1BMQB

Crystal structure of the complex of interleukin-1beta converting enzyme (ice) with a peptide based inhibitor, (3s )-n-methanesulfonyl-3-({1-[n-(2-naphtoyl)-l-valyl]-l-prolyl }amino)-4-oxobutanamide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords PROTEIN (INTERLEUKIN-1 BETA CONVERTASE)
publication title Peptide based interleukin-1 beta converting enzyme (ICE) inhibitors: synthesis, structure activity relationships and crystallographic study of the ICE-inhibitor complex.
pubmed rcsb
source organism Homo sapiens
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 1998-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1bmqB00
2HBZB 2P2CB 2H48B 2CNOB 1RHUB 3GJQB 4DCOB 2CJXB 3D6HB 3D6FB 1QDUB 1NMEB 1RHMB 2H4YB 3NS7B 2HBRB 3R7SB 1RWXB 2XYGB 1PAUB 4ZVTB 3R6LB 2CDRB 3IBFB 5IC4B 1RHRB 1I51B 3EDQB 2FQQB 4ZVPB 2C2KB 3QNWB 3SIPB 2CNKB 3KJNB 3P45B 4ZVSB 3P4UB 2H51B 3KJQB 3R5JB 1RWVB 2H65B 3R6GB 1F9EB 2HBQB 1QTNB 2XZDB 1RWMB 1RWOB 2H5IB 2C1EB 1IBCB 3GJTB 1I3OB 1RWNB 4ZVOB 4DCPB 1SC3B 5K20B 4ZVQB 3EDRB 2QL7B 1ICEB 1RWPB 2C2OB 3GJRB 2Y1LB 2DKOB 4LSZB 2H54B 4JB8B 1SC4B 4ZVUB 2H4WB 3RJMB 2XYHB 2C2ZB 4ZVRB 2CNNB 1RHKB 1GFWB 2CJYB 1RHJB 1RWKB 2XYPB 2XZTB 2QLBB 2HBYB 5IC6B 3GJSB 1RHQB 2Y0BB 2QLFB 3IBCB 3KJFB 1SC1B 3R7NB 1PYOB 1RWWB 1RE1B 3D6MB 1BMQB 2QL9B 3R7BB 2H5JB 2CNLB 4DCJB 2QLJB 2C2MB 2QL5B
chains in the Genus database with same CATH superfamily
4WFNQ 4ZP9A 2DNYA 3CCQS 2CJXB 2JL9A 1SL0A 2OPSB 4DX7A 1FTCA 2E7XA 1PC4A 4RR5A 1WI8A 2BJ8A 2GQQA 3TA1A 3UNYA 2C3MA 4OYXA 2AJ0A 3OV7A 1JJ2R 3PW5A 1T3NA 1FRKA 2ASJA 5B0CA 2E1AA 3VAKA 1R8HA 3JSMB 1U2RA 3N6MA 3A3OB 1TMJA 2QFJA 3E01A 1BQNB 3AJ2A 1RWNB 4DV6F 3Q8PB 2WB1D 2D1CA 1KLNA 1B0VA 3RB6A 3FRZA 4HI2A 4UQGA 2NXCA 3LGHA 2FZCB 2OPPA 3EGVA 4EFAC 5E3AA 2KM8C 3CC7S 2A3JA 1KBRA 1IQTA 3OSPA 1MROA 5F9LA 2XY5A 2CRLA 2DNZA 2I9SA 2N7YA 3IFEA 2HBYB 1U25A 3T1HJ 2HRTA 2XTJP 1VBYA 2J0QD 1T95A 4X4PA 4PQUB 4DL2A 4DL4A 3OVBA 1RP5A 2QL5B 1NZAA 2QGFB 1UW4A 2E5HA 1S0VA 1KQSR 2IAJB 2AV5A 2M0GB 1V9OA 2VF3A 1VQPS 1WEYA 1H0HB 4TLQA 3GR0A 2FY8A 4DJBA 3CO9A 4UOGA 1IR0A 4AD6A 5KOXA 4C3MA 2LQBA 1ROFA 2DB1A 3HULA 2X1FA 1VR6A 2CQ2A 3DLGA 3I31A 4JI7F 1P1TA 4K50A 4ECYA 4ZVOB 2HFZA 2W9BB 3OXLA 1N32F 4QR2A 3FBCA 4PWDA 2YQ0A 4CLYA 1NDLA 1H3DA 2BMBA 3DGVA 5IT0A 3OR2A 3EZUA 3T41A 1A7GE 1U1QA 1PSDA 1VDHA 3VR1A 1EKRA 3M30A 3G87A 4KQZA 4HH1A 4KTQA 3OW2R 4YHHF 3D1HA 2BJ7A 1R7IA 4DV5F 4KO0A 3L4BC 3CJ4A 1UEUA 1WNEA 3M1VA 2CNOB 2IA6A 3FEYB 1IJEB 1ZOTA 3PM9A 1WKKA 1FRHA 1T02A 1TUVA 4J90A 3UR3C 3G4SS 4U7UD 4CO0A 3C16B 2KI2A 4R0EA 2QA1A 3EZOA 4LFBJ 5DM7Q 1IKVA 1BE4A 2VHGA 4IH5A 1D8ZA 2UUWA 1NLKL 3PW0A 3GSIA 4DPXA 4R5PB 3MMJA 1IKXB 3KJVB 4KKOB 2H65B 4DX6A 4RUBA 1ZZFA 3LTOA 3BGFA 3ZZUA 2WW4A 2LVWA 1HNZF 4EWTA 1UA1A 3HM9A 1SH2A 3H4DA 3AY0A 4DV4F 3H98A 5LJ5Y 4DQRA 1AFJA 4F25A 3OL8A 2EFPA 4J9UE 1DY3A 1MG7A 2KU7A 1B99A 2FVSA 3G82B 3M2VA 2IVMA 5DQIA 1RAIB 5DDPC 4RBVA 1TAUA 3ET6A 1QDUB 1RCXB 1HLWA 4RW9B 2JH3A 2OEMA 4GO7X 2HK2A 3BN7A 1EZZB 3N01A 4U96A 4KB7A 2QG9B 3UO0A 2EBGA 2GW8A 4OJGA 3CCSS 3IO1A 1XC9A 4DL5A 2MZSA 3WQPA 3IA0A 3O3LA 4F2SA 3NAHA 3K59A 4ZPBA 1LV5A 1UL3A 2G4BA 1W26A 3AOCA 2CVEA 1J2VA 2CJ9A 3BSAA 3VAFA 1KTVA 4M63A 1WHWA 3HMJG 2QRRA 3MWBA 1AYEA 2H4WB 4UOHA 3O44A 1U1OA 6FD1A 2XZTB 5GVQA 4DXLA 3K89A 1R3NA 1B4SA 5FDLB 3CJKB 3LQVA 1H38A 1TL5A 4GC6A 2YY3A 2NXEA 5E2QA 3E2EA 2XSJA 3QAUA 4NLSA 5J1PA 1PBAA 2YWEA 3H20A 3GFYA 2MY8A 2CJKA 2EVZA 3C3LA 4PG5A 3I56S 3C6UB 2OPSA 3HHKA 3EDQB 2W4CA 2R7SA 3US5A 3LF0A 4DPOA 4PXBA 1BWEA 2I6WA 1PG5B 3Q8UA 3FDSA 5KFOA 2ZH3A 4ZHRB 3A8EA 1RWMB 3JSMA 4MKYA 1S0OA 3GJTB 2QMXA 5H9EJ 2GVDB 1KR4A 3TO8A 3OVSA 2R2SA 1S97A 3UDCA 2J76E 1BQNA 1SPBP 2KHCA 3CJQA 2HHSA 2MHNA 4AL6A 2RD5C 3KHGA 3C14B 2W9AA 4DV1J 4UQTA 4QW8A 3NCQA 2DBBA 5IC6B 4FNIA 1VJWA 3VAIA 1WSVA 3TUIC 4JV1A 1YK9A 2CWXA 5EGYA 4DCOB 4WZQA 2ZJPQ 3SXLA 3ENWA 3KHRA 2AYBA 2Y1RI 2IAJA 1U6BA 2OD6A 2DYAA 4LQ3A 2XMUA 1UVKA 4PRFA 4ILMA 1NEEA 3ZZRA 1SKSA 5KT6A 1GX5A 3I4PA 4RWXA 5D8HB 2ZC3A 3RYLA 3VALA 1NK6A 2H51B 4WYLA 4DS5A 5A8WA 1WOOA 3AD7C 1HHSA 3ILLA 2Z8QA 2HFSA 3EMTA 4JOUA 1V5VA 3FQKA 1N5YB 4D3GA 4OX6A 5EWGA 3QAEA 2W9BA 1TMMA 2UV8A 3T9NA 2FC8A 4WE1B 2Q1LA 4XTTA 5GADU 1T9UA 2DNOA 4H4KC 2B7BB 2AJ2A 5DDQC 2NXJA 1YRTA 4ELTA 2E1MC 3LP1B 1UJ5A 2OMOA 2OSRA 4IOBA 4C3KA 2MKIA 2VFVA 2Y0BB 5EWEA 2QLFB 1JLQB 2HQFA 2AZ1A 3D3BJ 3IAM9 1TELA 2ZH5A 2R8IA 3R5AA 1PYTA 4Q44A 2H4YB 4OZ5A 4C0HA 4TLRA 2ZC4A 2HZCA 3TAPA 1S6QB 2FVQA 2CPHA 2J9DE 1X9WA 1PCAA 1UTAA 2HHUA 5BYRA 1GTHA 2GJ2A 2J9EA 4R5PA 4KKOA 1FXRA 4FKYA 5DZ7A 4X66F 1KVKA 2GX8A 1R8CA 4DS4A 4A47A 2XS7A 2DR5A 4LF4F 2U1AA 1FNMA 2QIFA 3HP6A 2J6SA 1BD6A 2MZQA 5J1EB 2ZITA 1MN7A 3Q89A 1VC5A 2HQIA 3SI8A 4G3IA 2VFRA 4C7QA 3B4MA 1D3WA 3M05A 3RW6A 3NWGA 4WFZA 1OYDA 2R2UA 1S76D 3GQCA 5I3UB 3T1YJ 2VA2A 5KFVA 1HR0J 3DU5A 2DITA 4H4OB 4MAKA 1U1LA 4LJMA 3DKDA 5LXYA 1FX2A 1S5ZA 4DV2F 4GKJJ 5JJBA 1H2TZ 2ZH1A 4UZBA 2UXDJ 3PJ9A 4RW9A 3QFWA 4JI2J 1RTIB 4U9RA 3DLEA 4ED3A 1RT6B 2AQ4A 1C4AA 2VUGA 2WONB 1O0PA 3M9OB 4MIWA 2NSBA 2CPFA 1SJFA 2CFXA 1C0TA 3I9V9 1X8DA 3PRDA 2MZJA 1KWMA 4LF7J 1IKWA 1UPMB 3N79A 3K57A 4UUXA 4C11B 2J9DA 2W2OP 4DDFA 3CULA 2VPYB 3JB9k 3CW2C 2DKOB 2PMWA 4BC9A 1TL1B 2G1HA 1AFIA 3MMBB 2B7CB 4ECSA 2J6UA 4J7CA 4TQRA 2XCPA 2C3UA 1NHUA 1JIHA 1IBLJ 4ES2A 5E0OA 3NNAA 2U2FA 5KFAA 3CJKA 1LNQA 3QSIA 2IDEA 3DDNA 2G2ZA 3TW0A 4DX5A 4OI2A 5B0GA 4ZVEA 5J2NB 2W7OA 2DEIA 3MAQA 2EG2A 3AXKA 2FQQB 4ED6A 1L3SA 3C6UA 4Q43A 2KXNB 3O8WA 3SQGB 3KJNB 5ETSA 2ROGA 1R6VA 1QE1B 2HHQA 2GQ2A 1RWVB 4OZ1A 4B3RJ 3LA0A 4B3SF 2VOPA 1QAXA 3MM5B 2NZCA 2NSCA 3OSNA 2LKZA 4IG0A 2G2OA 4KBIA 3N6LA 2JJ4D 2GVDA 4MIBA 3GE9A 5KFTA 1NSAA 4LR8A 3QO9B 3GV5B 5JMNA 2M3DA 1S1VB 5KG5A 2MQOA 2XNQA 4UOFA 5F8JA 3I0SB 1X4AA 4F0MA 3KLEB 3TQ1A 1NHVA 1HMVB 2E9RX 2XGPA 5EDWA 3G6XA 4Q0BB 1WDTA 5GADI 1S9EB 2XY7A 1MWQA 4LVOP 2MQPA 2B5JB 2OH2A 1KQFB 5B0BA 4YB7A 4DPTA 2D3O1 1S9GA 4XK8C 5K8OA 5D3GB 3GILA 1U47A 1T05B 2OP5A 1FWPA 3H7HB 5KT5A 1OIAA 3WDOA 2AX1A 3FBFA 5GMKa 1KN6A 5HROB 1TV6B 2BVZA 4G1QA 4TU8A 4GMKA 2ZH7A 2K2PA 3WC2A 2HBQB 4CM2A 1F9HA 1Y3KA 1VIOA 4UZCA 5D78A 1U2CA 4CNZA 1CS4A 4ZPVR 2RH3A 3JSRA 2V50A 3BSCA 2CZ9A 2DGSA 3TUJC 2VODA 4I2PA 2BKNA 5KFUA 5L39A 2LXFA 3S01A 2NQPA 4WE1A 2NYIA 1Q8BA 2LU1A 5CYMB 4LF6J 1IWAA 4XAKA 4NASA 2V4QA 1S9FA 1HYSA 3LP1A 1VLYA 1JKHB 4PR6A 4HLBA 3D6MB 3HHLB 1D8YA 4LF2A 1JLQA 2OFGX 4DLGA 3RBXA 2W2QP 2K3IA 1JXEA 2HHXA 3PYGA 4J91A 4KGXB 2OHDA 2G0CA 1XMOF 4LF5J 3BH7B 4CNYA 4CT8A 2R7QA 1RHRB 3VZIA 3OD2A 1RA6A 3AOBA 1MWZA 2BXJA 4Y28C 1HQEA 1PAEX 3I55S 4FF4A 3LP2A 5H9EK 3QGGA 3RAXA 1GEHA 2XLJA 4Q8FA 3A8IA 3FMBA 4YDXA 3ZZZA 2W1BA 3AA9A 4DR4J 1KQKA 3NNHA 3DI6B 3KG0A 2E66A 3I5CA 3KUEA 3ZTPA 5IXUA 3TJ8A 2KVIA 5J1EA 4N77A 1RGVA 2GHWA 3PIPQ 2E7VA 3UVJA 1RTHA 2W9CB 3D9BA 1NUEA 4URQU 5I3UA 1EJ7L 4JI3F 3KDNA 2X3GA 3IBWA 1XQIA 1RWUA 2I5JA 4KYZA 4H4OA 4GVLA 3PW7A 3NKYA 5DLFA 3DXBA 3CO0P 1DFDA 2AYGA 2ZOGA 1U49A 3DNCA 4O3SA 4OX8A 1RTIA 3KLIB 4O23A 1FNOA 1RT6A 1TL4A 2CPJA 2WONA 4N8OA 1C1CB 1NH8A 2FTRA 1CLFA 4MK8A 3Q2TC 1ZTWA 4TU9A 2F7VA 3HDSA 2OELA 2Y9HA 1TK8A 4DOZA 4LFCJ 4IFVB 2FHJD 3MCSA 2MEWA 3OTDA 2YKOA 3DOMB 3ZTSA 4ID5A 4WXWA 2ROPA 1N5SA 2ASYA 4TY9A 3BBFA 3CB4A 3CJ3A 2O3DA 3CMES 1FKPB 3MI7X 2XMWA 4PXDA 4DV3J 5LSRA 1G4CA 2RDDA 4B9NA 5AT1B 4ZJQA 4JI0J 1RAOA 2AWZA 4OZJA 3TRGA 3P3DA 2BJ3A 3DHWC 4XDDA 2RILA 1Q0NA 2JVRA 1YRXA 3B54A 4YN3B 5L46A 3CPWR 1UMJA 4AL5A 1V3SA 2DRAA 2V9KA 2B4VA 1YJWS 4PWWA 1VBKA 5J2NA 4DUYJ 4K4YA 4DL0C 2NZ4A 3X3UA 3CGIA 2IA0A 2FUG9 4NLTA 2MKJA 3SQGA 1QVFR 1CJKB 3PO5A 1QE1A 2GIFA 1U8SA 2V8PA 1N5TA 2XWXA 3W8PA 1RWOB 1WF1A 2DXEA 3M8RA 3T1HF 3MM5A 3K2YA 1SKUB 3MDFA 1S1TB 1EARA 4ZP8A 1X5SA 3PG9A 4X64J 1NK4A 5KFWA 1M90T 3QO9A 3NXZA 2VPXB 3KOAA 3L7OA 1VQ8S 3CCTA 3KLEA 2QLBB 3PRVA 4F4ZA 3AB4B 4AFFA 1Y5LB 5HANA 1HBMA 4Q0BA 2HURA 2FZKB 1VS3A 1SKWA 1T9XA 2MQLA 3HSGA 3TQEA 2B5JA 5C25B 4O4GB 1FESA 1KC8T 3OL9A 3D6FB 2DNNA 4MK9A 2JLEA 4YFUA 2V0NA 3VAGA 1KONA 1VFJA 3CJ8A 1TP7A 1UP1A 4UY85 5KOWA 1FDDA 1TV6A 2Z57B 3E51A 1Y7PA 5ETKA 2P8IA 4GKKJ 4EUVA 1Q95G 1CG2A 1M5VC 2A18A 4F36A 4MMOA 2K7KA 2BOAA 3OLAA 4USHA 1VBXA 1XNRJ 2GZOA 3H0PA 2Z2MA 2UXBF 4EMDA 1QD1A 4K4SA 3QGPA 4DV7F 2CJBA 3CMAS 1NDPA 5CYMA 3X1LB 4WXOA 5I3QA 2JVOA 1L3KA 2AGOA 2R8KA 3OL7A 3QZ8A 3HX9A 1VQ9S 2HZVA 2WVBA 4A8XA 1J5OA 2DY9A 4NXNJ 4P7VA 1U4BA 5HATA 4WKRA 2F1FA 1JKHA 3HHLA 3A4TA 1PKUA 2C2NA 1PIEA 3EUNA 3HFKA 3FSYA 3CEDA 1SIZA 4DG1B 4AXJA 4OYAA 1KLMB 2XYGB 4NZ6A 1JLAA 4DSEA 1NRKA 2BV3A 1S1XA 2B51A 1X60A 1F2GA 1V5IB 4K7QA 3AD8C 3IRXA 4M5DB 1FJ7A 2V67A 1K0TA 2GO8A 3GYXB 1OYEA 3R97A 4C8YA 1A9NB 4DR6J 2LQ9A 3J7ZT 1T9WA 2W2NP 1SL1A 1QTMA 3DI6A 4EO8A 1H74A 2MGZB 5D6GA 2MB0B 1TKZB 2DNPA 4TNOA 2DNHA 4DN9A 3IS9B 4NXMJ 2L9WA 2DGTA 2WOMB 1YZ6A 4DHVA 1RWWB 1HWLA 1FKOB 1X31C 2UVRA 2W9CA 2CQIA 1EQMA 4ES3A 1LW2B 3IP0A 5HQMA 1REVB 1U24A 3CIMA 1RWXB 2ILYA 4XO0A 3FK4A 5DLGA 1UVNA 1QVGR 4BLGA 1FEHA 1Y11A 3FJ2A 2BKOA 4ED8A 2J0WA 2CQCA 4Y2AA 3KLIA 4B9MA 2J0XA 5K5MA 2APOA 3BDPA 3CDWA 4Q2MA 3VGUA 4USTA 3J7Z5 5A8KA 4HHUA 5EX3A 3KHHA 2MZRA 3KLHA 2XI3A 3TANA 5T7LB 1WKLA 4IFVA 4KGKA 1JQGA 4CI0B 3T19A 3DOMA 1U6FA 3CCMS 1FJEB 3GG1A 2M2BA 2UU9J 2HW3A 3M8QB 4GC7A 4IO9Q 2COLA 2IC3A 2M8DB 1D09B 1VLOA 1FKPA 4F4YA 1U0SA 1CQNA 3KMQA 5K14A 2MKCA 1FK9B 3OBIA 4OX9J 2J6TA 1RE1B 5IWAJ 3OHAA 4DQPA 4NLPA 3D2WA 2B3TB 4OHZA 4ERDA 4C8KA 4M94A 2LU2A 3VAMA 3OUYB 2OD4A 1KQGB 1KVJA 3T9ZA 4LRCA 3QZ7A 5KFIA 5F8HA 4L6V3 2GNKA 2RJZA 1CJKA 3V81A 5KTQA 1FEEA 2VG7B 2HQCA 5T14A 3DRYA 1N88A 3TX0A 2F5GA 3ELHA 1S1TA 2RQ4A 1RAHB 2RIJA 3AJDA 4LSLA 3D54A 2IIHA 2RE1A 4ZIVA 2K3KA 5BYSA 2LEBA 2M8HA 3T1AA 3WX4A 4DL7A 1N4LA 4JI4J 1YJUA 1R8PA 1IN0A 4J9KA 3BZQA 1YJ7A 4K4ZA 2DD8S 2WVCA 3U1MA 2AX0A 4RW8B 3QGIA 3JYTA 1I94J 3AFGA 1N5QA 1RK8A 2GHPA 4B3OB 3POTA 2HWHA 1U48A 4JYAJ 5C25A 4O4GA 1UA0A 3K5NA 4ZVTB 4RW7B 5KFJA 1MN9A 1VISA 4UUWA 2C2KB 1SI9A 2MDAA 2HG4A 4A8SA 2CPEA 2R9LA 4IKAA 3OTOJ 2OFHX 4N8NA 2CG4A 1LFWA 4XIUA 3W8GA 3HF5A 4F26A 2HHPA 2Z58B 4I4BA 1VQ6S 4NLWA 3IRWP 1OS5A 4AT1B 5F3TA 3SDEA 4CCHA 3DM2B 1WF2A 3CCUS 3MEDB 1PYSB 2E1CA 3BM7A 1Q4RA 1ZM2A 1F0XA 2BJ1A 4HHHA 3W66A 2DO0A 3OJSA 1ZAWA 3MTJA 3QT5A 4NMXA 1EX8A 2V4JA 4XDCA 1IBKF 5D77A 2B56A 3IGVA 1X0FA 4QYZJ 1RISA 2ZBCA 2L48A 3S6EA 2NLWA 1X4DA 1FRXA 3H40A 2YH0A 1EKSA 2C42A 3ZTQA 4YQWA 4PQAA 2VIHA 1NO8A 4IUFA 1FVQA 4DG1A 2FVPA 5J2QB 1KLMA 2DISA 2VV5A 3A3PB 3CD6S 5C24A 2KO1A 5DG7A 3OPKA 4PABA 2WTFA 4TKTA 3OXGA 1CQMA 3PDNA 4P6QA 5DRKA 2ZKTA 4M5DA 1TFYA 4NRUA 2XBPA 1AA1B 4A8QA 2UVWA 2MLZA 2DIUA 3T1YF 2VU5A 2YNIB 2PIIA 1X5OA 4AUKA 2YKMB 2CQBA 1H98A 5IT4A 1HR0F 5HMXA 2FHMA 1JLEA 4UW2A 2XSFA 3DLKB 4GKJF 3W7BA 2UZAA 4RNFA 3EJMA 2KN4A 1SQGA 2LP4A 2MGZA 4S0MA 2HAIA 2KXFA 1N48A 2R7RA 1RU2A 1VOMA 2UUCJ 1GNKA 2O67A 4JI2F 4OI0A 4I6AA 3IS9A 2XLIA 5C5JA 4U67Q 3VZHA 3MPVA 1XNQF 2ILZA 2BDPA 4ICLB 2HKEA 1UVLA 1KNZA 1SQFA 2JSXA 1FXLA 3NWRA 1LOUA 3W9JA 5F0UA 2EFVA 1LW2A 3KHLA 2Z2ZA 3GFHA 2XMJA 3SCJE 3W62A 4B9SA 3THVA 1Z4UA 4O3OA 3QNWB 2WHOA 4B9VA 1HNWF 2CZ4A 4EBDA 1R6YA 4FYXB 2J7WA 1MW7A 2LQ5A 5K8NA 5ETVA 3TYTA 7FD1A 3KLVA 3TUPA 5KFGA 2IYGA 2KHDA 3W63A 2HNYA 4ILLA 1X5TA 2QL7B 1IBLF 3IR6B 1N8RT 4ZITA 2A1BA 4ETXA 3CCWA 4G65A 3M7VA 4BS2A 4L73A 1WC5A 2WAQD 2V94A 3G96A 4DFKA 4WCEQ 5C2GA 3C6TB 3M8QA 1U1NA 5D4PA 4DZDA 5SUHA 3LP0B 1M1KT 5J1NA 2BE7D 2OPRA 1FK9A 2H5JB 2EC0A 2WBRA 4B3RF 4X65J 3WIVA 3P49B 3R1LA 1T3OA 2ZZNA 3P6YC 1AB8A 2RSQA 3H2VE 4H4MB 4M5IA 3D28A 5FD1A 3H5SA 4F4AA 1U1KA 3D4JA 3PTWA 4Y2KA 1HI0P 4P7TA 4F8RA 3P4UB 1IKYA 3MM6B 4K59A 3A13A 3VV2B 2AD9A 4NLGA 4JI6J 3AHPA 4QWBA 2VG7A 4M5GA 4M5JA 3MOJB 2HPUA 4HT7A 2GHVC 4O3PA 3VGVA 2E9TA 3UPFA 3DGPB 3GG0A 4LT6A 7AT1B 1TQLA 3GYGA 3U7JA 4O0NA 3QGHA 3IXQA 1YZ7A 4DQQA 1YJTA 4ATNA 4RW8A 5HQLA 4YB6A 4CM0A 1D9FA 2AEFA 1TKXB 3MPUB 3V6JA 1FFSB 4LRDA 4B3OA 4FKXA 4AE5A 3BR9A 1ZM3A 4NA1A 1UJ6A 1NPPA 3RR8A 1NK7A 3NP5A 4LREA 2ZWPA 4RW7A 1HBNB 1HFEL 1EIYB 2V2KA 1NSQA 4RO0A 4PXCA 4ZMMA 2DHHA 1DBDA 3KJQB 5KFFA 2KDOA 1Q1KA 2XI2A 1WC1A 3O2IA 4LF6F 3MMCA 1NAQA 1IQZA 5I4MA 2DR7A 2ASLA 3VCDA 1HKAA 2YKPA 1VYAA 1VRTA 5LM7E 1TUGB 3NGRA 1ZS6A 2M70A 3NGSA 2K1RB 3MM7B 3MEDA 1WC6A 1RHKB 5M2RA 3LPYA 2J7UA 2C3PA 2DCLA 2ZVIA 5DG9A 1PYOB 4I7FB 2DEJA 4Q5VA 3PV8A 3UD4P 1K1QA 1J5EJ 2BOPA 4Y3CA 3PACA 4OHYA 2Z2YB 1YG0A 1U45A 4JBCA 1FE4A 3BKTA 5KAKA 5JUMA 3Q8SB 4ZVFA 4DR4F 1NDCA 4B02A 1HWJA 3DXSX 3M4XA 3I9ZA 1RXOB 2PA3A 2FJBB 3GYNA 3OTBA 4NEYA 4M5KA 4JP8A 3DLBA 1HNIB 1NBEB 3C66A 3F41A 2VQEF 3RW7A 3TR5A 4F0HA 3V4MA 1DAXA 3EPGA 2X1AA 2KM8B 5K20B 2V9WA 4EBCA 2V2VA 5M2PA 2BRKA 2YNIA 5C7PA 1QUVA 2YKMA 2W2MP 4R8UB 1M1GA 4ZVUB 1RTZA 3RRGA 2QO3A 1WG1A 3IWNC 2EKYA 4NRTA 2AGPA 4HDGA 3B82A 3O1LA 4WZMA 2DH9A 3O6QA 3UQSA 2HIYA 2HVHA 4OZ0A 2BX6A 3JSBA 2MPUA 2BABA 3EX7B 3R2DJ 3PY8A 2MKSA 1YVFA 3W5ZA 2HBRB 3GSDA 1GTEA 2IRYA 1PAUB 1S12A 4LFCF 5ETQA 4YR3A 4DU8A 5KFEA 2MZ1A 3GWCA 4Y2CA 3UWTA 4DR1J 2ZE2B 1VQOS 4N56A 1X4FA 4ZP7A 4F4WA 1LEOA 2RUGA 3NBPB 3Q2SC 1LXNA 1N33F 4EO6A 2HFNA 4DV3F 3L09A 1IXKA 1JLGB 4Q7AA 3DOLA 1TUWA 3KDOA 4UTGA 3RAMA 2N3OA 2HNDB 1SC6A 3ICLA 1RT4B 1Q79A 4FYWB 3UW1A 1DQ8A 1FNXH 4LUBA 2FD2A 3BO2A 1P1LA 5AXMA 4O44A 2RF2A 3T6BA 4QYZK 2NS1B 1RWKB 2XMAA 2HS0A 2Y1JA 4IDKB 3U1LA 4ITSA 3W64A 3LP0A 1BMQB 4C97A 2LA4A 5KG4A 2Y3YA 2JRSA 4HH0A 4K2XA 1ZA2B 6FDRA 1OMSA 2D9OA 4HACB 3IBFB 2CQPA 1GAOA 1OQ6A 5FLXU 5CCMA 3T6JA 4KV8A 2AZ3A 2FY1A 1NK0A 4X64F 2Z4PA 3EICA 2MKYA 4FPRA 1V3RA 1ZYQA 4C4WA 4FVCA 3W5XA 5C42A 1B7FA 1K9MT 3MM6A 2OGUA 4RJVA 3L95X 1DQ9A 2AIRB 4KHPF 2NCKL 1FRLA 1M5OC 5E5NA 2JX2A 3FZBA 5CZXA 2XYHB 4A8MP 2KYZA 2CJYB 1Q81T 4ZVHA 3ILOA 4ETZA 3TUZC 1FJGF 2HNZB 2GMHA 3OVAA 1M5KC 1NJXA 1FX4A 2VKRA 2WZ1A 1SB6A 3M2RA 3D0GE 3G8TA 1TKXA 3DU6A 2KFYA 2EFOA 1BGXT 4GKKF 5CH7B 2XQCA 3PHTA 4ED2A 2IRUA 2HFVA 4OQJA 4EEYA 2VFTA 5DQGA 2BUNA 2YKAA 2B4PA 1SJQA 4USIA 1NSKL 1M5SA 1HBNA 2CPIA 2WVEA 1R43A 3QATA 1S1UB 4YEAA 2GMLA 2PEHA 4M8LA 3SCLE 3TP2A 2JFDA 1OY6A 4J9PA 4MH8A 1TZ0A 2B6AB 5KT2A 1TR0A 1VQ4S 4Q45A 4KH1B 4NXNF 3FEXB 1SJ1A 3JAMU 3ETMA 1RTDB 3IMQJ 3CXCR 1MMNA 3WIUA 3ENVA 3SCKE 3MEEB 3HT0A 3CT9A 1WTBA 1YX2A 2C2EA 4MIAA 2MHEA 2EXUA 3CJSA 2DR6A 4I7FA 3BGUA 1U6ZA 2HBZB 1RZMA 2V4RA 5LT5A 2EKNA 2JNJA 2ZDPA 1CPZA 2QA2A 4ID8A 1LQ9A 1XMQF 4DV6J 3TZXA 5HP1B 4DR6F 4RKUC 1XTZA 4WFAQ 2YBVA 2BQRA 1N36F 3HHNB 3D66A 2V34A 3M9NB 4PPDA 2GQCA 3C15B 3D3CJ 3LUYA 1VHIA 1AXQA 3MF5A 2VA3A 4RBTA 2CVIA 4NXMF 2VFUA 4DR7J 2GCFA 1W2BR 2NPIA 1S6OA 1ICEB 3MECB 2XG8A 1YJRA 4NLOA 5GMDA 1RLDA 1CJUA 4ELVA 1MU2B 2DY1A 3BR8A 3ZZYA 2LEPA 4PXEA 1U0HA 5FJ4A 2AF6A 1QAJA 1RT2B 3MFIA 2FJVA 4ZPCA 2QMWA 2DR8A 1KOOA 5HBMB 1OSDA 4KIAA 5KG3A 2D74B 4RL1A 2HMIB 2R8JA 2HVZA 2F4VF 4PG6A 2C28A 5G0RB 2YWWA 1NM2A 2DNMA 3AH6A 5EWFA 4A8KA 1YSJA 2KJWA 1RT7A 2VJUA 5A6WA 2GGPB 4ZVSB 2ZE2A 3MURP 4DZ6A 2KTQA 3HSZA 2UU9F 4I6WA 1JLBB 4XPEA 1AW0A 2G9OA 4BC7A 1S4FA 3NBPA 4RU2A 2HRYA 3J81U 2UVUA 3UCUP 1JLGA 4C8LA 2UUBF 2YXLA 4IOCQ 4OX9F 2K06A 5IWAF 3T5KA 3BDEA 2KJVA 4FNHA 3D1OA 4LMZA 2HNDA 1TVRB 1RT4A 4QIGA 4ZCIA 1X4BA 3E8OA 1F5CA 1N0VC 4YUDA 3IAS9 2QN6B 1SBRA 2CQ0A 3V2UC 4IDKA 2POKA 1SIWB 5ADZA 1HPZA 2BJ9A 4B9LA 1AZSB 4DFJA 4A48A 2RS8A 3D6HB 3DRPB 4A8FA 5L9XA 3Q8VA 3IWLA 1RSCA 1UEKA 2MTLA 2DNKA 4PPZA 3SIPB 1WTFA 1N6QB 5HL7Q 2ZH4A 1N56A 4WPAA 2BJEA 1F9EB 4JI4F 4BBYA 3VQSA 3NOGA 2IM0A 1UWBB 3BO3A 3DDIA 1U26A 5LSLA 4Z2XA 4I0WA 3FBBA 1SH3A 4CWBA 1DJ0A 1I94F 3IWXA 3JXOA 3U02A 1BLUA 2V69A 3RUBL 4KAIA 2ZH2A 1FDAA 4K4UA 3PHEA 2GO9A 4UOCA 2BM1A 2K7JA 1EP4A 3D1QA 4EK2A 3EM1A 2V68A 5EHHA 1QJHA 3V6DB 3BREA 5SZTA 2VDIA 2HS3A 3D0HE 1GMWA 3OTOF 2H5EA 1Y5NB 5B08A 3DRRB 3DHXA 4QIVA 4X4TA 3ADAC 2R7WA 2WBMA 2CPYA 3PKYA 2XO7A 3DRSB 1E6YB 4P2XA 1I5OB 3K17A 2YWGA 4DLEA 5JVGQ 1HHQA 4OZ2A 2IDLA 4OMFG 3KLGA 4J9QA 1N52B 1JLCA 2MJUA 3K8VA 1UFWA 3R2CJ 4F4XA 1RUSA 5D0EA 3J80U 4FXDA 2W8LA 1NJYA 1SC3B 5L38A 2RMLA 1U7LA 2HHHJ 4HDHA 3DLJA 1O51A 4PUOA 2Y1LB 1AROP 3ISZA 2H54B 3BO4A 4KR0B 2C2ZB 2SXLA 5A2QU 4I2QB 4NLUA 3TZZA 3W9HA 2NREA 4M1KA 4F02A 1U1MA 2LCWA 2FJDB 2YPZA 2LEAA 3GJSB 2YH1A 2Q6BA 3PKMA 5HK4A 5DM6Q 2GJIA 4DN0A 1XR7A 1S77D 1Y5IB 1P9QC 2AYEA 5KG7A 2MKKA 4ZP6A 1OQ3A 2KT2A 2P2CB 2LECA 5A76A 4X62J 4QIWD 5HJYA 3Q24A 1TL3B 1SQEA 5E7OB 3QRPA 5HSPA 4ZVGA 4KPCA 5IC4B 4DPUA 1HNXJ 1Q8IA 4ECVA 1SJ4P 4O3NA 2LDYA 2MJNA 1F5BA 5F9NA 4IQXA 3QPIA 2BW2A 2D9PA 2WRMA 3NS6A 3MM8B 4NLXA 2UUCF 3C15A 3KLFB 1NPKA 2F65A 2YNFB 4K2JA 3I5BA 3MTKA 2BR0A 3ITHB 3JTNA 2XWYA 5B7WA 4DUZJ 3CMQA 4QR0A 4LF8F 2ZDOA 4DL3A 1I1GA 4LIRA 3AD9C 3CWJA 2P6SA 1S79A 4HI1A 4HL9A 4G6VB 3K0JA 3TX8A 1XBWA 2UV8G 5E3QA 4V19J 2W4PA 1RT2A 5DO2A 1GMWD 3N28A 4Y6IA 3PVXA 3UDEA 5HBMA 1YBUA 2HVIA 4ECRA 1H6KX 3EGNA 2PE8A 3ISND 3OXFA 1TK0A 4QU7A 3U27A 2LFVA 2HHTA 3ENAA 3I32A 4X4VA 5K9FA 1CJVB 2CPDA 2DVIA 5KG2A 2E5GA 1RAGB 3A3NB 3HD2A 1K1SA 4C2MA 4CP5A 1Y4ZB 2GGPA 3QQCD 1DARA 2C2RA 1VQYA 2MLXA 1QTNB 1XMBA 2EI5A 2M7SA 1R8BA 2W4DA 2A6OA 2VBYA 4ZPTR 3P5TL 3PFOA 2IRXA 1WC4A 5ETTA 1RWPB 2C2OB 2F4FA 2R4FA 4H4KA 1RT1B 3DDKA 3CJTA 4X65F 4MT1A 3QLHB 3AT1B 2CNNB 2ZJRQ 1TVRA 1RAEB 5E33A 4HEA9 1Y00A 2QEXS 3OTEA 4KFBB 4PQUA 3W3SA 3GIKA 1UEVA 2VC0A 4O3QA 3KUGA 1RKJA 3KNGA 3IBCB 1HBUB 4I67A 2GJFA 1M5PC 4OYZA 1PJ6A 3I82A 5HLFB 3BKUA 1DTTB 4OI3A 5GAEU 1AZSA 5KFSA 3TZYA 4NYZA 5LSOA 1KTQA 5FLXY 4ZS6A 3CD5A 1H7WA 2GIRA 3Q8QB 4KGMA 1VC6A 1RCOB 1N6QA 2HQ3A 1TKTB 4WFXA 5MAOA 3HO1A 1T9VA 1UWBA 1Q5YA 1R8AA 2HRUA 2ATLA 3MR7A 1WSRA 4ZVQB 2BKPA 2JEGA 3KKFA 5EX0A 2CQHA 5HVGA 2IJRA 4CLWA 3PW4A 3RU0A 1T7PA 4U8VA 4WFBQ 1URNA 2LMIA 1NK5A 3SFGA 4P52A 3OFFA 2ZNYA 2XS5A 2RVJA 4CO1A 5F8MA 1QM9A 2IFXA 1DZ5A 2W8KA 2N4CA 2LA6A 1IBMJ 3V6DA 3C16A 3MR6A 4O4RA 4PEOA 1EHWA 1MLAA 2YWFA 3DRRA 1L3UA 1XR5A 2VG6B 1IKXA 3KJVA 3DRSA 1APSA 1E6YA 3MCMA 3NMRA 1FO1A 2R7OA 3GU0A 5H9FJ 5KG0A 1X7VA 3QT6A 4USUA 4AXIA 1HQ2A 3MCOA 4KJIA 5BR8F 4KT0C 3M2UB 2VBZA 3H5XA 3ONQA 3A1YG 3R3TA 3BQ2A 3KMSA 3BGOP 4FF1A 3JAMY 1FI4A 2NXNA 1XIQA 1SCJB 3LAKA 4YB5A 4QW9A 3E01B 3H90A 1R27B 2B0GA 1N54B 2XCAA 4RNNA 2I1RA 3QJPA 1T94A 2O1PA 2I2YA 3THPA 3G82A 1ZM4A 1RACB 2NUHA 3EGWB 3UI3A 3EGZA 5MLCV 2A2CA 4OV1A 4ZJOA 3R5CA 1MROB 3OL6A 3EE3A 4MKVA 4B3SJ 1KHVA 3RTVA 2FGOA 4N76A 4BCAA 1VIXA 2JZ5A 2W7PA 3LOUA 2JWNA 1XEZA 2KFZA 5J2PB 3PCOB 4RNHA 3GFZA 1NHKL 2VJVA 2ZHBA 1T9TA 4EZ6A 4KSEB 3BS9A 3QMQA 2Y8YA 1S6UA 2HVDA 2ACYA 3HFZB 1VI7A 3MM8A 3AXMA 2H5IB 3M8ZA 3KYLA 1NKEA 3KLFA 4J9SA 3AQOA 1PC5A 3QYYA 1ELOA 2VASA 3Q8YA 4OI6A 4JV5F 4B9UA 3PR5B 3M9MB 3DMJB 4RU9A 4WBFA 5FDLA 3N9UC 2MQ8A 1ULRA 2E1RA 2LQJA 2ZH8A 1IVZA 3BN4A 4WIIA 1UW9A 5HN0A 4DR1F 3OR2B 3EPIA 5CXTA 2O01C 3GIIA 2XO6A 2HS4A 3G8QA 1OY9A 3M30B 3BPDA 1GMUA 4ECZA 1S7HA 3RG6A 4JI8J 1VRQC 1ZBTA 3KK2B 2VPWB 3P8BB 4XPCA 5FIIA 2OPQB 2A0FB 4P10A 1VQSA 1W25A 1XK8A 2CYYA 2QFIA 4ZHRA 2HLUA 5GAEI 1K73T 4NLRA 4E0DA 4G1IA 3R1HA 2F40A 3L7UA 3M6XA 2YKNB 3G9CA 4EU0A 2DHXA 3KG4A 3J81Y 3NS5A 1WORA 1TU0B 1DHMA 3C14A 2NPFA 5AJ3F 2E29A 3OLBA 2YNGB 3RBEA 2JEJA 3H25A 1UVMA 2HYIB 1RT1A 4MKAA 4F0KA 1ZH5A 1FKAF 1VRUB 3N5BA 1XMOJ 1YRUA 3QLHA 3ZFVA 4B9TA 2RRBA 4YMEA 4DUTA 4WK1A 4KFBA 4M5NA 5HJXA 2N4DA 2N82B 2XLKA 2B4OA 4CZCA 1HBUA 1EQ0A 2RU9A 2EK1A 3B78A 2O66A 1HNVB 3M8YA 3DCAA 4C8ZA 5HLFA 2KFNA 1DTTA 4YP3A 1P9YA 2BEFA 3NEKA 3QJLA 2HIQA 3FKBA 4LQ9A 1U02A 3T5LA 4CLTA 1Q7YT 4QOTA 2DJWA 2I0XA 1N5VA 3K58A 2KKHA 4LBPA 1N5YA 3HI9A 3V4IB 2GAGC 2IPOB 3T5JA 2FLLA 1TKTA 4NLVA 4QPXA 1RT5B 6AT1B 1JJHA 3N5FA 4LFAF 2QSWA 1GQEA 1BWVA 4NCAA 3NMAA 1RBAA 3GPAA 2WW8A 1B3TA 4C0OC 4J9LA 2GC8A 4K4XA 1QSLA 4L76A 2HLTA 1R0CB 2G0JA 5DQHA 4CO4A 1VQ5S 2Z0GA 4C3LA 2KXHA 4P9SA 4WFYA 1BHNA 3G8SA 3EVWA 3NOCA 2ADBA 1QSSA 1S6QA 1KOHA 1CC8A 3H5UA 1V6HA 4C48A 2VG6A 3OTCA 1J27A 4DL6A 1DRZA 4ZVPB 4QYRA 5IFMA 3D68A 1T11A 3PEJA 3CCRS 1F60B 2E1PA 2HHVA 4RBUA 1KVIA 4U7UK 2B9XA 2DK2A 3J80Y 3F44A 2LXIA 4OHVA 4EGLA 3KTQA 3GMGA 3C19A 1URRA 1YGYA 2LQ8A 2VB6A 5F3ZA 2DHSA 2PA8D 4OLOA 2MQQA 3M2UA 2HZAA 2PSZA 2HHWA 3WZ0A 3LANA 5EUHA 1PO6A 3RZAA 5D15A 5A2QY 4FF3A 3GCWP 2QTWA 3ENQA 2AHOB 5A0YB 4WP3A 1D0EA 4LR9A 2G1DA 2KH9A 1ZAVA 5H1SV 2OO4A 3BGLA 3I0RB 2UXCF 1BQMB 4NLYA 4ZLNA 2GMJA 2BZ2A 2CNLB 3GCXP 2EBEA 2FDNA 3MAAB 1N34F 2QYGA 4RUHA 3TAMB 4DR7F 4AQYF 1WD6A 3TVKA 1FFWB 3M8PB 3SSSA 2HAFA 3QFHA 2GIQA 2C2DA 1S48A 4C11A 2XB2D 2ZBIA 1S0NA 2ZKUA 5J2PA 4ZIWA 3H2LA 5D0GA 1FRIA 3NY0A 5CYQB 3UDVA 1R0AB 3T3FA 1IBCB 1TL1A 2J9CA 3MMBA 1GT8A 1KS2A 5CAAA 5A8WB 4L75A 4TYBA 4FBUA 5DGBA 4NMLA 3D6TB 2ZZTA 3D0IE 2GAHC 4YY3J 4A8YA 1KFSA 1Q82T 1WG4A 2E5LJ 3DMJA 4RW4B 1F2HA 2OEJA 4C98A 3FNNA 2QV6A 1Q7LB 1PJ5A 4FPIA 3MGJA 2X51A 3QT8A 2PMHA 4NCBA 2OMLA 1FFGB 2QC3A 4B3MJ 4DSLA 5L9NA 2F8HA 3OT9A 2EWHA 3H42A 1QLNA 5IV4A 3TOQA 1Q53A 1FE0A 2VQFJ 4MYTA 4MYUA 5H9FK 3W65A 2FJAB 3KK2A 2OPQA 2WVDA 3FRYA 2EK6A 2P9GA 4ECQA 3UR0A 3CCLS 3H59A 3HZEA 1CJTB 1NJIT 3NCPA 4HTIA 3BSNA 2UXBJ 2L9NA 2DNRA 1VK8A 2LLZA 4BWJA 1DTQB 4A8WA 4DV7J 4K4TA 1U1PA 2YKNA 4QWAA 2BYCA 4RX6A 1S1VA 2QSFA 1I6JA 2EC2A 3I0SA 5ETOA 1D9DA 1WACA 1G1XA 1Q16B 1HMVA 2V63A 1HD0A 3DN9A 3GIRA 1YWXA 2YNGA 2VOOA 1S9EA 3FEZA 1KP6A 4CLSA 1VRUA 4PYDA 2AGQA 4ED5A 4NE9C 4B08A 5D3GA 1T05A 2XZWA 1U8WA 2MMYA 2RUSA 4ZCKA 1R0BG 2IM2A 5HROA 5HVHA 5ITHA 2CQ3A 1WEXA 2JOQA 1HNVA 3R6LB 2CDRB 1I51B 4W90B 3C2PA 2CJQA 1GXUA 3QIPB 3SQOP 2IY5B 4BWMA 3BB5A 1TAQA 3WC0A 3V4IA 2ZBRA 3DLEB 1HWKA 4ZLJA 4OYBA 3ISNC 3CNQP 2XHCA 4L3NA 4FVMA 1HI1A 1F5AA 1H2UX 3SZ2A 4USMA 1RT5A 3CVKA 1C0TB 4LFBF 3Q0AA 1FD2A 1IKWB 3MMAB 2YNHB 4CH1A 4Y2IA 3AA8A 5KT4A 2KG1A 2IM1A 3N0VA 9RUBA 4PAAA 1Y10A 1K8AT 3W60A 2WSCC 3K5OA 2VG5B 4ED4A 4N47A 3M32B 2AJ4A 4QWCA 3HVWA 1EB0A 3D7SB 1X9MA 3IG1B 3IR7B 1S99A 4GRSA 4PWUA 1ZZNA 3GP9A 4P74A 5AE2A 4RLEA 3L9ZA 9ATCB 2KG0A 2R42A 3BEGB 4F3QA 3CDBA 4J5OA 2RHSB 2HHHF 1RAAB 3KNAA 4ZCMA 2OLWA 3UNGC 3MUMP 3ILIA 5ETLA 3P45B 1WOPA 2LXUA 1QY7A 1NKBA 4CLUA 1HD1A 1VQ7S 2HWTA 4F3MA 4L72B 4Y65A 1B64A 4A4JA 3DC2A 3HHDA 4DX8H 4FS2A 2OI2A 4NCGB 2AW0A 3BQ0A 3PR4A 3I87A 5F8GA 4X62F 2DGWA 2ALYB 2WK4A 3UD5A 3L7PA 1ZTTA 4OJ1A 4P72A 4IG0B 5D4NA 1FA0A 3F56A 4X84A 2V2QA 4QR1A 1VBZA 3JTPA 4FZVA 1JK9B 3FSXA 1HNXF 1NU4A 5IT9U 5A0YA 1UPPA 1Q8LA 1BC6A 4USWA 1K44A 3I0RA 1BQMA 3EWGA 1S0MA 5DS7A 4ED1A 2PEBA 5L1KA 3IGNA 3J7AN 3MR5A 2PT0A 1JJCB 3F73A 4KGVB 3MAAA 5BJRA 3J81j 4TY8B 1IM4A 2WCXA 4PCQA 3TAMA 1C1CA 3AOAA 5CD4H 2ABYA 1WEZA 3N6NA 4P2MA 4RW6B 4IR1A 3M8PA 3F0NA 1S9GB 4DUZF 3FCHA 5RUBA 5LMUJ 5IM0B 2MQNA 2XC9A 4D3HA 1MSWD 1REGX 4IRCA 2FLOA 5AE3A 3FGVA 3I4HX 5LOQA 5CYQA 1R0AA 3LALA 4G1QB 7FDRA 3B6BA 2DRDA 2FVCA 4I64A 3W9IA 1CS4B 2RRNA 4NYOA 2AU0A 4CH7A 4RWWA 3HVRA 3HHLD 5U47A 1RHJB 4E2FB 4RW4A 2ZWOA 1YTYA 3UD3P 2RAQA 4I2PB 1NJZA 3ZTOA 3MZIA 2FPHX 2M4MA 3OHBA 4DBQA 1SJ3P 4YDDB 2MY7A 2Q79A 3SFUA 2JC1A 4ZLLA 3GZ7A 1UAWA 3K7RA 3HT3A 1S7IA 1NNDA 1HYSB 2MQMA 4OJ3A 4DV1F 3M8SA 4ED0A 4LF9J 4OV6A 1JNRB 3FQLA 3L3CA 5IOLA 5HMZA 3NGDA 4B3TJ 4L74A 5HMWA 4CLFA 2R2TA 1CJTA 5DDOC 1Y3JA 4LRFA 1HQEB 4GVBB 2XZDB 1DTQA 1IBKJ 3LP2B 2O5DA 1UZDA 3QJJA 4WIQA 3BGRB 3ZXWA 4P73A 5E3RA 2QLXA 1FWLA 2YX1A 4Y00A 2UVVA 2XMTA 1NH7A 4K8RA 4ZVRB 1OPIA 2DIVA 2R7UA 3NCRA 4R25A 3ZZPA 4CO5A 2Q43A 2RKIB 3U1NA 2EEYA 4FDFA 1FD8A 3ULHA 3UVJB 1RTHB 4ECXA 2UUAJ 4JUZA 4O3RA 5A6PA 1CULB 4CH0S 1T9YA 2I5JB 4EYHB 2JC0A 2DH7A 1YJVA 2ZH9A 1Z1ZA 3QIPA 3S8SA 3R6GB 3PRBA 5BXIA 1B0PA 1AUDA 3TAQA 2ZNZA 4PYAA 1SUQB 2CPXA 1XNQJ 4HYKA 2J0SD 3KWMA 2VBXA 3BH6B 3M6VA 4ENOA 1IBMF 2R7XA 3PX0A 1KEKA 2XY6A 3MMAA 2YNHA 5IZHA 1RADB 1R89A 3GB0A 4ANCA 1HHTP 1WF0A 4ID5B 3K5PA 2VG5A 2B9EA 3K5MA 3HKWA 3M32A 3VHQA 1HNWJ 2F8EX 1NJWA 3IG1A 2L41A 3K5LA 4NLDA 5A8RB 5I42B 2W24A 4USVA 2G2YA 2DO4A 4M5HA 2G0IA 2BW7A 2PDAA 3UE2A 4ALZA 3VWSA 2FYXA 5EN1A 1HW8A 1X4HA 2V8DA 5L1LA 2W2PP 2FB0A 4MTPA 1EETB 1LWCB 2KZZA 1ACMB 2QA4G 1HQUB 2HFUA 1T8EA 4DR3J 3HVTB 1L5UA 4LRAA 1KD1T 3H4BA 1NCLA 1RI7A 3CUNA 5L1JA 1TKZA 4ES1A 4DSJA 1TTHB 2UXDF 4MFBB 1YQHA 4DF4A 4CLPA 2WOMA 4NCGA 1TFWA 4U95A 2PO4A 2V8HA 3E3XA 2R3VA 3KK1B 2QE5A 1XERA 2M5YA 4KHRA 3DFEA 1FKOA 3C8YA 4UT4A 4WTOB 4LF7F 3R27A 5LMNJ 5GAGU 4W4MA 1REVA 3ZO7A 3HSDA 4QBUA 1X4CA 1SVDA 2OSQA 5GMEA 4QWDA 3CSKA 4DWIA 8RUCA 4HKQA 2CJAA 1HBMB 3CF5Q 2VKZG 2WB4A 1UZHA 4TY8A 3CE8A 3BQ1A 2PFDA 3FSIA 4RW6A 4ZDNA 3RGIA 1S72S 3RAQA 3MCNA 3B4DA 1ZAXA 3CCZA 3R5BA 4F4KA 1U09A 5T7LA 3PYEA 3OQ2A 5IM0A 1WHVA 5L8RC 1IJFB 4YS2A 4NPOA 1G7CB 4EZ9A 2ZEJA 2F8MA 3WX8A 4X4NA 3QWUA 2QJ3A 4Z37A 5AXNA 3G6ES 4QQBA 2NR0A 2X7IA 1MNEA 1S57A 2YKQA 4JI8F 3VAJA 2Q6CA 4I56A 2ERRA 2EW9A 3RRKA 4KC5A 2FHJA 2D69A 4IRKA 2IM3A 3QIDA 4KGZB 3MUTP 4WP9A 3R7NB 3AQPA 3HKZD 1P8GA 1NK8A 2B9YA 1C2PA 4TXSA 1LK7A 3OUYA 4M5LA 4CT9A 1NZ8A 2HVEA 1X5PA 1WHXA 4WKYA 4AL7A 4YR2A 5B09A 3R7SB 2PN6A 1J5OB 3H2UB 2D3ZA 3V6KA 5B0FA 1T0TV 1NSPA 3R5DA 4RUAA 4N5SA 5IQQA 4JI5J 1EAYC 2NXUA 3KFWX 4HHJA 4ZN1A 1FRMA 3GIJA 2E44A 1JLAB 2JDJA 2BE9B 1S1XB 2M88A 1JX4A 3W2WB 4QPTA 2IBKA 4ER8A 2AT1B 2MLYA 4GVBA 3VTIA 2MXYA 3IRXB 4WWSA 3PIOQ 4ECTA 3VVTA 3SEOA 2ZHOA 3BGRA 4HT5A 2QYCA 5D4OA 4PG7A 2FJXA 4GO5X 2BQ3A 2D3UA 5G4DA 1X4EA 5AXLA 2ZVSA 2KT5A 4N7TA 2ZHAA 3VGSA 4V19X 5KFMA 5KFPA 2QLJB 2OEKA 2C22A 2RQKA 3MXHP 2VQEJ 1GMVA 2RKIA 2IHR1 3GV7B 3MM9B 4ANDA 1IR2A 1F9FA 2R7TA 3MR2A 3W5YA 1VGYA 4OX7A 1CULA 3GFXA 1OPZA 1UVJA 4DQSA 5KFNA 1TKDA 3B8HA 4OYPA 4C0BA 2MZTA 2IBOA 3R9LA 2AEJA 4Z7YA 3LWMA 3NAIA 3DM2A 1FCAA 1W2IA 2FVRA 4DR2J 1O6XA 4ZPWR 3FCVA 4Q8EA 4LF5F 2J8SA 5HMYA 3CDUA 1LWEB 3ZZ0A 5KFXA 1SUQA 3GJRB 4LRBA 2ACMA 3IC1A 1SC4B 5CHCB 5A8KB 3LWLA 3BYPA 2ALZA 1ITPA 1S10A 3CJ2A 3KLHB 4NOHA 4U6PA 1WKJA 3EYZA 4HVZA 5F8IA 4DPWA 4J37A 4FP9A 3CD0A 4ZCLA 5J2QA 4DSIA 3OR1B 2EFNA 2IC3B 5AXKA 5KFCA 5GAGI 1N33J 2DNGA 4K0KJ 5A8RA 1LWFB 5I42A 5C2CA 5LXRA 5K14B 1YJNS 2V5HG 2KRBA 1YJ9S 4WP8A 2ZM6J 1HW9A 5D0HA 1SL2A 2Y0SD 5E3PA 2IMOA 2P6TA 4DR5J 1KKHA 3RBZA 2DGVA 2OIHA 1F1BB 1EETA 1LWCA 3CD7A 1QAIA 2DPJA 3ZTRA 1DLOB 3Q86A 1HQUA 4FS1A 3HVTA 2BM0A 3DLKA 4C8NA 1NDKA 4DCPB 3G6YA 2CG8A 3AJ1A 3S7RA 3SCIE 3V81B 5KG6A 3NL0A 4M5MA 4MFBA 4UY8T 4L3KA 1WUUA 1WWHA 4QCLA 4ICLA 2V6AA 2YQ1A 3CJ5A 3KK1A 4IO1A 4NX9A 3MD1A 2XYPB 5IT9Y 1KHWA 5CZVA 4WF9Q 4LSLB 3NRBA 4J9MA 1YITS 1G3OA 1QUPA 3EXCX 1LXJA 2BANB 2ZBQA 1SV5B 3SSQA 1YLXA 3MEGB 2CQGA 2AJFE 3HXMA 3HSJA 8ATCB 4X4RA 3MHYA 3QRQA 1RHUB 4DQIA 4X4OA 4K5SA 3JYTB 3PZPA 2ZBPA 4QZVB 3ILJA 1X4GA 4KHPJ 2MYFA 2BQUA 4URSA 2JLFA 2GVZB 3MPWA 3RB4A 3NLCA 3POTB 4DU7A 4JI0F 4YY3F 8AT1B 2LDIA 2W25A 2E5LF 2P9EA 3V5RA 2I38A 2R7VA 1JMTA 1M1HA 4NI2B 1RYRA 1BUXA 2HQGA 2DGQA 2R8HA 2JHEA 2BE2B 1X9SA 4OI4A 1FJGJ 1PBUA 3JTOA 1G6BA 2RS2A 5AE1A 4FYVB 3C6TA 4B3MF 4DUYF 4Z7CA 1D9AA 2VC1A 4ECUA 3RJMB 1XR6A 2VQFF 2LYVA 1NPRA 3C46A 4EYIB 3SDEB 2MKHA 1JLFB 4A46A 5K8PA 1PILA 3HVAA 4RPFA 4FYDA 4NL5A 4H54A 5J2MB 4EI2A 4NEZA 2PGCA 2Z30B 4P75A 2E5JA 4H4MA 4IG3B 4FXVA 2V4JB 1MMDA 2AJ1A 3GJQB 2HFOA 1RABB 1RT3B 1RHMB 5DDRC 4QIEA 1L3VA 4O0IA 2EG1A 3LPEA 3BF4A 2YX4A 4OYMA 3Q22A 4TVAB 3TJ9A 3QWPA 3P96A 1VQKS 2X3DA 2R2RA 1HL6A 3KK3B 5HVFA 4FF2A 5C24B 3DGPA 2G13A 5DG8A 3MPDA 3W2WA 2VBWA 2FC9A 4JI1J 1FRJA 4P2SA 3FFIB 4ILRA 4E98A 1VHFA 4IYQA 3FC9A 1WJ9A 1XMQJ 3FMWA 1GFWB 4I68A 4USKA 3PNIA 4MJKA 3FUYA 3VGTA 1JLEB 2PMZD 1C0UB 4PG8A 1N36J 4DV0J 3DYAB 4ZA1A 1GXTA 2HWIA 1XWLA 1XNRF 3N4WA 3OFHA 4F04B 2RQCA 4RNMA 2PI4A 3MM9A 5F41A 1VMBA 3HHLC 3W61A 1MWYA 2XNRA 3D67A 2A2DA 2QMUB 1YBTA 3VQTA 3HK2A 5CD4A 3MUVP 2I8EA 3PX6A 2CA9A 3K8WA 2A10A 5CABA 5KFQA 3HHEA 4M95A 1D1UA 1C1BB 3FCWA 1FTRA 2KZMA 2GS8A 2K1RA 3MM7A 4CQ1A 4OFZA 5KFRA 1KSPA 4DF8A 4LBIA 1LWEA 4LIWA 4P2FA 3FBEA 2HNYB 2F4VJ 4ZJLA 4OYWA 1FT8A 2IJNA 1FHTA 2PC6A 2QZ8A 3KJFB 3AAWB 1X0PA 4NZ7A 3R5GA 2H48B 2ZZMA 2N3LA 3OR1A 1Y0HA 1RJJA 2KL8A 4BHQA 3SMZA 1LWFA 3IM9A 5DJBA 2OPRB 1HNIA 2UUBJ 4DFPA 5IQ6A 5KG1A 5F0WA 1UJ4A 3PX4A 4FN5A 1HI8A 5CQGA 3M6WA 4DPYA 3JQKA 3UN5A 3QT7A 5T41A 3ETOA 3RB0A 4HR2A 2B4UA 5D4LA 1OWXA 4MK7A 4R8UA 2OKQA 5JXSA 5CCLA 1DLOA 3GV8B 4KRWA 1UCNA 1IKYB 2YPYA 3ZC4A 4RNOA 5THWA 2VPZB 5GAHU 5ETRA 3Q8RB 4YR0A 2XMKA 4JI7J 5KFHA 3LAMA 4LSNB 4TYAA 4Y2MA 2ZJQQ 1RHQB 2WVFA 2M9KA 1SC1B 1N32J 4AYBD 1M5HA 5LMUF 1ZM9A 2BANA 1SV5A 2Z56B 4OL8A 4OYOA 2D41A 2B8PA 3MEGA 4IOAQ 2XULA 3CJRA 2HQDA 2WSEC 3O5TB 2ADCA 4CO2A 1PGZA 4YHHJ 2CNKB 2QLWA 2VZ9A 2GVZA 1A0OB 2ZUAA 3OFEA 4DV5J 3AODA 4JV2A 3LGMA 4PKDB 3R5JB 4C6AA 4K4VA 3NGTA 3BBBA 1RAJA 5ETPA 3EZ5A 2Y1IA 2CKWA 1Z2ZA 1RBLA 4WK3A 3SYZA 4NI2A 4G1PA 2BE2A 2DXDA 5KFLA 3BPSP 2AJQA 3RBDA 4YB1P 4E8UA 3MMCB 2OTLS 4CDIA 4MKBA 2DHGA 1TK5A 2ROEA 1VRTB 5D0RA 3KUHA 1CVJA 2QA4S 4ZKAA 4LF9F 4X4QA 1JLFA 2FJWA 1BXNA 2GV1A 2C3YA 4RUCA 1HNZJ 4HACA 1KRPA 4RZRA 2XS2A 4B3TF 5J2MA 3A12A 3D5MA 1DURA 1FWKA 5CYJA 2MSTA 2CDQA 4IG3A 2RU3A 4CLKA 5E41A 2B43A 4DV4J 3DOKB 1NMEB 1PJ7A 5KT3A 1SJRA 4DMZA 3LW5C 3IR5B 3VVUA 2ZUGA 1RT3A 2CXEA 1P27B 3NGUA 4F7VA 3GIMA 2JLGA 3PXGa 1JXVA 3G6VA 2RB7A 1P6TA 1WOSA 5DETA 4IR9A 3FZ2A 4ZLPA 3OFGA 2ASDA 3BBCA 3PYFA 3TVZA 1E6VB 1QAYA 4TQSA 4WU2A 4JYAF 3KK3A 2C1EB 4OLPA 2R8GA 2C3OA 2MSSA 4QIFA 4F67A 1QSYA 1NB7A 3BJYA 2BACA 2L08A 3J7YU 1LKZA 3FFIA 2CAJA 3GR1A 2HNZA 2OTJS 3CDEA 2OUGA 2DR9A 4X2BA 3TARA 1SKRA 1B70B 4IRDA 4WJBA 2W7AA 2DNQA 3GTYX 2UUAF 3V6HA 3PJWA 3EVMA 3P5BP 2V8GA 4KH0B 4W98A 3ZZTA 1Y9OA 2QX0A 1C0UA 4DFMA 3DYAA 3WBZA 2AKWB 2B9WA 1OY8A 1CBKA 2IVYA 2VONA 1FXDA 4NLQA 2D3OR 1NK9A 3CIZA 2KT3A 1S1UA 3JSYA 2J7KA 3HJVA 2YTCA 3PO4A 3KXDA 1S59A 3UFCX 2B6AA 4LF8J 4ANEA 4ZK7M 2EFGA 1WELA 4OIXA 1SH0A 3QBCA 2UP1A 1C1BA 1RTDA 1I3OB 3UCZP 3R8YA 1RDRA 3MEEA 3JQJA 4QJVA 1MMLA 3DOLB 4LF1A 4ZPAA 2HSEB 2DXFA 4LR7A 5GAHI 1TL7B 2ZOFA 1VC0A 1OJ4A 2FHOB 1UVIA 1S6PB 1F3VA 4O44B 2BRLA 2RF2B 3TI0A 5HP1A 2PD1A 4J9RA 5LL6d 1IR1A 4DR3F 4I1TA 2VL1A 4YOEA 3PFEA 1WG5A 2CWKA 3IM8A 4ZOSA 2RHQB 2Q3PA 4ZPDA 3NS7B 3W2VB 3DLHA 2FHKA 3JQMA 2J8AA 1VQLS 4NA3A 3LH2S 4QWEA 2CUYA 3BSOA 1RQ0A 1S4EA 3CJ0A 3I5AA 3MECA 1RA7A 2Q66A 4KV8B 5LMNF 1MU2A 1O8BA 3TVYA 4CTAB 5C42B 3CCJS 2XMVA 5I3PA 4DI6A 5M2UA 2IMWP 4U8YA 1M0SA 1WHYA 2VDHA 3NNCA 1WI6A 5LJ3Y 1RU1A 3HLUA 3G86A 2E7WA 1UFLA 2HMIA 4LSNA 2DNLA 4CYUB 1F6TA 5G0RA 1YHQS 4J9NA 1UFKA 4DCJB 3QRRA 3UCGA 4FBTA 4BDPA 1R31A 2YWHA 5JVHQ 1KDNA 1LFPA 5KFBA 2KB2A 4LBHA 4IH6A 1S1WB 1JXLA 2M52A 1JLBA 3M2RB 2FGCA 2J5AA 3HZGA 3SBMA 1YDLA 5HQ8A 1G2EA 2AYMA 2E5IA 2CQ4A 4OJHA 2XHWA 2RQMA 1OSCA 3HD1A 2VFSA 3JS9A 4V1Ak 2IJFA 2OAUA 1VQNS 5HI7A 2OJ3A 1GH8A 5F8LA 2DT9A 2H1YA 4Q2LA 1YIJS 2DGXA 3MOZA 3MFHA 1FERA 3A8KA 1LW0B 1RAFB 5HO4A 3PJXA 4IFYB 2F9JA 3TA0A 1L3TA 2RT3A 4TN2A 4OZLA 2A6MA 5B0EA 3J7YI 4JI6F 4X66J 3Q23A 1RTJB 1H7XA 2RNEA 3DRPA 2PFFB 2YVSA 4LF4J 2D7SA 3VF0B 4JI5F 3RB3A 1RBOB 2C2MB 1VK3A 4Y0FA 3SV3A 2X1BA 5BR8J 4R0JA 2BBEA 3T5HA 2ZD1B 1HBOB 2DRBA 4DSKA 3TWZA 3RRHA 3I96A 2VD3A 2HGNA 3DOKA 2HK3A 2HGMA 3PW2A 4KHMA 4OHWA 1VCTA 2IVFB 3CDAA 1HWIA 4DV2J 2Y8WA 1N0UA 1S49A 2FZGB 3ZNUA 4IQMA 3EXYA 3CCES 1E6VA 2XM3A 1RKIA 2ZH6A 1T03B 3KG1A 3DLLQ 4NZ0A 1IUJA 2NYHA 1XN9A 1H73A 4LVNP 1FJCA 3PYDA 1ZPVA 1DQAA 3MPYA 4K4WA 2JFKA 4OI1A 1CSJA 2ZOMA 1Q86T 1CJUB 1ZETA 2GFFA 3LO3A 5F8NA 1HWUA 2QL9B 3R7BB 3TJAA 1IWGA 2DHAA 2ZFHA 1U0HB 2UUTA 1HARA 2FLNA 2AMCB 5B0DA 4DR2F 1HA1A 1FVSA 3CTRA 4FXWA 5IS2A 4OYIA 2XGQA 1CC7A 4JV5J 1WDDA 1RYSA 5E3CA 1FDBA 4IH7A 4PG4A 1J5EF 4WYWA 2PI5A 1GX6A 2X1GA 5BYQA 4ECWA 1RT7B 4J9OA 3UDLA 1FDNA 4U7CA 4I2QA 4TU7A 3ZZOA 4NYPA 2YX7A 2OPPB 2WSFC 2KYXA 2N7CA 2IYIA 5IV3A 4K0KF 1NXIA 4QU6A 2RRAA 3M6UA 2VICA 2CIMA 3MEKA 2ZM6F 2V8VA 2AP6A 1A6LA 4URGA 1VQMS 4ELUA 2XMMA 3LGNA 1AUSL 1TL3A 5ETNA 1TL7A 1LK5A 4C8MA 4DR5F 2BA9A 3S1TA 3SV4A 4KE5A 3BKFA 2JEFA 1S6PA 1OO0B 1Q5VA 1UETA 1Z2LA 4C8OA 1UWAA 2L9DA 5KFKA 2QT7A 2CADA 2XEXA 3AB2B 4F50A 3TZWA 3G2XA 1Q78A 3WHIA 5AJ3J 2HEKA 3W2VA 1JWWA 1HPZB 3EVOA 4C9DA 4FYYB 4NA2A 4P71A 4CRJA 3NGKA 2YNFA 2DGUA 3RR7A 2H3EB 3DLGB 3HJFA 3ITHA 4A8OA 1CEZA 2P9CA 4UF4A 3THTA 4KPYA 2VH7A 3UN2A 5B0AA 2NUUG 4PWDB 3VAHA 2DH8A 2HGLA 2DGOA 1UKUA 4CTAA 2RDIA 3TEHB 4X4UA 4EBEA 1SXLA 2AEMA 2YQ3A 1BY9A 4LSZB 1Q8KA 1C4CA 1HIYA 2JEIA 2GA7A 3CC2S 1ZA1B 2CQ1A 2F3JA 1XJWB 1V3ZA 4KO0B 5KFZA 3MAHA 2DPIA 4CYUA 5K8MA 3M1VB 1CJVA 1EP4B 1K0VA 1GXLA 4OHXA 1YI2S 3NG8A 1H2VZ 1VJQA 2BJDA 2FIUA 1ZPWX 1IKVB 4CO3A 5L1IA 4LFAJ 1S1WA 2E9ZA 4ZN3A 1W7WA 3TEGA 4F3OA 3HFVA 2EFQA 3A8JA 1NB2A 4HTJA 4F2RA 3ZNJ1 3H8YA 3MR3A 3KLGB 1AT1B 1JLCB 3I6PA 3CCVS 2EPIA 5KFYA 1WC0A 3EDRB 2CPZA 4W92B 4OZNA 4B17A 2RDJA 5ETMA 4JV0A 3SSRA 1B0TA 1U1RA 1FF2A 1B7YB 4N41A 2W01A 4X4SA 3OJUA 2FLPA 1YKWA 1LW0A 1K47A 4K5RA 4IFYA 1GK8A 3DRXA 4DSFA 4PUOB 5DGAA 1JNZB 1JJ4A 2ATCB 1RTJA 4CLLA 4I6YA 2DTJA 3M2VB 4OZ3A 3ET6B 3MD3A 3H5YA 1NKCA 3IN5A 2P5VA 2ZD1A 1HBOA 3BYRA 2DCUB 2CQDA 1WC3A 1BQXA 1RLCL 1IM6A 3TA2A 4JI1F 2F9DA 2V2ZA 4J9VA 4ED7A 3W1YC 4PZVA 1RB0A 3GLJA 3G71S 4KY3A 3Q83A 4JI3J 2L3MA 2CZVC 1O5JA 3BV8A 4I69A 2F63A 4CLZA 2KRRA 1U2FA 3UN3A 3TNVA 3HPOA 2Z2LA 4WTYA 3PEHA 4DV0F 3FVYA 2UXCJ 3CC4S 4CIOA 3HCXA 4NWBA 5HAOA 1LWXA 1F3FA 1T03A 4WU3A 1N34J 4JB8B 5KFDA 2K8GA 2FJEB 3QSYB 1H72C 4AQYJ 2KVQE 1YBAA 2B8QA 3GONA 5CA5A 2H9ZA 1JB0C 5DZ6A 1KFDA 2XSJB 4DEZA 3J7A1 4USJC 2YWKA 3M8WA 4Y34A 5KT7A
chains in the Genus database with same CATH topology
2HBZB 2P2CB 2H48B 2CNOB 1RHUB 3GJQB 4DCOB 2CJXB 3D6HB 3D6FB 1QDUB 1NMEB 1RHMB 2H4YB 3NS7B 2HBRB 3R7SB 1RWXB 2XYGB 1PAUB 4ZVTB 3R6LB 2CDRB 3IBFB 5IC4B 1RHRB 1I51B 3EDQB 2FQQB 4ZVPB 2C2KB 3QNWB 3SIPB 2CNKB 3KJNB 3P45B 4ZVSB 3P4UB 2H51B 3KJQB 3R5JB 1RWVB 2H65B 3R6GB 1F9EB 2HBQB 1QTNB 2XZDB 1RWMB 1RWOB 2H5IB 2C1EB 1IBCB 3GJTB 1I3OB 1RWNB 4ZVOB 4DCPB 1SC3B 5K20B 4ZVQB 3EDRB 2QL7B 1ICEB 1RWPB 2C2OB 3GJRB 2Y1LB 2DKOB 4LSZB 2H54B 4JB8B 1SC4B 4ZVUB 2H4WB 3RJMB 2XYHB 2C2ZB 4ZVRB 2CNNB 1RHKB 1GFWB 2CJYB 1RHJB 1RWKB 2XYPB 2XZTB 2QLBB 2HBYB 5IC6B 3GJSB 1RHQB 2Y0BB 2QLFB 3IBCB 3KJFB 1SC1B 3R7NB 1PYOB 1RWWB 1RE1B 3D6MB 1BMQB 2QL9B 3R7BB 2H5JB 2CNLB 4DCJB 2QLJB 2C2MB 2QL5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HBZ B;  2P2C B;  2H48 B;  2CNO B;  1RHU B;  3GJQ B;  4DCO B;  2CJX B;  3D6H B;  3D6F B;  1QDU B;  1NME B;  1RHM B;  2H4Y B;  3NS7 B;  2HBR B;  3R7S B;  1RWX B;  2XYG B;  1PAU B;  4ZVT B;  3R6L B;  2CDR B;  3IBF B;  5IC4 B;  1RHR B;  1I51 B;  3EDQ B;  2FQQ B;  4ZVP B;  2C2K B;  3QNW B;  3SIP B;  2CNK B;  3KJN B;  3P45 B;  4ZVS B;  3P4U B;  2H51 B;  3KJQ B;  3R5J B;  1RWV B;  2H65 B;  3R6G B;  1F9E B;  2HBQ B;  1QTN B;  2XZD B;  1RWM B;  1RWO B;  2H5I B;  2C1E B;  1IBC B;  3GJT B;  1I3O B;  1RWN B;  4ZVO B;  4DCP B;  1SC3 B;  5K20 B;  4ZVQ B;  3EDR B;  2QL7 B;  1ICE B;  1RWP B;  2C2O B;  3GJR B;  2Y1L B;  2DKO B;  4LSZ B;  2H54 B;  4JB8 B;  1SC4 B;  4ZVU B;  2H4W B;  3RJM B;  2XYH B;  2C2Z B;  4ZVR B;  2CNN B;  1RHK B;  1GFW B;  2CJY B;  1RHJ B;  1RWK B;  2XYP B;  2XZT B;  2QLB B;  2HBY B;  5IC6 B;  3GJS B;  1RHQ B;  2Y0B B;  2QLF B;  3IBC B;  3KJF B;  1SC1 B;  3R7N B;  1PYO B;  1RWW B;  1RE1 B;  3D6M B;  1BMQ B;  2QL9 B;  3R7B B;  2H5J B;  2CNL B;  4DCJ B;  2QLJ B;  2C2M B;  2QL5 B; 
#chains in the Genus database with same CATH topology
 4WFN Q;  4ZP9 A;  2DNY A;  3CCQ S;  2CJX B;  2JL9 A;  1SL0 A;  2OPS B;  4DX7 A;  1FTC A;  2E7X A;  1PC4 A;  4RR5 A;  1WI8 A;  2BJ8 A;  2GQQ A;  3TA1 A;  3UNY A;  2C3M A;  4OYX A;  2AJ0 A;  3OV7 A;  1JJ2 R;  3PW5 A;  1T3N A;  1FRK A;  2ASJ A;  5B0C A;  2E1A A;  3VAK A;  1R8H A;  3JSM B;  1U2R A;  3N6M A;  3A3O B;  1TMJ A;  2QFJ A;  3E01 A;  1BQN B;  3AJ2 A;  1RWN B;  4DV6 F;  3Q8P B;  2WB1 D;  2D1C A;  1KLN A;  1B0V A;  3RB6 A;  3FRZ A;  4HI2 A;  4UQG A;  2NXC A;  3LGH A;  2FZC B;  2OPP A;  3EGV A;  4EFA C;  5E3A A;  2KM8 C;  3CC7 S;  2A3J A;  1KBR A;  1IQT A;  3OSP A;  1MRO A;  5F9L A;  2XY5 A;  2CRL A;  2DNZ A;  2I9S A;  2N7Y A;  3IFE A;  2HBY B;  1U25 A;  3T1H J;  2HRT A;  2XTJ P;  1VBY A;  2J0Q D;  1T95 A;  4X4P A;  4PQU B;  4DL2 A;  4DL4 A;  3OVB A;  1RP5 A;  2QL5 B;  1NZA A;  2QGF B;  1UW4 A;  2E5H A;  1S0V A;  1KQS R;  2IAJ B;  2AV5 A;  2M0G B;  1V9O A;  2VF3 A;  1VQP S;  1WEY A;  1H0H B;  4TLQ A;  3GR0 A;  2FY8 A;  4DJB A;  3CO9 A;  4UOG A;  1IR0 A;  4AD6 A;  5KOX A;  4C3M A;  2LQB A;  1ROF A;  2DB1 A;  3HUL A;  2X1F A;  1VR6 A;  2CQ2 A;  3DLG A;  3I31 A;  4JI7 F;  1P1T A;  4K50 A;  4ECY A;  4ZVO B;  2HFZ A;  2W9B B;  3OXL A;  1N32 F;  4QR2 A;  3FBC A;  4PWD A;  2YQ0 A;  4CLY A;  1NDL A;  1H3D A;  2BMB A;  3DGV A;  5IT0 A;  3OR2 A;  3EZU A;  3T41 A;  1A7G E;  1U1Q A;  1PSD A;  1VDH A;  3VR1 A;  1EKR A;  3M30 A;  3G87 A;  4KQZ A;  4HH1 A;  4KTQ A;  3OW2 R;  4YHH F;  3D1H A;  2BJ7 A;  1R7I A;  4DV5 F;  4KO0 A;  3L4B C;  3CJ4 A;  1UEU A;  1WNE A;  3M1V A;  2CNO B;  2IA6 A;  3FEY B;  1IJE B;  1ZOT A;  3PM9 A;  1WKK A;  1FRH A;  1T02 A;  1TUV A;  4J90 A;  3UR3 C;  3G4S S;  4U7U D;  4CO0 A;  3C16 B;  2KI2 A;  4R0E A;  2QA1 A;  3EZO A;  4LFB J;  5DM7 Q;  1IKV A;  1BE4 A;  2VHG A;  4IH5 A;  1D8Z A;  2UUW A;  1NLK L;  3PW0 A;  3GSI A;  4DPX A;  4R5P B;  3MMJ A;  1IKX B;  3KJV B;  4KKO B;  2H65 B;  4DX6 A;  4RUB A;  1ZZF A;  3LTO A;  3BGF A;  3ZZU A;  2WW4 A;  2LVW A;  1HNZ F;  4EWT A;  1UA1 A;  3HM9 A;  1SH2 A;  3H4D A;  3AY0 A;  4DV4 F;  3H98 A;  5LJ5 Y;  4DQR A;  1AFJ A;  4F25 A;  3OL8 A;  2EFP A;  4J9U E;  1DY3 A;  1MG7 A;  2KU7 A;  1B99 A;  2FVS A;  3G82 B;  3M2V A;  2IVM A;  5DQI A;  1RAI B;  5DDP C;  4RBV A;  1TAU A;  3ET6 A;  1QDU B;  1RCX B;  1HLW A;  4RW9 B;  2JH3 A;  2OEM A;  4GO7 X;  2HK2 A;  3BN7 A;  1EZZ B;  3N01 A;  4U96 A;  4KB7 A;  2QG9 B;  3UO0 A;  2EBG A;  2GW8 A;  4OJG A;  3CCS S;  3IO1 A;  1XC9 A;  4DL5 A;  2MZS A;  3WQP A;  3IA0 A;  3O3L A;  4F2S A;  3NAH A;  3K59 A;  4ZPB A;  1LV5 A;  1UL3 A;  2G4B A;  1W26 A;  3AOC A;  2CVE A;  1J2V A;  2CJ9 A;  3BSA A;  3VAF A;  1KTV A;  4M63 A;  1WHW A;  3HMJ G;  2QRR A;  3MWB A;  1AYE A;  2H4W B;  4UOH A;  3O44 A;  1U1O A;  6FD1 A;  2XZT B;  5GVQ A;  4DXL A;  3K89 A;  1R3N A;  1B4S A;  5FDL B;  3CJK B;  3LQV A;  1H38 A;  1TL5 A;  4GC6 A;  2YY3 A;  2NXE A;  5E2Q A;  3E2E A;  2XSJ A;  3QAU A;  4NLS A;  5J1P A;  1PBA A;  2YWE A;  3H20 A;  3GFY A;  2MY8 A;  2CJK A;  2EVZ A;  3C3L A;  4PG5 A;  3I56 S;  3C6U B;  2OPS A;  3HHK A;  3EDQ B;  2W4C A;  2R7S A;  3US5 A;  3LF0 A;  4DPO A;  4PXB A;  1BWE A;  2I6W A;  1PG5 B;  3Q8U A;  3FDS A;  5KFO A;  2ZH3 A;  4ZHR B;  3A8E A;  1RWM B;  3JSM A;  4MKY A;  1S0O A;  3GJT B;  2QMX A;  5H9E J;  2GVD B;  1KR4 A;  3TO8 A;  3OVS A;  2R2S A;  1S97 A;  3UDC A;  2J76 E;  1BQN A;  1SPB P;  2KHC A;  3CJQ A;  2HHS A;  2MHN A;  4AL6 A;  2RD5 C;  3KHG A;  3C14 B;  2W9A A;  4DV1 J;  4UQT A;  4QW8 A;  3NCQ A;  2DBB A;  5IC6 B;  4FNI A;  1VJW A;  3VAI A;  1WSV A;  3TUI C;  4JV1 A;  1YK9 A;  2CWX A;  5EGY A;  4DCO B;  4WZQ A;  2ZJP Q;  3SXL A;  3ENW A;  3KHR A;  2AYB A;  2Y1R I;  2IAJ A;  1U6B A;  2OD6 A;  2DYA A;  4LQ3 A;  2XMU A;  1UVK A;  4PRF A;  4ILM A;  1NEE A;  3ZZR A;  1SKS A;  5KT6 A;  1GX5 A;  3I4P A;  4RWX A;  5D8H B;  2ZC3 A;  3RYL A;  3VAL A;  1NK6 A;  2H51 B;  4WYL A;  4DS5 A;  5A8W A;  1WOO A;  3AD7 C;  1HHS A;  3ILL A;  2Z8Q A;  2HFS A;  3EMT A;  4JOU A;  1V5V A;  3FQK A;  1N5Y B;  4D3G A;  4OX6 A;  5EWG A;  3QAE A;  2W9B A;  1TMM A;  2UV8 A;  3T9N A;  2FC8 A;  4WE1 B;  2Q1L A;  4XTT A;  5GAD U;  1T9U A;  2DNO A;  4H4K C;  2B7B B;  2AJ2 A;  5DDQ C;  2NXJ A;  1YRT A;  4ELT A;  2E1M C;  3LP1 B;  1UJ5 A;  2OMO A;  2OSR A;  4IOB A;  4C3K A;  2MKI A;  2VFV A;  2Y0B B;  5EWE A;  2QLF B;  1JLQ B;  2HQF A;  2AZ1 A;  3D3B J;  3IAM 9;  1TEL A;  2ZH5 A;  2R8I A;  3R5A A;  1PYT A;  4Q44 A;  2H4Y B;  4OZ5 A;  4C0H A;  4TLR A;  2ZC4 A;  2HZC A;  3TAP A;  1S6Q B;  2FVQ A;  2CPH A;  2J9D E;  1X9W A;  1PCA A;  1UTA A;  2HHU A;  5BYR A;  1GTH A;  2GJ2 A;  2J9E A;  4R5P A;  4KKO A;  1FXR A;  4FKY A;  5DZ7 A;  4X66 F;  1KVK A;  2GX8 A;  1R8C A;  4DS4 A;  4A47 A;  2XS7 A;  2DR5 A;  4LF4 F;  2U1A A;  1FNM A;  2QIF A;  3HP6 A;  2J6S A;  1BD6 A;  2MZQ A;  5J1E B;  2ZIT A;  1MN7 A;  3Q89 A;  1VC5 A;  2HQI A;  3SI8 A;  4G3I A;  2VFR A;  4C7Q A;  3B4M A;  1D3W A;  3M05 A;  3RW6 A;  3NWG A;  4WFZ A;  1OYD A;  2R2U A;  1S76 D;  3GQC A;  5I3U B;  3T1Y J;  2VA2 A;  5KFV A;  1HR0 J;  3DU5 A;  2DIT A;  4H4O B;  4MAK A;  1U1L A;  4LJM A;  3DKD A;  5LXY A;  1FX2 A;  1S5Z A;  4DV2 F;  4GKJ J;  5JJB A;  1H2T Z;  2ZH1 A;  4UZB A;  2UXD J;  3PJ9 A;  4RW9 A;  3QFW A;  4JI2 J;  1RTI B;  4U9R A;  3DLE A;  4ED3 A;  1RT6 B;  2AQ4 A;  1C4A A;  2VUG A;  2WON B;  1O0P A;  3M9O B;  4MIW A;  2NSB A;  2CPF A;  1SJF A;  2CFX A;  1C0T A;  3I9V 9;  1X8D A;  3PRD A;  2MZJ A;  1KWM A;  4LF7 J;  1IKW A;  1UPM B;  3N79 A;  3K57 A;  4UUX A;  4C11 B;  2J9D A;  2W2O P;  4DDF A;  3CUL A;  2VPY B;  3JB9 k;  3CW2 C;  2DKO B;  2PMW A;  4BC9 A;  1TL1 B;  2G1H A;  1AFI A;  3MMB B;  2B7C B;  4ECS A;  2J6U A;  4J7C A;  4TQR A;  2XCP A;  2C3U A;  1NHU A;  1JIH A;  1IBL J;  4ES2 A;  5E0O A;  3NNA A;  2U2F A;  5KFA A;  3CJK A;  1LNQ A;  3QSI A;  2IDE A;  3DDN A;  2G2Z A;  3TW0 A;  4DX5 A;  4OI2 A;  5B0G A;  4ZVE A;  5J2N B;  2W7O A;  2DEI A;  3MAQ A;  2EG2 A;  3AXK A;  2FQQ B;  4ED6 A;  1L3S A;  3C6U A;  4Q43 A;  2KXN B;  3O8W A;  3SQG B;  3KJN B;  5ETS A;  2ROG A;  1R6V A;  1QE1 B;  2HHQ A;  2GQ2 A;  1RWV B;  4OZ1 A;  4B3R J;  3LA0 A;  4B3S F;  2VOP A;  1QAX A;  3MM5 B;  2NZC A;  2NSC A;  3OSN A;  2LKZ A;  4IG0 A;  2G2O A;  4KBI A;  3N6L A;  2JJ4 D;  2GVD A;  4MIB A;  3GE9 A;  5KFT A;  1NSA A;  4LR8 A;  3QO9 B;  3GV5 B;  5JMN A;  2M3D A;  1S1V B;  5KG5 A;  2MQO A;  2XNQ A;  4UOF A;  5F8J A;  3I0S B;  1X4A A;  4F0M A;  3KLE B;  3TQ1 A;  1NHV A;  1HMV B;  2E9R X;  2XGP A;  5EDW A;  3G6X A;  4Q0B B;  1WDT A;  5GAD I;  1S9E B;  2XY7 A;  1MWQ A;  4LVO P;  2MQP A;  2B5J B;  2OH2 A;  1KQF B;  5B0B A;  4YB7 A;  4DPT A;  2D3O 1;  1S9G A;  4XK8 C;  5K8O A;  5D3G B;  3GIL A;  1U47 A;  1T05 B;  2OP5 A;  1FWP A;  3H7H B;  5KT5 A;  1OIA A;  3WDO A;  2AX1 A;  3FBF A;  5GMK a;  1KN6 A;  5HRO B;  1TV6 B;  2BVZ A;  4G1Q A;  4TU8 A;  4GMK A;  2ZH7 A;  2K2P A;  3WC2 A;  2HBQ B;  4CM2 A;  1F9H A;  1Y3K A;  1VIO A;  4UZC A;  5D78 A;  1U2C A;  4CNZ A;  1CS4 A;  4ZPV R;  2RH3 A;  3JSR A;  2V50 A;  3BSC A;  2CZ9 A;  2DGS A;  3TUJ C;  2VOD A;  4I2P A;  2BKN A;  5KFU A;  5L39 A;  2LXF A;  3S01 A;  2NQP A;  4WE1 A;  2NYI A;  1Q8B A;  2LU1 A;  5CYM B;  4LF6 J;  1IWA A;  4XAK A;  4NAS A;  2V4Q A;  1S9F A;  1HYS A;  3LP1 A;  1VLY A;  1JKH B;  4PR6 A;  4HLB A;  3D6M B;  3HHL B;  1D8Y A;  4LF2 A;  1JLQ A;  2OFG X;  4DLG A;  3RBX A;  2W2Q P;  2K3I A;  1JXE A;  2HHX A;  3PYG A;  4J91 A;  4KGX B;  2OHD A;  2G0C A;  1XMO F;  4LF5 J;  3BH7 B;  4CNY A;  4CT8 A;  2R7Q A;  1RHR B;  3VZI A;  3OD2 A;  1RA6 A;  3AOB A;  1MWZ A;  2BXJ A;  4Y28 C;  1HQE A;  1PAE X;  3I55 S;  4FF4 A;  3LP2 A;  5H9E K;  3QGG A;  3RAX A;  1GEH A;  2XLJ A;  4Q8F A;  3A8I A;  3FMB A;  4YDX A;  3ZZZ A;  2W1B A;  3AA9 A;  4DR4 J;  1KQK A;  3NNH A;  3DI6 B;  3KG0 A;  2E66 A;  3I5C A;  3KUE A;  3ZTP A;  5IXU A;  3TJ8 A;  2KVI A;  5J1E A;  4N77 A;  1RGV A;  2GHW A;  3PIP Q;  2E7V A;  3UVJ A;  1RTH A;  2W9C B;  3D9B A;  1NUE A;  4URQ U;  5I3U A;  1EJ7 L;  4JI3 F;  3KDN A;  2X3G A;  3IBW A;  1XQI A;  1RWU A;  2I5J A;  4KYZ A;  4H4O A;  4GVL A;  3PW7 A;  3NKY A;  5DLF A;  3DXB A;  3CO0 P;  1DFD A;  2AYG A;  2ZOG A;  1U49 A;  3DNC A;  4O3S A;  4OX8 A;  1RTI A;  3KLI B;  4O23 A;  1FNO A;  1RT6 A;  1TL4 A;  2CPJ A;  2WON A;  4N8O A;  1C1C B;  1NH8 A;  2FTR A;  1CLF A;  4MK8 A;  3Q2T C;  1ZTW A;  4TU9 A;  2F7V A;  3HDS A;  2OEL A;  2Y9H A;  1TK8 A;  4DOZ A;  4LFC J;  4IFV B;  2FHJ D;  3MCS A;  2MEW A;  3OTD A;  2YKO A;  3DOM B;  3ZTS A;  4ID5 A;  4WXW A;  2ROP A;  1N5S A;  2ASY A;  4TY9 A;  3BBF A;  3CB4 A;  3CJ3 A;  2O3D A;  3CME S;  1FKP B;  3MI7 X;  2XMW A;  4PXD A;  4DV3 J;  5LSR A;  1G4C A;  2RDD A;  4B9N A;  5AT1 B;  4ZJQ A;  4JI0 J;  1RAO A;  2AWZ A;  4OZJ A;  3TRG A;  3P3D A;  2BJ3 A;  3DHW C;  4XDD A;  2RIL A;  1Q0N A;  2JVR A;  1YRX A;  3B54 A;  4YN3 B;  5L46 A;  3CPW R;  1UMJ A;  4AL5 A;  1V3S A;  2DRA A;  2V9K A;  2B4V A;  1YJW S;  4PWW A;  1VBK A;  5J2N A;  4DUY J;  4K4Y A;  4DL0 C;  2NZ4 A;  3X3U A;  3CGI A;  2IA0 A;  2FUG 9;  4NLT A;  2MKJ A;  3SQG A;  1QVF R;  1CJK B;  3PO5 A;  1QE1 A;  2GIF A;  1U8S A;  2V8P A;  1N5T A;  2XWX A;  3W8P A;  1RWO B;  1WF1 A;  2DXE A;  3M8R A;  3T1H F;  3MM5 A;  3K2Y A;  1SKU B;  3MDF A;  1S1T B;  1EAR A;  4ZP8 A;  1X5S A;  3PG9 A;  4X64 J;  1NK4 A;  5KFW A;  1M90 T;  3QO9 A;  3NXZ A;  2VPX B;  3KOA A;  3L7O A;  1VQ8 S;  3CCT A;  3KLE A;  2QLB B;  3PRV A;  4F4Z A;  3AB4 B;  4AFF A;  1Y5L B;  5HAN A;  1HBM A;  4Q0B A;  2HUR A;  2FZK B;  1VS3 A;  1SKW A;  1T9X A;  2MQL A;  3HSG A;  3TQE A;  2B5J A;  5C25 B;  4O4G B;  1FES A;  1KC8 T;  3OL9 A;  3D6F B;  2DNN A;  4MK9 A;  2JLE A;  4YFU A;  2V0N A;  3VAG A;  1KON A;  1VFJ A;  3CJ8 A;  1TP7 A;  1UP1 A;  4UY8 5;  5KOW A;  1FDD A;  1TV6 A;  2Z57 B;  3E51 A;  1Y7P A;  5ETK A;  2P8I A;  4GKK J;  4EUV A;  1Q95 G;  1CG2 A;  1M5V C;  2A18 A;  4F36 A;  4MMO A;  2K7K A;  2BOA A;  3OLA A;  4USH A;  1VBX A;  1XNR J;  2GZO A;  3H0P A;  2Z2M A;  2UXB F;  4EMD A;  1QD1 A;  4K4S A;  3QGP A;  4DV7 F;  2CJB A;  3CMA S;  1NDP A;  5CYM A;  3X1L B;  4WXO A;  5I3Q A;  2JVO A;  1L3K A;  2AGO A;  2R8K A;  3OL7 A;  3QZ8 A;  3HX9 A;  1VQ9 S;  2HZV A;  2WVB A;  4A8X A;  1J5O A;  2DY9 A;  4NXN J;  4P7V A;  1U4B A;  5HAT A;  4WKR A;  2F1F A;  1JKH A;  3HHL A;  3A4T A;  1PKU A;  2C2N A;  1PIE A;  3EUN A;  3HFK A;  3FSY A;  3CED A;  1SIZ A;  4DG1 B;  4AXJ A;  4OYA A;  1KLM B;  2XYG B;  4NZ6 A;  1JLA A;  4DSE A;  1NRK A;  2BV3 A;  1S1X A;  2B51 A;  1X60 A;  1F2G A;  1V5I B;  4K7Q A;  3AD8 C;  3IRX A;  4M5D B;  1FJ7 A;  2V67 A;  1K0T A;  2GO8 A;  3GYX B;  1OYE A;  3R97 A;  4C8Y A;  1A9N B;  4DR6 J;  2LQ9 A;  3J7Z T;  1T9W A;  2W2N P;  1SL1 A;  1QTM A;  3DI6 A;  4EO8 A;  1H74 A;  2MGZ B;  5D6G A;  2MB0 B;  1TKZ B;  2DNP A;  4TNO A;  2DNH A;  4DN9 A;  3IS9 B;  4NXM J;  2L9W A;  2DGT A;  2WOM B;  1YZ6 A;  4DHV A;  1RWW B;  1HWL A;  1FKO B;  1X31 C;  2UVR A;  2W9C A;  2CQI A;  1EQM A;  4ES3 A;  1LW2 B;  3IP0 A;  5HQM A;  1REV B;  1U24 A;  3CIM A;  1RWX B;  2ILY A;  4XO0 A;  3FK4 A;  5DLG A;  1UVN A;  1QVG R;  4BLG A;  1FEH A;  1Y11 A;  3FJ2 A;  2BKO A;  4ED8 A;  2J0W A;  2CQC A;  4Y2A A;  3KLI A;  4B9M A;  2J0X A;  5K5M A;  2APO A;  3BDP A;  3CDW A;  4Q2M A;  3VGU A;  4UST A;  3J7Z 5;  5A8K A;  4HHU A;  5EX3 A;  3KHH A;  2MZR A;  3KLH A;  2XI3 A;  3TAN A;  5T7L B;  1WKL A;  4IFV A;  4KGK A;  1JQG A;  4CI0 B;  3T19 A;  3DOM A;  1U6F A;  3CCM S;  1FJE B;  3GG1 A;  2M2B A;  2UU9 J;  2HW3 A;  3M8Q B;  4GC7 A;  4IO9 Q;  2COL A;  2IC3 A;  2M8D B;  1D09 B;  1VLO A;  1FKP A;  4F4Y A;  1U0S A;  1CQN A;  3KMQ A;  5K14 A;  2MKC A;  1FK9 B;  3OBI A;  4OX9 J;  2J6T A;  1RE1 B;  5IWA J;  3OHA A;  4DQP A;  4NLP A;  3D2W A;  2B3T B;  4OHZ A;  4ERD A;  4C8K A;  4M94 A;  2LU2 A;  3VAM A;  3OUY B;  2OD4 A;  1KQG B;  1KVJ A;  3T9Z A;  4LRC A;  3QZ7 A;  5KFI A;  5F8H A;  4L6V 3;  2GNK A;  2RJZ A;  1CJK A;  3V81 A;  5KTQ A;  1FEE A;  2VG7 B;  2HQC A;  5T14 A;  3DRY A;  1N88 A;  3TX0 A;  2F5G A;  3ELH A;  1S1T A;  2RQ4 A;  1RAH B;  2RIJ A;  3AJD A;  4LSL A;  3D54 A;  2IIH A;  2RE1 A;  4ZIV A;  2K3K A;  5BYS A;  2LEB A;  2M8H A;  3T1A A;  3WX4 A;  4DL7 A;  1N4L A;  4JI4 J;  1YJU A;  1R8P A;  1IN0 A;  4J9K A;  3BZQ A;  1YJ7 A;  4K4Z A;  2DD8 S;  2WVC A;  3U1M A;  2AX0 A;  4RW8 B;  3QGI A;  3JYT A;  1I94 J;  3AFG A;  1N5Q A;  1RK8 A;  2GHP A;  4B3O B;  3POT A;  2HWH A;  1U48 A;  4JYA J;  5C25 A;  4O4G A;  1UA0 A;  3K5N A;  4ZVT B;  4RW7 B;  5KFJ A;  1MN9 A;  1VIS A;  4UUW A;  2C2K B;  1SI9 A;  2MDA A;  2HG4 A;  4A8S A;  2CPE A;  2R9L A;  4IKA A;  3OTO J;  2OFH X;  4N8N A;  2CG4 A;  1LFW A;  4XIU A;  3W8G A;  3HF5 A;  4F26 A;  2HHP A;  2Z58 B;  4I4B A;  1VQ6 S;  4NLW A;  3IRW P;  1OS5 A;  4AT1 B;  5F3T A;  3SDE A;  4CCH A;  3DM2 B;  1WF2 A;  3CCU S;  3MED B;  1PYS B;  2E1C A;  3BM7 A;  1Q4R A;  1ZM2 A;  1F0X A;  2BJ1 A;  4HHH A;  3W66 A;  2DO0 A;  3OJS A;  1ZAW A;  3MTJ A;  3QT5 A;  4NMX A;  1EX8 A;  2V4J A;  4XDC A;  1IBK F;  5D77 A;  2B56 A;  3IGV A;  1X0F A;  4QYZ J;  1RIS A;  2ZBC A;  2L48 A;  3S6E A;  2NLW A;  1X4D A;  1FRX A;  3H40 A;  2YH0 A;  1EKS A;  2C42 A;  3ZTQ A;  4YQW A;  4PQA A;  2VIH A;  1NO8 A;  4IUF A;  1FVQ A;  4DG1 A;  2FVP A;  5J2Q B;  1KLM A;  2DIS A;  2VV5 A;  3A3P B;  3CD6 S;  5C24 A;  2KO1 A;  5DG7 A;  3OPK A;  4PAB A;  2WTF A;  4TKT A;  3OXG A;  1CQM A;  3PDN A;  4P6Q A;  5DRK A;  2ZKT A;  4M5D A;  1TFY A;  4NRU A;  2XBP A;  1AA1 B;  4A8Q A;  2UVW A;  2MLZ A;  2DIU A;  3T1Y F;  2VU5 A;  2YNI B;  2PII A;  1X5O A;  4AUK A;  2YKM B;  2CQB A;  1H98 A;  5IT4 A;  1HR0 F;  5HMX A;  2FHM A;  1JLE A;  4UW2 A;  2XSF A;  3DLK B;  4GKJ F;  3W7B A;  2UZA A;  4RNF A;  3EJM A;  2KN4 A;  1SQG A;  2LP4 A;  2MGZ A;  4S0M A;  2HAI A;  2KXF A;  1N48 A;  2R7R A;  1RU2 A;  1VOM A;  2UUC J;  1GNK A;  2O67 A;  4JI2 F;  4OI0 A;  4I6A A;  3IS9 A;  2XLI A;  5C5J A;  4U67 Q;  3VZH A;  3MPV A;  1XNQ F;  2ILZ A;  2BDP A;  4ICL B;  2HKE A;  1UVL A;  1KNZ A;  1SQF A;  2JSX A;  1FXL A;  3NWR A;  1LOU A;  3W9J A;  5F0U A;  2EFV A;  1LW2 A;  3KHL A;  2Z2Z A;  3GFH A;  2XMJ A;  3SCJ E;  3W62 A;  4B9S A;  3THV A;  1Z4U A;  4O3O A;  3QNW B;  2WHO A;  4B9V A;  1HNW F;  2CZ4 A;  4EBD A;  1R6Y A;  4FYX B;  2J7W A;  1MW7 A;  2LQ5 A;  5K8N A;  5ETV A;  3TYT A;  7FD1 A;  3KLV A;  3TUP A;  5KFG A;  2IYG A;  2KHD A;  3W63 A;  2HNY A;  4ILL A;  1X5T A;  2QL7 B;  1IBL F;  3IR6 B;  1N8R T;  4ZIT A;  2A1B A;  4ETX A;  3CCW A;  4G65 A;  3M7V A;  4BS2 A;  4L73 A;  1WC5 A;  2WAQ D;  2V94 A;  3G96 A;  4DFK A;  4WCE Q;  5C2G A;  3C6T B;  3M8Q A;  1U1N A;  5D4P A;  4DZD A;  5SUH A;  3LP0 B;  1M1K T;  5J1N A;  2BE7 D;  2OPR A;  1FK9 A;  2H5J B;  2EC0 A;  2WBR A;  4B3R F;  4X65 J;  3WIV A;  3P49 B;  3R1L A;  1T3O A;  2ZZN A;  3P6Y C;  1AB8 A;  2RSQ A;  3H2V E;  4H4M B;  4M5I A;  3D28 A;  5FD1 A;  3H5S A;  4F4A A;  1U1K A;  3D4J A;  3PTW A;  4Y2K A;  1HI0 P;  4P7T A;  4F8R A;  3P4U B;  1IKY A;  3MM6 B;  4K59 A;  3A13 A;  3VV2 B;  2AD9 A;  4NLG A;  4JI6 J;  3AHP A;  4QWB A;  2VG7 A;  4M5G A;  4M5J A;  3MOJ B;  2HPU A;  4HT7 A;  2GHV C;  4O3P A;  3VGV A;  2E9T A;  3UPF A;  3DGP B;  3GG0 A;  4LT6 A;  7AT1 B;  1TQL A;  3GYG A;  3U7J A;  4O0N A;  3QGH A;  3IXQ A;  1YZ7 A;  4DQQ A;  1YJT A;  4ATN A;  4RW8 A;  5HQL A;  4YB6 A;  4CM0 A;  1D9F A;  2AEF A;  1TKX B;  3MPU B;  3V6J A;  1FFS B;  4LRD A;  4B3O A;  4FKX A;  4AE5 A;  3BR9 A;  1ZM3 A;  4NA1 A;  1UJ6 A;  1NPP A;  3RR8 A;  1NK7 A;  3NP5 A;  4LRE A;  2ZWP A;  4RW7 A;  1HBN B;  1HFE L;  1EIY B;  2V2K A;  1NSQ A;  4RO0 A;  4PXC A;  4ZMM A;  2DHH A;  1DBD A;  3KJQ B;  5KFF A;  2KDO A;  1Q1K A;  2XI2 A;  1WC1 A;  3O2I A;  4LF6 F;  3MMC A;  1NAQ A;  1IQZ A;  5I4M A;  2DR7 A;  2ASL A;  3VCD A;  1HKA A;  2YKP A;  1VYA A;  1VRT A;  5LM7 E;  1TUG B;  3NGR A;  1ZS6 A;  2M70 A;  3NGS A;  2K1R B;  3MM7 B;  3MED A;  1WC6 A;  1RHK B;  5M2R A;  3LPY A;  2J7U A;  2C3P A;  2DCL A;  2ZVI A;  5DG9 A;  1PYO B;  4I7F B;  2DEJ A;  4Q5V A;  3PV8 A;  3UD4 P;  1K1Q A;  1J5E J;  2BOP A;  4Y3C A;  3PAC A;  4OHY A;  2Z2Y B;  1YG0 A;  1U45 A;  4JBC A;  1FE4 A;  3BKT A;  5KAK A;  5JUM A;  3Q8S B;  4ZVF A;  4DR4 F;  1NDC A;  4B02 A;  1HWJ A;  3DXS X;  3M4X A;  3I9Z A;  1RXO B;  2PA3 A;  2FJB B;  3GYN A;  3OTB A;  4NEY A;  4M5K A;  4JP8 A;  3DLB A;  1HNI B;  1NBE B;  3C66 A;  3F41 A;  2VQE F;  3RW7 A;  3TR5 A;  4F0H A;  3V4M A;  1DAX A;  3EPG A;  2X1A A;  2KM8 B;  5K20 B;  2V9W A;  4EBC A;  2V2V A;  5M2P A;  2BRK A;  2YNI A;  5C7P A;  1QUV A;  2YKM A;  2W2M P;  4R8U B;  1M1G A;  4ZVU B;  1RTZ A;  3RRG A;  2QO3 A;  1WG1 A;  3IWN C;  2EKY A;  4NRT A;  2AGP A;  4HDG A;  3B82 A;  3O1L A;  4WZM A;  2DH9 A;  3O6Q A;  3UQS A;  2HIY A;  2HVH A;  4OZ0 A;  2BX6 A;  3JSB A;  2MPU A;  2BAB A;  3EX7 B;  3R2D J;  3PY8 A;  2MKS A;  1YVF A;  3W5Z A;  2HBR B;  3GSD A;  1GTE A;  2IRY A;  1PAU B;  1S12 A;  4LFC F;  5ETQ A;  4YR3 A;  4DU8 A;  5KFE A;  2MZ1 A;  3GWC A;  4Y2C A;  3UWT A;  4DR1 J;  2ZE2 B;  1VQO S;  4N56 A;  1X4F A;  4ZP7 A;  4F4W A;  1LEO A;  2RUG A;  3NBP B;  3Q2S C;  1LXN A;  1N33 F;  4EO6 A;  2HFN A;  4DV3 F;  3L09 A;  1IXK A;  1JLG B;  4Q7A A;  3DOL A;  1TUW A;  3KDO A;  4UTG A;  3RAM A;  2N3O A;  2HND B;  1SC6 A;  3ICL A;  1RT4 B;  1Q79 A;  4FYW B;  3UW1 A;  1DQ8 A;  1FNX H;  4LUB A;  2FD2 A;  3BO2 A;  1P1L A;  5AXM A;  4O44 A;  2RF2 A;  3T6B A;  4QYZ K;  2NS1 B;  1RWK B;  2XMA A;  2HS0 A;  2Y1J A;  4IDK B;  3U1L A;  4ITS A;  3W64 A;  3LP0 A;  1BMQ B;  4C97 A;  2LA4 A;  5KG4 A;  2Y3Y A;  2JRS A;  4HH0 A;  4K2X A;  1ZA2 B;  6FDR A;  1OMS A;  2D9O A;  4HAC B;  3IBF B;  2CQP A;  1GAO A;  1OQ6 A;  5FLX U;  5CCM A;  3T6J A;  4KV8 A;  2AZ3 A;  2FY1 A;  1NK0 A;  4X64 F;  2Z4P A;  3EIC A;  2MKY A;  4FPR A;  1V3R A;  1ZYQ A;  4C4W A;  4FVC A;  3W5X A;  5C42 A;  1B7F A;  1K9M T;  3MM6 A;  2OGU A;  4RJV A;  3L95 X;  1DQ9 A;  2AIR B;  4KHP F;  2NCK L;  1FRL A;  1M5O C;  5E5N A;  2JX2 A;  3FZB A;  5CZX A;  2XYH B;  4A8M P;  2KYZ A;  2CJY B;  1Q81 T;  4ZVH A;  3ILO A;  4ETZ A;  3TUZ C;  1FJG F;  2HNZ B;  2GMH A;  3OVA A;  1M5K C;  1NJX A;  1FX4 A;  2VKR A;  2WZ1 A;  1SB6 A;  3M2R A;  3D0G E;  3G8T A;  1TKX A;  3DU6 A;  2KFY A;  2EFO A;  1BGX T;  4GKK F;  5CH7 B;  2XQC A;  3PHT A;  4ED2 A;  2IRU A;  2HFV A;  4OQJ A;  4EEY A;  2VFT A;  5DQG A;  2BUN A;  2YKA A;  2B4P A;  1SJQ A;  4USI A;  1NSK L;  1M5S A;  1HBN A;  2CPI A;  2WVE A;  1R43 A;  3QAT A;  1S1U B;  4YEA A;  2GML A;  2PEH A;  4M8L A;  3SCL E;  3TP2 A;  2JFD A;  1OY6 A;  4J9P A;  4MH8 A;  1TZ0 A;  2B6A B;  5KT2 A;  1TR0 A;  1VQ4 S;  4Q45 A;  4KH1 B;  4NXN F;  3FEX B;  1SJ1 A;  3JAM U;  3ETM A;  1RTD B;  3IMQ J;  3CXC R;  1MMN A;  3WIU A;  3ENV A;  3SCK E;  3MEE B;  3HT0 A;  3CT9 A;  1WTB A;  1YX2 A;  2C2E A;  4MIA A;  2MHE A;  2EXU A;  3CJS A;  2DR6 A;  4I7F A;  3BGU A;  1U6Z A;  2HBZ B;  1RZM A;  2V4R A;  5LT5 A;  2EKN A;  2JNJ A;  2ZDP A;  1CPZ A;  2QA2 A;  4ID8 A;  1LQ9 A;  1XMQ F;  4DV6 J;  3TZX A;  5HP1 B;  4DR6 F;  4RKU C;  1XTZ A;  4WFA Q;  2YBV A;  2BQR A;  1N36 F;  3HHN B;  3D66 A;  2V34 A;  3M9N B;  4PPD A;  2GQC A;  3C15 B;  3D3C J;  3LUY A;  1VHI A;  1AXQ A;  3MF5 A;  2VA3 A;  4RBT A;  2CVI A;  4NXM F;  2VFU A;  4DR7 J;  2GCF A;  1W2B R;  2NPI A;  1S6O A;  1ICE B;  3MEC B;  2XG8 A;  1YJR A;  4NLO A;  5GMD A;  1RLD A;  1CJU A;  4ELV A;  1MU2 B;  2DY1 A;  3BR8 A;  3ZZY A;  2LEP A;  4PXE A;  1U0H A;  5FJ4 A;  2AF6 A;  1QAJ A;  1RT2 B;  3MFI A;  2FJV A;  4ZPC A;  2QMW A;  2DR8 A;  1KOO A;  5HBM B;  1OSD A;  4KIA A;  5KG3 A;  2D74 B;  4RL1 A;  2HMI B;  2R8J A;  2HVZ A;  2F4V F;  4PG6 A;  2C28 A;  5G0R B;  2YWW A;  1NM2 A;  2DNM A;  3AH6 A;  5EWF A;  4A8K A;  1YSJ A;  2KJW A;  1RT7 A;  2VJU A;  5A6W A;  2GGP B;  4ZVS B;  2ZE2 A;  3MUR P;  4DZ6 A;  2KTQ A;  3HSZ A;  2UU9 F;  4I6W A;  1JLB B;  4XPE A;  1AW0 A;  2G9O A;  4BC7 A;  1S4F A;  3NBP A;  4RU2 A;  2HRY A;  3J81 U;  2UVU A;  3UCU P;  1JLG A;  4C8L A;  2UUB F;  2YXL A;  4IOC Q;  4OX9 F;  2K06 A;  5IWA F;  3T5K A;  3BDE A;  2KJV A;  4FNH A;  3D1O A;  4LMZ A;  2HND A;  1TVR B;  1RT4 A;  4QIG A;  4ZCI A;  1X4B A;  3E8O A;  1F5C A;  1N0V C;  4YUD A;  3IAS 9;  2QN6 B;  1SBR A;  2CQ0 A;  3V2U C;  4IDK A;  2POK A;  1SIW B;  5ADZ A;  1HPZ A;  2BJ9 A;  4B9L A;  1AZS B;  4DFJ A;  4A48 A;  2RS8 A;  3D6H B;  3DRP B;  4A8F A;  5L9X A;  3Q8V A;  3IWL A;  1RSC A;  1UEK A;  2MTL A;  2DNK A;  4PPZ A;  3SIP B;  1WTF A;  1N6Q B;  5HL7 Q;  2ZH4 A;  1N56 A;  4WPA A;  2BJE A;  1F9E B;  4JI4 F;  4BBY A;  3VQS A;  3NOG A;  2IM0 A;  1UWB B;  3BO3 A;  3DDI A;  1U26 A;  5LSL A;  4Z2X A;  4I0W A;  3FBB A;  1SH3 A;  4CWB A;  1DJ0 A;  1I94 F;  3IWX A;  3JXO A;  3U02 A;  1BLU A;  2V69 A;  3RUB L;  4KAI A;  2ZH2 A;  1FDA A;  4K4U A;  3PHE A;  2GO9 A;  4UOC A;  2BM1 A;  2K7J A;  1EP4 A;  3D1Q A;  4EK2 A;  3EM1 A;  2V68 A;  5EHH A;  1QJH A;  3V6D B;  3BRE A;  5SZT A;  2VDI A;  2HS3 A;  3D0H E;  1GMW A;  3OTO F;  2H5E A;  1Y5N B;  5B08 A;  3DRR B;  3DHX A;  4QIV A;  4X4T A;  3ADA C;  2R7W A;  2WBM A;  2CPY A;  3PKY A;  2XO7 A;  3DRS B;  1E6Y B;  4P2X A;  1I5O B;  3K17 A;  2YWG A;  4DLE A;  5JVG Q;  1HHQ A;  4OZ2 A;  2IDL A;  4OMF G;  3KLG A;  4J9Q A;  1N52 B;  1JLC A;  2MJU A;  3K8V A;  1UFW A;  3R2C J;  4F4X A;  1RUS A;  5D0E A;  3J80 U;  4FXD A;  2W8L A;  1NJY A;  1SC3 B;  5L38 A;  2RML A;  1U7L A;  2HHH J;  4HDH A;  3DLJ A;  1O51 A;  4PUO A;  2Y1L B;  1ARO P;  3ISZ A;  2H54 B;  3BO4 A;  4KR0 B;  2C2Z B;  2SXL A;  5A2Q U;  4I2Q B;  4NLU A;  3TZZ A;  3W9H A;  2NRE A;  4M1K A;  4F02 A;  1U1M A;  2LCW A;  2FJD B;  2YPZ A;  2LEA A;  3GJS B;  2YH1 A;  2Q6B A;  3PKM A;  5HK4 A;  5DM6 Q;  2GJI A;  4DN0 A;  1XR7 A;  1S77 D;  1Y5I B;  1P9Q C;  2AYE A;  5KG7 A;  2MKK A;  4ZP6 A;  1OQ3 A;  2KT2 A;  2P2C B;  2LEC A;  5A76 A;  4X62 J;  4QIW D;  5HJY A;  3Q24 A;  1TL3 B;  1SQE A;  5E7O B;  3QRP A;  5HSP A;  4ZVG A;  4KPC A;  5IC4 B;  4DPU A;  1HNX J;  1Q8I A;  4ECV A;  1SJ4 P;  4O3N A;  2LDY A;  2MJN A;  1F5B A;  5F9N A;  4IQX A;  3QPI A;  2BW2 A;  2D9P A;  2WRM A;  3NS6 A;  3MM8 B;  4NLX A;  2UUC F;  3C15 A;  3KLF B;  1NPK A;  2F65 A;  2YNF B;  4K2J A;  3I5B A;  3MTK A;  2BR0 A;  3ITH B;  3JTN A;  2XWY A;  5B7W A;  4DUZ J;  3CMQ A;  4QR0 A;  4LF8 F;  2ZDO A;  4DL3 A;  1I1G A;  4LIR A;  3AD9 C;  3CWJ A;  2P6S A;  1S79 A;  4HI1 A;  4HL9 A;  4G6V B;  3K0J A;  3TX8 A;  1XBW A;  2UV8 G;  5E3Q A;  4V19 J;  2W4P A;  1RT2 A;  5DO2 A;  1GMW D;  3N28 A;  4Y6I A;  3PVX A;  3UDE A;  5HBM A;  1YBU A;  2HVI A;  4ECR A;  1H6K X;  3EGN A;  2PE8 A;  3ISN D;  3OXF A;  1TK0 A;  4QU7 A;  3U27 A;  2LFV A;  2HHT A;  3ENA A;  3I32 A;  4X4V A;  5K9F A;  1CJV B;  2CPD A;  2DVI A;  5KG2 A;  2E5G A;  1RAG B;  3A3N B;  3HD2 A;  1K1S A;  4C2M A;  4CP5 A;  1Y4Z B;  2GGP A;  3QQC D;  1DAR A;  2C2R A;  1VQY A;  2MLX A;  1QTN B;  1XMB A;  2EI5 A;  2M7S A;  1R8B A;  2W4D A;  2A6O A;  2VBY A;  4ZPT R;  3P5T L;  3PFO A;  2IRX A;  1WC4 A;  5ETT A;  1RWP B;  2C2O B;  2F4F A;  2R4F A;  4H4K A;  1RT1 B;  3DDK A;  3CJT A;  4X65 F;  4MT1 A;  3QLH B;  3AT1 B;  2CNN B;  2ZJR Q;  1TVR A;  1RAE B;  5E33 A;  4HEA 9;  1Y00 A;  2QEX S;  3OTE A;  4KFB B;  4PQU A;  3W3S A;  3GIK A;  1UEV A;  2VC0 A;  4O3Q A;  3KUG A;  1RKJ A;  3KNG A;  3IBC B;  1HBU B;  4I67 A;  2GJF A;  1M5P C;  4OYZ A;  1PJ6 A;  3I82 A;  5HLF B;  3BKU A;  1DTT B;  4OI3 A;  5GAE U;  1AZS A;  5KFS A;  3TZY A;  4NYZ A;  5LSO A;  1KTQ A;  5FLX Y;  4ZS6 A;  3CD5 A;  1H7W A;  2GIR A;  3Q8Q B;  4KGM A;  1VC6 A;  1RCO B;  1N6Q A;  2HQ3 A;  1TKT B;  4WFX A;  5MAO A;  3HO1 A;  1T9V A;  1UWB A;  1Q5Y A;  1R8A A;  2HRU A;  2ATL A;  3MR7 A;  1WSR A;  4ZVQ B;  2BKP A;  2JEG A;  3KKF A;  5EX0 A;  2CQH A;  5HVG A;  2IJR A;  4CLW A;  3PW4 A;  3RU0 A;  1T7P A;  4U8V A;  4WFB Q;  1URN A;  2LMI A;  1NK5 A;  3SFG A;  4P52 A;  3OFF A;  2ZNY A;  2XS5 A;  2RVJ A;  4CO1 A;  5F8M A;  1QM9 A;  2IFX A;  1DZ5 A;  2W8K A;  2N4C A;  2LA6 A;  1IBM J;  3V6D A;  3C16 A;  3MR6 A;  4O4R A;  4PEO A;  1EHW A;  1MLA A;  2YWF A;  3DRR A;  1L3U A;  1XR5 A;  2VG6 B;  1IKX A;  3KJV A;  3DRS A;  1APS A;  1E6Y A;  3MCM A;  3NMR A;  1FO1 A;  2R7O A;  3GU0 A;  5H9F J;  5KG0 A;  1X7V A;  3QT6 A;  4USU A;  4AXI A;  1HQ2 A;  3MCO A;  4KJI A;  5BR8 F;  4KT0 C;  3M2U B;  2VBZ A;  3H5X A;  3ONQ A;  3A1Y G;  3R3T A;  3BQ2 A;  3KMS A;  3BGO P;  4FF1 A;  3JAM Y;  1FI4 A;  2NXN A;  1XIQ A;  1SCJ B;  3LAK A;  4YB5 A;  4QW9 A;  3E01 B;  3H90 A;  1R27 B;  2B0G A;  1N54 B;  2XCA A;  4RNN A;  2I1R A;  3QJP A;  1T94 A;  2O1P A;  2I2Y A;  3THP A;  3G82 A;  1ZM4 A;  1RAC B;  2NUH A;  3EGW B;  3UI3 A;  3EGZ A;  5MLC V;  2A2C A;  4OV1 A;  4ZJO A;  3R5C A;  1MRO B;  3OL6 A;  3EE3 A;  4MKV A;  4B3S J;  1KHV A;  3RTV A;  2FGO A;  4N76 A;  4BCA A;  1VIX A;  2JZ5 A;  2W7P A;  3LOU A;  2JWN A;  1XEZ A;  2KFZ A;  5J2P B;  3PCO B;  4RNH A;  3GFZ A;  1NHK L;  2VJV A;  2ZHB A;  1T9T A;  4EZ6 A;  4KSE B;  3BS9 A;  3QMQ A;  2Y8Y A;  1S6U A;  2HVD A;  2ACY A;  3HFZ B;  1VI7 A;  3MM8 A;  3AXM A;  2H5I B;  3M8Z A;  3KYL A;  1NKE A;  3KLF A;  4J9S A;  3AQO A;  1PC5 A;  3QYY A;  1ELO A;  2VAS A;  3Q8Y A;  4OI6 A;  4JV5 F;  4B9U A;  3PR5 B;  3M9M B;  3DMJ B;  4RU9 A;  4WBF A;  5FDL A;  3N9U C;  2MQ8 A;  1ULR A;  2E1R A;  2LQJ A;  2ZH8 A;  1IVZ A;  3BN4 A;  4WII A;  1UW9 A;  5HN0 A;  4DR1 F;  3OR2 B;  3EPI A;  5CXT A;  2O01 C;  3GII A;  2XO6 A;  2HS4 A;  3G8Q A;  1OY9 A;  3M30 B;  3BPD A;  1GMU A;  4ECZ A;  1S7H A;  3RG6 A;  4JI8 J;  1VRQ C;  1ZBT A;  3KK2 B;  2VPW B;  3P8B B;  4XPC A;  5FII A;  2OPQ B;  2A0F B;  4P10 A;  1VQS A;  1W25 A;  1XK8 A;  2CYY A;  2QFI A;  4ZHR A;  2HLU A;  5GAE I;  1K73 T;  4NLR A;  4E0D A;  4G1I A;  3R1H A;  2F40 A;  3L7U A;  3M6X A;  2YKN B;  3G9C A;  4EU0 A;  2DHX A;  3KG4 A;  3J81 Y;  3NS5 A;  1WOR A;  1TU0 B;  1DHM A;  3C14 A;  2NPF A;  5AJ3 F;  2E29 A;  3OLB A;  2YNG B;  3RBE A;  2JEJ A;  3H25 A;  1UVM A;  2HYI B;  1RT1 A;  4MKA A;  4F0K A;  1ZH5 A;  1FKA F;  1VRU B;  3N5B A;  1XMO J;  1YRU A;  3QLH A;  3ZFV A;  4B9T A;  2RRB A;  4YME A;  4DUT A;  4WK1 A;  4KFB A;  4M5N A;  5HJX A;  2N4D A;  2N82 B;  2XLK A;  2B4O A;  4CZC A;  1HBU A;  1EQ0 A;  2RU9 A;  2EK1 A;  3B78 A;  2O66 A;  1HNV B;  3M8Y A;  3DCA A;  4C8Z A;  5HLF A;  2KFN A;  1DTT A;  4YP3 A;  1P9Y A;  2BEF A;  3NEK A;  3QJL A;  2HIQ A;  3FKB A;  4LQ9 A;  1U02 A;  3T5L A;  4CLT A;  1Q7Y T;  4QOT A;  2DJW A;  2I0X A;  1N5V A;  3K58 A;  2KKH A;  4LBP A;  1N5Y A;  3HI9 A;  3V4I B;  2GAG C;  2IPO B;  3T5J A;  2FLL A;  1TKT A;  4NLV A;  4QPX A;  1RT5 B;  6AT1 B;  1JJH A;  3N5F A;  4LFA F;  2QSW A;  1GQE A;  1BWV A;  4NCA A;  3NMA A;  1RBA A;  3GPA A;  2WW8 A;  1B3T A;  4C0O C;  4J9L A;  2GC8 A;  4K4X A;  1QSL A;  4L76 A;  2HLT A;  1R0C B;  2G0J A;  5DQH A;  4CO4 A;  1VQ5 S;  2Z0G A;  4C3L A;  2KXH A;  4P9S A;  4WFY A;  1BHN A;  3G8S A;  3EVW A;  3NOC A;  2ADB A;  1QSS A;  1S6Q A;  1KOH A;  1CC8 A;  3H5U A;  1V6H A;  4C48 A;  2VG6 A;  3OTC A;  1J27 A;  4DL6 A;  1DRZ A;  4ZVP B;  4QYR A;  5IFM A;  3D68 A;  1T11 A;  3PEJ A;  3CCR S;  1F60 B;  2E1P A;  2HHV A;  4RBU A;  1KVI A;  4U7U K;  2B9X A;  2DK2 A;  3J80 Y;  3F44 A;  2LXI A;  4OHV A;  4EGL A;  3KTQ A;  3GMG A;  3C19 A;  1URR A;  1YGY A;  2LQ8 A;  2VB6 A;  5F3Z A;  2DHS A;  2PA8 D;  4OLO A;  2MQQ A;  3M2U A;  2HZA A;  2PSZ A;  2HHW A;  3WZ0 A;  3LAN A;  5EUH A;  1PO6 A;  3RZA A;  5D15 A;  5A2Q Y;  4FF3 A;  3GCW P;  2QTW A;  3ENQ A;  2AHO B;  5A0Y B;  4WP3 A;  1D0E A;  4LR9 A;  2G1D A;  2KH9 A;  1ZAV A;  5H1S V;  2OO4 A;  3BGL A;  3I0R B;  2UXC F;  1BQM B;  4NLY A;  4ZLN A;  2GMJ A;  2BZ2 A;  2CNL B;  3GCX P;  2EBE A;  2FDN A;  3MAA B;  1N34 F;  2QYG A;  4RUH A;  3TAM B;  4DR7 F;  4AQY F;  1WD6 A;  3TVK A;  1FFW B;  3M8P B;  3SSS A;  2HAF A;  3QFH A;  2GIQ A;  2C2D A;  1S48 A;  4C11 A;  2XB2 D;  2ZBI A;  1S0N A;  2ZKU A;  5J2P A;  4ZIW A;  3H2L A;  5D0G A;  1FRI A;  3NY0 A;  5CYQ B;  3UDV A;  1R0A B;  3T3F A;  1IBC B;  1TL1 A;  2J9C A;  3MMB A;  1GT8 A;  1KS2 A;  5CAA A;  5A8W B;  4L75 A;  4TYB A;  4FBU A;  5DGB A;  4NML A;  3D6T B;  2ZZT A;  3D0I E;  2GAH C;  4YY3 J;  4A8Y A;  1KFS A;  1Q82 T;  1WG4 A;  2E5L J;  3DMJ A;  4RW4 B;  1F2H A;  2OEJ A;  4C98 A;  3FNN A;  2QV6 A;  1Q7L B;  1PJ5 A;  4FPI A;  3MGJ A;  2X51 A;  3QT8 A;  2PMH A;  4NCB A;  2OML A;  1FFG B;  2QC3 A;  4B3M J;  4DSL A;  5L9N A;  2F8H A;  3OT9 A;  2EWH A;  3H42 A;  1QLN A;  5IV4 A;  3TOQ A;  1Q53 A;  1FE0 A;  2VQF J;  4MYT A;  4MYU A;  5H9F K;  3W65 A;  2FJA B;  3KK2 A;  2OPQ A;  2WVD A;  3FRY A;  2EK6 A;  2P9G A;  4ECQ A;  3UR0 A;  3CCL S;  3H59 A;  3HZE A;  1CJT B;  1NJI T;  3NCP A;  4HTI A;  3BSN A;  2UXB J;  2L9N A;  2DNR A;  1VK8 A;  2LLZ A;  4BWJ A;  1DTQ B;  4A8W A;  4DV7 J;  4K4T A;  1U1P A;  2YKN A;  4QWA A;  2BYC A;  4RX6 A;  1S1V A;  2QSF A;  1I6J A;  2EC2 A;  3I0S A;  5ETO A;  1D9D A;  1WAC A;  1G1X A;  1Q16 B;  1HMV A;  2V63 A;  1HD0 A;  3DN9 A;  3GIR A;  1YWX A;  2YNG A;  2VOO A;  1S9E A;  3FEZ A;  1KP6 A;  4CLS A;  1VRU A;  4PYD A;  2AGQ A;  4ED5 A;  4NE9 C;  4B08 A;  5D3G A;  1T05 A;  2XZW A;  1U8W A;  2MMY A;  2RUS A;  4ZCK A;  1R0B G;  2IM2 A;  5HRO A;  5HVH A;  5ITH A;  2CQ3 A;  1WEX A;  2JOQ A;  1HNV A;  3R6L B;  2CDR B;  1I51 B;  4W90 B;  3C2P A;  2CJQ A;  1GXU A;  3QIP B;  3SQO P;  2IY5 B;  4BWM A;  3BB5 A;  1TAQ A;  3WC0 A;  3V4I A;  2ZBR A;  3DLE B;  1HWK A;  4ZLJ A;  4OYB A;  3ISN C;  3CNQ P;  2XHC A;  4L3N A;  4FVM A;  1HI1 A;  1F5A A;  1H2U X;  3SZ2 A;  4USM A;  1RT5 A;  3CVK A;  1C0T B;  4LFB F;  3Q0A A;  1FD2 A;  1IKW B;  3MMA B;  2YNH B;  4CH1 A;  4Y2I A;  3AA8 A;  5KT4 A;  2KG1 A;  2IM1 A;  3N0V A;  9RUB A;  4PAA A;  1Y10 A;  1K8A T;  3W60 A;  2WSC C;  3K5O A;  2VG5 B;  4ED4 A;  4N47 A;  3M32 B;  2AJ4 A;  4QWC A;  3HVW A;  1EB0 A;  3D7S B;  1X9M A;  3IG1 B;  3IR7 B;  1S99 A;  4GRS A;  4PWU A;  1ZZN A;  3GP9 A;  4P74 A;  5AE2 A;  4RLE A;  3L9Z A;  9ATC B;  2KG0 A;  2R42 A;  3BEG B;  4F3Q A;  3CDB A;  4J5O A;  2RHS B;  2HHH F;  1RAA B;  3KNA A;  4ZCM A;  2OLW A;  3UNG C;  3MUM P;  3ILI A;  5ETL A;  3P45 B;  1WOP A;  2LXU A;  1QY7 A;  1NKB A;  4CLU A;  1HD1 A;  1VQ7 S;  2HWT A;  4F3M A;  4L72 B;  4Y65 A;  1B64 A;  4A4J A;  3DC2 A;  3HHD A;  4DX8 H;  4FS2 A;  2OI2 A;  4NCG B;  2AW0 A;  3BQ0 A;  3PR4 A;  3I87 A;  5F8G A;  4X62 F;  2DGW A;  2ALY B;  2WK4 A;  3UD5 A;  3L7P A;  1ZTT A;  4OJ1 A;  4P72 A;  4IG0 B;  5D4N A;  1FA0 A;  3F56 A;  4X84 A;  2V2Q A;  4QR1 A;  1VBZ A;  3JTP A;  4FZV A;  1JK9 B;  3FSX A;  1HNX F;  1NU4 A;  5IT9 U;  5A0Y A;  1UPP A;  1Q8L A;  1BC6 A;  4USW A;  1K44 A;  3I0R A;  1BQM A;  3EWG A;  1S0M A;  5DS7 A;  4ED1 A;  2PEB A;  5L1K A;  3IGN A;  3J7A N;  3MR5 A;  2PT0 A;  1JJC B;  3F73 A;  4KGV B;  3MAA A;  5BJR A;  3J81 j;  4TY8 B;  1IM4 A;  2WCX A;  4PCQ A;  3TAM A;  1C1C A;  3AOA A;  5CD4 H;  2ABY A;  1WEZ A;  3N6N A;  4P2M A;  4RW6 B;  4IR1 A;  3M8P A;  3F0N A;  1S9G B;  4DUZ F;  3FCH A;  5RUB A;  5LMU J;  5IM0 B;  2MQN A;  2XC9 A;  4D3H A;  1MSW D;  1REG X;  4IRC A;  2FLO A;  5AE3 A;  3FGV A;  3I4H X;  5LOQ A;  5CYQ A;  1R0A A;  3LAL A;  4G1Q B;  7FDR A;  3B6B A;  2DRD A;  2FVC A;  4I64 A;  3W9I A;  1CS4 B;  2RRN A;  4NYO A;  2AU0 A;  4CH7 A;  4RWW A;  3HVR A;  3HHL D;  5U47 A;  1RHJ B;  4E2F B;  4RW4 A;  2ZWO A;  1YTY A;  3UD3 P;  2RAQ A;  4I2P B;  1NJZ A;  3ZTO A;  3MZI A;  2FPH X;  2M4M A;  3OHB A;  4DBQ A;  1SJ3 P;  4YDD B;  2MY7 A;  2Q79 A;  3SFU A;  2JC1 A;  4ZLL A;  3GZ7 A;  1UAW A;  3K7R A;  3HT3 A;  1S7I A;  1NND A;  1HYS B;  2MQM A;  4OJ3 A;  4DV1 F;  3M8S A;  4ED0 A;  4LF9 J;  4OV6 A;  1JNR B;  3FQL A;  3L3C A;  5IOL A;  5HMZ A;  3NGD A;  4B3T J;  4L74 A;  5HMW A;  4CLF A;  2R2T A;  1CJT A;  5DDO C;  1Y3J A;  4LRF A;  1HQE B;  4GVB B;  2XZD B;  1DTQ A;  1IBK J;  3LP2 B;  2O5D A;  1UZD A;  3QJJ A;  4WIQ A;  3BGR B;  3ZXW A;  4P73 A;  5E3R A;  2QLX A;  1FWL A;  2YX1 A;  4Y00 A;  2UVV A;  2XMT A;  1NH7 A;  4K8R A;  4ZVR B;  1OPI A;  2DIV A;  2R7U A;  3NCR A;  4R25 A;  3ZZP A;  4CO5 A;  2Q43 A;  2RKI B;  3U1N A;  2EEY A;  4FDF A;  1FD8 A;  3ULH A;  3UVJ B;  1RTH B;  4ECX A;  2UUA J;  4JUZ A;  4O3R A;  5A6P A;  1CUL B;  4CH0 S;  1T9Y A;  2I5J B;  4EYH B;  2JC0 A;  2DH7 A;  1YJV A;  2ZH9 A;  1Z1Z A;  3QIP A;  3S8S A;  3R6G B;  3PRB A;  5BXI A;  1B0P A;  1AUD A;  3TAQ A;  2ZNZ A;  4PYA A;  1SUQ B;  2CPX A;  1XNQ J;  4HYK A;  2J0S D;  3KWM A;  2VBX A;  3BH6 B;  3M6V A;  4ENO A;  1IBM F;  2R7X A;  3PX0 A;  1KEK A;  2XY6 A;  3MMA A;  2YNH A;  5IZH A;  1RAD B;  1R89 A;  3GB0 A;  4ANC A;  1HHT P;  1WF0 A;  4ID5 B;  3K5P A;  2VG5 A;  2B9E A;  3K5M A;  3HKW A;  3M32 A;  3VHQ A;  1HNW J;  2F8E X;  1NJW A;  3IG1 A;  2L41 A;  3K5L A;  4NLD A;  5A8R B;  5I42 B;  2W24 A;  4USV A;  2G2Y A;  2DO4 A;  4M5H A;  2G0I A;  2BW7 A;  2PDA A;  3UE2 A;  4ALZ A;  3VWS A;  2FYX A;  5EN1 A;  1HW8 A;  1X4H A;  2V8D A;  5L1L A;  2W2P P;  2FB0 A;  4MTP A;  1EET B;  1LWC B;  2KZZ A;  1ACM B;  2QA4 G;  1HQU B;  2HFU A;  1T8E A;  4DR3 J;  3HVT B;  1L5U A;  4LRA A;  1KD1 T;  3H4B A;  1NCL A;  1RI7 A;  3CUN A;  5L1J A;  1TKZ A;  4ES1 A;  4DSJ A;  1TTH B;  2UXD F;  4MFB B;  1YQH A;  4DF4 A;  4CLP A;  2WOM A;  4NCG A;  1TFW A;  4U95 A;  2PO4 A;  2V8H A;  3E3X A;  2R3V A;  3KK1 B;  2QE5 A;  1XER A;  2M5Y A;  4KHR A;  3DFE A;  1FKO A;  3C8Y A;  4UT4 A;  4WTO B;  4LF7 F;  3R27 A;  5LMN J;  5GAG U;  4W4M A;  1REV A;  3ZO7 A;  3HSD A;  4QBU A;  1X4C A;  1SVD A;  2OSQ A;  5GME A;  4QWD A;  3CSK A;  4DWI A;  8RUC A;  4HKQ A;  2CJA A;  1HBM B;  3CF5 Q;  2VKZ G;  2WB4 A;  1UZH A;  4TY8 A;  3CE8 A;  3BQ1 A;  2PFD A;  3FSI A;  4RW6 A;  4ZDN A;  3RGI A;  1S72 S;  3RAQ A;  3MCN A;  3B4D A;  1ZAX A;  3CCZ A;  3R5B A;  4F4K A;  1U09 A;  5T7L A;  3PYE A;  3OQ2 A;  5IM0 A;  1WHV A;  5L8R C;  1IJF B;  4YS2 A;  4NPO A;  1G7C B;  4EZ9 A;  2ZEJ A;  2F8M A;  3WX8 A;  4X4N A;  3QWU A;  2QJ3 A;  4Z37 A;  5AXN A;  3G6E S;  4QQB A;  2NR0 A;  2X7I A;  1MNE A;  1S57 A;  2YKQ A;  4JI8 F;  3VAJ A;  2Q6C A;  4I56 A;  2ERR A;  2EW9 A;  3RRK A;  4KC5 A;  2FHJ A;  2D69 A;  4IRK A;  2IM3 A;  3QID A;  4KGZ B;  3MUT P;  4WP9 A;  3R7N B;  3AQP A;  3HKZ D;  1P8G A;  1NK8 A;  2B9Y A;  1C2P A;  4TXS A;  1LK7 A;  3OUY A;  4M5L A;  4CT9 A;  1NZ8 A;  2HVE A;  1X5P A;  1WHX A;  4WKY A;  4AL7 A;  4YR2 A;  5B09 A;  3R7S B;  2PN6 A;  1J5O B;  3H2U B;  2D3Z A;  3V6K A;  5B0F A;  1T0T V;  1NSP A;  3R5D A;  4RUA A;  4N5S A;  5IQQ A;  4JI5 J;  1EAY C;  2NXU A;  3KFW X;  4HHJ A;  4ZN1 A;  1FRM A;  3GIJ A;  2E44 A;  1JLA B;  2JDJ A;  2BE9 B;  1S1X B;  2M88 A;  1JX4 A;  3W2W B;  4QPT A;  2IBK A;  4ER8 A;  2AT1 B;  2MLY A;  4GVB A;  3VTI A;  2MXY A;  3IRX B;  4WWS A;  3PIO Q;  4ECT A;  3VVT A;  3SEO A;  2ZHO A;  3BGR A;  4HT5 A;  2QYC A;  5D4O A;  4PG7 A;  2FJX A;  4GO5 X;  2BQ3 A;  2D3U A;  5G4D A;  1X4E A;  5AXL A;  2ZVS A;  2KT5 A;  4N7T A;  2ZHA A;  3VGS A;  4V19 X;  5KFM A;  5KFP A;  2QLJ B;  2OEK A;  2C22 A;  2RQK A;  3MXH P;  2VQE J;  1GMV A;  2RKI A;  2IHR 1;  3GV7 B;  3MM9 B;  4AND A;  1IR2 A;  1F9F A;  2R7T A;  3MR2 A;  3W5Y A;  1VGY A;  4OX7 A;  1CUL A;  3GFX A;  1OPZ A;  1UVJ A;  4DQS A;  5KFN A;  1TKD A;  3B8H A;  4OYP A;  4C0B A;  2MZT A;  2IBO A;  3R9L A;  2AEJ A;  4Z7Y A;  3LWM A;  3NAI A;  3DM2 A;  1FCA A;  1W2I A;  2FVR A;  4DR2 J;  1O6X A;  4ZPW R;  3FCV A;  4Q8E A;  4LF5 F;  2J8S A;  5HMY A;  3CDU A;  1LWE B;  3ZZ0 A;  5KFX A;  1SUQ A;  3GJR B;  4LRB A;  2ACM A;  3IC1 A;  1SC4 B;  5CHC B;  5A8K B;  3LWL A;  3BYP A;  2ALZ A;  1ITP A;  1S10 A;  3CJ2 A;  3KLH B;  4NOH A;  4U6P A;  1WKJ A;  3EYZ A;  4HVZ A;  5F8I A;  4DPW A;  4J37 A;  4FP9 A;  3CD0 A;  4ZCL A;  5J2Q A;  4DSI A;  3OR1 B;  2EFN A;  2IC3 B;  5AXK A;  5KFC A;  5GAG I;  1N33 J;  2DNG A;  4K0K J;  5A8R A;  1LWF B;  5I42 A;  5C2C A;  5LXR A;  5K14 B;  1YJN S;  2V5H G;  2KRB A;  1YJ9 S;  4WP8 A;  2ZM6 J;  1HW9 A;  5D0H A;  1SL2 A;  2Y0S D;  5E3P A;  2IMO A;  2P6T A;  4DR5 J;  1KKH A;  3RBZ A;  2DGV A;  2OIH A;  1F1B B;  1EET A;  1LWC A;  3CD7 A;  1QAI A;  2DPJ A;  3ZTR A;  1DLO B;  3Q86 A;  1HQU A;  4FS1 A;  3HVT A;  2BM0 A;  3DLK A;  4C8N A;  1NDK A;  4DCP B;  3G6Y A;  2CG8 A;  3AJ1 A;  3S7R A;  3SCI E;  3V81 B;  5KG6 A;  3NL0 A;  4M5M A;  4MFB A;  4UY8 T;  4L3K A;  1WUU A;  1WWH A;  4QCL A;  4ICL A;  2V6A A;  2YQ1 A;  3CJ5 A;  3KK1 A;  4IO1 A;  4NX9 A;  3MD1 A;  2XYP B;  5IT9 Y;  1KHW A;  5CZV A;  4WF9 Q;  4LSL B;  3NRB A;  4J9M A;  1YIT S;  1G3O A;  1QUP A;  3EXC X;  1LXJ A;  2BAN B;  2ZBQ A;  1SV5 B;  3SSQ A;  1YLX A;  3MEG B;  2CQG A;  2AJF E;  3HXM A;  3HSJ A;  8ATC B;  4X4R A;  3MHY A;  3QRQ A;  1RHU B;  4DQI A;  4X4O A;  4K5S A;  3JYT B;  3PZP A;  2ZBP A;  4QZV B;  3ILJ A;  1X4G A;  4KHP J;  2MYF A;  2BQU A;  4URS A;  2JLF A;  2GVZ B;  3MPW A;  3RB4 A;  3NLC A;  3POT B;  4DU7 A;  4JI0 F;  4YY3 F;  8AT1 B;  2LDI A;  2W25 A;  2E5L F;  2P9E A;  3V5R A;  2I38 A;  2R7V A;  1JMT A;  1M1H A;  4NI2 B;  1RYR A;  1BUX A;  2HQG A;  2DGQ A;  2R8H A;  2JHE A;  2BE2 B;  1X9S A;  4OI4 A;  1FJG J;  1PBU A;  3JTO A;  1G6B A;  2RS2 A;  5AE1 A;  4FYV B;  3C6T A;  4B3M F;  4DUY F;  4Z7C A;  1D9A A;  2VC1 A;  4ECU A;  3RJM B;  1XR6 A;  2VQF F;  2LYV A;  1NPR A;  3C46 A;  4EYI B;  3SDE B;  2MKH A;  1JLF B;  4A46 A;  5K8P A;  1PIL A;  3HVA A;  4RPF A;  4FYD A;  4NL5 A;  4H54 A;  5J2M B;  4EI2 A;  4NEZ A;  2PGC A;  2Z30 B;  4P75 A;  2E5J A;  4H4M A;  4IG3 B;  4FXV A;  2V4J B;  1MMD A;  2AJ1 A;  3GJQ B;  2HFO A;  1RAB B;  1RT3 B;  1RHM B;  5DDR C;  4QIE A;  1L3V A;  4O0I A;  2EG1 A;  3LPE A;  3BF4 A;  2YX4 A;  4OYM A;  3Q22 A;  4TVA B;  3TJ9 A;  3QWP A;  3P96 A;  1VQK S;  2X3D A;  2R2R A;  1HL6 A;  3KK3 B;  5HVF A;  4FF2 A;  5C24 B;  3DGP A;  2G13 A;  5DG8 A;  3MPD A;  3W2W A;  2VBW A;  2FC9 A;  4JI1 J;  1FRJ A;  4P2S A;  3FFI B;  4ILR A;  4E98 A;  1VHF A;  4IYQ A;  3FC9 A;  1WJ9 A;  1XMQ J;  3FMW A;  1GFW B;  4I68 A;  4USK A;  3PNI A;  4MJK A;  3FUY A;  3VGT A;  1JLE B;  2PMZ D;  1C0U B;  4PG8 A;  1N36 J;  4DV0 J;  3DYA B;  4ZA1 A;  1GXT A;  2HWI A;  1XWL A;  1XNR F;  3N4W A;  3OFH A;  4F04 B;  2RQC A;  4RNM A;  2PI4 A;  3MM9 A;  5F41 A;  1VMB A;  3HHL C;  3W61 A;  1MWY A;  2XNR A;  3D67 A;  2A2D A;  2QMU B;  1YBT A;  3VQT A;  3HK2 A;  5CD4 A;  3MUV P;  2I8E A;  3PX6 A;  2CA9 A;  3K8W A;  2A10 A;  5CAB A;  5KFQ A;  3HHE A;  4M95 A;  1D1U A;  1C1B B;  3FCW A;  1FTR A;  2KZM A;  2GS8 A;  2K1R A;  3MM7 A;  4CQ1 A;  4OFZ A;  5KFR A;  1KSP A;  4DF8 A;  4LBI A;  1LWE A;  4LIW A;  4P2F A;  3FBE A;  2HNY B;  2F4V J;  4ZJL A;  4OYW A;  1FT8 A;  2IJN A;  1FHT A;  2PC6 A;  2QZ8 A;  3KJF B;  3AAW B;  1X0P A;  4NZ7 A;  3R5G A;  2H48 B;  2ZZM A;  2N3L A;  3OR1 A;  1Y0H A;  1RJJ A;  2KL8 A;  4BHQ A;  3SMZ A;  1LWF A;  3IM9 A;  5DJB A;  2OPR B;  1HNI A;  2UUB J;  4DFP A;  5IQ6 A;  5KG1 A;  5F0W A;  1UJ4 A;  3PX4 A;  4FN5 A;  1HI8 A;  5CQG A;  3M6W A;  4DPY A;  3JQK A;  3UN5 A;  3QT7 A;  5T41 A;  3ETO A;  3RB0 A;  4HR2 A;  2B4U A;  5D4L A;  1OWX A;  4MK7 A;  4R8U A;  2OKQ A;  5JXS A;  5CCL A;  1DLO A;  3GV8 B;  4KRW A;  1UCN A;  1IKY B;  2YPY A;  3ZC4 A;  4RNO A;  5THW A;  2VPZ B;  5GAH U;  5ETR A;  3Q8R B;  4YR0 A;  2XMK A;  4JI7 J;  5KFH A;  3LAM A;  4LSN B;  4TYA A;  4Y2M A;  2ZJQ Q;  1RHQ B;  2WVF A;  2M9K A;  1SC1 B;  1N32 J;  4AYB D;  1M5H A;  5LMU F;  1ZM9 A;  2BAN A;  1SV5 A;  2Z56 B;  4OL8 A;  4OYO A;  2D41 A;  2B8P A;  3MEG A;  4IOA Q;  2XUL A;  3CJR A;  2HQD A;  2WSE C;  3O5T B;  2ADC A;  4CO2 A;  1PGZ A;  4YHH J;  2CNK B;  2QLW A;  2VZ9 A;  2GVZ A;  1A0O B;  2ZUA A;  3OFE A;  4DV5 J;  3AOD A;  4JV2 A;  3LGM A;  4PKD B;  3R5J B;  4C6A A;  4K4V A;  3NGT A;  3BBB A;  1RAJ A;  5ETP A;  3EZ5 A;  2Y1I A;  2CKW A;  1Z2Z A;  1RBL A;  4WK3 A;  3SYZ A;  4NI2 A;  4G1P A;  2BE2 A;  2DXD A;  5KFL A;  3BPS P;  2AJQ A;  3RBD A;  4YB1 P;  4E8U A;  3MMC B;  2OTL S;  4CDI A;  4MKB A;  2DHG A;  1TK5 A;  2ROE A;  1VRT B;  5D0R A;  3KUH A;  1CVJ A;  2QA4 S;  4ZKA A;  4LF9 F;  4X4Q A;  1JLF A;  2FJW A;  1BXN A;  2GV1 A;  2C3Y A;  4RUC A;  1HNZ J;  4HAC A;  1KRP A;  4RZR A;  2XS2 A;  4B3T F;  5J2M A;  3A12 A;  3D5M A;  1DUR A;  1FWK A;  5CYJ A;  2MST A;  2CDQ A;  4IG3 A;  2RU3 A;  4CLK A;  5E41 A;  2B43 A;  4DV4 J;  3DOK B;  1NME B;  1PJ7 A;  5KT3 A;  1SJR A;  4DMZ A;  3LW5 C;  3IR5 B;  3VVU A;  2ZUG A;  1RT3 A;  2CXE A;  1P27 B;  3NGU A;  4F7V A;  3GIM A;  2JLG A;  3PXG a;  1JXV A;  3G6V A;  2RB7 A;  1P6T A;  1WOS A;  5DET A;  4IR9 A;  3FZ2 A;  4ZLP A;  3OFG A;  2ASD A;  3BBC A;  3PYF A;  3TVZ A;  1E6V B;  1QAY A;  4TQS A;  4WU2 A;  4JYA F;  3KK3 A;  2C1E B;  4OLP A;  2R8G A;  2C3O A;  2MSS A;  4QIF A;  4F67 A;  1QSY A;  1NB7 A;  3BJY A;  2BAC A;  2L08 A;  3J7Y U;  1LKZ A;  3FFI A;  2CAJ A;  3GR1 A;  2HNZ A;  2OTJ S;  3CDE A;  2OUG A;  2DR9 A;  4X2B A;  3TAR A;  1SKR A;  1B70 B;  4IRD A;  4WJB A;  2W7A A;  2DNQ A;  3GTY X;  2UUA F;  3V6H A;  3PJW A;  3EVM A;  3P5B P;  2V8G A;  4KH0 B;  4W98 A;  3ZZT A;  1Y9O A;  2QX0 A;  1C0U A;  4DFM A;  3DYA A;  3WBZ A;  2AKW B;  2B9W A;  1OY8 A;  1CBK A;  2IVY A;  2VON A;  1FXD A;  4NLQ A;  2D3O R;  1NK9 A;  3CIZ A;  2KT3 A;  1S1U A;  3JSY A;  2J7K A;  3HJV A;  2YTC A;  3PO4 A;  3KXD A;  1S59 A;  3UFC X;  2B6A A;  4LF8 J;  4ANE A;  4ZK7 M;  2EFG A;  1WEL A;  4OIX A;  1SH0 A;  3QBC A;  2UP1 A;  1C1B A;  1RTD A;  1I3O B;  3UCZ P;  3R8Y A;  1RDR A;  3MEE A;  3JQJ A;  4QJV A;  1MML A;  3DOL B;  4LF1 A;  4ZPA A;  2HSE B;  2DXF A;  4LR7 A;  5GAH I;  1TL7 B;  2ZOF A;  1VC0 A;  1OJ4 A;  2FHO B;  1UVI A;  1S6P B;  1F3V A;  4O44 B;  2BRL A;  2RF2 B;  3TI0 A;  5HP1 A;  2PD1 A;  4J9R A;  5LL6 d;  1IR1 A;  4DR3 F;  4I1T A;  2VL1 A;  4YOE A;  3PFE A;  1WG5 A;  2CWK A;  3IM8 A;  4ZOS A;  2RHQ B;  2Q3P A;  4ZPD A;  3NS7 B;  3W2V B;  3DLH A;  2FHK A;  3JQM A;  2J8A A;  1VQL S;  4NA3 A;  3LH2 S;  4QWE A;  2CUY A;  3BSO A;  1RQ0 A;  1S4E A;  3CJ0 A;  3I5A A;  3MEC A;  1RA7 A;  2Q66 A;  4KV8 B;  5LMN F;  1MU2 A;  1O8B A;  3TVY A;  4CTA B;  5C42 B;  3CCJ S;  2XMV A;  5I3P A;  4DI6 A;  5M2U A;  2IMW P;  4U8Y A;  1M0S A;  1WHY A;  2VDH A;  3NNC A;  1WI6 A;  5LJ3 Y;  1RU1 A;  3HLU A;  3G86 A;  2E7W A;  1UFL A;  2HMI A;  4LSN A;  2DNL A;  4CYU B;  1F6T A;  5G0R A;  1YHQ S;  4J9N A;  1UFK A;  4DCJ B;  3QRR A;  3UCG A;  4FBT A;  4BDP A;  1R31 A;  2YWH A;  5JVH Q;  1KDN A;  1LFP A;  5KFB A;  2KB2 A;  4LBH A;  4IH6 A;  1S1W B;  1JXL A;  2M52 A;  1JLB A;  3M2R B;  2FGC A;  2J5A A;  3HZG A;  3SBM A;  1YDL A;  5HQ8 A;  1G2E A;  2AYM A;  2E5I A;  2CQ4 A;  4OJH A;  2XHW A;  2RQM A;  1OSC A;  3HD1 A;  2VFS A;  3JS9 A;  4V1A k;  2IJF A;  2OAU A;  1VQN S;  5HI7 A;  2OJ3 A;  1GH8 A;  5F8L A;  2DT9 A;  2H1Y A;  4Q2L A;  1YIJ S;  2DGX A;  3MOZ A;  3MFH A;  1FER A;  3A8K A;  1LW0 B;  1RAF B;  5HO4 A;  3PJX A;  4IFY B;  2F9J A;  3TA0 A;  1L3T A;  2RT3 A;  4TN2 A;  4OZL A;  2A6M A;  5B0E A;  3J7Y I;  4JI6 F;  4X66 J;  3Q23 A;  1RTJ B;  1H7X A;  2RNE A;  3DRP A;  2PFF B;  2YVS A;  4LF4 J;  2D7S A;  3VF0 B;  4JI5 F;  3RB3 A;  1RBO B;  2C2M B;  1VK3 A;  4Y0F A;  3SV3 A;  2X1B A;  5BR8 J;  4R0J A;  2BBE A;  3T5H A;  2ZD1 B;  1HBO B;  2DRB A;  4DSK A;  3TWZ A;  3RRH A;  3I96 A;  2VD3 A;  2HGN A;  3DOK A;  2HK3 A;  2HGM A;  3PW2 A;  4KHM A;  4OHW A;  1VCT A;  2IVF B;  3CDA A;  1HWI A;  4DV2 J;  2Y8W A;  1N0U A;  1S49 A;  2FZG B;  3ZNU A;  4IQM A;  3EXY A;  3CCE S;  1E6V A;  2XM3 A;  1RKI A;  2ZH6 A;  1T03 B;  3KG1 A;  3DLL Q;  4NZ0 A;  1IUJ A;  2NYH A;  1XN9 A;  1H73 A;  4LVN P;  1FJC A;  3PYD A;  1ZPV A;  1DQA A;  3MPY A;  4K4W A;  2JFK A;  4OI1 A;  1CSJ A;  2ZOM A;  1Q86 T;  1CJU B;  1ZET A;  2GFF A;  3LO3 A;  5F8N A;  1HWU A;  2QL9 B;  3R7B B;  3TJA A;  1IWG A;  2DHA A;  2ZFH A;  1U0H B;  2UUT A;  1HAR A;  2FLN A;  2AMC B;  5B0D A;  4DR2 F;  1HA1 A;  1FVS A;  3CTR A;  4FXW A;  5IS2 A;  4OYI A;  2XGQ A;  1CC7 A;  4JV5 J;  1WDD A;  1RYS A;  5E3C A;  1FDB A;  4IH7 A;  4PG4 A;  1J5E F;  4WYW A;  2PI5 A;  1GX6 A;  2X1G A;  5BYQ A;  4ECW A;  1RT7 B;  4J9O A;  3UDL A;  1FDN A;  4U7C A;  4I2Q A;  4TU7 A;  3ZZO A;  4NYP A;  2YX7 A;  2OPP B;  2WSF C;  2KYX A;  2N7C A;  2IYI A;  5IV3 A;  4K0K F;  1NXI A;  4QU6 A;  2RRA A;  3M6U A;  2VIC A;  2CIM A;  3MEK A;  2ZM6 F;  2V8V A;  2AP6 A;  1A6L A;  4URG A;  1VQM S;  4ELU A;  2XMM A;  3LGN A;  1AUS L;  1TL3 A;  5ETN A;  1TL7 A;  1LK5 A;  4C8M A;  4DR5 F;  2BA9 A;  3S1T A;  3SV4 A;  4KE5 A;  3BKF A;  2JEF A;  1S6P A;  1OO0 B;  1Q5V A;  1UET A;  1Z2L A;  4C8O A;  1UWA A;  2L9D A;  5KFK A;  2QT7 A;  2CAD A;  2XEX A;  3AB2 B;  4F50 A;  3TZW A;  3G2X A;  1Q78 A;  3WHI A;  5AJ3 J;  2HEK A;  3W2V A;  1JWW A;  1HPZ B;  3EVO A;  4C9D A;  4FYY B;  4NA2 A;  4P71 A;  4CRJ A;  3NGK A;  2YNF A;  2DGU A;  3RR7 A;  2H3E B;  3DLG B;  3HJF A;  3ITH A;  4A8O A;  1CEZ A;  2P9C A;  4UF4 A;  3THT A;  4KPY A;  2VH7 A;  3UN2 A;  5B0A A;  2NUU G;  4PWD B;  3VAH A;  2DH8 A;  2HGL A;  2DGO A;  1UKU A;  4CTA A;  2RDI A;  3TEH B;  4X4U A;  4EBE A;  1SXL A;  2AEM A;  2YQ3 A;  1BY9 A;  4LSZ B;  1Q8K A;  1C4C A;  1HIY A;  2JEI A;  2GA7 A;  3CC2 S;  1ZA1 B;  2CQ1 A;  2F3J A;  1XJW B;  1V3Z A;  4KO0 B;  5KFZ A;  3MAH A;  2DPI A;  4CYU A;  5K8M A;  3M1V B;  1CJV A;  1EP4 B;  1K0V A;  1GXL A;  4OHX A;  1YI2 S;  3NG8 A;  1H2V Z;  1VJQ A;  2BJD A;  2FIU A;  1ZPW X;  1IKV B;  4CO3 A;  5L1I A;  4LFA J;  1S1W A;  2E9Z A;  4ZN3 A;  1W7W A;  3TEG A;  4F3O A;  3HFV A;  2EFQ A;  3A8J A;  1NB2 A;  4HTJ A;  4F2R A;  3ZNJ 1;  3H8Y A;  3MR3 A;  3KLG B;  1AT1 B;  1JLC B;  3I6P A;  3CCV S;  2EPI A;  5KFY A;  1WC0 A;  3EDR B;  2CPZ A;  4W92 B;  4OZN A;  4B17 A;  2RDJ A;  5ETM A;  4JV0 A;  3SSR A;  1B0T A;  1U1R A;  1FF2 A;  1B7Y B;  4N41 A;  2W01 A;  4X4S A;  3OJU A;  2FLP A;  1YKW A;  1LW0 A;  1K47 A;  4K5R A;  4IFY A;  1GK8 A;  3DRX A;  4DSF A;  4PUO B;  5DGA A;  1JNZ B;  1JJ4 A;  2ATC B;  1RTJ A;  4CLL A;  4I6Y A;  2DTJ A;  3M2V B;  4OZ3 A;  3ET6 B;  3MD3 A;  3H5Y A;  1NKC A;  3IN5 A;  2P5V A;  2ZD1 A;  1HBO A;  3BYR A;  2DCU B;  2CQD A;  1WC3 A;  1BQX A;  1RLC L;  1IM6 A;  3TA2 A;  4JI1 F;  2F9D A;  2V2Z A;  4J9V A;  4ED7 A;  3W1Y C;  4PZV A;  1RB0 A;  3GLJ A;  3G71 S;  4KY3 A;  3Q83 A;  4JI3 J;  2L3M A;  2CZV C;  1O5J A;  3BV8 A;  4I69 A;  2F63 A;  4CLZ A;  2KRR A;  1U2F A;  3UN3 A;  3TNV A;  3HPO A;  2Z2L A;  4WTY A;  3PEH A;  4DV0 F;  3FVY A;  2UXC J;  3CC4 S;  4CIO A;  3HCX A;  4NWB A;  5HAO A;  1LWX A;  1F3F A;  1T03 A;  4WU3 A;  1N34 J;  4JB8 B;  5KFD A;  2K8G A;  2FJE B;  3QSY B;  1H72 C;  4AQY J;  2KVQ E;  1YBA A;  2B8Q A;  3GON A;  5CA5 A;  2H9Z A;  1JB0 C;  5DZ6 A;  1KFD A;  2XSJ B;  4DEZ A;  3J7A 1;  4USJ C;  2YWK A;  3M8W A;  4Y34 A;  5KT7 A; 
#chains in the Genus database with same CATH homology
 2HBZ B;  2P2C B;  2H48 B;  2CNO B;  1RHU B;  3GJQ B;  4DCO B;  2CJX B;  3D6H B;  3D6F B;  1QDU B;  1NME B;  1RHM B;  2H4Y B;  3NS7 B;  2HBR B;  3R7S B;  1RWX B;  2XYG B;  1PAU B;  4ZVT B;  3R6L B;  2CDR B;  3IBF B;  5IC4 B;  1RHR B;  1I51 B;  3EDQ B;  2FQQ B;  4ZVP B;  2C2K B;  3QNW B;  3SIP B;  2CNK B;  3KJN B;  3P45 B;  4ZVS B;  3P4U B;  2H51 B;  3KJQ B;  3R5J B;  1RWV B;  2H65 B;  3R6G B;  1F9E B;  2HBQ B;  1QTN B;  2XZD B;  1RWM B;  1RWO B;  2H5I B;  2C1E B;  1IBC B;  3GJT B;  1I3O B;  1RWN B;  4ZVO B;  4DCP B;  1SC3 B;  5K20 B;  4ZVQ B;  3EDR B;  2QL7 B;  1ICE B;  1RWP B;  2C2O B;  3GJR B;  2Y1L B;  2DKO B;  4LSZ B;  2H54 B;  4JB8 B;  1SC4 B;  4ZVU B;  2H4W B;  3RJM B;  2XYH B;  2C2Z B;  4ZVR B;  2CNN B;  1RHK B;  1GFW B;  2CJY B;  1RHJ B;  1RWK B;  2XYP B;  2XZT B;  2QLB B;  2HBY B;  5IC6 B;  3GJS B;  1RHQ B;  2Y0B B;  2QLF B;  3IBC B;  3KJF B;  1SC1 B;  3R7N B;  1PYO B;  1RWW B;  1RE1 B;  3D6M B;  1BMQ B;  2QL9 B;  3R7B B;  2H5J B;  2CNL B;  4DCJ B;  2QLJ B;  2C2M B;  2QL5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...