8 A;  2J6T A;  1VQ4 S;  3IA0 A;  1S12 A;  2EFQ A;  5D4O A;  5U47 A;  2FJE B;  3MED B;  3MFH A;  4V19 X;  4Y34 A;  2C2E A;  1GMW D;  3BO3 A;  1JK9 B;  1VLY A;  1RQ0 A;  3L7O A;  3BQ0 A;  1RI7 A;  5F41 A;  3TOQ A;  4C3M A;  2BOP A;  1XIQ A;  3KG1 A;  3G96 A;  1RP5 A;  2YH0 A;  3K89 A;  4EO6 A;  2YVS A;  2MGZ B;  4DF8 A;  3CUN A;  4DBQ A;  1CBK A;  2DR6 A;  3GIR A;  5KFX A;  5CZX A;  3V5R A;  3MR6 A;  5CCM A;  2V6A A;  4X64 J;  2BKN A;  2KFY A;  2HHU A;  2LP4 A;  1UW9 A;  2BE2 A;  3LOU A;  3OTB A;  1RWN B;  4CO4 A;  1NKC A;  1IVZ A;  5L8R C;  1RT2 B;  3CF5 Q;  4LJM A;  4KHR A;  1GTE A;  2KT3 A;  3KLF B;  1LFW A;  1Q79 A;  1LFP A;  2CG8 A;  4RBV A;  1WF2 A;  1HLW A;  2WB1 D;  4WFZ A;  3VGU A;  4DUZ F;  4ECS A;  3CUL A;  1B7F A;  2Z2Z A;  3U1M A;  3TAP A;  2FVR A;  3RRG A;  2HS4 A;  3L7P A;  5G0R A;  2VFS A;  4YDD B;  1NH8 A;  2ZNY A;  3UCZ P;  5ETT A;  2JEI A;  1Q8L A;  4PXC A;  4DR4 F;  3DFE A;  4K4X A;  4P2F A;  2WON B;  1HPZ A;  1WG1 A;  4FP9 A;  5IQQ A;  2IVF B;  2VA3 A;  3N9U C;  4B9V A;  2XS5 A;  2VOP A;  2ZBP A;  1RLC L;  5BYQ A;  3ET6 A;  2QLW A;  5MLC V;  4LVN P;  2R2R A;  5JVG Q;  4OL8 A;  2CVE A;  4ER8 A;  3GFZ A;  2PA8 D;  5IC4 B;  1HHT P;  3POT B;  2OPP B;  3J7Y U;  1FXL A;  2GMH A;  3IRX B;  4B3T F;  1TL5 A;  3UD3 P;  2EFO A;  4DV6 F;  2G2Z A;  5E3Q A;  3OL6 A;  2CZ4 A;  3PX6 A;  1Y3J A;  1TTH B;  1S1X A;  2LA4 A;  2X1G A;  2YQ1 A;  3MZI A;  4O44 B;  2LMI A;  3Q8R B;  2KB2 A;  2VQF J;  4RUC A;  3BSN A;  2FY1 A;  2VBW A;  2CPY A;  3R7B B;  4KKO A;  3LP0 A;  1S1T B;  3MM5 B;  4WXW A;  4DF4 A;  4O4G B;  2OSQ A;  2HQC A;  5HN0 A;  2Y0B B;  2VDH A;  4K2J A;  2R7X A;  2FJA B;  4URQ U;  3PFO A;  2MPU A;  3AXK A;  4NRU A;  5A0Y A;  1LXN A;  1WOR A;  3AOD A;  4OMF G;  1V5I B;  2Z4P A;  4P7V A;  5B0E A;  4DCJ B;  1BGX T;  5KFQ A;  2VIH A;  3G9C A;  1WHV A;  2P9C A;  4CYU A;  4I7F B;  1W2B R;  3H4B A;  1WF0 A;  1XQI A;  3R5A A;  4DUZ J;  3HI9 A;  1B3T A;  2LQB A;  2DEI A;  1RWO B;  2CPH A;  2FLO A;  1YIT S;  2XTJ P;  1TFY A;  2GQQ A;  2IMW P;  4M5D B;  3R2D J;  4NA1 A;  1RWV B;  3D9B A; 
#chains in the Genus database with same CATH homology
 3GJT B;  4ZVU B;  3SIP B;  2H65 B;  2C2Z B;  2H54 B;  4ZVP B;  3GJR B;  2CNK B;  3D6F B;  3RJM B;  1F9E B;  2XYP B;  4ZVT B;  1BMQ B;  3EDR B;  2CNN B;  3D6H B;  3R6L B;  2HBQ B;  3EDQ B;  2CDR B;  3QNW B;  3R5J B;  3NS7 B;  2QLJ B;  4ZVS B;  2QL9 B;  2C2K B;  1PYO B;  1PAU B;  3R7N B;  4DCP B;  2H5J B;  2CNL B;  2FQQ B;  1RHK B;  1RWX B;  2QL7 B;  2HBY B;  4ZVQ B;  1RWP B;  1RWM B;  2QL5 B;  3IBC B;  1RE1 B;  4LSZ B;  1RWW B;  1SC3 B;  2XYH B;  2C2M B;  3GJQ B;  2H4Y B;  1RWK B;  1RWN B;  2C1E B;  1RHJ B;  2H48 B;  2C2O B;  3R6G B;  1ICE B;  2CNO B;  2CJY B;  3KJN B;  1SC1 B;  2XZD B;  4DCO B;  2CJX B;  1RHM B;  5K20 B;  1QDU B;  1SC4 B;  1I3O B;  3P4U B;  4ZVO B;  5IC4 B;  3KJQ B;  1GFW B;  2H51 B;  1RHR B;  2QLF B;  2P2C B;  2XYG B;  1RHQ B;  3KJF B;  1QTN B;  3P45 B;  3R7B B;  2Y0B B;  2Y1L B;  3D6M B;  3R7S B;  1RHU B;  4DCJ B;  5IC6 B;  2H5I B;  3GJS B;  2HBR B;  1IBC B;  4JB8 B;  2H4W B;  1RWO B;  3IBF B;  4ZVR B;  2QLB B;  1NME B;  2XZT B;  2DKO B;  1RWV B;  1I51 B;  2HBZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...